3ER8C

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with two fragments of rna
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
468
structure length
445
Chain Sequence
b'NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
total genus 122
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er8C01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er8C03
3OWGA 2GA9D 3ERCC 3ER8C 2GAFD 3ER9B
chains in the Genus database with same CATH superfamily
4RPYA 2ZH7A 4NXUA 2Z8YA 4AZ5A 3ER8C 3L9DA 8ICSA 4RQ1A 4QZFA 2IUBA 4QZ9A 3MGIA 2I9GA 4JWDA 3CVRA 3RV1A 4JNFA 5J2FA 1ZQIA 3V7JA 5DBAA 4E80A 4AT9A 7ICSA 2EFKA 1FA0A 4X4VA 3B52X 4O9MA 1MIYA 1LQ7A 3V72A 2KHOA 3HAHA 1UEVA 8ICJA 2BCSA 3WFQE 4DOBA 2PFNA 4I2DA 3NVOA 3OUYA 2O5AA 3PLTA 3BUQA 4NLZA 1JN3A 1OAOA 3JCFA 4K8VA 1TQTA 7ICLA 4EZYA 4DOAA 1HTYA 4Z6EA 1ZQRA 4EZOA 4RWOA 4PGXA 8ICPA 4F00A 4F5OA 3BVUA 3AQNA 4KLEA 5IILA 4E8FA 3ERCC 5J2EA 4AT7B 4TURA 3C2MA 4TUPA 5CFUA 4PHDA 3H38A 2VANA 3HX0A 2DR8A 1TQWA 5CJ7A 8ICYA 2B51A 4YN4A 4KLJA 9ICHA 4EZXA 1ZQOA 3OK8A 4R66A 2WYHA 3C5GA 3RJKA 3VEBA 4I28A 5EOZA 4KIKA 9ICCA 5J2CA 5DBBA 4NY8A 3B0YA 4UBBA 4JWMA 4RQ2A 4M9GA 9ICXA 4HR1B 2W9MA 8ICHA 4XQ7A 5J0WA 4DO9A 3QA8A 4EP7A 4I2BA 1BPEA 2HN1A 4RQ7A 4PHPA 2BPFA 2ISPA 4WC7A 4WBZA 5E84A 4DYLA 3GDXA 1R8CA 4IM0A 1XSLA 5HRFA 5DDMA 4UB4A 4K97A 4H6HA 3AUOA 1I4TA 4AZ7A 4M0MA 2X3VA 3T46A 2BPGA 4BNEA 4N7RA 2F1BA 3OVSA 5J0OA 5FIGA 2Q12A 5DECA 5J2GA 4KLMA 2HHPA 4AVMA 1GN9A 3BVWA 3Q84A 4I29A 8ICQA 4QZ8A 3CZNA 1NO5A 1RPLA 5J2IA 7ICJA 1QWUA 1ZQWA 4HY9A 1BPBA 4JWEA 4PHEA 3BUBA 4WPEA 3C5FA 4QZDA 5IIMA 2ID1A 4JLCA 5HRKA 2ZH3A 4WC5A 3JPPA 8ICKA 2N3KA 1F5AA 5J2AA 3JPQA 4I1QA 2ZH8A 4DOCA 1YWMA 4MF8A 4F01A 1BPXA 4R5JA 2PFOA 5IINA 4LVSA 4IG8A 4B9QA 2X5CA 1SU7A 1TFWA 9ICNA 9ICGA 3B0XA 4XJEA 2MI7A 3DX0A 1JAJA 2Q13A 8ICOA 5CFTA 2NCZA 2DR7A 5J0XA 3DYTA 4RT2A 3KAWA 4O6AA 2Q66A 3DDGA 4F5RA 1MJGA 1SUFA 3CAZA 3MDCA 4I27A 4WC3A 2FMSA 4LEZA 4YMNA 1KDHA 2YI8A 3QE6A 4KLIA 4KM5A 4H8SA 1X03A 4TUQA 3RJIA 1QWNA 5B3QA 4WC4A 3LK9A 4EZWA 9ICAA 4MKPA 5J2HA 4TUSA 4NKUA 2GA9D 1YLQA 3LLLA 3OGUA 7ICPA 3AU2A 2IHOA 4PH5A 4WPCA 4FZSA 3VEAA 1UETA 4OAHA 5DEDA 8ICCA 1NOMA 4WC1A 5D62A 3UXNA 5DB7A 4NKTA 2BCQA 4QZCA 3O3OB 3NKUA 3G9GA 4R5IA 3MCRA 2FICA 2LXYA 3ISCA 1ZQDA 9ICLA 7ICRA 4M0AA 1ZQQA 1WDZA 4UDXX 2B4VA 2QFFA 3BVXA 3GI7A 1E1DA 2FCLA 3RJEA 3HJ4A 4RT3A 4EZUA 5D4BA 4UAZA 3JZ0A 2X3WA 4FZPA 4LT6A 2ZH9A 3TFRA 3D2FA 4X4TA 3C2KA 4PHAA 2M2TA 3O3MB 4GXIA 4E3CA 4OAIZ 4AT7A 4QZIA 1ZQAA 4QZEA 3ISBA 5HRLA 8ICZA 4EZVA 8ICAA 1ZQCA 4YD1A 4MFFA 4NSWA 2M2VA 3LMFA 4RQ5A 4FZOA 3HAIA 4KLSA 3C66A 7ICNA 3BUIA 1URUA 2BBJA 4NXVA 4YMOA 4PGQA 4QZGA 3ISDA 1Q78A 2BE3A 3I01A 8ICIA 3C18A 4YD2A 4RWQA 3RJGA 4G6QA 2O0I1 3V7LA 8ICXA 4MFCA 4YCXA 5J0QA 4EZQA 4R65A 4NXTA 1KEJA 4FHYA 4WQKA 3RJJA 4NLKA 2BPCA 2OZNB 5J0RA 3CV5A 4P4MA 1I49A 1Y2OA 2YIVX 2EX3B 4H6IA 4JN4A 2WYIA 4O69A 4RWPA 4X4UA 4Z6FA 2F1AA 4DCNC 1TQVA 4X0AA 4NLNA 3PMLA 3T48A 3Q0KA 1ZJNA 4I2AA 4WC0A 4M9NA 5FLEX 5CHEA 1Q79A 4X4NA 1E2UA 2DRBA 8ICMA 2RAIA 1GNTA 3JPNA 2YKTA 7ICQA 3WFPA 8ICRA 2BCRA 4JLXA 5HRGA 4I2EA 4JWCA 4EZZA 2EWRA 4FO6A 5B3PA 3BUDA 4IWPA 4ATBA 1R8AA 8ICWA 3OUYB 2YL9A 1ZQTA 5KBPA 3OVBA 2PXIA 4E7XA 4P4PA 4LEWA 3D51A 3CZSA 1ZJMA 4YMMA 3WFOA 2YLAA 2FYVA 5HHHA 3HW8A 3H37A 3UITA 2RFFA 5D46A 4UB3A 2EWFA 4XA5A 5JTGA 2Z0NA 1W9MA 4M04A 9ICBA 1MIWA 3MBYA 4O5KA 1OA1A 3B53X 1VJ7A 4AZ6A 4WOYA 9ICRA 2PMRA 4UAWA 5CWRA 4K4GA 5HHIA 5HREA 1ZQXA 5J0YA 3ABHA 3PMNA 4D8JA 4EEDA 3D52A 3HAJA 5J0SA 4NXXA 3DPPA 3DDFA 4IQWA 3RJFA 4O5EA 4P4OA 4FHXA 2ND1A 5BOLA 2NRKA 9ICVA 4KLTA 3JPSA 3EF2A 1R8BA 1ZQUA 2ZH1A 4X4PA 2DRAA 9ICJA 7ICVA 4EZNA 4UAYA 4NPHA 1ZYLA 1DKZA 4OAFA 4UDYX 2F7RA 1GNLA 5C5BB 5IIIA 4PGYA 1I4LA 4R5KA 4RQ8A 3RH6A 4HYBA 4I2HA 3T4AG 1UEUA 4FO1A 2GAFD 2ZH2A 2OO2A 4Z6DA 4AT8A 5BPCA 3UQ2A 3D4YA 3HIYA 2YL6A 4K9AA 5CA7A 4UB1A 5J2KA 1MQ2A 3D50A 1DKYA 4XQ8A 1SU6A 7ICEA 5J2BA 4I2GA 3D4ZA 4EGWA 4LZGA 1ZQVA 4FHPA 2ZHAA 1QX1A 2HN2A 5D49A 4R64A 3F7WA 4AZCB 3K75D 5J29A 1ZQGA 2ZH4A 3PHZA 4P2HA 2GF4A 2QXLA 3OVAA 4JWNA 2DVIA 2EFLA 1ZQZA 1OA0A 4WH5A 3T47A 2P66A 2ZH5A 5DB8A 3DX3A 1MIVA 1XSPA 4IWQA 4AZBA 1BPZA 3UXOA 1ZQPA 4KLQA 3A98A 4KLUA 3DX1A 4IM2A 1UPXA 1O7DB 3T49A 3UPSA 8ICVA 4M47A 1HUZA 2OW7A 5J0UA 4QZBA 2ZH6A 2ZHBA 1ZQMA 2ISOA 1VFGA 4I2FA 3QWEA 9ICQA 9ICKA 1ZQHA 2OBLA 3B51X 3EJTA 5IIJA 3UPQA 1HUOA 1R89A 2FMPA 3WFRE 5D61A 4QZHA 2F7OA 1R5EA 4RQ6A 4LZDA 4NQIA 3NYBA 4RQ4A 4QZAA 2M2UA 3KDRA 4IW0A 1OU5A 4O5CA 3ER9B 1GPJA 4AZHA 4K9BA 3QNIA 5J0PA 4WC6A 8ICGA 5CR0A 1TQSA 4M2YA 3NWIA 1PS3A 8ICEA 2Z0VA 3DX4A 5HRHA 1ZQNA 4WQLA 9ICIA 4S3NA 4MFAA 2YL5A 3RV0A 4JWIA 2YI9A 4EBJA 3QNJA 3BUPA 4UD4A 1ZQSA 1ZWWA 9ICMA 4HR1A 9ICEA 1U00A 4M9HA 4PO2A 4X0BA 2DR5A 4X4QA 2BCVA 4FHWA 5HRDA 8ICUA 2PFQA 4RQ3A 4X4RA 2YIBA 4GXJA 3L3PA 3V7KA 4IQUA 4K96A 5CB1A 4EBKA 4LEVA 4RQ0A 4IQVA 3RH4A 9ICTA 4AKVA 2D4CA 4RPXA 4EZTA 5HRIA 4M9LA 4LEYA 4XRHA 4IM3A 2F18A 4KLGA 3MGHA 5HRBA 2QKWA 3EJUA 2D1LA 1DKXA 3OHXM 4AZGA 2BBHA 4R5LA 4AT9B 4KLOA 4PPXA 4F5QA 3AU6A 7ICUA 8ICFA 2FMQA 4M5DA 2ZXQA 4FH3A 3L3OM 1HXKA 5TZVA 2X3XA 9ICFA 2RAJA 3HWTA 3EJSA 4M9JA 5CFSA 1E9VA 2YL8A 3H3AA 3O3NB 3TFSA 1KNYA 2M2WA 3C7NA 1TQUA 4IQTA 3LVTA 1SU8A 3LQCB 4O67A 4EV6A 4UB5A 1TVAA 3RPMA 3JYYA 4FHVA 2B56A 3DX2A 1R34A 3VKHA 1MQ3A 3DPOA 1R33A 9ICPA 4UBCA 4RWNA 4KLFA 5J2DA 5D63A 3UQ0A 5C5BA 2GWSA 2F7QA 3RJHA 2ELBA 4X4OA 4X5VA 3BVVA 5DB9A 9ICWA 4K98A 3DPQA 3C2LA 1ZQJA 2ND0A 2BCUA 3PNCA 7ICOA 4IWOA 7ICFA 1X04A 4EZSA 2IHMA 3AQKA 7ICKA 4GXKA 7ICTA 4FH5A 4RPZA 1ZQEA 3I2WA 4JL9A 4I2JA 4F5NA 1JMSA 5J2JA 1ZQYA 4I2CA 4KIKB 3JPRA 7ICIA 2Z0OA 4NXZA 4WC2A 5HR9A 3I39X 5CP2A 3JPTA 4MF2A 7ICMA 4HX0A 3AQLA 5IIOA 1ZQLA 4I2IA 5DKWA 3MDAA 1PX5A 9ICSA 3K7DA 4UD5A 4K4HA 4AZCA 3CK6A 3OWGA 2JNKA 3SYVA 1JQKA 2C08A 4ATMA 2PFPA 2LM0A 3EJRA 4E81A 4XUSA 3FD9A 3AQMA 3HJ1A 4ATBB 2DR9A 3CKDA 4K4IA 4WBYA 3BVTA 1TFYA 1ZQBA 4AZIA 2RAKA 9ICUA 2WINM 3OV7A 3JPOA 3RH5A 4EEBA 4KLDA 2O1PA 2F7PA 1ZQFA 3WFSC 1TV9A 5CHGA 2RT6A 4EZRA 4O68A 1WOTA 8ICNA 2OBMA 4Z6CA 1JQRA 1HWWA 7ICHA 8ICTA 3H39A 4KLLA 1O7DC 4F5PA 2YIAA 3KAVA 5DB6A 4UB2A 4JLZA 4R5GA 5DBCA 4KLHA 7ICGA 8ICLA 1BPDA 4K99A 5DDYA 3EJPA 3BLBA 2PY6A 4OAGA 5F2VO 2PBEA 5J0TA 3UXPA 1BPYA 3SOGA 1ZQKA 4NM2A 3M3WA 4FM3A 1I4DA 4NM1A 5BOMA 4WCWA 5IIKA 4I0UA 2YLLA 2V0OA 8ICBA 9ICOA 2JNSA 5TKYA 4R63A 2ALWA 3ACOA 3ZEDA 3D2EA 5HC9A 3EJQA 1RZTA 3I04A 4KB6A 1XSNA 2OW6A 4X4SA 1V4AA 4AT8B 4EZPA 4NXWA 4JNEA
chains in the Genus database with same CATH topology
1SUFA 4EZTA 2EWFA 4NXUA 1W9MA 2Z8YA 4LEYA 3ER8C 1OA1A 3B53X 4IM3A 4WOYA 4LEZA 2YI8A 4KM5A 3OHXM 1DKXA 4JWDA 4R5LA 3RV1A 5B3QA 4JNFA 4EZWA 4D8JA 4MKPA 3L3OM 4NXXA 3DPPA 2GA9D 5CFSA 2ND1A 1E9VA 3B52X 3O3NB 2IHOA 3EF2A 3VEAA 3C7NA 4OAHA 2KHOA 1SU8A 4O67A 4EZNA 4NPHA 1ZYLA 1DKZA 4OAFA 4UDYX 5D62A 2B56A 1GNLA 3VKHA 3O3OB 3DPOA 4R5KA 1OAOA 3NKUA 4R5IA 3MCRA 4K8VA 4HYBA 4EZYA 3T4AG 4FO1A 5D63A 2GAFD 4EZOA 4UDXX 4F00A 2B4VA 2QFFA 3GI7A 1E1DA 2FCLA 3DPQA 4K98A 3ERCC 4EZUA 2ND0A 4K9AA 4IWOA 3D2FA 1DKYA 4EZSA 1SU6A 5CFUA 3O3MB 4JL9A 4E3CA 4OAIZ 2B51A 4KIKB 3F7WA 3I39X 4EZVA 3PHZA 4HX0A 4EZXA 2QXLA 3LMFA 3VEBA 4KIKA 3K7DA 1OA0A 3OWGA 4WH5A 3T47A 4NXVA 1JQKA 2LM0A 4HR1B 4E81A 4IWQA 3I01A 3FD9A 3UITA 3A98A 4G6QA 4IM2A 1UPXA 3QA8A 3T49A 4O6AA 4EZQA 4NXTA 2WINM 5E84A 4WQKA 4IM0A 2OBLA 3B51X 4K97A 4H6HA 2RT6A 5D61A 2YIVX 4EZRA 4O68A 2OBMA 4M0MA 3T46A 2EX3B 4H6IA 4N7RA 4JN4A 5FIGA 4O69A 3KDRA 2YIAA 4IW0A 3KAVA 3ER9B 4JLZA 4R5GA 1GN9A 3T48A 1GPJA 4K9BA 4K99A 2PY6A 4OAGA 5FLEX 5CHEA 4HY9A 1E2UA 4WQLA 4JWEA 1GNTA 3RV0A 4FM3A 4JWIA 2YI9A 4JLXA 3QNJA 4JWCA 4HR1A 1U00A 4EZZA 4JLCA 2EWRA 4PO2A 5B3PA 4IWPA 2N3KA 4F01A 4R5JA 2JNSA 5TKYA 4B9QA 2X5CA 1SU7A 3ZEDA 3D2EA 4LEWA 2YIBA 4XJEA 3I04A 4KB6A 5CFTA 2NCZA 4K96A 4LEVA 4EZPA 3KAWA 4NXWA 4JNEA 1MJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWG A;  2GA9 D;  3ERC C;  3ER8 C;  2GAF D;  3ER9 B; 
#chains in the Genus database with same CATH topology
 4RPY A;  2ZH7 A;  4NXU A;  2Z8Y A;  4AZ5 A;  3ER8 C;  3L9D A;  8ICS A;  4RQ1 A;  4QZF A;  2IUB A;  4QZ9 A;  3MGI A;  2I9G A;  4JWD A;  3CVR A;  3RV1 A;  4JNF A;  5J2F A;  1ZQI A;  3V7J A;  5DBA A;  4E80 A;  4AT9 A;  7ICS A;  2EFK A;  1FA0 A;  4X4V A;  3B52 X;  4O9M A;  1MIY A;  1LQ7 A;  3V72 A;  2KHO A;  3HAH A;  1UEV A;  8ICJ A;  2BCS A;  3WFQ E;  4DOB A;  2PFN A;  4I2D A;  3NVO A;  3OUY A;  2O5A A;  3PLT A;  3BUQ A;  4NLZ A;  1JN3 A;  1OAO A;  3JCF A;  4K8V A;  1TQT A;  7ICL A;  4EZY A;  4DOA A;  1HTY A;  4Z6E A;  1ZQR A;  4EZO A;  4RWO A;  4PGX A;  8ICP A;  4F00 A;  4F5O A;  3BVU A;  3AQN A;  4KLE A;  5IIL A;  4E8F A;  3ERC C;  5J2E A;  4AT7 B;  4TUR A;  3C2M A;  4TUP A;  5CFU A;  4PHD A;  3H38 A;  2VAN A;  3HX0 A;  2DR8 A;  1TQW A;  5CJ7 A;  8ICY A;  2B51 A;  4YN4 A;  4KLJ A;  9ICH A;  4EZX A;  1ZQO A;  3OK8 A;  4R66 A;  2WYH A;  3C5G A;  3RJK A;  3VEB A;  4I28 A;  5EOZ A;  4KIK A;  9ICC A;  5J2C A;  5DBB A;  4NY8 A;  3B0Y A;  4UBB A;  4JWM A;  4RQ2 A;  4M9G A;  9ICX A;  4HR1 B;  2W9M A;  8ICH A;  4XQ7 A;  5J0W A;  4DO9 A;  3QA8 A;  4EP7 A;  4I2B A;  1BPE A;  2HN1 A;  4RQ7 A;  4PHP A;  2BPF A;  2ISP A;  4WC7 A;  4WBZ A;  5E84 A;  4DYL A;  3GDX A;  1R8C A;  4IM0 A;  1XSL A;  5HRF A;  5DDM A;  4UB4 A;  4K97 A;  4H6H A;  3AUO A;  1I4T A;  4AZ7 A;  4M0M A;  2X3V A;  3T46 A;  2BPG A;  4BNE A;  4N7R A;  2F1B A;  3OVS A;  5J0O A;  5FIG A;  2Q12 A;  5DEC A;  5J2G A;  4KLM A;  2HHP A;  4AVM A;  1GN9 A;  3BVW A;  3Q84 A;  4I29 A;  8ICQ A;  4QZ8 A;  3CZN A;  1NO5 A;  1RPL A;  5J2I A;  7ICJ A;  1QWU A;  1ZQW A;  4HY9 A;  1BPB A;  4JWE A;  4PHE A;  3BUB A;  4WPE A;  3C5F A;  4QZD A;  5IIM A;  2ID1 A;  4JLC A;  5HRK A;  2ZH3 A;  4WC5 A;  3JPP A;  8ICK A;  2N3K A;  1F5A A;  5J2A A;  3JPQ A;  4I1Q A;  2ZH8 A;  4DOC A;  1YWM A;  4MF8 A;  4F01 A;  1BPX A;  4R5J A;  2PFO A;  5IIN A;  4LVS A;  4IG8 A;  4B9Q A;  2X5C A;  1SU7 A;  1TFW A;  9ICN A;  9ICG A;  3B0X A;  4XJE A;  2MI7 A;  3DX0 A;  1JAJ A;  2Q13 A;  8ICO A;  5CFT A;  2NCZ A;  2DR7 A;  5J0X A;  3DYT A;  4RT2 A;  3KAW A;  4O6A A;  2Q66 A;  3DDG A;  4F5R A;  1MJG A;  1SUF A;  3CAZ A;  3MDC A;  4I27 A;  4WC3 A;  2FMS A;  4LEZ A;  4YMN A;  1KDH A;  2YI8 A;  3QE6 A;  4KLI A;  4KM5 A;  4H8S A;  1X03 A;  4TUQ A;  3RJI A;  1QWN A;  5B3Q A;  4WC4 A;  3LK9 A;  4EZW A;  9ICA A;  4MKP A;  5J2H A;  4TUS A;  4NKU A;  2GA9 D;  1YLQ A;  3LLL A;  3OGU A;  7ICP A;  3AU2 A;  2IHO A;  4PH5 A;  4WPC A;  4FZS A;  3VEA A;  1UET A;  4OAH A;  5DED A;  8ICC A;  1NOM A;  4WC1 A;  5D62 A;  3UXN A;  5DB7 A;  4NKT A;  2BCQ A;  4QZC A;  3O3O B;  3NKU A;  3G9G A;  4R5I A;  3MCR A;  2FIC A;  2LXY A;  3ISC A;  1ZQD A;  9ICL A;  7ICR A;  4M0A A;  1ZQQ A;  1WDZ A;  4UDX X;  2B4V A;  2QFF A;  3BVX A;  3GI7 A;  1E1D A;  2FCL A;  3RJE A;  3HJ4 A;  4RT3 A;  4EZU A;  5D4B A;  4UAZ A;  3JZ0 A;  2X3W A;  4FZP A;  4LT6 A;  2ZH9 A;  3TFR A;  3D2F A;  4X4T A;  3C2K A;  4PHA A;  2M2T A;  3O3M B;  4GXI A;  4E3C A;  4OAI Z;  4AT7 A;  4QZI A;  1ZQA A;  4QZE A;  3ISB A;  5HRL A;  8ICZ A;  4EZV A;  8ICA A;  1ZQC A;  4YD1 A;  4MFF A;  4NSW A;  2M2V A;  3LMF A;  4RQ5 A;  4FZO A;  3HAI A;  4KLS A;  3C66 A;  7ICN A;  3BUI A;  1URU A;  2BBJ A;  4NXV A;  4YMO A;  4PGQ A;  4QZG A;  3ISD A;  1Q78 A;  2BE3 A;  3I01 A;  8ICI A;  3C18 A;  4YD2 A;  4RWQ A;  3RJG A;  4G6Q A;  2O0I 1;  3V7L A;  8ICX A;  4MFC A;  4YCX A;  5J0Q A;  4EZQ A;  4R65 A;  4NXT A;  1KEJ A;  4FHY A;  4WQK A;  3RJJ A;  4NLK A;  2BPC A;  2OZN B;  5J0R A;  3CV5 A;  4P4M A;  1I49 A;  1Y2O A;  2YIV X;  2EX3 B;  4H6I A;  4JN4 A;  2WYI A;  4O69 A;  4RWP A;  4X4U A;  4Z6F A;  2F1A A;  4DCN C;  1TQV A;  4X0A A;  4NLN A;  3PML A;  3T48 A;  3Q0K A;  1ZJN A;  4I2A A;  4WC0 A;  4M9N A;  5FLE X;  5CHE A;  1Q79 A;  4X4N A;  1E2U A;  2DRB A;  8ICM A;  2RAI A;  1GNT A;  3JPN A;  2YKT A;  7ICQ A;  3WFP A;  8ICR A;  2BCR A;  4JLX A;  5HRG A;  4I2E A;  4JWC A;  4EZZ A;  2EWR A;  4FO6 A;  5B3P A;  3BUD A;  4IWP A;  4ATB A;  1R8A A;  8ICW A;  3OUY B;  2YL9 A;  1ZQT A;  5KBP A;  3OVB A;  2PXI A;  4E7X A;  4P4P A;  4LEW A;  3D51 A;  3CZS A;  1ZJM A;  4YMM A;  3WFO A;  2YLA A;  2FYV A;  5HHH A;  3HW8 A;  3H37 A;  3UIT A;  2RFF A;  5D46 A;  4UB3 A;  2EWF A;  4XA5 A;  5JTG A;  2Z0N A;  1W9M A;  4M04 A;  9ICB A;  1MIW A;  3MBY A;  4O5K A;  1OA1 A;  3B53 X;  1VJ7 A;  4AZ6 A;  4WOY A;  9ICR A;  2PMR A;  4UAW A;  5CWR A;  4K4G A;  5HHI A;  5HRE A;  1ZQX A;  5J0Y A;  3ABH A;  3PMN A;  4D8J A;  4EED A;  3D52 A;  3HAJ A;  5J0S A;  4NXX A;  3DPP A;  3DDF A;  4IQW A;  3RJF A;  4O5E A;  4P4O A;  4FHX A;  2ND1 A;  5BOL A;  2NRK A;  9ICV A;  4KLT A;  3JPS A;  3EF2 A;  1R8B A;  1ZQU A;  2ZH1 A;  4X4P A;  2DRA A;  9ICJ A;  7ICV A;  4EZN A;  4UAY A;  4NPH A;  1ZYL A;  1DKZ A;  4OAF A;  4UDY X;  2F7R A;  1GNL A;  5C5B B;  5III A;  4PGY A;  1I4L A;  4R5K A;  4RQ8 A;  3RH6 A;  4HYB A;  4I2H A;  3T4A G;  1UEU A;  4FO1 A;  2GAF D;  2ZH2 A;  2OO2 A;  4Z6D A;  4AT8 A;  5BPC A;  3UQ2 A;  3D4Y A;  3HIY A;  2YL6 A;  4K9A A;  5CA7 A;  4UB1 A;  5J2K A;  1MQ2 A;  3D50 A;  1DKY A;  4XQ8 A;  1SU6 A;  7ICE A;  5J2B A;  4I2G A;  3D4Z A;  4EGW A;  4LZG A;  1ZQV A;  4FHP A;  2ZHA A;  1QX1 A;  2HN2 A;  5D49 A;  4R64 A;  3F7W A;  4AZC B;  3K75 D;  5J29 A;  1ZQG A;  2ZH4 A;  3PHZ A;  4P2H A;  2GF4 A;  2QXL A;  3OVA A;  4JWN A;  2DVI A;  2EFL A;  1ZQZ A;  1OA0 A;  4WH5 A;  3T47 A;  2P66 A;  2ZH5 A;  5DB8 A;  3DX3 A;  1MIV A;  1XSP A;  4IWQ A;  4AZB A;  1BPZ A;  3UXO A;  1ZQP A;  4KLQ A;  3A98 A;  4KLU A;  3DX1 A;  4IM2 A;  1UPX A;  1O7D B;  3T49 A;  3UPS A;  8ICV A;  4M47 A;  1HUZ A;  2OW7 A;  5J0U A;  4QZB A;  2ZH6 A;  2ZHB A;  1ZQM A;  2ISO A;  1VFG A;  4I2F A;  3QWE A;  9ICQ A;  9ICK A;  1ZQH A;  2OBL A;  3B51 X;  3EJT A;  5IIJ A;  3UPQ A;  1HUO A;  1R89 A;  2FMP A;  3WFR E;  5D61 A;  4QZH A;  2F7O A;  1R5E A;  4RQ6 A;  4LZD A;  4NQI A;  3NYB A;  4RQ4 A;  4QZA A;  2M2U A;  3KDR A;  4IW0 A;  1OU5 A;  4O5C A;  3ER9 B;  1GPJ A;  4AZH A;  4K9B A;  3QNI A;  5J0P A;  4WC6 A;  8ICG A;  5CR0 A;  1TQS A;  4M2Y A;  3NWI A;  1PS3 A;  8ICE A;  2Z0V A;  3DX4 A;  5HRH A;  1ZQN A;  4WQL A;  9ICI A;  4S3N A;  4MFA A;  2YL5 A;  3RV0 A;  4JWI A;  2YI9 A;  4EBJ A;  3QNJ A;  3BUP A;  4UD4 A;  1ZQS A;  1ZWW A;  9ICM A;  4HR1 A;  9ICE A;  1U00 A;  4M9H A;  4PO2 A;  4X0B A;  2DR5 A;  4X4Q A;  2BCV A;  4FHW A;  5HRD A;  8ICU A;  2PFQ A;  4RQ3 A;  4X4R A;  2YIB A;  4GXJ A;  3L3P A;  3V7K A;  4IQU A;  4K96 A;  5CB1 A;  4EBK A;  4LEV A;  4RQ0 A;  4IQV A;  3RH4 A;  9ICT A;  4AKV A;  2D4C A;  4RPX A;  4EZT A;  5HRI A;  4M9L A;  4LEY A;  4XRH A;  4IM3 A;  2F18 A;  4KLG A;  3MGH A;  5HRB A;  2QKW A;  3EJU A;  2D1L A;  1DKX A;  3OHX M;  4AZG A;  2BBH A;  4R5L A;  4AT9 B;  4KLO A;  4PPX A;  4F5Q A;  3AU6 A;  7ICU A;  8ICF A;  2FMQ A;  4M5D A;  2ZXQ A;  4FH3 A;  3L3O M;  1HXK A;  5TZV A;  2X3X A;  9ICF A;  2RAJ A;  3HWT A;  3EJS A;  4M9J A;  5CFS A;  1E9V A;  2YL8 A;  3H3A A;  3O3N B;  3TFS A;  1KNY A;  2M2W A;  3C7N A;  1TQU A;  4IQT A;  3LVT A;  1SU8 A;  3LQC B;  4O67 A;  4EV6 A;  4UB5 A;  1TVA A;  3RPM A;  3JYY A;  4FHV A;  2B56 A;  3DX2 A;  1R34 A;  3VKH A;  1MQ3 A;  3DPO A;  1R33 A;  9ICP A;  4UBC A;  4RWN A;  4KLF A;  5J2D A;  5D63 A;  3UQ0 A;  5C5B A;  2GWS A;  2F7Q A;  3RJH A;  2ELB A;  4X4O A;  4X5V A;  3BVV A;  5DB9 A;  9ICW A;  4K98 A;  3DPQ A;  3C2L A;  1ZQJ A;  2ND0 A;  2BCU A;  3PNC A;  7ICO A;  4IWO A;  7ICF A;  1X04 A;  4EZS A;  2IHM A;  3AQK A;  7ICK A;  4GXK A;  7ICT A;  4FH5 A;  4RPZ A;  1ZQE A;  3I2W A;  4JL9 A;  4I2J A;  4F5N A;  1JMS A;  5J2J A;  1ZQY A;  4I2C A;  4KIK B;  3JPR A;  7ICI A;  2Z0O A;  4NXZ A;  4WC2 A;  5HR9 A;  3I39 X;  5CP2 A;  3JPT A;  4MF2 A;  7ICM A;  4HX0 A;  3AQL A;  5IIO A;  1ZQL A;  4I2I A;  5DKW A;  3MDA A;  1PX5 A;  9ICS A;  3K7D A;  4UD5 A;  4K4H A;  4AZC A;  3CK6 A;  3OWG A;  2JNK A;  3SYV A;  1JQK A;  2C08 A;  4ATM A;  2PFP A;  2LM0 A;  3EJR A;  4E81 A;  4XUS A;  3FD9 A;  3AQM A;  3HJ1 A;  4ATB B;  2DR9 A;  3CKD A;  4K4I A;  4WBY A;  3BVT A;  1TFY A;  1ZQB A;  4AZI A;  2RAK A;  9ICU A;  2WIN M;  3OV7 A;  3JPO A;  3RH5 A;  4EEB A;  4KLD A;  2O1P A;  2F7P A;  1ZQF A;  3WFS C;  1TV9 A;  5CHG A;  2RT6 A;  4EZR A;  4O68 A;  1WOT A;  8ICN A;  2OBM A;  4Z6C A;  1JQR A;  1HWW A;  7ICH A;  8ICT A;  3H39 A;  4KLL A;  1O7D C;  4F5P A;  2YIA A;  3KAV A;  5DB6 A;  4UB2 A;  4JLZ A;  4R5G A;  5DBC A;  4KLH A;  7ICG A;  8ICL A;  1BPD A;  4K99 A;  5DDY A;  3EJP A;  3BLB A;  2PY6 A;  4OAG A;  5F2V O;  2PBE A;  5J0T A;  3UXP A;  1BPY A;  3SOG A;  1ZQK A;  4NM2 A;  3M3W A;  4FM3 A;  1I4D A;  4NM1 A;  5BOM A;  4WCW A;  5IIK A;  4I0U A;  2YLL A;  2V0O A;  8ICB A;  9ICO A;  2JNS A;  5TKY A;  4R63 A;  2ALW A;  3ACO A;  3ZED A;  3D2E A;  5HC9 A;  3EJQ A;  1RZT A;  3I04 A;  4KB6 A;  1XSN A;  2OW6 A;  4X4S A;  1V4A A;  4AT8 B;  4EZP A;  4NXW A;  4JNE A; 
#chains in the Genus database with same CATH homology
 1SUF A;  4EZT A;  2EWF A;  4NXU A;  1W9M A;  2Z8Y A;  4LEY A;  3ER8 C;  1OA1 A;  3B53 X;  4IM3 A;  4WOY A;  4LEZ A;  2YI8 A;  4KM5 A;  3OHX M;  1DKX A;  4JWD A;  4R5L A;  3RV1 A;  5B3Q A;  4JNF A;  4EZW A;  4D8J A;  4MKP A;  3L3O M;  4NXX A;  3DPP A;  2GA9 D;  5CFS A;  2ND1 A;  1E9V A;  3B52 X;  3O3N B;  2IHO A;  3EF2 A;  3VEA A;  3C7N A;  4OAH A;  2KHO A;  1SU8 A;  4O67 A;  4EZN A;  4NPH A;  1ZYL A;  1DKZ A;  4OAF A;  4UDY X;  5D62 A;  2B56 A;  1GNL A;  3VKH A;  3O3O B;  3DPO A;  4R5K A;  1OAO A;  3NKU A;  4R5I A;  3MCR A;  4K8V A;  4HYB A;  4EZY A;  3T4A G;  4FO1 A;  5D63 A;  2GAF D;  4EZO A;  4UDX X;  4F00 A;  2B4V A;  2QFF A;  3GI7 A;  1E1D A;  2FCL A;  3DPQ A;  4K98 A;  3ERC C;  4EZU A;  2ND0 A;  4K9A A;  4IWO A;  3D2F A;  1DKY A;  4EZS A;  1SU6 A;  5CFU A;  3O3M B;  4JL9 A;  4E3C A;  4OAI Z;  2B51 A;  4KIK B;  3F7W A;  3I39 X;  4EZV A;  3PHZ A;  4HX0 A;  4EZX A;  2QXL A;  3LMF A;  3VEB A;  4KIK A;  3K7D A;  1OA0 A;  3OWG A;  4WH5 A;  3T47 A;  4NXV A;  1JQK A;  2LM0 A;  4HR1 B;  4E81 A;  4IWQ A;  3I01 A;  3FD9 A;  3UIT A;  3A98 A;  4G6Q A;  4IM2 A;  1UPX A;  3QA8 A;  3T49 A;  4O6A A;  4EZQ A;  4NXT A;  2WIN M;  5E84 A;  4WQK A;  4IM0 A;  2OBL A;  3B51 X;  4K97 A;  4H6H A;  2RT6 A;  5D61 A;  2YIV X;  4EZR A;  4O68 A;  2OBM A;  4M0M A;  3T46 A;  2EX3 B;  4H6I A;  4N7R A;  4JN4 A;  5FIG A;  4O69 A;  3KDR A;  2YIA A;  4IW0 A;  3KAV A;  3ER9 B;  4JLZ A;  4R5G A;  1GN9 A;  3T48 A;  1GPJ A;  4K9B A;  4K99 A;  2PY6 A;  4OAG A;  5FLE X;  5CHE A;  4HY9 A;  1E2U A;  4WQL A;  4JWE A;  1GNT A;  3RV0 A;  4FM3 A;  4JWI A;  2YI9 A;  4JLX A;  3QNJ A;  4JWC A;  4HR1 A;  1U00 A;  4EZZ A;  4JLC A;  2EWR A;  4PO2 A;  5B3P A;  4IWP A;  2N3K A;  4F01 A;  4R5J A;  2JNS A;  5TKY A;  4B9Q A;  2X5C A;  1SU7 A;  3ZED A;  3D2E A;  4LEW A;  2YIB A;  4XJE A;  3I04 A;  4KB6 A;  5CFT A;  2NCZ A;  4K96 A;  4LEV A;  4EZP A;  3KAW A;  4NXW A;  4JNE A;  1MJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...