2YL6A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 173
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl6A01
3GXDA 1UH3A 3HMCA 3W81A 3MANA 3VOCA 3VD3A 2W5FA 2VC9A 3SUTA 1BHGA 4WKAA 3ZJ8A 4JHZA 4GO9A 3FHQA 1KXVA 4AD0A 3EDFA 2D23A 3RMEA 1EDGA 1R7AA 5D9MA 4FLOA 3TTOA 3IJ8A 2D0FA 4E4PA 2GUYA 4FZOA 3PZQA 4WSKA 4CCEA 2WANA 3CIVA 1J10A 4GI8A 4J3UA 1QNPA 1ZJBA 1E3XA 1KBKA 4MNLA 1QOXA 3GYCA 2WHJA 4B9ZA 1J0HA 4AZIA 5FCZA 3AYRA 3AZRA 1QI5A 1HL9A 1MYRA 3T0DA 2WB5A 1XRVA 5A95A 2PI6A 3T0BA 2Y8VA 4UQDA 1OGBA 3VGEA 4MPKA 1Q4NX 3WL0A 5M3WA 1E6NA 2WLYA 4UQAA 1I75A 4H8HA 2EPOA 3WD3A 1VBUA 4XV0A 2J8GA 3AZSA 4Q22A 4TUFA 2XG9A 3DYPA 2DSVA 2WHLA 5C8BB 4ZFMA 4XZBA 3WQ8A 3IAPA 3NSMA 3VINA 3ZSSA 3AS2A 3BAWA 2OSWA 1XSJA 1CLXA 2A3BA 4BS0A 1UWSA 4N42A 1S46A 4BQ5A 1QW8A 2VVSA 3CHFA 4Z2IA 3EDJA 4MDPA 4PMDA 1TVNA 3WDPP 5EB8A 1Q6FA 5CG0A 3WNPA 3ECQA 2CBIA 3WF2A 1CEOA 2VI0A 2CHOA 3OGSA 1JYVA 4QLKA 3KL5A 2VQUA 6CGTA 4W7WA 4U3CA 1NP2A 1V3IA 2WYSA 3DECA 3SCVA 3WNLA 1OD8A 3F5JA 1UD8A 3AHTA 3A3HA 4FLRA 4HOXA 1B2YA 1KCLA 3CLWA 1ZBKA 4M29A 4HA4A 4HU0A 3EDEA 5IXEA 1HP5A 2ZOXA 4P7QA 3RJYA 3NYDA 1XC6A 4DUWA 4TTUA 3RDKA 1VEMA 2VCBA 4HA3A 2FGZA 3DHUA 2F61A 5CSYA 3GBDA 1G9HA 1HJSA 4R5EA 1UWQA 4PMOA 2CBJA 4U31A 1US2A 3U7VA 2DSWA 2WC7A 1X6LA 5LA1A 3SCRA 4QCEA 1B3ZA 2ZXBA 3IK2A 1SFSA 4EANA 1W9PA 2AOSA 2WVUA 4AW7A 4RE3A 4JFSA 4QLLA 3N12A 4LYRA 5F7UA 3UERA 2TAAA 2XFFA 1FOBA 1Y7VA 4E8CA 1UKSA 3WY1A 2NW0A 1UQYA 1PZ3A 5EBAA 2WKGA 5JIPA 3JUGA 2J25A 3LMYA 3CZLA 1V6UA 2O9TA 1HXJA 1GW1A 2GDUA 3KL3A 3WH6A 2GSJA 3ARQA 4MB4A 1TZ7A 1FHDA 4GPNA 3VIGA 3RPMA 5A8OA 1UR0A 1O6IA 3GH7A 3LPPA 1CXIA 1Z32X 1A47A 3WNOA 5FL1A 1LF1A 3PTQA 1H49A 2ZX9A 5I0DA 2BY2A 1K9FA 1JZ2A 1C7TA 1V02E 3ARWA 2DSZA 3AJ7A 5HNNA 1TE1A 3BCDA 4QP0A 2Y4SA 3AIEA 3EMCA 3CZ8A 3KEHA 2WBGA 3VGFA 1V0MA 1HKKA 1R87A 1CYGA 1VAHA 3OG2A 1UKQA 4ZE5A 3ARYA 2AMGA 1W3JA 3RO8A 1JZ6A 4WK9A 2PWEA 3WD4A 4P7RA 4JFVA 4PCTA 4NF7A 2D2OA 1N82A 1BYCA 3BGAA 4FF5A 1QHOA 2WVSA 2WMIA 1UKPA 1PEZA 3B8SA 4XZWA 4JFUA 1JFHA 4AIUA 4DM2A 1KGWA 3N13A 1BYAA 2VJXA 1IZJA 4JFWA 2FHCA 3A4XA 2ZX7A 5HXMA 1NWSA 1GQLA 1GOKA 3VIFA 4JHOA 4PMRA 1HJWA 3QHOA 1KCKA 1FA2A 3KL0A 1B3XA 1WDQA 2OYMA 3D5HA 2E8YA 3APGA 3N17A 5C70A 4UZSA 4LGXA 5E70A 4ATWA 5AYIA 4UNIA 4U3AA 1JZ8A 2J4GA 5A2AA 5A3HA 3WNNA 3S6TA 4X9YA 3UG4A 1BTCA 3GDBA 5ABGA 1P6WA 1QHPA 3BAJA 4UCFA 2VRJA 1V3HA 4MAVA 3ZIZA 2D20A 3VNZA 1UKTA 2YJQA 1JI1A 5IDIA 1CBGA 2Q8XA 3AZTA 5I2UA 1E56A 1M03A 2YA0A 2DT2A 3UG3A 5HPCA 3FAXA 2BHYA 3FXYA 4M1RA 3K4DA 3B9EA 1B3YA 1VJSA 2G3MA 1HNYA 3VD5A 2J47A 1JAKA 1V6VA 1CGWA 2J75A 2J7HA 3PTKA 1JXJA 1H0IA 1BG4A 2J77A 2C8NA 1E9LA 2VZSA 3N11A 2ZUSA 4MNKA 1GJWA 1FP8A 4QFUA 3AS3A 1C92A 1J0JA 1VEOA 4IUGA 4IPLA 4BF7A 3AROA 1RP9A 4F79A 2W92A 3CO4A 1W2VA 3K46A 4B9YA 3K8KA 4BZYA 1WDRA 1JZ4A 2YLLA 2WVVA 1HX0A 3SIMA 1XGZA 2VURA 2W4XA 3L4WA 4JCLA 1EXPA 1G0CA 2VL4A 1ISVA 4ATLA 3LPGA 4NSBA 4PUDA 5CQ1A 1CPUA 3DYOA 3T0AA 4HPHA 4PMXA 3CHDA 2BVYA 1MFUA 4UOQA 1ZBCA 2YL9A 2WKLA 4M56A 5A8QA 5CGTA 3TOPA 3WMSA 3WKZA 4Z2HA 3MS8A 3VIMA 2CIPA 3POHA 1G01A 1K6AA 2WZHA 5ABFA 4U33A 3PZVA 2W61A 4JCMA 4HZ6A 1NM9A 4Y7EA 5AYBA 3CUFA 4JKKA 5HOSA 1H41A 3EMZA 4W8AA 3T2OA 4WF7A 5M03A 1UA3A 1CZ1A 2WHKA 3WQ4A 4MB5A 2QMKA 2IXUA 4UFHA 2CBVA 4NZCA 3O9NA 2WXDM 1D7FA 1WDSA 4AD1A 1G94A 3GNPA 4BA0A 4PN2A 2GK1A 2FH8A 5JIWA 3WBAA 4XB3A 2QLYA 5D9PA 2VZOA 3DC0A 1UD3A 3NSNA 3WDHA 1HN1A 2WSPA 3SCPA 1KR1A 2D0HA 2YDSA 4DUXA 2O9RA 1W1VA 3CGTA 4FK9A 2XHYA 2OYKA 6A3HA 5M5DA 3MUZ1 2XGBA 2O92A 4P8XA 4GI6A 1G5AA 1V3LA 5BXRA 1V6YA 3T2QA 2QPSA 4L4OA 3ZSTA 2ZXAA 1H09A 3GNOA 3N1AA 1AMYA 5D8ZA 1CGXA 3BH4A 4JKMA 2PWFA 1W1PA 3AYSA 4J27A 1JG9A 4PTXA 5A69A 2CPUA 1QI4A 5CPSA 1C7SA 1WAWA 5DEZA 1NQ6A 1RPKA 4DWSA 2ZXQA 2J7GA 5HBFA 2XYLA 3N9KA 4D6EA 1VFOA 1GOQA 2FHBA 3CMJA 3ZJ6A 3QR3A 3VKKA 1OGSA 1JZ5A 2VRKA 4UQ9A 5HPOA 1HKIA 5CJ5A 2PWDA 2XIIA 3QOKA 4MNJA 3MKKA 3U5YA 1NWTA 4EAMA 2VTFA 2V38A 3FN9A 4PCSA 4GZIA 4H04A 3SCUA 1C8YA 1US3A 1MQQA 3BAYA 1VFUA 4IISA 1LG1A 4WSJA 3ALGA 4CCDA 1SMDA 2J78A 1OBAA 3VIJA 1MW2A 4CUCA 4W5UA 3NSXA 1NWUA 3CMGA 3VIIA 1JIBA 4A3YA 3SURA 5EFFA 1UD5A 4U2YA 3THDA 2XJ7A 3WD2A 4RE4A 5M17A 4RL3A 1TCMA 2WZEA 3PZ9A 2CETA 3AS0A 4MTVA 1E4MM 3U57A 2E3ZA 1UWIA 5BYWA 3CH9A 4R27A 4V2XA 1D2KA 2ZXDA 1KGXA 1MW3A 1UWUA 4PMUA 4GQQA 1ITCA 3MMWA 3D3AA 1ZBVA 1Q6DA 2ZE0A 4Z2JA 5KZ6A 3VUPA 2BY1A 3MO4A 4U5IA 1LLOA 1E6ZA 3BXWA 2UWFA 3WH8A 4GINA 3OGVA 1MXDA 4D6FA 1ISWA 1W9BM 2XM1A 2OWCA 1IV8A 5BXPA 2OYLA 7CGTA 3VTRA 3IJ9A 2VX5A 5JBDA 2VX4A 1ZU8A 2GJXB 2J8FA 3OZPA 1VJZA 1LQ0A 4JIEA 4OKDA 1K9EA 2JIWA 1E15A 4UR9A 1JZ7A 1EDTA 4PTVA 2BVDA 1LG2A 4H8VA 3FY1A 3UCQA 3PZMA 4KH2A 2VNCA 2PF0A 7A3HA 1FHLA 1XCWA 4Z2LA 3GZAA 4D6DA 1CWYA 3TTQA 1H4PA 1M01A 3G6LA 1QW9A 5E0FA 2JALA 4UFMA 4J3XA 1DWHM 1ZBWA 3AMLA 3BSHA 3VD4A 2E9MA 3UR8A 4TTGA 2YLAA 1MW0A 1BF2A 1C8QA 1VBRA 4GZEA 1W3LA 3I3EA 1XCXA 4CD6A 5EFDA 1XHGA 1V0KA 2XUCA 1I1XA 2ZUMA 1E4IA 2A3AA 1KR0A 1EHAA 1CXHA 3WN6A 4UTFA 2WBKA 2A3EA 1HP4A 2VZTA 4CGTA 4AZ6A 3W4RA 3VGGA 1W1TA 3W27A 5E9AA 1C91A 3OIHA 5D4YA 3VGDA 2YDRA 4HU8A 1GORA 3VM7A 3SCOA 2J79A 3AIRA 5ABFB 1E71M 1GQJA 4AD5A 4A4AA 5ABHA 1GOWA 5I78A 2E8ZA 3W25A 1UWRA 2XGIA 1KQZA 2XWDA 4CD5A 2YL6A 1E6PA 4U5KA 4IM4A 4A3HA 2VX7A 3L2MA 3HU7A 5DMYA 1NARA 1M7XA 1X1NA 2BV9A 1EIBA 5CXPA 2X0YA 1J0ZA 4TXEA 2JF7A 2W63A 3AHVA 4URIA 3WDIA 3AXHA 3FHAA 3L4UA 1CENA 3L4ZA 4LYPA 3UG5A 4J3VA 4TVUA 4CD4A 3O2LA 4V27A 3W29A 1B9ZA 4AEFA 1EGZA 2WM0A 3ARXA 1UA7A 1QNOA 4HMCA 3OGRA 4EK7A 4QDMA 4BQ4A 1B90A 1J0YA 3CUGA 1DEDA 1JF5A 5I79A 2DT1A 1L8NA 2ZICA 1V6XA 2QV4A 1PIFA 5AY7A 3RM9A 4AXNA 4DM1A 4WJXA 1BFNA 3BAXA 3WNMA 2YA2A 3F4VA 2RGMA 4C7FA 5A6SA 2G3JA 3CTTA 3VNYA 1LL7A 2WWDA 3ZT6A 3BAIA 1F4AA 4GXPA 2DT3A 4ACZA 9CGTA 4ZXLA 2VR4A 3WUEA 2J7EA 2ESCA 3SCSA 1GOMA 2X0HA 3SEPA 1UH2A 1OSEA 1V02A 1GZJA 4UOJA 1GVYA 1KFWA 4Z2KA 3UR7A 1OT2A 4DWSB 4F8XA 1TMQA 4GO8A 4AZ5A 3ARVA 1G1YA 4F9JA 1UR9A 2VZVA 2Z1SA 1DWIM 4NRRA 2XVLA 4C7GA 2WC4A 1OD0A 5D9NA 5ECUA 3CUHA 3SCNA 2OSYA 5E0CA 3ARPA 1UG6A 1HJQA 2W62A 2J7DA 1Q6EA 2V3FA 2VMFA 3BLPX 1JD7A 1XV8A 1C8XA 2D24A 1JF6A 3W0KA 1J11A 2ZIDA 3CHEA 3OLEA 3VO0A 1WNOA 4QCFA 1LWJA 2DGAA 1JYXA 1E6RA 5A8MA 3ARRA 3MV01 4ZXOA 3CBWA 4CD7A 3KE0A 3MUIA 1NP0A 1W9VA 3ZJ7A 1V03A 2UY5A 3GXMA 2PBGA 1EOKA 4W87A 1RH9A 1XH1A 3WF4A 2E9LA 5DT7A 1J18A 4C7DA 3WH7A 3AXIA 4HOWA 4OBRA 4DWSC 4OUEA 3WEZA 1DHKA 2HISA 1UZ1A 4JL1A 2GJPA 3U7BA 3WH5A 1L0PA 4P8UA 3WQVA 4YHEA 1CGYA 1MXGA 5LA2A 1QI3A 3NDYA 1WPCA 4HTYA 1ZJAA 4UFJA 3RJXA 1E1FA 3GH5A 1TFVA 1UD4A 1OIMA 3CPUA 4HMEA 5IHSA 3W26A 4AIEA 2G41A 3KZSA 4MNMA 2JEPA 3VGHA 1W3KA 3AI0A 1GVIA 4MB3A 4WKFA 4TVCA 3AMGA 1FH9A 1M04A 3K8MA 1CLVA 4AZGA 3OZOA 5A6BD 2OZNB 2X2YA 4ZE4A 3DYMA 4WLCA 4W8LA 1SMAA 1OM0A 2V3GA 2X09A 2XSAA 3E1F1 1JYNA 3SCWA 2WMHA 1GONA 2O9PA 2YL5A 1JGIA 1BG9A 4TVDA 4J3TA 1W9UA 3GXFA 3SCTA 2WMJA 1FFQA 1MQRA 3B9AA 3L4VA 5AC5A 3AMCA 1WZKA 1E70M 1EQCA 1HVXA 4AISA 2RGLA 1VFFA 5A94A 4KMQA 1Q6GA 2CYGA 3IANA 2WNWA 3B9DA 2G3IA 4GI9A 1UHVA 1W2PA 4KWUA 1E6XM 3WENA 1BQCA 3W53A 1HKJA 5EMYA 1KWKA 1DWGM 4J3SA 1R7OA 2XVKA 5E09A 1JDDA 1UZ4A 3RILA 3AICA 3TA9A 4HA1A 2W67A 2WMKA 3AHZA 2C7FA 3WUFA 4HZ7A 2DIJA 1ECEA 1TG7A 2CESA 3CZJA 2FGLA 3A6OA 3PZUA 1J9YA 1W9XA 3UESA 2C0HA 2BXYA 2ZUNA 1CGUA 3RM8A 1SR0A 2BY0A 2NT0A 1OB0A 2PB1A 1LJYA 4AIOA 1KQYA 3T2PA 4PMVA 2VZUA 1LL6A 4M82A 2V5DA 4P8VA 2DPEA 1E6QM 2B31A 1CECA 3ZOAA 2XSBA 5FIPA 3WDJA 1H5VA 3M7SA 3GM8A 2Y24A 2CKRA 5GNXA 4AD2A 1LWHA 2XIBA 5GNYA 3ZT5A 2X05A 1HJVA 2XVGA 2CXGA 1XSIA 2YOCA 2WK2A 2ZX8A 2WMFA 2JFEX 2V3EA 4CD8A 2J74A 2WW5A 3MU7A 3VX0A 4V28A 1YQ2A 4P7OA 3VD9A 2EXOA 3WH9A 4S3KA 4AC1X 2AAAA 1J12A 2YKKA 1BYDA 5CLTA 1E55A 4AYSA 1E3ZA 2QHAA 3AIVA 3LPFA 3VU2A 1U30A 3RIKA 2BHUA 4OBSA 3TTSA 1IZKA 3HJEA 3AISA 5CZKA 1PX3A 1KBBA 3ZJKA 1VFMA 1K9DA 2J7BA 4HMDA 3S2CA 1E0XA 3N04A 1W91A 5A2CA 3PHAA 3MSGA 1AQ0A 2F8QA 1HF6A 1QVBA 2ZWYA 1B30A 3OLIA 1BGGA 2EJ1A 1TR1A 2DH3A 4MDOA 1ZB5A 4H7VA 1OGGA 3WSUA 3UEQA 1BAGA 5LA0A 3POCA 4M8UA 1VRXA 3EBVA 3VD7A 3WQ5A 1TUXA 4PBGA 2BFGA 2WSKA 4HOZA 3NJ3A 1U33A 4JZ5A 2GDVA 1QBBA 3EMQA 2GVYA 1AQHA 1V0LA 1BYBA 4LX4A 1HKMA 2VR5A 1UKOA 2VOTA 2WCGA 1OCQA 1A3HA 2QPUA 3GXIA 3W37A 3FW6A 4J3WA 1WZAA 2CHNA 3J7HA 1M53A 2GFTA 4W84A 4UQEA 3KWXA 1ODUA 2EPMX 2ZUTA 2JIEA 5A6LA 4MAZA 1NOUA 2A3HA 3TONA 2BVTA 4E8DA 2WMIB 5A2BA 4ATDA 4PSRA 1EO7A 4W88A 4CCCA 2ZX6A 4J28A 4D6IA 3WUBA 2X8RA 1E0WA 1HJXA 2XVNA 1VEPA 1GUVA 2D3LA 4LXFA 5CPQA 2D1ZA 2WLZA 1GOIA 1W1YA 4ML4A 4W7VA 1XH2A 5GQBA 4UQBA 4FMVA 1OIFA 4PMNA 4CU8A 1B3VA 1VIWA 2DSKA 1MWOA 3VIPA 3MSDA 3T09A 2PBOA 3QOMA 3MUAA 1LL4A 4CVWA 3CHCA 3WEMA 3ZO9A 2FH6A 2MANA 3SUSA 3WQ6A 5CGMA 1WO2A 1JNEA 1U2YA 1XD0A 3K8LA 1B31A 2F2HA 1E6SM 3WFLA 3AMDA 4DUVA 5FOOA 5CSUA 1C93A 5BROA 5A1AA 1XYFA 1FH8A 1H3GA 2ZWZA 3AMKA 5BRQA 1TVPA 1PAMA 1PZ2A 4GIAA 3G6MA 1E5JA 4AMCA 2E4TA 1DP0A 3OB8A 4EE9A 1HT6A 3DHPA 4D6HA 3AIBA 1UUQA 1BGAA 3L4XA 1K9TA 3BLKA 3GH4A 3ZM8A 1JZ3A 5KEZA 4Z2GA 2EEXA 2WC3A 4DWSD 1PPIA 1R86A 3ARZA 2CNCA 1ISYA 2X1IA 4N0RA 1UR1A 1CXLA 2WWCA 3CZEA 1KWGA 4HZ8A 4K68A 1XSKA 4AZCA 2VUYA 4PEEA 4L4PA 2DDXA 1ZL1A 2PWHA 3PTMA 1NWRA 1OT1A 8A3HA 3EYPA 5CPTA 4JKLA 2WVVB 3VM5A 4AEEA 4D6GA 1H0GA 1VENA 2Y8KA 3LPOA 3QHMA 2VCAA 2W66A 1E40A 1JI2A 4B3LA 2IUZA 1GNXA 1B3WA 1KXHA 2BHZA 3OLDA 1NOWA 3WDRA 2XTKA 2YA1A 2J62A 8CGTA 1XD1A 4WKHA 2J7CA 3ARTA 2VO5A 1JD9A 4H8UA 1CIUA 5IFPA 2VQTA 2O9OA 3OLGA 2UY2A 4UZUA 4YHGA 1ISZA 1EQPA 3ALFA 1DWFM 2G4FA 5JBFA 1ITXA 2OWWA 2W91A 3AXXA 1GCYA 4QLJA 3WUGA 2EQDA 2XVPA 4UFKA 4OJYA 1H11A 4NI3A 1ESWA 1YHTA 1FH7A 5A6AA 2YL8A 5I24A 3VDBA 3WD1A 4PYSA 1JNDA 2GK1B 2JEQA 3ZT7A 5ABEA 2BNJA 1CGTA 3NUKA 2Y5EA 2XFRA 4LPCA 4W5ZA 2YIHA 4NRSA 2PWGA 3SUUA 4B3KA 4KGJA 1JL8A 1QNRA 2ZUVA 1AVAA 3AHXA 1EOMA 1GOOA 1F4HA 1NOFA 4Q7NA 5DO8A 4E2OA 1E0VA 5BXTA 2EPNA 1R8LA 3W38A 1DWJM 4UFIA 4UQCA 4CKQA 2UY4A 1PBGA 3VIHA 3WBEA 4PMQA 3SUWA 1BVNP 5E6YA 2CITA 2CBUA 3I3DA 3WMCA 1UR4A 4FLQA 3WIJA 5JUVA 3A47A 1CXFA 4AZ7A 3AHYA 1I1WA 1JDCA 4CU7A 5A6BA 4PTWA 4PTMA 4FZPA 1KGUA 2YBTA 1KXTA 3SUVA 3PZNA 4JAWA 4D6CA 3W24A 1GHRA 1GQIA 2JNKA 5GNZA 3ARUA 3ZQ9A 5FD0A 2G8ZA 4PSPA 4D1JA 1JAEA 2NSXA 1X6NA 1UH4A 1DWAM 3ZMRA 3TP4A 4HP5A 4UFLA 1UD2A 4WIWA 1J0IA 5BXSA 1QBAA 5AC4A 3F5KA 1GHSA 1QI2A 2DSUA 4GKLA 2J7FA 4BQ3A 3MV11 1MW1A 1UD6A 3A4AA 4AD3A 1E43A 2Y2WA 1E1EA 2QMJA 4M81A 3FNDA 2IXVA 3CZKA 3K4AA 2V3DA 3ZR6A 1IT0A 1V3MA 4ZENA 1WKYA 1MQPA 3W6MA 3WMBA 3VPLA 4KRUA 1D3CA 1H2JA 4GZJA 4OOUA 3MMUA 4MJ4A 3GTNA 1CDGA 2E0PA 4F9DA 1WZMA 3HN3A 3VVGA 3CUIA 2VRQA 4D1IA 1CNVA 4RE2A 1MVYA 4KGLA 1AQMA 2ZUWA 1V08A 4D72A 1TA3A 4BQ2A 4CN1A 3AIUA 1V0NA 1B0IA 4H2CA 2V5CA 3IJ7A 4MB1A 1JDAA 1EDQA 4IPNB 5A6JA 3WF1A 3PN8A 1QI0A 3BAKA 1B1YA 3VDAA 4W85A 4P7NA 3PZGA 1C90A 2VVNA 4U2ZA 2PMRA 1CGVA 1WB0A 3WF3A 3GNRA 3BC9A 5DT5A 2E9BA 4J7RA 7TAAA 2D0GA 1SYTA 2FHFA 2WPGA 1UR8A 1UWTA 1WDPA 2DIEA 1ISXA 2ZUUA 4HPGA 4BCEA 3AS1A 2EBNA 1QNQA 3QGVA 1CXEA 5I77A 3M6DA 2OLHA 4AZBA 3VGBA 1GJUA 4AZCB 4OIFA 1WZLA 2DQXA 1E73M 3VMPA 4PUEA 1GQKA 4PMYA 3L4TA 3BMWA 4LQ1A 3PBGA 3WELA 4M80A 5C71A 1O7AA 5IHRA 1C3FA 5D8WA 2XM2A 3RCNA 1EH9A 4W89A 1WE5A 4P7LA 4X0NA 2WMGA 4ACYA 2XWEA 3NDZA 5A8NA 3NCOA 1BSIA 1V3KA 5DF0A 4PRWA 3SCQA 1UR2A 3AOFA 5CLWA 3AQUA 4P8WA 5TD4A 1BPLB 2GJXA 4JL2A 1XYZA 4YN5A 4TX8A 2ZX5A 3BSGA 3L4YA 5HDRA 1V3JA 3WDQA 1RD6A 1DTUA 4TOQA 3IAQA 5A6MA 1QNSA 1W3HA 2CCRA 4OOZA 2YBUA 4M24A 4CN6A 4JFTA 3ZR5A 1UYQA 2HVMA 4EKJA 4W7UA 3WF0A 3OA5A 1KXQA 3U5UA 2YDQA 5I23A 2VX6A 1JFXA 3VX1A 2DEPA 4XUYA 2QF8A 2EPKX 4W8BA 1HL8A 1OWQA 3THCA 3W82A 3PZOA 2OO2A 2CEQA 3VDCA 1V6WA 5E6ZA 2FDMA 1MFVA 4AD4A 2E40A 2NT1A 5BWFA 1Q6CA 3AIWA 2G3NA 1GPFA 4D71A 4AZHA 4PMZA 4GQRA 5I6SA 2GJRA 1JXKA 1FP9A 1HVQA 1E5NA 4QAWA 3GBEA 5I3DA 3ARSA 4H41A 1J01A 5D9OA 2WCSA 5IFTA 1VB9A 3F5LA 4ACZB 4MADA 3W6LA 3O6AA 5BCAA 4CVUA 3TTYA 4UOZA 4X0VA 3RM4A 1ZS2A 4F66A 3A4WA 1WCGA 4D6JA 4YPJA 5JBEA 2JF6A 2Z1KA 3EDDA 4CN4A 1BVZA 3VMNA 1PIGA 3MUY1 4B16A 2EO7A 1XH0A 1EA9C 1PJ9A 3MMDA 5A6KA 1R85A 2CERA 2EPLX 1W9DM 3T08A 4TX6A 4MJ2A 3N18A 2DT0A 2VT0A 5I5RA 5BRPA 1PX4A 2JE8A 3NIYA 1WP6A 3M46A 1NH6A 4W86A 2BS9A 4W93A 3II1A 4S3JA 4AWEA 3VDHA 1QHZA 5A8PA 2WCAA 3VILA 3N15A 1OINA 3UETA 3I3BA 3OBAA 3K1DA 1HJUA 1EHNA 2XFYA 3CZGA 3EDKA 3AFBA 3PZIA 3WEOA 2PC8A 2XPKA 2BXZA 4XX6A 3WNKA 1ODZA 3WL1A 1JYWA 5LYRA 4KRTA 5GPRA 1E72M 2D3NA 1E4NA 1UOKA 1UQZA 3PZTA 4LYQA 3VMOA 2D22A 3QHNA 1H1NA 3WD0A 1QPKA 4FLSA 3FAWA 1FFRA 1CTNA 2OWXA 1VF8A 3BMVA 1HIZA 3M07A 3WFZA 4ZEPA 1E4LA 1J0KA 1PX8A 5DFAA 2WHMA 2WZIA 4B15A 2BY3A 2WAGA 2WVTA 3AIQA 1W32A 3L2LA 2UY3A 1RP8A 1TA3B 4OZOA 2A3CA 3BCFA 2DH2A 3W28A 2CKSA 3VIKA 4CU6A 5FL0A 3VIOA 4AY1A 5FKYA 3CUJA 2VCCA 3WQWA 1BLIA 2OSXA 6TAAA 1CXKA 1EO5A 1KB3A
chains in the Genus database with same CATH superfamily
4OGZA 1CW2A 1QMLA 4FX6M 3D2EA 4EZZA 3BG3A 1P0BA 1BHGA 2DUZA 3IUHA 4JHZA 2ZQ0A 4LF2A 1KXVA 1I8JA 2J13A 4WDTA 3EDFA 4S3CA 3T6CA 3RMEA 3R8GA 1R7AA 4DXVA 3O0FA 3K5XA 2D0FA 1P6CA 2GUYA 2ISFA 3F4DA 5REQB 3OVRA 4GJIA 4CCEA 4J3UA 1QNPA 1SW3A 1ZJBA 3HB9A 4MNLA 3N6JA 3GYCA 3REQB 1YPIA 1Q4WA 1XIBA 1N2VA 4JWCA 3LTSA 5FF2A 4ZQNA 5CSRA 1HL9A 2ATMA 4OT7A 3T0DA 2VFEA 5C2CA 3Q65A 5AVHA 3CB3A 3T0BA 2Y8VA 4S3FA 4JLCA 2Z1XA 1US0A 4JNEA 2NQ5A 5I7GA 4JPGA 2OR2A 3KTCA 4HK6A 4UNLA 2DUAA 1TMLA 2EPOA 3Q94A 2XG9A 2WHLA 3QZAA 3VKHA 3TC7A 4Q3MA 3NSMA 1XYAA 8RUCA 4LS0A 4U10A 1CLXA 3BANA 4JTAA 4HY9A 3A24A 1QW8A 4XBKA 3EOUA 3G77A 1KM3A 1WQ5A 4Z2IA 3HG3A 3TSDA 4FR6A 3CL6A 5EB8A 3WNPA 1U22A 5F2LA 3ECQA 1UP0A 2JKAA 4JIRA 4JNZA 1DOSA 4QLKA 3M5ZA 2QCDA 2P0IA 3HO8A 4KCWA 4C90A 4EZVA 3VNLA 3ZZ1A 1V3IA 2WYSA 3NQEA 4KEMA 3MWCA 3SCVA 3CJPA 4DQWA 3MKCA 5D38A 3DAQA 5KITA 1B9BA 1DKXA 3CU2A 4LJ3A 1O94A 3AHTA 1JPHA 4FLRA 1Y65A 2KZHA 2PDKA 1U5HA 4BF5A 4IX2A 2HEJA 5IXEA 4B4HA 3E0VA 4ERGA 5KZEA 4X60A 1H7PA 1A5LC 1SU8A 1XLIA 2BLEA 4LNYA 4Q4KA 1HKWA 4UBPC 4HA3A 3DHUA 1FWSA 5CSYA 1PYMA 4HZMA 2SFPA 1G9HA 4R5GA 4R5EA 3M5XA 3P0WA 4PMOA 4MM1A 4ZMGA 4U31A 4QQ3A 3U7VA 2WC7A 1X6LA 2XSXA 3EX4A 2E09A 2FB3A 3OWGA 3SCRA 1XFBA 4TU1A 1B3ZA 2ZXBA 1PB0A 3RLGA 4FHAA 3ID7A 2FZMA 3W1RA 5LGZA 3K13A 2WVUA 3C2FA 4HQVA 1XCFA 2LXYA 4DCNC 2C13A 4RE3A 4LOCA 4EZYA 3N12A 4DBDA 4IT1A 2HV5A 2TAAA 3KP0A 3SIZA 3WY1A 3BV7A 3NQ2A 2QIWA 1PZ3A 3E2SA 2J25A 4I90A 5RUBA 3WH6A 3E38A 3ARQA 4Q4OA 1QUMA 1TZ7A 5H8UA 3QY7A 4GPNA 2R1MA 1F9CA 1UR0A 4AWTA 3WNOA 5FL1A 2NVAA 2BMBA 3PTQA 1H49A 1GWJA 3EGJA 4H4IA 4YCOA 2OZ0A 4NUWA 1TV5A 1JZ2A 3ARWA 3CUXA 2DSZA 2J6VA 3AJ7A 4C1NA 3BCDA 4C6MA 3W7PA 1P0EA 3EMCA 3OBKA 3W22A 3DDFA 3I65A 1R87A 3NZQA 3AWOA 1VAHA 3OG2A 4DYLA 1DIOA 1OG0A 4ZE5A 2NQZA 4WHBA 4D8JA 1W5NA 1JZ6A 3QE6A 3DH7A 2PWEA 1PTDA 1S38A 4JFVA 2X3XA 1K7EA 1W6TA 2HE5A 3GWQA 2GJNA 1A5OC 2WVSA 2O0TA 1FX6A 3W72A 3B8SA 3B9NA 3W00A 3N13A 2X1TA 3A4XA 3D50A 3CTLA 3VIFA 3M7WA 4GVGA 5K9DA 1KCKA 1ZSXA 1QK0A 4S2BA 1FA2A 3KL0A 3WBYA 3CT2A 3N34A 3D5HA 4FI4A 3HPSA 3C0QA 3DESA 1IIHA 4LGXA 3CQKA 4IPJA 1FWFC 1GYLA 3TCEA 1E9YB 5A3HA 3H55A 4QJ4B 4HR1A 3GHTA 4BWLA 5K2ZA 1Z9AA 2Y62A 4WDXA 3P60A 1P6WA 3G1AA 4C65A 3SSJA 2CWNA 3UWZA 1SUFA 3I04A 2O55A 1JI1A 2NXGA 3UGVA 4J3ZA 5IDIA 3AZTA 3N2TA 1M03A 2YA0A 2QCFA 4I9AA 5HPCA 2XGZA 3FAXA 4Y8FA 4WY0F 3IGXA 3JR2A 3UNDA 4RCXA 3ICJA 3GG7A 3K4DA 2E5CA 4RKAA 1VJSA 2G3MA 3LG3A 3HGOA 1JXJA 1KV5A 1H0IA 3WK0A 2C8NA 2ZUSA 1DJQA 4AMAA 1FP8A 4R9XA 1C92A 1OA0A 1VEOA 2ISSA 4MKSA 5J5DA 2PF8A 3QGKC 3D4YA 3UBPC 4C6OA 4DAIA 2HSAA 2ZTKA 4RJEA 1FWNA 2A0NA 2CLIA 4E8GA 4I5UA 3G1RA 2A7NA 2MUCA 2NWRA 1U00A 5IRPA 2VGGA 5FLEX 3LRKA 3W2KA 5CCZA 2I57A 5CQ1A 4PMXA 1MFUA 4WJEA 1ZBCA 1D7KA 3JZEA 1KFBA 5A8QA 3LGDA 1PDYA 4IICA 3WKZA 4Z2HA 1I2PA 3VZYA 2XISA 5CC3A 4XZLX 1G01A 4F3HA 5LIKX 2CC0A 3CH0A 5ABFA 5T9CE 1R33A 1IT7A 3PJTA 2G95A 4Y7EA 1TE6A 3R43A 2VGIA 4AQLA 2YKTA 3H70A 4WQ6A 3CUFA 4JKKA 4IIBA 3AYTA 1ZCCA 1W5MA 3BW3A 5MF5A 3T2OA 1W8GA 2EAWA 2ISVA 4GXMA 4B91A 2LM0A 1CZ1A 4IIEA 2OODA 4DHGA 2FJUB 4MWAA 3TQPA 1TPC1 3LNPA 1SQ7A 3O9NA 1QWUA 3QKEA 3LXCA 3G1VA 1DJHA 3BOLA 3NPXA 4RZ5A 4ZB0A 2GK1A 7ODCA 1A0CA 1T7LA 4XB3A 1SJAA 3CV7A 2QLYA 3CAKA 1HN1A 3T47A 3BVJA 3SCPA 3W7GA 4DUXA 2YDSA 5M5DA 1UR3M 3SN4A 3NAVA 4KFPA 1G5AA 1V3LA 3P0XA 1V6YA 3VEBA 4LVDA 4GQGA 4I3GA 4O54A 4PULA 4ZODA 2ZXAA 1D8WA 1H09A 3N1AA 2PD9A 3Q0KA 4LWWA 4N4QA 2BX7A 4EZXA 2PWFA 4HYRA 1JG9A 4L5ZA 1TQVA 3GTHA 2GUUA 1GTHA 3BQ5A 1RPKA 2ZXQA 2DP3A 2J7GA 3G8EA 2PCEA 3T4AG 3T9PA 3S2LA 1GOQA 2FHBA 2V5BA 4Q8MA 3V7PA 3ZJ6A 1GKPA 4H9ZA 1OGSA 1JZ5A 4YJ5A 1CB7B 1HKIA 1R0MA 4M51A 2PWDA 1EYWA 3R11A 3B40A 4MNJA 1TZ9A 1SU5A 4A3UA 2GVLA 2V38A 2PDXA 3FN9A 4H04A 1C8YA 1US3A 3AALA 4R53A 1S5TA 4GRSA 1SMDA 3VIJA 1A80A 1ADSA 1KTCA 1AODA 1RBOB 3CMGA 1JIBA 2Z1VA 5EFFA 1UD5A 4U2YA 2QW5A 2XJ7A 4EXQA 3FVDA 1HTYA 1OADA 3O3NB 3GU2A 3LZ3A 3OTRA 1FQ0A 3LI1A 1TCMA 4RL3A 4XD3A 4HBKA 1R2TA 3DPQA 2WZEA 2CETA 2ZA1A 3RYSA 2NV2A 2BP1A 2I14A 4N6FA 4E2DA 4R27A 1EL3A 3HTWA 2AGTA 8XIMA 1KGXA 5F2IA 4HR1B 4FA3A 4CNNA 2ZE0A 5KZ6A 2FFIA 3MO4A 4U5IA 1FKWA 3DFOA 1I2NA 3BOFA 2UWFA 1DJYA 1MSSA 3OGVA 3MI3A 3B05A 2PWVA 4D6FA 4DWDA 4FNQA 3SRFA 5H8PA 4I1QA 1RAKA 3BPWA 3A4JA 4HHPA 1V77A 2OYLA 3QBUA 7CGTA 1XISA 1VR6A 3IJ9A 1W8SA 5JBDA 4ROQA 3ZYZA 3TYCA 1P1MA 1TQJA 1T96A 2V2DA 1K9EA 4YTRA 2JIWA 4S38A 3WLHA 4PTVA 1XINA 1LG2A 2BVDA 4H8VA 3ONBA 3PZMA 4P2VA 2GVJA 1A49A 3NPUA 1AD1A 1XCWA 4D6DA 3TTQA 1H4PA 1M01A 2CZ5A 3BW2A 4FNUA 3AXKA 4WCJA 1T5AA 2VGBA 3S1WA 1ZBWA 4IWOA 4XKYA 4FX8A 4IG2B 3EKLA 4PUNA 4QROA 3DC8A 4I9JA 1MW0A 1C8QA 3LTPA 3S5NA 2ZVRA 1Z42A 1V0KA 4XVEA 3S2JA 4B92A 1E4IA 4C6CA 2R94A 2QPXA 1KR0A 5EBUA 1CXHA 2ZA2A 3LB0A 4GUGA 3O6DA 3U4AA 3WN6A 2VDHA 3G0UA 3KDNA 1SSGA 3VNDA 1FWWA 3HA1A 1AW5A 3NL3A 4AZ6A 4JTHA 4CQCA 1W1TA 2YYTA 4ZGYA 3HM7A 2HMCA 3U2CA 1EZ2A 1PKYA 4J2MA 2Z29A 4R5LA 1YIXA 3MCOA 3OQ8A 2P1FA 3SDOA 1VBGA 4QE5A 2XN1A 2J79A 3WMLA 4LUYA 5ABFB 1GQJA 4I6KA 3D3FA 1XYMA 1E0TA 2XWDA 5TIMA 5AFDA 3O06A 4A3HA 3PVFA 1FRBA 3RV1A 3CAVA 4GC4A 1X1NA 2YCLA 2QR6A 3D6NA 4H9XA 4LALA 2JF7A 3ATYA 3FHAA 3VKCA 4FOKA 3BV4A 3DCPA 4MWAB 3WBWA 4TVUA 5HNUA 1EBHA 3BO9A 4O53A 1B9ZA 1IWAA 4AEFA 3IVUA 1P43A 2XIJA 1QNOA 4O19A 3OGRA 1NTHA 1DQXA 5I79A 3FEMA 2DT1A 1L8NA 1ZTVA 4UMAA 3RM9A 3O6CA 4AXNA 4WJXA 3BAXA 3WNMA 3B9OA 4C7FA 4WD0A 3M1ZA 1LL7A 4GXPA 2ONEA 4DJFC 3W6YA 3CLMA 1JRBA 2B7OA 3T42A 2DZPA 4JDBA 1UH2A 4YYCA 3VYLA 2RAGA 1K77A 2YCKX 1QDSA 3P62A 2CZVA 3V16A 3G3MA 2XIQA 3KOYA 3G8RA 2FZNA 3S42A 4NRRA 4XWUA 1GNTA 4C7GA 4IXXA 1EX5A 4Q8OA 3KCOA 5D9NA 3SCNA 2OSYA 1GVQA 3C7NA 1VPQA 4IFKA 4DZIA 3NEHA 3L0KA 3C6CA 1HJQA 2J7DA 1VD6A 4LSBA 2V3FA 3C5QA 3BLPX 2C16A 4F2UA 4EPBC 4KBXA 1C8XA 2D24A 4PUWA 1KKRA 1JF6A 2WJDA 3LYEA 3S0CA 3U2OA 4NAFA 4L1WA 3LNMA 4N4PA 3S6OA 1JYXA 3ARRA 2NCZA 3MV01 4CD7A 4LVBA 3ZJ7A 5CZJA 3T44A 2UY5A 2PDYA 4W87A 2AQOA 3W1NA 2FGBA 1F3EA 2E9LA 4DRSA 2HROA 1B57A 4OBRA 2BB0A 1O68A 1DHKA 2OU4A 2V5KA 1UZ1A 3WH5A 1L0PA 3NQ6A 4PBEA 1K8YA 3W74A 5FJUA 5LA2A 3NDYA 2YW3A 1KO0A 4IWWA 3RJXA 5CJNA 2DW7A 1UD4A 1OIMA 4NZFA 1QWKA 5DX7A 3PWGA 1WDZA 3MT1A 5I3FA 4MNMA 3RV0A 1GVIA 2EKGA 3LGGA 2W79A 4DJDC 3W7IA 3OP2A 4S2CA 1M04A 2FMOA 3K8MA 1ZP3A 4AZGA 5A6BD 1XDJA 3ER9B 3EPNA 1BXBA 3EA3A 5BU6A 2V3GA 4C60A 3BLBA 4HCDA 4E2VA 3SCWA 1PIIA 2O9PA 1X6UA 5E84A 3UR5A 3SN1A 2XH7A 2NVDA 3MC5A 4B5XA 3GXFA 4O1AA 3SCTA 4NXSA 3L4VA 5AC5A 3MUXA 5BRBA 3UPBA 3TXVA 1E70M 3CXOA 4L9YA 1EQCA 3BICA 4JN4A 2FYMA 1A5NC 2PTYA 2CYGA 2E6FA 4HNNA 3FS2A 3EXRA 4GI9A 1W2PA 3MKVA 2ELBA 1KFCA 5EMYA 2W3ZA 4KEZA 1R7OA 1JDDA 1XIGA 1SZRA 4QEEA 3RILA 3AHZA 5BOOA 2CLHA 1X97A 3WLQA 1I9CB 1Q7MA 4FM3A 3LQGA 4MZ8A 2DIJA 3OYXA 1J9YA 1W9XA 4F0KA 3TH6A 2FDSA 2ZUNA 1ZGDA 2GQ9A 3RM8A 2R1KA 2P10A 4XIAA 3T2PA 1V8EA 1G69A 2AMXA 3L7RA 4P8VA 1E6QM 4H1ZA 4OV4A 4JEJA 1CECA 2YCLB 2GL5A 5FIPA 1H5VA 2IQDA 3RLUA 1RBLA 3STFA 3W7CA 4AD2A 1MZHA 2XDFA 3L66A 1QO2A 4ADSA 4DBEA 2XVGA 1XSIA 2YPIA 2I7GA 2X3WA 3OZYA 2WK2A 4L9ZA 1I6NA 3CQIA 3QLLA 3KBNA 3YPIA 3LBOA 3GDRA 4S3KA 1NAL1 2AAAA 3VOFA 3MVTA 1KKOA 1E55A 1E3ZA 1XIDA 3VU2A 1LOSA 1M41A 3HJEA 4C5YA 3WZ0E 5CZKA 1V4YA 1VFMA 1K9DA 5A2CA 3PHAA 2VD9A 4GNKB 3FA3A 1HF6A 5AC6A 1BGGA 1XM3A 1KV8A 2DH3A 3ACOA 4LU0A 2RJHA 1L9WA 1EJ7L 3UEQA 2FICA 1H5YA 3POCA 1VLIA 4QISA 4QRNA 4XQ6A 1X03A 1XFCA 3UWVA 3QTGA 4IFKB 3LU2A 2VP8A 3SQLA 2G37A 2BWGA 3NJ3A 4Q6XA 4D9PA 2FKPA 2HBVA 4MZYA 4LX4A 5KTLA 3U0HA 5FSDC 5AHNA 2VR5A 1LDCA 2VOTA 4MYXA 2G96A 1JQXA 3W1LA 4MUZA 2OTDA 4HPNA 2QPUA 5K3VA 1E9ZB 3GVGA 1LOLA 4J3WA 2CHNA 4CQ9A 1M53A 3HURA 4W84A 4BFAA 3S47A 1R3SA 2DY3A 5CJMA 3T05A 3KWXA 1ODUA 4DI9A 2VFFA 1JGMA 2JIEA 3KCLA 4QSHA 1Q45A 3FVMA 3VKAA 3LLDA 2OCZA 3I7SA 1E2UA 4W88A 3NVDA 5G2WA 3WUBA 1OFEA 4NSWA 4NAEB 1HWWA 5LXXA 1VQTA 4HKPA 3CPGA 1I4TA 2WLZA 1GOIA 1W1YA 4ZO8A 4HNVA 1XH2A 3SR7A 4S39A 2F7PA 1R3VA 1Q7ZA 4DVOA 3QOMA 3EB2A 3MUAA 1UC5A 1URUA 4CVWA 3LN3A 3OK8A 3CHCA 3ZO9A 2MANA 5CGMA 4B3ZA 4M1BA 2OOGA 2GGGA 3P74A 1PYFA 1B31A 2F2HA 1HGYA 4O10A 1C93A 1E9VA 3EA1A 5BRQA 2W0UA 1PAMA 1PZ2A 4KQNA 4JWEA 4GIAA 3RNDA 4UR8A 1E5JA 3OB8A 2B0MA 5AECA 2QZRA 5CZSA 4D6HA 2AQVA 3GH4A 1XIHA 4Z2GA 3EWXA 1PPIA 1Q6QA 2PS2A 3Q2DA 3LSCA 1EP1A 4XBSA 4HZ8A 3QEZA 4K68A 2YFNA 3TLLA 3N3TA 4AZCA 5JH1A 1MZRA 4L4PA 2GGEA 3PTMA 3G0SA 1C29A 4C1KA 3NQGA 2WVVB 3F2BA 1IT8A 2Z6JA 2ZZ7A 4D6GA 2Y8KA 4A2SA 3S5OA 2QYGA 3BE7A 2HS6A 1E40A 5FJJA 1GNXA 2G3FA 1VGAA 3EWYA 3V0SA 4M19A 3HMJG 1LOQA 3AUJA 2QVHA 5FEWA 5H2ZA 1UJQA 3RX3A 4A8LA 4H8UA 1CIUA 3CM4A 1KNWA 3OLGA 2UY2A 2GSEA 2PDBA 3P7YA 1EQPA 2V5LA 1XR2A 1DWFM 4KFNA 4LUJA 1SZFA 3B51X 3AXXA 2PP1A 2C0AA 2EQDA 4WOQA 5E93A 4OJYA 3C0LA 4NI3A 4JIPA 1ESWA 3DFSA 5A6AA 2P0OA 2YL8A 2C79A 3LCWA 1I0BA 2PLJA 3WD1A 3W1AA 4PYSA 1OJXA 3P61A 4L80A 4YTUA 2XFRA 2OBMA 1UZDA 4LPCA 4B5TA 4NRSA 2Q3OA 1QNRA 1AVAA 3VKJA 4Q7NA 4E38A 1R8LA 4ICNA 2YIAA 1HL2A 5CAKA 3W38A 2N3KA 3PAJA 4KW2A 3TN4A 5H91A 4XZMX 2Q3RA 1OCNA 4JQ3A 1OFPA 4FPSA 3P81A 3WBEA 2XZ7A 3GE7A 3PNZA 3SQMA 1BVNP 4C6IA 2PZNA 1K1DA 2IPFA 3WMCA 5EA9A 2GWGA 3F4CA 4LS1A 5JVLA 1EF3A 4MKNA 4N9DA 4PTMA 2YBTA 2WYHA 1T8QA 1RY0A 3XISA 3PZNA 2J9ZA 4JAWA 4D6CA 1JUBA 1GQIA 2RDTA 2GYIA 3ABOA 4FNRA 5C0QA 1X6NA 4A21A 2OLSA 1UH4A 4E81A 4HNLA 3TP4A 2HK0A 4UFLA 1UD2A 5BXSA 4R3UA 3F5KA 1GHSA 3RLVA 5U4NA 1F07A 4IP7A 1OC6A 1MW1A 1UD6A 3E02A 3WCZA 1E1EA 3W71A 2QJIA 1J93A 3FNDA 4M5PA 5D02A 3S5SA 4XAZA 1IT0A 1GKRA 1GPWA 1Q66A 3W6MA 3W7MA 3TTEA 4AHPA 4B5NA 3WMBA 3KVLA 4RUBA 3GTNA 1CDGA 4F9DA 4AG0A 4A05A 4UTUA 2AKMA 4ASTA 4YNGA 3ABRA 2H9AB 3QVQA 2V0TA 4KGLA 2PDWA 2ZUWA 4DO7A 4KPLA 1TA3A 5MKGB 3DDMA 3AIUA 3M5YA 3HPAA 4H2CA 5FJIA 3IJ7A 4MB1A 1QI0A 3BAKA 2A1YA 1P7TB 4P7NA 1WKDA 4U2ZA 3W70A 1V7AA 1WKFA 1PS3A 3W23A 2FHFA 1ISXA 2ZUUA 5I77A 2DUXA 2OLHA 1AQFA 4AZCB 2PURA 5AKQA 3QGAC 3VNJA 1TELA 4H8NA 3VMPA 4PMYA 3C61A 2QNEA 3FSTA 5AOUA 4IGMA 4M80A 4PB5A 5FF4A 4DZ5A 4CQDA 5C71A 2OMAA 3N14A 5IHRA 2G50A 5EMMA 1WE5A 4X0NA 2WMGA 4ACYA 2XWEA 5BW6A 1ZNNA 3NCOA 3VOJA 3ITVA 5DF0A 3SCQA 1XKYA 2VM8A 1UR2A 1KFEA 1FCVA 4P8WA 5D09A 1DIKA 1TV4A 2GJXA 4TMCA 4OQVA 4O0QA 3HAJA 5LNUA 4TX8A 3BUBA 2Q8ZA 1EXBA 5GJNA 3L4YA 3QFWA 2QGHA 4JWDA 3B03A 1QNSA 2CCRA 2G0WA 1OA1A 4ZQOA 2OJPA 1FHUA 4LW7A 1UYQA 3PUEA 3V36A 4W7UA 3OA5A 4GUFA 3WLJA 2EKCA 2TRSA 5I23A 4MF4A 2VX6A 1D8CA 5HUPA 1R6WA 3I01A 2PDCA 3W82A 2CEQA 1V6WA 5E6ZA 1FWRA 3GC4A 3A13A 1DXIA 2FDMA 3TYUA 1ZWWA 5FAJA 1Q6CA 1GPFA 2E7FA 2QUUA 5E0KA 3UQNA 2HDJA 4AZHA 3OJGA 1EP2A 2OO6A 1SM9A 3LZ5A 2YDAA 1O12A 3TJIA 4XBJA 2QCMA 4JXCA 4WUIA 1TQXA 5I3DA 4H41A 4I5XA 1IGSA 5IFTA 4KETA 4ZQRA 4YS1A 3W6LA 3NQ7A 5BCAA 4X0VA 1WCGA 1S5NA 4DJFA 4GX9A 1K4GA 1F2JA 3EDDA 3HGRA 3MUY1 4B16A 1KCZA 1XH0A 3JVAA 1HG3A 4BNEA 3TYZA 2CW6A 5DCEA 3PTDA 1W9DM 2GF4A 3PR2A 3B97A 2X3VA 3DU0A 4TX6A 4GA8A 5G1YA 1A5AA 4DYJA 1PX4A 4QHRA 3NIYA 1WP6A 4PB4A 1A3XA 3C56A 4A22A 4DEFA 3II1A 5JMUA 3VDHA 2Z6IA 1QHZA 5A8PA 4WY0A 3O05A 3TWAA 1OINA 3P82A 3W7KA 2ZFAA 1EHNA 2DFAA 2XFYA 3IK4A 3CZGA 3EDKA 1B54A 4ZL1A 3AFBA 2PDFA 2BXZA 1QTWA 1ODZA 1Q2SA 3E2RA 1JYWA 4IP5A 5HMDA 1E72M 1UOKA 2INFA 3KBVA 3PZTA 1H1NA 4MIMA 3GKFA 3FFSA 3B8DA 1FFRA 2BDQA 4XTIA 1TR9A 1HIZA 5G1MA 4ZQPA 2WHMA 3PB2A 1F74A 2Y85A 2WAGA 1W32A 3L2LA 3B4YA 1TA3B 1EJWC 3QMTA 4YLWA 1HFBA 4I9MA 1U1UA 2A3CA 2DH2A 4GYKA 3W28A 4CU6A 4NXKA 5FL0A 3KOFA 4AY1A 4IM3A 4R5KA 3WQWA 1BLIA 1GTEA 2Z0NA 3FKRA 5KBPA 1KB3A 3R79A 1UH3A 3QYSA 3URNA 3SQSA 1I2QA 4PUUA 3ZJ8A 3FHQA 2VDGA 3PUGA 4IJCA 4LY8A 4C6QA 2QFFA 3EJUA 4GABA 5J5RA 3M0IA 4DB7A 2XH0A 1EDGA 1GN9A 4C6NA 2QS8A 1A5SA 2VFIA 4E4PA 3OVGA 4FZOA 3TEVA 3PZQA 4XAFA 1TPB1 3UR2A 2G5WA 1YDNA 2DZSA 1I4LA 4MFDA 1E3XA 1QOXA 3WO8A 3C3UA 2J66A 4B9ZA 5ENLA 2X42A 2OEJA 4KFOA 1OABA 4QR6A 2YXXA 5B7ZA 5D05A 4BEUA 1XRVA 1TSIA 2PI6A 4MPKA 2VKZG 5G1TA 4JN6A 4IL2A 5M3WA 1V51A 3W2NA 2WLYA 1I2RA 2JGYA 2FVKA 5T8GA 2QJJA 3L68A 1IR2A 4TUFA 2DSVA 1W1ZA 4XZBA 4GE8A 3NGJA 5G4EA 3TYBA 3IAPA 3AS2A 3BAWA 3STGA 1XSJA 1YEYA 3MBFA 4NJGA 5J8LA 2D1LA 3CNYA 5B7YA 2RH9A 3H54A 3OHMB 4MDPA 4E0CA 1IIGA 4GG9A 5CG0A 3WQPA 4AVMA 1HQTA 1CEOA 4KWVA 2PTWA 3OGSA 4C5ZA 2VQUA 5I06A 3K4WA 5C6MA 1VJIA 1R34A 2QCLA 8TIMA 2EGZA 5F1VA 1DTNA 3WNLA 5IOBA 3F5JA 2IMRA 4AKVA 4HNTA 1ZENA 1OYAA 1Q63A 4HA4A 1JCNA 3MI2A 1V5XA 3T48A 1HP5A 3W7QA 4Q8QA 2GWNA 4H01A 2BOGX 4DUWA 3OIXA 1OFOA 4WOZA 4YWIA 2VCBA 3CYVA 5CPOA 2VC6A 3HFTA 1XYCA 3GBDA 5G4WA 1NDVA 1J5TA 1UWQA 3WK3A 4XZ9A 3EB3A 3ENLA 1ENUA 1BXCA 2DSWA 5LA1A 1EUNA 3MZNA 4XIMA 3IPWA 4EANA 1SU7A 2VFHA 3DFHA 1GYNA 5FJPA 3WK2A 1NFBA 2UV8G 3W2JA 5AYZA 4JIHA 4QLLA 1QCWA 3PAOA 3GI7A 1K8ZA 1ADDA 1TKKA 3B0VC 3TR9A 1UKSA 4L61A 2XIMA 3DPOA 2WKGA 3C0JA 1V6UA 1LBFA 1HXJA 1S2UA 1OFRA 1I49A 3OEXA 4WR3A 3F1QA 3RPMA 1O6IA 2Q71A 1Z32X 1PKLA 3MMTA 2C71A 1L6FA 1LF1A 2FTWA 4PFMA 4LY4A 2W6RA 1Q65A 1ZFJA 3EOEA 1TQTA 1K9FA 4XG1A 1A3WA 1TPEA 2O0I1 1TE1A 2Y4SA 3CZ8A 3KEHA 1HKKA 4ZOEA 2C08A 2PDGA 1CYGA 1PS9A 3S3GA 1DQWA 2AMGA 5C2GA 4M7TA 4IIFA 4P7RA 3OHXM 4ZVJA 3G2GA 3T7VA 3STEA 1GVFA 3ZVIA 3CAQA 3DX3A 1EZWA 1LT8A 3OOQA 4XZWA 5HJXA 1JFHA 4QITA 1ZLPA 3VZXA 5TBOA 4DM2A 4JFWA 1XPGA 4JIQA 2ZX7A 4FF7A 3DERA 2C18A 1FWBC 2CLOA 3KOZA 3QHOA 3VC5A 2JKEA 3LBMA 3C8FA 3N17A 2X30A 3NL2A 5AC7A 3PJWA 1FWEC 5AYIA 1MNSA 5GJPA 3WNNA 4C1LA 2A7PA 1F6KA 1ECQA 1Z48A 4H19A 1K02A 3GDBA 2ZRVA 1F05A 3BTNA 5LHFA 3TKFA 3B0YA 4FS9A 5HMFA 1O7DC 1DXEA 7TIMA 4J35A 1TPFA 5I2UA 1E56A 4K7VA 2DT2A 2BHYA 3FXYA 3LS9A 1O5XA 1CT5A 3VD5A 3KDRA 4EZWA 1JAKA 1CGWA 2QJGA 4N9CA 3MPGA 5F4WA 5G2HA 1GJWA 3AS3A 2R1LA 3LCLA 1J0JA 1RD5A 3GG1A 1G4SA 2R1PA 2ACRA 1XPYA 4LV9A 4F79A 2W92A 3CO4A 1W2VA 5TNVA 4RZ4A 4P61A 4WPCA 3K8KA 4BZYA 1BRLB 2DV0A 1SO4A 4IUOA 1WDRA 3KX6A 5L9FA 1JZ4A 5LZLA 2Z2AA 1JDEA 1IEQA 2VURA 4JCLA 2W4XA 1EXPA 1G0CA 3K30A 4JTIA 2VL4A 2CWXA 2VFDA 1CPUA 2H8ZA 4HPHA 1TB3A 3CHDA 2BVYA 3MSYA 3GAKA 2WKLA 4M56A 3C3NA 1EPXA 4HTBA 3WMSA 3TAKA 4QE4A 3MS8A 3VABA 1KM2A 1I2OA 5HMEA 5BWAA 4JTUA 1Z8AA 1OF8A 3POHA 4MVAA 1P48A 4UUIA 2F84A 3IIZA 3W76A 1XS2A 3TR2A 1NVMA 2VEGA 4HZ6A 3G1FA 1ONRA 4JCMA 3DN5A 3ATZA 3EJPA 5AYBA 1LRNA 5AHEA 5HOSA 1YMYA 3WQDA 2C91A 4WF7A 5M03A 1UA3A 2H90A 4MB5A 4LVAA 2IXUA 1D7FA 1R2SA 1CB2A 1AFSA 1G94A 1YTDA 2X7VA 4BA0A 1L6SA 1XBZA 1PCWA 4JTTA 3CMFA 2CLEA 5U7SA 1ELSA 1UD3A 3NSNA 3WDHA 2WSPA 1KR1A 2D0HA 4Q7IA 6A3HA 2OYKA 1F76A 3MUZ1 3H2MA 4ML9A 3RMJA 4Q4RA 4LAZA 2XINA 1TQSA 3UZYA 4C91A 4L4OA 1QK2A 4D8LA 1O66A 1Q13A 3QW3A 1AMYA 3RITA 3KDOA 3AYSA 1K7XA 4PTXA 1QI4A 5CPSA 3UVAA 4NP7A 1WAWA 4WGXA 4WPEA 1NQ6A 4DWSA 1IEWA 4IGNA 4US5D 3CV1A 3GRIA 3QR3A 3UJEA 2ACSA 4MY8A 3VKKA 3D47A 1G7VA 2VRKA 1PCKA 2Y6ZA 5HPOA 1J8VA 1YTEA 3QOKA 3KM8A 3MKKA 2QKFA 4QQUA 2VTFA 1W37A 4GZIA 3H7RA 3KHDA 1X1OA 1MQQA 3BAYA 1VFUA 1O5KA 1TWZA 3CEUA 4E3TA 1OBAA 4RW5A 3W2LA 2J88A 3LV6A 3M5VA 5DMLA 1JULA 3NSXA 3M0KA 3GLCA 3VIIA 4R5IA 3NZRA 1BD0A 4EAYA 5EL1A 1MXSA 1QPQA 1AUSL 3ABSA 4ZQCA 2EFLA 3E49A 4V33A 1VFTA 3U57A 3WLLA 1C9WA 2OB3A 1F73A 1UWUA 4PMUA 4GQQA 3D3AA 2EF9A 4GQ0A 5HQEA 4GVFA 3WH8A 4GINA 1MXDA 4AWUA 5XIMA 5LXEA 2OVLA 5AHMA 1ISWA 3OBEA 4AF0A 4OVXA 1V93A 2XM1A 2E28A 4GWEA 3TC6A 3CKDA 5KZDA 3VTRA 3RU6A 2ZZ6A 3I7RA 1ZU8A 3QR0A 4HYBA 1TVLA 3OZPA 1VJZA 1LQ0A 4H9UA 3WQEA 1QXLA 4GIYA 3KLLA 3U6WA 3TOYA 3W7NA 1JZ7A 4PTNA 2NQHA 1YE4A 1DIEA 3UCQA 3HBLA 2YZ5A 2HVNA 3JW7A 4GJ1A 2PF0A 3UU0A 7A3HA 3QC0A 5HATA 4AX6A 1FHLA 2GQAA 2OW7A 2NQ9A 1R9YA 2TSYA 3MCMA 3G6LA 3F2CA 4QDWA 1DWHM 3AJXA 4BWLC 3AMLA 4LV4A 3QQ1A 3BVWA 1U83A 3S6DA 2P8CA 4EZTA 3VD4A 2IKGA 4WDUA 3ERPA 2Q01A 4FB7A 1QRQA 3I3EA 1XCXA 5EFDA 3JU2A 1XHGA 1M7PA 1EHAA 3DI0A 4N7QA 4EIVA 4I7UA 1ADOA 3U3HA 4WXZA 5AZ1A 1H51A 3LV5A 3EWZA 3VXGA 3H2FA 2VD8A 4XO6A 5E9AA 5HINA 1A5KC 4K6AA 5D4YA 4B4FA 2YDRA 3HGSA 4O0ZA 1GORA 4NQIA 4H9VA 3B8TA 1E71M 4A4AA 5ABHA 2DIKA 2E8ZA 1UWRA 2HXUA 4EF8A 4IM4A 3NA8A 1UW9A 2QCEA 2L5HA 5DMYA 1M7XA 4NILA 4MPQA 2GGJA 4Q8WA 2W63A 3AHVA 4URIA 5E5CA 3WDIA 4MHBA 4F0RA 4BF9A 4LYPA 3UG5A 4J5NA 2CLFA 3EXSA 1F3WA 4UTTA 1RHCA 3W29A 3UJRA 1EKOA 1W0MA 1EGZA 3GIQA 3M0XA 3E12A 1XBYA 2VDIA 4EK7A 4BQ4A 2P88A 3CUGA 1DEDA 3PY2A 4B5WA 2D4CA 2QV4A 1PIFA 1LQAA 3TA6A 3SADA 2PTDA 3T81A 2GQ3A 3QH2A 5DY3A 2A2IA 3KVKA 1TTPA 2YA2A 1XLDA 3NXLA 3C2VA 3ZT6A 3S9ZA 3BAIA 9CGTA 3TK7A 4ZXLA 1D9EA 4IMFA 3OYZA 2J7EA 3SCSA 1XLAA 2YW4A 2BOFX 3SEPA 1V02A 1GZJA 5C2XA 1S1RA 1KFWA 4IH3A 4MWAC 4U4MA 4DWSB 7REQB 3H6OA 1B5TA 4AZ5A 4NX5A 3ARVA 2XVLA 3LRLA 1DORA 3NGFA 3BJTA 1UG6A 1Q6EA 2VMFA 4IP4A 4OTKA 4RX0A 3RUBL 3W0KA 1J11A 3OLEA 1NF7A 1WNOA 2ZBTA 5AHLA 2DGAA 3ERCC 3OODA 5HWJA 1J6PA 5D32A 3TNBA 4F0SA 2XZ9A 3TIMA 4JTJA 3SOGA 1V03A 5CBJA 2RAJA 3H12A 2PBGA 1EOKA 1XH1A 3S1UA 1M6JA 1QOPA 1PV8A 3AXIA 4HOWA 4XZNX 2ZE3A 4RV3A 4Y2WA 4Y9NA 4Z08A 3U7BA 3LEPA 4QJ3B 5C9UA 1MXGA 3MVIA 1QI3A 1WPCA 3O3RA 3HQNA 1OC7A 4HTYA 3GDTA 1TFVA 4O15A 2WNZA 5H6HA 3SYVA 1ML1A 1KLZA 2D2GA 4UC5A 3W26A 5IHSA 1NQKA 2Z27A 4CNTA 3DG7A 1NFPA 1X98A 3ZVHA 4AXKA 3VGHA 3BLEA 5D30A 3KRBA 3UWYA 1ZAIA 4E3CA 1FH9A 2PZ0A 2HE8A 3DX2A 3SFKA 3Q4DA 3O8AA 4WLCA 3I4EA 4MG4A 2XSAA 1XYLA 1GONA 2YL5A 3MHFA 5HANA 3VK5A 3B4UA 1QAPA 2GLKA 4J3TA 3SRDA 1S5VA 1S5MA 2VC5A 4LCQA 1YE6A 1SO6A 4Q8TA 1MQRA 3B9AA 3TQ0A 1WZKA 1HVXA 3HG2A 3S5YA 1F6YA 3BW4A 4AISA 4KCVA 5A94A 4KMQA 4KWOA 3IANA 2BTMA 2EJAA 3EJRA 1UHVA 3LLFA 2AQWA 1HKJA 2PDPA 1DWGM 2X1SA 3N6QA 2XVKA 3QQWA 1SFLA 2ZADA 4NJKA 2V69A 2I5IA 3REQA 2W67A 1RV8A 2C7FA 2WSYA 1M68A 1TG7A 2CESA 5IM51 3CZJA 2YIBA 2FGLA 3GY1A 1UPXA 5KETA 2BXYA 4DPPA 1FXPA 4YYFA 3R25A 2BY0A 2NT0A 1OB0A 2ABBA 3D2FA 1KQYA 4PMVA 1HXKA 1LL6A 2DPEA 4JICA 3GVWA 3GVVA 1B4KA 5G2IA 1P4CA 1OX6A 2Y24A 3MZ2A 3RX4A 4RZ6A 3M0ZA 4EZNA 3DXIA 4O1BA 3PJUA 2CXGA 4C6EA 2YOCA 2NSOA 2ZX8A 2JFEX 2J74A 2WW5A 2R91A 3MU7A 3VX0A 4H6HA 1PZ1A 3TX9A 4DBWA 4FXJA 3BUQA 4DX3A 3GX9A 3L12A 5CLTA 4AYSA 3W83A 4ORMA 3RIKA 3UYCA 1IZKA 1WA3A 3AISA 3KTXA 1PX3A 1UZHA 5FJOA 3ZJKA 4DXXA 2CLMA 2J7BA 1E0XA 4PFHA 3EWUA 1W91A 4NNBA 3Q67A 1ONEA 1KRAC 4EF9A 2CFFA 2F8QA 1AQ0A 2ZWYA 3TV8A 4EWND 4NJHA 1B30A 3OLIA 3IACA 1TR1A 4PEKA 5TF0A 1R2RA 1UBSA 1ZB5A 4H7VA 3I6EA 3K1GA 3QY8A 3Q45A 4IF2A 3VZZA 1BAGA 5LA0A 3S8HA 2NXIA 3EBVA 3WQ5A 1Z69A 3MDWA 4PBGA 4UDYX 2WSKA 4HOZA 4JZ5A 5C9ZA 3R5EA 1T40A 4R9OA 2QAFA 2GVYA 4GACA 4KIRA 1AQHA 4IOTA 4V1YA 4PRTA 1XIFA 5C7HA 1LM1A 5EGRA 1QNVA 1UKOA 5BZAA 4ZSUA 1A3HA 2ZYFA 1T0OA 1YXDA 3E0FA 1WZAA 5C5BB 3VA8A 1WKEA 3CV2A 3ES7A 3M0JA 3LHVA 3F7JA 4M6QA 5AZ0A 3UA3A 3IVTA 2CU0A 4NNCA 5CGQA 5A6LA 1Z3NA 2GAFD 2A3HA 3TONA 2BVTA 3PNUA 2WMIB 5A2BA 1NU5A 4PSRA 5DCBA 4CNUA 2OEMA 2ZX6A 4DJFD 4I8YA 1DL3A 3CZNA 4F2BA 1WOBA 1E0WA 2XVNA 2OKTA 2D3LA 3ZVHB 4R7OA 3CV5A 4ML4A 4W7VA 3EEZA 2PDMA 4UQBA 4FMVA 1PWMA 1VIWA 1LZOA 4BEQA 3ORWA 1TWSA 2INZA 4IMCA 1XLGA 3MSDA 5CPLA 3T09A 2PBOA 3KXQA 3HF3A 2MNRA 4QGCA 5JU6A 3TXZA 4NQ1A 4DF0A 2FJKA 1XRFA 2FH6A 1AW2A 1JNEA 1XD0A 1LUCB 3K8LA 3LLXA 1XXXA 4NU7A 1E6SM 4Z1CA 4DUVA 3AMDA 3KBSA 1QWNA 5D2VA 5A1AA 1SVDA 3SY1A 4GH1A 2F2KA 1YXYA 4UMCA 2FMNA 3DHPA 4LCSA 3GB6A 4HVXA 2OBLA 1BGAA 1K9TA 3QV7A 1IEIA 3ZM8A 1JZ3A 3QKZA 5KEZA 2BGQA 5MHBA 1KRCC 1NIUA 3CEPA 1I0DA 5HWNA 1Q6OA 2Y7EA 3E74A 2CNCA 2X1IA 4L6DA 5FEZA 4FNSA 4Z0JA 1CXLA 2WJEA 4L9XA 1KWGA 3PPCA 4X3ZA 2VUYA 3QZ6A 1ZL1A 2ZTJA 2FTPA 1NWRA 4REQB 1H7XA 5CPTA 3QR1A 4K8GA 4JKLA 3GHRA 3V5CA 1K8CA 2FTYA 1QT1A 4O1CA 3AC0A 4DJDD 4GHRA 4Q8PA 5B80A 4DO4A 3EJSA 1GW9A 4IMDA 1B3WA 2IPWA 3GFYA 1KXHA 3UJ2A 4MMWA 4DI8A 3NPWA 3NM1A 1KM0A 3NO5A 2XTKA 2J62A 8CGTA 4JR5A 2J7CA 3ARTA 2VO5A 1TWDA 3LERA 2G4JA 3M4HA 2E6AA 4UZUA 2R8WA 2G4FA 4HSOA 1EEPA 2WSRA 1GCYA 3L9CA 2JKPA 1L8PA 4K38A 3N6HA 3XIMA 3WUGA 2XVPA 4UFKA 4CQAA 1H11A 2PCQA 4F48A 6XIAA 3LM3A 2Y63A 4IL0A 2QCGA 2HVOA 3VDBA 3UGRA 2DZXA 2YCJA 4HPJA 2BASA 3ZT7A 1J5SA 1XI3A 3WLKX 1W54A 1XGEA 2YIHA 2A79A 4KGJA 3W1PA 1TQWA 3PS7A 2ZZ2A 4Q8NA 1RJRA 4Z17A 4LEQA 4XKMA 2PC4A 4HHHA 1HW6A 4FX7A 1FY6A 1VC4A 4S1FA 3NQDA 4LAKA 2HTMA 4GY0A 2IQ0A 1WAUA 3SUWA 5E6YA 5DRIA 2A6NA 4H6EA 4EP8C 4C6BA 3GC2A 2F9RA 1UR4A 3DGRA 4FLQA 1FWGC 4ZR8A 1T8XA 4AZ7A 4Z0SA 4CU7A 4LUTB 4FZPA 4GD0A 1XW8A 4IMEA 1UUOA 5GNZA 3E2VA 5FD0A 4L6OA 1AJ2A 1SGJA 4PSPA 2ZZ5A 2NSXA 4PL2A 2ND1A 3EOOA 2PLCA 2A5HA 3UWWA 1YBQB 1YDVA 3MV11 1Y8BA 3A4AA 4AD3A 1E43A 4N9EA 2PDQA 4M81A 1XBVA 2IXVA 3K4AA 3NO1A 2V3DA 4PUJA 1QU4A 3TAOA 4ZENA 4LFYA 2GOKA 1MQPA 1PVNA 1XX1A 1AL7A 1UJPA 2V82A 2WQDA 3VPLA 1D3CA 5EMUA 2D2HA 3DFTA 1Z7AA 2E0PA 2QQ6A 5HJLA 4Q32A 3P67A 1MVYA 1AQMA 3JRKA 4S23A 3AXMA 1V0NA 1EDQA 4IPNB 4QTGA 4RR4A 3WF1A 2VELA 3R1ZA 2POZA 3PN8A 3C52A 2HNEA 2OGYA 5I3HA 2E5DA 3PZGA 3FYOA 3DDGA 1PTAA 2Y8UA 3NYZA 2PMRA 1CGVA 4GMEA 3RU8X 4NASA 5K9CA 5I3GA 5DT5A 2E9BA 4J7RA 1KD0A 7TAAA 2VEPA 1SYTA 1JCXA 1POJA 3FDKA 4HPXA 1UWTA 1YNYA 1M7OA 2D73A 4HCHA 2HJPA 3AS1A 3HG5A 3KUMA 2EBNA 1QFEA 4AZBA 4J2PA 3VGBA 1GJUA 2QJHA 2WO5A 3OA3A 4OIFA 4ZB5A 4PUEA 1GQKA 3BMWA 4LQ1A 3PBGA 1U5VA 1VIZA 4KCUA 3URBA 3WELA 2B7PA 3DX1A 1C3FA 2GGHA 1ME9A 4W89A 3SAZA 4HNUA 3GK0A 5D03A 1W1A1 1BSIA 2QUTA 3RR1A 3H4WA 3AOFA 5KINA 5I3KA 3UT0A 5CLWA 1BPLB 3H21A 1BSLA 3IGUA 3H4GA 5D33A 4K1GA 1HO4A 1OYCA 1E9IA 3WDQA 4DF2A 3IAQA 1TV3A 4JTLA 3L2IA 3IRDA 4M24A 2FZDA 3EOSA 3AUOA 2HVMA 1EGVA 3WF0A 1QJWA 4FR1A 1KXQA 2Y5JA 4LAUA 4QE1A 1MUCA 4IG2A 4YTQA 2ZC1A 2QF8A 3KOXA 1HL8A 1OWQA 3ABXA 3THCA 3EKGA 4TR9A 2PDHA 1A50A 3KS6A 2F7RA 1MFVA 5H1WA 4X63A 3AIWA 3VEAA 4AY7A 4N9BA 3DBNA 4QJ1A 4PMZA 2GJRA 1JXKA 3NG3A 1HVQA 2GJLA 3W2UA 1UUMA 3GBEA 3UNTA 2BSLA 5AYXA 2GPTA 3IS4A 3G5EA 3BGJA 2NXHA 3F5LA 4LNCA 4ACZB 1S2WA 3SI9A 3M0VA 4CVUA 4UOZA 4Q33A 4D6JA 3ELFA 5JBEA 2Z1KA 3MI6A 3VMNA 4AC7C 4J40A 1VP5A 3MCNA 1PE1A 1X96A 1DJWA 1W31A 1KM6A 1ZAJA 2EHHA 1H7OA 4GUIA 5SWUA 5A6KA 3M16A 1F6PA 1WDWA 1UROA 3DHDA 1D3HA 2VT0A 3PULA 1G67A 3L3OM 4IM0A 5CH9A 4AWEA 2WCAA 3EWWA 3N15A 1RSCA 4MWAE 3RRAA 4XZHA 3W88A 3H2CA 3U9IA 1S3HA 3GVQA 3MP5A 2AGKA 3S46A 3VMOA 1GVEA 3QHNA 5T9BG 1QPKA 1NY1A 2W9MA 1CTNA 4FOUA 4DIAA 1VF8A 4ZEPA 3BLIA 1PX8A 2WZIA 4QIUA 1FHVA 2WVTA 4BY3A 3F4WA 3SECA 1RP8A 4OZOA 3VIKA 4EZUA 3UXIA 3VIOA 3OG3A 2IKJA 4NZJA 3NOEA 1ZALA 1R9ZA 2VCCA 4ZTYA 2UBPC 1CXKA 1M5WA 3G1YA 4AEOA 1EO5A 2YIVX 3HG4A 3NQBA 3HMCA 3CWOX 4OWGA 1CLKA 3W1MA 4B2DA 3W81A 3A9IA 3MANA 1XIMA 3VOCA 3VD3A 5K4XA 1XLMA 3SUTA 4WKAA 2ZVIA 4GO9A 2P3ZA 3B3DA 4YTTA 2QDDA 5FA5A 1KBJA 2O4QA 3GXPA 2D23A 3RX2A 1IGWA 2JNSA 5D9MA 2V67A 3IJ8A 3ZR4A 4WSKA 2WANA 1G4PA 2FPTA 3HPXA 2WHJA 4LC6A 1J0HA 2JK2A 5FCZA 3AYRA 3TROA 3IV3A 2OKOA 1QI5A 1QPOA 1RXOB 5A95A 5CC6A 3BLLA 4UQDA 1OGBA 2YI8A 3AU2A 3PSWA 3PBUA 2HPIA 1OZQA 2Y7GA 3WL0A 3TW9A 3T8QA 1E6NA 3BLFA 2CZEA 2WSQA 4PMJA 3QN3A 4GLEA 3TWBA 2W27A 4MLRA 4XV0A 3AZSA 4Q22A 1A4LA 3DYPA 4PCPA 4FIQA 1Z44A 3VINA 3EZ4A 1GKQA 1FVPA 2OSWA 2HPMA 2A3BA 2OX4A 3URQA 1UWSA 3SW6A 2Z25A 4N42A 3ZWSA 1KM4A 5EY5A 1S46A 4BQ5A 4I9TA 3OU8A 3CHFA 3N73A 4WX2A 2PRHA 4ZB2A 1VFLA 4EPDC 1N8FA 3OPSA 1TREA 4PMDA 1XLJA 1TVNA 1LROA 3QV9A 4QSFA 1Q6FA 2VYOA 2PUZA 1EX1A 2CBIA 3WF2A 2VI0A 3SN0A 1JYVA 2EPHA 6CGTA 4PBFA 4W7WA 4DAFA 1NP2A 5G5IA 1ZZMA 1JCTA 5E1QA 1TYGA 4TQTA 5EU9A 3PWIA 1B2YA 3VOGA 3CLWA 1ZBKA 4PGLA 3L5MA 3UZZA 3PBMA 3R7MA 4HU0A 3EDEA 4PCNA 4QEHA 4CNSA 3CS2A 1LT7A 3E0LA 5I00A 4TTUA 1OAOA 3RDKA 4O8RA 2Z1BA 2FGZA 4AVOA 1EWEA 1P1XA 2CBJA 3B8IA 2P3EA 2GVEA 2OLAA 1JPDX 5D2YA 1PKMA 3IK2A 1TUFA 1SFSA 1RLDA 4N2YA 4Q8UA 3RF9A 3TDFA 4AW7A 3CUZA 3BZGA 4W9TA 2EFKA 2PGFA 3BMXA 2PTXA 5CPMA 3UERA 1LCOA 5AVNA 5HUOA 1FOBA 2Z7KA 4E8CA 2YFOA 3D46A 1UQYA 5JIPA 3JUGA 1J79A 3AU6A 3ITTA 3N4FA 1PTGA 4O14A 1GW1A 2GDUA 3KL3A 2GSJA 3FIGA 3R0UA 3G18A 1V7YA 4IXHA 4DYKA 1FHDA 1YDYA 5A8OA 3LPPA 1CXIA 1A47A 4ENLA 4K8EA 3EA2A 5I0DA 3W9ZA 4Q7BA 2P53A 2Y88A 1IXOA 3CHVA 1N8IA 3AIEA 3TMLA 3VOIA 3VGFA 3VFCA 2V2HA 3BCJA 1NDWA 2HS8A 3ARYA 3RO8A 1UP3A 3T4WA 4HCLA 4WK9A 1G6CA 1TRIA 3WD4A 1JR1A 2HWGA 4NF7A 3MHUA 1XLHA 1N82A 4JN8A 4FF5A 1AH3A 3N4EA 1UKPA 2GGIA 1PEZA 3IIOA 1QR7A 3EAUA 4QS5A 4EPKA 4AIUA 1KGWA 1IZJA 3E0IA 2FHCA 4JGDA 4NYUA 4NAEA 5DANA 2E67A 1OVDA 5HXMA 1GQLA 1OEPA 4JHOA 4PMRA 2FZBA 2R82A 2ADAA 2OT0A 4IGSA 4MZ1A 1JDFA 2IQTA 1VZWA 2VR2A 4UZSA 2QDEA 5E70A 3LCXA 4ATWA 3VKBA 4U3AA 2J4GA 5A2AA 3UG4A 1RK6A 2CLKA 4HYWA 1BTCA 5ABGA 2A4AA 1QHPA 1R3WA 2PAJA 3R8RA 4FALA 3KBJA 2C15A 4O28A 3WFAA 4UTIA 3VNZA 1UKTA 5D04C 2RHGA 3WLPA 1MDRA 4HK5A 1CBGA 2WJFA 2Z2BA 4M6UA 4RE0A 2ZRZA 3UG3A 3TFCA 3B0PA 3KRZA 4M1RA 3EX3A 3QMSA 3B9EA 2GSHA 2J75A 1FDJA 3PTKA 1TV7A 4GFIA 1BG4A 3L21A 1XG3A 2PEVA 4GY7A 1E9LA 2VZSA 3N11A 4MNKA 3T0CA 2RAKA 4UIOA 5CKSA 4QFUA 4UTMA 1DE5A 3VNIA 4IUGA 4IPPA 3DOPA 2QXLA 2RFGA 3UZ5A 4FSAA 3AROA 1F3XA 4YMZA 1RP9A 2YB1A 3VNMA 3LHZA 5LNSA 2HBXA 3K46A 2Y0FA 3LDVA 2PRLA 1KFKA 4XAPA 2DJXA 3I6TA 2WVVA 1XGZA 4X2RA 1ICSA 1PHQA 1EJRC 1ISVA 5I3IA 2X2GA 1KM5A 3D51A 3LPGA 4NSBA 2VEMA 1ZCOA 5CZTA 3L3PA 3VFLA 4AUBA 3TOPA 3W1QA 1XRSA 4AY8A 5FF3A 2CIPA 1EIXA 5EMLA 1K6AA 4AFYA 2PDNA 3EWCA 4U33A 3PZVA 2W61A 3KRUA 2OQLA 1NM9A 3TW6A 3KBWA 2NVCA 4IIHA 3HJZA 5BU9A 3RGTA 2B7NA 3PBYA 4CNPA 3IJLA 3NWRA 6TIMA 2V81A 2RT6A 4W8AA 1AH4A 5FACA 2WHKA 4JD4A 3WQ4A 3FOKA 4G2DA 3QFEA 4NZCA 2WXDM 1WDSA 2JBMA 3WLTA 1IQ8A 2WV8A 4AD1A 4CCZA 4UNKA 1TO3A 5JIWA 1TTQA 1H61A 4YCPA 2VC7A 4LYKA 2VZOA 3DC0A 1NJJA 3T46A 3RAOA 1SW7A 4O50A 4DBSA 1VFSA 2O9RA 1W1VA 2OZ8A 4FK9A 2XHYA 1OK6A 2XGBA 1TIMA 4P8XA 4QAIA 3NZGA 4POCA 1EP3A 4LBUA 3T2QA 2VEKA 2REQA 3ZSTA 3GNOA 1EUAA 3BH4A 4B90A 5EMJA 3ZLHA 2CXEA 5FAGA 1W1PA 4PZVA 1W5PA 1YNQA 1TRDA 1JPMA 4GUJA 5A69A 3P5YA 1AMKA 3GTIA 4F0MA 5DEZA 3W86A 5HR6A 5C7VA 3ITOA 2EG8A 5HBFA 3H4XA 3N9KA 3CMJA 3V18A 1F3TA 1R30A 3HV8A 4QBXA 4UQ9A 5CJ5A 5L6UA 3IIVA 3SFWA 4UB9A 4YTSA 2VENA 4QX4A 2Z7GA 3PFMA 3U5YA 3WLIA 2BXVA 4EAMA 4Q4MA 1OK4A 3O15A 3CASA 4FNPA 2OQHA 1LG1A 3ALGA 4CCDA 3NM3A 3FA4A 2D69A 3T4CA 3N25A 2J78A 2ALWA 4F2TA 3GQYA 4W5UA 4HU4A 1NWUA 2O4MA 4A3YA 3THDA 1X7IA 1XUZA 3H53A 4LBSA 3WD2A 3M3WA 3H2NA 4RE4A 1ITUA 3RN6A 4PB3A 3U2ZA 1RPXA 1NSJA 3TN3A 4IPIA 3W7RA 1SR9A 2QV5A 2E3ZA 2QCNA 4XSMA 1XP3A 5BYWA 3ZEDA 4O4WA 4TMBA 3GKAA 4HU3A 3QRHA 1D2KA 1DVJA 2ZXDA 1MW3A 4Z2JA 3MMWA 1ITCA 1E51A 1ZBVA 1Q6DA 4C6DA 2FIQA 1KW1A 3INPA 1LLOA 4Y8EA 1E6ZA 1UCWA 1H50A 3BLDA 4H7CA 3S9YA 2PWUA 3TZFA 2H9AA 3ZFHA 1PO9A 2OWCA 4AU0A 5MKGA 1Q8AA 1HGWA 1R9XA 3NQMA 1IV8A 5BXPA 5JXQA 3PM6A 2Y1HA 3CC1A 2VX5A 2J8FA 2PD5A 4L65A 4ZFCA 1P7TA 1X1ZA 3V35A 1E15A 4XZIA 3VE9A 1EDTA 2YXGA 4H00A 3FY1A 3HFYA 4KH2A 3GXNA 2YR1A 3IUIA 1E0UA 3LLLA 3OZMA 1R3QA 3B04A 3EX1A 4LRSA 1CWYA 3KAVA 1RCXB 1QW9A 4UFMA 4J3XA 1W3NA 3AO0A 5C9RA 3BSHA 1N8WA 4C6PA 3T1GA 4L6HA 1PXGA 2YLAA 3GSMA 3N9RA 4ECLA 4GZEA 4CD6A 4I8DA 2XUCA 1AW1A 3WQGA 4K3ZA 1I1XA 2ZUMA 3UXKA 1R5YA 4UTFA 2WBKA 2V6AA 3C2EA 5HWMA 3W4RA 3FJ6A 4ZA0A 3LOTA 4O18A 3VGDA 3RPTA 3SRKA 1TX0A 1JUEA 4HU8A 3DX5A 3VM7A 2ZRXA 3SCOA 1KRBC 4BK9A 4AD5A 1IWPA 2E77A 3ZLGA 4E4UA 1GOWA 1WYIA 4A8RA 5I78A 3W25A 2XGIA 1KQZA 4CD5A 1E6PA 1HKVA 4R5JA 2KAUC 1A4MA 1TZZA 3HU7A 4L4LA 1JPIA 1NARA 2BV9A 5CXPA 2X0YA 4TXEA 2YCIX 3LVTA 4AB4A 3GR7A 3AXHA 4F4RA 4LRTA 1CENA 3LQLA 2ZC8A 2OO0A 2HZGA 3GC5A 3O2LA 4V27A 3N2XA 3LI0A 1F7BA 4IGHA 1UA7A 4HMCA 4HHMA 3LGEA 3QPEA 1B90A 1J0YA 1F5ZA 1JF5A 5I09A 2NQLA 3ABHA 2ZICA 1FBAA 1V6XA 2ND0A 3GAYA 5AY7A 4DM1A 1BFNA 4PUMA 3NVTA 3F4VA 1UIPA 3B0UX 5A6SA 2G3JA 3B8VA 1UIOA 4NVTA 2REQB 2WWDA 1F4AA 1SPQA 4HK7A 4JS3A 1DJZA 4YVXA 1T41A 2VR4A 3CZSA 4JNMA 2ESCA 4I7WA 2O7SA 1OSEA 1W3IA 5F2GA 4F40A 4UOJA 3RCMA 1RQHA 2POTA 3O16A 4F8XA 3E96A 1TMQA 4K2SA 4R33A 1SZNA 4HNOA 1UR9A 2VZVA 2Z1SA 1DWIM 4GIRA 5CC5A 2WC4A 1H60A 1GGOA 5E0CA 2W62A 3GU1A 1JD7A 1XV8A 3RO6A 4EXBA 4RNHA 5LNVA 2QULA 4WGHA 4QCFA 5IBXC 4Q4PA 5A8MA 3FGCA 4ZXOA 3CBWA 1DV7A 3MUIA 5EKYA 1NP0A 4IWPA