2YL6A

Inhibition of the pneumococcal virulence factor strh and molecular insights into n-glycan recognition and hydrolysis
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
434
structure length
434
Chain Sequence
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITANGKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDAILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLDEYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIYYNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQGWYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSRLFKLMRHFANANAEYFAADYESAEQALNEVPKDLNRYTAESVTAVKEAEKAIRSLDSNLSRAQQDTIDQAIAKLQETVNNLTLTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of the Pneumococcal Virulence Factor Strh and Molecular Insights Into N-Glycan Recognition and Hydrolysis.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords BETA-N-ACETYLHEXOSAMINIDASE
total genus 173
structure length 434
sequence length 434
ec nomenclature ec 3.2.1.52: Beta-N-acetylhexosaminidase.
pdb deposition date 2011-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.90 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 AF1782-like 2yl6A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2yl6A01
4PMNA 5A2CA 4MNLA 4QDMA 5D9OA 2NT1A 2VVSA 3L4XA 5FIPA 3GBDA 4C7DA 4AZIA 4UFIA 3OA5A 3EMQA 2WCSA 4Q22A 1BGAA 3GXDA 3ALGA 2PWEA 3ARXA 3WH9A 3RJXA 3W38A 4Z2HA 1JNDA 3S2CA 3AHYA 1J0HA 5DT7A 1VRXA 2WMHA 3ARTA 1CTNA 1LLOA 4N0RA 1MQRA 3WFZA 3O6AA 4J7RA 2G4FA 1KQZA 5LYRA 3FHQA 1W9UA 5CSYA 1XH2A 3SUWA 3WNNA 4AIUA 3G6LA 3CTTA 4OBRA 3LPFA 4FLSA 4QP0A 5FD0A 3WMSA 2WC7A 1JD7A 1W3LA 2VCBA 2A3BA 5FCZA 4MJ2A 2JIEA 1EDGA 3AI0A 1BHGA 1D7FA 3VGFA 2EPOA 2IXUA 1V3IA 2QPSA 4AD0A 1TZ7A 5JIPA 4CU6A 3ARUA 3IJ7A 2DT0A 3WF2A 1JAKA 5ABHA 2D0GA 1UQZA 3UG5A 3MMUA 1HJXA 1RP8A 2UY3A 5JIWA 2G3IA 1KCKA 3CH9A 2CIPA 4P7OA 2FHBA 2X05A 1H11A 3SCPA 4E8CA 1SFSA 4UFKA 3CMGA 4GIAA 5CXPA 1CZ1A 1JAEA 3GXMA 3UR7A 1NOFA 1JI1A 1BFNA 1JYNA 9CGTA 3DYMA 2VX6A 3VD7A 2YA0A 3ZQ9A 4UCFA 3L4VA 4Z2JA 3RCNA 5BXRA 1PIGA 1L0PA 2VRKA 3WDJA 1HT6A 1UUQA 3IK2A 1KXQA 3WNKA 2PC8A 3W28A 4OBSA 5GNXA 3PN8A 4WF7A 3WNOA 4P7RA 2BVTA 1FOBA 4NRRA 4U3CA 1H09A 4AZCB 3GDBA 5LA1A 1ITXA 5GNZA 2XVLA 5BXSA 2QLYA 2J7BA 2DPEA 5A8QA 3W81A 2XVPA 3SUVA 1CXLA 4J3TA 3UR8A 3AMDA 1W32A 7CGTA 1TUXA 3WMCA 3N11A 1XD0A 3OGRA 2CKRA 1IZJA 3BSHA 4HA3A 3VILA 1WNOA 2X0HA 4UQDA 3DYPA 2J7GA 3BAWA 3I3DA 1ISWA 2A3AA 3ZR6A 1MQPA 3T08A 2ZX9A 4CD7A 4DWSB 4LGXA 1RD6A 4WKAA 1HVQA 3EDDA 2O9TA 2VUYA 4UQCA 2WC4A 1WZMA 3PZVA 3K8MA 1CGYA 2GUYA 4U3AA 1E70M 1E55A 1I75A 1FFRA 3VPLA 2VL4A 3WEZA 4PTMA 1JG9A 1NARA 4XB3A 3WUGA 3UETA 3CHEA 1P6WA 4J3VA 5ABEA 1LG2A 1CWYA 1U30A 2YBTA 3PTMA 4AD5A 2AOSA 2EPKX 3AS1A 4P7QA 3WDPP 3WEMA 4ZFMA 1E0XA 4AIEA 1QW8A 2W92A 1XC6A 4BQ2A 5I2UA 2D0FA 3VINA 4KRTA 1QI2A 1VF8A 3FHAA 4MNJA 4D71A 4E4PA 1HXJA 3PZTA 1EXPA 3NSXA 4AIOA 4UOJA 3CZEA 1G1YA 1AQ0A 3TONA 1W1TA 3ZO9A 2E4TA 4JKMA 1HKKA 2PBGA 4MDPA 1X6NA 4UZSA 3LPOA 1M03A 3MSDA 4CCCA 2DIEA 1UKOA 1B3VA 3VMPA 1BTCA 4ZE4A 1C8YA 1W3KA 3UG3A 4QLKA 1C90A 4W5ZA 4B3KA 5I5RA 1C3FA 3EBVA 1OGSA 3NCOA 2JEPA 1UD8A 4TVDA 3AYRA 2CBIA 2JE8A 3F5KA 2WVUA 3TA9A 1B90A 1ODZA 4WJXA 4DWSC 1UR9A 3SEPA 3VDHA 1F4AA 3FW6A 1UWRA 4DUWA 2JF7A 3VD4A 1WZAA 3W24A 1WKYA 1E1FA 4CVWA 2OO2A 3GTNA 1UWUA 3WDRA 3AMLA 2XVKA 1WZKA 2CKSA 4AZHA 5A6BD 4BQ5A 3OZOA 1H0IA 3IJ8A 4CKQA 4F66A 5BYWA 4LPCA 3VGHA 2WVVA 1O7AA 1WO2A 4GO9A 4IPNB 5A69A 5CLTA 5F7UA 1GOQA 2JALA 3K4DA 4LX4A 3NJ3A 3WUBA 1TVPA 2Z1KA 1GOWA 1CYGA 3JUGA 3TOPA 4WSKA 2WPGA 1BG4A 1DHKA 1ZBWA 2PBOA 1QI5A 1JZ8A 3AS2A 2CXGA 5AC4A 4A3YA 4AZ5A 1UYQA 1PIFA 3TTQA 3KZSA 4D6FA 5CJ5A 2BY2A 2VRQA 4K68A 1TE1A 1C7TA 1MXGA 2QMJA 4C7FA 1HKIA 1KGXA 1RH9A 3PTKA 4PTXA 2XHYA 1JDAA 4S3KA 4MAZA 1QOXA 3BAJA 1FP8A 1W3JA 4X0VA 4D6IA 2GDUA 2PWFA 2GK1B 3WF3A 4DM2A 5A6SA 1GQJA 2XYLA 1EO7A 2DSUA 4JFWA 1BYDA 2WAGA 4EKJA 1R85A 4OIFA 2ZUUA 4OOZA 1EHNA 4LYPA 5HBFA 3ZJ8A 1VJZA 2EBNA 3WH8A 5ABFB 4HZ6A 1XSIA 4RE2A 4S3JA 2W4XA 4Z2IA 3WL0A 1GQKA 1VEPA 4PMZA 2BV9A 4W87A 1D2KA 1JZ2A 2BY0A 1QNSA 4M80A 1UG6A 4X0NA 1EQPA 2V3DA 1EQCA 1VB9A 2G8ZA 1ZJBA 1E43A 2XSAA 3BLKA 2Y2WA 3MKKA 2XWEA 2WZHA 2WMGA 4U2YA 5E0CA 4D6DA 3L2LA 2ZX7A 1E4MM 1DTUA 2DDXA 1K9TA 8CGTA 3U5YA 2E9LA 3ZSTA 1KB3A 2OWXA 1NQ6A 2VQUA 4EE9A 1W1VA 1S46A 1UD3A 5DEZA 1XH0A 1SYTA 1E4LA 3A6OA 2GFTA 3K46A 1CLXA 3CHCA 4OUEA 4PBGA 4W89A 3SUUA 4PMYA 2TAAA 1FH7A 4PMQA 2WC3A 3PZQA 1HJUA 3PBGA 1W9PA 1LL6A 4NSBA 1DWFM 4JFUA 2DSWA 4GQQA 3AIBA 1TR1A 3I3EA 1NWRA 2DEPA 4PUEA 2WVTA 3CHFA 4HMEA 1KWGA 2EO7A 3ZMRA 4AZBA 1JDDA 1ISZA 2J78A 4TVCA 2BHZA 4KGJA 1ISYA 1G5AA 2BXZA 3M46A 1VIWA 2WKLA 1GCYA 3MSGA 1XYFA 2WWDA 5I78A 3ARWA 2D3LA 2DIJA 2J7FA 4HTYA 2WZIA 1V08A 2FHCA 3MV11 3VUPA 2VJXA 2OSYA 4NI3A 2YDSA 5FL0A 3W26A 4RE4A 3I3BA 2GVYA 4V2XA 2WMIB 1MQQA 2ZX8A 4IPLA 1PBGA 1OIMA 1Q4NX 3EYPA 3IAQA 2VT0A 1XSJA 1V02A 4PMUA 2WXDM 4U5KA 2DT3A 4NZCA 1V3LA 2ZIDA 4W8LA 5CG0A 2EPMX 2WHMA 2V3GA 3K1DA 2O92A 1VFUA 3VTRA 1JFXA 4JIEA 4BQ4A 4FLRA 4CCDA 2OYKA 3THDA 3B9DA 3BCFA 3VDBA 3VM5A 3CUJA 1PAMA 1DP0A 2EQDA 3EDJA 4AZ6A 5HDRA 1K9FA 2QF8A 4W7VA 3WD2A 4HU8A 1C92A 3OG2A 2VCCA 4CCEA 4UR9A 3SUSA 3RIKA 3W0KA 2YIHA 4CD6A 1OT2A 1R7OA 3WQ8A 4PMXA 3AXIA 4AZGA 4HA4A 1CDGA 5IFPA 3TP4A 1BQCA 4JCLA 3N04A 3EMZA 3WN6A 3W4RA 1CXHA 3ZJKA 3AFBA 1DWJM 4W5UA 1AQHA 2E9BA 3AZTA 2DH3A 3W37A 4F8XA 1IZKA 4XZWA 3WIJA 2ZXQA 2WBKA 1KBKA 4W7WA 2YKKA 2CERA 5KEZA 5EFDA 1UD4A 3VIIA 3CO4A 5A6MA 4PMRA 3ZT7A 1EOMA 1B3XA 1RPKA 4P8UA 2ZX6A 3ZT6A 3QOMA 3RM4A 4U2ZA 3BAKA 4JL2A 1C93A 1TG7A 5A8OA 4HOZA 3T0BA 1JZ7A 1J0YA 5FKYA 3DYOA 3BSGA 4H8VA 2GJXA 2G3NA 1GQLA 2BHYA 2WHJA 5CPSA 4YN5A 5DF0A 2WWCA 1V3JA 1DWGM 1NP0A 4TX6A 3SIMA 5D8ZA 2ZUWA 4BS0A 3U7VA 1JI2A 4HA1A 1B2YA 3LPPA 3MUIA 2YDQA 4Y7EA 4J3WA 3TTSA 1KBBA 2HISA 1C7SA 3O9NA 4PCTA 3VMNA 4EANA 1MW2A 3VDCA 1KGUA 2BHUA 3VVGA 2FGLA 2XM1A 1CGTA 5LA0A 1CXKA 1KR0A 3K8KA 2J74A 3OGVA 2O9RA 4L4PA 3IAPA 3MMDA 3K4AA 2W5FA 2OWWA 3BMWA 1E15A 3MV01 2VZOA 4AEEA 4D6JA 1UWSA 4IISA 1NWTA 1PX4A 4LYRA 1E4NA 1FH8A 1OWQA 3L4WA 4W8AA 3VDAA 1JXKA 5IDIA 4IM4A 2F2HA 5CQ1A 3OLGA 1QI0A 1EDTA 3WQ5A 3BMVA 2AMGA 4FF5A 1B30A 1M01A 1JXJA 2A3CA 2WM0A 3VGGA 3FXYA 1CXEA 3POHA 4DWSD 4QFUA 4DWSA 1WB0A 3AHXA 1AQMA 4B15A 4NF7A 1E0VA 1UKQA 4MB1A 4P7NA 3RILA 2Y4SA 4M29A 2XUCA 4HOWA 3ALFA 2G3MA 3ARSA 3ZM8A 3U5UA 3KL5A 2YOCA 5DT5A 5C8BB 3AMGA 3WDHA 4AY1A 2BFGA 5A6KA 3WH7A 4MNKA 1ZJAA 2CESA 4R27A 2F61A 5CGTA 1FHLA 1CXIA 1OM0A 2PWGA 5D4YA 3FY1A 3POCA 4F9DA 1V6VA 2CPUA 4B9YA 4ACYA 4W93A 4HMDA 1HVXA 2W67A 1MFUA 1XYZA 3SCVA 4TTUA 3WF0A 2XVGA 4Q7NA 3E1F1 1TCMA 2QV4A 2W61A 1QHPA 4DUVA 2UY2A 2J25A 4F79A 1CXFA 1K9EA 3W29A 4YHGA 2ZICA 3WL1A 4H8HA 1W91A 1ECEA 3L2MA 3ZOAA 1JF5A 3FNDA 1HKMA 5TD4A 3ZIZA 3AIRA 3HJEA 4D6EA 2ZXBA 1WPCA 1WE5A 5CLWA 4HMCA 1UA7A 1R7AA 2J8GA 2DGAA 2PF0A 2X8RA 5ECUA 1V0KA 4E8DA 4GQRA 2WMJA 3NSMA 3W25A 4E2OA 3IJ9A 4D6HA 3QHNA 4WKFA 1BYBA 2CBVA 1BLIA 4BCEA 1EA9C 4W86A 2V3FA 4JKKA 5A1AA 2FHFA 2PWDA 3WUFA 4J3SA 4Z2GA 1ZB5A 1E6ZA 1ESWA 3KWXA 3T2OA 2UY4A 1XSKA 3VNYA 4P7LA 1DEDA 4AXNA 1JNEA 2WVVB 3HMCA 3D5HA 3M07A 2VI0A 1CGWA 4AD1A 5A3HA 1E1EA 1HIZA 2VC9A 1H0GA 1UD6A 4H41A 2VR4A 3PTQA 1HP5A 5BRQA 3AS3A 1R87A 4A4AA 1V3MA 3RMEA 1HN1A 4W7UA 1GW1A 3FAXA 1VFFA 3OLIA 1LWJA 3CZLA 3D3AA 5EFFA 4OZOA 4XUYA 2W66A 1MW0A 4CVUA 1JYVA 2Z1SA 4B3LA 3KL0A 2A3HA 4CN4A 3THCA 1CGVA 5GQBA 1HP4A 3PZ9A 2CHNA 3DHPA 3AHTA 3F4VA 4UQ9A 1H1NA 2D20A 1J9YA 1OCQA 4XV0A 3VIPA 1LL4A 2PWHA 1WDPA 5BROA 2E40A 3RPMA 3ZT5A 4KWUA 4MTVA 3W27A 4H8UA 2PB1A 1V0LA 2VOTA 4YHEA 3CZJA 2QMKA 1H3GA 4DUXA 4LQ1A 1PEZA 1K9DA 3CLWA 4P8VA 5A8PA 2PMRA 2ZXDA 1MVYA 3HN3A 1NH6A 1J0KA 4U5IA 1EOKA 1QHOA 5A6JA 1UZ1A 3DC0A 3GH7A 1ITCA 1H5VA 2YLLA 1YQ2A 3ZJ7A 2OSXA 3ZSSA 2J7DA 2UY5A 3VU2A 1J0IA 2NT0A 3RM8A 1GZJA 5LA2A 4ATWA 4BZYA 3A3HA 2VRJA 3AXXA 3CPUA 3TTYA 1W3HA 1DWHM 1E56A 3OLDA 3CBWA 3MUZ1 1KR1A 1I1WA 3PZMA 5HOSA 3AROA 3GYCA 4W8BA 4Z2KA 1BYCA 2XTKA 3GXIA 2VX5A 2VVNA 4HPHA 4ATDA 2YJQA 4FMVA 3F5JA 4EK7A 1E3ZA 4TUFA 1JZ3A 1G9HA 4HOXA 4RE3A 1SR0A 3AS0A 2J62A 2B31A 2E8YA 5I6SA 3MU7A 3SCNA 1L8NA 4CD8A 4D6CA 2OLHA 2XFFA 2EPLX 3M7SA 4URIA 3RDKA 1R8LA 1MYRA 1TMQA 4KRUA 3KL3A 4BQ3A 4GXPA 1DWAM 3OB8A 3VGDA 3PHAA 3WQ6A 2XWDA 1QI3A 1V3HA 1B3YA 4UQBA 2C0HA 4QLLA 2WHLA 1GORA 4UFHA 2D3NA 1OD8A 1GOOA 1U33A 4UQAA 4D72A 3K8LA 2BY1A 2O9PA 1NM9A 3MMWA 5C70A 2J79A 2D1ZA 5FOOA 5A95A 1QNQA 1SMDA 2J47A 4HZ8A 1HNYA 2Y24A 4LYQA 3AXHA 1UWTA 2BXYA 5E6YA 3SCRA 1FHDA 2AAAA 1UKSA 3WKZA 1H41A 4UFLA 7TAAA 2YA2A 3WD1A 2D23A 1J18A 1D3CA 2CNCA 1QNPA 5DMYA 1E5JA 4PYSA 1MWOA 2ZUSA 4CD5A 4QAWA 3SUTA 2XGIA 1J11A 3DHUA 4ATLA 2O9OA 2WCAA 3L4UA 4JL1A 4Z2LA 3ECQA 2CEQA 3WH5A 2VCAA 5JUVA 1QNOA 1WDQA 1W1PA 1CPUA 2G3JA 2V5DA 4WLCA 2ZOXA 3TTOA 5M5DA 2CYGA 3L4YA 1BPLB 3FAWA 3M6DA 3L4TA 3MUAA 4TXEA 2GK1A 2X09A 3UCQA 3GH4A 2Y8KA 4V28A 1GOKA 1HX0A 2VZSA 3AZSA 2NW0A 3RO8A 1WAWA 2J7CA 1E71M 5BCAA 2ZUTA 4J3UA 3GZAA 4CU8A 4WSJA 3WD4A 1NWUA 1VFMA 4GI8A 3WNLA 1JGIA 4QCEA 3WNMA 5ABFA 5KZ6A 2GJXB 3ARVA 1OGBA 1VBUA 1US2A 1JZ4A 1CBGA 2VR5A 2J4GA 1XCWA 2YL6A 1B9ZA 2WK2A 1EIBA 1KXHA 2FH6A 2WMKA 3AICA 5IHRA 1VEMA 1B3ZA 3UEQA 2ZWZA 5E09A 1W9DM 4ZXOA 4FZOA 2XFYA 1X6LA 5AYBA 2OZNB 4H04A 1VJSA 4MB3A 1E73M 3AIQA 4AD2A 2BY3A 3QR3A 4TTGA 1UD5A 2VX4A 1PJ9A 3ARQA 1A3HA 3VIGA 3VGBA 4GI9A 3BLPX 1FA2A 3NUKA 5EB8A 4GKLA 1N82A 2XFRA 4CGTA 3AIWA 3CGTA 2OYMA 3GM8A 1I1XA 4WIWA 3WBAA 2CITA 1JD9A 3NYDA 4ACZA 3APGA 4ZEPA 1UWIA 3F5LA 4MADA 4ZXLA 4JFSA 2OSWA 2XIBA 3CZGA 1ISVA 1G94A 4AC1X 2Y8VA 1XHGA 4GI6A 2ZXAA 3W53A 2Q8XA 3WNPA 4XX6A 2WNWA 3GNPA 2ZWYA 5M03A 3BGAA 2EEXA 1GOIA 4W88A 2YBUA 2WW5A 2IXVA 1ZS2A 1HL8A 2IUZA 3VIKA 3CUGA 5BRPA 1BG9A 2J75A 5I24A 5D9PA 1GONA 2JIWA 3T2QA 4CN6A 1KGWA 5I23A 5A8NA 1GHSA 3BXWA 3VO0A 2VZTA 3N1AA 1KCLA 3VNZA 2VNCA 3AISA 4U33A 5BXTA 2VX7A 2VURA 3J7HA 2CBUA 1UH3A 4D1IA 3RM9A 1JDCA 3CUFA 3EDEA 4HPGA 4GINA 4PMVA 4B16A 1WP6A 4BA0A 4J27A 2YDRA 4GZJA 1E6QM 3T0DA 4MB5A 1QNRA 4UQEA 3VIHA 2V3EA 2E0PA 3A4AA 4F9JA 2YLAA 1B1YA 4MNMA 4WK9A 1CGXA 5A2AA 4HZ7A 3OZPA 3WSUA 3ZR5A 4AW7A 2FH8A 3AJ7A 1HJSA 2JNKA 1HF6A 2WHKA 1BSIA 3U57A 2ZX5A 4FLQA 3WQWA 1AMYA 1LJYA 1QHZA 3II1A 3VMOA 2UWFA 3WELA 1GVYA 1FFQA 4CD4A 2GDVA 1CLVA 1VBRA 1KWKA 5D9MA 3PZGA 3AHZA 1Q6EA 2DT2A 4W84A 1NP2A 5EBAA 3GXFA 4C7GA 4PUDA 5HNNA 3NIYA 2FGZA 5E9AA 4ML4A 5I0DA 1NWSA 1OGGA 3LPGA 2CHOA 1E6RA 1U2YA 4GZEA 1G01A 1K6AA 1HJQA 1ZBVA 4JFTA 4PMDA 1E6SM 1LWHA 3AYSA 1V6XA 2WSPA 2XGBA 3BAIA 4GZIA 1PZ3A 3N15A 2WLZA 1MFVA 4PMOA 4LXFA 1UR8A 1LL7A 5I3DA 3MO4A 1WDSA 4TX8A 3WQVA 1QBAA 3QHMA 2BS9A 1QPKA 1HJVA 2J77A 4AEFA 8A3HA 6A3HA 2OYLA 4UFMA 1MW1A 2D0HA 1BVZA 3B8SA 3MUY1 5E70A 1E4IA 1UH2A 4JHZA 3VIFA 3QGVA 1A47A 3CIVA 3ARPA 4AZ7A 1E40A 1VFOA 4KGLA 3LMYA 4MDOA 3PZIA 3SCWA 1Y7VA 1W9VA 2WBGA 4H7VA 4HP5A 2DQXA 4UOZA 1WCGA 6TAAA 2DSVA 1MXDA 2W63A 2W91A 3WMBA 2VZUA 3VIMA 1HJWA 5JBDA 4OJYA 1OB0A 4PSRA 2YA1A 3AIVA 1UQYA 1W2VA 2GSJA 4H2CA 1Z32X 3SCQA 4M8UA 2JFEX 1V0MA 2D24A 3CZKA 3VD5A 3B9EA 3EDKA 1C91A 4R5EA 1BF2A 2W62A 1V6YA 4J28A 5HPOA 4V27A 2YL9A 1QI4A 4JCMA 3BH4A 3VKKA 2E9MA 3N17A 4QCFA 3WY1A 2MANA 1ZU8A 4M1RA 2J7HA 4D1JA 1JL8A 1JF6A 6CGTA 4MPKA 5CPQA 1C8XA 3GBEA 1RP9A 3AMKA 2FDMA 3SURA 1UD2A 3AIEA 4JKLA 3OGSA 1HL9A 2XSBA 4MJ4A 3OLEA 5HXMA 5AYIA 1KXTA 1TA3A 1KXVA 3CMJA 5DO8A 5M17A 4FZPA 5E0FA 4AYSA 5D9NA 4P8WA 1ISXA 2CCRA 3VIJA 1W9BM 1UR0A 1W9XA 3SCUA 1UR4A 1BYAA 4YPJA 3AHVA 1LG1A 2VQTA 3KEHA 3OIHA 1OBAA 4PTVA 1X1NA 4DM1A 2XJ7A 1J10A 1CEOA 1ODUA 4QLJA 5DFAA 4EAMA 2Y5EA 4PTWA 2ZUMA 1J0JA 3ARZA 4PEEA 3UESA 3GNOA 1LQ0A 3SCOA 5M3WA 5IXEA 1UOKA 3A47A 1Q6FA 1E6NA 1OT1A 3W82A 3PZNA 2NSXA 3WD3A 3GH5A 5CPTA 3T0AA 3AZRA 3UERA 2BNJA 2C7FA 4TOQA 4AWEA 1CGUA 4A3HA 3VX1A 3GNRA 2EJ1A 4GPNA 3N18A 3CUIA 2X1IA 3UG4A 1UWQA 2WYSA 3IANA 1W2PA 1B31A 1QW9A 5HPCA 1GHRA 1QVBA 1M04A 5A6AA 1IT0A 3EMCA 4HU0A 2DT1A 2A3EA 2DH2A 3HU7A 3W6LA 1E3XA 1LF1A 4X9YA 2EPNA 1V6UA 1HKJA 1MW3A 4NRSA 2X0YA 1XV8A 1E72M 1BGGA 1YHTA 4KMQA 5I79A 3BCDA 4MAVA 5ABGA 2ESCA 3ARRA 3NDYA 3N9KA 1UHVA 4JAWA 3VM7A 1CNVA 2J8FA 4UOQA 1GJWA 1FH9A 1OD0A 4M56A 4XZBA 5GPRA 2DSKA 2V38A 4UNIA 4PN2A 2WMIA 1KFWA 1KQYA 1VEOA 1H49A 3MANA 5IHSA 5A8MA 2ZUVA 1UKPA 1E6XM 1GOMA 4JFVA 4B9ZA 2J7EA 5JBEA 3VIOA 4UZUA 5CSUA 4OOUA 4ZE5A 1ZL1A 1EH9A 2F8QA 2WANA 5C71A 2BVYA 1B0IA 4JHOA 4AD3A 4PCSA 2HVMA 4FK9A 5BWFA 1JYXA 1DWIM 1CECA 5GNYA 5A2BA 2E8ZA 1BVNP 3ARYA 1WDRA 1E9LA 3SCTA 1F4HA 1EGZA 3WF4A 4P8XA 4CN1A 1PZ2A 4CU7A 1PPIA 3WF1A 2GJPA 3PZUA 5IFTA 4AD4A 3G6MA 1Q6GA 3CUHA 4ZENA 1GJUA 3EDFA 1H4PA 1VENA 5EMYA 2C8NA 5E6ZA 1XGZA 1ZBKA 1JZ5A 5CZKA 1EO5A 1G0CA 5BXPA 2GJRA 3MS8A 1M7XA 1ZBCA 2CBJA 1B3WA 1W1YA 2JF6A 4UFJA 3N12A 3NDZA 4WKHA 1OINA 3AQUA 1IV8A 5AC5A 2E3ZA 4L4OA 3WD0A 3ZJ6A 1QBBA 1V3KA 1NOWA 3NSNA 5A94A 1TFVA 1GQIA 2VO5A 4FLOA 1CIUA 1UR2A 4BF7A 2X2YA 1UH4A 3A4XA 3WEOA 2G41A 3OBAA 4CUCA 2QPUA 1Q6DA 1V6WA 1E0WA 1V02E 3AIUA 1UR1A 1TA3B 1GNXA 5AY7A 3O2LA 1VAHA 2ZE0A 2VZVA 4ACZB 3A4WA 4AZCA 1XCXA 4N42A 3T2PA 2XG9A 2WMFA 2RGLA 2YL8A 1SMAA 3WQ4A 4M81A 4PSPA 1OIFA 2DSZA 5D8WA 1XH1A 4JZ5A 2VMFA 1C8QA 2WLYA 1UA3A 2XM2A 1M53A 2CETA 1EHAA 2WZEA 1O6IA 2V5CA 4M82A 3VX0A 5JBFA 1JYWA 3QOKA 1J0ZA 3FN9A 4U31A 4M24A 3VGEA 3VD3A 2WSKA 1BAGA 2ZUNA 3KE0A 1JFHA 1XRVA 1JIBA 1TVNA 2JEQA 2WVSA 2XPKA 5I77A 3RJYA 5FL1A 3U7BA 3AMCA 2PI6A 4D6GA 2D2OA 1WZLA 2WB5A 3CHDA 2BVDA 1V0NA 1GUVA 1PX8A 3L4ZA 4RL3A 1J01A 3VD9A 7A3HA 2XIIA 4AISA 5CGMA 3SCSA 2WCGA 4IUGA 1EDQA 2QHAA 2RGMA 1OSEA 4AMCA 3BC9A 1GPFA 2VTFA 1Q6CA 5A6BA 1H2JA 1R86A 4J3XA 4KH2A 3B9AA 1PX3A 1FP9A 1GVIA 1XD1A 3AOFA 3W6MA 1UKTA 3WUEA 4UTFA 1V03A 1UZ4A 3WH6A 2D22A 3QHOA 3WBEA 1NOUA 3BAXA 3VOCA 3CZ8A 5A6LA 3PZOA 4W85A 3DECA 2XVNA 4TVUA 1E6PA 3BAYA 2EXOA 3T09A 2WKGA 3WDIA 4MB4A 1AVAA 3WDQA 2YL5A 1E5NA 3WENA 2OWCA 1US3A 3S6TA 3WFLA 4PRWA 4GO8A 1CENA 3N13A 1JZ6A 1J12A 4OKDA
chains in the Genus database with same CATH superfamily
1H7WA 5A2CA 3SN1A 1AD1A 3N3MA 5D9OA 5FIPA 3GBDA 3KP0A 3CB3A 2GOKA 4Q22A 3CK5A 5DELA 1KKRA 4ORIA 1DXIA 5JH1A 3RJXA 4EZQA 1Q2SA 1BTMA 1JNDA 3UJRA 4IL2A 3NOEA 2HK0A 4TMCA 3ARTA 1FWFC 1LLOA 2Z8YA 1W3NA 1HTIA 4DBEA 2Z6JA 2G4FA 5LYRA 3FHQA 3UZZA 1VYPX 5CSYA 4LH8A 1TPEA 3WNNA 1EC7A 4OBRA 3U3HA 3ZVIA 4DUOA 3S5ZA 3AU6A 4LS2A 4L9ZA 3UITA 1I4TA 1KW1A 3AI0A 4GFSA 1BHGA 1D7FA 1MEHA 3DGRA 3S5SA 2XIOA 2QPSA 3FYPA 1LTDA 4IGHA 7REQB 3HFTA 4S23A 2CHRA 7ENLA 2DT0A 2VFDA 1EPXA 3WF2A 2YCLB 1JCLA 3F4CA 3URAA 1F07A 2D0GA 5ABHA 3V5CA 4DJFD 4L4MA 1HJXA 3KWSA 4HT3A 2HROA 4LOCA 1T0OA 2G3IA 4P7OA 4JQ4A 2X05A 3S2MA 4D9PA 1EL3A 1R5EA 2WOQA 4UFKA 3HAIA 2ZZ6A 4M19A 5CXPA 1CZ1A 1OYCA 2AKZA 3GXMA 3S83A 2O56A 1JI1A 4BEUA 1JYNA 2VX6A 3D51A 3ZQ9A 1O7DB 2P53A 4WCJA 3CH0A 3U2OA 2QJJA 5MKGB 1L0PA 2G5WA 3WLSA 1UUQA 3TFCA 2F84A 4R9OA 2R1LA 4JTTA 3W28A 5EMLA 8XIAA 3PN8A 4P7RA 6ALDA 3BSMA 2BVTA 4C6QA 3UJEA 1FOBA 2GLKA 2AGTA 4RPQA 1Q6QA 3THUA 4AZCB 5LA1A 3CAWA 2J7BA 4XTIA 5A8QA 5C2XA 4Z1BA 3SUVA 5G2HA 4EPEC 1V77A 4MWAC 3PWGA 1HFBA 2H9AA 4AXKA 1C9DA 1KM3A 1K77A 1W32A 3N11A 5CC5A 2CKRA 1PTGA 2E25A 3D47A 5CZSA 3EPNA 6ENLA 2FGBA 4LVFA 4QEEA 3DYPA 2A6LA 1AA1B 3TTEA 2R82A 2J7GA 4H00A 4DXXA 4YWSA 3MI3A 3G1HA 3NFUA 3LBCA 1FBAA 1AH0A 1WZMA 1CGYA 3LENA 1A49A 4C1LA 1FFRA 3VPLA 1GQNA 4PTMA 1ICSA 2NX9A 1O7DC 1NARA 4PO2A 3B0YA 1P6WA 2D2GA 4LW7A 2BGSA 2FICA 1CWYA 3S9ZA 4Q8OA 3WK0A 2YBTA 4AD5A 4P7QA 3WDPP 4IP5A 5E84A 5FIGA 2MI7A 2D0FA 2YYUA 1OA1A 3W1MA 5AFDA 3GDMA 1VF8A 3F4DA 2AKMA 2J66A 1GKRA 1A5LC 3PZTA 2NZLA 3KTXA 3M0IA 3CZEA 8RUCA 5HQLA 3JW7A 1W1TA 3OQEA 1XLIA 3LPOA 5D03A 3UPMA 3MSDA 3H2NA 4O13A 3VMPA 3ZWSA 1W3KA 3W7EA 1T8XA 4W5ZA 1C3FA 3EBVA 4IPJA 1UD8A 1OG0A 3G77A 4DBSA 3AYRA 5HULA 2WVUA 2PCEA 3W1PA 3N9SA 1SO4A 2NXGA 1N2VA 3S6DA 1K7EA 3VDHA 4GRSA 1UWRA 1J2WA 2D4CA 3M0ZA 3FGCA 4CVWA 2DVUA 4NILA 4AF0B 2XVKA 4XIMA 5A6BD 3HG2A 1QXLA 3OZOA 1H0IA 4IPIA 2FTPA 4F66A 2WVVA 1O7AA 5F7UA 1P5BA 4LX4A 2VUNA 1NU5A 4GK8A 3U8GA 3NJ3A 4JX4A 3RYSA 2FZDA 5I00A 1XIBA 3BJTA 4ZB0A 2B7PA 1DHKA 3C56A 5CPOA 3V0SA 1JZ8A 1VZWA 5FLEX 4PUJA 1U1UA 4ASTA 1PIFA 4D6FA 1VBGA 4OT7A 2VRQA 1MXGA 2VC5A 4C7FA 4I8YA 1RH9A 3PTKA 4PTXA 3SJNA 2XHYA 3WJWA 4S3KA 4MAZA 3TW7A 3BAJA 3NPXA 3BZJA 2VEFA 2CFFA 4GI4A 4O1BA 2PWFA 2IPWA 3UWZA 3QQ0A 2BBFA 3NPWA 2QGYA 5A6SA 2XYLA 4LF1A 4XZ9A 5D38A 3W6YA 1BYDA 5HNUA 4S3AA 3UWUA 4N2YA 4OIFA 1O4UA 1VPYA 4EXAA 4H6QA 1EHNA 1YEYA 1VJZA 3T49A 1RAKA 3EXSA 1FDJA 3WH8A 5AVNA 3QH2A 1GQKA 2BV9A 2V2DA 3LLFA 1JZ2A 3DAQA 2A21A 5AYXA 4X0NA 1EQPA 2V3DA 3V18A 4PGLA 3VZZA 2GVLA 1QFEA 4XO6A 4OHQA 5C54A 2JKEA 4KCUA 2XSAA 4IWQA 5T91A 3IVUA 2WMGA 2EPHA 3L2LA 4AY8A 1E4MM 1DTUA 3ME3A 1E9YB 8CGTA 3AYVA 1NVMA 4OBTA 2FJUB 4KIRA 1CT5A 4EE9A 1W1VA 2OBLA 1DBTA 5DEZA 1LT7A 5DRCA 3W1UA 3U6WA 3H23A 4LNYA 3A6OA 3TU9A 2GFTA 3CHCA 3SUUA 1F6PA 3P0WA 4KWVA 4PMQA 2WC3A 3PZQA 3NEVA 1YDOA 3BOFA 3ITXA 1Y65A 4JFUA 1FCBA 3W84A 4XZHA 3S3GA 4TR9A 3W7HA 2RDTA 3CL7A 3IS4A 2CZVA 3JRKA 5LNWA 4B2DA 5FF0A 3W71A 3I68A 1RA5A 3I3EA 1K70A 4NSWA 4JQ2A 2J27A 4ZSUA 4KRZA 4V33A 3E3HA 4DO4A 5B80A 3CAZA 1S3TC 1ISYA 1G5AA 3NVDA 4PCFA 4GY7A 4S3CA 3MSGA 5FSDC 5C7VA 1SUFA 1EX1A 2D3LA 3HGRA 3MMTA 2TPSA 5FJUA 3RK8A 3W70A 3W26A 4DY1A 1TQSA 3M5XA 1PBGA 1Q4NX 4R5IA 2E09A 1XSJA 1V02A 2X7WA 3EPMA 4AHPA 4G7EA 1JPIA 4BNEA 3C8FA 5GVJA 2WHMA 2N3KA 2W0UA 2V3GA 1Y8BA 2FFCA 4BQ4A 4LB4A 2ASHA 2ABBA 4C6BA 3THDA 3E0WA 2LM0A 3NWRA 2Q09A 3E49A 4WOQA 2DW7A 1K9FA 1NEYA 4HPXA 4NAEB 1G6CA 2IKGA 2ND1A 4CCEA 4UR9A 5LNUA 3GVRA 3IUHA 3RIKA 2AL2A 4AHOA 3G1YA 3LCWA 2PUZA 1JUKA 3SY1A 1XBYA 3GXNA 2F6KA 1R34A 4JCLA 1TWZA 1ZHAA 4OV9A 2ZA3A 3M16A 3AZTA 2DH3A 3LX9A 4F8XA 2F2KA 3TWAA 5LNVA 1FWGC 3KAOA 3M5ZA 2HBXA 1KBKA 3KHJA 3L12A 4H7CA 4C6CA 5KEZA 3VIIA 1RLDA 4EZNA 1B3XA 5FF7A 3QOMA 1YTKA 3PC0A 3STPA 4JL2A 2BSLA 1C93A 2OXNA 3BVTA 2C14A 3V1HA 2H8ZA 4NKCA 4HOZA 3T0BA 5FKYA 3BSGA 4YCOA 1GQLA 2WHJA 2ZZ4A 4LALA 5F2LA 3L3PA 3VOIA 3I6TA 3KTSA 4FOUA 3URQA 2BGQA 1IR2A 1V3JA 4JWDA 1DJWA 3R0DA 4TX6A 3SIMA 2GSHA 2ZUWA 4N7QA 3U7VA 1JI2A 3MUIA 1SR9A 3RMJA 1W8GA 3TTSA 1XKYA 3EPOA 1KBBA 3W7QA 1B54A 1C7SA 3I4KA 3VMNA 2BVWA 3HURA 3CL6A 2BHUA 1QNVA 3D46A 3VKCA 2FGLA 4J3ZA 3N2BA 4Q4QA 2I7GA 4XWUA 3K8KA 2OO6A 1B3OA 2YR1A 2ACQA 1UCWA 1O5RA 2O9RA 3MMDA 4JNMA 3GUWA 5EYWA 2DZPA 2GUUA 3HTWA 2J9YA 5HNTA 1EX5A 1UWSA 4F0SA 4IISA 4FIQA 3QR0A 4LYRA 4W8AA 4G9PA 4LAUA 5CQ1A 1QI0A 1EDTA 3LXBA 1MEIA 2AMGA 4YTUA 1B30A 1XLKA 3BG3A 4NJJA 3CV7A 1JQXA 2P8CA 3CO8A 3GLCA 4DJEA 3QWEA 5FEWA 2CLOA 2E6FA 4DWSD 4XSMA 3AHXA 3NNTA 5U4NA 4NF7A 4GIRA 4O1FA 4UCGA 4E5TA 4M6VA 4FB7A 5K4ZA 3S1UA 3TCSA 2Y4SA 1OYAA 9RUBA 1ME8A 3ARSA 3URBA 3ZM8A 3U5UA 2XU2A 4INFA 4C6OA 4AY1A 4E4UA 3OHMB 4H4IA 3C8NA 1S5WA 1O60A 4B5VA 4I90A 1QO5A 5A8GA 1H7NA 1OFPA 4Q7BA 4MY1A 2X5CA 1FHLA 4B4FA 1POKA 2HWGA 2IS7A 1XBVA 4H3DA 1PUDA 4IXHA 3H4XA 4ACYA 4ZSTA 4TIMA 3SSJA 4ZTYA 3VAVA 2VHLA 3WF0A 2V0OA 4K3ZA 1E2UA 3QC0A 4C6DA 2BP1A 5IRPA 1H7XA 1N7KA 4RUBA 4DBUA 2XH2A 1YPFA 1OAOA 4DPQA 2QCHA 1PB0A 1SFTA 1VKFA 2OOGA 3A13A 3TC7A 4JICA 1V5XA 5TD4A 3SGUA 3U0HA 5I02A 3ZIZA 2DP3A 3AIRA 3HJEA 1OF8A 1WE5A 4PL2A 1R33A 3QYSA 1XJBA 1UA7A 1R7AA 1UUOA 4HYRA 2DGAA 1SU5A 1IR1A 5AB3A 2PF0A 2WMJA 1S1PA 3U2CA 4D6HA 1AODA 3KOZA 3N9RA 3UXDA 4W86A 4O10A 4GYPA 4EZSA 3TQPA 2QUTA 3GKAA 5A1AA 4GUGA 3WUFA 4Z2GA 3LGDA 1QWNA 1KCXA 1A0EA 1QW7A 3VNYA 5CBBA 1YXCA 1DEDA 3JR2A 4H9TA 1AL7A 1Z42A 3STGA 4EZRA 4YL2A 3M07A 2G37A 4MLJA 1FWDC 1HIZA 1H0GA 2V30A 5TF0A 3V3WA 2DJLA 3AS3A 5CZ0A 3RMEA 4BI5A 4W7UA 1F73A 3FAXA 1XYCA 3CZLA 3D3AA 1XLFA 2W66A 3FVDA 3LUTA 1R3RA 3UZJA 1XC4A 3THCA 1Q3NA 3OWGA 3OPSA 4XVEA 3F4VA 3VKDA 1NF7A 1H1NA 2D20A 3KVLA 1UASA 4L1XA 1UBPC 4C90A 4XV0A 3VIPA 2PWHA 3E5BA 4YYCA 2PGWA 5EKYA 3MQTA 2ACSA 3V35A 3CAQA 2VOTA 3ITVA 1H3GA 3VI2A 4DUXA 4LQ1A 1K9DA 4FX7A 1S5VA 3P3BA 2NWSA 5A8PA 2PMRA 2ZXDA 2JGYA 4O4VA 1P6CA 4U5IA 4C6NA 1EC8A 5G2WA 1UZ1A 1EWDA 3C0JA 1TTQA 4IMGA 3R1ZA 1QPOA 3ZSSA 4JDBA 3SJ3A 3MWCA 3TXVA 2UY5A 4DELA 5AHNA 3VU2A 3MVTA 1A3XA 2YBVA 3GS6A 4GVIA 4HSOA 4ATWA 5I3JA 5J04A 3A3HA 4K7VA 4QNWA 1DWHM 3WLOA 3OLDA 1PYFA 3F4NA 3MUZ1 1YXDA 1I1WA 4Q8QA 3GYCA 4W8BA 1PHQA 4IM2A 3EOEA 3EKLA 4JS3A 4HPHA 2KAUC 2YJQA 3Q2DA 1I49A 3AC0A 1XIEA 2ABAA 4EK7A 4A22A 3VC6A 3Q0KA 1W31A 4Y9MA 1BKHA 1K7XA 1A4MA 4LRSA 1QATA 4M0MA 3T55A 4GE8A 2OLHA 4U10A 3G24A 4KRUA 5CPNA 3MP4A 1XISA 1GKQA 3OB8A 1E1DA 1DJQA 2XN1A 2V2CA 3C2OA 2C0HA 2PTXA 1ZCCA 2D3NA 2IPGA 3BUVA 3O7UA 1C8VA 2GVJA 1O5KA 5CZTA 2D1ZA 3UXAA 5A95A 1QNQA 3IJ6A 4RZ4A 2J47A 3EEGA 1SU6A 2AAAA 2PDMA 3H7UA 1FWRA 4UFLA 2NVCA 3WD1A 4EWJA 2D23A 1D3CA 3KAVA 1Q13A 2CNCA 1QNPA 2WINM 1E5JA 1MWOA 3P81A 4S1FA 3IGSA 3F2CA 3B52X 4ATLA 2PDHA 1XFBA 3IJLA 1TX2A 1TSIA 4L6HA 3ECQA 1XIJA 1V7AA 1A5KC 4MJZA 4GQGA 4RZBA 3WH5A 5JUVA 1QTWA 3MCMA 3NEHA 3TTOA 3D3FA 1H51A 3WLNA 1QWUA 2ISDA 2GQ8A 5KZDA 3MUAA 4TXEA 4JY9A 2X09A 3UCQA 1V51A 1HX0A 3AZSA 2NW0A 1E71M 1QMLA 1G69A 2ZUTA 3CT2A 4UDYX 3GZAA 4XBJA 1X39A 1VFMA 3W1TA 3WNLA 3HA1A 1RCQA 1XKJA 3A64A 3WNMA 4IWOA 1VBUA 2RAGA 2VR5A 1FWWA 1XCWA 3DYTA 4Y8FA 1B9ZA 2Z7GA 1BWLA 1EIBA 2FH6A 2WKJA 3BLBA 1W5PA 3AICA 5IHRA 3PBMA 4LUJA 4E81A 3DI1A 4DJFA 1WBHA 1VJSA 4MB3A 4AKVA 1XRFA 3AIQA 3SY8A 4AD2A 1VR6A 1UD5A 5FJIA 4FR6A 4GYPC 2QT3A 3MHUA 3EA1A 3S1VA 2VM8A 2XFRA 4CGTA 4LFYA 3GM8A 4WPEA 4WIWA 2CITA 1E9ZB 3H7RA 3WQPA 3APGA 4ZEPA 3F5LA 2OSWA 4DJEC 5T8GA 4C6FA 1ISVA 2XH7A 2FZMA 3IGHX 1KRBC 1XHGA 4GI6A 1D8WA 3W53A 3MCNA 1SQ7A 3M0JA 1DQUA 5JU6A 2WNWA 2ELBA 2ZWYA 2EEXA 1GOIA 1IIHA 3VNKA 3W87A 4QEHA 3TNOA 5BRPA 3VDGA 1BG9A 5I24A 1GONA 4HHHA 2JIWA 1KGWA 1NFBA 2R6OA 4GOAA 2VZTA 1KCLA 3BW2A 2ATMA 3VNZA 4CEUC 3G18A 2VURA 3GIYA 4D1IA 3RM9A 1JDCA 4WDXA 4JR5A 3EDEA 3COTA 3P2VA 3ANUA 3NO1A 5A6TC 4BA0A 3PSWA 1QT1A 4ML9A 3HM7A 3YPIA 4MB5A 4K2SA 3A23A 1GZ1A 3VIHA 2F9RA 2V3EA 3S9YA 3GO2A 3A4AA 3EKGA 4MY8A 4WK9A 1UB3A 3VKAA 4JTSA 3GXPA 4GJJA 3H54A 4DVOA 3GYEA 4NG3A 1PXGA 2WHKA 1VP5A 3U57A 3OZYA 1ZJIA 3WQEA 1P48A 4I6KA 1X7IA 4XO7A 5HWNA 1QHZA 3N34A 2AL2B 5EMMA 3D6NA 1VBRA 4DRSA 3Q45A 1CW2A 5D9MA 3AHZA 1Q6OA 3N3TA 3TSMA 1NP2A 1BD0A 4OV4A 3EA2A 1ZWWA 4PUDA 2FGZA 5I0DA 3DHFA 3M0LA 4KFPA 3EB2A 3ITCA 1OX4A 4JTQA 4GQBA 1G01A 2X3WA 4X2PA 1ZBVA 4JFTA 3PK7A 1B4KA 1R3YA 1JDFA 5HK4A 3AYSA 3G8RA 2VD9A 3PUDA 4H83A 2WSPA 4IIHA 4RR4A 2WLZA 1MFVA 4DXVA 2FTYA 1UR8A 5I3DA 3MO4A 3WJYA 4M3PA 4BFAA 1TPVA 1PKYA 3QHMA 5CC7A 1SZRA 1QO2A 1FX6A 3IIZA 1MRQA 1QASA 4EZZA 2PDKA 1BVZA 4PH6A 3MUY1 5E70A 1YDVA 5FESA 4JHZA 4LS0A 2E28A 2TODA 3QGVA 3NL6A 4LANA 4MVAA 4IQJA 2FYVA 3LMYA 5BOFA 3SCWA 2WBGA 3L2IA 3TQKA 3PVFA 2DQXA 2X1UA 1WCGA 2V5BA 1MXDA 2Z29A 2W91A 3EX4A 1S5TA 3VIMA 4OJYA 4PBEA 3H4WA 1HUVA 1VFSA 1OB0A 2YA1A 1UQYA 2GSJA 2JFEX 1KFKA 1V0MA 4HHMA 2D24A 2QNEA 2WNZA 4GJIA 3EDKA 4EOUA 3OTRA 1V6YA 1L6GA 4RNHA 4V27A 1E51A 3TK7A 1KM5A 2QEZA 1Q8AA 3MWAA 3E0IA 2E7FA 2C16A 4LWWA 5BU6A 2W9MA 4D1JA 5D2YA 1JL8A 5CAKA 3GDKA 3GBEA 2F7QA 3W76A 3ELFA 2FDMA 5BOOA 4MKNA 3IVTA 3SURA 2C15A 4JKLA 2C71A 3L68A 4DYLA 3APTA 1TA3A 1KXVA 3CMJA 1TQUA 3B0PA 3IARA 5D9NA 4CEXC 4ROPA 4P8WA 4D8JA 2FLIA 1US0A 3B0XA 1AJZA 3VIJA 1D3GA 1W9BM 4R34A 4NIRA 1UR4A 1BYAA 2JK2A 3E0FA 3KEHA 5CGQA 5DBUA 3EX1A 2BDQA 2WYIA 4DM1A 4IICA 2E67A 1CEOA 4QLJA 5DFAA 4EAMA 4PTWA 2ZUMA 4FR1A 4P5UA 3I10A 1LQ0A 1XBZA 1I4LA 3W2MA 1UOKA 2YI8A 4C6JA 3HGJA 4R88A 3RLUA 1HKWA 3GB6A 2NSXA 3GH5A 3AZRA 2QDEA 3A3XA 1SO5A 1CGUA 4GQ0A 1XUZA 1EEPA 1FHUA 3AWNA 3CUIA 2P76A 1PKMA 4DWDA 3PJWA 1DOSA 1YNYA 1DJIA 4JXCA 3W2JA 3P82A 5A6AA 3USBA 3XIMA 3UA3A 2QCFA 2OQHA 1AH4A 4AH7A 2OJPA 4GHRA 3HU7A 1E3XA 4DZ5A 1LF1A 1LOSA 1VLIA 3LCIA 4X9YA 4HNLA 4CQ8A 3CWHA 1GNLA 1MI3A 4XIAA 3TMLA 4NRSA 4H6HA 1D8CA 3CM4A 1EGMA 1XV8A 1E72M 1Q8JA 3DESA 2QCGA 4KESA 4Q4SA 1W1IE 4J5NA 2GGEA 1Y0EA 1J6PA 1EB3A 5ABGA 5FSEC 3ARRA 3N9KA 1O66A 4MWAE 1DV7A 3PJTA 1XLAA 1XYMA 2BLEA 4JAWA 3VM7A 4QXIA 4US5D 3F4WA 4YTSA 1EFZA 1GJWA 4AWTA 4YWIA 2OT1A 4M56A 1GGOA 1LRNA 5FEZA 1B4EA 1NDWA 2V38A 4PN2A 1YDYA 4BY3A 2OR2A 2WMIA 1AG1O 5DCDA 1VEOA 1H49A 3LI1A 2F6XA 4W4QA 3W00A 4IIBA 1GOMA 3IRDA 3ZLFA 1FVPA 4JTHA 2P3EA 3ITGA 2Z2AA 3LB0A 3QXBA 1T7LA 3SW6A 3STCA 2E1WA 3R43A 1PVNA 2BVYA 3OJGA 4JHOA 3S1XA 1J4EA 1RUSA 1NF0A 1X98A 4ADTA 3FCPA 3R0KA 3SCTA 4QHRA 3H4GA 1PPIA 3UJ2A 3PZUA 1RVGA 5IFTA 1R9ZA 4AD4A 4PULA 3UY8A 4IL0A 3CUHA 1GJUA 3EDFA 5KMYA 2ZRWA 4PODA 3T46A 2C8NA 1DJGA 2DJXA 4S2BA 5BXPA 2VGIA 2GJRA 5FF4A 1KV8A 4C60A 2QIWA 1ZBCA 1B3WA 1MEWA 1W1YA 3N12A 2FVKA 3DH7A 1FUYA 4PL1A 5MF5A 3CAKA 3RU6A 2ND0A 3TH6A 2PWUA 4ZTXA 3BLEA 2XIJA 4L4OA 1F6KA 2X40A 1EP2A 4MLRA 4CNOA 4WOZA 5FJJA 3W73A 1YW1A 3UWWA 4E3CA 4IHCA 5KZEA 2X2YA 3CQ0A 4B9QA 2G41A 1A5OC 3OBAA 3GDLA 1R30A 2PDIA 4O53A 3KLKA 2W27A 3PS7A 3AUJA 2OPJA 3SZ8A 3AIUA 5G5IA 4O8AA 3H26A 1I9CB 1YADA 3O2LA 3SOGA 2ZDSA 3K4WA 5BOEA 3A4WA 2QCDB 4S3FA 3WLRA 2XG9A 2WMFA 3QF0A 1TWSA 4M81A 3PTDA 2DSZA 4PUWA 1M7OA 1Z7AA 2WLYA 4ZQRA 4GLEA 1G67A 4AC7C 1FKXA 1WUEA 3G1XA 3BLIA 4ZMGA 3TW9A 3H24A 3L5LA 1JIBA 2QDHA 2JEQA 2WVSA 2XPKA 1KFEA 4UMAA 2PI6A 3BOLA 4D6GA 1FRBA 1WZLA 2WB5A 3C2EA 1UP3A 1ZNNA 1X96A 4GUIA 1V0NA 3SBFA 3QTPA 3L4ZA 4RL3A 5CKSA 3LHVA 4EZUA 3T4CA 3DPQA 4XAFA 4R7WA 1OCJA 1HL2A 3NQGA 5DCBA 2VTFA 4AVFA 1XDMA 5FJRA 2ZE3A 1IF2A 5CPMA 3RX3A 3QQWA 2EF9A 3I65A 3NQ7A 4A21A 1XLBA 4OWGA 1FP9A 1SUXA 3WUEA 1V03A 1GOXA 3LS9A 3WBEA 1NOUA 3S8HA 1TJ2A 3DI0A 3VOCA 5A6LA 3ABHA 3BUPA 3G0SA 4W85A 4ZQNA 4FNPA 2C18A 1XDLA 3BAYA 2HVNA 3K1GA 4MKVA 3SSZA 3PFMA 4PBFA 1AVAA 1EXBA 3KS5A 3S6TA 1RQHA 2PD5A 2ATSA 3P80A 3K30A 4MNLA 2QGHA 2NT1A 3JZUA 3OA5A 3EMQA 1BGAA 3GXDA 3ARXA 4C91A 3NZQA 2BGNE 3DU0A 2WV8A 3G9GA 3S1WA 3W38A 3S2CA 1XLMA 2EWFA 3AHYA 1J0HA 3P74A 5DT7A 1VRXA 2WMHA 2EX3B 4S3BA 4FXSA 2PE4A 3O6AA 4J7RA 3LA4A 1XIHA 1XH2A 2WQPA 2Z1BA 2Q6ZA 3CTTA 4NYUA 1XLLA 4YLWA 3LD5A 3LPFA 3WMSA 2WC7A 4NJHA 2OZ0A 2O4QA 4JQAA 1XQLA 5FCZA 1EDGA 4FX6M 1XL9A 4JTUA 3VGFA 4UXDA 2ZA1A 1S2AA 3STFA 3DKLA 3QYQA 1KTBA 4CU6A 3ARUA 4IIGA 4BI7A 4Q4OA 2AMXA 4UUIA 3O3MB 1EPVA 4IX2A 3MMUA 1UIPA 1LBLA 3QEZA 2UY3A 1RALA 3CH9A 1H11A 4NHVA 4JYFA 4E8CA 1SW3A 4JTEA 3ITTA 1G7VA 4GIAA 1EJSC 4O14A 5CH9A 3FKKA 3DFSA 9CGTA 4KKXA 4KETA 4PUUA 4LEFA 4UCFA 4Z2JA 3RCNA 2JQXA 2VRKA 1ADSA 1HT6A 1KXQA 1OX5A 4O8RA 2PC8A 2J9XA 1XIFA 1XRTA 1XIGA 4NX0A 1LWIA 1CLKA 4NRRA 2ZQ0A 1N55A 4DAIA 1ICQA 3GDBA 3L3OM 2XVLA 1XGDA 5BXSA 2QLYA 4GNKB 1S2WA 1TWWA 2DPEA 2X7VA 2Z4GA 4YMZA 4J3TA 1NY1A 3UR8A 3TC3A 5LNSA 3AMDA 1ONEA 3UPBA 3L66A 3JVAA 4EPKA 1R0MA 3QLDA 3OGRA 3KCOA 5AVHA 3BICA 2ZRUA 1TQJA 4HA3A 4TMBA 1WNOA 4JIPA 3BAWA 1LRTA 1ISWA 3H2AA 4QROA 4H9XA 2YIAA 5D04C 4CD7A 4DWSB 3KCLA 1RD6A 4WKAA 1HVQA 3EDDA 4UQCA 1IWAA 3UNTA 4KBXA 3LLLA 1VHCA 4GVGA 1OX6A 2VL4A 1JG9A 4TV5A 2PDQA 1FDYA 1UPMB 3UETA 3CHEA 3WJZA 1R3SA 2ZTKA 3LCFA 3OW1A 4IJBA 2KZHA 2NLYA 3GG0A 5LXXA 4LUTA 2Q13A 3DCPA 4ZFMA 1MXSA 5TQLA 3TJLA 1XC6A 3ITOA 1U22A 5I2UA 3TJXA 3VINA 1F05A 1SGJA 3QKZA 4MNJA 4E4PA 1TTJA 2QUUA 1EXPA 3NSXA 4AIOA 3RF9A 1AQ0A 3TONA 5D37A 4AFYA 2PBGA 3KBMA 4UTUA 4UZSA 1M03A 2DZTA 1M65A 2DIEA 3PF3A 4HNUA 3MZNA 4ZE4A 2QJIA 4IFKA 4WSHA 3MP5A 1Z8AA 4NT0A 4D8LA 2AAMA 3W1AA 3SYVA 2Y7FA 4LSBA 2Y6ZA 4RNJA 2OTDA 2QXLA 4TVDA 4ZQPA 2Y5JA 2GUBA 1B90A 3LI0A 1ODZA 3H70A 4DWSC 4OU1A 3TSDA 3FW6A 5C9WA 3O6CA 2QF7A 3M7WA 3CXOA 1OY0A 1WZAA 1ONWA 3GTNA 5HMSA 2CKSA 2PTDA 2VC6A 4BQ5A 1TWDA 1XICA 3NQ8A 1Y2OA 4NXSA 1Z48A 4LPCA 5C2CA 1WYIA 1WO2A 4GO9A 3TX9A 1XLEA 3KX6A 2JALA 4GUJA 4FNSA 1UPPA 3PP7A 1GOWA 4GUHA 2HS6A 3TA6A 4JX5A 3KBWA 3CAVA 1V7YA 1WDDA 3N6JA 1QWKA 4LAMA 2VFGA 4CNNA 2PBOA 2G50A 3P93A 3AS2A 2FZNA 4UTTC 2CXGA 4UTKA 4AZ5A 1UYQA 4F3HA 3NXFA 2BY2A 2IW0A 5C5YA 1TE1A 2QMJA 4HVXA 1W5OA 2ZZ7A 3SRDA 1QOXA 3O63A 5TAOA 1FP8A 1W3JA 3VA8A 3B8WA 2Q8LA 2GK1B 4YJ5A 1GQJA 4JTGA 1VS1A 4QJ3B 2IKIA 3W1LA 1KM1A 4FXRA 4LYPA 5BW6A 2NCZA 2C13A 2W4XA 3VXGA 2W79A 1G7UA 1D2KA 3WCZA 3HPZA 2BY0A 2OZ8A 3N14A 1UG6A 4RK8A 4PEKA 1O1HA 2NXIA 1EQCA 2YXXA 1VB9A 2QYGA 4DCNC 4M7SA 1YPIA 3MKKA 2XWEA 2WZHA 3T8QA 4H6IA 4D6DA 4DO7A 5I3FA 4DYEA 1R3WA 4JTJA 3HB9A 3FA5A 4LYKA 3C0SA 2DDXA 1K9TA 3GVVA 2H3BA 4KW2A 2OWXA 4HB7A 2VQUA 3P0XA 1S46A 4C6MA 2ICSA 1L9WA 1SYTA 4A2RA 2RHGA 3E96A 3K46A 6XIMA 4PBGA 4W89A 3LY0A 3B05A 1W9PA 4J2PA 4J35A 3QV9A 4NSBA 3IJDA 1JUBA 1M68A 1R5YA 3RO6A 3FS2A 1BXCA 2YSWA 3QPEA 4GQQA 2A6NA 3F7WA 1SM9A 3BJSA 1TR1A 1F8MA 2GPTA 3P14A 2DEPA 4PUEA 2WVTA 2VENA 2EO7A 2NLIA 3ZMRA 3EWXA 1ISZA 1I2QA 4TVCA 5XIAA 1I0BA 4KFOA 2W3ZA 1XPYA 3A9IA 3PBWA 2OEKA 4A29A 3L5MA 3M46A 3PPHA 4IQLA 3Q4DA 1GCYA 1RR2A 3QV7A 2Y8UA 3BV4A 3TVAA 2J7FA 4DBDA 3UNDA 4HTYA 4ICNA 4I9TA 4MY9A 4NI3A 2I5QA 5FL0A 4XZIA 3M0YA 1IT8A 3I3BA 5AC7A 2GVYA 2WMIB 1MQQA 4OECA 4IPLA 3IAQA 2VT0A 5HMFA 3N6QA 2V5JA 2Z1XA 2WXDM 2DT3A 1P0EA 1V3LA 4W8LA 5C5BA 2ZADA 2I57A 3K1DA 2O92A 1VYRA 1JFXA 4HNVA 1GVEA 4IJCA 4AUBA 1UC4A 3CUJA 3EDJA 4AZ6A 3KRZA 3B8UA 4AF0A 3SUSA 4PA8A 1NDZA 1AW1A 4FNTA 3W0KA 4XQ6A 1R7OA 3WQ8A 3IIOA 3AXIA 2QUVA 3N04A 3EMZA 1U1JA 2X16A 3DOPA 3QSTA 1A53A 3H12A 3W4RA 3ZJKA 4HR1B 4W5UA 1XYBA 3KLLA 4UR8A 2IPFA 3W37A 4HU4A 4HA0A 4IQEA 3WIJA 5D05A 2YKKA 2PU1A 1UD4A 2OMAA 3CO4A 3QJAA 4S3DA 1AJ2A 2OEJA 3LSCA 5A6MA 3NTYA 1EOMA 4QNEA 3HO8A 3RM4A 4U2ZA 1VLWA 4G1KA 5DRIA 3BAKA 1RD5A 4OTKA 2YX0A 1Q4WA 1K3UA 1AH3A 1J0YA 2HEJA 5CC3A 3KBJA 2BHYA 5CPSA 2PDGA 4YN5A 5DF0A 4P61A 2HJPA 4ZOEA 2WWCA 3IIVA 2F38A 4X61A 4D2JA 4D8ZA 1NP0A 3WLPA 5D8ZA 1O1ZA 2R14A 3UXIA 1ZALA 3T9PA 2WNQA 4GUFA 4IP4A 4Y7EA 3DX1A 3HAHA 4J3WA 4BKNA 3TKFA 3O9NA 4F2TA 4JNFA 2FZ9A 4NNBA 3IJIA 4ES4A 3BO9A 1KGUA 3VVGA 1EZ2A 4PRRA 1TELA 1CGTA 4HYBA 5F1UA 5U7SA 3CUZA 2NUXA 3DG3A 5F4WA 3NM1A 2G97A 3HBLA 4DO5A 1S2VA 3GUGA 1XPGA 2OWWA 3Q94A 1A50A 2NV9A 4RJEA 3BVUA 1T41A 3BMWA 5JXQA 1KM4A 3H7VA 5E93A 4V1YA 2I9EA 4AEEA 3O16A 3M41A 1NWTA 1ECQA 1PX4A 4YIWA 1E4NA 1FH8A 1OWQA 3GC5A 3TSBA 4ALDA 4TX9A 4JEQA 2F2HA 2R1MA 3BMVA 2HXUA 2QQ6A 5FEXA 4A8RA 4FF5A 1QRQA 3SQSA 1FKWA 4D8AA 2A3CA 1CXEA 3WFAA 3POHA 4NP7A 3HIJA 4FOKA 1ZZMA 1VYSX 5HJLA 4B15A 2D2HA 3W23A 1LOLA 4O57A 3RILA 1XGEA 4GISA 2XUCA 2G3MA 1FWHC 2YOCA 5C9UA 3RHGA 3MDUA 4NAFB 4H9MA 5C8BB 4ONVA 4NZJA 3AMGA 2Y1HA 4H9VA 3WH7A 1ME9A 4MNKA 1JCXA 3WZ0E 4R27A 1XLGA 1NJJA 3R5EA 1XLCA 2CLEA 5D4YA 4E3TA 5IOBA 3G3DA 3LHZA 2ACUA 3POCA 4F9DA 1V6VA 4O11A 2ACRA 4W93A 1VCGA 1S2UA 1THFD 1XYZA 3BW4A 4S2CA 1JCJA 4TTUA 5C9RA 3E1F1 4IMEA 3GHUA 2Y5SA 2IQDA 2ISFA 1QHPA 1ZQ5A 2AQWA 1YKWA 2CLIA 2G0WA 3LTSA 4F79A 4FZIA 4G7EB 5D2XA 1JRCA 2QCLA 3KRUA 1KFBA 4JWIA 1ECEA 3L2MA 1DKYA 4HJFA 4E6MA 4QQ3A 1HKMA 4G7FA 4JBRA 4Z1CA 4D6EA 2ZXBA 4EIVA 4FX8A 2QR6A 2J8GA 3MTWA 2X8RA 5ECUA 3LRKA 4HYWA 1EKOA 4ZCWA 3H2EA 3NSMA 3W25A 3Q65A 3A21A 1BYBA 2Y63A 3N73A 1IXPA 4BCEA 2NXHA 2V3FA 4JKKA 1KTNA 3DFTA 5TIMA 3MSYA 1LM1A 2V2HA 1E6ZA 1ESWA 4XD4A 2UY4A 1XSKA 2ZA2A 4P7LA 4NZ4A 3U2EA 4IFRA 1D7KA 4AXNA 3P61A 1P7TB 2WVVB 3HMCA 2VI0A 3ANYA 3KDNA 1XLJA 1ZENA 1E9IA 2A2IA 1UD6A 3PBYA 4H41A 4K1WA 3NQDA 4A4AA 1V3MA 1L6SA 1HN1A 1Z41A 3TR9A 2QUNA 2I56A 5EFFA 5DQPA 2X1RA 4CVUA 2GWGA 1JYVA 3KL0A 3V5FA 2BMBA 5GQBA 3HV8A 2CHNA 1GVQA 2X30A 4Z0SA 3AHTA 4HPNA 3BW3A 3DDGA 4FXFA 4K8EA 4FNQA 2P3ZA 4NVTA 3W7PA 2REQB 1WDPA 3L67A 5BROA 4BI6A 3RPMA 3ZT5A 4KWUA 4FS9A 4MTVA 4QQUA 3VNJA 1CB2A 3TEVA 4XISA 4KWWA 1JDEA 1PEZA 3S0CA 3AJXA 3QZAA 1ELSA 3A98A 3HN3A 1LUCA 2GF4A 1EOKA 3WBXA 4JOMA 4F00A 3NURA 4XZNX 2YLLA 2J8TA 2OSXA 4JNEA 1ZAIA 2PSNA 3QVQA 1TR9A 3D0CA 1JCTA 1EJWC 1UWAA 3RM8A 2WYHA 1GZJA 5LA2A 3N19B 3W7DA 1SFLA 3AXXA 3CPUA 3RLHA 1RQEA 2ZVRA 3CPGA 3RR4A 4LC6A 2PWVA 4DJDC 2IPJA 2OCZA 5GJNA 4MHBA 3CJPA 1Z44A 4TU1A 2GYIA 2XTKA 1WDZA 2VX5A 3KAWA 2ZZ5A 1IGWA 4ATDA 3DX3A 4FMVA 1K6WA 3PB2A 4TUFA 1G9HA 2Z7KA 3IV8A 3M43A 3AS0A 2J62A 1L8NA 3F7JA 4D6CA 4BEQA 3MI6A 4LVAA 2XFFA 3EGJA 4GJ1A 3M7SA 1PS3A 4URIA 3RLGA 3MUXA 3W07A 3HQ1A 4RDWA 2F1BA 1RLCL 4NNCA 4GXPA 1DWAM 1I2NA 3VGDA 2RT6A 1PTAA 2DZWA 2XWDA 5K4XA 2Z0IA 1V3HA 1B3YA 1JCNA 3QSRA 2O7QA 3FEMA 4DPPA 1SO6A 2WHLA 3DFNA 3WBYA 1TJ1A 2EG8A 1U33A 1YNPA 9XIAA 2BY1A 1J93A 4I6VA 5C70A 5FOOA 1WV2A 3SDOA 1ZP3A 2CWXA 1DJNA 3Q58A 2Y24A 3PG9A 3TZNA 3NO5A 4Q32A 3KBVA 1H41A 4I1QA 3GDRA 3AALA 7TAAA 4P2VA 2YA2A 3DZ1A 1ALDA 4F0MA 3W22A 4EZPA 1RV8A 1DHPA 4F48A 2INEA 3M47A 2NUYA 2CU0A 3TYDA 4QAWA 1MNSA 3DHUA 1AW2A 4M7TA 2WCAA 3NR0A 4JL1A 4RKAA 3LGEA 1OFQA 2F7OA 1LBMA 3MZ2A 4Y9OA 1TPWA 3VNDA 3UFYA 4Z1DA 2CEQA 4CNPA 1G4TA 1OZMA 4Z08A 1W1PA 2V5DA 5M5DA 1PIIA 3S5NA 4N9BA 3L4YA 4EXBA 3M5YA 4GY0A 4IW0A 1BPLB 3M6DA 3L4TA 1W5NA 3INPA 4O0ZA 2Y70A 2GK1A 4V28A 1GOKA 1WAWA 3O8AA 4AU0A 4H2HA 2J7CA 4EAYA 4J3UA 4UNLA 1YX1A 2GQAA 2ZRXA 1NWUA 3RRAA 5DXXA 5B7YA 1OGBA 1US2A 1AL8A 1JZ4A 3NVTA 3WYZA 1D9EA 1FXPA 5FACA 3M9YA 1KXHA 3C5QA 5EL1A 3G0UA 1VEMA 3LM7A 1B3ZA 3UEQA 3T0TA 2ZWZA 2RFGA 4XD6A 1XIMA 5K9CA 4ZXOA 4FZOA 1QK2A 2OZNB 3PFRA 1DJHA 1SJBA 4UIOA 4IMAA 1SFJA 5DCEA 4N4PA 3T4AG 3CIWA 5F2IA 2CZ5A 2DV0A 2X3VA 3GVQA 4GI9A 1JPDX 1YTDA 3T48A 1XI3A 1FA2A 2PLKA 3BLPX 4KEVA 5EB8A 1LT8A 2GJLA 4M6QA 3EWDA 1I1XA 4DHGA 3PPGA 3NYDA 4ACZA 4DAFA 4BWLC 1TYGA 1QK0A 4XKMA 2HSAA 2XIBA 4A3RA 1G94A 4AC1X 4GXWA 2GGJA 1VFLA 3MHGA 3EWBX 2E68A 2PODA 4XX6A 3SR7A 4W88A 2GVGA 3GVGA 2WW5A 3OZMA 3D50A 3VIKA 1HL8A 3A5VA 1GEHA 1OFBA 3I2WA 3CU2A 3C52A 4CN6A 3T2QA 3G1FA 4L80A 3R11A 1GHSA 3V0UA 3VO0A 3UW6A 3VCCA 2VNCA 3AISA 4QJ4B 3ACOA 2B7NA 5EY5A 4GX9A 5CJMA 4ZO7A 2CBUA 2J6XA 2O55A 4JN7A 4DJFC 3DX2A 1DJXA 1VBJA 5CZJA 4YVXA 1OFEA 1QU4A 1H7PA 3UWVA 2WZMA 2FPYA 1QPQA 4GINA 4GZJA 1E6QM 3TIMA 3F2BA 4M5PA 4ILSA 4Y6GA 1Q6RA 4LVBA 2R1PA 3HMJG 1GJPA 1YLVA 2YLAA 5CPLA 4MNMA 3ZYZA 1GVFA 3GTIA 1CGXA 1A80A 3WSUA 7ODCA 1VCVA 4S39A 1WOBA 3ZR5A 4AW7A 3R94A 2C1HA 1HJSA 2ZBTA 1HF6A 1BXBA 4DZAA 4FLQA 1AMYA 2X1SA 1LJYA 3II1A 3VMOA 1Z6KA 4HK6A 2UWFA 2V69A 4WY0F 4LUTB 3W75A 5BWAA 4G2DA 1CLVA 1E9VA 2MNRA 2QCEA 3NQCA 1E1CA 1FQ0A 5E9XA 3HG4A 1Q6EA 4FSAA 4QE1A 1XRSA 2FDSA 1O95A 4UC5A 3GXFA 4C7GA 4AX7A 4ML4A 2J9ZA 3LPGA 1G4EA 5H8PA 2A4AA 3F1QA 2IMRA 3DX0A 1R9YA 4PMDA 1S5NA 1E6SM 1LWHA 4QM1A 5DLCA 1I0DA 4F01A 4PMOA 1Q65A 3FD9A 1QPNA 1WDSA 5REQA 2EFLA 4KT2A 2BS9A 4A8IA 3WO8A 1QPKA 1HJVA 4EPDC 4PTNA 4MYAA 3GU1A 6A3HA 1QJWA 4UFMA 1MW1A 1QR7A 3B8IA 1FWSA 4YVVA 2KHOA 3VIFA 1KFJA 4N9EA 3S9IA 4AZ7A 1E40A 1VFOA 4KGLA 4MDOA 3PZIA 3RITA 4I3GA 1Y7VA 3CV6A 4K36A 4KFNA 3W9ZA 1RY0A 4JY8A 3DERA 2DSVA 2NVAA 3BPWA 4WPCA 1HJWA 5JBDA 5CG7A 3LHYA 1LCOA 3AIVA 4DO6A 1W2VA 2V68A 4HNNA 3PG8A 3IIPA 3FJ4A 3DX5A 1HTYA 1F3XA 3HAJA 4LTSA 5KETA 1C91A 3EOLA 4R5EA 1BF2A 5G1YA 4GMEA 3W1XA 2AL1A 1I4NA 1QI4A 4JCMA 3BH4A 1RBAA 3B3DA 3ZXWA 3GSMA 3WY1A 2MANA 4LAZA 1PE1A 1ZU8A 4A35A 4MPKA 1QPRA 1C8XA 4HQVA 3BARA 3BK0A 3AIEA 2XSBA 4MJ4A 3OLEA 5HXMA 4MF4A 3MC5A 3P67A 1KXTA 1Z9AA 5M17A 4FZPA 3UY7A 1RXOB 3TC6A 3T8LA 4K1GA 4Z42C 3WK2A 3GAYA 1J5SA 3HZ3A 3C2VA 1AZ1A 3SCUA 4YPJA 4WXZA 3AHVA 3AXKA 1LG1A 3OIHA 1OBAA 1X1NA 1J10A 3IRSA 2YPIA 2Y5EA 1J0JA 4Q7IA 3CT7A 2JGQA 4UTWA 3OIXA 3V7PA 3LRLA 1DORA 5IXEA 1OT1A 4C6LA 3PZNA 5AHLA 3LYEA 3GNDA 4A3HA 5HJYA 3VX1A 3GNRA 2EJ1A 1YBQA 1DTNA 4XKYA 1ZY9A 2P0OA 3ABZA 1IT7A 1XLHA 3VZYA 3BVXA 1GHRA 1QVBA 1DQXA 2O4MA 4F2UA 3EOOA 3T1GA 2GA9D 5FF3A 2RKXA 4TQTA 3URNA 3KM8A 2IKHA 1B9BA 3QV8A 1EUAA 3W6LA 4KWOA 3UR5A 4QAIA 1V6UA 4XAGA 3OQ8A 4B3ZA 4ZOCA 2OX4A 2Z00A 3OA3A 3B51X 1UPXA 3H6OA 4MAVA 1A5NC 1R9XA 2L5HA 1K4HA 2ZFAA 3DHDA 3H8AA 3FA4A 4IMDA 3IACA 4PFHA 2CZEA 3O0FA 4MMWA 1OD0A 4XZBA 1YYAA 4AQLA 3OOQA 3N29A 4M6UA 1HGWA 4UNIA 4IWPA 4IFOA 1K1DA 2HXTA 4XG1A 4ECLA 1KQYA 3MANA 1DIDA 2VXNA 1UKPA 5JVLA 3SN4A 4JFVA 4B9ZA 2UBPC 2Z0NA 2OG9A 5JBEA 2FTWA 3TN6A 1K02A 3VIOA 1KBLA 2VELA 3U4FA 1W9MA 1ZL1A 4MPQA 1EH9A 2F1AA 4AD3A 4PCSA 1QWGA 4FK9A 1JYXA 2RH9A 1DWIM 1G4SA 1BVNP 3ARYA 3VC5A 3TOYA 5AECA 1JQVA 5K9XA 1WAUA 3CHVA 1EGVA 3OO2A 3R2GA 3GG1A 2OOFA 4OFCA 3WF1A 2AQOA 2REQA 1W5MA 3G6MA 4PC8A 1Q6GA 7REQA 1H4PA 1TZZA 3MVIA 5EMYA 4REQB 5E6ZA 1T99A 1XGZA 1ZBKA 1CB7B 3R8HA 1JZ5A 5CZKA 1EO5A 1XM3A 5REQB 1KD0A 3DBNA 5E5CA 4DLFA 1P0BA 2H90A 1MJGA 2JF6A 3GR4A 4UFJA 3D4ZA 2H8XA 3GG7A 4RZ5A 3WQCA 1IV8A 5AC5A 5CSRA 1YRRA 3WD0A 3ZJ6A 2PP1A 1V3KA 1NOWA 3FSUA 1LYXA 2VO5A 1GK8A 3TXZA 1UW9A 1FWIC 1XIDA 1O12A 2QPUA 3MKVA 1Q6DA 3U2ZA 3PB0A 4NJGA 3R89A 3TQVA 2ISVA 1S3HA 2OT0A 1V02E 2PDBA 2GZXA 3GTXA 3ERCC 4L65A 1V93A 4NASA 1TMHA 2INFA 3T2PA 4AVOA 1EIXA 4ZO9A 2YL8A 4R53A 1SMAA 1FHVA 1W3TA 5FAJA 2Z2BA 1VBHA 4JZ5A 2NQJA 2VMFA 1UA3A 2XM2A 4A05A 3OK8A 2PURA 2V6AA 1EHAA 2WZEA 3U48A 2V5CA 3VX0A 1JYWA 4AYGA 4C6PA 3CMFA 3IGUA 3FN9A 3H55A 1KV5A 1XYLA 1R3VA 1JFHA 4J2MA 1TVNA 1ITUA 4TO8A 3VCRA 1H61A 4DX3A 4RNIA 4DZHA 5G4WA 3RFAA 1PZ1A 2X3XA 3SCSA 4LC8A 3WLHA 2RGMA 4HHLA 3BC9A 2VWSA 4I9JA 1H2JA 2GL5A 4J3XA 2OW6A 5C7HA 5K2ZA 3B9AA 3KVKA 1XD1A 3AOFA 3QKEA 1UKTA 1WQ5A 3CEUA 3QHOA 5HMEA 3DG7A 4HD5A 3PZOA 5KTLA 1WA3A 3QA8A 1Q7MA 3DBPA 3L7RA 1SJDA 3T09A 3QRHA 2WKGA 3WDIA 3IVSA 4MB4A 2YL5A 4MM1A 5FEPA 3WFLA 4PRWA 1CENA 1JZ6A 4Q8PA 1DIEA 1PZ0A 4CQBA 4PMNA 2CLKA 2NV1A 3LNMA 4QDMA 2VVSA 4H19A 4DJDA 4C7DA 2FVLA 3ZZ1A 4AZIA 2QKFA 4HK5A 2PWEA 1DL3A 4IIDA 4Z2HA 1ZPTA 5IM51 1UMYA 4EZXA 1CTNA 5EU9A 4N0RA 1MQRA 7XIMA 2XIQA 4IG2A 1KQZA 1W9UA 3V1PA 2HNHA 3ZVHB 4BK9A 1ZJHA 5FD0A 3KVJA 1JD7A 3C61A 1SZEA 2JIEA 3SRFA 2PRLA 4JDYA 2IXUA 1NQKA 1YDNA 1V3IA 4JTLA 1UMLA 2FMNA 2Q8ZA 3T07A 1TZ7A 3HQOA 2WSQA 2O7SA 4Q8UA 3MY9A 4M6PA 3LMZA 1PKNA 1JAKA 2J13A 4NX5A 3UG5A 5PTDA 3NAVA 3CS2A 2FHBA 1IIGA 1KTCA 1EJRC 1SFSA 3B0VC 2CC0A 3JU2A 3EX6A 4PCPA 3UR7A 1BFNA 3BLDA 1IEVA 3DYMA 3VD7A 3GRIA 1EJ7L 3BLLA 2ZZ2A 4HNOA 5BXRA 3MPGA 1PIGA 3WDJA 5TKYA 5I3HA 2DFAA 3IK2A 1PWLA 2X0SA 3GX9A 4OBSA 2OEMA 5GNXA 1TTPA 2XZ7A 2V5LA 4U3CA 1H09A 3FKRA 3CYVA 4NXKA 1ITXA 2RDXA 5GNZA 4L4LA 3TNBA 4HJWA 1HO1A 3QW4B 4Z0JA 1HW6A 1CXLA 3M0KA 2R94A 2NX1A 1GPWA 1TUXA 5J5DA 3PSVA 4LVDA 1WDWA 1IZJA 4B4HA 3OP2A 3BSHA 3W2NA 1REQB 3QZ6A 1OHLA 4UQDA 3UVAA 2YFOA 1LUCB 4N9DA 4S3EA 2C3ZA 1MQPA 3T08A 2ZX9A 4QX4A 3ZWTA 4YTTA 1VGAA 1XIIA 8XIMA 1X1ZA 2VUYA 2WC4A 4AIBA 3PZVA 3K8MA 2GUYA 4U3AA 1E55A 1U1HA 4O0QA 3RAOA 3WUGA 1ZAJA 5H91A 4I5RA 5ABEA 3MT1A 1LG2A 4GC4A 4KWSA 4LT9A 1AFSA 1O68A 3PTMA 3W86A 1IXNA 2EPKX 3AS1A 4DQWA 2RAKA 2I5GA 1E0XA 3DFYA 3EWUA 4AIEA 1QW8A 4IGNA 2DQWA 1E1CB 2F7FA 3RRXA 1FCVA 4D71A 3O07A 2WJZA 4O54A 4F0RA 3E2RA 5LGZA 2E4TA 1HKKA 4MDPA 2C1GA 3ONCA 4CCCA 1P43A 3DENA 3GTFA 2PA6A 1BTCA 4RXGA 5JH2A 3NPUA 4DB7A 4YYFA 2DU2A 1XR2A 1HZYA 1GG1A 2KX9A 4B5WA 3B53X 5I5RA 1OGSA 3NCOA 2JEPA 3CTLA 1UUMA 2JE8A 3F5KA 3L23A 3FEQA 1CI1A 4YTRA 5HINA 2WJDA 3EJPA 3VEAA 1UR9A 4IGMA 4C5YA 2DIKA 1TX0A 3SEPA 5J8LA 5LKYA 5LHEA 1A5SA 1ML1A 3AAMA 3VEBA 3AO0A 3W24A 1WKYA 2PZ0A 1NIUA 7PTDA 4IX0A 2OO2A 4H1ZA 3FFSA 3WDRA 2VWTA 4NPHA 3AMLA 4BWLA 3H22A 1KBJA 4AZHA 3IJ8A 1V79A 4CKQA 4KCTA 3CLMA 5CLTA 4IM3A 1GOQA 3PUOA 3K4DA 4JTCA 2HMCA 4QGCA 4L56A 1W5QA 3EB4A 1K8XA 1W17A 3FVMA 5CC6A 5DN1A 4DIAA 3TOPA 4WSKA 4F0KA 4AVNA 1C9WA 2Y7EA 3QGAC 1ZBWA 3FDKA 4KF1A 2BASA 1UP2A 4MWAA 5AC4A 4I5UA 2PDUA 3TTQA 5CJ5A 4IM0A 1KFCA 4K68A 3Q67A 1HKIA 1KGXA 1DIOA 1JDAA 2D2JA 4OQVA 4HKPA 4S38A 2CXEA 3REQB 4X0VA 4D6IA 2Q01A 2YB4A 5G1MA 4ENLA 3MBFA 2INZA 4C1NB 2HTMA 4IXXA 1J79A 5DY3A 1S38A 1F5ZA 4C6EA 4DM2A 3O05A 3NGJA 3BZGA 4AG0A 2DSUA 4JFWA 4EF9A 1H63A 4EKJA 5HQMA 1R85A 2PDJA 4JWCA 5HBFA 5HR7A 2EBNA 3W7OA 2Z0VA 2VGGA 4RE2A 2XH0A 4S3JA 3OBEA 4Z2IA 3ES8A 3WL0A 4PMZA 1VEPA 1KA9F 3QN3A 4LV4A 1QNSA 4GH3A 3TUUA 2F18A 4XD3A 1PL9A 3O06A 3GDTA 3BQ5A 5BZAA 5KSWA 2H9AB 3TW6A 3MDWA 1E43A 3KUMA 3BLKA 2Y2WA 4QIUA 4NZ1A 1PDZA 4U2YA 5E0CA 1LZOA 1W54A 3ATYA 1J6OA 3BDKA 3U5YA 5LZLA 4LEQA 2A0NA 2E9LA 3ZSTA 1KB3A 1NQ6A 1XDJA 5KITA 2YKTA 4L61A 4FNRA 3PNZA 2VFHA 1E4LA 3M1ZA 1CLXA 4OUEA 4MGGA 4PMYA 4WHBA 4AVMA 1I60A 5FJTA 2TAAA 1FH7A 3UWQA 3CZSA 1HJUA 3PBGA 4X60A 1HKVA 1H1YA 2DSWA 1TREA 5JMUA 3C0LA 2GQ3A 5DMMA 3CHFA 3N4FA 4QDWA 1KWGA 4U28A 4AZBA 1JDDA 3M0HA 2J78A 3CWOX 3LN3A 2BHZA 4B5XA 4IT1A 2CW6A 4Y9PA 2WKLA 2GGHA 4IIFA 1XYFA 2WWDA 3TZFA 3NQAA 2DIJA 2ZZ3A 1H1ZA 2WZIA 1V08A 1JPMA 4O16A 3MV11 2ZDRA 3VUPA 1P1XA 4LBUA 2GOUA 1W56A 4RE4A 4DF0A 3TN4A 1GYMA 2Z24A 4V2XA 2ZX8A 3EYPA 1A0CA 1GT8A 3NQ2A 3GI7A 1XINA 4RE0A 4Q8MA 4U5KA 2Q02A 3RV1A 2ZIDA 4NZCA 5CG0A 2VKZG 1VFUA 3VTRA 3E38A 4JIRA 4GWEA 3I6EA 4FLRA 1EEXA 3SFKA 3PULA 4Q6XA 5C9ZA 3B9DA 3W01A 3VM5A 2BTMA 2GWNA 3HPAA 2EQDA 5HDRA 2QF8A 3B8VA 3WD2A 3OG2A 4LBSA 1NELA 4HZMA 4N6FA 1KRCC 4ERAA 4ZGYA 5KZMA 3L9CA 3EWYA 3MO7A 2YIHA 4JNZA 1J96A 5DXYA 1OT2A 3ISIX 3WMLA 4B91A 3M5VA 1RJRA 4PMXA 5AN7A 5M1TA 3W7JA 3GFZA 4E3VA 4HA4A 5KBPA 4RNFA 4MZ1A 3TP4A 4QS5A 1TV2A 2ZC1A 3WN6A 3AFBA 1DWJM 3Q84A 5LNRA 3I6RA 5CCZA 2ZKMX 1AQHA 2E9BA 3EZ4A 4AMAA 1XP3A 4ZZ9A 1IZKA 4X9SA 3G2GA 2ZXQA 2Y88A 4XAZA 1Z89A 2YB1A 2BG5A 2CERA 4W7WA 5BMXA 4HSNA 4EZVA 5EFDA 5FA5A 3O15A 3ZT7A 1CX9A 1H7RA 1RPKA 2ZX6A 2ALDA 3A5FA 5IBXC 2DORA 3S5YA 1R38A 3K2GA 2CLLA 1TG7A 5A8OA 2Q71A 1DVJA 3GW3A 2GJXA 2G3NA 3N25A 4ZA0A 4JL9A 1D3HA 1OCBA 1UROA 2P88A 2FPTA 1DJZA 1B2YA 3LPPA 4GX8A 2YDQA 3ID7A 3DDMA 1I2RA 3MCOA 3BURA 1OCNA 3EWZA 3IGXA 2HISA 1W37A 2PDCA 1F76A 3V5OA 3ABOA 4EANA 2NV2A 2Y62A 1MW2A 2ADAA 2QVNA 3M3WA 2XM1A 1CXKA 4O19A 5LGXA 3QM3A 4FALA 4L4PA 1ZAHA 3IAPA 4IWWA 3TR2A 4RCXA 4O12A 2Y0FA 3F03K 1U00A 2HCVA 4O4WA 2EKCA 3GVWA 3PUGA 1O5QA 1TV3A 3L4WA 3VDAA 1JXKA 5IDIA 4IM4A 4YCPA 2CWNA 4AY7A 3WQ5A 4QJ5B 4X3ZA 3H2OA 2WM0A 3LLXA 3W7RA 3EB3A 3QGKC 4DWSA 1WB0A 2H6RA 1ITQA 4O15A 1E0VA 1GTEA 4I9MA 3BGGA 1GVOA 3G8EA 1UKQA 3C86A 1LORA 4HOWA 3VKHA 1ZGDA 4M29A 3ALFA 4K38A 5DT5A 3BMXA 4GFIA 2PDPA 1RBLA 4POCA 1DJYA 4US6A 1ZJAA 2CESA 2PDWA 3MYOA 5F1VA 4MOZA 1P0KA 4ZL1A 2F61A 4IP7A 1CXIA 1QCWA 4Q4PA 1OM0A 3FY1A 3DKJA 2A1YA 1OA0A 4HMDA 1HVXA 4PUNA 2W67A 1MFUA 1EJUC 1AK5A 1YBQB 2XVGA 4JNYA 2VYOA 3M4HA </