1JQRA

Nmr structure of the african swine fever virus dna polymerase x
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords DNA POLYMERASE BETA-LIKE
publication title Solution structure of a viral DNA polymerase X and evidence for a mutagenic function.
pubmed doi rcsb
source organism African swine fever virus
total genus 32
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 1jqrA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1jqrA01
5J2HA 7ICUA 4WC7A 3AQMA 1ZQVA 2NRKA 4P4PA 5DB8A 4RWNA 4AT9B 5CJ7A 5IILA 1R8BA 2PBEA 4X4VA 3V7JA 1ZQZA 1PX5A 2M2TA 4F5RA 2IHMA 1NO5A 4NLZA 9ICWA 4I2HA 2DR8A 4M5DA 1XSPA 3RJKA 4X4RA 2I9GA 4X0BA 1JN3A 5J0TA 1R89A 1V4AA 4RQ4A 1Q79A 5CA7A 2PXIA 7ICJA 5J2GA 1ZQJA 7ICRA 2ID1A 2DR5A 4NLNA 3L9DA 3H38A 3UQ2A 4I2IA 1JQRA 4NKUA 2ZH9A 1WOTA 2ZH6A 3OUYA 4P4OA 4YMNA 4XA5A 8ICGA 1MIVA 4YCXA 4M0AA 5HR9A 1ZQBA 3MGHA 8ICVA 2W9MA 1BPDA 1MIWA 4WC2A 4KLMA 4UAZA 5DB6A 5D4BA 4WC3A 4M04A 1JAJA 3V7KA 4QZDA 9ICEA 4ATBA 4M9GA 3JPPA 5EOZA 4X4NA 1HUZA 4O5KA 2PFPA 5DDYA 1MQ2A 8ICKA 4I2AA 1UETA 3H39A 4RPXA 4WBZA 4KLIA 2BCRA 3OUYB 3UPQA 8ICHA 1XSLA 4RWPA 3LQCB 4FHYA 3PNCA 1OU5A 4WC6A 9ICLA 2DR9A 4UAYA 3AQKA 2M2WA 4UD5A 3ISCA 4NLKA 4AT8A 2O5AA 3AU6A 2VANA 4FHVA 3WFRE 5J2DA 9ICRA 4FH3A 5CWRA 2M2UA 5J2IA 4UD4A 2ZH2A 5DEDA 7ICQA 7ICOA 5J2BA 4RQ8A 5HREA 4GXIA 4Z6EA 3JPSA 2FMPA 4ATBB 1VJ7A 4PGYA 2DVIA 4F5PA 1NOMA 4QZBA 9ICAA 3WFSC 3C2MA 4KLGA 3RH6A 4F5OA 4DO9A 1ZQPA 1VFGA 9ICMA 3AQLA 4IG8A 4QZIA 2FMSA 5J2AA 3NYBA 1ZQIA 5HHHA 4X4UA 5DBCA 3UXOA 9ICKA 3AU2A 2FMQA 1JMSA 9ICQA 9ICXA 4MFAA 2ZHBA 1UEVA 3JPTA 1RPLA 4F5NA 8ICZA 4X4TA 4X4SA 5HRBA 7ICNA 5J2JA 4TUPA 5DBBA 4WBYA 1TV9A 1ZQNA 1BPYA 4R66A 4EBKA 4UB2A 5J0OA 5F2VO 4LT6A 4RQ1A 4RPYA 1FA0A 4QZ9A 1ZQEA 4XQ8A 5DB9A 1ZQTA 4K4HA 4P2HA 3UXNA 7ICMA 8ICPA 3MGIA 5DB7A 4WC4A 3WFPA 5IINA 1ZQOA 7ICTA 2PFOA 4X0AA 5DDMA 3RH5A 4RQ7A 4O5EA 1TFWA 5J2CA 5J2FA 4KLFA 3RJEA 4M9NA 9ICGA 1ZQDA 7ICIA 3C5FA 4RQ0A 1UEUA 3C5GA 9ICHA 4YN4A 7ICLA 5J0UA 4XRHA 4M9HA 4I27A 8ICLA 2BCSA 8ICEA 7ICEA 4PGXA 4KLOA 4RT3A 4I2BA 4R64A 4NY8A 4QZEA 3AQNA 4XQ7A 8ICCA 5J0QA 5J0RA 2ZH7A 8ICXA 4WC1A 4FO6A 3C2LA 4KLLA 5DBAA 5IIMA 9ICIA 1YLQA 4X4QA 4QZGA 7ICGA 5IIOA 3JZ0A 4FHWA 1ZQFA 4PH5A 1MQ3A 4Z6DA 3WFQE 7ICKA 3WFOA 4X4PA 4YMMA 2ZH5A 1ZQLA 4E7XA 2BCQA 8ICIA 3RJIA 9ICVA 4WC0A 5CB1A 4TURA 2BCVA 8ICQA 3HJ1A 4I2JA 3HJ4A 2P66A 1ZQYA 4MFFA 4MFCA 2ZH3A 8ICWA 5J0SA 3RJGA 4KLTA 4S3NA 9ICBA 1ZQAA 8ICMA 4TUQA 4O9MA 3MDCA 3C2KA 4RQ2A 3JPRA 9ICOA 4IQVA 1ZQCA 3HX0A 3TFSA 3C66A 4DOBA 2DR7A 3K75D 1BPEA 1ZQXA 3OGUA 4I2CA 4M9LA 4PHPA 4EBJA 5J0YA 1ZQWA 4KLEA 3GDXA 1BPBA 4AT8B 7ICSA 5HRFA 5IIJA 4RPZA 2BCUA 4X4OA 1F5AA 4R63A 3V7LA 1MIYA 5HRIA 5HRHA 4IQUA 4F5QA 1BPZA 4NKTA 4RWQA 5J0XA 5D46A 1XSNA 1Q78A 4YD1A 1ZQQA 9ICUA 4JWNA 4K4IA 1ZQGA 4NM2A 4KLUA 4I2FA 9ICCA 2ISPA 4KLHA 4TUSA 5J2KA 4MF2A 4LZGA 4DOCA 5HRDA 3HIYA 4PGQA 8ICYA 4Z6FA 8ICAA 3JPQA 3LK9A 3AUOA 4RWOA 1ZQRA 2GWSA 4QZCA 4LZDA 9ICTA 9ICSA 3PMLA 2HHPA 1ZJNA 7ICVA 4PHEA 5J0WA 3OVBA 2DRAA 8ICTA 2ZH8A 4UB3A 2BPGA 2BE3A 2M2VA 7ICHA 2PFNA 7ICPA 1TFYA 4UBBA 5BOMA 4I2EA 4FH5A 4DOAA 5DECA 3V72A 1HUOA 3RJHA 4KLSA 5HRGA 4M47A 4O5CA 4E8FA 3OVSA 2ZH1A 5CR0A 4K4GA 3JPOA 8ICNA 3OVAA 4MF8A 4NXZA 4R65A 4PHAA 4NM1A 2RFFA 4IQTA 1R8CA 5D49A 3HWTA 1TVAA 1ZQMA 4JWMA 4RQ5A 4FHXA 8ICFA 3MBYA 4WCWA 4AT7A 2DRBA 4UB4A 4I29A 4E80A 3H3AA 2PFQA 4KLDA 2BPCA 5J0PA 4PPXA 3JPNA 1RZTA 1BPXA 5HRLA 3ISDA 2Q66A 4GXKA 1ZJMA 3UPSA 9ICFA 4GXJA 5BOLA 1ZQHA 8ICUA 3RJJA 4I2GA 7ICFA 2ZHAA 3B0XA 5J2EA 3HW8A 4UAWA 4YMOA 9ICPA 4YD2A 4M2YA 4UB5A 9ICNA 5IIIA 5HRKA 3ISBA 5BPCA 3MDAA 1ZQSA 1R8AA 4RT2A 3PMNA 8ICBA 4X5VA 5IIKA 5HHIA 5CHGA 2ISOA 4FHPA 4KLQA 8ICRA 3TFRA 4UB1A 4I28A 3JYYA 4AT7B 1ZQKA 2O1PA 4RQ3A 4RQ6A 1KEJA 4WC5A 3UQ0A 4LVSA 3RH4A 4QZFA 4Z6CA 4IQWA 4AT9A 5TZVA 3RJFA 4I2DA 1KDHA 8ICSA 4QZHA 4XUSA 4UBCA 8ICJA 4QZAA 3B0YA 3UXPA 2ZH4A 9ICJA 2BPFA 5HC9A 4KLJA 5J29A 1KNYA 4M9JA 5DKWA 3H37A 3OV7A 4PHDA 3C18A 8ICOA 4QZ8A 4EP7A 1ZQUA 5CP2A 4P4MA
chains in the Genus database with same CATH superfamily
4K8VA 5J2HA 7ICUA 4WC7A 4XJEA 4EGWA 3AQMA 1ZQVA 3ER8C 4OAIZ 2NRKA 4P4PA 5DB8A 4RWNA 4AT9B 5CJ7A 5IILA 1R8BA 2PBEA 4X4VA 3V7JA 1ZQZA 1PX5A 4OAFA 2M2TA 4F5RA 2IHMA 1NO5A 4NLZA 9ICWA 4I2HA 2DR8A 4M5DA 1XSPA 3RJKA 4X4RA 2I9GA 5D61A 4X0BA 1JN3A 5J0TA 3MCRA 1R89A 1V4AA 4RQ4A 1Q79A 5CA7A 2PXIA 7ICJA 5J2GA 1ZQJA 7ICRA 2ID1A 4K99A 4NLNA 2DR5A 4LEZA 2B4VA 3L9DA 3H38A 3UQ2A 4I2IA 1JQRA 4KM5A 4NKUA 2ZH9A 1WOTA 2ZH6A 3OUYA 4P4OA 4YMNA 4NXUA 4XA5A 8ICGA 1MIVA 3OWGA 4YCXA 4M0AA 5HR9A 1ZQBA 3MGHA 8ICVA 2W9MA 1BPDA 1MIWA 4WC2A 4KLMA 4O69A 4UAZA 5DB6A 5D4BA 4WC3A 4M04A 1JAJA 2FCLA 3V7KA 4QZDA 4I0UA 9ICEA 4ATBA 4M9GA 3JPPA 5EOZA 4X4NA 1HUZA 4O5KA 2PFPA 5DDYA 1MQ2A 8ICKA 2GA9D 4I2AA 1UETA 3H39A 4RPXA 4WBZA 4KLIA 2BCRA 3OUYB 3UPQA 8ICHA 1XSLA 4RWPA 3LQCB 4FHYA 3PNCA 1OU5A 4WC6A 9ICLA 2DR9A 4UAYA 3AQKA 2M2WA 4UD5A 3ISCA 4NLKA 4AT8A 2O5AA 3AU6A 2VANA 4FHVA 3WFRE 5J2DA 9ICRA 4FH3A 5CWRA 2M2UA 5J2IA 4UD4A 2ZH2A 5DEDA 7ICQA 7ICOA 5J2BA 4RQ8A 5HREA 4GXIA 5CFTA 4Z6EA 3JPSA 2FMPA 4FO1A 2DRBA 4ATBB 1VJ7A 4PGYA 3JCFA 2DVIA 4F5PA 1NOMA 4QZBA 9ICAA 3WFSC 3C2MA 4WOYA 4KLGA 3RH6A 4F5OA 4DO9A 1ZQPA 1VFGA 9ICMA 2BBHA 3AQLA 4IG8A 4QZIA 2FMSA 4LEWA 5J2AA 5JTGA 4O6AA 3NYBA 1ZQIA 5HHHA 4X4UA 5DBCA 3UXOA 9ICKA 3AU2A 2FMQA 1JMSA 9ICQA 4NXWA 4K97A 9ICXA 3NWIA 4MFAA 2ZHBA 1UEVA 3JPTA 1RPLA 2IHOA 4F5NA 8ICZA 4X4TA 4X4SA 5HRBA 7ICNA 5J2JA 3NKUA 4TUPA 5DBBA 4WBYA 1TV9A 1ZQNA 1BPYA 4R66A 4EBKA 4UB2A 5J0OA 5F2VO 4WQKA 4LT6A 4RQ1A 4RPYA 1FA0A 4QZ9A 1ZQEA 4XQ8A 5DB9A 1ZQTA 4K4HA 4P2HA 3UXNA 7ICMA 8ICPA 3MGIA 5DB7A 4WC4A 3WFPA 5IINA 1ZQOA 7ICTA 2PFOA 4X0AA 5DDMA 3RH5A 3K7DA 4RQ7A 4O5EA 5B3PA 1TFWA 2HN1A 5J2CA 5J2FA 4KLFA 3RJEA 4M9NA 5CFUA 9ICGA 1ZQDA 7ICIA 5D62A 3C5FA 4RQ0A 1UEUA 3C5GA 9ICHA 4YN4A 7ICLA 5J0UA 4XRHA 4M9HA 4I27A 8ICLA 2BCSA 8ICEA 7ICEA 4PGXA 4KLOA 4RT3A 4I2BA 4R64A 4NY8A 4QZEA 3AQNA 4WH5A 8ICCA 4XQ7A 5J0QA 5J0RA 2ZH7A 8ICXA 4WC1A 4FO6A 3C2LA 4KLLA 5DBAA 5IIMA 9ICIA 1YLQA 4X4QA 4QZGA 7ICGA 5IIOA 3JZ0A 4FHWA 1ZQFA 4PH5A 4K9AA 1MQ3A 4Z6DA 3WFQE 7ICKA 3WFOA 4X4PA 4YMMA 2ZH5A 1ZQLA 4E7XA 2BCQA 8ICIA 3RJIA 9ICVA 4WC0A 5CB1A 4TURA 1GPJA 2BCVA 8ICQA 5B3QA 3HJ1A 4I2JA 3HJ4A 2P66A 1ZQYA 4MFFA 4MFCA 2ZH3A 4LEYA 8ICWA 4MKPA 5J0SA 3RJGA 4KLTA 4O67A 4S3NA 9ICBA 1ZQAA 8ICMA 4TUQA 4O9MA 3MDCA 3C2KA 4RQ2A 3JPRA 9ICOA 4IQVA 1ZQCA 3HX0A 3TFSA 3C66A 4DOBA 2DR7A 3K75D 1BPEA 1ZQXA 3OGUA 4I2CA 4M9LA 4PHPA 4EBJA 5J0YA 1ZQWA 4KLEA 3GDXA 1BPBA 4OAGA 4AT8B 7ICSA 5HRFA 5IIJA 4RPZA 2BCUA 2GAFD 4WQLA 4X4OA 1F5AA 4R63A 3V7LA 1MIYA 5HRIA 5HRHA 4IQUA 4F5QA 1BPZA 4NKTA 4RWQA 5J0XA 5D46A 1XSNA 1Q78A 4YD1A 1ZQQA 9ICUA 4JWNA 4K4IA 1ZQGA 4NM2A 4KLUA 4I2FA 9ICCA 2ISPA 4KLHA 4N7RA 4JLXA 4TUSA 5J2KA 3EF2A 4MF2A 4LZGA 4DOCA 5HRDA 3HIYA 4KB6A 4PGQA 2EWRA 8ICYA 4Z6FA 8ICAA 4NXTA 3JPQA 3LK9A 3AUOA 4RWOA 1ZQRA 2GWSA 4QZCA 4LZDA 9ICTA 9ICSA 3PMLA 2BBJA 2HHPA 1ZJNA 7ICVA 4PHEA 5J0WA 3OVBA 2DRAA 8ICTA 2ZH8A 4UB3A 2BPGA 2BE3A 2M2VA 7ICHA 2PFNA 7ICPA 1TFYA 4UBBA 5BOMA 2B56A 2B51A 4I2EA 4FH5A 4DOAA 5DECA 4K9BA 4LEVA 3V72A 1HUOA 3RJHA 4KLSA 5HRGA 4M47A 4HX0A 4O5CA 3NVOA 4E8FA 3OVSA 2ZH1A 5CR0A 4K4GA 3JPOA 8ICNA 3OVAA 4MF8A 2HN2A 4NXZA 4R65A 4PHAA 4NM1A 4JLZA 2RFFA 4IQTA 1R8CA 5D49A 3HWTA 1TVAA 1ZQMA 4JWMA 4RQ5A 4FHXA 8ICFA 3MBYA 4WCWA 5CHEA 4AT7A 4UB4A 4I29A 4E80A 3H3AA 2PFQA 4KLDA 2BPCA 5J0PA 4PPXA 3JPNA 1RZTA 2IUBA 1BPXA 3CK6A 5HRLA 3ISDA 2Q66A 4GXKA 1ZJMA 3UPSA 9ICFA 4GXJA 4EEBA 5BOLA 1ZQHA 8ICUA 4K98A 3RJJA 4I2GA 7ICFA 2ZHAA 3B0XA 5J2EA 3HW8A 4UAWA 4YMOA 9ICPA 4YD2A 4M2YA 4UB5A 9ICNA 5IIIA 5HRKA 5D63A 3ISBA 5BPCA 3MDAA 1ZQSA 1R8AA 3ER9B 4RT2A 3ERCC 3PMNA 8ICBA 4X5VA 4EV6A 5IIKA 5HHIA 5CHGA 2ISOA 4FHPA 4KLQA 8ICRA 3TFRA 4UB1A 4I28A 3JYYA 4AT7B 1ZQKA 2O1PA 4RQ3A 4NXXA 4RQ6A 1KEJA 4O68A 4WC5A 3UQ0A 5CFSA 4LVSA 3RH4A 4QZFA 4Z6CA 4IQWA 4OAHA 4AT9A 5TZVA 4NXVA 3RJFA 4I2DA 1KDHA 8ICSA 4QZHA 4XUSA 4UBCA 8ICJA 4QZAA 3B0YA 3UXPA 2ZH4A 9ICJA 2BPFA 5HC9A 4KLJA 5J29A 1KNYA 4M9JA 5DKWA 3H37A 4K96A 3OV7A 4PHDA 3C18A 8ICOA 3PHZA 4EEDA 4QZ8A 4EP7A 1ZQUA 5CP2A 4P4MA
chains in the Genus database with same CATH topology
5J2HA 7ICUA 4WC7A 3AQMA 1ZQVA 2NRKA 4P4PA 5DB8A 4RWNA 4AT9B 5CJ7A 5IILA 1R8BA 2PBEA 4X4VA 3V7JA 1ZQZA 1PX5A 2M2TA 4F5RA 2IHMA 1NO5A 4NLZA 9ICWA 4I2HA 2DR8A 4M5DA 1XSPA 3RJKA 4X4RA 2I9GA 4X0BA 1JN3A 5J0TA 1R89A 1V4AA 4RQ4A 1Q79A 5CA7A 2PXIA 7ICJA 5J2GA 1ZQJA 7ICRA 2ID1A 2DR5A 4NLNA 3L9DA 3H38A 3UQ2A 4I2IA 1JQRA 4NKUA 2ZH9A 1WOTA 2ZH6A 3OUYA 4P4OA 4YMNA 4XA5A 8ICGA 1MIVA 4YCXA 4M0AA 5HR9A 1ZQBA 3MGHA 8ICVA 2W9MA 1BPDA 1MIWA 4WC2A 4KLMA 4UAZA 5DB6A 5D4BA 4WC3A 4M04A 1JAJA 3V7KA 4QZDA 9ICEA 4ATBA 4M9GA 3JPPA 5EOZA 4X4NA 1HUZA 4O5KA 2PFPA 5DDYA 1MQ2A 8ICKA 4I2AA 1UETA 3H39A 4RPXA 4WBZA 4KLIA 2BCRA 3OUYB 3UPQA 8ICHA 1XSLA 4RWPA 3LQCB 4FHYA 3PNCA 1OU5A 4WC6A 9ICLA 2DR9A 4UAYA 3AQKA 2M2WA 4UD5A 3ISCA 4NLKA 4AT8A 2O5AA 3AU6A 2VANA 4FHVA 3WFRE 5J2DA 9ICRA 4FH3A 5CWRA 2M2UA 5J2IA 4UD4A 2ZH2A 5DEDA 7ICQA 7ICOA 5J2BA 4RQ8A 5HREA 4GXIA 4Z6EA 3JPSA 2FMPA 4ATBB 1VJ7A 4PGYA 2DVIA 4F5PA 1NOMA 4QZBA 9ICAA 3WFSC 3C2MA 4KLGA 3RH6A 4F5OA 4DO9A 1ZQPA 1VFGA 9ICMA 3AQLA 4IG8A 4QZIA 2FMSA 5J2AA 3NYBA 1ZQIA 5HHHA 4X4UA 5DBCA 3UXOA 9ICKA 3AU2A 2FMQA 1JMSA 9ICQA 9ICXA 4MFAA 2ZHBA 1UEVA 3JPTA 1RPLA 4F5NA 8ICZA 4X4TA 4X4SA 5HRBA 7ICNA 5J2JA 4TUPA 5DBBA 4WBYA 1TV9A 1ZQNA 1BPYA 4R66A 4EBKA 4UB2A 5J0OA 5F2VO 4LT6A 4RQ1A 4RPYA 1FA0A 4QZ9A 1ZQEA 4XQ8A 5DB9A 1ZQTA 4K4HA 4P2HA 3UXNA 7ICMA 8ICPA 3MGIA 5DB7A 4WC4A 3WFPA 5IINA 1ZQOA 7ICTA 2PFOA 4X0AA 5DDMA 3RH5A 4RQ7A 4O5EA 1TFWA 5J2CA 5J2FA 4KLFA 3RJEA 4M9NA 9ICGA 1ZQDA 7ICIA 3C5FA 4RQ0A 1UEUA 3C5GA 9ICHA 4YN4A 7ICLA 5J0UA 4XRHA 4M9HA 4I27A 8ICLA 2BCSA 8ICEA 7ICEA 4PGXA 4KLOA 4RT3A 4I2BA 4R64A 4NY8A 4QZEA 3AQNA 4XQ7A 8ICCA 5J0QA 5J0RA 2ZH7A 8ICXA 4WC1A 4FO6A 3C2LA 4KLLA 5DBAA 5IIMA 9ICIA 1YLQA 4X4QA 4QZGA 7ICGA 5IIOA 3JZ0A 4FHWA 1ZQFA 4PH5A 1MQ3A 4Z6DA 3WFQE 7ICKA 3WFOA 4X4PA 4YMMA 2ZH5A 1ZQLA 4E7XA 2BCQA 8ICIA 3RJIA 9ICVA 4WC0A 5CB1A 4TURA 2BCVA 8ICQA 3HJ1A 4I2JA 3HJ4A 2P66A 1ZQYA 4MFFA 4MFCA 2ZH3A 8ICWA 5J0SA 3RJGA 4KLTA 4S3NA 9ICBA 1ZQAA 8ICMA 4TUQA 4O9MA 3MDCA 3C2KA 4RQ2A 3JPRA 9ICOA 4IQVA 1ZQCA 3HX0A 3TFSA 3C66A 4DOBA 2DR7A 3K75D 1BPEA 1ZQXA 3OGUA 4I2CA 4M9LA 4PHPA 4EBJA 5J0YA 1ZQWA 4KLEA 3GDXA 1BPBA 4AT8B 7ICSA 5HRFA 5IIJA 4RPZA 2BCUA 4X4OA 1F5AA 4R63A 3V7LA 1MIYA 5HRIA 5HRHA 4IQUA 4F5QA 1BPZA 4NKTA 4RWQA 5J0XA 5D46A 1XSNA 1Q78A 4YD1A 1ZQQA 9ICUA 4JWNA 4K4IA 1ZQGA 4NM2A 4KLUA 4I2FA 9ICCA 2ISPA 4KLHA 4TUSA 5J2KA 4MF2A 4LZGA 4DOCA 5HRDA 3HIYA 4PGQA 8ICYA 4Z6FA 8ICAA 3JPQA 3LK9A 3AUOA 4RWOA 1ZQRA 2GWSA 4QZCA 4LZDA 9ICTA 9ICSA 3PMLA 2HHPA 1ZJNA 7ICVA 4PHEA 5J0WA 3OVBA 2DRAA 8ICTA 2ZH8A 4UB3A 2BPGA 2BE3A 2M2VA 7ICHA 2PFNA 7ICPA 1TFYA 4UBBA 5BOMA 4I2EA 4FH5A 4DOAA 5DECA 3V72A 1HUOA 3RJHA 4KLSA 5HRGA 4M47A 4O5CA 4E8FA 3OVSA 2ZH1A 5CR0A 4K4GA 3JPOA 8ICNA 3OVAA 4MF8A 4NXZA 4R65A 4PHAA 4NM1A 2RFFA 4IQTA 1R8CA 5D49A 3HWTA 1TVAA 1ZQMA 4JWMA 4RQ5A 4FHXA 8ICFA 3MBYA 4WCWA 4AT7A 2DRBA 4UB4A 4I29A 4E80A 3H3AA 2PFQA 4KLDA 2BPCA 5J0PA 4PPXA 3JPNA 1RZTA 1BPXA 5HRLA 3ISDA 2Q66A 4GXKA 1ZJMA 3UPSA 9ICFA 4GXJA 5BOLA 1ZQHA 8ICUA 3RJJA 4I2GA 7ICFA 2ZHAA 3B0XA 5J2EA 3HW8A 4UAWA 4YMOA 9ICPA 4YD2A 4M2YA 4UB5A 9ICNA 5IIIA 5HRKA 3ISBA 5BPCA 3MDAA 1ZQSA 1R8AA 4RT2A 3PMNA 8ICBA 4X5VA 5IIKA 5HHIA 5CHGA 2ISOA 4FHPA 4KLQA 8ICRA 3TFRA 4UB1A 4I28A 3JYYA 4AT7B 1ZQKA 2O1PA 4RQ3A 4RQ6A 1KEJA 4WC5A 3UQ0A 4LVSA 3RH4A 4QZFA 4Z6CA 4IQWA 4AT9A 5TZVA 3RJFA 4I2DA 1KDHA 8ICSA 4QZHA 4XUSA 4UBCA 8ICJA 4QZAA 3B0YA 3UXPA 2ZH4A 9ICJA 2BPFA 5HC9A 4KLJA 5J29A 1KNYA 4M9JA 5DKWA 3H37A 3OV7A 4PHDA 3C18A 8ICOA 4QZ8A 4EP7A 1ZQUA 5CP2A 4P4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2H A;  7ICU A;  4WC7 A;  3AQM A;  1ZQV A;  2NRK A;  4P4P A;  5DB8 A;  4RWN A;  4AT9 B;  5CJ7 A;  5IIL A;  1R8B A;  2PBE A;  4X4V A;  3V7J A;  1ZQZ A;  1PX5 A;  2M2T A;  4F5R A;  2IHM A;  1NO5 A;  4NLZ A;  9ICW A;  4I2H A;  2DR8 A;  4M5D A;  1XSP A;  3RJK A;  4X4R A;  2I9G A;  4X0B A;  1JN3 A;  5J0T A;  1R89 A;  1V4A A;  4RQ4 A;  1Q79 A;  5CA7 A;  2PXI A;  7ICJ A;  5J2G A;  1ZQJ A;  7ICR A;  2ID1 A;  2DR5 A;  4NLN A;  3L9D A;  3H38 A;  3UQ2 A;  4I2I A;  1JQR A;  4NKU A;  2ZH9 A;  1WOT A;  2ZH6 A;  3OUY A;  4P4O A;  4YMN A;  4XA5 A;  8ICG A;  1MIV A;  4YCX A;  4M0A A;  5HR9 A;  1ZQB A;  3MGH A;  8ICV A;  2W9M A;  1BPD A;  1MIW A;  4WC2 A;  4KLM A;  4UAZ A;  5DB6 A;  5D4B A;  4WC3 A;  4M04 A;  1JAJ A;  3V7K A;  4QZD A;  9ICE A;  4ATB A;  4M9G A;  3JPP A;  5EOZ A;  4X4N A;  1HUZ A;  4O5K A;  2PFP A;  5DDY A;  1MQ2 A;  8ICK A;  4I2A A;  1UET A;  3H39 A;  4RPX A;  4WBZ A;  4KLI A;  2BCR A;  3OUY B;  3UPQ A;  8ICH A;  1XSL A;  4RWP A;  3LQC B;  4FHY A;  3PNC A;  1OU5 A;  4WC6 A;  9ICL A;  2DR9 A;  4UAY A;  3AQK A;  2M2W A;  4UD5 A;  3ISC A;  4NLK A;  4AT8 A;  2O5A A;  3AU6 A;  2VAN A;  4FHV A;  3WFR E;  5J2D A;  9ICR A;  4FH3 A;  5CWR A;  2M2U A;  5J2I A;  4UD4 A;  2ZH2 A;  5DED A;  7ICQ A;  7ICO A;  5J2B A;  4RQ8 A;  5HRE A;  4GXI A;  4Z6E A;  3JPS A;  2FMP A;  4ATB B;  1VJ7 A;  4PGY A;  2DVI A;  4F5P A;  1NOM A;  4QZB A;  9ICA A;  3WFS C;  3C2M A;  4KLG A;  3RH6 A;  4F5O A;  4DO9 A;  1ZQP A;  1VFG A;  9ICM A;  3AQL A;  4IG8 A;  4QZI A;  2FMS A;  5J2A A;  3NYB A;  1ZQI A;  5HHH A;  4X4U A;  5DBC A;  3UXO A;  9ICK A;  3AU2 A;  2FMQ A;  1JMS A;  9ICQ A;  9ICX A;  4MFA A;  2ZHB A;  1UEV A;  3JPT A;  1RPL A;  4F5N A;  8ICZ A;  4X4T A;  4X4S A;  5HRB A;  7ICN A;  5J2J A;  4TUP A;  5DBB A;  4WBY A;  1TV9 A;  1ZQN A;  1BPY A;  4R66 A;  4EBK A;  4UB2 A;  5J0O A;  5F2V O;  4LT6 A;  4RQ1 A;  4RPY A;  1FA0 A;  4QZ9 A;  1ZQE A;  4XQ8 A;  5DB9 A;  1ZQT A;  4K4H A;  4P2H A;  3UXN A;  7ICM A;  8ICP A;  3MGI A;  5DB7 A;  4WC4 A;  3WFP A;  5IIN A;  1ZQO A;  7ICT A;  2PFO A;  4X0A A;  5DDM A;  3RH5 A;  4RQ7 A;  4O5E A;  1TFW A;  5J2C A;  5J2F A;  4KLF A;  3RJE A;  4M9N A;  9ICG A;  1ZQD A;  7ICI A;  3C5F A;  4RQ0 A;  1UEU A;  3C5G A;  9ICH A;  4YN4 A;  7ICL A;  5J0U A;  4XRH A;  4M9H A;  4I27 A;  8ICL A;  2BCS A;  8ICE A;  7ICE A;  4PGX A;  4KLO A;  4RT3 A;  4I2B A;  4R64 A;  4NY8 A;  4QZE A;  3AQN A;  4XQ7 A;  8ICC A;  5J0Q A;  5J0R A;  2ZH7 A;  8ICX A;  4WC1 A;  4FO6 A;  3C2L A;  4KLL A;  5DBA A;  5IIM A;  9ICI A;  1YLQ A;  4X4Q A;  4QZG A;  7ICG A;  5IIO A;  3JZ0 A;  4FHW A;  1ZQF A;  4PH5 A;  1MQ3 A;  4Z6D A;  3WFQ E;  7ICK A;  3WFO A;  4X4P A;  4YMM A;  2ZH5 A;  1ZQL A;  4E7X A;  2BCQ A;  8ICI A;  3RJI A;  9ICV A;  4WC0 A;  5CB1 A;  4TUR A;  2BCV A;  8ICQ A;  3HJ1 A;  4I2J A;  3HJ4 A;  2P66 A;  1ZQY A;  4MFF A;  4MFC A;  2ZH3 A;  8ICW A;  5J0S A;  3RJG A;  4KLT A;  4S3N A;  9ICB A;  1ZQA A;  8ICM A;  4TUQ A;  4O9M A;  3MDC A;  3C2K A;  4RQ2 A;  3JPR A;  9ICO A;  4IQV A;  1ZQC A;  3HX0 A;  3TFS A;  3C66 A;  4DOB A;  2DR7 A;  3K75 D;  1BPE A;  1ZQX A;  3OGU A;  4I2C A;  4M9L A;  4PHP A;  4EBJ A;  5J0Y A;  1ZQW A;  4KLE A;  3GDX A;  1BPB A;  4AT8 B;  7ICS A;  5HRF A;  5IIJ A;  4RPZ A;  2BCU A;  4X4O A;  1F5A A;  4R63 A;  3V7L A;  1MIY A;  5HRI A;  5HRH A;  4IQU A;  4F5Q A;  1BPZ A;  4NKT A;  4RWQ A;  5J0X A;  5D46 A;  1XSN A;  1Q78 A;  4YD1 A;  1ZQQ A;  9ICU A;  4JWN A;  4K4I A;  1ZQG A;  4NM2 A;  4KLU A;  4I2F A;  9ICC A;  2ISP A;  4KLH A;  4TUS A;  5J2K A;  4MF2 A;  4LZG A;  4DOC A;  5HRD A;  3HIY A;  4PGQ A;  8ICY A;  4Z6F A;  8ICA A;  3JPQ A;  3LK9 A;  3AUO A;  4RWO A;  1ZQR A;  2GWS A;  4QZC A;  4LZD A;  9ICT A;  9ICS A;  3PML A;  2HHP A;  1ZJN A;  7ICV A;  4PHE A;  5J0W A;  3OVB A;  2DRA A;  8ICT A;  2ZH8 A;  4UB3 A;  2BPG A;  2BE3 A;  2M2V A;  7ICH A;  2PFN A;  7ICP A;  1TFY A;  4UBB A;  5BOM A;  4I2E A;  4FH5 A;  4DOA A;  5DEC A;  3V72 A;  1HUO A;  3RJH A;  4KLS A;  5HRG A;  4M47 A;  4O5C A;  4E8F A;  3OVS A;  2ZH1 A;  5CR0 A;  4K4G A;  3JPO A;  8ICN A;  3OVA A;  4MF8 A;  4NXZ A;  4R65 A;  4PHA A;  4NM1 A;  2RFF A;  4IQT A;  1R8C A;  5D49 A;  3HWT A;  1TVA A;  1ZQM A;  4JWM A;  4RQ5 A;  4FHX A;  8ICF A;  3MBY A;  4WCW A;  4AT7 A;  2DRB A;  4UB4 A;  4I29 A;  4E80 A;  3H3A A;  2PFQ A;  4KLD A;  2BPC A;  5J0P A;  4PPX A;  3JPN A;  1RZT A;  1BPX A;  5HRL A;  3ISD A;  2Q66 A;  4GXK A;  1ZJM A;  3UPS A;  9ICF A;  4GXJ A;  5BOL A;  1ZQH A;  8ICU A;  3RJJ A;  4I2G A;  7ICF A;  2ZHA A;  3B0X A;  5J2E A;  3HW8 A;  4UAW A;  4YMO A;  9ICP A;  4YD2 A;  4M2Y A;  4UB5 A;  9ICN A;  5III A;  5HRK A;  3ISB A;  5BPC A;  3MDA A;  1ZQS A;  1R8A A;  4RT2 A;  3PMN A;  8ICB A;  4X5V A;  5IIK A;  5HHI A;  5CHG A;  2ISO A;  4FHP A;  4KLQ A;  8ICR A;  3TFR A;  4UB1 A;  4I28 A;  3JYY A;  4AT7 B;  1ZQK A;  2O1P A;  4RQ3 A;  4RQ6 A;  1KEJ A;  4WC5 A;  3UQ0 A;  4LVS A;  3RH4 A;  4QZF A;  4Z6C A;  4IQW A;  4AT9 A;  5TZV A;  3RJF A;  4I2D A;  1KDH A;  8ICS A;  4QZH A;  4XUS A;  4UBC A;  8ICJ A;  4QZA A;  3B0Y A;  3UXP A;  2ZH4 A;  9ICJ A;  2BPF A;  5HC9 A;  4KLJ A;  5J29 A;  1KNY A;  4M9J A;  5DKW A;  3H37 A;  3OV7 A;  4PHD A;  3C18 A;  8ICO A;  4QZ8 A;  4EP7 A;  1ZQU A;  5CP2 A;  4P4M A; 
#chains in the Genus database with same CATH topology
 4K8V A;  5J2H A;  7ICU A;  4WC7 A;  4XJE A;  4EGW A;  3AQM A;  1ZQV A;  3ER8 C;  4OAI Z;  2NRK A;  4P4P A;  5DB8 A;  4RWN A;  4AT9 B;  5CJ7 A;  5IIL A;  1R8B A;  2PBE A;  4X4V A;  3V7J A;  1ZQZ A;  1PX5 A;  4OAF A;  2M2T A;  4F5R A;  2IHM A;  1NO5 A;  4NLZ A;  9ICW A;  4I2H A;  2DR8 A;  4M5D A;  1XSP A;  3RJK A;  4X4R A;  2I9G A;  5D61 A;  4X0B A;  1JN3 A;  5J0T A;  3MCR A;  1R89 A;  1V4A A;  4RQ4 A;  1Q79 A;  5CA7 A;  2PXI A;  7ICJ A;  5J2G A;  1ZQJ A;  7ICR A;  2ID1 A;  4K99 A;  4NLN A;  2DR5 A;  4LEZ A;  2B4V A;  3L9D A;  3H38 A;  3UQ2 A;  4I2I A;  1JQR A;  4KM5 A;  4NKU A;  2ZH9 A;  1WOT A;  2ZH6 A;  3OUY A;  4P4O A;  4YMN A;  4NXU A;  4XA5 A;  8ICG A;  1MIV A;  3OWG A;  4YCX A;  4M0A A;  5HR9 A;  1ZQB A;  3MGH A;  8ICV A;  2W9M A;  1BPD A;  1MIW A;  4WC2 A;  4KLM A;  4O69 A;  4UAZ A;  5DB6 A;  5D4B A;  4WC3 A;  4M04 A;  1JAJ A;  2FCL A;  3V7K A;  4QZD A;  4I0U A;  9ICE A;  4ATB A;  4M9G A;  3JPP A;  5EOZ A;  4X4N A;  1HUZ A;  4O5K A;  2PFP A;  5DDY A;  1MQ2 A;  8ICK A;  2GA9 D;  4I2A A;  1UET A;  3H39 A;  4RPX A;  4WBZ A;  4KLI A;  2BCR A;  3OUY B;  3UPQ A;  8ICH A;  1XSL A;  4RWP A;  3LQC B;  4FHY A;  3PNC A;  1OU5 A;  4WC6 A;  9ICL A;  2DR9 A;  4UAY A;  3AQK A;  2M2W A;  4UD5 A;  3ISC A;  4NLK A;  4AT8 A;  2O5A A;  3AU6 A;  2VAN A;  4FHV A;  3WFR E;  5J2D A;  9ICR A;  4FH3 A;  5CWR A;  2M2U A;  5J2I A;  4UD4 A;  2ZH2 A;  5DED A;  7ICQ A;  7ICO A;  5J2B A;  4RQ8 A;  5HRE A;  4GXI A;  5CFT A;  4Z6E A;  3JPS A;  2FMP A;  4FO1 A;  2DRB A;  4ATB B;  1VJ7 A;  4PGY A;  3JCF A;  2DVI A;  4F5P A;  1NOM A;  4QZB A;  9ICA A;  3WFS C;  3C2M A;  4WOY A;  4KLG A;  3RH6 A;  4F5O A;  4DO9 A;  1ZQP A;  1VFG A;  9ICM A;  2BBH A;  3AQL A;  4IG8 A;  4QZI A;  2FMS A;  4LEW A;  5J2A A;  5JTG A;  4O6A A;  3NYB A;  1ZQI A;  5HHH A;  4X4U A;  5DBC A;  3UXO A;  9ICK A;  3AU2 A;  2FMQ A;  1JMS A;  9ICQ A;  4NXW A;  4K97 A;  9ICX A;  3NWI A;  4MFA A;  2ZHB A;  1UEV A;  3JPT A;  1RPL A;  2IHO A;  4F5N A;  8ICZ A;  4X4T A;  4X4S A;  5HRB A;  7ICN A;  5J2J A;  3NKU A;  4TUP A;  5DBB A;  4WBY A;  1TV9 A;  1ZQN A;  1BPY A;  4R66 A;  4EBK A;  4UB2 A;  5J0O A;  5F2V O;  4WQK A;  4LT6 A;  4RQ1 A;  4RPY A;  1FA0 A;  4QZ9 A;  1ZQE A;  4XQ8 A;  5DB9 A;  1ZQT A;  4K4H A;  4P2H A;  3UXN A;  7ICM A;  8ICP A;  3MGI A;  5DB7 A;  4WC4 A;  3WFP A;  5IIN A;  1ZQO A;  7ICT A;  2PFO A;  4X0A A;  5DDM A;  3RH5 A;  3K7D A;  4RQ7 A;  4O5E A;  5B3P A;  1TFW A;  2HN1 A;  5J2C A;  5J2F A;  4KLF A;  3RJE A;  4M9N A;  5CFU A;  9ICG A;  1ZQD A;  7ICI A;  5D62 A;  3C5F A;  4RQ0 A;  1UEU A;  3C5G A;  9ICH A;  4YN4 A;  7ICL A;  5J0U A;  4XRH A;  4M9H A;  4I27 A;  8ICL A;  2BCS A;  8ICE A;  7ICE A;  4PGX A;  4KLO A;  4RT3 A;  4I2B A;  4R64 A;  4NY8 A;  4QZE A;  3AQN A;  4WH5 A;  8ICC A;  4XQ7 A;  5J0Q A;  5J0R A;  2ZH7 A;  8ICX A;  4WC1 A;  4FO6 A;  3C2L A;  4KLL A;  5DBA A;  5IIM A;  9ICI A;  1YLQ A;  4X4Q A;  4QZG A;  7ICG A;  5IIO A;  3JZ0 A;  4FHW A;  1ZQF A;  4PH5 A;  4K9A A;  1MQ3 A;  4Z6D A;  3WFQ E;  7ICK A;  3WFO A;  4X4P A;  4YMM A;  2ZH5 A;  1ZQL A;  4E7X A;  2BCQ A;  8ICI A;  3RJI A;  9ICV A;  4WC0 A;  5CB1 A;  4TUR A;  1GPJ A;  2BCV A;  8ICQ A;  5B3Q A;  3HJ1 A;  4I2J A;  3HJ4 A;  2P66 A;  1ZQY A;  4MFF A;  4MFC A;  2ZH3 A;  4LEY A;  8ICW A;  4MKP A;  5J0S A;  3RJG A;  4KLT A;  4O67 A;  4S3N A;  9ICB A;  1ZQA A;  8ICM A;  4TUQ A;  4O9M A;  3MDC A;  3C2K A;  4RQ2 A;  3JPR A;  9ICO A;  4IQV A;  1ZQC A;  3HX0 A;  3TFS A;  3C66 A;  4DOB A;  2DR7 A;  3K75 D;  1BPE A;  1ZQX A;  3OGU A;  4I2C A;  4M9L A;  4PHP A;  4EBJ A;  5J0Y A;  1ZQW A;  4KLE A;  3GDX A;  1BPB A;  4OAG A;  4AT8 B;  7ICS A;  5HRF A;  5IIJ A;  4RPZ A;  2BCU A;  2GAF D;  4WQL A;  4X4O A;  1F5A A;  4R63 A;  3V7L A;  1MIY A;  5HRI A;  5HRH A;  4IQU A;  4F5Q A;  1BPZ A;  4NKT A;  4RWQ A;  5J0X A;  5D46 A;  1XSN A;  1Q78 A;  4YD1 A;  1ZQQ A;  9ICU A;  4JWN A;  4K4I A;  1ZQG A;  4NM2 A;  4KLU A;  4I2F A;  9ICC A;  2ISP A;  4KLH A;  4N7R A;  4JLX A;  4TUS A;  5J2K A;  3EF2 A;  4MF2 A;  4LZG A;  4DOC A;  5HRD A;  3HIY A;  4KB6 A;  4PGQ A;  2EWR A;  8ICY A;  4Z6F A;  8ICA A;  4NXT A;  3JPQ A;  3LK9 A;  3AUO A;  4RWO A;  1ZQR A;  2GWS A;  4QZC A;  4LZD A;  9ICT A;  9ICS A;  3PML A;  2BBJ A;  2HHP A;  1ZJN A;  7ICV A;  4PHE A;  5J0W A;  3OVB A;  2DRA A;  8ICT A;  2ZH8 A;  4UB3 A;  2BPG A;  2BE3 A;  2M2V A;  7ICH A;  2PFN A;  7ICP A;  1TFY A;  4UBB A;  5BOM A;  2B56 A;  2B51 A;  4I2E A;  4FH5 A;  4DOA A;  5DEC A;  4K9B A;  4LEV A;  3V72 A;  1HUO A;  3RJH A;  4KLS A;  5HRG A;  4M47 A;  4HX0 A;  4O5C A;  3NVO A;  4E8F A;  3OVS A;  2ZH1 A;  5CR0 A;  4K4G A;  3JPO A;  8ICN A;  3OVA A;  4MF8 A;  2HN2 A;  4NXZ A;  4R65 A;  4PHA A;  4NM1 A;  4JLZ A;  2RFF A;  4IQT A;  1R8C A;  5D49 A;  3HWT A;  1TVA A;  1ZQM A;  4JWM A;  4RQ5 A;  4FHX A;  8ICF A;  3MBY A;  4WCW A;  5CHE A;  4AT7 A;  4UB4 A;  4I29 A;  4E80 A;  3H3A A;  2PFQ A;  4KLD A;  2BPC A;  5J0P A;  4PPX A;  3JPN A;  1RZT A;  2IUB A;  1BPX A;  3CK6 A;  5HRL A;  3ISD A;  2Q66 A;  4GXK A;  1ZJM A;  3UPS A;  9ICF A;  4GXJ A;  4EEB A;  5BOL A;  1ZQH A;  8ICU A;  4K98 A;  3RJJ A;  4I2G A;  7ICF A;  2ZHA A;  3B0X A;  5J2E A;  3HW8 A;  4UAW A;  4YMO A;  9ICP A;  4YD2 A;  4M2Y A;  4UB5 A;  9ICN A;  5III A;  5HRK A;  5D63 A;  3ISB A;  5BPC A;  3MDA A;  1ZQS A;  1R8A A;  3ER9 B;  4RT2 A;  3ERC C;  3PMN A;  8ICB A;  4X5V A;  4EV6 A;  5IIK A;  5HHI A;  5CHG A;  2ISO A;  4FHP A;  4KLQ A;  8ICR A;  3TFR A;  4UB1 A;  4I28 A;  3JYY A;  4AT7 B;  1ZQK A;  2O1P A;  4RQ3 A;  4NXX A;  4RQ6 A;  1KEJ A;  4O68 A;  4WC5 A;  3UQ0 A;  5CFS A;  4LVS A;  3RH4 A;  4QZF A;  4Z6C A;  4IQW A;  4OAH A;  4AT9 A;  5TZV A;  4NXV A;  3RJF A;  4I2D A;  1KDH A;  8ICS A;  4QZH A;  4XUS A;  4UBC A;  8ICJ A;  4QZA A;  3B0Y A;  3UXP A;  2ZH4 A;  9ICJ A;  2BPF A;  5HC9 A;  4KLJ A;  5J29 A;  1KNY A;  4M9J A;  5DKW A;  3H37 A;  4K96 A;  3OV7 A;  4PHD A;  3C18 A;  8ICO A;  3PHZ A;  4EED A;  4QZ8 A;  4EP7 A;  1ZQU A;  5CP2 A;  4P4M A; 
#chains in the Genus database with same CATH homology
 5J2H A;  7ICU A;  4WC7 A;  3AQM A;  1ZQV A;  2NRK A;  4P4P A;  5DB8 A;  4RWN A;  4AT9 B;  5CJ7 A;  5IIL A;  1R8B A;  2PBE A;  4X4V A;  3V7J A;  1ZQZ A;  1PX5 A;  2M2T A;  4F5R A;  2IHM A;  1NO5 A;  4NLZ A;  9ICW A;  4I2H A;  2DR8 A;  4M5D A;  1XSP A;  3RJK A;  4X4R A;  2I9G A;  4X0B A;  1JN3 A;  5J0T A;  1R89 A;  1V4A A;  4RQ4 A;  1Q79 A;  5CA7 A;  2PXI A;  7ICJ A;  5J2G A;  1ZQJ A;  7ICR A;  2ID1 A;  2DR5 A;  4NLN A;  3L9D A;  3H38 A;  3UQ2 A;  4I2I A;  1JQR A;  4NKU A;  2ZH9 A;  1WOT A;  2ZH6 A;  3OUY A;  4P4O A;  4YMN A;  4XA5 A;  8ICG A;  1MIV A;  4YCX A;  4M0A A;  5HR9 A;  1ZQB A;  3MGH A;  8ICV A;  2W9M A;  1BPD A;  1MIW A;  4WC2 A;  4KLM A;  4UAZ A;  5DB6 A;  5D4B A;  4WC3 A;  4M04 A;  1JAJ A;  3V7K A;  4QZD A;  9ICE A;  4ATB A;  4M9G A;  3JPP A;  5EOZ A;  4X4N A;  1HUZ A;  4O5K A;  2PFP A;  5DDY A;  1MQ2 A;  8ICK A;  4I2A A;  1UET A;  3H39 A;  4RPX A;  4WBZ A;  4KLI A;  2BCR A;  3OUY B;  3UPQ A;  8ICH A;  1XSL A;  4RWP A;  3LQC B;  4FHY A;  3PNC A;  1OU5 A;  4WC6 A;  9ICL A;  2DR9 A;  4UAY A;  3AQK A;  2M2W A;  4UD5 A;  3ISC A;  4NLK A;  4AT8 A;  2O5A A;  3AU6 A;  2VAN A;  4FHV A;  3WFR E;  5J2D A;  9ICR A;  4FH3 A;  5CWR A;  2M2U A;  5J2I A;  4UD4 A;  2ZH2 A;  5DED A;  7ICQ A;  7ICO A;  5J2B A;  4RQ8 A;  5HRE A;  4GXI A;  4Z6E A;  3JPS A;  2FMP A;  4ATB B;  1VJ7 A;  4PGY A;  2DVI A;  4F5P A;  1NOM A;  4QZB A;  9ICA A;  3WFS C;  3C2M A;  4KLG A;  3RH6 A;  4F5O A;  4DO9 A;  1ZQP A;  1VFG A;  9ICM A;  3AQL A;  4IG8 A;  4QZI A;  2FMS A;  5J2A A;  3NYB A;  1ZQI A;  5HHH A;  4X4U A;  5DBC A;  3UXO A;  9ICK A;  3AU2 A;  2FMQ A;  1JMS A;  9ICQ A;  9ICX A;  4MFA A;  2ZHB A;  1UEV A;  3JPT A;  1RPL A;  4F5N A;  8ICZ A;  4X4T A;  4X4S A;  5HRB A;  7ICN A;  5J2J A;  4TUP A;  5DBB A;  4WBY A;  1TV9 A;  1ZQN A;  1BPY A;  4R66 A;  4EBK A;  4UB2 A;  5J0O A;  5F2V O;  4LT6 A;  4RQ1 A;  4RPY A;  1FA0 A;  4QZ9 A;  1ZQE A;  4XQ8 A;  5DB9 A;  1ZQT A;  4K4H A;  4P2H A;  3UXN A;  7ICM A;  8ICP A;  3MGI A;  5DB7 A;  4WC4 A;  3WFP A;  5IIN A;  1ZQO A;  7ICT A;  2PFO A;  4X0A A;  5DDM A;  3RH5 A;  4RQ7 A;  4O5E A;  1TFW A;  5J2C A;  5J2F A;  4KLF A;  3RJE A;  4M9N A;  9ICG A;  1ZQD A;  7ICI A;  3C5F A;  4RQ0 A;  1UEU A;  3C5G A;  9ICH A;  4YN4 A;  7ICL A;  5J0U A;  4XRH A;  4M9H A;  4I27 A;  8ICL A;  2BCS A;  8ICE A;  7ICE A;  4PGX A;  4KLO A;  4RT3 A;  4I2B A;  4R64 A;  4NY8 A;  4QZE A;  3AQN A;  4XQ7 A;  8ICC A;  5J0Q A;  5J0R A;  2ZH7 A;  8ICX A;  4WC1 A;  4FO6 A;  3C2L A;  4KLL A;  5DBA A;  5IIM A;  9ICI A;  1YLQ A;  4X4Q A;  4QZG A;  7ICG A;  5IIO A;  3JZ0 A;  4FHW A;  1ZQF A;  4PH5 A;  1MQ3 A;  4Z6D A;  3WFQ E;  7ICK A;  3WFO A;  4X4P A;  4YMM A;  2ZH5 A;  1ZQL A;  4E7X A;  2BCQ A;  8ICI A;  3RJI A;  9ICV A;  4WC0 A;  5CB1 A;  4TUR A;  2BCV A;  8ICQ A;  3HJ1 A;  4I2J A;  3HJ4 A;  2P66 A;  1ZQY A;  4MFF A;  4MFC A;  2ZH3 A;  8ICW A;  5J0S A;  3RJG A;  4KLT A;  4S3N A;  9ICB A;  1ZQA A;  8ICM A;  4TUQ A;  4O9M A;  3MDC A;  3C2K A;  4RQ2 A;  3JPR A;  9ICO A;  4IQV A;  1ZQC A;  3HX0 A;  3TFS A;  3C66 A;  4DOB A;  2DR7 A;  3K75 D;  1BPE A;  1ZQX A;  3OGU A;  4I2C A;  4M9L A;  4PHP A;  4EBJ A;  5J0Y A;  1ZQW A;  4KLE A;  3GDX A;  1BPB A;  4AT8 B;  7ICS A;  5HRF A;  5IIJ A;  4RPZ A;  2BCU A;  4X4O A;  1F5A A;  4R63 A;  3V7L A;  1MIY A;  5HRI A;  5HRH A;  4IQU A;  4F5Q A;  1BPZ A;  4NKT A;  4RWQ A;  5J0X A;  5D46 A;  1XSN A;  1Q78 A;  4YD1 A;  1ZQQ A;  9ICU A;  4JWN A;  4K4I A;  1ZQG A;  4NM2 A;  4KLU A;  4I2F A;  9ICC A;  2ISP A;  4KLH A;  4TUS A;  5J2K A;  4MF2 A;  4LZG A;  4DOC A;  5HRD A;  3HIY A;  4PGQ A;  8ICY A;  4Z6F A;  8ICA A;  3JPQ A;  3LK9 A;  3AUO A;  4RWO A;  1ZQR A;  2GWS A;  4QZC A;  4LZD A;  9ICT A;  9ICS A;  3PML A;  2HHP A;  1ZJN A;  7ICV A;  4PHE A;  5J0W A;  3OVB A;  2DRA A;  8ICT A;  2ZH8 A;  4UB3 A;  2BPG A;  2BE3 A;  2M2V A;  7ICH A;  2PFN A;  7ICP A;  1TFY A;  4UBB A;  5BOM A;  4I2E A;  4FH5 A;  4DOA A;  5DEC A;  3V72 A;  1HUO A;  3RJH A;  4KLS A;  5HRG A;  4M47 A;  4O5C A;  4E8F A;  3OVS A;  2ZH1 A;  5CR0 A;  4K4G A;  3JPO A;  8ICN A;  3OVA A;  4MF8 A;  4NXZ A;  4R65 A;  4PHA A;  4NM1 A;  2RFF A;  4IQT A;  1R8C A;  5D49 A;  3HWT A;  1TVA A;  1ZQM A;  4JWM A;  4RQ5 A;  4FHX A;  8ICF A;  3MBY A;  4WCW A;  4AT7 A;  2DRB A;  4UB4 A;  4I29 A;  4E80 A;  3H3A A;  2PFQ A;  4KLD A;  2BPC A;  5J0P A;  4PPX A;  3JPN A;  1RZT A;  1BPX A;  5HRL A;  3ISD A;  2Q66 A;  4GXK A;  1ZJM A;  3UPS A;  9ICF A;  4GXJ A;  5BOL A;  1ZQH A;  8ICU A;  3RJJ A;  4I2G A;  7ICF A;  2ZHA A;  3B0X A;  5J2E A;  3HW8 A;  4UAW A;  4YMO A;  9ICP A;  4YD2 A;  4M2Y A;  4UB5 A;  9ICN A;  5III A;  5HRK A;  3ISB A;  5BPC A;  3MDA A;  1ZQS A;  1R8A A;  4RT2 A;  3PMN A;  8ICB A;  4X5V A;  5IIK A;  5HHI A;  5CHG A;  2ISO A;  4FHP A;  4KLQ A;  8ICR A;  3TFR A;  4UB1 A;  4I28 A;  3JYY A;  4AT7 B;  1ZQK A;  2O1P A;  4RQ3 A;  4RQ6 A;  1KEJ A;  4WC5 A;  3UQ0 A;  4LVS A;  3RH4 A;  4QZF A;  4Z6C A;  4IQW A;  4AT9 A;  5TZV A;  3RJF A;  4I2D A;  1KDH A;  8ICS A;  4QZH A;  4XUS A;  4UBC A;  8ICJ A;  4QZA A;  3B0Y A;  3UXP A;  2ZH4 A;  9ICJ A;  2BPF A;  5HC9 A;  4KLJ A;  5J29 A;  1KNY A;  4M9J A;  5DKW A;  3H37 A;  3OV7 A;  4PHD A;  3C18 A;  8ICO A;  4QZ8 A;  4EP7 A;  1ZQU A;  5CP2 A;  4P4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...