3SOGA

Crystal structure of the bar domain of human amphiphysin, isoform 1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
200
structure length
197
Chain Sequence
DEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amphiphysin
source organism Homo sapiens
molecule tags Structural protein
total genus 87
structure length 197
sequence length 200
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3sogA00
3QNIA 2RAJA 4ATMA 1X03A 2Q13A 2Z0NA 3QE6A 1ZWWA 4NQIA 4H8SA 4WPEA 2Z0OA 3HAHA 3PLTA 4AVMA 3HAIA 4WPCA 3QWEA 4FZSA 3HAJA 1I4DA 2EFLA 2X3XA 2YKTA 3G9GA 2FICA 3OK8A 2RAIA 2Q12A 3ACOA 3Q0KA 2ELBA 3I2WA 3Q84A 4AKVA 4DCNC 1Y2OA 2EFKA 1I4LA 4I1QA 2V0OA 4DYLA 3SYVA 3CAZA 2D1LA 3M3WA 2C08A 1I49A 3ABHA 3SOGA 1URUA 1WDZA 2X3WA 2RAKA 5C5BA 1X04A 3LLLA 5C5BB 4BNEA 3DYTA 2D4CA 4NSWA 2X3VA 2Z0VA 1I4TA
chains in the Genus database with same CATH superfamily
4AZCA 3OWGA 3PLTA 2Z8YA 3DX4A 4WPCA 4EZTA 3VKHA 3ERCC 3VEAA 3RV0A 3DDGA 2OBMA 3D2FA 3D51A 4DYLA 2FYVA 1DKZA 1HTYA 2YL5A 4IWPA 2EWFA 3ABHA 3ER8C 1O7DC 4H8SA 4KIKA 1TQUA 2ND0A 1I4DA 2EFLA 1DKXA 2F7QA 4M0MA 3DX0A 3D4ZA 2QXLA 2YLAA 3EJSA 2WINM 4JN4A 3LVTA 4FZOA 4AZCB 1E9VA 2X3XA 1MJGA 4F01A 2ND1A 3EJRA 2ZXQA 3F7WA 4DCNC 1I4LA 4JNEA 1GNTA 4AVMA 5KBPA 1LQ7A 1X04A 2PY6A 1JQKA 1ZWWA 3D2EA 1OA1A 5FIGA 4KIKB 1TQTA 1YWMA 3Q0KA 2N3KA 4EZWA 2EFKA 3CZNA 1QWNA 2C08A 2GAFD 3T49A 4H6IA 3GI7A 2X5CA 4BNEA 2X3VA 3B51X 3I04A 2PMRA 4HY9A 4IW0A 2OW6A 1HXKA 2F1BA 3D52A 4UDXX 4EZOA 2YKTA 1HWWA 2ELBA 4H6HA 2LM0A 2YIBA 3EJTA 2F7RA 3QNJA 1R5EA 3CV5A 3CAZA 4HYBA 3LLLA 2YI9A 2MI7A 1X03A 3C7NA 4EZSA 2NCZA 2WYHA 4FZSA 3BVXA 4JWDA 4I1QA 2RT6A 1URUA 3BUQA 1R33A 3DX3A 4IM0A 1QX1A 3KAVA 1SU6A 2KHOA 1OA0A 4B9QA 1GN9A 3L3OM 3CVRA 1Y2OA 2WYIA 3ER9B 2V0OA 2X3WA 5C5BA 4D8JA 4JL9A 2Z0VA 3BVUA 3BVTA 1QWUA 1UPXA 5FLEX 4JWIA 3I39X 3BLBA 3I2WA 2YLLA 4JNFA 4FZPA 3B53X 4EZPA 4EZZA 3SYVA 4UDYX 3KDRA 4R5LA 4AZIA 4HR1A 2QKWA 3T48A 2QFFA 3D50A 3O3NB 4E3CA 2RAIA 3ACOA 1DKYA 2F18A 3DPPA 3ZEDA 3BUPA 1R34A 1WDZA 5C5BB 3EJPA 2Q13A 4IWQA 4JLCA 4NQIA 1E2UA 3BUBA 1SU8A 3BUIA 3T46A 2JNSA 3BUDA 4EZYA 4EZQA 2YIVX 4EZNA 3KAWA 3T47A 2RAKA 3T4AG 4HR1B 1GNLA 3LMFA 4G6QA 3DX1A 4ATMA 2Z0NA 3QE6A 3DX2A 3QWEA 4IM2A 4NPHA 1O7DB 2OW7A 3B52X 3EJUA 1SUFA 3CZSA 4AZ7A 2YL9A 4AZGA 4F00A 4R5IA 4NSWA 2GA9D 1TQSA 4AKVA 2F7PA 1OAOA 1SU7A 3SOGA 2D1LA 2YL6A 3D4YA 2D4CA 2YIAA 4AZHA 4FM3A 2OZNB 4E81A 3RPMA 4R5JA 3HAHA 3HAIA 4EZUA 3DPQA 3UITA 3G9GA 3Q84A 3EJQA 1TQWA 5TKYA 2YL8A 3M3WA 1I49A 4JWEA 2O0I1 4EZRA 1U00A 4AZBA 4AZ6A 3O3MB 3QNIA 2OBLA 4EZVA 4WPEA 2Z0OA 3O3OB 4EZXA 3CKDA 2FICA 1ZYLA 2OO2A 1E1DA 3RV1A 2EX3B 3OHXM 2ALWA 1PS3A 2F1AA 3HAJA 2GF4A 2F7OA 3QA8A 2LXYA 1TQVA 4R5GA 1W9MA 3VEBA 4JWCA 4AZ5A 2RAJA 3L3PA 3A98A 3BVVA 3I01A 3OK8A 2Q12A 2JNKA 4R5KA 3BVWA 3DPOA 4IWOA 3DDFA 4IM3A 5E84A 3FD9A 4PO2A 2YI8A 3DYTA 1I4TA
chains in the Genus database with same CATH topology
3QNIA 2RAJA 4ATMA 1X03A 2Q13A 2Z0NA 3QE6A 1ZWWA 4NQIA 4H8SA 4WPEA 2Z0OA 3HAHA 3PLTA 4AVMA 3HAIA 4WPCA 3QWEA 4FZSA 3HAJA 1I4DA 2EFLA 2X3XA 2YKTA 3G9GA 2FICA 3OK8A 2RAIA 2Q12A 3ACOA 3Q0KA 2ELBA 3I2WA 3Q84A 4AKVA 4DCNC 1Y2OA 2EFKA 1I4LA 4I1QA 2V0OA 4DYLA 3SYVA 3CAZA 2D1LA 3M3WA 2C08A 1I49A 3ABHA 3SOGA 1URUA 1WDZA 2X3WA 2RAKA 5C5BA 1X04A 3LLLA 5C5BB 4BNEA 3DYTA 2D4CA 4NSWA 2X3VA 2Z0VA 1I4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QNI A;  2RAJ A;  4ATM A;  1X03 A;  2Q13 A;  2Z0N A;  3QE6 A;  1ZWW A;  4NQI A;  4H8S A;  4WPE A;  2Z0O A;  3HAH A;  3PLT A;  4AVM A;  3HAI A;  4WPC A;  3QWE A;  4FZS A;  3HAJ A;  1I4D A;  2EFL A;  2X3X A;  2YKT A;  3G9G A;  2FIC A;  3OK8 A;  2RAI A;  2Q12 A;  3ACO A;  3Q0K A;  2ELB A;  3I2W A;  3Q84 A;  4AKV A;  4DCN C;  1Y2O A;  2EFK A;  1I4L A;  4I1Q A;  2V0O A;  4DYL A;  3SYV A;  3CAZ A;  2D1L A;  3M3W A;  2C08 A;  1I49 A;  3ABH A;  3SOG A;  1URU A;  1WDZ A;  2X3W A;  2RAK A;  5C5B A;  1X04 A;  3LLL A;  5C5B B;  4BNE A;  3DYT A;  2D4C A;  4NSW A;  2X3V A;  2Z0V A;  1I4T A; 
#chains in the Genus database with same CATH topology
 4AZC A;  3OWG A;  3PLT A;  2Z8Y A;  3DX4 A;  4WPC A;  4EZT A;  3VKH A;  3ERC C;  3VEA A;  3RV0 A;  3DDG A;  2OBM A;  3D2F A;  3D51 A;  4DYL A;  2FYV A;  1DKZ A;  1HTY A;  2YL5 A;  4IWP A;  2EWF A;  3ABH A;  3ER8 C;  1O7D C;  4H8S A;  4KIK A;  1TQU A;  2ND0 A;  1I4D A;  2EFL A;  1DKX A;  2F7Q A;  4M0M A;  3DX0 A;  3D4Z A;  2QXL A;  2YLA A;  3EJS A;  2WIN M;  4JN4 A;  3LVT A;  4FZO A;  4AZC B;  1E9V A;  2X3X A;  1MJG A;  4F01 A;  2ND1 A;  3EJR A;  2ZXQ A;  3F7W A;  4DCN C;  1I4L A;  4JNE A;  1GNT A;  4AVM A;  5KBP A;  1LQ7 A;  1X04 A;  2PY6 A;  1JQK A;  1ZWW A;  3D2E A;  1OA1 A;  5FIG A;  4KIK B;  1TQT A;  1YWM A;  3Q0K A;  2N3K A;  4EZW A;  2EFK A;  3CZN A;  1QWN A;  2C08 A;  2GAF D;  3T49 A;  4H6I A;  3GI7 A;  2X5C A;  4BNE A;  2X3V A;  3B51 X;  3I04 A;  2PMR A;  4HY9 A;  4IW0 A;  2OW6 A;  1HXK A;  2F1B A;  3D52 A;  4UDX X;  4EZO A;  2YKT A;  1HWW A;  2ELB A;  4H6H A;  2LM0 A;  2YIB A;  3EJT A;  2F7R A;  3QNJ A;  1R5E A;  3CV5 A;  3CAZ A;  4HYB A;  3LLL A;  2YI9 A;  2MI7 A;  1X03 A;  3C7N A;  4EZS A;  2NCZ A;  2WYH A;  4FZS A;  3BVX A;  4JWD A;  4I1Q A;  2RT6 A;  1URU A;  3BUQ A;  1R33 A;  3DX3 A;  4IM0 A;  1QX1 A;  3KAV A;  1SU6 A;  2KHO A;  1OA0 A;  4B9Q A;  1GN9 A;  3L3O M;  3CVR A;  1Y2O A;  2WYI A;  3ER9 B;  2V0O A;  2X3W A;  5C5B A;  4D8J A;  4JL9 A;  2Z0V A;  3BVU A;  3BVT A;  1QWU A;  1UPX A;  5FLE X;  4JWI A;  3I39 X;  3BLB A;  3I2W A;  2YLL A;  4JNF A;  4FZP A;  3B53 X;  4EZP A;  4EZZ A;  3SYV A;  4UDY X;  3KDR A;  4R5L A;  4AZI A;  4HR1 A;  2QKW A;  3T48 A;  2QFF A;  3D50 A;  3O3N B;  4E3C A;  2RAI A;  3ACO A;  1DKY A;  2F18 A;  3DPP A;  3ZED A;  3BUP A;  1R34 A;  1WDZ A;  5C5B B;  3EJP A;  2Q13 A;  4IWQ A;  4JLC A;  4NQI A;  1E2U A;  3BUB A;  1SU8 A;  3BUI A;  3T46 A;  2JNS A;  3BUD A;  4EZY A;  4EZQ A;  2YIV X;  4EZN A;  3KAW A;  3T47 A;  2RAK A;  3T4A G;  4HR1 B;  1GNL A;  3LMF A;  4G6Q A;  3DX1 A;  4ATM A;  2Z0N A;  3QE6 A;  3DX2 A;  3QWE A;  4IM2 A;  4NPH A;  1O7D B;  2OW7 A;  3B52 X;  3EJU A;  1SUF A;  3CZS A;  4AZ7 A;  2YL9 A;  4AZG A;  4F00 A;  4R5I A;  4NSW A;  2GA9 D;  1TQS A;  4AKV A;  2F7P A;  1OAO A;  1SU7 A;  3SOG A;  2D1L A;  2YL6 A;  3D4Y A;  2D4C A;  2YIA A;  4AZH A;  4FM3 A;  2OZN B;  4E81 A;  3RPM A;  4R5J A;  3HAH A;  3HAI A;  4EZU A;  3DPQ A;  3UIT A;  3G9G A;  3Q84 A;  3EJQ A;  1TQW A;  5TKY A;  2YL8 A;  3M3W A;  1I49 A;  4JWE A;  2O0I 1;  4EZR A;  1U00 A;  4AZB A;  4AZ6 A;  3O3M B;  3QNI A;  2OBL A;  4EZV A;  4WPE A;  2Z0O A;  3O3O B;  4EZX A;  3CKD A;  2FIC A;  1ZYL A;  2OO2 A;  1E1D A;  3RV1 A;  2EX3 B;  3OHX M;  2ALW A;  1PS3 A;  2F1A A;  3HAJ A;  2GF4 A;  2F7O A;  3QA8 A;  2LXY A;  1TQV A;  4R5G A;  1W9M A;  3VEB A;  4JWC A;  4AZ5 A;  2RAJ A;  3L3P A;  3A98 A;  3BVV A;  3I01 A;  3OK8 A;  2Q12 A;  2JNK A;  4R5K A;  3BVW A;  3DPO A;  4IWO A;  3DDF A;  4IM3 A;  5E84 A;  3FD9 A;  4PO2 A;  2YI8 A;  3DYT A;  1I4T A; 
#chains in the Genus database with same CATH homology
 3QNI A;  2RAJ A;  4ATM A;  1X03 A;  2Q13 A;  2Z0N A;  3QE6 A;  1ZWW A;  4NQI A;  4H8S A;  4WPE A;  2Z0O A;  3HAH A;  3PLT A;  4AVM A;  3HAI A;  4WPC A;  3QWE A;  4FZS A;  3HAJ A;  1I4D A;  2EFL A;  2X3X A;  2YKT A;  3G9G A;  2FIC A;  3OK8 A;  2RAI A;  2Q12 A;  3ACO A;  3Q0K A;  2ELB A;  3I2W A;  3Q84 A;  4AKV A;  4DCN C;  1Y2O A;  2EFK A;  1I4L A;  4I1Q A;  2V0O A;  4DYL A;  3SYV A;  3CAZ A;  2D1L A;  3M3W A;  2C08 A;  1I49 A;  3ABH A;  3SOG A;  1URU A;  1WDZ A;  2X3W A;  2RAK A;  5C5B A;  1X04 A;  3LLL A;  5C5B B;  4BNE A;  3DYT A;  2D4C A;  4NSW A;  2X3V A;  2Z0V A;  1I4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...