2YL6A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 173
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl6A01
1E4NA 4HZ7A 1D7FA 4ZXOA 1PJ9A 4S3JA 2ZE0A 1GVYA 4D6GA 1KBBA 2EO7A 5CGMA 1LWHA 2EPMX 4PTXA 3AHZA 2CETA 4XUYA 1J11A 1HJSA 1MQRA 4H8HA 4MAZA 3AXHA 5JIPA 3AJ7A 3FAWA 4WKAA 1NWRA 5LA1A 5BCAA 1NOUA 3ARUA 3PZQA 3W6MA 5I5RA 4BF7A 1QI5A 1QNRA 5CPQA 1HX0A 1WZAA 4ACYA 4V28A 2VRJA 3AZSA 5FIPA 4V2XA 4AMCA 3WQ8A 4MAVA 3KWXA 4UOZA 5DF0A 2QLYA 4WKHA 4TVCA 4PSPA 1AQMA 3BSHA 4AY1A 3KE0A 1W1VA 1V3KA 4FLSA 3T08A 1ZJBA 2DT1A 4TTUA 2JFEX 4AYSA 1NWTA 1Q6CA 2C8NA 1DWIM 3GZAA 3ARXA 1LG1A 3GBEA 4GPNA 1V08A 3ZR6A 1UYQA 2VJXA 2WMIB 4B3LA 3WD4A 1ZBKA 4FZPA 5BROA 1I75A 1F4AA 3W38A 3EDDA 1OWQA 3WUBA 4TOQA 1K9EA 1GNXA 4JHOA 5A8PA 4U3AA 3CTTA 1CBGA 1GQIA 3PTKA 3W53A 2UY3A 3CIVA 4PMVA 3WF3A 2GDVA 3MUIA 4GI9A 1CXEA 1G94A 2V3DA 1GPFA 2VX7A 4ACZA 4JKLA 1HP4A 3ARZA 4D6JA 3PZMA 4P7NA 1TUXA 3AIRA 2E8YA 3VIMA 4IUGA 2DIJA 2X1IA 2J7EA 3THCA 1GZJA 1R7OA 5ABFB 2QMJA 2VCAA 4P8UA 3K8KA 2ZWZA 4M80A 3QGVA 7CGTA 5HBFA 3WNPA 1NQ6A 1NWUA 4W8AA 2A3CA 2PBOA 2E9BA 3AQUA 3ARRA 4PTVA 2BXYA 1CECA 5D9MA 1E6NA 1W9BM 1WAWA 3ALGA 2Y2WA 4AD5A 2BVTA 3T2QA 3GXIA 3SCQA 1XYFA 2DT2A 3HMCA 2XWDA 4HU8A 2O92A 4PUEA 1A47A 4W8LA 1V0MA 5TD4A 1VFFA 3CHEA 3K8MA 2O9RA 1GOQA 1KCLA 1TG7A 1V3IA 4A4AA 1JDCA 1WCGA 5A69A 2IXUA 3LPFA 4J7RA 1G5AA 5DT5A 5M3WA 2FDMA 2WVVB 5BYWA 4KGLA 1E6QM 3VIKA 1HNYA 2JF7A 4F8XA 3AISA 5HPOA 1DWJM 5LA2A 1OINA 4BCEA 1CXFA 4R5EA 3F5KA 1ISXA 1Q4NX 2ZXDA 4H8VA 3B9EA 2YDQA 1C8XA 3THDA 4AZIA 2OSWA 4A3HA 4AIEA 1JNDA 4MNKA 3GXFA 5CLTA 3UCQA 3MMDA 1QHZA 1BG9A 3WN6A 2WCAA 3N11A 4KWUA 2VUYA 2ZUUA 4QDMA 1BHGA 1VEPA 4GI8A 5KZ6A 1J10A 2WVUA 4CVUA 4F9DA 4MJ2A 4N0RA 2D24A 3UESA 4GZIA 2Y24A 3A4WA 1XHGA 2QMKA 5DFAA 5BRPA 1B0IA 1U30A 4Z2IA 2CIPA 1FP9A 2QF8A 4QFUA 3AIVA 4Z2HA 3N9KA 1JGIA 2QHAA 1TA3B 3A6OA 1NARA 4CCCA 1EH9A 3RO8A 5I2UA 5A94A 1JZ5A 2W91A 4W7VA 3AROA 1KCKA 4WLCA 1UR8A 4HOWA 1E6XM 4PN2A 1VB9A 2F8QA 1MFUA 2VVSA 1GOMA 2JIEA 2YA0A 1QNPA 3CH9A 3ARYA 1W1YA 1B1YA 4HP5A 3AHXA 1CWYA 2W4XA 3PTQA 4EAMA 3MSGA 5BXPA 3WMBA 2VX6A 4CD7A 4UQEA 5D9NA 2NT0A 1VFMA 3K4AA 5C70A 4D1JA 2W62A 3PZTA 4Z2LA 3W26A 3DECA 1HKIA 1UWIA 1R8LA 5E6YA 3MANA 4OBRA 3TTOA 1G1YA 2DT3A 4GINA 5EFDA 1HP5A 2VVNA 4X0VA 5A1AA 2J79A 1CGUA 2BXZA 3WDJA 2ESCA 1VJSA 2J47A 4LQ1A 3DC0A 2DPEA 1H1NA 2PWEA 1EA9C 1D2KA 2OSXA 4CU7A 1XH2A 2ZX8A 1K9DA 1E1FA 4ZEPA 2VCBA 3VDHA 5D8WA 5JIWA 3OIHA 4UFJA 4WKFA 3VPLA 4IISA 2YL6A 1AVAA 2G41A 4U2ZA 2BY3A 2BHUA 2PC8A 2XFFA 3GDBA 1XYZA 4D72A 5A8NA 1TE1A 2WBKA 1CXLA 3WEMA 5HDRA 4FLQA 3K8LA 2RGLA 4PMOA 3WEZA 3MV11 1XCXA 4UFHA 5DMYA 1ECEA 5GPRA 1HN1A 1UD3A 2WB5A 3VM7A 4CD5A 1H41A 2ZXBA 3NDYA 2XG9A 3PZVA 4UZSA 4JKKA 4HOXA 3IJ7A 3HU7A 2DSWA 3HN3A 5IFTA 1VBUA 3T0BA 2W63A 3L4TA 2BVDA 1MW0A 3WSUA 1GJUA 4ZFMA 1H0GA 2GK1B 5BWFA 4GIAA 2D2OA 3OLEA 3VIHA 2VZSA 3VGDA 4HU0A 1UKQA 4AIOA 3AIBA 1XV8A 2J25A 3KL5A 1LWJA 4DWSC 1CTNA 4W8BA 1CZ1A 1UA7A 3VX0A 3B8SA 1JZ4A 3GM8A 4PYSA 3FXYA 2YJQA 4AZHA 3KEHA 2X0YA 2XGBA 4GI6A 1UR9A 3SUTA 2ZXAA 1J18A 2E9MA 3U7BA 3VX1A 5A3HA 3OGVA 3EDEA 1HJUA 2W66A 2FH6A 1JYNA 3W28A 1JYVA 3AS3A 1FP8A 3QOKA 1E6ZA 3B9DA 1QHOA 4GQRA 3FW6A 3U5YA 2O9PA 1RD6A 3CZGA 4W84A 2XTKA 3VU2A 4IM4A 3N12A 3F5LA 1LF1A 1R86A 2YL8A 1MXGA 4NRRA 4YHEA 2D22A 4UQ9A 1CYGA 1PAMA 2WHKA 2ZUSA 2XIIA 4LPCA 1C93A 4WSJA 2DQXA 3TTYA 2A3AA 3BMWA 3CZ8A 3QOMA 4C7DA 4J3TA 2EPOA 5A95A 5E9AA 3VTRA 3QHNA 2NT1A 5EBAA 1A3HA 2CESA 5FL1A 1CXKA 1BYBA 2YBTA 4J3WA 2J7FA 4FK9A 1VIWA 3AIUA 1GW1A 4NRSA 1U33A 1B90A 4PRWA 3VMNA 4V27A 1IZKA 2WKGA 2WBGA 2WHJA 3T2PA 3MV01 2WC7A 4JL1A 5HPCA 1QI3A 4RL3A 6TAAA 1MW2A 2DDXA 2WMJA 2BVYA 2QPUA 2YA1A 3W37A 2DT0A 2WANA 1BF2A 2E4TA 2BHYA 2DSKA 4F79A 4B16A 3GH7A 4P7RA 4GKLA 3OBAA 5CZKA 3DYMA 3VOCA 1X1NA 2WCSA 4JL2A 1FFQA 4CCEA 2C7FA 3ARQA 1BAGA 2OSYA 2BY0A 3MMWA 2ZX5A 1V03A 5I0DA 3OB8A 6CGTA 3SURA 2WVVA 1CXIA 1LQ0A 1KXTA 3TOPA 2BHZA 4UR9A 1J0YA 1DTUA 3EDJA 1J12A 4PTMA 1CGYA 1YHTA 1M7XA 1L8NA 1MXDA 2XFYA 3WDRA 3WQ6A 3W25A 4DUWA 3RM8A 1CIUA 5GNZA 2PBGA 3AMDA 5CLWA 4U5IA 1V3LA 1HIZA 4CU8A 3WNOA 3RPMA 3GXMA 1OGSA 2DH2A 4XZWA 3WF1A 4NSBA 3IJ8A 3CO4A 1JZ8A 2D0GA 3CHFA 4UTFA 1K9FA 2Z1KA 1WZMA 1LJYA 3BAKA 1EDGA 1R87A 1TVNA 1V0NA 1V02A 3VM5A 2WMGA 4UZUA 2YKKA 1ESWA 3VINA 2XSBA 3SUUA 3POHA 3SCNA 4LYQA 3PZUA 2WVTA 3VDCA 2C0HA 4CN4A 2XVGA 4J27A 4C7FA 1EQCA 4HPHA 3WH9A 1W32A 9CGTA 2BY2A 2VC9A 4F9JA 4J3VA 3W6LA 1UD4A 3QHOA 5LA0A 5D4YA 1ZBCA 3VMOA 2VQTA 1B30A 2WSKA 2XUCA 4UCFA 1UWQA 5FL0A 1UD5A 3NJ3A 2YOCA 4CN6A 4KGJA 4QLLA 3MUY1 2E0PA 4MB5A 4J3XA 1QHPA 5IXEA 3S6TA 5CXPA 3BLKA 3SEPA 3ZMRA 4DM2A 1E72M 1JXJA 4ZENA 2WC3A 1KGWA 3WEOA 2WWDA 1W3KA 1VEMA 1W1PA 2IXVA 3AICA 2WSPA 1MW3A 4D1IA 5AYIA 1JYXA 4MB4A 1G0CA 4N42A 1W1TA 4UFLA 4E4PA 4E8DA 3K46A 1E71M 1GJWA 1M01A 3WENA 2BV9A 2DSZA 3TONA 1G01A 1UWTA 2XJ7A 3WD2A 3WY1A 1GCYA 1HJWA 2ZUNA 4X0NA 5E0CA 2WZHA 2OYMA 2WKLA 4JKMA 1WDRA 2GUYA 3WBEA 5IHSA 1V6YA 4FZOA 1FA2A 5CPTA 1JXKA 4ATWA 2G8ZA 1H4PA 1V3JA 1QNOA 3UETA 1GOKA 3AS0A 2VMFA 3TA9A 3ZJ7A 3GYCA 4HOZA 4TTGA 3T09A 3AMGA 1VEOA 3ARSA 3ZT5A 2XVKA 4QLJA 4ML4A 1OD8A 1PIGA 2Y5EA 5ABHA 1XD1A 4GXPA 1JD9A 1UWRA 3WNMA 1R85A 4PCSA 1ODUA 1GONA 1OIMA 3TP4A 4Z2GA 3FAXA 3UR8A 1UWSA 1OBAA 4KMQA 3U7VA 3UG3A 1FOBA 1HL8A 3ZQ9A 1E1EA 1MQPA 4MB1A 2YDSA 2Y4SA 5IDIA 2XWEA 3UEQA 4HZ8A 2WHLA 1JNEA 3NSMA 3ZR5A 3GNPA 4AEFA 3FHQA 1UKOA 4B15A 3IAPA 3WD1A 3WNKA 2V5DA 2EBNA 3NIYA 5CPSA 4CD6A 1H5VA 4JFSA 2YBUA 3SCTA 3N17A 1V0KA 4BS0A 1C90A 3UG5A 1B2YA 1C8QA 3CUGA 4HMCA 3ARVA 4AD2A 4PMYA 2OYKA 1XSKA 2WLZA 2DGAA 1E4MM 1W9VA 5D9OA 3DHUA 1RPKA 1W9UA 4P7QA 1RH9A 1VJZA 1TZ7A 3WUGA 1OIFA 2FGLA 1E5NA 2PF0A 1VFOA 1PZ3A 4WJXA 4OOUA 4JFVA 1BVZA 3MO4A 1V6XA 3MU7A 1TR1A 1E4LA 2UWFA 3BCFA 2XM2A 2OYLA 5JBDA 3OLIA 3CPUA 3SUSA 1WPCA 1QI2A 5D8ZA 5AC5A 1WO2A 5E70A 1MFVA 1ISYA 3AI0A 1KXVA 3WBAA 2WK2A 2XVNA 3NSNA 1GHRA 2AMGA 2YA2A 4H8UA 1KQYA 1V6WA 2CBUA 2IUZA 4HMDA 3CLWA 3AIEA 3W0KA 4CU6A 4HZ6A 1DHKA 4AZCB 3T0DA 1HJQA 3NCOA 3OZOA 1JDAA 3O2LA 3PBGA 1HJXA 1XH1A 8CGTA 4HMEA 1H09A 1UR1A 2JEPA 3CUFA 1UHVA 1MQQA 3AFBA 4D6CA 3WNLA 3RCNA 4TX6A 2J7HA 4WK9A 2CPUA 3CMGA 2WW5A 2VZUA 2BFGA 3AMKA 1EDTA 3AHTA 1KGUA 1N82A 4U2YA 3VD7A 4AC1X 1QNQA 2WYSA 3OLDA 3WL1A 2X2YA 5C71A 5I78A 3TTSA 3D5HA 2WHMA 2W61A 3SUVA 2D1ZA 3ZT6A 3MS8A 1DWAM 1I1XA 1CLVA 1UZ4A 4OZOA 3VDAA 1XC6A 1UD6A 4TVUA 1BFNA 5A6BA 2XVPA 1YQ2A 1VAHA 2CYGA 1J01A 3RJXA 5M17A 3BAXA 1JZ2A 5C8BB 1B3XA 4BZYA 5CSYA 4H04A 1EDQA 1HF6A 3WDIA 2G4FA 2ZWYA 3BGAA 2WPGA 7A3HA 3L4XA 2VTFA 2PI6A 1JZ3A 3WD3A 4PMUA 4U5KA 4HA4A 2J74A 1XH0A 2FHCA 3ZIZA 1OT2A 1HJVA 1B9ZA 1F4HA 2MANA 2PWHA 1UG6A 2WXDM 1W2PA 4MB3A 2GSJA 3HJEA 1PPIA 1Q6EA 3ARWA 3UG4A 4ZE4A 3U5UA 4JFTA 2D3LA 5FD0A 1RP9A 4NZCA 3W81A 2OWXA 4PMNA 4PMDA 1CLXA 3N15A 1PX4A 1FFRA 4OBSA 1WNOA 3PZIA 1IZJA 1OM0A 1Y7VA 3A4XA 2RGMA 3WMSA 4H41A 2X05A 1E3XA 2CHOA 2OLHA 3AYRA 4TXEA 3VILA 3FN9A 4JIEA 4R27A 2VNCA 5EFFA 4DWSD 4MJ4A 3O6AA 5A2BA 1C92A 5FOOA 1NP0A 3AMLA 1B3VA 4W7UA 3ZT7A 4W85A 2VI0A 4BQ3A 3VVGA 3ZSSA 1ZS2A 5M03A 4PMQA 5A8QA 5A6AA 4PMXA 3FHAA 4J28A 2WMKA 3T2OA 5AYBA 5ABEA 1H3GA 4AZ7A 1DWHM 1O7AA 3BXWA 1QVBA 4EANA 3L2MA 1WDQA 1WZKA 2G3IA 1E5JA 5AC4A 1M53A 3VUPA 2WZIA 5A6LA 4PMRA 2J7GA 2CNCA 2Z1SA 3IAQA 1NM9A 1TA3A 2UY4A 1QOXA 1CDGA 2OWCA 3VNYA 1GQLA 5ABGA 3WDQA 3AMCA 1FHDA 2CKRA 2D3NA 3FNDA 2VRQA 1NOWA 2JF6A 1DWFM 3BSGA 1J0KA 3ZSTA 2ZX6A 1UKSA 1Z32X 4Y7EA 2X0HA 2WZEA 2J62A 2EPNA 1UH4A 4LX4A 4BQ5A 2BNJA 5GQBA 3VMPA 1MYRA 4MPKA 2VR5A 4HA1A 6A3HA 5JBEA 5CG0A 2ZUVA 4PMZA 3I3BA 2EQDA 3GBDA 1UQZA 4M56A 2VURA 1EOMA 1TMQA 2W67A 3WUEA 1OT1A 5A6KA 4HPGA 2XYLA 4TVDA 4FMVA 1BTCA 2PWGA 1PIFA 4AD4A 1ZL1A 4H7VA 1E40A 1SYTA 4EE9A 1E6RA 4D71A 2ZUWA 3D3AA 3VGFA 1XCWA 4AD1A 2JE8A 3PHAA 5A2AA 1H0IA 4GO9A 3WIJA 5FCZA 1KXHA 3K4DA 5E6ZA 1FH8A 3ZJ6A 1E0VA 1W91A 1OB0A 3CHDA 4CD8A 2A3EA 3ZM8A 2VQUA 1UZ1A 3PN8A 1UR0A 1BQCA 4B9ZA 3EMCA 3QHMA 3BAJA 1PX3A 2A3HA 3W27A 2O9OA 3IJ9A 4CVWA 1LL4A 4AIUA 3TTQA 4CUCA 4M81A 3WL0A 4ACZB 4DM1A 1GVIA 2Y8VA 4DWSA 3K1DA 1KR1A 4H2CA 3PZNA 2XM1A 2Y8KA 4AWEA 2YL9A 3SCSA 2F2HA 2W92A 4P8WA 3WKZA 2J7DA 4M82A 1E43A 5D9PA 1X6LA 3NSXA 3GNOA 1JFXA 3WUFA 1FHLA 4E2OA 4UOJA 2X8RA 2D23A 3BAWA 1TCMA 2XIBA 4ZXLA 1GQJA 4W5UA 1EQPA 1IT0A 1XGZA 2ZX9A 4FF5A 1E56A 3VIOA 5ABFA 2CHNA 1W2VA 3ECQA 2D0FA 4TX8A 5DT7A 1QBBA 3II1A 4P8VA 3ZJKA 5HNNA 3SCRA 2FGZA 4JFWA 1CGVA 3EDKA 5A8OA 4PTWA 1M03A 4Z2KA 5CGTA 3I3DA 1WB0A 4AZ6A 1BSIA 2VZOA 3EMZA 1OGGA 4L4OA 1AQ0A 3FY1A 3LMYA 3EDFA 4XV0A 4AZGA 2GVYA 1VENA 3AOFA 3S2CA 4EKJA 1EO5A 4U33A 2ZICA 3EMQA 3VGEA 4CCDA 3BAIA 3OZPA 4XZBA 3SCOA 3M46A 3WMCA 1ITXA 1UKTA 1QI0A 1JI2A 5F7UA 1JYWA 2WAGA 4X9YA 1KR0A 1ZBWA 1G9HA 3BAYA 3VIGA 4KH2A 3RJYA 4AW7A 4NF7A 2DH3A 4CGTA 3GH5A 1WDSA 3L4VA 3L4YA 1UKPA 3AYSA 1XD0A 1LL7A 1V3MA 3A47A 4FLOA 2WCGA 2XGIA 2WMFA 4KRUA 1E9LA 1V02E 8A3HA 3LPOA 2J7BA 3I3EA 4DWSB 3W4RA 1WZLA 4W5ZA 3RM9A 2WVSA 1DEDA 2VX4A 4YPJA 1EO7A 4DUVA 2J78A 3NYDA 1B3WA 2QV4A 4UOQA 1UR2A 2PMRA 1NWSA 2DSVA 3M7SA 3VD9A 1EIBA 4FLRA 3A4AA 4UFKA 4GO8A 2B31A 3SCPA 1BVNP 3OG2A 4Q7NA 2TAAA 3PZ9A 1OCQA 3POCA 4GZJA 2WWCA 5JUVA 3WQVA 4D6FA 5I77A 1QBAA 1E15A 2J7CA 4P7OA 4KRTA 4OOZA 3DYPA 1E6SM 4K68A 3RIKA 4M1RA 1L0PA 3GH4A 3J7HA 5I6SA 3WQ5A 3APGA 4QAWA 2CBJA 3WFZA 1SMAA 1UD2A 4PUDA 2EEXA 1JD7A 2J8GA 1W3LA 4W88A 1CGXA 1GQKA 4DUXA 3SCWA 1BYCA 4AZBA 1B3YA 1H49A 4BQ4A 1X6NA 3VO0A 3RMEA 4JAWA 1C8YA 3VD4A 2ZOXA 4AD0A 4MDPA 3RILA 3NDZA 1I1WA 5HOSA 1UUQA 3G6LA 5GNXA 4IPNB 1SR0A 4HA3A 4U31A 1J9YA 1KB3A 3WH5A 4YHGA 2O9TA 2JEQA 5I23A 3OGSA 2CBVA 3WDHA 3RM4A 3VIFA 5BRQA 1K9TA 4Q22A 4QLKA 1NH6A 3AXIA 3SUWA 1QNSA 5GNYA 1J0ZA 4E8CA 3UERA 1JI1A 2G3NA 1HKJA 1LLOA 4GZEA 3VIJA 3ALFA 2VZTA 4YN5A 2JALA 1XSIA 3IK2A 5CSUA 1QW8A 4AZCA 3L2LA 3AHYA 4B3KA 2YIHA 1AMYA 4S3KA 3QR3A 1KFWA 1WKYA 2WM0A 4RE4A 2Q8XA 1VRXA 3KL3A 3SCUA 4F66A 1JZ7A 4JZ5A 1GOOA 1HXJA 1U2YA 2ZX7A 2A3BA 4C7GA 2CERA 4D6EA 1JFHA 4WIWA 2V3FA 3M6DA 1JIBA 1NP2A 2V3EA 2UY2A 1BPLB 2OWWA 2EPKX 4AD3A 1BG4A 2VOTA 1W3JA 2XVLA 1EGZA 1UH2A 2CCRA 5E0FA 1KQZA 1GUVA 3CBWA 3CUHA 1XRVA 3F4VA 1ITCA 4B9YA 4ATDA 1BGAA 4LGXA 5M5DA 2PWDA 5IHRA 1JL8A 1JF5A 3OGRA 5FKYA 2ZXQA 2DSUA 1S46A 5I24A 1PX8A 2VX5A 1OD0A 3CMJA 1J0HA 1PZ2A 3BCDA 3WH8A 1E6PA 3CGTA 4AXNA 1C7TA 4W86A 1VFUA 1HVQA 1OSEA 1QI4A 3WQWA 1E4IA 1EOKA 3W24A 1QPKA 3WDPP 2GK1A 1E0XA 4LXFA 1MW1A 1TFVA 3L4WA 3VIIA 3ZO9A 4J3UA 3W82A 1ISZA 1EHAA 2CEQA 1US3A 3IANA 3DYOA 1CPUA 4OKDA 2GJXB 3LPGA 4MTVA 3AS2A 1Q6GA 4ATLA 1B31A 1KBKA 2J77A 1UQYA 1UWUA 2OO2A 1ODZA 4MADA 3WD0A 1M04A 3CHCA 1LG2A 4CKQA 5BXSA 2NSXA 2WLYA 4P7LA 1W3HA 1C91A 4TUFA 4PEEA 2FHBA 2VL4A 1AQHA 2V5CA 3N1AA 7TAAA 4M8UA 3WF0A 1E55A 3VD3A 4OUEA 4D6IA 2BS9A 4IPLA 1E73M 1B3ZA 4CN1A 1UOKA 2D20A 3T0AA 3VGHA 1BYAA 3CZLA 3AIQA 1W9PA 4UQDA 3LPPA 3AZTA 4URIA 3VGGA 4OIFA 2CKSA 5DO8A 2E9LA 1OGBA 2FHFA 1ZJAA 3PZGA 4NI3A 1KXQA 1HVXA 4BA0A 1ISVA 1Q6FA 5CJ5A 4D6HA 1HT6A 1GORA 2CXGA 3AS1A 4ZE5A 5A2CA 2YDRA 2ZUTA 1LL6A 1GOIA 1JF6A 3U57A 5IFPA 3ZOAA 4UFMA 3CUIA 2GJPA 1CENA 3AXXA 5AY7A 2AOSA 3N04A 2PWFA 2EJ1A 4AZ5A 3BMVA 5KEZA 4L4PA 4UFIA 3MUAA 5BXTA 3N18A 2BY1A 3VNZA 2J75A 3BC9A 3PZOA 4Z2JA 4MDOA 1CNVA 1HKMA 4UQBA 1KGXA 4XB3A 5JBFA 1K6AA 2VO5A 3MMUA 1EXPA 2JIWA 1GOWA 1UH3A 1KWGA 2YLLA 2J4GA 4PBGA 2WMHA 2AAAA 1V6VA 1PBGA 4PSRA 2VZVA 4WSKA 2XPKA 3SIMA 4W7WA 1CGWA 4AEEA 2VCCA 1WE5A 4GQQA 1IV8A 3UR7A 1MWOA 4MNMA 1UD8A 1EHNA 1HL9A 1J0IA 1JZ6A 1KWKA 2QPSA 3VIPA 1SFSA 4LYPA 5E09A 3NUKA 4OJYA 4UQCA 2JNKA 3AIWA 3W29A 1C3FA 3WF4A 3WFLA 3WNNA 3DHPA 4JFUA 3GTNA 1O6IA 1ISWA 4W93A 1BGGA 5CQ1A 3WQ4A 2DEPA 3WH7A 1SMDA 5A6SA 2F61A 4JHZA 3GNRA 2G3MA 5I3DA 3G6MA 3MUZ1 1FH9A 1R7AA 3VD5A 2NW0A 2EXOA 2PB1A 3OA5A 3CZEA 3PTMA 3AHVA 3CUJA 3GXDA 2FH8A 2ZIDA 5DEZA 5EB8A 2CBIA 3OLGA 1FH7A 4M29A 3WELA 1D3CA 2GJRA 4A3YA 4W87A 1WDPA 3SCVA 4QCFA 1BYDA 1HKKA 5LYRA 2EPLX 1JAEA 2XHYA 4LYRA 1GHSA 4JCLA 2GFTA 1H11A 5HXMA 3MKKA 2VR4A 3RDKA 3E1F1 4WF7A 2J8FA 2GDUA 3M07A 1CEOA 1US2A 3L4UA 1JAKA 3F5JA 3KL0A 1XSJA 1P6WA 3B9AA 1E3ZA 2HVMA 3EBVA 4UQAA 3CZKA 3ARPA 4M24A 2V38A 1DWGM 2VT0A 4JCMA 2D0HA 3O9NA 4MNJA 3A3HA 1VF8A 2WMIA 3EYPA 4AISA 1WP6A 4U3CA 1ZU8A 2DIEA 2X09A 2WNWA 5A8MA 3WF2A 1MVYA 2VRKA 2GJXA 3VGBA 3ZJ8A 1TVPA 3BH4A 1V0LA 4D6DA 1J0JA 5EMYA 2YL5A 2V3GA 3N13A 5A6MA 5I79A 1Q6DA 1UR4A 1CGTA 4PCTA 3CZJA 1ZBVA 3L4ZA 1RP8A 2G3JA 3JUGA 2YLAA 2WC4A 3AZRA 1JDDA 2CITA 1E0WA 4P8XA 4HTYA 1UA3A 1BLIA 2XFRA 1E70M 2E40A 4XX6A 5A6JA 1PEZA 1DP0A 3KZSA 1CXHA 2E8ZA 2XSAA 3BLPX 4J3SA 4BQ2A 4RE3A 3ARTA 1JG9A 1H2JA 4QCEA 4RE2A 3WH6A 5A6BD 1VBRA 1NOFA 1V3HA 4QP0A 4EK7A 3MSDA 1W9XA 4W89A 1QW9A 3VDBA 1ZB5A 5BXRA 2UY5A 5ECUA 2OZNB 3VKKA 2ZUMA 2W5FA 4MNLA 4UNIA 2HISA 1C7SA 2E3ZA 1W9DM 4CD4A 1V6UA
chains in the Genus database with same CATH superfamily
4HZ7A 2VFHA 4H3DA 4PUJA 4P5UA 3QYQA 4S3JA 4G9PA 2EO7A 3VKAA 5CGMA 1LWHA 4AYGA 1XIDA 1SW7A 4PL2A 3NZGA 3QNIA 2CLKA 1BSLA 3EOUA 3TYZA 2E67A 2C19A 4BF7A 1QI5A 4JN6A 5CPQA 5DRCA 4V28A 3AYVA 5FIPA 3AZSA 2QXLA 1L2UA 3DFOA 5CJMA 2WQDA 2R1PA 3CV7A 4EZXA 3WLPA 5DF0A 4TVCA 4PSPA 1AQMA 2Y88A 3W7LA 4AY1A 4HHLA 4KEMA 3PBMA 2R9RA 2JFEX 3BVWA 2F7PA 3CV6A 3ARXA 3LXCA 2QGHA 3ZR6A 2VJXA 2WMIB 1P48A 3TLLA 3T4WA 1E9YB 3WD4A 5EMKA 1H7PA 3GTHA 4H01A 3C5QA 4FZPA 2QUUA 1Q85A 1A3XA 3SN1A 1K9EA 1TRDA 1GNXA 4J9JA 4PUNA 4RPQA 4UMBA 3W53A 3BVXA 2GDVA 4ACZA 2HE8A 5CKSA 3WMLA 1HP4A 2E09A 3AIRA 2E8YA 4HCLA 4DPQA 1LQ7A 3A13A 1S2AA 2QMJA 2VCAA 1Z7AA 1I2QA 3QGVA 1E1CB 7CGTA 1LCOA 1JCJA 5AC7A 3KCJA 4DAIA 1A5MC 3ARRA 1NF0A 3GFXA 1E6NA 2WINM 5FJIA 5EMJA 2Y2WA 3S0CA 3P8JA 2IQDA 3HMCA 3VCNA 2ASHA 4G6QA 4NJIA 2FPTA 4R5JA 1C9WA 1XFCA 4QS6A 4WY0F 1TWZA 1HWWA 3A12A 1V0MA 1SU7A 2ON3A 3F7JA 2R14A 3PP7A 3O05A 1UPXA 5FAGA 1OAOA 1PVNA 1LLZA 3EPNA 3NGFA 3O6YX 3BW4A 3VUSA 4WZHA 1TB3A 2VGIA 4J7RA 1ME7A 1RLDA 3B8VA 1KRAC 2W6RA 3BCJA 2FDMA 2L5HA 3VIKA 1HNYA 3AISA 1DWJM 1ITQA 4OUIA 4R5EA 1DIOA 1C8XA 3U9IA 4AZIA 1QPRA 3SGUA 4MNKA 3EJSA 4JYDA 4GHRA 2QKWA 1QHZA 4H83A 3WN6A 2WCAA 3QN3A 1O1HA 2JK2A 4O15A 3WQDA 4Q6XA 1SJAA 4AKVA 1BHGA 1J10A 5E93A 5K4XA 4N0RA 4GZIA 2Y24A 4JY9A 2JKEA 5BRPA 1GQNA 4HGXA 3NFUA 3OVPA 1U30A 2FPYA 1FWRA 1XLMA 3AIVA 3GC4A 1A4MA 2QHAA 1TA3B 4R88A 3NNTA 1FTXA 1NARA 3QR0A 1EH9A 2ZRUA 4QITA 3G1XA 4RV8A 5A94A 1XYCA 3AROA 2RHGA 4FEZA 1GG1A 1UJPA 2BOGX 1EX1A 4JL9A 2Z2UA 1CT5A 3CH9A 1EGMA 1PDZA 1W1YA 2GOUA 1B1YA 2QDEA 4NAFA 4IWOA 3MSGA 2VFIA 1Z8AA 5BXPA 1W37A 5D9NA 1DE6A 4C91A 1TJ2A 3F2DA 1QWNA 2NT0A 4BFAA 3UGVA 3LHZA 3ABSA 5DXXA 2CWXA 1HL2A 2W62A 5FI8A 3BPWA 3NEHA 1YPIA 1Q6QA 3NO1A 1ZJHA 3OYZA 3M16A 1EPVA 1V8EA 3T4AG 4JTSA 1DIDA 3D4YA 3COTA 4IIBA 1UP0A 4GD0A 2X1SA 4NZ1A 1VJSA 2VXNA 1IT7A 4HTBA 3PK7A 4OFCA 4F00A 1EA9C 5FA5A 4C5YA 4PUUA 1XH2A 2ZX8A 1K9DA 4UTIA 2P0OA 1XUUA 4LT9A 4AWSA 4L4LA 2QQ6A 3O06A 4NXKA 3LLFA 4UFJA 4WKFA 4XSMA 1TR9A 3VI2A 5A5WA 3L68A 2G41A 3TE9A 1LM1A 1TJRA 4DPPA 1DJXA 4H1ZA 1SJCA 3B03A 5D2YA 1TE1A 3LERA 2OEKA 1JJKA 1CXLA 3WEMA 2OG9A 4C6MA 2DP3A 1GYNA 1AW1A 4PMOA 3WEZA 3D50A 1XCXA 3W85A 4S3GA 4UFHA 1P7TA 3VOFA 2FTYA 2ZXBA 4GX8A 3EKGA 1Y2OA 1W1IE 4JKKA 1PV8A 2QIIA 3BICA 2P76A 4OT7A 3T0BA 3M5ZA 2BVDA 5D03A 1GJUA 3GVGA 1Q4WA 3PWAA 3N6JA 4GIAA 2VKZG 3W7MA 1N2VA 3VGDA 4HU0A 3ID7A 2ZE3A 4Y2WA 3CYVA 1LWJA 1CTNA 2QUVA 2WSYA 2XN2A 3RPDA 2QKFA 5F4SA 4CQ9A 1JZ4A 2GOKA 4EXAA 2YJQA 4ZB5A 3I6EA 4DNMA 1EPXA 1S2UA 3SUTA 4ZODA 2P8CA 5HMEA 3MHGA 4PCPA 1JYNA 3TYUA 3AS3A 3LV5A 4HNUA 4RNIA 4JWIA 3SOGA 4GQRA 2FMNA 3U5YA 2O9PA 4W84A 1LTDA 3O15A 4XISA 3MZ2A 4IM4A 3GNDA 3N12A 1R86A 4AY8A 3HQ1A 1MXGA 2VWSA 4O8RA 1CYGA 3L65A 4YVVA 3U2EA 5G5IA 4RLIA 1WXYA 3QV9A 1ZRQA 2QDDA 2DQXA 2H6RA 5HMSA 3FFSA 3QC0A 3BMWA 3CQKA 1PHWA 4C7DA 5E9AA 3UBPC 1FWNA 2OU4A 3MBDA 5LNUA 4QEEA 4ZB2A 3WBXA 3R6IA 1QO2A 3HPFA 2YBTA 1MUWA 5FLEX 3D47A 4FK9A 4AEOA 1VIWA 3CT7A 4NRSA 3W76A 4O4VA 1XLJA 3BLIA 3K1GA 3N29A 2WHJA 3MV01 5CAHA 4A6GA 4GUJA 2WC7A 4KPLA 4ZOBA 4XO6A 3HJZA 1Q63A 1QI3A 1BWVA 4DJFA 2OZ3A 2W79A 1KTCA 3F4DA 2QCNA 4F79A 4M7TA 4P7RA 4B16A 1I0BA 3URBA 3OBAA 1TWDA 3DENA 1X1NA 2X16A 2BY0A 3MMWA 2ZX5A 1V03A 3OB8A 2WVVA 2KX9A 3TOPA 1V93A 1J0YA 5C55A 1KFBA 3EDJA 3WBWA 1T5AA 1CGYA 1M7XA 1L8NA 4UTWA 3T0CA 3WDRA 4HB7A 3WQ6A 4RNFA 2ALDA 4DUWA 5CLWA 1ONRA 4ZO6A 5BMWA 3G1AA 3EX3A 3GC5A 4XZWA 5T8GA 2EWFA 3N4FA 4NSBA 3P80A 1YXCA 2LXYA 1R47A 3I2WA 2PRLA 1GPWA 2WV8A 4FIQA 4JOMA 1LJYA 3BAKA 1DPMA 3T81A 3MUXA 1I0DA 1V02A 4JX5A 1BWKA 3VM5A 4UZUA 1HTYA 3VINA 5G2IA 3POHA 3PZUA 2WVTA 3VDCA 4J27A 4C7FA 3KAOA 5U7SA 3PB2A 3B0XA 9CGTA 2Q71A 2G50A 3CZNA 1TYGA 2X1UA 3V4BA 4B5SA 2KHOA 2Q3RA 3VMOA 2TRSA 4O0KA 3M0JA 1XLAA 4KCVA 3ABQA 4HYRA 4MMWA 3MTWA 1UD5A 3NJ3A 4Q8NA 7PTDA 1QHPA 5CXPA 1BF6A 1Y8BA 3H24A 3I4KA 1QUMA 1T0OA 2WSPA 5AYIA 1RLCL 4DWDA 1W1TA 3EA3A 5LZLA 3FA5A 3KAVA 1GJWA 3WY1A 1G01A 2XJ7A 1PHQA 5D2XA 1GCYA 3B04A 1A5OC 3L7RA 1C9DA 2WZHA 3M0HA 3H55A 4JKMA 3WBEA 5IHSA 4AWUA 1L2QA 4H6HA 2CLLA 1VFTA 1JXKA 3FDKA 1YXYA 1A5BA 1Z3NA 4B91A 4DJEC 3ITCA 1GOKA 3AS0A 1OHLA 2VMFA 5AC8A 1UUMA 2Y61A 2YX0A 3KOWA 4TTGA 1X98A 2UZ9A 5CC5A 1OD8A 1VPQA 2RAGA 3LRMA 3W1AA 3WLKX 3P3BA 5KZMA 1FWBC 4KMQA 2VHLA 1R3SA 4PMJA 3UYIA 4IM3A 1HL8A 1MQPA 2YDSA 3GR4A 3EZ4A 4DF1A 4NYUA 2XWEA 3UEQA 4HZ8A 4WY0A 3W07A 2WHLA 3ELFA 3NSMA 2IKHA 3ZR5A 4RX0A 3IAPA 1IEQA 1JQVA 2EBNA 2V2CA 3LHTA 2CLIA 1J4EA 5LXXA 4CD6A 3LCLA 3OEXA 4Z17A 1V0KA 3KVMA 2YCIX 3G1DA 1RQEA 2OX1A 2WJEA 4PMYA 2OYKA 4Q8OA 4HYBA 3MBFA 2VENA 3MCMA 4FOJA 1F61A 3G22A 3LEPA 3QJAA 4P7QA 4K6AA 1VJZA 3PR2A 2FGLA 1E5NA 4DLMA 3N3MA 4BI6A 4LC8A 4GGHA 4OOUA 3MO4A 5EYWA 2QR6A 1V6XA 2V5KA 1E4LA 3BCFA 2XM2A 4AIBA 3OLIA 4QROA 1W3NA 1QI2A 1RK5A 3OTRA 3AI0A 2DZAA 2BGQA 1OYBA 3WBAA 2B0MA 3I7QA 4JPGA 3NSNA 2P0IA 1V7AA 4MHBA 1V6WA 3HQOA 2CBUA 3KP1A 3KWSA 4HMDA 4HZ6A 3GDRA 3WYZA 3T0DA 2HRWA 3CL7A 3QXBA 1N7KA 4HMEA 1UR1A 1FCVA 3H2OA 3I6TA 4CQ8A 1MQQA 3LRKA 1W5QA 3WNLA 3PAJA 4ZVJA 1OADA 2O0I1 2QDHA 4YIWA 4WK9A 2CPUA 3OHMB 3CMGA 3UZXA 2I7GA 3B05A 3V36A 2NV2A 1VYPX 2YIBA 3RRXA 4U2YA 1XKYA 2WYSA 3RFAA 3W7OA 3PBVA 2PU1A 2POZA 2P50A 5I78A 3NXLA 3MSRA 1JULA 3SUVA 1G4TA 1YDNA 3STCA 2V68A 4HK5A 4LS2A 4QQUA 1HUVA 4I90A 1I1XA 1XLKA 1Z89A 1XC6A 4WOQA 5I3KA 2XVPA 3U48A 3UJSA 2ZZ6A 2CYGA 3PNUA 3STGA 1E1CA 4BI7A 4DHGA 5C8BB 5EBUA 4AVNA 3CEPA 3T40A 1EDQA 4GC4A 2WPGA 2PI6A 4PMUA 3VKJA 2E6DA 2J74A 2ZTKA 3TWBA 1EJRC 5K3VA 1NY1A 3HJEA 2G96A 5ENLA 3ARWA 2BDQA 4ZE4A 3IGHX 4PULA 2OR2A 3DFPA 2EF9A 4E4FA 1EC9A 2OLAA 1SFLA 5KSWA 3GX9A 4H7CA 1V7YA 1SQ7A 4BNEA 4QX4A 1F05A 3GFYA 1A4LA 1XLCA 3UWZA 2A79A 2ACSA 3AYRA 4LUJA 2VNCA 4MJ4A 4S23A 5A2BA 3WQEA 3AMLA 1DJGA 1WDWA 4XIMA 4FXRA 3GC2A 1I4NA 2YB4A 2C1IA 2PTDA 1GOXA 3MKVA 5A8QA 3MYPA 2HE5A 3G5EA 3FHAA 2HXUA 3HPAA 4J28A 1TELA 3CAVA 4CQDA 1TPB1 3S83A 1XCFA 4AZ7A 3ORWA 3BXWA 4Y8FA 1WZKA 1XW8A 1MUCA 4GVHA 5AC4A 2ZFAA 1FDZA 3VUPA 3T44A 4PMRA 4QRNA 4Z1BA 3AO0A 2WO5A 2NV9A 4HR1A 1YADA 3SRFA 3VNYA 5G1MA 3T55A 1FHDA 3EOOA 4DYEA 4IFKA 1DWFM 1QATA 1OFEA 3BG3A 1VKFA 2X0HA 1TPFA 2VD8A 2WZEA 1UUOA 2H3DA 1W5NA 2BNJA 3I4EA 3LQLA 3LY0A 1WKDA 1MYRA 3TZNA 4ZA0A 2NZLA 4RKAA 3SFKA 2X2GA 3M64A 4PUWA 4ZFCA 2V67A 2PDIA 3BARA 3GHSA 4NU7A 3EKZA 3CV1A 1QPNA 5I09A 3UNTA 3KAWA 1XDMA 1F3XA 3WLJA 3AU2A 2QCDB 2BBFA 3OVQA 2F1BA 1WOBA 4EE9A 2PD5A 1T40A 3RYSA 4A2SA 4GFIA 3D3AA 1P6BA 1XCWA 1JCTA 2RDWA 1MEWA 1PSCA 3WIJA 5FCZA 1S1RA 1W3TA 1E0VA 3UWVA 1OB0A 2A3EA 1TO3A 3ZM8A 1P43A 1W8GA 1VZWA 3DESA 4B9ZA 3ER9B 1UPPA 2ICSA 3MA8A 4TMCA 4M81A 3JVAA 4DM1A 1VR6A 5I07A 3NURA 1GVIA 3S3GA 3ITGA 1JGMA 2YR1A 2IMRA 3CH0A 2FIQA 3B0VC 3QGAC 2XM1A 2OELA 1OF6A 3SCSA 4Z0JA 2IQ0A 3KZPA 4DXXA 4IL0A 4HPNA 4CCZA 1VFHA 1X6LA 1JFXA 2VEKA 3NYZA 3WUFA 1FHLA 5KETA 3R10A 3VYLA 1AJZA 4ONVA 2Q8LA 3ATZA 1ZP4A 2XIBA 3BLOA 2BOFX 1GQJA 1EQPA 2BP1A 1IT0A 3OO2A 4QR6A 1XGZA 1FKWA 5SWUA 3NDOA 5ABFA 1UZDA 3ECQA 4TX8A 2G3FA 4UWMA 3KFTA 4RNJA 2VFFA 3W1LA 3BVTA 3N2CA 4HNVA 1NFPA 1R3TA 5HNNA 3NM3A 4QG8A 4XBJA 3LX9A 5EU9A 2HQAA 4PTWA 2ISDA 4Z2KA 3I3DA 2RH9A 1QW7A 4KEUA 1BSIA 2VZOA 3EMZA 1OGGA 1O1ZA 3LMYA 3KVLA 4XG1A 4EOUA 4LBUA 3S6DA 3HAJA 3S2CA 1PDYA 3EMQA 2QUMA 3KBSA 2X30A 4ZSTA 4XZBA 3JU2A 3M46A 4HN4A 2Z2BA 4FXFA 2A85A 2WAGA 4YS1A 3NQEA 3BAYA 1A0DA 3EWZA 1ZY9A 2BGSA 4NF7A 2HK0A 3WJZA 1UBPC 3QWEA 3C0LA 3FD9A 1UKPA 3VAVA 3AYSA 3ONCA 3VFCA 4O10A 2YIVX 3S1WA 1U5VA 3Q58A 2WCGA 2WMFA 1E9LA 3FKKA 4DVOA 8XIMA 4FF7A 2WVSA 1DEDA 3BUBA 2J78A 3NYDA 4DF0A 4LJ3A 3I6RA 2QV4A 3MDWA 3IUDA 1IT8A 4UOQA 2PMRA 3QKEA 5AHMA 5A6TC 3VD9A 1XGEA 4UFKA 3MCNA 4NJHA 4H8SA 3WQCA 3UJ2A 2Y5JA 3MMTA 3PZ9A 4IT1A 5GJPA 1YPXA 4XAFA 1P0BA 4R5IA 4FA3A 1QBAA 1E15A 4HNCA 4KRTA 4OOZA 1EUAA 3DZ1A 3W02A 4Z1DA 5LIYX 1IWPA 2GQ3A 3QFWA 5HK4A 1QNVA 1REQB 4JHMA 3SRHA 3E0IA 5DX7A 1UD2A 4AX6A 4TQTA 4O1FA 3SCWA 4GKTA 1X6NA 4LS1A 4UR7A 4J2MA 3RMEA 4JAWA 5CCZA 3NDZA 1FWDC 3GHUA 1I1WA 3G6LA 3TW9A 4M6QA 4IPNB 4RZBA 4DO7A 4IICA 1XLHA 1KB3A 2AL2B 3GVWA 3P60A 3OGSA 5DMNA 1V5XA 4GGBA 3VIFA 1GNLA 5BRQA 2NXIA 4IUOA 4Q22A 1B9BA 1QK2A 4Y9AA 2WSRA 3QRHA 3SUWA 1QNSA 5GNYA 3EX1A 4E8CA 3UERA 2P53A 1HKJA 1F8IA 1TWIA 1GZ1A 2D73A 4PB5A 5H1WA 1ICSA 3BV4A 1XSIA 4XKMA 3MJMA 4IJBA 2X42A 3A9BA 3IK2A 1E51A 4E8GA 2NCZA 2Y1HA 4AZCA 3L2LA 4XBSA 5JXQA 2YIHA 4LANA 5FJRA 4S3KA 3QR3A 1WKYA 3D0CA 4QBXA 4RZ4A 3KL3A 3SCUA 4F66A 4YTUA 4PFMA 2CFFA 3BW2A 1HXJA 3L66A 4YTRA 7XIMA 3VCRA 3RXZA 1Q2RA 2V3FA 2V3EA 3H7UA 2UY2A 3OQEA 3MWAA 2VYOA 4DUOA 4WPCA 1GUVA 2ZRXA 4KWWA 4O19A 3TH6A 2DVXA 3KBVA 5IHRA 4N4QA 4UTMA 4R5LA 3TAOA 2F6KA 4MJMA 2A6NA 1JF5A 2C6QA 3A5FA 3OGRA 1AH3A 2ZXQA 2DSUA 2X5CA 3V0SA 3W2LA 1J0HA 3WQGA 2OOGA 1W8SA 2BB0A 5FEWA 1AA1B 2BOEX 1WQ5A 4C6DA 4N4PA 1B3OA 3WLHA 5J04A 4W86A 3ZVIA 4LAUA 1VFUA 5M2FX 1OSEA 3TJ4A 1E4IA 1QPKA 4LXFA 3FJLA 4NILA 1FCBA 2R94A 4DZ5A 3VIIA 3W2KA 1RHCA 4J3UA 3ABHA 1ISZA 3B9OA 4I9JA 1US3A 4EXQA 3FSTA 4NJJA 1CPUA 2ACQA 4JTQA 1Q6GA 1B31A 4YLWA 4ERGA 3L0NA 2R24A 4PR4A 4US6A 1LRTA 2OO2A 3HPSA 2VOMA 2ZZ5A 4DBUA 3UPWA 1XIHA 4N02A 3CQIA 5HAOA 4CNNA 1RQBA 3SQSA 4AHQA 1LG2A 1VBHA 4WQ6A 1X8FA 1A53A 2PRMA 4Q7IA 1C91A 5HNUA 4TUFA 4PEEA 3GIPA 2XU2A 4KERA 1AQHA 3UXIA 2V5CA 7TAAA 2V69A 1DXFA 3WF0A 3CKDA 3WQFA 3E9AA 4DYLA 3HFYA 1B3ZA 2JNSA 3APTA 2D20A 4EZNA 4YWSA 1P0KA 4HMNA 3CQ0A 3G24A 3VOJA 3AZTA 4UTTC 3DHFA 2E9LA 1OGBA 2ZVIA 4DEFA 1SJDA 1PYFA 4M0XA 3PZGA 3S5SA 1PUDA 1HVXA 1YDOA 4BA0A 1OC6A 1HT6A 4NAFB 3HGRA 2FJUB 5DMLA 5A2CA 2YDRA 2PGEA 2NQLA 2H8XA 3FX4A 1POJA 4O1CA 1QOQA 1LL6A 2J8TA 1ZCCA 1JF6A 5IFPA 4RPPA 2YXXA 1JPIA 1CENA 1EWEA 5JU6A 3AXXA 3Q94A 2PWFA 1F6PA 1X38A 4I5RA 1FWEC 4QJ5B 3M44A 1OFRA 3VABA 5IBXC 2FTPA 3NZRA 3MUAA 1YW1A 3SGGA 3K5XA 2J75A 4MDOA 4F0SA 2G37A 3HG5A 4UQBA 1KGXA 1K6AA 1TTJA 2VO5A 3OA3A 1EXPA 3N25A 1DJQA 3W6YA 1W1A1 2AAAA 1RPXA 3N34A 4WSKA 2XPKA 4W7WA 3SI9A 1CGWA 3CASA 4MY8A 4O54A 2X7WA 1VLWA 4GQQA 3UR7A 4MNMA 1EHNA 3W70A 3KBMA 1J0IA 3LA4A 4XZMX 3NQ8A 5E09A 3DG3A 2PDLA 4TX9A 4H6IA 2ZADA 1WUEA 3W29A 1C3FA 4M3PA 4NX5A 3WNNA 3TNBA 1FDJA 4B4FA 2I5IA 2W27A 3RLVA 4TU1A 2VGGA 2DQWA 4XTDA 3Q0KA 4D2JA 1T8XA 4H6QA 2ONEA 4S3BA 5DELA 5AZ0A 4AVFA 4EZSA 1T99A 1EIXA 1DKXA 3OVRA 3E96A 3OA5A 2NUWA 3CZEA 5DEZA 3LOTA 1KFCA 4M29A 2GJRA 8TIMA 1TIMA 4FNPA 4W87A 1QO5A 4QCFA 3H21A 4QTGA 3DCPA 5TNVA 3UWEA 2EPLX 2XHYA 4LYRA 2NX3A 4Q3MA 1H11A 2F2KA 1R3RA 3RDKA 3E1F1 4IWQA 1YMYA 2J8FA 5XIAA 1N55A 1US2A 1X6UA 3LB0A 4C6JA 1JAKA 3F4CA 3E0FA 1MRQA 4EXBA 4JN7A 1DJNA 4UQAA 4QIUA 3V5FA 1IGSA 1R2RA 1L8PA 4B4HA 4UTHA 5IBXA 1L6GA 3R43A 3ZVHA 1D9EA 4HU4A 2D0HA 2QUNA 3O9NA 1RAKA 1YLVA 2WMIA 2GVEA 1I2OA 2F7RA 4O8AA 3GUWA 2X09A 4ATMA 1JCXA 3C3NA 4QDWA 4PFHA 3NO5A 2VRKA 4HSHA 3VGBA 3W7KA 3TFXA 4J1OA 3S2NA 2HVNA 2Z00A 3M43A 4AC7C 5F1UA 2V5JA 4JS3A 1UR4A 1FY6A 5KTLA 3GTIA 4GJJA 3AZRA 1UBSA 4HN8A 1JDDA 3W73A 3RCYA 4HTYA 5J8LA 2PDQA 3EA1A 4QE5A 2E40A 3CYJA 2JKPA 5XIMA 2E77A 3LSCA 3FDGA 3T4CA 2XSAA 3ITVA 4OV4A 4BQ2A 4JIQA 1H2JA 4QCEA 1UCWA 3WH6A 3BQ6A 1RVKA 3RX3A 1HFBA 4V1YA 5I7GA 2GUBA 3BE7A 2CZFA 3MSDA 5T91A 2B4GA 3MPGA 4RDWA 2NQJA 3IWPA 2EG8A 2PDNA 3A98A 3UCDA 4CNTA 4V33A 4L61A 3VKKA 4UB9A 1WAUA 2W5FA 3E2VA 4IQLA 2E3ZA 1DXIA 3WX7A 3V0UA 1D7FA 3HM7A 4D6GA 4PRRA 1KBBA 2EPMX 2YGYA 3KCOA 5M1TA 1IWAA 4R5GA 4H8HA 3FVMA 4MAZA 3H7RA 3GKFA 1OA0A 3AXKA 3BGJA 4GE8A 2CZDA 3R13A 4WKAA 5LA1A 1NOUA 2CLOA 3W6MA 1J8VA 2YXGA 5I5RA 2DORA 3IPWA 3TJLA 1HX0A 1WZAA 2XGZA 2BSLA 4ACYA 1OZQA 3M6YA 2EGZA 1O7DC 1X97A 2NUYA 3I04A 4AMCA 5FF2A 4JWEA 1KO0A 1UP3A 2I9EA 3GU1A 2PDXA 4WKHA 3UPBA 3BUDA 4IPJA 3XIMA 3BSHA 5FF4A 3KE0A 1V3KA 2INEA 1ZJBA 2VFGA 4DI9A 4NL1A 2V81A 5H8MA 2I1OA 3GZAA 5GJMA 3H12A 3CAKA 4ZQCA 2R1LA 2QUTA 4AWTA 4PTDA 3OWGA 1I45A 4B3LA 5ABTA 1ZUAX 3HB9A 2IKGA 2QCLA 1K03A 3LTSA 1I75A 3W38A 3EDDA 1OWQA 3CS2A 4MVAA 3R0UA 3ZXWA 4HZMA 4IMGA 1FUYA 2F9RA 3RV0A 4JHOA 5A8PA 2PWUA 3N2XA 1GQIA 3PTKA 7REQA 3WF3A 1MSSA 3MYOA 1G94A 3N6HA 3T42A 1C8VA 1ZHAA 2V82A 1XYAA 2ZYFA 3B53X 2DIJA 4IUGA 4GX9A 3QZEA 3T0TA 3K8KA 4DJDA 1XLBA 3CNYA 5HBFA 3WNPA 4NIRA 5FF0A 2A3CA 2XIOA 3ZZ1A 2E9BA 2WSQA 4FR1A 3AQUA 2AMXA 4PTVA 3A4JA 1G4SA 1LWIA 4W9TA 4CNPA 1GZGA 2H3BA 1YRRA 2ODOA 3ANUA 1O66A 4L1GA 2PPGA 2YPIA 3IIVA 2XWDA 2FFCA 1I4LA 1A47A 4W8LA 3SM0A 4LCSA 3K8MA 3FCPA 4ZB0A 1XPGA 2Z24A 1TV7A 1V3IA 3NQMA 1JDCA 4IXHA 2IXUA 1WKFA 5G4WA 3B8WA 1G5AA 5DT5A 4RZ6A 3SAZA 1ZFJA 4ROPA 1P6CA 3HMJG 3W9ZA 4F8XA 1MNSA 3IJ6A 1XLEA 3LD5A 4BCEA 3DFTA 3F5KA 1ISXA 3B9EA 1T8QA 2DJXA 1CB7B 3HPXA 2OSWA 4WPEA 3GXFA 3QZAA 3TC6A 3UCQA 3IK4A 3QV8A 2FLIA 3GDMA 4WCJA 3N11A 3LCXA 3NL5A 1JR1A 1NF7A 4Q4RA 3EWBX 1VEPA 4HU3A 1AFSA 4I9MA 3QA8A 4JNYA 2VFDA 4F9DA 5CZSA 1QR7A 3A4WA 1RJQA 1HO1A 2I56A 4F2UA 4C1NA 1B0IA 2J9YA 1W5PA 5FJOA 4Z2IA 4IP4A 2QF8A 5BOFA 4Z2HA 4GYPC 5AN7A 2KAUC 1PIIA 4MY1A 3IVSA 4LBSA 4NNBA 4JTFA 4CCCA 4DZIA 4Z08A 3RO8A 1W0MA 3M0MA 5HANA 4HHHA 4XAZA 1JZ5A 2W91A 4W7VA 3GAKA 4MYXA 1UR8A 4LOCA 2ZC1A 2F8QA 4IOTA 4EPDC 1YTEA 1A5LC 2G5WA 3KDRA 2YA0A 1QNPA 1I60A 2XISA 2V6AA 1QASA 4Y9OA 3AHXA 1CWYA 1SJBA 3CHVA 3MI2A 1Q5MA 4EAMA 2ABBA 5AECA 2PGWA 3CIXA 1REQA 2VX6A 2VWTA 5IDZA 3GK0A 3K4AA 3GG0A 4XQ6A 4UTTA 1S3HA 1NFGA 1G7VA 3V1PA 4S39A 3SJNA 4Z2LA 3HO8A 3W26A 1GNTA 1HKIA 3A21A 1R8LA 1JUKA 3TSDA 4F3HA 3MANA 1OABA 3IIXA 2DT3A 4GINA 3LMFA 1KM2A 4QGCA 3NZQA 1HP5A 4HJWA 4X0VA 3C8NA 5A1AA 2GAFD 3UR2A 3QMRA 2EG6A 4ZTXA 4LQ1A 2OT1A 3R89A 1D2KA 4WHBA 1H61A 1ZCOA 4QSHA 1VQTA 3TTEA 2R1MA 3VDHA 3CAWA 5JIWA 1E2UA 2Z29A 3JR2A 4U2ZA 2X7VA 1OC5A 3MO7A 2PC8A 2VEFA 1ZP3A 2V9DA 2XFFA 4DJED 3E0WA 5A8NA 3NEVA 1V4YA 2NWSA 3LUTA 4QNWA 3TIMA 1DXEA 3ITTA 2WB5A 3NOEA 4REQB 3HGSA 3IIZA 4CD5A 1H41A 3TR2A 3NDYA 4LTSA 4GNVA 3PZVA 4UZSA 3U8GA 1P1MA 1IXNA 4H9MA 3IJ7A 3LCHA 3PVFA 3HN3A 3EWWA 1VBUA 3W01A 4PEKA 3L4TA 3L0KA 3M0IA 2HTMA 4F40A 5BWFA 1HKVA 3KX6A 3M1ZA 3CAZA 2PDKA 2VZSA 4AIOA 1O5KA 3AIBA 1XV8A 2J25A 1GT8A 4K38A 1U22A 4O11A 3HFTA 5C2CA 1XYBA 2PTYA 3R11A 1UIOA 1IEVA 5LGZA 4FM3A 3QFEA 1CZ1A 3HF3A 3VX0A 3TWAA 3B8SA 4L5ZA 6TIMA 5F2IA 1QWGA 3FXYA 3RG6A 3JZEA 3KEHA 1JQXA 4WJ8A 3W2JA 2ZXAA 3GXPA 3VX1A 3THAA 3D2FA 2W66A 1Q8AA 3BMXA 2FH6A 3G0XA 3S1XA 3W28A 1XBVA 1FWAC 1XLGA 1XDJA 3NPUA 1A5UA 3B9DA 1QHOA 3CZGA 4M51A 3BUIA 4A3QA 3F5LA 2Y7FA 6ENLA 4NRRA 4YHEA 3UWUA 1TKKA 4F0MA 1O5QA 2PURA 2AGTA 4IM0A 4WSJA 3TTYA 1TMLA 5E9XA 2WQPA 4M5PA 4J3TA 4HQVA 4DIAA 2EPOA 5A95A 3LM3A 1I6NA 5EBAA 2CESA 1TPUA 4J3WA 5F1VA 2JGYA 3UXKA 5CEWA 4ZSUA 2NXHA 5EMMA 3NQ6A 3EXRA 1IZKA 3MP4A 1OCBA 5CH9A 1DVJA 4JL1A 4L6OA 4INFA 4O57A 4RL3A 4LU0A 1MW2A 2DDXA 3S5NA 2YA1A 4YWIA 1MRAA 3RN6A 3W37A 3AJXA 2WANA 3W7CA 3R8RA 5DXYA 4MJZA 3D3FA 2E4TA 2BHYA 1ZQ5A 3GH7A 1ZPTA 4GKLA 3TZFA 3FVDA 3DYMA 4H9TA 3VOCA 1R46A 1ZALA 2PODA 3M0ZA 1XX1A 1CXIA 1KXTA 4JQ3A 1P1XA 4UR9A 4ZCWA 1DTUA 4O1AA 4LNYA 1YHTA 1MXDA 2ABAA 3C56A 2MI7A 3W25A 5FAJA 1CIUA 4C6NA 4GLEA 3WO8A 1V3LA 4RDYA 3W1XA 2LLEA 1FWCC 1SGJA 3STFA 1J5SA 3C2YA 3CMFA 3G9GA 3VOHA 4LALA 4OQVA 1JZ8A 4O13A 2D0GA 4A8LA 1K9FA 1CW2A 3DI1A 3HURA 3KHDA 2J88A 2DZSA 4DY1A 1R9YA 1TVNA 2C91A 1RA5A 3GHTA 1HKWA 2DUAA 3NQ7A 4AX7A 2WMGA 5CJNA 3W1RA 2YKKA 1VCFA 3SCNA 4LYQA 2OB3A 1X7IA 2C0HA 2C79A 5EY5A 2XVGA 6REQB 1UMLA 3VC5A 3L3PA 4Q8PA 4J3VA 3CUZA 1EXBA 3W6LA 3QHOA 5D4YA 1ZBCA 4R3UA 2HBVA 2WSKA 3FEQA 1UWQA 1KFLA 5FL0A 1TQUA 4K39A 4WDWA 4KGJA 3JRKA 5IXEA 4DM2A 3UY7A 1JXJA 4G5DA 4ZENA 1JUBA 3B9NA 1R33A 1W3KA 1SW0A 3AICA 3M0XA 3R8GA 4D1IA 1GW9A 2DV0A 2DIKA 4EPEC 4HNTA 2E6AA 3OW1A 4E8DA 5CBJA 1LT7A 3DX0A 3WD2A 1UWTA 1C29A 4JTJA 5JQ9A 4O52A 2ZUNA 4ILSA 3UD6A 4X0NA 2OYMA 3QR1A 2QV5A 3SB0A 2CW6A 1O5RA 2ALWA 5CPTA 3EOSA 2G8ZA 1H4PA 3KTSA 1PKMA 3M0LA 4EZUA 1QNOA 4R33A 3Q84A 1A0EA 3GYCA 4HOZA 2DZTA 2YYTA 3ZT5A 2XVKA 2Y5EA 5ABHA 4YVPA 1KM6A 2BWGA 3EX2A 1UWRA 1RY8A 4DO4A 4PCSA 1ODUA 1OIMA 4JICA 4Z2GA 3UR8A 1UWSA 2PDBA 3SYVA 1WV2A 3NXFA 1SO6A 1FOBA 3UA3A 4MB1A 2Y4SA 4J35A 5IDIA 1JNEA 1OFBA 3FHQA 4B15A 5LNVA 5BWAA 4XD6A 4Z1CA 3ACOA 3NIYA 4NZFA 3AC0A 5CPSA 4JFSA 4IHCA 3WLNA 4FIRA 1OX4A 2JQXA 3UG5A 1B2YA 4NASA 3Q4DA 3BUVA 1GK8A 2DGAA 3DX3A 3G77A 1YX1A 4PB3A 5D9OA 1RPKA 1W9UA 1ECQA 1K8CA 2ALRA 2PF0A 4R5KA 1KLYA 1G69A 1QPQA 2HK1A 1DL3A 2VGBA 4WJXA 1PTDA 4DF2A 2HJPA 1TX0A 3LNMA 2DZXA 4HYVA 4KFNA 2UWFA 3GHRA 2OYLA 3BW3A 3SUSA 4BWLC 4Z1AA 4Q4KA 5AC5A 3OVGA 4I1QA 2WNNA 2E68A 5C9XA 1MFVA 2X3XA 1BWLA 4L7ZA 2WK2A 1GHRA 1F2JA 2AMGA 4KWSA 2XH2A 1H5YA 1KQYA 3BUQA 2IUZA 3AIEA 1FKXA 3N6QA 4GNKB 2E5BA 4JY8A 4AZCB 3KTXA 2PP0A 1CX9A 1HJXA 3CUFA 3NQBA 3UFYA 1YDYA 4D6CA 5C5BB 1ONEA 3RCNA 4TX6A 1AD1A 2BFGA 2G0WA 1KGUA 1N82A 4NAEB 3GFZA 3DX5A 2ADAA 3OLDA 2GUUA 3P81A 5C71A 3TTSA 3D5HA 2WHMA 2JKAA 2W61A 2D1ZA 5DBUA 5DQPA 3MS8A 1DWAM 2QF7A 1CLVA 3T6CA 3VDAA 4DLFA 2ISVA 1D3GA 5FF7A 1VAHA 1RUSA 3NVTA 1IXOA 1TQJA 2PDCA 4J5NA 3H7VA 2NVDA 4KFOA 2ZWYA 3BGAA 3LCIA 3W75A 7A3HA 3WD3A 4U5KA 3GR7A 3QGKC 5CZ0A 2FHCA 3ZIZA 3DGBA 1OT2A 5DLCA 2GGHA 2FZBA 1F4HA 2MANA 4H9ZA 3WLSA 2GSJA 1PPIA 2E1WA 4OECA 3O1NA 3U5UA 2QCDA 4JFTA 3PM6A 2RAJA 5FD0A 3PFMA 1RBAA 1RP9A 3C2EA 3M0VA 3W3OA 2OWXA 2GJLA 4NYYA 5EMLA 1IEXA 4PMDA 1R38A 1M6JA 3N15A 4JTDA 2H8ZA 4OBSA 1FWFC 4B9QA 3TLQA 3PZIA 5I06A 2INFA 1OM0A 3A4XA 1S2WA 7ODCA 3WMSA 4EP8C 2OLHA 4JIEA 1WKEA 1J6PA 2W0UA 3R8HA 3GAYA 4W7UA 3ZT7A 1Y5WA 3BOFA 3JS3A 2FKPA 4D8AA 3R0DA 1ZZMA 1P0EA 5M03A 3PJUA 1Q6LA 3EJTA 2Y7DA 2WMKA 3T2OA 5AYBA 1YEYA 3VC6A 1H3GA 3GXTA 4MYAA 4EANA 5AZ1A 5AHLA 3DUGA 2OOFA 2G3IA 2IPGA 3VE9A 1M53A 2ISWA 3RR1A 5REQA 2CNCA 1NM9A 3PFRA 3PWGA 2EG7A 4TR9A 1TREA 2Q09A 4GY0A 4BK9A 1GQLA 5ABGA 3AMCA 3BSMA 3FNDA 4NP7A 1J0KA 4KS0A 4DB7A 2F84A 3ZSTA 2ZX6A 1UKSA 3P62A 3U4AA 5C9UA 3CK5A 4BQ5A 5GQBA 1DKYA 3VZYA 1EWDA 4MPKA 4HA1A 6A3HA 4I3GA 1JVNA 3B3DA 3S1UA 3TW6A 4PMZA 3INPA 3GBDA 4OTKA 3GSMA 2GVLA 3XINA 2QW5A 3CEUA 1GKRA 2VURA 1TMQA 5CZTA 2W67A 1TPC1 4LAKA 5A6KA 2XYLA 5C2GA 3P6LA 2PWVA 4RDVA 4FMVA 1K4HA 4IFOA 4H7VA 1SYTA 2VC5A 1E6RA 3KBJA 4JQAA 1VRDA 1OFDA 4A22A 2ZUWA 3PHAA 4JTLA 4FNRA 1GVOA 1KXHA 4NQIA 1FH8A 3ZJ6A 3DBPA 4CD8A 4JIRA 4MPQA 4ZTYA 4A2RA 1UZ1A 2QULA 3EMCA 4CUCA 4ACZB 4IGNA 4KCWA 5LNWA 2A3LA 4NPHA 1AW5A 1K8XA 2YL9A 4IQJA 2F2HA 2W92A 1JCYA 4PCNA 2NQ9A 3LQGA 2YZRA 2J7DA 3W2MA 2DZPA 2FZ8A 5D9PA 3VK5A 3GDLA 3GNOA 4UOJA 2X8RA 3GO2A 1TCMA 5LIWX 4EZZA 4KBXA 3VIOA 2C15A 3D6NA 2CHNA 1W2VA 2YDAA 3M47A 3VNMA 5DT7A 3E2SA 3CB3A 5CPLA 3V18A 4EZTA 4XZHA 2QJHA 1DJYA 2FGZA 1CGVA 3C4UA 2GQ9A 3TSMA 3EDKA 4E2BA 5CGTA 2NV1A 1K8ZA 5EKYA 4MFDA 3HAIA 1UOZA 3GR8A 1AQ0A 3EDFA 3TR9A 4AZGA 3NQFA 1ZAHA 3M41A 4IL2A 4U33A 3BLEA 3VKCA 1SPQA 3TA6A 3WQPA 3TC3A 3VGEA 1FRBA 3BAIA 1F9CA 3OZPA 9XIAA 3SCOA 3WMCA 1PZ0A 5TQLA 1UKTA 1QI0A 2C08A 1JI2A 1KCXA 4YTSA 1KR0A 1G9HA 3KTCA 4KH2A 4A3UA 1XXXA 1EJWC 4CGTA 3GH5A 3ES7A 3WLQA 3SJ3A 4ENLA 4ICCX 4FLOA 3HOJA 1A5NC 4GQGA 4AAJA 2HV5A 2AQOA 1UR3M 3RV1A 1V02E 2GJNA 3MSYA 1H1YA 4XVDA 5HNTA 3W4RA 3DOPA 3MHUA 8XIAA 3RM9A 2VX4A 1V77A 4X2RA 4DUVA 3QMTA 1IF2A 1F8MA 4O50A 2PLCA 4O18A 3M7SA 3HGJA 4YYFA 2AKMA 4FALA 4FLRA 3VE7A 3Q37A 3SCPA 3PBYA 1BVNP 3OG2A 4FXSA 1PZ1A 1KFKA 4M1BA 4GOAA 5JUVA 4QEHA 4W4QA 1HQTA 4ZQPA 4D6FA 3ITOA 3CWNA 1BXCA 2YCLA 4MZ1A 3EB4A 5B7ZA 3C6CA 2Y70A 4Y9MA 3GTXA 3WQ5A 4HJFA 3APGA 4L1WA 3B0YA 4K3ZA 2BZNA 3BJSA 1SMAA 4PUDA 2EEXA 2ANUA 3QVQA 2B7PA 2J8GA 4W88A 1XIMA 1GQKA 4IIHA 4AZBA 1B3YA 4BQ4A 4GJIA 5CPNA 1OG0A 3VCCA 3VD4A 4MDPA 3DN5A 1VBGA 4KETA 2C3ZA 3SW6A 1FWSA 1TV5A 2F7OA 3IJLA 3M0YA 1SR9A 3WH5A 3LZ5A 5GVJA 4WRHA 2JEQA 1K02A 2BG5A 3EJPA 3W1TA 1XRSA 2CBVA 3WDHA 4EPBC 3P61A 3AXIA 4JXCA 3OQ8A 2G3NA 4GZEA 4L9YA 4M6UA 1F07A 2CLHA 4OVXA 2J6XA 3TXVA 5CSUA 1RR2A 1AH4A 3T48A 1AMYA 3NAVA 2XN0A 3LM7A 4E2DA 1VRXA 1VFLA 2RDTA 1RQHA 3AALA 1GOOA 1U2YA 2ZX7A 1XYLA 4N9BA 1DJIA 1MUMA 3AYTA 1SZGA 4WIWA 1KD0A 1JIBA 3M6DA 3R25A 4IIGA 2VEGA 1CLKA 1BPLB 2OWWA 2Z0OA 2VDHA 2OGYA 2AQVA 1W3JA 2WPBA 1QT1A 1UH2A 4IFKB 4MUPA 5E0FA 3CBWA 3CUHA 3F4VA 5M5DA 3H23A 2YCJA 5H8PA 1VS1A 3QYSA 2Y7GA 3E38A 5I24A 1PX8A 1OD0A 1X8CA 4EF8A 2EPHA 2AKZA 3BCDA 3CGTA 2LM0A 4AXNA 1C7TA 3A64A 1XG3A 3MWCA 3ICJA 1HTIA 3TN4A 1AODA 3W24A 3UJEA 2YCEA 3WDPP 5BW6A 1MW1A 3TC7A 2R82A 3LRLA 1HG3A 4NT0A 2CEQA 4ML9A 2FICA 2VFEA 4HK7A 1XBXA 1FCQA 3GG1A 9XIMA 1JPMA 2GL5A 2GJXB 1W1B1 4EZWA 3URAA 1EGVA 1VHNA 2J77A 3ABZA 3C2VA 3I39X 3WD0A 1M04A 3CHCA 1AJ0A 2AL2A 5T9BG 5AKQA 1XJBA 4LYKA 1IWBA 2Z7KA 2FHBA 5FJPA 2BASA 1PTAA 4M8UA 2PDPA 4OUEA 3OZYA 4IPLA 3SADA 1UOKA 3H4XA 3GU2A 4LWWA 4DAFA 3VGHA 1QK0A 4TMBA 1DORA 1W9PA 3VGGA 3LPPA 1YE6A 1YBQA 2CKSA 3H53A 4IGHA 2D2HA 3HV9A 2PTZA 2PP3A 4KW2A 4S2CA 4KFPA 1Q6FA 4C6OA 3U2CA 2OW6A 3W2UA 4XO7A 1KBLA 3AS1A 2WYHA 4ZE5A 5JH2A 2ZUTA 3V75A 2RAIA 3G0SA 5FEXA 2GA9D 3B4YA 3NG3A 1EJUC 3NQVA 4POCA 4UFMA 5EL1A 3WLIA 4HNOA 2C71A 2GJPA 3KBWA 1R3VA 2Z0VA 1X1ZA 3N04A 4B5VA 1OCNA 4AZ5A 1YNPA 3CZSA 3BMVA 1IEWA 3BLLA 4L4PA 1GGOA 1O7DB 5BXTA 3N18A 1H7OA 1Z6KA 4C1KA 2H90A 3PZOA 1YTKA 1CNVA 4LUTA 1HKMA 4P2VA 4XB3A 4C6CA 3MMUA 4GCXA 1GVFA 1GOWA 1NAL1 3H2FA 2VDIA 2WMHA 1PBGA 4NNCA 4XAPA 1M9HA 4AEEA 3TAKA 3KCLA 2VCCA 1MMFA 2OKTA 4C5ZA 4ZOCA 1IV8A 2O7QA 4GVGA 1JZ6A 2CLMA 4AXKA 1URUA 2RFGA 3VIPA 1SFSA 3NUKA 1A5SA 2POTA 4UQCA 2JNKA 2Z1XA 4A8IA 1S5VA 1CCWB 4AQLA 3WFLA 1U5HA 4OU1A 4PBFA 4Q8UA 3GTNA 3HV8A 4XD5A 3BOXA 3QQ0A 3EA2A 4IMEA 4W93A 1BGGA 5CQ1A 3UWYA 3WH7A 1XIIA 5A6SA 2F61A 4ZR8A 4LRSA 4WOZA 4D8ZA 2G3MA 5I3DA 3G6MA 3TXZA 2PLKA 1R7AA 1FWHC 1Z41A 3CUJA 3GXDA 1TE6A 1B5TA 4DN1A 4C1NB 3WELA 1D3CA 3G1FA 4A3YA 4XD3A 1WDPA 4EWND 2ZKMX 1J2WA 2C18A 4O16A 3DH7A 2H9AA 1HKKA 1QRQA 5DANA 1ADOA 3R94A 5GJNA 4JCLA 4H19A 2VR4A 3UZYA 5CZJA 2R1KA 1CEOA 2RDXA 4LNCA 2A6LA 3F5JA 2HEJA 1XSJA 1E3ZA 2HVMA 4B5NA 3B51X 2BGNE 4ZBCA 1FHUA 4M24A 3E5PA 2FTWA 3M3WA 4EX4A 4JCMA 3H2AA 1QU4A 1ME8A 3QBUA 2PDHA 3TX9A 3FS2A 4MNJA 3A3HA 3EYPA 4KQNA 3W7QA 1HZYA 4KCTA 1ZU8A 3PTDA 1H1ZA 1I4TA 1GVEA 4L6HA 3WF2A 5HMFA 3ABOA 4Q8TA 5I3HA 2QGYA 2FYMA 4H9UA 1OZMA 3BH4A 2E6FA 1J0JA 3CWOX 2YL5A 2V3GA 3N13A 5A6MA 2W9MA 3CPGA 2X3VA 1T96A 3NQDA 4WX2A 1Q6DA 5C6MA 3VNJA 3L4ZA 5C0QA 3Q2DA 1RBOB 2G3JA 3JUGA 3CC1A 3BUPA 3L0GA 2CITA 5CAKA 4GVIA 4IWWA 1BLIA 2XFRA 2XN1A 5A6JA 3UVIA 1DP0A 1UASA 3GXNA 3KZSA 4H00A 1R5YA 5CC3A 4RE3A 3ARTA 1F5ZA 1EUNA 3NR0A 1T6MA 1NOFA 4NI8A 1Z42A 4JTAA 1W31A 3NPVA 3VDBA 1ZB5A 4IWPA 1A3WA 3BWWA 5BXRA 1DQWA 5ECUA 2FZNA 1XICA 4IW0A 1W9DM 4NHVA 2RUSA 4GWEA 2CXEA 1DQUA 1V6UA 4NZJA 3VNLA 1PJ9A 4WY0B 2ZE0A 2FYVA 4PTXA 3GG8A 4FHAA 4K8GA 3FA4A 3KDNA 1BD0A 1J11A 1HJSA 1MQRA 1PKNA 3AXHA 9RUBA 5HWMA 1D8CA 5JIPA 3AJ7A 2OMAA 1TJ1A 3FAWA 3IGUA 2XIMA 1E0TA 1NWRA 4H6EA 2I14A 2PD9A 1TV3A 3PZQA 1RCOB 5LNSA 3UNDA 4KCUA 1QNRA 2A5HA 4E81A 3EX6A 2EX3B 4DJEA 3SY5A 3OBKA 2VRJA 4WUIA 1AMKA 3DC8A 2RAKA 4L1XA 3WQ8A 3E2RA 2OO0A 4LUTB 3KWXA 1VCVA 4UOZA 1Q7ZA 1X03A 2QLYA 2PP1A 1XLIA 2DY3A 2A1YA 1OK6A 3QKZA 3T08A 2DT1A 4KKXA 4TTUA 4LRTA 2OGJA 5HR6A 3GNXA 4AYSA 5EGRA 1Q6OA 1Q6CA 2C8NA 1LG1A 1EP1A 2X1TA 3H2MA 3M4HA 4MKVA 1EZWA 2DUZA 4IQEA 3LVTA 1UYQA 1EYWA 4K7YA 3KVJA 1XG4A 4JN8A 5BROA 2HROA 1YKWA 4JD4A 4XBKA 1OG6A 1Q7QA 4U3AA 3CIVA 4PMVA 3W71A 1J96A 2Z6JA 3GG7A 4GI9A 1GPFA 4DQWA 1KM1A 2XINA 3FJ4A 3Q45A 2PDFA 3LLDA 2OJPA 4DO5A 4JKLA 2ZZ3A 3MY9A 3CIWA 1M5WA 3ARZA 4J2PA 4P7NA 1TUXA 2X1IA 1H7WA 1OF8A 4GFSA 3THCA 3E0LA 1GZJA 1KBJA 1R7OA 4FI4A 4GXWA 2PDYA 4B5TA 1ZAIA 5I3FA 4LS0A 1GWJA 4M80A 4K36A 4ORMA 4W8AA 3STEA 2C16A 1AQFA 4E38A 1E1DA 5D02A 2J9XA 5TIMA 1W9BM 3E5BA 2H9AB 1WAWA 3ALGA 1Y5VA 4Q8WA 3TYAA 1PWMA 2BVTA 4WJEA 3T2QA 1UC4A 3SCQA 2DT2A 4HU8A 3WQOA 2O92A 2TYSA 4PUEA 1BTMA 3S9IA 2EJAA 1VFFA 3HPZA 4C6BA 1GOQA 1ZNNA 4E2VA 1R2SA 4Q8MA 3B40A 4F0KA 4A4AA 4UXDA 1WCGA 3B52X 4LY8A 5A69A 4RUBA 3LPFA 4JTIA 4GABA 1W5MA 1SVDA 2XH0A 3TMLA 3PNZA 3U2OA 2HBXA 1OY0A 5HUOA 1AUSL 3RHGA 1Q2SA 3TU9A 1RV8A 5BYWA 4X3ZA 4S3EA 5HPOA 1OINA 2PTXA 4HYWA 3WJWA 4KEZA 5D2WA 4C60A 1B57A 4E5TA 4U4MA 3ZWTA 5CLTA 3D51A 2YI9A 4QISA 1BXBA 1IHIA 3SQLA 4KWUA 1TZZA 2VUYA 1VBJA 1YTDA 4GI8A 3P2VA 4JX6A 3VEAA 1M7JA 1XC4A 2WZTA 4HKPA 5KZ6A 4J40A 2WVUA 4RNHA 4PTNA 4JIIX 5TAOA 3UESA 1XHGA 4Z1YA 1ZYLA 2CLEA 5DFAA 3C2OA 1K8YA 1P0NA 3BG5A 4I8DA 3ANYA 2FZMA 3OOQA 5IOBA 1O95A 4MKSA 4A8RA 1FP9A 2DU2A 3N9KA 5LHFA 1JGIA 3A6OA 4Q8QA 4E3TA 3R12A 3A23A 3V0TA 4J3ZA 3S9ZA 4GY1A 4L9XA 4L64A 5I2UA 4DXKA 4HOWA 2PF8A 1E6XM 4PN2A 1ITUA 2D1LA 1EZ2A 3REQB 4B5UA 4XKYA 4M7SA 3M5VA 4HP5A 4PUKA 3TQVA 3ABRA 2W4XA 3PTQA 2G4JA 2E6YA 1KKOA 4QG6A 4CD7A 2BLEA 1K4GA 4JTTA 1VFMA 5H2ZA 5C9WA 1EEXA 1K7FA 3PZTA 4G2DA 1MEIA 4GH3A 3GUGA 4A8NA 1UWIA 3F7WA 2ZBTA 1BRLA 4OBRA 3DKLA 5EFDA 4OHQA 2GPTA 3V5OA 3T9PA 2P8BA 3EXSA 3QSTA 3WDJA 2PCQA 2ESCA 1MDRA 2J47A 3DC0A 3G8RA 3BK0A 3LHWA 2IPWA 5BOOA 2PWEA 3KOFA 2DZBA 4CU7A 1R30A 5D30A 1E1FA 3TW7A 2VCBA 3D46A 3H4GA 3EWXA 3RO6A 3OIHA 3VPLA 1TTPA 4IISA 4Q32A 1VPXA 2CHRA 2YL6A 1K6WA 1AVAA 2GQAA 3QPEA 4JIPA 4HNLA 2WBKA 3CU2A 5CPMA 2VGFA 5HDRA 2RGLA 1DQXA 3MV11 1LQAA 3NO3A 3TOYA 2FVKA 1GKPA 2FB2A 4C6PA 5DMYA 5GPRA 1UD3A 4D8LA 1VP5A 4K37A 3EJQA 2ZDSA 4FNSA 3BOLA 2XG9A 3S1GA 2ATSA 2X3WA 3G8EA 4XTIA 5I3IA 1M41A 1NDWA 2W63A 3E2QA 4DYKA 4XKYB 3WSUA 3EB3A 1QPOA 3MVTA 3KS5A 8RUCA 2NX9A 3OLEA 3WLLA 1GVSA 2XH7A 4JNFA 3EAUA 4PCFA 3KL5A 3RR4A 3TQKA 2A21A 2I17A 4W8BA 3MW7A 3VNIA 4Q7BA 4AZHA 5F4XA 1PTGA 2XGBA 4GI6A 1UR9A 3E6EA 2E9MA 5HWNA 4JNMA 1XLDA 3EDEA 3I7SA 2VDGA 1HJUA 1JYVA 1FP8A 1KKRA 3ERCC 3WK2A 4KEVA 2A7RA 1EEPA 4IG2B 3STPA 3TQPA 4M6PA 2Q8ZA 1JRCA 2YL8A 3DDFA 4MM1A 3R2GA 4CNUA 1FWWA 4UQ9A 1B54A 1G6CA 2V5LA 1ZGDA 1PAMA 3N73A 2ZUSA 3LCGA 4CQAA 5F2MA 3RX2A 2A3AA 3FJNA 3CZ8A 3ANVA 3RU6A 4PB4A 2OO6A 3FK4A 1RXOB 3VTRA 3QHNA 1EJXC 1A3HA 1U83A 1BQGA 1UB3A 2HVOA 2IKIA 3TYDA 4IJCA 2J7FA 1GW1A 1ZLPA 1U33A 1B90A 5JVLA 1UWAA 5JH1A 2F6UA 2WKGA 4DI8A 4RXFA 3T2PA 5H91A 1DJWA 2F7FA 5D37A 2XZ9A 1I2NA 5HPCA 6TAAA 2DUXA 2WMJA 2BVYA 3O8AA 4DBWA 2QJIA 5G2HA 1BF2A 3SN0A 2Z27A 4ZQOA 1GJPA 4LVBA 5T9CE 5CZKA 2D2GA 1U1HA 2WCSA 4JL2A 1FFQA 3ES8A 1HW6A 3ARQA 2FQIA 4B5WA 4N9CA 5I0DA 1OVDA 4NZ3A 4YTTA 3GVRA 4LH8A 2PU0A 4EVZA 1ADSA 1NQKA 3CB8A 4PTMA 5TBOA 4IPIA 4DCNC 4JTRA 5LKYA 4S1FA 3T07A 3S2MA 5BOEA 1ICQA 5GNZA 1XISA 4U5IA 1FDYA 4MKNA 1G4EA 2GGGA 3KP0A 1HIZA 4NXSA 3WNOA 5KMYA 1UP2A 3GXMA 1OGSA 1PS9A 2DH2A 3P74A 1KFJA 1ZTVA 3G1SA 4GIEA 3TJXA 1A80A 2Z1KA 3YPIA 2QNEA 3W7NA 5G1TA 1EDGA 1R87A 1V0NA 2ZQ0A 1Z69A 2Z25A 3ZS4A 3BVVA 3RLHA 4LV9A 2EKGA 2XZ7A 2XSBA 4AFYA 2VC6A 4CN4A 2MUCA 3WH9A 3WLTA 2VC9A 3E0VA 2HSAA 4F9JA 4JQ2A 4TV6A 5F2GA 3GLCA 1UD4A 5HQMA 5LA0A 2XUCA 4HHMA 1F3TA 4UCFA 1LRNA 2E28A 3VKHA 2YOCA 3IJIA 4QLLA 3MUY1 2E0PA 4J3XA 5F2LA 4K1WA 3SEPA 5LSMA 4Q8VA 1E72M 3LI1A 1XGDA 2WYIA 4H7ZA 3CQJA 1W1PA 2C1HA 3HBLA 3PPCA 4DBSA 1MW3A 3T49A 3IIPA 1G0CA 2J6VA 4N42A 4JYFA 3A24A 3LHUA 4UFLA 1S5NA 3K46A 3WLOA 1E71M 1RCQA 4OGZA 4BWLA 3WENA 3TONA 3W1MA 1HJWA 3LGEA 1RY0A 1P4CA 3CO8A 5E0CA 2OBMA 2EFLA 1PO9A 2GUYA 4G7EA 1XFBA 1V6YA 1JCMP 5K9XA 1V3JA 5I3JA 1VFSA 2GSHA 3UETA 1Z9AA 1LBMA 1SFTA 3ZJ7A 2DVUA 3BO9A 4ZO7A 1DBTA 1JDFA 3U4FA 1Y65A 3T09A 3AMGA 1VEOA 3ARSA 3DPPA 4QLJA 2RKXA 3W2NA 4ML4A 1K70A 3GNNA 1XD1A 1XLFA 1LP6A 1JD9A 3TDFA 1OCJA 1R85A 4JLCA 1GONA 1S1PA 3TP4A 2DVTA 1S5MA 5FIGA 3U7VA 3OBEA 3UG3A 3ZQ9A 5AVHA 2OW7A 2P3ZA 1NEYA 3N2MA 4EWJA 2Y62A 4AEFA 3LXBA 5C7VA 3WD1A 3WNKA 3BG9A 2V5DA 4KWOA 1VGAA 1H5VA 3ME3A 2OZTA 3M7WA 3TYCA 3CWHA 4M0MA 5C7HA 1C90A 1H7NA 1QDSA 4NY2A 1C8QA 3CUGA 3U0HA 4AD2A 2WLZA 1E4MM 3PS7A 1L9WA 1V51A 1W9VA 3NQCA 3O7UA 2WOQA 1SUXA 5C9RA 5D09A 3P0XA 3WUGA 1OIFA 1U1JA 2DW7A 3UCCA 3W88A 1HXKA 5LGXA 3H2EA 4IGSA 2N3KA 4EACA 4EZQA 2NSOA 1TR1A 5KZEA 1LOLA 3W1NA 3CPUA 1WPCA 3G3MA 1LQ2A 5D8ZA 4IX2A 1WO2A 5E70A 3QV7A 1ISYA 2HDJA 1KXVA 5CC6A </