3ER8C

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with two fragments of rna
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
total genus 122
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er8C01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er8C03
3ERCC 3ER9B 2GAFD 3OWGA 3ER8C 2GA9D
chains in the Genus database with same CATH superfamily
5J0OA 4EZWA 4EEBA 4EZQA 4FZOA 4IM2A 4B9QA 4P4OA 4K98A 5DBBA 1XSNA 3C5FA 1ZQFA 5CR0A 3AQMA 1ZQIA 1GPJA 4X4PA 3T48A 1O7DB 5HRIA 2EFKA 3CKDA 2ZH9A 2PY6A 4XUSA 8ICFA 9ICWA 2PFNA 5DB7A 4X4VA 4UAWA 3D50A 1E1DA 4D8JA 1ZQJA 9ICFA 5J2AA 4Z6CA 3ISCA 9ICVA 4RWNA 1TQWA 1ZQVA 4ATBB 1UEVA 3PLTA 3DX4A 1YWMA 3GDXA 1ZQEA 4YN4A 5B3PA 1QX1A 4UAYA 4UB2A 1SU6A 2OW7A 5KBPA 2PFOA 4FZPA 9ICCA 3AU2A 4EZVA 4XA5A 1JAJA 1X03A 4NQIA 4WC2A 7ICNA 1BPEA 1SU7A 3HAJA 4S3NA 1BPBA 3B52X 3C7NA 5J0SA 2YL9A 1YLQA 5TZVA 5HHIA 3CZNA 3EJTA 3I04A 5J2GA 3OUYB 4JN4A 3JPSA 1ZQGA 4MFFA 2JNKA 5J2KA 5TKYA 8ICSA 3RJJA 1UETA 3G9GA 3JCFA 2OZNB 3AQNA 2HN2A 5DDYA 4IQUA 3BUPA 4LEWA 4DOBA 4HX0A 4JL9A 2HHPA 4F5PA 4IWOA 3HAHA 9ICQA 4EEDA 5D49A 4R5GA 1I4LA 3BVXA 1ZQDA 4AZGA 2X5CA 2D4CA 3D51A 4E81A 3C18A 5BPCA 1ZQTA 4KLLA 3ACOA 4KLQA 4WPEA 5IIIA 3BUIA 1ZQAA 4RQ1A 2ND0A 1MIYA 4NXWA 1ZQNA 1Y2OA 4AZHA 2PMRA 2HN1A 4EZNA 8ICXA 9ICTA 7ICKA 1KDHA 4UB4A 3HJ1A 4KLTA 2O1PA 4RT3A 3Q84A 4Z6FA 5HR9A 4FH3A 2ALWA 5EOZA 4K99A 4KLDA 4X4UA 4QZCA 3QA8A 2OBMA 3RJGA 5J29A 5IIMA 3LK9A 3QE6A 4IWQA 3TFRA 7ICJA 4FH5A 2BPGA 2MI7A 3EJUA 4FHPA 3KDRA 3K7DA 3I39X 4ATMA 8ICIA 4WQLA 4PPXA 4WQKA 2FICA 8ICVA 3AQLA 3QNJA 3CK6A 4NY8A 1QWNA 2BE3A 1ZQKA 4HR1B 1ZQXA 5CFUA 3ABHA 5IINA 1SUFA 3I01A 5HRDA 3JPTA 1E9VA 4M9GA 3EJSA 3HAIA 3RH4A 4QZBA 5J0YA 4E3CA 4UB1A 3D2EA 4JWCA 4WC6A 3V7JA 4I1QA 4KLEA 5DECA 4EZZA 2KHOA 1GNTA 2GWSA 2QFFA 4E7XA 3OVAA 2O0I1 4MFAA 4JLCA 3D4ZA 4M47A 4UDYX 2ZHBA 4DOCA 4JNFA 5J2EA 4MF2A 4AZ6A 5DBAA 1ZQCA 5B3QA 3LMFA 2V0OA 1BPDA 4KLIA 3WFRE 4NM1A 4PHAA 4PGYA 4KLHA 3CV5A 4R5JA 3D2FA 3ER9B 5HRBA 3MGHA 4R63A 3HW8A 2X3WA 3WFSC 8ICPA 8ICRA 3NWIA 1HTYA 3KAVA 2IHOA 3DPOA 3BVTA 1ZQZA 5J2IA 9ICJA 4UD5A 4PGQA 3M3WA 2PXIA 3QNIA 8ICLA 4EP7A 5FLEX 4RQ7A 4X0AA 9ICHA 4I2HA 7ICGA 3UXOA 1WDZA 4O69A 5J2DA 4IQVA 4I2IA 3T49A 4XRHA 2YL6A 5J0XA 2YLLA 4R65A 2BCRA 7ICRA 5DDMA 4QZHA 4UBCA 9ICRA 3VEAA 2F7QA 1DKYA 1O7DC 3DX1A 1V4AA 4RWPA 1RPLA 2BCUA 3B0YA 8ICYA 5HC9A 2B56A 1ZJNA 3L3OM 4K4GA 3T46A 4AZIA 3C5GA 4GXKA 3DX0A 1TQUA 8ICBA 1PS3A 4O67A 2DR5A 3ERCC 1ZJMA 4YD1A 4JLZA 2GAFD 2OW6A 2ZH7A 4AT8A 4O5KA 4X4OA 2F1AA 4Z6EA 3PMNA 4PHPA 2ND1A 2QKWA 3HX0A 2ZH5A 4F5OA 1I4TA 1ZQLA 1ZQMA 8ICKA 5CHGA 5J0TA 3JPOA 4DOAA 1R8AA 4H6IA 3SOGA 4LZDA 4NXVA 3UQ2A 4EZSA 4LEZA 1JN3A 1OU5A 1DKXA 5DKWA 2P66A 3L9DA 4WBZA 4FO1A 1ZQPA 1LQ7A 1OAOA 1R34A 3RJHA 4QZFA 3K75D 1ZQUA 4X4RA 3DX3A 4XQ8A 3WFOA 4HR1A 4QZ9A 1UEUA 2BCVA 1F5AA 3RJEA 2F18A 4EZPA 4OAIZ 3RV1A 7ICLA 4EZXA 9ICGA 1ZQQA 1JQRA 4AZ7A 3UITA 4F5QA 1ZQRA 3MBYA 8ICAA 4F01A 4K9AA 4H6HA 2M2WA 5DB8A 3CZSA 3ISBA 4NXTA 2ZH3A 2F7PA 3UPQA 5IILA 3WFPA 3VKHA 2GF4A 2O5AA 5HRGA 8ICMA 4AKVA 4AT7B 2YIVX 5HHHA 2M2VA 2FMPA 2W9MA 2YL8A 3B51X 3PNCA 3NVOA 2WYHA 2WINM 2FMQA 2OO2A 1FA0A 2RAJA 4I2BA 4WH5A 5J2JA 3CVRA 4UAZA 4FO6A 9ICXA 2D1LA 5C5BA 9ICAA 3BUDA 4NKTA 3T4AG 3ISDA 2RFFA 2ZH1A 3SYVA 3OV7A 3LLLA 5JTGA 2ZHAA 8ICOA 2WYIA 5F2VO 4UB3A 4NLZA 2ID1A 4UBBA 3F7WA 5HRKA 4AZCB 5D61A 4EZRA 2BCSA 7ICIA 8ICTA 4I28A 3EF2A 3NYBA 4KIKB 3V7KA 2IUBA 1HXKA 2DRBA 4LZGA 4IG8A 5CB1A 4RQ4A 9ICBA 5J2FA 3I2WA 4WC3A 3FD9A 5DB6A 3ZEDA 4AT9B 9ICLA 3OK8A 4PGXA 4WC7A 4JWNA 2B4VA 1R33A 5CWRA 5HREA 5E84A 5D62A 5J0WA 1ZQOA 4WC0A 7ICUA 2FYVA 2Z0VA 4WBYA 4EZTA 3EJQA 4I2AA 4R66A 3JPNA 4IM3A 2ZH8A 1ZQBA 3JPQA 4I29A 3H37A 3HIYA 3BVVA 1TQSA 9ICMA 5D63A 9ICOA 4O5CA 5IIOA 4RQ5A 1MIWA 1W9MA 3DPQA 5BOLA 2F1BA 1HUZA 4K96A 4F5NA 4NKUA 4WC5A 3RJFA 9ICIA 3RJIA 3JZ0A 1GNLA 1TQVA 3JPRA 4R5IA 4ATBA 5FIGA 4FHVA 4PH5A 3TFSA 7ICEA 4RT2A 4N7RA 4TUQA 3KAWA 1TFWA 4AZ5A 3MCRA 9ICKA 4LEVA 5J0PA 5J0RA 8ICQA 4QZDA 3AU6A 4KB6A 2DVIA 4R64A 4M9LA 2YL5A 3BVWA 9ICPA 4QZAA 2LM0A 4X4TA 2RAKA 4I2EA 2DR9A 3OUYA 1QWUA 3OVSA 4KM5A 4LEYA 1TV9A 3WFQE 4LT6A 9ICNA 4XQ7A 5J2BA 2ZH2A 5DB9A 1TVAA 4AT7A 4KLSA 5CP2A 4EZUA 2EWRA 5CA7A 2BPFA 4NSWA 4OAGA 4O6AA 2DR7A 2M2UA 1ZWWA 4HYBA 2Q66A 3RPMA 3D52A 4G6QA 3RV0A 1BPXA 4KLJA 3MDAA 2YI9A 4EBKA 1BPYA 4P4PA 3RH6A 4KLUA 2ZXQA 1KEJA 4X0BA 2ISPA 4GXJA 3V7LA 5CJ7A 4RQ8A 4IWPA 4EZYA 5D46A 9ICEA 4O68A 3H3AA 3DYTA 2FCLA 2F7OA 4WC1A 7ICFA 3RH5A 4P2HA 7ICSA 4JWEA 4M5DA 4NXZA 2GA9D 1MIVA 2ZH4A 4YD2A 4HY9A 3H38A 3CAZA 4NLNA 4H8SA 4UDXX 4JWIA 4RQ6A 4RWOA 2LXYA 2RT6A 3LQCB 4K4IA 1ZQHA 1U00A 1I4DA 2Z0NA 4K9BA 4MF8A 3O3NB 1JMSA 1Q78A 4X5VA 4WOYA 3OVBA 5HRHA 1ZQYA 3V72A 1R5EA 3RJKA 3DDFA 4O9MA 8ICJA 4JLXA 3O3MB 5CHEA 4QZ8A 4EGWA 2X3VA 2JNSA 1KNYA 4RWQA 3UPSA 4KLFA 3L3PA 4DYLA 4FHWA 4K8VA 1MJGA 2ELBA 2BPCA 2IHMA 4M2YA 2I9GA 3NKUA 2B51A 4IW0A 1OA1A 1SU8A 3C2KA 3LVTA 4E80A 4M0MA 1ZQSA 2Z8YA 4UD4A 4M0AA 4RPYA 3A98A 1RZTA 4O5EA 4YMNA 9ICUA 2YI8A 3C2MA 4RQ3A 4BNEA 1MQ3A 4I27A 4AZBA 4WC4A 5J0QA 1MQ2A 4R5KA 4TUPA 7ICOA 1E2UA 2Q13A 4DO9A 5CFSA 4I2JA 2YLAA 2BCQA 4RQ0A 3B0XA 4K97A 1I49A 2ZH6A 4FHYA 4I2FA 4MKPA 1TQTA 4F5RA 4WPCA 3OHXM 1PX5A 2EWFA 3DDGA 5DEDA 3O3OB 3AUOA 4JWMA 3QWEA 7ICPA 3EJRA 4F00A 1Q79A 4M9NA 9ICSA 3T47A 1R89A 8ICCA 3H39A 1DKZA 4RPXA 4X4NA 2RAIA 2EX3B 4RPZA 3D4YA 2F7RA 4JWDA 4NM2A 1HUOA 3JPPA 3AQKA 5J2HA 4OAHA 2Q12A 4QZIA 5IIKA 4YMMA 4P4MA 7ICHA 2PBEA 4AT8B 3C66A 4YMOA 4IM0A 1ZYLA 2YIAA 3Q0KA 4YCXA 1TFYA 2C08A 3VEBA 1WOTA 4E8FA 4KLMA 4NLKA 3UXNA 4FZSA 2DR8A 1XSLA 8ICUA 5DBCA 5HRFA 3BVUA 2EFLA 5BOMA 2BBJA 4X4SA 4DCNC 4GXIA 1GN9A 4NXUA 5J2CA 3OGUA 1XSPA 5CFTA 3OWGA 2YIBA 4QZGA 4R5LA 8ICGA 2M2TA 3BUQA 3UXPA 5D4BA 1VFGA 3DPPA 4I2DA 7ICMA 2N3KA 4FHXA 1NO5A 1JQKA 4PO2A 3GI7A 1BPZA 1X04A 7ICTA 4RQ2A 4EZOA 4OAFA 3C2LA 8ICWA 1OA0A 3DX2A 2NCZA 1R8BA 2X3XA 3UQ0A 1R8CA 2YKTA 8ICHA 7ICVA 4WCWA 4TUSA 4K4HA 4IQTA 4I0UA 2PFPA 4M04A 4PHDA 2PFQA 1UPXA 2BBHA 4KLOA 5C5BB 2OBLA 3B53X 4JNEA 3PHZA 3PMLA 3EJPA 3MDCA 4KLGA 1URUA 2Z0OA 4M9JA 7ICQA 4NPHA 4MFCA 3JYYA 2FMSA 2NRKA 1HWWA 4NXXA 4TURA 2DRAA 8ICNA 4FM3A 4PHEA 4UB5A 3MGIA 2QXLA 1ZQWA 4M9HA 4AZCA 3ER8C 5IIJA 4AVMA 1VJ7A 5J0UA 1NOMA 2VANA 4I2GA 4KIKA 3BLBA 4X4QA 4QZEA 8ICZA 3HJ4A 4I2CA 4IQWA 4EBJA 4LVSA 3BUBA 4Z6DA 4EV6A 4XJEA 2ISOA 8ICEA 3HWTA 5HRLA 4AT9A
chains in the Genus database with same CATH topology
4M0MA 4JNFA 2Z8YA 4EZWA 2B4VA 3A98A 4EZQA 5E84A 5D62A 5B3QA 3LMFA 4IM2A 4B9QA 2YI8A 4K98A 4R5JA 3D2FA 4EZTA 3ER9B 1GPJA 3T48A 4R5KA 4IM3A 2PY6A 1E2UA 3KAVA 5D63A 2IHOA 3DPOA 5CFSA 1E1DA 4D8JA 1W9MA 3DPQA 4K97A 4K96A 5FLEX 4MKPA 1GNLA 4R5IA 4O69A 5B3PA 3OHXM 2EWFA 1SU6A 3O3OB 5FIGA 4EZVA 4F00A 3T49A 3T47A 4N7RA 3KAWA 1DKZA 3VEAA 1SU7A 1DKYA 2EX3B 3MCRA 4LEVA 3B52X 4JWDA 3C7NA 4KB6A 2B56A 3L3OM 4OAHA 3T46A 3I04A 2LM0A 4JN4A 4O67A 3ERCC 4KM5A 4JLZA 2GAFD 4LEYA 4IM0A 5TKYA 1ZYLA 2YIAA 3VEBA 2ND1A 4LEWA 4HX0A 4JL9A 4IWOA 4EZUA 2EWRA 4H6IA 4NXVA 4OAGA 4O6AA 1GN9A 4HYBA 4EZSA 4NXUA 4LEZA 4R5GA 4G6QA 1DKXA 5CFTA 3OWGA 3RV0A 4FO1A 2YIBA 2X5CA 1OAOA 2YI9A 4R5LA 4E81A 4HR1A 2ND0A 3DPPA 4EZPA 4IWPA 4NXWA 4OAIZ 2N3KA 3RV1A 4EZYA 4EZXA 4EZNA 4O68A 1JQKA 3UITA 2FCLA 4PO2A 3GI7A 4F01A 4K9AA 4H6HA 4JWEA 4EZOA 4NXTA 2GA9D 4OAFA 1OA0A 2NCZA 4HY9A 3VKHA 4K99A 2YIVX 3QA8A 2OBMA 4UDXX 4JWIA 4IWQA 3B51X 2RT6A 2WINM 1U00A 3KDRA 3I39X 3K7DA 1UPXA 4WH5A 4K9BA 2OBLA 3B53X 3O3NB 4JNEA 3PHZA 4WOYA 4WQLA 4WQKA 3QNJA 3T4AG 4HR1B 4NPHA 5CFUA 4JLXA 1SUFA 3F7WA 3I01A 3O3MB 1E9VA 4NXXA 5CHEA 4FM3A 5D61A 4EZRA 2JNSA 2QXLA 3EF2A 4KIKB 3ER8C 4E3CA 3D2EA 4JWCA 4K8VA 1MJGA 4KIKA 4EZZA 2KHOA 3NKUA 1GNTA 2B51A 2QFFA 3FD9A 3ZEDA 4IW0A 1OA1A 1SU8A 4JLCA 4XJEA 4UDYX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERC C;  3ER9 B;  2GAF D;  3OWG A;  3ER8 C;  2GA9 D; 
#chains in the Genus database with same CATH topology
 5J0O A;  4EZW A;  4EEB A;  4EZQ A;  4FZO A;  4IM2 A;  4B9Q A;  4P4O A;  4K98 A;  5DBB A;  1XSN A;  3C5F A;  1ZQF A;  5CR0 A;  3AQM A;  1ZQI A;  1GPJ A;  4X4P A;  3T48 A;  1O7D B;  5HRI A;  2EFK A;  3CKD A;  2ZH9 A;  2PY6 A;  4XUS A;  8ICF A;  9ICW A;  2PFN A;  5DB7 A;  4X4V A;  4UAW A;  3D50 A;  1E1D A;  4D8J A;  1ZQJ A;  9ICF A;  5J2A A;  4Z6C A;  3ISC A;  9ICV A;  4RWN A;  1TQW A;  1ZQV A;  4ATB B;  1UEV A;  3PLT A;  3DX4 A;  1YWM A;  3GDX A;  1ZQE A;  4YN4 A;  5B3P A;  1QX1 A;  4UAY A;  4UB2 A;  1SU6 A;  2OW7 A;  5KBP A;  2PFO A;  4FZP A;  9ICC A;  3AU2 A;  4EZV A;  4XA5 A;  1JAJ A;  1X03 A;  4NQI A;  4WC2 A;  7ICN A;  1BPE A;  1SU7 A;  3HAJ A;  4S3N A;  1BPB A;  3B52 X;  3C7N A;  5J0S A;  2YL9 A;  1YLQ A;  5TZV A;  5HHI A;  3CZN A;  3EJT A;  3I04 A;  5J2G A;  3OUY B;  4JN4 A;  3JPS A;  1ZQG A;  4MFF A;  2JNK A;  5J2K A;  5TKY A;  8ICS A;  3RJJ A;  1UET A;  3G9G A;  3JCF A;  2OZN B;  3AQN A;  2HN2 A;  5DDY A;  4IQU A;  3BUP A;  4LEW A;  4DOB A;  4HX0 A;  4JL9 A;  2HHP A;  4F5P A;  4IWO A;  3HAH A;  9ICQ A;  4EED A;  5D49 A;  4R5G A;  1I4L A;  3BVX A;  1ZQD A;  4AZG A;  2X5C A;  2D4C A;  3D51 A;  4E81 A;  3C18 A;  5BPC A;  1ZQT A;  4KLL A;  3ACO A;  4KLQ A;  4WPE A;  5III A;  3BUI A;  1ZQA A;  4RQ1 A;  2ND0 A;  1MIY A;  4NXW A;  1ZQN A;  1Y2O A;  4AZH A;  2PMR A;  2HN1 A;  4EZN A;  8ICX A;  9ICT A;  7ICK A;  1KDH A;  4UB4 A;  3HJ1 A;  4KLT A;  2O1P A;  4RT3 A;  3Q84 A;  4Z6F A;  5HR9 A;  4FH3 A;  2ALW A;  5EOZ A;  4K99 A;  4KLD A;  4X4U A;  4QZC A;  3QA8 A;  2OBM A;  3RJG A;  5J29 A;  5IIM A;  3LK9 A;  3QE6 A;  4IWQ A;  3TFR A;  7ICJ A;  4FH5 A;  2BPG A;  2MI7 A;  3EJU A;  4FHP A;  3KDR A;  3K7D A;  3I39 X;  4ATM A;  8ICI A;  4WQL A;  4PPX A;  4WQK A;  2FIC A;  8ICV A;  3AQL A;  3QNJ A;  3CK6 A;  4NY8 A;  1QWN A;  2BE3 A;  1ZQK A;  4HR1 B;  1ZQX A;  5CFU A;  3ABH A;  5IIN A;  1SUF A;  3I01 A;  5HRD A;  3JPT A;  1E9V A;  4M9G A;  3EJS A;  3HAI A;  3RH4 A;  4QZB A;  5J0Y A;  4E3C A;  4UB1 A;  3D2E A;  4JWC A;  4WC6 A;  3V7J A;  4I1Q A;  4KLE A;  5DEC A;  4EZZ A;  2KHO A;  1GNT A;  2GWS A;  2QFF A;  4E7X A;  3OVA A;  2O0I 1;  4MFA A;  4JLC A;  3D4Z A;  4M47 A;  4UDY X;  2ZHB A;  4DOC A;  4JNF A;  5J2E A;  4MF2 A;  4AZ6 A;  5DBA A;  1ZQC A;  5B3Q A;  3LMF A;  2V0O A;  1BPD A;  4KLI A;  3WFR E;  4NM1 A;  4PHA A;  4PGY A;  4KLH A;  3CV5 A;  4R5J A;  3D2F A;  3ER9 B;  5HRB A;  3MGH A;  4R63 A;  3HW8 A;  2X3W A;  3WFS C;  8ICP A;  8ICR A;  3NWI A;  1HTY A;  3KAV A;  2IHO A;  3DPO A;  3BVT A;  1ZQZ A;  5J2I A;  9ICJ A;  4UD5 A;  4PGQ A;  3M3W A;  2PXI A;  3QNI A;  8ICL A;  4EP7 A;  5FLE X;  4RQ7 A;  4X0A A;  9ICH A;  4I2H A;  7ICG A;  3UXO A;  1WDZ A;  4O69 A;  5J2D A;  4IQV A;  4I2I A;  3T49 A;  4XRH A;  2YL6 A;  5J0X A;  2YLL A;  4R65 A;  2BCR A;  7ICR A;  5DDM A;  4QZH A;  4UBC A;  9ICR A;  3VEA A;  2F7Q A;  1DKY A;  1O7D C;  3DX1 A;  1V4A A;  4RWP A;  1RPL A;  2BCU A;  3B0Y A;  8ICY A;  5HC9 A;  2B56 A;  1ZJN A;  3L3O M;  4K4G A;  3T46 A;  4AZI A;  3C5G A;  4GXK A;  3DX0 A;  1TQU A;  8ICB A;  1PS3 A;  4O67 A;  2DR5 A;  3ERC C;  1ZJM A;  4YD1 A;  4JLZ A;  2GAF D;  2OW6 A;  2ZH7 A;  4AT8 A;  4O5K A;  4X4O A;  2F1A A;  4Z6E A;  3PMN A;  4PHP A;  2ND1 A;  2QKW A;  3HX0 A;  2ZH5 A;  4F5O A;  1I4T A;  1ZQL A;  1ZQM A;  8ICK A;  5CHG A;  5J0T A;  3JPO A;  4DOA A;  1R8A A;  4H6I A;  3SOG A;  4LZD A;  4NXV A;  3UQ2 A;  4EZS A;  4LEZ A;  1JN3 A;  1OU5 A;  1DKX A;  5DKW A;  2P66 A;  3L9D A;  4WBZ A;  4FO1 A;  1ZQP A;  1LQ7 A;  1OAO A;  1R34 A;  3RJH A;  4QZF A;  3K75 D;  1ZQU A;  4X4R A;  3DX3 A;  4XQ8 A;  3WFO A;  4HR1 A;  4QZ9 A;  1UEU A;  2BCV A;  1F5A A;  3RJE A;  2F18 A;  4EZP A;  4OAI Z;  3RV1 A;  7ICL A;  4EZX A;  9ICG A;  1ZQQ A;  1JQR A;  4AZ7 A;  3UIT A;  4F5Q A;  1ZQR A;  3MBY A;  8ICA A;  4F01 A;  4K9A A;  4H6H A;  2M2W A;  5DB8 A;  3CZS A;  3ISB A;  4NXT A;  2ZH3 A;  2F7P A;  3UPQ A;  5IIL A;  3WFP A;  3VKH A;  2GF4 A;  2O5A A;  5HRG A;  8ICM A;  4AKV A;  4AT7 B;  2YIV X;  5HHH A;  2M2V A;  2FMP A;  2W9M A;  2YL8 A;  3B51 X;  3PNC A;  3NVO A;  2WYH A;  2WIN M;  2FMQ A;  2OO2 A;  1FA0 A;  2RAJ A;  4I2B A;  4WH5 A;  5J2J A;  3CVR A;  4UAZ A;  4FO6 A;  9ICX A;  2D1L A;  5C5B A;  9ICA A;  3BUD A;  4NKT A;  3T4A G;  3ISD A;  2RFF A;  2ZH1 A;  3SYV A;  3OV7 A;  3LLL A;  5JTG A;  2ZHA A;  8ICO A;  2WYI A;  5F2V O;  4UB3 A;  4NLZ A;  2ID1 A;  4UBB A;  3F7W A;  5HRK A;  4AZC B;  5D61 A;  4EZR A;  2BCS A;  7ICI A;  8ICT A;  4I28 A;  3EF2 A;  3NYB A;  4KIK B;  3V7K A;  2IUB A;  1HXK A;  2DRB A;  4LZG A;  4IG8 A;  5CB1 A;  4RQ4 A;  9ICB A;  5J2F A;  3I2W A;  4WC3 A;  3FD9 A;  5DB6 A;  3ZED A;  4AT9 B;  9ICL A;  3OK8 A;  4PGX A;  4WC7 A;  4JWN A;  2B4V A;  1R33 A;  5CWR A;  5HRE A;  5E84 A;  5D62 A;  5J0W A;  1ZQO A;  4WC0 A;  7ICU A;  2FYV A;  2Z0V A;  4WBY A;  4EZT A;  3EJQ A;  4I2A A;  4R66 A;  3JPN A;  4IM3 A;  2ZH8 A;  1ZQB A;  3JPQ A;  4I29 A;  3H37 A;  3HIY A;  3BVV A;  1TQS A;  9ICM A;  5D63 A;  9ICO A;  4O5C A;  5IIO A;  4RQ5 A;  1MIW A;  1W9M A;  3DPQ A;  5BOL A;  2F1B A;  1HUZ A;  4K96 A;  4F5N A;  4NKU A;  4WC5 A;  3RJF A;  9ICI A;  3RJI A;  3JZ0 A;  1GNL A;  1TQV A;  3JPR A;  4R5I A;  4ATB A;  5FIG A;  4FHV A;  4PH5 A;  3TFS A;  7ICE A;  4RT2 A;  4N7R A;  4TUQ A;  3KAW A;  1TFW A;  4AZ5 A;  3MCR A;  9ICK A;  4LEV A;  5J0P A;  5J0R A;  8ICQ A;  4QZD A;  3AU6 A;  4KB6 A;  2DVI A;  4R64 A;  4M9L A;  2YL5 A;  3BVW A;  9ICP A;  4QZA A;  2LM0 A;  4X4T A;  2RAK A;  4I2E A;  2DR9 A;  3OUY A;  1QWU A;  3OVS A;  4KM5 A;  4LEY A;  1TV9 A;  3WFQ E;  4LT6 A;  9ICN A;  4XQ7 A;  5J2B A;  2ZH2 A;  5DB9 A;  1TVA A;  4AT7 A;  4KLS A;  5CP2 A;  4EZU A;  2EWR A;  5CA7 A;  2BPF A;  4NSW A;  4OAG A;  4O6A A;  2DR7 A;  2M2U A;  1ZWW A;  4HYB A;  2Q66 A;  3RPM A;  3D52 A;  4G6Q A;  3RV0 A;  1BPX A;  4KLJ A;  3MDA A;  2YI9 A;  4EBK A;  1BPY A;  4P4P A;  3RH6 A;  4KLU A;  2ZXQ A;  1KEJ A;  4X0B A;  2ISP A;  4GXJ A;  3V7L A;  5CJ7 A;  4RQ8 A;  4IWP A;  4EZY A;  5D46 A;  9ICE A;  4O68 A;  3H3A A;  3DYT A;  2FCL A;  2F7O A;  4WC1 A;  7ICF A;  3RH5 A;  4P2H A;  7ICS A;  4JWE A;  4M5D A;  4NXZ A;  2GA9 D;  1MIV A;  2ZH4 A;  4YD2 A;  4HY9 A;  3H38 A;  3CAZ A;  4NLN A;  4H8S A;  4UDX X;  4JWI A;  4RQ6 A;  4RWO A;  2LXY A;  2RT6 A;  3LQC B;  4K4I A;  1ZQH A;  1U00 A;  1I4D A;  2Z0N A;  4K9B A;  4MF8 A;  3O3N B;  1JMS A;  1Q78 A;  4X5V A;  4WOY A;  3OVB A;  5HRH A;  1ZQY A;  3V72 A;  1R5E A;  3RJK A;  3DDF A;  4O9M A;  8ICJ A;  4JLX A;  3O3M B;  5CHE A;  4QZ8 A;  4EGW A;  2X3V A;  2JNS A;  1KNY A;  4RWQ A;  3UPS A;  4KLF A;  3L3P A;  4DYL A;  4FHW A;  4K8V A;  1MJG A;  2ELB A;  2BPC A;  2IHM A;  4M2Y A;  2I9G A;  3NKU A;  2B51 A;  4IW0 A;  1OA1 A;  1SU8 A;  3C2K A;  3LVT A;  4E80 A;  4M0M A;  1ZQS A;  2Z8Y A;  4UD4 A;  4M0A A;  4RPY A;  3A98 A;  1RZT A;  4O5E A;  4YMN A;  9ICU A;  2YI8 A;  3C2M A;  4RQ3 A;  4BNE A;  1MQ3 A;  4I27 A;  4AZB A;  4WC4 A;  5J0Q A;  1MQ2 A;  4R5K A;  4TUP A;  7ICO A;  1E2U A;  2Q13 A;  4DO9 A;  5CFS A;  4I2J A;  2YLA A;  2BCQ A;  4RQ0 A;  3B0X A;  4K97 A;  1I49 A;  2ZH6 A;  4FHY A;  4I2F A;  4MKP A;  1TQT A;  4F5R A;  4WPC A;  3OHX M;  1PX5 A;  2EWF A;  3DDG A;  5DED A;  3O3O B;  3AUO A;  4JWM A;  3QWE A;  7ICP A;  3EJR A;  4F00 A;  1Q79 A;  4M9N A;  9ICS A;  3T47 A;  1R89 A;  8ICC A;  3H39 A;  1DKZ A;  4RPX A;  4X4N A;  2RAI A;  2EX3 B;  4RPZ A;  3D4Y A;  2F7R A;  4JWD A;  4NM2 A;  1HUO A;  3JPP A;  3AQK A;  5J2H A;  4OAH A;  2Q12 A;  4QZI A;  5IIK A;  4YMM A;  4P4M A;  7ICH A;  2PBE A;  4AT8 B;  3C66 A;  4YMO A;  4IM0 A;  1ZYL A;  2YIA A;  3Q0K A;  4YCX A;  1TFY A;  2C08 A;  3VEB A;  1WOT A;  4E8F A;  4KLM A;  4NLK A;  3UXN A;  4FZS A;  2DR8 A;  1XSL A;  8ICU A;  5DBC A;  5HRF A;  3BVU A;  2EFL A;  5BOM A;  2BBJ A;  4X4S A;  4DCN C;  4GXI A;  1GN9 A;  4NXU A;  5J2C A;  3OGU A;  1XSP A;  5CFT A;  3OWG A;  2YIB A;  4QZG A;  4R5L A;  8ICG A;  2M2T A;  3BUQ A;  3UXP A;  5D4B A;  1VFG A;  3DPP A;  4I2D A;  7ICM A;  2N3K A;  4FHX A;  1NO5 A;  1JQK A;  4PO2 A;  3GI7 A;  1BPZ A;  1X04 A;  7ICT A;  4RQ2 A;  4EZO A;  4OAF A;  3C2L A;  8ICW A;  1OA0 A;  3DX2 A;  2NCZ A;  1R8B A;  2X3X A;  3UQ0 A;  1R8C A;  2YKT A;  8ICH A;  7ICV A;  4WCW A;  4TUS A;  4K4H A;  4IQT A;  4I0U A;  2PFP A;  4M04 A;  4PHD A;  2PFQ A;  1UPX A;  2BBH A;  4KLO A;  5C5B B;  2OBL A;  3B53 X;  4JNE A;  3PHZ A;  3PML A;  3EJP A;  3MDC A;  4KLG A;  1URU A;  2Z0O A;  4M9J A;  7ICQ A;  4NPH A;  4MFC A;  3JYY A;  2FMS A;  2NRK A;  1HWW A;  4NXX A;  4TUR A;  2DRA A;  8ICN A;  4FM3 A;  4PHE A;  4UB5 A;  3MGI A;  2QXL A;  1ZQW A;  4M9H A;  4AZC A;  3ER8 C;  5IIJ A;  4AVM A;  1VJ7 A;  5J0U A;  1NOM A;  2VAN A;  4I2G A;  4KIK A;  3BLB A;  4X4Q A;  4QZE A;  8ICZ A;  3HJ4 A;  4I2C A;  4IQW A;  4EBJ A;  4LVS A;  3BUB A;  4Z6D A;  4EV6 A;  4XJE A;  2ISO A;  8ICE A;  3HWT A;  5HRL A;  4AT9 A; 
#chains in the Genus database with same CATH homology
 4M0M A;  4JNF A;  2Z8Y A;  4EZW A;  2B4V A;  3A98 A;  4EZQ A;  5E84 A;  5D62 A;  5B3Q A;  3LMF A;  4IM2 A;  4B9Q A;  2YI8 A;  4K98 A;  4R5J A;  3D2F A;  4EZT A;  3ER9 B;  1GPJ A;  3T48 A;  4R5K A;  4IM3 A;  2PY6 A;  1E2U A;  3KAV A;  5D63 A;  2IHO A;  3DPO A;  5CFS A;  1E1D A;  4D8J A;  1W9M A;  3DPQ A;  4K97 A;  4K96 A;  5FLE X;  4MKP A;  1GNL A;  4R5I A;  4O69 A;  5B3P A;  3OHX M;  2EWF A;  1SU6 A;  3O3O B;  5FIG A;  4EZV A;  4F00 A;  3T49 A;  3T47 A;  4N7R A;  3KAW A;  1DKZ A;  3VEA A;  1SU7 A;  1DKY A;  2EX3 B;  3MCR A;  4LEV A;  3B52 X;  4JWD A;  3C7N A;  4KB6 A;  2B56 A;  3L3O M;  4OAH A;  3T46 A;  3I04 A;  2LM0 A;  4JN4 A;  4O67 A;  3ERC C;  4KM5 A;  4JLZ A;  2GAF D;  4LEY A;  4IM0 A;  5TKY A;  1ZYL A;  2YIA A;  3VEB A;  2ND1 A;  4LEW A;  4HX0 A;  4JL9 A;  4IWO A;  4EZU A;  2EWR A;  4H6I A;  4NXV A;  4OAG A;  4O6A A;  1GN9 A;  4HYB A;  4EZS A;  4NXU A;  4LEZ A;  4R5G A;  4G6Q A;  1DKX A;  5CFT A;  3OWG A;  3RV0 A;  4FO1 A;  2YIB A;  2X5C A;  1OAO A;  2YI9 A;  4R5L A;  4E81 A;  4HR1 A;  2ND0 A;  3DPP A;  4EZP A;  4IWP A;  4NXW A;  4OAI Z;  2N3K A;  3RV1 A;  4EZY A;  4EZX A;  4EZN A;  4O68 A;  1JQK A;  3UIT A;  2FCL A;  4PO2 A;  3GI7 A;  4F01 A;  4K9A A;  4H6H A;  4JWE A;  4EZO A;  4NXT A;  2GA9 D;  4OAF A;  1OA0 A;  2NCZ A;  4HY9 A;  3VKH A;  4K99 A;  2YIV X;  3QA8 A;  2OBM A;  4UDX X;  4JWI A;  4IWQ A;  3B51 X;  2RT6 A;  2WIN M;  1U00 A;  3KDR A;  3I39 X;  3K7D A;  1UPX A;  4WH5 A;  4K9B A;  2OBL A;  3B53 X;  3O3N B;  4JNE A;  3PHZ A;  4WOY A;  4WQL A;  4WQK A;  3QNJ A;  3T4A G;  4HR1 B;  4NPH A;  5CFU A;  4JLX A;  1SUF A;  3F7W A;  3I01 A;  3O3M B;  1E9V A;  4NXX A;  5CHE A;  4FM3 A;  5D61 A;  4EZR A;  2JNS A;  2QXL A;  3EF2 A;  4KIK B;  3ER8 C;  4E3C A;  3D2E A;  4JWC A;  4K8V A;  1MJG A;  4KIK A;  4EZZ A;  2KHO A;  3NKU A;  1GNT A;  2B51 A;  2QFF A;  3FD9 A;  3ZED A;  4IW0 A;  1OA1 A;  1SU8 A;  4JLC A;  4XJE A;  4UDY X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...