4UB1A

Dna polymerase beta product complex with a templating adenine and 8-oxodgmp, 90 s
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
317
Chain Sequence
b'NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 99
structure length 317
sequence length 321
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub1A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub1A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub1A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub1A03
5KFDA 4K4HA 1T4GA 4I28A 2HVHA 5DB6A 3TAPA 4KN4A 3B0YA 2PI4A 5EOZA 4O5EA 3AQLA 1S97A 8ICUA 1NK8A 4FS2A 1S0OA 2VA8A 2BPFA 3OHAA 1D8YA 2J6SA 4NKUA 1U45A 4X4SA 2ZH1A 3IHQB 4DQPA 4ECXA 7ICUA 4LT6A 5BPCA 2BCVA 2ZJAA 4F93B 5KFKA 2FLLA 2W9BA 2DR7A 3QEBZ 2J6UA 4X4TA 4I2CA 4YN4A 4YMOA 2DVIA 2IHMA 5J0OA 4ED8A 4DQSA 2PFQA 3T5LA 4IRCA 2ZH6A 2DPIA 1TK5A 4B9MA 4M9GA 3RB4A 4IRDA 1WOTA 3L9DA 3PW0A 1JMSA 4X4UA 1TFWA 1KTQA 4EEYA 4C8NA 1RXWA 2PFNA 3OVSA 3RAQA 3QZ8A 3AQMA 1KRPA 4KLEA 3PY8A 3T5HA 4DL6A 3Q8KA 2BDPA 5L1JA 4LVSA 7ICNA 9ICJA 8ICFA 2BCRA 4QZGA 2PBEA 4JV1A 3C1ZA 2MUTB 4RQ8A 4DSEA 8ICYA 5DDYA 1NK9A 5DQIA 2VANA 2NRXA 5J29A 1CUKA 3JPSA 2W8LA 1S0MA 4K4IA 4QWAA 7ICOA 3FYHA 1XC9A 4M5DA 1ZQWA 2ZUBA 2W9AA 4EBDA 4UB4A 1XSNA 2IHNA 2R8KA 4FBUA 2M9NA 4QZCA 4ECYA 1DGSA 3JPRA 3ZDCA 4F5NA 5HRBA 3K4GA 4GLXA 2P6UA 1BPEA 4IQUA 3Q8RB 3M9OB 4I2DA 4MFAA 1JX4A 4DL2A 4O5CA 2JEGA 3RBDA 1ZQPA 1S0VA 2KZZA 4RWPA 4JK1A 4O0IA 1L3UA 1BPYA 1UETA 5KG7A 5L1IA 1XSPA 4KLSA 3MDCA 1RPLA 3SV3A 3AU6A 4G3IA 1NK6A 2VA2A 4B9LA 9ICGA 2M2UA 4E7XA 3ISDA 4F8RA 5KFCA 1MIVA 1ZQXA 4J9QA 5L1KA 4AT8B 3PMNA 4X5VA 5CHGA 8ICRA 5KTQA 1Z00A 1X2IA 4FHWA 8ICVA 1H38A 5KFSA 4ATBA 5KFLA 3Q8MA 2ISOA 8ICGA 4YFKA 2Q0ZX 3M9MB 1ZQSA 2UVVA 4DF4A 4F4KA 3RJKA 1XWLA 8ICEA 2AJQA 3PW5A 5J0TA 4UBCA 3MR6A 9ICXA 4EBKA 4DL7A 4I2FA 4J9OA 4GXKA 2Q66A 3HT3A 3H4DA 1BPZA 4YQWA 5DLGA 5KFHA 4RPZA 4PGXA 2MAXA 2W8KA 1TK0A 3GIIA 9ICHA 9ICRA 4ZH4A 3HJ4A 3TFSA 5IILA 1SKRA 5KT4A 1R8BA 3OUYA 4M9JA 3ETLA 4DLEA 1NK0A 9ICCA 2ZHBA 4IRKA 9ICEA 4R64A 3QEAZ 4Z6FA 1L3TA 4KTQA 4DL3A 2DR5A 3G6XA 3ZDEA 4NLZA 1SZPA 3SV4A 3C23A 5KFAA 4YR0A 4TURA 5IIIA 4O3RA 7ICIA 4RQ5A 4KLFA 2P66A 1Y88A 4WC7A 3OSNA 5HMLA 4ECUA 2Y1JA 4UAWA 4F4YA 1XSLA 5HRHA 4NM2A 2HHTA 4JWNA 2C2DA 2VA3A 4P4OA 3OSPA 3C66A 4BWJA 9ICVA 4NLKA 5KG6A 2C28A 1BGXT 5KFMA 4RUCA 1D9DA 3AQNA 2XO7A 1ZQLA 4B9VA 3NYBA 4RWQA 5J2DA 1D8LA 1U47A 2NRVA 4DFMA 1ZETA 1X9WA 4B9TA 3JZ0A 4O3QA 4ECSA 4ECWA 1ZQZA 1ZQMA 1Q78A 2BPGA 4X4VA 1NKCA 4X4PA 4KLTA 5KFTA 5KG1A 1ZQGA 5KFVA 3GIJA 4EZ6A 5EWEA 4ECTA 2BCQA 4F5OA 2DRAA 5DG8A 3EWAA 5J2GA 1L3SA 5D46A 4XRHA 2HVIA 2KFNA 4E80A 5KFXA 5J0YA 4YCXA 4FS1A 3PX6A 4I2BA 5KT3A 4JV2A 2LYHA 3UXNA 9ICTA 5DEDA 4DFJA 4RQ3A 5IINA 2W9MA 5J0SA 4MFFA 2ZH2A 2BKEA 4RQ4A 4RWOA 8ICQA 1EXNA 3UXPA 5DGBA 1NK4A 3RR7A 2M2VA 4O9MA 4AT7B 4UQGA 1TFYA 2XGPA 2HW3A 5TZVA 2C2RA 9ICFA 5CJ7A 5HRLA 4EBJA 1JIHA 1SKSA 4F5QA 3G6YA 1NO5A 4RT3A 4GXIA 1DK2A 3HJ1A 2ZTCA 4RWNA 3BQ0A 1K1QA 4F50A 2C2EA 2I1QA 2DRBA 2NRWA 5KFWA 4F5RA 2AGOA 2BQUA 1NKBA 4FHPA 3LWLA 5KFEA 4AT9A 5DQGA 4EYIB 5KT6A 7ICKA 4QWBA 3V6HA 3FDSA 2ASLA 2M2TA 4FH5A 1RYRA 5KFJA 5KFIA 3JPPA 5HRIA 4QZFA 5HRFA 1V4AA 2ZH7A 3MDAA 3UQ0A 3KHGA 4NY8A 1DK3A 4QWEA 2W9CB 3TI0A 3V72A 2V4QA 3GQCA 9ICOA 1X9SA 2ATLA 7ICHA 2M2WA 3LDAA 1BPXA 4TUSA 3MFHA 2UVUA 1COOA 1ZQQA 2KP7A 1WCLA 2JZBA 4PHDA 4FH3A 2BE3A 2ZUDA 9ICAA 2ZJ5A 3KHLA 1MIWA 4Q45A 5D49A 1ZQIA 4J9RA 3HWTA 8ICXA 3PX0A 1UEUA 3H3AA 7ICGA 9ICQA 4QW9A 3B0XA 1NKEA 4RNMA 3PX4A 1ZQBA 5DB8A 3UPQA 1MC8A 3GIMA 2JEIA 4I2IA 1NK7A 2GWSA 4CCHA 4WC0A 5KFBA 2OWOA 2BPCA 5DBAA 3HW8A 2AGPA 2HHVA 3H8JA 5DG7A 1JN3A 3PV8A 1WCNA 5IIJA 2DR8A 4PHPA 4DOBA 1BNPA 1MIYA 2JEFA 1UEVA 4J9MA 5J0QA 1TK8A 5KT7A 3HIYA 4EBCA 5KFQA 4M47A 4DF8A 3Q8LA 4C8LA 3RTVA 1QSLA 1ZQJA 2V4RA 2XY7A 5D4BA 5KG3A 4QZ8A 4PHAA 4QWCA 4EBEA 8ICNA 4NKTA 1ZJNA 1SL1A 2UVWA 4RQ2A 2ZH3A 1A77A 9ICMA 3EYZA 4DS4A 1ZJMA 1ZQUA 4PGYA 5F9NA 4XA5A 5IIKA 5CA7A 2PFPA 1S9FA 4TUPA 4DFKA 4FHYA 1KFDA 3C1YA 3HX0A 1NOMA 2B21A 1RZTA 4F3OA 2HHPA 3M8SA 1SL2A 5KFRA 4KITB 3T5KA 3QE9Y 5BOMA 1UA1A 4UB3A 7ICSA 1B43A 4Z6CA 3PMLA 4J9PA 4RU9A 4X0BA 2XCAA 4KLLA 5DB9A 5J2HA 5J0XA 1XS9D 3NGDA 1IM4A 1S76D 4UD4A 2JEJA 1NK5A 2ZTDA 2ZJ8A 5J2KA 4WCWA 4YXJA 1ZQFA 5HHHA 5KFUA 4ELTA 3MABA 9ICLA 5HR9A 3SI8A 3RJGA 2XCPA 4C8KA 4ECZA 2BCUA 2HHQA 5DKWA 4UAYA 5HNKA 3PVXA 2ZH4A 4R66A 4GXJA 2BQRA 1ZQHA 2P6RA 3ORYA 3WFPA 2XC9A 2Y1IA 1TVAA 4DFPA 1XO1A 3UXOA 4DS5A 2NRTA 5IIMA 4RNOA 3OVBA 1HUZA 3V7KA 4DSFA 1YLQA 4ATBB 4DWIA 4P2HA 3UPSA 2A1JA 5HREA 4S3NA 3KHRA 4QZAA 2FLPA 2IA6A 5JUMA 3Q8QB 1ZQAA 4F4XA 2PFOA 3GFKB 4YMMA 1DOQA 3RR8A 4M9HA 4X4RA 2AQ4A 1JQRA 3MR2A 4ED3A 3MBYA 5DBBA 3ISBA 3OJUA 3V6KA 2RDIA 3OVAA 2KZ3A 2KZMA 4TQSA 8ICCA 4E8FA 3OUYB 3GDXA 1TV9A 1U9LA 1C7YA 2HHSA 1QLNA 1IXRA 8ICHA 2ID1A 1TKDA 1L3VA 2BR0A 1RYSA 1ZQCA 3GV5B 3WFOA 1ZQKA 5CB1A 4O5KA 1S0NA 5EWFA 4M2YA 4IR9A 2H5XA 5J2EA 5DLFA 2PI5A 4ED0A 4YR3A 1Z3EB 4JV0A 4I2HA 4EZ9A 4DQRA 3RAXA 4KLDA 3H38A 2ZH8A 4F5PA 5KG0A 4ED6A 1ZQYA 1NJYA 4R8UA 4WC1A 5HC9A 4MF8A 2DR9A 4BWMA 3ZDBA 4B9NA 8ICSA 2ASJA 4DL4A 2ZH5A 1U4BA 3H4BA 3ZDAA 4KN7A 2ZUCA 5HHIA 4KMUA 4UAZA 5DGAA 1PX5A 4YD1A 4ED2A 8ICOA 2AGQA 3RB3A 8ICJA 3JPQA 1XU4A 2F1JA 5KG2A 3T5JA 2R8JA 3GILA 4KLGA 5HRGA 2IBKA 1VJ7A 1Q79A 3ZD9A 1VFGA 3MR5A 2XY6A 1LB2B 9ICUA 4YXMA 3RJJA 4BDPA 2O5AA 2F1IA 4F91B 1HUOA 2ZTEA 4RPYA 3MFIA 1T3NA 3LK9A 4RQ7A 1LV5A 1QTMA 4BXOB 4M0AA 2KN7A 2C22A 3JPTA 4KLMA 1V9PA 2XY5A 4ELUA 4I27A 1B22A 3TFRA 3C18A 4X4OA 2O1PA 4X4QA 4J9NA 4I2JA 9ICPA 4HYKA 4RUAA 3HP6A 1AROP 4DLGA 3RBEA 4DQIA 3NTUA 4RT2A 2WTFA 4BGDA 4RQ6A 3K75D 2FMPA 4MF2A 7ICLA 4C8MA 1U49A 3WFRE 4FHXA 4X4NA 4M6WB 1NJWA 1L5UA 3T3FA 1D9FA 5DDMA 1HJPA 4XQ8A 4DOCA 9ICWA 8ICWA 7ICVA 2BCSA 4WC3A 3AU2A 4MEXA 3RH4A 3PW7A 4NM1A 4KLHA 3EPGA 3ISCA 4AT9B 3RJHA 4DOAA 4Q8FA 5KT2A 2HHWA 4PGQA 3RB0A 3M8RA 4M9NA 2DFLA 3H37A 4R65A 3TAQA 5DBCA 5J2AA 3PO5A 4DEZA 4M04A 4NLNA 7ICRA 4PPXA 5KFFA 5DG9A 4IG8A 4O3PA 2W9BB 3BJYA 4EYHB 2PXIA 2ZH9A 4DO9A 1ZQNA 2RFFA 3RB6A 2MUTA 7ICEA 5L1LA 3TARA 2NRKA 2AQ0A 5DECA 1NJZA 4PH5A 1R8AA 4JUZA 2JZBB 2FPKA 4Q44A 3EW9A 3H8SA 1NJXA 4WBYA 5EWGA 1R8CA 1UA0A 2UVRA 8ICMA 9ICIA 3RH6A 5IIOA 3BDPA 9ICSA 3PR5B 7ICTA 1R89A 3UQ2A 2HHXA 2XGQA 4C8OA 1TFRA 3H8WA 1TAQA 3MR3A 3G6VA 3SYZA 4ED1A 5F2VO 5BOLA 2FPMA 4J9LA 5KT5A 4B9UA 9ICKA 4TUQA 4B9SA 4YVZA 4E0DA 4RQ0A 4WC6A 2IMWP 4KLIA 1FA0A 3GV7B 4LZGA 8ICTA 5J2BA 4DSKA 4UB5A 7ICFA 3MGHA 3C2LA 3GV8B 5KG5A 4YD2A 5CP2A 3PO4A 4I2EA 1QSSA 8ICZA 3THVA 2J6TA 4FHVA 4AT8A 3OJSA 4UB2A 4WC2A 1KDHA 1JAJA 3H39A 4O3NA 1SL0A 2R8IA 5HRKA 1OU5A 3M9NB 4FBTA 4KLQA 4IQVA 5KFPA 4DSIA 3RRHA 8ICPA 2AU0A 4I2GA 4QZHA 3H40A 2R8GA 4F2RA 1S77D 4UD5A 4RPXA 3C5FA 5DB7A 1MQ3A 8ICKA 1UT8A 3GIKA 4PHEA 9ICNA 3RJFA 1PZNA 1KEJA 1N48A 1N56A 5J2JA 3BQ2A 3AUOA 1ZQTA 7ICMA 4YG2A 3HPOA 1QSYA 3EPIA 4NXZA 1BPBA 7ICJA 3C2KA 1Z00B 3Q8SB 8ICLA 1NZPA 3Q8PB 5CR0A 4ELVA 4YMNA 4I2AA 3BQ1A 4GC6A 1BVSA 4DSLA 4LZDA 1KNYA 3AQKA 5DQHA 1BPDA 5KFYA 3JPOA 4XUSA 3ZDDA 4DL5A 3JPNA 1JXLA 4YP3A 7ICPA 1ZQEA 4J9KA 5HP4A 4MEYA 4NLGA 4UBBA 4F92B 8ICIA 2NRZA 3BQTA 4QW8A 4QZBA 4I29A 4KLJA 1KSPA 1KLNA 3QZ7A 4XQ7A 4WC4A 2F1HA 2RDJA 2KFZA 1TAUA 1A76A 4F2SA 3KTQA 3H7IA 3PNCA 4R63A 4MFCA 4QWDA 1U48A 5L9XA 3OGUA 1F5AA 2A1JB 4IR1A 4UB1A 2ASDA 3E2EA 4FO6A 5J0RA 4O3SA 2FPLA 3MGIA 2BHNA 1CEZA 2ALZA 3RRGA 1K1SA 3EZ5A 3SZ2A 3RJIA 4WC5A 3RH5A 4IQWA 4P4MA 2R8HA 5J0UA 4O3OA 4J9SA 5CWRA 1T7PA 3OHBA 5C5JA 5J0PA 3V6JA 1UT5A 5HMMA 4M9LA 4Q8EA 1ZQOA 1X9MA 4QZ9A 4DQQA 2I9GA 4YR2A 1MQ2A 3IM1A 4KLUA 5J2IA 3V7LA 4IQTA 1MSWD 3N4MB 2FMQA 3PR4A 1KFSA 2HHUA 5KFOA 4Q43A 2BQ3A 7ICQA 1BNOA 1T8EA 5KFGA 2DPJA 3KHHA 4AT7A 3LQCB 4RZRA 3RJEA 3WFSC 3LWMA 5J0WA 4ED7A 1ZQRA 8ICBA 5HRDA 4ECRA 4R8UB 4ECVA 3C5GA 2BGWA 9ICBA 2ZHAA 4Z6EA 5KFZA 2FMSA 2FLNA 1ZQVA 4BXOA 3N97B 4K4GA 1ZQDA 1S10A 3TQ1A 1KFTA 4TQRA 3OV7A 8ICAA 3TANA 5KG4A 2V9WA 5F9LA 4KLOA 4QZEA 4EP7A 3V7JA 4P4PA 4GC7A 3C2MA 2ISPA 3ZD8A 1SKWA 4WBZA 3PW4A 4ECQA 5J2CA 1RXVA 1JXEA 4DSJA 4JWMA 5KFNA 4QZIA 3PW2A 5J2FA 3JYYA 4QZDA 2KTQA 1ZYQA 4RNNA 4Z6DA 2W9CA 4M6WA 4X0AA 3C21A 3WFQE 4F4WA 4RQ1A 4F4ZA
chains in the Genus database with same CATH superfamily
5AICA 1S97A 8ICUA 1NK8A 1S0OA 2BPFA 3OHAA 2J6SA 1U45A 4FZNA 3IHQB 2BCVA 4F93B 5KFKA 2FLLA 4K97A 2OCEA 2J6UA 4EELA 3MGVA 5JU5A 4YN4A 2IHMA 2PFQA 3T5LA 1Q8KA 4NXXA 4B9MA 4GFJA 4IRDA 3L9DA 1JMSA 2K4HA 1TFWA 1KTQA 3OVSA 3AQMA 3H0MB 4KLEA 2RQ5A 3PY8A 3T5HA 4DL6A 1B0XA 7ICNA 9ICJA 8ICFA 2PBEA 5DDYA 1NK9A 4K4IA 3ZDCA 3JPRA 4F5NA 3HRDD 2K8CB 2BBJA 1ZQPA 4NWIA 1S0VA 1L3UA 1LKYA 5L1IA 2JRZA 4KLSA 3MDCA 2HBMA 3SV3A 4G3IA 4C7ZA 4E7XA 1MIVA 3WKEA 4AT8B 2ESEA 4X5VA 1UPHA 2IOFK 4KB6A 5ALJA 4FHWA 1H38A 2ISOA 3Q8MA 4YFKA 3QYPA 2UVVA 4CNQA 3FM9A 4DF4A 3RJKA 5J0TA 4DL7A 4J9OA 2Q66A 4NXTA 1BPZA 3WK9A 2K8AA 4RPZA 2W8KA 1Q46A 2EDUA 3TFSA 5KT4A 1R8BA 4M9JA 4DLEA 9ICCA 3ER9B 9ICEA 2NO5A 2GO7A 3QEAZ 1SXDA 3SV4A 5KFAA 2M0NA 2QB0B 4KMOB 3OSNA 2CPRA 3ER8C 1XSLA 4NM2A 4JWNA 2C2DA 4BWJA 1UQVA 3ICXA 1D9DA 2Q4TA 2QARB 2XO7A 1ZQLA 4B9VA 4RWQA 5J2DA 1X9WA 2AH5A 5L1MA 1ZD4A 4O3QA 4ECSA 4ECWA 1ZQZA 1ZOLA 1NKCA 5CFSA 3GIJA 5EWEA 4F5OA 5ALUA 3EWAA 4E80A 2HVIA 5D46A 1QQ6A 2N1RA 1FFUA 3PX6A 4JV2A 4CDGA 5IINA 2W9MA 5J0SA 2ZH2A 4RQ4A 4RWOA 3D6JA 3CRXA 5ALEA 4AT7B 1GO3F 2HW3A 5TZVA 2CXYA 2KHVA 1SKSA 3G6YA 4RT3A 1DK2A 3SR6A 1SWVA 3IG8A 2ZIVB 1NKBA 1Q3VA 2KE7A 3I76A 5AIBA 5DQGA 2KD1A 3WK8A 2M2TA 5KFJA 5KFIA 2EAPA 4QZFA 3KHGA 1DK3A 3D2NA 2M2WA 7ICHA 3CW2C 2O6KA 1COOA 2A3VA 2ZUDA 9ICAA 2ZJ5A 8ICXA 1CRXA 4J9RA 2W3SA 4RNMA 3PX4A 1ZQBA 2JEIA 4I2IA 2LBOA 2OWOA 3CP8A 5AKKA 4J9MA 1UHUA 4EBCA 4M47A 4DF8A 1QSLA 1ZQJA 2XY7A 1KL9A 4QZ8A 4PHAA 4NKTA 1F5SA 2UVWA 2ZH3A 1ZJMA 2KVCA 2GLEA 1S9FA 3SMVA 3NVVA 4QIWF 3C1YA 3HX0A 1NOMA 3BQ7A 2IOHA 3TKAA 1RZTA 4F3OA 2NO4A 1UA1A 3T5KA 1B43A 3PMLA 3CK6A 4X0BA 4Y2UA 5J2HA 2DUYA 1XS9D 1IM4A 5CFTA 2Y9TA 3EUB2 2JEJA 1NK5A 3PSTA 1ZQ1C 3SI8A 2HN1A 4ECZA 1XO0A 3TADC 2QB1A 4K98A 3UXOA 4DS5A 2NRTA 2YB4A 4OJ6A 1YLQA 3UPSA 2E8MA 3NRZA 5HREA 4O69A 4S3NA 2FLPA 5ALVA 2PFOA 1DOQA 1JQRA 4JMUA 2HN2A 3KZIU 2RDIA 4BX9C 1KW4A 4EV6A 4TQSA 3OUYB 1U9LA 5AIAA 2HMXA 1C7YA 5D62A 2HHSA 1QLNA 5C0YA 3WFOA 5G5GA 2ZXHA 4M2YA 2H5XA 4FE3A 1Z3EB 4EZ9A 1NJYA 2DR9A 4OAGA 8ICSA 3WKDA 2W43A 3ZDAA 3N28A 4UAZA 1PX5A 3WK4A 1XU4A 2F1JA 3T5JA 4KLGA 5HRGA 2IBKA 1Q79A 5ALSA 1LB2B 5EE1A 3RJJA 5AI4A 2O5AA 1IIPA 3S6JA 1A6SA 3JCFA 2HOFA 4RQ7A 2KG5A 1L7MA 2XY5A 4ELUA 2YQEA 4X4QA 1OW5A 4HYKA 1AROP 3RBEA 2WTFA 4UB6U 2FMPA 7ICLA 4K8VA 4X4NA 1D9FA 9ICWA 4DOCA 5ALMA 1KN5A 3HKZF 2I5HA 4U6PA 4NM1A 2K89A 3ISCA 3RB0A 2KKVA 3PO5A 4NLNA 4PPXA 3NVZA 3ALRA 4EYHB 2ZG6A 3RB6A 3A0HU 5L1LA 2AQ0A 5DECA 4PH5A 3SENA 1SB3C 4JUZA 2JZBB 4WBYA 4Q44A 5EWGA 1R8CA 3BDPA 5IIOA 9ICSA 1S5LU 5ALHA 1TAQA 3H8WA 4FZLA 4ED1A 2W11A 5F2VO 5BOLA 5HR6A 4TUQA 4WC6A 4KLIA 1FA0A 4K99A 3GV7B 1SV0A 4K9AA 8ICTA 3QUTA 2JHDA 4UB5A 7ICFA 5AKLA 3GV8B 4WC2A 3ERCC 4AT8A 3QU2A 1QSSA 2J6TA 3RFAA 4O6AA 3H39A 1SL0A 2R8IA 5HRKA 3M9NB 4FO1A 1L7NA 1LKYB 2HOQA 1S77D 4QZHA 4F2RA 4UD5A 4HAIA 1MQ3A 2DWQA 5DB7A 1FIQA 8ICKA 3GIKA 4PHEA 3MCRA 1PZNA 1N56A 3AUOA 7ICMA 2DL0A 3C2KA 3MC1A 4C4SA 3Q8SB 4OAHA 1NZPA 4ELVA 3AQKA 4GC6A 3JPOA 3JPNA 4YP3A 7ICPA 2E1FA 2QB0A 3F5EA 4QW8A 1ECWA 1KSPA 3QZ7A 1TAUA 1A76A 2LYBA 2QARA 1U48A 3OGUA 1N5XA 1F5AA 2ASDA 2ALZA 3SZ2A 3RJIA 2WAQC 5FP0A 3VC8A 3OHBA 4Q8EA 3IM1A 5J2IA 3V7LA 4IQTA 2KSOB 2BBHA 5CEHA 5KFOA 2BQ3A 4OJOA 4AT7A 4RZRA 2HI0A 5J0WA 4AYBF 4R8UB 4ECVA 5GTIU 4U7CA 9ICBA 4Z6EA 1ZQVA 1WWVA 5ALRA 4I0UA 1KFTA 2V9WA 2CRXA 2ZIVA 1X42A 4EP7A 2ISPA 3ZD8A 3AN1A 4LEZA 4ECQA 3PW2A 2KTQA 1J97A 5AM4A 4Z6DA 4X0AA 4M6WA 3PSFA 5AM0A 3QX7A 4F4ZA 5KFDA 4K4HA 3AEVA 4I28A 2HVHA 3TAPA 5EOZA 2LM4A 4FS2A 4NKUA 3B9JA 4DQPA 5BPCA 2WF9A 2W9BA 5J8YA 2WB1C 5J0OA 4ED8A 2E8NA 4IRCA 3UM9A 4OCZA 2H3ZA 4C8NA 4EEYA 2PFNA 3QZ8A 2MUTB 4RQ8A 4DSEA 5DQIA 2ZUBA 2W9AA 4UB4A 2K4IA 3H3AA 4QZCA 4ECYA 2JR5A 1QQ5A 3N7PD 4IQUA 3QNMA 4DL2A 4O5CA 3RBDA 4O0IA 1BPYA 3QU9A 5KG7A 1XSPA 1RPLA 3AU6A 2M2UA 3ISDA 5K4LA 4J9QA 8ICRA 2YMLA 1X2IA 8ICVA 5KFSA 5KFLA 4UAUA 2QKQA 2K60A 8ICGA 3M9MB 2AJQA 1XWLA 9ICXA 4UBCA 3MR6A 1JALA 2ES6A 3HT3A 4EEDA 4YQWA 5DLGA 5AKYA 4PGXA 2BDUA 3HJ4A 9ICHA 3GIIA 9ICRA 2EZYA 5ALKA 1SKRA 3OUYA 2WF8A 3ETLA 1NK0A 3IV6A 4KTQA 4DL3A 3G6XA 4NLZA 1SZPA 7ICIA 4O3RA 2B0CA 5HMLA 2Y1JA 4F4YA 2NYVA 2VA3A 3C66A 4NLKA 5KG6A 4EX7A 4DCCA 2JMGA 1ZETA 4DFMA 3HILA 1Q78A 4KLTA 2EAMA 5KFTA 5KG1A 4Y2YA 4EZ6A 4UASA 2DRAA 5DG8A 4P0QB 1L3SA 4NL9C 2KFNA 5B66U 1PVPA 5KT3A 3UXNA 5DEDA 5KL8B 1RYUA 4N7RA 2BKEA 3IP4B 3UXPA 2DQNB 1Z19A 1NK4A 4O9MA 2XGPA 2F76X 5HRLA 3F2DA 2YX8A 1KKXA 3TADA 2YTUA 5GTHU 2XICA 3HJ1A 4RWNA 4F50A 2I1QA 5KFWA 3LWLA 5KFEA 5KT6A 4IL6U 3DEEA 4QWBA 2ASLA 4FH5A 4WQLA 2ZH7A 3MDAA 4NY8A 2W9CB 3V72A 5EE0A 3GQCA 3KZXA 5AK4A 3M7DA 3H0LB 4TUSA 4C4RA 3MFHA 3NRWA 4FH3A 4XJEA 2JZBA 4PHDA 3PHZA 5D49A 3HWTA 1UEUA 9ICQA 4QW9A 3B0XA 1NKEA 3UPQA 2F77X 4CCHA 2E3TA 1NK7A 2GWSA 4WC0A 2BPCA 5DBAA 1T94A 3PV8A 5DG7A 1JN3A 1WCNA 1MIYA 5KT7A 4ZOHC 5ALTA 5KG3A 8ICNA 1ZJNA 3EYZA 5F9NA 5IIKA 2FE9A 4TUPA 2EQYA 2KK0A 3H8MA 4DFKA 4FHYA 1PUZA 3M8SA 4KITB 4WOYA 4Z6CA 3DV9A 4NXWA 5DB9A 3AQFA 2D8CA 4WCWA 5HR9A 2W7PA 1Z1VA 5EE3A 1KQQA 2HHQA 5HNKA 2ZH4A 1X40A 3O0FA 4R66A 2BQRA 2H3FA 1FO4A 2XC9A 3NUQA 1TVAA 3OVBA 4RNOA 4DSFA 2A19A 4P2HA 3KHRA 2IA6A 3IRUA 5JUMA 1ZQAA 4YMMA 3RR8A 4X4RA 4K9BA 3MBYA 3LVWA 8ICCA 4E8FA 5AI6A 4UARA 8ICHA 3QU5A 1L3VA 2KSOA 1ZQCA 5ALPA 5J2EA 4ED0A 3C29A 4JV0A 4DQRA 3RAXA 4A8EA 3SD7A 1ZQYA 4ED6A 4R8UA 4MF8A 4BWMA 1OUQA 3ZDBA 1K5OA 4LJXA 1ZXIA 4EX6A 3NWIA 4KMUA 5DGAA 5CFUA 3JPQA 2E1EA 2ZXIA 4NJ8A 2G07A 1VFGA 2RHFA 4YXMA 1HUOA 4UAVA 3MFIA 3U26A 2C22A 3JPTA 4C7YA 1V9PA 2MU2A 4I27A 4KLMA 2HBKA 4OAIZ 4I2JA 3HP6A 3NTUA 5AK6A 1Q3UA 3ETRA 4BGDA 5AKZA 4MF2A 3WFRE 4M6WB 1L5UA 3KKAC 3T3FA 2YY6A 1HJPA 4XQ8A 2KMDA 2GOLA 4DOAA 5KT2A 3M8RA 4M9NA 2DFLA 3H37A 5DBCA 5J2AA 5KFFA 2W9BB 1OXJA 3BJYA 1ZQNA 2MUTA 1NJZA 4QJFB 1AQ6A 3D2SA 3EW9A 3H8SA 2MSNA 1F0MA 8ICMA 9ICIA 3RH6A 2XGQA 3G6VA 3SYZA 3MR3A 5EE9A 3OPXA 2W3RA 2FPMA 4B9SA 4RQ0A 1Z4OA 4Y2TA 4LZGA 5AM5A 3BS5A 3C2LA 4I2EA 3THVA 4FHVA 3OJSA 3E0FA 1JAJA 3OTQA 3AQEA 1OU5A 1PVRA 1QCKA 1L8OA 4PJ0U 2AU0A 4I2GA 4IG8A 2VIXA 5H2FU 3IDWA 1N48A 1ZQTA 3M6ZA 5AM2A 3HPOA 7ICJA 3QXGA 2WF5A 4YMNA 5ALXA 3BQ1A 1BVSA 1KNYA 5DQHA 2W55A 1NI3A 5KFYA 1XNSA 1WUDA 2I6XA 5ALWA 4C80A 1ZQEA 3SAGA 4O68A 5HP4A 3WKAA 4NLGA 8ICIA 2NRZA 3BQTA 4KLJA 5AKHA 4OJLA 4WC4A 2Y0SC 3KTQA 3PNCA 1TE2A 4EENA 3E2EA 5J0RA 2FPLA 2BHNA 4NV0A 3EZ5A 4P4MA 1ZD2P 4F71A 2OYYA 3V6JA 5J0PA 4P0QA 1ZQOA 5ALLA 1MQ2A 1PK1B 3N4MB 2FMQA 3PR4A 1KFSA 4Q43A 7ICQA 5KFGA 2VJ5A 3LQCB 3RJEA 4ED7A 5HRDA 3C5GA 5KFZA 2FLNA 3N97B 4K4GA 1JROA 5ALQA 3TQ1A 1ZQDA 5D61A 8ICAA 5KG4A 5F9LA 4GC7A 1MN8A 4US9A 2YN4A 4WBZA 1T3QA 4PZOA 5J2CA 1RXVA 2W9CA 3GZFA 3C21A 3WFQE 4F4WA 4RQ1A 1T4GA 3B0YA 2VA8A 1D8YA 1L7PA 3WKBA 4X4SA 2PKEA 1ZD3A 3QEBZ 2K8BB 4X4TA 4I2CA 2DVIA 2G5IB 5HR7A 1PVQA 2Y9UA 2ZH6A 4M9GA 1RG6A 1TK5A 3RB4A 1WOTA 4X4UA 1RXWA 3WU2U 4PL1A 3HJEA 3RAQA 1X6JA 2FJ6A 5L1JA 2BCRA 2RLTA 5HRHA 5J29A 2W8LA 3JPSA 3QU4A 4M5DA 1ZQWA 2R8KA 2KKPA 3R9KA 5AI8A 5HRBA 3K4GA 4GLXA 4JLZA 4UATA 1BPEA 4MFAA 2JEGA 3QU7A 2VJ4A 4F8RA 5KFCA 3PMNA 5CHGA 3KBBA 5KTQA 1Z00A 2MA1A 1ZRMA 1IV8A 1FEZA 3WK7A 4F4KA 1O03A 4EBKA 2KHQA 2IUBA 2ZH8A 5KFHA 1TK0A 5KAFU 2ZHBA 4R64A 4Z6FA 1L3TA 2KIVA 1VLBA 4KX3A 3KFUF 3ZDEA 4J03A 2ZIXB 3C23A 2KICA 4TURA 5IIIA 5JTIA 4YR0A 4RQ5A 3SAHA 1Y88A 2W54A 2WF6A 2E8OA 4Y2SA 1GPJA 1BGXT 4RUCA 3CYMA 1VDVA 3D2QA 4LEYA 5CRXA 2DGZA 2BPGA 2P35A 1QQ7A 4ECTA 4OAFA 1WG8A 5J2GA 5KFXA 5J0YA 4I2BA 9ICTA 3F2BA 1SWWA 4RQ3A 3RR7A 2M2VA 4UQGA 1TFYA 4EBJA 1D8BA 1JIHA 4F5QA 1NO5A 4GXIA 2OXOA 1K1QA 2AGOA 2BQUA 2PMZC 2WF7A 4EYIB 7ICKA 3V6HA 3FDSA 4CE6A 2W04A 3F5AA 5HRFA 2HDOA 2BZFA 1UCVA 3F2CA 2ZIUA 1X9SA 2G08A 2ATLA 9ICOA 3LDAA 1Z1BA 1A0PA 2UVUA 5ALZA 1ZQQA 2EZZA 1WCLA 2KP7A 2KV2A 1DXSA 1YT3A 3KHLA 4Q45A 4JB3A 1MC8A 3GIMA 4LEWA 5KFBA 3HW8A 2HHVA 3AMZA 3K1ZA 4PHPA 4DOBA 2JEFA 1BNPA 3NS1A 5AI0A 1S8OA 3HIYA 1SV4A 3VCBA 5KFQA 4C8LA 3RTVA 2G06A 5D4BA 2B4VA 4RQ2A 9ICMA 1ZQUA 2B51A 5AI5A 4XA5A 5CA7A 2PFPA 1KFDA 3BS5B 1SL2A 3I1YA 5KFRA 7ICSA 4J9PA 4RU9A 4KLLA 5J0XA 1J2NA 1S76D 4UD4A 1QH9A 2ZTDA 2ZJ8A 2R18A 1ZQFA 4WJ3B 5KFUA 4ELTA 9ICLA 3HKZC 3L5KA 3LYSA 4EEKA 1X6IA 4UAYA 2W03A 1J2MA 1DRGA 4GXJA 1ZQHA 4OJ5A 2P6RA 3ORYA 3WFPA 3PSIA 4DFPA 1XO1A 4PL2A 3WKCA 3V7KA 4ATBB 4QNLA 4QZAA 3Q8QB 2KIWA 4Y2PA 3KOOA 4M9HA 2AQ4A 3V6KA 3ISBA 2RRDA 4HX0A 2KOBA 2KZ3A 1PK1A 2ID1A 1TKDA 2BR0A 1RYSA 3GV5B 1ZQKA 4O5KA 1S0NA 4IR9A 2PI5A 5DLFA 2E5SA 4YR3A 4KM5A 3H38A 4KLDA 4WC1A 5AM3A 1V38A 2ZH5A 1U4BA 3H4BA 1JUDA 5ALYA 8ICJA 3PZPA 5KG2A 2DBYA 3GILA 2GA9D 2KJ9A 5AK5A 2XY6A 4BDPA 4OJPA 4RPYA 1SV0C 1T3NA 4M0AA 3PSPA 3C18A 3TFRA 2O1PA 4RUAA 3DDHA 4DLGA 4DQIA 2W7OA 1N61A 3K75D 1U49A 4FHXA 1NJWA 5DDMA 4WC3A 2IOFA 3RH4A 4KLHA 1B4FA 3EPGA 4OO1J 3RJHA 4AT9B 2HHWA 2AHOB 4R65A 3T79A 4M04A 3OWGA 4O3PA 5D63A 2PXIA 2ZH9A 4IS7A 2RFFA 2FDRA 4JLXA 5B3QA 1R8AA 4PZNA 2FPKA 1SXEA 1UA0A 2UVRA 4K96A 1R89A 4AYBC 2HHXA 4C8OA 1TFRA 2JV3A 2DKZA 1PK3A 2Y0SF 1Z4NA 4E0DA 4YVZA 4DSKA 3UMCA 1L8LA 3MGHA 5KG5A 3PO4A 8ICZA 5AKGA 2JGAA 1YZ6A 1L7OA 5KFPA 3GU3A 2D6FC 1RQNA 4RPXA 1HIWA 3NVYA 1RDFA 2YMMA 2HCFA 5J2JA 3BQ2A 2WHEA 1QSYA 5ALIA 1Z00B 4EGWA 1DGJA 5KNIA 4I2AA 4DSLA 4LZDA 3QUQA 2XVTA 2ZIXA 4MEYA 4NLCA 4UBBA 4QZBA 4I29A 4XQ7A 2F1HA 4F2SA 3H7IA 5CHEA 4QWDA 2NV3A 1M6YA 5L9XA 2A1JB 2MRLA 1P7DA 4RQMA 3EF2A 4O3SA 3MGIA 1CEZA 2GH1A 1K1SA 3RH5A 1X9XA 4IQWA 5J0UA 4O3OA 4J9SA 1T7PA 5C5JA 5J8YC 1UT5A 4M9LA 4QZ9A 4DQQA 1ED1A 4MHVA 4CF5A 1MSWD 4ACOA 2XI9A 1N63A 5E79U 5AKEA 1IG6A 1T8EA 4WQKA 3WFSC 3LWMA 1ZQRA 3SEIA 2KVSA 2ZHAA 2DF4B 4BXOA 3OV7A 4TQRA 3TANA 3M6KA 4QZEA 5AKXA 3RF9A 5ALFA 1X66A 3PW4A 5KFNA 4QZIA 2GAFD 1ZYQA 1YZ7A 2F8LA 1N60A 2LKYA 4Y2XA 1LVHA 1ZRNA 1N5WA 5DB6A 4KN4A 2PI4A 4O5EA 3AQLA 2F3NA 2FI1A 4DFDA 4O3MA 2XIDA 3F53A 2ZH1A 2G0AA 7ICUA 4ECXA 4LT6A 2ZJAA 3ONNA 2ZIUB 2DR7A 3IG5A 4YMOA 2ZIWB 4DQSA 5T14A 2DPIA 3ED5A 1SZHA 3PW0A 2YMQA 2LMRA 4B6JA 1KRPA 3Q8KA 2BDPA 4LVSA 2OM6A 5B3PA 2H3VA 4QZGA 5F3XB 2B6GA 4JV1A 3C1ZA 8ICYA 2VANA 2NRXA 1S0MA 1CUKA 4QWAA 7ICOA 3FYHA 1XC9A 4EBDA 1XSNA 2IHNA 2WAQF 4FBUA 5AKJA 2M9NA 1DGSA 5AHXA 5AKIA 2P6UA 3Q8RB 2L5YA 3M9OB 4I2DA 1JX4A 2H3IA 5AK3A 2KZZA 4RWPA 4JK1A 1UETA 1NNLA 4Y2VA 4Y2QA 3I28A 9ICGA 1NK6A 2VA2A 4B9LA 2G09A 1ZQXA 5L1KA 1C20A 4ATBA 1JI7A 4P0PB 2Q0ZX 1ZQSA 1HEKA 8ICEA 3PW5A 4I2FA 4GXKA 3H4DA 2MAXA 4ZH4A 5IILA 2LHTA 2OHFA 4NXVA 4US8A 4IRKA 5ALGA 4RQNA 2DR5A 3L4PA 4UW9A 2PMZF 1URJA 3A0BU 4KLFA 2P66A 4WC7A 4ECUA 4UAWA 3CNHA 3WK5A 3AM9A 2HHTA 4P4OA 3OSPA 9ICVA 1V85A 4FZMA 2C28A 5KFMA 3AQNA 4CGZA 2F2AB 2YMPA 3NYBA 2WB1F 1D8LA 1U47A 2NRVA 3JZ0A 4B9TA 1ZQMA 4X4VA 4X4PA 1ZQGA 5KFVA 2HBJA 2BCQA 4XRHA 4Y2JA 4YCXA 4FS1A 2LYHA 4DFJA 4MFFA 5JRTA 8ICQA 1EXNA 5DGBA 2KNJA 4USAA 4CF4A 3BZCA 2C2RA 9ICFA 5CJ7A 3K7DA 2CN1A 2ZTCA 5JTGA 3BQ0A 2C2EA 1WYGA 2DRBA 2NRWA 4AT9A 4F5RA 3LVVA 4FHPA 3WK6A 3N7RC 1ZD5A 1JRPA 4WH5A 4Y2RA 1RYRA 3JPPA 5HRIA 4GIBA 1V4AA 1SIJA 3UQ0A 4EEBA 4QWEA 3TI0A 2V4QA 1BPXA 2EANA 2VKQA 5KAIU 2BE3A 2HBLA 1NZBA 1N62A 1MIWA 1ZQIA 3PX0A 7ICGA 3TACB 5DB8A 1L6NA 2AGPA 4NL9A 3H8JA 2DR8A 5IIJA 1O08A 1UEVA 3SQIA 5J0QA 1TK8A 2OEHA 3NASA 3Q8LA 3UMGA 2V4RA 4EBEA 4QWCA 2LM1A 1VJ5A 1TAMA 1SL1A 1A77A 2LYAA 4DS4A 3E58A 4PGYA 2EZXA 2H3QA 2HHPA 2B21A 3QE9Y 5BOMA 4UB3A 2K4PA 4KX5A 2XCAA 3NVOA 1WWUA 3BS7A 3NGDA 2WFAA 3K1RB 5J2KA 5AM1A 4YXJA 4G9BA 5HHHA 3N7SC 3MABA 3RJGA 2XCPA 4C8KA 1N2XA 2BCUA 5DKWA 3PVXA 1MA7A 2JXJA 4CRXA 2Y1IA 5IIMA 1HUZA 4DWIA 2A1JA 4F4XA 3GFKB 4IC9A 3MR2A 2RP5A 5B5EU 4ED3A 5DBBA 2E8PA 3OJUA 3OVAA 2KZMA 4ICAA 3GDXA 1TV9A 3KD3A 1IXRA 4QIWC 5CB1A 3QUCA 5EWFA 4CF3A 4F72A 5ALNA 4I2HA 2ODGA 4F5PA 5KG0A 5HC9A 4LEVA 4B9NA 2ASJA 4DL4A 1FFVA 1CI4A 4KN7A 2ZUCA 5HHIA 1F44A 4YD1A 4ED2A 8ICOA 2AGQA 3RB3A 3AL0B 2R8JA 2D3DA 1VJ7A 3ZD9A 3MR5A 9ICUA 2F1IA 5ALOA 4F91B 2AXTU 4NXUA 2ZTEA 1QTMA 3LK9A 1LV5A 4BXOB 2JH7A 2KN7A 1B22A 4X4OA 3NVWA 2KEYA 4J9NA 9ICPA 4RT2A 4RQ6A 4C8MA 5KL1B 3L3FX 4FFDA 4AP9A 2LI6A 4BUGA 8ICWA 2BCSA 7ICVA 2DKXA 3AU2A 4MEXA 3J81j 2ZIWA 3PW7A 2K4EA 4Q8FA 4PGQA 4O67A 3TAQA 7ICRA 2F8KA 4DEZA 5DG9A 2Z7JA 5AI9A 4DO9A 7ICEA 2QLTA 3TARA 2NRKA 1NJXA 1COKA 5ALDA 5TISU 2G5HB 3FAHA 2HSZA 2EWRA 3PR5B 7ICTA 3UQ2A 4C4TA 3C28A 4J9LA 5KT5A 4B9UA 9ICKA 2IMWP 1V97A 5J2BA 3QUBA 2LPEA 4YD2A 5CP2A 5G5HA 4UB2A 2OH2A 1KDHA 4O3NA 4P0PA 4FBTA 4KLQA 4IQVA 4DSIA 3RRHA 8ICPA 3M1YA 3H40A 3KKAA 2R8GA 3C5FA 9ICNA 1UT8A 4MKPA 3RJFA 1KEJA 2B56A 3IN5A 3BZKA 1RQLA 4YG2A 3EPIA 4NXZA 1BPBA 8ICLA 3H0RB 5CR0A 3Q8PB 1BPDA 4XUSA 4BJQA 4DL5A 3ZDDA 1JXLA 4J9KA 2IHOA 4F92B 2KJ8A 5A0LA 1KLNA 2KFZA 2RDJA 4MFCA 4R63A 2YB1A 4IR1A 4UB1A 2KJ5A 4FO6A 3NKUA 3RRGA 2EAOA 4WC5A 3UMBA 2R8HA 3FC4A 5CWRA 5HMMA 1X9MA 2I9GA 2F44A 4YR2A 2HOIA 4KLUA 2HHUA 1BNOA 3SAFA 2DPJA 3KHHA 2EH9A 2A1AA 8ICBA 4ECRA 4C0ZA 2BGWA 2FCLA 1SGGA 2FMSA 2JH1A 1S10A 4KLOA 1RM6C 3V7JA 1KBUA 4P4PA 3C2MA 1SKWA 4DSJA 1JXEA 4JWMA 5J2FA 3JYYA 4QZDA 3ZI4A 4RNNA 4UB8U 4NLBA 4OD0A
chains in the Genus database with same CATH topology
5KFDA 4K4HA 1T4GA 4I28A 2HVHA 5DB6A 3TAPA 4KN4A 3B0YA 2PI4A 5EOZA 4O5EA 3AQLA 1S97A 8ICUA 1NK8A 4FS2A 1S0OA 2VA8A 2BPFA 3OHAA 1D8YA 2J6SA 4NKUA 1U45A 4X4SA 2ZH1A 3IHQB 4DQPA 4ECXA 7ICUA 4LT6A 5BPCA 2BCVA 2ZJAA 4F93B 5KFKA 2FLLA 2W9BA 2DR7A 3QEBZ 2J6UA 4X4TA 4I2CA 4YN4A 4YMOA 2DVIA 2IHMA 5J0OA 4ED8A 4DQSA 2PFQA 3T5LA 4IRCA 2ZH6A 2DPIA 1TK5A 4B9MA 4M9GA 3RB4A 4IRDA 1WOTA 3L9DA 3PW0A 1JMSA 4X4UA 1TFWA 1KTQA 4EEYA 4C8NA 1RXWA 2PFNA 3OVSA 3RAQA 3QZ8A 3AQMA 1KRPA 4KLEA 3PY8A 3T5HA 4DL6A 3Q8KA 2BDPA 5L1JA 4LVSA 7ICNA 9ICJA 8ICFA 2BCRA 4QZGA 2PBEA 4JV1A 3C1ZA 2MUTB 4RQ8A 4DSEA 8ICYA 5DDYA 1NK9A 5DQIA 2VANA 2NRXA 5J29A 1CUKA 3JPSA 2W8LA 1S0MA 4K4IA 4QWAA 7ICOA 3FYHA 1XC9A 4M5DA 1ZQWA 2ZUBA 2W9AA 4EBDA 4UB4A 1XSNA 2IHNA 2R8KA 4FBUA 2M9NA 4QZCA 4ECYA 1DGSA 3JPRA 3ZDCA 4F5NA 5HRBA 3K4GA 4GLXA 2P6UA 1BPEA 4IQUA 3Q8RB 3M9OB 4I2DA 4MFAA 1JX4A 4DL2A 4O5CA 2JEGA 3RBDA 1ZQPA 1S0VA 2KZZA 4RWPA 4JK1A 4O0IA 1L3UA 1BPYA 1UETA 5KG7A 5L1IA 1XSPA 4KLSA 3MDCA 1RPLA 3SV3A 3AU6A 4G3IA 1NK6A 2VA2A 4B9LA 9ICGA 2M2UA 4E7XA 3ISDA 4F8RA 5KFCA 1MIVA 1ZQXA 4J9QA 5L1KA 4AT8B 3PMNA 4X5VA 5CHGA 8ICRA 5KTQA 1Z00A 1X2IA 4FHWA 8ICVA 1H38A 5KFSA 4ATBA 5KFLA 3Q8MA 2ISOA 8ICGA 4YFKA 2Q0ZX 3M9MB 1ZQSA 2UVVA 4DF4A 4F4KA 3RJKA 1XWLA 8ICEA 2AJQA 3PW5A 5J0TA 4UBCA 3MR6A 9ICXA 4EBKA 4DL7A 4I2FA 4J9OA 4GXKA 2Q66A 3HT3A 3H4DA 1BPZA 4YQWA 5DLGA 5KFHA 4RPZA 4PGXA 2MAXA 2W8KA 1TK0A 3GIIA 9ICHA 9ICRA 4ZH4A 3HJ4A 3TFSA 5IILA 1SKRA 5KT4A 1R8BA 3OUYA 4M9JA 3ETLA 4DLEA 1NK0A 9ICCA 2ZHBA 4IRKA 9ICEA 4R64A 3QEAZ 4Z6FA 1L3TA 4KTQA 4DL3A 2DR5A 3G6XA 3ZDEA 4NLZA 1SZPA 3SV4A 3C23A 5KFAA 4YR0A 4TURA 5IIIA 4O3RA 7ICIA 4RQ5A 4KLFA 2P66A 1Y88A 4WC7A 3OSNA 5HMLA 4ECUA 2Y1JA 4UAWA 4F4YA 1XSLA 5HRHA 4NM2A 2HHTA 4JWNA 2C2DA 2VA3A 4P4OA 3OSPA 3C66A 4BWJA 9ICVA 4NLKA 5KG6A 2C28A 1BGXT 5KFMA 4RUCA 1D9DA 3AQNA 2XO7A 1ZQLA 4B9VA 3NYBA 4RWQA 5J2DA 1D8LA 1U47A 2NRVA 4DFMA 1ZETA 1X9WA 4B9TA 3JZ0A 4O3QA 4ECSA 4ECWA 1ZQZA 1ZQMA 1Q78A 2BPGA 4X4VA 1NKCA 4X4PA 4KLTA 5KFTA 5KG1A 1ZQGA 5KFVA 3GIJA 4EZ6A 5EWEA 4ECTA 2BCQA 4F5OA 2DRAA 5DG8A 3EWAA 5J2GA 1L3SA 5D46A 4XRHA 2HVIA 2KFNA 4E80A 5KFXA 5J0YA 4YCXA 4FS1A 3PX6A 4I2BA 5KT3A 4JV2A 2LYHA 3UXNA 9ICTA 5DEDA 4DFJA 4RQ3A 5IINA 2W9MA 5J0SA 4MFFA 2ZH2A 2BKEA 4RQ4A 4RWOA 8ICQA 1EXNA 3UXPA 5DGBA 1NK4A 3RR7A 2M2VA 4O9MA 4AT7B 4UQGA 1TFYA 2XGPA 2HW3A 5TZVA 2C2RA 9ICFA 5CJ7A 5HRLA 4EBJA 1JIHA 1SKSA 4F5QA 3G6YA 1NO5A 4RT3A 4GXIA 1DK2A 3HJ1A 2ZTCA 4RWNA 3BQ0A 1K1QA 4F50A 2C2EA 2I1QA 2DRBA 2NRWA 5KFWA 4F5RA 2AGOA 2BQUA 1NKBA 4FHPA 3LWLA 5KFEA 4AT9A 5DQGA 4EYIB 5KT6A 7ICKA 4QWBA 3V6HA 3FDSA 2ASLA 2M2TA 4FH5A 1RYRA 5KFJA 5KFIA 3JPPA 5HRIA 4QZFA 5HRFA 1V4AA 2ZH7A 3MDAA 3UQ0A 3KHGA 4NY8A 1DK3A 4QWEA 2W9CB 3TI0A 3V72A 2V4QA 3GQCA 9ICOA 1X9SA 2ATLA 7ICHA 2M2WA 3LDAA 1BPXA 4TUSA 3MFHA 2UVUA 1COOA 1ZQQA 2KP7A 1WCLA 2JZBA 4PHDA 4FH3A 2BE3A 2ZUDA 9ICAA 2ZJ5A 3KHLA 1MIWA 4Q45A 5D49A 1ZQIA 4J9RA 3HWTA 8ICXA 3PX0A 1UEUA 3H3AA 7ICGA 9ICQA 4QW9A 3B0XA 1NKEA 4RNMA 3PX4A 1ZQBA 5DB8A 3UPQA 1MC8A 3GIMA 2JEIA 4I2IA 1NK7A 2GWSA 4CCHA 4WC0A 5KFBA 2OWOA 2BPCA 5DBAA 3HW8A 2AGPA 2HHVA 3H8JA 5DG7A 1JN3A 3PV8A 1WCNA 5IIJA 2DR8A 4PHPA 4DOBA 1BNPA 1MIYA 2JEFA 1UEVA 4J9MA 5J0QA 1TK8A 5KT7A 3HIYA 4EBCA 5KFQA 4M47A 4DF8A 3Q8LA 4C8LA 3RTVA 1QSLA 1ZQJA 2V4RA 2XY7A 5D4BA 5KG3A 4QZ8A 4PHAA 4QWCA 4EBEA 8ICNA 4NKTA 1ZJNA 1SL1A 2UVWA 4RQ2A 2ZH3A 1A77A 9ICMA 3EYZA 4DS4A 1ZJMA 1ZQUA 4PGYA 5F9NA 4XA5A 5IIKA 5CA7A 2PFPA 1S9FA 4TUPA 4DFKA 4FHYA 1KFDA 3C1YA 3HX0A 1NOMA 2B21A 1RZTA 4F3OA 2HHPA 3M8SA 1SL2A 5KFRA 4KITB 3T5KA 3QE9Y 5BOMA 1UA1A 4UB3A 7ICSA 1B43A 4Z6CA 3PMLA 4J9PA 4RU9A 4X0BA 2XCAA 4KLLA 5DB9A 5J2HA 5J0XA 1XS9D 3NGDA 1IM4A 1S76D 4UD4A 2JEJA 1NK5A 2ZTDA 2ZJ8A 5J2KA 4WCWA 4YXJA 1ZQFA 5HHHA 5KFUA 4ELTA 3MABA 9ICLA 5HR9A 3SI8A 3RJGA 2XCPA 4C8KA 4ECZA 2BCUA 2HHQA 5DKWA 4UAYA 5HNKA 3PVXA 2ZH4A 4R66A 4GXJA 2BQRA 1ZQHA 2P6RA 3ORYA 3WFPA 2XC9A 2Y1IA 1TVAA 4DFPA 1XO1A 3UXOA 4DS5A 2NRTA 5IIMA 4RNOA 3OVBA 1HUZA 3V7KA 4DSFA 1YLQA 4ATBB 4DWIA 4P2HA 3UPSA 2A1JA 5HREA 4S3NA 3KHRA 4QZAA 2FLPA 2IA6A 5JUMA 3Q8QB 1ZQAA 4F4XA 2PFOA 3GFKB 4YMMA 1DOQA 3RR8A 4M9HA 4X4RA 2AQ4A 1JQRA 3MR2A 4ED3A 3MBYA 5DBBA 3ISBA 3OJUA 3V6KA 2RDIA 3OVAA 2KZ3A 2KZMA 4TQSA 8ICCA 4E8FA 3OUYB 3GDXA 1TV9A 1U9LA 1C7YA 2HHSA 1QLNA 1IXRA 8ICHA 2ID1A 1TKDA 1L3VA 2BR0A 1RYSA 1ZQCA 3GV5B 3WFOA 1ZQKA 5CB1A 4O5KA 1S0NA 5EWFA 4M2YA 4IR9A 2H5XA 5J2EA 5DLFA 2PI5A 4ED0A 4YR3A 1Z3EB 4JV0A 4I2HA 4EZ9A 4DQRA 3RAXA 4KLDA 3H38A 2ZH8A 4F5PA 5KG0A 4ED6A 1ZQYA 1NJYA 4R8UA 4WC1A 5HC9A 4MF8A 2DR9A 4BWMA 3ZDBA 4B9NA 8ICSA 2ASJA 4DL4A 2ZH5A 1U4BA 3H4BA 3ZDAA 4KN7A 2ZUCA 5HHIA 4KMUA 4UAZA 5DGAA 1PX5A 4YD1A 4ED2A 8ICOA 2AGQA 3RB3A 8ICJA 3JPQA 1XU4A 2F1JA 5KG2A 3T5JA 2R8JA 3GILA 4KLGA 5HRGA 2IBKA 1VJ7A 1Q79A 3ZD9A 1VFGA 3MR5A 2XY6A 1LB2B 9ICUA 4YXMA 3RJJA 4BDPA 2O5AA 2F1IA 4F91B 1HUOA 2ZTEA 4RPYA 3MFIA 1T3NA 3LK9A 4RQ7A 1LV5A 1QTMA 4BXOB 4M0AA 2KN7A 2C22A 3JPTA 4KLMA 1V9PA 2XY5A 4ELUA 4I27A 1B22A 3TFRA 3C18A 4X4OA 2O1PA 4X4QA 4J9NA 4I2JA 9ICPA 4HYKA 4RUAA 3HP6A 1AROP 4DLGA 3RBEA 4DQIA 3NTUA 4RT2A 2WTFA 4BGDA 4RQ6A 3K75D 2FMPA 4MF2A 7ICLA 4C8MA 1U49A 3WFRE 4FHXA 4X4NA 4M6WB 1NJWA 1L5UA 3T3FA 1D9FA 5DDMA 1HJPA 4XQ8A 4DOCA 9ICWA 8ICWA 7ICVA 2BCSA 4WC3A 3AU2A 4MEXA 3RH4A 3PW7A 4NM1A 4KLHA 3EPGA 3ISCA 4AT9B 3RJHA 4DOAA 4Q8FA 5KT2A 2HHWA 4PGQA 3RB0A 3M8RA 4M9NA 2DFLA 3H37A 4R65A 3TAQA 5DBCA 5J2AA 3PO5A 4DEZA 4M04A 4NLNA 7ICRA 4PPXA 5KFFA 5DG9A 4IG8A 4O3PA 2W9BB 3BJYA 4EYHB 2PXIA 2ZH9A 4DO9A 1ZQNA 2RFFA 3RB6A 2MUTA 7ICEA 5L1LA 3TARA 2NRKA 2AQ0A 5DECA 1NJZA 4PH5A 1R8AA 4JUZA 2JZBB 2FPKA 4Q44A 3EW9A 3H8SA 1NJXA 4WBYA 5EWGA 1R8CA 1UA0A 2UVRA 8ICMA 9ICIA 3RH6A 5IIOA 3BDPA 9ICSA 3PR5B 7ICTA 1R89A 3UQ2A 2HHXA 2XGQA 4C8OA 1TFRA 3H8WA 1TAQA 3MR3A 3G6VA 3SYZA 4ED1A 5F2VO 5BOLA 2FPMA 4J9LA 5KT5A 4B9UA 9ICKA 4TUQA 4B9SA 4YVZA 4E0DA 4RQ0A 4WC6A 2IMWP 4KLIA 1FA0A 3GV7B 4LZGA 8ICTA 5J2BA 4DSKA 4UB5A 7ICFA 3MGHA 3C2LA 3GV8B 5KG5A 4YD2A 5CP2A 3PO4A 4I2EA 1QSSA 8ICZA 3THVA 2J6TA 4FHVA 4AT8A 3OJSA 4UB2A 4WC2A 1KDHA 1JAJA 3H39A 4O3NA 1SL0A 2R8IA 5HRKA 1OU5A 3M9NB 4FBTA 4KLQA 4IQVA 5KFPA 4DSIA 3RRHA 8ICPA 2AU0A 4I2GA 4QZHA 3H40A 2R8GA 4F2RA 1S77D 4UD5A 4RPXA 3C5FA 5DB7A 1MQ3A 8ICKA 1UT8A 3GIKA 4PHEA 9ICNA 3RJFA 1PZNA 1KEJA 1N48A 1N56A 5J2JA 3BQ2A 3AUOA 1ZQTA 7ICMA 4YG2A 3HPOA 1QSYA 3EPIA 4NXZA 1BPBA 7ICJA 3C2KA 1Z00B 3Q8SB 8ICLA 1NZPA 3Q8PB 5CR0A 4ELVA 4YMNA 4I2AA 3BQ1A 4GC6A 1BVSA 4DSLA 4LZDA 1KNYA 3AQKA 5DQHA 1BPDA 5KFYA 3JPOA 4XUSA 3ZDDA 4DL5A 3JPNA 1JXLA 4YP3A 7ICPA 1ZQEA 4J9KA 5HP4A 4MEYA 4NLGA 4UBBA 4F92B 8ICIA 2NRZA 3BQTA 4QW8A 4QZBA 4I29A 4KLJA 1KSPA 1KLNA 3QZ7A 4XQ7A 4WC4A 2F1HA 2RDJA 2KFZA 1TAUA 1A76A 4F2SA 3KTQA 3H7IA 3PNCA 4R63A 4MFCA 4QWDA 1U48A 5L9XA 3OGUA 1F5AA 2A1JB 4IR1A 4UB1A 2ASDA 3E2EA 4FO6A 5J0RA 4O3SA 2FPLA 3MGIA 2BHNA 1CEZA 2ALZA 3RRGA 1K1SA 3EZ5A 3SZ2A 3RJIA 4WC5A 3RH5A 4IQWA 4P4MA 2R8HA 5J0UA 4O3OA 4J9SA 5CWRA 1T7PA 3OHBA 5C5JA 5J0PA 3V6JA 1UT5A 5HMMA 4M9LA 4Q8EA 1ZQOA 1X9MA 4QZ9A 4DQQA 2I9GA 4YR2A 1MQ2A 3IM1A 4KLUA 5J2IA 3V7LA 4IQTA 1MSWD 3N4MB 2FMQA 3PR4A 1KFSA 2HHUA 5KFOA 4Q43A 2BQ3A 7ICQA 1BNOA 1T8EA 5KFGA 2DPJA 3KHHA 4AT7A 3LQCB 4RZRA 3RJEA 3WFSC 3LWMA 5J0WA 4ED7A 1ZQRA 8ICBA 5HRDA 4ECRA 4R8UB 4ECVA 3C5GA 2BGWA 9ICBA 2ZHAA 4Z6EA 5KFZA 2FMSA 2FLNA 1ZQVA 4BXOA 3N97B 4K4GA 1ZQDA 1S10A 3TQ1A 1KFTA 4TQRA 3OV7A 8ICAA 3TANA 5KG4A 2V9WA 5F9LA 4KLOA 4QZEA 4EP7A 3V7JA 4P4PA 4GC7A 3C2MA 2ISPA 3ZD8A 1SKWA 4WBZA 3PW4A 4ECQA 5J2CA 1RXVA 1JXEA 4DSJA 4JWMA 5KFNA 4QZIA 3PW2A 5J2FA 3JYYA 4QZDA 2KTQA 1ZYQA 4RNNA 4Z6DA 2W9CA 4M6WA 4X0AA 3C21A 3WFQE 4F4WA 4RQ1A 4F4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KFD A;  4K4H A;  1T4G A;  4I28 A;  2HVH A;  5DB6 A;  3TAP A;  4KN4 A;  3B0Y A;  2PI4 A;  5EOZ A;  4O5E A;  3AQL A;  1S97 A;  8ICU A;  1NK8 A;  4FS2 A;  1S0O A;  2VA8 A;  2BPF A;  3OHA A;  1D8Y A;  2J6S A;  4NKU A;  1U45 A;  4X4S A;  2ZH1 A;  3IHQ B;  4DQP A;  4ECX A;  7ICU A;  4LT6 A;  5BPC A;  2BCV A;  2ZJA A;  4F93 B;  5KFK A;  2FLL A;  2W9B A;  2DR7 A;  3QEB Z;  2J6U A;  4X4T A;  4I2C A;  4YN4 A;  4YMO A;  2DVI A;  2IHM A;  5J0O A;  4ED8 A;  4DQS A;  2PFQ A;  3T5L A;  4IRC A;  2ZH6 A;  2DPI A;  1TK5 A;  4B9M A;  4M9G A;  3RB4 A;  4IRD A;  1WOT A;  3L9D A;  3PW0 A;  1JMS A;  4X4U A;  1TFW A;  1KTQ A;  4EEY A;  4C8N A;  1RXW A;  2PFN A;  3OVS A;  3RAQ A;  3QZ8 A;  3AQM A;  1KRP A;  4KLE A;  3PY8 A;  3T5H A;  4DL6 A;  3Q8K A;  2BDP A;  5L1J A;  4LVS A;  7ICN A;  9ICJ A;  8ICF A;  2BCR A;  4QZG A;  2PBE A;  4JV1 A;  3C1Z A;  2MUT B;  4RQ8 A;  4DSE A;  8ICY A;  5DDY A;  1NK9 A;  5DQI A;  2VAN A;  2NRX A;  5J29 A;  1CUK A;  3JPS A;  2W8L A;  1S0M A;  4K4I A;  4QWA A;  7ICO A;  3FYH A;  1XC9 A;  4M5D A;  1ZQW A;  2ZUB A;  2W9A A;  4EBD A;  4UB4 A;  1XSN A;  2IHN A;  2R8K A;  4FBU A;  2M9N A;  4QZC A;  4ECY A;  1DGS A;  3JPR A;  3ZDC A;  4F5N A;  5HRB A;  3K4G A;  4GLX A;  2P6U A;  1BPE A;  4IQU A;  3Q8R B;  3M9O B;  4I2D A;  4MFA A;  1JX4 A;  4DL2 A;  4O5C A;  2JEG A;  3RBD A;  1ZQP A;  1S0V A;  2KZZ A;  4RWP A;  4JK1 A;  4O0I A;  1L3U A;  1BPY A;  1UET A;  5KG7 A;  5L1I A;  1XSP A;  4KLS A;  3MDC A;  1RPL A;  3SV3 A;  3AU6 A;  4G3I A;  1NK6 A;  2VA2 A;  4B9L A;  9ICG A;  2M2U A;  4E7X A;  3ISD A;  4F8R A;  5KFC A;  1MIV A;  1ZQX A;  4J9Q A;  5L1K A;  4AT8 B;  3PMN A;  4X5V A;  5CHG A;  8ICR A;  5KTQ A;  1Z00 A;  1X2I A;  4FHW A;  8ICV A;  1H38 A;  5KFS A;  4ATB A;  5KFL A;  3Q8M A;  2ISO A;  8ICG A;  4YFK A;  2Q0Z X;  3M9M B;  1ZQS A;  2UVV A;  4DF4 A;  4F4K A;  3RJK A;  1XWL A;  8ICE A;  2AJQ A;  3PW5 A;  5J0T A;  4UBC A;  3MR6 A;  9ICX A;  4EBK A;  4DL7 A;  4I2F A;  4J9O A;  4GXK A;  2Q66 A;  3HT3 A;  3H4D A;  1BPZ A;  4YQW A;  5DLG A;  5KFH A;  4RPZ A;  4PGX A;  2MAX A;  2W8K A;  1TK0 A;  3GII A;  9ICH A;  9ICR A;  4ZH4 A;  3HJ4 A;  3TFS A;  5IIL A;  1SKR A;  5KT4 A;  1R8B A;  3OUY A;  4M9J A;  3ETL A;  4DLE A;  1NK0 A;  9ICC A;  2ZHB A;  4IRK A;  9ICE A;  4R64 A;  3QEA Z;  4Z6F A;  1L3T A;  4KTQ A;  4DL3 A;  2DR5 A;  3G6X A;  3ZDE A;  4NLZ A;  1SZP A;  3SV4 A;  3C23 A;  5KFA A;  4YR0 A;  4TUR A;  5III A;  4O3R A;  7ICI A;  4RQ5 A;  4KLF A;  2P66 A;  1Y88 A;  4WC7 A;  3OSN A;  5HML A;  4ECU A;  2Y1J A;  4UAW A;  4F4Y A;  1XSL A;  5HRH A;  4NM2 A;  2HHT A;  4JWN A;  2C2D A;  2VA3 A;  4P4O A;  3OSP A;  3C66 A;  4BWJ A;  9ICV A;  4NLK A;  5KG6 A;  2C28 A;  1BGX T;  5KFM A;  4RUC A;  1D9D A;  3AQN A;  2XO7 A;  1ZQL A;  4B9V A;  3NYB A;  4RWQ A;  5J2D A;  1D8L A;  1U47 A;  2NRV A;  4DFM A;  1ZET A;  1X9W A;  4B9T A;  3JZ0 A;  4O3Q A;  4ECS A;  4ECW A;  1ZQZ A;  1ZQM A;  1Q78 A;  2BPG A;  4X4V A;  1NKC A;  4X4P A;  4KLT A;  5KFT A;  5KG1 A;  1ZQG A;  5KFV A;  3GIJ A;  4EZ6 A;  5EWE A;  4ECT A;  2BCQ A;  4F5O A;  2DRA A;  5DG8 A;  3EWA A;  5J2G A;  1L3S A;  5D46 A;  4XRH A;  2HVI A;  2KFN A;  4E80 A;  5KFX A;  5J0Y A;  4YCX A;  4FS1 A;  3PX6 A;  4I2B A;  5KT3 A;  4JV2 A;  2LYH A;  3UXN A;  9ICT A;  5DED A;  4DFJ A;  4RQ3 A;  5IIN A;  2W9M A;  5J0S A;  4MFF A;  2ZH2 A;  2BKE A;  4RQ4 A;  4RWO A;  8ICQ A;  1EXN A;  3UXP A;  5DGB A;  1NK4 A;  3RR7 A;  2M2V A;  4O9M A;  4AT7 B;  4UQG A;  1TFY A;  2XGP A;  2HW3 A;  5TZV A;  2C2R A;  9ICF A;  5CJ7 A;  5HRL A;  4EBJ A;  1JIH A;  1SKS A;  4F5Q A;  3G6Y A;  1NO5 A;  4RT3 A;  4GXI A;  1DK2 A;  3HJ1 A;  2ZTC A;  4RWN A;  3BQ0 A;  1K1Q A;  4F50 A;  2C2E A;  2I1Q A;  2DRB A;  2NRW A;  5KFW A;  4F5R A;  2AGO A;  2BQU A;  1NKB A;  4FHP A;  3LWL A;  5KFE A;  4AT9 A;  5DQG A;  4EYI B;  5KT6 A;  7ICK A;  4QWB A;  3V6H A;  3FDS A;  2ASL A;  2M2T A;  4FH5 A;  1RYR A;  5KFJ A;  5KFI A;  3JPP A;  5HRI A;  4QZF A;  5HRF A;  1V4A A;  2ZH7 A;  3MDA A;  3UQ0 A;  3KHG A;  4NY8 A;  1DK3 A;  4QWE A;  2W9C B;  3TI0 A;  3V72 A;  2V4Q A;  3GQC A;  9ICO A;  1X9S A;  2ATL A;  7ICH A;  2M2W A;  3LDA A;  1BPX A;  4TUS A;  3MFH A;  2UVU A;  1COO A;  1ZQQ A;  2KP7 A;  1WCL A;  2JZB A;  4PHD A;  4FH3 A;  2BE3 A;  2ZUD A;  9ICA A;  2ZJ5 A;  3KHL A;  1MIW A;  4Q45 A;  5D49 A;  1ZQI A;  4J9R A;  3HWT A;  8ICX A;  3PX0 A;  1UEU A;  3H3A A;  7ICG A;  9ICQ A;  4QW9 A;  3B0X A;  1NKE A;  4RNM A;  3PX4 A;  1ZQB A;  5DB8 A;  3UPQ A;  1MC8 A;  3GIM A;  2JEI A;  4I2I A;  1NK7 A;  2GWS A;  4CCH A;  4WC0 A;  5KFB A;  2OWO A;  2BPC A;  5DBA A;  3HW8 A;  2AGP A;  2HHV A;  3H8J A;  5DG7 A;  1JN3 A;  3PV8 A;  1WCN A;  5IIJ A;  2DR8 A;  4PHP A;  4DOB A;  1BNP A;  1MIY A;  2JEF A;  1UEV A;  4J9M A;  5J0Q A;  1TK8 A;  5KT7 A;  3HIY A;  4EBC A;  5KFQ A;  4M47 A;  4DF8 A;  3Q8L A;  4C8L A;  3RTV A;  1QSL A;  1ZQJ A;  2V4R A;  2XY7 A;  5D4B A;  5KG3 A;  4QZ8 A;  4PHA A;  4QWC A;  4EBE A;  8ICN A;  4NKT A;  1ZJN A;  1SL1 A;  2UVW A;  4RQ2 A;  2ZH3 A;  1A77 A;  9ICM A;  3EYZ A;  4DS4 A;  1ZJM A;  1ZQU A;  4PGY A;  5F9N A;  4XA5 A;  5IIK A;  5CA7 A;  2PFP A;  1S9F A;  4TUP A;  4DFK A;  4FHY A;  1KFD A;  3C1Y A;  3HX0 A;  1NOM A;  2B21 A;  1RZT A;  4F3O A;  2HHP A;  3M8S A;  1SL2 A;  5KFR A;  4KIT B;  3T5K A;  3QE9 Y;  5BOM A;  1UA1 A;  4UB3 A;  7ICS A;  1B43 A;  4Z6C A;  3PML A;  4J9P A;  4RU9 A;  4X0B A;  2XCA A;  4KLL A;  5DB9 A;  5J2H A;  5J0X A;  1XS9 D;  3NGD A;  1IM4 A;  1S76 D;  4UD4 A;  2JEJ A;  1NK5 A;  2ZTD A;  2ZJ8 A;  5J2K A;  4WCW A;  4YXJ A;  1ZQF A;  5HHH A;  5KFU A;  4ELT A;  3MAB A;  9ICL A;  5HR9 A;  3SI8 A;  3RJG A;  2XCP A;  4C8K A;  4ECZ A;  2BCU A;  2HHQ A;  5DKW A;  4UAY A;  5HNK A;  3PVX A;  2ZH4 A;  4R66 A;  4GXJ A;  2BQR A;  1ZQH A;  2P6R A;  3ORY A;  3WFP A;  2XC9 A;  2Y1I A;  1TVA A;  4DFP A;  1XO1 A;  3UXO A;  4DS5 A;  2NRT A;  5IIM A;  4RNO A;  3OVB A;  1HUZ A;  3V7K A;  4DSF A;  1YLQ A;  4ATB B;  4DWI A;  4P2H A;  3UPS A;  2A1J A;  5HRE A;  4S3N A;  3KHR A;  4QZA A;  2FLP A;  2IA6 A;  5JUM A;  3Q8Q B;  1ZQA A;  4F4X A;  2PFO A;  3GFK B;  4YMM A;  1DOQ A;  3RR8 A;  4M9H A;  4X4R A;  2AQ4 A;  1JQR A;  3MR2 A;  4ED3 A;  3MBY A;  5DBB A;  3ISB A;  3OJU A;  3V6K A;  2RDI A;  3OVA A;  2KZ3 A;  2KZM A;  4TQS A;  8ICC A;  4E8F A;  3OUY B;  3GDX A;  1TV9 A;  1U9L A;  1C7Y A;  2HHS A;  1QLN A;  1IXR A;  8ICH A;  2ID1 A;  1TKD A;  1L3V A;  2BR0 A;  1RYS A;  1ZQC A;  3GV5 B;  3WFO A;  1ZQK A;  5CB1 A;  4O5K A;  1S0N A;  5EWF A;  4M2Y A;  4IR9 A;  2H5X A;  5J2E A;  5DLF A;  2PI5 A;  4ED0 A;  4YR3 A;  1Z3E B;  4JV0 A;  4I2H A;  4EZ9 A;  4DQR A;  3RAX A;  4KLD A;  3H38 A;  2ZH8 A;  4F5P A;  5KG0 A;  4ED6 A;  1ZQY A;  1NJY A;  4R8U A;  4WC1 A;  5HC9 A;  4MF8 A;  2DR9 A;  4BWM A;  3ZDB A;  4B9N A;  8ICS A;  2ASJ A;  4DL4 A;  2ZH5 A;  1U4B A;  3H4B A;  3ZDA A;  4KN7 A;  2ZUC A;  5HHI A;  4KMU A;  4UAZ A;  5DGA A;  1PX5 A;  4YD1 A;  4ED2 A;  8ICO A;  2AGQ A;  3RB3 A;  8ICJ A;  3JPQ A;  1XU4 A;  2F1J A;  5KG2 A;  3T5J A;  2R8J A;  3GIL A;  4KLG A;  5HRG A;  2IBK A;  1VJ7 A;  1Q79 A;  3ZD9 A;  1VFG A;  3MR5 A;  2XY6 A;  1LB2 B;  9ICU A;  4YXM A;  3RJJ A;  4BDP A;  2O5A A;  2F1I A;  4F91 B;  1HUO A;  2ZTE A;  4RPY A;  3MFI A;  1T3N A;  3LK9 A;  4RQ7 A;  1LV5 A;  1QTM A;  4BXO B;  4M0A A;  2KN7 A;  2C22 A;  3JPT A;  4KLM A;  1V9P A;  2XY5 A;  4ELU A;  4I27 A;  1B22 A;  3TFR A;  3C18 A;  4X4O A;  2O1P A;  4X4Q A;  4J9N A;  4I2J A;  9ICP A;  4HYK A;  4RUA A;  3HP6 A;  1ARO P;  4DLG A;  3RBE A;  4DQI A;  3NTU A;  4RT2 A;  2WTF A;  4BGD A;  4RQ6 A;  3K75 D;  2FMP A;  4MF2 A;  7ICL A;  4C8M A;  1U49 A;  3WFR E;  4FHX A;  4X4N A;  4M6W B;  1NJW A;  1L5U A;  3T3F A;  1D9F A;  5DDM A;  1HJP A;  4XQ8 A;  4DOC A;  9ICW A;  8ICW A;  7ICV A;  2BCS A;  4WC3 A;  3AU2 A;  4MEX A;  3RH4 A;  3PW7 A;  4NM1 A;  4KLH A;  3EPG A;  3ISC A;  4AT9 B;  3RJH A;  4DOA A;  4Q8F A;  5KT2 A;  2HHW A;  4PGQ A;  3RB0 A;  3M8R A;  4M9N A;  2DFL A;  3H37 A;  4R65 A;  3TAQ A;  5DBC A;  5J2A A;  3PO5 A;  4DEZ A;  4M04 A;  4NLN A;  7ICR A;  4PPX A;  5KFF A;  5DG9 A;  4IG8 A;  4O3P A;  2W9B B;  3BJY A;  4EYH B;  2PXI A;  2ZH9 A;  4DO9 A;  1ZQN A;  2RFF A;  3RB6 A;  2MUT A;  7ICE A;  5L1L A;  3TAR A;  2NRK A;  2AQ0 A;  5DEC A;  1NJZ A;  4PH5 A;  1R8A A;  4JUZ A;  2JZB B;  2FPK A;  4Q44 A;  3EW9 A;  3H8S A;  1NJX A;  4WBY A;  5EWG A;  1R8C A;  1UA0 A;  2UVR A;  8ICM A;  9ICI A;  3RH6 A;  5IIO A;  3BDP A;  9ICS A;  3PR5 B;  7ICT A;  1R89 A;  3UQ2 A;  2HHX A;  2XGQ A;  4C8O A;  1TFR A;  3H8W A;  1TAQ A;  3MR3 A;  3G6V A;  3SYZ A;  4ED1 A;  5F2V O;  5BOL A;  2FPM A;  4J9L A;  5KT5 A;  4B9U A;  9ICK A;  4TUQ A;  4B9S A;  4YVZ A;  4E0D A;  4RQ0 A;  4WC6 A;  2IMW P;  4KLI A;  1FA0 A;  3GV7 B;  4LZG A;  8ICT A;  5J2B A;  4DSK A;  4UB5 A;  7ICF A;  3MGH A;  3C2L A;  3GV8 B;  5KG5 A;  4YD2 A;  5CP2 A;  3PO4 A;  4I2E A;  1QSS A;  8ICZ A;  3THV A;  2J6T A;  4FHV A;  4AT8 A;  3OJS A;  4UB2 A;  4WC2 A;  1KDH A;  1JAJ A;  3H39 A;  4O3N A;  1SL0 A;  2R8I A;  5HRK A;  1OU5 A;  3M9N B;  4FBT A;  4KLQ A;  4IQV A;  5KFP A;  4DSI A;  3RRH A;  8ICP A;  2AU0 A;  4I2G A;  4QZH A;  3H40 A;  2R8G A;  4F2R A;  1S77 D;  4UD5 A;  4RPX A;  3C5F A;  5DB7 A;  1MQ3 A;  8ICK A;  1UT8 A;  3GIK A;  4PHE A;  9ICN A;  3RJF A;  1PZN A;  1KEJ A;  1N48 A;  1N56 A;  5J2J A;  3BQ2 A;  3AUO A;  1ZQT A;  7ICM A;  4YG2 A;  3HPO A;  1QSY A;  3EPI A;  4NXZ A;  1BPB A;  7ICJ A;  3C2K A;  1Z00 B;  3Q8S B;  8ICL A;  1NZP A;  3Q8P B;  5CR0 A;  4ELV A;  4YMN A;  4I2A A;  3BQ1 A;  4GC6 A;  1BVS A;  4DSL A;  4LZD A;  1KNY A;  3AQK A;  5DQH A;  1BPD A;  5KFY A;  3JPO A;  4XUS A;  3ZDD A;  4DL5 A;  3JPN A;  1JXL A;  4YP3 A;  7ICP A;  1ZQE A;  4J9K A;  5HP4 A;  4MEY A;  4NLG A;  4UBB A;  4F92 B;  8ICI A;  2NRZ A;  3BQT A;  4QW8 A;  4QZB A;  4I29 A;  4KLJ A;  1KSP A;  1KLN A;  3QZ7 A;  4XQ7 A;  4WC4 A;  2F1H A;  2RDJ A;  2KFZ A;  1TAU A;  1A76 A;  4F2S A;  3KTQ A;  3H7I A;  3PNC A;  4R63 A;  4MFC A;  4QWD A;  1U48 A;  5L9X A;  3OGU A;  1F5A A;  2A1J B;  4IR1 A;  4UB1 A;  2ASD A;  3E2E A;  4FO6 A;  5J0R A;  4O3S A;  2FPL A;  3MGI A;  2BHN A;  1CEZ A;  2ALZ A;  3RRG A;  1K1S A;  3EZ5 A;  3SZ2 A;  3RJI A;  4WC5 A;  3RH5 A;  4IQW A;  4P4M A;  2R8H A;  5J0U A;  4O3O A;  4J9S A;  5CWR A;  1T7P A;  3OHB A;  5C5J A;  5J0P A;  3V6J A;  1UT5 A;  5HMM A;  4M9L A;  4Q8E A;  1ZQO A;  1X9M A;  4QZ9 A;  4DQQ A;  2I9G A;  4YR2 A;  1MQ2 A;  3IM1 A;  4KLU A;  5J2I A;  3V7L A;  4IQT A;  1MSW D;  3N4M B;  2FMQ A;  3PR4 A;  1KFS A;  2HHU A;  5KFO A;  4Q43 A;  2BQ3 A;  7ICQ A;  1BNO A;  1T8E A;  5KFG A;  2DPJ A;  3KHH A;  4AT7 A;  3LQC B;  4RZR A;  3RJE A;  3WFS C;  3LWM A;  5J0W A;  4ED7 A;  1ZQR A;  8ICB A;  5HRD A;  4ECR A;  4R8U B;  4ECV A;  3C5G A;  2BGW A;  9ICB A;  2ZHA A;  4Z6E A;  5KFZ A;  2FMS A;  2FLN A;  1ZQV A;  4BXO A;  3N97 B;  4K4G A;  1ZQD A;  1S10 A;  3TQ1 A;  1KFT A;  4TQR A;  3OV7 A;  8ICA A;  3TAN A;  5KG4 A;  2V9W A;  5F9L A;  4KLO A;  4QZE A;  4EP7 A;  3V7J A;  4P4P A;  4GC7 A;  3C2M A;  2ISP A;  3ZD8 A;  1SKW A;  4WBZ A;  3PW4 A;  4ECQ A;  5J2C A;  1RXV A;  1JXE A;  4DSJ A;  4JWM A;  5KFN A;  4QZI A;  3PW2 A;  5J2F A;  3JYY A;  4QZD A;  2KTQ A;  1ZYQ A;  4RNN A;  4Z6D A;  2W9C A;  4M6W A;  4X0A A;  3C21 A;  3WFQ E;  4F4W A;  4RQ1 A;  4F4Z A; 
#chains in the Genus database with same CATH topology
 5AIC A;  1S97 A;  8ICU A;  1NK8 A;  1S0O A;  2BPF A;  3OHA A;  2J6S A;  1U45 A;  4FZN A;  3IHQ B;  2BCV A;  4F93 B;  5KFK A;  2FLL A;  4K97 A;  2OCE A;  2J6U A;  4EEL A;  3MGV A;  5JU5 A;  4YN4 A;  2IHM A;  2PFQ A;  3T5L A;  1Q8K A;  4NXX A;  4B9M A;  4GFJ A;  4IRD A;  3L9D A;  1JMS A;  2K4H A;  1TFW A;  1KTQ A;  3OVS A;  3AQM A;  3H0M B;  4KLE A;  2RQ5 A;  3PY8 A;  3T5H A;  4DL6 A;  1B0X A;  7ICN A;  9ICJ A;  8ICF A;  2PBE A;  5DDY A;  1NK9 A;  4K4I A;  3ZDC A;  3JPR A;  4F5N A;  3HRD D;  2K8C B;  2BBJ A;  1ZQP A;  4NWI A;  1S0V A;  1L3U A;  1LKY A;  5L1I A;  2JRZ A;  4KLS A;  3MDC A;  2HBM A;  3SV3 A;  4G3I A;  4C7Z A;  4E7X A;  1MIV A;  3WKE A;  4AT8 B;  2ESE A;  4X5V A;  1UPH A;  2IOF K;  4KB6 A;  5ALJ A;  4FHW A;  1H38 A;  2ISO A;  3Q8M A;  4YFK A;  3QYP A;  2UVV A;  4CNQ A;  3FM9 A;  4DF4 A;  3RJK A;  5J0T A;  4DL7 A;  4J9O A;  2Q66 A;  4NXT A;  1BPZ A;  3WK9 A;  2K8A A;  4RPZ A;  2W8K A;  1Q46 A;  2EDU A;  3TFS A;  5KT4 A;  1R8B A;  4M9J A;  4DLE A;  9ICC A;  3ER9 B;  9ICE A;  2NO5 A;  2GO7 A;  3QEA Z;  1SXD A;  3SV4 A;  5KFA A;  2M0N A;  2QB0 B;  4KMO B;  3OSN A;  2CPR A;  3ER8 C;  1XSL A;  4NM2 A;  4JWN A;  2C2D A;  4BWJ A;  1UQV A;  3ICX A;  1D9D A;  2Q4T A;  2QAR B;  2XO7 A;  1ZQL A;  4B9V A;  4RWQ A;  5J2D A;  1X9W A;  2AH5 A;  5L1M A;  1ZD4 A;  4O3Q A;  4ECS A;  4ECW A;  1ZQZ A;  1ZOL A;  1NKC A;  5CFS A;  3GIJ A;  5EWE A;  4F5O A;  5ALU A;  3EWA A;  4E80 A;  2HVI A;  5D46 A;  1QQ6 A;  2N1R A;  1FFU A;  3PX6 A;  4JV2 A;  4CDG A;  5IIN A;  2W9M A;  5J0S A;  2ZH2 A;  4RQ4 A;  4RWO A;  3D6J A;  3CRX A;  5ALE A;  4AT7 B;  1GO3 F;  2HW3 A;  5TZV A;  2CXY A;  2KHV A;  1SKS A;  3G6Y A;  4RT3 A;  1DK2 A;  3SR6 A;  1SWV A;  3IG8 A;  2ZIV B;  1NKB A;  1Q3V A;  2KE7 A;  3I76 A;  5AIB A;  5DQG A;  2KD1 A;  3WK8 A;  2M2T A;  5KFJ A;  5KFI A;  2EAP A;  4QZF A;  3KHG A;  1DK3 A;  3D2N A;  2M2W A;  7ICH A;  3CW2 C;  2O6K A;  1COO A;  2A3V A;  2ZUD A;  9ICA A;  2ZJ5 A;  8ICX A;  1CRX A;  4J9R A;  2W3S A;  4RNM A;  3PX4 A;  1ZQB A;  2JEI A;  4I2I A;  2LBO A;  2OWO A;  3CP8 A;  5AKK A;  4J9M A;  1UHU A;  4EBC A;  4M47 A;  4DF8 A;  1QSL A;  1ZQJ A;  2XY7 A;  1KL9 A;  4QZ8 A;  4PHA A;  4NKT A;  1F5S A;  2UVW A;  2ZH3 A;  1ZJM A;  2KVC A;  2GLE A;  1S9F A;  3SMV A;  3NVV A;  4QIW F;  3C1Y A;  3HX0 A;  1NOM A;  3BQ7 A;  2IOH A;  3TKA A;  1RZT A;  4F3O A;  2NO4 A;  1UA1 A;  3T5K A;  1B43 A;  3PML A;  3CK6 A;  4X0B A;  4Y2U A;  5J2H A;  2DUY A;  1XS9 D;  1IM4 A;  5CFT A;  2Y9T A;  3EUB 2;  2JEJ A;  1NK5 A;  3PST A;  1ZQ1 C;  3SI8 A;  2HN1 A;  4ECZ A;  1XO0 A;  3TAD C;  2QB1 A;  4K98 A;  3UXO A;  4DS5 A;  2NRT A;  2YB4 A;  4OJ6 A;  1YLQ A;  3UPS A;  2E8M A;  3NRZ A;  5HRE A;  4O69 A;  4S3N A;  2FLP A;  5ALV A;  2PFO A;  1DOQ A;  1JQR A;  4JMU A;  2HN2 A;  3KZI U;  2RDI A;  4BX9 C;  1KW4 A;  4EV6 A;  4TQS A;  3OUY B;  1U9L A;  5AIA A;  2HMX A;  1C7Y A;  5D62 A;  2HHS A;  1QLN A;  5C0Y A;  3WFO A;  5G5G A;  2ZXH A;  4M2Y A;  2H5X A;  4FE3 A;  1Z3E B;  4EZ9 A;  1NJY A;  2DR9 A;  4OAG A;  8ICS A;  3WKD A;  2W43 A;  3ZDA A;  3N28 A;  4UAZ A;  1PX5 A;  3WK4 A;  1XU4 A;  2F1J A;  3T5J A;  4KLG A;  5HRG A;  2IBK A;  1Q79 A;  5ALS A;  1LB2 B;  5EE1 A;  3RJJ A;  5AI4 A;  2O5A A;  1IIP A;  3S6J A;  1A6S A;  3JCF A;  2HOF A;  4RQ7 A;  2KG5 A;  1L7M A;  2XY5 A;  4ELU A;  2YQE A;  4X4Q A;  1OW5 A;  4HYK A;  1ARO P;  3RBE A;  2WTF A;  4UB6 U;  2FMP A;  7ICL A;  4K8V A;  4X4N A;  1D9F A;  9ICW A;  4DOC A;  5ALM A;  1KN5 A;  3HKZ F;  2I5H A;  4U6P A;  4NM1 A;  2K89 A;  3ISC A;  3RB0 A;  2KKV A;  3PO5 A;  4NLN A;  4PPX A;  3NVZ A;  3ALR A;  4EYH B;  2ZG6 A;  3RB6 A;  3A0H U;  5L1L A;  2AQ0 A;  5DEC A;  4PH5 A;  3SEN A;  1SB3 C;  4JUZ A;  2JZB B;  4WBY A;  4Q44 A;  5EWG A;  1R8C A;  3BDP A;  5IIO A;  9ICS A;  1S5L U;  5ALH A;  1TAQ A;  3H8W A;  4FZL A;  4ED1 A;  2W11 A;  5F2V O;  5BOL A;  5HR6 A;  4TUQ A;  4WC6 A;  4KLI A;  1FA0 A;  4K99 A;  3GV7 B;  1SV0 A;  4K9A A;  8ICT A;  3QUT A;  2JHD A;  4UB5 A;  7ICF A;  5AKL A;  3GV8 B;  4WC2 A;  3ERC C;  4AT8 A;  3QU2 A;  1QSS A;  2J6T A;  3RFA A;  4O6A A;  3H39 A;  1SL0 A;  2R8I A;  5HRK A;  3M9N B;  4FO1 A;  1L7N A;  1LKY B;  2HOQ A;  1S77 D;  4QZH A;  4F2R A;  4UD5 A;  4HAI A;  1MQ3 A;  2DWQ A;  5DB7 A;  1FIQ A;  8ICK A;  3GIK A;  4PHE A;  3MCR A;  1PZN A;  1N56 A;  3AUO A;  7ICM A;  2DL0 A;  3C2K A;  3MC1 A;  4C4S A;  3Q8S B;  4OAH A;  1NZP A;  4ELV A;  3AQK A;  4GC6 A;  3JPO A;  3JPN A;  4YP3 A;  7ICP A;  2E1F A;  2QB0 A;  3F5E A;  4QW8 A;  1ECW A;  1KSP A;  3QZ7 A;  1TAU A;  1A76 A;  2LYB A;  2QAR A;  1U48 A;  3OGU A;  1N5X A;  1F5A A;  2ASD A;  2ALZ A;  3SZ2 A;  3RJI A;  2WAQ C;  5FP0 A;  3VC8 A;  3OHB A;  4Q8E A;  3IM1 A;  5J2I A;  3V7L A;  4IQT A;  2KSO B;  2BBH A;  5CEH A;  5KFO A;  2BQ3 A;  4OJO A;  4AT7 A;  4RZR A;  2HI0 A;  5J0W A;  4AYB F;  4R8U B;  4ECV A;  5GTI U;  4U7C A;  9ICB A;  4Z6E A;  1ZQV A;  1WWV A;  5ALR A;  4I0U A;  1KFT A;  2V9W A;  2CRX A;  2ZIV A;  1X42 A;  4EP7 A;  2ISP A;  3ZD8 A;  3AN1 A;  4LEZ A;  4ECQ A;  3PW2 A;  2KTQ A;  1J97 A;  5AM4 A;  4Z6D A;  4X0A A;  4M6W A;  3PSF A;  5AM0 A;  3QX7 A;  4F4Z A;  5KFD A;  4K4H A;  3AEV A;  4I28 A;  2HVH A;  3TAP A;  5EOZ A;  2LM4 A;  4FS2 A;  4NKU A;  3B9J A;  4DQP A;  5BPC A;  2WF9 A;  2W9B A;  5J8Y A;  2WB1 C;  5J0O A;  4ED8 A;  2E8N A;  4IRC A;  3UM9 A;  4OCZ A;  2H3Z A;  4C8N A;  4EEY A;  2PFN A;  3QZ8 A;  2MUT B;  4RQ8 A;  4DSE A;  5DQI A;  2ZUB A;  2W9A A;  4UB4 A;  2K4I A;  3H3A A;  4QZC A;  4ECY A;  2JR5 A;  1QQ5 A;  3N7P D;  4IQU A;  3QNM A;  4DL2 A;  4O5C A;  3RBD A;  4O0I A;  1BPY A;  3QU9 A;  5KG7 A;  1XSP A;  1RPL A;  3AU6 A;  2M2U A;  3ISD A;  5K4L A;  4J9Q A;  8ICR A;  2YML A;  1X2I A;  8ICV A;  5KFS A;  5KFL A;  4UAU A;  2QKQ A;  2K60 A;  8ICG A;  3M9M B;  2AJQ A;  1XWL A;  9ICX A;  4UBC A;  3MR6 A;  1JAL A;  2ES6 A;  3HT3 A;  4EED A;  4YQW A;  5DLG A;  5AKY A;  4PGX A;  2BDU A;  3HJ4 A;  9ICH A;  3GII A;  9ICR A;  2EZY A;  5ALK A;  1SKR A;  3OUY A;  2WF8 A;  3ETL A;  1NK0 A;  3IV6 A;  4KTQ A;  4DL3 A;  3G6X A;  4NLZ A;  1SZP A;  7ICI A;  4O3R A;  2B0C A;  5HML A;  2Y1J A;  4F4Y A;  2NYV A;  2VA3 A;  3C66 A;  4NLK A;  5KG6 A;  4EX7 A;  4DCC A;  2JMG A;  1ZET A;  4DFM A;  3HIL A;  1Q78 A;  4KLT A;  2EAM A;  5KFT A;  5KG1 A;  4Y2Y A;  4EZ6 A;  4UAS A;  2DRA A;  5DG8 A;  4P0Q B;  1L3S A;  4NL9 C;  2KFN A;  5B66 U;  1PVP A;  5KT3 A;  3UXN A;  5DED A;  5KL8 B;  1RYU A;  4N7R A;  2BKE A;  3IP4 B;  3UXP A;  2DQN B;  1Z19 A;  1NK4 A;  4O9M A;  2XGP A;  2F76 X;  5HRL A;  3F2D A;  2YX8 A;  1KKX A;  3TAD A;  2YTU A;  5GTH U;  2XIC A;  3HJ1 A;  4RWN A;  4F50 A;  2I1Q A;  5KFW A;  3LWL A;  5KFE A;  5KT6 A;  4IL6 U;  3DEE A;  4QWB A;  2ASL A;  4FH5 A;  4WQL A;  2ZH7 A;  3MDA A;  4NY8 A;  2W9C B;  3V72 A;  5EE0 A;  3GQC A;  3KZX A;  5AK4 A;  3M7D A;  3H0L B;  4TUS A;  4C4R A;  3MFH A;  3NRW A;  4FH3 A;  4XJE A;  2JZB A;  4PHD A;  3PHZ A;  5D49 A;  3HWT A;  1UEU A;  9ICQ A;  4QW9 A;  3B0X A;  1NKE A;  3UPQ A;  2F77 X;  4CCH A;  2E3T A;  1NK7 A;  2GWS A;  4WC0 A;  2BPC A;  5DBA A;  1T94 A;  3PV8 A;  5DG7 A;  1JN3 A;  1WCN A;  1MIY A;  5KT7 A;  4ZOH C;  5ALT A;  5KG3 A;  8ICN A;  1ZJN A;  3EYZ A;  5F9N A;  5IIK A;  2FE9 A;  4TUP A;  2EQY A;  2KK0 A;  3H8M A;  4DFK A;  4FHY A;  1PUZ A;  3M8S A;  4KIT B;  4WOY A;  4Z6C A;  3DV9 A;  4NXW A;  5DB9 A;  3AQF A;  2D8C A;  4WCW A;  5HR9 A;  2W7P A;  1Z1V A;  5EE3 A;  1KQQ A;  2HHQ A;  5HNK A;  2ZH4 A;  1X40 A;  3O0F A;  4R66 A;  2BQR A;  2H3F A;  1FO4 A;  2XC9 A;  3NUQ A;  1TVA A;  3OVB A;  4RNO A;  4DSF A;  2A19 A;  4P2H A;  3KHR A;  2IA6 A;  3IRU A;  5JUM A;  1ZQA A;  4YMM A;  3RR8 A;  4X4R A;  4K9B A;  3MBY A;  3LVW A;  8ICC A;  4E8F A;  5AI6 A;  4UAR A;  8ICH A;  3QU5 A;  1L3V A;  2KSO A;  1ZQC A;  5ALP A;  5J2E A;  4ED0 A;  3C29 A;  4JV0 A;  4DQR A;  3RAX A;  4A8E A;  3SD7 A;  1ZQY A;  4ED6 A;  4R8U A;  4MF8 A;  4BWM A;  1OUQ A;  3ZDB A;  1K5O A;  4LJX A;  1ZXI A;  4EX6 A;  3NWI A;  4KMU A;  5DGA A;  5CFU A;  3JPQ A;  2E1E A;  2ZXI A;  4NJ8 A;  2G07 A;  1VFG A;  2RHF A;  4YXM A;  1HUO A;  4UAV A;  3MFI A;  3U26 A;  2C22 A;  3JPT A;  4C7Y A;  1V9P A;  2MU2 A;  4I27 A;  4KLM A;  2HBK A;  4OAI Z;  4I2J A;  3HP6 A;  3NTU A;  5AK6 A;  1Q3U A;  3ETR A;  4BGD A;  5AKZ A;  4MF2 A;  3WFR E;  4M6W B;  1L5U A;  3KKA C;  3T3F A;  2YY6 A;  1HJP A;  4XQ8 A;  2KMD A;  2GOL A;  4DOA A;  5KT2 A;  3M8R A;  4M9N A;  2DFL A;  3H37 A;  5DBC A;  5J2A A;  5KFF A;  2W9B B;  1OXJ A;  3BJY A;  1ZQN A;  2MUT A;  1NJZ A;  4QJF B;  1AQ6 A;  3D2S A;  3EW9 A;  3H8S A;  2MSN A;  1F0M A;  8ICM A;  9ICI A;  3RH6 A;  2XGQ A;  3G6V A;  3SYZ A;  3MR3 A;  5EE9 A;  3OPX A;  2W3R A;  2FPM A;  4B9S A;  4RQ0 A;  1Z4O A;  4Y2T A;  4LZG A;  5AM5 A;  3BS5 A;  3C2L A;  4I2E A;  3THV A;  4FHV A;  3OJS A;  3E0F A;  1JAJ A;  3OTQ A;  3AQE A;  1OU5 A;  1PVR A;  1QCK A;  1L8O A;  4PJ0 U;  2AU0 A;  4I2G A;  4IG8 A;  2VIX A;  5H2F U;  3IDW A;  1N48 A;  1ZQT A;  3M6Z A;  5AM2 A;  3HPO A;  7ICJ A;  3QXG A;  2WF5 A;  4YMN A;  5ALX A;  3BQ1 A;  1BVS A;  1KNY A;  5DQH A;  2W55 A;  1NI3 A;  5KFY A;  1XNS A;  1WUD A;  2I6X A;  5ALW A;  4C80 A;  1ZQE A;  3SAG A;  4O68 A;  5HP4 A;  3WKA A;  4NLG A;  8ICI A;  2NRZ A;  3BQT A;  4KLJ A;  5AKH A;  4OJL A;  4WC4 A;  2Y0S C;  3KTQ A;  3PNC A;  1TE2 A;  4EEN A;  3E2E A;  5J0R A;  2FPL A;  2BHN A;  4NV0 A;  3EZ5 A;  4P4M A;  1ZD2 P;  4F71 A;  2OYY A;  3V6J A;  5J0P A;  4P0Q A;  1ZQO A;  5ALL A;  1MQ2 A;  1PK1 B;  3N4M B;  2FMQ A;  3PR4 A;  1KFS A;  4Q43 A;  7ICQ A;  5KFG A;  2VJ5 A;  3LQC B;  3RJE A;  4ED7 A;  5HRD A;  3C5G A;  5KFZ A;  2FLN A;  3N97 B;  4K4G A;  1JRO A;  5ALQ A;  3TQ1 A;  1ZQD A;  5D61 A;  8ICA A;  5KG4 A;  5F9L A;  4GC7 A;  1MN8 A;  4US9 A;  2YN4 A;  4WBZ A;  1T3Q A;  4PZO A;  5J2C A;  1RXV A;  2W9C A;  3GZF A;  3C21 A;  3WFQ E;  4F4W A;  4RQ1 A;  1T4G A;  3B0Y A;  2VA8 A;  1D8Y A;  1L7P A;  3WKB A;  4X4S A;  2PKE A;  1ZD3 A;  3QEB Z;  2K8B B;  4X4T A;  4I2C A;  2DVI A;  2G5I B;  5HR7 A;  1PVQ A;  2Y9U A;  2ZH6 A;  4M9G A;  1RG6 A;  1TK5 A;  3RB4 A;  1WOT A;  4X4U A;  1RXW A;  3WU2 U;  4PL1 A;  3HJE A;  3RAQ A;  1X6J A;  2FJ6 A;  5L1J A;  2BCR A;  2RLT A;  5HRH A;  5J29 A;  2W8L A;  3JPS A;  3QU4 A;  4M5D A;  1ZQW A;  2R8K A;  2KKP A;  3R9K A;  5AI8 A;  5HRB A;  3K4G A;  4GLX A;  4JLZ A;  4UAT A;  1BPE A;  4MFA A;  2JEG A;  3QU7 A;  2VJ4 A;  4F8R A;  5KFC A;  3PMN A;  5CHG A;  3KBB A;  5KTQ A;  1Z00 A;  2MA1 A;  1ZRM A;  1IV8 A;  1FEZ A;  3WK7 A;  4F4K A;  1O03 A;  4EBK A;  2KHQ A;  2IUB A;  2ZH8 A;  5KFH A;  1TK0 A;  5KAF U;  2ZHB A;  4R64 A;  4Z6F A;  1L3T A;  2KIV A;  1VLB A;  4KX3 A;  3KFU F;  3ZDE A;  4J03 A;  2ZIX B;  3C23 A;  2KIC A;  4TUR A;  5III A;  5JTI A;  4YR0 A;  4RQ5 A;  3SAH A;  1Y88 A;  2W54 A;  2WF6 A;  2E8O A;  4Y2S A;  1GPJ A;  1BGX T;  4RUC A;  3CYM A;  1VDV A;  3D2Q A;  4LEY A;  5CRX A;  2DGZ A;  2BPG A;  2P35 A;  1QQ7 A;  4ECT A;  4OAF A;  1WG8 A;  5J2G A;  5KFX A;  5J0Y A;  4I2B A;  9ICT A;  3F2B A;  1SWW A;  4RQ3 A;  3RR7 A;  2M2V A;  4UQG A;  1TFY A;  4EBJ A;  1D8B A;  1JIH A;  4F5Q A;  1NO5 A;  4GXI A;  2OXO A;  1K1Q A;  2AGO A;  2BQU A;  2PMZ C;  2WF7 A;  4EYI B;  7ICK A;  3V6H A;  3FDS A;  4CE6 A;  2W04 A;  3F5A A;  5HRF A;  2HDO A;  2BZF A;  1UCV A;  3F2C A;  2ZIU A;  1X9S A;  2G08 A;  2ATL A;  9ICO A;  3LDA A;  1Z1B A;  1A0P A;  2UVU A;  5ALZ A;  1ZQQ A;  2EZZ A;  1WCL A;  2KP7 A;  2KV2 A;  1DXS A;  1YT3 A;  3KHL A;  4Q45 A;  4JB3 A;  1MC8 A;  3GIM A;  4LEW A;  5KFB A;  3HW8 A;  2HHV A;  3AMZ A;  3K1Z A;  4PHP A;  4DOB A;  2JEF A;  1BNP A;  3NS1 A;  5AI0 A;  1S8O A;  3HIY A;  1SV4 A;  3VCB A;  5KFQ A;  4C8L A;  3RTV A;  2G06 A;  5D4B A;  2B4V A;  4RQ2 A;  9ICM A;  1ZQU A;  2B51 A;  5AI5 A;  4XA5 A;  5CA7 A;  2PFP A;  1KFD A;  3BS5 B;  1SL2 A;  3I1Y A;  5KFR A;  7ICS A;  4J9P A;  4RU9 A;  4KLL A;  5J0X A;  1J2N A;  1S76 D;  4UD4 A;  1QH9 A;  2ZTD A;  2ZJ8 A;  2R18 A;  1ZQF A;  4WJ3 B;  5KFU A;  4ELT A;  9ICL A;  3HKZ C;  3L5K A;  3LYS A;  4EEK A;  1X6I A;  4UAY A;  2W03 A;  1J2M A;  1DRG A;  4GXJ A;  1ZQH A;  4OJ5 A;  2P6R A;  3ORY A;  3WFP A;  3PSI A;  4DFP A;  1XO1 A;  4PL2 A;  3WKC A;  3V7K A;  4ATB B;  4QNL A;  4QZA A;  3Q8Q B;  2KIW A;  4Y2P A;  3KOO A;  4M9H A;  2AQ4 A;  3V6K A;  3ISB A;  2RRD A;  4HX0 A;  2KOB A;  2KZ3 A;  1PK1 A;  2ID1 A;  1TKD A;  2BR0 A;  1RYS A;  3GV5 B;  1ZQK A;  4O5K A;  1S0N A;  4IR9 A;  2PI5 A;  5DLF A;  2E5S A;  4YR3 A;  4KM5 A;  3H38 A;  4KLD A;  4WC1 A;  5AM3 A;  1V38 A;  2ZH5 A;  1U4B A;  3H4B A;  1JUD A;  5ALY A;  8ICJ A;  3PZP A;  5KG2 A;  2DBY A;  3GIL A;  2GA9 D;  2KJ9 A;  5AK5 A;  2XY6 A;  4BDP A;  4OJP A;  4RPY A;  1SV0 C;  1T3N A;  4M0A A;  3PSP A;  3C18 A;  3TFR A;  2O1P A;  4RUA A;  3DDH A;  4DLG A;  4DQI A;  2W7O A;  1N61 A;  3K75 D;  1U49 A;  4FHX A;  1NJW A;  5DDM A;  4WC3 A;  2IOF A;  3RH4 A;  4KLH A;  1B4F A;  3EPG A;  4OO1 J;  3RJH A;  4AT9 B;  2HHW A;  2AHO B;  4R65 A;  3T79 A;  4M04 A;  3OWG A;  4O3P A;  5D63 A;  2PXI A;  2ZH9 A;  4IS7 A;  2RFF A;  2FDR A;  4JLX A;  5B3Q A;  1R8A A;  4PZN A;  2FPK A;  1SXE A;  1UA0 A;  2UVR A;  4K96 A;  1R89 A;  4AYB C;  2HHX A;  4C8O A;  1TFR A;  2JV3 A;  2DKZ A;  1PK3 A;  2Y0S F;  1Z4N A;  4E0D A;  4YVZ A;  4DSK A;  3UMC A;  1L8L A;  3MGH A;  5KG5 A;  3PO4 A;  8ICZ A;  5AKG A;  2JGA A;  1YZ6 A;  1L7O A;  5KFP A;  3GU3 A;  2D6F C;  1RQN A;  4RPX A;  1HIW A;  3NVY A;  1RDF A;  2YMM A;  2HCF A;  5J2J A;  3BQ2 A;  2WHE A;  1QSY A;  5ALI A;  1Z00 B;  4EGW A;  1DGJ A;  5KNI A;  4I2A A;  4DSL A;  4LZD A;  3QUQ A;  2XVT A;  2ZIX A;  4MEY A;  4NLC A;  4UBB A;  4QZB A;  4I29 A;  4XQ7 A;  2F1H A;  4F2S A;  3H7I A;  5CHE A;  4QWD A;  2NV3 A;  1M6Y A;  5L9X A;  2A1J B;  2MRL A;  1P7D A;  4RQM A;  3EF2 A;  4O3S A;  3MGI A;  1CEZ A;  2GH1 A;  1K1S A;  3RH5 A;  1X9X A;  4IQW A;  5J0U A;  4O3O A;  4J9S A;  1T7P A;  5C5J A;  5J8Y C;  1UT5 A;  4M9L A;  4QZ9 A;  4DQQ A;  1ED1 A;  4MHV A;  4CF5 A;  1MSW D;  4ACO A;  2XI9 A;  1N63 A;  5E79 U;  5AKE A;  1IG6 A;  1T8E A;  4WQK A;  3WFS C;  3LWM A;  1ZQR A;  3SEI A;  2KVS A;  2ZHA A;  2DF4 B;  4BXO A;  3OV7 A;  4TQR A;  3TAN A;  3M6K A;  4QZE A;  5AKX A;  3RF9 A;  5ALF A;  1X66 A;  3PW4 A;  5KFN A;  4QZI A;  2GAF D;  1ZYQ A;  1YZ7 A;  2F8L A;  1N60 A;  2LKY A;  4Y2X A;  1LVH A;  1ZRN A;  1N5W A;  5DB6 A;  4KN4 A;  2PI4 A;  4O5E A;  3AQL A;  2F3N A;  2FI1 A;  4DFD A;  4O3M A;  2XID A;  3F53 A;  2ZH1 A;  2G0A A;  7ICU A;  4ECX A;  4LT6 A;  2ZJA A;  3ONN A;  2ZIU B;  2DR7 A;  3IG5 A;  4YMO A;  2ZIW B;  4DQS A;  5T14 A;  2DPI A;  3ED5 A;  1SZH A;  3PW0 A;  2YMQ A;  2LMR A;  4B6J A;  1KRP A;  3Q8K A;  2BDP A;  4LVS A;  2OM6 A;  5B3P A;  2H3V A;  4QZG A;  5F3X B;  2B6G A;  4JV1 A;  3C1Z A;  8ICY A;  2VAN A;  2NRX A;  1S0M A;  1CUK A;  4QWA A;  7ICO A;  3FYH A;  1XC9 A;  4EBD A;  1XSN A;  2IHN A;  2WAQ F;  4FBU A;  5AKJ A;  2M9N A;  1DGS A;  5AHX A;  5AKI A;  2P6U A;  3Q8R B;  2L5Y A;  3M9O B;  4I2D A;  1JX4 A;  2H3I A;  5AK3 A;  2KZZ A;  4RWP A;  4JK1 A;  1UET A;  1NNL A;  4Y2V A;  4Y2Q A;  3I28 A;  9ICG A;  1NK6 A;  2VA2 A;  4B9L A;  2G09 A;  1ZQX A;  5L1K A;  1C20 A;  4ATB A;  1JI7 A;  4P0P B;  2Q0Z X;  1ZQS A;  1HEK A;  8ICE A;  3PW5 A;  4I2F A;  4GXK A;  3H4D A;  2MAX A;  4ZH4 A;  5IIL A;  2LHT A;  2OHF A;  4NXV A;  4US8 A;  4IRK A;  5ALG A;  4RQN A;  2DR5 A;  3L4P A;  4UW9 A;  2PMZ F;  1URJ A;  3A0B U;  4KLF A;  2P66 A;  4WC7 A;  4ECU A;  4UAW A;  3CNH A;  3WK5 A;  3AM9 A;  2HHT A;  4P4O A;  3OSP A;  9ICV A;  1V85 A;  4FZM A;  2C28 A;  5KFM A;  3AQN A;  4CGZ A;  2F2A B;  2YMP A;  3NYB A;  2WB1 F;  1D8L A;  1U47 A;  2NRV A;  3JZ0 A;  4B9T A;  1ZQM A;  4X4V A;  4X4P A;  1ZQG A;  5KFV A;  2HBJ A;  2BCQ A;  4XRH A;  4Y2J A;  4YCX A;  4FS1 A;  2LYH A;  4DFJ A;  4MFF A;  5JRT A;  8ICQ A;  1EXN A;  5DGB A;  2KNJ A;  4USA A;  4CF4 A;  3BZC A;  2C2R A;  9ICF A;  5CJ7 A;  3K7D A;  2CN1 A;  2ZTC A;  5JTG A;  3BQ0 A;  2C2E A;  1WYG A;  2DRB A;  2NRW A;  4AT9 A;  4F5R A;  3LVV A;  4FHP A;  3WK6 A;  3N7R C;  1ZD5 A;  1JRP A;  4WH5 A;  4Y2R A;  1RYR A;  3JPP A;  5HRI A;  4GIB A;  1V4A A;  1SIJ A;  3UQ0 A;  4EEB A;  4QWE A;  3TI0 A;  2V4Q A;  1BPX A;  2EAN A;  2VKQ A;  5KAI U;  2BE3 A;  2HBL A;  1NZB A;  1N62 A;  1MIW A;  1ZQI A;  3PX0 A;  7ICG A;  3TAC B;  5DB8 A;  1L6N A;  2AGP A;  4NL9 A;  3H8J A;  2DR8 A;  5IIJ A;  1O08 A;  1UEV A;  3SQI A;  5J0Q A;  1TK8 A;  2OEH A;  3NAS A;  3Q8L A;  3UMG A;  2V4R A;  4EBE A;  4QWC A;  2LM1 A;  1VJ5 A;  1TAM A;  1SL1 A;  1A77 A;  2LYA A;  4DS4 A;  3E58 A;  4PGY A;  2EZX A;  2H3Q A;  2HHP A;  2B21 A;  3QE9 Y;  5BOM A;  4UB3 A;  2K4P A;  4KX5 A;  2XCA A;  3NVO A;  1WWU A;  3BS7 A;  3NGD A;  2WFA A;  3K1R B;  5J2K A;  5AM1 A;  4YXJ A;  4G9B A;  5HHH A;  3N7S C;  3MAB A;  3RJG A;  2XCP A;  4C8K A;  1N2X A;  2BCU A;  5DKW A;  3PVX A;  1MA7 A;  2JXJ A;  4CRX A;  2Y1I A;  5IIM A;  1HUZ A;  4DWI A;  2A1J A;  4F4X A;  3GFK B;  4IC9 A;  3MR2 A;  2RP5 A;  5B5E U;  4ED3 A;  5DBB A;  2E8P A;  3OJU A;  3OVA A;  2KZM A;  4ICA A;  3GDX A;  1TV9 A;  3KD3 A;  1IXR A;  4QIW C;  5CB1 A;  3QUC A;  5EWF A;  4CF3 A;  4F72 A;  5ALN A;  4I2H A;  2ODG A;  4F5P A;  5KG0 A;  5HC9 A;  4LEV A;  4B9N A;  2ASJ A;  4DL4 A;  1FFV A;  1CI4 A;  4KN7 A;  2ZUC A;  5HHI A;  1F44 A;  4YD1 A;  4ED2 A;  8ICO A;  2AGQ A;  3RB3 A;  3AL0 B;  2R8J A;  2D3D A;  1VJ7 A;  3ZD9 A;  3MR5 A;  9ICU A;  2F1I A;  5ALO A;  4F91 B;  2AXT U;  4NXU A;  2ZTE A;  1QTM A;  3LK9 A;  1LV5 A;  4BXO B;  2JH7 A;  2KN7 A;  1B22 A;  4X4O A;  3NVW A;  2KEY A;  4J9N A;  9ICP A;  4RT2 A;  4RQ6 A;  4C8M A;  5KL1 B;  3L3F X;  4FFD A;  4AP9 A;  2LI6 A;  4BUG A;  8ICW A;  2BCS A;  7ICV A;  2DKX A;  3AU2 A;  4MEX A;  3J81 j;  2ZIW A;  3PW7 A;  2K4E A;  4Q8F A;  4PGQ A;  4O67 A;  3TAQ A;  7ICR A;  2F8K A;  4DEZ A;  5DG9 A;  2Z7J A;  5AI9 A;  4DO9 A;  7ICE A;  2QLT A;  3TAR A;  2NRK A;  1NJX A;  1COK A;  5ALD A;  5TIS U;  2G5H B;  3FAH A;  2HSZ A;  2EWR A;  3PR5 B;  7ICT A;  3UQ2 A;  4C4T A;  3C28 A;  4J9L A;  5KT5 A;  4B9U A;  9ICK A;  2IMW P;  1V97 A;  5J2B A;  3QUB A;  2LPE A;  4YD2 A;  5CP2 A;  5G5H A;  4UB2 A;  2OH2 A;  1KDH A;  4O3N A;  4P0P A;  4FBT A;  4KLQ A;  4IQV A;  4DSI A;  3RRH A;  8ICP A;  3M1Y A;  3H40 A;  3KKA A;  2R8G A;  3C5F A;  9ICN A;  1UT8 A;  4MKP A;  3RJF A;  1KEJ A;  2B56 A;  3IN5 A;  3BZK A;  1RQL A;  4YG2 A;  3EPI A;  4NXZ A;  1BPB A;  8ICL A;  3H0R B;  5CR0 A;  3Q8P B;  1BPD A;  4XUS A;  4BJQ A;  4DL5 A;  3ZDD A;  1JXL A;  4J9K A;  2IHO A;  4F92 B;  2KJ8 A;  5A0L A;  1KLN A;  2KFZ A;  2RDJ A;  4MFC A;  4R63 A;  2YB1 A;  4IR1 A;  4UB1 A;  2KJ5 A;  4FO6 A;  3NKU A;  3RRG A;  2EAO A;  4WC5 A;  3UMB A;  2R8H A;  3FC4 A;  5CWR A;  5HMM A;  1X9M A;  2I9G A;  2F44 A;  4YR2 A;  2HOI A;  4KLU A;  2HHU A;  1BNO A;  3SAF A;  2DPJ A;  3KHH A;  2EH9 A;  2A1A A;  8ICB A;  4ECR A;  4C0Z A;  2BGW A;  2FCL A;  1SGG A;  2FMS A;  2JH1 A;  1S10 A;  4KLO A;  1RM6 C;  3V7J A;  1KBU A;  4P4P A;  3C2M A;  1SKW A;  4DSJ A;  1JXE A;  4JWM A;  5J2F A;  3JYY A;  4QZD A;  3ZI4 A;  4RNN A;  4UB8 U;  4NLB A;  4OD0 A; 
#chains in the Genus database with same CATH homology
 5KFD A;  4K4H A;  1T4G A;  4I28 A;  2HVH A;  5DB6 A;  3TAP A;  4KN4 A;  3B0Y A;  2PI4 A;  5EOZ A;  4O5E A;  3AQL A;  1S97 A;  8ICU A;  1NK8 A;  4FS2 A;  1S0O A;  2VA8 A;  2BPF A;  3OHA A;  1D8Y A;  2J6S A;  4NKU A;  1U45 A;  4X4S A;  2ZH1 A;  3IHQ B;  4DQP A;  4ECX A;  7ICU A;  4LT6 A;  5BPC A;  2BCV A;  2ZJA A;  4F93 B;  5KFK A;  2FLL A;  2W9B A;  2DR7 A;  3QEB Z;  2J6U A;  4X4T A;  4I2C A;  4YN4 A;  4YMO A;  2DVI A;  2IHM A;  5J0O A;  4ED8 A;  4DQS A;  2PFQ A;  3T5L A;  4IRC A;  2ZH6 A;  2DPI A;  1TK5 A;  4B9M A;  4M9G A;  3RB4 A;  4IRD A;  1WOT A;  3L9D A;  3PW0 A;  1JMS A;  4X4U A;  1TFW A;  1KTQ A;  4EEY A;  4C8N A;  1RXW A;  2PFN A;  3OVS A;  3RAQ A;  3QZ8 A;  3AQM A;  1KRP A;  4KLE A;  3PY8 A;  3T5H A;  4DL6 A;  3Q8K A;  2BDP A;  5L1J A;  4LVS A;  7ICN A;  9ICJ A;  8ICF A;  2BCR A;  4QZG A;  2PBE A;  4JV1 A;  3C1Z A;  2MUT B;  4RQ8 A;  4DSE A;  8ICY A;  5DDY A;  1NK9 A;  5DQI A;  2VAN A;  2NRX A;  5J29 A;  1CUK A;  3JPS A;  2W8L A;  1S0M A;  4K4I A;  4QWA A;  7ICO A;  3FYH A;  1XC9 A;  4M5D A;  1ZQW A;  2ZUB A;  2W9A A;  4EBD A;  4UB4 A;  1XSN A;  2IHN A;  2R8K A;  4FBU A;  2M9N A;  4QZC A;  4ECY A;  1DGS A;  3JPR A;  3ZDC A;  4F5N A;  5HRB A;  3K4G A;  4GLX A;  2P6U A;  1BPE A;  4IQU A;  3Q8R B;  3M9O B;  4I2D A;  4MFA A;  1JX4 A;  4DL2 A;  4O5C A;  2JEG A;  3RBD A;  1ZQP A;  1S0V A;  2KZZ A;  4RWP A;  4JK1 A;  4O0I A;  1L3U A;  1BPY A;  1UET A;  5KG7 A;  5L1I A;  1XSP A;  4KLS A;  3MDC A;  1RPL A;  3SV3 A;  3AU6 A;  4G3I A;  1NK6 A;  2VA2 A;  4B9L A;  9ICG A;  2M2U A;  4E7X A;  3ISD A;  4F8R A;  5KFC A;  1MIV A;  1ZQX A;  4J9Q A;  5L1K A;  4AT8 B;  3PMN A;  4X5V A;  5CHG A;  8ICR A;  5KTQ A;  1Z00 A;  1X2I A;  4FHW A;  8ICV A;  1H38 A;  5KFS A;  4ATB A;  5KFL A;  3Q8M A;  2ISO A;  8ICG A;  4YFK A;  2Q0Z X;  3M9M B;  1ZQS A;  2UVV A;  4DF4 A;  4F4K A;  3RJK A;  1XWL A;  8ICE A;  2AJQ A;  3PW5 A;  5J0T A;  4UBC A;  3MR6 A;  9ICX A;  4EBK A;  4DL7 A;  4I2F A;  4J9O A;  4GXK A;  2Q66 A;  3HT3 A;  3H4D A;  1BPZ A;  4YQW A;  5DLG A;  5KFH A;  4RPZ A;  4PGX A;  2MAX A;  2W8K A;  1TK0 A;  3GII A;  9ICH A;  9ICR A;  4ZH4 A;  3HJ4 A;  3TFS A;  5IIL A;  1SKR A;  5KT4 A;  1R8B A;  3OUY A;  4M9J A;  3ETL A;  4DLE A;  1NK0 A;  9ICC A;  2ZHB A;  4IRK A;  9ICE A;  4R64 A;  3QEA Z;  4Z6F A;  1L3T A;  4KTQ A;  4DL3 A;  2DR5 A;  3G6X A;  3ZDE A;  4NLZ A;  1SZP A;  3SV4 A;  3C23 A;  5KFA A;  4YR0 A;  4TUR A;  5III A;  4O3R A;  7ICI A;  4RQ5 A;  4KLF A;  2P66 A;  1Y88 A;  4WC7 A;  3OSN A;  5HML A;  4ECU A;  2Y1J A;  4UAW A;  4F4Y A;  1XSL A;  5HRH A;  4NM2 A;  2HHT A;  4JWN A;  2C2D A;  2VA3 A;  4P4O A;  3OSP A;  3C66 A;  4BWJ A;  9ICV A;  4NLK A;  5KG6 A;  2C28 A;  1BGX T;  5KFM A;  4RUC A;  1D9D A;  3AQN A;  2XO7 A;  1ZQL A;  4B9V A;  3NYB A;  4RWQ A;  5J2D A;  1D8L A;  1U47 A;  2NRV A;  4DFM A;  1ZET A;  1X9W A;  4B9T A;  3JZ0 A;  4O3Q A;  4ECS A;  4ECW A;  1ZQZ A;  1ZQM A;  1Q78 A;  2BPG A;  4X4V A;  1NKC A;  4X4P A;  4KLT A;  5KFT A;  5KG1 A;  1ZQG A;  5KFV A;  3GIJ A;  4EZ6 A;  5EWE A;  4ECT A;  2BCQ A;  4F5O A;  2DRA A;  5DG8 A;  3EWA A;  5J2G A;  1L3S A;  5D46 A;  4XRH A;  2HVI A;  2KFN A;  4E80 A;  5KFX A;  5J0Y A;  4YCX A;  4FS1 A;  3PX6 A;  4I2B A;  5KT3 A;  4JV2 A;  2LYH A;  3UXN A;  9ICT A;  5DED A;  4DFJ A;  4RQ3 A;  5IIN A;  2W9M A;  5J0S A;  4MFF A;  2ZH2 A;  2BKE A;  4RQ4 A;  4RWO A;  8ICQ A;  1EXN A;  3UXP A;  5DGB A;  1NK4 A;  3RR7 A;  2M2V A;  4O9M A;  4AT7 B;  4UQG A;  1TFY A;  2XGP A;  2HW3 A;  5TZV A;  2C2R A;  9ICF A;  5CJ7 A;  5HRL A;  4EBJ A;  1JIH A;  1SKS A;  4F5Q A;  3G6Y A;  1NO5 A;  4RT3 A;  4GXI A;  1DK2 A;  3HJ1 A;  2ZTC A;  4RWN A;  3BQ0 A;  1K1Q A;  4F50 A;  2C2E A;  2I1Q A;  2DRB A;  2NRW A;  5KFW A;  4F5R A;  2AGO A;  2BQU A;  1NKB A;  4FHP A;  3LWL A;  5KFE A;  4AT9 A;  5DQG A;  4EYI B;  5KT6 A;  7ICK A;  4QWB A;  3V6H A;  3FDS A;  2ASL A;  2M2T A;  4FH5 A;  1RYR A;  5KFJ A;  5KFI A;  3JPP A;  5HRI A;  4QZF A;  5HRF A;  1V4A A;  2ZH7 A;  3MDA A;  3UQ0 A;  3KHG A;  4NY8 A;  1DK3 A;  4QWE A;  2W9C B;  3TI0 A;  3V72 A;  2V4Q A;  3GQC A;  9ICO A;  1X9S A;  2ATL A;  7ICH A;  2M2W A;  3LDA A;  1BPX A;  4TUS A;  3MFH A;  2UVU A;  1COO A;  1ZQQ A;  2KP7 A;  1WCL A;  2JZB A;  4PHD A;  4FH3 A;  2BE3 A;  2ZUD A;  9ICA A;  2ZJ5 A;  3KHL A;  1MIW A;  4Q45 A;  5D49 A;  1ZQI A;  4J9R A;  3HWT A;  8ICX A;  3PX0 A;  1UEU A;  3H3A A;  7ICG A;  9ICQ A;  4QW9 A;  3B0X A;  1NKE A;  4RNM A;  3PX4 A;  1ZQB A;  5DB8 A;  3UPQ A;  1MC8 A;  3GIM A;  2JEI A;  4I2I A;  1NK7 A;  2GWS A;  4CCH A;  4WC0 A;  5KFB A;  2OWO A;  2BPC A;  5DBA A;  3HW8 A;  2AGP A;  2HHV A;  3H8J A;  5DG7 A;  1JN3 A;  3PV8 A;  1WCN A;  5IIJ A;  2DR8 A;  4PHP A;  4DOB A;  1BNP A;  1MIY A;  2JEF A;  1UEV A;  4J9M A;  5J0Q A;  1TK8 A;  5KT7 A;  3HIY A;  4EBC A;  5KFQ A;  4M47 A;  4DF8 A;  3Q8L A;  4C8L A;  3RTV A;  1QSL A;  1ZQJ A;  2V4R A;  2XY7 A;  5D4B A;  5KG3 A;  4QZ8 A;  4PHA A;  4QWC A;  4EBE A;  8ICN A;  4NKT A;  1ZJN A;  1SL1 A;  2UVW A;  4RQ2 A;  2ZH3 A;  1A77 A;  9ICM A;  3EYZ A;  4DS4 A;  1ZJM A;  1ZQU A;  4PGY A;  5F9N A;  4XA5 A;  5IIK A;  5CA7 A;  2PFP A;  1S9F A;  4TUP A;  4DFK A;  4FHY A;  1KFD A;  3C1Y A;  3HX0 A;  1NOM A;  2B21 A;  1RZT A;  4F3O A;  2HHP A;  3M8S A;  1SL2 A;  5KFR A;  4KIT B;  3T5K A;  3QE9 Y;  5BOM A;  1UA1 A;  4UB3 A;  7ICS A;  1B43 A;  4Z6C A;  3PML A;  4J9P A;  4RU9 A;  4X0B A;  2XCA A;  4KLL A;  5DB9 A;  5J2H A;  5J0X A;  1XS9 D;  3NGD A;  1IM4 A;  1S76 D;  4UD4 A;  2JEJ A;  1NK5 A;  2ZTD A;  2ZJ8 A;  5J2K A;  4WCW A;  4YXJ A;  1ZQF A;  5HHH A;  5KFU A;  4ELT A;  3MAB A;  9ICL A;  5HR9 A;  3SI8 A;  3RJG A;  2XCP A;  4C8K A;  4ECZ A;  2BCU A;  2HHQ A;  5DKW A;  4UAY A;  5HNK A;  3PVX A;  2ZH4 A;  4R66 A;  4GXJ A;  2BQR A;  1ZQH A;  2P6R A;  3ORY A;  3WFP A;  2XC9 A;  2Y1I A;  1TVA A;  4DFP A;  1XO1 A;  3UXO A;  4DS5 A;  2NRT A;  5IIM A;  4RNO A;  3OVB A;  1HUZ A;  3V7K A;  4DSF A;  1YLQ A;  4ATB B;  4DWI A;  4P2H A;  3UPS A;  2A1J A;  5HRE A;  4S3N A;  3KHR A;  4QZA A;  2FLP A;  2IA6 A;  5JUM A;  3Q8Q B;  1ZQA A;  4F4X A;  2PFO A;  3GFK B;  4YMM A;  1DOQ A;  3RR8 A;  4M9H A;  4X4R A;  2AQ4 A;  1JQR A;  3MR2 A;  4ED3 A;  3MBY A;  5DBB A;  3ISB A;  3OJU A;  3V6K A;  2RDI A;  3OVA A;  2KZ3 A;  2KZM A;  4TQS A;  8ICC A;  4E8F A;  3OUY B;  3GDX A;  1TV9 A;  1U9L A;  1C7Y A;  2HHS A;  1QLN A;  1IXR A;  8ICH A;  2ID1 A;  1TKD A;  1L3V A;  2BR0 A;  1RYS A;  1ZQC A;  3GV5 B;  3WFO A;  1ZQK A;  5CB1 A;  4O5K A;  1S0N A;  5EWF A;  4M2Y A;  4IR9 A;  2H5X A;  5J2E A;  5DLF A;  2PI5 A;  4ED0 A;  4YR3 A;  1Z3E B;  4JV0 A;  4I2H A;  4EZ9 A;  4DQR A;  3RAX A;  4KLD A;  3H38 A;  2ZH8 A;  4F5P A;  5KG0 A;  4ED6 A;  1ZQY A;  1NJY A;  4R8U A;  4WC1 A;  5HC9 A;  4MF8 A;  2DR9 A;  4BWM A;  3ZDB A;  4B9N A;  8ICS A;  2ASJ A;  4DL4 A;  2ZH5 A;  1U4B A;  3H4B A;  3ZDA A;  4KN7 A;  2ZUC A;  5HHI A;  4KMU A;  4UAZ A;  5DGA A;  1PX5 A;  4YD1 A;  4ED2 A;  8ICO A;  2AGQ A;  3RB3 A;  8ICJ A;  3JPQ A;  1XU4 A;  2F1J A;  5KG2 A;  3T5J A;  2R8J A;  3GIL A;  4KLG A;  5HRG A;  2IBK A;  1VJ7 A;  1Q79 A;  3ZD9 A;  1VFG A;  3MR5 A;  2XY6 A;  1LB2 B;  9ICU A;  4YXM A;  3RJJ A;  4BDP A;  2O5A A;  2F1I A;  4F91 B;  1HUO A;  2ZTE A;  4RPY A;  3MFI A;  1T3N A;  3LK9 A;  4RQ7 A;  1LV5 A;  1QTM A;  4BXO B;  4M0A A;  2KN7 A;  2C22 A;  3JPT A;  4KLM A;  1V9P A;  2XY5 A;  4ELU A;  4I27 A;  1B22 A;  3TFR A;  3C18 A;  4X4O A;  2O1P A;  4X4Q A;  4J9N A;  4I2J A;  9ICP A;  4HYK A;  4RUA A;  3HP6 A;  1ARO P;  4DLG A;  3RBE A;  4DQI A;  3NTU A;  4RT2 A;  2WTF A;  4BGD A;  4RQ6 A;  3K75 D;  2FMP A;  4MF2 A;  7ICL A;  4C8M A;  1U49 A;  3WFR E;  4FHX A;  4X4N A;  4M6W B;  1NJW A;  1L5U A;  3T3F A;  1D9F A;  5DDM A;  1HJP A;  4XQ8 A;  4DOC A;  9ICW A;  8ICW A;  7ICV A;  2BCS A;  4WC3 A;  3AU2 A;  4MEX A;  3RH4 A;  3PW7 A;  4NM1 A;  4KLH A;  3EPG A;  3ISC A;  4AT9 B;  3RJH A;  4DOA A;  4Q8F A;  5KT2 A;  2HHW A;  4PGQ A;  3RB0 A;  3M8R A;  4M9N A;  2DFL A;  3H37 A;  4R65 A;  3TAQ A;  5DBC A;  5J2A A;  3PO5 A;  4DEZ A;  4M04 A;  4NLN A;  7ICR A;  4PPX A;  5KFF A;  5DG9 A;  4IG8 A;  4O3P A;  2W9B B;  3BJY A;  4EYH B;  2PXI A;  2ZH9 A;  4DO9 A;  1ZQN A;  2RFF A;  3RB6 A;  2MUT A;  7ICE A;  5L1L A;  3TAR A;  2NRK A;  2AQ0 A;  5DEC A;  1NJZ A;  4PH5 A;  1R8A A;  4JUZ A;  2JZB B;  2FPK A;  4Q44 A;  3EW9 A;  3H8S A;  1NJX A;  4WBY A;  5EWG A;  1R8C A;  1UA0 A;  2UVR A;  8ICM A;  9ICI A;  3RH6 A;  5IIO A;  3BDP A;  9ICS A;  3PR5 B;  7ICT A;  1R89 A;  3UQ2 A;  2HHX A;  2XGQ A;  4C8O A;  1TFR A;  3H8W A;  1TAQ A;  3MR3 A;  3G6V A;  3SYZ A;  4ED1 A;  5F2V O;  5BOL A;  2FPM A;  4J9L A;  5KT5 A;  4B9U A;  9ICK A;  4TUQ A;  4B9S A;  4YVZ A;  4E0D A;  4RQ0 A;  4WC6 A;  2IMW P;  4KLI A;  1FA0 A;  3GV7 B;  4LZG A;  8ICT A;  5J2B A;  4DSK A;  4UB5 A;  7ICF A;  3MGH A;  3C2L A;  3GV8 B;  5KG5 A;  4YD2 A;  5CP2 A;  3PO4 A;  4I2E A;  1QSS A;  8ICZ A;  3THV A;  2J6T A;  4FHV A;  4AT8 A;  3OJS A;  4UB2 A;  4WC2 A;  1KDH A;  1JAJ A;  3H39 A;  4O3N A;  1SL0 A;  2R8I A;  5HRK A;  1OU5 A;  3M9N B;  4FBT A;  4KLQ A;  4IQV A;  5KFP A;  4DSI A;  3RRH A;  8ICP A;  2AU0 A;  4I2G A;  4QZH A;  3H40 A;  2R8G A;  4F2R A;  1S77 D;  4UD5 A;  4RPX A;  3C5F A;  5DB7 A;  1MQ3 A;  8ICK A;  1UT8 A;  3GIK A;  4PHE A;  9ICN A;  3RJF A;  1PZN A;  1KEJ A;  1N48 A;  1N56 A;  5J2J A;  3BQ2 A;  3AUO A;  1ZQT A;  7ICM A;  4YG2 A;  3HPO A;  1QSY A;  3EPI A;  4NXZ A;  1BPB A;  7ICJ A;  3C2K A;  1Z00 B;  3Q8S B;  8ICL A;  1NZP A;  3Q8P B;  5CR0 A;  4ELV A;  4YMN A;  4I2A A;  3BQ1 A;  4GC6 A;  1BVS A;  4DSL A;  4LZD A;  1KNY A;  3AQK A;  5DQH A;  1BPD A;  5KFY A;  3JPO A;  4XUS A;  3ZDD A;  4DL5 A;  3JPN A;  1JXL A;  4YP3 A;  7ICP A;  1ZQE A;  4J9K A;  5HP4 A;  4MEY A;  4NLG A;  4UBB A;  4F92 B;  8ICI A;  2NRZ A;  3BQT A;  4QW8 A;  4QZB A;  4I29 A;  4KLJ A;  1KSP A;  1KLN A;  3QZ7 A;  4XQ7 A;  4WC4 A;  2F1H A;  2RDJ A;  2KFZ A;  1TAU A;  1A76 A;  4F2S A;  3KTQ A;  3H7I A;  3PNC A;  4R63 A;  4MFC A;  4QWD A;  1U48 A;  5L9X A;  3OGU A;  1F5A A;  2A1J B;  4IR1 A;  4UB1 A;  2ASD A;  3E2E A;  4FO6 A;  5J0R A;  4O3S A;  2FPL A;  3MGI A;  2BHN A;  1CEZ A;  2ALZ A;  3RRG A;  1K1S A;  3EZ5 A;  3SZ2 A;  3RJI A;  4WC5 A;  3RH5 A;  4IQW A;  4P4M A;  2R8H A;  5J0U A;  4O3O A;  4J9S A;  5CWR A;  1T7P A;  3OHB A;  5C5J A;  5J0P A;  3V6J A;  1UT5 A;  5HMM A;  4M9L A;  4Q8E A;  1ZQO A;  1X9M A;  4QZ9 A;  4DQQ A;  2I9G A;  4YR2 A;  1MQ2 A;  3IM1 A;  4KLU A;  5J2I A;  3V7L A;  4IQT A;  1MSW D;  3N4M B;  2FMQ A;  3PR4 A;  1KFS A;  2HHU A;  5KFO A;  4Q43 A;  2BQ3 A;  7ICQ A;  1BNO A;  1T8E A;  5KFG A;  2DPJ A;  3KHH A;  4AT7 A;  3LQC B;  4RZR A;  3RJE A;  3WFS C;  3LWM A;  5J0W A;  4ED7 A;  1ZQR A;  8ICB A;  5HRD A;  4ECR A;  4R8U B;  4ECV A;  3C5G A;  2BGW A;  9ICB A;  2ZHA A;  4Z6E A;  5KFZ A;  2FMS A;  2FLN A;  1ZQV A;  4BXO A;  3N97 B;  4K4G A;  1ZQD A;  1S10 A;  3TQ1 A;  1KFT A;  4TQR A;  3OV7 A;  8ICA A;  3TAN A;  5KG4 A;  2V9W A;  5F9L A;  4KLO A;  4QZE A;  4EP7 A;  3V7J A;  4P4P A;  4GC7 A;  3C2M A;  2ISP A;  3ZD8 A;  1SKW A;  4WBZ A;  3PW4 A;  4ECQ A;  5J2C A;  1RXV A;  1JXE A;  4DSJ A;  4JWM A;  5KFN A;  4QZI A;  3PW2 A;  5J2F A;  3JYY A;  4QZD A;  2KTQ A;  1ZYQ A;  4RNN A;  4Z6D A;  2W9C A;  4M6W A;  4X0A A;  3C21 A;  3WFQ E;  4F4W A;  4RQ1 A;  4F4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...