2YL6A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 173
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl6A01
1OGBA 1ZS2A 5JBFA 4GXPA 1E0XA 3VDHA 5TD4A 4V28A 3VPLA 4ATWA 5KZ6A 3PHAA 4CU8A 2WNWA 2RGLA 1WB0A 2XFYA 2ZUUA 2WLZA 3BAKA 5A6LA 1JGIA 1CEOA 3SUSA 3PTMA 3WBEA 1UR2A 1B3ZA 4Z2LA 4J28A 2PWDA 4LQ1A 1MQRA 4AD3A 3AIBA 5GNZA 4GIAA 3UG3A 4H7VA 2YDSA 3ZQ9A 5LYRA 1R85A 1OIMA 3ZJ7A 2WVSA 1E6PA 2ZUVA 2CITA 1IZKA 1PEZA 4L4OA 1C91A 3AZRA 4WJXA 4W93A 3N04A 1WNOA 3QR3A 1V3MA 1M03A 1EHNA 4MADA 1CGYA 4V2XA 3TTQA 3W53A 3GZAA 2JFEX 3RJYA 1E4MM 2VT0A 5I79A 1GQIA 1KBKA 4PMYA 3OIHA 2YA2A 4LXFA 3TTOA 5AYBA 3WKZA 1JDDA 2ZXQA 2CBJA 1H5VA 2XSAA 1G9HA 4D6FA 1B3VA 2GJPA 1CGXA 1UD2A 2FGZA 3VD5A 2ESCA 4AWEA 3L4XA 1W1VA 1TVPA 4F9JA 1DHKA 2Z1SA 4PSRA 1ODUA 1V6VA 1W9XA 1TZ7A 3OBAA 1LF1A 5I24A 5I3DA 3U7BA 1B2YA 3BMWA 4X9YA 3LMYA 1JL8A 1UD6A 1ZU8A 5HPCA 3D3AA 5D8ZA 3VGHA 1KWGA 4E4PA 5FL0A 1Q6FA 1K9EA 1W3HA 4BQ3A 5CSYA 1GOMA 1ISYA 1CGTA 3FW6A 5I23A 3A6OA 4BCEA 1H1NA 3VNYA 2PBGA 3QHNA 4AZIA 1MWOA 4WIWA 4Z2GA 1EGZA 3OLGA 3VMPA 4PMXA 2EO7A 4OZOA 1GOWA 3ZM8A 4D1IA 5F7UA 1UG6A 2W91A 1E4LA 3GNPA 4EAMA 4ZE4A 1UR1A 3RJXA 3AHYA 1JDAA 4W88A 2WHLA 1XHGA 5A6KA 4HU8A 1J10A 5JBEA 2G3NA 5E0CA 3WD4A 3W82A 3BSGA 3MSDA 1CYGA 2WMIA 1Q6EA 4ATDA 3ARVA 5IDIA 1CIUA 2PWGA 3OGVA 3VILA 1UR0A 1KXQA 4QAWA 3ZT7A 4IISA 2VI0A 4PMNA 4F9DA 3ZJ6A 1WDPA 3PZIA 1SMAA 1E9LA 2D24A 4UFKA 4P7OA 4J3WA 4PTWA 2VOTA 3VX1A 4TX6A 3WDJA 4LX4A 3M07A 1UD5A 4H8HA 2VX7A 2Y8VA 5CG0A 1H49A 5CXPA 3U57A 2DT3A 2WMKA 1TMQA 4GQQA 4CCDA 4F66A 2G3IA 1C7TA 1M53A 3WF0A 2FGLA 5I6SA 1L8NA 3CUGA 3IK2A 1VEMA 3MANA 2WBGA 2W5FA 3FAXA 5C70A 5GPRA 3F5LA 2WW5A 2XGBA 4TVDA 1V0MA 3VM7A 2VUYA 1UYQA 1HKKA 3WH9A 5A6JA 1JNDA 2GJRA 1UWUA 1FH8A 2V3GA 4UZSA 1CBGA 1BSIA 4BS0A 1H3GA 1UA7A 1B1YA 1D2KA 2YA0A 1W2VA 4KRUA 1ZJAA 2AMGA 2YL9A 1HN1A 1N82A 2GJXA 2VJXA 4FF5A 2ZX7A 5A8MA 2EQDA 3SCOA 1B3WA 1XD0A 3VGDA 2JE8A 4DWSC 3WUBA 5IFTA 4MDPA 1LL6A 3O9NA 4IM4A 2WVTA 2WVVB 2CETA 5M5DA 5GNYA 3ARWA 3GXIA 4HU0A 1QHPA 1CXEA 5BRPA 2VCBA 1R7OA 1TFVA 3AQUA 4GQRA 3NCOA 3VD4A 2JALA 4AIOA 2VRKA 1BYCA 3PTKA 4OOUA 3EBVA 1LJYA 4BZYA 1I1XA 2VVSA 3WNKA 3WEZA 1WZAA 3AIRA 3WY1A 1H11A 3NDZA 5I78A 4LYRA 2WC4A 3T0DA 3U5UA 3VGGA 1KBBA 4HPGA 1V0LA 3W38A 4J3TA 4FLRA 1UKQA 5DFAA 2XG9A 3AISA 5EMYA 3EDEA 4YPJA 3NSXA 1W2PA 3K4AA 1HF6A 2GK1A 5E70A 4V27A 3WD0A 3ZO9A 4PMZA 1UWQA 4URIA 4FZOA 1CLXA 3MO4A 1CPUA 4P7QA 4XZWA 3ZT6A 2J7HA 2VZUA 3T2PA 4GZIA 1ZBWA 3GYCA 2V3DA 1PZ3A 1VFOA 4GI9A 4CD5A 3PZ9A 2ZIDA 3ARZA 1UA3A 3AHVA 4XB3A 2UY5A 4ATLA 4UQBA 2VURA 2VTFA 2O9PA 5BRQA 4OOZA 1E0WA 3BAXA 2IUZA 1EO5A 4ML4A 5FL1A 1XGZA 1KQYA 7CGTA 3ZSSA 3JUGA 1ISZA 1OINA 1W3KA 4UQ9A 1Q6CA 3AZSA 1E6NA 1V03A 3SUWA 4Q22A 7A3HA 1QW8A 4J3XA 1NWUA 2CBIA 2XM2A 2BVDA 3CPUA 1QW9A 4CUCA 2DGAA 2XVKA 5BXSA 4KGLA 1VBUA 4QLLA 3VNZA 4AZ5A 3SUUA 3ZR5A 1HL8A 5DMYA 5I2UA 3CIVA 3WD1A 1F4AA 5C71A 3WMCA 1OM0A 4JZ5A 1DWGM 2YBUA 3II1A 1U33A 1JF5A 4X0NA 4JKKA 2OZNB 4JFWA 3VM5A 4TVCA 5GNXA 3AS3A 1UD3A 4UOZA 1HJSA 1GOKA 1V02E 1NQ6A 2VRQA 1OGGA 3VIFA 1GNXA 1QI2A 2WANA 5CGMA 2FHCA 2GSJA 4JKMA 1G94A 5CZKA 3KE0A 5CSUA 4AD2A 4IPLA 3S6TA 4AZCA 1XH1A 5A2BA 1YHTA 1JYWA 4GINA 2YKKA 1JZ8A 3N9KA 6A3HA 2XWDA 3OZOA 1S46A 2XVPA 1UKPA 1GJWA 1JD7A 3RO8A 5BWFA 2JEPA 4L4PA 3AMGA 4AW7A 1ISWA 2ZX9A 1QNPA 3IJ7A 2PC8A 1KR0A 3BH4A 4AD5A 2X05A 3VIOA 1J9YA 3CZEA 3IAPA 3F4VA 4H8VA 3L4YA 1UWIA 3FNDA 1E73M 4J3VA 1W9VA 1M04A 1UQZA 1OGSA 1E5NA 4HZ8A 1KGWA 1LG1A 1NWTA 3TA9A 3GH5A 4B3LA 1E3XA 1OIFA 1OD8A 9CGTA 4GPNA 2QLYA 2G4FA 4UFIA 3WNNA 3MKKA 4HMCA 4HPHA 1HJWA 3BC9A 2OWXA 5HOSA 3WENA 3SUTA 2CESA 2OLHA 6CGTA 5AC5A 1QNQA 2Y4SA 4R5EA 5A2AA 1SYTA 2ZXDA 3AZTA 3MMWA 3WL0A 4ZXLA 2BFGA 3DHPA 1IZJA 3CUFA 1W9DM 4PTVA 1QPKA 1ZL1A 2CIPA 1E3ZA 3PZUA 1BFNA 4AZ6A 3WELA 2XPKA 2WPGA 2VCCA 4M24A 4NZCA 4QCEA 4Z2IA 1HKIA 2QMKA 2TAAA 4TOQA 4B15A 3PZMA 1GOQA 2NW0A 3PZOA 1PZ2A 3NUKA 3N17A 4GI8A 4MNJA 3WMBA 3TONA 3WDQA 1HIZA 3GXFA 1G0CA 1B3XA 4CU7A 1K9TA 1EA9C 3AIQA 3CZLA 2W67A 4P7NA 1VFFA 4D1JA 1CENA 3WEOA 4XZBA 4PMOA 1Y7VA 3UERA 1RPKA 1UWTA 3G6LA 1WE5A 1BGAA 3S2CA 3HU7A 1I1WA 1V3KA 3MS8A 4GKLA 4QCFA 3HMCA 2W63A 1H4PA 2VZSA 4PUEA 4EK7A 3T0BA 4N42A 1BF2A 3ZJ8A 1VB9A 4MDOA 1ZJBA 4Y7EA 2WHMA 1W9PA 1KXTA 1W1YA 1JYXA 3WIJA 3WNMA 3RCNA 4WKHA 1OWQA 3BLPX 2VRJA 5EB8A 3DYPA 2CKRA 1XRVA 1BYBA 3GBDA 3WNLA 4W85A 3ARTA 1LQ0A 5LA0A 2MANA 3CMJA 4HOXA 1BYAA 2W62A 3SCRA 1CNVA 1YQ2A 2DT1A 1MYRA 4MB1A 1E40A 1K9DA 2A3EA 3F5JA 3J7HA 1UR8A 3WH8A 1MVYA 5IHSA 1MQQA 1JFHA 1E5JA 1MQPA 3BAJA 5D9PA 2J4GA 3NDYA 2YOCA 4NF7A 1B0IA 3AI0A 1CXFA 3VUPA 5D9NA 2WWCA 1UKSA 3GNRA 1GHSA 4AZHA 1JDCA 1UKTA 1A47A 5BROA 1OSEA 1W3LA 3BAWA 5CJ5A 1V3LA 1B31A 3VMNA 4BA0A 1CGUA 2QV4A 3UCQA 3VMOA 3WN6A 2DIJA 1FOBA 2BHYA 1JAEA 3L4VA 4PN2A 2GUYA 3WFLA 1E1EA 1JNEA 2E40A 3AICA 2CCRA 1HL9A 2BNJA 4AEEA 3CBWA 2QF8A 4M29A 3EDJA 3WF4A 2EPOA 1GQKA 3N15A 1OT2A 2BHUA 3SCQA 4E2OA 4H2CA 4YHEA 2J79A 2UWFA 4W8BA 1RP9A 4D6GA 2E3ZA 3AMLA 4FLOA 3AIEA 3WQVA 4JHOA 3ZMRA 1HJXA 4EANA 3ARYA 1UH4A 1E6QM 2D22A 4XX6A 3D5HA 2X2YA 1O7AA 2WM0A 1CGWA 1PPIA 4CU6A 1H2JA 4UQAA 3MV01 3O2LA 1C8QA 1XYZA 2J78A 2XHYA 5I77A 2XFRA 3KWXA 1ITCA 2F8QA 1EXPA 2Y5EA 2YA1A 5IFPA 1C90A 4W89A 1SR0A 1G1YA 1TR1A 2VMFA 3TP4A 2BY3A 1EDGA 1AQ0A 3OZPA 5EFDA 1HKJA 4UQCA 4AD0A 4ZEPA 3K8LA 1C8YA 4TVUA 2XM1A 1QNSA 2J77A 2AAAA 2E4TA 1US3A 2HVMA 2G3JA 3W29A 5JUVA 1JAKA 4TTGA 3POHA 1R7AA 3WH5A 1JYNA 2QHAA 3GNOA 4XV0A 2CHNA 1JZ4A 3IANA 1B90A 1BPLB 3VU2A 4HA4A 3RM4A 1UZ1A 2YJQA 2WCAA 5HBFA 1H0GA 3GM8A 1NP2A 3AYSA 1EOKA 4ACZA 2ZUSA 3SCPA 4D71A 3O6AA 1R8LA 3ZJKA 1NOUA 2D20A 5CPTA 4UZUA 4OBSA 2FDMA 3LPPA 1TA3A 4HMEA 1BHGA 4JL2A 4W5UA 1W1PA 4P7RA 5I5RA 2YDRA 2Y8KA 4D72A 1MW3A 2WHKA 1KXHA 2ZX6A 3K8KA 4W8LA 3B9EA 1GORA 3AMDA 4MAZA 3PZNA 5A8QA 5DT5A 4OUEA 4DM2A 2VZTA 3DC0A 5AY7A 2HISA 1VIWA 2GFTA 2VZOA 5A1AA 2BXYA 1P6WA 3ARXA 1JZ7A 4M80A 3AFBA 1V3JA 4NI3A 1VFMA 5DT7A 2D0GA 3WEMA 4W87A 3AS0A 2WMIB 2XJ7A 4HMDA 1E0VA 3SURA 1QNRA 3BCDA 5AC4A 2VL4A 4A3HA 1JI2A 2EXOA 3VGEA 4K68A 5BCAA 4U33A 1HJVA 2IXVA 3GH7A 2VO5A 3WQWA 3FHQA 1PIGA 2V3FA 1BTCA 3HJEA 1VEPA 1AMYA 3VDBA 1GQLA 3CMGA 1SMDA 3SIMA 2WKGA 3VKKA 2X1IA 1EOMA 2G8ZA 4CD4A 1GONA 5C8BB 2W66A 1ECEA 2VQUA 3NSNA 1X6NA 2BY2A 5A94A 3ARPA 2W4XA 5FKYA 3TTSA 1ESWA 3BGAA 1CDGA 3IJ9A 4FLQA 2YL5A 2JIWA 2BXZA 1PX8A 1WO2A 5FOOA 2GDUA 2WMFA 1OCQA 1QI5A 5D4YA 4CD7A 1I75A 2PF0A 2J47A 2ZWYA 3CZGA 1UWSA 2ZE0A 3CGTA 1EIBA 2A3AA 1HP4A 3VGBA 5ECUA 4PUDA 2XUCA 1NWRA 2GJXB 2G41A 3U7VA 3MU7A 1GQJA 1E56A 4P8UA 4AZBA 2O9TA 1LWJA 4F79A 4CN1A 1E6XM 1BVNP 3EMQA 3VO0A 4CD6A 1VFUA 3SCUA 3AOFA 3AHXA 2WYSA 2DT2A 2X0HA 4A3YA 3VDCA 3WUFA 4W5ZA 1DWJM 3KEHA 1JYVA 4U31A 3SCSA 3DHUA 1BGGA 2A3BA 4AXNA 1ISVA 2XYLA 1V0NA 4F8XA 4W86A 4UOJA 5A6AA 4P8VA 2JIEA 5A3HA 2XVNA 4J3UA 4AIUA 4UQEA 1J12A 3MUZ1 3N18A 1FFRA 4W8AA 5IXEA 5M17A 3T0AA 1X6LA 1QI4A 1TE1A 1Z32X 5ABFA 3AIUA 1OT1A 2V3EA 1UD8A 2AOSA 2ZUNA 3KL0A 4DWSD 4M82A 1V6WA 1U2YA 3N12A 3B8SA 1UWRA 4DUWA 3MUAA 3WD3A 5A8NA 1UOKA 1M7XA 4JKLA 2J7EA 2OSXA 1CXLA 2O92A 2OSYA 1JFXA 3WMSA 3W25A 1DTUA 4N0RA 2D3NA 4PTMA 1C92A 4MAVA 1WP6A 2GK1B 2EJ1A 1XSKA 1RP8A 4DWSA 3HN3A 1CXKA 2J7DA 4Q7NA 1E1FA 3THDA 4TX8A 2WSKA 2YBTA 1EQCA 1ZBKA 3FXYA 4JFTA 4YHGA 4OKDA 1K6AA 3BCFA 4H41A 4HP5A 4M1RA 2J8GA 1MW2A 2OYKA 4DUVA 2F61A 1EDQA 1UR4A 1FP8A 1KGUA 1UH3A 3WDRA 4PEEA 3DYMA 4CVWA 2EPLX 3UEQA 3W24A 1EH9A 4B9ZA 3VOCA 1R87A 1KWKA 3ARSA 1E4NA 3WNPA 4PMRA 5DO8A 3NYDA 1JF6A 5FCZA 2B31A 2EEXA 2D23A 1F4HA 3OGSA 3N11A 1UD4A 2PBOA 4UFHA 1EDTA 1MW1A 3I3DA 5CLTA 3SCNA 1BG9A 1KFWA 1JZ5A 4AMCA 3EDFA 1JG9A 4B16A 3WQ6A 1V3HA 2ZICA 1WCGA 4J3SA 3WNOA 3CTTA 4LGXA 1J0KA 1NP0A 4MNMA 2XWEA 2O9OA 5EFFA 3W37A 2Q8XA 3T08A 4AC1X 1HJUA 1CECA 2VC9A 2CHOA 3AXIA 2J7FA 3A4AA 2W61A 4C7FA 2WB5A 4BQ5A 4GZJA 4H8UA 2DSWA 4PCSA 1GCYA 1J18A 4EKJA 8CGTA 2WAGA 1E15A 2WCSA 4P8XA 4LYQA 3AXXA 1PX4A 1SFSA 2QPSA 2X09A 4D6HA 2XVLA 3SUVA 3WFZA 3GXDA 4C7GA 5A95A 4CD8A 3K4DA 1TCMA 4HA3A 3T09A 4W7VA 1KCLA 3EDDA 3RPMA 1JXKA 4AZCB 3F5KA 5A69A 3ARQA 2E9MA 3MMUA 2E9LA 3ECQA 1ODZA 1KGXA 2WVUA 3FN9A 1HNYA 3OLIA 3AS2A 4E8CA 5BXTA 4WSKA 4MJ2A 2NT1A 4RE4A 1WAWA 3NSMA 3UESA 5A6MA 2VCAA 1ZBVA 2PWEA 1J01A 1OB0A 5CGTA 5E0FA 3VX0A 5M3WA 4AIEA 1NARA 2DSVA 2WSPA 4PSPA 2BVTA 4D6JA 2DQXA 2WMJA 2DH3A 4U3CA 4PBGA 1MXGA 3IJ8A 3W0KA 1W3JA 1XSIA 2BVYA 1UQYA 2J7BA 3L4ZA 1H09A 4KWUA 1UH2A 4PMQA 3OLDA 3WQ5A 1WKYA 2DSKA 1B30A 1NOWA 4GI6A 2CEQA 2XIBA 1EQPA 3WF1A 4JHZA 4JIEA 1QVBA 2CPUA 1UR9A 3T2QA 1WPCA 2PWHA 1KXVA 1AQMA 3OB8A 2F2HA 5EBAA 3WDIA 3RIKA 3VGFA 1E4IA 1Q4NX 2J74A 1J0ZA 1R86A 3WF2A 2VX5A 1UHVA 4OBRA 1GJUA 4RE2A 3T2OA 3N13A 3WDHA 3CZJA 5LA2A 1E55A 1ZB5A 1C8XA 1J11A 3KZSA 3CUHA 2OO2A 3PN8A 3ALFA 2WC3A 1UZ4A 4CN6A 3OA5A 2IXUA 4W84A 1CGVA 1XV8A 2C0HA 4CKQA 1FH7A 1VENA 1E43A 3GH4A 5D8WA 1BVZA 3IAQA 1G5AA 3GDBA 4UQDA 3WSUA 2J7CA 1HXJA 4FK9A 3SCTA 4ZXOA 1BYDA 2YDQA 1ITXA 4YN5A 5M03A 6TAAA 1XSJA 3LPFA 3BXWA 5JIWA 1WZLA 4M8UA 4WKFA 1W32A 3MSGA 2WLYA 1U30A 1MFVA 4QLJA 4KH2A 5FD0A 2VX4A 2YIHA 5HDRA 4IPNB 2GDVA 3AMCA 5CPQA 1DWFM 1JI1A 2YLAA 5BYWA 1VRXA 3A4XA 3W27A 1W9BM 1TG7A 1BQCA 1VAHA 1US2A 1MW0A 2UY4A 2E0PA 4Z2KA 3GTNA 4GO8A 3CHCA 3VD3A 3RMEA 3UETA 2DSZA 2XTKA 4WSJA 4MB5A 2PWFA 4QFUA 5JIPA 1PX3A 4PMUA 3UR7A 3OGRA 1DP0A 1D7FA 4R27A 3VIHA 2CXGA 3PZTA 5CQ1A 4JFVA 1UKOA 3WQ8A 4U3AA 4MTVA 1NM9A 1A3HA 4BF7A 4CCEA 3AHTA 2J8FA 4HOWA 2OWCA 1LLOA 2XGIA 1PJ9A 5E09A 1V6XA 3ALGA 4MPKA 3AJ7A 3CZKA 3K46A 5FIPA 1O6IA 3EYPA 4HZ7A 5JBDA 2A3HA 3RDKA 1QHZA 4BQ4A 1X1NA 4M81A 1QOXA 1LG2A 4W7WA 3APGA 4UCFA 3VIKA 1C93A 2O9RA 4QLKA 4UFLA 2XFFA 4AISA 1CLVA 5LA1A 4D6IA 1XCWA 1J0YA 4QDMA 1GOOA 4P8WA 5HPOA 3U5YA 2VVNA 1IV8A 1B9ZA 3EMZA 2J75A 1XH2A 4PCTA 4CGTA 3AIVA 3K1DA 3AHZA 4OJYA 3AS1A 2E8YA 2J7GA 4U5KA 2CBUA 5ABGA 1WZMA 2D0FA 1XH0A 5A8OA 1PIFA 3M46A 2FH8A 1E70M 4LPCA 3WUGA 3NJ3A 3ZIZA 4AD1A 2BY1A 2ZUWA 2FHBA 5A2CA 1C7SA 3MUY1 2WVVA 4E8DA 2QMJA 1CZ1A 3UG4A 4W7UA 4BQ2A 3MUIA 1J0IA 1PBGA 4UFMA 4GZEA 3TOPA 1E6ZA 2XSBA 4ACZB 1KCKA 2E8ZA 4HOZA 1G01A 3CHDA 3WH6A 1K9FA 3QHOA 3W6LA 1D3CA 3POCA 2FH6A 1ZBCA 3LPGA 4HZ6A 4MNLA 2ZX8A 2C8NA 3BLKA 3G6MA 4DUXA 3WH7A 1TA3B 1KR1A 3WDPP 3ARUA 3ZSTA 3QHMA 4ZE5A 1V08A 1IT0A 1JIBA 2V5DA 3VINA 1QHOA 1BAGA 2D3LA 3CLWA 4B9YA 3B9DA 1GW1A 4H04A 1HX0A 3KL3A 3OG2A 2JNKA 2DDXA 1AQHA 3A3HA 1W1TA 2CNCA 2BHZA 2RGMA 3K8MA 3VIJA 2XIIA 2YLLA 4DM1A 3DYOA 5ABHA 2DPEA 1CXIA 2J62A 8A3HA 5CLWA 2J25A 3WF3A 2ZXAA 3I3EA 1J0HA 4UNIA 2DSUA 3MV11 2BY0A 1HP5A 1XYFA 1J0JA 1TVNA 2OYMA 5E6YA 4JAWA 2WC7A 4Z2HA 2X0YA 1E71M 1HVQA 3ZOAA 3WBAA 4TUFA 5KEZA 3FHAA 2NT0A 4AZ7A 3CZ8A 2D2OA 5A6BD 1PAMA 3QGVA 1QNOA 4U2YA 1MXDA 2JF6A 1JZ6A 5IHRA 2OWWA 2BV9A 5D9MA 1GOIA 4JCLA 1BLIA 1CXHA 1RD6A 2PMRA 1JXJA 5E9AA 1GHRA 4NRRA 3M6DA 4U2ZA 2YL6A 4WF7A 2DH2A 4ZENA 5A6BA 4C7DA 3MMDA 1HT6A 2DT0A 4ZFMA 1CWYA 1TUXA 4D6EA 1QI0A 2JEQA 1AVAA 1V6YA 3N1AA 3W26A 3CHFA 1V0KA 2Y2WA 4JCMA 5ABEA 5HNNA 1OD0A 2WXDM 3FAWA 1DWAM 3PBGA 1QBBA 1XD1A 2WMGA 2VR4A 3E1F1 3QOKA 4A4AA 1H41A 2WZHA 2ZWZA 3VD7A 1B3YA 4GO9A 4UFJA 4M56A 2XVGA 3VIPA 3AYRA 7TAAA 4IUGA 2CYGA 1ISXA 2OSWA 3VIGA 3AIWA 3BSHA 4D6CA 5DF0A 1NWSA 3W81A 2V5CA 4KMQA 3ZR6A 1VJSA 2D0HA 3L4TA 2Y24A 1FA2A 1XCXA 1JZ2A 4AYSA 5A8PA 1LWHA 3M7SA 3W28A 3PZVA 1BG4A 3NIYA 3EMCA 4LYPA 4X0VA 4P7LA 4AD4A 2BS9A 2CKSA 4B3KA 2DIEA 5I0DA 5GQBA 3A4WA 1KB3A 1JZ3A 2GVYA 3L2MA 1V6UA 2PB1A 3WL1A 2UY2A 3WUEA 1W9UA 3L4WA 3UR8A 5ABFB 3THCA 2W92A 1VEOA 1W91A 3KL5A 3QOMA 3SCWA 3VIMA 2Z1KA 3CO4A 3PZGA 2VZVA 3W4RA 4AEFA 4TTUA 1E6SM 4JFUA 2E9BA 5E6ZA 4NRSA 1FP9A 3RM8A 2V38A 1GUVA 2WCGA 3BMVA 3BAYA 3A47A 2ZUMA 1VJZA 4DWSB 1LL4A 1V02A 3RILA 1V3IA 2ZX5A 2G3MA 4AY1A 3B9AA 1QI3A 1FHDA 2EBNA 2NSXA 4UR9A 3DECA 3CH9A 1CTNA 4NSBA 4U5IA 2FHFA 1DEDA 1E72M 5HXMA 3BAIA 2ZXBA 3WQ4A 1WDRA 5D9OA 1HKMA 1FHLA 4ACYA 1Q6GA 3TTYA 4CN4A 4MJ4A 1UUQA 2WKLA 2WZEA 1JD9A 3L2LA 1VF8A 4AZGA 2WHJA 2VX6A 2WWDA 2CERA 2QPUA 1LL7A 2YL8A 1OBAA 1GZJA 3VD9A 3VIIA 4J27A 1H0IA 2X8RA 4MB3A 3SCVA 1DWIM 4MNKA 3AROA 3CUIA 2EPKX 4S3JA 3VTRA 1NH6A 3EDKA 3PTQA 2VR5A 1L0PA 1NOFA 4JFSA 1FH9A 4WK9A 4WLCA 3I3BA 1C3FA 4OIFA 4KGJA 2WBKA 1EO7A 4WKAA 2VQTA 4RL3A 4UOQA 4PRWA 1EHAA 3CUJA 4PMDA 3VDAA 4EE9A 4RE3A 2JF7A 3LPOA 1GPFA 3GXMA 2EPNA 3VVGA 4J7RA 2UY3A 4PYSA 3OLEA 4CVUA 4TXEA 3FY1A 2EPMX 1M01A 1KQZA 2D1ZA 3RM9A 2A3CA 3WD2A 4Z2JA 2DEPA 2WK2A 1WZKA 1WDQA 1HVXA 4S3KA 3UG5A 4CCCA 2PI6A 2VNCA 1DWHM 4UTFA 5DEZA 1QBAA 1Q6DA 1VBRA 5BXRA 4FLSA 4QP0A 5CPSA 3AMKA 2ZOXA 2OYLA 1GVIA 5A6SA 3W6MA 2CBVA 2ZUTA 3GBEA 4PTXA 4XUYA 4HTYA 3SEPA 2WMHA 4MB4A 3ZT5A 5BXPA 4HA1A 1XC6A 1WDSA 1GVYA 4PMVA 4FZPA 4FMVA 3L4UA 1E6RA 1HJQA 2C7FA 3CHEA 3AXHA 1FFQA 2WZIA 5AYIA 3PZQA 1RH9A 4D6DA 1MFUA 3ARRA 4KRTA 4JL1A
chains in the Genus database with same CATH superfamily
1YWMA 3C86A 5AFDA 3PF3A 1E0XA 3VDHA 2B7OA 3TJXA 3PHAA 4QEHA 5F2LA 1WB0A 2XFYA 4D9PA 1EUAA 3S46A 1CEOA 4NL1A 1JQKA 3N2CA 2R94A 5D04C 4TV5A 4QDWA 4Z2LA 1W9MA 4XD4A 5DQPA 2PWDA 4JOMA 3W07A 3QC0A 1MQRA 1R0MA 4B5TA 3NNTA 4GIAA 4P2VA 3ZQ9A 1KNWA 4HJFA 2BG5A 3OW1A 3ER8C 2GAFD 2EWFA 2YCLA 3W1NA 1GOXA 1H63A 1IZKA 4G2DA 4L4OA 3CJPA 4MWAD 4DBEA 4UTHA 2A79A 3UCCA 4KWWA 4AVMA 4MADA 4MGGA 2MUCA 3QWEA 3ANYA 4LTSA 3TTQA 3W53A 3UVAA 4Y8FA 1NDZA 2X0SA 1RR2A 4Z42C 1K7XA 2VT0A 3LMFA 4PMYA 2XN0A 3QA8A 2YA2A 2GGHA 5AYBA 2ZXQA 5FJUA 5C2GA 3OHIA 1FCUA 1VCVA 1TTPA 4E2BA 1B3VA 3AWNA 1ZENA 1CGXA 3DUGA 1R3QA 1TELA 3SRHA 4AWEA 3L4XA 4R3UA 4F9JA 3W1LA 3IIZA 4EPKA 1ZAIA 1E1DA 2I17A 2ANUA 5I3DA 4OFCA 1VRDA 2BODX 2FZNA 2IPFA 3N4AA 5D8ZA 1D3HA 2YYTA 5DRIA 3VGHA 2NQ9A 1UUOA 3LHTA 1A5LC 3NXLA 1GOMA 1ISYA 1CGTA 3TNOA 3UZ5A 2QNEA 3KVLA 3VNYA 4AZIA 4X2PA 1EGZA 4HK7A 3MKCA 4PMXA 2EO7A 4NUWA 1GOWA 4D1IA 1T0OA 1K4HA 3GNPA 3LD5A 3N34A 1RZMA 1UR1A 3AHYA 1PYMA 4DJFD 3S2JA 5K4ZA 3CV5A 4B2DD 4HU8A 3I65A 5HUOA 5JBEA 5E0CA 3NL2A 2PTWA 3W82A 3ZXWA 1CYGA 2WMIA 4IFOA 1CIUA 3VILA 5LZLA 2E5DA 3S8HA 4QAWA 1DHPA 1AFSA 1OZQA 4EP8C 1F73A 3PZIA 1MRAA 1WX0A 2D24A 3AWOA 4UFKA 4P7OA 2A5HA 4J3WA 1TQVA 4PTWA 2VOTA 3N73A 4AKVA 1R2SA 3WDJA 4LX4A 4I9JA 2UV8G 4DI9A 5XIMA 4H8HA 5IBXC 4L80A 1H49A 3DC8A 1C7TA 4NU7A 3SY1A 2FGLA 5I6SA 3SSJA 4WR3A 1PTDA 3MANA 1UCWA 3P5YA 2WBGA 3T7VA 1R47A 4J2MA 4ERAA 3DX4A 3F5LA 3QH2A 5E1QA 3O6YX 3VM7A 2HDJA 4JGDA 2Z00A 4L7ZA 4A8RA 4RE0A 3W7MA 3WH9A 3M0ZA 3E0FA 3RLGA 3H70A 1UWUA 2V82A 5HULA 2XDFA 4UZSA 3OHXM 2Z2AA 1ZLPA 1B1YA 3OVRA 1D2KA 2YA0A 5K9XA 4G1NA 4G6QA 2NVAA 3I68A 3F4CA 3TQ0A 2G97A 3NZGA 4H19A 1GW9A 2EQDA 4CQCA 2WO5A 4EZNA 1B3WA 4B3ZA 1UOZA 2ZRYA 4LANA 3CL7A 2WVVB 2CETA 3LHYA 4B4FA 3GXIA 3UCDA 4N4QA 4LVGA 1D7KA 2ZTKA 3G1SA 3W7GA 3GNNA 3HGRA 1RA5A 2F7RA 1REQA 4NAEB 1R6WA 4B5WA 2VENA 2DP3A 4FO4A 5G5IA 4GQRA 4TX9A 4ZQNA 1HTYA 3V18A 1PUDA 3EXSA 4DI8A 5E84A 4OOUA 2PZNA 2YIBA 1LJYA 3EBVA 4UCGA 3WEZA 1P43A 4KWVA 3R8GA 2QCDA 3T07A 3VNLA 4BK9A 4O12A 4UTKA 4J1OA 5C5BA 2FFIA 1LQ2A 3T0DA 1X03A 3U5UA 2PDBA 3I6TA 4JTFA 5G4HC 3HPFA 3B4YA 1BVWA 5L6UA 4J3TA 3ANVA 3AISA 1ZNNA 4DXVA 1HF6A 2FMOA 4I8YA 3WD0A 3ZO9A 4UTWC 3GXNA 1UWQA 3I6EA 4NILA 3L5LA 4UNLA 4LWWA 1S38A 3ATZA 2XIQA 2YW4A 1CPUA 4P7QA 4XZWA 3R0DA 3T2PA 4E2DA 2V3DA 1PZ3A 1VFOA 4YVXA 3HAIA 4CD5A 4XZIA 3CWNA 2ZIDA 4GRSA 1UA3A 1ALDA 3PJUA 3WBWA 3IJLA 2VURA 2XIMA 2VTFA 2QR6A 4OOZA 5BRQA 2VD8A 3R1ZA 2ZZ7A 1XGZA 1A4MA 1LYXA 1HO4A 4IXHA 4ZSTA 1E6NA 7A3HA 4S3DA 1QW8A 1EJ7L 1E1CA 1NWUA 2CBIA 4GNJA 2BVDA 4AHOA 1K4GA 1QW9A 4FF7A 3BUBA 1EWDA 5KZEA 1Q6RA 2Z28A 3KP0A 3CIVA 3L66A 3MJYA 2NXIA 3WMCA 4JZ5A 3SRKA 2ZE3A 4L9XA 5BOEA 3GAKA 1SO5A 4JKKA 3BUDA 1TRIA 4JFWA 4Z1CA 3P81A 5DX7A 2DVTA 4C6CA 1HJSA 4RKAA 1NQ6A 2VRQA 1OGGA 1GNXA 5CGMA 3DBPA 1DJYA 1F7BA 3TJ4A 1DV7A 3ITOA 1SU6A 1RCXB 3S6TA 4JQ1A 1YHTA 2GSHA 5HJYA 1JZ8A 4I90A 3THUA 3V0SA 6A3HA 2XWDA 1S46A 2HCVA 1GJWA 5BWFA 2BBFA 1FXQA 2JEPA 4L4PA 4G9PA 4CQBA 1ISWA 2QDHA 3IJ7A 2PC8A 1KR0A 3EWDA 4LUIA 1SGJA 3GFZA 5KZMA 1DKWA 2X05A 3VIOA 3CZEA 2QCNA 3MZ2A 4LS2A 3UJSA 4QE4A 5DBTA 4M7SA 1M04A 1UQZA 2KAUC 1E5NA 5HJXA 1NWTA 2C18A 3IIOA 3TA9A 2Z7KA 3LBOA 3F2BA 1OD8A 4GPNA 4JY9A 4JTHA 2QLYA 2G4FA 4UFIA 1XC4A 1EYEA 1RJRA 2AGKA 4ZQRA 1LDCA 1HJWA 4ERIA 3EWZA 4DUOA 5HOSA 1B4KA 3E2QA 6CGTA 4INFA 5AC5A 1SW3A 2H9AA 4NZ3A 2QDEA 1LLWA 2NCZA 5JVLA 3Q4DA 3WL0A 3DDMA 3GG0A 2BOFX 2ZRWA 2CIPA 4JTSA 2A7PA 4XAFA 2ZYFA 4JYEA 1BFNA 4NAFB 3GAYA 3LHZA 2XPKA 2Z6JA 3MHGA 2WPGA 3GFXA 1XIMA 4NZCA 4QCEA 3W7KA 4Z2IA 3G3MA 5CZ0A 1ZCCA 2TAAA 4B15A 1GOQA 2NW0A 4QTGA 3CC1A 1G4TA 1J2BA 2YZRA 1PZ2A 4QSFA 1OYAA 5AHFA 3BARA 1K8XA 4HQVA 1O94A 3GXFA 1B3XA 4MOZA 1K9TA 1EA9C 3CZLA 5CZJA 2W67A 3W1PA 1CENA 1R2TA 1BGAA 4B90A 4UTJA 2F6XA 4GKLA 3WCZA 1AW5A 1H4PA 2VZSA 4HHMA 4PUEA 4EK7A 4N42A 4ROPA 1BF2A 3V5CA 1VB9A 3I2WA 1SFJA 2Q8ZA 3D2EA 1F6KA 1ZJBA 1HUVA 1W1YA 2AAMA 3WNMA 1OFQA 4O10A 1QUMA 3SN1A 1OWQA 2NX1A 3MQTA 4WOZA 4MVAA 4LCRA 3PPCA 4HPNA 3SN4A 1YDVA 1XRVA 3GBDA 3WNLA 3BZGA 1XLFA 3NQCA 1LQ0A 4QS5A 2MANA 3CMJA 2Q71A 5FJOA 3G1HA 2WJDA 4GY1A 4LC6A 1YQ2A 1MYRA 4IX2A 1NF0A 1QWUA 4WRHA 2FVKA 5AHLA 1IIGA 1E5JA 5D9PA 2J4GA 2HV5A 3NDYA 4MF4A 1FCQA 2YOCA 4NF7A 2OGYA 3W86A 3AI0A 1RSCA 4AQLA 3SECA 3UZJA 2I14A 3W2UA 5LNSA 5BROA 3RLVA 2DZSA 5FF4A 1KM4A 3H4WA 2HTMA 3N25A 4O1BA 1XR2A 3Q37A 1Z9AA 3GFYA 2I7GA 1LP6A 2DIJA 2NWRA 1A5BA 1FOBA 3FYOA 5LXXA 4XIMA 1S2UA 3C61A 1P6BA 3WMLA 5JMUA 1XI3A 1E1EA 1JNEA 2E40A 1KLYA 3EPOA 4GVGA 2PDNA 3GR7A 4Q8OA 1P1XA 1W1B1 3WF4A 2ISDA 4R7OA 4YHEA 2F1BA 2J79A 2UWFA 1QR7A 1YEYA 3G0XA 3QW3A 2C1HA 4KF1A 3WQVA 3A21A 3ZMRA 4EANA 3HV9A 1EP2A 3ARYA 1E6QM 4BWLC 4PTDA 1KFKA 2WM0A 3TZFA 3QPEA 3MV01 4UQAA 1C8QA 3AXKA 2BGSA 3IGUA 3VE7A 4GABA 4FIQA 4I5XA 4IQJA 4W89A 5CGQA 1OX4A 3DGRA 2XISA 4GXWA 1TR1A 3TP4A 2BY3A 3PNZA 3FOKA 3D3FA 1HKJA 4AD0A 3LRKA 4BEQA 3P93A 3B8UA 2A1YA 3K8LA 3NFUA 4TVUA 2XM1A 2AAAA 2G3JA 2V0TA 3VK5A 2B4GA 1JAKA 3POHA 3MBDA 1JYNA 2OKTA 3GNOA 4JS3A 4XV0A 3VU2A 3T8QA 4IQEA 2GJNA 4MWAB 4N02A 5EY5A 3RFAA 3GM8A 1NP2A 2QIWA 2TYSA 1WQ5A 3CEUA 2VDGA 2R1PA 1XRTA 1JPMA 3TH6A 5CPTA 3P0XA 1KFCA 4CEUC 2FDMA 2OO0A 1TA3A 3KDNA 1W1PA 6TIMA 3R4IA 4D72A 4QEEA 2ZX6A 3UA4A 3AMDA 5A8QA 5DT5A 3DAQA 4OUEA 3SJNA 1M3UA 3FSUA 4OV9A 4DM2A 3DC0A 5AY7A 1S5TA 3STPA 2HISA 1OFAA 1VIWA 4JQ3A 4GZ7A 3ARXA 3KVKA 1W0MA 4IMDA 1X8CA 3MCNA 3MPGA 1TPVA 3UXAA 5EMJA 4B5VA 1EFZA 4JQAA 1QNRA 3KRBA 7XIMA 3URBA 3R0UA 2RAIA 1C9DA 4DO6A 3QZAA 3KDRA 1TREA 2ZRVA 4JDYA 4QE5A 1O68A 5EA9A 1WKDA 3QN3A 3PG9A 2PA6A 4A35A 4F01A 1AMYA 1VEPA 1SMDA 2WKGA 1YDOA 3VKKA 4ZO9A 1EOMA 1TQSA 4C6LA 4H9ZA 3L5MA 4CD4A 2W66A 5C8BB 3EPNA 3RX4A 2HWGA 2QJMA 3GG7A 2W4XA 3TTSA 4BI7A 1ESWA 4C1NB 3BGAA 4U10A 4MM1A 1R3SA 1XIDA 4XSLA 3CNYA 2JKAA 2X1TA 4FX6M 1E9VA 1WO2A 4MZYA 2B7NA 4MUZA 2WMFA 3E2SA 1TVLA 1OCQA 5D4YA 4CD7A 2PF0A 2QCLA 1TWZA 1IWAA 2CWXA 3TDFA 4EPDC 3EA1A 4JWDA 1HP4A 3VGBA 4LUYA 5DMNA 3W72A 4R7JA 3TSBA 3NO5A 1NWRA 2Z1WA 8XIAA 3MU7A 1GQJA 4QITA 3VO0A 3P6LA 4PUMA 3S2MA 3CVRA 3FYYA 1U22A 3T9PA 2X0HA 3R58A 4A3YA 3RU6A 1AL7A 4AF0A 2F7QA 2FYMA 3VDCA 3SGZA 3M16A 1Q6OA 1XRSA 1ISVA 5HINA 3W87A 3BUQA 1V0NA 4F8XA 3RR1A 2HBVA 5LHFA 1O7DB 4R7WA 2AGTA 3LLLA 3MUZ1 2Z2BA 4YTUA 3G1AA 4XZMX 3A9BA 5M17A 2PP1A 3C0LA 5D2YA 5BOFA 3AUOA 1TPDA 1TE1A 3AIUA 1OT1A 3GLCA 2ZADA 3U0HA 1HXKA 1V6WA 3BLIA 1UWRA 3MUAA 2EFLA 4I6VA 1JCNA 1M7XA 2JQXA 2OSYA 1JQVA 2I57A 2GF4A 3BG9A 1JEZA 1VD6A 3W25A 5CC5A 4ES4A 4N0RA 1K03A 1LCOA 2QT3A 2TPSA 4DJEC 1YXDA 3PANA 4MAVA 1WP6A 2EJ1A 2ALRA 1XSKA 3KOFA 3QQ1A 2G37A 1E1FA 2YBTA 4PTNA 1ZBKA 4MY8A 2C3ZA 3Q94A 3PAJA 4HP5A 4M1RA 1OAOA 1XDLA 5CBIA 1UR4A 1FP8A 3EJTA 4UC5A 1KFEA 3E96A 3TZNA 2EPLX 5LNVA 3U2EA 1B54A 1KWKA 3CH0A 1S2TA 2B31A 2C71A 3N11A 2PDFA 3SCNA 1BG9A 2P8CA 2ZZ2A 4B16A 3HV8A 1FWAC 4XBKA 1V3HA 1H5YA 4DVOA 3R13A 1QWNA 4F4RA 3IJQA 2O9OA 4DYKA 1LROA 4AC1X 3SFWA 3VCNA 3OBKA 2CHOA 2BLEA 2P50A 1JRBA 3AXIA 1HO1A 1IR1A 3A4AA 4C7FA 1RA0A 2O7QA 4UDYX 1J18A 4IM3A 3EOSA 1YXYA 2VEFA 4EIVA 8CGTA 2WCSA 4P8XA 4LYQA 3AXXA 2F2KA 2QPSA 2H6RA 4K38A 4CD8A 5LKYA 4W7VA 1KCLA 4HIBA 3RPMA 3LS9A 1JXKA 4AZCB 4TV6A 1VKFA 1O5QA 3MMUA 4ALDA 4OECA 1QASA 2INFA 4DEFA 4LCSA 3W73A 3AS2A 5BXTA 3AJXA 3W70A 4RE4A 4F40A 3NSMA 5FSEC 2F38A 4XUGA 5A6MA 5HWMA 2VCAA 4O4WA 1ZBVA 1J01A 5REQB 4OT7A 4DY1A 5CGTA 1S5MA 2P53A 3NR0A 3M1ZA 3W2MA 4LUJA 3DX1A 2PCQA 2FVLA 3LN3A 3MWCA 4I5UA 2J6XA 2ALDA 2HK0A 3MDWA 2YGYA 4PBGA 2YFOA 1MXGA 4XTDA 3A5VA 1RBOB 1AJ0A 3OLDA 4GJ1A 4GI6A 1I9CB 1PCWA 3NQDA 4JHZA 1QVBA 4QISA 3GKFA 2PRLA 3CQIA 3T44A 2PWHA 3BE7A 3A3WA 3OB8A 2F2HA 3WDIA 1DIEA 1FUYA 3VGFA 2PGWA 1LZOA 2JGYA 3RPDA 1FVPA 3NVDA 3T2OA 4O54A 1BWVA 3A64A 4GFSA 4HYWA 5LA2A 1ZB5A 1C8XA 2YB4A 4AHPA 3S47A 3NXFA 1IE7C 1UZ4A 1Q7ZA 4CN6A 1H7PA 2IXUA 4X60A 2C0HA 5EBUA 3A9IA 1V6TA 1RUSA 3R25A 2NX9A 2ABAA 1IIHA 2O56A 3GDBA 3CPGA 4FK9A 4HR1B 1Q3NA 1DIDA 2E67A 2QUUA 1BYDA 2YDQA 1ITXA 1DKXA 3HGJA 5DCDA 5HWJA 3A5FA 1RQEA 4LU0A 4YN5A 4XD3A 6TAAA 3CKDA 3BXWA 3KOWA 1HQTA 1J6PA 3S4TA 1W32A 2PWVA 1Q8JA 4JIQA 4MY9A 2PDXA 2W0UA 4QLJA 1XS2A 2YIHA 3T4CA 4N7QA 4KFNA 1DWFM 1CX9A 2DZXA 3G8RA 1EPXA 5CCZA 2YLAA 4AHQA 3EX2A 4EPEC 1VRXA 1W9BM 2GL5A 1TG7A 1TO3A 4A3UA 4C6DA 3BGGA 1ICSA 4UR8A 3JVAA 3EOLA 2E0PA 4MYXA 4M5PA 1F3EA 3FYPA 3VABA 3LX9A 2XTKA 2WQDA 5J5DA 3EPMA 3MCMA 2PWFA 2RDUA 2WSYA 4PMUA 4C6OA 1DP0A 1A5MC 2D2GA 3JS3A 4IM2A 4PBEA 3PZTA 4IIEA 1A3HA 3EWYA 2QEZA 1IXQA 1LLOA 4CCZA 3S5OA 4RDYA 3GVWA 2BZNA 5CZTA 5BMXA 3GU2A 3SDOA 4Y9OA 2CLEA 4X3ZA 4EZYA 3KS5A 1DE5A 3THAA 3BJSA 1TZ9A 4BQ4A 4EPBC 4AX6A 4IQDA 3TMLA 3TW9A 1VFLA 4K2SA 1YPXA 2GWGA 4Y6GA 2PGRA 2QPXA 1C93A 2O9RA 3QPYA 1FX6A 2XFFA 3RITA 4D6IA 4DAFA 1PE1A 1J0YA 3O15A 2OQYA 3NPUA 1WXZA 3TCEA 5HPOA 2V2DA 3U5YA 3P74A 1ITUA 1KM3A 3T8LA 3CIWA 2OVLA 4GUHA 4LAKA 1XH2A 4O1FA 4IW0A 2Z7GA 4PCTA 3NL6A 4CGTA 1OYBA 2HVOA 2FZMA 3K1DA 2PF8A 4X2RA 2I1OA 5HMFA 3TROA 3AS1A 5HMSA 1U1JA 3M46A 4YVVA 1E51A 3AU2A 2Z1BA 1GVRA 1XBYA 3SO7A 1TTQA 3TUUA 3N9RA 3WJSA 2ZUWA 5A2CA 4PULA 1UPPA 2WV8A 2WVVA 2Y7EA 3OHMB 2RH9A 2ALWA 4E8DA 3QMSA 1LLZA 1VIZA 2YXGA 4UTIA 3CWHA 4NAEA 3W9ZA 3TYBA 3TQVA 1QPNA 2PD9A 4LBUA 3M0IA 1NFPA 3SAZA 1KCKA 4HOZA 4EZOA 1G01A 3W6LA 2FH6A 1TIMA 1SO4A 3PBYA 3CV7A 3LPGA 4HZ6A 3MSRA 4EACA 2C8NA 3LBCA 3BLKA 4GYPA 3TOYA 1Z3NA 3ARUA 4KEZA 3ZSTA 4ZE5A 3V75A 3VINA 4DO5A 1UP0A 4A29A 5C9XA 5D2XA 2MNRA 3VNDA 1UJPA 4H04A 2PURA 2JNKA 3K8MA 2BHZA 1TWIA 2FKPA 3VIJA 1NF7A 3FCPA 4HN8A 5GJMA 3W1RA 3DPOA 3IGXA 2YLLA 2ZZ1A 2DPEA 1CXIA 1FWTA 1LBLA 3FJ4A 3UW6A 3QTPA 2J62A 8A3HA 1PTGA 5CLWA 3PSVA 4MKSA 1J0HA 1G4SA 1IWPA 2OLSA 3MV11 4MLJA 3UR2A 1HP5A 2CU0A 4US6A 3DDGA 3WBAA 1OX5A 3BVVA 4NXSA 5KEZA 3G0UA 3FHAA 2DU2A 4AZ7A 4DCNC 4XSMA 1FWWA 1PAMA 1RBAA 2PDPA 4DX3A 2X1SA 2JF6A 1FDJA 1U5HA 4PUUA 3MO7A 5E9AA 4NRRA 3M6DA 4FEZA 4B92A 3NAVA 2YL6A 1RLDA 4QIUA 4C7DA 3MMDA 2CHRA 3IVSA 1TQXA 3DI1A 4IP4A 1TUXA 2PC4A 4XO7A 1TIWA 5DN1A 1LRQA 3FV9A 1DPMA 4NX0A 3N1AA 3BK0A 4XQ6A 2X1RA 3GE7A 2GVJA 4FM3A 5HNNA 1A0CA 1P0NA 2WXDM 1SJAA 3B40A 2Y7GA 1G6CA 2WZHA 3QYSA 4G8TA 4LC8A 3TKFA 4LRTA 1BSLA 3VIPA 3H2NA 4IUGA 3E2RA 2JGQA 3VIGA 3AIWA 4D6CA 4D8ZA 3GVRA 4QJ1A 1O12A 4HB7A 3DYTA 3GXPA 5A8PA 3I7RA 1FXPA 3M7SA 4DBSA 3NIYA 4AU0A 1GNLA 4IMEA 3UP8A 4LYPA 4X0VA 3RLUA 1GTHA 1O60A 3JR2A 1X96A 4WDUA 4IWQA 2BS9A 3GW0A 1JDFA 5RUBA 1KB3A 2GVYA 4Q4MA 3L2MA 4PB4A 2NZLA 5KTLA 1VLWA 4ZBCA 1W9UA 1E9IA 4O13A 4HSNA 4LCQA 2HZGA 3IRDA 4NXKA 3QOMA 1HG3A 1OF6A 4TTUA 4FALA 3KXQA 4ROQA 1U5JA 3KAOA 3WG6A 3WLLA 4DBDA 4REQA 2LLEA 1FP9A 3RM8A 1GUVA 4NAFA 1TPFA 2GUUA 1V93A 4G7EB 3D0CA 1FCVA 5FACA 3ZLHA 1RBLA 3UJ2A 4IPPA 3UWWA 3DN5A 3DFYA 4Q4QA 2BSLA 1CTNA 1EXBA 4NSBA 1E72M 5AZ1A 2HMCA 5C9RA 1EBGA 1VPYA 3FD9A 3IJ6A 1WDRA 3C0QA 1Q7QA 5D9OA 4AUBA 2NUXA 4JHMA 4FNRA 4JN8A 3H2CA 3OYZA 3EJQA 1R30A 2CFFA 3DG3A 1A80A 2WKLA 3TC3A 1VF8A 1SW7A 2WHJA 2CW6A 2WWDA 4DO7A 1UBSA 2R8WA 1QPQA 1LQ7A 1H0IA 2X8RA 1DWIM 2L5HA 4S3JA 3VTRA 3TSDA 1NH6A 4G5DA 3F2DA 7ENLA 3E3HA 5IM51 4IH3A 1W54A 3G0SA 1NOFA 3KZPA 5LNWA 1GVFA 4M6PA 4WLCA 2QAFA 1LOSA 1EO7A 3LNMA 1OK6A 2ZFAA 3C2FA 3H54A 7ODCA 4PMDA 2GGJA 3QZEA 4RZ6A 1GPFA 4I8DA 3VVGA 3EOEA 3KBSA 1MSSA 4TXEA 1M6JA 3PVFA 4B4HA 3WJZA 4CQ9A 1RVGA 3LDVA 4J3ZA 5B7ZA 2DEPA 1ME9A 1KV8A 4PRRA 4CNUA 2VNCA 4M51A 1VBRA 4GNKB 3BGJA 4GACA 4YTSA 3Q0KA 4L6OA 2CBVA 3GBEA 4PTXA 2EGZA 1U5VA 7TIMA 1DKZA 4XUYA 3SEPA 4MB4A 1NVMA 3UYCA 3ZT5A 1WDSA 1A5UA 1MI3A 1TWSA 4PMVA 4FZPA 4FMVA 3L4UA 3W76A 1OA1A 4B91A 1DXFA 2J6VA 1FFQA 2WZIA 3CUXA 4Z17A 1OGBA 4D2JA 2E68A 3SGUA 3W7HA 4A2RA 4CNSA 5KZ6A 4XIAA 5K2ZA 2RGLA 4YTTA 2XN2A 4EOUA 2ZUUA 1GKRA 4LSBA 5A6LA 2ZC1A 1HGWA 2W6RA 1DQUA 3WBEA 3QFWA 3KX6A 4J28A 1XDMA 4LQ1A 3AIBA 1US0A 4G56A 3DH7A 1UC4A 5LYRA 1EJWC 2WVSA 3H53A 3SGGA 4LH8A 5AHIA 1E6PA 2ZUVA 3AZRA 4KESA 4WJXA 1EHNA 4EVZA 4Q4PA 1MZHA 3LV5A 3GR4A 3DFSA 3FGCB 3RJYA 5FJJA 2V5JA 3LRLA 1E4MM 3PB0A 5I79A 1CB7B 1KBKA 3M0HA 1TB3A 2FPYA 3STEA 5FA5A 1GK8A 3TTOA 4WXZA 3LEPA 4IL0A 4Q8TA 1G9HA 4H9TA 1FQ0A 2RHGA 4MWAA 4D6FA 1IEVA 4LAUA 1JCMP 1H61A 1TVPA 4PO2A 3C8FA 3LHVA 3BV7A 3PFRA 4A3QA 4BFAA 5HPCA 3OU8A 4H01A 1TUFA 4N6EA 4E4PA 5FL0A 4M1BA 1W3HA 2DW7A 2J66A 1JRCA 5I23A 4XK2A 5DCBA 1IXOA 4O57A 3QHNA 2P88A 1HL2A 1MWOA 3GC5A 3TYZA 5F7UA 2FJUB 1E4LA 3MJMA 3A22A 4FXJA 4Z0JA 1KM0A 1XYMA 2ZZ4A 4ZOCA 3NPWA 3MZNA 3H55A 4DWDA 2YKTA 3DEQA 3BSGA 1RK6A 3DFNA 1KXQA 4LEQA 2G96A 1F3WA 2P5NA 2QFFA 3PAOA 1SMAA 4DJFA 5CEWA 4B2DA 3U2OA 3KAWA 3VX1A 4BI5A 3D4YA 3OO2A 3BZJA 2VX7A 1D3GA 3STGA 2WMKA 2J88A 2PRMA 4GQQA 4KCTA 2G3IA 4C1NA 1M53A 1QOPA 1L8NA 3CUGA 1VEMA 3UZYA 2EG7A 3GTHA 4M19A 4NP7A 2CLOA 3B0YA 3M0JA 3QYQA 5C70A 5GPRA 4HNOA 2A6LA 3EB2A 3R8HA 2XGBA 1WDZA 2H8ZA 1UYQA 5A6JA 4O16A 2GJRA 1EC8A 1FH8A 2V3GA 3H12A 1H3GA 4QXIA 4HNNA 4KRUA 2GQ8A 1ZJAA 3UXLA 3GYEA 1LUCB 1W56A 1TJ2A 4OTKA 3NOEA 1KM6A 4FF5A 4GVHA 3NTYA 2ZX7A 4NKCA 1XD0A 3B4UA 1XLJA 3WUBA 5U4NA 5IFTA 3BLDA 3O9NA 4IX0A 3I10A 4IM4A 2WVTA 1Z8AA 3P7YA 4HU0A 1CXEA 1S5NA 4TMCA 2I56A 3OVPA 1J2WA 2OT0A 4IIFA 1L6YA 3NCOA 4D8JA 4FHAA 3VD4A 4XTIA 1S3TC 3A13A 3EA2A 4OQVA 1BXBA 3CQ0A 3PTKA 4BZYA 3QR0A 3W74A 4NASA 1ONEA 1M9HA 4LYRA 2WC4A 1KRCC 3I01A 1Y0EA 4EX4A 3R5EA 1V0LA 3NG3A 2WNNA 3VXGA 2H3BA 1RHCA 1UKQA 1F61A 4GIRA 4HPJA 2NXGA 3NSXA 1I6NA 1ZY9A 5GVJA 1W2PA 3K4AA 5E70A 1VPQA 2GWNA 1Z44A 1ZJHA 1BXCA 3CYJA 1CLXA 4CQDA 1IT7A 5I3KA 3ABSA 2YB1A 2VGGA 2YI9A 2J7HA 3MUCA 4KT2A 4IPIA 3GYCA 1JCTA 3NQVA 2VEMA 2V2CA 3ARZA 4H00A 1Q8AA 5TNVA 4XB3A 3M0VA 3RU8X 1TV8A 1YPIA 4UQBA 4MYAA 3UZZA 1E0WA 3B0UX 2WINM 1EO5A 4ML4A 7CGTA 1Q66A 1W3KA 3KDOA 3P67A 3SUWA 2PAJA 3D2FA 1XIHA 4FNTA 1ADOA 1K8ZA 1QK2A 1WKEA 4CUCA 3ABHA 2VGFA 2D69A 5FIGA 4UDXX 5BXSA 3ES7A 1VBUA 4JBRA 2DZAA 4AZ5A 3SUUA 1SJCA 2QUVA 2QUNA 3DG7A 5I2UA 5EMMA 4HSHA 1OM0A 1DWGM 1U33A 1KKRA 3HTWA 4X0NA 4HSOA 1GYNA 4TVCA 3LCIA 1UD3A 4UOZA 1GOKA 3ENLA 2VHLA 3L5AA 5ECVA 5BW6A 1QI2A 2WANA 5LGXA 2FHCA 3UA3A 2HQAA 1VGAA 3TN6A 3VOGA 4E8GA 4JKMA 4UTTA 5CZKA 2FICA 1ELSA 4B5SA 2FTWA 3UU0A 5CSUA 4AZCA 4V1YA 2YKKA 4C6BA 3B8TA 1Z48A 1VS1A 2XVPA 1S2AA 1UKPA 1JD7A 1BRLB 4RK8A 3B52X 4BR1A 1S2WA 5FJRA 1O95A 4DHGA 1ZAJA 4R5GA 3BURA 3HG4A 3IAPA 4H8VA 5HATA 3L4YA 4Y9MA 1UWIA 1E73M 1NSJA 3W2NA 1AA1B 2V9DA 2YYUA 1OIFA 1S2CA 3B9OA 4O19A 4J2PA 3W7QA 4GBUA 4XISA 3HM7A 3WNNA 2ZTJA 3QNJA 1OG6A 3MKKA 4HMCA 3CTLA 4LUSB 2GYIA 3H6OA 3S6OA 3SUTA 3P84A 2Y4SA 4R5EA 5A2AA 3IVTA 1SUFA 3UPWA 2ZXDA 1TPB1 3NPXA 4ZXLA 2BFGA 3M0MA 2X42A 3DHPA 3N29A 1IZJA 2OZ0A 1W9DM 2VGIA 4IT1A 4US5D 3B8WA 4PL2A 2OZ3A 4C5YA 3E74A 3NEHA 2XH4A 3V4BA 2VCCA 1XW8A 4YCOA 1I2OA 1FCBA 3PZMA 3HG5A 2P3EA 3T46A 1ZPTA 1AZ2A 1YTEA 4XAPA 3CQJA 3NYZA 4H8NA 1HIZA 5BU6A 3R0KA 5FLEX 1F8IA 4GISA 2QAPA 5LNRA 4L5ZA 2Y88A 3SZ8A 3G6LA 1WE5A 1RXOB 4DN1A 1FKWA 3VAVA 4HR1A 2V2HA 1KXTA 1FWFC 3WIJA 4KIRA 3S1UA 1Z69A 3BL3A 2VRJA 3TXVA 5I06A 4GD0A 1URUA 1GEQA 4JLCA 1X1ZA 5KETA 1DQXA 4GYFA 3UQNA 4H6KA 2PFHA 1CNVA 2DT1A 1QPOA 1E40A 3F5JA 3J7HA 2GGGA 1AG1O 5MKGB 2Y1HA 1JFHA 1MQPA 3BAJA 4MKVA 1G67A 4LNYA 3GHSA 1R9YA 1B0IA 2ZVIA 1CXFA 4Q33A 5D9NA 2WWCA 4JNYA 4FNUA 5CC6A 3DKLA 4UWMA 2JKEA 1A47A 1OSEA 4EZXA 5EKYA 3A4JA 1V3LA 4BA0A 5C9WA 2X16A 1CGUA 4QM1A 2QCGA 2J8TA 3KWSA 3UCQA 1XIJA 3VMOA 3MUXA 1PKMA 2B0MA 4HVXA 2BHYA 4L4LA 4L1WA 4O15A 3C56A 3R8RA 2GUYA 3WFLA 1KBIA 5F4XA 4TU1A 2CCRA 4E2VA 1NDVA 1J93A 3NQ2A 3SFKA 2EPOA 1GQKA 3E5PA 3EWBX 1XCFA 1I4NA 1PL9A 1RP9A 2OELA 3GS6A 2E3ZA 3AMLA 3F4WA 3B04A 4FLOA 3AIEA 1HJXA 5G2WA 3D5HA 5G2IA 1LT8A 2PLCA 5I00A 1CGWA 5TQLA 3O2LA 1XYZA 3WJYA 5C5YA 2EKGA 2V5LA 4GYPC 3KWXA 4ZO7A 4O1CA 3OK8A 2F8QA 2G0WA 2Y5EA 4RUBA 5IFPA 3ORWA 1OK4A 5IRPA 2E1WA 1V77A 1XICA 2LM0A 1EDGA 1RD5A 3MT1A 1SU7A 3BVJA 2GGIA 3VCRA 1KRBC 2NUWA 3SY8A 1C8YA 3TWAA 4F0RA 1L9WA 1QNSA 2J77A 1VC4A 1W3IA 4PB5A 2DUXA 3VNJA 1UB3A 2A2IA 1DXIA 3K2GA 4N9CA 1JZ4A 2P1FA 5LNUA 3IANA 2NXHA 2EKCA 1GWJA 4HA4A 3ZYZA 2QYGA 1R3TA 2WCAA 4DXXA 3P61A 1VBJA 2RDWA 3SCPA 4D71A 3ZVHB 3O6AA 1EJTC 1R8LA 1SR9A 3DCPA 3ZJKA 1NOUA 1TV7A 3F1QA 4DLFA 1J96A 4S3GA 3I39X 4KFPA 1K6WA 2RDXA 3QY7A 4H2HA 1RV8A 3VKDA 3P8IA 3W02A 2QZRA 4FP1A 4JTEA 4W5UA 3HPSA 2PD5A 2YDRA 5I03A 1MW3A 4L9ZA 4Q6JA 2WHKA 1QWGA 1GORA 4DJDC 3QLLA 1YIXA 4J40A 3EOUA 1BWKA 5G1YA 3H22A 2BXYA 1P6WA 3GW3A 1NDWA 1JZ7A 4FI4A 4JN4A 1VYRA 3UVIA 4J4KA 5KBPA 1SM9A 1XG4A 4N2YA 3PUDA 3WEMA 3AS0A 4QG8A 3A12A 3KHDA 5DBUA 4H4IA 3BCDA 5CAKA 2GGEA 2R82A 1JI2A 1EEXA 1QNVA 4K68A 5BCAA 4U33A 1YW1A 3G22A 1TMLA 2BASA 5E0KA 2GA9D 1YTKA 1BTCA 3HJEA 3IEBA 4CNTA 3CMGA 2X7WA 3LI0A 2IQDA 4N9DA 2DZUA 1ZTVA 1GONA 3IJDA 4LBSA 2VQUA 4MHBA 3NSNA 1EIXA 5B80A 5JH1A 2CLLA 2WPBA 3PC0A 1CDGA 3C8NA 2B7PA 4PE8A 4FLQA 2JIWA 2OXNA 1XLIA 2OBLA 3U4AA 2BXZA 1PX8A 3W7LA 5FOOA 3N6JA 2EHHA 3HQ1A 3WQGA 5JXQA 1SZGA 5D03A 4QNWA 3CGTA 1XUZA 1XISA 2XUCA 2AMXA 2V81A 4YJ5A 3SY5A 2HNEA 4P8UA 3DENA 3OBEA 2DVUA 1E6XM 3EMQA 4CD6A 1VFUA 3NQMA 1IEQA 3WBYA 3O16A 3AOFA 3AHXA 2HBXA 2DT2A 2PTDA 3NWRA 3LB0A 3UT0A 2NV1A 4RZBA 1DWJM 3SCSA 3LHWA 4AH7A 3LNPA 4HK6A 2VM8A 4W4QA 5A6AA 2C13A 1NJJA 1J12A 3KLKA 3PWGA 1TR9A 2R9RA 1X6LA 5A6TC 4I9AA 1QI4A 1AW2A 1PTAA 1Z32X 1ZWWA 4DWSD 4PCNA 3NZ1A 4ZTYA 2XFWA 1FKXA 1C29A 3PY2A 2OEMA 5A8NA 4JPGA 3UYIA 1T40A 3UPMA 3N3TA 2O92A 4POCA 1JFXA 1DTUA 2FMNA 1YKWA 2D3NA 4PTMA 1C92A 4G7EA 2RJGA 2GK1B 4E6MA 1L2UA 3OYXA 1A50A 3HGSA 1K7EA 1RP8A 3B97A 3HN3A 5CBJA 2WSKA 1I4LA 4YHGA 4JQ4A 4X9SA 1A5AA 1KFJA 5HR7A 1DOSA 1D8CA 4WY0B 4CVWA 5D2VA 2CLFA 4WJ8A 3PUGA 3ARSA 3GRIA 2I5IA 3RHGA 5D33A 3EZ4A 4DYEA 5FCZA 2XH0A 3LXAA 4Q4OA 3OGSA 4L4MA 2PBOA 2Q09A 4UFHA 1MW1A 3I3DA 3KRSA 4EZRA 1JZ5A 4AMCA 1JG9A 1A0EA 2BTMA 3LLDA 1ZAHA 3TW6A 4R5IA 3W84A 5A8GA 7PTDA 3FLUA 4J3SA 3WNOA 3CTTA 4GGBA 2C1GA 1SPQA 2VGBA 4NJIA 1KFBA 2YCKX 3EXRA 4JDBA 2VFIA 2W61A 4BQ5A 1V7YA 4HA0A 4H8UA 4O18A 3O0KA 1GCYA 1SU8A 3EKGA 2O4QA 2XVLA 3ERCC 2V30A 5L9FA 3K4DA 2CLPA 1OHLA 4AX7A 4O14A 3ITTA 3E02A 4FNPA 2C15A 1W3NA 4DF0A 1KGXA 3OLIA 1OJXA 4CNNA 3A24A 5B7YA 4EZZA 4NZ5A 3UGRA 1CT5A 1WAWA 1HW6A 4CQAA 5LIKX 2FYVA 3M6YA 3BG3A 1MJGA 4UIOA 3TJIA 2IKIA 4AIEA 3V5FA 3GVQA 4D6JA 5FSDC 2WMJA 3CB8A 4H8SA 2PLJA 3ANUA 3E0WA 3PBWA 4QS6A 4RDVA 4MWAC 1LWIA 3W0KA 3EX1A 4F00A 2BVYA 3RAOA 2J7BA 3L4ZA 4KWUA 3M41A 4WDTA 2DSKA 3NO3A 3IWPA 3LUTA 5F4WA 1T8XA 1UR9A 3LENA 5MHBA 5EBAA 1AQFA 4HCLA 1G4EA 5HK4A 2Q02A 1E4IA 1Q4NX 4HPXA 1T6MA 2WKJA 3DG6A 4PL1A 3WF2A 3LMZA 4S2BA 4OBRA 1GJUA 3WDHA 3FDKA 4GGHA 4MKNA 3VC5A 3MYPA 5I3JA 1E55A 3BCJA 4DB7A 2IMRA 3I7SA 4NSWA 3LCWA 2BMBA 3AAMA 5ABTA 1EYWA 3NQEA 1YDYA 3SSZA 3F4DA 1DYSA 1MEWA 3GH4A 1TZZA 5EMLA 1S1RA 3IAQA 5AHEA 1NFGA 1YDNA 4UQDA 6XIAA 1HXJA 3TEVA 3AYVA 1X7FA 2E1DA 4BI6A 2HPIA 1ZYLA 3H26A 5HAOA 2X41A 2O4MA 2YPIA 4DXKA 4AYGA 3EEGA 4DJFC 1XYAA 3N2MA 2RAGA 3LPFA 3KRZA 5T9BG 4C5ZA 2WLYA 1EKOA 3W6YA 2PCEA 1DVJA 4V15A 1Q2RA 1CW2A 4JTIA 1KCZA 1MW0A 2UY4A 4ERGA 1PDYA 3GTNA 3MI6A 4JICA 4BEUA 1PYFA 3CHCA 1TMHA 3IV3A 1KM5A 1JCLA 3QTGA 3DOPA 1RK5A 1QW7A 3HGOA 3PWAA 4FX8A 4MB5A 2PPGA 4QFUA 3T48A 5JIPA 2E25A 3CAWA 3UR7A 4R27A 4DZHA 4JFVA 5AKQA 1ZFJA 4BF7A 4EXQA 1TX0A 3MTWA 1W6TA 5KINA 2XGIA 1PJ9A 4KIEA 1V6XA 1SFLA 1IEXA 3ALGA 4H9MA 1XLDA 4MPKA 4E81A 3AJ7A 3K46A 5FIPA 1O6IA 1XLEA 3C7NA 3TXZA 1Q7MA 3PLTA 1QHZA 2O0I1 4NG3A 3V0TA 4HD5A 3RCMA 3D4ZA 4M81A 2VWSA 1QOXA 3NURA 4QHRA 1TJRA 2PE4A 3FVDA 4QLKA 1WXYA 2RKXA 4AISA 1O7DC 4GIYA 2E77A 3M5VA 2YI8A 3TR2A 4QDMA 2INEA 3U2CA 4P8WA 2VEKA 4ZO6A 4PFHA 2TRSA 2DUAA 1IV8A 3TYAA 3TFXA 2WNQA 3LTPA 2R91A 4E4FA 3BOXA 1V51A 1IQ8A 3BW2A 3AIVA 3T81A 2BGNE 4OJYA 4PR4A 4Y9NA 1TQWA 3L3OM 2D0FA 3H2MA 2JK2A 1E70M 5C7HA 2WSRA 3PG8A 3WUGA 2GUBA 2UZ9A 4EXAA 1F2JA 4H6IA 3ZIZA 3OG3A 3LCLA 1QDSA 3MUY1 2FB3A 4BJHA 2QMJA 1CZ1A 2F1AA 3PPFA 1NDYA 4W7UA 1RPXA 4BQ2A 3TWBA 1EA0A 2O55A 2Y89A 1MNSA 3BV4A 4GZEA 4MLRA 3URNA 1TV4A 2E6YA 4G7FA 5AVHA 3M5XA 2PY6A 1E6ZA 2XSBA 4ACZB 3CHDA 3WH6A 1WOAA 4K1GA 3POCA 2C19A 3T40A 4PB3A 8XIMA 1KD0A 3BUVA 5DANA 2ACSA 2ZX8A 3LOTA 4DUXA 1KR1A 3WDPP 1EC7A 3G8EA 3QHMA 2AQWA 1IT0A 2V5DA 1PKNA 4WJEA 1XINA 1K8CA 3QGAC 3B9DA 4MZ8A 2DDXA 1W1TA 1EP3A 4AB4A 1H7NA 2ISSA 2Y62A 3V0UA 3CWOX 3TYEA 1MO0A 3WF3A 3UZXA 2ZXAA 3I3EA 4QGCA 4UNIA 2DSUA 1DL3A 1J0JA 4K8GA 2Q13A 2XZ7A 3TCSA 2X0YA 3ZOAA 4UTTC 4ZMGA 2VKZG 4QE1A 4H9UA 2NT0A 4IHCA 4XD6A 3CZ8A 3TVAA 3GDTA 2E7FA 3HURA 4U2YA 1MXDA 3LSCA 3CAZA 2ZRXA 1JZ6A 2I5GA 2OWWA 1GOIA 3EOOA 4UMAA 3E0IA 2JNSA 3BOFA 3LXCA 2PMRA 5C7VA 2WYHA 1V4YA 2X3VA 2FGBA 1PIIA 4U2ZA 3QFEA 3FX4A 5HNRA 1HT6A 1H7RA 2DT0A 1C9WA 1CWYA 2ND1A 2QUTA 2D73A 3DFPA 1AVAA 3F2CA 3W26A 4H7CA 4JCMA 2Y70A 5ABEA 1R38A 3GD6A 1SW0A 4FNSA 1IHIA 4GBDA 2KX9A 3GB6A 3FAWA 4I6KA 3PBGA 5FEPA 4HTBA 1XD1A 2ACRA 3WFAA 1VBHA 1TX2A 1A5KC 4GVIA 3KCOA 1B3YA 1ZHAA 4Q6XA 4UMCA 2WZMA 3FJ6A 4IMFA 5HNTA 2X2GA 2E6AA 2GVEA 3AYRA 2G5WA 1BRLA 1VYPX 1XQLA 2BXVA 3WLSA 2Y7FA 1QT1A 3H7VA 3LU2A 1AJZA 4NJKA 1VLIA 4M6QA 4N6FA 2V5CA 1EPVA 2P76A 2Y85A 2VD9A 2OX1A 1CI1A 1GVOA 1LWHA 4CNOA 4XZHA 4AMAA 1BG4A 2Y61A 3O8AA 3SRFA 1XLHA 3VC6A 2OCZA 5BOOA 1Z89A 4ZGYA 4B3KA 4YL2A 4R5LA 3SQLA 2FFCA 3UWVA 3A4WA 4BKNA 4DPPA 4LUSA 1TPC1 1GKPA 3WO8A 1H7XA 3MC5A 3WBXA 4GCXA 5ABFB 4OV4A 1VEOA 3V35A 1W91A 3SCWA 2Z1KA 3CO4A 3SR7A 5AYYA 4AEFA 3FA3A 2F6UA 1T96A 4JFUA 2E9BA 5E6ZA 4K36A 3P5ZA 1L6FA 3W83A 2WCGA 3HFYA 5G4EA 3BAYA 4NJJA 3W2KA 1J79A 2ZUMA 4DWSB 4DZAA 3RILA 3S1GA 3O1NA 3GC4A 2DZBA 4UR9A 1Z41A 4U5IA 1DEDA 3CYVA 1VCGA 2IS7A 4EZPA 4PC8A 3TE9A 4N9BA 4KEVA 1HKMA 4H3DA 4JX6A 4D8LA 3GDKA 3MMTA 1FHLA 3L65A 5TAOA 1ONWA 3OP2A 3O3MB 3MSYA 4CN4A 3KW3A 3SBFA 4MJ4A 1WDWA 1DTNA 3WQCA 2YXOA 4JTUA 1A5NC 4PODA 4JTCA 1RJPA 2J9XA 2WZEA 2YCEA 3REQB 1X04A 3L2LA 3BUIA 4AZGA 4QX4A 4YVPA 3KOZA 1F05A 2QPUA 2X3XA 2NQJA 3TN3A 1TJ1A 4MB3A 2TODA 3SCVA 3W1QA 2PTXA 3UY8A 3DKJA 4XVEA 3PTQA 2VR5A 4ZR8A 3KAVA 1W5NA 3Q2DA 1W1IE 4C6KA 4WKAA 4UOQA 4XG1A 2IQTA 2RFGA 2PDIA 3VDAA 5D2WA 5MKGA 1ME8A 3DX2A 3LPOA 1XYCA 1KBLA 1GG0A 2ATMA 4J7RA 2Y63A 4YNGA 2UY3A 3OODA 3M0YA 4NNBA 3H4XA 1M01A 1KQZA 1M7PA 3UJEA 3NM3A 1XYBA 1SU5A 3HPZA 4V1XA 4MUPA 4CCCA 3QXBA 4LS0A 4UTFA 1MEIA 5BXRA 4QP0A 5CPSA 2ZOXA 2OYLA 5A6SA 2A4AA 3W6MA 3SQSA 4YLWA 1EX1A 2WMHA 4JTJA 3XIMA 4BF5A 2OOGA 1X38A 3SJ3A 4GUGA 1XPYA 2A7NA 2YDAA 1V7AA 1XXXA 2QUMA 4ZZ9A 1XYLA 2BP1A 2E5CA 1D9EA 1RH9A 4D6DA 1MFUA 4KRTA 4JL1A 1OFBA 2GZXA 5J04A 2A85A 3M0LA 4GXPA 5TD4A 4AVOA 4V28A 3VPLA 1UROA 3DHDA 3NOYA 1VCFA 3BAKA 2J9YA 4F0HA 3DFQA 5TF0A 3L0GA 1B3ZA 3EX6A 5DY3A 3E2VA 1TV2A 3KTCA 3UG3A 4IWOA 5LIXX 2YDSA 3DHFA 1R85A 3QM3A 5CC7A 4FXFA 1UPXA 1OABA 2CLIA 2CITA 1PEZA 1C91A 1HKWA 1JCYA 1V3MA 1M03A 1CGYA 4V2XA 3P60A 3GZAA 4IIHA 2E5BA 1QWKA 3O0FA 3OIHA 2GOKA 2J27A 2QJIA 2R1NA 4ZCWA 1ZSXA 3WKZA 5CPOA 1JDDA 2CBJA 5AN7A 1G7VA 2XSAA 2NUYA 1RALA 4JQ2A 4ADUA 3KVMA 1UD2A 4S3BA 2FGZA 2ESCA 4PMJA 4WDWA 1NAL1 2QKWA 5DLCA 4GJJA 4IGSA 3ZVHA 4PSRA 1ODUA 3T0TA 1W9XA 3OBAA 1TZ7A 3U7BA 1B2YA 3QZ6A 3BMWA 4JTDA 4ICNA 1UD6A 1ZU8A 1XDJA 4I3GA 4DYJA 1KWGA 4J35A 2BOGX 4BQ3A 2VEIA 4MY1A 5CSYA 4Y9AA 3FW6A 2ZKMX 4DZIA 1K70A 1H1NA 2C16A 4LVAA 2PBGA 2FZ8A 4QQ3A 4WIWA 4Z2GA 4OZOA 3W75A 3IGSA 1UC5A 1Q13A 1UG6A 3WZ0E 1W17A 2W91A 2GQ3A 5CKSA 3OEXA 3T42A 3LBMA 4EXBA 1P0BA 1J10A 3RF9A 3KOYA 2EF9A 3MSDA 3L3PA 1Q6EA 3GTXA 1KBJA 3LA4A 4ATDA 1OVDA 3WLTA 2FPVA 3KBVA 5IDIA 2PWGA 2DZWA 1UR0A 1FWDC 4AXKA 4RNHA 4DAIA 3ZT7A 4RNIA 2DW6A 3L7RA 3V1PA 2VI0A 1SVDA 4XO6A 3MCOA 3ZJ6A 1WDPA 4X63A 5DXXA 3MYOA 3ABXA 1POJA 2ABBA 4GQGA 2CLKA 1Q65A 1UD5A 2Y8VA 5CG0A 1RY8A 3U57A 1TMQA 1SSDA 5FEWA 3ITVA 4CCDA 4F66A 3WF0A 3KP1A 1IYXA 1DJHA 4YWSA 3APYA 2ZDRA 3DXIA 4NYUA 2W5FA 3ZFHA 3VZXA 2WW5A 2VELA 4RV8A 4LAZA 4NQ1A 2VUYA 3CV2A 2PLMA 3HA1A 2FZDA 3ONCA 3OOQA 4IICA 3VKJA 4ZQOA 2C14A 3IPWA 4ZOEA 2JKPA 5KSWA 5AYZA 1CBGA 1BSIA 1TYGA 3CT7A 1P0KA 3V36A 4LVFA 3QGKC 2SFPA 1HN1A 1N82A 4JX4A 5T8GA 1B5TA 4QG9A 2VJXA 4DPQA 3EEZA 5A8MA 3TX9A 3SCOA 3HQOA 4RV3A 4O11A 3FEQA 2JE8A 4H1ZA 4MDPA 1M65A 3QE6A 3EWUA 5TBOA 3RXZA 2VXNA 5M5DA 3S9YA 3ABQA 3ARWA 4XKYB 1QHPA 1FWBC 1TV5A 5G2HA 4YS1A 2VCBA 1R7OA 1PO9A 3BSMA 5KITA 1QAPA 4C91A 4F2UA 3AQUA 5F2MA 3OVQA 4AIOA 2VRKA 4JWEA 3B9NA 2NVDA 3EWCA 4Q8VA 1BYCA 3TYUA 1I1XA 2VVSA 4DF2A 3AC0A 1QO5A 1H11A 2X40A 2OO6A 1QATA 3WJWA 4H7ZA 3ISIX 3MBFA 4TMBA 3MHUA 1A5SA 4O8RA 3QQ0A 1TWWA 3VGGA 1KBBA 3W38A 3TJLA 4FLRA 4EZWA 1LOLA 2XG9A 4YPJA 2CZDA 3TTEA 2KZHA 1EJUC 3APTA 4C90A 4IP5A 2GK1A 3LYEA 4P61A 1FWEC 4V27A 4PMZA 4R9XA 4URIA 4HU4A 2PODA 2V68A 2QCFA 3MKVA 4GI9A 3UJRA 2CXEA 3WJXA 1TQUA 4WY0A 3S1XA 1TJ0A 2UY5A 4ATLA 4I9MA 2O9PA 3STCA 3KM8A 5FL1A 4LUTB 3ZSSA 1RAKA 3JUGA 1ISZA 1THFD 1UPMB 3L21A 1Q6CA 3AZSA 1V03A 2H3DA 4ZVJA 4JN6A 3Q84A 3ABZA 2XM2A 3NDOA 2DGAA 5BRBA 5D09A 2XVKA 1EBHA 1GZ1A 2Z0OA 4QLLA 3C2VA 3ITXA 3ZR5A 5DMYA 1KA9F 1GEHA 4A05A 4ASTA 2VC5A 5EGRA 1UWAA 5D30A 2YBUA 3Q67A 3B0PA 1JF5A 3GUGA 3H7RA 1SJDA 3VM5A 8TIMA 3AS3A 4QROA 1DORA 1V02E 1X97A 4IG2B 3DPQA 3P2VA 2PUZA 5U7SA 5C9UA 3IRSA 2PDWA 4LV9A 4IPLA 4D8AA 1EJXC 4MIMA 1XH1A 5A2BA 4GINA 3VKAA 4E3TA 3N9KA 1XGEA 3NA8A 2QJNA 2Z25A 3I4EA 3R43A 2E09A 4G1KA 3G1VA 2I5QA 3AMGA 4I7WA 4AW7A 5FF0A 2IKHA 2ZX9A 4ZTXA 1Q6LA 2V63A 4PUWA 1L8PA 1JQXA 4ZODA 4TO8A 3C5QA 3FNDA 4GUJA 4IF2A 3NQ6A 1FWNA 4HU3A 4LNCA 1OGSA 3QV9A 3URAA 1QJWA 1KGWA 4FXSA 3VI2A 4ILSA 3GH5A 4B3LA 3IIPA 1ENUA 3RRAA 9CGTA 1R2RA 1Y5WA 2V0OA 1WKFA 4MJZA 1Q85A 4HPHA 2OWXA 3WENA 2ZDSA 2CESA 1AW1A 1QNQA 2OLAA 3NGJA 4HNLA 3W23A 1SYTA 2BOEX 5TIMA 3M3WA 3AZTA 1SZRA 3MMWA 3S2NA 1M41A 1EF2A 4PH6A 4KWSA 3KLLA 3CUFA 3LM3A 3VDGA 4PTVA 3PPHA 1QPKA 1NTHA 3SQMA 4PCFA 3PZUA 2WM1A 4M24A 2ZRUA 5FJPA 3L23A 1V5XA 3BLFA 6XIMA 3PZOA 3S9ZA 1FTXA 2NSOA 4L9YA 2Q3RA 4GI8A 4MNJA 4US5A 3WMBA 4XAZA 2FQIA 4Q7BA 1G0CA 2HXTA 3UG8A 5AHNA 3SRDA 3FJLA 4P7NA 3FA4A 3MP4A 4D1JA 3WEOA 2VFHA 4PMOA 5FF7A 3IIXA 1RPKA 3UNDA 3WQDA 2HPMA 4C6EA 1GTEA 3ITGA 3HU7A 1I1WA 1BTMA 1K8YA 1N8FA 1RCQA 3HMCA 2W63A 2VFGA 3W3OA 3ZJ8A 2ZQ0A 4RW5A 4MDOA 1U00A 2WHMA 3PULA 1JYXA 5H91A 2Z4GA 4HHHA 3UF9A 3GTIA 5EB8A 3GHTA 3OIXA 2CKRA 1IXNA 3JW7A 2TSYA 3HO8A 2FVMA 4XAYA 4KIKB 4WGXA 5T9CE 4FZSA 1BYAA 1QRQA 4B5XA 2W62A 3SCRA 3W01A 2YFNA 2PSNA 4MB1A 1K9DA 4AVFA 2A3EA 1KW1A 4A8LA 4LW7A 4R34A 3WH8A 1MQQA 2V5BA 3HB9A 2VFEA 1U1UA 1JJKA 1BD0A 3FKRA 1GJPA 1EJVC 2PZ0A 3VUPA 4Q3MA 1UKSA 4RDWA 3GNRA 4AZHA 1JDCA 4GX8A 4O0ZA 1RLCL 3C3UA 1R5YA 3RUBL 5CJ5A 2Z26A 3S5NA 4LT9A 1B31A 2R1LA 2EJAA 3B53X 4HNVA 2RAKA 3CHVA 1X1OA 1W5OA 2B81A 1JAEA 4ZL1A 3L4VA 4DLMA 1QO2A 1YYAA 3VFCA 1HL9A 2BNJA 1HKVA 2QF8A 4RR4A 4QAIA 2GDQA 3HAHA 4M29A 3N15A 3C6CA 4E2OA 3A98A 5LSMA 4M6UA 2F7FA 3T05A 4GCAA 4QRNA 2HE8A 3R7MA 3R94A 2REQB 2NLYA 4Q8WA 1UH4A 1ML1A 1JDEA 4M0MA 4XX6A 3U2ZA 1F6PA 4GE8A 1S3HA 5H2ZA 1AODA 5I77A 2XFRA 2PS2A 3W7PA 1ITCA 1HFBA 3N9SA 2Q6ZA 2YA1A 4ENLA 1C90A 1WDDA 4GK8A 1SR0A 2QJHA 2R6OA 5HJLA 3OZPA 3KBNA 5EFDA 4UQCA 3WK0A 3Q45A 2YW3A 4ZEPA 1AH4A 1ZUAX 4JNEA 5CPLA 4IGNA 2DV0A 1US3A 1LT7A 2HVMA 3QY6A 5JUVA 1W1ZA 3CL6A 3AALA 4TTGA 1G7UA 1TTJA 3WH5A 4C1LA 2QHAA 1GVSA 4O50A 3TN5A 1BPLB 4JTAA 2Q3OA 3RM4A 1ZJIA 1UZ1A 5HBFA 1H0GA 1GZGA 3KUMA 1UW9A 1EOKA 1EF3A 4ACZA 4O1AA 4FOJA 5FEXA 3LG3A 4UZUA 4S2CA 4EF9A 1DJIA 2O0TA 1WBJA 3ZLFA 1KV5A 1LRTA 4HMEA 1YADA 2QDGA 4JL2A 5C6MA 3NQAA 3DGBA 4P7RA 4HCDA 4WX2A 1Y8BA 1W31A 3D6NA 4W8LA 3B9EA 1E9ZB 3NPVA 3QY8A 4CEXC 2YCJA 1WUFA 2DY3A 1BXNA 2Z2UA 3OVGA 3ONBA 4H6HA 3QF0A 1Z6KA 1ZRQA 3JZUA 2VZOA 3E6EA 5A1AA 4LVBA 3USBA 4FPSA 1YBQB 4M80A 3TYCA 4GJIA 1V3JA 2QGHA 4NI3A 1VFMA 4NY2A 3ZR4A 4YTRA 1OFRA 2VP8A 2B7QA 3XISA 2XU2A 3PBMA 4GC4A 2XJ7A 1E0VA 3L0NA 1LM1A 3ABRA 5AC4A 4L65A 1SFTA 2VL4A 4A3HA 3DERA 1JGMA 2EXOA 3LCXA 3VGEA 1K3UA 1HJVA 2DZPA 2IXVA 2VO5A 1DE6A 3ACOA 3FHQ