2Z0VA

Crystal structure of bar domain of endophilin-iii
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
223
structure length
223
Chain Sequence
DDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 3
publication title Crystal structure of BAR domain of Endophilin-III
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 75
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2z0vA00
2EFLA 3LLLA 3OK8A 3DYTA 3M3WA 3Q84A 5C5BA 1X04A 2FICA 3ABHA 4WPEA 4FZSA 2Q12A 4NQIA 1URUA 2Z0OA 3I2WA 3QE6A 3Q0KA 3SOGA 2Q13A 2RAKA 2X3WA 2RAJA 3SYVA 1I49A 2EFKA 2ELBA 3QWEA 3PLTA 2D4CA 1I4DA 2RAIA 3CAZA 1Y2OA 5C5BB 4H8SA 4AKVA 4WPCA 2X3VA 3G9GA 2YKTA 4DCNC 1ZWWA 1WDZA 2Z0NA 3HAIA 3HAHA 2D1LA 1X03A 3ACOA 4ATMA 4DYLA 1I4LA 2V0OA 2C08A 4AVMA 3QNIA 2X3XA 4I1QA 4BNEA 3HAJA 4NSWA 1I4TA 2Z0VA
chains in the Genus database with same CATH superfamily
2ALWA 2YL5A 3EJPA 4IW0A 2RAKA 1O7DC 4EZRA 4F01A 4JL9A 5KBPA 4AZ6A 5C5BB 2WYHA 2X3VA 4M0MA 1X03A 4IM2A 3DPPA 3T48A 3BVUA 3BUIA 4AZGA 3CZSA 1HXKA 1URUA 4R5GA 4FM3A 3EJUA 3BUBA 3OHXM 1ZYLA 3D4ZA 4HR1A 2YIAA 3SYVA 2EFKA 3QWEA 3PLTA 1HWWA 1GNLA 3DX2A 1OAOA 1E1DA 3I04A 5C5BA 2X5CA 4JNFA 2WINM 2Z0OA 1U00A 2YIBA 2PY6A 3KAWA 1QWUA 4DYLA 4UDXX 3CKDA 4JWEA 4JNEA 3LVTA 3CAZA 2EFLA 2FICA 1GNTA 2F7PA 2OO2A 3KDRA 3CVRA 3VEAA 2YIVX 1DKXA 4ATMA 1GN9A 3BUPA 2YL9A 4EZUA 1HTYA 3ZEDA 2F7OA 2ND1A 3BVXA 1QX1A 2WYIA 3I2WA 4EZPA 3BUDA 3RPMA 3GI7A 1O7DB 1TQSA 3T46A 3RV0A 4JLCA 3HAIA 3ACOA 1I4LA 4EZVA 4JWCA 3ER8C 4AZHA 4JWDA 2F7RA 2YLAA 3B51X 4PO2A 2F7QA 4E3CA 4EZQA 2Q13A 3T49A 3CZNA 2D1LA 4AZCB 2C08A 3A98A 1I4TA 3ERCC 3L3PA 2OBMA 3Q0KA 5E84A 1SUFA 4AZ5A 4IM0A 4EZXA 2RAIA 3I01A 4H8SA 2GF4A 4DCNC 3HAHA 4JWIA 2YI9A 2ZXQA 3EJTA 3RV1A 2NCZA 4EZYA 3ABHA 1QWNA 3SOGA 3BVWA 4AZCA 2JNSA 2YL6A 4R5LA 4R5IA 4WPCA 1ZWWA 3I39X 1JQKA 3O3NB 2QXLA 3QE6A 2F18A 3M3WA 2GAFD 2LM0A 3D4YA 2RT6A 1I49A 1I4DA 1Y2OA 4IM3A 2N3KA 3CV5A 2GA9D 3FD9A 2X3XA 4I1QA 3LLLA 1SU6A 4R5JA 3BVTA 1DKYA 1PS3A 3B53X 3ER9B 2X3WA 4F00A 3BUQA 2JNKA 3DDGA 3KAVA 3DX0A 4NPHA 2F1AA 1X04A 4JN4A 3D2EA 3B52X 2YL8A 4IWQA 2RAJA 3DX1A 2ELBA 3C7NA 3EJQA 4AKVA 2OW6A 4E81A 1R33A 1WDZA 3UITA 4HR1B 5TKYA 4H6IA 4R5KA 4BNEA 3DDFA 2Z0VA 1TQWA 1TQTA 1LQ7A 3VEBA 1OA1A 3LMFA 3O3OB 2Z8YA 4D8JA 2EWFA 3DYTA 3F7WA 3D50A 1R34A 3L3OM 4IWPA 5FIGA 4FZOA 2O0I1 1OA0A 3EJRA 4AZ7A 3DX4A 2ND0A 3DPOA 3EJSA 2OBLA 4H6HA 4EZZA 4EZOA 2MI7A 3BVVA 2QKWA 2Z0NA 1UPXA 4EZNA 1YWMA 4IWOA 4AVMA 3QNIA 3OK8A 3Q84A 2FYVA 2PMRA 4WPEA 3D51A 1MJGA 3BLBA 4AZIA 3D52A 4EZWA 1R5EA 2KHOA 2D4CA 1TQVA 2YKTA 1SU8A 2QFFA 3T4AG 4AZBA 4EZSA 3DX3A 4FZSA 2Q12A 4KIKB 4NQIA 2YLLA 2OW7A 1E2UA 4HYBA 2YI8A 3G9GA 2F1BA 1W9MA 4B9QA 3DPQA 3D2FA 4NSWA 5FLEX 1SU7A 4EZTA 3OWGA 3QNJA 1DKZA 2OZNB 3VKHA 4HY9A 2LXYA 3T47A 4UDYX 4KIKA 3O3MB 4FZPA 2V0OA 1TQUA 2EX3B 4G6QA 1E9VA 3QA8A 3HAJA
chains in the Genus database with same CATH topology
2EFLA 3LLLA 3OK8A 3DYTA 3M3WA 3Q84A 5C5BA 1X04A 2FICA 3ABHA 4WPEA 4FZSA 2Q12A 4NQIA 1URUA 2Z0OA 3I2WA 3QE6A 3Q0KA 3SOGA 2Q13A 2RAKA 2X3WA 2RAJA 3SYVA 1I49A 2EFKA 2ELBA 3QWEA 3PLTA 2D4CA 1I4DA 2RAIA 3CAZA 1Y2OA 5C5BB 4H8SA 4AKVA 4WPCA 2X3VA 3G9GA 2YKTA 4DCNC 1ZWWA 1WDZA 2Z0NA 3HAIA 3HAHA 2D1LA 1X03A 3ACOA 4ATMA 4DYLA 1I4LA 2V0OA 2C08A 4AVMA 3QNIA 2X3XA 4I1QA 4BNEA 3HAJA 4NSWA 1I4TA 2Z0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFL A;  3LLL A;  3OK8 A;  3DYT A;  3M3W A;  3Q84 A;  5C5B A;  1X04 A;  2FIC A;  3ABH A;  4WPE A;  4FZS A;  2Q12 A;  4NQI A;  1URU A;  2Z0O A;  3I2W A;  3QE6 A;  3Q0K A;  3SOG A;  2Q13 A;  2RAK A;  2X3W A;  2RAJ A;  3SYV A;  1I49 A;  2EFK A;  2ELB A;  3QWE A;  3PLT A;  2D4C A;  1I4D A;  2RAI A;  3CAZ A;  1Y2O A;  5C5B B;  4H8S A;  4AKV A;  4WPC A;  2X3V A;  3G9G A;  2YKT A;  4DCN C;  1ZWW A;  1WDZ A;  2Z0N A;  3HAI A;  3HAH A;  2D1L A;  1X03 A;  3ACO A;  4ATM A;  4DYL A;  1I4L A;  2V0O A;  2C08 A;  4AVM A;  3QNI A;  2X3X A;  4I1Q A;  4BNE A;  3HAJ A;  4NSW A;  1I4T A;  2Z0V A; 
#chains in the Genus database with same CATH topology
 2ALW A;  2YL5 A;  3EJP A;  4IW0 A;  2RAK A;  1O7D C;  4EZR A;  4F01 A;  4JL9 A;  5KBP A;  4AZ6 A;  5C5B B;  2WYH A;  2X3V A;  4M0M A;  1X03 A;  4IM2 A;  3DPP A;  3T48 A;  3BVU A;  3BUI A;  4AZG A;  3CZS A;  1HXK A;  1URU A;  4R5G A;  4FM3 A;  3EJU A;  3BUB A;  3OHX M;  1ZYL A;  3D4Z A;  4HR1 A;  2YIA A;  3SYV A;  2EFK A;  3QWE A;  3PLT A;  1HWW A;  1GNL A;  3DX2 A;  1OAO A;  1E1D A;  3I04 A;  5C5B A;  2X5C A;  4JNF A;  2WIN M;  2Z0O A;  1U00 A;  2YIB A;  2PY6 A;  3KAW A;  1QWU A;  4DYL A;  4UDX X;  3CKD A;  4JWE A;  4JNE A;  3LVT A;  3CAZ A;  2EFL A;  2FIC A;  1GNT A;  2F7P A;  2OO2 A;  3KDR A;  3CVR A;  3VEA A;  2YIV X;  1DKX A;  4ATM A;  1GN9 A;  3BUP A;  2YL9 A;  4EZU A;  1HTY A;  3ZED A;  2F7O A;  2ND1 A;  3BVX A;  1QX1 A;  2WYI A;  3I2W A;  4EZP A;  3BUD A;  3RPM A;  3GI7 A;  1O7D B;  1TQS A;  3T46 A;  3RV0 A;  4JLC A;  3HAI A;  3ACO A;  1I4L A;  4EZV A;  4JWC A;  3ER8 C;  4AZH A;  4JWD A;  2F7R A;  2YLA A;  3B51 X;  4PO2 A;  2F7Q A;  4E3C A;  4EZQ A;  2Q13 A;  3T49 A;  3CZN A;  2D1L A;  4AZC B;  2C08 A;  3A98 A;  1I4T A;  3ERC C;  3L3P A;  2OBM A;  3Q0K A;  5E84 A;  1SUF A;  4AZ5 A;  4IM0 A;  4EZX A;  2RAI A;  3I01 A;  4H8S A;  2GF4 A;  4DCN C;  3HAH A;  4JWI A;  2YI9 A;  2ZXQ A;  3EJT A;  3RV1 A;  2NCZ A;  4EZY A;  3ABH A;  1QWN A;  3SOG A;  3BVW A;  4AZC A;  2JNS A;  2YL6 A;  4R5L A;  4R5I A;  4WPC A;  1ZWW A;  3I39 X;  1JQK A;  3O3N B;  2QXL A;  3QE6 A;  2F18 A;  3M3W A;  2GAF D;  2LM0 A;  3D4Y A;  2RT6 A;  1I49 A;  1I4D A;  1Y2O A;  4IM3 A;  2N3K A;  3CV5 A;  2GA9 D;  3FD9 A;  2X3X A;  4I1Q A;  3LLL A;  1SU6 A;  4R5J A;  3BVT A;  1DKY A;  1PS3 A;  3B53 X;  3ER9 B;  2X3W A;  4F00 A;  3BUQ A;  2JNK A;  3DDG A;  3KAV A;  3DX0 A;  4NPH A;  2F1A A;  1X04 A;  4JN4 A;  3D2E A;  3B52 X;  2YL8 A;  4IWQ A;  2RAJ A;  3DX1 A;  2ELB A;  3C7N A;  3EJQ A;  4AKV A;  2OW6 A;  4E81 A;  1R33 A;  1WDZ A;  3UIT A;  4HR1 B;  5TKY A;  4H6I A;  4R5K A;  4BNE A;  3DDF A;  2Z0V A;  1TQW A;  1TQT A;  1LQ7 A;  3VEB A;  1OA1 A;  3LMF A;  3O3O B;  2Z8Y A;  4D8J A;  2EWF A;  3DYT A;  3F7W A;  3D50 A;  1R34 A;  3L3O M;  4IWP A;  5FIG A;  4FZO A;  2O0I 1;  1OA0 A;  3EJR A;  4AZ7 A;  3DX4 A;  2ND0 A;  3DPO A;  3EJS A;  2OBL A;  4H6H A;  4EZZ A;  4EZO A;  2MI7 A;  3BVV A;  2QKW A;  2Z0N A;  1UPX A;  4EZN A;  1YWM A;  4IWO A;  4AVM A;  3QNI A;  3OK8 A;  3Q84 A;  2FYV A;  2PMR A;  4WPE A;  3D51 A;  1MJG A;  3BLB A;  4AZI A;  3D52 A;  4EZW A;  1R5E A;  2KHO A;  2D4C A;  1TQV A;  2YKT A;  1SU8 A;  2QFF A;  3T4A G;  4AZB A;  4EZS A;  3DX3 A;  4FZS A;  2Q12 A;  4KIK B;  4NQI A;  2YLL A;  2OW7 A;  1E2U A;  4HYB A;  2YI8 A;  3G9G A;  2F1B A;  1W9M A;  4B9Q A;  3DPQ A;  3D2F A;  4NSW A;  5FLE X;  1SU7 A;  4EZT A;  3OWG A;  3QNJ A;  1DKZ A;  2OZN B;  3VKH A;  4HY9 A;  2LXY A;  3T47 A;  4UDY X;  4KIK A;  3O3M B;  4FZP A;  2V0O A;  1TQU A;  2EX3 B;  4G6Q A;  1E9V A;  3QA8 A;  3HAJ A; 
#chains in the Genus database with same CATH homology
 2EFL A;  3LLL A;  3OK8 A;  3DYT A;  3M3W A;  3Q84 A;  5C5B A;  1X04 A;  2FIC A;  3ABH A;  4WPE A;  4FZS A;  2Q12 A;  4NQI A;  1URU A;  2Z0O A;  3I2W A;  3QE6 A;  3Q0K A;  3SOG A;  2Q13 A;  2RAK A;  2X3W A;  2RAJ A;  3SYV A;  1I49 A;  2EFK A;  2ELB A;  3QWE A;  3PLT A;  2D4C A;  1I4D A;  2RAI A;  3CAZ A;  1Y2O A;  5C5B B;  4H8S A;  4AKV A;  4WPC A;  2X3V A;  3G9G A;  2YKT A;  4DCN C;  1ZWW A;  1WDZ A;  2Z0N A;  3HAI A;  3HAH A;  2D1L A;  1X03 A;  3ACO A;  4ATM A;  4DYL A;  1I4L A;  2V0O A;  2C08 A;  4AVM A;  3QNI A;  2X3X A;  4I1Q A;  4BNE A;  3HAJ A;  4NSW A;  1I4T A;  2Z0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...