3ER8C

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with two fragments of rna
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 122
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er8C01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er8C03
3OWGA 3ERCC 2GAFD 3ER9B 2GA9D 3ER8C
chains in the Genus database with same CATH superfamily
9ICTA 4OAHA 3DX2A 1E2UA 1KNYA 9ICSA 2YL8A 2FMSA 5B3PA 1R33A 1NOMA 4QZ9A 4UBCA 9ICVA 2ELBA 3T4AG 5D62A 4KLOA 3CV5A 4YCXA 4YN4A 4M9LA 4JWCA 1R8BA 5BOMA 4E81A 3MDCA 4WPCA 1ZQVA 4EZQA 1ZQCA 4M0AA 9ICGA 4AZCA 5DBAA 3HWTA 3D2EA 4Z6DA 4NKTA 5HRGA 3C18A 1PX5A 4O6AA 4PH5A 2JNKA 4R63A 3MBYA 4I2HA 1TQWA 4EBJA 4AZ5A 8ICYA 3NWIA 2PY6A 2BPCA 5HC9A 7ICEA 4EEDA 5J0TA 3BVUA 2PFOA 4NM1A 4ATMA 3VKHA 1UPXA 5J0SA 2ISPA 3RJKA 9ICMA 3SYVA 3UXPA 3BLBA 3CVRA 3I39X 8ICEA 1ZQOA 2GA9D 4RQ7A 2ND0A 4RQ0A 4K8VA 7ICGA 3QNJA 1MIWA 2Z0NA 3H37A 7ICHA 2D1LA 4JNFA 4R66A 4WBYA 5CP2A 2ZH1A 2KHOA 3KDRA 4NXXA 1JQRA 5IIKA 1ZQYA 2OW6A 2DRBA 4X5VA 3KAVA 3C5FA 2ISOA 4AT9A 2X3VA 4FO1A 3OVSA 4O5KA 3C7NA 4FZSA 1UEUA 1Q78A 4XRHA 3MGIA 4DOAA 5C5BA 4RQ5A 9ICOA 3DX1A 4TUQA 4FHPA 3PMLA 4K4GA 2PBEA 1YLQA 4MFFA 4RQ4A 1ZQSA 4H6IA 4AT7B 8ICCA 3AQNA 4F00A 2EX3B 3B51X 3CZNA 3FD9A 4EBKA 5DBCA 4KM5A 2B56A 2RT6A 4AT8B 2OBLA 3DX4A 2EWRA 5J0XA 1ZQTA 4WC4A 9ICPA 2QKWA 4QZBA 4KLGA 3DDGA 3QE6A 4EZRA 3ABHA 4FH5A 5TZVA 4EZPA 2BCQA 3RH6A 3UPSA 5J2HA 3NVOA 4LZDA 3Q0KA 2OW7A 4MF2A 1JN3A 3EF2A 3H3AA 3ER9B 4M9NA 1ZQZA 3B0YA 3EJQA 2ZH4A 5DDYA 4YMOA 4IQWA 3C2LA 3EJPA 5FIGA 4AZIA 3OV7A 3HAHA 3MGHA 2O0I1 3LMFA 1TQUA 4I27A 1TVAA 4M47A 1WOTA 4PGQA 3BUPA 1DKZA 4H8SA 3BUIA 1ZWWA 2Z0OA 4IW0A 4R5LA 3V7LA 5HRLA 5DBBA 2JNSA 2YI9A 3EJTA 4RQ3A 1BPXA 2NRKA 4FZPA 2ALWA 3D51A 1I49A 4RWOA 2WYIA 3C5GA 2HN2A 4WQKA 4NXZA 4X4SA 5C5BB 1R89A 4NKUA 4WC5A 3O3MB 1GNTA 3JPNA 1QX1A 3C2MA 4DOBA 4KLUA 4UD5A 3HJ1A 3LQCB 4KB6A 4WC2A 4PO2A 4H6HA 2VANA 1ZQHA 4QZAA 4M2YA 7ICPA 4D8JA 5BPCA 2BCSA 1TV9A 4I2IA 2F18A 1ZQFA 5J2DA 2F7RA 2HN1A 4MFAA 3ISBA 4WQLA 5B3QA 4QZEA 4RT3A 4KLHA 2LXYA 3F7WA 7ICOA 5CWRA 3OHXM 1VJ7A 1ZQKA 4KIKB 3RH5A 4XA5A 3PHZA 4RQ2A 3TFSA 2PFQA 5HR9A 8ICTA 1ZQLA 1TFWA 4RWQA 2Z8YA 1W9MA 1TFYA 9ICFA 2WYHA 5J2BA 4I2FA 9ICLA 4PHPA 3O3OB 3D2FA 2F7PA 5HRBA 4EZTA 3JCFA 1BPYA 3LVTA 3OVAA 3C2KA 5CR0A 5D49A 5J0PA 4M5DA 2F7OA 1MQ2A 4EZVA 1X04A 1SU7A 2YIVX 1ZQBA 2M2WA 8ICRA 1GNLA 1R8AA 2Q13A 5CFSA 3BUDA 4UAWA 5DB8A 8ICVA 1ZYLA 4X4QA 5CB1A 3RJHA 4OAIZ 4JLXA 9ICWA 4DOCA 5J0UA 2EWFA 3RJIA 4LEVA 3L9DA 4O5EA 4K4IA 4O9MA 2F1BA 2YI8A 9ICHA 3AQLA 4YMNA 4LEZA 3ZEDA 4NXUA 3LK9A 4RWNA 2ZH3A 5JTGA 4NY8A 5HHIA 5J2FA 9ICJA 2F7QA 5DB7A 3CKDA 4UDYX 4RPZA 4MF8A 4IQVA 4UBBA 2QXLA 4RQ1A 2EFLA 2FYVA 4I2BA 4M0MA 7ICUA 5J2AA 3BVXA 4NLZA 4I2AA 2EFKA 4IWQA 4JLCA 4O68A 3WFRE 3K75D 4PHDA 4Z6FA 4FHYA 5J2JA 2ZH9A 3T48A 5HRFA 4M04A 9ICQA 1I4DA 5IIIA 4I2CA 4BNEA 4LT6A 3I04A 2M2TA 5J2KA 4I2DA 3CAZA 2GWSA 2IHOA 4I1QA 4B9QA 5DKWA 1I4TA 2DR8A 8ICNA 3T46A 4EZOA 4IWOA 4JL9A 2BCRA 4I2GA 1ZQIA 4HR1B 3OK8A 2BBJA 5J2IA 2NCZA 4EZWA 4PHAA 4S3NA 8ICSA 1Q79A 9ICXA 4MKPA 1X03A 2IUBA 3AUOA 3M3WA 1OU5A 2C08A 1JAJA 4EZSA 3UQ0A 3VEAA 4R5JA 5J0QA 7ICKA 2FMQA 4UAYA 3B0XA 1SU6A 4WH5A 8ICMA 2OO2A 3B52X 3AQKA 4PGYA 8ICLA 3DPOA 2PMRA 4E3CA 3HAIA 2M2VA 4WOYA 4QZDA 3BVWA 4UB4A 4NSWA 4OAGA 4Z6CA 4KLJA 3KAWA 1JMSA 1GN9A 3PNCA 1MIVA 1OAOA 4FH3A 4JLZA 4E7XA 3O3NB 8ICQA 4Z6EA 4TUSA 9ICRA 2DR9A 4X4VA 2OBMA 5HRDA 1UETA 7ICNA 2GF4A 1F5AA 4QZ8A 3OGUA 8ICAA 3UXNA 4LZGA 1O7DC 1MJGA 2FICA 2F1AA 3QWEA 2DRAA 4PPXA 4I28A 1ZQWA 1BPZA 4EZXA 4EZUA 4TUPA 4GXJA 3EJSA 1ZQJA 5J29A 1XSPA 4O67A 1SUFA 2ID1A 2FMPA 4JNEA 4AZHA 4NXTA 4UDXX 3AQMA 1DKXA 1ZQAA 5CHEA 4FO6A 8ICKA 2BBHA 3D50A 4P4PA 3V7KA 9ICCA 4K98A 3SOGA 4XJEA 2YIBA 3I01A 4IWPA 3OUYB 4JWEA 4X4PA 3AU6A 1HUOA 4YMMA 4P2HA 2ZXQA 4FM3A 1PS3A 4WC7A 5IIOA 3T49A 3WFPA 4F5OA 1TQTA 4M9HA 4F5RA 9ICNA 4EV6A 3EJUA 8ICIA 2O5AA 4QZIA 3L3OM 3CZSA 2RAJA 2HHPA 3ISDA 4P4MA 3GI7A 3QA8A 4JWDA 4NXWA 2DR7A 4KLSA 3UPQA 4UD4A 7ICMA 1DKYA 4R65A 5J2GA 5DDMA 1QWUA 4AZ7A 4YD2A 4PHEA 4PGXA 2DR5A 8ICUA 2BPGA 3RV1A 3RJEA 1I4LA 9ICUA 1OA0A 4FHXA 4WC6A 5FLEX 1ZQEA 4EGWA 4YD1A 4IM2A 4RT2A 2DVIA 1TQVA 4IG8A 3H38A 4AZGA 4JWMA 3BVVA 2B4VA 4XQ8A 3V72A 3WFOA 5HRKA 4GXKA 4I0UA 2Q12A 5J2CA 8ICJA 2BCVA 4G6QA 2FCLA 1ZJNA 3RJFA 4FZOA 4KLTA 2I9GA 4K4HA 2RAKA 3JPQA 4F5PA 4UB3A 4EZZA 3JPSA 4NLKA 1VFGA 4IQTA 4X4UA 3HX0A 3DX3A 5D61A 2PFPA 4KLIA 3GDXA 5F2VO 5BOLA 3OVBA 4E80A 7ICJA 2YLLA 5J0YA 3OUYA 9ICEA 4R5GA 2B51A 2WINM 1ZJMA 1XSLA 2YL6A 3DYTA 3PMNA 3EJRA 2ZHBA 1RPLA 5EOZA 1OA1A 8ICGA 1QWNA 3RV0A 1BPBA 3JPRA 4RWPA 4UB2A 2ZH8A 3UITA 2BCUA 4O5CA 9ICKA 3D4ZA 8ICXA 4F01A 1HXKA 4AT7A 5D4BA 4AVMA 2X3XA 1BPEA 4AT8A 2GAFD 3DDFA 5J0WA 3NYBA 4K97A 7ICVA 4N7RA 1E1DA 4QZFA 4I2JA 3JPPA 4EP7A 3WFSC 4RQ8A 2MI7A 3C66A 3NKUA 3BUBA 5E84A 1URUA 2Q66A 1R8CA 4HX0A 2P66A 4QZHA 4LEWA 4ATBA 4K99A 2YL5A 4OAFA 3AU2A 1MIYA 4E8FA 4X4TA 2RAIA 4AT9B 5IIJA 8ICHA 7ICSA 1HWWA 2YIAA 1ZQUA 1ZQMA 7ICTA 5CFUA 4WC1A 5KBPA 1NO5A 9ICIA 3JYYA 4QZCA 2LM0A 4KIKA 4IM3A 3L3PA 3A98A 4WBZA 3DPPA 8ICOA 5CFTA 4UB5A 4EEBA 4TURA 1ZQGA 2X5CA 4IM0A 4R5KA 4EZYA 3HJ4A 4K9AA 2RFFA 5D63A 4LEYA 5IINA 4WPEA 1UEVA 1BPDA 5DECA 4KLFA 4X4OA 5HRHA 3Q84A 1HUZA 4NM2A 2O1PA 4F5QA 1U00A 5J2EA 5IIMA 4K9BA 5IILA 5HRIA 3ERCC 1MQ3A 1SU8A 1FA0A 2BPFA 4MFCA 4KLDA 5DEDA 3JPOA 1RZTA 4M9GA 2V0OA 4X0BA 4KLQA 7ICQA 7ICRA 4X0AA 4WC0A 3BUQA 2Z0VA 3RPMA 4WCWA 4LVSA 4JWIA 2YLAA 7ICFA 4AZCB 3K7DA 3T47A 5DB9A 1ZQNA 4RQ6A 2YL9A 1Y2OA 4KLLA 4FHVA 1JQKA 2ZH6A 3V7JA 4EZNA 4NLNA 5HHHA 2OZNB 5TKYA 2D4CA 4K96A 4JN4A 1R34A 4UAZA 4FHWA 5J0OA 3RJGA 8ICBA 3RJJA 3G9GA 4HR1A 5DB6A 2M2UA 4DCNC 4KLMA 1ZQDA 3LLLA 4I2EA 7ICLA 5J0RA 8ICPA 1ZQRA 2QFFA 4X4RA 2YKTA 5CJ7A 4M9JA 4RPYA 3BVTA 1ZQPA 4XQ7A 5D46A 4AKVA 3VEBA 3HW8A 3B53X 3UQ2A 2ZH7A 7ICIA 1V4AA 1TQSA 4AZBA 3ISCA 2W9MA 3JZ0A 4JWNA 3H39A 1WDZA 3OWGA 3D52A 4O69A 8ICWA 4NQIA 1KEJA 2ZHAA 2ND1A 8ICZA 4F5NA 1E9VA 4HY9A 9ICBA 4P4OA 4HYBA 5CHGA 4R5IA 9ICAA 8ICFA 5CA7A 4KLEA 2PXIA 1ZQXA 4UB1A 1O7DB 1YWMA 3I2WA 4GXIA 3QNIA 1KDHA 4I29A 3WFQE 4ATBB 4DO9A 3HIYA 4AZ6A 2PFNA 2IHMA 2N3KA 4XUSA 3UXOA 2BE3A 2ZH5A 4NPHA 1XSNA 1HTYA 3DPQA 1GPJA 3MDAA 4QZGA 3HAJA 3RH4A 4NXVA 4RPXA 5HREA 4R64A 1ZQQA 4X4NA 3ER8C 4DYLA 1LQ7A 2X3WA 3TFRA 3MCRA 3DX0A 4IQUA 4WC3A 3ACOA 2ZH2A 1R5EA 3PLTA 3JPTA 3CK6A 3D4YA
chains in the Genus database with same CATH topology
4PO2A 4H6HA 5E84A 4OAHA 1E2UA 4JLZA 4HX0A 4D8JA 4K99A 4LEWA 3O3NB 4OAFA 5B3PA 3T4AG 2OBMA 5D62A 4WQLA 4JWCA 5B3QA 2YIAA 3F7WA 4E81A 5CFUA 1MJGA 3OHXM 4EZQA 4KIKB 2LM0A 4KIKA 4IM3A 4EZUA 3A98A 4EZXA 3D2EA 3DPPA 3PHZA 5CFTA 4O67A 2X5CA 4IM0A 4R5KA 1SUFA 4EZYA 4O6AA 4K9AA 4JNEA 5D63A 4NXTA 4LEYA 2Z8YA 1W9MA 4UDXX 1DKXA 2PY6A 5CHEA 3O3OB 3D2FA 3VKHA 1UPXA 1U00A 4EZTA 4K9BA 3I39X 3ERCC 4K98A 1SU8A 2GA9D 4XJEA 2YIBA 2ND0A 3I01A 4K8VA 4EZVA 4IWPA 4JWEA 1SU7A 2YIVX 1GNLA 3QNJA 4FM3A 5CFSA 3T49A 4JNFA 4JWIA 3K7DA 3T47A 1ZYLA 2KHOA 3L3OM 3KDRA 4NXXA 4OAIZ 4JLXA 1JQKA 3GI7A 2EWFA 3QA8A 4EZNA 3KAVA 4LEVA 4FO1A 4JWDA 4NXWA 2YI8A 5TKYA 4K96A 3C7NA 4JN4A 4LEZA 3ZEDA 4NXUA 1DKYA 4HR1A 3NKUA 3RV1A 1OA0A 4UDYX 5FLEX 2QFFA 2QXLA 4H6IA 4IM2A 4F00A 2EX3B 4M0MA 3VEBA 3B53X 3B51X 3FD9A 2B4VA 2B56A 4KM5A 2RT6A 4IWQA 2OBLA 4JLCA 4O68A 2EWRA 3OWGA 4O69A 4G6QA 3T48A 2FCLA 2ND1A 4EZRA 1E9VA 4HY9A 4EZPA 4HYBA 3I04A 4EZZA 4R5IA 3EF2A 2IHOA 3ER9B 4B9QA 5D61A 3T46A 4EZOA 4IWOA 4JL9A 4R5GA 2WINM 5FIGA 2B51A 4HR1B 3LMFA 2NCZA 4EZWA 1OA1A 4MKPA 3RV0A 2N3KA 1DKZA 4R5LA 4IW0A 3UITA 4NPHA 2JNSA 2YI9A 4EZSA 3DPQA 3VEAA 4F01A 1GPJA 4R5JA 2GAFD 1SU6A 4NXVA 4WH5A 4K97A 3B52X 3ER8C 4WQKA 3DPOA 4N7RA 4E3CA 1E1DA 3MCRA 4WOYA 4OAGA 3O3MB 1GNTA 3KAWA 1GN9A 4KB6A 1OAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWG A;  3ERC C;  2GAF D;  3ER9 B;  2GA9 D;  3ER8 C; 
#chains in the Genus database with same CATH topology
 9ICT A;  4OAH A;  3DX2 A;  1E2U A;  1KNY A;  9ICS A;  2YL8 A;  2FMS A;  5B3P A;  1R33 A;  1NOM A;  4QZ9 A;  4UBC A;  9ICV A;  2ELB A;  3T4A G;  5D62 A;  4KLO A;  3CV5 A;  4YCX A;  4YN4 A;  4M9L A;  4JWC A;  1R8B A;  5BOM A;  4E81 A;  3MDC A;  4WPC A;  1ZQV A;  4EZQ A;  1ZQC A;  4M0A A;  9ICG A;  4AZC A;  5DBA A;  3HWT A;  3D2E A;  4Z6D A;  4NKT A;  5HRG A;  3C18 A;  1PX5 A;  4O6A A;  4PH5 A;  2JNK A;  4R63 A;  3MBY A;  4I2H A;  1TQW A;  4EBJ A;  4AZ5 A;  8ICY A;  3NWI A;  2PY6 A;  2BPC A;  5HC9 A;  7ICE A;  4EED A;  5J0T A;  3BVU A;  2PFO A;  4NM1 A;  4ATM A;  3VKH A;  1UPX A;  5J0S A;  2ISP A;  3RJK A;  9ICM A;  3SYV A;  3UXP A;  3BLB A;  3CVR A;  3I39 X;  8ICE A;  1ZQO A;  2GA9 D;  4RQ7 A;  2ND0 A;  4RQ0 A;  4K8V A;  7ICG A;  3QNJ A;  1MIW A;  2Z0N A;  3H37 A;  7ICH A;  2D1L A;  4JNF A;  4R66 A;  4WBY A;  5CP2 A;  2ZH1 A;  2KHO A;  3KDR A;  4NXX A;  1JQR A;  5IIK A;  1ZQY A;  2OW6 A;  2DRB A;  4X5V A;  3KAV A;  3C5F A;  2ISO A;  4AT9 A;  2X3V A;  4FO1 A;  3OVS A;  4O5K A;  3C7N A;  4FZS A;  1UEU A;  1Q78 A;  4XRH A;  3MGI A;  4DOA A;  5C5B A;  4RQ5 A;  9ICO A;  3DX1 A;  4TUQ A;  4FHP A;  3PML A;  4K4G A;  2PBE A;  1YLQ A;  4MFF A;  4RQ4 A;  1ZQS A;  4H6I A;  4AT7 B;  8ICC A;  3AQN A;  4F00 A;  2EX3 B;  3B51 X;  3CZN A;  3FD9 A;  4EBK A;  5DBC A;  4KM5 A;  2B56 A;  2RT6 A;  4AT8 B;  2OBL A;  3DX4 A;  2EWR A;  5J0X A;  1ZQT A;  4WC4 A;  9ICP A;  2QKW A;  4QZB A;  4KLG A;  3DDG A;  3QE6 A;  4EZR A;  3ABH A;  4FH5 A;  5TZV A;  4EZP A;  2BCQ A;  3RH6 A;  3UPS A;  5J2H A;  3NVO A;  4LZD A;  3Q0K A;  2OW7 A;  4MF2 A;  1JN3 A;  3EF2 A;  3H3A A;  3ER9 B;  4M9N A;  1ZQZ A;  3B0Y A;  3EJQ A;  2ZH4 A;  5DDY A;  4YMO A;  4IQW A;  3C2L A;  3EJP A;  5FIG A;  4AZI A;  3OV7 A;  3HAH A;  3MGH A;  2O0I 1;  3LMF A;  1TQU A;  4I27 A;  1TVA A;  4M47 A;  1WOT A;  4PGQ A;  3BUP A;  1DKZ A;  4H8S A;  3BUI A;  1ZWW A;  2Z0O A;  4IW0 A;  4R5L A;  3V7L A;  5HRL A;  5DBB A;  2JNS A;  2YI9 A;  3EJT A;  4RQ3 A;  1BPX A;  2NRK A;  4FZP A;  2ALW A;  3D51 A;  1I49 A;  4RWO A;  2WYI A;  3C5G A;  2HN2 A;  4WQK A;  4NXZ A;  4X4S A;  5C5B B;  1R89 A;  4NKU A;  4WC5 A;  3O3M B;  1GNT A;  3JPN A;  1QX1 A;  3C2M A;  4DOB A;  4KLU A;  4UD5 A;  3HJ1 A;  3LQC B;  4KB6 A;  4WC2 A;  4PO2 A;  4H6H A;  2VAN A;  1ZQH A;  4QZA A;  4M2Y A;  7ICP A;  4D8J A;  5BPC A;  2BCS A;  1TV9 A;  4I2I A;  2F18 A;  1ZQF A;  5J2D A;  2F7R A;  2HN1 A;  4MFA A;  3ISB A;  4WQL A;  5B3Q A;  4QZE A;  4RT3 A;  4KLH A;  2LXY A;  3F7W A;  7ICO A;  5CWR A;  3OHX M;  1VJ7 A;  1ZQK A;  4KIK B;  3RH5 A;  4XA5 A;  3PHZ A;  4RQ2 A;  3TFS A;  2PFQ A;  5HR9 A;  8ICT A;  1ZQL A;  1TFW A;  4RWQ A;  2Z8Y A;  1W9M A;  1TFY A;  9ICF A;  2WYH A;  5J2B A;  4I2F A;  9ICL A;  4PHP A;  3O3O B;  3D2F A;  2F7P A;  5HRB A;  4EZT A;  3JCF A;  1BPY A;  3LVT A;  3OVA A;  3C2K A;  5CR0 A;  5D49 A;  5J0P A;  4M5D A;  2F7O A;  1MQ2 A;  4EZV A;  1X04 A;  1SU7 A;  2YIV X;  1ZQB A;  2M2W A;  8ICR A;  1GNL A;  1R8A A;  2Q13 A;  5CFS A;  3BUD A;  4UAW A;  5DB8 A;  8ICV A;  1ZYL A;  4X4Q A;  5CB1 A;  3RJH A;  4OAI Z;  4JLX A;  9ICW A;  4DOC A;  5J0U A;  2EWF A;  3RJI A;  4LEV A;  3L9D A;  4O5E A;  4K4I A;  4O9M A;  2F1B A;  2YI8 A;  9ICH A;  3AQL A;  4YMN A;  4LEZ A;  3ZED A;  4NXU A;  3LK9 A;  4RWN A;  2ZH3 A;  5JTG A;  4NY8 A;  5HHI A;  5J2F A;  9ICJ A;  2F7Q A;  5DB7 A;  3CKD A;  4UDY X;  4RPZ A;  4MF8 A;  4IQV A;  4UBB A;  2QXL A;  4RQ1 A;  2EFL A;  2FYV A;  4I2B A;  4M0M A;  7ICU A;  5J2A A;  3BVX A;  4NLZ A;  4I2A A;  2EFK A;  4IWQ A;  4JLC A;  4O68 A;  3WFR E;  3K75 D;  4PHD A;  4Z6F A;  4FHY A;  5J2J A;  2ZH9 A;  3T48 A;  5HRF A;  4M04 A;  9ICQ A;  1I4D A;  5III A;  4I2C A;  4BNE A;  4LT6 A;  3I04 A;  2M2T A;  5J2K A;  4I2D A;  3CAZ A;  2GWS A;  2IHO A;  4I1Q A;  4B9Q A;  5DKW A;  1I4T A;  2DR8 A;  8ICN A;  3T46 A;  4EZO A;  4IWO A;  4JL9 A;  2BCR A;  4I2G A;  1ZQI A;  4HR1 B;  3OK8 A;  2BBJ A;  5J2I A;  2NCZ A;  4EZW A;  4PHA A;  4S3N A;  8ICS A;  1Q79 A;  9ICX A;  4MKP A;  1X03 A;  2IUB A;  3AUO A;  3M3W A;  1OU5 A;  2C08 A;  1JAJ A;  4EZS A;  3UQ0 A;  3VEA A;  4R5J A;  5J0Q A;  7ICK A;  2FMQ A;  4UAY A;  3B0X A;  1SU6 A;  4WH5 A;  8ICM A;  2OO2 A;  3B52 X;  3AQK A;  4PGY A;  8ICL A;  3DPO A;  2PMR A;  4E3C A;  3HAI A;  2M2V A;  4WOY A;  4QZD A;  3BVW A;  4UB4 A;  4NSW A;  4OAG A;  4Z6C A;  4KLJ A;  3KAW A;  1JMS A;  1GN9 A;  3PNC A;  1MIV A;  1OAO A;  4FH3 A;  4JLZ A;  4E7X A;  3O3N B;  8ICQ A;  4Z6E A;  4TUS A;  9ICR A;  2DR9 A;  4X4V A;  2OBM A;  5HRD A;  1UET A;  7ICN A;  2GF4 A;  1F5A A;  4QZ8 A;  3OGU A;  8ICA A;  3UXN A;  4LZG A;  1O7D C;  1MJG A;  2FIC A;  2F1A A;  3QWE A;  2DRA A;  4PPX A;  4I28 A;  1ZQW A;  1BPZ A;  4EZX A;  4EZU A;  4TUP A;  4GXJ A;  3EJS A;  1ZQJ A;  5J29 A;  1XSP A;  4O67 A;  1SUF A;  2ID1 A;  2FMP A;  4JNE A;  4AZH A;  4NXT A;  4UDX X;  3AQM A;  1DKX A;  1ZQA A;  5CHE A;  4FO6 A;  8ICK A;  2BBH A;  3D50 A;  4P4P A;  3V7K A;  9ICC A;  4K98 A;  3SOG A;  4XJE A;  2YIB A;  3I01 A;  4IWP A;  3OUY B;  4JWE A;  4X4P A;  3AU6 A;  1HUO A;  4YMM A;  4P2H A;  2ZXQ A;  4FM3 A;  1PS3 A;  4WC7 A;  5IIO A;  3T49 A;  3WFP A;  4F5O A;  1TQT A;  4M9H A;  4F5R A;  9ICN A;  4EV6 A;  3EJU A;  8ICI A;  2O5A A;  4QZI A;  3L3O M;  3CZS A;  2RAJ A;  2HHP A;  3ISD A;  4P4M A;  3GI7 A;  3QA8 A;  4JWD A;  4NXW A;  2DR7 A;  4KLS A;  3UPQ A;  4UD4 A;  7ICM A;  1DKY A;  4R65 A;  5J2G A;  5DDM A;  1QWU A;  4AZ7 A;  4YD2 A;  4PHE A;  4PGX A;  2DR5 A;  8ICU A;  2BPG A;  3RV1 A;  3RJE A;  1I4L A;  9ICU A;  1OA0 A;  4FHX A;  4WC6 A;  5FLE X;  1ZQE A;  4EGW A;  4YD1 A;  4IM2 A;  4RT2 A;  2DVI A;  1TQV A;  4IG8 A;  3H38 A;  4AZG A;  4JWM A;  3BVV A;  2B4V A;  4XQ8 A;  3V72 A;  3WFO A;  5HRK A;  4GXK A;  4I0U A;  2Q12 A;  5J2C A;  8ICJ A;  2BCV A;  4G6Q A;  2FCL A;  1ZJN A;  3RJF A;  4FZO A;  4KLT A;  2I9G A;  4K4H A;  2RAK A;  3JPQ A;  4F5P A;  4UB3 A;  4EZZ A;  3JPS A;  4NLK A;  1VFG A;  4IQT A;  4X4U A;  3HX0 A;  3DX3 A;  5D61 A;  2PFP A;  4KLI A;  3GDX A;  5F2V O;  5BOL A;  3OVB A;  4E80 A;  7ICJ A;  2YLL A;  5J0Y A;  3OUY A;  9ICE A;  4R5G A;  2B51 A;  2WIN M;  1ZJM A;  1XSL A;  2YL6 A;  3DYT A;  3PMN A;  3EJR A;  2ZHB A;  1RPL A;  5EOZ A;  1OA1 A;  8ICG A;  1QWN A;  3RV0 A;  1BPB A;  3JPR A;  4RWP A;  4UB2 A;  2ZH8 A;  3UIT A;  2BCU A;  4O5C A;  9ICK A;  3D4Z A;  8ICX A;  4F01 A;  1HXK A;  4AT7 A;  5D4B A;  4AVM A;  2X3X A;  1BPE A;  4AT8 A;  2GAF D;  3DDF A;  5J0W A;  3NYB A;  4K97 A;  7ICV A;  4N7R A;  1E1D A;  4QZF A;  4I2J A;  3JPP A;  4EP7 A;  3WFS C;  4RQ8 A;  2MI7 A;  3C66 A;  3NKU A;  3BUB A;  5E84 A;  1URU A;  2Q66 A;  1R8C A;  4HX0 A;  2P66 A;  4QZH A;  4LEW A;  4ATB A;  4K99 A;  2YL5 A;  4OAF A;  3AU2 A;  1MIY A;  4E8F A;  4X4T A;  2RAI A;  4AT9 B;  5IIJ A;  8ICH A;  7ICS A;  1HWW A;  2YIA A;  1ZQU A;  1ZQM A;  7ICT A;  5CFU A;  4WC1 A;  5KBP A;  1NO5 A;  9ICI A;  3JYY A;  4QZC A;  2LM0 A;  4KIK A;  4IM3 A;  3L3P A;  3A98 A;  4WBZ A;  3DPP A;  8ICO A;  5CFT A;  4UB5 A;  4EEB A;  4TUR A;  1ZQG A;  2X5C A;  4IM0 A;  4R5K A;  4EZY A;  3HJ4 A;  4K9A A;  2RFF A;  5D63 A;  4LEY A;  5IIN A;  4WPE A;  1UEV A;  1BPD A;  5DEC A;  4KLF A;  4X4O A;  5HRH A;  3Q84 A;  1HUZ A;  4NM2 A;  2O1P A;  4F5Q A;  1U00 A;  5J2E A;  5IIM A;  4K9B A;  5IIL A;  5HRI A;  3ERC C;  1MQ3 A;  1SU8 A;  1FA0 A;  2BPF A;  4MFC A;  4KLD A;  5DED A;  3JPO A;  1RZT A;  4M9G A;  2V0O A;  4X0B A;  4KLQ A;  7ICQ A;  7ICR A;  4X0A A;  4WC0 A;  3BUQ A;  2Z0V A;  3RPM A;  4WCW A;  4LVS A;  4JWI A;  2YLA A;  7ICF A;  4AZC B;  3K7D A;  3T47 A;  5DB9 A;  1ZQN A;  4RQ6 A;  2YL9 A;  1Y2O A;  4KLL A;  4FHV A;  1JQK A;  2ZH6 A;  3V7J A;  4EZN A;  4NLN A;  5HHH A;  2OZN B;  5TKY A;  2D4C A;  4K96 A;  4JN4 A;  1R34 A;  4UAZ A;  4FHW A;  5J0O A;  3RJG A;  8ICB A;  3RJJ A;  3G9G A;  4HR1 A;  5DB6 A;  2M2U A;  4DCN C;  4KLM A;  1ZQD A;  3LLL A;  4I2E A;  7ICL A;  5J0R A;  8ICP A;  1ZQR A;  2QFF A;  4X4R A;  2YKT A;  5CJ7 A;  4M9J A;  4RPY A;  3BVT A;  1ZQP A;  4XQ7 A;  5D46 A;  4AKV A;  3VEB A;  3HW8 A;  3B53 X;  3UQ2 A;  2ZH7 A;  7ICI A;  1V4A A;  1TQS A;  4AZB A;  3ISC A;  2W9M A;  3JZ0 A;  4JWN A;  3H39 A;  1WDZ A;  3OWG A;  3D52 A;  4O69 A;  8ICW A;  4NQI A;  1KEJ A;  2ZHA A;  2ND1 A;  8ICZ A;  4F5N A;  1E9V A;  4HY9 A;  9ICB A;  4P4O A;  4HYB A;  5CHG A;  4R5I A;  9ICA A;  8ICF A;  5CA7 A;  4KLE A;  2PXI A;  1ZQX A;  4UB1 A;  1O7D B;  1YWM A;  3I2W A;  4GXI A;  3QNI A;  1KDH A;  4I29 A;  3WFQ E;  4ATB B;  4DO9 A;  3HIY A;  4AZ6 A;  2PFN A;  2IHM A;  2N3K A;  4XUS A;  3UXO A;  2BE3 A;  2ZH5 A;  4NPH A;  1XSN A;  1HTY A;  3DPQ A;  1GPJ A;  3MDA A;  4QZG A;  3HAJ A;  3RH4 A;  4NXV A;  4RPX A;  5HRE A;  4R64 A;  1ZQQ A;  4X4N A;  3ER8 C;  4DYL A;  1LQ7 A;  2X3W A;  3TFR A;  3MCR A;  3DX0 A;  4IQU A;  4WC3 A;  3ACO A;  2ZH2 A;  1R5E A;  3PLT A;  3JPT A;  3CK6 A;  3D4Y A; 
#chains in the Genus database with same CATH homology
 4PO2 A;  4H6H A;  5E84 A;  4OAH A;  1E2U A;  4JLZ A;  4HX0 A;  4D8J A;  4K99 A;  4LEW A;  3O3N B;  4OAF A;  5B3P A;  3T4A G;  2OBM A;  5D62 A;  4WQL A;  4JWC A;  5B3Q A;  2YIA A;  3F7W A;  4E81 A;  5CFU A;  1MJG A;  3OHX M;  4EZQ A;  4KIK B;  2LM0 A;  4KIK A;  4IM3 A;  4EZU A;  3A98 A;  4EZX A;  3D2E A;  3DPP A;  3PHZ A;  5CFT A;  4O67 A;  2X5C A;  4IM0 A;  4R5K A;  1SUF A;  4EZY A;  4O6A A;  4K9A A;  4JNE A;  5D63 A;  4NXT A;  4LEY A;  2Z8Y A;  1W9M A;  4UDX X;  1DKX A;  2PY6 A;  5CHE A;  3O3O B;  3D2F A;  3VKH A;  1UPX A;  1U00 A;  4EZT A;  4K9B A;  3I39 X;  3ERC C;  4K98 A;  1SU8 A;  2GA9 D;  4XJE A;  2YIB A;  2ND0 A;  3I01 A;  4K8V A;  4EZV A;  4IWP A;  4JWE A;  1SU7 A;  2YIV X;  1GNL A;  3QNJ A;  4FM3 A;  5CFS A;  3T49 A;  4JNF A;  4JWI A;  3K7D A;  3T47 A;  1ZYL A;  2KHO A;  3L3O M;  3KDR A;  4NXX A;  4OAI Z;  4JLX A;  1JQK A;  3GI7 A;  2EWF A;  3QA8 A;  4EZN A;  3KAV A;  4LEV A;  4FO1 A;  4JWD A;  4NXW A;  2YI8 A;  5TKY A;  4K96 A;  3C7N A;  4JN4 A;  4LEZ A;  3ZED A;  4NXU A;  1DKY A;  4HR1 A;  3NKU A;  3RV1 A;  1OA0 A;  4UDY X;  5FLE X;  2QFF A;  2QXL A;  4H6I A;  4IM2 A;  4F00 A;  2EX3 B;  4M0M A;  3VEB A;  3B53 X;  3B51 X;  3FD9 A;  2B4V A;  2B56 A;  4KM5 A;  2RT6 A;  4IWQ A;  2OBL A;  4JLC A;  4O68 A;  2EWR A;  3OWG A;  4O69 A;  4G6Q A;  3T48 A;  2FCL A;  2ND1 A;  4EZR A;  1E9V A;  4HY9 A;  4EZP A;  4HYB A;  3I04 A;  4EZZ A;  4R5I A;  3EF2 A;  2IHO A;  3ER9 B;  4B9Q A;  5D61 A;  3T46 A;  4EZO A;  4IWO A;  4JL9 A;  4R5G A;  2WIN M;  5FIG A;  2B51 A;  4HR1 B;  3LMF A;  2NCZ A;  4EZW A;  1OA1 A;  4MKP A;  3RV0 A;  2N3K A;  1DKZ A;  4R5L A;  4IW0 A;  3UIT A;  4NPH A;  2JNS A;  2YI9 A;  4EZS A;  3DPQ A;  3VEA A;  4F01 A;  1GPJ A;  4R5J A;  2GAF D;  1SU6 A;  4NXV A;  4WH5 A;  4K97 A;  3B52 X;  3ER8 C;  4WQK A;  3DPO A;  4N7R A;  4E3C A;  1E1D A;  3MCR A;  4WOY A;  4OAG A;  3O3M B;  1GNT A;  3KAW A;  1GN9 A;  4KB6 A;  1OAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...