2C08A

Rat endophilin a1 bar domain
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
204
structure length
204
Chain Sequence
EGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SH3-CONTAINING GRB2-LIKE PROTEIN 2
publication title Mechanism of Endophilin N-Bar Domain-Mediated Membrane Curvature.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 73
structure length 204
sequence length 204
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2c08A00
3DYTA 2YKTA 1X04A 2EFKA 3ACOA 3HAIA 3OK8A 2FICA 2X3XA 3QNIA 1X03A 2Z0OA 2ELBA 4ATMA 4AKVA 1I4LA 3HAJA 2X3WA 2V0OA 2D1LA 4WPEA 1WDZA 2D4CA 4DCNC 3QE6A 4WPCA 4DYLA 4BNEA 3SYVA 5C5BB 2RAKA 1I4TA 1Y2OA 1ZWWA 2RAIA 2Z0VA 4AVMA 2EFLA 2Q12A 3HAHA 4I1QA 2Q13A 3QWEA 2Z0NA 3M3WA 4NSWA 3G9GA 2RAJA 3PLTA 4H8SA 3SOGA 5C5BA 3ABHA 1URUA 4NQIA 2C08A 4FZSA 1I4DA 3Q0KA 2X3VA 1I49A 3Q84A 3LLLA 3I2WA 3CAZA
chains in the Genus database with same CATH superfamily
4AZGA 3OK8A 5E84A 3D51A 3F7WA 2F1AA 4AZ6A 4WPEA 1GNTA 4BNEA 3T46A 3ZEDA 1UPXA 2RAJA 4JWIA 3CVRA 4IW0A 2YL9A 2OBLA 1I49A 2WYIA 3CZNA 2YKTA 2EFKA 3HAIA 2X3XA 2QXLA 2NCZA 4IWPA 4G6QA 4KIKB 4DCNC 4EZOA 4WPCA 3C7NA 1ZWWA 3BUQA 4JNFA 2N3KA 5C5BA 4HR1A 1YWMA 2WYHA 5TKYA 3T49A 1JQKA 1HWWA 1W9MA 3O3MB 4EZZA 2D1LA 2MI7A 3T4AG 1SUFA 4JL9A 3OHXM 3T47A 1R5EA 2Z0VA 4IWOA 3CV5A 4JWEA 4R5GA 4EZQA 2WINM 3CZSA 3ER9B 3T48A 3CAZA 4AZBA 4FM3A 1TQTA 5C5BB 3VKHA 4HR1B 1GN9A 4IWQA 3M3WA 1I4DA 2OBMA 2F7QA 2OO2A 4EZYA 4EZSA 3QNJA 1SU8A 3BVVA 4EZVA 1HTYA 3BVXA 2Q12A 3RV0A 3EJRA 3L3PA 3BUIA 1E2UA 4FZPA 3I04A 1TQUA 3BVWA 3ACOA 3O3NB 2Z0OA 2RT6A 3DPOA 4F01A 2LXYA 3FD9A 2F7RA 4DYLA 3SYVA 2RAKA 3BLBA 3I01A 3QWEA 4NSWA 2GF4A 3BUPA 3CKDA 3ER8C 3EJSA 4HY9A 2YIVX 1TQVA 2YIBA 2F18A 3B52X 3RV1A 3KDRA 4IM3A 3BVUA 3EJUA 4AZCA 1Y2OA 2EFLA 3ABHA 4EZWA 3D2FA 3DX3A 4JWCA 4EZNA 4ATMA 2QKWA 2KHOA 1GNLA 3HAJA 2ND0A 1WDZA 3QE6A 4HYBA 2Q13A 3DX1A 3SOGA 2YI8A 4NPHA 2F7OA 3DX2A 4AZCB 1SU6A 3A98A 2V0OA 1OAOA 2ND1A 3VEAA 1TQWA 1I4TA 4AVMA 2FYVA 3VEBA 2PMRA 1QX1A 3DYTA 1X04A 2YL8A 4EZXA 4AKVA 3LVTA 1E1DA 4JWDA 4EZTA 3O3OB 1HXKA 2Z8YA 1PS3A 1QWUA 2F7PA 2OW6A 4R5JA 3D50A 4FZSA 2F1BA 3EJPA 3L3OM 3LLLA 1MJGA 2ELBA 2ALWA 3EJTA 3RPMA 4JNEA 4PO2A 4I1QA 2JNKA 3ERCC 4H6IA 1OA1A 2YLLA 3Q0KA 4F00A 4R5IA 2GA9D 3B53X 4UDYX 1I4LA 1DKXA 2JNSA 3DX0A 4D8JA 4AZIA 3D4ZA 3GI7A 2OW7A 2LM0A 3UITA 3DDGA 4B9QA 1URUA 1QWNA 3KAWA 3DDFA 4M0MA 1TQSA 3EJQA 1U00A 2O0I1 2YL5A 3D4YA 2D4CA 4H6HA 1R34A 2X5CA 4IM0A 4R5KA 3G9GA 3PLTA 4JLCA 2X3VA 1ZYLA 2YI9A 4UDXX 3BVTA 1O7DC 3DPPA 3LMFA 5FLEX 3BUBA 2GAFD 4AZ5A 1DKYA 4EZRA 3BUDA 3OWGA 2YL6A 3I39X 4EZUA 3B51X 4H8SA 3D2EA 3Q84A 4FZOA 2FICA 3QNIA 1X03A 2QFFA 5KBPA 3KAVA 2OZNB 2ZXQA 1DKZA 1O7DB 5FIGA 4E81A 2RAIA 4AZ7A 2YIAA 3HAHA 4IM2A 3QA8A 2Z0NA 2YLAA 2C08A 1R33A 4EZPA 1E9VA 1OA0A 1SU7A 3DX4A 3DPQA 2X3WA 3D52A 2EX3B 1LQ7A 4R5LA 4KIKA 2PY6A 2EWFA 4NQIA 4AZHA 4E3CA 3I2WA 4JN4A
chains in the Genus database with same CATH topology
3DYTA 2YKTA 1X04A 2EFKA 3ACOA 3HAIA 3OK8A 2FICA 2X3XA 3QNIA 1X03A 2Z0OA 2ELBA 4ATMA 4AKVA 1I4LA 3HAJA 2X3WA 2V0OA 2D1LA 4WPEA 1WDZA 2D4CA 4DCNC 3QE6A 4WPCA 4DYLA 4BNEA 3SYVA 5C5BB 2RAKA 1I4TA 1Y2OA 1ZWWA 2RAIA 2Z0VA 4AVMA 2EFLA 2Q12A 3HAHA 4I1QA 2Q13A 3QWEA 2Z0NA 3M3WA 4NSWA 3G9GA 2RAJA 3PLTA 4H8SA 3SOGA 5C5BA 3ABHA 1URUA 4NQIA 2C08A 4FZSA 1I4DA 3Q0KA 2X3VA 1I49A 3Q84A 3LLLA 3I2WA 3CAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DYT A;  2YKT A;  1X04 A;  2EFK A;  3ACO A;  3HAI A;  3OK8 A;  2FIC A;  2X3X A;  3QNI A;  1X03 A;  2Z0O A;  2ELB A;  4ATM A;  4AKV A;  1I4L A;  3HAJ A;  2X3W A;  2V0O A;  2D1L A;  4WPE A;  1WDZ A;  2D4C A;  4DCN C;  3QE6 A;  4WPC A;  4DYL A;  4BNE A;  3SYV A;  5C5B B;  2RAK A;  1I4T A;  1Y2O A;  1ZWW A;  2RAI A;  2Z0V A;  4AVM A;  2EFL A;  2Q12 A;  3HAH A;  4I1Q A;  2Q13 A;  3QWE A;  2Z0N A;  3M3W A;  4NSW A;  3G9G A;  2RAJ A;  3PLT A;  4H8S A;  3SOG A;  5C5B A;  3ABH A;  1URU A;  4NQI A;  2C08 A;  4FZS A;  1I4D A;  3Q0K A;  2X3V A;  1I49 A;  3Q84 A;  3LLL A;  3I2W A;  3CAZ A; 
#chains in the Genus database with same CATH topology
 4AZG A;  3OK8 A;  5E84 A;  3D51 A;  3F7W A;  2F1A A;  4AZ6 A;  4WPE A;  1GNT A;  4BNE A;  3T46 A;  3ZED A;  1UPX A;  2RAJ A;  4JWI A;  3CVR A;  4IW0 A;  2YL9 A;  2OBL A;  1I49 A;  2WYI A;  3CZN A;  2YKT A;  2EFK A;  3HAI A;  2X3X A;  2QXL A;  2NCZ A;  4IWP A;  4G6Q A;  4KIK B;  4DCN C;  4EZO A;  4WPC A;  3C7N A;  1ZWW A;  3BUQ A;  4JNF A;  2N3K A;  5C5B A;  4HR1 A;  1YWM A;  2WYH A;  5TKY A;  3T49 A;  1JQK A;  1HWW A;  1W9M A;  3O3M B;  4EZZ A;  2D1L A;  2MI7 A;  3T4A G;  1SUF A;  4JL9 A;  3OHX M;  3T47 A;  1R5E A;  2Z0V A;  4IWO A;  3CV5 A;  4JWE A;  4R5G A;  4EZQ A;  2WIN M;  3CZS A;  3ER9 B;  3T48 A;  3CAZ A;  4AZB A;  4FM3 A;  1TQT A;  5C5B B;  3VKH A;  4HR1 B;  1GN9 A;  4IWQ A;  3M3W A;  1I4D A;  2OBM A;  2F7Q A;  2OO2 A;  4EZY A;  4EZS A;  3QNJ A;  1SU8 A;  3BVV A;  4EZV A;  1HTY A;  3BVX A;  2Q12 A;  3RV0 A;  3EJR A;  3L3P A;  3BUI A;  1E2U A;  4FZP A;  3I04 A;  1TQU A;  3BVW A;  3ACO A;  3O3N B;  2Z0O A;  2RT6 A;  3DPO A;  4F01 A;  2LXY A;  3FD9 A;  2F7R A;  4DYL A;  3SYV A;  2RAK A;  3BLB A;  3I01 A;  3QWE A;  4NSW A;  2GF4 A;  3BUP A;  3CKD A;  3ER8 C;  3EJS A;  4HY9 A;  2YIV X;  1TQV A;  2YIB A;  2F18 A;  3B52 X;  3RV1 A;  3KDR A;  4IM3 A;  3BVU A;  3EJU A;  4AZC A;  1Y2O A;  2EFL A;  3ABH A;  4EZW A;  3D2F A;  3DX3 A;  4JWC A;  4EZN A;  4ATM A;  2QKW A;  2KHO A;  1GNL A;  3HAJ A;  2ND0 A;  1WDZ A;  3QE6 A;  4HYB A;  2Q13 A;  3DX1 A;  3SOG A;  2YI8 A;  4NPH A;  2F7O A;  3DX2 A;  4AZC B;  1SU6 A;  3A98 A;  2V0O A;  1OAO A;  2ND1 A;  3VEA A;  1TQW A;  1I4T A;  4AVM A;  2FYV A;  3VEB A;  2PMR A;  1QX1 A;  3DYT A;  1X04 A;  2YL8 A;  4EZX A;  4AKV A;  3LVT A;  1E1D A;  4JWD A;  4EZT A;  3O3O B;  1HXK A;  2Z8Y A;  1PS3 A;  1QWU A;  2F7P A;  2OW6 A;  4R5J A;  3D50 A;  4FZS A;  2F1B A;  3EJP A;  3L3O M;  3LLL A;  1MJG A;  2ELB A;  2ALW A;  3EJT A;  3RPM A;  4JNE A;  4PO2 A;  4I1Q A;  2JNK A;  3ERC C;  4H6I A;  1OA1 A;  2YLL A;  3Q0K A;  4F00 A;  4R5I A;  2GA9 D;  3B53 X;  4UDY X;  1I4L A;  1DKX A;  2JNS A;  3DX0 A;  4D8J A;  4AZI A;  3D4Z A;  3GI7 A;  2OW7 A;  2LM0 A;  3UIT A;  3DDG A;  4B9Q A;  1URU A;  1QWN A;  3KAW A;  3DDF A;  4M0M A;  1TQS A;  3EJQ A;  1U00 A;  2O0I 1;  2YL5 A;  3D4Y A;  2D4C A;  4H6H A;  1R34 A;  2X5C A;  4IM0 A;  4R5K A;  3G9G A;  3PLT A;  4JLC A;  2X3V A;  1ZYL A;  2YI9 A;  4UDX X;  3BVT A;  1O7D C;  3DPP A;  3LMF A;  5FLE X;  3BUB A;  2GAF D;  4AZ5 A;  1DKY A;  4EZR A;  3BUD A;  3OWG A;  2YL6 A;  3I39 X;  4EZU A;  3B51 X;  4H8S A;  3D2E A;  3Q84 A;  4FZO A;  2FIC A;  3QNI A;  1X03 A;  2QFF A;  5KBP A;  3KAV A;  2OZN B;  2ZXQ A;  1DKZ A;  1O7D B;  5FIG A;  4E81 A;  2RAI A;  4AZ7 A;  2YIA A;  3HAH A;  4IM2 A;  3QA8 A;  2Z0N A;  2YLA A;  2C08 A;  1R33 A;  4EZP A;  1E9V A;  1OA0 A;  1SU7 A;  3DX4 A;  3DPQ A;  2X3W A;  3D52 A;  2EX3 B;  1LQ7 A;  4R5L A;  4KIK A;  2PY6 A;  2EWF A;  4NQI A;  4AZH A;  4E3C A;  3I2W A;  4JN4 A; 
#chains in the Genus database with same CATH homology
 3DYT A;  2YKT A;  1X04 A;  2EFK A;  3ACO A;  3HAI A;  3OK8 A;  2FIC A;  2X3X A;  3QNI A;  1X03 A;  2Z0O A;  2ELB A;  4ATM A;  4AKV A;  1I4L A;  3HAJ A;  2X3W A;  2V0O A;  2D1L A;  4WPE A;  1WDZ A;  2D4C A;  4DCN C;  3QE6 A;  4WPC A;  4DYL A;  4BNE A;  3SYV A;  5C5B B;  2RAK A;  1I4T A;  1Y2O A;  1ZWW A;  2RAI A;  2Z0V A;  4AVM A;  2EFL A;  2Q12 A;  3HAH A;  4I1Q A;  2Q13 A;  3QWE A;  2Z0N A;  3M3W A;  4NSW A;  3G9G A;  2RAJ A;  3PLT A;  4H8S A;  3SOG A;  5C5B A;  3ABH A;  1URU A;  4NQI A;  2C08 A;  4FZS A;  1I4D A;  3Q0K A;  2X3V A;  1I49 A;  3Q84 A;  3LLL A;  3I2W A;  3CAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...