2OO2A

Crystal structure of protein af1782 from archaeoglobus fulgidus, pfam duf357
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
76
structure length
76
Chain Sequence
SLEEELRRETLKWLERIEERVKEIEGDEGFMRNIEAYISDSRYFLEKGDLVRAFECVVWAWAWLEIGLEVGKLHET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the hypothetical AF_1782 protein from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein AF_1782
total genus 32
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2oo2A00
4AZ7A 4AZ6A 4AZ5A 2YL8A 4AZCB 4AZCA 3RPMA 2YLLA 2YL5A 2OO2A 2YLAA 4FZOA 4AZHA 2PMRA 4AZGA 4AZIA 4FZPA 2YL9A 2JNKA 2YL6A 2OZNB 4AZBA
chains in the Genus database with same CATH superfamily
4H6HA 2EWFA 4UDXX 4E81A 4AZ7A 2F7OA 4EZPA 1O7DB 2RT6A 4HR1B 3T48A 3DX0A 1QWNA 2F18A 4EZQA 4AZCA 1E2UA 4EZYA 3QWEA 3ZEDA 2NCZA 1OA1A 1TQTA 1TQVA 2C08A 3DX2A 2YL5A 1I4TA 2ZXQA 2QXLA 3CZSA 4G6QA 4IM3A 4JL9A 5FLEX 3I04A 3SOGA 3BUPA 1E1DA 2OBMA 3D52A 3BVVA 5E84A 2Z8YA 2QKWA 3I39X 3BLBA 3KAWA 3O3NB 1I49A 4UDYX 4AKVA 3T46A 1JQKA 3L3PA 3BVXA 3CZNA 4EZZA 1LQ7A 4JWEA 4E3CA 3DX3A 2OW7A 3ERCC 1TQUA 4F01A 2ALWA 4R5KA 3RV1A 4R5IA 4M0MA 2GAFD 2X3XA 4AZ6A 4I1QA 4AZ5A 3O3OB 2KHOA 4AZCB 2ELBA 5C5BA 1MJGA 1ZYLA 2WINM 3B52X 4BNEA 4IWPA 3DPOA 4FZSA 4NPHA 4H6IA 1I4LA 1U00A 4JNEA 1WDZA 4JLCA 3CVRA 2ND1A 3ER9B 1UPXA 2F1BA 2X5CA 3D2FA 3D2EA 1E9VA 3M3WA 1R5EA 1R33A 2YLLA 3O3MB 4IWOA 4JNFA 3VEAA 1GNLA 3CAZA 3DDFA 3BUQA 3T49A 3F7WA 3I2WA 2FYVA 3D50A 3L3OM 4JWCA 4KIKA 4EZOA 1DKXA 1SU7A 2Q12A 3PLTA 3Q0KA 2OBLA 1QWUA 4JWIA 3BVWA 1TQSA 2EFLA 2YIBA 1SU8A 3DPQA 3FD9A 1GNTA 2YL9A 1I4DA 5KBPA 4R5GA 2WYIA 3EJPA 4EZWA 2OW6A 3VKHA 2OZNB 2PY6A 2RAKA 2ND0A 4AZBA 5C5BB 4DCNC 2YIAA 2RAIA 2D1LA 3QNIA 2QFFA 2LM0A 4R5LA 2GF4A 4DYLA 3DPPA 4FM3A 2YL8A 3ABHA 3D51A 1OAOA 1PS3A 4NQIA 5FIGA 2YKTA 3T4AG 3UITA 2EFKA 4NSWA 1YWMA 1TQWA 1X04A 1O7DC 1R34A 3ACOA 3EJQA 3Q84A 1GN9A 2Z0OA 4KIKB 3RPMA 3EJRA 3QE6A 3EJTA 3DX1A 2LXYA 2OO2A 3DX4A 1SUFA 3LLLA 2YI9A 1DKYA 3KAVA 4AZHA 3EJSA 2X3WA 4R5JA 3RV0A 4IM0A 3SYVA 4B9QA 1HWWA 4AZGA 2O0I1 1HXKA 4AZIA 4F00A 2F7RA 4FZPA 4HY9A 4HYBA 1Y2OA 3HAJA 4HR1A 2JNKA 4EZTA 2YL6A 4D8JA 1URUA 2JNSA 1ZWWA 2X3VA 2D4CA 3G9GA 2YIVX 2Z0VA 2N3KA 4IW0A 3QNJA 2MI7A 4EZVA 3LMFA 3OHXM 3A98A 4WPCA 4EZSA 4PO2A 3ER8C 2FICA 4H8SA 4IWQA 3DYTA 2V0OA 3EJUA 3D4ZA 1W9MA 3OWGA 4IM2A 3BUIA 2EX3B 3BUDA 3T47A 4EZXA 2WYHA 3B53X 2F1AA 3D4YA 2Z0NA 4JWDA 1HTYA 4ATMA 3BUBA 3B51X 3C7NA 3LVTA 4JN4A 3GI7A 1X03A 3HAHA 5TKYA 2RAJA 3DDGA 2YLAA 4EZRA 2F7PA 3I01A 4FZOA 4AVMA 2PMRA 1OA0A 2GA9D 1SU6A 3BVUA 4EZNA 3CKDA 1QX1A 3HAIA 3OK8A 3QA8A 4EZUA 4WPEA 3VEBA 3BVTA 3KDRA 2F7QA 1DKZA 3CV5A 2Q13A 2YI8A
chains in the Genus database with same CATH topology
4AZ7A 4AZ6A 4AZ5A 2YL8A 4AZCB 4AZCA 3RPMA 2YLLA 2YL5A 2OO2A 2YLAA 4FZOA 4AZHA 2PMRA 4AZGA 4AZIA 4FZPA 2YL9A 2JNKA 2YL6A 2OZNB 4AZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AZ7 A;  4AZ6 A;  4AZ5 A;  2YL8 A;  4AZC B;  4AZC A;  3RPM A;  2YLL A;  2YL5 A;  2OO2 A;  2YLA A;  4FZO A;  4AZH A;  2PMR A;  4AZG A;  4AZI A;  4FZP A;  2YL9 A;  2JNK A;  2YL6 A;  2OZN B;  4AZB A; 
#chains in the Genus database with same CATH topology
 4H6H A;  2EWF A;  4UDX X;  4E81 A;  4AZ7 A;  2F7O A;  4EZP A;  1O7D B;  2RT6 A;  4HR1 B;  3T48 A;  3DX0 A;  1QWN A;  2F18 A;  4EZQ A;  4AZC A;  1E2U A;  4EZY A;  3QWE A;  3ZED A;  2NCZ A;  1OA1 A;  1TQT A;  1TQV A;  2C08 A;  3DX2 A;  2YL5 A;  1I4T A;  2ZXQ A;  2QXL A;  3CZS A;  4G6Q A;  4IM3 A;  4JL9 A;  5FLE X;  3I04 A;  3SOG A;  3BUP A;  1E1D A;  2OBM A;  3D52 A;  3BVV A;  5E84 A;  2Z8Y A;  2QKW A;  3I39 X;  3BLB A;  3KAW A;  3O3N B;  1I49 A;  4UDY X;  4AKV A;  3T46 A;  1JQK A;  3L3P A;  3BVX A;  3CZN A;  4EZZ A;  1LQ7 A;  4JWE A;  4E3C A;  3DX3 A;  2OW7 A;  3ERC C;  1TQU A;  4F01 A;  2ALW A;  4R5K A;  3RV1 A;  4R5I A;  4M0M A;  2GAF D;  2X3X A;  4AZ6 A;  4I1Q A;  4AZ5 A;  3O3O B;  2KHO A;  4AZC B;  2ELB A;  5C5B A;  1MJG A;  1ZYL A;  2WIN M;  3B52 X;  4BNE A;  4IWP A;  3DPO A;  4FZS A;  4NPH A;  4H6I A;  1I4L A;  1U00 A;  4JNE A;  1WDZ A;  4JLC A;  3CVR A;  2ND1 A;  3ER9 B;  1UPX A;  2F1B A;  2X5C A;  3D2F A;  3D2E A;  1E9V A;  3M3W A;  1R5E A;  1R33 A;  2YLL A;  3O3M B;  4IWO A;  4JNF A;  3VEA A;  1GNL A;  3CAZ A;  3DDF A;  3BUQ A;  3T49 A;  3F7W A;  3I2W A;  2FYV A;  3D50 A;  3L3O M;  4JWC A;  4KIK A;  4EZO A;  1DKX A;  1SU7 A;  2Q12 A;  3PLT A;  3Q0K A;  2OBL A;  1QWU A;  4JWI A;  3BVW A;  1TQS A;  2EFL A;  2YIB A;  1SU8 A;  3DPQ A;  3FD9 A;  1GNT A;  2YL9 A;  1I4D A;  5KBP A;  4R5G A;  2WYI A;  3EJP A;  4EZW A;  2OW6 A;  3VKH A;  2OZN B;  2PY6 A;  2RAK A;  2ND0 A;  4AZB A;  5C5B B;  4DCN C;  2YIA A;  2RAI A;  2D1L A;  3QNI A;  2QFF A;  2LM0 A;  4R5L A;  2GF4 A;  4DYL A;  3DPP A;  4FM3 A;  2YL8 A;  3ABH A;  3D51 A;  1OAO A;  1PS3 A;  4NQI A;  5FIG A;  2YKT A;  3T4A G;  3UIT A;  2EFK A;  4NSW A;  1YWM A;  1TQW A;  1X04 A;  1O7D C;  1R34 A;  3ACO A;  3EJQ A;  3Q84 A;  1GN9 A;  2Z0O A;  4KIK B;  3RPM A;  3EJR A;  3QE6 A;  3EJT A;  3DX1 A;  2LXY A;  2OO2 A;  3DX4 A;  1SUF A;  3LLL A;  2YI9 A;  1DKY A;  3KAV A;  4AZH A;  3EJS A;  2X3W A;  4R5J A;  3RV0 A;  4IM0 A;  3SYV A;  4B9Q A;  1HWW A;  4AZG A;  2O0I 1;  1HXK A;  4AZI A;  4F00 A;  2F7R A;  4FZP A;  4HY9 A;  4HYB A;  1Y2O A;  3HAJ A;  4HR1 A;  2JNK A;  4EZT A;  2YL6 A;  4D8J A;  1URU A;  2JNS A;  1ZWW A;  2X3V A;  2D4C A;  3G9G A;  2YIV X;  2Z0V A;  2N3K A;  4IW0 A;  3QNJ A;  2MI7 A;  4EZV A;  3LMF A;  3OHX M;  3A98 A;  4WPC A;  4EZS A;  4PO2 A;  3ER8 C;  2FIC A;  4H8S A;  4IWQ A;  3DYT A;  2V0O A;  3EJU A;  3D4Z A;  1W9M A;  3OWG A;  4IM2 A;  3BUI A;  2EX3 B;  3BUD A;  3T47 A;  4EZX A;  2WYH A;  3B53 X;  2F1A A;  3D4Y A;  2Z0N A;  4JWD A;  1HTY A;  4ATM A;  3BUB A;  3B51 X;  3C7N A;  3LVT A;  4JN4 A;  3GI7 A;  1X03 A;  3HAH A;  5TKY A;  2RAJ A;  3DDG A;  2YLA A;  4EZR A;  2F7P A;  3I01 A;  4FZO A;  4AVM A;  2PMR A;  1OA0 A;  2GA9 D;  1SU6 A;  3BVU A;  4EZN A;  3CKD A;  1QX1 A;  3HAI A;  3OK8 A;  3QA8 A;  4EZU A;  4WPE A;  3VEB A;  3BVT A;  3KDR A;  2F7Q A;  1DKZ A;  3CV5 A;  2Q13 A;  2YI8 A; 
#chains in the Genus database with same CATH homology
 4AZ7 A;  4AZ6 A;  4AZ5 A;  2YL8 A;  4AZC B;  4AZC A;  3RPM A;  2YLL A;  2YL5 A;  2OO2 A;  2YLA A;  4FZO A;  4AZH A;  2PMR A;  4AZG A;  4AZI A;  4FZP A;  2YL9 A;  2JNK A;  2YL6 A;  2OZN B;  4AZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...