2OO2A

Crystal structure of protein af1782 from archaeoglobus fulgidus, pfam duf357
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
76
structure length
76
Chain Sequence
b'SLEEELRRETLKWLERIEERVKEIEGDEGFMRNIEAYISDSRYFLEKGDLVRAFECVVWAWAWLEIGLEVGKLHET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AF_1782
molecule tags Structural genomics, unknown function
source organism Archaeoglobus fulgidus dsm 4304
publication title Crystal structure of the hypothetical AF_1782 protein from Archaeoglobus fulgidus
rcsb
total genus 32
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2007-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04010 DUF357 Protein of unknown function (DUF357)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2oo2A00
4AZCA 2YLAA 2YL9A 4FZPA 4AZ5A 2YLLA 2JNKA 2YL6A 4AZIA 4AZBA 4FZOA 4AZ7A 3RPMA 2YL5A 2YL8A 4AZHA 4AZCB 2OO2A 4AZ6A 2OZNB 2PMRA 4AZGA
chains in the Genus database with same CATH superfamily
2OW6A 3BVVA 4FM3A 1U00A 2OBMA 4JL9A 2X3VA 1X04A 4NPHA 3CKDA 2WYIA 3CZNA 4JN4A 1OA0A 2YIVX 3O3OB 3FD9A 4IM2A 3B51X 2X5CA 3EJQA 1O7DC 3QE6A 4NQIA 3ZEDA 3QNIA 3RV1A 4AZCA 4AZ5A 4EZYA 3HAJA 4I1QA 4WPCA 2F7RA 3EJSA 2Z0VA 4H6HA 4F00A 4JLCA 4BNEA 3DX1A 4HR1B 4FZSA 4AZ7A 2YKTA 3RPMA 2ND0A 4E81A 2EX3B 1WDZA 4H8SA 3D4ZA 3ACOA 4AZCB 3D50A 3EJPA 4R5LA 4B9QA 3ABHA 3O3MB 5C5BA 1HWWA 4EZUA 1TQTA 4AZ6A 3DX3A 2OZNB 2Z8YA 4WPEA 3BVWA 3ERCC 3DX2A 1HXKA 2YI9A 1GNTA 3QNJA 4JWDA 4IM3A 3Q84A 1TQWA 3QA8A 3T48A 1R33A 3OWGA 3BVTA 4AVMA 3ER9B 3DDFA 1E9VA 4R5KA 3HAIA 1SU6A 4R5IA 5KBPA 3BUQA 2WINM 3DX0A 2YLLA 3A98A 4JNFA 2Q13A 1TQVA 2OW7A 3LVTA 2F1AA 2YL6A 3RV0A 5FLEX 4EZPA 3L3PA 4JWEA 3CV5A 4HYBA 4UDXX 4EZVA 2X3XA 3D51A 4PO2A 1I4TA 1OA1A 2LXYA 3HAHA 3OHXM 3QWEA 4HR1A 4EZXA 2YL8A 1SUFA 3I04A 4G6QA 1GN9A 3KAWA 3BUIA 3I39X 3I01A 3SOGA 5E84A 4EZOA 1ZWWA 3VEAA 1DKXA 3EJTA 4HY9A 2ND1A 5C5BB 4IWOA 3DYTA 1URUA 2ELBA 4JNEA 4AZGA 2FICA 3KAVA 4JWIA 3M3WA 4AKVA 4D8JA 3D52A 5TKYA 2PY6A 2V0OA 3T47A 2YL9A 1W9MA 3BVUA 2D1LA 3T46A 2RAJA 3PLTA 1Y2OA 3CVRA 4FZPA 2ZXQA 4IWQA 2ALWA 1I4DA 2JNKA 3LLLA 4IW0A 1TQUA 2YIBA 3O3NB 4IM0A 2LM0A 2MI7A 4F01A 2F1BA 4EZTA 3GI7A 3VKHA 2KHOA 3UITA 3BUPA 4AZBA 2Q12A 3VEBA 3G9GA 4JWCA 1OAOA 1SU8A 2N3KA 3CZSA 2X3WA 2C08A 2EFLA 1HTYA 1R5EA 2O0I1 2EWFA 2QXLA 2YL5A 3DX4A 2EFKA 3LMFA 3I2WA 1QWUA 4IWPA 1UPXA 2YI8A 4ATMA 4AZHA 3D2FA 4H6IA 3DPOA 3B52X 3D2EA 1QX1A 2F7OA 1I49A 4R5JA 3SYVA 1YWMA 3KDRA 4DCNC 3ER8C 2PMRA 2Z0NA 1SU7A 1ZYLA 3DPPA 4EZWA 1JQKA 2YLAA 2Z0OA 1R34A 3EJRA 3L3OM 4M0MA 5FIGA 2F18A 2NCZA 3EJUA 4EZQA 2JNSA 3C7NA 4KIKA 3BVXA 4NSWA 3CAZA 3BLBA 3F7WA 1E1DA 1MJGA 3Q0KA 4EZZA 1GNLA 3OK8A 1PS3A 2D4CA 3T4AG 3DDGA 4AZIA 1O7DB 2RAIA 2GA9D 4FZOA 4E3CA 4KIKB 2QFFA 2QKWA 2RT6A 4R5GA 2GAFD 2F7PA 3DPQA 2WYHA 3BUBA 1DKZA 4UDYX 2YIAA 1LQ7A 3T49A 1QWNA 3B53X 2OBLA 3D4YA 1E2UA 4EZSA 1TQSA 2OO2A 2GF4A 1DKYA 1I4LA 4EZNA 4EZRA 2FYVA 2RAKA 2F7QA 4DYLA 3BUDA 1X03A
chains in the Genus database with same CATH topology
4AZCA 2YLAA 2YL9A 4FZPA 4AZ5A 2YLLA 2JNKA 2YL6A 4AZIA 4AZBA 4FZOA 4AZ7A 3RPMA 2YL5A 2YL8A 4AZHA 4AZCB 2OO2A 4AZ6A 2OZNB 2PMRA 4AZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AZC A;  2YLA A;  2YL9 A;  4FZP A;  4AZ5 A;  2YLL A;  2JNK A;  2YL6 A;  4AZI A;  4AZB A;  4FZO A;  4AZ7 A;  3RPM A;  2YL5 A;  2YL8 A;  4AZH A;  4AZC B;  2OO2 A;  4AZ6 A;  2OZN B;  2PMR A;  4AZG A; 
#chains in the Genus database with same CATH topology
 2OW6 A;  3BVV A;  4FM3 A;  1U00 A;  2OBM A;  4JL9 A;  2X3V A;  1X04 A;  4NPH A;  3CKD A;  2WYI A;  3CZN A;  4JN4 A;  1OA0 A;  2YIV X;  3O3O B;  3FD9 A;  4IM2 A;  3B51 X;  2X5C A;  3EJQ A;  1O7D C;  3QE6 A;  4NQI A;  3ZED A;  3QNI A;  3RV1 A;  4AZC A;  4AZ5 A;  4EZY A;  3HAJ A;  4I1Q A;  4WPC A;  2F7R A;  3EJS A;  2Z0V A;  4H6H A;  4F00 A;  4JLC A;  4BNE A;  3DX1 A;  4HR1 B;  4FZS A;  4AZ7 A;  2YKT A;  3RPM A;  2ND0 A;  4E81 A;  2EX3 B;  1WDZ A;  4H8S A;  3D4Z A;  3ACO A;  4AZC B;  3D50 A;  3EJP A;  4R5L A;  4B9Q A;  3ABH A;  3O3M B;  5C5B A;  1HWW A;  4EZU A;  1TQT A;  4AZ6 A;  3DX3 A;  2OZN B;  2Z8Y A;  4WPE A;  3BVW A;  3ERC C;  3DX2 A;  1HXK A;  2YI9 A;  1GNT A;  3QNJ A;  4JWD A;  4IM3 A;  3Q84 A;  1TQW A;  3QA8 A;  3T48 A;  1R33 A;  3OWG A;  3BVT A;  4AVM A;  3ER9 B;  3DDF A;  1E9V A;  4R5K A;  3HAI A;  1SU6 A;  4R5I A;  5KBP A;  3BUQ A;  2WIN M;  3DX0 A;  2YLL A;  3A98 A;  4JNF A;  2Q13 A;  1TQV A;  2OW7 A;  3LVT A;  2F1A A;  2YL6 A;  3RV0 A;  5FLE X;  4EZP A;  3L3P A;  4JWE A;  3CV5 A;  4HYB A;  4UDX X;  4EZV A;  2X3X A;  3D51 A;  4PO2 A;  1I4T A;  1OA1 A;  2LXY A;  3HAH A;  3OHX M;  3QWE A;  4HR1 A;  4EZX A;  2YL8 A;  1SUF A;  3I04 A;  4G6Q A;  1GN9 A;  3KAW A;  3BUI A;  3I39 X;  3I01 A;  3SOG A;  5E84 A;  4EZO A;  1ZWW A;  3VEA A;  1DKX A;  3EJT A;  4HY9 A;  2ND1 A;  5C5B B;  4IWO A;  3DYT A;  1URU A;  2ELB A;  4JNE A;  4AZG A;  2FIC A;  3KAV A;  4JWI A;  3M3W A;  4AKV A;  4D8J A;  3D52 A;  5TKY A;  2PY6 A;  2V0O A;  3T47 A;  2YL9 A;  1W9M A;  3BVU A;  2D1L A;  3T46 A;  2RAJ A;  3PLT A;  1Y2O A;  3CVR A;  4FZP A;  2ZXQ A;  4IWQ A;  2ALW A;  1I4D A;  2JNK A;  3LLL A;  4IW0 A;  1TQU A;  2YIB A;  3O3N B;  4IM0 A;  2LM0 A;  2MI7 A;  4F01 A;  2F1B A;  4EZT A;  3GI7 A;  3VKH A;  2KHO A;  3UIT A;  3BUP A;  4AZB A;  2Q12 A;  3VEB A;  3G9G A;  4JWC A;  1OAO A;  1SU8 A;  2N3K A;  3CZS A;  2X3W A;  2C08 A;  2EFL A;  1HTY A;  1R5E A;  2O0I 1;  2EWF A;  2QXL A;  2YL5 A;  3DX4 A;  2EFK A;  3LMF A;  3I2W A;  1QWU A;  4IWP A;  1UPX A;  2YI8 A;  4ATM A;  4AZH A;  3D2F A;  4H6I A;  3DPO A;  3B52 X;  3D2E A;  1QX1 A;  2F7O A;  1I49 A;  4R5J A;  3SYV A;  1YWM A;  3KDR A;  4DCN C;  3ER8 C;  2PMR A;  2Z0N A;  1SU7 A;  1ZYL A;  3DPP A;  4EZW A;  1JQK A;  2YLA A;  2Z0O A;  1R34 A;  3EJR A;  3L3O M;  4M0M A;  5FIG A;  2F18 A;  2NCZ A;  3EJU A;  4EZQ A;  2JNS A;  3C7N A;  4KIK A;  3BVX A;  4NSW A;  3CAZ A;  3BLB A;  3F7W A;  1E1D A;  1MJG A;  3Q0K A;  4EZZ A;  1GNL A;  3OK8 A;  1PS3 A;  2D4C A;  3T4A G;  3DDG A;  4AZI A;  1O7D B;  2RAI A;  2GA9 D;  4FZO A;  4E3C A;  4KIK B;  2QFF A;  2QKW A;  2RT6 A;  4R5G A;  2GAF D;  2F7P A;  3DPQ A;  2WYH A;  3BUB A;  1DKZ A;  4UDY X;  2YIA A;  1LQ7 A;  3T49 A;  1QWN A;  3B53 X;  2OBL A;  3D4Y A;  1E2U A;  4EZS A;  1TQS A;  2OO2 A;  2GF4 A;  1DKY A;  1I4L A;  4EZN A;  4EZR A;  2FYV A;  2RAK A;  2F7Q A;  4DYL A;  3BUD A;  1X03 A; 
#chains in the Genus database with same CATH homology
 4AZC A;  2YLA A;  2YL9 A;  4FZP A;  4AZ5 A;  2YLL A;  2JNK A;  2YL6 A;  4AZI A;  4AZB A;  4FZO A;  4AZ7 A;  3RPM A;  2YL5 A;  2YL8 A;  4AZH A;  4AZC B;  2OO2 A;  4AZ6 A;  2OZN B;  2PMR A;  4AZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...