5DBAA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a dt
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 114
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbaA03
5DBAA 4LZGA 5KFHA 4P2HA 4WC7A 3OVBA 4RQ8A 2W9BA 4O5EA 8ICCA 3QEBZ 2F1JA 3PNCA 4RNMA 4RQ7A 1XO1A 4DS4A 4I28A 1B22A 1BNPA 5F9NA 3MR3A 1NK4A 2IBKA 2IA6A 9ICWA 3T5LA 3KHHA 3EZ5A 2J6TA 4NKUA 4Q8FA 5KFDA 4QWCA 3GFKB 5KG5A 4IRKA 4RQ2A 4RNOA 3HJ1A 5KFRA 2XY7A 1NK7A 2P6RA 2GWSA 8ICVA 2BE3A 3MR6A 4DSJA 1ZQZA 5KG2A 5J29A 2MAXA 4PGYA 4J9KA 3TFRA 1S0NA 5J0TA 3SYZA 3T3FA 4I2BA 4QZEA 1A76A 3JPTA 4F5QA 8ICXA 5J0XA 2KTQA 2JEFA 5DQHA 5J2DA 3KHRA 4P4OA 5DBCA 3RB4A 4ELUA 4RNNA 2DR5A 2PI4A 8ICGA 3C23A 1ZQMA 3RJKA 4GC7A 3HIYA 3PR4A 2BPCA 1XSNA 4JV2A 2M2WA 4ECRA 9ICEA 3GIIA 1OU5A 1ZQPA 4TUQA 3ZDCA 4K4IA 4F4YA 1ZQJA 3HW8A 3BDPA 2BKEA 3Q8KA 4WBZA 4UB2A 2ZH7A 1BPZA 4GXJA 1KTQA 4O5CA 5KG3A 3SZ2A 5J0SA 4C8KA 4B9NA 1NOMA 4R8UB 3UXOA 1R8BA 2DR7A 1XS9D 4FO6A 2VA3A 3LQCB 5KFSA 4YR0A 1ZQGA 4QZGA 4X4UA 2XO7A 3C1ZA 3RJEA 4RQ0A 3L9DA 5KFIA 3GDXA 2C22A 3M9NB 4X4TA 4PGXA 3LWLA 1S10A 4PHEA 3GIMA 1L3VA 5CA7A 1X9MA 3OVSA 7ICVA 5KT3A 1ZQEA 4ECQA 1VFGA 2ISOA 1R89A 9ICLA 4MFFA 1BPXA 1NK6A 2M9NA 3PX6A 5IIOA 8ICWA 5BOLA 3UXPA 1L3TA 4KLFA 4J9NA 4IQWA 5J2CA 5EOZA 3MR2A 4WBYA 5HRGA 4M04A 3TAQA 4XQ8A 4I2CA 3MR5A 2B21A 1NK0A 4I2JA 3HPOA 9ICHA 1T8EA 4FS1A 4IRDA 1YLQA 3RJJA 7ICJA 4PHDA 4F93B 2W9CB 2W8KA 4DFMA 7ICTA 4E7XA 3B0XA 3V7LA 4B9TA 3HT3A 1TFYA 1S97A 4I2AA 9ICJA 1ZQNA 5J0RA 1TK5A 4YD2A 2DRBA 1DOQA 2BGWA 7ICIA 3GILA 4AT8A 3AUOA 4WC0A 2W9BB 2NRVA 3M9MB 4E80A 5IIKA 1K1QA 2XCPA 4GC6A 4KLHA 2HHTA 9ICAA 8ICRA 8ICSA 4RWOA 1S0MA 4QZIA 3AU6A 1TKDA 1NJZA 9ICOA 1KFTA 4EP7A 4RQ4A 3BQ2A 2KN7A 4X0AA 1B43A 2W8LA 2BQUA 4JV1A 4KLGA 4DL2A 4ZH4A 2M2UA 1BPBA 1WCNA 4EBJA 1Q79A 3PW7A 4DQPA 4EBKA 4WC1A 5D46A 4IQUA 1SL1A 1N48A 1CEZA 4MEYA 1D9FA 3RJHA 3MGHA 4O0IA 4I2HA 1Z3EB 3Q8SB 3RJFA 5DDMA 9ICSA 1ZQCA 4M6WB 3JPQA 4J9RA 2ASDA 4F5PA 4DL5A 1RZTA 4UAWA 4RWNA 4YFKA 1ZETA 4Z6DA 2AU0A 1QTMA 2VANA 1XU4A 3PX0A 7ICRA 4DFKA 3ISCA 1RXVA 1SL0A 1VJ7A 4FHXA 4X4PA 4O3RA 4NLZA 8ICYA 3IHQB 1BPEA 5KFNA 4QW9A 4AT7B 4FHWA 2BQ3A 4GXKA 3Q8QB 1HUZA 3EWAA 2J6SA 2P66A 9ICPA 3GIJA 5J2EA 2BCQA 4X0BA 4J9MA 4I29A 4ED1A 5BPCA 4DSIA 1QLNA 3OSNA 1JAJA 3HJ4A 5DBBA 5EWFA 8ICIA 5HNKA 3PX4A 5J0YA 9ICIA 3PW5A 4NLNA 1UEVA 2KP7A 4MF8A 4F2RA 3NTUA 3QZ8A 3TFSA 2HW3A 7ICMA 4E8FA 1NK8A 1SKSA 4MFCA 1KFSA 4FS2A 4KLLA 2O5AA 4X5VA 1ZQSA 2PI5A 4PPXA 8ICBA 1NJYA 2C2RA 8ICEA 5KFFA 1SKWA 4X4RA 1JQRA 4DL3A 2KFNA 4ED8A 4F5NA 2DRAA 2HHXA 3ZD8A 1HUOA 3JPOA 3SV3A 2AGQA 4YXJA 3TI0A 5J0WA 5TZVA 1BGXT 4B9LA 5IILA 3C2MA 4KLOA 7ICGA 5L1JA 7ICEA 3HP6A 3N97B 1TFWA 3QE9Y 2MUTA 3JYYA 4O3OA 1MIWA 3OUYB 2LYHA 3MGIA 2PFOA 4I27A 1S0VA 2HVHA 7ICUA 1BNOA 2BCSA 1LV5A 2R8GA 4EEYA 2ZH4A 4IR9A 4Q45A 3H3AA 1N56A 4QZFA 4RPYA 4YXMA 4EBDA 3RJGA 4RPXA 1ZQXA 5HRDA 4NXZA 2XGQA 2HHPA 4DL4A 4J9OA 3ETLA 5CP2A 1D8YA 3ZDAA 2F1IA 5DG7A 3OJSA 3H40A 5DDYA 4F4KA 1JN3A 4C8MA 2ZJ8A 1S0OA 1KLNA 5D4BA 4MFAA 1WCLA 4O3QA 5J2GA 4FH3A 4M0AA 3H38A 2AQ4A 4DQRA 4WCWA 3AU2A 7ICQA 4AT8B 4RWPA 3PY8A 2I1QA 4UBCA 1NK9A 5KFYA 5J2AA 4DO9A 4C8LA 4ED0A 4EZ6A 4NLKA 5KG0A 1ZQDA 3H4DA 1NKBA 2ZJ5A 3SI8A 3V6JA 5DLFA 2ZTEA 5J2JA 9ICUA 4S3NA 2DR9A 5JUMA 2A1JA 2Q0ZX 4QZAA 4RPZA 5CHGA 2PFNA 5KFGA 3PMNA 9ICKA 5KFEA 4WC6A 1X9SA 2I9GA 3PR5B 2VA2A 5HC9A 1NKEA 5KG4A 1K1SA 2BCVA 4I2FA 2HHSA 9ICVA 5KFMA 1BVSA 2KFZA 5J2BA 3RBDA 5DECA 3GV7B 1ZQQA 3Q8LA 1ZQBA 7ICSA 3UQ0A 4ECYA 4WC3A 4EBEA 4NM1A 5L9XA 3Q8PB 3ZDDA 1Q78A 5HMLA 5IIIA 2IHNA 2KZ3A 4M9LA 1KDHA 2FMQA 2KZZA 3JPNA 7ICNA 8ICLA 2ZJAA 3C2KA 3PO4A 3RAQA 3BJYA 1Z00B 1ZQOA 1ZQRA 4PGQA 1JX4A 4DFPA 3RH6A 2HHQA 1V4AA 4NKTA 4YMNA 3EYZA 5BOMA 4EZ9A 7ICOA 4RUAA 8ICAA 2R8IA 2ZHBA 4DF4A 3EW9A 4DQIA 4AT9B 5HHHA 3PW4A 2VA8A 5EWGA 8ICFA 4YMMA 4DSEA 7ICKA 4I2DA 2NRZA 5KFQA 5KT7A 4KITB 1RXWA 3RR7A 4F4XA 5IINA 4YN4A 3H8SA 4M9HA 2HHVA 1XWLA 4CCHA 4ELVA 1PX5A 4ED6A 1UT5A 4FH5A 2J6UA 3WFPA 5KG6A 2FLPA 4ECUA 4YR3A 4O3NA 4Q44A 7ICFA 3AQKA 4UB4A 2F1HA 1U4BA 3RH5A 3EPIA 3THVA 1TAUA 4DOCA 4KLMA 2ZH1A 3ZD9A 2PXIA 9ICBA 2XC9A 2NRXA 2MUTB 1LB2B 4KLDA 8ICMA 2AQ0A 5F9LA 3Q8MA 2ISPA 5DB6A 4F2SA 2ZH5A 4DS5A 2DFLA 4IRCA 1MSWD 3AQLA 2BPGA 1JIHA 1TK0A 5D49A 4O3PA 3TANA 1QSYA 1ZJNA 4ED2A 9ICXA 5KG7A 2Q66A 4IG8A 3ISBA 2BCUA 5J0PA 4EBCA 4ECWA 4ECVA 1UT8A 2RDIA 5KT6A 4BXOA 4FBTA 4UQGA 1XSLA 1NZPA 5HRIA 3GV8B 3OJUA 4UBBA 4WC2A 2DPIA 4Z6EA 8ICOA 4JWNA 2FLLA 2KZMA 1MC8A 2ZUBA 2R8JA 3H8WA 4DSFA 3OV7A 5L1IA 3ISDA 8ICUA 4ECZA 1S76D 3T5KA 4C8OA 3JZ0A 1ZQKA 1NK5A 4EYHB 2XCAA 4G3IA 4J9LA 1T4GA 4R63A 2W9AA 2ZUDA 2ATLA 2P6UA 2IMWP 1T7PA 4QZHA 2C2EA 7ICLA 3B0YA 4UD4A 1CUKA 3HX0A 2FMPA 2ZH6A 5DB7A 1NJXA 3G6XA 3G6VA 1MQ2A 1QSLA 5KFAA 3RBEA 4NLGA 4Q8EA 5HRFA 3H39A 4QW8A 1ZJMA 5HRBA 4F5RA 4YQWA 3UPQA 2R8KA 1KRPA 4M9GA 4O9MA 1KNYA 8ICPA 5HREA 4ED7A 1SKRA 2ZH3A 1R8AA 1MIVA 3PV8A 1RYRA 5DG8A 5DB9A 3MDCA 5CJ7A 3ORYA 3C18A 2WTFA 1U49A 3GIKA 4DQSA 1UA1A 4TUSA 3RRGA 4P4PA 4IQTA 2Y1JA 3RB0A 3LK9A 1S77D 2ZTCA 4J9PA 3NYBA 4WC4A 4WC5A 3OVAA 4J9QA 8ICTA 4FHPA 4BWJA 5CB1A 4R66A 1HJPA 1FA0A 3UQ2A 5KFLA 9ICCA 3PW2A 2C28A 5DG9A 5DQGA 4QZBA 5KFTA 5J0UA 1TFRA 3RR8A 2ID1A 5DLGA 2BCRA 4KLIA 5F2VO 2W9CA 4ECTA 3MABA 4BDPA 2V4QA 7ICHA 4JV0A 1L3UA 3MFIA 2M2TA 4LT6A 1BPDA 1ZQUA 4I2EA 4UAZA 4RU9A 4YP3A 1ZQWA 4EYIB 1PZNA 4DL7A 3T5HA 4PH5A 4RQ1A 4M9JA 1S9FA 1ZQTA 4X4OA 3C2LA 2HHWA 4XRHA 4YR2A 2FMSA 9ICMA 2M2VA 2PFPA 2FLNA 1IM4A 1TV9A 1NO5A 5L1KA 4Z6FA 2ASJA 4F91B 4MF2A 5KFPA 2AGOA 2BDPA 2UVVA 3KTQA 5DB8A 4ATBA 1ZQIA 1ZQVA 3C1YA 5KFXA 2FPMA 3G6YA 2AJQA 4M9NA 3M8RA 4KLUA 5KFOA 3AQMA 1DK3A 2HHUA 5J2IA 1SZPA 2FPKA 3H4BA 3PMLA 3V6KA 2OWOA 3KHGA 1SL2A 5HRLA 3JPPA 4XA5A 4UAYA 2BPFA 2UVRA 3FDSA 4GLXA 4UB3A 4ED3A 1NKCA 3K75D 4B9UA 4M6WA 4TUPA 2JZBA 9ICRA 3ZDEA 9ICNA 4P4MA 4BXOB 2XY6A 2HVIA 3MFHA 2FPLA 4IQVA 4DLEA 2UVWA 4YCXA 4NM2A 4QZ9A 4KLQA 4BWMA 4AT7A 3WFRE 5HRKA 1ZYQA 4O3SA 8ICKA 1DK2A 4PHPA 3RJIA 4DF8A 3C5FA 4DWIA 5KT2A 3BQ1A 8ICNA 3H7IA 4KN4A 4YMOA 1ZQHA 3LDAA 4RUCA 5DEDA 1ZQFA 2ALZA 3C21A 2JEGA 2ZH9A 5CR0A 4M5DA 8ICJA 3UPSA 4K4HA 3BQ0A 1X9WA 3PO5A 5DGAA 2DR8A 5EWEA 5HR9A 2PBEA 4XQ7A 1L5UA 5KT5A 4MEXA 3V7KA 1TAQA 3RRHA 3PVXA 9ICQA 3GQCA 1ZQYA 5C5JA 1UETA 4E0DA 4YD1A 5DGBA 1RYSA 4IR1A 3Q8RB 4DOAA 3V6HA 4RZRA 5KFCA 2XY5A 3TARA 2DPJA 4FHVA 4LZDA 5KG1A 2BQRA 2BR0A 3C5GA 4F8RA 5IIJA 4M47A 1AROP 4DL6A 5J2KA 5CWRA 3SV4A 2DVIA 8ICHA 5KFWA 1JXLA 4QWBA 4B9MA 5HP4A 4O5KA 4KLSA 1DGSA 3BQTA 9ICGA 3RB6A 4JUZA 4UD5A 1L3SA 3K4GA 5DKWA 5HMMA 3OHAA 2ZUCA 4DEZA 3GV5B 2H5XA 1MIYA 3C66A 4KLEA 1ZQAA 3TQ1A 4B9SA 4DQQA 2AGPA 4ECSA 3OUYA 1JXEA 1Y88A 3V72A 4KLTA 3HWTA 1T3NA 4F92B 4QWDA 3H37A 1V9PA 5KFZA 3MDAA 4DSLA 2W9MA 3FYHA 4FHYA 3IM1A 3QZ7A 5J2HA 1QSSA 4QWAA 4PHAA 3N4MB 2UVUA 4QZDA 4X4SA 1H38A 4Z6CA 4BGDA 4UB5A 3V7JA 8ICQA 4JWMA 4RT2A 1UA0A 4KTQA 4DSKA 5KFUA 3JPSA 3WFSC 5HHIA 1MQ3A 2JEJA 2IHMA 5KFJA 2NRTA 3AQNA 1BPYA 3PW0A 3UXNA 4RQ6A 2O1PA 3WFQE 4QZCA 3RAXA 5HRHA 5L1LA 2ZHAA 4ATBB 3RTVA 1TVAA 3T5JA 4DFJA 5IIMA 5KT4A 2ZH2A 4ECXA 5J2FA 4F4ZA 1EXNA 1A77A 1RPLA 3NGDA 1KSPA 7ICPA 1U45A 2ASLA 1D8LA 4JK1A 3ZDBA 4B9VA 4LVSA 4R8UA 4Q43A 3EPGA 1ZQLA 4DOBA 9ICTA 5KFVA 4RT3A 3QEAZ 4TURA 1D9DA 2A1JB 5KFKA 4J9SA 3RB3A 4KLJA 1JMSA 5KTQA 4F50A 2JZBB 1XSPA 4RQ3A 1NJWA 3M8SA 4X4VA 1U47A 4DLGA 4I2IA 4KMUA 4R64A 4HYKA 9ICFA 4K4GA 4XUSA 3TAPA 1KEJA 1WOTA 2NRKA 3JPRA 2R8HA 2ZH8A 4X4NA 2C2DA 4M2YA 3E2EA 3OSPA 4GXIA 2Y1IA 4NY8A 2V9WA 4YVZA 2JEIA 2PFQA 4YG2A 8ICZA 3KHLA 4F4WA 3RH4A 3WFOA 1Z00A 1COOA 5DQIA 3M9OB 4R65A 1TK8A 3OHBA 3OGUA 1C7YA 4I2GA 4FBUA 4RQ5A 2NRWA 4KN7A 2XGPA 4F3OA 3H8JA 1KFDA 1U48A 2ZTDA 4ELTA 4AT9A 1F5AA 5J0QA 1R8CA 4TQRA 2RFFA 4RWQA 2BHNA 5KFBA 4UB1A 1U9LA 4F5OA 2RDJA 1XC9A 1UEUA 4TQSA 3LWMA 4QWEA 1X2IA 2V4RA 4QZ8A 1IXRA 4C8NA 4X4QA 3MBYA 5J0OA
chains in the Genus database with same CATH superfamily
3OVBA 2W9BA 4FE3A 4FZMA 2F1JA 4DS4A 3KHHA 2ODGA 5KFDA 4QWCA 2KG5A 5KG5A 2XY7A 2JV3A 4DSJA 5J29A 2MAXA 4QIWC 4PGYA 4J9KA 1S0NA 3DDHA 1CRXA 2JEFA 5DQHA 2MU2A 4GIBA 2GOLA 2M2WA 4ECRA 3GIIA 4TUQA 4F4YA 1ZQJA 3HW8A 4UB2A 2HOFA 5CFSA 2B4VA 3TADC 3I1YA 4C8KA 4B9NA 2KK0A 4FO6A 4X4UA 4RQ0A 1S10A 4IC9A 3GIMA 2KSOA 3CRXA 3OVSA 2H3VA 1ZQEA 5AKHA 9ICLA 4PL2A 2HBJA 1RQNA 1FFUA 2B21A 4I2JA 4BX9C 2VKQA 2KV2A 4UATA 4B9TA 5AHXA 4P0PA 3NRWA 4OJOA 7ICIA 4FZNA 2NRVA 4E80A 4KLHA 1ZRNA 4ZOHC 1TKDA 4EP7A 4RQ4A 4JV1A 4QIWF 1BPBA 5D46A 3WK5A 1Z3EB 3RJFA 1ZQCA 4J9RA 4F5PA 2EWRA 4Y2VA 1ZETA 2VANA 3ISCA 1VJ7A 4FHXA 1Z19A 2G5IB 3IHQB 4QW9A 3UMBA 3Q8QB 4FZLA 1HUZA 3EWAA 2P66A 3D2QA 2Q4TA 2QB1A 4J9MA 4X0BA 4I29A 4ED1A 3OSNA 5EWFA 3LVVA 2QARA 4C7YA 4NLNA 1F5SA 3KOOA 3NTUA 3QZ8A 3TFSA 4EX6A 4MFCA 1KFSA 4X5VA 3T79A 4PPXA 8ICBA 3ERCC 2C2RA 3H8MA 4X4RA 1JQRA 4DL3A 4ED8A 1X9XA 2HHXA 3ZD8A 5ALGA 5IILA 1TFWA 3HP6A 3BS7A 3OUYB 1S0VA 2HVHA 2BCSA 2OXOA 3H3AA 4K97A 4QZFA 4RPYA 2ZXIA 2HHPA 5AIAA 4NXZA 5CP2A 3OWGA 4F4KA 1JN3A 4OAIZ 2ZJ8A 1WCLA 4A8EA 5J2GA 4M0AA 3AU2A 1O03A 2F8KA 3PY8A 2I1QA 3WK4A 3QNMA 1NK9A 4C8LA 5CRXA 3H4DA 4K98A 5J2JA 1GO3F 2JXJA 4S3NA 4QZAA 4RPZA 3PMNA 5KFEA 4WC6A 1RDFA 1NKEA 3WK6A 1K1SA 4NWIA 5KL1B 1BVSA 5EE3A 5DECA 1ZD2P 3GV7B 3IN5A 4ECYA 3ZDDA 1Q78A 5IIIA 2KZZA 3QYPA 7ICNA 2FDRA 3JPNA 8ICLA 2EAPA 2XICA 2ZJAA 3C2KA 3RAQA 4PGQA 1JX4A 2ES6A 1V4AA 3F2DA 3EYZA 2W03A 1SV4A 4DF4A 4AT9B 3ICXA 4KITB 1PX5A 4CCHA 3SR6A 3KZXA 2GO7A 1UT5A 2FLPA 4ECUA 2LYAA 4UB4A 3QU5A 4DOCA 2ZH1A 2XC9A 1WYGA 1LB2B 2AQ0A 5F9LA 4IRCA 5AI8A 2IOFA 1IG6A 1JIHA 1QQ7A 4O3PA 1QSYA 2Q66A 1JROA 3ISBA 2DWQA 4EBCA 5KT6A 4UQGA 3GV8B 3OJUA 4UBBA 2KKVA 3B9JA 3D6JA 2ZIWA 4DSFA 2NV3A 1OUQA 3JZ0A 3WKAA 2XCAA 4HAIA 2W9AA 2ZUDA 2P6UA 1CUKA 2FMPA 5DB7A 2F2AB 3G6VA 1MQ2A 4Q8EA 3H39A 4LEWA 2DUYA 1PUZA 2LI6A 1SKRA 2ZH3A 2NYVA 1WWVA 1R8AA 3MDCA 1VLBA 3ORYA 4DQSA 1UA1A 4P4PA 2Y1JA 2IUBA 4USAA 1X42A 1J2MA 1L8LA 5L1MA 4FHPA 4NJ8A 4R66A 1FA0A 3UQ2A 3F2BA 5DG9A 5DQGA 4QZBA 3TKAA 2ID1A 5DLGA 2BCRA 2KNJA 5A0LA 4O68A 2M2TA 2W11A 1ZQUA 3SMVA 4I2EA 2D3DA 4RU9A 4UAZA 1ZQWA 1PZNA 2ZIVB 4X4OA 1OXJA 2M2VA 4RQMA 2PFPA 1IM4A 1TV9A 2ASJA 5KFPA 3C1YA 3G6YA 3M1YA 5KFOA 5J2IA 1SL2A 3MC1A 3JPPA 4UB3A 4M6WA 1MA7A 2ZXHA 4BXOB 2UVWA 5JU5A 4QZ9A 1T94A 2QKQA 1ZYQA 4O3SA 8ICKA 3C5FA 3BQ1A 5B3QA 3LDAA 2WB1C 3KBBA 3PO5A 5EWEA 5HR9A 2PBEA 4XQ7A 5AM4A 5KT5A 3V7KA 3LYSA 3RRHA 5C5JA 4IL6U 1RYSA 2XY5A 3TARA 1PK1B 4FHVA 2W3RA 2PKEA 2DVIA 4DL6A 1VJ5A 2HMXA 4QWBA 4Y2YA 4K96A 3VCBA 5EE1A 3K4GA 5DKWA 4M5DA 2ZUCA 4OO1J 1ZQAA 1DXSA 1LKYB 1KN5A 4P0QB 3JCFA 1T3NA 2F8LA 4F92B 4DSLA 3KFUF 4CF5A 3QZ7A 1RM6C 4QWAA 4UB5A 2F3NA 4RT2A 1UA0A 5AM3A 4KTQA 5AK3A 5KFUA 5HHIA 1MQ3A 2IHMA 5KFJA 1BPYA 1SV0C 3FAHA 2O1PA 3SEIA 4JB3A 5HRHA 2ZHAA 4ATBB 3RTVA 3T5JA 2G5HB 4ECXA 5J2FA 1EXNA 1A77A 3NGDA 1KKXA 1U45A 2H3IA 4JK1A 3QU9A 1ZQLA 3MGVA 4DOBA 5KFVA 3QEAZ 3S6JA 2EZYA 4KLJA 5KTQA 4F50A 2JZBB 1XSPA 5ALZA 4KMUA 3KZIU 4K4GA 2NRKA 1LVHA 3OSPA 2V9WA 2JEIA 1Z00A 1COOA 3M9OB 3OGUA 1L6NA 2NRWA 4LEVA 1R8CA 4TQRA 2RFFA 2GLEA 4F5OA 4TQSA 4QWEA 1L7NA 5ALIA 4P2HA 4RQ8A 2W7PA 3QEBZ 5AI6A 4RQ7A 4I28A 2IBKA 3AM9A 2IA6A 9ICWA 3T5LA 1P7DA 3GFKB 4RQ2A 3HJ1A 5KFRA 1NK7A 2P6RA 3MR6A 1ZQZA 2F76X 4UB6U 2E8MA 5J0TA 3T3FA 2RQ5A 1A76A 8ICXA 5J0XA 2M0NA 2XI9A 1L7OA 2JR5A 5B3PA 4RNNA 2XIDA 2PI4A 3C23A 3HILA 9ICEA 3ED5A 4K4IA 3BDPA 2BKEA 4WBZA 1BPZA 4Y2RA 3UXOA 3NRZA 3QU7A 3LQCB 4O69A 4C4TA 3F5EA 3C1ZA 3RJEA 2WF6A 3IDWA 3GDXA 3SAGA 3LWLA 4PHEA 1L3VA 5CA7A 1X9MA 4DCCA 7ICVA 4NLCA 5KT3A 4ECQA 2ISOA 2CRXA 4MFFA 1BPXA 1NK6A 2M9NA 3PX6A 8ICWA 5BOLA 3UXPA 1L3TA 4J03A 5AKIA 4IQWA 5AICA 5J2CA 3MR2A 4WBYA 5HRGA 4M04A 2GAFD 4XQ8A 2R18A 3BQ7A 5AKJA 4MHVA 4KM5A 1YLQA 3RJJA 4PHDA 4F93B 2W9CB 4XJEA 3PSIA 3B0XA 3V7LA 4I2AA 5JRTA 9ICJA 2W55A 1ZQNA 2DRBA 1YZ6A 4AT8A 3AUOA 2DGZA 2W9BB 4OJLA 5IIKA 2XCPA 8ICSA 1C20A 1Z1VA 1S0MA 3AU6A 9ICOA 1NJZA 3BQ2A 4KLGA 4DL2A 3MCRA 2M2UA 4CF3A 4WC1A 4IQUA 4I2HA 2EZZA 2LBOA 4C4RA 3JPQA 4UAWA 4YFKA 4Z6DA 5KL8B 1XU4A 4X4PA 3PX0A 7ICRA 4DFKA 1RXVA 4CRXA 4O3RA 8ICYA 4AT7B 3M6KA 2J6SA 9ICPA 3GIJA 5BPCA 1JAJA 5HNKA 9ICIA 3PW5A 1TAMA 2HW3A 4E8FA 4FS2A 2PI5A 2KSOB 1SKWA 4OJ5A 2KFNA 2DRAA 1HUOA 5J0WA 5TZVA 1BGXT 2H3FA 4B9LA 4KLOA 7ICGA 3PSTA 5ALWA 5AM0A 1RG6A 3N28A 1BNOA 1ZRMA 2Y0SC 4AYBC 1LV5A 4G9BA 4EEYA 4IR9A 3M6ZA 3L5KA 2ZIUA 4YXMA 4EBDA 2IHOA 5HRDA 3EF2A 3ETLA 4P0PB 5DG7A 3WKCA 3IP4B 3H40A 5AK4A 4PZNA 5D4BA 2EZXA 4O3QA 3NWIA 2AQ4A 4WCWA 4RWPA 4LEZA 3IRUA 2KHQA 2B51A 5KFYA 1GPJA 5ALDA 1ZQDA 1NKBA 1XNSA 2EH9A 2ZJ5A 2ZTEA 1ZD4A 3VC8A 2P35A 2A1JA 9ICKA 1X9SA 2I9GA 2VA2A 3BZKA 4I2FA 5KFMA 2FCLA 5J2BA 3RBDA 3UQ0A 1OW5A 5L9XA 2FE9A 5HMLA 4M9LA 2KZ3A 1KDHA 3M7DA 3PO4A 1FEZA 2RHFA 3NVYA 3KKAC 3NASA 2HHQA 4DFPA 3RH6A 4NKTA 4EZ9A 1A0PA 3EW9A 1QCKA 5EWGA 4YMMA 7ICKA 5KT7A 5IINA 3H8SA 2JMGA 4FH5A 1N5WA 4C7ZA 7ICFA 3AQKA 1N63A 5KAFU 2Y0SF 4AYBF 3ZD9A 4KLMA 9ICBA 2HCFA 5DB6A 2CPRA 4UARA 2DFLA 3AQLA 3AL0B 5D49A 5E79U 9ICXA 3F5AA 1ZJNA 1O08A 5J0PA 4ECWA 2BCUA 4ECVA 2RLTA 4WC2A 1PVRA 4JWNA 2FLLA 1A6SA 2KZMA 2R8JA 2ZUBA 3ISDA 8ICUA 4ECZA 4K99A 4C8OA 1ZQKA 1UPHA 1J2NA 3O0FA 4QZHA 1T7PA 7ICLA 1SGGA 2ZH6A 2O6KA 3RBEA 4QW8A 1JRPA 3UPQA 1KRPA 5ALVA 4ED7A 1MIVA 4NL9A 1RYRA 5DG8A 5DB9A 5CJ7A 5D61A 3GIKA 3E0FA 3LK9A 4WC4A 2ZTCA 4J9QA 8ICTA 5F3XB 1HJPA 5KFLA 5J0UA 3RR8A 3QU2A 4NXXA 3MABA 2V4QA 2OCEA 1BPDA 1NNLA 1XO0A 4YP3A 4DL7A 3T5HA 4M9JA 2HHWA 4XRHA 4YR2A 3AMZA 2FMSA 2FLNA 1V38A 2BDPA 2UVVA 3KTQA 5AKLA 2FPMA 1UHUA 5AI9A 4M9NA 3WKBA 5ALYA 2EDUA 3WK8A 1DK3A 2HHUA 2FPKA 3V6KA 5HRLA 1D8BA 2UVRA 4K8VA 4GLXA 4ED3A 3K75D 4B9UA 4N7RA 5CFTA 2G07A 2XY6A 3MFHA 1N60A 2A3VA 4DLEA 2LPEA 4PHPA 3RJIA 2OH2A 4DWIA 1IV8A 3NVWA 2E8OA 3PSFA 1ZQFA 3C21A 4K4HA 5DGAA 1L5UA 4MEXA 1TAQA 3GQCA 3ETRA 4YD1A 1NI3A 4RZRA 1B4FA 2KIVA 5CEHA 2DPJA 2BQRA 2BR0A 2OHFA 3C5GA 1AROP 5CWRA 3SV4A 5ALLA 9ICGA 2WAQC 4UD5A 5ALQA 3AQEA 3OHAA 5HMMA 1MIYA 2W54A 3HKZC 4KLEA 3TQ1A 4B9SA 1FFVA 2AGPA 2PMZC 4ECSA 3OUYA 1JXEA 1Y88A 3H37A 3WU2U 1FIQA 2HBKA 3SAFA 4EEDA 1QSSA 2IOFK 4X4SA 5ALSA 4ACOA 4BGDA 2DKZA 8ICQA 4EX7A 3JPSA 2Y9TA 5T14A 3RAXA 5L1LA 2ZH2A 5AM1A 5KT4A 2ASLA 4WH5A 1D8LA 3ZDBA 4LVSA 4R8UA 5AKKA 5KFKA 3RB3A 1JMSA 4RQ3A 3M8SA 4FO1A 2F77X 3KD3A 4DLGA 9ICFA 4HYKA 2WHEA 4CNQA 1KEJA 3JPRA 4X4NA 4WOYA 2C2DA 4M2YA 2Y1IA 2HBLA 2PFQA 4YG2A 3RH4A 1SIJA 1L7MA 5DQIA 3OHBA 1C7YA 3ER8C 2XGPA 4ELTA 4AT9A 2XVTA 5AI5A 1F5AA 4UB1A 4US9A 1XC9A 1UEUA 3LWMA 1X2IA 4C8NA 5J0OA 1N2XA 4C0ZA 5DBAA 4LZGA 1SWWA 2E3TA 2PMZF 1B22A 1XO1A 4JLXA 5ALMA 3MR3A 1B0XA 4NKUA 3C28A 4IRKA 2GWSA 8ICVA 2NO4A 3TFRA 1Q46A 3SYZA 4I2BA 4QZEA 3E58A 3CNHA 3JPTA 2E8PA 2LM4A 5J2DA 4I0UA 3CW2C 3NS1A 2DR5A 4CGZA 1Z1BA 3PR4A 3C66A 1XSNA 4JV2A 2L5YA 1ZQPA 3ZDCA 2W7OA 3CK6A 2W43A 3SZ2A 2K60A 5J0SA 1R8BA 3RFAA 1L7PA 2RRDA 5KFSA 2H3ZA 4YR0A 1ZQGA 2WF8A 2AHOB 3M9NB 4X4TA 4CDGA 2G09A 2E8NA 1R89A 3HRDD 5IIOA 4KLFA 3R9KA 4J9NA 3ONNA 2LM1A 2VJ5A 3TAQA 4I2CA 4FS1A 1F0MA 4AP9A 7ICJA 4E7XA 2W8KA 5G5HA 2WFAA 5J0RA 1HEKA 3GILA 2K4HA 4GC6A 1RQLA 4QZIA 1N61A 3NVZA 2YMMA 2KN7A 2BQUA 2W8LA 3AQFA 4Y2UA 1WCNA 4EBJA 4DQPA 1AQ6A 1SL1A 4MEYA 1D9FA 3RJHA 3MGHA 4O0IA 2AH5A 3BZCA 3Q8SB 3WK9A 2ASDA 3I76A 4NXWA 1SL0A 4NLZA 2MA1A 4FHWA 2BQ3A 5GTHU 2WB1F 4B6JA 2BCQA 5AKZA 1QH9A 4DSIA 1QLNA 4WQLA 2K4IA 1X40A 5J0YA 1UEVA 4PJ0U 4MF8A 4F2RA 2G08A 1NK8A 5HR6A 3D2NA 1ZQSA 1PK3A 2GH1A 2N1RA 4RQNA 4F5NA 3JPOA 1ZOLA 4HX0A 3C2MA 7ICEA 5L1JA 1LKYA 3DV9A 2MUTA 1JI7A 2LYHA 3MGIA 2PFOA 4Q45A 1N56A 2E1EA 3RJGA 4RPXA 2XGQA 1S8OA 3A0BU 3OJSA 2YN4A 5ALHA 5DDYA 1KLNA 1S0OA 5G5GA 4U7CA 3NVVA 3H38A 4DQRA 2YB4A 7ICQA 4AT8B 2HOQA 4UBCA 4C80A 4ED0A 1CI4A 5KG0A 4UASA 3V6JA 1UQVA 1KQQA 9ICUA 5B66U 3IV6A 2DR9A 2Q0ZX 5CHGA 5KFGA 2HBMA 2HN2A 2QB0A 3PR5B 5HC9A 2YY6A 4ICAA 4NXTA 2KVCA 2WF9A 4QJFB 2HHSA 2KFZA 1RYUA 3Q8LA 1N62A 5ALNA 4NM1A 2VJ4A 2ZIXA 3Q8PB 4U6PA 5J8YA 1ZQOA 1ZQRA 4YMNA 5BOMA 4RUAA 8ICAA 2ZHBA 2DF4B 5HHHA 4PL1A 3PW4A 2KJ9A 1PVQA 4I2DA 2NRZA 3OVAA 4M9HA 1XWLA 5AM5A 4ELVA 3BS5A 4ED6A 1KL9A 5AI0A 3WFPA 2KOBA 4O3NA 3TACB 1V85A 2F44A 3EPIA 1DRGA 5ALPA 4KLDA 8ICMA 1SXEA 3Q8MA 2ISPA 4F2SA 2ZH5A 4CE6A 4DS5A 3TANA 4ED2A 2ZIUB 4IG8A 1HIWA 3QUBA 1UT8A 2RDIA 5HRIA 1NZPA 2KEYA 3F2CA 1XSLA 2DPIA 4Z6EA 8ICOA 5CFUA 1MC8A 3H8WA 3OV7A 5L1IA 1NK5A 4J9LA 4R63A 2KJ5A 2C2EA 3B0YA 4UD4A 3HX0A 2OM6A 1NJXA 1QSLA 4NLGA 2YB1A 5HRBA 4F5RA 4YQWA 4NL9C 4M9GA 4O9MA 1WG8A 3PV8A 1UCVA 1YZ7A 4TUSA 3RRGA 1S77D 3H0MB 3NYBA 4J9PA 5ALEA 4WC5A 5CB1A 9ICCA 3PW2A 5KFTA 5AKGA 2G06A 2K8AA 2HI0A 5F2VO 5AM2A 2W9CA 7ICHA 1L3UA 3MFIA 4EYIB 3IG8A 3QUQA 2CN1A 1S9FA 3C2LA 1ED1A 5L1KA 4Z6FA 2AGOA 3LVWA 5DB8A 2MSNA 1ZQVA 2AJQA 3M8RA 4KLUA 7ICSA 2OWOA 4UAYA 5AI4A 2WF7A 3U26A 3ER9B 4TUPA 9ICRA 3ZDEA 1F44A 4NM2A 4KLQA 4BWMA 4AT7A 1X6IA 1SXDA 5HRKA 1JUDA 4DF8A 8ICNA 3H7IA 1Q3VA 1ZQHA 4RUCA 3WK7A 2ALZA 3PHZA 2ZH9A 1SWVA 2YX8A 5CR0A 8ICJA 3UPSA 3BQ0A 1X9WA 1M6YA 2JHDA 2Y9UA 2QARB 2G0AA 3EUB2 2K89A 5DGBA 4EENA 4DOAA 3V6HA 5KFCA 3NVOA 4LZDA 4F8RA 4KMOB 4M47A 4WJ3B 1WUDA 2BDUA 4KLSA 3BQTA 3H0LB 3RB6A 1L3SA 2H5XA 4UW9A 3CP8A 3V72A 3HWTA 4QWDA 3H0RB 4FHYA 3IM1A 5ALFA 4PHAA 4LEYA 2UVUA 1IIPA 4K9AA 1YT3A 3IG5A 4DSKA 2K8BB 3AQNA 3PW0A 2DQNB 3WFQE 2B0CA 4QZCA 1KSPA 2KD1A 3FC4A 4Q43A 9ICTA 4RT3A 3SQIA 5D62A 1NJWA 4X4VA 1N5XA 4R64A 4OD0A 3E2EA 4GXIA 4IS7A 4YVZA 8ICZA 3KHLA 4F4WA 3WFOA 3OTQA 4O3MA 4R65A 5AK5A 2BBHA 4FBUA 3RF9A 4RQ5A 4JLZA 1SZHA 4KN7A 5KNIA 3N7PD 2BZFA 1KFDA 1U48A 2ZTDA 2K4PA 5KFBA 2QLTA 2RDJA 2V4RA 4QZ8A 3SAHA 2D8CA 4WC3A 4X4QA 5AKEA 3MBYA 4PZOA 5EE9A 5KFHA 2A1AA 4WC7A 4Y2XA 4O5EA 8ICCA 3PNCA 4RNMA 1BNPA 5F9NA 2KMDA 1QQ6A 1NK4A 4MKPA 1TE2A 2EQYA 3EZ5A 2J6TA 4OJPA 4Q8FA 1FO4A 4RNOA 5AKXA 2BE3A 4OJ6A 5KG2A 4NXVA 2HSZA 4F5QA 2ESEA 2KTQA 3KHRA 4P4OA 5DBCA 3RB4A 2ZIWB 4ELUA 1MN8A 3AEVA 8ICGA 1ZQMA 3RJKA 4GC7A 3HIYA 2BPCA 1OU5A 1QQ5A 2A19A 3Q8KA 2ZH7A 5C0YA 3NKUA 3AN1A 4GXJA 1KTQA 4O5CA 5KG3A 1NOMA 4R8UB 2DR7A 3TADA 1XS9D 2VA3A 5AKYA 4CF4A 4QZGA 2XO7A 2DL0A 1Q8KA 3L9DA 5KFIA 2C22A 1VDVA 4PGXA 2E5SA 2LKYA 2W04A 4NXUA 3N7RC 3PZPA 2OEHA 4EEBA 5EOZA 4BUGA 4US8A 3MR5A 1NK0A 3KKAA 3UMGA 3HPOA 9ICHA 1T8EA 4IRDA 3ZI4A 2KE7A 4DFMA 1JALA 7ICTA 3HT3A 1TFYA 2K4EA 1S97A 4EV6A 1TK5A 4YD2A 3GU3A 1DOQA 3NUQA 4WQKA 1KBUA 2BGWA 4WC0A 3M9MB 1K1QA 2HHTA 8ICRA 9ICAA 4RWOA 1KFTA 5JTGA 4OAFA 5CHEA 2FI1A 4X0AA 1B43A 4ZH4A 1Q79A 3PW7A 4EBKA 3WKEA 2BBJA 1N48A 1CEZA 3HJEA 9ICSA 5DDMA 4M6WB 1RZTA 4RWNA 4DL5A 2H3QA 2AU0A 1QTMA 2RP5A 1COKA 5AIBA 1BPEA 5KFNA 4GXKA 4LJXA 2NO5A 2GA9D 4KX5A 5J2EA 3HJ4A 5DBBA 8ICIA 5B5EU 3PX4A 2KKPA 5KAIU 2KP7A 5H2FU 7ICMA 1SKSA 4KLLA 2O5AA 2WAQF 1NJYA 8ICEA 5KFFA 3F53A 3HKZF 3SV3A 2AGQA 4YXJA 1T3QA 1WWUA 3TI0A 4EEKA 2B6GA 1X66A 3N97B 4O67A 3L3FX 4F72A 3QE9Y 4O3OA 3JYYA 4KX3A 1MIWA 3CYMA 4I27A 7ICUA 2ZH4A 2HOIA 2R8GA 3UM9A 1ZQXA 4DL4A 4J9OA 1D8YA 3ZDAA 2F1IA 3SENA 4C8MA 4MFAA 4FH3A 2K8CB 5ALKA 3QX7A 4EZ6A 4NLKA 3FM9A 5J2AA 3K1ZA 4BJQA 4DFDA 4DO9A 2D6FC 4Y2JA 3PSPA 2FJ6A 3SI8A 1X6JA 5DLFA 3OPXA 2KIWA 5JUMA 2PFNA 4UB8U 2LHTA 2HDOA 5KG4A 2BCVA 9ICVA 4Y2SA 2KVSA 1ZQQA 1ZQBA 2WF5A 2JGAA 4EBEA 5J8YC 2IHNA 1VFGA 2FMQA 2OYYA 3QXGA 3ALRA 3BJYA 5ALUA 1Z00B 2JH1A 4NV0A 7ICOA 2R8IA 1Q3UA 4DQIA 8ICFA 2VA8A 3QU4A 4DSEA 1RXWA 5KFQA 3RR7A 2AXTU 4F4XA 4YN4A 2HHVA 5FP0A 2ZIVA 3C29A 2J6UA 5KG6A 4YR3A 4Q44A 2F1HA 1U4BA 3RH5A 3QUCA 3THVA 1TAUA 2PXIA 2NRXA 2MUTB 3N7SC 1K5OA 4EGWA 1MSWD 2BPGA 1TK0A 5KG7A 1Z4OA 4EELA 2EAOA 4FBTA 4BXOA 2YMLA 3L4PA 1S76D 3T5KA 3K7DA 4EYHB 4G3IA 2Z7JA 1T4GA 1PVPA 2ATLA 2IMWP 4Y2PA 4NLBA 2I6XA 2HN1A 2YTUA 3G6XA 5HRFA 5KFAA 5K4LA 2B56A 1ZJMA 2R8KA 5ALJA 2QB0B 1KNYA 1PK1A 8ICPA 5ALXA 5HREA 1URJA 2E1FA 4OCZA 1SB3C 3C18A 2WTFA 1ZD5A 1U49A 4Y2QA 4IQTA 3RB0A 3WKDA 4OAGA 2ZIXB 4BWJA 4C4SA 2C28A 4P0QA 1TFRA 4KLIA 4ECTA 2KICA 4BDPA 3DEEA 2DBYA 4JV0A 3QUTA 4LT6A 1Z4NA 5D63A 5ALTA 3BS5B 4PH5A 4RQ1A 1ZQTA 2MRLA 9ICMA 1NO5A 5HR7A 4F91B 4MF2A 3K1RB 4ATBA 1ZQIA 4Y2TA 5KFXA 1L8OA 1J97A 1ZQ1C 3AQMA 5EE0A 5AK6A 2EAMA 1SZPA 3H4BA 3PMLA 4O6AA 3KHGA 2I5HA 4XA5A 2BPFA 2LYBA 3FDSA 1NKCA 3SD7A 2JZBA 9ICNA 4P4MA 2HVIA 2FPLA 4UAUA 4IQVA 1DGJA 4YCXA 5GTIU 2EANA 3WFRE 1DK2A 5KT2A 4KN4A 4YMOA 4GFJA 5DEDA 2JEGA 4KB6A 2DR8A 3PVXA 9ICQA 1ZQYA 1ZXIA 4E0DA 5ALOA 1UETA 4IR1A 3Q8RB 5KG1A 3J81j 5IIJA 5J2KA 8ICHA 4UAVA 5KFWA 1JXLA 4B9MA 5HP4A 4O5KA 3D2SA 1DGSA 4JUZA 3GV5B 4DEZA 2JH7A 4OAHA 4K9BA 4DQQA 2CXYA 2VIXA 2ZG6A 4KLTA 2YQEA 4JMUA 1V9PA 5KFZA 3MDAA 2W9MA 3FYHA 5ALRA 5J2HA 3N4MB 1S5LU 4QZDA 1H38A 4Z6CA 2KJ8A 3V7JA 4JWMA 2DKXA 2IOHA 3WFSC 2JEJA 2NRTA 3UXNA 2YMQA 4RQ6A 1ZD3A 1TVAA 1SV0A 4DFJA 5IIMA 2KHVA 3I28A 4F4ZA 1RPLA 3A0HU 7ICPA 4B9VA 3UMCA 3EPGA 1D9DA 4TURA 2A1JB 4J9SA 4F71A 2W3SA 3GZFA 1U47A 4I2IA 4XUSA 3TAPA 2JRZA 1WOTA 2R8HA 5JTIA 2ZH8A 4FFDA 2LMRA 4NY8A 1TK8A 4I2GA 5TISU 1NZBA 1V97A 4F3OA 3H8JA 5J0QA 2BHNA 1U9LA 1KW4A 4QNLA 2YMPA 1ECWA 1IXRA 4RWQA
chains in the Genus database with same CATH topology
5DBAA 4LZGA 5KFHA 4P2HA 4WC7A 3OVBA 4RQ8A 2W9BA 4O5EA 8ICCA 3QEBZ 2F1JA 3PNCA 4RNMA 4RQ7A 1XO1A 4DS4A 4I28A 1B22A 1BNPA 5F9NA 3MR3A 1NK4A 2IBKA 2IA6A 9ICWA 3T5LA 3KHHA 3EZ5A 2J6TA 4NKUA 4Q8FA 5KFDA 4QWCA 3GFKB 5KG5A 4IRKA 4RQ2A 4RNOA 3HJ1A 5KFRA 2XY7A 1NK7A 2P6RA 2GWSA 8ICVA 2BE3A 3MR6A 4DSJA 1ZQZA 5KG2A 5J29A 2MAXA 4PGYA 4J9KA 3TFRA 1S0NA 5J0TA 3SYZA 3T3FA 4I2BA 4QZEA 1A76A 3JPTA 4F5QA 8ICXA 5J0XA 2KTQA 2JEFA 5DQHA 5J2DA 3KHRA 4P4OA 5DBCA 3RB4A 4ELUA 4RNNA 2DR5A 2PI4A 8ICGA 3C23A 1ZQMA 3RJKA 4GC7A 3HIYA 3PR4A 2BPCA 1XSNA 4JV2A 2M2WA 4ECRA 9ICEA 3GIIA 1OU5A 1ZQPA 4TUQA 3ZDCA 4K4IA 4F4YA 1ZQJA 3HW8A 3BDPA 2BKEA 3Q8KA 4WBZA 4UB2A 2ZH7A 1BPZA 4GXJA 1KTQA 4O5CA 5KG3A 3SZ2A 5J0SA 4C8KA 4B9NA 1NOMA 4R8UB 3UXOA 1R8BA 2DR7A 1XS9D 4FO6A 2VA3A 3LQCB 5KFSA 4YR0A 1ZQGA 4QZGA 4X4UA 2XO7A 3C1ZA 3RJEA 4RQ0A 3L9DA 5KFIA 3GDXA 2C22A 3M9NB 4X4TA 4PGXA 3LWLA 1S10A 4PHEA 3GIMA 1L3VA 5CA7A 1X9MA 3OVSA 7ICVA 5KT3A 1ZQEA 4ECQA 1VFGA 2ISOA 1R89A 9ICLA 4MFFA 1BPXA 1NK6A 2M9NA 3PX6A 5IIOA 8ICWA 5BOLA 3UXPA 1L3TA 4KLFA 4J9NA 4IQWA 5J2CA 5EOZA 3MR2A 4WBYA 5HRGA 4M04A 3TAQA 4XQ8A 4I2CA 3MR5A 2B21A 1NK0A 4I2JA 3HPOA 9ICHA 1T8EA 4FS1A 4IRDA 1YLQA 3RJJA 7ICJA 4PHDA 4F93B 2W9CB 2W8KA 4DFMA 7ICTA 4E7XA 3B0XA 3V7LA 4B9TA 3HT3A 1TFYA 1S97A 4I2AA 9ICJA 1ZQNA 5J0RA 1TK5A 4YD2A 2DRBA 1DOQA 2BGWA 7ICIA 3GILA 4AT8A 3AUOA 4WC0A 2W9BB 2NRVA 3M9MB 4E80A 5IIKA 1K1QA 2XCPA 4GC6A 4KLHA 2HHTA 9ICAA 8ICRA 8ICSA 4RWOA 1S0MA 4QZIA 3AU6A 1TKDA 1NJZA 9ICOA 1KFTA 4EP7A 4RQ4A 3BQ2A 2KN7A 4X0AA 1B43A 2W8LA 2BQUA 4JV1A 4KLGA 4DL2A 4ZH4A 2M2UA 1BPBA 1WCNA 4EBJA 1Q79A 3PW7A 4DQPA 4EBKA 4WC1A 5D46A 4IQUA 1SL1A 1N48A 1CEZA 4MEYA 1D9FA 3RJHA 3MGHA 4O0IA 4I2HA 1Z3EB 3Q8SB 3RJFA 5DDMA 9ICSA 1ZQCA 4M6WB 3JPQA 4J9RA 2ASDA 4F5PA 4DL5A 1RZTA 4UAWA 4RWNA 4YFKA 1ZETA 4Z6DA 2AU0A 1QTMA 2VANA 1XU4A 3PX0A 7ICRA 4DFKA 3ISCA 1RXVA 1SL0A 1VJ7A 4FHXA 4X4PA 4O3RA 4NLZA 8ICYA 3IHQB 1BPEA 5KFNA 4QW9A 4AT7B 4FHWA 2BQ3A 4GXKA 3Q8QB 1HUZA 3EWAA 2J6SA 2P66A 9ICPA 3GIJA 5J2EA 2BCQA 4X0BA 4J9MA 4I29A 4ED1A 5BPCA 4DSIA 1QLNA 3OSNA 1JAJA 3HJ4A 5DBBA 5EWFA 8ICIA 5HNKA 3PX4A 5J0YA 9ICIA 3PW5A 4NLNA 1UEVA 2KP7A 4MF8A 4F2RA 3NTUA 3QZ8A 3TFSA 2HW3A 7ICMA 4E8FA 1NK8A 1SKSA 4MFCA 1KFSA 4FS2A 4KLLA 2O5AA 4X5VA 1ZQSA 2PI5A 4PPXA 8ICBA 1NJYA 2C2RA 8ICEA 5KFFA 1SKWA 4X4RA 1JQRA 4DL3A 2KFNA 4ED8A 4F5NA 2DRAA 2HHXA 3ZD8A 1HUOA 3JPOA 3SV3A 2AGQA 4YXJA 3TI0A 5J0WA 5TZVA 1BGXT 4B9LA 5IILA 3C2MA 4KLOA 7ICGA 5L1JA 7ICEA 3HP6A 3N97B 1TFWA 3QE9Y 2MUTA 3JYYA 4O3OA 1MIWA 3OUYB 2LYHA 3MGIA 2PFOA 4I27A 1S0VA 2HVHA 7ICUA 1BNOA 2BCSA 1LV5A 2R8GA 4EEYA 2ZH4A 4IR9A 4Q45A 3H3AA 1N56A 4QZFA 4RPYA 4YXMA 4EBDA 3RJGA 4RPXA 1ZQXA 5HRDA 4NXZA 2XGQA 2HHPA 4DL4A 4J9OA 3ETLA 5CP2A 1D8YA 3ZDAA 2F1IA 5DG7A 3OJSA 3H40A 5DDYA 4F4KA 1JN3A 4C8MA 2ZJ8A 1S0OA 1KLNA 5D4BA 4MFAA 1WCLA 4O3QA 5J2GA 4FH3A 4M0AA 3H38A 2AQ4A 4DQRA 4WCWA 3AU2A 7ICQA 4AT8B 4RWPA 3PY8A 2I1QA 4UBCA 1NK9A 5KFYA 5J2AA 4DO9A 4C8LA 4ED0A 4EZ6A 4NLKA 5KG0A 1ZQDA 3H4DA 1NKBA 2ZJ5A 3SI8A 3V6JA 5DLFA 2ZTEA 5J2JA 9ICUA 4S3NA 2DR9A 5JUMA 2A1JA 2Q0ZX 4QZAA 4RPZA 5CHGA 2PFNA 5KFGA 3PMNA 9ICKA 5KFEA 4WC6A 1X9SA 2I9GA 3PR5B 2VA2A 5HC9A 1NKEA 5KG4A 1K1SA 2BCVA 4I2FA 2HHSA 9ICVA 5KFMA 1BVSA 2KFZA 5J2BA 3RBDA 5DECA 3GV7B 1ZQQA 3Q8LA 1ZQBA 7ICSA 3UQ0A 4ECYA 4WC3A 4EBEA 4NM1A 5L9XA 3Q8PB 3ZDDA 1Q78A 5HMLA 5IIIA 2IHNA 2KZ3A 4M9LA 1KDHA 2FMQA 2KZZA 3JPNA 7ICNA 8ICLA 2ZJAA 3C2KA 3PO4A 3RAQA 3BJYA 1Z00B 1ZQOA 1ZQRA 4PGQA 1JX4A 4DFPA 3RH6A 2HHQA 1V4AA 4NKTA 4YMNA 3EYZA 5BOMA 4EZ9A 7ICOA 4RUAA 8ICAA 2R8IA 2ZHBA 4DF4A 3EW9A 4DQIA 4AT9B 5HHHA 3PW4A 2VA8A 5EWGA 8ICFA 4YMMA 4DSEA 7ICKA 4I2DA 2NRZA 5KFQA 5KT7A 4KITB 1RXWA 3RR7A 4F4XA 5IINA 4YN4A 3H8SA 4M9HA 2HHVA 1XWLA 4CCHA 4ELVA 1PX5A 4ED6A 1UT5A 4FH5A 2J6UA 3WFPA 5KG6A 2FLPA 4ECUA 4YR3A 4O3NA 4Q44A 7ICFA 3AQKA 4UB4A 2F1HA 1U4BA 3RH5A 3EPIA 3THVA 1TAUA 4DOCA 4KLMA 2ZH1A 3ZD9A 2PXIA 9ICBA 2XC9A 2NRXA 2MUTB 1LB2B 4KLDA 8ICMA 2AQ0A 5F9LA 3Q8MA 2ISPA 5DB6A 4F2SA 2ZH5A 4DS5A 2DFLA 4IRCA 1MSWD 3AQLA 2BPGA 1JIHA 1TK0A 5D49A 4O3PA 3TANA 1QSYA 1ZJNA 4ED2A 9ICXA 5KG7A 2Q66A 4IG8A 3ISBA 2BCUA 5J0PA 4EBCA 4ECWA 4ECVA 1UT8A 2RDIA 5KT6A 4BXOA 4FBTA 4UQGA 1XSLA 1NZPA 5HRIA 3GV8B 3OJUA 4UBBA 4WC2A 2DPIA 4Z6EA 8ICOA 4JWNA 2FLLA 2KZMA 1MC8A 2ZUBA 2R8JA 3H8WA 4DSFA 3OV7A 5L1IA 3ISDA 8ICUA 4ECZA 1S76D 3T5KA 4C8OA 3JZ0A 1ZQKA 1NK5A 4EYHB 2XCAA 4G3IA 4J9LA 1T4GA 4R63A 2W9AA 2ZUDA 2ATLA 2P6UA 2IMWP 1T7PA 4QZHA 2C2EA 7ICLA 3B0YA 4UD4A 1CUKA 3HX0A 2FMPA 2ZH6A 5DB7A 1NJXA 3G6XA 3G6VA 1MQ2A 1QSLA 5KFAA 3RBEA 4NLGA 4Q8EA 5HRFA 3H39A 4QW8A 1ZJMA 5HRBA 4F5RA 4YQWA 3UPQA 2R8KA 1KRPA 4M9GA 4O9MA 1KNYA 8ICPA 5HREA 4ED7A 1SKRA 2ZH3A 1R8AA 1MIVA 3PV8A 1RYRA 5DG8A 5DB9A 3MDCA 5CJ7A 3ORYA 3C18A 2WTFA 1U49A 3GIKA 4DQSA 1UA1A 4TUSA 3RRGA 4P4PA 4IQTA 2Y1JA 3RB0A 3LK9A 1S77D 2ZTCA 4J9PA 3NYBA 4WC4A 4WC5A 3OVAA 4J9QA 8ICTA 4FHPA 4BWJA 5CB1A 4R66A 1HJPA 1FA0A 3UQ2A 5KFLA 9ICCA 3PW2A 2C28A 5DG9A 5DQGA 4QZBA 5KFTA 5J0UA 1TFRA 3RR8A 2ID1A 5DLGA 2BCRA 4KLIA 5F2VO 2W9CA 4ECTA 3MABA 4BDPA 2V4QA 7ICHA 4JV0A 1L3UA 3MFIA 2M2TA 4LT6A 1BPDA 1ZQUA 4I2EA 4UAZA 4RU9A 4YP3A 1ZQWA 4EYIB 1PZNA 4DL7A 3T5HA 4PH5A 4RQ1A 4M9JA 1S9FA 1ZQTA 4X4OA 3C2LA 2HHWA 4XRHA 4YR2A 2FMSA 9ICMA 2M2VA 2PFPA 2FLNA 1IM4A 1TV9A 1NO5A 5L1KA 4Z6FA 2ASJA 4F91B 4MF2A 5KFPA 2AGOA 2BDPA 2UVVA 3KTQA 5DB8A 4ATBA 1ZQIA 1ZQVA 3C1YA 5KFXA 2FPMA 3G6YA 2AJQA 4M9NA 3M8RA 4KLUA 5KFOA 3AQMA 1DK3A 2HHUA 5J2IA 1SZPA 2FPKA 3H4BA 3PMLA 3V6KA 2OWOA 3KHGA 1SL2A 5HRLA 3JPPA 4XA5A 4UAYA 2BPFA 2UVRA 3FDSA 4GLXA 4UB3A 4ED3A 1NKCA 3K75D 4B9UA 4M6WA 4TUPA 2JZBA 9ICRA 3ZDEA 9ICNA 4P4MA 4BXOB 2XY6A 2HVIA 3MFHA 2FPLA 4IQVA 4DLEA 2UVWA 4YCXA 4NM2A 4QZ9A 4KLQA 4BWMA 4AT7A 3WFRE 5HRKA 1ZYQA 4O3SA 8ICKA 1DK2A 4PHPA 3RJIA 4DF8A 3C5FA 4DWIA 5KT2A 3BQ1A 8ICNA 3H7IA 4KN4A 4YMOA 1ZQHA 3LDAA 4RUCA 5DEDA 1ZQFA 2ALZA 3C21A 2JEGA 2ZH9A 5CR0A 4M5DA 8ICJA 3UPSA 4K4HA 3BQ0A 1X9WA 3PO5A 5DGAA 2DR8A 5EWEA 5HR9A 2PBEA 4XQ7A 1L5UA 5KT5A 4MEXA 3V7KA 1TAQA 3RRHA 3PVXA 9ICQA 3GQCA 1ZQYA 5C5JA 1UETA 4E0DA 4YD1A 5DGBA 1RYSA 4IR1A 3Q8RB 4DOAA 3V6HA 4RZRA 5KFCA 2XY5A 3TARA 2DPJA 4FHVA 4LZDA 5KG1A 2BQRA 2BR0A 3C5GA 4F8RA 5IIJA 4M47A 1AROP 4DL6A 5J2KA 5CWRA 3SV4A 2DVIA 8ICHA 5KFWA 1JXLA 4QWBA 4B9MA 5HP4A 4O5KA 4KLSA 1DGSA 3BQTA 9ICGA 3RB6A 4JUZA 4UD5A 1L3SA 3K4GA 5DKWA 5HMMA 3OHAA 2ZUCA 4DEZA 3GV5B 2H5XA 1MIYA 3C66A 4KLEA 1ZQAA 3TQ1A 4B9SA 4DQQA 2AGPA 4ECSA 3OUYA 1JXEA 1Y88A 3V72A 4KLTA 3HWTA 1T3NA 4F92B 4QWDA 3H37A 1V9PA 5KFZA 3MDAA 4DSLA 2W9MA 3FYHA 4FHYA 3IM1A 3QZ7A 5J2HA 1QSSA 4QWAA 4PHAA 3N4MB 2UVUA 4QZDA 4X4SA 1H38A 4Z6CA 4BGDA 4UB5A 3V7JA 8ICQA 4JWMA 4RT2A 1UA0A 4KTQA 4DSKA 5KFUA 3JPSA 3WFSC 5HHIA 1MQ3A 2JEJA 2IHMA 5KFJA 2NRTA 3AQNA 1BPYA 3PW0A 3UXNA 4RQ6A 2O1PA 3WFQE 4QZCA 3RAXA 5HRHA 5L1LA 2ZHAA 4ATBB 3RTVA 1TVAA 3T5JA 4DFJA 5IIMA 5KT4A 2ZH2A 4ECXA 5J2FA 4F4ZA 1EXNA 1A77A 1RPLA 3NGDA 1KSPA 7ICPA 1U45A 2ASLA 1D8LA 4JK1A 3ZDBA 4B9VA 4LVSA 4R8UA 4Q43A 3EPGA 1ZQLA 4DOBA 9ICTA 5KFVA 4RT3A 3QEAZ 4TURA 1D9DA 2A1JB 5KFKA 4J9SA 3RB3A 4KLJA 1JMSA 5KTQA 4F50A 2JZBB 1XSPA 4RQ3A 1NJWA 3M8SA 4X4VA 1U47A 4DLGA 4I2IA 4KMUA 4R64A 4HYKA 9ICFA 4K4GA 4XUSA 3TAPA 1KEJA 1WOTA 2NRKA 3JPRA 2R8HA 2ZH8A 4X4NA 2C2DA 4M2YA 3E2EA 3OSPA 4GXIA 2Y1IA 4NY8A 2V9WA 4YVZA 2JEIA 2PFQA 4YG2A 8ICZA 3KHLA 4F4WA 3RH4A 3WFOA 1Z00A 1COOA 5DQIA 3M9OB 4R65A 1TK8A 3OHBA 3OGUA 1C7YA 4I2GA 4FBUA 4RQ5A 2NRWA 4KN7A 2XGPA 4F3OA 3H8JA 1KFDA 1U48A 2ZTDA 4ELTA 4AT9A 1F5AA 5J0QA 1R8CA 4TQRA 2RFFA 4RWQA 2BHNA 5KFBA 4UB1A 1U9LA 4F5OA 2RDJA 1XC9A 1UEUA 4TQSA 3LWMA 4QWEA 1X2IA 2V4RA 4QZ8A 1IXRA 4C8NA 4X4QA 3MBYA 5J0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBA A;  4LZG A;  5KFH A;  4P2H A;  4WC7 A;  3OVB A;  4RQ8 A;  2W9B A;  4O5E A;  8ICC A;  3QEB Z;  2F1J A;  3PNC A;  4RNM A;  4RQ7 A;  1XO1 A;  4DS4 A;  4I28 A;  1B22 A;  1BNP A;  5F9N A;  3MR3 A;  1NK4 A;  2IBK A;  2IA6 A;  9ICW A;  3T5L A;  3KHH A;  3EZ5 A;  2J6T A;  4NKU A;  4Q8F A;  5KFD A;  4QWC A;  3GFK B;  5KG5 A;  4IRK A;  4RQ2 A;  4RNO A;  3HJ1 A;  5KFR A;  2XY7 A;  1NK7 A;  2P6R A;  2GWS A;  8ICV A;  2BE3 A;  3MR6 A;  4DSJ A;  1ZQZ A;  5KG2 A;  5J29 A;  2MAX A;  4PGY A;  4J9K A;  3TFR A;  1S0N A;  5J0T A;  3SYZ A;  3T3F A;  4I2B A;  4QZE A;  1A76 A;  3JPT A;  4F5Q A;  8ICX A;  5J0X A;  2KTQ A;  2JEF A;  5DQH A;  5J2D A;  3KHR A;  4P4O A;  5DBC A;  3RB4 A;  4ELU A;  4RNN A;  2DR5 A;  2PI4 A;  8ICG A;  3C23 A;  1ZQM A;  3RJK A;  4GC7 A;  3HIY A;  3PR4 A;  2BPC A;  1XSN A;  4JV2 A;  2M2W A;  4ECR A;  9ICE A;  3GII A;  1OU5 A;  1ZQP A;  4TUQ A;  3ZDC A;  4K4I A;  4F4Y A;  1ZQJ A;  3HW8 A;  3BDP A;  2BKE A;  3Q8K A;  4WBZ A;  4UB2 A;  2ZH7 A;  1BPZ A;  4GXJ A;  1KTQ A;  4O5C A;  5KG3 A;  3SZ2 A;  5J0S A;  4C8K A;  4B9N A;  1NOM A;  4R8U B;  3UXO A;  1R8B A;  2DR7 A;  1XS9 D;  4FO6 A;  2VA3 A;  3LQC B;  5KFS A;  4YR0 A;  1ZQG A;  4QZG A;  4X4U A;  2XO7 A;  3C1Z A;  3RJE A;  4RQ0 A;  3L9D A;  5KFI A;  3GDX A;  2C22 A;  3M9N B;  4X4T A;  4PGX A;  3LWL A;  1S10 A;  4PHE A;  3GIM A;  1L3V A;  5CA7 A;  1X9M A;  3OVS A;  7ICV A;  5KT3 A;  1ZQE A;  4ECQ A;  1VFG A;  2ISO A;  1R89 A;  9ICL A;  4MFF A;  1BPX A;  1NK6 A;  2M9N A;  3PX6 A;  5IIO A;  8ICW A;  5BOL A;  3UXP A;  1L3T A;  4KLF A;  4J9N A;  4IQW A;  5J2C A;  5EOZ A;  3MR2 A;  4WBY A;  5HRG A;  4M04 A;  3TAQ A;  4XQ8 A;  4I2C A;  3MR5 A;  2B21 A;  1NK0 A;  4I2J A;  3HPO A;  9ICH A;  1T8E A;  4FS1 A;  4IRD A;  1YLQ A;  3RJJ A;  7ICJ A;  4PHD A;  4F93 B;  2W9C B;  2W8K A;  4DFM A;  7ICT A;  4E7X A;  3B0X A;  3V7L A;  4B9T A;  3HT3 A;  1TFY A;  1S97 A;  4I2A A;  9ICJ A;  1ZQN A;  5J0R A;  1TK5 A;  4YD2 A;  2DRB A;  1DOQ A;  2BGW A;  7ICI A;  3GIL A;  4AT8 A;  3AUO A;  4WC0 A;  2W9B B;  2NRV A;  3M9M B;  4E80 A;  5IIK A;  1K1Q A;  2XCP A;  4GC6 A;  4KLH A;  2HHT A;  9ICA A;  8ICR A;  8ICS A;  4RWO A;  1S0M A;  4QZI A;  3AU6 A;  1TKD A;  1NJZ A;  9ICO A;  1KFT A;  4EP7 A;  4RQ4 A;  3BQ2 A;  2KN7 A;  4X0A A;  1B43 A;  2W8L A;  2BQU A;  4JV1 A;  4KLG A;  4DL2 A;  4ZH4 A;  2M2U A;  1BPB A;  1WCN A;  4EBJ A;  1Q79 A;  3PW7 A;  4DQP A;  4EBK A;  4WC1 A;  5D46 A;  4IQU A;  1SL1 A;  1N48 A;  1CEZ A;  4MEY A;  1D9F A;  3RJH A;  3MGH A;  4O0I A;  4I2H A;  1Z3E B;  3Q8S B;  3RJF A;  5DDM A;  9ICS A;  1ZQC A;  4M6W B;  3JPQ A;  4J9R A;  2ASD A;  4F5P A;  4DL5 A;  1RZT A;  4UAW A;  4RWN A;  4YFK A;  1ZET A;  4Z6D A;  2AU0 A;  1QTM A;  2VAN A;  1XU4 A;  3PX0 A;  7ICR A;  4DFK A;  3ISC A;  1RXV A;  1SL0 A;  1VJ7 A;  4FHX A;  4X4P A;  4O3R A;  4NLZ A;  8ICY A;  3IHQ B;  1BPE A;  5KFN A;  4QW9 A;  4AT7 B;  4FHW A;  2BQ3 A;  4GXK A;  3Q8Q B;  1HUZ A;  3EWA A;  2J6S A;  2P66 A;  9ICP A;  3GIJ A;  5J2E A;  2BCQ A;  4X0B A;  4J9M A;  4I29 A;  4ED1 A;  5BPC A;  4DSI A;  1QLN A;  3OSN A;  1JAJ A;  3HJ4 A;  5DBB A;  5EWF A;  8ICI A;  5HNK A;  3PX4 A;  5J0Y A;  9ICI A;  3PW5 A;  4NLN A;  1UEV A;  2KP7 A;  4MF8 A;  4F2R A;  3NTU A;  3QZ8 A;  3TFS A;  2HW3 A;  7ICM A;  4E8F A;  1NK8 A;  1SKS A;  4MFC A;  1KFS A;  4FS2 A;  4KLL A;  2O5A A;  4X5V A;  1ZQS A;  2PI5 A;  4PPX A;  8ICB A;  1NJY A;  2C2R A;  8ICE A;  5KFF A;  1SKW A;  4X4R A;  1JQR A;  4DL3 A;  2KFN A;  4ED8 A;  4F5N A;  2DRA A;  2HHX A;  3ZD8 A;  1HUO A;  3JPO A;  3SV3 A;  2AGQ A;  4YXJ A;  3TI0 A;  5J0W A;  5TZV A;  1BGX T;  4B9L A;  5IIL A;  3C2M A;  4KLO A;  7ICG A;  5L1J A;  7ICE A;  3HP6 A;  3N97 B;  1TFW A;  3QE9 Y;  2MUT A;  3JYY A;  4O3O A;  1MIW A;  3OUY B;  2LYH A;  3MGI A;  2PFO A;  4I27 A;  1S0V A;  2HVH A;  7ICU A;  1BNO A;  2BCS A;  1LV5 A;  2R8G A;  4EEY A;  2ZH4 A;  4IR9 A;  4Q45 A;  3H3A A;  1N56 A;  4QZF A;  4RPY A;  4YXM A;  4EBD A;  3RJG A;  4RPX A;  1ZQX A;  5HRD A;  4NXZ A;  2XGQ A;  2HHP A;  4DL4 A;  4J9O A;  3ETL A;  5CP2 A;  1D8Y A;  3ZDA A;  2F1I A;  5DG7 A;  3OJS A;  3H40 A;  5DDY A;  4F4K A;  1JN3 A;  4C8M A;  2ZJ8 A;  1S0O A;  1KLN A;  5D4B A;  4MFA A;  1WCL A;  4O3Q A;  5J2G A;  4FH3 A;  4M0A A;  3H38 A;  2AQ4 A;  4DQR A;  4WCW A;  3AU2 A;  7ICQ A;  4AT8 B;  4RWP A;  3PY8 A;  2I1Q A;  4UBC A;  1NK9 A;  5KFY A;  5J2A A;  4DO9 A;  4C8L A;  4ED0 A;  4EZ6 A;  4NLK A;  5KG0 A;  1ZQD A;  3H4D A;  1NKB A;  2ZJ5 A;  3SI8 A;  3V6J A;  5DLF A;  2ZTE A;  5J2J A;  9ICU A;  4S3N A;  2DR9 A;  5JUM A;  2A1J A;  2Q0Z X;  4QZA A;  4RPZ A;  5CHG A;  2PFN A;  5KFG A;  3PMN A;  9ICK A;  5KFE A;  4WC6 A;  1X9S A;  2I9G A;  3PR5 B;  2VA2 A;  5HC9 A;  1NKE A;  5KG4 A;  1K1S A;  2BCV A;  4I2F A;  2HHS A;  9ICV A;  5KFM A;  1BVS A;  2KFZ A;  5J2B A;  3RBD A;  5DEC A;  3GV7 B;  1ZQQ A;  3Q8L A;  1ZQB A;  7ICS A;  3UQ0 A;  4ECY A;  4WC3 A;  4EBE A;  4NM1 A;  5L9X A;  3Q8P B;  3ZDD A;  1Q78 A;  5HML A;  5III A;  2IHN A;  2KZ3 A;  4M9L A;  1KDH A;  2FMQ A;  2KZZ A;  3JPN A;  7ICN A;  8ICL A;  2ZJA A;  3C2K A;  3PO4 A;  3RAQ A;  3BJY A;  1Z00 B;  1ZQO A;  1ZQR A;  4PGQ A;  1JX4 A;  4DFP A;  3RH6 A;  2HHQ A;  1V4A A;  4NKT A;  4YMN A;  3EYZ A;  5BOM A;  4EZ9 A;  7ICO A;  4RUA A;  8ICA A;  2R8I A;  2ZHB A;  4DF4 A;  3EW9 A;  4DQI A;  4AT9 B;  5HHH A;  3PW4 A;  2VA8 A;  5EWG A;  8ICF A;  4YMM A;  4DSE A;  7ICK A;  4I2D A;  2NRZ A;  5KFQ A;  5KT7 A;  4KIT B;  1RXW A;  3RR7 A;  4F4X A;  5IIN A;  4YN4 A;  3H8S A;  4M9H A;  2HHV A;  1XWL A;  4CCH A;  4ELV A;  1PX5 A;  4ED6 A;  1UT5 A;  4FH5 A;  2J6U A;  3WFP A;  5KG6 A;  2FLP A;  4ECU A;  4YR3 A;  4O3N A;  4Q44 A;  7ICF A;  3AQK A;  4UB4 A;  2F1H A;  1U4B A;  3RH5 A;  3EPI A;  3THV A;  1TAU A;  4DOC A;  4KLM A;  2ZH1 A;  3ZD9 A;  2PXI A;  9ICB A;  2XC9 A;  2NRX A;  2MUT B;  1LB2 B;  4KLD A;  8ICM A;  2AQ0 A;  5F9L A;  3Q8M A;  2ISP A;  5DB6 A;  4F2S A;  2ZH5 A;  4DS5 A;  2DFL A;  4IRC A;  1MSW D;  3AQL A;  2BPG A;  1JIH A;  1TK0 A;  5D49 A;  4O3P A;  3TAN A;  1QSY A;  1ZJN A;  4ED2 A;  9ICX A;  5KG7 A;  2Q66 A;  4IG8 A;  3ISB A;  2BCU A;  5J0P A;  4EBC A;  4ECW A;  4ECV A;  1UT8 A;  2RDI A;  5KT6 A;  4BXO A;  4FBT A;  4UQG A;  1XSL A;  1NZP A;  5HRI A;  3GV8 B;  3OJU A;  4UBB A;  4WC2 A;  2DPI A;  4Z6E A;  8ICO A;  4JWN A;  2FLL A;  2KZM A;  1MC8 A;  2ZUB A;  2R8J A;  3H8W A;  4DSF A;  3OV7 A;  5L1I A;  3ISD A;  8ICU A;  4ECZ A;  1S76 D;  3T5K A;  4C8O A;  3JZ0 A;  1ZQK A;  1NK5 A;  4EYH B;  2XCA A;  4G3I A;  4J9L A;  1T4G A;  4R63 A;  2W9A A;  2ZUD A;  2ATL A;  2P6U A;  2IMW P;  1T7P A;  4QZH A;  2C2E A;  7ICL A;  3B0Y A;  4UD4 A;  1CUK A;  3HX0 A;  2FMP A;  2ZH6 A;  5DB7 A;  1NJX A;  3G6X A;  3G6V A;  1MQ2 A;  1QSL A;  5KFA A;  3RBE A;  4NLG A;  4Q8E A;  5HRF A;  3H39 A;  4QW8 A;  1ZJM A;  5HRB A;  4F5R A;  4YQW A;  3UPQ A;  2R8K A;  1KRP A;  4M9G A;  4O9M A;  1KNY A;  8ICP A;  5HRE A;  4ED7 A;  1SKR A;  2ZH3 A;  1R8A A;  1MIV A;  3PV8 A;  1RYR A;  5DG8 A;  5DB9 A;  3MDC A;  5CJ7 A;  3ORY A;  3C18 A;  2WTF A;  1U49 A;  3GIK A;  4DQS A;  1UA1 A;  4TUS A;  3RRG A;  4P4P A;  4IQT A;  2Y1J A;  3RB0 A;  3LK9 A;  1S77 D;  2ZTC A;  4J9P A;  3NYB A;  4WC4 A;  4WC5 A;  3OVA A;  4J9Q A;  8ICT A;  4FHP A;  4BWJ A;  5CB1 A;  4R66 A;  1HJP A;  1FA0 A;  3UQ2 A;  5KFL A;  9ICC A;  3PW2 A;  2C28 A;  5DG9 A;  5DQG A;  4QZB A;  5KFT A;  5J0U A;  1TFR A;  3RR8 A;  2ID1 A;  5DLG A;  2BCR A;  4KLI A;  5F2V O;  2W9C A;  4ECT A;  3MAB A;  4BDP A;  2V4Q A;  7ICH A;  4JV0 A;  1L3U A;  3MFI A;  2M2T A;  4LT6 A;  1BPD A;  1ZQU A;  4I2E A;  4UAZ A;  4RU9 A;  4YP3 A;  1ZQW A;  4EYI B;  1PZN A;  4DL7 A;  3T5H A;  4PH5 A;  4RQ1 A;  4M9J A;  1S9F A;  1ZQT A;  4X4O A;  3C2L A;  2HHW A;  4XRH A;  4YR2 A;  2FMS A;  9ICM A;  2M2V A;  2PFP A;  2FLN A;  1IM4 A;  1TV9 A;  1NO5 A;  5L1K A;  4Z6F A;  2ASJ A;  4F91 B;  4MF2 A;  5KFP A;  2AGO A;  2BDP A;  2UVV A;  3KTQ A;  5DB8 A;  4ATB A;  1ZQI A;  1ZQV A;  3C1Y A;  5KFX A;  2FPM A;  3G6Y A;  2AJQ A;  4M9N A;  3M8R A;  4KLU A;  5KFO A;  3AQM A;  1DK3 A;  2HHU A;  5J2I A;  1SZP A;  2FPK A;  3H4B A;  3PML A;  3V6K A;  2OWO A;  3KHG A;  1SL2 A;  5HRL A;  3JPP A;  4XA5 A;  4UAY A;  2BPF A;  2UVR A;  3FDS A;  4GLX A;  4UB3 A;  4ED3 A;  1NKC A;  3K75 D;  4B9U A;  4M6W A;  4TUP A;  2JZB A;  9ICR A;  3ZDE A;  9ICN A;  4P4M A;  4BXO B;  2XY6 A;  2HVI A;  3MFH A;  2FPL A;  4IQV A;  4DLE A;  2UVW A;  4YCX A;  4NM2 A;  4QZ9 A;  4KLQ A;  4BWM A;  4AT7 A;  3WFR E;  5HRK A;  1ZYQ A;  4O3S A;  8ICK A;  1DK2 A;  4PHP A;  3RJI A;  4DF8 A;  3C5F A;  4DWI A;  5KT2 A;  3BQ1 A;  8ICN A;  3H7I A;  4KN4 A;  4YMO A;  1ZQH A;  3LDA A;  4RUC A;  5DED A;  1ZQF A;  2ALZ A;  3C21 A;  2JEG A;  2ZH9 A;  5CR0 A;  4M5D A;  8ICJ A;  3UPS A;  4K4H A;  3BQ0 A;  1X9W A;  3PO5 A;  5DGA A;  2DR8 A;  5EWE A;  5HR9 A;  2PBE A;  4XQ7 A;  1L5U A;  5KT5 A;  4MEX A;  3V7K A;  1TAQ A;  3RRH A;  3PVX A;  9ICQ A;  3GQC A;  1ZQY A;  5C5J A;  1UET A;  4E0D A;  4YD1 A;  5DGB A;  1RYS A;  4IR1 A;  3Q8R B;  4DOA A;  3V6H A;  4RZR A;  5KFC A;  2XY5 A;  3TAR A;  2DPJ A;  4FHV A;  4LZD A;  5KG1 A;  2BQR A;  2BR0 A;  3C5G A;  4F8R A;  5IIJ A;  4M47 A;  1ARO P;  4DL6 A;  5J2K A;  5CWR A;  3SV4 A;  2DVI A;  8ICH A;  5KFW A;  1JXL A;  4QWB A;  4B9M A;  5HP4 A;  4O5K A;  4KLS A;  1DGS A;  3BQT A;  9ICG A;  3RB6 A;  4JUZ A;  4UD5 A;  1L3S A;  3K4G A;  5DKW A;  5HMM A;  3OHA A;  2ZUC A;  4DEZ A;  3GV5 B;  2H5X A;  1MIY A;  3C66 A;  4KLE A;  1ZQA A;  3TQ1 A;  4B9S A;  4DQQ A;  2AGP A;  4ECS A;  3OUY A;  1JXE A;  1Y88 A;  3V72 A;  4KLT A;  3HWT A;  1T3N A;  4F92 B;  4QWD A;  3H37 A;  1V9P A;  5KFZ A;  3MDA A;  4DSL A;  2W9M A;  3FYH A;  4FHY A;  3IM1 A;  3QZ7 A;  5J2H A;  1QSS A;  4QWA A;  4PHA A;  3N4M B;  2UVU A;  4QZD A;  4X4S A;  1H38 A;  4Z6C A;  4BGD A;  4UB5 A;  3V7J A;  8ICQ A;  4JWM A;  4RT2 A;  1UA0 A;  4KTQ A;  4DSK A;  5KFU A;  3JPS A;  3WFS C;  5HHI A;  1MQ3 A;  2JEJ A;  2IHM A;  5KFJ A;  2NRT A;  3AQN A;  1BPY A;  3PW0 A;  3UXN A;  4RQ6 A;  2O1P A;  3WFQ E;  4QZC A;  3RAX A;  5HRH A;  5L1L A;  2ZHA A;  4ATB B;  3RTV A;  1TVA A;  3T5J A;  4DFJ A;  5IIM A;  5KT4 A;  2ZH2 A;  4ECX A;  5J2F A;  4F4Z A;  1EXN A;  1A77 A;  1RPL A;  3NGD A;  1KSP A;  7ICP A;  1U45 A;  2ASL A;  1D8L A;  4JK1 A;  3ZDB A;  4B9V A;  4LVS A;  4R8U A;  4Q43 A;  3EPG A;  1ZQL A;  4DOB A;  9ICT A;  5KFV A;  4RT3 A;  3QEA Z;  4TUR A;  1D9D A;  2A1J B;  5KFK A;  4J9S A;  3RB3 A;  4KLJ A;  1JMS A;  5KTQ A;  4F50 A;  2JZB B;  1XSP A;  4RQ3 A;  1NJW A;  3M8S A;  4X4V A;  1U47 A;  4DLG A;  4I2I A;  4KMU A;  4R64 A;  4HYK A;  9ICF A;  4K4G A;  4XUS A;  3TAP A;  1KEJ A;  1WOT A;  2NRK A;  3JPR A;  2R8H A;  2ZH8 A;  4X4N A;  2C2D A;  4M2Y A;  3E2E A;  3OSP A;  4GXI A;  2Y1I A;  4NY8 A;  2V9W A;  4YVZ A;  2JEI A;  2PFQ A;  4YG2 A;  8ICZ A;  3KHL A;  4F4W A;  3RH4 A;  3WFO A;  1Z00 A;  1COO A;  5DQI A;  3M9O B;  4R65 A;  1TK8 A;  3OHB A;  3OGU A;  1C7Y A;  4I2G A;  4FBU A;  4RQ5 A;  2NRW A;  4KN7 A;  2XGP A;  4F3O A;  3H8J A;  1KFD A;  1U48 A;  2ZTD A;  4ELT A;  4AT9 A;  1F5A A;  5J0Q A;  1R8C A;  4TQR A;  2RFF A;  4RWQ A;  2BHN A;  5KFB A;  4UB1 A;  1U9L A;  4F5O A;  2RDJ A;  1XC9 A;  1UEU A;  4TQS A;  3LWM A;  4QWE A;  1X2I A;  2V4R A;  4QZ8 A;  1IXR A;  4C8N A;  4X4Q A;  3MBY A;  5J0O A; 
#chains in the Genus database with same CATH topology
 3OVB A;  2W9B A;  4FE3 A;  4FZM A;  2F1J A;  4DS4 A;  3KHH A;  2ODG A;  5KFD A;  4QWC A;  2KG5 A;  5KG5 A;  2XY7 A;  2JV3 A;  4DSJ A;  5J29 A;  2MAX A;  4QIW C;  4PGY A;  4J9K A;  1S0N A;  3DDH A;  1CRX A;  2JEF A;  5DQH A;  2MU2 A;  4GIB A;  2GOL A;  2M2W A;  4ECR A;  3GII A;  4TUQ A;  4F4Y A;  1ZQJ A;  3HW8 A;  4UB2 A;  2HOF A;  5CFS A;  2B4V A;  3TAD C;  3I1Y A;  4C8K A;  4B9N A;  2KK0 A;  4FO6 A;  4X4U A;  4RQ0 A;  1S10 A;  4IC9 A;  3GIM A;  2KSO A;  3CRX A;  3OVS A;  2H3V A;  1ZQE A;  5AKH A;  9ICL A;  4PL2 A;  2HBJ A;  1RQN A;  1FFU A;  2B21 A;  4I2J A;  4BX9 C;  2VKQ A;  2KV2 A;  4UAT A;  4B9T A;  5AHX A;  4P0P A;  3NRW A;  4OJO A;  7ICI A;  4FZN A;  2NRV A;  4E80 A;  4KLH A;  1ZRN A;  4ZOH C;  1TKD A;  4EP7 A;  4RQ4 A;  4JV1 A;  4QIW F;  1BPB A;  5D46 A;  3WK5 A;  1Z3E B;  3RJF A;  1ZQC A;  4J9R A;  4F5P A;  2EWR A;  4Y2V A;  1ZET A;  2VAN A;  3ISC A;  1VJ7 A;  4FHX A;  1Z19 A;  2G5I B;  3IHQ B;  4QW9 A;  3UMB A;  3Q8Q B;  4FZL A;  1HUZ A;  3EWA A;  2P66 A;  3D2Q A;  2Q4T A;  2QB1 A;  4J9M A;  4X0B A;  4I29 A;  4ED1 A;  3OSN A;  5EWF A;  3LVV A;  2QAR A;  4C7Y A;  4NLN A;  1F5S A;  3KOO A;  3NTU A;  3QZ8 A;  3TFS A;  4EX6 A;  4MFC A;  1KFS A;  4X5V A;  3T79 A;  4PPX A;  8ICB A;  3ERC C;  2C2R A;  3H8M A;  4X4R A;  1JQR A;  4DL3 A;  4ED8 A;  1X9X A;  2HHX A;  3ZD8 A;  5ALG A;  5IIL A;  1TFW A;  3HP6 A;  3BS7 A;  3OUY B;  1S0V A;  2HVH A;  2BCS A;  2OXO A;  3H3A A;  4K97 A;  4QZF A;  4RPY A;  2ZXI A;  2HHP A;  5AIA A;  4NXZ A;  5CP2 A;  3OWG A;  4F4K A;  1JN3 A;  4OAI Z;  2ZJ8 A;  1WCL A;  4A8E A;  5J2G A;  4M0A A;  3AU2 A;  1O03 A;  2F8K A;  3PY8 A;  2I1Q A;  3WK4 A;  3QNM A;  1NK9 A;  4C8L A;  5CRX A;  3H4D A;  4K98 A;  5J2J A;  1GO3 F;  2JXJ A;  4S3N A;  4QZA A;  4RPZ A;  3PMN A;  5KFE A;  4WC6 A;  1RDF A;  1NKE A;  3WK6 A;  1K1S A;  4NWI A;  5KL1 B;  1BVS A;  5EE3 A;  5DEC A;  1ZD2 P;  3GV7 B;  3IN5 A;  4ECY A;  3ZDD A;  1Q78 A;  5III A;  2KZZ A;  3QYP A;  7ICN A;  2FDR A;  3JPN A;  8ICL A;  2EAP A;  2XIC A;  2ZJA A;  3C2K A;  3RAQ A;  4PGQ A;  1JX4 A;  2ES6 A;  1V4A A;  3F2D A;  3EYZ A;  2W03 A;  1SV4 A;  4DF4 A;  4AT9 B;  3ICX A;  4KIT B;  1PX5 A;  4CCH A;  3SR6 A;  3KZX A;  2GO7 A;  1UT5 A;  2FLP A;  4ECU A;  2LYA A;  4UB4 A;  3QU5 A;  4DOC A;  2ZH1 A;  2XC9 A;  1WYG A;  1LB2 B;  2AQ0 A;  5F9L A;  4IRC A;  5AI8 A;  2IOF A;  1IG6 A;  1JIH A;  1QQ7 A;  4O3P A;  1QSY A;  2Q66 A;  1JRO A;  3ISB A;  2DWQ A;  4EBC A;  5KT6 A;  4UQG A;  3GV8 B;  3OJU A;  4UBB A;  2KKV A;  3B9J A;  3D6J A;  2ZIW A;  4DSF A;  2NV3 A;  1OUQ A;  3JZ0 A;  3WKA A;  2XCA A;  4HAI A;  2W9A A;  2ZUD A;  2P6U A;  1CUK A;  2FMP A;  5DB7 A;  2F2A B;  3G6V A;  1MQ2 A;  4Q8E A;  3H39 A;  4LEW A;  2DUY A;  1PUZ A;  2LI6 A;  1SKR A;  2ZH3 A;  2NYV A;  1WWV A;  1R8A A;  3MDC A;  1VLB A;  3ORY A;  4DQS A;  1UA1 A;  4P4P A;  2Y1J A;  2IUB A;  4USA A;  1X42 A;  1J2M A;  1L8L A;  5L1M A;  4FHP A;  4NJ8 A;  4R66 A;  1FA0 A;  3UQ2 A;  3F2B A;  5DG9 A;  5DQG A;  4QZB A;  3TKA A;  2ID1 A;  5DLG A;  2BCR A;  2KNJ A;  5A0L A;  4O68 A;  2M2T A;  2W11 A;  1ZQU A;  3SMV A;  4I2E A;  2D3D A;  4RU9 A;  4UAZ A;  1ZQW A;  1PZN A;  2ZIV B;  4X4O A;  1OXJ A;  2M2V A;  4RQM A;  2PFP A;  1IM4 A;  1TV9 A;  2ASJ A;  5KFP A;  3C1Y A;  3G6Y A;  3M1Y A;  5KFO A;  5J2I A;  1SL2 A;  3MC1 A;  3JPP A;  4UB3 A;  4M6W A;  1MA7 A;  2ZXH A;  4BXO B;  2UVW A;  5JU5 A;  4QZ9 A;  1T94 A;  2QKQ A;  1ZYQ A;  4O3S A;  8ICK A;  3C5F A;  3BQ1 A;  5B3Q A;  3LDA A;  2WB1 C;  3KBB A;  3PO5 A;  5EWE A;  5HR9 A;  2PBE A;  4XQ7 A;  5AM4 A;  5KT5 A;  3V7K A;  3LYS A;  3RRH A;  5C5J A;  4IL6 U;  1RYS A;  2XY5 A;  3TAR A;  1PK1 B;  4FHV A;  2W3R A;  2PKE A;  2DVI A;  4DL6 A;  1VJ5 A;  2HMX A;  4QWB A;  4Y2Y A;  4K96 A;  3VCB A;  5EE1 A;  3K4G A;  5DKW A;  4M5D A;  2ZUC A;  4OO1 J;  1ZQA A;  1DXS A;  1LKY B;  1KN5 A;  4P0Q B;  3JCF A;  1T3N A;  2F8L A;  4F92 B;  4DSL A;  3KFU F;  4CF5 A;  3QZ7 A;  1RM6 C;  4QWA A;  4UB5 A;  2F3N A;  4RT2 A;  1UA0 A;  5AM3 A;  4KTQ A;  5AK3 A;  5KFU A;  5HHI A;  1MQ3 A;  2IHM A;  5KFJ A;  1BPY A;  1SV0 C;  3FAH A;  2O1P A;  3SEI A;  4JB3 A;  5HRH A;  2ZHA A;  4ATB B;  3RTV A;  3T5J A;  2G5H B;  4ECX A;  5J2F A;  1EXN A;  1A77 A;  3NGD A;  1KKX A;  1U45 A;  2H3I A;  4JK1 A;  3QU9 A;  1ZQL A;  3MGV A;  4DOB A;  5KFV A;  3QEA Z;  3S6J A;  2EZY A;  4KLJ A;  5KTQ A;  4F50 A;  2JZB B;  1XSP A;  5ALZ A;  4KMU A;  3KZI U;  4K4G A;  2NRK A;  1LVH A;  3OSP A;  2V9W A;  2JEI A;  1Z00 A;  1COO A;  3M9O B;  3OGU A;  1L6N A;  2NRW A;  4LEV A;  1R8C A;  4TQR A;  2RFF A;  2GLE A;  4F5O A;  4TQS A;  4QWE A;  1L7N A;  5ALI A;  4P2H A;  4RQ8 A;  2W7P A;  3QEB Z;  5AI6 A;  4RQ7 A;  4I28 A;  2IBK A;  3AM9 A;  2IA6 A;  9ICW A;  3T5L A;  1P7D A;  3GFK B;  4RQ2 A;  3HJ1 A;  5KFR A;  1NK7 A;  2P6R A;  3MR6 A;  1ZQZ A;  2F76 X;  4UB6 U;  2E8M A;  5J0T A;  3T3F A;  2RQ5 A;  1A76 A;  8ICX A;  5J0X A;  2M0N A;  2XI9 A;  1L7O A;  2JR5 A;  5B3P A;  4RNN A;  2XID A;  2PI4 A;  3C23 A;  3HIL A;  9ICE A;  3ED5 A;  4K4I A;  3BDP A;  2BKE A;  4WBZ A;  1BPZ A;  4Y2R A;  3UXO A;  3NRZ A;  3QU7 A;  3LQC B;  4O69 A;  4C4T A;  3F5E A;  3C1Z A;  3RJE A;  2WF6 A;  3IDW A;  3GDX A;  3SAG A;  3LWL A;  4PHE A;  1L3V A;  5CA7 A;  1X9M A;  4DCC A;  7ICV A;  4NLC A;  5KT3 A;  4ECQ A;  2ISO A;  2CRX A;  4MFF A;  1BPX A;  1NK6 A;  2M9N A;  3PX6 A;  8ICW A;  5BOL A;  3UXP A;  1L3T A;  4J03 A;  5AKI A;  4IQW A;  5AIC A;  5J2C A;  3MR2 A;  4WBY A;  5HRG A;  4M04 A;  2GAF D;  4XQ8 A;  2R18 A;  3BQ7 A;  5AKJ A;  4MHV A;  4KM5 A;  1YLQ A;  3RJJ A;  4PHD A;  4F93 B;  2W9C B;  4XJE A;  3PSI A;  3B0X A;  3V7L A;  4I2A A;  5JRT A;  9ICJ A;  2W55 A;  1ZQN A;  2DRB A;  1YZ6 A;  4AT8 A;  3AUO A;  2DGZ A;  2W9B B;  4OJL A;  5IIK A;  2XCP A;  8ICS A;  1C20 A;  1Z1V A;  1S0M A;  3AU6 A;  9ICO A;  1NJZ A;  3BQ2 A;  4KLG A;  4DL2 A;  3MCR A;  2M2U A;  4CF3 A;  4WC1 A;  4IQU A;  4I2H A;  2EZZ A;  2LBO A;  4C4R A;  3JPQ A;  4UAW A;  4YFK A;  4Z6D A;  5KL8 B;  1XU4 A;  4X4P A;  3PX0 A;  7ICR A;  4DFK A;  1RXV A;  4CRX A;  4O3R A;  8ICY A;  4AT7 B;  3M6K A;  2J6S A;  9ICP A;  3GIJ A;  5BPC A;  1JAJ A;  5HNK A;  9ICI A;  3PW5 A;  1TAM A;  2HW3 A;  4E8F A;  4FS2 A;  2PI5 A;  2KSO B;  1SKW A;  4OJ5 A;  2KFN A;  2DRA A;  1HUO A;  5J0W A;  5TZV A;  1BGX T;  2H3F A;  4B9L A;  4KLO A;  7ICG A;  3PST A;  5ALW A;  5AM0 A;  1RG6 A;  3N28 A;  1BNO A;  1ZRM A;  2Y0S C;  4AYB C;  1LV5 A;  4G9B A;  4EEY A;  4IR9 A;  3M6Z A;  3L5K A;  2ZIU A;  4YXM A;  4EBD A;  2IHO A;  5HRD A;  3EF2 A;  3ETL A;  4P0P B;  5DG7 A;  3WKC A;  3IP4 B;  3H40 A;  5AK4 A;  4PZN A;  5D4B A;  2EZX A;  4O3Q A;  3NWI A;  2AQ4 A;  4WCW A;  4RWP A;  4LEZ A;  3IRU A;  2KHQ A;  2B51 A;  5KFY A;  1GPJ A;  5ALD A;  1ZQD A;  1NKB A;  1XNS A;  2EH9 A;  2ZJ5 A;  2ZTE A;  1ZD4 A;  3VC8 A;  2P35 A;  2A1J A;  9ICK A;  1X9S A;  2I9G A;  2VA2 A;  3BZK A;  4I2F A;  5KFM A;  2FCL A;  5J2B A;  3RBD A;  3UQ0 A;  1OW5 A;  5L9X A;  2FE9 A;  5HML A;  4M9L A;  2KZ3 A;  1KDH A;  3M7D A;  3PO4 A;  1FEZ A;  2RHF A;  3NVY A;  3KKA C;  3NAS A;  2HHQ A;  4DFP A;  3RH6 A;  4NKT A;  4EZ9 A;  1A0P A;  3EW9 A;  1QCK A;  5EWG A;  4YMM A;  7ICK A;  5KT7 A;  5IIN A;  3H8S A;  2JMG A;  4FH5 A;  1N5W A;  4C7Z A;  7ICF A;  3AQK A;  1N63 A;  5KAF U;  2Y0S F;  4AYB F;  3ZD9 A;  4KLM A;  9ICB A;  2HCF A;  5DB6 A;  2CPR A;  4UAR A;  2DFL A;  3AQL A;  3AL0 B;  5D49 A;  5E79 U;  9ICX A;  3F5A A;  1ZJN A;  1O08 A;  5J0P A;  4ECW A;  2BCU A;  4ECV A;  2RLT A;  4WC2 A;  1PVR A;  4JWN A;  2FLL A;  1A6S A;  2KZM A;  2R8J A;  2ZUB A;  3ISD A;  8ICU A;  4ECZ A;  4K99 A;  4C8O A;  1ZQK A;  1UPH A;  1J2N A;  3O0F A;  4QZH A;  1T7P A;  7ICL A;  1SGG A;  2ZH6 A;  2O6K A;  3RBE A;  4QW8 A;  1JRP A;  3UPQ A;  1KRP A;  5ALV A;  4ED7 A;  1MIV A;  4NL9 A;  1RYR A;  5DG8 A;  5DB9 A;  5CJ7 A;  5D61 A;  3GIK A;  3E0F A;  3LK9 A;  4WC4 A;  2ZTC A;  4J9Q A;  8ICT A;  5F3X B;  1HJP A;  5KFL A;  5J0U A;  3RR8 A;  3QU2 A;  4NXX A;  3MAB A;  2V4Q A;  2OCE A;  1BPD A;  1NNL A;  1XO0 A;  4YP3 A;  4DL7 A;  3T5H A;  4M9J A;  2HHW A;  4XRH A;  4YR2 A;  3AMZ A;  2FMS A;  2FLN A;  1V38 A;  2BDP A;  2UVV A;  3KTQ A;  5AKL A;  2FPM A;  1UHU A;  5AI9 A;  4M9N A;  3WKB A;  5ALY A;  2EDU A;  3WK8 A;  1DK3 A;  2HHU A;  2FPK A;  3V6K A;  5HRL A;  1D8B A;  2UVR A;  4K8V A;  4GLX A;  4ED3 A;  3K75 D;  4B9U A;  4N7R A;  5CFT A;  2G07 A;  2XY6 A;  3MFH A;  1N60 A;  2A3V A;  4DLE A;  2LPE A;  4PHP A;  3RJI A;  2OH2 A;  4DWI A;  1IV8 A;  3NVW A;  2E8O A;  3PSF A;  1ZQF A;  3C21 A;  4K4H A;  5DGA A;  1L5U A;  4MEX A;  1TAQ A;  3GQC A;  3ETR A;  4YD1 A;  1NI3 A;  4RZR A;  1B4F A;  2KIV A;  5CEH A;  2DPJ A;  2BQR A;  2BR0 A;  2OHF A;  3C5G A;  1ARO P;  5CWR A;  3SV4 A;  5ALL A;  9ICG A;  2WAQ C;  4UD5 A;  5ALQ A;  3AQE A;  3OHA A;  5HMM A;  1MIY A;  2W54 A;  3HKZ C;  4KLE A;  3TQ1 A;  4B9S A;  1FFV A;  2AGP A;  2PMZ C;  4ECS A;  3OUY A;  1JXE A;  1Y88 A;  3H37 A;  3WU2 U;  1FIQ A;  2HBK A;  3SAF A;  4EED A;  1QSS A;  2IOF K;  4X4S A;  5ALS A;  4ACO A;  4BGD A;  2DKZ A;  8ICQ A;  4EX7 A;  3JPS A;  2Y9T A;  5T14 A;  3RAX A;  5L1L A;  2ZH2 A;  5AM1 A;  5KT4 A;  2ASL A;  4WH5 A;  1D8L A;  3ZDB A;  4LVS A;  4R8U A;  5AKK A;  5KFK A;  3RB3 A;  1JMS A;  4RQ3 A;  3M8S A;  4FO1 A;  2F77 X;  3KD3 A;  4DLG A;  9ICF A;  4HYK A;  2WHE A;  4CNQ A;  1KEJ A;  3JPR A;  4X4N A;  4WOY A;  2C2D A;  4M2Y A;  2Y1I A;  2HBL A;  2PFQ A;  4YG2 A;  3RH4 A;  1SIJ A;  1L7M A;  5DQI A;  3OHB A;  1C7Y A;  3ER8 C;  2XGP A;  4ELT A;  4AT9 A;  2XVT A;  5AI5 A;  1F5A A;  4UB1 A;  4US9 A;  1XC9 A;  1UEU A;  3LWM A;  1X2I A;  4C8N A;  5J0O A;  1N2X A;  4C0Z A;  5DBA A;  4LZG A;  1SWW A;  2E3T A;  2PMZ F;  1B22 A;  1XO1 A;  4JLX A;  5ALM A;  3MR3 A;  1B0X A;  4NKU A;  3C28 A;  4IRK A;  2GWS A;  8ICV A;  2NO4 A;  3TFR A;  1Q46 A;  3SYZ A;  4I2B A;  4QZE A;  3E58 A;  3CNH A;  3JPT A;  2E8P A;  2LM4 A;  5J2D A;  4I0U A;  3CW2 C;  3NS1 A;  2DR5 A;  4CGZ A;  1Z1B A;  3PR4 A;  3C66 A;  1XSN A;  4JV2 A;  2L5Y A;  1ZQP A;  3ZDC A;  2W7O A;  3CK6 A;  2W43 A;  3SZ2 A;  2K60 A;  5J0S A;  1R8B A;  3RFA A;  1L7P A;  2RRD A;  5KFS A;  2H3Z A;  4YR0 A;  1ZQG A;  2WF8 A;  2AHO B;  3M9N B;  4X4T A;  4CDG A;  2G09 A;  2E8N A;  1R89 A;  3HRD D;  5IIO A;  4KLF A;  3R9K A;  4J9N A;  3ONN A;  2LM1 A;  2VJ5 A;  3TAQ A;  4I2C A;  4FS1 A;  1F0M A;  4AP9 A;  7ICJ A;  4E7X A;  2W8K A;  5G5H A;  2WFA A;  5J0R A;  1HEK A;  3GIL A;  2K4H A;  4GC6 A;  1RQL A;  4QZI A;  1N61 A;  3NVZ A;  2YMM A;  2KN7 A;  2BQU A;  2W8L A;  3AQF A;  4Y2U A;  1WCN A;  4EBJ A;  4DQP A;  1AQ6 A;  1SL1 A;  4MEY A;  1D9F A;  3RJH A;  3MGH A;  4O0I A;  2AH5 A;  3BZC A;  3Q8S B;  3WK9 A;  2ASD A;  3I76 A;  4NXW A;  1SL0 A;  4NLZ A;  2MA1 A;  4FHW A;  2BQ3 A;  5GTH U;  2WB1 F;  4B6J A;  2BCQ A;  5AKZ A;  1QH9 A;  4DSI A;  1QLN A;  4WQL A;  2K4I A;  1X40 A;  5J0Y A;  1UEV A;  4PJ0 U;  4MF8 A;  4F2R A;  2G08 A;  1NK8 A;  5HR6 A;  3D2N A;  1ZQS A;  1PK3 A;  2GH1 A;  2N1R A;  4RQN A;  4F5N A;  3JPO A;  1ZOL A;  4HX0 A;  3C2M A;  7ICE A;  5L1J A;  1LKY A;  3DV9 A;  2MUT A;  1JI7 A;  2LYH A;  3MGI A;  2PFO A;  4Q45 A;  1N56 A;  2E1E A;  3RJG A;  4RPX A;  2XGQ A;  1S8O A;  3A0B U;  3OJS A;  2YN4 A;  5ALH A;  5DDY A;  1KLN A;  1S0O A;  5G5G A;  4U7C A;  3NVV A;  3H38 A;  4DQR A;  2YB4 A;  7ICQ A;  4AT8 B;  2HOQ A;  4UBC A;  4C80 A;  4ED0 A;  1CI4 A;  5KG0 A;  4UAS A;  3V6J A;  1UQV A;  1KQQ A;  9ICU A;  5B66 U;  3IV6 A;  2DR9 A;  2Q0Z X;  5CHG A;  5KFG A;  2HBM A;  2HN2 A;  2QB0 A;  3PR5 B;  5HC9 A;  2YY6 A;  4ICA A;  4NXT A;  2KVC A;  2WF9 A;  4QJF B;  2HHS A;  2KFZ A;  1RYU A;  3Q8L A;  1N62 A;  5ALN A;  4NM1 A;  2VJ4 A;  2ZIX A;  3Q8P B;  4U6P A;  5J8Y A;  1ZQO A;  1ZQR A;  4YMN A;  5BOM A;  4RUA A;  8ICA A;  2ZHB A;  2DF4 B;  5HHH A;  4PL1 A;  3PW4 A;  2KJ9 A;  1PVQ A;  4I2D A;  2NRZ A;  3OVA A;  4M9H A;  1XWL A;  5AM5 A;  4ELV A;  3BS5 A;  4ED6 A;  1KL9 A;  5AI0 A;  3WFP A;  2KOB A;  4O3N A;  3TAC B;  1V85 A;  2F44 A;  3EPI A;  1DRG A;  5ALP A;  4KLD A;  8ICM A;  1SXE A;  3Q8M A;  2ISP A;  4F2S A;  2ZH5 A;  4CE6 A;  4DS5 A;  3TAN A;  4ED2 A;  2ZIU B;  4IG8 A;  1HIW A;  3QUB A;  1UT8 A;  2RDI A;  5HRI A;  1NZP A;  2KEY A;  3F2C A;  1XSL A;  2DPI A;  4Z6E A;  8ICO A;  5CFU A;  1MC8 A;  3H8W A;  3OV7 A;  5L1I A;  1NK5 A;  4J9L A;  4R63 A;  2KJ5 A;  2C2E A;  3B0Y A;  4UD4 A;  3HX0 A;  2OM6 A;  1NJX A;  1QSL A;  4NLG A;  2YB1 A;  5HRB A;  4F5R A;  4YQW A;  4NL9 C;  4M9G A;  4O9M A;  1WG8 A;  3PV8 A;  1UCV A;  1YZ7 A;  4TUS A;  3RRG A;  1S77 D;  3H0M B;  3NYB A;  4J9P A;  5ALE A;  4WC5 A;  5CB1 A;  9ICC A;  3PW2 A;  5KFT A;  5AKG A;  2G06 A;  2K8A A;  2HI0 A;  5F2V O;  5AM2 A;  2W9C A;  7ICH A;  1L3U A;  3MFI A;  4EYI B;  3IG8 A;  3QUQ A;  2CN1 A;  1S9F A;  3C2L A;  1ED1 A;  5L1K A;  4Z6F A;  2AGO A;  3LVW A;  5DB8 A;  2MSN A;  1ZQV A;  2AJQ A;  3M8R A;  4KLU A;  7ICS A;  2OWO A;  4UAY A;  5AI4 A;  2WF7 A;  3U26 A;  3ER9 B;  4TUP A;  9ICR A;  3ZDE A;  1F44 A;  4NM2 A;  4KLQ A;  4BWM A;  4AT7 A;  1X6I A;  1SXD A;  5HRK A;  1JUD A;  4DF8 A;  8ICN A;  3H7I A;  1Q3V A;  1ZQH A;  4RUC A;  3WK7 A;  2ALZ A;  3PHZ A;  2ZH9 A;  1SWV A;  2YX8 A;  5CR0 A;  8ICJ A;  3UPS A;  3BQ0 A;  1X9W A;  1M6Y A;  2JHD A;  2Y9U A;  2QAR B;  2G0A A;  3EUB 2;  2K89 A;  5DGB A;  4EEN A;  4DOA A;  3V6H A;  5KFC A;  3NVO A;  4LZD A;  4F8R A;  4KMO B;  4M47 A;  4WJ3 B;  1WUD A;  2BDU A;  4KLS A;  3BQT A;  3H0L B;  3RB6 A;  1L3S A;  2H5X A;  4UW9 A;  3CP8 A;  3V72 A;  3HWT A;  4QWD A;  3H0R B;  4FHY A;  3IM1 A;  5ALF A;  4PHA A;  4LEY A;  2UVU A;  1IIP A;  4K9A A;  1YT3 A;  3IG5 A;  4DSK A;  2K8B B;  3AQN A;  3PW0 A;  2DQN B;  3WFQ E;  2B0C A;  4QZC A;  1KSP A;  2KD1 A;  3FC4 A;  4Q43 A;  9ICT A;  4RT3 A;  3SQI A;  5D62 A;  1NJW A;  4X4V A;  1N5X A;  4R64 A;  4OD0 A;  3E2E A;  4GXI A;  4IS7 A;  4YVZ A;  8ICZ A;  3KHL A;  4F4W A;  3WFO A;  3OTQ A;  4O3M A;  4R65 A;  5AK5 A;  2BBH A;  4FBU A;  3RF9 A;  4RQ5 A;  4JLZ A;  1SZH A;  4KN7 A;  5KNI A;  3N7P D;  2BZF A;  1KFD A;  1U48 A;  2ZTD A;  2K4P A;  5KFB A;  2QLT A;  2RDJ A;  2V4R A;  4QZ8 A;  3SAH A;  2D8C A;  4WC3 A;  4X4Q A;  5AKE A;  3MBY A;  4PZO A;  5EE9 A;  5KFH A;  2A1A A;  4WC7 A;  4Y2X A;  4O5E A;  8ICC A;  3PNC A;  4RNM A;  1BNP A;  5F9N A;  2KMD A;  1QQ6 A;  1NK4 A;  4MKP A;  1TE2 A;  2EQY A;  3EZ5 A;  2J6T A;  4OJP A;  4Q8F A;  1FO4 A;  4RNO A;  5AKX A;  2BE3 A;  4OJ6 A;  5KG2 A;  4NXV A;  2HSZ A;  4F5Q A;  2ESE A;  2KTQ A;  3KHR A;  4P4O A;  5DBC A;  3RB4 A;  2ZIW B;  4ELU A;  1MN8 A;  3AEV A;  8ICG A;  1ZQM A;  3RJK A;  4GC7 A;  3HIY A;  2BPC A;  1OU5 A;  1QQ5 A;  2A19 A;  3Q8K A;  2ZH7 A;  5C0Y A;  3NKU A;  3AN1 A;  4GXJ A;  1KTQ A;  4O5C A;  5KG3 A;  1NOM A;  4R8U B;  2DR7 A;  3TAD A;  1XS9 D;  2VA3 A;  5AKY A;  4CF4 A;  4QZG A;  2XO7 A;  2DL0 A;  1Q8K A;  3L9D A;  5KFI A;  2C22 A;  1VDV A;  4PGX A;  2E5S A;  2LKY A;  2W04 A;  4NXU A;  3N7R C;  3PZP A;  2OEH A;  4EEB A;  5EOZ A;  4BUG A;  4US8 A;  3MR5 A;  1NK0 A;  3KKA A;  3UMG A;  3HPO A;  9ICH A;  1T8E A;  4IRD A;  3ZI4 A;  2KE7 A;  4DFM A;  1JAL A;  7ICT A;  3HT3 A;  1TFY A;  2K4E A;  1S97 A;  4EV6 A;  1TK5 A;  4YD2 A;  3GU3 A;  1DOQ A;  3NUQ A;  4WQK A;  1KBU A;  2BGW A;  4WC0 A;  3M9M B;  1K1Q A;  2HHT A;  8ICR A;  9ICA A;  4RWO A;  1KFT A;  5JTG A;  4OAF A;  5CHE A;  2FI1 A;  4X0A A;  1B43 A;  4ZH4 A;  1Q79 A;  3PW7 A;  4EBK A;  3WKE A;  2BBJ A;  1N48 A;  1CEZ A;  3HJE A;  9ICS A;  5DDM A;  4M6W B;  1RZT A;  4RWN A;  4DL5 A;  2H3Q A;  2AU0 A;  1QTM A;  2RP5 A;  1COK A;  5AIB A;  1BPE A;  5KFN A;  4GXK A;  4LJX A;  2NO5 A;  2GA9 D;  4KX5 A;  5J2E A;  3HJ4 A;  5DBB A;  8ICI A;  5B5E U;  3PX4 A;  2KKP A;  5KAI U;  2KP7 A;  5H2F U;  7ICM A;  1SKS A;  4KLL A;  2O5A A;  2WAQ F;  1NJY A;  8ICE A;  5KFF A;  3F53 A;  3HKZ F;  3SV3 A;  2AGQ A;  4YXJ A;  1T3Q A;  1WWU A;  3TI0 A;  4EEK A;  2B6G A;  1X66 A;  3N97 B;  4O67 A;  3L3F X;  4F72 A;  3QE9 Y;  4O3O A;  3JYY A;  4KX3 A;  1MIW A;  3CYM A;  4I27 A;  7ICU A;  2ZH4 A;  2HOI A;  2R8G A;  3UM9 A;  1ZQX A;  4DL4 A;  4J9O A;  1D8Y A;  3ZDA A;  2F1I A;  3SEN A;  4C8M A;  4MFA A;  4FH3 A;  2K8C B;  5ALK A;  3QX7 A;  4EZ6 A;  4NLK A;  3FM9 A;  5J2A A;  3K1Z A;  4BJQ A;  4DFD A;  4DO9 A;  2D6F C;  4Y2J A;  3PSP A;  2FJ6 A;  3SI8 A;  1X6J A;  5DLF A;  3OPX A;  2KIW A;  5JUM A;  2PFN A;  4UB8 U;  2LHT A;  2HDO A;  5KG4 A;  2BCV A;  9ICV A;  4Y2S A;  2KVS A;  1ZQQ A;  1ZQB A;  2WF5 A;  2JGA A;  4EBE A;  5J8Y C;  2IHN A;  1VFG A;  2FMQ A;  2OYY A;  3QXG A;  3ALR A;  3BJY A;  5ALU A;  1Z00 B;  2JH1 A;  4NV0 A;  7ICO A;  2R8I A;  1Q3U A;  4DQI A;  8ICF A;  2VA8 A;  3QU4 A;  4DSE A;  1RXW A;  5KFQ A;  3RR7 A;  2AXT U;  4F4X A;  4YN4 A;  2HHV A;  5FP0 A;  2ZIV A;  3C29 A;  2J6U A;  5KG6 A;  4YR3 A;  4Q44 A;  2F1H A;  1U4B A;  3RH5 A;  3QUC A;  3THV A;  1TAU A;  2PXI A;  2NRX A;  2MUT B;  3N7S C;  1K5O A;  4EGW A;  1MSW D;  2BPG A;  1TK0 A;  5KG7 A;  1Z4O A;  4EEL A;  2EAO A;  4FBT A;  4BXO A;  2YML A;  3L4P A;  1S76 D;  3T5K A;  3K7D A;  4EYH B;  4G3I A;  2Z7J A;  1T4G A;  1PVP A;  2ATL A;  2IMW P;  4Y2P A;  4NLB A;  2I6X A;  2HN1 A;  2YTU A;  3G6X A;  5HRF A;  5KFA A;  5K4L A;  2B56 A;  1ZJM A;  2R8K A;  5ALJ A;  2QB0 B;  1KNY A;  1PK1 A;  8ICP A;  5ALX A;  5HRE A;  1URJ A;  2E1F A;  4OCZ A;  1SB3 C;  3C18 A;  2WTF A;  1ZD5 A;  1U49 A;  4Y2Q A;  4IQT A;  3RB0 A;  3WKD A;  4OAG A;  2ZIX B;  4BWJ A;  4C4S A;  2C28 A;  4P0Q A;  1TFR A;  4KLI A;  4ECT A;  2KIC A;  4BDP A;  3DEE A;  2DBY A;  4JV0 A;  3QUT A;  4LT6 A;  1Z4N A;  5D63 A;  5ALT A;  3BS5 B;  4PH5 A;  4RQ1 A;  1ZQT A;  2MRL A;  9ICM A;  1NO5 A;  5HR7 A;  4F91 B;  4MF2 A;  3K1R B;  4ATB A;  1ZQI A;  4Y2T A;  5KFX A;  1L8O A;  1J97 A;  1ZQ1 C;  3AQM A;  5EE0 A;  5AK6 A;  2EAM A;  1SZP A;  3H4B A;  3PML A;  4O6A A;  3KHG A;  2I5H A;  4XA5 A;  2BPF A;  2LYB A;  3FDS A;  1NKC A;  3SD7 A;  2JZB A;  9ICN A;  4P4M A;  2HVI A;  2FPL A;  4UAU A;  4IQV A;  1DGJ A;  4YCX A;  5GTI U;  2EAN A;  3WFR E;  1DK2 A;  5KT2 A;  4KN4 A;  4YMO A;  4GFJ A;  5DED A;  2JEG A;  4KB6 A;  2DR8 A;  3PVX A;  9ICQ A;  1ZQY A;  1ZXI A;  4E0D A;  5ALO A;  1UET A;  4IR1 A;  3Q8R B;  5KG1 A;  3J81 j;  5IIJ A;  5J2K A;  8ICH A;  4UAV A;  5KFW A;  1JXL A;  4B9M A;  5HP4 A;  4O5K A;  3D2S A;  1DGS A;  4JUZ A;  3GV5 B;  4DEZ A;  2JH7 A;  4OAH A;  4K9B A;  4DQQ A;  2CXY A;  2VIX A;  2ZG6 A;  4KLT A;  2YQE A;  4JMU A;  1V9P A;  5KFZ A;  3MDA A;  2W9M A;  3FYH A;  5ALR A;  5J2H A;  3N4M B;  1S5L U;  4QZD A;  1H38 A;  4Z6C A;  2KJ8 A;  3V7J A;  4JWM A;  2DKX A;  2IOH A;  3WFS C;  2JEJ A;  2NRT A;  3UXN A;  2YMQ A;  4RQ6 A;  1ZD3 A;  1TVA A;  1SV0 A;  4DFJ A;  5IIM A;  2KHV A;  3I28 A;  4F4Z A;  1RPL A;  3A0H U;  7ICP A;  4B9V A;  3UMC A;  3EPG A;  1D9D A;  4TUR A;  2A1J B;  4J9S A;  4F71 A;  2W3S A;  3GZF A;  1U47 A;  4I2I A;  4XUS A;  3TAP A;  2JRZ A;  1WOT A;  2R8H A;  5JTI A;  2ZH8 A;  4FFD A;  2LMR A;  4NY8 A;  1TK8 A;  4I2G A;  5TIS U;  1NZB A;  1V97 A;  4F3O A;  3H8J A;  5J0Q A;  2BHN A;  1U9L A;  1KW4 A;  4QNL A;  2YMP A;  1ECW A;  1IXR A;  4RWQ A; 
#chains in the Genus database with same CATH homology
 5DBA A;  4LZG A;  5KFH A;  4P2H A;  4WC7 A;  3OVB A;  4RQ8 A;  2W9B A;  4O5E A;  8ICC A;  3QEB Z;  2F1J A;  3PNC A;  4RNM A;  4RQ7 A;  1XO1 A;  4DS4 A;  4I28 A;  1B22 A;  1BNP A;  5F9N A;  3MR3 A;  1NK4 A;  2IBK A;  2IA6 A;  9ICW A;  3T5L A;  3KHH A;  3EZ5 A;  2J6T A;  4NKU A;  4Q8F A;  5KFD A;  4QWC A;  3GFK B;  5KG5 A;  4IRK A;  4RQ2 A;  4RNO A;  3HJ1 A;  5KFR A;  2XY7 A;  1NK7 A;  2P6R A;  2GWS A;  8ICV A;  2BE3 A;  3MR6 A;  4DSJ A;  1ZQZ A;  5KG2 A;  5J29 A;  2MAX A;  4PGY A;  4J9K A;  3TFR A;  1S0N A;  5J0T A;  3SYZ A;  3T3F A;  4I2B A;  4QZE A;  1A76 A;  3JPT A;  4F5Q A;  8ICX A;  5J0X A;  2KTQ A;  2JEF A;  5DQH A;  5J2D A;  3KHR A;  4P4O A;  5DBC A;  3RB4 A;  4ELU A;  4RNN A;  2DR5 A;  2PI4 A;  8ICG A;  3C23 A;  1ZQM A;  3RJK A;  4GC7 A;  3HIY A;  3PR4 A;  2BPC A;  1XSN A;  4JV2 A;  2M2W A;  4ECR A;  9ICE A;  3GII A;  1OU5 A;  1ZQP A;  4TUQ A;  3ZDC A;  4K4I A;  4F4Y A;  1ZQJ A;  3HW8 A;  3BDP A;  2BKE A;  3Q8K A;  4WBZ A;  4UB2 A;  2ZH7 A;  1BPZ A;  4GXJ A;  1KTQ A;  4O5C A;  5KG3 A;  3SZ2 A;  5J0S A;  4C8K A;  4B9N A;  1NOM A;  4R8U B;  3UXO A;  1R8B A;  2DR7 A;  1XS9 D;  4FO6 A;  2VA3 A;  3LQC B;  5KFS A;  4YR0 A;  1ZQG A;  4QZG A;  4X4U A;  2XO7 A;  3C1Z A;  3RJE A;  4RQ0 A;  3L9D A;  5KFI A;  3GDX A;  2C22 A;  3M9N B;  4X4T A;  4PGX A;  3LWL A;  1S10 A;  4PHE A;  3GIM A;  1L3V A;  5CA7 A;  1X9M A;  3OVS A;  7ICV A;  5KT3 A;  1ZQE A;  4ECQ A;  1VFG A;  2ISO A;  1R89 A;  9ICL A;  4MFF A;  1BPX A;  1NK6 A;  2M9N A;  3PX6 A;  5IIO A;  8ICW A;  5BOL A;  3UXP A;  1L3T A;  4KLF A;  4J9N A;  4IQW A;  5J2C A;  5EOZ A;  3MR2 A;  4WBY A;  5HRG A;  4M04 A;  3TAQ A;  4XQ8 A;  4I2C A;  3MR5 A;  2B21 A;  1NK0 A;  4I2J A;  3HPO A;  9ICH A;  1T8E A;  4FS1 A;  4IRD A;  1YLQ A;  3RJJ A;  7ICJ A;  4PHD A;  4F93 B;  2W9C B;  2W8K A;  4DFM A;  7ICT A;  4E7X A;  3B0X A;  3V7L A;  4B9T A;  3HT3 A;  1TFY A;  1S97 A;  4I2A A;  9ICJ A;  1ZQN A;  5J0R A;  1TK5 A;  4YD2 A;  2DRB A;  1DOQ A;  2BGW A;  7ICI A;  3GIL A;  4AT8 A;  3AUO A;  4WC0 A;  2W9B B;  2NRV A;  3M9M B;  4E80 A;  5IIK A;  1K1Q A;  2XCP A;  4GC6 A;  4KLH A;  2HHT A;  9ICA A;  8ICR A;  8ICS A;  4RWO A;  1S0M A;  4QZI A;  3AU6 A;  1TKD A;  1NJZ A;  9ICO A;  1KFT A;  4EP7 A;  4RQ4 A;  3BQ2 A;  2KN7 A;  4X0A A;  1B43 A;  2W8L A;  2BQU A;  4JV1 A;  4KLG A;  4DL2 A;  4ZH4 A;  2M2U A;  1BPB A;  1WCN A;  4EBJ A;  1Q79 A;  3PW7 A;  4DQP A;  4EBK A;  4WC1 A;  5D46 A;  4IQU A;  1SL1 A;  1N48 A;  1CEZ A;  4MEY A;  1D9F A;  3RJH A;  3MGH A;  4O0I A;  4I2H A;  1Z3E B;  3Q8S B;  3RJF A;  5DDM A;  9ICS A;  1ZQC A;  4M6W B;  3JPQ A;  4J9R A;  2ASD A;  4F5P A;  4DL5 A;  1RZT A;  4UAW A;  4RWN A;  4YFK A;  1ZET A;  4Z6D A;  2AU0 A;  1QTM A;  2VAN A;  1XU4 A;  3PX0 A;  7ICR A;  4DFK A;  3ISC A;  1RXV A;  1SL0 A;  1VJ7 A;  4FHX A;  4X4P A;  4O3R A;  4NLZ A;  8ICY A;  3IHQ B;  1BPE A;  5KFN A;  4QW9 A;  4AT7 B;  4FHW A;  2BQ3 A;  4GXK A;  3Q8Q B;  1HUZ A;  3EWA A;  2J6S A;  2P66 A;  9ICP A;  3GIJ A;  5J2E A;  2BCQ A;  4X0B A;  4J9M A;  4I29 A;  4ED1 A;  5BPC A;  4DSI A;  1QLN A;  3OSN A;  1JAJ A;  3HJ4 A;  5DBB A;  5EWF A;  8ICI A;  5HNK A;  3PX4 A;  5J0Y A;  9ICI A;  3PW5 A;  4NLN A;  1UEV A;  2KP7 A;  4MF8 A;  4F2R A;  3NTU A;  3QZ8 A;  3TFS A;  2HW3 A;  7ICM A;  4E8F A;  1NK8 A;  1SKS A;  4MFC A;  1KFS A;  4FS2 A;  4KLL A;  2O5A A;  4X5V A;  1ZQS A;  2PI5 A;  4PPX A;  8ICB A;  1NJY A;  2C2R A;  8ICE A;  5KFF A;  1SKW A;  4X4R A;  1JQR A;  4DL3 A;  2KFN A;  4ED8 A;  4F5N A;  2DRA A;  2HHX A;  3ZD8 A;  1HUO A;  3JPO A;  3SV3 A;  2AGQ A;  4YXJ A;  3TI0 A;  5J0W A;  5TZV A;  1BGX T;  4B9L A;  5IIL A;  3C2M A;  4KLO A;  7ICG A;  5L1J A;  7ICE A;  3HP6 A;  3N97 B;  1TFW A;  3QE9 Y;  2MUT A;  3JYY A;  4O3O A;  1MIW A;  3OUY B;  2LYH A;  3MGI A;  2PFO A;  4I27 A;  1S0V A;  2HVH A;  7ICU A;  1BNO A;  2BCS A;  1LV5 A;  2R8G A;  4EEY A;  2ZH4 A;  4IR9 A;  4Q45 A;  3H3A A;  1N56 A;  4QZF A;  4RPY A;  4YXM A;  4EBD A;  3RJG A;  4RPX A;  1ZQX A;  5HRD A;  4NXZ A;  2XGQ A;  2HHP A;  4DL4 A;  4J9O A;  3ETL A;  5CP2 A;  1D8Y A;  3ZDA A;  2F1I A;  5DG7 A;  3OJS A;  3H40 A;  5DDY A;  4F4K A;  1JN3 A;  4C8M A;  2ZJ8 A;  1S0O A;  1KLN A;  5D4B A;  4MFA A;  1WCL A;  4O3Q A;  5J2G A;  4FH3 A;  4M0A A;  3H38 A;  2AQ4 A;  4DQR A;  4WCW A;  3AU2 A;  7ICQ A;  4AT8 B;  4RWP A;  3PY8 A;  2I1Q A;  4UBC A;  1NK9 A;  5KFY A;  5J2A A;  4DO9 A;  4C8L A;  4ED0 A;  4EZ6 A;  4NLK A;  5KG0 A;  1ZQD A;  3H4D A;  1NKB A;  2ZJ5 A;  3SI8 A;  3V6J A;  5DLF A;  2ZTE A;  5J2J A;  9ICU A;  4S3N A;  2DR9 A;  5JUM A;  2A1J A;  2Q0Z X;  4QZA A;  4RPZ A;  5CHG A;  2PFN A;  5KFG A;  3PMN A;  9ICK A;  5KFE A;  4WC6 A;  1X9S A;  2I9G A;  3PR5 B;  2VA2 A;  5HC9 A;  1NKE A;  5KG4 A;  1K1S A;  2BCV A;  4I2F A;  2HHS A;  9ICV A;  5KFM A;  1BVS A;  2KFZ A;  5J2B A;  3RBD A;  5DEC A;  3GV7 B;  1ZQQ A;  3Q8L A;  1ZQB A;  7ICS A;  3UQ0 A;  4ECY A;  4WC3 A;  4EBE A;  4NM1 A;  5L9X A;  3Q8P B;  3ZDD A;  1Q78 A;  5HML A;  5III A;  2IHN A;  2KZ3 A;  4M9L A;  1KDH A;  2FMQ A;  2KZZ A;  3JPN A;  7ICN A;  8ICL A;  2ZJA A;  3C2K A;  3PO4 A;  3RAQ A;  3BJY A;  1Z00 B;  1ZQO A;  1ZQR A;  4PGQ A;  1JX4 A;  4DFP A;  3RH6 A;  2HHQ A;  1V4A A;  4NKT A;  4YMN A;  3EYZ A;  5BOM A;  4EZ9 A;  7ICO A;  4RUA A;  8ICA A;  2R8I A;  2ZHB A;  4DF4 A;  3EW9 A;  4DQI A;  4AT9 B;  5HHH A;  3PW4 A;  2VA8 A;  5EWG A;  8ICF A;  4YMM A;  4DSE A;  7ICK A;  4I2D A;  2NRZ A;  5KFQ A;  5KT7 A;  4KIT B;  1RXW A;  3RR7 A;  4F4X A;  5IIN A;  4YN4 A;  3H8S A;  4M9H A;  2HHV A;  1XWL A;  4CCH A;  4ELV A;  1PX5 A;  4ED6 A;  1UT5 A;  4FH5 A;  2J6U A;  3WFP A;  5KG6 A;  2FLP A;  4ECU A;  4YR3 A;  4O3N A;  4Q44 A;  7ICF A;  3AQK A;  4UB4 A;  2F1H A;  1U4B A;  3RH5 A;  3EPI A;  3THV A;  1TAU A;  4DOC A;  4KLM A;  2ZH1 A;  3ZD9 A;  2PXI A;  9ICB A;  2XC9 A;  2NRX A;  2MUT B;  1LB2 B;  4KLD A;  8ICM A;  2AQ0 A;  5F9L A;  3Q8M A;  2ISP A;  5DB6 A;  4F2S A;  2ZH5 A;  4DS5 A;  2DFL A;  4IRC A;  1MSW D;  3AQL A;  2BPG A;  1JIH A;  1TK0 A;  5D49 A;  4O3P A;  3TAN A;  1QSY A;  1ZJN A;  4ED2 A;  9ICX A;  5KG7 A;  2Q66 A;  4IG8 A;  3ISB A;  2BCU A;  5J0P A;  4EBC A;  4ECW A;  4ECV A;  1UT8 A;  2RDI A;  5KT6 A;  4BXO A;  4FBT A;  4UQG A;  1XSL A;  1NZP A;  5HRI A;  3GV8 B;  3OJU A;  4UBB A;  4WC2 A;  2DPI A;  4Z6E A;  8ICO A;  4JWN A;  2FLL A;  2KZM A;  1MC8 A;  2ZUB A;  2R8J A;  3H8W A;  4DSF A;  3OV7 A;  5L1I A;  3ISD A;  8ICU A;  4ECZ A;  1S76 D;  3T5K A;  4C8O A;  3JZ0 A;  1ZQK A;  1NK5 A;  4EYH B;  2XCA A;  4G3I A;  4J9L A;  1T4G A;  4R63 A;  2W9A A;  2ZUD A;  2ATL A;  2P6U A;  2IMW P;  1T7P A;  4QZH A;  2C2E A;  7ICL A;  3B0Y A;  4UD4 A;  1CUK A;  3HX0 A;  2FMP A;  2ZH6 A;  5DB7 A;  1NJX A;  3G6X A;  3G6V A;  1MQ2 A;  1QSL A;  5KFA A;  3RBE A;  4NLG A;  4Q8E A;  5HRF A;  3H39 A;  4QW8 A;  1ZJM A;  5HRB A;  4F5R A;  4YQW A;  3UPQ A;  2R8K A;  1KRP A;  4M9G A;  4O9M A;  1KNY A;  8ICP A;  5HRE A;  4ED7 A;  1SKR A;  2ZH3 A;  1R8A A;  1MIV A;  3PV8 A;  1RYR A;  5DG8 A;  5DB9 A;  3MDC A;  5CJ7 A;  3ORY A;  3C18 A;  2WTF A;  1U49 A;  3GIK A;  4DQS A;  1UA1 A;  4TUS A;  3RRG A;  4P4P A;  4IQT A;  2Y1J A;  3RB0 A;  3LK9 A;  1S77 D;  2ZTC A;  4J9P A;  3NYB A;  4WC4 A;  4WC5 A;  3OVA A;  4J9Q A;  8ICT A;  4FHP A;  4BWJ A;  5CB1 A;  4R66 A;  1HJP A;  1FA0 A;  3UQ2 A;  5KFL A;  9ICC A;  3PW2 A;  2C28 A;  5DG9 A;  5DQG A;  4QZB A;  5KFT A;  5J0U A;  1TFR A;  3RR8 A;  2ID1 A;  5DLG A;  2BCR A;  4KLI A;  5F2V O;  2W9C A;  4ECT A;  3MAB A;  4BDP A;  2V4Q A;  7ICH A;  4JV0 A;  1L3U A;  3MFI A;  2M2T A;  4LT6 A;  1BPD A;  1ZQU A;  4I2E A;  4UAZ A;  4RU9 A;  4YP3 A;  1ZQW A;  4EYI B;  1PZN A;  4DL7 A;  3T5H A;  4PH5 A;  4RQ1 A;  4M9J A;  1S9F A;  1ZQT A;  4X4O A;  3C2L A;  2HHW A;  4XRH A;  4YR2 A;  2FMS A;  9ICM A;  2M2V A;  2PFP A;  2FLN A;  1IM4 A;  1TV9 A;  1NO5 A;  5L1K A;  4Z6F A;  2ASJ A;  4F91 B;  4MF2 A;  5KFP A;  2AGO A;  2BDP A;  2UVV A;  3KTQ A;  5DB8 A;  4ATB A;  1ZQI A;  1ZQV A;  3C1Y A;  5KFX A;  2FPM A;  3G6Y A;  2AJQ A;  4M9N A;  3M8R A;  4KLU A;  5KFO A;  3AQM A;  1DK3 A;  2HHU A;  5J2I A;  1SZP A;  2FPK A;  3H4B A;  3PML A;  3V6K A;  2OWO A;  3KHG A;  1SL2 A;  5HRL A;  3JPP A;  4XA5 A;  4UAY A;  2BPF A;  2UVR A;  3FDS A;  4GLX A;  4UB3 A;  4ED3 A;  1NKC A;  3K75 D;  4B9U A;  4M6W A;  4TUP A;  2JZB A;  9ICR A;  3ZDE A;  9ICN A;  4P4M A;  4BXO B;  2XY6 A;  2HVI A;  3MFH A;  2FPL A;  4IQV A;  4DLE A;  2UVW A;  4YCX A;  4NM2 A;  4QZ9 A;  4KLQ A;  4BWM A;  4AT7 A;  3WFR E;  5HRK A;  1ZYQ A;  4O3S A;  8ICK A;  1DK2 A;  4PHP A;  3RJI A;  4DF8 A;  3C5F A;  4DWI A;  5KT2 A;  3BQ1 A;  8ICN A;  3H7I A;  4KN4 A;  4YMO A;  1ZQH A;  3LDA A;  4RUC A;  5DED A;  1ZQF A;  2ALZ A;  3C21 A;  2JEG A;  2ZH9 A;  5CR0 A;  4M5D A;  8ICJ A;  3UPS A;  4K4H A;  3BQ0 A;  1X9W A;  3PO5 A;  5DGA A;  2DR8 A;  5EWE A;  5HR9 A;  2PBE A;  4XQ7 A;  1L5U A;  5KT5 A;  4MEX A;  3V7K A;  1TAQ A;  3RRH A;  3PVX A;  9ICQ A;  3GQC A;  1ZQY A;  5C5J A;  1UET A;  4E0D A;  4YD1 A;  5DGB A;  1RYS A;  4IR1 A;  3Q8R B;  4DOA A;  3V6H A;  4RZR A;  5KFC A;  2XY5 A;  3TAR A;  2DPJ A;  4FHV A;  4LZD A;  5KG1 A;  2BQR A;  2BR0 A;  3C5G A;  4F8R A;  5IIJ A;  4M47 A;  1ARO P;  4DL6 A;  5J2K A;  5CWR A;  3SV4 A;  2DVI A;  8ICH A;  5KFW A;  1JXL A;  4QWB A;  4B9M A;  5HP4 A;  4O5K A;  4KLS A;  1DGS A;  3BQT A;  9ICG A;  3RB6 A;  4JUZ A;  4UD5 A;  1L3S A;  3K4G A;  5DKW A;  5HMM A;  3OHA A;  2ZUC A;  4DEZ A;  3GV5 B;  2H5X A;  1MIY A;  3C66 A;  4KLE A;  1ZQA A;  3TQ1 A;  4B9S A;  4DQQ A;  2AGP A;  4ECS A;  3OUY A;  1JXE A;  1Y88 A;  3V72 A;  4KLT A;  3HWT A;  1T3N A;  4F92 B;  4QWD A;  3H37 A;  1V9P A;  5KFZ A;  3MDA A;  4DSL A;  2W9M A;  3FYH A;  4FHY A;  3IM1 A;  3QZ7 A;  5J2H A;  1QSS A;  4QWA A;  4PHA A;  3N4M B;  2UVU A;  4QZD A;  4X4S A;  1H38 A;  4Z6C A;  4BGD A;  4UB5 A;  3V7J A;  8ICQ A;  4JWM A;  4RT2 A;  1UA0 A;  4KTQ A;  4DSK A;  5KFU A;  3JPS A;  3WFS C;  5HHI A;  1MQ3 A;  2JEJ A;  2IHM A;  5KFJ A;  2NRT A;  3AQN A;  1BPY A;  3PW0 A;  3UXN A;  4RQ6 A;  2O1P A;  3WFQ E;  4QZC A;  3RAX A;  5HRH A;  5L1L A;  2ZHA A;  4ATB B;  3RTV A;  1TVA A;  3T5J A;  4DFJ A;  5IIM A;  5KT4 A;  2ZH2 A;  4ECX A;  5J2F A;  4F4Z A;  1EXN A;  1A77 A;  1RPL A;  3NGD A;  1KSP A;  7ICP A;  1U45 A;  2ASL A;  1D8L A;  4JK1 A;  3ZDB A;  4B9V A;  4LVS A;  4R8U A;  4Q43 A;  3EPG A;  1ZQL A;  4DOB A;  9ICT A;  5KFV A;  4RT3 A;  3QEA Z;  4TUR A;  1D9D A;  2A1J B;  5KFK A;  4J9S A;  3RB3 A;  4KLJ A;  1JMS A;  5KTQ A;  4F50 A;  2JZB B;  1XSP A;  4RQ3 A;  1NJW A;  3M8S A;  4X4V A;  1U47 A;  4DLG A;  4I2I A;  4KMU A;  4R64 A;  4HYK A;  9ICF A;  4K4G A;  4XUS A;  3TAP A;  1KEJ A;  1WOT A;  2NRK A;  3JPR A;  2R8H A;  2ZH8 A;  4X4N A;  2C2D A;  4M2Y A;  3E2E A;  3OSP A;  4GXI A;  2Y1I A;  4NY8 A;  2V9W A;  4YVZ A;  2JEI A;  2PFQ A;  4YG2 A;  8ICZ A;  3KHL A;  4F4W A;  3RH4 A;  3WFO A;  1Z00 A;  1COO A;  5DQI A;  3M9O B;  4R65 A;  1TK8 A;  3OHB A;  3OGU A;  1C7Y A;  4I2G A;  4FBU A;  4RQ5 A;  2NRW A;  4KN7 A;  2XGP A;  4F3O A;  3H8J A;  1KFD A;  1U48 A;  2ZTD A;  4ELT A;  4AT9 A;  1F5A A;  5J0Q A;  1R8C A;  4TQR A;  2RFF A;  4RWQ A;  2BHN A;  5KFB A;  4UB1 A;  1U9L A;  4F5O A;  2RDJ A;  1XC9 A;  1UEU A;  4TQS A;  3LWM A;  4QWE A;  1X2I A;  2V4R A;  4QZ8 A;  1IXR A;  4C8N A;  4X4Q A;  3MBY A;  5J0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...