5DBAA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a dt
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 114
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbaA03
3HX0A 1HUOA 4RQ4A 1Z00A 4P2HA 1MC8A 4DL5A 5KT3A 2R8JA 7ICIA 2JZBA 5DQIA 2PFNA 1Q78A 4TURA 2ISOA 1TFWA 3HJ4A 8ICWA 1NK5A 8ICUA 8ICLA 3Q8KA 4YQWA 3RBEA 3MGIA 2HHVA 4FHYA 2Q0ZX 1D9FA 3C21A 2XGPA 1QSLA 3ZD9A 5DBCA 4ELUA 7ICFA 1UT8A 4FS1A 5KFDA 4RPXA 1KRPA 3RTVA 5KG5A 1B43A 5DQHA 3PNCA 5CHGA 1JXLA 8ICZA 5BOMA 4KLQA 9ICSA 1Y88A 3HP6A 8ICNA 3LQCB 7ICTA 4X4OA 2DRBA 1A76A 4O3RA 3GIJA 4IQTA 2Y1JA 3LWMA 2ZH5A 8ICJA 4DFKA 5KFNA 4ED6A 3PW4A 1UA0A 1KFDA 1RYSA 4ELVA 1U45A 2HHSA 1MIYA 4F93B 2AQ4A 3BQTA 3KHGA 2FMPA 3SV3A 3H4DA 2HW3A 5DDYA 2W9BB 4R64A 3V7JA 1NOMA 3T5HA 4F92B 5L1KA 4ATBA 4XUSA 3GIMA 2W9AA 4MF2A 1R8AA 5HRHA 3H38A 2Y1IA 4WC7A 2AGPA 4TUQA 1SKWA 3M9OB 1V4AA 4EBJA 5CJ7A 8ICYA 8ICIA 7ICGA 1JAJA 3TFSA 4RWOA 3K75D 4IRCA 1BNPA 1L3TA 4DL6A 5KFOA 2IHNA 1DOQA 4Z6FA 4X4PA 9ICKA 3ZDDA 4I2EA 2ZH8A 4PHPA 3LK9A 4NLNA 2R8HA 9ICBA 2MUTA 3MDAA 3V6JA 9ICHA 3HT3A 3Q8LA 2C2EA 3BQ1A 5HHHA 1X2IA 4F5RA 4B9MA 4DWIA 1U4BA 1DK3A 5KG0A 1YLQA 2DPIA 3RH6A 4M0AA 5KT4A 4QWCA 5L1IA 4QW8A 4QZGA 4GXJA 9ICWA 4ATBB 4RWNA 4F91B 4DQQA 3PX4A 2BPFA 1A77A 1IM4A 2V9WA 2M2UA 1D9DA 2M2VA 3L9DA 4RZRA 4B9VA 1S77D 4BXOA 4DQSA 3AQMA 1L3VA 3UQ2A 2BCRA 4PHEA 2BCVA 4I28A 2ZTCA 4RWPA 4IQWA 4F4WA 4KMUA 5J2DA 4WC5A 4F5OA 4MF8A 2VA2A 9ICNA 5DB8A 1ZQZA 5CR0A 2JEFA 2FPMA 1ZQWA 4RNMA 4DS4A 4IG8A 4WC2A 4ECYA 3UXOA 5KFRA 4RPZA 2IMWP 5HRBA 5HRIA 2ASLA 5HRKA 4KLIA 1JXEA 1XWLA 5C5JA 3OUYA 2RFFA 1NK9A 1KFSA 1X9MA 9ICQA 2B21A 1TVAA 4ED2A 4R8UB 2BCQA 4BXOB 1NO5A 5J2FA 4NM1A 1ZQXA 4ECRA 4DS5A 2UVUA 4RWQA 4C8NA 4Z6DA 1ZQMA 2FMQA 1ZQSA 4QWBA 2XY5A 1JQRA 5L1JA 1UT5A 3EW9A 3MR6A 4DF8A 4DSLA 1UEUA 2ZJ8A 4YR0A 1KNYA 4PHDA 5KG1A 4M6WB 4O0IA 4DO9A 5DB6A 3PW5A 2ZTEA 3Q8MA 4I2FA 5KT7A 1N48A 3H39A 3MABA 4UB3A 1IXRA 2J6TA 3V7KA 5J29A 4KLMA 7ICEA 3PX0A 1SL2A 4F4XA 3B0YA 4FHXA 2W9MA 5KFFA 4E8FA 3TFRA 3HWTA 2AGOA 4IQUA 4QZIA 3RAXA 1NK0A 4WCWA 1ZQFA 1S0MA 4I2BA 3GQCA 4DSFA 2ID1A 5DLGA 4J9SA 4JWMA 4ED3A 2I9GA 4DFPA 3IM1A 1B22A 1BPXA 8ICEA 3EPIA 2BHNA 4DFMA 1LB2B 2V4QA 4YMMA 4E80A 2XY7A 9ICRA 3OJUA 4JV2A 5KG3A 4EBDA 4O5CA 7ICVA 4GXIA 5HRGA 4UD4A 4DEZA 1R89A 3MDCA 8ICXA 1TK0A 4WC4A 4RQ2A 1DGSA 4F4YA 4M9NA 4O9MA 4KLHA 3SV4A 8ICGA 4KLSA 2XC9A 3AQLA 1V9PA 3H8JA 4UB1A 2HHTA 4EYHB 5KFEA 8ICTA 3TAQA 9ICFA 2ZUBA 5IIOA 2BKEA 5EWGA 4FHWA 4E0DA 1S0NA 3WFPA 4X4SA 3KHRA 1T8EA 1WOTA 2ZH4A 4ECUA 5F9NA 5J0OA 1ZQPA 1ZQYA 4M2YA 8ICBA 3HIYA 2R8GA 3E2EA 4F5QA 4Q8FA 7ICKA 4KN7A 3TQ1A 2PI4A 4I27A 5DEDA 1ZQKA 4YD2A 3EZ5A 4F3OA 4ED1A 4K4HA 2JEIA 1ZQQA 4DF4A 5HRDA 4YXMA 3OHAA 5DKWA 3ISDA 1PZNA 4J9PA 2ZUCA 3BQ0A 4G3IA 8ICAA 2M9NA 3UXNA 4XA5A 3PMNA 3ISCA 5EOZA 3SYZA 2XCPA 5DG9A 5D49A 1TFRA 3MR5A 2AJQA 2C22A 4J9OA 4RT2A 4F4ZA 4P4OA 4WBZA 2KZMA 1D8YA 3RB3A 5IIKA 8ICOA 4XQ7A 2ZH9A 3NTUA 4M9LA 4NKUA 1KSPA 5HMMA 1Z00B 4QZ8A 4FBUA 3EWAA 1XSLA 4YMNA 1TAQA 4B9LA 4DOAA 5DGBA 1U47A 4QZBA 2KZZA 3RJFA 1KTQA 4EBEA 4LZGA 5J2BA 2DR9A 2ZUDA 4KLFA 3JPTA 4YR2A 3GDXA 2KP7A 4I2DA 1TV9A 1JIHA 2R8IA 1XSPA 4R66A 2ZH6A 2PI5A 4LVSA 7ICQA 2KN7A 4F2SA 2FPLA 4PGXA 1RXWA 1NK6A 1KFTA 2W9CA 2NRKA 5KG4A 3OV7A 5DB7A 2NRXA 4C8KA 2DR8A 5KFBA 4I29A 4I2HA 5KT5A 4RQ6A 1T7PA 4ELTA 4KLGA 3C18A 1F5AA 4DSJA 3OHBA 2KFNA 4QZ9A 3N97B 4DLGA 4F5NA 1COOA 5CWRA 1NJZA 1JX4A 1ZQHA 3JPRA 3RBDA 2V4RA 4EZ9A 4X4NA 5KFSA 4JV1A 5F9LA 1QSYA 3G6YA 3RJKA 2FLLA 3OVAA 1TFYA 5KTQA 4J9NA 1L3UA 2JEGA 4NXZA 2KZ3A 5IIMA 3FYHA 3QEBZ 1NKCA 1HJPA 5J2JA 1X9SA 5KFHA 1SKSA 3ZDBA 4M5DA 4ED8A 4AT9B 1BPEA 2DVIA 1KEJA 4DLEA 9ICTA 2A1JA 5J2GA 1BGXT 4XRHA 3QZ8A 5HMLA 3PV8A 5L1LA 1U49A 4BWJA 1RYRA 1NZPA 4P4MA 4PPXA 2ZH7A 3OVBA 3PW7A 3OSPA 1CUKA 1XC9A 3ZDCA 3C2LA 2ASDA 2UVRA 4NLKA 2O5AA 3GFKB 1JN3A 5DECA 3HPOA 2DR5A 3JPPA 4UAWA 5IILA 3G6VA 8ICRA 5KFIA 4RQ8A 1ZQAA 5JUMA 1BNOA 5DG8A 3BQ2A 3M9NB 1S0VA 7ICRA 4I2IA 3AQKA 4M9GA 8ICVA 4C8MA 3AU2A 5J2CA 3H40A 4MEXA 4J9LA 1JMSA 1RPLA 5KT2A 4YD1A 2HHXA 4BDPA 4YP3A 4HYKA 3RJJA 5DLFA 1NJXA 5KFCA 2C2RA 1EXNA 7ICSA 4X4TA 4J9MA 5J2HA 5J0YA 4DFJA 4PGYA 2GWSA 5KFYA 4O3OA 5J2EA 4F5PA 8ICKA 1UA1A 4RQ3A 3V6KA 2ZH1A 2IBKA 4C8OA 4KN4A 2KTQA 4I2JA 4RQ7A 2DRAA 2RDIA 2MUTB 4EP7A 2ASJA 3C1ZA 1TK5A 1NKBA 9ICOA 3C23A 2KFZA 4E7XA 4X0AA 3PW2A 4S3NA 1XS9D 1WCNA 5KFXA 4QZHA 3N4MB 5IIIA 4NKTA 1WCLA 4YR3A 1BPBA 5HNKA 4YG2A 3MFHA 3ISBA 3GV5B 4ZH4A 2I1QA 2ZJAA 1S9FA 5D46A 1X9WA 2NRZA 1S10A 4DQPA 4DSIA 5KFMA 4Q8EA 3TARA 3H4BA 5J0WA 5KG2A 4UAYA 5KFKA 1ZQEA 3T5KA 2JEJA 2ISPA 4R65A 2HVHA 8ICFA 4DSKA 2WTFA 4QZCA 2BQUA 3QZ7A 2UVWA 7ICMA 4UQGA 4J9RA 3H8WA 5J0XA 4MFFA 2HHUA 2ZH3A 4MFAA 4B9TA 3PR4A 4ECTA 4O5EA 2HHWA 4AT7B 1MIWA 4M9HA 3RRGA 5DG7A 5DQGA 2ZJ5A 3HW8A 2W8LA 1SKRA 4UBCA 4PHAA 2BDPA 1NK4A 4RT3A 4K4GA 5HR9A 2XGQA 3OVSA 3WFQE 2BQRA 2NRWA 4X5VA 5HRFA 4X4UA 1ZQTA 3AU6A 3KHHA 4IRKA 3UPQA 2NRVA 3V7LA 1LV5A 1L5UA 8ICHA 3EYZA 4Q45A 4EEYA 4QWAA 5CB1A 5J0RA 3PO4A 1U48A 3SZ2A 9ICXA 4LZDA 1PX5A 3K4GA 4O5KA 4O3SA 2PFOA 5KFPA 1AROP 2M2WA 2O1PA 3C1YA 3ZDAA 1ZJMA 3KTQA 2FMSA 4WC3A 3TANA 4YN4A 9ICLA 5KT6A 3RJHA 1S97A 1BPDA 4RNNA 5KG6A 3RAQA 5HREA 4X4VA 2MAXA 1K1SA 3BDPA 2PFPA 4B9UA 4M9JA 2F1IA 4WC0A 4DSEA 4JK1A 1NK8A 1ZQUA 5J0TA 2XY6A 2P6RA 4NLGA 4QZAA 4XQ8A 4RNOA 5HP4A 2BCUA 4DL4A 5DBBA 8ICCA 4KLOA 1ZQLA 3GIIA 5L9XA 9ICVA 2P66A 4TUPA 3MR3A 3OSNA 3JPNA 9ICEA 4O3PA 3JZ0A 5KFGA 1S0OA 3H8SA 3LDAA 5J2KA 3RR8A 1XSNA 4IR1A 2W9BA 4BGDA 4GC6A 2FPKA 7ICNA 1VJ7A 4QWDA 2ZH2A 5J0QA 3Q8QB 1NKEA 4IQVA 3T3FA 4QZEA 3WFSC 4R8UA 4TUSA 4GC7A 4C8LA 4I2GA 4RPYA 3C5GA 4NY8A 3T5LA 4J9KA 2J6UA 8ICSA 3GV7B 4PH5A 2PFQA 5J0SA 3MFIA 7ICOA 9ICJA 3AQNA 3OJSA 3H37A 2VA8A 3EPGA 4YFKA 1D8LA 4P4PA 2F1HA 3RJIA 8ICMA 1ZQBA 5EWFA 5KG7A 3NGDA 7ICHA 2HHPA 1DK2A 3PX6A 2AQ0A 4IR9A 4AT8A 3ZD8A 4ECXA 1ZQDA 5KFTA 9ICCA 2LYHA 4Q43A 9ICMA 3Q8RB 2C2DA 4F4KA 3RJEA 4B9SA 1ZQRA 3ZDEA 5DB9A 4YXJA 3QE9Y 3RB0A 1SL1A 1CEZA 2W9CB 3KHLA 9ICGA 1KDHA 4RU9A 3TAPA 2ZHBA 4KLTA 1ZJNA 4FBTA 1RZTA 4EYIB 4Z6CA 3BJYA 4DL2A 3RH4A 4QWEA 1ZQVA 4MEYA 5IINA 4X4RA 3LWLA 2PBEA 5BPCA 3JPOA 4FH5A 1ZETA 1TAUA 1T3NA 2W8KA 5F2VO 4ED0A 4YMOA 4Q44A 1FA0A 8ICPA 9ICIA 2PXIA 1R8BA 4FHPA 4WC1A 3B0XA 5TZVA 4WBYA 3RB4A 4UB2A 1MIVA 3C2MA 4BWMA 4ECSA 1L3SA 4LT6A 3JPSA 7ICLA 4YCXA 3MR2A 2F1JA 4GLXA 4TQSA 3PMLA 3RR7A 1UETA 3PY8A 3JYYA 3RRHA 3OUYB 1QSSA 1N56A 4I2AA 9ICUA 1XO1A 5KFZA 4O3NA 4Z6EA 3GILA 3C5FA 5EWEA 3PO5A 4KITB 1TKDA 5KFJA 4CCHA 4X4QA 4AT8B 4EBCA 3TI0A 5J0PA 4UB5A 4QW9A 4UD5A 3UPSA 1NJWA 4JWNA 2BE3A 1SL0A 5HRLA 3HJ1A 3G6XA 3UQ0A 4WC6A 4KLUA 1ZQOA 4K4IA 2VANA 9ICAA 1OU5A 5KFUA 1ZQNA 2BPCA 4NM2A 4B9NA 5DGAA 4RUCA 5J0UA 3IHQB 4DOCA 5BOLA 3RH5A 2J6SA 7ICUA 1KLNA 3FDSA 2XCAA 2BPGA 1NJYA 2DFLA 3GIKA 2UVVA 3V72A 4JV0A 1ZYQA 5DBAA 5HHIA 4JUZA 4DOBA 3SI8A 4RQ5A 2AU0A 4F8RA 2IA6A 4R63A 3UXPA 4DQRA 3T5JA 5CP2A 3M9MB 9ICPA 4EZ6A 1XU4A 1ZQIA 1T4GA 3Q8PB 1ZQJA 2P6UA 1Q79A 5IIJA 4FS2A 4FO6A 2BCSA 4RUAA 4EBKA 4KLJA 3OGUA 5DDMA 2IHMA 3WFRE 3GV8B 1C7YA 1ZQCA 5HC9A 4ECWA 2A1JB 3THVA 3H3AA 3RB6A 4M47A 1U9LA 1Z3EB 4ECQA 1SZPA 2BGWA 4DQIA 4KLLA 1TK8A 2ALZA 2DR7A 4MFCA 2DPJA 4DL7A 2BQ3A 3PR5B 1BPYA 2RDJA 3C2KA 4RQ1A 5KFLA 4PGQA 4IRDA 1R8CA 3H7IA 4F50A 5D4BA 4GXKA 1MSWD 2BR0A 4RQ0A 4TQRA 3Q8SB 3M8SA 4O3QA 1NK7A 2H5XA 3AUOA 2C28A 2HHQA 5KFQA 3WFOA 4NLZA 3MGHA 4AT9A 3RJGA 4QZDA 3M8RA 3QEAZ 2ATLA 1QTMA 2VA3A 4UAZA 2OWOA 4M04A 4KLDA 2NRTA 5J2IA 4UBBA 3ETLA 5KFAA 4KLEA 4M6WA 4UB4A 1UEVA 3NYBA 4YVZA 4AT7A 3C66A 2ZHAA 1VFGA 3JPQA 1HUZA 1BVSA 2XO7A 3ORYA 5J2AA 3PVXA 4ECVA 4QZFA 3PW0A 2FLNA 4FH3A 1MQ3A 4ED7A 7ICJA 4FHVA 4F2RA 1QLNA 7ICPA 2HVIA 4I2CA 1S76D 4KTQA 4DL3A 2JZBB 1RXVA 8ICQA 4J9QA 2M2TA 2Q66A 2AGQA 1BPZA 1MQ2A 4X0BA 5KFVA 1H38A 5KFWA 2ZTDA 2FLPA 3V6HA 2R8KA 5CA7A 4ECZA 3MBYA 1ZQGA 1K1QA
chains in the Genus database with same CATH superfamily
1MC8A 2R8JA 3TKAA 4TURA 2ISOA 8ICWA 3N7SC 2Q0ZX 1D9FA 3C21A 1QSLA 3ZD9A 4ELUA 1UT8A 5KG5A 5CHGA 1JXLA 4C7YA 1RDFA 2HMXA 3HP6A 4X4OA 4O3RA 2Y1JA 2ZXIA 1UA0A 1KFDA 3BQTA 1NOMA 4CDGA 2FJ6A 2W9AA 2AXTU 1V4AA 4EBJA 4Y2VA 2KNJA 5CJ7A 8ICYA 1JAJA 5K4LA 3TFSA 4RWOA 1QQ7A 4IRCA 5AKZA 4Z6FA 4X4PA 9ICKA 2ZH8A 3MDAA 2C2EA 5D61A 5HHHA 1X2IA 4F5RA 2IHOA 4ATBB 9ICWA 4F91B 1LVHA 2V9WA 1A77A 4PL2A 1D9DA 1ZOLA 2KV2A 2M2VA 3L9DA 4B9VA 1S77D 4BXOA 4DQSA 3AQMA 2BCRA 4PHEA 5KAIU 4KMUA 5J2DA 4UASA 3BZCA 2JEFA 5AK4A 5KFRA 5HRKA 2ASLA 4KLIA 1XWLA 2B21A 1TVAA 4BXOB 1JI7A 2UVUA 2WAQC 3BS5B 1ZQSA 1JQRA 4YR0A 2Z7JA 4JB3A 5KT7A 1IXRA 2HDOA 7ICEA 2JR5A 3F53A 4FHXA 5KFFA 1V97A 4WCWA 4I2BA 4DSFA 4J9SA 5GTHU 3IM1A 3EPIA 4YMMA 2WFAA 4GXIA 2OEHA 4FZMA 4DEZA 1R89A 4O9MA 4KLHA 3WK5A 1SV0C 8ICGA 4KLSA 2XC9A 1V9PA 2E8NA 5KFEA 5EWGA 2KEYA 4PZOA 1NZBA 1S0NA 3KHRA 1T8EA 1ZQPA 3WU2U 5ALKA 4Q8FA 4KN7A 4I27A 3EZ5A 4ED1A 3OHAA 2KSOB 5DKWA 2ZUCA 5D49A 1TFRA 5B3QA 8ICOA 2ZH9A 5IIKA 1YT3A 5ALEA 4M9LA 5HMMA 4QZ8A 5AM4A 4FZLA 5DGBA 2XIDA 4YR2A 4R66A 4F71A 4LVSA 7ICQA 5AKYA 2NRKA 2QB0B 3OV7A 5DB7A 2DR8A 4LEZA 4DSJA 2KFNA 3N97B 3KOOA 1Z4NA 5CWRA 5AI5A 1N5WA 3G6YA 4NWIA 3KKAC 4J9NA 2E1FA 4NXZA 5IIMA 1X9SA 1KBUA 4ED8A 4AT9B 1BPEA 3D2NA 2NYVA 4DLEA 1OUQA 1L7MA 1CUKA 3BQ7A 2UVRA 3GFKB 1JN3A 3JPPA 4UAWA 5IILA 3G6VA 2YY6A 4Y2YA 1IIPA 1CRXA 1CI4A 3BQ2A 7ICRA 4IS7A 4C8MA 5J2CA 4J9LA 5KT2A 4OAFA 2HN2A 4HYKA 1NJXA 1EXNA 3IG8A 4C7ZA 5J2EA 4F5PA 4GFJA 2RDIA 2MUTB 4GIBA 2ASJA 2GAFD 4EP7A 3KFUF 2HI0A 2KFZA 4E7XA 4K96A 2K8AA 4QZHA 3N7RC 5IIIA 3N4MB 1WCLA 2F3NA 4YR3A 5HNKA 3M1YA 4IC9A 1BPZA 4ZH4A 4DQPA 3LVWA 4A8EA 1S10A 3HKZF 2W11A 2HVHA 3QZ7A 2UVWA 4UQGA 2P35A 2MRLA 3H8WA 1ZD2P 4B9TA 4ECTA 3PSIA 3RRGA 5DG7A 4U6PA 2DQNB 1X6IA 4PHAA 2JH7A 3ER9B 5AM2A 3V7LA 1VLBA 1Q3UA 1WWVA 3SZ2A 3O0FA 1PX5A 3HJEA 2WF9A 2PFOA 3I76A 4RNNA 3RAQA 5EE1A 2KG5A 2MAXA 5EE3A 2PFPA 4B9UA 4M9JA 2A19A 4NV0A 2P6RA 1UCVA 5B66U 4EELA 4RNOA 1A0PA 2MU2A 8ICCA 1ZQLA 3ALRA 4NXTA 1SIJA 3B9JA 1S0OA 1KNYA 2N1RA 4QZEA 4TUSA 4RPYA 3U26A 2ZXHA 1NI3A 4PH5A 3SAHA 3MFIA 5AI9A 1LKYB 2VA8A 2GLEA 3RJIA 4YFKA 8ICMA 2F1HA 4J03A 2HHPA 1WYGA 3PX6A 3F2CA 5KFTA 9ICCA 2BBHA 2LYHA 5AM1A 5JRTA 4F4KA 3RJEA 4B9SA 1ZQRA 1SL1A 4YXJA 1PVQA 1CEZA 5J8YA 1KDHA 1JALA 4KLTA 1B0XA 3DDHA 1N61A 1J2NA 4DL2A 3BJYA 3RH4A 4MEYA 2RRDA 5BPCA 4FH5A 3F5AA 4Q44A 1FA0A 4FHPA 1ZQ1C 2PXIA 3TACB 4LT6A 3GU3A 3AQFA 4YCXA 2ZIUA 3RR7A 1N56A 1XNSA 5KFZA 4O3NA 3GILA 4KITB 5KFJA 4AT8B 4QW9A 3UPSA 3NRZA 2W54A 1OW5A 2QARB 1OU5A 5ALPA 4RUCA 5J0UA 4Y2QA 3IHQB 2HOQA 4HAIA 1NJYA 3R9KA 1S5LU 1Z4OA 5DBAA 4RQ5A 4Y2TA 2AU0A 2IA6A 2MA1A 3M9MB 4EZ6A 1ZQIA 2P6UA 5IIJA 2BCSA 5EE0A 3WFRE 1C7YA 1X6JA 2EDUA 1ZQCA 4CGZA 4ECWA 3THVA 1Z3EB 1O08A 2L5YA 1TK8A 5AI0A 2DR7A 3PR5B 1BPYA 3C2KA 5ALWA 5KFLA 4PGQA 5D4BA 4GXKA 3Q8SB 4RQMA 3F5EA 1OXJA 3J81j 3H8MA 2C28A 4NLZA 2LBOA 4AT9A 3QEAZ 2ATLA 2YB4A 5J2IA 2G09A 4UBBA 4EV6A 4KLEA 4JLZA 4UB4A 4CE6A 3JPQA 4WOYA 4PL1A 4ECVA 2JGAA 2ZG6A 4QZFA 1SV0A 3BZKA 4I0UA 7ICJA 4F2RA 2QLTA 4I2CA 1S76D 2JZBB 8ICQA 4O69A 1MQ2A 4USAA 3RF9A 1H38A 2ZTDA 5CA7A 1ZQGA 1L7OA 4DL5A 5KT3A 1Q78A 4Y2UA 2W04A 8ICUA 4AYBF 3DV9A 4YQWA 5ALUA 4OJOA 2CPRA 2HHVA 5DBCA 7ICFA 1KRPA 4RPXA 5DQHA 3PNCA 1PK3A 8ICZA 4KLQA 8ICNA 2DRBA 1A76A 3GIJA 4IQTA 2ZH5A 8ICJA 2QB0A 4F93B 2AQ4A 3SV3A 3H4DA 1SB3C 5DDYA 2W9BB 3V7JA 4ATBA 4BUGA 3GIMA 2K60A 5HRHA 2Y1IA 2GA9D 1SKWA 3M9OB 2ZIXA 8ICIA 2O6KA 3K75D 4WH5A 1BNPA 1L3TA 4DL6A 5KNIA 4PHPA 2KKPA 1VJ5A 2DKXA 3WK4A 9ICHA 1DK3A 4WJ3B 1YLQA 5KG0A 4K98A 4M0AA 3LYSA 3SMVA 2H3IA 4GXJA 1UHUA 3PX4A 2BPFA 2QB1A 5ALVA 1XO0A 2W3RA 1PK1A 1L3VA 3NVVA 2ZTCA 2JXJA 3IV6A 4F4WA 4P0PB 9ICNA 5CR0A 1ZQWA 5ALGA 4WC2A 5AK5A 3UXOA 4RPZA 5HRBA 2RFFA 1X9MA 2K4EA 1X9XA 5J2FA 4NM1A 4XJEA 4ECRA 4DS5A 4Z6DA 4LJXA 1ZQMA 2XY5A 5L1JA 1UT5A 4DSLA 2YMLA 4M6WB 4DO9A 4I2FA 3MABA 4UB3A 4CF5A 3WKEA 1SL2A 3B0YA 1FFVA 2W9MA 1KL9A 4JMUA 4E8FA 3HWTA 4QZIA 3RAXA 2RP5A 3GQCA 4K8VA 4JWMA 3AQEA 1BPXA 2V4QA 2XY7A 4O5CA 3K1RB 4EBDA 5HRGA 4WC4A 4RQ2A 1DGSA 3CK6A 1N62A 1QH9A 3AQLA 2JV3A 3NVZA 8ICTA 3M6KA 3TAQA 9ICFA 2FI1A 2EH9A 5F9NA 5J0OA 8ICBA 2OCEA 4F5QA 7ICKA 1QQ5A 1ZQQA 4DF4A 1GO3F 5HRDA 3ISDA 4J9PA 8ICAA 3BQ0A 1DXSA 4C4RA 4EEKA 2DBYA 3ISCA 4XA5A 5DG9A 4C4TA 2C22A 5JU5A 4F4ZA 2K4HA 4P4OA 2G08A 3RB3A 3NTUA 2DWQA 3EUB2 4NKUA 1KSPA 1O03A 2I5HA 1TAQA 3HKZC 4DOAA 4QZBA 3T79A 3ED5A 1KTQA 4LZGA 5J2BA 3GDXA 2IOHA 2KP7A 2CXYA 4F72A 2KN7A 2NV3A 1RXWA 1KFTA 2W9CA 5KG4A 2W43A 2FDRA 3OWGA 1T7PA 4ELTA 4KLGA 2XI9A 3C18A 4P0QA 4O3MA 2LM4A 1L8LA 3AM9A 4F5NA 1NJZA 4EZ9A 3RBDA 2V4RA 5F9LA 2HOFA 4FZNA 3OVAA 1TFYA 5KTQA 1L3UA 1KQQA 1NKCA 4C0ZA 5J2JA 2F8KA 2HBMA 3HILA 3MCRA 2DVIA 5J2GA 1L7NA 1U49A 2PKEA 4BWJA 1NZPA 1D8BA 1PK1B 4PPXA 2ZH7A 3PW7A 3OSPA 4NLKA 3C2LA 2NO4A 2DR5A 2YQEA 2WF5A 5JUMA 3M9NB 1S0VA 3AQKA 8ICVA 1AQ6A 1JROA 2B6GA 2EZZA 1JMSA 2ZIWA 2D3DA 2AHOB 1Q8KA 2C2RA 7ICSA 4OCZA 4J9MA 4X4TA 5J0YA 4DFJA 4PGYA 4AP9A 1UA1A 2IBKA 4KN4A 4RQ7A 2YN4A 3UMBA 9ICOA 2R18A 5ALJA 1XS9D 1WCNA 2RLTA 5KFXA 4NKTA 1SGGA 1BPBA 3ISBA 4EX6A 4YG2A 1S9FA 2I1QA 5D46A 2NRZA 5KFMA 2BQUA 4J9RA 2LYAA 4MFFA 2ZH3A 1N5XA 4O5EA 2KE7A 4M9HA 2W8LA 1RQLA 2K89A 4UBCA 4KM5A 2KJ5A 4LEVA 1NK4A 4RT3A 3WFQE 5HR9A 2NRWA 4BJQA 3UPQA 3E58A 1LV5A 8ICHA 4Q45A 4EEYA 2WHEA 4QWAA 5CB1A 5J0RA 2KICA 2E3TA 1U48A 2Y9TA 2EAPA 4O5KA 2M2WA 2O1PA 3ZDAA 1ZJMA 3KTQA 2FMSA 4YN4A 9ICLA 1S97A 2WF6A 5KG6A 5AIBA 4NL9A 3BDPA 4JK1A 1ZQUA 2YMQA 4XQ8A 2G5IB 4KLOA 3GIIA 5KL1B 5L9XA 2P66A 4TUPA 4CNQA 3OSNA 2BZFA 9ICEA 5KFGA 4IR1A 1XSNA 2FPKA 4IQVA 3ERCC 3WFSC 4R8UA 5CHEA 2J6UA 8ICSA 3GV7B 3AQNA 3H37A 3A0BU 1ZQBA 5KG7A 2JH1A 2WAQF 3ZD8A 4ECXA 1ZQDA 9ICMA 3Q8RB 4JLXA 1HIWA 4O6AA 3WKBA 3KHLA 4K9AA 2LPEA 4RU9A 3TAPA 1L7PA 1ZJNA 1RZTA 1VDVA 4KX3A 1IG6A 3ZI4A 3QXGA 1ZQVA 4X4RA 3LWLA 2PBEA 1ZD5A 1ZETA 2YTUA 1TAUA 2W8KA 5F2VO 1Z19A 4YMOA 4WC1A 9ICIA 3KD3A 3B0XA 3CYMA 3RB4A 4UB2A 1MIVA 1WUDA 3JYYA 4GLXA 1UETA 3PY8A 3D2SA 3RRHA 3OUYB 1QSSA 4I2AA 1XO1A 3C5FA 3PO5A 1TKDA 2F77X 3M7DA 3QNMA 4UB5A 3UQ0A 4WC6A 5AK6A 5E79U 5AM3A 4DOCA 5BOLA 3RH5A 3FDSA 2XCAA 3GIKA 5HHIA 1A6SA 4DOBA 4N7RA 4F8RA 1MN8A 4DQRA 5CP2A 1XU4A 1T4GA 1UPHA 1ZQJA 1PVRA 4FO6A 5DDMA 2IHMA 1K5OA 3H3AA 4M47A 1U9LA 4DQIA 2BGWA 2ALZA 4DL7A 4RQ1A 3H7IA 1ZD3A 1MSWD 3M8SA 1NK7A 3AUOA 1J2MA 4WQKA 4QZDA 4Y2SA 2VA3A 4UAZA 4KLDA 2NRTA 4WQLA 3QU2A 1VFGA 4YVZA 4AT7A 2XO7A 2PMZF 4OD0A 3S6JA 4UATA 1MQ3A 1YZ6A 5HR6A 4FHVA 4EEDA 4K9BA 3SENA 4IL6U 7ICPA 3D6JA 4KTQA 4PZNA 4J9QA 2D6FC 2Q66A 2AGQA 2G0AA 1T94A 5KFVA 2R8KA 2LYBA 3WKDA 5AI4A 5ALHA 3MBYA 4X4VA 3HX0A 1HUOA 1Z00A 4P2HA 2JZBA 5DQIA 2PFNA 4O67A 4G9BA 1TFWA 2K4PA 5ALFA 2ESEA 5AM0A 3SQIA 2EZXA 3RBEA 4FHYA 3MGIA 3WKCA 2XGPA 4FS1A 3RTVA 1B43A 2RHFA 3LQCB 2JRZA 4EEBA 2YX8A 1ZRMA 4ED6A 3PW4A 1MIYA 1U45A 2FMPA 2HW3A 3KHGA 4R64A 3T5HA 3IRUA 4XUSA 4MF2A 4WC7A 3GZFA 3H38A 4TUQA 3CW2C 3QYPA 7ICGA 3PSFA 1DOQA 4OAGA 3ZDDA 4I2EA 4NLNA 3L4PA 2R8HA 3V6JA 3BQ1A 4FO1A 4Y2RA 4DWIA 2DPIA 3NRWA 3RH6A 4QW8A 2JHDA 4RWNA 2BDUA 1JUDA 4DQQA 4U7CA 3MC1A 2B4VA 4I28A 2BCVA 1COKA 4MF8A 2VA2A 5DB8A 2EQYA 5AKGA 4DS4A 4ECYA 2KMDA 1NK9A 1KFSA 9ICQA 1N63A 4ED2A 2E8MA 1ZQXA 4RWQA 1DGJA 2FMQA 4QWBA 4NLCA 3L3FX 3EW9A 1UEUA 3PZPA 2YMMA 2ZJ8A 4PHDA 4O0IA 2WB1C 3Q8MA 1N48A 3H39A 5ALXA 3V7KA 3BS5A 5J29A 4KLMA 3CNHA 5KL8B 3PX0A 2DL0A 2VIXA 4F4XA 1NK0A 4ICAA 4MHVA 1ZQFA 3QUQA 5AI6A 3PHZA 2H3QA 2ID1A 5DLGA 4ED3A 2I9GA 1B22A 8ICEA 2BHNA 4UB8U 4DFMA 3F2DA 2H3VA 9ICRA 3OJUA 5KG3A 3SAGA 4UD4A 2HSZA 1ECWA 8ICXA 1TK0A 2B51A 4F4YA 1YZ7A 4Y2PA 2KHQA 4QJFB 3H8JA 1SXEA 4O68A 5GTIU 1Q3VA 2BKEA 3QU9A 3WFPA 1IV8A 4C80A 2W7OA 3E2EA 2Y0SC 2Y9UA 2F76X 2QKQA 2PI4A 4CRXA 5DEDA 1ZQKA 4YD2A 4F3OA 2MSNA 1QQ6A 1PZNA 3DEEA 3SYZA 3MR5A 4J9OA 4CF4A 4WBZA 2KZMA 1F0MA 2ES6A 1XSLA 3WKAA 2G5HB 3IP4B 3PSTA 1U47A 2KZZA 2W3SA 2FE9A 4FFDA 2ZUDA 1PUZA 4BX9C 3JPTA 1TV9A 2ZH6A 1ED1A 4P0PA 5L1MA 2M0NA 4F2SA 4PGXA 1NK6A 1QCKA 2NRXA 4C8KA 5ALTA 5KFBA 4I29A 5KT5A 1F5AA 4QZ9A 4DLGA 3CRXA 4JV1A 4US8A 2KZ3A 2VJ5A 1HJPA 1SKSA 4M5DA 5KFHA 2A1JA 1BGXT 3AMZA 3QZ8A 4P4MA 3IDWA 3OVBA 2EANA 2ASDA 5AHXA 2K8CB 3WK7A 5DECA 5CFTA 8ICRA 4RQ8A 1ZQAA 1BNOA 4NL9C 4I2IA 4EENA 4M9GA 3H40A 4MEXA 1NNLA 1X66A 3IN5A 2EZYA 4YP3A 1L6NA 5DLFA 3QUBA 2LI6A 5J2HA 2KIVA 1ZD4A 3BS7A 3F2BA 3V6KA 4C8OA 2LKYA 3KKAA 2ZIVA 1NKBA 4EX7A 3OPXA 1WG8A 2IUBA 1FFUA 3PW2A 2GH1A 8ICPA 3GV5B 3QU5A 3TARA 4KMOB 2CRXA 4UAYA 2JEJA 1ZQEA 3T5KA 8ICFA 4DSKA 4QZCA 7ICMA 3JCFA 4NXXA 2GO7A 5J0XA 2HHUA 4MFAA 4OJ6A 1MIWA 3HW8A 3AN1A 2BDPA 4K4GA 3OVSA 5CFUA 2KK0A 2BQRA 3SEIA 4X5VA 5HRFA 5JTIA 4LEWA 4X4UA 2K8BB 5ALRA 5ALMA 3AU6A 2IOFA 3KHHA 3EYZA 4QIWC 4NLBA 3K4GA 4O3SA 4US9A 4WC3A 3NVWA 1P7DA 3TANA 5CFSA 3RJHA 1BPDA 2JMGA 4OJ5A 5G5HA 4WC0A 4DSEA 1NK8A 3KBBA 5J0TA 2XY6A 4QZAA 2OM6A 2BCUA 1WWUA 5C0YA 1Z1VA 9ICVA 3MR3A 3JZ0A 4O3PA 3H8SA 3LDAA 5J2KA 3RR8A 2HBKA 2W9BA 1VJ7A 2WF8A 1LKYA 2D8CA 2ZH2A 5T14A 3Q8QB 3T3FA 2H3FA 5AICA 5CEHA 2RQ5A 2E8PA 3C5GA 4I2GA 4NY8A 3T5LA 2PFQA 5J0SA 9ICJA 3AL0B 3I1YA 2AH5A 3NVYA 1D8LA 3TADA 3NGDA 7ICHA 2AQ0A 4AT8A 4Y2XA 1UQVA 5DB9A 9ICGA 3RB0A 2ZHBA 4EYIB 3C29A 3A0HU 3JPOA 1T3NA 4WBYA 3C2MA 4ECSA 5H2FU 4TQSA 3NUQA 2KOBA 3ETRA 9ICUA 4X4QA 4CCHA 5AM5A 4EBCA 3TI0A 5J0PA 5HRLA 3G6XA 3L5KA 1J97A 3WK9A 9ICAA 5KFUA 1ZQNA 3ICXA 4B9NA 3N28A 5B3PA 7ICUA 1KLNA 2BPGA 2DFLA 2UVVA 3V72A 3ONNA 1ZYQA 5J8YC 3UXPA 4PJ0U 3Q8PB 2E8OA 1Q79A 4EBKA 3SR6A 3OGUA 3GV8B 1SWWA 2A1JB 3RB6A 4ECQA 1SZPA 4LEYA 2BQ3A 3CP8A 2RDJA 1R8CA 4UB6U 5ALQA 2BR0A 3WK6A 4RQ0A 1PVPA 1SV4A 2F2AB 1QTMA 2OWOA 1N60A 5KFAA 5ALIA 4M6WA 4K97A 5AKEA 3PVXA 5J2AA 3PW0A 3K7DA 4FH3A 4NJ8A 4Y2JA 1QLNA 2ZIUB 4OJLA 4DL3A 1RXVA 2M2TA 5HR7A 2LMRA 5KFWA 1DRGA 2FLPA 3V6HA 4Q8EA 1K1QA 4RQ4A 7ICIA 2BBJA 1C20A 3UM9A 3HJ4A 1NK5A 8ICLA 3Q8KA 4MKPA 1FIQA 1Z1BA 2W03A 5KFDA 3LVVA 5BOMA 9ICSA 1Y88A 3K1ZA 7ICTA 3LWMA 1JRPA 4DFKA 2VJ4A 3HRDD 5KFNA 2HHSA 1RYSA 4ELVA 2I6XA 2DF4B 4F92B 5L1KA 1R8AA 2AGPA 4KB6A 2DKZA 3SD7A 2A3VA 4UAUA 5KFOA 2IHNA 3LK9A 3FAHA 9ICBA 2MUTA 3HT3A 3Q8LA 1T3QA 4B9MA 1U4BA 4EGWA 1URJA 4UAVA 5KT4A 5G5GA 4AYBC 4QWCA 4QZGA 5L1IA 3AEVA 3NKUA 1IM4A 2M2UA 4RZRA 4DCCA 2W55A 3UQ2A 1SWVA 2HOIA 4RWPA 4IQWA 2ZIXB 4WC5A 2XICA 5EE9A 1F5SA 4F5OA 5AK3A 1ZQZA 2FPMA 4RNMA 4IG8A 2IMWP 5HRIA 2KKVA 3OUYA 1JXEA 5C5JA 4R8UB 5ALLA 2BCQA 5ALSA 4C8NA 2H3ZA 5AI8A 5TISU 2KD1A 2EAMA 3MR6A 1KW4A 3H0MB 4DF8A 3EF2A 4HX0A 1HEKA 5KG1A 3PW5A 5DB6A 2ZTEA 3NVOA 2J6TA 4DFDA 2KVSA 2PMZC 3TFRA 4UW9A 2AGOA 4IQUA 5AKHA 3UMGA 3M6ZA 1S0MA 4DFPA 3MGVA 1LB2B 2KJ8A 4JV2A 7ICVA 3MDCA 4M9NA 3SV4A 4RQNA 4UB1A 2HHTA 4EYHB 2ZUBA 5IIOA 4FHWA 4E0DA 4QIWF 4X4SA 1WOTA 2ZH4A 4ECUA 3HIYA 1ZQYA 2R8GA 2LM1A 3TQ1A 3FM9A 4K4HA 2JEIA 4YXMA 5ALOA 2CN1A 3D2QA 4G3IA 2M9NA 2HBJA 3UXNA 3PMNA 4M2YA 2AJQA 5EOZA 1NO5A 2XCPA 4RT2A 1KN5A 2EAOA 2XVTA 1V38A 1D8YA 4XQ7A 4KX5A 1Z00B 4FBUA 3EWAA 4YMNA 4B9LA 1SZHA 1ZRNA 1ZXIA 3RJFA 4EBEA 2DR9A 4KLFA 3VCBA 4I2DA 1JIHA 2R8IA 1XSPA 1MA7A 2HBLA 2PI5A 4FE3A 1L8OA 2FPLA 2F44A 2DGZA 2OYYA 4I2HA 4RQ6A 3UMCA 3OHBA 1RG6A 1COOA 2OHFA 1JX4A 1ZQHA 3JPRA 4X4NA 2DUYA 5KFSA 2LHTA 1QSYA 3RJKA 3I28A 2FLLA 3QU7A 2JEGA 4OAHA 3QEBZ 3FYHA 3ZDBA 1M6YA 1KEJA 9ICTA 3PV8A 4XRHA 5HMLA 5L1LA 1RYRA 1XC9A 3ZDCA 2O5AA 1TAMA 5F3XB 3HPOA 5KFIA 3SAFA 2A1AA 5DG8A 5AKJA 3AU2A 1B4FA 1RPLA 4YD1A 2HHXA 4BDPA 3RJJA 5KFCA 2HN1A 1RYUA 2KIWA 2GWSA 5KFYA 4O3OA 8ICKA 2ZH1A 4RQ3A 4NXWA 2KTQA 4I2JA 2DRAA 2OXOA 3C1ZA 1TK5A 3C28A 4X0AA 3C23A 2K4IA 4S3NA 3WK8A 3MFHA 4C4SA 3TADC 2ZJAA 1X9WA 3VC8A 4DSIA 3H4BA 5J0WA 5KG2A 5KFKA 2QARA 2ISPA 4R65A 4UARA 2WTFA 5ALNA 3QX7A 3QU4A 1SXDA 3PR4A 2FCLA 2HHWA 4AT7B 1X40A 3QUTA 3PSPA 5DQGA 1TE2A 2ZJ5A 1SKRA 3OTQA 2XGQA 2Y0SF 1ZQTA 4IRKA 2NRVA 1L5UA 2IOFK 5D63A 3PO4A 3KZXA 9ICXA 4NXUA 1RM6C 1N2XA 4LZDA 1FO4A 5KFPA 1AROP 3C1YA 3ER8C 1X42A 1GPJA 5KT6A 5ALDA 3FC4A 5HREA 1K1SA 2KVCA 5CRXA 2F1IA 4NLGA 2WF7A 5HP4A 4DL4A 5DBBA 1F44A 3JPNA 2F8LA 4BGDA 4GC6A 7ICNA 4QWDA 5J0QA 1NKEA 3QUCA 4GC7A 4C8LA 2E5SA 5AKXA 4J9KA 2WB1F 2W7PA 4CF3A 7ICOA 4B6JA 3OJSA 3EPGA 4P4PA 4ZOHC 5EWFA 1DK2A 1RQNA 2ODGA 3N7PD 4IR9A 4Q43A 2C2DA 3ZDEA 2E1EA 3QE9Y 3NS1A 4OO1J 2W9CB 4P0QB 4FBTA 2YB1A 4Z6CA 4QWEA 5IINA 2ZIVB 4ED0A 1R8BA 2G06A 5JTGA 5TZVA 4BWMA 1L3SA 3JPSA 7ICLA 4E80A 3MR2A 2F1JA 3PMLA 4Z6EA 5B5EU 5EWEA 5KAFU 4UD5A 1NJWA 4JWNA 2BE3A 1SL0A 4OAIZ 5AKLA 3HJ1A 3H0RB 4NXVA 4ACOA 4KLUA 1ZQOA 4K4IA 2VANA 2BPCA 4NM2A 3E0FA 5DGAA 2J6SA 2OH2A 2G07A 2KJ9A 4JV0A 4OJPA 3SI8A 4JUZA 2NO5A 4R63A 3KZIU 3T5JA 3RFAA 2ZIWB 9ICPA 4FS2A 1S8OA 2KHVA 4RUAA 4KLJA 1KKXA 5AKKA 5HC9A 5AIAA 2YMPA 4KLLA 2KSOA 1FEZA 4MFCA 2DPJA 4IRDA 4F50A 2Q4TA 2EWRA 3NWIA 4TQRA 4O3QA 2H5XA 2HHQA 5KFQA 3WFOA 1Q46A 5A0LA 3MGHA 5FP0A 3RJGA 3M8RA 4M04A 5D62A 3ETLA 3H0LB 1UEVA 2ZHAA 4QNLA 3NYBA 3C66A 2HCFA 1HUZA 4K99A 1BVSA 3ORYA 3IG5A 2FLNA 5AKIA 4ED7A 2B56A 5ALYA 5ALZA 2HVIA 1V85A 4X0BA 2B0CA 4ECZA 2GOLA 2VKQA 3NASA
chains in the Genus database with same CATH topology
3HX0A 1HUOA 4RQ4A 1Z00A 4P2HA 1MC8A 4DL5A 5KT3A 2R8JA 7ICIA 2JZBA 5DQIA 2PFNA 1Q78A 4TURA 2ISOA 1TFWA 3HJ4A 8ICWA 1NK5A 8ICUA 8ICLA 3Q8KA 4YQWA 3RBEA 3MGIA 2HHVA 4FHYA 2Q0ZX 1D9FA 3C21A 2XGPA 1QSLA 3ZD9A 5DBCA 4ELUA 7ICFA 1UT8A 4FS1A 5KFDA 4RPXA 1KRPA 3RTVA 5KG5A 1B43A 5DQHA 3PNCA 5CHGA 1JXLA 8ICZA 5BOMA 4KLQA 9ICSA 1Y88A 3HP6A 8ICNA 3LQCB 7ICTA 4X4OA 2DRBA 1A76A 4O3RA 3GIJA 4IQTA 2Y1JA 3LWMA 2ZH5A 8ICJA 4DFKA 5KFNA 4ED6A 3PW4A 1UA0A 1KFDA 1RYSA 4ELVA 1U45A 2HHSA 1MIYA 4F93B 2AQ4A 3BQTA 3KHGA 2FMPA 3SV3A 3H4DA 2HW3A 5DDYA 2W9BB 4R64A 3V7JA 1NOMA 3T5HA 4F92B 5L1KA 4ATBA 4XUSA 3GIMA 2W9AA 4MF2A 1R8AA 5HRHA 3H38A 2Y1IA 4WC7A 2AGPA 4TUQA 1SKWA 3M9OB 1V4AA 4EBJA 5CJ7A 8ICYA 8ICIA 7ICGA 1JAJA 3TFSA 4RWOA 3K75D 4IRCA 1BNPA 1L3TA 4DL6A 5KFOA 2IHNA 1DOQA 4Z6FA 4X4PA 9ICKA 3ZDDA 4I2EA 2ZH8A 4PHPA 3LK9A 4NLNA 2R8HA 9ICBA 2MUTA 3MDAA 3V6JA 9ICHA 3HT3A 3Q8LA 2C2EA 3BQ1A 5HHHA 1X2IA 4F5RA 4B9MA 4DWIA 1U4BA 1DK3A 5KG0A 1YLQA 2DPIA 3RH6A 4M0AA 5KT4A 4QWCA 5L1IA 4QW8A 4QZGA 4GXJA 9ICWA 4ATBB 4RWNA 4F91B 4DQQA 3PX4A 2BPFA 1A77A 1IM4A 2V9WA 2M2UA 1D9DA 2M2VA 3L9DA 4RZRA 4B9VA 1S77D 4BXOA 4DQSA 3AQMA 1L3VA 3UQ2A 2BCRA 4PHEA 2BCVA 4I28A 2ZTCA 4RWPA 4IQWA 4F4WA 4KMUA 5J2DA 4WC5A 4F5OA 4MF8A 2VA2A 9ICNA 5DB8A 1ZQZA 5CR0A 2JEFA 2FPMA 1ZQWA 4RNMA 4DS4A 4IG8A 4WC2A 4ECYA 3UXOA 5KFRA 4RPZA 2IMWP 5HRBA 5HRIA 2ASLA 5HRKA 4KLIA 1JXEA 1XWLA 5C5JA 3OUYA 2RFFA 1NK9A 1KFSA 1X9MA 9ICQA 2B21A 1TVAA 4ED2A 4R8UB 2BCQA 4BXOB 1NO5A 5J2FA 4NM1A 1ZQXA 4ECRA 4DS5A 2UVUA 4RWQA 4C8NA 4Z6DA 1ZQMA 2FMQA 1ZQSA 4QWBA 2XY5A 1JQRA 5L1JA 1UT5A 3EW9A 3MR6A 4DF8A 4DSLA 1UEUA 2ZJ8A 4YR0A 1KNYA 4PHDA 5KG1A 4M6WB 4O0IA 4DO9A 5DB6A 3PW5A 2ZTEA 3Q8MA 4I2FA 5KT7A 1N48A 3H39A 3MABA 4UB3A 1IXRA 2J6TA 3V7KA 5J29A 4KLMA 7ICEA 3PX0A 1SL2A 4F4XA 3B0YA 4FHXA 2W9MA 5KFFA 4E8FA 3TFRA 3HWTA 2AGOA 4IQUA 4QZIA 3RAXA 1NK0A 4WCWA 1ZQFA 1S0MA 4I2BA 3GQCA 4DSFA 2ID1A 5DLGA 4J9SA 4JWMA 4ED3A 2I9GA 4DFPA 3IM1A 1B22A 1BPXA 8ICEA 3EPIA 2BHNA 4DFMA 1LB2B 2V4QA 4YMMA 4E80A 2XY7A 9ICRA 3OJUA 4JV2A 5KG3A 4EBDA 4O5CA 7ICVA 4GXIA 5HRGA 4UD4A 4DEZA 1R89A 3MDCA 8ICXA 1TK0A 4WC4A 4RQ2A 1DGSA 4F4YA 4M9NA 4O9MA 4KLHA 3SV4A 8ICGA 4KLSA 2XC9A 3AQLA 1V9PA 3H8JA 4UB1A 2HHTA 4EYHB 5KFEA 8ICTA 3TAQA 9ICFA 2ZUBA 5IIOA 2BKEA 5EWGA 4FHWA 4E0DA 1S0NA 3WFPA 4X4SA 3KHRA 1T8EA 1WOTA 2ZH4A 4ECUA 5F9NA 5J0OA 1ZQPA 1ZQYA 4M2YA 8ICBA 3HIYA 2R8GA 3E2EA 4F5QA 4Q8FA 7ICKA 4KN7A 3TQ1A 2PI4A 4I27A 5DEDA 1ZQKA 4YD2A 3EZ5A 4F3OA 4ED1A 4K4HA 2JEIA 1ZQQA 4DF4A 5HRDA 4YXMA 3OHAA 5DKWA 3ISDA 1PZNA 4J9PA 2ZUCA 3BQ0A 4G3IA 8ICAA 2M9NA 3UXNA 4XA5A 3PMNA 3ISCA 5EOZA 3SYZA 2XCPA 5DG9A 5D49A 1TFRA 3MR5A 2AJQA 2C22A 4J9OA 4RT2A 4F4ZA 4P4OA 4WBZA 2KZMA 1D8YA 3RB3A 5IIKA 8ICOA 4XQ7A 2ZH9A 3NTUA 4M9LA 4NKUA 1KSPA 5HMMA 1Z00B 4QZ8A 4FBUA 3EWAA 1XSLA 4YMNA 1TAQA 4B9LA 4DOAA 5DGBA 1U47A 4QZBA 2KZZA 3RJFA 1KTQA 4EBEA 4LZGA 5J2BA 2DR9A 2ZUDA 4KLFA 3JPTA 4YR2A 3GDXA 2KP7A 4I2DA 1TV9A 1JIHA 2R8IA 1XSPA 4R66A 2ZH6A 2PI5A 4LVSA 7ICQA 2KN7A 4F2SA 2FPLA 4PGXA 1RXWA 1NK6A 1KFTA 2W9CA 2NRKA 5KG4A 3OV7A 5DB7A 2NRXA 4C8KA 2DR8A 5KFBA 4I29A 4I2HA 5KT5A 4RQ6A 1T7PA 4ELTA 4KLGA 3C18A 1F5AA 4DSJA 3OHBA 2KFNA 4QZ9A 3N97B 4DLGA 4F5NA 1COOA 5CWRA 1NJZA 1JX4A 1ZQHA 3JPRA 3RBDA 2V4RA 4EZ9A 4X4NA 5KFSA 4JV1A 5F9LA 1QSYA 3G6YA 3RJKA 2FLLA 3OVAA 1TFYA 5KTQA 4J9NA 1L3UA 2JEGA 4NXZA 2KZ3A 5IIMA 3FYHA 3QEBZ 1NKCA 1HJPA 5J2JA 1X9SA 5KFHA 1SKSA 3ZDBA 4M5DA 4ED8A 4AT9B 1BPEA 2DVIA 1KEJA 4DLEA 9ICTA 2A1JA 5J2GA 1BGXT 4XRHA 3QZ8A 5HMLA 3PV8A 5L1LA 1U49A 4BWJA 1RYRA 1NZPA 4P4MA 4PPXA 2ZH7A 3OVBA 3PW7A 3OSPA 1CUKA 1XC9A 3ZDCA 3C2LA 2ASDA 2UVRA 4NLKA 2O5AA 3GFKB 1JN3A 5DECA 3HPOA 2DR5A 3JPPA 4UAWA 5IILA 3G6VA 8ICRA 5KFIA 4RQ8A 1ZQAA 5JUMA 1BNOA 5DG8A 3BQ2A 3M9NB 1S0VA 7ICRA 4I2IA 3AQKA 4M9GA 8ICVA 4C8MA 3AU2A 5J2CA 3H40A 4MEXA 4J9LA 1JMSA 1RPLA 5KT2A 4YD1A 2HHXA 4BDPA 4YP3A 4HYKA 3RJJA 5DLFA 1NJXA 5KFCA 2C2RA 1EXNA 7ICSA 4X4TA 4J9MA 5J2HA 5J0YA 4DFJA 4PGYA 2GWSA 5KFYA 4O3OA 5J2EA 4F5PA 8ICKA 1UA1A 4RQ3A 3V6KA 2ZH1A 2IBKA 4C8OA 4KN4A 2KTQA 4I2JA 4RQ7A 2DRAA 2RDIA 2MUTB 4EP7A 2ASJA 3C1ZA 1TK5A 1NKBA 9ICOA 3C23A 2KFZA 4E7XA 4X0AA 3PW2A 4S3NA 1XS9D 1WCNA 5KFXA 4QZHA 3N4MB 5IIIA 4NKTA 1WCLA 4YR3A 1BPBA 5HNKA 4YG2A 3MFHA 3ISBA 3GV5B 4ZH4A 2I1QA 2ZJAA 1S9FA 5D46A 1X9WA 2NRZA 1S10A 4DQPA 4DSIA 5KFMA 4Q8EA 3TARA 3H4BA 5J0WA 5KG2A 4UAYA 5KFKA 1ZQEA 3T5KA 2JEJA 2ISPA 4R65A 2HVHA 8ICFA 4DSKA 2WTFA 4QZCA 2BQUA 3QZ7A 2UVWA 7ICMA 4UQGA 4J9RA 3H8WA 5J0XA 4MFFA 2HHUA 2ZH3A 4MFAA 4B9TA 3PR4A 4ECTA 4O5EA 2HHWA 4AT7B 1MIWA 4M9HA 3RRGA 5DG7A 5DQGA 2ZJ5A 3HW8A 2W8LA 1SKRA 4UBCA 4PHAA 2BDPA 1NK4A 4RT3A 4K4GA 5HR9A 2XGQA 3OVSA 3WFQE 2BQRA 2NRWA 4X5VA 5HRFA 4X4UA 1ZQTA 3AU6A 3KHHA 4IRKA 3UPQA 2NRVA 3V7LA 1LV5A 1L5UA 8ICHA 3EYZA 4Q45A 4EEYA 4QWAA 5CB1A 5J0RA 3PO4A 1U48A 3SZ2A 9ICXA 4LZDA 1PX5A 3K4GA 4O5KA 4O3SA 2PFOA 5KFPA 1AROP 2M2WA 2O1PA 3C1YA 3ZDAA 1ZJMA 3KTQA 2FMSA 4WC3A 3TANA 4YN4A 9ICLA 5KT6A 3RJHA 1S97A 1BPDA 4RNNA 5KG6A 3RAQA 5HREA 4X4VA 2MAXA 1K1SA 3BDPA 2PFPA 4B9UA 4M9JA 2F1IA 4WC0A 4DSEA 4JK1A 1NK8A 1ZQUA 5J0TA 2XY6A 2P6RA 4NLGA 4QZAA 4XQ8A 4RNOA 5HP4A 2BCUA 4DL4A 5DBBA 8ICCA 4KLOA 1ZQLA 3GIIA 5L9XA 9ICVA 2P66A 4TUPA 3MR3A 3OSNA 3JPNA 9ICEA 4O3PA 3JZ0A 5KFGA 1S0OA 3H8SA 3LDAA 5J2KA 3RR8A 1XSNA 4IR1A 2W9BA 4BGDA 4GC6A 2FPKA 7ICNA 1VJ7A 4QWDA 2ZH2A 5J0QA 3Q8QB 1NKEA 4IQVA 3T3FA 4QZEA 3WFSC 4R8UA 4TUSA 4GC7A 4C8LA 4I2GA 4RPYA 3C5GA 4NY8A 3T5LA 4J9KA 2J6UA 8ICSA 3GV7B 4PH5A 2PFQA 5J0SA 3MFIA 7ICOA 9ICJA 3AQNA 3OJSA 3H37A 2VA8A 3EPGA 4YFKA 1D8LA 4P4PA 2F1HA 3RJIA 8ICMA 1ZQBA 5EWFA 5KG7A 3NGDA 7ICHA 2HHPA 1DK2A 3PX6A 2AQ0A 4IR9A 4AT8A 3ZD8A 4ECXA 1ZQDA 5KFTA 9ICCA 2LYHA 4Q43A 9ICMA 3Q8RB 2C2DA 4F4KA 3RJEA 4B9SA 1ZQRA 3ZDEA 5DB9A 4YXJA 3QE9Y 3RB0A 1SL1A 1CEZA 2W9CB 3KHLA 9ICGA 1KDHA 4RU9A 3TAPA 2ZHBA 4KLTA 1ZJNA 4FBTA 1RZTA 4EYIB 4Z6CA 3BJYA 4DL2A 3RH4A 4QWEA 1ZQVA 4MEYA 5IINA 4X4RA 3LWLA 2PBEA 5BPCA 3JPOA 4FH5A 1ZETA 1TAUA 1T3NA 2W8KA 5F2VO 4ED0A 4YMOA 4Q44A 1FA0A 8ICPA 9ICIA 2PXIA 1R8BA 4FHPA 4WC1A 3B0XA 5TZVA 4WBYA 3RB4A 4UB2A 1MIVA 3C2MA 4BWMA 4ECSA 1L3SA 4LT6A 3JPSA 7ICLA 4YCXA 3MR2A 2F1JA 4GLXA 4TQSA 3PMLA 3RR7A 1UETA 3PY8A 3JYYA 3RRHA 3OUYB 1QSSA 1N56A 4I2AA 9ICUA 1XO1A 5KFZA 4O3NA 4Z6EA 3GILA 3C5FA 5EWEA 3PO5A 4KITB 1TKDA 5KFJA 4CCHA 4X4QA 4AT8B 4EBCA 3TI0A 5J0PA 4UB5A 4QW9A 4UD5A 3UPSA 1NJWA 4JWNA 2BE3A 1SL0A 5HRLA 3HJ1A 3G6XA 3UQ0A 4WC6A 4KLUA 1ZQOA 4K4IA 2VANA 9ICAA 1OU5A 5KFUA 1ZQNA 2BPCA 4NM2A 4B9NA 5DGAA 4RUCA 5J0UA 3IHQB 4DOCA 5BOLA 3RH5A 2J6SA 7ICUA 1KLNA 3FDSA 2XCAA 2BPGA 1NJYA 2DFLA 3GIKA 2UVVA 3V72A 4JV0A 1ZYQA 5DBAA 5HHIA 4JUZA 4DOBA 3SI8A 4RQ5A 2AU0A 4F8RA 2IA6A 4R63A 3UXPA 4DQRA 3T5JA 5CP2A 3M9MB 9ICPA 4EZ6A 1XU4A 1ZQIA 1T4GA 3Q8PB 1ZQJA 2P6UA 1Q79A 5IIJA 4FS2A 4FO6A 2BCSA 4RUAA 4EBKA 4KLJA 3OGUA 5DDMA 2IHMA 3WFRE 3GV8B 1C7YA 1ZQCA 5HC9A 4ECWA 2A1JB 3THVA 3H3AA 3RB6A 4M47A 1U9LA 1Z3EB 4ECQA 1SZPA 2BGWA 4DQIA 4KLLA 1TK8A 2ALZA 2DR7A 4MFCA 2DPJA 4DL7A 2BQ3A 3PR5B 1BPYA 2RDJA 3C2KA 4RQ1A 5KFLA 4PGQA 4IRDA 1R8CA 3H7IA 4F50A 5D4BA 4GXKA 1MSWD 2BR0A 4RQ0A 4TQRA 3Q8SB 3M8SA 4O3QA 1NK7A 2H5XA 3AUOA 2C28A 2HHQA 5KFQA 3WFOA 4NLZA 3MGHA 4AT9A 3RJGA 4QZDA 3M8RA 3QEAZ 2ATLA 1QTMA 2VA3A 4UAZA 2OWOA 4M04A 4KLDA 2NRTA 5J2IA 4UBBA 3ETLA 5KFAA 4KLEA 4M6WA 4UB4A 1UEVA 3NYBA 4YVZA 4AT7A 3C66A 2ZHAA 1VFGA 3JPQA 1HUZA 1BVSA 2XO7A 3ORYA 5J2AA 3PVXA 4ECVA 4QZFA 3PW0A 2FLNA 4FH3A 1MQ3A 4ED7A 7ICJA 4FHVA 4F2RA 1QLNA 7ICPA 2HVIA 4I2CA 1S76D 4KTQA 4DL3A 2JZBB 1RXVA 8ICQA 4J9QA 2M2TA 2Q66A 2AGQA 1BPZA 1MQ2A 4X0BA 5KFVA 1H38A 5KFWA 2ZTDA 2FLPA 3V6HA 2R8KA 5CA7A 4ECZA 3MBYA 1ZQGA 1K1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HX0 A;  1HUO A;  4RQ4 A;  1Z00 A;  4P2H A;  1MC8 A;  4DL5 A;  5KT3 A;  2R8J A;  7ICI A;  2JZB A;  5DQI A;  2PFN A;  1Q78 A;  4TUR A;  2ISO A;  1TFW A;  3HJ4 A;  8ICW A;  1NK5 A;  8ICU A;  8ICL A;  3Q8K A;  4YQW A;  3RBE A;  3MGI A;  2HHV A;  4FHY A;  2Q0Z X;  1D9F A;  3C21 A;  2XGP A;  1QSL A;  3ZD9 A;  5DBC A;  4ELU A;  7ICF A;  1UT8 A;  4FS1 A;  5KFD A;  4RPX A;  1KRP A;  3RTV A;  5KG5 A;  1B43 A;  5DQH A;  3PNC A;  5CHG A;  1JXL A;  8ICZ A;  5BOM A;  4KLQ A;  9ICS A;  1Y88 A;  3HP6 A;  8ICN A;  3LQC B;  7ICT A;  4X4O A;  2DRB A;  1A76 A;  4O3R A;  3GIJ A;  4IQT A;  2Y1J A;  3LWM A;  2ZH5 A;  8ICJ A;  4DFK A;  5KFN A;  4ED6 A;  3PW4 A;  1UA0 A;  1KFD A;  1RYS A;  4ELV A;  1U45 A;  2HHS A;  1MIY A;  4F93 B;  2AQ4 A;  3BQT A;  3KHG A;  2FMP A;  3SV3 A;  3H4D A;  2HW3 A;  5DDY A;  2W9B B;  4R64 A;  3V7J A;  1NOM A;  3T5H A;  4F92 B;  5L1K A;  4ATB A;  4XUS A;  3GIM A;  2W9A A;  4MF2 A;  1R8A A;  5HRH A;  3H38 A;  2Y1I A;  4WC7 A;  2AGP A;  4TUQ A;  1SKW A;  3M9O B;  1V4A A;  4EBJ A;  5CJ7 A;  8ICY A;  8ICI A;  7ICG A;  1JAJ A;  3TFS A;  4RWO A;  3K75 D;  4IRC A;  1BNP A;  1L3T A;  4DL6 A;  5KFO A;  2IHN A;  1DOQ A;  4Z6F A;  4X4P A;  9ICK A;  3ZDD A;  4I2E A;  2ZH8 A;  4PHP A;  3LK9 A;  4NLN A;  2R8H A;  9ICB A;  2MUT A;  3MDA A;  3V6J A;  9ICH A;  3HT3 A;  3Q8L A;  2C2E A;  3BQ1 A;  5HHH A;  1X2I A;  4F5R A;  4B9M A;  4DWI A;  1U4B A;  1DK3 A;  5KG0 A;  1YLQ A;  2DPI A;  3RH6 A;  4M0A A;  5KT4 A;  4QWC A;  5L1I A;  4QW8 A;  4QZG A;  4GXJ A;  9ICW A;  4ATB B;  4RWN A;  4F91 B;  4DQQ A;  3PX4 A;  2BPF A;  1A77 A;  1IM4 A;  2V9W A;  2M2U A;  1D9D A;  2M2V A;  3L9D A;  4RZR A;  4B9V A;  1S77 D;  4BXO A;  4DQS A;  3AQM A;  1L3V A;  3UQ2 A;  2BCR A;  4PHE A;  2BCV A;  4I28 A;  2ZTC A;  4RWP A;  4IQW A;  4F4W A;  4KMU A;  5J2D A;  4WC5 A;  4F5O A;  4MF8 A;  2VA2 A;  9ICN A;  5DB8 A;  1ZQZ A;  5CR0 A;  2JEF A;  2FPM A;  1ZQW A;  4RNM A;  4DS4 A;  4IG8 A;  4WC2 A;  4ECY A;  3UXO A;  5KFR A;  4RPZ A;  2IMW P;  5HRB A;  5HRI A;  2ASL A;  5HRK A;  4KLI A;  1JXE A;  1XWL A;  5C5J A;  3OUY A;  2RFF A;  1NK9 A;  1KFS A;  1X9M A;  9ICQ A;  2B21 A;  1TVA A;  4ED2 A;  4R8U B;  2BCQ A;  4BXO B;  1NO5 A;  5J2F A;  4NM1 A;  1ZQX A;  4ECR A;  4DS5 A;  2UVU A;  4RWQ A;  4C8N A;  4Z6D A;  1ZQM A;  2FMQ A;  1ZQS A;  4QWB A;  2XY5 A;  1JQR A;  5L1J A;  1UT5 A;  3EW9 A;  3MR6 A;  4DF8 A;  4DSL A;  1UEU A;  2ZJ8 A;  4YR0 A;  1KNY A;  4PHD A;  5KG1 A;  4M6W B;  4O0I A;  4DO9 A;  5DB6 A;  3PW5 A;  2ZTE A;  3Q8M A;  4I2F A;  5KT7 A;  1N48 A;  3H39 A;  3MAB A;  4UB3 A;  1IXR A;  2J6T A;  3V7K A;  5J29 A;  4KLM A;  7ICE A;  3PX0 A;  1SL2 A;  4F4X A;  3B0Y A;  4FHX A;  2W9M A;  5KFF A;  4E8F A;  3TFR A;  3HWT A;  2AGO A;  4IQU A;  4QZI A;  3RAX A;  1NK0 A;  4WCW A;  1ZQF A;  1S0M A;  4I2B A;  3GQC A;  4DSF A;  2ID1 A;  5DLG A;  4J9S A;  4JWM A;  4ED3 A;  2I9G A;  4DFP A;  3IM1 A;  1B22 A;  1BPX A;  8ICE A;  3EPI A;  2BHN A;  4DFM A;  1LB2 B;  2V4Q A;  4YMM A;  4E80 A;  2XY7 A;  9ICR A;  3OJU A;  4JV2 A;  5KG3 A;  4EBD A;  4O5C A;  7ICV A;  4GXI A;  5HRG A;  4UD4 A;  4DEZ A;  1R89 A;  3MDC A;  8ICX A;  1TK0 A;  4WC4 A;  4RQ2 A;  1DGS A;  4F4Y A;  4M9N A;  4O9M A;  4KLH A;  3SV4 A;  8ICG A;  4KLS A;  2XC9 A;  3AQL A;  1V9P A;  3H8J A;  4UB1 A;  2HHT A;  4EYH B;  5KFE A;  8ICT A;  3TAQ A;  9ICF A;  2ZUB A;  5IIO A;  2BKE A;  5EWG A;  4FHW A;  4E0D A;  1S0N A;  3WFP A;  4X4S A;  3KHR A;  1T8E A;  1WOT A;  2ZH4 A;  4ECU A;  5F9N A;  5J0O A;  1ZQP A;  1ZQY A;  4M2Y A;  8ICB A;  3HIY A;  2R8G A;  3E2E A;  4F5Q A;  4Q8F A;  7ICK A;  4KN7 A;  3TQ1 A;  2PI4 A;  4I27 A;  5DED A;  1ZQK A;  4YD2 A;  3EZ5 A;  4F3O A;  4ED1 A;  4K4H A;  2JEI A;  1ZQQ A;  4DF4 A;  5HRD A;  4YXM A;  3OHA A;  5DKW A;  3ISD A;  1PZN A;  4J9P A;  2ZUC A;  3BQ0 A;  4G3I A;  8ICA A;  2M9N A;  3UXN A;  4XA5 A;  3PMN A;  3ISC A;  5EOZ A;  3SYZ A;  2XCP A;  5DG9 A;  5D49 A;  1TFR A;  3MR5 A;  2AJQ A;  2C22 A;  4J9O A;  4RT2 A;  4F4Z A;  4P4O A;  4WBZ A;  2KZM A;  1D8Y A;  3RB3 A;  5IIK A;  8ICO A;  4XQ7 A;  2ZH9 A;  3NTU A;  4M9L A;  4NKU A;  1KSP A;  5HMM A;  1Z00 B;  4QZ8 A;  4FBU A;  3EWA A;  1XSL A;  4YMN A;  1TAQ A;  4B9L A;  4DOA A;  5DGB A;  1U47 A;  4QZB A;  2KZZ A;  3RJF A;  1KTQ A;  4EBE A;  4LZG A;  5J2B A;  2DR9 A;  2ZUD A;  4KLF A;  3JPT A;  4YR2 A;  3GDX A;  2KP7 A;  4I2D A;  1TV9 A;  1JIH A;  2R8I A;  1XSP A;  4R66 A;  2ZH6 A;  2PI5 A;  4LVS A;  7ICQ A;  2KN7 A;  4F2S A;  2FPL A;  4PGX A;  1RXW A;  1NK6 A;  1KFT A;  2W9C A;  2NRK A;  5KG4 A;  3OV7 A;  5DB7 A;  2NRX A;  4C8K A;  2DR8 A;  5KFB A;  4I29 A;  4I2H A;  5KT5 A;  4RQ6 A;  1T7P A;  4ELT A;  4KLG A;  3C18 A;  1F5A A;  4DSJ A;  3OHB A;  2KFN A;  4QZ9 A;  3N97 B;  4DLG A;  4F5N A;  1COO A;  5CWR A;  1NJZ A;  1JX4 A;  1ZQH A;  3JPR A;  3RBD A;  2V4R A;  4EZ9 A;  4X4N A;  5KFS A;  4JV1 A;  5F9L A;  1QSY A;  3G6Y A;  3RJK A;  2FLL A;  3OVA A;  1TFY A;  5KTQ A;  4J9N A;  1L3U A;  2JEG A;  4NXZ A;  2KZ3 A;  5IIM A;  3FYH A;  3QEB Z;  1NKC A;  1HJP A;  5J2J A;  1X9S A;  5KFH A;  1SKS A;  3ZDB A;  4M5D A;  4ED8 A;  4AT9 B;  1BPE A;  2DVI A;  1KEJ A;  4DLE A;  9ICT A;  2A1J A;  5J2G A;  1BGX T;  4XRH A;  3QZ8 A;  5HML A;  3PV8 A;  5L1L A;  1U49 A;  4BWJ A;  1RYR A;  1NZP A;  4P4M A;  4PPX A;  2ZH7 A;  3OVB A;  3PW7 A;  3OSP A;  1CUK A;  1XC9 A;  3ZDC A;  3C2L A;  2ASD A;  2UVR A;  4NLK A;  2O5A A;  3GFK B;  1JN3 A;  5DEC A;  3HPO A;  2DR5 A;  3JPP A;  4UAW A;  5IIL A;  3G6V A;  8ICR A;  5KFI A;  4RQ8 A;  1ZQA A;  5JUM A;  1BNO A;  5DG8 A;  3BQ2 A;  3M9N B;  1S0V A;  7ICR A;  4I2I A;  3AQK A;  4M9G A;  8ICV A;  4C8M A;  3AU2 A;  5J2C A;  3H40 A;  4MEX A;  4J9L A;  1JMS A;  1RPL A;  5KT2 A;  4YD1 A;  2HHX A;  4BDP A;  4YP3 A;  4HYK A;  3RJJ A;  5DLF A;  1NJX A;  5KFC A;  2C2R A;  1EXN A;  7ICS A;  4X4T A;  4J9M A;  5J2H A;  5J0Y A;  4DFJ A;  4PGY A;  2GWS A;  5KFY A;  4O3O A;  5J2E A;  4F5P A;  8ICK A;  1UA1 A;  4RQ3 A;  3V6K A;  2ZH1 A;  2IBK A;  4C8O A;  4KN4 A;  2KTQ A;  4I2J A;  4RQ7 A;  2DRA A;  2RDI A;  2MUT B;  4EP7 A;  2ASJ A;  3C1Z A;  1TK5 A;  1NKB A;  9ICO A;  3C23 A;  2KFZ A;  4E7X A;  4X0A A;  3PW2 A;  4S3N A;  1XS9 D;  1WCN A;  5KFX A;  4QZH A;  3N4M B;  5III A;  4NKT A;  1WCL A;  4YR3 A;  1BPB A;  5HNK A;  4YG2 A;  3MFH A;  3ISB A;  3GV5 B;  4ZH4 A;  2I1Q A;  2ZJA A;  1S9F A;  5D46 A;  1X9W A;  2NRZ A;  1S10 A;  4DQP A;  4DSI A;  5KFM A;  4Q8E A;  3TAR A;  3H4B A;  5J0W A;  5KG2 A;  4UAY A;  5KFK A;  1ZQE A;  3T5K A;  2JEJ A;  2ISP A;  4R65 A;  2HVH A;  8ICF A;  4DSK A;  2WTF A;  4QZC A;  2BQU A;  3QZ7 A;  2UVW A;  7ICM A;  4UQG A;  4J9R A;  3H8W A;  5J0X A;  4MFF A;  2HHU A;  2ZH3 A;  4MFA A;  4B9T A;  3PR4 A;  4ECT A;  4O5E A;  2HHW A;  4AT7 B;  1MIW A;  4M9H A;  3RRG A;  5DG7 A;  5DQG A;  2ZJ5 A;  3HW8 A;  2W8L A;  1SKR A;  4UBC A;  4PHA A;  2BDP A;  1NK4 A;  4RT3 A;  4K4G A;  5HR9 A;  2XGQ A;  3OVS A;  3WFQ E;  2BQR A;  2NRW A;  4X5V A;  5HRF A;  4X4U A;  1ZQT A;  3AU6 A;  3KHH A;  4IRK A;  3UPQ A;  2NRV A;  3V7L A;  1LV5 A;  1L5U A;  8ICH A;  3EYZ A;  4Q45 A;  4EEY A;  4QWA A;  5CB1 A;  5J0R A;  3PO4 A;  1U48 A;  3SZ2 A;  9ICX A;  4LZD A;  1PX5 A;  3K4G A;  4O5K A;  4O3S A;  2PFO A;  5KFP A;  1ARO P;  2M2W A;  2O1P A;  3C1Y A;  3ZDA A;  1ZJM A;  3KTQ A;  2FMS A;  4WC3 A;  3TAN A;  4YN4 A;  9ICL A;  5KT6 A;  3RJH A;  1S97 A;  1BPD A;  4RNN A;  5KG6 A;  3RAQ A;  5HRE A;  4X4V A;  2MAX A;  1K1S A;  3BDP A;  2PFP A;  4B9U A;  4M9J A;  2F1I A;  4WC0 A;  4DSE A;  4JK1 A;  1NK8 A;  1ZQU A;  5J0T A;  2XY6 A;  2P6R A;  4NLG A;  4QZA A;  4XQ8 A;  4RNO A;  5HP4 A;  2BCU A;  4DL4 A;  5DBB A;  8ICC A;  4KLO A;  1ZQL A;  3GII A;  5L9X A;  9ICV A;  2P66 A;  4TUP A;  3MR3 A;  3OSN A;  3JPN A;  9ICE A;  4O3P A;  3JZ0 A;  5KFG A;  1S0O A;  3H8S A;  3LDA A;  5J2K A;  3RR8 A;  1XSN A;  4IR1 A;  2W9B A;  4BGD A;  4GC6 A;  2FPK A;  7ICN A;  1VJ7 A;  4QWD A;  2ZH2 A;  5J0Q A;  3Q8Q B;  1NKE A;  4IQV A;  3T3F A;  4QZE A;  3WFS C;  4R8U A;  4TUS A;  4GC7 A;  4C8L A;  4I2G A;  4RPY A;  3C5G A;  4NY8 A;  3T5L A;  4J9K A;  2J6U A;  8ICS A;  3GV7 B;  4PH5 A;  2PFQ A;  5J0S A;  3MFI A;  7ICO A;  9ICJ A;  3AQN A;  3OJS A;  3H37 A;  2VA8 A;  3EPG A;  4YFK A;  1D8L A;  4P4P A;  2F1H A;  3RJI A;  8ICM A;  1ZQB A;  5EWF A;  5KG7 A;  3NGD A;  7ICH A;  2HHP A;  1DK2 A;  3PX6 A;  2AQ0 A;  4IR9 A;  4AT8 A;  3ZD8 A;  4ECX A;  1ZQD A;  5KFT A;  9ICC A;  2LYH A;  4Q43 A;  9ICM A;  3Q8R B;  2C2D A;  4F4K A;  3RJE A;  4B9S A;  1ZQR A;  3ZDE A;  5DB9 A;  4YXJ A;  3QE9 Y;  3RB0 A;  1SL1 A;  1CEZ A;  2W9C B;  3KHL A;  9ICG A;  1KDH A;  4RU9 A;  3TAP A;  2ZHB A;  4KLT A;  1ZJN A;  4FBT A;  1RZT A;  4EYI B;  4Z6C A;  3BJY A;  4DL2 A;  3RH4 A;  4QWE A;  1ZQV A;  4MEY A;  5IIN A;  4X4R A;  3LWL A;  2PBE A;  5BPC A;  3JPO A;  4FH5 A;  1ZET A;  1TAU A;  1T3N A;  2W8K A;  5F2V O;  4ED0 A;  4YMO A;  4Q44 A;  1FA0 A;  8ICP A;  9ICI A;  2PXI A;  1R8B A;  4FHP A;  4WC1 A;  3B0X A;  5TZV A;  4WBY A;  3RB4 A;  4UB2 A;  1MIV A;  3C2M A;  4BWM A;  4ECS A;  1L3S A;  4LT6 A;  3JPS A;  7ICL A;  4YCX A;  3MR2 A;  2F1J A;  4GLX A;  4TQS A;  3PML A;  3RR7 A;  1UET A;  3PY8 A;  3JYY A;  3RRH A;  3OUY B;  1QSS A;  1N56 A;  4I2A A;  9ICU A;  1XO1 A;  5KFZ A;  4O3N A;  4Z6E A;  3GIL A;  3C5F A;  5EWE A;  3PO5 A;  4KIT B;  1TKD A;  5KFJ A;  4CCH A;  4X4Q A;  4AT8 B;  4EBC A;  3TI0 A;  5J0P A;  4UB5 A;  4QW9 A;  4UD5 A;  3UPS A;  1NJW A;  4JWN A;  2BE3 A;  1SL0 A;  5HRL A;  3HJ1 A;  3G6X A;  3UQ0 A;  4WC6 A;  4KLU A;  1ZQO A;  4K4I A;  2VAN A;  9ICA A;  1OU5 A;  5KFU A;  1ZQN A;  2BPC A;  4NM2 A;  4B9N A;  5DGA A;  4RUC A;  5J0U A;  3IHQ B;  4DOC A;  5BOL A;  3RH5 A;  2J6S A;  7ICU A;  1KLN A;  3FDS A;  2XCA A;  2BPG A;  1NJY A;  2DFL A;  3GIK A;  2UVV A;  3V72 A;  4JV0 A;  1ZYQ A;  5DBA A;  5HHI A;  4JUZ A;  4DOB A;  3SI8 A;  4RQ5 A;  2AU0 A;  4F8R A;  2IA6 A;  4R63 A;  3UXP A;  4DQR A;  3T5J A;  5CP2 A;  3M9M B;  9ICP A;  4EZ6 A;  1XU4 A;  1ZQI A;  1T4G A;  3Q8P B;  1ZQJ A;  2P6U A;  1Q79 A;  5IIJ A;  4FS2 A;  4FO6 A;  2BCS A;  4RUA A;  4EBK A;  4KLJ A;  3OGU A;  5DDM A;  2IHM A;  3WFR E;  3GV8 B;  1C7Y A;  1ZQC A;  5HC9 A;  4ECW A;  2A1J B;  3THV A;  3H3A A;  3RB6 A;  4M47 A;  1U9L A;  1Z3E B;  4ECQ A;  1SZP A;  2BGW A;  4DQI A;  4KLL A;  1TK8 A;  2ALZ A;  2DR7 A;  4MFC A;  2DPJ A;  4DL7 A;  2BQ3 A;  3PR5 B;  1BPY A;  2RDJ A;  3C2K A;  4RQ1 A;  5KFL A;  4PGQ A;  4IRD A;  1R8C A;  3H7I A;  4F50 A;  5D4B A;  4GXK A;  1MSW D;  2BR0 A;  4RQ0 A;  4TQR A;  3Q8S B;  3M8S A;  4O3Q A;  1NK7 A;  2H5X A;  3AUO A;  2C28 A;  2HHQ A;  5KFQ A;  3WFO A;  4NLZ A;  3MGH A;  4AT9 A;  3RJG A;  4QZD A;  3M8R A;  3QEA Z;  2ATL A;  1QTM A;  2VA3 A;  4UAZ A;  2OWO A;  4M04 A;  4KLD A;  2NRT A;  5J2I A;  4UBB A;  3ETL A;  5KFA A;  4KLE A;  4M6W A;  4UB4 A;  1UEV A;  3NYB A;  4YVZ A;  4AT7 A;  3C66 A;  2ZHA A;  1VFG A;  3JPQ A;  1HUZ A;  1BVS A;  2XO7 A;  3ORY A;  5J2A A;  3PVX A;  4ECV A;  4QZF A;  3PW0 A;  2FLN A;  4FH3 A;  1MQ3 A;  4ED7 A;  7ICJ A;  4FHV A;  4F2R A;  1QLN A;  7ICP A;  2HVI A;  4I2C A;  1S76 D;  4KTQ A;  4DL3 A;  2JZB B;  1RXV A;  8ICQ A;  4J9Q A;  2M2T A;  2Q66 A;  2AGQ A;  1BPZ A;  1MQ2 A;  4X0B A;  5KFV A;  1H38 A;  5KFW A;  2ZTD A;  2FLP A;  3V6H A;  2R8K A;  5CA7 A;  4ECZ A;  3MBY A;  1ZQG A;  1K1Q A; 
#chains in the Genus database with same CATH topology
 1MC8 A;  2R8J A;  3TKA A;  4TUR A;  2ISO A;  8ICW A;  3N7S C;  2Q0Z X;  1D9F A;  3C21 A;  1QSL A;  3ZD9 A;  4ELU A;  1UT8 A;  5KG5 A;  5CHG A;  1JXL A;  4C7Y A;  1RDF A;  2HMX A;  3HP6 A;  4X4O A;  4O3R A;  2Y1J A;  2ZXI A;  1UA0 A;  1KFD A;  3BQT A;  1NOM A;  4CDG A;  2FJ6 A;  2W9A A;  2AXT U;  1V4A A;  4EBJ A;  4Y2V A;  2KNJ A;  5CJ7 A;  8ICY A;  1JAJ A;  5K4L A;  3TFS A;  4RWO A;  1QQ7 A;  4IRC A;  5AKZ A;  4Z6F A;  4X4P A;  9ICK A;  2ZH8 A;  3MDA A;  2C2E A;  5D61 A;  5HHH A;  1X2I A;  4F5R A;  2IHO A;  4ATB B;  9ICW A;  4F91 B;  1LVH A;  2V9W A;  1A77 A;  4PL2 A;  1D9D A;  1ZOL A;  2KV2 A;  2M2V A;  3L9D A;  4B9V A;  1S77 D;  4BXO A;  4DQS A;  3AQM A;  2BCR A;  4PHE A;  5KAI U;  4KMU A;  5J2D A;  4UAS A;  3BZC A;  2JEF A;  5AK4 A;  5KFR A;  5HRK A;  2ASL A;  4KLI A;  1XWL A;  2B21 A;  1TVA A;  4BXO B;  1JI7 A;  2UVU A;  2WAQ C;  3BS5 B;  1ZQS A;  1JQR A;  4YR0 A;  2Z7J A;  4JB3 A;  5KT7 A;  1IXR A;  2HDO A;  7ICE A;  2JR5 A;  3F53 A;  4FHX A;  5KFF A;  1V97 A;  4WCW A;  4I2B A;  4DSF A;  4J9S A;  5GTH U;  3IM1 A;  3EPI A;  4YMM A;  2WFA A;  4GXI A;  2OEH A;  4FZM A;  4DEZ A;  1R89 A;  4O9M A;  4KLH A;  3WK5 A;  1SV0 C;  8ICG A;  4KLS A;  2XC9 A;  1V9P A;  2E8N A;  5KFE A;  5EWG A;  2KEY A;  4PZO A;  1NZB A;  1S0N A;  3KHR A;  1T8E A;  1ZQP A;  3WU2 U;  5ALK A;  4Q8F A;  4KN7 A;  4I27 A;  3EZ5 A;  4ED1 A;  3OHA A;  2KSO B;  5DKW A;  2ZUC A;  5D49 A;  1TFR A;  5B3Q A;  8ICO A;  2ZH9 A;  5IIK A;  1YT3 A;  5ALE A;  4M9L A;  5HMM A;  4QZ8 A;  5AM4 A;  4FZL A;  5DGB A;  2XID A;  4YR2 A;  4R66 A;  4F71 A;  4LVS A;  7ICQ A;  5AKY A;  2NRK A;  2QB0 B;  3OV7 A;  5DB7 A;  2DR8 A;  4LEZ A;  4DSJ A;  2KFN A;  3N97 B;  3KOO A;  1Z4N A;  5CWR A;  5AI5 A;  1N5W A;  3G6Y A;  4NWI A;  3KKA C;  4J9N A;  2E1F A;  4NXZ A;  5IIM A;  1X9S A;  1KBU A;  4ED8 A;  4AT9 B;  1BPE A;  3D2N A;  2NYV A;  4DLE A;  1OUQ A;  1L7M A;  1CUK A;  3BQ7 A;  2UVR A;  3GFK B;  1JN3 A;  3JPP A;  4UAW A;  5IIL A;  3G6V A;  2YY6 A;  4Y2Y A;  1IIP A;  1CRX A;  1CI4 A;  3BQ2 A;  7ICR A;  4IS7 A;  4C8M A;  5J2C A;  4J9L A;  5KT2 A;  4OAF A;  2HN2 A;  4HYK A;  1NJX A;  1EXN A;  3IG8 A;  4C7Z A;  5J2E A;  4F5P A;  4GFJ A;  2RDI A;  2MUT B;  4GIB A;  2ASJ A;  2GAF D;  4EP7 A;  3KFU F;  2HI0 A;  2KFZ A;  4E7X A;  4K96 A;  2K8A A;  4QZH A;  3N7R C;  5III A;  3N4M B;  1WCL A;  2F3N A;  4YR3 A;  5HNK A;  3M1Y A;  4IC9 A;  1BPZ A;  4ZH4 A;  4DQP A;  3LVW A;  4A8E A;  1S10 A;  3HKZ F;  2W11 A;  2HVH A;  3QZ7 A;  2UVW A;  4UQG A;  2P35 A;  2MRL A;  3H8W A;  1ZD2 P;  4B9T A;  4ECT A;  3PSI A;  3RRG A;  5DG7 A;  4U6P A;  2DQN B;  1X6I A;  4PHA A;  2JH7 A;  3ER9 B;  5AM2 A;  3V7L A;  1VLB A;  1Q3U A;  1WWV A;  3SZ2 A;  3O0F A;  1PX5 A;  3HJE A;  2WF9 A;  2PFO A;  3I76 A;  4RNN A;  3RAQ A;  5EE1 A;  2KG5 A;  2MAX A;  5EE3 A;  2PFP A;  4B9U A;  4M9J A;  2A19 A;  4NV0 A;  2P6R A;  1UCV A;  5B66 U;  4EEL A;  4RNO A;  1A0P A;  2MU2 A;  8ICC A;  1ZQL A;  3ALR A;  4NXT A;  1SIJ A;  3B9J A;  1S0O A;  1KNY A;  2N1R A;  4QZE A;  4TUS A;  4RPY A;  3U26 A;  2ZXH A;  1NI3 A;  4PH5 A;  3SAH A;  3MFI A;  5AI9 A;  1LKY B;  2VA8 A;  2GLE A;  3RJI A;  4YFK A;  8ICM A;  2F1H A;  4J03 A;  2HHP A;  1WYG A;  3PX6 A;  3F2C A;  5KFT A;  9ICC A;  2BBH A;  2LYH A;  5AM1 A;  5JRT A;  4F4K A;  3RJE A;  4B9S A;  1ZQR A;  1SL1 A;  4YXJ A;  1PVQ A;  1CEZ A;  5J8Y A;  1KDH A;  1JAL A;  4KLT A;  1B0X A;  3DDH A;  1N61 A;  1J2N A;  4DL2 A;  3BJY A;  3RH4 A;  4MEY A;  2RRD A;  5BPC A;  4FH5 A;  3F5A A;  4Q44 A;  1FA0 A;  4FHP A;  1ZQ1 C;  2PXI A;  3TAC B;  4LT6 A;  3GU3 A;  3AQF A;  4YCX A;  2ZIU A;  3RR7 A;  1N56 A;  1XNS A;  5KFZ A;  4O3N A;  3GIL A;  4KIT B;  5KFJ A;  4AT8 B;  4QW9 A;  3UPS A;  3NRZ A;  2W54 A;  1OW5 A;  2QAR B;  1OU5 A;  5ALP A;  4RUC A;  5J0U A;  4Y2Q A;  3IHQ B;  2HOQ A;  4HAI A;  1NJY A;  3R9K A;  1S5L U;  1Z4O A;  5DBA A;  4RQ5 A;  4Y2T A;  2AU0 A;  2IA6 A;  2MA1 A;  3M9M B;  4EZ6 A;  1ZQI A;  2P6U A;  5IIJ A;  2BCS A;  5EE0 A;  3WFR E;  1C7Y A;  1X6J A;  2EDU A;  1ZQC A;  4CGZ A;  4ECW A;  3THV A;  1Z3E B;  1O08 A;  2L5Y A;  1TK8 A;  5AI0 A;  2DR7 A;  3PR5 B;  1BPY A;  3C2K A;  5ALW A;  5KFL A;  4PGQ A;  5D4B A;  4GXK A;  3Q8S B;  4RQM A;  3F5E A;  1OXJ A;  3J81 j;  3H8M A;  2C28 A;  4NLZ A;  2LBO A;  4AT9 A;  3QEA Z;  2ATL A;  2YB4 A;  5J2I A;  2G09 A;  4UBB A;  4EV6 A;  4KLE A;  4JLZ A;  4UB4 A;  4CE6 A;  3JPQ A;  4WOY A;  4PL1 A;  4ECV A;  2JGA A;  2ZG6 A;  4QZF A;  1SV0 A;  3BZK A;  4I0U A;  7ICJ A;  4F2R A;  2QLT A;  4I2C A;  1S76 D;  2JZB B;  8ICQ A;  4O69 A;  1MQ2 A;  4USA A;  3RF9 A;  1H38 A;  2ZTD A;  5CA7 A;  1ZQG A;  1L7O A;  4DL5 A;  5KT3 A;  1Q78 A;  4Y2U A;  2W04 A;  8ICU A;  4AYB F;  3DV9 A;  4YQW A;  5ALU A;  4OJO A;  2CPR A;  2HHV A;  5DBC A;  7ICF A;  1KRP A;  4RPX A;  5DQH A;  3PNC A;  1PK3 A;  8ICZ A;  4KLQ A;  8ICN A;  2DRB A;  1A76 A;  3GIJ A;  4IQT A;  2ZH5 A;  8ICJ A;  2QB0 A;  4F93 B;  2AQ4 A;  3SV3 A;  3H4D A;  1SB3 C;  5DDY A;  2W9B B;  3V7J A;  4ATB A;  4BUG A;  3GIM A;  2K60 A;  5HRH A;  2Y1I A;  2GA9 D;  1SKW A;  3M9O B;  2ZIX A;  8ICI A;  2O6K A;  3K75 D;  4WH5 A;  1BNP A;  1L3T A;  4DL6 A;  5KNI A;  4PHP A;  2KKP A;  1VJ5 A;  2DKX A;  3WK4 A;  9ICH A;  1DK3 A;  4WJ3 B;  1YLQ A;  5KG0 A;  4K98 A;  4M0A A;  3LYS A;  3SMV A;  2H3I A;  4GXJ A;  1UHU A;  3PX4 A;  2BPF A;  2QB1 A;  5ALV A;  1XO0 A;  2W3R A;  1PK1 A;  1L3V A;  3NVV A;  2ZTC A;  2JXJ A;  3IV6 A;  4F4W A;  4P0P B;  9ICN A;  5CR0 A;  1ZQW A;  5ALG A;  4WC2 A;  5AK5 A;  3UXO A;  4RPZ A;  5HRB A;  2RFF A;  1X9M A;  2K4E A;  1X9X A;  5J2F A;  4NM1 A;  4XJE A;  4ECR A;  4DS5 A;  4Z6D A;  4LJX A;  1ZQM A;  2XY5 A;  5L1J A;  1UT5 A;  4DSL A;  2YML A;  4M6W B;  4DO9 A;  4I2F A;  3MAB A;  4UB3 A;  4CF5 A;  3WKE A;  1SL2 A;  3B0Y A;  1FFV A;  2W9M A;  1KL9 A;  4JMU A;  4E8F A;  3HWT A;  4QZI A;  3RAX A;  2RP5 A;  3GQC A;  4K8V A;  4JWM A;  3AQE A;  1BPX A;  2V4Q A;  2XY7 A;  4O5C A;  3K1R B;  4EBD A;  5HRG A;  4WC4 A;  4RQ2 A;  1DGS A;  3CK6 A;  1N62 A;  1QH9 A;  3AQL A;  2JV3 A;  3NVZ A;  8ICT A;  3M6K A;  3TAQ A;  9ICF A;  2FI1 A;  2EH9 A;  5F9N A;  5J0O A;  8ICB A;  2OCE A;  4F5Q A;  7ICK A;  1QQ5 A;  1ZQQ A;  4DF4 A;  1GO3 F;  5HRD A;  3ISD A;  4J9P A;  8ICA A;  3BQ0 A;  1DXS A;  4C4R A;  4EEK A;  2DBY A;  3ISC A;  4XA5 A;  5DG9 A;  4C4T A;  2C22 A;  5JU5 A;  4F4Z A;  2K4H A;  4P4O A;  2G08 A;  3RB3 A;  3NTU A;  2DWQ A;  3EUB 2;  4NKU A;  1KSP A;  1O03 A;  2I5H A;  1TAQ A;  3HKZ C;  4DOA A;  4QZB A;  3T79 A;  3ED5 A;  1KTQ A;  4LZG A;  5J2B A;  3GDX A;  2IOH A;  2KP7 A;  2CXY A;  4F72 A;  2KN7 A;  2NV3 A;  1RXW A;  1KFT A;  2W9C A;  5KG4 A;  2W43 A;  2FDR A;  3OWG A;  1T7P A;  4ELT A;  4KLG A;  2XI9 A;  3C18 A;  4P0Q A;  4O3M A;  2LM4 A;  1L8L A;  3AM9 A;  4F5N A;  1NJZ A;  4EZ9 A;  3RBD A;  2V4R A;  5F9L A;  2HOF A;  4FZN A;  3OVA A;  1TFY A;  5KTQ A;  1L3U A;  1KQQ A;  1NKC A;  4C0Z A;  5J2J A;  2F8K A;  2HBM A;  3HIL A;  3MCR A;  2DVI A;  5J2G A;  1L7N A;  1U49 A;  2PKE A;  4BWJ A;  1NZP A;  1D8B A;  1PK1 B;  4PPX A;  2ZH7 A;  3PW7 A;  3OSP A;  4NLK A;  3C2L A;  2NO4 A;  2DR5 A;  2YQE A;  2WF5 A;  5JUM A;  3M9N B;  1S0V A;  3AQK A;  8ICV A;  1AQ6 A;  1JRO A;  2B6G A;  2EZZ A;  1JMS A;  2ZIW A;  2D3D A;  2AHO B;  1Q8K A;  2C2R A;  7ICS A;  4OCZ A;  4J9M A;  4X4T A;  5J0Y A;  4DFJ A;  4PGY A;  4AP9 A;  1UA1 A;  2IBK A;  4KN4 A;  4RQ7 A;  2YN4 A;  3UMB A;  9ICO A;  2R18 A;  5ALJ A;  1XS9 D;  1WCN A;  2RLT A;  5KFX A;  4NKT A;  1SGG A;  1BPB A;  3ISB A;  4EX6 A;  4YG2 A;  1S9F A;  2I1Q A;  5D46 A;  2NRZ A;  5KFM A;  2BQU A;  4J9R A;  2LYA A;  4MFF A;  2ZH3 A;  1N5X A;  4O5E A;  2KE7 A;  4M9H A;  2W8L A;  1RQL A;  2K89 A;  4UBC A;  4KM5 A;  2KJ5 A;  4LEV A;  1NK4 A;  4RT3 A;  3WFQ E;  5HR9 A;  2NRW A;  4BJQ A;  3UPQ A;  3E58 A;  1LV5 A;  8ICH A;  4Q45 A;  4EEY A;  2WHE A;  4QWA A;  5CB1 A;  5J0R A;  2KIC A;  2E3T A;  1U48 A;  2Y9T A;  2EAP A;  4O5K A;  2M2W A;  2O1P A;  3ZDA A;  1ZJM A;  3KTQ A;  2FMS A;  4YN4 A;  9ICL A;  1S97 A;  2WF6 A;  5KG6 A;  5AIB A;  4NL9 A;  3BDP A;  4JK1 A;  1ZQU A;  2YMQ A;  4XQ8 A;  2G5I B;  4KLO A;  3GII A;  5KL1 B;  5L9X A;  2P66 A;  4TUP A;  4CNQ A;  3OSN A;  2BZF A;  9ICE A;  5KFG A;  4IR1 A;  1XSN A;  2FPK A;  4IQV A;  3ERC C;  3WFS C;  4R8U A;  5CHE A;  2J6U A;  8ICS A;  3GV7 B;  3AQN A;  3H37 A;  3A0B U;  1ZQB A;  5KG7 A;  2JH1 A;  2WAQ F;  3ZD8 A;  4ECX A;  1ZQD A;  9ICM A;  3Q8R B;  4JLX A;  1HIW A;  4O6A A;  3WKB A;  3KHL A;  4K9A A;  2LPE A;  4RU9 A;  3TAP A;  1L7P A;  1ZJN A;  1RZT A;  1VDV A;  4KX3 A;  1IG6 A;  3ZI4 A;  3QXG A;  1ZQV A;  4X4R A;  3LWL A;  2PBE A;  1ZD5 A;  1ZET A;  2YTU A;  1TAU A;  2W8K A;  5F2V O;  1Z19 A;  4YMO A;  4WC1 A;  9ICI A;  3KD3 A;  3B0X A;  3CYM A;  3RB4 A;  4UB2 A;  1MIV A;  1WUD A;  3JYY A;  4GLX A;  1UET A;  3PY8 A;  3D2S A;  3RRH A;  3OUY B;  1QSS A;  4I2A A;  1XO1 A;  3C5F A;  3PO5 A;  1TKD A;  2F77 X;  3M7D A;  3QNM A;  4UB5 A;  3UQ0 A;  4WC6 A;  5AK6 A;  5E79 U;  5AM3 A;  4DOC A;  5BOL A;  3RH5 A;  3FDS A;  2XCA A;  3GIK A;  5HHI A;  1A6S A;  4DOB A;  4N7R A;  4F8R A;  1MN8 A;  4DQR A;  5CP2 A;  1XU4 A;  1T4G A;  1UPH A;  1ZQJ A;  1PVR A;  4FO6 A;  5DDM A;  2IHM A;  1K5O A;  3H3A A;  4M47 A;  1U9L A;  4DQI A;  2BGW A;  2ALZ A;  4DL7 A;  4RQ1 A;  3H7I A;  1ZD3 A;  1MSW D;  3M8S A;  1NK7 A;  3AUO A;  1J2M A;  4WQK A;  4QZD A;  4Y2S A;  2VA3 A;  4UAZ A;  4KLD A;  2NRT A;  4WQL A;  3QU2 A;  1VFG A;  4YVZ A;  4AT7 A;  2XO7 A;  2PMZ F;  4OD0 A;  3S6J A;  4UAT A;  1MQ3 A;  1YZ6 A;  5HR6 A;  4FHV A;  4EED A;  4K9B A;  3SEN A;  4IL6 U;  7ICP A;  3D6J A;  4KTQ A;  4PZN A;  4J9Q A;  2D6F C;  2Q66 A;  2AGQ A;  2G0A A;  1T94 A;  5KFV A;  2R8K A;  2LYB A;  3WKD A;  5AI4 A;  5ALH A;  3MBY A;  4X4V A;  3HX0 A;  1HUO A;  1Z00 A;  4P2H A;  2JZB A;  5DQI A;  2PFN A;  4O67 A;  4G9B A;  1TFW A;  2K4P A;  5ALF A;  2ESE A;  5AM0 A;  3SQI A;  2EZX A;  3RBE A;  4FHY A;  3MGI A;  3WKC A;  2XGP A;  4FS1 A;  3RTV A;  1B43 A;  2RHF A;  3LQC B;  2JRZ A;  4EEB A;  2YX8 A;  1ZRM A;  4ED6 A;  3PW4 A;  1MIY A;  1U45 A;  2FMP A;  2HW3 A;  3KHG A;  4R64 A;  3T5H A;  3IRU A;  4XUS A;  4MF2 A;  4WC7 A;  3GZF A;  3H38 A;  4TUQ A;  3CW2 C;  3QYP A;  7ICG A;  3PSF A;  1DOQ A;  4OAG A;  3ZDD A;  4I2E A;  4NLN A;  3L4P A;  2R8H A;  3V6J A;  3BQ1 A;  4FO1 A;  4Y2R A;  4DWI A;  2DPI A;  3NRW A;  3RH6 A;  4QW8 A;  2JHD A;  4RWN A;  2BDU A;  1JUD A;  4DQQ A;  4U7C A;  3MC1 A;  2B4V A;  4I28 A;  2BCV A;  1COK A;  4MF8 A;  2VA2 A;  5DB8 A;  2EQY A;  5AKG A;  4DS4 A;  4ECY A;  2KMD A;  1NK9 A;  1KFS A;  9ICQ A;  1N63 A;  4ED2 A;  2E8M A;  1ZQX A;  4RWQ A;  1DGJ A;  2FMQ A;  4QWB A;  4NLC A;  3L3F X;  3EW9 A;  1UEU A;  3PZP A;  2YMM A;  2ZJ8 A;  4PHD A;  4O0I A;  2WB1 C;  3Q8M A;  1N48 A;  3H39 A;  5ALX A;  3V7K A;  3BS5 A;  5J29 A;  4KLM A;  3CNH A;  5KL8 B;  3PX0 A;  2DL0 A;  2VIX A;  4F4X A;  1NK0 A;  4ICA A;  4MHV A;  1ZQF A;  3QUQ A;  5AI6 A;  3PHZ A;  2H3Q A;  2ID1 A;  5DLG A;  4ED3 A;  2I9G A;  1B22 A;  8ICE A;  2BHN A;  4UB8 U;  4DFM A;  3F2D A;  2H3V A;  9ICR A;  3OJU A;  5KG3 A;  3SAG A;  4UD4 A;  2HSZ A;  1ECW A;  8ICX A;  1TK0 A;  2B51 A;  4F4Y A;  1YZ7 A;  4Y2P A;  2KHQ A;  4QJF B;  3H8J A;  1SXE A;  4O68 A;  5GTI U;  1Q3V A;  2BKE A;  3QU9 A;  3WFP A;  1IV8 A;  4C80 A;  2W7O A;  3E2E A;  2Y0S C;  2Y9U A;  2F76 X;  2QKQ A;  2PI4 A;  4CRX A;  5DED A;  1ZQK A;  4YD2 A;  4F3O A;  2MSN A;  1QQ6 A;  1PZN A;  3DEE A;  3SYZ A;  3MR5 A;  4J9O A;  4CF4 A;  4WBZ A;  2KZM A;  1F0M A;  2ES6 A;  1XSL A;  3WKA A;  2G5H B;  3IP4 B;  3PST A;  1U47 A;  2KZZ A;  2W3S A;  2FE9 A;  4FFD A;  2ZUD A;  1PUZ A;  4BX9 C;  3JPT A;  1TV9 A;  2ZH6 A;  1ED1 A;  4P0P A;  5L1M A;  2M0N A;  4F2S A;  4PGX A;  1NK6 A;  1QCK A;  2NRX A;  4C8K A;  5ALT A;  5KFB A;  4I29 A;  5KT5 A;  1F5A A;  4QZ9 A;  4DLG A;  3CRX A;  4JV1 A;  4US8 A;  2KZ3 A;  2VJ5 A;  1HJP A;  1SKS A;  4M5D A;  5KFH A;  2A1J A;  1BGX T;  3AMZ A;  3QZ8 A;  4P4M A;  3IDW A;  3OVB A;  2EAN A;  2ASD A;  5AHX A;  2K8C B;  3WK7 A;  5DEC A;  5CFT A;  8ICR A;  4RQ8 A;  1ZQA A;  1BNO A;  4NL9 C;  4I2I A;  4EEN A;  4M9G A;  3H40 A;  4MEX A;  1NNL A;  1X66 A;  3IN5 A;  2EZY A;  4YP3 A;  1L6N A;  5DLF A;  3QUB A;  2LI6 A;  5J2H A;  2KIV A;  1ZD4 A;  3BS7 A;  3F2B A;  3V6K A;  4C8O A;  2LKY A;  3KKA A;  2ZIV A;  1NKB A;  4EX7 A;  3OPX A;  1WG8 A;  2IUB A;  1FFU A;  3PW2 A;  2GH1 A;  8ICP A;  3GV5 B;  3QU5 A;  3TAR A;  4KMO B;  2CRX A;  4UAY A;  2JEJ A;  1ZQE A;  3T5K A;  8ICF A;  4DSK A;  4QZC A;  7ICM A;  3JCF A;  4NXX A;  2GO7 A;  5J0X A;  2HHU A;  4MFA A;  4OJ6 A;  1MIW A;  3HW8 A;  3AN1 A;  2BDP A;  4K4G A;  3OVS A;  5CFU A;  2KK0 A;  2BQR A;  3SEI A;  4X5V A;  5HRF A;  5JTI A;  4LEW A;  4X4U A;  2K8B B;  5ALR A;  5ALM A;  3AU6 A;  2IOF A;  3KHH A;  3EYZ A;  4QIW C;  4NLB A;  3K4G A;  4O3S A;  4US9 A;  4WC3 A;  3NVW A;  1P7D A;  3TAN A;  5CFS A;  3RJH A;  1BPD A;  2JMG A;  4OJ5 A;  5G5H A;  4WC0 A;  4DSE A;  1NK8 A;  3KBB A;  5J0T A;  2XY6 A;  4QZA A;  2OM6 A;  2BCU A;  1WWU A;  5C0Y A;  1Z1V A;  9ICV A;  3MR3 A;  3JZ0 A;  4O3P A;  3H8S A;  3LDA A;  5J2K A;  3RR8 A;  2HBK A;  2W9B A;  1VJ7 A;  2WF8 A;  1LKY A;  2D8C A;  2ZH2 A;  5T14 A;  3Q8Q B;  3T3F A;  2H3F A;  5AIC A;  5CEH A;  2RQ5 A;  2E8P A;  3C5G A;  4I2G A;  4NY8 A;  3T5L A;  2PFQ A;  5J0S A;  9ICJ A;  3AL0 B;  3I1Y A;  2AH5 A;  3NVY A;  1D8L A;  3TAD A;  3NGD A;  7ICH A;  2AQ0 A;  4AT8 A;  4Y2X A;  1UQV A;  5DB9 A;  9ICG A;  3RB0 A;  2ZHB A;  4EYI B;  3C29 A;  3A0H U;  3JPO A;  1T3N A;  4WBY A;  3C2M A;  4ECS A;  5H2F U;  4TQS A;  3NUQ A;  2KOB A;  3ETR A;  9ICU A;  4X4Q A;  4CCH A;  5AM5 A;  4EBC A;  3TI0 A;  5J0P A;  5HRL A;  3G6X A;  3L5K A;  1J97 A;  3WK9 A;  9ICA A;  5KFU A;  1ZQN A;  3ICX A;  4B9N A;  3N28 A;  5B3P A;  7ICU A;  1KLN A;  2BPG A;  2DFL A;  2UVV A;  3V72 A;  3ONN A;  1ZYQ A;  5J8Y C;  3UXP A;  4PJ0 U;  3Q8P B;  2E8O A;  1Q79 A;  4EBK A;  3SR6 A;  3OGU A;  3GV8 B;  1SWW A;  2A1J B;  3RB6 A;  4ECQ A;  1SZP A;  4LEY A;  2BQ3 A;  3CP8 A;  2RDJ A;  1R8C A;  4UB6 U;  5ALQ A;  2BR0 A;  3WK6 A;  4RQ0 A;  1PVP A;  1SV4 A;  2F2A B;  1QTM A;  2OWO A;  1N60 A;  5KFA A;  5ALI A;  4M6W A;  4K97 A;  5AKE A;  3PVX A;  5J2A A;  3PW0 A;  3K7D A;  4FH3 A;  4NJ8 A;  4Y2J A;  1QLN A;  2ZIU B;  4OJL A;  4DL3 A;  1RXV A;  2M2T A;  5HR7 A;  2LMR A;  5KFW A;  1DRG A;  2FLP A;  3V6H A;  4Q8E A;  1K1Q A;  4RQ4 A;  7ICI A;  2BBJ A;  1C20 A;  3UM9 A;  3HJ4 A;  1NK5 A;  8ICL A;  3Q8K A;  4MKP A;  1FIQ A;  1Z1B A;  2W03 A;  5KFD A;  3LVV A;  5BOM A;  9ICS A;  1Y88 A;  3K1Z A;  7ICT A;  3LWM A;  1JRP A;  4DFK A;  2VJ4 A;  3HRD D;  5KFN A;  2HHS A;  1RYS A;  4ELV A;  2I6X A;  2DF4 B;  4F92 B;  5L1K A;  1R8A A;  2AGP A;  4KB6 A;  2DKZ A;  3SD7 A;  2A3V A;  4UAU A;  5KFO A;  2IHN A;  3LK9 A;  3FAH A;  9ICB A;  2MUT A;  3HT3 A;  3Q8L A;  1T3Q A;  4B9M A;  1U4B A;  4EGW A;  1URJ A;  4UAV A;  5KT4 A;  5G5G A;  4AYB C;  4QWC A;  4QZG A;  5L1I A;  3AEV A;  3NKU A;  1IM4 A;  2M2U A;  4RZR A;  4DCC A;  2W55 A;  3UQ2 A;  1SWV A;  2HOI A;  4RWP A;  4IQW A;  2ZIX B;  4WC5 A;  2XIC A;  5EE9 A;  1F5S A;  4F5O A;  5AK3 A;  1ZQZ A;  2FPM A;  4RNM A;  4IG8 A;  2IMW P;  5HRI A;  2KKV A;  3OUY A;  1JXE A;  5C5J A;  4R8U B;  5ALL A;  2BCQ A;  5ALS A;  4C8N A;  2H3Z A;  5AI8 A;  5TIS U;  2KD1 A;  2EAM A;  3MR6 A;  1KW4 A;  3H0M B;  4DF8 A;  3EF2 A;  4HX0 A;  1HEK A;  5KG1 A;  3PW5 A;  5DB6 A;  2ZTE A;  3NVO A;  2J6T A;  4DFD A;  2KVS A;  2PMZ C;  3TFR A;  4UW9 A;  2AGO A;  4IQU A;  5AKH A;  3UMG A;  3M6Z A;  1S0M A;  4DFP A;  3MGV A;  1LB2 B;  2KJ8 A;  4JV2 A;  7ICV A;  3MDC A;  4M9N A;  3SV4 A;  4RQN A;  4UB1 A;  2HHT A;  4EYH B;  2ZUB A;  5IIO A;  4FHW A;  4E0D A;  4QIW F;  4X4S A;  1WOT A;  2ZH4 A;  4ECU A;  3HIY A;  1ZQY A;  2R8G A;  2LM1 A;  3TQ1 A;  3FM9 A;  4K4H A;  2JEI A;  4YXM A;  5ALO A;  2CN1 A;  3D2Q A;  4G3I A;  2M9N A;  2HBJ A;  3UXN A;  3PMN A;  4M2Y A;  2AJQ A;  5EOZ A;  1NO5 A;  2XCP A;  4RT2 A;  1KN5 A;  2EAO A;  2XVT A;  1V38 A;  1D8Y A;  4XQ7 A;  4KX5 A;  1Z00 B;  4FBU A;  3EWA A;  4YMN A;  4B9L A;  1SZH A;  1ZRN A;  1ZXI A;  3RJF A;  4EBE A;  2DR9 A;  4KLF A;  3VCB A;  4I2D A;  1JIH A;  2R8I A;  1XSP A;  1MA7 A;  2HBL A;  2PI5 A;  4FE3 A;  1L8O A;  2FPL A;  2F44 A;  2DGZ A;  2OYY A;  4I2H A;  4RQ6 A;  3UMC A;  3OHB A;  1RG6 A;  1COO A;  2OHF A;  1JX4 A;  1ZQH A;  3JPR A;  4X4N A;  2DUY A;  5KFS A;  2LHT A;  1QSY A;  3RJK A;  3I28 A;  2FLL A;  3QU7 A;  2JEG A;  4OAH A;  3QEB Z;  3FYH A;  3ZDB A;  1M6Y A;  1KEJ A;  9ICT A;  3PV8 A;  4XRH A;  5HML A;  5L1L A;  1RYR A;  1XC9 A;  3ZDC A;  2O5A A;  1TAM A;  5F3X B;  3HPO A;  5KFI A;  3SAF A;  2A1A A;  5DG8 A;  5AKJ A;  3AU2 A;  1B4F A;  1RPL A;  4YD1 A;  2HHX A;  4BDP A;  3RJJ A;  5KFC A;  2HN1 A;  1RYU A;  2KIW A;  2GWS A;  5KFY A;  4O3O A;  8ICK A;  2ZH1 A;  4RQ3 A;  4NXW A;  2KTQ A;  4I2J A;  2DRA A;  2OXO A;  3C1Z A;  1TK5 A;  3C28 A;  4X0A A;  3C23 A;  2K4I A;  4S3N A;  3WK8 A;  3MFH A;  4C4S A;  3TAD C;  2ZJA A;  1X9W A;  3VC8 A;  4DSI A;  3H4B A;  5J0W A;  5KG2 A;  5KFK A;  2QAR A;  2ISP A;  4R65 A;  4UAR A;  2WTF A;  5ALN A;  3QX7 A;  3QU4 A;  1SXD A;  3PR4 A;  2FCL A;  2HHW A;  4AT7 B;  1X40 A;  3QUT A;  3PSP A;  5DQG A;  1TE2 A;  2ZJ5 A;  1SKR A;  3OTQ A;  2XGQ A;  2Y0S F;  1ZQT A;  4IRK A;  2NRV A;  1L5U A;  2IOF K;  5D63 A;  3PO4 A;  3KZX A;  9ICX A;  4NXU A;  1RM6 C;  1N2X A;  4LZD A;  1FO4 A;  5KFP A;  1ARO P;  3C1Y A;  3ER8 C;  1X42 A;  1GPJ A;  5KT6 A;  5ALD A;  3FC4 A;  5HRE A;  1K1S A;  2KVC A;  5CRX A;  2F1I A;  4NLG A;  2WF7 A;  5HP4 A;  4DL4 A;  5DBB A;  1F44 A;  3JPN A;  2F8L A;  4BGD A;  4GC6 A;  7ICN A;  4QWD A;  5J0Q A;  1NKE A;  3QUC A;  4GC7 A;  4C8L A;  2E5S A;  5AKX A;  4J9K A;  2WB1 F;  2W7P A;  4CF3 A;  7ICO A;  4B6J A;  3OJS A;  3EPG A;  4P4P A;  4ZOH C;  5EWF A;  1DK2 A;  1RQN A;  2ODG A;  3N7P D;  4IR9 A;  4Q43 A;  2C2D A;  3ZDE A;  2E1E A;  3QE9 Y;  3NS1 A;  4OO1 J;  2W9C B;  4P0Q B;  4FBT A;  2YB1 A;  4Z6C A;  4QWE A;  5IIN A;  2ZIV B;  4ED0 A;  1R8B A;  2G06 A;  5JTG A;  5TZV A;  4BWM A;  1L3S A;  3JPS A;  7ICL A;  4E80 A;  3MR2 A;  2F1J A;  3PML A;  4Z6E A;  5B5E U;  5EWE A;  5KAF U;  4UD5 A;  1NJW A;  4JWN A;  2BE3 A;  1SL0 A;  4OAI Z;  5AKL A;  3HJ1 A;  3H0R B;  4NXV A;  4ACO A;  4KLU A;  1ZQO A;  4K4I A;  2VAN A;  2BPC A;  4NM2 A;  3E0F A;  5DGA A;  2J6S A;  2OH2 A;  2G07 A;  2KJ9 A;  4JV0 A;  4OJP A;  3SI8 A;  4JUZ A;  2NO5 A;  4R63 A;  3KZI U;  3T5J A;  3RFA A;  2ZIW B;  9ICP A;  4FS2 A;  1S8O A;  2KHV A;  4RUA A;  4KLJ A;  1KKX A;  5AKK A;  5HC9 A;  5AIA A;  2YMP A;  4KLL A;  2KSO A;  1FEZ A;  4MFC A;  2DPJ A;  4IRD A;  4F50 A;  2Q4T A;  2EWR A;  3NWI A;  4TQR A;  4O3Q A;  2H5X A;  2HHQ A;  5KFQ A;  3WFO A;  1Q46 A;  5A0L A;  3MGH A;  5FP0 A;  3RJG A;  3M8R A;  4M04 A;  5D62 A;  3ETL A;  3H0L B;  1UEV A;  2ZHA A;  4QNL A;  3NYB A;  3C66 A;  2HCF A;  1HUZ A;  4K99 A;  1BVS A;  3ORY A;  3IG5 A;  2FLN A;  5AKI A;  4ED7 A;  2B56 A;  5ALY A;  5ALZ A;  2HVI A;  1V85 A;  4X0B A;  2B0C A;  4ECZ A;  2GOL A;  2VKQ A;  3NAS A; 
#chains in the Genus database with same CATH homology
 3HX0 A;  1HUO A;  4RQ4 A;  1Z00 A;  4P2H A;  1MC8 A;  4DL5 A;  5KT3 A;  2R8J A;  7ICI A;  2JZB A;  5DQI A;  2PFN A;  1Q78 A;  4TUR A;  2ISO A;  1TFW A;  3HJ4 A;  8ICW A;  1NK5 A;  8ICU A;  8ICL A;  3Q8K A;  4YQW A;  3RBE A;  3MGI A;  2HHV A;  4FHY A;  2Q0Z X;  1D9F A;  3C21 A;  2XGP A;  1QSL A;  3ZD9 A;  5DBC A;  4ELU A;  7ICF A;  1UT8 A;  4FS1 A;  5KFD A;  4RPX A;  1KRP A;  3RTV A;  5KG5 A;  1B43 A;  5DQH A;  3PNC A;  5CHG A;  1JXL A;  8ICZ A;  5BOM A;  4KLQ A;  9ICS A;  1Y88 A;  3HP6 A;  8ICN A;  3LQC B;  7ICT A;  4X4O A;  2DRB A;  1A76 A;  4O3R A;  3GIJ A;  4IQT A;  2Y1J A;  3LWM A;  2ZH5 A;  8ICJ A;  4DFK A;  5KFN A;  4ED6 A;  3PW4 A;  1UA0 A;  1KFD A;  1RYS A;  4ELV A;  1U45 A;  2HHS A;  1MIY A;  4F93 B;  2AQ4 A;  3BQT A;  3KHG A;  2FMP A;  3SV3 A;  3H4D A;  2HW3 A;  5DDY A;  2W9B B;  4R64 A;  3V7J A;  1NOM A;  3T5H A;  4F92 B;  5L1K A;  4ATB A;  4XUS A;  3GIM A;  2W9A A;  4MF2 A;  1R8A A;  5HRH A;  3H38 A;  2Y1I A;  4WC7 A;  2AGP A;  4TUQ A;  1SKW A;  3M9O B;  1V4A A;  4EBJ A;  5CJ7 A;  8ICY A;  8ICI A;  7ICG A;  1JAJ A;  3TFS A;  4RWO A;  3K75 D;  4IRC A;  1BNP A;  1L3T A;  4DL6 A;  5KFO A;  2IHN A;  1DOQ A;  4Z6F A;  4X4P A;  9ICK A;  3ZDD A;  4I2E A;  2ZH8 A;  4PHP A;  3LK9 A;  4NLN A;  2R8H A;  9ICB A;  2MUT A;  3MDA A;  3V6J A;  9ICH A;  3HT3 A;  3Q8L A;  2C2E A;  3BQ1 A;  5HHH A;  1X2I A;  4F5R A;  4B9M A;  4DWI A;  1U4B A;  1DK3 A;  5KG0 A;  1YLQ A;  2DPI A;  3RH6 A;  4M0A A;  5KT4 A;  4QWC A;  5L1I A;  4QW8 A;  4QZG A;  4GXJ A;  9ICW A;  4ATB B;  4RWN A;  4F91 B;  4DQQ A;  3PX4 A;  2BPF A;  1A77 A;  1IM4 A;  2V9W A;  2M2U A;  1D9D A;  2M2V A;  3L9D A;  4RZR A;  4B9V A;  1S77 D;  4BXO A;  4DQS A;  3AQM A;  1L3V A;  3UQ2 A;  2BCR A;  4PHE A;  2BCV A;  4I28 A;  2ZTC A;  4RWP A;  4IQW A;  4F4W A;  4KMU A;  5J2D A;  4WC5 A;  4F5O A;  4MF8 A;  2VA2 A;  9ICN A;  5DB8 A;  1ZQZ A;  5CR0 A;  2JEF A;  2FPM A;  1ZQW A;  4RNM A;  4DS4 A;  4IG8 A;  4WC2 A;  4ECY A;  3UXO A;  5KFR A;  4RPZ A;  2IMW P;  5HRB A;  5HRI A;  2ASL A;  5HRK A;  4KLI A;  1JXE A;  1XWL A;  5C5J A;  3OUY A;  2RFF A;  1NK9 A;  1KFS A;  1X9M A;  9ICQ A;  2B21 A;  1TVA A;  4ED2 A;  4R8U B;  2BCQ A;  4BXO B;  1NO5 A;  5J2F A;  4NM1 A;  1ZQX A;  4ECR A;  4DS5 A;  2UVU A;  4RWQ A;  4C8N A;  4Z6D A;  1ZQM A;  2FMQ A;  1ZQS A;  4QWB A;  2XY5 A;  1JQR A;  5L1J A;  1UT5 A;  3EW9 A;  3MR6 A;  4DF8 A;  4DSL A;  1UEU A;  2ZJ8 A;  4YR0 A;  1KNY A;  4PHD A;  5KG1 A;  4M6W B;  4O0I A;  4DO9 A;  5DB6 A;  3PW5 A;  2ZTE A;  3Q8M A;  4I2F A;  5KT7 A;  1N48 A;  3H39 A;  3MAB A;  4UB3 A;  1IXR A;  2J6T A;  3V7K A;  5J29 A;  4KLM A;  7ICE A;  3PX0 A;  1SL2 A;  4F4X A;  3B0Y A;  4FHX A;  2W9M A;  5KFF A;  4E8F A;  3TFR A;  3HWT A;  2AGO A;  4IQU A;  4QZI A;  3RAX A;  1NK0 A;  4WCW A;  1ZQF A;  1S0M A;  4I2B A;  3GQC A;  4DSF A;  2ID1 A;  5DLG A;  4J9S A;  4JWM A;  4ED3 A;  2I9G A;  4DFP A;  3IM1 A;  1B22 A;  1BPX A;  8ICE A;  3EPI A;  2BHN A;  4DFM A;  1LB2 B;  2V4Q A;  4YMM A;  4E80 A;  2XY7 A;  9ICR A;  3OJU A;  4JV2 A;  5KG3 A;  4EBD A;  4O5C A;  7ICV A;  4GXI A;  5HRG A;  4UD4 A;  4DEZ A;  1R89 A;  3MDC A;  8ICX A;  1TK0 A;  4WC4 A;  4RQ2 A;  1DGS A;  4F4Y A;  4M9N A;  4O9M A;  4KLH A;  3SV4 A;  8ICG A;  4KLS A;  2XC9 A;  3AQL A;  1V9P A;  3H8J A;  4UB1 A;  2HHT A;  4EYH B;  5KFE A;  8ICT A;  3TAQ A;  9ICF A;  2ZUB A;  5IIO A;  2BKE A;  5EWG A;  4FHW A;  4E0D A;  1S0N A;  3WFP A;  4X4S A;  3KHR A;  1T8E A;  1WOT A;  2ZH4 A;  4ECU A;  5F9N A;  5J0O A;  1ZQP A;  1ZQY A;  4M2Y A;  8ICB A;  3HIY A;  2R8G A;  3E2E A;  4F5Q A;  4Q8F A;  7ICK A;  4KN7 A;  3TQ1 A;  2PI4 A;  4I27 A;  5DED A;  1ZQK A;  4YD2 A;  3EZ5 A;  4F3O A;  4ED1 A;  4K4H A;  2JEI A;  1ZQQ A;  4DF4 A;  5HRD A;  4YXM A;  3OHA A;  5DKW A;  3ISD A;  1PZN A;  4J9P A;  2ZUC A;  3BQ0 A;  4G3I A;  8ICA A;  2M9N A;  3UXN A;  4XA5 A;  3PMN A;  3ISC A;  5EOZ A;  3SYZ A;  2XCP A;  5DG9 A;  5D49 A;  1TFR A;  3MR5 A;  2AJQ A;  2C22 A;  4J9O A;  4RT2 A;  4F4Z A;  4P4O A;  4WBZ A;  2KZM A;  1D8Y A;  3RB3 A;  5IIK A;  8ICO A;  4XQ7 A;  2ZH9 A;  3NTU A;  4M9L A;  4NKU A;  1KSP A;  5HMM A;  1Z00 B;  4QZ8 A;  4FBU A;  3EWA A;  1XSL A;  4YMN A;  1TAQ A;  4B9L A;  4DOA A;  5DGB A;  1U47 A;  4QZB A;  2KZZ A;  3RJF A;  1KTQ A;  4EBE A;  4LZG A;  5J2B A;  2DR9 A;  2ZUD A;  4KLF A;  3JPT A;  4YR2 A;  3GDX A;  2KP7 A;  4I2D A;  1TV9 A;  1JIH A;  2R8I A;  1XSP A;  4R66 A;  2ZH6 A;  2PI5 A;  4LVS A;  7ICQ A;  2KN7 A;  4F2S A;  2FPL A;  4PGX A;  1RXW A;  1NK6 A;  1KFT A;  2W9C A;  2NRK A;  5KG4 A;  3OV7 A;  5DB7 A;  2NRX A;  4C8K A;  2DR8 A;  5KFB A;  4I29 A;  4I2H A;  5KT5 A;  4RQ6 A;  1T7P A;  4ELT A;  4KLG A;  3C18 A;  1F5A A;  4DSJ A;  3OHB A;  2KFN A;  4QZ9 A;  3N97 B;  4DLG A;  4F5N A;  1COO A;  5CWR A;  1NJZ A;  1JX4 A;  1ZQH A;  3JPR A;  3RBD A;  2V4R A;  4EZ9 A;  4X4N A;  5KFS A;  4JV1 A;  5F9L A;  1QSY A;  3G6Y A;  3RJK A;  2FLL A;  3OVA A;  1TFY A;  5KTQ A;  4J9N A;  1L3U A;  2JEG A;  4NXZ A;  2KZ3 A;  5IIM A;  3FYH A;  3QEB Z;  1NKC A;  1HJP A;  5J2J A;  1X9S A;  5KFH A;  1SKS A;  3ZDB A;  4M5D A;  4ED8 A;  4AT9 B;  1BPE A;  2DVI A;  1KEJ A;  4DLE A;  9ICT A;  2A1J A;  5J2G A;  1BGX T;  4XRH A;  3QZ8 A;  5HML A;  3PV8 A;  5L1L A;  1U49 A;  4BWJ A;  1RYR A;  1NZP A;  4P4M A;  4PPX A;  2ZH7 A;  3OVB A;  3PW7 A;  3OSP A;  1CUK A;  1XC9 A;  3ZDC A;  3C2L A;  2ASD A;  2UVR A;  4NLK A;  2O5A A;  3GFK B;  1JN3 A;  5DEC A;  3HPO A;  2DR5 A;  3JPP A;  4UAW A;  5IIL A;  3G6V A;  8ICR A;  5KFI A;  4RQ8 A;  1ZQA A;  5JUM A;  1BNO A;  5DG8 A;  3BQ2 A;  3M9N B;  1S0V A;  7ICR A;  4I2I A;  3AQK A;  4M9G A;  8ICV A;  4C8M A;  3AU2 A;  5J2C A;  3H40 A;  4MEX A;  4J9L A;  1JMS A;  1RPL A;  5KT2 A;  4YD1 A;  2HHX A;  4BDP A;  4YP3 A;  4HYK A;  3RJJ A;  5DLF A;  1NJX A;  5KFC A;  2C2R A;  1EXN A;  7ICS A;  4X4T A;  4J9M A;  5J2H A;  5J0Y A;  4DFJ A;  4PGY A;  2GWS A;  5KFY A;  4O3O A;  5J2E A;  4F5P A;  8ICK A;  1UA1 A;  4RQ3 A;  3V6K A;  2ZH1 A;  2IBK A;  4C8O A;  4KN4 A;  2KTQ A;  4I2J A;  4RQ7 A;  2DRA A;  2RDI A;  2MUT B;  4EP7 A;  2ASJ A;  3C1Z A;  1TK5 A;  1NKB A;  9ICO A;  3C23 A;  2KFZ A;  4E7X A;  4X0A A;  3PW2 A;  4S3N A;  1XS9 D;  1WCN A;  5KFX A;  4QZH A;  3N4M B;  5III A;  4NKT A;  1WCL A;  4YR3 A;  1BPB A;  5HNK A;  4YG2 A;  3MFH A;  3ISB A;  3GV5 B;  4ZH4 A;  2I1Q A;  2ZJA A;  1S9F A;  5D46 A;  1X9W A;  2NRZ A;  1S10 A;  4DQP A;  4DSI A;  5KFM A;  4Q8E A;  3TAR A;  3H4B A;  5J0W A;  5KG2 A;  4UAY A;  5KFK A;  1ZQE A;  3T5K A;  2JEJ A;  2ISP A;  4R65 A;  2HVH A;  8ICF A;  4DSK A;  2WTF A;  4QZC A;  2BQU A;  3QZ7 A;  2UVW A;  7ICM A;  4UQG A;  4J9R A;  3H8W A;  5J0X A;  4MFF A;  2HHU A;  2ZH3 A;  4MFA A;  4B9T A;  3PR4 A;  4ECT A;  4O5E A;  2HHW A;  4AT7 B;  1MIW A;  4M9H A;  3RRG A;  5DG7 A;  5DQG A;  2ZJ5 A;  3HW8 A;  2W8L A;  1SKR A;  4UBC A;  4PHA A;  2BDP A;  1NK4 A;  4RT3 A;  4K4G A;  5HR9 A;  2XGQ A;  3OVS A;  3WFQ E;  2BQR A;  2NRW A;  4X5V A;  5HRF A;  4X4U A;  1ZQT A;  3AU6 A;  3KHH A;  4IRK A;  3UPQ A;  2NRV A;  3V7L A;  1LV5 A;  1L5U A;  8ICH A;  3EYZ A;  4Q45 A;  4EEY A;  4QWA A;  5CB1 A;  5J0R A;  3PO4 A;  1U48 A;  3SZ2 A;  9ICX A;  4LZD A;  1PX5 A;  3K4G A;  4O5K A;  4O3S A;  2PFO A;  5KFP A;  1ARO P;  2M2W A;  2O1P A;  3C1Y A;  3ZDA A;  1ZJM A;  3KTQ A;  2FMS A;  4WC3 A;  3TAN A;  4YN4 A;  9ICL A;  5KT6 A;  3RJH A;  1S97 A;  1BPD A;  4RNN A;  5KG6 A;  3RAQ A;  5HRE A;  4X4V A;  2MAX A;  1K1S A;  3BDP A;  2PFP A;  4B9U A;  4M9J A;  2F1I A;  4WC0 A;  4DSE A;  4JK1 A;  1NK8 A;  1ZQU A;  5J0T A;  2XY6 A;  2P6R A;  4NLG A;  4QZA A;  4XQ8 A;  4RNO A;  5HP4 A;  2BCU A;  4DL4 A;  5DBB A;  8ICC A;  4KLO A;  1ZQL A;  3GII A;  5L9X A;  9ICV A;  2P66 A;  4TUP A;  3MR3 A;  3OSN A;  3JPN A;  9ICE A;  4O3P A;  3JZ0 A;  5KFG A;  1S0O A;  3H8S A;  3LDA A;  5J2K A;  3RR8 A;  1XSN A;  4IR1 A;  2W9B A;  4BGD A;  4GC6 A;  2FPK A;  7ICN A;  1VJ7 A;  4QWD A;  2ZH2 A;  5J0Q A;  3Q8Q B;  1NKE A;  4IQV A;  3T3F A;  4QZE A;  3WFS C;  4R8U A;  4TUS A;  4GC7 A;  4C8L A;  4I2G A;  4RPY A;  3C5G A;  4NY8 A;  3T5L A;  4J9K A;  2J6U A;  8ICS A;  3GV7 B;  4PH5 A;  2PFQ A;  5J0S A;  3MFI A;  7ICO A;  9ICJ A;  3AQN A;  3OJS A;  3H37 A;  2VA8 A;  3EPG A;  4YFK A;  1D8L A;  4P4P A;  2F1H A;  3RJI A;  8ICM A;  1ZQB A;  5EWF A;  5KG7 A;  3NGD A;  7ICH A;  2HHP A;  1DK2 A;  3PX6 A;  2AQ0 A;  4IR9 A;  4AT8 A;  3ZD8 A;  4ECX A;  1ZQD A;  5KFT A;  9ICC A;  2LYH A;  4Q43 A;  9ICM A;  3Q8R B;  2C2D A;  4F4K A;  3RJE A;  4B9S A;  1ZQR A;  3ZDE A;  5DB9 A;  4YXJ A;  3QE9 Y;  3RB0 A;  1SL1 A;  1CEZ A;  2W9C B;  3KHL A;  9ICG A;  1KDH A;  4RU9 A;  3TAP A;  2ZHB A;  4KLT A;  1ZJN A;  4FBT A;  1RZT A;  4EYI B;  4Z6C A;  3BJY A;  4DL2 A;  3RH4 A;  4QWE A;  1ZQV A;  4MEY A;  5IIN A;  4X4R A;  3LWL A;  2PBE A;  5BPC A;  3JPO A;  4FH5 A;  1ZET A;  1TAU A;  1T3N A;  2W8K A;  5F2V O;  4ED0 A;  4YMO A;  4Q44 A;  1FA0 A;  8ICP A;  9ICI A;  2PXI A;  1R8B A;  4FHP A;  4WC1 A;  3B0X A;  5TZV A;  4WBY A;  3RB4 A;  4UB2 A;  1MIV A;  3C2M A;  4BWM A;  4ECS A;  1L3S A;  4LT6 A;  3JPS A;  7ICL A;  4YCX A;  3MR2 A;  2F1J A;  4GLX A;  4TQS A;  3PML A;  3RR7 A;  1UET A;  3PY8 A;  3JYY A;  3RRH A;  3OUY B;  1QSS A;  1N56 A;  4I2A A;  9ICU A;  1XO1 A;  5KFZ A;  4O3N A;  4Z6E A;  3GIL A;  3C5F A;  5EWE A;  3PO5 A;  4KIT B;  1TKD A;  5KFJ A;  4CCH A;  4X4Q A;  4AT8 B;  4EBC A;  3TI0 A;  5J0P A;  4UB5 A;  4QW9 A;  4UD5 A;  3UPS A;  1NJW A;  4JWN A;  2BE3 A;  1SL0 A;  5HRL A;  3HJ1 A;  3G6X A;  3UQ0 A;  4WC6 A;  4KLU A;  1ZQO A;  4K4I A;  2VAN A;  9ICA A;  1OU5 A;  5KFU A;  1ZQN A;  2BPC A;  4NM2 A;  4B9N A;  5DGA A;  4RUC A;  5J0U A;  3IHQ B;  4DOC A;  5BOL A;  3RH5 A;  2J6S A;  7ICU A;  1KLN A;  3FDS A;  2XCA A;  2BPG A;  1NJY A;  2DFL A;  3GIK A;  2UVV A;  3V72 A;  4JV0 A;  1ZYQ A;  5DBA A;  5HHI A;  4JUZ A;  4DOB A;  3SI8 A;  4RQ5 A;  2AU0 A;  4F8R A;  2IA6 A;  4R63 A;  3UXP A;  4DQR A;  3T5J A;  5CP2 A;  3M9M B;  9ICP A;  4EZ6 A;  1XU4 A;  1ZQI A;  1T4G A;  3Q8P B;  1ZQJ A;  2P6U A;  1Q79 A;  5IIJ A;  4FS2 A;  4FO6 A;  2BCS A;  4RUA A;  4EBK A;  4KLJ A;  3OGU A;  5DDM A;  2IHM A;  3WFR E;  3GV8 B;  1C7Y A;  1ZQC A;  5HC9 A;  4ECW A;  2A1J B;  3THV A;  3H3A A;  3RB6 A;  4M47 A;  1U9L A;  1Z3E B;  4ECQ A;  1SZP A;  2BGW A;  4DQI A;  4KLL A;  1TK8 A;  2ALZ A;  2DR7 A;  4MFC A;  2DPJ A;  4DL7 A;  2BQ3 A;  3PR5 B;  1BPY A;  2RDJ A;  3C2K A;  4RQ1 A;  5KFL A;  4PGQ A;  4IRD A;  1R8C A;  3H7I A;  4F50 A;  5D4B A;  4GXK A;  1MSW D;  2BR0 A;  4RQ0 A;  4TQR A;  3Q8S B;  3M8S A;  4O3Q A;  1NK7 A;  2H5X A;  3AUO A;  2C28 A;  2HHQ A;  5KFQ A;  3WFO A;  4NLZ A;  3MGH A;  4AT9 A;  3RJG A;  4QZD A;  3M8R A;  3QEA Z;  2ATL A;  1QTM A;  2VA3 A;  4UAZ A;  2OWO A;  4M04 A;  4KLD A;  2NRT A;  5J2I A;  4UBB A;  3ETL A;  5KFA A;  4KLE A;  4M6W A;  4UB4 A;  1UEV A;  3NYB A;  4YVZ A;  4AT7 A;  3C66 A;  2ZHA A;  1VFG A;  3JPQ A;  1HUZ A;  1BVS A;  2XO7 A;  3ORY A;  5J2A A;  3PVX A;  4ECV A;  4QZF A;  3PW0 A;  2FLN A;  4FH3 A;  1MQ3 A;  4ED7 A;  7ICJ A;  4FHV A;  4F2R A;  1QLN A;  7ICP A;  2HVI A;  4I2C A;  1S76 D;  4KTQ A;  4DL3 A;  2JZB B;  1RXV A;  8ICQ A;  4J9Q A;  2M2T A;  2Q66 A;  2AGQ A;  1BPZ A;  1MQ2 A;  4X0B A;  5KFV A;  1H38 A;  5KFW A;  2ZTD A;  2FLP A;  3V6H A;  2R8K A;  5CA7 A;  4ECZ A;  3MBY A;  1ZQG A;  1K1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...