2OO2A

Crystal structure of protein af1782 from archaeoglobus fulgidus, pfam duf357
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
76
structure length
76
Chain Sequence
SLEEELRRETLKWLERIEERVKEIEGDEGFMRNIEAYISDSRYFLEKGDLVRAFECVVWAWAWLEIGLEVGKLHET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF_1782
publication title Crystal structure of the hypothetical AF_1782 protein from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Structural genomics, unknown function
total genus 32
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2oo2A00
4AZBA 4AZIA 2YL8A 4AZ7A 4AZGA 2PMRA 4AZ5A 4AZ6A 4AZHA 2JNKA 2YL9A 4AZCA 4AZCB 2YL6A 2YL5A 2OZNB 2YLAA 2YLLA 3RPMA 2OO2A 4FZPA 4FZOA
chains in the Genus database with same CATH superfamily
4AZIA 4B9QA 3D4YA 2ZXQA 1DKZA 4AZGA 4AZHA 3L3OM 2Q12A 4R5KA 2ND0A 1GNTA 5TKYA 1I4LA 1QWNA 4KIKB 3M3WA 4JNFA 4BNEA 2EWFA 3KAWA 1R34A 2EX3B 1TQVA 3L3PA 4EZSA 1TQSA 2PMRA 3CZSA 4JNEA 4E3CA 4NPHA 2YKTA 4AZCA 4F01A 3ERCC 2JNSA 3BUQA 3F7WA 4E81A 4JL9A 2Z0NA 1MJGA 1TQUA 4R5GA 3DX1A 3C7NA 3O3MB 4FZSA 3QNJA 1W9MA 3EJTA 1QWUA 4EZPA 2YLAA 4EZUA 2YLLA 3KDRA 3B53X 2RAKA 2X3VA 1UPXA 2GAFD 3LLLA 3Q0KA 2ELBA 3FD9A 4JWEA 4EZZA 2C08A 4IM2A 4KIKA 3OHXM 2YL8A 2OBLA 4I1QA 2LM0A 1YWMA 1JQKA 4DCNC 3D2EA 4EZWA 3DPPA 3OK8A 3DDFA 3B52X 2YL9A 4M0MA 3ZEDA 3CKDA 2FYVA 3I2WA 3G9GA 3HAIA 4FZPA 2OW6A 1R5EA 2X5CA 4JWCA 1DKXA 4IM0A 1GNLA 2EFKA 3QE6A 2F1BA 4AZ6A 4R5JA 2YI9A 3SYVA 3O3OB 2WYHA 4EZRA 2RT6A 4AKVA 1GN9A 2F7PA 4ATMA 4AZBA 2F7QA 3HAJA 2GF4A 4EZNA 2YIVX 2Z0VA 3DX3A 1DKYA 3CV5A 3RV0A 3QA8A 3BVXA 3D51A 4FZOA 2Z0OA 3LVTA 3ACOA 3D2FA 3VEAA 1X04A 2ALWA 2O0I1 3T49A 4R5IA 3Q84A 1URUA 4UDXX 1WDZA 2YIBA 3EJQA 1O7DB 3DPQA 2X3WA 1TQWA 2LXYA 3BUIA 3GI7A 4H6HA 1HXKA 1SUFA 2ND1A 1SU8A 3SOGA 3ER8C 2NCZA 4AZ5A 2WYIA 4HR1B 4HY9A 4EZQA 2F18A 2Q13A 2F7OA 3BUBA 3DDGA 2GA9D 3BUDA 3I04A 4HYBA 3ER9B 2N3KA 3UITA 2QKWA 1E9VA 2WINM 4EZTA 4AZ7A 2FICA 3I01A 3D50A 3B51X 3DX4A 1ZYLA 1OA0A 3D52A 3BVVA 2RAJA 4WPEA 3EJRA 4JWDA 2D1LA 4G6QA 4EZOA 3T48A 4IWOA 1I49A 1E1DA 1U00A 2RAIA 2KHOA 3PLTA 3EJUA 4F00A 4EZVA 4NQIA 3EJSA 4WPCA 3BLBA 3D4ZA 2OW7A 2QFFA 4H8SA 1OAOA 1I4TA 4JN4A 5C5BA 4HR1A 5FIGA 3BVWA 4IWPA 4PO2A 1SU6A 3LMFA 3BVTA 4AVMA 1QX1A 1LQ7A 1SU7A 3CAZA 2JNKA 1Y2OA 3BVUA 4FM3A 2YL6A 2YL5A 2OBMA 3KAVA 4R5LA 1ZWWA 2F7RA 2OZNB 1HWWA 2V0OA 1HTYA 3A98A 1R33A 3ABHA 3DX2A 4JWIA 4IM3A 2MI7A 3VKHA 3RV1A 2Z8YA 1O7DC 3CZNA 2PY6A 3OWGA 4IWQA 5C5BB 3HAHA 3I39X 3T4AG 2YI8A 1I4DA 1TQTA 3DPOA 3EJPA 3BUPA 3T46A 1X03A 3CVRA 2YIAA 4DYLA 1OA1A 3T47A 4D8JA 4AZCB 4H6IA 5KBPA 4JLCA 4NSWA 2D4CA 3DYTA 2F1AA 2OO2A 4IW0A 2EFLA 3VEBA 4UDYX 3QNIA 2QXLA 5E84A 1PS3A 4EZYA 3O3NB 2X3XA 1E2UA 3QWEA 3DX0A 3RPMA 5FLEX 4EZXA
chains in the Genus database with same CATH topology
4AZBA 4AZIA 2YL8A 4AZ7A 4AZGA 2PMRA 4AZ5A 4AZ6A 4AZHA 2JNKA 2YL9A 4AZCA 4AZCB 2YL6A 2YL5A 2OZNB 2YLAA 2YLLA 3RPMA 2OO2A 4FZPA 4FZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AZB A;  4AZI A;  2YL8 A;  4AZ7 A;  4AZG A;  2PMR A;  4AZ5 A;  4AZ6 A;  4AZH A;  2JNK A;  2YL9 A;  4AZC A;  4AZC B;  2YL6 A;  2YL5 A;  2OZN B;  2YLA A;  2YLL A;  3RPM A;  2OO2 A;  4FZP A;  4FZO A; 
#chains in the Genus database with same CATH topology
 4AZI A;  4B9Q A;  3D4Y A;  2ZXQ A;  1DKZ A;  4AZG A;  4AZH A;  3L3O M;  2Q12 A;  4R5K A;  2ND0 A;  1GNT A;  5TKY A;  1I4L A;  1QWN A;  4KIK B;  3M3W A;  4JNF A;  4BNE A;  2EWF A;  3KAW A;  1R34 A;  2EX3 B;  1TQV A;  3L3P A;  4EZS A;  1TQS A;  2PMR A;  3CZS A;  4JNE A;  4E3C A;  4NPH A;  2YKT A;  4AZC A;  4F01 A;  3ERC C;  2JNS A;  3BUQ A;  3F7W A;  4E81 A;  4JL9 A;  2Z0N A;  1MJG A;  1TQU A;  4R5G A;  3DX1 A;  3C7N A;  3O3M B;  4FZS A;  3QNJ A;  1W9M A;  3EJT A;  1QWU A;  4EZP A;  2YLA A;  4EZU A;  2YLL A;  3KDR A;  3B53 X;  2RAK A;  2X3V A;  1UPX A;  2GAF D;  3LLL A;  3Q0K A;  2ELB A;  3FD9 A;  4JWE A;  4EZZ A;  2C08 A;  4IM2 A;  4KIK A;  3OHX M;  2YL8 A;  2OBL A;  4I1Q A;  2LM0 A;  1YWM A;  1JQK A;  4DCN C;  3D2E A;  4EZW A;  3DPP A;  3OK8 A;  3DDF A;  3B52 X;  2YL9 A;  4M0M A;  3ZED A;  3CKD A;  2FYV A;  3I2W A;  3G9G A;  3HAI A;  4FZP A;  2OW6 A;  1R5E A;  2X5C A;  4JWC A;  1DKX A;  4IM0 A;  1GNL A;  2EFK A;  3QE6 A;  2F1B A;  4AZ6 A;  4R5J A;  2YI9 A;  3SYV A;  3O3O B;  2WYH A;  4EZR A;  2RT6 A;  4AKV A;  1GN9 A;  2F7P A;  4ATM A;  4AZB A;  2F7Q A;  3HAJ A;  2GF4 A;  4EZN A;  2YIV X;  2Z0V A;  3DX3 A;  1DKY A;  3CV5 A;  3RV0 A;  3QA8 A;  3BVX A;  3D51 A;  4FZO A;  2Z0O A;  3LVT A;  3ACO A;  3D2F A;  3VEA A;  1X04 A;  2ALW A;  2O0I 1;  3T49 A;  4R5I A;  3Q84 A;  1URU A;  4UDX X;  1WDZ A;  2YIB A;  3EJQ A;  1O7D B;  3DPQ A;  2X3W A;  1TQW A;  2LXY A;  3BUI A;  3GI7 A;  4H6H A;  1HXK A;  1SUF A;  2ND1 A;  1SU8 A;  3SOG A;  3ER8 C;  2NCZ A;  4AZ5 A;  2WYI A;  4HR1 B;  4HY9 A;  4EZQ A;  2F18 A;  2Q13 A;  2F7O A;  3BUB A;  3DDG A;  2GA9 D;  3BUD A;  3I04 A;  4HYB A;  3ER9 B;  2N3K A;  3UIT A;  2QKW A;  1E9V A;  2WIN M;  4EZT A;  4AZ7 A;  2FIC A;  3I01 A;  3D50 A;  3B51 X;  3DX4 A;  1ZYL A;  1OA0 A;  3D52 A;  3BVV A;  2RAJ A;  4WPE A;  3EJR A;  4JWD A;  2D1L A;  4G6Q A;  4EZO A;  3T48 A;  4IWO A;  1I49 A;  1E1D A;  1U00 A;  2RAI A;  2KHO A;  3PLT A;  3EJU A;  4F00 A;  4EZV A;  4NQI A;  3EJS A;  4WPC A;  3BLB A;  3D4Z A;  2OW7 A;  2QFF A;  4H8S A;  1OAO A;  1I4T A;  4JN4 A;  5C5B A;  4HR1 A;  5FIG A;  3BVW A;  4IWP A;  4PO2 A;  1SU6 A;  3LMF A;  3BVT A;  4AVM A;  1QX1 A;  1LQ7 A;  1SU7 A;  3CAZ A;  2JNK A;  1Y2O A;  3BVU A;  4FM3 A;  2YL6 A;  2YL5 A;  2OBM A;  3KAV A;  4R5L A;  1ZWW A;  2F7R A;  2OZN B;  1HWW A;  2V0O A;  1HTY A;  3A98 A;  1R33 A;  3ABH A;  3DX2 A;  4JWI A;  4IM3 A;  2MI7 A;  3VKH A;  3RV1 A;  2Z8Y A;  1O7D C;  3CZN A;  2PY6 A;  3OWG A;  4IWQ A;  5C5B B;  3HAH A;  3I39 X;  3T4A G;  2YI8 A;  1I4D A;  1TQT A;  3DPO A;  3EJP A;  3BUP A;  3T46 A;  1X03 A;  3CVR A;  2YIA A;  4DYL A;  1OA1 A;  3T47 A;  4D8J A;  4AZC B;  4H6I A;  5KBP A;  4JLC A;  4NSW A;  2D4C A;  3DYT A;  2F1A A;  2OO2 A;  4IW0 A;  2EFL A;  3VEB A;  4UDY X;  3QNI A;  2QXL A;  5E84 A;  1PS3 A;  4EZY A;  3O3N B;  2X3X A;  1E2U A;  3QWE A;  3DX0 A;  3RPM A;  5FLE X;  4EZX A; 
#chains in the Genus database with same CATH homology
 4AZB A;  4AZI A;  2YL8 A;  4AZ7 A;  4AZG A;  2PMR A;  4AZ5 A;  4AZ6 A;  4AZH A;  2JNK A;  2YL9 A;  4AZC A;  4AZC B;  2YL6 A;  2YL5 A;  2OZN B;  2YLA A;  2YLL A;  3RPM A;  2OO2 A;  4FZP A;  4FZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...