2Z0VA

Crystal structure of bar domain of endophilin-iii
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
223
structure length
223
Chain Sequence
DDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords SH3-containing GRB2-like protein 3
publication title Crystal structure of BAR domain of Endophilin-III
rcsb
source organism Homo sapiens
total genus 75
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2z0vA00
4BNEA 3HAHA 4AKVA 1I49A 2D4CA 3ABHA 4DCNC 4DYLA 4I1QA 2X3XA 1URUA 1I4LA 4H8SA 2RAJA 3OK8A 3Q84A 4WPCA 2RAKA 3HAIA 2RAIA 1X03A 2Z0NA 1X04A 3LLLA 2Q12A 3SYVA 2V0OA 4NQIA 1Y2OA 5C5BB 2D1LA 3G9GA 2FICA 3PLTA 3QWEA 2ELBA 1I4DA 2C08A 3ACOA 3DYTA 3QE6A 3CAZA 4NSWA 2Z0VA 3HAJA 3SOGA 2Q13A 3Q0KA 2X3VA 1I4TA 2X3WA 2Z0OA 4FZSA 4ATMA 4AVMA 5C5BA 4WPEA 1WDZA 3QNIA 2YKTA 3I2WA 3M3WA 2EFKA 1ZWWA 2EFLA
chains in the Genus database with same CATH superfamily
3DX1A 2Z8YA 3EJPA 4JN4A 1URUA 2RAKA 1X04A 2ZXQA 3T47A 2ALWA 2D1LA 1I4DA 3LMFA 3C7NA 3HAJA 3VEBA 4E81A 2WYIA 1I4TA 2OW6A 4AVMA 4UDYX 3RV1A 3QNIA 3I39X 3Q84A 2JNSA 4EZPA 4NQIA 2X5CA 4JWDA 4NPHA 2X3WA 3F7WA 4FZOA 4IM0A 1ZWWA 4KIKB 4UDXX 2YI8A 2X3XA 1I4LA 4IWOA 1UPXA 4AZGA 2F7PA 3B52X 3B53X 3D51A 2ND1A 3QWEA 4AZHA 3EJUA 2QFFA 1SUFA 3M3WA 1DKYA 2GAFD 3BUIA 4I1QA 2F18A 2Z0NA 4EZNA 1OAOA 2Q12A 1PS3A 3I04A 2NCZA 3ACOA 4NSWA 2OZNB 3CVRA 4R5IA 1HWWA 2O0I1 2GF4A 2LXYA 4BNEA 4EZUA 3B51X 4IM2A 1JQKA 1GNLA 1OA1A 3O3MB 3HAIA 4AZ5A 4FZPA 3A98A 2F1BA 4IWQA 3BLBA 2MI7A 2YL6A 3BUQA 4JL9A 4R5JA 1YWMA 3DX4A 3OWGA 3QA8A 4AKVA 4AZCA 3ERCC 4DYLA 3OK8A 3CKDA 2RAIA 3PLTA 2FICA 2ELBA 2YIBA 3LVTA 3DDFA 4R5GA 3T48A 4EZQA 5C5BA 1QWUA 1TQVA 2OW7A 4IW0A 1I49A 2D4CA 1O7DC 3RPMA 4EZVA 2YLLA 3EJQA 3L3OM 2KHOA 2JNKA 5FIGA 2YL9A 2OO2A 4M0MA 2F1AA 3KDRA 1E9VA 3D4ZA 1E2UA 3T4AG 3I2WA 2EFKA 3RV0A 4JWEA 2LM0A 1TQSA 3T46A 1SU8A 1E1DA 4HR1A 2RT6A 3BVVA 4R5LA 2Z0OA 3BUDA 3BVWA 3VKHA 3CZSA 3T49A 2RAJA 5E84A 2YIVX 4HR1B 4EZXA 4JNFA 3CAZA 4EZTA 1R33A 3VEAA 4AZ6A 2YL8A 4WPEA 1WDZA 3DPOA 3D2FA 4AZ7A 3DPQA 3KAWA 4H6IA 1X03A 3UITA 1HTYA 3SYVA 2WINM 4R5KA 3BUPA 1QX1A 3G9GA 5FLEX 3BVTA 4HYBA 2N3KA 2C08A 2OBMA 2X3VA 1W9MA 1O7DB 3EJTA 3DDGA 1DKZA 3CV5A 1OA0A 3LLLA 1TQWA 3QE6A 3GI7A 1TQUA 1ZYLA 2GA9D 4EZZA 2YI9A 4EZSA 3EJSA 4AZCB 5KBPA 1GNTA 3HAHA 3ABHA 3ER9B 4G6QA 3CZNA 4H8SA 1R34A 4WPCA 4HY9A 3O3OB 2V0OA 5C5BB 2QKWA 1SU7A 4JWIA 4D8JA 4EZYA 2Z0VA 3KAVA 2PMRA 2F7RA 3O3NB 4F00A 2YIAA 1SU6A 3ER8C 1U00A 4AZIA 3DPPA 4KIKA 3FD9A 1Y2OA 1GN9A 3BVXA 4EZOA 5TKYA 4B9QA 4E3CA 2PY6A 2FYVA 2EFLA 4PO2A 2EX3B 3QNJA 1TQTA 1DKXA 3L3PA 1HXKA 4JWCA 3DX0A 3DYTA 3D4YA 2YL5A 3DX2A 2YLAA 3EJRA 4AZBA 3ZEDA 3BUBA 3D2EA 4JNEA 1LQ7A 3DX3A 3D50A 3OHXM 3SOGA 4JLCA 2Q13A 3BVUA 4FZSA 4FM3A 4IM3A 1R5EA 2YKTA 2QXLA 4H6HA 4EZRA 4DCNC 2F7QA 2EWFA 2WYHA 4IWPA 2ND0A 4EZWA 1MJGA 4F01A 2F7OA 3D52A 2OBLA 3Q0KA 3I01A 4ATMA 1QWNA
chains in the Genus database with same CATH topology
4BNEA 3HAHA 4AKVA 1I49A 2D4CA 3ABHA 4DCNC 4DYLA 4I1QA 2X3XA 1URUA 1I4LA 4H8SA 2RAJA 3OK8A 3Q84A 4WPCA 2RAKA 3HAIA 2RAIA 1X03A 2Z0NA 1X04A 3LLLA 2Q12A 3SYVA 2V0OA 4NQIA 1Y2OA 5C5BB 2D1LA 3G9GA 2FICA 3PLTA 3QWEA 2ELBA 1I4DA 2C08A 3ACOA 3DYTA 3QE6A 3CAZA 4NSWA 2Z0VA 3HAJA 3SOGA 2Q13A 3Q0KA 2X3VA 1I4TA 2X3WA 2Z0OA 4FZSA 4ATMA 4AVMA 5C5BA 4WPEA 1WDZA 3QNIA 2YKTA 3I2WA 3M3WA 2EFKA 1ZWWA 2EFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BNE A;  3HAH A;  4AKV A;  1I49 A;  2D4C A;  3ABH A;  4DCN C;  4DYL A;  4I1Q A;  2X3X A;  1URU A;  1I4L A;  4H8S A;  2RAJ A;  3OK8 A;  3Q84 A;  4WPC A;  2RAK A;  3HAI A;  2RAI A;  1X03 A;  2Z0N A;  1X04 A;  3LLL A;  2Q12 A;  3SYV A;  2V0O A;  4NQI A;  1Y2O A;  5C5B B;  2D1L A;  3G9G A;  2FIC A;  3PLT A;  3QWE A;  2ELB A;  1I4D A;  2C08 A;  3ACO A;  3DYT A;  3QE6 A;  3CAZ A;  4NSW A;  2Z0V A;  3HAJ A;  3SOG A;  2Q13 A;  3Q0K A;  2X3V A;  1I4T A;  2X3W A;  2Z0O A;  4FZS A;  4ATM A;  4AVM A;  5C5B A;  4WPE A;  1WDZ A;  3QNI A;  2YKT A;  3I2W A;  3M3W A;  2EFK A;  1ZWW A;  2EFL A; 
#chains in the Genus database with same CATH topology
 3DX1 A;  2Z8Y A;  3EJP A;  4JN4 A;  1URU A;  2RAK A;  1X04 A;  2ZXQ A;  3T47 A;  2ALW A;  2D1L A;  1I4D A;  3LMF A;  3C7N A;  3HAJ A;  3VEB A;  4E81 A;  2WYI A;  1I4T A;  2OW6 A;  4AVM A;  4UDY X;  3RV1 A;  3QNI A;  3I39 X;  3Q84 A;  2JNS A;  4EZP A;  4NQI A;  2X5C A;  4JWD A;  4NPH A;  2X3W A;  3F7W A;  4FZO A;  4IM0 A;  1ZWW A;  4KIK B;  4UDX X;  2YI8 A;  2X3X A;  1I4L A;  4IWO A;  1UPX A;  4AZG A;  2F7P A;  3B52 X;  3B53 X;  3D51 A;  2ND1 A;  3QWE A;  4AZH A;  3EJU A;  2QFF A;  1SUF A;  3M3W A;  1DKY A;  2GAF D;  3BUI A;  4I1Q A;  2F18 A;  2Z0N A;  4EZN A;  1OAO A;  2Q12 A;  1PS3 A;  3I04 A;  2NCZ A;  3ACO A;  4NSW A;  2OZN B;  3CVR A;  4R5I A;  1HWW A;  2O0I 1;  2GF4 A;  2LXY A;  4BNE A;  4EZU A;  3B51 X;  4IM2 A;  1JQK A;  1GNL A;  1OA1 A;  3O3M B;  3HAI A;  4AZ5 A;  4FZP A;  3A98 A;  2F1B A;  4IWQ A;  3BLB A;  2MI7 A;  2YL6 A;  3BUQ A;  4JL9 A;  4R5J A;  1YWM A;  3DX4 A;  3OWG A;  3QA8 A;  4AKV A;  4AZC A;  3ERC C;  4DYL A;  3OK8 A;  3CKD A;  2RAI A;  3PLT A;  2FIC A;  2ELB A;  2YIB A;  3LVT A;  3DDF A;  4R5G A;  3T48 A;  4EZQ A;  5C5B A;  1QWU A;  1TQV A;  2OW7 A;  4IW0 A;  1I49 A;  2D4C A;  1O7D C;  3RPM A;  4EZV A;  2YLL A;  3EJQ A;  3L3O M;  2KHO A;  2JNK A;  5FIG A;  2YL9 A;  2OO2 A;  4M0M A;  2F1A A;  3KDR A;  1E9V A;  3D4Z A;  1E2U A;  3T4A G;  3I2W A;  2EFK A;  3RV0 A;  4JWE A;  2LM0 A;  1TQS A;  3T46 A;  1SU8 A;  1E1D A;  4HR1 A;  2RT6 A;  3BVV A;  4R5L A;  2Z0O A;  3BUD A;  3BVW A;  3VKH A;  3CZS A;  3T49 A;  2RAJ A;  5E84 A;  2YIV X;  4HR1 B;  4EZX A;  4JNF A;  3CAZ A;  4EZT A;  1R33 A;  3VEA A;  4AZ6 A;  2YL8 A;  4WPE A;  1WDZ A;  3DPO A;  3D2F A;  4AZ7 A;  3DPQ A;  3KAW A;  4H6I A;  1X03 A;  3UIT A;  1HTY A;  3SYV A;  2WIN M;  4R5K A;  3BUP A;  1QX1 A;  3G9G A;  5FLE X;  3BVT A;  4HYB A;  2N3K A;  2C08 A;  2OBM A;  2X3V A;  1W9M A;  1O7D B;  3EJT A;  3DDG A;  1DKZ A;  3CV5 A;  1OA0 A;  3LLL A;  1TQW A;  3QE6 A;  3GI7 A;  1TQU A;  1ZYL A;  2GA9 D;  4EZZ A;  2YI9 A;  4EZS A;  3EJS A;  4AZC B;  5KBP A;  1GNT A;  3HAH A;  3ABH A;  3ER9 B;  4G6Q A;  3CZN A;  4H8S A;  1R34 A;  4WPC A;  4HY9 A;  3O3O B;  2V0O A;  5C5B B;  2QKW A;  1SU7 A;  4JWI A;  4D8J A;  4EZY A;  2Z0V A;  3KAV A;  2PMR A;  2F7R A;  3O3N B;  4F00 A;  2YIA A;  1SU6 A;  3ER8 C;  1U00 A;  4AZI A;  3DPP A;  4KIK A;  3FD9 A;  1Y2O A;  1GN9 A;  3BVX A;  4EZO A;  5TKY A;  4B9Q A;  4E3C A;  2PY6 A;  2FYV A;  2EFL A;  4PO2 A;  2EX3 B;  3QNJ A;  1TQT A;  1DKX A;  3L3P A;  1HXK A;  4JWC A;  3DX0 A;  3DYT A;  3D4Y A;  2YL5 A;  3DX2 A;  2YLA A;  3EJR A;  4AZB A;  3ZED A;  3BUB A;  3D2E A;  4JNE A;  1LQ7 A;  3DX3 A;  3D50 A;  3OHX M;  3SOG A;  4JLC A;  2Q13 A;  3BVU A;  4FZS A;  4FM3 A;  4IM3 A;  1R5E A;  2YKT A;  2QXL A;  4H6H A;  4EZR A;  4DCN C;  2F7Q A;  2EWF A;  2WYH A;  4IWP A;  2ND0 A;  4EZW A;  1MJG A;  4F01 A;  2F7O A;  3D52 A;  2OBL A;  3Q0K A;  3I01 A;  4ATM A;  1QWN A; 
#chains in the Genus database with same CATH homology
 4BNE A;  3HAH A;  4AKV A;  1I49 A;  2D4C A;  3ABH A;  4DCN C;  4DYL A;  4I1Q A;  2X3X A;  1URU A;  1I4L A;  4H8S A;  2RAJ A;  3OK8 A;  3Q84 A;  4WPC A;  2RAK A;  3HAI A;  2RAI A;  1X03 A;  2Z0N A;  1X04 A;  3LLL A;  2Q12 A;  3SYV A;  2V0O A;  4NQI A;  1Y2O A;  5C5B B;  2D1L A;  3G9G A;  2FIC A;  3PLT A;  3QWE A;  2ELB A;  1I4D A;  2C08 A;  3ACO A;  3DYT A;  3QE6 A;  3CAZ A;  4NSW A;  2Z0V A;  3HAJ A;  3SOG A;  2Q13 A;  3Q0K A;  2X3V A;  1I4T A;  2X3W A;  2Z0O A;  4FZS A;  4ATM A;  4AVM A;  5C5B A;  4WPE A;  1WDZ A;  3QNI A;  2YKT A;  3I2W A;  3M3W A;  2EFK A;  1ZWW A;  2EFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...