3O3OB

(r)-2-hydroxyisocaproyl-coa dehydratase in complex with (r)-2-hydroxyisocaproate
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
375
structure length
375
Chain Sequence
MEAILSKMKEVVENPNAAVKKYKSETGKKAIGCFPVYCPEEIIHAAGMLPVGIWGGQTELDLAKQYFPAFACSIMQSCLEYGLKGAYDELSGVIIPGMCDTLICLGQNWKSAVPHIKYISLVHPQNRKLEAGVKYLISEYKGVKRELEEICGYEIEEAKIHESIEVYNEHRKTMRDFVEVAYKHSNTIKPSIRSLVIKSGFFMRKEEHTELVKDLIAKLNAMPEEVCSGKKVLLTGILADSKDILDILEDNNISVVADDLAQETRQFRTDVPAGDDALERLARQWSNIEGCSLAYDPKKKRGSLIVDEVKKKDIDGVIFCMMKFCDPEEYDYPLVRKDIEDSGIPTLYVEIDQQTQNNEQARTRIQTFAEMMSLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-subunit 2-hydroxyisocaproyl-CoA dehydratase
publication title Structural Basis for Reductive Radical Formation and Electron Recycling in (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
pubmed doi rcsb
source organism Clostridium difficile
molecule tags Lyase
total genus 151
structure length 375
sequence length 375
ec nomenclature ec 4.2.1.157: (R)-2-hydroxyisocaproyl-CoA dehydratase.
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06050 HGD-D 2-hydroxyglutaryl-CoA dehydratase, D-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.370 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3o3oB01
3.40.50.11890 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3oB02
3.40.50.11900 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o3oB03
3O3MB 3O3OB 3O3NB
chains in the Genus database with same CATH superfamily
1M7BA 4PLCA 3OKAA 2H00A 1JAZA 1DUSA 2E4UA 3Q11A 1DJQA 4B3BA 4X1YB 3PLAE 4KQKA 2YFYA 4FXPA 3UY4A 5A5DA 1RKBA 3HVUA 2QTRA 3BCRA 4X7PA 1ODTC 2Q50A 3KXIA 4P86A 4V0KA 4Q4JA 4ZD6A 4CU5A 2GXAA 1HQDA 4NTZA 1XZPA 4IJMA 3DHWC 3DX4A 2EFYA 1GZ3A 3LCVB 4LSZA 3T5GA 5CX4A 1YL5A 2UXCB 1EFUA 1QH8A 2NZYA 2YBEA 3DEJA 3FMFA 3KWMA 2HPZA 1BRTA 1H9BA 4C05A 3Q84A 4U6SA 3VZBA 3E9CA 4NZYA 3PD1A 1K2WA 4HAVA 4R6WA 1QIEA 4D96A 2PMKA 3B5IA 3DVRX 3HY3A 4Y6PA 3G8AA 2UUCB 3N8IA 3OPVA 4PNHA 1F2TA 2AG8A 4GPZA 2GZAA 4K9QA 4A2CA 3EGEA 2L19A 2NO6A 2Y1KA 3HCFA 2HADA 2GUGA 1QLHA 2FMUA 4DCOA 1BA2A 4PC2A 1DWOA 4CCYA 4G5QA 3VGPA 5LQDA 4RGQA 2DU8A 3MB5A 1NE2A 3V3TA 2AKYA 3A6GA 4NECA 5JQGF 1CLUA 3QK7A 1NJFA 4LMPA 4LY3A 3TN7A 4JT8A 4AECA 1G9TA 3IH5A 3FRJA 2AZXA 3WV5A 1NIJA 3DE0X 2O7RA 4V0MA 3GCWA 3TTSA 3LMKA 2ZYDA 5FWXB 4CF5A 2OFOA 5FF9A 1JZTA 5BSUA 4D6PA 4M9SA 5JQGB 2W6ID 4YV1A 1D2AA 5B55A 4E6EA 2PS9A 3I6IA 1KVRA 3NFYA 5D7BA 2ZUUA 3DOUA 5ED4A 4UQPA 2Q41A 2HJVA 4TSFA 2XCLA 3T5PA 1U2EA 1YB6A 1IJFA 3EHDA 1PQ4A 2BGLA 3EDQA 4EVQA 3JQAA 1QP4A 4JI4B 1BTOA 5AD1A 1VIDA 2QTMA 3ER6A 4N6GA 2H8GA 4H4EA 2XGSA 2B0JA 2HMUA 4MW9A 4R2IA 2JL1A 3RFCA 3V5NA 2XGJA 1OASA 4XR4A 5AHXA 5BOVA 5KOIA 5HRAA 3CH6A 3IP1A 4AUEA 2WFLA 4JP8A 1PTKA 2G6TA 3OQVA 5C81A 5IAAA 1YD7A 4JP2A 5KYKA 5TARA 3KTAB 3JAMA 4QO8A 1W25A 1XNRB 3MWDA 4D8TA 1OZHA 5MN6A 4OI0A 3I0NA 3UYKA 3Q40A 2I2BA 3EUEA 3KT8A 2BC9A 2NV6A 4FYXA 2Y67A 1QYCA 3I92A 2C1XA 5L8VA 5BUZA 1P1HA 3DVAB 3UA3A 3ZHZA 3EW9A 4G0XA 4IW0A 2H1SA 2WM9B 4NYMQ 4N01A 3R5XA 5ILOA 3EMVA 4YMLA 3ZLTA 2E4ZA 1DFIA 2EQAA 5ALLA 2LXNA 4JUAA 3LC1O 4JX9A 4N49A 3WGMA 3LF1A 3LY5A 3WIBA 1UDAA 4BKUA 5AVRA 3EGXB 1A9RA 3HVJA 1IHXA 5JT1A 2JLVA 2QT0A 4LBZA 1M8PA 3TGWA 5GMOA 2YC2C 1UMKA 3SDSA 1G18A 4TS3A 1YRLA 2LXYA 1R4NB 2BMEA 4YIHA 1O7DB 4GLOA 3K5WA 1T4BA 1UKEA 1N77A 4BX3A 4CPDA 4LQLA 2ADOA 4HH3C 5SV2A 1LSSA 5E4YA 2RHCA 1WUKS 4DLSA 1J7JA 2F8MA 1A9QA 1Z4KA 2NIPA 5DHQA 2ZSIA 3KT0A 1ZUNB 5A2GA 1KEEA 4L0DA 4ND8B 3L79A 2APJA 1LJ8A 1S2OA 1AGPA 2HJWA 5A0FA 3AXTA 2GF9A 5F7JA 1RAEA 1XZLA 1SUEA 1H4QA 2K7FA 2CVFA 1FVHA 4PC3A 4FZSA 1DL5A 1RVDA 2O20A 1FFEA 3L07A 2Q13A 5GOTA 1Z0JA 1SCUB 1UFRA 3BXHA 4LZJA 2IV7A 3NTUA 4D74A 4DT1A 2PFGA 4EYSA 1TJNA 4QDXA 3QVSA 3UC9A 3VVMA 2ZUEA 1WDWB 1VGVA 1ZM2A 3SF8A 3WAKA 4CM3A 2HU2A 1Y6JA 2WUDA 3RFXA 2VUHB 3IVAA 3KFVA 4EL0A 4ND6A 3RJ9A 5HCUA 2D00A 3RF6A 1E89A 1KH3A 3CLHA 4H7KA 3RAJA 3DKPA 4D9EA 1DEAA 1XWFA 2YN2A 1NSYA 1JEYA 3RPMA 1WDTA 1RAIA 2V0NA 3LVQE 3O7MA 4PSKA 4DGQA 3R5HA 4E14A 3RW9A 2CB9A 1L5NA 1M7GA 1EX6A 3CR8A 2ELBA 2Q0SA 3UHJA 2QE7A 3A4VA 1NYRA 3REFA 3G5TA 2YOFA 5TF0A 5AKHA 2O8EB 1N2OA 2CFOA 3QITA 3RYIB 4C7XA 4N7BA 3AFNA 1UL1X 3HKEA 1L4BA 4B9AA 4Y3UA 2F18A 4CT5A 5D86A 2WWFA 5ENDA 5JXJA 1ZP6A 4MINA 3ZY6A 4CTJA 2G8LA 3V4RA 3I6QA 4E7PA 1A5SB 1R4MB 3A3KA 1ND6A 2HMTA 2O3TA 4R01A 4XAQA 3LDAA 1NR5A 1WW8A 2NPOA 5J23A 2F1BA 3ETLA 2ATCA 3A0UA 4TL9A 3R74A 3OM9A 3N86A 3V4SA 3OEYA 5B3JC 4JLSA 1OTHA 2J59A 3N5KA 1AVTA 1U2PA 4EYGA 4UBKA 3CGWA 4LV8B 3I5UA 4MPJA 3T9DA 1BE8A 1U3FA 4Y0VA 1JTFA 2D2IA 3W77A 3I1FA 2OO5C 3GDWA 2VK4A 3P0RA 4KQHA 4Y9UA 1K68A 4QGFA 1VJ1A 2K4MA 3L40A 1LX6A 1FSFA 4CN9A 1Z4MA 3BE4A 3JVEA 2QQEA 4QT0A 3CEPB 1PVDA 3V46A 1I3OA 2J32A 5H3CA 3UHPA 4FUQA 1ODJA 4YAOA 4ER0A 1M3SA 3Q9UA 4NZPA 3B36A 2JFVA 1CUHA 2HF8A 2WU0A 4L7QA 4J2TA 2PJRA 1W93A 3AU9A 3R3YA 5B3JA 4B3RB 4DABA 1Z2DA 3FF1A 1UC8A 1NJ5A 3ZU5A 1QCYA 1L4NA 3LCCA 2AB0A 1R8SA 1OAOC 2OO5A 2B61A 4O1IA 3DAPA 1H2AS 3HI6A 3FPEA 3SJAA 5CBPB 3OTIA 1WB9A 4B4KA 4ARCA 3TW6A 1E62A 3V1KA 3ICCA 1OCEA 2BM9A 2W11A 2WV7A 4W1QA 5BWBA 2ZXQA 3AUXA 3MZ0A 1HETA 1Y8QA 3MERA 2NZ2A 4TRNA 3TLGA 3VC2A 4EKEA 1WDMA 4P4SA 3RYCA 1XVAA 2J0UB 2ZRMA 4AX8A 1NP7A 5B3KA 2KQUA 3EEIA 3ZUGA 2WSSA 3HJCA 2FY8A 1GTJ1 2ZJ6A 5C8YA 1WMSA 2F67A 1E6LA 4LC0A 3QU9A 4PF1A 1LK7A 4Q7JB 1RPAA 1XVLA 3AF2A 1OAOA 1K9VF 1QDEA 4WZBB 3WNVA 2FQQA 2IH2A 5JHHB 1X7XA 3P7MA 4LOKA 4YRIA 1I6LA 2LP4Y 4J7AA 1V1MB 4ALKA 4QTZA 4RD0A 3CZ9A 5CDTA 4BVFA 5CDUA 1JSCA 2OZKA 3WB0A 4Y1EA 5IZ4A 5DLQC 2VFAA 1E0KA 3M9WA 2KHOA 4RBNA 1HDIA 1RABA 4BNIA 5JEEA 2OV2A 4IIFA 3M6AA 4WGGA 5HF8A 4POAA 4L4SA 4B3DA 4WNCA 4O08A 4F3NA 3VEBA 1UMDB 1XKTA 2GK4A 2I4LA 2OXCA 2Q0XA 3NC4A 2FOXA 2PRYA 3OCYA 1TL7C 4IDCA 3ZWYA 3GROA 4XLLA 1QTNA 4D43A 5FPTA 1FMJA 1T36B 2FF5A 4QGGA 1XWIA 1YS9A 2VNJA 4FCWA 4F6RA 3U7IA 4F1WA 1L0BA 5EZ5A 3D5QA 4URYR 5HXAA 3I6YA 2PZKA 4UUBA 3K8QA 3U0BA 4KN9S 4BYGA 1CX9B 1R64A 2I4RA 5C7YA 2DUWA 3S1SA 1KR2A 1QDLB 2BWJA 3W5VA 4XVCA 1ZMXA 1TF5A 2ZRIA 4NMMA 3ZTYA 1WQ3A 1QJ4A 2WMNB 3PFHA 4BZPA 2YV1A 5FI0B 4IEEA 1KP2A 5HMMA 1NI4B 1X74A 4HF7A 4DY4A 3SOGA 2PKYX 3AL2A 3PL5A 4HDNA 4KAJA 3ZWCA 3E18A 1T9AA 3HYRA 4R40A 3P9QA 2QKYA 8ABPA 2OY0A 2UV8A 4GLBA 3SOPA 5KHAA 2Y92A 1VHLA 3E81A 2J3KA 5LIRA 4KR3A 1W19A 1NHGA 4DKJA 3LWNA 1SUWA 1RC0A 1V0JA 2C4KA 2I65A 2WSLA 3E27A 3LDGA 1YDHA 5CNIA 4ZHSA 4OAQA 2O06A 3UWSA 2WQ7A 2ZBEA 4YI3A 3HP4A 5KKNB 1JWBB 3S0JA 3D43A 4ND3A 1KYWA 2GD2A 3GWZA 1CS4C 3QKSA 4OJMX 4IJWA 3CE6A 1ECFA 3HWRA 2OFFA 4JI5B 5AXCA 2ZZKA 4TTRA 2GRUA 5FL3A 3JARB 2E82A 2BGGA 2WABA 5BYKA 3FKJA 3LBNA 3OU7A 1T0IA 3RSSA 4YCCA 1CS0A 3O1HB 3ME5A 1RQNA 3U49A 5IKEA 5L3SA 2RT6A 2CK3A 3B1ZA 4G86A 5FD8A 1U65A 1E2NA 4UBLA 4YASA 4NCJA 3FUXA 4LHWA 3I53A 1SXJE 4N3AA 1GAQA 2H57A 521PA 1MO2A 1VLLA 1E0DA 1QQBA 1NBHA 1Z2OX 2RKWA 3AJEA 4JEHA 2X1HA 1G20A 1YDWA 4BQEA 3LY8A 2HK9A 4G6QA 1ZGZA 3PUVA 1O4WA 2Y4NA 3E53A 3DXZA 3G68A 1YF3A 1QTRA 2JGEA 1W88A 2YVQA 4QA9A 2FG7C 1YGYA 4AVYA 3L0ZA 2J09A 1JN0A 1UPAA 2IDJA 3E3NA 2QI9F 4MQUA 3WKDA 2WAMA 1AB6A 3GJYA 1EM8B 3I23A 1FTNA 1EK5A 1K98A 4PCLA 1T1RA 1L4KA 1QPGA 2V4UA 3SF0A 4HXFB 4CUKA 4HSEA 1S1MA 4XSHA 3V4PB 4LTNA 3PQ4A 3JX9A 5JYDA 1R6UA 1QKIA 2RONA 5EIBC 5JJIA 1QFYA 2OW7A 1X1TA 2I2FA 2YWRA 3QW4B 4ZRMA 1OT5A 2O8FA 4XUEA 1Z33A 5IT9A 3ERCA 2PZJA 2Z2IA 5CFZA 2JHCA 2FFQA 2RH4A 1H2BA 4L51A 3DAGA 3FDZB 2CMDA 3CINA 3OEHA 4F46A 3C8UA 1GRCA 5LB2A 3IAS1 2Z3ZA 3FHCB 3ACBA 2V65A 3NXSA 4KCGA 4H0NA 1GRVA 2QM3A 3HPRA 2J3QA 4N8EA 3QEKA 5K51A 1L5KA 1I7DA 2DEUA 3DP7A 2I4MA 2YFQA 3MQ2A 1IOWA 3LXUX 3EDRA 4H7DA 3AM4A 3RPEA 2HMWA 3TOSA 1VYUA 4JKIA 1S96A 3TLEA 2YUTA 4R9RA 1J6UA 5HKBA 4HKTA 2IELA 1V1JA 3OECA 4JLAA 3K9FC 1Z75A 5KQMA 2D5AA 1YVDA 3F3KA 3IA2A 3W90A 3N76A 2NZXA 4N18A 2H65A 2PZFA 3NVDA 1SQ0A 4AYXA 5LQJA 1PTJC 2B7CA 2I2CA 3EPKA 2IE8A 4UULA 1KQPA 2JVJA 1E77A 1NQTA 1IOZA 4UDNA 2O8VA 4I5DA 4FTWA 3SEAA 4BX8A 4CG1A 5A4JA 1NDHA 2Q6LA 3G9QA 1N2JA 3FHOA 5HR5A 2NWQA 1JQLB 2IK8A 2P4HX 2VP4A 4TSFD 4XPIA 4AZWA 2GTPA 5IBRA 1CHDA 1LQ2A 4IS3A 4ZCLA 5KMGB 3JQAD 1JAYA 4QVGA 3G7NA 4YUXA 1J5XA 5J2UF 2TS1A 1XMPA 1A71A 3DTVA 3Q1KA 2Q27A 2P2YA 1Z7WA 2P2NA 1N5LA 2NUTB 2W58A 3AR3A 3LOPA 1PTJA 3PDHA 5F5LA 3M2PA 3TEFA 4Z99A 3FI0A 1GPAA 2XXAA 4ZJYA 4H31A 3SQMA 2HU7A 3GJ3A 3TBFA 2QX4A 4NJMB 4BZWA 4H6VA 5A5FA 5LQAA 2CV2A 5J5AA 3ICQB 1TU0A 1ORDA 1ZJZA 5HZMA 4DYHA 1GZVA 2BCGY 5F1KA 4URFA 3QEMA 4M1WA 1PZFA 3LXMA 4RMIA 4GI1A 5AM5A 1ADYA 3K0CC 1CZUA 2BFPA 2ATIA 4JHLA 2X40A 1YS7A 2O07A 2XW6A 2FZLA 2PUHA 5EA2A 2C5BA 1RJEA 1K9SA 1NW7A 2YWEA 1AS3A 3ITKA 3BH7A 1X0VA 3BHNA 3V1LA 3U16A 2I3GA 1MJGA 4QLAA 3V7WA 4HAUA 5MGBA 4Y2QA 3G23A 5ALPA 4H7IA 5M2QA 3G9UA 1N1EA 5BO5A 4B71A 9MHTA 3C6XA 4BNTA 2ID8A 3ENVA 2QT9A 2X2EA 3LFHA 4OGWA 3QUQA 3K0CA 1Y9ZA 3IUNA 2ZQYA 3QMVA 3ZWKA 2NOAA 1U7OA 4FGJA 1A7AA 3M5WA 2GT1A 4M55A 5J2TF 3KZCA 1CEXA 2ZR0A 5COQA 3O38A 5E6RB 4J0JA 3CX6A 3F1LA 1DEXA 3QWIA 1ENZA 1B00A 1GSIA 1SBHA 4RDCA 4CV1A 1N33B 3L8ZA 5GJWC 4E3ZA 5K3AA 2WYUA 1E2PA 3LS2A 2D7CA 3CH7A 4M0KA 5JD6A 3ZX5A 5HKOA 4LDJA 1DPGA 1RC1A 1XEWX 1OLSA 4LE1A 4UU1A 5DN6A 4AXBA 2O2YA 3ZHSA 2BFFA 5BN1A 2O6HA 4LYJA 4BVKA 1SZCA 3R0XA 3U4DA 3R5TA 3JQBC 3T8YA 2IYOA 3U9SA 3UV7A 4YY3B 1JNYA 2XNHA 1K89A 1CTQA 2OE2A 2W0SA 4FFNA 4FR2A 4M1ZA 4QRIA 4JV5B 5B53A 4M0DA 1IVNA 3AHHA 3S1AB 2B5WA 3NYRA 1U98A 3HWWA 1C4OA 1P6UA 4YJGA 1JR3E 1NLFA 1MXFA 3DR5A 3SAJA 2B35A 4EF4A 3V32A 1ECJA 3KLOA 1YZUA 1IYZA 1GGJA 2CNNA 1JL3A 1JDNA 4ZO4A 2FWJA 2ZB4A 4Y2VA 5CU7A 4F85A 4DR3B 2QP4A 4JXJA 5JYBA 4R3NA 4OXRA 2AUTA 3VO2A 3O2NA 3V8BA 4EELA 1P5FA 5BOSA 1M1NA 3JQBA 4GR5A 4DIEA 4Q01A 4PYLA 2QE7D 4MI3A 3SS7X 1YS1X 3MBIA 1UM8A 3VR5A 5JV5A 2I29A 2ODQA 3HB1A 1WUTA 3HBFA 1IJEA 1XD8A 4FMBB 3UPTA 2FFBA 1FJ2A 1XXHB 4TWJA 3C3JA 1F2TB 3SJBA 1VA4A 4BWVA 3IQZA 1L5RA 3B6KA 4RTPA 1SXPA 3G82C 4MIYA 4EJFA 1XLWA 1GL6A 1KQNA 3BTVA 1WLYA 4CCYB 5I01A 1QK3A 4KPYA 1IEVA 1L7NA 3D3NA 1DDGA 3GX1A 1A2QA 3TKLA 3QVWA 3TAUA 4YCAA 1P5JA 1P1RA 3HTXA 3CB4A 4OGFA 2R11A 5CT9A 1IE3A 3GLHA 2HRCA 1ZJ5A 2RGEA 5CT5A 2ZROA 3TX2A 1R7RA 2EHDA 3D4LA 1USVA 4HVLA 5C3UA 3HO8A 5CH3A 4Y1RB 3NJ4A 4E2ZA 2RJOA 2X3YA 4RVFA 3T7CA 4JGIA 4R8VA 1HKHA 1KYXA 4PX2A 1JDZA 3NFRA 5KQRA 2A9RA 2CWDA 1JXMA 2A1UA 4Y6LA 3HAJA 2VH2A 3JQAB 4GRAA 1JDTA 1KZHA 4CR8A 1FLNA 2I3DA 4FFBA 3NGLA 3G88A 4KFTA 1KJ9A 1GKYA 4A15A 1JFTA 2VJMA 4B9EA 1EZ1A 1LZLA 1CQWA 1OBOA 3BB4A 3K6KA 4ENUA 3FWZA 4BGDA 3D6NB 1EUCA 2AN9A 5EPUA 4CMCA 1Z29A 1WX1A 3L02A 5ALNA 5EMLA 4U2BA 5BMOA 2Y6VA 1OA0A 1CB7A 3E61A 4Y9SA 3ZW8A 3BXPA 1T6BY 2OD7A 1I4LA 1DAHA 1UEXC 1JSXA 1YB1A 3UHAA 5M5BA 4AP6A 4UUPA 1WUHS 3ZDFA 1VJ0A 3EVBA 3M5PA 1QKJA 4P2GA 4AAYA 4G1FA 2WIKA 4RUKA 1DG3A 3RI3A 1C2YA 2XMDA 1KI4A 3RVNA 3INNA 2WSSD 2QW0X 3PFNA 1C9EA 3K8YA 3BBPA 2H2FA 3SY8A 2ZFUA 2WYVA 4DXDA 4L0QA 3HNPA 5TEWA 1JALA 2DQ4A 1J0AA 4GVLA 5HS6A 3QV1A 2QENA 2HWUA 3KOYA 4AY3A 2PGDA 4YC7A 1N7JA 3PD7A 3U80A 5LDHA 2XE7A 5AJZA 5FV7A 3KAVA 1NBMA 1YC2A 3JWJA 1NOIA 1KEUA 4OLFA 3PQCA 4XRGA 3BK7A 4JJ4A 5HEKA 4QGSA 1D2MA 2GAIA 2HHLA 2WU4A 1B3RA 3LP8A 4GFDA 4XQEA 3IAS6 1XHLA 3D9QX 2GZDA 4WBXC 3EB9A 2ZT6A 4MB2A 2QRHA 2WZDA 3EBLA 3NANA 2PD4A 3ND5A 1E99A 3FNRA 2E55A 1KEEB 3ZU6A 1SN7A 2CW5A 3SIRA 1UKCA 3T0IA 4JN4A 3N6XA 3JTEA 4FZVA 4OFZA 1WY7A 2VF7A 3TUIC 3U5TA 2PSFA 3SC4A 4W1PA 5DNWA 5AQEA 2WR8A 1Z74A 2ZRLA 3AVYA 1LVUA 3FAKA 4CF4A 1N36B 3VDQA 1N4AA 3IP7A 1OROA 5JNVA 3GGSA 3O0TA 5IT0A 2NADA 4BNGA 4YB8A 4EZNA 3DL4A 4JB0A 3TLJA 1M75A 4FILA 4CT4B 1J0BA 4DMGA 13PKA 2VPXA 1L8LA 1N7HA 2V9PA 2UYOA 3EW7A 3NNDA 3RTBA 4OH7A 2MYTA 5FL7A 1F48A 4C4XA 4F9GA 4YT4A 1V5GA 2Z8ZA 3IAAA 1ZAYA 3EVTA 3WK7A 1R00A 3E0QA 4EPXA 1XQVA 1N2ZA 3QE3A 3KOZA 5D5HA 4H9GA 4ON9A 1JEJA 4M76B 1CF9A 4GOOD 1QU2A 3KHTA 1XD2A 3W9YA 2IXGA 1TQSA 2I7TA 3N74A 3KYBA 3R41A 3I32A 3RSCA 2WG1A 1IN8A 5U4XA 1J5EB 2JVKA 3ZU4A 1UWLA 1ADJA 1B73A 4FGSA 3VUEA 2F9LA 3I72A 3X1XA 3D4BA 3PU6A 4FSXA 6LDHA 3I5YA 3TSYA 1L5WA 2IY8A 3OSZA 2X4GA 5I51A 3UMRA 3LFTA 4BO5A 3I1YA 1D1PA 3QKTA 2OQIA 4G5OA 4ESVA 2ZREA 5ESXA 4H16A 1S5PA 3DBRA 3UANA 2IT1A 3SBOA 3HKEB 3WYFA 2AT1A 2YWGA 5LZ4A 4OHYA 1SUFA 2FQYA 1A5ZA 2VO1A 2HN9A 3F98A 4C29A 3FYSA 1RZ3A 1OIXA 1PJTA 2CK3D 3OIGA 3BUPA 1GPBA 4ZOLF 4OLHA 2GZSA 5ALDA 3HKBB 5HK8A 5KTRA 4C0LA 4EYQA 4M87A 3NHFA 4OHMA 3ECAA 2SCUB 3ACCA 3DZHA 4HD8A 4X8OA 4YS6A 3ZE9A 4HJXA 3ZYCA 1S3GA 4KAAA 4AF7A 2WVGA 2R47A 2HEGA 4R2XA 4ZOLB 2X4LA 2XD4A 1M2NA 4WAUA 3B1WA 3RFVA 4ZYTA 5AHOA 1VMKA 3WAJA 4PLPA 4S2UA 4FGKA 3RODA 3M5CA 2VTKA 1U2SA 4PV7A 3QUAA 3HNRA 2IX9A 1Z7YA 4DCJA 3AX6A 5DPMA 3K32A 4YPOA 5IT5A 4XGKA 4UDXX 2AV6A 3U7JA 4OYHA 4E2WA 1U8CB 3L7AA 1PJAA 2DPMA 4P4NA 3U9LA 3PVSA 4ID9A 2BELA 1I2DA 1PT5A 4JB8A 4CL3A 2NTNA 3MJFA 1KY5A 3IX7A 1N6NA 2JJ8A 1E6MA 1Q22A 2P9ZA 3AJ9A 3B12A 1B8VA 4QT4A 3SYNA 4EYOA 4YV2A 3ABHA 2GOYA 2B3TA 2XTAA 1DRKA 1O9HA 2AXNA 1FBNA 4QBTA 1J5PA 4X64B 1UBJS 4WX2B 1XZKA 5L4SA 3FOAA 2ZIFA 2ZS8A 2MYUA 3E1GA 4HDRB 3H9EO 2J0VA 3X1KA 2WUGA 3PTAA 3O83A 4RHEA 4KYUA 1DC3A 5A06A 5C8YF 1D6JA 1VSUA 1I3LA 1J99A 1Y8QB 2EJTA 2V7QD 3T12A 3AONB 3TLGB 4RULA 2CL0X 4MDHA 3KJZA 3RYCB 1Q21A 4G5SA 3OEHD 4XIIA 3HUDA 5DHRA 1KQGA 2X19A 1RXEA 3WGUA 1EVIA 3UT5B 1XMVA 4JL6A 2X0RA 2XB2A 3KU1A 4DPLA 3WL6A 4U9HS 4WGFA 3AV3A 4Z2AA 1VPVA 1N1DA 2H4XA 3KBOA 3EARA 3F49S 4IDNA 4PHCA 3SVZA 1RTTA 3NBQA 1YH3A 2CJWA 2NU9A 1MW9X 2ENWA 3CUWA 1UPXA 3KLPX 3L6BA 4CIYA 1DAPA 2YL9A 2RH8A 2XF8A 3DEKA 3OTHA 3P4XA 4GE3A 4E33A 9LDTA 3BLBA 4DJAA 2COKA 4MPPA 1HLPA 5TMPA 1UBKS 3RU3A 3O7WA 5HZKA 2PRJA 1GPDG 2ZTVA 1QCDA 3U61B 1ISSA 3Q7SA 2GN1A 4PZZA 1XZGA 1E7MA 2H5EA 4YA6A 2NM0A 5CFPA 2IHUA 4N4AA 4AYWA 4EG1A 3PNYA 3O4IA 4MR9B 2RKOA 4J3NA 4B4WA 1Q7CA 4I1YA 1P5HA 1TKRA 4CLRB 3BK2A 3FWNA 1NMEA 5L7TA 2IKQA 1XTRA 1MOPA 2F1RA 3MTAA 1YT5A 3CEMA 4PU0A 4RK6A 3ZW7A 4F6RB 2QR2A 3O8BA 1JHXA 2VBCA 1A95A 4YAJA 5M7EA 4Y7DA 1AU9A 3A4IA 1ZESA 2R8EA 3N0VA 2BISA 2PZAA 3HWX1 4DYVA 1QE5A 2BGJA 2ONYA 4N6NA 5FO1A 1BCSB 4V2IA 2PUEA 1LK5A 4TZ6A 4ENTA 1FNMA 3DHNA 2YS7A 4X62B 1HORA 1ISGA 3HCWA 4JFRA 1H94A 3LRXA 3PPIA 3MPUA 2GEBA 4NAUA 4QM6A 4QVIA 3NPMA 3UMVA 4OBWA 3WNDA 3O75A 1WXEA 4HDNB 2VH1A 4BKOA 1NULA 1VPTA 1K6JA 1YQ9A 1V16B 4OHKA 3AR9A 1PW7A 4UPVA 2WYWA 5C7IO 4IKEA 3KPUA 2XTJA 4D8WA 4YJFA 5KKAA 2D7DA 1YQQA 1J0EA 3VHRA 3U3RA 1XB2A 5EEHA 1NUQA 1X77A 4KIJA 2Q7OE 3JRNA 3TNJA 3OIWA 1DI0A 1KHHA 1FRQA 2PVPA 1XZQA 3EAGA 3MS4A 4I8XA 4KPGA 1X1QA 2CUZA 3F8WA 3A2MA 1DT5A 1B8NA 4MROA 2JI4A 3A25A 4MYSA 4R2JA 3CTMA 4R7TA 4JLCA 5DRTA 1FMCA 4F4UA 5JISA 1RXVA 1JU9A 1PFKA 4MQLA 2NNWB 3V4ZA 1WTCA 1CVRA 1FTGA 4PBTA 4RMJA 3WZ2A 4XD2A 1JLMA 1WJGA 1ZNWA 1UXOA 1W94A 2BD0A 2PSEA 4TMZA 3C43A 4Q39A 4B75A 4CE6A 2BYTA 1JZSA 2E21A 3FNBA 4PG4A 1Y9AA 5EXXA 1UBTS 3LW8A 1PV2A 3QNJA 1W5BA 2Q5QA 2ID9A 5ENZA 3PYXA 5TGTA 2V0OA 4ZEXA 1REQA 1XKXA 1CYEA 3MUOA 3Q3HA 4YALA 3GRZA 4QYIA 2OV6A 3FYCA 1GUYA 3KB2A 3W2GA 1SK9A 3CURA 3ENQA 3T61A 2ZZNA 1QHHA 5DN6D 1SOAA 3GNLA 2F64A 2HMAA 2KX7A 4R2WA 4XFKA 2IPOA 1SQGA 4YXFA 3ESBA 1K06A 4ZA2A 2ZAIA 2ZRPA 4QASA 3PDUA 4OKIA 1NF2A 3WMGA 5IC4A 5JPIA 4S05A 4U39A 2X5CA 3TRHA 3O95A 1HNNA 4X65B 1Q5PA 2QROA 4OSEA 2BF4A 1KBOA 2P7IA 4GGPA 5AT1A 1FEZA 4JNEA 1ODCA 4B2PA 4P54A 3TJRA 1VJRA 2G0TA 2O8FB 4II7A 4BFLA 2Y1DA 3DNFA 1RYDA 2MWMA 5DZSA 3QX7A 1RHUA 2REOA 4L78A 4BPRA 5REQB 3VR5D 3AY7A 5F7XA 4XX0B 3QY0A 1Y9JA 1NJ2A 5JXGA 2IU0A 2CL6X 1BCRA 1Z6TA 2RSLA 1JHDA 1PWHA 3BWDD 2JBWA 1HT0A 2ZRQA 3IP3A 1EFKA 4FLMA 4CM7A 3ABZA 3TE7A 3DB2A 1RI4A 2FJ0A 5G0SA 5IPFA 8MHTA 1M8GA 4KUGA 1U3VA 4MVJA 5D3KA 3Q3EA 5AI5A 4R0VA 1CG6A 4YROA 3JZMA 3BA6A 3P9NA 5CVJA 2XDWA 4PLHA 1JTVA 3MYYA 3SLKA 5JTUA 1A76A 2FB9A 1R0SA 3DOJA 1JJAA 1X13A 5CBKA 1SPBS 1P4GA 5C8DA 5FOWA 3FLMA 2D7JA 3I37X 4EHDA 4XPIB 1WSDA 4B17A 1ATZA 1AK2A 2ZUCA 3I6ZA 1MN6A 4M60A 3K5HA 4L4ZA 3HDHA 3HNOA 2ND1A 3ZGOA 3UHFA 2DGDA 3UENA 4W9MC 4F1JA 1QSGA 2VTDA 4BO8A 1R0XA 3T5TA 1VLJA 3JZAA 2MSKA 2K2WA 4REMA 4Q3EA 5F4ZA 5FORA 1A2BA 3ESCA 4NJOA 5K0NA 1JQDA 2EWVA 3GVCA 5JZBA 3CR7A 2O2XA 1RACA 5SZHB 3BVUA 2Y27A 3HFSA 1I4LD 1S6YA 3LT4A 3LHDA 3WLJA 3HK2A 2G7MC 4AZ3B 4F45A 1OXMA 1ZI6A 1VYHA 4GWGA 4L8FA 3QEMB 4LHXA 5LP6C 2DFPA 3PLNA 2B82A 2CE7A 2VUIB 4IIYA 4O1HA 4RJ2A 1N4DA 2VWHA 3PG5A 1HOXA 2I0FA 1SVUA 1RWPA 5BYBA 4J9VA 5TR9A 3LPCA 4IM7A 4DC0A 2WQZA 1G3IA 4PTYA 5CNJA 2OGSA 3EVAA 3HABA 2GXQA 3U6BA 1HKUA 2ODAA 5T5QA 1F0KA 2ZBUA 5FUWA 3L6UA 1BEUB 2VHQA 3OEWA 5ALJA 3ETJA 5JD5A 4C3UA 3TRFA 1UBHS 1JSLA 3H11B 5JSHA 1EKXA 2D0PB 3NCTA 4LX0A 4ZRNA 1VQ1A 4IWNA 3FBWA 5HKLA 4CCAA 3FW1A 3QYPA 4JUBA 1PKXA 4ZEMA 5LP6A 2LDBA 1KI8A 1NBMD 1NLUA 2HTFA 3OAAA 4HI0E 2NACA 5EXPA 3RT9A 1B15A 1YOVA 2X2OA 2JAQA 2ZPUA 3E8XA 4YRCA 5D5QA 1LI4A 4EK9A 4AJ9A 2WIFA 3OKPA 5JVDF 1B76A 2DT8A 2W6OA 4QL3A 3RAEC 2VHCA 4YRLA 1NY5A 2B8TA 4NEHB 1N6RA 1W46A 1YRBA 2EIHA 2ODTX 2R6JA 5JQWA 3ZHVA 2QUHA 4DNXA 3D8BA 4OYLA 4JQZA 3TAXA 1JH8A 1UXGA 4UE6A 5JVDB 4TLBA 1N3IA 2RB5A 2ISCA 3VGJA 4LSGA 4AWAA 3L1IA 1PT8A 2GDJA 4GAEA 4TWAA 1OLSB 4PZ9A 1PBTA 4JUCA 1KDVA 5HTKA 1KVUA 1X9HA 3G2MA 3FD8A 1XEFA 1PGOA 1XQXA 2X8BA 4O2RA 4PGFA 1NXXA 1HGXA 5FL7D 1FYEA 5E0KB 2W98A 1FL9A 4YJGB 3KC2A 3CT6A 1HRKA 3PA8A 4R1QA 1Y63A 1ZSYA 1QG4A 1SKYB 1T2FA 2RHOA 5IANA 2ENUA 1MPXA 2PBZA 2I7XA 2INGX 4PFJA 3JV7A 2CLIB 4I4TA 4E88A 1ZL0A 2XB8A 5F5XA 4YPVA 4OUDA 4LZAA 5BOSB 2Z0VA 1M1NB 2DF8A 5K0TA 1LV8A 1MP0A 3HEBA 2ZYIA 2P2CA 2LR0A 3USES 1XZDA 3M8KA 3OPMA 4R1UA 3VISA 1C9KA 2CGEA 3I58A 2IOQA 2VI5A 5A3QA 5LQRA 3NASA 4P3OA 4TUYA 1PP4A 4IDHA 2UZIR 2JAOA 2Z57A 4IFIA 1YI0A 2VXCA 3CRQA 2J3MA 5FYQA 5KDLA 2OKGA 4ZYYA 3BZWA 2QD1A 4OQMA 2VPYA 1CFZA 1XX6A 4EKNB 2GHIA 5CTAA 2DFVA 2OAEA 4E3CA 1M34A 4JWIA 5HGXA 3PEYA 4I99A 1RAGA 4YV0A 3GLHB 4ALLA 4HLQB 3I45A 3OE7A 3B20A 1XXLA 5C9ZA 3W7BA 1XQWA 1QYRA 1IBKB 2FR1A 3B70A 2OORC 2XVZA 4HNSA 3T5DA 8ATCA 4LDRA 4E12A 4RXUA 1W29A 3CX8A 4L1KA 1P75A 2Q21A 3GFTA 1QANA 4KVAA 5DM60 4TTJA 5JSFA 2PGOA 3E7DA 4GZLA 1N25A 2QOEA 1L7RA 1WE2A 1P45A 1B6SA 2O3UA 2X5XA 3DFKA 2NXEA 3GT0A 1ZIXA 4XUDA 5H02A 1JVNA 3LWZA 1EUCB 2B2XA 4Z1MA 1TEVA 2NMVA 1FUUA 1PZHA 1XDDA 3IYLW 4P36A 3E5RA 4D8XA 1TCCA 1NZFA 3IPYA 1B43A 3PC2A 2OORA 1VHJA 1ZXLA 3R3SA 1KWKA 4XYGA 3M6UA 1HWWA 1U5BA 3IQGX 3SR0A 2OOKA 4PG7A 3U40A 1ZEMA 3GCDA 1O77A 2IXDA 5C4GB 3ICEA 1G8FA 3O1JC 1IXYA 3WP1B 4YCLA 3H8SA 3LD9A 4H8SA 1RI1A 2EFGA 4A0GA 2KB0A 5F64A 1XDSA 2QVBA 4WLFA 1LFAA 4KWCA 2Q4DA 3NKFA 4WZBE 5ALIA 4F06A 4FGZA 4IDQA 4PXSA 1PWEA 3HRIA 4Y2SA 2I9KA 4D3XA 1YL7A 2ZYGA 1YA8A 3IALA 1A4IA 3QFSA 4W7SA 4YRPA 3WQRA 4F0JA 5KNCA 2GPSA 1DXOA 3VSBA 3AYZB 3CV5A 5ANRB 3HZRA 3ONNA 2WA1A 5FI1B 1P0QA 1UC9A 2JB9A 2XMSA 1XZJA 1BQ4A 3AIIA 3BE6A 3QXHA 3QVTA 1XNHA 1V3UA 2HQ1A 4MLPA 4RU1A 2PMCA 2BEWA 4K8RB 1U31A 3TQQA 4E5MA 5BRAA 1UKYA 2DUJA 2HWXA 2OFXA 2UVPA 3NRBA 3ZOZA 4DJJA 5JWOA 3GOHA 3I05A 1I30A 5FBQB 1GNRA 2EBWA 3WGIA 2Q99A 1AHIA 5BUCA 1D1QA 1UUFA 3GRRA 4NX2A 5LBTA 1YJCA 3FYHA 4WT7A 5DWDA 3TCXB 3CISA 1YVUA 4G3XA 3LUAA 4NV0A 2OUKA 4KIWA 5B6IA 3KSAC 3H5NA 5DHFA 1QZUA 3MBOA 4CQJA 3GY0A 4J3FA 2BN4A 1J1ZA 1RWOA 4CL2A 1LY1A 2WMDA 3SHOA 4EEZA 4A2QA 4BQPA 2WU8A 4ALIA 3VXKA 3O26A 4MW6A 4B6FA 1G4UR 3G9TA 4MW4A 3LUGA 3TD2A 2ZYWX 5JAPA 3NT2A 1P60A 3BQ9A 1DKUA 4M8KA 2JA1A 4QQRA 1AUVA 4UUMA 5DHUA 2WDZA 1T8PA 2C2HA 3UB3A 3WZMA 2ODEA 3JVDA 4IEFB 3V7YA 3B1YA 4RJKA 1G7TA 1RP7A 4AMYA 4Z9XA 2VRWA 1DS6A 3CB2A 1L4FA 1U7DA 2PZBA 1U9IC 1SVOA 3FI9A 4JI7B 1B0ZA 3GCZA 4QXPA 3OZUA 4JBWA 4R1NA 4M0UA 4UZSA 2R65A 4DDVA 2II6A 1XD2B 4ETWA 3NEPX 1FXSA 4KRGA 5J4HA 4TV8A 3TE6A 3TPCA 2PWAA 3FCCA 3P9IA 2PX6A 3AMVA 4PPGA 2CVPA 1UT6A 3WIEA 1NURA 1BC5A 3D4PA 3DSRA 5EZYF 3T95A 1Z08A 5DISB 3JD0A 3NHWA 2HJSA 2LCIA 2XUJA 3OLZA 3WLTA 4XYEA 4CBVA 1U9IA 4FM3A 2F3UA 1DBRA 2O54A 1EINA 2QIPA 4PC6A 2DG2A 2FE1A 2OBYA 3DBRB 3LT0A 5EZYB 1TW3A 1E6WA 1JEAA 3I12A 2ZTLA 1MHTA 3BRQA 1LQ7A 4AN4A 3KKLA 2ERXA 4FB4A 2XB9A 3VPAA 1TOAA 2E4VA 2JJ1D 4JYMA 3G8YA 4LSWA 2Z95A 4MGHA 1NR1A 3TUZC 3IIJA 1CY7A 1ULZA 2I54A 4M36A 4OH1A 1URUA 1AC5A 5CITA 3MT7A 3EIWA 1BDMA 3F7NA 5J4YA 3GEBA 3QOXA 1NPTO 1GIAA 2XUPA 2YW2A 1ZX1A 4G37A 3TM4A 1E4OA 1YZKA 1DBQA 3X2SA 3J7AC 3LAWA 4C4SA 4GT1A 2QAGA 3O9VA 1PJBA 4PSCA 1ENOA 3LPAA 1YR8A 4QQ8A 4D81A 4E07A 5T4BA 1O0SA 3KZNA 1ZYLA 1AZLA 3AEXA 3C5WP 4FFMA 3H75A 1YGPA 1ACLA 3IAHA 3CRMA 3MNFA 1FUYB 4P3PA 3ZE1B 5CG1A 2M1ZA 3NHAA 3C2QA 4L4RA 4OQQA 3OF2A 1JPUA 4NFYA 4RPGA 3QA8A 1C7EA 1KAEA 2AXEA 2BUCA 3L8EA 3PSHA 3U1TA 4XGQA 4CI9A 5JNLA 2V97A 4NF2A 2O23A 3C0KA 3TSCA 3FUUA 3L0DA 3TVTA 4DAOA 2ZYTX 4CLOB 1HLGA 4B85A 4QBFA 1Z3CA 1Q1NA 3FCEA 3MD9A 3R0VA 3M6MD 5HJ2A 5HKAA 3W5DA 1HRDA 1AK1A 4FCVA 4J0KA 3T3EA 3SSNA 4EUFA 3DT8A 2I1LA 1FJXA 2JGIA 3AW8A 3H1TA 4URVR 1QRSA 2EZ8A 1QBKC 3P9PA 4PS1A 1XRMA 2PCJA 2G5TA 3G2KA 3K3PA 4OK5A 1U81A 2BZ1A 5JI2E 3UB2A 2O50A 5AW9A 2WHQA 1FRNA 2WZQA 3E1KA 4UPEA 1FIUA 3LOUA 2ZIXA 3GU3A 1B2LA 3H17A 3BVWA 1JLLB 1QAOA 2ZAMA 2NU9B 2BGKA 2F1HA 3HVHA 3DBLA 1L1EA 2QRNA 3H1AA 4E1BA 2C00A 3NAZA 4GPAA 2G1JA 1R0WA 3ZDEA 3KZVA 5F7OA 3BYZA 1TNDA 3TS1A 4E2XA 4FHEA 2Q46A 2WAOA 4LG1A 2HCTA 2I6UA 4I9GA 3E5NA 1B16A 4E81A 4LOHA 4M0LA 3ON5A 3WYDA 2F7QA 3JWPA 4KGZA 1TXGA 2WPNA 1I6WA 1F0NA 4XCVA 2EX0A 3D52A 1E32A 1LNZA 2VF5X 1UBGA 3RK4A 1DBWA 3SU8A 4ZODA 2X2FA 5HQTA 5IS2A 4FNOA 3BORA 1V5FA 1QIDA 5EY5B 1GZUA 1DOZA 1OGJA 5HG0A 2V7WA 4X92A 5CD9A 3DCJA 4IZHA 4RCYA 2OZLA 4EQZA 4XASA 1R1DA 1A4RA 1N92A 1INLA 3N6RA 2O0LA 1GYQA 1LDYA 1EM6A 3GRUA 4PLYA 3UCFA 3C5CA 4GUDA 4B09A 4F86A 5L6LB 1ZVJA 1K8RA 2C9CA 4P0TA 2E4AA 3HJHA 4YI5A 2A0WA 3GJ0A 1JPVA 3SIXA 3BXXA 3N2YA 3PDIB 2AF4C 3IL2A 5TQ0A 4EH1A 1YDFA 3EHEA 4MW2A 5IVHA 4FR0A 3VPDA 3N7AA 2BBWA 3TBKA 4LYYA 5TJ9A 4KNYA 1CR6A 1HE3A 3PNBA 4L5CA 6Q21A 3DB1A 1LSUA 2D6FA 3OQOA 1TT7A 3C3AA 4PR0A 4RZHA 1T9ZA 3KQSA 1ZJ6A 5EMNA 3IDFA 1MQAA 1ZCJA 4GX2A 4H1UA 2P6MA 3QZUA 1TK9A 3VZCA 1GNLA 1DBPA 2YHIB 5BWOA 5KTSA 1UDBA 2EKBA 4J16C 5AXDA 1E6EA 3HKDB 3M83A 1ESMA 3GH1A 3NHBA 3OQPA 3ZLBA 2NP7A 2E4YA 3B1JA 4U9UA 3C3XA 4KIUA 1YVEI 3HM9A 1K6EA 3F0TA 2QRMA 4J6FA 5L40A 4ZOCA 121PA 3E35A 1TAUA 5JJKA 4CDNA 1SQ6A 2HT1A 1OFHA 4B6GA 3OAAD 2BFWA 4P3YA 4DNOA 5K0GA 3RRXA 1MPTA 1M73E 1KVSA 4Q0MA 4DREA 2HREA 3SMVA 1ZL2A 4J16A 3EZLA 4IINA 1ZD1A 5IU6A 2JZCA 4A73A 4YAKA 5JTTA 3ZR4B 1PFWA 1IAVA 2ZATA 4L74A 5JROA 1N32B 1XPUA 3C3DA 1ZMTA 5LR6A 5EUCA 1VKHA 1EWQA 2H07A 3D81A 4JDUA 5ALRA 3H87A 1NXWA 2HM7A 4LYDA 4WY8A 3TD6A 4C7JA 4YNBA 2C20A 5J1TB 3G17A 2ZW9A 5DEIA 5AIBA 1H4SA 2VQEB 1K6IA 1GVHA 4M7OA 1R37A 1V47A 2FPGA 4WA8A 5FUYA 5JATA 5KC9A 1QLWA 1PJ3A 2FK7A 3KKQA 5TV2A 1AMUA 5BW4A 3GPCA 4EUHA 3THXA 1ACMA 4RVSA 3FGPA 2XQVA 3QLVC 3QJGA 4EW6A 1PD1A 1AF7A 1P9RA 2GF4A 1KQ3A 1SG0A 4G1BA 3D3QA 4FSHA 3TLBA 3HI4A 2EGGA 3EZGA 4RKQA 2GX6A 4A92A 1GTMA 2AD5A 1H0SA 4K6MA 4OF4A 2WPDA 4UFPA 3CYFA 4F12A 1IN4A 2PQMA 5BN4A 5GIPE 3Q8LA 3R6DA 4O25A 1D2NA 1KI3A 5B58C 5U1PA 4CKBA 2JRCA 1XXHE 1M10A 5CPBA 3ZPXA 4AZSA 2NT3A 1E2QA 3H5AA 4GVXA 3Q7QA 4QE3A 5CYPA 5CB8A 4J0FA 3RC2A 3LSYA 3QLVA 4GICA 3BL6A 3VYRB 1I4EB 2HU5A 1FNCA 4LJ7A 5K09A 4CLEA 16PKA 1BCRB 2V0GA 4A10A 1ZD4A 2ADFA 3W8FA 4WCFB 4DLRA 3TBHA 1R6DA 1G63A 3ZY5A 1PL8A 4MS1A 3AG6A 2YIVX 4ZIRA 3ANXA 3SOZA 4RCZA 3KR9A 4JBLA 4AJJA 5IJZA 2HNKA 4PVDA 1J7KA 4TTPA 1M2KA 5ER9A 5F1YA 1CVLA 3BX1A 3MWEA 2P2SA 1KVQA 2YWBA 4QOHA 3WDSA 2PBRA 5ICCA 1WABA 2IYNA 3PHCA 4P98A 4PQFA 3OQ1A 3WYAA 5CCXA 5DNUA 1VI6A 3QENA 4UTRA 1AQ6A 5BNFA 3R3WA 4CQMA 1IDN1 3FWPA 1UIMA 2OFWA 1JR4A 2PWYA 1S02A 2QRUA 4S1VA 3M70A 5GP1A 4JI1B 4PONA 1QRRA 2JEYA 3BRWD 2C8LA 3GZNA 1WNFA 3AVXA 3QJYA 1EVZA 2B36A 4WBSA 2PUFA 3W1WA 1WCYA 4KC0A 5JNWA 2FKAA 3WK9A 3O4JA 3FVTA 3OBIA 4ZV9A 1BEZA 4DA9A 1WVGA 2QYHA 3AY3A 5B4UA 3D8HA 4UD6A 4FW8A 3I30X 5P21A 4REOA 3GLFA 4OAOA 4I5FA 1MT3A 4Z1MD 3T1YB 3QVUA 1YDGA 3C15C 1NHWA 2VWPA 4EZRA 2PH3A 3DZJA 4HYTA 4AKHA 3C6MA 3IUPA 4IJUA 1PQYA 3LYLA 1GZ7A 3KOOA 5FHQA 2RGRA 1C7IA 3M4ZA 2F3SA 4N0DA 4MQ4A 4W5TA 5KO2A 4A6EA 1BS2A 1O6GA 2CYAA 3LYHA 4R69A 1N34B 4KRFA 3A14A 1FNBA 4Y2JA 1TZJA 1WHTA 2VRCD 3DHEA 2C58A 2DAPA 2BHSA 3BULA 3PPWA 3QPVA 2CBGA 4LZZA 2C97A 2D0OB 1X7ZA 2H2GA 3EXHC 4EW2A 4XQGA 5BN5A 1A88A 3PSAA 4OQLA 1V5WA 2XA9A 4AY2A 4FBGA 5KNCD 1TM4E 3OTWA 4FS8A 5TS2A 1XDUA 3BB1A 3FOWA 5LP6F 1FPQA 2R6FA 3HVKA 3BM5A 1V41E 3QWFA 4NKRA 3PE3A 3I9LA 5FUMA 4B46A 2Q3EA 2H9AA 1R5BA 3FOEC 1K6XA 4OI2A 5LP6B 3BHIA 1MAHA 5HOQA 1U9ZA 8ADHA 5CMLA 2WLSA 3EXHA 3GD7A 3L7JA 1GZ6A 2BM1A 4WQMA 4HB2A 2PX8A 5KI6A 4UKDA 3AKDA 2ICAA 2QV0A 5IM5A 3ZGLA 4MW1A 2BSAA 4D9GA 2P7HA 3LTNC 4B6SA 1KJNA 4MWZA 5LQUA 1BGWA 3GGCA 1R34A 1U90A 4RKWA 2RHGB 4B76A 1NNI1 3HACA 1U1DA 3AR4A 1EGMB 2GR9A 4KR7A 3BFVA 1KE1A 3L92A 4XWKA 1LGYA 4OP2A 2R62A 3JQ7B 4MYHA 1QK5A 3IUQA 1VL6A 1HFEL 1J8DA 3DMPA 1V43A 3EF1A 2CT8A 1KK0A 5IN5A 2EBFX 1CRLA 4ZAFA 4XVUA 1ZHHA 3L93A 5DH9A 5H3HA 3I2HA 5G40A 3ASYA 3GUUA 3GRKA 4GX0A 2FCRA 3ABIA 4KH1A 4I4TF 1HYHA 4XW2A 1Z4QA 3LXXA 4GR9A 1UR5A 3D2CA 4JSRA 2B1IA 5DVZA 5SZJA 3RADC 1YI8A 2ERYA 1EJ0A 5C52B 1N5KA 4WECA 2G8NA 2V7XA 3MCWA 5L3QB 2CBZA 4ZAZA 3WWZA 4GZ6A 5MN4A 1SY7A 4FMCB 2FSFA 1SELA 2XCOA 4TUYF 4ZT7A 2P4EA 4CYMA 2YUIA 4AZBA 4HB3A 1DT3A 1P39A 3BUDA 1XTUA 4HFMA 4L9AA 1AZSC 1Z82A 2DPXA 3PYLA 5BR1A 3FIJA 3CA8A 3E2PA 3K9CA 4LK2A 1RZVA 2E89A 4Q47A 4ZOQI 1YRHA 3EDCA 4HJRA 4M3NA 4MYTA 5CVVA 3AKEA 3PIDA 5JH7B 1IK6A 1PJCA 3GOQA 3MMPA 4UOQA 2YMQA 2MI7A 2QNIA 3UFBA 2BFMA 1RI3A 4M6WB 4X1KB 4G0ZA 1YZFA 2Q9AA 1NX9A 3H4IA 3K31A 1W5TA 4D9NA 3OOEA 2GEJA 5BSVA 1JIQA 2F2TA 1L4EA 2ZIEA 4YQYA 3QIVA 2C9OA 4KOEC 1MXHA 4M1OA 3BT7A 4Y6RA 3ETHA 5DTRA 1GRRA 5LZ7A 4KQWA 2HSJA 2VJAA 2Z6VA 3P19A 2BSQA 2WG2A 1DJLA 1ZK2A 2CJYA 2PMDA 4IMJB 3N7TA 5AR1A 4LE2A 3H13A 4YRJA 3IVMA 3ZH2A 4CEJA 2MMCA 1GA1A 2DFTA 2ZTHA 4WN9B 5DP1A 1Y1QA 4M4SA 5T67A 3VH4A 2QXLA 5M04A 4W5WA 2WM2A 1B8UA 4MHSA 3G3EA 4L22A 2DH5A 4BP8A 3I39X 1Y5IA 2YL6A 1NUTA 5BQFA 1Q14A 5I9BA 1I3CA 2HQRA 3C24A 4LYFA 3VZPA 4E5VA 1J9GA 1RYNA 1YZLA 2IVZA 3OM0A 1C3OA 4HWRA 4TTQA 5DLPA 4UOZA 5C32A 5JY6A 4WA7A 3DE4X 1FE8A 1OXVA 4OBBA 4NBRA 1F2VA 3SJUA 4JCCA 1KETA 1KP9A 1LUAA 1V7PC 5E2IA 5JNSA 5IP5A 1U5BB 3O3MB 5JECA 1DNPA 3N8KA 3RNOA 3T3PB 4D8VA 1U7XA 3L9WA 2DH6A 1Y6ZA 2Q3MA 2F48A 3QA9A 4IQFA 5E3HA 2PV0A 2OC4A 3LZDA 3Q7PA 4HNRA 4OQPA 1PQPA 4AIIA 1D1TA 3QKRB 4TLMB 1EFVB 2G70A 4X54A 5ULLA 3ESZA 1NF8A 2A67A 2FWBA 3EXG2 4K05A 4MVJG 4EZQA 1TT5B 4IV0A 3LGAA 4KZKA 1LF5A 2C7GA 3HXLA 4S12A 3I1JA 4WKPA 2AS0A 2PLAA 2X0KA 2VYCA 3WIVA 4M9XA 3DMGA 2FSUA 2QLTA 4KUEA 2BJHA 4ZJUA 1IRXA 5AHRA 1LBSA 4AMGA 3OZCA 5AI9A 2Q1SA 2MR6A 1XZAA 1S4MA 2BEWB 2ZYRA 3LT2A 4R7GA 2EKQA 2A59A 4HDCA 1OX4B 3LUDA 4ZEWA 1LDGA 2IPMA 5MGNA 3CHYA 1C7RA 4TLEA 4TSRA 1D0IA 1Y5RA 1ZCFA 5JFGA 3F6CA 4GM0A 5CDHA 3HXQA 1Z6YA 4P5PA 1O0CA 4F4JA 2PH5A 3FFTA 3FY4A 1FU8A 3GC6A 3LWDA 1FDTA 4NAVA 3ZD6A 2HLNA 2QQ5A 2I2DA 5SICE 4JL9A 2ES4A 4TZ0A 4XOUA 5EINA 4EG8A 1AZWA 1ECGA 2ZYSA 3AQIA 3P9CA 1V3VA 3FSEA 4QJ3A 1FFWA 2VZ9A 2V03A 3JATA 1I2CA 4E2FA 1MW8X 1PEYA 3FTQA 3NOXA 2PX4A 4GLLA 4RD4A 4DW8A 4ILEA 3TNLA 1E64A 3J81k 1ECBA 2SECE 2XOXA 3UWDA 4HDSB 5DGDA 1NT2A 5FTLA 3CEJA 4D41A 1OVGA 3FVVA 3G7UA 3T7RA 2XCUA 1GTL1 1R33A 4FOLA 4GW3A 4Y9DA 3U6KA 2F6RA 2BDEA 2WINI 5JCJA 2HW8A 4ARBA 5CM2Z 2VYNA 2NYVA 2WOJA 2YDXA 3EJWA 3L8DA 4V0OA 5LDDC 4X1IA 4TV8F 1E9EA 3K20A 5CVTA 4R9VA 2Z0NA 4XGRA 5K05A 3KEFA 2YRXA 3WWOA 1FS4A 1VG8A 4ALJA 1VJDA 1TKCA 3T47A 2FEPA 4TV8B 1HL7A 2XMBA 4M1EA 2C9YA 1GAJA 3PS9A 1AN9A 4PXYA 2O0HA 1P8AA 2H0QA 2WJAA 2PWBA 3RK0A 1ONNA 3WLOA 1CJVC 1VPEA 2F8LA 1X8LA 4CVNA 4J0GA 3CO5A 2DT5A 1EFPA 3HBNA 3C8HA 5DK4A 3U13A 2GCPA 2IYFA 4NK4A 4ARZB 4AY6A 1PR9A 1W0KA 2Z8YM 4K6FA 2QBYB 3EUFA 2O57A 3R75A 4BEBA 1N3YA 2ZSKA 1Q0UA 2YXDA 1OTXA 1T43A 2YRFA 3KD2A 4L8LA 3VVCA 4DQ0A 5ARBA 1GLVA 3RUPA 3EPPA 3CRZA 3PR1A 2VS1A 3KDPA 4EGJA 1POWA 2I67A 1MVOA 2FFJA 4HS9A 4PNEA 3V7UA 1E1RA 1RQ2A 5AK5A 3ADCA 1JFRA 3RHZA 5DBFA 3OA0A 3FF4A 3ZKWA 1H2ZA 2GVZC 3GVXA 4HMPA 1LJUA 1SHZA 1KMMA 4G2NA 4YLEA 5IBPA 4RLQA 2OP0A 2XTNA 4UZEA 4YAUA 5IKPA 1GGHA 2FH5B 3AR2A 3HCBA 5A02A 5D51S 1F9AA 3HQ4O 4AY4A 3NVAA 3FKQA 1RSZA 1NW5A 2JIOA 5CFQA 5BWLA 4KQIA 5B7GA 1BKDR 4N0EA 4RLHA 2ON6A 3OZVA 5GOZA 1A77A 3MTIA 1A9PA 4MARA 2IDKA 3L7BA 5BVGA 2ATVA 3FPLA 4JSYA 3OFSA 1C7QA 4HDQB 4M1YA 2C2YA 5BSMA 2EX3B 5D85A 3LUCA 3ZVMA 3UJ9A 5CK4A 1PNVA 1N5OX 2BGWA 1M1YA 2NN3C 4TS9A 1IZ8A 1GKLA 3NOOA 4OQEA 5G1OA 2GJ8A 4GMHA 1JLKA 3TJMA 4E13A 1I10A 3SM3A 1NNSA 5HX7A 4QQKA 4ZWNA 2L0XA 1FUEA 3F7MA 5DKFA 1IONA 1P31A 4X9XA 1OZFA 2NYAA 1ZMBA 1Z0ZA 3EX7C 2VAXA 1E1MA 1UBEA 1BYIA 3K16A 5JSZA 2QLNA 2E5LB 1WXFA 4GP6A 2PX5A 1Y98A 1YQXA 3G9GA 1F4LA 2C3OA 3FWYA 3EOAI 4IMRA 2O5CA 1ZI9A 3LUPA 1DAGA 2ZCJA 3PIIA 2PRKA 3HVRA 3A6FA 3PK0A 4EHIA 3NAQA 4HN4B 1L5GB 3TDMA 1Q0PA 4IICA 3FPSA 3ZV5A 3RS4A 1GJRA 3DBLB 5B1SA 4Y18A 2B3DA 1DKMA 2GPJA 1ZS9A 1Z36A 1A5AB 1TAHA 2RAFA 3AVQA 2QN7A 3DGEC 3OT1B 4A5SA 3U3JA 4N39A 4XFJA 1OBFO 2QUKA 2C84A 2Q9BA 2C8VA 1W6RA 1UAYA 3UMGA 1IUKA 4DB2A 4WLEA 4R7ZA 5BSGA 2AQIA 5LCXA 2BR4A 1VIYA 3BD9A 2E85A 3WYCA 5H82A 2EFJA 4Z8XA 1A9XA 5B2FA 4PYOA 3LPLA 3DL2A 2YN0A 2NSLA 4ZREA 4CQMD 4GLJA 5ESRA 1L7OA 1Z47A 3PQ7A 2AOTA 3IAEA 5EKSA 5EMMA 3EVDA 5KYWB 5IJ9A 2RAIA 3PNVA 5JXIA 4INAA 2FSIA 5A9TA 1MABB 3THRA 4NARA 1MZVA 2QRVB 4KK4A 3WHKA 3RBVA 1QYWA 3KSZO 2R79A 1P2GA 3NHKA 4LJYA 1DCTA 2OZLB 3Q72A 2CXTA 4YACA 2M9MA 2HHCA 2HSEA 3DDHA 2BP7A 5AESA 3TRDA 4RGYA 1G2OA 4KN6A 4TVSA 1B6RA 5A71A 3IQXA 4E0BA 1I0IA 4MB6A 5ALWA 1EYZA 2Q5CA 2DHDA 4KI7A 2H5JA 4I4CA 2YYSA 4OFWA 1XAHA 2JJ2A 3RSQA 3AUYA 1NKVA 4DLVA 4FJ2A 4I36A 2WU1A 5KOHA 1PJLA 1ULHA 1XZHA 2QG4A 421PA 1KSFX 1XEXA 4JA2A 5G1NA 1GA6A 3SSOA 1E8NA 2YV5A 3NBZC 4O4LB 1ISHA 3LGXA 4DC1A 2LNDA 4EDHA 3VR4A 2WWYA 1E1QA 1N2BA 1OV6A 1AG9A 2B0CA 3UUFA 4ZVSA 3TDKA 4IDBA 2CYCA 3PUKA 3RTAA 3TZ6A 3VU8A 4KR6A 1COZA 3CCFA 1P6XA 3V4FA 3BCUA 1DWUA 3IAUA 1SCKA 1JKMA 4GOKA 4TGLA 2DPYA 4ZVRA 3VPFA 3AKCA 2VTBA 3GJXC 2CNWA 1WZ2A 4LI0A 1SB9A 5AJXA 2IUEA 4ISCA 4KYTA 5EP2A 4EMTA 1QPZA 3PP8A 4ZAXA 1K7YA 1Q2UA 1W87A 4RF2A 3BAFA 2NCZA 1CUAA 1KJJA 1OGYA 4IQ8A 4PX5A 3L3BA 3WFJA 1G19A 4WESA 4H1TA 1KK2A 3ZZMA 1DJMA 3FTEA 4AROA 5IDWA 3COPA 5H5JA 4C06A 3R5SA 1MTZA 3ZH9B 3BCHA 3KIPA 2EF1A 3V4OA 3VHLB 4NCIA 1SWVA 1OPXA 1P4RA 5EGSA 2FYVA 1ODIA 2IXBA 3DF7A 3FN4A 3B6MA 1E92A 5KNDA 4YMGA 1BH6A 3B6JA 1VIVA 1R88A 2OESA 3T4EA 1MB4A 1CYDA 2QMUA 2WE8A 4QWMA 4MEAA 2WAYA 1R4ZA 4L76A 1ABFA 3GVHA 2PSDA 2NUBA 3WLFA 5KPDA 2EX1A 2NTJA 4PHHA 4PXAA 3HO1A 2H1VA 3WQQA 1SKYE 1PJ2A 5GV7A 3R3VA 4J03A 5ALUA 1N5MA 1UPBA 3M2TA 3IAM1 1KMIY 2N1BA 3CZCA 3D7SA 4MQFB 1DQSA 4Q12A 4YQFA 2I6TA 2E5WA 2J9YB 4N7MA 3T3DA 4DNQA 1W36C 5I47A 1XAJA 5IFKA 1VPLA 2DY0A 3A06A 2CNKA 3HUEA 4JITA 4OMFG 5KYXB 4IKOA 1H3NA 1KDZA 1U3TA 4MTLA 1KMCA 4B47A 2POCA 2MYPA 1F38A 5DNYB 4CJXA 2L17A 2EEPA 4OHRA 3MIIA 1O7JA 1P9NA 1P4SA 2EKDA 2KM1A 3GT4A 1EI9A 4L72A 3UJPA 1LTKA 3F7OA 4XARA 2Q0HA 1QRDA 1W581 2Y99A 4DKXA 3UMYA 4B2LA 1FFYA 3W6OA 3LW7A 3CR3C 5H9VA 2P6OA 2W8BB 3W0LB 3KO8A 2AXPA 1PS3A 2QF7A 1T2NA 4MRRA 3OJWA 4US1R 3GLHE 1DKPA 2NVUB 3ZDQA 4C0QC 3H5WA 3IMCA 2G09A 2BLLA 4WUVA 3PNLA 4S1NA 3SD7A 3OZGA 4KE6A 3H19A 3LP5A 3WS7A 1G17A 2I3AA 2LRHA 4EA9A 4QXMA 3ZHXA 5ALTA 4GI2A 1SHJA 4H1WA 4DB4A 1GT91 3UMJA 1KNXA 1U0OC 3HU1A 4B9QA 3QBVA 1K4YA 4G8CA 4PM4A 1O3YA 1HZJA 4UCWA 4XE5A 2J4FA 1P2BA 2W9XA 1ZPDA 5F2KA 2ZRCA 3BHJA 3EGCA 4BFWA 5A03A 3ADBA 3DPQA 1VE7A 2IPNA 2X2PA 4QICA 4DLAA 2FPUA 5AMXA 4GNRA 4N65A 3K30A 4AZ7A 1X7WB 4WZAB 5KAPA 1R66A 4MX8A 4KQEA 3AF4A 2I5PO 1M33A 1OXBB 3AHFA 3CZMA 3GF4A 1E5TA 4XYMA 2XV1A 2PH7A 4DDTA 3UM9A 4M37A 2YVLA 4M1MA 1PJZA 4DQDA 4E5KA 1W48A 1X19A 2VXYA 1U0SY 3REQA 1O89A 1NMZA 5EZSA 1QTQA 3UMBA 1ISFA 3SEQA 1BE1A 1QMPA 3LSTA 4K88A 4OXKA 1SZJG 4H60A 2QFFA 3CPHA 1DEKA 3FJYA 5CCDA 1DJPA 5TVGA 1R0CA 1GD1O 3LRPA 4Q1BA 3DYTA 4URUR 3WKCA 1WHTB 1QWSA 4PHGA 4GBGA 2JLBA 5JEDA 3W5BA 4OXQA 1X7ZB 2R6ZA 2BOVA 4HL6A 3UJCA 4QXRA 5CXQA 2Q4TA 1P5ZB 1DXHA 2N47A 2VPTA 3FFWA 2XUDA 5AOAA 4XUCA 3UITA 2A0YA 4UHKA 1TCBA 3B3QA 2I1QA 4B74A 4C21A 1NBME 3GDOA 2BFCB 4MPDA 3S3TA 1T4CA 4EWLA 4JY7A 5BPHA 4G2TA 1YONA 2BE7A 2BPOA 2HLPA 3HN6A 4GF5A 5BW8A 2R1VB 5HNKA 4GL2A 2FUKA 4WBNA 1WCXA 1GLNA 2N75A 2R4UA 1GRNA 5ELMA 5JADA 3H0EA 1C9NA 2B7BA 3EXHB 3BS4A 5D01A 3PFIA 2G1AA 4X93A 4M9RA 3RUFA 4J49A 4AO7A 3OJLA 5G4KB 1TJPB 3V8EA 1OC2A 3A6JA 3ZS9A 4ZVMA 5F3WB 3U44B 4U6NA 2HHHB 5JNUA 1VDMA 4RTSA 4JI0B 1T29A 1J33A 3KSMA 3L8CA 4CMKA 3CW2A 3GRCA 1C1HA 4OJQA 2V4ZA 4KGXA 3ZW9A 1CVIA 2XQFA 1VL1A 3PJRA 3RARA 4L6IA 4WFKA 4GQBA 4ND7A 1I7NA 2Z2ZA 3BWCA 1YTLA 4MA5A 3UWKA 2FU5C 5ISMA 2OW6A 3QMWA 2A92A 2R48A 2GNPA 3CW8X 1MT0A 3WDLA 2G28A 4DIMA 1RVV1 4Q02A 4GZMA 2OHGA 5JCJD 1D9ZA 1H6AA 3PX2A 4UNNA 3QGMA 2VYND 2BFBB 3HADA 3PF8A 1IFXA 4P83A 1DADA 5JANA 5B2EA 1E0AA 4J8PA 4EIWA 1EIWA 2WJWA 4IZ6A 3P0IA 2R8PA 1X86B 1W85A 1Y3IA 2EWMA 3CZPA 3GJQA 3KBBA 4JGGA 3SR4A 4ENQA 4QU8A 3HCAA 1GLGA 4D3ZA 5LMCA 3H5TA 1A7KA 2IHVA 4AWXA 4DJEC 3EJ6A 5IJ0A 5KWVA 3AW9A 1BXZA 4XWWA 3MSCA 2YI8A 1NQUA 3CZ4A 1L4MA 5I4IA 1HM5A 1OGIA 2KI5A 4FFVA 4IFTA 4QTUB 4DZZA 4NPCA 3NP9A 2YLAA 2IS1A 2C98A 4JC8A 3R23A 2FNAA 4Y6SA 4D99A 1SQSA 4ISBA 2XRZA 2WD8A 3WOHA 3S27A 4BY9E 1LLCA 4ZOAA 1G3UA 1MX1A 3NX4A 1FJHA 3L6DA 3LYUA 1W0KD 3JQQA 3Q7EA 2F3RA 2PPLA 1AV6A 4GXQA 3BL8A 1DMRA 3ZZUA 2XA1A 4EMBA 2XT0A 2H4YA 4K1XA 4RMHA 2BKLA 4IDEA 2R25B 4QPZA 5BN3A 3NGMA 1D4OA 3OH8A 4KL8S 4P80A 2Z43A 4RQTA 3C7CB 4ZARA 4ZT6A 5FFMA 5COBA 2ONJA 3CVVA 2H1OA 1E1RD 1OFIA 2Y8EA 3D6AA 1OX6A 5K6TA 2IYWA 3BTSA 3N3BC 1CIJA 4J1NA 1G3RA 1PSDA 2PVCA 4EHAA 1UIRA 1EEXB 2C3MA 2I6FA 4I9UA 2IS4A 4LVCA 2W2KB 5DSTA 3URMA 3W2TA 5F1PA 2OCDA 1ZICA 1VGRA 2V7TA 2WJVA 3PQ8A 2ZRAA 2Y0EA 4KBGA 4EZZA 1AKQA 4QTTB 5DYYA 5LWQA 5C4MA 3WE7A 1I01A 2PKRA 3TZKA 5T8KC 5L53A 3C45A 1U0RA 3PNPA 2JI7A 3IDZA 4IY1A 4QDOA 3D3EA 1C3OB 2BGTA 1PLJA 2IOHA 2AJDA 1N2CB 3GLIA 1SG6A 3EH1A 4M21A 2D5LA 1TI7A 5FWDA 5I4CA 1Y4UA 1T8UA 2HPAA 3R09A 4RADA 3OZAA 3UN1A 1G41A 3ZCXA 5JU6A 1ZC3A 2QY9A 4RK1A 3M4JA 1KFKB 4LC1A 5L45A 3D5TA 5K8VA 3OY2A 3EJSA 1Y42X 3E0XA 1WOYA 1R74A 5IRCD 1V9LA 3LC0A 1P91A 3NXKA 4CHTA 5DI3B 3UGJA 1RRCA 5KQLA 3VKFA 1KRHA 3H7AA 3DA8A 1R5NA 9ABPA 5T8KA 1LBTA 1OYWA 4NSNA 3GLTA 3BIJA 3ER9A 2NX2A 2B4AA 2CVZA 4XM1A 3EG5A 3W8DA 5I4BA 1ADCA 1EK2A 1NKTA 3DFMA 2ZUVA 1WQ1R 3Q8MA 1JNXX 2R60A 3ESYA 3IAM6 3MXTA 1FOEB 1NBEA 2GH1A 4C3ZA 4ZYZA 4AI6A 3RUAA 3SG0A 3RLFA 2XYPA 2RK6A 3SFVA 3HR8A 2AWNA 3OZIA 1J70A 2X4IA 4NS1A 2Q4EA 2VBFA 4HN9A 4DILA 3CVYA 5DXAA 2NU7A 4FQ7A 4Z3OA 4KMRA 4RFLA 1M72A 4U00A 1O2DA 1MHPA 2B1RA 2IW3A 2P9QA 4BHTA 4HNQA 1ZJYA 1OXSC 1H5QA 1YRYE 3JQEA 3T4XA 4A3SA 1W34A 4KVGA 3R7DA 1KPHA 3QMPA 1BHSA 4OX9Y 1W5AA 4HAIA 4RELA 3TW8B 2WWWA 1GKKA 3TLZA 1QHGA 3IOYA 3GZ4A 3LA8A 3HMQA 2ZT7A 3AJAA 3HCNA 4GYJA 4N82A 1MVNA 1PG2A 2FPSA 2OGUA 2VPQA 3NRCA 3BJIC 5FBWB 4BN0A 3G79A 4E21A 3DLBA 4K6HA 4L3VA 3ICVA 2WUFA 3JD4A 3OUTA 4WRRA 3VHQA 4B5LA 1SZDA 3ONDA 2FG5A 3F5MA 3EY9A 4C78A 3I4CA 4EFMA 4XB2A 3RTCA 1XIVA 1CRZA 1GCAA 3NIGB 1KMHA 4E11A 4EECA 1Q11A 2GJSA 3GD5A 3QU4A 1WLSA 4OJTA 3PZRA 5ALGA 1IBCA 3E2MA 3HP1A 5EERA 4BU1A 3L0OA 4KOAA 4EBBA 2CHGA 4AMBA 5DXFA 3PBKA 2JJ2D 3ILYA 4G4SP 4BUZA 1O95C 3RKUA 2NUPB 2EZ9A 1RRKA 2VSQA 4V1CA 1ZWLA 4UTPA 1KZ9A 3PVZA 1Z45A 4R0NA 3K71B 3THWB 1I3KA 1JMKC 4PSDA 4QUBA 1RRGA 4KRXA 3TCKA 2IXTA 2I6QA 2HF7A 2CUNA 3GDFA 1HXKA 4KTTE 4MUHA 1AX9A 1GPMA 2I55A 3DEAA 4BQRA 1E1QD 4CIDA 1WMDA 1JHYA 4EI2A 1ACJA 1E3IA 4ND1A 1XYGA 4D2IA 2IZ1A 1K97A 3K0AA 1ZRSA 3U7EB 4Z4CA 2ZWAA 3KDSE 2GZ1A 4H7FA 4HH0A 2IEBA 3BUBA 2C88A 4BKMA 2WB4A 3PLRA 2CNBA 4TT3A 2NZUG 5FTJA 1ODKA 1EFPB 1R3DA 2ZIZA 3PV0A 2A0XA 4NEGA 3SE0A 4H17A 1YUNA 3VX4A 4BGVA 1XPRA 1E94E 1JBEA 3LHKA 4OB8A 3WWCA 3IDSA 2AVDA 3WL7A 3WGVA 4EEKA 3FCXA 3I4LA 3TTUA 5FPKA 3LH5A 4QXOA 2IODA 2FPIB 1P44A 4KQ9A 5KTPA 1ZU5A 4DA4A 4X85A 2XCRB 2JLZA 1NV9A 1YJXA 5I9LA 1UM9A 4M38A 2YC4C 1T5LA 3A9UA 3DF9A 3KR0A 1GM5A 3ZKWB 1AIPA 1ZWWA 3H2KA 3WDKA 5C51B 3K53A 3FLAA 2OL4A 1C7ZA 1JYEA 2PYIA 5B7NA 2VDRB 1ZM9A 1GNPA 2JK0A 3ANTA 4ESOA 1ATIA 3AUFA 4MA4A 2ZK7A 2ZXUA 4HWTA 3R7NA 2QEQA 2F4NA 4PPYA 4DMCA 5KNDD 2PLWA 3W6ZA 4D0GA 1Z16A 2WT4A 4B4OA 2XWSA 2VLBA 5HM6A 4RM3A 3N70A 5CB6A 1QGZA 4KG7A 1NMSA 3P4UA 4IBOA 5JSKA 4CQLB 4J1SA 1FRVA 2WZBA 1K08A 2OO3A 1MAWA 3DO5A 3EMBA 4FFDA 4D79A 4KITB 3IBSA 2PAFA 5KYGA 2ZI9A 4QYXA 3ILXA 1TYZA 1Z2EA 3GYGA 4PFSA 3DE2X 3LUKA 4DDKA 2YYZA 1THTA 3IPAA 2OSVA 4KH0A 5EVCA 4R8RA 3UFXA 1A5TA 1ORTA 1RI2A 4RKRA 3K05A 3FDFA 2JNSA 4RV4A 4D9MA 1ISJA 5K1ZA 2VEDA 3BMNA 1MIOB 4MS3A 2C7RA 1C5KA 2PKQP 2L42A 4Q03A 5AHKA 5JASA 1U99A 3U3ZA 1RZRA 4JJFA 1YU6A 3CS3A 3KUKA 4RX1A 3PNQA 4PYKA 4OXIA 1QGED 2EJUA 2W2NA 4XCXA 1YSCA 1CB0A 2Z9BA 2OGTA 2OK8A 5JDIA 1PR6A 1G59A 2IYTA 3KQPA 1QF6A 1C9JA 2VSOA 3JCZA 3P5SA 4RZIA 1SD1A 1GGVA 2EBUA 4JBGA 4D82A 2HRBA 1RS0A 2F7SA 4WE3A 5FO0A 3QPCA 3H4MA 5HZGA 1NZDA 3OPQA 4B44A 2YN4A 4LFBB 1KAQA 3EXFA 2ZQ5A 5HW0A 3CZSA 2G5GX 1D2HA 3DT9A 10MHA 3GZTB 3QX8A 1S2MA 3NKVA 4CIXA 2HOQA 4G5RA 1PEAA 3GXOA 3B5EA 4WPCA 5C7LO 3VFDA 3MILA 4BUJA 1FNSA 1C30B 2JK1A 2G77B 3FMGA 3N2NA 4CR6A 3T7EA 3CEAA 4KFUA 3S2FA 3F6YA 5F23A 4RPCA 5ERYA 4BRWA 3LRTA 2D2XA 4UMEA 2AOTB 3IDOA 3KB8A 1UK9A 1I7QB 1NU8A 4L50A 3BVVA 4PYIA 2XTMA 4OOEA 5IJ9B 4GBED 2GCOA 5CJ2A 3WZLA 3TI9A 2A0UA 2XLCA 3C3EA 3DBHA 4YIKA 2OSBA 1H6CA 1ULAA 1QHNA 3T3GA 4DPKA 4EF5A 2A9OA 3K35A 4K0KB 1A72A 1RDFA 3C4VA 3FROA 5SY9A 2C94A 3ZKAA 4CIBA 2G6BA 3U56A 2JIMA 4F3TA 4Q7QA 2XBLA 4Q7EA 4MVJH 2IDMA 1RHKA 4CEIA 5FOTA 1U0GA 4W4TA 1J0XO 3ZXIA 4AF8A 5A9RA 1Z2PX 2VCHA 3Q0IA 3TPFA 2RAPA 1ORRA 2YZMA 2IFTA 1A82A 1XEXB 2Q2VA 1HDEA 5LNK1 4LOLA 3LCJA 3VZSA 1G4AE 3OWOA 1EFLA 1F8GA 2GYYA 2J5BA 2QV7A 3L05A 1D04A 1EXWA 3I01A 3LBHA 1QC5A 1XAGA 4NQRA 3GGOA 3A6ZA 2P8SA 3STHA 4GKAA 2SICE 3K73O 4OMCA 1CY1A 2OBNA 4KQMA 4BNXA 5CD1A 4LWQA 5HK9A 4MWCA 4N5DA 3NUQA 4NG4A 4G1EB 3GP3A 3KXKA 2D3TA 1JYSA 1OXKB 1M6NA 2O3RA 4RJIA 3YASA 4S0ZA 4AG6A 4AURA 4WBNB 3IOEA 3R6TA 3QW2A 1NC1A 5ELLA 3F7TA 2XUQA 3QBEA 3JYHA 1OILA 4AULA 1FA9A 1YFKA 4EPRA 3WLNA 9LDBA 1OV4A 3QYJA 5A9SA 1N78A 1D8AA 4BIIA 1XDBA 3NTLA 5F9HA 4EBFA 4A36A 3JQRA 4FINA 1G3MA 1H42A 3VNBA 4HN2A 5LUBA 3WJ7A 3PWTA 1WP4A 4Q82A 3ZOKA 3IE2A 2X1VA 2G1PA 2F17A 3H5OA 2VPIA 2ID4A 2NT4A 4EG4A 2ZUDA 3GNSA 1SFRA 3VO9A 2B9EA 1YR7A 2AR0A 2XUAA 4MV4A 4EA6A 2X0FA 5BR7A 2QYSA 4M86A 4YXWA 1K86A 3D4NA 4JBHA 5TT0A 3HL0A 4BGIA 3EUWA 3DAOA 5GV8A 4M9CA 1GV0A 1MB2A 1RKUA 3FZNA 3H2BA 3L82B 2GHRA 4NENA 2H1RA 4Q6BA 4YJHB 1ZHFA 3WFZA 4QPNA 1J07A 1GUBA 1K7XB 1V7QA 3MT0A 4PY2A 4W5NA 2G4CA 2RHLA 3GPLA 1MO4A 5E6UB 1QYIA 1USKA 2A14A 2C61A 2H63A 3PHJA 4FE7A 3V8PA 1D2EA 5ITZA 2HGSA 1A97A 2QVZX 2XVMA 1FSPA 4MPRA 2EW8A 4MLCA 3ZE8A 3KYDA 5HJ5A 3VNRA 1EVJA 5LA6A 1S2IA 5JS1A 2VHXA 3K4QA 3QVXA 4V3CA 4ETIA 3MJSA 1QWUA 1WZNA 4HZIA 1ARZA 5ALHA 5FQNA 3LCMA 4FDAA 2HK7A 3GW8A 1NJ1A 1NQVA 3OCXA 4JC0A 2NQTA 1ST2A 5IBQA 4GUAA 2H4JA 2VJNA 4IM0A 5AHWA 4YP0A 2ADMA 4YUWA 2Z30A 1ISMA 1MFZA 1Z6PA 2AE1A 3IOBA 4X66B 3LK6A 3FPKA 3IO3A 1I4TA 3TQFA 2MT9A 4GI7A 1YC5A 4TTIA 4F3KA 1BS1A 3ED5A 3JYQA 2CUKA 4MAAA 5JRZA 4EMSA 3RRJA 4CEHB 4F3CA 3OFVA 3Q8WA 3QFHA 2QR5A 2Q49A 1WXGA 1X9GA 4LGMA 4JJ6A 2IEGA 1V37A 4BKQA 1JTEA 4FHFA 1ZRMA 3HM2A 1G5QA 2P9GA 4PE5B 4I9NA 1N57A 1U2ZA 1W5EA 4FM9A 4BTEA 2WC1A 2XQKA 4HRYA 2UZ1A 3O0DA 4MV0A 4TN1A 2YFHA 5AM4A 1QUFA 1JA1A 6YASA 3TQSA 1KDRA 4JR2A 4PBRA 2GBFA 5GGXA 4H6IA 3WA7A 3I42A 4PEVA 3C3YA 4EI7A 4GPIB 4YRZA 4GSYA 1E2HA 1F3LA 2AN4A 3OHXM 3NTRA 2OG2A 3II6X 3RF7A 1PQWA 1Z7GA 5TEVA 4GPTA 4U2DA 3S5JA 2GK7A 3DZCA 5LJLA 3HXMA 1JKIA 3BMOA 1JQJC 1EXDA 3AEKA 3T5AA 4X20A 4H59A 2XPCA 3G0IA 3R3JA 4DDWA 1ABEA 1CDEA 2I4OA 5CA1B 2YFKA 3ZDZB 2L18A 3WWEA 4QDJA 5TC4A 4C76A 2R66A 1O4VA 3L0PA 4HH4A 2AZDA 1FU4A 1Z8NA 3G59A 4JD5A 2LGJA 2R44A 4K1LA 1RJGA 2C59A 3T3MB 1RD4A 3U3XA 1F7VA 1FX0B 3TB4A 4UZFA 1F3OA 4XSGA 1VBNA 2Z1MA 4HNAA 1SU4A 4HXGA 4KV9A 4UU8A 3ZY3A 1E96A 3C6QA 5AICA 3CZQA 5GJCA 3TQTA 4H0CA 4OHWA 3WA6A 4ASUA 3BG5A 2QN3A 3K8ZA 3R3UA 3WYEA 2B5OA 3HCOA 2O8NA 1ESEA 4B5KA 1R3UA 2YHUA 3D6TB 1I9CA 3BWMA 4ZQHA 4DM4A 3AEZA 1ONBA 1PR5A 1JE1A 2X3VA 3R5FA 4PLZA 2CKDA 4DV0B 1CXZA 2QW1A 4CDRA 1UFVA 3I2KA 1OAAA 1NN3A 1AY0A 1XTBA 1KAOA 3F9CA 2X6TA 4XVHA 2AZ4A 4HTFB 4WBNF 2P0EA 1ZJJA 1ZW1A 2QQGA 1NL3A 3N2GB 3KU4A 4E1VA 5MFZA 3COJA 1T4CB 4CQNA 5EHXA 3WNCA 3C97A 5H59A 4GMFA 4UBNA 1M54A 2Q4RA 2H29A 3EK2A 3VTZA 2JLYA 4WUTA 1PNQA 1GNTA 1WUJS 3MJCA 3ND9A 4RJLA 5EN4A 1SA0B 4C6HA 1NF9A 2QTNA 2P8JA 1TC2A 3UTDA 1LCIA 1IDOA 1V9CA 4MHTA 2B7LA 2VVTA 2FEMA 3O6VA 3CW9A 2Q8QA 3ETEA 1C1DA 3Q2OA 3UAGA 1DIOB 2XJ9A 1DHTA 5T6MA 2FSHA 5IYZB 1TUIA 1DCKA 4GGMX 3GPDG 5CFRA 1H2HA 3ONWA 2VHJA 5ECDA 4EG5A 4MKIA 4EARA 2AOUA 5SZKB 1V35A 4K6KA 3F4BA 5YASA 1I7PA 2V0CA 1ECLA 2IE0A 1UXJA 2XGGA 2KWIA 4RK4A 2J85A 2VP5A 1P1CA 3ND8A 3N8HA 4HQRA 2CMGA 4ETMA 1J09A 3OMLA 1HK7A 1OU0A 2IHKA 3AB3A 1QO9A 4YTEA 3R8XA 4W82A 3ZNOA 1XRRA 4OU5A 4HQ6A 4PHTA 1OH7A 1L5HA 2NO0A 5ICFA 2FVYA 1RT9A 2W0MA 1FRFS 4DE5A 2WINM 1BHJA 3H1PA 1W85B 2HYDA 3KEMA 4D9JA 4EY8A 1W35A 1WMFA 1SXQA 2ZRBA 4HSGA 1CZLA 1Z28A 3ZHQA 4EITA 1U1EA 2DBRA 4J0IA 3VJRA 3GMSA 4DMUB 1HPLA 1V7CA 2W42A 1U00A 2XITA 2Y0CA 2X8JA 3QPDA 1PNRA 3U31A 5K99A 2WNIA 3LPDA 4TWBA 4YR9A 4CKXA 4ZC1A 3BUQA 1BXGB 1U0JA 3DOEA 2R00C 4RFSB 1H1LA 3OU6A 3PKZA 3ETDA 4ECAA 2CHFA 2P3OA 1U7WA 2AKAB 3KT3A 2Z0OA 1C4WA 4GXTA 1O95D 3PHLA 2AFHB 4LVOA 4TT3D 4FN5A 3IP9A 4QRHA 3FYTA 4ZZ3A 1XTZA 2CXHA 3ND7A 4DCSA 3NHLA 3K0HA 3NOVA 3OTOB 1C8BA 3V8RA 5FWNA 5KSZA 3EGDA 4N0QA 5BN3B 3FDIA 2ZSFA 1U9YA 3H1GA 1WP9A 2BBSA 4TXMA 3VSCA 1VIAA 4UTOA 1S4QA 2R00A 2WKPA 3EVGA 4HK4A 3IQHX 1BRMA 1WWKA 1Q2XA 1FFXA 2I2AA 1YHYA 2IF2A 3RRNA 5AFSA 3VA7A 3EBOA 1G16A 4TYNA 1Q57A 1OXUA 1YKSA 3ESQA 4DIFA 3KP1A 4BMPB 5KWSA 3ZHTA 1MH9A 1KEZA 2QPLA 2YIMA 2ZWPA 2OBXA 5G3ZA 4DDHA 3OHMA 2YJ6A 3B6ZA 2OV3A 3AVTA 3G0OA 2GHQA 4Z3KA 2D3WA 3A4MA