2Z0VA

Crystal structure of bar domain of endophilin-iii
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
223
structure length
223
Chain Sequence
DDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-containing GRB2-like protein 3
publication title Crystal structure of BAR domain of Endophilin-III
rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 75
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2z0vA00
3QWEA 3QNIA 4FZSA 3M3WA 4WPCA 2EFKA 2C08A 1X04A 1I49A 3OK8A 4BNEA 4NQIA 3ACOA 3HAHA 1I4LA 3PLTA 3HAJA 2RAIA 2D1LA 1URUA 4NSWA 2X3WA 3Q84A 2Q13A 1WDZA 3HAIA 4WPEA 1X03A 2X3XA 2Z0NA 3SOGA 4ATMA 3SYVA 1I4DA 3G9GA 2Z0VA 1ZWWA 2X3VA 4AKVA 2EFLA 2ELBA 3LLLA 3QE6A 5C5BA 2RAKA 1I4TA 2RAJA 3DYTA 4I1QA 4AVMA 4DYLA 2YKTA 3I2WA 2FICA 3CAZA 2Q12A 4DCNC 2V0OA 5C5BB 1Y2OA 4H8SA 3ABHA 2D4CA 3Q0KA 2Z0OA
chains in the Genus database with same CATH superfamily
4HR1B 4JL9A 3T47A 4NQIA 3T46A 3PLTA 3DPPA 3D4ZA 2Z0NA 3OHXM 2N3KA 3VKHA 3OWGA 3VEBA 4DCNC 4FZSA 3L3PA 3D52A 3UITA 2C08A 2OW6A 4AZ6A 3B52X 3EJRA 2F18A 5C5BA 4EZVA 4EZUA 2LXYA 3EJTA 2YL5A 1GNLA 3ABHA 4IM2A 1LQ7A 2Z0OA 1GNTA 4EZOA 4WPCA 3BUPA 1OA0A 4AZGA 1HTYA 2YIVX 2Q13A 2OZNB 2RAKA 4R5LA 1TQTA 1E9VA 4EZPA 1R5EA 1JQKA 1MJGA 1GN9A 4JLCA 1DKYA 3LMFA 1HXKA 3ACOA 3B51X 3EJQA 3EJPA 1E2UA 3BLBA 2GF4A 4H6IA 2YI9A 4F01A 4EZYA 4IM3A 1R34A 2JNKA 3QNIA 3DX1A 3O3NB 3OK8A 2FYVA 1QWNA 4WPEA 2YL9A 4B9QA 1I4DA 3D4YA 2Z0VA 3QA8A 4I1QA 4R5KA 4JWIA 3T48A 2V0OA 2YIAA 2GAFD 3BUIA 3D51A 3CZNA 3VEAA 2OBMA 2X3WA 4HYBA 1X03A 3F7WA 1R33A 2WYHA 4EZRA 4R5IA 3EJUA 1TQSA 2NCZA 4IWOA 1SUFA 2JNSA 3QWEA 1SU7A 4EZQA 3BUDA 1HWWA 1X04A 4JNEA 2RAIA 1O7DB 3DDGA 3BVTA 3BUQA 4E3CA 5FIGA 3QNJA 3ZEDA 3BUBA 1OAOA 4DYLA 4HY9A 2YKTA 2F7OA 4H8SA 2YLLA 2F7RA 4R5JA 4AZ5A 3GI7A 3DX2A 5TKYA 3CKDA 3HAHA 4H6HA 1URUA 4NSWA 1TQUA 3O3MB 4JNFA 1I4TA 1O7DC 4FZOA 1W9MA 3I2WA 2ND1A 1Y2OA 2D4CA 4F00A 1QX1A 4EZXA 2LM0A 1I49A 4BNEA 2EX3B 1OA1A 4EZSA 3EJSA 3BVVA 1YWMA 4AZBA 3FD9A 1ZWWA 3CV5A 3LLLA 3KAVA 5KBPA 3DX0A 4FM3A 4JWCA 1E1DA 2ZXQA 3RV1A 2F1BA 2D1LA 3SYVA 2X3VA 2EFLA 4EZNA 4AZHA 2PMRA 4G6QA 3B53X 3I39X 2X5CA 2MI7A 2YL8A 3BVWA 3DX4A 1I4LA 2ND0A 3A98A 2QKWA 3HAJA 4PO2A 4KIKB 3HAIA 2YL6A 2ELBA 4UDXX 2KHOA 3KDRA 4AVMA 3D2FA 4IW0A 2EWFA 3ER9B 4EZWA 2WINM 2QXLA 3KAWA 3Q84A 3BVXA 3BVUA 1TQWA 4R5GA 4AZCB 4UDYX 1SU6A 2ALWA 3Q0KA 2OBLA 4KIKA 4EZTA 2EFKA 4JWDA 1DKXA 2Z8YA 2YLAA 3CZSA 2X3XA 5E84A 4JWEA 4AKVA 4HR1A 4EZZA 2FICA 3CAZA 4D8JA 2OO2A 1UPXA 1ZYLA 3RPMA 3I04A 5FLEX 3DDFA 3O3OB 1TQVA 4AZCA 4AZ7A 3D2EA 4ATMA 1U00A 2YIBA 3QE6A 3LVTA 2OW7A 3ERCC 2RAJA 1DKZA 2PY6A 3T4AG 4E81A 3D50A 2YI8A 4JN4A 4IM0A 1PS3A 1SU8A 3DX3A 4NPHA 1QWUA 3CVRA 4IWPA 1WDZA 3SOGA 2F7QA 3DPQA 4M0MA 3ER8C 2F7PA 4FZPA 2O0I1 3M3WA 2F1AA 3L3OM 3T49A 3DPOA 4IWQA 3G9GA 3RV0A 2WYIA 3DYTA 3C7NA 2QFFA 2RT6A 2Q12A 4AZIA 5C5BB 3I01A 2GA9D
chains in the Genus database with same CATH topology
3QWEA 3QNIA 4FZSA 3M3WA 4WPCA 2EFKA 2C08A 1X04A 1I49A 3OK8A 4BNEA 4NQIA 3ACOA 3HAHA 1I4LA 3PLTA 3HAJA 2RAIA 2D1LA 1URUA 4NSWA 2X3WA 3Q84A 2Q13A 1WDZA 3HAIA 4WPEA 1X03A 2X3XA 2Z0NA 3SOGA 4ATMA 3SYVA 1I4DA 3G9GA 2Z0VA 1ZWWA 2X3VA 4AKVA 2EFLA 2ELBA 3LLLA 3QE6A 5C5BA 2RAKA 1I4TA 2RAJA 3DYTA 4I1QA 4AVMA 4DYLA 2YKTA 3I2WA 2FICA 3CAZA 2Q12A 4DCNC 2V0OA 5C5BB 1Y2OA 4H8SA 3ABHA 2D4CA 3Q0KA 2Z0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QWE A;  3QNI A;  4FZS A;  3M3W A;  4WPC A;  2EFK A;  2C08 A;  1X04 A;  1I49 A;  3OK8 A;  4BNE A;  4NQI A;  3ACO A;  3HAH A;  1I4L A;  3PLT A;  3HAJ A;  2RAI A;  2D1L A;  1URU A;  4NSW A;  2X3W A;  3Q84 A;  2Q13 A;  1WDZ A;  3HAI A;  4WPE A;  1X03 A;  2X3X A;  2Z0N A;  3SOG A;  4ATM A;  3SYV A;  1I4D A;  3G9G A;  2Z0V A;  1ZWW A;  2X3V A;  4AKV A;  2EFL A;  2ELB A;  3LLL A;  3QE6 A;  5C5B A;  2RAK A;  1I4T A;  2RAJ A;  3DYT A;  4I1Q A;  4AVM A;  4DYL A;  2YKT A;  3I2W A;  2FIC A;  3CAZ A;  2Q12 A;  4DCN C;  2V0O A;  5C5B B;  1Y2O A;  4H8S A;  3ABH A;  2D4C A;  3Q0K A;  2Z0O A; 
#chains in the Genus database with same CATH topology
 4HR1 B;  4JL9 A;  3T47 A;  4NQI A;  3T46 A;  3PLT A;  3DPP A;  3D4Z A;  2Z0N A;  3OHX M;  2N3K A;  3VKH A;  3OWG A;  3VEB A;  4DCN C;  4FZS A;  3L3P A;  3D52 A;  3UIT A;  2C08 A;  2OW6 A;  4AZ6 A;  3B52 X;  3EJR A;  2F18 A;  5C5B A;  4EZV A;  4EZU A;  2LXY A;  3EJT A;  2YL5 A;  1GNL A;  3ABH A;  4IM2 A;  1LQ7 A;  2Z0O A;  1GNT A;  4EZO A;  4WPC A;  3BUP A;  1OA0 A;  4AZG A;  1HTY A;  2YIV X;  2Q13 A;  2OZN B;  2RAK A;  4R5L A;  1TQT A;  1E9V A;  4EZP A;  1R5E A;  1JQK A;  1MJG A;  1GN9 A;  4JLC A;  1DKY A;  3LMF A;  1HXK A;  3ACO A;  3B51 X;  3EJQ A;  3EJP A;  1E2U A;  3BLB A;  2GF4 A;  4H6I A;  2YI9 A;  4F01 A;  4EZY A;  4IM3 A;  1R34 A;  2JNK A;  3QNI A;  3DX1 A;  3O3N B;  3OK8 A;  2FYV A;  1QWN A;  4WPE A;  2YL9 A;  4B9Q A;  1I4D A;  3D4Y A;  2Z0V A;  3QA8 A;  4I1Q A;  4R5K A;  4JWI A;  3T48 A;  2V0O A;  2YIA A;  2GAF D;  3BUI A;  3D51 A;  3CZN A;  3VEA A;  2OBM A;  2X3W A;  4HYB A;  1X03 A;  3F7W A;  1R33 A;  2WYH A;  4EZR A;  4R5I A;  3EJU A;  1TQS A;  2NCZ A;  4IWO A;  1SUF A;  2JNS A;  3QWE A;  1SU7 A;  4EZQ A;  3BUD A;  1HWW A;  1X04 A;  4JNE A;  2RAI A;  1O7D B;  3DDG A;  3BVT A;  3BUQ A;  4E3C A;  5FIG A;  3QNJ A;  3ZED A;  3BUB A;  1OAO A;  4DYL A;  4HY9 A;  2YKT A;  2F7O A;  4H8S A;  2YLL A;  2F7R A;  4R5J A;  4AZ5 A;  3GI7 A;  3DX2 A;  5TKY A;  3CKD A;  3HAH A;  4H6H A;  1URU A;  4NSW A;  1TQU A;  3O3M B;  4JNF A;  1I4T A;  1O7D C;  4FZO A;  1W9M A;  3I2W A;  2ND1 A;  1Y2O A;  2D4C A;  4F00 A;  1QX1 A;  4EZX A;  2LM0 A;  1I49 A;  4BNE A;  2EX3 B;  1OA1 A;  4EZS A;  3EJS A;  3BVV A;  1YWM A;  4AZB A;  3FD9 A;  1ZWW A;  3CV5 A;  3LLL A;  3KAV A;  5KBP A;  3DX0 A;  4FM3 A;  4JWC A;  1E1D A;  2ZXQ A;  3RV1 A;  2F1B A;  2D1L A;  3SYV A;  2X3V A;  2EFL A;  4EZN A;  4AZH A;  2PMR A;  4G6Q A;  3B53 X;  3I39 X;  2X5C A;  2MI7 A;  2YL8 A;  3BVW A;  3DX4 A;  1I4L A;  2ND0 A;  3A98 A;  2QKW A;  3HAJ A;  4PO2 A;  4KIK B;  3HAI A;  2YL6 A;  2ELB A;  4UDX X;  2KHO A;  3KDR A;  4AVM A;  3D2F A;  4IW0 A;  2EWF A;  3ER9 B;  4EZW A;  2WIN M;  2QXL A;  3KAW A;  3Q84 A;  3BVX A;  3BVU A;  1TQW A;  4R5G A;  4AZC B;  4UDY X;  1SU6 A;  2ALW A;  3Q0K A;  2OBL A;  4KIK A;  4EZT A;  2EFK A;  4JWD A;  1DKX A;  2Z8Y A;  2YLA A;  3CZS A;  2X3X A;  5E84 A;  4JWE A;  4AKV A;  4HR1 A;  4EZZ A;  2FIC A;  3CAZ A;  4D8J A;  2OO2 A;  1UPX A;  1ZYL A;  3RPM A;  3I04 A;  5FLE X;  3DDF A;  3O3O B;  1TQV A;  4AZC A;  4AZ7 A;  3D2E A;  4ATM A;  1U00 A;  2YIB A;  3QE6 A;  3LVT A;  2OW7 A;  3ERC C;  2RAJ A;  1DKZ A;  2PY6 A;  3T4A G;  4E81 A;  3D50 A;  2YI8 A;  4JN4 A;  4IM0 A;  1PS3 A;  1SU8 A;  3DX3 A;  4NPH A;  1QWU A;  3CVR A;  4IWP A;  1WDZ A;  3SOG A;  2F7Q A;  3DPQ A;  4M0M A;  3ER8 C;  2F7P A;  4FZP A;  2O0I 1;  3M3W A;  2F1A A;  3L3O M;  3T49 A;  3DPO A;  4IWQ A;  3G9G A;  3RV0 A;  2WYI A;  3DYT A;  3C7N A;  2QFF A;  2RT6 A;  2Q12 A;  4AZI A;  5C5B B;  3I01 A;  2GA9 D; 
#chains in the Genus database with same CATH homology
 3QWE A;  3QNI A;  4FZS A;  3M3W A;  4WPC A;  2EFK A;  2C08 A;  1X04 A;  1I49 A;  3OK8 A;  4BNE A;  4NQI A;  3ACO A;  3HAH A;  1I4L A;  3PLT A;  3HAJ A;  2RAI A;  2D1L A;  1URU A;  4NSW A;  2X3W A;  3Q84 A;  2Q13 A;  1WDZ A;  3HAI A;  4WPE A;  1X03 A;  2X3X A;  2Z0N A;  3SOG A;  4ATM A;  3SYV A;  1I4D A;  3G9G A;  2Z0V A;  1ZWW A;  2X3V A;  4AKV A;  2EFL A;  2ELB A;  3LLL A;  3QE6 A;  5C5B A;  2RAK A;  1I4T A;  2RAJ A;  3DYT A;  4I1Q A;  4AVM A;  4DYL A;  2YKT A;  3I2W A;  2FIC A;  3CAZ A;  2Q12 A;  4DCN C;  2V0O A;  5C5B B;  1Y2O A;  4H8S A;  3ABH A;  2D4C A;  3Q0K A;  2Z0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...