2C08A

Rat endophilin a1 bar domain
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
204
structure length
204
Chain Sequence
EGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SH3-CONTAINING GRB2-LIKE PROTEIN 2
publication title Mechanism of Endophilin N-Bar Domain-Mediated Membrane Curvature.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 73
structure length 204
sequence length 204
ec nomenclature ec 2.3.1.-:
pdb deposition date 2005-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2c08A00
4DYLA 1I4DA 5C5BB 3HAHA 4FZSA 2EFKA 2Q13A 3LLLA 5C5BA 1Y2OA 4NSWA 2EFLA 1I4LA 2RAKA 3G9GA 4BNEA 3CAZA 3Q84A 4H8SA 2RAIA 4AKVA 3DYTA 2D1LA 2X3VA 4NQIA 2D4CA 2Q12A 2Z0NA 3Q0KA 3SOGA 3HAIA 4AVMA 3PLTA 1ZWWA 2RAJA 1X03A 2YKTA 3ACOA 3HAJA 3M3WA 1I49A 3OK8A 1I4TA 3QWEA 4WPCA 2X3WA 3QNIA 4ATMA 4DCNC 4WPEA 2FICA 2Z0OA 4I1QA 3I2WA 1WDZA 2Z0VA 3ABHA 1URUA 2C08A 2V0OA 2X3XA 3SYVA 3QE6A 1X04A 2ELBA
chains in the Genus database with same CATH superfamily
3KDRA 4F00A 4AZ5A 3ER9B 2EFLA 3EJUA 3DYTA 4M0MA 2EWFA 4F01A 3EJQA 3T49A 1R33A 2V0OA 3OWGA 4JL9A 3EJPA 4AZGA 1HXKA 4H6IA 2OBLA 4EZQA 2YL5A 3C7NA 2YIVX 4EZXA 3DX4A 2X5CA 3M3WA 3DPPA 2KHOA 1E1DA 1TQVA 4JNEA 1MJGA 3BUQA 3I01A 4G6QA 2F18A 3BVXA 3GI7A 4AZIA 3G9GA 1JQKA 1OA1A 3CAZA 2RAIA 2D1LA 2PY6A 4IWPA 1TQUA 1O7DB 4WPEA 3DX2A 3EJRA 3BUDA 4R5IA 2GAFD 3CZSA 2YLLA 4FZOA 4EZTA 4NPHA 4IM2A 1SU8A 4R5KA 2Z0NA 4KIKB 2RAJA 2X3WA 4ATMA 4IM3A 1TQSA 1E9VA 1O7DC 1PS3A 2OZNB 2YL9A 4JWIA 3SYVA 2ND0A 3QA8A 4EZZA 4FZSA 2Q13A 3BVUA 2O0I1 2YIAA 2D4CA 3Q0KA 3HAIA 4AZBA 4EZRA 3D52A 3QNIA 3ERCC 2C08A 2YL8A 3CV5A 3CZNA 5FIGA 4JWEA 4H6HA 3OHXM 1HTYA 4D8JA 3DX1A 2YLAA 3B53X 2JNSA 3EJSA 1TQTA 3FD9A 4IW0A 4HY9A 3RV1A 2F1AA 2F7OA 2Z8YA 1SU7A 1ZYLA 1U00A 3I39X 4AZ7A 4I1QA 5FLEX 3ABHA 3DX3A 4EZVA 3EJTA 2NCZA 2QXLA 1SUFA 3L3OM 1OA0A 3BLBA 4UDYX 2OBMA 4JWCA 4AZ6A 3RV0A 1R34A 4HR1B 3T46A 3HAJA 1I49A 4AZCB 3T48A 1GNLA 3BUPA 3QE6A 4JN4A 3L3PA 4EZPA 2JNKA 3DPOA 2OW7A 3B51X 2ND1A 4NQIA 2QKWA 5TKYA 4AVMA 3D4YA 4R5GA 3D2EA 3DDGA 4EZSA 1QWNA 1WDZA 4UDXX 3CKDA 3T4AG 3VEBA 3I04A 4H8SA 2OW6A 3D2FA 3D50A 4IWOA 2F7PA 1ZWWA 3BVVA 3OK8A 4E81A 4FM3A 4KIKA 4DCNC 2Z0OA 3T47A 1YWMA 5KBPA 1QX1A 1GN9A 1X04A 2F1BA 2YL6A 5C5BB 1Y2OA 3BVWA 1LQ7A 4EZYA 3QNJA 1SU6A 3O3NB 3D4ZA 4FZPA 2N3KA 3KAWA 3A98A 2EX3B 2F7QA 2EFKA 3LVTA 5C5BA 1GNTA 3Q84A 4IM0A 4EZUA 1E2UA 2YI8A 2Q12A 3SOGA 4WPCA 1I4TA 3DPQA 3F7WA 2ALWA 2Z0VA 4E3CA 2OO2A 3UITA 1DKZA 2WINM 4NSWA 3ZEDA 3KAVA 2X3VA 4JNFA 2YKTA 1QWUA 2WYHA 1DKXA 2FICA 3I2WA 2LM0A 1URUA 2X3XA 2YI9A 1I4DA 3O3OB 4B9QA 3HAHA 3BUIA 1OAOA 3LLLA 1UPXA 3DX0A 1I4LA 2QFFA 4BNEA 2MI7A 2GF4A 1W9MA 4HR1A 2PMRA 1DKYA 2LXYA 2YIBA 4AZCA 3RPMA 3B52X 3D51A 3LMFA 3DDFA 4HYBA 5E84A 4EZWA 2ZXQA 4AKVA 4EZNA 3PLTA 3QWEA 4PO2A 4IWQA 2FYVA 1TQWA 4R5JA 2ELBA 2F7RA 4DYLA 3VKHA 3CVRA 4EZOA 4R5LA 3BUBA 1R5EA 2RAKA 2RT6A 1HWWA 4JLCA 4AZHA 3ER8C 3ACOA 1X03A 3O3MB 3VEAA 3BVTA 2WYIA 4JWDA 2GA9D
chains in the Genus database with same CATH topology
4DYLA 1I4DA 5C5BB 3HAHA 4FZSA 2EFKA 2Q13A 3LLLA 5C5BA 1Y2OA 4NSWA 2EFLA 1I4LA 2RAKA 3G9GA 4BNEA 3CAZA 3Q84A 4H8SA 2RAIA 4AKVA 3DYTA 2D1LA 2X3VA 4NQIA 2D4CA 2Q12A 2Z0NA 3Q0KA 3SOGA 3HAIA 4AVMA 3PLTA 1ZWWA 2RAJA 1X03A 2YKTA 3ACOA 3HAJA 3M3WA 1I49A 3OK8A 1I4TA 3QWEA 4WPCA 2X3WA 3QNIA 4ATMA 4DCNC 4WPEA 2FICA 2Z0OA 4I1QA 3I2WA 1WDZA 2Z0VA 3ABHA 1URUA 2C08A 2V0OA 2X3XA 3SYVA 3QE6A 1X04A 2ELBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DYL A;  1I4D A;  5C5B B;  3HAH A;  4FZS A;  2EFK A;  2Q13 A;  3LLL A;  5C5B A;  1Y2O A;  4NSW A;  2EFL A;  1I4L A;  2RAK A;  3G9G A;  4BNE A;  3CAZ A;  3Q84 A;  4H8S A;  2RAI A;  4AKV A;  3DYT A;  2D1L A;  2X3V A;  4NQI A;  2D4C A;  2Q12 A;  2Z0N A;  3Q0K A;  3SOG A;  3HAI A;  4AVM A;  3PLT A;  1ZWW A;  2RAJ A;  1X03 A;  2YKT A;  3ACO A;  3HAJ A;  3M3W A;  1I49 A;  3OK8 A;  1I4T A;  3QWE A;  4WPC A;  2X3W A;  3QNI A;  4ATM A;  4DCN C;  4WPE A;  2FIC A;  2Z0O A;  4I1Q A;  3I2W A;  1WDZ A;  2Z0V A;  3ABH A;  1URU A;  2C08 A;  2V0O A;  2X3X A;  3SYV A;  3QE6 A;  1X04 A;  2ELB A; 
#chains in the Genus database with same CATH topology
 3KDR A;  4F00 A;  4AZ5 A;  3ER9 B;  2EFL A;  3EJU A;  3DYT A;  4M0M A;  2EWF A;  4F01 A;  3EJQ A;  3T49 A;  1R33 A;  2V0O A;  3OWG A;  4JL9 A;  3EJP A;  4AZG A;  1HXK A;  4H6I A;  2OBL A;  4EZQ A;  2YL5 A;  3C7N A;  2YIV X;  4EZX A;  3DX4 A;  2X5C A;  3M3W A;  3DPP A;  2KHO A;  1E1D A;  1TQV A;  4JNE A;  1MJG A;  3BUQ A;  3I01 A;  4G6Q A;  2F18 A;  3BVX A;  3GI7 A;  4AZI A;  3G9G A;  1JQK A;  1OA1 A;  3CAZ A;  2RAI A;  2D1L A;  2PY6 A;  4IWP A;  1TQU A;  1O7D B;  4WPE A;  3DX2 A;  3EJR A;  3BUD A;  4R5I A;  2GAF D;  3CZS A;  2YLL A;  4FZO A;  4EZT A;  4NPH A;  4IM2 A;  1SU8 A;  4R5K A;  2Z0N A;  4KIK B;  2RAJ A;  2X3W A;  4ATM A;  4IM3 A;  1TQS A;  1E9V A;  1O7D C;  1PS3 A;  2OZN B;  2YL9 A;  4JWI A;  3SYV A;  2ND0 A;  3QA8 A;  4EZZ A;  4FZS A;  2Q13 A;  3BVU A;  2O0I 1;  2YIA A;  2D4C A;  3Q0K A;  3HAI A;  4AZB A;  4EZR A;  3D52 A;  3QNI A;  3ERC C;  2C08 A;  2YL8 A;  3CV5 A;  3CZN A;  5FIG A;  4JWE A;  4H6H A;  3OHX M;  1HTY A;  4D8J A;  3DX1 A;  2YLA A;  3B53 X;  2JNS A;  3EJS A;  1TQT A;  3FD9 A;  4IW0 A;  4HY9 A;  3RV1 A;  2F1A A;  2F7O A;  2Z8Y A;  1SU7 A;  1ZYL A;  1U00 A;  3I39 X;  4AZ7 A;  4I1Q A;  5FLE X;  3ABH A;  3DX3 A;  4EZV A;  3EJT A;  2NCZ A;  2QXL A;  1SUF A;  3L3O M;  1OA0 A;  3BLB A;  4UDY X;  2OBM A;  4JWC A;  4AZ6 A;  3RV0 A;  1R34 A;  4HR1 B;  3T46 A;  3HAJ A;  1I49 A;  4AZC B;  3T48 A;  1GNL A;  3BUP A;  3QE6 A;  4JN4 A;  3L3P A;  4EZP A;  2JNK A;  3DPO A;  2OW7 A;  3B51 X;  2ND1 A;  4NQI A;  2QKW A;  5TKY A;  4AVM A;  3D4Y A;  4R5G A;  3D2E A;  3DDG A;  4EZS A;  1QWN A;  1WDZ A;  4UDX X;  3CKD A;  3T4A G;  3VEB A;  3I04 A;  4H8S A;  2OW6 A;  3D2F A;  3D50 A;  4IWO A;  2F7P A;  1ZWW A;  3BVV A;  3OK8 A;  4E81 A;  4FM3 A;  4KIK A;  4DCN C;  2Z0O A;  3T47 A;  1YWM A;  5KBP A;  1QX1 A;  1GN9 A;  1X04 A;  2F1B A;  2YL6 A;  5C5B B;  1Y2O A;  3BVW A;  1LQ7 A;  4EZY A;  3QNJ A;  1SU6 A;  3O3N B;  3D4Z A;  4FZP A;  2N3K A;  3KAW A;  3A98 A;  2EX3 B;  2F7Q A;  2EFK A;  3LVT A;  5C5B A;  1GNT A;  3Q84 A;  4IM0 A;  4EZU A;  1E2U A;  2YI8 A;  2Q12 A;  3SOG A;  4WPC A;  1I4T A;  3DPQ A;  3F7W A;  2ALW A;  2Z0V A;  4E3C A;  2OO2 A;  3UIT A;  1DKZ A;  2WIN M;  4NSW A;  3ZED A;  3KAV A;  2X3V A;  4JNF A;  2YKT A;  1QWU A;  2WYH A;  1DKX A;  2FIC A;  3I2W A;  2LM0 A;  1URU A;  2X3X A;  2YI9 A;  1I4D A;  3O3O B;  4B9Q A;  3HAH A;  3BUI A;  1OAO A;  3LLL A;  1UPX A;  3DX0 A;  1I4L A;  2QFF A;  4BNE A;  2MI7 A;  2GF4 A;  1W9M A;  4HR1 A;  2PMR A;  1DKY A;  2LXY A;  2YIB A;  4AZC A;  3RPM A;  3B52 X;  3D51 A;  3LMF A;  3DDF A;  4HYB A;  5E84 A;  4EZW A;  2ZXQ A;  4AKV A;  4EZN A;  3PLT A;  3QWE A;  4PO2 A;  4IWQ A;  2FYV A;  1TQW A;  4R5J A;  2ELB A;  2F7R A;  4DYL A;  3VKH A;  3CVR A;  4EZO A;  4R5L A;  3BUB A;  1R5E A;  2RAK A;  2RT6 A;  1HWW A;  4JLC A;  4AZH A;  3ER8 C;  3ACO A;  1X03 A;  3O3M B;  3VEA A;  3BVT A;  2WYI A;  4JWD A;  2GA9 D; 
#chains in the Genus database with same CATH homology
 4DYL A;  1I4D A;  5C5B B;  3HAH A;  4FZS A;  2EFK A;  2Q13 A;  3LLL A;  5C5B A;  1Y2O A;  4NSW A;  2EFL A;  1I4L A;  2RAK A;  3G9G A;  4BNE A;  3CAZ A;  3Q84 A;  4H8S A;  2RAI A;  4AKV A;  3DYT A;  2D1L A;  2X3V A;  4NQI A;  2D4C A;  2Q12 A;  2Z0N A;  3Q0K A;  3SOG A;  3HAI A;  4AVM A;  3PLT A;  1ZWW A;  2RAJ A;  1X03 A;  2YKT A;  3ACO A;  3HAJ A;  3M3W A;  1I49 A;  3OK8 A;  1I4T A;  3QWE A;  4WPC A;  2X3W A;  3QNI A;  4ATM A;  4DCN C;  4WPE A;  2FIC A;  2Z0O A;  4I1Q A;  3I2W A;  1WDZ A;  2Z0V A;  3ABH A;  1URU A;  2C08 A;  2V0O A;  2X3X A;  3SYV A;  3QE6 A;  1X04 A;  2ELB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...