5DBAA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a dt
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 114
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbaA03
3V72A 2NRKA 3V6KA 1ZQVA 5KFOA 5J0TA 5J2JA 1DGSA 1XWLA 9ICRA 5D49A 3T5LA 4UBCA 1NK5A 2FLNA 4UAWA 1TV9A 8ICPA 2F1IA 2DPIA 1N56A 2HHXA 2JEGA 2R8KA 3RH4A 1UA1A 5KG4A 2ASDA 4M5DA 4P4PA 4FHWA 1XSPA 4NXZA 3V7JA 1JAJA 5F2VO 5DG8A 3WFPA 4YR3A 2ASJA 7ICQA 1ZQXA 2ZUCA 4O5KA 3OVBA 2NRTA 1MSWD 4ECZA 1TFRA 3G6YA 1MIWA 4DSLA 4F4KA 1A76A 8ICVA 4F5NA 4R66A 4KLFA 5J2KA 4FHVA 3M8RA 4TQRA 3EZ5A 3EPIA 3V7LA 3ZD9A 4ECUA 4QZIA 4ELUA 4E8FA 4F5PA 5HHHA 2BPFA 4DL7A 4BXOB 3RJIA 2HVHA 4FBUA 4X4SA 4DLEA 4WCWA 9ICLA 1UETA 3GDXA 1LB2B 9ICAA 3RJGA 2AGOA 1S0NA 5KFFA 5HRHA 5HHIA 5KFNA 3BJYA 4GC7A 4KLUA 8ICOA 4UQGA 4Z6EA 1B22A 1KRPA 4IQVA 3FDSA 1YLQA 4XQ8A 2FMQA 4F4WA 3OSNA 1D9FA 4I2IA 4BGDA 9ICHA 4RQ6A 5J0RA 4F50A 4F3OA 4B9VA 3SV3A 2XY7A 2XO7A 5D4BA 1X9SA 4ELVA 1ZJMA 2HHVA 4YMOA 1SL2A 7ICUA 8ICJA 3C1ZA 4O9MA 8ICUA 5DQIA 3TANA 4DS4A 4B9UA 4F8RA 2ASLA 4QZEA 2BDPA 4JV2A 1FA0A 3AQNA 4RU9A 2JEJA 4ED3A 3ZDCA 1TKDA 8ICWA 2ZTCA 1ZQJA 1S77D 4RUAA 4BDPA 3C23A 8ICBA 1ZQKA 2A1JA 3GV5B 2Q66A 4R63A 4M9LA 1UT5A 1NJWA 2OWOA 3OHAA 3UQ0A 4RWNA 1CUKA 5KFRA 4RQ8A 4UAYA 3KHLA 1RPLA 2C2RA 1ZQBA 4C8LA 1NKBA 1HJPA 7ICJA 3LK9A 4Q44A 7ICOA 3JZ0A 5KG2A 4G3IA 2ZH8A 4B9NA 5KT7A 3MR6A 3EPGA 3ZDEA 1MIVA 2ZH3A 3JPRA 3OVAA 5DQHA 2DRAA 4YN4A 3HP6A 4ECYA 2FPMA 2UVWA 2NRWA 3HIYA 5J2EA 3K75D 4O3PA 5CWRA 8ICTA 1C7YA 1WOTA 4RWOA 5KFDA 1ZQWA 4I29A 2ISPA 3PR5B 4NM2A 1PZNA 8ICMA 3LDAA 1JIHA 3RB6A 3HT3A 3Q8SB 1X9MA 5C5JA 3SYZA 4BXOA 4NY8A 2IBKA 5CP2A 4DS5A 4Z6CA 9ICNA 7ICSA 3AQMA 4B9SA 2ZH6A 4X4VA 3RJEA 4S3NA 4UB2A 2ZTEA 2IA6A 4F2SA 3PMNA 4FS2A 2C28A 1BPYA 4EZ9A 1DK2A 4IG8A 4MEXA 4O5CA 2C22A 2AJQA 7ICHA 1U47A 2W8KA 1HUZA 5IIKA 7ICEA 1ZQZA 4Z6DA 1ZQMA 4DSKA 3PX4A 4EBJA 1L3VA 1KEJA 2NRXA 5J2CA 4K4GA 4QZGA 4RT3A 4DLGA 2BQRA 4TUQA 2M2TA 4J9SA 3HX0A 5F9NA 2MAXA 3UQ2A 4ED0A 5HRGA 4EBKA 5KFPA 1LV5A 4Q8FA 2KZZA 5CA7A 1NKCA 4M9JA 5KG7A 4RPXA 4PH5A 4PHDA 5DGAA 1T3NA 2V4QA 7ICVA 1Q78A 2NRZA 4ECVA 3PR4A 9ICFA 4AT7A 4DF4A 1VJ7A 5J2IA 4PHEA 5HRFA 5L1KA 3V6HA 1KDHA 5HC9A 2KZ3A 1NK4A 5KFTA 3ISDA 2R8JA 4IRKA 4DOBA 5DBAA 4F2RA 1EXNA 1BGXT 4M9GA 5KFCA 4DQPA 5JUMA 3BQTA 2M2WA 1NK9A 4KLLA 4DFJA 5KFLA 2DR9A 2ZH1A 2XCAA 3M9NB 2W9MA 4YG2A 4F5OA 3QE9Y 4ECSA 9ICOA 2DFLA 4UD5A 4XA5A 4PHAA 3GV8B 4KN4A 5DG7A 1RZTA 1IM4A 1OU5A 2ZH5A 5HRBA 2R8HA 4KMUA 4UAZA 4M04A 1XU4A 5KFHA 4KTQA 1UEUA 1B43A 5DBBA 4FHXA 3MDAA 2PI4A 1U45A 8ICXA 1AROP 2FPLA 4KLEA 5J0XA 3C2KA 3EW9A 5J2GA 3Q8KA 4BWMA 3OV7A 2P66A 4QZCA 3RBDA 4RQ7A 3M9MB 4NM1A 4PPXA 2IHNA 1BNPA 4MFCA 3HPOA 4LT6A 3MR2A 2RFFA 5KG5A 4O3OA 4MF8A 4JK1A 4QWDA 4Z6FA 4F4YA 4F4XA 2VANA 3T3FA 5DB8A 2F1HA 4RPZA 3RBEA 5KFEA 1N48A 3PV8A 1Q79A 4X0AA 4X5VA 5DLGA 5DGBA 2ALZA 5HP4A 3MFIA 1RXVA 4J9NA 8ICHA 3THVA 4P4MA 4JV0A 4MF2A 4KLHA 2ZUDA 3RJKA 4ECXA 2BCSA 4YXMA 5EWGA 1U9LA 4GXJA 5CJ7A 3GFKB 3NYBA 4EP7A 3C1YA 3BDPA 3T5HA 3WFRE 2AQ0A 4I28A 3GQCA 2DVIA 2XGPA 4DWIA 2RDJA 4ECRA 1ZQPA 2ZUBA 4KLMA 5J0WA 3TFSA 2ZH2A 3ZDAA 3ZDBA 5HRKA 1ZQEA 3BQ1A 5KT2A 3OGUA 1ZQDA 3C5FA 1NJYA 5IIIA 2ZH9A 4YQWA 4ATBB 1S0MA 4YFKA 4KLGA 3EYZA 5KFGA 3OUYB 5HRDA 1ZQRA 1Z3EB 3MDCA 4I2BA 4KLQA 4E80A 4GLXA 1D9DA 4UB4A 3OJUA 5KFKA 4RQ1A 4DF8A 2C2EA 3N97B 2RDIA 3AU2A 8ICKA 5J0YA 4J9MA 4ED2A 3PW7A 1MQ3A 3RJFA 2FPKA 1TK0A 4LVSA 4NKTA 4X0BA 4NLGA 2PXIA 4J9LA 4F5QA 5EWEA 1JN3A 1NOMA 4R64A 1IXRA 5J2BA 5HNKA 3H8SA 3LWLA 3WFQE 2KFNA 7ICNA 4PGQA 9ICGA 1RYRA 2BQUA 2JZBB 4GXIA 2P6RA 3TAPA 2MUTB 1ZQYA 4QZBA 1KLNA 3RR7A 2V4RA 4AT7B 2ZJ8A 3PVXA 3RB3A 4X4RA 2BCUA 4KLIA 2J6SA 3RJHA 2KP7A 1R8AA 1XSNA 4C8NA 2ZH7A 4O5EA 2BQ3A 1ZQUA 4EYIB 4KLJA 2HW3A 3C5GA 1F5AA 1TFYA 4DQRA 1BPEA 5HMMA 3UXNA 1TFWA 5CR0A 5DB7A 4LZGA 7ICKA 5KG6A 4FH3A 2XCPA 3RRHA 7ICRA 3G6XA 3RAXA 1ZQCA 4QZAA 3H40A 4GC6A 1NK7A 5KFMA 3M9OB 1KFDA 4IQTA 1H38A 4TQSA 4DFPA 7ICTA 3KHGA 2XGQA 4B9TA 4AT8B 4YR2A 9ICCA 1RYSA 2JEFA 3OHBA 2HHSA 4DSIA 4WC4A 2AGPA 1ZQTA 4GXKA 2WTFA 3PW0A 3C66A 2W9AA 4WC2A 2Y1JA 2I1QA 4ATBA 4DO9A 4QWEA 2M2UA 4X4NA 4UB1A 5L1LA 1WCLA 3V6JA 1KFTA 7ICLA 3RB0A 3GIMA 3OUYA 4Q45A 4R65A 3QZ8A 8ICAA 3JPTA 1TK8A 1NO5A 2PI5A 4M9NA 8ICCA 1JXLA 3ISCA 9ICVA 4YCXA 2JEIA 2HHPA 2IHMA 3SI8A 4JWMA 5D46A 4WBYA 2LYHA 4DL4A 1BPZA 4RQ0A 2P6UA 3JPPA 2BGWA 1QSYA 1S0VA 8ICNA 3H7IA 3C2MA 3RRGA 1JQRA 1KNYA 3LQCB 2KN7A 4BWJA 7ICGA 2DR7A 2BCVA 1BPDA 4ECQA 4QZ8A 3OJSA 1SKSA 3KTQA 2JZBA 2ID1A 4QW9A 3SV4A 4IRCA 3MABA 3KHHA 4J9KA 1L5UA 1Y88A 2MUTA 4DSJA 1S0OA 1BPXA 4IQWA 1X2IA 4UD4A 1TK5A 2B21A 5J0UA 4EYHB 3HJ1A 2XY5A 5KFVA 4DOCA 4FHYA 4KLTA 1NZPA 3GIIA 2BCRA 2FLPA 3BQ2A 2ISOA 1ZQHA 4IR1A 3N4MB 4WC6A 1SKRA 4QWBA 8ICFA 3ISBA 4RQ3A 4F92B 2W9CB 3V7KA 2UVRA 3Q8QB 3ORYA 2BE3A 2BPGA 4F5RA 4YVZA 1MC8A 5BOMA 1UT8A 1Z00B 4RQ2A 2HHUA 4AT8A 1NK6A 3MGIA 4WC0A 3AQLA 5HMLA 3MR5A 3TAQA 2KZMA 4YR0A 4FHPA 5KG0A 1ZQGA 2M9NA 2GWSA 3PO4A 4M0AA 4QWAA 2J6UA 4MFAA 9ICWA 4ECTA 5KT3A 4TUSA 4JWNA 2ATLA 4X4UA 3RTVA 2FMSA 3ZD8A 1R8CA 9ICIA 8ICLA 4NKUA 1ZYQA 2PFQA 4I2CA 1XC9A 5L1IA 4C8OA 1QLNA 1K1QA 4FH5A 7ICMA 1ZQSA 8ICEA 3IM1A 3UXPA 4PHPA 3RJJA 4YP3A 4R8UB 4I2AA 4PGXA 1TAUA 9ICJA 4EEYA 5J2HA 1ZQNA 2ZJAA 2PFOA 8ICIA 1R8BA 4X4QA 5KTQA 4ED6A 5IINA 2J6TA 2BCQA 4JUZA 5J29A 4MEYA 1TAQA 3K4GA 4WC1A 1RXWA 2FMPA 4E0DA 2HVIA 4O3SA 1K1SA 1T8EA 1ZQOA 5DEDA 4K4IA 1BPBA 4QWCA 4JV1A 8ICQA 4F93B 1A77A 1T4GA 4M6WA 4I2FA 5KFBA 3PX6A 2BKEA 4XUSA 5L1JA 4B9MA 4O3NA 3JPQA 2F1JA 4J9QA 9ICXA 1S97A 9ICUA 1HUOA 8ICYA 7ICFA 3JPOA 1KTQA 4F91B 2AGQA 3NTUA 3T5KA 1XSLA 1NJXA 3RR8A 3C2LA 3QEAZ 2ZHBA 4DFKA 2BHNA 4PGYA 5DDMA 2W9CA 3TI0A 5HRIA 3AQKA 2HHWA 4KLDA 3GIKA 5DECA 3JPNA 1XS9D 1COOA 1Z00A 5KFUA 4DQIA 2IMWP 3L9DA 3BQ0A 2R8IA 1ZQQA 1UA0A 3PW2A 4P2HA 3UPSA 3E2EA 5KFAA 5HR9A 3UPQA 5KFXA 2HHQA 1ZETA 5DB6A 1NJZA 2VA3A 4I2DA 3Q8RB 4E7XA 3FYHA 4I27A 4RT2A 4FO6A 4RWQA 5EWFA 2PBEA 9ICPA 1JXEA 3H4BA 2O5AA 4DOAA 4RUCA 3RH5A 2ZTDA 3EWAA 5F9LA 4X4TA 3H39A 4EBCA 2KFZA 4YXJA 5DB9A 4UBBA 4RPYA 4RNMA 4FBTA 4XQ7A 5IIOA 2UVVA 2HHTA 3QZ7A 5TZVA 4QZFA 4Q43A 4RZRA 1MQ2A 3Q8MA 4I2GA 4R8UA 3H38A 4YMNA 8ICRA 3PY8A 3AU6A 1U49A 3MFHA 4QZHA 4WC5A 3HJ4A 2Y1IA 1ZQIA 1U4BA 2DR5A 3PMLA 2ZH4A 4RQ5A 4ED8A 5DG9A 3TFRA 4M9HA 1KSPA 4C8KA 4DQSA 2AU0A 5KT4A 5KFZA 4QZ9A 3MGHA 5CB1A 3GV7B 4AT9B 1QTMA 2XC9A 3TARA 5J0OA 2I9GA 9ICSA 3Q8PB 4ED7A 3QEBZ 3RAQA 4IR9A 3C18A 3OVSA 3MR3A 4DL2A 2VA2A 5IILA 1TVAA 1X9WA 1NKEA 4DQQA 2BPCA 2W9BB 1SL0A 4UB5A 4M2YA 3IHQB 1V4AA 1S10A 9ICQA 4XRHA 4K4HA 4I2EA 5HREA 1PX5A 5KFWA 5J0SA 2PFNA 1UEVA 4KITB 3GIJA 4O0IA 4J9RA 1U48A 4I2HA 1DK3A 4DSFA 3LWMA 2NRVA 3Q8LA 4NLKA 2Q0ZX 2R8GA 9ICKA 4RNOA 3H37A 4X4PA 3B0XA 4C8MA 2ZJ5A 5KFYA 4J9PA 4TURA 4KLSA 2XY6A 1KFSA 2DRBA 4I2JA 3PW5A 4NLNA 3B0YA 4WC7A 3RB4A 1D8LA 1JMSA 4EBDA 5DDYA 4B9LA 4EZ6A 2KTQA 4P4OA 5DQGA 1SKWA 4O3QA 8ICGA 4YD1A 4TUPA 1NK8A 2FLLA 3JYYA 4X4OA 3G6VA 5KFSA 4LZDA 4DSEA 4M6WB 4RNNA 4ECWA 3PNCA 1SL1A 3H8JA 5KG1A 1XO1A 3T5JA 3H3AA 2M2VA 4YD2A 1WCNA 4QW8A 4YMMA 4QZDA 3KHRA 3JPSA 1QSSA 9ICMA 7ICPA 5BOLA 4ZH4A 2BR0A 8ICZA 3WFOA 1NK0A 4KLOA 3WFSC 5KFQA 3SZ2A 1T7PA 5CHGA 3UXOA 4ELTA 4DL3A 5KG3A 5KT5A 4WC3A 2PFPA 3H8WA 5DLFA 4NLZA 4O3RA 1DOQA 5KT6A 3H4DA 2C2DA 5J0QA 1MIYA 4RQ4A 4DL6A 5J0PA 3AUOA 7ICIA 1JX4A 1R89A 2ZHAA 4WBZA 4AT9A 4IQUA 2DR8A 2VA8A 3NGDA 3PO5A 2W8LA 8ICSA 1CEZA 5HRLA 4HYKA 2AQ4A 3C21A 1VFGA 4IRDA 5L9XA 3RH6A 1L3TA 5J2DA 3ZDDA 3ETLA 1V9PA 3TQ1A 1S76D 1BVSA 1ZJNA 1L3UA 2DPJA 4DEZA 4FS1A 4DFMA 2W9BA 4EBEA 4DL5A 2UVUA 3GILA 1ZQFA 2O1PA 9ICBA 1QSLA 1L3SA 2H5XA 3OSPA 5J2FA 9ICTA 4MFFA 4KN7A 5KFIA 4ED1A 9ICEA 4RWPA 5IIJA 3HW8A 3PX0A 4J9OA 4F4ZA 4Q8EA 2V9WA 3HWTA 1ZQAA 5J2AA 1BNOA 3PW4A 3MBYA 5BPCA 1S9FA 3M8SA 5IIMA 5EOZA 4UB3A 4CCHA 4M47A 5KFJA 5DKWA 1ZQLA 2A1JB 1D8YA 5DBCA 1SZPA
chains in the Genus database with same CATH superfamily
1ZXIA 3B9JA 9ICRA 3PSPA 3T5LA 2QLTA 2DF4B 4UAWA 2F1IA 2OH2A 2HHXA 3EF2A 5KG4A 4P4PA 5JTGA 4C7YA 3FC4A 5DG8A 3QU7A 4YR3A 1ZQXA 2NRTA 1MSWD 2JH1A 1MIWA 4KLFA 3EPIA 4ECUA 4DL7A 4BXOB 5B3PA 4FBUA 4DLEA 5CRXA 2YB1A 9ICLA 3GDXA 1LB2B 5KFFA 5HHIA 2HMXA 3BJYA 2KEYA 3M6KA 4IQVA 3FDSA 4XQ8A 2FMQA 5D4BA 3NS1A 4ELVA 1SL2A 2ZG6A 5DQIA 4B9UA 4JV2A 4QZEA 2JEJA 5KNIA 2ZTCA 5AHXA 3C23A 1PVRA 4R63A 4M9LA 4LEVA 3UQ0A 5KFRA 3JZ0A 4B9NA 3EPGA 3ZDEA 3JPRA 2DRAA 4BUGA 3SD7A 4ECYA 2UVWA 2Q4TA 3K75D 2BBHA 1ZQWA 1SV0A 4I29A 5ALMA 2ISPA 1PZNA 3Q8SB 1X9MA 3AQMA 2EWRA 3I1YA 5AIBA 2C22A 7ICEA 1KEJA 2L5YA 3QUCA 3FAHA 4TUQA 2MAXA 4EBKA 1LV5A 5CA7A 5ALQA 4RPXA 5AI0A 4PHDA 3PR4A 1X9XA 4DF4A 4PHEA 3RF9A 1HIWA 4IRKA 2ES6A 2AHOB 4M9GA 1BGXT 5KFCA 2KG5A 3BQTA 3AN1A 4KLLA 5KFLA 3I76A 2XCAA 2ZH1A 3QE9Y 4ECSA 4XA5A 4ACOA 2DGZA 5DG7A 1IM4A 4NWIA 2PMZF 4FFDA 4KTQA 1UEUA 5ALYA 5DBBA 4FHXA 1U45A 1AROP 2FPLA 4KLEA 3EW9A 3OV7A 3GU3A 4QZCA 2G08A 4PPXA 4MFCA 4QWDA 1Q79A 4RPZA 2F1HA 4X0AA 5KFEA 3ERCC 8ICHA 2OM6A 4JV0A 4MF2A 1RQNA 4YXMA 1SV4A 3UMBA 1SWWA 5CJ7A 3D2NA 2H3IA 2EZXA 3BDPA 3T5HA 1N63A 2DVIA 2KMDA 1Z4NA 5AICA 3OGUA 1ZQDA 4P0QB 5IIIA 3NVYA 3HJEA 4YQWA 4ATBB 2PKEA 2IOFA 3EYZA 5KFGA 2JRZA 1Z1BA 5HRDA 2DQNB 3MDCA 4KLQA 1X42A 2Y0SF 1D9DA 5KFKA 2C2EA 3N97B 5J0YA 5B3QA 4NLGA 4J9LA 4F5QA 2PMZC 2KSOA 3H8SA 3LWLA 4OCZA 2KHVA 7ICNA 2JZBB 4GXIA 4QZBA 3ICXA 2V4RA 2ZJ8A 1X6JA 3RB3A 1IIPA 2KP7A 1R8AA 1XSNA 2ZH7A 4OJ5A 4DQRA 2XVTA 5HMMA 3UXNA 5DB7A 2KKVA 5KG6A 2DL0A 2XCPA 3WK5A 3H40A 2Y9UA 1KFDA 4IQTA 4TQSA 4DFPA 3PSIA 1RYSA 4KX3A 2G06A 4KB6A 3PW0A 4WC2A 3F5AA 3KKAC 5J8YC 5TISU 2E8PA 4K99A 4C80A 2BZFA 2HDOA 2E1FA 2JMGA 1JI7A 1TK8A 4M9NA 2A1AA 1JXLA 3ISCA 9ICVA 1ZD3A 4UW9A 2IHMA 4O6AA 5D46A 3NASA 1QCKA 2LYHA 1BPZA 2FE9A 1S0VA 3JPPA 2BGWA 4FHVA 5G5HA 4C7ZA 3LQCB 2BCVA 1BPDA 4ECQA 4QZ8A 3OJSA 3KTQA 4IRCA 2B0CA 3MABA 2KKPA 1L7NA 4UD4A 4OAIZ 5KFVA 4FHYA 4Y2JA 2BCRA 1ZQHA 4IR1A 3QU4A 8ICFA 4LJXA 1PVQA 3NVVA 1A6SA 3PSFA 5BOMA 1UT8A 2KJ9A 1Z00B 4AT8A 1NK6A 5HMLA 4M0AA 2J6UA 4ECTA 4TUSA 4P0PA 2ATLA 4XJEA 2KJ8A 2FMSA 1R8CA 1ZYQA 2OXOA 4NXTA 3C28A 7ICMA 2D6FC 8ICEA 3IM1A 3PZPA 4PHPA 4R8UB 5ALLA 3SENA 5J2HA 3D2QA 3KZIU 1R8BA 1PVPA 1MN8A 2BCQA 4WC1A 1TAQA 1RXWA 1T8EA 1BPBA 4I2FA 2F2AB 2BKEA 2AH5A 2NRKA 8ICYA 1NNLA 7ICFA 9ICMA 4F91B 3NTUA 2F76X 2W9CA 5ALTA 1PK1B 4RQMA 4NL9A 2JXJA 3UPSA 3IDWA 1P7DA 2HHQA 5DB6A 2ZIXB 3Q8RB 3FYHA 4RT2A 9ICPA 1JXEA 1B4FA 4DOAA 5F9LA 3H39A 2KFZA 4UBBA 3QZ7A 4QZFA 1MQ2A 3Q8MA 3MFHA 4Y2RA 5ALRA 4QZHA 1VJ5A 2DR5A 2ZH4A 1KSPA 4DQSA 5KT4A 5KFZA 4QZ9A 5CB1A 3GV7B 4AT9B 2K8CB 3NVOA 4IR9A 3WKCA 3SEIA 1B0XA 2KE7A 2VA2A 1S8OA 4UB5A 1SXDA 1PX5A 5HREA 3D2SA 2PFNA 3KBBA 1UEVA 4I2HA 3LWMA 2NRVA 5AM2A 4J9PA 5KFYA 2XY6A 4C4RA 2QB0A 2GA9D 3PW5A 4CF3A 1SKWA 4YD1A 2VJ4A 2G09A 3NVWA 5JU5A 1NK8A 4X4OA 3G6VA 4LZDA 4M6WB 5KG1A 1XO1A 4YD2A 4QZDA 4YMMA 2LHTA 7ICPA 8ICZA 2EZZA 4ZH4A 2BR0A 2JV3A 1MA7A 2KJ5A 3HILA 1WWUA 1WG8A 4WC3A 3ER9B 3WK7A 4NV0A 4O69A 4RQ4A 4QIWF 3AUOA 7ICIA 3WKDA 5HRLA 2W8LA 1N5WA 3C21A 1SXEA 3BS7A 4HAIA 1V9PA 2G5HB 2E5SA 1BVSA 1L3UA 4DEZA 5EE0A 2UVUA 1L3SA 5J2FA 9ICTA 4ED1A 2YMMA 3FM9A 9ICEA 5IIJA 5AKGA 4J9OA 2KK0A 1L7MA 5A0LA 3AQEA 3ZI4A 1J2MA 4UB3A 1ZQLA 5J0TA 5J2JA 8ICPA 4UB8U 2JEGA 4OJLA 3RH4A 2JGAA 4M5DA 2YY6A 1XSPA 3K1RB 3WFPA 2LKYA 2ZUCA 4O5KA 3OVBA 1VDVA 1TFRA 1A76A 5J2KA 4GIBA 3V7LA 3ZD9A 2EZYA 4QIWC 4F5PA 4X4SA 1A0PA 3LVWA 5AKKA 1ZD2P 3RJGA 2AGOA 2PBEA 4KLUA 4ZOHC 4UQGA 1KRPA 1YLQA 4F4WA 2A3VA 9ICHA 4F50A 3KFUF 4B9VA 2HHVA 7ICUA 4OJ6A 3C1ZA 8ICUA 3TANA 1X6IA 4F8RA 2BDPA 1S77D 4RUAA 8ICBA 2A1JA 2EAPA 1KBUA 4O3MA 2Q66A 1NJWA 4RQ8A 4UAYA 1ZQBA 2WB1F 1RPLA 4C0ZA 1HJPA 7ICOA 4Q44A 3MR6A 3I28A 3OVAA 4YN4A 3HP6A 1URJA 2FPMA 2EDUA 5J2EA 4O3PA 5AK4A 1WOTA 3PR5B 4NM2A 5D61A 3LDAA 3SYZA 2CXYA 4X4VA 5CP2A 7ICSA 4UB2A 1DK2A 4EZ9A 4EEKA 4O5CA 7ICHA 1HUZA 5IIKA 2NRXA 4K4GA 4QZGA 1VLBA 4RT3A 2BQRA 4ED0A 4NLBA 1N5XA 1T3NA 5DGAA 2NRZA 2BDUA 3AEVA 4AT7A 1VJ7A 1KDHA 3V6HA 2KZ3A 3ISDA 2D8CA 2K8AA 2K60A 3ALRA 1LKYA 2ESEA 2KVCA 2DR9A 2W9MA 9ICOA 2WB1C 4UD5A 2DFLA 4KN4A 4G9BA 5AKEA 3MDAA 2PI4A 5ALNA 2LM4A 1JUDA 2KSOB 3RBDA 4RQ7A 3MR2A 2RFFA 3RBEA 2ZHBA 3F5EA 2VANA 1N48A 2HBJA 4WQKA 1PUZA 4X5VA 4EEBA 1RXVA 3THVA 4P4MA 4KLHA 2ZUDA 5ALXA 3H0MB 2WF6A 3H0LB 2W55A 3HRDD 1T94A 4EP7A 5ALVA 4DWIA 2RDJA 2HN2A 5J0WA 3TFSA 2ZH2A 5ALUA 4LEWA 3BQ1A 2ZH9A 2DUYA 2K8BB 2G5IB 4UB6U 1Z3EB 2KIVA 2R18A 3N7RC 4E80A 3UMGA 4USAA 4RQ1A 2RDIA 4ED2A 3RJFA 4LVSA 1TK0A 4NKTA 5CEHA 1Z19A 1JN3A 1NOMA 5HNKA 3F2DA 4PGQA 2ZIUA 1RYRA 2P6RA 3TAPA 3HKZC 1ZQYA 4X4RA 4OO1J 3PVXA 1QQ5A 4KLIA 4EYIB 1TFWA 1ZRNA 2LYAA 4NXVA 3G6XA 3RAXA 1SB3C 4GC6A 5KFMA 3M9OB 2I6XA 5GTIU 4AT8B 3OHBA 1OUQA 4DSIA 5F3XB 4DO9A 4QWEA 1PK3A 2YQEA 4UB1A 1WCLA 4P0PB 5D62A 7ICLA 1O03A 4R65A 5KAIU 2K4PA 2G07A 2PI5A 3TADC 2G0AA 2HHPA 4JWMA 4DL4A 2P6UA 1QSYA 8ICNA 3H7IA 3C2MA 4BWJA 4J9KA 1L5UA 1Y88A 4F72A 4DSJA 4OD0A 1TK5A 5J0UA 2F3NA 1NZPA 5K4LA 1SKRA 3VCBA 3ISBA 4F92B 2W9CB 2UVRA 4AYBF 2BPGA 4F5RA 3L5KA 4WC0A 3CP8A 5AKIA 4YR0A 3DEEA 4QWAA 4MFAA 9ICWA 3JCFA 5KT3A 4X4UA 3ZD8A 9ICIA 3WK6A 8ICLA 2PFQA 4I2CA 1QLNA 1ZQSA 4EENA 4I2AA 2LPEA 4EEYA 4DFDA 3KOOA 1K5OA 2W54A 2WFAA 4X4QA 2J6TA 3CYMA 1K1SA 1ZQOA 3S6JA 1CI4A 4K4IA 4JV1A 1UPHA 4B9MA 4K9BA 2F1JA 9ICUA 2YMLA 2AGQA 3T5KA 3C2LA 5DDMA 3TI0A 3AQKA 2HHWA 4KLDA 3IP4B 3JPNA 3N7SC 1XS9D 4FO1A 4AYBC 3E58A 3L9DA 4WH5A 1J2NA 1UA0A 3OWGA 2QB0B 2IHOA 5KFAA 3UPQA 1ZETA 1FFVA 4KMOB 5AK3A 5EWFA 5G5GA 2ZTDA 4YXJA 4RNMA 2UVVA 3UMCA 5TZVA 4I2GA 3PY8A 1U49A 4OJOA 4CF5A 3HJ4A 2I5HA 2Y1IA 1U4BA 4C8KA 4US9A 3MGHA 1QTMA 3RAQA 3QEBZ 3C18A 3OVSA 1GPJA 1TVAA 4M2YA 3IHQB 1V4AA 3SMVA 4XRHA 2Y0SC 4KITB 3GIJA 1U48A 4K9AA 4U6PA 2KICA 4C8MA 4KLSA 2DRBA 2F8KA 5DDYA 4B9LA 1TE2A 4ECWA 4RNNA 3H8JA 4PZNA 3H3AA 4QW8A 3WFOA 5AI8A 1KKXA 2GOLA 5BOLA 3F2BA 4KLOA 5KFQA 3SZ2A 5CHGA 3UXOA 4ELTA 5KG3A 2PFPA 3F53A 3H8WA 5DLFA 4C4SA 4NLZA 4O3RA 1FFUA 3H4DA 5CHEA 3NKUA 2IOHA 3NRZA 5ALWA 2FJ6A 4EEDA 4WBZA 4IQUA 1WYGA 8ICSA 2OCEA 4I0UA 2AQ4A 1FO4A 5L9XA 3RH6A 3ZDDA 1ZJNA 2DPJA 4DL5A 1ZQFA 2H5XA 2VIXA 4MFFA 1OXJA 3PX0A 4F4ZA 4Q8EA 5J2AA 5AM0A 3PW4A 3MBYA 4UATA 2KIWA 5EOZA 2A1JB 1D8YA 5DBCA 1SZPA 1ZQVA 5KFOA 1DGSA 1XWLA 5AKYA 5D49A 1NK5A 1TV9A 1N56A 3BS5A 2ASDA 4AP9A 4NXZA 3V7JA 5F2VO 2ASJA 4ECZA 4F4KA 8ICVA 3M8RA 3EZ5A 1Q3VA 5B66U 3SAFA 2HOFA 4ELUA 2WF9A 5HHHA 2K89A 3WK8A 2ZIVA 1AQ6A 2OYYA 3R9KA 5HR6A 4JLXA 5ALZA 5HRHA 4GC7A 1B22A 4Z6EA 5E79U 1D9FA 3OSNA 4I2IA 2K4EA 4BGDA 5J0RA 2DKXA 4F3OA 1X9SA 8ICJA 4O9MA 4DS4A 1F44A 1L7PA 1FA0A 4RU9A 4ED3A 3ZDCA 1ZD5A 1ZQJA 1ZQKA 3K7DA 3WKBA 3GV5B 2OWOA 4PZOA 4RWNA 3KHLA 4C8LA 1LKYB 7ICJA 5KG2A 2LBOA 1CRXA 2ZH8A 5DQHA 3NWIA 5CFSA 1COKA 3HIYA 5JTIA 1Q46A 2KHQA 5CWRA 1C7YA 4RWOA 2KVSA 2CN1A 3CK6A 2E8NA 8ICMA 2YMQA 1JIHA 3RB6A 2WAQF 9ICNA 4K8VA 1M6YA 4DS5A 4Z6CA 4B9SA 3RJEA 2A19A 2CPRA 2Y9TA 4S3NA 4F2SA 3PMNA 1BPYA 2W8KA 3QUQA 5AKHA 2W7PA 3PX4A 1L3VA 4C4TA 2M2TA 4J9SA 3HX0A 2EAOA 2E1EA 1IV8A 4Q8FA 1UHUA 3CNHA 3L4PA 1Q3UA 1NKCA 5KG7A 7ICVA 2V4QA 4LEZA 1JROA 9ICFA 5J2IA 5HRFA 1NK4A 2HBLA 5ALKA 4DOBA 5DBAA 4F2RA 1EXNA 1ZRMA 4DQPA 5EE9A 5JUMA 2QARA 4YG2A 4F5OA 1KW4A 1RZTA 2ZH5A 1OU5A 4KMUA 4UAZA 4M04A 5KFHA 1B43A 2ODGA 4QNLA 8ICXA 3PHZA 2RRDA 5B5EU 5J0XA 2OEHA 4BWMA 3IV6A 2ZIUB 4NM1A 4NLCA 1BNPA 5KG5A 1ZQ1C 4O3OA 4JK1A 4F4YA 4X4NA 2WAQC 5DB8A 2B4VA 1SV0C 5DGBA 1NZBA 2ALZA 5HP4A 3MFIA 4J9NA 5KAFU 4OJPA 2BCSA 5EWGA 1T3QA 3ONNA 4GXJA 3KKAA 5J8YA 3SAGA 4PJ0U 5AM4A 4I28A 3GQCA 2XICA 1L8LA 4ECRA 4KLMA 3ZDAA 1ZQEA 3C5FA 5ALIA 1NJYA 1S0MA 4K98A 4FZMA 4KLGA 1ECWA 4UB4A 3IN5A 4DF8A 3AU2A 8ICKA 5AI9A 1MQ3A 4X0BA 2PXIA 5EWEA 4R64A 4K97A 1IXRA 4N7RA 2KFNA 9ICGA 5AKJA 2XI9A 3RR7A 1RYUA 2YTUA 2YMPA 3SQIA 2BCUA 2DWQA 2BQ3A 3C5GA 1BPEA 2HI0A 2W03A 5AM5A 3O0FA 4LZGA 4FH3A 2WF8A 7ICKA 2ZXIA 2QB1A 5ALPA 1ZQCA 4QZAA 1NK7A 1QQ7A 2Z7JA 3LYSA 4B9TA 3CRXA 2LI6A 2W7OA 5ALHA 2JEFA 4WC4A 2IUBA 3C66A 2W9AA 4OAFA 2NV3A 5L1LA 1KFTA 2HSZA 3OUYA 1ZOLA 8ICAA 3JPTA 1OW5A 3ETRA 8ICCA 4IL6U 5C0YA 4YCXA 2JHDA 3SI8A 3M1YA 1ED1A 3RRGA 3QNMA 5KL8B 3E0FA 2ID1A 4QW9A 3SV4A 4A8EA 4NXUA 3KHHA 2MUTA 4IQWA 1X2IA 4EYHB 4KLTA 2FLPA 1RDFA 2ISOA 3N4MB 2HN1A 5T14A 4EV6A 4QWBA 3V7KA 1C20A 4PL2A 3ORYA 2BE3A 4CF4A 4YVZA 1MC8A 4NXWA 4RQ2A 2HHUA 3N7PD 3AQLA 3TAQA 3ER8C 3AQFA 5KG0A 3IG5A 4EX7A 2GWSA 4Y2SA 4JWNA 2JH7A 1UCVA 4NKUA 4US8A 3WU2U 5L1IA 1K1QA 3UXPA 1TAUA 4PGXA 2O6KA 1SZHA 2ZJAA 8ICIA 3MCRA 3C29A 4O67A 5KTQA 2MA1A 5IINA 2E8MA 4LEYA 4JUZA 5J29A 2FMPA 4WOYA 2HVIA 5DEDA 5HR7A 2WF5A 4F93B 2KOBA 1T4GA 4M6WA 3PX6A 9ICXA 3JPQA 4J9QA 1S97A 1XSLA 1KTQA 3IG8A 4WQLA 2F8LA 3QEAZ 4UAVA 2BHNA 3K1ZA 5HRIA 1SIJA 3BQ7A 2NYVA 3A0BU 5DECA 3WKAA 1COOA 2W3RA 5EE3A 2IMWP 2R8IA 1L8OA 4P2HA 3E2EA 1DRGA 1DXSA 1O08A 4I2DA 4I27A 4FO6A 2EH9A 4RUCA 3NVZA 5EE1A 4X4TA 3QU9A 4KX5A 5DB9A 4HX0A 4RPYA 1XNSA 3SAHA 2HHTA 4RZRA 2CRXA 4YMNA 2ZIWA 3AU6A 4FZNA 3QUBA 4RQ5A 4ED8A 4M9HA 3BZCA 4NJ8A 2XC9A 3TARA 3DV9A 2I9GA 9ICSA 4ED7A 3MR3A 4DL2A 1ZD4A 2GAFD 5IILA 2BPCA 3WK4A 1S10A 4K4HA 4CE6A 4I2EA 5J0SA 1V38A 1DK3A 4O0IA 4J9RA 2W04A 4DSFA 3Q8LA 4NLKA 2R8GA 9ICKA 4RNOA 3H37A 5CFUA 3B0XA 3TKAA 4TURA 2KNJA 1KFSA 3M6ZA 2RLTA 1QQ6A 4I2JA 1JMSA 1V85A 4EZ6A 2KTQA 8ICGA 4TUPA 2FCLA 4NL9C 3M7DA 4DSEA 3PNCA 3T5JA 3NRWA 3WKEA 2M2VA 1WCNA 1QSSA 3JPSA 3BS5B 5ALSA 1NK0A 2LM1A 3WFSC 2OHFA 4Y2VA 4DL3A 5KT6A 1MIYA 2C2DA 4IS7A 4DL6A 5J0PA 2EANA 2KD1A 2W11A 2VA8A 3PO5A 5AIAA 2ZIVB 1WWVA 5JRTA 4IRDA 1L3TA 3ETLA 4OAGA 3TQ1A 4FS1A 2W9BA 3GILA 1N62A 3OSPA 4RWPA 3QX7A 5AKXA 2V9WA 3HWTA 3N28A 4U7CA 4FE3A 4Y2XA 3D6JA 4CCHA 4M47A 5KFJA 5DKWA 4B6JA 3V72A 4NXXA 3V6KA 3QUTA 4UBCA 2FLNA 2DPIA 2R8KA 1UA1A 2FI1A 4FHWA 4RQNA 1DGJA 1JAJA 1N2XA 7ICQA 1L6NA 2ZXHA 4PL1A 3G6YA 4DSLA 4F5NA 4R66A 4TQRA 4QZIA 4E8FA 2BPFA 1L7OA 3RJIA 2HVHA 5L1MA 4WCWA 3UM9A 1UETA 9ICAA 1S0NA 5KFNA 8ICOA 4Y2YA 2MSNA 1N60A 2K4IA 4RQ6A 1KL9A 3ED5A 3SV3A 2XO7A 2XY7A 1ZJMA 4YMOA 2WHEA 1X66A 2ASLA 3AQNA 1TKDA 8ICWA 4BDPA 1UT5A 3OHAA 1CUKA 4UAUA 4MKPA 4Y2UA 2QARB 2C2RA 1NKBA 3LK9A 1RM6C 4G3IA 5KT7A 1MIVA 2ZH3A 4FZLA 1XO0A 2NRWA 8ICTA 5AK5A 5KFDA 4CDGA 1Z4OA 2H3VA 3OTQA 3HT3A 4BXOA 5C5JA 3J81j 4NY8A 2IBKA 5CFTA 2ZH6A 4EX6A 2ZTEA 2IA6A 4FS2A 2C28A 2E8OA 1KN5A 2RHFA 4IG8A 4MEXA 2AJQA 4O68A 1U47A 3KD3A 2JR5A 1YT3A 1ZQZA 4Z6DA 3AM9A 1ZQMA 4DSKA 4EBJA 2MU2A 2NO4A 5J2CA 1SWVA 2H3ZA 2GH1A 4DLGA 5F9NA 3UQ2A 1JRPA 5HRGA 5KFPA 2KZZA 5AI6A 4M9JA 2RP5A 4PH5A 1Q78A 4ECVA 4MHVA 5HC9A 5L1KA 5KFTA 2R8JA 2XIDA 2K4HA 2M2WA 1NK9A 4DFJA 3M9NB 1NI3A 4PHAA 3GV8B 5HRBA 3H8MA 2R8HA 1N61A 1XU4A 2MRLA 5AM1A 2HBMA 3C2KA 3OPXA 5J2GA 3Q8KA 2P66A 3M9MB 4EELA 2IHNA 3HPOA 4QJFB 4LT6A 4MF8A 3T3FA 4Z6FA 2JEIA 4F4XA 3PV8A 5DLGA 3H0RB 4Y2TA 3RJKA 4ECXA 2W3SA 1U9LA 3GFKB 3NYBA 5AI5A 3C1YA 2GLEA 3WFRE 2AQ0A 2F77X 4OAHA 2XGPA 2RQ5A 1ZQPA 2ZUBA 3GZFA 3ZDBA 5HRKA 1QH9A 5KT2A 3TADA 1F5SA 4YFKA 3DDHA 2BBJA 3OUYB 2GO7A 3QU2A 1ZQRA 4I2BA 4GLXA 3OJUA 3WK9A 4J9MA 3PW7A 2FPKA 5J2BA 3WFQE 1YZ6A 2BQUA 4KM5A 5FP0A 1FIQA 2MUTB 4AT7B 1KLNA 2J6SA 3RJHA 5AI4A 4C8NA 4O5EA 3AL0B 1ZQUA 2HW3A 4KLJA 1F5AA 1TFYA 5GTHU 5CR0A 7ICRA 3RRHA 1H38A 3MC1A 7ICTA 3KHGA 2XGQA 2QKQA 4YR2A 9ICCA 2FDRA 2HHSA 2AGPA 1ZQTA 2W43A 2N1RA 4GXKA 2WTFA 2YN4A 2Y1JA 2I1QA 4P0QA 3MGVA 4ATBA 2M2UA 3V6JA 3RB0A 3CW2C 3GIMA 4Q45A 3QZ8A 1NO5A 3QYPA 1RQLA 1X40A 1JALA 2HCFA 4WBYA 5ALOA 4RQ0A 5ALDA 3KZXA 1JQRA 1KNYA 2KN7A 2DR7A 7ICGA 1SKSA 2JZBA 4K96A 1J97A 1D8BA 1S0OA 1BPXA 5ALJA 1TAMA 1LVHA 2B21A 2IOFK 3HJ1A 2XY5A 4DOCA 3LVVA 3GIIA 3BQ2A 4WC6A 5ALFA 3U26A 3NUQA 2YB4A 4RQ3A 3Q8QB 4JB3A 2WF7A 4JLZA 5AK6A 3MGIA 3MR5A 3VC8A 2KZMA 4FHPA 1ZQGA 2M9NA 2M0NA 3PO4A 4UARA 3EUB2 5AKZA 3BZKA 1WUDA 3IRUA 2B51A 4BX9C 3RTVA 5AM3A 1XC9A 4J03A 4C8OA 4FH5A 2P35A 1KQQA 3RJJA 4YP3A 1F0MA 2ZIWB 9ICJA 1Q8KA 1ZQNA 4EGWA 4Y2PA 2PFOA 4CNQA 4ED6A 4MEYA 3K4GA 3TACB 3SR6A 4E0DA 4O3SA 2NO5A 5ALEA 2DBYA 4QWCA 8ICQA 1A77A 5KFBA 4XUSA 5L1JA 1HEKA 2YX8A 4O3NA 1HUOA 3JPOA 3RR8A 1NJXA 4DFKA 2HOQA 4PGYA 4ICAA 3GIKA 3RFAA 2HOIA 1Z00A 5KFUA 4DQIA 2LYBA 3BQ0A 2D3DA 4Y2QA 1GO3F 1ZQQA 3PW2A 4JMUA 5HR9A 3AMZA 5KFXA 4DCCA 3PSTA 1NJZA 2VA3A 4E7XA 4RWQA 3H4BA 2O5AA 3RH5A 2KV2A 3EWAA 5AKLA 4EBCA 2B6GA 4XQ7A 4FBTA 5IIOA 4Q43A 1SGGA 4R8UA 3H38A 8ICRA 1RG6A 2DKZA 4WC5A 3L3FX 1ZQIA 3PMLA 5DG9A 3TFRA 2E3TA 4GFJA 2AU0A 1Z1VA 5J0OA 3Q8PB 3A0HU 4IC9A 1X9WA 1NKEA 4DQQA 2W9BB 1SL0A 9ICQA 5KFWA 1S5LU 1PK1A 2VKQA 1FEZA 2Q0ZX 4X4PA 4F71A 2ZJ5A 2F44A 4NLNA 3B0YA 4WC7A 2ZIXA 3RB4A 1D8LA 4EBDA 4P4OA 2EQYA 5DQGA 4O3QA 3F2CA 2FLLA 3JYYA 5KFSA 1SL1A 2H3FA 1UQVA 5D63A 3KHRA 2VJ5A 2LMRA 4CRXA 4UASA 1T7PA 4BJQA 2B56A 1YZ7A 5KT5A 1DOQA 5J0QA 1JX4A 2EAMA 4WJ3B 1R89A 2ZHAA 4AT9A 2DR8A 3NGDA 1CEZA 2HBKA 4HYKA 3QU5A 1V97A 1VFGA 5J2DA 2H3QA 1S76D 5KL1B 4DFMA 4EBEA 4CGZA 2O1PA 9ICBA 1QSLA 4KN7A 5KFIA 3HW8A 1IG6A 1ZQAA 2AXTU 1BNOA 3HKZF 3QXGA 5BPCA 1S9FA 3M8SA 5IIMA 3T79A 5ALGA 5H2FU
chains in the Genus database with same CATH topology
3V72A 2NRKA 3V6KA 1ZQVA 5KFOA 5J0TA 5J2JA 1DGSA 1XWLA 9ICRA 5D49A 3T5LA 4UBCA 1NK5A 2FLNA 4UAWA 1TV9A 8ICPA 2F1IA 2DPIA 1N56A 2HHXA 2JEGA 2R8KA 3RH4A 1UA1A 5KG4A 2ASDA 4M5DA 4P4PA 4FHWA 1XSPA 4NXZA 3V7JA 1JAJA 5F2VO 5DG8A 3WFPA 4YR3A 2ASJA 7ICQA 1ZQXA 2ZUCA 4O5KA 3OVBA 2NRTA 1MSWD 4ECZA 1TFRA 3G6YA 1MIWA 4DSLA 4F4KA 1A76A 8ICVA 4F5NA 4R66A 4KLFA 5J2KA 4FHVA 3M8RA 4TQRA 3EZ5A 3EPIA 3V7LA 3ZD9A 4ECUA 4QZIA 4ELUA 4E8FA 4F5PA 5HHHA 2BPFA 4DL7A 4BXOB 3RJIA 2HVHA 4FBUA 4X4SA 4DLEA 4WCWA 9ICLA 1UETA 3GDXA 1LB2B 9ICAA 3RJGA 2AGOA 1S0NA 5KFFA 5HRHA 5HHIA 5KFNA 3BJYA 4GC7A 4KLUA 8ICOA 4UQGA 4Z6EA 1B22A 1KRPA 4IQVA 3FDSA 1YLQA 4XQ8A 2FMQA 4F4WA 3OSNA 1D9FA 4I2IA 4BGDA 9ICHA 4RQ6A 5J0RA 4F50A 4F3OA 4B9VA 3SV3A 2XY7A 2XO7A 5D4BA 1X9SA 4ELVA 1ZJMA 2HHVA 4YMOA 1SL2A 7ICUA 8ICJA 3C1ZA 4O9MA 8ICUA 5DQIA 3TANA 4DS4A 4B9UA 4F8RA 2ASLA 4QZEA 2BDPA 4JV2A 1FA0A 3AQNA 4RU9A 2JEJA 4ED3A 3ZDCA 1TKDA 8ICWA 2ZTCA 1ZQJA 1S77D 4RUAA 4BDPA 3C23A 8ICBA 1ZQKA 2A1JA 3GV5B 2Q66A 4R63A 4M9LA 1UT5A 1NJWA 2OWOA 3OHAA 3UQ0A 4RWNA 1CUKA 5KFRA 4RQ8A 4UAYA 3KHLA 1RPLA 2C2RA 1ZQBA 4C8LA 1NKBA 1HJPA 7ICJA 3LK9A 4Q44A 7ICOA 3JZ0A 5KG2A 4G3IA 2ZH8A 4B9NA 5KT7A 3MR6A 3EPGA 3ZDEA 1MIVA 2ZH3A 3JPRA 3OVAA 5DQHA 2DRAA 4YN4A 3HP6A 4ECYA 2FPMA 2UVWA 2NRWA 3HIYA 5J2EA 3K75D 4O3PA 5CWRA 8ICTA 1C7YA 1WOTA 4RWOA 5KFDA 1ZQWA 4I29A 2ISPA 3PR5B 4NM2A 1PZNA 8ICMA 3LDAA 1JIHA 3RB6A 3HT3A 3Q8SB 1X9MA 5C5JA 3SYZA 4BXOA 4NY8A 2IBKA 5CP2A 4DS5A 4Z6CA 9ICNA 7ICSA 3AQMA 4B9SA 2ZH6A 4X4VA 3RJEA 4S3NA 4UB2A 2ZTEA 2IA6A 4F2SA 3PMNA 4FS2A 2C28A 1BPYA 4EZ9A 1DK2A 4IG8A 4MEXA 4O5CA 2C22A 2AJQA 7ICHA 1U47A 2W8KA 1HUZA 5IIKA 7ICEA 1ZQZA 4Z6DA 1ZQMA 4DSKA 3PX4A 4EBJA 1L3VA 1KEJA 2NRXA 5J2CA 4K4GA 4QZGA 4RT3A 4DLGA 2BQRA 4TUQA 2M2TA 4J9SA 3HX0A 5F9NA 2MAXA 3UQ2A 4ED0A 5HRGA 4EBKA 5KFPA 1LV5A 4Q8FA 2KZZA 5CA7A 1NKCA 4M9JA 5KG7A 4RPXA 4PH5A 4PHDA 5DGAA 1T3NA 2V4QA 7ICVA 1Q78A 2NRZA 4ECVA 3PR4A 9ICFA 4AT7A 4DF4A 1VJ7A 5J2IA 4PHEA 5HRFA 5L1KA 3V6HA 1KDHA 5HC9A 2KZ3A 1NK4A 5KFTA 3ISDA 2R8JA 4IRKA 4DOBA 5DBAA 4F2RA 1EXNA 1BGXT 4M9GA 5KFCA 4DQPA 5JUMA 3BQTA 2M2WA 1NK9A 4KLLA 4DFJA 5KFLA 2DR9A 2ZH1A 2XCAA 3M9NB 2W9MA 4YG2A 4F5OA 3QE9Y 4ECSA 9ICOA 2DFLA 4UD5A 4XA5A 4PHAA 3GV8B 4KN4A 5DG7A 1RZTA 1IM4A 1OU5A 2ZH5A 5HRBA 2R8HA 4KMUA 4UAZA 4M04A 1XU4A 5KFHA 4KTQA 1UEUA 1B43A 5DBBA 4FHXA 3MDAA 2PI4A 1U45A 8ICXA 1AROP 2FPLA 4KLEA 5J0XA 3C2KA 3EW9A 5J2GA 3Q8KA 4BWMA 3OV7A 2P66A 4QZCA 3RBDA 4RQ7A 3M9MB 4NM1A 4PPXA 2IHNA 1BNPA 4MFCA 3HPOA 4LT6A 3MR2A 2RFFA 5KG5A 4O3OA 4MF8A 4JK1A 4QWDA 4Z6FA 4F4YA 4F4XA 2VANA 3T3FA 5DB8A 2F1HA 4RPZA 3RBEA 5KFEA 1N48A 3PV8A 1Q79A 4X0AA 4X5VA 5DLGA 5DGBA 2ALZA 5HP4A 3MFIA 1RXVA 4J9NA 8ICHA 3THVA 4P4MA 4JV0A 4MF2A 4KLHA 2ZUDA 3RJKA 4ECXA 2BCSA 4YXMA 5EWGA 1U9LA 4GXJA 5CJ7A 3GFKB 3NYBA 4EP7A 3C1YA 3BDPA 3T5HA 3WFRE 2AQ0A 4I28A 3GQCA 2DVIA 2XGPA 4DWIA 2RDJA 4ECRA 1ZQPA 2ZUBA 4KLMA 5J0WA 3TFSA 2ZH2A 3ZDAA 3ZDBA 5HRKA 1ZQEA 3BQ1A 5KT2A 3OGUA 1ZQDA 3C5FA 1NJYA 5IIIA 2ZH9A 4YQWA 4ATBB 1S0MA 4YFKA 4KLGA 3EYZA 5KFGA 3OUYB 5HRDA 1ZQRA 1Z3EB 3MDCA 4I2BA 4KLQA 4E80A 4GLXA 1D9DA 4UB4A 3OJUA 5KFKA 4RQ1A 4DF8A 2C2EA 3N97B 2RDIA 3AU2A 8ICKA 5J0YA 4J9MA 4ED2A 3PW7A 1MQ3A 3RJFA 2FPKA 1TK0A 4LVSA 4NKTA 4X0BA 4NLGA 2PXIA 4J9LA 4F5QA 5EWEA 1JN3A 1NOMA 4R64A 1IXRA 5J2BA 5HNKA 3H8SA 3LWLA 3WFQE 2KFNA 7ICNA 4PGQA 9ICGA 1RYRA 2BQUA 2JZBB 4GXIA 2P6RA 3TAPA 2MUTB 1ZQYA 4QZBA 1KLNA 3RR7A 2V4RA 4AT7B 2ZJ8A 3PVXA 3RB3A 4X4RA 2BCUA 4KLIA 2J6SA 3RJHA 2KP7A 1R8AA 1XSNA 4C8NA 2ZH7A 4O5EA 2BQ3A 1ZQUA 4EYIB 4KLJA 2HW3A 3C5GA 1F5AA 1TFYA 4DQRA 1BPEA 5HMMA 3UXNA 1TFWA 5CR0A 5DB7A 4LZGA 7ICKA 5KG6A 4FH3A 2XCPA 3RRHA 7ICRA 3G6XA 3RAXA 1ZQCA 4QZAA 3H40A 4GC6A 1NK7A 5KFMA 3M9OB 1KFDA 4IQTA 1H38A 4TQSA 4DFPA 7ICTA 3KHGA 2XGQA 4B9TA 4AT8B 4YR2A 9ICCA 1RYSA 2JEFA 3OHBA 2HHSA 4DSIA 4WC4A 2AGPA 1ZQTA 4GXKA 2WTFA 3PW0A 3C66A 2W9AA 4WC2A 2Y1JA 2I1QA 4ATBA 4DO9A 4QWEA 2M2UA 4X4NA 4UB1A 5L1LA 1WCLA 3V6JA 1KFTA 7ICLA 3RB0A 3GIMA 3OUYA 4Q45A 4R65A 3QZ8A 8ICAA 3JPTA 1TK8A 1NO5A 2PI5A 4M9NA 8ICCA 1JXLA 3ISCA 9ICVA 4YCXA 2JEIA 2HHPA 2IHMA 3SI8A 4JWMA 5D46A 4WBYA 2LYHA 4DL4A 1BPZA 4RQ0A 2P6UA 3JPPA 2BGWA 1QSYA 1S0VA 8ICNA 3H7IA 3C2MA 3RRGA 1JQRA 1KNYA 3LQCB 2KN7A 4BWJA 7ICGA 2DR7A 2BCVA 1BPDA 4ECQA 4QZ8A 3OJSA 1SKSA 3KTQA 2JZBA 2ID1A 4QW9A 3SV4A 4IRCA 3MABA 3KHHA 4J9KA 1L5UA 1Y88A 2MUTA 4DSJA 1S0OA 1BPXA 4IQWA 1X2IA 4UD4A 1TK5A 2B21A 5J0UA 4EYHB 3HJ1A 2XY5A 5KFVA 4DOCA 4FHYA 4KLTA 1NZPA 3GIIA 2BCRA 2FLPA 3BQ2A 2ISOA 1ZQHA 4IR1A 3N4MB 4WC6A 1SKRA 4QWBA 8ICFA 3ISBA 4RQ3A 4F92B 2W9CB 3V7KA 2UVRA 3Q8QB 3ORYA 2BE3A 2BPGA 4F5RA 4YVZA 1MC8A 5BOMA 1UT8A 1Z00B 4RQ2A 2HHUA 4AT8A 1NK6A 3MGIA 4WC0A 3AQLA 5HMLA 3MR5A 3TAQA 2KZMA 4YR0A 4FHPA 5KG0A 1ZQGA 2M9NA 2GWSA 3PO4A 4M0AA 4QWAA 2J6UA 4MFAA 9ICWA 4ECTA 5KT3A 4TUSA 4JWNA 2ATLA 4X4UA 3RTVA 2FMSA 3ZD8A 1R8CA 9ICIA 8ICLA 4NKUA 1ZYQA 2PFQA 4I2CA 1XC9A 5L1IA 4C8OA 1QLNA 1K1QA 4FH5A 7ICMA 1ZQSA 8ICEA 3IM1A 3UXPA 4PHPA 3RJJA 4YP3A 4R8UB 4I2AA 4PGXA 1TAUA 9ICJA 4EEYA 5J2HA 1ZQNA 2ZJAA 2PFOA 8ICIA 1R8BA 4X4QA 5KTQA 4ED6A 5IINA 2J6TA 2BCQA 4JUZA 5J29A 4MEYA 1TAQA 3K4GA 4WC1A 1RXWA 2FMPA 4E0DA 2HVIA 4O3SA 1K1SA 1T8EA 1ZQOA 5DEDA 4K4IA 1BPBA 4QWCA 4JV1A 8ICQA 4F93B 1A77A 1T4GA 4M6WA 4I2FA 5KFBA 3PX6A 2BKEA 4XUSA 5L1JA 4B9MA 4O3NA 3JPQA 2F1JA 4J9QA 9ICXA 1S97A 9ICUA 1HUOA 8ICYA 7ICFA 3JPOA 1KTQA 4F91B 2AGQA 3NTUA 3T5KA 1XSLA 1NJXA 3RR8A 3C2LA 3QEAZ 2ZHBA 4DFKA 2BHNA 4PGYA 5DDMA 2W9CA 3TI0A 5HRIA 3AQKA 2HHWA 4KLDA 3GIKA 5DECA 3JPNA 1XS9D 1COOA 1Z00A 5KFUA 4DQIA 2IMWP 3L9DA 3BQ0A 2R8IA 1ZQQA 1UA0A 3PW2A 4P2HA 3UPSA 3E2EA 5KFAA 5HR9A 3UPQA 5KFXA 2HHQA 1ZETA 5DB6A 1NJZA 2VA3A 4I2DA 3Q8RB 4E7XA 3FYHA 4I27A 4RT2A 4FO6A 4RWQA 5EWFA 2PBEA 9ICPA 1JXEA 3H4BA 2O5AA 4DOAA 4RUCA 3RH5A 2ZTDA 3EWAA 5F9LA 4X4TA 3H39A 4EBCA 2KFZA 4YXJA 5DB9A 4UBBA 4RPYA 4RNMA 4FBTA 4XQ7A 5IIOA 2UVVA 2HHTA 3QZ7A 5TZVA 4QZFA 4Q43A 4RZRA 1MQ2A 3Q8MA 4I2GA 4R8UA 3H38A 4YMNA 8ICRA 3PY8A 3AU6A 1U49A 3MFHA 4QZHA 4WC5A 3HJ4A 2Y1IA 1ZQIA 1U4BA 2DR5A 3PMLA 2ZH4A 4RQ5A 4ED8A 5DG9A 3TFRA 4M9HA 1KSPA 4C8KA 4DQSA 2AU0A 5KT4A 5KFZA 4QZ9A 3MGHA 5CB1A 3GV7B 4AT9B 1QTMA 2XC9A 3TARA 5J0OA 2I9GA 9ICSA 3Q8PB 4ED7A 3QEBZ 3RAQA 4IR9A 3C18A 3OVSA 3MR3A 4DL2A 2VA2A 5IILA 1TVAA 1X9WA 1NKEA 4DQQA 2BPCA 2W9BB 1SL0A 4UB5A 4M2YA 3IHQB 1V4AA 1S10A 9ICQA 4XRHA 4K4HA 4I2EA 5HREA 1PX5A 5KFWA 5J0SA 2PFNA 1UEVA 4KITB 3GIJA 4O0IA 4J9RA 1U48A 4I2HA 1DK3A 4DSFA 3LWMA 2NRVA 3Q8LA 4NLKA 2Q0ZX 2R8GA 9ICKA 4RNOA 3H37A 4X4PA 3B0XA 4C8MA 2ZJ5A 5KFYA 4J9PA 4TURA 4KLSA 2XY6A 1KFSA 2DRBA 4I2JA 3PW5A 4NLNA 3B0YA 4WC7A 3RB4A 1D8LA 1JMSA 4EBDA 5DDYA 4B9LA 4EZ6A 2KTQA 4P4OA 5DQGA 1SKWA 4O3QA 8ICGA 4YD1A 4TUPA 1NK8A 2FLLA 3JYYA 4X4OA 3G6VA 5KFSA 4LZDA 4DSEA 4M6WB 4RNNA 4ECWA 3PNCA 1SL1A 3H8JA 5KG1A 1XO1A 3T5JA 3H3AA 2M2VA 4YD2A 1WCNA 4QW8A 4YMMA 4QZDA 3KHRA 3JPSA 1QSSA 9ICMA 7ICPA 5BOLA 4ZH4A 2BR0A 8ICZA 3WFOA 1NK0A 4KLOA 3WFSC 5KFQA 3SZ2A 1T7PA 5CHGA 3UXOA 4ELTA 4DL3A 5KG3A 5KT5A 4WC3A 2PFPA 3H8WA 5DLFA 4NLZA 4O3RA 1DOQA 5KT6A 3H4DA 2C2DA 5J0QA 1MIYA 4RQ4A 4DL6A 5J0PA 3AUOA 7ICIA 1JX4A 1R89A 2ZHAA 4WBZA 4AT9A 4IQUA 2DR8A 2VA8A 3NGDA 3PO5A 2W8LA 8ICSA 1CEZA 5HRLA 4HYKA 2AQ4A 3C21A 1VFGA 4IRDA 5L9XA 3RH6A 1L3TA 5J2DA 3ZDDA 3ETLA 1V9PA 3TQ1A 1S76D 1BVSA 1ZJNA 1L3UA 2DPJA 4DEZA 4FS1A 4DFMA 2W9BA 4EBEA 4DL5A 2UVUA 3GILA 1ZQFA 2O1PA 9ICBA 1QSLA 1L3SA 2H5XA 3OSPA 5J2FA 9ICTA 4MFFA 4KN7A 5KFIA 4ED1A 9ICEA 4RWPA 5IIJA 3HW8A 3PX0A 4J9OA 4F4ZA 4Q8EA 2V9WA 3HWTA 1ZQAA 5J2AA 1BNOA 3PW4A 3MBYA 5BPCA 1S9FA 3M8SA 5IIMA 5EOZA 4UB3A 4CCHA 4M47A 5KFJA 5DKWA 1ZQLA 2A1JB 1D8YA 5DBCA 1SZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V72 A;  2NRK A;  3V6K A;  1ZQV A;  5KFO A;  5J0T A;  5J2J A;  1DGS A;  1XWL A;  9ICR A;  5D49 A;  3T5L A;  4UBC A;  1NK5 A;  2FLN A;  4UAW A;  1TV9 A;  8ICP A;  2F1I A;  2DPI A;  1N56 A;  2HHX A;  2JEG A;  2R8K A;  3RH4 A;  1UA1 A;  5KG4 A;  2ASD A;  4M5D A;  4P4P A;  4FHW A;  1XSP A;  4NXZ A;  3V7J A;  1JAJ A;  5F2V O;  5DG8 A;  3WFP A;  4YR3 A;  2ASJ A;  7ICQ A;  1ZQX A;  2ZUC A;  4O5K A;  3OVB A;  2NRT A;  1MSW D;  4ECZ A;  1TFR A;  3G6Y A;  1MIW A;  4DSL A;  4F4K A;  1A76 A;  8ICV A;  4F5N A;  4R66 A;  4KLF A;  5J2K A;  4FHV A;  3M8R A;  4TQR A;  3EZ5 A;  3EPI A;  3V7L A;  3ZD9 A;  4ECU A;  4QZI A;  4ELU A;  4E8F A;  4F5P A;  5HHH A;  2BPF A;  4DL7 A;  4BXO B;  3RJI A;  2HVH A;  4FBU A;  4X4S A;  4DLE A;  4WCW A;  9ICL A;  1UET A;  3GDX A;  1LB2 B;  9ICA A;  3RJG A;  2AGO A;  1S0N A;  5KFF A;  5HRH A;  5HHI A;  5KFN A;  3BJY A;  4GC7 A;  4KLU A;  8ICO A;  4UQG A;  4Z6E A;  1B22 A;  1KRP A;  4IQV A;  3FDS A;  1YLQ A;  4XQ8 A;  2FMQ A;  4F4W A;  3OSN A;  1D9F A;  4I2I A;  4BGD A;  9ICH A;  4RQ6 A;  5J0R A;  4F50 A;  4F3O A;  4B9V A;  3SV3 A;  2XY7 A;  2XO7 A;  5D4B A;  1X9S A;  4ELV A;  1ZJM A;  2HHV A;  4YMO A;  1SL2 A;  7ICU A;  8ICJ A;  3C1Z A;  4O9M A;  8ICU A;  5DQI A;  3TAN A;  4DS4 A;  4B9U A;  4F8R A;  2ASL A;  4QZE A;  2BDP A;  4JV2 A;  1FA0 A;  3AQN A;  4RU9 A;  2JEJ A;  4ED3 A;  3ZDC A;  1TKD A;  8ICW A;  2ZTC A;  1ZQJ A;  1S77 D;  4RUA A;  4BDP A;  3C23 A;  8ICB A;  1ZQK A;  2A1J A;  3GV5 B;  2Q66 A;  4R63 A;  4M9L A;  1UT5 A;  1NJW A;  2OWO A;  3OHA A;  3UQ0 A;  4RWN A;  1CUK A;  5KFR A;  4RQ8 A;  4UAY A;  3KHL A;  1RPL A;  2C2R A;  1ZQB A;  4C8L A;  1NKB A;  1HJP A;  7ICJ A;  3LK9 A;  4Q44 A;  7ICO A;  3JZ0 A;  5KG2 A;  4G3I A;  2ZH8 A;  4B9N A;  5KT7 A;  3MR6 A;  3EPG A;  3ZDE A;  1MIV A;  2ZH3 A;  3JPR A;  3OVA A;  5DQH A;  2DRA A;  4YN4 A;  3HP6 A;  4ECY A;  2FPM A;  2UVW A;  2NRW A;  3HIY A;  5J2E A;  3K75 D;  4O3P A;  5CWR A;  8ICT A;  1C7Y A;  1WOT A;  4RWO A;  5KFD A;  1ZQW A;  4I29 A;  2ISP A;  3PR5 B;  4NM2 A;  1PZN A;  8ICM A;  3LDA A;  1JIH A;  3RB6 A;  3HT3 A;  3Q8S B;  1X9M A;  5C5J A;  3SYZ A;  4BXO A;  4NY8 A;  2IBK A;  5CP2 A;  4DS5 A;  4Z6C A;  9ICN A;  7ICS A;  3AQM A;  4B9S A;  2ZH6 A;  4X4V A;  3RJE A;  4S3N A;  4UB2 A;  2ZTE A;  2IA6 A;  4F2S A;  3PMN A;  4FS2 A;  2C28 A;  1BPY A;  4EZ9 A;  1DK2 A;  4IG8 A;  4MEX A;  4O5C A;  2C22 A;  2AJQ A;  7ICH A;  1U47 A;  2W8K A;  1HUZ A;  5IIK A;  7ICE A;  1ZQZ A;  4Z6D A;  1ZQM A;  4DSK A;  3PX4 A;  4EBJ A;  1L3V A;  1KEJ A;  2NRX A;  5J2C A;  4K4G A;  4QZG A;  4RT3 A;  4DLG A;  2BQR A;  4TUQ A;  2M2T A;  4J9S A;  3HX0 A;  5F9N A;  2MAX A;  3UQ2 A;  4ED0 A;  5HRG A;  4EBK A;  5KFP A;  1LV5 A;  4Q8F A;  2KZZ A;  5CA7 A;  1NKC A;  4M9J A;  5KG7 A;  4RPX A;  4PH5 A;  4PHD A;  5DGA A;  1T3N A;  2V4Q A;  7ICV A;  1Q78 A;  2NRZ A;  4ECV A;  3PR4 A;  9ICF A;  4AT7 A;  4DF4 A;  1VJ7 A;  5J2I A;  4PHE A;  5HRF A;  5L1K A;  3V6H A;  1KDH A;  5HC9 A;  2KZ3 A;  1NK4 A;  5KFT A;  3ISD A;  2R8J A;  4IRK A;  4DOB A;  5DBA A;  4F2R A;  1EXN A;  1BGX T;  4M9G A;  5KFC A;  4DQP A;  5JUM A;  3BQT A;  2M2W A;  1NK9 A;  4KLL A;  4DFJ A;  5KFL A;  2DR9 A;  2ZH1 A;  2XCA A;  3M9N B;  2W9M A;  4YG2 A;  4F5O A;  3QE9 Y;  4ECS A;  9ICO A;  2DFL A;  4UD5 A;  4XA5 A;  4PHA A;  3GV8 B;  4KN4 A;  5DG7 A;  1RZT A;  1IM4 A;  1OU5 A;  2ZH5 A;  5HRB A;  2R8H A;  4KMU A;  4UAZ A;  4M04 A;  1XU4 A;  5KFH A;  4KTQ A;  1UEU A;  1B43 A;  5DBB A;  4FHX A;  3MDA A;  2PI4 A;  1U45 A;  8ICX A;  1ARO P;  2FPL A;  4KLE A;  5J0X A;  3C2K A;  3EW9 A;  5J2G A;  3Q8K A;  4BWM A;  3OV7 A;  2P66 A;  4QZC A;  3RBD A;  4RQ7 A;  3M9M B;  4NM1 A;  4PPX A;  2IHN A;  1BNP A;  4MFC A;  3HPO A;  4LT6 A;  3MR2 A;  2RFF A;  5KG5 A;  4O3O A;  4MF8 A;  4JK1 A;  4QWD A;  4Z6F A;  4F4Y A;  4F4X A;  2VAN A;  3T3F A;  5DB8 A;  2F1H A;  4RPZ A;  3RBE A;  5KFE A;  1N48 A;  3PV8 A;  1Q79 A;  4X0A A;  4X5V A;  5DLG A;  5DGB A;  2ALZ A;  5HP4 A;  3MFI A;  1RXV A;  4J9N A;  8ICH A;  3THV A;  4P4M A;  4JV0 A;  4MF2 A;  4KLH A;  2ZUD A;  3RJK A;  4ECX A;  2BCS A;  4YXM A;  5EWG A;  1U9L A;  4GXJ A;  5CJ7 A;  3GFK B;  3NYB A;  4EP7 A;  3C1Y A;  3BDP A;  3T5H A;  3WFR E;  2AQ0 A;  4I28 A;  3GQC A;  2DVI A;  2XGP A;  4DWI A;  2RDJ A;  4ECR A;  1ZQP A;  2ZUB A;  4KLM A;  5J0W A;  3TFS A;  2ZH2 A;  3ZDA A;  3ZDB A;  5HRK A;  1ZQE A;  3BQ1 A;  5KT2 A;  3OGU A;  1ZQD A;  3C5F A;  1NJY A;  5III A;  2ZH9 A;  4YQW A;  4ATB B;  1S0M A;  4YFK A;  4KLG A;  3EYZ A;  5KFG A;  3OUY B;  5HRD A;  1ZQR A;  1Z3E B;  3MDC A;  4I2B A;  4KLQ A;  4E80 A;  4GLX A;  1D9D A;  4UB4 A;  3OJU A;  5KFK A;  4RQ1 A;  4DF8 A;  2C2E A;  3N97 B;  2RDI A;  3AU2 A;  8ICK A;  5J0Y A;  4J9M A;  4ED2 A;  3PW7 A;  1MQ3 A;  3RJF A;  2FPK A;  1TK0 A;  4LVS A;  4NKT A;  4X0B A;  4NLG A;  2PXI A;  4J9L A;  4F5Q A;  5EWE A;  1JN3 A;  1NOM A;  4R64 A;  1IXR A;  5J2B A;  5HNK A;  3H8S A;  3LWL A;  3WFQ E;  2KFN A;  7ICN A;  4PGQ A;  9ICG A;  1RYR A;  2BQU A;  2JZB B;  4GXI A;  2P6R A;  3TAP A;  2MUT B;  1ZQY A;  4QZB A;  1KLN A;  3RR7 A;  2V4R A;  4AT7 B;  2ZJ8 A;  3PVX A;  3RB3 A;  4X4R A;  2BCU A;  4KLI A;  2J6S A;  3RJH A;  2KP7 A;  1R8A A;  1XSN A;  4C8N A;  2ZH7 A;  4O5E A;  2BQ3 A;  1ZQU A;  4EYI B;  4KLJ A;  2HW3 A;  3C5G A;  1F5A A;  1TFY A;  4DQR A;  1BPE A;  5HMM A;  3UXN A;  1TFW A;  5CR0 A;  5DB7 A;  4LZG A;  7ICK A;  5KG6 A;  4FH3 A;  2XCP A;  3RRH A;  7ICR A;  3G6X A;  3RAX A;  1ZQC A;  4QZA A;  3H40 A;  4GC6 A;  1NK7 A;  5KFM A;  3M9O B;  1KFD A;  4IQT A;  1H38 A;  4TQS A;  4DFP A;  7ICT A;  3KHG A;  2XGQ A;  4B9T A;  4AT8 B;  4YR2 A;  9ICC A;  1RYS A;  2JEF A;  3OHB A;  2HHS A;  4DSI A;  4WC4 A;  2AGP A;  1ZQT A;  4GXK A;  2WTF A;  3PW0 A;  3C66 A;  2W9A A;  4WC2 A;  2Y1J A;  2I1Q A;  4ATB A;  4DO9 A;  4QWE A;  2M2U A;  4X4N A;  4UB1 A;  5L1L A;  1WCL A;  3V6J A;  1KFT A;  7ICL A;  3RB0 A;  3GIM A;  3OUY A;  4Q45 A;  4R65 A;  3QZ8 A;  8ICA A;  3JPT A;  1TK8 A;  1NO5 A;  2PI5 A;  4M9N A;  8ICC A;  1JXL A;  3ISC A;  9ICV A;  4YCX A;  2JEI A;  2HHP A;  2IHM A;  3SI8 A;  4JWM A;  5D46 A;  4WBY A;  2LYH A;  4DL4 A;  1BPZ A;  4RQ0 A;  2P6U A;  3JPP A;  2BGW A;  1QSY A;  1S0V A;  8ICN A;  3H7I A;  3C2M A;  3RRG A;  1JQR A;  1KNY A;  3LQC B;  2KN7 A;  4BWJ A;  7ICG A;  2DR7 A;  2BCV A;  1BPD A;  4ECQ A;  4QZ8 A;  3OJS A;  1SKS A;  3KTQ A;  2JZB A;  2ID1 A;  4QW9 A;  3SV4 A;  4IRC A;  3MAB A;  3KHH A;  4J9K A;  1L5U A;  1Y88 A;  2MUT A;  4DSJ A;  1S0O A;  1BPX A;  4IQW A;  1X2I A;  4UD4 A;  1TK5 A;  2B21 A;  5J0U A;  4EYH B;  3HJ1 A;  2XY5 A;  5KFV A;  4DOC A;  4FHY A;  4KLT A;  1NZP A;  3GII A;  2BCR A;  2FLP A;  3BQ2 A;  2ISO A;  1ZQH A;  4IR1 A;  3N4M B;  4WC6 A;  1SKR A;  4QWB A;  8ICF A;  3ISB A;  4RQ3 A;  4F92 B;  2W9C B;  3V7K A;  2UVR A;  3Q8Q B;  3ORY A;  2BE3 A;  2BPG A;  4F5R A;  4YVZ A;  1MC8 A;  5BOM A;  1UT8 A;  1Z00 B;  4RQ2 A;  2HHU A;  4AT8 A;  1NK6 A;  3MGI A;  4WC0 A;  3AQL A;  5HML A;  3MR5 A;  3TAQ A;  2KZM A;  4YR0 A;  4FHP A;  5KG0 A;  1ZQG A;  2M9N A;  2GWS A;  3PO4 A;  4M0A A;  4QWA A;  2J6U A;  4MFA A;  9ICW A;  4ECT A;  5KT3 A;  4TUS A;  4JWN A;  2ATL A;  4X4U A;  3RTV A;  2FMS A;  3ZD8 A;  1R8C A;  9ICI A;  8ICL A;  4NKU A;  1ZYQ A;  2PFQ A;  4I2C A;  1XC9 A;  5L1I A;  4C8O A;  1QLN A;  1K1Q A;  4FH5 A;  7ICM A;  1ZQS A;  8ICE A;  3IM1 A;  3UXP A;  4PHP A;  3RJJ A;  4YP3 A;  4R8U B;  4I2A A;  4PGX A;  1TAU A;  9ICJ A;  4EEY A;  5J2H A;  1ZQN A;  2ZJA A;  2PFO A;  8ICI A;  1R8B A;  4X4Q A;  5KTQ A;  4ED6 A;  5IIN A;  2J6T A;  2BCQ A;  4JUZ A;  5J29 A;  4MEY A;  1TAQ A;  3K4G A;  4WC1 A;  1RXW A;  2FMP A;  4E0D A;  2HVI A;  4O3S A;  1K1S A;  1T8E A;  1ZQO A;  5DED A;  4K4I A;  1BPB A;  4QWC A;  4JV1 A;  8ICQ A;  4F93 B;  1A77 A;  1T4G A;  4M6W A;  4I2F A;  5KFB A;  3PX6 A;  2BKE A;  4XUS A;  5L1J A;  4B9M A;  4O3N A;  3JPQ A;  2F1J A;  4J9Q A;  9ICX A;  1S97 A;  9ICU A;  1HUO A;  8ICY A;  7ICF A;  3JPO A;  1KTQ A;  4F91 B;  2AGQ A;  3NTU A;  3T5K A;  1XSL A;  1NJX A;  3RR8 A;  3C2L A;  3QEA Z;  2ZHB A;  4DFK A;  2BHN A;  4PGY A;  5DDM A;  2W9C A;  3TI0 A;  5HRI A;  3AQK A;  2HHW A;  4KLD A;  3GIK A;  5DEC A;  3JPN A;  1XS9 D;  1COO A;  1Z00 A;  5KFU A;  4DQI A;  2IMW P;  3L9D A;  3BQ0 A;  2R8I A;  1ZQQ A;  1UA0 A;  3PW2 A;  4P2H A;  3UPS A;  3E2E A;  5KFA A;  5HR9 A;  3UPQ A;  5KFX A;  2HHQ A;  1ZET A;  5DB6 A;  1NJZ A;  2VA3 A;  4I2D A;  3Q8R B;  4E7X A;  3FYH A;  4I27 A;  4RT2 A;  4FO6 A;  4RWQ A;  5EWF A;  2PBE A;  9ICP A;  1JXE A;  3H4B A;  2O5A A;  4DOA A;  4RUC A;  3RH5 A;  2ZTD A;  3EWA A;  5F9L A;  4X4T A;  3H39 A;  4EBC A;  2KFZ A;  4YXJ A;  5DB9 A;  4UBB A;  4RPY A;  4RNM A;  4FBT A;  4XQ7 A;  5IIO A;  2UVV A;  2HHT A;  3QZ7 A;  5TZV A;  4QZF A;  4Q43 A;  4RZR A;  1MQ2 A;  3Q8M A;  4I2G A;  4R8U A;  3H38 A;  4YMN A;  8ICR A;  3PY8 A;  3AU6 A;  1U49 A;  3MFH A;  4QZH A;  4WC5 A;  3HJ4 A;  2Y1I A;  1ZQI A;  1U4B A;  2DR5 A;  3PML A;  2ZH4 A;  4RQ5 A;  4ED8 A;  5DG9 A;  3TFR A;  4M9H A;  1KSP A;  4C8K A;  4DQS A;  2AU0 A;  5KT4 A;  5KFZ A;  4QZ9 A;  3MGH A;  5CB1 A;  3GV7 B;  4AT9 B;  1QTM A;  2XC9 A;  3TAR A;  5J0O A;  2I9G A;  9ICS A;  3Q8P B;  4ED7 A;  3QEB Z;  3RAQ A;  4IR9 A;  3C18 A;  3OVS A;  3MR3 A;  4DL2 A;  2VA2 A;  5IIL A;  1TVA A;  1X9W A;  1NKE A;  4DQQ A;  2BPC A;  2W9B B;  1SL0 A;  4UB5 A;  4M2Y A;  3IHQ B;  1V4A A;  1S10 A;  9ICQ A;  4XRH A;  4K4H A;  4I2E A;  5HRE A;  1PX5 A;  5KFW A;  5J0S A;  2PFN A;  1UEV A;  4KIT B;  3GIJ A;  4O0I A;  4J9R A;  1U48 A;  4I2H A;  1DK3 A;  4DSF A;  3LWM A;  2NRV A;  3Q8L A;  4NLK A;  2Q0Z X;  2R8G A;  9ICK A;  4RNO A;  3H37 A;  4X4P A;  3B0X A;  4C8M A;  2ZJ5 A;  5KFY A;  4J9P A;  4TUR A;  4KLS A;  2XY6 A;  1KFS A;  2DRB A;  4I2J A;  3PW5 A;  4NLN A;  3B0Y A;  4WC7 A;  3RB4 A;  1D8L A;  1JMS A;  4EBD A;  5DDY A;  4B9L A;  4EZ6 A;  2KTQ A;  4P4O A;  5DQG A;  1SKW A;  4O3Q A;  8ICG A;  4YD1 A;  4TUP A;  1NK8 A;  2FLL A;  3JYY A;  4X4O A;  3G6V A;  5KFS A;  4LZD A;  4DSE A;  4M6W B;  4RNN A;  4ECW A;  3PNC A;  1SL1 A;  3H8J A;  5KG1 A;  1XO1 A;  3T5J A;  3H3A A;  2M2V A;  4YD2 A;  1WCN A;  4QW8 A;  4YMM A;  4QZD A;  3KHR A;  3JPS A;  1QSS A;  9ICM A;  7ICP A;  5BOL A;  4ZH4 A;  2BR0 A;  8ICZ A;  3WFO A;  1NK0 A;  4KLO A;  3WFS C;  5KFQ A;  3SZ2 A;  1T7P A;  5CHG A;  3UXO A;  4ELT A;  4DL3 A;  5KG3 A;  5KT5 A;  4WC3 A;  2PFP A;  3H8W A;  5DLF A;  4NLZ A;  4O3R A;  1DOQ A;  5KT6 A;  3H4D A;  2C2D A;  5J0Q A;  1MIY A;  4RQ4 A;  4DL6 A;  5J0P A;  3AUO A;  7ICI A;  1JX4 A;  1R89 A;  2ZHA A;  4WBZ A;  4AT9 A;  4IQU A;  2DR8 A;  2VA8 A;  3NGD A;  3PO5 A;  2W8L A;  8ICS A;  1CEZ A;  5HRL A;  4HYK A;  2AQ4 A;  3C21 A;  1VFG A;  4IRD A;  5L9X A;  3RH6 A;  1L3T A;  5J2D A;  3ZDD A;  3ETL A;  1V9P A;  3TQ1 A;  1S76 D;  1BVS A;  1ZJN A;  1L3U A;  2DPJ A;  4DEZ A;  4FS1 A;  4DFM A;  2W9B A;  4EBE A;  4DL5 A;  2UVU A;  3GIL A;  1ZQF A;  2O1P A;  9ICB A;  1QSL A;  1L3S A;  2H5X A;  3OSP A;  5J2F A;  9ICT A;  4MFF A;  4KN7 A;  5KFI A;  4ED1 A;  9ICE A;  4RWP A;  5IIJ A;  3HW8 A;  3PX0 A;  4J9O A;  4F4Z A;  4Q8E A;  2V9W A;  3HWT A;  1ZQA A;  5J2A A;  1BNO A;  3PW4 A;  3MBY A;  5BPC A;  1S9F A;  3M8S A;  5IIM A;  5EOZ A;  4UB3 A;  4CCH A;  4M47 A;  5KFJ A;  5DKW A;  1ZQL A;  2A1J B;  1D8Y A;  5DBC A;  1SZP A; 
#chains in the Genus database with same CATH topology
 1ZXI A;  3B9J A;  9ICR A;  3PSP A;  3T5L A;  2QLT A;  2DF4 B;  4UAW A;  2F1I A;  2OH2 A;  2HHX A;  3EF2 A;  5KG4 A;  4P4P A;  5JTG A;  4C7Y A;  3FC4 A;  5DG8 A;  3QU7 A;  4YR3 A;  1ZQX A;  2NRT A;  1MSW D;  2JH1 A;  1MIW A;  4KLF A;  3EPI A;  4ECU A;  4DL7 A;  4BXO B;  5B3P A;  4FBU A;  4DLE A;  5CRX A;  2YB1 A;  9ICL A;  3GDX A;  1LB2 B;  5KFF A;  5HHI A;  2HMX A;  3BJY A;  2KEY A;  3M6K A;  4IQV A;  3FDS A;  4XQ8 A;  2FMQ A;  5D4B A;  3NS1 A;  4ELV A;  1SL2 A;  2ZG6 A;  5DQI A;  4B9U A;  4JV2 A;  4QZE A;  2JEJ A;  5KNI A;  2ZTC A;  5AHX A;  3C23 A;  1PVR A;  4R63 A;  4M9L A;  4LEV A;  3UQ0 A;  5KFR A;  3JZ0 A;  4B9N A;  3EPG A;  3ZDE A;  3JPR A;  2DRA A;  4BUG A;  3SD7 A;  4ECY A;  2UVW A;  2Q4T A;  3K75 D;  2BBH A;  1ZQW A;  1SV0 A;  4I29 A;  5ALM A;  2ISP A;  1PZN A;  3Q8S B;  1X9M A;  3AQM A;  2EWR A;  3I1Y A;  5AIB A;  2C22 A;  7ICE A;  1KEJ A;  2L5Y A;  3QUC A;  3FAH A;  4TUQ A;  2MAX A;  4EBK A;  1LV5 A;  5CA7 A;  5ALQ A;  4RPX A;  5AI0 A;  4PHD A;  3PR4 A;  1X9X A;  4DF4 A;  4PHE A;  3RF9 A;  1HIW A;  4IRK A;  2ES6 A;  2AHO B;  4M9G A;  1BGX T;  5KFC A;  2KG5 A;  3BQT A;  3AN1 A;  4KLL A;  5KFL A;  3I76 A;  2XCA A;  2ZH1 A;  3QE9 Y;  4ECS A;  4XA5 A;  4ACO A;  2DGZ A;  5DG7 A;  1IM4 A;  4NWI A;  2PMZ F;  4FFD A;  4KTQ A;  1UEU A;  5ALY A;  5DBB A;  4FHX A;  1U45 A;  1ARO P;  2FPL A;  4KLE A;  3EW9 A;  3OV7 A;  3GU3 A;  4QZC A;  2G08 A;  4PPX A;  4MFC A;  4QWD A;  1Q79 A;  4RPZ A;  2F1H A;  4X0A A;  5KFE A;  3ERC C;  8ICH A;  2OM6 A;  4JV0 A;  4MF2 A;  1RQN A;  4YXM A;  1SV4 A;  3UMB A;  1SWW A;  5CJ7 A;  3D2N A;  2H3I A;  2EZX A;  3BDP A;  3T5H A;  1N63 A;  2DVI A;  2KMD A;  1Z4N A;  5AIC A;  3OGU A;  1ZQD A;  4P0Q B;  5III A;  3NVY A;  3HJE A;  4YQW A;  4ATB B;  2PKE A;  2IOF A;  3EYZ A;  5KFG A;  2JRZ A;  1Z1B A;  5HRD A;  2DQN B;  3MDC A;  4KLQ A;  1X42 A;  2Y0S F;  1D9D A;  5KFK A;  2C2E A;  3N97 B;  5J0Y A;  5B3Q A;  4NLG A;  4J9L A;  4F5Q A;  2PMZ C;  2KSO A;  3H8S A;  3LWL A;  4OCZ A;  2KHV A;  7ICN A;  2JZB B;  4GXI A;  4QZB A;  3ICX A;  2V4R A;  2ZJ8 A;  1X6J A;  3RB3 A;  1IIP A;  2KP7 A;  1R8A A;  1XSN A;  2ZH7 A;  4OJ5 A;  4DQR A;  2XVT A;  5HMM A;  3UXN A;  5DB7 A;  2KKV A;  5KG6 A;  2DL0 A;  2XCP A;  3WK5 A;  3H40 A;  2Y9U A;  1KFD A;  4IQT A;  4TQS A;  4DFP A;  3PSI A;  1RYS A;  4KX3 A;  2G06 A;  4KB6 A;  3PW0 A;  4WC2 A;  3F5A A;  3KKA C;  5J8Y C;  5TIS U;  2E8P A;  4K99 A;  4C80 A;  2BZF A;  2HDO A;  2E1F A;  2JMG A;  1JI7 A;  1TK8 A;  4M9N A;  2A1A A;  1JXL A;  3ISC A;  9ICV A;  1ZD3 A;  4UW9 A;  2IHM A;  4O6A A;  5D46 A;  3NAS A;  1QCK A;  2LYH A;  1BPZ A;  2FE9 A;  1S0V A;  3JPP A;  2BGW A;  4FHV A;  5G5H A;  4C7Z A;  3LQC B;  2BCV A;  1BPD A;  4ECQ A;  4QZ8 A;  3OJS A;  3KTQ A;  4IRC A;  2B0C A;  3MAB A;  2KKP A;  1L7N A;  4UD4 A;  4OAI Z;  5KFV A;  4FHY A;  4Y2J A;  2BCR A;  1ZQH A;  4IR1 A;  3QU4 A;  8ICF A;  4LJX A;  1PVQ A;  3NVV A;  1A6S A;  3PSF A;  5BOM A;  1UT8 A;  2KJ9 A;  1Z00 B;  4AT8 A;  1NK6 A;  5HML A;  4M0A A;  2J6U A;  4ECT A;  4TUS A;  4P0P A;  2ATL A;  4XJE A;  2KJ8 A;  2FMS A;  1R8C A;  1ZYQ A;  2OXO A;  4NXT A;  3C28 A;  7ICM A;  2D6F C;  8ICE A;  3IM1 A;  3PZP A;  4PHP A;  4R8U B;  5ALL A;  3SEN A;  5J2H A;  3D2Q A;  3KZI U;  1R8B A;  1PVP A;  1MN8 A;  2BCQ A;  4WC1 A;  1TAQ A;  1RXW A;  1T8E A;  1BPB A;  4I2F A;  2F2A B;  2BKE A;  2AH5 A;  2NRK A;  8ICY A;  1NNL A;  7ICF A;  9ICM A;  4F91 B;  3NTU A;  2F76 X;  2W9C A;  5ALT A;  1PK1 B;  4RQM A;  4NL9 A;  2JXJ A;  3UPS A;  3IDW A;  1P7D A;  2HHQ A;  5DB6 A;  2ZIX B;  3Q8R B;  3FYH A;  4RT2 A;  9ICP A;  1JXE A;  1B4F A;  4DOA A;  5F9L A;  3H39 A;  2KFZ A;  4UBB A;  3QZ7 A;  4QZF A;  1MQ2 A;  3Q8M A;  3MFH A;  4Y2R A;  5ALR A;  4QZH A;  1VJ5 A;  2DR5 A;  2ZH4 A;  1KSP A;  4DQS A;  5KT4 A;  5KFZ A;  4QZ9 A;  5CB1 A;  3GV7 B;  4AT9 B;  2K8C B;  3NVO A;  4IR9 A;  3WKC A;  3SEI A;  1B0X A;  2KE7 A;  2VA2 A;  1S8O A;  4UB5 A;  1SXD A;  1PX5 A;  5HRE A;  3D2S A;  2PFN A;  3KBB A;  1UEV A;  4I2H A;  3LWM A;  2NRV A;  5AM2 A;  4J9P A;  5KFY A;  2XY6 A;  4C4R A;  2QB0 A;  2GA9 D;  3PW5 A;  4CF3 A;  1SKW A;  4YD1 A;  2VJ4 A;  2G09 A;  3NVW A;  5JU5 A;  1NK8 A;  4X4O A;  3G6V A;  4LZD A;  4M6W B;  5KG1 A;  1XO1 A;  4YD2 A;  4QZD A;  4YMM A;  2LHT A;  7ICP A;  8ICZ A;  2EZZ A;  4ZH4 A;  2BR0 A;  2JV3 A;  1MA7 A;  2KJ5 A;  3HIL A;  1WWU A;  1WG8 A;  4WC3 A;  3ER9 B;  3WK7 A;  4NV0 A;  4O69 A;  4RQ4 A;  4QIW F;  3AUO A;  7ICI A;  3WKD A;  5HRL A;  2W8L A;  1N5W A;  3C21 A;  1SXE A;  3BS7 A;  4HAI A;  1V9P A;  2G5H B;  2E5S A;  1BVS A;  1L3U A;  4DEZ A;  5EE0 A;  2UVU A;  1L3S A;  5J2F A;  9ICT A;  4ED1 A;  2YMM A;  3FM9 A;  9ICE A;  5IIJ A;  5AKG A;  4J9O A;  2KK0 A;  1L7M A;  5A0L A;  3AQE A;  3ZI4 A;  1J2M A;  4UB3 A;  1ZQL A;  5J0T A;  5J2J A;  8ICP A;  4UB8 U;  2JEG A;  4OJL A;  3RH4 A;  2JGA A;  4M5D A;  2YY6 A;  1XSP A;  3K1R B;  3WFP A;  2LKY A;  2ZUC A;  4O5K A;  3OVB A;  1VDV A;  1TFR A;  1A76 A;  5J2K A;  4GIB A;  3V7L A;  3ZD9 A;  2EZY A;  4QIW C;  4F5P A;  4X4S A;  1A0P A;  3LVW A;  5AKK A;  1ZD2 P;  3RJG A;  2AGO A;  2PBE A;  4KLU A;  4ZOH C;  4UQG A;  1KRP A;  1YLQ A;  4F4W A;  2A3V A;  9ICH A;  4F50 A;  3KFU F;  4B9V A;  2HHV A;  7ICU A;  4OJ6 A;  3C1Z A;  8ICU A;  3TAN A;  1X6I A;  4F8R A;  2BDP A;  1S77 D;  4RUA A;  8ICB A;  2A1J A;  2EAP A;  1KBU A;  4O3M A;  2Q66 A;  1NJW A;  4RQ8 A;  4UAY A;  1ZQB A;  2WB1 F;  1RPL A;  4C0Z A;  1HJP A;  7ICO A;  4Q44 A;  3MR6 A;  3I28 A;  3OVA A;  4YN4 A;  3HP6 A;  1URJ A;  2FPM A;  2EDU A;  5J2E A;  4O3P A;  5AK4 A;  1WOT A;  3PR5 B;  4NM2 A;  5D61 A;  3LDA A;  3SYZ A;  2CXY A;  4X4V A;  5CP2 A;  7ICS A;  4UB2 A;  1DK2 A;  4EZ9 A;  4EEK A;  4O5C A;  7ICH A;  1HUZ A;  5IIK A;  2NRX A;  4K4G A;  4QZG A;  1VLB A;  4RT3 A;  2BQR A;  4ED0 A;  4NLB A;  1N5X A;  1T3N A;  5DGA A;  2NRZ A;  2BDU A;  3AEV A;  4AT7 A;  1VJ7 A;  1KDH A;  3V6H A;  2KZ3 A;  3ISD A;  2D8C A;  2K8A A;  2K60 A;  3ALR A;  1LKY A;  2ESE A;  2KVC A;  2DR9 A;  2W9M A;  9ICO A;  2WB1 C;  4UD5 A;  2DFL A;  4KN4 A;  4G9B A;  5AKE A;  3MDA A;  2PI4 A;  5ALN A;  2LM4 A;  1JUD A;  2KSO B;  3RBD A;  4RQ7 A;  3MR2 A;  2RFF A;  3RBE A;  2ZHB A;  3F5E A;  2VAN A;  1N48 A;  2HBJ A;  4WQK A;  1PUZ A;  4X5V A;  4EEB A;  1RXV A;  3THV A;  4P4M A;  4KLH A;  2ZUD A;  5ALX A;  3H0M B;  2WF6 A;  3H0L B;  2W55 A;  3HRD D;  1T94 A;  4EP7 A;  5ALV A;  4DWI A;  2RDJ A;  2HN2 A;  5J0W A;  3TFS A;  2ZH2 A;  5ALU A;  4LEW A;  3BQ1 A;  2ZH9 A;  2DUY A;  2K8B B;  2G5I B;  4UB6 U;  1Z3E B;  2KIV A;  2R18 A;  3N7R C;  4E80 A;  3UMG A;  4USA A;  4RQ1 A;  2RDI A;  4ED2 A;  3RJF A;  4LVS A;  1TK0 A;  4NKT A;  5CEH A;  1Z19 A;  1JN3 A;  1NOM A;  5HNK A;  3F2D A;  4PGQ A;  2ZIU A;  1RYR A;  2P6R A;  3TAP A;  3HKZ C;  1ZQY A;  4X4R A;  4OO1 J;  3PVX A;  1QQ5 A;  4KLI A;  4EYI B;  1TFW A;  1ZRN A;  2LYA A;  4NXV A;  3G6X A;  3RAX A;  1SB3 C;  4GC6 A;  5KFM A;  3M9O B;  2I6X A;  5GTI U;  4AT8 B;  3OHB A;  1OUQ A;  4DSI A;  5F3X B;  4DO9 A;  4QWE A;  1PK3 A;  2YQE A;  4UB1 A;  1WCL A;  4P0P B;  5D62 A;  7ICL A;  1O03 A;  4R65 A;  5KAI U;  2K4P A;  2G07 A;  2PI5 A;  3TAD C;  2G0A A;  2HHP A;  4JWM A;  4DL4 A;  2P6U A;  1QSY A;  8ICN A;  3H7I A;  3C2M A;  4BWJ A;  4J9K A;  1L5U A;  1Y88 A;  4F72 A;  4DSJ A;  4OD0 A;  1TK5 A;  5J0U A;  2F3N A;  1NZP A;  5K4L A;  1SKR A;  3VCB A;  3ISB A;  4F92 B;  2W9C B;  2UVR A;  4AYB F;  2BPG A;  4F5R A;  3L5K A;  4WC0 A;  3CP8 A;  5AKI A;  4YR0 A;  3DEE A;  4QWA A;  4MFA A;  9ICW A;  3JCF A;  5KT3 A;  4X4U A;  3ZD8 A;  9ICI A;  3WK6 A;  8ICL A;  2PFQ A;  4I2C A;  1QLN A;  1ZQS A;  4EEN A;  4I2A A;  2LPE A;  4EEY A;  4DFD A;  3KOO A;  1K5O A;  2W54 A;  2WFA A;  4X4Q A;  2J6T A;  3CYM A;  1K1S A;  1ZQO A;  3S6J A;  1CI4 A;  4K4I A;  4JV1 A;  1UPH A;  4B9M A;  4K9B A;  2F1J A;  9ICU A;  2YML A;  2AGQ A;  3T5K A;  3C2L A;  5DDM A;  3TI0 A;  3AQK A;  2HHW A;  4KLD A;  3IP4 B;  3JPN A;  3N7S C;  1XS9 D;  4FO1 A;  4AYB C;  3E58 A;  3L9D A;  4WH5 A;  1J2N A;  1UA0 A;  3OWG A;  2QB0 B;  2IHO A;  5KFA A;  3UPQ A;  1ZET A;  1FFV A;  4KMO B;  5AK3 A;  5EWF A;  5G5G A;  2ZTD A;  4YXJ A;  4RNM A;  2UVV A;  3UMC A;  5TZV A;  4I2G A;  3PY8 A;  1U49 A;  4OJO A;  4CF5 A;  3HJ4 A;  2I5H A;  2Y1I A;  1U4B A;  4C8K A;  4US9 A;  3MGH A;  1QTM A;  3RAQ A;  3QEB Z;  3C18 A;  3OVS A;  1GPJ A;  1TVA A;  4M2Y A;  3IHQ B;  1V4A A;  3SMV A;  4XRH A;  2Y0S C;  4KIT B;  3GIJ A;  1U48 A;  4K9A A;  4U6P A;  2KIC A;  4C8M A;  4KLS A;  2DRB A;  2F8K A;  5DDY A;  4B9L A;  1TE2 A;  4ECW A;  4RNN A;  3H8J A;  4PZN A;  3H3A A;  4QW8 A;  3WFO A;  5AI8 A;  1KKX A;  2GOL A;  5BOL A;  3F2B A;  4KLO A;  5KFQ A;  3SZ2 A;  5CHG A;  3UXO A;  4ELT A;  5KG3 A;  2PFP A;  3F53 A;  3H8W A;  5DLF A;  4C4S A;  4NLZ A;  4O3R A;  1FFU A;  3H4D A;  5CHE A;  3NKU A;  2IOH A;  3NRZ A;  5ALW A;  2FJ6 A;  4EED A;  4WBZ A;  4IQU A;  1WYG A;  8ICS A;  2OCE A;  4I0U A;  2AQ4 A;  1FO4 A;  5L9X A;  3RH6 A;  3ZDD A;  1ZJN A;  2DPJ A;  4DL5 A;  1ZQF A;  2H5X A;  2VIX A;  4MFF A;  1OXJ A;  3PX0 A;  4F4Z A;  4Q8E A;  5J2A A;  5AM0 A;  3PW4 A;  3MBY A;  4UAT A;  2KIW A;  5EOZ A;  2A1J B;  1D8Y A;  5DBC A;  1SZP A;  1ZQV A;  5KFO A;  1DGS A;  1XWL A;  5AKY A;  5D49 A;  1NK5 A;  1TV9 A;  1N56 A;  3BS5 A;  2ASD A;  4AP9 A;  4NXZ A;  3V7J A;  5F2V O;  2ASJ A;  4ECZ A;  4F4K A;  8ICV A;  3M8R A;  3EZ5 A;  1Q3V A;  5B66 U;  3SAF A;  2HOF A;  4ELU A;  2WF9 A;  5HHH A;  2K89 A;  3WK8 A;  2ZIV A;  1AQ6 A;  2OYY A;  3R9K A;  5HR6 A;  4JLX A;  5ALZ A;  5HRH A;  4GC7 A;  1B22 A;  4Z6E A;  5E79 U;  1D9F A;  3OSN A;  4I2I A;  2K4E A;  4BGD A;  5J0R A;  2DKX A;  4F3O A;  1X9S A;  8ICJ A;  4O9M A;  4DS4 A;  1F44 A;  1L7P A;  1FA0 A;  4RU9 A;  4ED3 A;  3ZDC A;  1ZD5 A;  1ZQJ A;  1ZQK A;  3K7D A;  3WKB A;  3GV5 B;  2OWO A;  4PZO A;  4RWN A;  3KHL A;  4C8L A;  1LKY B;  7ICJ A;  5KG2 A;  2LBO A;  1CRX A;  2ZH8 A;  5DQH A;  3NWI A;  5CFS A;  1COK A;  3HIY A;  5JTI A;  1Q46 A;  2KHQ A;  5CWR A;  1C7Y A;  4RWO A;  2KVS A;  2CN1 A;  3CK6 A;  2E8N A;  8ICM A;  2YMQ A;  1JIH A;  3RB6 A;  2WAQ F;  9ICN A;  4K8V A;  1M6Y A;  4DS5 A;  4Z6C A;  4B9S A;  3RJE A;  2A19 A;  2CPR A;  2Y9T A;  4S3N A;  4F2S A;  3PMN A;  1BPY A;  2W8K A;  3QUQ A;  5AKH A;  2W7P A;  3PX4 A;  1L3V A;  4C4T A;  2M2T A;  4J9S A;  3HX0 A;  2EAO A;  2E1E A;  1IV8 A;  4Q8F A;  1UHU A;  3CNH A;  3L4P A;  1Q3U A;  1NKC A;  5KG7 A;  7ICV A;  2V4Q A;  4LEZ A;  1JRO A;  9ICF A;  5J2I A;  5HRF A;  1NK4 A;  2HBL A;  5ALK A;  4DOB A;  5DBA A;  4F2R A;  1EXN A;  1ZRM A;  4DQP A;  5EE9 A;  5JUM A;  2QAR A;  4YG2 A;  4F5O A;  1KW4 A;  1RZT A;  2ZH5 A;  1OU5 A;  4KMU A;  4UAZ A;  4M04 A;  5KFH A;  1B43 A;  2ODG A;  4QNL A;  8ICX A;  3PHZ A;  2RRD A;  5B5E U;  5J0X A;  2OEH A;  4BWM A;  3IV6 A;  2ZIU B;  4NM1 A;  4NLC A;  1BNP A;  5KG5 A;  1ZQ1 C;  4O3O A;  4JK1 A;  4F4Y A;  4X4N A;  2WAQ C;  5DB8 A;  2B4V A;  1SV0 C;  5DGB A;  1NZB A;  2ALZ A;  5HP4 A;  3MFI A;  4J9N A;  5KAF U;  4OJP A;  2BCS A;  5EWG A;  1T3Q A;  3ONN A;  4GXJ A;  3KKA A;  5J8Y A;  3SAG A;  4PJ0 U;  5AM4 A;  4I28 A;  3GQC A;  2XIC A;  1L8L A;  4ECR A;  4KLM A;  3ZDA A;  1ZQE A;  3C5F A;  5ALI A;  1NJY A;  1S0M A;  4K98 A;  4FZM A;  4KLG A;  1ECW A;  4UB4 A;  3IN5 A;  4DF8 A;  3AU2 A;  8ICK A;  5AI9 A;  1MQ3 A;  4X0B A;  2PXI A;  5EWE A;  4R64 A;  4K97 A;  1IXR A;  4N7R A;  2KFN A;  9ICG A;  5AKJ A;  2XI9 A;  3RR7 A;  1RYU A;  2YTU A;  2YMP A;  3SQI A;  2BCU A;  2DWQ A;  2BQ3 A;  3C5G A;  1BPE A;  2HI0 A;  2W03 A;  5AM5 A;  3O0F A;  4LZG A;  4FH3 A;  2WF8 A;  7ICK A;  2ZXI A;  2QB1 A;  5ALP A;  1ZQC A;  4QZA A;  1NK7 A;  1QQ7 A;  2Z7J A;  3LYS A;  4B9T A;  3CRX A;  2LI6 A;  2W7O A;  5ALH A;  2JEF A;  4WC4 A;  2IUB A;  3C66 A;  2W9A A;  4OAF A;  2NV3 A;  5L1L A;  1KFT A;  2HSZ A;  3OUY A;  1ZOL A;  8ICA A;  3JPT A;  1OW5 A;  3ETR A;  8ICC A;  4IL6 U;  5C0Y A;  4YCX A;  2JHD A;  3SI8 A;  3M1Y A;  1ED1 A;  3RRG A;  3QNM A;  5KL8 B;  3E0F A;  2ID1 A;  4QW9 A;  3SV4 A;  4A8E A;  4NXU A;  3KHH A;  2MUT A;  4IQW A;  1X2I A;  4EYH B;  4KLT A;  2FLP A;  1RDF A;  2ISO A;  3N4M B;  2HN1 A;  5T14 A;  4EV6 A;  4QWB A;  3V7K A;  1C20 A;  4PL2 A;  3ORY A;  2BE3 A;  4CF4 A;  4YVZ A;  1MC8 A;  4NXW A;  4RQ2 A;  2HHU A;  3N7P D;  3AQL A;  3TAQ A;  3ER8 C;  3AQF A;  5KG0 A;  3IG5 A;  4EX7 A;  2GWS A;  4Y2S A;  4JWN A;  2JH7 A;  1UCV A;  4NKU A;  4US8 A;  3WU2 U;  5L1I A;  1K1Q A;  3UXP A;  1TAU A;  4PGX A;  2O6K A;  1SZH A;  2ZJA A;  8ICI A;  3MCR A;  3C29 A;  4O67 A;  5KTQ A;  2MA1 A;  5IIN A;  2E8M A;  4LEY A;  4JUZ A;  5J29 A;  2FMP A;  4WOY A;  2HVI A;  5DED A;  5HR7 A;  2WF5 A;  4F93 B;  2KOB A;  1T4G A;  4M6W A;  3PX6 A;  9ICX A;  3JPQ A;  4J9Q A;  1S97 A;  1XSL A;  1KTQ A;  3IG8 A;  4WQL A;  2F8L A;  3QEA Z;  4UAV A;  2BHN A;  3K1Z A;  5HRI A;  1SIJ A;  3BQ7 A;  2NYV A;  3A0B U;  5DEC A;  3WKA A;  1COO A;  2W3R A;  5EE3 A;  2IMW P;  2R8I A;  1L8O A;  4P2H A;  3E2E A;  1DRG A;  1DXS A;  1O08 A;  4I2D A;  4I27 A;  4FO6 A;  2EH9 A;  4RUC A;  3NVZ A;  5EE1 A;  4X4T A;  3QU9 A;  4KX5 A;  5DB9 A;  4HX0 A;  4RPY A;  1XNS A;  3SAH A;  2HHT A;  4RZR A;  2CRX A;  4YMN A;  2ZIW A;  3AU6 A;  4FZN A;  3QUB A;  4RQ5 A;  4ED8 A;  4M9H A;  3BZC A;  4NJ8 A;  2XC9 A;  3TAR A;  3DV9 A;  2I9G A;  9ICS A;  4ED7 A;  3MR3 A;  4DL2 A;  1ZD4 A;  2GAF D;  5IIL A;  2BPC A;  3WK4 A;  1S10 A;  4K4H A;  4CE6 A;  4I2E A;  5J0S A;  1V38 A;  1DK3 A;  4O0I A;  4J9R A;  2W04 A;  4DSF A;  3Q8L A;  4NLK A;  2R8G A;  9ICK A;  4RNO A;  3H37 A;  5CFU A;  3B0X A;  3TKA A;  4TUR A;  2KNJ A;  1KFS A;  3M6Z A;  2RLT A;  1QQ6 A;  4I2J A;  1JMS A;  1V85 A;  4EZ6 A;  2KTQ A;  8ICG A;  4TUP A;  2FCL A;  4NL9 C;  3M7D A;  4DSE A;  3PNC A;  3T5J A;  3NRW A;  3WKE A;  2M2V A;  1WCN A;  1QSS A;  3JPS A;  3BS5 B;  5ALS A;  1NK0 A;  2LM1 A;  3WFS C;  2OHF A;  4Y2V A;  4DL3 A;  5KT6 A;  1MIY A;  2C2D A;  4IS7 A;  4DL6 A;  5J0P A;  2EAN A;  2KD1 A;  2W11 A;  2VA8 A;  3PO5 A;  5AIA A;  2ZIV B;  1WWV A;  5JRT A;  4IRD A;  1L3T A;  3ETL A;  4OAG A;  3TQ1 A;  4FS1 A;  2W9B A;  3GIL A;  1N62 A;  3OSP A;  4RWP A;  3QX7 A;  5AKX A;  2V9W A;  3HWT A;  3N28 A;  4U7C A;  4FE3 A;  4Y2X A;  3D6J A;  4CCH A;  4M47 A;  5KFJ A;  5DKW A;  4B6J A;  3V72 A;  4NXX A;  3V6K A;  3QUT A;  4UBC A;  2FLN A;  2DPI A;  2R8K A;  1UA1 A;  2FI1 A;  4FHW A;  4RQN A;  1DGJ A;  1JAJ A;  1N2X A;  7ICQ A;  1L6N A;  2ZXH A;  4PL1 A;  3G6Y A;  4DSL A;  4F5N A;  4R66 A;  4TQR A;  4QZI A;  4E8F A;  2BPF A;  1L7O A;  3RJI A;  2HVH A;  5L1M A;  4WCW A;  3UM9 A;  1UET A;  9ICA A;  1S0N A;  5KFN A;  8ICO A;  4Y2Y A;  2MSN A;  1N60 A;  2K4I A;  4RQ6 A;  1KL9 A;  3ED5 A;  3SV3 A;  2XO7 A;  2XY7 A;  1ZJM A;  4YMO A;  2WHE A;  1X66 A;  2ASL A;  3AQN A;  1TKD A;  8ICW A;  4BDP A;  1UT5 A;  3OHA A;  1CUK A;  4UAU A;  4MKP A;  4Y2U A;  2QAR B;  2C2R A;  1NKB A;  3LK9 A;  1RM6 C;  4G3I A;  5KT7 A;  1MIV A;  2ZH3 A;  4FZL A;  1XO0 A;  2NRW A;  8ICT A;  5AK5 A;  5KFD A;  4CDG A;  1Z4O A;  2H3V A;  3OTQ A;  3HT3 A;  4BXO A;  5C5J A;  3J81 j;  4NY8 A;  2IBK A;  5CFT A;  2ZH6 A;  4EX6 A;  2ZTE A;  2IA6 A;  4FS2 A;  2C28 A;  2E8O A;  1KN5 A;  2RHF A;  4IG8 A;  4MEX A;  2AJQ A;  4O68 A;  1U47 A;  3KD3 A;  2JR5 A;  1YT3 A;  1ZQZ A;  4Z6D A;  3AM9 A;  1ZQM A;  4DSK A;  4EBJ A;  2MU2 A;  2NO4 A;  5J2C A;  1SWV A;  2H3Z A;  2GH1 A;  4DLG A;  5F9N A;  3UQ2 A;  1JRP A;  5HRG A;  5KFP A;  2KZZ A;  5AI6 A;  4M9J A;  2RP5 A;  4PH5 A;  1Q78 A;  4ECV A;  4MHV A;  5HC9 A;  5L1K A;  5KFT A;  2R8J A;  2XID A;  2K4H A;  2M2W A;  1NK9 A;  4DFJ A;  3M9N B;  1NI3 A;  4PHA A;  3GV8 B;  5HRB A;  3H8M A;  2R8H A;  1N61 A;  1XU4 A;  2MRL A;  5AM1 A;  2HBM A;  3C2K A;  3OPX A;  5J2G A;  3Q8K A;  2P66 A;  3M9M B;  4EEL A;  2IHN A;  3HPO A;  4QJF B;  4LT6 A;  4MF8 A;  3T3F A;  4Z6F A;  2JEI A;  4F4X A;  3PV8 A;  5DLG A;  3H0R B;  4Y2T A;  3RJK A;  4ECX A;  2W3S A;  1U9L A;  3GFK B;  3NYB A;  5AI5 A;  3C1Y A;  2GLE A;  3WFR E;  2AQ0 A;  2F77 X;  4OAH A;  2XGP A;  2RQ5 A;  1ZQP A;  2ZUB A;  3GZF A;  3ZDB A;  5HRK A;  1QH9 A;  5KT2 A;  3TAD A;  1F5S A;  4YFK A;  3DDH A;  2BBJ A;  3OUY B;  2GO7 A;  3QU2 A;  1ZQR A;  4I2B A;  4GLX A;  3OJU A;  3WK9 A;  4J9M A;  3PW7 A;  2FPK A;  5J2B A;  3WFQ E;  1YZ6 A;  2BQU A;  4KM5 A;  5FP0 A;  1FIQ A;  2MUT B;  4AT7 B;  1KLN A;  2J6S A;  3RJH A;  5AI4 A;  4C8N A;  4O5E A;  3AL0 B;  1ZQU A;  2HW3 A;  4KLJ A;  1F5A A;  1TFY A;  5GTH U;  5CR0 A;  7ICR A;  3RRH A;  1H38 A;  3MC1 A;  7ICT A;  3KHG A;  2XGQ A;  2QKQ A;  4YR2 A;  9ICC A;  2FDR A;  2HHS A;  2AGP A;  1ZQT A;  2W43 A;  2N1R A;  4GXK A;  2WTF A;  2YN4 A;  2Y1J A;  2I1Q A;  4P0Q A;  3MGV A;  4ATB A;  2M2U A;  3V6J A;  3RB0 A;  3CW2 C;  3GIM A;  4Q45 A;  3QZ8 A;  1NO5 A;  3QYP A;  1RQL A;  1X40 A;  1JAL A;  2HCF A;  4WBY A;  5ALO A;  4RQ0 A;  5ALD A;  3KZX A;  1JQR A;  1KNY A;  2KN7 A;  2DR7 A;  7ICG A;  1SKS A;  2JZB A;  4K96 A;  1J97 A;  1D8B A;  1S0O A;  1BPX A;  5ALJ A;  1TAM A;  1LVH A;  2B21 A;  2IOF K;  3HJ1 A;  2XY5 A;  4DOC A;  3LVV A;  3GII A;  3BQ2 A;  4WC6 A;  5ALF A;  3U26 A;  3NUQ A;  2YB4 A;  4RQ3 A;  3Q8Q B;  4JB3 A;  2WF7 A;  4JLZ A;  5AK6 A;  3MGI A;  3MR5 A;  3VC8 A;  2KZM A;  4FHP A;  1ZQG A;  2M9N A;  2M0N A;  3PO4 A;  4UAR A;  3EUB 2;  5AKZ A;  3BZK A;  1WUD A;  3IRU A;  2B51 A;  4BX9 C;  3RTV A;  5AM3 A;  1XC9 A;  4J03 A;  4C8O A;  4FH5 A;  2P35 A;  1KQQ A;  3RJJ A;  4YP3 A;  1F0M A;  2ZIW B;  9ICJ A;  1Q8K A;  1ZQN A;  4EGW A;  4Y2P A;  2PFO A;  4CNQ A;  4ED6 A;  4MEY A;  3K4G A;  3TAC B;  3SR6 A;  4E0D A;  4O3S A;  2NO5 A;  5ALE A;  2DBY A;  4QWC A;  8ICQ A;  1A77 A;  5KFB A;  4XUS A;  5L1J A;  1HEK A;  2YX8 A;  4O3N A;  1HUO A;  3JPO A;  3RR8 A;  1NJX A;  4DFK A;  2HOQ A;  4PGY A;  4ICA A;  3GIK A;  3RFA A;  2HOI A;  1Z00 A;  5KFU A;  4DQI A;  2LYB A;  3BQ0 A;  2D3D A;  4Y2Q A;  1GO3 F;  1ZQQ A;  3PW2 A;  4JMU A;  5HR9 A;  3AMZ A;  5KFX A;  4DCC A;  3PST A;  1NJZ A;  2VA3 A;  4E7X A;  4RWQ A;  3H4B A;  2O5A A;  3RH5 A;  2KV2 A;  3EWA A;  5AKL A;  4EBC A;  2B6G A;  4XQ7 A;  4FBT A;  5IIO A;  4Q43 A;  1SGG A;  4R8U A;  3H38 A;  8ICR A;  1RG6 A;  2DKZ A;  4WC5 A;  3L3F X;  1ZQI A;  3PML A;  5DG9 A;  3TFR A;  2E3T A;  4GFJ A;  2AU0 A;  1Z1V A;  5J0O A;  3Q8P B;  3A0H U;  4IC9 A;  1X9W A;  1NKE A;  4DQQ A;  2W9B B;  1SL0 A;  9ICQ A;  5KFW A;  1S5L U;  1PK1 A;  2VKQ A;  1FEZ A;  2Q0Z X;  4X4P A;  4F71 A;  2ZJ5 A;  2F44 A;  4NLN A;  3B0Y A;  4WC7 A;  2ZIX A;  3RB4 A;  1D8L A;  4EBD A;  4P4O A;  2EQY A;  5DQG A;  4O3Q A;  3F2C A;  2FLL A;  3JYY A;  5KFS A;  1SL1 A;  2H3F A;  1UQV A;  5D63 A;  3KHR A;  2VJ5 A;  2LMR A;  4CRX A;  4UAS A;  1T7P A;  4BJQ A;  2B56 A;  1YZ7 A;  5KT5 A;  1DOQ A;  5J0Q A;  1JX4 A;  2EAM A;  4WJ3 B;  1R89 A;  2ZHA A;  4AT9 A;  2DR8 A;  3NGD A;  1CEZ A;  2HBK A;  4HYK A;  3QU5 A;  1V97 A;  1VFG A;  5J2D A;  2H3Q A;  1S76 D;  5KL1 B;  4DFM A;  4EBE A;  4CGZ A;  2O1P A;  9ICB A;  1QSL A;  4KN7 A;  5KFI A;  3HW8 A;  1IG6 A;  1ZQA A;  2AXT U;  1BNO A;  3HKZ F;  3QXG A;  5BPC A;  1S9F A;  3M8S A;  5IIM A;  3T79 A;  5ALG A;  5H2F U; 
#chains in the Genus database with same CATH homology
 3V72 A;  2NRK A;  3V6K A;  1ZQV A;  5KFO A;  5J0T A;  5J2J A;  1DGS A;  1XWL A;  9ICR A;  5D49 A;  3T5L A;  4UBC A;  1NK5 A;  2FLN A;  4UAW A;  1TV9 A;  8ICP A;  2F1I A;  2DPI A;  1N56 A;  2HHX A;  2JEG A;  2R8K A;  3RH4 A;  1UA1 A;  5KG4 A;  2ASD A;  4M5D A;  4P4P A;  4FHW A;  1XSP A;  4NXZ A;  3V7J A;  1JAJ A;  5F2V O;  5DG8 A;  3WFP A;  4YR3 A;  2ASJ A;  7ICQ A;  1ZQX A;  2ZUC A;  4O5K A;  3OVB A;  2NRT A;  1MSW D;  4ECZ A;  1TFR A;  3G6Y A;  1MIW A;  4DSL A;  4F4K A;  1A76 A;  8ICV A;  4F5N A;  4R66 A;  4KLF A;  5J2K A;  4FHV A;  3M8R A;  4TQR A;  3EZ5 A;  3EPI A;  3V7L A;  3ZD9 A;  4ECU A;  4QZI A;  4ELU A;  4E8F A;  4F5P A;  5HHH A;  2BPF A;  4DL7 A;  4BXO B;  3RJI A;  2HVH A;  4FBU A;  4X4S A;  4DLE A;  4WCW A;  9ICL A;  1UET A;  3GDX A;  1LB2 B;  9ICA A;  3RJG A;  2AGO A;  1S0N A;  5KFF A;  5HRH A;  5HHI A;  5KFN A;  3BJY A;  4GC7 A;  4KLU A;  8ICO A;  4UQG A;  4Z6E A;  1B22 A;  1KRP A;  4IQV A;  3FDS A;  1YLQ A;  4XQ8 A;  2FMQ A;  4F4W A;  3OSN A;  1D9F A;  4I2I A;  4BGD A;  9ICH A;  4RQ6 A;  5J0R A;  4F50 A;  4F3O A;  4B9V A;  3SV3 A;  2XY7 A;  2XO7 A;  5D4B A;  1X9S A;  4ELV A;  1ZJM A;  2HHV A;  4YMO A;  1SL2 A;  7ICU A;  8ICJ A;  3C1Z A;  4O9M A;  8ICU A;  5DQI A;  3TAN A;  4DS4 A;  4B9U A;  4F8R A;  2ASL A;  4QZE A;  2BDP A;  4JV2 A;  1FA0 A;  3AQN A;  4RU9 A;  2JEJ A;  4ED3 A;  3ZDC A;  1TKD A;  8ICW A;  2ZTC A;  1ZQJ A;  1S77 D;  4RUA A;  4BDP A;  3C23 A;  8ICB A;  1ZQK A;  2A1J A;  3GV5 B;  2Q66 A;  4R63 A;  4M9L A;  1UT5 A;  1NJW A;  2OWO A;  3OHA A;  3UQ0 A;  4RWN A;  1CUK A;  5KFR A;  4RQ8 A;  4UAY A;  3KHL A;  1RPL A;  2C2R A;  1ZQB A;  4C8L A;  1NKB A;  1HJP A;  7ICJ A;  3LK9 A;  4Q44 A;  7ICO A;  3JZ0 A;  5KG2 A;  4G3I A;  2ZH8 A;  4B9N A;  5KT7 A;  3MR6 A;  3EPG A;  3ZDE A;  1MIV A;  2ZH3 A;  3JPR A;  3OVA A;  5DQH A;  2DRA A;  4YN4 A;  3HP6 A;  4ECY A;  2FPM A;  2UVW A;  2NRW A;  3HIY A;  5J2E A;  3K75 D;  4O3P A;  5CWR A;  8ICT A;  1C7Y A;  1WOT A;  4RWO A;  5KFD A;  1ZQW A;  4I29 A;  2ISP A;  3PR5 B;  4NM2 A;  1PZN A;  8ICM A;  3LDA A;  1JIH A;  3RB6 A;  3HT3 A;  3Q8S B;  1X9M A;  5C5J A;  3SYZ A;  4BXO A;  4NY8 A;  2IBK A;  5CP2 A;  4DS5 A;  4Z6C A;  9ICN A;  7ICS A;  3AQM A;  4B9S A;  2ZH6 A;  4X4V A;  3RJE A;  4S3N A;  4UB2 A;  2ZTE A;  2IA6 A;  4F2S A;  3PMN A;  4FS2 A;  2C28 A;  1BPY A;  4EZ9 A;  1DK2 A;  4IG8 A;  4MEX A;  4O5C A;  2C22 A;  2AJQ A;  7ICH A;  1U47 A;  2W8K A;  1HUZ A;  5IIK A;  7ICE A;  1ZQZ A;  4Z6D A;  1ZQM A;  4DSK A;  3PX4 A;  4EBJ A;  1L3V A;  1KEJ A;  2NRX A;  5J2C A;  4K4G A;  4QZG A;  4RT3 A;  4DLG A;  2BQR A;  4TUQ A;  2M2T A;  4J9S A;  3HX0 A;  5F9N A;  2MAX A;  3UQ2 A;  4ED0 A;  5HRG A;  4EBK A;  5KFP A;  1LV5 A;  4Q8F A;  2KZZ A;  5CA7 A;  1NKC A;  4M9J A;  5KG7 A;  4RPX A;  4PH5 A;  4PHD A;  5DGA A;  1T3N A;  2V4Q A;  7ICV A;  1Q78 A;  2NRZ A;  4ECV A;  3PR4 A;  9ICF A;  4AT7 A;  4DF4 A;  1VJ7 A;  5J2I A;  4PHE A;  5HRF A;  5L1K A;  3V6H A;  1KDH A;  5HC9 A;  2KZ3 A;  1NK4 A;  5KFT A;  3ISD A;  2R8J A;  4IRK A;  4DOB A;  5DBA A;  4F2R A;  1EXN A;  1BGX T;  4M9G A;  5KFC A;  4DQP A;  5JUM A;  3BQT A;  2M2W A;  1NK9 A;  4KLL A;  4DFJ A;  5KFL A;  2DR9 A;  2ZH1 A;  2XCA A;  3M9N B;  2W9M A;  4YG2 A;  4F5O A;  3QE9 Y;  4ECS A;  9ICO A;  2DFL A;  4UD5 A;  4XA5 A;  4PHA A;  3GV8 B;  4KN4 A;  5DG7 A;  1RZT A;  1IM4 A;  1OU5 A;  2ZH5 A;  5HRB A;  2R8H A;  4KMU A;  4UAZ A;  4M04 A;  1XU4 A;  5KFH A;  4KTQ A;  1UEU A;  1B43 A;  5DBB A;  4FHX A;  3MDA A;  2PI4 A;  1U45 A;  8ICX A;  1ARO P;  2FPL A;  4KLE A;  5J0X A;  3C2K A;  3EW9 A;  5J2G A;  3Q8K A;  4BWM A;  3OV7 A;  2P66 A;  4QZC A;  3RBD A;  4RQ7 A;  3M9M B;  4NM1 A;  4PPX A;  2IHN A;  1BNP A;  4MFC A;  3HPO A;  4LT6 A;  3MR2 A;  2RFF A;  5KG5 A;  4O3O A;  4MF8 A;  4JK1 A;  4QWD A;  4Z6F A;  4F4Y A;  4F4X A;  2VAN A;  3T3F A;  5DB8 A;  2F1H A;  4RPZ A;  3RBE A;  5KFE A;  1N48 A;  3PV8 A;  1Q79 A;  4X0A A;  4X5V A;  5DLG A;  5DGB A;  2ALZ A;  5HP4 A;  3MFI A;  1RXV A;  4J9N A;  8ICH A;  3THV A;  4P4M A;  4JV0 A;  4MF2 A;  4KLH A;  2ZUD A;  3RJK A;  4ECX A;  2BCS A;  4YXM A;  5EWG A;  1U9L A;  4GXJ A;  5CJ7 A;  3GFK B;  3NYB A;  4EP7 A;  3C1Y A;  3BDP A;  3T5H A;  3WFR E;  2AQ0 A;  4I28 A;  3GQC A;  2DVI A;  2XGP A;  4DWI A;  2RDJ A;  4ECR A;  1ZQP A;  2ZUB A;  4KLM A;  5J0W A;  3TFS A;  2ZH2 A;  3ZDA A;  3ZDB A;  5HRK A;  1ZQE A;  3BQ1 A;  5KT2 A;  3OGU A;  1ZQD A;  3C5F A;  1NJY A;  5III A;  2ZH9 A;  4YQW A;  4ATB B;  1S0M A;  4YFK A;  4KLG A;  3EYZ A;  5KFG A;  3OUY B;  5HRD A;  1ZQR A;  1Z3E B;  3MDC A;  4I2B A;  4KLQ A;  4E80 A;  4GLX A;  1D9D A;  4UB4 A;  3OJU A;  5KFK A;  4RQ1 A;  4DF8 A;  2C2E A;  3N97 B;  2RDI A;  3AU2 A;  8ICK A;  5J0Y A;  4J9M A;  4ED2 A;  3PW7 A;  1MQ3 A;  3RJF A;  2FPK A;  1TK0 A;  4LVS A;  4NKT A;  4X0B A;  4NLG A;  2PXI A;  4J9L A;  4F5Q A;  5EWE A;  1JN3 A;  1NOM A;  4R64 A;  1IXR A;  5J2B A;  5HNK A;  3H8S A;  3LWL A;  3WFQ E;  2KFN A;  7ICN A;  4PGQ A;  9ICG A;  1RYR A;  2BQU A;  2JZB B;  4GXI A;  2P6R A;  3TAP A;  2MUT B;  1ZQY A;  4QZB A;  1KLN A;  3RR7 A;  2V4R A;  4AT7 B;  2ZJ8 A;  3PVX A;  3RB3 A;  4X4R A;  2BCU A;  4KLI A;  2J6S A;  3RJH A;  2KP7 A;  1R8A A;  1XSN A;  4C8N A;  2ZH7 A;  4O5E A;  2BQ3 A;  1ZQU A;  4EYI B;  4KLJ A;  2HW3 A;  3C5G A;  1F5A A;  1TFY A;  4DQR A;  1BPE A;  5HMM A;  3UXN A;  1TFW A;  5CR0 A;  5DB7 A;  4LZG A;  7ICK A;  5KG6 A;  4FH3 A;  2XCP A;  3RRH A;  7ICR A;  3G6X A;  3RAX A;  1ZQC A;  4QZA A;  3H40 A;  4GC6 A;  1NK7 A;  5KFM A;  3M9O B;  1KFD A;  4IQT A;  1H38 A;  4TQS A;  4DFP A;  7ICT A;  3KHG A;  2XGQ A;  4B9T A;  4AT8 B;  4YR2 A;  9ICC A;  1RYS A;  2JEF A;  3OHB A;  2HHS A;  4DSI A;  4WC4 A;  2AGP A;  1ZQT A;  4GXK A;  2WTF A;  3PW0 A;  3C66 A;  2W9A A;  4WC2 A;  2Y1J A;  2I1Q A;  4ATB A;  4DO9 A;  4QWE A;  2M2U A;  4X4N A;  4UB1 A;  5L1L A;  1WCL A;  3V6J A;  1KFT A;  7ICL A;  3RB0 A;  3GIM A;  3OUY A;  4Q45 A;  4R65 A;  3QZ8 A;  8ICA A;  3JPT A;  1TK8 A;  1NO5 A;  2PI5 A;  4M9N A;  8ICC A;  1JXL A;  3ISC A;  9ICV A;  4YCX A;  2JEI A;  2HHP A;  2IHM A;  3SI8 A;  4JWM A;  5D46 A;  4WBY A;  2LYH A;  4DL4 A;  1BPZ A;  4RQ0 A;  2P6U A;  3JPP A;  2BGW A;  1QSY A;  1S0V A;  8ICN A;  3H7I A;  3C2M A;  3RRG A;  1JQR A;  1KNY A;  3LQC B;  2KN7 A;  4BWJ A;  7ICG A;  2DR7 A;  2BCV A;  1BPD A;  4ECQ A;  4QZ8 A;  3OJS A;  1SKS A;  3KTQ A;  2JZB A;  2ID1 A;  4QW9 A;  3SV4 A;  4IRC A;  3MAB A;  3KHH A;  4J9K A;  1L5U A;  1Y88 A;  2MUT A;  4DSJ A;  1S0O A;  1BPX A;  4IQW A;  1X2I A;  4UD4 A;  1TK5 A;  2B21 A;  5J0U A;  4EYH B;  3HJ1 A;  2XY5 A;  5KFV A;  4DOC A;  4FHY A;  4KLT A;  1NZP A;  3GII A;  2BCR A;  2FLP A;  3BQ2 A;  2ISO A;  1ZQH A;  4IR1 A;  3N4M B;  4WC6 A;  1SKR A;  4QWB A;  8ICF A;  3ISB A;  4RQ3 A;  4F92 B;  2W9C B;  3V7K A;  2UVR A;  3Q8Q B;  3ORY A;  2BE3 A;  2BPG A;  4F5R A;  4YVZ A;  1MC8 A;  5BOM A;  1UT8 A;  1Z00 B;  4RQ2 A;  2HHU A;  4AT8 A;  1NK6 A;  3MGI A;  4WC0 A;  3AQL A;  5HML A;  3MR5 A;  3TAQ A;  2KZM A;  4YR0 A;  4FHP A;  5KG0 A;  1ZQG A;  2M9N A;  2GWS A;  3PO4 A;  4M0A A;  4QWA A;  2J6U A;  4MFA A;  9ICW A;  4ECT A;  5KT3 A;  4TUS A;  4JWN A;  2ATL A;  4X4U A;  3RTV A;  2FMS A;  3ZD8 A;  1R8C A;  9ICI A;  8ICL A;  4NKU A;  1ZYQ A;  2PFQ A;  4I2C A;  1XC9 A;  5L1I A;  4C8O A;  1QLN A;  1K1Q A;  4FH5 A;  7ICM A;  1ZQS A;  8ICE A;  3IM1 A;  3UXP A;  4PHP A;  3RJJ A;  4YP3 A;  4R8U B;  4I2A A;  4PGX A;  1TAU A;  9ICJ A;  4EEY A;  5J2H A;  1ZQN A;  2ZJA A;  2PFO A;  8ICI A;  1R8B A;  4X4Q A;  5KTQ A;  4ED6 A;  5IIN A;  2J6T A;  2BCQ A;  4JUZ A;  5J29 A;  4MEY A;  1TAQ A;  3K4G A;  4WC1 A;  1RXW A;  2FMP A;  4E0D A;  2HVI A;  4O3S A;  1K1S A;  1T8E A;  1ZQO A;  5DED A;  4K4I A;  1BPB A;  4QWC A;  4JV1 A;  8ICQ A;  4F93 B;  1A77 A;  1T4G A;  4M6W A;  4I2F A;  5KFB A;  3PX6 A;  2BKE A;  4XUS A;  5L1J A;  4B9M A;  4O3N A;  3JPQ A;  2F1J A;  4J9Q A;  9ICX A;  1S97 A;  9ICU A;  1HUO A;  8ICY A;  7ICF A;  3JPO A;  1KTQ A;  4F91 B;  2AGQ A;  3NTU A;  3T5K A;  1XSL A;  1NJX A;  3RR8 A;  3C2L A;  3QEA Z;  2ZHB A;  4DFK A;  2BHN A;  4PGY A;  5DDM A;  2W9C A;  3TI0 A;  5HRI A;  3AQK A;  2HHW A;  4KLD A;  3GIK A;  5DEC A;  3JPN A;  1XS9 D;  1COO A;  1Z00 A;  5KFU A;  4DQI A;  2IMW P;  3L9D A;  3BQ0 A;  2R8I A;  1ZQQ A;  1UA0 A;  3PW2 A;  4P2H A;  3UPS A;  3E2E A;  5KFA A;  5HR9 A;  3UPQ A;  5KFX A;  2HHQ A;  1ZET A;  5DB6 A;  1NJZ A;  2VA3 A;  4I2D A;  3Q8R B;  4E7X A;  3FYH A;  4I27 A;  4RT2 A;  4FO6 A;  4RWQ A;  5EWF A;  2PBE A;  9ICP A;  1JXE A;  3H4B A;  2O5A A;  4DOA A;  4RUC A;  3RH5 A;  2ZTD A;  3EWA A;  5F9L A;  4X4T A;  3H39 A;  4EBC A;  2KFZ A;  4YXJ A;  5DB9 A;  4UBB A;  4RPY A;  4RNM A;  4FBT A;  4XQ7 A;  5IIO A;  2UVV A;  2HHT A;  3QZ7 A;  5TZV A;  4QZF A;  4Q43 A;  4RZR A;  1MQ2 A;  3Q8M A;  4I2G A;  4R8U A;  3H38 A;  4YMN A;  8ICR A;  3PY8 A;  3AU6 A;  1U49 A;  3MFH A;  4QZH A;  4WC5 A;  3HJ4 A;  2Y1I A;  1ZQI A;  1U4B A;  2DR5 A;  3PML A;  2ZH4 A;  4RQ5 A;  4ED8 A;  5DG9 A;  3TFR A;  4M9H A;  1KSP A;  4C8K A;  4DQS A;  2AU0 A;  5KT4 A;  5KFZ A;  4QZ9 A;  3MGH A;  5CB1 A;  3GV7 B;  4AT9 B;  1QTM A;  2XC9 A;  3TAR A;  5J0O A;  2I9G A;  9ICS A;  3Q8P B;  4ED7 A;  3QEB Z;  3RAQ A;  4IR9 A;  3C18 A;  3OVS A;  3MR3 A;  4DL2 A;  2VA2 A;  5IIL A;  1TVA A;  1X9W A;  1NKE A;  4DQQ A;  2BPC A;  2W9B B;  1SL0 A;  4UB5 A;  4M2Y A;  3IHQ B;  1V4A A;  1S10 A;  9ICQ A;  4XRH A;  4K4H A;  4I2E A;  5HRE A;  1PX5 A;  5KFW A;  5J0S A;  2PFN A;  1UEV A;  4KIT B;  3GIJ A;  4O0I A;  4J9R A;  1U48 A;  4I2H A;  1DK3 A;  4DSF A;  3LWM A;  2NRV A;  3Q8L A;  4NLK A;  2Q0Z X;  2R8G A;  9ICK A;  4RNO A;  3H37 A;  4X4P A;  3B0X A;  4C8M A;  2ZJ5 A;  5KFY A;  4J9P A;  4TUR A;  4KLS A;  2XY6 A;  1KFS A;  2DRB A;  4I2J A;  3PW5 A;  4NLN A;  3B0Y A;  4WC7 A;  3RB4 A;  1D8L A;  1JMS A;  4EBD A;  5DDY A;  4B9L A;  4EZ6 A;  2KTQ A;  4P4O A;  5DQG A;  1SKW A;  4O3Q A;  8ICG A;  4YD1 A;  4TUP A;  1NK8 A;  2FLL A;  3JYY A;  4X4O A;  3G6V A;  5KFS A;  4LZD A;  4DSE A;  4M6W B;  4RNN A;  4ECW A;  3PNC A;  1SL1 A;  3H8J A;  5KG1 A;  1XO1 A;  3T5J A;  3H3A A;  2M2V A;  4YD2 A;  1WCN A;  4QW8 A;  4YMM A;  4QZD A;  3KHR A;  3JPS A;  1QSS A;  9ICM A;  7ICP A;  5BOL A;  4ZH4 A;  2BR0 A;  8ICZ A;  3WFO A;  1NK0 A;  4KLO A;  3WFS C;  5KFQ A;  3SZ2 A;  1T7P A;  5CHG A;  3UXO A;  4ELT A;  4DL3 A;  5KG3 A;  5KT5 A;  4WC3 A;  2PFP A;  3H8W A;  5DLF A;  4NLZ A;  4O3R A;  1DOQ A;  5KT6 A;  3H4D A;  2C2D A;  5J0Q A;  1MIY A;  4RQ4 A;  4DL6 A;  5J0P A;  3AUO A;  7ICI A;  1JX4 A;  1R89 A;  2ZHA A;  4WBZ A;  4AT9 A;  4IQU A;  2DR8 A;  2VA8 A;  3NGD A;  3PO5 A;  2W8L A;  8ICS A;  1CEZ A;  5HRL A;  4HYK A;  2AQ4 A;  3C21 A;  1VFG A;  4IRD A;  5L9X A;  3RH6 A;  1L3T A;  5J2D A;  3ZDD A;  3ETL A;  1V9P A;  3TQ1 A;  1S76 D;  1BVS A;  1ZJN A;  1L3U A;  2DPJ A;  4DEZ A;  4FS1 A;  4DFM A;  2W9B A;  4EBE A;  4DL5 A;  2UVU A;  3GIL A;  1ZQF A;  2O1P A;  9ICB A;  1QSL A;  1L3S A;  2H5X A;  3OSP A;  5J2F A;  9ICT A;  4MFF A;  4KN7 A;  5KFI A;  4ED1 A;  9ICE A;  4RWP A;  5IIJ A;  3HW8 A;  3PX0 A;  4J9O A;  4F4Z A;  4Q8E A;  2V9W A;  3HWT A;  1ZQA A;  5J2A A;  1BNO A;  3PW4 A;  3MBY A;  5BPC A;  1S9F A;  3M8S A;  5IIM A;  5EOZ A;  4UB3 A;  4CCH A;  4M47 A;  5KFJ A;  5DKW A;  1ZQL A;  2A1J B;  1D8Y A;  5DBC A;  1SZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...