3ER8C

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with two fragments of rna
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 122
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er8C01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er8C03
3OWGA 2GAFD 3ER8C 3ER9B 3ERCC 2GA9D
chains in the Genus database with same CATH superfamily
1R34A 2OW6A 9ICNA 2VANA 4KLUA 4M47A 4JNFA 5J0TA 5J2CA 1JMSA 2YI8A 4YMOA 3AQNA 4P2HA 4EGWA 3O3MB 4HR1B 4F00A 4E7XA 7ICGA 2F18A 2O0I1 1X03A 4I28A 1ZQNA 4R66A 8ICIA 4M04A 5CR0A 9ICGA 5E84A 2WYHA 5JTGA 3AQLA 4RQ4A 5F2VO 2PXIA 2DR8A 4UD5A 3PHZA 4NXTA 4NM2A 8ICUA 5HC9A 4ATMA 4X4UA 3WFPA 5HRGA 3CZNA 4K8VA 4UAYA 3I39X 4IM0A 3C18A 4FHVA 3PMLA 4WC4A 1ZQJA 4LEZA 3EJUA 7ICNA 5D63A 3RJIA 2ISOA 1GN9A 2YI9A 9ICEA 2F7OA 4O5EA 2OZNB 3I04A 4HR1A 4QZHA 1ZQBA 4I0UA 4I2BA 7ICSA 4AT8A 7ICJA 9ICJA 2YL8A 4NXVA 5BOLA 4IWPA 3B0XA 1HUOA 1ZQLA 4E3CA 4WCWA 3V72A 1KNYA 1ZQWA 5J0YA 4RWQA 3H39A 4UDXX 4RWOA 9ICUA 4OAFA 5J2AA 3I01A 8ICTA 9ICVA 4UD4A 4DOCA 2BBHA 3BVXA 2BPCA 3DX3A 4OAIZ 2PMRA 3ACOA 3B52X 3EF2A 2N3KA 7ICTA 1PS3A 2DR7A 5CA7A 4EBKA 4X4VA 4NQIA 9ICIA 4H6IA 3MCRA 5J2JA 4DOBA 4NXXA 3F7WA 3T48A 3ISBA 3UPQA 4LEWA 1HTYA 1MIYA 5J2EA 4X0AA 3AQKA 2YL6A 4JWEA 4YMNA 4XUSA 4WPCA 4S3NA 2V0OA 3NKUA 4EZYA 4RT3A 2DRAA 1GPJA 4WQKA 3AQMA 3BVTA 4JN4A 4WQLA 4X4SA 2Z0NA 7ICLA 3MGHA 4AZIA 4X4QA 3BUPA 1O7DB 3D52A 4TUPA 1VFGA 4JL9A 4O5CA 4KIKA 1F5AA 3B53X 4Z6DA 7ICVA 4F5PA 4DO9A 3QWEA 5FLEX 1BPXA 4UBCA 3RJHA 4WC7A 3L3PA 4QZFA 3D51A 1ZQHA 5CP2A 3ERCC 4WC5A 1SU8A 5J2DA 3B0YA 4I2AA 3UQ0A 2M2TA 1FA0A 3VKHA 5KBPA 4XQ8A 3MBYA 3CV5A 3EJQA 2D1LA 5CB1A 3JPNA 4X0BA 4EZOA 2W9MA 3DYTA 3OWGA 4HX0A 4K4GA 4N7RA 3HIYA 8ICVA 3NVOA 4FHYA 2Q12A 4UAZA 3JCFA 3O3OB 4M9NA 8ICBA 4NXUA 2NCZA 1RZTA 3JPOA 5D4BA 3H37A 8ICMA 3TFSA 4MFCA 1ZQQA 2ZH8A 3UXPA 3NWIA 8ICYA 1OA1A 5C5BB 1DKXA 3K75D 4F5OA 4R5JA 4ATBB 9ICBA 4HY9A 4QZIA 1WDZA 2OBMA 2ZH7A 3JPPA 4EZTA 4D8JA 3RH4A 1WOTA 4QZ8A 4K4IA 8ICSA 4PHDA 2OBLA 4O68A 3DX1A 5TZVA 3Q0KA 2BCRA 1I4TA 4F5RA 3MGIA 4WC1A 4LEYA 5HREA 4NLKA 1ZQYA 2BE3A 2YL5A 4NPHA 1BPZA 4UB2A 9ICOA 4O67A 4R5GA 3EJSA 5J2HA 5DB8A 2F1AA 5J0QA 3V7KA 4QZAA 4JWDA 3RPMA 4OAGA 4JNEA 3BVWA 1JQKA 2QFFA 3ER9B 2BCUA 4QZDA 1O7DC 2ZH2A 8ICWA 4KLFA 4FZPA 1NO5A 4LZDA 5IIMA 2GWSA 4LVSA 4PHEA 4UDYX 4HYBA 3VEAA 9ICCA 4PH5A 4PGXA 4F5QA 3JZ0A 4Z6EA 3AUOA 1UPXA 4KIKB 1R5EA 2JNSA 5CJ7A 1ZJNA 3UITA 3OGUA 5CFUA 4YN4A 7ICKA 4JWIA 4I2HA 1BPEA 4YD1A 1RPLA 3HWTA 4PGQA 4R64A 4MFAA 2BCQA 1ZQIA 3BUBA 3KDRA 3MDAA 2BCVA 4TUQA 2BCSA 4X4RA 5J0SA 1I4DA 1Q78A 3EJTA 3HAIA 4I1QA 3BVVA 5DECA 9ICKA 4WC3A 1ZQRA 2Q66A 8ICZA 8ICPA 4WPEA 2ELBA 2HN2A 2ID1A 3CZSA 3WFOA 4I2CA 4PPXA 3RH5A 3BLBA 4RQ2A 3UXNA 4K9BA 3D4ZA 2FICA 3DX0A 1ZQTA 4RQ1A 3RJGA 1URUA 4AZ5A 4AZCA 4RPXA 4I2FA 9ICPA 2FCLA 5D46A 1E1DA 3HW8A 2BPFA 4XQ7A 5HRKA 1R89A 3ISCA 7ICPA 3BUQA 4YCXA 4M9HA 3DPPA 1ZQXA 4EZWA 2HN1A 4UBBA 3GI7A 1XSPA 3OVBA 2YLAA 4IQWA 8ICGA 4X4PA 4WH5A 7ICHA 4M9LA 7ICIA 2M2WA 4MF2A 4IQUA 2KHOA 3C5GA 3D4YA 4PO2A 4ATBA 2Q13A 4K96A 5IIJA 2ZH4A 1TQVA 4AZCB 5D62A 1DKYA 1QWUA 4NKTA 4EZSA 2FMSA 4NXWA 1GNTA 2O5AA 4RQ0A 2OW7A 3HAHA 4YMMA 2F7RA 2D4CA 4R65A 2X3WA 4EZVA 4PGYA 2PFOA 1YLQA 1R8BA 3D2FA 4YD2A 4K97A 4QZCA 1QX1A 2M2VA 9ICFA 4I2GA 5CFSA 2MI7A 1HXKA 4K9AA 4LZGA 3K7DA 5J0RA 8ICXA 5J29A 1TQTA 3DX4A 1TV9A 4O5KA 4IM2A 3LQCB 5J2KA 1R8AA 2RAKA 3JPQA 1BPYA 4NM1A 1DKZA 4EEBA 3VEBA 1ZQEA 1TQSA 4KLQA 2C08A 4GXJA 4BNEA 3LVTA 3OHXM 4RQ8A 1OA0A 3UXOA 3CKDA 1U00A 1W9MA 2GA9D 4IWOA 5DB6A 1ZQVA 2RAIA 4JWCA 4AZBA 4RQ7A 4K99A 1GNLA 5HRIA 4M2YA 2FMQA 4FZOA 3OUYA 4PHPA 4IQTA 2YKTA 4I2DA 4B9QA 5D49A 3G9GA 4NLZA 5J2IA 4M9GA 4M0MA 5C5BA 3JPSA 4JLCA 3QNIA 4R63A 4RPYA 1QWNA 4TURA 3C5FA 1HUZA 4QZGA 2ND1A 2ISPA 2DR5A 5DB7A 3LK9A 1KEJA 3O3NB 4KB6A 3UPSA 4R5KA 2ALWA 4AZ6A 4H6HA 1UETA 5CWRA 3T46A 4UB1A 5J0XA 4P4MA 2HHPA 8ICLA 3EJPA 1X04A 4FH3A 3CAZA 4E80A 1ZQFA 4R5IA 5IIKA 5HRHA 4AT7A 3HX0A 4RWPA 4KLLA 3RJEA 1I49A 1SU7A 4FHWA 5D61A 1ZQKA 8ICAA 5BOMA 5IINA 4F01A 4NSWA 2F1BA 4FH5A 3V7LA 4FHXA 3JYYA 4WC6A 3M3WA 7ICOA 1V4AA 1TVAA 3BVUA 4WBZA 5B3PA 3D2EA 4OAHA 2IHMA 2NRKA 3HJ1A 3WFRE 1TFYA 3DDGA 1JQRA 4IW0A 2EFKA 3V7JA 2B51A 4RPZA 2EWRA 4QZ9A 4I29A 1HWWA 2LM0A 3DX2A 1TQWA 4QZEA 8ICQA 2YL9A 2PBEA 1I4LA 4Z6CA 4EBJA 4AZHA 1ZQZA 4RQ3A 9ICQA 4IWQA 3PMNA 1ZYLA 4PHAA 5DBAA 2PFNA 1OU5A 3T4AG 3KAVA 2BBJA 3PNCA 4F5NA 4M9JA 9ICLA 2P66A 4EZNA 4P4OA 8ICOA 4QZBA 4UAWA 2YIBA 4WOYA 3RJKA 2YIAA 4NLNA 4I2EA 2FMPA 2YIVX 5HHIA 1MQ2A 4EV6A 4DOAA 2B4VA 4Z6FA 5J0WA 8ICNA 5FIGA 3DPQA 3C2LA 5DBCA 5BPCA 9ICXA 1MJGA 5IIOA 4IM3A 4GXIA 1MQ3A 3C2MA 4M0AA 4O9MA 4K98A 2RT6A 5J0UA 5DDMA 3OVSA 3DPOA 4AT9B 3I2WA 8ICCA 4X4OA 1JAJA 5CFTA 3T47A 1YWMA 1ZQPA 4KLGA 9ICSA 4R5LA 5CHGA 3A98A 3H38A 2WINM 4WC0A 4XRHA 5DBBA 2EFLA 4FO6A 4EZZA 5J2FA 4KLHA 5DEDA 3AU2A 1R33A 2DR9A 3ISDA 4KLMA 5DB9A 3JPRA 1BPBA 8ICFA 4JLZA 5HRFA 5EOZA 3RV0A 2X5CA 1ZWWA 9ICWA 3PLTA 4EZUA 4UB4A 4JLXA 3OV7A 4E81A 4XA5A 4KLJA 7ICFA 4WBYA 3L3OM 3QNJA 3QA8A 8ICKA 1E2UA 4RQ5A 4JWNA 3ABHA 4IQVA 1ZQSA 2ZHBA 4AKVA 4RT2A 2X3XA 1JN3A 1NOMA 3L9DA 4XJEA 3MDCA 4I27A 3C2KA 4LT6A 5J2GA 2ZH9A 3C7NA 4EZQA 3BUIA 4AT7B 4KM5A 2Z0VA 2F7QA 3RH6A 4O6AA 5HRLA 2ZH5A 4X5VA 4H8SA 4AZ7A 3H3AA 2PFQA 1SU6A 9ICAA 3RJFA 1Q79A 3NYBA 2ZXQA 3RJJA 5B3QA 3HJ4A 4MKPA 4AZGA 4DYLA 4LEVA 5HRBA 1R8CA 4RWNA 3FD9A 5HRDA 4EZPA 7ICUA 4K4HA 1VJ7A 3JPTA 4KLEA 9ICMA 4KLDA 3UQ2A 2ZH1A 8ICHA 2DVIA 2EX3B 1ZQAA 1ZJMA 3QE6A 4NY8A 1TQUA 2JNKA 5HR9A 3KAWA 1ZQMA 3Q84A 2Z8YA 3OK8A 3TFRA 1XSNA 5J0OA 2GF4A 9ICTA 9ICRA 3BUDA 4AT8B 5J0PA 3OVAA 4KLTA 1E9VA 4KLSA 4AVMA 3CVRA 5CHEA 3OUYB 2M2UA 4FO1A 4IG8A 4I2JA 8ICEA 2WYIA 3HAJA 2PY6A 4FM3A 4NXZA 2ND0A 4MF8A 1ZQOA 3RV1A 4MFFA 3B51X 1TFWA 7ICRA 2EWFA 1UEVA 4EP7A 3LMFA 4AT9A 4I2IA 4O69A 4P4PA 5IIIA 4RQ6A 8ICRA 4TUSA 1KDHA 3SYVA 4M5DA 4GXKA 3DDFA 4UB5A 3GDXA 9ICHA 4X4TA 3SOGA 2RFFA 3EJRA 4KLOA 2BPGA 4JWMA 1PX5A 2B56A 1ZQGA 2FYVA 3CK6A 2DRBA 2OO2A 2YLLA 5J2BA 3ZEDA 3C66A 4G6QA 4UB3A 2ZH6A 4KLIA 2IHOA 4EZXA 1MIVA 2O1PA 5DDYA 1BPDA 2GAFD 4EEDA 2I9GA 4FHPA 2ZH3A 7ICEA 1XSLA 3D50A 2F7PA 1LQ7A 2QKWA 2QXLA 5HHHA 2LXYA 2PFPA 3LLLA 3ER8C 1ZQCA 2X3VA 2RAJA 5TKYA 3AU6A 3WFSC 2Z0OA 2ZHAA 7ICMA 2IUBA 1ZQDA 3WFQE 4E8FA 4EZRA 3T49A 4DCNC 1MIWA 1ZQUA 8ICJA 4WC2A 4NKUA 4X4NA 5IILA 7ICQA 1Y2OA 5DKWA 4FZSA 1SUFA 1OAOA 1UEUA
chains in the Genus database with same CATH topology
3K7DA 4EZUA 4JLXA 2OBMA 4E81A 4EZTA 4D8JA 4JNFA 4IM2A 2OBLA 4O68A 3L3OM 3QNJA 1DKZA 2YI8A 3QA8A 3VEBA 1E2UA 3O3MB 4HR1B 4F00A 4LEYA 3OHXM 1OA0A 4XJEA 1U00A 1W9MA 2GA9D 4IWOA 4NPHA 4JWCA 5E84A 4O67A 4R5GA 3C7NA 4EZQA 4K99A 1GNLA 4KM5A 3PHZA 4NXTA 4JWDA 4O6AA 4OAGA 4JNEA 4K8VA 4LEZA 3I39X 4IM0A 4B9QA 1JQKA 2QFFA 3ER9B 4M0MA 1SU6A 4JLCA 5D63A 4JLZA 1GN9A 2YI9A 4UDYX 2ND1A 3I04A 4HYBA 3VEAA 4HR1A 1UPXA 5B3QA 4MKPA 3O3NB 4KIKB 2JNSA 4LEVA 4IWPA 4NXVA 4KB6A 3UITA 3FD9A 4R5KA 5CFUA 4H6HA 4EZPA 4E3CA 3T46A 4UDXX 4OAFA 3I01A 2EX3B 4OAIZ 3B52X 3EF2A 4R5IA 2N3KA 3KAWA 3KDRA 2Z8YA 1SU7A 5D61A 4H6IA 3MCRA 4F01A 4NXXA 3F7WA 1E9VA 3T48A 4LEWA 5CHEA 4FO1A 5B3PA 3D2EA 4OAHA 2PY6A 4FM3A 4JWEA 2ND0A 3RV1A 3B51X 2EWFA 3NKUA 4EZYA 3LMFA 4IW0A 4K9BA 1GPJA 4O69A 2B51A 4WQKA 2EWRA 4JN4A 4WQLA 2LM0A 2FCLA 1E1DA 4JL9A 4IWQA 4KIKA 3B53X 3DPPA 1ZYLA 4EZWA 2B56A 5FLEX 3GI7A 3T4AG 3KAVA 3ZEDA 4WH5A 4EZNA 4G6QA 3ERCC 1SU8A 2IHOA 2YIBA 4WOYA 4EZXA 2YIAA 2YIVX 3VKHA 2GAFD 2B4VA 2KHOA 5FIGA 3DPQA 4PO2A 1MJGA 2QXLA 4IM3A 4K96A 4EZOA 3OWGA 5D62A 1DKYA 4K98A 3ER8C 4EZSA 2RT6A 4HX0A 4N7RA 5TKYA 4NXWA 3DPOA 1GNTA 3O3OB 5CFTA 3T47A 4NXUA 2NCZA 4R5LA 3A98A 2WINM 4EZVA 4EZZA 3D2FA 4EZRA 3T49A 4K97A 1OA1A 1DKXA 4R5JA 5CFSA 4HY9A 4K9AA 3RV0A 1SUFA 2X5CA 1OAOA 4JWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWG A;  2GAF D;  3ER8 C;  3ER9 B;  3ERC C;  2GA9 D; 
#chains in the Genus database with same CATH topology
 1R34 A;  2OW6 A;  9ICN A;  2VAN A;  4KLU A;  4M47 A;  4JNF A;  5J0T A;  5J2C A;  1JMS A;  2YI8 A;  4YMO A;  3AQN A;  4P2H A;  4EGW A;  3O3M B;  4HR1 B;  4F00 A;  4E7X A;  7ICG A;  2F18 A;  2O0I 1;  1X03 A;  4I28 A;  1ZQN A;  4R66 A;  8ICI A;  4M04 A;  5CR0 A;  9ICG A;  5E84 A;  2WYH A;  5JTG A;  3AQL A;  4RQ4 A;  5F2V O;  2PXI A;  2DR8 A;  4UD5 A;  3PHZ A;  4NXT A;  4NM2 A;  8ICU A;  5HC9 A;  4ATM A;  4X4U A;  3WFP A;  5HRG A;  3CZN A;  4K8V A;  4UAY A;  3I39 X;  4IM0 A;  3C18 A;  4FHV A;  3PML A;  4WC4 A;  1ZQJ A;  4LEZ A;  3EJU A;  7ICN A;  5D63 A;  3RJI A;  2ISO A;  1GN9 A;  2YI9 A;  9ICE A;  2F7O A;  4O5E A;  2OZN B;  3I04 A;  4HR1 A;  4QZH A;  1ZQB A;  4I0U A;  4I2B A;  7ICS A;  4AT8 A;  7ICJ A;  9ICJ A;  2YL8 A;  4NXV A;  5BOL A;  4IWP A;  3B0X A;  1HUO A;  1ZQL A;  4E3C A;  4WCW A;  3V72 A;  1KNY A;  1ZQW A;  5J0Y A;  4RWQ A;  3H39 A;  4UDX X;  4RWO A;  9ICU A;  4OAF A;  5J2A A;  3I01 A;  8ICT A;  9ICV A;  4UD4 A;  4DOC A;  2BBH A;  3BVX A;  2BPC A;  3DX3 A;  4OAI Z;  2PMR A;  3ACO A;  3B52 X;  3EF2 A;  2N3K A;  7ICT A;  1PS3 A;  2DR7 A;  5CA7 A;  4EBK A;  4X4V A;  4NQI A;  9ICI A;  4H6I A;  3MCR A;  5J2J A;  4DOB A;  4NXX A;  3F7W A;  3T48 A;  3ISB A;  3UPQ A;  4LEW A;  1HTY A;  1MIY A;  5J2E A;  4X0A A;  3AQK A;  2YL6 A;  4JWE A;  4YMN A;  4XUS A;  4WPC A;  4S3N A;  2V0O A;  3NKU A;  4EZY A;  4RT3 A;  2DRA A;  1GPJ A;  4WQK A;  3AQM A;  3BVT A;  4JN4 A;  4WQL A;  4X4S A;  2Z0N A;  7ICL A;  3MGH A;  4AZI A;  4X4Q A;  3BUP A;  1O7D B;  3D52 A;  4TUP A;  1VFG A;  4JL9 A;  4O5C A;  4KIK A;  1F5A A;  3B53 X;  4Z6D A;  7ICV A;  4F5P A;  4DO9 A;  3QWE A;  5FLE X;  1BPX A;  4UBC A;  3RJH A;  4WC7 A;  3L3P A;  4QZF A;  3D51 A;  1ZQH A;  5CP2 A;  3ERC C;  4WC5 A;  1SU8 A;  5J2D A;  3B0Y A;  4I2A A;  3UQ0 A;  2M2T A;  1FA0 A;  3VKH A;  5KBP A;  4XQ8 A;  3MBY A;  3CV5 A;  3EJQ A;  2D1L A;  5CB1 A;  3JPN A;  4X0B A;  4EZO A;  2W9M A;  3DYT A;  3OWG A;  4HX0 A;  4K4G A;  4N7R A;  3HIY A;  8ICV A;  3NVO A;  4FHY A;  2Q12 A;  4UAZ A;  3JCF A;  3O3O B;  4M9N A;  8ICB A;  4NXU A;  2NCZ A;  1RZT A;  3JPO A;  5D4B A;  3H37 A;  8ICM A;  3TFS A;  4MFC A;  1ZQQ A;  2ZH8 A;  3UXP A;  3NWI A;  8ICY A;  1OA1 A;  5C5B B;  1DKX A;  3K75 D;  4F5O A;  4R5J A;  4ATB B;  9ICB A;  4HY9 A;  4QZI A;  1WDZ A;  2OBM A;  2ZH7 A;  3JPP A;  4EZT A;  4D8J A;  3RH4 A;  1WOT A;  4QZ8 A;  4K4I A;  8ICS A;  4PHD A;  2OBL A;  4O68 A;  3DX1 A;  5TZV A;  3Q0K A;  2BCR A;  1I4T A;  4F5R A;  3MGI A;  4WC1 A;  4LEY A;  5HRE A;  4NLK A;  1ZQY A;  2BE3 A;  2YL5 A;  4NPH A;  1BPZ A;  4UB2 A;  9ICO A;  4O67 A;  4R5G A;  3EJS A;  5J2H A;  5DB8 A;  2F1A A;  5J0Q A;  3V7K A;  4QZA A;  4JWD A;  3RPM A;  4OAG A;  4JNE A;  3BVW A;  1JQK A;  2QFF A;  3ER9 B;  2BCU A;  4QZD A;  1O7D C;  2ZH2 A;  8ICW A;  4KLF A;  4FZP A;  1NO5 A;  4LZD A;  5IIM A;  2GWS A;  4LVS A;  4PHE A;  4UDY X;  4HYB A;  3VEA A;  9ICC A;  4PH5 A;  4PGX A;  4F5Q A;  3JZ0 A;  4Z6E A;  3AUO A;  1UPX A;  4KIK B;  1R5E A;  2JNS A;  5CJ7 A;  1ZJN A;  3UIT A;  3OGU A;  5CFU A;  4YN4 A;  7ICK A;  4JWI A;  4I2H A;  1BPE A;  4YD1 A;  1RPL A;  3HWT A;  4PGQ A;  4R64 A;  4MFA A;  2BCQ A;  1ZQI A;  3BUB A;  3KDR A;  3MDA A;  2BCV A;  4TUQ A;  2BCS A;  4X4R A;  5J0S A;  1I4D A;  1Q78 A;  3EJT A;  3HAI A;  4I1Q A;  3BVV A;  5DEC A;  9ICK A;  4WC3 A;  1ZQR A;  2Q66 A;  8ICZ A;  8ICP A;  4WPE A;  2ELB A;  2HN2 A;  2ID1 A;  3CZS A;  3WFO A;  4I2C A;  4PPX A;  3RH5 A;  3BLB A;  4RQ2 A;  3UXN A;  4K9B A;  3D4Z A;  2FIC A;  3DX0 A;  1ZQT A;  4RQ1 A;  3RJG A;  1URU A;  4AZ5 A;  4AZC A;  4RPX A;  4I2F A;  9ICP A;  2FCL A;  5D46 A;  1E1D A;  3HW8 A;  2BPF A;  4XQ7 A;  5HRK A;  1R89 A;  3ISC A;  7ICP A;  3BUQ A;  4YCX A;  4M9H A;  3DPP A;  1ZQX A;  4EZW A;  2HN1 A;  4UBB A;  3GI7 A;  1XSP A;  3OVB A;  2YLA A;  4IQW A;  8ICG A;  4X4P A;  4WH5 A;  7ICH A;  4M9L A;  7ICI A;  2M2W A;  4MF2 A;  4IQU A;  2KHO A;  3C5G A;  3D4Y A;  4PO2 A;  4ATB A;  2Q13 A;  4K96 A;  5IIJ A;  2ZH4 A;  1TQV A;  4AZC B;  5D62 A;  1DKY A;  1QWU A;  4NKT A;  4EZS A;  2FMS A;  4NXW A;  1GNT A;  2O5A A;  4RQ0 A;  2OW7 A;  3HAH A;  4YMM A;  2F7R A;  2D4C A;  4R65 A;  2X3W A;  4EZV A;  4PGY A;  2PFO A;  1YLQ A;  1R8B A;  3D2F A;  4YD2 A;  4K97 A;  4QZC A;  1QX1 A;  2M2V A;  9ICF A;  4I2G A;  5CFS A;  2MI7 A;  1HXK A;  4K9A A;  4LZG A;  3K7D A;  5J0R A;  8ICX A;  5J29 A;  1TQT A;  3DX4 A;  1TV9 A;  4O5K A;  4IM2 A;  3LQC B;  5J2K A;  1R8A A;  2RAK A;  3JPQ A;  1BPY A;  4NM1 A;  1DKZ A;  4EEB A;  3VEB A;  1ZQE A;  1TQS A;  4KLQ A;  2C08 A;  4GXJ A;  4BNE A;  3LVT A;  3OHX M;  4RQ8 A;  1OA0 A;  3UXO A;  3CKD A;  1U00 A;  1W9M A;  2GA9 D;  4IWO A;  5DB6 A;  1ZQV A;  2RAI A;  4JWC A;  4AZB A;  4RQ7 A;  4K99 A;  1GNL A;  5HRI A;  4M2Y A;  2FMQ A;  4FZO A;  3OUY A;  4PHP A;  4IQT A;  2YKT A;  4I2D A;  4B9Q A;  5D49 A;  3G9G A;  4NLZ A;  5J2I A;  4M9G A;  4M0M A;  5C5B A;  3JPS A;  4JLC A;  3QNI A;  4R63 A;  4RPY A;  1QWN A;  4TUR A;  3C5F A;  1HUZ A;  4QZG A;  2ND1 A;  2ISP A;  2DR5 A;  5DB7 A;  3LK9 A;  1KEJ A;  3O3N B;  4KB6 A;  3UPS A;  4R5K A;  2ALW A;  4AZ6 A;  4H6H A;  1UET A;  5CWR A;  3T46 A;  4UB1 A;  5J0X A;  4P4M A;  2HHP A;  8ICL A;  3EJP A;  1X04 A;  4FH3 A;  3CAZ A;  4E80 A;  1ZQF A;  4R5I A;  5IIK A;  5HRH A;  4AT7 A;  3HX0 A;  4RWP A;  4KLL A;  3RJE A;  1I49 A;  1SU7 A;  4FHW A;  5D61 A;  1ZQK A;  8ICA A;  5BOM A;  5IIN A;  4F01 A;  4NSW A;  2F1B A;  4FH5 A;  3V7L A;  4FHX A;  3JYY A;  4WC6 A;  3M3W A;  7ICO A;  1V4A A;  1TVA A;  3BVU A;  4WBZ A;  5B3P A;  3D2E A;  4OAH A;  2IHM A;  2NRK A;  3HJ1 A;  3WFR E;  1TFY A;  3DDG A;  1JQR A;  4IW0 A;  2EFK A;  3V7J A;  2B51 A;  4RPZ A;  2EWR A;  4QZ9 A;  4I29 A;  1HWW A;  2LM0 A;  3DX2 A;  1TQW A;  4QZE A;  8ICQ A;  2YL9 A;  2PBE A;  1I4L A;  4Z6C A;  4EBJ A;  4AZH A;  1ZQZ A;  4RQ3 A;  9ICQ A;  4IWQ A;  3PMN A;  1ZYL A;  4PHA A;  5DBA A;  2PFN A;  1OU5 A;  3T4A G;  3KAV A;  2BBJ A;  3PNC A;  4F5N A;  4M9J A;  9ICL A;  2P66 A;  4EZN A;  4P4O A;  8ICO A;  4QZB A;  4UAW A;  2YIB A;  4WOY A;  3RJK A;  2YIA A;  4NLN A;  4I2E A;  2FMP A;  2YIV X;  5HHI A;  1MQ2 A;  4EV6 A;  4DOA A;  2B4V A;  4Z6F A;  5J0W A;  8ICN A;  5FIG A;  3DPQ A;  3C2L A;  5DBC A;  5BPC A;  9ICX A;  1MJG A;  5IIO A;  4IM3 A;  4GXI A;  1MQ3 A;  3C2M A;  4M0A A;  4O9M A;  4K98 A;  2RT6 A;  5J0U A;  5DDM A;  3OVS A;  3DPO A;  4AT9 B;  3I2W A;  8ICC A;  4X4O A;  1JAJ A;  5CFT A;  3T47 A;  1YWM A;  1ZQP A;  4KLG A;  9ICS A;  4R5L A;  5CHG A;  3A98 A;  3H38 A;  2WIN M;  4WC0 A;  4XRH A;  5DBB A;  2EFL A;  4FO6 A;  4EZZ A;  5J2F A;  4KLH A;  5DED A;  3AU2 A;  1R33 A;  2DR9 A;  3ISD A;  4KLM A;  5DB9 A;  3JPR A;  1BPB A;  8ICF A;  4JLZ A;  5HRF A;  5EOZ A;  3RV0 A;  2X5C A;  1ZWW A;  9ICW A;  3PLT A;  4EZU A;  4UB4 A;  4JLX A;  3OV7 A;  4E81 A;  4XA5 A;  4KLJ A;  7ICF A;  4WBY A;  3L3O M;  3QNJ A;  3QA8 A;  8ICK A;  1E2U A;  4RQ5 A;  4JWN A;  3ABH A;  4IQV A;  1ZQS A;  2ZHB A;  4AKV A;  4RT2 A;  2X3X A;  1JN3 A;  1NOM A;  3L9D A;  4XJE A;  3MDC A;  4I27 A;  3C2K A;  4LT6 A;  5J2G A;  2ZH9 A;  3C7N A;  4EZQ A;  3BUI A;  4AT7 B;  4KM5 A;  2Z0V A;  2F7Q A;  3RH6 A;  4O6A A;  5HRL A;  2ZH5 A;  4X5V A;  4H8S A;  4AZ7 A;  3H3A A;  2PFQ A;  1SU6 A;  9ICA A;  3RJF A;  1Q79 A;  3NYB A;  2ZXQ A;  3RJJ A;  5B3Q A;  3HJ4 A;  4MKP A;  4AZG A;  4DYL A;  4LEV A;  5HRB A;  1R8C A;  4RWN A;  3FD9 A;  5HRD A;  4EZP A;  7ICU A;  4K4H A;  1VJ7 A;  3JPT A;  4KLE A;  9ICM A;  4KLD A;  3UQ2 A;  2ZH1 A;  8ICH A;  2DVI A;  2EX3 B;  1ZQA A;  1ZJM A;  3QE6 A;  4NY8 A;  1TQU A;  2JNK A;  5HR9 A;  3KAW A;  1ZQM A;  3Q84 A;  2Z8Y A;  3OK8 A;  3TFR A;  1XSN A;  5J0O A;  2GF4 A;  9ICT A;  9ICR A;  3BUD A;  4AT8 B;  5J0P A;  3OVA A;  4KLT A;  1E9V A;  4KLS A;  4AVM A;  3CVR A;  5CHE A;  3OUY B;  2M2U A;  4FO1 A;  4IG8 A;  4I2J A;  8ICE A;  2WYI A;  3HAJ A;  2PY6 A;  4FM3 A;  4NXZ A;  2ND0 A;  4MF8 A;  1ZQO A;  3RV1 A;  4MFF A;  3B51 X;  1TFW A;  7ICR A;  2EWF A;  1UEV A;  4EP7 A;  3LMF A;  4AT9 A;  4I2I A;  4O69 A;  4P4P A;  5III A;  4RQ6 A;  8ICR A;  4TUS A;  1KDH A;  3SYV A;  4M5D A;  4GXK A;  3DDF A;  4UB5 A;  3GDX A;  9ICH A;  4X4T A;  3SOG A;  2RFF A;  3EJR A;  4KLO A;  2BPG A;  4JWM A;  1PX5 A;  2B56 A;  1ZQG A;  2FYV A;  3CK6 A;  2DRB A;  2OO2 A;  2YLL A;  5J2B A;  3ZED A;  3C66 A;  4G6Q A;  4UB3 A;  2ZH6 A;  4KLI A;  2IHO A;  4EZX A;  1MIV A;  2O1P A;  5DDY A;  1BPD A;  2GAF D;  4EED A;  2I9G A;  4FHP A;  2ZH3 A;  7ICE A;  1XSL A;  3D50 A;  2F7P A;  1LQ7 A;  2QKW A;  2QXL A;  5HHH A;  2LXY A;  2PFP A;  3LLL A;  3ER8 C;  1ZQC A;  2X3V A;  2RAJ A;  5TKY A;  3AU6 A;  3WFS C;  2Z0O A;  2ZHA A;  7ICM A;  2IUB A;  1ZQD A;  3WFQ E;  4E8F A;  4EZR A;  3T49 A;  4DCN C;  1MIW A;  1ZQU A;  8ICJ A;  4WC2 A;  4NKU A;  4X4N A;  5IIL A;  7ICQ A;  1Y2O A;  5DKW A;  4FZS A;  1SUF A;  1OAO A;  1UEU A; 
#chains in the Genus database with same CATH homology
 3K7D A;  4EZU A;  4JLX A;  2OBM A;  4E81 A;  4EZT A;  4D8J A;  4JNF A;  4IM2 A;  2OBL A;  4O68 A;  3L3O M;  3QNJ A;  1DKZ A;  2YI8 A;  3QA8 A;  3VEB A;  1E2U A;  3O3M B;  4HR1 B;  4F00 A;  4LEY A;  3OHX M;  1OA0 A;  4XJE A;  1U00 A;  1W9M A;  2GA9 D;  4IWO A;  4NPH A;  4JWC A;  5E84 A;  4O67 A;  4R5G A;  3C7N A;  4EZQ A;  4K99 A;  1GNL A;  4KM5 A;  3PHZ A;  4NXT A;  4JWD A;  4O6A A;  4OAG A;  4JNE A;  4K8V A;  4LEZ A;  3I39 X;  4IM0 A;  4B9Q A;  1JQK A;  2QFF A;  3ER9 B;  4M0M A;  1SU6 A;  4JLC A;  5D63 A;  4JLZ A;  1GN9 A;  2YI9 A;  4UDY X;  2ND1 A;  3I04 A;  4HYB A;  3VEA A;  4HR1 A;  1UPX A;  5B3Q A;  4MKP A;  3O3N B;  4KIK B;  2JNS A;  4LEV A;  4IWP A;  4NXV A;  4KB6 A;  3UIT A;  3FD9 A;  4R5K A;  5CFU A;  4H6H A;  4EZP A;  4E3C A;  3T46 A;  4UDX X;  4OAF A;  3I01 A;  2EX3 B;  4OAI Z;  3B52 X;  3EF2 A;  4R5I A;  2N3K A;  3KAW A;  3KDR A;  2Z8Y A;  1SU7 A;  5D61 A;  4H6I A;  3MCR A;  4F01 A;  4NXX A;  3F7W A;  1E9V A;  3T48 A;  4LEW A;  5CHE A;  4FO1 A;  5B3P A;  3D2E A;  4OAH A;  2PY6 A;  4FM3 A;  4JWE A;  2ND0 A;  3RV1 A;  3B51 X;  2EWF A;  3NKU A;  4EZY A;  3LMF A;  4IW0 A;  4K9B A;  1GPJ A;  4O69 A;  2B51 A;  4WQK A;  2EWR A;  4JN4 A;  4WQL A;  2LM0 A;  2FCL A;  1E1D A;  4JL9 A;  4IWQ A;  4KIK A;  3B53 X;  3DPP A;  1ZYL A;  4EZW A;  2B56 A;  5FLE X;  3GI7 A;  3T4A G;  3KAV A;  3ZED A;  4WH5 A;  4EZN A;  4G6Q A;  3ERC C;  1SU8 A;  2IHO A;  2YIB A;  4WOY A;  4EZX A;  2YIA A;  2YIV X;  3VKH A;  2GAF D;  2B4V A;  2KHO A;  5FIG A;  3DPQ A;  4PO2 A;  1MJG A;  2QXL A;  4IM3 A;  4K96 A;  4EZO A;  3OWG A;  5D62 A;  1DKY A;  4K98 A;  3ER8 C;  4EZS A;  2RT6 A;  4HX0 A;  4N7R A;  5TKY A;  4NXW A;  3DPO A;  1GNT A;  3O3O B;  5CFT A;  3T47 A;  4NXU A;  2NCZ A;  4R5L A;  3A98 A;  2WIN M;  4EZV A;  4EZZ A;  3D2F A;  4EZR A;  3T49 A;  4K97 A;  1OA1 A;  1DKX A;  4R5J A;  5CFS A;  4HY9 A;  4K9A A;  3RV0 A;  1SUF A;  2X5C A;  1OAO A;  4JWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...