4UB1A

Dna polymerase beta product complex with a templating adenine and 8-oxodgmp, 90 s
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
321
structure length
317
Chain Sequence
NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 99
structure length 317
sequence length 321
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub1A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub1A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub1A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub1A03
4F50A 4QWCA 4CCHA 3ZDAA 1KLNA 4IRDA 1ZJMA 5KFBA 1OU5A 3Q8RB 4M9NA 4EBKA 3PX4A 4JWMA 2W8KA 1B43A 4XA5A 1D9FA 1RPLA 2JEGA 4RQ3A 1K1QA 1T7PA 5IIIA 3AQMA 4C8NA 4RUAA 5J0QA 4F5PA 1U45A 8ICMA 4PGQA 4NLKA 4IQTA 4NLZA 3KTQA 4KLOA 1ZQJA 4LT6A 4FHWA 4X4UA 2VANA 2AGOA 3IHQB 5L1IA 2ZH6A 2ZH7A 9ICIA 2ASLA 4O3OA 1DGSA 3KHLA 4DF8A 1LB2B 4LZGA 4I2FA 4K4HA 1S76D 9ICMA 9ICEA 4RQ7A 4YXMA 4JV0A 5KG1A 5CJ7A 3BQ2A 8ICHA 1PX5A 2BCSA 4XRHA 4RNNA 4UAYA 3ISBA 5L1KA 4NKUA 3GQCA 4YN4A 5BPCA 9ICHA 4R8UB 4AT9A 3LWLA 3MGHA 4J9LA 1UA0A 4JV1A 3RB3A 1KDHA 1ZQLA 2ID1A 3MR2A 4F2SA 2BE3A 2DR8A 2KTQA 2C2RA 4M9GA 2P6UA 5DQGA 5J0OA 3PR4A 4FHPA 4QZCA 3UPSA 1TK0A 4DS5A 1S9FA 4DSKA 2BPCA 2PFNA 3V7KA 3C23A 4IRCA 4R63A 3H8SA 3TQ1A 2Y1JA 1NKEA 5DEDA 4YVZA 4DSEA 4KLEA 8ICQA 2UVWA 4KITB 1QLNA 5HHIA 5J2JA 1UT8A 4YFKA 2M9NA 3GIJA 9ICRA 4UB3A 3Q8QB 3L9DA 3PW5A 3QE9Y 1WCLA 2BCQA 3M9OB 3OHAA 4M0AA 2FPKA 4YR0A 1XU4A 3WFSC 1LV5A 4IG8A 2W9BA 4M6WA 3KHHA 4EBEA 1SKSA 5IINA 1MQ2A 1ZQNA 2BQUA 5F9LA 1Z00B 5J2BA 3HJ4A 3B0XA 4J9MA 3OUYA 2DR7A 2FLNA 4ECVA 5J2CA 2XC9A 1DOQA 5F9NA 4J9NA 4IR9A 4RPXA 3RJGA 7ICTA 3OJUA 3AQLA 8ICVA 3LQCB 4ECTA 7ICUA 1Q78A 3TFRA 1ZQYA 5IILA 4AT7A 4ED6A 9ICOA 4RWQA 1U4BA 5J0SA 3HWTA 3HIYA 3ORYA 4WBZA 4XQ7A 4RPYA 4GXJA 4O5CA 5DQHA 4EZ9A 4WC3A 4ED7A 1QSSA 3T5HA 2NRXA 5HRLA 5KFRA 4RNOA 3ZDDA 5HRIA 4QWDA 3PX0A 5CWRA 3UXOA 4ECUA 1SKWA 3ZDBA 1TFYA 5KFDA 4F5RA 4JK1A 4FBUA 4DSLA 2BHNA 2NRZA 5KG5A 4RQ1A 4TQRA 2R8GA 1X9SA 3RJHA 3RJIA 2W9CB 1X9MA 1KFSA 2JZBB 1UA1A 4DL3A 2PI5A 4O9MA 2HVHA 4TURA 4XUSA 4F5OA 5DG7A 3N97B 3H7IA 4J9OA 4DWIA 3QEBZ 9ICAA 8ICTA 5HRFA 4Q8FA 1ZQGA 1BPEA 4F92B 5J2KA 4J9QA 4F4ZA 4XQ8A 4KLDA 5JUMA 5J2FA 3C2KA 4ED2A 3Q8PB 3M9MB 1ZQPA 5KFTA 1ZQDA 2W9AA 4RUCA 4F5QA 2HW3A 4X0AA 5KFWA 3ZD8A 5DB6A 4UBCA 5D4BA 4RT3A 2AGPA 4O5KA 4UD5A 4DLEA 1V4AA 4EYIB 2V4RA 3EW9A 4ZH4A 3GIMA 8ICWA 5HREA 4EBDA 4NKTA 3HJ1A 3PMNA 3QEAZ 2MUTA 3B0YA 4O5EA 9ICKA 1DK2A 3PR5B 4QZEA 4YD1A 1ZQIA 1XSPA 1ZQRA 1CUKA 5J0UA 7ICPA 3TAPA 4X5VA 4YQWA 3TARA 4B9SA 8ICXA 3HT3A 1KRPA 4UQGA 4ED3A 2J6UA 3IM1A 4GLXA 1T4GA 2HHXA 4RQ8A 3NTUA 5J0YA 5KG2A 7ICLA 4FHYA 4EZ6A 3OSNA 4BWJA 5KFQA 1S0NA 4NLNA 1NJZA 4BWMA 5KT2A 3JPQA 1KEJA 1XSLA 1HUZA 2ISOA 2IHMA 7ICGA 2FMPA 2BKEA 3RB6A 1L3SA 3PO5A 1NJXA 5DB9A 4BGDA 4KLQA 4ATBB 3RR7A 4DL6A 3C21A 5DG9A 3MR5A 1SZPA 2F1HA 4DQRA 3RJJA 3V6KA 2KZZA 1NZPA 3C2MA 4WC1A 3MR3A 5KT6A 9ICPA 4P4PA 2RDJA 1L5UA 4MF2A 4QWBA 4YR3A 2C2EA 1ZQEA 2M2VA 2MAXA 1Z3EB 3OHBA 3JPPA 5HMLA 3V7LA 2I9GA 4EP7A 1MIVA 2F1JA 1TK5A 1UETA 3PX6A 3JYYA 3MABA 4Z6EA 3T5LA 2DPJA 4RQ4A 2IBKA 4F8RA 2HHVA 3MFIA 2P6RA 4B9NA 2FPMA 1NK4A 3E2EA 2C28A 1RXVA 4TUPA 3H8JA 4ECXA 2V9WA 3GIKA 1JXEA 2XCAA 2HHWA 1BVSA 3Q8KA 3G6YA 1BNPA 4AT9B 4FH5A 3UQ0A 3TI0A 1UT5A 5BOMA 3KHGA 2HHTA 2A1JB 4WC0A 3BQ0A 5KFVA 4RWOA 4PGXA 5KFKA 5CR0A 4YXJA 4F4WA 1ZQTA 4YMOA 3JPRA 2NRVA 1NJWA 4B9UA 2ZJ5A 9ICVA 3OVSA 1XS9D 2ZH5A 4I2BA 3AUOA 4DFMA 5F2VO 3EWAA 3JPOA 4FS1A 4M9LA 4YMNA 4QZDA 4TUSA 3ZDEA 8ICUA 4I28A 4X4RA 4X4VA 1SKRA 2HHUA 4UB5A 2NRKA 2IMWP 3WFOA 1ZQZA 1KTQA 5HRBA 5KFIA 4RWPA 2ZTDA 1XWLA 1KSPA 2J6TA 5EWFA 3HP6A 1NK5A 2ZH2A 1ZQKA 7ICIA 3RJFA 3H39A 4QWAA 3H8WA 3ZDCA 2ZTCA 9ICCA 4JUZA 4JWNA 2C2DA 1S0OA 1JMSA 2BCRA 8ICOA 4I2JA 4K4IA 5IIJA 2ATLA 4ELUA 4PHEA 3RBEA 3GILA 3JPTA 3K4GA 5KT7A 2AU0A 4O0IA 2KN7A 4MFAA 1ZQAA 2PFQA 3TFSA 5KTQA 1X2IA 5DQIA 3V7JA 3UXNA 4HYKA 2BPGA 5HRKA 4Q43A 2RFFA 1XSNA 2DR9A 2RDIA 1WOTA 2ASDA 4DEZA 4X4TA 4R64A 3GFKB 4J9RA 3OJSA 4KLFA 4M2YA 3SI8A 3PVXA 4PHPA 3N4MB 1IM4A 4F2RA 8ICKA 2R8IA 4WC5A 5KT5A 1ZYQA 9ICSA 2XO7A 1QSLA 2PFPA 4F91B 2UVVA 5D46A 2O5AA 4KLJA 4ECYA 4QW8A 4KN4A 4R65A 4DFKA 1V9PA 1NKBA 1BPDA 5KFHA 3V6JA 3RAQA 4BXOB 7ICQA 5KFCA 3MR6A 3GV8B 4X4QA 1RZTA 1RYSA 4KN7A 1TAUA 4ECZA 3QZ8A 3HW8A 1ZQHA 4IRKA 5J2HA 3MBYA 5HNKA 4YP3A 4IQUA 2AQ4A 1EXNA 3GIIA 4C8OA 5C5JA 4EBCA 2F1IA 4F93B 2XY5A 5DGBA 7ICFA 8ICYA 2M2WA 3FDSA 1ZQVA 4FS2A 4NLGA 5CHGA 3BDPA 2ALZA 4C8LA 4I29A 9ICGA 2KP7A 4J9KA 2J6SA 4X4OA 3OVAA 4Z6CA 5HHHA 2V4QA 4GXKA 3UPQA 5IIMA 9ICTA 4AT8B 7ICEA 1JX4A 4RWNA 5KT3A 2R8HA 2KZ3A 1Z00A 1TK8A 2KZMA 4YG2A 1NO5A 2PXIA 3WFRE 2MUTB 1K1SA 1FA0A 4QWEA 3UXPA 4UB1A 1CEZA 3H3AA 2UVUA 4QZIA 4O3QA 4DO9A 9ICUA 4B9VA 1COOA 7ICMA 3LK9A 4QZHA 4ED0A 4UAZA 1ZQOA 2IA6A 8ICIA 3C18A 2HHSA 3MFHA 4DL2A 8ICJA 4DQQA 1N56A 4MEYA 3PW2A 3H38A 4FO6A 1Q79A 3EZ5A 4WBYA 2ZHAA 5DLFA 3G6VA 4DF4A 1XC9A 4RU9A 1ZQSA 2BCVA 2UVRA 2BGWA 1JXLA 4RQ0A 4I2EA 4G3IA 2KFZA 7ICNA 5KG7A 1F5AA 4F4XA 4DQIA 2FLPA 4NY8A 2WTFA 4RT2A 4FHXA 4S3NA 4Z6FA 3C1ZA 1ZQXA 5HR9A 3LDAA 2W9CA 2JZBA 4EBJA 4PPXA 4P4MA 5KFGA 5KFJA 4EYHB 3Q8SB 4IQVA 4J9SA 2JEJA 2W9MA 5J2AA 3EYZA 4DL4A 1A77A 5KFPA 3SV4A 3TANA 3JPSA 1ZQQA 2IHNA 2BDPA 8ICNA 1XO1A 2H5XA 3K75D 3BQ1A 4RQ5A 3AU6A 5KFXA 1C7YA 1MC8A 4TQSA 2ASJA 4DOAA 1RXWA 3RRGA 3H37A 2ZH1A 3AU2A 5EOZA 4PH5A 4DFPA 1U49A 3EPIA 3GV7B 4R66A 4E80A 9ICJA 4UBBA 2ZUDA 3RH4A 2BPFA 5DBAA 3M8RA 4FBTA 1R8AA 3C66A 3M8SA 2FMQA 2B21A 9ICXA 1MQ3A 1ZQWA 3QZ7A 7ICSA 2FMSA 3PNCA 9ICQA 2FLLA 7ICVA 3NYBA 2BQ3A 3RJKA 2HHQA 5KFUA 4X4NA 4EEYA 3H4BA 4P2HA 1YLQA 2PBEA 9ICWA 4PGYA 8ICCA 2W8LA 8ICPA 3RBDA 5TZVA 3ISDA 1S0MA 5L1JA 4YR2A 1NK9A 2VA3A 9ICFA 8ICSA 4LZDA 2DR5A 2PFOA 1NK0A 4P4OA 4ED1A 5DGAA 1BGXT 4QW9A 4I2HA 4C8MA 5DLGA 4ECRA 4KMUA 1HJPA 3OSPA 8ICFA 5KFSA 8ICZA 4MF8A 5DDMA 2XGQA 3PW7A 3PO4A 4QZBA 3EPGA 4O3RA 5HRHA 1SL1A 1R89A 2C22A 3Q8LA 5KFOA 4NXZA 3PV8A 5KG4A 4QZ8A 1X9WA 4ATBA 3ETLA 4PHAA 5CB1A 5J0PA 5J0WA 2AJQA 4UD4A 1ZQFA 4WC4A 1NK6A 4M04A 4X4SA 3LWMA 5J29A 3GDXA 1TFRA 4K4GA 4DL7A 2OWOA 3WFQE 3V72A 4RNMA 3GV5B 5L1LA 4ELTA 1BNOA 4X4PA 4UB4A 3RR8A 4DS4A 1KFTA 3PY8A 3RH5A 4ED8A 4PHDA 3C5GA 4B9MA 2W9BB 4M6WB 4ECWA 3M9NB 8ICAA 1RYRA 1KNYA 5KFNA 2M2TA 4DSFA 5IIOA 3OUYB 4DLGA 1NJYA 3NGDA 4YMMA 1SL0A 5DDYA 4NM1A 2A1JA 3MGIA 4I27A 4QZ9A 1NKCA 5HC9A 1U48A 4KLHA 1TVAA 5HRDA 2XCPA 4AT7B 5J2GA 4DSJA 5DKWA 4O3SA 3ZD9A 2Q0ZX 5J2EA 2VA8A 4TUQA 4M47A 5L9XA 5KG6A 2AGQA 5D49A 4R8UA 2LYHA 4GC7A 2ZH3A 4YCXA 1VJ7A 5EWEA 7ICJA 4I2DA 1S10A 1H38A 3RTVA 9ICLA 1D9DA 2O1PA 1BPZA 5J0TA 3RB4A 3RJEA 1JAJA 3OV7A 4E0DA 1PZNA 3SV3A 5J2IA 4KLSA 4RZRA 2Y1IA 5KG0A 5KFEA 2R8KA 1ZQMA 1NOMA 2PI4A 2XY7A 1L3UA 4WC7A 1L3TA 4O3NA 2DRBA 1S0VA 3OVBA 5DBCA 2ZUBA 2ZHBA 3PMLA 4KLGA 1MSWD 9ICNA 5CP2A 2R8JA 5KFZA 3C2LA 4Z6DA 3MDAA 2DPIA 2BCUA 4KTQA 4NM2A 5DB7A 2JEFA 3C5FA 5J2DA 4KLUA 1MIWA 4O3PA 3KHRA 4KLTA 5KFLA 1SL2A 1R8CA 4DQPA 5KG3A 4DQSA 5J0RA 4ECQA 2DRAA 1ZJNA 4GC6A 4FHVA 3FYHA 5J0XA 3RB0A 5DB8A 8ICLA 1UEUA 3HX0A 3T5KA 1T8EA 4YD2A 4QZFA 4ELVA 1Y88A 5HRGA 2JEIA 5CA7A 2ZJ8A 5EWGA 2P66A 3ISCA 4QZAA 2XY6A 2VA2A 1ZQCA 1ZQUA 5KFAA 1QSYA 1S77D 8ICBA 4DL5A 1TV9A 5BOLA 3JPNA 2ISPA 4DOBA 4BXOA 4KLIA 3BJYA 1HUOA 8ICEA 4UB2A 2M2UA 2HVIA 4M5DA 2AQ0A 5DECA 1DK3A 1A76A 1TFWA 4MEXA 3THVA 1U9LA 4Q8EA 3JZ0A 4B9LA 4KLLA 1BPXA 3RRHA 9ICBA 7ICKA 1ZETA 8ICRA 1UEVA 4WC2A 2ZH4A 1S97A 1AROP 1IXRA 4QZGA 2ZUCA 3Q8MA 1N48A 2KFNA 1JQRA 4B9TA 2ZTEA 3UQ2A 4M9HA 4I2GA 4IR1A 3T3FA 3G6XA 1NK8A 2DFLA 4E8FA 4I2IA 5DBBA 3SZ2A 2NRWA 4I2AA 2DVIA 3SYZA 3H4DA 1MIYA 5KFYA 4AT8A 5KFFA 4KLMA 3T5JA 3AQNA 2ZH9A 5KT4A 3AQKA 4UAWA 1D8YA 3TAQA 4IQWA 7ICHA 4WCWA 4I2CA 2ZJAA 4J9PA 1TKDA 7ICOA 2FPLA 2GWSA 4JV2A 5KFMA 3HPOA 4RPZA 1NK7A 4WC6A 4C8KA 4F3OA 2BQRA 8ICGA 5HMMA 4MFFA 4X0BA 3OGUA 4GXIA 1JIHA 7ICRA 4M9JA 4F4YA 1T3NA 4MFCA 4F4KA 2I1QA 3WFPA 3BQTA 4E7XA 3H40A 4ECSA 1QTMA 2ZH8A 3RH6A 3PW4A 1B22A 1KFDA 4F5NA 3V6HA 4DSIA 4DOCA 1BPYA 1JN3A 4LVSA 4DFJA 2HHPA 4Q45A 1TAQA 4FH3A 1VFGA 3PW0A 3MDCA 1R8BA 3C1YA 5DG8A 3RAXA 1ZQBA 2BR0A 2XGPA 5HP4A 1WCNA 4BDPA 4RQ6A 4RQ2A 2Q66A 1U47A 2NRTA 4Q44A 1L3VA 1D8LA 5IIKA 1BPBA
chains in the Genus database with same CATH superfamily
2KNJA 4MKPA 1Z19A 4EBKA 3H0MB 4JWMA 2XI9A 4XA5A 2JEGA 4IL6U 2O6KA 1KBUA 4Y2QA 4PGQA 4NLKA 1DGJA 4OAGA 4NLZA 1QQ7A 3KTQA 4KLOA 3SAFA 1X40A 1LB2B 4DCCA 4LZGA 9ICEA 4YXMA 2ZXIA 2A1AA 2Y9TA 4XRHA 3TADA 4RNNA 4UAYA 5L1KA 4EEBA 5BPCA 4R8UB 1UA0A 3RB3A 2B6GA 3M6ZA 2P6UA 2HCFA 4NXVA 2F3NA 3V7KA 2YB4A 3C23A 4YVZA 4KLEA 4KITB 5B3PA 3Q8QB 1WCLA 5CEHA 2FPKA 2FI1A 4IG8A 4M6WA 3KHHA 1MQ2A 5AK4A 2W54A 5F9LA 5J2BA 3B0XA 2IUBA 1NZBA 4ECVA 4RPXA 7ICUA 1ZQYA 5IILA 4ED6A 5ALHA 2AXTU 4RPYA 4ED7A 1QSSA 3RF9A 2NRXA 4QWDA 4ECUA 5H2FU 5KFDA 4F5RA 4JK1A 4FBUA 4DSLA 1SGGA 3NUQA 4RQ1A 3RJHA 1KFSA 5AKXA 4DL3A 8ICTA 2H3ZA 5JUMA 3C2KA 3Q8PB 4ZOHC 4NXUA 4UD5A 1V4AA 3N7PD 4ZH4A 8ICWA 4EBDA 3HJ1A 2MUTA 4QIWC 4O5EA 3PR5B 2E8MA 4QZEA 3PSTA 4YD1A 1N60A 7ICPA 3TAPA 4X5VA 1COKA 4EENA 1KRPA 4UQGA 1Q46A 1T4GA 4K98A 4US8A 3OSNA 5KFQA 1S0NA 1KEJA 2E8OA 4NXTA 4EX7A 2BKEA 3PO5A 4KLQA 1F5SA 1X6JA 3CYMA 4NXWA 4DQRA 1J2NA 2KZZA 1NZPA 5KT6A 2RDJA 4QWBA 3WKBA 1T3QA 2M2VA 2MAXA 2KSOA 3HRDD 5HMLA 3V7LA 1UETA 2LHTA 4KM5A 3T5LA 2ZIUB 2P6RA 3H8JA 2V9WA 2HHWA 1BVSA 3TI0A 2HHTA 4WC0A 3BQ0A 4Y2TA 5KFVA 4LJXA 4PGXA 5CR0A 4OO1J 4F4WA 3JPRA 2NRVA 4B9UA 3F2DA 1XS9D 4DFMA 3EWAA 4FS1A 4YMNA 4X4VA 2EQYA 3IG8A 1ZQZA 5HRBA 3DV9A 1F0MA 1KSPA 4PZOA 1NK5A 2WF5A 7ICIA 4QWAA 3ZDCA 2ZTCA 3KKAC 1X6IA 2BCRA 1JMSA 4ELUA 4O69A 2W55A 2WF6A 5ALPA 5KT7A 5ALDA 5AI5A 3D6JA 4MFAA 2WAQF 5KTQA 2BPGA 4Q43A 2RFFA 4RQNA 2OYYA 3SI8A 3N4MB 3NVOA 1QH9A 2R8IA 5AI9A 4F91B 1L8OA 4UAUA 5K4LA 2O5AA 4KLJA 1V9PA 2F44A 3MR6A 1TAUA 3HW8A 5J2HA 3EF2A 5ALLA 3MBYA 5HNKA 5C5JA 3KZXA 5DGBA 7ICFA 2YQEA 3BDPA 5EE1A 4C8LA 5JRTA 9ICGA 4J9KA 3OVAA 2V4QA 5IIMA 9ICTA 4RWNA 2KZ3A 5E79U 1NO5A 3WFRE 2MUTB 1K1SA 3UXPA 2DGZA 4DO9A 3M7DA 5ALVA 3LK9A 3QUQA 3C18A 3MFHA 3H38A 4WJ3B 3EZ5A 2IOFK 4FFDA 5DLFA 2UVRA 4I2EA 2PMZC 2BGWA 3F5EA 4G3IA 4DQIA 2KV2A 4FHXA 2K4IA 2W9CA 1WWVA 2JZBA 4NWIA 4PPXA 4P4MA 5CHEA 3Q8SB 1A77A 1M6YA 5CFSA 1XO1A 4MFCA 3ZI4A 2GA9D 3WK9A 4DOAA 1RXWA 5EOZA 4E80A 1WYGA 2ZUDA 5DBAA 3C66A 2FMQA 2B21A 1ZQWA 9ICQA 3RJKA 4BX9C 4P2HA 1YLQA 4AYBF 2XIDA 2PBEA 9ICWA 3RBDA 4YR2A 2VA3A 9ICFA 2RLTA 1XO0A 4ED1A 1B0XA 2OCEA 4QW9A 4C8MA 3NWIA 5KFSA 8ICZA 5DDMA 3PW7A 4O3RA 5HRHA 3EPGA 3VCBA 1YZ7A 3GU3A 4HX0A 4QZ8A 3ETLA 4UD4A 1ZQFA 1JI7A 2ODGA 3GDXA 2GLEA 3WFQE 5L1LA 1BNOA 3RR8A 1KFTA 4ED8A 3J81j 2JXJA 4ECWA 1RYRA 4HAIA 3HKZC 1YT3A 5DDYA 2VJ5A 3SAGA 1NKCA 5HC9A 4AT7B 2HSZA 1YZ6A 3F2CA 1VDVA 4O3SA 4P0PB 4TUQA 3ZD9A 4M47A 5L9XA 5KG6A 2AGQA 2G08A 5D49A 2ZH3A 2OHFA 4YCXA 1IIPA 9ICLA 5AKJA 5J0TA 3RB4A 5J2IA 5KG0A 2NV3A 4OD0A 3NASA 4O3NA 1S0VA 5DBCA 3QNMA 4NXXA 5KFZA 4Z6DA 3MDAA 2DPIA 2BCUA 2JEFA 2ESEA 5HR7A 5J2DA 4O3PA 4KLTA 4DQPA 5B5EU 2YMMA 3RB0A 5DB8A 8ICLA 3HX0A 4ELVA 1PUZA 1Y88A 5HRGA 2JEIA 5CA7A 1ZQUA 2KKPA 5KFAA 5T14A 1QSYA 8ICBA 2PKEA 2ISPA 2M2UA 1WWUA 8ICEA 4UB2A 2HVIA 5DECA 1TFWA 2AH5A 4B9LA 2HBLA 1UEVA 3Q8MA 4QZGA 2KIWA 4B9TA 4I2GA 2DFLA 4I2IA 4I2AA 2NRWA 4AT8A 4KLMA 2ZH9A 5KT4A 5CRXA 4IQWA 4Y2RA 1URJA 4I2CA 1ZD4A 1TKDA 3DDHA 2GWSA 3IN5A 4RPZA 4NJ8A 2BQRA 4MFFA 4X0BA 2RHFA 4M9JA 2I1QA 1OXJA 4JB3A 2YN4A 3FM9A 3NRWA 2E1FA 4EX6A 2YB1A 2D6FC 1TAQA 1VFGA 2KKVA 1R8BA 1KN5A 3ETRA 3S6JA 1U47A 2NRTA 1V38A 4QWCA 4IRDA 4PJ0U 3Q8RB 4M9NA 2HDOA 2XVTA 4OCZA 3AQMA 5IIIA 1IG6A 4RUAA 8ICMA 3QU4A 4LT6A 4X4UA 2VANA 3IHQB 2ZH6A 2ZH7A 1DGSA 2KVCA 4DF8A 2ZIXB 2DKZA 4JV0A 5KG1A 3BQ2A 1PX5A 2BCSA 4AT9A 3LWLA 1KDHA 1ZQLA 2ID1A 3MR2A 1V97A 2DR8A 4M9GA 1GO3F 1SXEA 4FHPA 5ALQA 4DSKA 2BPCA 2KEYA 4XJEA 3H8SA 3QUBA 1HEKA 2L5YA 4DSEA 2UVWA 1SXDA 5J2JA 3M9OB 4M0AA 3WFSC 4YR0A 3LYSA 2EZZA 5IINA 2VJ4A 1Z00B 3ERCC 3HJ4A 2DR7A 5J2CA 2XC9A 5F9NA 1J2MA 3RJGA 2DQNB 3OJUA 4ECTA 3ICXA 1U4BA 2QARA 3ORYA 1Q3VA 4O5CA 4WC3A 3T5HA 3ZDDA 2YTUA 3UXOA 1TFYA 2NYVA 4TQRA 4K99A 5KG5A 2YMLA 2HVHA 1N63A 4TURA 5DG7A 3N97B 3SMVA 9ICAA 1JRPA 4F92B 3SAHA 4ED2A 2HBMA 2W9AA 4RUCA 4F5QA 2HW3A 4X0AA 5DB6A 4UBCA 4RT3A 3UM9A 5ALKA 1ZRMA 4OJ6A 2V4RA 3EW9A 4UW9A 4Y2JA 5AK6A 1DK2A 5ALFA 3PSPA 3U26A 1ZQRA 3HT3A 2YX8A 4ED3A 2J6UA 3IM1A 4GLXA 3NVWA 2HHXA 4RQ8A 5J0YA 7ICLA 3KD3A 1ED1A 3WU2U 2Z7JA 1XSLA 2ISOA 1X9XA 2B0CA 2IHMA 7ICGA 2FMPA 2ZIWA 3RB6A 1L3SA 3KFUF 5DB9A 1ZD2P 2K8BB 3C21A 4WC1A 3IV6A 4P4PA 5B3QA 1Z3EB 3JPPA 5TISU 3PX6A 3MABA 4K97A 2FPMA 2K4PA 3GIKA 3NVYA 2XCAA 4CGZA 1BNPA 4AT9B 3UQ0A 4RWOA 5KFKA 5AKEA 1ZQTA 3IDWA 9ICVA 2MU2A 3H8MA 3JPOA 4X4RA 2IMWP 3AM9A 3AQEA 1L8LA 3QX7A 1XWLA 2J6TA 4Y2XA 2G0AA 3HP6A 3H39A 2JV3A 5FP0A 9ICCA 4JUZA 2C2DA 4FZNA 8ICOA 5ALJA 5AIAA 2LYAA 2ATLA 1LKYA 2KICA 3RBEA 3JPTA 5AI0A 1QQ5A 2KN7A 3WK4A 4QJFB 5DQIA 2RDIA 4FZMA 2ASDA 4J03A 3GFKB 1NI3A 3LVWA 4KLFA 4F2RA 3SD7A 3L3FX 5KT5A 1ZYQA 1QSLA 3ER9B 2KHVA 2E3TA 4WH5A 4UASA 2F8LA 4KN4A 1NKBA 7ICQA 3RAQA 3GV8B 5KL8B 2LI6A 4KN7A 3QUTA 4IRKA 2LPEA 2AQ4A 1RYUA 3QXGA 4IQUA 5ALEA 1EXNA 3AMZA 2DKXA 5AI4A 4EBCA 2F1IA 4F93B 1L7NA 8ICYA 4OJ5A 3CNHA 1KQQA 2KD1A 4I29A 2J6SA 7ICEA 5KT3A 4NL9C 2KZMA 1FA0A 3EUB2 5EE0A 2VKQA 4QZIA 9ICUA 1L6NA 2JRZA 4QZHA 4ED0A 4UAZA 8ICIA 2P35A 4LEZA 2JMGA 3NS1A 8ICJA 1N56A 2D8CA 5ALOA 1XC9A 1SB3C 2BCVA 2OEHA 7ICNA 1SV4A 1JXLA 2KFZA 2FLPA 4NY8A 2WTFA 4RT2A 4KB6A 1NNLA 4EYHB 4IQVA 2W9MA 1WOTA 2BDPA 1ZQQA 2W3RA 3AU6A 2BBJA 5AHXA 2FE9A 3CP8A 1C7YA 1GPJA 2ASJA 5B66U 4CDGA 4DFPA 3DEEA 9ICJA 4UBBA 3RH4A 2BPFA 2RP5A 9ICXA 1MQ3A 7ICSA 2KVSA 2FMSA 5G5HA 4EV6A 4RQMA 2BQ3A 2HHQA 5KFUA 3SENA 1ZOLA 2W8LA 3ISDA 4FE3A 1NK9A 5AKZA 2PFOA 4P4OA 5DGAA 1BGXT 4ECRA 3F53A 3OSPA 2G06A 1SL1A 3F2BA 1R89A 3Q8LA 4NXZA 3PV8A 4ATBA 2MSNA 3QU7A 5J0PA 4WC4A 4X4SA 1SWVA 4DL7A 2OWOA 1LKYB 3B9JA 4RNMA 1ZD5A 2HOFA 4PHDA 4B9MA 5G5GA 4M6WB 3TADC 1JALA 3M9NB 3PZPA 4USAA 2WF9A 2M2TA 1N5WA 2A1JA 2QB1A 4I27A 1U48A 4KLHA 5J2GA 2KE7A 4IC9A 1MN8A 1H38A 2ZXHA 1D9DA 2O1PA 4EEKA 4E0DA 1KKXA 2Y1IA 2EZYA 5KFEA 4I0UA 3OVBA 1MSWD 3K1ZA 2F76X 2R18A 4NM2A 5AKGA 1MIWA 1R8CA 2MRLA 5GTHU 1UEUA 4YD2A 5AICA 2ZJ8A 4QZAA 1ZQCA 1S77D 4BJQA 4DL5A 1TV9A 5BOLA 2W3SA 1L7MA 4BXOA 4JLXA 2W11A 3BJYA 1HUOA 4M5DA 1DK3A 3WK5A 5KNIA 4NLBA 4MEXA 3CK6A 3JZ0A 4KLLA 3I1YA 1ZETA 2ZH4A 1IXRA 2KFNA 2K89A 3IP4B 2ZTEA 5C0YA 2GO7A 2RRDA 3K7DA 4IR1A 3T3FA 1NK8A 3SZ2A 2YMQA 4NV0A 3SYZA 3H0RB 5KFYA 3WK8A 1PVPA 1PK1A 1D8YA 7ICHA 2LKYA 7ICOA 2KSOB 2FPLA 3UMGA 4WC6A 1RG6A 4F3OA 3RFAA 2ZIVA 4GXIA 1JIHA 7ICRA 5CFUA 2K8CB 5AKYA 1QTMA 1B22A 3PW4A 4F5NA 4C7YA 1X42A 1XNSA 4DFJA 3C1YA 3RAXA 2XGPA 1WCNA 2Q66A 1L3VA 1JAJA 4CCHA 1ZJMA 3PX4A 2W8KA 1B43A 1D9FA 1RPLA 2H3QA 4RQ3A 1K1QA 1T7PA 2QB0A 3QUCA 2WAQC 4F5PA 1U45A 2EANA 4IQTA 4CF5A 2KMDA 3IG5A 2AGOA 2ASLA 4UAVA 4K4HA 1WUDA 9ICMA 3L4PA 8ICHA 2NO5A 4NKUA 4YN4A 1VLBA 4JV1A 2EZXA 1O03A 2Y9UA 3A0HU 3BS5A 4C0ZA 2BE3A 2EAPA 2KTQA 2C2RA 4C4SA 5DQGA 5J0OA 3PR4A 4QZCA 3LVVA 1SV0A 4IRCA 1NKEA 3TQ1A 2OH2A 8ICQA 1QLNA 1UT8A 9ICRA 3L9DA 3PW5A 2BCQA 1XU4A 2B4VA 1LV5A 2W9BA 2CPRA 4EBEA 4C7ZA 1SKSA 2BQUA 1PVQA 4J9MA 3OUYA 2FLNA 4C80A 3ONNA 4J9NA 1ECWA 8ICVA 4U6PA 3TFRA 3M1YA 2RQ5A 5J0SA 3HWTA 4Y2YA 5AKLA 5ALGA 5DQHA 4EZ9A 2NO4A 1DXSA 5KFRA 4O6AA 5CWRA 5A0LA 1SKWA 2NRZA 1X9SA 2W9CB 1X9MA 2JZBB 2W43A 2E8NA 2PI5A 2HN1A 4J9OA 4J9QA 4F4ZA 2HMXA 5J2FA 2JH1A 3M9MB 2CXYA 5KFWA 3ZD8A 4O5KA 2AGPA 3BZKA 2ZIVB 2KK0A 2I5HA 2N1RA 5AM3A 4EYIB 1AQ6A 4AYBC 5HREA 3QEAZ 5JTIA 1XSPA 5J0UA 2A3VA 4YQWA 8ICXA 2DBYA 3JCFA 4WOYA 4FZLA 2K4HA 3NTUA 4FHYA 3HILA 2H3VA 4BWJA 2W7PA 1NJZA 1QQ6A 1NJXA 5AKKA 3RR7A 5AIBA 1Z1BA 4DL6A 3MR5A 3V6KA 3C2MA 3MR3A 1L5UA 4MF2A 4NLCA 2C2EA 3SR6A 2F1JA 3PSFA 4Z6EA 3UMBA 4RQ4A 2HHVA 2H3FA 2E1EA 3MFIA 1NK4A 2C28A 1RXVA 3NVZA 4ECXA 1JXEA 4LEWA 4FH5A 1SZHA 4U7CA 1X66A 4YXJA 5F3XB 2ZJ5A 3AUOA 3KOOA 4WBYA 4M9LA 3GZFA 3ZDEA 2ES6A 4I28A 2HHUA 2NRKA 1KTQA 1RDFA 1FIQA 3F5AA 4RWPA 4PZNA 4LEVA 5D61A 2ZTDA 2G5IB 2ZH2A 1ZQKA 4UATA 1A6SA 4JWNA 3BZCA 4K4IA 5IIJA 2WF7A 2LM4A 3GILA 2AU0A 2PFQA 3PSIA 1X2IA 5AM4A 2DR9A 4X4TA 4CE6A 4R64A 3PVXA 1SV0C 1UPHA 4PHPA 5AM0A 8ICKA 2KIVA 9ICSA 2XO7A 2PFPA 3WKDA 2A19A 5D46A 4ECYA 4QW8A 4R65A 4DFKA 5KFHA 1SIJA 1ZRNA 1ZXIA 1RZTA 1RYSA 4X4QA 3UMCA 1P7DA 4Y2UA 4YP3A 3GIIA 4PL1A 3FAHA 2XY5A 1JUDA 2K4EA 3FDSA 1ZQVA 4FS2A 4K96A 5CHGA 4X4OA 1RQLA 5D62A 4AT8B 5HHHA 4GXKA 1ZQ1C 4WQLA 2R8HA 1TK8A 4YG2A 2PXIA 1CEZA 2IOHA 2JH7A 4O3QA 4B9VA 1COOA 1ZQOA 4DQQA 4MEYA 4FO6A 1ZQSA 4RQ0A 3QU9A 5CFTA 5ALYA 4S3NA 4Z6FA 3C1ZA 1ZQXA 4F71A 3LDAA 2B51A 2KOBA 5KFGA 5KFJA 1UQVA 2IHOA 4J9SA 2JEJA 4FO1A 4DL4A 5KFPA 3TANA 2I6XA 5AM2A 2IHNA 8ICNA 2H5XA 3BQ1A 3K75D 4RQ5A 5KFXA 1MC8A 4TQSA 1UCVA 3H37A 3AU2A 4PH5A 1Q3UA 3EPIA 3GV7B 3M8RA 3M8SA 3QZ7A 4KMOB 1JROA 2HBJA 3QU5A 4EEYA 3H4BA 4IS7A 8ICCA 2EAOA 1L7PA 1S0MA 2F8KA 5L1JA 2GAFD 3E58A 8ICSA 3MC1A 1OUQA 1NK0A 4I2HA 3D2QA 1B4FA 4KMUA 8ICFA 3PO4A 4QZBA 5AK5A 1L7OA 5KFOA 1C20A 1O08A 1X9WA 4PHAA 5J0WA 4G9BA 3TKAA 2AJQA 3L5KA 4M04A 3VC8A 3LWMA 5J29A 3GV5B 4KX5A 2QLTA 3TACB 4UB4A 3KKAA 8ICAA 2ZIUA 2G07A 4AP9A 1KNYA 1Z4OA 1NJYA 4A8EA 3NGDA 1SL0A 3MGIA 1TVAA 5HRDA 2XCPA 4DSJA 2QARB 5J2EA 2VA8A 1PK3A 3OTQA 4I2DA 1VJ5A 1BPZA 3RJEA 1PZNA 4KLSA 3D2NA 2HOIA 2LBOA 4Y2SA 1NOMA 2PI4A 2XY7A 2YMPA 4WC7A 1L3TA 4K9AA 2ZUBA 4KLGA 1FEZA 2KJ9A 3C5FA 4KLUA 2KHQA 3KHRA 5KFLA 1SL2A 5J0RA 4ECQA 2QKQA 1ZJNA 4GC6A 4FHVA 3FYHA 5J0XA 3T5KA 1T8EA 4QZFA 2OXOA 5EWGA 2VA2A 3ISCA 2XY6A 3N7RC 2YY6A 4DOBA 4KLIA 1A76A 4Q8EA 1S8OA 4GFJA 4ICAA 2E8PA 4EELA 7ICKA 9ICBA 4WC2A 1S97A 1AROP 2CN1A 1JQRA 2VIXA 4M9HA 2ZIWB 4OAIZ 3G6XA 4JLZA 4E8FA 2MA1A 4K9BA 1MIYA 3H4DA 5KFFA 3AQNA 4UB8U 4UAWA 3TAQA 4J9PA 3HPOA 4EEDA 1NK7A 2F77X 2BZFA 8ICGA 5HMMA 5ALXA 4O3MA 1T3NA 4F4KA 4ECSA 5AM5A 2ZH8A 3RH6A 4GIBA 3V6HA 5L1MA 1WG8A 4DSIA 1BPYA 1N2XA 2Y0SF 4Q45A 4FH3A 3MDCA 5DG8A 1ZQBA 2PMZF 4RQ6A 2D3DA 3WKEA 4Q44A 3T79A 5IIKA 2XICA 3BQTA 4F50A 3ZDAA 1KLNA 5KFBA 1OU5A 5AKIA 1A0PA 4C8NA 5J0QA 1S5LU 5ALMA 3I76A 1ZQJA 4FHWA 5L1IA 9ICIA 4O3OA 3WKCA 3KHLA 2W03A 4I2FA 1S76D 4RQ7A 5CJ7A 3A0BU 3ISBA 3GQCA 9ICHA 1KL9A 4CF3A 1CRXA 5ALIA 3MGVA 3MGHA 4J9LA 4F2SA 2GH1A 4C4TA 3UPSA 1TK0A 4DS5A 1S9FA 2PFNA 2FCLA 4KX3A 4R63A 2Y1JA 5J8YA 5DEDA 5HHIA 4YFKA 2M9NA 3HJEA 5AI6A 3GIJA 4UB3A 3QE9Y 1Z4NA 3OHAA 2OM6A 4UARA 3AQFA 1ZQNA 1DOQA 4IR9A 2HBKA 7ICTA 3AQLA 3LQCB 1Q78A 3HKZF 4DFDA 2EH9A 4AT7A 4JMUA 2JHDA 3QU2A 9ICOA 4RWQA 4P0PA 3HIYA 4XQ7A 4WBZA 4GXJA 2KG5A 5HRLA 4RNOA 5HRIA 3PX0A 3ZDBA 2BHNA 2R8GA 3RJIA 1UA1A 4O9MA 4XUSA 4F5OA 4DWIA 2JGAA 3H7IA 3QEBZ 5HRFA 2B56A 4OJPA 4Q8FA 1ZQGA 1BPEA 2DWQA 5J2KA 4XQ8A 4KLDA 1LVHA 2FJ6A 1IV8A 1ZQPA 5KFTA 1RQNA 1ZQDA 3CRXA 3NKUA 4O68A 5D4BA 4K8VA 4DLEA 2CRXA 5HR6A 3GIMA 2BDUA 5EE9A 4NKTA 3PMNA 3B0YA 9ICKA 2Y0SC 1N61A 4B6JA 2GOLA 1ZQIA 1RM6C 3PHZA 1CUKA 4MHVA 3TARA 2JR5A 2G09A 3KZIU 4B9SA 3O0FA 2FDRA 4WQKA 1FFUA 5ALUA 5KG2A 2BBHA 2F2AB 4EZ6A 4NLNA 4BWMA 5KT2A 3JPQA 1HUZA 4OAFA 4ATBB 1FFVA 4BGDA 5DG9A 3OPXA 1SZPA 2F1HA 3RJJA 9ICPA 4YR3A 1ZQEA 3OHBA 2I9GA 4EP7A 1MIVA 1TK5A 1UHUA 3JYYA 2DPJA 3C28A 2IBKA 4F8RA 4B9NA 3E2EA 4TUPA 3Q8KA 3G6YA 2W04A 5F2VO 1UT5A 5BOMA 3KHGA 2A1JB 1SWWA 4YMOA 1NJWA 5KAFU 3OVSA 2ZH5A 4I2BA 3K1RB 8ICUA 4QZDA 4TUSA 5AK3A 1SKRA 4UB5A 3WFOA 1TAMA 5KFIA 1KW4A 5EWFA 2WB1F 1Q8KA 3RJFA 1CI4A 3H8WA 2KJ8A 1S0OA 4I2JA 2ZG6A 4PHEA 3CW2C 3K4GA 3R9KA 4O0IA 1ZQAA 3TFSA 4OJOA 3V7JA 4HYKA 5HRKA 3UXNA 1XSNA 3BQ7A 3I28A 2ZIXA 4DEZA 1J97A 3WK7A 3OJSA 4J9RA 4M2YA 5ALNA 1IM4A 4WC5A 2WFAA 5J8YC 5ALWA 2UVVA 5ALTA 1ZD3A 3M6KA 1BPDA 3V6JA 4BXOB 5KFCA 5JU5A 4ECZA 3QZ8A 1MA7A 1ZQHA 4UB6U 4C8OA 5EE3A 2M2WA 4NLGA 2ALZA 2KP7A 2KJ5A 4Z6CA 3UPQA 1JX4A 3AN1A 1PK1B 3ALRA 1Z00A 2HI0A 3IRUA 4QWEA 4UB1A 3H3AA 2UVUA 4US9A 2DF4B 7ICMA 2IA6A 2HHSA 4DL2A 1OW5A 3PW2A 1Q79A 2ZHAA 4DF4A 3G6VA 4RU9A 5AKHA 1F5AA 5KG7A 4F4XA 5HR9A 4CNQA 4EBJA 2DUYA 2HOQA 2AHOB 4CRXA 2Q4TA 1DRGA 1N62A 3EYZA 5J2AA 3SQIA 3SV4A 2W7OA 3JPSA 3RRGA 2ZH1A 1U49A 4R66A 2QB0B 4EGWA 1R8AA 4FBTA 2K60A 5JTGA 2EWRA 3PNCA 1F44A 2FLLA 7ICVA 3NYBA 2E5SA 4X4NA 2LM1A 3AL0B 4PGYA 4Y2PA 5KL1B 8ICPA 4CF4A 5TZVA 2DR5A 4LZDA 4P0QA 2WB1C 5DLGA 1HJPA 1K5OA 4MF8A 2XGQA 3BS5B 2M0NA 3E0FA 2C22A 5KG4A 3QYPA 5ALRA 4N7RA 5CB1A 3NVVA 5ALSA 1NK6A 4K4GA 1TFRA 3V72A 4ELTA 4X4PA 4DS4A 3OWGA 3PY8A 3RH5A 2WHEA 1QCKA 3C5GA 5AI8A 2W9BB 1FO4A 5KFNA 4DSFA 5IIOA 4ACOA 3OUYB 4DLGA 4YMMA 4LEYA 4NM1A 3WK6A 4QZ9A 3AEVA 3MCRA 5DKWA 2Q0ZX 3N7SC 1T94A 5KAIU 4R8UA 2LYHA 4BUGA 4GC7A 1VJ7A 5EWEA 1N5XA 7ICJA 1S10A 3RTVA 3NRZA 4O67A 3BS7A 3OV7A 2WF8A 3SV3A 4RZRA 3ED5A 2R8KA 1ZQMA 1L3UA 2HN2A 2DRBA 4QNLA 2ZHBA 3PMLA 9ICNA 5CP2A 2R8JA 3C2LA 4KTQA 5DB7A 3D2SA 2G5HB 5KG3A 4DQSA 2DRAA 5ALZA 1D8BA 2IOFA 4NL9A 2P66A 5GTIU 4Y2VA 3C29A 1HIWA 3JPNA 1TE2A 2AQ0A 5D63A 3THVA 1U9LA 2EDUA 1BPXA 3RRHA 2H3IA 8ICRA 2LYBA 4PL2A 5AM1A 2ZUCA 3H0LB 1N48A 3UQ2A 5DBBA 1PVRA 2DVIA 3KBBA 3T5JA 3AQKA 4C4RA 3N28A 4WCWA 2ZJAA 4JV2A 5KFMA 2K8AA 2LMRA 4C8KA 2DL0A 1V85A 4OAHA 3OGUA 4F72A 3FC4A 4F4YA 4P0QB 3WFPA 3SEIA 4E7XA 3H40A 2EAMA 1KFDA 4DOCA 1JN3A 4LVSA 3ER8C 4QIWF 2HHPA 3PW0A 2BR0A 5HP4A 4BDPA 4RQ2A 4OJLA 1Z1VA 1D8LA 1BPBA 3WKAA
chains in the Genus database with same CATH topology
4F50A 4QWCA 4CCHA 3ZDAA 1KLNA 4IRDA 1ZJMA 5KFBA 1OU5A 3Q8RB 4M9NA 4EBKA 3PX4A 4JWMA 2W8KA 1B43A 4XA5A 1D9FA 1RPLA 2JEGA 4RQ3A 1K1QA 1T7PA 5IIIA 3AQMA 4C8NA 4RUAA 5J0QA 4F5PA 1U45A 8ICMA 4PGQA 4NLKA 4IQTA 4NLZA 3KTQA 4KLOA 1ZQJA 4LT6A 4FHWA 4X4UA 2VANA 2AGOA 3IHQB 5L1IA 2ZH6A 2ZH7A 9ICIA 2ASLA 4O3OA 1DGSA 3KHLA 4DF8A 1LB2B 4LZGA 4I2FA 4K4HA 1S76D 9ICMA 9ICEA 4RQ7A 4YXMA 4JV0A 5KG1A 5CJ7A 3BQ2A 8ICHA 1PX5A 2BCSA 4XRHA 4RNNA 4UAYA 3ISBA 5L1KA 4NKUA 3GQCA 4YN4A 5BPCA 9ICHA 4R8UB 4AT9A 3LWLA 3MGHA 4J9LA 1UA0A 4JV1A 3RB3A 1KDHA 1ZQLA 2ID1A 3MR2A 4F2SA 2BE3A 2DR8A 2KTQA 2C2RA 4M9GA 2P6UA 5DQGA 5J0OA 3PR4A 4FHPA 4QZCA 3UPSA 1TK0A 4DS5A 1S9FA 4DSKA 2BPCA 2PFNA 3V7KA 3C23A 4IRCA 4R63A 3H8SA 3TQ1A 2Y1JA 1NKEA 5DEDA 4YVZA 4DSEA 4KLEA 8ICQA 2UVWA 4KITB 1QLNA 5HHIA 5J2JA 1UT8A 4YFKA 2M9NA 3GIJA 9ICRA 4UB3A 3Q8QB 3L9DA 3PW5A 3QE9Y 1WCLA 2BCQA 3M9OB 3OHAA 4M0AA 2FPKA 4YR0A 1XU4A 3WFSC 1LV5A 4IG8A 2W9BA 4M6WA 3KHHA 4EBEA 1SKSA 5IINA 1MQ2A 1ZQNA 2BQUA 5F9LA 1Z00B 5J2BA 3HJ4A 3B0XA 4J9MA 3OUYA 2DR7A 2FLNA 4ECVA 5J2CA 2XC9A 1DOQA 5F9NA 4J9NA 4IR9A 4RPXA 3RJGA 7ICTA 3OJUA 3AQLA 8ICVA 3LQCB 4ECTA 7ICUA 1Q78A 3TFRA 1ZQYA 5IILA 4AT7A 4ED6A 9ICOA 4RWQA 1U4BA 5J0SA 3HWTA 3HIYA 3ORYA 4WBZA 4XQ7A 4RPYA 4GXJA 4O5CA 5DQHA 4EZ9A 4WC3A 4ED7A 1QSSA 3T5HA 2NRXA 5HRLA 5KFRA 4RNOA 3ZDDA 5HRIA 4QWDA 3PX0A 5CWRA 3UXOA 4ECUA 1SKWA 3ZDBA 1TFYA 5KFDA 4F5RA 4JK1A 4FBUA 4DSLA 2BHNA 2NRZA 5KG5A 4RQ1A 4TQRA 2R8GA 1X9SA 3RJHA 3RJIA 2W9CB 1X9MA 1KFSA 2JZBB 1UA1A 4DL3A 2PI5A 4O9MA 2HVHA 4TURA 4XUSA 4F5OA 5DG7A 3N97B 3H7IA 4J9OA 4DWIA 3QEBZ 9ICAA 8ICTA 5HRFA 4Q8FA 1ZQGA 1BPEA 4F92B 5J2KA 4J9QA 4F4ZA 4XQ8A 4KLDA 5JUMA 5J2FA 3C2KA 4ED2A 3Q8PB 3M9MB 1ZQPA 5KFTA 1ZQDA 2W9AA 4RUCA 4F5QA 2HW3A 4X0AA 5KFWA 3ZD8A 5DB6A 4UBCA 5D4BA 4RT3A 2AGPA 4O5KA 4UD5A 4DLEA 1V4AA 4EYIB 2V4RA 3EW9A 4ZH4A 3GIMA 8ICWA 5HREA 4EBDA 4NKTA 3HJ1A 3PMNA 3QEAZ 2MUTA 3B0YA 4O5EA 9ICKA 1DK2A 3PR5B 4QZEA 4YD1A 1ZQIA 1XSPA 1ZQRA 1CUKA 5J0UA 7ICPA 3TAPA 4X5VA 4YQWA 3TARA 4B9SA 8ICXA 3HT3A 1KRPA 4UQGA 4ED3A 2J6UA 3IM1A 4GLXA 1T4GA 2HHXA 4RQ8A 3NTUA 5J0YA 5KG2A 7ICLA 4FHYA 4EZ6A 3OSNA 4BWJA 5KFQA 1S0NA 4NLNA 1NJZA 4BWMA 5KT2A 3JPQA 1KEJA 1XSLA 1HUZA 2ISOA 2IHMA 7ICGA 2FMPA 2BKEA 3RB6A 1L3SA 3PO5A 1NJXA 5DB9A 4BGDA 4KLQA 4ATBB 3RR7A 4DL6A 3C21A 5DG9A 3MR5A 1SZPA 2F1HA 4DQRA 3RJJA 3V6KA 2KZZA 1NZPA 3C2MA 4WC1A 3MR3A 5KT6A 9ICPA 4P4PA 2RDJA 1L5UA 4MF2A 4QWBA 4YR3A 2C2EA 1ZQEA 2M2VA 2MAXA 1Z3EB 3OHBA 3JPPA 5HMLA 3V7LA 2I9GA 4EP7A 1MIVA 2F1JA 1TK5A 1UETA 3PX6A 3JYYA 3MABA 4Z6EA 3T5LA 2DPJA 4RQ4A 2IBKA 4F8RA 2HHVA 3MFIA 2P6RA 4B9NA 2FPMA 1NK4A 3E2EA 2C28A 1RXVA 4TUPA 3H8JA 4ECXA 2V9WA 3GIKA 1JXEA 2XCAA 2HHWA 1BVSA 3Q8KA 3G6YA 1BNPA 4AT9B 4FH5A 3UQ0A 3TI0A 1UT5A 5BOMA 3KHGA 2HHTA 2A1JB 4WC0A 3BQ0A 5KFVA 4RWOA 4PGXA 5KFKA 5CR0A 4YXJA 4F4WA 1ZQTA 4YMOA 3JPRA 2NRVA 1NJWA 4B9UA 2ZJ5A 9ICVA 3OVSA 1XS9D 2ZH5A 4I2BA 3AUOA 4DFMA 5F2VO 3EWAA 3JPOA 4FS1A 4M9LA 4YMNA 4QZDA 4TUSA 3ZDEA 8ICUA 4I28A 4X4RA 4X4VA 1SKRA 2HHUA 4UB5A 2NRKA 2IMWP 3WFOA 1ZQZA 1KTQA 5HRBA 5KFIA 4RWPA 2ZTDA 1XWLA 1KSPA 2J6TA 5EWFA 3HP6A 1NK5A 2ZH2A 1ZQKA 7ICIA 3RJFA 3H39A 4QWAA 3H8WA 3ZDCA 2ZTCA 9ICCA 4JUZA 4JWNA 2C2DA 1S0OA 1JMSA 2BCRA 8ICOA 4I2JA 4K4IA 5IIJA 2ATLA 4ELUA 4PHEA 3RBEA 3GILA 3JPTA 3K4GA 5KT7A 2AU0A 4O0IA 2KN7A 4MFAA 1ZQAA 2PFQA 3TFSA 5KTQA 1X2IA 5DQIA 3V7JA 3UXNA 4HYKA 2BPGA 5HRKA 4Q43A 2RFFA 1XSNA 2DR9A 2RDIA 1WOTA 2ASDA 4DEZA 4X4TA 4R64A 3GFKB 4J9RA 3OJSA 4KLFA 4M2YA 3SI8A 3PVXA 4PHPA 3N4MB 1IM4A 4F2RA 8ICKA 2R8IA 4WC5A 5KT5A 1ZYQA 9ICSA 2XO7A 1QSLA 2PFPA 4F91B 2UVVA 5D46A 2O5AA 4KLJA 4ECYA 4QW8A 4KN4A 4R65A 4DFKA 1V9PA 1NKBA 1BPDA 5KFHA 3V6JA 3RAQA 4BXOB 7ICQA 5KFCA 3MR6A 3GV8B 4X4QA 1RZTA 1RYSA 4KN7A 1TAUA 4ECZA 3QZ8A 3HW8A 1ZQHA 4IRKA 5J2HA 3MBYA 5HNKA 4YP3A 4IQUA 2AQ4A 1EXNA 3GIIA 4C8OA 5C5JA 4EBCA 2F1IA 4F93B 2XY5A 5DGBA 7ICFA 8ICYA 2M2WA 3FDSA 1ZQVA 4FS2A 4NLGA 5CHGA 3BDPA 2ALZA 4C8LA 4I29A 9ICGA 2KP7A 4J9KA 2J6SA 4X4OA 3OVAA 4Z6CA 5HHHA 2V4QA 4GXKA 3UPQA 5IIMA 9ICTA 4AT8B 7ICEA 1JX4A 4RWNA 5KT3A 2R8HA 2KZ3A 1Z00A 1TK8A 2KZMA 4YG2A 1NO5A 2PXIA 3WFRE 2MUTB 1K1SA 1FA0A 4QWEA 3UXPA 4UB1A 1CEZA 3H3AA 2UVUA 4QZIA 4O3QA 4DO9A 9ICUA 4B9VA 1COOA 7ICMA 3LK9A 4QZHA 4ED0A 4UAZA 1ZQOA 2IA6A 8ICIA 3C18A 2HHSA 3MFHA 4DL2A 8ICJA 4DQQA 1N56A 4MEYA 3PW2A 3H38A 4FO6A 1Q79A 3EZ5A 4WBYA 2ZHAA 5DLFA 3G6VA 4DF4A 1XC9A 4RU9A 1ZQSA 2BCVA 2UVRA 2BGWA 1JXLA 4RQ0A 4I2EA 4G3IA 2KFZA 7ICNA 5KG7A 1F5AA 4F4XA 4DQIA 2FLPA 4NY8A 2WTFA 4RT2A 4FHXA 4S3NA 4Z6FA 3C1ZA 1ZQXA 5HR9A 3LDAA 2W9CA 2JZBA 4EBJA 4PPXA 4P4MA 5KFGA 5KFJA 4EYHB 3Q8SB 4IQVA 4J9SA 2JEJA 2W9MA 5J2AA 3EYZA 4DL4A 1A77A 5KFPA 3SV4A 3TANA 3JPSA 1ZQQA 2IHNA 2BDPA 8ICNA 1XO1A 2H5XA 3K75D 3BQ1A 4RQ5A 3AU6A 5KFXA 1C7YA 1MC8A 4TQSA 2ASJA 4DOAA 1RXWA 3RRGA 3H37A 2ZH1A 3AU2A 5EOZA 4PH5A 4DFPA 1U49A 3EPIA 3GV7B 4R66A 4E80A 9ICJA 4UBBA 2ZUDA 3RH4A 2BPFA 5DBAA 3M8RA 4FBTA 1R8AA 3C66A 3M8SA 2FMQA 2B21A 9ICXA 1MQ3A 1ZQWA 3QZ7A 7ICSA 2FMSA 3PNCA 9ICQA 2FLLA 7ICVA 3NYBA 2BQ3A 3RJKA 2HHQA 5KFUA 4X4NA 4EEYA 3H4BA 4P2HA 1YLQA 2PBEA 9ICWA 4PGYA 8ICCA 2W8LA 8ICPA 3RBDA 5TZVA 3ISDA 1S0MA 5L1JA 4YR2A 1NK9A 2VA3A 9ICFA 8ICSA 4LZDA 2DR5A 2PFOA 1NK0A 4P4OA 4ED1A 5DGAA 1BGXT 4QW9A 4I2HA 4C8MA 5DLGA 4ECRA 4KMUA 1HJPA 3OSPA 8ICFA 5KFSA 8ICZA 4MF8A 5DDMA 2XGQA 3PW7A 3PO4A 4QZBA 3EPGA 4O3RA 5HRHA 1SL1A 1R89A 2C22A 3Q8LA 5KFOA 4NXZA 3PV8A 5KG4A 4QZ8A 1X9WA 4ATBA 3ETLA 4PHAA 5CB1A 5J0PA 5J0WA 2AJQA 4UD4A 1ZQFA 4WC4A 1NK6A 4M04A 4X4SA 3LWMA 5J29A 3GDXA 1TFRA 4K4GA 4DL7A 2OWOA 3WFQE 3V72A 4RNMA 3GV5B 5L1LA 4ELTA 1BNOA 4X4PA 4UB4A 3RR8A 4DS4A 1KFTA 3PY8A 3RH5A 4ED8A 4PHDA 3C5GA 4B9MA 2W9BB 4M6WB 4ECWA 3M9NB 8ICAA 1RYRA 1KNYA 5KFNA 2M2TA 4DSFA 5IIOA 3OUYB 4DLGA 1NJYA 3NGDA 4YMMA 1SL0A 5DDYA 4NM1A 2A1JA 3MGIA 4I27A 4QZ9A 1NKCA 5HC9A 1U48A 4KLHA 1TVAA 5HRDA 2XCPA 4AT7B 5J2GA 4DSJA 5DKWA 4O3SA 3ZD9A 2Q0ZX 5J2EA 2VA8A 4TUQA 4M47A 5L9XA 5KG6A 2AGQA 5D49A 4R8UA 2LYHA 4GC7A 2ZH3A 4YCXA 1VJ7A 5EWEA 7ICJA 4I2DA 1S10A 1H38A 3RTVA 9ICLA 1D9DA 2O1PA 1BPZA 5J0TA 3RB4A 3RJEA 1JAJA 3OV7A 4E0DA 1PZNA 3SV3A 5J2IA 4KLSA 4RZRA 2Y1IA 5KG0A 5KFEA 2R8KA 1ZQMA 1NOMA 2PI4A 2XY7A 1L3UA 4WC7A 1L3TA 4O3NA 2DRBA 1S0VA 3OVBA 5DBCA 2ZUBA 2ZHBA 3PMLA 4KLGA 1MSWD 9ICNA 5CP2A 2R8JA 5KFZA 3C2LA 4Z6DA 3MDAA 2DPIA 2BCUA 4KTQA 4NM2A 5DB7A 2JEFA 3C5FA 5J2DA 4KLUA 1MIWA 4O3PA 3KHRA 4KLTA 5KFLA 1SL2A 1R8CA 4DQPA 5KG3A 4DQSA 5J0RA 4ECQA 2DRAA 1ZJNA 4GC6A 4FHVA 3FYHA 5J0XA 3RB0A 5DB8A 8ICLA 1UEUA 3HX0A 3T5KA 1T8EA 4YD2A 4QZFA 4ELVA 1Y88A 5HRGA 2JEIA 5CA7A 2ZJ8A 5EWGA 2P66A 3ISCA 4QZAA 2XY6A 2VA2A 1ZQCA 1ZQUA 5KFAA 1QSYA 1S77D 8ICBA 4DL5A 1TV9A 5BOLA 3JPNA 2ISPA 4DOBA 4BXOA 4KLIA 3BJYA 1HUOA 8ICEA 4UB2A 2M2UA 2HVIA 4M5DA 2AQ0A 5DECA 1DK3A 1A76A 1TFWA 4MEXA 3THVA 1U9LA 4Q8EA 3JZ0A 4B9LA 4KLLA 1BPXA 3RRHA 9ICBA 7ICKA 1ZETA 8ICRA 1UEVA 4WC2A 2ZH4A 1S97A 1AROP 1IXRA 4QZGA 2ZUCA 3Q8MA 1N48A 2KFNA 1JQRA 4B9TA 2ZTEA 3UQ2A 4M9HA 4I2GA 4IR1A 3T3FA 3G6XA 1NK8A 2DFLA 4E8FA 4I2IA 5DBBA 3SZ2A 2NRWA 4I2AA 2DVIA 3SYZA 3H4DA 1MIYA 5KFYA 4AT8A 5KFFA 4KLMA 3T5JA 3AQNA 2ZH9A 5KT4A 3AQKA 4UAWA 1D8YA 3TAQA 4IQWA 7ICHA 4WCWA 4I2CA 2ZJAA 4J9PA 1TKDA 7ICOA 2FPLA 2GWSA 4JV2A 5KFMA 3HPOA 4RPZA 1NK7A 4WC6A 4C8KA 4F3OA 2BQRA 8ICGA 5HMMA 4MFFA 4X0BA 3OGUA 4GXIA 1JIHA 7ICRA 4M9JA 4F4YA 1T3NA 4MFCA 4F4KA 2I1QA 3WFPA 3BQTA 4E7XA 3H40A 4ECSA 1QTMA 2ZH8A 3RH6A 3PW4A 1B22A 1KFDA 4F5NA 3V6HA 4DSIA 4DOCA 1BPYA 1JN3A 4LVSA 4DFJA 2HHPA 4Q45A 1TAQA 4FH3A 1VFGA 3PW0A 3MDCA 1R8BA 3C1YA 5DG8A 3RAXA 1ZQBA 2BR0A 2XGPA 5HP4A 1WCNA 4BDPA 4RQ6A 4RQ2A 2Q66A 1U47A 2NRTA 4Q44A 1L3VA 1D8LA 5IIKA 1BPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F50 A;  4QWC A;  4CCH A;  3ZDA A;  1KLN A;  4IRD A;  1ZJM A;  5KFB A;  1OU5 A;  3Q8R B;  4M9N A;  4EBK A;  3PX4 A;  4JWM A;  2W8K A;  1B43 A;  4XA5 A;  1D9F A;  1RPL A;  2JEG A;  4RQ3 A;  1K1Q A;  1T7P A;  5III A;  3AQM A;  4C8N A;  4RUA A;  5J0Q A;  4F5P A;  1U45 A;  8ICM A;  4PGQ A;  4NLK A;  4IQT A;  4NLZ A;  3KTQ A;  4KLO A;  1ZQJ A;  4LT6 A;  4FHW A;  4X4U A;  2VAN A;  2AGO A;  3IHQ B;  5L1I A;  2ZH6 A;  2ZH7 A;  9ICI A;  2ASL A;  4O3O A;  1DGS A;  3KHL A;  4DF8 A;  1LB2 B;  4LZG A;  4I2F A;  4K4H A;  1S76 D;  9ICM A;  9ICE A;  4RQ7 A;  4YXM A;  4JV0 A;  5KG1 A;  5CJ7 A;  3BQ2 A;  8ICH A;  1PX5 A;  2BCS A;  4XRH A;  4RNN A;  4UAY A;  3ISB A;  5L1K A;  4NKU A;  3GQC A;  4YN4 A;  5BPC A;  9ICH A;  4R8U B;  4AT9 A;  3LWL A;  3MGH A;  4J9L A;  1UA0 A;  4JV1 A;  3RB3 A;  1KDH A;  1ZQL A;  2ID1 A;  3MR2 A;  4F2S A;  2BE3 A;  2DR8 A;  2KTQ A;  2C2R A;  4M9G A;  2P6U A;  5DQG A;  5J0O A;  3PR4 A;  4FHP A;  4QZC A;  3UPS A;  1TK0 A;  4DS5 A;  1S9F A;  4DSK A;  2BPC A;  2PFN A;  3V7K A;  3C23 A;  4IRC A;  4R63 A;  3H8S A;  3TQ1 A;  2Y1J A;  1NKE A;  5DED A;  4YVZ A;  4DSE A;  4KLE A;  8ICQ A;  2UVW A;  4KIT B;  1QLN A;  5HHI A;  5J2J A;  1UT8 A;  4YFK A;  2M9N A;  3GIJ A;  9ICR A;  4UB3 A;  3Q8Q B;  3L9D A;  3PW5 A;  3QE9 Y;  1WCL A;  2BCQ A;  3M9O B;  3OHA A;  4M0A A;  2FPK A;  4YR0 A;  1XU4 A;  3WFS C;  1LV5 A;  4IG8 A;  2W9B A;  4M6W A;  3KHH A;  4EBE A;  1SKS A;  5IIN A;  1MQ2 A;  1ZQN A;  2BQU A;  5F9L A;  1Z00 B;  5J2B A;  3HJ4 A;  3B0X A;  4J9M A;  3OUY A;  2DR7 A;  2FLN A;  4ECV A;  5J2C A;  2XC9 A;  1DOQ A;  5F9N A;  4J9N A;  4IR9 A;  4RPX A;  3RJG A;  7ICT A;  3OJU A;  3AQL A;  8ICV A;  3LQC B;  4ECT A;  7ICU A;  1Q78 A;  3TFR A;  1ZQY A;  5IIL A;  4AT7 A;  4ED6 A;  9ICO A;  4RWQ A;  1U4B A;  5J0S A;  3HWT A;  3HIY A;  3ORY A;  4WBZ A;  4XQ7 A;  4RPY A;  4GXJ A;  4O5C A;  5DQH A;  4EZ9 A;  4WC3 A;  4ED7 A;  1QSS A;  3T5H A;  2NRX A;  5HRL A;  5KFR A;  4RNO A;  3ZDD A;  5HRI A;  4QWD A;  3PX0 A;  5CWR A;  3UXO A;  4ECU A;  1SKW A;  3ZDB A;  1TFY A;  5KFD A;  4F5R A;  4JK1 A;  4FBU A;  4DSL A;  2BHN A;  2NRZ A;  5KG5 A;  4RQ1 A;  4TQR A;  2R8G A;  1X9S A;  3RJH A;  3RJI A;  2W9C B;  1X9M A;  1KFS A;  2JZB B;  1UA1 A;  4DL3 A;  2PI5 A;  4O9M A;  2HVH A;  4TUR A;  4XUS A;  4F5O A;  5DG7 A;  3N97 B;  3H7I A;  4J9O A;  4DWI A;  3QEB Z;  9ICA A;  8ICT A;  5HRF A;  4Q8F A;  1ZQG A;  1BPE A;  4F92 B;  5J2K A;  4J9Q A;  4F4Z A;  4XQ8 A;  4KLD A;  5JUM A;  5J2F A;  3C2K A;  4ED2 A;  3Q8P B;  3M9M B;  1ZQP A;  5KFT A;  1ZQD A;  2W9A A;  4RUC A;  4F5Q A;  2HW3 A;  4X0A A;  5KFW A;  3ZD8 A;  5DB6 A;  4UBC A;  5D4B A;  4RT3 A;  2AGP A;  4O5K A;  4UD5 A;  4DLE A;  1V4A A;  4EYI B;  2V4R A;  3EW9 A;  4ZH4 A;  3GIM A;  8ICW A;  5HRE A;  4EBD A;  4NKT A;  3HJ1 A;  3PMN A;  3QEA Z;  2MUT A;  3B0Y A;  4O5E A;  9ICK A;  1DK2 A;  3PR5 B;  4QZE A;  4YD1 A;  1ZQI A;  1XSP A;  1ZQR A;  1CUK A;  5J0U A;  7ICP A;  3TAP A;  4X5V A;  4YQW A;  3TAR A;  4B9S A;  8ICX A;  3HT3 A;  1KRP A;  4UQG A;  4ED3 A;  2J6U A;  3IM1 A;  4GLX A;  1T4G A;  2HHX A;  4RQ8 A;  3NTU A;  5J0Y A;  5KG2 A;  7ICL A;  4FHY A;  4EZ6 A;  3OSN A;  4BWJ A;  5KFQ A;  1S0N A;  4NLN A;  1NJZ A;  4BWM A;  5KT2 A;  3JPQ A;  1KEJ A;  1XSL A;  1HUZ A;  2ISO A;  2IHM A;  7ICG A;  2FMP A;  2BKE A;  3RB6 A;  1L3S A;  3PO5 A;  1NJX A;  5DB9 A;  4BGD A;  4KLQ A;  4ATB B;  3RR7 A;  4DL6 A;  3C21 A;  5DG9 A;  3MR5 A;  1SZP A;  2F1H A;  4DQR A;  3RJJ A;  3V6K A;  2KZZ A;  1NZP A;  3C2M A;  4WC1 A;  3MR3 A;  5KT6 A;  9ICP A;  4P4P A;  2RDJ A;  1L5U A;  4MF2 A;  4QWB A;  4YR3 A;  2C2E A;  1ZQE A;  2M2V A;  2MAX A;  1Z3E B;  3OHB A;  3JPP A;  5HML A;  3V7L A;  2I9G A;  4EP7 A;  1MIV A;  2F1J A;  1TK5 A;  1UET A;  3PX6 A;  3JYY A;  3MAB A;  4Z6E A;  3T5L A;  2DPJ A;  4RQ4 A;  2IBK A;  4F8R A;  2HHV A;  3MFI A;  2P6R A;  4B9N A;  2FPM A;  1NK4 A;  3E2E A;  2C28 A;  1RXV A;  4TUP A;  3H8J A;  4ECX A;  2V9W A;  3GIK A;  1JXE A;  2XCA A;  2HHW A;  1BVS A;  3Q8K A;  3G6Y A;  1BNP A;  4AT9 B;  4FH5 A;  3UQ0 A;  3TI0 A;  1UT5 A;  5BOM A;  3KHG A;  2HHT A;  2A1J B;  4WC0 A;  3BQ0 A;  5KFV A;  4RWO A;  4PGX A;  5KFK A;  5CR0 A;  4YXJ A;  4F4W A;  1ZQT A;  4YMO A;  3JPR A;  2NRV A;  1NJW A;  4B9U A;  2ZJ5 A;  9ICV A;  3OVS A;  1XS9 D;  2ZH5 A;  4I2B A;  3AUO A;  4DFM A;  5F2V O;  3EWA A;  3JPO A;  4FS1 A;  4M9L A;  4YMN A;  4QZD A;  4TUS A;  3ZDE A;  8ICU A;  4I28 A;  4X4R A;  4X4V A;  1SKR A;  2HHU A;  4UB5 A;  2NRK A;  2IMW P;  3WFO A;  1ZQZ A;  1KTQ A;  5HRB A;  5KFI A;  4RWP A;  2ZTD A;  1XWL A;  1KSP A;  2J6T A;  5EWF A;  3HP6 A;  1NK5 A;  2ZH2 A;  1ZQK A;  7ICI A;  3RJF A;  3H39 A;  4QWA A;  3H8W A;  3ZDC A;  2ZTC A;  9ICC A;  4JUZ A;  4JWN A;  2C2D A;  1S0O A;  1JMS A;  2BCR A;  8ICO A;  4I2J A;  4K4I A;  5IIJ A;  2ATL A;  4ELU A;  4PHE A;  3RBE A;  3GIL A;  3JPT A;  3K4G A;  5KT7 A;  2AU0 A;  4O0I A;  2KN7 A;  4MFA A;  1ZQA A;  2PFQ A;  3TFS A;  5KTQ A;  1X2I A;  5DQI A;  3V7J A;  3UXN A;  4HYK A;  2BPG A;  5HRK A;  4Q43 A;  2RFF A;  1XSN A;  2DR9 A;  2RDI A;  1WOT A;  2ASD A;  4DEZ A;  4X4T A;  4R64 A;  3GFK B;  4J9R A;  3OJS A;  4KLF A;  4M2Y A;  3SI8 A;  3PVX A;  4PHP A;  3N4M B;  1IM4 A;  4F2R A;  8ICK A;  2R8I A;  4WC5 A;  5KT5 A;  1ZYQ A;  9ICS A;  2XO7 A;  1QSL A;  2PFP A;  4F91 B;  2UVV A;  5D46 A;  2O5A A;  4KLJ A;  4ECY A;  4QW8 A;  4KN4 A;  4R65 A;  4DFK A;  1V9P A;  1NKB A;  1BPD A;  5KFH A;  3V6J A;  3RAQ A;  4BXO B;  7ICQ A;  5KFC A;  3MR6 A;  3GV8 B;  4X4Q A;  1RZT A;  1RYS A;  4KN7 A;  1TAU A;  4ECZ A;  3QZ8 A;  3HW8 A;  1ZQH A;  4IRK A;  5J2H A;  3MBY A;  5HNK A;  4YP3 A;  4IQU A;  2AQ4 A;  1EXN A;  3GII A;  4C8O A;  5C5J A;  4EBC A;  2F1I A;  4F93 B;  2XY5 A;  5DGB A;  7ICF A;  8ICY A;  2M2W A;  3FDS A;  1ZQV A;  4FS2 A;  4NLG A;  5CHG A;  3BDP A;  2ALZ A;  4C8L A;  4I29 A;  9ICG A;  2KP7 A;  4J9K A;  2J6S A;  4X4O A;  3OVA A;  4Z6C A;  5HHH A;  2V4Q A;  4GXK A;  3UPQ A;  5IIM A;  9ICT A;  4AT8 B;  7ICE A;  1JX4 A;  4RWN A;  5KT3 A;  2R8H A;  2KZ3 A;  1Z00 A;  1TK8 A;  2KZM A;  4YG2 A;  1NO5 A;  2PXI A;  3WFR E;  2MUT B;  1K1S A;  1FA0 A;  4QWE A;  3UXP A;  4UB1 A;  1CEZ A;  3H3A A;  2UVU A;  4QZI A;  4O3Q A;  4DO9 A;  9ICU A;  4B9V A;  1COO A;  7ICM A;  3LK9 A;  4QZH A;  4ED0 A;  4UAZ A;  1ZQO A;  2IA6 A;  8ICI A;  3C18 A;  2HHS A;  3MFH A;  4DL2 A;  8ICJ A;  4DQQ A;  1N56 A;  4MEY A;  3PW2 A;  3H38 A;  4FO6 A;  1Q79 A;  3EZ5 A;  4WBY A;  2ZHA A;  5DLF A;  3G6V A;  4DF4 A;  1XC9 A;  4RU9 A;  1ZQS A;  2BCV A;  2UVR A;  2BGW A;  1JXL A;  4RQ0 A;  4I2E A;  4G3I A;  2KFZ A;  7ICN A;  5KG7 A;  1F5A A;  4F4X A;  4DQI A;  2FLP A;  4NY8 A;  2WTF A;  4RT2 A;  4FHX A;  4S3N A;  4Z6F A;  3C1Z A;  1ZQX A;  5HR9 A;  3LDA A;  2W9C A;  2JZB A;  4EBJ A;  4PPX A;  4P4M A;  5KFG A;  5KFJ A;  4EYH B;  3Q8S B;  4IQV A;  4J9S A;  2JEJ A;  2W9M A;  5J2A A;  3EYZ A;  4DL4 A;  1A77 A;  5KFP A;  3SV4 A;  3TAN A;  3JPS A;  1ZQQ A;  2IHN A;  2BDP A;  8ICN A;  1XO1 A;  2H5X A;  3K75 D;  3BQ1 A;  4RQ5 A;  3AU6 A;  5KFX A;  1C7Y A;  1MC8 A;  4TQS A;  2ASJ A;  4DOA A;  1RXW A;  3RRG A;  3H37 A;  2ZH1 A;  3AU2 A;  5EOZ A;  4PH5 A;  4DFP A;  1U49 A;  3EPI A;  3GV7 B;  4R66 A;  4E80 A;  9ICJ A;  4UBB A;  2ZUD A;  3RH4 A;  2BPF A;  5DBA A;  3M8R A;  4FBT A;  1R8A A;  3C66 A;  3M8S A;  2FMQ A;  2B21 A;  9ICX A;  1MQ3 A;  1ZQW A;  3QZ7 A;  7ICS A;  2FMS A;  3PNC A;  9ICQ A;  2FLL A;  7ICV A;  3NYB A;  2BQ3 A;  3RJK A;  2HHQ A;  5KFU A;  4X4N A;  4EEY A;  3H4B A;  4P2H A;  1YLQ A;  2PBE A;  9ICW A;  4PGY A;  8ICC A;  2W8L A;  8ICP A;  3RBD A;  5TZV A;  3ISD A;  1S0M A;  5L1J A;  4YR2 A;  1NK9 A;  2VA3 A;  9ICF A;  8ICS A;  4LZD A;  2DR5 A;  2PFO A;  1NK0 A;  4P4O A;  4ED1 A;  5DGA A;  1BGX T;  4QW9 A;  4I2H A;  4C8M A;  5DLG A;  4ECR A;  4KMU A;  1HJP A;  3OSP A;  8ICF A;  5KFS A;  8ICZ A;  4MF8 A;  5DDM A;  2XGQ A;  3PW7 A;  3PO4 A;  4QZB A;  3EPG A;  4O3R A;  5HRH A;  1SL1 A;  1R89 A;  2C22 A;  3Q8L A;  5KFO A;  4NXZ A;  3PV8 A;  5KG4 A;  4QZ8 A;  1X9W A;  4ATB A;  3ETL A;  4PHA A;  5CB1 A;  5J0P A;  5J0W A;  2AJQ A;  4UD4 A;  1ZQF A;  4WC4 A;  1NK6 A;  4M04 A;  4X4S A;  3LWM A;  5J29 A;  3GDX A;  1TFR A;  4K4G A;  4DL7 A;  2OWO A;  3WFQ E;  3V72 A;  4RNM A;  3GV5 B;  5L1L A;  4ELT A;  1BNO A;  4X4P A;  4UB4 A;  3RR8 A;  4DS4 A;  1KFT A;  3PY8 A;  3RH5 A;  4ED8 A;  4PHD A;  3C5G A;  4B9M A;  2W9B B;  4M6W B;  4ECW A;  3M9N B;  8ICA A;  1RYR A;  1KNY A;  5KFN A;  2M2T A;  4DSF A;  5IIO A;  3OUY B;  4DLG A;  1NJY A;  3NGD A;  4YMM A;  1SL0 A;  5DDY A;  4NM1 A;  2A1J A;  3MGI A;  4I27 A;  4QZ9 A;  1NKC A;  5HC9 A;  1U48 A;  4KLH A;  1TVA A;  5HRD A;  2XCP A;  4AT7 B;  5J2G A;  4DSJ A;  5DKW A;  4O3S A;  3ZD9 A;  2Q0Z X;  5J2E A;  2VA8 A;  4TUQ A;  4M47 A;  5L9X A;  5KG6 A;  2AGQ A;  5D49 A;  4R8U A;  2LYH A;  4GC7 A;  2ZH3 A;  4YCX A;  1VJ7 A;  5EWE A;  7ICJ A;  4I2D A;  1S10 A;  1H38 A;  3RTV A;  9ICL A;  1D9D A;  2O1P A;  1BPZ A;  5J0T A;  3RB4 A;  3RJE A;  1JAJ A;  3OV7 A;  4E0D A;  1PZN A;  3SV3 A;  5J2I A;  4KLS A;  4RZR A;  2Y1I A;  5KG0 A;  5KFE A;  2R8K A;  1ZQM A;  1NOM A;  2PI4 A;  2XY7 A;  1L3U A;  4WC7 A;  1L3T A;  4O3N A;  2DRB A;  1S0V A;  3OVB A;  5DBC A;  2ZUB A;  2ZHB A;  3PML A;  4KLG A;  1MSW D;  9ICN A;  5CP2 A;  2R8J A;  5KFZ A;  3C2L A;  4Z6D A;  3MDA A;  2DPI A;  2BCU A;  4KTQ A;  4NM2 A;  5DB7 A;  2JEF A;  3C5F A;  5J2D A;  4KLU A;  1MIW A;  4O3P A;  3KHR A;  4KLT A;  5KFL A;  1SL2 A;  1R8C A;  4DQP A;  5KG3 A;  4DQS A;  5J0R A;  4ECQ A;  2DRA A;  1ZJN A;  4GC6 A;  4FHV A;  3FYH A;  5J0X A;  3RB0 A;  5DB8 A;  8ICL A;  1UEU A;  3HX0 A;  3T5K A;  1T8E A;  4YD2 A;  4QZF A;  4ELV A;  1Y88 A;  5HRG A;  2JEI A;  5CA7 A;  2ZJ8 A;  5EWG A;  2P66 A;  3ISC A;  4QZA A;  2XY6 A;  2VA2 A;  1ZQC A;  1ZQU A;  5KFA A;  1QSY A;  1S77 D;  8ICB A;  4DL5 A;  1TV9 A;  5BOL A;  3JPN A;  2ISP A;  4DOB A;  4BXO A;  4KLI A;  3BJY A;  1HUO A;  8ICE A;  4UB2 A;  2M2U A;  2HVI A;  4M5D A;  2AQ0 A;  5DEC A;  1DK3 A;  1A76 A;  1TFW A;  4MEX A;  3THV A;  1U9L A;  4Q8E A;  3JZ0 A;  4B9L A;  4KLL A;  1BPX A;  3RRH A;  9ICB A;  7ICK A;  1ZET A;  8ICR A;  1UEV A;  4WC2 A;  2ZH4 A;  1S97 A;  1ARO P;  1IXR A;  4QZG A;  2ZUC A;  3Q8M A;  1N48 A;  2KFN A;  1JQR A;  4B9T A;  2ZTE A;  3UQ2 A;  4M9H A;  4I2G A;  4IR1 A;  3T3F A;  3G6X A;  1NK8 A;  2DFL A;  4E8F A;  4I2I A;  5DBB A;  3SZ2 A;  2NRW A;  4I2A A;  2DVI A;  3SYZ A;  3H4D A;  1MIY A;  5KFY A;  4AT8 A;  5KFF A;  4KLM A;  3T5J A;  3AQN A;  2ZH9 A;  5KT4 A;  3AQK A;  4UAW A;  1D8Y A;  3TAQ A;  4IQW A;  7ICH A;  4WCW A;  4I2C A;  2ZJA A;  4J9P A;  1TKD A;  7ICO A;  2FPL A;  2GWS A;  4JV2 A;  5KFM A;  3HPO A;  4RPZ A;  1NK7 A;  4WC6 A;  4C8K A;  4F3O A;  2BQR A;  8ICG A;  5HMM A;  4MFF A;  4X0B A;  3OGU A;  4GXI A;  1JIH A;  7ICR A;  4M9J A;  4F4Y A;  1T3N A;  4MFC A;  4F4K A;  2I1Q A;  3WFP A;  3BQT A;  4E7X A;  3H40 A;  4ECS A;  1QTM A;  2ZH8 A;  3RH6 A;  3PW4 A;  1B22 A;  1KFD A;  4F5N A;  3V6H A;  4DSI A;  4DOC A;  1BPY A;  1JN3 A;  4LVS A;  4DFJ A;  2HHP A;  4Q45 A;  1TAQ A;  4FH3 A;  1VFG A;  3PW0 A;  3MDC A;  1R8B A;  3C1Y A;  5DG8 A;  3RAX A;  1ZQB A;  2BR0 A;  2XGP A;  5HP4 A;  1WCN A;  4BDP A;  4RQ6 A;  4RQ2 A;  2Q66 A;  1U47 A;  2NRT A;  4Q44 A;  1L3V A;  1D8L A;  5IIK A;  1BPB A; 
#chains in the Genus database with same CATH topology
 2KNJ A;  4MKP A;  1Z19 A;  4EBK A;  3H0M B;  4JWM A;  2XI9 A;  4XA5 A;  2JEG A;  4IL6 U;  2O6K A;  1KBU A;  4Y2Q A;  4PGQ A;  4NLK A;  1DGJ A;  4OAG A;  4NLZ A;  1QQ7 A;  3KTQ A;  4KLO A;  3SAF A;  1X40 A;  1LB2 B;  4DCC A;  4LZG A;  9ICE A;  4YXM A;  2ZXI A;  2A1A A;  2Y9T A;  4XRH A;  3TAD A;  4RNN A;  4UAY A;  5L1K A;  4EEB A;  5BPC A;  4R8U B;  1UA0 A;  3RB3 A;  2B6G A;  3M6Z A;  2P6U A;  2HCF A;  4NXV A;  2F3N A;  3V7K A;  2YB4 A;  3C23 A;  4YVZ A;  4KLE A;  4KIT B;  5B3P A;  3Q8Q B;  1WCL A;  5CEH A;  2FPK A;  2FI1 A;  4IG8 A;  4M6W A;  3KHH A;  1MQ2 A;  5AK4 A;  2W54 A;  5F9L A;  5J2B A;  3B0X A;  2IUB A;  1NZB A;  4ECV A;  4RPX A;  7ICU A;  1ZQY A;  5IIL A;  4ED6 A;  5ALH A;  2AXT U;  4RPY A;  4ED7 A;  1QSS A;  3RF9 A;  2NRX A;  4QWD A;  4ECU A;  5H2F U;  5KFD A;  4F5R A;  4JK1 A;  4FBU A;  4DSL A;  1SGG A;  3NUQ A;  4RQ1 A;  3RJH A;  1KFS A;  5AKX A;  4DL3 A;  8ICT A;  2H3Z A;  5JUM A;  3C2K A;  3Q8P B;  4ZOH C;  4NXU A;  4UD5 A;  1V4A A;  3N7P D;  4ZH4 A;  8ICW A;  4EBD A;  3HJ1 A;  2MUT A;  4QIW C;  4O5E A;  3PR5 B;  2E8M A;  4QZE A;  3PST A;  4YD1 A;  1N60 A;  7ICP A;  3TAP A;  4X5V A;  1COK A;  4EEN A;  1KRP A;  4UQG A;  1Q46 A;  1T4G A;  4K98 A;  4US8 A;  3OSN A;  5KFQ A;  1S0N A;  1KEJ A;  2E8O A;  4NXT A;  4EX7 A;  2BKE A;  3PO5 A;  4KLQ A;  1F5S A;  1X6J A;  3CYM A;  4NXW A;  4DQR A;  1J2N A;  2KZZ A;  1NZP A;  5KT6 A;  2RDJ A;  4QWB A;  3WKB A;  1T3Q A;  2M2V A;  2MAX A;  2KSO A;  3HRD D;  5HML A;  3V7L A;  1UET A;  2LHT A;  4KM5 A;  3T5L A;  2ZIU B;  2P6R A;  3H8J A;  2V9W A;  2HHW A;  1BVS A;  3TI0 A;  2HHT A;  4WC0 A;  3BQ0 A;  4Y2T A;  5KFV A;  4LJX A;  4PGX A;  5CR0 A;  4OO1 J;  4F4W A;  3JPR A;  2NRV A;  4B9U A;  3F2D A;  1XS9 D;  4DFM A;  3EWA A;  4FS1 A;  4YMN A;  4X4V A;  2EQY A;  3IG8 A;  1ZQZ A;  5HRB A;  3DV9 A;  1F0M A;  1KSP A;  4PZO A;  1NK5 A;  2WF5 A;  7ICI A;  4QWA A;  3ZDC A;  2ZTC A;  3KKA C;  1X6I A;  2BCR A;  1JMS A;  4ELU A;  4O69 A;  2W55 A;  2WF6 A;  5ALP A;  5KT7 A;  5ALD A;  5AI5 A;  3D6J A;  4MFA A;  2WAQ F;  5KTQ A;  2BPG A;  4Q43 A;  2RFF A;  4RQN A;  2OYY A;  3SI8 A;  3N4M B;  3NVO A;  1QH9 A;  2R8I A;  5AI9 A;  4F91 B;  1L8O A;  4UAU A;  5K4L A;  2O5A A;  4KLJ A;  1V9P A;  2F44 A;  3MR6 A;  1TAU A;  3HW8 A;  5J2H A;  3EF2 A;  5ALL A;  3MBY A;  5HNK A;  5C5J A;  3KZX A;  5DGB A;  7ICF A;  2YQE A;  3BDP A;  5EE1 A;  4C8L A;  5JRT A;  9ICG A;  4J9K A;  3OVA A;  2V4Q A;  5IIM A;  9ICT A;  4RWN A;  2KZ3 A;  5E79 U;  1NO5 A;  3WFR E;  2MUT B;  1K1S A;  3UXP A;  2DGZ A;  4DO9 A;  3M7D A;  5ALV A;  3LK9 A;  3QUQ A;  3C18 A;  3MFH A;  3H38 A;  4WJ3 B;  3EZ5 A;  2IOF K;  4FFD A;  5DLF A;  2UVR A;  4I2E A;  2PMZ C;  2BGW A;  3F5E A;  4G3I A;  4DQI A;  2KV2 A;  4FHX A;  2K4I A;  2W9C A;  1WWV A;  2JZB A;  4NWI A;  4PPX A;  4P4M A;  5CHE A;  3Q8S B;  1A77 A;  1M6Y A;  5CFS A;  1XO1 A;  4MFC A;  3ZI4 A;  2GA9 D;  3WK9 A;  4DOA A;  1RXW A;  5EOZ A;  4E80 A;  1WYG A;  2ZUD A;  5DBA A;  3C66 A;  2FMQ A;  2B21 A;  1ZQW A;  9ICQ A;  3RJK A;  4BX9 C;  4P2H A;  1YLQ A;  4AYB F;  2XID A;  2PBE A;  9ICW A;  3RBD A;  4YR2 A;  2VA3 A;  9ICF A;  2RLT A;  1XO0 A;  4ED1 A;  1B0X A;  2OCE A;  4QW9 A;  4C8M A;  3NWI A;  5KFS A;  8ICZ A;  5DDM A;  3PW7 A;  4O3R A;  5HRH A;  3EPG A;  3VCB A;  1YZ7 A;  3GU3 A;  4HX0 A;  4QZ8 A;  3ETL A;  4UD4 A;  1ZQF A;  1JI7 A;  2ODG A;  3GDX A;  2GLE A;  3WFQ E;  5L1L A;  1BNO A;  3RR8 A;  1KFT A;  4ED8 A;  3J81 j;  2JXJ A;  4ECW A;  1RYR A;  4HAI A;  3HKZ C;  1YT3 A;  5DDY A;  2VJ5 A;  3SAG A;  1NKC A;  5HC9 A;  4AT7 B;  2HSZ A;  1YZ6 A;  3F2C A;  1VDV A;  4O3S A;  4P0P B;  4TUQ A;  3ZD9 A;  4M47 A;  5L9X A;  5KG6 A;  2AGQ A;  2G08 A;  5D49 A;  2ZH3 A;  2OHF A;  4YCX A;  1IIP A;  9ICL A;  5AKJ A;  5J0T A;  3RB4 A;  5J2I A;  5KG0 A;  2NV3 A;  4OD0 A;  3NAS A;  4O3N A;  1S0V A;  5DBC A;  3QNM A;  4NXX A;  5KFZ A;  4Z6D A;  3MDA A;  2DPI A;  2BCU A;  2JEF A;  2ESE A;  5HR7 A;  5J2D A;  4O3P A;  4KLT A;  4DQP A;  5B5E U;  2YMM A;  3RB0 A;  5DB8 A;  8ICL A;  3HX0 A;  4ELV A;  1PUZ A;  1Y88 A;  5HRG A;  2JEI A;  5CA7 A;  1ZQU A;  2KKP A;  5KFA A;  5T14 A;  1QSY A;  8ICB A;  2PKE A;  2ISP A;  2M2U A;  1WWU A;  8ICE A;  4UB2 A;  2HVI A;  5DEC A;  1TFW A;  2AH5 A;  4B9L A;  2HBL A;  1UEV A;  3Q8M A;  4QZG A;  2KIW A;  4B9T A;  4I2G A;  2DFL A;  4I2I A;  4I2A A;  2NRW A;  4AT8 A;  4KLM A;  2ZH9 A;  5KT4 A;  5CRX A;  4IQW A;  4Y2R A;  1URJ A;  4I2C A;  1ZD4 A;  1TKD A;  3DDH A;  2GWS A;  3IN5 A;  4RPZ A;  4NJ8 A;  2BQR A;  4MFF A;  4X0B A;  2RHF A;  4M9J A;  2I1Q A;  1OXJ A;  4JB3 A;  2YN4 A;  3FM9 A;  3NRW A;  2E1F A;  4EX6 A;  2YB1 A;  2D6F C;  1TAQ A;  1VFG A;  2KKV A;  1R8B A;  1KN5 A;  3ETR A;  3S6J A;  1U47 A;  2NRT A;  1V38 A;  4QWC A;  4IRD A;  4PJ0 U;  3Q8R B;  4M9N A;  2HDO A;  2XVT A;  4OCZ A;  3AQM A;  5III A;  1IG6 A;  4RUA A;  8ICM A;  3QU4 A;  4LT6 A;  4X4U A;  2VAN A;  3IHQ B;  2ZH6 A;  2ZH7 A;  1DGS A;  2KVC A;  4DF8 A;  2ZIX B;  2DKZ A;  4JV0 A;  5KG1 A;  3BQ2 A;  1PX5 A;  2BCS A;  4AT9 A;  3LWL A;  1KDH A;  1ZQL A;  2ID1 A;  3MR2 A;  1V97 A;  2DR8 A;  4M9G A;  1GO3 F;  1SXE A;  4FHP A;  5ALQ A;  4DSK A;  2BPC A;  2KEY A;  4XJE A;  3H8S A;  3QUB A;  1HEK A;  2L5Y A;  4DSE A;  2UVW A;  1SXD A;  5J2J A;  3M9O B;  4M0A A;  3WFS C;  4YR0 A;  3LYS A;  2EZZ A;  5IIN A;  2VJ4 A;  1Z00 B;  3ERC C;  3HJ4 A;  2DR7 A;  5J2C A;  2XC9 A;  5F9N A;  1J2M A;  3RJG A;  2DQN B;  3OJU A;  4ECT A;  3ICX A;  1U4B A;  2QAR A;  3ORY A;  1Q3V A;  4O5C A;  4WC3 A;  3T5H A;  3ZDD A;  2YTU A;  3UXO A;  1TFY A;  2NYV A;  4TQR A;  4K99 A;  5KG5 A;  2YML A;  2HVH A;  1N63 A;  4TUR A;  5DG7 A;  3N97 B;  3SMV A;  9ICA A;  1JRP A;  4F92 B;  3SAH A;  4ED2 A;  2HBM A;  2W9A A;  4RUC A;  4F5Q A;  2HW3 A;  4X0A A;  5DB6 A;  4UBC A;  4RT3 A;  3UM9 A;  5ALK A;  1ZRM A;  4OJ6 A;  2V4R A;  3EW9 A;  4UW9 A;  4Y2J A;  5AK6 A;  1DK2 A;  5ALF A;  3PSP A;  3U26 A;  1ZQR A;  3HT3 A;  2YX8 A;  4ED3 A;  2J6U A;  3IM1 A;  4GLX A;  3NVW A;  2HHX A;  4RQ8 A;  5J0Y A;  7ICL A;  3KD3 A;  1ED1 A;  3WU2 U;  2Z7J A;  1XSL A;  2ISO A;  1X9X A;  2B0C A;  2IHM A;  7ICG A;  2FMP A;  2ZIW A;  3RB6 A;  1L3S A;  3KFU F;  5DB9 A;  1ZD2 P;  2K8B B;  3C21 A;  4WC1 A;  3IV6 A;  4P4P A;  5B3Q A;  1Z3E B;  3JPP A;  5TIS U;  3PX6 A;  3MAB A;  4K97 A;  2FPM A;  2K4P A;  3GIK A;  3NVY A;  2XCA A;  4CGZ A;  1BNP A;  4AT9 B;  3UQ0 A;  4RWO A;  5KFK A;  5AKE A;  1ZQT A;  3IDW A;  9ICV A;  2MU2 A;  3H8M A;  3JPO A;  4X4R A;  2IMW P;  3AM9 A;  3AQE A;  1L8L A;  3QX7 A;  1XWL A;  2J6T A;  4Y2X A;  2G0A A;  3HP6 A;  3H39 A;  2JV3 A;  5FP0 A;  9ICC A;  4JUZ A;  2C2D A;  4FZN A;  8ICO A;  5ALJ A;  5AIA A;  2LYA A;  2ATL A;  1LKY A;  2KIC A;  3RBE A;  3JPT A;  5AI0 A;  1QQ5 A;  2KN7 A;  3WK4 A;  4QJF B;  5DQI A;  2RDI A;  4FZM A;  2ASD A;  4J03 A;  3GFK B;  1NI3 A;  3LVW A;  4KLF A;  4F2R A;  3SD7 A;  3L3F X;  5KT5 A;  1ZYQ A;  1QSL A;  3ER9 B;  2KHV A;  2E3T A;  4WH5 A;  4UAS A;  2F8L A;  4KN4 A;  1NKB A;  7ICQ A;  3RAQ A;  3GV8 B;  5KL8 B;  2LI6 A;  4KN7 A;  3QUT A;  4IRK A;  2LPE A;  2AQ4 A;  1RYU A;  3QXG A;  4IQU A;  5ALE A;  1EXN A;  3AMZ A;  2DKX A;  5AI4 A;  4EBC A;  2F1I A;  4F93 B;  1L7N A;  8ICY A;  4OJ5 A;  3CNH A;  1KQQ A;  2KD1 A;  4I29 A;  2J6S A;  7ICE A;  5KT3 A;  4NL9 C;  2KZM A;  1FA0 A;  3EUB 2;  5EE0 A;  2VKQ A;  4QZI A;  9ICU A;  1L6N A;  2JRZ A;  4QZH A;  4ED0 A;  4UAZ A;  8ICI A;  2P35 A;  4LEZ A;  2JMG A;  3NS1 A;  8ICJ A;  1N56 A;  2D8C A;  5ALO A;  1XC9 A;  1SB3 C;  2BCV A;  2OEH A;  7ICN A;  1SV4 A;  1JXL A;  2KFZ A;  2FLP A;  4NY8 A;  2WTF A;  4RT2 A;  4KB6 A;  1NNL A;  4EYH B;  4IQV A;  2W9M A;  1WOT A;  2BDP A;  1ZQQ A;  2W3R A;  3AU6 A;  2BBJ A;  5AHX A;  2FE9 A;  3CP8 A;  1C7Y A;  1GPJ A;  2ASJ A;  5B66 U;  4CDG A;  4DFP A;  3DEE A;  9ICJ A;  4UBB A;  3RH4 A;  2BPF A;  2RP5 A;  9ICX A;  1MQ3 A;  7ICS A;  2KVS A;  2FMS A;  5G5H A;  4EV6 A;  4RQM A;  2BQ3 A;  2HHQ A;  5KFU A;  3SEN A;  1ZOL A;  2W8L A;  3ISD A;  4FE3 A;  1NK9 A;  5AKZ A;  2PFO A;  4P4O A;  5DGA A;  1BGX T;  4ECR A;  3F53 A;  3OSP A;  2G06 A;  1SL1 A;  3F2B A;  1R89 A;  3Q8L A;  4NXZ A;  3PV8 A;  4ATB A;  2MSN A;  3QU7 A;  5J0P A;  4WC4 A;  4X4S A;  1SWV A;  4DL7 A;  2OWO A;  1LKY B;  3B9J A;  4RNM A;  1ZD5 A;  2HOF A;  4PHD A;  4B9M A;  5G5G A;  4M6W B;  3TAD C;  1JAL A;  3M9N B;  3PZP A;  4USA A;  2WF9 A;  2M2T A;  1N5W A;  2A1J A;  2QB1 A;  4I27 A;  1U48 A;  4KLH A;  5J2G A;  2KE7 A;  4IC9 A;  1MN8 A;  1H38 A;  2ZXH A;  1D9D A;  2O1P A;  4EEK A;  4E0D A;  1KKX A;  2Y1I A;  2EZY A;  5KFE A;  4I0U A;  3OVB A;  1MSW D;  3K1Z A;  2F76 X;  2R18 A;  4NM2 A;  5AKG A;  1MIW A;  1R8C A;  2MRL A;  5GTH U;  1UEU A;  4YD2 A;  5AIC A;  2ZJ8 A;  4QZA A;  1ZQC A;  1S77 D;  4BJQ A;  4DL5 A;  1TV9 A;  5BOL A;  2W3S A;  1L7M A;  4BXO A;  4JLX A;  2W11 A;  3BJY A;  1HUO A;  4M5D A;  1DK3 A;  3WK5 A;  5KNI A;  4NLB A;  4MEX A;  3CK6 A;  3JZ0 A;  4KLL A;  3I1Y A;  1ZET A;  2ZH4 A;  1IXR A;  2KFN A;  2K89 A;  3IP4 B;  2ZTE A;  5C0Y A;  2GO7 A;  2RRD A;  3K7D A;  4IR1 A;  3T3F A;  1NK8 A;  3SZ2 A;  2YMQ A;  4NV0 A;  3SYZ A;  3H0R B;  5KFY A;  3WK8 A;  1PVP A;  1PK1 A;  1D8Y A;  7ICH A;  2LKY A;  7ICO A;  2KSO B;  2FPL A;  3UMG A;  4WC6 A;  1RG6 A;  4F3O A;  3RFA A;  2ZIV A;  4GXI A;  1JIH A;  7ICR A;  5CFU A;  2K8C B;  5AKY A;  1QTM A;  1B22 A;  3PW4 A;  4F5N A;  4C7Y A;  1X42 A;  1XNS A;  4DFJ A;  3C1Y A;  3RAX A;  2XGP A;  1WCN A;  2Q66 A;  1L3V A;  1JAJ A;  4CCH A;  1ZJM A;  3PX4 A;  2W8K A;  1B43 A;  1D9F A;  1RPL A;  2H3Q A;  4RQ3 A;  1K1Q A;  1T7P A;  2QB0 A;  3QUC A;  2WAQ C;  4F5P A;  1U45 A;  2EAN A;  4IQT A;  4CF5 A;  2KMD A;  3IG5 A;  2AGO A;  2ASL A;  4UAV A;  4K4H A;  1WUD A;  9ICM A;  3L4P A;  8ICH A;  2NO5 A;  4NKU A;  4YN4 A;  1VLB A;  4JV1 A;  2EZX A;  1O03 A;  2Y9U A;  3A0H U;  3BS5 A;  4C0Z A;  2BE3 A;  2EAP A;  2KTQ A;  2C2R A;  4C4S A;  5DQG A;  5J0O A;  3PR4 A;  4QZC A;  3LVV A;  1SV0 A;  4IRC A;  1NKE A;  3TQ1 A;  2OH2 A;  8ICQ A;  1QLN A;  1UT8 A;  9ICR A;  3L9D A;  3PW5 A;  2BCQ A;  1XU4 A;  2B4V A;  1LV5 A;  2W9B A;  2CPR A;  4EBE A;  4C7Z A;  1SKS A;  2BQU A;  1PVQ A;  4J9M A;  3OUY A;  2FLN A;  4C80 A;  3ONN A;  4J9N A;  1ECW A;  8ICV A;  4U6P A;  3TFR A;  3M1Y A;  2RQ5 A;  5J0S A;  3HWT A;  4Y2Y A;  5AKL A;  5ALG A;  5DQH A;  4EZ9 A;  2NO4 A;  1DXS A;  5KFR A;  4O6A A;  5CWR A;  5A0L A;  1SKW A;  2NRZ A;  1X9S A;  2W9C B;  1X9M A;  2JZB B;  2W43 A;  2E8N A;  2PI5 A;  2HN1 A;  4J9O A;  4J9Q A;  4F4Z A;  2HMX A;  5J2F A;  2JH1 A;  3M9M B;  2CXY A;  5KFW A;  3ZD8 A;  4O5K A;  2AGP A;  3BZK A;  2ZIV B;  2KK0 A;  2I5H A;  2N1R A;  5AM3 A;  4EYI B;  1AQ6 A;  4AYB C;  5HRE A;  3QEA Z;  5JTI A;  1XSP A;  5J0U A;  2A3V A;  4YQW A;  8ICX A;  2DBY A;  3JCF A;  4WOY A;  4FZL A;  2K4H A;  3NTU A;  4FHY A;  3HIL A;  2H3V A;  4BWJ A;  2W7P A;  1NJZ A;  1QQ6 A;  1NJX A;  5AKK A;  3RR7 A;  5AIB A;  1Z1B A;  4DL6 A;  3MR5 A;  3V6K A;  3C2M A;  3MR3 A;  1L5U A;  4MF2 A;  4NLC A;  2C2E A;  3SR6 A;  2F1J A;  3PSF A;  4Z6E A;  3UMB A;  4RQ4 A;  2HHV A;  2H3F A;  2E1E A;  3MFI A;  1NK4 A;  2C28 A;  1RXV A;  3NVZ A;  4ECX A;  1JXE A;  4LEW A;  4FH5 A;  1SZH A;  4U7C A;  1X66 A;  4YXJ A;  5F3X B;  2ZJ5 A;  3AUO A;  3KOO A;  4WBY A;  4M9L A;  3GZF A;  3ZDE A;  2ES6 A;  4I28 A;  2HHU A;  2NRK A;  1KTQ A;  1RDF A;  1FIQ A;  3F5A A;  4RWP A;  4PZN A;  4LEV A;  5D61 A;  2ZTD A;  2G5I B;  2ZH2 A;  1ZQK A;  4UAT A;  1A6S A;  4JWN A;  3BZC A;  4K4I A;  5IIJ A;  2WF7 A;  2LM4 A;  3GIL A;  2AU0 A;  2PFQ A;  3PSI A;  1X2I A;  5AM4 A;  2DR9 A;  4X4T A;  4CE6 A;  4R64 A;  3PVX A;  1SV0 C;  1UPH A;  4PHP A;  5AM0 A;  8ICK A;  2KIV A;  9ICS A;  2XO7 A;  2PFP A;  3WKD A;  2A19 A;  5D46 A;  4ECY A;  4QW8 A;  4R65 A;  4DFK A;  5KFH A;  1SIJ A;  1ZRN A;  1ZXI A;  1RZT A;  1RYS A;  4X4Q A;  3UMC A;  1P7D A;  4Y2U A;  4YP3 A;  3GII A;  4PL1 A;  3FAH A;  2XY5 A;  1JUD A;  2K4E A;  3FDS A;  1ZQV A;  4FS2 A;  4K96 A;  5CHG A;  4X4O A;  1RQL A;  5D62 A;  4AT8 B;  5HHH A;  4GXK A;  1ZQ1 C;  4WQL A;  2R8H A;  1TK8 A;  4YG2 A;  2PXI A;  1CEZ A;  2IOH A;  2JH7 A;  4O3Q A;  4B9V A;  1COO A;  1ZQO A;  4DQQ A;  4MEY A;  4FO6 A;  1ZQS A;  4RQ0 A;  3QU9 A;  5CFT A;  5ALY A;  4S3N A;  4Z6F A;  3C1Z A;  1ZQX A;  4F71 A;  3LDA A;  2B51 A;  2KOB A;  5KFG A;  5KFJ A;  1UQV A;  2IHO A;  4J9S A;  2JEJ A;  4FO1 A;  4DL4 A;  5KFP A;  3TAN A;  2I6X A;  5AM2 A;  2IHN A;  8ICN A;  2H5X A;  3BQ1 A;  3K75 D;  4RQ5 A;  5KFX A;  1MC8 A;  4TQS A;  1UCV A;  3H37 A;  3AU2 A;  4PH5 A;  1Q3U A;  3EPI A;  3GV7 B;  3M8R A;  3M8S A;  3QZ7 A;  4KMO B;  1JRO A;  2HBJ A;  3QU5 A;  4EEY A;  3H4B A;  4IS7 A;  8ICC A;  2EAO A;  1L7P A;  1S0M A;  2F8K A;  5L1J A;  2GAF D;  3E58 A;  8ICS A;  3MC1 A;  1OUQ A;  1NK0 A;  4I2H A;  3D2Q A;  1B4F A;  4KMU A;  8ICF A;  3PO4 A;  4QZB A;  5AK5 A;  1L7O A;  5KFO A;  1C20 A;  1O08 A;  1X9W A;  4PHA A;  5J0W A;  4G9B A;  3TKA A;  2AJQ A;  3L5K A;  4M04 A;  3VC8 A;  3LWM A;  5J29 A;  3GV5 B;  4KX5 A;  2QLT A;  3TAC B;  4UB4 A;  3KKA A;  8ICA A;  2ZIU A;  2G07 A;  4AP9 A;  1KNY A;  1Z4O A;  1NJY A;  4A8E A;  3NGD A;  1SL0 A;  3MGI A;  1TVA A;  5HRD A;  2XCP A;  4DSJ A;  2QAR B;  5J2E A;  2VA8 A;  1PK3 A;  3OTQ A;  4I2D A;  1VJ5 A;  1BPZ A;  3RJE A;  1PZN A;  4KLS A;  3D2N A;  2HOI A;  2LBO A;  4Y2S A;  1NOM A;  2PI4 A;  2XY7 A;  2YMP A;  4WC7 A;  1L3T A;  4K9A A;  2ZUB A;  4KLG A;  1FEZ A;  2KJ9 A;  3C5F A;  4KLU A;  2KHQ A;  3KHR A;  5KFL A;  1SL2 A;  5J0R A;  4ECQ A;  2QKQ A;  1ZJN A;  4GC6 A;  4FHV A;  3FYH A;  5J0X A;  3T5K A;  1T8E A;  4QZF A;  2OXO A;  5EWG A;  2VA2 A;  3ISC A;  2XY6 A;  3N7R C;  2YY6 A;  4DOB A;  4KLI A;  1A76 A;  4Q8E A;  1S8O A;  4GFJ A;  4ICA A;  2E8P A;  4EEL A;  7ICK A;  9ICB A;  4WC2 A;  1S97 A;  1ARO P;  2CN1 A;  1JQR A;  2VIX A;  4M9H A;  2ZIW B;  4OAI Z;  3G6X A;  4JLZ A;  4E8F A;  2MA1 A;  4K9B A;  1MIY A;  3H4D A;  5KFF A;  3AQN A;  4UB8 U;  4UAW A;  3TAQ A;  4J9P A;  3HPO A;  4EED A;  1NK7 A;  2F77 X;  2BZF A;  8ICG A;  5HMM A;  5ALX A;  4O3M A;  1T3N A;  4F4K A;  4ECS A;  5AM5 A;  2ZH8 A;  3RH6 A;  4GIB A;  3V6H A;  5L1M A;  1WG8 A;  4DSI A;  1BPY A;  1N2X A;  2Y0S F;  4Q45 A;  4FH3 A;  3MDC A;  5DG8 A;  1ZQB A;  2PMZ F;  4RQ6 A;  2D3D A;  3WKE A;  4Q44 A;  3T79 A;  5IIK A;  2XIC A;  3BQT A;  4F50 A;  3ZDA A;  1KLN A;  5KFB A;  1OU5 A;  5AKI A;  1A0P A;  4C8N A;  5J0Q A;  1S5L U;  5ALM A;  3I76 A;  1ZQJ A;  4FHW A;  5L1I A;  9ICI A;  4O3O A;  3WKC A;  3KHL A;  2W03 A;  4I2F A;  1S76 D;  4RQ7 A;  5CJ7 A;  3A0B U;  3ISB A;  3GQC A;  9ICH A;  1KL9 A;  4CF3 A;  1CRX A;  5ALI A;  3MGV A;  3MGH A;  4J9L A;  4F2S A;  2GH1 A;  4C4T A;  3UPS A;  1TK0 A;  4DS5 A;  1S9F A;  2PFN A;  2FCL A;  4KX3 A;  4R63 A;  2Y1J A;  5J8Y A;  5DED A;  5HHI A;  4YFK A;  2M9N A;  3HJE A;  5AI6 A;  3GIJ A;  4UB3 A;  3QE9 Y;  1Z4N A;  3OHA A;  2OM6 A;  4UAR A;  3AQF A;  1ZQN A;  1DOQ A;  4IR9 A;  2HBK A;  7ICT A;  3AQL A;  3LQC B;  1Q78 A;  3HKZ F;  4DFD A;  2EH9 A;  4AT7 A;  4JMU A;  2JHD A;  3QU2 A;  9ICO A;  4RWQ A;  4P0P A;  3HIY A;  4XQ7 A;  4WBZ A;  4GXJ A;  2KG5 A;  5HRL A;  4RNO A;  5HRI A;  3PX0 A;  3ZDB A;  2BHN A;  2R8G A;  3RJI A;  1UA1 A;  4O9M A;  4XUS A;  4F5O A;  4DWI A;  2JGA A;  3H7I A;  3QEB Z;  5HRF A;  2B56 A;  4OJP A;  4Q8F A;  1ZQG A;  1BPE A;  2DWQ A;  5J2K A;  4XQ8 A;  4KLD A;  1LVH A;  2FJ6 A;  1IV8 A;  1ZQP A;  5KFT A;  1RQN A;  1ZQD A;  3CRX A;  3NKU A;  4O68 A;  5D4B A;  4K8V A;  4DLE A;  2CRX A;  5HR6 A;  3GIM A;  2BDU A;  5EE9 A;  4NKT A;  3PMN A;  3B0Y A;  9ICK A;  2Y0S C;  1N61 A;  4B6J A;  2GOL A;  1ZQI A;  1RM6 C;  3PHZ A;  1CUK A;  4MHV A;  3TAR A;  2JR5 A;  2G09 A;  3KZI U;  4B9S A;  3O0F A;  2FDR A;  4WQK A;  1FFU A;  5ALU A;  5KG2 A;  2BBH A;  2F2A B;  4EZ6 A;  4NLN A;  4BWM A;  5KT2 A;  3JPQ A;  1HUZ A;  4OAF A;  4ATB B;  1FFV A;  4BGD A;  5DG9 A;  3OPX A;  1SZP A;  2F1H A;  3RJJ A;  9ICP A;  4YR3 A;  1ZQE A;  3OHB A;  2I9G A;  4EP7 A;  1MIV A;  1TK5 A;  1UHU A;  3JYY A;  2DPJ A;  3C28 A;  2IBK A;  4F8R A;  4B9N A;  3E2E A;  4TUP A;  3Q8K A;  3G6Y A;  2W04 A;  5F2V O;  1UT5 A;  5BOM A;  3KHG A;  2A1J B;  1SWW A;  4YMO A;  1NJW A;  5KAF U;  3OVS A;  2ZH5 A;  4I2B A;  3K1R B;  8ICU A;  4QZD A;  4TUS A;  5AK3 A;  1SKR A;  4UB5 A;  3WFO A;  1TAM A;  5KFI A;  1KW4 A;  5EWF A;  2WB1 F;  1Q8K A;  3RJF A;  1CI4 A;  3H8W A;  2KJ8 A;  1S0O A;  4I2J A;  2ZG6 A;  4PHE A;  3CW2 C;  3K4G A;  3R9K A;  4O0I A;  1ZQA A;  3TFS A;  4OJO A;  3V7J A;  4HYK A;  5HRK A;  3UXN A;  1XSN A;  3BQ7 A;  3I28 A;  2ZIX A;  4DEZ A;  1J97 A;  3WK7 A;  3OJS A;  4J9R A;  4M2Y A;  5ALN A;  1IM4 A;  4WC5 A;  2WFA A;  5J8Y C;  5ALW A;  2UVV A;  5ALT A;  1ZD3 A;  3M6K A;  1BPD A;  3V6J A;  4BXO B;  5KFC A;  5JU5 A;  4ECZ A;  3QZ8 A;  1MA7 A;  1ZQH A;  4UB6 U;  4C8O A;  5EE3 A;  2M2W A;  4NLG A;  2ALZ A;  2KP7 A;  2KJ5 A;  4Z6C A;  3UPQ A;  1JX4 A;  3AN1 A;  1PK1 B;  3ALR A;  1Z00 A;  2HI0 A;  3IRU A;  4QWE A;  4UB1 A;  3H3A A;  2UVU A;  4US9 A;  2DF4 B;  7ICM A;  2IA6 A;  2HHS A;  4DL2 A;  1OW5 A;  3PW2 A;  1Q79 A;  2ZHA A;  4DF4 A;  3G6V A;  4RU9 A;  5AKH A;  1F5A A;  5KG7 A;  4F4X A;  5HR9 A;  4CNQ A;  4EBJ A;  2DUY A;  2HOQ A;  2AHO B;  4CRX A;  2Q4T A;  1DRG A;  1N62 A;  3EYZ A;  5J2A A;  3SQI A;  3SV4 A;  2W7O A;  3JPS A;  3RRG A;  2ZH1 A;  1U49 A;  4R66 A;  2QB0 B;  4EGW A;  1R8A A;  4FBT A;  2K60 A;  5JTG A;  2EWR A;  3PNC A;  1F44 A;  2FLL A;  7ICV A;  3NYB A;  2E5S A;  4X4N A;  2LM1 A;  3AL0 B;  4PGY A;  4Y2P A;  5KL1 B;  8ICP A;  4CF4 A;  5TZV A;  2DR5 A;  4LZD A;  4P0Q A;  2WB1 C;  5DLG A;  1HJP A;  1K5O A;  4MF8 A;  2XGQ A;  3BS5 B;  2M0N A;  3E0F A;  2C22 A;  5KG4 A;  3QYP A;  5ALR A;  4N7R A;  5CB1 A;  3NVV A;  5ALS A;  1NK6 A;  4K4G A;  1TFR A;  3V72 A;  4ELT A;  4X4P A;  4DS4 A;  3OWG A;  3PY8 A;  3RH5 A;  2WHE A;  1QCK A;  3C5G A;  5AI8 A;  2W9B B;  1FO4 A;  5KFN A;  4DSF A;  5IIO A;  4ACO A;  3OUY B;  4DLG A;  4YMM A;  4LEY A;  4NM1 A;  3WK6 A;  4QZ9 A;  3AEV A;  3MCR A;  5DKW A;  2Q0Z X;  3N7S C;  1T94 A;  5KAI U;  4R8U A;  2LYH A;  4BUG A;  4GC7 A;  1VJ7 A;  5EWE A;  1N5X A;  7ICJ A;  1S10 A;  3RTV A;  3NRZ A;  4O67 A;  3BS7 A;  3OV7 A;  2WF8 A;  3SV3 A;  4RZR A;  3ED5 A;  2R8K A;  1ZQM A;  1L3U A;  2HN2 A;  2DRB A;  4QNL A;  2ZHB A;  3PML A;  9ICN A;  5CP2 A;  2R8J A;  3C2L A;  4KTQ A;  5DB7 A;  3D2S A;  2G5H B;  5KG3 A;  4DQS A;  2DRA A;  5ALZ A;  1D8B A;  2IOF A;  4NL9 A;  2P66 A;  5GTI U;  4Y2V A;  3C29 A;  1HIW A;  3JPN A;  1TE2 A;  2AQ0 A;  5D63 A;  3THV A;  1U9L A;  2EDU A;  1BPX A;  3RRH A;  2H3I A;  8ICR A;  2LYB A;  4PL2 A;  5AM1 A;  2ZUC A;  3H0L B;  1N48 A;  3UQ2 A;  5DBB A;  1PVR A;  2DVI A;  3KBB A;  3T5J A;  3AQK A;  4C4R A;  3N28 A;  4WCW A;  2ZJA A;  4JV2 A;  5KFM A;  2K8A A;  2LMR A;  4C8K A;  2DL0 A;  1V85 A;  4OAH A;  3OGU A;  4F72 A;  3FC4 A;  4F4Y A;  4P0Q B;  3WFP A;  3SEI A;  4E7X A;  3H40 A;  2EAM A;  1KFD A;  4DOC A;  1JN3 A;  4LVS A;  3ER8 C;  4QIW F;  2HHP A;  3PW0 A;  2BR0 A;  5HP4 A;  4BDP A;  4RQ2 A;  4OJL A;  1Z1V A;  1D8L A;  1BPB A;  3WKA A; 
#chains in the Genus database with same CATH homology
 4F50 A;  4QWC A;  4CCH A;  3ZDA A;  1KLN A;  4IRD A;  1ZJM A;  5KFB A;  1OU5 A;  3Q8R B;  4M9N A;  4EBK A;  3PX4 A;  4JWM A;  2W8K A;  1B43 A;  4XA5 A;  1D9F A;  1RPL A;  2JEG A;  4RQ3 A;  1K1Q A;  1T7P A;  5III A;  3AQM A;  4C8N A;  4RUA A;  5J0Q A;  4F5P A;  1U45 A;  8ICM A;  4PGQ A;  4NLK A;  4IQT A;  4NLZ A;  3KTQ A;  4KLO A;  1ZQJ A;  4LT6 A;  4FHW A;  4X4U A;  2VAN A;  2AGO A;  3IHQ B;  5L1I A;  2ZH6 A;  2ZH7 A;  9ICI A;  2ASL A;  4O3O A;  1DGS A;  3KHL A;  4DF8 A;  1LB2 B;  4LZG A;  4I2F A;  4K4H A;  1S76 D;  9ICM A;  9ICE A;  4RQ7 A;  4YXM A;  4JV0 A;  5KG1 A;  5CJ7 A;  3BQ2 A;  8ICH A;  1PX5 A;  2BCS A;  4XRH A;  4RNN A;  4UAY A;  3ISB A;  5L1K A;  4NKU A;  3GQC A;  4YN4 A;  5BPC A;  9ICH A;  4R8U B;  4AT9 A;  3LWL A;  3MGH A;  4J9L A;  1UA0 A;  4JV1 A;  3RB3 A;  1KDH A;  1ZQL A;  2ID1 A;  3MR2 A;  4F2S A;  2BE3 A;  2DR8 A;  2KTQ A;  2C2R A;  4M9G A;  2P6U A;  5DQG A;  5J0O A;  3PR4 A;  4FHP A;  4QZC A;  3UPS A;  1TK0 A;  4DS5 A;  1S9F A;  4DSK A;  2BPC A;  2PFN A;  3V7K A;  3C23 A;  4IRC A;  4R63 A;  3H8S A;  3TQ1 A;  2Y1J A;  1NKE A;  5DED A;  4YVZ A;  4DSE A;  4KLE A;  8ICQ A;  2UVW A;  4KIT B;  1QLN A;  5HHI A;  5J2J A;  1UT8 A;  4YFK A;  2M9N A;  3GIJ A;  9ICR A;  4UB3 A;  3Q8Q B;  3L9D A;  3PW5 A;  3QE9 Y;  1WCL A;  2BCQ A;  3M9O B;  3OHA A;  4M0A A;  2FPK A;  4YR0 A;  1XU4 A;  3WFS C;  1LV5 A;  4IG8 A;  2W9B A;  4M6W A;  3KHH A;  4EBE A;  1SKS A;  5IIN A;  1MQ2 A;  1ZQN A;  2BQU A;  5F9L A;  1Z00 B;  5J2B A;  3HJ4 A;  3B0X A;  4J9M A;  3OUY A;  2DR7 A;  2FLN A;  4ECV A;  5J2C A;  2XC9 A;  1DOQ A;  5F9N A;  4J9N A;  4IR9 A;  4RPX A;  3RJG A;  7ICT A;  3OJU A;  3AQL A;  8ICV A;  3LQC B;  4ECT A;  7ICU A;  1Q78 A;  3TFR A;  1ZQY A;  5IIL A;  4AT7 A;  4ED6 A;  9ICO A;  4RWQ A;  1U4B A;  5J0S A;  3HWT A;  3HIY A;  3ORY A;  4WBZ A;  4XQ7 A;  4RPY A;  4GXJ A;  4O5C A;  5DQH A;  4EZ9 A;  4WC3 A;  4ED7 A;  1QSS A;  3T5H A;  2NRX A;  5HRL A;  5KFR A;  4RNO A;  3ZDD A;  5HRI A;  4QWD A;  3PX0 A;  5CWR A;  3UXO A;  4ECU A;  1SKW A;  3ZDB A;  1TFY A;  5KFD A;  4F5R A;  4JK1 A;  4FBU A;  4DSL A;  2BHN A;  2NRZ A;  5KG5 A;  4RQ1 A;  4TQR A;  2R8G A;  1X9S A;  3RJH A;  3RJI A;  2W9C B;  1X9M A;  1KFS A;  2JZB B;  1UA1 A;  4DL3 A;  2PI5 A;  4O9M A;  2HVH A;  4TUR A;  4XUS A;  4F5O A;  5DG7 A;  3N97 B;  3H7I A;  4J9O A;  4DWI A;  3QEB Z;  9ICA A;  8ICT A;  5HRF A;  4Q8F A;  1ZQG A;  1BPE A;  4F92 B;  5J2K A;  4J9Q A;  4F4Z A;  4XQ8 A;  4KLD A;  5JUM A;  5J2F A;  3C2K A;  4ED2 A;  3Q8P B;  3M9M B;  1ZQP A;  5KFT A;  1ZQD A;  2W9A A;  4RUC A;  4F5Q A;  2HW3 A;  4X0A A;  5KFW A;  3ZD8 A;  5DB6 A;  4UBC A;  5D4B A;  4RT3 A;  2AGP A;  4O5K A;  4UD5 A;  4DLE A;  1V4A A;  4EYI B;  2V4R A;  3EW9 A;  4ZH4 A;  3GIM A;  8ICW A;  5HRE A;  4EBD A;  4NKT A;  3HJ1 A;  3PMN A;  3QEA Z;  2MUT A;  3B0Y A;  4O5E A;  9ICK A;  1DK2 A;  3PR5 B;  4QZE A;  4YD1 A;  1ZQI A;  1XSP A;  1ZQR A;  1CUK A;  5J0U A;  7ICP A;  3TAP A;  4X5V A;  4YQW A;  3TAR A;  4B9S A;  8ICX A;  3HT3 A;  1KRP A;  4UQG A;  4ED3 A;  2J6U A;  3IM1 A;  4GLX A;  1T4G A;  2HHX A;  4RQ8 A;  3NTU A;  5J0Y A;  5KG2 A;  7ICL A;  4FHY A;  4EZ6 A;  3OSN A;  4BWJ A;  5KFQ A;  1S0N A;  4NLN A;  1NJZ A;  4BWM A;  5KT2 A;  3JPQ A;  1KEJ A;  1XSL A;  1HUZ A;  2ISO A;  2IHM A;  7ICG A;  2FMP A;  2BKE A;  3RB6 A;  1L3S A;  3PO5 A;  1NJX A;  5DB9 A;  4BGD A;  4KLQ A;  4ATB B;  3RR7 A;  4DL6 A;  3C21 A;  5DG9 A;  3MR5 A;  1SZP A;  2F1H A;  4DQR A;  3RJJ A;  3V6K A;  2KZZ A;  1NZP A;  3C2M A;  4WC1 A;  3MR3 A;  5KT6 A;  9ICP A;  4P4P A;  2RDJ A;  1L5U A;  4MF2 A;  4QWB A;  4YR3 A;  2C2E A;  1ZQE A;  2M2V A;  2MAX A;  1Z3E B;  3OHB A;  3JPP A;  5HML A;  3V7L A;  2I9G A;  4EP7 A;  1MIV A;  2F1J A;  1TK5 A;  1UET A;  3PX6 A;  3JYY A;  3MAB A;  4Z6E A;  3T5L A;  2DPJ A;  4RQ4 A;  2IBK A;  4F8R A;  2HHV A;  3MFI A;  2P6R A;  4B9N A;  2FPM A;  1NK4 A;  3E2E A;  2C28 A;  1RXV A;  4TUP A;  3H8J A;  4ECX A;  2V9W A;  3GIK A;  1JXE A;  2XCA A;  2HHW A;  1BVS A;  3Q8K A;  3G6Y A;  1BNP A;  4AT9 B;  4FH5 A;  3UQ0 A;  3TI0 A;  1UT5 A;  5BOM A;  3KHG A;  2HHT A;  2A1J B;  4WC0 A;  3BQ0 A;  5KFV A;  4RWO A;  4PGX A;  5KFK A;  5CR0 A;  4YXJ A;  4F4W A;  1ZQT A;  4YMO A;  3JPR A;  2NRV A;  1NJW A;  4B9U A;  2ZJ5 A;  9ICV A;  3OVS A;  1XS9 D;  2ZH5 A;  4I2B A;  3AUO A;  4DFM A;  5F2V O;  3EWA A;  3JPO A;  4FS1 A;  4M9L A;  4YMN A;  4QZD A;  4TUS A;  3ZDE A;  8ICU A;  4I28 A;  4X4R A;  4X4V A;  1SKR A;  2HHU A;  4UB5 A;  2NRK A;  2IMW P;  3WFO A;  1ZQZ A;  1KTQ A;  5HRB A;  5KFI A;  4RWP A;  2ZTD A;  1XWL A;  1KSP A;  2J6T A;  5EWF A;  3HP6 A;  1NK5 A;  2ZH2 A;  1ZQK A;  7ICI A;  3RJF A;  3H39 A;  4QWA A;  3H8W A;  3ZDC A;  2ZTC A;  9ICC A;  4JUZ A;  4JWN A;  2C2D A;  1S0O A;  1JMS A;  2BCR A;  8ICO A;  4I2J A;  4K4I A;  5IIJ A;  2ATL A;  4ELU A;  4PHE A;  3RBE A;  3GIL A;  3JPT A;  3K4G A;  5KT7 A;  2AU0 A;  4O0I A;  2KN7 A;  4MFA A;  1ZQA A;  2PFQ A;  3TFS A;  5KTQ A;  1X2I A;  5DQI A;  3V7J A;  3UXN A;  4HYK A;  2BPG A;  5HRK A;  4Q43 A;  2RFF A;  1XSN A;  2DR9 A;  2RDI A;  1WOT A;  2ASD A;  4DEZ A;  4X4T A;  4R64 A;  3GFK B;  4J9R A;  3OJS A;  4KLF A;  4M2Y A;  3SI8 A;  3PVX A;  4PHP A;  3N4M B;  1IM4 A;  4F2R A;  8ICK A;  2R8I A;  4WC5 A;  5KT5 A;  1ZYQ A;  9ICS A;  2XO7 A;  1QSL A;  2PFP A;  4F91 B;  2UVV A;  5D46 A;  2O5A A;  4KLJ A;  4ECY A;  4QW8 A;  4KN4 A;  4R65 A;  4DFK A;  1V9P A;  1NKB A;  1BPD A;  5KFH A;  3V6J A;  3RAQ A;  4BXO B;  7ICQ A;  5KFC A;  3MR6 A;  3GV8 B;  4X4Q A;  1RZT A;  1RYS A;  4KN7 A;  1TAU A;  4ECZ A;  3QZ8 A;  3HW8 A;  1ZQH A;  4IRK A;  5J2H A;  3MBY A;  5HNK A;  4YP3 A;  4IQU A;  2AQ4 A;  1EXN A;  3GII A;  4C8O A;  5C5J A;  4EBC A;  2F1I A;  4F93 B;  2XY5 A;  5DGB A;  7ICF A;  8ICY A;  2M2W A;  3FDS A;  1ZQV A;  4FS2 A;  4NLG A;  5CHG A;  3BDP A;  2ALZ A;  4C8L A;  4I29 A;  9ICG A;  2KP7 A;  4J9K A;  2J6S A;  4X4O A;  3OVA A;  4Z6C A;  5HHH A;  2V4Q A;  4GXK A;  3UPQ A;  5IIM A;  9ICT A;  4AT8 B;  7ICE A;  1JX4 A;  4RWN A;  5KT3 A;  2R8H A;  2KZ3 A;  1Z00 A;  1TK8 A;  2KZM A;  4YG2 A;  1NO5 A;  2PXI A;  3WFR E;  2MUT B;  1K1S A;  1FA0 A;  4QWE A;  3UXP A;  4UB1 A;  1CEZ A;  3H3A A;  2UVU A;  4QZI A;  4O3Q A;  4DO9 A;  9ICU A;  4B9V A;  1COO A;  7ICM A;  3LK9 A;  4QZH A;  4ED0 A;  4UAZ A;  1ZQO A;  2IA6 A;  8ICI A;  3C18 A;  2HHS A;  3MFH A;  4DL2 A;  8ICJ A;  4DQQ A;  1N56 A;  4MEY A;  3PW2 A;  3H38 A;  4FO6 A;  1Q79 A;  3EZ5 A;  4WBY A;  2ZHA A;  5DLF A;  3G6V A;  4DF4 A;  1XC9 A;  4RU9 A;  1ZQS A;  2BCV A;  2UVR A;  2BGW A;  1JXL A;  4RQ0 A;  4I2E A;  4G3I A;  2KFZ A;  7ICN A;  5KG7 A;  1F5A A;  4F4X A;  4DQI A;  2FLP A;  4NY8 A;  2WTF A;  4RT2 A;  4FHX A;  4S3N A;  4Z6F A;  3C1Z A;  1ZQX A;  5HR9 A;  3LDA A;  2W9C A;  2JZB A;  4EBJ A;  4PPX A;  4P4M A;  5KFG A;  5KFJ A;  4EYH B;  3Q8S B;  4IQV A;  4J9S A;  2JEJ A;  2W9M A;  5J2A A;  3EYZ A;  4DL4 A;  1A77 A;  5KFP A;  3SV4 A;  3TAN A;  3JPS A;  1ZQQ A;  2IHN A;  2BDP A;  8ICN A;  1XO1 A;  2H5X A;  3K75 D;  3BQ1 A;  4RQ5 A;  3AU6 A;  5KFX A;  1C7Y A;  1MC8 A;  4TQS A;  2ASJ A;  4DOA A;  1RXW A;  3RRG A;  3H37 A;  2ZH1 A;  3AU2 A;  5EOZ A;  4PH5 A;  4DFP A;  1U49 A;  3EPI A;  3GV7 B;  4R66 A;  4E80 A;  9ICJ A;  4UBB A;  2ZUD A;  3RH4 A;  2BPF A;  5DBA A;  3M8R A;  4FBT A;  1R8A A;  3C66 A;  3M8S A;  2FMQ A;  2B21 A;  9ICX A;  1MQ3 A;  1ZQW A;  3QZ7 A;  7ICS A;  2FMS A;  3PNC A;  9ICQ A;  2FLL A;  7ICV A;  3NYB A;  2BQ3 A;  3RJK A;  2HHQ A;  5KFU A;  4X4N A;  4EEY A;  3H4B A;  4P2H A;  1YLQ A;  2PBE A;  9ICW A;  4PGY A;  8ICC A;  2W8L A;  8ICP A;  3RBD A;  5TZV A;  3ISD A;  1S0M A;  5L1J A;  4YR2 A;  1NK9 A;  2VA3 A;  9ICF A;  8ICS A;  4LZD A;  2DR5 A;  2PFO A;  1NK0 A;  4P4O A;  4ED1 A;  5DGA A;  1BGX T;  4QW9 A;  4I2H A;  4C8M A;  5DLG A;  4ECR A;  4KMU A;  1HJP A;  3OSP A;  8ICF A;  5KFS A;  8ICZ A;  4MF8 A;  5DDM A;  2XGQ A;  3PW7 A;  3PO4 A;  4QZB A;  3EPG A;  4O3R A;  5HRH A;  1SL1 A;  1R89 A;  2C22 A;  3Q8L A;  5KFO A;  4NXZ A;  3PV8 A;  5KG4 A;  4QZ8 A;  1X9W A;  4ATB A;  3ETL A;  4PHA A;  5CB1 A;  5J0P A;  5J0W A;  2AJQ A;  4UD4 A;  1ZQF A;  4WC4 A;  1NK6 A;  4M04 A;  4X4S A;  3LWM A;  5J29 A;  3GDX A;  1TFR A;  4K4G A;  4DL7 A;  2OWO A;  3WFQ E;  3V72 A;  4RNM A;  3GV5 B;  5L1L A;  4ELT A;  1BNO A;  4X4P A;  4UB4 A;  3RR8 A;  4DS4 A;  1KFT A;  3PY8 A;  3RH5 A;  4ED8 A;  4PHD A;  3C5G A;  4B9M A;  2W9B B;  4M6W B;  4ECW A;  3M9N B;  8ICA A;  1RYR A;  1KNY A;  5KFN A;  2M2T A;  4DSF A;  5IIO A;  3OUY B;  4DLG A;  1NJY A;  3NGD A;  4YMM A;  1SL0 A;  5DDY A;  4NM1 A;  2A1J A;  3MGI A;  4I27 A;  4QZ9 A;  1NKC A;  5HC9 A;  1U48 A;  4KLH A;  1TVA A;  5HRD A;  2XCP A;  4AT7 B;  5J2G A;  4DSJ A;  5DKW A;  4O3S A;  3ZD9 A;  2Q0Z X;  5J2E A;  2VA8 A;  4TUQ A;  4M47 A;  5L9X A;  5KG6 A;  2AGQ A;  5D49 A;  4R8U A;  2LYH A;  4GC7 A;  2ZH3 A;  4YCX A;  1VJ7 A;  5EWE A;  7ICJ A;  4I2D A;  1S10 A;  1H38 A;  3RTV A;  9ICL A;  1D9D A;  2O1P A;  1BPZ A;  5J0T A;  3RB4 A;  3RJE A;  1JAJ A;  3OV7 A;  4E0D A;  1PZN A;  3SV3 A;  5J2I A;  4KLS A;  4RZR A;  2Y1I A;  5KG0 A;  5KFE A;  2R8K A;  1ZQM A;  1NOM A;  2PI4 A;  2XY7 A;  1L3U A;  4WC7 A;  1L3T A;  4O3N A;  2DRB A;  1S0V A;  3OVB A;  5DBC A;  2ZUB A;  2ZHB A;  3PML A;  4KLG A;  1MSW D;  9ICN A;  5CP2 A;  2R8J A;  5KFZ A;  3C2L A;  4Z6D A;  3MDA A;  2DPI A;  2BCU A;  4KTQ A;  4NM2 A;  5DB7 A;  2JEF A;  3C5F A;  5J2D A;  4KLU A;  1MIW A;  4O3P A;  3KHR A;  4KLT A;  5KFL A;  1SL2 A;  1R8C A;  4DQP A;  5KG3 A;  4DQS A;  5J0R A;  4ECQ A;  2DRA A;  1ZJN A;  4GC6 A;  4FHV A;  3FYH A;  5J0X A;  3RB0 A;  5DB8 A;  8ICL A;  1UEU A;  3HX0 A;  3T5K A;  1T8E A;  4YD2 A;  4QZF A;  4ELV A;  1Y88 A;  5HRG A;  2JEI A;  5CA7 A;  2ZJ8 A;  5EWG A;  2P66 A;  3ISC A;  4QZA A;  2XY6 A;  2VA2 A;  1ZQC A;  1ZQU A;  5KFA A;  1QSY A;  1S77 D;  8ICB A;  4DL5 A;  1TV9 A;  5BOL A;  3JPN A;  2ISP A;  4DOB A;  4BXO A;  4KLI A;  3BJY A;  1HUO A;  8ICE A;  4UB2 A;  2M2U A;  2HVI A;  4M5D A;  2AQ0 A;  5DEC A;  1DK3 A;  1A76 A;  1TFW A;  4MEX A;  3THV A;  1U9L A;  4Q8E A;  3JZ0 A;  4B9L A;  4KLL A;  1BPX A;  3RRH A;  9ICB A;  7ICK A;  1ZET A;  8ICR A;  1UEV A;  4WC2 A;  2ZH4 A;  1S97 A;  1ARO P;  1IXR A;  4QZG A;  2ZUC A;  3Q8M A;  1N48 A;  2KFN A;  1JQR A;  4B9T A;  2ZTE A;  3UQ2 A;  4M9H A;  4I2G A;  4IR1 A;  3T3F A;  3G6X A;  1NK8 A;  2DFL A;  4E8F A;  4I2I A;  5DBB A;  3SZ2 A;  2NRW A;  4I2A A;  2DVI A;  3SYZ A;  3H4D A;  1MIY A;  5KFY A;  4AT8 A;  5KFF A;  4KLM A;  3T5J A;  3AQN A;  2ZH9 A;  5KT4 A;  3AQK A;  4UAW A;  1D8Y A;  3TAQ A;  4IQW A;  7ICH A;  4WCW A;  4I2C A;  2ZJA A;  4J9P A;  1TKD A;  7ICO A;  2FPL A;  2GWS A;  4JV2 A;  5KFM A;  3HPO A;  4RPZ A;  1NK7 A;  4WC6 A;  4C8K A;  4F3O A;  2BQR A;  8ICG A;  5HMM A;  4MFF A;  4X0B A;  3OGU A;  4GXI A;  1JIH A;  7ICR A;  4M9J A;  4F4Y A;  1T3N A;  4MFC A;  4F4K A;  2I1Q A;  3WFP A;  3BQT A;  4E7X A;  3H40 A;  4ECS A;  1QTM A;  2ZH8 A;  3RH6 A;  3PW4 A;  1B22 A;  1KFD A;  4F5N A;  3V6H A;  4DSI A;  4DOC A;  1BPY A;  1JN3 A;  4LVS A;  4DFJ A;  2HHP A;  4Q45 A;  1TAQ A;  4FH3 A;  1VFG A;  3PW0 A;  3MDC A;  1R8B A;  3C1Y A;  5DG8 A;  3RAX A;  1ZQB A;  2BR0 A;  2XGP A;  5HP4 A;  1WCN A;  4BDP A;  4RQ6 A;  4RQ2 A;  2Q66 A;  1U47 A;  2NRT A;  4Q44 A;  1L3V A;  1D8L A;  5IIK A;  1BPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...