4UB1A

Dna polymerase beta product complex with a templating adenine and 8-oxodgmp, 90 s
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
317
Chain Sequence
NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 317
sequence length 321
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub1A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub1A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub1A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub1A03
3LDAA 3Q8KA 1S0NA 1S76D 2DPJA 5DB8A 1HUZA 4O9MA 4RWPA 1ZQDA 5J0PA 4JV0A 5J0RA 3M9OB 2DR9A 4DL3A 4DQQA 3L9DA 3Q8LA 1S0OA 4DSKA 4EZ9A 1BPYA 4KLEA 4QZIA 3ZD8A 5DLGA 2BHNA 2BPFA 4KLJA 4J9NA 8ICHA 1YLQA 4X4VA 1ZQZA 1L5UA 5HRHA 4YD2A 4I2DA 4PHPA 3GFKB 3RRGA 4QZAA 4FHXA 1SL1A 4AT7A 4BGDA 4YQWA 2HHQA 2BPGA 2IBKA 4NM1A 4JV2A 3E2EA 1NK9A 3EZ5A 9ICXA 2BCUA 1BVSA 3SI8A 4DOAA 4F91B 2FMQA 3T5LA 3C21A 1A76A 2RDIA 4R63A 2W9MA 4ECZA 2JEFA 2R8GA 3T5HA 3PY8A 4K4HA 4KLIA 7ICNA 7ICPA 1BNOA 5DG9A 4EBDA 9ICCA 4O3QA 1T8EA 4O5KA 7ICRA 5KFZA 2V4RA 1UT5A 3RJJA 2M2TA 8ICTA 1AROP 4FH5A 2P66A 2ZTEA 3PO4A 4NLKA 3OSPA 5KFBA 2AQ0A 2BGWA 3B0XA 4I2IA 4R8UA 5F9LA 3NGDA 1ZQXA 4EBCA 3Q8QB 2BQRA 3ISCA 2UVVA 4EYIB 4J9LA 4KLTA 9ICAA 1ZQEA 4ECQA 3AQMA 4E80A 4BDPA 1UA1A 4RWNA 4P4MA 4F5OA 4DQSA 7ICTA 1TFWA 4QW9A 4DL7A 4XA5A 9ICGA 3QZ8A 2UVUA 4B9LA 2W9AA 3PMLA 5L1JA 2XY7A 4IRDA 4IR1A 5J0YA 9ICIA 2DR5A 2ZH2A 4J9SA 3OHAA 1C7YA 2BCVA 1Z3EB 2BKEA 4ECUA 4J9OA 1PZNA 4GXIA 4RNOA 1UA0A 1S77D 1SKWA 8ICRA 3MDCA 4M6WB 3PMNA 2FPMA 5J2EA 2C2EA 1BPEA 5D4BA 5J2KA 1X9SA 2M2WA 1MIVA 3WFRE 4DF4A 4IQTA 1FA0A 1MIYA 4X4SA 4F50A 8ICBA 3SV3A 5KFKA 1HUOA 5DG8A 2W9CA 4F5NA 4QWAA 2ZTCA 2FMSA 4KLMA 4F5QA 4RU9A 5KFYA 1U4BA 8ICWA 4O0IA 3TAQA 3N4MB 1N48A 3C2MA 5KG1A 2AGPA 3RR8A 3AQNA 3C66A 5F2VO 1ZQFA 5CP2A 1BPDA 1Z00A 3EYZA 4DQIA 4EYHB 8ICNA 2F1IA 3MR2A 4EZ6A 5KFXA 3GV5B 5KG3A 1KDHA 2Y1IA 5HP4A 4ELUA 2PFOA 2JEIA 2HVIA 4RUAA 4K4GA 2O1PA 3LWMA 4AT7B 4WBZA 4O3OA 7ICJA 3RBEA 3MFHA 4UAYA 1BGXT 2HHXA 8ICUA 2DRAA 3PVXA 5HHHA 4YXMA 5KG6A 2P6UA 3HT3A 3OJSA 9ICPA 5DGAA 3UQ2A 4O5CA 2W9BA 8ICJA 5BOMA 2BE3A 3ZDAA 4F2RA 3OVAA 3KHRA 3RBDA 3UXPA 4NY8A 8ICFA 3OUYA 3UXOA 4GLXA 1ZQIA 4DFJA 1ZQNA 3OHBA 4F2SA 1QSYA 4R8UB 1V9PA 2KZ3A 3GIKA 4DL6A 3RJKA 4C8LA 4JWNA 4I2GA 3H8WA 4ECRA 4CCHA 4ATBA 8ICAA 1A77A 4YG2A 5KT3A 8ICXA 4FBUA 1XSLA 1TFRA 4QWDA 3AU6A 5DB9A 2R8IA 3V7JA 3TAPA 7ICQA 4DSIA 2HHUA 9ICHA 9ICRA 5KG4A 4GXJA 3TQ1A 4YXJA 5J2IA 4M2YA 3TFRA 4I2AA 7ICLA 3HJ1A 1NK0A 4B9MA 3V72A 3C1YA 2PXIA 4FS1A 1U47A 2J6SA 2UVWA 2F1JA 4DSFA 4AT9A 3GV7B 2GWSA 5HRBA 4RWOA 5J2FA 3N97B 1DK2A 5DDMA 1Y88A 3G6XA 1ZQAA 4X4TA 2VA2A 1L3VA 5KT2A 3G6YA 3RJFA 1ZYQA 4UB2A 4GC6A 2ZH6A 4PHEA 4PGQA 4M04A 2W9CB 1ZQVA 4DF8A 2HHSA 4KITB 1KNYA 4B9VA 4YVZA 8ICCA 3Q8RB 4ED7A 3TARA 5F9NA 5J0WA 4RPZA 4M9JA 2DRBA 3WFQE 3MDAA 4WC2A 2BDPA 2MUTB 1Z00B 3H4BA 3SYZA 3ZDBA 4ED2A 1NKBA 4KLDA 4X4PA 9ICVA 4QZBA 2VA8A 5J0OA 1U48A 4O3PA 4QZGA 3OSNA 3G6VA 3T3FA 2IMWP 4I2JA 4I28A 2ZH8A 3RB3A 1BNPA 1XS9D 4P4OA 1QSLA 2ZH7A 1RXWA 1JN3A 5L1KA 1T7PA 5IIOA 4AT8B 4MEYA 4RQ3A 4F92B 5KFJA 8ICSA 4TURA 1ZQMA 2ID1A 1NJYA 1F5AA 1WCNA 4PPXA 3UQ0A 4WC7A 2NRWA 5KT4A 4KLLA 1U49A 4I2EA 4F4WA 4M9GA 5HR9A 9ICSA 4UB5A 3OV7A 3MGIA 2W9BB 4DSEA 1ZQGA 4LZGA 1JIHA 1K1QA 4RQ8A 2XGQA 5KFUA 2HHVA 7ICHA 2AGQA 9ICKA 2ASLA 4BWJA 2NRXA 4QWBA 3MR3A 1R8AA 5DDYA 4F8RA 5HREA 3OUYB 1ZQKA 5HRKA 2I1QA 5J0SA 2NRTA 4RQ5A 1L3TA 4ATBB 2C28A 4O3NA 4DS5A 1R89A 3RH6A 3ZDEA 3RJIA 3PR5B 2I9GA 3NTUA 1ZQUA 2Q0ZX 4QW8A 5DBAA 2XGPA 3GDXA 2Q66A 5KT6A 3GIMA 4EEYA 3HW8A 4X4RA 3PW4A 5KFLA 5DG7A 2BCSA 4NKUA 4YCXA 2Y1JA 4B9SA 8ICLA 4PGYA 4FBTA 4I2HA 7ICFA 1KSPA 2ZH3A 1TV9A 4AT9B 1NKCA 4DSLA 2XY5A 2OWOA 5DBBA 3RB6A 5IIKA 8ICMA 4ECSA 4EP7A 8ICIA 1DGSA 4XUSA 1WCLA 3FYHA 4DL4A 4WC0A 3V6HA 4IRCA 4RQ7A 3JPOA 4DL5A 1MIWA 3M8RA 4DFMA 3RH5A 4PHDA 2IA6A 3C18A 2DR7A 5DB7A 1JXEA 5DKWA 1JMSA 1DK3A 1ZQJA 4UAZA 2J6TA 4KLOA 4YD1A 3BJYA 4I2FA 2ASJA 3BQTA 4ECTA 4UD4A 1S9FA 4P4PA 8ICGA 4RQ6A 2DPIA 4P2HA 4DOBA 5EOZA 2DFLA 4Q44A 1KFSA 2JEJA 4B9TA 4FHYA 3PW7A 3KHGA 4RPYA 1D9DA 1SL0A 4IQWA 3H4DA 4MEXA 3H8SA 7ICSA 4KMUA 4QZCA 4C8NA 3H38A 4YMMA 1B22A 5J0TA 4Z6CA 4NLZA 4ECYA 1S0VA 4KTQA 5IINA 3EWAA 4QZ9A 4ED1A 2PI5A 2MUTA 4MF8A 1MC8A 4RQ2A 3HJ4A 4HYKA 3OJUA 3HPOA 3MR6A 3C5GA 1ZQTA 4ECVA 4WC6A 4GXKA 3T5KA 3H39A 2HHTA 4I2CA 1RYSA 4EBKA 5HRGA 9ICJA 4XQ8A 1ZQPA 5J29A 3H40A 4AT8A 5J2DA 4TUQA 3KHHA 3AQKA 4BWMA 2ALZA 3GQCA 1NKEA 4C8OA 4Q43A 3IM1A 3JPSA 1UETA 7ICGA 3M8SA 5HRLA 3JZ0A 4S3NA 4UBBA 5HC9A 3RB0A 4M9LA 2HVHA 4QWEA 2F1HA 5KFOA 4IG8A 1RPLA 3HP6A 8ICZA 2ATLA 1ZQHA 3C23A 4DQRA 7ICEA 1UEVA 3M9NB 4QZ8A 1B43A 2BPCA 5C5JA 5KG7A 5KFMA 4DFPA 3QE9Y 9ICMA 1SL2A 1NK7A 1EXNA 2UVRA 4E8FA 2KP7A 4KN4A 2ZJ5A 5DQIA 4PHAA 1R8CA 1JX4A 3Q8PB 3V7LA 1D8YA 2J6UA 1S10A 2ISPA 2ZH4A 5HMLA 5KFHA 3MR5A 2FLPA 3MABA 1NK5A 4J9PA 1S97A 5HRFA 1KFDA 4JK1A 8ICKA 4YR3A 3QEBZ 4QZFA 2BCQA 5HHIA 1XSPA 4YP3A 5CJ7A 4RQ4A 5IIMA 4M5DA 5D49A 2AQ4A 4ED0A 3HX0A 1S0MA 2FLLA 4M47A 3WFOA 4RPXA 1VJ7A 1QSSA 5HRIA 4IRKA 5KFNA 2XO7A 4F4XA 4ECWA 2A1JA 4F3OA 3IHQB 3GILA 3RRHA 3FDSA 1TVAA 5CWRA 4J9RA 1Q78A 2B21A 4KLSA 3OGUA 9ICNA 1V4AA 4FHVA 2RFFA 1RZTA 4R66A 5L1LA 5DEDA 4Q8FA 1COOA 8ICYA 5KFCA 4KLUA 5KFDA 9ICLA 1UT8A 5L9XA 4QZEA 1NK4A 4MFCA 4RNNA 3Q8SB 2XCPA 1NJWA 9ICFA 2PFQA 5EWEA 4B9UA 2R8JA 1PX5A 4Z6EA 3JYYA 1VFGA 1KTQA 4ED6A 4Z6DA 4LVSA 4J9QA 2P6RA 2AU0A 5L1IA 3RTVA 2JZBA 4XRHA 4TQSA 2XC9A 5J2HA 4MFAA 5EWFA 4DSJA 3C1ZA 4R65A 3BQ2A 4ED3A 4ZH4A 9ICEA 5BOLA 4C8MA 3BQ0A 1UEUA 4UD5A 4E7XA 5J2AA 4X4UA 2NRZA 4TUPA 3KHLA 5DQGA 3PW2A 5KFGA 3JPNA 5KFIA 5J2BA 3H8JA 1KEJA 4M9HA 3ISDA 5KG2A 1T3NA 1RXVA 2LYHA 1TKDA 2PFPA 4I2BA 4WC1A 4EBJA 5KFAA 4YMNA 5D46A 4GC7A 4ECXA 3TFSA 4C8KA 9ICOA 2DVIA 1MQ3A 2BCRA 4UB4A 3UPSA 3JPPA 5KG0A 2ZUBA 3RH4A 3LWLA 1ZJNA 3RJGA 2ZHBA 2HW3A 1D8LA 9ICQA 7ICUA 5TZVA 5J2CA 9ICUA 1TAUA 1KFTA 2NRKA 5J0XA 1TFYA 3BQ1A 2KFZA 1CUKA 4ELTA 4RQ0A 2R8KA 1OU5A 1JXLA 4IQUA 4J9KA 1TK8A 1X2IA 4O5EA 1RYRA 4UB1A 4O3SA 4NLGA 4TQRA 4FHWA 3RJHA 4E0DA 4JWMA 3V7KA 3H3AA 3SV4A 3RAXA 1IM4A 4YFKA 4KLQA 2C2RA 4BXOA 1QLNA 2A1JB 3C2KA 1MQ2A 4JV1A 3PO5A 5KFRA 2HHWA 2V9WA 4M9NA 7ICMA 1TAQA 4QZHA 2AGOA 4DO9A 3PW5A 4F5PA 3LK9A 8ICQA 1T4GA 2WTFA 3GV8B 5DLFA 1X9WA 1BPBA 4LZDA 2BR0A 3HIYA 1XC9A 3AQLA 4X4QA 3WFSC 5CA7A 4G3IA 1NO5A 8ICPA 2IHMA 2H5XA 5J0QA 1KLNA 1D9FA 1U45A 2BQUA 1HJPA 2PI4A 4X5VA 4NLNA 4X4OA 2ASDA 1IXRA 4YN4A 4DOCA 1XSNA 2JZBB 5HMMA 1QTMA 5IIJA 3TI0A 2HHPA 3JPQA 1TK5A 1ZETA 5IIIA 4UQGA 4WC3A 4M0AA 3JPTA 3HWTA 4X0BA 8ICEA 1H38A 1JAJA 1ZQWA 1NJZA 4WBYA 2C2DA 5KFEA 3K4GA 4F93B 4B9NA 4DEZA 5KFFA 2JEGA 3V6KA 1KRPA 5CR0A 4IR9A 4I29A 9ICWA 3PNCA 2M2VA 5J2GA 4QZDA 7ICVA 2KZMA 1BPZA 4ELVA 4ED8A 2NRVA 2XCAA 1JQRA 1K1SA 4FO6A 3EW9A 1ZQLA 3UXNA 1XO1A 3K75D 5KFQA 3PX0A 1NJXA 4KLFA 5HNKA 4DFKA 1SZPA 3BDPA 1MSWD 4WC4A 8ICVA 4RT3A 2KZZA 3TANA 3RR7A 1N56A 3EPIA 1L3SA 2BQ3A 4YMOA 4FH3A 3QZ7A 2C22A 1BPXA 9ICTA 4X0AA 4PH5A 3JPRA 1NK8A 4RNMA 3AUOA 3H7IA 4O3RA 2VA3A 2FPKA 3C2LA 3RAQA 4PGXA 4UBCA 5DGBA 4NM2A 5KT5A 4RZRA 2R8HA 2PFNA 2O5AA 2ZH1A 3UPQA 2DR8A 1ZQRA 2XY6A 1X9MA 4FHPA 4Q8EA 5KTQA 3ORYA 2IHNA 2KTQA 3C5FA 4BXOB 5KT7A 3MFIA 4J9MA 3KTQA 2ZJ8A 4DQPA 5J2JA 2FLNA 3PW0A 3ETLA 3LQCB 3ISBA 2ZH5A 3ZDCA 1U9LA 3GIJA 1NK6A 5CHGA 5DECA 3ZDDA 5KFTA 7ICKA 1ZQOA 2W8KA 4MF2A 4EBEA 3ZD9A 5BPCA 4UAWA 2KN7A 2V4QA 2M2UA 5IILA 4Z6FA 1ZQYA 1R8BA 3M9MB 3RJEA 5KFPA 4XQ7A 4WC5A 4DLGA 1SKRA 2ZH9A 5J0UA 2RDJA 3THVA 1WOTA 3T5JA 3WFPA 4QWCA 1ZQBA 3V6JA 4NKTA 4R64A 4KN7A 2ISOA 5DB6A 4KLGA 9ICBA 1TK0A 5KFSA 3RB4A 3OVBA 2AJQA 4LT6A 3PR4A 2ZTDA 4JUZA 5EWGA 1NOMA 5HRDA 1ZJMA 2FMPA 3SZ2A 3PX6A 2ZHAA 4RQ1A 2KFNA 7ICOA 4I27A 4DLEA 5JUMA 3AU2A 5KG5A 4IQVA 5DQHA 2ZUCA 1Q79A 1L3UA 3PV8A 1XWLA 1ZQCA 4RUCA 4DS4A 4RT2A 3QEAZ 1SKSA 8ICOA 4MFFA 4F5RA 2ZJAA 4K4IA 4KLHA 4RWQA 4FS2A 5DBCA 2MAXA 4F4KA 4YR0A 4WCWA 4TUSA 1LV5A 1NZPA 1ZQSA 4YR2A 4Q45A 3GIIA 2W8LA 4F4YA 1LB2B 1XU4A 4NXZA 2VANA 3B0YA 4M6WA 3H37A 5KFWA 1DOQA 1CEZA 3MBYA 7ICIA 2PBEA 2M9NA 3OVSA 5KFVA 3MGHA 1ZQQA 4DL2A 4UB3A 3PX4A 4F4ZA 3NYBA 2ZUDA 2FPLA 4DWIA 4X4NA 3EPGA 3Q8MA 5CB1A
chains in the Genus database with same CATH superfamily
4BJQA 4O9MA 5CRXA 2G08A 3WK6A 2G06A 3L9DA 4EZ9A 2WF9A 1BPYA 3ETRA 4QZIA 4J9NA 1ZQZA 1L5UA 4K99A 4O68A 4YD2A 3GFKB 4FHXA 2JR5A 2HHQA 3EZ5A 1UPHA 1BVSA 2JEFA 4R63A 4EBDA 2AH5A 4O3QA 1T8EA 7ICRA 3RJJA 1AROP 1FO4A 4Y2PA 3B0XA 4R8UA 4B9SA 3NGDA 4EBCA 2UVVA 2JXJA 1ZQEA 4ECQA 4OAGA 4RWNA 3PHZA 4F5OA 4QW9A 2ZIWA 3KZXA 2UVUA 2W9AA 4B9LA 2XY7A 4IRDA 2K8AA 3K1ZA 4HX0A 2KG5A 4J9OA 1PZNA 1JROA 4FFDA 5J2EA 2C2EA 1BPEA 5D4BA 2W55A 3NRWA 8ICBA 3SV3A 2B56A 4F5NA 4QWAA 2ZTCA 1Z19A 4F5QA 5D63A 3N4MB 1N5XA 3AQNA 3C66A 4Y2VA 3TADA 1Z00A 4EYHB 5KFXA 5AI5A 2PFOA 4RUAA 5ALLA 2ZIVB 5KL1B 2I6XA 3F53A 7ICJA 5CEHA 4EENA 5HHHA 5KG6A 3OJSA 5DGAA 2W9BA 2QB1A 3ZDAA 1QQ6A 3UXPA 4GLXA 1C20A 1ZQNA 3OHBA 4DL6A 3PSIA 4ATBA 4CCHA 4OO1J 5ALHA 8ICXA 4YG2A 2BBJA 2YMQA 1XSLA 3TAPA 4QWDA 4UD5A 5DB9A 7ICQA 9ICRA 4GXJA 5E79U 4YXJA 5J2IA 4M2YA 3TFRA 5HR6A 2YMLA 3V72A 2GAFD 3HJEA 5B3PA 5HRBA 1COKA 3G6XA 1Y88A 4X4TA 1ZQAA 1K5OA 1L3VA 4GC6A 4PGQA 2W9CB 1ZQVA 5AM5A 3TARA 3WFQE 3MDAA 3SYZA 4X4PA 3G6VA 3VCBA 3RB3A 1BNPA 1XS9D 4P4OA 1SZHA 5L1KA 4F92B 5ALTA 2ZXIA 5EE0A 1SWWA 1NJYA 2O6KA 2E1EA 3SAGA 3QUBA 5KT4A 4M9GA 5HR9A 4F4WA 4Y2RA 2F8LA 2OCEA 1N60A 5AM4A 2I1QA 4RQ5A 1YZ7A 3CYMA 2C28A 1R89A 3RH6A 3NTUA 2Q66A 5DG7A 5AICA 4PGYA 5D62A 1IG6A 1TV9A 2PMZF 1Q3UA 3L5KA 5DBBA 3V6HA 4HAIA 3JPOA 3C18A 1PK1B 1DK3A 1JXEA 4PL1A 1ZQJA 4UAZA 4YD1A 3BJYA 2OH2A 4Y2UA 2HN2A 4RQ6A 4DOBA 4J03A 3SENA 3PW7A 1A0PA 4KMUA 2YX8A 1B22A 2B0CA 4Z6CA 1S0VA 1UQVA 5IINA 3MGVA 4ED1A 4CGZA 4MF8A 3PSPA 3HPOA 3MR6A 3C5GA 2KJ5A 4ECVA 4WC6A 4GXKA 3H39A 2HHTA 4EBKA 1RYSA 3MCRA 9ICJA 4XQ8A 1ZQPA 1T94A 3KHHA 3AQKA 2KHQA 2KK0A 3IM1A 3JZ0A 2KICA 3T79A 2ATLA 2HOFA 2K4IA 4QZ8A 1B43A 2JMGA 5KG7A 2GO7A 5TISU 2KNJA 1SL2A 1NK7A 4KN4A 5DQIA 2LI6A 1R8CA 4FZLA 3Q8PB 2K8BB 1J2NA 3MR5A 2FLPA 3MABA 5HRFA 1KFDA 4MHVA 5IIMA 3QU4A 2W11A 3WFOA 1VJ7A 4F4XA 1ZXIA 3R9KA 3IHQB 3RRHA 3ERCC 4K9AA 1L8LA 4Q8FA 4MKPA 3Q8SB 2PFQA 4WOYA 4EX6A 1ED1A 1LKYB 2CXYA 2KHVA 1X6IA 3UMCA 4OD0A 1VFGA 4ED6A 4Z6DA 3IP4B 2NO5A 5L1IA 4TQSA 4DSJA 5EWFA 3BQ0A 4E7XA 2NRZA 3PW2A 4PZOA 5ALJA 1P7DA 3JCFA 3TFSA 4WQLA 2BCRA 3UPSA 2EQYA 3RH4A 2OEHA 3SEIA 7ICUA 5J2CA 4C4RA 2GOLA 3BQ1A 5B66U 2KFZA 4RQ0A 2R8KA 3NVWA 2YMMA 1S8OA 4NV0A 1RYRA 1NI3A 4NLGA 2FJ6A 4JWMA 2KE7A 3H3AA 3WKEA 3RAXA 2C2RA 4OJLA 5EE3A 1HIWA 5KFRA 4QZHA 3PW5A 1T4GA 1XC9A 3AQLA 3WFSC 2IHMA 1KLNA 1D9FA 2ASDA 4C0ZA 2E3TA 1XSNA 5IIJA 3TI0A 4NLBA 1TK5A 1SWVA 5IIIA 4WC3A 4M0AA 1J2MA 2F3NA 4Y2TA 5CR0A 4CF3A 4I29A 9ICWA 5J2GA 3E0FA 5G5HA 5AK6A 1BPZA 4ED8A 1DGJA 4DCCA 1XO1A 1PK3A 1SZPA 4WC4A 1MSWD 3TANA 4FH3A 4YMOA 3JPRA 2VA3A 3RAQA 4BX9C 1VDVA 4PGXA 4UBCA 4QIWC 2ZH1A 2PFNA 2IHNA 3F2CA 1RM6C 2EAOA 3M6ZA 4DQPA 3LQCB 5AK4A 2E8MA 3ISBA 2JV3A 4C80A 5DECA 2R18A 3NUQA 7ICKA 2W8KA 3ZD9A 1KW4A 4UAWA 2KN7A 2NYVA 2M2UA 1ZQYA 1R8BA 5KFPA 4XQ7A 4WC5A 2EAMA 1SKRA 2ZH9A 5J0UA 1WOTA 3QNMA 3WFPA 3V6JA 4R64A 3D2NA 2ZIUA 2AJQA 4LT6A 2ZTDA 2F76X 5ALKA 3PX6A 2ZHAA 4RQ1A 2KFNA 4I27A 1QQ7A 4Y2SA 2DF4B 3PV8A 1ZQCA 3TADC 4DS4A 1SKSA 3ALRA 4RWQA 2MAXA 2YQEA 4TUSA 1LV5A 3NVZA 3PSTA 4Q45A 2IUBA 2VANA 4M6WA 5KFWA 2HI0A 3KKAA 4RQNA 2PBEA 4C7ZA 5KFVA 3VC8A 2RQ5A 2AXTU 2ZUDA 4DWIA 1X9XA 3Q8MA 3LDAA 5DB8A 4OJPA 5J0PA 4JV0A 3M9OB 3F5EA 4DSKA 4KLEA 4LEZA 3ZD8A 4KLJA 1YLQA 5ALZA 8ICHA 4IL6U 3WU2U 4PHPA 5ALPA 2B51A 2LKYA 3C29A 2DGZA 2BPGA 2IBKA 3E2EA 2E8PA 4C7YA 4ECZA 4RQMA 1BNOA 5HR7A 5D61A 3H0RB 5AM0A 4O5KA 5KFZA 4EELA 3GZFA 1Q3VA 2BGWA 4EV6A 5F9LA 3ISCA 4EYIB 3AQMA 2RLTA 3F2BA 4NXXA 1N61A 1TFWA 2IOHA 2A19A 4XA5A 9ICGA 3PMLA 4OJOA 2BKEA 8ICRA 4GXIA 1S77D 3MDCA 2FPMA 1MIVA 1X9SA 2M2WA 3WFRE 1JALA 4F50A 3IN5A 8ICWA 4O0IA 3TAQA 2AGPA 1PVRA 5CP2A 4BUGA 8ICNA 3IG8A 4EZ6A 2QKQA 5JTIA 2JEIA 2O1PA 3MFHA 5AKEA 2DRAA 8ICUA 2P6UA 5BOMA 3M1YA 4F2RA 1SXDA 3KHRA 5KL8B 9ICHA 1QSYA 4R8UB 2HDOA 3GIKA 4UASA 4I2GA 4ECRA 5AKZA 8ICAA 3AL0B 4FBUA 4X4QA 3AU6A 3V7JA 2R8IA 4DSIA 2ZIWB 3TQ1A 1X66A 3L4PA 4I2AA 2K4HA 3C1YA 2PXIA 2LPEA 3N7SC 4RWOA 3N97B 5ALRA 2VA2A 3G6YA 3RJFA 2ZH6A 4PHEA 3KD3A 4DF8A 2HHSA 5EE1A 2K89A 4B9VA 4YVZA 3SD7A 2DRBA 5J0WA 4RPZA 3PZPA 4M9JA 2BDPA 1Z00B 4ED2A 3IV6A 3OSNA 2EZYA 3ICXA 2F2AB 5KNIA 1QSLA 2QB0A 2ZH7A 1JN3A 5IIOA 2W3SA 1Z4OA 1F5SA 4TURA 3I28A 4NJ8A 3FC4A 1WCNA 3CW2C 1U49A 2KKVA 1SIJA 3LVVA 2W9BB 9ICLA 2VJ5A 1JIHA 1X40A 2ZXHA 1Z4NA 1CI4A 5J0SA 2JHDA 5ALWA 4ATBB 3RF9A 3PR5B 1ZQUA 5DBAA 3GDXA 3SMVA 1OXJA 4KM5A 5KT6A 3HW8A 3PW4A 2Y1JA 3TKAA 8ICLA 4I2HA 1KSPA 5IIKA 4IS7A 4ECSA 8ICMA 8ICIA 1WCLA 4XUSA 4DL4A 4RQ7A 1N5WA 4DL5A 4DFMA 4PHDA 5DB7A 2ASJA 3BQTA 1RQLA 1ZD5A 2WAQC 1V85A 4P4PA 8ICGA 2DPIA 2LYBA 4B9TA 1AQ6A 5AKJA 2WHEA 1SB3C 2DKXA 2PKEA 1D9DA 4IQWA 4MEXA 3H8SA 7ICSA 4QZCA 1VJ5A 2D8CA 1X6JA 2WB1F 3HJ4A 3OTQA 4O3MA 3T5KA 2HOIA 5HRGA 4EX7A 2F77X 3H40A 4UARA 4TUQA 1NKEA 3UMGA 7ICGA 2F1HA 2DBYA 4USAA 3AM9A 1V38A 2F44A 1RPLA 3AQEA 4NL9A 7ICEA 1SGGA 3QE9Y 5ALNA 1ZRNA 1JI7A 2UVRA 2ZJ5A 1L7PA 5GTHU 1D8YA 2J6UA 2ISPA 2ZH4A 4J9PA 2YMPA 4JK1A 2L5YA 8ICKA 2Y0SC 2BCQA 5HHIA 4YP3A 1PUZA 5CJ7A 1B0XA 2QARA 3NVYA 3IRUA 4K97A 2MU2A 1QSSA 3QX7A 5HRIA 4ECWA 1OUQA 4AYBF 1SV4A 4CE6A 2YY6A 4F3OA 4WH5A 2EANA 4O6AA 1TVAA 4J9RA 2G0AA 3OGUA 5L1LA 5KFCA 3K7DA 5L9XA 4QZEA 1NK4A 1NJWA 9ICFA 2R8JA 2JH1A 2P6RA 3RTVA 2JZBA 1WUDA 3ED5A 5AKIA 1UEUA 3BZKA 5J2AA 5DQGA 5KFGA 5ALMA 3H8JA 1D8BA 1RXVA 5KG2A 2LYHA 2PFPA 4EBJA 2IHOA 3OWGA 4YMNA 4GC7A 4C8KA 5J8YA 2EWRA 2ZIXA 2HW3A 4O69A 9ICQA 1KFTA 5TZVA 9ICUA 2B4VA 3WKCA 2KKPA 5ALXA 4ELTA 4K8VA 5B5EU 1TK8A 5CFTA 2W03A 4O5EA 4UB1A 4TQRA 1SV0A 2W04A 5G5GA 4YFKA 4PL2A 4BXOA 3C2KA 3L3FX 4JV1A 1TAQA 4ICAA 5DLFA 2WTFA 3GV8B 4A8EA 5AKHA 3N7PD 3DV9A 4G3IA 1NO5A 5J0QA 1HJPA 4X4OA 1IXRA 2Z7JA 2HHPA 3JPQA 1ZETA 4UQGA 1UHUA 3JPTA 3KKAC 8ICEA 2HN1A 4IC9A 2C2DA 5KFEA 4B9NA 5KFFA 3UMBA 4IR9A 4P0PA 2NRVA 2XICA 3U26A 4KLFA 3NVOA 3BDPA 1S5LU 4OAHA 3RR7A 1FFUA 5ALEA 2BQ3A 3KFUF 4X0AA 3H7IA 4FE3A 3C2LA 5DGBA 4RZRA 2DR8A 2E1FA 2XY6A 4OAIZ 5KTQA 3ORYA 2KTQA 2RHFA 5AIAA 5KT7A 4US9A 3ETLA 1U9LA 3GIJA 5CHGA 2KJ8A 2K8CB 4MF2A 5BPCA 1XO0A 5ALIA 2V4QA 5ALOA 3M9MB 3BS5A 3T5JA 1YT3A 4KN7A 5DB6A 5KFSA 3PR4A 4JUZA 4LEWA 3SZ2A 2BZFA 5JUMA 1WWUA 5KG5A 3WK9A 4IQVA 1O03A 4UATA 1UCVA 2P35A 1N63A 5AI6A 8ICOA 4F5RA 3BS7A 2KIVA 3DDHA 1ZQSA 4YR2A 2KVCA 4LJXA 3GIIA 4NXZA 1URJA 2JH7A 4F71A 1MA7A 3ZI4A 2M9NA 3PX4A 3EPGA 1N2XA 5CB1A 2GA9D 2H3FA 2NO4A 2DPJA 4RWPA 1ZQDA 3FAHA 2LHTA 3Q8LA 1S0OA 2CRXA 5DLGA 2BPFA 2HBJA 3IDWA 5HRHA 1JUDA 4CF5A 1N62A 1ZD4A 3RRGA 1O08A 4AT7A 4NM1A 4JV2A 2Q4TA 9ICXA 3SI8A 4DOAA 3T5LA 2RDIA 2W9MA 4KLIA 4FZMA 5JRTA 3T5HA 7ICNA 2PMZC 2ZIUB 3CP8A 3EUB2 2V4RA 1UT5A 2M2TA 8ICTA 4FH5A 5KFBA 4I2IA 1ZQXA 8ICVA 3Q8QB 2BQRA 4J9LA 4DL7A 3QZ8A 4NXUA 4IR1A 1IV8A 2DR5A 4J9SA 3OHAA 1Z3EB 2N1RA 8ICYA 1UA0A 4RNOA 1SKWA 4M6WB 3PMNA 3QYPA 4X4SA 1HUOA 4F72A 5DG8A 2FMSA 2OYYA 4KLMA 5AKYA 4RU9A 2EZXA 3M7DA 4Y2XA 3C2MA 3RR8A 1ZQFA 1BPDA 4DQIA 3GV5B 5KG3A 1ZRMA 1KDHA 3CRXA 3LYSA 2WF8A 5HP4A 4ELUA 3WKBA 5JU5A 2HVIA 4K4GA 5ALFA 4WBZA 4O3OA 2MRLA 4UAYA 2XIDA 3PVXA 3ER9B 3HT3A 9ICPA 4O5CA 2BE3A 2LM1A 4NY8A 1ZD3A 8ICFA 3OUYA 1ZQIA 4DFJA 3RJKA 4JWNA 1A77A 5KT3A 3S6JA 1DRGA 1TFRA 2HHUA 1HEKA 7ICLA 3HJ1A 4B9MA 2J6SA 2UVWA 2D3DA 2F1JA 4DSFA 4AT9A 2GWSA 4PJ0U 3F2DA 5J2FA 1DK2A 5DDMA 5KT2A 4UB2A 3HKZF 4M04A 3DEEA 4KITB 1KNYA 5K4LA 8ICCA 3Q8RB 4Y2YA 5T14A 2HOQA 1FEZA 4WC2A 2MUTB 5H2FU 3H4BA 3ZDBA 4KLDA 4WJ3B 1U48A 4QZGA 2IMWP 1RXWA 4MEYA 4RQ3A 5EE9A 8ICSA 4QJFB 3M6KA 4PPXA 4NL9C 4WC7A 2NRWA 4I2EA 3EF2A 9ICSA 3OV7A 4DSEA 1TE2A 4RQ8A 4JLZA 2XGQA 7ICHA 9ICKA 3MR3A 1Q46A 5AK3A 1ZD2P 4F8RA 1ZQKA 2G09A 2NRTA 2KSOA 1L3TA 4DS5A 3ZDEA 3RJIA 2I9GA 4XJEA 2Q0ZX 2FI1A 2XGPA 3GIMA 4EEYA 5KFLA 2BCSA 3H8MA 4YCXA 4FBTA 2WF5A 2ZH3A 3WK5A 2W54A 4DSLA 4WQKA 2XY5A 4FZNA 3NRZA 1DGSA 4WC0A 1MIWA 3M8RA 2W43A 5DKWA 4KLOA 1NNLA 2GH1A 4I2FA 1Z1VA 4ECTA 2DUYA 3QU2A 1S9FA 3NWIA 1RDFA 2JEJA 4FHYA 1KFSA 3OPXA 3KHGA 4RPYA 2QB0B 2W3RA 1SL0A 3H4DA 1L7MA 3H38A 3I76A 4NLZA 4ECYA 4QZ9A 2PI5A 2MUTA 4RQ2A 4HYKA 3OJUA 1ZQTA 5J29A 5J8YC 5J2DA 3K1RB 2W7PA 4BWMA 2ALZA 3GQCA 5CFSA 4Q43A 4PZNA 3JPSA 1UETA 4S3NA 3M8SA 2Y9TA 4ZOHC 4M9LA 4QWEA 1XNSA 3HP6A 8ICZA 1ZQHA 3F5AA 3C23A 4DQRA 3M9NB 2BDUA 5KAIU 5KFMA 5C5JA 4DFPA 1SV0C 2ODGA 3ER8C 3PSFA 2KP7A 3WK7A 1JX4A 3V7LA 1S10A 5HMLA 2VIXA 1NK5A 4EEKA 3AQFA 4YR3A 3QEBZ 4QZFA 2FDRA 3H0LB 3GU3A 4ED0A 1S0MA 4O67A 2FLLA 2B6GA 4IRKA 4CF4A 5KFNA 2XO7A 2A1JA 3AN1A 4N7RA 2B21A 1TAMA 1V4AA 5AKXA 2RFFA 1RZTA 2G5IB 2EAPA 2NV3A 4R66A 5DEDA 4KLUA 1Q8KA 3KOOA 5AHXA 2LMRA 2XCPA 5AKKA 5EWEA 4Z6EA 3JYYA 3UM9A 1KTQA 1GO3F 4XRHA 2XC9A 4NLCA 4MFAA 3C1ZA 4R65A 5BOLA 4TUPA 1FFVA 2WFAA 1KBUA 3JPNA 5AKGA 5KFIA 3WKDA 4M9HA 5KFAA 5D46A 9ICOA 3QUQA 1MQ3A 3JPPA 5KG0A 3RJGA 3LWLA 1TAUA 1TFYA 3ONNA 3LVWA 3CK6A 4ACOA 4P0QA 2H3VA 1OU5A 2OM6A 5AIBA 3MC1A 4J9KA 2QARB 1X2IA 4O3SA 4CNQA 4FHWA 4I0UA 3V7KA 2XVTA 3A0BU 1QLNA 5B3QA 4NXVA 3NKUA 2V9WA 2AGOA 4UW9A 4DO9A 3B9JA 4F5PA 8ICQA 1X9WA 3HIYA 1BPBA 2BR0A 5CA7A 4JB3A 8ICPA 3SAFA 4U7CA 2PI4A 4NLNA 4DOCA 2JZBB 2E8OA 1QTMA 5ALDA 1PVPA 1QH9A 3NASA 1F44A 1ZQWA 2K60A 1NJZA 4WBYA 4KX5A 4F93B 4DEZA 2JEGA 1CRXA 2EH9A 3PNCA 1FIQA 4ELVA 2XCAA 1K1SA 2H3IA 3E58A 1ZQLA 3UXNA 3PX0A 1NJXA 2ZIXB 4DFKA 4RT3A 2KZZA 2OHFA 1N56A 3EPIA 1M6YA 4C4TA 4LEVA 2C22A 2ZG6A 9ICTA 4CRXA 4RNMA 3D6JA 4O3RA 2FPKA 4NM2A 5KT5A 5CFUA 3UPQA 1ZQRA 5KAFU 4FHPA 3C5FA 4BXOB 3MFIA 3KTQA 2ZJ8A 5J2JA 3PW0A 2ZH5A 2LBOA 1NK6A 3RFAA 2CPRA 1ZQOA 4EBEA 4UB8U 4NXTA 5IILA 3N28A 4DLGA 1YZ6A 3THVA 4NWIA 4NKTA 5AI0A 3QXGA 2YB1A 3OVBA 4Y2JA 2D6FC 5EWGA 5HRDA 2AHOB 7ICOA 4DLEA 2JGAA 4P0PB 5DQHA 2ZUCA 1L3UA 1ECWA 1F0MA 1XWLA 4RUCA 3QEAZ 2K4EA 2WF6A 4UB6U 4FS2A 4F4KA 4YR0A 5AI8A 1NZPA 4OCZA 2W8LA 4F4YA 4OJ5A 1DOQA 7ICIA 3OVSA 3MGHA 1ZQQA 4DL2A 4UB3A 4F4ZA 3NYBA 2EZZA 1X42A 1L8OA 3Q8KA 1S0NA 1S76D 1HUZA 5J0RA 3QUTA 2DR9A 4DL3A 4DQQA 2H3QA 1V97A 2BHNA 4X4VA 4EGWA 4I2DA 2Y9UA 4QZAA 2ZIVA 1SL1A 4JLXA 4NXWA 4BGDA 4YQWA 2LYAA 4OAFA 1NK9A 3BS5B 2BCUA 1L7OA 4F91B 2FMQA 3AMZA 4UAVA 3C21A 1A76A 2R8GA 3PY8A 4K4HA 7ICPA 1DXSA 5DG9A 9ICCA 3BZCA 2P66A 2ZTEA 3PO4A 4NLKA 3OSPA 3TACB 2AQ0A 5AM2A 9ICAA 4KLTA 2BBHA 4E80A 4BDPA 1UA1A 2M0NA 4P4MA 4DQSA 7ICTA 3SQIA 4GIBA 5L1JA 2YB4A 5J0YA 9ICIA 5F3XB 2ZH2A 1C7YA 2BCVA 4ECUA 2ES6A 2RRDA 1OW5A 5J2KA 4DF4A 4IQTA 3WK4A 1FA0A 1MIYA 5KFKA 2A1AA 2W9CA 2WB1C 5KFYA 1U4BA 1N48A 5F2VO 5KG1A 3EYZA 5GTIU 2F1IA 3MR2A 3A0HU 3KZIU 2IOFK 1Z1BA 5ALVA 2Y1IA 2KVSA 3LWMA 4AT7B 1KL9A 1GPJA 3RBEA 4QIWF 1BGXT 2HHXA 1RYUA 4YXMA 2EDUA 3UQ2A 2VJ4A 2MSNA 8ICJA 3OVAA 3RBDA 3UXOA 4F2SA 4C8LA 1V9PA 2KZ3A 3H8WA 2G5HB 2HMXA 5KG4A 1NZBA 1NK0A 3D2QA 4G9BA 4FS1A 1U47A 3GV7B 3WKAA 4AYBC 5CHEA 1ZYQA 2KD1A 1PK1A 3O0FA 2DQNB 4ED7A 5F9NA 1ZOLA 3KBBA 1NKBA 9ICVA 4QZBA 2VA8A 3BQ7A 5J0OA 4O3PA 3T3FA 4I28A 2ZH8A 4I2JA 1T7PA 4AT8B 2DL0A 5KFJA 1ZQMA 2ID1A 1F5AA 3UQ0A 4KLLA 2FE9A 3CNHA 4UB5A 3MGIA 2HBLA 1ZQGA 4LZGA 2HHVA 1K1QA 5KFUA 1JRPA 2AGQA 2ASLA 4BWJA 2NRXA 4QWBA 1R8AA 5DDYA 3OUYB 5HREA 5HRKA 4GFJA 3HRDD 3D2SA 4O3NA 4QW8A 1L6NA 4FO1A 5ALGA 4X4RA 4NKUA 3NS1A 7ICFA 1LVHA 4AT9B 1NKCA 5JTGA 1A6SA 2OWOA 3RB6A 4EP7A 3FYHA 4IRCA 3RH5A 2IA6A 2DR7A 1JMSA 2J6TA 2ESEA 4UD4A 1IIPA 4P2HA 5EOZA 2DFLA 4Q44A 2KEYA 4Y2QA 4LEYA 3QUCA 4C8NA 4YMMA 2F8KA 5J0TA 4C4SA 4KTQA 3EWAA 2KIWA 1MC8A 3N7RC 3HILA 5L1MA 4I2CA 2QLTA 4EEBA 1LKYA 4B6JA 4AT8A 5AI4A 4C8OA 2KSOB 3I1YA 5HRLA 2WF7A 4UBBA 5HC9A 3RB0A 2DKZA 2HVHA 5KFOA 1QQ5A 4IG8A 4DFDA 1UEVA 2BPCA 5C0YA 1T3QA 5FP0A 9ICMA 1EXNA 3QU7A 4E8FA 4PHAA 2KMDA 4K98A 1KN5A 5KFHA 2MA1A 1S97A 4EEDA 5AI9A 1XSPA 4RQ4A 4M5DA 5D49A 2AQ4A 3HX0A 4KB6A 5ALQA 4M47A 3QU9A 4RPXA 1KQQA 3C28A 1KKXA 5AM1A 3GILA 3FDSA 5CWRA 1Q78A 4KLSA 9ICNA 2HCFA 4FHVA 1COOA 2IOFA 5KFDA 1UT8A 4MFCA 4RNNA 4K96A 1PX5A 4B9UA 1SXEA 4K9BA 4LVSA 4J9QA 2AU0A 5J2HA 3H0MB 5ALYA 3BQ2A 4ED3A 4ZH4A 1B4FA 9ICEA 4C8MA 4X4UA 3KHLA 1PVQA 1ZQ1C 2G07A 5J2BA 1KEJA 3ISDA 1T3NA 1TKDA 3QU5A 4I2BA 4WC1A 4U6PA 4ECXA 1WYGA 2K4PA 2DVIA 4UB4A 2ZUBA 1ZJNA 2ZHBA 1D8LA 2NRKA 2KV2A 5J0XA 1CUKA 1JXLA 4IQUA 2YN4A 3SAHA 3RJHA 2I5HA 4E0DA 3SV4A 4AP9A 1RG6A 1IM4A 4KLQA 4UAUA 2KJ9A 2A1JB 2A3VA 1MQ2A 3PO5A 4M9NA 7ICMA 4QNLA 3LK9A 4CDGA 3NVVA 4LZDA 2WAQF 2H5XA 1WG8A 1QCKA 4OJ6A 1U45A 2BQUA 3WK8A 4X5VA 3FM9A 4YN4A 1VLBA 4JMUA 5HMMA 1J97A 1WWVA 3HWTA 4X0BA 1JAJA 1H38A 2HBKA 3K4GA 2HSZA 2W7OA 3V6KA 1KRPA 2E5SA 2M2VA 4QZDA 7ICVA 2KZMA 2KOBA 2H3ZA 1JQRA 4FO6A 3EW9A 3K75D 5KFQA 3AEVA 4US8A 5HNKA 4P0QB 1L3SA 3QZ7A 5A0LA 1BPXA 4PH5A 2XI9A 1NK8A 3AUOA 2LM4A 2OXOA 3IG5A 2GLEA 2R8HA 2RP5A 2O5AA 1RQNA 1X9MA 4Q8EA 4J9MA 5AM3A 2FLNA 3ZDCA 3ZDDA 5KFTA 2Y0SF 4KMOB 3J81j 4Z6FA 3RJEA 2DWQA 2RDJA 4QWCA 1ZQBA 2HBMA 2ISOA 9ICBA 4KLGA 1TK0A 3RB4A 5AKLA 1NOMA 1ZJMA 2FMPA 3HKZC 3SR6A 2FCLA 2JRZA 3AU2A 1Q79A 5ALUA 2VKQA 4RT2A 4MFFA 1L7NA 2CN1A 2ZJAA 4K4IA 4KLHA 4KX3A 5DBCA 4WCWA 2E8NA 1MN8A 1LB2B 1XU4A 3B0YA 3H37A 1CEZA 3MBYA 2YTUA 2FPLA 5AK5A 4X4NA 2HHWA 5ALSA
chains in the Genus database with same CATH topology
3LDAA 3Q8KA 1S0NA 1S76D 2DPJA 5DB8A 1HUZA 4O9MA 4RWPA 1ZQDA 5J0PA 4JV0A 5J0RA 3M9OB 2DR9A 4DL3A 4DQQA 3L9DA 3Q8LA 1S0OA 4DSKA 4EZ9A 1BPYA 4KLEA 4QZIA 3ZD8A 5DLGA 2BHNA 2BPFA 4KLJA 4J9NA 8ICHA 1YLQA 4X4VA 1ZQZA 1L5UA 5HRHA 4YD2A 4I2DA 4PHPA 3GFKB 3RRGA 4QZAA 4FHXA 1SL1A 4AT7A 4BGDA 4YQWA 2HHQA 2BPGA 2IBKA 4NM1A 4JV2A 3E2EA 1NK9A 3EZ5A 9ICXA 2BCUA 1BVSA 3SI8A 4DOAA 4F91B 2FMQA 3T5LA 3C21A 1A76A 2RDIA 4R63A 2W9MA 4ECZA 2JEFA 2R8GA 3T5HA 3PY8A 4K4HA 4KLIA 7ICNA 7ICPA 1BNOA 5DG9A 4EBDA 9ICCA 4O3QA 1T8EA 4O5KA 7ICRA 5KFZA 2V4RA 1UT5A 3RJJA 2M2TA 8ICTA 1AROP 4FH5A 2P66A 2ZTEA 3PO4A 4NLKA 3OSPA 5KFBA 2AQ0A 2BGWA 3B0XA 4I2IA 4R8UA 5F9LA 3NGDA 1ZQXA 4EBCA 3Q8QB 2BQRA 3ISCA 2UVVA 4EYIB 4J9LA 4KLTA 9ICAA 1ZQEA 4ECQA 3AQMA 4E80A 4BDPA 1UA1A 4RWNA 4P4MA 4F5OA 4DQSA 7ICTA 1TFWA 4QW9A 4DL7A 4XA5A 9ICGA 3QZ8A 2UVUA 4B9LA 2W9AA 3PMLA 5L1JA 2XY7A 4IRDA 4IR1A 5J0YA 9ICIA 2DR5A 2ZH2A 4J9SA 3OHAA 1C7YA 2BCVA 1Z3EB 2BKEA 4ECUA 4J9OA 1PZNA 4GXIA 4RNOA 1UA0A 1S77D 1SKWA 8ICRA 3MDCA 4M6WB 3PMNA 2FPMA 5J2EA 2C2EA 1BPEA 5D4BA 5J2KA 1X9SA 2M2WA 1MIVA 3WFRE 4DF4A 4IQTA 1FA0A 1MIYA 4X4SA 4F50A 8ICBA 3SV3A 5KFKA 1HUOA 5DG8A 2W9CA 4F5NA 4QWAA 2ZTCA 2FMSA 4KLMA 4F5QA 4RU9A 5KFYA 1U4BA 8ICWA 4O0IA 3TAQA 3N4MB 1N48A 3C2MA 5KG1A 2AGPA 3RR8A 3AQNA 3C66A 5F2VO 1ZQFA 5CP2A 1BPDA 1Z00A 3EYZA 4DQIA 4EYHB 8ICNA 2F1IA 3MR2A 4EZ6A 5KFXA 3GV5B 5KG3A 1KDHA 2Y1IA 5HP4A 4ELUA 2PFOA 2JEIA 2HVIA 4RUAA 4K4GA 2O1PA 3LWMA 4AT7B 4WBZA 4O3OA 7ICJA 3RBEA 3MFHA 4UAYA 1BGXT 2HHXA 8ICUA 2DRAA 3PVXA 5HHHA 4YXMA 5KG6A 2P6UA 3HT3A 3OJSA 9ICPA 5DGAA 3UQ2A 4O5CA 2W9BA 8ICJA 5BOMA 2BE3A 3ZDAA 4F2RA 3OVAA 3KHRA 3RBDA 3UXPA 4NY8A 8ICFA 3OUYA 3UXOA 4GLXA 1ZQIA 4DFJA 1ZQNA 3OHBA 4F2SA 1QSYA 4R8UB 1V9PA 2KZ3A 3GIKA 4DL6A 3RJKA 4C8LA 4JWNA 4I2GA 3H8WA 4ECRA 4CCHA 4ATBA 8ICAA 1A77A 4YG2A 5KT3A 8ICXA 4FBUA 1XSLA 1TFRA 4QWDA 3AU6A 5DB9A 2R8IA 3V7JA 3TAPA 7ICQA 4DSIA 2HHUA 9ICHA 9ICRA 5KG4A 4GXJA 3TQ1A 4YXJA 5J2IA 4M2YA 3TFRA 4I2AA 7ICLA 3HJ1A 1NK0A 4B9MA 3V72A 3C1YA 2PXIA 4FS1A 1U47A 2J6SA 2UVWA 2F1JA 4DSFA 4AT9A 3GV7B 2GWSA 5HRBA 4RWOA 5J2FA 3N97B 1DK2A 5DDMA 1Y88A 3G6XA 1ZQAA 4X4TA 2VA2A 1L3VA 5KT2A 3G6YA 3RJFA 1ZYQA 4UB2A 4GC6A 2ZH6A 4PHEA 4PGQA 4M04A 2W9CB 1ZQVA 4DF8A 2HHSA 4KITB 1KNYA 4B9VA 4YVZA 8ICCA 3Q8RB 4ED7A 3TARA 5F9NA 5J0WA 4RPZA 4M9JA 2DRBA 3WFQE 3MDAA 4WC2A 2BDPA 2MUTB 1Z00B 3H4BA 3SYZA 3ZDBA 4ED2A 1NKBA 4KLDA 4X4PA 9ICVA 4QZBA 2VA8A 5J0OA 1U48A 4O3PA 4QZGA 3OSNA 3G6VA 3T3FA 2IMWP 4I2JA 4I28A 2ZH8A 3RB3A 1BNPA 1XS9D 4P4OA 1QSLA 2ZH7A 1RXWA 1JN3A 5L1KA 1T7PA 5IIOA 4AT8B 4MEYA 4RQ3A 4F92B 5KFJA 8ICSA 4TURA 1ZQMA 2ID1A 1NJYA 1F5AA 1WCNA 4PPXA 3UQ0A 4WC7A 2NRWA 5KT4A 4KLLA 1U49A 4I2EA 4F4WA 4M9GA 5HR9A 9ICSA 4UB5A 3OV7A 3MGIA 2W9BB 4DSEA 1ZQGA 4LZGA 1JIHA 1K1QA 4RQ8A 2XGQA 5KFUA 2HHVA 7ICHA 2AGQA 9ICKA 2ASLA 4BWJA 2NRXA 4QWBA 3MR3A 1R8AA 5DDYA 4F8RA 5HREA 3OUYB 1ZQKA 5HRKA 2I1QA 5J0SA 2NRTA 4RQ5A 1L3TA 4ATBB 2C28A 4O3NA 4DS5A 1R89A 3RH6A 3ZDEA 3RJIA 3PR5B 2I9GA 3NTUA 1ZQUA 2Q0ZX 4QW8A 5DBAA 2XGPA 3GDXA 2Q66A 5KT6A 3GIMA 4EEYA 3HW8A 4X4RA 3PW4A 5KFLA 5DG7A 2BCSA 4NKUA 4YCXA 2Y1JA 4B9SA 8ICLA 4PGYA 4FBTA 4I2HA 7ICFA 1KSPA 2ZH3A 1TV9A 4AT9B 1NKCA 4DSLA 2XY5A 2OWOA 5DBBA 3RB6A 5IIKA 8ICMA 4ECSA 4EP7A 8ICIA 1DGSA 4XUSA 1WCLA 3FYHA 4DL4A 4WC0A 3V6HA 4IRCA 4RQ7A 3JPOA 4DL5A 1MIWA 3M8RA 4DFMA 3RH5A 4PHDA 2IA6A 3C18A 2DR7A 5DB7A 1JXEA 5DKWA 1JMSA 1DK3A 1ZQJA 4UAZA 2J6TA 4KLOA 4YD1A 3BJYA 4I2FA 2ASJA 3BQTA 4ECTA 4UD4A 1S9FA 4P4PA 8ICGA 4RQ6A 2DPIA 4P2HA 4DOBA 5EOZA 2DFLA 4Q44A 1KFSA 2JEJA 4B9TA 4FHYA 3PW7A 3KHGA 4RPYA 1D9DA 1SL0A 4IQWA 3H4DA 4MEXA 3H8SA 7ICSA 4KMUA 4QZCA 4C8NA 3H38A 4YMMA 1B22A 5J0TA 4Z6CA 4NLZA 4ECYA 1S0VA 4KTQA 5IINA 3EWAA 4QZ9A 4ED1A 2PI5A 2MUTA 4MF8A 1MC8A 4RQ2A 3HJ4A 4HYKA 3OJUA 3HPOA 3MR6A 3C5GA 1ZQTA 4ECVA 4WC6A 4GXKA 3T5KA 3H39A 2HHTA 4I2CA 1RYSA 4EBKA 5HRGA 9ICJA 4XQ8A 1ZQPA 5J29A 3H40A 4AT8A 5J2DA 4TUQA 3KHHA 3AQKA 4BWMA 2ALZA 3GQCA 1NKEA 4C8OA 4Q43A 3IM1A 3JPSA 1UETA 7ICGA 3M8SA 5HRLA 3JZ0A 4S3NA 4UBBA 5HC9A 3RB0A 4M9LA 2HVHA 4QWEA 2F1HA 5KFOA 4IG8A 1RPLA 3HP6A 8ICZA 2ATLA 1ZQHA 3C23A 4DQRA 7ICEA 1UEVA 3M9NB 4QZ8A 1B43A 2BPCA 5C5JA 5KG7A 5KFMA 4DFPA 3QE9Y 9ICMA 1SL2A 1NK7A 1EXNA 2UVRA 4E8FA 2KP7A 4KN4A 2ZJ5A 5DQIA 4PHAA 1R8CA 1JX4A 3Q8PB 3V7LA 1D8YA 2J6UA 1S10A 2ISPA 2ZH4A 5HMLA 5KFHA 3MR5A 2FLPA 3MABA 1NK5A 4J9PA 1S97A 5HRFA 1KFDA 4JK1A 8ICKA 4YR3A 3QEBZ 4QZFA 2BCQA 5HHIA 1XSPA 4YP3A 5CJ7A 4RQ4A 5IIMA 4M5DA 5D49A 2AQ4A 4ED0A 3HX0A 1S0MA 2FLLA 4M47A 3WFOA 4RPXA 1VJ7A 1QSSA 5HRIA 4IRKA 5KFNA 2XO7A 4F4XA 4ECWA 2A1JA 4F3OA 3IHQB 3GILA 3RRHA 3FDSA 1TVAA 5CWRA 4J9RA 1Q78A 2B21A 4KLSA 3OGUA 9ICNA 1V4AA 4FHVA 2RFFA 1RZTA 4R66A 5L1LA 5DEDA 4Q8FA 1COOA 8ICYA 5KFCA 4KLUA 5KFDA 9ICLA 1UT8A 5L9XA 4QZEA 1NK4A 4MFCA 4RNNA 3Q8SB 2XCPA 1NJWA 9ICFA 2PFQA 5EWEA 4B9UA 2R8JA 1PX5A 4Z6EA 3JYYA 1VFGA 1KTQA 4ED6A 4Z6DA 4LVSA 4J9QA 2P6RA 2AU0A 5L1IA 3RTVA 2JZBA 4XRHA 4TQSA 2XC9A 5J2HA 4MFAA 5EWFA 4DSJA 3C1ZA 4R65A 3BQ2A 4ED3A 4ZH4A 9ICEA 5BOLA 4C8MA 3BQ0A 1UEUA 4UD5A 4E7XA 5J2AA 4X4UA 2NRZA 4TUPA 3KHLA 5DQGA 3PW2A 5KFGA 3JPNA 5KFIA 5J2BA 3H8JA 1KEJA 4M9HA 3ISDA 5KG2A 1T3NA 1RXVA 2LYHA 1TKDA 2PFPA 4I2BA 4WC1A 4EBJA 5KFAA 4YMNA 5D46A 4GC7A 4ECXA 3TFSA 4C8KA 9ICOA 2DVIA 1MQ3A 2BCRA 4UB4A 3UPSA 3JPPA 5KG0A 2ZUBA 3RH4A 3LWLA 1ZJNA 3RJGA 2ZHBA 2HW3A 1D8LA 9ICQA 7ICUA 5TZVA 5J2CA 9ICUA 1TAUA 1KFTA 2NRKA 5J0XA 1TFYA 3BQ1A 2KFZA 1CUKA 4ELTA 4RQ0A 2R8KA 1OU5A 1JXLA 4IQUA 4J9KA 1TK8A 1X2IA 4O5EA 1RYRA 4UB1A 4O3SA 4NLGA 4TQRA 4FHWA 3RJHA 4E0DA 4JWMA 3V7KA 3H3AA 3SV4A 3RAXA 1IM4A 4YFKA 4KLQA 2C2RA 4BXOA 1QLNA 2A1JB 3C2KA 1MQ2A 4JV1A 3PO5A 5KFRA 2HHWA 2V9WA 4M9NA 7ICMA 1TAQA 4QZHA 2AGOA 4DO9A 3PW5A 4F5PA 3LK9A 8ICQA 1T4GA 2WTFA 3GV8B 5DLFA 1X9WA 1BPBA 4LZDA 2BR0A 3HIYA 1XC9A 3AQLA 4X4QA 3WFSC 5CA7A 4G3IA 1NO5A 8ICPA 2IHMA 2H5XA 5J0QA 1KLNA 1D9FA 1U45A 2BQUA 1HJPA 2PI4A 4X5VA 4NLNA 4X4OA 2ASDA 1IXRA 4YN4A 4DOCA 1XSNA 2JZBB 5HMMA 1QTMA 5IIJA 3TI0A 2HHPA 3JPQA 1TK5A 1ZETA 5IIIA 4UQGA 4WC3A 4M0AA 3JPTA 3HWTA 4X0BA 8ICEA 1H38A 1JAJA 1ZQWA 1NJZA 4WBYA 2C2DA 5KFEA 3K4GA 4F93B 4B9NA 4DEZA 5KFFA 2JEGA 3V6KA 1KRPA 5CR0A 4IR9A 4I29A 9ICWA 3PNCA 2M2VA 5J2GA 4QZDA 7ICVA 2KZMA 1BPZA 4ELVA 4ED8A 2NRVA 2XCAA 1JQRA 1K1SA 4FO6A 3EW9A 1ZQLA 3UXNA 1XO1A 3K75D 5KFQA 3PX0A 1NJXA 4KLFA 5HNKA 4DFKA 1SZPA 3BDPA 1MSWD 4WC4A 8ICVA 4RT3A 2KZZA 3TANA 3RR7A 1N56A 3EPIA 1L3SA 2BQ3A 4YMOA 4FH3A 3QZ7A 2C22A 1BPXA 9ICTA 4X0AA 4PH5A 3JPRA 1NK8A 4RNMA 3AUOA 3H7IA 4O3RA 2VA3A 2FPKA 3C2LA 3RAQA 4PGXA 4UBCA 5DGBA 4NM2A 5KT5A 4RZRA 2R8HA 2PFNA 2O5AA 2ZH1A 3UPQA 2DR8A 1ZQRA 2XY6A 1X9MA 4FHPA 4Q8EA 5KTQA 3ORYA 2IHNA 2KTQA 3C5FA 4BXOB 5KT7A 3MFIA 4J9MA 3KTQA 2ZJ8A 4DQPA 5J2JA 2FLNA 3PW0A 3ETLA 3LQCB 3ISBA 2ZH5A 3ZDCA 1U9LA 3GIJA 1NK6A 5CHGA 5DECA 3ZDDA 5KFTA 7ICKA 1ZQOA 2W8KA 4MF2A 4EBEA 3ZD9A 5BPCA 4UAWA 2KN7A 2V4QA 2M2UA 5IILA 4Z6FA 1ZQYA 1R8BA 3M9MB 3RJEA 5KFPA 4XQ7A 4WC5A 4DLGA 1SKRA 2ZH9A 5J0UA 2RDJA 3THVA 1WOTA 3T5JA 3WFPA 4QWCA 1ZQBA 3V6JA 4NKTA 4R64A 4KN7A 2ISOA 5DB6A 4KLGA 9ICBA 1TK0A 5KFSA 3RB4A 3OVBA 2AJQA 4LT6A 3PR4A 2ZTDA 4JUZA 5EWGA 1NOMA 5HRDA 1ZJMA 2FMPA 3SZ2A 3PX6A 2ZHAA 4RQ1A 2KFNA 7ICOA 4I27A 4DLEA 5JUMA 3AU2A 5KG5A 4IQVA 5DQHA 2ZUCA 1Q79A 1L3UA 3PV8A 1XWLA 1ZQCA 4RUCA 4DS4A 4RT2A 3QEAZ 1SKSA 8ICOA 4MFFA 4F5RA 2ZJAA 4K4IA 4KLHA 4RWQA 4FS2A 5DBCA 2MAXA 4F4KA 4YR0A 4WCWA 4TUSA 1LV5A 1NZPA 1ZQSA 4YR2A 4Q45A 3GIIA 2W8LA 4F4YA 1LB2B 1XU4A 4NXZA 2VANA 3B0YA 4M6WA 3H37A 5KFWA 1DOQA 1CEZA 3MBYA 7ICIA 2PBEA 2M9NA 3OVSA 5KFVA 3MGHA 1ZQQA 4DL2A 4UB3A 3PX4A 4F4ZA 3NYBA 2ZUDA 2FPLA 4DWIA 4X4NA 3EPGA 3Q8MA 5CB1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDA A;  3Q8K A;  1S0N A;  1S76 D;  2DPJ A;  5DB8 A;  1HUZ A;  4O9M A;  4RWP A;  1ZQD A;  5J0P A;  4JV0 A;  5J0R A;  3M9O B;  2DR9 A;  4DL3 A;  4DQQ A;  3L9D A;  3Q8L A;  1S0O A;  4DSK A;  4EZ9 A;  1BPY A;  4KLE A;  4QZI A;  3ZD8 A;  5DLG A;  2BHN A;  2BPF A;  4KLJ A;  4J9N A;  8ICH A;  1YLQ A;  4X4V A;  1ZQZ A;  1L5U A;  5HRH A;  4YD2 A;  4I2D A;  4PHP A;  3GFK B;  3RRG A;  4QZA A;  4FHX A;  1SL1 A;  4AT7 A;  4BGD A;  4YQW A;  2HHQ A;  2BPG A;  2IBK A;  4NM1 A;  4JV2 A;  3E2E A;  1NK9 A;  3EZ5 A;  9ICX A;  2BCU A;  1BVS A;  3SI8 A;  4DOA A;  4F91 B;  2FMQ A;  3T5L A;  3C21 A;  1A76 A;  2RDI A;  4R63 A;  2W9M A;  4ECZ A;  2JEF A;  2R8G A;  3T5H A;  3PY8 A;  4K4H A;  4KLI A;  7ICN A;  7ICP A;  1BNO A;  5DG9 A;  4EBD A;  9ICC A;  4O3Q A;  1T8E A;  4O5K A;  7ICR A;  5KFZ A;  2V4R A;  1UT5 A;  3RJJ A;  2M2T A;  8ICT A;  1ARO P;  4FH5 A;  2P66 A;  2ZTE A;  3PO4 A;  4NLK A;  3OSP A;  5KFB A;  2AQ0 A;  2BGW A;  3B0X A;  4I2I A;  4R8U A;  5F9L A;  3NGD A;  1ZQX A;  4EBC A;  3Q8Q B;  2BQR A;  3ISC A;  2UVV A;  4EYI B;  4J9L A;  4KLT A;  9ICA A;  1ZQE A;  4ECQ A;  3AQM A;  4E80 A;  4BDP A;  1UA1 A;  4RWN A;  4P4M A;  4F5O A;  4DQS A;  7ICT A;  1TFW A;  4QW9 A;  4DL7 A;  4XA5 A;  9ICG A;  3QZ8 A;  2UVU A;  4B9L A;  2W9A A;  3PML A;  5L1J A;  2XY7 A;  4IRD A;  4IR1 A;  5J0Y A;  9ICI A;  2DR5 A;  2ZH2 A;  4J9S A;  3OHA A;  1C7Y A;  2BCV A;  1Z3E B;  2BKE A;  4ECU A;  4J9O A;  1PZN A;  4GXI A;  4RNO A;  1UA0 A;  1S77 D;  1SKW A;  8ICR A;  3MDC A;  4M6W B;  3PMN A;  2FPM A;  5J2E A;  2C2E A;  1BPE A;  5D4B A;  5J2K A;  1X9S A;  2M2W A;  1MIV A;  3WFR E;  4DF4 A;  4IQT A;  1FA0 A;  1MIY A;  4X4S A;  4F50 A;  8ICB A;  3SV3 A;  5KFK A;  1HUO A;  5DG8 A;  2W9C A;  4F5N A;  4QWA A;  2ZTC A;  2FMS A;  4KLM A;  4F5Q A;  4RU9 A;  5KFY A;  1U4B A;  8ICW A;  4O0I A;  3TAQ A;  3N4M B;  1N48 A;  3C2M A;  5KG1 A;  2AGP A;  3RR8 A;  3AQN A;  3C66 A;  5F2V O;  1ZQF A;  5CP2 A;  1BPD A;  1Z00 A;  3EYZ A;  4DQI A;  4EYH B;  8ICN A;  2F1I A;  3MR2 A;  4EZ6 A;  5KFX A;  3GV5 B;  5KG3 A;  1KDH A;  2Y1I A;  5HP4 A;  4ELU A;  2PFO A;  2JEI A;  2HVI A;  4RUA A;  4K4G A;  2O1P A;  3LWM A;  4AT7 B;  4WBZ A;  4O3O A;  7ICJ A;  3RBE A;  3MFH A;  4UAY A;  1BGX T;  2HHX A;  8ICU A;  2DRA A;  3PVX A;  5HHH A;  4YXM A;  5KG6 A;  2P6U A;  3HT3 A;  3OJS A;  9ICP A;  5DGA A;  3UQ2 A;  4O5C A;  2W9B A;  8ICJ A;  5BOM A;  2BE3 A;  3ZDA A;  4F2R A;  3OVA A;  3KHR A;  3RBD A;  3UXP A;  4NY8 A;  8ICF A;  3OUY A;  3UXO A;  4GLX A;  1ZQI A;  4DFJ A;  1ZQN A;  3OHB A;  4F2S A;  1QSY A;  4R8U B;  1V9P A;  2KZ3 A;  3GIK A;  4DL6 A;  3RJK A;  4C8L A;  4JWN A;  4I2G A;  3H8W A;  4ECR A;  4CCH A;  4ATB A;  8ICA A;  1A77 A;  4YG2 A;  5KT3 A;  8ICX A;  4FBU A;  1XSL A;  1TFR A;  4QWD A;  3AU6 A;  5DB9 A;  2R8I A;  3V7J A;  3TAP A;  7ICQ A;  4DSI A;  2HHU A;  9ICH A;  9ICR A;  5KG4 A;  4GXJ A;  3TQ1 A;  4YXJ A;  5J2I A;  4M2Y A;  3TFR A;  4I2A A;  7ICL A;  3HJ1 A;  1NK0 A;  4B9M A;  3V72 A;  3C1Y A;  2PXI A;  4FS1 A;  1U47 A;  2J6S A;  2UVW A;  2F1J A;  4DSF A;  4AT9 A;  3GV7 B;  2GWS A;  5HRB A;  4RWO A;  5J2F A;  3N97 B;  1DK2 A;  5DDM A;  1Y88 A;  3G6X A;  1ZQA A;  4X4T A;  2VA2 A;  1L3V A;  5KT2 A;  3G6Y A;  3RJF A;  1ZYQ A;  4UB2 A;  4GC6 A;  2ZH6 A;  4PHE A;  4PGQ A;  4M04 A;  2W9C B;  1ZQV A;  4DF8 A;  2HHS A;  4KIT B;  1KNY A;  4B9V A;  4YVZ A;  8ICC A;  3Q8R B;  4ED7 A;  3TAR A;  5F9N A;  5J0W A;  4RPZ A;  4M9J A;  2DRB A;  3WFQ E;  3MDA A;  4WC2 A;  2BDP A;  2MUT B;  1Z00 B;  3H4B A;  3SYZ A;  3ZDB A;  4ED2 A;  1NKB A;  4KLD A;  4X4P A;  9ICV A;  4QZB A;  2VA8 A;  5J0O A;  1U48 A;  4O3P A;  4QZG A;  3OSN A;  3G6V A;  3T3F A;  2IMW P;  4I2J A;  4I28 A;  2ZH8 A;  3RB3 A;  1BNP A;  1XS9 D;  4P4O A;  1QSL A;  2ZH7 A;  1RXW A;  1JN3 A;  5L1K A;  1T7P A;  5IIO A;  4AT8 B;  4MEY A;  4RQ3 A;  4F92 B;  5KFJ A;  8ICS A;  4TUR A;  1ZQM A;  2ID1 A;  1NJY A;  1F5A A;  1WCN A;  4PPX A;  3UQ0 A;  4WC7 A;  2NRW A;  5KT4 A;  4KLL A;  1U49 A;  4I2E A;  4F4W A;  4M9G A;  5HR9 A;  9ICS A;  4UB5 A;  3OV7 A;  3MGI A;  2W9B B;  4DSE A;  1ZQG A;  4LZG A;  1JIH A;  1K1Q A;  4RQ8 A;  2XGQ A;  5KFU A;  2HHV A;  7ICH A;  2AGQ A;  9ICK A;  2ASL A;  4BWJ A;  2NRX A;  4QWB A;  3MR3 A;  1R8A A;  5DDY A;  4F8R A;  5HRE A;  3OUY B;  1ZQK A;  5HRK A;  2I1Q A;  5J0S A;  2NRT A;  4RQ5 A;  1L3T A;  4ATB B;  2C28 A;  4O3N A;  4DS5 A;  1R89 A;  3RH6 A;  3ZDE A;  3RJI A;  3PR5 B;  2I9G A;  3NTU A;  1ZQU A;  2Q0Z X;  4QW8 A;  5DBA A;  2XGP A;  3GDX A;  2Q66 A;  5KT6 A;  3GIM A;  4EEY A;  3HW8 A;  4X4R A;  3PW4 A;  5KFL A;  5DG7 A;  2BCS A;  4NKU A;  4YCX A;  2Y1J A;  4B9S A;  8ICL A;  4PGY A;  4FBT A;  4I2H A;  7ICF A;  1KSP A;  2ZH3 A;  1TV9 A;  4AT9 B;  1NKC A;  4DSL A;  2XY5 A;  2OWO A;  5DBB A;  3RB6 A;  5IIK A;  8ICM A;  4ECS A;  4EP7 A;  8ICI A;  1DGS A;  4XUS A;  1WCL A;  3FYH A;  4DL4 A;  4WC0 A;  3V6H A;  4IRC A;  4RQ7 A;  3JPO A;  4DL5 A;  1MIW A;  3M8R A;  4DFM A;  3RH5 A;  4PHD A;  2IA6 A;  3C18 A;  2DR7 A;  5DB7 A;  1JXE A;  5DKW A;  1JMS A;  1DK3 A;  1ZQJ A;  4UAZ A;  2J6T A;  4KLO A;  4YD1 A;  3BJY A;  4I2F A;  2ASJ A;  3BQT A;  4ECT A;  4UD4 A;  1S9F A;  4P4P A;  8ICG A;  4RQ6 A;  2DPI A;  4P2H A;  4DOB A;  5EOZ A;  2DFL A;  4Q44 A;  1KFS A;  2JEJ A;  4B9T A;  4FHY A;  3PW7 A;  3KHG A;  4RPY A;  1D9D A;  1SL0 A;  4IQW A;  3H4D A;  4MEX A;  3H8S A;  7ICS A;  4KMU A;  4QZC A;  4C8N A;  3H38 A;  4YMM A;  1B22 A;  5J0T A;  4Z6C A;  4NLZ A;  4ECY A;  1S0V A;  4KTQ A;  5IIN A;  3EWA A;  4QZ9 A;  4ED1 A;  2PI5 A;  2MUT A;  4MF8 A;  1MC8 A;  4RQ2 A;  3HJ4 A;  4HYK A;  3OJU A;  3HPO A;  3MR6 A;  3C5G A;  1ZQT A;  4ECV A;  4WC6 A;  4GXK A;  3T5K A;  3H39 A;  2HHT A;  4I2C A;  1RYS A;  4EBK A;  5HRG A;  9ICJ A;  4XQ8 A;  1ZQP A;  5J29 A;  3H40 A;  4AT8 A;  5J2D A;  4TUQ A;  3KHH A;  3AQK A;  4BWM A;  2ALZ A;  3GQC A;  1NKE A;  4C8O A;  4Q43 A;  3IM1 A;  3JPS A;  1UET A;  7ICG A;  3M8S A;  5HRL A;  3JZ0 A;  4S3N A;  4UBB A;  5HC9 A;  3RB0 A;  4M9L A;  2HVH A;  4QWE A;  2F1H A;  5KFO A;  4IG8 A;  1RPL A;  3HP6 A;  8ICZ A;  2ATL A;  1ZQH A;  3C23 A;  4DQR A;  7ICE A;  1UEV A;  3M9N B;  4QZ8 A;  1B43 A;  2BPC A;  5C5J A;  5KG7 A;  5KFM A;  4DFP A;  3QE9 Y;  9ICM A;  1SL2 A;  1NK7 A;  1EXN A;  2UVR A;  4E8F A;  2KP7 A;  4KN4 A;  2ZJ5 A;  5DQI A;  4PHA A;  1R8C A;  1JX4 A;  3Q8P B;  3V7L A;  1D8Y A;  2J6U A;  1S10 A;  2ISP A;  2ZH4 A;  5HML A;  5KFH A;  3MR5 A;  2FLP A;  3MAB A;  1NK5 A;  4J9P A;  1S97 A;  5HRF A;  1KFD A;  4JK1 A;  8ICK A;  4YR3 A;  3QEB Z;  4QZF A;  2BCQ A;  5HHI A;  1XSP A;  4YP3 A;  5CJ7 A;  4RQ4 A;  5IIM A;  4M5D A;  5D49 A;  2AQ4 A;  4ED0 A;  3HX0 A;  1S0M A;  2FLL A;  4M47 A;  3WFO A;  4RPX A;  1VJ7 A;  1QSS A;  5HRI A;  4IRK A;  5KFN A;  2XO7 A;  4F4X A;  4ECW A;  2A1J A;  4F3O A;  3IHQ B;  3GIL A;  3RRH A;  3FDS A;  1TVA A;  5CWR A;  4J9R A;  1Q78 A;  2B21 A;  4KLS A;  3OGU A;  9ICN A;  1V4A A;  4FHV A;  2RFF A;  1RZT A;  4R66 A;  5L1L A;  5DED A;  4Q8F A;  1COO A;  8ICY A;  5KFC A;  4KLU A;  5KFD A;  9ICL A;  1UT8 A;  5L9X A;  4QZE A;  1NK4 A;  4MFC A;  4RNN A;  3Q8S B;  2XCP A;  1NJW A;  9ICF A;  2PFQ A;  5EWE A;  4B9U A;  2R8J A;  1PX5 A;  4Z6E A;  3JYY A;  1VFG A;  1KTQ A;  4ED6 A;  4Z6D A;  4LVS A;  4J9Q A;  2P6R A;  2AU0 A;  5L1I A;  3RTV A;  2JZB A;  4XRH A;  4TQS A;  2XC9 A;  5J2H A;  4MFA A;  5EWF A;  4DSJ A;  3C1Z A;  4R65 A;  3BQ2 A;  4ED3 A;  4ZH4 A;  9ICE A;  5BOL A;  4C8M A;  3BQ0 A;  1UEU A;  4UD5 A;  4E7X A;  5J2A A;  4X4U A;  2NRZ A;  4TUP A;  3KHL A;  5DQG A;  3PW2 A;  5KFG A;  3JPN A;  5KFI A;  5J2B A;  3H8J A;  1KEJ A;  4M9H A;  3ISD A;  5KG2 A;  1T3N A;  1RXV A;  2LYH A;  1TKD A;  2PFP A;  4I2B A;  4WC1 A;  4EBJ A;  5KFA A;  4YMN A;  5D46 A;  4GC7 A;  4ECX A;  3TFS A;  4C8K A;  9ICO A;  2DVI A;  1MQ3 A;  2BCR A;  4UB4 A;  3UPS A;  3JPP A;  5KG0 A;  2ZUB A;  3RH4 A;  3LWL A;  1ZJN A;  3RJG A;  2ZHB A;  2HW3 A;  1D8L A;  9ICQ A;  7ICU A;  5TZV A;  5J2C A;  9ICU A;  1TAU A;  1KFT A;  2NRK A;  5J0X A;  1TFY A;  3BQ1 A;  2KFZ A;  1CUK A;  4ELT A;  4RQ0 A;  2R8K A;  1OU5 A;  1JXL A;  4IQU A;  4J9K A;  1TK8 A;  1X2I A;  4O5E A;  1RYR A;  4UB1 A;  4O3S A;  4NLG A;  4TQR A;  4FHW A;  3RJH A;  4E0D A;  4JWM A;  3V7K A;  3H3A A;  3SV4 A;  3RAX A;  1IM4 A;  4YFK A;  4KLQ A;  2C2R A;  4BXO A;  1QLN A;  2A1J B;  3C2K A;  1MQ2 A;  4JV1 A;  3PO5 A;  5KFR A;  2HHW A;  2V9W A;  4M9N A;  7ICM A;  1TAQ A;  4QZH A;  2AGO A;  4DO9 A;  3PW5 A;  4F5P A;  3LK9 A;  8ICQ A;  1T4G A;  2WTF A;  3GV8 B;  5DLF A;  1X9W A;  1BPB A;  4LZD A;  2BR0 A;  3HIY A;  1XC9 A;  3AQL A;  4X4Q A;  3WFS C;  5CA7 A;  4G3I A;  1NO5 A;  8ICP A;  2IHM A;  2H5X A;  5J0Q A;  1KLN A;  1D9F A;  1U45 A;  2BQU A;  1HJP A;  2PI4 A;  4X5V A;  4NLN A;  4X4O A;  2ASD A;  1IXR A;  4YN4 A;  4DOC A;  1XSN A;  2JZB B;  5HMM A;  1QTM A;  5IIJ A;  3TI0 A;  2HHP A;  3JPQ A;  1TK5 A;  1ZET A;  5III A;  4UQG A;  4WC3 A;  4M0A A;  3JPT A;  3HWT A;  4X0B A;  8ICE A;  1H38 A;  1JAJ A;  1ZQW A;  1NJZ A;  4WBY A;  2C2D A;  5KFE A;  3K4G A;  4F93 B;  4B9N A;  4DEZ A;  5KFF A;  2JEG A;  3V6K A;  1KRP A;  5CR0 A;  4IR9 A;  4I29 A;  9ICW A;  3PNC A;  2M2V A;  5J2G A;  4QZD A;  7ICV A;  2KZM A;  1BPZ A;  4ELV A;  4ED8 A;  2NRV A;  2XCA A;  1JQR A;  1K1S A;  4FO6 A;  3EW9 A;  1ZQL A;  3UXN A;  1XO1 A;  3K75 D;  5KFQ A;  3PX0 A;  1NJX A;  4KLF A;  5HNK A;  4DFK A;  1SZP A;  3BDP A;  1MSW D;  4WC4 A;  8ICV A;  4RT3 A;  2KZZ A;  3TAN A;  3RR7 A;  1N56 A;  3EPI A;  1L3S A;  2BQ3 A;  4YMO A;  4FH3 A;  3QZ7 A;  2C22 A;  1BPX A;  9ICT A;  4X0A A;  4PH5 A;  3JPR A;  1NK8 A;  4RNM A;  3AUO A;  3H7I A;  4O3R A;  2VA3 A;  2FPK A;  3C2L A;  3RAQ A;  4PGX A;  4UBC A;  5DGB A;  4NM2 A;  5KT5 A;  4RZR A;  2R8H A;  2PFN A;  2O5A A;  2ZH1 A;  3UPQ A;  2DR8 A;  1ZQR A;  2XY6 A;  1X9M A;  4FHP A;  4Q8E A;  5KTQ A;  3ORY A;  2IHN A;  2KTQ A;  3C5F A;  4BXO B;  5KT7 A;  3MFI A;  4J9M A;  3KTQ A;  2ZJ8 A;  4DQP A;  5J2J A;  2FLN A;  3PW0 A;  3ETL A;  3LQC B;  3ISB A;  2ZH5 A;  3ZDC A;  1U9L A;  3GIJ A;  1NK6 A;  5CHG A;  5DEC A;  3ZDD A;  5KFT A;  7ICK A;  1ZQO A;  2W8K A;  4MF2 A;  4EBE A;  3ZD9 A;  5BPC A;  4UAW A;  2KN7 A;  2V4Q A;  2M2U A;  5IIL A;  4Z6F A;  1ZQY A;  1R8B A;  3M9M B;  3RJE A;  5KFP A;  4XQ7 A;  4WC5 A;  4DLG A;  1SKR A;  2ZH9 A;  5J0U A;  2RDJ A;  3THV A;  1WOT A;  3T5J A;  3WFP A;  4QWC A;  1ZQB A;  3V6J A;  4NKT A;  4R64 A;  4KN7 A;  2ISO A;  5DB6 A;  4KLG A;  9ICB A;  1TK0 A;  5KFS A;  3RB4 A;  3OVB A;  2AJQ A;  4LT6 A;  3PR4 A;  2ZTD A;  4JUZ A;  5EWG A;  1NOM A;  5HRD A;  1ZJM A;  2FMP A;  3SZ2 A;  3PX6 A;  2ZHA A;  4RQ1 A;  2KFN A;  7ICO A;  4I27 A;  4DLE A;  5JUM A;  3AU2 A;  5KG5 A;  4IQV A;  5DQH A;  2ZUC A;  1Q79 A;  1L3U A;  3PV8 A;  1XWL A;  1ZQC A;  4RUC A;  4DS4 A;  4RT2 A;  3QEA Z;  1SKS A;  8ICO A;  4MFF A;  4F5R A;  2ZJA A;  4K4I A;  4KLH A;  4RWQ A;  4FS2 A;  5DBC A;  2MAX A;  4F4K A;  4YR0 A;  4WCW A;  4TUS A;  1LV5 A;  1NZP A;  1ZQS A;  4YR2 A;  4Q45 A;  3GII A;  2W8L A;  4F4Y A;  1LB2 B;  1XU4 A;  4NXZ A;  2VAN A;  3B0Y A;  4M6W A;  3H37 A;  5KFW A;  1DOQ A;  1CEZ A;  3MBY A;  7ICI A;  2PBE A;  2M9N A;  3OVS A;  5KFV A;  3MGH A;  1ZQQ A;  4DL2 A;  4UB3 A;  3PX4 A;  4F4Z A;  3NYB A;  2ZUD A;  2FPL A;  4DWI A;  4X4N A;  3EPG A;  3Q8M A;  5CB1 A; 
#chains in the Genus database with same CATH topology
 4BJQ A;  4O9M A;  5CRX A;  2G08 A;  3WK6 A;  2G06 A;  3L9D A;  4EZ9 A;  2WF9 A;  1BPY A;  3ETR A;  4QZI A;  4J9N A;  1ZQZ A;  1L5U A;  4K99 A;  4O68 A;  4YD2 A;  3GFK B;  4FHX A;  2JR5 A;  2HHQ A;  3EZ5 A;  1UPH A;  1BVS A;  2JEF A;  4R63 A;  4EBD A;  2AH5 A;  4O3Q A;  1T8E A;  7ICR A;  3RJJ A;  1ARO P;  1FO4 A;  4Y2P A;  3B0X A;  4R8U A;  4B9S A;  3NGD A;  4EBC A;  2UVV A;  2JXJ A;  1ZQE A;  4ECQ A;  4OAG A;  4RWN A;  3PHZ A;  4F5O A;  4QW9 A;  2ZIW A;  3KZX A;  2UVU A;  2W9A A;  4B9L A;  2XY7 A;  4IRD A;  2K8A A;  3K1Z A;  4HX0 A;  2KG5 A;  4J9O A;  1PZN A;  1JRO A;  4FFD A;  5J2E A;  2C2E A;  1BPE A;  5D4B A;  2W55 A;  3NRW A;  8ICB A;  3SV3 A;  2B56 A;  4F5N A;  4QWA A;  2ZTC A;  1Z19 A;  4F5Q A;  5D63 A;  3N4M B;  1N5X A;  3AQN A;  3C66 A;  4Y2V A;  3TAD A;  1Z00 A;  4EYH B;  5KFX A;  5AI5 A;  2PFO A;  4RUA A;  5ALL A;  2ZIV B;  5KL1 B;  2I6X A;  3F53 A;  7ICJ A;  5CEH A;  4EEN A;  5HHH A;  5KG6 A;  3OJS A;  5DGA A;  2W9B A;  2QB1 A;  3ZDA A;  1QQ6 A;  3UXP A;  4GLX A;  1C20 A;  1ZQN A;  3OHB A;  4DL6 A;  3PSI A;  4ATB A;  4CCH A;  4OO1 J;  5ALH A;  8ICX A;  4YG2 A;  2BBJ A;  2YMQ A;  1XSL A;  3TAP A;  4QWD A;  4UD5 A;  5DB9 A;  7ICQ A;  9ICR A;  4GXJ A;  5E79 U;  4YXJ A;  5J2I A;  4M2Y A;  3TFR A;  5HR6 A;  2YML A;  3V72 A;  2GAF D;  3HJE A;  5B3P A;  5HRB A;  1COK A;  3G6X A;  1Y88 A;  4X4T A;  1ZQA A;  1K5O A;  1L3V A;  4GC6 A;  4PGQ A;  2W9C B;  1ZQV A;  5AM5 A;  3TAR A;  3WFQ E;  3MDA A;  3SYZ A;  4X4P A;  3G6V A;  3VCB A;  3RB3 A;  1BNP A;  1XS9 D;  4P4O A;  1SZH A;  5L1K A;  4F92 B;  5ALT A;  2ZXI A;  5EE0 A;  1SWW A;  1NJY A;  2O6K A;  2E1E A;  3SAG A;  3QUB A;  5KT4 A;  4M9G A;  5HR9 A;  4F4W A;  4Y2R A;  2F8L A;  2OCE A;  1N60 A;  5AM4 A;  2I1Q A;  4RQ5 A;  1YZ7 A;  3CYM A;  2C28 A;  1R89 A;  3RH6 A;  3NTU A;  2Q66 A;  5DG7 A;  5AIC A;  4PGY A;  5D62 A;  1IG6 A;  1TV9 A;  2PMZ F;  1Q3U A;  3L5K A;  5DBB A;  3V6H A;  4HAI A;  3JPO A;  3C18 A;  1PK1 B;  1DK3 A;  1JXE A;  4PL1 A;  1ZQJ A;  4UAZ A;  4YD1 A;  3BJY A;  2OH2 A;  4Y2U A;  2HN2 A;  4RQ6 A;  4DOB A;  4J03 A;  3SEN A;  3PW7 A;  1A0P A;  4KMU A;  2YX8 A;  1B22 A;  2B0C A;  4Z6C A;  1S0V A;  1UQV A;  5IIN A;  3MGV A;  4ED1 A;  4CGZ A;  4MF8 A;  3PSP A;  3HPO A;  3MR6 A;  3C5G A;  2KJ5 A;  4ECV A;  4WC6 A;  4GXK A;  3H39 A;  2HHT A;  4EBK A;  1RYS A;  3MCR A;  9ICJ A;  4XQ8 A;  1ZQP A;  1T94 A;  3KHH A;  3AQK A;  2KHQ A;  2KK0 A;  3IM1 A;  3JZ0 A;  2KIC A;  3T79 A;  2ATL A;  2HOF A;  2K4I A;  4QZ8 A;  1B43 A;  2JMG A;  5KG7 A;  2GO7 A;  5TIS U;  2KNJ A;  1SL2 A;  1NK7 A;  4KN4 A;  5DQI A;  2LI6 A;  1R8C A;  4FZL A;  3Q8P B;  2K8B B;  1J2N A;  3MR5 A;  2FLP A;  3MAB A;  5HRF A;  1KFD A;  4MHV A;  5IIM A;  3QU4 A;  2W11 A;  3WFO A;  1VJ7 A;  4F4X A;  1ZXI A;  3R9K A;  3IHQ B;  3RRH A;  3ERC C;  4K9A A;  1L8L A;  4Q8F A;  4MKP A;  3Q8S B;  2PFQ A;  4WOY A;  4EX6 A;  1ED1 A;  1LKY B;  2CXY A;  2KHV A;  1X6I A;  3UMC A;  4OD0 A;  1VFG A;  4ED6 A;  4Z6D A;  3IP4 B;  2NO5 A;  5L1I A;  4TQS A;  4DSJ A;  5EWF A;  3BQ0 A;  4E7X A;  2NRZ A;  3PW2 A;  4PZO A;  5ALJ A;  1P7D A;  3JCF A;  3TFS A;  4WQL A;  2BCR A;  3UPS A;  2EQY A;  3RH4 A;  2OEH A;  3SEI A;  7ICU A;  5J2C A;  4C4R A;  2GOL A;  3BQ1 A;  5B66 U;  2KFZ A;  4RQ0 A;  2R8K A;  3NVW A;  2YMM A;  1S8O A;  4NV0 A;  1RYR A;  1NI3 A;  4NLG A;  2FJ6 A;  4JWM A;  2KE7 A;  3H3A A;  3WKE A;  3RAX A;  2C2R A;  4OJL A;  5EE3 A;  1HIW A;  5KFR A;  4QZH A;  3PW5 A;  1T4G A;  1XC9 A;  3AQL A;  3WFS C;  2IHM A;  1KLN A;  1D9F A;  2ASD A;  4C0Z A;  2E3T A;  1XSN A;  5IIJ A;  3TI0 A;  4NLB A;  1TK5 A;  1SWV A;  5III A;  4WC3 A;  4M0A A;  1J2M A;  2F3N A;  4Y2T A;  5CR0 A;  4CF3 A;  4I29 A;  9ICW A;  5J2G A;  3E0F A;  5G5H A;  5AK6 A;  1BPZ A;  4ED8 A;  1DGJ A;  4DCC A;  1XO1 A;  1PK3 A;  1SZP A;  4WC4 A;  1MSW D;  3TAN A;  4FH3 A;  4YMO A;  3JPR A;  2VA3 A;  3RAQ A;  4BX9 C;  1VDV A;  4PGX A;  4UBC A;  4QIW C;  2ZH1 A;  2PFN A;  2IHN A;  3F2C A;  1RM6 C;  2EAO A;  3M6Z A;  4DQP A;  3LQC B;  5AK4 A;  2E8M A;  3ISB A;  2JV3 A;  4C80 A;  5DEC A;  2R18 A;  3NUQ A;  7ICK A;  2W8K A;  3ZD9 A;  1KW4 A;  4UAW A;  2KN7 A;  2NYV A;  2M2U A;  1ZQY A;  1R8B A;  5KFP A;  4XQ7 A;  4WC5 A;  2EAM A;  1SKR A;  2ZH9 A;  5J0U A;  1WOT A;  3QNM A;  3WFP A;  3V6J A;  4R64 A;  3D2N A;  2ZIU A;  2AJQ A;  4LT6 A;  2ZTD A;  2F76 X;  5ALK A;  3PX6 A;  2ZHA A;  4RQ1 A;  2KFN A;  4I27 A;  1QQ7 A;  4Y2S A;  2DF4 B;  3PV8 A;  1ZQC A;  3TAD C;  4DS4 A;  1SKS A;  3ALR A;  4RWQ A;  2MAX A;  2YQE A;  4TUS A;  1LV5 A;  3NVZ A;  3PST A;  4Q45 A;  2IUB A;  2VAN A;  4M6W A;  5KFW A;  2HI0 A;  3KKA A;  4RQN A;  2PBE A;  4C7Z A;  5KFV A;  3VC8 A;  2RQ5 A;  2AXT U;  2ZUD A;  4DWI A;  1X9X A;  3Q8M A;  3LDA A;  5DB8 A;  4OJP A;  5J0P A;  4JV0 A;  3M9O B;  3F5E A;  4DSK A;  4KLE A;  4LEZ A;  3ZD8 A;  4KLJ A;  1YLQ A;  5ALZ A;  8ICH A;  4IL6 U;  3WU2 U;  4PHP A;  5ALP A;  2B51 A;  2LKY A;  3C29 A;  2DGZ A;  2BPG A;  2IBK A;  3E2E A;  2E8P A;  4C7Y A;  4ECZ A;  4RQM A;  1BNO A;  5HR7 A;  5D61 A;  3H0R B;  5AM0 A;  4O5K A;  5KFZ A;  4EEL A;  3GZF A;  1Q3V A;  2BGW A;  4EV6 A;  5F9L A;  3ISC A;  4EYI B;  3AQM A;  2RLT A;  3F2B A;  4NXX A;  1N61 A;  1TFW A;  2IOH A;  2A19 A;  4XA5 A;  9ICG A;  3PML A;  4OJO A;  2BKE A;  8ICR A;  4GXI A;  1S77 D;  3MDC A;  2FPM A;  1MIV A;  1X9S A;  2M2W A;  3WFR E;  1JAL A;  4F50 A;  3IN5 A;  8ICW A;  4O0I A;  3TAQ A;  2AGP A;  1PVR A;  5CP2 A;  4BUG A;  8ICN A;  3IG8 A;  4EZ6 A;  2QKQ A;  5JTI A;  2JEI A;  2O1P A;  3MFH A;  5AKE A;  2DRA A;  8ICU A;  2P6U A;  5BOM A;  3M1Y A;  4F2R A;  1SXD A;  3KHR A;  5KL8 B;  9ICH A;  1QSY A;  4R8U B;  2HDO A;  3GIK A;  4UAS A;  4I2G A;  4ECR A;  5AKZ A;  8ICA A;  3AL0 B;  4FBU A;  4X4Q A;  3AU6 A;  3V7J A;  2R8I A;  4DSI A;  2ZIW B;  3TQ1 A;  1X66 A;  3L4P A;  4I2A A;  2K4H A;  3C1Y A;  2PXI A;  2LPE A;  3N7S C;  4RWO A;  3N97 B;  5ALR A;  2VA2 A;  3G6Y A;  3RJF A;  2ZH6 A;  4PHE A;  3KD3 A;  4DF8 A;  2HHS A;  5EE1 A;  2K89 A;  4B9V A;  4YVZ A;  3SD7 A;  2DRB A;  5J0W A;  4RPZ A;  3PZP A;  4M9J A;  2BDP A;  1Z00 B;  4ED2 A;  3IV6 A;  3OSN A;  2EZY A;  3ICX A;  2F2A B;  5KNI A;  1QSL A;  2QB0 A;  2ZH7 A;  1JN3 A;  5IIO A;  2W3S A;  1Z4O A;  1F5S A;  4TUR A;  3I28 A;  4NJ8 A;  3FC4 A;  1WCN A;  3CW2 C;  1U49 A;  2KKV A;  1SIJ A;  3LVV A;  2W9B B;  9ICL A;  2VJ5 A;  1JIH A;  1X40 A;  2ZXH A;  1Z4N A;  1CI4 A;  5J0S A;  2JHD A;  5ALW A;  4ATB B;  3RF9 A;  3PR5 B;  1ZQU A;  5DBA A;  3GDX A;  3SMV A;  1OXJ A;  4KM5 A;  5KT6 A;  3HW8 A;  3PW4 A;  2Y1J A;  3TKA A;  8ICL A;  4I2H A;  1KSP A;  5IIK A;  4IS7 A;  4ECS A;  8ICM A;  8ICI A;  1WCL A;  4XUS A;  4DL4 A;  4RQ7 A;  1N5W A;  4DL5 A;  4DFM A;  4PHD A;  5DB7 A;  2ASJ A;  3BQT A;  1RQL A;  1ZD5 A;  2WAQ C;  1V85 A;  4P4P A;  8ICG A;  2DPI A;  2LYB A;  4B9T A;  1AQ6 A;  5AKJ A;  2WHE A;  1SB3 C;  2DKX A;  2PKE A;  1D9D A;  4IQW A;  4MEX A;  3H8S A;  7ICS A;  4QZC A;  1VJ5 A;  2D8C A;  1X6J A;  2WB1 F;  3HJ4 A;  3OTQ A;  4O3M A;  3T5K A;  2HOI A;  5HRG A;  4EX7 A;  2F77 X;  3H40 A;  4UAR A;  4TUQ A;  1NKE A;  3UMG A;  7ICG A;  2F1H A;  2DBY A;  4USA A;  3AM9 A;  1V38 A;  2F44 A;  1RPL A;  3AQE A;  4NL9 A;  7ICE A;  1SGG A;  3QE9 Y;  5ALN A;  1ZRN A;  1JI7 A;  2UVR A;  2ZJ5 A;  1L7P A;  5GTH U;  1D8Y A;  2J6U A;  2ISP A;  2ZH4 A;  4J9P A;  2YMP A;  4JK1 A;  2L5Y A;  8ICK A;  2Y0S C;  2BCQ A;  5HHI A;  4YP3 A;  1PUZ A;  5CJ7 A;  1B0X A;  2QAR A;  3NVY A;  3IRU A;  4K97 A;  2MU2 A;  1QSS A;  3QX7 A;  5HRI A;  4ECW A;  1OUQ A;  4AYB F;  1SV4 A;  4CE6 A;  2YY6 A;  4F3O A;  4WH5 A;  2EAN A;  4O6A A;  1TVA A;  4J9R A;  2G0A A;  3OGU A;  5L1L A;  5KFC A;  3K7D A;  5L9X A;  4QZE A;  1NK4 A;  1NJW A;  9ICF A;  2R8J A;  2JH1 A;  2P6R A;  3RTV A;  2JZB A;  1WUD A;  3ED5 A;  5AKI A;  1UEU A;  3BZK A;  5J2A A;  5DQG A;  5KFG A;  5ALM A;  3H8J A;  1D8B A;  1RXV A;  5KG2 A;  2LYH A;  2PFP A;  4EBJ A;  2IHO A;  3OWG A;  4YMN A;  4GC7 A;  4C8K A;  5J8Y A;  2EWR A;  2ZIX A;  2HW3 A;  4O69 A;  9ICQ A;  1KFT A;  5TZV A;  9ICU A;  2B4V A;  3WKC A;  2KKP A;  5ALX A;  4ELT A;  4K8V A;  5B5E U;  1TK8 A;  5CFT A;  2W03 A;  4O5E A;  4UB1 A;  4TQR A;  1SV0 A;  2W04 A;  5G5G A;  4YFK A;  4PL2 A;  4BXO A;  3C2K A;  3L3F X;  4JV1 A;  1TAQ A;  4ICA A;  5DLF A;  2WTF A;  3GV8 B;  4A8E A;  5AKH A;  3N7P D;  3DV9 A;  4G3I A;  1NO5 A;  5J0Q A;  1HJP A;  4X4O A;  1IXR A;  2Z7J A;  2HHP A;  3JPQ A;  1ZET A;  4UQG A;  1UHU A;  3JPT A;  3KKA C;  8ICE A;  2HN1 A;  4IC9 A;  2C2D A;  5KFE A;  4B9N A;  5KFF A;  3UMB A;  4IR9 A;  4P0P A;  2NRV A;  2XIC A;  3U26 A;  4KLF A;  3NVO A;  3BDP A;  1S5L U;  4OAH A;  3RR7 A;  1FFU A;  5ALE A;  2BQ3 A;  3KFU F;  4X0A A;  3H7I A;  4FE3 A;  3C2L A;  5DGB A;  4RZR A;  2DR8 A;  2E1F A;  2XY6 A;  4OAI Z;  5KTQ A;  3ORY A;  2KTQ A;  2RHF A;  5AIA A;  5KT7 A;  4US9 A;  3ETL A;  1U9L A;  3GIJ A;  5CHG A;  2KJ8 A;  2K8C B;  4MF2 A;  5BPC A;  1XO0 A;  5ALI A;  2V4Q A;  5ALO A;  3M9M B;  3BS5 A;  3T5J A;  1YT3 A;  4KN7 A;  5DB6 A;  5KFS A;  3PR4 A;  4JUZ A;  4LEW A;  3SZ2 A;  2BZF A;  5JUM A;  1WWU A;  5KG5 A;  3WK9 A;  4IQV A;  1O03 A;  4UAT A;  1UCV A;  2P35 A;  1N63 A;  5AI6 A;  8ICO A;  4F5R A;  3BS7 A;  2KIV A;  3DDH A;  1ZQS A;  4YR2 A;  2KVC A;  4LJX A;  3GII A;  4NXZ A;  1URJ A;  2JH7 A;  4F71 A;  1MA7 A;  3ZI4 A;  2M9N A;  3PX4 A;  3EPG A;  1N2X A;  5CB1 A;  2GA9 D;  2H3F A;  2NO4 A;  2DPJ A;  4RWP A;  1ZQD A;  3FAH A;  2LHT A;  3Q8L A;  1S0O A;  2CRX A;  5DLG A;  2BPF A;  2HBJ A;  3IDW A;  5HRH A;  1JUD A;  4CF5 A;  1N62 A;  1ZD4 A;  3RRG A;  1O08 A;  4AT7 A;  4NM1 A;  4JV2 A;  2Q4T A;  9ICX A;  3SI8 A;  4DOA A;  3T5L A;  2RDI A;  2W9M A;  4KLI A;  4FZM A;  5JRT A;  3T5H A;  7ICN A;  2PMZ C;  2ZIU B;  3CP8 A;  3EUB 2;  2V4R A;  1UT5 A;  2M2T A;  8ICT A;  4FH5 A;  5KFB A;  4I2I A;  1ZQX A;  8ICV A;  3Q8Q B;  2BQR A;  4J9L A;  4DL7 A;  3QZ8 A;  4NXU A;  4IR1 A;  1IV8 A;  2DR5 A;  4J9S A;  3OHA A;  1Z3E B;  2N1R A;  8ICY A;  1UA0 A;  4RNO A;  1SKW A;  4M6W B;  3PMN A;  3QYP A;  4X4S A;  1HUO A;  4F72 A;  5DG8 A;  2FMS A;  2OYY A;  4KLM A;  5AKY A;  4RU9 A;  2EZX A;  3M7D A;  4Y2X A;  3C2M A;  3RR8 A;  1ZQF A;  1BPD A;  4DQI A;  3GV5 B;  5KG3 A;  1ZRM A;  1KDH A;  3CRX A;  3LYS A;  2WF8 A;  5HP4 A;  4ELU A;  3WKB A;  5JU5 A;  2HVI A;  4K4G A;  5ALF A;  4WBZ A;  4O3O A;  2MRL A;  4UAY A;  2XID A;  3PVX A;  3ER9 B;  3HT3 A;  9ICP A;  4O5C A;  2BE3 A;  2LM1 A;  4NY8 A;  1ZD3 A;  8ICF A;  3OUY A;  1ZQI A;  4DFJ A;  3RJK A;  4JWN A;  1A77 A;  5KT3 A;  3S6J A;  1DRG A;  1TFR A;  2HHU A;  1HEK A;  7ICL A;  3HJ1 A;  4B9M A;  2J6S A;  2UVW A;  2D3D A;  2F1J A;  4DSF A;  4AT9 A;  2GWS A;  4PJ0 U;  3F2D A;  5J2F A;  1DK2 A;  5DDM A;  5KT2 A;  4UB2 A;  3HKZ F;  4M04 A;  3DEE A;  4KIT B;  1KNY A;  5K4L A;  8ICC A;  3Q8R B;  4Y2Y A;  5T14 A;  2HOQ A;  1FEZ A;  4WC2 A;  2MUT B;  5H2F U;  3H4B A;  3ZDB A;  4KLD A;  4WJ3 B;  1U48 A;  4QZG A;  2IMW P;  1RXW A;  4MEY A;  4RQ3 A;  5EE9 A;  8ICS A;  4QJF B;  3M6K A;  4PPX A;  4NL9 C;  4WC7 A;  2NRW A;  4I2E A;  3EF2 A;  9ICS A;  3OV7 A;  4DSE A;  1TE2 A;  4RQ8 A;  4JLZ A;  2XGQ A;  7ICH A;  9ICK A;  3MR3 A;  1Q46 A;  5AK3 A;  1ZD2 P;  4F8R A;  1ZQK A;  2G09 A;  2NRT A;  2KSO A;  1L3T A;  4DS5 A;  3ZDE A;  3RJI A;  2I9G A;  4XJE A;  2Q0Z X;  2FI1 A;  2XGP A;  3GIM A;  4EEY A;  5KFL A;  2BCS A;  3H8M A;  4YCX A;  4FBT A;  2WF5 A;  2ZH3 A;  3WK5 A;  2W54 A;  4DSL A;  4WQK A;  2XY5 A;  4FZN A;  3NRZ A;  1DGS A;  4WC0 A;  1MIW A;  3M8R A;  2W43 A;  5DKW A;  4KLO A;  1NNL A;  2GH1 A;  4I2F A;  1Z1V A;  4ECT A;  2DUY A;  3QU2 A;  1S9F A;  3NWI A;  1RDF A;  2JEJ A;  4FHY A;  1KFS A;  3OPX A;  3KHG A;  4RPY A;  2QB0 B;  2W3R A;  1SL0 A;  3H4D A;  1L7M A;  3H38 A;  3I76 A;  4NLZ A;  4ECY A;  4QZ9 A;  2PI5 A;  2MUT A;  4RQ2 A;  4HYK A;  3OJU A;  1ZQT A;  5J29 A;  5J8Y C;  5J2D A;  3K1R B;  2W7P A;  4BWM A;  2ALZ A;  3GQC A;  5CFS A;  4Q43 A;  4PZN A;  3JPS A;  1UET A;  4S3N A;  3M8S A;  2Y9T A;  4ZOH C;  4M9L A;  4QWE A;  1XNS A;  3HP6 A;  8ICZ A;  1ZQH A;  3F5A A;  3C23 A;  4DQR A;  3M9N B;  2BDU A;  5KAI U;  5KFM A;  5C5J A;  4DFP A;  1SV0 C;  2ODG A;  3ER8 C;  3PSF A;  2KP7 A;  3WK7 A;  1JX4 A;  3V7L A;  1S10 A;  5HML A;  2VIX A;  1NK5 A;  4EEK A;  3AQF A;  4YR3 A;  3QEB Z;  4QZF A;  2FDR A;  3H0L B;  3GU3 A;  4ED0 A;  1S0M A;  4O67 A;  2FLL A;  2B6G A;  4IRK A;  4CF4 A;  5KFN A;  2XO7 A;  2A1J A;  3AN1 A;  4N7R A;  2B21 A;  1TAM A;  1V4A A;  5AKX A;  2RFF A;  1RZT A;  2G5I B;  2EAP A;  2NV3 A;  4R66 A;  5DED A;  4KLU A;  1Q8K A;  3KOO A;  5AHX A;  2LMR A;  2XCP A;  5AKK A;  5EWE A;  4Z6E A;  3JYY A;  3UM9 A;  1KTQ A;  1GO3 F;  4XRH A;  2XC9 A;  4NLC A;  4MFA A;  3C1Z A;  4R65 A;  5BOL A;  4TUP A;  1FFV A;  2WFA A;  1KBU A;  3JPN A;  5AKG A;  5KFI A;  3WKD A;  4M9H A;  5KFA A;  5D46 A;  9ICO A;  3QUQ A;  1MQ3 A;  3JPP A;  5KG0 A;  3RJG A;  3LWL A;  1TAU A;  1TFY A;  3ONN A;  3LVW A;  3CK6 A;  4ACO A;  4P0Q A;  2H3V A;  1OU5 A;  2OM6 A;  5AIB A;  3MC1 A;  4J9K A;  2QAR B;  1X2I A;  4O3S A;  4CNQ A;  4FHW A;  4I0U A;  3V7K A;  2XVT A;  3A0B U;  1QLN A;  5B3Q A;  4NXV A;  3NKU A;  2V9W A;  2AGO A;  4UW9 A;  4DO9 A;  3B9J A;  4F5P A;  8ICQ A;  1X9W A;  3HIY A;  1BPB A;  2BR0 A;  5CA7 A;  4JB3 A;  8ICP A;  3SAF A;  4U7C A;  2PI4 A;  4NLN A;  4DOC A;  2JZB B;  2E8O A;  1QTM A;  5ALD A;  1PVP A;  1QH9 A;  3NAS A;  1F44 A;  1ZQW A;  2K60 A;  1NJZ A;  4WBY A;  4KX5 A;  4F93 B;  4DEZ A;  2JEG A;  1CRX A;  2EH9 A;  3PNC A;  1FIQ A;  4ELV A;  2XCA A;  1K1S A;  2H3I A;  3E58 A;  1ZQL A;  3UXN A;  3PX0 A;  1NJX A;  2ZIX B;  4DFK A;  4RT3 A;  2KZZ A;  2OHF A;  1N56 A;  3EPI A;  1M6Y A;  4C4T A;  4LEV A;  2C22 A;  2ZG6 A;  9ICT A;  4CRX A;  4RNM A;  3D6J A;  4O3R A;  2FPK A;  4NM2 A;  5KT5 A;  5CFU A;  3UPQ A;  1ZQR A;  5KAF U;  4FHP A;  3C5F A;  4BXO B;  3MFI A;  3KTQ A;  2ZJ8 A;  5J2J A;  3PW0 A;  2ZH5 A;  2LBO A;  1NK6 A;  3RFA A;  2CPR A;  1ZQO A;  4EBE A;  4UB8 U;  4NXT A;  5IIL A;  3N28 A;  4DLG A;  1YZ6 A;  3THV A;  4NWI A;  4NKT A;  5AI0 A;  3QXG A;  2YB1 A;  3OVB A;  4Y2J A;  2D6F C;  5EWG A;  5HRD A;  2AHO B;  7ICO A;  4DLE A;  2JGA A;  4P0P B;  5DQH A;  2ZUC A;  1L3U A;  1ECW A;  1F0M A;  1XWL A;  4RUC A;  3QEA Z;  2K4E A;  2WF6 A;  4UB6 U;  4FS2 A;  4F4K A;  4YR0 A;  5AI8 A;  1NZP A;  4OCZ A;  2W8L A;  4F4Y A;  4OJ5 A;  1DOQ A;  7ICI A;  3OVS A;  3MGH A;  1ZQQ A;  4DL2 A;  4UB3 A;  4F4Z A;  3NYB A;  2EZZ A;  1X42 A;  1L8O A;  3Q8K A;  1S0N A;  1S76 D;  1HUZ A;  5J0R A;  3QUT A;  2DR9 A;  4DL3 A;  4DQQ A;  2H3Q A;  1V97 A;  2BHN A;  4X4V A;  4EGW A;  4I2D A;  2Y9U A;  4QZA A;  2ZIV A;  1SL1 A;  4JLX A;  4NXW A;  4BGD A;  4YQW A;  2LYA A;  4OAF A;  1NK9 A;  3BS5 B;  2BCU A;  1L7O A;  4F91 B;  2FMQ A;  3AMZ A;  4UAV A;  3C21 A;  1A76 A;  2R8G A;  3PY8 A;  4K4H A;  7ICP A;  1DXS A;  5DG9 A;  9ICC A;  3BZC A;  2P66 A;  2ZTE A;  3PO4 A;  4NLK A;  3OSP A;  3TAC B;  2AQ0 A;  5AM2 A;  9ICA A;  4KLT A;  2BBH A;  4E80 A;  4BDP A;  1UA1 A;  2M0N A;  4P4M A;  4DQS A;  7ICT A;  3SQI A;  4GIB A;  5L1J A;  2YB4 A;  5J0Y A;  9ICI A;  5F3X B;  2ZH2 A;  1C7Y A;  2BCV A;  4ECU A;  2ES6 A;  2RRD A;  1OW5 A;  5J2K A;  4DF4 A;  4IQT A;  3WK4 A;  1FA0 A;  1MIY A;  5KFK A;  2A1A A;  2W9C A;  2WB1 C;  5KFY A;  1U4B A;  1N48 A;  5F2V O;  5KG1 A;  3EYZ A;  5GTI U;  2F1I A;  3MR2 A;  3A0H U;  3KZI U;  2IOF K;  1Z1B A;  5ALV A;  2Y1I A;  2KVS A;  3LWM A;  4AT7 B;  1KL9 A;  1GPJ A;  3RBE A;  4QIW F;  1BGX T;  2HHX A;  1RYU A;  4YXM A;  2EDU A;  3UQ2 A;  2VJ4 A;  2MSN A;  8ICJ A;  3OVA A;  3RBD A;  3UXO A;  4F2S A;  4C8L A;  1V9P A;  2KZ3 A;  3H8W A;  2G5H B;  2HMX A;  5KG4 A;  1NZB A;  1NK0 A;  3D2Q A;  4G9B A;  4FS1 A;  1U47 A;  3GV7 B;  3WKA A;  4AYB C;  5CHE A;  1ZYQ A;  2KD1 A;  1PK1 A;  3O0F A;  2DQN B;  4ED7 A;  5F9N A;  1ZOL A;  3KBB A;  1NKB A;  9ICV A;  4QZB A;  2VA8 A;  3BQ7 A;  5J0O A;  4O3P A;  3T3F A;  4I28 A;  2ZH8 A;  4I2J A;  1T7P A;  4AT8 B;  2DL0 A;  5KFJ A;  1ZQM A;  2ID1 A;  1F5A A;  3UQ0 A;  4KLL A;  2FE9 A;  3CNH A;  4UB5 A;  3MGI A;  2HBL A;  1ZQG A;  4LZG A;  2HHV A;  1K1Q A;  5KFU A;  1JRP A;  2AGQ A;  2ASL A;  4BWJ A;  2NRX A;  4QWB A;  1R8A A;  5DDY A;  3OUY B;  5HRE A;  5HRK A;  4GFJ A;  3HRD D;  3D2S A;  4O3N A;  4QW8 A;  1L6N A;  4FO1 A;  5ALG A;  4X4R A;  4NKU A;  3NS1 A;  7ICF A;  1LVH A;  4AT9 B;  1NKC A;  5JTG A;  1A6S A;  2OWO A;  3RB6 A;  4EP7 A;  3FYH A;  4IRC A;  3RH5 A;  2IA6 A;  2DR7 A;  1JMS A;  2J6T A;  2ESE A;  4UD4 A;  1IIP A;  4P2H A;  5EOZ A;  2DFL A;  4Q44 A;  2KEY A;  4Y2Q A;  4LEY A;  3QUC A;  4C8N A;  4YMM A;  2F8K A;  5J0T A;  4C4S A;  4KTQ A;  3EWA A;  2KIW A;  1MC8 A;  3N7R C;  3HIL A;  5L1M A;  4I2C A;  2QLT A;  4EEB A;  1LKY A;  4B6J A;  4AT8 A;  5AI4 A;  4C8O A;  2KSO B;  3I1Y A;  5HRL A;  2WF7 A;  4UBB A;  5HC9 A;  3RB0 A;  2DKZ A;  2HVH A;  5KFO A;  1QQ5 A;  4IG8 A;  4DFD A;  1UEV A;  2BPC A;  5C0Y A;  1T3Q A;  5FP0 A;  9ICM A;  1EXN A;  3QU7 A;  4E8F A;  4PHA A;  2KMD A;  4K98 A;  1KN5 A;  5KFH A;  2MA1 A;  1S97 A;  4EED A;  5AI9 A;  1XSP A;  4RQ4 A;  4M5D A;  5D49 A;  2AQ4 A;  3HX0 A;  4KB6 A;  5ALQ A;  4M47 A;  3QU9 A;  4RPX A;  1KQQ A;  3C28 A;  1KKX A;  5AM1 A;  3GIL A;  3FDS A;  5CWR A;  1Q78 A;  4KLS A;  9ICN A;  2HCF A;  4FHV A;  1COO A;  2IOF A;  5KFD A;  1UT8 A;  4MFC A;  4RNN A;  4K96 A;  1PX5 A;  4B9U A;  1SXE A;  4K9B A;  4LVS A;  4J9Q A;  2AU0 A;  5J2H A;  3H0M B;  5ALY A;  3BQ2 A;  4ED3 A;  4ZH4 A;  1B4F A;  9ICE A;  4C8M A;  4X4U A;  3KHL A;  1PVQ A;  1ZQ1 C;  2G07 A;  5J2B A;  1KEJ A;  3ISD A;  1T3N A;  1TKD A;  3QU5 A;  4I2B A;  4WC1 A;  4U6P A;  4ECX A;  1WYG A;  2K4P A;  2DVI A;  4UB4 A;  2ZUB A;  1ZJN A;  2ZHB A;  1D8L A;  2NRK A;  2KV2 A;  5J0X A;  1CUK A;  1JXL A;  4IQU A;  2YN4 A;  3SAH A;  3RJH A;  2I5H A;  4E0D A;  3SV4 A;  4AP9 A;  1RG6 A;  1IM4 A;  4KLQ A;  4UAU A;  2KJ9 A;  2A1J B;  2A3V A;  1MQ2 A;  3PO5 A;  4M9N A;  7ICM A;  4QNL A;  3LK9 A;  4CDG A;  3NVV A;  4LZD A;  2WAQ F;  2H5X A;  1WG8 A;  1QCK A;  4OJ6 A;  1U45 A;  2BQU A;  3WK8 A;  4X5V A;  3FM9 A;  4YN4 A;  1VLB A;  4JMU A;  5HMM A;  1J97 A;  1WWV A;  3HWT A;  4X0B A;  1JAJ A;  1H38 A;  2HBK A;  3K4G A;  2HSZ A;  2W7O A;  3V6K A;  1KRP A;  2E5S A;  2M2V A;  4QZD A;  7ICV A;  2KZM A;  2KOB A;  2H3Z A;  1JQR A;  4FO6 A;  3EW9 A;  3K75 D;  5KFQ A;  3AEV A;  4US8 A;  5HNK A;  4P0Q B;  1L3S A;  3QZ7 A;  5A0L A;  1BPX A;  4PH5 A;  2XI9 A;  1NK8 A;  3AUO A;  2LM4 A;  2OXO A;  3IG5 A;  2GLE A;  2R8H A;  2RP5 A;  2O5A A;  1RQN A;  1X9M A;  4Q8E A;  4J9M A;  5AM3 A;  2FLN A;  3ZDC A;  3ZDD A;  5KFT A;  2Y0S F;  4KMO B;  3J81 j;  4Z6F A;  3RJE A;  2DWQ A;  2RDJ A;  4QWC A;  1ZQB A;  2HBM A;  2ISO A;  9ICB A;  4KLG A;  1TK0 A;  3RB4 A;  5AKL A;  1NOM A;  1ZJM A;  2FMP A;  3HKZ C;  3SR6 A;  2FCL A;  2JRZ A;  3AU2 A;  1Q79 A;  5ALU A;  2VKQ A;  4RT2 A;  4MFF A;  1L7N A;  2CN1 A;  2ZJA A;  4K4I A;  4KLH A;  4KX3 A;  5DBC A;  4WCW A;  2E8N A;  1MN8 A;  1LB2 B;  1XU4 A;  3B0Y A;  3H37 A;  1CEZ A;  3MBY A;  2YTU A;  2FPL A;  5AK5 A;  4X4N A;  2HHW A;  5ALS A; 
#chains in the Genus database with same CATH homology
 3LDA A;  3Q8K A;  1S0N A;  1S76 D;  2DPJ A;  5DB8 A;  1HUZ A;  4O9M A;  4RWP A;  1ZQD A;  5J0P A;  4JV0 A;  5J0R A;  3M9O B;  2DR9 A;  4DL3 A;  4DQQ A;  3L9D A;  3Q8L A;  1S0O A;  4DSK A;  4EZ9 A;  1BPY A;  4KLE A;  4QZI A;  3ZD8 A;  5DLG A;  2BHN A;  2BPF A;  4KLJ A;  4J9N A;  8ICH A;  1YLQ A;  4X4V A;  1ZQZ A;  1L5U A;  5HRH A;  4YD2 A;  4I2D A;  4PHP A;  3GFK B;  3RRG A;  4QZA A;  4FHX A;  1SL1 A;  4AT7 A;  4BGD A;  4YQW A;  2HHQ A;  2BPG A;  2IBK A;  4NM1 A;  4JV2 A;  3E2E A;  1NK9 A;  3EZ5 A;  9ICX A;  2BCU A;  1BVS A;  3SI8 A;  4DOA A;  4F91 B;  2FMQ A;  3T5L A;  3C21 A;  1A76 A;  2RDI A;  4R63 A;  2W9M A;  4ECZ A;  2JEF A;  2R8G A;  3T5H A;  3PY8 A;  4K4H A;  4KLI A;  7ICN A;  7ICP A;  1BNO A;  5DG9 A;  4EBD A;  9ICC A;  4O3Q A;  1T8E A;  4O5K A;  7ICR A;  5KFZ A;  2V4R A;  1UT5 A;  3RJJ A;  2M2T A;  8ICT A;  1ARO P;  4FH5 A;  2P66 A;  2ZTE A;  3PO4 A;  4NLK A;  3OSP A;  5KFB A;  2AQ0 A;  2BGW A;  3B0X A;  4I2I A;  4R8U A;  5F9L A;  3NGD A;  1ZQX A;  4EBC A;  3Q8Q B;  2BQR A;  3ISC A;  2UVV A;  4EYI B;  4J9L A;  4KLT A;  9ICA A;  1ZQE A;  4ECQ A;  3AQM A;  4E80 A;  4BDP A;  1UA1 A;  4RWN A;  4P4M A;  4F5O A;  4DQS A;  7ICT A;  1TFW A;  4QW9 A;  4DL7 A;  4XA5 A;  9ICG A;  3QZ8 A;  2UVU A;  4B9L A;  2W9A A;  3PML A;  5L1J A;  2XY7 A;  4IRD A;  4IR1 A;  5J0Y A;  9ICI A;  2DR5 A;  2ZH2 A;  4J9S A;  3OHA A;  1C7Y A;  2BCV A;  1Z3E B;  2BKE A;  4ECU A;  4J9O A;  1PZN A;  4GXI A;  4RNO A;  1UA0 A;  1S77 D;  1SKW A;  8ICR A;  3MDC A;  4M6W B;  3PMN A;  2FPM A;  5J2E A;  2C2E A;  1BPE A;  5D4B A;  5J2K A;  1X9S A;  2M2W A;  1MIV A;  3WFR E;  4DF4 A;  4IQT A;  1FA0 A;  1MIY A;  4X4S A;  4F50 A;  8ICB A;  3SV3 A;  5KFK A;  1HUO A;  5DG8 A;  2W9C A;  4F5N A;  4QWA A;  2ZTC A;  2FMS A;  4KLM A;  4F5Q A;  4RU9 A;  5KFY A;  1U4B A;  8ICW A;  4O0I A;  3TAQ A;  3N4M B;  1N48 A;  3C2M A;  5KG1 A;  2AGP A;  3RR8 A;  3AQN A;  3C66 A;  5F2V O;  1ZQF A;  5CP2 A;  1BPD A;  1Z00 A;  3EYZ A;  4DQI A;  4EYH B;  8ICN A;  2F1I A;  3MR2 A;  4EZ6 A;  5KFX A;  3GV5 B;  5KG3 A;  1KDH A;  2Y1I A;  5HP4 A;  4ELU A;  2PFO A;  2JEI A;  2HVI A;  4RUA A;  4K4G A;  2O1P A;  3LWM A;  4AT7 B;  4WBZ A;  4O3O A;  7ICJ A;  3RBE A;  3MFH A;  4UAY A;  1BGX T;  2HHX A;  8ICU A;  2DRA A;  3PVX A;  5HHH A;  4YXM A;  5KG6 A;  2P6U A;  3HT3 A;  3OJS A;  9ICP A;  5DGA A;  3UQ2 A;  4O5C A;  2W9B A;  8ICJ A;  5BOM A;  2BE3 A;  3ZDA A;  4F2R A;  3OVA A;  3KHR A;  3RBD A;  3UXP A;  4NY8 A;  8ICF A;  3OUY A;  3UXO A;  4GLX A;  1ZQI A;  4DFJ A;  1ZQN A;  3OHB A;  4F2S A;  1QSY A;  4R8U B;  1V9P A;  2KZ3 A;  3GIK A;  4DL6 A;  3RJK A;  4C8L A;  4JWN A;  4I2G A;  3H8W A;  4ECR A;  4CCH A;  4ATB A;  8ICA A;  1A77 A;  4YG2 A;  5KT3 A;  8ICX A;  4FBU A;  1XSL A;  1TFR A;  4QWD A;  3AU6 A;  5DB9 A;  2R8I A;  3V7J A;  3TAP A;  7ICQ A;  4DSI A;  2HHU A;  9ICH A;  9ICR A;  5KG4 A;  4GXJ A;  3TQ1 A;  4YXJ A;  5J2I A;  4M2Y A;  3TFR A;  4I2A A;  7ICL A;  3HJ1 A;  1NK0 A;  4B9M A;  3V72 A;  3C1Y A;  2PXI A;  4FS1 A;  1U47 A;  2J6S A;  2UVW A;  2F1J A;  4DSF A;  4AT9 A;  3GV7 B;  2GWS A;  5HRB A;  4RWO A;  5J2F A;  3N97 B;  1DK2 A;  5DDM A;  1Y88 A;  3G6X A;  1ZQA A;  4X4T A;  2VA2 A;  1L3V A;  5KT2 A;  3G6Y A;  3RJF A;  1ZYQ A;  4UB2 A;  4GC6 A;  2ZH6 A;  4PHE A;  4PGQ A;  4M04 A;  2W9C B;  1ZQV A;  4DF8 A;  2HHS A;  4KIT B;  1KNY A;  4B9V A;  4YVZ A;  8ICC A;  3Q8R B;  4ED7 A;  3TAR A;  5F9N A;  5J0W A;  4RPZ A;  4M9J A;  2DRB A;  3WFQ E;  3MDA A;  4WC2 A;  2BDP A;  2MUT B;  1Z00 B;  3H4B A;  3SYZ A;  3ZDB A;  4ED2 A;  1NKB A;  4KLD A;  4X4P A;  9ICV A;  4QZB A;  2VA8 A;  5J0O A;  1U48 A;  4O3P A;  4QZG A;  3OSN A;  3G6V A;  3T3F A;  2IMW P;  4I2J A;  4I28 A;  2ZH8 A;  3RB3 A;  1BNP A;  1XS9 D;  4P4O A;  1QSL A;  2ZH7 A;  1RXW A;  1JN3 A;  5L1K A;  1T7P A;  5IIO A;  4AT8 B;  4MEY A;  4RQ3 A;  4F92 B;  5KFJ A;  8ICS A;  4TUR A;  1ZQM A;  2ID1 A;  1NJY A;  1F5A A;  1WCN A;  4PPX A;  3UQ0 A;  4WC7 A;  2NRW A;  5KT4 A;  4KLL A;  1U49 A;  4I2E A;  4F4W A;  4M9G A;  5HR9 A;  9ICS A;  4UB5 A;  3OV7 A;  3MGI A;  2W9B B;  4DSE A;  1ZQG A;  4LZG A;  1JIH A;  1K1Q A;  4RQ8 A;  2XGQ A;  5KFU A;  2HHV A;  7ICH A;  2AGQ A;  9ICK A;  2ASL A;  4BWJ A;  2NRX A;  4QWB A;  3MR3 A;  1R8A A;  5DDY A;  4F8R A;  5HRE A;  3OUY B;  1ZQK A;  5HRK A;  2I1Q A;  5J0S A;  2NRT A;  4RQ5 A;  1L3T A;  4ATB B;  2C28 A;  4O3N A;  4DS5 A;  1R89 A;  3RH6 A;  3ZDE A;  3RJI A;  3PR5 B;  2I9G A;  3NTU A;  1ZQU A;  2Q0Z X;  4QW8 A;  5DBA A;  2XGP A;  3GDX A;  2Q66 A;  5KT6 A;  3GIM A;  4EEY A;  3HW8 A;  4X4R A;  3PW4 A;  5KFL A;  5DG7 A;  2BCS A;  4NKU A;  4YCX A;  2Y1J A;  4B9S A;  8ICL A;  4PGY A;  4FBT A;  4I2H A;  7ICF A;  1KSP A;  2ZH3 A;  1TV9 A;  4AT9 B;  1NKC A;  4DSL A;  2XY5 A;  2OWO A;  5DBB A;  3RB6 A;  5IIK A;  8ICM A;  4ECS A;  4EP7 A;  8ICI A;  1DGS A;  4XUS A;  1WCL A;  3FYH A;  4DL4 A;  4WC0 A;  3V6H A;  4IRC A;  4RQ7 A;  3JPO A;  4DL5 A;  1MIW A;  3M8R A;  4DFM A;  3RH5 A;  4PHD A;  2IA6 A;  3C18 A;  2DR7 A;  5DB7 A;  1JXE A;  5DKW A;  1JMS A;  1DK3 A;  1ZQJ A;  4UAZ A;  2J6T A;  4KLO A;  4YD1 A;  3BJY A;  4I2F A;  2ASJ A;  3BQT A;  4ECT A;  4UD4 A;  1S9F A;  4P4P A;  8ICG A;  4RQ6 A;  2DPI A;  4P2H A;  4DOB A;  5EOZ A;  2DFL A;  4Q44 A;  1KFS A;  2JEJ A;  4B9T A;  4FHY A;  3PW7 A;  3KHG A;  4RPY A;  1D9D A;  1SL0 A;  4IQW A;  3H4D A;  4MEX A;  3H8S A;  7ICS A;  4KMU A;  4QZC A;  4C8N A;  3H38 A;  4YMM A;  1B22 A;  5J0T A;  4Z6C A;  4NLZ A;  4ECY A;  1S0V A;  4KTQ A;  5IIN A;  3EWA A;  4QZ9 A;  4ED1 A;  2PI5 A;  2MUT A;  4MF8 A;  1MC8 A;  4RQ2 A;  3HJ4 A;  4HYK A;  3OJU A;  3HPO A;  3MR6 A;  3C5G A;  1ZQT A;  4ECV A;  4WC6 A;  4GXK A;  3T5K A;  3H39 A;  2HHT A;  4I2C A;  1RYS A;  4EBK A;  5HRG A;  9ICJ A;  4XQ8 A;  1ZQP A;  5J29 A;  3H40 A;  4AT8 A;  5J2D A;  4TUQ A;  3KHH A;  3AQK A;  4BWM A;  2ALZ A;  3GQC A;  1NKE A;  4C8O A;  4Q43 A;  3IM1 A;  3JPS A;  1UET A;  7ICG A;  3M8S A;  5HRL A;  3JZ0 A;  4S3N A;  4UBB A;  5HC9 A;  3RB0 A;  4M9L A;  2HVH A;  4QWE A;  2F1H A;  5KFO A;  4IG8 A;  1RPL A;  3HP6 A;  8ICZ A;  2ATL A;  1ZQH A;  3C23 A;  4DQR A;  7ICE A;  1UEV A;  3M9N B;  4QZ8 A;  1B43 A;  2BPC A;  5C5J A;  5KG7 A;  5KFM A;  4DFP A;  3QE9 Y;  9ICM A;  1SL2 A;  1NK7 A;  1EXN A;  2UVR A;  4E8F A;  2KP7 A;  4KN4 A;  2ZJ5 A;  5DQI A;  4PHA A;  1R8C A;  1JX4 A;  3Q8P B;  3V7L A;  1D8Y A;  2J6U A;  1S10 A;  2ISP A;  2ZH4 A;  5HML A;  5KFH A;  3MR5 A;  2FLP A;  3MAB A;  1NK5 A;  4J9P A;  1S97 A;  5HRF A;  1KFD A;  4JK1 A;  8ICK A;  4YR3 A;  3QEB Z;  4QZF A;  2BCQ A;  5HHI A;  1XSP A;  4YP3 A;  5CJ7 A;  4RQ4 A;  5IIM A;  4M5D A;  5D49 A;  2AQ4 A;  4ED0 A;  3HX0 A;  1S0M A;  2FLL A;  4M47 A;  3WFO A;  4RPX A;  1VJ7 A;  1QSS A;  5HRI A;  4IRK A;  5KFN A;  2XO7 A;  4F4X A;  4ECW A;  2A1J A;  4F3O A;  3IHQ B;  3GIL A;  3RRH A;  3FDS A;  1TVA A;  5CWR A;  4J9R A;  1Q78 A;  2B21 A;  4KLS A;  3OGU A;  9ICN A;  1V4A A;  4FHV A;  2RFF A;  1RZT A;  4R66 A;  5L1L A;  5DED A;  4Q8F A;  1COO A;  8ICY A;  5KFC A;  4KLU A;  5KFD A;  9ICL A;  1UT8 A;  5L9X A;  4QZE A;  1NK4 A;  4MFC A;  4RNN A;  3Q8S B;  2XCP A;  1NJW A;  9ICF A;  2PFQ A;  5EWE A;  4B9U A;  2R8J A;  1PX5 A;  4Z6E A;  3JYY A;  1VFG A;  1KTQ A;  4ED6 A;  4Z6D A;  4LVS A;  4J9Q A;  2P6R A;  2AU0 A;  5L1I A;  3RTV A;  2JZB A;  4XRH A;  4TQS A;  2XC9 A;  5J2H A;  4MFA A;  5EWF A;  4DSJ A;  3C1Z A;  4R65 A;  3BQ2 A;  4ED3 A;  4ZH4 A;  9ICE A;  5BOL A;  4C8M A;  3BQ0 A;  1UEU A;  4UD5 A;  4E7X A;  5J2A A;  4X4U A;  2NRZ A;  4TUP A;  3KHL A;  5DQG A;  3PW2 A;  5KFG A;  3JPN A;  5KFI A;  5J2B A;  3H8J A;  1KEJ A;  4M9H A;  3ISD A;  5KG2 A;  1T3N A;  1RXV A;  2LYH A;  1TKD A;  2PFP A;  4I2B A;  4WC1 A;  4EBJ A;  5KFA A;  4YMN A;  5D46 A;  4GC7 A;  4ECX A;  3TFS A;  4C8K A;  9ICO A;  2DVI A;  1MQ3 A;  2BCR A;  4UB4 A;  3UPS A;  3JPP A;  5KG0 A;  2ZUB A;  3RH4 A;  3LWL A;  1ZJN A;  3RJG A;  2ZHB A;  2HW3 A;  1D8L A;  9ICQ A;  7ICU A;  5TZV A;  5J2C A;  9ICU A;  1TAU A;  1KFT A;  2NRK A;  5J0X A;  1TFY A;  3BQ1 A;  2KFZ A;  1CUK A;  4ELT A;  4RQ0 A;  2R8K A;  1OU5 A;  1JXL A;  4IQU A;  4J9K A;  1TK8 A;  1X2I A;  4O5E A;  1RYR A;  4UB1 A;  4O3S A;  4NLG A;  4TQR A;  4FHW A;  3RJH A;  4E0D A;  4JWM A;  3V7K A;  3H3A A;  3SV4 A;  3RAX A;  1IM4 A;  4YFK A;  4KLQ A;  2C2R A;  4BXO A;  1QLN A;  2A1J B;  3C2K A;  1MQ2 A;  4JV1 A;  3PO5 A;  5KFR A;  2HHW A;  2V9W A;  4M9N A;  7ICM A;  1TAQ A;  4QZH A;  2AGO A;  4DO9 A;  3PW5 A;  4F5P A;  3LK9 A;  8ICQ A;  1T4G A;  2WTF A;  3GV8 B;  5DLF A;  1X9W A;  1BPB A;  4LZD A;  2BR0 A;  3HIY A;  1XC9 A;  3AQL A;  4X4Q A;  3WFS C;  5CA7 A;  4G3I A;  1NO5 A;  8ICP A;  2IHM A;  2H5X A;  5J0Q A;  1KLN A;  1D9F A;  1U45 A;  2BQU A;  1HJP A;  2PI4 A;  4X5V A;  4NLN A;  4X4O A;  2ASD A;  1IXR A;  4YN4 A;  4DOC A;  1XSN A;  2JZB B;  5HMM A;  1QTM A;  5IIJ A;  3TI0 A;  2HHP A;  3JPQ A;  1TK5 A;  1ZET A;  5III A;  4UQG A;  4WC3 A;  4M0A A;  3JPT A;  3HWT A;  4X0B A;  8ICE A;  1H38 A;  1JAJ A;  1ZQW A;  1NJZ A;  4WBY A;  2C2D A;  5KFE A;  3K4G A;  4F93 B;  4B9N A;  4DEZ A;  5KFF A;  2JEG A;  3V6K A;  1KRP A;  5CR0 A;  4IR9 A;  4I29 A;  9ICW A;  3PNC A;  2M2V A;  5J2G A;  4QZD A;  7ICV A;  2KZM A;  1BPZ A;  4ELV A;  4ED8 A;  2NRV A;  2XCA A;  1JQR A;  1K1S A;  4FO6 A;  3EW9 A;  1ZQL A;  3UXN A;  1XO1 A;  3K75 D;  5KFQ A;  3PX0 A;  1NJX A;  4KLF A;  5HNK A;  4DFK A;  1SZP A;  3BDP A;  1MSW D;  4WC4 A;  8ICV A;  4RT3 A;  2KZZ A;  3TAN A;  3RR7 A;  1N56 A;  3EPI A;  1L3S A;  2BQ3 A;  4YMO A;  4FH3 A;  3QZ7 A;  2C22 A;  1BPX A;  9ICT A;  4X0A A;  4PH5 A;  3JPR A;  1NK8 A;  4RNM A;  3AUO A;  3H7I A;  4O3R A;  2VA3 A;  2FPK A;  3C2L A;  3RAQ A;  4PGX A;  4UBC A;  5DGB A;  4NM2 A;  5KT5 A;  4RZR A;  2R8H A;  2PFN A;  2O5A A;  2ZH1 A;  3UPQ A;  2DR8 A;  1ZQR A;  2XY6 A;  1X9M A;  4FHP A;  4Q8E A;  5KTQ A;  3ORY A;  2IHN A;  2KTQ A;  3C5F A;  4BXO B;  5KT7 A;  3MFI A;  4J9M A;  3KTQ A;  2ZJ8 A;  4DQP A;  5J2J A;  2FLN A;  3PW0 A;  3ETL A;  3LQC B;  3ISB A;  2ZH5 A;  3ZDC A;  1U9L A;  3GIJ A;  1NK6 A;  5CHG A;  5DEC A;  3ZDD A;  5KFT A;  7ICK A;  1ZQO A;  2W8K A;  4MF2 A;  4EBE A;  3ZD9 A;  5BPC A;  4UAW A;  2KN7 A;  2V4Q A;  2M2U A;  5IIL A;  4Z6F A;  1ZQY A;  1R8B A;  3M9M B;  3RJE A;  5KFP A;  4XQ7 A;  4WC5 A;  4DLG A;  1SKR A;  2ZH9 A;  5J0U A;  2RDJ A;  3THV A;  1WOT A;  3T5J A;  3WFP A;  4QWC A;  1ZQB A;  3V6J A;  4NKT A;  4R64 A;  4KN7 A;  2ISO A;  5DB6 A;  4KLG A;  9ICB A;  1TK0 A;  5KFS A;  3RB4 A;  3OVB A;  2AJQ A;  4LT6 A;  3PR4 A;  2ZTD A;  4JUZ A;  5EWG A;  1NOM A;  5HRD A;  1ZJM A;  2FMP A;  3SZ2 A;  3PX6 A;  2ZHA A;  4RQ1 A;  2KFN A;  7ICO A;  4I27 A;  4DLE A;  5JUM A;  3AU2 A;  5KG5 A;  4IQV A;  5DQH A;  2ZUC A;  1Q79 A;  1L3U A;  3PV8 A;  1XWL A;  1ZQC A;  4RUC A;  4DS4 A;  4RT2 A;  3QEA Z;  1SKS A;  8ICO A;  4MFF A;  4F5R A;  2ZJA A;  4K4I A;  4KLH A;  4RWQ A;  4FS2 A;  5DBC A;  2MAX A;  4F4K A;  4YR0 A;  4WCW A;  4TUS A;  1LV5 A;  1NZP A;  1ZQS A;  4YR2 A;  4Q45 A;  3GII A;  2W8L A;  4F4Y A;  1LB2 B;  1XU4 A;  4NXZ A;  2VAN A;  3B0Y A;  4M6W A;  3H37 A;  5KFW A;  1DOQ A;  1CEZ A;  3MBY A;  7ICI A;  2PBE A;  2M9N A;  3OVS A;  5KFV A;  3MGH A;  1ZQQ A;  4DL2 A;  4UB3 A;  3PX4 A;  4F4Z A;  3NYB A;  2ZUD A;  2FPL A;  4DWI A;  4X4N A;  3EPG A;  3Q8M A;  5CB1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...