3O3OB

(r)-2-hydroxyisocaproyl-coa dehydratase in complex with (r)-2-hydroxyisocaproate
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
375
structure length
375
Chain Sequence
MEAILSKMKEVVENPNAAVKKYKSETGKKAIGCFPVYCPEEIIHAAGMLPVGIWGGQTELDLAKQYFPAFACSIMQSCLEYGLKGAYDELSGVIIPGMCDTLICLGQNWKSAVPHIKYISLVHPQNRKLEAGVKYLISEYKGVKRELEEICGYEIEEAKIHESIEVYNEHRKTMRDFVEVAYKHSNTIKPSIRSLVIKSGFFMRKEEHTELVKDLIAKLNAMPEEVCSGKKVLLTGILADSKDILDILEDNNISVVADDLAQETRQFRTDVPAGDDALERLARQWSNIEGCSLAYDPKKKRGSLIVDEVKKKDIDGVIFCMMKFCDPEEYDYPLVRKDIEDSGIPTLYVEIDQQTQNNEQARTRIQTFAEMMSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords alpha-subunit 2-hydroxyisocaproyl-CoA dehydratase
publication title Structural Basis for Reductive Radical Formation and Electron Recycling in (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
pubmed doi rcsb
source organism Clostridium difficile
total genus 151
structure length 375
sequence length 375
ec nomenclature ec 4.2.1.157: (R)-2-hydroxyisocaproyl-CoA dehydratase.
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06050 HGD-D 2-hydroxyglutaryl-CoA dehydratase, D-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.370 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3o3oB01
3.40.50.11890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3oB02
3.40.50.11900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3oB03
3O3MB 3O3NB 3O3OB
chains in the Genus database with same CATH superfamily
3H7IA 2UUOA 1JZSA 1X6VA 1EK0A 1NBOA 1DOAA 2GHTA 3E0QA 4MTLA 1MQ9A 4X1KB 4KGVA 2VTBB 2QB5A 1P6XA 4MK4A 1P3Y1 1WKVA 2EGGA 4B3SB 4BUCA 1D04A 4D3SA 2CMFA 4F5WA 4JJ6A 3ND7A 1SKUA 3UAYA 3GYBA 4Y8VA 4NQZA 4OL9A 5AKEA 3X3HA 4G8DA 1REQB 3PHHA 4C3UA 4D4IA 3JXEA 2YUTA 1TAQA 1VJTA 1J42A 2GGSA 2Q4BA 2YWJA 3I76A 5AK4A 3UVEA 5KEIA 2X14A 4UUPA 4OTZA 2CDNA 4KR6A 1M2OA 3KQHA 3NALA 1WUYA 2C77A 2ON6A 1FP4A 2X9QA 4BNTA 3GELA 5A7HA 1ZC3A 4GAEA 1G4UR 4QATA 1QHXA 2PDAA 3EDMA 5H02A 2WP8J 4Y2TA 3LT2A 2AJDA 3EDYA 3HCFA 4Q3LA 2ET6A 2VQDA 3FZEA 2R1UA 4KXMA 3BZBA 4LJKA 1JHDA 1KEPA 1PVVA 2QM0A 1IHOA 2YYZA 3RFUA 4OV6B 2FN4A 1PL0A 4GI3A 2F1JA 3BULA 1SVKA 1LZLA 3I5XA 4CL0A 5LB2A 4BO8A 2H17A 2LD4A 3LHKA 4M1SA 5DLQC 1XZLA 3MJRA 3ITDA 3CISA 3BEDA 3DPSA 3LVQE 3QE4A 2RGUA 3LQYA 2WJIA 1Z4PX 1KMCA 2ZWPA 1QFYA 3BCUA 4B33A 1M54A 5JI2E 3TBFA 5I7OA 1BMTA 1VJDA 3WIBA 3U49A 4REQA 3ZE1B 5ITZA 5IKPA 1NOIA 3N6RA 1QF9A 2HCFA 3H0EA 4YWHA 4IMRA 1MJGA 1LV7A 1RKXA 2QRJA 5AKIA 4IJQA 2ONJA 3OUTA 2VSFA 2ZKLA 4JODA 3CJTA 3D4IA 4PEVA 3A14A 3ETGA 4B2LA 2ZLBA 1H8HD 5BW8A 4M9UA 2VOEA 3A11A 4IX9A 4QQKA 3WLLA 1KWGA 4BBZA 4BL5A 1AG9A 4ZYXA 1C7IA 3TOXA 5BYBA 5D3MB 3P26A 3BIJA 2FW9A 3G0CA 4CF7A 1E7WA 1GZ7A 5SYNA 2FWJA 2A35A 2HA4A 3AI3A 3PITA 1BHSA 4G4JA 3IQHX 3TRHA 4QPDA 2AWOA 1F8YA 3AB3A 4MB6A 2VJKA 2C2HA 2QEQA 1KSJA 3EVDA 3Q7PA 4WINA 2RJNA 3WFZA 2HX1A 2J5QA 2VSQA 3R9WA 5I5GA 1F9AA 2QW0X 3DUWA 3LQFA 2VTVA 3N05A 5DSTA 3WMEA 1QRSA 1U2GA 3BD9A 3BIOA 1XC7A 4RO0A 1YRYE 2Y66A 1VL2A 1ZOOA 1G3UA 3NFYA 4FN5A 5IK2A 3ZXIA 3JYPA 5MGNA 2QTVB 5B4VA 3QENA 4RH1A 3DMDA 1NF8A 1NJSA 2I7CA 2C3MA 1HE3A 2LGJA 3O2NA 4YUAA 2AEFA 3RHZA 1YAHA 2I1LA 3HJNA 3LBFA 2W6OA 2HYDA 1SZPA 1KQFA 2IKQA 3UAWA 3PDWA 1GCGA 4PLZA 4X93A 3SQMA 1KFCB 4HH0A 1QHNA 4G97A 1MIHA 2CK3D 1E2KA 3RIHA 4ZYVA 2XPCA 3TKLA 2DR2A 2OCGA 1Y5LA 2Q9BA 1E89A 2AFIE 2FOXA 1LQUA 1SVSA 1XZQA 3QPUA 1IEVA 3M1IA 4CCYA 5IHXA 1TVKA 2CXOA 3O7MA 4A6EA 4DYHA 3I04M 3L43A 5F76A 3D4ZA 4D82A 3V8PA 2EZ8A 3MTDA 1PQWA 3SEAA 1T8UA 1G4HA 2QL7A 1F0NA 3CWQA 3FFXA 3MTEA 1E32A 5EY5B 4EK9A 2I3DA 1E3QA 4QRHA 2ZE6A 5SICE 4HLCA 3P2YA 1F4PA 4EVQA 3C3PA 5J2TA 1ESCA 3K9CA 4CMBA 1AKYA 1GRQA 2GYYA 5JASA 1JR3D 3QKSA 4U7TB 2EL7A 3R24A 1X7YB 1Y4ZA 1GTG1 5EMNA 4LECA 2PX0A 4XUGB 2JCVA 3R0QA 4J0KA 4HFNA 3Q84A 2Q2OA 2Q29A 3TSCA 3PFIA 5L3SB 4D44A 2V0OA 1LW6E 1GAJA 2G4LA 4XFJA 5FPYA 1YA8A 2WHRA 1JQEA 1SHJA 2EDAA 3DBIA 5BOVA 1H3NA 4QU5A 4ZKEA 1M1YA 4EJ0A 1ZK3A 5KC8A 3EVEA 1T8RA 4DBLE 1TW2A 3HCAA 2QD1A 4K9RA 1I6KA 4DIBA 7GPBA 3WK4A 3EBLA 4HBZA 4DLAA 4OQMA 1FJXA 3BH6A 1C9KA 1ZCBA 2D0OB 3GLIB 2XGMA 3PCRB 3CGGA 4Z4QA 3L0PA 2VP5A 4AU1A 4QZVA 2ENUA 3V42A 1K06A 3QLEA 4G8BA 1NTRA 1SCDA 4MVJI 2WWVD 2ICAA 1VHLA 3DONA 2NTVA 3R23A 3CA8A 1R0ZA 5KBYA 2JGDB 4F9GA 1PJRA 2FUKA 4J4TA 5B58T 2C8VA 4LV6A 4FE7A 5BP7A 3MHPA 1ESMA 1G64A 1PGPA 2QT1A 3LHSA 4OKSA 1X94A 2WWHA 4XGNA 5JPIA 1SCIA 3E7DA 3F73A 1OFVA 3ORHA 1M2WA 4AIRA 3QWHA 3DE3X 3BSYA 4G5FA 4WESA 5EIFA 4ZEVA 3EAQA 3DFIA 3TB4A 5TPWA 4G67A 3DAGA 1WOYA 3P1JA 4LHWA 4Q02A 1RBZA 4B48A 4PFSA 3NEAA 5MFZA 3HPQA 2BP7A 2CZQA 4GWKA 3VZBA 1E9VA 2ZB4A 3M3PA 4MS4B 1POWA 4KU4A 5DNUA 4F5EA 5F7XA 4R1MA 1UPCA 5BXYA 4PW0A 4OH7A 2BSXA 4PAQA 2IU0A 1P7WA 1ESZA 4QARA 1P4RA 1T1JA 3SSMA 3FOFC 5IT9A 1NP6A 1QOQB 3QWBA 3O2JA 3LQRA 3Q40A 4U2DA 1VKRA 2ODPA 4YMTA 1I3KA 1JXOA 1QGZA 1E60A 3M1AA 5DULA 5HBGA 3ZI7A 4FB4A 4XVCA 2PGLA 2CLCX 4BVGA 4ZVTA 3CRNA 3PYMA 2ZB7A 2K2WA 3AKEA 4DIKA 2ZBQA 3L8GA 1TVCA 4JR0A 4LHEA 1O89A 1I6LA 3MUOA 2I2AA 3OOWA 4QYIA 3HJBA 4RMHA 2YFQA 4IY1A 1U3DA 1H1TA 1EBBA 4Q4DA 5JFOA 3MGGA 3VDMA 1Z2PX 5JAMA 4R16A 1I10A 1TMGE 1K2WA 4JLVA 2W70A 4FE3A 1E79A 3I9MA 5A03A 3NO4A 1EFPA 3ZGVA 4UTPA 1SUFA 2H0AA 5SYMA 1M8JA 4V02A 1I2BA 2HNKA 3KR0A 5F23A 1DXHA 3UXYA 3AR4A 3L7KA 3WLQA 5E4YA 3QXJA 2B25A 3L07A 4CIWA 2CUZA 2NVWA 1JJ7A 1W88A 3Q10A 1IZ7A 4KO1S 3JALA 5JYEA 4RHXA 4KR3A 2ZRQA 2CXXA 3VMMA 3IODA 2RH9B 1DMRA 4QGGA 5KJ1A 1H2BA 1V71A 5IAJA 2CFTA 3L06A 2JLYA 1KC1A 4LDQA 2BAGA 4IICA 2NU9B 1A27A 3G0BA 3VHQA 1W8IA 3TGWA 1PTKA 3AZPA 1T9CA 2JDID 3K0AB 4YQFA 4EW1A 3K16A 4DV5B 2WI8A 4O02B 4RIIA 3OCXA 1UC4B 2EP5A 5BYJA 5CDHA 5KNBA 5LP6B 4A8TA 2CLMB 5CK4A 3KKMA 2ZYIA 3AFGA 5BNIA 1YDMA 1Z82A 1KJ9A 2C08A 2DUJA 2JFYA 2Q3EA 2REOA 4QU9A 1EJ6A 2J09A 3RODA 5K8TA 5K5EA 1WD5A 1T4CA 2N3ZA 2G36A 5DEOA 3KS9A 2Y2UA 3IA7A 3IPXA 2AHRA 3Q0EA 3WOVA 2VHTA 3H2ZA 4X90A 4LSZA 4Y6PA 1AH2A 3HVUA 2IIQA 3DX0A 1G8JA 2TSYB 5KVQA 4ZXFA 4A03A 4IOMA 4RZ3A 4U3JA 4QYTA 3RYFB 2QD4A 3L77A 4RZ2A 4ERXA 1I5RA 3AF0A 2JNWA 3ELBA 2J87A 3JRNA 4WZBE 2YXLA 1GA4A 3IUNA 3NT2A 1HF3A 1VSQA 1L8AA 4FOTA 4MP3A 3HP7A 5LZ2A 3H17A 3MJEA 3Q15C 4HSEA 4FFWA 4K5QA 2HD4A 4MULA 4DMMA 4HADA 1Q95A 5JZOA 4RNDB 3PXEA 2Q2QA 5BMVB 2HH9A 2ZDQA 3DFZA 3OA0A 1C8LA 2A1UB 1RAIA 4FWBA 3VPSA 2PSFA 3W9BA 3W8FA 2DQ4A 2RGRA 2GLXA 2C8LA 2MSNA 5KKNB 2XLCA 2G6TA 4UVEA 4IGIA 5F33A 2BBTA 2H4YA 1NNSA 4DYLA 1TTQB 1UQRA 2C1ZA 2GAFA 1P45A 1X9GA 2QENA 1OA1A 1B6RA 2QVGA 3DX4A 2RHMA 3R3XA 1RABA 4TMXA 4BNYA 1N6KA 1V5FA 5DYNA 2OFWA 2G4VA 1DAPA 3G0IA 2QTHA 2B1IA 4KE9A 4GZ5A 4DA6A 3IAM1 1QS0A 2WWXA 1LBSA 3PJDA 2O7NA 5YASA 1YUMA 4Q4LA 3OQIA 1Z2CA 3DOOA 1Y98A 1G9SA 5KYVA 2C54A 3OPNA 1HDYA 5AM0A 4I55F 1TUBB 1CRZA 3GGDA 3NETA 3QEKA 2DULA 3T4XA 4P7BA 3TPFA 4D3FA 4OAOA 3OY2A 2GTIA 2JCBA 4UTOA 3GCXA 5HYVA 4OK3A 1VE7A 3SFVA 3HJRA 4KXXA 2AEEA 2ERYA 2ID8A 1JKIA 4R1SA 3U44A 1PIWA 1Z25A 3QBTA 5IM4A 3ANLA 3Q72A 1UBLS 1VYVA 3CQ9A 1IBCA 1O7DB 3B5JA 2VYFA 3FDZA 4LCEA 5BRNA 1PR3A 3KJFA 4P2GA 5EJ9A 2ZJ0A 1ISRA 1L5GB 3BMOB 4GBED 5K3BA 3GAFA 1W76A 3C3KA 3FNQA 3OQBA 4FFMA 3CW8X 3QUCA 3HUUA 2NSDA 5DYTA 4EF5A 3SC2A 3S2EA 4N40A 4N48A 3ICQB 4I1YA 4ENSA 4NV1A 2HPVA 2DYKA 5AOAA 4L0MA 4N5LA 4J16A 2BBWA 1L4BA 3ND6A 4RPJA 2TS1A 1FVFA 3UWDA 2PPVA 4WBXC 1VLMA 3HU1A 3N7TA 1ORDA 5BQ5A 3VPGA 4S12A 1NJ2A 1PDOA 2PT9A 1DQPA 3UHJA 2NZYA 5BVHA 2AEJA 5DLYA 4PF1A 3K9LA 1NZDA 1PZHA 1DO8A 3E18A 4MMXB 5AW8A 2W2LD 1ID8A 4BZZA 3RLFA 1UDAA 1GLGA 3KPVA 3PC8A 3ZQ6A 4I9UA 3ID6C 5T41A 4YH1A 1U5BA 5HQJA 1ISFA 4ZHQB 3OM8A 1FP7A 1XA4A 2ZVQX 3OZEA 1T15A 3VOTA 4JXKA 5IWAB 2DECA 3A1NA 2KW5A 5K3AA 5HPYB 1P29A 4PQGA 3DYTA 2HSWA 1VSTA 2XUJA 2OZLB 3MZ0A 5DX0A 1E3LA 4AJ1A 5JSFA 5KUTA 4LXYA 3SBEA 2R7MA 3E22A 4LCBA 1L7QA 1LTHR 1NNUA 1OYOA 1Q1EA 1XD8A 2CFSA 3NR2A 3PJEA 2Y76A 2ZRMA 4RHCA 1UKBA 4RTNA 2FG7C 4EBBA 4O5OA 4YR9A 2YIAA 4J9UE 4OGWA 3GQVA 2VHEA 3PJGA 1OKKD 3ZE0B 3IIMA 4KWTA 2CHUA 4INPA 4LI0A 3UPDA 5C32A 3AFHA 4XFDA 4ZQGA 1XZEA 3C3MA 3RQIA 2WJHA 1RXIA 4W1PA 4BNIA 3GAAA 4Q1DA 2GQ0A 5HKKD 5CBPB 2JZOA 5JEDA 1Q50A 2CD7A 1F38A 5E1OA 1Z0DA 2H54A 5FP0A 4BB6A 4LE2A 2FRVA 3FLAA 2IYYA 3N2GA 3R6DA 1QHHA 2AOTB 2Q62A 1MO5A 1A04A 3C97A 1FSZA 3E8MA 3FCXA 1XZGA 5FTWA 5ALOA 3NB0A 3ZDYB 1MXHA 4L6IA 4YRIA 5I7FA 2DBRA 3OCZA 2GRJA 3A2LA 1HL3A 3GFPA 1KAHA 1KJJA 2VWGA 2P7HA 4IJUA 4PX2A 4CM5A 2W42A 2XB4A 2XHZA 2NG1A 4HFMA 2Q3FA 4ZEMA 5FT9A 5CYFA 3BX1A 2I4LA 2JCGA 4YHBA 3RSFA 3VC3A 3WLFA 3FOAA 1O95C 3V34A 2O8FA 1PQYA 5HILA 3HSKA 1HURA 1M8FA 3KRTA 4LI3X 3AP3A 1F0PA 1B2LA 3NWJA 1I2DA 5DMXA 4MVJF 2JCYA 3RRJA 4F04A 2G5GX 4W9NC 1CDZA 1VGVA 4ETWA 3QLVA 3FPHA 1DXQA 4IV8A 4GSKA 3NBQA 1ANKA 4LJSA 1VMEA 3E1KA 3IL2A 1ULAA 2QR2A 2E4ZA 3E9RA 3E2IA 3IP8A 4FNAA 2EJVA 4RTOA 1AXEA 4RZIA 1TK3A 2GSWA 2H1RA 3F3MA 4C4OA 2I7DA 1UXJA 1RPJA 2MI7A 4LRXA 3OCVA 4WECA 2PH5A 4LOJA 5T4BA 2EYUA 3LCCA 3GEIA 4L95C 5HJ5A 2X4DA 4HMOA 1AKEA 1KQOA 3F9IA 4KAXA 2GJSA 1XQYA 2OMKA 2ZZKA 3UUGA 1S3GA 2I2BA 2VZEA 5F1OA 3CXUA 1ZD5A 1LFAA 3FE2A 3U80A 2A58A 2F8LA 1YVEI 1TPZA 3QPCA 1JIXA 3TCXB 2NTJA 3B3GA 4FIDA 3ZWMA 3OT4A 2JL1A 1RPTA 1NFFA 2GJ8A 3PFFA 1K8RA 4II7A 1XRPA 3G0HA 2QZSA 4AP9A 1S6YA 3OLXA 3H1TA 4GPD1 4U7DA 4YI5A 2A5DA 2LE0A 2QE7D 3TQRA 5C81A 5JNTA 1S01A 3F47A 2JLXA 4N7JA 1MH9A 4O8ZA 2C4HA 4K2AA 5IEBA 4OHVA 3WDSA 1V1MA 2FR8A 2LW7A 5HM8A 2QRKA 4QJ5A 4OHZA 5KTKA 3S28A 4E1VA 2Y77A 4FYWA 1PQUA 1T8TA 3LXRA 5C8YB 4DW8A 4RF5A 4AQDA 5CFNA 1L3IA 2CSUA 4DAOA 1SUCA 2PSHA 3ONFA 4IZHA 4OCZA 4RC9A 1O08A 5E8RA 5KQGA 1SK9A 4Q15A 1YS1X 2JFUA 3EPPA 1UQTA 2VDWA 3L6EA 3Q2OA 4N41A 1FP2A 3A1WA 1D9ZA 3ESDA 3HVHA 1G20E 2IYTA 1C9EA 3WX0A 1O54A 2RGNC 3ZBQA 2DQZA 1IZYA 1ISGA 1GNTA 2QN8A 4KQXA 2Z2ZA 2Z4SA 4ZU6X 4D3DA 4F96A 3VUEA 3A06A 1GL6A 2PXCA 4IWQA 3FHLA 4JYBA 5ALLA 1GGHA 2HPZA 1M6YA 2WF8A 1M6HA 4B79A 4F4DA 1IN6A 3WL8A 4YI3A 1NW8A 2OE2A 3NBMA 4YBRA 4BNJA 3SSNA 1O03A 1QGYA 2Q1YA 3T38A 1CW2B 1UFKA 3ZCVA 1ZQ9A 1WB4A 1OD6A 2VTKA 3WGYA 4MPRA 4GXTA 5G0TA 2AN5A 3NIGB 3T0GA 5J43A 1SVWA 2IOYA 1NPDA 3VHXA 2GZ1A 3I2JA 4JA2A 4PGFA 1H6CA 4UEOA 2P68A 4JXJA 5TF4A 3LKVA 4AY4A 1N25A 4BE7B 5KMGA 3HY3A 2CGEA 2YOHA 3CLUD 1DV1A 1C30B 1OH5A 2X0KA 4TUYA 5HZGA 3JYOA 1ZZEA 1QQ7A 2R8EA 4I46A 2NO9A 3DB2A 1C1XB 3PXAA 3N1UA 4R4JA 1PP4A 3NYIA 4EEZA 3U3KA 1URUA 3U26A 4BNEA 4C6TB 4CT5A 2PS3A 3EIHA 3T5DA 3N7AA 3DEHA 1G3IA 3B9QA 3IE2A 1X8XA 1M10A 4QAQA 1SQ5A 4OHBA 4ZARA 2XNHA 1SIUA 1ZSVA 1Y1PA 1DRUA 2O5RA 3CSDA 3D6UA 4UM9D 4DQLA 2Y1OA 5JBIA 5ADHA 3WKCA 3KSMA 4IH9A 2ATEA 3DOEA 4RVFA 3EZ9A 4LXQA 1Z6TA 3DBLA 3RLIA 2QU8A 3LBNA 4CCWA 3SE0A 1UOEA 4Q01A 4CUKA 2FWAA 1T4BA 3L3PA 2CNWA 2QD2A 2ONCA 3TNFA 3AXTA 1JQ3A 4TZ6A 1YVDA 1GAXA 2HLPA 3AZOA 4B35A 4N49A 3KKOA 4UCQA 3OM1A 5HWSA 1NR7A 5UKDA 2VNIA 2QUJA 2I54A 2ANBA 2NUPA 5E0KB 3EJSA 4CMKA 1V25A 4LF9B 1P2BA 1QVZA 4U5XA 3KTDA 3EZXA 1RJFA 2BEUA 1CZHA 3AEXA 4RE5A 3DT9A 1XN4A 4JB8A 1TOAA 1WXGA 3PUZA 3NAMA 1U3CA 3LXMA 5DI9A 4ZAYA 2Y92A 4Q1FA 3WQQA 3QFTA 3DP7A 3R8XA 1P2FA 1XXHB 2PBZA 1RRFA 1XMIA 2HBZA 5LP6F 4B81A 4EB0A 1GHTA 1DIRA 1FQOA 1V5GA 1J2JA 4O1HA 4W1SA 2AFVA 2OV2A 1G8HA 4Q7JB 4S2EA 5DM2A 3RUCA 4X64B 1N2JA 1FZTA 5BN3A 3MJHA 1OWPA 1COWD 5IVHA 1UC5B 2ISQA 2A86A 2X5OA 1ZM4A 3BFPA 2H07A 3QEMA 1B3BA 4OB8A 2GZHA 2J9YB 4WY8A 1EFRA 4HDRB 4MKIA 4C88A 3T1HB 1NSTA 4S1VA 5DHPA 1N5LA 1XAIA 1SB9A 4YJ3A 2Q7XA 2EW1A 1FYFA 1MCZA 1QGED 1SAYA 2SICE 3CBGA 1D4AA 4GFDA 1O9GA 3ET4A 4M0DA 5D3KA 1KSHA 4MR9B 5G1PA 2QQEA 3SYNA 2XXBA 1PGNA 4TLBA 5KBPA 2ZROA 1B8VA 3L8FA 4H6HA 3ROEA 4FT4A 4ZRMA 4DWOA 4MUXA 4EY5A 1UPTA 3SX2A 1I4LA 3AUKA 2IXTA 1F06A 3V7UA 4Q7MB 3H97A 1I5OA 4R9UC 2UYYA 3EQZA 1ZI6A 1HE8B 3KQPA 1LI5A 1OHHA 1SHLA 1RZVA 2DWCA 3PQFA 8ABPA 5IAOA 3W79A 1QQ6A 3GGJA 4GXQA 2G80A 1FFCA 4BNDB 3BWEA 1QO0D 2CHFA 2I1QA 4D25A 2XEXA 3UT6A 1ACLA 2BISA 4GMKA 1Y37A 3BUPA 1G41A 1RJ9A 1S2IA 2V6FA 2X3WA 2V3VA 1Z8DA 4D9CA 1FJGB 1E9CA 2J3JA 3AUYA 2AQKA 3LWZA 5K6AC 2V6JA 1PHRA 1JMYA 1QYXA 1E96A 3TX2A 2PR7A 2A8YA 4LHYA 1G5FA 3M5WA 3N07A 1CC1S 4CWAA 1X7HA 1KMHA 2PKXA 1NKTA 5G1OA 5G3ZA 5DTRA 4JBGA 4QOFA 4FN4A 3R44A 3PLTA 3HN6A 4R98A 1DINA 2EZ9A 2P9BA 1VOTA 3KQYA 4DXDA 1UXHA 1KHHA 3PB3A 3G9TA 1NPTO 2FGKA 2JCXA 3C5EA 1R33A 3MBKA 3GLSA 5CT4A 2QKWA 1B8PA 1LUAA 2OGWA 4LF7B 2FG5A 1U8AA 2VZ8A 2RG7A 4BB9A 3M83A 4DZZA 1HTYA 2VS1A 5DNYB 3BHNA 1BW9A 3MS7A 3U7IA 4B75A 1Q7BA 2Q5CA 3DMTC 4BKQA 4YT5A 5H4GA 2CYCA 4HYBA 1ADYA 3ZTYA 3NHUA 1OB5A 3JARB 4FZ5A 2C8JA 3Q0TA 3IQIX 2ZSEA 2CFCA 4TX1A 4PRZA 2R4QA 3E7XA 3K05A 4FBMA 5B1SA 6CHYA 3QPAA 4UHJA 2O06A 3HBFA 3T49A 1VHDA 2V7XA 3M7IA 4CU2A 1HKUA 3A4VA 3IVXA 4YPOA 1VGRA 2QMUA 4QVKA 2BDEA 1P1FA 5ED0A 4CVNA 2Y9MB 4AJNA 4QGHA 2KLHA 2IHZA 2ROQA 3BXOA 4FGJA 4X1IA 5LP6C 3D51A 4JSRA 2GHQA 3TL6A 4X20A 5JHHB 4WKCA 1E59A 3WL4A 1Z0JA 1LRJA 2H2FA 1O5OA 3HNPA 2BHSA 2RGXA 2ZE7A 3HVJA 4HK4A 2AK3A 3JZDA 2YYSA 1NJ5A 3OLZA 3QG5A 1CJMA 4ID3A 4OQXA 4J03A 2JFHA 5H3CA 2PO5A 1UJ6A 1V6AA 3K0EA 4PZUA 4XJVA 4OI0A 4RKQA 4MWEA 5BW4A 3BXEA 4LISA 2FWNA 2JJ2A 1T5HX 1E63A 5HS6A 1YMQA 4D9HA 1T2CA 4ZHQF 1JFSA 3TOZA 4QKQA 4XDZA 4GNKA 2OXIA 3RVKA 1WY5A 3IQFA 5F3DA 3GA5A 3PXCX 3FY4A 3TLBA 4C0XA 4DG9A 5JQGB 2QXLA 4WUVA 2EFHB 5IU6A 3WSWA 2QP9X 1FNNA 1VRCA 2AFHE 1WIWA 2OVBA 3K0FB 4OB6A 5G53C 2G9NA 2EJTA 3ECAA 3JU3A 2ONYA 3K5HA 2CXNA 2IYOA 5G40A 3ZCQA 2DMRA 4Q9IA 1V3UA 5J2TF 3DJFA 4JOCA 2F6RA 1E6WA 1WULS 2WU8A 2Q3JA 3JWEA 4KQHA 5CK5A 5HKLA 4AN4A 1TXGA 4C14A 4C76A 3ZY4A 3FGZA 3S8MA 2ZXQA 1NVXQ 4DN6A 5AP9A 1BN6A 5KINB 2BYTA 3OKCA 1FUEA 1JHXA 4IBOA 4IDNA 5H1YA 5CIQA 1G7TA 1F20A 4O4HB 4URZR 3ZJYA 1WLYA 4QDJA 3UT5B 3KQLA 1DT3A 1NR1A 2RGAA 4J76A 4TPKA 1KBZA 3RF7A 1E1NA 1Z68A 3FETA 4PFKA 1EK2A 1JIQA 2IDMA 5GQSA 1RKQA 2OP1A 1BXKA 1TAHA 4U2KA 2EKPA 2N3KA 5AKHA 3WKAA 2BEKA 3TSZA 4TN5A 4GOKA 2RGCA 5ALHA 3MCAA 1CQZA 4M1EA 5CCDA 3TVTA 2Q0QA 4TWRA 5CU7A 2FSVC 3ORRA 1LDEA 5TPZD 5J59A 2RAIA 3K31A 2HCBA 2JFFA 1O9HA 3FYSA 1NF9A 3VAAA 4QNMA 5JARA 4HEHA 3CB2A 3K20A 3WS7A 1RQGA 3JRWA 5TARA 4B3JA 4YPVA 1Y8ZA 1S2NA 3RSSA 1TU4A 5AHWA 5KI6A 1KK1A 2NV6A 3PDCA 4M98A 4PO8A 4R5JA 1LWOA 1W5BA 4PTZA 1BH2A 2FPMA 1OLSB 2OFXA 1O7DC 1RYFA 4PYLA 2JPDA 5DKFA 3UEOA 1I1QB 2F1OA 7REQB 5FXMA 5K4GA 1EESA 4QGAA 2E49A 2P0EA 3D8HA 4EKYA 1DELA 3UJ7A 1KDRA 1HX7A 1UODA 1HOXA 5D01A 1KDYA 3RHTA 3WBJA 4E32A 3AVWA 2HJVA 2L18A 2WMYA 1YOBA 3AJEA 3BG5A 1KO1A 3N2YA 4GQAA 1SXJB 5EKTA 4DPMA 1CNFA 3FPJA 1P73A 3TZCA 3ZS9A 2VWPA 1P9WA 3A9SA 3O8OA 3BTOA 2IHJA 4MR7A 3W4IA 3WZLA 3L6UA 5CLHA 4BCDA 1XOIA 2VDQB 5REQA 2PQ0A 1B8NA 2BMJA 4Z1MA 1EDZA 4RORA 3QI7A 1C0LA 2H7XA 1HC7A 3R3JA 3T3DA 1W85A 2DOKA 5JXGA 1WRBA 2JFWA 2VBFA 3FJ1A 4H15A 1GARA 3IVCA 3OC0A 5K05A 3VH1A 1M76A 4HCJA 4EHBA 1AKQA 2UXCB 2BFDA 5DW3A 4IMIB 2ZWAA 2O05A 2AXNA 4OO3A 3RTAA 4X8LA 3DX1A 2ZCUA 4NCIA 4BRWA 1UEIA 4MZDA 4RHYA 4JD5A 5IFLA 1PX0A 3D31A 1A8HA 3HI4A 4JL6A 4O4IB 4MRPA 2B5VA 4FIZA 2JAWA 4R3WA 4KWIA 3C4JA 2WM8A 4PE5B 2RAUA 1ZESA 3N6XA 4UNIA 4MP6A 3VYSB 1E7YA 2N75A 1RBQA 4C0BA 2I9PA 1E7QA 2ZG6A 4LF4B 4GKVA 3CNEA 4RLFA 4XSVA 1ZX1A 2I67A 5BQPA 4D81A 1CUJA 2PWPA 4QJ4A 5GZ6A 3GJXC 4RKRA 3V7NA 4Z49A 4NJEB 3W3AD 3ORSA 3PDJA 3EOZA 3D8TA 3GLFB 2P5SA 3OF3A 1XBTA 1VE9A 2FP4A 1HQDA 3P0HA 1V1RB 4JLPA 1DAGA 4JMLA 3C6XA 5BO5A 3T35A 3K0HA 4EH1A 4O2BA 2DHDA 3MILA 3DDZX 5CDGA 1BJRE 1LSSA 2NAFA 3N5CA 3QVGA 4N65A 3EMDA 5CFOA 4FEYA 3WP0A 1GP2A 2D1RA 4OYYA 2ZZNA 4PIPA 2IX3A 3OX2A 1S89A 3HFRA 1QVWA 2IEAA 4MVJP 3ESCA 4U2GA 4YCMA 5JJBA 4OHYA 4U2EA 3BMCB 2H1WA 1TT5A 2UZ1B 1EFKA 2P9QA 1UJ2A 4G9EA 3IV9A 1PZEA 3AESA 3EJPA 2NVUA 2YOFA 1PLJA 1FNSA 4TTPA 3G6WA 3UMSA 5LD2B 5A5GA 1YFZA 2A3RA 2ZJ2A 3NOQA 4ITRC 3FM9A 2WW8A 3QX8A 3GFQA 4PLPA 5E6UB 1BCRA 3ZV6A 4Z4CA 2LTAA 1DJLA 3PTLA 4Q12A 1KVQA 3EOAI 1GD1O 2Z0MA 1U7HA 4HDQB 1XZAA 4EFLA 5JSHA 1KDZA 2PFKA 2XMZA 3V1NA 3GFBA 3W6PA 1JHAA 2OHOA 3KXIA 3JCZA 4O2AA 3DD1A 3AQ4A 4AWXA 4ZKDA 4MHTA 1SURA 5BQXA 3A05A 5TRTA 4PC6A 1ZUIA 3EN0A 2HCTA 3O0DA 3WB0A 4W5QA 2G1PA 2H5LA 2H4WA 3VA7A 1JJAA 1GFIA 5K0JA 4WQMA 2FCAA 3NDRA 5CCBA 3STUA 3PLAE 4HAOA 1DIBA 1GZHB 4UTZA 2OECA 5E4JA 1THMA 4PAWA 2J3IA 1JEQA 1Q0TA 1SEPA 3T48A 1VLLA 2V7BA 3EWNA 2FZ5A 3DFMA 1NUUA 4MJ7A 1E1RD 2NX2A 4BJ3A 4GL4A 4DCCA 4F7DA 5JNWA 4FWTA 3THXA 2YHBA 1GR1A 1E3JA 1TUGA 1Z5ZA 2QAGB 4FCWA 3HJAA 4JKIA 3M4ZA 4DOMA 5KYNA 4B3RB 1W47A 2X8BA 5BVGA 4ATMA 1BN7A 4WOBA 4ZOQI 1XDBA 5IAAA 5JTUA 4RYLA 2FQQA 1C1DA 2QLNA 2ZUSA 3DFFA 1LRLA 4B09A 1BXGB 1EM6A 1ECCA 1KMMA 2QRGA 4OMDA 4K9QA 3AG6A 4NYJR 4W7HA 1JLLA 1PWXA 3IV7A 4G41A 5FUWA 5JDCA 2JLBA 4US1R 1QLJA 4D9JA 3EW9A 3UUWA 3I45A 1H0SA 4YMWA 3ZDRA 1EX6A 4OMFG 2BF7A 3ASZA 3NIBA 5I9SA 3D8UA 4MPDA 3E7FA 4UAUA 3C7NA 5IM4F 3ZNOA 2WSSD 4LYJA 4F6CA 4YJ2A 4DR5B 4HATA 1FBTA 3PDHA 4L3VA 4M36A 1UBGA 5EE9A 5A1JA 4MVJE 5B2ZA 5FO0A 4Q7LA 3Q3HA 2IYUA 3SYKA 1TD1A 1F6WA 2CVZA 2HSEA 3PZBA 5EXSA 2R7KA 5K2MA 5EXTA 3ROGA 1G7SA 3RRBA 3HKCB 1YACA 3ER9A 2Z98A 1J8YF 3G49A 1CUYA 4EG5A 1L1RA 1TM7E 4R0NA 5JVDA 2RK3A 3UH0A 1ZCAA 4TTJA 3H5WA 3SAJA 5TGDA 1I0ZA 1E2EA 2DETA 1RLUA 3TIVA 5F4BA 4AJJA 4C5CA 2WMNB 3OETA 1MAWA 2V96A 3I37X 2ECKA 1J9EA 1USIA 1GGEA 4REOA 4RCZA 4GOND 2VCEA 3OSZA 4HRXA 1XCBA 2WVAA 4M8NE 3VI4B 4AQ7A 1X13A 1VC2A 3TGPA 4ZZ0A 2VR1A 4IWOA 2Y9PB 3OEYA 1YVUA 1E1LA 1KEUA 3KE8A 3W1WA 4BX2A 2CCGA 1QE0A 1RVDA 3DKIA 3KOOA 1SVOA 2QUIA 3USES 1RKBA 4EM6A 2ZCJA 1V3TA 3O3MB 3FCAA 1XMPA 2BJVA 4R1UA 3KZVA 4CM9D 4BQFA 1O97D 4FFBB 1N1DA 1TK2A 2R65A 4ZD6A 3TDNA 3TEFA 4JWDA 1I24A 4RY0A 5AI8A 1Y3BE 5AKZA 4NSNA 4QNNA 1H0HA 1VE1A 1VYUA 5DV9A 3MOIA 1VG9B 3VR3D 4L5YA 2QUZA 3CRRA 1N9ZA 1P1HA 2A5LA 4LQDA 2JLCA 5HZMA 4HS4A 3DW1X 3WMWA 1OXTA 1WDKA 1X2EA 3SYLA 4BZPA 4I4TB 1W4BA 2X9GA 5IAEA 3ZVNA 4IP0A 1EE1A 1WKCA 3B2QA 3O2SB 3TMAA 4DA0A 4F06A 4N5NA 3ANTA 5DZSA 5BUQA 1YDHA 2C95A 3RG2A 1JVNA 2JKYA 1NW5A 2OHXA 1PKXA 3DKRA 5L40A 4EZNA 1DAKA 2A88A 2QR5A 5THKA 3OZRA 3DYVA 3SC3A 5I4IA 1RBYA 1WTCA 2V6BA 4HGYA 5FWXA 2WLTA 4RQBA 2CVHA 2XUFA 1FTSA 3BSSA 3NTQA 3QTLA 2FETA 1WV1A 3KXDA 3WIDA 1W2WB 3FLBA 2KB0A 1TO6A 2REQB 3OWOA 3ROXA 5I8PA 5AW9A 3TOSA 3UK7A 5KSZA 3ISTA 1TQHA 2ZPTX 3IOEA 1R9MA 2GCIA 3ZWQA 1A9XA 1KPIA 4IJMA 2XCTB 2O8VA 3ISJA 3TSAA 3QQPA 3QBEA 3TLGB 1LBEA 3GFVA 3OKFA 4B85A 3EPLA 3BVWA 2JAQA 4KFUA 4FC6A 4RSMA 2O59A 2A67A 4YCSA 1LNQA 3NVKI 4P4TA 2X41A 2FCRA 4GMDA 1U7UA 1FMFA 1KY4A 2I3AA 3BE6A 2GF0A 3HB9A 4R83A 3QXSA 1ESDA 4LTDA 2OK8A 4BFTA 1U94A 3GLHE 4DIOA 1G6KA 5KWVA 2O7VA 4J9VA 4B1FA 4GICA 5LC1A 3EPHA 1DBRA 1D7AA 4K0KB 2C3PA 1C7EA 1T0HB 2VRBA 1E5DA 4GHWA 3PJRA 2B8EA 4XQGA 4A23A 4CIXA 1KI2A 5H80A 3CS3A 2ZBEA 2R3SA 3INGA 4AZCA 4LXXA 2HJGA 1W0KD 2ZBFA 4PGHA 3G02A 1M73E 4JLJA 3WGGA 5JQGF 1DXOA 3ETDA 4MW2A 4BAZA 4HAYA 1T2EA 4HVLA 4XQEA 2QMOA 3DZ8A 3NGLA 5I4CA 2I2CA 2IZOA 4US2R 4DR6B 5DM60 5LSAA 4KYVA 1Q0SA 4RPGA 2HF7A 3ROQA 1C0IA 3PEEA 1N8TA 1JEEA 1KI8A 4BVFA 5C2JB 5EKDA 4P1ZA 2W6ZA 4ZP1A 1D6JA 3SI7A 3OFND 1NVVR 2GVZC 1NUQA 4BQIA 5JRZA 3KETA 4J0JA 1Y63A 5FUVA 4EHAA 5A1TA 3W9SA 1HL7A 4Y6RA 2FFBA 4A1FA 3JYLA 4Y2QA 3BMQA 3KG2A 4O4HF 2HXYA 4MROA 3EZNA 4LNAA 4LPSA 3GRYA 2AWNA 4OBEA 5EWJB 5TKYA 4UAVA 3UBMA 1BFKA 4UPEA 3H8WA 2PWAA 2NXJA 1CE8B 2Y0EA 1JI0A 5LYYA 3S5JA 4XWYA 4F93B 4F3NA 3SQLA 4AJPA 1ZNWA 4E14A 2F4VB 5AVZA 1U1GA 2QTBA 4RHTA 2NO6A 2FVYA 4IVNA 1EVEA 2C57A 1VLHA 2DXIA 2CHQA 1O94D 3RU7A 1K7YA 3V46A 5KTNA 3EGVA 1U8EA 2W2TA 2FSSA 3TZQA 1WDLA 3I42A 3I6YA 4BXOA 1KYIA 2D2FA 3UAXA 5KSOA 2XVYA 1PT6A 4RVNA 3KD2A 1Q7CA 4W6QA 5L9AA 1TA9A 2VJMA 4BNWA 4D41A 5KNDD 1X80B 3OUUA 4L51A 1NVEA 4EW3A 3WFJA 3ZW9A 2HIHA 2AK2A 4X71A 4KPEC 4KYTA 2HLDA 2JIBA 1RFLA 3IT2A 1IZ9A 4OREX 4U9UA 1KEWA 1DKMA 4DSTA 5TMPA 3HKEB 1E7RA 1R4NB 1QH0A 3SXPA 3UGJA 3A6EA 1TQTA 3VTAA 4KDRA 1W49A 4JEHA 4DJTA 3FNFA 5J4YA 4OBWA 4QULA 5EXEA 5JALA 3SG0A 3FTEA 2HR1A 4JWCA 2DM6A 2XW6A 1IY0A 2R8XA 3OE1A 3ED5A 2JGIA 3BCSA 3F3KA 3C1OA 1F2UB 4ZT5A 5HF5A 2XRZA 2E1PA 5TQ2B 2X0EA 3L4BC 5GM2A 2QQ0A 4G0OA 3K6KA 4DV0B 3QLVC 2DHQA 3BUSA 2XNJA 4XOIA 5F64A 3T7IA 2WB4A 5CEFA 5LQNA 4D4JA 1DKOA 1DPGA 2P27A 4TLMB 5LXTA 4JWEA 4DMFA 3MM4A 5HHTA 3NHKA 3FPFA 1W59A 4RGYA 1LK0A 1JILA 4BNLA 5DI3B 4Z3DA 2UVPB 2ZI7A 4D0RA 3GHYA 1MAAA 4YXWD 3RVDA 2VF4X 5BOSA 2BGUA 3BDVA 1B7GO 3K73O 1DE0A 3KSDO 4KIKA 1J90A 5AVYA 4KFSA 3H6KA 1TLLA 1O96A 2YOGA 3LWBA 5AJZA 4DCJA 1W19A 1UMBB 3OX4A 1C3LA 1KMIY 4MHSA 3ZBUA 5ESWA 1G66A 4WKNA 1N7IA 4EA9A 2UZ3A 3OTQA 2O5CA 1VPTA 3FBWA 1T6ZA 4O4IF 2X86A 2ZS9A 3DMFA 3JASB 3NTVA 3OC6A 3OWHA 5H70A 4B6JA 4DJ5X 2WQ6A 1QVRA 1VJCA 3ZQUA 4C0AC 1Z0AA 1C4XA 1G55A 2WJYA 2YV1A 3F5SA 4KAAA 2GXAA 1T3SA 4BYGA 4JL9A 4QO7A 3OE7A 4IG9A 2RC5A 3SHVA 5CFPA 2PH7A 1UEJA 3GUUA 2IXBA 1ZSNA 2F67A 3WGLA 1Z63A 3EPJA 2GDZA 2BL4A 1T6NA 1U0GA 1U8YA 4JC0A 1V5EA 4Q3NA 5C1DA 2GF2A 3LXXA 3REOA 3MAJA 3PHJA 3FWPA 1KDOA 1VPEA 3W6ZA 2FR8C 5AKLA 5IJ9B 5EJAA 1YR9A 1DQNA 1H4TA 3V4OA 3ZU4A 2PLRA 4QHYA 2BZ0A 4EHFA 4IOLA 1W96A 1IRXA 2GEKA 5ABPA 3UK0A 1N9GA 2C5SA 2JJ1A 3E3OA 4AF6A 3AETB 1LPAB 4COKA 5BT8A 1IM8A 1YJ8A 4K9PA 4LE1A 4N0EA 2OHVA 1H05A 4QTZA 4E5VA 1HY3A 4A8JB 4YRNA 2EZ4A 1OX4B 2WU1A 5JJ5A 4L8YA 3O4JA 1Z6ZA 1FX0B 4B73A 2YASA 5CMLA 1BWRA 3WO1A 4B5KA 3LGSA 1RIIA 1V41E 5LA6A 3BXXA 3C1TA 3OO0A 2QRQA 4IIUA 2PMDA 3QBJA 5KOHA 1OIWA 2XLBA 4Y2HA 5A4IS 3QJ5A 2DPLA 1TQ2A 3JVIA 3OZCA 4LMPA 4ZDKA 4MGEA 3O4FA 3RM3A 2JGFA 1L4YA 3RKUA 1T3TA 4WY5A 5CT6A 1N2ZA 2IGBA 1IXRC 2C9OA 2HIGA 2IS4A 2MSKA 1Z5UA 4P08A 2Z6VA 3AX6A 3FRHA 3W9UA 4URYR 1JJVA 3RRYA 4CLOA 1W0JD 4WFJA 2IS6A 3AYXB 2G8NA 4KO8A 5J23A 4BVLA 2WPDA 3I12A 5F2OA 3U1BA 1SHUX 2E48A 3SOPA 4GVPA 5CH3A 5AK3A 1XNQB 4HWGA 2XMSA 3BHIA 3I23A 3PPXA 4Y9UA 3LDUA 3UJCA 3AJDA 5F2EA 1CY1A 1HT1E 2KS6A 3HCNA 4X9XA 1SXJC 3DULA 1U2QA 3HCDA 5FBHA 1WBDA 4JLCA 3WYEA 3EBOA 1Q3KA 1R6XA 2ES4A 2GILA 3ZS8A 3IMKA 2A3NA 2YJTD 1KJIA 3HXLA 5G4KA 4YRKA 1ICEA 4RMGA 1A96A 5AVVA 4CMAA 4EJ2A 1CFZA 2MHCA 1M1YE 1Z2EA 3A31A 1E20A 3HP4A 1U8UA 5DXFA 1WKBA 2VH5R 1Q6ZA 1U0LA 1W1UA 2O52A 3JD3A 5DNDA 3RNOA 4KE6A 5FFFA 3HY6A 3D5QA 3SZUA 5KPDA 1P7ZA 1TA4A 2Q6KA 1BVRA 1CJKC 4PZPA 2REBA 1C2YA 2ACEA 3ESXA 1GG2A 5KVVA 3TSYA 1BVUA 5ALRA 2HO4A 2FJPA 3PP8A 1L5FA 2BKAA 4L15A 1WMDA 2EF1A 1Z17A 5TT1A 2AR7A 1R6AA 2QJRA 2SKDA 3KOYA 3JAMA 4HRVA 3VKHA 4D7AA 4GOMD 3P45A 4IM0A 4BN5A 4P92A 3KQQA 3F7TA 2BRUA 3P0JA 2YJ4A 4I8DA 5EHXA 1JZQA 2O2EA 3ONEA 1LW7A 1B74A 3GLKA 2O57A 3EOBI 3GL9A 4DC9A 3TLEA 4Q4AA 5JY6A 1F9EA 4D9MA 3ZXXA 3IBGA 3VSAA 1MGOA 1GTMA 1KO8A 3N7UA 1P39A 3G2JA 4G3XA 4HYEA 4MO2A 5ADUS 2A0XA 1L7MA 4Q9AA 1Q2XA 3T8YA 1V8ZA 3H04A 3QVUA 4WI1A 1OBFO 4EGCB 1MPXA 4Q3EA 2TMGA 5KYGA 3K1TA 1CUAA 1RLIA 3ACCA 5DWDA 3RAJA 1EVYA 5DTMA 1JT9A 4XM0A 3R4VA 5M29A 3CEAA 4EPWA 4NG5A 2ECPA 2I4NA 3BZUA 1PNQA 1HT2E 2J07A 3QNMA 3SYRA 3PDUA 3WG9A 4ILKA 3OZIA 2ORYA 2B6NA 2ZBPA 3FPLA 5GZ1A 2WQ7A 4RKEA 4DB4A 5LD2C 5FTNA 2ZRKA 5AVUA 2Z2JA 3DE0X 3ITKA 3TRDA 1WMFA 4XTRA 1SA0A 2NN3C 1J33A 3VPCA 2HREA 2VKQA 1QIHA 4AWAA 5EXPA 4DYVA 5K8VA 1I7NA 3ACBA 3DEJA 1XG5A 3AEKA 3L4JA 4P0QB 1JKXA 3LRPA 3PT9A 2YMQA 3EVGA 3PKZA 2HDNB 4YCNA 3MYYA 2AGVA 4S1NA 1RPZA 2OWDA 2ZIXA 1YB7A 1QV9A 2BONA 2WWRA 2XDWA 4XOUA 1LNZA 4LDZA 4YRRA 4ZICA 2OORA 2H16A 2G08A 2QM8A 3N59A 5DLPA 5GMOA 5JDIC 3EISA 1AGNA 1KDVA 2J7PA 4I4TF 4E5SA 1L7DA 3LQQA 4HQ6A 4BV2A 4MIOA 4QA9A 1ZJJA 1EX7A 3K72B 1GIAA 1Y5MA 2J46A 4OFZA 4RABA 4DV4B 3VISA 4NI5A 4UEKA 4PSCA 2ZR9A 4EHKA 2V45A 2QAGC 3MJFA 3G3EA 4F4HA 3VKFA 1RQPA 3ORQA 4NEHB 4KSCA 1R0BA 5JH7A 3LU1A 3IYLW 2G9QA 4MV0A 5CRIA 5CT8A 1MO4A 2HK8A 2VAWA 2B7BA 3HB1A 1DX6A 3EG9A 2G09A 1T0PA 3FHOA 3HBNA 1Q20A 1MJFA 4YJHA 4QLOA 1T8WA 2R97A 4MINA 3RTCA 1CY6A 5IF9A 3L7OA 3X1ZA 4OQ4A 1KFJB 3J7TA 1E2MA 3E05A 4JBHA 1NQTA 4ZI2A 4ZAZA 2WDZA 4ZCPA 3U61B 1LPBB 1QDLB 1YKSA 1L2TA 1XEAA 1Z74A 2ZK7A 4KQJA 3W77A 4BNHA 3JZIA 3T41A 421PA 2Q4RA 4C4ZA 4U8GA 4CN8A 4YP9A 3KU1A 3SXUA 5JSUA 2W2XA 1FQKA 3DAPA 3PF8A 3MSCA 4X5OA 1M2EA 3EXHA 5CB0A 1P0IA 4IGKA 5ILQA 4EYEA 2PUJA 4A0RA 3BQ9A 4P86A 1CJTC 1K7SN 1MAVA 3BXZA 2XMGA 4IDCA 1GGJA 4LCJA 3AHCA 4DCTA 2DH6A 2QN3A 4FMDB 2IP1A 2V8OA 3O9MA 1GQYA 2PX4A 1ZRMA 1P62B 1YTLA 3OEWA 4L4RA 4F85A 2FEPA 4S1PA 4CF4A 2IF2A 2W6ID 2Q1TA 4GMHA 4YN3A 4RIHA 2XCOA 2GN9A 4HRAA 4V2UA 2FX2A 1ZK1A 3A10A 2RIPA 3HCCA 3KHTA 3ZQJA 2IXGA 5BY2A 2QTNA 5I7EA 4CIVA 1BVHA 1YZNA 2AZDA 2EKLA 3SDSA 3HJHA 2J0EA 1MQ8B 2W6QA 4NC9A 1RVV1 2XHEA 5ALUA 1Y9JA 4UD2A 4PR3A 3RARA 2AL7A 1FTYA 1L1EA 1T5OA 2OQIA 1BKYA 2UVDA 2V98A 4N3CA 1RWXA 1SJ9A 2UVQA 4FMBB 2YQ4A 2OXRA 1I7PA 4K6GA 4CLEA 4OOEA 4ISCA 1J5XA 3KJIA 3GUVA 1ECGA 4KIKB 5C5BA 3JAKB 3VR2A 1CY2A 2YVUA 3H4TA 4HH3C 2G1UA 3LW8A 3IXMA 3LHDA 1NUHA 1GXSB 5DIZA 1OXSC 5ALJA 3U4DA 1LQ7A 1N6HA 1WXXA 1B8OA 3SS8A 1FDUA 4XVRA 3IP7A 2EV9A 2IYWA 3DZFA 3O4RA 3W3AH 3N75A 5AVTA 3C6QA 3TSOA 1ZM7A 4BO5A 4EUFA 3TB6A 4HYQA 4B9EA 2P0YA 1NG9A 3MEQA 1R5JA 2OUIA 2VDPB 1FYXA 3RVRA 2WHXA 2MR6A 1TCCA 3RWMB 3ZD8A 3LUPA 3QOWA 4FSHA 1ZA1A 4UDOA 2B4KA 2E6UX 1KK2A 1KKLA 2VSOA 2XRYA 1XFDA 4C7MA 2ZKIA 4O4LB 1OGJA 2YJ6A 3EFEA 3N86A 1LLQA 3SYMA 5LQRA 3VNVA 2BFNA 4LJYA 4TKUB 4UZSA 5CEEA 5L51A 4KXNA 3GMSA 1T3HA 4AKIA 1GILA 5FOVA 3IKTA 3AJ9A 4L02A 2AKEA 3K53A 3BXFA 1ZISA 2PKWA 4F12A 2YX1A 3DV2A 3KQVA 1B3RA 3VV3A 2B8NA 4BGUA 3KYDB 1W7AA 4LTMA 2YNMA 5A6SA 1THTA 2NZ2A 4ZI5A 4EUHA 2PGAA 4AB1A 1TLTA 1OLXA 4JVMA 4R3UC 4QM7A 5EGNA 1KE2A 3H2SA 4HAUA 5ITVA 2P4UA 4S3MA 5DHRA 3LYUA 3MB5A 5BYAA 4L7VA 4QFDA 2X8JB 5BN1A 1OIXA 1XRLA 4Y2GA 1JAZA 2ZSAA 3FMVA 4JJAA 1PJQA 1RFGE 2JIMA 3I9KA 4PHHA 3CH4B 2JHFA 5L7YA 1WCWA 4OH1A 3D1VA 1ZJ5A 5KYKA 1SUBA 2WHYA 4UBKA 3GQBA 4I1UA 2O2GA 2CXQA 2FPKA 1V9LA 1HYQA 2XADA 3R5HA 5DBHX 3T1NA 4DJEC 2AMYA 4H4DA 4O2AF 3UYKA 3JTMA 3GFGA 1SBYA 3FN4A 4WKOA 1YA4A 2O23A 1IPHA 3NKLA 3S55A 4DLYA 2E2WA 1QRTA 4FU0A 3U9LA 4JN4A 1ZIOA 2ZATA 2V54A 1PS3A 1V11A 1RCTE 1XMXA 3QXHA 4OQYA 4JYAB 4GZ3A 4O6VA 3L8YA 2GMWA 5C3MA 1Q84A 2VP3A 1QF7A 1L5MA 1PNOA 2OGTA 3MBOA 2VUHB 4JP5A 1MOZA 4MKZA 1BIFA 1U7OA 3I6MA 3PK0A 1BDJA 4CLRB 3CZCA 4HUTA 2ID9A 2GFQA 3OESA 4W5WA 3SQNA 4LZOA 3WRWA 1ZQ1A 2AA3A 4GLBA 4ZAGA 5BURA 4K1LA 2C2MA 1ESEA 1I1HA 2C5HA 3EXAA 4LHXA 3IB6A 2C00A 1HQKA 4MMZB 1MB4A 4YMGA 2O7RA 1M2HA 3KB8A 1NYQA 4C0HA 4QPZA 1U28A 8LDHA 3DLHA 1Y3HA 4TV9A 1L5KA 3V4FA 2JKZA 1TJ4A 2H9AA 5A3QA 4X66B 1NQAO 2ZT5A 1MX5A 1WPGA 2VDLB 2HCJB 3IBTA 3AWIA 3KKEA 3RVLA 1W87A 4GKBA 3JR3A 1W36D 3SVZA 4JWIA 2J6BA 4UJ5A 1ZVMA 3QEOA 2ZQ5A 4G26A 1EVQA 2PJDA 1DFGA 2SCUA 1DWPA 1YBAA 4QX6A 4X54A 3BRSA 1JPUA 4NU8X 4TTTS 3TIXB 5FBRB 4DUGA 1WQ4A 5EHZA 1E2PA 2CB9A 2JGMA 1L4EA 3HCBA 3ROZA 2XT9A 2FG6C 4V03A 4YGYA 3UF0A 3SM3A 4JUDX 5AT1A 2N47A 1JMVA 1K92A 2VF7A 3DTVA 1ZH0A 3M1LA 4HNHA 4IFTA 4E15A 1WBBA 3D2FA 1F8UA 1AU9A 3HDQA 4F9EA 2NXNA 4X6YA 3M81A 1SBQA 3ESBA 1A9SA 1PR0A 2I2WA 2QY9A 1WS6A 2Z2XA 3I1JA 3P9CA 5FWAA 3SBXA 3TKYA 1YL7A 4OA8A 4EEXA 1A8QA 3DE5X 1O0BA 1O6FA 2IYZA 2RB4A 4J43A 1L8QA 3THOA 1T13A 4WXRA 3FD9A 2XV1A 3K5PA 5AHOA 4EL5A 3Q98A 3FTCA 4GPIB 4KXLA 1Y8QB 1RBMA 4CETA 2X0NA 3AR8A 1P1JA 2JLZA 1ZM9A 2MINA 1R0WA 4M0KA 4C4YA 5KYYB 1B43A 4UVGA 5LBIA 5LMNB 1H3EA 4YRLA 3IIJA 1C4OA 2OG1A 3BIWA 1NA5A 1E0DA 3JQCA 4MUYA 4C43A 4EVIA 5HKBA 4YXFA 1XAGA 3HQ4O 5C8XA 3T4EA 3K8YA 3Q3CA 1R66A 1XJ0A 3K6SB 1FSGA 1CY7A 2Z30A 4PQYA 3KWFA 3BGVA 3MERA 1T2UA 2FR1A 4MUEA 4KK4A 4XGKA 4AO6A 4BEVA 5LQSA 3ZWDA 1ULZA 3JYNA 1EXVA 3FMPB 1YE5A 1ZGHA 3S7TA 3RFTA 2BMDA 2JZCA 3NBUA 5H3LA 3T4UA 5HS4A 1E6LA 2W6NA 1NI5A 4GBMA 1HI9A 2I6QA 4CJXA 4TMKA 2YZ2A 2NU6A 4LJLA 3M6AA 2IOFK 1L3CA 2WWTA 3ICEA 4WEQA 4FW9A 3EIQA 3LOQA 1GKUB 3W2EA 4AURA 2AXQA 1EE2A 1EGVB 5I9TA 3TQQA 2AZMA 4YNBA 4WN3A 4J07A 5KC9A 3ELDA 3D8BA 4AG3A 5JXJA 2I2DA 3K2QA 1HNWB 1KAGA 3R5FA 3R6LA 4DDUA 3THWB 1B16A 4JNKA 4BO7A 4Z53A 3QA9A 5T4HA 2WSYB 2FUEA 3OQMA 4AP5A 1ZJ6A 5DHSA 3AFOA 2V4MA 4HEQA 3MCTA 1Z8FA 1N5MA 3CZ5A 2GUGA 2YIDA 3ENKA 3KT0A 2E89A 1JPNA 3CLTD 2PIAA 2MYTA 3A0RB 1XRMA 2FUG6 3ZYZA 1IM2A 2O2CA 1QBKC 1M34A 1R74A 2FPUA 4XIIA 2WU4A 4ZEWA 1JLMA 3EXEB 1CNMA 3B6KA 4IFEA 1WXDA 1TJ5A 1T1EA 3O82A 3TRIA 4BU0A 1HXKA 5MN5A 3AVYA 3WYGA 3N2KB 3FIUA 3RC1A 3VPXA 1AZWA 4Q9HA 3CRZA 2QMQA 4F72A 4IHAA 1NQXA 5AHRA 2J08A 4X1YB 1NC1A 2H2DA 1EFUA 3GRFA 2CBXA 1PEAA 2QUHA 1R4ZA 3AFNA 2ZE5A 4CFYA 3UIEA 3NWOA 4BVHA 4LF5B 3MELA 2DBQA 2QMEA 3EXG2 4YP5A 5TF0A 4A8JC 4PYJA 1DS6A 2BKXA 3G85A 4BB5A 3BL6A 2H0QA 5KOJA 1IMJA 1PK7A 1XTZA 1SR8A 3GLGA 4EMSA 4E2YA 1GQQA 2VYVD 4AY6A 3AR7A 4JZKA 2VQ3A 5DN9A 3I2FA 5JCJD 4JSTA 1C50A 2C0QA 721PA 3IE1A 2NNWB 3QYPA 4YRSA 1NXVA 2XTJA 1RJEA 2AF4C 2ORED 3W2TA 4NIMA 1QWOA 4DJFC 3GI7A 3GLTA 1KI6A 3A37A 4P35A 1ML3A 2ZJBA 2IY8A 1FRQA 1RSZA 2G70A 2JAUA 2ZBUA 3ZJ5A 1JMKC 4HF7A 5IM5A 1I30A 1AM4D 3NAZA 3IPLA 2HF2A 5A4MS 4CR8A 3HG7A 5L4LA 4ZCTA 4KKVA 4UBLA 4UHEA 1G5HA 4KG7A 3R7BA 2BEVA 2XE7A 2WHEA 1V35A 4JJKA 1E8MA 4B80A 4WFKA 5H4HA 2QORA 3UJ8A 2ZJYA 1Q12A 2QQFA 2QYOA 1DJPA 3ZZNA 2EFYA 3H2BA 4TQAA 5ARDA 1TIPA 1OXUA 1M75A 3R5KA 1E2UA 3LC1O 2CWWA 4RXUA 5IAKA 3V3TA 4BO1A 4FZPA 5FADA 4ABTA 1FNBA 4OYHA 4NWIA 4YV7A 4M7RA 1IZ8A 3LFHA 5BSVA 1NV8A 4KOEC 4NU5A 2GFHA 5EG5A 3WLHA 2GYUA 3M89A 4QGFA 2O2JA 1Y6FA 3S27A 1XAHA 1I94B 1TFUA 5FPSA 4ZVMA 3WISA 4BZXA 4GXRA 3BYZA 2FMIA 3M6FA 4MLPA 1YQUA 3M5CA 4FFDA 4FZ3A 1N4AA 2Z6UA 2Q4TA 1OA0A 2YL9A 1BTOA 1U1EA 2QNIA 4GYYA 5BRAA 1ISPA 2F1HA 2QTZA 4CM8A 2H4FA 1XA3A 4V0LA 3S1SA 4QOIA 2XWBF 3DMHA 3IUMA 5IS2A 2F7QA 1L4GA 3A1DA 2CMGA 3IBFA 3PR3A 1BDHA 4H6IA 4PONA 4DEVA 2G76A 3UFXB 4YAEA 3JWHA 2D3TA 4YROA 2YWEA 2IW1A 1V5WA 2Z8YM 1I6MA 2X8LA 3DZHA 1SWWA 4XGIA 1C7JA 2ZRLA 4UMVA 4FMDF 4G2TA 5T67A 1H6DA 2C7RA 2QX7A 5EP2A 3H13A 1JE0A 1MJHA 5JS1A 1G1MA 3N8KA 4YV0A 1JHOA 1DUVG 2CMKA 5B36A 1YUBA 3GRUA 3TW8B 1VQ1A 4YUZA 2YN2A 3IFSA 1RWVA 4QXOA 4XCXA 5AVWA 2R0QC 3CZ4A 4OLFA 4R41A 2ZVDA 2H0RA 3K1AB 4PXYA 4US0R 4KQMA 4B84A 3EASA 5TB5A 3BJRA 2WJGA 5KWEA 1D4ZA 2Q3LA 3DEFA 4CQMA 1XZKA 1I33A 4QXQA 2MSDB 1IK4A 1EQAA 1WP9A 3OPYA 5AVRA 3DZCA 2MYNA 2MOKA 2Z2IA 2H1SA 1UM8A 2XSZD 4BVEA 3K0BA 4CTMA 2C31A 2QUAA 4U7JA 1ID1A 1FPMA 3GNSA 1N5IA 8ATCA 4JNEA 2BFBA 4IVPA 1WB6A 3CKLA 3NOVA 3A9VA 4M6WA 5HIMA 2X3XA 4GMFA 3S99A 3TZHA 2OG2A 3MUEA 2ODTX 4EYOA 1O8BA 1P4HA 3KELA 4TSFD 4C30A 2ZSHA 1JX6A 4MS3B 4DKXA 4HVCA 2JK1A 1LY1A 2B0JA 3B51X 2BM0A 2E4WA 1CZOA 3E15A 4LSGA 5KDLA 4PZYA 1R8SA 1TEHA 3MJVA 4DUYB 4LGYA 3FHTA 2O4UX 3EARA 1RCUA 1GZ4A 3CO0S 1JDNA 1MN6A 5DPMA 1K1EA 4CKWB 4L2IB 1RHQA 2C61A 3QPDA 1MO3A 3QPBA 1JDSA 1S2MA 1ZN7A 4JGIA 3V1LA 1HRDA 4AMYA 4O4LF 1ZI9A 4GDFA 1YZVA 2FDRA 3T0FA 1UINA 2CLDX 3H9GA 4RS3A 3BA1A 4QBIA 2RHTA 2XQVA 3I1IA 3EE6A 2NUAA 3ZBTA 1C9DB 1EJ2A 4TS1A 3PRKE 5JE8A 5LL6P 1RM0A 2LRHA 4DARA 3FUWA 3I9FA 5J2UB 2HT6A 4EGFA 2VUSA 1OI2A 1P9RA 1UM9B 5BN5B 2PRKA 2WIDA 1GQRA 1KZ4A 4JBIA 4LV5B 4N01A 3P4XA 3KZMA 5GZ3A 2WZDA 1E1QD 5LNK1 3MIZA 1UFRA 3OFKA 1YE8A 4RKWA 1ILWA 5D1HA 1CP3A 4J90A 4BBPA 4CUJA 2RKOA 1QJCA 4OU4A 2R00A 2JC3A 2HA0A 2I2FA 2PWZA 2QYSA 1GDDA 2AYZA 3BPSA 4KL8S 1Y6GA 1ND6A 5HK8A 3VR4A 5K3SA 4EQ6A 2CK3A 3CLHA 3HB7A 3HDTA 3O95A 2HK6A 1NUTA 1KBQA 3FOCA 4B7UA 2JLRA 3TXAA 5E7MA 3SOZA 4BEBA 1QHYA 4UARA 2F7OA 4WH0A 3GVIA 4P2BA 4AZTA 3U9SA 3ILHA 2Z6AA 5AI0A 3AGQA 1MX1A 2ZYRA 1LPPA 3KL4A 4LHZA 4YO7A 5LMUB 3RADC 4WXMA 3JATA 1E0KA 1R1DA 2FTKE 2BGJA 3GJ8A 2E4YA 4KI0A 3WDKA 3KZNA 3QNIA 5BUCA 4FZJA 1FFDA 2XWSA 4WX2B 1SU8A 2C94A 4OJQA 3JAWB 4CQJA 4J7UA 5I7VA 3TKAA 2Z0NA 2RHWA 4KIGA 2ZRGA 4QAJA 2J6IA 3SBDA 2O6HA 1J2TA 3AM3A 4KNWA 4BQSA 4MCAA 2DPMA 1J39A 1T5BA 2Q3HA 4RCYA 2RKWA 1QFZA 2NT3A 4LX0A 3RYCB 4A5SA 1HDCA 4IIGA 2NU6B 4JB2A 1RI3A 1GL9B 3TLYA 4QUIA 1HRKA 1BEUB 1L4KA 2V6GA 4CV3A 3QY0A 1I3LA 1WMEA 2B99A 2Z4TA 4KMSA 1C41A 3NBFA 4A3SA 3BD7A 3RU2A 2WE7A 1UP6A 1Y2OA 1A97A 1DBSA 2WJ3A 3N58A 4BQPA 1WNTA 2Z08A 1VGQA 2VOJA 4K26A 1OUMA 4WK2B 5J1SB 1ZYUA 2Q5IA 4CG2A 4DCPA 3SC6A 2R7LA 2M98A 3BLBA 2ZPAA 4EYSA 5BN4A 2H4JA 1G5TA 1LK7A 1RIFA 2WHPB 5EQJB 3GRRA 4TXHA 5MGBA 4DS3A 4RTJA 3EG5A 1XTSA 3ZH2A 1FQWA 4UPDA 4HSGA 2VUUA 3PHIA 2XCIA 1QFJA 3J80A 3EC2A 3QUTA 4P3YA 2YDYA 3L5OA 3QP9A 4CF6A 2NPFA 4ZVLA 4F56A 1ZSYA 2DE0X 2NSLA 1MB3A 4GEKA 3T3GA 2Z2KA 3EGOA 3EWSA 3HLYA 3HWRA 2FK7A 3QV2A 3QMMA 2NUTA 4RA9B 1AXRA 3DVAA 2AX4A 4I5DA 4H0NA 2RB5A 4NDNE 5D84A 5KTPA 1WUHS 2GZRA 1JP7A 1WA5A 3I9LA 1UXGA 3F9CA 4IJKA 4HDAA 4RLQA 3FYUB 4U4AA 5HG0A 1EFCA 3GT3A 4YECA 2GAAA 2BT4A 4HH1A 2HWUA 2NADA 3K0CA 5HXAA 1Q0HA 1JG2A 1JIVA 1LGYA 4LZAA 1YNSA 3AERB 4IUYA 2X23A 5DISB 1G6OA 2AZTA 5FOTA 3GMDA 1E1CA 4JNCA 1M1NA 2DTDA 4YRAA 1QR2A 2W0SA 4OK6A 3BJZA 1JQLB 2AN3A 3QLUC 2XRFA 2Y67A 4G0WA 3R6WA 5HNKA 1GO2A 3PGA1 4Q05A 4N8SA 3R2JA 4FDTA 1WXWA 2FW0A 1VA4A 2DZDA 3THSA 3GVCA 2X5XA 3LX5A 4KNVA 2YY6A 3VNSA 3NMUF 1AQUA 1Y8CA 3BCRA 2BGRA 2N42A 3PBKA 4OPMA 1ENZA 2FF5A 3NT4A 1YL6A 4NATA 2QRVA 4UPVA 4F5DA 2K5UA 3GJ0A 3B1JA 1YQEA 4NE2A 1Q21A 4EECA 5LWHA 2VPPA 1YQGA 3GZ4A 4EO7A 3ZLJA 2JLUA 1ZO8A 1P72A 4QD3A 1YR2A 4D5EA 3Q7RA 5TR9A 1UBJS 2IEGA 3EFOA 3R0VA 4G85A 1NUPA 3EHEA 2X0IA 4UJ3A 2OBFA 2WYHA 1OZ0A 2Z9CA 3ZLBA 4S24A 3WQBA 1XVIA 1F1JA 4MS1A 1XA0A 3NHMA 3MBIA 1S7CA 1UH5A 1YVRA 2NU8A 3VR4H 5A62A 1ECBA 3N8IA 2Q0SA 4MQMA 3CLVA 3EEOA 1JB9A 5IDYA 1NTOA 2CVFA 3V8VA 1QF6A 4LW8A 1TJPB 3A28A 1T5TA 2J5KA 1MAHA 4TL9A 4OD0A 1TB4A 4M0PA 1Q19A 3GFTA 3HJGA 1A88A 4PFJA 1UKYA 1CZRA 1XR3A 4J2HA 4QOGA 5EJ2A 2E4XA 3Q41A 4ZMRA 1IMOA 1OVMA 1T9GS 2VEOA 4W1RA 1EWTA 4K9LA 2FMUA 1N9KA 3JD1A 3CY6A 4I1IA 3LHIA 3NAGA 4P22A 3DXXA 5H9VA 3VC7A 3OIUA 4CEJB 5KNCA 1VPLA 2CDCA 3KD3A 1PTJA 2I22A 1IH8A 3IAFA 2CHGA 1TRHA 3AC0A 3A3YA 5AJUA 3RDPA 1WCIB 3V8EA 2PANA 2XKBA 5IMSA 5JH7F 1CUDA 1GRVA 1YDEA 1T3LA 4YHHB 3VFDA 3MT7A 1BGWA 1WVGA 2IPMA 4L1KA 2CNKA 2O07A 2IPNA 1KI4A 3B36A 2Z1DA 4M21A 3WBBA 5JCOC 1QHGA 1BQEA 1WZNA 3ASVA 4JB0A 4BLSA 2O8DA 3HAIA 3IMGA 1BHO1 2B9EA 5BV8A 4TLLB 4UE3S 1UC9A 1AC5A 1L5OA 1N7JA 3AVOA 4Q0MA 4Y7DA 3RRXA 1YR6A 5DCUA 5LZ4A 1Z4IA 1WCYA 2O8NA 4K05A 1UOQA 2GNOA 5FPQA 2OO5C 2E21A 1UAAA 2KBFA 2IXDA 4NU0A 5C5IA 2PT7A 3AEQB 4K28A 4WOJA 5L6LB 3Q5GA 3BK2A 2YI8A 4GPAA 5AW3A 1HQYE 3ICVA 4NH4A 1BGVA 1IZZA 2ZOSA 3ILXA 4BVBA 5AICA 3ESYA 1R18A 2AG8A 4ND8B 3I01A 3WSVA 2DVMA 3KALA 1XTQA 1GRRA 3ZWBA 4X8OA 3RC2A 1U2DA 1OFIA 1YGYA 1ZMBA 3IT0A 1KYYA 2PZKA 4Q1AA 1T5LA 3EF1A 1N2EA 1X7XA 5A9SB 3R0IA 5IF3A 1TEZA 3SMVA 4M89A 4B4UA 2HU5A 4BO3A 2B20A 3BXGA 3F6CA 3ZU6A 4M83A 1N1MA 1Q7RA 3PHCA 3HWX1 4ZZ2A 5L53A 1UBCA 1KEEB 3EQ8A 1QRRA 4FFSA 4U5QA 1AK2A 4S35A 3T3IA 3ESZA 3VPDA 3Q8LA 3UJBA 2QTGA 4OSEA 4ENVA 4J8PA 1P0FA 1GQSA 4X24A 3FYCA 4ZWNA 3R9IA 3TJZA 3WNCA 5JAZA 3EEQA 4C7OA 4LYAA 2PUGA 3LUFA 2GXQA 3DSRA 5IANA 1B0AA 5EKSA 4UU7A 3F98A 4C4RA 4TYYA 1DKQA 4P36A 1L4MA 3T54A 3KKZA 2VRCA 2COEA 1JWBB 4K6HA 3B9PA 4XRRA 3PVCA 1BXRA 1U8FO 4WVLA 1XEXA 1OPXA 2HU2A 2J4FA 1QCYA 2XUIA 2IV3A 2OM2A 1ZNYA 3PYLA 3TDMA 4M86A 1A76A 4X95A 3V8NA 4D4GA 4PM4A 5AHKA 2C9CA 5AW1A 2FE4A 3GUCA 2BV3A 2XBLA 2PIDA 2PYIA 1LLUA 3C6YA 4ECEA 1DG3A 1RHKA 1GSAA 1MG5A 4TLDA 4D46A 1Z26A 2E4UA 2J4DA 1KSGA 3WKBA 3WWDA 4TVKA 4HNTA 5CVVA 1CVIA 4ZOEA 5EIEA 3RIGA 3Q8XB 2A30A 2X2FA 4H1UA 4LRUA 3O94A 1EVLA 1TKRA 2C1XA 2WIJA 3H4IA 1QR6A 4AJLA 4GUDA 4D56A 1DAIA 1Z35A 4KPUB 2J41A 2ZSJA 4C5BA 3QM1A 3IULA 1RMQA 3HDYA 4B4DA 4EZZA 4WZ6A 5FH9A 3PWZA 1NM5A 1W4AA 1H85A 3H6GA 3U6KA 5HCNA 4RF4A 5JZBA 3U7HB 5C7LO 5KZMB 3ODGA 4BE9A 2HBRA 1H66A 1J25A 2PN1A 3PSAA 1T2VA 4FD3A 2AD5A 2KLBA 4ODIA 5KNCH 1NJ1A 3OPYI 5GIOE 4B6PA 2ACVA 4XYEA 4D8TA 3UV6A 4F4JA 3MRSA 4LDNA 1A9TA 1NLMA 1MA3A 2FN7A 2PU7A 3HCOA 2CV1A 3LLMA 2JIDA 3I0NA 3GVPA 2AOUA 1Y8AA 1G6HA 4Q9JA 3UOGA 1XEFA 4G5XA 1ZNXA 4K6KA 1A98A 4URWR 5EVCA 2CYBA 3FB4A 4R7ZA 3HAHA 4TXLA 1JNXX 5DM4A 5CDSA 2XTAA 4MQEA 3A6LA 4MQLA 1TCUA 2FHPA 2NSHA 4MW1A 3LBYA 4EG1A 3VU8A 4P93A 2CNNA 5TC4A 5FPPA 4CT4B 4F1JA 4F9TA 3L8EA 4FFVA 1K8YB 2HFJA 3PXUA 5T4FA 1X2BA 4C0JA 4G9BA 4YJGB 4L8GA 2YWBA 3ZOKA 5IN4A 2Z56A 2VXCA 5ICSA 2FPIB 2F43B 4H6VA 1L4FA 3A3OA 4XUDA 2QGFA 5ICCA 2CJPA 5JMTA 1LCIA 2BUCA 2CCKA 2TMDA 3P97A 4K9NA 2V4ZA 3V00A 3WKEA 3TINA 4JN6B 4EPRA 1DBPA 2FWPA 4Q39A 1VKOA 3SICE 1YZQA 5HKKA 1V26A 1BX1A 2FEXA 4ZTUB 4YRZA 2G6BA 1GFWA 3DR3A 2ILVA 3KJXA 4EG6A 1UJ4A 4ZZ1A 4TV9F 3UV7A 1EJBA 2IJGX 1EH5A 3BTUA 4MLDA 4E13A 3WLKX 1OB2A 3DX2A 4AXBA 1US8A 3FNIA 4V1CA 2ZW9A 5JJCA 1EUYA 3LCJA 5AM4A 3SF8A 1H2RS 4KH0A 4RMJA 3WK6A 4A0QA 4MQFA 1R6VA 2W58A 3ZV3A 2Q8PA 4W4TA 1E3SA 4E70A 1C0PA 3TCNA 3KZKA 3PUXA 1QQTA 3BMNB 1TZ2A 1OI3A 2AJCA 2OGSA 1RJWA 2PGOA 3H3JA 1WXQA 1XTKA 3T9DA 5E3HA 1YU6A 4MA0A 3QW4B 4II2A 4UNRA 2W2OA 1YB1A 2GS9A 2XXJA 1UUFA 2FFJA 2QPOA 1U0TA 4REMA 1BE0A 2HQRA 1ZONA 4L8VA 3ED1A 4FNMA 5E6SA 1MQAA 1UKAA 4KV9A 5J2UF 2IY9A 2J0QA 1A7UA 1A5ZA 1AY0A 3PSHA 5DH9A 4MYDA 2QRZA 2X7HA 3CCCA 4IAOA 4MYHA 4I8IA 4K8OA 3VNUA 4NCBA 3PQDA 4PZCA 2IZ7A 3OFVA 2Y6VA 4ZI7B 3AW8A 1JN0A 3JQBA 3MA0A 1FFWA 2VDOB 3BSFA 2CFIA 4I08A 1O97C 2VXYA 2O20A 3QKRA 2Y4OA 3IHWA 5BV0A 1PFYA 4CTKA 1AUXA 1HZZC 4RS4A 3LDHA 4RJKA 2QR3A 3OA2A 4HYTA 3RSLA 2WV9A 5KX5B 2GEJA 1AQLA 2O8CB 5LBUA 1VLZA 4IQ4A 1OFTA 2K2QB 2JFXA 2J8ZA 2ELBA 2QBYB 4H2DA 5J3JA 5EHNA 2O3TA 2G5TA 4G0QA 4J0EA 4OFBA 1MBZA 1YFKA 2Z83A 2XF2A 4MRVA 2P2DA 4PYOA 2QX6A 4R1QA 1KH1A 3U3MA 5JZ9A 2O3JA 2EBHX 3T7DA 1CF2O 1GLNA 2HAEA 1U7XA 1J2YA 4JI0B 4BN0A 4MRMA 1FDOA 1J0AA 2IUFA 3O8QA 5B1EA 1SXPA 1EWQA 2JI8A 3QVLA 2VPIA 1NVVQ 1JR6A 2Q7OE 3SYTA 2Y2VA 5D85A 1EDBA 1SU6A 1B14A 1E9EA 1TQ8A 2HMSA 3UB4A 3I39X 4C6HA 5F1PA 3T3OA 3G5LA 5LPNA 2B82A 1MKYA 1RAGA 2NZVG 4V0RA 2QE7A 2UU9B 2ZT7A 3KQWA 4LVCA 4H1TA 3IHTA 4HZIA 4IWPA 3LFTA 2EJCA 2D2XA 3T5CA 1Q7TA 1QHFA 1NMYA 1TCAA 4LK3A 2EFLA 2KM1A 2BDTA 4BNGA 4OHFA 1C4WA 3AO0B 4RTLA 2PJRA 4K03A 4W9RA 3LTNC 1KC3A 5TQ0B 4ALIA 2NU7B 1QH8B 1U65A 5C8YF 3SQWA 5FV4A 1GAQA 5FO1A 1ZA2A 4EEKA 1EUDA 1JKJB 1JV2B 2FLWA 2ODBA 1U28C 1E3EA 1FEZA 1XEWY 2ZUBA 4OATA 1MB2A 1SUDA 1DTWA 5FWDA 4E7PA 1ZH8A 1E9AA 1FLVA 3VJRA 2UYGA 3MJTA 3D7RA 4GP6A 2X3YA 2H85A 2IZ1A 1P8AA 4MV6A 5BNFA 4I1RA 1N6NA 2BUAA 3G2KA 1KI1A 4H6XA 3DC7A 4JJZA 4Y2XA 2PG3A 3UB2A 4CDMA 2AJBA 3VO2A 3U7GA 3FVWA 1NWCA 2GPYA 1DC4A 2Y93A 3E81A 3REQB 4CKZA 1A8IA 1NMSA 4P4LA 3KR2A 2DPYA 1LBTA 5CW1A 4ZOCA 2ORIA 3UJ6A 5IZCC 1QH9A 3MVEA 1UMCB 1WNFA 3E3NA 4L9WA 8AT1A 5E7JA 1V8BA 3L7MA 5B64A 1SCUA 5H3HA 3CKYA 2HIAA 1ZH4A 4IGEA 2X5JO 3QUSA 1Z7EA 3Q88A 5U9CA 4Q4HA 1MV8A 4L7QA 4BY9E 2P9FA 2ZR7A 2LZ0A 1SC4A 3PL5A 3KK0A 5EHIA 1Y80A 1Z6QA 4XYLA 1U0SY 1M2KA 1R00A 1AO0A 1W36B 2CW5A 2BEWB 3ZZUA 2UUAB 4DVGA 4Y6OA 4OP1A 1SVIA 2YHIA 4OXQA 5EAIA 1ADCA 1P2TA 5I8ZA 4DR3B 1CZNA 1CULC 4BLOA 2JGJA 1JFLA 2AJLI 5KWIA 4MKRA 3Q7QA 1VMIA 5AJXA 4O1MA 1A2BA 4DGQA 1JT2A 1MZPA 2EXXA 3E82A 4LDAA 4PLWA 1QANA 5EWLB 4LMAA 3S0JA 3VYUB 3WNDA 1DUSA 2WTMA 4NJMB 4Q4JA 4DT1A 8GPBA 1TKCA 1X1CA 2HSDA 3OTGA 4RMIA 3GPDG 4WOKA 1D2MA 1U2ZA 4ZCSA 2OB2A 1RAFA 3PWSA 1J23A 1IHYA 1RZ3A 1SM4A 1NVUQ 3B85A 1J7JA 1X1TA 1LLCA 3QKWA 4GECA 1D2NA 1CQIA 1Q0LA 2D62A 3WRXA 1WO8A 4E3CA 2ID7A 3N0RA 2AG5A 4EKIA 4E30A 3U60B 3FCEA 1KU0A 1WXIA 2OWEA 3FUCA 2A9JA 3UAGA 1CBUA 1NW7A 1PJSA 2QMHA 3Q2KA 5LU9A 1K3FA 3NPMA 4I5EA 3RSGA 5A3VA 4H3VA 5B37A 5TMBA 5IYZA 4XWWA 1KNQA 3IKMB 2QTAA 4NENB 3DZDA 1Q91A 1EX9A 2CE7A 1JG6A 2DU8A 4NS1A 4EZIA 4QLBA 5L8VA 1HSZA 2IYLD 2VAPA 1P4GA 2BUBA 3KTFA 1Q5PA 5DGIA 3UENA 3LY7A 4BFSA 4ZV4A 2Q2WA 4V3CA 2CYAA 4UDXX 3B12A 3FD8A 1GNLA 3ER6A 3F1LA 3FGPA 3IURA 1NL3A 1PZGA 3NHFA 3NJ4A 3O4HA 4FQ7A 5G3YA 4EA6A 4JA0A 1GPKA 2P1RA 3FJOA 4OX9Y 3BHMA 2QLMA 2F1BA 4QJIA 4C03A 1QG0A 2D2IA 3BHJA 2A9RA 3CCFA 3R3SA 1NG1A 2IXEA 4R0VA 2DFPA 1X0XA 4YQZA 3U7QA 5I7HA 2V9ZA 4W7IA 1CJCA 1X77A 1MOSA 1XYYA 5EOVA 4BJHB 1C8BA 1NMEA 2W2KA 2WABA 5FULA 2EBFX 2HOQA 4AFNA 3QE3A 5KTMA 2X40A 3FSRA 3PI6A 4EA7A 3H42B 2R5FA 1SN7A 2LIPA 4Z4EA 1AUOA 1EGQA 4CMIA 5ALMA 3QWAA 3FYUC 1XP5A 4PU0A 1FVOA 1NU6A 1B41A 4BKOA 1OF1A 2PX5A 2SBTA 4TTRA 2YZ7A 2Z58A 5EUBA 3LO8A 3MWLA 1QZUA 3UJAA 3W3ZB 4UREA 3UB3A 5ALZA 2ECOA 2OLEA 2W6JA 3OZBA 3PLNA 4Q18A 3CM0A 2Q6TA 1M2GA 3BWVA 3KBOA 3A27A 1BMQA 2YMMA 4IUDS 4BC0A 1XE3A 2H2IA 2O48X 4FHZA 3DPOA 2FW7A 2VO1A 3ES9A 5DT9A 1HBJA 1QO0A 3JX9A 2ZQZA 3KHKA 1A8PA 4DWJA 3GHHA 4HZUA 5C31A 4R8VA 1ENPA 3WGIA 3TR5A 3T7SA 1HNZB 4QYXA 1E1MA 1EFHA 1PT9A 2KBEA 3ELWA 3HUTA 1A72A 3N0XA 4AMUA 1GUAA 3SSAA 4DY6A 1X7ZB 4CODB 1WZUA 3VNRA 4M38A 2YCBA 1E1KA 3EZFA 3DNPA 2GEBA 1STOA 3O1JC 2QTTA 4CLHA 2P2NA 2A1TR 3COPA 4NULA 1W73A 2XH8A 2YZKA 3OPXA 3P2JA 3D3WA 1CK4A 3IKLA 5E0OA 4RSHA 3IVAA 5B3JA 1RHUA 5H16A 2ODQA 1H9AA 3FVVA 1XELA 1U98A 4KQ9A 2BKLA 4HTAA 4QDOA 4LJ8A 2HF8A 2ZEJA 4HGNA 4P4GA 5ELXA 4G37A 2ZTLA 3GF4A 3E5RA 4CKEA 3DMRA 3H4MA 3WHIA 4BZQA 5J4KA 5JYBA 1H2AS 1J0BA 4GG1A 4UM7A 1XCMA 4WN9A 1WZEA 1JDZA 1RE0A 1HPLA 1RRCA 1O5IA 2GHRA 1V45E 2PLWA 4PPYA 5E2BA 2W98A 2YL2A 4TXJA 3RTGA 2HW8A 4G1MB 1QAOA 1V8PA 2DTEA 3HGTA 4ECAA 3SN6A 2YFHA 4KR9A 1L4NA 1GSIA 2PGIA 1GYRA 3FGNA 4GH5A 4GYJA 5IVDA 3DW3X 5BPFA 5E8JA 1JUDA 3LHFA 1YB6A 2AOVA 3CF4G 3TK1A 4GMGA 4TROA 5EN4A 2D13A 4JI5B 2HA5A 4CV2A 3HYTA 4OG2A 2XNDA 3ETNA 4X8HA 5AXDA 4DEYA 2FN8A 3IEMA 1EGHA 1VJ1A 3H9CA 3OZAA 2I8AA 1ZGGA 4RD3A 1L7RA 1O95D 1S1CA 2F48A 5AW0A 1ZMTA 2IDZA 2ZYVX 3H5TA 2BWJA 4KO2S 4Q1CA 4F2PA 2NQTA 1TTTA 3C4VA 4XDHA 5KDDA 1CU1A 1RJGA 5C37A 2OCXA 2AFIB 5D1NA 2RD2A 4IHJA 5KYWB 2J5XA 3BM5A 1G2OA 1XQWA 3SQOA 1VSBA 2C59A 3HCWA 4MYRA 4MUKA 1KZHA 5BSGA 1RRVA 1CJSA 4UBMA 5DX8A 1OH6A 1OOEA 3GBSA 5A7GA 1M8KA 4CQLA 2C2XA 1F60A 4IRUB 2J0SA 1K6EA 4B3BA 3OZDA 4GR9A 3FI0A 4WLFA 3ZHYA 2AHOA 3EGXB 3IDQA 2ISSD 3HEMA 1XLVA 3ONWA 3E2PA 4QPPA 4B3TB 2EIXA 1HEUA 1SKYE 1V6CA 3GLRA 3ON5A 3FPEA 4ND1A 4WD3A 3VAZA 1WW2A 3SZGA 5KREA 1WE2A 1QTRA 4NBVA 1KVUA 2CVPA 3PUWA 1T5DX 2Q3DA 3D3EA 1XLUA 4QBFA 5TEWA 3Q3GE 3DDNA 3VNQA 2W2MA 4V1CI 5KSYA 1VLJA 4WDRA 2IXAA 3TNYA 1QFXA 4LBWA 1IU9A 4BLVA 2H8KA 3KVYA 1QLWA 3FGOA 2A9OA 2HL6A 3DBRB 3HU2A 3OQ1A 1Q57A 3JQ6A 1ZY2A 4G01B 3WGZA 4AJHA 5LZ5A 4LYDA 2JJ8A 4X7MA 4Z0HO 3C3CA 5D5HA 4IIXA 2QL6A 4H08A 1Y8RB 5MDHA 4YMSA 1JEOA 1W29A 3EXIB 3NHAA 5C1PA 3QVKA 2UYHA 4JT4A 2PEYA 4MPTA