2YL6A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
total genus 173
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl6A01
2WAGA 1W91A 1HP5A 5BWFA 3WMSA 5CLTA 1C91A 1J9YA 4OUEA 1V6XA 5LYRA 3QOKA 3MMDA 4BQ4A 4JL2A 1JDDA 1ZBKA 3JUGA 3FAXA 8CGTA 1DTUA 3WH8A 3T2QA 1HJVA 3AJ7A 3ARRA 4MB1A 4H41A 1VB9A 3ZT6A 1GOQA 2VVSA 3A47A 4PN2A 4HP5A 2TAAA 2JIWA 1C93A 2WKLA 4JIEA 1NWSA 3S6TA 3GH4A 4ZE5A 1WDRA 1QHPA 1JD9A 2YBTA 1RD6A 2WMJA 4MB4A 1OGSA 3MSDA 5ECUA 3W53A 1PJ9A 2ZUSA 2J47A 5M3WA 5A94A 2CBJA 3L4XA 1IZKA 2JEQA 4AZGA 4N0RA 2XVLA 2JALA 4UOQA 2BV9A 1J0KA 4MNJA 4W86A 4EKJA 5M03A 1K9FA 2J7GA 3WFLA 1BYBA 1W32A 4AZ7A 6CGTA 3K8LA 1BYDA 3UG5A 1J0IA 3AMLA 1W9BM 4BQ3A 4P8WA 3O9NA 4PBGA 1VAHA 1WZAA 2CXGA 3WQWA 1KXHA 2YIHA 3W82A 2O92A 1E1FA 3ZJ8A 3WUEA 3SUWA 1EO7A 1EXPA 2CETA 1MVYA 1QI3A 5I78A 1L0PA 4NF7A 1D2KA 1FHLA 1BVZA 1SMAA 5CPSA 1QBBA 5AYIA 2PMRA 4AZIA 5I5RA 5A2AA 5AY7A 2FH6A 1GVIA 1UD3A 1EHAA 1AQHA 1E4LA 1NH6A 2VJXA 1GJWA 5A8NA 3T08A 4AD3A 3G6MA 4W7WA 2VZTA 1UH3A 4UQ9A 4PYSA 1PZ3A 4F9DA 1R85A 3FHAA 2WSPA 3AS3A 3BAYA 1W9VA 1J12A 1DWIM 4D6DA 1LLOA 3N15A 1Q6FA 3D3AA 4KRUA 2VCAA 1BFNA 3WBEA 1JAEA 1E40A 4CD4A 2OWWA 1IZJA 1GOOA 1HX0A 1PIFA 3CMGA 4HZ6A 2VRKA 3AZSA 1U30A 2A3BA 4CN1A 3W6LA 1BF2A 3EDFA 3WFZA 4HMDA 1OIMA 1E0XA 1GUVA 4W5UA 3VGBA 2F61A 1UD8A 5HNNA 3MANA 3ARWA 1R7AA 3WL0A 4ZENA 1DWAM 1W3LA 1RPKA 1VFOA 4JFWA 3AI0A 1RH9A 5A6SA 1HNYA 4UOZA 1CLVA 1G01A 1US3A 5M5DA 4AZBA 1DHKA 4PCSA 5A3HA 3BAIA 2VX7A 1UR2A 4B9ZA 2ZOXA 2W63A 4V2XA 5GPRA 4HPGA 1ZBCA 4U2YA 1K9EA 5A8OA 5A1AA 5I6SA 2AOSA 4JFSA 5IHRA 5E09A 3SCWA 1UWUA 4PTWA 3AXIA 2DT1A 3PZIA 5IFTA 5IDIA 1CZ1A 3VIGA 3PTMA 3AIQA 1EHNA 3WD3A 1B3ZA 1AQ0A 4D1IA 2JF6A 2DQXA 4UOJA 5A6LA 2XFYA 1V3HA 1XGZA 3VGEA 3LPPA 2G3NA 2VX5A 2CCRA 1PZ2A 6A3HA 1EQPA 1GOWA 4D6GA 7TAAA 5EBAA 5A2CA 3BMVA 3ZIZA 4C7DA 3GH7A 2BFGA 1BG9A 3T0AA 2IXUA 1VJZA 4KWUA 4CUCA 5D9OA 4OJYA 3I3EA 4BQ2A 1QNRA 4D6JA 3K8KA 4QFUA 1RP9A 2D1ZA 4F8XA 4GZJA 4GQRA 4H2CA 3OGSA 4PMUA 4CD8A 4Z2KA 1PEZA 2YLAA 5A95A 1JNEA 3N04A 5C70A 2O9RA 2DEPA 2D20A 1JYXA 1QBAA 3GNPA 2X0YA 4W87A 4D72A 3WD0A 4AXNA 2ZX5A 4GPNA 2JF7A 2XUCA 2PI6A 3SCOA 3VKKA 2Z1SA 2F8QA 2Y8KA 2WW5A 1E15A 3GXDA 3WDJA 3L4WA 1CXFA 1V3MA 4DWSC 2J75A 3CZEA 3POCA 3O2LA 1C7TA 6TAAA 1CTNA 2DH3A 2WHMA 2ZXQA 1E6ZA 3THDA 4HPHA 4W89A 4TXEA 4TVCA 1XD0A 1H09A 2A3AA 3NDZA 1QI0A 3BAXA 3VD5A 5I0DA 2OSYA 3UETA 5JBFA 2WBKA 1EDTA 3RJXA 4WIWA 3W81A 4AD4A 3KE0A 3POHA 3GTNA 4ZXOA 3F4VA 1JYVA 1X6LA 1VFFA 2XG9A 5GNXA 3VIOA 5CPQA 3RM4A 1JZ5A 4NSBA 2UWFA 1VFMA 2JIEA 3MMUA 4W5ZA 3PZUA 3MV11 3WKZA 1CXLA 4AZ6A 1TFVA 3FHQA 3BAWA 3NDYA 3WDHA 1YHTA 4WKAA 1UZ1A 2XTKA 2W92A 1MW3A 1JZ2A 4PMDA 1KXTA 1WAWA 1V3IA 1JFXA 4FLQA 1XSJA 4PTVA 2PWGA 4OBSA 1UD4A 1WDPA 2VRQA 2YJQA 1O6IA 2X05A 4AMCA 5I23A 3MUIA 2EBNA 4WK9A 2WLYA 1ISXA 4CCDA 3PBGA 4MNLA 2GDUA 4TTUA 3WDPP 1H1NA 3ZSSA 8A3HA 1W1PA 2UY4A 2GSJA 1K6AA 3AHXA 3SEPA 1LQ0A 4KGLA 3RJYA 2D24A 3OGVA 4ZFMA 2E8ZA 5A8MA 3ZJKA 1FFRA 3CLWA 4WKFA 3ALGA 4PMQA 2BXYA 4B3LA 5CG0A 2FHCA 2E9LA 1M01A 3DECA 4PMXA 5FKYA 3WIJA 1HJUA 4KMQA 1BPLB 4CD6A 1NWRA 3M07A 3CZKA 4Z2JA 1QNQA 4UZUA 4GZIA 1L8NA 2YKKA 2PWFA 2G3MA 3ARUA 1EGZA 1KCKA 3IAQA 1TVPA 1DWGM 2B31A 4D6IA 3WY1A 3MV01 3IAPA 3EDKA 4OOZA 4CCEA 2BNJA 4Q22A 4B3KA 1E43A 2EPOA 4FLRA 1JXJA 3ZSTA 4UFJA 5HXMA 3HN3A 3PZOA 4QLJA 1BYCA 1ZS2A 1J0YA 2E8YA 2WXDM 4OBRA 4S3KA 1E0WA 5D9NA 5A8QA 4HTYA 1HP4A 1NOFA 2BY2A 2J7CA 3VGFA 1MW1A 3ECQA 1UKQA 1CNVA 3PZQA 4XZWA 3WUFA 4DUVA 3GZAA 2BY1A 4PMZA 2J4GA 4M29A 1Z32X 1CENA 1WCGA 3QHOA 4JL1A 3T0BA 1UA3A 3L4YA 4P8VA 5HPOA 1UYQA 1FH8A 3PTKA 4PMOA 3B9AA 1XYFA 3E1F1 4RE2A 3WD4A 3SUSA 2Q8XA 4MDPA 1PX3A 1HKJA 4JAWA 3OLDA 1FP9A 1J0HA 3K1DA 1CGUA 4ACZB 3VIPA 1ZU8A 1HJXA 1HJWA 5CGTA 1ISWA 4HU0A 2VTFA 1LG2A 2JNKA 2WCGA 3WH5A 1W1TA 1HVQA 4PSPA 3AMDA 3AOFA 2A3EA 3WEMA 1HVXA 1UH2A 3SCQA 4YHEA 3PZTA 3CUFA 4IPNB 2ZXBA 4XB3A 3LPGA 3FW6A 1HIZA 4K68A 3ARSA 2MANA 3WDIA 4E8DA 1GOIA 2BS9A 3W0KA 1BQCA 3AIEA 5HBFA 1YQ2A 4QLLA 2J8GA 1J01A 4PMVA 5FCZA 4GIAA 4DUXA 1CGVA 3KL3A 5DEZA 2J79A 1JYNA 2XGIA 1ESWA 4M56A 3VD7A 5AC4A 4ATWA 5BCAA 3WNPA 2WVUA 1JZ7A 4AIEA 3KL0A 1DWJM 5CXPA 1C7SA 2VZUA 2QPUA 1HKMA 1KQZA 3VDHA 3RM9A 1W3JA 2DSVA 1E71M 1GQKA 4AISA 1E6PA 3SCVA 1G5AA 2WCAA 4P8UA 3GNRA 3T2PA 1BYAA 4NI3A 4KH2A 4CD5A 3BSGA 3ZM8A 2VX4A 1V0KA 4JHZA 1E4MM 4QDMA 3WMCA 1PBGA 2CESA 1E6NA 1XD1A 2WVVA 4B9YA 5A6KA 1HXJA 2J8FA 4UFKA 1OD0A 3CO4A 4BCEA 2XPKA 4TOQA 3VGGA 1VRXA 3MO4A 1B31A 2A3HA 3GXFA 1KBKA 1TR1A 1E1EA 3WH9A 3ZOAA 1PX8A 5JBDA 4HA3A 1E4NA 3SURA 1KXVA 3NIYA 2V5CA 3LPOA 3UESA 2QF8A 3OB8A 2GJXB 3KEHA 3O6AA 2G8ZA 4HU8A 2XGBA 4ACZA 2WMIB 2X8RA 1AMYA 2Y4SA 1G9HA 5GNYA 3G6LA 3UR8A 2WC3A 4M8UA 4PMRA 2NW0A 4ZEPA 3U7BA 2HVMA 5E70A 1K9TA 2PWHA 3U7VA 5CQ1A 4W8BA 4QCEA 3IJ9A 1UKPA 4PUEA 3W29A 3W28A 1H2JA 4EAMA 3ZR6A 4QP0A 3T0DA 3RMEA 4AC1X 2G4FA 1HJQA 1CXKA 3SIMA 1DWFM 5I3DA 5I24A 3VMOA 2WMFA 1RP8A 5M17A 4PTXA 4UFHA 1TCMA 4W8LA 1AQMA 4BS0A 4Z2HA 1KR1A 3HMCA 4A3HA 1Q6EA 3OZPA 5FD0A 4WF7A 3TOPA 5LA0A 2XM2A 1O7AA 2A3CA 2YDRA 3VTRA 2CIPA 3W24A 2C7FA 1V6WA 1C8XA 1A47A 4HA4A 4RE4A 3VPLA 1MW0A 3PZVA 1W9PA 1NOWA 2DT3A 4CKQA 1TZ7A 2XWEA 1PIGA 4JFTA 4ZXLA 3UCQA 4AD0A 3FY1A 4V27A 5ABGA 2C0HA 2J74A 2WCSA 3VU2A 3CZGA 3PZGA 4UQDA 2ZUMA 3WL1A 2CKSA 2PWEA 4PCTA 3AXHA 1GOMA 2GVYA 3I3DA 3W26A 1V0NA 1LWHA 2CPUA 4D6HA 5BRQA 3L4UA 3MUY1 3N9KA 4CN4A 5ABHA 1UWIA 4ATDA 2WHJA 1E6QM 3WEZA 1XHGA 2J78A 4TUFA 3F5LA 4JFUA 3RDKA 1FOBA 2NT0A 2ZX8A 2X09A 3WSUA 1VEPA 1M04A 1VENA 2DDXA 4C7GA 1GPFA 3S2CA 4DM1A 5AC5A 1V02E 1W2VA 1NP0A 2FDMA 2YL9A 2YDQA 1BVNP 1E4IA 4UFIA 3WF3A 1N82A 3AZRA 3U5YA 2GJXA 1UR1A 2WMIA 3AFBA 2VZSA 3TTYA 1UD5A 1OGGA 2D2OA 3TONA 3M7SA 4GKLA 1PAMA 1B3XA 1GW1A 2WLZA 1ZB5A 4AYSA 2RGMA 3ZR5A 1WNOA 4J3WA 2V3EA 1AVAA 2GDVA 1CGTA 5IXEA 1SFSA 4YHGA 4LGXA 4AZCB 1MFVA 3IJ7A 1MQQA 1ZBVA 1R8LA 5TD4A 2YL8A 5C8BB 5A6MA 2VMFA 2XVNA 4P7RA 1VEOA 2W91A 4HOWA 3APGA 4W8AA 4CGTA 2CITA 4J3XA 1TMQA 2O9PA 1X1NA 3WF1A 3B9DA 1C8QA 3T2OA 4CU6A 3OIHA 1US2A 4LXFA 2J7EA 2JEPA 1TUXA 5E9AA 1GHSA 2FGZA 4DM2A 2W4XA 1X6NA 1ZBWA 4UQAA 4GQQA 2XSBA 3DC0A 1E72M 3CUJA 1EOKA 4UQBA 1OSEA 2VZVA 4FK9A 4AIOA 1J0JA 2V3FA 2ZWYA 3F5KA 2WHKA 1Q6GA 4FZOA 2BVTA 1ISVA 1V3LA 3UERA 4AD5A 1B3WA 1OB0A 1B30A 3WQ8A 4XX6A 2WVTA 2IUZA 2VUYA 4AIUA 2XVGA 1UR8A 3BXWA 5A69A 1UG6A 2DIJA 1CGWA 2VURA 1V6VA 4XUYA 1DP0A 2D0HA 1WZLA 1Q6DA 4BZYA 2WZIA 1V0MA 3CGTA 4W88A 1UKSA 1BHGA 4JZ5A 4ZE4A 1W9UA 1JXKA 1GOKA 3CHDA 4F66A 3QOMA 3SUVA 4R5EA 2XHYA 4MNMA 3CMJA 1C8YA 3MMWA 2XM1A 1V3KA 1GQJA 2FHFA 3NCOA 3AIWA 3MUZ1 5BROA 1FH7A 2FGLA 4QLKA 2NSXA 2WYSA 3N18A 4B15A 2VT0A 3CPUA 4TX6A 4HOZA 2J77A 2XFFA 4CD7A 1JI1A 3MS8A 5BXTA 1LJYA 2QMKA 1B2YA 2BHUA 3II1A 3A4WA 4AZCA 3WF0A 1R86A 1ISZA 1FFQA 3NSXA 2EEXA 1UUQA 4OZOA 4X0NA 4UFMA 1E73M 1CWYA 3BH4A 3BSHA 1S46A 1QHZA 3GXIA 3D5HA 5JIPA 2V38A 2BVYA 2WB5A 2D0FA 4B16A 2V5DA 1H4PA 5BYWA 3A3HA 5CGMA 1EDGA 3L2MA 2G3IA 2WPGA 4H8VA 1WZKA 5KZ6A 2AMGA 2WK2A 5D9PA 1HF6A 1KB3A 2ZX9A 3AYRA 3DYPA 4CCCA 3VNZA 2OZNB 2DGAA 3L4TA 4V28A 1VF8A 1C90A 3WDQA 1TE1A 4GI6A 3L2LA 2OYKA 3THCA 3PZNA 1NWUA 1WDQA 1V02A 1VFUA 2VO5A 3RIKA 2Z1KA 4U31A 1HKIA 2X0HA 1E55A 3HJEA 3N13A 4RE3A 3VD3A 2RGLA 1UZ4A 3FN9A 1CDGA 3ZT5A 1ZJBA 2ZIDA 1XH0A 2X1IA 4U5IA 2VQTA 5JIWA 3SCPA 2FHBA 1JZ8A 1ZL1A 1FHDA 3N11A 2XVPA 1V0LA 2WWCA 1MXGA 5D9MA 4GO9A 2OYLA 5BXPA 4Y7EA 3GNOA 2UY2A 3OLGA 2JFEX 1MFUA 1JI2A 3WD1A 1XV8A 1F4HA 2J7HA 1XH1A 3AICA 3BAKA 2FH8A 2O9TA 1JF5A 2XIBA 3IJ8A 3RPMA 1HT6A 2AAAA 4H8HA 4IUGA 2J7FA 2CBIA 3PTQA 2XWDA 2OWXA 5BXSA 5GNZA 1TA3B 4PEEA 1CGYA 1NOUA 3VIMA 4P7QA 5D4YA 5IHSA 4F79A 4YPJA 1UR9A 1EQCA 3AQUA 3RO8A 5JBEA 2VC9A 2WVVB 4GI8A 3CH9A 4R27A 5EFFA 1LF1A 3PHAA 3AIUA 1NM9A 1UD2A 2DIEA 3BCFA 4PRWA 1XSKA 3N17A 4J3VA 1VJSA 4AD2A 1BSIA 1E9LA 5DT7A 4GINA 4TVUA 1QNSA 2V3GA 1B0IA 2J7DA 2GJPA 3ARQA 4D6FA 1OT1A 3WD2A 3W27A 1EO5A 4MB3A 3VDBA 4Q7NA 4U3AA 3J7HA 1UD6A 4XZBA 5CPTA 5FIPA 2VR4A 1EDQA 3CHCA 3MSGA 3EDEA 2J7BA 1J0ZA 5LA1A 2BY3A 2EPKX 2QPSA 3N1AA 4GI9A 3PZMA 4JKMA 3QR3A 5C71A 4M1RA 5A6JA 2VCCA 4UNIA 4M81A 4LQ1A 2WM0A 4E8CA 4UFLA 1QVBA 2ZUVA 3W25A 1JZ3A 1H11A 1H0GA 4WSKA 1WKYA 4MB5A 4J27A 2QV4A 4D1JA 2YL5A 3OLIA 4YN5A 3EMZA 2G41A 1W2PA 1WP6A 3BGAA 1UR4A 4QCFA 5GQBA 5D8ZA 1E3ZA 4J3UA 1BLIA 4WLCA 2PBGA 1E3XA 2ESCA 2NT1A 4D71A 3AZTA 4DWSD 1KBBA 3VUPA 4D6CA 2W5FA 2EPNA 1BGAA 2J62A 2ZUUA 1VIWA 4PMYA 2VR5A 4UTFA 1I1WA 1TA3A 3W6MA 2E40A 5ABFA 1MYRA 1R87A 4MDOA 1BAGA 1JIBA 4N42A 2CHOA 1KR0A 3WMBA 3WNNA 4C7FA 3ZMRA 1QW9A 3BLKA 4BQ5A 1MWOA 3EDJA 1B1YA 1I75A 2Y24A 4FLSA 1C92A 3GYCA 3WNKA 2Y5EA 3CUGA 2BHZA 4MJ4A 4MAVA 5FOOA 1ECEA 1M03A 3AIVA 1IV8A 3VNYA 2ZX7A 5D8WA 2XIIA 1CECA 1CXIA 4DWSB 3KZSA 2WMHA 2UY5A 1ISYA 4MTVA 2E3ZA 1XH2A 2Y8VA 4L4PA 3CBWA 4HMCA 1Y7VA 4JKKA 1R7OA 1NWTA 1VEMA 4H7VA 4UR9A 1WE5A 1SR0A 2WC7A 3ARZA 2OSXA 3WQ5A 3DYMA 3DYOA 2WZEA 1E5JA 2WBGA 2VRJA 5CLWA 2YDSA 3WDRA 4RL3A 2ZX6A 2W61A 1B90A 4IISA 4Z2LA 1A3HA 4UCFA 4UQCA 1G94A 3MU7A 3W37A 1CLXA 2UY3A 3GBDA 3TTSA 3W4RA 3PN8A 4E2OA 1OINA 4D6EA 1TG7A 2VOTA 1E70M 4LYPA 3UEQA 5BXRA 3T09A 3WQ6A 1CPUA 1CEOA 2WC4A 4OKDA 1CBGA 2BXZA 5E6ZA 1WPCA 3AHZA 1V6YA 2VX6A 3EBVA 1CXHA 3OBAA 3CZLA 1W3KA 3ZO9A 1V3JA 3ZT7A 2DSZA 2BHYA 2GUYA 4UZSA 3L4ZA 4AD1A 2EPMX 4IPLA 4TX8A 2DSUA 3KWXA 4LYQA 4FZPA 2VZOA 3KL5A 3OLEA 1HN1A 5KEZA 3ZQ9A 4LX4A 3RILA 1UH4A 2ZXAA 2BVDA 1LWJA 1PPIA 1UWSA 2D0GA 2QHAA 5EMYA 3PZ9A 1J10A 4GO8A 4HOXA 2VQUA 1WZMA 4HZ7A 5DO8A 4A3YA 3F5JA 1KQYA 4X0VA 4OOUA 1UWTA 1MQPA 1XSIA 3EDDA 4J3TA 3ARVA 4H8UA 1QI2A 2DT2A 1P6WA 1JDCA 1QPKA 1XYZA 1EA9C 5HDRA 3EMQA 2CEQA 2E9BA 3CHEA 1KCLA 4CN6A 3K4DA 3SCTA 4DWSA 3FAWA 7A3HA 3OA5A 5E0CA 4JHOA 1W3HA 1MXDA 4P7NA 2IXVA 3RM8A 5A6AA 3NJ3A 3BCDA 2DT0A 3DHUA 1JFHA 3CZ8A 1LG1A 3SUTA 2YA2A 2CBVA 3ARYA 2OSWA 3WENA 3ZJ6A 1E56A 3OGRA 3AHTA 3A4AA 1W1YA 4PTMA 5CZKA 3WUBA 3VD4A 4M82A 1GVYA 3SCNA 2O9OA 4MNKA 4Z2GA 5AYBA 3WQ4A 1ITXA 1XRVA 3SCRA 4W7VA 2YA1A 4W85A 1MW2A 1QI4A 1D7FA 1M7XA 3VMPA 2WZHA 2PWDA 3GXMA 3ALFA 1JAKA 1H49A 3AISA 4CU8A 1DWHM 1E0VA 1QNPA 1B9ZA 2VI0A 1ODUA 2CKRA 2CYGA 4W7UA 3VILA 1QNOA 1UKTA 4FLOA 1UHVA 1EIBA 4NRRA 1E6XM 2XJ7A 1Q6CA 2ZICA 2WMGA 2WSKA 3NUKA 2DPEA 3VM7A 1XCWA 5LA2A 2YLLA 1J11A 1V6UA 3SUUA 5ABEA 1HJSA 5IFPA 4P7LA 1UKOA 3A4XA 3AXXA 4EANA 3WH6A 3WH7A 5EFDA 5I77A 3B8SA 1IT0A 2V3DA 5EB8A 2WANA 5A6BD 1GORA 1KGWA 5A8PA 3LMYA 3TTQA 2EXOA 4CVWA 3ARTA 1KGUA 4MADA 1E6RA 2WWDA 1D3CA 3I3BA 4MAZA 1LL6A 5JUVA 3TTOA 3UR7A 3CIVA 1UQZA 4TVDA 1OCQA 1GCYA 3QHMA 1FH9A 3VDAA 1NP2A 3B9EA 1EH9A 3EMCA 4PUDA 5DT5A 3CHFA 3A6OA 1UR0A 1DEDA 4J7RA 1CYGA 1H41A 2CNCA 1EOMA 3CUHA 3VIKA 4AY1A 3WNLA 7CGTA 2VL4A 3UG4A 2VCBA 2J25A 1J18A 2EPLX 3MUAA 1JYWA 1GZJA 3CZJA 1UA7A 1GONA 1KWGA 3N12A 4J3SA 1OGBA 1K9DA 5E0FA 2D22A 3WEOA 5DF0A 1OT2A 1VBRA 2WHLA 4AW7A 1GHRA 3GBEA 2JE8A 4AEFA 3VM5A 1G0CA 3VD9A 3RCNA 2W66A 1UQYA 1UWQA 2VVNA 4J28A 4ML4A 5HPCA 3TP4A 4U5KA 4NZCA 1XC6A 5I2UA 3AMCA 2CBUA 2ZWZA 4WSJA 4AZ5A 1U2YA 1C3FA 3VGDA 1GJUA 3VIJA 5E6YA 4IM4A 2BY0A 3BMWA 4U33A 1OIFA 2X2YA 2XVKA 4KRTA 4UQEA 1HL8A 3CTTA 4W93A 4H04A 5FL0A 4NRSA 4XV0A 4HA1A 2GK1B 1HL9A 3IK2A 1JZ4A 3WUGA 3CUIA 3K8MA 1B3VA 3WF4A 2F2HA 3VOCA 1MQRA 3NSMA 3WBAA 1V03A 3IANA 1NARA 1PX4A 1GQLA 1V08A 4WKHA 3DHPA 3AMKA 4HZ8A 2Y2WA 3W38A 1FP8A 1UOKA 3QHNA 4U2ZA 4WJXA 4GZEA 2EO7A 3EYPA 4CVUA 3AIRA 3VGHA 5CJ5A 4ATLA 3OZOA 3AYSA 2YOCA 3LPFA 3BC9A 4X9YA 2YL6A 2WNWA 1GNXA 1ITCA 2WKGA 1LL4A 1BG4A 2WVSA 3BAJA 3QGVA 3AHYA 4U3CA 3FXYA 3U5UA 1UWRA 2DSWA 4JCLA 2VNCA 3WNMA 1KGXA 1H3GA 3VMNA 5HOSA 4Z2IA 1E5NA 4PMNA 4BF7A 1JZ6A 2PF0A 2W67A 3VIHA 1F4AA 3ARPA 2C8NA 1BGGA 3NSNA 2QLYA 1QW8A 4LYRA 1QHOA 2YA0A 5A6BA 4FMVA 2GJRA 5ABFB 5I79A 2OLHA 1Q4NX 1CGXA 1W9XA 4JKLA 2G3JA 4FF5A 2ZE0A 3GH5A 3AHVA 3K46A 1TVNA 1W9DM 4QAWA 2D3NA 3VIIA 3K4AA 3WELA 4TTGA 4F9JA 2EJ1A 3WNOA 4JFVA 5CSYA 2E9MA 2GFTA 4CU7A 3M46A 1SMDA 1E6SM 2ZUTA 2PBOA 1HKKA 3WN6A 1OD8A 3L4VA 4AWEA 3VX1A 3VIFA 1U33A 2DSKA 3AS1A 3ZJ7A 4EK7A 3WF2A 5CSUA 3NYDA 2GK1A 1SYTA 4P8XA 1H5VA 1JGIA 4MJ2A 1OM0A 2D23A 1JF6A 2E0PA 1KXQA 4M80A 2OWCA 3SCSA 3VDCA 2CHNA 1ODZA 3VVGA 4MPKA 1GQIA 5DFAA 4HMEA 4A4AA 2YBUA 3OG2A 1W1VA 1WO2A 1OBAA 1QI5A 4BA0A 4L4OA 3SCUA 1KFWA 1BTCA 3AIBA 2W62A 3AS2A 4S3JA 1JDAA 9CGTA 1CIUA 1JG9A 3VO0A 5F7UA 1XCXA 4KGJA 1NQ6A 3UG3A 3VINA 1G1YA 3TA9A 2ZXDA 2PB1A 1ZJAA 2E4TA 4ACYA 1B3YA 2D3LA 2WMKA 3FNDA 1LL7A 4E4PA 3U57A 1QOXA 4GXPA 1CXEA 2HISA 2CERA 1WDSA 4P7OA 4M24A 1JL8A 4DUWA 2DH2A 4URIA 4EE9A 1M53A 3WQVA 2OYMA 2XFRA 1JNDA 1I1XA 2XSAA 2QMJA 2ZUWA 4AEEA 5FL1A 3AMGA 3M6DA 1JD7A 4AZHA 3GM8A 2ZUNA 1OWQA 3AS0A 5DMYA 3HU7A 1KWKA 4W84A 3VX0A 2PC8A 3AROA 5A2BA 4LPCA 5BRPA 1VBUA 2XYLA 4PSRA 1WB0A 3MKKA 4JCMA 3BLPX 4OIFA 2EQDA 1FA2A 1H0IA 3ARXA 3GDBA 2OO2A
chains in the Genus database with same CATH superfamily
5BWFA 3P0WA 5K9CA 1C91A 4OUEA 4DPPA 4UTJA 5LYRA 3QOKA 1VBJA 4F4RA 4AXKA 3XISA 2OGJA 2VHLA 4BQ4A 2HMCA 1ZBKA 2JK2A 1AA1B 2NQLA 4HU3A 1GYNA 3WH8A 3ARRA 1VQTA 2VYOA 2ON3A 2TAAA 4PCFA 1SPQA 2FZ9A 3GH4A 4I8YA 4MZ1A 2XN1A 2OZTA 2V5KA 3B8UA 1RD6A 4NP7A 2WMJA 1WXJA 3U4FA 2EFLA 4H9YA 3GXPA 1IT7A 1NF0A 3RV1A 2ZUSA 3M7WA 2CBJA 5CC6A 3IGSA 2LLEA 3P93A 4MNJA 2ELBA 2XIQA 2Y70A 1MUMA 3SADA 3FX4A 3OZYA 1W32A 2Y0FA 2YW4A 4AZ7A 3FEQA 3LTPA 2R9RA 3K8LA 1RALA 4XAYA 3NO5A 3UG5A 3E12A 4P8WA 1YTDA 2CHRA 4RNJA 3L5LA 2CXGA 2PGRA 3BMXA 2O92A 4NUWA 4UNLA 3SN4A 2IKHA 1NFBA 1XIFA 3H26A 4L6OA 1A3WA 1H7RA 5CPSA 1QBBA 1ENUA 5E9XA 3G1VA 5I5RA 5LIUX 3UW6A 4ATMA 1AQHA 3Q58A 2FB2A 1O5RA 2VJXA 4IFRA 4I6KA 4W7WA 3TAOA 3OG3A 1PZ3A 3PWGA 1H7NA 1W9VA 3TCEA 3Q37A 1LLOA 3W7RA 1Q6FA 3H55A 1TYGA 4MKNA 4XQ6A 5JVLA 2QCDA 3H24A 1E40A 4ZSTA 4PEKA 3A12A 3SB0A 4YL2A 1IZJA 1Q8AA 2XIOA 1HX0A 1PIFA 4ZQNA 3BV4A 4H3DA 4HZ6A 3W86A 3ZLFA 4IIEA 4GFIA 4YVXA 1OIMA 4O1DA 4W5UA 5FEZA 1UD8A 4J1OA 4H9TA 2Y63A 1RSCA 2QCFA 3TLQA 1RLDA 3RLGA 4ZENA 3U6WA 3QY8A 2VELA 3AWNA 1RH9A 1OG0A 5LXXA 4JR5A 4DJFC 1G7VA 1X39A 3TV8A 7TIMA 5M5DA 4UTTC 4FAMA 5FJRA 3EPNA 1Z41A 2VX7A 4C6NA 4B9ZA 4IQLA 4HR1B 1JPDX 4A21A 1AFSA 3MKVA 1ZBCA 1H1YA 1K9EA 3L67A 4HMNA 5I6SA 2AOSA 1ONWA 1TV7A 5IHRA 2GSEA 3CAZA 3SCWA 2ZVIA 3C0JA 3H2NA 3BARA 5CJMA 3BLEA 3PZIA 1B3ZA 5LGZA 1I45A 4Y90A 4D1IA 5HQMA 2XH4A 3DHDA 1OA1A 2XFYA 4L4MA 2O4QA 4XAZA 1R6WA 3W7CA 1YNYA 5G1MA 2VX5A 2CCRA 4Z1DA 3UA4A 1EQPA 3ISIX 4EOUA 4D6GA 3CC1A 5AOUA 5H2ZA 3ZEDA 4WOZA 3ZIZA 4C7DA 2CZEA 2VGGA 3GH7A 4D2JA 3WBXA 1F3XA 4CUCA 3L2IA 5HINA 4BQ2A 4AB4A 2TMDA 4N4PA 2D1ZA 3NPWA 4GQRA 3DZ1A 4GZJA 3RUBL 3SGZA 5HMEA 2YLAA 5GJPA 3VNLA 3LU2A 2I9UA 5C70A 3F7WA 1K7XA 1FWBC 3LA4A 1QBAA 3QTGA 4D72A 3NZPA 5J8LA 4ZTXA 5CZJA 1QWKA 2F8QA 2QCHA 4FX8A 2WW5A 3QPYA 3PG8A 3NM3A 1FWEC 3L4WA 3H2FA 3E38A 3T07A 3EWXA 2J75A 3CZEA 3R4IA 4QJ5B 3GVRA 4B9QA 1C7TA 1M1BA 2C1GA 2ZZ6A 5CBIA 3H54A 3I04A 4W89A 2R94A 3H2EA 3NZ1A 1XD0A 2VEFA 4L80A 1H09A 3F1QA 3HGJA 3BAXA 3VD5A 2C18A 3VKDA 2OTDA 5FF3A 5IBXC 4HR1A 4MVAA 3GTNA 3IJIA 4ZXOA 3VKCA 1A5OC 1JYVA 4W9TA 3DH7A 3C2YA 5CPQA 3RM4A 2H6RA 4LUIA 1XLLA 1RBLA 2R1KA 4KIEA 2IKGA 4LBUA 3FHQA 2NX3A 4GCXA 2ZRWA 3M0LA 3NDYA 3F4NA 4WKAA 1A53A 2W92A 2AQOA 3H22A 3ES8A 1ZTVA 4FLQA 3S2JA 2C6QA 4PTVA 3S1UA 1TTQA 3GC4A 1WDPA 3W70A 1F3WA 2YJQA 2QUNA 2QVNA 1RCQA 4LV4A 2ZZ3A 3MUIA 1SZFA 4YVPA 5C5BB 5TKYA 2ATMA 3PBGA 4HSOA 4GE8A 3WDPP 8A3HA 1W1PA 2UY4A 3AWOA 1XKJA 3CK5A 3XIMA 4NILA 3NQBA 2E8ZA 2OMAA 4H6RA 4JIRA 1TTIA 3S83A 1ZHAA 5CG0A 2E9LA 1QFEA 5KZEA 4PMXA 2E6FA 3E2SA 4Z2JA 4GZIA 1L8NA 1L6YA 2PWFA 1G7UA 2G3MA 1KCKA 2QW5A 4ZQMA 1TVPA 1DWGM 1KA9F 3MV01 3IAPA 1QWUA 3EDKA 4AWSA 1GKPA 4OOZA 4B3KA 4FLRA 2J24A 5HNTA 4GGHA 2CU0A 4UFJA 5D37A 4LOCA 2ZC8A 4H01A 2DZBA 4H8NA 4S3KA 1XRTA 2BY2A 1D3HA 3QC3A 1QR7A 2E28A 3EB4A 4B5VA 1RCOB 3PZQA 4M6PA 2DW6A 4DXXA 1OF8A 3B53X 4PMZA 3ANVA 4DYKA 3PB0A 2CLIA 3UITA 4M29A 1IXOA 8RUCA 3I6RA 3QHOA 4O8RA 3L4YA 1EWEA 1KM0A 2CFFA 1XYFA 3SUSA 4OUIA 3C2FA 3NA8A 5I00A 1J0HA 2E77A 4ZB2A 4ACZB 1IXQA 5JMUA 1XJBA 1HJXA 1ZU8A 3FXGA 1PVNA 4N6FA 2KX9A 4Q8OA 1MI3A 2VTFA 1LG2A 2JNKA 5C5BA 1XYBA 2HROA 3GDLA 1A80A 4PSPA 3CMFA 4G8TA 2CLKA 1PXGA 3FA3A 3WEMA 3QN3A 1HVXA 4OV9A 3I01A 4GGBA 3HPAA 3GG0A 1GVSA 2V2CA 2HEJA 2ZXBA 4KCUA 3STGA 3WDIA 2BVWA 1K1DA 4QAIA 1M6JA 3O3RA 4S23A 1GW9A 3AIEA 5HBFA 1P0BA 3VKJA 1F73A 1TZZA 5DEZA 1QT1A 3W7EA 3VKHA 2DZAA 3G1FA 1DQUA 1JYNA 4G6CA 4K8GA 1JZ7A 1IYXA 3UCCA 3UXKA 5C9UA 3C0LA 1AMKA 3KL0A 4NG3A 4C60A 2YYUA 1E1DA 3D51A 3ONCA 3VDHA 1W3JA 1YXYA 4Q32A 1E6PA 1YTKA 3URNA 3GNRA 5DLCA 4NI3A 3R12A 4NJIA 2BTMA 1TPH1 2RAGA 4KKXA 3TOYA 2GQ3A 4JHZA 2DW7A 1E4MM 1PBGA 1H7PA 1S2AA 1E6NA 4X2RA 4B9YA 1DXFA 3S9IA 3FEMA 3TZFA 2WSYA 1VRXA 2GGEA 1Z7AA 2W27A 3GXFA 4DBUA 3PUOA 2WV8A 1PX8A 3ATZA 4G7EB 3LVTA 5CG7A 3SURA 5KZDA 1KXVA 4TO8A 1AJ0A 4MPQA 4GUJA 3UESA 4Q8TA 2ZZ1A 3SY1A 2GJXB 3NO1A 4ACZA 2WMIB 3KBJA 1F07A 2Y4SA 4E38A 3F4CA 4M8UA 3M64A 5T9BG 3U7BA 5E70A 4O54A 5CZ0A 3MBDA 3U7VA 2DZVA 4QCEA 3VKAA 2G0WA 3NPXA 4R34A 3T0DA 2V6AA 1JCXA 4AC1X 2G4FA 1HJQA 3SIMA 4NZFA 5I24A 1KLYA 2BZNA 3PANA 4Z2HA 4NZ5A 3WBWA 1AZ1A 1Q6EA 2F6XA 4WF7A 3KS5A 2XM2A 1O7AA 3HG3A 2A3CA 3LLLA 4Y2WA 4KWVA 2OFJA 3W24A 5EY5A 2C7FA 3H4GA 1F2JA 1Z3NA 3THQA 1TX2A 2PGWA 2QAPA 3WLRA 1OQFA 4RE4A 1VHNA 1MW0A 3BW3A 1HWWA 2YW3A 3GHUA 4CKQA 1VCGA 3FY1A 5ABGA 1W1B1 2C0HA 3GG8A 2WCSA 4C6CA 2D69A 3QLLA 4UQDA 4MOZA 1XGDA 2PWEA 3W88A 3CB3A 3DX1A 3CIXA 1V0NA 2CPUA 3L4UA 1O1HA 2I5QA 1TR9A 1UIPA 4R7WA 1JQVA 1GKQA 1UWIA 4FI4A 4PRRA 4ATDA 4FOKA 2NXIA 2NQZA 3WEZA 4C6OA 5CC5A 3F5LA 2NT0A 2Z0NA 2PDYA 1RJQA 4IWWA 4F00A 4MLRA 3WSUA 5J5RA 1M04A 1TV2A 1GPFA 4G7EA 3MYPA 1NP0A 2FDMA 2YL9A 3AXKA 3TW6A 3W1UA 4LC8A 2GJXA 3PWIA 3C5QA 1M9HA 3KP1A 4V1XA 1US0A 2WMIA 5AC8A 2EG8A 2YIAA 1OGGA 3LX9A 3M0VA 3IJQA 3TONA 3M7SA 4YLWA 4GKLA 3UZ5A 2LXYA 3MI2A 4LVBA 4JTQA 3VZXA 1OFEA 4AYSA 1WNOA 3OODA 4K1WA 2PDQA 1ZCOA 4MYAA 1C29A 4AZCB 3IJ7A 3LTYA 5TD4A 4NKCA 5A6MA 3S2LA 4KPLA 3CYVA 4HOWA 1SGJA 3APGA 3P61A 1ICQA 2CITA 4JY9A 1TMQA 1TMHA 3B9DA 3W23A 2PU1A 2PDWA 3OYXA 4PUNA 2RAJA 3O15A 3TJ4A 2XISA 5F4SA 3UWQA 1TUXA 4S1FA 1KTCA 2ACQA 1V6TA 4DM2A 4WDXA 5FF7A 1X6NA 4BI5A 1ZBWA 3A4JA 4C1KA 3CJPA 3IVUA 3UPWA 4GQQA 1MZHA 1EOKA 4XKMA 4UQBA 1OSEA 4FK9A 3QZEA 3TYUA 4AIOA 2H3BA 2ZWYA 3EOUA 4KCTA 4H6KA 5XINA 3DGRA 1ISVA 4R9XA 3GSMA 3K13A 3WJXA 1DJWA 1B30A 3GO2A 2WVTA 2CZ5A 3TKFA 1VCFA 1IWAA 3QSRA 5DRCA 2P5NA 5A69A 1CGWA 4EX4A 3SM0A 1DP0A 4NJKA 1Q6DA 3QYQA 1H51A 1YTEA 1V0MA 1UKSA 3H7VA 4JZ5A 4ZE4A 1JPHA 4F66A 3CYJA 1NF7A 4JTLA 3SUVA 4R5EA 3ITTA 4FIQA 1DOSA 3PR2A 4EZXA 3ZWSA 4EPKA 4IXHA 1ZP4A 2CZDA 2FTYA 5DXYA 4CNTA 1D3GA 3PPGA 3O3NB 3QY6A 2QKWA 1A4MA 1FWNA 1PSCA 3P14A 4MFDA 4QG8A 3L23A 4TX6A 3SDOA 2XFFA 4CD7A 1JI1A 3EPOA 3M0HA 3MJMA 3TX9A 5U7SA 1X7IA 3QKZA 5EMJA 1W37A 2X0SA 4AZCA 3WF0A 3U4AA 1LZOA 1FFQA 1Z48A 4X0NA 3VOHA 4DLMA 1E73M 3BH4A 5KZMA 1XISA 3GXIA 1AL7A 3D5HA 5JIPA 4H9ZA 4HQVA 4UTKA 4LNCA 2WB5A 1H4PA 1H60A 1EDGA 3L2MA 3C4UA 3L68A 1WZKA 3KRBA 5CZTA 3S2MA 4CCCA 1Q6LA 3VNZA 2P1FA 4V28A 1C90A 3WDQA 4OU1A 3L2LA 1XIBA 1WDQA 3T05A 2INEA 3RIKA 1R3RA 4G7FA 1J2WA 4IWQA 3D47A 4HYBA 3CEPA 3N13A 1KKOA 1LBFA 1UZ4A 1PB0A 3ZT5A 4ERIA 2ZIDA 4U5IA 4GC4A 3TC3A 2DVXA 5H8PA 4L7ZA 4LCRA 1GK8A 1MXGA 1J5SA 4DX3A 5F1VA 4QIUA 3PBWA 1TIWA 1VCVA 2JFEX 1MFUA 1U5HA 1F4HA 3LHVA 2J7HA 3TA6A 3BAKA 4N9BA 3G1DA 5C7VA 4RCXA 2XIBA 3EX4A 2GOKA 1YXCA 1NIUA 1HT6A 4H8HA 1T96A 3BSMA 4OVXA 4GI4A 2CBIA 2E68A 3BUIA 2OWXA 4NXKA 1EPXA 2PDPA 4HKPA 3QC0A 2Z2AA 1EXBA 5IHSA 3R43A 1UR9A 4DJFD 1EQCA 2Q12A 5JBEA 4YTTA 5C9RA 3PPFA 5EFFA 3PHAA 4HA0A 5DCBA 1NM9A 5FIGA 2HNHA 2PUZA 3B04A 3BCFA 4JX4A 3N17A 4J3VA 5HWMA 5FSEC 3R89A 5DT7A 3ITXA 4TVUA 4KT2A 1QNSA 2X1TA 1EP3A 1I8JA 1B0IA 1V93A 1GJPA 2GJPA 3V5OA 3KBMA 4PB4A 4D6FA 2WQPA 4QRNA 3WD2A 1FWTA 3UZXA 5TAOA 4U3AA 3KCOA 3J7HA 4ZQCA 3LGEA 1KO0A 2FZBA 2EF9A 4QBXA 3E9AA 5CPTA 5FIPA 2VR4A 4RXFA 4E3TA 3CQ0A 3EDEA 1J0ZA 2V67A 3CXOA 5LA1A 3MP4A 2QPSA 3PZMA 4IM2A 1MEWA 4JKMA 1A0CA 3NFUA 5L6UA 4R88A 4UNIA 5AB3A 4NQ1A 3L7RA 2WM0A 2A21A 2PDIA 1JZ3A 1H11A 5C9ZA 4PB5A 3W02A 3TNBA 3B9OA 3LQLA 2RJGA 3T4WA 3EA2A 3L12A 6XIAA 3AO0A 2QV4A 3QZ6A 4MZ8A 2OKOA 2R24A 3R7MA 3NXLA 3DC8A 4YN5A 2FPYA 3R94A 1TPB1 3EMZA 3FYYA 5JU6A 1BKHA 4ZR8A 3ER9B 4HYVA 4WLCA 4XKYB 3N2XA 2ESCA 3AZTA 1KBBA 2DFAA 1GG1A 3RYSA 3GVQA 3K1GA 2X1RA 3C2OA 2XSXA 2EPNA 3URQA 2VR5A 2DORA 2PRHA 2E40A 4M0XA 1MYRA 3GTHA 4JPGA 4FOJA 1JUEA 4C7FA 1Q2RA 3C61A 3FA5A 1JJKA 1MWOA 3E0VA 3EDJA 4KWOA 1FWWA 3G1RA 3GDTA 3QSTA 3VKBA 1TQSA 2Z8YA 3TYZA 2BHZA 3UF9A 3PFRA 3FDGA 3D50A 1IV8A 3BJFA 4XO7A 2ZX7A 1CXIA 2OQLA 1SUXA 1R46A 4EZVA 4G9PA 1VKFA 4HMCA 3I65A 2QPXA 3N4AA 1RQBA 4HN8A 4NYYA 2NXGA 4DYLA 2PU0A 4FR1A 1E5JA 3TXZA 5CLWA 3WDRA 2GJLA 1R9YA 3QW3A 2W61A 3B40A 2BXVA 4ZO6A 3R8RA 4E2OA 4MGGA 3KBNA 3VE7A 4CQBA 2VOTA 1UP3A 1ADDA 3IGXA 3GG7A 1PKLA 4JTKA 4OKDA 1CBGA 3ZXWA 1N55A 2VFDA 4GUHA 3GTXA 1FTXA 2QDEA 1ZGDA 2WJZA 3P5ZA 1S5VA 3OBAA 2F18A 3ZO9A 1DJHA 2AKZA 2E5DA 3ZT7A 2DJXA 1R5EA 3L5AA 3KOWA 1IR2A 1PL9A 3NEVA 5CJNA 2AL2B 2NWSA 1I4LA 2RKXA 4TX8A 1EGVA 4XKYA 3U2CA 3VFCA 1I4TA 4FZPA 3LV5A 4IIHA 4IMFA 4GFSA 3ZQ9A 3OQ8A 5D03A 3HF3A 4Q8MA 2ZXAA 2BVDA 3L21A 1UWSA 3LGGA 3M5ZA 1K4HA 3SYVA 4WXZA 5DO8A 3UWUA 4WSHA 1KQYA 3R6IA 2Z0OA 4GVFA 1RLCL 4FXRA 3MSRA 3EJUA 1V79A 1JDCA 5LNVA 1XYZA 5AYYA 5REQA 1EA9C 3VI2A 1ZWWA 1OX4A 3EMQA 1H7XA 4CN6A 3K4DA 2GJNA 3CT7A 3FAWA 5K7JA 4DBWA 1KC7A 3S5SA 5AN7A 3FV9A 5E0CA 2FVLA 4AAJA 3P2VA 1Z69A 3GVVA 5A6AA 3BCDA 3DHUA 1VJIA 3BGJA 4Y8EA 3UGRA 3OHMB 2NXHA 3CT2A 3A4AA 4JX6A 1UUOA 2DP3A 2VEKA 1KV5A 3P60A 3UBPC 3TYCA 4O1FA 3WUBA 4M7TA 2ADAA 4C1NB 4GX9A 3SCNA 3E3HA 2O9OA 4MNKA 3W87A 1F61A 4XK2A 5AYBA 2XH7A 3U2ZA 2PDLA 2P76A 5T91A 2V0OA 4YYCA 2MUCA 2X3VA 3ID7A 1JAKA 1V7YA 1H49A 4QDWA 4LVGA 2X40A 5H1WA 1DWHM 3E0WA 5CPLA 2LM0A 2XH2A 4Q8NA 3V7PA 3EKGA 2DUAA 4RDWA 3Q94A 4ZO8A 2GQ9A 2VXNA 1YWMA 3LHWA 1IIGA 5D30A 1NDVA 1Q6CA 3RU8X 1TPUA 3DI1A 2DPEA 3VM7A 5LA2A 3MC5A 1J11A 1V6UA 4JXCA 1DKWA 3SUUA 3USZA 3EKZA 3UT0A 3QXBA 1HJSA 4L61A 4QM1A 4WJ8A 3A4XA 4EANA 5I77A 1YMYA 1CW2A 5EB8A 2HSAA 2WANA 4UTIA 3EOOA 2CLFA 1GORA 2W9MA 1LP6A 4HVXA 1JEZA 4CVWA 1KGUA 2HXUA 4IIFA 4X3ZA 1IR1A 4S3CA 1FXQA 1UQZA 1GCYA 3GYEA 3FK4A 2GUBA 4WOQA 3VDAA 1P7TB 3B9EA 1QU4A 3CHFA 3A6OA 2JBMA 4R5JA 1PTAA 1KTBA 5TQLA 4JNEA 3D4YA 4AY1A 4PO2A 1C8VA 1VZWA 3UG4A 1UC4A 3LRKA 2VWSA 3CZJA 3SO7A 3WX7A 1GONA 1EUAA 1KWGA 3NL2A 1K9DA 1XG3A 3URAA 4GYKA 4DO5A 4GIEA 4AY8A 3H2OA 1MEIA 3WEOA 1JCNA 2WHLA 4R5GA 2QIIA 2JE8A 1EFZA 2E7FA 1KBLA 4B2DD 4O1CA 5BWAA 1A0EA 3JS3A 4C1NA 4X9SA 4EIVA 4LUJA 1XC6A 3AMCA 5TNVA 3NL6A 2ZWZA 4WSJA 1Y0EA 4PFHA 4YVVA 3VIJA 2BY0A 3RO6A 3HPXA 4O12A 2X2YA 3ABRA 1Q65A 3LV6A 1HL8A 4H04A 1I2PA 4XAFA 7ENLA 3FGCB 1XQKA 3IK2A 1B3VA 2X42A 3T4AG 4GRSA 4DYJA 1AH4A 3AMKA 4HZ8A 2Y2WA 1FP8A 5D38A 4A2RA 4LUSA 4US6A 1W54A 4PB3A 4IP4A 4JYDA 4CVUA 1XG4A 2ODOA 2GZXA 2PAJA 4DAFA 2YCJA 1XGEA 1EJUC 4MWAB 1K3UA 3NGJA 3GG1A 4IM3A 3LPFA 3BC9A 4WDTA 3W9ZA 2YL6A 2WNWA 3CV5A 1GTHA 1Q4WA 5BRBA 2NLIA 1G4SA 2WVSA 1P7TA 4L9ZA 4U3CA 1UWRA 4AWTA 2VNCA 1DJNA 3DX5A 4OFCA 4D8LA 1GTEA 5CEWA 4Z2IA 2PC4A 4BF7A 1JZ6A 2PF0A 2F6UA 5AHLA 1EJVC 3ER8C 3NSNA 2B4GA 3Q65A 3LLXA 5A6BA 4Y6GA 4FMVA 5ABFB 2WYHA 3C2RA 5I79A 2OX1A 1PS9A 4H9MA 4DJDD 4V1YA 1Q4NX 3EAUA 5D2WA 3DHFA 1XICA 2GPTA 3RPDA 4BJHA 3E2VA 2G3JA 1XLFA 3CU2A 4O1AA 4FF5A 2ZE0A 3T81A 1QPOA 2D3NA 1S5MA 4TTGA 4H6QA 4HCLA 3M9YA 3U2OA 1U1HA 1S2WA 2GFTA 4CU7A 3M46A 1TQVA 2AQVA 1BD0A 3HQNA 1P1XA 3MWCA 3DFSA 1U33A 1QK2A 3MUXA 3BLOA 4REQA 1DIOA 4EK7A 3WF2A 1DJQA 5CSUA 1SYTA 2ACUA 4KWSA 1JGIA 1K70A 4NX5A 2FMOA 3QVQA 4NVTA 3SW6A 1P5BA 2EX3B 4X63A 1U5VA 2CHNA 3M0KA 3PY2A 1S38A 4J35A 5DFAA 3OG2A 1Y2OA 3L66A 4BA0A 4GG9A 1KFWA 2QGYA 4EZTA 3AIBA 3W2JA 2Y5SA 4M19A 3QFEA 4JIIX 4MWAA 5FA5A 5F7UA 1I0DA 4JNFA 1PCWA 2DJLA 2F2KA 4CCZA 3EXRA 4H2HA 1MMFA 1XRSA 2OX4A 2GL5A 3RPTA 3OK8A 2VKZG 4JTEA 3KCLA 4A8NA 1QOXA 3DESA 2CERA 2A2IA 5I06A 3A13A 7REQB 4JS3A 3S1WA 3D46A 4URIA 4EE9A 1M53A 3LCGA 3WQVA 1EC9A 3KRSA 4UDXX 3QZAA 3W3OA 2XSAA 5ABTA 5CBJA 2ZUWA 3WLHA 3D6NA 4XBSA 3M6DA 1JD7A 3BLFA 2ZUNA 2I57A 2Z27A 1KWKA 4B5UA 3NOEA 3HZ3A 2OGYA 5U4NA 5A2BA 5BRPA 2A7RA 3GI7A 3CV2A 2CWXA 3BG5A 1MUCA 3BLPX 3OYZA 1PUDA 3P80A 4XD3A 1J4EA 2WAGA 3VYLA 2Q71A 2G37A 1UWAA 2HVOA 3QFWA 3B8DA 3O6DA 1XW8A 3RF9A 4IGMA 4RUBA 1URUA 1JDDA 2RT6A 3JUGA 5BU6A 3FAXA 3MUCA 1Z9AA 1KNWA 3AJ7A 4MB1A 4H41A 1VB9A 1K8CA 3GXTA 2FTWA 3PAJA 4PN2A 4JTRA 1BXNA 4IP5A 4HP5A 2JIWA 2ZBTA 4JIEA 2WZTA 1SR9A 2QUVA 3OP2A 3W7LA 1QHPA 1LWIA 3HIJA 5ECUA 2Q8ZA 4EXAA 1PJ9A 2XFWA 1IZKA 3I4EA 4FZSA 2VC5A 1TPWA 1SZNA 1ZQ5A 4W86A 5M03A 4XZ9A 3MT1A 2RUSA 3CASA 3CM4A 3WFLA 2PFHA 1BYBA 4G1KA 4HYWA 6CGTA 1IXPA 3WQGA 1G4TA 3O9NA 2C3ZA 4KFNA 3E0FA 1GZGA 1RBAA 7REQA 3MSYA 5DQPA 2CLEA 1OFRA 2ZADA 3ZJ8A 3DKJA 3SUWA 2QCNA 2PTWA 1EXPA 4M6UA 2CETA 1E1CB 3EXSA 1QI3A 5I78A 2C1IA 3IVSA 1L0PA 5C2CA 3F2CA 1XLEA 4UMCA 3DKLA 2GGJA 5EMUA 2J9ZA 4AZIA 5AY7A 1UD3A 2CW6A 3A5VA 1NH6A 3KDNA 4MY9A 1QO5A 2EPHA 5A8NA 2YCIX 1WQ5A 3V3WA 1UH3A 3R0DA 4I7VA 4UBPC 4AMAA 4LUTB 1YBQB 2WSPA 3O63A 3HQ1A 5I07A 3GUWA 3GR7A 4GOAA 4XBJA 4KRUA 3ABXA 4AF0B 1GT8A 1JAEA 3SZ8A 2YCEA 4C5YA 3UU0A 1GOOA 1ZENA 3FJ6A 1U30A 3A64A 4FXJA 4EACA 3PC0A 1ME7A 3STCA 2F61A 3EWUA 1FDYA 3WL0A 4UTWA 4PUKA 5A5WA 2GUUA 4JD4A 1VFOA 2FVMA 4DWDA 2IPWA 2O7SA 1G01A 3NZRA 5MF5A 5A3HA 2OEMA 2RFGA 3BAIA 1S2UA 2JNSA 1WV2A 1LBMA 1XINA 3LUTA 1XIJA 3BL3A 4GA8A 2IQ0A 4JNZA 3GNDA 3ABQA 1BWVA 3WJSA 1S2CA 4NJJA 5EYWA 4JFSA 2X7WA 4A3UA 3HFTA 2ZKMX 1UWUA 4PTWA 3SGGA 5IFTA 3PTMA 2ACRA 4RE0A 5CPNA 3NVTA 3WD3A 1XL9A 2VFEA 5FEPA 1TTJA 2DQXA 2HJPA 5MKGB 4U10A 1XGZA 4ORIA 1SJDA 1VR6A 4WY0A 1UJQA 3SSJA 1QUMA 3I6EA 2ISWA 1OCJA 3C52A 3JZUA 1IGSA 4KWUA 4LTSA 4LCQA 3MY9A 3KOZA 1JUKA 4TV6A 2OLSA 2D73A 4LUTA 1YBQA 2YFNA 2XZ7A 4XZMX 4CD8A 4A05A 5A95A 1F6KA 5K2ZA 2OKTA 4JBRA 3N04A 2DEPA 2D20A 1E51A 1PE1A 4IMCA 4PMJA 3GAKA 4W87A 3B0XA 2P0OA 3R2GA 2PS2A 4JTAA 1PHQA 3SCOA 1R2SA 3GXDA 3KAWA 1KRBC 8TIMA 1X1OA 1CXFA 4R33A 4QTGA 3E5BA 1V3MA 3EEZA 2BOGX 4AYGA 4FEZA 3POCA 1E6ZA 2VC7A 3UPMA 4HPHA 2NV1A 4TVCA 2OW7A 3NDZA 2P10A 5I0DA 1WDWA 2OSYA 5JBFA 4DQWA 2WBKA 4I9MA 1EDTA 3UWWA 3W81A 3POHA 4JYFA 3LDVA 1LBLA 4HSNA 4POCA 2V8ZA 3KFTA 3RX3A 2BGSA 1XYLA 3R79A 6XIMA 2E6YA 5CPOA 4YTUA 2UWFA 4FNTA 3UA3A 3IJ6A 1CXLA 1TFVA 2HBVA 3WDHA 3BAWA 5C2GA 1UZ1A 4K39A 2VFGA 4OBTA 1R3QA 5LXEA 1XSJA 5JH1A 5MKGA 1TJ0A 2PWGA 4OBSA 3MHUA 4UMBA 1UD4A 2PRMA 2X05A 2HXTA 1MNZA 3B4UA 3CV7A 3BZJA 2EBNA 5DBUA 1ISXA 2CLOA 4AX6A 1BF6A 4TTUA 2A6LA 3BO9A 2V9DA 2GSJA 1K6AA 2PGFA 4AVOA 4M51A 1LQ0A 3NQAA 3EJQA 3DG7A 4O1BA 3M5XA 2WJFA 3HG5A 3RJYA 2ZYFA 3OGVA 2F6KA 4DVOA 3ZJKA 4PMQA 3V5CA 1RK5A 1DE5A 4PRTA 1HJUA 1PS3A 3UD6A 4HNVA 4CD6A 1NWRA 1XF0A 4FALA 3CZKA 3LCFA 2F1AA 2YKKA 1A5SA 3PWAA 3IAQA 4D6IA 3WY1A 3C8FA 2DU2A 4CCEA 2QS8A 2EPOA 4EWND 3IACA 1U22A 3T0TA 2A5HA 2PPGA 5B80A 1VBGA 2QFFA 3PZOA 1BYCA 1XX1A 3P82A 1DQXA 1L2UA 4HTYA 3UWZA 1HP4A 2J7CA 1MW1A 1O5XA 1CNVA 3EWBX 3O07A 1JCLA 3U8GA 3WUFA 2OJPA 3NURA 4DUVA 4XZNX 4KEZA 4HZMA 2INZA 2OG9A 3BTNA 1Z32X 4Q4SA 1TV3A 1WCGA 2J6XA 4JL1A 3VEBA 1J6PA 2ISDA 5F1UA 4P8VA 5HPOA 1KFLA 2JKAA 4PMOA 3G1HA 1W31A 3TK7A 2ZRYA 4C6EA 4RE2A 3WD4A 2QCCA 2POTA 4MDPA 4YIWA 2DY3A 2XN2A 4YCPA 2QQ6A 3FA4A 3M1ZA 1MJGA 3ENLA 3MHFA 3T9PA 1HJWA 1LUCB 5CGTA 5ENLA 1ISWA 1WDZA 4HHHA 3EKLA 2A3EA 2Y62A 1JPKA 1QK0A 3QR1A 1PWMA 1KCZA 3A22A 4YHEA 1CT5A 1IQ8A 3PZTA 4I5XA 3PPHA 1QOQA 2YZRA 5RUBA 1TPC1 4IPNB 3MDWA 1RA0A 3FW6A 4OTKA 1OK6A 2MANA 3IWPA 3ZYZA 4GWEA 4E8DA 3KX6A 1UIOA 1GOIA 2BS9A 4EZOA 1BQCA 4RV8A 1LDCA 1LLWA 3S47A 4GNKB 1HW6A 4GIAA 2RAIA 1CGVA 4R5LA 3TQKA 5AC7A 1P6CA 2XGIA 3RITA 3UY7A 4ATWA 4DUOA 2WVUA 2RAKA 1UB3A 5FF0A 4I3GA 2PCEA 3C6CA 4Q8VA 2DSVA 4AISA 3SCVA 1W5PA 2QDGA 3DN5A 4I5RA 2VX4A 4E2DA 1V0KA 4RNIA 2CESA 3SJNA 2WVVA 1TJPA 2FZ8A 3SI9A 4DJEA 3B51X 3TSDA 2QUMA 1A5KC 1S3HA 3MO4A 4RDYA 2A3HA 2FYMA 4A3RA 2DZSA 3WH9A 3ZOAA 5JBDA 3ABZA 3TC7A 3SQLA 1EJTC 4LUYA 4KW2A 4AHOA 4XZHA 3NIYA 4JIHA 1R9ZA 4LRTA 3O6AA 2G8ZA 2X8RA 1G9HA 5GNYA 5FLEX 3GVGA 3MPGA 4CQ9A 4ZOCA 2NW0A 1WA3A 1ZNNA 3CZNA 4B3ZA 2QF7A 3KVMA 4WY0F 2CZVA 3MBFA 1ELSA 3IJ9A 1UKPA 4PUEA 3W28A 3U48A 1DIDA 2OZ3A 4RZ5A 5EGRA 3DEQA 5M17A 3LLDA 3WQEA 1AQMA 3WQPA 3EWZA 3IV3A 3TN6A 1ZLPA 4A3HA 4IFKA 3TOPA 3UYIA 1QPRA 2OCZA 5K9XA 3GE7A 1JCMP 2YDRA 4H7ZA 4QEHA 3USBA 4MWAC 4LC6A 2ZTJA 3EWYA 2BB0A 2D4CA 1W9PA 2R1MA 1JRCA 2DT3A 2VDIA 2XWEA 4JFTA 4ZXLA 3UCQA 2E5CA 3W1XA 4V27A 3CB8A 4DEFA 5KBPA 2H8ZA 3ITVA 4JHMA 5CSSA 4QX4A 4IX0A 3PZGA 3BGGA 1FWGC 4JDYA 3GK0A 3N2BA 5TBOA 3FIGA 4HJWA 3TC6A 5DY2A 2PMQA 4HYRA 2GQAA 3UJEA 1XLAA 2I17A 3W26A 1LWHA 5HNRA 4GMEA 3P7YA 5AYXA 4D6HA 5BRQA 2PA6A 4CN4A 4N9CA 3D52A 3GS6A 1FUYA 2PDFA 4AG0A 1E6QM 4DPQA 1F05A 3QA8A 2OZ8A 4RW5A 2Q6ZA 2HZGA 3TROA 3RDKA 1HKVA 4RNFA 5L9FA 1VENA 2DDXA 1IGWA 4HT3A 1OY0A 5AC5A 3W7JA 1V02E 3LENA 1SU8A 1E4IA 4UFIA 3PB2A 4NYUA 1N82A 3U5YA 5AZ1A 4YYFA 1UR1A 3B4YA 4KEUA 2VZSA 4R9OA 3FJLA 4BR1A 3W2MA 3BPWA 1IF2A 1ZJHA 3MP3A 5CCZA 5I09A 1ZB5A 2RGMA 3ZR5A 4J3WA 3TH6A 5IXEA 4YHGA 2PY6A 3S6OA 1R8LA 2YL8A 2OBLA 1VBHA 3W1LA 2VMFA 2XVNA 2W91A 3XINA 4CGTA 1JVNA 4LF2A 1X1NA 2OVLA 4CU6A 1KRMA 3W01A 1FRBA 2J7EA 4O4VA 2B7PA 1RY8A 4DYEA 4FNQA 3CV6A 1W5QA 3W7GA 2FGZA 3IIVA 2QCGA 5AECA 1YE4A 4ZQOA 3E0IA 2RDTA 1X6UA 5E84A 4UQAA 2IQTA 1M41A 3T1GA 1VFLA 3CUJA 1E9ZB 3ONBA 1KRAC 2L5HA 3VFLA 3S3GA 4C65A 1P0KA 1NTHA 3MKCA 5HJLA 3OPSA 3V5FA 3APYA 4B91A 1AW5A 4XTIA 1OB0A 2F84A 2FICA 3WCZA 4Z42C 4ZCWA 3NZQA 2XVGA 2QT3A 1EKOA 1ZYLA 4I7WA 2DIJA 3NL3A 5KMYA 3NG3A 3RG6A 2F7RA 3HGRA 5C6MA 3PBYA 4W88A 1R38A 4DZIA 1BXBA 1A5AA 2FZDA 1W9UA 3CHDA 1Q63A 3EJRA 2P8CA 1ADOA 4MMWA 4ZOAA 2WNNA 1C8YA 2JKEA 3NCOA 3RLVA 4NHVA 3VNDA 4HK7A 4K1GA 1VIZA 1W9MA 3T49A 2NSXA 5EKYA 4B15A 1XDJA 4C6DA 1RA5A 2VT0A 2J77A 1H61A 2R91A 3GKAA 3MCMA 4F0HA 3GZ3A 4O17A 1B2YA 3MMTA 3KDRA 2V68A 3NSXA 4OZOA 4H6HA 1CWYA 1GEHA 4ERGA 1QHZA 2HRWA 3TEVA 4K6AA 4UTWC 1W5MA 4IMGA 4MLJA 2V38A 3GFXA 1DV7A 2VOMA 2Y89A 2D0FA 3DCPA 3QMRA 2V5DA 3W00A 4B16A 3DUGA 5BYWA 3G2GA 5CGMA 1OAOA 3W1MA 3DU0A 3TMLA 3QQ0A 3R13A 4J2MA 3DYPA 3UXLA 3L4TA 2DGAA 1CX9A 2QIWA 4E0CA 1VF8A 1FXPA 3C86A 4ICMA 1NWUA 1O95A 2VO5A 4N6EA 1TQJA 1KW1A 2DUZA 2Y85A 3SECA 1XBVA 4H1ZA 2RGLA 3A23A 4FB7A 4GJIA 3N34A 1XH0A 2B7NA 5JIWA 4QGCA 5IRPA 1VFTA 3L65A 3MP5A 3N11A 2PDCA 2XVPA 1V0LA 3UR2A 4EZWA 1RUSA 2Y88A 1UP0A 2OYLA 3M3WA 1W17A 4FNPA 1GKRA 4N2YA 4Y7EA 3KUMA 1KV8A 1LLZA 3U2EA 1IEWA 1JI2A 5C9WA 1PZ1A 1XV8A 2FPVA 4RW3A 1K03A 4QJ3B 3AICA 1XH1A 3W2UA 2O9TA 2PP0A 3VAVA 5DCDA 3IPWA 3C2EA 3WG6A 2J7FA 4JQ1A 4JN8A 3RCYA 1KFJA 2XWDA 5BXSA 2BODX 1JDEA 3O06A 1TA3B 5KETA 3VIMA 4P7QA 4O15A 5D4YA 4WJEA 2DZUA 1ZAIA 5AKQA 1TRIA 5CZSA 2TRSA 3CH9A 1FCVA 4PUUA 3G1SA 4EZZA 4AKVA 2DIEA 3GR8A 1PHWA 3S8HA 4EZRA 1BSIA 4YTRA 4DI9A 5EBUA 1W5NA 4UUIA 3REQB 3LSBA 2PF8A 4D9PA 1OT1A 3W27A 5C2XA 3VDBA 3LRLA 1QWGA 1UD6A 1TPEA 4F0RA 1DJGA 1W8SA 1P1MA 1FKXA 3CPRA 4IUOA 2O4MA 4B2DA 1UUMA 1A5LC 1OYAA 4YXGA 2EPKX 1EX5A 3N1AA 3QR3A 3PUEA 2Z1WA 3O3OB 1TPDA 5LIYX 3S1GA 1A3XA 1GN9A 4LQ1A 3M0ZA 5CH9A 4E8CA 1JQKA 1QVBA 5AZ0A 3BVWA 1H0GA 1MEHA 4G6QA 5GVJA 4JDBA 3KTXA 4WSKA 1WKYA 2FQIA 4GYPA 3EX6A 3NL5A 4BWLA 1QO2A 1JDFA 1TO3A 1UR4A 2FFCA 1ZSXA 4J3UA 2PBGA 1G69A 2Y6ZA 1E3XA 4JNMA 4GUIA 3BANA 3CO8A 1Q13A 5G2IA 1LRQA 1H7OA 3HM7A 3EPMA 1HZYA 2NUYA 3BZGA 5D33A 1I1WA 1TA3A 3W6MA 4MDOA 4EPDC 4N42A 1VS1A 4LAOA 1Q7MA 4XZLX 1BVWA 3ZMRA 4BQ5A 4GVHA 4QE1A 5PTDA 2EGZA 1WBHA 1I4NA 4GYJA 2GYIA 2Y24A 1C92A 3GYCA 4MY1A 2Y5EA 1Q66A 3CUGA 3TYEA 3L9CA 3QGKC 5FOOA 1ECEA 3VNYA 3AIVA 4R3UA 4HNCA 4KEVA 2XIIA 1PIIA 4DWSB 3SR7A 2UY5A 3REQA 4MTVA 3GD6A 4KIKB 2J8TA 4NIRA 3QPZA 1J93A 1AW2A 1Y7VA 1J96A 1R7OA 2O7QA 1VEMA 4UR9A 1WE5A 1SR0A 1HL2A 3DFNA 4DJDA 2IKIA 3DYMA 3H12A 3GTFA 3AALA 1ECQA 4R7OA 2ZX6A 4I7UA 4L6HA 3HBLA 2HK0A 1A3HA 5HJXA 1NY1A 3MU7A 1PDZA 1CLXA 3TTSA 2VR2A 3PN8A 1OINA 3BVXA 1JQXA 1DYSA 4L1WA 3UWYA 4LYPA 1XPGA 3W07A 4BK9A 3LYEA 1CEOA 4K7YA 2WC4A 4UWMA 4LT9A 2VX6A 4Q8WA 4JL9A 3EBVA 1RD5A 1W3KA 4H6IA 4Q4QA 3L4ZA 3NAVA 2DSUA 4HNTA 3GTIA 5E93A 4I5UA 4A2SA 4LYQA 5T9CE 2FYVA 1OX5A 3KL5A 4MHBA 3OLEA 1RJPA 4IQDA 4EXQA 5BMXA 3STPA 1DKZA 3I68A 1T8XA 4LX4A 3F2DA 1UH4A 1PPIA 4IH3A 3B97A 4S3BA 1KBJA 5EMYA 4GO8A 4DXVA 4Q8UA 5HUOA 1WZMA 2CWNA 4HZ7A 1R3SA 4L9XA 4FPSA 4OOUA 1XSIA 1MQPA 2Z1BA 2X30A 3EDDA 3I7QA 3OU8A 3PBUA 1P6WA 2J27A 1R3YA 5I02A 1Q7QA 3MZNA 2KHOA 2CEQA 1KCLA 3S5OA 4DWSA 2QCMA 1XIMA 2OOGA 3LCXA 4KIKA 1JPIA 2C71A 5DANA 2Y5JA 4JHOA 4TMBA 2V63A 1TWSA 4DJEC 4ZBCA 1GVRA 5D2YA 1FWSA 1JFHA 1LQAA 1AH0A 2YA2A 3WQCA 3ARYA 4N9EA 1R47A 2ND1A 3SGUA 5B7YA 2WOQA 3KVKA 3UXAA 2BSLA 3FYOA 1PTDA 3EB3A 4PTMA 5CZKA 3HV9A 2PLCA 3W1AA 4JEQA 4JQ2A 2YYTA 3VD4A 3PJWA 1GVYA 4V15A 4DNMA 4IPPA 3WQ4A 1ITXA 3QBUA 4K8EA 4W85A 4DNHA 1M7XA 1R30A 4C6FA 2WZHA 4GBDA 4HNUA 3JZEA 3ALFA 4ZB0A 3HQPA 3AISA 4CU8A 3MWAA 2PTXA 2ZZ4A 4GY0A 2C14A 4J2PA 1TJRA 5BOFA 3S5NA 2QEZA 1TV4A 1ODUA 2AMXA 2P3ZA 4FNRA 2CKRA 4W7UA 4GCAA 4FLOA 1XLGA 2WMGA 4O18A 5H91A 3NUKA 1Q6QA 4JEJA 1XCWA 3EOLA 1C9DA 2PTYA 3BOFA 5ABEA 4IMAA 4AEOA 5IFPA 1UKOA 4DELA 4LEQA 3QE6A 2ALDA 1TIMA 2P3EA 3DG3A 3HPSA 5A6BD 5A8PA 3LMYA 2REQB 3TTQA 2EXOA 4DZAA 3THUA 3H7RA 2WWDA 3M16A 4Q7BA 4MAZA 3TTOA 3UR7A 1Y65A 3CIVA 1OCQA 4Z08A 3QHMA 2V81A 3O6YX 3NTYA 5DMNA 3VE9A 4GISA 4LBSA 3S5ZA 1LCOA 3EMCA 4XSLA 4J7RA 1H41A 3NQMA 1A5NC 3CUHA 1IE7C 1TX0A 2GVGA 3Q45A 2EPLX 3MUAA 3MCNA 1UA7A 1SU6A 4HK5A 3CIWA 4JIQA 3DAQA 5E0FA 2D22A 4NZ1A 1XKYA 4QNWA 3L5MA 1MDRA 2P88A 3VUSA 1H1ZA 3R8GA 4AW7A 1VFHA 4F0KA 1XFBA 4GQ0A 3W6YA 3LN3A 4S3GA 3DDGA 1UQYA 1JULA 1UWQA 4ML4A 2YX0A 5HPCA 3EX2A 1OA0A 4PGLA 4O57A 4U5KA 3T8LA 4JY8A 3TXVA 3DDFA 2OW6A 4D8JA 2BBFA 5AHFA 1C3FA 2UBPC 4O0KA 3VGDA 1GJUA 3ABHA 4ZVJA 4U33A 3NQDA 4MWAD 4LBRA 3DX2A 4UQEA 3HURA 5BW6A 4S38A 4YCOA 3EJSA 4HA1A 4EZQA 5HANA 1JZ4A 1E9IA 4PTDA 3LRMA 2YR1A 3V1PA 4S3EA 1MQRA 3NSMA 4UNKA 3WBAA 3IANA 2NX1A 1V08A 3BK0A 1ZCCA 2VDHA 3OA3A 2VC6A 3HPZA 5CKSA 2FIQA 4WJXA 2EO7A 3HAJA 5KTLA 5HR6A 3VGHA 4AVMA 4HD5A 2ZFAA 4PUMA 4X9YA 4L1XA 1RAKA 4EZPA 2WKGA 1BG4A 1X03A 2QKFA 3WLQA 3BAJA 3QGVA 3FXYA 1DXEA 3U5UA 2WYIA 4Q33A 4Z1AA 2E6DA 3N9RA 4IGNA 3CZSA 5HOSA 3BG9A 3BLLA 1E5NA 4PMNA 1I6NA 5M1TA 1RBOB 2W67A 1DJXA 2C8NA 4LVAA 4LAUA 4LYRA 1QW8A 2YA0A 2GJRA 3H2CA 1PO9A 3LK6A 3W2LA 3VNJA 1W9XA 1YIXA 3JR2A 3ABSA 2R6OA 4A29A 5I03A 2JGQA 3QQWA 3WK2A 3W71A 5D05A 3K46A 1TVNA 3EXTA 3UP8A 3F4WA 4BEQA 2PWUA 1I0BA 1XBXA 1XXXA 4RZ6A 4F9JA 4JFVA 4K3ZA 3R0UA 4KS0A 2NQ5A 4E3CA 2PBOA 3ZLHA 3NDOA 3MYOA 4BEUA 2GOUA 4PH6A 1OD8A 3W7DA 1OVDA 3W7IA 4JWDA 3ZJ7A 1ZY9A 1YLVA 2VD9A 3DFHA 4U28A 3I10A 4G2DA 1X96A 1OZMA 4D8AA 3CQIA 3ZLGA 4IJRA 1L8PA 1O7DC 4XAPA 2D23A 5FJIA 1KKRA 2OOFA 3KWSA 3SOGA 4M80A 2OWCA 5F4XA 2AL1A 5CC7A 1F6YA 1KCXA 2ND0A 5K4ZA 5LIWX 3TQ0A 3AXMA 3VVGA 1EF3A 1X1ZA 1OJXA 3KLLA 4L4OA 3SCUA 4FM3A 9CGTA 4FX6M 1TWIA 1CIUA 3VO0A 4KGJA 3UG3A 3VINA 1G1YA 9RUBA 4ADSA 4Q6JA 2ZXDA 2PB1A 1ZJAA 2E4TA 2PDJA 2BLEA 5AHEA 1EA0A 1DJZA 4GXPA 2HISA 1WDSA 4P7OA 2IMRA 4C1LA 2DH2A 3TDFA 4MKVA 1D9EA 4X2PA 3ORWA 4CQAA 2ANUA 1B5TA 2OYMA 1LM1A 4AEEA 1XP3A 1XIEA 3AMGA 4OECA 4AZHA 3UXIA 2OBMA 1OC6A 3WJWA 1NSJA 3UNDA 3K4WA 3AS0A 5DMYA 4IIGA 2PC8A 4GLEA 4LPCA 2Q3OA 3GW3A 4OIFA 3HA1A 4WGXA 2PDUA 4F0SA 1W91A 1HP5A 5CLTA 5DCEA 3PF3A 4IP7A 2G96A 1V6XA 3TNOA 1EJWC 2IQDA 3IUDA 2TSYA 3MMDA 4JL2A 4B4FA 4R5KA 1DTUA 4PULA 1G4PA 3T2QA 2ACSA 5DBTA 3ERCC 3ZT6A 2VVSA 2W79A 3A24A 3NM1A 4IPIA 1VPYA 2FKPA 2WKLA 4HB7A 2DVTA 1XLMA 3MW7A 1AUSL 1NWSA 3S6TA 1U5JA 4ZE5A 3TZNA 3VOFA 3FLUA 4TU1A 4MB4A 1OGSA 2BDQA 3H4XA 3MSDA 4ZMGA 4PL2A 2YXOA 2J47A 5M3WA 5A94A 4FNUA 4ZL1A 2JEQA 4AQLA 2JALA 3DGBA 4UOQA 4HHMA 1J0KA 4LS1A 3URBA 3CS2A 1K9FA 3GDRA 1EYWA 5LIKX 3TW7A 2UZ9A 2QULA 4ZQRA 1BQGA 4XUGA 1NAL1 3W72A 2OZ0A 1W9BM 3WLTA 1Y5VA 2D2JA 1KFKA 3R8HA 4HNLA 1WZAA 4HPXA 3DERA 3WQWA 3V16A 3W82A 1AZ2A 3NEHA 3WUEA 1TV8A 1EO7A 3SN0A 5SWUA 1YW1A 3EOEA 3W1PA 5HK4A 3TJIA 4GYPC 4NF7A 4F3HA 1FHLA 4RJEA 5DMLA 4O0QA 2XH0A 4BWLC 2C13A 1BVZA 1RQHA 4AVFA 4DZ5A 5A2AA 3VDGA 3BQ6A 5A8GA 2FH6A 1GVIA 4Z1CA 1EHAA 1O12A 4RX0A 3WYZA 2NWRA 1ITQA 2MNRA 3BURA 3GUGA 4ZO9A 1GJWA 3T08A 4AFYA 3G6MA 2EHHA 2VZTA 1Z8AA 4PYSA 5CSRA 1R85A 2PD9A 2Z6JA 3BAYA 2ABBA 4RNHA 1J12A 4D6DA 4GH3A 3HMJG 1BFNA 2CLMA 4WR3A 3WBEA 4O8AA 4IIDA 3EEGA 5AHIA 4Q4MA 3KVJA 3GKFA 4NJHA 1F9CA 3AZSA 2R1LA 3PJUA 2A3BA 4CN1A 3W6LA 3B8WA 2GVEA 3OIXA 3BDKA 1BF2A 3WFZA 3QPEA 3MQTA 1E0XA 1GUVA 3CQKA 3MANA 2P50A 4K8HA 3S1VA 1DWAM 1V4YA 2QV5A 3M5VA 4JFWA 3AI0A 5A6SA 1TCDA 1HNYA 4E81A 1CLVA 4DJDC 1US3A 3LGDA 5F2MA 2GQ8A 1J5TA 2EG7A 3DPOA 2W63A 1F6PA 4GIRA 4HPGA 4U2YA 4A8IA 5A8OA 5B7ZA 1KM1A 3GC2A 5A1AA 2O0I1 1WKFA 3GFZA 2G50A 4GXMA 3ZZ1A 5FAJA 1XIHA 3FKRA 4ZGYA 4GX8A 2DT1A 4LJ3A 1FWHC 2ISFA 1CZ1A 1TPVA 3A9IA 3AIQA 3WFAA 4IF2A 2JF6A 1C9WA 3N6HA 4P61A 4UOJA 3SN1A 4BY3A 1RJRA 3N14A 4DY1A 1V3HA 5E1QA 3VGEA 1FDJA 3TQVA 2FLIA 6A3HA 1XPYA 4H4IA 7TAAA 4AVNA 2J13A 4QS6A 1RK6A 1HFBA 4QSHA 1BG9A 1OYBA 1VJZA 4ILSA 4KFOA 4ECLA 2QJNA 3I3EA 1QNRA 3WJYA 3K8KA 4QFUA 2PLKA 4F8XA 3OGSA 1L6SA 1CI1A 4Z2KA 4EP8C 4IFOA 1SO5A 1JNEA 3DFQA 3SSZA 3CH0A 4WVXA 1DPMA 2O9RA 2WPBA 4EZSA 2X0YA 4JWCA 1P0DA 1J2BA 4AXNA 4PE8A 3BOXA 2ZX5A 2JF7A 2XUCA 2PI6A 3VKKA 1E15A 3PAOA 2D1LA 1QWNA 3C0SA 3UFYA 4LB4A 4DWSC 3BLBA 1SZGA 3H7UA 1F8IA 2ZRZA 1W1ZA 4JICA 3O2LA 4JQAA 3THDA 1UP2A 5G4HC 2Z6IA 2W3ZA 1JR1A 4KERA 4XVDA 4O19A 4Q6XA 4ZSUA 2DV0A 2PE4A 3UXDA 1TV5A 3RJXA 5LHFA 4JQ3A 4WIWA 1A4LA 3KE0A 3UYCA 2VEIA 3UJRA 2XG9A 3VIOA 2DZXA 4XD5A 1JZ5A 4QSFA 1UBSA 2V82A 1SJCA 1VFMA 4LRSA 5GJMA 1L6FA 3O6CA 4W5ZA 3WKZA 3FJ4A 3DBNA 2XTKA 1MW3A 3NQGA 4PMDA 5C54A 1EP1A 1WAWA 3V35A 3H6OA 2VRQA 3NGFA 1T8QA 4WK9A 2D2HA 4CCDA 2HS6A 3N2CA 5AHNA 3GDKA 3PM6A 1TWZA 1JCYA 5JQ9A 2E09A 2G95A 3AHXA 3BVVA 3SEPA 4KGLA 4NJGA 4WCJA 3WK0A 1LOSA 3GHTA 2O55A 4YWSA 1FFRA 5I3GA 4WKFA 2OEKA 4D8ZA 2BXYA 1HTIA 2Z24A 4B3LA 2C79A 3DECA 3OHIA 3AUJA 4YNGA 4DJED 2X41A 1IXNA 1BPLB 1OFDA 2C19A 2EAWA 2JQXA 1WOBA 3UCDA 4QG6A 1UMYA 2BNJA 1QOPA 3E6EA 3OVRA 2Z2UA 4Q22A 3T48A 1LQ7A 1JXJA 5FJPA 4FSAA 4I9TA 2SFPA 1HKWA 3Q0KA 2PZ0A 3BUBA 4AH7A 1YDNA 1HG3A 1J0YA 5A8QA 2NQHA 5D9NA 4E3VA 2FFIA 3DI0A 1NOFA 1FX6A 4XD6A 3VGFA 4TV5A 1UKQA 3VNIA 4XZWA 2FGBA 2BY1A 2ZRVA 2J4GA 2ZRXA 3PSWA 4E4UA 1CENA 4HHLA 5LNWA 2HPMA 3B3DA 2RDXA 3KW3A 3RXZA 1QXLA 3VZYA 2RDUA 3WJZA 1FH8A 2HVNA 1VYRA 4I1QA 4ZODA 3B9AA 4XTDA 2GA9D 1Z6KA 3BICA 1PX3A 3OLDA 4JN7A 3O3MB 3K1DA 1I9CB 3W1QA 4KQNA 3IEBA 3WH5A 4INFA 1HVQA 3LZ5A 3AMDA 3TIMA 4BHYA 1OZQA 1S5NA 4UTHA 3Q67A 1YDVA 4E2BA 3STEA 1K7FA 4XB3A 3LPGA 4A3QA 1EWDA 3ARSA 4DBEA 2WM1A 2QJHA 1BWKA 1KFBA 3G8RA 3W0KA 1TJ1A 2GWGA 1YQ2A 4QLLA 1VLIA 2GF4A 1J01A 2J8GA 2FMNA 3KXQA 5FCZA 3AU6A 3KL3A 4EWJA 1ESWA 4M56A 5AC4A 4J40A 5DX7A 3WNPA 4JOMA 3W7KA 1I4DA 5HJYA 2H9AB 1U1JA 1WXZA 1GNLA 1TREA 2ZA1A 5CXPA 4DBDA 3R58A 2QPUA 4B5XA 1HKMA 1Y5WA 5LNSA 1G5AA 2WCAA 3N3MA 4P8UA 4F0MA 3ITYA 3T2PA 2INFA 4DIAA 4CD5A 3BSGA 2ZA2A 2ZZ7A 2HPIA 2V2HA 3ZM8A 3JVAA 1R33A 3VC5A 3WMCA 1VYSX 4ZO7A 1XD1A 3FFSA 3JU2A 4UFKA 1XRFA 3CO4A 2QCDB 4BCEA 2XPKA 4FX7A 4H83A 3PBMA 1B31A 3UJFA 1OEPA 3HB9A 3R0KA 4PFMA 1TR1A 4JX5A 4YTQA 1H7WA 3C3NA 4S3DA 2OPJA 3W1TA 5KITA 2OEJA 3LPOA 3Q84A 2QF8A 2NVAA 3KEHA 3NQ2A 1LT7A 2GGIA 3W76A 1AMYA 4AY7A 3UR8A 1K8XA 4PMRA 1LRTA 2Z28A 4MG4A 4ZEPA 2HVMA 1DVJA 4IQEA 1K9TA 2PWHA 3HG4A 3BUQA 1AG1O 2YFOA 4W8BA 3W29A 4EAMA 3ZR6A 4QP0A 1WKDA 1CXKA 1E0TA 3OVGA 5I3DA 1ME9A 1RP8A 4PTXA 1UPXA 4S3AA 3VCNA 3N2MA 2G4JA 3L3PA 3CL8A 1EGMA 5LKYA 1SO4A 3OZPA 5FD0A 4IICA 4LF1A 1OFOA 3ITGA 3KHDA 3VTRA 1FWAC 3S9ZA 4DLFA 1LRNA 3KRZA 3CUXA 3S1XA 4IX2A 3L0GA 4NU7A 1V6WA 1C8XA 1A47A 3K5XA 1HO4A 1P6BA 3LS9A 4HA4A 3F2BA 2H9AA 3VPLA 3QQ1A 2R82A 1PV8A 2ISVA 3BLDA 1IEQA 3O16A 1PIGA 5G1TA 1N8IA 2I1OA 3NZGA 5M2FX 1F76A 2J74A 4KF1A 4DXKA 3VU2A 1W3IA 1MNSA 3G8EA 3NPVA 4ZA0A 2Z25A 1DKYA 2YCLB 3DDMA 3V0TA 2ZUMA 2CKSA 5CC3A 4ADUA 3LM3A 1WDDA 4JWEA 4JTDA 3KDOA 1OFBA 4GBUA 3N9KA 3CL6A 1G4EA 3A98A 2WHJA 3DXIA 4NSWA 3BE7A 1XWYA 4S3FA 2H3DA 2J78A 4TUFA 2XZ9A 4JFUA 4F2BA 1FOBA 1X38A 2X09A 1VEPA 4DO4A 3EJTA 4CNSA 2A4AA 1XBYA 3BWWA 3S2CA 4O14A 4B5TA 4DM1A 4JTTA 3WQDA 4ONVA 4OGZA 3WF3A 1I49A 1TWWA 3AZRA 3RN6A 3ATYA 2GGGA 6ALDA 5XIAA 1ITUA 5F2LA 2YI8A 3W84A 3NNTA 2WLZA 3VA8A 1RXOB 3WLOA 1YE6A 4HNNA 3TQPA 3IGUA 2V3EA 4R53A 1AVAA 2GDVA 3COTA 1EUNA 1XC4A 3TJLA 1CGTA 4O1EA 3W83A 4LGXA 2OODA 4C6KA 1MQQA 4CNOA 1ZBVA 5C8BB 3P74A 4P7RA 1VEOA 4KCWA 4W8A