2YL6A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 173
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl6A01
1I75A 3ZOAA 3CUFA 4QP0A 1EOKA 3CMGA 3AHZA 3LPOA 3CZEA 4B9YA 3A4XA 1OCQA 4GXPA 2FHCA 2PBOA 3MU7A 1I1XA 3ZJ6A 5IFTA 2JF7A 2J77A 1L0PA 4AD0A 4DM2A 1VEOA 2GK1B 5JUVA 1HVQA 1G5AA 1US2A 2ZXQA 2AAAA 3QGVA 3DYOA 3MO4A 4BZYA 2OYMA 2WLYA 5A95A 2WHKA 4H41A 2X0HA 1AQ0A 2YA2A 3E1F1 4RL3A 1XRVA 4H04A 4K68A 3UETA 2JF6A 3BSGA 3EDFA 4CUCA 1WDQA 3M07A 1E6RA 4OBRA 1UHVA 1UWQA 2FGLA 4ACZB 1HX0A 1CXLA 4P8XA 1CXFA 4WIWA 5BXPA 1IZJA 1KCKA 1LL7A 3WEZA 4AZ7A 3BMVA 2A3BA 4Z2IA 5I0DA 3QHOA 4PTXA 1KFWA 1FHDA 1V02E 5D8ZA 3IANA 4CD7A 1UQYA 2DSWA 2WMKA 2FHFA 3N18A 3A47A 1K9DA 4JFSA 2WMIB 1KXHA 4EE9A 4TVDA 2ZX7A 1V6XA 3CGTA 2OZNB 4OZOA 1V0KA 2CKRA 1UKTA 2VO5A 4LGXA 2BVYA 3AYRA 3CPUA 4W5UA 2DDXA 1XH1A 2TAAA 4J7RA 2W5FA 1ISYA 3K4AA 1BPLB 3SUTA 4A4AA 3AMDA 1B1YA 4NZCA 3AI0A 1UWTA 1TZ7A 3OLEA 1MFVA 4B9ZA 2BXYA 1R7OA 1MXGA 1Q6CA 1B90A 4KH2A 2Q8XA 1OGGA 4BF7A 3I3EA 3AHTA 2PWHA 4Z2HA 1JI1A 3UESA 3B9DA 1TG7A 2XIIA 4FZOA 3L4ZA 2J7HA 4EKJA 1WNOA 4CVWA 4C7DA 1J12A 3BAYA 1B3XA 1HJSA 4FF5A 1W9VA 5E6YA 4PTVA 4ATWA 1GONA 1HL9A 3WSUA 3WF1A 4ACZA 2FGZA 4FLRA 4MNJA 4LXFA 2OLHA 1HJVA 2VRKA 1GW1A 3AHYA 3AMLA 1WZMA 4RE3A 3PTKA 4HA1A 3BGAA 3PZQA 4KGJA 2GJPA 1GQKA 2G3JA 2XPKA 1CLVA 5A1AA 5I6SA 3N15A 4UNIA 2GSJA 4D6JA 1E6QM 2JALA 2XYLA 1E4NA 2YL6A 1JF5A 4J3TA 1JZ8A 2J74A 4PMNA 3WF2A 4AZIA 1B3VA 4QLJA 5GNYA 5HDRA 1RPKA 1UZ1A 1XH2A 3ZSTA 1JXJA 2VVNA 3VIHA 2YA1A 2J79A 2DT2A 3ZJKA 4GZIA 3OBAA 3PZMA 1XYZA 4ATLA 3FW6A 2WC4A 3FAXA 1UWIA 1C7TA 1G01A 3WUEA 1AVAA 2VURA 4WSJA 3ZT7A 4QCEA 1VIWA 3DC0A 2WZIA 5DFAA 3OGRA 3U57A 4GQRA 1ECEA 4JHZA 3HN3A 5M03A 1EHNA 1UKQA 4XV0A 2ZXBA 4MDPA 3VILA 3WNKA 2J62A 1VJSA 5CPQA 2GVYA 4D6HA 3W27A 2VC9A 4W8LA 4AZCA 2XG9A 3K8MA 4NF7A 4CCCA 5ECUA 3VO0A 1JI2A 1BYBA 2BHYA 3CBWA 1XD0A 2RGMA 2G4FA 1FP9A 1MXDA 1GOIA 3IAPA 1BTCA 1WDSA 3W53A 1LL6A 4JCMA 2VJXA 1GOKA 3PN8A 4P7LA 3L4YA 1MQPA 2D3NA 2W67A 5A6JA 1JDDA 1H4PA 4W8AA 1S46A 1BYCA 2VZTA 1KGXA 3GM8A 2X1IA 3AISA 1OD8A 1GOWA 1UYQA 2YOCA 4TX6A 1ODUA 1DEDA 3GH7A 3GNOA 1W3KA 1BGAA 1VEPA 1ZBWA 1O6IA 4OKDA 2X8RA 2WM0A 3WMBA 2ZICA 3FN9A 5A94A 1A3HA 1JXKA 4AZHA 4EK7A 2VOTA 1R85A 1R8LA 5E70A 1BVNP 4AISA 3F5JA 2ZX5A 2PB1A 4KGLA 1NM9A 1CXEA 1JNEA 1W9PA 3NSXA 4IISA 3LMYA 3VIKA 2C7FA 4UR9A 2CETA 3SUWA 4ATDA 1QVBA 2EPOA 3NCOA 1W1TA 1BG9A 2PWFA 3RPMA 3EYPA 4HU8A 1U30A 1E40A 3VX1A 2WB5A 1OT2A 2WHMA 2VI0A 3BLKA 2WMHA 1DTUA 3CZGA 3K1DA 1BG4A 1XYFA 5ABGA 4CKQA 1W3HA 1OSEA 2OO2A 1QOXA 1JFXA 2XVNA 1CENA 1B2YA 3VMPA 1C3FA 2RGLA 1EOMA 1H3GA 3FHQA 3WN6A 5DF0A 5DMYA 4GZEA 2D2OA 3VM7A 1BGGA 4J3SA 1JFHA 1UA7A 1PEZA 3BAXA 1W1PA 3D5HA 2WNWA 4CVUA 3WL0A 3VIFA 5BXTA 1Y7VA 1ZBKA 1B30A 4UFKA 1DWHM 3WQ4A 1PX8A 2UY4A 3OLDA 2HISA 2J7DA 4B16A 4GKLA 1ZS2A 5LYRA 1MW3A 1YQ2A 4CU8A 2E40A 5CPSA 2YDQA 1E5JA 4JKLA 1UUQA 2BY1A 2Y8KA 1UG6A 4UOZA 4PEEA 3TP4A 1FFQA 3WF0A 5DO8A 1QI5A 1PZ3A 1ZU8A 5BYWA 1BVZA 4X9YA 2XSBA 2E4TA 2IXVA 2VR5A 4FK9A 3MUIA 4AW7A 3AROA 1HXJA 2E3ZA 1UR9A 2EXOA 1BYAA 1GQJA 4PMYA 5JIPA 2X0YA 4P8WA 3T2OA 4UQCA 1W9XA 3EMZA 3WH6A 6TAAA 1QBAA 4QCFA 1QHPA 5FD0A 3TTQA 3RO8A 5JBDA 5JBEA 3HJEA 3SCVA 3AIEA 1LWHA 3AZTA 3WDQA 5BCAA 3MSDA 1QNOA 2W66A 5IHRA 3WQWA 3PZTA 5BRQA 1G1YA 7TAAA 1NP2A 4FMVA 3OB8A 4W87A 1FOBA 3BC9A 3O2LA 3L2MA 1YHTA 2DH2A 3BAKA 1WB0A 4TTUA 1E6PA 1X6NA 4UQBA 1SFSA 4CU6A 2GJXA 1PZ2A 2E8YA 2XWEA 4J3XA 1EA9C 1OIMA 5A6LA 3MKKA 1R87A 3ARUA 1RP8A 5HXMA 4X0VA 2W63A 4UOJA 5E0FA 2VQUA 1KWKA 1OINA 3WEOA 1VRXA 4FLSA 2W4XA 1UR2A 1JYXA 2O9PA 4W8BA 2V3GA 3ARSA 1E4LA 5HNNA 3UR8A 4MADA 1B3YA 3VOCA 4J28A 1F4HA 1E1EA 4MNKA 3EMQA 1TFVA 2XWDA 1R7AA 2JEPA 1JDAA 4AD3A 1ZL1A 1HKKA 4L4OA 4DUVA 2VMFA 5IFPA 2J47A 3T0BA 2OYKA 2BHZA 2QPSA 1H2JA 2E0PA 3ZT5A 3BXWA 4J3UA 1ZB5A 5DT5A 4D1IA 4AZ6A 3ZJ7A 1QI3A 4HMCA 3U5UA 1DWAM 1FH7A 1H41A 2D1ZA 4KRTA 1KBKA 4XZBA 2MANA 3OGSA 3EBVA 2FHBA 1C93A 1XC6A 2XTKA 5CGMA 1C8QA 4BS0A 1JNDA 2GDUA 3K4DA 4J3WA 1MVYA 1QNQA 3WY1A 2QLYA 3OIHA 5AC5A 2GUYA 4CD4A 2DGAA 4JFVA 3DHPA 2ZUNA 2V5CA 4CGTA 4TXEA 1W1YA 4UFIA 4PUDA 2VX4A 2CXGA 4XB3A 2ESCA 1SYTA 1WCGA 3O9NA 3ZR6A 5AYIA 1H11A 1CXKA 1EO5A 5D4YA 2WVSA 4QLLA 4CD8A 2OSWA 1PIFA 4D71A 2NW0A 4JL1A 4KRUA 3DYPA 4AZCB 1QHZA 3BMWA 1QI2A 5A8PA 1E6XM 4M81A 1UD6A 1ISVA 1VBRA 1E55A 1GOOA 4U31A 3TOPA 1JYWA 1UR1A 2QHAA 2GJRA 2QF8A 4MPKA 2DEPA 2QMKA 3UG3A 2AOSA 1HNYA 3NYDA 1RD6A 2PMRA 1WP6A 1UWSA 2V5DA 1K6AA 4U3CA 4U2ZA 2GJXB 3SCOA 2VX5A 1E56A 4PMUA 4CCEA 5E9AA 4RE2A 3QOKA 4BCEA 2NT1A 2VZUA 1NWTA 1OWQA 4GINA 2CNCA 3AJ7A 2XGIA 2D0FA 5A6SA 2DIEA 3WENA 2WSPA 5A69A 4B15A 1UH4A 3DHUA 3F5LA 3TTOA 5A3HA 2BHUA 3AS0A 3OZPA 1TVPA 2G8ZA 2XHYA 1HL8A 5LA0A 1HT6A 2XM2A 2J7EA 1CBGA 3VKKA 5ABEA 2CIPA 4C7FA 1U2YA 1GZJA 3NSMA 2WWDA 1UR4A 1KWGA 4DWSD 1GQIA 3ALGA 1M03A 1NWUA 4Z2JA 1LG1A 3ARRA 5M5DA 1JGIA 2DT3A 3VGHA 3AIVA 4IPLA 3GXDA 1ITXA 1E5NA 3ARTA 2J25A 1CGVA 1QI0A 4FLOA 4MNLA 1CECA 5I77A 2ZXDA 1EO7A 5BWFA 4PYSA 3CZLA 3B8SA 3U5YA 1AMYA 4JFWA 3QHMA 1V6VA 4E8DA 5C8BB 4LX4A 3POHA 1B31A 3ARXA 1I1WA 3AS2A 1L8NA 1UR0A 1OGBA 2EJ1A 5AYBA 5CJ5A 2YL5A 1JZ2A 3RMEA 3K8KA 2J7CA 4ZENA 1UOKA 3AHVA 4CN6A 3M46A 1HKJA 2HVMA 3SCWA 3BCFA 2DPEA 3FNDA 3J7HA 5GPRA 5FIPA 2O9RA 3WDRA 3PZGA 2G41A 3N11A 3CTTA 1V0MA 3A4AA 4W7UA 3PZIA 2PC8A 5EBAA 3S6TA 3WUBA 5F7UA 1Q6GA 4D72A 2OWXA 3AZRA 5A6KA 1TVNA 5D9MA 3AIBA 4PCTA 4P8UA 4S3JA 1E73M 1EQPA 3AXXA 1GVYA 5I23A 1HKIA 2WLZA 2WK2A 3AIRA 1ZBVA 3UCQA 1W2PA 4D6EA 3CUIA 3VX0A 3W82A 3WQVA 4AWEA 3WFLA 3WDPP 1WDRA 3VU2A 4URIA 3SCNA 3WIJA 2WZEA 5BXSA 3SCUA 4WF7A 3KL0A 4ZE5A 1PX3A 1TCMA 2VQTA 3KL3A 2W91A 5I78A 1JAKA 2WHJA 3WD4A 1SMAA 1FH9A 3OLIA 3RJXA 4WKFA 4HZ6A 1JL8A 2VCBA 4PMRA 5EFFA 3IJ7A 3WQ6A 4PMQA 1W2VA 3W4RA 2FH8A 4HZ8A 4MAZA 1VB9A 3ZSSA 2VUYA 2DT1A 4YPJA 4V2XA 5CZKA 3SUSA 1M01A 4AIUA 4PTMA 1MYRA 2ZUSA 5D9PA 1AQMA 4MDOA 2CCRA 3IAQA 1MW2A 3AQUA 2F2HA 2VX6A 1K9EA 2GFTA 2CHNA 2VR4A 1QW8A 3AHXA 4HTYA 5JIWA 3ZR5A 3SUUA 1CXHA 2VRJA 1V0NA 5M3WA 2WVVA 4DWSA 2EPMX 1GPFA 4U2YA 3RM9A 2E9BA 1JD9A 4IUGA 4AD4A 1V0LA 2WC3A 1UR8A 2BFGA 4HMDA 3VIMA 1GCYA 2ZE0A 1TE1A 3VD3A 4Q22A 4W89A 3L4TA 2Y5EA 3MUY1 3MSGA 1EHAA 5D9NA 4PMXA 3VDCA 1FA2A 3VUPA 1CGUA 3TTSA 2WWCA 4H2CA 3WL1A 1C92A 1UD4A 4CD6A 1M53A 1E70M 4QLKA 3T09A 1H49A 4W84A 3CUJA 3OG2A 5I24A 4AC1X 2UWFA 1A47A 1UA3A 3GBDA 3VIJA 4IM4A 1XSJA 4HPHA 7A3HA 3LPGA 1K9TA 1AQHA 2OWWA 1HF6A 2WHLA 4D1JA 2VT0A 2JIEA 4TVUA 3GTNA 2BVDA 4JKKA 4P7QA 4PN2A 1VAHA 8A3HA 6CGTA 4P7RA 1CNVA 4P7OA 4MNMA 2XIBA 1KQYA 3UG5A 1HP5A 2PI6A 2BY2A 3NDYA 2ZX6A 2J78A 3L4WA 5GNZA 1SR0A 4KWUA 4W85A 2VRQA 4AEFA 1WZKA 4UQEA 1ITCA 1XD1A 2XVGA 1GVIA 1R86A 3OLGA 1Z32X 3MV01 3KEHA 4OOUA 3PZNA 1B9ZA 1GOQA 2CKSA 4PSPA 4MB5A 5IHSA 5CSYA 2YBUA 1JYVA 2VTFA 5E6ZA 5ABHA 3AMCA 2WC7A 3W6LA 3EDDA 1UKOA 2J75A 3TTYA 1SMDA 3VGGA 1KXVA 4GI6A 4HOZA 1BYDA 2W62A 3K46A 3CO4A 2WAGA 2VL4A 4UQAA 1IV8A 3AICA 1NH6A 3UR7A 1CGYA 5AC4A 2YLAA 3BAJA 1GNXA 5CLTA 1XSIA 4M24A 3ALFA 3L2LA 1PX4A 3WH8A 4DWSB 3WQ5A 4EANA 2O9OA 1QW9A 4YHEA 4L4PA 3FAWA 4HMEA 3ZIZA 5TD4A 3OZOA 3WH5A 3ARZA 1W3JA 1HJUA 5EB8A 4OUEA 3W26A 4AZ5A 3PBGA 1J9YA 2YL8A 3NIYA 1E0VA 4GI9A 4V27A 2CPUA 4N42A 3LPFA 4ML4A 3HMCA 1BHGA 3T2PA 4JFTA 2ZX8A 3AZSA 3M7SA 4D6GA 3SURA 1NARA 3CZJA 4MTVA 2Z1KA 3W25A 4HU0A 2G3NA 2V3EA 2X2YA 3PTMA 1DHKA 1V08A 4WSKA 4TOQA 1JZ6A 2A3CA 3W38A 4JCLA 2WMJA 3ARYA 2NSXA 1LF1A 4H8VA 2J8GA 5I3DA 5CXPA 4AMCA 1UZ4A 5KEZA 3N12A 4MB4A 5DT7A 5CLWA 4OBSA 3EDJA 3ZO9A 1V02A 1C8YA 1CXIA 1VFMA 1XCWA 5IDIA 4PRWA 1B0IA 3K8LA 1MFUA 1V6UA 1HJXA 1HJWA 4WK9A 1KBBA 3T0DA 3PHAA 2ZWYA 3A6OA 3RILA 3OGVA 1CTNA 3NUKA 3CZKA 2GDVA 3ARPA 3L4VA 1QNSA 3AOFA 1OM0A 1HP4A 3WD2A 2J7BA 1XV8A 1D2KA 1KCLA 3AIWA 4J27A 4D6FA 1F4AA 1W9DM 3SIMA 5M17A 1E43A 1W32A 1H0GA 3T2QA 4AIEA 2D0HA 3AXIA 3CHFA 1BLIA 1CWYA 1V3IA 3W28A 1E0WA 3CH9A 2Z1SA 2ZXAA 1V3KA 2A3AA 2X09A 3F4VA 1C8XA 5LA2A 1UQZA 1E71M 3WMSA 3AXHA 2D0GA 3APGA 4LYQA 4U3AA 1QPKA 3GDBA 4NI3A 2VNCA 2G3IA 1OB0A 2WPGA 3ARQA 3WNPA 1JYNA 2D24A 3I3DA 2XFFA 4AY1A 2WZHA 1FHLA 1XSKA 4U5KA 2V3FA 1ODZA 1XCXA 2CBUA 2VCAA 5A2CA 5E0CA 3VMNA 3WDIA 1UH2A 2PBGA 2WMFA 3QR3A 2F61A 1H0IA 1QHOA 3A4WA 4GQQA 3WFZA 1J10A 4JIEA 3VD5A 3ZJ8A 2J4GA 2J7FA 4UFHA 1MQQA 2W61A 3HU7A 1LG2A 1E6SM 3D3AA 2XVPA 3CHEA 1GUVA 4OIFA 4MJ4A 4E4PA 1E3ZA 4DWSC 3EDEA 4QFUA 2OYLA 1DWJM 2WANA 5A8MA 4E2OA 4M8UA 3TA9A 1PJ9A 5BXRA 1O7AA 4HA4A 4F9DA 3UG4A 4F79A 1J0KA 1XGZA 1PPIA 4S3KA 3AFBA 4HZ7A 1JD7A 4F9JA 1NWSA 2WMIA 3W81A 3ARVA 4WKHA 1Q6DA 4C7GA 2W92A 3VD9A 1PIGA 4TVCA 2V38A 2VZVA 2UY5A 1Q4NX 3O6AA 3THDA 4PBGA 3MMDA 3WUGA 1JIBA 2E9MA 1ZJBA 1ZBCA 4UZUA 5BROA 4HP5A 3WF3A 2CESA 4H8HA 3VGDA 4UQDA 1NOUA 1G94A 3WD0A 4F8XA 2UY3A 3EDKA 4TUFA 1G0CA 1LL4A 1X1NA 1JAEA 1J0HA 4BQ5A 2DQXA 1J18A 1UWRA 1OGSA 1EQCA 2A3EA 1CYGA 3WBAA 1CGTA 1QBBA 3MMWA 4UTFA 4Z2LA 1H09A 4J3VA 3L4XA 1E6ZA 1KGWA 4U5IA 2JFEX 3VDAA 2VZOA 2CYGA 3IJ9A 2IXUA 1B3ZA 3GXIA 3WKZA 4YHGA 1KR0A 4NRSA 1UKSA 2WSKA 4W7WA 1W1VA 1BSIA 1UWUA 2PWDA 4HPGA 1W9UA 2DSVA 3GXFA 3TONA 5EMYA 4D6IA 3N9KA 3BSHA 4W86A 2DSUA 4E8CA 2WBKA 3B9EA 1WKYA 2J8FA 3W6MA 4PMOA 3BAIA 3VGBA 3W37A 5D8WA 3ZQ9A 2D3LA 1P6WA 9CGTA 2QV4A 3SUVA 1KGUA 3G6LA 4WKAA 1W91A 5C71A 4JAWA 4P7NA 4U33A 3SCQA 1JDCA 3SCSA 2PWEA 3WNNA 3BAWA 3QOMA 5HOSA 2WCAA 2WYSA 1KXTA 3WF4A 3GNRA 3GYCA 2YIHA 2ZX9A 3WDHA 1BFNA 5FL1A 2Y24A 2JE8A 4F66A 4QDMA 3CIVA 5A2AA 4X0NA 1CGWA 4FLQA 1KR1A 1MW1A 1VFUA 4D6CA 4GO9A 3VDHA 3PZ9A 4NSBA 3AMKA 1V3MA 2CITA 2DSKA 1WZLA 4PSRA 2CBJA 1D3CA 2XVLA 2DH3A 1JZ5A 3KWXA 1BF2A 1M7XA 6A3HA 1CDGA 1WE5A 1CGXA 2XM1A 2WVVB 5A8OA 2Y8VA 3VD4A 2VZSA 2XVKA 4OJYA 1DWGM 3CUHA 1E0XA 2BY3A 4ZXLA 3VVGA 3FXYA 3T08A 3AYSA 1UD2A 1K9FA 3II1A 1J0IA 5I79A 5BRPA 4UQ9A 4B3LA 2BXZA 2Y2WA 3DYMA 1TUXA 2CERA 1JG9A 5D9OA 4M1RA 4PMZA 1UD8A 2XFRA 1EDTA 1J0JA 1C7SA 5DEZA 4Q7NA 3SCRA 3LPPA 4M29A 1TR1A 1VFOA 1GHSA 2O92A 5A6BA 1E15A 3BLPX 3VMOA 4BQ4A 2YKKA 2WVTA 3VPLA 4GZJA 4PMDA 1EGZA 3WELA 2XFYA 4BA0A 2CEQA 4LYPA 2WXDM 1D7FA 2WVUA 4GO8A 3WH7A 3NDZA 2JNKA 1UKPA 2J7GA 1RH9A 1CIUA 1WZAA 1TA3A 1B3WA 1KXQA 2WCGA 2E9LA 3RM4A 2BVTA 2PWGA 2BS9A 1VBUA 2C0HA 3KE0A 1JZ4A 4KMQA 2FDMA 4W5ZA 4PTWA 3EMCA 4LYRA 1CZ1A 4AD2A 1HKMA 3ECQA 3WQ8A 5E09A 1X6LA 3N13A 2BNJA 2CBIA 1GORA 2VCCA 5FOOA 2EPLX 1E1FA 4GI8A 3GNPA 4AZGA 1M04A 4XZWA 1HVXA 1CEOA 3DECA 3VDBA 1MWOA 2B31A 1VEMA 1JF6A 3AMGA 1VJZA 1NOWA 2CBVA 4UZSA 5FKYA 4IPNB 1FH8A 4AD1A 1WDPA 3MS8A 4BQ2A 4DUWA 1LWJA 1J0ZA 2YA0A 5CG0A 1E4MM 1BAGA 1GHRA 3VGFA 3ZM8A 4W7VA 3WEMA 5FCZA 4JHOA 1V3LA 3G6MA 4R27A 5HPCA 3UERA 1G9HA 3AIUA 5A8QA 3F5KA 1XH0A 4LPCA 1V03A 2UY2A 1U33A 1VF8A 4UFLA 5JBFA 1KB3A 4CCDA 2BV9A 3PZOA 5ABFA 4W88A 4FZPA 1CPUA 3RJYA 2A3HA 2O9TA 5I2UA 1RP9A 1J0YA 2ZOXA 2G3MA 3SEPA 4UOQA 1HN1A 1PAMA 3OA5A 3W24A 1TMQA 2YL9A 1WAWA 3GXMA 1UD3A 3CHCA 4M80A 1DWFM 3FHAA 4M82A 7CGTA 2ZWZA 3W0KA 1Q6EA 4Z2GA 3CZ8A 1ESWA 2X05A 4ACYA 2E8ZA 2YLLA 4B3KA 5CPTA 3WNLA 1LQ0A 2EQDA 4ZXOA 1LLOA 8CGTA 1FFRA 2ZUMA 1GOMA 3L4UA 3GZAA 3KZSA 2JEQA 1EXPA 4HOXA 1ISWA 2OSXA 2PF0A 5FL0A 4CN1A 4WLCA 3RM8A 4W93A 2ZUWA 2ZUVA 3B9AA 3RCNA 4UFJA 3KL5A 2QMJA 3BCDA 1ZJAA 1Q6FA 3PZVA 3VM5A 1BQCA 1WPCA 5ABFB 4CN4A 5A6BD 4CU7A 1E4IA 1LJYA 3WDJA 1OD0A 2DT0A 1MW0A 2D22A 3ZT6A 3MUZ1 1EIBA 3NJ3A 3WUFA 1W3LA 2Y4SA 4YN5A 3SCTA 1QNPA 3T0AA 1JZ3A 5A6AA 3CHDA 4R5EA 3WH9A 4RE4A 4ZE4A 4N0RA 3WNMA 3CLWA 1HIZA 1E6NA 2AMGA 4DM1A 4DUXA 1EH9A 2JIWA 3WD1A 2V3DA 3VIPA 2C8NA 1V6WA 2IUZA 5CQ1A 1CLXA 1VENA 4V28A 1GJUA 4AD5A 3WNOA 2VVSA 4AIOA 1XHGA 3QHNA 3S2CA 2OSYA 3MMUA 3POCA 1ISZA 3N04A 2EPNA 2FH6A 2BY0A 2WMGA 4A3YA 4MB3A 3PZUA 1OT1A 5GQBA 3SCPA 1KQZA 1UH3A 1OIFA 3BH4A 1W9BM 3VNZA 3GH5A 2NT0A 3AS1A 5C70A 1TA3B 5KZ6A 3GBEA 4P8VA 1V3JA 1J11A 3WBEA 5GNXA 5HBFA 4MJ2A 4WJXA 3THCA 2WKLA 2XUCA 3W29A 3VIIA 1NOFA 4MB1A 4UFMA 4OOZA 3VIGA 4JKMA 2EO7A 4AEEA 4Z2KA 2DIJA 2XJ7A 4JZ5A 1NP0A 3U7VA 1MQRA 3MANA 2YDSA 1FP8A 3U7BA 1US3A 2YDRA 5A8NA 3VD7A 2CHOA 3NSNA 1DWIM 5CSUA 3AS3A 3VGEA 2F8QA 4LQ1A 4AXNA 5A2BA 2WKGA 3N1AA 3CMJA 3MUAA 4PCSA 4EAMA 1PBGA 4JL2A 1H5VA 2ZIDA 2DSZA 3RIKA 4XUYA 1JZ7A 4XX6A 4NRRA 4UCFA 2GK1A 3MV11 2WCSA 3RDKA 2YBTA 1IT0A 4GIAA 4ZFMA 1J01A 1E9LA 4HA3A 1OBAA 2EEXA 1QI4A 3PTQA 3UEQA 4JFUA 1DP0A 2VX7A 5I5RA 4GPNA 4BQ3A 2WBGA 4H7VA 5EFDA 1UD5A 1E3XA 1NWRA 3WMCA 2XGBA 2QPUA 2EBNA 5IXEA 1HJQA 2D23A 3JUGA 1NQ6A 3IJ8A 1VFFA 3CUGA 4D6DA 4M56A 3ZMRA 2XSAA 2EPKX 4Y7EA 5LA1A 2ZUUA 4H8UA 3IK2A 1N82A 4TX8A 4HOWA 1C90A 1V6YA 4AYSA 3VIOA 4AZBA 2D20A 4CD5A 2YJQA 3GH4A 1EDQA 3VTRA 4PMVA 1IZKA 1V3HA 5A6MA 3VNYA 2WW5A 4TTGA 1H1NA 2ZUTA 3AIQA 1GJWA 3ARWA 5HPOA 1WO2A 1E72M 3M6DA 3A3HA 3N17A 1EDGA 1GQLA 3FY1A 4A3HA 4ZEPA 5AY7A 1ISXA 3VINA 4QAWA 3WD3A 5CGTA 4MAVA 1C91A 1QNRA 3I3BA 4PUEA 2OWCA
chains in the Genus database with same CATH superfamily
1OFDA 4GABA 5G2WA 3CQHA 3QYQA 1V93A 3CMGA 3AHZA 3T55A 5F1UA 4DZAA 2HK0A 3WQEA 1JQKA 3MU7A 1I1XA 1XGDA 2ABBA 4AD0A 1SZEA 3R25A 3LX9A 1HVQA 1ONRA 2AAAA 3DYOA 2ASHA 3BGJA 5A95A 2TRSA 3EJPA 2WHKA 4H41A 2X0HA 4PCPA 4S3BA 3MP3A 2Y6ZA 1AJ2A 3T4AG 4HNUA 2WM1A 3UETA 4W4QA 1XM3A 5B7YA 4AX6A 4OHQA 1E6RA 3W7HA 2FGLA 2Z2BA 1IGSA 1ZP3A 1HX0A 1CXLA 1THFD 1CXFA 5BXPA 1T96A 1KCKA 1QWUA 2JGQA 4AZ7A 3EOLA 4Z2IA 4IMEA 1SUFA 5I0DA 1KLZA 4REQB 3VUSA 3UWYA 3GZ3A 5LIWX 3QTPA 1XLJA 3IANA 3QKZA 3V0TA 2WMKA 3ZXWA 2FHFA 1KBIA 1EIXA 3LRLA 4TVDA 2ZX7A 4O53A 1X6UA 3NDOA 5AC8A 4OZOA 1V0KA 3QA8A 1UKTA 2VO5A 3EB3A 4LGXA 3PPGA 3CPUA 4Y9MA 2XINA 2NSOA 2QJIA 3H4GA 3B53X 4D8ZA 2P0IA 4GY1A 4ERIA 3AMDA 1B1YA 2Y61A 4NZCA 4W9TA 5JMUA 3QR1A 4UTLA 4FPSA 4MJZA 3E2SA 3C86A 3HPZA 1B90A 1R38A 1YADA 4BF7A 3TYZA 2FGBA 1M5WA 1US0A 1SZRA 4PBFA 1KTNA 2GJNA 1A5NC 1Q66A 1TIWA 1LLZA 1TG7A 4BEQA 5A8GA 2J7HA 1UMLA 1VJIA 1WNOA 4JOMA 3LXCA 4E5TA 2PCQA 1WKDA 4FF5A 1W9VA 1HL9A 3WSUA 1AJZA 3WQOA 5CCZA 4MNJA 3UWWA 1X04A 2XN2A 1GW1A 3AMLA 3LI1A 1OC6A 3MCMA 1TQWA 2PDPA 3PTKA 4HA1A 3PZQA 1GQKA 2XPKA 1UROA 4DQWA 2BX7A 5A1AA 2QCGA 1RCOB 2Y7EA 3NPUA 5HR7A 2ZVRA 4YVPA 3M64A 3UITA 4TQTA 2J74A 3WF2A 5DBUA 2RAJA 4GUFA 3QZ6A 3APYA 1RPKA 1UZ1A 1GYNA 3DYTA 2HJPA 2ZRXA 4UMCA 4KIRA 3LEPA 3ZJKA 1W1IE 4GZIA 4S2BA 3PFMA 3NQCA 3HGRA 4G9PA 3FW6A 4XWUA 4QEEA 4RV3A 1G01A 1DQUA 5TKYA 4ZTYA 2Y7FA 4ZSUA 5DFAA 2W0UA 3OGRA 4GQRA 3BVJA 1Q6QA 1TZ9A 4ZL1A 3OZMA 2OJPA 3O63A 4GY0A 3CWNA 1IYXA 1Q5MA 3UA3A 3JS3A 3SSZA 5CPQA 2VC9A 2FZ8A 2I5GA 2XG9A 2OKOA 1IXNA 3VO0A 4BJHA 3EB2A 3CBWA 1XD0A 2RGMA 2G4FA 1MXDA 2CLHA 3T47A 4NYYA 1WDSA 3W53A 1LL6A 3PP7A 4C1KA 4M6QA 1MRAA 1FCVA 4L5ZA 2ZDSA 3L4YA 1MQPA 5A6JA 5LIYX 1JDDA 3KLKA 3TC3A 1RPXA 2CWNA 4PE8A 5AKQA 4AF0A 1KGXA 3CL7A 3GM8A 3AISA 3STEA 1OD8A 1GOWA 1P6CA 2GPTA 5LGXA 2WYIA 2Z0IA 1OCNA 4BHYA 2CZFA 1S1RA 1M41A 1ODUA 1DEDA 4YVXA 4WDWA 3GNOA 1ZBWA 4M0XA 2X8RA 2H9AA 2FTYA 3WMBA 3KOXA 1I60A 1XYMA 1OF6A 2VOTA 3F03K 5E70A 1BVNP 3F5JA 3GG7A 2PB1A 4KGLA 3LNPA 4J5NA 3K4WA 3N2XA 1TELA 5HMEA 3BJFA 2WZTA 3SUWA 4DO5A 3IV3A 1UC4A 1R5YA 2EPOA 3T8QA 3LTSA 2XFWA 1BG9A 4I9MA 4Q8UA 1G4EA 4HU8A 1EC8A 1E40A 2WB5A 1OT2A 2VI0A 3CZGA 2Y1HA 3K1DA 2QZRA 1GZGA 1XYFA 4GYPA 4O0QA 3W88A 2RGLA 3WN6A 3U2ZA 5DMYA 1R2RA 1QK2A 4O0KA 4K1GA 1RALA 2GVGA 1ZNNA 3BAXA 1W1PA 4CVUA 2WNWA 1QWNA 3R6IA 2UZ9A 2PDHA 4UFKA 4MOZA 1DWHM 1HO4A 1LCOA 4QJ5B 2J8TA 4WJEA 3OLDA 2HISA 2E6DA 3O3MB 4EZUA 1Q6OA 4ROQA 1ZZMA 1M6JA 1YQ2A 2E40A 4DX3A 2HNEA 5T9BG 5C6MA 2REQA 4JQ2A 1A5AA 4JKLA 2B4GA 3M0LA 3TP4A 1DJQA 3ENLA 2G37A 1VC4A 4X9YA 3N2OA 4ERGA 3MUIA 4AW7A 3WJYA 3CPGA 1UR9A 5AVNA 1BYAA 4RZ4A 1TKKA 3MHFA 5JIPA 2X0YA 4R33A 3NPWA 3D0CA 1NY1A 1QPRA 3WH6A 2NQLA 2Y5JA 4LAMA 1A5CA 4HHLA 3TTQA 1P1XA 3B8VA 5BCAA 3RX3A 2HMCA 1OF8A 2CZVA 4E81A 1L6GA 1W5PA 2W66A 1H62A 1PUDA 2WJFA 5BRQA 3C8FA 4XZHA 7TAAA 3GXNA 1NP2A 2GQ8A 2PSNA 5FF4A 3O2LA 4WX2A 1YHTA 1QW7A 1F73A 1JCTA 4Q8WA 1IWBA 1E6PA 1X6NA 1ADOA 1ALDA 1QOQA 3LCGA 2EF9A 4CU6A 4JX4A 1EA9C 2DVTA 5A6LA 3FDKA 3RU6A 1VBHA 5HXMA 4UOJA 4MMWA 3WLQA 4AEOA 1O94A 2WYHA 3BLDA 3KUMA 1OINA 3WEOA 4PFMA 3FFSA 5G4WA 2W4XA 3DC8A 1VYSX 5JQ9A 5M2FX 1JYXA 4FR1A 3TJXA 4O17A 3LV6A 2GDQA 3UPWA 4MADA 1B3YA 1NFPA 1QOPA 1I2PA 4PUMA 1TFVA 1J6PA 4A35A 1OX4B 1R7AA 2JEPA 1W37A 1HKKA 4L4OA 5IFPA 3T0BA 4FXJA 5CH9A 4HBKA 3D46A 2SFPA 4C60A 1YE4A 3ZT5A 2DVUA 1QXLA 5DT5A 1FTXA 1N8IA 3SGUA 4D1IA 1Q7ZA 3SQLA 3B04A 3THUA 1FWBC 3BARA 3W1MA 2FFIA 4HMCA 4RPQA 3T8LA 2D1ZA 1KBKA 4XIAA 2VC7A 9XIMA 1KFKA 4OGZA 1C8QA 3H8AA 3KVLA 2BGSA 3EWXA 2Z1VA 2GDUA 4J3WA 4FNPA 3UF9A 3O6DA 2GUYA 4DB7A 1FQ0A 4CD4A 2DGAA 2XIJA 4TXEA 4NG3A 4G7FA 1W1YA 4PUDA 1MEHA 3BZJA 3MUXA 1RR2A 3PB2A 3W1QA 1POJA 4UTUA 1XLFA 2CXGA 3TC6A 3QH2A 3OW1A 3Q37A 2H3BA 2A2IA 3G1SA 1H11A 1CXKA 5D4YA 4N7QA 4JNYA 3WMLA 1Z89A 2YXXA 4V1YA 2INFA 4DPQA 4ZODA 3BMWA 1E6XM 4M81A 1UD6A 5FJOA 3TE9A 2FYVA 3TOPA 1A50A 1F3XA 1S5VA 4LCSA 1JYWA 2EG6A 3C2YA 2AAMA 3DBPA 1W54A 2QF8A 2C16A 3CQKA 4MPKA 2WSYA 4LB4A 2Q3RA 1L6YA 2QMKA 4HTBA 1K8YA 1HNYA 5DY3A 3HV8A 3PJTA 2OODA 3DCPA 4QGCA 4N9CA 1DKXA 3P62A 4KEVA 1WP6A 4GC4A 1J5TA 1UWSA 4U3CA 2NQJA 1S3HA 3ITCA 4JDBA 4MJMA 1XIHA 3R0KA 2VX5A 4C5ZA 1E56A 3FGCB 4HYVA 5E9AA 4RE2A 3LQLA 7TIMA 3QOKA 3F4DA 2VGFA 1MUMA 4O13A 5EU9A 4HJWA 1K03A 1RLCL 1DHPA 3E9AA 4NP7A 4JTJA 2XGIA 5LIUX 3VOFA 1TV4A 5A69A 1UH4A 3TTOA 2BHUA 1TVPA 1YPXA 1HL8A 1JR1A 4RNHA 5LA0A 1QR7A 2J7EA 4QBXA 1U2YA 1KWGA 1ZSXA 2V2CA 1ZHAA 3W2MA 3KBSA 4JTLA 4GXWA 3UFYA 1JGIA 3CASA 2X2GA 4L1GA 2IQDA 4Z17A 1CGVA 1OX5A 1QI0A 1SFJA 2AL2A 4FLOA 4MNLA 3HPAA 5I77A 4MKVA 3P93A 1EO7A 5BWFA 2I57A 2VFEA 4HU4A 5T8GA 3VOJA 5FI8A 3T0CA 1IEXA 2QCCA 2Y0FA 2YR1A 4WGXA 1HTIA 5AN7A 1Q2RA 4CNPA 1LUCB 3AU2A 4LX4A 1Z3NA 3E12A 3W22A 1SO3A 3XISA 2HBVA 3ARXA 4Z42C 1UR0A 3LMFA 2A21A 2J88A 4F48A 3GUGA 2PODA 3QPZA 4IIHA 2G41A 3N11A 4KWVA 3NVTA 3TQVA 3PZIA 1HKVA 2GVEA 3PF3A 3S6TA 4L9ZA 1AA1B 3DX5A 4XD4A 2OBLA 2EFKA 3HBLA 3CYVA 3AZRA 5MF5A 3AIBA 4LV4A 4S3JA 4A8LA 4JWEA 3A64A 1ZBVA 1LBLA 3IUDA 4KFOA 4XZMX 2IQ0A 2ZA2A 1FUYA 1JDEA 3CTLA 3WIJA 4V33A 2XIOA 5BXSA 2QGHA 4AVFA 4WF7A 1W17A 2V5LA 2C71A 3KL3A 5I78A 1JAKA 3GHRA 4Y8FA 4NVTA 4PMRA 5EFFA 3IJ7A 4KESA 3WQ6A 3W4RA 3OBEA 3ZR4A 1QRQA 2DT1A 4YPJA 4XG1A 1IWAA 5CZKA 4I6VA 3TWAA 4AIUA 4GOAA 3WQGA 2P88A 2CCRA 2VX6A 1K9EA 3IVSA 2VDIA 3TXZA 3IRDA 1DVJA 3VNIA 3GTIA 3ZR5A 2GWGA 1PSCA 2FJKA 1V0NA 3VOIA 2WVVA 3KDNA 4GVHA 1XIEA 1Z42A 4LVFA 3FEMA 2QCMA 4JTIA 2WC3A 4RDVA 4HCLA 4JDYA 1QO5A 3GO2A 2ZE0A 2I17A 1H50A 7REQB 3L4TA 2NUYA 1U1JA 3MSGA 2IPFA 4PMXA 3VDCA 1XIMA 4FIRA 4JNEA 3CT7A 4ZBCA 3GXTA 2WWCA 1G7VA 1UD4A 1MEWA 1T6MA 3QNJA 5JH1A 3TW9A 5I24A 5KTLA 4I9AA 2GUBA 1LYXA 2BG5A 4KIKA 1UP3A 3BV4A 3BLFA 4IM4A 3GNNA 1XSJA 4HPHA 2PRHA 2C3ZA 2VEFA 1UUMA 1W3NA 1YPIA 3K30A 4D1JA 3S2NA 2GGIA 1TTJA 3RG6A 1R2SA 4EZPA 4IJCA 5FF0A 1EWEA 2PI6A 2PDQA 3NDYA 4K6AA 2ZX6A 3EPOA 2ICSA 5GNZA 4KWUA 4NQIA 4W85A 4NXKA 3OYZA 4UQEA 4HPXA 3W1UA 4R88A 1GVIA 1KO0A 3MCNA 1Z32X 4IJRA 4OOUA 3UZYA 1B9ZA 5K4XA 2CKSA 4GUJA 4QJ3B 2RH9A 3CLMA 1SZNA 5CSYA 1P0BA 1JYVA 1XKYA 2OFJA 1QCWA 2OQHA 2J75A 4IICA 3TTYA 4ZSTA 2Y70A 2V67A 3K46A 3KRZA 2WAGA 3EJRA 3GHTA 3ZVIA 3W01A 2EGZA 4WDXA 4C6QA 4US5A 3T42A 4I5XA 4M24A 1ZCCA 4E6MA 2HCVA 2PWVA 3UZ5A 5HNRA 3WH8A 3WQ5A 4EANA 1KTCA 2O9OA 2PCEA 4L4PA 4HMEA 3NQ2A 2DQWA 1YDNA 1HJUA 2GLKA 4GVGA 3GAKA 1J9YA 4DELA 4GFIA 5K9DA 3EXRA 4GI9A 1VP5A 5FJTA 2CPUA 4QQUA 2KAUC 2QULA 4JFTA 1OFOA 2ZX8A 3WZ0E 2AL2B 4D6GA 3SURA 4MTVA 2EG8A 4HU0A 2X2YA 3VI2A 3DDMA 1DHKA 1V08A 4TOQA 1JZ6A 2A3CA 2F7QA 1VCVA 5H6HA 1RCQA 1KTBA 3Q84A 3UJFA 3FJNA 1MDRA 1W56A 4NL1A 1UZ4A 2Z2UA 4CNSA 3ABXA 3WJSA 1GPWA 3E2QA 4GD0A 5IBXA 3RGTA 4M0MA 1I9CB 2C91A 4UDYX 3ZO9A 1C8YA 3TYCA 1XCWA 1FCUA 5IDZA 4MKSA 3RNDA 1I4NA 4H9MA 2GL5A 3R89A 5FF3A 3A6OA 1TO3A 2Y7GA 5C9ZA 3PNUA 2VD9A 2ZKMX 1VBJA 3LSCA 5HWMA 1OM0A 1FBAA 3P2VA 3LENA 5D2TA 3AIWA 2NLIA 1E43A 1TWDA 2HSAA 2D0HA 3RPTA 4G7EB 2QQ6A 3M0IA 1E0WA 4FZSA 1K7XA 1V3KA 2A3AA 4NZ1A 3F4VA 2BOFX 2ZCGA 3U4AA 3AC0A 1UQZA 3EXSA 5EMLA 3BVXA 4IXHA 2PGWA 3TC7A 2X0SA 4LYQA 1QK0A 2G3IA 3E0WA 5T91A 1Y5XA 3P14A 1KA9F 4AXKA 1XSKA 2V3FA 2OEJA 1TB3A 3BK0A 5AHIA 2VCAA 2KZHA 4EZWA 5C9WA 4QXIA 1L9WA 3WDIA 5I3FA 3E5PA 2WMFA 1SU6A 5DRIA 3R2GA 3BURA 3UXKA 1J10A 2YI8A 5CZSA 1MUCA 4UFHA 4NAEA 3GVRA 3KRSA 1ZJIA 4Q8MA 4QHRA 3W6YA 1E3ZA 1FY6A 3EDEA 1TZZA 4QFUA 2ZZ2A 2ZA3A 3TK7A 4IX2A 1PJ9A 4DO4A 1O7AA 4LSBA 4YTUA 1LBMA 4LAZA 4R7JA 4Y96A 4YWSA 4S3KA 1WKFA 4CNNA 4F9JA 1NWSA 2WMIA 4DAIA 1TX2A 5HMDA 3LOTA 3D47A 2UY5A 4RX0A 1H7NA 1FWSA 4Y9OA 3MMDA 4GQGA 1ZBCA 4UZUA 3M0KA 1GKPA 4HP5A 2E7FA 3W76A 4GCAA 4K3ZA 1TQVA 1DJHA 1G94A 2YX0A 3WD0A 3MKVA 2UY3A 5CBBA 4TUFA 5B7ZA 1Z41A 3KBVA 4QIUA 2X41A 1JAEA 1UWRA 2A3EA 1CYGA 3WBAA 4UTFA 3L4XA 3VOHA 3MJYA 1KGWA 4U5IA 4AY7A 3IJ9A 5H91A 3N6JA 1ADSA 6REQA 4BR1A 5E0KA 1K4GA 2XIMA 3V5FA 3VNMA 1YE6A 1XCFA 4EWJA 5EMYA 2F7RA 3N9KA 4WEVX 3BSHA 4W86A 6XIMA 4E8CA 3B3DA 2J8FA 1FWRA 2FZ9A 3SYVA 3IWPA 2VEMA 3BAIA 2X30A 2F6KA 1AK5A 2ISWA 3VGBA 3AJXA 2QV4A 4OVXA 3G6LA 1MUWA 1U1HA 1S38A 1ZCOA 4JAWA 4P7NA 4QJ4B 3SCQA 4JR5A 3LVTA 4L1WA 3QOMA 5HOSA 4YCPA 1VZWA 1Q4WA 1Q8JA 3DFYA 3GYCA 4JIIX 1M7OA 1QDSA 5T26A 4ZFCA 1DBTA 1BFNA 4DJFC 2QCDA 4F66A 4ZA0A 3CIVA 2F1AA 4X0NA 3VDHA 3PZ9A 4NSBA 1XP3A 4HNTA 2FTWA 4PSRA 2Q01A 4JTGA 3JW7A 2Y89A 3DENA 3HGJA 3KWXA 1GVOA 1MDLA 2Q09A 6A3HA 1P43A 1CDGA 3H21A 1DXFA 2C1IA 5A8OA 2Y8VA 3VD4A 4O52A 3SGGA 2E1DA 4QM1A 1K1DA 3FYYA 5JH2A 4GUHA 2BY3A 4ZXLA 4RW5A 3P5ZA 2A6LA 3TDFA 2CXEA 1UD2A 1K9FA 4GX9A 3ANVA 2V69A 3GY1A 3LU2A 1B9BA 3OOQA 4POCA 4UQ9A 4GXMA 2VGGA 4B3LA 1KFJA 1QO2A 2E6YA 2ZRVA 3FV9A 3TR9A 3HIJA 3FSUA 1JULA 4HR1A 2XFRA 2Z7KA 3GDLA 4Q7NA 3VFLA 1NSJA 3LPPA 2ONEA 1TR1A 3GE7A 3BUDA 3GKAA 4YTQA 1GHSA 2O92A 4HCDA 2HZGA 3FYPA 3GWQA 1E15A 3N4FA 1TPUA 1FRBA 1EGZA 4GLEA 3WELA 3C0JA 1XRFA 1KM0A 4IP7A 4L6HA 4DHGA 4LYPA 1CW2A 2WVUA 4KFPA 4GO8A 3R94A 4LBUA 1F8IA 2HE5A 3NDZA 2OW6A 1Q3NA 1RUSA 4H00A 5I06A 1CIUA 1WZAA 3EWYA 1O5XA 4KMQA 1X8CA 2FDMA 2X1UA 3ZLHA 4PTWA 1X7IA 3ATYA 4LYRA 4U28A 3ECQA 3RF9A 2E28A 5E09A 3D4ZA 2F38A 1QT1A 1E1FA 3M5XA 1TPVA 2ELBA 3TV8A 3CK5A 3JRKA 1M04A 4PRRA 4XZNX 3MZ2A 1CEOA 1PKYA 3QXBA 3EPNA 3H70A 4UZSA 5M1TA 1VJZA 1NOWA 3G8RA 4AD1A 1ME9A 1UIPA 5G1TA 1EP1A 4BQ2A 4DUWA 4ZQNA 4IM3A 1J0ZA 1E9IA 2HVNA 1B5TA 1GHRA 3VGFA 4INFA 3F2DA 1C29A 2X16A 5CC6A 2PDIA 4C65A 4R27A 5HPCA 3T81A 5DN1A 2V0TA 4DJDA 2PLKA 4LPCA 1V03A 3KS6A 2LM0A 4CCDA 2BV9A 4CQ8A 2ZC8A 3LK6A 4BEUA 4JICA 4I9JA 4YXGA 2ZOXA 4UTMA 1CLKA 2YL9A 4GIRA 3MBFA 3CHCA 3DFOA 1Q6EA 3CZ8A 3O06A 3GVWA 3KXQA 2YLLA 4B3KA 4PCFA 2PC4A 4U10A 1OFBA 3LXBA 1OYCA 4X2RA 2ZUMA 3UWVA 4NX0A 4MHBA 2JEQA 2OCZA 4FI4A 4O18A 4EZZA 1P0DA 5FL0A 2GQ3A 4E2DA 2QMJA 1CT5A 2WSRA 3W71A 3CQIA 1RQHA 2GJLA 3CAZA 4JTAA 5ABFB 3P8IA 4E2VA 5G5IA 1UB3A 3RCYA 4PR4A 1GNTA 1TQUA 1VLWA 2V2HA 1LJYA 5LNSA 2F1BA 3MUZ1 4MZ8A 4ZQRA 1P4CA 4NYUA 3SCTA 4YN5A 3T0AA 1QNPA 4E0CA 4HKPA 3G0UA 4H8SA 3WNMA 4JIHA 4QAIA 4XBKA 3CQ0A 1XJBA 3PUOA 1EH9A 2IUZA 1CLXA 3DHDA 1GJUA 2CLMA 5I3HA 4DO7A 3O8AA 4HSNA 3RXZA 2F9RA 2HDJA 3S2LA 4DXVA 3PJUA 1KM6A 2PD9A 3IJQA 3UYIA 3W86A 1ISZA 2XZ7A 2EPNA 4ZB0A 4ZOEA 1YW1A 5BMXA 4A3YA 4FX8A 3P8JA 3SRHA 3SCPA 3BH4A 3PPFA 2NT0A 4GA8A 3GFXA 2P5NA 3W1TA 3QY7A 3THQA 3WBEA 4Q4PA 1JUKA 1KCXA 5HBFA 2QIIA 3W02A 2KHOA 2ANUA 2YIBA 4Q6XA 4NZ4A 3B52X 2AGKA 3M0XA 3H2MA 3VIGA 2QYGA 3USBA 4AEEA 2AQVA 1SUXA 1RBOB 1UASA 3ZVHA 3U7VA 1HGYA 1RCXB 4NX5A 5CJMA 1RQEA 2BBFA 3LN3A 3U7BA 1F76A 5A8NA 4B3ZA 2CHOA 2O0TA 4LY8A 2RAGA 4J2MA 4PZVA 1OC7A 4M6PA 1PCWA 3NPVA 4PCSA 1W3TA 3E2RA 4EAMA 1PBGA 4JL2A 2ZIDA 1P6BA 3RIKA 1JZ7A 1TMLA 4UCFA 2A0NA 2QT3A 3RDKA 2VR2A 4IGMA 5CPOA 4GISA 4AX7A 4HA3A 1DKZA 3TYAA 3M6YA 3KBNA 3UEQA 3EJTA 3PS7A 1FXQA 1DP0A 5I5RA 2DJLA 1E1CB 4BQ3A 4H7VA 4MWAA 4DUOA 3IGHX 1NWRA 2XGBA 1YRRA 3A22A 4HSOA 1RBAA 2D23A 1NQ6A 4UC5A 1VFFA 4O8RA 4D6DA 3GHSA 2WSQA 3ZMRA 1AZ2A 2XSAA 4LJ3A 2EPKX 1GGOA 2ZUUA 2VP8A 3ABOA 2VFFA 4YTSA 4HK5A 4KFNA 3TFXA 3GAYA 4TX8A 4HA0A 4EAYA 1UBPC 4CD5A 1MI3A 2YJQA 2VXNA 2ZA1A 4PMVA 1IZKA 2ZZ6A 1XDMA 2DY3A 2ZUTA 2W9MA 5AHMA 2NXGA 1VLIA 2D69A 3M6DA 2OBMA 4C6FA 1EDGA 1GQLA 3FY1A 3MO7A 1PO9A 3A4JA 3BL3A 4MAVA 4PUEA 3BG3A 2R91A 5CJNA 2PRLA 2DU2A 3UT0A 3CUFA 4MZ1A 4HT3A 3LPOA 4B9YA 4GXPA 2TMDA 3ZJ6A 4LNCA 2J9ZA 3KP0A 2JF7A 2J77A 2QS8A 5A5WA 1VEOA 3IVTA 2I14A 3QGVA 4C1NA 4IUOA 1EJSC 4BZYA 5AB3A 3EWZA 5BOFA 1AQ0A 2YGYA 4RL3A 1XRVA 2R94A 4EVZA 3FVDA 4DAFA 3BZGA 4GUIA 3A21A 3H4WA 3SRKA 3N2BA 3EDFA 4M19A 5G1YA 1D3HA 4OBRA 2EKCA 3VEAA 3MYOA 1HKWA 3LERA 2N3KA 1YDYA 4HNVA 1TE6A 4WIWA 4X3ZA 5K9CA 4CQBA 1LL7A 5GJPA 4KCTA 3QHOA 1EGVA 3VKAA 3LLLA 3WQCA 2CLEA 3RX2A 2OO6A 1FWFC 3G1YA 4BKNA 4KETA 4MG4A 1AH4A 4R9XA 3A47A 1K9DA 4ZMGA 4EE9A 5AYYA 3UYCA 2CW6A 3VE7A 3H53A 2DUXA 2FZNA 1TYGA 2GGJA 4XZIA 2FTPA 4O50A 3AYRA 4WY0B 4HY9A 3I4EA 1G6CA 1LWIA 1A3XA 4J7RA 3OHXM 4JEJA 1HUVA 3SUTA 3L5LA 3V1HA 1F5ZA 1Q6LA 4LNYA 3TYBA 1XIFA 1HO1A 2BXYA 4IL0A 1SU8A 1R7OA 1WBJA 1MXGA 5DMNA 1Q6CA 3KVKA 2Z24A 4KH2A 2C18A 3QC3A 1XLHA 4FO4A 1PDYA 2PWHA 2G5WA 1ZWWA 2XIIA 2Z1WA 3KFTA 5LSMA 4GG9A 3BAYA 4L9XA 5FEWA 4ATWA 4O12A 1JVNA 3HO8A 3ATZA 4ACZA 3NQ7A 4I3GA 3DDGA 4LXFA 2OLHA 4CQAA 2VRKA 4EXQA 3AHYA 2PTWA 3TQPA 3WLOA 3V35A 2G3JA 3NFUA 2DW6A 3E49A 4H3DA 5I3KA 4UNIA 3OVPA 1UMYA 2JALA 1E4NA 3DU0A 3GNDA 1JF5A 1PYMA 3E0VA 1JZ8A 1K77A 4LV9A 2WZMA 3CJPA 1TWZA 3P7YA 3EA1A 1XH2A 4O1FA 4IIBA 4RNIA 4MWAE 2DT2A 3IS4A 4JQ4A 5MKGB 2XZ9A 3GFZA 3GR7A 3GK0A 1XYZA 4XTDA 4IMGA 3H55A 3UXAA 4AG0A 5I3IA 3FAXA 5LHFA 3WUEA 1OAOA 2P10A 1VIWA 3ZVHB 2WZIA 1W5MA 3L5AA 3U57A 4HN4A 3LSBA 4JHZA 2QJMA 5M03A 1UKQA 4XV0A 2ZXBA 2Q3OA 5FAGA 4MDPA 3VILA 3WNKA 2J62A 2ZZ3A 1GT8A 4D6HA 4B9QA 5ENLA 4K38A 3WLTA 4W8LA 1PYFA 3K8MA 3TIMA 3UWQA 1BYBA 5CEWA 2ZZ4A 5GVJA 4FX7A 1U5HA 3GSMA 1GOKA 3PN8A 3UGRA 5JVLA 4US5D 2VEPA 1NAL1 1JCYA 2W67A 1N8WA 4ORMA 3QQWA 4HNCA 4ZQPA 2VWSA 1XICA 2PTZA 4IL2A 1S46A 3V0UA 1XL9A 2X1IA 4O10A 3LGEA 1F3WA 1ZALA 2YOCA 5CSSA 2X7VA 4LVAA 4XKMA 3NQGA 4BI7A 4QSFA 4M7SA 3TAOA 1TV3A 1W3KA 1O6IA 3I68A 4WOZA 5A94A 2Q8ZA 4AZHA 4HMNA 2QCEA 4EPDC 3TR2A 4AISA 3CHVA 4JBRA 3N3TA 2PE4A 1JNEA 3NSXA 2C7FA 3DIPA 2CETA 4UR9A 1H7RA 4KT2A 2FMNA 4RZBA 1NFBA 4JS3A 4LAKA 2PP3A 1ZP4A 2OPJA 3EYPA 4H2HA 1AH3A 3N34A 2GUUA 1U30A 2BTMA 2X5CA 3SW6A 2WHMA 3FEQA 2WMHA 4QROA 5CC5A 4CKQA 2QDEA 3CL6A 4XAPA 4L61A 2YFNA 1B2YA 1C3FA 1H3GA 2Y63A 3M1ZA 4KIEA 7REQA 4WR3A 3W75A 2D2OA 4PMJA 2BB0A 2YXOA 3TROA 1UA7A 1Y5VA 4S23A 3BLEA 3R10A 1D3GA 1MEIA 5BXTA 4WZHA 1RVKA 1VYPX 4DZ5A 1Z7AA 4UWMA 4JIQA 2IKHA 1PX8A 2UY4A 1OK4A 2QKFA 3OPSA 2YCJA 1J5SA 4MWAD 1TV2A 4E4UA 1U22A 1R9XA 3NQAA 1LDCA 3CQJA 5CPSA 3GC5A 2D2JA 4AVOA 1FHUA 3V36A 3S6DA 3RLGA 3IK4A 4UOZA 4I5UA 4FB7A 2OXNA 4YYFA 1X7FA 1BVZA 3URBA 3L3OM 4FK9A 3OODA 1HXJA 2VFIA 1GQJA 4PMYA 3S1VA 2E5CA 1EF3A 3NPXA 3ABSA 3ABQA 1SZGA 1GYMA 3EWCA 3T2OA 1W9XA 2ACQA 4R5LA 6TAAA 5KITA 3CIXA 1QBAA 4RNFA 4QCFA 3BGGA 5REQA 4RDZA 4MWAC 5JBEA 3SCVA 3LDVA 4F2UA 5IHRA 5DXXA 3M16A 5AHEA 1VGAA 4JLCA 3U2CA 1FOBA 2F6UA 3BC9A 4QSHA 4EPEC 4UMAA 2DH2A 2OT0A 1UW9A 3IJ6A 3QKEA 3ITGA 3O0FA 3GS6A 5L9FA 3A13A 1D9EA 2GJXA 4UTTC 1OIMA 1R87A 3ARUA 1X03A 4DCNC 4GACA 2W63A 5E0FA 3P74A 1R3YA 3S5OA 2I5QA 3C2EA 4H6EA 4EXBA 5IBXC 2VQUA 1KWKA 3C8NA 4D8LA 5AOUA 1VRXA 2HPIA 3N25A 3NAVA 3REQB 3RITA 2O9PA 1XKJA 3QC0A 2VDGA 3ARSA 1E4LA 5HNNA 1YTKA 1KFCA 1XW8A 3CM4A 3OYXA 3TYUA 1F4HA 3PJXA 4MNKA 2ADAA 4HR1B 4DUVA 2PDYA 3O3RA 2BP1A 2OYKA 5KZEA 3EGJA 2Z26A 2BHZA 4MUZA 2QPSA 4YYCA 1WXYA 1R5EA 1LOLA 2V5BA 1X1ZA 4Q33A 1QI3A 3I04A 1EX1A 3U5UA 3FK4A 3TWBA 1DWAM 1XLIA 3LRKA 2VUNA 3EBVA 2FHBA 2MI7A 1XC6A 1A5OC 3KOYA 1BXNA 4K7VA 4ALDA 5G2HA 3TN3A 5H8MA 3R8RA 4NZ5A 2Z0OA 3S46A 1J4EA 1UJQA 3OIHA 3WLIA 1LRTA 1ELSA 2IKJA 5H1WA 4CGTA 3ELFA 2YW3A 3ANYA 3RLUA 4O4VA 5CC3A 3QMRA 3AO0A 3TQ0A 1S2TA 4XB3A 3COTA 1VKFA 3TW6A 3ZR6A 2EFLA 2G97A 4OE7A 1XC4A 2F2KA 2QDDA 4CD8A 2OSWA 1PIFA 2NW0A 3L67A 4RCXA 4TO8A 4AZCB 5BNKA 1QPOA 3M9YA 3W7CA 1BRLB 4JX6A 2QHAA 3VK5A 3O6CA 2GJRA 3KZPA 2PA6A 2PDKA 3I65A 5CAHA 1A5UA 2WNNA 2P3EA 1FVPA 3ME3A 2AOSA 1EEXA 3DX2A 1RD6A 3VZZA 1O5RA 2V68A 4OBTA 2IKIA 3SCOA 2YCLA 4UTWC 4PC8A 4Y9PA 3RYSA 5D38A 3MWAA 1NWTA 2CNCA 3AJ7A 4IIEA 2D0FA 2VYOA 2DIEA 4K36A 3S2MA 3WENA 4F2TA 1WAUA 3F5LA 5LNWA 4NI8A 3AS0A 3OZPA 2G8ZA 4REQA 3GIYA 3I7RA 2XM2A 4L6OA 4ZB5A 5I3JA 4ERAA 3RR1A 5ABEA 2CIPA 3FJ4A 1GZJA 2O4QA 3EOUA 4QNWA 3S1XA 1NWUA 4NZFA 3ARRA 3DFNA 3BUQA 5C5YA 2DT3A 2PRMA 3VGHA 2QAPA 3N2MA 2FMOA 3GXDA 4EZSA 3B0YA 3IIOA 3LV5A 3VCCA 2J25A 4CEUC 5XIMA 3AUJA 2ZXDA 1REQB 3L66A 5BW6A 1XYBA 4PYSA 1F6YA 3WCZA 3S5SA 2FLIA 1F8MA 4IG2A 3VDGA 1PTDA 4BF5A 4JFWA 3C7NA 5F1VA 1PIIA 2W3ZA 4E8DA 2YI9A 5C8BB 3W1NA 4A3QA 3UBPC 1XS2A 4H6QA 2QCFA 3IPWA 1L8NA 4LVGA 1JZ2A 4Q4KA 3K8KA 2C13A 4A8NA 1GW9A 4ZENA 2DZWA 1SU7A 3HTWA 5F2MA 4HPJA 3UR2A 2QXLA 5FIPA 3FD9A 3PZGA 5D2YA 3CTTA 1DL3A 4W7UA 5HQLA 3H7VA 3MHGA 2PC8A 3EKLA 5EBAA 3SBFA 4HGXA 4RR4A 5LZLA 2OWXA 1ZTVA 4PCTA 4IGSA 1C8VA 1X96A 3LRMA 4YMZA 5DXYA 4C6BA 3AXXA 5I23A 1HKIA 2WLZA 3NO5A 3H2CA 3UCQA 1EPVA 1W2PA 3VX0A 3MPGA 4AWEA 3WFLA 3PNZA 3KHJA 4TMBA 3OBKA 3VU2A 2YFOA 2W6RA 3UGVA 2WZEA 3TFCA 3SCUA 4FSAA 4FX6M 3KL0A 4ZE5A 2QUNA 9RUBA 1TCMA 2VFHA 4H9XA 2W91A 3N2CA 2DZPA 3WD4A 1FH9A 3QSRA 4ZO6A 5HWNA 2POZA 1O68A 4PMQA 3JZUA 2BGNE 4MAZA 3WQDA 4TX9A 2EAWA 2QDGA 3QZEA 3SUSA 4PTMA 1MRQA 2I9EA 1JPDX 4Q8NA 2GFTA 1QW8A 1VHNA 4HTYA 1K02A 5JIWA 1XIBA 3SUUA 1UUOA 3W7GA 1CXHA 1T8XA 2VRJA 3BVWA 4JWIA 2PGRA 3A9IA 3G77A 1JD9A 4PL2A 3O15A 2BFGA 4HMDA 3KRBA 5EMKA 1GCYA 3TCSA 4GBUA 4NZJA 4Z1YA 1EJXC 3RRAA 3UY7A 1TV8A 3E38A 3MI2A 3ITOA 3NL2A 1XLBA 3PSVA 3IGUA 3VUPA 1CGUA 5KBPA 4ECLA 3BUBA 3WL1A 4DBWA 4JQAA 2QNEA 4CD6A 4LS2A 3ER9B 1M53A 2V82A 4QLKA 3T09A 5AZ0A 1H49A 1R0MA 1V77A 3S1WA 4W84A 1O12A 4WXZA 3RAOA 2HS8A 4X9SA 1KM1A 3VIJA 3N19B 3VKDA 4GI4A 4EZVA 3KP1A 3DPQA 4DXKA 2OWWA 1HF6A 2JIEA 3EA3A 4TVUA 4NNAA 5JU6A 6PTDA 2XU2A 3MP4A 5F4WA 1VAHA 2NLYA 3ABHA 4IQJA 6CGTA 2OEMA 1CNVA 1KQYA 4R34A 1MXSA 3SN1A 3STFA 3W7NA 2J78A 4H7ZA 1SR0A 1JCXA 4MLRA 4GGHA 1WZKA 1ITCA 1XD1A 1J2WA 1NDWA 4LALA 1IT7A 4M6UA 3SRFA 3KOZA 2BZNA 2XH0A 4PSPA 1M9HA 4H83A 3FSTA 3VNKA 3VE9A 1IR2A 2VTFA 3VCNA 4PUKA 3AMCA 1DIOA 2WC7A 4FA3A 5BU9A 3EDDA 1DJNA 1TIMA 4MYXA 2QCDB 4JN7A 3GTHA 3BLLA 1OA0A 4GI6A 2RJHA 2NQ5A 1QASA 3CO4A 4Z1CA 2VL4A 4OQVA 1NH6A 5ABTA 4UR8A 4GKTA 4JTKA 1CGYA 2H90A 3OP2A 1GNXA 2Q71A 5CLTA 1XSIA 1KM5A 3L2LA 3P3BA 1PX4A 3LCFA 2X42A 4MFDA 3C4UA 3L2IA 1EFZA 3ZIZA 3W7DA 4XKYB 1E9ZB 2AQWA 2FKPA 2PP1A 3ARZA 4B91A 5EB8A 4FZIA 2YL8A 3NIYA 4DPPA 1R46A 5FF2A 1FWCC 4ZQCA 4O28A 1AMKA 4N42A 3S8HA 3LPFA 4XVDA 4JNFA 1XIDA 3P6LA 1HFBA 3T2PA 3SY8A 4S39A 5HJYA 1XRTA 4Q8PA 2Z1KA 2V3EA 1PKMA 3F4NA 3UZWA 1J2BA 4FS9A 1A53A 4GQBA 2P50A 4JCLA 2WMJA 4LB3A 1RA0A 3WBYA 4DJDD 1LF1A 4H8VA 2J8GA 5I3DA 3OZYA 4F01A 5CXPA 5KSWA 3N12A 3MHUA 4Y6GA 4J3ZA 4MB4A 5DT7A 2UBPC 3G3DA 3EDJA 4DWDA 5G1MA 1PXGA 1VFMA 4B5XA 5K3VA 3K8LA 1MFUA 4JD4A 1HJWA 4WK9A 2DW7A 3PHAA 2V6AA 5AYXA 3RILA 3OGVA 3NUKA 1TUFA 1LLWA 3DH7A 3P0WA 4LCQA 3HF3A 3L4VA 1QNSA 3LTYA 5BOEA 3AOFA 4XBSA 3WD2A 1KCLA 1F4AA 5CC7A 4AIEA 1KLYA 1X97A 3H26A 5C5BB 3L65A 1CWYA 3LD5A 3M0MA 3UG8A 4Q8OA 4A8RA 2QW5A 3CU2A 2Z1SA 4JQ3A 1C8XA 2VDHA 5JXQA 2QF7A 1E71M 3APGA 3M44A 2H3DA 2OQYA 4U3AA 4NI3A 2ODOA 3CIWA 1OB0A 3WNPA 3I3DA 2XFFA 2WZHA 1FHLA 4U5KA 1ODZA 1QWGA 4G5DA 1YX1A 5D02A 2X1TA 4EZXA 3QNIA 1FCQA 2PBGA 2F61A 1GVQA 1QHOA 3WFZA 4JIEA 3DN5A 3VD5A 3ZJ8A 3BOXA 5D30A 2ATMA 2J7FA 3S9IA 3CKDA 2W61A 2XVPA 1GUVA 2YSWA 1EJTC 4RV8A 3S5YA 3WBXA 3WQPA 1M65A 1CI1A 3MQTA 4M8UA 2DFAA 5KZMA 4YJ5A 4PB3A 4B5SA 2QCHA 2NUXA 4PULA 3AFBA 4HZ7A 4HD5A 5HATA 1RA5A 2Q02A 1VHCA 3NXFA 3ARVA 4NU7A 4NJIA 3VD9A 4LUIA 3LCHA 2OW7A 3MW7A 3O6AA 3THDA 2X3VA 3WUGA 1JIBA 3XIMA 1T8QA 2CESA 3KRUA 3WF3A 3VGDA 4UQDA 2ZFAA 4DN1A 1I2NA 3LGGA 3EDKA 1QX1A 1UZHA 1G0CA 3BVVA 2B0MA 1O4UA 3TYDA 1J18A 2P1FA 3MMWA 2F18A 4LH8A 1E6ZA 4ZOBA 2VZOA 3MB9A 2IXUA 5HA7A 4QQ3A 3WKZA 1VFTA 4I5RA 2ZRWA 3M0YA 3UXLA 3LBMA 4JPGA 1U83A 3IGXA 4DJFA 1UWUA 4HPGA 2DSVA 5LKYA 3C2VA 1Z6KA 4MSSA 4RDYA 4XIMA 4JQ1A 5EBUA 2B7QA 3PR2A 3B9EA 1WKYA 3W83A 1V7AA 3W07A 3W6MA 1QPNA 4IF2A 3W37A 1DV7A 3BANA 3ZQ9A 3NZQA 4MF4A 2D3LA 1P6WA 3NO3A 4WKAA 3T9PA 1W91A 2GOUA 3R1ZA 3WNNA 3BAWA 3HG5A 2WCAA 4EZYA 1XF0A 1KXTA 3WF4A 3GNRA 3B05A 2OG9A 4LBRA 2YIHA 3WDHA 1I2OA 3L7RA 2VEGA 1OQFA 2JE8A 2Y24A 3TAKA 4Y9AA 4QDMA 4R3UA 1VFHA 2GF4A 1F61A 3GDRA 3KWSA 1CGWA 1EA0A 4FLQA 4LANA 4D6CA 2BSLA 3PY2A 4GVFA 1T5AA 3PWGA 1TMHA 4L56A 1IWPA 3S9ZA 3WJZA 1WZLA 2V81A 3UJ2A 2CBJA 1WXJA 4I90A 1ICSA 4Q7BA 2O0I1 1M7XA 5XIAA 3L9CA 1WE5A 1CGXA 4K7YA 2X3WA 2O4MA 3D6NA 2XVKA 1LORA 3OHIA 3BOFA 1DWGM 4LYKA 4AC7C 1E2UA 4FOJA 2A4AA 4OT7A 3APTA 3RR4A 3SADA 3N14A 1XX1A 3II1A 1J0IA 1LTDA 3LTPA 4NUWA 5BRPA 2J9YA 2XH4A 3BCJA 4ADTA 2Y2WA 4BI5A 1S5WA 4M1RA 1OG6A 4YTRA 2EHHA 5HANA 1I0DA 1HW6A 2PDLA 4JNMA 4HYWA 1C7SA 2Q13A 2NVCA 5DEZA 1JCJA 2CZDA 3SCRA 3R58A 2WNZA 4KBXA 5FJIA 1JPHA 3GC2A 3RHGA 3NZRA 2RDXA 2YB1A 2H8XA 2WVTA 3A24A 1ITUA 5HINA 3VFCA 2WQPA 1RQBA 1XQLA 2WXDM 3OQ8A 1OVDA 3G1FA 2GQ9A 4C1NB 4LT9A 2J7GA 1QPQA 3H7RA 1KXQA 5LXEA 4FEZA 1FWWA 2PD5A 4JTHA 4GUGA 2Z2AA 1OZMA 3ID7A 1Q85A 1GORA 2VCCA 2EPLX 3EB4A 4GI8A 3GNPA 4AZGA 3NG3A 1TJRA 1LUCA 4XZWA 1ZLPA 4ZO8A 3DX4A 1EJWC 1R9YA 2F7FA 3LGDA 3UA4A 4MYAA 1VEMA 2ACSA 3KAOA 1JF6A 3THAA 1FH8A 3UCDA 3MS8A 2NVDA 3AWOA 1LWJA 5CG0A 4O14A 3ZM8A 2ZBTA 3HG4A 3QQ1A 2JGYA 4W7VA 3WEMA 1BQGA 4AVMA 3E2VA 4H9VA 1J79A 3UERA 2WO5A 2DJXA 4M5PA 4AUBA 1VF8A 5JBFA 3NQ8A 4O16A 3PZOA 4KS0A 5E9XA 2EWFA 4AVNA 4W88A 1DOSA 3IEBA 4PODA 5C5BA 5I2UA 4O8AA 4JY8A 2G3MA 3N73A 1PAMA 2PWUA 1DWFM 4QG6A 7CGTA 3W0KA 3V5OA 4Z2GA 3DX1A 2E8ZA 1C9WA 2OLAA 3WNLA 1LQ0A 1U5JA 2X1RA 4WJ8A 3RN6A 1FFRA 2B7NA 3L4UA 4XBJA 1O7DB 4IOTA 3G2GA 1GYLA 2NX3A 1KBLA 3U6WA 4HOXA 1ISWA 1B3OA 3GQYA 1F6PA 4CN1A 4F40A 4WLCA 5LNUA 4W93A 2ZUWA 1ZJHA 3DFHA 4LUJA 1BQCA 1Z69A 5A6BD 2HVOA 1E4IA 3WDJA 2DT0A 3EX2A 4XISA 5DCBA 3HQOA 3L3PA 1W3LA 2F84A 4R5EA 3HGSA 4O1DA 5HMFA 4XTIA 4ZE4A 4GYKA 4EXAA 1DKWA 4DM1A 4EZQA 3V1PA 3ES8A 3BJSA 2JIWA 3WD1A 3PM6A 4PEKA 4IMDA 1VENA 1KNWA 4ENLA 4WDTA 2VVSA 4AIOA 4O0ZA 1XHGA 3CO8A 2OSYA 3MMUA 3B51X 3TMLA 2FH6A 4C6OA 2QIWA 1MO0A 3LM7A 1EZ2A 5KZDA 3BLIA 4M51A 1CX9A 1OIFA 3SY1A 4HYBA 5CG7A 3CUZA 4UTKA 4YS1A 3GH5A 3N3MA 3AS1A 4WHBA 3WLLA 3GBEA 5KZ6A 4Z0SA 2QDHA 3TN6A 1XLAA 4HZMA 4MJ2A 1EPXA 4HB7A 3SY5A 3THCA 1VCGA 1ZGDA 2WKLA 4F00A 3GUWA 2XUCA 3PSWA 4MB1A 1OABA 3R79A 4JX5A 4UFMA 1ZAHA 1TCDA 4Z2KA 3C0SA 4A21A 2DIJA 3GD6A 2RFGA 3STCA 2R82A 1MQRA 1GOXA 3SZ8A 2NZLA 4ZQOA 2YDSA 4RNJA 5DX7A 4LAOA 4LUSA 1EBHA 3D3FA 3NSNA 2IQTA 5CSUA 3U4FA 3C3NA 3H2AA 4LUTB 2ZTKA 3HQPA 2E68A 4ADSA 2WKGA 3V18A 4JTFA 1H5VA 4N6EA 2DSZA 4LY4A 5AYZA 2WJZA 3NQ6A 3G8EA 2J6VA 4XX6A 4HK7A 1IT0A 4GIAA 4LC8A 1E9LA 3DHFA 1OBAA 3HAIA 4UXDA 1QI4A 3GW3A 2NV9A 3SI9A 4GPNA 1LOQA 3UWUA 3ERCC 4PBEA 3W1PA 2GSEA 3W2LA 2QPUA 1NFGA 1FDJA 3WMCA 3QQ0A 2E67A 2V5JA 4GY7A 3IJ8A 2IW0A 5DQPA 1O5QA 5LA1A 4Y7EA 1Y2OA 4H4IA 5I00A 3R43A 3Q65A 2ZZ7A 1TRIA 3KOFA 5AC6A 1V6YA 3E96A 4AYSA 3RUBL 3BW4A 1VQTA 5LGZA 1W9MA 4JYDA 1OFRA 3NOYA 2PDNA 1BWVA 1ITQA 4TTGA 1H1NA 1RAKA 3DG7A 4DVOA 1S2WA 3AIQA 1Z48A 1E72M 1LM1A 1W0MA 1ISXA 3VINA 3SR7A 3S1UA 4QAWA 5CGTA 3I3BA 3HG3A 2DZXA 1I75A 2HNHA 4QP0A 3BSMA 4F0MA 2G95A 3FCPA 3OU8A 3A4XA 1OCQA 3WLRA 1L0PA 2GK1B 5JUVA 1G5AA 1BWLA 2ZRZA 2OYMA 2ISVA 1YWMA 1XLCA 2YA2A 2XISA 4XSMA 8XIMA 2OELA 5DMMA 4K68A 1OX4A 4CUCA 1UWQA 2PU1A 2PDCA 2P53A 4UIOA 2E1WA 1JDFA 1IZJA 5FF7A 3UZJA 3TZFA 4O54A 3LZ5A 3BMVA 3G0XA 3CXOA 1OFEA 4QE5A 3MZNA 1KFWA 1WYIA 3DGBA 4IFOA 1BEUA 1V02E 5D8ZA 3KM8A 2B7PA 4Q4RA 3DERA 2WMIB 3ZZ1A 1KXHA 4EX4A 3BOLA 3LS9A 3UU0A 3I7QA 4YVVA 3B8TA 5BOOA 3A5FA 2OZNB 4ORIA 4R7OA 3O7UA 3OQEA 2BVYA 3PBWA 4W5UA 4O19A 2FVMA 1ISYA 3K4AA 2NQHA 3PBYA 3AI0A 4G1KA 4YIWA 1TZ7A 4WXYA 4N6FA 1MFVA 4B9ZA 2OGJA 3UY8A 1UOZA 3B0XA 1AFSA 2Q8XA 4YCOA 1OGGA 3I3EA 3QV9A 3AHTA 2DIKA 3B9DA 4FZOA 3L4ZA 5I3GA 3W7LA 1H51A 3P82A 4C7DA 1J12A 4PFHA 4JL9A 3VKBA 4FP1A 1HJSA 3W7JA 4CQ9A 2PY6A 4IWWA 4MKNA 1VBGA 3WF1A 3L21A 4IPJA 2D2GA 7XIMA 3NM1A 3LCXA 3S2JA 2D2HA 1HJVA 2F6XA 3BQ5A 5J04A 3BVUA 4RE3A 3W7RA 4CCZA 2GJPA 5D37A 4NHVA 2ZZ1A 1CLVA 4S3DA 5I6SA 3LBCA 3N15A 2GSJA 1VCFA 2XYLA 3GG8A 1P5BA 5CZTA 3DG6A 1U1UA 4PGLA 1B3VA 4QLJA 5MHBA 4DZIA 1SW7A 4MY8A 4JTUA 3ZSTA 3VEBA 1KV5A 3O05A 3QRHA 3VIHA 4C6LA 1TREA 2YA1A 3PZMA 2ABAA 3HAJA 4O11A 3RRXA 4Z1DA 5EL1A 2WC4A 5DLCA 1C7TA 3NQMA 2AQOA 4WSJA 4QCEA 3DC0A 1UPXA 4K8HA 3VKJA 2RAKA 3HN3A 3SQSA 1TRDA 5EMJA 4QG9A 2EX3B 4G2DA 1VJSA 1UCWA 3E0FA 4AZCA 4CCCA 5ECUA 5KMYA 1RJRA 1X39A 2QCLA 2BHYA 1GOIA 1KM2A 2H6RA 5C2CA 2O56A 2VJXA 4WRHA 4TU1A 3ORWA 3ZYZA 4EPBC 4Q4OA 4W8AA 2IPJA 3NGFA 1T41A 3QM3A 1KW1A 2DZSA 2QPXA 3T7VA 2HXUA 3BLOA 4XVEA 4I7UA 3G1HA 4IWPA 7ODCA 1BGAA 1GKQA 4OKDA 3IJIA 3NVDA 1A3HA 1JXKA 3V7PA 1QTWA 2PDJA 3EKGA 1R85A 1VFSA 3OA3A 4ASTA 2ZX5A 5E1QA 4LTSA 3JVAA 1R47A 1YNYA 1CXEA 1GVFA 4LWWA 1R3TA 4IISA 3VIKA 4IJBA 3M4HA 3E5BA 1OFPA 3H2EA 2GZXA 1W1TA 2CLFA 2GGHA 2PWFA 3RPMA 1HGWA 2PZNA 3VX1A 1R3RA 4WVXA 1BF6A 4FR6A 4MZYA 2YIAA 5ABGA 4NPHA 5T9CE 1O66A 2OO2A 4IM0A 1CENA 3VMPA 1EOMA 3FHQA 5LIXX 5DF0A 4R5JA 4GZEA 2G96A 3M0HA 4JN6A 3RK8A 3VM7A 4J3SA 5CGQA 1JFHA 1PEZA 1XWYA 3B0UX 3E3HA 1A5BA 1XYCA 4A3UA 3WL0A 4IFRA 3MY9A 1FWNA 3GR8A 4IGNA 1ZBKA 3B9NA 1B30A 3WQ4A 4H6RA 4RPPA 5C0QA 4AYGA 2J7DA 4WY0A 4B16A 4GKLA 1ZS2A 5LYRA 2R1LA 2R1KA 3VNJA 1MW3A 2ZRYA 3PAJA 2DZTA 4UDXX 1YXCA 2NXIA 5E84A 2YDQA 4TMCA 1VR6A 1UUQA 4O4WA 1I45A 2BY1A 3TCEA 2Y8KA 3FX4A 3ABRA 1QI5A 2P76A 5BYWA 1Q8AA 1XBZA 3N4AA 3WYZA 3EJSA 2XSBA 3I4KA 4C6KA 1JCNA 2VR5A 1L2UA 3AROA 4S3AA 4Q4QA 2E3ZA 2OEKA 2PURA 2C79A 2VKZG 4S3EA 4UQCA 3GG1A 4IPPA 1GJPA 5FD0A 2OX1A 3RO8A 5JBDA 4IQEA 4MUPA 4P5UA 3AIEA 1LWHA 3WDQA 3MSDA 1TTQA 1QNOA 3PZTA 1G1YA 4FMVA 1I4TA 3LM3A 3U0HA 3OB8A 3TLLA 3IUIA 3BAKA 4TTUA 2PU0A 2G3FA 4UQBA 1SFSA 1PZ2A 2XWEA 1H63A 5CKSA 3DAQA 3MKKA 4CNUA 1MSSA 3URQA 2OZ8A 3SN4A 4KKXA 4GE8A 4Y8EA 4FLSA 2ALDA 1UR2A 3L23A 4GQ0A 4W8BA 2X40A 1VH7A 2W79A 4TV5A 3VOCA 3SO7A 2POTA 1G7UA 4C1LA 1E1EA 3EMQA 3LHYA 1OA1A 2XWDA 1W6TA 3I6RA 4AD3A 3CNYA 4EP8C 2VMFA 3DXIA 4XSLA 4GYJA 4QE4A 1NEYA 1D8WA 1H2JA 3BXWA 4J3UA 3SJ3A 1AL8A 3AAMA 1WDDA 2V8ZA 3UCCA 1PWLA 1XBXA 1OEPA 1XLGA 1FH7A 3NGJA 4B5WA 2FB2A 4DJFD 4XZBA 2PGFA 1C93A 2XTKA 5CGMA 1GG0A 3E0LA 3MSYA 4BS0A 3T0TA 1JNDA 4YL2A 2P3ZA 3FYOA 2F7OA 4C6PA 4CNOA 1XYAA 1MMFA 2VC6A 1MVYA 1TJ1A 3WY1A 2ISDA 2QLYA 3KCLA 4JFVA 4S3GA 1GVRA 3DHPA 2V5CA 3B8WA 3HG2A 3NEHA 3ONBA 4LVDA 1A0DA 2CLPA 5CPMA 2A3LA 4A2SA 3HMJG 3TX9A 3O6YX 3CVRA 2X7WA 3VNDA 2ESCA 1SYTA 4GCXA 3UQNA 5HNTA 1EO5A 4C6IA 2WVSA 4QLLA 1AL7A 4NNCA 1A49A 1WDWA 2RHGA 4G8TA 4JL1A 4KRUA 3DYPA 3I2WA 5ECVA 1QI2A 1YKWA 1ONXA 1NELA 1E55A 4U31A 1UR1A 5EYWA 3V75A 5D33A 2PDGA 3OO2A 1XPGA 2D4CA 1MZRA 2DEPA 1ONEA 1AZ1A 3NL6A 3QWEA 3LLDA 2OX4A 1AW2A 3NYDA 1RSCA 4LEFA 2PMRA 3REQA 1LQ2A 4AIBA 3WBWA 2V5DA 2GJXB 4XQ6A 1E9YB 1UPPA 4CCEA 1OYBA 4QG8A 3CWOX 3OEXA 1I6NA 4XAFA 1M68A 1XLLA 4GINA 1Z9AA 2HEJA 2Q8LA 1NDYA 3F4CA 2YYUA 3QF0A 3DHUA 1KFEA 4E3TA 4LUTA 4ZCWA 2WJDA 2XHYA 3W9ZA 1HT6A 3D2EA 1XIIA 3SGZA 3BW3A 3VKKA 1Q6RA 4IQLA 4C7FA 3NSMA 2WWDA 4I8YA 1OC5A 1UR4A 2ISFA 4DWSD 2IMRA 2FPYA 2IPGA 3WLJA 3ALGA 1M03A 3PUEA 4Z2JA 1LG1A 1SU5A 3AIVA 1YBQB 3VKHA 1ITXA 5TAOA 3H2OA 4Q4MA 4JIRA 4EWND 2A85A 1PTGA 1H7XA 3GTFA 3I6TA 3QV7A 4G6QA 3L5MA 4XD5A 1L6SA 3CZLA 3B8SA 4S3FA 4A05A 1AMYA 1RJQA 2A1YA 3QHMA 3GDKA 1NF7A 2PDXA 3B8UA 3R5EA 3POHA 3NURA 1LOSA 4NJKA 2ACUA 5D2XA 3RFAA 3U2OA 1IHIA 1I1WA 3AS2A 1OGBA 2EJ1A 5AYBA 4AY8A 3RMEA 2ZADA 1UOKA 4H8NA 3RLVA 3MP5A 3AHVA 4MWAB 1EKOA 1QNVA 3ISIX 3SCWA 3BCFA 1E1CA 3FNDA 1F7BA 1ECQA 5GPRA 3WO8A 3S6OA 3S5NA 4N4PA 2O9RA 3CYJA 4HK6A 3ZLGA 4IX0A 1V0MA 3B8IA 4K8EA 1TTPA 2OKTA 3NNTA 3WUBA 4Q6JA 4CQDA 4DXXA 1BWKA 2ALRA 3AXMA 1Q6GA 4D72A 5A6KA 1XBYA 4XO6A 4N4QA 5D9MA 1A4LA 4P8UA 3S47A 4MM1A 1H5YA 4RJEA 3L0KA 2GWNA 2HWGA 1GVYA 5C7VA 5FACA 2WK2A 5F2GA 3AIRA 3CUIA 3TNOA 1QJWA 3G1VA 3LHWA 5AHLA 3WQVA 1WXZA 1MJGA 1V51A 4X61A 4D8AA 1ICPA 1KKRA 3SCNA 3UP8A 3G1XA 4AHPA 1PX3A 3ZS4A 2VQTA 4JN4A 3CMFA 3BG5A 3P67A 1SMAA 3OLIA 4E38A 2C0AA 4WKFA 1JL8A 1HWWA 6ENLA 3NZGA 3M3WA 1W2VA 2FH8A 4HZ8A 1VB9A 2J13A 2VUYA 1BD0A 3K2GA 1SJCA 4V2XA 1IZCA 4LW7A 3NM3A 2O7SA 1MYRA 3K1GA 1SW3A 1AQMA 4MDOA 5FLEX 2PZ0A 4LRSA 3AQUA 2F2HA 2C6QA 2I56A 1RY0A 2CHNA 3AHXA 1FDZA 3IARA 4DNHA 4WQ6A 1KFLA 2DZVA 5M3WA 1PCKA 4DYEA 3M0JA 1ZY9A 4DWSA 2J66A 4LRTA 3RM9A 3P81A 4MFEA 3MSRA 1JQXA 3R13A 2XSXA </