2OO2A

Crystal structure of protein af1782 from archaeoglobus fulgidus, pfam duf357
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
76
structure length
76
Chain Sequence
SLEEELRRETLKWLERIEERVKEIEGDEGFMRNIEAYISDSRYFLEKGDLVRAFECVVWAWAWLEIGLEVGKLHET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF_1782
publication title Crystal structure of the hypothetical AF_1782 protein from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 32
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2oo2A00
2JNKA 4FZPA 4AZ7A 4AZHA 4AZGA 4FZOA 2OZNB 2OO2A 2PMRA 4AZBA 2YL9A 4AZIA 2YLAA 2YL5A 2YLLA 4AZ5A 2YL6A 4AZCA 4AZ6A 2YL8A 3RPMA 4AZCB
chains in the Genus database with same CATH superfamily
1YWMA 3ZEDA 5E84A 3D4YA 4AZ7A 4JNFA 3DPOA 3BUIA 3OWGA 2D1LA 4EZTA 1R5EA 4IM2A 2WINM 2YL8A 3EJTA 4R5KA 4JL9A 3Q0KA 4JWEA 2OW7A 3HAHA 1QWUA 4IW0A 3D4ZA 3CVRA 3EJQA 3SOGA 3ER9B 2Q13A 4M0MA 4EZZA 2X3VA 2ZXQA 2NCZA 3LVTA 4EZPA 4F00A 2LXYA 1QWNA 1PS3A 2X5CA 3HAIA 3T46A 5KBPA 3GI7A 3M3WA 4H6IA 1Y2OA 3BUQA 4H6HA 2O0I1 4HR1A 3A98A 3T48A 3KAVA 2OW6A 3CV5A 2PMRA 2EFKA 3I39X 2ELBA 4AZ5A 2YL6A 1MJGA 3ABHA 4R5LA 3DX0A 3T4AG 2RT6A 3D52A 3HAJA 4EZYA 3BUPA 3QNIA 2F18A 3D50A 4IM3A 4AZIA 2D4CA 1X04A 2PY6A 1TQSA 2KHOA 4ATMA 2F7PA 3DDGA 1W9MA 1SUFA 3I2WA 3DX3A 3RPMA 3ERCC 3QWEA 3EJUA 4BNEA 3DPQA 4IWPA 4DCNC 1QX1A 4JLCA 1OA1A 3QA8A 1R33A 3KAWA 2X3XA 3LLLA 4H8SA 2YIAA 3KDRA 4AZCB 3DX1A 2FICA 4KIKB 4HYBA 2QFFA 1O7DB 2YIVX 3O3MB 3PLTA 2GF4A 1SU8A 3BVXA 4G6QA 3VKHA 3BVWA 3L3PA 2RAJA 3OHXM 3D51A 1E2UA 4EZVA 2RAIA 4AZHA 4IM0A 2YL9A 3EJRA 1LQ7A 3ACOA 1E9VA 4WPCA 4AKVA 3C7NA 1O7DC 1OAOA 1URUA 3B51X 4IWQA 4FZSA 3DX4A 3SYVA 1I49A 2WYHA 2ND0A 4JNEA 1X03A 2Z0OA 4AVMA 4EZRA 2YI8A 1GNLA 2Z8YA 3DX2A 3CZNA 3RV0A 3L3OM 4PO2A 3CKDA 1U00A 1TQWA 2F7QA 2Z0NA 4FM3A 2EWFA 4AZGA 4FZOA 4E81A 5C5BB 2OO2A 3B53X 4EZOA 2WYIA 3UITA 4EZSA 2YLAA 2JNSA 1R34A 1I4LA 4AZCA 4AZ6A 3B52X 3EJPA 4HR1B 2V0OA 2YIBA 4KIKA 3I01A 1E1DA 4F01A 4JWCA 5FLEX 4B9QA 2MI7A 4AZBA 2F1AA 2FYVA 1JQKA 5FIGA 4EZNA 4UDXX 3QE6A 3DYTA 4FZPA 2N3KA 4WPEA 1DKXA 4HY9A 4EZQA 1SU7A 1TQUA 2QXLA 3VEBA 1I4DA 2EFLA 4NQIA 3BUBA 1UPXA 3LMFA 3ER8C 4IWOA 3O3NB 4DYLA 1ZYLA 3DPPA 2OBMA 3T49A 3I04A 1TQVA 3OK8A 3D2FA 2LM0A 1I4TA 3BUDA 1HXKA 3CZSA 4EZXA 3VEAA 3BVUA 1ZWWA 2YKTA 3T47A 1GN9A 5TKYA 1GNTA 2QKWA 1DKYA 3DDFA 5C5BA 4JN4A 2Z0VA 2ND1A 2OZNB 2C08A 2Q12A 4D8JA 4R5JA 2GA9D 2YL5A 2YLLA 1TQTA 4E3CA 2F7RA 3QNJA 2RAKA 2JNKA 3RV1A 4R5GA 2EX3B 2ALWA 3BVVA 3CAZA 1OA0A 2F1BA 3EJSA 4JWDA 2GAFD 4UDYX 2YI9A 3D2EA 4R5IA 1HTYA 3BVTA 3FD9A 2F7OA 2OBLA 3O3OB 4I1QA 3BLBA 1DKZA 1HWWA 4NSWA 4JWIA 4NPHA 3Q84A 3G9GA 3F7WA 1SU6A 4EZWA 1WDZA 4EZUA 2X3WA
chains in the Genus database with same CATH topology
2JNKA 4FZPA 4AZ7A 4AZHA 4AZGA 4FZOA 2OZNB 2OO2A 2PMRA 4AZBA 2YL9A 4AZIA 2YLAA 2YL5A 2YLLA 4AZ5A 2YL6A 4AZCA 4AZ6A 2YL8A 3RPMA 4AZCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JNK A;  4FZP A;  4AZ7 A;  4AZH A;  4AZG A;  4FZO A;  2OZN B;  2OO2 A;  2PMR A;  4AZB A;  2YL9 A;  4AZI A;  2YLA A;  2YL5 A;  2YLL A;  4AZ5 A;  2YL6 A;  4AZC A;  4AZ6 A;  2YL8 A;  3RPM A;  4AZC B; 
#chains in the Genus database with same CATH topology
 1YWM A;  3ZED A;  5E84 A;  3D4Y A;  4AZ7 A;  4JNF A;  3DPO A;  3BUI A;  3OWG A;  2D1L A;  4EZT A;  1R5E A;  4IM2 A;  2WIN M;  2YL8 A;  3EJT A;  4R5K A;  4JL9 A;  3Q0K A;  4JWE A;  2OW7 A;  3HAH A;  1QWU A;  4IW0 A;  3D4Z A;  3CVR A;  3EJQ A;  3SOG A;  3ER9 B;  2Q13 A;  4M0M A;  4EZZ A;  2X3V A;  2ZXQ A;  2NCZ A;  3LVT A;  4EZP A;  4F00 A;  2LXY A;  1QWN A;  1PS3 A;  2X5C A;  3HAI A;  3T46 A;  5KBP A;  3GI7 A;  3M3W A;  4H6I A;  1Y2O A;  3BUQ A;  4H6H A;  2O0I 1;  4HR1 A;  3A98 A;  3T48 A;  3KAV A;  2OW6 A;  3CV5 A;  2PMR A;  2EFK A;  3I39 X;  2ELB A;  4AZ5 A;  2YL6 A;  1MJG A;  3ABH A;  4R5L A;  3DX0 A;  3T4A G;  2RT6 A;  3D52 A;  3HAJ A;  4EZY A;  3BUP A;  3QNI A;  2F18 A;  3D50 A;  4IM3 A;  4AZI A;  2D4C A;  1X04 A;  2PY6 A;  1TQS A;  2KHO A;  4ATM A;  2F7P A;  3DDG A;  1W9M A;  1SUF A;  3I2W A;  3DX3 A;  3RPM A;  3ERC C;  3QWE A;  3EJU A;  4BNE A;  3DPQ A;  4IWP A;  4DCN C;  1QX1 A;  4JLC A;  1OA1 A;  3QA8 A;  1R33 A;  3KAW A;  2X3X A;  3LLL A;  4H8S A;  2YIA A;  3KDR A;  4AZC B;  3DX1 A;  2FIC A;  4KIK B;  4HYB A;  2QFF A;  1O7D B;  2YIV X;  3O3M B;  3PLT A;  2GF4 A;  1SU8 A;  3BVX A;  4G6Q A;  3VKH A;  3BVW A;  3L3P A;  2RAJ A;  3OHX M;  3D51 A;  1E2U A;  4EZV A;  2RAI A;  4AZH A;  4IM0 A;  2YL9 A;  3EJR A;  1LQ7 A;  3ACO A;  1E9V A;  4WPC A;  4AKV A;  3C7N A;  1O7D C;  1OAO A;  1URU A;  3B51 X;  4IWQ A;  4FZS A;  3DX4 A;  3SYV A;  1I49 A;  2WYH A;  2ND0 A;  4JNE A;  1X03 A;  2Z0O A;  4AVM A;  4EZR A;  2YI8 A;  1GNL A;  2Z8Y A;  3DX2 A;  3CZN A;  3RV0 A;  3L3O M;  4PO2 A;  3CKD A;  1U00 A;  1TQW A;  2F7Q A;  2Z0N A;  4FM3 A;  2EWF A;  4AZG A;  4FZO A;  4E81 A;  5C5B B;  2OO2 A;  3B53 X;  4EZO A;  2WYI A;  3UIT A;  4EZS A;  2YLA A;  2JNS A;  1R34 A;  1I4L A;  4AZC A;  4AZ6 A;  3B52 X;  3EJP A;  4HR1 B;  2V0O A;  2YIB A;  4KIK A;  3I01 A;  1E1D A;  4F01 A;  4JWC A;  5FLE X;  4B9Q A;  2MI7 A;  4AZB A;  2F1A A;  2FYV A;  1JQK A;  5FIG A;  4EZN A;  4UDX X;  3QE6 A;  3DYT A;  4FZP A;  2N3K A;  4WPE A;  1DKX A;  4HY9 A;  4EZQ A;  1SU7 A;  1TQU A;  2QXL A;  3VEB A;  1I4D A;  2EFL A;  4NQI A;  3BUB A;  1UPX A;  3LMF A;  3ER8 C;  4IWO A;  3O3N B;  4DYL A;  1ZYL A;  3DPP A;  2OBM A;  3T49 A;  3I04 A;  1TQV A;  3OK8 A;  3D2F A;  2LM0 A;  1I4T A;  3BUD A;  1HXK A;  3CZS A;  4EZX A;  3VEA A;  3BVU A;  1ZWW A;  2YKT A;  3T47 A;  1GN9 A;  5TKY A;  1GNT A;  2QKW A;  1DKY A;  3DDF A;  5C5B A;  4JN4 A;  2Z0V A;  2ND1 A;  2OZN B;  2C08 A;  2Q12 A;  4D8J A;  4R5J A;  2GA9 D;  2YL5 A;  2YLL A;  1TQT A;  4E3C A;  2F7R A;  3QNJ A;  2RAK A;  2JNK A;  3RV1 A;  4R5G A;  2EX3 B;  2ALW A;  3BVV A;  3CAZ A;  1OA0 A;  2F1B A;  3EJS A;  4JWD A;  2GAF D;  4UDY X;  2YI9 A;  3D2E A;  4R5I A;  1HTY A;  3BVT A;  3FD9 A;  2F7O A;  2OBL A;  3O3O B;  4I1Q A;  3BLB A;  1DKZ A;  1HWW A;  4NSW A;  4JWI A;  4NPH A;  3Q84 A;  3G9G A;  3F7W A;  1SU6 A;  4EZW A;  1WDZ A;  4EZU A;  2X3W A; 
#chains in the Genus database with same CATH homology
 2JNK A;  4FZP A;  4AZ7 A;  4AZH A;  4AZG A;  4FZO A;  2OZN B;  2OO2 A;  2PMR A;  4AZB A;  2YL9 A;  4AZI A;  2YLA A;  2YL5 A;  2YLL A;  4AZ5 A;  2YL6 A;  4AZC A;  4AZ6 A;  2YL8 A;  3RPM A;  4AZC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...