3SOGA

Crystal structure of the bar domain of human amphiphysin, isoform 1
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
200
structure length
197
Chain Sequence
DEQFEEYVQNFKRQEAEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSKDESRISKAEEEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Amphiphysin
source organism Homo sapiens
total genus 87
structure length 197
sequence length 200
ec nomenclature
pdb deposition date 2011-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 3sogA00
2ELBA 3LLLA 2Z0NA 1X04A 4NQIA 2X3XA 3OK8A 1I4LA 1ZWWA 3ACOA 4DYLA 2X3VA 2Q13A 3QNIA 3SOGA 2RAJA 1WDZA 3QE6A 2RAKA 3SYVA 4AVMA 2Z0OA 3ABHA 3DYTA 3HAJA 2YKTA 4DCNC 2D1LA 2Q12A 3Q0KA 1I4TA 4H8SA 4WPCA 2EFKA 3PLTA 1I4DA 1I49A 3I2WA 1Y2OA 2RAIA 5C5BB 4BNEA 3G9GA 4NSWA 3M3WA 4I1QA 2D4CA 4FZSA 3CAZA 1URUA 2V0OA 3Q84A 4AKVA 4ATMA 2EFLA 4WPEA 2FICA 2X3WA 3HAHA 3QWEA 5C5BA 2Z0VA 2C08A 3HAIA 1X03A
chains in the Genus database with same CATH superfamily
2YL8A 3LVTA 4DYLA 3D2EA 3ER9B 4AVMA 3DDFA 4E81A 1MJGA 4EZYA 3ER8C 3VKHA 3RPMA 2D4CA 3C7NA 4EZZA 3BVUA 3HAIA 1X03A 3UITA 4F00A 2F7PA 3ACOA 1HWWA 4R5IA 2X3VA 4PO2A 4JNFA 3DYTA 4EZRA 4AZCA 3T4AG 2GAFD 3I2WA 3DX1A 2RT6A 4EZNA 4E3CA 2YIVX 3Q84A 2JNKA 4JWIA 3D50A 2YI8A 2X3WA 2KHOA 4EZSA 3D2FA 2OBLA 4UDXX 4HY9A 2OW7A 3O3NB 1WDZA 3KAVA 2QFFA 2PY6A 2ND0A 4JWCA 1Y2OA 4AZ6A 3KDRA 2GA9D 4IWOA 4AZHA 3BUPA 1OA1A 3DX2A 2OW6A 1QWNA 4R5KA 3F7WA 3T48A 2Q13A 1ZYLA 1E2UA 2F1AA 1TQTA 1QWUA 3G9GA 3CAZA 1W9MA 2EWFA 3B53X 2F7RA 2YLLA 1I4LA 1TQVA 4HR1B 4AZCB 2FYVA 4AZGA 2N3KA 1LQ7A 4FZSA 1DKZA 3RV0A 5C5BA 2QKWA 3BUIA 1HTYA 4KIKA 2OO2A 3QA8A 4AZ5A 4F01A 3D51A 1E1DA 4BNEA 3D4ZA 4NSWA 4B9QA 2F18A 2WYIA 4ATMA 2MI7A 5E84A 2O0I1 4EZQA 4M0MA 2ELBA 4EZTA 3DX3A 2RAJA 1OAOA 3ABHA 4JNEA 2QXLA 4H8SA 3CZNA 4JN4A 1SU6A 3EJPA 4I1QA 1URUA 4WPEA 2C08A 2LXYA 2F7OA 3LLLA 3CKDA 4IWQA 1TQSA 2PMRA 3ERCC 4JWDA 3O3OB 2ZXQA 2YKTA 4HYBA 4AZ7A 3O3MB 3PLTA 5C5BB 4IM3A 4AKVA 1GNLA 4KIKB 1X04A 3DX4A 1HXKA 4AZBA 3SOGA 3A98A 3QE6A 4UDYX 3L3PA 1UPXA 4IWPA 3GI7A 1I4DA 4R5GA 3LMFA 3EJTA 4EZVA 2Z0NA 3VEBA 3DX0A 2YL5A 3EJQA 2YIBA 4R5JA 2Q12A 4D8JA 4JL9A 4AZIA 5FIGA 3EJRA 4NQIA 3FD9A 1ZWWA 2YI9A 4IM2A 2GF4A 2OBMA 1PS3A 3BLBA 2D1LA 3Q0KA 2EFKA 4EZWA 3L3OM 3OWGA 2RAIA 2Z8YA 4H6HA 1SU7A 1U00A 3OHXM 4JWEA 2Z0VA 2OZNB 3QNIA 3I39X 3KAWA 4NPHA 3RV1A 4FZOA 3CZSA 2EX3B 2F7QA 2X5CA 2WINM 3EJUA 4EZPA 3BVXA 3I01A 5FLEX 1QX1A 1TQWA 1SU8A 1I49A 4EZOA 3M3WA 2V0OA 4EZUA 3D52A 3BVTA 1TQUA 1R34A 3ZEDA 4FM3A 1GNTA 2YL6A 2RAKA 1O7DB 3SYVA 3T46A 3BUDA 2WYHA 4HR1A 3QNJA 1I4TA 1O7DC 3BVWA 3EJSA 4JLCA 2JNSA 2YL9A 3I04A 1R5EA 3BUQA 1JQKA 3B52X 2F1BA 4H6IA 2YIAA 4DCNC 4WPCA 1R33A 1SUFA 3D4YA 4IM0A 2EFLA 3VEAA 4IW0A 3CV5A 2ND1A 5KBPA 2YLAA 3HAJA 4R5LA 4G6QA 1GN9A 3DDGA 1DKXA 3DPOA 2ALWA 3HAHA 2NCZA 2X3XA 3B51X 3OK8A 1OA0A 3CVRA 1E9VA 5TKYA 2LM0A 3T49A 2Z0OA 3T47A 3BVVA 3BUBA 3DPQA 1DKYA 4FZPA 1YWMA 2FICA 3QWEA 3DPPA 4EZXA
chains in the Genus database with same CATH topology
2ELBA 3LLLA 2Z0NA 1X04A 4NQIA 2X3XA 3OK8A 1I4LA 1ZWWA 3ACOA 4DYLA 2X3VA 2Q13A 3QNIA 3SOGA 2RAJA 1WDZA 3QE6A 2RAKA 3SYVA 4AVMA 2Z0OA 3ABHA 3DYTA 3HAJA 2YKTA 4DCNC 2D1LA 2Q12A 3Q0KA 1I4TA 4H8SA 4WPCA 2EFKA 3PLTA 1I4DA 1I49A 3I2WA 1Y2OA 2RAIA 5C5BB 4BNEA 3G9GA 4NSWA 3M3WA 4I1QA 2D4CA 4FZSA 3CAZA 1URUA 2V0OA 3Q84A 4AKVA 4ATMA 2EFLA 4WPEA 2FICA 2X3WA 3HAHA 3QWEA 5C5BA 2Z0VA 2C08A 3HAIA 1X03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELB A;  3LLL A;  2Z0N A;  1X04 A;  4NQI A;  2X3X A;  3OK8 A;  1I4L A;  1ZWW A;  3ACO A;  4DYL A;  2X3V A;  2Q13 A;  3QNI A;  3SOG A;  2RAJ A;  1WDZ A;  3QE6 A;  2RAK A;  3SYV A;  4AVM A;  2Z0O A;  3ABH A;  3DYT A;  3HAJ A;  2YKT A;  4DCN C;  2D1L A;  2Q12 A;  3Q0K A;  1I4T A;  4H8S A;  4WPC A;  2EFK A;  3PLT A;  1I4D A;  1I49 A;  3I2W A;  1Y2O A;  2RAI A;  5C5B B;  4BNE A;  3G9G A;  4NSW A;  3M3W A;  4I1Q A;  2D4C A;  4FZS A;  3CAZ A;  1URU A;  2V0O A;  3Q84 A;  4AKV A;  4ATM A;  2EFL A;  4WPE A;  2FIC A;  2X3W A;  3HAH A;  3QWE A;  5C5B A;  2Z0V A;  2C08 A;  3HAI A;  1X03 A; 
#chains in the Genus database with same CATH topology
 2YL8 A;  3LVT A;  4DYL A;  3D2E A;  3ER9 B;  4AVM A;  3DDF A;  4E81 A;  1MJG A;  4EZY A;  3ER8 C;  3VKH A;  3RPM A;  2D4C A;  3C7N A;  4EZZ A;  3BVU A;  3HAI A;  1X03 A;  3UIT A;  4F00 A;  2F7P A;  3ACO A;  1HWW A;  4R5I A;  2X3V A;  4PO2 A;  4JNF A;  3DYT A;  4EZR A;  4AZC A;  3T4A G;  2GAF D;  3I2W A;  3DX1 A;  2RT6 A;  4EZN A;  4E3C A;  2YIV X;  3Q84 A;  2JNK A;  4JWI A;  3D50 A;  2YI8 A;  2X3W A;  2KHO A;  4EZS A;  3D2F A;  2OBL A;  4UDX X;  4HY9 A;  2OW7 A;  3O3N B;  1WDZ A;  3KAV A;  2QFF A;  2PY6 A;  2ND0 A;  4JWC A;  1Y2O A;  4AZ6 A;  3KDR A;  2GA9 D;  4IWO A;  4AZH A;  3BUP A;  1OA1 A;  3DX2 A;  2OW6 A;  1QWN A;  4R5K A;  3F7W A;  3T48 A;  2Q13 A;  1ZYL A;  1E2U A;  2F1A A;  1TQT A;  1QWU A;  3G9G A;  3CAZ A;  1W9M A;  2EWF A;  3B53 X;  2F7R A;  2YLL A;  1I4L A;  1TQV A;  4HR1 B;  4AZC B;  2FYV A;  4AZG A;  2N3K A;  1LQ7 A;  4FZS A;  1DKZ A;  3RV0 A;  5C5B A;  2QKW A;  3BUI A;  1HTY A;  4KIK A;  2OO2 A;  3QA8 A;  4AZ5 A;  4F01 A;  3D51 A;  1E1D A;  4BNE A;  3D4Z A;  4NSW A;  4B9Q A;  2F18 A;  2WYI A;  4ATM A;  2MI7 A;  5E84 A;  2O0I 1;  4EZQ A;  4M0M A;  2ELB A;  4EZT A;  3DX3 A;  2RAJ A;  1OAO A;  3ABH A;  4JNE A;  2QXL A;  4H8S A;  3CZN A;  4JN4 A;  1SU6 A;  3EJP A;  4I1Q A;  1URU A;  4WPE A;  2C08 A;  2LXY A;  2F7O A;  3LLL A;  3CKD A;  4IWQ A;  1TQS A;  2PMR A;  3ERC C;  4JWD A;  3O3O B;  2ZXQ A;  2YKT A;  4HYB A;  4AZ7 A;  3O3M B;  3PLT A;  5C5B B;  4IM3 A;  4AKV A;  1GNL A;  4KIK B;  1X04 A;  3DX4 A;  1HXK A;  4AZB A;  3SOG A;  3A98 A;  3QE6 A;  4UDY X;  3L3P A;  1UPX A;  4IWP A;  3GI7 A;  1I4D A;  4R5G A;  3LMF A;  3EJT A;  4EZV A;  2Z0N A;  3VEB A;  3DX0 A;  2YL5 A;  3EJQ A;  2YIB A;  4R5J A;  2Q12 A;  4D8J A;  4JL9 A;  4AZI A;  5FIG A;  3EJR A;  4NQI A;  3FD9 A;  1ZWW A;  2YI9 A;  4IM2 A;  2GF4 A;  2OBM A;  1PS3 A;  3BLB A;  2D1L A;  3Q0K A;  2EFK A;  4EZW A;  3L3O M;  3OWG A;  2RAI A;  2Z8Y A;  4H6H A;  1SU7 A;  1U00 A;  3OHX M;  4JWE A;  2Z0V A;  2OZN B;  3QNI A;  3I39 X;  3KAW A;  4NPH A;  3RV1 A;  4FZO A;  3CZS A;  2EX3 B;  2F7Q A;  2X5C A;  2WIN M;  3EJU A;  4EZP A;  3BVX A;  3I01 A;  5FLE X;  1QX1 A;  1TQW A;  1SU8 A;  1I49 A;  4EZO A;  3M3W A;  2V0O A;  4EZU A;  3D52 A;  3BVT A;  1TQU A;  1R34 A;  3ZED A;  4FM3 A;  1GNT A;  2YL6 A;  2RAK A;  1O7D B;  3SYV A;  3T46 A;  3BUD A;  2WYH A;  4HR1 A;  3QNJ A;  1I4T A;  1O7D C;  3BVW A;  3EJS A;  4JLC A;  2JNS A;  2YL9 A;  3I04 A;  1R5E A;  3BUQ A;  1JQK A;  3B52 X;  2F1B A;  4H6I A;  2YIA A;  4DCN C;  4WPC A;  1R33 A;  1SUF A;  3D4Y A;  4IM0 A;  2EFL A;  3VEA A;  4IW0 A;  3CV5 A;  2ND1 A;  5KBP A;  2YLA A;  3HAJ A;  4R5L A;  4G6Q A;  1GN9 A;  3DDG A;  1DKX A;  3DPO A;  2ALW A;  3HAH A;  2NCZ A;  2X3X A;  3B51 X;  3OK8 A;  1OA0 A;  3CVR A;  1E9V A;  5TKY A;  2LM0 A;  3T49 A;  2Z0O A;  3T47 A;  3BVV A;  3BUB A;  3DPQ A;  1DKY A;  4FZP A;  1YWM A;  2FIC A;  3QWE A;  3DPP A;  4EZX A; 
#chains in the Genus database with same CATH homology
 2ELB A;  3LLL A;  2Z0N A;  1X04 A;  4NQI A;  2X3X A;  3OK8 A;  1I4L A;  1ZWW A;  3ACO A;  4DYL A;  2X3V A;  2Q13 A;  3QNI A;  3SOG A;  2RAJ A;  1WDZ A;  3QE6 A;  2RAK A;  3SYV A;  4AVM A;  2Z0O A;  3ABH A;  3DYT A;  3HAJ A;  2YKT A;  4DCN C;  2D1L A;  2Q12 A;  3Q0K A;  1I4T A;  4H8S A;  4WPC A;  2EFK A;  3PLT A;  1I4D A;  1I49 A;  3I2W A;  1Y2O A;  2RAI A;  5C5B B;  4BNE A;  3G9G A;  4NSW A;  3M3W A;  4I1Q A;  2D4C A;  4FZS A;  3CAZ A;  1URU A;  2V0O A;  3Q84 A;  4AKV A;  4ATM A;  2EFL A;  4WPE A;  2FIC A;  2X3W A;  3HAH A;  3QWE A;  5C5B A;  2Z0V A;  2C08 A;  3HAI A;  1X03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...