5DBAA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a dt
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 114
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbaA03
4C8MA 3QE9Y 1KFDA 8ICLA 2F1JA 5J0OA 3UQ0A 4MFFA 5KFXA 5IIKA 5DB8A 3RH5A 4KLGA 5KG4A 4F91B 1QSYA 2AJQA 1ZQRA 5CA7A 2FPKA 3HIYA 2FPLA 4NM1A 4FHXA 3QEAZ 2KFZA 3NTUA 4ED6A 1FA0A 4EP7A 4Q8EA 4RQ4A 1KDHA 4X4RA 4TUSA 1ZQWA 4IG8A 1ZQHA 1ZQAA 5DGAA 2FMQA 1A76A 4F4XA 1S0OA 2A1JA 4JV0A 4ECYA 4DFMA 5J2CA 1ZQDA 4X4OA 4E7XA 1KTQA 1HJPA 4YD2A 3PX4A 3M9MB 3V6HA 2HW3A 4C8LA 1JIHA 1S10A 2UVVA 4RNMA 3IHQB 5J0TA 5HHHA 1X9WA 2KZ3A 3HW8A 2IHMA 3ZDCA 2P6RA 8ICRA 3RH6A 2VA3A 5J2DA 1JAJA 1TK8A 4YMMA 5DBAA 3MR6A 4I2DA 1H38A 2ASLA 5HP4A 2AGQA 1QSLA 2HHSA 1BNPA 2HHPA 4HYKA 2IHNA 3UXNA 2V4RA 4IR9A 1UT8A 2BHNA 3ETLA 2VA2A 1R8AA 3C2LA 1RXVA 2DR9A 5KFVA 3V7KA 2NRKA 3OJSA 4XA5A 4YR0A 3Q8LA 1ZQLA 4QZAA 1KLNA 4JV2A 4WC1A 2FLLA 4NLNA 3PMLA 4YN4A 3M8SA 5DDYA 1JMSA 3BQTA 5HMMA 1XC9A 4ATBB 4X4UA 8ICTA 5KFQA 1MSWD 9ICNA 4ECTA 3TFRA 5CHGA 2Q0ZX 4TUPA 4DL4A 4IR1A 3NYBA 4UB3A 3JPRA 2C2DA 2RDIA 4NXZA 1NK7A 4YCXA 1S0MA 9ICCA 5DG7A 4FHWA 4LZDA 1T3NA 4EBJA 5EWGA 3AQNA 4UQGA 3PX0A 2ZH7A 5KFIA 5KT7A 3LQCB 4I2JA 4KN4A 4QZ9A 5CWRA 2P66A 4YQWA 2KFNA 3JPNA 5KFPA 4FHPA 5DB6A 5DECA 4O3PA 2J6TA 1S77D 1U4BA 8ICVA 8ICUA 4M04A 4WC5A 1TFRA 5J0PA 4RWPA 3H4DA 3RB6A 1LV5A 4I27A 5KFHA 5KT3A 4DSJA 2ZH8A 4DFPA 1NJZA 2F1HA 3KHGA 3Q8QB 4ATBA 5IIIA 2DRBA 4ECVA 5KFRA 4RUCA 4QZDA 4GLXA 3RJHA 4YP3A 3PO4A 5F9NA 2R8JA 4BXOB 4DOAA 4O3RA 8ICJA 4BWJA 8ICGA 3C66A 1QSSA 4ZH4A 3MFIA 3T3FA 3OVSA 2DVIA 3H8JA 3H7IA 4YFKA 1X9MA 2O1PA 3HWTA 4GXKA 7ICGA 3OUYB 2FPMA 4IQTA 4IQWA 4O5KA 4MFCA 4NKUA 4X4QA 4WC7A 4FBUA 4F50A 9ICFA 5KFYA 4QZBA 3EPIA 3RJEA 5KT6A 4P4PA 1TK0A 3PW7A 2ASJA 1ZQNA 3Q8RB 4JV1A 1KNYA 2JEJA 3MGIA 2I1QA 4RZRA 1BPYA 8ICFA 2BE3A 2VANA 3H4BA 5KFOA 8ICQA 1MC8A 2HHVA 3OGUA 2R8GA 8ICOA 5J0WA 4J9NA 8ICKA 2AQ0A 1IM4A 4O5EA 4WCWA 3RJKA 2XC9A 4F5OA 3GIIA 2ZTDA 4M9NA 1BPDA 2ASDA 2ZUBA 8ICMA 9ICLA 1TFYA 3EWAA 4F93B 3TFSA 4E8FA 2ZUCA 4MF2A 7ICNA 5HRFA 3OSPA 2PI4A 9ICEA 2ISOA 4ECRA 4NLZA 4RPYA 3GIMA 4RQ7A 3OUYA 3ORYA 5KT5A 4I2AA 3T5LA 1XS9D 3ZDBA 4ED2A 2PFQA 2AU0A 3RRGA 4ED8A 3RH4A 4RQ0A 1TFWA 4QZGA 5KG7A 2C2RA 1U47A 1RYSA 2PI5A 4E0DA 4KLFA 3PVXA 5DQHA 2HHUA 3EPGA 7ICEA 4WC2A 3PNCA 4DWIA 3ISDA 3KHRA 3G6YA 4DOCA 2PBEA 3PW2A 3JPOA 5HRKA 3MR3A 5L1KA 4J9MA 4Z6DA 4UB4A 1MIWA 9ICRA 5HRHA 7ICOA 8ICPA 2ZHAA 1NJYA 3AQLA 4LT6A 5KG5A 5KFDA 4R66A 4DQRA 1NJXA 4G3IA 3RJGA 4UD5A 4MEYA 8ICHA 4BGDA 3GV5B 5DLFA 2ZTEA 4QW8A 3Q8MA 1L3UA 3NGDA 2JEGA 5KFCA 4B9TA 4ELTA 3MR5A 4PPXA 4Z6EA 4R8UA 3JPPA 4NM2A 4KLJA 4IRKA 9ICTA 3RB3A 3GFKB 4QZHA 1ZQCA 1Q79A 4M5DA 4DS5A 7ICIA 4F5PA 4KMUA 5HRDA 4RQ6A 5BOLA 4RU9A 4KLOA 7ICRA 5HRLA 4MEXA 4DF8A 2BPCA 4GC7A 4EBKA 4QWBA 3GV7B 4Q8FA 2NRXA 3HT3A 2C28A 2BQ3A 1MQ3A 2UVUA 4B9VA 3H40A 1UETA 5CP2A 4DSIA 4O5CA 5KFMA 2Y1IA 5J2GA 1D8YA 9ICPA 5KG3A 1ZJNA 4ELVA 9ICBA 3H39A 5HRIA 1VJ7A 3TAPA 4RT3A 1ZQXA 4GXIA 1Q78A 4F5QA 4S3NA 3ZDDA 3BQ2A 4J9OA 1ZQBA 2M2TA 1Z00A 3Q8SB 2XGQA 1SL0A 1R8BA 4J9RA 4RPXA 3TAQA 1TVAA 3V6KA 4I2FA 2KTQA 1XO1A 4TQRA 4M0AA 4RT2A 4PHDA 1NKBA 4XQ7A 2ZH3A 1MIYA 4X4SA 2BDPA 5J0QA 3MBYA 3TANA 1NK0A 1U45A 4M2YA 3KTQA 3PV8A 4AT9A 4X4TA 4Z6FA 5KG0A 3C2KA 2MUTB 3V7JA 2NRVA 1RXWA 4RWNA 5DEDA 3RAXA 4ECSA 4K4IA 4IRCA 3AQKA 1Y88A 2ATLA 4BDPA 3WFRE 4J9KA 3AU2A 3HPOA 2HVHA 4J9LA 4NLGA 7ICHA 5DQIA 3H37A 4EBCA 9ICGA 1RPLA 4DS4A 2HHXA 4X4NA 5J0RA 2IA6A 4FH5A 2BR0A 2W9BB 1SZPA 2BCSA 4XQ8A 4B9NA 5DLGA 5EWFA 4DFJA 1ZQTA 3SV3A 1UEVA 4QZCA 4RQ8A 4X4VA 3AQMA 1DK2A 3RBDA 2XY7A 2BCVA 2KZMA 1T7PA 1V9PA 2M2VA 4DEZA 5F9LA 4PGQA 2XY6A 1ZQPA 4R63A 4F5NA 4C8NA 4F4YA 3MDAA 5HRBA 5HRGA 1D9DA 5DQGA 3FYHA 3OSNA 1SL2A 4C8KA 4I2HA 4M9HA 1K1SA 4B9MA 3IM1A 1R89A 4RWQA 4PHEA 2ZH1A 1JXEA 4MFAA 5CR0A 5J2HA 1KSPA 5J2JA 4YD1A 3HJ4A 8ICSA 1R8CA 5KT4A 4WBYA 3GV8B 5HHIA 5D46A 3Q8KA 2RFFA 2ZH5A 4QWEA 4O9MA 5KG2A 3MFHA 1HUZA 1CEZA 4WC0A 5HC9A 5J2EA 5KFGA 4UAYA 5KFUA 3RTVA 4RQ2A 2BQUA 1T8EA 4R8UB 4RQ1A 2ZJ8A 4YR2A 1ZQEA 2F1IA 1MIVA 1ZETA 5TZVA 7ICKA 4EEYA 3Q8PB 3TI0A 7ICLA 3PW5A 1ZQQA 7ICTA 4FO6A 3H38A 3OVAA 4QZFA 4KLUA 1TAQA 3EZ5A 9ICMA 3JPTA 1T4GA 5IINA 8ICAA 9ICHA 1D9FA 9ICWA 4YXMA 4B9SA 2W9CB 4WC3A 4F2RA 4M9LA 2ZUDA 1WCNA 2JEIA 7ICUA 2VA8A 1S9FA 9ICIA 2R8IA 4EYIB 1TK5A 2M2UA 4EBEA 3M8RA 4C8OA 1ZQOA 2BCQA 4UB2A 4RQ5A 2GWSA 4RNOA 4O0IA 1N56A 2BQRA 1UT5A 2V4QA 4I2GA 4LZGA 9ICUA 3PMNA 4M6WA 7ICFA 3THVA 3OVBA 1ZQJA 5JUMA 4DF4A 2ZHBA 2NRTA 4R65A 3RBEA 4I2EA 5KFKA 4IQVA 2Q66A 1WCLA 1SKRA 4UBBA 2JZBA 1L5UA 3SYZA 4TUQA 1OU5A 3PR4A 4F4WA 4KITB 4K4HA 1YLQA 4GC6A 4IRDA 4M9GA 5L9XA 4M47A 4E80A 5J2IA 2ZH9A 4DL3A 4KN7A 5J0XA 3ZDAA 2DFLA 4I28A 5KG1A 3BDPA 4P2HA 4XUSA 1SKWA 1U9LA 2W8LA 8ICEA 4EYHB 3SZ2A 8ICNA 2BCUA 4F8RA 5KFZA 3E2EA 5BOMA 3H8WA 4K4GA 1SKSA 2W9MA 4FHYA 1DOQA 4O3NA 5CB1A 3C5GA 8ICIA 5KFNA 3LK9A 4I2BA 2ZH4A 4EZ9A 3FDSA 3LWMA 4DQQA 2ZTCA 2LYHA 3T5HA 1BPEA 1NK8A 2J6SA 2V9WA 4DQPA 3HJ1A 3OHBA 4KLMA 1VFGA 2FMSA 3C23A 5DDMA 2ZH6A 1D8LA 4QZEA 1NZPA 4F92B 5KFTA 3RJIA 3OJUA 4O3SA 2BCRA 4YG2A 3H3AA 3PR5B 2M9NA 4Q45A 3MGHA 4LVSA 4KLTA 4DL2A 3B0YA 1S0VA 1MQ2A 3GIJA 4KLIA 8ICWA 4FHVA 2I9GA 4NKTA 1PX5A 1BPZA 1QTMA 4DL7A 2UVRA 1NJWA 7ICPA 3RJJA 5DKWA 1ZYQA 2IMWP 4X0AA 5EOZA 4TURA 1DK3A 3QEBZ 3PX6A 2KP7A 2J6UA 2DRAA 4ED1A 2AQ4A 3OV7A 5KFFA 2Y1JA 3ISBA 2BKEA 5IIJA 4XRHA 3JPQA 1NK9A 3GILA 3GQCA 4KLSA 2HHTA 3ISCA 5DG9A 5DB7A 2DPJA 4NLKA 3G6VA 2NRWA 2XCAA 1V4AA 3UXOA 3RRHA 4QWAA 2UVWA 3MABA 4NY8A 4RWOA 2HHQA 4DOBA 4DSLA 8ICYA 5IIOA 3WFOA 1K1QA 3C5FA 4CCHA 4JUZA 7ICJA 4WBZA 4QWDA 3JPSA 4ED0A 1KEJA 3TARA 1ZQKA 7ICMA 5KFAA 1COOA 3SI8A 3V72A 4RQ3A 2A1JB 1KRPA 4BXOA 3ZD8A 5EWEA 4AT7A 4KLQA 5L1JA 1JQRA 4BWMA 4B9UA 5J29A 1ZQFA 2ZJAA 1EXNA 3MR2A 4JWMA 7ICQA 4PHPA 2DR5A 1XU4A 1NK5A 3RR7A 4JK1A 2BPGA 2WTFA 3UPQA 2JZBB 1DGSA 4DL5A 1C7YA 3RR8A 2O5AA 3C18A 4ECQA 4B9LA 3C1ZA 3PO5A 4YVZA 3V6JA 3RB4A 5J0SA 1XSLA 1QLNA 2ZJ5A 5J2AA 1B43A 5D49A 3T5JA 3N4MB 8ICCA 2OWOA 3RB0A 1LB2B 1NO5A 2DR7A 4UAWA 5HNKA 4EBDA 2ALZA 4WC6A 5KG6A 3C2MA 1ZQZA 4O3QA 1BGXT 1NKEA 1L3TA 8ICZA 4KLHA 1U48A 3WFPA 4YMOA 5DBCA 2W9AA 4R64A 1ZQMA 4RPZA 7ICSA 5CJ7A 2C2EA 3PY8A 1ZQUA 1NOMA 5KFBA 3N97B 3OHAA 1XSPA 2M2WA 4YMNA 4AT7B 1N48A 3RJFA 1TAUA 3ZDEA 4Q44A 3GDXA 3KHHA 3LDAA 3BQ0A 3TQ1A 5DG8A 1NKCA 4ECWA 4DSEA 1BVSA 2PXIA 5DB9A 3M9OB 4RUAA 2C22A 1S0NA 3UQ2A 5F2VO 4X0BA 2AGPA 1JXLA 4DLEA 2ID1A 2BPFA 5KTQA 3LWLA 3K75D 1UEUA 2MUTA 5KFEA 2RDJA 1TKDA 1U49A 4GXJA 4UD4A 2AGOA 4AT8B 1BPXA 4FBTA 1TV9A 2R8HA 2W9CA 3M9NB 5D4BA 1UA1A 1ZQGA 1NK6A 5J0UA 3UXPA 3JYYA 3UPSA 3RAQA 2PFNA 2PFPA 4F4KA 4UBCA 9ICJA 2XO7A 2KZZA 4ECUA 4F2SA 2BGWA 1BNOA 1JN3A 2XY5A 1RYRA 1PZNA 4PGXA 1ZJMA 4M6WB 2FLPA 4J9QA 1HUOA 4F5RA 2ZH2A 4ECZA 2KN7A 4QZIA 2IBKA 3ZD9A 5DGBA 1XWLA 2XCPA 3PW4A 3KHLA 4DFKA 3EW9A 4KLLA 5HMLA 2DPIA 4FS2A 4P4MA 3EYZA 1AROP 3K4GA 4ECXA 5IIMA 3L9DA 1XSNA 4PH5A 1ZQIA 4M9JA 4AT8A 1RZTA 5J0YA 4UB5A 4F4ZA 4DLGA 3HX0A 2HVIA 9ICOA 2H5XA 4DQSA 2JEFA 9ICSA 4PHAA 5L1LA 4X4PA 4X5VA 5L1IA 4Q43A 1L3VA 4KLDA 4J9SA 8ICXA 4IQUA 4DQIA 4UAZA 1S97A 3QZ7A 1JX4A 4DSFA 4I29A 3BQ1A 4MF8A 4QZ8A 1B22A 3QZ8A 3BJYA 1X9SA 1Z00B 4ELUA 8ICBA 9ICAA 3GIKA 2HHWA 7ICVA 3G6XA 4KTQA 9ICXA 1SL1A 3WFQE 2ISPA 5DBBA 3PW0A 2B21A 4PGYA 9ICKA 3H8SA 5C5JA 4DSKA 5IILA 1CUKA 2DR8A 1ZQVA 3JZ0A 4JWNA 4AT9B 3C1YA 2MAXA 1X2IA 1F5AA 3AUOA 1WOTA 1ZQYA 5J2KA 2W8KA 4J9PA 4FH3A 5BPCA 3B0XA 1S76D 5HR9A 4ED7A 2PFOA 2R8KA 3V7LA 4DO9A 9ICVA 5KT2A 2NRZA 2XGPA 1UA0A 5HREA 4I2CA 5J2BA 5KFSA 4Z6CA 5J2FA 4UB1A 3SV4A 1NK4A 1KFTA 1KFSA 4EZ6A 4YR3A 4I2IA 4P4OA 5KFLA 4RNNA 3MDCA 5KFWA 4FS1A 4O3OA 4QWCA 2FMPA 4F3OA 4KLEA 3HP6A 4WC4A 3WFSC 4QW9A 2W9BA 3C21A 9ICQA 4TQSA 1Z3EB 1A77A 2P6UA 3AU6A 1BPBA 5KFJA 1IXRA 4YXJA 4ED3A 3T5KA 1L3SA 1ZQSA 2FLNA 4DL6A
chains in the Genus database with same CATH superfamily
4MFFA 5DB8A 3F2DA 1ZQRA 5CA7A 3HIYA 3H0RB 3WKDA 4X4RA 4TUSA 1ZQWA 4F4XA 2B0CA 4JV0A 3ONNA 5J2CA 1ZQDA 4X4OA 4E7XA 1HJPA 3M9MB 1S10A 4RNMA 4K9AA 3HW8A 3NRWA 4OO1J 5DBAA 5KL8B 1H38A 1BNPA 2AGQA 2HHPA 3UXNA 2P35A 3C2LA 3SQIA 2DR9A 1UPHA 3HRDD 3V7KA 3OJSA 1ZQLA 2W54A 3M8SA 4ATBB 5HMMA 4CF3A 8ICTA 1X42A 4ECTA 3TFRA 4IR1A 2RDIA 3NWIA 2DL0A 4MHVA 5EWGA 5ALPA 2RLTA 2P66A 4YQWA 5KFPA 1S77D 1U4BA 1ZD3A 3NKUA 4WC5A 3IN5A 1LV5A 4I27A 4DSJA 4OAIZ 4DFPA 1NJZA 3Q8QB 4O3RA 3CRXA 3C66A 3T3FA 3OVSA 1X9MA 2O1PA 4IQTA 4X4QA 4WC7A 3Q8RB 3AQEA 3WKCA 5JTGA 5KFOA 1MC8A 2HHVA 8ICKA 3CP8A 2YMLA 9ICLA 2ZUBA 4F93B 1RDFA 4Y2SA 2PI4A 2JRZA 3D2NA 2ISOA 4NLZA 4RPYA 2NO4A 4RQ7A 1XS9D 2ZIXB 3AM9A 1J2MA 2C2RA 5DQHA 7ICEA 3EPGA 3PNCA 1T94A 2PBEA 3BS5B 3OWGA 4J9MA 1QQ5A 5ALOA 4DFDA 2ZHAA 1A6SA 5KFDA 4R66A 4USAA 2ZIUB 2EANA 1V38A 4Z6EA 4R8UA 4KLJA 1URJA 1ZQCA 4RU9A 4EBKA 4QWBA 2I5HA 2XVTA 4B9VA 3WK4A 4DSIA 4O5CA 2WHEA 1D8BA 3KZXA 2ZIWB 9ICBA 1ZOLA 1VJ7A 3PHZA 1ZQXA 4GXIA 4S3NA 3HILA 1ZQBA 2M2TA 1Z00A 1SL0A 3M6ZA 4RPXA 1TVAA 4M0AA 3NS1A 2NYVA 3TANA 2HOIA 3PV8A 3NVWA 4Z6FA 5KG0A 2W3SA 3V7JA 5DEDA 4K4IA 3AQKA 4Y2UA 4IRCA 1ZD4A 4J9LA 2OCEA 4NLGA 2F3NA 3ER8C 2VJ5A 1SZPA 2BCSA 2G09A 4DFJA 1ZQTA 4QZCA 1DK2A 2XY7A 4PGQA 2F8KA 2XY6A 3SD7A 4F4YA 2KICA 1D9DA 3WKAA 4CDGA 3OSNA 2ZH1A 1KQQA 4KM5A 1JXEA 4MFAA 2K4IA 8ICSA 3E0FA 5D46A 2ZH5A 5KG2A 1OUQA 4WC0A 5AKHA 5CHEA 5HC9A 5J2EA 4UAYA 3RTVA 4R8UB 1KN5A 4KB6A 7ICKA 1MN8A 3TI0A 7ICLA 3H38A 3EZ5A 9ICHA 5IINA 1D9FA 9ICWA 4YXMA 1DRGA 4FZNA 2YX8A 4EBEA 4C8OA 1PVRA 4RQ5A 4RNOA 5AIBA 5ALLA 2V4QA 4I2GA 4LZGA 3PMNA 1NI3A 2VJ4A 7ICFA 3THVA 3OVBA 1ZQJA 2E5SA 3ALRA 5JUMA 3RBEA 5KFKA 1WCLA 2JZBA 1L5UA 3F2BA 4TUQA 3PR4A 4F4WA 4XJEA 5J2IA 4DL3A 1V97A 4KN7A 4Y2QA 5J0XA 3ZDAA 4I28A 5C0YA 3BDPA 5ALHA 4PL1A 1SKWA 2E3TA 5ALYA 2BCUA 2OM6A 5KFZA 5B3QA 5BOMA 1DOQA 3C5GA 2WAQC 2EAOA 5B66U 3IDWA 4NXXA 3BS7A 1N5WA 4EZ9A 3FDSA 1NK8A 2ZH4A 3HJ1A 4F92B 3WU2U 3RJIA 1AQ6A 2BCRA 3H3AA 3PR5B 4UW9A 3UM9A 5ALVA 4DL2A 3B0YA 1S0VA 1MQ2A 4KLIA 2HN2A 1QTMA 5AK4A 1NJWA 5DKWA 1ZYQA 1S5LU 4NV0A 3NVZA 2DGZA 4EEDA 5EOZA 1DK3A 2K4HA 2DRAA 2AQ4A 1JRPA 3WK6A 1NK9A 4NLKA 3G6VA 2DWQA 2R18A 4EELA 4RWOA 4NY8A 2IOFA 8ICYA 4K99A 3WFOA 3C5FA 4CCHA 2G5IB 3C28A 1QQ6A 4ED0A 1ZQKA 5KFAA 3SI8A 2A1JB 5EWEA 5L1JA 4BWMA 3L3FX 4B9UA 1EXNA 5ALDA 4PHPA 1NK5A 2FCLA 4JK1A 4P0PA 2JZBB 1DGSA 3ETRA 1LKYB 3RR8A 2LM4A 2B6GA 3RB4A 5J0SA 8ICCA 2DR7A 1RYUA 2OWOA 3RB0A 4EBDA 2L5YA 5KG6A 2OXOA 4YMOA 2W9AA 4R64A 4RPZA 1ZQUA 3KOOA 1NOMA 2B51A 2KMDA 2O6KA 2M2WA 1DGJA 1TAUA 1X9XA 3TQ1A 5DG8A 4GIBA 2C22A 4UAVA 1JXLA 5KTQA 4OAGA 2MUTA 5KFEA 3K7DA 3FC4A 4AT8B 1BPXA 1TV9A 1ZQGA 5D4BA 5J0UA 3UXPA 2PFNA 4HX0A 4ECUA 1TE2A 3CYMA 2YMQA 1RYRA 1PZNA 4PGXA 4M6WB 3I1YA 5AKEA 4ZOHC 4J9QA 1HUOA 2EZZA 1RM6C 4F5RA 5JTIA 2FDRA 2ZH2A 3ZD9A 2XCPA 4EX6A 5ALTA 2BBJA 4OJLA 3L9DA 4PH5A 3TKAA 4UB5A 3HX0A 2HVIA 3S6JA 9ICSA 4X4PA 5L1IA 4Q43A 1L3VA 4C4TA 3SEIA 2LHTA 3JCFA 2KD1A 3QZ7A 3BQ1A 3BQ7A 4NWIA 4ELUA 1B22A 1Z00B 5AKIA 4CF5A 4ICAA 9ICAA 2HHWA 3NRZA 7ICVA 3WFPA 3UMCA 1SL1A 5DBBA 4PGYA 3H8SA 1CUKA 4U6PA 4JWNA 3QUCA 3F2CA 1X2IA 1WOTA 2W8KA 3HKZF 5BPCA 3B0XA 4O3MA 1S76D 2YMMA 5HR9A 2GA9D 5KT2A 2VKQA 3QU5A 1N61A 5ALMA 4EZ6A 3ER9B 5KFLA 2W7PA 4O3OA 3WFSC 2H3ZA 4QW9A 9ICQA 5KAFU 2EDUA 1BPBA 1IXRA 4YXJA 4DL6A 3UQ0A 5IIKA 3RH5A 5KG4A 2AJQA 4O69A 4ED6A 1FA0A 1KDHA 4B6JA 2KEYA 3L4PA 1A76A 2D6FC 4LJXA 1N62A 1KTQA 4U7CA 2LYBA 2RP5A 5J0TA 5HHHA 3ZDCA 2K89A 2YN4A 3RH6A 2VA3A 1JAJA 4YMMA 1QSLA 2HHSA 1RQNA 2V4RA 4IR9A 1UT8A 1Z1BA 1Q3VA 3QU4A 5KFVA 2QLTA 2XI9A 4XA5A 4YR0A 3Q8LA 4NLNA 4YN4A 5DDYA 1JMSA 4X4UA 2HI0A 1MSWD 2HBJA 5AKXA 3QXGA 4DL4A 3CK6A 2OYYA 2C2DA 9ICCA 4YCXA 4FHWA 5DG7A 2KOBA 4EBJA 4UQGA 1UQVA 5KT7A 4FHPA 4QZ9A 2WF8A 4F72A 3JPNA 5DECA 2J6TA 2QARB 8ICUA 2CRXA 3H4DA 5KFHA 2KIWA 2DRBA 2F1HA 2JHDA 3KHGA 4ECVA 4RUCA 3PO4A 4GLXA 5F9NA 3PSPA 4P0QB 4ZH4A 2HN1A 3H7IA 3AMZA 4GXKA 5AM2A 2FPMA 5G5GA 4O5KA 4Y2PA 2E8NA 3ZDDA 3EPIA 3RJEA 1QQ7A 5KT6A 1TK0A 2A1AA 3PW7A 5B3PA 4RZRA 2BE3A 3H4BA 8ICQA 1SV4A 2DBYA 2R8GA 1VDVA 4F5OA 3GIIA 4M9NA 5AICA 1TFYA 1L7PA 2ZIUA 4MF2A 1Z4NA 3OSPA 9ICEA 5HRFA 3GIMA 3ORYA 5KT5A 2YB4A 4I2AA 4ED2A 2PFQA 2F8LA 3RH4A 3D6JA 4QZGA 1U47A 3KHRA 2W04A 3G6YA 4DOCA 3JPOA 3J81j 5HRHA 7ICOA 5KG5A 4DQRA 4G3IA 4UD5A 4MEYA 4BGDA 1GO3F 5DLFA 8ICJA 3Q8MA 4B9TA 4Y2TA 4NM2A 1X40A 3GFKB 4M5DA 1LKYA 5HRDA 4RQ6A 3KBBA 5HRLA 4Q8FA 2UVUA 1OW5A 1YT3A 1D8YA 3H39A 4N7RA 3H0MB 1L7NA 3BZKA 2H3VA 5B5EU 1Q78A 3Q8SB 4J9RA 3TAQA 3V6KA 2KTQA 1XO1A 4RT2A 1LVHA 4C80A 1PK1B 3R9KA 2JR5A 2AHOB 4X4SA 4NL9C 1N63A 3KZIU 3MBYA 1NK0A 1U45A 1O03A 2MUTB 1RXWA 4RWNA 3RAXA 4WJ3B 4AYBC 3B9JA 4ECSA 1Y88A 2WF7A 1WG8A 3WK5A 2YB1A 5AI8A 7ICHA 5DQIA 1NNLA 3H37A 9ICGA 4DS4A 4X4NA 4FH5A 3FAHA 2BR0A 2KG5A 4XQ8A 4Y2JA 4MKPA 5DLGA 1ZD5A 1KKXA 1UEVA 4X4VA 5KNIA 1T7PA 2MA1A 1ZQPA 4F5NA 4C8NA 2HSZA 4F71A 2H3QA 2KHQA 1SL2A 3FYHA 3PSFA 4M9HA 4RWQA 5CR0A 4OJOA 5J2JA 5ALNA 5HHIA 2EH9A 5ALQA 4QWEA 1CEZA 5KFUA 1T8EA 4RQ1A 4YR2A 3QUQA 1MIVA 1ZETA 3OPXA 5TZVA 1F44A 3PW5A 4FO6A 4QZFA 1TAQA 2RQ5A 3JPTA 1T4GA 8ICAA 1X6JA 5GTIU 2W9CB 4WC3A 4F2RA 1WCNA 9ICIA 2VA8A 2M2UA 3LVWA 2R8IA 4EYIB 3WK8A 1TK5A 4PJ0U 5AM4A 2GWSA 2BQRA 1UT5A 1SV0C 2NRTA 4KX5A 1B0XA 2LMRA 3SYZA 4C0ZA 2LKYA 2MSNA 4RQMA 4KITB 1FO4A 4JMUA 2BDUA 2YQEA 3QYPA 2W8LA 4EYHB 5E79U 3SZ2A 3F5EA 4F8RA 2HBLA 1SKSA 2W9MA 2DKXA 4O3NA 5CB1A 4I2BA 3LWMA 2ZTCA 2LYHA 3T5HA 4DQPA 2V9WA 2W3RA 5AI6A 1A0PA 1D8LA 1NZPA 4QZEA 4WH5A 3OJUA 4O3SA 4YG2A 1K5OA 4Q45A 1CI4A 4KLTA 5ALSA 2BZFA 4NKTA 4DL7A 3E58A 3RJJA 7ICPA 3KKAC 1SV0A 1F5SA 2EAPA 4Y2YA 2W55A 4EEBA 1YZ6A 2J6UA 4ED1A 4P0PB 5KFFA 5IIJA 4XRHA 3JPQA 5ALUA 4KLSA 5DB7A 2DPJA 2NRWA 5H2FU 2I6XA 1CRXA 4DOBA 4DSLA 4A8EA 2QARA 5IIOA 2HDOA 4WBZA 4JUZA 4QWDA 1KEJA 2IOFK 1COOA 3V72A 4RQ3A 2JH1A 3AN1A 1KRPA 5AIAA 4KLQA 1JQRA 4LEYA 5GTHU 2LBOA 2ZJAA 4UB6U 3RR7A 2BPGA 4K98A 3D2SA 3C18A 5AHXA 4B9LA 3C1ZA 3V6JA 4JB3A 1QLNA 2E1FA 5D49A 2Q4TA 4OJ6A 3IRUA 5HNKA 4WC6A 4FZLA 3C2MA 1ZQZA 1BGXT 8ICZA 2RHFA 1U48A 2LI6A 5CJ7A 3PY8A 4C7YA 2NO5A 3N97B 4AT7B 4YMNA 3RJFA 3ZDEA 4Q44A 2LYAA 3GDXA 3LDAA 3BQ0A 2K4EA 1NKCA 4ECWA 1BVSA 5F2VO 2ID1A 3K75D 3BZCA 2R8HA 3JYYA 3UMGA 3RAQA 4F4KA 4UBCA 9ICJA 1T3QA 4F2SA 3ICXA 4OJ5A 2FLPA 2KKPA 4QZIA 2IBKA 3PW4A 3KHLA 3EW9A 3NVOA 1AROP 5CEHA 3WKBA 5IIMA 1XSNA 4M9JA 5J0YA 4F4ZA 3VCBA 2JEFA 2PKEA 1TAMA 4X5VA 4IQUA 3SAFA 4DSFA 1X9SA 8ICBA 3GIKA 3G6XA 1L6NA 1MA7A 3PW0A 2ZIVB 9ICKA 2DR8A 1ZQVA 3JZ0A 1SXEA 1ZQYA 5J2KA 4KX3A 2EZXA 4FH3A 5HR7A 4ED7A 2B56A 5EE0A 4DO9A 4I0UA 1QCKA 9ICVA 1ZRNA 2XGPA 2KIVA 1KFSA 4CGZA 4YR3A 3MDCA 4FE3A 4FS1A 4K9BA 4F3OA 4KLEA 3A0BU 3IG8A 1Z3EB 4TQSA 3AU6A 5KFJA 4ED3A 3T5KA 1L3SA 4C8MA 1KFDA 8ICLA 2F1JA 4KLGA 5KFXA 1QSYA 2FPKA 4FHXA 3QEAZ 1M6YA 2QKQA 4NL9A 4EP7A 1KW4A 2KVCA 4RQ4A 3NVYA 4IL6U 4IG8A 1ZQAA 1KBUA 1FIQA 2FMQA 1S0OA 2A1JA 2VIXA 4J03A 4YD2A 3PX4A 1X6IA 3V6HA 1SGGA 1ZQ1C 5D61A 4C8LA 1JIHA 2UVVA 3IHQB 4IC9A 2P6RA 1X9WA 2KZ3A 8ICRA 1TK8A 3MR6A 4X4TA 5ALEA 4HYKA 4JLZA 3ETLA 2K4PA 2A19A 5CRXA 1KLNA 1ZD2P 4Q8EA 3PMLA 2AXTU 2JEIA 3BQTA 1PVPA 5KFQA 9ICNA 2WB1C 5CHGA 4P0QA 2KNJA 3WKEA 2W43A 1JUDA 3NYBA 3QUBA 3DEEA 4NXZA 1NK7A 3EUB2 3AQNA 5ALZA 3PX0A 2Y9UA 5KFIA 2PMZC 1SZHA 4I2JA 4KN4A 5CWRA 1HIWA 1KL9A 4O3PA 3H0LB 8ICVA 4M04A 1FFUA 5J0PA 5L1MA 3RB6A 4RWPA 2ZH8A 5KT3A 4QZDA 3RJHA 5J8YA 2R8JA 4BXOB 1FFVA 4DOAA 4BWJA 3MFIA 3H8JA 3K1ZA 7ICGA 1RQLA 4MFCA 2OEHA 9ICFA 4P4PA 1ZQNA 4JV1A 1KNYA 2JEJA 3MGIA 2I1QA 8ICFA 2AH5A 1BPYA 2H3IA 1Z4OA 3OGUA 5J0WA 3M6KA 2AQ0A 1IM4A 3RJKA 1BPDA 1SIJA 2ZUCA 4Y2RA 3OUYA 3T5LA 3ZDBA 3RRGA 5ALKA 4K8VA 3KD3A 2PI5A 4KLFA 1RYSA 4QJFB 4E0DA 4DWIA 3ISDA 5HRKA 5AKGA 5L1KA 4Z6DA 4UB4A 1MIWA 9ICRA 2PMZF 3ED5A 8ICPA 1ZXIA 3F5AA 3AQLA 1IIPA 4LT6A 3RJGA 5AK5A 4LEVA 2ZTEA 4QW8A 5AKYA 3NGDA 5KFCA 4ELTA 2DQNB 5HRIA 3L5KA 2WAQF 4IRKA 3RB3A 1Q79A 4UASA 4DS5A 1SWVA 5EE3A 4KLOA 4GC7A 3GV7B 2NRXA 3HT3A 2BQ3A 3AEVA 3MC1A 5CP2A 1Z1VA 2GO7A 5KFMA 2Y1IA 5J2GA 2KKVA 5KG3A 1ZJNA 2BBHA 3QUTA 4RT3A 2KHVA 3QU7A 2GOLA 5T14A 3BQ2A 2XGQA 4QIWF 2QB0A 4TQRA 4PHDA 1NKBA 4XQ7A 2ZH3A 1MIYA 4NXVA 4AT9A 5CFSA 3C2KA 3QX7A 4BDPA 4J9KA 3AU2A 4FZMA 1NZBA 4EBCA 4WQLA 5AK3A 5J0RA 4QNLA 2H3FA 3LYSA 3SV3A 1UCVA 3AQMA 2BCVA 2KZMA 2D8CA 2M2VA 1V9PA 2N1RA 5F9LA 2HBMA 3M7DA 3UMBA 3MDAA 5HRBA 5DQGA 1R89A 3KKAA 4C8KA 4US8A 4I2HA 1K1SA 4B9MA 3IM1A 1KSPA 4YD1A 3VC8A 1WYGA 5KT4A 4WBYA 3Q8KA 2RFFA 4KMOB 1XNSA 4O9MA 3MFHA 1HUZA 1IG6A 4RQ2A 2F1IA 2ESEA 3N28A 4EEYA 3Q8PB 4BX9C 1ZQQA 7ICTA 9ICMA 1RG6A 5ALXA 4M9LA 2ZUDA 7ICUA 1S9FA 5EE9A 1ZQOA 4UB2A 4O0IA 1L7OA 3CNHA 4DF4A 4R65A 2QB0B 2Q66A 4QIWC 1Q46A 1SKRA 4PZOA 1DXSA 1WUDA 1OU5A 4K4HA 1YLQA 4GC6A 4IRDA 4M9GA 3N7PD 3TACB 4M47A 2ZH9A 4BJQA 4P2HA 4XUSA 3SAGA 8ICNA 2W03A 8ICIA 3LK9A 4DQQA 2J6SA 1BPEA 4KLMA 2FMSA 5DDMA 2MRLA 5AK6A 2M9NA 3MGHA 4LVSA 8ICWA 3H8MA 4FHVA 1COKA 4IS7A 2KVSA 1PX5A 2UVRA 4K96A 5CFTA 1PVQA 2QB1A 3QEBZ 4NLBA 2LPEA 4C7ZA 1PK1A 2BKEA 1JALA 3O0FA 3GQCA 4NJ8A 3ISCA 3I28A 3RRHA 2UVWA 2XIDA 2HHQA 2KJ8A 4G9BA 1K1QA 7ICMA 5ALJA 5JU5A 4BXOA 4AT7A 5EE1A 7ICQA 2ZXIA 2DR5A 1XU4A 3OTQA 1C7YA 1SXDA 4DL5A 2O5AA 4UAUA 4ECQA 4O67A 3PO5A 2ZJ5A 1B43A 1J97A 4Y2XA 1LB2B 3M1YA 1OXJA 2KK0A 2Y0SC 2F44A 4KLHA 1ZQMA 7ICSA 2C2EA 5KFBA 3A0HU 3OHAA 1XSPA 1N48A 2WFAA 4ACOA 3KHHA 5AKZA 4DSEA 5DB9A 4EEKA 4RUAA 4RQNA 2WB1F 1S0NA 2BPFA 1UEUA 4FFDA 1TKDA 2KV2A 4UD4A 2HCFA 2W9CA 4NXUA 3NVVA 2JH7A 5AM5A 1Q8KA 1WWVA 1J2NA 3IP4B 1BNOA 2BGWA 2XY5A 4NXTA 4OAHA 2F76X 5CFUA 4ECZA 2KN7A 1SB3C 2YY6A 3T79A 2ZIVA 1XWLA 1C20A 4FO1A 1ZRMA 4DFKA 4PZNA 4KLLA 2DPIA 2GH1A 4FS2A 1Q3UA 4P4MA 3EYZA 3K4GA 2WF6A 4ECXA 2E8MA 2ZXHA 5FP0A 2H5XA 4DQSA 2A3VA 1F0MA 4KLDA 4J9SA 8ICXA 4CE6A 1JX4A 4QZ8A 3BJYA 2ISPA 3SR6A 2ZIXA 5C5JA 4DSKA 5KAIU 4AT9B 2MAXA 2K8AA 2ES6A 1F5AA 4J9PA 4HAIA 2G0AA 2IHOA 3N7RC 2NRZA 1UA0A 5HREA 4I2CA 5J2BA 4UB1A 1NK4A 4P4OA 3DDHA 2FMPA 2K8BB 3C21A 2P6UA 5AI0A 1ZQSA 3U26A 3CW2C 2FLNA 3QE9Y 5AI5A 1L7MA 5J0OA 3LVVA 4F91B 2IOHA 3MGVA 2FPLA 4NM1A 2E8OA 4AYBF 2KFZA 3NTUA 2FI1A 1ZQHA 2EWRA 5DGAA 2FE9A 4EV6A 4ECYA 4DFMA 1UHUA 2HW3A 3I76A 3PSTA 2IHMA 5F3XB 5J2DA 2Y9TA 4I2DA 2ASLA 5HP4A 1IV8A 1PK3A 2IHNA 3QNMA 2BHNA 2VA2A 1R8AA 1RXVA 2NRKA 2K8CB 4QZAA 3AL0B 4JV2A 4WQKA 4WC1A 2FLLA 2D3DA 1XC9A 3PZPA 2Q0ZX 4TUPA 4UB3A 3JPRA 2JXJA 3MCRA 1S0MA 2NV3A 3SAHA 4LZDA 1T3NA 5AM1A 2ZH7A 3LQCB 2KFNA 5DB6A 1TFRA 4ATBA 5IIIA 5KFRA 4YP3A 4OAFA 2JMGA 8ICGA 1QSSA 2DVIA 4YFKA 3HWTA 3OUYB 4IQWA 4NKUA 4FBUA 4F50A 5KFYA 4QZBA 4BUGA 2ASJA 4CRXA 2VANA 1VLBA 4LEWA 8ICOA 4EX7A 4J9NA 3TADC 4O5EA 2EAMA 1N5XA 4WCWA 2XC9A 2ZTDA 2ASDA 4CNQA 8ICMA 3EWAA 4E8FA 3TFSA 2G07A 7ICNA 4ECRA 3HJEA 2AU0A 4ED8A 3EF2A 4RQ0A 5HR6A 1TFWA 5KG7A 3PVXA 2HHUA 4WC2A 4UATA 3PW2A 2KJ9A 5AM0A 2DKZA 3MR3A 1SWWA 1NJYA 2KSOA 1NJXA 2IUBA 8ICHA 2OHFA 3GV5B 1N60A 1L3UA 2JEGA 4PPXA 3MR5A 9ICTA 4UARA 3JPPA 3OVAA 4QZHA 7ICIA 4F5PA 4KMUA 5BOLA 5D62A 5G5HA 3SMVA 7ICRA 4MEXA 4DF8A 2BPCA 1MQ3A 2C28A 1UETA 3H40A 4GFJA 1N2XA 9ICPA 3NASA 5TISU 4ELVA 3DV9A 4UB8U 5JRTA 2W7OA 3TAPA 2G06A 4F5QA 4K97A 4J9OA 3ERCC 1R8BA 4X0AA 4I2FA 4Y2VA 3QU2A 2BDPA 5J0QA 4M2YA 2YMPA 3KTQA 2NRVA 2B4VA 2M0NA 2ZIWA 2ATLA 3C29A 3WFRE 3HPOA 2HVHA 1O08A 1RPLA 2HHXA 2IA6A 3IV6A 2W9BB 4B9NA 1B4FA 5EWFA 4RQ8A 3RBDA 4DEZA 2E8PA 4R63A 3N7SC 2F77X 4O68A 5HRGA 4C4RA 2WF9A 4NXWA 4PHEA 5ALGA 5J2HA 3HJ4A 1R8CA 1P7DA 2KSOB 3GV8B 3IG5A 4LEZA 5KFGA 2BQUA 3TADA 5ALRA 2ZJ8A 1ZQEA 3GU3A 2RRDA 4KLUA 2F2AB 2EQYA 4B9SA 1L8OA 1WWUA 5AM3A 3M8RA 2BCQA 2HOQA 1N56A 9ICUA 1L8LA 4M6WA 2K60A 2DUYA 1ECWA 2ZHBA 4I2EA 2MU2A 4IQVA 4UBBA 1QH9A 4C4SA 5KL1B 2Z7JA 5L9XA 2CXYA 5AI4A 4E80A 2DFLA 2HOFA 5KG1A 4CF4A 2HMXA 3F53A 1U9LA 8ICEA 3SENA 3E2EA 3H8WA 4K4GA 4FHYA 4OCZA 4PL2A 5KFNA 3K1RB 3AQFA 3OHBA 3PSIA 3C23A 2ZH6A 5KFTA 3FM9A 2W11A 4EGWA 2Y0SF 3GIJA 2YTUA 3RF9A 2I9GA 1BPZA 3WK9A 5AKLA 2IMWP 4TURA 2ZG6A 2KP7A 2LM1A 1JI7A 3PX6A 2OH2A 3OV7A 2Y1JA 3ISBA 5A0LA 1V85A 4AP9A 3GILA 2HHTA 2DF4B 5DG9A 1HEKA 2XCAA 1ED1A 1V4AA 3UXOA 4QWAA 3MABA 3BS5A 1YZ7A 7ICJA 3TARA 3JPSA 1FEZA 2EZYA 3ZD8A 4O6AA 2GAFD 2CPRA 5J29A 2HBKA 1ZQFA 3MR2A 4JWMA 1S8OA 5AKKA 3UPQA 2WTFA 2E1EA 4YVZA 5AKJA 1XSLA 5J2AA 3N4MB 1NO5A 3T5JA 4UAWA 2ALZA 1NKEA 4O3QA 1L3TA 3WK7A 5DBCA 3D2QA 4US9A 1JROA 3RFAA 3KFUF 2JV3A 2PXIA 5K4LA 3M9OB 3UQ2A 4X0BA 2AGPA 2G08A 4DLEA 3LWLA 2RDJA 1U49A 4GXJA 2AGOA 4FBTA 1PUZA 1GPJA 4WOYA 3M9NB 1UA1A 4OD0A 4NLCA 1NK6A 2G5HB 3UPSA 2PFPA 3ZI4A 2CN1A 2XO7A 2KZZA 1JN3A 1ZJMA 3QU9A 5DGBA 1VJ5A 2KJ5A 5HMLA 2XICA 2JGAA 1ZQIA 4AT8A 1RZTA 4DLGA 9ICOA 4PHAA 5L1LA 2KE7A 5AI9A 4DQIA 4UAZA 2FJ6A 1S97A 4I29A 4MF8A 3QZ8A 5ALWA 4JLXA 4EENA 5D63A 4KTQA 9ICXA 3WFQE 2B21A 5ALFA 5IILA 1Z19A 4OJPA 3C1YA 5ALIA 3AUOA 1VFGA 2PFOA 2R8KA 3V7LA 5J8YC 3HKZC 3SV4A 5KFSA 4Z6CA 5J2FA 1KFTA 3GZFA 4I2IA 4RNNA 4WC4A 2ODGA 3NUQA 4DCCA 5KFWA 4QWCA 1X66A 3HP6A 2W9BA 2WF5A 1A77A 2GLEA 1XO0A
chains in the Genus database with same CATH topology
4C8MA 3QE9Y 1KFDA 8ICLA 2F1JA 5J0OA 3UQ0A 4MFFA 5KFXA 5IIKA 5DB8A 3RH5A 4KLGA 5KG4A 4F91B 1QSYA 2AJQA 1ZQRA 5CA7A 2FPKA 3HIYA 2FPLA 4NM1A 4FHXA 3QEAZ 2KFZA 3NTUA 4ED6A 1FA0A 4EP7A 4Q8EA 4RQ4A 1KDHA 4X4RA 4TUSA 1ZQWA 4IG8A 1ZQHA 1ZQAA 5DGAA 2FMQA 1A76A 4F4XA 1S0OA 2A1JA 4JV0A 4ECYA 4DFMA 5J2CA 1ZQDA 4X4OA 4E7XA 1KTQA 1HJPA 4YD2A 3PX4A 3M9MB 3V6HA 2HW3A 4C8LA 1JIHA 1S10A 2UVVA 4RNMA 3IHQB 5J0TA 5HHHA 1X9WA 2KZ3A 3HW8A 2IHMA 3ZDCA 2P6RA 8ICRA 3RH6A 2VA3A 5J2DA 1JAJA 1TK8A 4YMMA 5DBAA 3MR6A 4I2DA 1H38A 2ASLA 5HP4A 2AGQA 1QSLA 2HHSA 1BNPA 2HHPA 4HYKA 2IHNA 3UXNA 2V4RA 4IR9A 1UT8A 2BHNA 3ETLA 2VA2A 1R8AA 3C2LA 1RXVA 2DR9A 5KFVA 3V7KA 2NRKA 3OJSA 4XA5A 4YR0A 3Q8LA 1ZQLA 4QZAA 1KLNA 4JV2A 4WC1A 2FLLA 4NLNA 3PMLA 4YN4A 3M8SA 5DDYA 1JMSA 3BQTA 5HMMA 1XC9A 4ATBB 4X4UA 8ICTA 5KFQA 1MSWD 9ICNA 4ECTA 3TFRA 5CHGA 2Q0ZX 4TUPA 4DL4A 4IR1A 3NYBA 4UB3A 3JPRA 2C2DA 2RDIA 4NXZA 1NK7A 4YCXA 1S0MA 9ICCA 5DG7A 4FHWA 4LZDA 1T3NA 4EBJA 5EWGA 3AQNA 4UQGA 3PX0A 2ZH7A 5KFIA 5KT7A 3LQCB 4I2JA 4KN4A 4QZ9A 5CWRA 2P66A 4YQWA 2KFNA 3JPNA 5KFPA 4FHPA 5DB6A 5DECA 4O3PA 2J6TA 1S77D 1U4BA 8ICVA 8ICUA 4M04A 4WC5A 1TFRA 5J0PA 4RWPA 3H4DA 3RB6A 1LV5A 4I27A 5KFHA 5KT3A 4DSJA 2ZH8A 4DFPA 1NJZA 2F1HA 3KHGA 3Q8QB 4ATBA 5IIIA 2DRBA 4ECVA 5KFRA 4RUCA 4QZDA 4GLXA 3RJHA 4YP3A 3PO4A 5F9NA 2R8JA 4BXOB 4DOAA 4O3RA 8ICJA 4BWJA 8ICGA 3C66A 1QSSA 4ZH4A 3MFIA 3T3FA 3OVSA 2DVIA 3H8JA 3H7IA 4YFKA 1X9MA 2O1PA 3HWTA 4GXKA 7ICGA 3OUYB 2FPMA 4IQTA 4IQWA 4O5KA 4MFCA 4NKUA 4X4QA 4WC7A 4FBUA 4F50A 9ICFA 5KFYA 4QZBA 3EPIA 3RJEA 5KT6A 4P4PA 1TK0A 3PW7A 2ASJA 1ZQNA 3Q8RB 4JV1A 1KNYA 2JEJA 3MGIA 2I1QA 4RZRA 1BPYA 8ICFA 2BE3A 2VANA 3H4BA 5KFOA 8ICQA 1MC8A 2HHVA 3OGUA 2R8GA 8ICOA 5J0WA 4J9NA 8ICKA 2AQ0A 1IM4A 4O5EA 4WCWA 3RJKA 2XC9A 4F5OA 3GIIA 2ZTDA 4M9NA 1BPDA 2ASDA 2ZUBA 8ICMA 9ICLA 1TFYA 3EWAA 4F93B 3TFSA 4E8FA 2ZUCA 4MF2A 7ICNA 5HRFA 3OSPA 2PI4A 9ICEA 2ISOA 4ECRA 4NLZA 4RPYA 3GIMA 4RQ7A 3OUYA 3ORYA 5KT5A 4I2AA 3T5LA 1XS9D 3ZDBA 4ED2A 2PFQA 2AU0A 3RRGA 4ED8A 3RH4A 4RQ0A 1TFWA 4QZGA 5KG7A 2C2RA 1U47A 1RYSA 2PI5A 4E0DA 4KLFA 3PVXA 5DQHA 2HHUA 3EPGA 7ICEA 4WC2A 3PNCA 4DWIA 3ISDA 3KHRA 3G6YA 4DOCA 2PBEA 3PW2A 3JPOA 5HRKA 3MR3A 5L1KA 4J9MA 4Z6DA 4UB4A 1MIWA 9ICRA 5HRHA 7ICOA 8ICPA 2ZHAA 1NJYA 3AQLA 4LT6A 5KG5A 5KFDA 4R66A 4DQRA 1NJXA 4G3IA 3RJGA 4UD5A 4MEYA 8ICHA 4BGDA 3GV5B 5DLFA 2ZTEA 4QW8A 3Q8MA 1L3UA 3NGDA 2JEGA 5KFCA 4B9TA 4ELTA 3MR5A 4PPXA 4Z6EA 4R8UA 3JPPA 4NM2A 4KLJA 4IRKA 9ICTA 3RB3A 3GFKB 4QZHA 1ZQCA 1Q79A 4M5DA 4DS5A 7ICIA 4F5PA 4KMUA 5HRDA 4RQ6A 5BOLA 4RU9A 4KLOA 7ICRA 5HRLA 4MEXA 4DF8A 2BPCA 4GC7A 4EBKA 4QWBA 3GV7B 4Q8FA 2NRXA 3HT3A 2C28A 2BQ3A 1MQ3A 2UVUA 4B9VA 3H40A 1UETA 5CP2A 4DSIA 4O5CA 5KFMA 2Y1IA 5J2GA 1D8YA 9ICPA 5KG3A 1ZJNA 4ELVA 9ICBA 3H39A 5HRIA 1VJ7A 3TAPA 4RT3A 1ZQXA 4GXIA 1Q78A 4F5QA 4S3NA 3ZDDA 3BQ2A 4J9OA 1ZQBA 2M2TA 1Z00A 3Q8SB 2XGQA 1SL0A 1R8BA 4J9RA 4RPXA 3TAQA 1TVAA 3V6KA 4I2FA 2KTQA 1XO1A 4TQRA 4M0AA 4RT2A 4PHDA 1NKBA 4XQ7A 2ZH3A 1MIYA 4X4SA 2BDPA 5J0QA 3MBYA 3TANA 1NK0A 1U45A 4M2YA 3KTQA 3PV8A 4AT9A 4X4TA 4Z6FA 5KG0A 3C2KA 2MUTB 3V7JA 2NRVA 1RXWA 4RWNA 5DEDA 3RAXA 4ECSA 4K4IA 4IRCA 3AQKA 1Y88A 2ATLA 4BDPA 3WFRE 4J9KA 3AU2A 3HPOA 2HVHA 4J9LA 4NLGA 7ICHA 5DQIA 3H37A 4EBCA 9ICGA 1RPLA 4DS4A 2HHXA 4X4NA 5J0RA 2IA6A 4FH5A 2BR0A 2W9BB 1SZPA 2BCSA 4XQ8A 4B9NA 5DLGA 5EWFA 4DFJA 1ZQTA 3SV3A 1UEVA 4QZCA 4RQ8A 4X4VA 3AQMA 1DK2A 3RBDA 2XY7A 2BCVA 2KZMA 1T7PA 1V9PA 2M2VA 4DEZA 5F9LA 4PGQA 2XY6A 1ZQPA 4R63A 4F5NA 4C8NA 4F4YA 3MDAA 5HRBA 5HRGA 1D9DA 5DQGA 3FYHA 3OSNA 1SL2A 4C8KA 4I2HA 4M9HA 1K1SA 4B9MA 3IM1A 1R89A 4RWQA 4PHEA 2ZH1A 1JXEA 4MFAA 5CR0A 5J2HA 1KSPA 5J2JA 4YD1A 3HJ4A 8ICSA 1R8CA 5KT4A 4WBYA 3GV8B 5HHIA 5D46A 3Q8KA 2RFFA 2ZH5A 4QWEA 4O9MA 5KG2A 3MFHA 1HUZA 1CEZA 4WC0A 5HC9A 5J2EA 5KFGA 4UAYA 5KFUA 3RTVA 4RQ2A 2BQUA 1T8EA 4R8UB 4RQ1A 2ZJ8A 4YR2A 1ZQEA 2F1IA 1MIVA 1ZETA 5TZVA 7ICKA 4EEYA 3Q8PB 3TI0A 7ICLA 3PW5A 1ZQQA 7ICTA 4FO6A 3H38A 3OVAA 4QZFA 4KLUA 1TAQA 3EZ5A 9ICMA 3JPTA 1T4GA 5IINA 8ICAA 9ICHA 1D9FA 9ICWA 4YXMA 4B9SA 2W9CB 4WC3A 4F2RA 4M9LA 2ZUDA 1WCNA 2JEIA 7ICUA 2VA8A 1S9FA 9ICIA 2R8IA 4EYIB 1TK5A 2M2UA 4EBEA 3M8RA 4C8OA 1ZQOA 2BCQA 4UB2A 4RQ5A 2GWSA 4RNOA 4O0IA 1N56A 2BQRA 1UT5A 2V4QA 4I2GA 4LZGA 9ICUA 3PMNA 4M6WA 7ICFA 3THVA 3OVBA 1ZQJA 5JUMA 4DF4A 2ZHBA 2NRTA 4R65A 3RBEA 4I2EA 5KFKA 4IQVA 2Q66A 1WCLA 1SKRA 4UBBA 2JZBA 1L5UA 3SYZA 4TUQA 1OU5A 3PR4A 4F4WA 4KITB 4K4HA 1YLQA 4GC6A 4IRDA 4M9GA 5L9XA 4M47A 4E80A 5J2IA 2ZH9A 4DL3A 4KN7A 5J0XA 3ZDAA 2DFLA 4I28A 5KG1A 3BDPA 4P2HA 4XUSA 1SKWA 1U9LA 2W8LA 8ICEA 4EYHB 3SZ2A 8ICNA 2BCUA 4F8RA 5KFZA 3E2EA 5BOMA 3H8WA 4K4GA 1SKSA 2W9MA 4FHYA 1DOQA 4O3NA 5CB1A 3C5GA 8ICIA 5KFNA 3LK9A 4I2BA 2ZH4A 4EZ9A 3FDSA 3LWMA 4DQQA 2ZTCA 2LYHA 3T5HA 1BPEA 1NK8A 2J6SA 2V9WA 4DQPA 3HJ1A 3OHBA 4KLMA 1VFGA 2FMSA 3C23A 5DDMA 2ZH6A 1D8LA 4QZEA 1NZPA 4F92B 5KFTA 3RJIA 3OJUA 4O3SA 2BCRA 4YG2A 3H3AA 3PR5B 2M9NA 4Q45A 3MGHA 4LVSA 4KLTA 4DL2A 3B0YA 1S0VA 1MQ2A 3GIJA 4KLIA 8ICWA 4FHVA 2I9GA 4NKTA 1PX5A 1BPZA 1QTMA 4DL7A 2UVRA 1NJWA 7ICPA 3RJJA 5DKWA 1ZYQA 2IMWP 4X0AA 5EOZA 4TURA 1DK3A 3QEBZ 3PX6A 2KP7A 2J6UA 2DRAA 4ED1A 2AQ4A 3OV7A 5KFFA 2Y1JA 3ISBA 2BKEA 5IIJA 4XRHA 3JPQA 1NK9A 3GILA 3GQCA 4KLSA 2HHTA 3ISCA 5DG9A 5DB7A 2DPJA 4NLKA 3G6VA 2NRWA 2XCAA 1V4AA 3UXOA 3RRHA 4QWAA 2UVWA 3MABA 4NY8A 4RWOA 2HHQA 4DOBA 4DSLA 8ICYA 5IIOA 3WFOA 1K1QA 3C5FA 4CCHA 4JUZA 7ICJA 4WBZA 4QWDA 3JPSA 4ED0A 1KEJA 3TARA 1ZQKA 7ICMA 5KFAA 1COOA 3SI8A 3V72A 4RQ3A 2A1JB 1KRPA 4BXOA 3ZD8A 5EWEA 4AT7A 4KLQA 5L1JA 1JQRA 4BWMA 4B9UA 5J29A 1ZQFA 2ZJAA 1EXNA 3MR2A 4JWMA 7ICQA 4PHPA 2DR5A 1XU4A 1NK5A 3RR7A 4JK1A 2BPGA 2WTFA 3UPQA 2JZBB 1DGSA 4DL5A 1C7YA 3RR8A 2O5AA 3C18A 4ECQA 4B9LA 3C1ZA 3PO5A 4YVZA 3V6JA 3RB4A 5J0SA 1XSLA 1QLNA 2ZJ5A 5J2AA 1B43A 5D49A 3T5JA 3N4MB 8ICCA 2OWOA 3RB0A 1LB2B 1NO5A 2DR7A 4UAWA 5HNKA 4EBDA 2ALZA 4WC6A 5KG6A 3C2MA 1ZQZA 4O3QA 1BGXT 1NKEA 1L3TA 8ICZA 4KLHA 1U48A 3WFPA 4YMOA 5DBCA 2W9AA 4R64A 1ZQMA 4RPZA 7ICSA 5CJ7A 2C2EA 3PY8A 1ZQUA 1NOMA 5KFBA 3N97B 3OHAA 1XSPA 2M2WA 4YMNA 4AT7B 1N48A 3RJFA 1TAUA 3ZDEA 4Q44A 3GDXA 3KHHA 3LDAA 3BQ0A 3TQ1A 5DG8A 1NKCA 4ECWA 4DSEA 1BVSA 2PXIA 5DB9A 3M9OB 4RUAA 2C22A 1S0NA 3UQ2A 5F2VO 4X0BA 2AGPA 1JXLA 4DLEA 2ID1A 2BPFA 5KTQA 3LWLA 3K75D 1UEUA 2MUTA 5KFEA 2RDJA 1TKDA 1U49A 4GXJA 4UD4A 2AGOA 4AT8B 1BPXA 4FBTA 1TV9A 2R8HA 2W9CA 3M9NB 5D4BA 1UA1A 1ZQGA 1NK6A 5J0UA 3UXPA 3JYYA 3UPSA 3RAQA 2PFNA 2PFPA 4F4KA 4UBCA 9ICJA 2XO7A 2KZZA 4ECUA 4F2SA 2BGWA 1BNOA 1JN3A 2XY5A 1RYRA 1PZNA 4PGXA 1ZJMA 4M6WB 2FLPA 4J9QA 1HUOA 4F5RA 2ZH2A 4ECZA 2KN7A 4QZIA 2IBKA 3ZD9A 5DGBA 1XWLA 2XCPA 3PW4A 3KHLA 4DFKA 3EW9A 4KLLA 5HMLA 2DPIA 4FS2A 4P4MA 3EYZA 1AROP 3K4GA 4ECXA 5IIMA 3L9DA 1XSNA 4PH5A 1ZQIA 4M9JA 4AT8A 1RZTA 5J0YA 4UB5A 4F4ZA 4DLGA 3HX0A 2HVIA 9ICOA 2H5XA 4DQSA 2JEFA 9ICSA 4PHAA 5L1LA 4X4PA 4X5VA 5L1IA 4Q43A 1L3VA 4KLDA 4J9SA 8ICXA 4IQUA 4DQIA 4UAZA 1S97A 3QZ7A 1JX4A 4DSFA 4I29A 3BQ1A 4MF8A 4QZ8A 1B22A 3QZ8A 3BJYA 1X9SA 1Z00B 4ELUA 8ICBA 9ICAA 3GIKA 2HHWA 7ICVA 3G6XA 4KTQA 9ICXA 1SL1A 3WFQE 2ISPA 5DBBA 3PW0A 2B21A 4PGYA 9ICKA 3H8SA 5C5JA 4DSKA 5IILA 1CUKA 2DR8A 1ZQVA 3JZ0A 4JWNA 4AT9B 3C1YA 2MAXA 1X2IA 1F5AA 3AUOA 1WOTA 1ZQYA 5J2KA 2W8KA 4J9PA 4FH3A 5BPCA 3B0XA 1S76D 5HR9A 4ED7A 2PFOA 2R8KA 3V7LA 4DO9A 9ICVA 5KT2A 2NRZA 2XGPA 1UA0A 5HREA 4I2CA 5J2BA 5KFSA 4Z6CA 5J2FA 4UB1A 3SV4A 1NK4A 1KFTA 1KFSA 4EZ6A 4YR3A 4I2IA 4P4OA 5KFLA 4RNNA 3MDCA 5KFWA 4FS1A 4O3OA 4QWCA 2FMPA 4F3OA 4KLEA 3HP6A 4WC4A 3WFSC 4QW9A 2W9BA 3C21A 9ICQA 4TQSA 1Z3EB 1A77A 2P6UA 3AU6A 1BPBA 5KFJA 1IXRA 4YXJA 4ED3A 3T5KA 1L3SA 1ZQSA 2FLNA 4DL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8M A;  3QE9 Y;  1KFD A;  8ICL A;  2F1J A;  5J0O A;  3UQ0 A;  4MFF A;  5KFX A;  5IIK A;  5DB8 A;  3RH5 A;  4KLG A;  5KG4 A;  4F91 B;  1QSY A;  2AJQ A;  1ZQR A;  5CA7 A;  2FPK A;  3HIY A;  2FPL A;  4NM1 A;  4FHX A;  3QEA Z;  2KFZ A;  3NTU A;  4ED6 A;  1FA0 A;  4EP7 A;  4Q8E A;  4RQ4 A;  1KDH A;  4X4R A;  4TUS A;  1ZQW A;  4IG8 A;  1ZQH A;  1ZQA A;  5DGA A;  2FMQ A;  1A76 A;  4F4X A;  1S0O A;  2A1J A;  4JV0 A;  4ECY A;  4DFM A;  5J2C A;  1ZQD A;  4X4O A;  4E7X A;  1KTQ A;  1HJP A;  4YD2 A;  3PX4 A;  3M9M B;  3V6H A;  2HW3 A;  4C8L A;  1JIH A;  1S10 A;  2UVV A;  4RNM A;  3IHQ B;  5J0T A;  5HHH A;  1X9W A;  2KZ3 A;  3HW8 A;  2IHM A;  3ZDC A;  2P6R A;  8ICR A;  3RH6 A;  2VA3 A;  5J2D A;  1JAJ A;  1TK8 A;  4YMM A;  5DBA A;  3MR6 A;  4I2D A;  1H38 A;  2ASL A;  5HP4 A;  2AGQ A;  1QSL A;  2HHS A;  1BNP A;  2HHP A;  4HYK A;  2IHN A;  3UXN A;  2V4R A;  4IR9 A;  1UT8 A;  2BHN A;  3ETL A;  2VA2 A;  1R8A A;  3C2L A;  1RXV A;  2DR9 A;  5KFV A;  3V7K A;  2NRK A;  3OJS A;  4XA5 A;  4YR0 A;  3Q8L A;  1ZQL A;  4QZA A;  1KLN A;  4JV2 A;  4WC1 A;  2FLL A;  4NLN A;  3PML A;  4YN4 A;  3M8S A;  5DDY A;  1JMS A;  3BQT A;  5HMM A;  1XC9 A;  4ATB B;  4X4U A;  8ICT A;  5KFQ A;  1MSW D;  9ICN A;  4ECT A;  3TFR A;  5CHG A;  2Q0Z X;  4TUP A;  4DL4 A;  4IR1 A;  3NYB A;  4UB3 A;  3JPR A;  2C2D A;  2RDI A;  4NXZ A;  1NK7 A;  4YCX A;  1S0M A;  9ICC A;  5DG7 A;  4FHW A;  4LZD A;  1T3N A;  4EBJ A;  5EWG A;  3AQN A;  4UQG A;  3PX0 A;  2ZH7 A;  5KFI A;  5KT7 A;  3LQC B;  4I2J A;  4KN4 A;  4QZ9 A;  5CWR A;  2P66 A;  4YQW A;  2KFN A;  3JPN A;  5KFP A;  4FHP A;  5DB6 A;  5DEC A;  4O3P A;  2J6T A;  1S77 D;  1U4B A;  8ICV A;  8ICU A;  4M04 A;  4WC5 A;  1TFR A;  5J0P A;  4RWP A;  3H4D A;  3RB6 A;  1LV5 A;  4I27 A;  5KFH A;  5KT3 A;  4DSJ A;  2ZH8 A;  4DFP A;  1NJZ A;  2F1H A;  3KHG A;  3Q8Q B;  4ATB A;  5III A;  2DRB A;  4ECV A;  5KFR A;  4RUC A;  4QZD A;  4GLX A;  3RJH A;  4YP3 A;  3PO4 A;  5F9N A;  2R8J A;  4BXO B;  4DOA A;  4O3R A;  8ICJ A;  4BWJ A;  8ICG A;  3C66 A;  1QSS A;  4ZH4 A;  3MFI A;  3T3F A;  3OVS A;  2DVI A;  3H8J A;  3H7I A;  4YFK A;  1X9M A;  2O1P A;  3HWT A;  4GXK A;  7ICG A;  3OUY B;  2FPM A;  4IQT A;  4IQW A;  4O5K A;  4MFC A;  4NKU A;  4X4Q A;  4WC7 A;  4FBU A;  4F50 A;  9ICF A;  5KFY A;  4QZB A;  3EPI A;  3RJE A;  5KT6 A;  4P4P A;  1TK0 A;  3PW7 A;  2ASJ A;  1ZQN A;  3Q8R B;  4JV1 A;  1KNY A;  2JEJ A;  3MGI A;  2I1Q A;  4RZR A;  1BPY A;  8ICF A;  2BE3 A;  2VAN A;  3H4B A;  5KFO A;  8ICQ A;  1MC8 A;  2HHV A;  3OGU A;  2R8G A;  8ICO A;  5J0W A;  4J9N A;  8ICK A;  2AQ0 A;  1IM4 A;  4O5E A;  4WCW A;  3RJK A;  2XC9 A;  4F5O A;  3GII A;  2ZTD A;  4M9N A;  1BPD A;  2ASD A;  2ZUB A;  8ICM A;  9ICL A;  1TFY A;  3EWA A;  4F93 B;  3TFS A;  4E8F A;  2ZUC A;  4MF2 A;  7ICN A;  5HRF A;  3OSP A;  2PI4 A;  9ICE A;  2ISO A;  4ECR A;  4NLZ A;  4RPY A;  3GIM A;  4RQ7 A;  3OUY A;  3ORY A;  5KT5 A;  4I2A A;  3T5L A;  1XS9 D;  3ZDB A;  4ED2 A;  2PFQ A;  2AU0 A;  3RRG A;  4ED8 A;  3RH4 A;  4RQ0 A;  1TFW A;  4QZG A;  5KG7 A;  2C2R A;  1U47 A;  1RYS A;  2PI5 A;  4E0D A;  4KLF A;  3PVX A;  5DQH A;  2HHU A;  3EPG A;  7ICE A;  4WC2 A;  3PNC A;  4DWI A;  3ISD A;  3KHR A;  3G6Y A;  4DOC A;  2PBE A;  3PW2 A;  3JPO A;  5HRK A;  3MR3 A;  5L1K A;  4J9M A;  4Z6D A;  4UB4 A;  1MIW A;  9ICR A;  5HRH A;  7ICO A;  8ICP A;  2ZHA A;  1NJY A;  3AQL A;  4LT6 A;  5KG5 A;  5KFD A;  4R66 A;  4DQR A;  1NJX A;  4G3I A;  3RJG A;  4UD5 A;  4MEY A;  8ICH A;  4BGD A;  3GV5 B;  5DLF A;  2ZTE A;  4QW8 A;  3Q8M A;  1L3U A;  3NGD A;  2JEG A;  5KFC A;  4B9T A;  4ELT A;  3MR5 A;  4PPX A;  4Z6E A;  4R8U A;  3JPP A;  4NM2 A;  4KLJ A;  4IRK A;  9ICT A;  3RB3 A;  3GFK B;  4QZH A;  1ZQC A;  1Q79 A;  4M5D A;  4DS5 A;  7ICI A;  4F5P A;  4KMU A;  5HRD A;  4RQ6 A;  5BOL A;  4RU9 A;  4KLO A;  7ICR A;  5HRL A;  4MEX A;  4DF8 A;  2BPC A;  4GC7 A;  4EBK A;  4QWB A;  3GV7 B;  4Q8F A;  2NRX A;  3HT3 A;  2C28 A;  2BQ3 A;  1MQ3 A;  2UVU A;  4B9V A;  3H40 A;  1UET A;  5CP2 A;  4DSI A;  4O5C A;  5KFM A;  2Y1I A;  5J2G A;  1D8Y A;  9ICP A;  5KG3 A;  1ZJN A;  4ELV A;  9ICB A;  3H39 A;  5HRI A;  1VJ7 A;  3TAP A;  4RT3 A;  1ZQX A;  4GXI A;  1Q78 A;  4F5Q A;  4S3N A;  3ZDD A;  3BQ2 A;  4J9O A;  1ZQB A;  2M2T A;  1Z00 A;  3Q8S B;  2XGQ A;  1SL0 A;  1R8B A;  4J9R A;  4RPX A;  3TAQ A;  1TVA A;  3V6K A;  4I2F A;  2KTQ A;  1XO1 A;  4TQR A;  4M0A A;  4RT2 A;  4PHD A;  1NKB A;  4XQ7 A;  2ZH3 A;  1MIY A;  4X4S A;  2BDP A;  5J0Q A;  3MBY A;  3TAN A;  1NK0 A;  1U45 A;  4M2Y A;  3KTQ A;  3PV8 A;  4AT9 A;  4X4T A;  4Z6F A;  5KG0 A;  3C2K A;  2MUT B;  3V7J A;  2NRV A;  1RXW A;  4RWN A;  5DED A;  3RAX A;  4ECS A;  4K4I A;  4IRC A;  3AQK A;  1Y88 A;  2ATL A;  4BDP A;  3WFR E;  4J9K A;  3AU2 A;  3HPO A;  2HVH A;  4J9L A;  4NLG A;  7ICH A;  5DQI A;  3H37 A;  4EBC A;  9ICG A;  1RPL A;  4DS4 A;  2HHX A;  4X4N A;  5J0R A;  2IA6 A;  4FH5 A;  2BR0 A;  2W9B B;  1SZP A;  2BCS A;  4XQ8 A;  4B9N A;  5DLG A;  5EWF A;  4DFJ A;  1ZQT A;  3SV3 A;  1UEV A;  4QZC A;  4RQ8 A;  4X4V A;  3AQM A;  1DK2 A;  3RBD A;  2XY7 A;  2BCV A;  2KZM A;  1T7P A;  1V9P A;  2M2V A;  4DEZ A;  5F9L A;  4PGQ A;  2XY6 A;  1ZQP A;  4R63 A;  4F5N A;  4C8N A;  4F4Y A;  3MDA A;  5HRB A;  5HRG A;  1D9D A;  5DQG A;  3FYH A;  3OSN A;  1SL2 A;  4C8K A;  4I2H A;  4M9H A;  1K1S A;  4B9M A;  3IM1 A;  1R89 A;  4RWQ A;  4PHE A;  2ZH1 A;  1JXE A;  4MFA A;  5CR0 A;  5J2H A;  1KSP A;  5J2J A;  4YD1 A;  3HJ4 A;  8ICS A;  1R8C A;  5KT4 A;  4WBY A;  3GV8 B;  5HHI A;  5D46 A;  3Q8K A;  2RFF A;  2ZH5 A;  4QWE A;  4O9M A;  5KG2 A;  3MFH A;  1HUZ A;  1CEZ A;  4WC0 A;  5HC9 A;  5J2E A;  5KFG A;  4UAY A;  5KFU A;  3RTV A;  4RQ2 A;  2BQU A;  1T8E A;  4R8U B;  4RQ1 A;  2ZJ8 A;  4YR2 A;  1ZQE A;  2F1I A;  1MIV A;  1ZET A;  5TZV A;  7ICK A;  4EEY A;  3Q8P B;  3TI0 A;  7ICL A;  3PW5 A;  1ZQQ A;  7ICT A;  4FO6 A;  3H38 A;  3OVA A;  4QZF A;  4KLU A;  1TAQ A;  3EZ5 A;  9ICM A;  3JPT A;  1T4G A;  5IIN A;  8ICA A;  9ICH A;  1D9F A;  9ICW A;  4YXM A;  4B9S A;  2W9C B;  4WC3 A;  4F2R A;  4M9L A;  2ZUD A;  1WCN A;  2JEI A;  7ICU A;  2VA8 A;  1S9F A;  9ICI A;  2R8I A;  4EYI B;  1TK5 A;  2M2U A;  4EBE A;  3M8R A;  4C8O A;  1ZQO A;  2BCQ A;  4UB2 A;  4RQ5 A;  2GWS A;  4RNO A;  4O0I A;  1N56 A;  2BQR A;  1UT5 A;  2V4Q A;  4I2G A;  4LZG A;  9ICU A;  3PMN A;  4M6W A;  7ICF A;  3THV A;  3OVB A;  1ZQJ A;  5JUM A;  4DF4 A;  2ZHB A;  2NRT A;  4R65 A;  3RBE A;  4I2E A;  5KFK A;  4IQV A;  2Q66 A;  1WCL A;  1SKR A;  4UBB A;  2JZB A;  1L5U A;  3SYZ A;  4TUQ A;  1OU5 A;  3PR4 A;  4F4W A;  4KIT B;  4K4H A;  1YLQ A;  4GC6 A;  4IRD A;  4M9G A;  5L9X A;  4M47 A;  4E80 A;  5J2I A;  2ZH9 A;  4DL3 A;  4KN7 A;  5J0X A;  3ZDA A;  2DFL A;  4I28 A;  5KG1 A;  3BDP A;  4P2H A;  4XUS A;  1SKW A;  1U9L A;  2W8L A;  8ICE A;  4EYH B;  3SZ2 A;  8ICN A;  2BCU A;  4F8R A;  5KFZ A;  3E2E A;  5BOM A;  3H8W A;  4K4G A;  1SKS A;  2W9M A;  4FHY A;  1DOQ A;  4O3N A;  5CB1 A;  3C5G A;  8ICI A;  5KFN A;  3LK9 A;  4I2B A;  2ZH4 A;  4EZ9 A;  3FDS A;  3LWM A;  4DQQ A;  2ZTC A;  2LYH A;  3T5H A;  1BPE A;  1NK8 A;  2J6S A;  2V9W A;  4DQP A;  3HJ1 A;  3OHB A;  4KLM A;  1VFG A;  2FMS A;  3C23 A;  5DDM A;  2ZH6 A;  1D8L A;  4QZE A;  1NZP A;  4F92 B;  5KFT A;  3RJI A;  3OJU A;  4O3S A;  2BCR A;  4YG2 A;  3H3A A;  3PR5 B;  2M9N A;  4Q45 A;  3MGH A;  4LVS A;  4KLT A;  4DL2 A;  3B0Y A;  1S0V A;  1MQ2 A;  3GIJ A;  4KLI A;  8ICW A;  4FHV A;  2I9G A;  4NKT A;  1PX5 A;  1BPZ A;  1QTM A;  4DL7 A;  2UVR A;  1NJW A;  7ICP A;  3RJJ A;  5DKW A;  1ZYQ A;  2IMW P;  4X0A A;  5EOZ A;  4TUR A;  1DK3 A;  3QEB Z;  3PX6 A;  2KP7 A;  2J6U A;  2DRA A;  4ED1 A;  2AQ4 A;  3OV7 A;  5KFF A;  2Y1J A;  3ISB A;  2BKE A;  5IIJ A;  4XRH A;  3JPQ A;  1NK9 A;  3GIL A;  3GQC A;  4KLS A;  2HHT A;  3ISC A;  5DG9 A;  5DB7 A;  2DPJ A;  4NLK A;  3G6V A;  2NRW A;  2XCA A;  1V4A A;  3UXO A;  3RRH A;  4QWA A;  2UVW A;  3MAB A;  4NY8 A;  4RWO A;  2HHQ A;  4DOB A;  4DSL A;  8ICY A;  5IIO A;  3WFO A;  1K1Q A;  3C5F A;  4CCH A;  4JUZ A;  7ICJ A;  4WBZ A;  4QWD A;  3JPS A;  4ED0 A;  1KEJ A;  3TAR A;  1ZQK A;  7ICM A;  5KFA A;  1COO A;  3SI8 A;  3V72 A;  4RQ3 A;  2A1J B;  1KRP A;  4BXO A;  3ZD8 A;  5EWE A;  4AT7 A;  4KLQ A;  5L1J A;  1JQR A;  4BWM A;  4B9U A;  5J29 A;  1ZQF A;  2ZJA A;  1EXN A;  3MR2 A;  4JWM A;  7ICQ A;  4PHP A;  2DR5 A;  1XU4 A;  1NK5 A;  3RR7 A;  4JK1 A;  2BPG A;  2WTF A;  3UPQ A;  2JZB B;  1DGS A;  4DL5 A;  1C7Y A;  3RR8 A;  2O5A A;  3C18 A;  4ECQ A;  4B9L A;  3C1Z A;  3PO5 A;  4YVZ A;  3V6J A;  3RB4 A;  5J0S A;  1XSL A;  1QLN A;  2ZJ5 A;  5J2A A;  1B43 A;  5D49 A;  3T5J A;  3N4M B;  8ICC A;  2OWO A;  3RB0 A;  1LB2 B;  1NO5 A;  2DR7 A;  4UAW A;  5HNK A;  4EBD A;  2ALZ A;  4WC6 A;  5KG6 A;  3C2M A;  1ZQZ A;  4O3Q A;  1BGX T;  1NKE A;  1L3T A;  8ICZ A;  4KLH A;  1U48 A;  3WFP A;  4YMO A;  5DBC A;  2W9A A;  4R64 A;  1ZQM A;  4RPZ A;  7ICS A;  5CJ7 A;  2C2E A;  3PY8 A;  1ZQU A;  1NOM A;  5KFB A;  3N97 B;  3OHA A;  1XSP A;  2M2W A;  4YMN A;  4AT7 B;  1N48 A;  3RJF A;  1TAU A;  3ZDE A;  4Q44 A;  3GDX A;  3KHH A;  3LDA A;  3BQ0 A;  3TQ1 A;  5DG8 A;  1NKC A;  4ECW A;  4DSE A;  1BVS A;  2PXI A;  5DB9 A;  3M9O B;  4RUA A;  2C22 A;  1S0N A;  3UQ2 A;  5F2V O;  4X0B A;  2AGP A;  1JXL A;  4DLE A;  2ID1 A;  2BPF A;  5KTQ A;  3LWL A;  3K75 D;  1UEU A;  2MUT A;  5KFE A;  2RDJ A;  1TKD A;  1U49 A;  4GXJ A;  4UD4 A;  2AGO A;  4AT8 B;  1BPX A;  4FBT A;  1TV9 A;  2R8H A;  2W9C A;  3M9N B;  5D4B A;  1UA1 A;  1ZQG A;  1NK6 A;  5J0U A;  3UXP A;  3JYY A;  3UPS A;  3RAQ A;  2PFN A;  2PFP A;  4F4K A;  4UBC A;  9ICJ A;  2XO7 A;  2KZZ A;  4ECU A;  4F2S A;  2BGW A;  1BNO A;  1JN3 A;  2XY5 A;  1RYR A;  1PZN A;  4PGX A;  1ZJM A;  4M6W B;  2FLP A;  4J9Q A;  1HUO A;  4F5R A;  2ZH2 A;  4ECZ A;  2KN7 A;  4QZI A;  2IBK A;  3ZD9 A;  5DGB A;  1XWL A;  2XCP A;  3PW4 A;  3KHL A;  4DFK A;  3EW9 A;  4KLL A;  5HML A;  2DPI A;  4FS2 A;  4P4M A;  3EYZ A;  1ARO P;  3K4G A;  4ECX A;  5IIM A;  3L9D A;  1XSN A;  4PH5 A;  1ZQI A;  4M9J A;  4AT8 A;  1RZT A;  5J0Y A;  4UB5 A;  4F4Z A;  4DLG A;  3HX0 A;  2HVI A;  9ICO A;  2H5X A;  4DQS A;  2JEF A;  9ICS A;  4PHA A;  5L1L A;  4X4P A;  4X5V A;  5L1I A;  4Q43 A;  1L3V A;  4KLD A;  4J9S A;  8ICX A;  4IQU A;  4DQI A;  4UAZ A;  1S97 A;  3QZ7 A;  1JX4 A;  4DSF A;  4I29 A;  3BQ1 A;  4MF8 A;  4QZ8 A;  1B22 A;  3QZ8 A;  3BJY A;  1X9S A;  1Z00 B;  4ELU A;  8ICB A;  9ICA A;  3GIK A;  2HHW A;  7ICV A;  3G6X A;  4KTQ A;  9ICX A;  1SL1 A;  3WFQ E;  2ISP A;  5DBB A;  3PW0 A;  2B21 A;  4PGY A;  9ICK A;  3H8S A;  5C5J A;  4DSK A;  5IIL A;  1CUK A;  2DR8 A;  1ZQV A;  3JZ0 A;  4JWN A;  4AT9 B;  3C1Y A;  2MAX A;  1X2I A;  1F5A A;  3AUO A;  1WOT A;  1ZQY A;  5J2K A;  2W8K A;  4J9P A;  4FH3 A;  5BPC A;  3B0X A;  1S76 D;  5HR9 A;  4ED7 A;  2PFO A;  2R8K A;  3V7L A;  4DO9 A;  9ICV A;  5KT2 A;  2NRZ A;  2XGP A;  1UA0 A;  5HRE A;  4I2C A;  5J2B A;  5KFS A;  4Z6C A;  5J2F A;  4UB1 A;  3SV4 A;  1NK4 A;  1KFT A;  1KFS A;  4EZ6 A;  4YR3 A;  4I2I A;  4P4O A;  5KFL A;  4RNN A;  3MDC A;  5KFW A;  4FS1 A;  4O3O A;  4QWC A;  2FMP A;  4F3O A;  4KLE A;  3HP6 A;  4WC4 A;  3WFS C;  4QW9 A;  2W9B A;  3C21 A;  9ICQ A;  4TQS A;  1Z3E B;  1A77 A;  2P6U A;  3AU6 A;  1BPB A;  5KFJ A;  1IXR A;  4YXJ A;  4ED3 A;  3T5K A;  1L3S A;  1ZQS A;  2FLN A;  4DL6 A; 
#chains in the Genus database with same CATH topology
 4MFF A;  5DB8 A;  3F2D A;  1ZQR A;  5CA7 A;  3HIY A;  3H0R B;  3WKD A;  4X4R A;  4TUS A;  1ZQW A;  4F4X A;  2B0C A;  4JV0 A;  3ONN A;  5J2C A;  1ZQD A;  4X4O A;  4E7X A;  1HJP A;  3M9M B;  1S10 A;  4RNM A;  4K9A A;  3HW8 A;  3NRW A;  4OO1 J;  5DBA A;  5KL8 B;  1H38 A;  1BNP A;  2AGQ A;  2HHP A;  3UXN A;  2P35 A;  3C2L A;  3SQI A;  2DR9 A;  1UPH A;  3HRD D;  3V7K A;  3OJS A;  1ZQL A;  2W54 A;  3M8S A;  4ATB B;  5HMM A;  4CF3 A;  8ICT A;  1X42 A;  4ECT A;  3TFR A;  4IR1 A;  2RDI A;  3NWI A;  2DL0 A;  4MHV A;  5EWG A;  5ALP A;  2RLT A;  2P66 A;  4YQW A;  5KFP A;  1S77 D;  1U4B A;  1ZD3 A;  3NKU A;  4WC5 A;  3IN5 A;  1LV5 A;  4I27 A;  4DSJ A;  4OAI Z;  4DFP A;  1NJZ A;  3Q8Q B;  4O3R A;  3CRX A;  3C66 A;  3T3F A;  3OVS A;  1X9M A;  2O1P A;  4IQT A;  4X4Q A;  4WC7 A;  3Q8R B;  3AQE A;  3WKC A;  5JTG A;  5KFO A;  1MC8 A;  2HHV A;  8ICK A;  3CP8 A;  2YML A;  9ICL A;  2ZUB A;  4F93 B;  1RDF A;  4Y2S A;  2PI4 A;  2JRZ A;  3D2N A;  2ISO A;  4NLZ A;  4RPY A;  2NO4 A;  4RQ7 A;  1XS9 D;  2ZIX B;  3AM9 A;  1J2M A;  2C2R A;  5DQH A;  7ICE A;  3EPG A;  3PNC A;  1T94 A;  2PBE A;  3BS5 B;  3OWG A;  4J9M A;  1QQ5 A;  5ALO A;  4DFD A;  2ZHA A;  1A6S A;  5KFD A;  4R66 A;  4USA A;  2ZIU B;  2EAN A;  1V38 A;  4Z6E A;  4R8U A;  4KLJ A;  1URJ A;  1ZQC A;  4RU9 A;  4EBK A;  4QWB A;  2I5H A;  2XVT A;  4B9V A;  3WK4 A;  4DSI A;  4O5C A;  2WHE A;  1D8B A;  3KZX A;  2ZIW B;  9ICB A;  1ZOL A;  1VJ7 A;  3PHZ A;  1ZQX A;  4GXI A;  4S3N A;  3HIL A;  1ZQB A;  2M2T A;  1Z00 A;  1SL0 A;  3M6Z A;  4RPX A;  1TVA A;  4M0A A;  3NS1 A;  2NYV A;  3TAN A;  2HOI A;  3PV8 A;  3NVW A;  4Z6F A;  5KG0 A;  2W3S A;  3V7J A;  5DED A;  4K4I A;  3AQK A;  4Y2U A;  4IRC A;  1ZD4 A;  4J9L A;  2OCE A;  4NLG A;  2F3N A;  3ER8 C;  2VJ5 A;  1SZP A;  2BCS A;  2G09 A;  4DFJ A;  1ZQT A;  4QZC A;  1DK2 A;  2XY7 A;  4PGQ A;  2F8K A;  2XY6 A;  3SD7 A;  4F4Y A;  2KIC A;  1D9D A;  3WKA A;  4CDG A;  3OSN A;  2ZH1 A;  1KQQ A;  4KM5 A;  1JXE A;  4MFA A;  2K4I A;  8ICS A;  3E0F A;  5D46 A;  2ZH5 A;  5KG2 A;  1OUQ A;  4WC0 A;  5AKH A;  5CHE A;  5HC9 A;  5J2E A;  4UAY A;  3RTV A;  4R8U B;  1KN5 A;  4KB6 A;  7ICK A;  1MN8 A;  3TI0 A;  7ICL A;  3H38 A;  3EZ5 A;  9ICH A;  5IIN A;  1D9F A;  9ICW A;  4YXM A;  1DRG A;  4FZN A;  2YX8 A;  4EBE A;  4C8O A;  1PVR A;  4RQ5 A;  4RNO A;  5AIB A;  5ALL A;  2V4Q A;  4I2G A;  4LZG A;  3PMN A;  1NI3 A;  2VJ4 A;  7ICF A;  3THV A;  3OVB A;  1ZQJ A;  2E5S A;  3ALR A;  5JUM A;  3RBE A;  5KFK A;  1WCL A;  2JZB A;  1L5U A;  3F2B A;  4TUQ A;  3PR4 A;  4F4W A;  4XJE A;  5J2I A;  4DL3 A;  1V97 A;  4KN7 A;  4Y2Q A;  5J0X A;  3ZDA A;  4I28 A;  5C0Y A;  3BDP A;  5ALH A;  4PL1 A;  1SKW A;  2E3T A;  5ALY A;  2BCU A;  2OM6 A;  5KFZ A;  5B3Q A;  5BOM A;  1DOQ A;  3C5G A;  2WAQ C;  2EAO A;  5B66 U;  3IDW A;  4NXX A;  3BS7 A;  1N5W A;  4EZ9 A;  3FDS A;  1NK8 A;  2ZH4 A;  3HJ1 A;  4F92 B;  3WU2 U;  3RJI A;  1AQ6 A;  2BCR A;  3H3A A;  3PR5 B;  4UW9 A;  3UM9 A;  5ALV A;  4DL2 A;  3B0Y A;  1S0V A;  1MQ2 A;  4KLI A;  2HN2 A;  1QTM A;  5AK4 A;  1NJW A;  5DKW A;  1ZYQ A;  1S5L U;  4NV0 A;  3NVZ A;  2DGZ A;  4EED A;  5EOZ A;  1DK3 A;  2K4H A;  2DRA A;  2AQ4 A;  1JRP A;  3WK6 A;  1NK9 A;  4NLK A;  3G6V A;  2DWQ A;  2R18 A;  4EEL A;  4RWO A;  4NY8 A;  2IOF A;  8ICY A;  4K99 A;  3WFO A;  3C5F A;  4CCH A;  2G5I B;  3C28 A;  1QQ6 A;  4ED0 A;  1ZQK A;  5KFA A;  3SI8 A;  2A1J B;  5EWE A;  5L1J A;  4BWM A;  3L3F X;  4B9U A;  1EXN A;  5ALD A;  4PHP A;  1NK5 A;  2FCL A;  4JK1 A;  4P0P A;  2JZB B;  1DGS A;  3ETR A;  1LKY B;  3RR8 A;  2LM4 A;  2B6G A;  3RB4 A;  5J0S A;  8ICC A;  2DR7 A;  1RYU A;  2OWO A;  3RB0 A;  4EBD A;  2L5Y A;  5KG6 A;  2OXO A;  4YMO A;  2W9A A;  4R64 A;  4RPZ A;  1ZQU A;  3KOO A;  1NOM A;  2B51 A;  2KMD A;  2O6K A;  2M2W A;  1DGJ A;  1TAU A;  1X9X A;  3TQ1 A;  5DG8 A;  4GIB A;  2C22 A;  4UAV A;  1JXL A;  5KTQ A;  4OAG A;  2MUT A;  5KFE A;  3K7D A;  3FC4 A;  4AT8 B;  1BPX A;  1TV9 A;  1ZQG A;  5D4B A;  5J0U A;  3UXP A;  2PFN A;  4HX0 A;  4ECU A;  1TE2 A;  3CYM A;  2YMQ A;  1RYR A;  1PZN A;  4PGX A;  4M6W B;  3I1Y A;  5AKE A;  4ZOH C;  4J9Q A;  1HUO A;  2EZZ A;  1RM6 C;  4F5R A;  5JTI A;  2FDR A;  2ZH2 A;  3ZD9 A;  2XCP A;  4EX6 A;  5ALT A;  2BBJ A;  4OJL A;  3L9D A;  4PH5 A;  3TKA A;  4UB5 A;  3HX0 A;  2HVI A;  3S6J A;  9ICS A;  4X4P A;  5L1I A;  4Q43 A;  1L3V A;  4C4T A;  3SEI A;  2LHT A;  3JCF A;  2KD1 A;  3QZ7 A;  3BQ1 A;  3BQ7 A;  4NWI A;  4ELU A;  1B22 A;  1Z00 B;  5AKI A;  4CF5 A;  4ICA A;  9ICA A;  2HHW A;  3NRZ A;  7ICV A;  3WFP A;  3UMC A;  1SL1 A;  5DBB A;  4PGY A;  3H8S A;  1CUK A;  4U6P A;  4JWN A;  3QUC A;  3F2C A;  1X2I A;  1WOT A;  2W8K A;  3HKZ F;  5BPC A;  3B0X A;  4O3M A;  1S76 D;  2YMM A;  5HR9 A;  2GA9 D;  5KT2 A;  2VKQ A;  3QU5 A;  1N61 A;  5ALM A;  4EZ6 A;  3ER9 B;  5KFL A;  2W7P A;  4O3O A;  3WFS C;  2H3Z A;  4QW9 A;  9ICQ A;  5KAF U;  2EDU A;  1BPB A;  1IXR A;  4YXJ A;  4DL6 A;  3UQ0 A;  5IIK A;  3RH5 A;  5KG4 A;  2AJQ A;  4O69 A;  4ED6 A;  1FA0 A;  1KDH A;  4B6J A;  2KEY A;  3L4P A;  1A76 A;  2D6F C;  4LJX A;  1N62 A;  1KTQ A;  4U7C A;  2LYB A;  2RP5 A;  5J0T A;  5HHH A;  3ZDC A;  2K89 A;  2YN4 A;  3RH6 A;  2VA3 A;  1JAJ A;  4YMM A;  1QSL A;  2HHS A;  1RQN A;  2V4R A;  4IR9 A;  1UT8 A;  1Z1B A;  1Q3V A;  3QU4 A;  5KFV A;  2QLT A;  2XI9 A;  4XA5 A;  4YR0 A;  3Q8L A;  4NLN A;  4YN4 A;  5DDY A;  1JMS A;  4X4U A;  2HI0 A;  1MSW D;  2HBJ A;  5AKX A;  3QXG A;  4DL4 A;  3CK6 A;  2OYY A;  2C2D A;  9ICC A;  4YCX A;  4FHW A;  5DG7 A;  2KOB A;  4EBJ A;  4UQG A;  1UQV A;  5KT7 A;  4FHP A;  4QZ9 A;  2WF8 A;  4F72 A;  3JPN A;  5DEC A;  2J6T A;  2QAR B;  8ICU A;  2CRX A;  3H4D A;  5KFH A;  2KIW A;  2DRB A;  2F1H A;  2JHD A;  3KHG A;  4ECV A;  4RUC A;  3PO4 A;  4GLX A;  5F9N A;  3PSP A;  4P0Q B;  4ZH4 A;  2HN1 A;  3H7I A;  3AMZ A;  4GXK A;  5AM2 A;  2FPM A;  5G5G A;  4O5K A;  4Y2P A;  2E8N A;  3ZDD A;  3EPI A;  3RJE A;  1QQ7 A;  5KT6 A;  1TK0 A;  2A1A A;  3PW7 A;  5B3P A;  4RZR A;  2BE3 A;  3H4B A;  8ICQ A;  1SV4 A;  2DBY A;  2R8G A;  1VDV A;  4F5O A;  3GII A;  4M9N A;  5AIC A;  1TFY A;  1L7P A;  2ZIU A;  4MF2 A;  1Z4N A;  3OSP A;  9ICE A;  5HRF A;  3GIM A;  3ORY A;  5KT5 A;  2YB4 A;  4I2A A;  4ED2 A;  2PFQ A;  2F8L A;  3RH4 A;  3D6J A;  4QZG A;  1U47 A;  3KHR A;  2W04 A;  3G6Y A;  4DOC A;  3JPO A;  3J81 j;  5HRH A;  7ICO A;  5KG5 A;  4DQR A;  4G3I A;  4UD5 A;  4MEY A;  4BGD A;  1GO3 F;  5DLF A;  8ICJ A;  3Q8M A;  4B9T A;  4Y2T A;  4NM2 A;  1X40 A;  3GFK B;  4M5D A;  1LKY A;  5HRD A;  4RQ6 A;  3KBB A;  5HRL A;  4Q8F A;  2UVU A;  1OW5 A;  1YT3 A;  1D8Y A;  3H39 A;  4N7R A;  3H0M B;  1L7N A;  3BZK A;  2H3V A;  5B5E U;  1Q78 A;  3Q8S B;  4J9R A;  3TAQ A;  3V6K A;  2KTQ A;  1XO1 A;  4RT2 A;  1LVH A;  4C80 A;  1PK1 B;  3R9K A;  2JR5 A;  2AHO B;  4X4S A;  4NL9 C;  1N63 A;  3KZI U;  3MBY A;  1NK0 A;  1U45 A;  1O03 A;  2MUT B;  1RXW A;  4RWN A;  3RAX A;  4WJ3 B;  4AYB C;  3B9J A;  4ECS A;  1Y88 A;  2WF7 A;  1WG8 A;  3WK5 A;  2YB1 A;  5AI8 A;  7ICH A;  5DQI A;  1NNL A;  3H37 A;  9ICG A;  4DS4 A;  4X4N A;  4FH5 A;  3FAH A;  2BR0 A;  2KG5 A;  4XQ8 A;  4Y2J A;  4MKP A;  5DLG A;  1ZD5 A;  1KKX A;  1UEV A;  4X4V A;  5KNI A;  1T7P A;  2MA1 A;  1ZQP A;  4F5N A;  4C8N A;  2HSZ A;  4F71 A;  2H3Q A;  2KHQ A;  1SL2 A;  3FYH A;  3PSF A;  4M9H A;  4RWQ A;  5CR0 A;  4OJO A;  5J2J A;  5ALN A;  5HHI A;  2EH9 A;  5ALQ A;  4QWE A;  1CEZ A;  5KFU A;  1T8E A;  4RQ1 A;  4YR2 A;  3QUQ A;  1MIV A;  1ZET A;  3OPX A;  5TZV A;  1F44 A;  3PW5 A;  4FO6 A;  4QZF A;  1TAQ A;  2RQ5 A;  3JPT A;  1T4G A;  8ICA A;  1X6J A;  5GTI U;  2W9C B;  4WC3 A;  4F2R A;  1WCN A;  9ICI A;  2VA8 A;  2M2U A;  3LVW A;  2R8I A;  4EYI B;  3WK8 A;  1TK5 A;  4PJ0 U;  5AM4 A;  2GWS A;  2BQR A;  1UT5 A;  1SV0 C;  2NRT A;  4KX5 A;  1B0X A;  2LMR A;  3SYZ A;  4C0Z A;  2LKY A;  2MSN A;  4RQM A;  4KIT B;  1FO4 A;  4JMU A;  2BDU A;  2YQE A;  3QYP A;  2W8L A;  4EYH B;  5E79 U;  3SZ2 A;  3F5E A;  4F8R A;  2HBL A;  1SKS A;  2W9M A;  2DKX A;  4O3N A;  5CB1 A;  4I2B A;  3LWM A;  2ZTC A;  2LYH A;  3T5H A;  4DQP A;  2V9W A;  2W3R A;  5AI6 A;  1A0P A;  1D8L A;  1NZP A;  4QZE A;  4WH5 A;  3OJU A;  4O3S A;  4YG2 A;  1K5O A;  4Q45 A;  1CI4 A;  4KLT A;  5ALS A;  2BZF A;  4NKT A;  4DL7 A;  3E58 A;  3RJJ A;  7ICP A;  3KKA C;  1SV0 A;  1F5S A;  2EAP A;  4Y2Y A;  2W55 A;  4EEB A;  1YZ6 A;  2J6U A;  4ED1 A;  4P0P B;  5KFF A;  5IIJ A;  4XRH A;  3JPQ A;  5ALU A;  4KLS A;  5DB7 A;  2DPJ A;  2NRW A;  5H2F U;  2I6X A;  1CRX A;  4DOB A;  4DSL A;  4A8E A;  2QAR A;  5IIO A;  2HDO A;  4WBZ A;  4JUZ A;  4QWD A;  1KEJ A;  2IOF K;  1COO A;  3V72 A;  4RQ3 A;  2JH1 A;  3AN1 A;  1KRP A;  5AIA A;  4KLQ A;  1JQR A;  4LEY A;  5GTH U;  2LBO A;  2ZJA A;  4UB6 U;  3RR7 A;  2BPG A;  4K98 A;  3D2S A;  3C18 A;  5AHX A;  4B9L A;  3C1Z A;  3V6J A;  4JB3 A;  1QLN A;  2E1F A;  5D49 A;  2Q4T A;  4OJ6 A;  3IRU A;  5HNK A;  4WC6 A;  4FZL A;  3C2M A;  1ZQZ A;  1BGX T;  8ICZ A;  2RHF A;  1U48 A;  2LI6 A;  5CJ7 A;  3PY8 A;  4C7Y A;  2NO5 A;  3N97 B;  4AT7 B;  4YMN A;  3RJF A;  3ZDE A;  4Q44 A;  2LYA A;  3GDX A;  3LDA A;  3BQ0 A;  2K4E A;  1NKC A;  4ECW A;  1BVS A;  5F2V O;  2ID1 A;  3K75 D;  3BZC A;  2R8H A;  3JYY A;  3UMG A;  3RAQ A;  4F4K A;  4UBC A;  9ICJ A;  1T3Q A;  4F2S A;  3ICX A;  4OJ5 A;  2FLP A;  2KKP A;  4QZI A;  2IBK A;  3PW4 A;  3KHL A;  3EW9 A;  3NVO A;  1ARO P;  5CEH A;  3WKB A;  5IIM A;  1XSN A;  4M9J A;  5J0Y A;  4F4Z A;  3VCB A;  2JEF A;  2PKE A;  1TAM A;  4X5V A;  4IQU A;  3SAF A;  4DSF A;  1X9S A;  8ICB A;  3GIK A;  3G6X A;  1L6N A;  1MA7 A;  3PW0 A;  2ZIV B;  9ICK A;  2DR8 A;  1ZQV A;  3JZ0 A;  1SXE A;  1ZQY A;  5J2K A;  4KX3 A;  2EZX A;  4FH3 A;  5HR7 A;  4ED7 A;  2B56 A;  5EE0 A;  4DO9 A;  4I0U A;  1QCK A;  9ICV A;  1ZRN A;  2XGP A;  2KIV A;  1KFS A;  4CGZ A;  4YR3 A;  3MDC A;  4FE3 A;  4FS1 A;  4K9B A;  4F3O A;  4KLE A;  3A0B U;  3IG8 A;  1Z3E B;  4TQS A;  3AU6 A;  5KFJ A;  4ED3 A;  3T5K A;  1L3S A;  4C8M A;  1KFD A;  8ICL A;  2F1J A;  4KLG A;  5KFX A;  1QSY A;  2FPK A;  4FHX A;  3QEA Z;  1M6Y A;  2QKQ A;  4NL9 A;  4EP7 A;  1KW4 A;  2KVC A;  4RQ4 A;  3NVY A;  4IL6 U;  4IG8 A;  1ZQA A;  1KBU A;  1FIQ A;  2FMQ A;  1S0O A;  2A1J A;  2VIX A;  4J03 A;  4YD2 A;  3PX4 A;  1X6I A;  3V6H A;  1SGG A;  1ZQ1 C;  5D61 A;  4C8L A;  1JIH A;  2UVV A;  3IHQ B;  4IC9 A;  2P6R A;  1X9W A;  2KZ3 A;  8ICR A;  1TK8 A;  3MR6 A;  4X4T A;  5ALE A;  4HYK A;  4JLZ A;  3ETL A;  2K4P A;  2A19 A;  5CRX A;  1KLN A;  1ZD2 P;  4Q8E A;  3PML A;  2AXT U;  2JEI A;  3BQT A;  1PVP A;  5KFQ A;  9ICN A;  2WB1 C;  5CHG A;  4P0Q A;  2KNJ A;  3WKE A;  2W43 A;  1JUD A;  3NYB A;  3QUB A;  3DEE A;  4NXZ A;  1NK7 A;  3EUB 2;  3AQN A;  5ALZ A;  3PX0 A;  2Y9U A;  5KFI A;  2PMZ C;  1SZH A;  4I2J A;  4KN4 A;  5CWR A;  1HIW A;  1KL9 A;  4O3P A;  3H0L B;  8ICV A;  4M04 A;  1FFU A;  5J0P A;  5L1M A;  3RB6 A;  4RWP A;  2ZH8 A;  5KT3 A;  4QZD A;  3RJH A;  5J8Y A;  2R8J A;  4BXO B;  1FFV A;  4DOA A;  4BWJ A;  3MFI A;  3H8J A;  3K1Z A;  7ICG A;  1RQL A;  4MFC A;  2OEH A;  9ICF A;  4P4P A;  1ZQN A;  4JV1 A;  1KNY A;  2JEJ A;  3MGI A;  2I1Q A;  8ICF A;  2AH5 A;  1BPY A;  2H3I A;  1Z4O A;  3OGU A;  5J0W A;  3M6K A;  2AQ0 A;  1IM4 A;  3RJK A;  1BPD A;  1SIJ A;  2ZUC A;  4Y2R A;  3OUY A;  3T5L A;  3ZDB A;  3RRG A;  5ALK A;  4K8V A;  3KD3 A;  2PI5 A;  4KLF A;  1RYS A;  4QJF B;  4E0D A;  4DWI A;  3ISD A;  5HRK A;  5AKG A;  5L1K A;  4Z6D A;  4UB4 A;  1MIW A;  9ICR A;  2PMZ F;  3ED5 A;  8ICP A;  1ZXI A;  3F5A A;  3AQL A;  1IIP A;  4LT6 A;  3RJG A;  5AK5 A;  4LEV A;  2ZTE A;  4QW8 A;  5AKY A;  3NGD A;  5KFC A;  4ELT A;  2DQN B;  5HRI A;  3L5K A;  2WAQ F;  4IRK A;  3RB3 A;  1Q79 A;  4UAS A;  4DS5 A;  1SWV A;  5EE3 A;  4KLO A;  4GC7 A;  3GV7 B;  2NRX A;  3HT3 A;  2BQ3 A;  3AEV A;  3MC1 A;  5CP2 A;  1Z1V A;  2GO7 A;  5KFM A;  2Y1I A;  5J2G A;  2KKV A;  5KG3 A;  1ZJN A;  2BBH A;  3QUT A;  4RT3 A;  2KHV A;  3QU7 A;  2GOL A;  5T14 A;  3BQ2 A;  2XGQ A;  4QIW F;  2QB0 A;  4TQR A;  4PHD A;  1NKB A;  4XQ7 A;  2ZH3 A;  1MIY A;  4NXV A;  4AT9 A;  5CFS A;  3C2K A;  3QX7 A;  4BDP A;  4J9K A;  3AU2 A;  4FZM A;  1NZB A;  4EBC A;  4WQL A;  5AK3 A;  5J0R A;  4QNL A;  2H3F A;  3LYS A;  3SV3 A;  1UCV A;  3AQM A;  2BCV A;  2KZM A;  2D8C A;  2M2V A;  1V9P A;  2N1R A;  5F9L A;  2HBM A;  3M7D A;  3UMB A;  3MDA A;  5HRB A;  5DQG A;  1R89 A;  3KKA A;  4C8K A;  4US8 A;  4I2H A;  1K1S A;  4B9M A;  3IM1 A;  1KSP A;  4YD1 A;  3VC8 A;  1WYG A;  5KT4 A;  4WBY A;  3Q8K A;  2RFF A;  4KMO B;  1XNS A;  4O9M A;  3MFH A;  1HUZ A;  1IG6 A;  4RQ2 A;  2F1I A;  2ESE A;  3N28 A;  4EEY A;  3Q8P B;  4BX9 C;  1ZQQ A;  7ICT A;  9ICM A;  1RG6 A;  5ALX A;  4M9L A;  2ZUD A;  7ICU A;  1S9F A;  5EE9 A;  1ZQO A;  4UB2 A;  4O0I A;  1L7O A;  3CNH A;  4DF4 A;  4R65 A;  2QB0 B;  2Q66 A;  4QIW C;  1Q46 A;  1SKR A;  4PZO A;  1DXS A;  1WUD A;  1OU5 A;  4K4H A;  1YLQ A;  4GC6 A;  4IRD A;  4M9G A;  3N7P D;  3TAC B;  4M47 A;  2ZH9 A;  4BJQ A;  4P2H A;  4XUS A;  3SAG A;  8ICN A;  2W03 A;  8ICI A;  3LK9 A;  4DQQ A;  2J6S A;  1BPE A;  4KLM A;  2FMS A;  5DDM A;  2MRL A;  5AK6 A;  2M9N A;  3MGH A;  4LVS A;  8ICW A;  3H8M A;  4FHV A;  1COK A;  4IS7 A;  2KVS A;  1PX5 A;  2UVR A;  4K96 A;  5CFT A;  1PVQ A;  2QB1 A;  3QEB Z;  4NLB A;  2LPE A;  4C7Z A;  1PK1 A;  2BKE A;  1JAL A;  3O0F A;  3GQC A;  4NJ8 A;  3ISC A;  3I28 A;  3RRH A;  2UVW A;  2XID A;  2HHQ A;  2KJ8 A;  4G9B A;  1K1Q A;  7ICM A;  5ALJ A;  5JU5 A;  4BXO A;  4AT7 A;  5EE1 A;  7ICQ A;  2ZXI A;  2DR5 A;  1XU4 A;  3OTQ A;  1C7Y A;  1SXD A;  4DL5 A;  2O5A A;  4UAU A;  4ECQ A;  4O67 A;  3PO5 A;  2ZJ5 A;  1B43 A;  1J97 A;  4Y2X A;  1LB2 B;  3M1Y A;  1OXJ A;  2KK0 A;  2Y0S C;  2F44 A;  4KLH A;  1ZQM A;  7ICS A;  2C2E A;  5KFB A;  3A0H U;  3OHA A;  1XSP A;  1N48 A;  2WFA A;  4ACO A;  3KHH A;  5AKZ A;  4DSE A;  5DB9 A;  4EEK A;  4RUA A;  4RQN A;  2WB1 F;  1S0N A;  2BPF A;  1UEU A;  4FFD A;  1TKD A;  2KV2 A;  4UD4 A;  2HCF A;  2W9C A;  4NXU A;  3NVV A;  2JH7 A;  5AM5 A;  1Q8K A;  1WWV A;  1J2N A;  3IP4 B;  1BNO A;  2BGW A;  2XY5 A;  4NXT A;  4OAH A;  2F76 X;  5CFU A;  4ECZ A;  2KN7 A;  1SB3 C;  2YY6 A;  3T79 A;  2ZIV A;  1XWL A;  1C20 A;  4FO1 A;  1ZRM A;  4DFK A;  4PZN A;  4KLL A;  2DPI A;  2GH1 A;  4FS2 A;  1Q3U A;  4P4M A;  3EYZ A;  3K4G A;  2WF6 A;  4ECX A;  2E8M A;  2ZXH A;  5FP0 A;  2H5X A;  4DQS A;  2A3V A;  1F0M A;  4KLD A;  4J9S A;  8ICX A;  4CE6 A;  1JX4 A;  4QZ8 A;  3BJY A;  2ISP A;  3SR6 A;  2ZIX A;  5C5J A;  4DSK A;  5KAI U;  4AT9 B;  2MAX A;  2K8A A;  2ES6 A;  1F5A A;  4J9P A;  4HAI A;  2G0A A;  2IHO A;  3N7R C;  2NRZ A;  1UA0 A;  5HRE A;  4I2C A;  5J2B A;  4UB1 A;  1NK4 A;  4P4O A;  3DDH A;  2FMP A;  2K8B B;  3C21 A;  2P6U A;  5AI0 A;  1ZQS A;  3U26 A;  3CW2 C;  2FLN A;  3QE9 Y;  5AI5 A;  1L7M A;  5J0O A;  3LVV A;  4F91 B;  2IOH A;  3MGV A;  2FPL A;  4NM1 A;  2E8O A;  4AYB F;  2KFZ A;  3NTU A;  2FI1 A;  1ZQH A;  2EWR A;  5DGA A;  2FE9 A;  4EV6 A;  4ECY A;  4DFM A;  1UHU A;  2HW3 A;  3I76 A;  3PST A;  2IHM A;  5F3X B;  5J2D A;  2Y9T A;  4I2D A;  2ASL A;  5HP4 A;  1IV8 A;  1PK3 A;  2IHN A;  3QNM A;  2BHN A;  2VA2 A;  1R8A A;  1RXV A;  2NRK A;  2K8C B;  4QZA A;  3AL0 B;  4JV2 A;  4WQK A;  4WC1 A;  2FLL A;  2D3D A;  1XC9 A;  3PZP A;  2Q0Z X;  4TUP A;  4UB3 A;  3JPR A;  2JXJ A;  3MCR A;  1S0M A;  2NV3 A;  3SAH A;  4LZD A;  1T3N A;  5AM1 A;  2ZH7 A;  3LQC B;  2KFN A;  5DB6 A;  1TFR A;  4ATB A;  5III A;  5KFR A;  4YP3 A;  4OAF A;  2JMG A;  8ICG A;  1QSS A;  2DVI A;  4YFK A;  3HWT A;  3OUY B;  4IQW A;  4NKU A;  4FBU A;  4F50 A;  5KFY A;  4QZB A;  4BUG A;  2ASJ A;  4CRX A;  2VAN A;  1VLB A;  4LEW A;  8ICO A;  4EX7 A;  4J9N A;  3TAD C;  4O5E A;  2EAM A;  1N5X A;  4WCW A;  2XC9 A;  2ZTD A;  2ASD A;  4CNQ A;  8ICM A;  3EWA A;  4E8F A;  3TFS A;  2G07 A;  7ICN A;  4ECR A;  3HJE A;  2AU0 A;  4ED8 A;  3EF2 A;  4RQ0 A;  5HR6 A;  1TFW A;  5KG7 A;  3PVX A;  2HHU A;  4WC2 A;  4UAT A;  3PW2 A;  2KJ9 A;  5AM0 A;  2DKZ A;  3MR3 A;  1SWW A;  1NJY A;  2KSO A;  1NJX A;  2IUB A;  8ICH A;  2OHF A;  3GV5 B;  1N60 A;  1L3U A;  2JEG A;  4PPX A;  3MR5 A;  9ICT A;  4UAR A;  3JPP A;  3OVA A;  4QZH A;  7ICI A;  4F5P A;  4KMU A;  5BOL A;  5D62 A;  5G5H A;  3SMV A;  7ICR A;  4MEX A;  4DF8 A;  2BPC A;  1MQ3 A;  2C28 A;  1UET A;  3H40 A;  4GFJ A;  1N2X A;  9ICP A;  3NAS A;  5TIS U;  4ELV A;  3DV9 A;  4UB8 U;  5JRT A;  2W7O A;  3TAP A;  2G06 A;  4F5Q A;  4K97 A;  4J9O A;  3ERC C;  1R8B A;  4X0A A;  4I2F A;  4Y2V A;  3QU2 A;  2BDP A;  5J0Q A;  4M2Y A;  2YMP A;  3KTQ A;  2NRV A;  2B4V A;  2M0N A;  2ZIW A;  2ATL A;  3C29 A;  3WFR E;  3HPO A;  2HVH A;  1O08 A;  1RPL A;  2HHX A;  2IA6 A;  3IV6 A;  2W9B B;  4B9N A;  1B4F A;  5EWF A;  4RQ8 A;  3RBD A;  4DEZ A;  2E8P A;  4R63 A;  3N7S C;  2F77 X;  4O68 A;  5HRG A;  4C4R A;  2WF9 A;  4NXW A;  4PHE A;  5ALG A;  5J2H A;  3HJ4 A;  1R8C A;  1P7D A;  2KSO B;  3GV8 B;  3IG5 A;  4LEZ A;  5KFG A;  2BQU A;  3TAD A;  5ALR A;  2ZJ8 A;  1ZQE A;  3GU3 A;  2RRD A;  4KLU A;  2F2A B;  2EQY A;  4B9S A;  1L8O A;  1WWU A;  5AM3 A;  3M8R A;  2BCQ A;  2HOQ A;  1N56 A;  9ICU A;  1L8L A;  4M6W A;  2K60 A;  2DUY A;  1ECW A;  2ZHB A;  4I2E A;  2MU2 A;  4IQV A;  4UBB A;  1QH9 A;  4C4S A;  5KL1 B;  2Z7J A;  5L9X A;  2CXY A;  5AI4 A;  4E80 A;  2DFL A;  2HOF A;  5KG1 A;  4CF4 A;  2HMX A;  3F53 A;  1U9L A;  8ICE A;  3SEN A;  3E2E A;  3H8W A;  4K4G A;  4FHY A;  4OCZ A;  4PL2 A;  5KFN A;  3K1R B;  3AQF A;  3OHB A;  3PSI A;  3C23 A;  2ZH6 A;  5KFT A;  3FM9 A;  2W11 A;  4EGW A;  2Y0S F;  3GIJ A;  2YTU A;  3RF9 A;  2I9G A;  1BPZ A;  3WK9 A;  5AKL A;  2IMW P;  4TUR A;  2ZG6 A;  2KP7 A;  2LM1 A;  1JI7 A;  3PX6 A;  2OH2 A;  3OV7 A;  2Y1J A;  3ISB A;  5A0L A;  1V85 A;  4AP9 A;  3GIL A;  2HHT A;  2DF4 B;  5DG9 A;  1HEK A;  2XCA A;  1ED1 A;  1V4A A;  3UXO A;  4QWA A;  3MAB A;  3BS5 A;  1YZ7 A;  7ICJ A;  3TAR A;  3JPS A;  1FEZ A;  2EZY A;  3ZD8 A;  4O6A A;  2GAF D;  2CPR A;  5J29 A;  2HBK A;  1ZQF A;  3MR2 A;  4JWM A;  1S8O A;  5AKK A;  3UPQ A;  2WTF A;  2E1E A;  4YVZ A;  5AKJ A;  1XSL A;  5J2A A;  3N4M B;  1NO5 A;  3T5J A;  4UAW A;  2ALZ A;  1NKE A;  4O3Q A;  1L3T A;  3WK7 A;  5DBC A;  3D2Q A;  4US9 A;  1JRO A;  3RFA A;  3KFU F;  2JV3 A;  2PXI A;  5K4L A;  3M9O B;  3UQ2 A;  4X0B A;  2AGP A;  2G08 A;  4DLE A;  3LWL A;  2RDJ A;  1U49 A;  4GXJ A;  2AGO A;  4FBT A;  1PUZ A;  1GPJ A;  4WOY A;  3M9N B;  1UA1 A;  4OD0 A;  4NLC A;  1NK6 A;  2G5H B;  3UPS A;  2PFP A;  3ZI4 A;  2CN1 A;  2XO7 A;  2KZZ A;  1JN3 A;  1ZJM A;  3QU9 A;  5DGB A;  1VJ5 A;  2KJ5 A;  5HML A;  2XIC A;  2JGA A;  1ZQI A;  4AT8 A;  1RZT A;  4DLG A;  9ICO A;  4PHA A;  5L1L A;  2KE7 A;  5AI9 A;  4DQI A;  4UAZ A;  2FJ6 A;  1S97 A;  4I29 A;  4MF8 A;  3QZ8 A;  5ALW A;  4JLX A;  4EEN A;  5D63 A;  4KTQ A;  9ICX A;  3WFQ E;  2B21 A;  5ALF A;  5IIL A;  1Z19 A;  4OJP A;  3C1Y A;  5ALI A;  3AUO A;  1VFG A;  2PFO A;  2R8K A;  3V7L A;  5J8Y C;  3HKZ C;  3SV4 A;  5KFS A;  4Z6C A;  5J2F A;  1KFT A;  3GZF A;  4I2I A;  4RNN A;  4WC4 A;  2ODG A;  3NUQ A;  4DCC A;  5KFW A;  4QWC A;  1X66 A;  3HP6 A;  2W9B A;  2WF5 A;  1A77 A;  2GLE A;  1XO0 A; 
#chains in the Genus database with same CATH homology
 4C8M A;  3QE9 Y;  1KFD A;  8ICL A;  2F1J A;  5J0O A;  3UQ0 A;  4MFF A;  5KFX A;  5IIK A;  5DB8 A;  3RH5 A;  4KLG A;  5KG4 A;  4F91 B;  1QSY A;  2AJQ A;  1ZQR A;  5CA7 A;  2FPK A;  3HIY A;  2FPL A;  4NM1 A;  4FHX A;  3QEA Z;  2KFZ A;  3NTU A;  4ED6 A;  1FA0 A;  4EP7 A;  4Q8E A;  4RQ4 A;  1KDH A;  4X4R A;  4TUS A;  1ZQW A;  4IG8 A;  1ZQH A;  1ZQA A;  5DGA A;  2FMQ A;  1A76 A;  4F4X A;  1S0O A;  2A1J A;  4JV0 A;  4ECY A;  4DFM A;  5J2C A;  1ZQD A;  4X4O A;  4E7X A;  1KTQ A;  1HJP A;  4YD2 A;  3PX4 A;  3M9M B;  3V6H A;  2HW3 A;  4C8L A;  1JIH A;  1S10 A;  2UVV A;  4RNM A;  3IHQ B;  5J0T A;  5HHH A;  1X9W A;  2KZ3 A;  3HW8 A;  2IHM A;  3ZDC A;  2P6R A;  8ICR A;  3RH6 A;  2VA3 A;  5J2D A;  1JAJ A;  1TK8 A;  4YMM A;  5DBA A;  3MR6 A;  4I2D A;  1H38 A;  2ASL A;  5HP4 A;  2AGQ A;  1QSL A;  2HHS A;  1BNP A;  2HHP A;  4HYK A;  2IHN A;  3UXN A;  2V4R A;  4IR9 A;  1UT8 A;  2BHN A;  3ETL A;  2VA2 A;  1R8A A;  3C2L A;  1RXV A;  2DR9 A;  5KFV A;  3V7K A;  2NRK A;  3OJS A;  4XA5 A;  4YR0 A;  3Q8L A;  1ZQL A;  4QZA A;  1KLN A;  4JV2 A;  4WC1 A;  2FLL A;  4NLN A;  3PML A;  4YN4 A;  3M8S A;  5DDY A;  1JMS A;  3BQT A;  5HMM A;  1XC9 A;  4ATB B;  4X4U A;  8ICT A;  5KFQ A;  1MSW D;  9ICN A;  4ECT A;  3TFR A;  5CHG A;  2Q0Z X;  4TUP A;  4DL4 A;  4IR1 A;  3NYB A;  4UB3 A;  3JPR A;  2C2D A;  2RDI A;  4NXZ A;  1NK7 A;  4YCX A;  1S0M A;  9ICC A;  5DG7 A;  4FHW A;  4LZD A;  1T3N A;  4EBJ A;  5EWG A;  3AQN A;  4UQG A;  3PX0 A;  2ZH7 A;  5KFI A;  5KT7 A;  3LQC B;  4I2J A;  4KN4 A;  4QZ9 A;  5CWR A;  2P66 A;  4YQW A;  2KFN A;  3JPN A;  5KFP A;  4FHP A;  5DB6 A;  5DEC A;  4O3P A;  2J6T A;  1S77 D;  1U4B A;  8ICV A;  8ICU A;  4M04 A;  4WC5 A;  1TFR A;  5J0P A;  4RWP A;  3H4D A;  3RB6 A;  1LV5 A;  4I27 A;  5KFH A;  5KT3 A;  4DSJ A;  2ZH8 A;  4DFP A;  1NJZ A;  2F1H A;  3KHG A;  3Q8Q B;  4ATB A;  5III A;  2DRB A;  4ECV A;  5KFR A;  4RUC A;  4QZD A;  4GLX A;  3RJH A;  4YP3 A;  3PO4 A;  5F9N A;  2R8J A;  4BXO B;  4DOA A;  4O3R A;  8ICJ A;  4BWJ A;  8ICG A;  3C66 A;  1QSS A;  4ZH4 A;  3MFI A;  3T3F A;  3OVS A;  2DVI A;  3H8J A;  3H7I A;  4YFK A;  1X9M A;  2O1P A;  3HWT A;  4GXK A;  7ICG A;  3OUY B;  2FPM A;  4IQT A;  4IQW A;  4O5K A;  4MFC A;  4NKU A;  4X4Q A;  4WC7 A;  4FBU A;  4F50 A;  9ICF A;  5KFY A;  4QZB A;  3EPI A;  3RJE A;  5KT6 A;  4P4P A;  1TK0 A;  3PW7 A;  2ASJ A;  1ZQN A;  3Q8R B;  4JV1 A;  1KNY A;  2JEJ A;  3MGI A;  2I1Q A;  4RZR A;  1BPY A;  8ICF A;  2BE3 A;  2VAN A;  3H4B A;  5KFO A;  8ICQ A;  1MC8 A;  2HHV A;  3OGU A;  2R8G A;  8ICO A;  5J0W A;  4J9N A;  8ICK A;  2AQ0 A;  1IM4 A;  4O5E A;  4WCW A;  3RJK A;  2XC9 A;  4F5O A;  3GII A;  2ZTD A;  4M9N A;  1BPD A;  2ASD A;  2ZUB A;  8ICM A;  9ICL A;  1TFY A;  3EWA A;  4F93 B;  3TFS A;  4E8F A;  2ZUC A;  4MF2 A;  7ICN A;  5HRF A;  3OSP A;  2PI4 A;  9ICE A;  2ISO A;  4ECR A;  4NLZ A;  4RPY A;  3GIM A;  4RQ7 A;  3OUY A;  3ORY A;  5KT5 A;  4I2A A;  3T5L A;  1XS9 D;  3ZDB A;  4ED2 A;  2PFQ A;  2AU0 A;  3RRG A;  4ED8 A;  3RH4 A;  4RQ0 A;  1TFW A;  4QZG A;  5KG7 A;  2C2R A;  1U47 A;  1RYS A;  2PI5 A;  4E0D A;  4KLF A;  3PVX A;  5DQH A;  2HHU A;  3EPG A;  7ICE A;  4WC2 A;  3PNC A;  4DWI A;  3ISD A;  3KHR A;  3G6Y A;  4DOC A;  2PBE A;  3PW2 A;  3JPO A;  5HRK A;  3MR3 A;  5L1K A;  4J9M A;  4Z6D A;  4UB4 A;  1MIW A;  9ICR A;  5HRH A;  7ICO A;  8ICP A;  2ZHA A;  1NJY A;  3AQL A;  4LT6 A;  5KG5 A;  5KFD A;  4R66 A;  4DQR A;  1NJX A;  4G3I A;  3RJG A;  4UD5 A;  4MEY A;  8ICH A;  4BGD A;  3GV5 B;  5DLF A;  2ZTE A;  4QW8 A;  3Q8M A;  1L3U A;  3NGD A;  2JEG A;  5KFC A;  4B9T A;  4ELT A;  3MR5 A;  4PPX A;  4Z6E A;  4R8U A;  3JPP A;  4NM2 A;  4KLJ A;  4IRK A;  9ICT A;  3RB3 A;  3GFK B;  4QZH A;  1ZQC A;  1Q79 A;  4M5D A;  4DS5 A;  7ICI A;  4F5P A;  4KMU A;  5HRD A;  4RQ6 A;  5BOL A;  4RU9 A;  4KLO A;  7ICR A;  5HRL A;  4MEX A;  4DF8 A;  2BPC A;  4GC7 A;  4EBK A;  4QWB A;  3GV7 B;  4Q8F A;  2NRX A;  3HT3 A;  2C28 A;  2BQ3 A;  1MQ3 A;  2UVU A;  4B9V A;  3H40 A;  1UET A;  5CP2 A;  4DSI A;  4O5C A;  5KFM A;  2Y1I A;  5J2G A;  1D8Y A;  9ICP A;  5KG3 A;  1ZJN A;  4ELV A;  9ICB A;  3H39 A;  5HRI A;  1VJ7 A;  3TAP A;  4RT3 A;  1ZQX A;  4GXI A;  1Q78 A;  4F5Q A;  4S3N A;  3ZDD A;  3BQ2 A;  4J9O A;  1ZQB A;  2M2T A;  1Z00 A;  3Q8S B;  2XGQ A;  1SL0 A;  1R8B A;  4J9R A;  4RPX A;  3TAQ A;  1TVA A;  3V6K A;  4I2F A;  2KTQ A;  1XO1 A;  4TQR A;  4M0A A;  4RT2 A;  4PHD A;  1NKB A;  4XQ7 A;  2ZH3 A;  1MIY A;  4X4S A;  2BDP A;  5J0Q A;  3MBY A;  3TAN A;  1NK0 A;  1U45 A;  4M2Y A;  3KTQ A;  3PV8 A;  4AT9 A;  4X4T A;  4Z6F A;  5KG0 A;  3C2K A;  2MUT B;  3V7J A;  2NRV A;  1RXW A;  4RWN A;  5DED A;  3RAX A;  4ECS A;  4K4I A;  4IRC A;  3AQK A;  1Y88 A;  2ATL A;  4BDP A;  3WFR E;  4J9K A;  3AU2 A;  3HPO A;  2HVH A;  4J9L A;  4NLG A;  7ICH A;  5DQI A;  3H37 A;  4EBC A;  9ICG A;  1RPL A;  4DS4 A;  2HHX A;  4X4N A;  5J0R A;  2IA6 A;  4FH5 A;  2BR0 A;  2W9B B;  1SZP A;  2BCS A;  4XQ8 A;  4B9N A;  5DLG A;  5EWF A;  4DFJ A;  1ZQT A;  3SV3 A;  1UEV A;  4QZC A;  4RQ8 A;  4X4V A;  3AQM A;  1DK2 A;  3RBD A;  2XY7 A;  2BCV A;  2KZM A;  1T7P A;  1V9P A;  2M2V A;  4DEZ A;  5F9L A;  4PGQ A;  2XY6 A;  1ZQP A;  4R63 A;  4F5N A;  4C8N A;  4F4Y A;  3MDA A;  5HRB A;  5HRG A;  1D9D A;  5DQG A;  3FYH A;  3OSN A;  1SL2 A;  4C8K A;  4I2H A;  4M9H A;  1K1S A;  4B9M A;  3IM1 A;  1R89 A;  4RWQ A;  4PHE A;  2ZH1 A;  1JXE A;  4MFA A;  5CR0 A;  5J2H A;  1KSP A;  5J2J A;  4YD1 A;  3HJ4 A;  8ICS A;  1R8C A;  5KT4 A;  4WBY A;  3GV8 B;  5HHI A;  5D46 A;  3Q8K A;  2RFF A;  2ZH5 A;  4QWE A;  4O9M A;  5KG2 A;  3MFH A;  1HUZ A;  1CEZ A;  4WC0 A;  5HC9 A;  5J2E A;  5KFG A;  4UAY A;  5KFU A;  3RTV A;  4RQ2 A;  2BQU A;  1T8E A;  4R8U B;  4RQ1 A;  2ZJ8 A;  4YR2 A;  1ZQE A;  2F1I A;  1MIV A;  1ZET A;  5TZV A;  7ICK A;  4EEY A;  3Q8P B;  3TI0 A;  7ICL A;  3PW5 A;  1ZQQ A;  7ICT A;  4FO6 A;  3H38 A;  3OVA A;  4QZF A;  4KLU A;  1TAQ A;  3EZ5 A;  9ICM A;  3JPT A;  1T4G A;  5IIN A;  8ICA A;  9ICH A;  1D9F A;  9ICW A;  4YXM A;  4B9S A;  2W9C B;  4WC3 A;  4F2R A;  4M9L A;  2ZUD A;  1WCN A;  2JEI A;  7ICU A;  2VA8 A;  1S9F A;  9ICI A;  2R8I A;  4EYI B;  1TK5 A;  2M2U A;  4EBE A;  3M8R A;  4C8O A;  1ZQO A;  2BCQ A;  4UB2 A;  4RQ5 A;  2GWS A;  4RNO A;  4O0I A;  1N56 A;  2BQR A;  1UT5 A;  2V4Q A;  4I2G A;  4LZG A;  9ICU A;  3PMN A;  4M6W A;  7ICF A;  3THV A;  3OVB A;  1ZQJ A;  5JUM A;  4DF4 A;  2ZHB A;  2NRT A;  4R65 A;  3RBE A;  4I2E A;  5KFK A;  4IQV A;  2Q66 A;  1WCL A;  1SKR A;  4UBB A;  2JZB A;  1L5U A;  3SYZ A;  4TUQ A;  1OU5 A;  3PR4 A;  4F4W A;  4KIT B;  4K4H A;  1YLQ A;  4GC6 A;  4IRD A;  4M9G A;  5L9X A;  4M47 A;  4E80 A;  5J2I A;  2ZH9 A;  4DL3 A;  4KN7 A;  5J0X A;  3ZDA A;  2DFL A;  4I28 A;  5KG1 A;  3BDP A;  4P2H A;  4XUS A;  1SKW A;  1U9L A;  2W8L A;  8ICE A;  4EYH B;  3SZ2 A;  8ICN A;  2BCU A;  4F8R A;  5KFZ A;  3E2E A;  5BOM A;  3H8W A;  4K4G A;  1SKS A;  2W9M A;  4FHY A;  1DOQ A;  4O3N A;  5CB1 A;  3C5G A;  8ICI A;  5KFN A;  3LK9 A;  4I2B A;  2ZH4 A;  4EZ9 A;  3FDS A;  3LWM A;  4DQQ A;  2ZTC A;  2LYH A;  3T5H A;  1BPE A;  1NK8 A;  2J6S A;  2V9W A;  4DQP A;  3HJ1 A;  3OHB A;  4KLM A;  1VFG A;  2FMS A;  3C23 A;  5DDM A;  2ZH6 A;  1D8L A;  4QZE A;  1NZP A;  4F92 B;  5KFT A;  3RJI A;  3OJU A;  4O3S A;  2BCR A;  4YG2 A;  3H3A A;  3PR5 B;  2M9N A;  4Q45 A;  3MGH A;  4LVS A;  4KLT A;  4DL2 A;  3B0Y A;  1S0V A;  1MQ2 A;  3GIJ A;  4KLI A;  8ICW A;  4FHV A;  2I9G A;  4NKT A;  1PX5 A;  1BPZ A;  1QTM A;  4DL7 A;  2UVR A;  1NJW A;  7ICP A;  3RJJ A;  5DKW A;  1ZYQ A;  2IMW P;  4X0A A;  5EOZ A;  4TUR A;  1DK3 A;  3QEB Z;  3PX6 A;  2KP7 A;  2J6U A;  2DRA A;  4ED1 A;  2AQ4 A;  3OV7 A;  5KFF A;  2Y1J A;  3ISB A;  2BKE A;  5IIJ A;  4XRH A;  3JPQ A;  1NK9 A;  3GIL A;  3GQC A;  4KLS A;  2HHT A;  3ISC A;  5DG9 A;  5DB7 A;  2DPJ A;  4NLK A;  3G6V A;  2NRW A;  2XCA A;  1V4A A;  3UXO A;  3RRH A;  4QWA A;  2UVW A;  3MAB A;  4NY8 A;  4RWO A;  2HHQ A;  4DOB A;  4DSL A;  8ICY A;  5IIO A;  3WFO A;  1K1Q A;  3C5F A;  4CCH A;  4JUZ A;  7ICJ A;  4WBZ A;  4QWD A;  3JPS A;  4ED0 A;  1KEJ A;  3TAR A;  1ZQK A;  7ICM A;  5KFA A;  1COO A;  3SI8 A;  3V72 A;  4RQ3 A;  2A1J B;  1KRP A;  4BXO A;  3ZD8 A;  5EWE A;  4AT7 A;  4KLQ A;  5L1J A;  1JQR A;  4BWM A;  4B9U A;  5J29 A;  1ZQF A;  2ZJA A;  1EXN A;  3MR2 A;  4JWM A;  7ICQ A;  4PHP A;  2DR5 A;  1XU4 A;  1NK5 A;  3RR7 A;  4JK1 A;  2BPG A;  2WTF A;  3UPQ A;  2JZB B;  1DGS A;  4DL5 A;  1C7Y A;  3RR8 A;  2O5A A;  3C18 A;  4ECQ A;  4B9L A;  3C1Z A;  3PO5 A;  4YVZ A;  3V6J A;  3RB4 A;  5J0S A;  1XSL A;  1QLN A;  2ZJ5 A;  5J2A A;  1B43 A;  5D49 A;  3T5J A;  3N4M B;  8ICC A;  2OWO A;  3RB0 A;  1LB2 B;  1NO5 A;  2DR7 A;  4UAW A;  5HNK A;  4EBD A;  2ALZ A;  4WC6 A;  5KG6 A;  3C2M A;  1ZQZ A;  4O3Q A;  1BGX T;  1NKE A;  1L3T A;  8ICZ A;  4KLH A;  1U48 A;  3WFP A;  4YMO A;  5DBC A;  2W9A A;  4R64 A;  1ZQM A;  4RPZ A;  7ICS A;  5CJ7 A;  2C2E A;  3PY8 A;  1ZQU A;  1NOM A;  5KFB A;  3N97 B;  3OHA A;  1XSP A;  2M2W A;  4YMN A;  4AT7 B;  1N48 A;  3RJF A;  1TAU A;  3ZDE A;  4Q44 A;  3GDX A;  3KHH A;  3LDA A;  3BQ0 A;  3TQ1 A;  5DG8 A;  1NKC A;  4ECW A;  4DSE A;  1BVS A;  2PXI A;  5DB9 A;  3M9O B;  4RUA A;  2C22 A;  1S0N A;  3UQ2 A;  5F2V O;  4X0B A;  2AGP A;  1JXL A;  4DLE A;  2ID1 A;  2BPF A;  5KTQ A;  3LWL A;  3K75 D;  1UEU A;  2MUT A;  5KFE A;  2RDJ A;  1TKD A;  1U49 A;  4GXJ A;  4UD4 A;  2AGO A;  4AT8 B;  1BPX A;  4FBT A;  1TV9 A;  2R8H A;  2W9C A;  3M9N B;  5D4B A;  1UA1 A;  1ZQG A;  1NK6 A;  5J0U A;  3UXP A;  3JYY A;  3UPS A;  3RAQ A;  2PFN A;  2PFP A;  4F4K A;  4UBC A;  9ICJ A;  2XO7 A;  2KZZ A;  4ECU A;  4F2S A;  2BGW A;  1BNO A;  1JN3 A;  2XY5 A;  1RYR A;  1PZN A;  4PGX A;  1ZJM A;  4M6W B;  2FLP A;  4J9Q A;  1HUO A;  4F5R A;  2ZH2 A;  4ECZ A;  2KN7 A;  4QZI A;  2IBK A;  3ZD9 A;  5DGB A;  1XWL A;  2XCP A;  3PW4 A;  3KHL A;  4DFK A;  3EW9 A;  4KLL A;  5HML A;  2DPI A;  4FS2 A;  4P4M A;  3EYZ A;  1ARO P;  3K4G A;  4ECX A;  5IIM A;  3L9D A;  1XSN A;  4PH5 A;  1ZQI A;  4M9J A;  4AT8 A;  1RZT A;  5J0Y A;  4UB5 A;  4F4Z A;  4DLG A;  3HX0 A;  2HVI A;  9ICO A;  2H5X A;  4DQS A;  2JEF A;  9ICS A;  4PHA A;  5L1L A;  4X4P A;  4X5V A;  5L1I A;  4Q43 A;  1L3V A;  4KLD A;  4J9S A;  8ICX A;  4IQU A;  4DQI A;  4UAZ A;  1S97 A;  3QZ7 A;  1JX4 A;  4DSF A;  4I29 A;  3BQ1 A;  4MF8 A;  4QZ8 A;  1B22 A;  3QZ8 A;  3BJY A;  1X9S A;  1Z00 B;  4ELU A;  8ICB A;  9ICA A;  3GIK A;  2HHW A;  7ICV A;  3G6X A;  4KTQ A;  9ICX A;  1SL1 A;  3WFQ E;  2ISP A;  5DBB A;  3PW0 A;  2B21 A;  4PGY A;  9ICK A;  3H8S A;  5C5J A;  4DSK A;  5IIL A;  1CUK A;  2DR8 A;  1ZQV A;  3JZ0 A;  4JWN A;  4AT9 B;  3C1Y A;  2MAX A;  1X2I A;  1F5A A;  3AUO A;  1WOT A;  1ZQY A;  5J2K A;  2W8K A;  4J9P A;  4FH3 A;  5BPC A;  3B0X A;  1S76 D;  5HR9 A;  4ED7 A;  2PFO A;  2R8K A;  3V7L A;  4DO9 A;  9ICV A;  5KT2 A;  2NRZ A;  2XGP A;  1UA0 A;  5HRE A;  4I2C A;  5J2B A;  5KFS A;  4Z6C A;  5J2F A;  4UB1 A;  3SV4 A;  1NK4 A;  1KFT A;  1KFS A;  4EZ6 A;  4YR3 A;  4I2I A;  4P4O A;  5KFL A;  4RNN A;  3MDC A;  5KFW A;  4FS1 A;  4O3O A;  4QWC A;  2FMP A;  4F3O A;  4KLE A;  3HP6 A;  4WC4 A;  3WFS C;  4QW9 A;  2W9B A;  3C21 A;  9ICQ A;  4TQS A;  1Z3E B;  1A77 A;  2P6U A;  3AU6 A;  1BPB A;  5KFJ A;  1IXR A;  4YXJ A;  4ED3 A;  3T5K A;  1L3S A;  1ZQS A;  2FLN A;  4DL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...