5DBAA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a dt
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 114
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbaA03
1SL1A 5L1JA 4UBBA 2R8KA 9ICSA 4B9SA 4O3SA 2MAXA 5KFQA 4MEYA 1JQRA 1BPEA 9ICQA 4KLGA 3WFRE 3Q8KA 1BPYA 3ZDCA 2FMSA 1NK6A 4I2CA 4DQSA 2KZMA 1NK7A 2IBKA 1Q78A 5DG7A 2HHVA 2JEFA 4UD4A 4IRCA 4DS4A 4UAZA 3MFHA 1KFTA 4ZH4A 4DSJA 8ICRA 9ICPA 5D4BA 1NJXA 3GIIA 1D9DA 5J2HA 1SL2A 4EEYA 2BCRA 8ICCA 4AT8A 1ZQOA 3NGDA 3MGHA 3PW7A 3BQTA 4WC6A 4QZAA 7ICTA 4WC4A 3B0YA 7ICSA 3GDXA 5CR0A 4XQ8A 7ICKA 4J9PA 5KG6A 1ZETA 4PGYA 1A77A 5BPCA 2ZUCA 3MR6A 5J0RA 3PX6A 4DSEA 2KTQA 1SZPA 4F4ZA 1Z00A 4C8OA 5TZVA 4R64A 3JZ0A 5L9XA 1KDHA 5IIMA 5CJ7A 5D49A 3T5LA 4P2HA 3RR7A 5KT7A 3M9MB 1C7YA 5KFDA 3PW2A 5KG0A 4UD5A 4QWBA 2HHXA 3GILA 5KG7A 5J2IA 2R8GA 2VA2A 4RQ2A 3H4BA 5KFVA 4ECVA 3LDAA 9ICJA 1ZQFA 2ZH7A 5HRFA 4YVZA 4YN4A 4DF4A 2BR0A 9ICLA 4XRHA 4ECZA 2A1JA 2P6UA 7ICMA 1S0MA 3GIKA 3AQMA 2XCPA 1Y88A 5L1KA 4B9UA 4WC3A 4KLQA 2LYHA 3C2LA 8ICZA 4FHPA 3JPQA 3RH4A 3SV4A 4ATBA 1D9FA 5DLGA 1XSNA 7ICJA 4DSLA 3OHBA 3RBDA 3C2MA 7ICHA 9ICKA 4GLXA 3PVXA 5KFHA 2ZTEA 1UA0A 4DO9A 4F5QA 1AROP 3PY8A 4B9TA 3GV5B 2HHQA 5KFPA 1QTMA 4MEXA 4MFCA 3V7KA 8ICSA 1U4BA 2DVIA 4KLFA 8ICEA 4F4YA 4MFFA 5CA7A 3V6KA 4KLHA 2DR7A 3M8RA 4O3NA 4QZ8A 2DPIA 4RUCA 2DR9A 4IQVA 5BOMA 1VFGA 1X9WA 5J0UA 5KFJA 4Z6DA 4UB4A 5J0OA 4FS2A 2BGWA 4IQWA 9ICRA 7ICQA 4Q44A 4ED6A 1ZQNA 4O3QA 3MR2A 1L3TA 9ICTA 1BNOA 5KFRA 4X0AA 1UEUA 5J2CA 3QE9Y 3RJFA 4KLLA 4EBCA 1Z00B 5EWEA 3AQKA 1KFDA 2BE3A 1ZQXA 1ZQCA 4GXJA 8ICAA 3IM1A 4ECYA 4M6WA 1S0NA 5DQIA 3M9OB 1DK3A 3H8WA 3C2KA 4K4IA 4M0AA 4ECQA 4E8FA 4B9NA 2PI4A 4DFKA 2F1IA 1T8EA 3RBEA 4ED8A 4KLOA 3C1ZA 9ICGA 5DG8A 5J29A 8ICBA 2A1JB 3Q8LA 1BNPA 4MF8A 5HRGA 2NRKA 5KFOA 3Q8PB 4ECUA 4NKUA 5J0XA 4RQ1A 1PX5A 2BDPA 2JEGA 9ICHA 3TAPA 1FA0A 5J0QA 3BJYA 4WCWA 1QLNA 4UAYA 2O1PA 4PH5A 5KFXA 5KFIA 5DB7A 4YFKA 4ED2A 2ISPA 4DL3A 1ZYQA 2HVHA 4X4QA 3GV8B 4DQRA 5KFCA 1VJ7A 9ICWA 1N48A 3WFQE 5DLFA 4F93B 4PHDA 5IIKA 4JV1A 8ICPA 3HPOA 1T4GA 4F2SA 2ZUBA 3GFKB 1DK2A 4TURA 3PR5B 3JPTA 3UQ2A 2UVUA 1XSPA 4DSIA 5HRIA 2ASJA 1R8AA 2XC9A 4I2DA 5KFSA 4C8KA 4F4WA 5KTQA 3RB6A 1KLNA 2ZH4A 8ICKA 4NLNA 2PFQA 3OVAA 4YCXA 1COOA 4RQ0A 4RZRA 5DB8A 2KZ3A 2R8HA 4KLIA 2ZTCA 1L5UA 3OUYA 1U9LA 2VA8A 2KZZA 1L3UA 3AU2A 3K4GA 8ICOA 1CEZA 4WBYA 3H40A 1S0VA 1ZQUA 1IXRA 1XU4A 3OV7A 3RH6A 1KFSA 4EBJA 4UB3A 3EYZA 2KFZA 4R8UA 4RQ4A 1BPBA 4RNMA 4LVSA 3V7JA 1K1SA 2AGOA 4XUSA 1UA1A 4M6WB 1JN3A 4F91B 1ZQHA 4QW9A 1TAUA 4RPZA 1XS9D 1SKSA 4C8MA 4QWAA 3RRGA 1S76D 4MFAA 2HHTA 2FPKA 4JUZA 2W8LA 2J6TA 2DFLA 4DOAA 3AUOA 1NK4A 1R8CA 2PBEA 5DDMA 3HJ1A 2W9BA 2V9WA 4Q8FA 4RT3A 5KT2A 3T5KA 4RQ5A 1L3VA 4YQWA 2PFNA 5DKWA 3BQ1A 3N97B 2M2TA 4RWQA 3UPSA 4JWMA 5HHIA 8ICNA 5KT3A 3RJGA 4O3RA 8ICMA 2ATLA 4KLTA 4E80A 4X4TA 3EW9A 5DB6A 4KLDA 1BPZA 1XWLA 3WFOA 4PHEA 7ICLA 5IIJA 5KG5A 1XO1A 5J0TA 4QZGA 1D8LA 4R63A 3MDCA 3T3FA 1KRPA 4BXOA 3TFRA 5DEDA 4YD2A 4B9LA 4BDPA 1ZQKA 3Q8SB 4F2RA 4RUAA 5HRDA 4X4OA 4EZ9A 4DOCA 4FHXA 4M5DA 5J2BA 1NK8A 3RAXA 7ICVA 4Z6CA 2UVWA 3B0XA 1S0OA 3H8JA 2ALZA 2ISOA 3RR8A 3C5GA 5KFWA 4Q45A 2KFNA 2PFOA 1NO5A 2XGQA 3BQ2A 8ICTA 4NLKA 3AQNA 3QZ8A 5BOLA 3RB4A 3BDPA 1NOMA 1U49A 4QZCA 1S9FA 5DDYA 4J9RA 5HRLA 2UVVA 3MBYA 1ZQWA 5J0SA 5J2AA 3PMNA 5L1IA 4EZ6A 4O9MA 4E7XA 1JAJA 3OUYB 4IG8A 4WC2A 1PZNA 4EBKA 1L3SA 2FLNA 4K4HA 4DFMA 4O5EA 3TI0A 4I2GA 3C21A 4E0DA 7ICOA 3EWAA 5KG2A 3RJIA 3RJKA 5KG3A 4R8UB 3RRHA 2M2UA 1H38A 5HR9A 4YMNA 5KT4A 1MSWD 4ECWA 4NXZA 4RQ7A 4IR9A 3RAQA 4J9KA 3JYYA 1KTQA 2ZH8A 4EP7A 4J9MA 3TQ1A 3L9DA 3JPOA 2VA3A 1RZTA 1D8YA 1JMSA 1T7PA 2W9BB 3EZ5A 5J2FA 2ZH3A 4KN4A 9ICFA 2ZUDA 2W9CA 4KLSA 4RPYA 4NM1A 4QZHA 2W8KA 4O3OA 3EPIA 2AQ4A 3H7IA 4IQUA 4DWIA 4WC5A 4IRDA 2ZH9A 4YD1A 1NKBA 5KFMA 3RB3A 2C22A 3OJSA 2BCUA 3RTVA 4M9LA 1Q79A 2DRAA 3H4DA 3NTUA 1K1QA 5CHGA 4RU9A 3EPGA 1MQ3A 2OWOA 2HHUA 3LQCB 1ZQSA 1JIHA 2ZHBA 4BXOB 3C5FA 4PHPA 3THVA 7ICFA 7ICUA 3HP6A 4WC0A 4RWOA 4DS5A 4KLEA 5J2EA 3C23A 2DR5A 5KFNA 4WC1A 1BPDA 2ZJ8A 1X9MA 4C8LA 4FHYA 4Z6FA 3V6HA 4UAWA 1TK0A 2UVRA 2DRBA 2R8IA 3UPQA 3Q8QB 3JPNA 2IA6A 3PO5A 3OSNA 1U45A 1NK0A 1V9PA 9ICOA 4X4NA 5HHHA 4IQTA 4YXMA 5EWFA 1ZQDA 3ZD8A 1S10A 5J2DA 2NRXA 2AGPA 2J6UA 5EWGA 4MF2A 5HC9A 2FMPA 4I2HA 2M2WA 2BQ3A 1OU5A 5J2JA 4J9NA 2RFFA 1U48A 4X4PA 4EBDA 2V4RA 4TQSA 1EXNA 1QSSA 3QEBZ 3PW4A 1HJPA 3C66A 4EYIB 4I2IA 1UETA 2BQRA 4F4KA 5HRHA 3MABA 3RB0A 3C18A 3KHRA 4M9HA 2BPCA 2RDJA 8ICXA 2V4QA 3V6JA 3PW0A 2F1JA 3UQ0A 4JV0A 4HYKA 1HUZA 3H8SA 4TQRA 1TFRA 2NRWA 2AGQA 3N4MB 1IM4A 2C28A 4ED3A 5KFEA 1ZQBA 1SKWA 3ZD9A 4EYHB 3G6YA 4AT9A 3ZDEA 4DL5A 3PMLA 3PV8A 3ZDAA 1ZQLA 4RQ8A 2HHPA 4O5CA 4PPXA 2DPJA 8ICYA 9ICXA 4LZGA 4ED0A 1KEJA 2IHMA 4RWNA 3KHHA 2HHWA 4F5PA 3UXNA 3G6VA 2W9CB 4DQPA 4FBUA 4G3IA 3NYBA 4YR3A 2H5XA 2C2EA 1NJWA 1BVSA 4KTQA 5F9NA 4X4RA 2ZH1A 3LWMA 4FS1A 1SKRA 7ICEA 4KITB 4YP3A 4YMOA 1ZJNA 4QZEA 2I9GA 4KN7A 1ZQRA 2FPLA 5J0YA 5IIIA 8ICLA 4UB1A 4UBCA 5DGBA 3PX0A 4NM2A 5HRKA 3T5HA 4R65A 4DSKA 5HMLA 4KLUA 1MIWA 4QZBA 4RPXA 2BCVA 4GC7A 1LB2B 5F9LA 4YR0A 1RPLA 3KTQA 2DR8A 4B9MA 3GIJA 3ISCA 4O5KA 4R66A 4GC6A 1KSPA 5HMMA 4KMUA 4WC7A 4ELUA 9ICMA 7ICRA 4P4PA 4M9JA 8ICUA 1TKDA 4I2JA 5IINA 1BGXT 1ZQYA 4ELVA 1MIYA 2ZTDA 8ICGA 4QWEA 3K75D 3H38A 4FHWA 3Q8RB 3ORYA 3GQCA 4K4GA 5KG4A 1R89A 3JPPA 2ASLA 3ZDBA 2P6RA 2J6SA 1B22A 3UXPA 2O5AA 2Q66A 4DL2A 4DEZA 4PGQA 8ICWA 4S3NA 4B9VA 4QW8A 3JPSA 1RXWA 2ZJ5A 1XSLA 1TVAA 3HW8A 1NZPA 1YLQA 1MC8A 3OSPA 3TARA 2ZHAA 9ICNA 1TFYA 2HW3A 5J2GA 2JEIA 3TAQA 4M9NA 3FYHA 4DF8A 1X2IA 1Z3EB 5KFGA 1WOTA 4AT9B 4J9QA 5IIOA 3FDSA 3QZ7A 1TV9A 3GV7B 3T5JA 4NLGA 8ICJA 5HNKA 2Y1JA 2FMQA 4CCHA 1UT5A 4F5OA 3KHLA 3H37A 3V72A 4WBZA 2ZH5A 3MDAA 4ECRA 1DGSA 2NRVA 4KLJA 4F5RA 3HIYA 5KFZA 4F8RA 3TANA 3PX4A 1S77D 9ICEA 5C5JA 3SV3A 1V4AA 2M9NA 3C1YA 3OJUA 5J2KA 4J9SA 1ZQEA 2MUTA 5D46A 5KFLA 4P4MA 4DFPA 2GWSA 3HWTA 1HUOA 1DOQA 5JUMA 4FH3A 3HJ4A 2XGPA 4TUQA 4M9GA 1XC9A 4DLGA 4I29A 4NLZA 1F5AA 3MFIA 2IHNA 1R8BA 4ECTA 1U47A 3H39A 5KFTA 4YG2A 2FPMA 1TAQA 5KFBA 3RH5A 4O3PA 4YXJA 4QWDA 5KFKA 1CUKA 5DBCA 5DQHA 2KN7A 1MQ2A 1ZQAA 2JEJA 2PI5A 4QZDA 1QSYA 1NJZA 2XY5A 2BPFA 2IMWP 2AU0A 4I2FA 4PGXA 1NKEA 7ICGA 4DL6A 4FHVA 4I2BA 3OVBA 3PNCA 4BWMA 1S97A 4DOBA 2Y1IA 2F1HA 5KT6A 5DBAA 4XQ7A 4DL7A 2JZBA 7ICIA 1TFWA 4X4VA 4RQ3A 1NK9A 4XA5A 4O0IA 3RJJA 4JV2A 2FLLA 2ID1A 4ECSA 4I2EA 5CB1A 4AT7A 3HT3A 1UT8A 2R8JA 4RNNA 4UQGA 3SZ2A 3LK9A 3MR5A 3QEAZ 4X5VA 4X4SA 3OVSA 3H3AA 2P66A 4X4UA 9ICCA 4NKTA 4DFJA 4GXKA 4I2AA 2HVIA 3Q8MA 4Z6EA 2WTFA 2M2VA 2ZH2A 4C8NA 2C2DA 5DB9A 4BGDA 5KG1A 1TK5A 3MGIA 4I27A 4AT8B 4ELTA 2XY6A 2ASDA 4QZFA 1KNYA 1NJYA 4FO6A 4IR1A 5DECA 3PW5A 2ZH6A 4TUPA 3PR4A 2XCAA 1NK5A 4F50A 2KP7A 4IRKA 2W9AA 2W9MA 5HREA 2BHNA 2NRTA 4LT6A 2BQUA 4ECXA 1ZQPA 5L1LA 4NY8A 2C2RA 1JXLA 4BWJA 4DQIA 4Q8EA 8ICFA 4JWNA 3AQLA 4Q43A 8ICVA 1UEVA 2ZJAA 3UXOA 4F3OA 5J0PA 2MUTB 2FLPA 4YMMA 4F5NA 2PFPA 5KFYA 4RT2A 2VANA 3ISBA 4ED1A 1TK8A 2BPGA 4QZ9A 1ZQZA 4ED7A 5HP4A 1JXEA 1BPXA 1WCNA 1ZQGA 7ICPA 3E2EA 2XY7A 4M04A 2PXIA 1QSLA 4RNOA 3OGUA 8ICHA 4FBTA 2Q0ZX 3LWLA 3ISDA 4PHAA 3SI8A 3PO4A 2HHSA 8ICIA 1LV5A 5HRBA 4UB5A 9ICIA 5DG9A 4DL4A 4ATBB 4RQ6A 2NRZA 1ZQMA 9ICUA 4JK1A 7ICNA 4LZDA 4X0BA 1N56A 3IHQB 1WCLA 4DLEA 5F2VO 5EOZA 1NKCA 4P4OA 1ZQIA 1X9SA 3JPRA 1ZQJA 9ICBA 2JZBB 5IILA 4J9OA 3V7LA 3M9NB 3TFSA 1ZQTA 5DBBA 4QZIA 5CWRA 2I1QA 5DGAA 5KFUA 4UB2A 4F92B 4QWCA 3KHGA 4GXIA 2RDIA 4EBEA 2AJQA 4AT7B 4RWPA 5KFFA 1SL0A 2AQ0A 1B43A 3M8SA 4M47A 4DQQA 3ETLA 5J0WA 2XO7A 3HX0A 3GIMA 1T3NA 1RYSA 9ICVA 4J9LA 4F4XA 5KFAA 4DSFA 3AU6A 4I28A 1RXVA 1ZJMA 1ZQVA 5CP2A 3OHAA 4M2YA 1A76A 5KT5A 5DQGA 4FH5A 3RJHA 2BKEA 1JX4A 3BQ0A 3ZDDA 8ICQA 4YR2A 1RYRA 1ZQQA 3WFPA 3SYZA 3G6XA 3WFSC 4KLMA 1MIVA 3RJEA 3MR3A 2B21A 2BCQA 4TUSA 2BCSA 9ICAA
chains in the Genus database with same CATH superfamily
1SL1A 2MAXA 5KFQA 2A3VA 3QUQA 4KLGA 1J2MA 4B6JA 2JEFA 2HN1A 4IRCA 2E1FA 5ALYA 2DQNB 3MFHA 5H2FU 5ALTA 4AT8A 4WOYA 3QYPA 1ZQOA 3MGHA 2E1EA 1SWWA 7ICKA 5CR0A 4LEYA 1ZETA 3MR6A 4DSEA 5TZVA 3JZ0A 3AMZA 3T5LA 5KT7A 5KG0A 4WQKA 1CI4A 4XJEA 5KG7A 2VA2A 3H4BA 2LM1A 1ZQFA 2HBJA 2BR0A 4XRHA 3F53A 2A1JA 2JMGA 2P6UA 1PUZA 4OAHA 3KD3A 2CRXA 5L1KA 2LYHA 3C2LA 8ICZA 4ATBA 3QU7A 2HOQA 5DLGA 3RBDA 4K99A 3C2MA 3GU3A 4FFDA 1ZD5A 1KL9A 4GLXA 2EZYA 5KFHA 2ZTEA 3PY8A 4B9TA 4MFCA 3V7KA 1U4BA 2W7PA 4WH5A 3N28A 4F4YA 4MFFA 4O3NA 3C29A 4RUCA 1N60A 4IQVA 4IC9A 4UB4A 3L4PA 2LHTA 4NWIA 3WK5A 4Q44A 3MR2A 1L3TA 4X0AA 5J2CA 3QE9Y 4KLLA 4PL1A 3AQKA 1KFDA 1UHUA 3OPXA 3IM1A 4ECYA 1L7NA 3E58A 4F71A 3D2SA 2ESEA 5J29A 2A1JB 2NRKA 4RQ1A 2JEGA 3BJYA 4CF3A 5KFXA 5ALEA 5KFIA 4X4QA 5KFCA 2EZXA 2ES6A 2WB1F 2KE7A 1DK2A 5ALFA 4F4WA 5KTQA 2LM4A 8ICKA 4NLNA 4RZRA 2R8HA 2KZ3A 1JALA 1L5UA 4EV6A 1SIJA 5G5HA 3WKDA 2NO5A 4K96A 5JRTA 3RH6A 1KFSA 4JLZA 1ZRNA 2KFZA 3SEIA 4RQ4A 1ZQHA 1Z4NA 1XS9D 2HHTA 2W8LA 2FCLA 4Q8FA 4RT3A 3T5KA 3UPSA 5B5EU 8ICNA 3RJGA 8ICMA 4X4TA 2ZXHA 1BPZA 3NRWA 4P0PA 3MDCA 3T3FA 1L7MA 1KRPA 4BDPA 1ZQKA 3Q8SB 3TKAA 3RAXA 2KVCA 2UVWA 4C7ZA 2ISOA 5KFWA 2KFNA 8ICTA 2W43A 5AKLA 4NLKA 3QZ8A 3BDPA 1U49A 4QZCA 1S9FA 5DDYA 4J9RA 5L1IA 4E7XA 4IG8A 1PZNA 5ALVA 2W7OA 5D62A 3QUBA 4I2GA 7ICOA 1TAMA 3RJIA 2OXOA 5D63A 2M2UA 1H38A 3B9JA 5KT4A 1OW5A 4RQ7A 3RAQA 1KTQA 2ZH8A 4J9MA 3DDHA 3JCFA 5GTIU 3PSTA 2VA3A 4PJ0U 2W9CA 4RPYA 2Q66A 4WC5A 4IQUA 5JU5A 2HCFA 2K60A 3RTVA 3NTUA 1F0MA 3EPGA 2B4VA 4RWOA 4DS5A 4KLEA 5J2EA 2DR5A 4PZOA 5KFNA 4C8LA 4Z6FA 4AYBC 1F5SA 3UPQA 5ALUA 3Q8QB 4FZMA 1U45A 2MA1A 4X4NA 3AQEA 5HHHA 1N5XA 4YXMA 4O68A 3WKBA 5J2DA 2J6UA 4MF2A 4I2HA 2M2WA 1OU5A 5J2JA 4EBDA 1QSSA 4EYIB 5AM2A 5HRHA 2HMXA 2ZIXA 3KHRA 8ICXA 2V4QA 2EAPA 4JV0A 1QQ5A 1HUZA 3N4MB 1IM4A 2C28A 1SKWA 5HR7A 1M6YA 3T79A 4O5CA 1OUQA 1NNLA 3DV9A 8ICYA 9ICXA 4ED0A 1KEJA 4F5PA 2W9CB 3I1YA 3NVZA 5AHXA 3LWMA 2YMPA 1SKRA 1ZJNA 3AN1A 1ZQRA 4UBCA 5DGBA 3ICXA 4R65A 4DSKA 5ALRA 2HN2A 4QZBA 4RPXA 1RPLA 4O5KA 3GIJA 1O03A 3ISCA 4R66A 4FE3A 1S8OA 1UCVA 7ICRA 2QARA 3SAGA 5IINA 1ZQYA 1N62A 2ZTDA 4QWEA 5AIAA 4K4GA 1PVPA 1B22A 2P6RA 2JR5A 2ZIXB 2O5AA 4DEZA 3HJEA 2FDRA 2G08A 2ZJ5A 2ZHAA 1MC8A 4C4RA 3TARA 3OSPA 1TFYA 3IDWA 4EELA 3AQFA 2ZIVA 4M9NA 2EAMA 1B4FA 2W11A 1TV9A 4CGZA 3T5JA 4NLGA 2BZFA 3V72A 4J03A 3HIYA 5KFZA 1Z19A 4EEDA 1KKXA 5C5JA 3SV3A 1V4AA 3F2DA 2MUTA 2WAQC 3HWTA 4TUQA 2G09A 2GA9D 4YXJA 4QWDA 2LKYA 4QZDA 1O08A 1Z4OA 4PGXA 2HOIA 2EWRA 2Y1IA 1TFWA 2JZBA 2FI1A 4I2EA 5ALOA 2XIDA 3KZIU 2FE9A 3SZ2A 3H3AA 2P66A 4GXKA 3ZI4A 1MN8A 4Z6EA 2M2VA 2PMZC 4BGDA 2MRLA 4EENA 4LEWA 1SWVA 4UASA 4F50A 4Y2XA 4IRKA 1Z1VA 2I6XA 2W9AA 3IN5A 4O6AA 5AKYA 4USAA 8ICVA 4F3OA 5J8YA 2MUTB 2IOFK 2FLPA 1J97A 2GLEA 4QZ9A 1X40A 3BS7A 3UMCA 3MGVA 7ICPA 2XY7A 3LWLA 3ISDA 4GIBA 5AICA 2HHSA 9ICIA 3K7DA 4DLEA 1WCLA 2KEYA 2KJ5A 3JPRA 9ICBA 2JZBB 3TACB 4J9OA 3M9NB 5DBBA 4QZIA 3IRUA 5DGAA 4GXIA 3KHGA 4EBEA 1SL0A 1P7DA 4MKPA 3VC8A 4F4XA 5HR6A 4M2YA 5JTGA 5DQGA 4FH5A 3RJHA 5AI6A 1JX4A 2D6FC 1ZQQA 1FFUA 4QJFB 4K97A 3KFUF 2B21A 2BCSA 4TUSA 2WF8A 5L1JA 9ICSA 4O3SA 1F44A 1JQRA 3Q8KA 1BPYA 9ICGA 2FMSA 5AK5A 1Q78A 3SMVA 2HHVA 2LYBA 4DS4A 4UAZA 2QB0A 4ZH4A 8ICRA 2Y0SC 5D4BA 2IUBA 2HSZA 1D9DA 5AI4A 5AM3A 3NGDA 3PW7A 2KVSA 1KN5A 4J9PA 4QIWC 2ZIUA 3PX6A 1SZPA 4C8OA 4R64A 2DKXA 4P2HA 5L1MA 2D3DA 2WFAA 4EEKA 1ECWA 5KFVA 4NLBA 4ECZA 3GIKA 4WC3A 1Y88A 2VJ5A 2LPEA 3DEEA 7ICJA 4O3MA 7ICHA 3AL0B 9ICKA 1UA0A 4DO9A 4CE6A 4KLFA 8ICEA 1YT3A 3M8RA 2HOFA 4QZ8A 2QB0B 2Y9UA 5ALQA 1DXSA 1NZBA 2IHOA 4RQMA 1URJA 4Z6DA 2BGWA 9ICRA 1ZD4A 1ZOLA 3QXGA 1PVRA 7ICQA 2KJ8A 2ZIUB 9ICTA 1BNOA 5KFRA 1A0PA 3RJFA 5EWEA 1GPJA 2BE3A 1JROA 2LBOA 1DK3A 2G06A 1S0NA 4K4IA 2F44A 5ALSA 2PI4A 1T8EA 2K8AA 1JI7A 4ED8A 4KLOA 2ODGA 1BNPA 5KFOA 4ECUA 3IP4B 5K4LA 9ICHA 2P35A 3OWGA 5J0QA 1QLNA 4PH5A 4ED2A 2ISPA 4DL3A 2K8BB 2HVHA 3GV8B 4DQRA 1N48A 3WFQE 3D2QA 5IIKA 1T4GA 1ED1A 3GFKB 1SXDA 3UMBA 2UVUA 3UQ2A 3NS1A 3QU2A 2KSOB 1FO4A 2PFQA 4O69A 1C20A 5DB8A 2XVTA 1U9LA 4UAUA 1AQ6A 4Y2YA 4WBYA 2ZIWB 1CEZA 1S0VA 4EBJA 4UB3A 1ZD3A 1BPBA 1K1SA 3QU9A 1UA1A 4F91B 4C8MA 4QWAA 3RRGA 2FPKA 1R8CA 1NK4A 2V9WA 1JUDA 2RLTA 2PFNA 3TADC 3BQ1A 4OAGA 2ATLA 3EW9A 1XWLA 3WFOA 5IIJA 7ICTA 5J0TA 4BXOA 3CYMA 4YD2A 4B9LA 4F2RA 4DOCA 2OM6A 5J2BA 3ED5A 4WQLA 4Z6CA 3UM9A 3WK6A 4OO1J 1A6SA 1SB3C 1S0OA 4Q45A 4UW9A 5T14A 1NO5A 3BQ2A 3AQNA 3RB4A 4K98A 1NOMA 3QX7A 5F3XB 5J2AA 1JAJA 2KIWA 4EBKA 1L3SA 2FLNA 2CN1A 4DFMA 1KQQA 4US9A 3TI0A 1D8BA 3EWAA 3RJKA 3N7SC 5KG3A 3RRHA 5HR9A 4YMNA 4NXZA 4J9KA 4EP7A 3TQ1A 3L9DA 5A0LA 3EZ5A 3AM9A 4KN4A 9ICFA 4KLSA 3SAFA 4IRDA 4YD1A 1NKBA 5KFMA 3CP8A 3H4DA 3LQCB 1JIHA 4HX0A 4BXOB 2K4EA 4EGWA 1VJ5A 3M7DA 2DRBA 3JPNA 2IA6A 9ICOA 1ZQDA 3ZD8A 2EANA 3M6KA 3QNMA 3R9KA 5EWGA 2PKEA 4TQSA 5ALZA 3C66A 4I2IA 2K89A 2KMDA 4F4KA 3RB0A 2BPCA 2F1JA 4HYKA 1TFRA 1VLBA 5KFEA 2XI9A 2DF4B 3ZD9A 3G6YA 4AYBF 4DL5A 2KHQA 5KAFU 3ZDAA 4C80A 4RQ8A 4PL2A 5EE1A 3KZXA 4RWNA 3KHHA 3UXNA 4DQPA 3NYBA 2WF6A 4X4RA 2HBLA 5F9NA 2RQ5A 4KITB 4YP3A 3L3FX 3TADA 3PX0A 5HRKA 4BJQA 1IV8A 5HMLA 4KLUA 2W55A 2BCVA 4GC7A 1LB2B 2Q4TA 4YR0A 3KTQA 1WYGA 5AK3A 5HMMA 2I5HA 3BZCA 4P4PA 4M9JA 8ICUA 4ELVA 1MIYA 2H3QA 8ICGA 4MHVA 3ORYA 3GQCA 2ASLA 3ZDBA 4A8EA 4PGQA 8ICWA 4S3NA 2GOLA 4QW8A 3JPSA 2QKQA 1NZPA 9ICNA 5J2GA 3F2CA 3TAQA 4DF8A 4NLCA 3ER9B 2ZXIA 5IIOA 5ALGA 2FMQA 1UT5A 3H37A 4EX7A 1DGSA 2NRVA 4KLJA 2YB4A 2F2AB 3TANA 3PX4A 2A19A 2DGZA 1WG8A 3SR6A 3OJUA 5J2KA 1ZRMA 3LVWA 5JUMA 3HJ4A 2XGPA 4M9GA 2QB1A 4I29A 4DLGA 4AP9A 3MFIA 4ECTA 4EX6A 1U47A 3H39A 3M1YA 2KOBA 5AK6A 5KFBA 2YB1A 1ZQAA 5EE0A 2BPFA 2IMWP 4I2FA 7ICGA 1NKEA 3WK8A 3PSPA 2E8MA 2F1HA 5KT6A 4XQ7A 4DL7A 4X4VA 3ONNA 2ID1A 4JMUA 5CB1A 3HT3A 1UT8A 4UQGA 2WAQF 4X4SA 4X5VA 4US8A 3Q8MA 5DB9A 2VKQA 3MGIA 4I27A 2ASDA 2EZZA 4FO6A 1CRXA 2BHNA 2BQUA 3IG5A 5L1LA 1JXLA 4BWJA 4DQIA 4Q8EA 8ICFA 1UEVA 3UXOA 5J0PA 3FAHA 4YMMA 3RFAA 4F5NA 2DL0A 4RT2A 4ED1A 2BPGA 4LEZA 1JXEA 1ZQGA 2MSNA 2PMZF 2PXIA 4M04A 4QNLA 5AI9A 8ICIA 2QLTA 1ZQMA 5J8YC 4OJ5A 4LZDA 4X0BA 1N56A 3IHQB 5F2VO 3KBBA 5EOZA 1NKCA 5AKJA 3WKCA 5IILA 2JGAA 5CWRA 2JH1A 4CF5A 4UB2A 1N61A 4DQQA 2XO7A 4J9LA 2WF7A 3KOOA 2HI0A 2W54A 4DSFA 1XO0A 1A76A 3BQ0A 4YR2A 3O0FA 1RYRA 5AM4A 3WFSC 4ACOA 2RHFA 3CNHA 1PK3A 5AM0A 2O6KA 4MEYA 1BPEA 1NK6A 4DQSA 1NK7A 2IBKA 4K9BA 5DG7A 4GFJA 4NXWA 1PK1A 1KFTA 2YN4A 9ICPA 3GIIA 5J2HA 1SL2A 2BCRA 1VDVA 4HAIA 2G0AA 5GTHU 4QZAA 1RDFA 7ICSA 1X9XA 4XQ8A 5AK4A 4PGYA 5BPCA 2ZUCA 1L6NA 1SV4A 1LVHA 1Z00A 5L9XA 1KDHA 3KKAC 5IIMA 5CJ7A 2E8NA 3RR7A 3M9MB 4UD5A 3GILA 5J2IA 4RQ2A 5ALHA 9ICJA 2DUYA 3QUCA 4YN4A 4DF4A 2YQEA 3WK4A 9ICLA 3AQMA 2NV3A 2XCPA 2W3RA 4CRXA 4FHPA 1SXEA 3RH4A 2MU2A 1D9FA 4NXXA 4DSLA 4LJXA 4QIWF 3NKUA 5ALNA 4Y2VA 4F5QA 2AXTU 2G07A 2JH7A 3GV5B 2HHQA 4MEXA 2DVIA 2NYVA 2DR7A 1N2XA 1PK1B 5ALIA 2DR9A 5TISU 1FEZA 5CEHA 3WK9A 2F76X 5KFJA 4IQWA 5J0OA 5FP0A 4ED6A 3PSIA 1ZQNA 2CXYA 2YX8A 1UEUA 5AKXA 1Z00B 4IL6U 3ER8C 5DQIA 3H8WA 3C2KA 4M0AA 4ECQA 4E8FA 4OJPA 3RBEA 5DG8A 2OEHA 4P0QA 5AKZA 4MF8A 5HRGA 3Q8PB 4NKUA 3WU2U 1PX5A 3A0HU 2BDPA 3TAPA 4DCCA 1FA0A 4C4SA 4UAYA 3K1RB 4YFKA 3NWIA 2H3VA 1VJ7A 3D2NA 4NXTA 5DLFA 5ALWA 4PHDA 4RQNA 4K9AA 4F2SA 2ZUBA 1ZQ1C 3JPTA 1XSPA 5HRIA 1R8AA 3RB6A 5AIBA 2ZH4A 3OVAA 4YCXA 1COOA 4RQ0A 2ZTCA 1WWUA 1L3UA 3AU2A 8ICOA 4Y2TA 3EYZA 4LVSA 4RNMA 4XUSA 1TAUA 1SKSA 4JUZA 2J6TA 4DOAA 3AUOA 3KKAA 2PBEA 5DDMA 4EEBA 5KT2A 1L3VA 3SD7A 3N97B 4P0QB 4RWQA 5ALDA 4JWMA 5HHIA 4O3RA 1NI3A 4PHEA 4LEVA 4R63A 4QZGA 3TFRA 5DEDA 3L5KA 4RUAA 5HRDA 2IOFA 4FHXA 1X42A 1NK8A 7ICVA 3B0XA 3H8JA 3RR8A 3C5GA 4KX3A 3K1ZA 3EUB2 3PMNA 3F2BA 2F3NA 4K4HA 1T3QA 4O5EA 1WWVA 3C21A 4E0DA 2DBYA 2KICA 5KG2A 4Y2UA 1MSWD 4ECWA 4IR9A 2BBJA 2OYYA 2G5IB 4Y2JA 4UB6U 1RZTA 1B0XA 1QQ7A 2KSOA 1T7PA 5J2FA 1MA7A 2ZH3A 4NM1A 4O3OA 4DWIA 3H7IA 3RF9A 3RB3A 2ZIWA 2BCUA 4M9LA 1Q79A 1X66A 4CNQA 5CHGA 1MQ3A 2HHUA 4RU9A 1V85A 1ZQSA 3C5FA 4PHPA 7ICFA 7ICUA 3HP6A 3U26A 1BPDA 2ZJ8A 1X9MA 4PZNA 2WHEA 4UAWA 3V6HA 2UVRA 2R8IA 3PO5A 1V9PA 1SGGA 1N63A 2NRXA 3H0MB 2AGPA 1L8OA 2KKVA 2RFFA 4J9NA 3QEBZ 3PW4A 1HJPA 3J81j 4M9HA 2RDJA 4UATA 4FZLA 5EE9A 3H8SA 4TQRA 5B66U 2NRWA 3N7RC 4ED3A 4I0UA 1ZQBA 1SV0A 2WF5A 4EYHB 5AI5A 3ZDEA 3PV8A 4NL9C 2KK0A 5KAIU 1HEKA 5CRXA 4PPXA 2IHMA 3G6VA 4G3IA 1WUDA 4YR3A 2H5XA 1NJWA 4KTQA 1BVSA 7ICEA 1LKYA 2I9GA 4QZEA 4KN7A 8ICLA 5J0YA 5IIIA 4NM2A 3T5HA 1RQNA 2K4IA 2RRDA 3HKZC 4U6PA 1DGJA 2DR8A 4B9MA 1YZ6A 4WC7A 1KSPA 4KMUA 2HDOA 9ICMA 1GO3F 4I2JA 1K5OA 2H3FA 5AI0A 4CF4A 4FHWA 5KG4A 3JPPA 2OCEA 4B9VA 1XSLA 3HW8A 1YLQA 2HW3A 2EAOA 3FYHA 5ALXA 5KFGA 4J9QA 3FDSA 3QZ7A 1IG6A 3GV7B 2Y1JA 4OD0A 4CCHA 3KHLA 4WBZA 3VCBA 1X6IA 1S77D 1LKYB 1V38A 1X6JA 4J9SA 4ICAA 4UAVA 5KNIA 1ZQEA 3CRXA 5D46A 4P4MA 4DFPA 1HUOA 2Z7JA 4NLZA 1XC9A 2L5YA 5ALPA 5KL1B 1F5AA 5B3PA 1R8BA 1Q3VA 1TAQA 4Y2SA 3RH5A 4O3PA 1MQ2A 2JEJA 1QSYA 1NJZA 4FHVA 3OVBA 4I2BA 1S97A 4DOBA 5DBAA 7ICIA 4RQ3A 1NK9A 4XA5A 4O0IA 4OAIZ 4ECSA 4AT7A 2R8JA 4RNNA 3LK9A 3MR5A 3OVSA 1L7OA 4X4UA 4I2AA 2HBMA 2N1RA 3ALRA 4NXUA 3CK6A 2WTFA 4C8NA 2C2DA 1TK5A 4AT8B 4CDGA 1NJYA 4IR1A 3PW5A 2CPRA 2ZH6A 1RG6A 4TUPA 2XCAA 1NK5A 2KP7A 4NL9A 5HREA 4ECXA 4NY8A 2C2RA 3EF2A 4JWNA 2ZJAA 2K4HA 2PFPA 5KFYA 3IG8A 3ISBA 4ED7A 1WCNA 1QSLA 8ICHA 3OGUA 2H3IA 4FBTA 4PHAA 3PO4A 5DG9A 4DL4A 3SQIA 4ATBB 2NRZA 5C0YA 2EDUA 1ZQTA 2KNJA 2I1QA 4F72A 4QWCA 4F92B 2AJQA 1Q46A 4AT7B 1Z1BA 2YTUA 1ZXIA 5KL8B 5KFFA 4KM5A 3M8SA 1RYSA 1T3NA 9ICVA 4BX9C 3PZPA 5KFAA 4I28A 1ZJMA 1ZQVA 4OAFA 3LYSA 1J2NA 3WFPA 3G6XA 4KLMA 1MIVA 3F5EA 9ICAA 4UBBA 2R8KA 4B9SA 2F77X 3I28A 9ICQA 3WFRE 3ZDCA 4I2CA 2KZMA 3NVOA 4UD4A 2OHFA 4NXVA 1JRPA 3ETRA 4DSJA 1NJXA 3M6ZA 8ICCA 4EEYA 3WKEA 3BQTA 4WC6A 4NV0A 3B0YA 4WC4A 3GDXA 1YZ7A 5KG6A 1A77A 4OJLA 5J0RA 2KTQA 4F4ZA 5D49A 1C7YA 5KFDA 3PW2A 4QWBA 2HHXA 2R8GA 4ECVA 2BDUA 3LDAA 1L8LA 2ZH7A 5HRFA 4YVZA 7ICMA 4OJOA 1S0MA 4B9UA 3AEVA 3JPQA 3SAHA 3SV4A 1XSNA 3OHBA 3IV6A 2KG5A 3NVVA 1UQVA 3PVXA 1AROP 5KFPA 1QTMA 3I76A 8ICSA 4NJ8A 2KIVA 2K8CB 5CA7A 3V6KA 4KLHA 2DPIA 5BOMA 1VFGA 1X9WA 5J0UA 4UB8U 4FS2A 1V97A 5E79U 4O3QA 4DFDA 4P0PB 4EBCA 2KJ9A 3H0LB 5B3QA 1ZQXA 1IIPA 2WB1C 4GXJA 1ZQCA 8ICAA 4M6WA 3M9OB 2K4PA 4B9NA 2GH1A 4DFKA 2F1IA 3C1ZA 8ICBA 1S5LU 3Q8LA 5J0XA 3WKAA 3C28A 3FC4A 1PVQA 4WCWA 4KMOB 2O1PA 5DB7A 1ZYQA 4Y2QA 3BZKA 4JLXA 9ICWA 4F93B 4JV1A 8ICPA 3HPOA 5AKHA 4TURA 3PR5B 4DSIA 2ASJA 2XC9A 4I2DA 5KFSA 4C8KA 1KLNA 4G9BA 3PHZA 3F5AA 5ALLA 4KLIA 3OUYA 3UMGA 2VA8A 2KZZA 3K4GA 3H40A 2A1AA 1ZQUA 2B0CA 1IXRA 4FZNA 1XU4A 3OV7A 2IOHA 2B51A 4R8UA 4C4TA 3V7JA 2AGOA 4M6WB 1JN3A 2G5HB 4QW9A 4RPZA 1S76D 1R89A 4MFAA 2RP5A 2DFLA 4IS7A 3HJ1A 4Y2RA 2W9BA 2YMMA 3D6JA 4RQ5A 2E8PA 4YQWA 5DKWA 2M2TA 5KT3A 4E80A 4KLTA 4KB6A 5DB6A 4KLDA 1XNSA 7ICLA 5KG5A 2ZH5A 1XO1A 1D8LA 1RYUA 5JTIA 4WJ3B 4X4OA 4EZ9A 4M5DA 2FJ6A 2ALZA 4FO1A 2PFOA 2XGQA 2Y0SF 2B56A 2M0NA 2YMQA 3ERCC 5BOLA 5HRLA 1N5WA 2UVVA 3MBYA 1ZQWA 5J0SA 4EZ6A 4O9MA 3OUYB 2E5SA 4WC2A 1OXJA 2F8KA 1Q8KA 5AI8A 5G5GA 2DKZA 2EH9A 4OCZA 4R8UB 2AHOB 2KD1A 3JYYA 3S6JA 3JPOA 1D8YA 1JMSA 2QARB 2W9BB 5CFSA 2ZUDA 4QZHA 2W8KA 3EPIA 2AQ4A 2ZH9A 3LVVA 2C22A 4O67A 3OJSA 2DRAA 2KV2A 3H0RB 4UARA 1K1QA 2OWOA 5CFUA 2ZHBA 3QUTA 3THVA 4WC0A 2E8OA 3C23A 4WC1A 4FHYA 3HILA 1TK0A 3QU5A 2ZIVB 3OSNA 1NK0A 1KBUA 4IQTA 5EWFA 1S10A 5HC9A 2FMPA 2W3SA 4KX5A 2BQ3A 4X4PA 1U48A 2GO7A 2V4RA 1EXNA 3E0FA 4U7CA 1UETA 2BQRA 3C18A 3MABA 3V6JA 2DWQA 3PW0A 3UQ0A 1RQLA 4C7YA 2AGQA 3PSFA 3A0BU 4AT9A 3PMLA 5CFTA 2VJ4A 1ZQLA 2HHPA 1UPHA 2DPJA 2W03A 4LZGA 2HHWA 4K8VA 4FBUA 4Y2PA 2C2EA 3GZFA 2ZH1A 4FS1A 1SV0C 2XICA 4YMOA 2FPLA 1DRGA 4UB1A 1L7PA 2R18A 1MIWA 2LYAA 2D8CA 5F9LA 1QCKA 2HBKA 4GC6A 4ELUA 1RM6C 1TKDA 2JXJA 1BGXT 5ALKA 4N7RA 3K75D 3H38A 3Q8RB 3MC1A 5AKEA 2J6SA 3UXPA 4DL2A 1RXWA 1FIQA 1TVAA 3OTQA 2KKPA 2JEIA 1Q3UA 3BQ7A 3HKZF 1X2IA 1Z3EB 1WOTA 4AT9B 2KHVA 3H8MA 5CHEA 4OJ6A 3WK7A 2BBHA 4BUGA 1SZHA 8ICJA 5HNKA 4F5OA 3MDAA 3NUQA 2E3TA 4ECRA 4F5RA 4F8RA 2VIXA 9ICEA 3CW2C 1TE2A 2M9NA 3C1YA 3BS5A 2NO4A 5AKGA 2ZG6A 1ZD2P 2GWSA 5KFLA 1QQ6A 4FH3A 1DOQA 3QU4A 4C0ZA 2IHNA 2H3ZA 5KFTA 4YG2A 2FPMA 2LI6A 4JB3A 5KFKA 1CUKA 5DBCA 5DQHA 2KN7A 2PI5A 1KW4A 2XY5A 2AU0A 2JRZA 1HIWA 4DL6A 3PNCA 4BWMA 2YY6A 3RJJA 4JV2A 2FLLA 5EE3A 3QEAZ 5D61A 9ICCA 4NKTA 4DFJA 2HVIA 2ZH2A 2JV3A 1COKA 5KG1A 2EQYA 2F8LA 3FM9A 4ELTA 2XY6A 4QZFA 1KNYA 5DECA 3PR4A 2W9MA 2OH2A 4LT6A 2NRTA 3NRZA 5AKIA 1ZQPA 3AQLA 4Q43A 3BS5B 2B6GA 2Y9TA 2GAFD 5ALMA 2VANA 1TK8A 3NASA 1ZQZA 5AM1A 5HP4A 1BPXA 3E2EA 4RNOA 2Q0ZX 3SI8A 5HRBA 5ALJA 1LV5A 4UB5A 3MCRA 3NVWA 4RQ6A 9ICUA 4JK1A 7ICNA 4P4OA 1ZQIA 1X9SA 1ZQJA 1T94A 3V7LA 3TFSA 3HRDD 5KFUA 4RWPA 2RDIA 4M47A 2AQ0A 1B43A 3ETLA 5J0WA 3HX0A 3GIMA 2JHDA 4ZOHC 2YMLA 2W04A 3N7PD 3AU6A 3SENA 1RXVA 5CP2A 3OHAA 5KT5A 2BKEA 2WF9A 2LMRA 3ZDDA 8ICQA 1QH9A 5AM5A 3SYZA 5AKKA 3RJEA 3MR3A 2BCQA 1FFVA 4KLQA 3NVYA 2AH5A
chains in the Genus database with same CATH topology
1SL1A 5L1JA 4UBBA 2R8KA 9ICSA 4B9SA 4O3SA 2MAXA 5KFQA 4MEYA 1JQRA 1BPEA 9ICQA 4KLGA 3WFRE 3Q8KA 1BPYA 3ZDCA 2FMSA 1NK6A 4I2CA 4DQSA 2KZMA 1NK7A 2IBKA 1Q78A 5DG7A 2HHVA 2JEFA 4UD4A 4IRCA 4DS4A 4UAZA 3MFHA 1KFTA 4ZH4A 4DSJA 8ICRA 9ICPA 5D4BA 1NJXA 3GIIA 1D9DA 5J2HA 1SL2A 4EEYA 2BCRA 8ICCA 4AT8A 1ZQOA 3NGDA 3MGHA 3PW7A 3BQTA 4WC6A 4QZAA 7ICTA 4WC4A 3B0YA 7ICSA 3GDXA 5CR0A 4XQ8A 7ICKA 4J9PA 5KG6A 1ZETA 4PGYA 1A77A 5BPCA 2ZUCA 3MR6A 5J0RA 3PX6A 4DSEA 2KTQA 1SZPA 4F4ZA 1Z00A 4C8OA 5TZVA 4R64A 3JZ0A 5L9XA 1KDHA 5IIMA 5CJ7A 5D49A 3T5LA 4P2HA 3RR7A 5KT7A 3M9MB 1C7YA 5KFDA 3PW2A 5KG0A 4UD5A 4QWBA 2HHXA 3GILA 5KG7A 5J2IA 2R8GA 2VA2A 4RQ2A 3H4BA 5KFVA 4ECVA 3LDAA 9ICJA 1ZQFA 2ZH7A 5HRFA 4YVZA 4YN4A 4DF4A 2BR0A 9ICLA 4XRHA 4ECZA 2A1JA 2P6UA 7ICMA 1S0MA 3GIKA 3AQMA 2XCPA 1Y88A 5L1KA 4B9UA 4WC3A 4KLQA 2LYHA 3C2LA 8ICZA 4FHPA 3JPQA 3RH4A 3SV4A 4ATBA 1D9FA 5DLGA 1XSNA 7ICJA 4DSLA 3OHBA 3RBDA 3C2MA 7ICHA 9ICKA 4GLXA 3PVXA 5KFHA 2ZTEA 1UA0A 4DO9A 4F5QA 1AROP 3PY8A 4B9TA 3GV5B 2HHQA 5KFPA 1QTMA 4MEXA 4MFCA 3V7KA 8ICSA 1U4BA 2DVIA 4KLFA 8ICEA 4F4YA 4MFFA 5CA7A 3V6KA 4KLHA 2DR7A 3M8RA 4O3NA 4QZ8A 2DPIA 4RUCA 2DR9A 4IQVA 5BOMA 1VFGA 1X9WA 5J0UA 5KFJA 4Z6DA 4UB4A 5J0OA 4FS2A 2BGWA 4IQWA 9ICRA 7ICQA 4Q44A 4ED6A 1ZQNA 4O3QA 3MR2A 1L3TA 9ICTA 1BNOA 5KFRA 4X0AA 1UEUA 5J2CA 3QE9Y 3RJFA 4KLLA 4EBCA 1Z00B 5EWEA 3AQKA 1KFDA 2BE3A 1ZQXA 1ZQCA 4GXJA 8ICAA 3IM1A 4ECYA 4M6WA 1S0NA 5DQIA 3M9OB 1DK3A 3H8WA 3C2KA 4K4IA 4M0AA 4ECQA 4E8FA 4B9NA 2PI4A 4DFKA 2F1IA 1T8EA 3RBEA 4ED8A 4KLOA 3C1ZA 9ICGA 5DG8A 5J29A 8ICBA 2A1JB 3Q8LA 1BNPA 4MF8A 5HRGA 2NRKA 5KFOA 3Q8PB 4ECUA 4NKUA 5J0XA 4RQ1A 1PX5A 2BDPA 2JEGA 9ICHA 3TAPA 1FA0A 5J0QA 3BJYA 4WCWA 1QLNA 4UAYA 2O1PA 4PH5A 5KFXA 5KFIA 5DB7A 4YFKA 4ED2A 2ISPA 4DL3A 1ZYQA 2HVHA 4X4QA 3GV8B 4DQRA 5KFCA 1VJ7A 9ICWA 1N48A 3WFQE 5DLFA 4F93B 4PHDA 5IIKA 4JV1A 8ICPA 3HPOA 1T4GA 4F2SA 2ZUBA 3GFKB 1DK2A 4TURA 3PR5B 3JPTA 3UQ2A 2UVUA 1XSPA 4DSIA 5HRIA 2ASJA 1R8AA 2XC9A 4I2DA 5KFSA 4C8KA 4F4WA 5KTQA 3RB6A 1KLNA 2ZH4A 8ICKA 4NLNA 2PFQA 3OVAA 4YCXA 1COOA 4RQ0A 4RZRA 5DB8A 2KZ3A 2R8HA 4KLIA 2ZTCA 1L5UA 3OUYA 1U9LA 2VA8A 2KZZA 1L3UA 3AU2A 3K4GA 8ICOA 1CEZA 4WBYA 3H40A 1S0VA 1ZQUA 1IXRA 1XU4A 3OV7A 3RH6A 1KFSA 4EBJA 4UB3A 3EYZA 2KFZA 4R8UA 4RQ4A 1BPBA 4RNMA 4LVSA 3V7JA 1K1SA 2AGOA 4XUSA 1UA1A 4M6WB 1JN3A 4F91B 1ZQHA 4QW9A 1TAUA 4RPZA 1XS9D 1SKSA 4C8MA 4QWAA 3RRGA 1S76D 4MFAA 2HHTA 2FPKA 4JUZA 2W8LA 2J6TA 2DFLA 4DOAA 3AUOA 1NK4A 1R8CA 2PBEA 5DDMA 3HJ1A 2W9BA 2V9WA 4Q8FA 4RT3A 5KT2A 3T5KA 4RQ5A 1L3VA 4YQWA 2PFNA 5DKWA 3BQ1A 3N97B 2M2TA 4RWQA 3UPSA 4JWMA 5HHIA 8ICNA 5KT3A 3RJGA 4O3RA 8ICMA 2ATLA 4KLTA 4E80A 4X4TA 3EW9A 5DB6A 4KLDA 1BPZA 1XWLA 3WFOA 4PHEA 7ICLA 5IIJA 5KG5A 1XO1A 5J0TA 4QZGA 1D8LA 4R63A 3MDCA 3T3FA 1KRPA 4BXOA 3TFRA 5DEDA 4YD2A 4B9LA 4BDPA 1ZQKA 3Q8SB 4F2RA 4RUAA 5HRDA 4X4OA 4EZ9A 4DOCA 4FHXA 4M5DA 5J2BA 1NK8A 3RAXA 7ICVA 4Z6CA 2UVWA 3B0XA 1S0OA 3H8JA 2ALZA 2ISOA 3RR8A 3C5GA 5KFWA 4Q45A 2KFNA 2PFOA 1NO5A 2XGQA 3BQ2A 8ICTA 4NLKA 3AQNA 3QZ8A 5BOLA 3RB4A 3BDPA 1NOMA 1U49A 4QZCA 1S9FA 5DDYA 4J9RA 5HRLA 2UVVA 3MBYA 1ZQWA 5J0SA 5J2AA 3PMNA 5L1IA 4EZ6A 4O9MA 4E7XA 1JAJA 3OUYB 4IG8A 4WC2A 1PZNA 4EBKA 1L3SA 2FLNA 4K4HA 4DFMA 4O5EA 3TI0A 4I2GA 3C21A 4E0DA 7ICOA 3EWAA 5KG2A 3RJIA 3RJKA 5KG3A 4R8UB 3RRHA 2M2UA 1H38A 5HR9A 4YMNA 5KT4A 1MSWD 4ECWA 4NXZA 4RQ7A 4IR9A 3RAQA 4J9KA 3JYYA 1KTQA 2ZH8A 4EP7A 4J9MA 3TQ1A 3L9DA 3JPOA 2VA3A 1RZTA 1D8YA 1JMSA 1T7PA 2W9BB 3EZ5A 5J2FA 2ZH3A 4KN4A 9ICFA 2ZUDA 2W9CA 4KLSA 4RPYA 4NM1A 4QZHA 2W8KA 4O3OA 3EPIA 2AQ4A 3H7IA 4IQUA 4DWIA 4WC5A 4IRDA 2ZH9A 4YD1A 1NKBA 5KFMA 3RB3A 2C22A 3OJSA 2BCUA 3RTVA 4M9LA 1Q79A 2DRAA 3H4DA 3NTUA 1K1QA 5CHGA 4RU9A 3EPGA 1MQ3A 2OWOA 2HHUA 3LQCB 1ZQSA 1JIHA 2ZHBA 4BXOB 3C5FA 4PHPA 3THVA 7ICFA 7ICUA 3HP6A 4WC0A 4RWOA 4DS5A 4KLEA 5J2EA 3C23A 2DR5A 5KFNA 4WC1A 1BPDA 2ZJ8A 1X9MA 4C8LA 4FHYA 4Z6FA 3V6HA 4UAWA 1TK0A 2UVRA 2DRBA 2R8IA 3UPQA 3Q8QB 3JPNA 2IA6A 3PO5A 3OSNA 1U45A 1NK0A 1V9PA 9ICOA 4X4NA 5HHHA 4IQTA 4YXMA 5EWFA 1ZQDA 3ZD8A 1S10A 5J2DA 2NRXA 2AGPA 2J6UA 5EWGA 4MF2A 5HC9A 2FMPA 4I2HA 2M2WA 2BQ3A 1OU5A 5J2JA 4J9NA 2RFFA 1U48A 4X4PA 4EBDA 2V4RA 4TQSA 1EXNA 1QSSA 3QEBZ 3PW4A 1HJPA 3C66A 4EYIB 4I2IA 1UETA 2BQRA 4F4KA 5HRHA 3MABA 3RB0A 3C18A 3KHRA 4M9HA 2BPCA 2RDJA 8ICXA 2V4QA 3V6JA 3PW0A 2F1JA 3UQ0A 4JV0A 4HYKA 1HUZA 3H8SA 4TQRA 1TFRA 2NRWA 2AGQA 3N4MB 1IM4A 2C28A 4ED3A 5KFEA 1ZQBA 1SKWA 3ZD9A 4EYHB 3G6YA 4AT9A 3ZDEA 4DL5A 3PMLA 3PV8A 3ZDAA 1ZQLA 4RQ8A 2HHPA 4O5CA 4PPXA 2DPJA 8ICYA 9ICXA 4LZGA 4ED0A 1KEJA 2IHMA 4RWNA 3KHHA 2HHWA 4F5PA 3UXNA 3G6VA 2W9CB 4DQPA 4FBUA 4G3IA 3NYBA 4YR3A 2H5XA 2C2EA 1NJWA 1BVSA 4KTQA 5F9NA 4X4RA 2ZH1A 3LWMA 4FS1A 1SKRA 7ICEA 4KITB 4YP3A 4YMOA 1ZJNA 4QZEA 2I9GA 4KN7A 1ZQRA 2FPLA 5J0YA 5IIIA 8ICLA 4UB1A 4UBCA 5DGBA 3PX0A 4NM2A 5HRKA 3T5HA 4R65A 4DSKA 5HMLA 4KLUA 1MIWA 4QZBA 4RPXA 2BCVA 4GC7A 1LB2B 5F9LA 4YR0A 1RPLA 3KTQA 2DR8A 4B9MA 3GIJA 3ISCA 4O5KA 4R66A 4GC6A 1KSPA 5HMMA 4KMUA 4WC7A 4ELUA 9ICMA 7ICRA 4P4PA 4M9JA 8ICUA 1TKDA 4I2JA 5IINA 1BGXT 1ZQYA 4ELVA 1MIYA 2ZTDA 8ICGA 4QWEA 3K75D 3H38A 4FHWA 3Q8RB 3ORYA 3GQCA 4K4GA 5KG4A 1R89A 3JPPA 2ASLA 3ZDBA 2P6RA 2J6SA 1B22A 3UXPA 2O5AA 2Q66A 4DL2A 4DEZA 4PGQA 8ICWA 4S3NA 4B9VA 4QW8A 3JPSA 1RXWA 2ZJ5A 1XSLA 1TVAA 3HW8A 1NZPA 1YLQA 1MC8A 3OSPA 3TARA 2ZHAA 9ICNA 1TFYA 2HW3A 5J2GA 2JEIA 3TAQA 4M9NA 3FYHA 4DF8A 1X2IA 1Z3EB 5KFGA 1WOTA 4AT9B 4J9QA 5IIOA 3FDSA 3QZ7A 1TV9A 3GV7B 3T5JA 4NLGA 8ICJA 5HNKA 2Y1JA 2FMQA 4CCHA 1UT5A 4F5OA 3KHLA 3H37A 3V72A 4WBZA 2ZH5A 3MDAA 4ECRA 1DGSA 2NRVA 4KLJA 4F5RA 3HIYA 5KFZA 4F8RA 3TANA 3PX4A 1S77D 9ICEA 5C5JA 3SV3A 1V4AA 2M9NA 3C1YA 3OJUA 5J2KA 4J9SA 1ZQEA 2MUTA 5D46A 5KFLA 4P4MA 4DFPA 2GWSA 3HWTA 1HUOA 1DOQA 5JUMA 4FH3A 3HJ4A 2XGPA 4TUQA 4M9GA 1XC9A 4DLGA 4I29A 4NLZA 1F5AA 3MFIA 2IHNA 1R8BA 4ECTA 1U47A 3H39A 5KFTA 4YG2A 2FPMA 1TAQA 5KFBA 3RH5A 4O3PA 4YXJA 4QWDA 5KFKA 1CUKA 5DBCA 5DQHA 2KN7A 1MQ2A 1ZQAA 2JEJA 2PI5A 4QZDA 1QSYA 1NJZA 2XY5A 2BPFA 2IMWP 2AU0A 4I2FA 4PGXA 1NKEA 7ICGA 4DL6A 4FHVA 4I2BA 3OVBA 3PNCA 4BWMA 1S97A 4DOBA 2Y1IA 2F1HA 5KT6A 5DBAA 4XQ7A 4DL7A 2JZBA 7ICIA 1TFWA 4X4VA 4RQ3A 1NK9A 4XA5A 4O0IA 3RJJA 4JV2A 2FLLA 2ID1A 4ECSA 4I2EA 5CB1A 4AT7A 3HT3A 1UT8A 2R8JA 4RNNA 4UQGA 3SZ2A 3LK9A 3MR5A 3QEAZ 4X5VA 4X4SA 3OVSA 3H3AA 2P66A 4X4UA 9ICCA 4NKTA 4DFJA 4GXKA 4I2AA 2HVIA 3Q8MA 4Z6EA 2WTFA 2M2VA 2ZH2A 4C8NA 2C2DA 5DB9A 4BGDA 5KG1A 1TK5A 3MGIA 4I27A 4AT8B 4ELTA 2XY6A 2ASDA 4QZFA 1KNYA 1NJYA 4FO6A 4IR1A 5DECA 3PW5A 2ZH6A 4TUPA 3PR4A 2XCAA 1NK5A 4F50A 2KP7A 4IRKA 2W9AA 2W9MA 5HREA 2BHNA 2NRTA 4LT6A 2BQUA 4ECXA 1ZQPA 5L1LA 4NY8A 2C2RA 1JXLA 4BWJA 4DQIA 4Q8EA 8ICFA 4JWNA 3AQLA 4Q43A 8ICVA 1UEVA 2ZJAA 3UXOA 4F3OA 5J0PA 2MUTB 2FLPA 4YMMA 4F5NA 2PFPA 5KFYA 4RT2A 2VANA 3ISBA 4ED1A 1TK8A 2BPGA 4QZ9A 1ZQZA 4ED7A 5HP4A 1JXEA 1BPXA 1WCNA 1ZQGA 7ICPA 3E2EA 2XY7A 4M04A 2PXIA 1QSLA 4RNOA 3OGUA 8ICHA 4FBTA 2Q0ZX 3LWLA 3ISDA 4PHAA 3SI8A 3PO4A 2HHSA 8ICIA 1LV5A 5HRBA 4UB5A 9ICIA 5DG9A 4DL4A 4ATBB 4RQ6A 2NRZA 1ZQMA 9ICUA 4JK1A 7ICNA 4LZDA 4X0BA 1N56A 3IHQB 1WCLA 4DLEA 5F2VO 5EOZA 1NKCA 4P4OA 1ZQIA 1X9SA 3JPRA 1ZQJA 9ICBA 2JZBB 5IILA 4J9OA 3V7LA 3M9NB 3TFSA 1ZQTA 5DBBA 4QZIA 5CWRA 2I1QA 5DGAA 5KFUA 4UB2A 4F92B 4QWCA 3KHGA 4GXIA 2RDIA 4EBEA 2AJQA 4AT7B 4RWPA 5KFFA 1SL0A 2AQ0A 1B43A 3M8SA 4M47A 4DQQA 3ETLA 5J0WA 2XO7A 3HX0A 3GIMA 1T3NA 1RYSA 9ICVA 4J9LA 4F4XA 5KFAA 4DSFA 3AU6A 4I28A 1RXVA 1ZJMA 1ZQVA 5CP2A 3OHAA 4M2YA 1A76A 5KT5A 5DQGA 4FH5A 3RJHA 2BKEA 1JX4A 3BQ0A 3ZDDA 8ICQA 4YR2A 1RYRA 1ZQQA 3WFPA 3SYZA 3G6XA 3WFSC 4KLMA 1MIVA 3RJEA 3MR3A 2B21A 2BCQA 4TUSA 2BCSA 9ICAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SL1 A;  5L1J A;  4UBB A;  2R8K A;  9ICS A;  4B9S A;  4O3S A;  2MAX A;  5KFQ A;  4MEY A;  1JQR A;  1BPE A;  9ICQ A;  4KLG A;  3WFR E;  3Q8K A;  1BPY A;  3ZDC A;  2FMS A;  1NK6 A;  4I2C A;  4DQS A;  2KZM A;  1NK7 A;  2IBK A;  1Q78 A;  5DG7 A;  2HHV A;  2JEF A;  4UD4 A;  4IRC A;  4DS4 A;  4UAZ A;  3MFH A;  1KFT A;  4ZH4 A;  4DSJ A;  8ICR A;  9ICP A;  5D4B A;  1NJX A;  3GII A;  1D9D A;  5J2H A;  1SL2 A;  4EEY A;  2BCR A;  8ICC A;  4AT8 A;  1ZQO A;  3NGD A;  3MGH A;  3PW7 A;  3BQT A;  4WC6 A;  4QZA A;  7ICT A;  4WC4 A;  3B0Y A;  7ICS A;  3GDX A;  5CR0 A;  4XQ8 A;  7ICK A;  4J9P A;  5KG6 A;  1ZET A;  4PGY A;  1A77 A;  5BPC A;  2ZUC A;  3MR6 A;  5J0R A;  3PX6 A;  4DSE A;  2KTQ A;  1SZP A;  4F4Z A;  1Z00 A;  4C8O A;  5TZV A;  4R64 A;  3JZ0 A;  5L9X A;  1KDH A;  5IIM A;  5CJ7 A;  5D49 A;  3T5L A;  4P2H A;  3RR7 A;  5KT7 A;  3M9M B;  1C7Y A;  5KFD A;  3PW2 A;  5KG0 A;  4UD5 A;  4QWB A;  2HHX A;  3GIL A;  5KG7 A;  5J2I A;  2R8G A;  2VA2 A;  4RQ2 A;  3H4B A;  5KFV A;  4ECV A;  3LDA A;  9ICJ A;  1ZQF A;  2ZH7 A;  5HRF A;  4YVZ A;  4YN4 A;  4DF4 A;  2BR0 A;  9ICL A;  4XRH A;  4ECZ A;  2A1J A;  2P6U A;  7ICM A;  1S0M A;  3GIK A;  3AQM A;  2XCP A;  1Y88 A;  5L1K A;  4B9U A;  4WC3 A;  4KLQ A;  2LYH A;  3C2L A;  8ICZ A;  4FHP A;  3JPQ A;  3RH4 A;  3SV4 A;  4ATB A;  1D9F A;  5DLG A;  1XSN A;  7ICJ A;  4DSL A;  3OHB A;  3RBD A;  3C2M A;  7ICH A;  9ICK A;  4GLX A;  3PVX A;  5KFH A;  2ZTE A;  1UA0 A;  4DO9 A;  4F5Q A;  1ARO P;  3PY8 A;  4B9T A;  3GV5 B;  2HHQ A;  5KFP A;  1QTM A;  4MEX A;  4MFC A;  3V7K A;  8ICS A;  1U4B A;  2DVI A;  4KLF A;  8ICE A;  4F4Y A;  4MFF A;  5CA7 A;  3V6K A;  4KLH A;  2DR7 A;  3M8R A;  4O3N A;  4QZ8 A;  2DPI A;  4RUC A;  2DR9 A;  4IQV A;  5BOM A;  1VFG A;  1X9W A;  5J0U A;  5KFJ A;  4Z6D A;  4UB4 A;  5J0O A;  4FS2 A;  2BGW A;  4IQW A;  9ICR A;  7ICQ A;  4Q44 A;  4ED6 A;  1ZQN A;  4O3Q A;  3MR2 A;  1L3T A;  9ICT A;  1BNO A;  5KFR A;  4X0A A;  1UEU A;  5J2C A;  3QE9 Y;  3RJF A;  4KLL A;  4EBC A;  1Z00 B;  5EWE A;  3AQK A;  1KFD A;  2BE3 A;  1ZQX A;  1ZQC A;  4GXJ A;  8ICA A;  3IM1 A;  4ECY A;  4M6W A;  1S0N A;  5DQI A;  3M9O B;  1DK3 A;  3H8W A;  3C2K A;  4K4I A;  4M0A A;  4ECQ A;  4E8F A;  4B9N A;  2PI4 A;  4DFK A;  2F1I A;  1T8E A;  3RBE A;  4ED8 A;  4KLO A;  3C1Z A;  9ICG A;  5DG8 A;  5J29 A;  8ICB A;  2A1J B;  3Q8L A;  1BNP A;  4MF8 A;  5HRG A;  2NRK A;  5KFO A;  3Q8P B;  4ECU A;  4NKU A;  5J0X A;  4RQ1 A;  1PX5 A;  2BDP A;  2JEG A;  9ICH A;  3TAP A;  1FA0 A;  5J0Q A;  3BJY A;  4WCW A;  1QLN A;  4UAY A;  2O1P A;  4PH5 A;  5KFX A;  5KFI A;  5DB7 A;  4YFK A;  4ED2 A;  2ISP A;  4DL3 A;  1ZYQ A;  2HVH A;  4X4Q A;  3GV8 B;  4DQR A;  5KFC A;  1VJ7 A;  9ICW A;  1N48 A;  3WFQ E;  5DLF A;  4F93 B;  4PHD A;  5IIK A;  4JV1 A;  8ICP A;  3HPO A;  1T4G A;  4F2S A;  2ZUB A;  3GFK B;  1DK2 A;  4TUR A;  3PR5 B;  3JPT A;  3UQ2 A;  2UVU A;  1XSP A;  4DSI A;  5HRI A;  2ASJ A;  1R8A A;  2XC9 A;  4I2D A;  5KFS A;  4C8K A;  4F4W A;  5KTQ A;  3RB6 A;  1KLN A;  2ZH4 A;  8ICK A;  4NLN A;  2PFQ A;  3OVA A;  4YCX A;  1COO A;  4RQ0 A;  4RZR A;  5DB8 A;  2KZ3 A;  2R8H A;  4KLI A;  2ZTC A;  1L5U A;  3OUY A;  1U9L A;  2VA8 A;  2KZZ A;  1L3U A;  3AU2 A;  3K4G A;  8ICO A;  1CEZ A;  4WBY A;  3H40 A;  1S0V A;  1ZQU A;  1IXR A;  1XU4 A;  3OV7 A;  3RH6 A;  1KFS A;  4EBJ A;  4UB3 A;  3EYZ A;  2KFZ A;  4R8U A;  4RQ4 A;  1BPB A;  4RNM A;  4LVS A;  3V7J A;  1K1S A;  2AGO A;  4XUS A;  1UA1 A;  4M6W B;  1JN3 A;  4F91 B;  1ZQH A;  4QW9 A;  1TAU A;  4RPZ A;  1XS9 D;  1SKS A;  4C8M A;  4QWA A;  3RRG A;  1S76 D;  4MFA A;  2HHT A;  2FPK A;  4JUZ A;  2W8L A;  2J6T A;  2DFL A;  4DOA A;  3AUO A;  1NK4 A;  1R8C A;  2PBE A;  5DDM A;  3HJ1 A;  2W9B A;  2V9W A;  4Q8F A;  4RT3 A;  5KT2 A;  3T5K A;  4RQ5 A;  1L3V A;  4YQW A;  2PFN A;  5DKW A;  3BQ1 A;  3N97 B;  2M2T A;  4RWQ A;  3UPS A;  4JWM A;  5HHI A;  8ICN A;  5KT3 A;  3RJG A;  4O3R A;  8ICM A;  2ATL A;  4KLT A;  4E80 A;  4X4T A;  3EW9 A;  5DB6 A;  4KLD A;  1BPZ A;  1XWL A;  3WFO A;  4PHE A;  7ICL A;  5IIJ A;  5KG5 A;  1XO1 A;  5J0T A;  4QZG A;  1D8L A;  4R63 A;  3MDC A;  3T3F A;  1KRP A;  4BXO A;  3TFR A;  5DED A;  4YD2 A;  4B9L A;  4BDP A;  1ZQK A;  3Q8S B;  4F2R A;  4RUA A;  5HRD A;  4X4O A;  4EZ9 A;  4DOC A;  4FHX A;  4M5D A;  5J2B A;  1NK8 A;  3RAX A;  7ICV A;  4Z6C A;  2UVW A;  3B0X A;  1S0O A;  3H8J A;  2ALZ A;  2ISO A;  3RR8 A;  3C5G A;  5KFW A;  4Q45 A;  2KFN A;  2PFO A;  1NO5 A;  2XGQ A;  3BQ2 A;  8ICT A;  4NLK A;  3AQN A;  3QZ8 A;  5BOL A;  3RB4 A;  3BDP A;  1NOM A;  1U49 A;  4QZC A;  1S9F A;  5DDY A;  4J9R A;  5HRL A;  2UVV A;  3MBY A;  1ZQW A;  5J0S A;  5J2A A;  3PMN A;  5L1I A;  4EZ6 A;  4O9M A;  4E7X A;  1JAJ A;  3OUY B;  4IG8 A;  4WC2 A;  1PZN A;  4EBK A;  1L3S A;  2FLN A;  4K4H A;  4DFM A;  4O5E A;  3TI0 A;  4I2G A;  3C21 A;  4E0D A;  7ICO A;  3EWA A;  5KG2 A;  3RJI A;  3RJK A;  5KG3 A;  4R8U B;  3RRH A;  2M2U A;  1H38 A;  5HR9 A;  4YMN A;  5KT4 A;  1MSW D;  4ECW A;  4NXZ A;  4RQ7 A;  4IR9 A;  3RAQ A;  4J9K A;  3JYY A;  1KTQ A;  2ZH8 A;  4EP7 A;  4J9M A;  3TQ1 A;  3L9D A;  3JPO A;  2VA3 A;  1RZT A;  1D8Y A;  1JMS A;  1T7P A;  2W9B B;  3EZ5 A;  5J2F A;  2ZH3 A;  4KN4 A;  9ICF A;  2ZUD A;  2W9C A;  4KLS A;  4RPY A;  4NM1 A;  4QZH A;  2W8K A;  4O3O A;  3EPI A;  2AQ4 A;  3H7I A;  4IQU A;  4DWI A;  4WC5 A;  4IRD A;  2ZH9 A;  4YD1 A;  1NKB A;  5KFM A;  3RB3 A;  2C22 A;  3OJS A;  2BCU A;  3RTV A;  4M9L A;  1Q79 A;  2DRA A;  3H4D A;  3NTU A;  1K1Q A;  5CHG A;  4RU9 A;  3EPG A;  1MQ3 A;  2OWO A;  2HHU A;  3LQC B;  1ZQS A;  1JIH A;  2ZHB A;  4BXO B;  3C5F A;  4PHP A;  3THV A;  7ICF A;  7ICU A;  3HP6 A;  4WC0 A;  4RWO A;  4DS5 A;  4KLE A;  5J2E A;  3C23 A;  2DR5 A;  5KFN A;  4WC1 A;  1BPD A;  2ZJ8 A;  1X9M A;  4C8L A;  4FHY A;  4Z6F A;  3V6H A;  4UAW A;  1TK0 A;  2UVR A;  2DRB A;  2R8I A;  3UPQ A;  3Q8Q B;  3JPN A;  2IA6 A;  3PO5 A;  3OSN A;  1U45 A;  1NK0 A;  1V9P A;  9ICO A;  4X4N A;  5HHH A;  4IQT A;  4YXM A;  5EWF A;  1ZQD A;  3ZD8 A;  1S10 A;  5J2D A;  2NRX A;  2AGP A;  2J6U A;  5EWG A;  4MF2 A;  5HC9 A;  2FMP A;  4I2H A;  2M2W A;  2BQ3 A;  1OU5 A;  5J2J A;  4J9N A;  2RFF A;  1U48 A;  4X4P A;  4EBD A;  2V4R A;  4TQS A;  1EXN A;  1QSS A;  3QEB Z;  3PW4 A;  1HJP A;  3C66 A;  4EYI B;  4I2I A;  1UET A;  2BQR A;  4F4K A;  5HRH A;  3MAB A;  3RB0 A;  3C18 A;  3KHR A;  4M9H A;  2BPC A;  2RDJ A;  8ICX A;  2V4Q A;  3V6J A;  3PW0 A;  2F1J A;  3UQ0 A;  4JV0 A;  4HYK A;  1HUZ A;  3H8S A;  4TQR A;  1TFR A;  2NRW A;  2AGQ A;  3N4M B;  1IM4 A;  2C28 A;  4ED3 A;  5KFE A;  1ZQB A;  1SKW A;  3ZD9 A;  4EYH B;  3G6Y A;  4AT9 A;  3ZDE A;  4DL5 A;  3PML A;  3PV8 A;  3ZDA A;  1ZQL A;  4RQ8 A;  2HHP A;  4O5C A;  4PPX A;  2DPJ A;  8ICY A;  9ICX A;  4LZG A;  4ED0 A;  1KEJ A;  2IHM A;  4RWN A;  3KHH A;  2HHW A;  4F5P A;  3UXN A;  3G6V A;  2W9C B;  4DQP A;  4FBU A;  4G3I A;  3NYB A;  4YR3 A;  2H5X A;  2C2E A;  1NJW A;  1BVS A;  4KTQ A;  5F9N A;  4X4R A;  2ZH1 A;  3LWM A;  4FS1 A;  1SKR A;  7ICE A;  4KIT B;  4YP3 A;  4YMO A;  1ZJN A;  4QZE A;  2I9G A;  4KN7 A;  1ZQR A;  2FPL A;  5J0Y A;  5III A;  8ICL A;  4UB1 A;  4UBC A;  5DGB A;  3PX0 A;  4NM2 A;  5HRK A;  3T5H A;  4R65 A;  4DSK A;  5HML A;  4KLU A;  1MIW A;  4QZB A;  4RPX A;  2BCV A;  4GC7 A;  1LB2 B;  5F9L A;  4YR0 A;  1RPL A;  3KTQ A;  2DR8 A;  4B9M A;  3GIJ A;  3ISC A;  4O5K A;  4R66 A;  4GC6 A;  1KSP A;  5HMM A;  4KMU A;  4WC7 A;  4ELU A;  9ICM A;  7ICR A;  4P4P A;  4M9J A;  8ICU A;  1TKD A;  4I2J A;  5IIN A;  1BGX T;  1ZQY A;  4ELV A;  1MIY A;  2ZTD A;  8ICG A;  4QWE A;  3K75 D;  3H38 A;  4FHW A;  3Q8R B;  3ORY A;  3GQC A;  4K4G A;  5KG4 A;  1R89 A;  3JPP A;  2ASL A;  3ZDB A;  2P6R A;  2J6S A;  1B22 A;  3UXP A;  2O5A A;  2Q66 A;  4DL2 A;  4DEZ A;  4PGQ A;  8ICW A;  4S3N A;  4B9V A;  4QW8 A;  3JPS A;  1RXW A;  2ZJ5 A;  1XSL A;  1TVA A;  3HW8 A;  1NZP A;  1YLQ A;  1MC8 A;  3OSP A;  3TAR A;  2ZHA A;  9ICN A;  1TFY A;  2HW3 A;  5J2G A;  2JEI A;  3TAQ A;  4M9N A;  3FYH A;  4DF8 A;  1X2I A;  1Z3E B;  5KFG A;  1WOT A;  4AT9 B;  4J9Q A;  5IIO A;  3FDS A;  3QZ7 A;  1TV9 A;  3GV7 B;  3T5J A;  4NLG A;  8ICJ A;  5HNK A;  2Y1J A;  2FMQ A;  4CCH A;  1UT5 A;  4F5O A;  3KHL A;  3H37 A;  3V72 A;  4WBZ A;  2ZH5 A;  3MDA A;  4ECR A;  1DGS A;  2NRV A;  4KLJ A;  4F5R A;  3HIY A;  5KFZ A;  4F8R A;  3TAN A;  3PX4 A;  1S77 D;  9ICE A;  5C5J A;  3SV3 A;  1V4A A;  2M9N A;  3C1Y A;  3OJU A;  5J2K A;  4J9S A;  1ZQE A;  2MUT A;  5D46 A;  5KFL A;  4P4M A;  4DFP A;  2GWS A;  3HWT A;  1HUO A;  1DOQ A;  5JUM A;  4FH3 A;  3HJ4 A;  2XGP A;  4TUQ A;  4M9G A;  1XC9 A;  4DLG A;  4I29 A;  4NLZ A;  1F5A A;  3MFI A;  2IHN A;  1R8B A;  4ECT A;  1U47 A;  3H39 A;  5KFT A;  4YG2 A;  2FPM A;  1TAQ A;  5KFB A;  3RH5 A;  4O3P A;  4YXJ A;  4QWD A;  5KFK A;  1CUK A;  5DBC A;  5DQH A;  2KN7 A;  1MQ2 A;  1ZQA A;  2JEJ A;  2PI5 A;  4QZD A;  1QSY A;  1NJZ A;  2XY5 A;  2BPF A;  2IMW P;  2AU0 A;  4I2F A;  4PGX A;  1NKE A;  7ICG A;  4DL6 A;  4FHV A;  4I2B A;  3OVB A;  3PNC A;  4BWM A;  1S97 A;  4DOB A;  2Y1I A;  2F1H A;  5KT6 A;  5DBA A;  4XQ7 A;  4DL7 A;  2JZB A;  7ICI A;  1TFW A;  4X4V A;  4RQ3 A;  1NK9 A;  4XA5 A;  4O0I A;  3RJJ A;  4JV2 A;  2FLL A;  2ID1 A;  4ECS A;  4I2E A;  5CB1 A;  4AT7 A;  3HT3 A;  1UT8 A;  2R8J A;  4RNN A;  4UQG A;  3SZ2 A;  3LK9 A;  3MR5 A;  3QEA Z;  4X5V A;  4X4S A;  3OVS A;  3H3A A;  2P66 A;  4X4U A;  9ICC A;  4NKT A;  4DFJ A;  4GXK A;  4I2A A;  2HVI A;  3Q8M A;  4Z6E A;  2WTF A;  2M2V A;  2ZH2 A;  4C8N A;  2C2D A;  5DB9 A;  4BGD A;  5KG1 A;  1TK5 A;  3MGI A;  4I27 A;  4AT8 B;  4ELT A;  2XY6 A;  2ASD A;  4QZF A;  1KNY A;  1NJY A;  4FO6 A;  4IR1 A;  5DEC A;  3PW5 A;  2ZH6 A;  4TUP A;  3PR4 A;  2XCA A;  1NK5 A;  4F50 A;  2KP7 A;  4IRK A;  2W9A A;  2W9M A;  5HRE A;  2BHN A;  2NRT A;  4LT6 A;  2BQU A;  4ECX A;  1ZQP A;  5L1L A;  4NY8 A;  2C2R A;  1JXL A;  4BWJ A;  4DQI A;  4Q8E A;  8ICF A;  4JWN A;  3AQL A;  4Q43 A;  8ICV A;  1UEV A;  2ZJA A;  3UXO A;  4F3O A;  5J0P A;  2MUT B;  2FLP A;  4YMM A;  4F5N A;  2PFP A;  5KFY A;  4RT2 A;  2VAN A;  3ISB A;  4ED1 A;  1TK8 A;  2BPG A;  4QZ9 A;  1ZQZ A;  4ED7 A;  5HP4 A;  1JXE A;  1BPX A;  1WCN A;  1ZQG A;  7ICP A;  3E2E A;  2XY7 A;  4M04 A;  2PXI A;  1QSL A;  4RNO A;  3OGU A;  8ICH A;  4FBT A;  2Q0Z X;  3LWL A;  3ISD A;  4PHA A;  3SI8 A;  3PO4 A;  2HHS A;  8ICI A;  1LV5 A;  5HRB A;  4UB5 A;  9ICI A;  5DG9 A;  4DL4 A;  4ATB B;  4RQ6 A;  2NRZ A;  1ZQM A;  9ICU A;  4JK1 A;  7ICN A;  4LZD A;  4X0B A;  1N56 A;  3IHQ B;  1WCL A;  4DLE A;  5F2V O;  5EOZ A;  1NKC A;  4P4O A;  1ZQI A;  1X9S A;  3JPR A;  1ZQJ A;  9ICB A;  2JZB B;  5IIL A;  4J9O A;  3V7L A;  3M9N B;  3TFS A;  1ZQT A;  5DBB A;  4QZI A;  5CWR A;  2I1Q A;  5DGA A;  5KFU A;  4UB2 A;  4F92 B;  4QWC A;  3KHG A;  4GXI A;  2RDI A;  4EBE A;  2AJQ A;  4AT7 B;  4RWP A;  5KFF A;  1SL0 A;  2AQ0 A;  1B43 A;  3M8S A;  4M47 A;  4DQQ A;  3ETL A;  5J0W A;  2XO7 A;  3HX0 A;  3GIM A;  1T3N A;  1RYS A;  9ICV A;  4J9L A;  4F4X A;  5KFA A;  4DSF A;  3AU6 A;  4I28 A;  1RXV A;  1ZJM A;  1ZQV A;  5CP2 A;  3OHA A;  4M2Y A;  1A76 A;  5KT5 A;  5DQG A;  4FH5 A;  3RJH A;  2BKE A;  1JX4 A;  3BQ0 A;  3ZDD A;  8ICQ A;  4YR2 A;  1RYR A;  1ZQQ A;  3WFP A;  3SYZ A;  3G6X A;  3WFS C;  4KLM A;  1MIV A;  3RJE A;  3MR3 A;  2B21 A;  2BCQ A;  4TUS A;  2BCS A;  9ICA A; 
#chains in the Genus database with same CATH topology
 1SL1 A;  2MAX A;  5KFQ A;  2A3V A;  3QUQ A;  4KLG A;  1J2M A;  4B6J A;  2JEF A;  2HN1 A;  4IRC A;  2E1F A;  5ALY A;  2DQN B;  3MFH A;  5H2F U;  5ALT A;  4AT8 A;  4WOY A;  3QYP A;  1ZQO A;  3MGH A;  2E1E A;  1SWW A;  7ICK A;  5CR0 A;  4LEY A;  1ZET A;  3MR6 A;  4DSE A;  5TZV A;  3JZ0 A;  3AMZ A;  3T5L A;  5KT7 A;  5KG0 A;  4WQK A;  1CI4 A;  4XJE A;  5KG7 A;  2VA2 A;  3H4B A;  2LM1 A;  1ZQF A;  2HBJ A;  2BR0 A;  4XRH A;  3F53 A;  2A1J A;  2JMG A;  2P6U A;  1PUZ A;  4OAH A;  3KD3 A;  2CRX A;  5L1K A;  2LYH A;  3C2L A;  8ICZ A;  4ATB A;  3QU7 A;  2HOQ A;  5DLG A;  3RBD A;  4K99 A;  3C2M A;  3GU3 A;  4FFD A;  1ZD5 A;  1KL9 A;  4GLX A;  2EZY A;  5KFH A;  2ZTE A;  3PY8 A;  4B9T A;  4MFC A;  3V7K A;  1U4B A;  2W7P A;  4WH5 A;  3N28 A;  4F4Y A;  4MFF A;  4O3N A;  3C29 A;  4RUC A;  1N60 A;  4IQV A;  4IC9 A;  4UB4 A;  3L4P A;  2LHT A;  4NWI A;  3WK5 A;  4Q44 A;  3MR2 A;  1L3T A;  4X0A A;  5J2C A;  3QE9 Y;  4KLL A;  4PL1 A;  3AQK A;  1KFD A;  1UHU A;  3OPX A;  3IM1 A;  4ECY A;  1L7N A;  3E58 A;  4F71 A;  3D2S A;  2ESE A;  5J29 A;  2A1J B;  2NRK A;  4RQ1 A;  2JEG A;  3BJY A;  4CF3 A;  5KFX A;  5ALE A;  5KFI A;  4X4Q A;  5KFC A;  2EZX A;  2ES6 A;  2WB1 F;  2KE7 A;  1DK2 A;  5ALF A;  4F4W A;  5KTQ A;  2LM4 A;  8ICK A;  4NLN A;  4RZR A;  2R8H A;  2KZ3 A;  1JAL A;  1L5U A;  4EV6 A;  1SIJ A;  5G5H A;  3WKD A;  2NO5 A;  4K96 A;  5JRT A;  3RH6 A;  1KFS A;  4JLZ A;  1ZRN A;  2KFZ A;  3SEI A;  4RQ4 A;  1ZQH A;  1Z4N A;  1XS9 D;  2HHT A;  2W8L A;  2FCL A;  4Q8F A;  4RT3 A;  3T5K A;  3UPS A;  5B5E U;  8ICN A;  3RJG A;  8ICM A;  4X4T A;  2ZXH A;  1BPZ A;  3NRW A;  4P0P A;  3MDC A;  3T3F A;  1L7M A;  1KRP A;  4BDP A;  1ZQK A;  3Q8S B;  3TKA A;  3RAX A;  2KVC A;  2UVW A;  4C7Z A;  2ISO A;  5KFW A;  2KFN A;  8ICT A;  2W43 A;  5AKL A;  4NLK A;  3QZ8 A;  3BDP A;  1U49 A;  4QZC A;  1S9F A;  5DDY A;  4J9R A;  5L1I A;  4E7X A;  4IG8 A;  1PZN A;  5ALV A;  2W7O A;  5D62 A;  3QUB A;  4I2G A;  7ICO A;  1TAM A;  3RJI A;  2OXO A;  5D63 A;  2M2U A;  1H38 A;  3B9J A;  5KT4 A;  1OW5 A;  4RQ7 A;  3RAQ A;  1KTQ A;  2ZH8 A;  4J9M A;  3DDH A;  3JCF A;  5GTI U;  3PST A;  2VA3 A;  4PJ0 U;  2W9C A;  4RPY A;  2Q66 A;  4WC5 A;  4IQU A;  5JU5 A;  2HCF A;  2K60 A;  3RTV A;  3NTU A;  1F0M A;  3EPG A;  2B4V A;  4RWO A;  4DS5 A;  4KLE A;  5J2E A;  2DR5 A;  4PZO A;  5KFN A;  4C8L A;  4Z6F A;  4AYB C;  1F5S A;  3UPQ A;  5ALU A;  3Q8Q B;  4FZM A;  1U45 A;  2MA1 A;  4X4N A;  3AQE A;  5HHH A;  1N5X A;  4YXM A;  4O68 A;  3WKB A;  5J2D A;  2J6U A;  4MF2 A;  4I2H A;  2M2W A;  1OU5 A;  5J2J A;  4EBD A;  1QSS A;  4EYI B;  5AM2 A;  5HRH A;  2HMX A;  2ZIX A;  3KHR A;  8ICX A;  2V4Q A;  2EAP A;  4JV0 A;  1QQ5 A;  1HUZ A;  3N4M B;  1IM4 A;  2C28 A;  1SKW A;  5HR7 A;  1M6Y A;  3T79 A;  4O5C A;  1OUQ A;  1NNL A;  3DV9 A;  8ICY A;  9ICX A;  4ED0 A;  1KEJ A;  4F5P A;  2W9C B;  3I1Y A;  3NVZ A;  5AHX A;  3LWM A;  2YMP A;  1SKR A;  1ZJN A;  3AN1 A;  1ZQR A;  4UBC A;  5DGB A;  3ICX A;  4R65 A;  4DSK A;  5ALR A;  2HN2 A;  4QZB A;  4RPX A;  1RPL A;  4O5K A;  3GIJ A;  1O03 A;  3ISC A;  4R66 A;  4FE3 A;  1S8O A;  1UCV A;  7ICR A;  2QAR A;  3SAG A;  5IIN A;  1ZQY A;  1N62 A;  2ZTD A;  4QWE A;  5AIA A;  4K4G A;  1PVP A;  1B22 A;  2P6R A;  2JR5 A;  2ZIX B;  2O5A A;  4DEZ A;  3HJE A;  2FDR A;  2G08 A;  2ZJ5 A;  2ZHA A;  1MC8 A;  4C4R A;  3TAR A;  3OSP A;  1TFY A;  3IDW A;  4EEL A;  3AQF A;  2ZIV A;  4M9N A;  2EAM A;  1B4F A;  2W11 A;  1TV9 A;  4CGZ A;  3T5J A;  4NLG A;  2BZF A;  3V72 A;  4J03 A;  3HIY A;  5KFZ A;  1Z19 A;  4EED A;  1KKX A;  5C5J A;  3SV3 A;  1V4A A;  3F2D A;  2MUT A;  2WAQ C;  3HWT A;  4TUQ A;  2G09 A;  2GA9 D;  4YXJ A;  4QWD A;  2LKY A;  4QZD A;  1O08 A;  1Z4O A;  4PGX A;  2HOI A;  2EWR A;  2Y1I A;  1TFW A;  2JZB A;  2FI1 A;  4I2E A;  5ALO A;  2XID A;  3KZI U;  2FE9 A;  3SZ2 A;  3H3A A;  2P66 A;  4GXK A;  3ZI4 A;  1MN8 A;  4Z6E A;  2M2V A;  2PMZ C;  4BGD A;  2MRL A;  4EEN A;  4LEW A;  1SWV A;  4UAS A;  4F50 A;  4Y2X A;  4IRK A;  1Z1V A;  2I6X A;  2W9A A;  3IN5 A;  4O6A A;  5AKY A;  4USA A;  8ICV A;  4F3O A;  5J8Y A;  2MUT B;  2IOF K;  2FLP A;  1J97 A;  2GLE A;  4QZ9 A;  1X40 A;  3BS7 A;  3UMC A;  3MGV A;  7ICP A;  2XY7 A;  3LWL A;  3ISD A;  4GIB A;  5AIC A;  2HHS A;  9ICI A;  3K7D A;  4DLE A;  1WCL A;  2KEY A;  2KJ5 A;  3JPR A;  9ICB A;  2JZB B;  3TAC B;  4J9O A;  3M9N B;  5DBB A;  4QZI A;  3IRU A;  5DGA A;  4GXI A;  3KHG A;  4EBE A;  1SL0 A;  1P7D A;  4MKP A;  3VC8 A;  4F4X A;  5HR6 A;  4M2Y A;  5JTG A;  5DQG A;  4FH5 A;  3RJH A;  5AI6 A;  1JX4 A;  2D6F C;  1ZQQ A;  1FFU A;  4QJF B;  4K97 A;  3KFU F;  2B21 A;  2BCS A;  4TUS A;  2WF8 A;  5L1J A;  9ICS A;  4O3S A;  1F44 A;  1JQR A;  3Q8K A;  1BPY A;  9ICG A;  2FMS A;  5AK5 A;  1Q78 A;  3SMV A;  2HHV A;  2LYB A;  4DS4 A;  4UAZ A;  2QB0 A;  4ZH4 A;  8ICR A;  2Y0S C;  5D4B A;  2IUB A;  2HSZ A;  1D9D A;  5AI4 A;  5AM3 A;  3NGD A;  3PW7 A;  2KVS A;  1KN5 A;  4J9P A;  4QIW C;  2ZIU A;  3PX6 A;  1SZP A;  4C8O A;  4R64 A;  2DKX A;  4P2H A;  5L1M A;  2D3D A;  2WFA A;  4EEK A;  1ECW A;  5KFV A;  4NLB A;  4ECZ A;  3GIK A;  4WC3 A;  1Y88 A;  2VJ5 A;  2LPE A;  3DEE A;  7ICJ A;  4O3M A;  7ICH A;  3AL0 B;  9ICK A;  1UA0 A;  4DO9 A;  4CE6 A;  4KLF A;  8ICE A;  1YT3 A;  3M8R A;  2HOF A;  4QZ8 A;  2QB0 B;  2Y9U A;  5ALQ A;  1DXS A;  1NZB A;  2IHO A;  4RQM A;  1URJ A;  4Z6D A;  2BGW A;  9ICR A;  1ZD4 A;  1ZOL A;  3QXG A;  1PVR A;  7ICQ A;  2KJ8 A;  2ZIU B;  9ICT A;  1BNO A;  5KFR A;  1A0P A;  3RJF A;  5EWE A;  1GPJ A;  2BE3 A;  1JRO A;  2LBO A;  1DK3 A;  2G06 A;  1S0N A;  4K4I A;  2F44 A;  5ALS A;  2PI4 A;  1T8E A;  2K8A A;  1JI7 A;  4ED8 A;  4KLO A;  2ODG A;  1BNP A;  5KFO A;  4ECU A;  3IP4 B;  5K4L A;  9ICH A;  2P35 A;  3OWG A;  5J0Q A;  1QLN A;  4PH5 A;  4ED2 A;  2ISP A;  4DL3 A;  2K8B B;  2HVH A;  3GV8 B;  4DQR A;  1N48 A;  3WFQ E;  3D2Q A;  5IIK A;  1T4G A;  1ED1 A;  3GFK B;  1SXD A;  3UMB A;  2UVU A;  3UQ2 A;  3NS1 A;  3QU2 A;  2KSO B;  1FO4 A;  2PFQ A;  4O69 A;  1C20 A;  5DB8 A;  2XVT A;  1U9L A;  4UAU A;  1AQ6 A;  4Y2Y A;  4WBY A;  2ZIW B;  1CEZ A;  1S0V A;  4EBJ A;  4UB3 A;  1ZD3 A;  1BPB A;  1K1S A;  3QU9 A;  1UA1 A;  4F91 B;  4C8M A;  4QWA A;  3RRG A;  2FPK A;  1R8C A;  1NK4 A;  2V9W A;  1JUD A;  2RLT A;  2PFN A;  3TAD C;  3BQ1 A;  4OAG A;  2ATL A;  3EW9 A;  1XWL A;  3WFO A;  5IIJ A;  7ICT A;  5J0T A;  4BXO A;  3CYM A;  4YD2 A;  4B9L A;  4F2R A;  4DOC A;  2OM6 A;  5J2B A;  3ED5 A;  4WQL A;  4Z6C A;  3UM9 A;  3WK6 A;  4OO1 J;  1A6S A;  1SB3 C;  1S0O A;  4Q45 A;  4UW9 A;  5T14 A;  1NO5 A;  3BQ2 A;  3AQN A;  3RB4 A;  4K98 A;  1NOM A;  3QX7 A;  5F3X B;  5J2A A;  1JAJ A;  2KIW A;  4EBK A;  1L3S A;  2FLN A;  2CN1 A;  4DFM A;  1KQQ A;  4US9 A;  3TI0 A;  1D8B A;  3EWA A;  3RJK A;  3N7S C;  5KG3 A;  3RRH A;  5HR9 A;  4YMN A;  4NXZ A;  4J9K A;  4EP7 A;  3TQ1 A;  3L9D A;  5A0L A;  3EZ5 A;  3AM9 A;  4KN4 A;  9ICF A;  4KLS A;  3SAF A;  4IRD A;  4YD1 A;  1NKB A;  5KFM A;  3CP8 A;  3H4D A;  3LQC B;  1JIH A;  4HX0 A;  4BXO B;  2K4E A;  4EGW A;  1VJ5 A;  3M7D A;  2DRB A;  3JPN A;  2IA6 A;  9ICO A;  1ZQD A;  3ZD8 A;  2EAN A;  3M6K A;  3QNM A;  3R9K A;  5EWG A;  2PKE A;  4TQS A;  5ALZ A;  3C66 A;  4I2I A;  2K89 A;  2KMD A;  4F4K A;  3RB0 A;  2BPC A;  2F1J A;  4HYK A;  1TFR A;  1VLB A;  5KFE A;  2XI9 A;  2DF4 B;  3ZD9 A;  3G6Y A;  4AYB F;  4DL5 A;  2KHQ A;  5KAF U;  3ZDA A;  4C80 A;  4RQ8 A;  4PL2 A;  5EE1 A;  3KZX A;  4RWN A;  3KHH A;  3UXN A;  4DQP A;  3NYB A;  2WF6 A;  4X4R A;  2HBL A;  5F9N A;  2RQ5 A;  4KIT B;  4YP3 A;  3L3F X;  3TAD A;  3PX0 A;  5HRK A;  4BJQ A;  1IV8 A;  5HML A;  4KLU A;  2W55 A;  2BCV A;  4GC7 A;  1LB2 B;  2Q4T A;  4YR0 A;  3KTQ A;  1WYG A;  5AK3 A;  5HMM A;  2I5H A;  3BZC A;  4P4P A;  4M9J A;  8ICU A;  4ELV A;  1MIY A;  2H3Q A;  8ICG A;  4MHV A;  3ORY A;  3GQC A;  2ASL A;  3ZDB A;  4A8E A;  4PGQ A;  8ICW A;  4S3N A;  2GOL A;  4QW8 A;  3JPS A;  2QKQ A;  1NZP A;  9ICN A;  5J2G A;  3F2C A;  3TAQ A;  4DF8 A;  4NLC A;  3ER9 B;  2ZXI A;  5IIO A;  5ALG A;  2FMQ A;  1UT5 A;  3H37 A;  4EX7 A;  1DGS A;  2NRV A;  4KLJ A;  2YB4 A;  2F2A B;  3TAN A;  3PX4 A;  2A19 A;  2DGZ A;  1WG8 A;  3SR6 A;  3OJU A;  5J2K A;  1ZRM A;  3LVW A;  5JUM A;  3HJ4 A;  2XGP A;  4M9G A;  2QB1 A;  4I29 A;  4DLG A;  4AP9 A;  3MFI A;  4ECT A;  4EX6 A;  1U47 A;  3H39 A;  3M1Y A;  2KOB A;  5AK6 A;  5KFB A;  2YB1 A;  1ZQA A;  5EE0 A;  2BPF A;  2IMW P;  4I2F A;  7ICG A;  1NKE A;  3WK8 A;  3PSP A;  2E8M A;  2F1H A;  5KT6 A;  4XQ7 A;  4DL7 A;  4X4V A;  3ONN A;  2ID1 A;  4JMU A;  5CB1 A;  3HT3 A;  1UT8 A;  4UQG A;  2WAQ F;  4X4S A;  4X5V A;  4US8 A;  3Q8M A;  5DB9 A;  2VKQ A;  3MGI A;  4I27 A;  2ASD A;  2EZZ A;  4FO6 A;  1CRX A;  2BHN A;  2BQU A;  3IG5 A;  5L1L A;  1JXL A;  4BWJ A;  4DQI A;  4Q8E A;  8ICF A;  1UEV A;  3UXO A;  5J0P A;  3FAH A;  4YMM A;  3RFA A;  4F5N A;  2DL0 A;  4RT2 A;  4ED1 A;  2BPG A;  4LEZ A;  1JXE A;  1ZQG A;  2MSN A;  2PMZ F;  2PXI A;  4M04 A;  4QNL A;  5AI9 A;  8ICI A;  2QLT A;  1ZQM A;  5J8Y C;  4OJ5 A;  4LZD A;  4X0B A;  1N56 A;  3IHQ B;  5F2V O;  3KBB A;  5EOZ A;  1NKC A;  5AKJ A;  3WKC A;  5IIL A;  2JGA A;  5CWR A;  2JH1 A;  4CF5 A;  4UB2 A;  1N61 A;  4DQQ A;  2XO7 A;  4J9L A;  2WF7 A;  3KOO A;  2HI0 A;  2W54 A;  4DSF A;  1XO0 A;  1A76 A;  3BQ0 A;  4YR2 A;  3O0F A;  1RYR A;  5AM4 A;  3WFS C;  4ACO A;  2RHF A;  3CNH A;  1PK3 A;  5AM0 A;  2O6K A;  4MEY A;  1BPE A;  1NK6 A;  4DQS A;  1NK7 A;  2IBK A;  4K9B A;  5DG7 A;  4GFJ A;  4NXW A;  1PK1 A;  1KFT A;  2YN4 A;  9ICP A;  3GII A;  5J2H A;  1SL2 A;  2BCR A;  1VDV A;  4HAI A;  2G0A A;  5GTH U;  4QZA A;  1RDF A;  7ICS A;  1X9X A;  4XQ8 A;  5AK4 A;  4PGY A;  5BPC A;  2ZUC A;  1L6N A;  1SV4 A;  1LVH A;  1Z00 A;  5L9X A;  1KDH A;  3KKA C;  5IIM A;  5CJ7 A;  2E8N A;  3RR7 A;  3M9M B;  4UD5 A;  3GIL A;  5J2I A;  4RQ2 A;  5ALH A;  9ICJ A;  2DUY A;  3QUC A;  4YN4 A;  4DF4 A;  2YQE A;  3WK4 A;  9ICL A;  3AQM A;  2NV3 A;  2XCP A;  2W3R A;  4CRX A;  4FHP A;  1SXE A;  3RH4 A;  2MU2 A;  1D9F A;  4NXX A;  4DSL A;  4LJX A;  4QIW F;  3NKU A;  5ALN A;  4Y2V A;  4F5Q A;  2AXT U;  2G07 A;  2JH7 A;  3GV5 B;  2HHQ A;  4MEX A;  2DVI A;  2NYV A;  2DR7 A;  1N2X A;  1PK1 B;  5ALI A;  2DR9 A;  5TIS U;  1FEZ A;  5CEH A;  3WK9 A;  2F76 X;  5KFJ A;  4IQW A;  5J0O A;  5FP0 A;  4ED6 A;  3PSI A;  1ZQN A;  2CXY A;  2YX8 A;  1UEU A;  5AKX A;  1Z00 B;  4IL6 U;  3ER8 C;  5DQI A;  3H8W A;  3C2K A;  4M0A A;  4ECQ A;  4E8F A;  4OJP A;  3RBE A;  5DG8 A;  2OEH A;  4P0Q A;  5AKZ A;  4MF8 A;  5HRG A;  3Q8P B;  4NKU A;  3WU2 U;  1PX5 A;  3A0H U;  2BDP A;  3TAP A;  4DCC A;  1FA0 A;  4C4S A;  4UAY A;  3K1R B;  4YFK A;  3NWI A;  2H3V A;  1VJ7 A;  3D2N A;  4NXT A;  5DLF A;  5ALW A;  4PHD A;  4RQN A;  4K9A A;  4F2S A;  2ZUB A;  1ZQ1 C;  3JPT A;  1XSP A;  5HRI A;  1R8A A;  3RB6 A;  5AIB A;  2ZH4 A;  3OVA A;  4YCX A;  1COO A;  4RQ0 A;  2ZTC A;  1WWU A;  1L3U A;  3AU2 A;  8ICO A;  4Y2T A;  3EYZ A;  4LVS A;  4RNM A;  4XUS A;  1TAU A;  1SKS A;  4JUZ A;  2J6T A;  4DOA A;  3AUO A;  3KKA A;  2PBE A;  5DDM A;  4EEB A;  5KT2 A;  1L3V A;  3SD7 A;  3N97 B;  4P0Q B;  4RWQ A;  5ALD A;  4JWM A;  5HHI A;  4O3R A;  1NI3 A;  4PHE A;  4LEV A;  4R63 A;  4QZG A;  3TFR A;  5DED A;  3L5K A;  4RUA A;  5HRD A;  2IOF A;  4FHX A;  1X42 A;  1NK8 A;  7ICV A;  3B0X A;  3H8J A;  3RR8 A;  3C5G A;  4KX3 A;  3K1Z A;  3EUB 2;  3PMN A;  3F2B A;  2F3N A;  4K4H A;  1T3Q A;  4O5E A;  1WWV A;  3C21 A;  4E0D A;  2DBY A;  2KIC A;  5KG2 A;  4Y2U A;  1MSW D;  4ECW A;  4IR9 A;  2BBJ A;  2OYY A;  2G5I B;  4Y2J A;  4UB6 U;  1RZT A;  1B0X A;  1QQ7 A;  2KSO A;  1T7P A;  5J2F A;  1MA7 A;  2ZH3 A;  4NM1 A;  4O3O A;  4DWI A;  3H7I A;  3RF9 A;  3RB3 A;  2ZIW A;  2BCU A;  4M9L A;  1Q79 A;  1X66 A;  4CNQ A;  5CHG A;  1MQ3 A;  2HHU A;  4RU9 A;  1V85 A;  1ZQS A;  3C5F A;  4PHP A;  7ICF A;  7ICU A;  3HP6 A;  3U26 A;  1BPD A;  2ZJ8 A;  1X9M A;  4PZN A;  2WHE A;  4UAW A;  3V6H A;  2UVR A;  2R8I A;  3PO5 A;  1V9P A;  1SGG A;  1N63 A;  2NRX A;  3H0M B;  2AGP A;  1L8O A;  2KKV A;  2RFF A;  4J9N A;  3QEB Z;  3PW4 A;  1HJP A;  3J81 j;  4M9H A;  2RDJ A;  4UAT A;  4FZL A;  5EE9 A;  3H8S A;  4TQR A;  5B66 U;  2NRW A;  3N7R C;  4ED3 A;  4I0U A;  1ZQB A;  1SV0 A;  2WF5 A;  4EYH B;  5AI5 A;  3ZDE A;  3PV8 A;  4NL9 C;  2KK0 A;  5KAI U;  1HEK A;  5CRX A;  4PPX A;  2IHM A;  3G6V A;  4G3I A;  1WUD A;  4YR3 A;  2H5X A;  1NJW A;  4KTQ A;  1BVS A;  7ICE A;  1LKY A;  2I9G A;  4QZE A;  4KN7 A;  8ICL A;  5J0Y A;  5III A;  4NM2 A;  3T5H A;  1RQN A;  2K4I A;  2RRD A;  3HKZ C;  4U6P A;  1DGJ A;  2DR8 A;  4B9M A;  1YZ6 A;  4WC7 A;  1KSP A;  4KMU A;  2HDO A;  9ICM A;  1GO3 F;  4I2J A;  1K5O A;  2H3F A;  5AI0 A;  4CF4 A;  4FHW A;  5KG4 A;  3JPP A;  2OCE A;  4B9V A;  1XSL A;  3HW8 A;  1YLQ A;  2HW3 A;  2EAO A;  3FYH A;  5ALX A;  5KFG A;  4J9Q A;  3FDS A;  3QZ7 A;  1IG6 A;  3GV7 B;  2Y1J A;  4OD0 A;  4CCH A;  3KHL A;  4WBZ A;  3VCB A;  1X6I A;  1S77 D;  1LKY B;  1V38 A;  1X6J A;  4J9S A;  4ICA A;  4UAV A;  5KNI A;  1ZQE A;  3CRX A;  5D46 A;  4P4M A;  4DFP A;  1HUO A;  2Z7J A;  4NLZ A;  1XC9 A;  2L5Y A;  5ALP A;  5KL1 B;  1F5A A;  5B3P A;  1R8B A;  1Q3V A;  1TAQ A;  4Y2S A;  3RH5 A;  4O3P A;  1MQ2 A;  2JEJ A;  1QSY A;  1NJZ A;  4FHV A;  3OVB A;  4I2B A;  1S97 A;  4DOB A;  5DBA A;  7ICI A;  4RQ3 A;  1NK9 A;  4XA5 A;  4O0I A;  4OAI Z;  4ECS A;  4AT7 A;  2R8J A;  4RNN A;  3LK9 A;  3MR5 A;  3OVS A;  1L7O A;  4X4U A;  4I2A A;  2HBM A;  2N1R A;  3ALR A;  4NXU A;  3CK6 A;  2WTF A;  4C8N A;  2C2D A;  1TK5 A;  4AT8 B;  4CDG A;  1NJY A;  4IR1 A;  3PW5 A;  2CPR A;  2ZH6 A;  1RG6 A;  4TUP A;  2XCA A;  1NK5 A;  2KP7 A;  4NL9 A;  5HRE A;  4ECX A;  4NY8 A;  2C2R A;  3EF2 A;  4JWN A;  2ZJA A;  2K4H A;  2PFP A;  5KFY A;  3IG8 A;  3ISB A;  4ED7 A;  1WCN A;  1QSL A;  8ICH A;  3OGU A;  2H3I A;  4FBT A;  4PHA A;  3PO4 A;  5DG9 A;  4DL4 A;  3SQI A;  4ATB B;  2NRZ A;  5C0Y A;  2EDU A;  1ZQT A;  2KNJ A;  2I1Q A;  4F72 A;  4QWC A;  4F92 B;  2AJQ A;  1Q46 A;  4AT7 B;  1Z1B A;  2YTU A;  1ZXI A;  5KL8 B;  5KFF A;  4KM5 A;  3M8S A;  1RYS A;  1T3N A;  9ICV A;  4BX9 C;  3PZP A;  5KFA A;  4I28 A;  1ZJM A;  1ZQV A;  4OAF A;  3LYS A;  1J2N A;  3WFP A;  3G6X A;  4KLM A;  1MIV A;  3F5E A;  9ICA A;  4UBB A;  2R8K A;  4B9S A;  2F77 X;  3I28 A;  9ICQ A;  3WFR E;  3ZDC A;  4I2C A;  2KZM A;  3NVO A;  4UD4 A;  2OHF A;  4NXV A;  1JRP A;  3ETR A;  4DSJ A;  1NJX A;  3M6Z A;  8ICC A;  4EEY A;  3WKE A;  3BQT A;  4WC6 A;  4NV0 A;  3B0Y A;  4WC4 A;  3GDX A;  1YZ7 A;  5KG6 A;  1A77 A;  4OJL A;  5J0R A;  2KTQ A;  4F4Z A;  5D49 A;  1C7Y A;  5KFD A;  3PW2 A;  4QWB A;  2HHX A;  2R8G A;  4ECV A;  2BDU A;  3LDA A;  1L8L A;  2ZH7 A;  5HRF A;  4YVZ A;  7ICM A;  4OJO A;  1S0M A;  4B9U A;  3AEV A;  3JPQ A;  3SAH A;  3SV4 A;  1XSN A;  3OHB A;  3IV6 A;  2KG5 A;  3NVV A;  1UQV A;  3PVX A;  1ARO P;  5KFP A;  1QTM A;  3I76 A;  8ICS A;  4NJ8 A;  2KIV A;  2K8C B;  5CA7 A;  3V6K A;  4KLH A;  2DPI A;  5BOM A;  1VFG A;  1X9W A;  5J0U A;  4UB8 U;  4FS2 A;  1V97 A;  5E79 U;  4O3Q A;  4DFD A;  4P0P B;  4EBC A;  2KJ9 A;  3H0L B;  5B3Q A;  1ZQX A;  1IIP A;  2WB1 C;  4GXJ A;  1ZQC A;  8ICA A;  4M6W A;  3M9O B;  2K4P A;  4B9N A;  2GH1 A;  4DFK A;  2F1I A;  3C1Z A;  8ICB A;  1S5L U;  3Q8L A;  5J0X A;  3WKA A;  3C28 A;  3FC4 A;  1PVQ A;  4WCW A;  4KMO B;  2O1P A;  5DB7 A;  1ZYQ A;  4Y2Q A;  3BZK A;  4JLX A;  9ICW A;  4F93 B;  4JV1 A;  8ICP A;  3HPO A;  5AKH A;  4TUR A;  3PR5 B;  4DSI A;  2ASJ A;  2XC9 A;  4I2D A;  5KFS A;  4C8K A;  1KLN A;  4G9B A;  3PHZ A;  3F5A A;  5ALL A;  4KLI A;  3OUY A;  3UMG A;  2VA8 A;  2KZZ A;  3K4G A;  3H40 A;  2A1A A;  1ZQU A;  2B0C A;  1IXR A;  4FZN A;  1XU4 A;  3OV7 A;  2IOH A;  2B51 A;  4R8U A;  4C4T A;  3V7J A;  2AGO A;  4M6W B;  1JN3 A;  2G5H B;  4QW9 A;  4RPZ A;  1S76 D;  1R89 A;  4MFA A;  2RP5 A;  2DFL A;  4IS7 A;  3HJ1 A;  4Y2R A;  2W9B A;  2YMM A;  3D6J A;  4RQ5 A;  2E8P A;  4YQW A;  5DKW A;  2M2T A;  5KT3 A;  4E80 A;  4KLT A;  4KB6 A;  5DB6 A;  4KLD A;  1XNS A;  7ICL A;  5KG5 A;  2ZH5 A;  1XO1 A;  1D8L A;  1RYU A;  5JTI A;  4WJ3 B;  4X4O A;  4EZ9 A;  4M5D A;  2FJ6 A;  2ALZ A;  4FO1 A;  2PFO A;  2XGQ A;  2Y0S F;  2B56 A;  2M0N A;  2YMQ A;  3ERC C;  5BOL A;  5HRL A;  1N5W A;  2UVV A;  3MBY A;  1ZQW A;  5J0S A;  4EZ6 A;  4O9M A;  3OUY B;  2E5S A;  4WC2 A;  1OXJ A;  2F8K A;  1Q8K A;  5AI8 A;  5G5G A;  2DKZ A;  2EH9 A;  4OCZ A;  4R8U B;  2AHO B;  2KD1 A;  3JYY A;  3S6J A;  3JPO A;  1D8Y A;  1JMS A;  2QAR B;  2W9B B;  5CFS A;  2ZUD A;  4QZH A;  2W8K A;  3EPI A;  2AQ4 A;  2ZH9 A;  3LVV A;  2C22 A;  4O67 A;  3OJS A;  2DRA A;  2KV2 A;  3H0R B;  4UAR A;  1K1Q A;  2OWO A;  5CFU A;  2ZHB A;  3QUT A;  3THV A;  4WC0 A;  2E8O A;  3C23 A;  4WC1 A;  4FHY A;  3HIL A;  1TK0 A;  3QU5 A;  2ZIV B;  3OSN A;  1NK0 A;  1KBU A;  4IQT A;  5EWF A;  1S10 A;  5HC9 A;  2FMP A;  2W3S A;  4KX5 A;  2BQ3 A;  4X4P A;  1U48 A;  2GO7 A;  2V4R A;  1EXN A;  3E0F A;  4U7C A;  1UET A;  2BQR A;  3C18 A;  3MAB A;  3V6J A;  2DWQ A;  3PW0 A;  3UQ0 A;  1RQL A;  4C7Y A;  2AGQ A;  3PSF A;  3A0B U;  4AT9 A;  3PML A;  5CFT A;  2VJ4 A;  1ZQL A;  2HHP A;  1UPH A;  2DPJ A;  2W03 A;  4LZG A;  2HHW A;  4K8V A;  4FBU A;  4Y2P A;  2C2E A;  3GZF A;  2ZH1 A;  4FS1 A;  1SV0 C;  2XIC A;  4YMO A;  2FPL A;  1DRG A;  4UB1 A;  1L7P A;  2R18 A;  1MIW A;  2LYA A;  2D8C A;  5F9L A;  1QCK A;  2HBK A;  4GC6 A;  4ELU A;  1RM6 C;  1TKD A;  2JXJ A;  1BGX T;  5ALK A;  4N7R A;  3K75 D;  3H38 A;  3Q8R B;  3MC1 A;  5AKE A;  2J6S A;  3UXP A;  4DL2 A;  1RXW A;  1FIQ A;  1TVA A;  3OTQ A;  2KKP A;  2JEI A;  1Q3U A;  3BQ7 A;  3HKZ F;  1X2I A;  1Z3E B;  1WOT A;  4AT9 B;  2KHV A;  3H8M A;  5CHE A;  4OJ6 A;  3WK7 A;  2BBH A;  4BUG A;  1SZH A;  8ICJ A;  5HNK A;  4F5O A;  3MDA A;  3NUQ A;  2E3T A;  4ECR A;  4F5R A;  4F8R A;  2VIX A;  9ICE A;  3CW2 C;  1TE2 A;  2M9N A;  3C1Y A;  3BS5 A;  2NO4 A;  5AKG A;  2ZG6 A;  1ZD2 P;  2GWS A;  5KFL A;  1QQ6 A;  4FH3 A;  1DOQ A;  3QU4 A;  4C0Z A;  2IHN A;  2H3Z A;  5KFT A;  4YG2 A;  2FPM A;  2LI6 A;  4JB3 A;  5KFK A;  1CUK A;  5DBC A;  5DQH A;  2KN7 A;  2PI5 A;  1KW4 A;  2XY5 A;  2AU0 A;  2JRZ A;  1HIW A;  4DL6 A;  3PNC A;  4BWM A;  2YY6 A;  3RJJ A;  4JV2 A;  2FLL A;  5EE3 A;  3QEA Z;  5D61 A;  9ICC A;  4NKT A;  4DFJ A;  2HVI A;  2ZH2 A;  2JV3 A;  1COK A;  5KG1 A;  2EQY A;  2F8L A;  3FM9 A;  4ELT A;  2XY6 A;  4QZF A;  1KNY A;  5DEC A;  3PR4 A;  2W9M A;  2OH2 A;  4LT6 A;  2NRT A;  3NRZ A;  5AKI A;  1ZQP A;  3AQL A;  4Q43 A;  3BS5 B;  2B6G A;  2Y9T A;  2GAF D;  5ALM A;  2VAN A;  1TK8 A;  3NAS A;  1ZQZ A;  5AM1 A;  5HP4 A;  1BPX A;  3E2E A;  4RNO A;  2Q0Z X;  3SI8 A;  5HRB A;  5ALJ A;  1LV5 A;  4UB5 A;  3MCR A;  3NVW A;  4RQ6 A;  9ICU A;  4JK1 A;  7ICN A;  4P4O A;  1ZQI A;  1X9S A;  1ZQJ A;  1T94 A;  3V7L A;  3TFS A;  3HRD D;  5KFU A;  4RWP A;  2RDI A;  4M47 A;  2AQ0 A;  1B43 A;  3ETL A;  5J0W A;  3HX0 A;  3GIM A;  2JHD A;  4ZOH C;  2YML A;  2W04 A;  3N7P D;  3AU6 A;  3SEN A;  1RXV A;  5CP2 A;  3OHA A;  5KT5 A;  2BKE A;  2WF9 A;  2LMR A;  3ZDD A;  8ICQ A;  1QH9 A;  5AM5 A;  3SYZ A;  5AKK A;  3RJE A;  3MR3 A;  2BCQ A;  1FFV A;  4KLQ A;  3NVY A;  2AH5 A; 
#chains in the Genus database with same CATH homology
 1SL1 A;  5L1J A;  4UBB A;  2R8K A;  9ICS A;  4B9S A;  4O3S A;  2MAX A;  5KFQ A;  4MEY A;  1JQR A;  1BPE A;  9ICQ A;  4KLG A;  3WFR E;  3Q8K A;  1BPY A;  3ZDC A;  2FMS A;  1NK6 A;  4I2C A;  4DQS A;  2KZM A;  1NK7 A;  2IBK A;  1Q78 A;  5DG7 A;  2HHV A;  2JEF A;  4UD4 A;  4IRC A;  4DS4 A;  4UAZ A;  3MFH A;  1KFT A;  4ZH4 A;  4DSJ A;  8ICR A;  9ICP A;  5D4B A;  1NJX A;  3GII A;  1D9D A;  5J2H A;  1SL2 A;  4EEY A;  2BCR A;  8ICC A;  4AT8 A;  1ZQO A;  3NGD A;  3MGH A;  3PW7 A;  3BQT A;  4WC6 A;  4QZA A;  7ICT A;  4WC4 A;  3B0Y A;  7ICS A;  3GDX A;  5CR0 A;  4XQ8 A;  7ICK A;  4J9P A;  5KG6 A;  1ZET A;  4PGY A;  1A77 A;  5BPC A;  2ZUC A;  3MR6 A;  5J0R A;  3PX6 A;  4DSE A;  2KTQ A;  1SZP A;  4F4Z A;  1Z00 A;  4C8O A;  5TZV A;  4R64 A;  3JZ0 A;  5L9X A;  1KDH A;  5IIM A;  5CJ7 A;  5D49 A;  3T5L A;  4P2H A;  3RR7 A;  5KT7 A;  3M9M B;  1C7Y A;  5KFD A;  3PW2 A;  5KG0 A;  4UD5 A;  4QWB A;  2HHX A;  3GIL A;  5KG7 A;  5J2I A;  2R8G A;  2VA2 A;  4RQ2 A;  3H4B A;  5KFV A;  4ECV A;  3LDA A;  9ICJ A;  1ZQF A;  2ZH7 A;  5HRF A;  4YVZ A;  4YN4 A;  4DF4 A;  2BR0 A;  9ICL A;  4XRH A;  4ECZ A;  2A1J A;  2P6U A;  7ICM A;  1S0M A;  3GIK A;  3AQM A;  2XCP A;  1Y88 A;  5L1K A;  4B9U A;  4WC3 A;  4KLQ A;  2LYH A;  3C2L A;  8ICZ A;  4FHP A;  3JPQ A;  3RH4 A;  3SV4 A;  4ATB A;  1D9F A;  5DLG A;  1XSN A;  7ICJ A;  4DSL A;  3OHB A;  3RBD A;  3C2M A;  7ICH A;  9ICK A;  4GLX A;  3PVX A;  5KFH A;  2ZTE A;  1UA0 A;  4DO9 A;  4F5Q A;  1ARO P;  3PY8 A;  4B9T A;  3GV5 B;  2HHQ A;  5KFP A;  1QTM A;  4MEX A;  4MFC A;  3V7K A;  8ICS A;  1U4B A;  2DVI A;  4KLF A;  8ICE A;  4F4Y A;  4MFF A;  5CA7 A;  3V6K A;  4KLH A;  2DR7 A;  3M8R A;  4O3N A;  4QZ8 A;  2DPI A;  4RUC A;  2DR9 A;  4IQV A;  5BOM A;  1VFG A;  1X9W A;  5J0U A;  5KFJ A;  4Z6D A;  4UB4 A;  5J0O A;  4FS2 A;  2BGW A;  4IQW A;  9ICR A;  7ICQ A;  4Q44 A;  4ED6 A;  1ZQN A;  4O3Q A;  3MR2 A;  1L3T A;  9ICT A;  1BNO A;  5KFR A;  4X0A A;  1UEU A;  5J2C A;  3QE9 Y;  3RJF A;  4KLL A;  4EBC A;  1Z00 B;  5EWE A;  3AQK A;  1KFD A;  2BE3 A;  1ZQX A;  1ZQC A;  4GXJ A;  8ICA A;  3IM1 A;  4ECY A;  4M6W A;  1S0N A;  5DQI A;  3M9O B;  1DK3 A;  3H8W A;  3C2K A;  4K4I A;  4M0A A;  4ECQ A;  4E8F A;  4B9N A;  2PI4 A;  4DFK A;  2F1I A;  1T8E A;  3RBE A;  4ED8 A;  4KLO A;  3C1Z A;  9ICG A;  5DG8 A;  5J29 A;  8ICB A;  2A1J B;  3Q8L A;  1BNP A;  4MF8 A;  5HRG A;  2NRK A;  5KFO A;  3Q8P B;  4ECU A;  4NKU A;  5J0X A;  4RQ1 A;  1PX5 A;  2BDP A;  2JEG A;  9ICH A;  3TAP A;  1FA0 A;  5J0Q A;  3BJY A;  4WCW A;  1QLN A;  4UAY A;  2O1P A;  4PH5 A;  5KFX A;  5KFI A;  5DB7 A;  4YFK A;  4ED2 A;  2ISP A;  4DL3 A;  1ZYQ A;  2HVH A;  4X4Q A;  3GV8 B;  4DQR A;  5KFC A;  1VJ7 A;  9ICW A;  1N48 A;  3WFQ E;  5DLF A;  4F93 B;  4PHD A;  5IIK A;  4JV1 A;  8ICP A;  3HPO A;  1T4G A;  4F2S A;  2ZUB A;  3GFK B;  1DK2 A;  4TUR A;  3PR5 B;  3JPT A;  3UQ2 A;  2UVU A;  1XSP A;  4DSI A;  5HRI A;  2ASJ A;  1R8A A;  2XC9 A;  4I2D A;  5KFS A;  4C8K A;  4F4W A;  5KTQ A;  3RB6 A;  1KLN A;  2ZH4 A;  8ICK A;  4NLN A;  2PFQ A;  3OVA A;  4YCX A;  1COO A;  4RQ0 A;  4RZR A;  5DB8 A;  2KZ3 A;  2R8H A;  4KLI A;  2ZTC A;  1L5U A;  3OUY A;  1U9L A;  2VA8 A;  2KZZ A;  1L3U A;  3AU2 A;  3K4G A;  8ICO A;  1CEZ A;  4WBY A;  3H40 A;  1S0V A;  1ZQU A;  1IXR A;  1XU4 A;  3OV7 A;  3RH6 A;  1KFS A;  4EBJ A;  4UB3 A;  3EYZ A;  2KFZ A;  4R8U A;  4RQ4 A;  1BPB A;  4RNM A;  4LVS A;  3V7J A;  1K1S A;  2AGO A;  4XUS A;  1UA1 A;  4M6W B;  1JN3 A;  4F91 B;  1ZQH A;  4QW9 A;  1TAU A;  4RPZ A;  1XS9 D;  1SKS A;  4C8M A;  4QWA A;  3RRG A;  1S76 D;  4MFA A;  2HHT A;  2FPK A;  4JUZ A;  2W8L A;  2J6T A;  2DFL A;  4DOA A;  3AUO A;  1NK4 A;  1R8C A;  2PBE A;  5DDM A;  3HJ1 A;  2W9B A;  2V9W A;  4Q8F A;  4RT3 A;  5KT2 A;  3T5K A;  4RQ5 A;  1L3V A;  4YQW A;  2PFN A;  5DKW A;  3BQ1 A;  3N97 B;  2M2T A;  4RWQ A;  3UPS A;  4JWM A;  5HHI A;  8ICN A;  5KT3 A;  3RJG A;  4O3R A;  8ICM A;  2ATL A;  4KLT A;  4E80 A;  4X4T A;  3EW9 A;  5DB6 A;  4KLD A;  1BPZ A;  1XWL A;  3WFO A;  4PHE A;  7ICL A;  5IIJ A;  5KG5 A;  1XO1 A;  5J0T A;  4QZG A;  1D8L A;  4R63 A;  3MDC A;  3T3F A;  1KRP A;  4BXO A;  3TFR A;  5DED A;  4YD2 A;  4B9L A;  4BDP A;  1ZQK A;  3Q8S B;  4F2R A;  4RUA A;  5HRD A;  4X4O A;  4EZ9 A;  4DOC A;  4FHX A;  4M5D A;  5J2B A;  1NK8 A;  3RAX A;  7ICV A;  4Z6C A;  2UVW A;  3B0X A;  1S0O A;  3H8J A;  2ALZ A;  2ISO A;  3RR8 A;  3C5G A;  5KFW A;  4Q45 A;  2KFN A;  2PFO A;  1NO5 A;  2XGQ A;  3BQ2 A;  8ICT A;  4NLK A;  3AQN A;  3QZ8 A;  5BOL A;  3RB4 A;  3BDP A;  1NOM A;  1U49 A;  4QZC A;  1S9F A;  5DDY A;  4J9R A;  5HRL A;  2UVV A;  3MBY A;  1ZQW A;  5J0S A;  5J2A A;  3PMN A;  5L1I A;  4EZ6 A;  4O9M A;  4E7X A;  1JAJ A;  3OUY B;  4IG8 A;  4WC2 A;  1PZN A;  4EBK A;  1L3S A;  2FLN A;  4K4H A;  4DFM A;  4O5E A;  3TI0 A;  4I2G A;  3C21 A;  4E0D A;  7ICO A;  3EWA A;  5KG2 A;  3RJI A;  3RJK A;  5KG3 A;  4R8U B;  3RRH A;  2M2U A;  1H38 A;  5HR9 A;  4YMN A;  5KT4 A;  1MSW D;  4ECW A;  4NXZ A;  4RQ7 A;  4IR9 A;  3RAQ A;  4J9K A;  3JYY A;  1KTQ A;  2ZH8 A;  4EP7 A;  4J9M A;  3TQ1 A;  3L9D A;  3JPO A;  2VA3 A;  1RZT A;  1D8Y A;  1JMS A;  1T7P A;  2W9B B;  3EZ5 A;  5J2F A;  2ZH3 A;  4KN4 A;  9ICF A;  2ZUD A;  2W9C A;  4KLS A;  4RPY A;  4NM1 A;  4QZH A;  2W8K A;  4O3O A;  3EPI A;  2AQ4 A;  3H7I A;  4IQU A;  4DWI A;  4WC5 A;  4IRD A;  2ZH9 A;  4YD1 A;  1NKB A;  5KFM A;  3RB3 A;  2C22 A;  3OJS A;  2BCU A;  3RTV A;  4M9L A;  1Q79 A;  2DRA A;  3H4D A;  3NTU A;  1K1Q A;  5CHG A;  4RU9 A;  3EPG A;  1MQ3 A;  2OWO A;  2HHU A;  3LQC B;  1ZQS A;  1JIH A;  2ZHB A;  4BXO B;  3C5F A;  4PHP A;  3THV A;  7ICF A;  7ICU A;  3HP6 A;  4WC0 A;  4RWO A;  4DS5 A;  4KLE A;  5J2E A;  3C23 A;  2DR5 A;  5KFN A;  4WC1 A;  1BPD A;  2ZJ8 A;  1X9M A;  4C8L A;  4FHY A;  4Z6F A;  3V6H A;  4UAW A;  1TK0 A;  2UVR A;  2DRB A;  2R8I A;  3UPQ A;  3Q8Q B;  3JPN A;  2IA6 A;  3PO5 A;  3OSN A;  1U45 A;  1NK0 A;  1V9P A;  9ICO A;  4X4N A;  5HHH A;  4IQT A;  4YXM A;  5EWF A;  1ZQD A;  3ZD8 A;  1S10 A;  5J2D A;  2NRX A;  2AGP A;  2J6U A;  5EWG A;  4MF2 A;  5HC9 A;  2FMP A;  4I2H A;  2M2W A;  2BQ3 A;  1OU5 A;  5J2J A;  4J9N A;  2RFF A;  1U48 A;  4X4P A;  4EBD A;  2V4R A;  4TQS A;  1EXN A;  1QSS A;  3QEB Z;  3PW4 A;  1HJP A;  3C66 A;  4EYI B;  4I2I A;  1UET A;  2BQR A;  4F4K A;  5HRH A;  3MAB A;  3RB0 A;  3C18 A;  3KHR A;  4M9H A;  2BPC A;  2RDJ A;  8ICX A;  2V4Q A;  3V6J A;  3PW0 A;  2F1J A;  3UQ0 A;  4JV0 A;  4HYK A;  1HUZ A;  3H8S A;  4TQR A;  1TFR A;  2NRW A;  2AGQ A;  3N4M B;  1IM4 A;  2C28 A;  4ED3 A;  5KFE A;  1ZQB A;  1SKW A;  3ZD9 A;  4EYH B;  3G6Y A;  4AT9 A;  3ZDE A;  4DL5 A;  3PML A;  3PV8 A;  3ZDA A;  1ZQL A;  4RQ8 A;  2HHP A;  4O5C A;  4PPX A;  2DPJ A;  8ICY A;  9ICX A;  4LZG A;  4ED0 A;  1KEJ A;  2IHM A;  4RWN A;  3KHH A;  2HHW A;  4F5P A;  3UXN A;  3G6V A;  2W9C B;  4DQP A;  4FBU A;  4G3I A;  3NYB A;  4YR3 A;  2H5X A;  2C2E A;  1NJW A;  1BVS A;  4KTQ A;  5F9N A;  4X4R A;  2ZH1 A;  3LWM A;  4FS1 A;  1SKR A;  7ICE A;  4KIT B;  4YP3 A;  4YMO A;  1ZJN A;  4QZE A;  2I9G A;  4KN7 A;  1ZQR A;  2FPL A;  5J0Y A;  5III A;  8ICL A;  4UB1 A;  4UBC A;  5DGB A;  3PX0 A;  4NM2 A;  5HRK A;  3T5H A;  4R65 A;  4DSK A;  5HML A;  4KLU A;  1MIW A;  4QZB A;  4RPX A;  2BCV A;  4GC7 A;  1LB2 B;  5F9L A;  4YR0 A;  1RPL A;  3KTQ A;  2DR8 A;  4B9M A;  3GIJ A;  3ISC A;  4O5K A;  4R66 A;  4GC6 A;  1KSP A;  5HMM A;  4KMU A;  4WC7 A;  4ELU A;  9ICM A;  7ICR A;  4P4P A;  4M9J A;  8ICU A;  1TKD A;  4I2J A;  5IIN A;  1BGX T;  1ZQY A;  4ELV A;  1MIY A;  2ZTD A;  8ICG A;  4QWE A;  3K75 D;  3H38 A;  4FHW A;  3Q8R B;  3ORY A;  3GQC A;  4K4G A;  5KG4 A;  1R89 A;  3JPP A;  2ASL A;  3ZDB A;  2P6R A;  2J6S A;  1B22 A;  3UXP A;  2O5A A;  2Q66 A;  4DL2 A;  4DEZ A;  4PGQ A;  8ICW A;  4S3N A;  4B9V A;  4QW8 A;  3JPS A;  1RXW A;  2ZJ5 A;  1XSL A;  1TVA A;  3HW8 A;  1NZP A;  1YLQ A;  1MC8 A;  3OSP A;  3TAR A;  2ZHA A;  9ICN A;  1TFY A;  2HW3 A;  5J2G A;  2JEI A;  3TAQ A;  4M9N A;  3FYH A;  4DF8 A;  1X2I A;  1Z3E B;  5KFG A;  1WOT A;  4AT9 B;  4J9Q A;  5IIO A;  3FDS A;  3QZ7 A;  1TV9 A;  3GV7 B;  3T5J A;  4NLG A;  8ICJ A;  5HNK A;  2Y1J A;  2FMQ A;  4CCH A;  1UT5 A;  4F5O A;  3KHL A;  3H37 A;  3V72 A;  4WBZ A;  2ZH5 A;  3MDA A;  4ECR A;  1DGS A;  2NRV A;  4KLJ A;  4F5R A;  3HIY A;  5KFZ A;  4F8R A;  3TAN A;  3PX4 A;  1S77 D;  9ICE A;  5C5J A;  3SV3 A;  1V4A A;  2M9N A;  3C1Y A;  3OJU A;  5J2K A;  4J9S A;  1ZQE A;  2MUT A;  5D46 A;  5KFL A;  4P4M A;  4DFP A;  2GWS A;  3HWT A;  1HUO A;  1DOQ A;  5JUM A;  4FH3 A;  3HJ4 A;  2XGP A;  4TUQ A;  4M9G A;  1XC9 A;  4DLG A;  4I29 A;  4NLZ A;  1F5A A;  3MFI A;  2IHN A;  1R8B A;  4ECT A;  1U47 A;  3H39 A;  5KFT A;  4YG2 A;  2FPM A;  1TAQ A;  5KFB A;  3RH5 A;  4O3P A;  4YXJ A;  4QWD A;  5KFK A;  1CUK A;  5DBC A;  5DQH A;  2KN7 A;  1MQ2 A;  1ZQA A;  2JEJ A;  2PI5 A;  4QZD A;  1QSY A;  1NJZ A;  2XY5 A;  2BPF A;  2IMW P;  2AU0 A;  4I2F A;  4PGX A;  1NKE A;  7ICG A;  4DL6 A;  4FHV A;  4I2B A;  3OVB A;  3PNC A;  4BWM A;  1S97 A;  4DOB A;  2Y1I A;  2F1H A;  5KT6 A;  5DBA A;  4XQ7 A;  4DL7 A;  2JZB A;  7ICI A;  1TFW A;  4X4V A;  4RQ3 A;  1NK9 A;  4XA5 A;  4O0I A;  3RJJ A;  4JV2 A;  2FLL A;  2ID1 A;  4ECS A;  4I2E A;  5CB1 A;  4AT7 A;  3HT3 A;  1UT8 A;  2R8J A;  4RNN A;  4UQG A;  3SZ2 A;  3LK9 A;  3MR5 A;  3QEA Z;  4X5V A;  4X4S A;  3OVS A;  3H3A A;  2P66 A;  4X4U A;  9ICC A;  4NKT A;  4DFJ A;  4GXK A;  4I2A A;  2HVI A;  3Q8M A;  4Z6E A;  2WTF A;  2M2V A;  2ZH2 A;  4C8N A;  2C2D A;  5DB9 A;  4BGD A;  5KG1 A;  1TK5 A;  3MGI A;  4I27 A;  4AT8 B;  4ELT A;  2XY6 A;  2ASD A;  4QZF A;  1KNY A;  1NJY A;  4FO6 A;  4IR1 A;  5DEC A;  3PW5 A;  2ZH6 A;  4TUP A;  3PR4 A;  2XCA A;  1NK5 A;  4F50 A;  2KP7 A;  4IRK A;  2W9A A;  2W9M A;  5HRE A;  2BHN A;  2NRT A;  4LT6 A;  2BQU A;  4ECX A;  1ZQP A;  5L1L A;  4NY8 A;  2C2R A;  1JXL A;  4BWJ A;  4DQI A;  4Q8E A;  8ICF A;  4JWN A;  3AQL A;  4Q43 A;  8ICV A;  1UEV A;  2ZJA A;  3UXO A;  4F3O A;  5J0P A;  2MUT B;  2FLP A;  4YMM A;  4F5N A;  2PFP A;  5KFY A;  4RT2 A;  2VAN A;  3ISB A;  4ED1 A;  1TK8 A;  2BPG A;  4QZ9 A;  1ZQZ A;  4ED7 A;  5HP4 A;  1JXE A;  1BPX A;  1WCN A;  1ZQG A;  7ICP A;  3E2E A;  2XY7 A;  4M04 A;  2PXI A;  1QSL A;  4RNO A;  3OGU A;  8ICH A;  4FBT A;  2Q0Z X;  3LWL A;  3ISD A;  4PHA A;  3SI8 A;  3PO4 A;  2HHS A;  8ICI A;  1LV5 A;  5HRB A;  4UB5 A;  9ICI A;  5DG9 A;  4DL4 A;  4ATB B;  4RQ6 A;  2NRZ A;  1ZQM A;  9ICU A;  4JK1 A;  7ICN A;  4LZD A;  4X0B A;  1N56 A;  3IHQ B;  1WCL A;  4DLE A;  5F2V O;  5EOZ A;  1NKC A;  4P4O A;  1ZQI A;  1X9S A;  3JPR A;  1ZQJ A;  9ICB A;  2JZB B;  5IIL A;  4J9O A;  3V7L A;  3M9N B;  3TFS A;  1ZQT A;  5DBB A;  4QZI A;  5CWR A;  2I1Q A;  5DGA A;  5KFU A;  4UB2 A;  4F92 B;  4QWC A;  3KHG A;  4GXI A;  2RDI A;  4EBE A;  2AJQ A;  4AT7 B;  4RWP A;  5KFF A;  1SL0 A;  2AQ0 A;  1B43 A;  3M8S A;  4M47 A;  4DQQ A;  3ETL A;  5J0W A;  2XO7 A;  3HX0 A;  3GIM A;  1T3N A;  1RYS A;  9ICV A;  4J9L A;  4F4X A;  5KFA A;  4DSF A;  3AU6 A;  4I28 A;  1RXV A;  1ZJM A;  1ZQV A;  5CP2 A;  3OHA A;  4M2Y A;  1A76 A;  5KT5 A;  5DQG A;  4FH5 A;  3RJH A;  2BKE A;  1JX4 A;  3BQ0 A;  3ZDD A;  8ICQ A;  4YR2 A;  1RYR A;  1ZQQ A;  3WFP A;  3SYZ A;  3G6X A;  3WFS C;  4KLM A;  1MIV A;  3RJE A;  3MR3 A;  2B21 A;  2BCQ A;  4TUS A;  2BCS A;  9ICA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...