2FICA

The crystal structure of the bar domain from human bin1/amphiphysin ii and its implications for molecular recognition
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
198
structure length
191
Chain Sequence
EQFEQCVQNFNKQLTEGTRLQKDLRTYLASVKAMHEASKKLNECLQEVYEPDWPGRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPDIKSRIAKRGRKLVDYDSARHHYESLQTKIAKAEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTFQSIAGLEENFHKEMSKLNQNLNDVLVGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis, membrane protein
molecule keywords Myc box-dependent-interacting protein 1
publication title The Crystal Structure of the BAR Domain from Human Bin1/Amphiphysin II and Its Implications for Molecular Recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 191
sequence length 198
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03114 BAR BAR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.60 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Arfaptin homology (AH) domain/BAR domain 2ficA00
3HAIA 4AKVA 3LLLA 2Z0OA 2Z0VA 2YKTA 3HAJA 4DYLA 3ABHA 3G9GA 1WDZA 3SYVA 2Q12A 2D1LA 2ELBA 1X03A 1I49A 4FZSA 1I4TA 5C5BB 3SOGA 2Z0NA 3ACOA 2EFLA 3QE6A 1Y2OA 4NSWA 2RAIA 1X04A 3M3WA 3OK8A 3HAHA 4NQIA 2Q13A 4WPEA 2X3XA 3Q0KA 4AVMA 1URUA 2EFKA 2RAJA 1I4LA 4BNEA 4DCNC 2RAKA 2V0OA 4ATMA 3CAZA 4I1QA 3QNIA 1I4DA 3QWEA 1ZWWA 3I2WA 2C08A 3PLTA 2X3VA 2D4CA 2X3WA 4WPCA 3DYTA 5C5BA 3Q84A 4H8SA 2FICA
chains in the Genus database with same CATH superfamily
1TQSA 3EJUA 2Q12A 1DKYA 3GI7A 2WINM 1X04A 3A98A 3ZEDA 3D4YA 4BNEA 3F7WA 5FLEX 3I2WA 1O7DB 4EZRA 4EZOA 1YWMA 2ELBA 2FYVA 1I4TA 2EFLA 2MI7A 3ER8C 4EZUA 4JWEA 3EJRA 3DDFA 2F7RA 2WYHA 1I4LA 2YIAA 3OHXM 3BUDA 4I1QA 2C08A 2KHOA 1O7DC 3D51A 3EJTA 4AZ6A 3G9GA 4FZSA 4UDYX 4F00A 1Y2OA 4FZPA 4AZBA 1ZYLA 1URUA 2RAJA 3B51X 3QNIA 2ND1A 1E1DA 3PLTA 2D4CA 3BVTA 4R5IA 3DX0A 4H8SA 2O0I1 4HY9A 3T4AG 3D4ZA 4KIKB 1TQWA 3OWGA 2YL8A 2ALWA 3RPMA 3RV0A 1OAOA 2Z8YA 4NQIA 4AVMA 4DCNC 4D8JA 2OBMA 4KIKA 4WPCA 3CZNA 4HR1B 3LMFA 3FD9A 5KBPA 4JWIA 2OZNB 3EJSA 4R5GA 2ND0A 5C5BB 1OA1A 3D2EA 4AZIA 4EZSA 4AZGA 4AZCA 4EZNA 1R33A 1DKXA 4HR1A 2V0OA 4JNFA 4R5LA 2YL5A 3VEAA 4AZ5A 4R5KA 4JNEA 3Q84A 3DX2A 4NPHA 2GA9D 4IM0A 2OBLA 3SYVA 3BUIA 2Z0NA 2RAIA 3KDRA 1GN9A 3HAHA 2JNKA 2F7QA 4JWCA 1HXKA 3CKDA 3DYTA 4E81A 2Z0VA 2QXLA 1QWNA 1X03A 2YIVX 4EZXA 3DPPA 3M3WA 2X3XA 3Q0KA 4IM2A 1GNLA 3O3MB 1E2UA 4ATMA 3L3PA 1LQ7A 2GAFD 2X3VA 2X3WA 4IW0A 2WYIA 4HYBA 2YKTA 3BUBA 2EX3B 1UPXA 4EZPA 1TQTA 1SU8A 5TKYA 3UITA 4B9QA 4FZOA 2YI9A 3HAIA 3EJPA 2F1AA 3ABHA 1SU7A 2GF4A 3ER9B 3D52A 3B53X 2F18A 3DX1A 1W9MA 4IWPA 4H6IA 2LXYA 4F01A 3BUQA 3QWEA 3LLLA 4EZWA 3VKHA 2F1BA 3C7NA 1MJGA 4IWOA 4JLCA 5FIGA 3OK8A 2EWFA 1SUFA 4JWDA 1OA0A 4AZ7A 1TQVA 2NCZA 3BVVA 3B52X 2RAKA 1QWUA 3I04A 3O3NB 1I4DA 2RT6A 1ZWWA 3O3OB 3DPOA 5C5BA 3EJQA 3DDGA 4EZVA 4JN4A 1QX1A 3T46A 1TQUA 4AZHA 3QNJA 2PMRA 1HTYA 2OW6A 4R5JA 3QA8A 5E84A 3CVRA 4DYLA 2YI8A 4AKVA 2Z0OA 1WDZA 2QFFA 1PS3A 2X5CA 1DKZA 2Q13A 4WPEA 3DPQA 3CV5A 2YLAA 4EZYA 3BVXA 3BUPA 2QKWA 2OW7A 2OO2A 3KAWA 3ACOA 3L3OM 4H6HA 3VEBA 3ERCC 2PY6A 3LVTA 3I39X 1JQKA 4EZTA 3QE6A 3KAVA 3DX4A 1I49A 2D1LA 4G6QA 1R34A 2F7OA 4UDXX 3BVWA 4NSWA 2EFKA 3CAZA 2N3KA 3BLBA 1U00A 4FM3A 3CZSA 2ZXQA 3T48A 3SOGA 1SU6A 4E3CA 4PO2A 3D2FA 4IWQA 4AZCB 1R5EA 2JNSA 1E9VA 2FICA 2YIBA 2YL6A 3HAJA 3DX3A 4IM3A 1GNTA 2LM0A 4EZZA 4EZQA 4M0MA 3RV1A 2F7PA 3T49A 3I01A 2YL9A 1HWWA 3BVUA 4JL9A 3D50A 2YLLA 3T47A
chains in the Genus database with same CATH topology
3HAIA 4AKVA 3LLLA 2Z0OA 2Z0VA 2YKTA 3HAJA 4DYLA 3ABHA 3G9GA 1WDZA 3SYVA 2Q12A 2D1LA 2ELBA 1X03A 1I49A 4FZSA 1I4TA 5C5BB 3SOGA 2Z0NA 3ACOA 2EFLA 3QE6A 1Y2OA 4NSWA 2RAIA 1X04A 3M3WA 3OK8A 3HAHA 4NQIA 2Q13A 4WPEA 2X3XA 3Q0KA 4AVMA 1URUA 2EFKA 2RAJA 1I4LA 4BNEA 4DCNC 2RAKA 2V0OA 4ATMA 3CAZA 4I1QA 3QNIA 1I4DA 3QWEA 1ZWWA 3I2WA 2C08A 3PLTA 2X3VA 2D4CA 2X3WA 4WPCA 3DYTA 5C5BA 3Q84A 4H8SA 2FICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HAI A;  4AKV A;  3LLL A;  2Z0O A;  2Z0V A;  2YKT A;  3HAJ A;  4DYL A;  3ABH A;  3G9G A;  1WDZ A;  3SYV A;  2Q12 A;  2D1L A;  2ELB A;  1X03 A;  1I49 A;  4FZS A;  1I4T A;  5C5B B;  3SOG A;  2Z0N A;  3ACO A;  2EFL A;  3QE6 A;  1Y2O A;  4NSW A;  2RAI A;  1X04 A;  3M3W A;  3OK8 A;  3HAH A;  4NQI A;  2Q13 A;  4WPE A;  2X3X A;  3Q0K A;  4AVM A;  1URU A;  2EFK A;  2RAJ A;  1I4L A;  4BNE A;  4DCN C;  2RAK A;  2V0O A;  4ATM A;  3CAZ A;  4I1Q A;  3QNI A;  1I4D A;  3QWE A;  1ZWW A;  3I2W A;  2C08 A;  3PLT A;  2X3V A;  2D4C A;  2X3W A;  4WPC A;  3DYT A;  5C5B A;  3Q84 A;  4H8S A;  2FIC A; 
#chains in the Genus database with same CATH topology
 1TQS A;  3EJU A;  2Q12 A;  1DKY A;  3GI7 A;  2WIN M;  1X04 A;  3A98 A;  3ZED A;  3D4Y A;  4BNE A;  3F7W A;  5FLE X;  3I2W A;  1O7D B;  4EZR A;  4EZO A;  1YWM A;  2ELB A;  2FYV A;  1I4T A;  2EFL A;  2MI7 A;  3ER8 C;  4EZU A;  4JWE A;  3EJR A;  3DDF A;  2F7R A;  2WYH A;  1I4L A;  2YIA A;  3OHX M;  3BUD A;  4I1Q A;  2C08 A;  2KHO A;  1O7D C;  3D51 A;  3EJT A;  4AZ6 A;  3G9G A;  4FZS A;  4UDY X;  4F00 A;  1Y2O A;  4FZP A;  4AZB A;  1ZYL A;  1URU A;  2RAJ A;  3B51 X;  3QNI A;  2ND1 A;  1E1D A;  3PLT A;  2D4C A;  3BVT A;  4R5I A;  3DX0 A;  4H8S A;  2O0I 1;  4HY9 A;  3T4A G;  3D4Z A;  4KIK B;  1TQW A;  3OWG A;  2YL8 A;  2ALW A;  3RPM A;  3RV0 A;  1OAO A;  2Z8Y A;  4NQI A;  4AVM A;  4DCN C;  4D8J A;  2OBM A;  4KIK A;  4WPC A;  3CZN A;  4HR1 B;  3LMF A;  3FD9 A;  5KBP A;  4JWI A;  2OZN B;  3EJS A;  4R5G A;  2ND0 A;  5C5B B;  1OA1 A;  3D2E A;  4AZI A;  4EZS A;  4AZG A;  4AZC A;  4EZN A;  1R33 A;  1DKX A;  4HR1 A;  2V0O A;  4JNF A;  4R5L A;  2YL5 A;  3VEA A;  4AZ5 A;  4R5K A;  4JNE A;  3Q84 A;  3DX2 A;  4NPH A;  2GA9 D;  4IM0 A;  2OBL A;  3SYV A;  3BUI A;  2Z0N A;  2RAI A;  3KDR A;  1GN9 A;  3HAH A;  2JNK A;  2F7Q A;  4JWC A;  1HXK A;  3CKD A;  3DYT A;  4E81 A;  2Z0V A;  2QXL A;  1QWN A;  1X03 A;  2YIV X;  4EZX A;  3DPP A;  3M3W A;  2X3X A;  3Q0K A;  4IM2 A;  1GNL A;  3O3M B;  1E2U A;  4ATM A;  3L3P A;  1LQ7 A;  2GAF D;  2X3V A;  2X3W A;  4IW0 A;  2WYI A;  4HYB A;  2YKT A;  3BUB A;  2EX3 B;  1UPX A;  4EZP A;  1TQT A;  1SU8 A;  5TKY A;  3UIT A;  4B9Q A;  4FZO A;  2YI9 A;  3HAI A;  3EJP A;  2F1A A;  3ABH A;  1SU7 A;  2GF4 A;  3ER9 B;  3D52 A;  3B53 X;  2F18 A;  3DX1 A;  1W9M A;  4IWP A;  4H6I A;  2LXY A;  4F01 A;  3BUQ A;  3QWE A;  3LLL A;  4EZW A;  3VKH A;  2F1B A;  3C7N A;  1MJG A;  4IWO A;  4JLC A;  5FIG A;  3OK8 A;  2EWF A;  1SUF A;  4JWD A;  1OA0 A;  4AZ7 A;  1TQV A;  2NCZ A;  3BVV A;  3B52 X;  2RAK A;  1QWU A;  3I04 A;  3O3N B;  1I4D A;  2RT6 A;  1ZWW A;  3O3O B;  3DPO A;  5C5B A;  3EJQ A;  3DDG A;  4EZV A;  4JN4 A;  1QX1 A;  3T46 A;  1TQU A;  4AZH A;  3QNJ A;  2PMR A;  1HTY A;  2OW6 A;  4R5J A;  3QA8 A;  5E84 A;  3CVR A;  4DYL A;  2YI8 A;  4AKV A;  2Z0O A;  1WDZ A;  2QFF A;  1PS3 A;  2X5C A;  1DKZ A;  2Q13 A;  4WPE A;  3DPQ A;  3CV5 A;  2YLA A;  4EZY A;  3BVX A;  3BUP A;  2QKW A;  2OW7 A;  2OO2 A;  3KAW A;  3ACO A;  3L3O M;  4H6H A;  3VEB A;  3ERC C;  2PY6 A;  3LVT A;  3I39 X;  1JQK A;  4EZT A;  3QE6 A;  3KAV A;  3DX4 A;  1I49 A;  2D1L A;  4G6Q A;  1R34 A;  2F7O A;  4UDX X;  3BVW A;  4NSW A;  2EFK A;  3CAZ A;  2N3K A;  3BLB A;  1U00 A;  4FM3 A;  3CZS A;  2ZXQ A;  3T48 A;  3SOG A;  1SU6 A;  4E3C A;  4PO2 A;  3D2F A;  4IWQ A;  4AZC B;  1R5E A;  2JNS A;  1E9V A;  2FIC A;  2YIB A;  2YL6 A;  3HAJ A;  3DX3 A;  4IM3 A;  1GNT A;  2LM0 A;  4EZZ A;  4EZQ A;  4M0M A;  3RV1 A;  2F7P A;  3T49 A;  3I01 A;  2YL9 A;  1HWW A;  3BVU A;  4JL9 A;  3D50 A;  2YLL A;  3T47 A; 
#chains in the Genus database with same CATH homology
 3HAI A;  4AKV A;  3LLL A;  2Z0O A;  2Z0V A;  2YKT A;  3HAJ A;  4DYL A;  3ABH A;  3G9G A;  1WDZ A;  3SYV A;  2Q12 A;  2D1L A;  2ELB A;  1X03 A;  1I49 A;  4FZS A;  1I4T A;  5C5B B;  3SOG A;  2Z0N A;  3ACO A;  2EFL A;  3QE6 A;  1Y2O A;  4NSW A;  2RAI A;  1X04 A;  3M3W A;  3OK8 A;  3HAH A;  4NQI A;  2Q13 A;  4WPE A;  2X3X A;  3Q0K A;  4AVM A;  1URU A;  2EFK A;  2RAJ A;  1I4L A;  4BNE A;  4DCN C;  2RAK A;  2V0O A;  4ATM A;  3CAZ A;  4I1Q A;  3QNI A;  1I4D A;  3QWE A;  1ZWW A;  3I2W A;  2C08 A;  3PLT A;  2X3V A;  2D4C A;  2X3W A;  4WPC A;  3DYT A;  5C5B A;  3Q84 A;  4H8S A;  2FIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...