4UB1A

Dna polymerase beta product complex with a templating adenine and 8-oxodgmp, 90 s
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
317
Chain Sequence
NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 99
structure length 317
sequence length 321
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub1A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub1A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub1A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub1A03
5KG7A 1N48A 9ICUA 2R8GA 1TFYA 2WTFA 4YP3A 4RZRA 1V9PA 3PW0A 4WC4A 4B9MA 4PHEA 3MR2A 3BQ1A 1NK0A 5KFUA 4RT3A 3RJHA 5KFSA 4QW8A 4O3NA 4ELVA 3ORYA 7ICNA 4YR3A 2KTQA 3OV7A 4ECWA 3FDSA 1ZQHA 1NOMA 5L1IA 4RQ3A 5HMMA 4O3PA 5KT2A 5HRIA 1WCLA 2PXIA 2V4QA 4WC3A 3V72A 3OHAA 3OVBA 5HRHA 1UETA 2KP7A 5DQGA 4RPXA 2ASJA 2FPKA 5KG4A 4X5VA 4M9NA 4M9GA 5DDMA 5F9NA 1TK0A 5KT3A 2IHMA 1RYSA 4KLEA 1NO5A 2FMQA 2PFPA 4KTQA 4DSEA 5HMLA 4XUSA 5J0UA 4RQ7A 4MEXA 2ZUCA 3V7LA 3C1ZA 5BOLA 1ZQMA 4C8OA 4NM1A 9ICCA 4RUCA 4EZ9A 4E7XA 4DFPA 2HHTA 3GIMA 3GV7B 4EYIB 3PMNA 3Q8SB 4GXIA 5KFCA 1NKEA 4IG8A 2KZ3A 2J6SA 4IR9A 4TQSA 5CJ7A 4DQIA 3RTVA 4O3RA 4UB1A 7ICUA 2PFNA 3UXPA 3PO4A 3RRGA 4RQ0A 2BCUA 4M6WA 5HNKA 2ZHAA 2XY5A 2XCPA 2ZH7A 3V6HA 2A1JA 4QWCA 3RJIA 1XO1A 5J2DA 1T8EA 4X0AA 3RAQA 5KFWA 2FLPA 8ICJA 4AT8A 3Q8QB 2DRAA 5J2EA 3H8WA 5DB8A 4C8MA 4R8UB 3TARA 4X4UA 2R8KA 1KTQA 2BKEA 4PGQA 5KFBA 2W9BA 2JEGA 3PR4A 3C5GA 4FHWA 5JUMA 9ICJA 3JZ0A 1Y88A 3V7JA 3C5FA 4BXOA 3MR6A 9ICNA 3RH6A 2ALZA 4DOCA 3MGHA 1R8AA 2I1QA 2DR7A 9ICFA 3ZDAA 5KFJA 1MC8A 5L9XA 7ICFA 9ICBA 3MGIA 3RAXA 3AQLA 3UPQA 2V9WA 3C66A 4YVZA 3M9MB 4B9NA 8ICLA 5L1KA 3TQ1A 3GDXA 2BPCA 1ZQWA 1NK8A 5F9LA 2NRWA 1ZQPA 2BCVA 5KT7A 4IQTA 4I2HA 3FYHA 3SV4A 1JN3A 3ZDDA 3EPGA 1BPZA 2ISOA 2XY7A 1OU5A 4MF2A 4Q44A 4I2AA 4Q8FA 2XCAA 2AGPA 2BPFA 5J0XA 2HHXA 1XU4A 4UB4A 2HHQA 4DFJA 2DFLA 3KHRA 4QWEA 1KDHA 4K4IA 3KTQA 1ZQZA 1BPYA 4DFKA 2HVIA 4DEZA 2NRZA 4YXJA 2PBEA 4RQ1A 2MAXA 5J0WA 3MFHA 3EWAA 4F5RA 5EWFA 1S0NA 5IIOA 5KFLA 1ZQAA 5DGAA 1U45A 1B22A 4AT7B 9ICTA 5KFHA 2FPMA 1BGXT 4R64A 5DB9A 3SV3A 4F3OA 4LVSA 3WFOA 4I2JA 4ATBB 4PGXA 2DR8A 3QEBZ 2ZJAA 2R8IA 4QZAA 4YFKA 3OJUA 3K4GA 4UBBA 4UQGA 1X9WA 5DQIA 2UVRA 8ICGA 4ED7A 1ZJNA 9ICXA 2DR9A 3NYBA 4M9HA 1JAJA 3QZ8A 2FPLA 3GFKB 4G3IA 3PW2A 2PFQA 3T5KA 2IA6A 5CR0A 3RRHA 4HYKA 2BR0A 5KG6A 4XQ7A 4DO9A 1TAUA 4NKTA 3BQ0A 4DL7A 1S0OA 4MFAA 3BQ2A 3T5JA 8ICZA 4PPXA 4JWNA 2FMPA 4MF8A 4F50A 3T3FA 2ZJ8A 8ICVA 3AQNA 4F5NA 4DQRA 5HP4A 4O3QA 4QZIA 2JZBB 1U4BA 2HW3A 4UD4A 1S0VA 5EWEA 4NM2A 2BCQA 3H40A 1L3TA 1EXNA 2W8KA 1X9MA 4FS1A 4KLTA 4J9KA 1NZPA 1K1QA 7ICTA 4RQ5A 4M9LA 5HHIA 1L3UA 3H7IA 1HJPA 3NTUA 4PGYA 4EYHB 1ZQNA 1ZQFA 1TFRA 1T4GA 4FHVA 4ZH4A 1Z3EB 4RQ8A 3M9NB 1NJYA 4O5CA 3TFSA 5DKWA 4YXMA 3SYZA 4YN4A 2M2UA 5KFZA 3LQCB 5DDYA 5DG9A 5KG2A 1HUOA 4RUAA 1QTMA 5F2VO 2ZUDA 1UEVA 3AQMA 4GXKA 2C2RA 5KG1A 3QZ7A 3AUOA 2ZH5A 5KT5A 4GXJA 1U47A 2PFOA 4ELTA 4AT9A 5HHHA 3HP6A 4WC6A 4GLXA 1Z00A 4QW9A 3Q8KA 4X4QA 2ZH6A 5DG7A 2Y1JA 5J2CA 2C22A 4KITB 4QZ9A 4DS4A 1SL1A 5EOZA 4KLHA 2AGQA 4X4TA 4DQPA 1NKBA 3M8RA 2C2DA 4C8NA 3C2MA 4J9NA 2H5XA 3UXOA 4I28A 5IINA 4Z6FA 3GILA 5L1JA 1ZQLA 4FHXA 4QZHA 2HHWA 4KLQA 4J9OA 3JPPA 3ZD8A 2W9AA 2OWOA 3QE9Y 1ZQIA 4UAYA 4E0DA 4UD5A 4DL6A 5DECA 4KLDA 3UPSA 3WFQE 4YR0A 5HRBA 3V6JA 4KLFA 3PX0A 3WFRE 1R8BA 2W9MA 5KFFA 2BCSA 4KLLA 7ICJA 4EBKA 4RWOA 4XQ8A 3LWMA 4EBDA 1C7YA 2W9CA 2VA2A 4YD2A 3MDAA 2BE3A 3WFPA 4YQWA 4C8KA 1TK8A 2ZH2A 4ECSA 3UQ0A 2M2WA 1NJZA 3ZDCA 2XO7A 4QZ8A 1ZQTA 2FLNA 4ECXA 4JV2A 1ZJMA 3RH5A 1S97A 4DSIA 4RWPA 3RBDA 5J2HA 4Z6DA 5KFXA 2O1PA 3T5LA 1X9SA 3TAPA 5IIIA 1ZQBA 7ICEA 1QSYA 2DPJA 5TZVA 5J0RA 5EWGA 5BPCA 2BCRA 3B0XA 4P2HA 4P4OA 4C8LA 3KHLA 3RR7A 2JEJA 8ICTA 4M6WB 4I2BA 5HRGA 2DVIA 3K75D 4DF8A 3ISCA 3KHHA 4FO6A 2A1JB 4MFCA 3H38A 4EEYA 4KLUA 2ZTCA 4YCXA 3HJ4A 3TAQA 1QLNA 2Q0ZX 3OVSA 4RNMA 4B9UA 3UXNA 3GQCA 4ECTA 2HVHA 3HJ1A 5KFVA 2RDIA 4RQ4A 7ICVA 7ICHA 3PW7A 1ZQGA 4WC5A 3H39A 4MEYA 2W9BB 2ZH8A 3ETLA 2UVWA 4F4KA 1UEUA 4DFMA 4ECUA 2R8JA 3ZD9A 4J9QA 4K4HA 4F8RA 4RU9A 4UAZA 3EZ5A 4BXOB 2ID1A 4ECQA 5DLGA 4QZGA 4X4PA 5KFTA 1A77A 4I27A 4M0AA 1SKWA 4EZ6A 2BQUA 4IRKA 1ZQJA 1N56A 4DWIA 1MIVA 5L1LA 4ECYA 5HRFA 4S3NA 1NK4A 4RPZA 1S76D 1TFWA 4YMOA 2J6UA 2F1HA 3RR8A 4BDPA 4KLMA 2VANA 5KG3A 4O0IA 4EBJA 9ICSA 1TV9A 3G6VA 4RPYA 2IMWP 4WC7A 5IIKA 1MQ3A 4QZEA 2V4RA 1S9FA 2XC9A 7ICOA 5HRLA 1AROP 3AU2A 3BJYA 4I2CA 2GWSA 1ZQQA 3Q8PB 2AQ4A 9ICRA 2RDJA 2PI4A 4X4RA 1IM4A 1TVAA 4XA5A 9ICEA 4MFFA 3BDPA 1ZQXA 3EYZA 1KFTA 5KFDA 4AT7A 5DLFA 1D8YA 4DL4A 4PHAA 2KZZA 3RBEA 2DRBA 5KFRA 1TAQA 3HWTA 3N4MB 3RJJA 4E80A 7ICPA 1F5AA 1PX5A 1ZQCA 2UVUA 4TUPA 1QSSA 1PZNA 7ICRA 5KFPA 4J9RA 2FMSA 4KLJA 1KRPA 4PHDA 5CA7A 5DBAA 1R89A 3SZ2A 2Y1IA 1KSPA 4DLEA 4F92B 4NXZA 2BQ3A 1B43A 2F1JA 5D49A 3ZDEA 8ICYA 1DGSA 3PY8A 2LYHA 4FBTA 3LWLA 2AGOA 1X2IA 1L3SA 1L5UA 5CB1A 1RXVA 1DK3A 4QWAA 9ICOA 1KNYA 2RFFA 1Q78A 3OUYB 2BHNA 4F4WA 1TKDA 3PNCA 1A76A 1NK7A 5DB6A 9ICLA 3JPRA 3PR5B 4ECRA 4DQQA 3T5HA 3HX0A 3C18A 2MUTA 4ED3A 3RJGA 4YMMA 3THVA 1SL2A 4F5OA 1D8LA 3H4BA 4QWDA 4ECZA 3N97B 9ICPA 5CP2A 1JQRA 1BNPA 4UB5A 5D4BA 4IRCA 4PHPA 8ICPA 3Q8MA 3JYYA 3LDAA 3TFRA 2XY6A 3PX4A 5HREA 1MIYA 4WCWA 4X4OA 1XSPA 9ICKA 3UQ2A 4Q8EA 1JIHA 4ELUA 2HHVA 2J6TA 5J2AA 1XSLA 4B9SA 2B21A 3IM1A 5DQHA 4F2RA 4BWJA 7ICKA 3HIYA 4ED6A 3PVXA 5J2KA 3OSNA 1SZPA 5J0YA 1BPXA 8ICWA 5HC9A 1S0MA 4QWBA 4UBCA 4I2FA 1SL0A 3Q8RB 9ICQA 2ZH3A 1UA1A 5KTQA 1ZQVA 3H4DA 3EW9A 4Z6EA 4IQUA 4J9PA 4KMUA 2XGPA 3QEAZ 5HRDA 2VA8A 1WOTA 3WFSC 4DLGA 1XWLA 4B9LA 4O5EA 4ED8A 5KFYA 4F91B 3E2EA 5KFMA 1CEZA 4DSFA 4AT9B 8ICSA 3HT3A 4IQWA 2UVVA 1Z00B 8ICIA 2IBKA 2I9GA 1ZQSA 3PMLA 4DL5A 3KHGA 3GIKA 1DK2A 2HHUA 4RWNA 5J0OA 4J9SA 2C2EA 3JPQA 4QZFA 1NK5A 1NK6A 2ISPA 4K4GA 3L9DA 4IR1A 8ICNA 4Z6CA 4DL3A 4KLOA 3Q8LA 3RJKA 2ATLA 3ZDBA 1JXLA 4WBZA 4J9MA 3RB6A 1MQ2A 4F93B 4BWMA 4X4NA 4BGDA 3PX6A 5HRKA 5KG0A 4M04A 3H8JA 4I29A 3C2KA 3B0YA 2HHPA 2Q66A 3OGUA 5CHGA 2ZH4A 4O5KA 4KLSA 7ICMA 1FA0A 3OHBA 1H38A 2ZHBA 3H8SA 4I2GA 5DB7A 2BGWA 2JEFA 4KLIA 4I2DA 1MSWD 8ICFA 3SI8A 4JWMA 1QSLA 1SKSA 7ICQA 1SKRA 2C28A 2M9NA 4R63A 3PW4A 1LV5A 2DPIA 2W9CB 4M9JA 1BNOA 9ICHA 4M47A 1V4AA 4I2EA 4M5DA 4R8UA 1ZQOA 4JUZA 3PW5A 3HW8A 5CWRA 5J2GA 4Q43A 2W8LA 8ICEA 4LT6A 1JXEA 4DF4A 1K1SA 4QZBA 4YR2A 3MFIA 4B9TA 4IQVA 3C2LA 4O3SA 4NLNA 4EBCA 4AT8B 2PI5A 5KFAA 5DBCA 4UB3A 1RPLA 1XS9D 5KT4A 3JPNA 4DL2A 1BPBA 5KFEA 5KFKA 3HPOA 3RH4A 4P4MA 4FH5A 1RYRA 1R8CA 5J0TA 2DR5A 2ASDA 1ZQUA 9ICVA 1ZYQA 2BDPA 4YMNA 2HHSA 4KN7A 2M2VA 5KFNA 2O5AA 4DQSA 1BPDA 1KEJA 3EPIA 9ICGA 4TQRA 4DSLA 1S77D 2AQ0A 1JX4A 3OVAA 5DG8A 1CUKA 3GIJA 4NY8A 8ICCA 5J2FA 3LK9A 4RWQA 1T7PA 5KG5A 3RJEA 5DBBA 4NLKA 3PO5A 4F4YA 1RXWA 3RB3A 8ICAA 4TUSA 2NRKA 4O3OA 8ICUA 1ZQRA 2NRXA 5J0PA 3V6KA 1IXRA 4F5QA 5IILA 3TI0A 1S10A 3H3AA 4TURA 4M2YA 3AQKA 2ZH1A 4P4PA 3MABA 2NRTA 4LZGA 1YLQA 2P6RA 1VFGA 4RT2A 5KFGA 3GV5B 4ED1A 1COOA 4QZDA 1ZQDA 5J0QA 5KT6A 5KFOA 1NJWA 2VA3A 4O9MA 7ICIA 7ICLA 4DOBA 3GIIA 5KFIA 8ICQA 2ZTEA 3G6XA 1NKCA 5IIJA 3ISDA 4DS5A 4JV1A 2FLLA 7ICGA 2M2TA 5J2BA 8ICOA 3C21A 2NRVA 3H37A 2KZMA 5D46A 2BQRA 3NGDA 4ED2A 2ZH9A 2IHNA 9ICAA 8ICKA 8ICMA 4ATBA 2JEIA 4RQ6A 4EBEA 4I2IA 4RNNA 2ASLA 8ICXA 4EP7A 4X4SA 1D9FA 3RB0A 1ZQEA 2ZUBA 4F5PA 1HUZA 2AU0A 4F2SA 1LB2B 5HR9A 5J2JA 3M8SA 1JMSA 4GC7A 4UB2A 4R65A 4F4ZA 2BPGA 4JK1A 4GC6A 4B9VA 4NLZA 4ED0A 1U9LA 1UT8A 2XGQA 1KFDA 5J2IA 1T3NA 3JPOA 3JPTA 4FBUA 5BOMA 8ICHA 1Q79A 3ISBA 4J9LA 4FHPA 4WC2A 1DOQA 4FH3A 2JZBA 4QZCA 1VJ7A 3C23A 4Q45A 4UAWA 1U49A 1TK5A 2P6UA 1MIWA 3V7KA 4WC0A 3MR3A 3C1YA 1ZQKA 2KN7A 1UT5A 9ICWA 4PH5A 3RJFA 3JPSA 4R66A 4XRHA 4NKUA 4RQ2A 1U48A 3MDCA 4CCHA 5DGBA 1XSNA 4KN4A 4F4XA 1BPEA 3G6YA 7ICSA 3PV8A 4YG2A 9ICIA 4X0BA 4DOAA 5IIMA 2F1IA 5KFQA 3TANA 1NJXA 1KLNA 4DSJA 4IRDA 8ICBA 9ICMA 5DEDA 4E8FA 4TUQA 1RZTA 4JV0A 1L3VA 1D9DA 1UA0A 2P66A 4KLGA 4X4VA 3M9OB 1ZQYA 3MR5A 2R8HA 4ECVA 3RB4A 5J0SA 8ICRA 5C5JA 2MUTB 2AJQA 4RNOA 4WC1A 3OSPA 2KFZA 4WBYA 3BQTA 3MBYA 3OUYA 3AU6A 4FHYA 1NK9A 2ZTDA 3IHQB 3OJSA 1WCNA 1XC9A 4LZDA 4NLGA 3GV8B 1ZETA 4DSKA 2ZJ5A 2KFNA 4YD1A 1KFSA 5J29A 1BVSA 4FS2A
chains in the Genus database with same CATH superfamily
4CDGA 2YMLA 3AQFA 5AKGA 4EV6A 1V9PA 2EDUA 4C4TA 3MR2A 4B9MA 2JR5A 1SV0C 4RT3A 3ORYA 4UB6U 7ICNA 3OV7A 1NOMA 2JHDA 4Y2PA 1WCLA 3V72A 2YMQA 5DQGA 3MCRA 4X5VA 2DKZA 1TK0A 5KT3A 1RYSA 1WYGA 3GZFA 5HMLA 4XUSA 4MEXA 1ZQMA 2ZUCA 5BOLA 3WKDA 4IS7A 2HHTA 3WK4A 3EF2A 5KFCA 5CJ7A 2LYBA 3N7SC 2OH2A 7ICUA 1RQLA 4RQ0A 2ZHAA 3RJIA 1KW4A 2W43A 2FLPA 1SIJA 2F3NA 4X4UA 3H8WA 5DB8A 5ALQA 5KFBA 1RDFA 9ICJA 1PK3A 1Y88A 4BXOA 9ICNA 2KJ8A 3NVYA 5L9XA 7ICFA 3RAXA 8ICLA 5L1KA 3TQ1A 4FZNA 1NK8A 2NRWA 4IQTA 1XO0A 4OAGA 1BPZA 1QCKA 4MF2A 2AGPA 2BPFA 2HHXA 1XU4A 4UB4A 4JLXA 2DFLA 1KDHA 1K5OA 5KNIA 4DFKA 4DEZA 2LKYA 9ICTA 5IIOA 4GFJA 5AHXA 2KICA 2RP5A 2D3DA 1UCVA 2HSZA 3QEBZ 2NYVA 4QZAA 4YFKA 8ICGA 1ZJNA 3NYBA 4P0PA 3QZ8A 3PSPA 3PW2A 5CR0A 4HYKA 1PVPA 1S0OA 8ICZA 2FMPA 3T3FA 3AQNA 4F5NA 4O3QA 4QIWC 2BCQA 1L3TA 4U7CA 2W8KA 4OD0A 4RQ5A 4M9LA 1L3UA 3H7IA 2Q4TA 1ZQNA 1TFRA 1SXEA 3F2DA 4FHVA 1Z3EB 4RQ8A 3AMZA 2PKEA 2ZXHA 3M6ZA 4YXMA 2M2UA 2IHOA 5DDYA 5KG2A 4AYBF 2DL0A 4Y2VA 4Y2JA 3HKZC 4WC6A 4QW9A 2WHEA 5J2CA 2C22A 1PVQA 4QZ9A 3H0MB 4KLHA 4X4TA 2ZIUA 4DQPA 5CEHA 3M8RA 3C2MA 4J9NA 2QARB 1ZQLA 2BDUA 4J9OA 2EAPA 3PSIA 5AI8A 3QE9Y 4XJEA 1HIWA 3WFRE 1R8BA 4EBKA 4XQ8A 2VA2A 3MDAA 4C8KA 3UQ0A 3SMVA 1ZQTA 1ZJMA 4Z6DA 5KFXA 5IIIA 1QSYA 2MU2A 4CNQA 4P4OA 4C8LA 1ZD5A 8ICTA 4M6WB 4I2BA 5HRGA 3ISCA 3KHHA 2YX8A 3S6JA 4YCXA 3HJ4A 1T3QA 4B9UA 1ECWA 3HJ1A 2WAQC 3UMGA 4RQ4A 3CYMA 3H39A 2W9BB 2CPRA 2Z7JA 2VKQA 4F4KA 1UEUA 4JLZA 4DFMA 2R8JA 3ZD9A 5AM2A 4F8RA 4RU9A 2ID1A 4ECQA 2LPEA 1A77A 2BQUA 1MIVA 5L1LA 4YMOA 4BDPA 2F1HA 3ALRA 5KG3A 3NVWA 4EBJA 3G6VA 4WC7A 1SV0A 3U26A 2V4RA 1S9FA 2F2AB 5HRLA 1FIQA 2FJ6A 2GWSA 4JB3A 4MFFA 1JALA 1X6JA 5KFDA 3CW2C 2DRBA 3HWTA 5CHEA 1ZQCA 1QSSA 1PZNA 2QB1A 2KSOA 5KFPA 5CA7A 1KSPA 1J97A 4NXZA 2B0CA 3VC8A 1B43A 3ZDEA 3LWLA 2AGOA 1FO4A 2ESEA 1L3SA 1KNYA 1O03A 5B5EU 2YB4A 2DF4B 1L7PA 4P0QA 4ED3A 2K60A 4ECZA 1NNLA 1JQRA 1WG8A 3CK6A 2XI9A 2E5SA 1DRGA 4WCWA 3NVZA 9ICKA 3UQ2A 5J8YC 4ELUA 1JI7A 5J2AA 4B9SA 3IM1A 5DQHA 3HIYA 4FO1A 3PVXA 1BPXA 3OSNA 2Y0SF 4I2FA 4QWBA 9ICQA 5KTQA 3H4DA 3EW9A 4J9PA 5HRDA 5AKJA 3WFSC 3B9JA 2KD1A 5KFYA 4F91B 4DSFA 8ICSA 2UVVA 2IBKA 2QB0B 5AKEA 2N1RA 5AIBA 1YT3A 2ISPA 3L9DA 8ICNA 3E58A 4WBZA 1JXLA 5HRKA 2QLTA 2IUBA 3OGUA 2ZH4A 5AI4A 3OHBA 1H38A 1MSWD 5DB7A 2BGWA 4KLIA 8ICFA 4I2DA 1QSLA 1SKSA 1SKRA 3KD3A 2M9NA 1BNOA 2C28A 1LV5A 2W9CB 9ICHA 1V4AA 2KMDA 4LT6A 2K4HA 3MFIA 3R9KA 5KFAA 3JPNA 3F53A 1BPBA 2G07A 5CRXA 2ASDA 3TACB 9ICVA 2BDPA 1HEKA 2M2VA 9ICGA 8ICCA 3LK9A 4RWQA 5AIAA 4O3OA 2NRXA 5J0PA 5IILA 4F5QA 2WF5A 3H3AA 2KKVA 1YLQA 2NRTA 4RT2A 1C20A 5KFIA 8ICQA 3G6XA 3ISDA 4DS5A 3IV6A 5J2BA 8ICOA 2EH9A 2NRVA 2KZMA 5D46A 4AYBC 2IHNA 2JEIA 1UQVA 4EBEA 3UMCA 2DBYA 3RB0A 4F5PA 2Y9TA 2AU0A 5HR9A 2YQEA 5J2JA 5CFSA 3SD7A 4FBUA 4NXUA 8ICHA 3ISBA 4O3MA 4FH3A 2BZFA 2OYYA 5AI6A 5KAIU 3FM9A 1COKA 1SXDA 1MIWA 3QU9A 3MR3A 2KN7A 1UT5A 2KG5A 2B51A 1JROA 1XSNA 3G6YA 5AI9A 4DOAA 9ICMA 1NJXA 4EEKA 4IRDA 8ICBA 3H8MA 2LHTA 4JV0A 3QXGA 5F3XB 2P66A 4KLGA 1LVHA 4X4VA 3MR5A 4ECVA 3RB4A 5C5JA 3A0HU 5ALTA 3KKAC 2HOIA 1IV8A 1NK9A 1WCNA 2LI6A 4LZDA 2KFNA 2EAMA 3DDHA 1YZ7A 1ZOLA 2H3QA 2OCEA 3PW0A 4WC4A 3RJHA 4ELVA 4O3NA 2W7OA 2WFAA 2WF8A 2KTQA 4ECWA 1ZQHA 3NKUA 5HMMA 2QARA 1Q46A 2V4QA 4WC3A 3OHAA 1NZBA 5HRHA 4LEYA 2FPKA 5KG4A 5F9NA 2IHMA 4KLEA 2PFPA 4FE3A 4K9AA 2G5IB 2KK0A 4RQ7A 3T79A 9ICCA 3HRDD 3WK8A 4E7XA 4Y2RA 3GV7B 5H2FU 4EYIB 4IG8A 3K1ZA 3BZCA 2J6SA 3KZIU 4TQSA 3RTVA 1D8BA 4UB1A 3IG8A 2PFNA 2BCUA 2AH5A 2HN2A 4M6WA 5HNKA 1N62A 2XCPA 4CRXA 1RG6A 3V6HA 4QWCA 1XO1A 5J2DA 4GIBA 2R8KA 2BKEA 4PGQA 2W9BA 2JEGA 3PR4A 4FHWA 1S8OA 2OM6A 3MR6A 2KVCA 2E3TA 4DOCA 5KAFU 1R8AA 1OW5A 9ICFA 9ICBA 4NLCA 3UPQA 3C66A 1J2MA 2W55A 4B9NA 3NRWA 5J8YA 2BPCA 2BCVA 5T14A 3SV4A 3ZDDA 2ISOA 1QQ7A 4Q8FA 5L1MA 5J0XA 2HHQA 4DFJA 3KHRA 1AQ6A 3KTQA 1RM6C 2A19A 3D2SA 4NLBA 2FDRA 1S0NA 5EWFA 2LM1A 4NL9C 2OXOA 5KFHA 4B6JA 4R64A 3SV3A 3WFOA 1PVRA 5ALMA 2R8IA 5TISU 4WJ3B 4NJ8A 2KSOB 3K4GA 5G5GA 4UBBA 3M7DA 4UQGA 2UVRA 2DQNB 9ICXA 2DUYA 4M9HA 4G3IA 2PFQA 3RRHA 4DO9A 4NKTA 3BQ0A 4DL7A 3BQ2A 2PMZF 2AXTU 2CXYA 4DQRA 5HP4A 1U4BA 4UD4A 2HW3A 5AM0A 1V97A 4FS1A 4KLTA 5HHIA 3NTUA 4EYHB 4UW9A 1T4GA 4UASA 2RRDA 5ALWA 5DKWA 3ZI4A 5KFZA 4US8A 4GXKA 3L5KA 5AM3A 3QZ7A 3RFAA 2ZH5A 4GXJA 5HHHA 4GLXA 2ZIXA 5DG7A 2QB0A 4DS4A 4EGWA 3WKCA 2C2DA 2A3VA 4I28A 3A0BU 4Z6FA 2AHOB 3GILA 1L7OA 1WUDA 3ZD8A 4KM5A 4PZNA 4E0DA 3UPSA 4YR0A 5HRBA 2G5HB 2W9MA 5KFFA 1IIPA 2W9CA 5KL1B 2XICA 4YD2A 2BE3A 4YQWA 1TK8A 2XO7A 1Z1VA 4JV2A 3RH5A 4DSIA 4OO1J 3RBDA 2XIDA 5ALSA 2O1PA 1X9SA 3TAPA 7ICEA 1ZQBA 5D63A 5TZVA 5EWGA 5ALYA 4LEZA 3KHLA 4DF8A 2A1JB 4EX6A 4K99A 4EEYA 3TAQA 3O0FA 3OVSA 1Z4NA 4ECTA 3GQCA 2HVHA 3SR6A 2RDIA 4MEYA 2W3SA 4ECUA 2EZXA 4OJ5A 5ALUA 4MHVA 3WU2U 4IRKA 5JTGA 2DKXA 3KKAA 1TFWA 2J6UA 2ODGA 2VANA 1F5SA 1TV9A 4RPYA 2WB1F 5IIKA 4QZEA 1AROP 3AU2A 4I2CA 2EANA 4KX5A 1SB3C 4OAFA 1IM4A 5JTIA 2OHFA 1TVAA 3BDPA 1ZQXA 1KFTA 5DLFA 2W11A 4EELA 4DL4A 4PHAA 1D8YA 5JU5A 2KZZA 4O69A 1TAQA 4PJ0U 7ICPA 1F5AA 1PX5A 2JMGA 5ALKA 4TUPA 4WQLA 4KLJA 4PHDA 1R89A 3SZ2A 3QU4A 2Y1IA 2BQ3A 4OJ6A 5D49A 8ICYA 1DGSA 3PY8A 3WKAA 1X2IA 1L5UA 2EQYA 3ER8C 5AKKA 3OUYB 2BHNA 1Q3VA 4F4WA 2WF6A 2G0AA 3PR5B 3T5HA 1RYUA 3RJGA 3THVA 1SL2A 9ICPA 3N97B 5CP2A 5ALZA 5ALDA 1BNPA 4OAHA 4WOYA 2XY6A 3PX4A 1XSPA 1JIHA 2HHVA 2KNJA 2B21A 4F2RA 7ICKA 4BWJA 4ED6A 3D2QA 8ICWA 1S0MA 2ZH3A 3Q8RB 4Z6EA 4IQUA 4KMUA 2KJ9A 3E2EA 1CEZA 2KHVA 3HT3A 1ED1A 2IOFK 8ICIA 4UARA 1Q8KA 1QQ5A 2I9GA 3PMLA 3QUBA 4UAUA 2HHUA 2C2EA 4RWNA 1LKYB 2BBHA 4IR1A 4Z6CA 4FZLA 4KLOA 3ZDBA 3WKBA 3PX6A 4M04A 3H8JA 3C2KA 5AICA 4NL9A 2Q66A 2FCLA 7ICMA 1FA0A 3H8SA 4I2GA 1DXSA 2O6KA 2JGAA 4R63A 2HOFA 4M47A 4M5DA 5B3QA 5CWRA 4HX0A 1JXEA 3WK5A 4QZBA 4DF4A 4YR2A 4B9TA 5K4LA 1RPLA 3QU7A 4LEWA 1VLBA 3RH4A 1RYRA 1F44A 1A0PA 5KFNA 2JV3A 4EENA 1N2XA 2GLEA 1CUKA 2PMZC 5J2FA 2VIXA 1T7PA 4NLKA 2G06A 3TI0A 1S10A 4M2YA 2B6GA 4LZGA 4ED1A 4QZDA 1ZQDA 5J0QA 5KT6A 2VA3A 4O9MA 7ICIA 3PZPA 2ZTEA 4JV1A 5IIJA 7ICGA 2M2TA 1ZD4A 3C21A 3H37A 3NGDA 3CNHA 4ED2A 5AKXA 8ICKA 2E8MA 4OJLA 8ICXA 1TE2A 2ZUBA 3IDWA 2HMXA 4NXTA 1LB2B 4UB2A 4F4ZA 4NLZA 1UT8A 1T3NA 4FHPA 1Q79A 4WC2A 4QZCA 1VJ7A 1TK5A 2P6UA 4NV0A 3OWGA 9ICWA 4PH5A 3RJFA 4NKUA 3MDCA 4CCHA 1BPEA 4YG2A 9ICIA 5IIMA 5KFQA 5DEDA 4TUQA 1RZTA 1UA0A 3M9OB 2R8HA 5J0SA 2AJQA 3I1YA 4RNOA 3BQTA 3OJSA 4NLGA 3ONNA 5KG7A 2R8GA 2JH1A 4RZRA 3BQ1A 1NK0A 5KFUA 3BQ7A 2ZIXB 2HDOA 5L1IA 4O3PA 1N60A 2ASJA 3D2NA 1S5LU 4M9GA 5DDMA 2FMQA 2ZIWA 4KTQA 4DCCA 3KZXA 4C8OA 4RUCA 4EZ9A 2DWQA 3NWIA 4DFPA 4KX3A 3Q8SB 4GXIA 2F8KA 5GTHU 5KL8B 4DQIA 3UXPA 3PO4A 3RRGA 2A1JA 1T8EA 1J2NA 4C7YA 4AT8A 3Q8QB 5J2EA 3TARA 4C8MA 4R8UB 1GO3F 2HCFA 3C5GA 5JUMA 1Z1BA 5ALJA 3JZ0A 3C5FA 2K4PA 4A8EA 3MGHA 3NVOA 3ZDAA 3BS5B 3UM9A 1MC8A 3C28A 1X40A 3AQLA 2V9WA 4YVZA 4OCZA 3GDXA 3LYSA 5F9LA 1B0XA 5KT7A 1L8OA 4I2HA 3FYHA 5EE1A 4NXXA 4QWEA 4OAIZ 1ZQZA 1BPYA 3HJEA 2HVIA 5EE3A 2NRZA 4YXJA 4RQ1A 2MAXA 2J6TA 3MFHA 4UAVA 1ZQAA 5KFLA 5DGAA 1U45A 4Y2UA 2FPMA 4C0ZA 2NV3A 5DB9A 3AQEA 4I2JA 4ATBB 4PGXA 2DR8A 2ES6A 2ZJAA 1X9WA 5DQIA 1JAJA 3GFKB 3OUYA 3T5KA 3E0FA 5KG6A 4MFAA 4PL2A 4MF8A 5ALNA 4QZIA 2JZBB 3TKAA 1S0VA 1MN8A 4NM2A 3H40A 1NZPA 1X9MA 3SAHA 4IL6U 2B4VA 3N7PD 4C7ZA 4ZH4A 3FAHA 5ALLA 1NJYA 3TADC 4O5CA 3TFSA 4AP9A 3SYZA 4YN4A 2I5HA 5DG9A 5AK6A 5CFTA 4WQKA 5KT5A 1U47A 4ELTA 1M6YA 4US9A 4X4QA 2W03A 2ZH6A 2Y1JA 4BUGA 4KITB 1LKYA 2AGQA 1FEZA 1X42A 1O08A 2DGZA 5IINA 2BBJA 4FHXA 4QZHA 2HHWA 5AI0A 5AK4A 4KLQA 3JPPA 2OWOA 1ZQIA 4UAYA 3V6JA 4KLFA 3PX0A 5AM1A 4K9BA 2BCSA 7ICJA 4NXVA 2RHFA 4RWOA 3LWMA 5ALEA 4QIWF 3WFPA 4ECSA 2M2WA 3ZDCA 4QZ8A 2FLNA 4C4SA 1S97A 4RWPA 4USAA 5J2HA 3IP4B 2HBLA 2DPJA 1A6SA 4IC9A 5BPCA 4P2HA 3L4PA 1SWVA 1N5WA 4FO6A 3CRXA 3H38A 2ZTCA 4Y2QA 1QLNA 4RNMA 2W3RA 3ICXA 3K7DA 2H3ZA 3UXNA 3HKZF 2XVTA 7ICVA 7ICHA 1ZQGA 3KBBA 4K4HA 4C80A 3H0RB 4X4PA 4QJFB 1SKWA 1ZQJA 1N56A 4DWIA 3KOOA 4ECYA 5AK5A 5HRFA 4S3NA 1NK4A 4RPZA 1S76D 2I6XA 1QQ6A 1X9XA 5AI5A 2IMWP 1MQ3A 2R18A 4MKPA 2XC9A 7ICOA 3SENA 4O68A 2Y0SC 3Q8PB 2AQ4A 9ICRA 2RDJA 2PI4A 4X4RA 1SWWA 3LVWA 9ICEA 3EYZA 4AT7A 2HOQA 3RJJA 5ALOA 2RLTA 3NVVA 2UVUA 2G08A 2IOHA 7ICRA 1KRPA 3OTQA 4Y2YA 2E1FA 2KIWA 2F1JA 1T94A 4JMUA 4FBTA 5CB1A 1DK3A 2WAQF 1SV4A 1TKDA 3SQIA 2EAOA 9ICLA 4DQQA 4ECRA 3C29A 2Y9UA 4Y2SA 3I28A 3C18A 5G5HA 2ZIVB 4F5OA 1D8LA 2G09A 4UB5A 5D4BA 3LDAA 3TFRA 4Q8EA 2HBKA 1B4FA 3BZKA 4UATA 3GU3A 1L7NA 5J2KA 5J0YA 5HC9A 1SL0A 3MC1A 1UA1A 3QEAZ 2XGPA 2VA8A 3F5EA 4B9LA 1XWLA 4ED8A 2YMMA 5KFMA 4AT9B 3NUQA 1Z00B 3ED5A 1ZRMA 1ZQSA 4DL5A 1N63A 3KHGA 5J0OA 3JPQA 1WWVA 4QZFA 1NK5A 4K4GA 4DL3A 2ZIWB 2A1AA 3EUB2 2K4IA 4PZOA 3RB6A 1MQ2A 4F93B 2KEYA 4BWMA 5KG0A 2JRZA 1CRXA 5D61A 4K97A 4EEDA 4O6AA 5EE0A 3NRZA 4O5KA 5JRTA 3SI8A 4NXWA 3I76A 2DPIA 4M9JA 4R8UA 5J2GA 4Q43A 2W8LA 1K1SA 3C2LA 4EBCA 4AT8B 2PI5A 1XS9D 3HPOA 5KFKA 4P4MA 5J0TA 2DR5A 1ZQUA 1ZYQA 3BS5A 4KN7A 1ZRNA 4DQSA 2YB1A 1BPDA 3EPIA 2CRXA 1UPHA 2AQ0A 3OVAA 4F72A 3GIJA 2E8PA 5KG5A 5DBBA 3PO5A 2WF7A 3MGVA 1RXWA 2D6FC 2HBMA 2JXJA 2NRKA 5AKZA 3TADA 1ZQRA 8ICUA 3V6KA 3FC4A 3AQKA 2ZH1A 4P4PA 3MABA 3GV5B 5GTIU 4Y2XA 1NJWA 7ICLA 1NI3A 4N7RA 3GIIA 1NKCA 2GOLA 1L7MA 2BQRA 4ATBA 4RQ6A 4LEVA 4X4SA 2NO5A 4EP7A 1RQNA 2VJ5A 3M8SA 1TAMA 4GC7A 3WFQE 2BPGA 4B9VA 4GC6A 3QNMA 4BJQA 2XGQA 1KFDA 2E8OA 1ZQ1C 2JZBA 3C23A 4UAWA 1U49A 3PHZA 2YY6A 2GO7A 3C1YA 4UB8U 1ZQKA 3JPSA 4XRHA 4RQ2A 1U48A 4KN4A 2MSNA 3J81j 7ICSA 3PV8A 2NO4A 5B3PA 4RQMA 2F1IA 1KLNA 2L5YA 4E8FA 3LVVA 3WKEA 1ZQYA 8ICRA 2MUTB 4NWIA 2KFZA 2LBOA 3MBYA 3AU6A 5EE9A 2ZTDA 3IHQB 1XC9A 5AKHA 4DSKA 4YD1A 5FP0A 1KFSA 5ALXA 5J29A 1BVSA 4FS2A 9ICUA 1N48A 3AEVA 1TFYA 2WTFA 4YP3A 2HI0A 4PHEA 5KFSA 4QW8A 1URJA 3IG5A 4YR3A 3FDSA 4RQ3A 5HRIA 5KT2A 3OPXA 4I0UA 2PXIA 1X6IA 3OVBA 1UETA 2KP7A 4RPXA 5C0YA 3DV9A 4M9NA 3HILA 3QU2A 4K98A 1PK1B 4DSEA 2EWRA 5J0UA 3V7LA 3C1ZA 3AN1A 4U6PA 4NM1A 4F71A 1Q3UA 3M1YA 3GIMA 3PMNA 1NKEA 1KN5A 2KZ3A 4IR9A 2K8BB 4O3RA 1V85A 4K96A 2XY5A 2ZH7A 4X0AA 3RAQA 5KFWA 8ICJA 2DRAA 1KTQA 2KIVA 2B56A 3V7JA 5ALIA 3RH6A 3BS7A 2JH7A 2KVSA 2ALZA 2I1QA 2W7PA 2DR7A 4EX7A 3KFUF 5KFJA 2F76X 2MA1A 1PUZA 3MGIA 3M9MB 3IN5A 3QU5A 2ZXIA 1ZQWA 2D8CA 1ZQPA 2KKPA 1JN3A 4EEBA 3EPGA 2XY7A 1OU5A 4Q44A 4I2AA 2XCAA 4K4IA 2MRLA 3DEEA 3RF9A 2PBEA 5J0WA 4F5RA 3EWAA 4J03A 1B22A 4AT7B 2HBJA 1BGXT 4F3OA 4LVSA 2KV2A 1ZD2P 3OJUA 3L3FX 4ED7A 2H3FA 2DR9A 2GH1A 2FPLA 4XQ7A 2IA6A 3JCFA 2BR0A 1TAUA 3T5JA 1ZXIA 5ALRA 4PPXA 4JWNA 8ICVA 4F50A 2ZIVA 2ZJ8A 5EWEA 1EXNA 4J9KA 1K1QA 7ICTA 1HJPA 1VJ5A 5HR7A 3SAGA 4PGYA 1ZQFA 1P7DA 2E8NA 1KKXA 3M9NB 1L6NA 4CF3A 2F77X 3LQCB 1HUOA 4RUAA 1QTMA 5F2VO 2ZUDA 1UEVA 3AQMA 2C2RA 1ZD3A 5KG1A 3AUOA 2PFOA 4AT9A 3HP6A 1Z00A 3SEIA 3Q8KA 1SL1A 5EOZA 4LJXA 1NKBA 4QNLA 4C8NA 1MA7A 3QUTA 2CN1A 2H5XA 3UXOA 5L1JA 1X66A 2GA9D 3CP8A 2W9AA 5DECA 4UD5A 4DL6A 4KLDA 2WB1C 2H3VA 4KLLA 1JRPA 2K89A 4EBDA 1C7YA 4KB6A 4ACOA 4FFDA 2ZH2A 1NJZA 1Z4OA 4ECXA 3T5LA 1VDVA 4BX9C 4K8VA 2YMPA 5J0RA 2BCRA 3B0XA 1OUQA 3RR7A 2JEJA 3K75D 3ETRA 4MFCA 4KLUA 5B66U 2Q0ZX 5AKIA 2KHQA 5KFVA 3IRUA 1KBUA 2YTUA 2YN4A 1UHUA 3PW7A 4WC5A 2ZH8A 3ETLA 2UVWA 1KQQA 4J9QA 4UAZA 1V38A 3EZ5A 4BXOB 3N28A 5DLGA 4QZGA 3F5AA 5KFTA 4I27A 4M0AA 4EZ6A 3WK7A 4KLMA 3RR8A 4O0IA 9ICSA 3M6KA 2KE7A 2FI1A 2K8AA 3BJYA 3PSTA 5HR6A 1ZQQA 5AKYA 4XA5A 5AK3A 3RBEA 5KFRA 3N4MB 4E80A 3WK9A 2OEHA 3AM9A 5ALGA 4J9RA 2FMSA 4FZMA 4PL1A 5DBAA 2LYAA 1L8LA 4F92B 4DLEA 3K1RB 3D6JA 5ALVA 2LYHA 2KOBA 1RXVA 4HAIA 4P0PB 3N7RC 4QWAA 9ICOA 2RFFA 1Q78A 3NASA 1A76A 2IOFA 5DB6A 3PNCA 3JPRA 1NK7A 1YZ6A 2W54A 3HX0A 1JUDA 1FFVA 2MUTA 4YMMA 3H4BA 4QWDA 1Z19A 4CE6A 8ICPA 4IRCA 4PHPA 3JYYA 3Q8MA 4X4OA 5HREA 1MIYA 1XSLA 3WK6A 5AKLA 2H3IA 4Y2TA 2WF9A 1SZPA 4UBCA 1ZQVA 4ZOHC 2KJ5A 1WOTA 2M0NA 4DLGA 4O5EA 2ZG6A 3QUQA 4IQWA 2QKQA 1PK1A 2K8CB 3GIKA 1DK2A 3NS1A 2W04A 4J9SA 3VCBA 2ZIUB 5E79U 1NK6A 3Q8LA 3RJKA 2ATLA 2LMRA 2F8LA 4J9MA 3SAFA 4X4NA 4BGDA 4I29A 4CF4A 1IG6A 3B0YA 5AM5A 2HHPA 5CHGA 4KLSA 2ZHBA 2JEFA 5CFUA 4WH5A 1GPJA 7ICQA 3QYPA 4JWMA 3H0LB 3PW4A 4I2EA 1ZQOA 4JUZA 1OXJA 4OJPA 3PW5A 3HW8A 8ICEA 4O3SA 4IQVA 4NLNA 5ALFA 5DBCA 4UB3A 5AM4A 5KT4A 4DL2A 5D62A 5KFEA 1DGJA 4FH5A 3PSFA 1R8CA 4ICAA 4O67A 3F2BA 4YMNA 2HHSA 2VJ4A 2O5AA 1KEJA 4TQRA 4DSLA 1N61A 3QX7A 1JX4A 1WWUA 5DG8A 4NY8A 1KL9A 3RJEA 4F4YA 3RB3A 2GAFD 8ICAA 4TUSA 3ERCC 1IXRA 2EZZA 4TURA 2P6RA 1VFGA 5KFGA 1COOA 4KMOB 1N5XA 5KFOA 2LM4A 5A0LA 4DOBA 3AL0B 4G9BA 2FLLA 1CI4A 4C4RA 2ZH9A 9ICAA 8ICMA 4I2IA 4RNNA 2ASLA 2HN1A 1D9FA 1ZQEA 5ALHA 4F2SA 2K4EA 1XNSA 1HUZA 1JMSA 1NO5A 4R65A 4JK1A 1S77D 4ED0A 1U9LA 4CF5A 5J2IA 3JPOA 3JPTA 4CGZA 5BOMA 4J9LA 4DFDA 1DOQA 1SZHA 3ER9B 3QUCA 4Q45A 2E1EA 3V7KA 4WC0A 4OJOA 4R66A 5DGBA 1F0MA 1SGGA 4F4XA 2P35A 4RQNA 4X0BA 3TANA 2F44A 4DSJA 1L3VA 1D9DA 2FE9A 1QH9A 2RQ5A 3UMBA 4WC1A 4P0QB 3OSPA 4WBYA 2EZYA 3F2CA 4FHYA 2DVIA 3GV8B 1ZETA 2ZJ5A 5ALPA 1FFUA
chains in the Genus database with same CATH topology
5KG7A 1N48A 9ICUA 2R8GA 1TFYA 2WTFA 4YP3A 4RZRA 1V9PA 3PW0A 4WC4A 4B9MA 4PHEA 3MR2A 3BQ1A 1NK0A 5KFUA 4RT3A 3RJHA 5KFSA 4QW8A 4O3NA 4ELVA 3ORYA 7ICNA 4YR3A 2KTQA 3OV7A 4ECWA 3FDSA 1ZQHA 1NOMA 5L1IA 4RQ3A 5HMMA 4O3PA 5KT2A 5HRIA 1WCLA 2PXIA 2V4QA 4WC3A 3V72A 3OHAA 3OVBA 5HRHA 1UETA 2KP7A 5DQGA 4RPXA 2ASJA 2FPKA 5KG4A 4X5VA 4M9NA 4M9GA 5DDMA 5F9NA 1TK0A 5KT3A 2IHMA 1RYSA 4KLEA 1NO5A 2FMQA 2PFPA 4KTQA 4DSEA 5HMLA 4XUSA 5J0UA 4RQ7A 4MEXA 2ZUCA 3V7LA 3C1ZA 5BOLA 1ZQMA 4C8OA 4NM1A 9ICCA 4RUCA 4EZ9A 4E7XA 4DFPA 2HHTA 3GIMA 3GV7B 4EYIB 3PMNA 3Q8SB 4GXIA 5KFCA 1NKEA 4IG8A 2KZ3A 2J6SA 4IR9A 4TQSA 5CJ7A 4DQIA 3RTVA 4O3RA 4UB1A 7ICUA 2PFNA 3UXPA 3PO4A 3RRGA 4RQ0A 2BCUA 4M6WA 5HNKA 2ZHAA 2XY5A 2XCPA 2ZH7A 3V6HA 2A1JA 4QWCA 3RJIA 1XO1A 5J2DA 1T8EA 4X0AA 3RAQA 5KFWA 2FLPA 8ICJA 4AT8A 3Q8QB 2DRAA 5J2EA 3H8WA 5DB8A 4C8MA 4R8UB 3TARA 4X4UA 2R8KA 1KTQA 2BKEA 4PGQA 5KFBA 2W9BA 2JEGA 3PR4A 3C5GA 4FHWA 5JUMA 9ICJA 3JZ0A 1Y88A 3V7JA 3C5FA 4BXOA 3MR6A 9ICNA 3RH6A 2ALZA 4DOCA 3MGHA 1R8AA 2I1QA 2DR7A 9ICFA 3ZDAA 5KFJA 1MC8A 5L9XA 7ICFA 9ICBA 3MGIA 3RAXA 3AQLA 3UPQA 2V9WA 3C66A 4YVZA 3M9MB 4B9NA 8ICLA 5L1KA 3TQ1A 3GDXA 2BPCA 1ZQWA 1NK8A 5F9LA 2NRWA 1ZQPA 2BCVA 5KT7A 4IQTA 4I2HA 3FYHA 3SV4A 1JN3A 3ZDDA 3EPGA 1BPZA 2ISOA 2XY7A 1OU5A 4MF2A 4Q44A 4I2AA 4Q8FA 2XCAA 2AGPA 2BPFA 5J0XA 2HHXA 1XU4A 4UB4A 2HHQA 4DFJA 2DFLA 3KHRA 4QWEA 1KDHA 4K4IA 3KTQA 1ZQZA 1BPYA 4DFKA 2HVIA 4DEZA 2NRZA 4YXJA 2PBEA 4RQ1A 2MAXA 5J0WA 3MFHA 3EWAA 4F5RA 5EWFA 1S0NA 5IIOA 5KFLA 1ZQAA 5DGAA 1U45A 1B22A 4AT7B 9ICTA 5KFHA 2FPMA 1BGXT 4R64A 5DB9A 3SV3A 4F3OA 4LVSA 3WFOA 4I2JA 4ATBB 4PGXA 2DR8A 3QEBZ 2ZJAA 2R8IA 4QZAA 4YFKA 3OJUA 3K4GA 4UBBA 4UQGA 1X9WA 5DQIA 2UVRA 8ICGA 4ED7A 1ZJNA 9ICXA 2DR9A 3NYBA 4M9HA 1JAJA 3QZ8A 2FPLA 3GFKB 4G3IA 3PW2A 2PFQA 3T5KA 2IA6A 5CR0A 3RRHA 4HYKA 2BR0A 5KG6A 4XQ7A 4DO9A 1TAUA 4NKTA 3BQ0A 4DL7A 1S0OA 4MFAA 3BQ2A 3T5JA 8ICZA 4PPXA 4JWNA 2FMPA 4MF8A 4F50A 3T3FA 2ZJ8A 8ICVA 3AQNA 4F5NA 4DQRA 5HP4A 4O3QA 4QZIA 2JZBB 1U4BA 2HW3A 4UD4A 1S0VA 5EWEA 4NM2A 2BCQA 3H40A 1L3TA 1EXNA 2W8KA 1X9MA 4FS1A 4KLTA 4J9KA 1NZPA 1K1QA 7ICTA 4RQ5A 4M9LA 5HHIA 1L3UA 3H7IA 1HJPA 3NTUA 4PGYA 4EYHB 1ZQNA 1ZQFA 1TFRA 1T4GA 4FHVA 4ZH4A 1Z3EB 4RQ8A 3M9NB 1NJYA 4O5CA 3TFSA 5DKWA 4YXMA 3SYZA 4YN4A 2M2UA 5KFZA 3LQCB 5DDYA 5DG9A 5KG2A 1HUOA 4RUAA 1QTMA 5F2VO 2ZUDA 1UEVA 3AQMA 4GXKA 2C2RA 5KG1A 3QZ7A 3AUOA 2ZH5A 5KT5A 4GXJA 1U47A 2PFOA 4ELTA 4AT9A 5HHHA 3HP6A 4WC6A 4GLXA 1Z00A 4QW9A 3Q8KA 4X4QA 2ZH6A 5DG7A 2Y1JA 5J2CA 2C22A 4KITB 4QZ9A 4DS4A 1SL1A 5EOZA 4KLHA 2AGQA 4X4TA 4DQPA 1NKBA 3M8RA 2C2DA 4C8NA 3C2MA 4J9NA 2H5XA 3UXOA 4I28A 5IINA 4Z6FA 3GILA 5L1JA 1ZQLA 4FHXA 4QZHA 2HHWA 4KLQA 4J9OA 3JPPA 3ZD8A 2W9AA 2OWOA 3QE9Y 1ZQIA 4UAYA 4E0DA 4UD5A 4DL6A 5DECA 4KLDA 3UPSA 3WFQE 4YR0A 5HRBA 3V6JA 4KLFA 3PX0A 3WFRE 1R8BA 2W9MA 5KFFA 2BCSA 4KLLA 7ICJA 4EBKA 4RWOA 4XQ8A 3LWMA 4EBDA 1C7YA 2W9CA 2VA2A 4YD2A 3MDAA 2BE3A 3WFPA 4YQWA 4C8KA 1TK8A 2ZH2A 4ECSA 3UQ0A 2M2WA 1NJZA 3ZDCA 2XO7A 4QZ8A 1ZQTA 2FLNA 4ECXA 4JV2A 1ZJMA 3RH5A 1S97A 4DSIA 4RWPA 3RBDA 5J2HA 4Z6DA 5KFXA 2O1PA 3T5LA 1X9SA 3TAPA 5IIIA 1ZQBA 7ICEA 1QSYA 2DPJA 5TZVA 5J0RA 5EWGA 5BPCA 2BCRA 3B0XA 4P2HA 4P4OA 4C8LA 3KHLA 3RR7A 2JEJA 8ICTA 4M6WB 4I2BA 5HRGA 2DVIA 3K75D 4DF8A 3ISCA 3KHHA 4FO6A 2A1JB 4MFCA 3H38A 4EEYA 4KLUA 2ZTCA 4YCXA 3HJ4A 3TAQA 1QLNA 2Q0ZX 3OVSA 4RNMA 4B9UA 3UXNA 3GQCA 4ECTA 2HVHA 3HJ1A 5KFVA 2RDIA 4RQ4A 7ICVA 7ICHA 3PW7A 1ZQGA 4WC5A 3H39A 4MEYA 2W9BB 2ZH8A 3ETLA 2UVWA 4F4KA 1UEUA 4DFMA 4ECUA 2R8JA 3ZD9A 4J9QA 4K4HA 4F8RA 4RU9A 4UAZA 3EZ5A 4BXOB 2ID1A 4ECQA 5DLGA 4QZGA 4X4PA 5KFTA 1A77A 4I27A 4M0AA 1SKWA 4EZ6A 2BQUA 4IRKA 1ZQJA 1N56A 4DWIA 1MIVA 5L1LA 4ECYA 5HRFA 4S3NA 1NK4A 4RPZA 1S76D 1TFWA 4YMOA 2J6UA 2F1HA 3RR8A 4BDPA 4KLMA 2VANA 5KG3A 4O0IA 4EBJA 9ICSA 1TV9A 3G6VA 4RPYA 2IMWP 4WC7A 5IIKA 1MQ3A 4QZEA 2V4RA 1S9FA 2XC9A 7ICOA 5HRLA 1AROP 3AU2A 3BJYA 4I2CA 2GWSA 1ZQQA 3Q8PB 2AQ4A 9ICRA 2RDJA 2PI4A 4X4RA 1IM4A 1TVAA 4XA5A 9ICEA 4MFFA 3BDPA 1ZQXA 3EYZA 1KFTA 5KFDA 4AT7A 5DLFA 1D8YA 4DL4A 4PHAA 2KZZA 3RBEA 2DRBA 5KFRA 1TAQA 3HWTA 3N4MB 3RJJA 4E80A 7ICPA 1F5AA 1PX5A 1ZQCA 2UVUA 4TUPA 1QSSA 1PZNA 7ICRA 5KFPA 4J9RA 2FMSA 4KLJA 1KRPA 4PHDA 5CA7A 5DBAA 1R89A 3SZ2A 2Y1IA 1KSPA 4DLEA 4F92B 4NXZA 2BQ3A 1B43A 2F1JA 5D49A 3ZDEA 8ICYA 1DGSA 3PY8A 2LYHA 4FBTA 3LWLA 2AGOA 1X2IA 1L3SA 1L5UA 5CB1A 1RXVA 1DK3A 4QWAA 9ICOA 1KNYA 2RFFA 1Q78A 3OUYB 2BHNA 4F4WA 1TKDA 3PNCA 1A76A 1NK7A 5DB6A 9ICLA 3JPRA 3PR5B 4ECRA 4DQQA 3T5HA 3HX0A 3C18A 2MUTA 4ED3A 3RJGA 4YMMA 3THVA 1SL2A 4F5OA 1D8LA 3H4BA 4QWDA 4ECZA 3N97B 9ICPA 5CP2A 1JQRA 1BNPA 4UB5A 5D4BA 4IRCA 4PHPA 8ICPA 3Q8MA 3JYYA 3LDAA 3TFRA 2XY6A 3PX4A 5HREA 1MIYA 4WCWA 4X4OA 1XSPA 9ICKA 3UQ2A 4Q8EA 1JIHA 4ELUA 2HHVA 2J6TA 5J2AA 1XSLA 4B9SA 2B21A 3IM1A 5DQHA 4F2RA 4BWJA 7ICKA 3HIYA 4ED6A 3PVXA 5J2KA 3OSNA 1SZPA 5J0YA 1BPXA 8ICWA 5HC9A 1S0MA 4QWBA 4UBCA 4I2FA 1SL0A 3Q8RB 9ICQA 2ZH3A 1UA1A 5KTQA 1ZQVA 3H4DA 3EW9A 4Z6EA 4IQUA 4J9PA 4KMUA 2XGPA 3QEAZ 5HRDA 2VA8A 1WOTA 3WFSC 4DLGA 1XWLA 4B9LA 4O5EA 4ED8A 5KFYA 4F91B 3E2EA 5KFMA 1CEZA 4DSFA 4AT9B 8ICSA 3HT3A 4IQWA 2UVVA 1Z00B 8ICIA 2IBKA 2I9GA 1ZQSA 3PMLA 4DL5A 3KHGA 3GIKA 1DK2A 2HHUA 4RWNA 5J0OA 4J9SA 2C2EA 3JPQA 4QZFA 1NK5A 1NK6A 2ISPA 4K4GA 3L9DA 4IR1A 8ICNA 4Z6CA 4DL3A 4KLOA 3Q8LA 3RJKA 2ATLA 3ZDBA 1JXLA 4WBZA 4J9MA 3RB6A 1MQ2A 4F93B 4BWMA 4X4NA 4BGDA 3PX6A 5HRKA 5KG0A 4M04A 3H8JA 4I29A 3C2KA 3B0YA 2HHPA 2Q66A 3OGUA 5CHGA 2ZH4A 4O5KA 4KLSA 7ICMA 1FA0A 3OHBA 1H38A 2ZHBA 3H8SA 4I2GA 5DB7A 2BGWA 2JEFA 4KLIA 4I2DA 1MSWD 8ICFA 3SI8A 4JWMA 1QSLA 1SKSA 7ICQA 1SKRA 2C28A 2M9NA 4R63A 3PW4A 1LV5A 2DPIA 2W9CB 4M9JA 1BNOA 9ICHA 4M47A 1V4AA 4I2EA 4M5DA 4R8UA 1ZQOA 4JUZA 3PW5A 3HW8A 5CWRA 5J2GA 4Q43A 2W8LA 8ICEA 4LT6A 1JXEA 4DF4A 1K1SA 4QZBA 4YR2A 3MFIA 4B9TA 4IQVA 3C2LA 4O3SA 4NLNA 4EBCA 4AT8B 2PI5A 5KFAA 5DBCA 4UB3A 1RPLA 1XS9D 5KT4A 3JPNA 4DL2A 1BPBA 5KFEA 5KFKA 3HPOA 3RH4A 4P4MA 4FH5A 1RYRA 1R8CA 5J0TA 2DR5A 2ASDA 1ZQUA 9ICVA 1ZYQA 2BDPA 4YMNA 2HHSA 4KN7A 2M2VA 5KFNA 2O5AA 4DQSA 1BPDA 1KEJA 3EPIA 9ICGA 4TQRA 4DSLA 1S77D 2AQ0A 1JX4A 3OVAA 5DG8A 1CUKA 3GIJA 4NY8A 8ICCA 5J2FA 3LK9A 4RWQA 1T7PA 5KG5A 3RJEA 5DBBA 4NLKA 3PO5A 4F4YA 1RXWA 3RB3A 8ICAA 4TUSA 2NRKA 4O3OA 8ICUA 1ZQRA 2NRXA 5J0PA 3V6KA 1IXRA 4F5QA 5IILA 3TI0A 1S10A 3H3AA 4TURA 4M2YA 3AQKA 2ZH1A 4P4PA 3MABA 2NRTA 4LZGA 1YLQA 2P6RA 1VFGA 4RT2A 5KFGA 3GV5B 4ED1A 1COOA 4QZDA 1ZQDA 5J0QA 5KT6A 5KFOA 1NJWA 2VA3A 4O9MA 7ICIA 7ICLA 4DOBA 3GIIA 5KFIA 8ICQA 2ZTEA 3G6XA 1NKCA 5IIJA 3ISDA 4DS5A 4JV1A 2FLLA 7ICGA 2M2TA 5J2BA 8ICOA 3C21A 2NRVA 3H37A 2KZMA 5D46A 2BQRA 3NGDA 4ED2A 2ZH9A 2IHNA 9ICAA 8ICKA 8ICMA 4ATBA 2JEIA 4RQ6A 4EBEA 4I2IA 4RNNA 2ASLA 8ICXA 4EP7A 4X4SA 1D9FA 3RB0A 1ZQEA 2ZUBA 4F5PA 1HUZA 2AU0A 4F2SA 1LB2B 5HR9A 5J2JA 3M8SA 1JMSA 4GC7A 4UB2A 4R65A 4F4ZA 2BPGA 4JK1A 4GC6A 4B9VA 4NLZA 4ED0A 1U9LA 1UT8A 2XGQA 1KFDA 5J2IA 1T3NA 3JPOA 3JPTA 4FBUA 5BOMA 8ICHA 1Q79A 3ISBA 4J9LA 4FHPA 4WC2A 1DOQA 4FH3A 2JZBA 4QZCA 1VJ7A 3C23A 4Q45A 4UAWA 1U49A 1TK5A 2P6UA 1MIWA 3V7KA 4WC0A 3MR3A 3C1YA 1ZQKA 2KN7A 1UT5A 9ICWA 4PH5A 3RJFA 3JPSA 4R66A 4XRHA 4NKUA 4RQ2A 1U48A 3MDCA 4CCHA 5DGBA 1XSNA 4KN4A 4F4XA 1BPEA 3G6YA 7ICSA 3PV8A 4YG2A 9ICIA 4X0BA 4DOAA 5IIMA 2F1IA 5KFQA 3TANA 1NJXA 1KLNA 4DSJA 4IRDA 8ICBA 9ICMA 5DEDA 4E8FA 4TUQA 1RZTA 4JV0A 1L3VA 1D9DA 1UA0A 2P66A 4KLGA 4X4VA 3M9OB 1ZQYA 3MR5A 2R8HA 4ECVA 3RB4A 5J0SA 8ICRA 5C5JA 2MUTB 2AJQA 4RNOA 4WC1A 3OSPA 2KFZA 4WBYA 3BQTA 3MBYA 3OUYA 3AU6A 4FHYA 1NK9A 2ZTDA 3IHQB 3OJSA 1WCNA 1XC9A 4LZDA 4NLGA 3GV8B 1ZETA 4DSKA 2ZJ5A 2KFNA 4YD1A 1KFSA 5J29A 1BVSA 4FS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KG7 A;  1N48 A;  9ICU A;  2R8G A;  1TFY A;  2WTF A;  4YP3 A;  4RZR A;  1V9P A;  3PW0 A;  4WC4 A;  4B9M A;  4PHE A;  3MR2 A;  3BQ1 A;  1NK0 A;  5KFU A;  4RT3 A;  3RJH A;  5KFS A;  4QW8 A;  4O3N A;  4ELV A;  3ORY A;  7ICN A;  4YR3 A;  2KTQ A;  3OV7 A;  4ECW A;  3FDS A;  1ZQH A;  1NOM A;  5L1I A;  4RQ3 A;  5HMM A;  4O3P A;  5KT2 A;  5HRI A;  1WCL A;  2PXI A;  2V4Q A;  4WC3 A;  3V72 A;  3OHA A;  3OVB A;  5HRH A;  1UET A;  2KP7 A;  5DQG A;  4RPX A;  2ASJ A;  2FPK A;  5KG4 A;  4X5V A;  4M9N A;  4M9G A;  5DDM A;  5F9N A;  1TK0 A;  5KT3 A;  2IHM A;  1RYS A;  4KLE A;  1NO5 A;  2FMQ A;  2PFP A;  4KTQ A;  4DSE A;  5HML A;  4XUS A;  5J0U A;  4RQ7 A;  4MEX A;  2ZUC A;  3V7L A;  3C1Z A;  5BOL A;  1ZQM A;  4C8O A;  4NM1 A;  9ICC A;  4RUC A;  4EZ9 A;  4E7X A;  4DFP A;  2HHT A;  3GIM A;  3GV7 B;  4EYI B;  3PMN A;  3Q8S B;  4GXI A;  5KFC A;  1NKE A;  4IG8 A;  2KZ3 A;  2J6S A;  4IR9 A;  4TQS A;  5CJ7 A;  4DQI A;  3RTV A;  4O3R A;  4UB1 A;  7ICU A;  2PFN A;  3UXP A;  3PO4 A;  3RRG A;  4RQ0 A;  2BCU A;  4M6W A;  5HNK A;  2ZHA A;  2XY5 A;  2XCP A;  2ZH7 A;  3V6H A;  2A1J A;  4QWC A;  3RJI A;  1XO1 A;  5J2D A;  1T8E A;  4X0A A;  3RAQ A;  5KFW A;  2FLP A;  8ICJ A;  4AT8 A;  3Q8Q B;  2DRA A;  5J2E A;  3H8W A;  5DB8 A;  4C8M A;  4R8U B;  3TAR A;  4X4U A;  2R8K A;  1KTQ A;  2BKE A;  4PGQ A;  5KFB A;  2W9B A;  2JEG A;  3PR4 A;  3C5G A;  4FHW A;  5JUM A;  9ICJ A;  3JZ0 A;  1Y88 A;  3V7J A;  3C5F A;  4BXO A;  3MR6 A;  9ICN A;  3RH6 A;  2ALZ A;  4DOC A;  3MGH A;  1R8A A;  2I1Q A;  2DR7 A;  9ICF A;  3ZDA A;  5KFJ A;  1MC8 A;  5L9X A;  7ICF A;  9ICB A;  3MGI A;  3RAX A;  3AQL A;  3UPQ A;  2V9W A;  3C66 A;  4YVZ A;  3M9M B;  4B9N A;  8ICL A;  5L1K A;  3TQ1 A;  3GDX A;  2BPC A;  1ZQW A;  1NK8 A;  5F9L A;  2NRW A;  1ZQP A;  2BCV A;  5KT7 A;  4IQT A;  4I2H A;  3FYH A;  3SV4 A;  1JN3 A;  3ZDD A;  3EPG A;  1BPZ A;  2ISO A;  2XY7 A;  1OU5 A;  4MF2 A;  4Q44 A;  4I2A A;  4Q8F A;  2XCA A;  2AGP A;  2BPF A;  5J0X A;  2HHX A;  1XU4 A;  4UB4 A;  2HHQ A;  4DFJ A;  2DFL A;  3KHR A;  4QWE A;  1KDH A;  4K4I A;  3KTQ A;  1ZQZ A;  1BPY A;  4DFK A;  2HVI A;  4DEZ A;  2NRZ A;  4YXJ A;  2PBE A;  4RQ1 A;  2MAX A;  5J0W A;  3MFH A;  3EWA A;  4F5R A;  5EWF A;  1S0N A;  5IIO A;  5KFL A;  1ZQA A;  5DGA A;  1U45 A;  1B22 A;  4AT7 B;  9ICT A;  5KFH A;  2FPM A;  1BGX T;  4R64 A;  5DB9 A;  3SV3 A;  4F3O A;  4LVS A;  3WFO A;  4I2J A;  4ATB B;  4PGX A;  2DR8 A;  3QEB Z;  2ZJA A;  2R8I A;  4QZA A;  4YFK A;  3OJU A;  3K4G A;  4UBB A;  4UQG A;  1X9W A;  5DQI A;  2UVR A;  8ICG A;  4ED7 A;  1ZJN A;  9ICX A;  2DR9 A;  3NYB A;  4M9H A;  1JAJ A;  3QZ8 A;  2FPL A;  3GFK B;  4G3I A;  3PW2 A;  2PFQ A;  3T5K A;  2IA6 A;  5CR0 A;  3RRH A;  4HYK A;  2BR0 A;  5KG6 A;  4XQ7 A;  4DO9 A;  1TAU A;  4NKT A;  3BQ0 A;  4DL7 A;  1S0O A;  4MFA A;  3BQ2 A;  3T5J A;  8ICZ A;  4PPX A;  4JWN A;  2FMP A;  4MF8 A;  4F50 A;  3T3F A;  2ZJ8 A;  8ICV A;  3AQN A;  4F5N A;  4DQR A;  5HP4 A;  4O3Q A;  4QZI A;  2JZB B;  1U4B A;  2HW3 A;  4UD4 A;  1S0V A;  5EWE A;  4NM2 A;  2BCQ A;  3H40 A;  1L3T A;  1EXN A;  2W8K A;  1X9M A;  4FS1 A;  4KLT A;  4J9K A;  1NZP A;  1K1Q A;  7ICT A;  4RQ5 A;  4M9L A;  5HHI A;  1L3U A;  3H7I A;  1HJP A;  3NTU A;  4PGY A;  4EYH B;  1ZQN A;  1ZQF A;  1TFR A;  1T4G A;  4FHV A;  4ZH4 A;  1Z3E B;  4RQ8 A;  3M9N B;  1NJY A;  4O5C A;  3TFS A;  5DKW A;  4YXM A;  3SYZ A;  4YN4 A;  2M2U A;  5KFZ A;  3LQC B;  5DDY A;  5DG9 A;  5KG2 A;  1HUO A;  4RUA A;  1QTM A;  5F2V O;  2ZUD A;  1UEV A;  3AQM A;  4GXK A;  2C2R A;  5KG1 A;  3QZ7 A;  3AUO A;  2ZH5 A;  5KT5 A;  4GXJ A;  1U47 A;  2PFO A;  4ELT A;  4AT9 A;  5HHH A;  3HP6 A;  4WC6 A;  4GLX A;  1Z00 A;  4QW9 A;  3Q8K A;  4X4Q A;  2ZH6 A;  5DG7 A;  2Y1J A;  5J2C A;  2C22 A;  4KIT B;  4QZ9 A;  4DS4 A;  1SL1 A;  5EOZ A;  4KLH A;  2AGQ A;  4X4T A;  4DQP A;  1NKB A;  3M8R A;  2C2D A;  4C8N A;  3C2M A;  4J9N A;  2H5X A;  3UXO A;  4I28 A;  5IIN A;  4Z6F A;  3GIL A;  5L1J A;  1ZQL A;  4FHX A;  4QZH A;  2HHW A;  4KLQ A;  4J9O A;  3JPP A;  3ZD8 A;  2W9A A;  2OWO A;  3QE9 Y;  1ZQI A;  4UAY A;  4E0D A;  4UD5 A;  4DL6 A;  5DEC A;  4KLD A;  3UPS A;  3WFQ E;  4YR0 A;  5HRB A;  3V6J A;  4KLF A;  3PX0 A;  3WFR E;  1R8B A;  2W9M A;  5KFF A;  2BCS A;  4KLL A;  7ICJ A;  4EBK A;  4RWO A;  4XQ8 A;  3LWM A;  4EBD A;  1C7Y A;  2W9C A;  2VA2 A;  4YD2 A;  3MDA A;  2BE3 A;  3WFP A;  4YQW A;  4C8K A;  1TK8 A;  2ZH2 A;  4ECS A;  3UQ0 A;  2M2W A;  1NJZ A;  3ZDC A;  2XO7 A;  4QZ8 A;  1ZQT A;  2FLN A;  4ECX A;  4JV2 A;  1ZJM A;  3RH5 A;  1S97 A;  4DSI A;  4RWP A;  3RBD A;  5J2H A;  4Z6D A;  5KFX A;  2O1P A;  3T5L A;  1X9S A;  3TAP A;  5III A;  1ZQB A;  7ICE A;  1QSY A;  2DPJ A;  5TZV A;  5J0R A;  5EWG A;  5BPC A;  2BCR A;  3B0X A;  4P2H A;  4P4O A;  4C8L A;  3KHL A;  3RR7 A;  2JEJ A;  8ICT A;  4M6W B;  4I2B A;  5HRG A;  2DVI A;  3K75 D;  4DF8 A;  3ISC A;  3KHH A;  4FO6 A;  2A1J B;  4MFC A;  3H38 A;  4EEY A;  4KLU A;  2ZTC A;  4YCX A;  3HJ4 A;  3TAQ A;  1QLN A;  2Q0Z X;  3OVS A;  4RNM A;  4B9U A;  3UXN A;  3GQC A;  4ECT A;  2HVH A;  3HJ1 A;  5KFV A;  2RDI A;  4RQ4 A;  7ICV A;  7ICH A;  3PW7 A;  1ZQG A;  4WC5 A;  3H39 A;  4MEY A;  2W9B B;  2ZH8 A;  3ETL A;  2UVW A;  4F4K A;  1UEU A;  4DFM A;  4ECU A;  2R8J A;  3ZD9 A;  4J9Q A;  4K4H A;  4F8R A;  4RU9 A;  4UAZ A;  3EZ5 A;  4BXO B;  2ID1 A;  4ECQ A;  5DLG A;  4QZG A;  4X4P A;  5KFT A;  1A77 A;  4I27 A;  4M0A A;  1SKW A;  4EZ6 A;  2BQU A;  4IRK A;  1ZQJ A;  1N56 A;  4DWI A;  1MIV A;  5L1L A;  4ECY A;  5HRF A;  4S3N A;  1NK4 A;  4RPZ A;  1S76 D;  1TFW A;  4YMO A;  2J6U A;  2F1H A;  3RR8 A;  4BDP A;  4KLM A;  2VAN A;  5KG3 A;  4O0I A;  4EBJ A;  9ICS A;  1TV9 A;  3G6V A;  4RPY A;  2IMW P;  4WC7 A;  5IIK A;  1MQ3 A;  4QZE A;  2V4R A;  1S9F A;  2XC9 A;  7ICO A;  5HRL A;  1ARO P;  3AU2 A;  3BJY A;  4I2C A;  2GWS A;  1ZQQ A;  3Q8P B;  2AQ4 A;  9ICR A;  2RDJ A;  2PI4 A;  4X4R A;  1IM4 A;  1TVA A;  4XA5 A;  9ICE A;  4MFF A;  3BDP A;  1ZQX A;  3EYZ A;  1KFT A;  5KFD A;  4AT7 A;  5DLF A;  1D8Y A;  4DL4 A;  4PHA A;  2KZZ A;  3RBE A;  2DRB A;  5KFR A;  1TAQ A;  3HWT A;  3N4M B;  3RJJ A;  4E80 A;  7ICP A;  1F5A A;  1PX5 A;  1ZQC A;  2UVU A;  4TUP A;  1QSS A;  1PZN A;  7ICR A;  5KFP A;  4J9R A;  2FMS A;  4KLJ A;  1KRP A;  4PHD A;  5CA7 A;  5DBA A;  1R89 A;  3SZ2 A;  2Y1I A;  1KSP A;  4DLE A;  4F92 B;  4NXZ A;  2BQ3 A;  1B43 A;  2F1J A;  5D49 A;  3ZDE A;  8ICY A;  1DGS A;  3PY8 A;  2LYH A;  4FBT A;  3LWL A;  2AGO A;  1X2I A;  1L3S A;  1L5U A;  5CB1 A;  1RXV A;  1DK3 A;  4QWA A;  9ICO A;  1KNY A;  2RFF A;  1Q78 A;  3OUY B;  2BHN A;  4F4W A;  1TKD A;  3PNC A;  1A76 A;  1NK7 A;  5DB6 A;  9ICL A;  3JPR A;  3PR5 B;  4ECR A;  4DQQ A;  3T5H A;  3HX0 A;  3C18 A;  2MUT A;  4ED3 A;  3RJG A;  4YMM A;  3THV A;  1SL2 A;  4F5O A;  1D8L A;  3H4B A;  4QWD A;  4ECZ A;  3N97 B;  9ICP A;  5CP2 A;  1JQR A;  1BNP A;  4UB5 A;  5D4B A;  4IRC A;  4PHP A;  8ICP A;  3Q8M A;  3JYY A;  3LDA A;  3TFR A;  2XY6 A;  3PX4 A;  5HRE A;  1MIY A;  4WCW A;  4X4O A;  1XSP A;  9ICK A;  3UQ2 A;  4Q8E A;  1JIH A;  4ELU A;  2HHV A;  2J6T A;  5J2A A;  1XSL A;  4B9S A;  2B21 A;  3IM1 A;  5DQH A;  4F2R A;  4BWJ A;  7ICK A;  3HIY A;  4ED6 A;  3PVX A;  5J2K A;  3OSN A;  1SZP A;  5J0Y A;  1BPX A;  8ICW A;  5HC9 A;  1S0M A;  4QWB A;  4UBC A;  4I2F A;  1SL0 A;  3Q8R B;  9ICQ A;  2ZH3 A;  1UA1 A;  5KTQ A;  1ZQV A;  3H4D A;  3EW9 A;  4Z6E A;  4IQU A;  4J9P A;  4KMU A;  2XGP A;  3QEA Z;  5HRD A;  2VA8 A;  1WOT A;  3WFS C;  4DLG A;  1XWL A;  4B9L A;  4O5E A;  4ED8 A;  5KFY A;  4F91 B;  3E2E A;  5KFM A;  1CEZ A;  4DSF A;  4AT9 B;  8ICS A;  3HT3 A;  4IQW A;  2UVV A;  1Z00 B;  8ICI A;  2IBK A;  2I9G A;  1ZQS A;  3PML A;  4DL5 A;  3KHG A;  3GIK A;  1DK2 A;  2HHU A;  4RWN A;  5J0O A;  4J9S A;  2C2E A;  3JPQ A;  4QZF A;  1NK5 A;  1NK6 A;  2ISP A;  4K4G A;  3L9D A;  4IR1 A;  8ICN A;  4Z6C A;  4DL3 A;  4KLO A;  3Q8L A;  3RJK A;  2ATL A;  3ZDB A;  1JXL A;  4WBZ A;  4J9M A;  3RB6 A;  1MQ2 A;  4F93 B;  4BWM A;  4X4N A;  4BGD A;  3PX6 A;  5HRK A;  5KG0 A;  4M04 A;  3H8J A;  4I29 A;  3C2K A;  3B0Y A;  2HHP A;  2Q66 A;  3OGU A;  5CHG A;  2ZH4 A;  4O5K A;  4KLS A;  7ICM A;  1FA0 A;  3OHB A;  1H38 A;  2ZHB A;  3H8S A;  4I2G A;  5DB7 A;  2BGW A;  2JEF A;  4KLI A;  4I2D A;  1MSW D;  8ICF A;  3SI8 A;  4JWM A;  1QSL A;  1SKS A;  7ICQ A;  1SKR A;  2C28 A;  2M9N A;  4R63 A;  3PW4 A;  1LV5 A;  2DPI A;  2W9C B;  4M9J A;  1BNO A;  9ICH A;  4M47 A;  1V4A A;  4I2E A;  4M5D A;  4R8U A;  1ZQO A;  4JUZ A;  3PW5 A;  3HW8 A;  5CWR A;  5J2G A;  4Q43 A;  2W8L A;  8ICE A;  4LT6 A;  1JXE A;  4DF4 A;  1K1S A;  4QZB A;  4YR2 A;  3MFI A;  4B9T A;  4IQV A;  3C2L A;  4O3S A;  4NLN A;  4EBC A;  4AT8 B;  2PI5 A;  5KFA A;  5DBC A;  4UB3 A;  1RPL A;  1XS9 D;  5KT4 A;  3JPN A;  4DL2 A;  1BPB A;  5KFE A;  5KFK A;  3HPO A;  3RH4 A;  4P4M A;  4FH5 A;  1RYR A;  1R8C A;  5J0T A;  2DR5 A;  2ASD A;  1ZQU A;  9ICV A;  1ZYQ A;  2BDP A;  4YMN A;  2HHS A;  4KN7 A;  2M2V A;  5KFN A;  2O5A A;  4DQS A;  1BPD A;  1KEJ A;  3EPI A;  9ICG A;  4TQR A;  4DSL A;  1S77 D;  2AQ0 A;  1JX4 A;  3OVA A;  5DG8 A;  1CUK A;  3GIJ A;  4NY8 A;  8ICC A;  5J2F A;  3LK9 A;  4RWQ A;  1T7P A;  5KG5 A;  3RJE A;  5DBB A;  4NLK A;  3PO5 A;  4F4Y A;  1RXW A;  3RB3 A;  8ICA A;  4TUS A;  2NRK A;  4O3O A;  8ICU A;  1ZQR A;  2NRX A;  5J0P A;  3V6K A;  1IXR A;  4F5Q A;  5IIL A;  3TI0 A;  1S10 A;  3H3A A;  4TUR A;  4M2Y A;  3AQK A;  2ZH1 A;  4P4P A;  3MAB A;  2NRT A;  4LZG A;  1YLQ A;  2P6R A;  1VFG A;  4RT2 A;  5KFG A;  3GV5 B;  4ED1 A;  1COO A;  4QZD A;  1ZQD A;  5J0Q A;  5KT6 A;  5KFO A;  1NJW A;  2VA3 A;  4O9M A;  7ICI A;  7ICL A;  4DOB A;  3GII A;  5KFI A;  8ICQ A;  2ZTE A;  3G6X A;  1NKC A;  5IIJ A;  3ISD A;  4DS5 A;  4JV1 A;  2FLL A;  7ICG A;  2M2T A;  5J2B A;  8ICO A;  3C21 A;  2NRV A;  3H37 A;  2KZM A;  5D46 A;  2BQR A;  3NGD A;  4ED2 A;  2ZH9 A;  2IHN A;  9ICA A;  8ICK A;  8ICM A;  4ATB A;  2JEI A;  4RQ6 A;  4EBE A;  4I2I A;  4RNN A;  2ASL A;  8ICX A;  4EP7 A;  4X4S A;  1D9F A;  3RB0 A;  1ZQE A;  2ZUB A;  4F5P A;  1HUZ A;  2AU0 A;  4F2S A;  1LB2 B;  5HR9 A;  5J2J A;  3M8S A;  1JMS A;  4GC7 A;  4UB2 A;  4R65 A;  4F4Z A;  2BPG A;  4JK1 A;  4GC6 A;  4B9V A;  4NLZ A;  4ED0 A;  1U9L A;  1UT8 A;  2XGQ A;  1KFD A;  5J2I A;  1T3N A;  3JPO A;  3JPT A;  4FBU A;  5BOM A;  8ICH A;  1Q79 A;  3ISB A;  4J9L A;  4FHP A;  4WC2 A;  1DOQ A;  4FH3 A;  2JZB A;  4QZC A;  1VJ7 A;  3C23 A;  4Q45 A;  4UAW A;  1U49 A;  1TK5 A;  2P6U A;  1MIW A;  3V7K A;  4WC0 A;  3MR3 A;  3C1Y A;  1ZQK A;  2KN7 A;  1UT5 A;  9ICW A;  4PH5 A;  3RJF A;  3JPS A;  4R66 A;  4XRH A;  4NKU A;  4RQ2 A;  1U48 A;  3MDC A;  4CCH A;  5DGB A;  1XSN A;  4KN4 A;  4F4X A;  1BPE A;  3G6Y A;  7ICS A;  3PV8 A;  4YG2 A;  9ICI A;  4X0B A;  4DOA A;  5IIM A;  2F1I A;  5KFQ A;  3TAN A;  1NJX A;  1KLN A;  4DSJ A;  4IRD A;  8ICB A;  9ICM A;  5DED A;  4E8F A;  4TUQ A;  1RZT A;  4JV0 A;  1L3V A;  1D9D A;  1UA0 A;  2P66 A;  4KLG A;  4X4V A;  3M9O B;  1ZQY A;  3MR5 A;  2R8H A;  4ECV A;  3RB4 A;  5J0S A;  8ICR A;  5C5J A;  2MUT B;  2AJQ A;  4RNO A;  4WC1 A;  3OSP A;  2KFZ A;  4WBY A;  3BQT A;  3MBY A;  3OUY A;  3AU6 A;  4FHY A;  1NK9 A;  2ZTD A;  3IHQ B;  3OJS A;  1WCN A;  1XC9 A;  4LZD A;  4NLG A;  3GV8 B;  1ZET A;  4DSK A;  2ZJ5 A;  2KFN A;  4YD1 A;  1KFS A;  5J29 A;  1BVS A;  4FS2 A; 
#chains in the Genus database with same CATH topology
 4CDG A;  2YML A;  3AQF A;  5AKG A;  4EV6 A;  1V9P A;  2EDU A;  4C4T A;  3MR2 A;  4B9M A;  2JR5 A;  1SV0 C;  4RT3 A;  3ORY A;  4UB6 U;  7ICN A;  3OV7 A;  1NOM A;  2JHD A;  4Y2P A;  1WCL A;  3V72 A;  2YMQ A;  5DQG A;  3MCR A;  4X5V A;  2DKZ A;  1TK0 A;  5KT3 A;  1RYS A;  1WYG A;  3GZF A;  5HML A;  4XUS A;  4MEX A;  1ZQM A;  2ZUC A;  5BOL A;  3WKD A;  4IS7 A;  2HHT A;  3WK4 A;  3EF2 A;  5KFC A;  5CJ7 A;  2LYB A;  3N7S C;  2OH2 A;  7ICU A;  1RQL A;  4RQ0 A;  2ZHA A;  3RJI A;  1KW4 A;  2W43 A;  2FLP A;  1SIJ A;  2F3N A;  4X4U A;  3H8W A;  5DB8 A;  5ALQ A;  5KFB A;  1RDF A;  9ICJ A;  1PK3 A;  1Y88 A;  4BXO A;  9ICN A;  2KJ8 A;  3NVY A;  5L9X A;  7ICF A;  3RAX A;  8ICL A;  5L1K A;  3TQ1 A;  4FZN A;  1NK8 A;  2NRW A;  4IQT A;  1XO0 A;  4OAG A;  1BPZ A;  1QCK A;  4MF2 A;  2AGP A;  2BPF A;  2HHX A;  1XU4 A;  4UB4 A;  4JLX A;  2DFL A;  1KDH A;  1K5O A;  5KNI A;  4DFK A;  4DEZ A;  2LKY A;  9ICT A;  5IIO A;  4GFJ A;  5AHX A;  2KIC A;  2RP5 A;  2D3D A;  1UCV A;  2HSZ A;  3QEB Z;  2NYV A;  4QZA A;  4YFK A;  8ICG A;  1ZJN A;  3NYB A;  4P0P A;  3QZ8 A;  3PSP A;  3PW2 A;  5CR0 A;  4HYK A;  1PVP A;  1S0O A;  8ICZ A;  2FMP A;  3T3F A;  3AQN A;  4F5N A;  4O3Q A;  4QIW C;  2BCQ A;  1L3T A;  4U7C A;  2W8K A;  4OD0 A;  4RQ5 A;  4M9L A;  1L3U A;  3H7I A;  2Q4T A;  1ZQN A;  1TFR A;  1SXE A;  3F2D A;  4FHV A;  1Z3E B;  4RQ8 A;  3AMZ A;  2PKE A;  2ZXH A;  3M6Z A;  4YXM A;  2M2U A;  2IHO A;  5DDY A;  5KG2 A;  4AYB F;  2DL0 A;  4Y2V A;  4Y2J A;  3HKZ C;  4WC6 A;  4QW9 A;  2WHE A;  5J2C A;  2C22 A;  1PVQ A;  4QZ9 A;  3H0M B;  4KLH A;  4X4T A;  2ZIU A;  4DQP A;  5CEH A;  3M8R A;  3C2M A;  4J9N A;  2QAR B;  1ZQL A;  2BDU A;  4J9O A;  2EAP A;  3PSI A;  5AI8 A;  3QE9 Y;  4XJE A;  1HIW A;  3WFR E;  1R8B A;  4EBK A;  4XQ8 A;  2VA2 A;  3MDA A;  4C8K A;  3UQ0 A;  3SMV A;  1ZQT A;  1ZJM A;  4Z6D A;  5KFX A;  5III A;  1QSY A;  2MU2 A;  4CNQ A;  4P4O A;  4C8L A;  1ZD5 A;  8ICT A;  4M6W B;  4I2B A;  5HRG A;  3ISC A;  3KHH A;  2YX8 A;  3S6J A;  4YCX A;  3HJ4 A;  1T3Q A;  4B9U A;  1ECW A;  3HJ1 A;  2WAQ C;  3UMG A;  4RQ4 A;  3CYM A;  3H39 A;  2W9B B;  2CPR A;  2Z7J A;  2VKQ A;  4F4K A;  1UEU A;  4JLZ A;  4DFM A;  2R8J A;  3ZD9 A;  5AM2 A;  4F8R A;  4RU9 A;  2ID1 A;  4ECQ A;  2LPE A;  1A77 A;  2BQU A;  1MIV A;  5L1L A;  4YMO A;  4BDP A;  2F1H A;  3ALR A;  5KG3 A;  3NVW A;  4EBJ A;  3G6V A;  4WC7 A;  1SV0 A;  3U26 A;  2V4R A;  1S9F A;  2F2A B;  5HRL A;  1FIQ A;  2FJ6 A;  2GWS A;  4JB3 A;  4MFF A;  1JAL A;  1X6J A;  5KFD A;  3CW2 C;  2DRB A;  3HWT A;  5CHE A;  1ZQC A;  1QSS A;  1PZN A;  2QB1 A;  2KSO A;  5KFP A;  5CA7 A;  1KSP A;  1J97 A;  4NXZ A;  2B0C A;  3VC8 A;  1B43 A;  3ZDE A;  3LWL A;  2AGO A;  1FO4 A;  2ESE A;  1L3S A;  1KNY A;  1O03 A;  5B5E U;  2YB4 A;  2DF4 B;  1L7P A;  4P0Q A;  4ED3 A;  2K60 A;  4ECZ A;  1NNL A;  1JQR A;  1WG8 A;  3CK6 A;  2XI9 A;  2E5S A;  1DRG A;  4WCW A;  3NVZ A;  9ICK A;  3UQ2 A;  5J8Y C;  4ELU A;  1JI7 A;  5J2A A;  4B9S A;  3IM1 A;  5DQH A;  3HIY A;  4FO1 A;  3PVX A;  1BPX A;  3OSN A;  2Y0S F;  4I2F A;  4QWB A;  9ICQ A;  5KTQ A;  3H4D A;  3EW9 A;  4J9P A;  5HRD A;  5AKJ A;  3WFS C;  3B9J A;  2KD1 A;  5KFY A;  4F91 B;  4DSF A;  8ICS A;  2UVV A;  2IBK A;  2QB0 B;  5AKE A;  2N1R A;  5AIB A;  1YT3 A;  2ISP A;  3L9D A;  8ICN A;  3E58 A;  4WBZ A;  1JXL A;  5HRK A;  2QLT A;  2IUB A;  3OGU A;  2ZH4 A;  5AI4 A;  3OHB A;  1H38 A;  1MSW D;  5DB7 A;  2BGW A;  4KLI A;  8ICF A;  4I2D A;  1QSL A;  1SKS A;  1SKR A;  3KD3 A;  2M9N A;  1BNO A;  2C28 A;  1LV5 A;  2W9C B;  9ICH A;  1V4A A;  2KMD A;  4LT6 A;  2K4H A;  3MFI A;  3R9K A;  5KFA A;  3JPN A;  3F53 A;  1BPB A;  2G07 A;  5CRX A;  2ASD A;  3TAC B;  9ICV A;  2BDP A;  1HEK A;  2M2V A;  9ICG A;  8ICC A;  3LK9 A;  4RWQ A;  5AIA A;  4O3O A;  2NRX A;  5J0P A;  5IIL A;  4F5Q A;  2WF5 A;  3H3A A;  2KKV A;  1YLQ A;  2NRT A;  4RT2 A;  1C20 A;  5KFI A;  8ICQ A;  3G6X A;  3ISD A;  4DS5 A;  3IV6 A;  5J2B A;  8ICO A;  2EH9 A;  2NRV A;  2KZM A;  5D46 A;  4AYB C;  2IHN A;  2JEI A;  1UQV A;  4EBE A;  3UMC A;  2DBY A;  3RB0 A;  4F5P A;  2Y9T A;  2AU0 A;  5HR9 A;  2YQE A;  5J2J A;  5CFS A;  3SD7 A;  4FBU A;  4NXU A;  8ICH A;  3ISB A;  4O3M A;  4FH3 A;  2BZF A;  2OYY A;  5AI6 A;  5KAI U;  3FM9 A;  1COK A;  1SXD A;  1MIW A;  3QU9 A;  3MR3 A;  2KN7 A;  1UT5 A;  2KG5 A;  2B51 A;  1JRO A;  1XSN A;  3G6Y A;  5AI9 A;  4DOA A;  9ICM A;  1NJX A;  4EEK A;  4IRD A;  8ICB A;  3H8M A;  2LHT A;  4JV0 A;  3QXG A;  5F3X B;  2P66 A;  4KLG A;  1LVH A;  4X4V A;  3MR5 A;  4ECV A;  3RB4 A;  5C5J A;  3A0H U;  5ALT A;  3KKA C;  2HOI A;  1IV8 A;  1NK9 A;  1WCN A;  2LI6 A;  4LZD A;  2KFN A;  2EAM A;  3DDH A;  1YZ7 A;  1ZOL A;  2H3Q A;  2OCE A;  3PW0 A;  4WC4 A;  3RJH A;  4ELV A;  4O3N A;  2W7O A;  2WFA A;  2WF8 A;  2KTQ A;  4ECW A;  1ZQH A;  3NKU A;  5HMM A;  2QAR A;  1Q46 A;  2V4Q A;  4WC3 A;  3OHA A;  1NZB A;  5HRH A;  4LEY A;  2FPK A;  5KG4 A;  5F9N A;  2IHM A;  4KLE A;  2PFP A;  4FE3 A;  4K9A A;  2G5I B;  2KK0 A;  4RQ7 A;  3T79 A;  9ICC A;  3HRD D;  3WK8 A;  4E7X A;  4Y2R A;  3GV7 B;  5H2F U;  4EYI B;  4IG8 A;  3K1Z A;  3BZC A;  2J6S A;  3KZI U;  4TQS A;  3RTV A;  1D8B A;  4UB1 A;  3IG8 A;  2PFN A;  2BCU A;  2AH5 A;  2HN2 A;  4M6W A;  5HNK A;  1N62 A;  2XCP A;  4CRX A;  1RG6 A;  3V6H A;  4QWC A;  1XO1 A;  5J2D A;  4GIB A;  2R8K A;  2BKE A;  4PGQ A;  2W9B A;  2JEG A;  3PR4 A;  4FHW A;  1S8O A;  2OM6 A;  3MR6 A;  2KVC A;  2E3T A;  4DOC A;  5KAF U;  1R8A A;  1OW5 A;  9ICF A;  9ICB A;  4NLC A;  3UPQ A;  3C66 A;  1J2M A;  2W55 A;  4B9N A;  3NRW A;  5J8Y A;  2BPC A;  2BCV A;  5T14 A;  3SV4 A;  3ZDD A;  2ISO A;  1QQ7 A;  4Q8F A;  5L1M A;  5J0X A;  2HHQ A;  4DFJ A;  3KHR A;  1AQ6 A;  3KTQ A;  1RM6 C;  2A19 A;  3D2S A;  4NLB A;  2FDR A;  1S0N A;  5EWF A;  2LM1 A;  4NL9 C;  2OXO A;  5KFH A;  4B6J A;  4R64 A;  3SV3 A;  3WFO A;  1PVR A;  5ALM A;  2R8I A;  5TIS U;  4WJ3 B;  4NJ8 A;  2KSO B;  3K4G A;  5G5G A;  4UBB A;  3M7D A;  4UQG A;  2UVR A;  2DQN B;  9ICX A;  2DUY A;  4M9H A;  4G3I A;  2PFQ A;  3RRH A;  4DO9 A;  4NKT A;  3BQ0 A;  4DL7 A;  3BQ2 A;  2PMZ F;  2AXT U;  2CXY A;  4DQR A;  5HP4 A;  1U4B A;  4UD4 A;  2HW3 A;  5AM0 A;  1V97 A;  4FS1 A;  4KLT A;  5HHI A;  3NTU A;  4EYH B;  4UW9 A;  1T4G A;  4UAS A;  2RRD A;  5ALW A;  5DKW A;  3ZI4 A;  5KFZ A;  4US8 A;  4GXK A;  3L5K A;  5AM3 A;  3QZ7 A;  3RFA A;  2ZH5 A;  4GXJ A;  5HHH A;  4GLX A;  2ZIX A;  5DG7 A;  2QB0 A;  4DS4 A;  4EGW A;  3WKC A;  2C2D A;  2A3V A;  4I28 A;  3A0B U;  4Z6F A;  2AHO B;  3GIL A;  1L7O A;  1WUD A;  3ZD8 A;  4KM5 A;  4PZN A;  4E0D A;  3UPS A;  4YR0 A;  5HRB A;  2G5H B;  2W9M A;  5KFF A;  1IIP A;  2W9C A;  5KL1 B;  2XIC A;  4YD2 A;  2BE3 A;  4YQW A;  1TK8 A;  2XO7 A;  1Z1V A;  4JV2 A;  3RH5 A;  4DSI A;  4OO1 J;  3RBD A;  2XID A;  5ALS A;  2O1P A;  1X9S A;  3TAP A;  7ICE A;  1ZQB A;  5D63 A;  5TZV A;  5EWG A;  5ALY A;  4LEZ A;  3KHL A;  4DF8 A;  2A1J B;  4EX6 A;  4K99 A;  4EEY A;  3TAQ A;  3O0F A;  3OVS A;  1Z4N A;  4ECT A;  3GQC A;  2HVH A;  3SR6 A;  2RDI A;  4MEY A;  2W3S A;  4ECU A;  2EZX A;  4OJ5 A;  5ALU A;  4MHV A;  3WU2 U;  4IRK A;  5JTG A;  2DKX A;  3KKA A;  1TFW A;  2J6U A;  2ODG A;  2VAN A;  1F5S A;  1TV9 A;  4RPY A;  2WB1 F;  5IIK A;  4QZE A;  1ARO P;  3AU2 A;  4I2C A;  2EAN A;  4KX5 A;  1SB3 C;  4OAF A;  1IM4 A;  5JTI A;  2OHF A;  1TVA A;  3BDP A;  1ZQX A;  1KFT A;  5DLF A;  2W11 A;  4EEL A;  4DL4 A;  4PHA A;  1D8Y A;  5JU5 A;  2KZZ A;  4O69 A;  1TAQ A;  4PJ0 U;  7ICP A;  1F5A A;  1PX5 A;  2JMG A;  5ALK A;  4TUP A;  4WQL A;  4KLJ A;  4PHD A;  1R89 A;  3SZ2 A;  3QU4 A;  2Y1I A;  2BQ3 A;  4OJ6 A;  5D49 A;  8ICY A;  1DGS A;  3PY8 A;  3WKA A;  1X2I A;  1L5U A;  2EQY A;  3ER8 C;  5AKK A;  3OUY B;  2BHN A;  1Q3V A;  4F4W A;  2WF6 A;  2G0A A;  3PR5 B;  3T5H A;  1RYU A;  3RJG A;  3THV A;  1SL2 A;  9ICP A;  3N97 B;  5CP2 A;  5ALZ A;  5ALD A;  1BNP A;  4OAH A;  4WOY A;  2XY6 A;  3PX4 A;  1XSP A;  1JIH A;  2HHV A;  2KNJ A;  2B21 A;  4F2R A;  7ICK A;  4BWJ A;  4ED6 A;  3D2Q A;  8ICW A;  1S0M A;  2ZH3 A;  3Q8R B;  4Z6E A;  4IQU A;  4KMU A;  2KJ9 A;  3E2E A;  1CEZ A;  2KHV A;  3HT3 A;  1ED1 A;  2IOF K;  8ICI A;  4UAR A;  1Q8K A;  1QQ5 A;  2I9G A;  3PML A;  3QUB A;  4UAU A;  2HHU A;  2C2E A;  4RWN A;  1LKY B;  2BBH A;  4IR1 A;  4Z6C A;  4FZL A;  4KLO A;  3ZDB A;  3WKB A;  3PX6 A;  4M04 A;  3H8J A;  3C2K A;  5AIC A;  4NL9 A;  2Q66 A;  2FCL A;  7ICM A;  1FA0 A;  3H8S A;  4I2G A;  1DXS A;  2O6K A;  2JGA A;  4R63 A;  2HOF A;  4M47 A;  4M5D A;  5B3Q A;  5CWR A;  4HX0 A;  1JXE A;  3WK5 A;  4QZB A;  4DF4 A;  4YR2 A;  4B9T A;  5K4L A;  1RPL A;  3QU7 A;  4LEW A;  1VLB A;  3RH4 A;  1RYR A;  1F44 A;  1A0P A;  5KFN A;  2JV3 A;  4EEN A;  1N2X A;  2GLE A;  1CUK A;  2PMZ C;  5J2F A;  2VIX A;  1T7P A;  4NLK A;  2G06 A;  3TI0 A;  1S10 A;  4M2Y A;  2B6G A;  4LZG A;  4ED1 A;  4QZD A;  1ZQD A;  5J0Q A;  5KT6 A;  2VA3 A;  4O9M A;  7ICI A;  3PZP A;  2ZTE A;  4JV1 A;  5IIJ A;  7ICG A;  2M2T A;  1ZD4 A;  3C21 A;  3H37 A;  3NGD A;  3CNH A;  4ED2 A;  5AKX A;  8ICK A;  2E8M A;  4OJL A;  8ICX A;  1TE2 A;  2ZUB A;  3IDW A;  2HMX A;  4NXT A;  1LB2 B;  4UB2 A;  4F4Z A;  4NLZ A;  1UT8 A;  1T3N A;  4FHP A;  1Q79 A;  4WC2 A;  4QZC A;  1VJ7 A;  1TK5 A;  2P6U A;  4NV0 A;  3OWG A;  9ICW A;  4PH5 A;  3RJF A;  4NKU A;  3MDC A;  4CCH A;  1BPE A;  4YG2 A;  9ICI A;  5IIM A;  5KFQ A;  5DED A;  4TUQ A;  1RZT A;  1UA0 A;  3M9O B;  2R8H A;  5J0S A;  2AJQ A;  3I1Y A;  4RNO A;  3BQT A;  3OJS A;  4NLG A;  3ONN A;  5KG7 A;  2R8G A;  2JH1 A;  4RZR A;  3BQ1 A;  1NK0 A;  5KFU A;  3BQ7 A;  2ZIX B;  2HDO A;  5L1I A;  4O3P A;  1N60 A;  2ASJ A;  3D2N A;  1S5L U;  4M9G A;  5DDM A;  2FMQ A;  2ZIW A;  4KTQ A;  4DCC A;  3KZX A;  4C8O A;  4RUC A;  4EZ9 A;  2DWQ A;  3NWI A;  4DFP A;  4KX3 A;  3Q8S B;  4GXI A;  2F8K A;  5GTH U;  5KL8 B;  4DQI A;  3UXP A;  3PO4 A;  3RRG A;  2A1J A;  1T8E A;  1J2N A;  4C7Y A;  4AT8 A;  3Q8Q B;  5J2E A;  3TAR A;  4C8M A;  4R8U B;  1GO3 F;  2HCF A;  3C5G A;  5JUM A;  1Z1B A;  5ALJ A;  3JZ0 A;  3C5F A;  2K4P A;  4A8E A;  3MGH A;  3NVO A;  3ZDA A;  3BS5 B;  3UM9 A;  1MC8 A;  3C28 A;  1X40 A;  3AQL A;  2V9W A;  4YVZ A;  4OCZ A;  3GDX A;  3LYS A;  5F9L A;  1B0X A;  5KT7 A;  1L8O A;  4I2H A;  3FYH A;  5EE1 A;  4NXX A;  4QWE A;  4OAI Z;  1ZQZ A;  1BPY A;  3HJE A;  2HVI A;  5EE3 A;  2NRZ A;  4YXJ A;  4RQ1 A;  2MAX A;  2J6T A;  3MFH A;  4UAV A;  1ZQA A;  5KFL A;  5DGA A;  1U45 A;  4Y2U A;  2FPM A;  4C0Z A;  2NV3 A;  5DB9 A;  3AQE A;  4I2J A;  4ATB B;  4PGX A;  2DR8 A;  2ES6 A;  2ZJA A;  1X9W A;  5DQI A;  1JAJ A;  3GFK B;  3OUY A;  3T5K A;  3E0F A;  5KG6 A;  4MFA A;  4PL2 A;  4MF8 A;  5ALN A;  4QZI A;  2JZB B;  3TKA A;  1S0V A;  1MN8 A;  4NM2 A;  3H40 A;  1NZP A;  1X9M A;  3SAH A;  4IL6 U;  2B4V A;  3N7P D;  4C7Z A;  4ZH4 A;  3FAH A;  5ALL A;  1NJY A;  3TAD C;  4O5C A;  3TFS A;  4AP9 A;  3SYZ A;  4YN4 A;  2I5H A;  5DG9 A;  5AK6 A;  5CFT A;  4WQK A;  5KT5 A;  1U47 A;  4ELT A;  1M6Y A;  4US9 A;  4X4Q A;  2W03 A;  2ZH6 A;  2Y1J A;  4BUG A;  4KIT B;  1LKY A;  2AGQ A;  1FEZ A;  1X42 A;  1O08 A;  2DGZ A;  5IIN A;  2BBJ A;  4FHX A;  4QZH A;  2HHW A;  5AI0 A;  5AK4 A;  4KLQ A;  3JPP A;  2OWO A;  1ZQI A;  4UAY A;  3V6J A;  4KLF A;  3PX0 A;  5AM1 A;  4K9B A;  2BCS A;  7ICJ A;  4NXV A;  2RHF A;  4RWO A;  3LWM A;  5ALE A;  4QIW F;  3WFP A;  4ECS A;  2M2W A;  3ZDC A;  4QZ8 A;  2FLN A;  4C4S A;  1S97 A;  4RWP A;  4USA A;  5J2H A;  3IP4 B;  2HBL A;  2DPJ A;  1A6S A;  4IC9 A;  5BPC A;  4P2H A;  3L4P A;  1SWV A;  1N5W A;  4FO6 A;  3CRX A;  3H38 A;  2ZTC A;  4Y2Q A;  1QLN A;  4RNM A;  2W3R A;  3ICX A;  3K7D A;  2H3Z A;  3UXN A;  3HKZ F;  2XVT A;  7ICV A;  7ICH A;  1ZQG A;  3KBB A;  4K4H A;  4C80 A;  3H0R B;  4X4P A;  4QJF B;  1SKW A;  1ZQJ A;  1N56 A;  4DWI A;  3KOO A;  4ECY A;  5AK5 A;  5HRF A;  4S3N A;  1NK4 A;  4RPZ A;  1S76 D;  2I6X A;  1QQ6 A;  1X9X A;  5AI5 A;  2IMW P;  1MQ3 A;  2R18 A;  4MKP A;  2XC9 A;  7ICO A;  3SEN A;  4O68 A;  2Y0S C;  3Q8P B;  2AQ4 A;  9ICR A;  2RDJ A;  2PI4 A;  4X4R A;  1SWW A;  3LVW A;  9ICE A;  3EYZ A;  4AT7 A;  2HOQ A;  3RJJ A;  5ALO A;  2RLT A;  3NVV A;  2UVU A;  2G08 A;  2IOH A;  7ICR A;  1KRP A;  3OTQ A;  4Y2Y A;  2E1F A;  2KIW A;  2F1J A;  1T94 A;  4JMU A;  4FBT A;  5CB1 A;  1DK3 A;  2WAQ F;  1SV4 A;  1TKD A;  3SQI A;  2EAO A;  9ICL A;  4DQQ A;  4ECR A;  3C29 A;  2Y9U A;  4Y2S A;  3I28 A;  3C18 A;  5G5H A;  2ZIV B;  4F5O A;  1D8L A;  2G09 A;  4UB5 A;  5D4B A;  3LDA A;  3TFR A;  4Q8E A;  2HBK A;  1B4F A;  3BZK A;  4UAT A;  3GU3 A;  1L7N A;  5J2K A;  5J0Y A;  5HC9 A;  1SL0 A;  3MC1 A;  1UA1 A;  3QEA Z;  2XGP A;  2VA8 A;  3F5E A;  4B9L A;  1XWL A;  4ED8 A;  2YMM A;  5KFM A;  4AT9 B;  3NUQ A;  1Z00 B;  3ED5 A;  1ZRM A;  1ZQS A;  4DL5 A;  1N63 A;  3KHG A;  5J0O A;  3JPQ A;  1WWV A;  4QZF A;  1NK5 A;  4K4G A;  4DL3 A;  2ZIW B;  2A1A A;  3EUB 2;  2K4I A;  4PZO A;  3RB6 A;  1MQ2 A;  4F93 B;  2KEY A;  4BWM A;  5KG0 A;  2JRZ A;  1CRX A;  5D61 A;  4K97 A;  4EED A;  4O6A A;  5EE0 A;  3NRZ A;  4O5K A;  5JRT A;  3SI8 A;  4NXW A;  3I76 A;  2DPI A;  4M9J A;  4R8U A;  5J2G A;  4Q43 A;  2W8L A;  1K1S A;  3C2L A;  4EBC A;  4AT8 B;  2PI5 A;  1XS9 D;  3HPO A;  5KFK A;  4P4M A;  5J0T A;  2DR5 A;  1ZQU A;  1ZYQ A;  3BS5 A;  4KN7 A;  1ZRN A;  4DQS A;  2YB1 A;  1BPD A;  3EPI A;  2CRX A;  1UPH A;  2AQ0 A;  3OVA A;  4F72 A;  3GIJ A;  2E8P A;  5KG5 A;  5DBB A;  3PO5 A;  2WF7 A;  3MGV A;  1RXW A;  2D6F C;  2HBM A;  2JXJ A;  2NRK A;  5AKZ A;  3TAD A;  1ZQR A;  8ICU A;  3V6K A;  3FC4 A;  3AQK A;  2ZH1 A;  4P4P A;  3MAB A;  3GV5 B;  5GTI U;  4Y2X A;  1NJW A;  7ICL A;  1NI3 A;  4N7R A;  3GII A;  1NKC A;  2GOL A;  1L7M A;  2BQR A;  4ATB A;  4RQ6 A;  4LEV A;  4X4S A;  2NO5 A;  4EP7 A;  1RQN A;  2VJ5 A;  3M8S A;  1TAM A;  4GC7 A;  3WFQ E;  2BPG A;  4B9V A;  4GC6 A;  3QNM A;  4BJQ A;  2XGQ A;  1KFD A;  2E8O A;  1ZQ1 C;  2JZB A;  3C23 A;  4UAW A;  1U49 A;  3PHZ A;  2YY6 A;  2GO7 A;  3C1Y A;  4UB8 U;  1ZQK A;  3JPS A;  4XRH A;  4RQ2 A;  1U48 A;  4KN4 A;  2MSN A;  3J81 j;  7ICS A;  3PV8 A;  2NO4 A;  5B3P A;  4RQM A;  2F1I A;  1KLN A;  2L5Y A;  4E8F A;  3LVV A;  3WKE A;  1ZQY A;  8ICR A;  2MUT B;  4NWI A;  2KFZ A;  2LBO A;  3MBY A;  3AU6 A;  5EE9 A;  2ZTD A;  3IHQ B;  1XC9 A;  5AKH A;  4DSK A;  4YD1 A;  5FP0 A;  1KFS A;  5ALX A;  5J29 A;  1BVS A;  4FS2 A;  9ICU A;  1N48 A;  3AEV A;  1TFY A;  2WTF A;  4YP3 A;  2HI0 A;  4PHE A;  5KFS A;  4QW8 A;  1URJ A;  3IG5 A;  4YR3 A;  3FDS A;  4RQ3 A;  5HRI A;  5KT2 A;  3OPX A;  4I0U A;  2PXI A;  1X6I A;  3OVB A;  1UET A;  2KP7 A;  4RPX A;  5C0Y A;  3DV9 A;  4M9N A;  3HIL A;  3QU2 A;  4K98 A;  1PK1 B;  4DSE A;  2EWR A;  5J0U A;  3V7L A;  3C1Z A;  3AN1 A;  4U6P A;  4NM1 A;  4F71 A;  1Q3U A;  3M1Y A;  3GIM A;  3PMN A;  1NKE A;  1KN5 A;  2KZ3 A;  4IR9 A;  2K8B B;  4O3R A;  1V85 A;  4K96 A;  2XY5 A;  2ZH7 A;  4X0A A;  3RAQ A;  5KFW A;  8ICJ A;  2DRA A;  1KTQ A;  2KIV A;  2B56 A;  3V7J A;  5ALI A;  3RH6 A;  3BS7 A;  2JH7 A;  2KVS A;  2ALZ A;  2I1Q A;  2W7P A;  2DR7 A;  4EX7 A;  3KFU F;  5KFJ A;  2F76 X;  2MA1 A;  1PUZ A;  3MGI A;  3M9M B;  3IN5 A;  3QU5 A;  2ZXI A;  1ZQW A;  2D8C A;  1ZQP A;  2KKP A;  1JN3 A;  4EEB A;  3EPG A;  2XY7 A;  1OU5 A;  4Q44 A;  4I2A A;  2XCA A;  4K4I A;  2MRL A;  3DEE A;  3RF9 A;  2PBE A;  5J0W A;  4F5R A;  3EWA A;  4J03 A;  1B22 A;  4AT7 B;  2HBJ A;  1BGX T;  4F3O A;  4LVS A;  2KV2 A;  1ZD2 P;  3OJU A;  3L3F X;  4ED7 A;  2H3F A;  2DR9 A;  2GH1 A;  2FPL A;  4XQ7 A;  2IA6 A;  3JCF A;  2BR0 A;  1TAU A;  3T5J A;  1ZXI A;  5ALR A;  4PPX A;  4JWN A;  8ICV A;  4F50 A;  2ZIV A;  2ZJ8 A;  5EWE A;  1EXN A;  4J9K A;  1K1Q A;  7ICT A;  1HJP A;  1VJ5 A;  5HR7 A;  3SAG A;  4PGY A;  1ZQF A;  1P7D A;  2E8N A;  1KKX A;  3M9N B;  1L6N A;  4CF3 A;  2F77 X;  3LQC B;  1HUO A;  4RUA A;  1QTM A;  5F2V O;  2ZUD A;  1UEV A;  3AQM A;  2C2R A;  1ZD3 A;  5KG1 A;  3AUO A;  2PFO A;  4AT9 A;  3HP6 A;  1Z00 A;  3SEI A;  3Q8K A;  1SL1 A;  5EOZ A;  4LJX A;  1NKB A;  4QNL A;  4C8N A;  1MA7 A;  3QUT A;  2CN1 A;  2H5X A;  3UXO A;  5L1J A;  1X66 A;  2GA9 D;  3CP8 A;  2W9A A;  5DEC A;  4UD5 A;  4DL6 A;  4KLD A;  2WB1 C;  2H3V A;  4KLL A;  1JRP A;  2K89 A;  4EBD A;  1C7Y A;  4KB6 A;  4ACO A;  4FFD A;  2ZH2 A;  1NJZ A;  1Z4O A;  4ECX A;  3T5L A;  1VDV A;  4BX9 C;  4K8V A;  2YMP A;  5J0R A;  2BCR A;  3B0X A;  1OUQ A;  3RR7 A;  2JEJ A;  3K75 D;  3ETR A;  4MFC A;  4KLU A;  5B66 U;  2Q0Z X;  5AKI A;  2KHQ A;  5KFV A;  3IRU A;  1KBU A;  2YTU A;  2YN4 A;  1UHU A;  3PW7 A;  4WC5 A;  2ZH8 A;  3ETL A;  2UVW A;  1KQQ A;  4J9Q A;  4UAZ A;  1V38 A;  3EZ5 A;  4BXO B;  3N28 A;  5DLG A;  4QZG A;  3F5A A;  5KFT A;  4I27 A;  4M0A A;  4EZ6 A;  3WK7 A;  4KLM A;  3RR8 A;  4O0I A;  9ICS A;  3M6K A;  2KE7 A;  2FI1 A;  2K8A A;  3BJY A;  3PST A;  5HR6 A;  1ZQQ A;  5AKY A;  4XA5 A;  5AK3 A;  3RBE A;  5KFR A;  3N4M B;  4E80 A;  3WK9 A;  2OEH A;  3AM9 A;  5ALG A;  4J9R A;  2FMS A;  4FZM A;  4PL1 A;  5DBA A;  2LYA A;  1L8L A;  4F92 B;  4DLE A;  3K1R B;  3D6J A;  5ALV A;  2LYH A;  2KOB A;  1RXV A;  4HAI A;  4P0P B;  3N7R C;  4QWA A;  9ICO A;  2RFF A;  1Q78 A;  3NAS A;  1A76 A;  2IOF A;  5DB6 A;  3PNC A;  3JPR A;  1NK7 A;  1YZ6 A;  2W54 A;  3HX0 A;  1JUD A;  1FFV A;  2MUT A;  4YMM A;  3H4B A;  4QWD A;  1Z19 A;  4CE6 A;  8ICP A;  4IRC A;  4PHP A;  3JYY A;  3Q8M A;  4X4O A;  5HRE A;  1MIY A;  1XSL A;  3WK6 A;  5AKL A;  2H3I A;  4Y2T A;  2WF9 A;  1SZP A;  4UBC A;  1ZQV A;  4ZOH C;  2KJ5 A;  1WOT A;  2M0N A;  4DLG A;  4O5E A;  2ZG6 A;  3QUQ A;  4IQW A;  2QKQ A;  1PK1 A;  2K8C B;  3GIK A;  1DK2 A;  3NS1 A;  2W04 A;  4J9S A;  3VCB A;  2ZIU B;  5E79 U;  1NK6 A;  3Q8L A;  3RJK A;  2ATL A;  2LMR A;  2F8L A;  4J9M A;  3SAF A;  4X4N A;  4BGD A;  4I29 A;  4CF4 A;  1IG6 A;  3B0Y A;  5AM5 A;  2HHP A;  5CHG A;  4KLS A;  2ZHB A;  2JEF A;  5CFU A;  4WH5 A;  1GPJ A;  7ICQ A;  3QYP A;  4JWM A;  3H0L B;  3PW4 A;  4I2E A;  1ZQO A;  4JUZ A;  1OXJ A;  4OJP A;  3PW5 A;  3HW8 A;  8ICE A;  4O3S A;  4IQV A;  4NLN A;  5ALF A;  5DBC A;  4UB3 A;  5AM4 A;  5KT4 A;  4DL2 A;  5D62 A;  5KFE A;  1DGJ A;  4FH5 A;  3PSF A;  1R8C A;  4ICA A;  4O67 A;  3F2B A;  4YMN A;  2HHS A;  2VJ4 A;  2O5A A;  1KEJ A;  4TQR A;  4DSL A;  1N61 A;  3QX7 A;  1JX4 A;  1WWU A;  5DG8 A;  4NY8 A;  1KL9 A;  3RJE A;  4F4Y A;  3RB3 A;  2GAF D;  8ICA A;  4TUS A;  3ERC C;  1IXR A;  2EZZ A;  4TUR A;  2P6R A;  1VFG A;  5KFG A;  1COO A;  4KMO B;  1N5X A;  5KFO A;  2LM4 A;  5A0L A;  4DOB A;  3AL0 B;  4G9B A;  2FLL A;  1CI4 A;  4C4R A;  2ZH9 A;  9ICA A;  8ICM A;  4I2I A;  4RNN A;  2ASL A;  2HN1 A;  1D9F A;  1ZQE A;  5ALH A;  4F2S A;  2K4E A;  1XNS A;  1HUZ A;  1JMS A;  1NO5 A;  4R65 A;  4JK1 A;  1S77 D;  4ED0 A;  1U9L A;  4CF5 A;  5J2I A;  3JPO A;  3JPT A;  4CGZ A;  5BOM A;  4J9L A;  4DFD A;  1DOQ A;  1SZH A;  3ER9 B;  3QUC A;  4Q45 A;  2E1E A;  3V7K A;  4WC0 A;  4OJO A;  4R66 A;  5DGB A;  1F0M A;  1SGG A;  4F4X A;  2P35 A;  4RQN A;  4X0B A;  3TAN A;  2F44 A;  4DSJ A;  1L3V A;  1D9D A;  2FE9 A;  1QH9 A;  2RQ5 A;  3UMB A;  4WC1 A;  4P0Q B;  3OSP A;  4WBY A;  2EZY A;  3F2C A;  4FHY A;  2DVI A;  3GV8 B;  1ZET A;  2ZJ5 A;  5ALP A;  1FFU A; 
#chains in the Genus database with same CATH homology
 5KG7 A;  1N48 A;  9ICU A;  2R8G A;  1TFY A;  2WTF A;  4YP3 A;  4RZR A;  1V9P A;  3PW0 A;  4WC4 A;  4B9M A;  4PHE A;  3MR2 A;  3BQ1 A;  1NK0 A;  5KFU A;  4RT3 A;  3RJH A;  5KFS A;  4QW8 A;  4O3N A;  4ELV A;  3ORY A;  7ICN A;  4YR3 A;  2KTQ A;  3OV7 A;  4ECW A;  3FDS A;  1ZQH A;  1NOM A;  5L1I A;  4RQ3 A;  5HMM A;  4O3P A;  5KT2 A;  5HRI A;  1WCL A;  2PXI A;  2V4Q A;  4WC3 A;  3V72 A;  3OHA A;  3OVB A;  5HRH A;  1UET A;  2KP7 A;  5DQG A;  4RPX A;  2ASJ A;  2FPK A;  5KG4 A;  4X5V A;  4M9N A;  4M9G A;  5DDM A;  5F9N A;  1TK0 A;  5KT3 A;  2IHM A;  1RYS A;  4KLE A;  1NO5 A;  2FMQ A;  2PFP A;  4KTQ A;  4DSE A;  5HML A;  4XUS A;  5J0U A;  4RQ7 A;  4MEX A;  2ZUC A;  3V7L A;  3C1Z A;  5BOL A;  1ZQM A;  4C8O A;  4NM1 A;  9ICC A;  4RUC A;  4EZ9 A;  4E7X A;  4DFP A;  2HHT A;  3GIM A;  3GV7 B;  4EYI B;  3PMN A;  3Q8S B;  4GXI A;  5KFC A;  1NKE A;  4IG8 A;  2KZ3 A;  2J6S A;  4IR9 A;  4TQS A;  5CJ7 A;  4DQI A;  3RTV A;  4O3R A;  4UB1 A;  7ICU A;  2PFN A;  3UXP A;  3PO4 A;  3RRG A;  4RQ0 A;  2BCU A;  4M6W A;  5HNK A;  2ZHA A;  2XY5 A;  2XCP A;  2ZH7 A;  3V6H A;  2A1J A;  4QWC A;  3RJI A;  1XO1 A;  5J2D A;  1T8E A;  4X0A A;  3RAQ A;  5KFW A;  2FLP A;  8ICJ A;  4AT8 A;  3Q8Q B;  2DRA A;  5J2E A;  3H8W A;  5DB8 A;  4C8M A;  4R8U B;  3TAR A;  4X4U A;  2R8K A;  1KTQ A;  2BKE A;  4PGQ A;  5KFB A;  2W9B A;  2JEG A;  3PR4 A;  3C5G A;  4FHW A;  5JUM A;  9ICJ A;  3JZ0 A;  1Y88 A;  3V7J A;  3C5F A;  4BXO A;  3MR6 A;  9ICN A;  3RH6 A;  2ALZ A;  4DOC A;  3MGH A;  1R8A A;  2I1Q A;  2DR7 A;  9ICF A;  3ZDA A;  5KFJ A;  1MC8 A;  5L9X A;  7ICF A;  9ICB A;  3MGI A;  3RAX A;  3AQL A;  3UPQ A;  2V9W A;  3C66 A;  4YVZ A;  3M9M B;  4B9N A;  8ICL A;  5L1K A;  3TQ1 A;  3GDX A;  2BPC A;  1ZQW A;  1NK8 A;  5F9L A;  2NRW A;  1ZQP A;  2BCV A;  5KT7 A;  4IQT A;  4I2H A;  3FYH A;  3SV4 A;  1JN3 A;  3ZDD A;  3EPG A;  1BPZ A;  2ISO A;  2XY7 A;  1OU5 A;  4MF2 A;  4Q44 A;  4I2A A;  4Q8F A;  2XCA A;  2AGP A;  2BPF A;  5J0X A;  2HHX A;  1XU4 A;  4UB4 A;  2HHQ A;  4DFJ A;  2DFL A;  3KHR A;  4QWE A;  1KDH A;  4K4I A;  3KTQ A;  1ZQZ A;  1BPY A;  4DFK A;  2HVI A;  4DEZ A;  2NRZ A;  4YXJ A;  2PBE A;  4RQ1 A;  2MAX A;  5J0W A;  3MFH A;  3EWA A;  4F5R A;  5EWF A;  1S0N A;  5IIO A;  5KFL A;  1ZQA A;  5DGA A;  1U45 A;  1B22 A;  4AT7 B;  9ICT A;  5KFH A;  2FPM A;  1BGX T;  4R64 A;  5DB9 A;  3SV3 A;  4F3O A;  4LVS A;  3WFO A;  4I2J A;  4ATB B;  4PGX A;  2DR8 A;  3QEB Z;  2ZJA A;  2R8I A;  4QZA A;  4YFK A;  3OJU A;  3K4G A;  4UBB A;  4UQG A;  1X9W A;  5DQI A;  2UVR A;  8ICG A;  4ED7 A;  1ZJN A;  9ICX A;  2DR9 A;  3NYB A;  4M9H A;  1JAJ A;  3QZ8 A;  2FPL A;  3GFK B;  4G3I A;  3PW2 A;  2PFQ A;  3T5K A;  2IA6 A;  5CR0 A;  3RRH A;  4HYK A;  2BR0 A;  5KG6 A;  4XQ7 A;  4DO9 A;  1TAU A;  4NKT A;  3BQ0 A;  4DL7 A;  1S0O A;  4MFA A;  3BQ2 A;  3T5J A;  8ICZ A;  4PPX A;  4JWN A;  2FMP A;  4MF8 A;  4F50 A;  3T3F A;  2ZJ8 A;  8ICV A;  3AQN A;  4F5N A;  4DQR A;  5HP4 A;  4O3Q A;  4QZI A;  2JZB B;  1U4B A;  2HW3 A;  4UD4 A;  1S0V A;  5EWE A;  4NM2 A;  2BCQ A;  3H40 A;  1L3T A;  1EXN A;  2W8K A;  1X9M A;  4FS1 A;  4KLT A;  4J9K A;  1NZP A;  1K1Q A;  7ICT A;  4RQ5 A;  4M9L A;  5HHI A;  1L3U A;  3H7I A;  1HJP A;  3NTU A;  4PGY A;  4EYH B;  1ZQN A;  1ZQF A;  1TFR A;  1T4G A;  4FHV A;  4ZH4 A;  1Z3E B;  4RQ8 A;  3M9N B;  1NJY A;  4O5C A;  3TFS A;  5DKW A;  4YXM A;  3SYZ A;  4YN4 A;  2M2U A;  5KFZ A;  3LQC B;  5DDY A;  5DG9 A;  5KG2 A;  1HUO A;  4RUA A;  1QTM A;  5F2V O;  2ZUD A;  1UEV A;  3AQM A;  4GXK A;  2C2R A;  5KG1 A;  3QZ7 A;  3AUO A;  2ZH5 A;  5KT5 A;  4GXJ A;  1U47 A;  2PFO A;  4ELT A;  4AT9 A;  5HHH A;  3HP6 A;  4WC6 A;  4GLX A;  1Z00 A;  4QW9 A;  3Q8K A;  4X4Q A;  2ZH6 A;  5DG7 A;  2Y1J A;  5J2C A;  2C22 A;  4KIT B;  4QZ9 A;  4DS4 A;  1SL1 A;  5EOZ A;  4KLH A;  2AGQ A;  4X4T A;  4DQP A;  1NKB A;  3M8R A;  2C2D A;  4C8N A;  3C2M A;  4J9N A;  2H5X A;  3UXO A;  4I28 A;  5IIN A;  4Z6F A;  3GIL A;  5L1J A;  1ZQL A;  4FHX A;  4QZH A;  2HHW A;  4KLQ A;  4J9O A;  3JPP A;  3ZD8 A;  2W9A A;  2OWO A;  3QE9 Y;  1ZQI A;  4UAY A;  4E0D A;  4UD5 A;  4DL6 A;  5DEC A;  4KLD A;  3UPS A;  3WFQ E;  4YR0 A;  5HRB A;  3V6J A;  4KLF A;  3PX0 A;  3WFR E;  1R8B A;  2W9M A;  5KFF A;  2BCS A;  4KLL A;  7ICJ A;  4EBK A;  4RWO A;  4XQ8 A;  3LWM A;  4EBD A;  1C7Y A;  2W9C A;  2VA2 A;  4YD2 A;  3MDA A;  2BE3 A;  3WFP A;  4YQW A;  4C8K A;  1TK8 A;  2ZH2 A;  4ECS A;  3UQ0 A;  2M2W A;  1NJZ A;  3ZDC A;  2XO7 A;  4QZ8 A;  1ZQT A;  2FLN A;  4ECX A;  4JV2 A;  1ZJM A;  3RH5 A;  1S97 A;  4DSI A;  4RWP A;  3RBD A;  5J2H A;  4Z6D A;  5KFX A;  2O1P A;  3T5L A;  1X9S A;  3TAP A;  5III A;  1ZQB A;  7ICE A;  1QSY A;  2DPJ A;  5TZV A;  5J0R A;  5EWG A;  5BPC A;  2BCR A;  3B0X A;  4P2H A;  4P4O A;  4C8L A;  3KHL A;  3RR7 A;  2JEJ A;  8ICT A;  4M6W B;  4I2B A;  5HRG A;  2DVI A;  3K75 D;  4DF8 A;  3ISC A;  3KHH A;  4FO6 A;  2A1J B;  4MFC A;  3H38 A;  4EEY A;  4KLU A;  2ZTC A;  4YCX A;  3HJ4 A;  3TAQ A;  1QLN A;  2Q0Z X;  3OVS A;  4RNM A;  4B9U A;  3UXN A;  3GQC A;  4ECT A;  2HVH A;  3HJ1 A;  5KFV A;  2RDI A;  4RQ4 A;  7ICV A;  7ICH A;  3PW7 A;  1ZQG A;  4WC5 A;  3H39 A;  4MEY A;  2W9B B;  2ZH8 A;  3ETL A;  2UVW A;  4F4K A;  1UEU A;  4DFM A;  4ECU A;  2R8J A;  3ZD9 A;  4J9Q A;  4K4H A;  4F8R A;  4RU9 A;  4UAZ A;  3EZ5 A;  4BXO B;  2ID1 A;  4ECQ A;  5DLG A;  4QZG A;  4X4P A;  5KFT A;  1A77 A;  4I27 A;  4M0A A;  1SKW A;  4EZ6 A;  2BQU A;  4IRK A;  1ZQJ A;  1N56 A;  4DWI A;  1MIV A;  5L1L A;  4ECY A;  5HRF A;  4S3N A;  1NK4 A;  4RPZ A;  1S76 D;  1TFW A;  4YMO A;  2J6U A;  2F1H A;  3RR8 A;  4BDP A;  4KLM A;  2VAN A;  5KG3 A;  4O0I A;  4EBJ A;  9ICS A;  1TV9 A;  3G6V A;  4RPY A;  2IMW P;  4WC7 A;  5IIK A;  1MQ3 A;  4QZE A;  2V4R A;  1S9F A;  2XC9 A;  7ICO A;  5HRL A;  1ARO P;  3AU2 A;  3BJY A;  4I2C A;  2GWS A;  1ZQQ A;  3Q8P B;  2AQ4 A;  9ICR A;  2RDJ A;  2PI4 A;  4X4R A;  1IM4 A;  1TVA A;  4XA5 A;  9ICE A;  4MFF A;  3BDP A;  1ZQX A;  3EYZ A;  1KFT A;  5KFD A;  4AT7 A;  5DLF A;  1D8Y A;  4DL4 A;  4PHA A;  2KZZ A;  3RBE A;  2DRB A;  5KFR A;  1TAQ A;  3HWT A;  3N4M B;  3RJJ A;  4E80 A;  7ICP A;  1F5A A;  1PX5 A;  1ZQC A;  2UVU A;  4TUP A;  1QSS A;  1PZN A;  7ICR A;  5KFP A;  4J9R A;  2FMS A;  4KLJ A;  1KRP A;  4PHD A;  5CA7 A;  5DBA A;  1R89 A;  3SZ2 A;  2Y1I A;  1KSP A;  4DLE A;  4F92 B;  4NXZ A;  2BQ3 A;  1B43 A;  2F1J A;  5D49 A;  3ZDE A;  8ICY A;  1DGS A;  3PY8 A;  2LYH A;  4FBT A;  3LWL A;  2AGO A;  1X2I A;  1L3S A;  1L5U A;  5CB1 A;  1RXV A;  1DK3 A;  4QWA A;  9ICO A;  1KNY A;  2RFF A;  1Q78 A;  3OUY B;  2BHN A;  4F4W A;  1TKD A;  3PNC A;  1A76 A;  1NK7 A;  5DB6 A;  9ICL A;  3JPR A;  3PR5 B;  4ECR A;  4DQQ A;  3T5H A;  3HX0 A;  3C18 A;  2MUT A;  4ED3 A;  3RJG A;  4YMM A;  3THV A;  1SL2 A;  4F5O A;  1D8L A;  3H4B A;  4QWD A;  4ECZ A;  3N97 B;  9ICP A;  5CP2 A;  1JQR A;  1BNP A;  4UB5 A;  5D4B A;  4IRC A;  4PHP A;  8ICP A;  3Q8M A;  3JYY A;  3LDA A;  3TFR A;  2XY6 A;  3PX4 A;  5HRE A;  1MIY A;  4WCW A;  4X4O A;  1XSP A;  9ICK A;  3UQ2 A;  4Q8E A;  1JIH A;  4ELU A;  2HHV A;  2J6T A;  5J2A A;  1XSL A;  4B9S A;  2B21 A;  3IM1 A;  5DQH A;  4F2R A;  4BWJ A;  7ICK A;  3HIY A;  4ED6 A;  3PVX A;  5J2K A;  3OSN A;  1SZP A;  5J0Y A;  1BPX A;  8ICW A;  5HC9 A;  1S0M A;  4QWB A;  4UBC A;  4I2F A;  1SL0 A;  3Q8R B;  9ICQ A;  2ZH3 A;  1UA1 A;  5KTQ A;  1ZQV A;  3H4D A;  3EW9 A;  4Z6E A;  4IQU A;  4J9P A;  4KMU A;  2XGP A;  3QEA Z;  5HRD A;  2VA8 A;  1WOT A;  3WFS C;  4DLG A;  1XWL A;  4B9L A;  4O5E A;  4ED8 A;  5KFY A;  4F91 B;  3E2E A;  5KFM A;  1CEZ A;  4DSF A;  4AT9 B;  8ICS A;  3HT3 A;  4IQW A;  2UVV A;  1Z00 B;  8ICI A;  2IBK A;  2I9G A;  1ZQS A;  3PML A;  4DL5 A;  3KHG A;  3GIK A;  1DK2 A;  2HHU A;  4RWN A;  5J0O A;  4J9S A;  2C2E A;  3JPQ A;  4QZF A;  1NK5 A;  1NK6 A;  2ISP A;  4K4G A;  3L9D A;  4IR1 A;  8ICN A;  4Z6C A;  4DL3 A;  4KLO A;  3Q8L A;  3RJK A;  2ATL A;  3ZDB A;  1JXL A;  4WBZ A;  4J9M A;  3RB6 A;  1MQ2 A;  4F93 B;  4BWM A;  4X4N A;  4BGD A;  3PX6 A;  5HRK A;  5KG0 A;  4M04 A;  3H8J A;  4I29 A;  3C2K A;  3B0Y A;  2HHP A;  2Q66 A;  3OGU A;  5CHG A;  2ZH4 A;  4O5K A;  4KLS A;  7ICM A;  1FA0 A;  3OHB A;  1H38 A;  2ZHB A;  3H8S A;  4I2G A;  5DB7 A;  2BGW A;  2JEF A;  4KLI A;  4I2D A;  1MSW D;  8ICF A;  3SI8 A;  4JWM A;  1QSL A;  1SKS A;  7ICQ A;  1SKR A;  2C28 A;  2M9N A;  4R63 A;  3PW4 A;  1LV5 A;  2DPI A;  2W9C B;  4M9J A;  1BNO A;  9ICH A;  4M47 A;  1V4A A;  4I2E A;  4M5D A;  4R8U A;  1ZQO A;  4JUZ A;  3PW5 A;  3HW8 A;  5CWR A;  5J2G A;  4Q43 A;  2W8L A;  8ICE A;  4LT6 A;  1JXE A;  4DF4 A;  1K1S A;  4QZB A;  4YR2 A;  3MFI A;  4B9T A;  4IQV A;  3C2L A;  4O3S A;  4NLN A;  4EBC A;  4AT8 B;  2PI5 A;  5KFA A;  5DBC A;  4UB3 A;  1RPL A;  1XS9 D;  5KT4 A;  3JPN A;  4DL2 A;  1BPB A;  5KFE A;  5KFK A;  3HPO A;  3RH4 A;  4P4M A;  4FH5 A;  1RYR A;  1R8C A;  5J0T A;  2DR5 A;  2ASD A;  1ZQU A;  9ICV A;  1ZYQ A;  2BDP A;  4YMN A;  2HHS A;  4KN7 A;  2M2V A;  5KFN A;  2O5A A;  4DQS A;  1BPD A;  1KEJ A;  3EPI A;  9ICG A;  4TQR A;  4DSL A;  1S77 D;  2AQ0 A;  1JX4 A;  3OVA A;  5DG8 A;  1CUK A;  3GIJ A;  4NY8 A;  8ICC A;  5J2F A;  3LK9 A;  4RWQ A;  1T7P A;  5KG5 A;  3RJE A;  5DBB A;  4NLK A;  3PO5 A;  4F4Y A;  1RXW A;  3RB3 A;  8ICA A;  4TUS A;  2NRK A;  4O3O A;  8ICU A;  1ZQR A;  2NRX A;  5J0P A;  3V6K A;  1IXR A;  4F5Q A;  5IIL A;  3TI0 A;  1S10 A;  3H3A A;  4TUR A;  4M2Y A;  3AQK A;  2ZH1 A;  4P4P A;  3MAB A;  2NRT A;  4LZG A;  1YLQ A;  2P6R A;  1VFG A;  4RT2 A;  5KFG A;  3GV5 B;  4ED1 A;  1COO A;  4QZD A;  1ZQD A;  5J0Q A;  5KT6 A;  5KFO A;  1NJW A;  2VA3 A;  4O9M A;  7ICI A;  7ICL A;  4DOB A;  3GII A;  5KFI A;  8ICQ A;  2ZTE A;  3G6X A;  1NKC A;  5IIJ A;  3ISD A;  4DS5 A;  4JV1 A;  2FLL A;  7ICG A;  2M2T A;  5J2B A;  8ICO A;  3C21 A;  2NRV A;  3H37 A;  2KZM A;  5D46 A;  2BQR A;  3NGD A;  4ED2 A;  2ZH9 A;  2IHN A;  9ICA A;  8ICK A;  8ICM A;  4ATB A;  2JEI A;  4RQ6 A;  4EBE A;  4I2I A;  4RNN A;  2ASL A;  8ICX A;  4EP7 A;  4X4S A;  1D9F A;  3RB0 A;  1ZQE A;  2ZUB A;  4F5P A;  1HUZ A;  2AU0 A;  4F2S A;  1LB2 B;  5HR9 A;  5J2J A;  3M8S A;  1JMS A;  4GC7 A;  4UB2 A;  4R65 A;  4F4Z A;  2BPG A;  4JK1 A;  4GC6 A;  4B9V A;  4NLZ A;  4ED0 A;  1U9L A;  1UT8 A;  2XGQ A;  1KFD A;  5J2I A;  1T3N A;  3JPO A;  3JPT A;  4FBU A;  5BOM A;  8ICH A;  1Q79 A;  3ISB A;  4J9L A;  4FHP A;  4WC2 A;  1DOQ A;  4FH3 A;  2JZB A;  4QZC A;  1VJ7 A;  3C23 A;  4Q45 A;  4UAW A;  1U49 A;  1TK5 A;  2P6U A;  1MIW A;  3V7K A;  4WC0 A;  3MR3 A;  3C1Y A;  1ZQK A;  2KN7 A;  1UT5 A;  9ICW A;  4PH5 A;  3RJF A;  3JPS A;  4R66 A;  4XRH A;  4NKU A;  4RQ2 A;  1U48 A;  3MDC A;  4CCH A;  5DGB A;  1XSN A;  4KN4 A;  4F4X A;  1BPE A;  3G6Y A;  7ICS A;  3PV8 A;  4YG2 A;  9ICI A;  4X0B A;  4DOA A;  5IIM A;  2F1I A;  5KFQ A;  3TAN A;  1NJX A;  1KLN A;  4DSJ A;  4IRD A;  8ICB A;  9ICM A;  5DED A;  4E8F A;  4TUQ A;  1RZT A;  4JV0 A;  1L3V A;  1D9D A;  1UA0 A;  2P66 A;  4KLG A;  4X4V A;  3M9O B;  1ZQY A;  3MR5 A;  2R8H A;  4ECV A;  3RB4 A;  5J0S A;  8ICR A;  5C5J A;  2MUT B;  2AJQ A;  4RNO A;  4WC1 A;  3OSP A;  2KFZ A;  4WBY A;  3BQT A;  3MBY A;  3OUY A;  3AU6 A;  4FHY A;  1NK9 A;  2ZTD A;  3IHQ B;  3OJS A;  1WCN A;  1XC9 A;  4LZD A;  4NLG A;  3GV8 B;  1ZET A;  4DSK A;  2ZJ5 A;  2KFN A;  4YD1 A;  1KFS A;  5J29 A;  1BVS A;  4FS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...