3ER8C

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with two fragments of rna
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna, rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
total genus 122
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er8C01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er8C03
3ER8C 2GAFD 3ER9B 3ERCC 2GA9D 3OWGA
chains in the Genus database with same CATH superfamily
7ICNA 4WC0A 3BVXA 5DBCA 8ICFA 4NSWA 4LZGA 2ALWA 3UQ2A 8ICQA 1ZQFA 2PXIA 1JQKA 3BUQA 1HUZA 3L3OM 4IWOA 4RT2A 4H8SA 4RWQA 4X4PA 1PX5A 4PHAA 3F7WA 2ZH8A 4NLZA 2ELBA 1Q78A 4QZDA 3LQCB 3I2WA 3KDRA 3H39A 4JWCA 5IIMA 4N7RA 4I2GA 4IQWA 3PMNA 3T47A 4I2DA 3HAIA 1ZQOA 8ICCA 3B53X 4KLGA 2D1LA 1QWNA 3RH6A 1XSNA 1ZQIA 3ZEDA 3K7DA 4O68A 4M9JA 5J0PA 3ISCA 4MFFA 2BCQA 3HAJA 4HY9A 1BPBA 3JPSA 4O69A 5FLEX 4EZOA 8ICKA 4RPXA 4E3CA 4MFAA 1KDHA 2MI7A 4JNEA 4F5PA 2LM0A 4EZUA 4PHDA 4EZTA 5C5BB 4IM0A 3QA8A 1TQVA 1MIWA 3OUYA 2P66A 3D4YA 3LMFA 4XRHA 4RQ0A 4XQ8A 1YWMA 3KAWA 5J2DA 5J2FA 3RJGA 5DEDA 4P2HA 3ACOA 1GPJA 2IUBA 2M2VA 3G9GA 2EWFA 2YKTA 5HRIA 4UB1A 3AUOA 8ICHA 4MF2A 4F5QA 3ER8C 2DR7A 2B51A 5DDMA 1ZQSA 2Z0OA 1NO5A 4AZ6A 3EJQA 5J2IA 3H3AA 4EZVA 2FMPA 2JNKA 1QWUA 3RV0A 2WYIA 2OW6A 1ZQTA 5J2BA 2ZH9A 4EBJA 4M9HA 4LZDA 1W9MA 2C08A 4EZRA 4UD5A 1HXKA 1MQ2A 2BCUA 9ICKA 3OVBA 4OAFA 4MKPA 4IWPA 1ZQEA 4NY8A 4AZCB 4DO9A 4LEVA 4XUSA 2NCZA 4FO6A 3K75D 5KBPA 3JPTA 1OAOA 4AZIA 4KLQA 2LXYA 3BVTA 4FZOA 5DB9A 3ISBA 2O0I1 4O5CA 4WC3A 4PGYA 1TQSA 1ZQWA 3ER9B 2BPCA 3UXPA 4E8FA 3OK8A 4FZSA 2BCSA 2FMSA 1MIYA 4WC2A 7ICFA 2Z0VA 3UPSA 8ICTA 4AKVA 5TKYA 5HRFA 1UPXA 4K9AA 8ICLA 7ICMA 3OGUA 1BPYA 8ICUA 1O7DC 4TUQA 8ICRA 5J2KA 1VFGA 4KLEA 2JNSA 8ICGA 5DB8A 5DBBA 4AT7B 3NVOA 5IINA 4KLIA 1YLQA 4MFCA 3LK9A 1F5AA 1GN9A 2QFFA 3L3PA 1TV9A 2YIBA 3JYYA 7ICQA 4P4MA 1R8AA 3C7NA 4NM1A 2YI8A 2ZHAA 2HN1A 4RQ6A 3WFSC 3UPQA 4K96A 3DYTA 4O67A 1DKZA 3AU2A 1XSLA 4YMOA 5CFTA 9ICBA 2EX3B 4YD2A 9ICFA 2Z8YA 1Y2OA 2X3VA 4R5IA 4Z6EA 5BOLA 4OAIZ 4JNFA 1ZQGA 9ICWA 4EZQA 1TFYA 1FA0A 3MGHA 2NRKA 3OV7A 3AQNA 2ID1A 4NXXA 4E81A 8ICZA 9ICGA 2YIAA 4X4QA 1UETA 4P4PA 4EZZA 4EGWA 3B0XA 2O1PA 3DX3A 2ZH4A 4AZGA 5EOZA 4WC5A 2D4CA 2ND1A 1ZQDA 4KLUA 1ZQYA 3O3MB 4M0MA 4I2CA 4WOYA 2BPGA 2YI9A 4LVSA 4KLLA 4I2IA 4AT7A 3TFSA 4F01A 3QE6A 4RQ8A 3OHXM 4FHXA 4NM2A 4UB2A 4UB3A 1R33A 2WINM 2BBJA 4X5VA 4RWOA 5D46A 4X4TA 2IHOA 2I9GA 4WBZA 3UXOA 3C2KA 3FD9A 4DCNC 3DX0A 4YN4A 2ZH2A 4DOCA 3OUYB 4X4RA 4JWNA 8ICXA 8ICVA 2ND0A 3BUIA 9ICOA 1QX1A 3LLLA 7ICVA 3L9DA 4EBKA 9ICPA 3BUBA 4O5KA 2PMRA 4NXZA 4EZXA 1VJ7A 5HRDA 5DB6A 4QZ8A 2PFOA 3T4AG 4UBBA 5J0QA 5CFSA 1MIVA 2O5AA 4X0AA 1WDZA 4I27A 2WYHA 4LT6A 4JWEA 4EZSA 5DB7A 1TQWA 4R63A 3UQ0A 3BVVA 3NYBA 2PFQA 2Z0NA 4IM2A 4YD1A 3RH4A 4K4GA 1ZQUA 3WFRE 4AZ5A 1GNTA 4PPXA 9ICVA 4YMNA 1ZQAA 2RAIA 4LEZA 3PHZA 3HIYA 5IIOA 7ICUA 5CFUA 3CV5A 5HRBA 4FHPA 3A98A 4RWNA 3VKHA 8ICAA 4F00A 2F7RA 3O3NB 3NWIA 2EFKA 1OU5A 4E80A 3RJKA 3RJIA 1ZQXA 1XSPA 5HHHA 4K8VA 4I2BA 1E9VA 4EZPA 1V4AA 2OW7A 5CWRA 3UITA 4AZHA 3V7JA 1KEJA 2F7QA 1SUFA 2HHPA 5J0WA 2GWSA 2YIVX 3RJFA 4X4NA 1UEVA 1E2UA 2QXLA 5D62A 4I0UA 1R5EA 3I01A 3HJ4A 4KB6A 4H6IA 4M04A 4O9MA 2RAJA 3MCRA 9ICSA 1OA1A 4AVMA 1ZQJA 3QNJA 4EV6A 4UAZA 3JPQA 2DVIA 4O6AA 4FHWA 4M5DA 3GI7A 4XJEA 5J29A 9ICQA 4KLTA 3M3WA 3DPPA 4R5LA 5CP2A 4FM3A 4PGXA 3SYVA 1X04A 4RQ5A 4KLDA 5DKWA 3JPPA 5IILA 2PY6A 1ZJMA 4R65A 3EF2A 8ICWA 1ZQHA 3JPOA 2FYVA 7ICJA 2B56A 2X3WA 3HWTA 4QZAA 3ABHA 4K4IA 4AT8B 4KIKB 1BPDA 4G6QA 4YMMA 5J2AA 3HJ1A 9ICCA 4UAYA 5BOMA 4EEBA 3MBYA 2PBEA 2OBLA 4RQ1A 9ICTA 3D50A 4WCWA 4FZPA 4PHEA 4NKTA 3D2FA 1ZQKA 4UB4A 1I4LA 4WBYA 2BPFA 1SU8A 4IWQA 3EJSA 3BLBA 3JZ0A 4ATMA 2N3KA 2DRBA 1NOMA 4IW0A 3D51A 2VANA 3H38A 4GXIA 1R34A 4R66A 2YLLA 1HUOA 1ZQPA 4KLFA 8ICBA 7ICHA 9ICHA 3JCFA 5J2CA 7ICOA 2YL6A 4AZ7A 5DBAA 4PHPA 4K99A 3RJJA 2OO2A 4KLJA 4AT9B 4NXVA 2HN2A 4M9NA 3V7KA 2OZNB 4NQIA 9ICRA 3B0YA 4R5KA 2F1AA 4Z6DA 4F5RA 2EFLA 4RWPA 9ICNA 3B52X 5DECA 1LQ7A 2GAFD 4HX0A 4Z6CA 2ZH3A 3RH5A 4M47A 2EWRA 5E84A 2DR5A 3H37A 2GA9D 4IG8A 4AT8A 4JWDA 4KIKA 2ISOA 5J0TA 3HX0A 4X0BA 1ZQZA 2F7PA 3WFQE 2IHMA 3GDXA 7ICEA 4NXTA 3UXNA 4RPZA 2QKWA 1BPXA 4I28A 4R5GA 4QZEA 1SU7A 4TUPA 3DDGA 3C5GA 3C2MA 4JWMA 4WPCA 3AQKA 2ZXQA 4EEDA 4IM3A 3C66A 5IIIA 1R8BA 3MGIA 2BE3A 1ZQCA 8ICYA 3T46A 2F1BA 4S3NA 5J2HA 2X5CA 4M2YA 2RT6A 3V7LA 4NLKA 8ICSA 4DYLA 3VEBA 5J0RA 5J0UA 4M9LA 1JAJA 5B3QA 4M0AA 1I4DA 2GF4A 3OVSA 1ZQRA 4AZBA 4KLSA 8ICIA 4AT9A 2X3XA 3EJUA 5J0OA 4K9BA 4P4OA 3CZSA 4H6HA 1I4TA 3EJRA 3LVTA 3T49A 3CZNA 4HYBA 1TQTA 2PFNA 2F7OA 4WH5A 3TFRA 3T48A 2DR8A 7ICIA 1OA0A 4OAHA 4IQTA 9ICJA 3D52A 4FHYA 3DPQA 3HAHA 2ZH5A 2ZHBA 5HHIA 7ICRA 3HW8A 4UDYX 4YCXA 4M9GA 2Q12A 4I2JA 5HR9A 1I49A 4KLOA 2YL5A 4WC4A 2FICA 3DDFA 8ICEA 1TFWA 4WC7A 4F5NA 3OVAA 4QZGA 4PO2A 5FIGA 4LEYA 1PS3A 5J0YA 4QZFA 3NKUA 3CVRA 8ICJA 4TURA 3JPRA 4RQ2A 4EZYA 1JQRA 4KLHA 1ZQBA 5F2VO 5HREA 1DKYA 4NXWA 5HRHA 9ICLA 4UDXX 2B4VA 3C18A 4K4HA 2OBMA 5J0XA 3RPMA 1Q79A 2BCVA 4NPHA 4I29A 5CB1A 4JN4A 4UD4A 1ZQMA 1BPEA 2FMQA 5IIKA 4RT3A 1KNYA 2ZH6A 1HWWA 9ICEA 3EJPA 3BVWA 8ICMA 4I2HA 8ICOA 4IQUA 2ISPA 4ATBB 3SOGA 4WQKA 4B9QA 1JN3A 1X03A 5D4BA 1ZWWA 3KAVA 9ICUA 4JWIA 4UBCA 2BBHA 3DX2A 1ZQLA 4NXUA 3C2LA 4X4UA 2M2UA 5CHGA 2V0OA 3BUPA 3CK6A 4XQ7A 3AQMA 4JLZA 1U00A 4Z6FA 1RZTA 3PLTA 5HRKA 1URUA 5IIJA 3JPNA 3PMLA 1TVAA 2DR9A 4X4VA 3D4ZA 1WOTA 4RPYA 3O3OB 5J2GA 7ICGA 9ICXA 1SU6A 3I39X 4UB5A 4F5OA 3QWEA 9ICAA 3B51X 4K98A 2M2TA 1ZYLA 4BNEA 1ZJNA 4WQLA 2YLAA 4EZNA 5JTGA 4QZIA 4K97A 2M2WA 3DX1A 4FO1A 3V72A 2RAKA 4QZBA 2F18A 3BUDA 5TZVA 5C5BA 4I2EA 3BVUA 5HRLA 1BPZA 4ATBA 1TQUA 4RQ4A 2Q66A 3AU6A 3MDAA 4I2FA 4DOBA 1ZQNA 1MQ3A 1HTYA 3EJTA 3D2EA 4RQ3A 5J2JA 1UEUA 5D63A 4R64A 3Q84A 4I2AA 2KHOA 4DOAA 4WPEA 3MDCA 4EP7A 4JLCA 9ICIA 7ICSA 5D61A 4KLMA 5D49A 3VEAA 4X4SA 4UAWA 2BCRA 4FHVA 4HR1B 4GXKA 3C5FA 4QZCA 4WC1A 5HC9A 4LEWA 4JL9A 4IQVA 3ISDA 7ICKA 2YL8A 3DX4A 4JLXA 4QZHA 4MF8A 4EZWA 3RJHA 3AQLA 4FH3A 4PH5A 5HRGA 4AZCA 2ZH1A 1ZQVA 1GNLA 4TUSA 2RFFA 8ICPA 5CHEA 5BPCA 3RV1A 4WC6A 3I04A 3Q0KA 1O7DB 1R8CA 3WFPA 3QNIA 1MJGA 9ICMA 4E7XA 3CKDA 3WFOA 4O5EA 3ERCC 3OWGA 1E1DA 2FCLA 4GXJA 1RPLA 1DKXA 7ICLA 5CR0A 5J0SA 4PGQA 7ICTA 4R5JA 4XA5A 2ZH7A 4HR1A 2W9MA 4RQ7A 5CJ7A 2YL9A 1JMSA 5J2EA 4D8JA 2PFPA 4OAGA 2DRAA 7ICPA 2Q13A 3CAZA 3RJEA 4QZ9A 5B3PA 4KM5A 4X4OA 1ZQQA 5CA7A 1R89A 4FH5A 8ICNA 4I1QA 5DDYA 3DPOA 4NLNA 4NKUA 3PNCA
chains in the Genus database with same CATH topology
4OAIZ 4JNFA 4EZQA 3D2FA 1SU8A 4IWQA 4NXXA 4E81A 1JQKA 2N3KA 2YIAA 3L3OM 4IWOA 4IW0A 4B9QA 4WQKA 4EZZA 3KAVA 3F7WA 4JWIA 2ND1A 3KDRA 3O3MB 4M0MA 4JWCA 4K99A 4N7RA 4WOYA 3T47A 2YI9A 4NXVA 4NXUA 3B53X 4F01A 3ZEDA 3K7DA 4O68A 4R5KA 3OHXM 4JLZA 1U00A 2WINM 3B52X 4HY9A 2GAFD 4HX0A 4O69A 2EWRA 5E84A 5FLEX 4EZOA 2IHOA 2GA9D 4JWDA 4KIKA 3FD9A 3O3OB 4E3CA 1SU6A 3I39X 4JNEA 3B51X 2LM0A 4K98A 4EZUA 4EZTA 2ND0A 1ZYLA 4NXTA 4WQLA 4IM0A 4R5GA 4EZNA 4K97A 1SU7A 3QA8A 4FO1A 4EZXA 4IM3A 3LMFA 3T4AG 3KAWA 3T46A 5CFSA 2X5CA 2RT6A 1GPJA 2EWFA 4JWEA 4EZSA 3VEBA 3D2EA 3ER8C 5B3QA 4IM2A 2B51A 1GNTA 5D63A 4K9BA 4LEZA 2KHOA 3PHZA 4H6HA 3T49A 4EZVA 5CFUA 3RV0A 4HYBA 4JLCA 3A98A 3VKHA 4F00A 3O3NB 5D61A 1W9MA 3VEAA 4EZRA 4HR1B 4WH5A 3T48A 4K8VA 4OAFA 4MKPA 1E9VA 1OA0A 4IWPA 4JL9A 4EZPA 4LEWA 4OAHA 3UITA 3DPQA 4LEVA 4JLXA 4EZWA 1SUFA 2NCZA 2YIVX 1E2UA 2QXLA 1OAOA 5D62A 4UDYX 1GNLA 3I01A 5CHEA 3RV1A 4H6IA 4KB6A 3I04A 3ER9B 3MCRA 1OA1A 3QNJA 5TKYA 1UPXA 4O6AA 4PO2A 4K9AA 1MJGA 5FIGA 3GI7A 4XJEA 4LEYA 3ERCC 3DPPA 4R5LA 3NKUA 3OWGA 4FM3A 4EZYA 2JNSA 1E1DA 2FCLA 2PY6A 3EF2A 1DKYA 4NXWA 1DKXA 1GN9A 2QFFA 2B56A 4UDXX 4R5JA 2YIBA 2B4VA 4HR1A 2OBMA 3C7NA 4KIKB 4D8JA 2YI8A 4G6QA 4OAGA 4NPHA 4JN4A 5B3PA 4KM5A 4K96A 4O67A 1DKZA 2OBLA 5CFTA 2EX3B 2Z8YA 3DPOA 4R5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ER8 C;  2GAF D;  3ER9 B;  3ERC C;  2GA9 D;  3OWG A; 
#chains in the Genus database with same CATH topology
 7ICN A;  4WC0 A;  3BVX A;  5DBC A;  8ICF A;  4NSW A;  4LZG A;  2ALW A;  3UQ2 A;  8ICQ A;  1ZQF A;  2PXI A;  1JQK A;  3BUQ A;  1HUZ A;  3L3O M;  4IWO A;  4RT2 A;  4H8S A;  4RWQ A;  4X4P A;  1PX5 A;  4PHA A;  3F7W A;  2ZH8 A;  4NLZ A;  2ELB A;  1Q78 A;  4QZD A;  3LQC B;  3I2W A;  3KDR A;  3H39 A;  4JWC A;  5IIM A;  4N7R A;  4I2G A;  4IQW A;  3PMN A;  3T47 A;  4I2D A;  3HAI A;  1ZQO A;  8ICC A;  3B53 X;  4KLG A;  2D1L A;  1QWN A;  3RH6 A;  1XSN A;  1ZQI A;  3ZED A;  3K7D A;  4O68 A;  4M9J A;  5J0P A;  3ISC A;  4MFF A;  2BCQ A;  3HAJ A;  4HY9 A;  1BPB A;  3JPS A;  4O69 A;  5FLE X;  4EZO A;  8ICK A;  4RPX A;  4E3C A;  4MFA A;  1KDH A;  2MI7 A;  4JNE A;  4F5P A;  2LM0 A;  4EZU A;  4PHD A;  4EZT A;  5C5B B;  4IM0 A;  3QA8 A;  1TQV A;  1MIW A;  3OUY A;  2P66 A;  3D4Y A;  3LMF A;  4XRH A;  4RQ0 A;  4XQ8 A;  1YWM A;  3KAW A;  5J2D A;  5J2F A;  3RJG A;  5DED A;  4P2H A;  3ACO A;  1GPJ A;  2IUB A;  2M2V A;  3G9G A;  2EWF A;  2YKT A;  5HRI A;  4UB1 A;  3AUO A;  8ICH A;  4MF2 A;  4F5Q A;  3ER8 C;  2DR7 A;  2B51 A;  5DDM A;  1ZQS A;  2Z0O A;  1NO5 A;  4AZ6 A;  3EJQ A;  5J2I A;  3H3A A;  4EZV A;  2FMP A;  2JNK A;  1QWU A;  3RV0 A;  2WYI A;  2OW6 A;  1ZQT A;  5J2B A;  2ZH9 A;  4EBJ A;  4M9H A;  4LZD A;  1W9M A;  2C08 A;  4EZR A;  4UD5 A;  1HXK A;  1MQ2 A;  2BCU A;  9ICK A;  3OVB A;  4OAF A;  4MKP A;  4IWP A;  1ZQE A;  4NY8 A;  4AZC B;  4DO9 A;  4LEV A;  4XUS A;  2NCZ A;  4FO6 A;  3K75 D;  5KBP A;  3JPT A;  1OAO A;  4AZI A;  4KLQ A;  2LXY A;  3BVT A;  4FZO A;  5DB9 A;  3ISB A;  2O0I 1;  4O5C A;  4WC3 A;  4PGY A;  1TQS A;  1ZQW A;  3ER9 B;  2BPC A;  3UXP A;  4E8F A;  3OK8 A;  4FZS A;  2BCS A;  2FMS A;  1MIY A;  4WC2 A;  7ICF A;  2Z0V A;  3UPS A;  8ICT A;  4AKV A;  5TKY A;  5HRF A;  1UPX A;  4K9A A;  8ICL A;  7ICM A;  3OGU A;  1BPY A;  8ICU A;  1O7D C;  4TUQ A;  8ICR A;  5J2K A;  1VFG A;  4KLE A;  2JNS A;  8ICG A;  5DB8 A;  5DBB A;  4AT7 B;  3NVO A;  5IIN A;  4KLI A;  1YLQ A;  4MFC A;  3LK9 A;  1F5A A;  1GN9 A;  2QFF A;  3L3P A;  1TV9 A;  2YIB A;  3JYY A;  7ICQ A;  4P4M A;  1R8A A;  3C7N A;  4NM1 A;  2YI8 A;  2ZHA A;  2HN1 A;  4RQ6 A;  3WFS C;  3UPQ A;  4K96 A;  3DYT A;  4O67 A;  1DKZ A;  3AU2 A;  1XSL A;  4YMO A;  5CFT A;  9ICB A;  2EX3 B;  4YD2 A;  9ICF A;  2Z8Y A;  1Y2O A;  2X3V A;  4R5I A;  4Z6E A;  5BOL A;  4OAI Z;  4JNF A;  1ZQG A;  9ICW A;  4EZQ A;  1TFY A;  1FA0 A;  3MGH A;  2NRK A;  3OV7 A;  3AQN A;  2ID1 A;  4NXX A;  4E81 A;  8ICZ A;  9ICG A;  2YIA A;  4X4Q A;  1UET A;  4P4P A;  4EZZ A;  4EGW A;  3B0X A;  2O1P A;  3DX3 A;  2ZH4 A;  4AZG A;  5EOZ A;  4WC5 A;  2D4C A;  2ND1 A;  1ZQD A;  4KLU A;  1ZQY A;  3O3M B;  4M0M A;  4I2C A;  4WOY A;  2BPG A;  2YI9 A;  4LVS A;  4KLL A;  4I2I A;  4AT7 A;  3TFS A;  4F01 A;  3QE6 A;  4RQ8 A;  3OHX M;  4FHX A;  4NM2 A;  4UB2 A;  4UB3 A;  1R33 A;  2WIN M;  2BBJ A;  4X5V A;  4RWO A;  5D46 A;  4X4T A;  2IHO A;  2I9G A;  4WBZ A;  3UXO A;  3C2K A;  3FD9 A;  4DCN C;  3DX0 A;  4YN4 A;  2ZH2 A;  4DOC A;  3OUY B;  4X4R A;  4JWN A;  8ICX A;  8ICV A;  2ND0 A;  3BUI A;  9ICO A;  1QX1 A;  3LLL A;  7ICV A;  3L9D A;  4EBK A;  9ICP A;  3BUB A;  4O5K A;  2PMR A;  4NXZ A;  4EZX A;  1VJ7 A;  5HRD A;  5DB6 A;  4QZ8 A;  2PFO A;  3T4A G;  4UBB A;  5J0Q A;  5CFS A;  1MIV A;  2O5A A;  4X0A A;  1WDZ A;  4I27 A;  2WYH A;  4LT6 A;  4JWE A;  4EZS A;  5DB7 A;  1TQW A;  4R63 A;  3UQ0 A;  3BVV A;  3NYB A;  2PFQ A;  2Z0N A;  4IM2 A;  4YD1 A;  3RH4 A;  4K4G A;  1ZQU A;  3WFR E;  4AZ5 A;  1GNT A;  4PPX A;  9ICV A;  4YMN A;  1ZQA A;  2RAI A;  4LEZ A;  3PHZ A;  3HIY A;  5IIO A;  7ICU A;  5CFU A;  3CV5 A;  5HRB A;  4FHP A;  3A98 A;  4RWN A;  3VKH A;  8ICA A;  4F00 A;  2F7R A;  3O3N B;  3NWI A;  2EFK A;  1OU5 A;  4E80 A;  3RJK A;  3RJI A;  1ZQX A;  1XSP A;  5HHH A;  4K8V A;  4I2B A;  1E9V A;  4EZP A;  1V4A A;  2OW7 A;  5CWR A;  3UIT A;  4AZH A;  3V7J A;  1KEJ A;  2F7Q A;  1SUF A;  2HHP A;  5J0W A;  2GWS A;  2YIV X;  3RJF A;  4X4N A;  1UEV A;  1E2U A;  2QXL A;  5D62 A;  4I0U A;  1R5E A;  3I01 A;  3HJ4 A;  4KB6 A;  4H6I A;  4M04 A;  4O9M A;  2RAJ A;  3MCR A;  9ICS A;  1OA1 A;  4AVM A;  1ZQJ A;  3QNJ A;  4EV6 A;  4UAZ A;  3JPQ A;  2DVI A;  4O6A A;  4FHW A;  4M5D A;  3GI7 A;  4XJE A;  5J29 A;  9ICQ A;  4KLT A;  3M3W A;  3DPP A;  4R5L A;  5CP2 A;  4FM3 A;  4PGX A;  3SYV A;  1X04 A;  4RQ5 A;  4KLD A;  5DKW A;  3JPP A;  5IIL A;  2PY6 A;  1ZJM A;  4R65 A;  3EF2 A;  8ICW A;  1ZQH A;  3JPO A;  2FYV A;  7ICJ A;  2B56 A;  2X3W A;  3HWT A;  4QZA A;  3ABH A;  4K4I A;  4AT8 B;  4KIK B;  1BPD A;  4G6Q A;  4YMM A;  5J2A A;  3HJ1 A;  9ICC A;  4UAY A;  5BOM A;  4EEB A;  3MBY A;  2PBE A;  2OBL A;  4RQ1 A;  9ICT A;  3D50 A;  4WCW A;  4FZP A;  4PHE A;  4NKT A;  3D2F A;  1ZQK A;  4UB4 A;  1I4L A;  4WBY A;  2BPF A;  1SU8 A;  4IWQ A;  3EJS A;  3BLB A;  3JZ0 A;  4ATM A;  2N3K A;  2DRB A;  1NOM A;  4IW0 A;  3D51 A;  2VAN A;  3H38 A;  4GXI A;  1R34 A;  4R66 A;  2YLL A;  1HUO A;  1ZQP A;  4KLF A;  8ICB A;  7ICH A;  9ICH A;  3JCF A;  5J2C A;  7ICO A;  2YL6 A;  4AZ7 A;  5DBA A;  4PHP A;  4K99 A;  3RJJ A;  2OO2 A;  4KLJ A;  4AT9 B;  4NXV A;  2HN2 A;  4M9N A;  3V7K A;  2OZN B;  4NQI A;  9ICR A;  3B0Y A;  4R5K A;  2F1A A;  4Z6D A;  4F5R A;  2EFL A;  4RWP A;  9ICN A;  3B52 X;  5DEC A;  1LQ7 A;  2GAF D;  4HX0 A;  4Z6C A;  2ZH3 A;  3RH5 A;  4M47 A;  2EWR A;  5E84 A;  2DR5 A;  3H37 A;  2GA9 D;  4IG8 A;  4AT8 A;  4JWD A;  4KIK A;  2ISO A;  5J0T A;  3HX0 A;  4X0B A;  1ZQZ A;  2F7P A;  3WFQ E;  2IHM A;  3GDX A;  7ICE A;  4NXT A;  3UXN A;  4RPZ A;  2QKW A;  1BPX A;  4I28 A;  4R5G A;  4QZE A;  1SU7 A;  4TUP A;  3DDG A;  3C5G A;  3C2M A;  4JWM A;  4WPC A;  3AQK A;  2ZXQ A;  4EED A;  4IM3 A;  3C66 A;  5III A;  1R8B A;  3MGI A;  2BE3 A;  1ZQC A;  8ICY A;  3T46 A;  2F1B A;  4S3N A;  5J2H A;  2X5C A;  4M2Y A;  2RT6 A;  3V7L A;  4NLK A;  8ICS A;  4DYL A;  3VEB A;  5J0R A;  5J0U A;  4M9L A;  1JAJ A;  5B3Q A;  4M0A A;  1I4D A;  2GF4 A;  3OVS A;  1ZQR A;  4AZB A;  4KLS A;  8ICI A;  4AT9 A;  2X3X A;  3EJU A;  5J0O A;  4K9B A;  4P4O A;  3CZS A;  4H6H A;  1I4T A;  3EJR A;  3LVT A;  3T49 A;  3CZN A;  4HYB A;  1TQT A;  2PFN A;  2F7O A;  4WH5 A;  3TFR A;  3T48 A;  2DR8 A;  7ICI A;  1OA0 A;  4OAH A;  4IQT A;  9ICJ A;  3D52 A;  4FHY A;  3DPQ A;  3HAH A;  2ZH5 A;  2ZHB A;  5HHI A;  7ICR A;  3HW8 A;  4UDY X;  4YCX A;  4M9G A;  2Q12 A;  4I2J A;  5HR9 A;  1I49 A;  4KLO A;  2YL5 A;  4WC4 A;  2FIC A;  3DDF A;  8ICE A;  1TFW A;  4WC7 A;  4F5N A;  3OVA A;  4QZG A;  4PO2 A;  5FIG A;  4LEY A;  1PS3 A;  5J0Y A;  4QZF A;  3NKU A;  3CVR A;  8ICJ A;  4TUR A;  3JPR A;  4RQ2 A;  4EZY A;  1JQR A;  4KLH A;  1ZQB A;  5F2V O;  5HRE A;  1DKY A;  4NXW A;  5HRH A;  9ICL A;  4UDX X;  2B4V A;  3C18 A;  4K4H A;  2OBM A;  5J0X A;  3RPM A;  1Q79 A;  2BCV A;  4NPH A;  4I29 A;  5CB1 A;  4JN4 A;  4UD4 A;  1ZQM A;  1BPE A;  2FMQ A;  5IIK A;  4RT3 A;  1KNY A;  2ZH6 A;  1HWW A;  9ICE A;  3EJP A;  3BVW A;  8ICM A;  4I2H A;  8ICO A;  4IQU A;  2ISP A;  4ATB B;  3SOG A;  4WQK A;  4B9Q A;  1JN3 A;  1X03 A;  5D4B A;  1ZWW A;  3KAV A;  9ICU A;  4JWI A;  4UBC A;  2BBH A;  3DX2 A;  1ZQL A;  4NXU A;  3C2L A;  4X4U A;  2M2U A;  5CHG A;  2V0O A;  3BUP A;  3CK6 A;  4XQ7 A;  3AQM A;  4JLZ A;  1U00 A;  4Z6F A;  1RZT A;  3PLT A;  5HRK A;  1URU A;  5IIJ A;  3JPN A;  3PML A;  1TVA A;  2DR9 A;  4X4V A;  3D4Z A;  1WOT A;  4RPY A;  3O3O B;  5J2G A;  7ICG A;  9ICX A;  1SU6 A;  3I39 X;  4UB5 A;  4F5O A;  3QWE A;  9ICA A;  3B51 X;  4K98 A;  2M2T A;  1ZYL A;  4BNE A;  1ZJN A;  4WQL A;  2YLA A;  4EZN A;  5JTG A;  4QZI A;  4K97 A;  2M2W A;  3DX1 A;  4FO1 A;  3V72 A;  2RAK A;  4QZB A;  2F18 A;  3BUD A;  5TZV A;  5C5B A;  4I2E A;  3BVU A;  5HRL A;  1BPZ A;  4ATB A;  1TQU A;  4RQ4 A;  2Q66 A;  3AU6 A;  3MDA A;  4I2F A;  4DOB A;  1ZQN A;  1MQ3 A;  1HTY A;  3EJT A;  3D2E A;  4RQ3 A;  5J2J A;  1UEU A;  5D63 A;  4R64 A;  3Q84 A;  4I2A A;  2KHO A;  4DOA A;  4WPE A;  3MDC A;  4EP7 A;  4JLC A;  9ICI A;  7ICS A;  5D61 A;  4KLM A;  5D49 A;  3VEA A;  4X4S A;  4UAW A;  2BCR A;  4FHV A;  4HR1 B;  4GXK A;  3C5F A;  4QZC A;  4WC1 A;  5HC9 A;  4LEW A;  4JL9 A;  4IQV A;  3ISD A;  7ICK A;  2YL8 A;  3DX4 A;  4JLX A;  4QZH A;  4MF8 A;  4EZW A;  3RJH A;  3AQL A;  4FH3 A;  4PH5 A;  5HRG A;  4AZC A;  2ZH1 A;  1ZQV A;  1GNL A;  4TUS A;  2RFF A;  8ICP A;  5CHE A;  5BPC A;  3RV1 A;  4WC6 A;  3I04 A;  3Q0K A;  1O7D B;  1R8C A;  3WFP A;  3QNI A;  1MJG A;  9ICM A;  4E7X A;  3CKD A;  3WFO A;  4O5E A;  3ERC C;  3OWG A;  1E1D A;  2FCL A;  4GXJ A;  1RPL A;  1DKX A;  7ICL A;  5CR0 A;  5J0S A;  4PGQ A;  7ICT A;  4R5J A;  4XA5 A;  2ZH7 A;  4HR1 A;  2W9M A;  4RQ7 A;  5CJ7 A;  2YL9 A;  1JMS A;  5J2E A;  4D8J A;  2PFP A;  4OAG A;  2DRA A;  7ICP A;  2Q13 A;  3CAZ A;  3RJE A;  4QZ9 A;  5B3P A;  4KM5 A;  4X4O A;  1ZQQ A;  5CA7 A;  1R89 A;  4FH5 A;  8ICN A;  4I1Q A;  5DDY A;  3DPO A;  4NLN A;  4NKU A;  3PNC A; 
#chains in the Genus database with same CATH homology
 4OAI Z;  4JNF A;  4EZQ A;  3D2F A;  1SU8 A;  4IWQ A;  4NXX A;  4E81 A;  1JQK A;  2N3K A;  2YIA A;  3L3O M;  4IWO A;  4IW0 A;  4B9Q A;  4WQK A;  4EZZ A;  3KAV A;  3F7W A;  4JWI A;  2ND1 A;  3KDR A;  3O3M B;  4M0M A;  4JWC A;  4K99 A;  4N7R A;  4WOY A;  3T47 A;  2YI9 A;  4NXV A;  4NXU A;  3B53 X;  4F01 A;  3ZED A;  3K7D A;  4O68 A;  4R5K A;  3OHX M;  4JLZ A;  1U00 A;  2WIN M;  3B52 X;  4HY9 A;  2GAF D;  4HX0 A;  4O69 A;  2EWR A;  5E84 A;  5FLE X;  4EZO A;  2IHO A;  2GA9 D;  4JWD A;  4KIK A;  3FD9 A;  3O3O B;  4E3C A;  1SU6 A;  3I39 X;  4JNE A;  3B51 X;  2LM0 A;  4K98 A;  4EZU A;  4EZT A;  2ND0 A;  1ZYL A;  4NXT A;  4WQL A;  4IM0 A;  4R5G A;  4EZN A;  4K97 A;  1SU7 A;  3QA8 A;  4FO1 A;  4EZX A;  4IM3 A;  3LMF A;  3T4A G;  3KAW A;  3T46 A;  5CFS A;  2X5C A;  2RT6 A;  1GPJ A;  2EWF A;  4JWE A;  4EZS A;  3VEB A;  3D2E A;  3ER8 C;  5B3Q A;  4IM2 A;  2B51 A;  1GNT A;  5D63 A;  4K9B A;  4LEZ A;  2KHO A;  3PHZ A;  4H6H A;  3T49 A;  4EZV A;  5CFU A;  3RV0 A;  4HYB A;  4JLC A;  3A98 A;  3VKH A;  4F00 A;  3O3N B;  5D61 A;  1W9M A;  3VEA A;  4EZR A;  4HR1 B;  4WH5 A;  3T48 A;  4K8V A;  4OAF A;  4MKP A;  1E9V A;  1OA0 A;  4IWP A;  4JL9 A;  4EZP A;  4LEW A;  4OAH A;  3UIT A;  3DPQ A;  4LEV A;  4JLX A;  4EZW A;  1SUF A;  2NCZ A;  2YIV X;  1E2U A;  2QXL A;  1OAO A;  5D62 A;  4UDY X;  1GNL A;  3I01 A;  5CHE A;  3RV1 A;  4H6I A;  4KB6 A;  3I04 A;  3ER9 B;  3MCR A;  1OA1 A;  3QNJ A;  5TKY A;  1UPX A;  4O6A A;  4PO2 A;  4K9A A;  1MJG A;  5FIG A;  3GI7 A;  4XJE A;  4LEY A;  3ERC C;  3DPP A;  4R5L A;  3NKU A;  3OWG A;  4FM3 A;  4EZY A;  2JNS A;  1E1D A;  2FCL A;  2PY6 A;  3EF2 A;  1DKY A;  4NXW A;  1DKX A;  1GN9 A;  2QFF A;  2B56 A;  4UDX X;  4R5J A;  2YIB A;  2B4V A;  4HR1 A;  2OBM A;  3C7N A;  4KIK B;  4D8J A;  2YI8 A;  4G6Q A;  4OAG A;  4NPH A;  4JN4 A;  5B3P A;  4KM5 A;  4K96 A;  4O67 A;  1DKZ A;  2OBL A;  5CFT A;  2EX3 B;  2Z8Y A;  3DPO A;  4R5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...