1JQRA

Nmr structure of the african swine fever virus dna polymerase x
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE BETA-LIKE
publication title Solution structure of a viral DNA polymerase X and evidence for a mutagenic function.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Viral protein
total genus 32
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 1jqrA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1jqrA01
5IINA 5IIOA 3WFRE 4NY8A 4QZGA 7ICSA 4F5PA 4R66A 1ZQNA 2BCQA 5J2CA 4NLNA 3NYBA 3AU2A 4TURA 4YMNA 4JWMA 2ZHBA 5J0QA 4UAYA 3AQMA 4KLDA 1VJ7A 9ICHA 1NOMA 5J2JA 4YD1A 5IIIA 5J0WA 4PHPA 3RJIA 2ISPA 2DVIA 8ICIA 3HX0A 4X4RA 5CB1A 5CP2A 1BPEA 9ICBA 4I2AA 3JPRA 4RQ1A 5CWRA 1ZQHA 4FHPA 1ZJNA 8ICUA 8ICQA 4WC4A 3WFQE 4KLFA 5DBCA 4RT3A 1ZQEA 2NRKA 4NKTA 4X4OA 4X4SA 4DO9A 4E80A 7ICOA 4FH3A 5J0OA 1UEUA 1Q79A 1HUOA 2IHMA 2GWSA 4JWNA 8ICXA 4I29A 3UPSA 3WFPA 5BOLA 4QZ8A 3V7KA 4KLUA 2ZH2A 3H39A 3C18A 3OVBA 1OU5A 3UQ0A 4WC2A 3MGIA 9ICPA 2FMPA 4FHVA 4R63A 3JPNA 5EOZA 3RH6A 3H38A 1ZQBA 8ICWA 4FHXA 5J2HA 4EBKA 4DOCA 9ICKA 3ISDA 4UB4A 3ISBA 4X4VA 4K4GA 5DB6A 4M9GA 5HRFA 3JPOA 3TFRA 4I28A 7ICUA 1JN3A 8ICLA 3RJFA 4I2IA 8ICBA 4X4PA 3JPSA 4M04A 5HRBA 2DRBA 4F5RA 1XSPA 4X4UA 5D49A 5J2FA 3UQ2A 2ZH5A 4LZGA 4PHEA 3RJJA 2O5AA 9ICNA 4UD5A 5J0YA 3RJHA 7ICMA 3UXNA 4I2HA 3WFOA 3V72A 4XQ7A 4PGYA 4UBCA 4RQ5A 7ICQA 4MFFA 4GXJA 3H37A 3JYYA 4I2EA 4YD2A 4UB1A 4XQ8A 3C5FA 1R8CA 4TUQA 5HRLA 4KLJA 3OGUA 1RPLA 3JPTA 4QZAA 5HRDA 1ZQAA 1ZQFA 1ZQWA 5J2KA 9ICOA 4M5DA 4DOBA 4QZDA 4RQ8A 5DBBA 1TFWA 5D46A 4X4NA 4FH5A 2I9GA 4AT8A 5HHIA 3B0YA 1ZJMA 4YCXA 3AQLA 4PGQA 7ICVA 1ZQGA 4UB5A 9ICCA 5J0PA 1R8BA 3OVAA 4K4HA 4RQ2A 9ICWA 4R65A 7ICJA 1NO5A 4LVSA 4X4TA 4XA5A 1KNYA 4S3NA 2PBEA 4ATBB 2P66A 4RWNA 8ICPA 2ID1A 4M9NA 5J2IA 2O1PA 2PXIA 1RZTA 1MIWA 2ZH9A 2VANA 4WC7A 1JQRA 9ICRA 4X0AA 3OUYA 2M2TA 1ZQDA 5DB8A 5J2BA 4O5EA 2BE3A 5DKWA 4I2GA 8ICVA 7ICFA 4WBZA 3RH5A 3LQCB 1HUZA 4X5VA 5DECA 4NLZA 7ICRA 4KLIA 4KLTA 4EBJA 8ICFA 2M2VA 1YLQA 2M2WA 4RWOA 4UB2A 4TUSA 2RFFA 3UPQA 4UD4A 4RPZA 5IIMA 2BPFA 4LZDA 7ICTA 4QZ9A 5D4BA 5DBAA 4WCWA 5HRGA 4RWQA 5J2EA 1TV9A 5BPCA 5CHGA 4F5NA 1KEJA 1VFGA 8ICCA 3MGHA 4P4MA 4YMMA 5DDMA 4UB3A 4IQUA 1R8AA 8ICNA 1BPXA 8ICZA 2Q66A 2ZH4A 8ICAA 3RH4A 4O5CA 8ICRA 4KLSA 4E7XA 4NKUA 7ICNA 3HWTA 9ICLA 3TFSA 4I2FA 4RWPA 4QZHA 1FA0A 5J0TA 5HRKA 4FHWA 4KLLA 5IIJA 1JAJA 4AT7B 8ICOA 4IG8A 4YN4A 7ICIA 3UXOA 4WC3A 1MIYA 3H3AA 4YMOA 5HRIA 3B0XA 3LK9A 4DOAA 3RJGA 4RQ0A 2BCVA 4M0AA 1ZQXA 3JPPA 4RPXA 2ZH7A 4AT9B 3UXPA 1ZQLA 1Q78A 9ICUA 4WBYA 1ZQJA 7ICLA 2M2UA 4XUSA 8ICGA 3HJ4A 1MQ3A 9ICTA 1ZQOA 4I2JA 4MFAA 1ZQSA 4I2BA 1PX5A 2BPGA 8ICYA 2BCSA 5DDYA 9ICAA 2FMSA 3C66A 2BCRA 4FO6A 3RJKA 1ZQVA 4PHDA 5HREA 7ICHA 4MF2A 3V7LA 4NXZA 4QZCA 8ICHA 9ICFA 1ZQTA 1ZQPA 4RQ6A 2DR7A 5CJ7A 4MF8A 8ICSA 4P4OA 4M47A 2ZHAA 1R89A 3MDAA 7ICPA 3HW8A 2DRAA 5HRHA 1ZQUA 4P2HA 5HR9A 4KLEA 4IQWA 8ICMA 4XRHA 4O5KA 1XSLA 4RQ7A 4KLMA 5F2VO 4QZIA 4Z6EA 4KLOA 1TVAA 8ICTA 5DB9A 4RQ4A 5J0UA 1KDHA 1TFYA 1ZQRA 4I2DA 4KLHA 1UETA 1BPZA 2ISOA 3AQNA 3AQKA 2ZH6A 4MFCA 8ICJA 5BOMA 4R64A 9ICVA 3PMLA 1ZQYA 5DB7A 4AT8B 4Z6DA 4NM2A 4I27A 3C2KA 4I2CA 5J0SA 3JZ0A 1ZQIA 5HC9A 3L9DA 4AT7A 4KLQA 4IQVA 5J29A 3PNCA 2DR5A 9ICEA 9ICMA 4UAWA 3WFSC 5CR0A 4Z6FA 3MBYA 5DEDA 5J2DA 9ICIA 2DR8A 1ZQMA 8ICKA 3V7JA 9ICSA 4F5OA 4M9HA 1BPDA 4AT9A 3C2LA 2PFPA 4X0BA 9ICXA 3HIYA 4QZFA 4TUPA 4M9JA 2HHPA 3C5GA 2PFOA 4PPXA 3RJEA 4WC6A 1BPBA 5TZVA 4QZEA 5IIKA 3PMNA 4RPYA 5HHHA 9ICGA 4LT6A 2ZH8A 1ZQZA 5J2AA 5J0XA 1MQ2A 4FHYA 5J0RA 3OVSA 3AUOA 3OUYB 4KLGA 4IQTA 3ISCA 9ICJA 4M2YA 4GXIA 3JPQA 2DR9A 1UEVA 2PFQA 4K4IA 4RT2A 4NM1A 8ICEA 4X4QA 2BPCA 4EP7A 4Z6CA 5CA7A 4WC0A 3HJ1A 1WOTA 7ICKA 3MDCA 4QZBA 2W9MA 4F5QA 1MIVA 4P4PA 2ZH1A 3AU6A 4PHAA 1ZQKA 1JMSA 1V4AA 2BCUA 2ZH3A 4ATBA 4UAZA 5IILA 7ICEA 1F5AA 4PH5A 2FMQA 7ICGA 4PGXA 9ICQA 4RQ3A 3K75D 4GXKA 4NLKA 1BPYA 5J2GA 4WC1A 4WC5A 3OV7A 4E8FA 4UBBA 1ZQCA 2PFNA 3GDXA 4M9LA 1XSNA 3C2MA 1ZQQA 4O9MA
chains in the Genus database with same CATH superfamily
5IINA 5IIOA 3WFRE 4LEYA 4NY8A 4QZGA 4WQLA 7ICSA 4F5PA 4R66A 1ZQNA 2BCQA 5J2CA 4NLNA 3NYBA 3AU2A 4TURA 4YMNA 4JWMA 2ZHBA 5J0QA 4UAYA 3AQMA 4KLDA 1VJ7A 9ICHA 1NOMA 5J2JA 4YD1A 5IIIA 5J0WA 2B56A 4PHPA 3RJIA 2ISPA 2DVIA 8ICIA 3HX0A 4X4RA 5CB1A 5CP2A 1BPEA 4FO1A 9ICBA 4I2AA 4I0UA 3JPRA 4RQ1A 5CWRA 1ZQHA 4FHPA 1ZJNA 4OAIZ 8ICUA 3EF2A 8ICQA 4WC4A 3WFQE 4KLFA 5DBCA 4RT3A 1ZQEA 2NRKA 4NKTA 4X4OA 4X4SA 4DO9A 2GA9D 4E80A 7ICOA 4FH3A 5J0OA 1UEUA 1Q79A 1HUOA 2IHMA 2GWSA 4JWNA 8ICXA 4EEBA 4I29A 3ER9B 3UPSA 3WFPA 5BOLA 4QZ8A 3V7KA 4KLUA 2ZH2A 3H39A 3C18A 3OVBA 1OU5A 3UQ0A 4WC2A 3MGIA 3ER8C 9ICPA 2FMPA 4FHVA 4LEZA 4R63A 2B4VA 4WQKA 3PHZA 3JPNA 5EOZA 3RH6A 4O69A 3H38A 1ZQBA 8ICWA 4FHXA 5J2HA 4EBKA 4DOCA 9ICKA 3ISDA 4UB4A 3ISBA 4JLXA 4X4VA 4K4GA 3OWGA 5DB6A 4M9GA 5HRFA 3JPOA 3TFRA 4I28A 7ICUA 5D61A 1JN3A 2HN1A 8ICLA 3RJFA 4I2IA 8ICBA 4X4PA 3JPSA 4M04A 5HRBA 2DRBA 4F5RA 1XSPA 4X4UA 4K8VA 5D49A 5J2FA 3UQ2A 4O6AA 4LZGA 2ZH5A 4PHEA 3RJJA 2O5AA 9ICNA 4UD5A 5J0YA 3RJHA 7ICMA 3UXNA 4I2HA 3WFOA 3V72A 4XQ7A 4PGYA 4UBCA 4RQ5A 7ICQA 4MFFA 4GXJA 3H37A 4K9BA 3JYYA 4I2EA 4YD2A 4UB1A 4XQ8A 3C5FA 1R8CA 4TUQA 5HRLA 3K7DA 4KLJA 3OGUA 1RPLA 3JPTA 4QZAA 5HRDA 1ZQAA 1ZQFA 1ZQWA 4K99A 5J2KA 9ICOA 4M5DA 2BBHA 4DOBA 4QZDA 4RQ8A 4O68A 5DBBA 1TFWA 4NXWA 5D46A 4X4NA 4FH5A 2I9GA 4AT8A 5HHIA 2HN2A 2GAFD 3B0YA 1ZJMA 4YCXA 3AQLA 4PGQA 7ICVA 1ZQGA 4UB5A 9ICCA 4HX0A 5J0PA 1R8BA 3OVAA 4K4HA 4O67A 4RQ2A 9ICWA 4R65A 4K9AA 7ICJA 1NO5A 4LVSA 4X4TA 4XA5A 1KNYA 4S3NA 2PBEA 4ATBB 2P66A 4RWNA 8ICPA 2ID1A 4M9NA 5J2IA 2O1PA 2PXIA 1RZTA 1MIWA 2ZH9A 2VANA 4WC7A 3NVOA 1JQRA 9ICRA 4X0AA 3OUYA 2M2TA 1ZQDA 5DB8A 5J2BA 4O5EA 2BE3A 5DKWA 4I2GA 8ICVA 7ICFA 4WBZA 3RH5A 3LQCB 1HUZA 4X5VA 5DECA 4NLZA 7ICRA 4KLIA 4KLTA 4EBJA 8ICFA 2M2VA 4WH5A 1YLQA 2M2WA 4RWOA 4UB2A 4TUSA 2RFFA 3UPQA 4UD4A 4RPZA 5IIMA 2BPFA 4LZDA 4JLZA 7ICTA 4MKPA 4QZ9A 5D4BA 5DBAA 2BBJA 3ERCC 4WCWA 5HRGA 4RWQA 5J2EA 1TV9A 5BPCA 4LEWA 5CHGA 4F5NA 1KEJA 5B3QA 1VFGA 8ICCA 3MGHA 4P4MA 5CHEA 4YMMA 5CFSA 5DDMA 4UB3A 3MCRA 4IQUA 1R8AA 4EEDA 8ICNA 1BPXA 8ICZA 2Q66A 2ZH4A 4NXTA 8ICAA 3RH4A 4O5CA 8ICRA 4KLSA 4E7XA 4NKUA 7ICNA 3HWTA 9ICLA 3TFSA 4I2FA 4RWPA 4LEVA 4QZHA 1FA0A 4XJEA 5J0TA 2B51A 5HRKA 4NXXA 4FHWA 4KLLA 5IIJA 1JAJA 4AT7B 8ICOA 4IG8A 4YN4A 7ICIA 3UXOA 4WC3A 1MIYA 3H3AA 5JTGA 4YMOA 5HRIA 3B0XA 3LK9A 4DOAA 3RJGA 4RQ0A 2BCVA 4M0AA 1ZQXA 3JPPA 4RPXA 4KB6A 2ZH7A 4AT9B 3UXPA 1ZQLA 1Q78A 9ICUA 4WBYA 1ZQJA 7ICLA 4NXUA 2M2UA 4XUSA 8ICGA 3HJ4A 1MQ3A 9ICTA 1ZQOA 4I2JA 4MFAA 1ZQSA 4I2BA 1PX5A 2BPGA 8ICYA 2BCSA 5DDYA 9ICAA 2FMSA 3C66A 2BCRA 4FO6A 3RJKA 3CK6A 1ZQVA 4PHDA 5HREA 7ICHA 4MF2A 3V7LA 4NXZA 4QZCA 8ICHA 9ICFA 1ZQTA 1ZQPA 5D63A 4RQ6A 2DR7A 5CJ7A 4MF8A 8ICSA 4P4OA 5CFTA 4M47A 2ZHAA 4K98A 1R89A 3MDAA 7ICPA 3HW8A 2DRAA 5HRHA 1ZQUA 4P2HA 5HR9A 4KLEA 4IQWA 8ICMA 4XRHA 4O5KA 1XSLA 4RQ7A 4KLMA 5F2VO 4QZIA 4Z6EA 4KLOA 1TVAA 8ICTA 5DB9A 4RQ4A 4OAGA 5J0UA 1KDHA 1TFYA 1ZQRA 4WOYA 4I2DA 4KLHA 1UETA 1BPZA 2ISOA 3AQNA 3AQKA 2ZH6A 4MFCA 4NXVA 4EV6A 8ICJA 5BOMA 4R64A 4OAFA 9ICVA 3PMLA 1GPJA 1ZQYA 5DB7A 5CFUA 4AT8B 4Z6DA 4NM2A 4I27A 3C2KA 4I2CA 5J0SA 3JZ0A 1ZQIA 5HC9A 3L9DA 4AT7A 4KLQA 4IQVA 5J29A 3PNCA 2DR5A 9ICEA 9ICMA 4UAWA 3WFSC 5CR0A 4Z6FA 3MBYA 5DEDA 5J2DA 9ICIA 2IHOA 2DR8A 1ZQMA 8ICKA 3V7JA 9ICSA 4K97A 4F5OA 4M9HA 1BPDA 4AT9A 3C2LA 2PFPA 4X0BA 4EGWA 9ICXA 3HIYA 4QZFA 4TUPA 4M9JA 2HHPA 3C5GA 2PFOA 4PPXA 3RJEA 4WC6A 1BPBA 5TZVA 4QZEA 4OAHA 5IIKA 3PMNA 4RPYA 5HHHA 9ICGA 4LT6A 2ZH8A 1ZQZA 5J2AA 5J0XA 1MQ2A 4FHYA 5J0RA 5D62A 3OVSA 5B3PA 3AUOA 3OUYB 4KLGA 4IQTA 3ISCA 9ICJA 2IUBA 4M2YA 2FCLA 3NKUA 4GXIA 3JPQA 2DR9A 1UEVA 2PFQA 4K4IA 3NWIA 4RT2A 4NM1A 8ICEA 4X4QA 2BPCA 4EP7A 4Z6CA 5CA7A 4N7RA 3HJ1A 2EWRA 1WOTA 7ICKA 4WC0A 3MDCA 3JCFA 4QZBA 2W9MA 4F5QA 1MIVA 4P4PA 2ZH1A 3AU6A 4PHAA 1ZQKA 1JMSA 1V4AA 2BCUA 2ZH3A 4ATBA 4UAZA 5IILA 7ICEA 1F5AA 4PH5A 2FMQA 7ICGA 4PGXA 9ICQA 4RQ3A 4K96A 3K75D 4GXKA 4NLKA 1BPYA 5J2GA 4KM5A 4WC1A 4WC5A 3OV7A 4E8FA 4UBBA 1ZQCA 2PFNA 3GDXA 4M9LA 1XSNA 3C2MA 1ZQQA 4O9MA
chains in the Genus database with same CATH topology
5IINA 5IIOA 3WFRE 4NY8A 4QZGA 7ICSA 4F5PA 4R66A 1ZQNA 2BCQA 5J2CA 4NLNA 3NYBA 3AU2A 4TURA 4YMNA 4JWMA 2ZHBA 5J0QA 4UAYA 3AQMA 4KLDA 1VJ7A 9ICHA 1NOMA 5J2JA 4YD1A 5IIIA 5J0WA 4PHPA 3RJIA 2ISPA 2DVIA 8ICIA 3HX0A 4X4RA 5CB1A 5CP2A 1BPEA 9ICBA 4I2AA 3JPRA 4RQ1A 5CWRA 1ZQHA 4FHPA 1ZJNA 8ICUA 8ICQA 4WC4A 3WFQE 4KLFA 5DBCA 4RT3A 1ZQEA 2NRKA 4NKTA 4X4OA 4X4SA 4DO9A 4E80A 7ICOA 4FH3A 5J0OA 1UEUA 1Q79A 1HUOA 2IHMA 2GWSA 4JWNA 8ICXA 4I29A 3UPSA 3WFPA 5BOLA 4QZ8A 3V7KA 4KLUA 2ZH2A 3H39A 3C18A 3OVBA 1OU5A 3UQ0A 4WC2A 3MGIA 9ICPA 2FMPA 4FHVA 4R63A 3JPNA 5EOZA 3RH6A 3H38A 1ZQBA 8ICWA 4FHXA 5J2HA 4EBKA 4DOCA 9ICKA 3ISDA 4UB4A 3ISBA 4X4VA 4K4GA 5DB6A 4M9GA 5HRFA 3JPOA 3TFRA 4I28A 7ICUA 1JN3A 8ICLA 3RJFA 4I2IA 8ICBA 4X4PA 3JPSA 4M04A 5HRBA 2DRBA 4F5RA 1XSPA 4X4UA 5D49A 5J2FA 3UQ2A 2ZH5A 4LZGA 4PHEA 3RJJA 2O5AA 9ICNA 4UD5A 5J0YA 3RJHA 7ICMA 3UXNA 4I2HA 3WFOA 3V72A 4XQ7A 4PGYA 4UBCA 4RQ5A 7ICQA 4MFFA 4GXJA 3H37A 3JYYA 4I2EA 4YD2A 4UB1A 4XQ8A 3C5FA 1R8CA 4TUQA 5HRLA 4KLJA 3OGUA 1RPLA 3JPTA 4QZAA 5HRDA 1ZQAA 1ZQFA 1ZQWA 5J2KA 9ICOA 4M5DA 4DOBA 4QZDA 4RQ8A 5DBBA 1TFWA 5D46A 4X4NA 4FH5A 2I9GA 4AT8A 5HHIA 3B0YA 1ZJMA 4YCXA 3AQLA 4PGQA 7ICVA 1ZQGA 4UB5A 9ICCA 5J0PA 1R8BA 3OVAA 4K4HA 4RQ2A 9ICWA 4R65A 7ICJA 1NO5A 4LVSA 4X4TA 4XA5A 1KNYA 4S3NA 2PBEA 4ATBB 2P66A 4RWNA 8ICPA 2ID1A 4M9NA 5J2IA 2O1PA 2PXIA 1RZTA 1MIWA 2ZH9A 2VANA 4WC7A 1JQRA 9ICRA 4X0AA 3OUYA 2M2TA 1ZQDA 5DB8A 5J2BA 4O5EA 2BE3A 5DKWA 4I2GA 8ICVA 7ICFA 4WBZA 3RH5A 3LQCB 1HUZA 4X5VA 5DECA 4NLZA 7ICRA 4KLIA 4KLTA 4EBJA 8ICFA 2M2VA 1YLQA 2M2WA 4RWOA 4UB2A 4TUSA 2RFFA 3UPQA 4UD4A 4RPZA 5IIMA 2BPFA 4LZDA 7ICTA 4QZ9A 5D4BA 5DBAA 4WCWA 5HRGA 4RWQA 5J2EA 1TV9A 5BPCA 5CHGA 4F5NA 1KEJA 1VFGA 8ICCA 3MGHA 4P4MA 4YMMA 5DDMA 4UB3A 4IQUA 1R8AA 8ICNA 1BPXA 8ICZA 2Q66A 2ZH4A 8ICAA 3RH4A 4O5CA 8ICRA 4KLSA 4E7XA 4NKUA 7ICNA 3HWTA 9ICLA 3TFSA 4I2FA 4RWPA 4QZHA 1FA0A 5J0TA 5HRKA 4FHWA 4KLLA 5IIJA 1JAJA 4AT7B 8ICOA 4IG8A 4YN4A 7ICIA 3UXOA 4WC3A 1MIYA 3H3AA 4YMOA 5HRIA 3B0XA 3LK9A 4DOAA 3RJGA 4RQ0A 2BCVA 4M0AA 1ZQXA 3JPPA 4RPXA 2ZH7A 4AT9B 3UXPA 1ZQLA 1Q78A 9ICUA 4WBYA 1ZQJA 7ICLA 2M2UA 4XUSA 8ICGA 3HJ4A 1MQ3A 9ICTA 1ZQOA 4I2JA 4MFAA 1ZQSA 4I2BA 1PX5A 2BPGA 8ICYA 2BCSA 5DDYA 9ICAA 2FMSA 3C66A 2BCRA 4FO6A 3RJKA 1ZQVA 4PHDA 5HREA 7ICHA 4MF2A 3V7LA 4NXZA 4QZCA 8ICHA 9ICFA 1ZQTA 1ZQPA 4RQ6A 2DR7A 5CJ7A 4MF8A 8ICSA 4P4OA 4M47A 2ZHAA 1R89A 3MDAA 7ICPA 3HW8A 2DRAA 5HRHA 1ZQUA 4P2HA 5HR9A 4KLEA 4IQWA 8ICMA 4XRHA 4O5KA 1XSLA 4RQ7A 4KLMA 5F2VO 4QZIA 4Z6EA 4KLOA 1TVAA 8ICTA 5DB9A 4RQ4A 5J0UA 1KDHA 1TFYA 1ZQRA 4I2DA 4KLHA 1UETA 1BPZA 2ISOA 3AQNA 3AQKA 2ZH6A 4MFCA 8ICJA 5BOMA 4R64A 9ICVA 3PMLA 1ZQYA 5DB7A 4AT8B 4Z6DA 4NM2A 4I27A 3C2KA 4I2CA 5J0SA 3JZ0A 1ZQIA 5HC9A 3L9DA 4AT7A 4KLQA 4IQVA 5J29A 3PNCA 2DR5A 9ICEA 9ICMA 4UAWA 3WFSC 5CR0A 4Z6FA 3MBYA 5DEDA 5J2DA 9ICIA 2DR8A 1ZQMA 8ICKA 3V7JA 9ICSA 4F5OA 4M9HA 1BPDA 4AT9A 3C2LA 2PFPA 4X0BA 9ICXA 3HIYA 4QZFA 4TUPA 4M9JA 2HHPA 3C5GA 2PFOA 4PPXA 3RJEA 4WC6A 1BPBA 5TZVA 4QZEA 5IIKA 3PMNA 4RPYA 5HHHA 9ICGA 4LT6A 2ZH8A 1ZQZA 5J2AA 5J0XA 1MQ2A 4FHYA 5J0RA 3OVSA 3AUOA 3OUYB 4KLGA 4IQTA 3ISCA 9ICJA 4M2YA 4GXIA 3JPQA 2DR9A 1UEVA 2PFQA 4K4IA 4RT2A 4NM1A 8ICEA 4X4QA 2BPCA 4EP7A 4Z6CA 5CA7A 4WC0A 3HJ1A 1WOTA 7ICKA 3MDCA 4QZBA 2W9MA 4F5QA 1MIVA 4P4PA 2ZH1A 3AU6A 4PHAA 1ZQKA 1JMSA 1V4AA 2BCUA 2ZH3A 4ATBA 4UAZA 5IILA 7ICEA 1F5AA 4PH5A 2FMQA 7ICGA 4PGXA 9ICQA 4RQ3A 3K75D 4GXKA 4NLKA 1BPYA 5J2GA 4WC1A 4WC5A 3OV7A 4E8FA 4UBBA 1ZQCA 2PFNA 3GDXA 4M9LA 1XSNA 3C2MA 1ZQQA 4O9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IIN A;  5IIO A;  3WFR E;  4NY8 A;  4QZG A;  7ICS A;  4F5P A;  4R66 A;  1ZQN A;  2BCQ A;  5J2C A;  4NLN A;  3NYB A;  3AU2 A;  4TUR A;  4YMN A;  4JWM A;  2ZHB A;  5J0Q A;  4UAY A;  3AQM A;  4KLD A;  1VJ7 A;  9ICH A;  1NOM A;  5J2J A;  4YD1 A;  5III A;  5J0W A;  4PHP A;  3RJI A;  2ISP A;  2DVI A;  8ICI A;  3HX0 A;  4X4R A;  5CB1 A;  5CP2 A;  1BPE A;  9ICB A;  4I2A A;  3JPR A;  4RQ1 A;  5CWR A;  1ZQH A;  4FHP A;  1ZJN A;  8ICU A;  8ICQ A;  4WC4 A;  3WFQ E;  4KLF A;  5DBC A;  4RT3 A;  1ZQE A;  2NRK A;  4NKT A;  4X4O A;  4X4S A;  4DO9 A;  4E80 A;  7ICO A;  4FH3 A;  5J0O A;  1UEU A;  1Q79 A;  1HUO A;  2IHM A;  2GWS A;  4JWN A;  8ICX A;  4I29 A;  3UPS A;  3WFP A;  5BOL A;  4QZ8 A;  3V7K A;  4KLU A;  2ZH2 A;  3H39 A;  3C18 A;  3OVB A;  1OU5 A;  3UQ0 A;  4WC2 A;  3MGI A;  9ICP A;  2FMP A;  4FHV A;  4R63 A;  3JPN A;  5EOZ A;  3RH6 A;  3H38 A;  1ZQB A;  8ICW A;  4FHX A;  5J2H A;  4EBK A;  4DOC A;  9ICK A;  3ISD A;  4UB4 A;  3ISB A;  4X4V A;  4K4G A;  5DB6 A;  4M9G A;  5HRF A;  3JPO A;  3TFR A;  4I28 A;  7ICU A;  1JN3 A;  8ICL A;  3RJF A;  4I2I A;  8ICB A;  4X4P A;  3JPS A;  4M04 A;  5HRB A;  2DRB A;  4F5R A;  1XSP A;  4X4U A;  5D49 A;  5J2F A;  3UQ2 A;  2ZH5 A;  4LZG A;  4PHE A;  3RJJ A;  2O5A A;  9ICN A;  4UD5 A;  5J0Y A;  3RJH A;  7ICM A;  3UXN A;  4I2H A;  3WFO A;  3V72 A;  4XQ7 A;  4PGY A;  4UBC A;  4RQ5 A;  7ICQ A;  4MFF A;  4GXJ A;  3H37 A;  3JYY A;  4I2E A;  4YD2 A;  4UB1 A;  4XQ8 A;  3C5F A;  1R8C A;  4TUQ A;  5HRL A;  4KLJ A;  3OGU A;  1RPL A;  3JPT A;  4QZA A;  5HRD A;  1ZQA A;  1ZQF A;  1ZQW A;  5J2K A;  9ICO A;  4M5D A;  4DOB A;  4QZD A;  4RQ8 A;  5DBB A;  1TFW A;  5D46 A;  4X4N A;  4FH5 A;  2I9G A;  4AT8 A;  5HHI A;  3B0Y A;  1ZJM A;  4YCX A;  3AQL A;  4PGQ A;  7ICV A;  1ZQG A;  4UB5 A;  9ICC A;  5J0P A;  1R8B A;  3OVA A;  4K4H A;  4RQ2 A;  9ICW A;  4R65 A;  7ICJ A;  1NO5 A;  4LVS A;  4X4T A;  4XA5 A;  1KNY A;  4S3N A;  2PBE A;  4ATB B;  2P66 A;  4RWN A;  8ICP A;  2ID1 A;  4M9N A;  5J2I A;  2O1P A;  2PXI A;  1RZT A;  1MIW A;  2ZH9 A;  2VAN A;  4WC7 A;  1JQR A;  9ICR A;  4X0A A;  3OUY A;  2M2T A;  1ZQD A;  5DB8 A;  5J2B A;  4O5E A;  2BE3 A;  5DKW A;  4I2G A;  8ICV A;  7ICF A;  4WBZ A;  3RH5 A;  3LQC B;  1HUZ A;  4X5V A;  5DEC A;  4NLZ A;  7ICR A;  4KLI A;  4KLT A;  4EBJ A;  8ICF A;  2M2V A;  1YLQ A;  2M2W A;  4RWO A;  4UB2 A;  4TUS A;  2RFF A;  3UPQ A;  4UD4 A;  4RPZ A;  5IIM A;  2BPF A;  4LZD A;  7ICT A;  4QZ9 A;  5D4B A;  5DBA A;  4WCW A;  5HRG A;  4RWQ A;  5J2E A;  1TV9 A;  5BPC A;  5CHG A;  4F5N A;  1KEJ A;  1VFG A;  8ICC A;  3MGH A;  4P4M A;  4YMM A;  5DDM A;  4UB3 A;  4IQU A;  1R8A A;  8ICN A;  1BPX A;  8ICZ A;  2Q66 A;  2ZH4 A;  8ICA A;  3RH4 A;  4O5C A;  8ICR A;  4KLS A;  4E7X A;  4NKU A;  7ICN A;  3HWT A;  9ICL A;  3TFS A;  4I2F A;  4RWP A;  4QZH A;  1FA0 A;  5J0T A;  5HRK A;  4FHW A;  4KLL A;  5IIJ A;  1JAJ A;  4AT7 B;  8ICO A;  4IG8 A;  4YN4 A;  7ICI A;  3UXO A;  4WC3 A;  1MIY A;  3H3A A;  4YMO A;  5HRI A;  3B0X A;  3LK9 A;  4DOA A;  3RJG A;  4RQ0 A;  2BCV A;  4M0A A;  1ZQX A;  3JPP A;  4RPX A;  2ZH7 A;  4AT9 B;  3UXP A;  1ZQL A;  1Q78 A;  9ICU A;  4WBY A;  1ZQJ A;  7ICL A;  2M2U A;  4XUS A;  8ICG A;  3HJ4 A;  1MQ3 A;  9ICT A;  1ZQO A;  4I2J A;  4MFA A;  1ZQS A;  4I2B A;  1PX5 A;  2BPG A;  8ICY A;  2BCS A;  5DDY A;  9ICA A;  2FMS A;  3C66 A;  2BCR A;  4FO6 A;  3RJK A;  1ZQV A;  4PHD A;  5HRE A;  7ICH A;  4MF2 A;  3V7L A;  4NXZ A;  4QZC A;  8ICH A;  9ICF A;  1ZQT A;  1ZQP A;  4RQ6 A;  2DR7 A;  5CJ7 A;  4MF8 A;  8ICS A;  4P4O A;  4M47 A;  2ZHA A;  1R89 A;  3MDA A;  7ICP A;  3HW8 A;  2DRA A;  5HRH A;  1ZQU A;  4P2H A;  5HR9 A;  4KLE A;  4IQW A;  8ICM A;  4XRH A;  4O5K A;  1XSL A;  4RQ7 A;  4KLM A;  5F2V O;  4QZI A;  4Z6E A;  4KLO A;  1TVA A;  8ICT A;  5DB9 A;  4RQ4 A;  5J0U A;  1KDH A;  1TFY A;  1ZQR A;  4I2D A;  4KLH A;  1UET A;  1BPZ A;  2ISO A;  3AQN A;  3AQK A;  2ZH6 A;  4MFC A;  8ICJ A;  5BOM A;  4R64 A;  9ICV A;  3PML A;  1ZQY A;  5DB7 A;  4AT8 B;  4Z6D A;  4NM2 A;  4I27 A;  3C2K A;  4I2C A;  5J0S A;  3JZ0 A;  1ZQI A;  5HC9 A;  3L9D A;  4AT7 A;  4KLQ A;  4IQV A;  5J29 A;  3PNC A;  2DR5 A;  9ICE A;  9ICM A;  4UAW A;  3WFS C;  5CR0 A;  4Z6F A;  3MBY A;  5DED A;  5J2D A;  9ICI A;  2DR8 A;  1ZQM A;  8ICK A;  3V7J A;  9ICS A;  4F5O A;  4M9H A;  1BPD A;  4AT9 A;  3C2L A;  2PFP A;  4X0B A;  9ICX A;  3HIY A;  4QZF A;  4TUP A;  4M9J A;  2HHP A;  3C5G A;  2PFO A;  4PPX A;  3RJE A;  4WC6 A;  1BPB A;  5TZV A;  4QZE A;  5IIK A;  3PMN A;  4RPY A;  5HHH A;  9ICG A;  4LT6 A;  2ZH8 A;  1ZQZ A;  5J2A A;  5J0X A;  1MQ2 A;  4FHY A;  5J0R A;  3OVS A;  3AUO A;  3OUY B;  4KLG A;  4IQT A;  3ISC A;  9ICJ A;  4M2Y A;  4GXI A;  3JPQ A;  2DR9 A;  1UEV A;  2PFQ A;  4K4I A;  4RT2 A;  4NM1 A;  8ICE A;  4X4Q A;  2BPC A;  4EP7 A;  4Z6C A;  5CA7 A;  4WC0 A;  3HJ1 A;  1WOT A;  7ICK A;  3MDC A;  4QZB A;  2W9M A;  4F5Q A;  1MIV A;  4P4P A;  2ZH1 A;  3AU6 A;  4PHA A;  1ZQK A;  1JMS A;  1V4A A;  2BCU A;  2ZH3 A;  4ATB A;  4UAZ A;  5IIL A;  7ICE A;  1F5A A;  4PH5 A;  2FMQ A;  7ICG A;  4PGX A;  9ICQ A;  4RQ3 A;  3K75 D;  4GXK A;  4NLK A;  1BPY A;  5J2G A;  4WC1 A;  4WC5 A;  3OV7 A;  4E8F A;  4UBB A;  1ZQC A;  2PFN A;  3GDX A;  4M9L A;  1XSN A;  3C2M A;  1ZQQ A;  4O9M A; 
#chains in the Genus database with same CATH topology
 5IIN A;  5IIO A;  3WFR E;  4LEY A;  4NY8 A;  4QZG A;  4WQL A;  7ICS A;  4F5P A;  4R66 A;  1ZQN A;  2BCQ A;  5J2C A;  4NLN A;  3NYB A;  3AU2 A;  4TUR A;  4YMN A;  4JWM A;  2ZHB A;  5J0Q A;  4UAY A;  3AQM A;  4KLD A;  1VJ7 A;  9ICH A;  1NOM A;  5J2J A;  4YD1 A;  5III A;  5J0W A;  2B56 A;  4PHP A;  3RJI A;  2ISP A;  2DVI A;  8ICI A;  3HX0 A;  4X4R A;  5CB1 A;  5CP2 A;  1BPE A;  4FO1 A;  9ICB A;  4I2A A;  4I0U A;  3JPR A;  4RQ1 A;  5CWR A;  1ZQH A;  4FHP A;  1ZJN A;  4OAI Z;  8ICU A;  3EF2 A;  8ICQ A;  4WC4 A;  3WFQ E;  4KLF A;  5DBC A;  4RT3 A;  1ZQE A;  2NRK A;  4NKT A;  4X4O A;  4X4S A;  4DO9 A;  2GA9 D;  4E80 A;  7ICO A;  4FH3 A;  5J0O A;  1UEU A;  1Q79 A;  1HUO A;  2IHM A;  2GWS A;  4JWN A;  8ICX A;  4EEB A;  4I29 A;  3ER9 B;  3UPS A;  3WFP A;  5BOL A;  4QZ8 A;  3V7K A;  4KLU A;  2ZH2 A;  3H39 A;  3C18 A;  3OVB A;  1OU5 A;  3UQ0 A;  4WC2 A;  3MGI A;  3ER8 C;  9ICP A;  2FMP A;  4FHV A;  4LEZ A;  4R63 A;  2B4V A;  4WQK A;  3PHZ A;  3JPN A;  5EOZ A;  3RH6 A;  4O69 A;  3H38 A;  1ZQB A;  8ICW A;  4FHX A;  5J2H A;  4EBK A;  4DOC A;  9ICK A;  3ISD A;  4UB4 A;  3ISB A;  4JLX A;  4X4V A;  4K4G A;  3OWG A;  5DB6 A;  4M9G A;  5HRF A;  3JPO A;  3TFR A;  4I28 A;  7ICU A;  5D61 A;  1JN3 A;  2HN1 A;  8ICL A;  3RJF A;  4I2I A;  8ICB A;  4X4P A;  3JPS A;  4M04 A;  5HRB A;  2DRB A;  4F5R A;  1XSP A;  4X4U A;  4K8V A;  5D49 A;  5J2F A;  3UQ2 A;  4O6A A;  4LZG A;  2ZH5 A;  4PHE A;  3RJJ A;  2O5A A;  9ICN A;  4UD5 A;  5J0Y A;  3RJH A;  7ICM A;  3UXN A;  4I2H A;  3WFO A;  3V72 A;  4XQ7 A;  4PGY A;  4UBC A;  4RQ5 A;  7ICQ A;  4MFF A;  4GXJ A;  3H37 A;  4K9B A;  3JYY A;  4I2E A;  4YD2 A;  4UB1 A;  4XQ8 A;  3C5F A;  1R8C A;  4TUQ A;  5HRL A;  3K7D A;  4KLJ A;  3OGU A;  1RPL A;  3JPT A;  4QZA A;  5HRD A;  1ZQA A;  1ZQF A;  1ZQW A;  4K99 A;  5J2K A;  9ICO A;  4M5D A;  2BBH A;  4DOB A;  4QZD A;  4RQ8 A;  4O68 A;  5DBB A;  1TFW A;  4NXW A;  5D46 A;  4X4N A;  4FH5 A;  2I9G A;  4AT8 A;  5HHI A;  2HN2 A;  2GAF D;  3B0Y A;  1ZJM A;  4YCX A;  3AQL A;  4PGQ A;  7ICV A;  1ZQG A;  4UB5 A;  9ICC A;  4HX0 A;  5J0P A;  1R8B A;  3OVA A;  4K4H A;  4O67 A;  4RQ2 A;  9ICW A;  4R65 A;  4K9A A;  7ICJ A;  1NO5 A;  4LVS A;  4X4T A;  4XA5 A;  1KNY A;  4S3N A;  2PBE A;  4ATB B;  2P66 A;  4RWN A;  8ICP A;  2ID1 A;  4M9N A;  5J2I A;  2O1P A;  2PXI A;  1RZT A;  1MIW A;  2ZH9 A;  2VAN A;  4WC7 A;  3NVO A;  1JQR A;  9ICR A;  4X0A A;  3OUY A;  2M2T A;  1ZQD A;  5DB8 A;  5J2B A;  4O5E A;  2BE3 A;  5DKW A;  4I2G A;  8ICV A;  7ICF A;  4WBZ A;  3RH5 A;  3LQC B;  1HUZ A;  4X5V A;  5DEC A;  4NLZ A;  7ICR A;  4KLI A;  4KLT A;  4EBJ A;  8ICF A;  2M2V A;  4WH5 A;  1YLQ A;  2M2W A;  4RWO A;  4UB2 A;  4TUS A;  2RFF A;  3UPQ A;  4UD4 A;  4RPZ A;  5IIM A;  2BPF A;  4LZD A;  4JLZ A;  7ICT A;  4MKP A;  4QZ9 A;  5D4B A;  5DBA A;  2BBJ A;  3ERC C;  4WCW A;  5HRG A;  4RWQ A;  5J2E A;  1TV9 A;  5BPC A;  4LEW A;  5CHG A;  4F5N A;  1KEJ A;  5B3Q A;  1VFG A;  8ICC A;  3MGH A;  4P4M A;  5CHE A;  4YMM A;  5CFS A;  5DDM A;  4UB3 A;  3MCR A;  4IQU A;  1R8A A;  4EED A;  8ICN A;  1BPX A;  8ICZ A;  2Q66 A;  2ZH4 A;  4NXT A;  8ICA A;  3RH4 A;  4O5C A;  8ICR A;  4KLS A;  4E7X A;  4NKU A;  7ICN A;  3HWT A;  9ICL A;  3TFS A;  4I2F A;  4RWP A;  4LEV A;  4QZH A;  1FA0 A;  4XJE A;  5J0T A;  2B51 A;  5HRK A;  4NXX A;  4FHW A;  4KLL A;  5IIJ A;  1JAJ A;  4AT7 B;  8ICO A;  4IG8 A;  4YN4 A;  7ICI A;  3UXO A;  4WC3 A;  1MIY A;  3H3A A;  5JTG A;  4YMO A;  5HRI A;  3B0X A;  3LK9 A;  4DOA A;  3RJG A;  4RQ0 A;  2BCV A;  4M0A A;  1ZQX A;  3JPP A;  4RPX A;  4KB6 A;  2ZH7 A;  4AT9 B;  3UXP A;  1ZQL A;  1Q78 A;  9ICU A;  4WBY A;  1ZQJ A;  7ICL A;  4NXU A;  2M2U A;  4XUS A;  8ICG A;  3HJ4 A;  1MQ3 A;  9ICT A;  1ZQO A;  4I2J A;  4MFA A;  1ZQS A;  4I2B A;  1PX5 A;  2BPG A;  8ICY A;  2BCS A;  5DDY A;  9ICA A;  2FMS A;  3C66 A;  2BCR A;  4FO6 A;  3RJK A;  3CK6 A;  1ZQV A;  4PHD A;  5HRE A;  7ICH A;  4MF2 A;  3V7L A;  4NXZ A;  4QZC A;  8ICH A;  9ICF A;  1ZQT A;  1ZQP A;  5D63 A;  4RQ6 A;  2DR7 A;  5CJ7 A;  4MF8 A;  8ICS A;  4P4O A;  5CFT A;  4M47 A;  2ZHA A;  4K98 A;  1R89 A;  3MDA A;  7ICP A;  3HW8 A;  2DRA A;  5HRH A;  1ZQU A;  4P2H A;  5HR9 A;  4KLE A;  4IQW A;  8ICM A;  4XRH A;  4O5K A;  1XSL A;  4RQ7 A;  4KLM A;  5F2V O;  4QZI A;  4Z6E A;  4KLO A;  1TVA A;  8ICT A;  5DB9 A;  4RQ4 A;  4OAG A;  5J0U A;  1KDH A;  1TFY A;  1ZQR A;  4WOY A;  4I2D A;  4KLH A;  1UET A;  1BPZ A;  2ISO A;  3AQN A;  3AQK A;  2ZH6 A;  4MFC A;  4NXV A;  4EV6 A;  8ICJ A;  5BOM A;  4R64 A;  4OAF A;  9ICV A;  3PML A;  1GPJ A;  1ZQY A;  5DB7 A;  5CFU A;  4AT8 B;  4Z6D A;  4NM2 A;  4I27 A;  3C2K A;  4I2C A;  5J0S A;  3JZ0 A;  1ZQI A;  5HC9 A;  3L9D A;  4AT7 A;  4KLQ A;  4IQV A;  5J29 A;  3PNC A;  2DR5 A;  9ICE A;  9ICM A;  4UAW A;  3WFS C;  5CR0 A;  4Z6F A;  3MBY A;  5DED A;  5J2D A;  9ICI A;  2IHO A;  2DR8 A;  1ZQM A;  8ICK A;  3V7J A;  9ICS A;  4K97 A;  4F5O A;  4M9H A;  1BPD A;  4AT9 A;  3C2L A;  2PFP A;  4X0B A;  4EGW A;  9ICX A;  3HIY A;  4QZF A;  4TUP A;  4M9J A;  2HHP A;  3C5G A;  2PFO A;  4PPX A;  3RJE A;  4WC6 A;  1BPB A;  5TZV A;  4QZE A;  4OAH A;  5IIK A;  3PMN A;  4RPY A;  5HHH A;  9ICG A;  4LT6 A;  2ZH8 A;  1ZQZ A;  5J2A A;  5J0X A;  1MQ2 A;  4FHY A;  5J0R A;  5D62 A;  3OVS A;  5B3P A;  3AUO A;  3OUY B;  4KLG A;  4IQT A;  3ISC A;  9ICJ A;  2IUB A;  4M2Y A;  2FCL A;  3NKU A;  4GXI A;  3JPQ A;  2DR9 A;  1UEV A;  2PFQ A;  4K4I A;  3NWI A;  4RT2 A;  4NM1 A;  8ICE A;  4X4Q A;  2BPC A;  4EP7 A;  4Z6C A;  5CA7 A;  4N7R A;  3HJ1 A;  2EWR A;  1WOT A;  7ICK A;  4WC0 A;  3MDC A;  3JCF A;  4QZB A;  2W9M A;  4F5Q A;  1MIV A;  4P4P A;  2ZH1 A;  3AU6 A;  4PHA A;  1ZQK A;  1JMS A;  1V4A A;  2BCU A;  2ZH3 A;  4ATB A;  4UAZ A;  5IIL A;  7ICE A;  1F5A A;  4PH5 A;  2FMQ A;  7ICG A;  4PGX A;  9ICQ A;  4RQ3 A;  4K96 A;  3K75 D;  4GXK A;  4NLK A;  1BPY A;  5J2G A;  4KM5 A;  4WC1 A;  4WC5 A;  3OV7 A;  4E8F A;  4UBB A;  1ZQC A;  2PFN A;  3GDX A;  4M9L A;  1XSN A;  3C2M A;  1ZQQ A;  4O9M A; 
#chains in the Genus database with same CATH homology
 5IIN A;  5IIO A;  3WFR E;  4NY8 A;  4QZG A;  7ICS A;  4F5P A;  4R66 A;  1ZQN A;  2BCQ A;  5J2C A;  4NLN A;  3NYB A;  3AU2 A;  4TUR A;  4YMN A;  4JWM A;  2ZHB A;  5J0Q A;  4UAY A;  3AQM A;  4KLD A;  1VJ7 A;  9ICH A;  1NOM A;  5J2J A;  4YD1 A;  5III A;  5J0W A;  4PHP A;  3RJI A;  2ISP A;  2DVI A;  8ICI A;  3HX0 A;  4X4R A;  5CB1 A;  5CP2 A;  1BPE A;  9ICB A;  4I2A A;  3JPR A;  4RQ1 A;  5CWR A;  1ZQH A;  4FHP A;  1ZJN A;  8ICU A;  8ICQ A;  4WC4 A;  3WFQ E;  4KLF A;  5DBC A;  4RT3 A;  1ZQE A;  2NRK A;  4NKT A;  4X4O A;  4X4S A;  4DO9 A;  4E80 A;  7ICO A;  4FH3 A;  5J0O A;  1UEU A;  1Q79 A;  1HUO A;  2IHM A;  2GWS A;  4JWN A;  8ICX A;  4I29 A;  3UPS A;  3WFP A;  5BOL A;  4QZ8 A;  3V7K A;  4KLU A;  2ZH2 A;  3H39 A;  3C18 A;  3OVB A;  1OU5 A;  3UQ0 A;  4WC2 A;  3MGI A;  9ICP A;  2FMP A;  4FHV A;  4R63 A;  3JPN A;  5EOZ A;  3RH6 A;  3H38 A;  1ZQB A;  8ICW A;  4FHX A;  5J2H A;  4EBK A;  4DOC A;  9ICK A;  3ISD A;  4UB4 A;  3ISB A;  4X4V A;  4K4G A;  5DB6 A;  4M9G A;  5HRF A;  3JPO A;  3TFR A;  4I28 A;  7ICU A;  1JN3 A;  8ICL A;  3RJF A;  4I2I A;  8ICB A;  4X4P A;  3JPS A;  4M04 A;  5HRB A;  2DRB A;  4F5R A;  1XSP A;  4X4U A;  5D49 A;  5J2F A;  3UQ2 A;  2ZH5 A;  4LZG A;  4PHE A;  3RJJ A;  2O5A A;  9ICN A;  4UD5 A;  5J0Y A;  3RJH A;  7ICM A;  3UXN A;  4I2H A;  3WFO A;  3V72 A;  4XQ7 A;  4PGY A;  4UBC A;  4RQ5 A;  7ICQ A;  4MFF A;  4GXJ A;  3H37 A;  3JYY A;  4I2E A;  4YD2 A;  4UB1 A;  4XQ8 A;  3C5F A;  1R8C A;  4TUQ A;  5HRL A;  4KLJ A;  3OGU A;  1RPL A;  3JPT A;  4QZA A;  5HRD A;  1ZQA A;  1ZQF A;  1ZQW A;  5J2K A;  9ICO A;  4M5D A;  4DOB A;  4QZD A;  4RQ8 A;  5DBB A;  1TFW A;  5D46 A;  4X4N A;  4FH5 A;  2I9G A;  4AT8 A;  5HHI A;  3B0Y A;  1ZJM A;  4YCX A;  3AQL A;  4PGQ A;  7ICV A;  1ZQG A;  4UB5 A;  9ICC A;  5J0P A;  1R8B A;  3OVA A;  4K4H A;  4RQ2 A;  9ICW A;  4R65 A;  7ICJ A;  1NO5 A;  4LVS A;  4X4T A;  4XA5 A;  1KNY A;  4S3N A;  2PBE A;  4ATB B;  2P66 A;  4RWN A;  8ICP A;  2ID1 A;  4M9N A;  5J2I A;  2O1P A;  2PXI A;  1RZT A;  1MIW A;  2ZH9 A;  2VAN A;  4WC7 A;  1JQR A;  9ICR A;  4X0A A;  3OUY A;  2M2T A;  1ZQD A;  5DB8 A;  5J2B A;  4O5E A;  2BE3 A;  5DKW A;  4I2G A;  8ICV A;  7ICF A;  4WBZ A;  3RH5 A;  3LQC B;  1HUZ A;  4X5V A;  5DEC A;  4NLZ A;  7ICR A;  4KLI A;  4KLT A;  4EBJ A;  8ICF A;  2M2V A;  1YLQ A;  2M2W A;  4RWO A;  4UB2 A;  4TUS A;  2RFF A;  3UPQ A;  4UD4 A;  4RPZ A;  5IIM A;  2BPF A;  4LZD A;  7ICT A;  4QZ9 A;  5D4B A;  5DBA A;  4WCW A;  5HRG A;  4RWQ A;  5J2E A;  1TV9 A;  5BPC A;  5CHG A;  4F5N A;  1KEJ A;  1VFG A;  8ICC A;  3MGH A;  4P4M A;  4YMM A;  5DDM A;  4UB3 A;  4IQU A;  1R8A A;  8ICN A;  1BPX A;  8ICZ A;  2Q66 A;  2ZH4 A;  8ICA A;  3RH4 A;  4O5C A;  8ICR A;  4KLS A;  4E7X A;  4NKU A;  7ICN A;  3HWT A;  9ICL A;  3TFS A;  4I2F A;  4RWP A;  4QZH A;  1FA0 A;  5J0T A;  5HRK A;  4FHW A;  4KLL A;  5IIJ A;  1JAJ A;  4AT7 B;  8ICO A;  4IG8 A;  4YN4 A;  7ICI A;  3UXO A;  4WC3 A;  1MIY A;  3H3A A;  4YMO A;  5HRI A;  3B0X A;  3LK9 A;  4DOA A;  3RJG A;  4RQ0 A;  2BCV A;  4M0A A;  1ZQX A;  3JPP A;  4RPX A;  2ZH7 A;  4AT9 B;  3UXP A;  1ZQL A;  1Q78 A;  9ICU A;  4WBY A;  1ZQJ A;  7ICL A;  2M2U A;  4XUS A;  8ICG A;  3HJ4 A;  1MQ3 A;  9ICT A;  1ZQO A;  4I2J A;  4MFA A;  1ZQS A;  4I2B A;  1PX5 A;  2BPG A;  8ICY A;  2BCS A;  5DDY A;  9ICA A;  2FMS A;  3C66 A;  2BCR A;  4FO6 A;  3RJK A;  1ZQV A;  4PHD A;  5HRE A;  7ICH A;  4MF2 A;  3V7L A;  4NXZ A;  4QZC A;  8ICH A;  9ICF A;  1ZQT A;  1ZQP A;  4RQ6 A;  2DR7 A;  5CJ7 A;  4MF8 A;  8ICS A;  4P4O A;  4M47 A;  2ZHA A;  1R89 A;  3MDA A;  7ICP A;  3HW8 A;  2DRA A;  5HRH A;  1ZQU A;  4P2H A;  5HR9 A;  4KLE A;  4IQW A;  8ICM A;  4XRH A;  4O5K A;  1XSL A;  4RQ7 A;  4KLM A;  5F2V O;  4QZI A;  4Z6E A;  4KLO A;  1TVA A;  8ICT A;  5DB9 A;  4RQ4 A;  5J0U A;  1KDH A;  1TFY A;  1ZQR A;  4I2D A;  4KLH A;  1UET A;  1BPZ A;  2ISO A;  3AQN A;  3AQK A;  2ZH6 A;  4MFC A;  8ICJ A;  5BOM A;  4R64 A;  9ICV A;  3PML A;  1ZQY A;  5DB7 A;  4AT8 B;  4Z6D A;  4NM2 A;  4I27 A;  3C2K A;  4I2C A;  5J0S A;  3JZ0 A;  1ZQI A;  5HC9 A;  3L9D A;  4AT7 A;  4KLQ A;  4IQV A;  5J29 A;  3PNC A;  2DR5 A;  9ICE A;  9ICM A;  4UAW A;  3WFS C;  5CR0 A;  4Z6F A;  3MBY A;  5DED A;  5J2D A;  9ICI A;  2DR8 A;  1ZQM A;  8ICK A;  3V7J A;  9ICS A;  4F5O A;  4M9H A;  1BPD A;  4AT9 A;  3C2L A;  2PFP A;  4X0B A;  9ICX A;  3HIY A;  4QZF A;  4TUP A;  4M9J A;  2HHP A;  3C5G A;  2PFO A;  4PPX A;  3RJE A;  4WC6 A;  1BPB A;  5TZV A;  4QZE A;  5IIK A;  3PMN A;  4RPY A;  5HHH A;  9ICG A;  4LT6 A;  2ZH8 A;  1ZQZ A;  5J2A A;  5J0X A;  1MQ2 A;  4FHY A;  5J0R A;  3OVS A;  3AUO A;  3OUY B;  4KLG A;  4IQT A;  3ISC A;  9ICJ A;  4M2Y A;  4GXI A;  3JPQ A;  2DR9 A;  1UEV A;  2PFQ A;  4K4I A;  4RT2 A;  4NM1 A;  8ICE A;  4X4Q A;  2BPC A;  4EP7 A;  4Z6C A;  5CA7 A;  4WC0 A;  3HJ1 A;  1WOT A;  7ICK A;  3MDC A;  4QZB A;  2W9M A;  4F5Q A;  1MIV A;  4P4P A;  2ZH1 A;  3AU6 A;  4PHA A;  1ZQK A;  1JMS A;  1V4A A;  2BCU A;  2ZH3 A;  4ATB A;  4UAZ A;  5IIL A;  7ICE A;  1F5A A;  4PH5 A;  2FMQ A;  7ICG A;  4PGX A;  9ICQ A;  4RQ3 A;  3K75 D;  4GXK A;  4NLK A;  1BPY A;  5J2G A;  4WC1 A;  4WC5 A;  3OV7 A;  4E8F A;  4UBB A;  1ZQC A;  2PFN A;  3GDX A;  4M9L A;  1XSN A;  3C2M A;  1ZQQ A;  4O9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...