3O3OB

(r)-2-hydroxyisocaproyl-coa dehydratase in complex with (r)-2-hydroxyisocaproate
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
375
structure length
375
Chain Sequence
MEAILSKMKEVVENPNAAVKKYKSETGKKAIGCFPVYCPEEIIHAAGMLPVGIWGGQTELDLAKQYFPAFACSIMQSCLEYGLKGAYDELSGVIIPGMCDTLICLGQNWKSAVPHIKYISLVHPQNRKLEAGVKYLISEYKGVKRELEEICGYEIEEAKIHESIEVYNEHRKTMRDFVEVAYKHSNTIKPSIRSLVIKSGFFMRKEEHTELVKDLIAKLNAMPEEVCSGKKVLLTGILADSKDILDILEDNNISVVADDLAQETRQFRTDVPAGDDALERLARQWSNIEGCSLAYDPKKKRGSLIVDEVKKKDIDGVIFCMMKFCDPEEYDYPLVRKDIEDSGIPTLYVEIDQQTQNNEQARTRIQTFAEMMSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-subunit 2-hydroxyisocaproyl-CoA dehydratase
publication title Structural Basis for Reductive Radical Formation and Electron Recycling in (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Lyase
total genus 151
structure length 375
sequence length 375
ec nomenclature ec 4.2.1.157: (R)-2-hydroxyisocaproyl-CoA dehydratase.
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06050 HGD-D 2-hydroxyglutaryl-CoA dehydratase, D-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.370 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3o3oB01
3.40.50.11890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3oB02
3.40.50.11900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3oB03
3O3MB 3O3NB 3O3OB
chains in the Genus database with same CATH superfamily
3D7KA 5KCZA 2G82A 5DYTA 1UXIA 3LPLA 5CFLA 1GRNA 4JP5A 3DZCA 2PXHA 3NKVA 3CKYA 3KHTA 4Q5IA 4C0SA 4MXDA 1N9ZA 3L8YA 1JPVA 1K7CA 2I9PA 3FKSD 4IHKA 3TOVA 1HSZA 4YRNA 1VE5A 3L4JA 5HZGA 4UNIA 3V97A 5AJXA 2P9HA 3IAHA 5E0KB 4I9HA 1V11A 1TKBA 1KY5A 1S8FA 2X9GA 4K7JA 4KLCA 2Q29A 4JCCA 4Z3DA 1X80A 3TSYA 3U39A 3F73A 3ZZMA 1DC8A 4IAOA 3RTCA 4JT2A 5ELLA 5EJ4A 1JHRA 4RX1A 1QF6A 1NZFA 4B83A 4DNFA 3K8YA 4OL9A 3LY5A 2Z98A 1KQGA 1JIJA 4M0EA 3UFXB 3ZCUA 4F4IA 2N46A 3W2IA 2P9YA 3LQYA 4HDAA 2WYUA 3QVSA 4DMRA 3QEJA 1QO9A 5HJ2A 3D7SA 5AVZA 4KMMA 4YV1A 4NE9A 2XGMA 5FDFA 1XN1A 2DWUA 2MMGA 1N2XA 4AF6A 2V5UA 4J43A 2HDOA 3BRCA 1PL8A 3CQ9A 3TL2A 3WGOA 4Q4CA 1QP8A 4HQKA 4DCVA 1FFYA 1HE5A 5EQDA 3UUEA 3E5RA 4RF3A 4DLPA 1EFPB 4TKZA 2RH9B 4DA6A 3UMYA 2OORA 3LPDA 4C4TA 5IYZF 2PSSA 1I7LA 1WVMA 3S1LA 1U1DA 3H7IA 4UTZA 4ZOBA 1ODIA 2GCOA 2P9ZA 2C7VA 1XQYA 1A2QA 1CJUC 1DIHA 3BGVA 1CJBA 2BFAA 1ZISA 3UFXA 4ICIA 4LGVA 1JKIA 4HSGA 2MSNA 4BWVA 4HD8A 4C29A 1UIMA 3GFFA 4AJJA 3GEBA 2WWHA 1JPJA 2C2OA 3SDZA 3BKXA 4X66B 1TU0A 3ZE8A 4KRFA 1VSBA 1U0OC 3GI7A 1R0XA 3N2LA 4MRPA 4RHXA 4AWBA 4DHWA 2BZGA 5HF8A 3FHTA 4PYRA 1JXQA 5AD1A 4EZZA 4LJ4A 2O50A 4C20A 2WAXA 3JWJA 3NHKA 3U7RA 5JSKA 1S8AA 1EFPA 2VF2A 5A4IS 3NT5A 4V0LA 1REQB 1PV4A 5FEMA 4BB0A 5TF4A 5FV4A 3MWLA 1DQRA 2IHTA 4GLBA 4UUOA 2J46A 4AXXA 4EKIA 1O9GA 3NETA 4ZMSA 4CKCB 5F51A 3IUPA 4DQDA 3BAZA 1FCJA 2JI6A 4DHEA 3THYA 2WLSA 2YWEA 1T8TA 2G4LA 3ZOZA 5IM5A 2ODQA 4COOA 1TLTA 4OUKX 2QXYA 1N4AA 1KBZA 2IWRA 1UCFA 2CUTA 4AYTA 4US0R 5H5JA 2C7RA 1KYWA 2O3SA 3B3JA 2V45A 4LNUB 1JT9A 4X8MA 2NYAA 1W4CA 2AUNA 4H0CA 1KYQA 1IPFA 1HDCA 2FFJA 4U7JA 1QHHB 4PFQA 1ADGA 4Y2HA 2QRGA 1GTSA 4F2HA 2FWJA 1NUHA 3LHIA 4OBXA 3PPWA 1LB1B 5IWAB 1RWWA 2HW8A 4QUGA 4FDAA 2QTWB 3QK7A 1PI3A 4I2VA 1E3EA 1J09A 1OX5A 2GZAA 4RVUA 4TROA 4PTLA 4YPFA 1R64A 2VSNA 3L0OA 5JI3E 1AGPA 1KMIY 2HLNA 4K9OA 4RVHA 1VXOA 4Y6OA 3Q9NA 4NK5A 2C29D 4BVGA 4CKCA 1FSZA 4MV0A 3L7AA 4IH9A 4IIUA 4JJZA 4X0EA 3M4YA 5J3JA 1P5ZB 4HEQA 3QJ5A 4HMQA 4R2JA 3OZBA 3FOCA 4PAWA 1VKJA 2DPMA 4QVGA 5CLQA 1FJHA 3NHLA 1MORA 1BYUA 4LNUA 1MN6A 3KT8A 1LVGA 3WGHA 2VPQA 1T24A 1UZMA 3MIZA 2OYCA 1T29A 5GZ6A 1U0EA 1EP3B 5I5EA 1CU1A 1JHXA 5D3ZA 2DF8A 2CJFA 4NI5A 1Q0LA 3W2GA 3G0CA 3LG2A 2C8KA 5E2AA 1VRWA 3L6EA 3E27A 3ES9A 1VL1A 4R1QA 3TW6A 5INTA 1J25A 1RPNA 1P1IA 4Y7DA 4H3KB 2IYVA 2Z6VA 4HRYA 1FP4B 1S7GA 2RGUA 3TR6A 4CM1A 1UQUA 2O5VA 3CLRD 3PJFA 3WP1B 1KZYC 2AHRA 2GPWA 2ZBQA 1XO1A 2Q8NA 4F3RA 4KLRA 1KQFA 1LPSA 4EGFA 3H0KA 1QKIA 4IYRA 4X63A 4BNGA 5BNZA 3G2KA 3DMFA 1JU4A 2VYFA 1CQWA 2O52A 2QORA 4KX3A 2W71A 3EPHA 2NQTA 3RC7A 3CEJA 4K6FA 1DS6A 3B1WA 1QQTA 3R3XA 4J03A 1ZIYA 3GNQA 3QU4A 3VRHA 2GYUA 3FCEA 4QULA 3VNBA 3CKMA 4ARZB 4C4ZA 2R44A 4GRAA 2HJHA 1NTOA 2EL7A 5J2TF 3G1TA 2NG1A 4L0DA 2BJHA 3T3GA 4D4LA 5E7QA 2JLVA 1FP4A 2BMFA 5AW4A 2W2TA 1E2KA 1MNAA 3CURA 2AE2A 4QU5A 1YJ8A 3VDRA 1L4NA 1WW3A 4MKFA 4RTSA 3SWWA 2GZ3A 3DZJA 4CM4A 5DMXA 1NW4A 1CEQA 1K5HA 3CC8A 4AECA 2W58A 3CZCA 3QUSA 3GI1A 2XAAA 1N6HA 5AI9A 5LNK1 2HTFA 1H93A 1XZEA 1XTBA 5B1IA 3U62A 1OD6A 4B3GA 4OAPA 3FZQA 1PJ2A 4LOAA 4DSTA 1V4BA 1ZK4A 3AY6A 3GRAA 4QZVA 2W2XA 4LPSA 3PENA 4TLEA 4TKMA 2VSFA 3E1KA 4KH0A 1A7KA 2FSIA 4MUJA 1KWKA 2GERA 4NU0A 1PL7A 1TCBA 3G2LA 3TI7A 4ARZA 3CX8A 1C9DB 2DBZA 5FO0A 4DLKA 4RYLA 1ODFA 3GRCA 1QU2A 1KS9A 1QGDA 1YDGA 2BZSA 2ZRQA 3CMMA 3A8TA 5K6AA 1S2OA 3QWEA 1SD5A 1PR4A 2J5QA 5IN5A 1TRKA 3VJMA 3DX1A 5G4KB 1L8QA 4QJ3A 2PBRA 3WRXC 2G0NA 2CL6X 5DHQA 4EZVA 1DDOA 1E2HA 1E94E 4D8YA 1XYGA 2IPAB 1IJKA 1YKFA 3GRYA 3WWYA 2P6NA 5DHSA 3CZ4A 1SN7A 2BBOA 1JL3A 1M2GA 2AOXA 2G0AA 2CBZA 4LQDA 3TWOA 1NBIA 2Q5QA 2WSMA 2WU4A 3BWBA 5LA6A 3BWXA 1CY4A 4EPWA 5BPHA 1NKVA 5KX5B 3MXTA 2YI8A 1NU6A 5CM9C 5ARBA 4INPA 4RJJA 3ZKAA 3NYWA 1DEHA 4QA9A 4M9QA 3UCFA 2GA9D 3LM8A 2WQ7A 3SOZA 1G5RA 4KPFC 2CNWD 2J9RA 4ESOA 3L1JA 3BCUA 4TLCA 3BFPA 1ULBA 4L7VA 1ZLXA 4FS8A 4L9AA 1XCLA 4BEJA 3AW8A 5G4KA 5EQFA 1OLSB 3MZ0A 1Z68A 3AKDA 4KO8A 3STHA 4LF6B 1NUAA 3VO2A 1GQYA 5JXHA 5AMXA 2WKWA 4J1NA 2P27A 1I0IA 3HA3A 2YMQA 3N8DA 3QG1A 1RABA 1UBMS 4BGIA 3LX8A 2G76A 3NT4A 3ZY6A 3A4YA 3MD9A 1U0JA 1Z07A 2FN8A 2EFCB 1YJBA 4H7KA 4JV5B 1ULUA 4NX2A 3IEUA 3QPCA 4IIJF 4A5SA 5KX5A 3Q1KA 2FOLA 1BU5A 3LT1A 3FKSA 4UM8B 3C6XA 1Z22A 3KB1A 1N6KA 2FG5A 4G2TA 3HRIA 2VF4X 4AG3A 2OV3A 2MR5A 3HU1A 1QIFA 3FGPA 4ZC1A 4AJNA 3PNPA 3W79A 1P6QA 5AW8A 1JGTA 2YBEA 3PGKA 1ZSVA 4KO3S 4C05A 3BVWA 1ZU5A 3CTPA 1D4ZA 2CXXA 5DIFA 1OLSA 3D2LA 4EM6A 2O1EA 1EFDN 3LXXA 3N2ZB 3MT8A 1RVDA 5DGCA 1UFKA 1SVLA 3OTGA 1YJAA 2NTJA 2X14A 3IOCA 3NOXA 1YGYA 4H9GA 2YV3A 4A2WA 5TMDA 2C84A 4C2TA 2MTBA 4UAVA 2DFDA 1X74A 3N2YA 4HNGA 3PYXA 4Q1EA 1RLTA 5D00A 1XZDA 2H57A 5BNWA 4P3OA 4AN1A 3UUGA 1CZLA 2R85A 2PM8A 4G9GA 2A84A 2Q6VA 3T95A 1TECE 3P9NA 4EYQA 5BSMA 3U3KA 3RASA 4O6VA 1P4GA 2XJ4A 4X6XA 3RWMB 3MWDB 4BMSA 3DE2X 4PAOA 3T9BA 4KAJA 2PA3A 1V35A 2QI9C 3OMWA 4R2XA 3KRTA 4X1YB 1VSUA 3MQ4A 2KB0A 3N0XA 1U2PA 3PPIA 2NO6A 1AUXA 3WHPA 4UNSA 3PEFA 1T8WA 3H5OA 5E8JA 5BUSA 5K4HA 3TLYA 1KH2A 1M2FA 2AF3C 3BOSA 3F49S 3OJLA 1KA9H 4TL9A 3MWJA 4F5EA 3HJUA 1FSFA 2XUDA 1JQDA 3JQFC 1ONBA 4QXOA 3CRQA 3IPYA 2H29A 4XYBA 5JASA 1M72A 1J99A 4EBFA 3LUCA 3N0RA 5BXYA 3HJRA 2PU7A 4DM4A 3GLRA 4EELA 3U13A 2QV7A 4N9WA 3AOEA 4DLBA 4PLTA 2ZYTX 2EP8A 3UWSA 1GPLA 1PQWA 3P9XA 2X4DA 3SHOA 4X1YA 1G5FA 4AZ3B 5JZ9A 4UUMA 1RP1A 1YVEI 3IMCA 5TARA 2YYAA 2Q2QA 5CDYA 1MH9A 3HCRA 1E64A 5C0OE 5CFZA 3GY0A 1PFWA 3GVPA 3AF1A 1U98A 2YL8A 2QXLA 5LYYA 5CW2A 1K88A 1P9NA 2CLDX 1K0UA 2IZOA 3F7NA 4HC4A 4OO3A 3ZLVA 3A98A 3ZVKA 3Q3EA 3PTAA 2K7FA 2OBMA 1MOSA 3KEQA 2OESA 1FXWF 4MIEA 1BVUA 3RC9A 3GLFB 1NN0A 2A3NA 2YHIB 4KHPB 3KV1A 2NPIA 3DDOA 4GYJA 4PF1A 4BUCA 4D4KA 1A96A 1IN5A 4YP5A 2O0I1 2W6PA 4H6XA 4GI5A 1XX6A 5NULA 1KY2A 4D45A 3A6GA 4OHBA 2VRNA 1XCGB 5F5LA 1H3EA 1MW9X 4AZ3A 3I73A 3DTNA 2HEGA 3H9BA 4ZO4A 4OM7A 4ENWA 1B74A 2CK3D 1D4AA 1L4EA 1UBOS 3R6DA 4G8DA 4KFTA 4ZVSA 2PQ0A 3PC4A 1UBNA 1YU6A 3F9RA 1I9GA 1JQLB 4MR7B 4YMVA 4U9UA 1E1LA 3KHKA 3AUSA 5EHGA 2D1FA 3VYSB 4TUYB 5HJ7A 5K0TA 2QROA 2R00A 5A0FA 2PZLA 4E1VA 4HH3C 3IOEA 3KZMA 2UZ4A 3GLFA 3RAFC 2GAFD 3GEPA 3UOWA 2YHIA 4YJ3B 3H8SA 5C7YA 4PGAA 4NBVA 4WKOA 3H9UA 2A33A 5DLDA 2C7OA 2QJFA 3A32A 3MTGA 4HN4B 4YJHA 3A3NA 4ZQBA 2GA8A 2QRJA 2ZS7A 3EXEB 1AUPA 2VTVA 5DEOA 4DV6B 4M9UA 3JQ7B 1YRLA 1T5IA 4QFMA 3H9CA 4Q9LA 2DTDA 1D9ZA 3DEHA 3CEHA 2G36A 3TEFA 1V16B 2QE7A 4OB8A 3RYHB 1O6CA 2Q3FA 3NONA 2X6RA 1OFVA 2J4DA 4KRXA 4AUKA 1GR0A 1F2VA 4RTNA 1EUQA 2O5EA 2HXSA 4MR7A 3HLKA 2HJ9A 1WF6A 3KQYA 1GFIA 3G1UA 4GWLA 4TUYA 4GMXA 4B5KA 1DV2A 5JWOA 4RC9A 4QBKA 4UZSA 1FQJA 1L5FA 1SH7A 2XGOA 3O4VA 1NVMB 2QDXA 2D1LA 2EDCA 1M34E 2JIMA 2Q4EA 2GF9A 1BOOA 3AERB 3E9EA 3JRWA 4YJ3A 1IN1A 1SO8A 3GCWA 3UCXA 1TX4B 2UVDA 2AT1A 3EXEA 4QM6A 4MI3A 4ND8B 2RGYA 3JQ7A 5FB3A 1DC7A 3S2IA 3R44A 3G85A 3KQVA 1G8AA 4WK6A 5AJZA 4ENQA 1EDEA 2XQFA 3A6ZA 2ZVQX 4MUYA 4O4IF 4F4CA 3WGIA 1QRTA 4EG8A 5L4NA 1V16A 4HB2A 3DC7A 2C4WA 2YC4C 4XYGA 4Y2TA 5E9AA 5HHTA 2NV6A 2Z83A 2ZETA 1ORHA 2JJ1D 2XY4A 5HUJA 1JLHA 3GA7A 4PZAA 2JIRA 3ZU4A 1KKLA 2OP1A 3EQ8A 4OUDB 5DHFA 2FEKA 2XTMA 4YAGA 1EX6A 2WSYB 3KX2A 3K2EA 3MINB 4GMKA 2I87A 2CYCA 1I30A 2RHCA 2PQ2A 4H6PA 3S1AB 3DHEA 4EAAA 1XF1A 3AERA 1ACMA 4Y6LA 5A9SB 2Y71A 3VPAA 1EVQA 4BKUA 4C03A 1V2HE 2ZBEA 2ZXUA 3L06A 2IVZA 4KQEA 5D7NA 4B7UA 4BFWA 5IJWA 1P19A 2WAOA 2WUVA 5K4AA 1T5BA 3T7AA 5JDCC 4L3OA 3IUJA 3U4DA 1RJEA 1ZRNA 3WGZA 1OYYA 1MV8A 1ZWKA 3FLMA 1KI6B 3FSGD 2SECE 4OGKA 1JTEA 1R1DA 5H3CA 4JWKA 4ZREA 4QO7A 3NBQA 2CV2A 3D2CA 1L5HB 1OGIA 1Y1PA 4OUDA 4OL0A 2GXUA 4PC7A 4NC9A 3TX6A 3JCZA 3MINA 4JI1B 3OQOA 4EF4A 4M3NA 1PG5A 1P2UA 3ORRA 3SXUB 2RAKA 3HP7A 1EBFA 2RGDA 4JP3A 3S1AA 2ZWOA 3KSDO 4NBRA 5A9SA 3FFBA 1TZCA 4IY1A 4WERA 4NJEB 3D7MA 2B7CA 3TMKA 2AD5A 3BA6A 3JVIA 4J9VA 2WTMA 3GRFA 3WWEA 3CA8A 1O9BA 2QNIA 2QP4A 3HKDB 2DGDA 1SXGA 1AIPA 3E22B 4ZYWA 4A82A 3DEFA 1N8KA 2FXIA 4ZZIA 1GUYA 3NASA 5AJHA 1YIOA 1KI6A 5CFQA 1V48A 3EY4A 4XQEA 5G1NA 2Y66A 3P0EA 2FN7A 4W1RA 5AOAA 3VYTB 4LJ9A 1QCDA 1ZUHA 1U8UA 5AUQA 3X2EA 2ZG6A 3AIOA 4IGAA 3LW8A 4XKJA 2P6RA 3NVKI 1L5HA 5DOVA 3ZWAA 1ZAKA 2HHAA 4O4HB 1ZGBA 3B7PA 3L07A 1J8VA 5A6VA 5IKPA 5I3CA 1WUHS 4PQEA 1MRSA 4ZVTA 3I04A 5CXQA 1URUA 3SXUA 1C81A 2LWIA 3PUJA 1GHTA 4J3FA 2XMBA 3REGA 3RSLA 1MXFA 1S2MA 2X1HA 3HB9A 3ZY3A 2ZJBA 3R8CA 4CM8A 2M6SA 4ZVNA 1ZA2A 4EA8A 2IYPA 5CPBA 5FKJA 3HKDA 1AC5A 4PLYA 5LOVA 1EVEA 2VXOA 3MGAA 2XYHA 1IOLA 1N78A 1E2IA 3E22A 1R0SA 4TT8A 2J6HA 1XQXA 3BHIA 3W5BA 2BYTA 1QM5A 1SCNE 4LF9B 5FUXA 1VE6A 2BBWA 1JXMA 3U44B 1BZYA 1RW4A 2G1KA 4BQQA 3NRBA 3ZV3A 1T3HA 3TSOA 4HNTA 4CIAA 3WLEA 1AK2A 5C53B 2XNDD 5CEEA 4EPRA 1SC1A 1Q3KA 2EHDA 3DOOA 4HDQB 4PSAA 1FS5A 3G5UA 3EDCA 1R2QA 4IDCA 3GLIB 1CDOA 4D41A 5ADHA 1B0AA 1V9LA 2I2XB 2NNWB 4WFKA 3GAAA 3S3TA 4BUZA 4X65B 1MO6A 3CE6A 4PYJA 5HKBA 4XOUA 3DZGA 3OLZA 4QTXA 1UDCA 2H1FA 4GGMX 3MWKA 8ATCA 1PJRA 3NX4A 3WFIA 1SG0A 1OXTA 2GJ8A 3PI7A 3R5JA 1QF7A 4IIEA 4C6TB 1Q77A 1SB9A 1PT9A 2BP7B 1G1AA 5LKAA 1DHTA 3A10A 3AUKA 1W44A 1P7ZA 2B4KA 1QHNA 1B2RA 3GNTA 3BHNA 3M5PA 3W78A 4I08A 4LDRA 3RS9A 4BJ1A 1C9KA 3U44A 3P4UA 3NHUA 3ZD9A 1ZK1A 2C7QA 1PWEA 4HNRA 2XUOA 3FTDA 4UAUA 5ECWA 2E4WA 1PJBA 3A3PA 3V6LA 5JW6A 3GLIA 2OBXA 2RHLA 3EMKA 5CM8B 4DMCA 3DFZA 2ZRJA 4BE4A 3QOFA 3PEUA 4E5PA 3B1FA 4HEHA 2C31A 4IZOA 4F96A 4GQBA 5ER6A 7YASA 2ZJ7A 1XXHB 1ST3A 2V4MA 3PHGA 3OQ6A 4C4YA 4J9UE 4YHBA 1E0KA 2GM9A 4C6TA 2J0VA 1X15A 2JC3A 4FLMA 1PQUA 1BHO1 1GPJA 2OW7A 2V1UA 3CX7A 2BP7A 1SOUA 3Q72A 4KO2S 5JAZA 4NQRA 3ZTYA 3ZVLA 3CVVA 1A3CA 2AKAB 4K0KB 4MYTA 5H3LA 1AQYA 1QVRA 3NHMA 1U2RA 1GV0A 1VL2A 3COVA 3H11B 4L5YA 5BYBA 1PS3A 3PLRA 2XNJA 1USIA 2GJ9A 1NN1A 1NVEA 5CW1A 4Z1OA 5IANA 2V6BA 2PZBA 5FI1B 4PG4A 3I83A 3WBJA 3L49A 3WL4A 2VJNA 1JU9A 3F90A 1DXQA 1H8HA 5F98A 3RK0A 4ZO8A 3K70D 5CK5A 4ZFNA 3IIJA 3EXG1 4KQ9A 2GEJA 1ICIA 3F6BX 1DAHA 3K0CC 4NS4A 3OZCA 4M38A 2GJAA 1XXHA 3KAWA 3IP9A 1YT5A 2NYRA 1H23A 4V0QA 2O8FB 2VT2A 2V4UA 1Y5LA 3MLAA 1ZUD1 5DZSA 2FSFA 2D0PB 3VZRA 1GTRA 4F5YA 1MQ9A 4TYQA 5ED0A 2F7PA 2X19A 4IJ5A 1GV1A 4OKIA 4OQDA 5E4FA 1MABA 3EXHC 3KR2A 4DQXA 2GAOA 2PY6A 1CF9A 2YYSA 3JZDA 2GFQA 5A4JA 3SYVA 2AOWA 2YWFA 3DBRA 5K03A 3GBPA 2PXCA 1BTOA 1MB2A 1V1RB 2CK3A 2H1VA 2XIQA 2Z43A 3Q98A 4OI2A 3JQGB 1T9KA 1V8DA 5JNTA 3HC7A 2G83A 5H81A 4W9RA 3DL4A 4ARIA 1XZKA 4D9JA 3K6KA 4MCIA 1VJ1A 3TOZA 3UK6A 3K2IA 3N0TA 4RZQA 2C8VA 2CUKA 4I9GA 1ATIA 1Z0DA 2UXCB 3WR5A 1G7RA 5ES4B 1KR5A 3C7AA 5DX1A 5KSOA 4P58A 1SXJC 3IULA 4H18A 2O8FA 1DG1G 3HBFA 3VKUA 2D7CA 1UPAA 3CBGA 4G36A 4TKUB 2WTXA 1Z4IA 3M6VA 4MYUA 5JR3A 4KFRA 4RWEA 1KAEA 2PSEA 4Q9NA 4Y1FA 1M6VB 1UT5A 1V1RA 3T15A 5REQB 3JQGA 2D1SA 5BORA 4G5SA 1E3TA 2QZZA 3D5EA 3LC0A 4OBBA 2D4AA 2NPOA 3T6KA 3KG2A 4TL6A 3D3EA 4HAYA 2DC1A 2WU1A 3M89A 4KBYA 4EB3A 3AM4A 4K3UA 2GI4A 2GEBA 2N47A 3EIUA 1FQOA 3A1DA 4NBTA 3FNEA 4OKNA 5BWCA 4LSGA 3ZXYA 1F3LA 1BX3A 4NOKA 5T6BA 3DT6A 3EIFA 1LDMA 2VRWA 1CNEA 4DBVO 3NW9A 3K9FC 1VGQA 2VCHA 2XUGA 2YL2A 3ZJYA 1Y3FE 4EG3A 5TMPA 3B2EA 4MGIR 3PJDA 4BVAA 3EODA 4O8CA 4DM3A 1CUYA 4W8OA 4WOCA 3HSSA 4POAA 2WTBA 3HN7A 3NIDB 5I51A 3QMVA 4D80A 4H7HA 3Q5DA 1M6VA 3P7MA 4YQZA 3VV2A 3IH5A 1RJDA 4RZ2A 3T94A 1FLVA 3V48A 1PT8A 2VRCD 4E21A 3NGMA 4X93A 4WZBB 2FQQA 5IAJA 1JVNA 2FZ4A 2IEZA 2JJ1A 4UBLA 1XLWA 1J2EA 1T1RA 5BN4B 3BHMA 3S8YA 4JP1A 3GPLA 3ICOA 4UE6A 1NRJB 3LUDA 3KAJA 3OP4A 4RV4A 1QZXA 1YBMA 2WMYA 1VRVA 2X15A 3BFXA 5JEEA 1XPRA 2IA5A 3ENQA 3ELUA 2GTHA 3LY7A 4QVIA 3HZZA 5A1TA 4F00A 3LTNC 1YS9A 4YRJA 3ZGOA 1FSSA 1NQ5A 1X1CA 4WY8A 2HR1A 4AMYA 5JNSA 3MMXA 1DP4A 5KNDH 1XHEA 1RLJA 4ZVPA 4MW9A 1EFVB 1Z7GA 3RT7A 1KAOA 1U28C 2O3QA 4EOGA 1GGVA 4TTRA 1QMGA 5T6MA 5BNFA 6LDHA 3E3OA 1PDVA 2G0TA 2GBGA 2W8BB 2WM3A 3JY6A 3CNBA 4Q1VA 2AFIB 4H0FA 3I37X 4WZBA 1U94A 1VA4A 3FOBA 4JUBA 2G77B 3CN7A 5BN4A 2OC9A 3LDAA 4J0HA 4XJVA 1IN8A 2JNSA 1OAKA 4HWSA 4XX1A 5H68A 3JR3A 2C2XA 2PT9A 4ZQHA 1QIMA 3VOBA 1N5OX 1BS9A 4DLVA 3SR0A 2OFOA 3VUFA 5B1YA 2XRZA 4YAUA 1F20A 3L6RA 5EJ6A 1YZ3A 4MMZB 2R6FA 4H4CA 4KO1S 2I4RA 2H5LA 4IM2A 1W1UA 2ZR0A 3CONA 3DKIA 3FWZA 1QZ3A 1TYCA 3LVTA 1EFVA 3GHHA 2VDOB 3QLEA 4L6IA 2J0UB 1I7DA 4XUEA 1T5TA 1UEJA 2VHCA 2P3QA 4LOHA 3E9DA 3ILHA 2FR0A 1CDDA 2WRZA 3ZGYA 4FYKA 1EBBA 1HE4A 2FPPA 2W48A 2V7TA 3B8HA 4IH4A 4M1SA 4GC9A 1ZUWA 2AFIA 4Y2SA 1Y33E 3N76A 5JY6A 3O90A 4MZDA 4KK3A 1UMKA 1RQPA 2B8TA 5C4GB 1WVIA 1T1EA 2QPTA 4IJVA 1QO7A 4NE2A 1AK1A 1MIHA 3PIRA 4QOJA 4UPVA 4Y2VA 2ZWAA 1MH1A 4FGWA 4AZWA 1UK9A 3FJYA 3NC1C 4HEJA 3GP5A 1UJ5A 3V4RA 3AHIA 1A97A 1Z2OX 4IMPA 1I4TD 1T34A 1CR2A 4KOEC 3LTEA 1WIWA 1TADA 4CI0B 3U4MA 1OHHA 3A4VA 2VZ8A 1WXDA 3HB7A 5EVCA 3W4JA 4G4SP 3AJDA 4ZO7A 3ROMA 4B46A 1QDUA 3OETA 1U8TA 2GD6A 4DNPA 4ARCA 3NIBA 1YCGA 1UC9A 2DH6A 5TEVA 4JBYA 2P62A 1YB4A 3SHTA 4YRZA 1D9XA 1FLDA 4M2LA 4MRVA 4RGVA 2CD7A 4BNNA 4RPLA 2VPWA 3TH5A 1WUJS 4DMGA 1P18A 3WMWA 3N6RA 3BZBA 3OZXA 3SEZA 3M82A 3CU5A 4CMAA 1P4JA 2PT7A 3KZXA 2P3SA 3DMTC 1VI5A 5CXXA 3NBFA 5C1PA 2AFVA 2H5IA 1P7VA 2X3FA 3QEMB 1VMDA 1YRHA 1ESEA 1E63A 2XCIA 3IX7A 5SZHB 3IKJA 2A9QA 3NP9A 4MVWA 1I49A 1UJNA 5FYDA 5KVCA 5AJTA 4HFRA 4PPFA 5IJAA 1M73E 2A7XA 2FOXA 4XM1A 3TRDA 4MRRA 4RHUA 1L4GA 5KJEA 4K6OA 1AS2A 3L4BC 4TTQA 2CXPA 4LCJA 5CNMA 1W73A 5LP6F 1L8LA 2PKEA 1FSPA 1RT9A 1N0HA 1XMXA 1PNVA 1R16A 1EXMA 2OWDA 4NYIQ 4Y9UA 4GKKB 1C7IA 1TFUA 2V5AA 2NLOA 1A9PA 2X40A 1OOEA 3AG6A 4UBKA 4XCXA 4EVIA 5M29A 3KB6A 3R6WA 2W6IA 5DSZA 2F3QA 2IOQA 2O0JA 3HHEA 4KSCA 5KNBH 1QS0B 2OLKA 3G7SA 3RHFA 1FF9A 4PLCA 4JYAB 1I4DD 3QEMA 1M8PA 3K70B 4MV9A 5EYPA 1VKHA 4K0RA 4MR8A 4Y2RA 3UYKA 5ERGB 4N5IX 5C32A 4RVGA 5H59A 1TK3A 3T3OA 1SBQA 1WSAA 2FP3A 2Z57A 5FR1A 4FR0A 1ZSNA 1YBAA 3R23A 2IITA 3SE7A 3VX3A 4J07A 4UHCA 4OM8A 1B0UA 1U0LA 3LUJA 4MUXA 5A2QA 1ACJA 4RZHA 1ZONA 3SSNA 5COAA 5CYOA 1WL8A 3IELA 4CKBA 1YR9A 4KLAA 4FOLA 2VYVD 1NFRA 4C07A 2NU7B 2I62A 3OEHD 1T5DX 4B34A 5JMTA 1RI5A 4HLCA 3SKVA 5JSUA 1TAUA 1LWNA 2QGNA 821PA 2JKZA 2J6CA 4MINA 1QS0A 2ZTHA 3CNQS 1GNLA 1Y7IA 4GX5A 3IEXA 3VAAA 1KYYA 3A6HA 2ZTLA 4F60A 1L7QA 2FF7A 3WDSA 4I3FA 4PZCA 4WFJA 2ST1A 3Q12A 2DTXA 2J31A 4OK3A 2DULA 2OD7A 1KIFA 1ZRMA 4HNVA 1JMYA 3RLIA 3QVLA 3E9NA 3ZWXA 4HY9A 4EZUA 5HVNA 5FNVF 3WB9A 5DLPA 4KR0A 4YT2A 1SCJA 1U9CA 3BB4A 1UZLA 4FNMA 3LIPA 3KQTA 2Q28A 4DIBA 3G2MA 3IAFA 4RH0A 4F93B 1NXXA 1QLHA 2X1VA 3EK2A 3AVYA 1PYGA 4RA6A 3HEAA 2YVQA 1JEAA 1ZUIA 2A6PA 1SCAA 2COUA 1KYIA 2OBLA 3RJMA 3WBKA 5BQXA 2XUIA 2NU7A 4D1YA 3KYDB 1G5IA 3NHFA 4QASA 3L9XA 4F1WA 3BEDA 4X90A 3AESA 4RORA 4X3CA 4OLBA 3UHOA 4BMZA 2Q6OA 2WE8A 3GIWA 4H17A 1K9VF 2CNBA 3D31A 5KYWB 2ZIGA 1P7CA 4JEUA 3FVVA 2O2ZA 3DO6A 3K0AB 1DOZA 2JGAA 3PGXA 1HT0A 1O87A 2BBSA 1LSOA 2DWCA 2F90A 3AWDA 1ODSA 3IOYA 4G37A 4LXIA 3OOJA 2IYWA 5ALSA 2A0YA 5JXIA 1ZNZA 3IP5A 4OD0A 4EG6A 3NM4A 2GEKA 3OESA 1UC8A 1KRWA 3C7NA 1U3TA 4YONB 5K01A 1WDTA 4QSMA 2X3WA 4TMWA 4ZI3A 1EK6A 1BQ4A 1T2EA 1Q83A 4KK4A 1WZEA 5C8VA 1QK5A 3O95A 3I0ZA 1KBOA 3FTQA 1QE3A 4RZUA 4E3ZA 5B1HA 4PLWA 3RV0A 2QAIA 5EOVA 1FMCA 1OAAA 3PV0A 2GCGA 4IL5A 3JRNA 3LOPA 5KYWA 4JJAA 2R47A 4H31A 3V1TC 3UPDA 1WU8A 3MRSA 5BN1A 4DNQA 3EULA 1L4FA 3K0AA 3BREA 3E84A 5TQ2B 5ELMA 1JSRA 1ORIA 1QUFA 3F96A 1OFTA 2JDIA 1VA5A 2WVAA 3HPQA 1TQWA 3EGEA 3M0EA 3M8KA 3OFJA 4IZHA 3GFBA 4W7SA 3JWEA 1EG2A 4EENA 1TKCA 13PKA 4KL8S 2CMHA 1H22A 1A9SA 3AUAA 2Y1KA 1X2BA 4RHFA 3GN1A 3EDYA 3NEJA 1Y7HA 4FT2A 4NAUA 5E8RA 1AXEA 1CQZA 1DX9A 3EUWA 5FNZA 3CV3A 5BT9A 3BWVA 3CR3C 3O4GA 3QVMA 4IINA 5HW0A 1NC3A 3ZGNA 4LZLA 1FFEA 1DCTA 5FPHA 2CCGA 1TO1E 1CR0A 3OP1A 1SBCA 4FR5A 5CIWA 2VDQB 1M66A 2ZB3A 2ZEJA 3NT2A 1G5HA 1A69A 4DBZA 3IIEA 3MNFA 4ZYXA 4DJTA 5KTNA 5H0IA 3O75A 1Q6YA 2HSWA 4M1YA 3RF6A 4IDOA 4IRUB 1DELA 1CJCA 1SQ0A 1T3LA 1X86B 1USWA 3C3JA 1M8GA 5TQ2A 3ZHSA 2XLBA 4QSHA 1A1VA 1KQ3A 1PV1A 1N0IA 2ZW9A 4EKEA 3MJCA 2Z2XA 4CIDA 3FAZA 4RAQA 1PD0A 3JVVA 2FV8A 4FFSA 4WLVA 4D46A 1Y8RB 1E69A 3VTKA 1ZMOA 2WA2A 3P9IA 4EW3A 5TGTA 1L4BA 1GITA 2QMHA 4QPDA 3RYCB 3GLFE 3VR0A 2QUJA 3BWYA 2ZPAA 2MOKA 1ENPA 1U2QA 1NSYA 1GAJA 1PW7A 2JAQA 1JH8A 4PS0A 1RNLA 4RPJA 3K30A 2VTBA 1UDRA 3EPRA 4GQIA 5DGIA 2XCTB 3OKCA 4XIYA 4Q7QA 4TTVA 2ZCVA 2O1WA 2AEMA 1N2EA 3IA7A 5K0LA 3V4OA 3N59A 3RGGA 4Z2AA 4F06A 5IVHA 4I99A 3W3AD 1WXWA 5G3YA 4JKYA 1IVYA 4PWYA 5B57C 3H86A 5HNKA 2GFIA 2GESA 4MDYA 1E1QD 2PXXA 4O2AB 4X71A 5P21A 1TYAE 1Y8RA 4QTYA 4L4SA 3ZCQA 3PC8A 4XI9A 2WA1A 4UEKA 3UJNA 1FRNA 4EMTA 3FRJA 3KWFA 1P3JA 3RYCA 2EFGA 4R3WA 1NI5A 4LI0A 3WYEA 4EUSA 2P2NA 3D4YA 4ON9A 4FJ0A 3K72B 1G6OA 5IM4F 4L8WB 1FNCA 1LUAA 1JH9A 2ORVA 2Y05A 1YFKA 5FULA 4HRVA 3DMGA 1IBKB 4EQ6B 3H2YA 4J2OA 1ZCBA 4BO0A 1NQWA 1HDYA 2XB8A 2VJMB 3D0KA 3JR7A 4YP7A 2PGLA 4MEJA 3ABSB 2P65A 4E2ZA 1G7CA 5TKYA 1H6DA 2ZWIA 4FOOA 1BDIA 2BH2A 2NCZA 3II6X 3VX4A 4XH9B 3SIRA 3OT1A 3KO8A 2ZJ8A 1XELA 4O2AA 1MTZA 1JV2B 3FY4A 4DL9A 5MGBA 3L7NA 4L5IA 4NYIR 4NCIA 1RYDA 1DARA 3R3ZA 3IESA 4HDKB 1MVOA 4OHOA 1O96A 2DR3A 4U5XA 4ZQGA 3CISA 2C7PA 2YUTA 1ZGAA 3GZNB 4Q3OA 1IUPA 1EFCA 4UMDA 4L0QA 2BC9A 1O57A 3U4GA 3BUDA 1WS6A 2QR2A 1LDNA 2VP3A 5CT6A 5J1TB 1MBZA 4C0HA 4R5MA 2F3SA 1BCRA 2BONA 2PYDA 2GN4A 2Q3HA 5JWHA 2WIAA 1JDSA 1F8UA 2PUWA 2V7QA 2WZBA 2YJ3A 3C8HA 4QQKA 2ONJA 2ZBRA 4BBAA 4HAIA 2VJMA 1U9IA 2Y0EA 2I1LA 1GCGA 4F38A 1BWQA 3A4NA 1QOZA 3MPUA 3PXAA 2IIQA 3RS7A 3UA4A 3UMFA 4QEKA 3FUTA 4AT1A 1XFDA 3EIQA 2QLTA 3LYUA 3BIFA 1BQ3A 3LF1A 4OP2A 4XWTA 1JLRA 1NX6A 1WQ3A 3F0TA 2AGVA 4MPRA 4ZK6A 4KXNA 2A94A 1KGSA 2ZUUA 1XXLA 3PNLA 2V9PA 3QYFA 1U4SA 1LI7A 4HDKA 4LJKA 3AEUB 4QGAA 4UM5A 4YFYA 3GZNA 3CMCO 4S12A 3OWOA 1JE0A 3EEIA 1L7EA 2SKEA 4JK3A 4N12A 4KSBA 2NXWA 3KL4A 2FMKA 4ZARA 1V8BA 2JHFA 4LWOA 2C3PA 4MAMA 2I3DA 1NLFA 2PS9A 3CUYA 4MB6A 4YACA 5KMGB 1VBFA 4MGEA 1VSVA 4NH0A 4YMLA 4IHJF 1XZNA 2D5AA 2WMDA 1H2YA 3DO5A 3PRKE 2GX6A 3A0RB 3BZWA 5LLSA 3RREA 1ZD2P 2PMCA 3UIEA 1G66A 3S2YA 3WNVA 4CMJA 4DWVA 4BNYA 5SY6A 1PG2A 2XIJA 1RAIA 1WCIB 2Y1LA 3DOEA 3JYQA 3FZYA 4LZWA 5F23A 1HYQA 2YRWA 4JI3B 3VNRA 3HA2A 4AL4A 4MV4A 3U7JA 4HQ0A 3JQFA 2JLZA 4EW2A 3HFGA 2VSQA 1ZM9A 2R7NA 1R8QA 5KDOA 1RQ7A 5J1SB 1KERA 2QLLA 3AF4A 4HB3A 3PJRA 4MUGA 4N1AA 1PZMA 2IOFK 5E3HA 3U3ZA 1PJLA 3CWQA 1WUIS 2MIIA 1KZ4A 4OU5A 3WLNA 1KDPA 3PQ6A 1QVAA 1RDFA 2Q6IA 4WFQA 2DT5A 4X92A 4CR8A 5KMGA 4MGZR 1EAMA 4G5YA 4GKAA 3QA9A 2ONCA 4S3MA 5L51A 3FF4A 4IWOA 4G6QA 5FT9A 1EJ6A 1FNSA 4RVCA 2BM8A 5JY1A 3ICWA 1WCIA 2HK9A 2Q6KA 4G1MB 4LC9A 3T7JA 4AS2A 1NPYA 3EXIB 4WL0A 4BVEA 4HKTA 1RCFA 4PIMA 1AKMA 1V37A 3M3HA 3OM8A 4HB0A 4RMJA 5IG2A 1NRIA 1QUEA 2WWTA 1FNBA 3GLKA 3O4FA 4NENB 4Y2JA 2QMUA 5L3SB 2QX8A 3AIKA 2CVPA 3U3OA 2NSDA 2IKQA 3FB4A 4F4JA 3O8RA 3LV8A 3RJ5A 5EMKA 2A9FA 1GDDA 4Z7JA 5HIIA 3W5HA 5FOWA 2PRKA 2XUZA 3LFTA 2YINC 1L5MA 1BMTA 2RSLA 4KXUA 1YR7A 1VCIA 3QWFA 1JFRA 4CDMA 5JAMA 3VZBA 3X1ZA 3W6NA 4RIEA 1FS6A 3NV7A 4LWZA 3NU1A 2DBYA 1OWMA 2LGJA 1NR7A 2WF9A 3SXPA 1AGXA 4BNEA 3EXIA 4O4JB 4UVIA 4NJMB 2WBLC 3OE4A 1VOTA 4LXHA 2EX3B 3FWKA 1EWVA 1W47A 5ANRB 3TQOA 4EI2A 5L3SA 3GLIE 5AP9A 1EG7A 1T36B 4YUVA 4TV9B 5JD5A 4YFVA 1JVSA 2WHPB 3EWAA 3N87A 4J3JA 3V00A 2QTTA 3UITA 3LE8A 4MRSA 4YMWA 1TEHA 2VDWB 1NBMA 3URKA 5K8UA 2DFVA 3RC8A 3DHVA 4QBHA 5JBNA 1OYWA 4N7JA 2VXCA 4JP2A 2C04A 5LYJB 1ESNA 2PL5A 3RUEA 2UUCB 3CUSA 3R9XA 3PXXA 4HCJA 4TT3A 5E1DA 3PLNA 2NXEA 3WHKA 3G8BA 3VH3A 1DXHA 2G1AA 3GGJA 4NNPA 4R2WA 1NVAA 4I4TB 1EUDB 2R11A 1I9CA 1NM5C 4NBKA 4O4JA 4NJMA 3H8JA 2YVKA 3MT9A 3MTBA 2IT1A 5G53C 1QRUA 2YY5A 2KS6A 2C95A 3AR9A 1KDTA 4KQGA 4XCVA 4X5OA 3WYBA 4ZV4A 1Z6PA 1YUBA 1T36A 4YTEA 4TV9A 3F71A 3UPUA 2WHPA 4O02B 2QA5A 1X87A 1KZ6A 4XD7D 2WNSA 3B5IA 1EU1A 2HIHA 1V1MB 3HWX1 1XXHE 1ZD3A 2BR5A 1J1ZA 1GKIA 2VDWA 3KT0A 3CH5A 4KMSA 2ENUA 8ADHA 4MVJA 2Q07A 1V8ZA 5I4KA 3WQRA 3W0LB 4MDFA 4Q01A 1MJGA 1D2HA 1OIXA 2YV5A 3EEYA 3NCTA 2XHZA 5LYJA 4CKYA 1XA3A 1YRQA 1UXOA 3C3AA 4BKMA 2H92A 3N0WA 3H5WA 3ZDFA 1KTIA 2O1SA 3M6LA 1W0JA 3HUDA 1U7UA 3UMMA 4I4TA 4NR0A 1EUDA 2MHCA 4L72A 4RUKA 4J0GA 1EWTA 1E1RD 1K6EA 1HKUA 3AGQA 4KBGA 2PYIA 4UJ5A 4BX2A 1QIEA 1H0HA 1FFSA 2BEJA 4IF6A 3ISVA 2O2YA 4MPDA 4MVXA 4JI0B 3MC1A 1RWOA 1FDVA 2Z95A 3E3MA 4INJA 2QF7A 4R5LA 1QU3A 1K5DA 2YICA 1P7PA 1OB5A 2REBA 4Q34A 3QA3E 3UF0A 2YN4A 4YROA 1V1MA 3VEBA 2JAPA 2Z08A 3SMVA 1Y6QA 1VJRA 2B36A 1BE1A 2BOVA 1USGA 4BAUA 2PZKA 2D4CA 2HWUA 3OOHA 1THZA 2GEUA 5JISA 2D4HA 2QHXA 3GVXA 5A5DA 1T9GR 5I9LA 4RD1A 5JDCA 3BICA 2PGIA 3CZRA 5EP1A 3TJZA 3TOCA 3ZWDA 4PGGA 4E6EA 5TF0A 1WXFA 4OYHA 3CWCA 2ZI9A 3DVLA 4RPCA 4LZZA 4ZXFA 2F9MA 3W3AA 4IIFA 4Q1BA 3F8SA 1DCKA 4GXNA 4TYMA 1JLLB 2XZDA 3FYSA 3W6UA 4AJHA 3ZVMA 3C5WP 4R6WA 3WLPA 1VTKA 3OO1A 4F04A 2PXAA 4YASA 4F1JA 5A4DA 5JARA 1R5JA 3AXTA 1VHDA 5CLHA 4IWXA 3GDGA 1NI4B 4N41A 5K8TA 4B9EA 5JROA 3LCUA 4CIWA 1SOAA 1G59A 4DUGD 2G8LA 3M3WA 2WB4A 2MI7A 3WXBA 1N0VC 1YDWA 5BMVB 1KPHA 3OZFA 1KI8A 2DG2A 3QJGA 7ABPA 1DJQA 2H18A 3OX1A 1FMFA 3ITEA 4BO7A 3D2EA 4L95C 4PN7A 2C2ZA 3IEPA 4AQYB 2P1RA 2I0FA 2QDKA 3E2IA 1JEQB 3KU1A 4BLOA 1G8HA 4FJ1A 4BQSA 3OZTA 1LCIA 2GAIA 2I9KA 4Q4LA 3NTLA 4NDZA 2CZQA 2FFHA 4AJ1A 5JQGF 4F3TA 1JLLA 4F4HA 4KQ1A 4ZTUB 1MJNA 3PFGA 3O8LA 1P4RA 2J5BA 2HAEA 2H6EA 1Z13A 3EIOA 3N2IA 3PF9A 4PZDA 3HXQA 5KO2A 1ZZGA 3D59A 1CUXA 1QNLA 4YRRA 4K9KA 1NI4A 4OQYA 4IJQA 2CFCA 3P71T 3FR8A 1ZAYA 2TMGA 4LWPA 3TCNA 4K86A 3ZS8A 4BX8A 5EKDA 2OO5C 4XGKA 1ST2A 2QT1A 4PZUA 4EW6A 5JZBA 5BMVA 4QELA 3GAZA 3LFUA 3U19A 2IYLD 4ME6A 4WESB 4CM5A 1NI3A 1Q15A 5TJHA 4BASA 1G8JA 1AH2A 4ES6A 1IUKA 4DLNA 4O33A 4J0KA 2R5WA 1JEQA 1PLJA 4LZJA 4LY3A 4OGWA 4OLAA 1V47A 4PQGA 3S29A 4GX0A 5IHXA 2GNPA 3FPSA 3H1AA 3K1AB 4EB0A 4RULA 1TJ3A 5JADA 4L4XA 4NMWA 4HDMB 2PVCA 2IP4A 3RJ9A 1FTSA 2B8EA 5BRNA 1JILA 1NJ8A 4M9ZA 5B3JC 4I1UA 1P4AA 2H06A 4X97A 1L5SA 4GEGA 4MARA 4DSNA 5H8WA 4CMGA 5COBA 4NARA 4EY7A 2WWYA 4OHXA 3ZHYA 4Q0MA 5IASA 5AM4A 4FYHA 2WHYA 3SLGA 3AFGA 4UBMA 1GILA 4AZ5A 4C6HA 4LF5B 3RV3A 4ZPXA 3L4EA 2INGX 3LZDA 3KQSA 3V7UA 3TEMA 3TFOA 3HSKA 1PQPA 1PBNA 3CSDA 3L92A 4WESA 4ARUA 5CLFA 5ENVA 4P31A 4AG6A 1RJFA 3C5HA 2A92A 4JR2A 1WZNA 2AMYA 2E89A 3ZU2A 1LK5A 1KK2A 4S1WA 1N77A 4LF8B 4BECA 4XVUA 3S2UA 3AM5A 3E35A 4EUNA 4TQAA 2KPOA 2QLMA 5E1OA 2AFIE 2CLFB 3K1AA 1TUBA 3A3YA 2G06A 1THGA 3FIJA 3VGPA 2A35A 3Q7TA 3WP0A 1M8FA 3C43A 5LC1A 5JMWA 1GTG1 4X45A 4CL8A 4G25A 5JXJA 4J16C 3ENKA 3V34A 4ZQEA 2BTEA 1JHVA 2H4XA 3FGNA 1G3IA 2PAAA 3MJ4A 4J6FA 4MEAA 4D79A 4BMDA 4YP1A 1RZ3A 4J7AA 1TO2E 1JBQA 1GO2A 1OU4A 1ZITA 5JNVA 2ZJ4A 3BFKA 3FGOA 3KNZA 4BNXA 5FFMA 2F9LA 5D01A 2CLLB 3DMRA 1M2HA 3EVDA 1C4OA 1TTPB 1VJ0A 3ZJ4A 2I34A 1G60A 4RELA 3WV5A 1EWQA 2G4VA 5C8XA 1R9JA 3EXHB 3KJIA 4RHYA 3RV4A 4D57A 1TQHA 4BE9A 2R68A 3CZMA 2VJOA 4X44A 1QNFA 4QPNA 1DIGA 2QD1A 3L18A 2X77A 1HDZA 4XSGA 4C4PA 2ZUWA 2L18A 5KU1A 1GEEA 3H2SA 4NU6A 1K63A 2VWPA 4K5QA 1I2MA 5IVIA 3K2BA 3ZZ1A 4OLHA 3R3UA 3D3QA 1EMDA 1K7FB 3I6ZA 3O8DA 5IULC 4IHAA 3IVXA 3KELA 4PFKA 3K0CA 4FDTA 1KI1A 3I9JA 1EP9A 4M7OA 2YL9A 1SXJB 3WG9A 2W2QA 4M83A 2XYQA 2WU3A 3IKMB 2CB0A 3CKDA 1U8XX 2WKRA 3A36A 3L8GA 3QX8A 5DFAA 3D8BA 5L3ZA 2C96A 2Q3LA 3AO0B 4JJ7A 4B6JA 1B0PA 2LW7A 1Q3TA 4JQZA 1WHSB 5SICE 4BKRA 4C6RA 3D8UA 1JUDA 4ZAVA 3WKAA 1CQPA 1A5SB 1JEEA 4MJXA 2B2NA 3R24A 1PR2A 5K0NA 3OZAA 3UEOA 3WLSA 3WWZA 4C06A 1Y0BA 1CB7A 1RHKA 4NY1A 1PBTA 4RMHA 1U7WA 4U7PB 4QKQA 3LUFA 2FQYA 3MA0A 5ITVA 2Q0XA 5FOXA 2RGWA 2O7NA 2NW6A 3GLTA 2QRKA 3DHYA 2V7VA 3LUHA 4G09A 3ICEA 5FUYA 2F17A 2DHRA 5ALEA 3WAKA 4XRGA 1ELOA 5JIBA 2V54A 2VHTA 4DCUA 2ET6A 4JVSB 1SXJA 4W4TA 5AHRA 5EJAA 4D4GA 4E0BA 5JZVA 4M37A 2C5GA 4ND7A 2VSXA 5TQ0B 5JS2A 4POOA 4QUDA 5DBHX 1YMQA 2IEDA 1SUWA 1VG9B 1Z37A 4LXUA 3AIIA 1UJMA 4XPZA 4NYMQ 1J56A 1SVOA 1WHSA 1G16A 3B6MA 4GG1A 1ECPA 3EISA 4MPTA 3C3DA 1GRRA 4LVNA 1ZQ9A 5KVSA 3Q1LA 1IRIA 4US1R 3HWRA 1FBTA 1EAYA 4ERNA 2Z2IA 2ZXEA 2HZ7A 1R8SA 5JQGB 4KWHA 1L9KA 3G2JA 5D5QA 2YRXA 5IKOA 3IT0A 4B6OA 3QXGA 3HGMA 3QYPA 1KXZA 2B3DA 4FCWA 5AK6A 3ZIAA 3IBFA 3KYCB 16PKA 1FFXB 2B3TA 3TZ6A 3NYIA 3ZHUA 1P9OA 2CCKA 2YV4A 1E61A 2XHEA 1WCV1 2O57A 3P2EA 1GAEO 4WSOA 1ZW1A 2BF7A 4NZOA 3T7RA 3O9ZA 4R1NA 2I6TA 4QDTA 5FHQA 5TQ0A 4XIIA 4C0QC 2GYVA 3DUWA 2CT8A 2BT4A 2NO9A 1VLQA 1G2QA 2IEIA 1A82A 1UBTS 5BSEA 5B5SA 1JWBB 1G41A 1ETHA 2JH8A 3HR8A 1DTSA 3A3KA 2C3MA 2DUJA 3LH5A 3TQIA 1BC5A 1XAIA 1ZM4A 3DZBA 4KE7A 3V8QA 2FUG6 5HQTA 5T4FA 2IUYA 3BSFA 4RS4A 3MWYW 5A03A 3P9PA 1JWLA 4MHTA 3HO8A 2FVXA 1P1FA 1OGYA 3VC2A 4B45A 3Q6MA 1BROA 3PTLA 3PR3A 5FWXB 3K71B 3PNYA 4FNOA 4WQMA 1D04A 2UUPA 2C4VA 1T1JA 3BGOS 4L3VA 3C24A 4KDEA 2IIPA 5U4QA 3WIBA 2ZRLA 5E2IA 1P4HA 6GPBA 5IK2D 5JC1A 3KYCA 4CFYA 4JJGA 1FFXA 3KV3O 3P19A 1PUXA 2HGSA 3DMNA 4YHHB 5EZQA 4JXZA 1UJBA 2DZDA 2EKLA 3ERCA 3I9KA 4HDRB 4A8JA 2ILVA 4NFYA 3GPCA 3KJXA 3MCAA 4UD2A 3KZ1E 3KQWA 2YMLA 2CVHA 4GX2A 4X94A 3QMWA 4TQUS 2ZTVA 2VJDA 1Z35A 4UVDA 3EGXB 1SK8A 4N6GA 4DARA 5G0WA 3DXZA 3N2GB 5H3HA 1QRDA 2NVWA 3ANYB 521PA 3ZS9A 1DEXA 1QQBA 5FWXA 5IYZB 2ZT8A 3OC0A 2A0WA 3D8HA 1VRCA 2RHDA 3COWA 2WSSD 2CBGA 2PQMA 2FPLA 3THXA 4GP6A 1SBNE 5HM6A 3MMZA 4CMHA 2RB4A 2XQGA 4NFSA 3SC2B 7GPBA 1KI3A 1WJGA 2YJZA 3IOMA 1RBYA 2IE8A 3NWOA 4ZOEA 5HILA 1RKBA 3UK0A 3O1JC 4N5HX 4HDRA 3E58A 5LP6C 1PR1A 3WYGA 1K4MA 2FSVC 1ML3A 3EJTA 3ACBA 4OA8A 1J0BA 4I50B 1V5IA 4DUPA 4OX9Y 4DDUA 5F21A 2BEUB 2YLLA 1T1IA 2NZXA 1L8XA 2IZZA 2DLCX 1BMQA 1JRLA 1VMAA 4FW8A 4JSRA 4KQFA 3EGXA 2DBVO 3AQ4A 3TBHA 4PZ9A 3A6PC 4LOKA 4ADSG 4F71A 2PGXA 2HO5A 3N2GA 3OQIB 1FVXA 1X8JA 2A0XA 2HWXA 3DF7A 5SYAA 4A73A 1WLYA 8MHTA 4IFIA 2O05A 4PSVA 4Q6WA 2BUBA 3OCVA 4EA7A 3A9WA 3DXXA 1OH6A 3SC2A 1CVIA 5DXAA 3WLRA 2Y93A 1U7ZA 1XQWA 3GVHA 1G42A 1ZN7A 2YS6A 1VM6A 4QIHA 1TC2A 5EXPA 1FNNA 4XWKA 2AFRA 2HRZA 2J1LA 1FRZA 3HBJA 4PSKA 3VI4B 1YS7A 5CVTA 5ADWA 1GZUA 3ROFA 5JCOA 1DB3A 1C41A 4I50A 3INGA 2GHIA 1U3FA 2BEUA 1FDTA 3M81A 1J0XO 1MF7A 1XMJA 2RC5A 3B1JA 5A1JA 3N53A 1L8AA 5A62A 4WK4B 2PBZA 3T4UA 4MQEB 2AJCA 2I1VB 3OQIA 4JHLA 3SM3A 2WOOA 1T4MA 2Z5LA 1LKZA 1YMUA 1SC3A 3GAFA 1OLXB 3ZG6A 4CKZA 2F8TA 1C7QA 3I9V1 1W8IA 4MP6A 3URMA 3RTAA 2IP2A 4GVPA 3H2KA 3AVXA 5FD8A 4Q18A 3IGFA 3ZU3A 3K05A 3EFBA 1QHEA 2PCJA 2H85A 2QJOA 2QMQA 1DGQA 2VDRB 2PUVA 3I45A 1LBEA 3KLOA 1NIJA 1T26A 4PE5B 3UO8B 4F9TA 1KQNA 1AN0A 4BC0A 1XCBA 3L4BA 3DVQX 2X4GA 2V0NA 3O6VA 3RU3A 1VG1A 2EIXA 3X1JA 4LE0A 2KW5A 3GWGA 2V6IA 3MUFA 3PT9A 4CM9D 4DC1A 4W1QA 1Y48E 2EYUA 4CWAA 4MQEA 2YVUA 4FHEA 2JGMA 4JROA 5BQ3A 1B73A 4FMCF 2DCUA 3JS5A 3OHXM 1GKUB 4QFBA 4DNOA 1YIDA 2AN9A 1U0TA 2VUHB 1OLXA 4WZAA 1MW8X 5JH7F 4N7MA 1WP4A 3FVWA 4YWJA 4TYPA 5EESA 4EKYA 4LZAA 2PX3A 3O03A 2C8JA 2GXQA 1E4OA 3BUPA 4EL0A 4EDHA 1LNZA 5FL3A 3VUEA 4BMPB 3RBVA 3TO5A 3MGGA 1EHCA 1FY2A 1ADJA 3W9UA 4IDBA 5L6MB 1FZTA 1GCUA 1O0CA 4Y6PA 3RARA 4M0UA 5DSTA 4WLFA 4EG0A 9LDBA 4XGNA 4RXTA 4X64B 1R9GA 4A36A 1SUCA 3LVQE 1E3LA 3HN6A 4D4JA 1Q0QA 2WWRA 4C30A 2IYXA 2OO2A 4R69A 1VL8A 2GD0A 4P54A 2WMNB 3DE5X 3GEGA 4F12A 2Y6VA 3QF4B 3IUSA 3RH0A 2G1PA 3DWFA 4HLQB 5DULA 3IERA 3RC1A 3R9XB 2C0QA 4CUJA 3V3TA 3DPQA 2Q2WA 4CN9A 3GU3A 4LCEA 4RNCA 3WWPA 2HD4A 3CFYA 2R8RA 3TQHA 1HQYE 1AHIA 2RAUA 2WPNA 1Y1SA 1D07A 1XFAA 3AEKB 1V7QA 2VO1A 4G5GA 3C70A 4HYYA 4YDHB 5I9BA 4XR9A 3R9KA 3SSOA 1R34A 1ITZA 5BWMA 2XXAB 1MX3A 4QDOA 1D2AA 2JLQA 3FHCB 4YEDA 1ORDA 3W7BA 4NYMR 4HRAA 4EGJA 1R15A 1SOWA 2VNAA 4PHGA 4RQBA 1QGYA 4H6VA 4XLZA 2H54A 4RLFA 1H6CA 4FSDA 1H2RS 3RB8A 5BRJA 3GGCA 1DV1A 2FJPA 2YASA 4LJ5A 3T1OA 4LHYA 2V4ZA 4C88A 3Q88A 4G0MA 3QF4A 2Q6LA 3HBNA 3I5XA 4XPIB 3UA3A 2VH5R 2H5JA 4FYJA 4R83A 5I8WA 5K0CA 2J9FA 2QL6A 3BMNA 3OH8A 4G1FA 1RKQA 4QHYA 1A9XB 2VHUA 2QD5A 3HHPA 4GYWA 4BNKA 2ZUVA 4DS3A 2HMYB 3QMPA 4FFMA 4UULA 1NG1A 4MDEA 1V41E 3AEKA 3EWNA 5KYYA 3PG5A 3WYDA 2XXAA 4P7GA 1DO0A 3R7NA 2D1YA 4B5LA 1JA0A 1ECGA 3GG9A 3OX2A 3RS8A 3ZBTA 5KQRA 4ZEVA 4CT5A 3L9WA 1Q21A 4YRDA 3S5UA 1T2FA 2QRHA 2UVPB 3LPNA 3M6XA 1I1NA 3OEEA 4QLBA 3GJTA 1JPNA 3OLCX 2A5DA 4BO5A 1OWLA 4EWLA 2W2VA 2WF5A 1QH1A 2Q2NA 1JA1A 3GQBB 5AH0A 2IEBA 4DDTA 2O7QA 2O4UX 3B60A 5K5EA 3G79A 3VH4A 1DO8A 3U7GA 4XPIA 4W5OA 4BJHB 4EA9A 4PYMA 2L82A 1E8NA 3OZIA 4BDTA 3UFBA 1QO0D 2VG8A 3D64A 3ZD7A 2OKCA 2IX3A 3NR2A 1XRJA 1Z56C 3QVTA 4OXQA 5AVTA 5KSYA 5HMLA 4A6EA 1ZEMA 1XSEA 2B7LA 2BKAA 4LW8A 5K7SA 4RK0A 5EKXA 1LSUA 3GF4A 4JP8A 2J3JA 2VDLB 2Y1EA 3U4QB 3T7KA 3TUZC 1XKLA 1VP9A 4P92A 3EIXA 3N3BC 3QH4A 4LBZA 2AG8A 2BFBB 2P90A 2H4YA 2OCBA 3MWFA 4FYMA 4L22A 4N03A 1RIIA 4J0EA 2CNOA 5C4MA 2UVPA 3QVWA 3PLAE 1P0PA 3KC2A 3RS3A 1PK8A 2HMWA 2IUFA 2P9QA 3V2HA 3KAVA 1Z2CA 1RQLA 2P78A 2QS9A 3GQBA 4U1RA 4ACBA 4B3XA 1FTNA 1GR1A 1UJ4A 1WY7A 4KVZA 1T4BA 3RANA 3PNBA 4UEJA 4BRZA 4ZYUA 4N3CA 5HK8A 5ICSA 1PT6A 5LNK6 3A70A 1XRQA 2BV3A 3C8ZA 3PGVA 3OJCA 4JR0A 1NVKA 3OLYA 1G3MA 1G4AE 1TD9A 5CVEA 4OB7A 5TSDA 1K8ZB 4Y6SA 1GZ3A 1M6HA 4NFLA 3RAJA 5DWQA 2UAGA 3U4QA 1ULHA 1XVLA 4P0TA 2ZR9A 4CEIA 1G55A 1LJUA 3V4ZA 5ALLA 1Y6GA 1ZN2A 2WD7B 2YYZA 4UOEA 3CRZA 1IZ7A 4DCPA 5GOZA 1JHAA 1MJ5A 4PRKA 1CY2A 1J5XA 1YFZA 2DQZA 2YXDA 5AM1A 2ZYHA 1YBFA 1PVVA 2GF0A 1MXHA 2JEZA 2Y67A 4W63A 1U80A 2WG0A 3HR7A 4GOOD 1R0BA 5DB4A 1OY1A 2O3TA 1K68A 3VZPA 1G9SA 3R0VA 3O3CA 3R5TA 4FT4A 2F3UA 3O47A 4D8XA 1NBME 1FYWA 1N36B 3I8SA 1K5GA 2P1DA 1BWPA 4MUIA 1CF2O 2WFZA 3M4ZA 4U9IS 4IV0A 3TJMA 3GC6A 2JAWA 5JCZA 1M7HA 1IZ0A 3PC7A 4I1OA 1XL1A 3GJSA 3P2MA 1UM8A 5HYVA 5DNWA 1ZJZA 3KSMA 2WK1A 3WJ1A 5ALOA 1IM5A 1N2IA 1XJWA 2YMMA 4UASA 4L5BA 1I4EB 2ZVDA 4N82A 4J3NA 3U16A 3DW3X 3OD5A 1DAGA 3HXLA 3KKKA 3E8SA 3NDPA 4K2AA 4EYKA 2D2VA 4J0CA 3T1TA 1XKQA 4IJMA 1F48A 1TIKA 4YO8A 1IAVA 3OI7A 4D56A 5J5VA 2PUFA 1NAHA 1V5EA 3FVTA 3RADC 4NXNB 2FAXA 3FD9A 1IY1A 4BQIA 2RHBA 1MC1A 1RCUA 3MB8A 3RKRA 1VJ5A 1U7DA 2C4UA 2AG0A 2AQHA 4M86A 3NEAA 1HI9A 4Q4HA 2F1JA 3K5WA 3C8MA 1F12A 1UBFA 1W93A 3EFEA 4E30A 5B7GA 5DGXA 1M1XB 2QRVB 5FYQA 1J2UA 3K09C 1XZHA 2IODA 5SZJA 4ZU1X 5EGSA 4D98A 2GMWA 4IJKA 4ALNA 4B3JA 3UQYS 3SEQA 5L7YA 4YXFA 1D4OA 1RE1A 3HB0A 3E7FA 3PICA 1KFEB 4KJZA 4F4FA 5A7FA 3DDGA 3FF1A 4BAZA 2B35A 2YOHA 4GHWA 3ZXSA 3GW8A 4PYLA 2E6UX 5UKDA 1F14A 3ND9A 1KE1A 3K0SA 3GXOA 4TSFA 4W8GA 2QYTA 2Q5HA 4N47A 4M60A 5E4TA 4B6PA 4DIDA 1YWMA 3SQWA 3R0JA 4YGXB 3AHEA 3EG9B 1QYXA 4WUVA 4MV7A 5FUWA 3TS1A 4DG9A 4GP9A 5IN4A 1RPZA 3S4YA 3CH4B 4YQFA 3BMQB 2GD1O 4JI8B 2YW2A 2PGJA 3UC9A 3SEAA 3WL5A 1FJXA 5JJKA 3U9TA 3PB3A 1JA9A 2CJPA 2W6JA 3VPHA 1FS4A 1W9HA 3AC0A 2XUQA 2OY0A 4TM8A 2F7RA 1VJCA 4S04A 4Z4CA 4ITRC 1A7UA 3NHJA 4PR3A 2AZMA 1C3VA 3DKRA 2IHZA 5BWLA 2EWFA 4FMPA 5J43A 1S0UA 3KTDA 1OB2A 4JC4A 5AJUA 4V0OA 1GL3A 4KP7A 1PIWA 4AZSA 4EGAA 1Z7BA 1FXWA 1K6MA 2HMUA 1I01A 2BJVA 4FNAA 2X5XA 3N3AC 4YGYA 4JLAA 2ZE8A 2YL6A 3KWJA 3EG9A 1IG0A 3GGOA 4XDGA 2P0AA 1EUZA 2OZEA 4BZWA 4OLJA 5LA6F 3K5IA 4YLGA 3GLGB 1U5BB 1DAOA 1R8XA 2CWWA 1GA4A 4JQOA 3N39C 1D2GA 4WH0A 2NO4A 1J97A 2EFLA 2PGNA 2GF4A 4RPGA 4BQPA 4PQFA 2J3EA 2E4XA 2GPSA 4X6LA 3PL1A 5ALIA 1XA4A 3V7YA 5AHXA 2UKDA 2EX4A 1W4ZA 2OAGA 4X7PA 1OFHA 1HETA 1NW9B 4EHIA 1LJ8A 1EE1A 4PLPA 1MX9A 1PDWA 2H8GA 3M6FA 2G5GX 3FFWA 3U61B 1ZJ6A 1G7TA 5ALVA 4AKGA 1W59A 4WNYA 1HUQA 1HYGA 1JQBA 3TAHA 3I30X 1AKUA 2E82A 3LKBA 3X1KA 3SN6A 3I9FA 4Q7JB 4NAHA 2V8OA 4F4DA 2OXTA 1PZNA 4AJ2A 5I9MA 3GLGA 1NF8A 1OT5A 1U5BA 4PWZA 3I23A 2AN4A 3ZHZA 5KX5F 4WGGA 3WICA 2W8ZA 3NQ41 5T4HA 5ALDA 3AVUA 1X04A 1GFZA 1O3YA 3N2NA 2NT3A 4Z7QB 4EZSA 4XWYA 1LD3A 5I7EA 4TKLA 5DN6D 1Y3IA 3GCXA 2PUBA 1DI0A 1OROA 2P9GA 3L46A 4D3DA 2VK1A 2YQZA 3BS4A 3P52A 3ZDRA 5JNUA 4JYZA 2QTRA 1SBTA 1UJ6A 1AKWA 2P9BA 4H08A 4J4HA 1MHPA 5JFOA 3JD4A 1SR8A 2X0RA 4B2IA 3OQBA 4M0KA 2IS1A 2POCA 2P91A 1E62A 5DE3A 1OUMA 2QRNA 3WHLA 3UMSA 1VBMA 4CF6A 2VOEA 1YZFA 3KUCA 4BP1A 3ISJA 1JEJA 3CVOA 2D2FA 1C8BA 2QVXX 4IW0A 4BTVA 1KJZA 1FPQA 4E81A 2R751 5G1OA 3QPDA 5EJFA 4DJJA 1Y8ZA 1SD2A 4QHTA 3R7DA 1MOPA 1SZPA 5KNBD 1GLVA 2A5GA 3CUEF 4M8KA 2OD9A 4EKDA 5CH5A 4V0RA 3THRA 3M1YA 4D0NA 1NNLA 3OBBA 3ESBA 2ZBGA 3EHDA 4DZRA 1X7ZB 4JQYA 5DM70 2EFHB 5ABPA 2QZPA 3B6EA 4XJSA 4EZXA 4RWZA 2PUGA 2FP4B 3AEXA 5EUQB 2FEMA 4HMOA 3JALB 2AS0A 3ONVA 2ZSFA 3BILA 2P6PA 3I64A 1E1NA 2C20A 2GILA 3I53A 4J0JA 2YDXA 5KPDA 5CT4A 2IXGA 5DMHA 4MITA 4HAOA 4FI3F 3OIVA 4RH1A 4CLOB 1BWSA 1P9LA 5FPKA 3FE2A 3EUEA 2FG7C 2PEZA 3GDHA 3LP6A 5TDHA 2W2LD 1XR3A 4NLLA 5JJ5A 4FFNA 3NDIA 3EZXA 1A9QA 4FNGA 3FX2A 1LXCA 1NY6A 3BX1A 3IHWA 5T64A 4IBOA 2YI9A 1DC4A 3PL5A 3KQLA 1QO0A 1IHXA 1UBHS 4QPCA 1DHRA 2BFMA 4URFA 2CUZA 4LVCA 1DDGA 2P5TB 3SLKA 1ZJWA 2IOYA 4AKEA 1X7ZA 3D1VA 1DINA 1FDSA 2R97A 1KZ1A 4P3XA 3PRHA 3U49A 1Y1KE 1BEEA 2FP4A 2QM0A 1SB8A 3JALA 4ZCPA 3VKVA 2ZDHA 3RR2A 3HU3A 1FDIA 5C51B 4KWTA 5FUVA 5BQPA 1LDYA 4U00A 1U2SA 2ZUBA 3C5VA 4L51A 3BIWA 4WTOA 3PC2A 1QHFA 2UU9B 2P9EA 2BMJA 3H2GA 3VAZA 2X9QA 4CLOA 1HR0B 4NZMA 4PX3A 4B79A 3B9BA 3DV2A 4GE3A 3AR2A 1G8KA 1WMAA 2POQX 4JBIA 5IF9A 2HSGA 1HX7A 1AS3A 4RBNA 1DBSA 1W4BA 4NZ9A 3KYBA 4WLNA 3E5MA 4E14A 1DTWB 3SBDA 2XCSB 1U3WA 2G17A 3EFOA 3A4MA 2OCGA 2R4TA 1RAGA 3FBWA 1ONOA 1H2HA 2PUHA 5ARCA 3TW0A 4BX9A 3U26A 3SF8B 2DOKA 3R1IA 4PC1A 1VFPA 1Y34E 3OF2A 4L16A 3NHWA 3CLUC 5BQFA 5GM2A 3NXKA 2WF7A 2FRDA 2YV2A 1FUEA 1WXIA 4M1EA 5T41A 1IXRC 5GONF 1EYZA 2AZTA 2PO5A 3CUWA 4HQLA 2D1TA 5IT4A 3ZWWA 1HYHA 1J70A 5IBRA 4LMAA 3QUCA 3UHPA 4HS4A 3WMRA 2PBFA 3LRPA 2Z58A 1DQSA 2C82A 5I9TA 4P35A 4CLEA 3FDJA 4DUYB 1KPGA 2H2AA 3KPYA 3QOYA 1SQFA 5ICEA 3EZ6A 3UK2A 3LX6A 1BE8A 3E8XA 3IBYA 2B99A 3DX4A 2O2DA 3I6QA 1TTHA 3PUHA 2VAPA 3T49A 1SXJE 1QPGA 2FE4A 5EERA 1MOZA 3PHHA 1KAMA 2BEVB 1DTWA 2R60A 3P0HA 4JVMA 4QX6A 4EPYA 5F7XA 4YAKA 1O94D 1U3UA 1OFUA 1KDRA 2IY9A 3BD6A 1RSZA 3VR2A 2ADMA 3W8DA 1TM4E 2EZ8A 3KOOA 1VIYA 3HM9A 2F7QA 3SF8A 2IYQA 3V33A 3IBTA 3GH1A 2XMCA 3ZUGA 4LJAA 3M7IA 4LDJA 1RBZA 1D2CA 1WA5A 1OXVA 5CHEA 5AM5A 3BVPA 4B3RB 5JDIC 3D0RA 1Z88A 1W25A 4WVFA 4KPYA 2HQRA 4ENTA 3L0IB 1GADO 4ZYZA 5K0BA 1I4WA 1Q91A 1QKJA 3D6TB 3Q85A 1XC7A 3H97A 2NT4A 3DEYX 3P5SA 3GK3A 4X41A 5MGNA 2OLEA 2HZBA 2X7HA 5FOQA 4WCFC 3KFLA 2BEVA 2A5LA 1M6WA 3FRHA 1V4VA 3LQQA 3J7AC 2OXFA 4GPD1 1KH1A 3HNRA 4MWGA 4NATA 7REQB 3T8YA 1TYBE 2NTEA 1L1RA 1W48A 1ZXLA 4G0WA 2Y0DA 3DFKA 1ZQ1A 4TXLA 1R0ZA 1QJCA 3OHMA 4H0NA 1HTWA 5LMZA 3VV3A 5H4GA 2VF7A 4JVNA 4J29A 1HNXB 5KNDA 2CMDA 1D8AA 3BUSA 4OI4A 4EGSA 4KFSA 2CHVA 3DFUA 2JZOA 2GPNA 4ZDKA 3QU7A 3AF5A 3Q2KA 2WY2D 5FWAA 4K3VA 1XT6A 2EOAA 1Q12A 4Q48A 4TRNA 2A59A 3A6LA 2CVZA 5MN4A 2I3GA 1W2WB 1HE3A 1T5LA 4TVSA 4AD8A 3C3PA 5ICCA 2WYHA 3ZY4A 2A5JA 1ZJ4A 1K6JA 4M0DA 5H1YA 4TMFA 2I3ZA 3O7MA 4IUYA 7REQA 1C1DB 4DGSA 1P77A 5LZ5A 3A37A 5BY2A 4RXUA 2AR9A 2O2GA 1V5WA 1AT1A 2C2HA 5THXA 4A0SA 4RAOA 1YQGA 2QVZX 4JBNA 4BLRA 3ZY5A 1JR4A 4UDOA 4ZGWA 2V6MA 3COZA 4FN5A 1H2ZA 2H4HA 2CLCX 1RU3A 1YQXA 4OFXA 4ZT2A 5B3JA 2GWRA 2BZ0A 1L8OA 2CDRA 3IHLA 3MOGA 1BGWA 3AG5A 5KDLA 3U9SA 3VU9B 2J67A 3USZA 2VQFB 1COZA 1X13A 3HV0A 4JVOA 4IKPA 4B87A 2ZXQA 4ZGGA 1LQUA 2AXEA 1D09A 2NUTB 3EJ6A 3RQIA 3GFVA 1AHNA 1U0BB 3WLJA 4ALKA 2IYZA 4QOGA 5LZ9A 1XMIA 1EZ4A 2VTEA 3HYNA 2WVGA 1IN6A 3QFSA 4ZOCA 5BSUA 4DIUA 1X1DA 4KQMA 2IVFA 3VJRA 1NUSA 3F7WA 5LQMA 1C1DA 1R6AA 4RK4A 3QY0A 3ODPA 2Q9UA 4BVLA 4QU8A 3N75A 1SPBS 1FFWA 4KTVE 4EITA 4OJQA 2CYAA 2JAXA 2CMKA 3R9WA 3VDXA 1HYBA 1H5UA 1FP1D 1PZHA 2B1QA 3B36A 4EZQA 3DZDA 3JTMA 4FKBA 4Q03A 2W6CX 1LPNA 3VR4H 1OKKA 3I8OA 4KZKA 4DDWA 4URZR 4YCLA 3BJEA 3VU9A 4ECAA 1XMQB 3NIGB 5LZ7A 2CE2X 3TE6A 4PVDA 2EFDB 1KL7A 3ZV4A 3L7MA 4J16A 1QJ4A 1WCXA 2X8LA 3SYKA 2JCBA 5KAMA 2NUTA 4C7JA 1SBHA 1WDZA 4AS1A 1UEIA 1M0TA 2J3QA 3E05A 1Z83A 3WSWA 1U2GC 4WFIA 4RTMA 2BFDB 2AWNA 2K2WA 5DWDA 3SR4A 4JXJA 3ZGLA 1AG9A 1B42A 4IQ4A 5LOVF 3FCAA 4MRMB 2CLMB 3VO1A 2GBCA 3M83A 3MQFA 2HK7A 2J5XA 1NOIA 1O5IA 4M49A 4QATA 3DYBA 3TX2A 1ZL0A 2WD9A 3P45A 4WZ6A 2ZR8A 4H8SA 2RAVA 2V55B 2WWGA 3I9MA 2RAJA 2XKAA 4P3PA 1RACA 3DMPA 3LFHA 1I7SB 4FCTA 4B3IA 1VKRA 1BGXT 2G4CA 1V9CA 1GSHA 1EVLA 2NZYA 3FCUB 1NRXA 4R16A 4YRLA 3WMGA 5I4BA 1YHNA 1E99A 5EUCA 3SP1A 3T1NA 4EKNB 3RYTC 2BR4A 3D9QX 2GBLA 4EZTA 5E6UB 3DPUA 5AVYA 3ZBPA 4AZBA 4G0PA 3B1VA 3N2EA 2BFDA 1A8PA 2CB9A 5KNBA 3ZOKA 1U63A 4NPAA 2WFAA 2XB4A 4UTOA 3SR3A 3AFOA 4UJ3A 3AY7A 4MRMA 2HI0A 3H1PA 3OAAA 4LTDA 4BFUA 4Y2QA 4BV9A 1F6BA 4D92A 4E5SA 4ZIRB 4Y6RA 1YA8A 4HQ6A 4KGZA 3P0RA 4D3XA 3SVZA 4DG8A 2OO3A 2XNKA 4FDLA 4K9SA 4C3OB 2LP4Y 4PYQA 4CFZA 4ZU6X 4TM7A 3GOQA 2JZNA 1E32A 3RRZA 2C9CA 5AW1A 3CRNA 2WYWA 2PGOA 4QTTB 3OU7A 4M88A 1Y1QA 3CF4G 5JHGB 4XE5A 1XBTA 3ITNA 3V1MA 3DFIA 1VCMA 3GFRA 3KKEA 3FETA 3LRTA 3MRXA 3Q9LA 4I81A 4Q1FA 3E53A 4RACA 3DLHA 2ONKA 1H1LB 2ZSKA 3LUBA 3Q0EA 2RGEA 4JLOA 1ZOSA 1LI4A 3LKDA 4FGJA 2YWXA 2JHPA 5G40A 4LHVA 4P0PB 2O06A 3BUQA 5LQUA 1IQUA 3EZNA 2JW5A 4IUDS 5FF9A 1NE2A 1YV9A 3K4QA 1JFLA 2JGRA 3OZSA 4AP6A 1RM0A 2GEFA 4BLUA 4ZIRA 3PGMA 1HM5A 2FW7A 1CUDA 2Q21A 4LFBB 4K9DA 5LQDA 1GRCA 2ZRPA 2AXQA 3QLUC 4LXXA 3WQSB 3UT6A 2YHAA 1V7CA 2DMRA 4R8LA 3A3OA 4CR6A 1LLUA 4YAEA 1VPWA 5K4GA 3A26A 4HNAB 2FZ5A 1JHDA 3OY2A 1OJ7A 4V0ME 2MMCA 4JIMA 2Y1CA 3CB4A 2ODBA 1J0AA 1QGAA 2QM8A 1H1LA 3STWA 3DB1A 5JU6A 5LFAA 3D2BA 2OFXA 4HGZA 5D6OA 5J59A 3UV7A 4BCBA 2X9NA 5L8VA 2PWBA 3VH1A 2QPOA 1ZD9A 2QLBA 1QBKC 3HUFA 1QH8B 3QIVA 5FJJA 2YWBA 4MV8A 2BGMA 4GH5A 3G02A 4Z4QA 1WZ2A 2EAUA 3C6KA 4JQSA 2YZGA 3CRVA 3W4KA 5IMSA 2QTAA 3KOYA 1T3GA 4YMIA 4AY2A 2FQWA 1SKUA 1PGOA 4I4LA 2G6BA 2FMFA 2VDVE 2CE7A 1RJ9B 3NAZA 4HNAA 2O2XA 4QNNA 4TXMA 2O8VA 4W1PA 2O7VA 3ADDA 2EU8A 4BHTA 3GJ3A 4P4SA 5F2EA 3G9UA 2Y1WA 3OZRA 4I4NA 1CR4A 2V6JA 4L4RA 5HPYB 2ES4A 8OHMA 4B3FX 2X6TA 1QX3A 4G23A 4ZRMA 2CLHB 1FP2A 3G17A 1M8JA 1WX1A 3LBAA 3HKBB 4MW1A 4NMXB 4HVLA 4HYBA 1MPTA 4RE5A 1PUJA 3CIFA 5EJGA 3GEDA 1RQGA 2I4MA 1XTUA 4CMIB 2A2ZA 221PA 3C8DA 3FPCA 2QTHA 1PR0A 1AX9A 1QH8A 1UK8A 1VHJA 3HA5A 3K4PA 4FGKA 3OPMA 4LDPA 3UUWA 1T0PA 1AOXA 3I2WA 3OMLA 4LRTB 4QYMA 3BQ9A 3GB9A 1CJMA 5JS1A 2XOXA 3HP4A 2GH1A 3LBYA 2FEAA 1JSCA 3M33A 1P8JA 2J07A 5E84A 1PKXA 1KNQA 4AFNA 4EW1A 3I5YA 4MVJI 4OQFA 1M5TA 1QG4A 2RGXA 5B37A 5T8KA 5L3QB 5E38A 3C3XA 4EHFA 4G26A 1ECCA 3P94A 3NBXX 5FRDA 3H4TA 4YPOA 3AP3A 2OUKA 5KAPA 3OU6A 3R3JA 4I5FA 4LYEA 4B7CA 3TF5A 1E0AA 2HRBA 1OXBB 2GBPA 1T0IA 1W52X 2BDEA 2CMFA 2WM8A 3B85A 1N1GA 3HKBA 1JNYA 1GCAA 1ZIDA 2WTNA 4GZLA 1E1CB 4RK6A 5ALUA 2CL5A 5L45A 2QN6A 2P4EA 1BH2A 3QEKA 4CQJA 4CMIA 3NAMA 4OFZA 4RY2A 2BR3A 5SY4A 5GGXA 2BEWB 3UJAA 3G9GA 2FSVA 5JEDA 4JLCA 2ETVA 1EK1A 2O8CB 4B31A 4UKDA 2H4JA 4LFAB 5DYGA 3K6RA 3S5JA 3MD0A 4NG4A 2YHBA 2FEXA 2VK4A 3FCXA 2E4VA 4BRWA 4C0LA 2QN3A 2CNKA 2G88A 4U39A 4UUBA 4DRYA 4ZCLA 3HB1A 2HCTA 3DE0X 1P1CA 1PEYA 1Q2XA 1N5KA 1RQNA 2E4ZA 5L3QA 2Q5FA 4JIGA 3EX7C 3T9FA 5KWEA 2IV3A 3ID6C 3F9CA 4B84A 3OG9A 1SULA 4LY6A 5FNVB 3LI2A 1EUYA 2AG6A 3ANLA 4ZYTA 3IVCA 2D0IA 3TTYA 2XQIA 1E1CA 1M8KA 1L5LA 2QLNA 3SS7X 5JSHA 5KQGA 1B00A 1UP6A 1ZDMA 5AOCA 1U1GA 4V39A 5G0VA 3ZD8A 4JQCA 4DQKA 3T54A 3C15C 4PLGA 2VP2A 1SEPA 2BEWA 3KZCA 3CLSC 4QYXA 1FE8A 4U7HA 2O8CA 1NZJA 1BVRA 3CSSA 3EGWA 3JZFA 2EZ4A 3O4IA 4EATA 1IXZA 2ADOA 2ZIZA 5CVCA 3L1KA 1O4WA 5TQJA 4TMVA 1ID8A 1DKQA 3H83A 4NVRA 5ES3A 2HM7A 5AWFC 2F8SA 3KOXA 1QZTA 2HUPA 1XEWY 3QEAZ 3HYTA 1BFKA 4GKVA 2G1UA 2TMDA 2GRJA 5AT1A 1CY8A 1TEXA 2XXJA 2PLFA 1ONPA 5A2GA 1ECJA 1ISRA 1QYWA 1HF3A 1UADA 1V1JA 2LR0A 3LKZA 3O0DA 2PDAA 4HYTA 5BO5A 2B1IA 3NHSA 4ND3A 3DV0A 6AT1A 1G3UA 5KYNA 3MJVA 2CEAA 4HX2A 3CT6A 3BSSA 5E3IA 4WOBA 2OZNB 5KTPA 1KSJA 1Q14A 1BJRE 2OT3B 3FNQA 3IXLA 3CLTC 2ISQA 3MXOA 4IMJB 3UWMA 3JPWA 5DBFA 1FDUA 3ZN2A 5KYUB 1ISPA 1XEAA 1IDOA 2P9TA 3V4VB 4DJFC 1G5TA 1GKLA 2H0RA 1AQJA 4X24A 1CF4A 3FUWA 5CITA 3HR4A 1ZKMA 3YASA 4OH7A 3M5DA 5F3WB 3T5PA 1YR8A 3GDOA 4IIBA 3NEPX 3UWKA 3V4FA 3R3HA 2PH7A 5A5GA 3OCYA 3A9UA 2OR3A 1OMOA 4H1WA 1WB5A 2Z1DA 4B3CA 4D5EA 4ABYA 5K99A 1JYSA 1GRVA 1T2NA 2WT9A 3IEIA 3IUYA 2YWHA 3N7UA 3QUAA 3MTEA 4GOKA 1NTRA 2R96A 1XK6A 3R6LA 4UEQA 5DX0A 1VGRA 1ZWWA 2JFVA 3U4CA 3NJRA 2E1PA 1LNSA 4GVLA 4F8YA 1TZBA 4IVNA 3EEQA 2ZBVA 3NATA 1EDOA 3RYIB 2X3VA 1WNFA 3H9QA 3T5MA 3W8FA 5KYUA 4J6EA 3QVVA 5EXTA 5ITWA 4Q15A 1NPDA 1R27A 4XEUA 1IBRA 2ZXFA 1BDHA 2DR2A 1VJTA 3BXEA 4BLPA 1T6NA 1RM5A 2ZWVA 3K0EA 3ECAA 4HQNA 3PK0A 1XNGA 1XL0A 3PD1A 5C9ZA 1MGPA 1GNPA 3C8UA 2IWHA 1YTUA 1G291 4MWBA 3FA2A 4J7UA 5EP4A 1FU4A 4BQNA 4ZZ0A 1O2DA 5IZ4A 2O3UA 3R5SA 5GZ3A 3BVTA 1IY8A 1K6XA 2PJUA 1L5YA 1VSTA 1YR6A 3DC2A 4OTZA 2ZUCA 4S1PA 4C4AA 3ZWVA 1E18A 4ZO9A 2B0JA 1ZVVA 4L4YA 1JG4A 3LAWA 1VHQA 1R4MB 2BGLA 2X4LA 2CNNA 1BHJA 1JMKC 2GLUA 3RYIA 1RE0A 3QLVA 1DJNA 3H2BA 3PVCA 4JGIA 3SG0A 2JJYA 4KTTE 2ZIUB 4LV8B 3PQ8A 2FOIA 2RIRA 3T5GA