5DBAA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a dt
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 114
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbaA03
1ZQQA 1ZQPA 1KTQA 2HHUA 4FH5A 4P4OA 3SZ2A 3LK9A 2BPFA 8ICTA 8ICUA 4FS2A 4F4WA 4TUSA 5J2FA 4NLGA 5HRGA 4E7XA 1LB2B 4GC6A 3OSPA 3GIJA 4O3RA 5J0XA 4YXJA 4WC1A 1TKDA 1L3VA 2R8GA 9ICFA 4DWIA 4MF8A 4I2IA 2AQ0A 2F1HA 5DLFA 4DF4A 3RR7A 1D8LA 2B21A 4RU9A 1KDHA 5IIJA 5L1KA 4J9SA 5L1JA 4ECSA 3Q8RB 1ZQSA 1HUOA 2OWOA 2O1PA 1ZQUA 3MDAA 1MQ2A 1TVAA 1SL2A 4I2DA 2NRWA 3ZD9A 3H8JA 5KG2A 2ZUCA 3TFRA 4Q8EA 2I1QA 1BGXT 4R64A 2P66A 4PHPA 2FPLA 3RH5A 7ICSA 4RZRA 1EXNA 3BQ2A 4DLGA 3RR8A 5IIIA 3Q8PB 3G6YA 1DK3A 4FHYA 4LT6A 5KT7A 2KFNA 2V4RA 1X9MA 2AQ4A 2O5AA 3C23A 2BPCA 3RJIA 4EBJA 3PO4A 3OJSA 3H4DA 1SKSA 3MGIA 1TV9A 5KFFA 5KFWA 4ED1A 2C28A 3LQCB 4FBTA 4M5DA 2DRBA 4P2HA 8ICRA 1HUZA 3RJGA 4AT7B 5KG7A 1XSPA 3H3AA 4KLIA 2BCUA 1MIVA 4QZAA 4JV2A 4KMUA 3GDXA 4ATBA 5HNKA 1ZQWA 3C1YA 4IQUA 3HWTA 3Q8KA 1UA1A 4M9LA 1JAJA 1D8YA 4YR0A 8ICXA 4ECQA 2ASJA 5KT6A 4KLHA 4KLQA 4QWCA 4O0IA 2UVUA 5J2IA 3EYZA 1ZJMA 3OVBA 5HHHA 4E80A 5D4BA 1COOA 5EWFA 1ZQEA 1SKWA 2ZH8A 4BWJA 1N56A 1A76A 5J0TA 3HX0A 4LVSA 5KFDA 5CP2A 1ZQFA 4B9UA 2HHWA 1VJ7A 1D9DA 1NKEA 3QEAZ 4R63A 8ICZA 3HW8A 4X4SA 1NJWA 5DBAA 3AQMA 5DG7A 2KTQA 4J9LA 4TUPA 5DBCA 1S10A 2ASDA 2BGWA 1KFTA 4FHXA 8ICPA 4UB5A 8ICJA 3ZDBA 1NZPA 4B9NA 4WBYA 2XGQA 4X4RA 5IINA 3HJ4A 3H7IA 1L5UA 2R8KA 4DL4A 2AGPA 1BPYA 5KT4A 2FLNA 4PH5A 1ZQJA 4FH3A 1RZTA 2J6SA 3GV8B 1Y88A 1B22A 2W9AA 3Q8MA 5HREA 3C5GA 1JN3A 1NOMA 1QSYA 3GFKB 4DOBA 7ICRA 1WOTA 1BNPA 2F1IA 4RNNA 2Q0ZX 4UAWA 4RQ2A 4B9TA 9ICAA 4DOAA 4WC5A 5KFBA 1L3SA 4C8LA 4AT9B 3FDSA 4P4MA 1BPEA 5C5JA 4XA5A 4FHVA 3C66A 4Z6CA 3EWAA 1SKRA 3JPOA 4QZCA 5KFUA 3B0XA 3PV8A 2MUTB 2XY6A 2AGOA 4J9MA 5HRFA 3JPPA 3H38A 3WFRE 1MC8A 1T3NA 1QTMA 4WC7A 4O9MA 4F4XA 7ICUA 5KT5A 5L1IA 1R8BA 2W9BA 2PFOA 5KG6A 4QWBA 7ICIA 3M9OB 3PMNA 3BQ0A 3T5JA 4Q43A 2W9CB 4M9GA 3SYZA 1U9LA 2HHVA 5KFXA 9ICLA 4Q44A 4DO9A 4QZHA 3V72A 3RBEA 2ZH9A 3OJUA 4GC7A 3Q8LA 2KP7A 1BPDA 2HHQA 3Q8QB 4RWPA 1MSWD 7ICQA 3V7LA 4F92B 1S0OA 2BCRA 4DSLA 3MFIA 2DR8A 4GLXA 5DQGA 2HW3A 8ICQA 1T8EA 2ZH1A 1CUKA 4J9RA 3TARA 3RAXA 1KSPA 2DR7A 4GXIA 2DRAA 3BDPA 9ICKA 4JV1A 2VANA 3PX6A 4I2FA 4MFFA 4QZ8A 9ICTA 5CR0A 3ISCA 4KLOA 2C22A 3KTQA 5DBBA 2FLLA 5HMMA 4DEZA 4RT2A 4F5OA 8ICYA 1UETA 1QSLA 4KLUA 2AU0A 2C2DA 7ICOA 7ICTA 1K1QA 5CB1A 3RTVA 4KITB 2ALZA 2JEJA 3ZDAA 7ICJA 4IQWA 1Z3EB 5DDYA 3THVA 3JPRA 3UXOA 3RJKA 2XC9A 7ICGA 3RJEA 4XQ8A 4F93B 1T7PA 2AJQA 1PX5A 8ICVA 4ED3A 4ECWA 3HIYA 5CHGA 2DR5A 2F1JA 2ZTDA 4YFKA 1ZQLA 3SV4A 5TZVA 3T5KA 3PO5A 9ICQA 2BPGA 3LWLA 3SV3A 3T5HA 3OVAA 1SL0A 2BQ3A 4O3NA 4QWEA 1KEJA 1KFSA 3WFPA 4F50A 9ICUA 4FS1A 5IILA 5KFCA 4ATBB 4DSJA 2VA3A 4KLTA 1SZPA 3EW9A 3NTUA 3JPTA 2RDJA 4RWQA 8ICKA 1X9SA 5KFMA 4C8OA 5DB7A 5CWRA 4RQ4A 5HRLA 2DPJA 4NKTA 4X4NA 4XRHA 4BDPA 5KG4A 4RNMA 5J2CA 4X5VA 8ICBA 4DLEA 3B0YA 3V7JA 4RQ7A 4RQ8A 1T4GA 4RPZA 2XY7A 2ISPA 2KZZA 1F5AA 4WC4A 3M8RA 3WFQE 4RPXA 1TAUA 2H5XA 4EBEA 1WCNA 5KFGA 4ECYA 4DSEA 3RB3A 2BQRA 3GIKA 9ICPA 7ICVA 1ZQIA 2Q66A 4I29A 1ZQAA 3AQKA 4ED8A 2ISOA 9ICWA 3H8SA 3JPNA 2IMWP 3AU6A 3PVXA 1UT8A 5KTQA 2XO7A 2PFQA 4O3SA 3H37A 3HJ1A 4J9NA 3LDAA 5J0UA 4B9SA 4NM2A 4B9VA 1PZNA 5J2KA 4TQRA 4FHWA 3UXPA 5KFSA 2BDPA 2RFFA 1TFYA 4JUZA 4RUCA 4UAZA 4YN4A 4DF8A 4YR2A 5J29A 4QW8A 5BOMA 3RJJA 3BQTA 2PBEA 3JYYA 4FHPA 1SL1A 2FLPA 2MAXA 1N48A 1UT5A 4YMMA 4NM1A 5KFKA 1DOQA 9ICOA 2DVIA 3ZDCA 4QZEA 5DKWA 5L1LA 5IIKA 2NRKA 5HP4A 3IM1A 3AQLA 3C18A 1S97A 5DEDA 1BPXA 2PI5A 3KHGA 1H38A 2IHMA 4DQQA 1ZYQA 3OUYB 8ICSA 4DQIA 9ICEA 5DGBA 4YQWA 4I2JA 3GIMA 3MABA 4DL6A 4MFCA 2NRTA 2W9BB 3ISDA 1S0MA 1ZQNA 1RYSA 1ZQBA 4I27A 9ICMA 1YLQA 4I2HA 4NY8A 4ELVA 2A1JB 3C2KA 1MIYA 1V9PA 2M9NA 5KFOA 1AROP 2ZJ8A 3G6VA 4ECVA 4UD5A 1BPBA 4RQ0A 3NGDA 2PFNA 2ZJ5A 4IQTA 4F4YA 5DB6A 1ZQCA 4F4KA 4ECXA 4ZH4A 8ICAA 4O5CA 4UBBA 3V6JA 2IHNA 4QW9A 3RB4A 3QE9Y 4I2EA 5DB8A 3T5LA 4ECZA 1DGSA 9ICRA 2V4QA 1S0VA 4ED2A 4UAYA 3HT3A 3MR2A 2JZBA 4IRCA 3PW7A 3MBYA 4E0DA 1TAQA 5KFRA 2XGPA 2R8IA 4F5QA 2LYHA 1ZJNA 3PR5B 3MFHA 4IR9A 4O5EA 3KHLA 5J0SA 2NRVA 5DDMA 3OSNA 1NK0A 4WC6A 4KLEA 3JZ0A 3KHRA 1XSNA 4J9OA 3PR4A 2ZUBA 3V7KA 4F3OA 4G3IA 4BXOB 1NKCA 2W9MA 4ELUA 4HYKA 3E2EA 4KLJA 1Q78A 4XUSA 2ZHAA 1S0NA 1MIWA 2XY5A 1ZQVA 4PHEA 5KFLA 1ZQZA 4ECTA 2I9GA 4RUAA 5DB9A 2ZTCA 4PGXA 2FPMA 4KLMA 5HRDA 1U48A 3PY8A 2HHXA 2FMQA 3TANA 5HRBA 2P6UA 4DL7A 2ZH2A 5KFAA 2HVHA 4RQ3A 5KFNA 4EBKA 4UB4A 3SI8A 5EWEA 2JEIA 3QZ7A 2PI4A 4S3NA 1B43A 4IRKA 2R8JA 3UXNA 2JEFA 1R8AA 2ZH3A 4QWDA 4YMOA 3K75D 2ASLA 3TI0A 2M2VA 2BKEA 4PGYA 5KT2A 5J0YA 4M47A 5J0QA 1NK4A 3UPQA 3V6KA 3RH4A 4K4IA 3MR6A 3MDCA 1U45A 5J0WA 1ZQKA 5J2DA 9ICVA 2VA2A 5F2VO 4XQ7A 4FBUA 4Z6DA 4NLKA 4DL5A 4O5KA 2DPIA 1TK0A 1D9FA 4JWNA 5F9LA 4EYIB 5HMLA 3H39A 4WC3A 4UBCA 3MGHA 2P6RA 4M9JA 4IQVA 3HPOA 1L3UA 4M9NA 9ICNA 1XSLA 3PW0A 5KFQA 5CA7A 1XC9A 1IXRA 2KZ3A 1MQ3A 2ZTEA 4KLFA 2DR9A 5JUMA 4QZDA 5J0PA 4JWMA 2ZUDA 2HVIA 4F5RA 1JMSA 4RNOA 1UEVA 1KRPA 3WFOA 5DQHA 3OV7A 3G6XA 5HRIA 1Z00A 4ECUA 3AU2A 3HP6A 4DS5A 2ATLA 4O3QA 5KG0A 3RBDA 8ICIA 4X0AA 3GV5B 4DS4A 1ZQTA 1KNYA 2ZH7A 2FMPA 2KN7A 4F8RA 3M9MB 1NJYA 9ICHA 4I2GA 1NJZA 8ICWA 4YMNA 3H4BA 4UB1A 9ICCA 4X4VA 4TQSA 3UPSA 4M6WA 4K4GA 2DFLA 2M2TA 4F2RA 2BCVA 3MR3A 4M2YA 3OHAA 5KFJA 4QZ9A 3WFSC 5EWGA 4YP3A 4DFKA 3PW2A 4UD4A 2W9CA 5J2JA 1KLNA 5J2AA 4LZGA 4JV0A 5J0OA 8ICHA 7ICFA 4WCWA 1K1SA 5J2HA 4K4HA 5HRKA 4DSIA 3C21A 4O3OA 2Y1JA 1Q79A 5KFHA 5J0RA 4M04A 1NO5A 2ZH4A 4C8MA 4DFPA 3N4MB 1U47A 3ISBA 3RRHA 1NKBA 7ICMA 9ICSA 1JXEA 4DQRA 4FO6A 1S9FA 9ICGA 2FMSA 4R8UA 1ZETA 1NK6A 2KZMA 5DLGA 4AT8A 1XO1A 5EOZA 1BNOA 3NYBA 5J2BA 2BHNA 2R8HA 2PXIA 2C2RA 2JZBB 4ED7A 4B9LA 1TFWA 4KLGA 9ICXA 1UA0A 2BCQA 3RB0A 4MF2A 1QLNA 5BOLA 8ICCA 1BPZA 5KFZA 2ZJAA 1S77D 5D46A 4MEXA 4EP7A 4YG2A 4EEYA 1VFGA 3PX0A 3PW4A 2UVRA 1LV5A 2V9WA 4Q8FA 8ICMA 2ZH6A 4F91B 3PX4A 4KLSA 3GIIA 4EBDA 4RWOA 2C2EA 3PNCA 3QZ8A 4J9PA 3RH6A 5J2EA 1JXLA 3AUOA 3RJFA 4X4TA 1FA0A 4DSFA 5KT3A 2W8KA 2HHPA 3H8WA 4DQPA 4YD2A 3OHBA 2WTFA 4QZGA 5DGAA 1TK8A 5DECA 2M2UA 1ZQOA 1TFRA 2FPKA 4RQ5A 4IR1A 2BR0A 4NXZA 1U49A 4KLLA 4PHDA 4YD1A 1NK8A 4GXJA 4NKUA 2UVWA 1ZQMA 1XWLA 7ICEA 3RJHA 4YCXA 5KFPA 4MFAA 1NK9A 1C7YA 2PFPA 8ICGA 3ZDEA 5BPCA 1UEUA 2UVVA 3BQ1A 8ICNA 4KN7A 1R8CA 3JPQA 4C8NA 5KFTA 4BGDA 4KN4A 4RT3A 8ICFA 4PGQA 4LZDA 4ECRA 2HHTA 7ICKA 4EYHB 1HJPA 2IA6A 4TURA 3MR5A 7ICNA 9ICIA 4YR3A 7ICHA 4J9QA 3FYHA 1QSSA 3TFSA 1KFDA 2VA8A 1XU4A 3GV7B 4DL3A 3TAPA 5KFEA 3UQ0A 8ICOA 1NK5A 4DFMA 4F4ZA 4Z6EA 3N97B 4DL2A 3EPIA 5D49A 2XCPA 3ZDDA 4X4UA 5KG5A 3L9DA 5HHIA 4DOCA 3UQ2A 3M9NB 4UB2A 2Y1IA 2NRXA 5F9NA 2GWSA 4I2AA 2W8LA 4RQ1A 1IM4A 4R65A 4RQ6A 1X9WA 4C8KA 2M2WA 4EZ9A 1DK2A 2ZHBA 1NK7A 1JX4A 5KG1A 1L3TA 4MEYA 4AT7A 4X4PA 1JIHA 3EZ5A 3C1ZA 3TQ1A 4P4PA 1TK5A 4IG8A 4WC2A 5KFIA 1Z00B 3JPSA 4QZFA 4Z6FA 5L9XA 4DSKA 4M0AA 5DG9A 4X0BA 1XS9D 4Q45A 2J6UA 3IHQB 4PPXA 4ELTA 8ICLA 1X2IA 3ETLA 4UB3A 1U4BA 4DQSA 3OUYA 4F5PA 5DQIA 3EPGA 4ED6A 4M6WB 4DFJA 2HHSA 3ORYA 4YVZA 4ED0A 5IIMA 9ICJA 4GXKA 4I2BA 4EBCA 3Q8SB 2NRZA 2BQUA 3AQNA 2A1JA 3ZD8A 3BJYA 3C2MA 4EZ6A 5HRHA 1JQRA 3M8SA 1ZQGA 1V4AA 4RPYA 5KG3A 2BE3A 2RDIA 4BWMA 1OU5A 5KFYA 2KFZA 4KTQA 7ICPA 4QWAA 3RAQA 4F5NA 3TAQA 7ICLA 3PMLA 3C5FA 1WCLA 4J9KA 2J6TA 5IIOA 5CJ7A 2IBKA 4F2SA 3RB6A 3QEBZ 5HR9A 4R8UB 1RXVA 1RYRA 3GILA 1CEZA 1R89A 2ID1A 4R66A 4AT8B 4O3PA 1NJXA 4X4QA 4UQGA 3H40A 5KFVA 4TUQA 3GQCA 9ICBA 4WC0A 4X4OA 3V6HA 4E8FA 3OVSA 4PHAA 3OGUA 4CCHA 2BCSA 4KLDA 3LWMA 2JEGA 5HC9A 2ZH5A 2XCAA 4NLZA 1BVSA 5J2GA 4YXMA 1RPLA 4QZIA 4AT9A 1ZQRA 4NLNA 1ZQXA 1ZQYA 1S76D 4JK1A 3KHHA 3PW5A 3RRGA 1RXWA 3K4GA 1ZQDA 4I2CA 3T3FA 4BXOA 4WBZA 2MUTA 2AGQA 4M9HA 4I28A 4QZBA 5DG8A 1ZQHA 1A77A 8ICEA 4IRDA 4RWNA 4B9MA 3C2LA
chains in the Genus database with same CATH superfamily
4B6JA 4Y2VA 2QARA 4P4OA 2BPFA 3NUQA 5HRGA 3OSPA 3H0MB 5DLFA 3RR7A 1D8LA 1DRGA 5L1KA 1S5LU 5D61A 3MDAA 2LBOA 2NRWA 1LKYA 2ZUCA 4Q8EA 1BGXT 1QCKA 2DKXA 3RR8A 1DK3A 4OJLA 3C23A 2ZG6A 4EBJA 3OJSA 5KFWA 2DRBA 4AT7B 1XSPA 4KLIA 1MIVA 4JV2A 3GDXA 4OAHA 3C1YA 4IQUA 1JAJA 5A0LA 8ICXA 4KLHA 3EYZA 1ZJMA 3M7DA 5KAFU 3OVBA 1PK3A 4E80A 1DXSA 1SKWA 4BWJA 3HX0A 5KFDA 5CP2A 3QUCA 4JLXA 2HHWA 1UPHA 5DBCA 2WB1C 2YQEA 1J97A 4UB5A 3HJ4A 1BPYA 1NZBA 4PH5A 1RZTA 2W9AA 1QSYA 7ICRA 4B9TA 4WC5A 4DOAA 3KZXA 1L3SA 4GFJA 3FDSA 1BPEA 5C5JA 3EWAA 3SENA 1SKRA 3M6KA 4QZCA 5KFUA 4UATA 5ALJA 2D6FC 4O9MA 4K9AA 4JMUA 7ICIA 3M9OB 5AI6A 3WK6A 2RHFA 4Q44A 1XO0A 2EANA 3RBEA 2ZH9A 3OJUA 1VJ5A 4K98A 2KP7A 1S0OA 2ESEA 5DQGA 2ZH1A 2W7PA 1T8EA 9ICKA 3L4PA 4MFFA 5CR0A 4KLOA 3KTQA 4RT2A 8ICYA 2HOFA 2C2DA 2ALZA 3ZDAA 7ICJA 4IQWA 2DKZA 2XC9A 7ICGA 1T7PA 4ED3A 4ECWA 3HIYA 2F1JA 4YFKA 3PO5A 9ICQA 2WF7A 3HKZF 3SV3A 1PVRA 3WFPA 1KFSA 5JTIA 4KLTA 1Q8KA 2WAQC 3NTUA 3JPTA 5B3PA 3WK8A 8ICKA 2KKPA 3HILA 3NVWA 5ALWA 4RNMA 4X5VA 2ISPA 1S8OA 1SWWA 3WFQE 3QX7A 4EX7A 1TAUA 5AKEA 5KFGA 9ICPA 3PSPA 1N63A 1ZQIA 2Q66A 9ICWA 3H8SA 2KIWA 2XO7A 4B9VA 4US9A 1TFYA 2BDPA 3QNMA 4YR2A 4FHPA 2PBEA 1PK1A 3WKBA 4U6PA 2H3QA 3DEEA 5KFKA 3ZDCA 3IM1A 1H38A 3KKAA 2OH2A 2W9BB 1YZ7A 1ZQNA 1D8BA 3D6JA 3C2KA 4CNQA 5KFOA 2E8OA 1OXJA 4UD5A 2HMXA 1ZOLA 2WF9A 4UBBA 3QE9Y 3IN5A 4A8EA 4HX0A 3MR2A 3A0HU 3MBYA 4Y2XA 2W3SA 4F5QA 2OXOA 4N7RA 3PR5B 2KJ5A 1NK0A 4DFDA 4KLEA 3KHRA 3PSIA 3PR4A 4G3IA 1NKCA 2W9MA 4ELUA 4AYBC 5CFSA 2B56A 5KFLA 1ZQZA 4ECTA 5HR6A 1L6NA 5ALMA 4PGXA 2LM4A 1M6YA 2A19A 2K8BB 1U48A 5HRBA 3TANA 2G07A 3IG5A 3SI8A 2PI4A 4WOYA 2ZH3A 3UXNA 3TI0A 2Y0SF 2M2VA 2ZIUB 4PGYA 2B6GA 2PMZC 3ICXA 1ED1A 2KOBA 3V6KA 4K4IA 3MR6A 5F2VO 4Z6DA 4NLKA 3SR6A 1TK0A 4JWNA 3K1ZA 4WC3A 3HPOA 4F71A 5KFQA 5GTHU 5K4LA 2KMDA 3MCRA 2ZUDA 2NV3A 3WFOA 3G6XA 4DS5A 2ATLA 2G08A 3RBDA 8ICIA 5CRXA 3GV5B 1ZQTA 4EX6A 2KHQA 1KNYA 2ZH7A 2Y9TA 4F8RA 1X40A 2HCFA 1V85A 5ALXA 1NJZA 4YMNA 4M6WA 3MR3A 4M2YA 3OHAA 5KFJA 5EWGA 3PW2A 5J2JA 8ICHA 5J0OA 3JCFA 4NXVA 1KW4A 1K1SA 3C21A 2Y1JA 1WG8A 2KJ9A 1TAMA 4DFPA 1U47A 9ICSA 3NRZA 9ICGA 2FMSA 4R8UA 4MHVA 1ZETA 4AT8A 3NYBA 3NVYA 2BHNA 3NS1A 2R8HA 1TFWA 1UA0A 2BCQA 4MF2A 1QLNA 1BPZA 5D46A 4MEXA 4YG2A 2F3NA 4LJXA 2UVRA 2EAOA 4Q8FA 2W03A 3QZ8A 4X4TA 2YB1A 3OHBA 5ALDA 4WQLA 5DGAA 3F53A 1TFRA 2FPKA 5ALGA 4KLLA 1RDFA 3AN1A 1NK8A 5AM2A 7ICEA 3HRDD 2PFPA 1NK9A 8ICGA 5KL1B 3C29A 2OHFA 4RT3A 5KFTA 4BGDA 2DF4B 4J9QA 3TFSA 1XU4A 3N7RC 2EQYA 8ICOA 5KFEA 1NK5A 1FEZA 3PSTA 5AIAA 3L9DA 1Z1VA 2W04A 4I2AA 2W8LA 1JX4A 3KOOA 5KG1A 1L3TA 3F2DA 3F2CA 1K5OA 3WK9A 3C1ZA 4AP9A 4P4PA 4WC2A 4QZFA 4Z6FA 2KK0A 5E79U 5ALNA 1XS9D 1LVHA 3IHQB 4PPXA 1X2IA 3QU4A 4UB3A 4DQSA 5AK4A 4ED6A 3QUTA 4ED0A 4UAVA 4FZNA 3AMZA 3ZD8A 1HEKA 5JRTA 3BJYA 3C2MA 5HRHA 3M8SA 1JQRA 4RPYA 5KG3A 4KTQA 1MN8A 3RAQA 1UCVA 3C5FA 4J9KA 3EUB2 1VLBA 3BS5A 5HR9A 1TE2A 3OWGA 4R66A 3E58A 4UQGA 5KFVA 3GQCA 4WC0A 4X4OA 1N2XA 3OGUA 4AT9A 1ZQRA 4NLNA 4P0QA 1ZQYA 3PW5A 3BS7A 3FM9A 4CF5A 2CRXA 2K4HA 1ZQHA 4USAA 2KE7A 1V38A 1ZQPA 4FH5A 3SZ2A 4O68A 4E7XA 1LB2B 4GC6A 5J0XA 2A1AA 4YXJA 5AKLA 9ICFA 1N5WA 2M0NA 2F1HA 4DF4A 4RU9A 5IIJA 2Q4TA 2HBMA 2KVSA 1ZQUA 2O1PA 1SXDA 1ZQ1C 3TFRA 3MC1A 2I1QA 5AM0A 3Q8PB 5KT7A 2V4RA 2AQ4A 2O5AA 3PO4A 1SKSA 5KFFA 3LQCB 5ALRA 1OUQA 4M5DA 2CN1A 5KG7A 3M1YA 2BCUA 4QZAA 4KMUA 1L7NA 2HBLA 1ZRNA 4M9LA 1D8YA 4YR0A 2NYVA 4KLQA 5KT6A 1T3QA 4ICAA 1HIWA 3WKEA 2OM6A 1ZQEA 2JH1A 2ZH8A 4LVSA 4B9UA 1NNLA 3QEAZ 3WK5A 3HW8A 2BGWA 3I76A 3ZDBA 5IINA 3H7IA 5AKXA 4DL4A 5KT4A 2K8CB 4FH3A 1Y88A 5HREA 1Q3UA 2F1IA 4RNNA 4RQ2A 9ICAA 4NJ8A 3BQ7A 4C8LA 3C66A 4C4SA 2DBYA 3F5AA 3B0XA 2MUTB 2W7OA 4J9MA 5HRFA 1MC8A 1QTMA 2EZYA 5KG6A 3IDWA 3T5JA 2NO5A 2W9CB 3SYZA 1U9LA 9ICLA 2G0AA 4GC7A 4EV6A 1QQ7A 4LEYA 3Q8QB 4RWPA 3NKUA 1MSWD 3DDHA 3GU3A 3V7LA 4DSLA 7ICQA 2DR8A 2WB1F 1CUKA 3TARA 2DR7A 1KSPA 4GXIA 2DRAA 5AICA 3BDPA 4JV1A 2QB0A 2VANA 9ICTA 4OJOA 2C22A 2K60A 2G5IB 5HMMA 4F5OA 1UETA 4KLUA 3CYMA 2KSOB 4XQ8A 4F93B 4FO1A 8ICVA 2EH9A 2DR5A 3T5KA 3RFAA 1X9XA 4IL6U 2P35A 4PL1A 4F50A 4FS1A 2R18A 4ATBB 4DSJA 5CFUA 2YMLA 1Q46A 1X9SA 1QH9A 4C8OA 2MRLA 4RQ4A 2DPJA 5CEHA 4XRHA 8ICBA 4DLEA 4RQ7A 4RQ8A 4RPZA 5ALKA 4WC4A 5AHXA 3M8RA 4LEVA 4RPXA 2H5XA 1WCNA 4ECYA 4DSEA 2ISOA 3JPNA 2IMWP 4QJFB 3M6ZA 5KTQA 4O3SA 4OJ6A 3HJ1A 5J0UA 3F2BA 3IV6A 3UMCA 2GAFD 1PZNA 4TQRA 3H8MA 4JUZA 2WFAA 4UAZA 4YN4A 4DF8A 5J29A 1KL9A 3JYYA 4QNLA 1SXEA 2MAXA 1UT5A 4YMMA 4NM1A 3VC8A 5KNIA 5DKWA 4OAFA 4JLZA 4Y2RA 2PI5A 1ZYQA 4JB3A 2DUYA 2WAQF 4DQIA 5DGBA 2QKQA 4YQWA 2RQ5A 4MFCA 4DL6A 2NRTA 4OAGA 3ISDA 1S0MA 4I27A 2L5YA 4NY8A 5ALFA 3G6VA 2ZJ8A 4RQ0A 4F4YA 5DB6A 1ZQCA 4F4KA 3IRUA 4ZH4A 1VDVA 5DB8A 4ZOHC 1NI3A 4ED2A 4UAYA 5AKHA 2JZBA 4E0DA 5KFRA 1PVPA 2LYHA 1ZJNA 4O5EA 4WC6A 3KHLA 2NRVA 3OSNA 3JZ0A 4J9OA 2CXYA 2ZUBA 1P7DA 3TACB 3E2EA 2I6XA 4KLJA 1MIWA 1ZQVA 1A6SA 2GH1A 2I9GA 5DB9A 5HRDA 2HHXA 3PY8A 2ZH2A 5KFNA 3H0LB 4S3NA 4C7YA 1R8AA 2BKEA 2O6KA 5J0YA 5J0QA 1NK4A 4C4RA 2Z7JA 3MDCA 5J2DA 3I28A 5G5HA 2VA2A 4XQ7A 4DL5A 4O5KA 2DPIA 1D9FA 2W54A 4RQMA 3H39A 4M9JA 9ICNA 2VKQA 3U26A 1PVQA 4OJPA 3PW0A 5CA7A 1Z1BA 4EELA 1MQ3A 1Z19A 4JWMA 4AYBF 5DQHA 1Z00A 2E3TA 3HP6A 2FMPA 1SZHA 4CGZA 1NJYA 8ICWA 1XNSA 3CP8A 4F2RA 3QU2A 4YP3A 4UD4A 2W9CA 5J2AA 4WCWA 4JV0A 2PMZF 7ICFA 4DSIA 5KFHA 4M04A 1NO5A 4C8MA 7ICMA 2BBJA 3ISBA 4FO6A 4NLBA 4KB6A 5DLGA 5J2BA 4ED7A 2H3VA 4KLGA 9ICXA 3VCBA 8ICCA 4EP7A 2ZIXB 4FZMA 3PX0A 1LV5A 3IP4B 2C2EA 2K4EA 2KJ8A 1JXLA 2LYAA 3RH6A 4DSFA 3CW2C 2W8KA 4DQPA 5DECA 2WTFA 1TK8A 3D2QA 4RQ5A 2BR0A 4PHDA 4YCXA 3ZDEA 4CE6A 8ICNA 4LZDA 2H3ZA 4EEKA 3FYHA 1KFDA 1PUZA 3GV7B 4DL3A 3TAPA 4F4ZA 3EPIA 5D49A 5KG5A 2YMMA 4EEBA 3UQ2A 4CF3A 5F9NA 1X9WA 3SAFA 4R65A 4RQ6A 4C8KA 2LYBA 4AT7A 4X4PA 5AK5A 5AI9A 4IG8A 4UAUA 4J03A 4KM5A 3JPSA 2G06A 5L9XA 3ER8C 5EE0A 4Q45A 2I5HA 5AM5A 4Y2QA 4ELTA 1U4BA 4F5PA 5DQIA 3EPGA 3WK7A 4YVZA 5JTGA 9ICJA 2RP5A 4F72A 3D2SA 3UMBA 3R9KA 4EZ6A 1V4AA 1QQ5A 2RDIA 1ZD3A 2IOFA 4QWAA 3PMLA 2FI1A 2IBKA 1WCLA 2J6TA 3RB6A 3H40A 4TUQA 9ICBA 3E0FA 5HC9A 1FIQA 2LKYA 4NLZA 4YXMA 3KHHA 3RRGA 1RXWA 2IOHA 3T3FA 2AGQA 1L7MA 4M9HA 2H3IA 2XICA 2DWQA 4RWNA 4B9MA 3C2LA 4C7ZA 2YMQA 3LK9A 1ZRMA 8ICTA 8ICUA 4F4WA 1F0MA 3LVWA 4O3RA 1TKDA 4PZOA 1KDHA 3NVVA 4J9SA 2XVTA 4ECSA 5D62A 1ZQSA 2OWOA 1TVAA 1SL2A 1WWVA 3AEVA 3QU9A 4R64A 2P66A 4RZRA 4QIWC 1EXNA 4LT6A 2KFNA 2IHOA 3RJIA 3H4DA 5AKJA 2KKVA 2PKEA 4ED1A 2C28A 4EEDA 3I1YA 1YT3A 4FBTA 8ICRA 4LEZA 1ZQWA 2A3VA 1UA1A 4C4TA 5AM4A 4QWCA 4O0IA 2UVUA 2W11A 2E8PA 5HHHA 5D4BA 2VJ4A 4UARA 1FFVA 5J0TA 2XI9A 1VJ7A 3O0FA 1D9DA 4GIBA 1NKEA 3PHZA 2AHOB 8ICZA 4X4SA 5DG7A 2HI0A 1S10A 4FHXA 5AK6A 1X6JA 8ICPA 2FJ6A 1F44A 2F77X 1WYGA 2AGPA 4NWIA 1ZQJA 3K7DA 3GV8B 1UHUA 3PZPA 1NOMA 2HDOA 2JV3A 1SB3C 1BNPA 2Q0ZX 1URJA 5KFBA 2JMGA 2KIVA 4P4MA 2JR5A 4XA5A 3JPOA 2B0CA 3PV8A 1OW5A 2XY6A 3WFRE 4WC7A 4F4XA 7ICUA 5KT5A 1R8BA 2HOIA 2W9BA 2PFOA 3PMNA 5B3QA 2QARB 4DO9A 2HOQA 4QZHA 3Q8LA 5ALEA 2HHQA 2HBJA 2BCRA 4GLXA 2HW3A 8ICQA 4J9RA 3RAXA 2LPEA 2Y9UA 2F44A 3C28A 1ZD4A 3WU2U 1C20A 2EWRA 4DEZA 1IV8A 1QSLA 2AU0A 2JGAA 3RTVA 4KITB 3THVA 3UXOA 2LM1A 3RJKA 2AJQA 1IG6A 2G5HB 1ZQLA 1DGJA 1COKA 5TZVA 2BPGA 3LWLA 3T5HA 1SL0A 4O3NA 9ICUA 2YB4A 5KFCA 1SZPA 3K1RB 5EE1A 2AH5A 4RWQA 2W43A 5KFMA 2F76X 5DB7A 5HRLA 4MKPA 2ZIUA 4X4NA 1JI7A 5KG4A 4BUGA 4NXWA 3B0YA 3V7JA 4Y2UA 4U7CA 2KZZA 4O67A 3RB3A 4FHVA 3IG8A 2BQRA 4I29A 3H37A 4CF4A 1O03A 5J2KA 5KFSA 2RFFA 1IIPA 4RUCA 3RJJA 2BBHA 2FLPA 5CHEA 1DOQA 9ICOA 2DVIA 2BZFA 2AXTU 2ZXHA 5L1LA 3AQLA 3SQIA 5HP4A 3C18A 1S97A 5DEDA 3KHGA 2IHMA 4UASA 4DQQA 3OUYB 9ICEA 5AKKA 1ZQBA 2A1JB 1L8LA 1V9PA 2M9NA 1ECWA 4ECVA 3AQFA 1BPBA 3NGDA 2PFNA 3FAHA 4K97A 3B9JA 4NV0A 1A0PA 3V6JA 3CK6A 4I2EA 3T5LA 4ECZA 9ICRA 2V4QA 3HT3A 1TAQA 2KV2A 2R8IA 2QB1A 4Y2YA 1XSNA 3WKCA 3V7KA 4BXOB 5AIBA 1JALA 4XUSA 5C0YA 1S0NA 2XIDA 4PHEA 2ZTCA 2HBKA 2FMQA 4DL7A 2HVHA 4RQ3A 1ZXIA 3RF9A 4EBKA 1CI4A 5EWEA 2JEIA 3QZ7A 4NXXA 4IRKA 4IC9A 5EE9A 4YMOA 4M47A 3UPQA 3GZFA 4FBUA 5F9LA 4UBCA 3MGHA 4NLCA 1L3UA 4M9NA 2LHTA 2K4PA 4EENA 1MA7A 2B51A 1XC9A 1IXRA 2JXJA 2KZ3A 4KLFA 2DR9A 4QZDA 5J0PA 1QQ6A 4F5RA 1JMSA 1X66A 3OV7A 4ECUA 3AU2A 1PK1B 3NVZA 2K8AA 4O3QA 4X0AA 1L7OA 3TADC 4HAIA 3H4BA 4X4VA 4TQSA 1N5XA 4K4GA 2DFLA 2M2TA 3WKAA 2BCVA 4UB6U 3J81j 5CFTA 4QZ9A 2KHVA 5ALIA 5ALVA 2F2AB 4DFKA 3WFSC 1KLNA 5ALSA 5AM1A 5AKIA 2LI6A 5F3XB 3NVOA 5AKGA 3RRHA 2KZMA 1NK6A 3WK4A 3DV9A 1SV0A 4B9LA 3ER9B 4FZLA 3RB0A 5BOLA 2K4IA 5KFZA 5J8YC 1VFGA 3QUBA 4K9BA 8ICMA 2ZH6A 4F91B 2F8KA 2JHDA 5ALPA 3MGVA 4EBDA 3PNCA 5ALTA 5J2EA 3RJFA 3AUOA 2IOFK 5ALLA 5GTIU 5JU5A 2HHPA 3H8WA 4QZGA 2M2UA 4K99A 4C0ZA 4YD1A 4GXJA 5ALOA 1O08A 2FE9A 4C80A 5KFPA 4KX3A 3RJHA 5BPCA 3UM9A 2UVVA 4DCCA 3BQ1A 4KN7A 3JPQA 4C8NA 4KN4A 4PGQA 2HHTA 3WKDA 4TURA 3MR5A 9ICIA 7ICHA 2VA8A 5B5EU 3UQ0A 4FFDA 3LVVA 4X4UA 2XCPA 5HHIA 4DOCA 3M9NB 3TKAA 2Y1IA 3N7SC 2ZIVB 1IM4A 2ZHBA 2M2WA 4EZ9A 1DK2A 1NK7A 3SD7A 3EF2A 4MEYA 3EZ5A 3ALRA 1TK5A 4OJ5A 2KVCA 2WHEA 5DG9A 2WF5A 2RLTA 1RG6A 2J6UA 3QUQA 8ICLA 2ZIWB 3OUYA 2F8LA 5AI4A 4M6WB 3ORYA 5IIMA 4WH5A 4GXKA 4I2BA 4EBCA 2A1JA 4PJ0U 1ZQGA 2BE3A 1OU5A 4BWMA 2KFZA 3SAGA 7ICPA 4F5NA 7ICLA 1FFUA 3KBBA 2W55A 4R8UB 1RYRA 3GILA 1R89A 4AT8B 4O3PA 1NJXA 3ZI4A 2DL0A 3OVSA 3V6HA 4E8FA 2BCSA 2JEGA 2YMPA 2XCAA 1BVSA 4OCZA 4QZIA 3FC4A 1S76D 1ZQXA 1CRXA 1ZQDA 4BXOA 4WBZA 2MUTA 3BZKA 4PZNA 2H3FA 5ALYA 5DG8A 1SIJA 1A77A 8ICEA 4IRDA 1ZQQA 2HHUA 1KTQA 4FS2A 4NLGA 4TUSA 5J2FA 4ACOA 4NL9A 4UB8U 3GIJA 4WC1A 1L3VA 2R8GA 3ERCC 4DWIA 4MF8A 4I2IA 2AQ0A 1UQVA 3S6JA 5KAIU 2B21A 4BX9C 2GOLA 1B4FA 3L3FX 5L1JA 3Q8RB 1HUOA 1MQ2A 1SV0C 4I2DA 3ZD9A 3H8JA 5KG2A 7ICSA 4PHPA 2FPLA 3RH5A 4Y2PA 3BQ2A 1ZD2P 4DLGA 5IIIA 4FHYA 3G6YA 3AQEA 2KSOA 1X9MA 2BPCA 2G09A 3MGIA 1TV9A 4CRXA 4P2HA 4EGWA 1HUZA 3RJGA 3H3AA 3CNHA 5AM3A 3KFUF 4ATBA 5HNKA 5ALQA 3HWTA 3Q8KA 4Y2SA 4ECQA 2MA1A 2ASJA 1T94A 5J2IA 1COOA 5AI0A 5EWFA 2KEYA 1N56A 1A76A 1ZQFA 2EZXA 4O6AA 1ZD5A 4R63A 1NJWA 5DBAA 3AQMA 2KTQA 4J9LA 4TUPA 1KFTA 2ASDA 8ICJA 1NZPA 4B9NA 4NXUA 2XGQA 4WBYA 4X4RA 1L5UA 2R8KA 2FLNA 4QIWF 2J6SA 1B22A 3Q8MA 3QXGA 3BS5B 4K96A 3N7PD 3C5GA 1JN3A 3GFKB 4DOBA 1WOTA 4UAWA 1L8OA 1N62A 4AT9B 4P0QB 4Z6CA 2K89A 3HKZC 2GLEA 3QYPA 4P0PB 3A0BU 3L5KA 2AGOA 4WQKA 3JPPA 3H38A 1T3NA 2YX8A 1RYUA 2N1RA 5L1IA 4QWBA 3BQ0A 4Q43A 4M9GA 1KBUA 2HHVA 5KFXA 3V72A 1J2NA 1Z4NA 1BPDA 4F92B 3MFIA 2ODGA 2GO7A 3PSFA 3PX6A 4I2FA 4QZ8A 3LYSA 3ISCA 5DBBA 5KL8B 2FLLA 2VJ5A 7ICTA 7ICOA 2OYYA 1K1QA 5CB1A 2FCLA 2EAPA 2JEJA 1Z3EB 5DDYA 3JPRA 3RJEA 1PX5A 3NASA 5CHGA 2ZIVA 4O69A 2ZTDA 3SV4A 3OVAA 2BQ3A 4QWEA 5ALHA 1KEJA 5EE3A 5IILA 4NL9C 2VA3A 3EW9A 2RDJA 2WF6A 5CWRA 4NKTA 4BDPA 2ZIWA 5J2CA 4BJQA 2E8MA 2XY7A 1T4GA 1F5AA 2MU2A 1SV4A 4EBEA 7ICVA 1YZ6A 1B0XA 3GIKA 1ZQAA 3AQKA 4ED8A 1Z4OA 3AU6A 3PVXA 1UT8A 2PFQA 3D2NA 4J9NA 3LDAA 4B9SA 2E8NA 3OPXA 4NM2A 4FHWA 3UXPA 1KKXA 4QW8A 5BOMA 2YN4A 3BQTA 1SL1A 1KQQA 1N48A 1L7PA 1X6IA 1SGGA 1JROA 4QZEA 5IIKA 2NRKA 1RQNA 1BPXA 3KKAC 8ICSA 4I2JA 3GIMA 3MABA 2YTUA 1RYSA 1YLQA 4NXTA 9ICMA 5AI8A 4OAIZ 4XJEA 4I2HA 4ELVA 4RQNA 1MIYA 5AKYA 2WF8A 5FP0A 2YY6A 1AROP 2Y0SC 2CPRA 2D3DA 2ZJ5A 4IQTA 1WWUA 5AI5A 4ECXA 8ICAA 4O5CA 2IHNA 4QW9A 3RB4A 2QB0B 1DGSA 4FE3A 1S0VA 4IRCA 3PW7A 2XGPA 4WJ3B 3SEIA 3MFHA 4IR9A 5J0SA 5DDMA 1X42A 4F3OA 2ZIXA 4HYKA 1Q78A 2ZHAA 2XY5A 4K8VA 4RUAA 3QU7A 2FPMA 3NRWA 4KLMA 2P6UA 5KFAA 3T79A 4O3MA 4UB4A 5B66U 4OO1J 3QU5A 1B43A 2E5SA 4KMOB 4Y2TA 2R8JA 2JEFA 4QWDA 2VIXA 3KZIU 3K75D 2ASLA 1J2MA 5KT2A 3SMVA 1GPJA 2KD1A 3RH4A 1GO3F 5T14A 1U45A 1LKYB 5J0WA 1ZQKA 9ICVA 4G9BA 4UW9A 2W3RA 2HN1A 4EYIB 5HMLA 2P6RA 4IQVA 3F5EA 3ED5A 1XSLA 3AM9A 4I0UA 2ZTEA 5JUMA 2HVIA 1UEVA 4RNOA 1KRPA 5HRIA 3ONNA 5KG0A 4DS4A 2ES6A 1SWVA 2KN7A 4IS7A 3M9MB 4P0PA 9ICHA 3TADA 4I2GA 1JUDA 4UB1A 9ICCA 3UPSA 2E1EA 3OTQA 2HSZA 4LZGA 2ZXIA 5G5GA 5J2HA 2JH7A 4K4HA 5HRKA 4O3OA 1Q79A 5J0RA 2ZH4A 2BDUA 3N4MB 1NKBA 1JXEA 4DQRA 1S9FA 2KNJA 4OD0A 1XO1A 5EOZA 2KICA 1BNOA 2D8CA 2PXIA 2JZBB 2C2RA 4PL2A 2NO4A 2EAMA 2OCEA 1JRPA 5J8YA 2ZJAA 1S77D 4EEYA 3ETRA 2EZZA 3PW4A 5HR7A 2V9WA 1RQLA 2E1FA 3PX4A 4KLSA 3GIIA 4RWOA 1RM6C 4J9PA 2B4VA 5KT3A 3UMGA 1Q3VA 4YD2A 1ZQOA 4IR1A 4NXZA 1U49A 4NKUA 2UVWA 1ZQMA 1XWLA 3SAHA 5AK3A 4MFAA 1C7YA 1UEUA 2EDUA 4LEWA 1R8CA 8ICFA 4ECRA 7ICNA 7ICKA 4EYHB 1HJPA 2IA6A 4YR3A 1QSSA 4DFMA 3N97B 4Z6EA 3N28A 4DL2A 3ZDDA 2FDRA 2LMRA 2DGZA 4UB2A 2NRXA 2GWSA 4RQ1A 5D63A 1KN5A 2RRDA 2KG5A 1JIHA 3TQ1A 2QLTA 5KFIA 2JRZA 1Z00B 1AQ6A 4DSKA 4M0AA 4X0BA 5AKZA 5ALUA 3ETLA 5H2FU 2MSNA 1FA0A 4US8A 4DFJA 2HHSA 4CDGA 3Q8SB 1WUDA 2NRZA 5TISU 2BQUA 2OEHA 1V97A 2GA9D 3AQNA 2DQNB 5KFYA 3TAQA 1N60A 4F2SA 3H0RB 5IIOA 5CJ7A 3QEBZ 1RXVA 2ID1A 1CEZA 3CRXA 4X4QA 1FO4A 2HN2A 4PHAA 4CCHA 4KLDA 3LWMA 2ZH5A 3KD3A 1N61A 3HJEA 5J2GA 1RPLA 3BZCA 4JK1A 5ALZA 4KX5A 3K4GA 4I2CA 5L1MA 3AL0B 1F5SA 4I28A 4QZBA 2IUBA 3NWIA 4Y2JA
chains in the Genus database with same CATH topology
1ZQQA 1ZQPA 1KTQA 2HHUA 4FH5A 4P4OA 3SZ2A 3LK9A 2BPFA 8ICTA 8ICUA 4FS2A 4F4WA 4TUSA 5J2FA 4NLGA 5HRGA 4E7XA 1LB2B 4GC6A 3OSPA 3GIJA 4O3RA 5J0XA 4YXJA 4WC1A 1TKDA 1L3VA 2R8GA 9ICFA 4DWIA 4MF8A 4I2IA 2AQ0A 2F1HA 5DLFA 4DF4A 3RR7A 1D8LA 2B21A 4RU9A 1KDHA 5IIJA 5L1KA 4J9SA 5L1JA 4ECSA 3Q8RB 1ZQSA 1HUOA 2OWOA 2O1PA 1ZQUA 3MDAA 1MQ2A 1TVAA 1SL2A 4I2DA 2NRWA 3ZD9A 3H8JA 5KG2A 2ZUCA 3TFRA 4Q8EA 2I1QA 1BGXT 4R64A 2P66A 4PHPA 2FPLA 3RH5A 7ICSA 4RZRA 1EXNA 3BQ2A 4DLGA 3RR8A 5IIIA 3Q8PB 3G6YA 1DK3A 4FHYA 4LT6A 5KT7A 2KFNA 2V4RA 1X9MA 2AQ4A 2O5AA 3C23A 2BPCA 3RJIA 4EBJA 3PO4A 3OJSA 3H4DA 1SKSA 3MGIA 1TV9A 5KFFA 5KFWA 4ED1A 2C28A 3LQCB 4FBTA 4M5DA 2DRBA 4P2HA 8ICRA 1HUZA 3RJGA 4AT7B 5KG7A 1XSPA 3H3AA 4KLIA 2BCUA 1MIVA 4QZAA 4JV2A 4KMUA 3GDXA 4ATBA 5HNKA 1ZQWA 3C1YA 4IQUA 3HWTA 3Q8KA 1UA1A 4M9LA 1JAJA 1D8YA 4YR0A 8ICXA 4ECQA 2ASJA 5KT6A 4KLHA 4KLQA 4QWCA 4O0IA 2UVUA 5J2IA 3EYZA 1ZJMA 3OVBA 5HHHA 4E80A 5D4BA 1COOA 5EWFA 1ZQEA 1SKWA 2ZH8A 4BWJA 1N56A 1A76A 5J0TA 3HX0A 4LVSA 5KFDA 5CP2A 1ZQFA 4B9UA 2HHWA 1VJ7A 1D9DA 1NKEA 3QEAZ 4R63A 8ICZA 3HW8A 4X4SA 1NJWA 5DBAA 3AQMA 5DG7A 2KTQA 4J9LA 4TUPA 5DBCA 1S10A 2ASDA 2BGWA 1KFTA 4FHXA 8ICPA 4UB5A 8ICJA 3ZDBA 1NZPA 4B9NA 4WBYA 2XGQA 4X4RA 5IINA 3HJ4A 3H7IA 1L5UA 2R8KA 4DL4A 2AGPA 1BPYA 5KT4A 2FLNA 4PH5A 1ZQJA 4FH3A 1RZTA 2J6SA 3GV8B 1Y88A 1B22A 2W9AA 3Q8MA 5HREA 3C5GA 1JN3A 1NOMA 1QSYA 3GFKB 4DOBA 7ICRA 1WOTA 1BNPA 2F1IA 4RNNA 2Q0ZX 4UAWA 4RQ2A 4B9TA 9ICAA 4DOAA 4WC5A 5KFBA 1L3SA 4C8LA 4AT9B 3FDSA 4P4MA 1BPEA 5C5JA 4XA5A 4FHVA 3C66A 4Z6CA 3EWAA 1SKRA 3JPOA 4QZCA 5KFUA 3B0XA 3PV8A 2MUTB 2XY6A 2AGOA 4J9MA 5HRFA 3JPPA 3H38A 3WFRE 1MC8A 1T3NA 1QTMA 4WC7A 4O9MA 4F4XA 7ICUA 5KT5A 5L1IA 1R8BA 2W9BA 2PFOA 5KG6A 4QWBA 7ICIA 3M9OB 3PMNA 3BQ0A 3T5JA 4Q43A 2W9CB 4M9GA 3SYZA 1U9LA 2HHVA 5KFXA 9ICLA 4Q44A 4DO9A 4QZHA 3V72A 3RBEA 2ZH9A 3OJUA 4GC7A 3Q8LA 2KP7A 1BPDA 2HHQA 3Q8QB 4RWPA 1MSWD 7ICQA 3V7LA 4F92B 1S0OA 2BCRA 4DSLA 3MFIA 2DR8A 4GLXA 5DQGA 2HW3A 8ICQA 1T8EA 2ZH1A 1CUKA 4J9RA 3TARA 3RAXA 1KSPA 2DR7A 4GXIA 2DRAA 3BDPA 9ICKA 4JV1A 2VANA 3PX6A 4I2FA 4MFFA 4QZ8A 9ICTA 5CR0A 3ISCA 4KLOA 2C22A 3KTQA 5DBBA 2FLLA 5HMMA 4DEZA 4RT2A 4F5OA 8ICYA 1UETA 1QSLA 4KLUA 2AU0A 2C2DA 7ICOA 7ICTA 1K1QA 5CB1A 3RTVA 4KITB 2ALZA 2JEJA 3ZDAA 7ICJA 4IQWA 1Z3EB 5DDYA 3THVA 3JPRA 3UXOA 3RJKA 2XC9A 7ICGA 3RJEA 4XQ8A 4F93B 1T7PA 2AJQA 1PX5A 8ICVA 4ED3A 4ECWA 3HIYA 5CHGA 2DR5A 2F1JA 2ZTDA 4YFKA 1ZQLA 3SV4A 5TZVA 3T5KA 3PO5A 9ICQA 2BPGA 3LWLA 3SV3A 3T5HA 3OVAA 1SL0A 2BQ3A 4O3NA 4QWEA 1KEJA 1KFSA 3WFPA 4F50A 9ICUA 4FS1A 5IILA 5KFCA 4ATBB 4DSJA 2VA3A 4KLTA 1SZPA 3EW9A 3NTUA 3JPTA 2RDJA 4RWQA 8ICKA 1X9SA 5KFMA 4C8OA 5DB7A 5CWRA 4RQ4A 5HRLA 2DPJA 4NKTA 4X4NA 4XRHA 4BDPA 5KG4A 4RNMA 5J2CA 4X5VA 8ICBA 4DLEA 3B0YA 3V7JA 4RQ7A 4RQ8A 1T4GA 4RPZA 2XY7A 2ISPA 2KZZA 1F5AA 4WC4A 3M8RA 3WFQE 4RPXA 1TAUA 2H5XA 4EBEA 1WCNA 5KFGA 4ECYA 4DSEA 3RB3A 2BQRA 3GIKA 9ICPA 7ICVA 1ZQIA 2Q66A 4I29A 1ZQAA 3AQKA 4ED8A 2ISOA 9ICWA 3H8SA 3JPNA 2IMWP 3AU6A 3PVXA 1UT8A 5KTQA 2XO7A 2PFQA 4O3SA 3H37A 3HJ1A 4J9NA 3LDAA 5J0UA 4B9SA 4NM2A 4B9VA 1PZNA 5J2KA 4TQRA 4FHWA 3UXPA 5KFSA 2BDPA 2RFFA 1TFYA 4JUZA 4RUCA 4UAZA 4YN4A 4DF8A 4YR2A 5J29A 4QW8A 5BOMA 3RJJA 3BQTA 2PBEA 3JYYA 4FHPA 1SL1A 2FLPA 2MAXA 1N48A 1UT5A 4YMMA 4NM1A 5KFKA 1DOQA 9ICOA 2DVIA 3ZDCA 4QZEA 5DKWA 5L1LA 5IIKA 2NRKA 5HP4A 3IM1A 3AQLA 3C18A 1S97A 5DEDA 1BPXA 2PI5A 3KHGA 1H38A 2IHMA 4DQQA 1ZYQA 3OUYB 8ICSA 4DQIA 9ICEA 5DGBA 4YQWA 4I2JA 3GIMA 3MABA 4DL6A 4MFCA 2NRTA 2W9BB 3ISDA 1S0MA 1ZQNA 1RYSA 1ZQBA 4I27A 9ICMA 1YLQA 4I2HA 4NY8A 4ELVA 2A1JB 3C2KA 1MIYA 1V9PA 2M9NA 5KFOA 1AROP 2ZJ8A 3G6VA 4ECVA 4UD5A 1BPBA 4RQ0A 3NGDA 2PFNA 2ZJ5A 4IQTA 4F4YA 5DB6A 1ZQCA 4F4KA 4ECXA 4ZH4A 8ICAA 4O5CA 4UBBA 3V6JA 2IHNA 4QW9A 3RB4A 3QE9Y 4I2EA 5DB8A 3T5LA 4ECZA 1DGSA 9ICRA 2V4QA 1S0VA 4ED2A 4UAYA 3HT3A 3MR2A 2JZBA 4IRCA 3PW7A 3MBYA 4E0DA 1TAQA 5KFRA 2XGPA 2R8IA 4F5QA 2LYHA 1ZJNA 3PR5B 3MFHA 4IR9A 4O5EA 3KHLA 5J0SA 2NRVA 5DDMA 3OSNA 1NK0A 4WC6A 4KLEA 3JZ0A 3KHRA 1XSNA 4J9OA 3PR4A 2ZUBA 3V7KA 4F3OA 4G3IA 4BXOB 1NKCA 2W9MA 4ELUA 4HYKA 3E2EA 4KLJA 1Q78A 4XUSA 2ZHAA 1S0NA 1MIWA 2XY5A 1ZQVA 4PHEA 5KFLA 1ZQZA 4ECTA 2I9GA 4RUAA 5DB9A 2ZTCA 4PGXA 2FPMA 4KLMA 5HRDA 1U48A 3PY8A 2HHXA 2FMQA 3TANA 5HRBA 2P6UA 4DL7A 2ZH2A 5KFAA 2HVHA 4RQ3A 5KFNA 4EBKA 4UB4A 3SI8A 5EWEA 2JEIA 3QZ7A 2PI4A 4S3NA 1B43A 4IRKA 2R8JA 3UXNA 2JEFA 1R8AA 2ZH3A 4QWDA 4YMOA 3K75D 2ASLA 3TI0A 2M2VA 2BKEA 4PGYA 5KT2A 5J0YA 4M47A 5J0QA 1NK4A 3UPQA 3V6KA 3RH4A 4K4IA 3MR6A 3MDCA 1U45A 5J0WA 1ZQKA 5J2DA 9ICVA 2VA2A 5F2VO 4XQ7A 4FBUA 4Z6DA 4NLKA 4DL5A 4O5KA 2DPIA 1TK0A 1D9FA 4JWNA 5F9LA 4EYIB 5HMLA 3H39A 4WC3A 4UBCA 3MGHA 2P6RA 4M9JA 4IQVA 3HPOA 1L3UA 4M9NA 9ICNA 1XSLA 3PW0A 5KFQA 5CA7A 1XC9A 1IXRA 2KZ3A 1MQ3A 2ZTEA 4KLFA 2DR9A 5JUMA 4QZDA 5J0PA 4JWMA 2ZUDA 2HVIA 4F5RA 1JMSA 4RNOA 1UEVA 1KRPA 3WFOA 5DQHA 3OV7A 3G6XA 5HRIA 1Z00A 4ECUA 3AU2A 3HP6A 4DS5A 2ATLA 4O3QA 5KG0A 3RBDA 8ICIA 4X0AA 3GV5B 4DS4A 1ZQTA 1KNYA 2ZH7A 2FMPA 2KN7A 4F8RA 3M9MB 1NJYA 9ICHA 4I2GA 1NJZA 8ICWA 4YMNA 3H4BA 4UB1A 9ICCA 4X4VA 4TQSA 3UPSA 4M6WA 4K4GA 2DFLA 2M2TA 4F2RA 2BCVA 3MR3A 4M2YA 3OHAA 5KFJA 4QZ9A 3WFSC 5EWGA 4YP3A 4DFKA 3PW2A 4UD4A 2W9CA 5J2JA 1KLNA 5J2AA 4LZGA 4JV0A 5J0OA 8ICHA 7ICFA 4WCWA 1K1SA 5J2HA 4K4HA 5HRKA 4DSIA 3C21A 4O3OA 2Y1JA 1Q79A 5KFHA 5J0RA 4M04A 1NO5A 2ZH4A 4C8MA 4DFPA 3N4MB 1U47A 3ISBA 3RRHA 1NKBA 7ICMA 9ICSA 1JXEA 4DQRA 4FO6A 1S9FA 9ICGA 2FMSA 4R8UA 1ZETA 1NK6A 2KZMA 5DLGA 4AT8A 1XO1A 5EOZA 1BNOA 3NYBA 5J2BA 2BHNA 2R8HA 2PXIA 2C2RA 2JZBB 4ED7A 4B9LA 1TFWA 4KLGA 9ICXA 1UA0A 2BCQA 3RB0A 4MF2A 1QLNA 5BOLA 8ICCA 1BPZA 5KFZA 2ZJAA 1S77D 5D46A 4MEXA 4EP7A 4YG2A 4EEYA 1VFGA 3PX0A 3PW4A 2UVRA 1LV5A 2V9WA 4Q8FA 8ICMA 2ZH6A 4F91B 3PX4A 4KLSA 3GIIA 4EBDA 4RWOA 2C2EA 3PNCA 3QZ8A 4J9PA 3RH6A 5J2EA 1JXLA 3AUOA 3RJFA 4X4TA 1FA0A 4DSFA 5KT3A 2W8KA 2HHPA 3H8WA 4DQPA 4YD2A 3OHBA 2WTFA 4QZGA 5DGAA 1TK8A 5DECA 2M2UA 1ZQOA 1TFRA 2FPKA 4RQ5A 4IR1A 2BR0A 4NXZA 1U49A 4KLLA 4PHDA 4YD1A 1NK8A 4GXJA 4NKUA 2UVWA 1ZQMA 1XWLA 7ICEA 3RJHA 4YCXA 5KFPA 4MFAA 1NK9A 1C7YA 2PFPA 8ICGA 3ZDEA 5BPCA 1UEUA 2UVVA 3BQ1A 8ICNA 4KN7A 1R8CA 3JPQA 4C8NA 5KFTA 4BGDA 4KN4A 4RT3A 8ICFA 4PGQA 4LZDA 4ECRA 2HHTA 7ICKA 4EYHB 1HJPA 2IA6A 4TURA 3MR5A 7ICNA 9ICIA 4YR3A 7ICHA 4J9QA 3FYHA 1QSSA 3TFSA 1KFDA 2VA8A 1XU4A 3GV7B 4DL3A 3TAPA 5KFEA 3UQ0A 8ICOA 1NK5A 4DFMA 4F4ZA 4Z6EA 3N97B 4DL2A 3EPIA 5D49A 2XCPA 3ZDDA 4X4UA 5KG5A 3L9DA 5HHIA 4DOCA 3UQ2A 3M9NB 4UB2A 2Y1IA 2NRXA 5F9NA 2GWSA 4I2AA 2W8LA 4RQ1A 1IM4A 4R65A 4RQ6A 1X9WA 4C8KA 2M2WA 4EZ9A 1DK2A 2ZHBA 1NK7A 1JX4A 5KG1A 1L3TA 4MEYA 4AT7A 4X4PA 1JIHA 3EZ5A 3C1ZA 3TQ1A 4P4PA 1TK5A 4IG8A 4WC2A 5KFIA 1Z00B 3JPSA 4QZFA 4Z6FA 5L9XA 4DSKA 4M0AA 5DG9A 4X0BA 1XS9D 4Q45A 2J6UA 3IHQB 4PPXA 4ELTA 8ICLA 1X2IA 3ETLA 4UB3A 1U4BA 4DQSA 3OUYA 4F5PA 5DQIA 3EPGA 4ED6A 4M6WB 4DFJA 2HHSA 3ORYA 4YVZA 4ED0A 5IIMA 9ICJA 4GXKA 4I2BA 4EBCA 3Q8SB 2NRZA 2BQUA 3AQNA 2A1JA 3ZD8A 3BJYA 3C2MA 4EZ6A 5HRHA 1JQRA 3M8SA 1ZQGA 1V4AA 4RPYA 5KG3A 2BE3A 2RDIA 4BWMA 1OU5A 5KFYA 2KFZA 4KTQA 7ICPA 4QWAA 3RAQA 4F5NA 3TAQA 7ICLA 3PMLA 3C5FA 1WCLA 4J9KA 2J6TA 5IIOA 5CJ7A 2IBKA 4F2SA 3RB6A 3QEBZ 5HR9A 4R8UB 1RXVA 1RYRA 3GILA 1CEZA 1R89A 2ID1A 4R66A 4AT8B 4O3PA 1NJXA 4X4QA 4UQGA 3H40A 5KFVA 4TUQA 3GQCA 9ICBA 4WC0A 4X4OA 3V6HA 4E8FA 3OVSA 4PHAA 3OGUA 4CCHA 2BCSA 4KLDA 3LWMA 2JEGA 5HC9A 2ZH5A 2XCAA 4NLZA 1BVSA 5J2GA 4YXMA 1RPLA 4QZIA 4AT9A 1ZQRA 4NLNA 1ZQXA 1ZQYA 1S76D 4JK1A 3KHHA 3PW5A 3RRGA 1RXWA 3K4GA 1ZQDA 4I2CA 3T3FA 4BXOA 4WBZA 2MUTA 2AGQA 4M9HA 4I28A 4QZBA 5DG8A 1ZQHA 1A77A 8ICEA 4IRDA 4RWNA 4B9MA 3C2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQQ A;  1ZQP A;  1KTQ A;  2HHU A;  4FH5 A;  4P4O A;  3SZ2 A;  3LK9 A;  2BPF A;  8ICT A;  8ICU A;  4FS2 A;  4F4W A;  4TUS A;  5J2F A;  4NLG A;  5HRG A;  4E7X A;  1LB2 B;  4GC6 A;  3OSP A;  3GIJ A;  4O3R A;  5J0X A;  4YXJ A;  4WC1 A;  1TKD A;  1L3V A;  2R8G A;  9ICF A;  4DWI A;  4MF8 A;  4I2I A;  2AQ0 A;  2F1H A;  5DLF A;  4DF4 A;  3RR7 A;  1D8L A;  2B21 A;  4RU9 A;  1KDH A;  5IIJ A;  5L1K A;  4J9S A;  5L1J A;  4ECS A;  3Q8R B;  1ZQS A;  1HUO A;  2OWO A;  2O1P A;  1ZQU A;  3MDA A;  1MQ2 A;  1TVA A;  1SL2 A;  4I2D A;  2NRW A;  3ZD9 A;  3H8J A;  5KG2 A;  2ZUC A;  3TFR A;  4Q8E A;  2I1Q A;  1BGX T;  4R64 A;  2P66 A;  4PHP A;  2FPL A;  3RH5 A;  7ICS A;  4RZR A;  1EXN A;  3BQ2 A;  4DLG A;  3RR8 A;  5III A;  3Q8P B;  3G6Y A;  1DK3 A;  4FHY A;  4LT6 A;  5KT7 A;  2KFN A;  2V4R A;  1X9M A;  2AQ4 A;  2O5A A;  3C23 A;  2BPC A;  3RJI A;  4EBJ A;  3PO4 A;  3OJS A;  3H4D A;  1SKS A;  3MGI A;  1TV9 A;  5KFF A;  5KFW A;  4ED1 A;  2C28 A;  3LQC B;  4FBT A;  4M5D A;  2DRB A;  4P2H A;  8ICR A;  1HUZ A;  3RJG A;  4AT7 B;  5KG7 A;  1XSP A;  3H3A A;  4KLI A;  2BCU A;  1MIV A;  4QZA A;  4JV2 A;  4KMU A;  3GDX A;  4ATB A;  5HNK A;  1ZQW A;  3C1Y A;  4IQU A;  3HWT A;  3Q8K A;  1UA1 A;  4M9L A;  1JAJ A;  1D8Y A;  4YR0 A;  8ICX A;  4ECQ A;  2ASJ A;  5KT6 A;  4KLH A;  4KLQ A;  4QWC A;  4O0I A;  2UVU A;  5J2I A;  3EYZ A;  1ZJM A;  3OVB A;  5HHH A;  4E80 A;  5D4B A;  1COO A;  5EWF A;  1ZQE A;  1SKW A;  2ZH8 A;  4BWJ A;  1N56 A;  1A76 A;  5J0T A;  3HX0 A;  4LVS A;  5KFD A;  5CP2 A;  1ZQF A;  4B9U A;  2HHW A;  1VJ7 A;  1D9D A;  1NKE A;  3QEA Z;  4R63 A;  8ICZ A;  3HW8 A;  4X4S A;  1NJW A;  5DBA A;  3AQM A;  5DG7 A;  2KTQ A;  4J9L A;  4TUP A;  5DBC A;  1S10 A;  2ASD A;  2BGW A;  1KFT A;  4FHX A;  8ICP A;  4UB5 A;  8ICJ A;  3ZDB A;  1NZP A;  4B9N A;  4WBY A;  2XGQ A;  4X4R A;  5IIN A;  3HJ4 A;  3H7I A;  1L5U A;  2R8K A;  4DL4 A;  2AGP A;  1BPY A;  5KT4 A;  2FLN A;  4PH5 A;  1ZQJ A;  4FH3 A;  1RZT A;  2J6S A;  3GV8 B;  1Y88 A;  1B22 A;  2W9A A;  3Q8M A;  5HRE A;  3C5G A;  1JN3 A;  1NOM A;  1QSY A;  3GFK B;  4DOB A;  7ICR A;  1WOT A;  1BNP A;  2F1I A;  4RNN A;  2Q0Z X;  4UAW A;  4RQ2 A;  4B9T A;  9ICA A;  4DOA A;  4WC5 A;  5KFB A;  1L3S A;  4C8L A;  4AT9 B;  3FDS A;  4P4M A;  1BPE A;  5C5J A;  4XA5 A;  4FHV A;  3C66 A;  4Z6C A;  3EWA A;  1SKR A;  3JPO A;  4QZC A;  5KFU A;  3B0X A;  3PV8 A;  2MUT B;  2XY6 A;  2AGO A;  4J9M A;  5HRF A;  3JPP A;  3H38 A;  3WFR E;  1MC8 A;  1T3N A;  1QTM A;  4WC7 A;  4O9M A;  4F4X A;  7ICU A;  5KT5 A;  5L1I A;  1R8B A;  2W9B A;  2PFO A;  5KG6 A;  4QWB A;  7ICI A;  3M9O B;  3PMN A;  3BQ0 A;  3T5J A;  4Q43 A;  2W9C B;  4M9G A;  3SYZ A;  1U9L A;  2HHV A;  5KFX A;  9ICL A;  4Q44 A;  4DO9 A;  4QZH A;  3V72 A;  3RBE A;  2ZH9 A;  3OJU A;  4GC7 A;  3Q8L A;  2KP7 A;  1BPD A;  2HHQ A;  3Q8Q B;  4RWP A;  1MSW D;  7ICQ A;  3V7L A;  4F92 B;  1S0O A;  2BCR A;  4DSL A;  3MFI A;  2DR8 A;  4GLX A;  5DQG A;  2HW3 A;  8ICQ A;  1T8E A;  2ZH1 A;  1CUK A;  4J9R A;  3TAR A;  3RAX A;  1KSP A;  2DR7 A;  4GXI A;  2DRA A;  3BDP A;  9ICK A;  4JV1 A;  2VAN A;  3PX6 A;  4I2F A;  4MFF A;  4QZ8 A;  9ICT A;  5CR0 A;  3ISC A;  4KLO A;  2C22 A;  3KTQ A;  5DBB A;  2FLL A;  5HMM A;  4DEZ A;  4RT2 A;  4F5O A;  8ICY A;  1UET A;  1QSL A;  4KLU A;  2AU0 A;  2C2D A;  7ICO A;  7ICT A;  1K1Q A;  5CB1 A;  3RTV A;  4KIT B;  2ALZ A;  2JEJ A;  3ZDA A;  7ICJ A;  4IQW A;  1Z3E B;  5DDY A;  3THV A;  3JPR A;  3UXO A;  3RJK A;  2XC9 A;  7ICG A;  3RJE A;  4XQ8 A;  4F93 B;  1T7P A;  2AJQ A;  1PX5 A;  8ICV A;  4ED3 A;  4ECW A;  3HIY A;  5CHG A;  2DR5 A;  2F1J A;  2ZTD A;  4YFK A;  1ZQL A;  3SV4 A;  5TZV A;  3T5K A;  3PO5 A;  9ICQ A;  2BPG A;  3LWL A;  3SV3 A;  3T5H A;  3OVA A;  1SL0 A;  2BQ3 A;  4O3N A;  4QWE A;  1KEJ A;  1KFS A;  3WFP A;  4F50 A;  9ICU A;  4FS1 A;  5IIL A;  5KFC A;  4ATB B;  4DSJ A;  2VA3 A;  4KLT A;  1SZP A;  3EW9 A;  3NTU A;  3JPT A;  2RDJ A;  4RWQ A;  8ICK A;  1X9S A;  5KFM A;  4C8O A;  5DB7 A;  5CWR A;  4RQ4 A;  5HRL A;  2DPJ A;  4NKT A;  4X4N A;  4XRH A;  4BDP A;  5KG4 A;  4RNM A;  5J2C A;  4X5V A;  8ICB A;  4DLE A;  3B0Y A;  3V7J A;  4RQ7 A;  4RQ8 A;  1T4G A;  4RPZ A;  2XY7 A;  2ISP A;  2KZZ A;  1F5A A;  4WC4 A;  3M8R A;  3WFQ E;  4RPX A;  1TAU A;  2H5X A;  4EBE A;  1WCN A;  5KFG A;  4ECY A;  4DSE A;  3RB3 A;  2BQR A;  3GIK A;  9ICP A;  7ICV A;  1ZQI A;  2Q66 A;  4I29 A;  1ZQA A;  3AQK A;  4ED8 A;  2ISO A;  9ICW A;  3H8S A;  3JPN A;  2IMW P;  3AU6 A;  3PVX A;  1UT8 A;  5KTQ A;  2XO7 A;  2PFQ A;  4O3S A;  3H37 A;  3HJ1 A;  4J9N A;  3LDA A;  5J0U A;  4B9S A;  4NM2 A;  4B9V A;  1PZN A;  5J2K A;  4TQR A;  4FHW A;  3UXP A;  5KFS A;  2BDP A;  2RFF A;  1TFY A;  4JUZ A;  4RUC A;  4UAZ A;  4YN4 A;  4DF8 A;  4YR2 A;  5J29 A;  4QW8 A;  5BOM A;  3RJJ A;  3BQT A;  2PBE A;  3JYY A;  4FHP A;  1SL1 A;  2FLP A;  2MAX A;  1N48 A;  1UT5 A;  4YMM A;  4NM1 A;  5KFK A;  1DOQ A;  9ICO A;  2DVI A;  3ZDC A;  4QZE A;  5DKW A;  5L1L A;  5IIK A;  2NRK A;  5HP4 A;  3IM1 A;  3AQL A;  3C18 A;  1S97 A;  5DED A;  1BPX A;  2PI5 A;  3KHG A;  1H38 A;  2IHM A;  4DQQ A;  1ZYQ A;  3OUY B;  8ICS A;  4DQI A;  9ICE A;  5DGB A;  4YQW A;  4I2J A;  3GIM A;  3MAB A;  4DL6 A;  4MFC A;  2NRT A;  2W9B B;  3ISD A;  1S0M A;  1ZQN A;  1RYS A;  1ZQB A;  4I27 A;  9ICM A;  1YLQ A;  4I2H A;  4NY8 A;  4ELV A;  2A1J B;  3C2K A;  1MIY A;  1V9P A;  2M9N A;  5KFO A;  1ARO P;  2ZJ8 A;  3G6V A;  4ECV A;  4UD5 A;  1BPB A;  4RQ0 A;  3NGD A;  2PFN A;  2ZJ5 A;  4IQT A;  4F4Y A;  5DB6 A;  1ZQC A;  4F4K A;  4ECX A;  4ZH4 A;  8ICA A;  4O5C A;  4UBB A;  3V6J A;  2IHN A;  4QW9 A;  3RB4 A;  3QE9 Y;  4I2E A;  5DB8 A;  3T5L A;  4ECZ A;  1DGS A;  9ICR A;  2V4Q A;  1S0V A;  4ED2 A;  4UAY A;  3HT3 A;  3MR2 A;  2JZB A;  4IRC A;  3PW7 A;  3MBY A;  4E0D A;  1TAQ A;  5KFR A;  2XGP A;  2R8I A;  4F5Q A;  2LYH A;  1ZJN A;  3PR5 B;  3MFH A;  4IR9 A;  4O5E A;  3KHL A;  5J0S A;  2NRV A;  5DDM A;  3OSN A;  1NK0 A;  4WC6 A;  4KLE A;  3JZ0 A;  3KHR A;  1XSN A;  4J9O A;  3PR4 A;  2ZUB A;  3V7K A;  4F3O A;  4G3I A;  4BXO B;  1NKC A;  2W9M A;  4ELU A;  4HYK A;  3E2E A;  4KLJ A;  1Q78 A;  4XUS A;  2ZHA A;  1S0N A;  1MIW A;  2XY5 A;  1ZQV A;  4PHE A;  5KFL A;  1ZQZ A;  4ECT A;  2I9G A;  4RUA A;  5DB9 A;  2ZTC A;  4PGX A;  2FPM A;  4KLM A;  5HRD A;  1U48 A;  3PY8 A;  2HHX A;  2FMQ A;  3TAN A;  5HRB A;  2P6U A;  4DL7 A;  2ZH2 A;  5KFA A;  2HVH A;  4RQ3 A;  5KFN A;  4EBK A;  4UB4 A;  3SI8 A;  5EWE A;  2JEI A;  3QZ7 A;  2PI4 A;  4S3N A;  1B43 A;  4IRK A;  2R8J A;  3UXN A;  2JEF A;  1R8A A;  2ZH3 A;  4QWD A;  4YMO A;  3K75 D;  2ASL A;  3TI0 A;  2M2V A;  2BKE A;  4PGY A;  5KT2 A;  5J0Y A;  4M47 A;  5J0Q A;  1NK4 A;  3UPQ A;  3V6K A;  3RH4 A;  4K4I A;  3MR6 A;  3MDC A;  1U45 A;  5J0W A;  1ZQK A;  5J2D A;  9ICV A;  2VA2 A;  5F2V O;  4XQ7 A;  4FBU A;  4Z6D A;  4NLK A;  4DL5 A;  4O5K A;  2DPI A;  1TK0 A;  1D9F A;  4JWN A;  5F9L A;  4EYI B;  5HML A;  3H39 A;  4WC3 A;  4UBC A;  3MGH A;  2P6R A;  4M9J A;  4IQV A;  3HPO A;  1L3U A;  4M9N A;  9ICN A;  1XSL A;  3PW0 A;  5KFQ A;  5CA7 A;  1XC9 A;  1IXR A;  2KZ3 A;  1MQ3 A;  2ZTE A;  4KLF A;  2DR9 A;  5JUM A;  4QZD A;  5J0P A;  4JWM A;  2ZUD A;  2HVI A;  4F5R A;  1JMS A;  4RNO A;  1UEV A;  1KRP A;  3WFO A;  5DQH A;  3OV7 A;  3G6X A;  5HRI A;  1Z00 A;  4ECU A;  3AU2 A;  3HP6 A;  4DS5 A;  2ATL A;  4O3Q A;  5KG0 A;  3RBD A;  8ICI A;  4X0A A;  3GV5 B;  4DS4 A;  1ZQT A;  1KNY A;  2ZH7 A;  2FMP A;  2KN7 A;  4F8R A;  3M9M B;  1NJY A;  9ICH A;  4I2G A;  1NJZ A;  8ICW A;  4YMN A;  3H4B A;  4UB1 A;  9ICC A;  4X4V A;  4TQS A;  3UPS A;  4M6W A;  4K4G A;  2DFL A;  2M2T A;  4F2R A;  2BCV A;  3MR3 A;  4M2Y A;  3OHA A;  5KFJ A;  4QZ9 A;  3WFS C;  5EWG A;  4YP3 A;  4DFK A;  3PW2 A;  4UD4 A;  2W9C A;  5J2J A;  1KLN A;  5J2A A;  4LZG A;  4JV0 A;  5J0O A;  8ICH A;  7ICF A;  4WCW A;  1K1S A;  5J2H A;  4K4H A;  5HRK A;  4DSI A;  3C21 A;  4O3O A;  2Y1J A;  1Q79 A;  5KFH A;  5J0R A;  4M04 A;  1NO5 A;  2ZH4 A;  4C8M A;  4DFP A;  3N4M B;  1U47 A;  3ISB A;  3RRH A;  1NKB A;  7ICM A;  9ICS A;  1JXE A;  4DQR A;  4FO6 A;  1S9F A;  9ICG A;  2FMS A;  4R8U A;  1ZET A;  1NK6 A;  2KZM A;  5DLG A;  4AT8 A;  1XO1 A;  5EOZ A;  1BNO A;  3NYB A;  5J2B A;  2BHN A;  2R8H A;  2PXI A;  2C2R A;  2JZB B;  4ED7 A;  4B9L A;  1TFW A;  4KLG A;  9ICX A;  1UA0 A;  2BCQ A;  3RB0 A;  4MF2 A;  1QLN A;  5BOL A;  8ICC A;  1BPZ A;  5KFZ A;  2ZJA A;  1S77 D;  5D46 A;  4MEX A;  4EP7 A;  4YG2 A;  4EEY A;  1VFG A;  3PX0 A;  3PW4 A;  2UVR A;  1LV5 A;  2V9W A;  4Q8F A;  8ICM A;  2ZH6 A;  4F91 B;  3PX4 A;  4KLS A;  3GII A;  4EBD A;  4RWO A;  2C2E A;  3PNC A;  3QZ8 A;  4J9P A;  3RH6 A;  5J2E A;  1JXL A;  3AUO A;  3RJF A;  4X4T A;  1FA0 A;  4DSF A;  5KT3 A;  2W8K A;  2HHP A;  3H8W A;  4DQP A;  4YD2 A;  3OHB A;  2WTF A;  4QZG A;  5DGA A;  1TK8 A;  5DEC A;  2M2U A;  1ZQO A;  1TFR A;  2FPK A;  4RQ5 A;  4IR1 A;  2BR0 A;  4NXZ A;  1U49 A;  4KLL A;  4PHD A;  4YD1 A;  1NK8 A;  4GXJ A;  4NKU A;  2UVW A;  1ZQM A;  1XWL A;  7ICE A;  3RJH A;  4YCX A;  5KFP A;  4MFA A;  1NK9 A;  1C7Y A;  2PFP A;  8ICG A;  3ZDE A;  5BPC A;  1UEU A;  2UVV A;  3BQ1 A;  8ICN A;  4KN7 A;  1R8C A;  3JPQ A;  4C8N A;  5KFT A;  4BGD A;  4KN4 A;  4RT3 A;  8ICF A;  4PGQ A;  4LZD A;  4ECR A;  2HHT A;  7ICK A;  4EYH B;  1HJP A;  2IA6 A;  4TUR A;  3MR5 A;  7ICN A;  9ICI A;  4YR3 A;  7ICH A;  4J9Q A;  3FYH A;  1QSS A;  3TFS A;  1KFD A;  2VA8 A;  1XU4 A;  3GV7 B;  4DL3 A;  3TAP A;  5KFE A;  3UQ0 A;  8ICO A;  1NK5 A;  4DFM A;  4F4Z A;  4Z6E A;  3N97 B;  4DL2 A;  3EPI A;  5D49 A;  2XCP A;  3ZDD A;  4X4U A;  5KG5 A;  3L9D A;  5HHI A;  4DOC A;  3UQ2 A;  3M9N B;  4UB2 A;  2Y1I A;  2NRX A;  5F9N A;  2GWS A;  4I2A A;  2W8L A;  4RQ1 A;  1IM4 A;  4R65 A;  4RQ6 A;  1X9W A;  4C8K A;  2M2W A;  4EZ9 A;  1DK2 A;  2ZHB A;  1NK7 A;  1JX4 A;  5KG1 A;  1L3T A;  4MEY A;  4AT7 A;  4X4P A;  1JIH A;  3EZ5 A;  3C1Z A;  3TQ1 A;  4P4P A;  1TK5 A;  4IG8 A;  4WC2 A;  5KFI A;  1Z00 B;  3JPS A;  4QZF A;  4Z6F A;  5L9X A;  4DSK A;  4M0A A;  5DG9 A;  4X0B A;  1XS9 D;  4Q45 A;  2J6U A;  3IHQ B;  4PPX A;  4ELT A;  8ICL A;  1X2I A;  3ETL A;  4UB3 A;  1U4B A;  4DQS A;  3OUY A;  4F5P A;  5DQI A;  3EPG A;  4ED6 A;  4M6W B;  4DFJ A;  2HHS A;  3ORY A;  4YVZ A;  4ED0 A;  5IIM A;  9ICJ A;  4GXK A;  4I2B A;  4EBC A;  3Q8S B;  2NRZ A;  2BQU A;  3AQN A;  2A1J A;  3ZD8 A;  3BJY A;  3C2M A;  4EZ6 A;  5HRH A;  1JQR A;  3M8S A;  1ZQG A;  1V4A A;  4RPY A;  5KG3 A;  2BE3 A;  2RDI A;  4BWM A;  1OU5 A;  5KFY A;  2KFZ A;  4KTQ A;  7ICP A;  4QWA A;  3RAQ A;  4F5N A;  3TAQ A;  7ICL A;  3PML A;  3C5F A;  1WCL A;  4J9K A;  2J6T A;  5IIO A;  5CJ7 A;  2IBK A;  4F2S A;  3RB6 A;  3QEB Z;  5HR9 A;  4R8U B;  1RXV A;  1RYR A;  3GIL A;  1CEZ A;  1R89 A;  2ID1 A;  4R66 A;  4AT8 B;  4O3P A;  1NJX A;  4X4Q A;  4UQG A;  3H40 A;  5KFV A;  4TUQ A;  3GQC A;  9ICB A;  4WC0 A;  4X4O A;  3V6H A;  4E8F A;  3OVS A;  4PHA A;  3OGU A;  4CCH A;  2BCS A;  4KLD A;  3LWM A;  2JEG A;  5HC9 A;  2ZH5 A;  2XCA A;  4NLZ A;  1BVS A;  5J2G A;  4YXM A;  1RPL A;  4QZI A;  4AT9 A;  1ZQR A;  4NLN A;  1ZQX A;  1ZQY A;  1S76 D;  4JK1 A;  3KHH A;  3PW5 A;  3RRG A;  1RXW A;  3K4G A;  1ZQD A;  4I2C A;  3T3F A;  4BXO A;  4WBZ A;  2MUT A;  2AGQ A;  4M9H A;  4I28 A;  4QZB A;  5DG8 A;  1ZQH A;  1A77 A;  8ICE A;  4IRD A;  4RWN A;  4B9M A;  3C2L A; 
#chains in the Genus database with same CATH topology
 4B6J A;  4Y2V A;  2QAR A;  4P4O A;  2BPF A;  3NUQ A;  5HRG A;  3OSP A;  3H0M B;  5DLF A;  3RR7 A;  1D8L A;  1DRG A;  5L1K A;  1S5L U;  5D61 A;  3MDA A;  2LBO A;  2NRW A;  1LKY A;  2ZUC A;  4Q8E A;  1BGX T;  1QCK A;  2DKX A;  3RR8 A;  1DK3 A;  4OJL A;  3C23 A;  2ZG6 A;  4EBJ A;  3OJS A;  5KFW A;  2DRB A;  4AT7 B;  1XSP A;  4KLI A;  1MIV A;  4JV2 A;  3GDX A;  4OAH A;  3C1Y A;  4IQU A;  1JAJ A;  5A0L A;  8ICX A;  4KLH A;  3EYZ A;  1ZJM A;  3M7D A;  5KAF U;  3OVB A;  1PK3 A;  4E80 A;  1DXS A;  1SKW A;  4BWJ A;  3HX0 A;  5KFD A;  5CP2 A;  3QUC A;  4JLX A;  2HHW A;  1UPH A;  5DBC A;  2WB1 C;  2YQE A;  1J97 A;  4UB5 A;  3HJ4 A;  1BPY A;  1NZB A;  4PH5 A;  1RZT A;  2W9A A;  1QSY A;  7ICR A;  4B9T A;  4WC5 A;  4DOA A;  3KZX A;  1L3S A;  4GFJ A;  3FDS A;  1BPE A;  5C5J A;  3EWA A;  3SEN A;  1SKR A;  3M6K A;  4QZC A;  5KFU A;  4UAT A;  5ALJ A;  2D6F C;  4O9M A;  4K9A A;  4JMU A;  7ICI A;  3M9O B;  5AI6 A;  3WK6 A;  2RHF A;  4Q44 A;  1XO0 A;  2EAN A;  3RBE A;  2ZH9 A;  3OJU A;  1VJ5 A;  4K98 A;  2KP7 A;  1S0O A;  2ESE A;  5DQG A;  2ZH1 A;  2W7P A;  1T8E A;  9ICK A;  3L4P A;  4MFF A;  5CR0 A;  4KLO A;  3KTQ A;  4RT2 A;  8ICY A;  2HOF A;  2C2D A;  2ALZ A;  3ZDA A;  7ICJ A;  4IQW A;  2DKZ A;  2XC9 A;  7ICG A;  1T7P A;  4ED3 A;  4ECW A;  3HIY A;  2F1J A;  4YFK A;  3PO5 A;  9ICQ A;  2WF7 A;  3HKZ F;  3SV3 A;  1PVR A;  3WFP A;  1KFS A;  5JTI A;  4KLT A;  1Q8K A;  2WAQ C;  3NTU A;  3JPT A;  5B3P A;  3WK8 A;  8ICK A;  2KKP A;  3HIL A;  3NVW A;  5ALW A;  4RNM A;  4X5V A;  2ISP A;  1S8O A;  1SWW A;  3WFQ E;  3QX7 A;  4EX7 A;  1TAU A;  5AKE A;  5KFG A;  9ICP A;  3PSP A;  1N63 A;  1ZQI A;  2Q66 A;  9ICW A;  3H8S A;  2KIW A;  2XO7 A;  4B9V A;  4US9 A;  1TFY A;  2BDP A;  3QNM A;  4YR2 A;  4FHP A;  2PBE A;  1PK1 A;  3WKB A;  4U6P A;  2H3Q A;  3DEE A;  5KFK A;  3ZDC A;  3IM1 A;  1H38 A;  3KKA A;  2OH2 A;  2W9B B;  1YZ7 A;  1ZQN A;  1D8B A;  3D6J A;  3C2K A;  4CNQ A;  5KFO A;  2E8O A;  1OXJ A;  4UD5 A;  2HMX A;  1ZOL A;  2WF9 A;  4UBB A;  3QE9 Y;  3IN5 A;  4A8E A;  4HX0 A;  3MR2 A;  3A0H U;  3MBY A;  4Y2X A;  2W3S A;  4F5Q A;  2OXO A;  4N7R A;  3PR5 B;  2KJ5 A;  1NK0 A;  4DFD A;  4KLE A;  3KHR A;  3PSI A;  3PR4 A;  4G3I A;  1NKC A;  2W9M A;  4ELU A;  4AYB C;  5CFS A;  2B56 A;  5KFL A;  1ZQZ A;  4ECT A;  5HR6 A;  1L6N A;  5ALM A;  4PGX A;  2LM4 A;  1M6Y A;  2A19 A;  2K8B B;  1U48 A;  5HRB A;  3TAN A;  2G07 A;  3IG5 A;  3SI8 A;  2PI4 A;  4WOY A;  2ZH3 A;  3UXN A;  3TI0 A;  2Y0S F;  2M2V A;  2ZIU B;  4PGY A;  2B6G A;  2PMZ C;  3ICX A;  1ED1 A;  2KOB A;  3V6K A;  4K4I A;  3MR6 A;  5F2V O;  4Z6D A;  4NLK A;  3SR6 A;  1TK0 A;  4JWN A;  3K1Z A;  4WC3 A;  3HPO A;  4F71 A;  5KFQ A;  5GTH U;  5K4L A;  2KMD A;  3MCR A;  2ZUD A;  2NV3 A;  3WFO A;  3G6X A;  4DS5 A;  2ATL A;  2G08 A;  3RBD A;  8ICI A;  5CRX A;  3GV5 B;  1ZQT A;  4EX6 A;  2KHQ A;  1KNY A;  2ZH7 A;  2Y9T A;  4F8R A;  1X40 A;  2HCF A;  1V85 A;  5ALX A;  1NJZ A;  4YMN A;  4M6W A;  3MR3 A;  4M2Y A;  3OHA A;  5KFJ A;  5EWG A;  3PW2 A;  5J2J A;  8ICH A;  5J0O A;  3JCF A;  4NXV A;  1KW4 A;  1K1S A;  3C21 A;  2Y1J A;  1WG8 A;  2KJ9 A;  1TAM A;  4DFP A;  1U47 A;  9ICS A;  3NRZ A;  9ICG A;  2FMS A;  4R8U A;  4MHV A;  1ZET A;  4AT8 A;  3NYB A;  3NVY A;  2BHN A;  3NS1 A;  2R8H A;  1TFW A;  1UA0 A;  2BCQ A;  4MF2 A;  1QLN A;  1BPZ A;  5D46 A;  4MEX A;  4YG2 A;  2F3N A;  4LJX A;  2UVR A;  2EAO A;  4Q8F A;  2W03 A;  3QZ8 A;  4X4T A;  2YB1 A;  3OHB A;  5ALD A;  4WQL A;  5DGA A;  3F53 A;  1TFR A;  2FPK A;  5ALG A;  4KLL A;  1RDF A;  3AN1 A;  1NK8 A;  5AM2 A;  7ICE A;  3HRD D;  2PFP A;  1NK9 A;  8ICG A;  5KL1 B;  3C29 A;  2OHF A;  4RT3 A;  5KFT A;  4BGD A;  2DF4 B;  4J9Q A;  3TFS A;  1XU4 A;  3N7R C;  2EQY A;  8ICO A;  5KFE A;  1NK5 A;  1FEZ A;  3PST A;  5AIA A;  3L9D A;  1Z1V A;  2W04 A;  4I2A A;  2W8L A;  1JX4 A;  3KOO A;  5KG1 A;  1L3T A;  3F2D A;  3F2C A;  1K5O A;  3WK9 A;  3C1Z A;  4AP9 A;  4P4P A;  4WC2 A;  4QZF A;  4Z6F A;  2KK0 A;  5E79 U;  5ALN A;  1XS9 D;  1LVH A;  3IHQ B;  4PPX A;  1X2I A;  3QU4 A;  4UB3 A;  4DQS A;  5AK4 A;  4ED6 A;  3QUT A;  4ED0 A;  4UAV A;  4FZN A;  3AMZ A;  3ZD8 A;  1HEK A;  5JRT A;  3BJY A;  3C2M A;  5HRH A;  3M8S A;  1JQR A;  4RPY A;  5KG3 A;  4KTQ A;  1MN8 A;  3RAQ A;  1UCV A;  3C5F A;  4J9K A;  3EUB 2;  1VLB A;  3BS5 A;  5HR9 A;  1TE2 A;  3OWG A;  4R66 A;  3E58 A;  4UQG A;  5KFV A;  3GQC A;  4WC0 A;  4X4O A;  1N2X A;  3OGU A;  4AT9 A;  1ZQR A;  4NLN A;  4P0Q A;  1ZQY A;  3PW5 A;  3BS7 A;  3FM9 A;  4CF5 A;  2CRX A;  2K4H A;  1ZQH A;  4USA A;  2KE7 A;  1V38 A;  1ZQP A;  4FH5 A;  3SZ2 A;  4O68 A;  4E7X A;  1LB2 B;  4GC6 A;  5J0X A;  2A1A A;  4YXJ A;  5AKL A;  9ICF A;  1N5W A;  2M0N A;  2F1H A;  4DF4 A;  4RU9 A;  5IIJ A;  2Q4T A;  2HBM A;  2KVS A;  1ZQU A;  2O1P A;  1SXD A;  1ZQ1 C;  3TFR A;  3MC1 A;  2I1Q A;  5AM0 A;  3Q8P B;  5KT7 A;  2V4R A;  2AQ4 A;  2O5A A;  3PO4 A;  1SKS A;  5KFF A;  3LQC B;  5ALR A;  1OUQ A;  4M5D A;  2CN1 A;  5KG7 A;  3M1Y A;  2BCU A;  4QZA A;  4KMU A;  1L7N A;  2HBL A;  1ZRN A;  4M9L A;  1D8Y A;  4YR0 A;  2NYV A;  4KLQ A;  5KT6 A;  1T3Q A;  4ICA A;  1HIW A;  3WKE A;  2OM6 A;  1ZQE A;  2JH1 A;  2ZH8 A;  4LVS A;  4B9U A;  1NNL A;  3QEA Z;  3WK5 A;  3HW8 A;  2BGW A;  3I76 A;  3ZDB A;  5IIN A;  3H7I A;  5AKX A;  4DL4 A;  5KT4 A;  2K8C B;  4FH3 A;  1Y88 A;  5HRE A;  1Q3U A;  2F1I A;  4RNN A;  4RQ2 A;  9ICA A;  4NJ8 A;  3BQ7 A;  4C8L A;  3C66 A;  4C4S A;  2DBY A;  3F5A A;  3B0X A;  2MUT B;  2W7O A;  4J9M A;  5HRF A;  1MC8 A;  1QTM A;  2EZY A;  5KG6 A;  3IDW A;  3T5J A;  2NO5 A;  2W9C B;  3SYZ A;  1U9L A;  9ICL A;  2G0A A;  4GC7 A;  4EV6 A;  1QQ7 A;  4LEY A;  3Q8Q B;  4RWP A;  3NKU A;  1MSW D;  3DDH A;  3GU3 A;  3V7L A;  4DSL A;  7ICQ A;  2DR8 A;  2WB1 F;  1CUK A;  3TAR A;  2DR7 A;  1KSP A;  4GXI A;  2DRA A;  5AIC A;  3BDP A;  4JV1 A;  2QB0 A;  2VAN A;  9ICT A;  4OJO A;  2C22 A;  2K60 A;  2G5I B;  5HMM A;  4F5O A;  1UET A;  4KLU A;  3CYM A;  2KSO B;  4XQ8 A;  4F93 B;  4FO1 A;  8ICV A;  2EH9 A;  2DR5 A;  3T5K A;  3RFA A;  1X9X A;  4IL6 U;  2P35 A;  4PL1 A;  4F50 A;  4FS1 A;  2R18 A;  4ATB B;  4DSJ A;  5CFU A;  2YML A;  1Q46 A;  1X9S A;  1QH9 A;  4C8O A;  2MRL A;  4RQ4 A;  2DPJ A;  5CEH A;  4XRH A;  8ICB A;  4DLE A;  4RQ7 A;  4RQ8 A;  4RPZ A;  5ALK A;  4WC4 A;  5AHX A;  3M8R A;  4LEV A;  4RPX A;  2H5X A;  1WCN A;  4ECY A;  4DSE A;  2ISO A;  3JPN A;  2IMW P;  4QJF B;  3M6Z A;  5KTQ A;  4O3S A;  4OJ6 A;  3HJ1 A;  5J0U A;  3F2B A;  3IV6 A;  3UMC A;  2GAF D;  1PZN A;  4TQR A;  3H8M A;  4JUZ A;  2WFA A;  4UAZ A;  4YN4 A;  4DF8 A;  5J29 A;  1KL9 A;  3JYY A;  4QNL A;  1SXE A;  2MAX A;  1UT5 A;  4YMM A;  4NM1 A;  3VC8 A;  5KNI A;  5DKW A;  4OAF A;  4JLZ A;  4Y2R A;  2PI5 A;  1ZYQ A;  4JB3 A;  2DUY A;  2WAQ F;  4DQI A;  5DGB A;  2QKQ A;  4YQW A;  2RQ5 A;  4MFC A;  4DL6 A;  2NRT A;  4OAG A;  3ISD A;  1S0M A;  4I27 A;  2L5Y A;  4NY8 A;  5ALF A;  3G6V A;  2ZJ8 A;  4RQ0 A;  4F4Y A;  5DB6 A;  1ZQC A;  4F4K A;  3IRU A;  4ZH4 A;  1VDV A;  5DB8 A;  4ZOH C;  1NI3 A;  4ED2 A;  4UAY A;  5AKH A;  2JZB A;  4E0D A;  5KFR A;  1PVP A;  2LYH A;  1ZJN A;  4O5E A;  4WC6 A;  3KHL A;  2NRV A;  3OSN A;  3JZ0 A;  4J9O A;  2CXY A;  2ZUB A;  1P7D A;  3TAC B;  3E2E A;  2I6X A;  4KLJ A;  1MIW A;  1ZQV A;  1A6S A;  2GH1 A;  2I9G A;  5DB9 A;  5HRD A;  2HHX A;  3PY8 A;  2ZH2 A;  5KFN A;  3H0L B;  4S3N A;  4C7Y A;  1R8A A;  2BKE A;  2O6K A;  5J0Y A;  5J0Q A;  1NK4 A;  4C4R A;  2Z7J A;  3MDC A;  5J2D A;  3I28 A;  5G5H A;  2VA2 A;  4XQ7 A;  4DL5 A;  4O5K A;  2DPI A;  1D9F A;  2W54 A;  4RQM A;  3H39 A;  4M9J A;  9ICN A;  2VKQ A;  3U26 A;  1PVQ A;  4OJP A;  3PW0 A;  5CA7 A;  1Z1B A;  4EEL A;  1MQ3 A;  1Z19 A;  4JWM A;  4AYB F;  5DQH A;  1Z00 A;  2E3T A;  3HP6 A;  2FMP A;  1SZH A;  4CGZ A;  1NJY A;  8ICW A;  1XNS A;  3CP8 A;  4F2R A;  3QU2 A;  4YP3 A;  4UD4 A;  2W9C A;  5J2A A;  4WCW A;  4JV0 A;  2PMZ F;  7ICF A;  4DSI A;  5KFH A;  4M04 A;  1NO5 A;  4C8M A;  7ICM A;  2BBJ A;  3ISB A;  4FO6 A;  4NLB A;  4KB6 A;  5DLG A;  5J2B A;  4ED7 A;  2H3V A;  4KLG A;  9ICX A;  3VCB A;  8ICC A;  4EP7 A;  2ZIX B;  4FZM A;  3PX0 A;  1LV5 A;  3IP4 B;  2C2E A;  2K4E A;  2KJ8 A;  1JXL A;  2LYA A;  3RH6 A;  4DSF A;  3CW2 C;  2W8K A;  4DQP A;  5DEC A;  2WTF A;  1TK8 A;  3D2Q A;  4RQ5 A;  2BR0 A;  4PHD A;  4YCX A;  3ZDE A;  4CE6 A;  8ICN A;  4LZD A;  2H3Z A;  4EEK A;  3FYH A;  1KFD A;  1PUZ A;  3GV7 B;  4DL3 A;  3TAP A;  4F4Z A;  3EPI A;  5D49 A;  5KG5 A;  2YMM A;  4EEB A;  3UQ2 A;  4CF3 A;  5F9N A;  1X9W A;  3SAF A;  4R65 A;  4RQ6 A;  4C8K A;  2LYB A;  4AT7 A;  4X4P A;  5AK5 A;  5AI9 A;  4IG8 A;  4UAU A;  4J03 A;  4KM5 A;  3JPS A;  2G06 A;  5L9X A;  3ER8 C;  5EE0 A;  4Q45 A;  2I5H A;  5AM5 A;  4Y2Q A;  4ELT A;  1U4B A;  4F5P A;  5DQI A;  3EPG A;  3WK7 A;  4YVZ A;  5JTG A;  9ICJ A;  2RP5 A;  4F72 A;  3D2S A;  3UMB A;  3R9K A;  4EZ6 A;  1V4A A;  1QQ5 A;  2RDI A;  1ZD3 A;  2IOF A;  4QWA A;  3PML A;  2FI1 A;  2IBK A;  1WCL A;  2J6T A;  3RB6 A;  3H40 A;  4TUQ A;  9ICB A;  3E0F A;  5HC9 A;  1FIQ A;  2LKY A;  4NLZ A;  4YXM A;  3KHH A;  3RRG A;  1RXW A;  2IOH A;  3T3F A;  2AGQ A;  1L7M A;  4M9H A;  2H3I A;  2XIC A;  2DWQ A;  4RWN A;  4B9M A;  3C2L A;  4C7Z A;  2YMQ A;  3LK9 A;  1ZRM A;  8ICT A;  8ICU A;  4F4W A;  1F0M A;  3LVW A;  4O3R A;  1TKD A;  4PZO A;  1KDH A;  3NVV A;  4J9S A;  2XVT A;  4ECS A;  5D62 A;  1ZQS A;  2OWO A;  1TVA A;  1SL2 A;  1WWV A;  3AEV A;  3QU9 A;  4R64 A;  2P66 A;  4RZR A;  4QIW C;  1EXN A;  4LT6 A;  2KFN A;  2IHO A;  3RJI A;  3H4D A;  5AKJ A;  2KKV A;  2PKE A;  4ED1 A;  2C28 A;  4EED A;  3I1Y A;  1YT3 A;  4FBT A;  8ICR A;  4LEZ A;  1ZQW A;  2A3V A;  1UA1 A;  4C4T A;  5AM4 A;  4QWC A;  4O0I A;  2UVU A;  2W11 A;  2E8P A;  5HHH A;  5D4B A;  2VJ4 A;  4UAR A;  1FFV A;  5J0T A;  2XI9 A;  1VJ7 A;  3O0F A;  1D9D A;  4GIB A;  1NKE A;  3PHZ A;  2AHO B;  8ICZ A;  4X4S A;  5DG7 A;  2HI0 A;  1S10 A;  4FHX A;  5AK6 A;  1X6J A;  8ICP A;  2FJ6 A;  1F44 A;  2F77 X;  1WYG A;  2AGP A;  4NWI A;  1ZQJ A;  3K7D A;  3GV8 B;  1UHU A;  3PZP A;  1NOM A;  2HDO A;  2JV3 A;  1SB3 C;  1BNP A;  2Q0Z X;  1URJ A;  5KFB A;  2JMG A;  2KIV A;  4P4M A;  2JR5 A;  4XA5 A;  3JPO A;  2B0C A;  3PV8 A;  1OW5 A;  2XY6 A;  3WFR E;  4WC7 A;  4F4X A;  7ICU A;  5KT5 A;  1R8B A;  2HOI A;  2W9B A;  2PFO A;  3PMN A;  5B3Q A;  2QAR B;  4DO9 A;  2HOQ A;  4QZH A;  3Q8L A;  5ALE A;  2HHQ A;  2HBJ A;  2BCR A;  4GLX A;  2HW3 A;  8ICQ A;  4J9R A;  3RAX A;  2LPE A;  2Y9U A;  2F44 A;  3C28 A;  1ZD4 A;  3WU2 U;  1C20 A;  2EWR A;  4DEZ A;  1IV8 A;  1QSL A;  2AU0 A;  2JGA A;  3RTV A;  4KIT B;  3THV A;  3UXO A;  2LM1 A;  3RJK A;  2AJQ A;  1IG6 A;  2G5H B;  1ZQL A;  1DGJ A;  1COK A;  5TZV A;  2BPG A;  3LWL A;  3T5H A;  1SL0 A;  4O3N A;  9ICU A;  2YB4 A;  5KFC A;  1SZP A;  3K1R B;  5EE1 A;  2AH5 A;  4RWQ A;  2W43 A;  5KFM A;  2F76 X;  5DB7 A;  5HRL A;  4MKP A;  2ZIU A;  4X4N A;  1JI7 A;  5KG4 A;  4BUG A;  4NXW A;  3B0Y A;  3V7J A;  4Y2U A;  4U7C A;  2KZZ A;  4O67 A;  3RB3 A;  4FHV A;  3IG8 A;  2BQR A;  4I29 A;  3H37 A;  4CF4 A;  1O03 A;  5J2K A;  5KFS A;  2RFF A;  1IIP A;  4RUC A;  3RJJ A;  2BBH A;  2FLP A;  5CHE A;  1DOQ A;  9ICO A;  2DVI A;  2BZF A;  2AXT U;  2ZXH A;  5L1L A;  3AQL A;  3SQI A;  5HP4 A;  3C18 A;  1S97 A;  5DED A;  3KHG A;  2IHM A;  4UAS A;  4DQQ A;  3OUY B;  9ICE A;  5AKK A;  1ZQB A;  2A1J B;  1L8L A;  1V9P A;  2M9N A;  1ECW A;  4ECV A;  3AQF A;  1BPB A;  3NGD A;  2PFN A;  3FAH A;  4K97 A;  3B9J A;  4NV0 A;  1A0P A;  3V6J A;  3CK6 A;  4I2E A;  3T5L A;  4ECZ A;  9ICR A;  2V4Q A;  3HT3 A;  1TAQ A;  2KV2 A;  2R8I A;  2QB1 A;  4Y2Y A;  1XSN A;  3WKC A;  3V7K A;  4BXO B;  5AIB A;  1JAL A;  4XUS A;  5C0Y A;  1S0N A;  2XID A;  4PHE A;  2ZTC A;  2HBK A;  2FMQ A;  4DL7 A;  2HVH A;  4RQ3 A;  1ZXI A;  3RF9 A;  4EBK A;  1CI4 A;  5EWE A;  2JEI A;  3QZ7 A;  4NXX A;  4IRK A;  4IC9 A;  5EE9 A;  4YMO A;  4M47 A;  3UPQ A;  3GZF A;  4FBU A;  5F9L A;  4UBC A;  3MGH A;  4NLC A;  1L3U A;  4M9N A;  2LHT A;  2K4P A;  4EEN A;  1MA7 A;  2B51 A;  1XC9 A;  1IXR A;  2JXJ A;  2KZ3 A;  4KLF A;  2DR9 A;  4QZD A;  5J0P A;  1QQ6 A;  4F5R A;  1JMS A;  1X66 A;  3OV7 A;  4ECU A;  3AU2 A;  1PK1 B;  3NVZ A;  2K8A A;  4O3Q A;  4X0A A;  1L7O A;  3TAD C;  4HAI A;  3H4B A;  4X4V A;  4TQS A;  1N5X A;  4K4G A;  2DFL A;  2M2T A;  3WKA A;  2BCV A;  4UB6 U;  3J81 j;  5CFT A;  4QZ9 A;  2KHV A;  5ALI A;  5ALV A;  2F2A B;  4DFK A;  3WFS C;  1KLN A;  5ALS A;  5AM1 A;  5AKI A;  2LI6 A;  5F3X B;  3NVO A;  5AKG A;  3RRH A;  2KZM A;  1NK6 A;  3WK4 A;  3DV9 A;  1SV0 A;  4B9L A;  3ER9 B;  4FZL A;  3RB0 A;  5BOL A;  2K4I A;  5KFZ A;  5J8Y C;  1VFG A;  3QUB A;  4K9B A;  8ICM A;  2ZH6 A;  4F91 B;  2F8K A;  2JHD A;  5ALP A;  3MGV A;  4EBD A;  3PNC A;  5ALT A;  5J2E A;  3RJF A;  3AUO A;  2IOF K;  5ALL A;  5GTI U;  5JU5 A;  2HHP A;  3H8W A;  4QZG A;  2M2U A;  4K99 A;  4C0Z A;  4YD1 A;  4GXJ A;  5ALO A;  1O08 A;  2FE9 A;  4C80 A;  5KFP A;  4KX3 A;  3RJH A;  5BPC A;  3UM9 A;  2UVV A;  4DCC A;  3BQ1 A;  4KN7 A;  3JPQ A;  4C8N A;  4KN4 A;  4PGQ A;  2HHT A;  3WKD A;  4TUR A;  3MR5 A;  9ICI A;  7ICH A;  2VA8 A;  5B5E U;  3UQ0 A;  4FFD A;  3LVV A;  4X4U A;  2XCP A;  5HHI A;  4DOC A;  3M9N B;  3TKA A;  2Y1I A;  3N7S C;  2ZIV B;  1IM4 A;  2ZHB A;  2M2W A;  4EZ9 A;  1DK2 A;  1NK7 A;  3SD7 A;  3EF2 A;  4MEY A;  3EZ5 A;  3ALR A;  1TK5 A;  4OJ5 A;  2KVC A;  2WHE A;  5DG9 A;  2WF5 A;  2RLT A;  1RG6 A;  2J6U A;  3QUQ A;  8ICL A;  2ZIW B;  3OUY A;  2F8L A;  5AI4 A;  4M6W B;  3ORY A;  5IIM A;  4WH5 A;  4GXK A;  4I2B A;  4EBC A;  2A1J A;  4PJ0 U;  1ZQG A;  2BE3 A;  1OU5 A;  4BWM A;  2KFZ A;  3SAG A;  7ICP A;  4F5N A;  7ICL A;  1FFU A;  3KBB A;  2W55 A;  4R8U B;  1RYR A;  3GIL A;  1R89 A;  4AT8 B;  4O3P A;  1NJX A;  3ZI4 A;  2DL0 A;  3OVS A;  3V6H A;  4E8F A;  2BCS A;  2JEG A;  2YMP A;  2XCA A;  1BVS A;  4OCZ A;  4QZI A;  3FC4 A;  1S76 D;  1ZQX A;  1CRX A;  1ZQD A;  4BXO A;  4WBZ A;  2MUT A;  3BZK A;  4PZN A;  2H3F A;  5ALY A;  5DG8 A;  1SIJ A;  1A77 A;  8ICE A;  4IRD A;  1ZQQ A;  2HHU A;  1KTQ A;  4FS2 A;  4NLG A;  4TUS A;  5J2F A;  4ACO A;  4NL9 A;  4UB8 U;  3GIJ A;  4WC1 A;  1L3V A;  2R8G A;  3ERC C;  4DWI A;  4MF8 A;  4I2I A;  2AQ0 A;  1UQV A;  3S6J A;  5KAI U;  2B21 A;  4BX9 C;  2GOL A;  1B4F A;  3L3F X;  5L1J A;  3Q8R B;  1HUO A;  1MQ2 A;  1SV0 C;  4I2D A;  3ZD9 A;  3H8J A;  5KG2 A;  7ICS A;  4PHP A;  2FPL A;  3RH5 A;  4Y2P A;  3BQ2 A;  1ZD2 P;  4DLG A;  5III A;  4FHY A;  3G6Y A;  3AQE A;  2KSO A;  1X9M A;  2BPC A;  2G09 A;  3MGI A;  1TV9 A;  4CRX A;  4P2H A;  4EGW A;  1HUZ A;  3RJG A;  3H3A A;  3CNH A;  5AM3 A;  3KFU F;  4ATB A;  5HNK A;  5ALQ A;  3HWT A;  3Q8K A;  4Y2S A;  4ECQ A;  2MA1 A;  2ASJ A;  1T94 A;  5J2I A;  1COO A;  5AI0 A;  5EWF A;  2KEY A;  1N56 A;  1A76 A;  1ZQF A;  2EZX A;  4O6A A;  1ZD5 A;  4R63 A;  1NJW A;  5DBA A;  3AQM A;  2KTQ A;  4J9L A;  4TUP A;  1KFT A;  2ASD A;  8ICJ A;  1NZP A;  4B9N A;  4NXU A;  2XGQ A;  4WBY A;  4X4R A;  1L5U A;  2R8K A;  2FLN A;  4QIW F;  2J6S A;  1B22 A;  3Q8M A;  3QXG A;  3BS5 B;  4K96 A;  3N7P D;  3C5G A;  1JN3 A;  3GFK B;  4DOB A;  1WOT A;  4UAW A;  1L8O A;  1N62 A;  4AT9 B;  4P0Q B;  4Z6C A;  2K89 A;  3HKZ C;  2GLE A;  3QYP A;  4P0P B;  3A0B U;  3L5K A;  2AGO A;  4WQK A;  3JPP A;  3H38 A;  1T3N A;  2YX8 A;  1RYU A;  2N1R A;  5L1I A;  4QWB A;  3BQ0 A;  4Q43 A;  4M9G A;  1KBU A;  2HHV A;  5KFX A;  3V72 A;  1J2N A;  1Z4N A;  1BPD A;  4F92 B;  3MFI A;  2ODG A;  2GO7 A;  3PSF A;  3PX6 A;  4I2F A;  4QZ8 A;  3LYS A;  3ISC A;  5DBB A;  5KL8 B;  2FLL A;  2VJ5 A;  7ICT A;  7ICO A;  2OYY A;  1K1Q A;  5CB1 A;  2FCL A;  2EAP A;  2JEJ A;  1Z3E B;  5DDY A;  3JPR A;  3RJE A;  1PX5 A;  3NAS A;  5CHG A;  2ZIV A;  4O69 A;  2ZTD A;  3SV4 A;  3OVA A;  2BQ3 A;  4QWE A;  5ALH A;  1KEJ A;  5EE3 A;  5IIL A;  4NL9 C;  2VA3 A;  3EW9 A;  2RDJ A;  2WF6 A;  5CWR A;  4NKT A;  4BDP A;  2ZIW A;  5J2C A;  4BJQ A;  2E8M A;  2XY7 A;  1T4G A;  1F5A A;  2MU2 A;  1SV4 A;  4EBE A;  7ICV A;  1YZ6 A;  1B0X A;  3GIK A;  1ZQA A;  3AQK A;  4ED8 A;  1Z4O A;  3AU6 A;  3PVX A;  1UT8 A;  2PFQ A;  3D2N A;  4J9N A;  3LDA A;  4B9S A;  2E8N A;  3OPX A;  4NM2 A;  4FHW A;  3UXP A;  1KKX A;  4QW8 A;  5BOM A;  2YN4 A;  3BQT A;  1SL1 A;  1KQQ A;  1N48 A;  1L7P A;  1X6I A;  1SGG A;  1JRO A;  4QZE A;  5IIK A;  2NRK A;  1RQN A;  1BPX A;  3KKA C;  8ICS A;  4I2J A;  3GIM A;  3MAB A;  2YTU A;  1RYS A;  1YLQ A;  4NXT A;  9ICM A;  5AI8 A;  4OAI Z;  4XJE A;  4I2H A;  4ELV A;  4RQN A;  1MIY A;  5AKY A;  2WF8 A;  5FP0 A;  2YY6 A;  1ARO P;  2Y0S C;  2CPR A;  2D3D A;  2ZJ5 A;  4IQT A;  1WWU A;  5AI5 A;  4ECX A;  8ICA A;  4O5C A;  2IHN A;  4QW9 A;  3RB4 A;  2QB0 B;  1DGS A;  4FE3 A;  1S0V A;  4IRC A;  3PW7 A;  2XGP A;  4WJ3 B;  3SEI A;  3MFH A;  4IR9 A;  5J0S A;  5DDM A;  1X42 A;  4F3O A;  2ZIX A;  4HYK A;  1Q78 A;  2ZHA A;  2XY5 A;  4K8V A;  4RUA A;  3QU7 A;  2FPM A;  3NRW A;  4KLM A;  2P6U A;  5KFA A;  3T79 A;  4O3M A;  4UB4 A;  5B66 U;  4OO1 J;  3QU5 A;  1B43 A;  2E5S A;  4KMO B;  4Y2T A;  2R8J A;  2JEF A;  4QWD A;  2VIX A;  3KZI U;  3K75 D;  2ASL A;  1J2M A;  5KT2 A;  3SMV A;  1GPJ A;  2KD1 A;  3RH4 A;  1GO3 F;  5T14 A;  1U45 A;  1LKY B;  5J0W A;  1ZQK A;  9ICV A;  4G9B A;  4UW9 A;  2W3R A;  2HN1 A;  4EYI B;  5HML A;  2P6R A;  4IQV A;  3F5E A;  3ED5 A;  1XSL A;  3AM9 A;  4I0U A;  2ZTE A;  5JUM A;  2HVI A;  1UEV A;  4RNO A;  1KRP A;  5HRI A;  3ONN A;  5KG0 A;  4DS4 A;  2ES6 A;  1SWV A;  2KN7 A;  4IS7 A;  3M9M B;  4P0P A;  9ICH A;  3TAD A;  4I2G A;  1JUD A;  4UB1 A;  9ICC A;  3UPS A;  2E1E A;  3OTQ A;  2HSZ A;  4LZG A;  2ZXI A;  5G5G A;  5J2H A;  2JH7 A;  4K4H A;  5HRK A;  4O3O A;  1Q79 A;  5J0R A;  2ZH4 A;  2BDU A;  3N4M B;  1NKB A;  1JXE A;  4DQR A;  1S9F A;  2KNJ A;  4OD0 A;  1XO1 A;  5EOZ A;  2KIC A;  1BNO A;  2D8C A;  2PXI A;  2JZB B;  2C2R A;  4PL2 A;  2NO4 A;  2EAM A;  2OCE A;  1JRP A;  5J8Y A;  2ZJA A;  1S77 D;  4EEY A;  3ETR A;  2EZZ A;  3PW4 A;  5HR7 A;  2V9W A;  1RQL A;  2E1F A;  3PX4 A;  4KLS A;  3GII A;  4RWO A;  1RM6 C;  4J9P A;  2B4V A;  5KT3 A;  3UMG A;  1Q3V A;  4YD2 A;  1ZQO A;  4IR1 A;  4NXZ A;  1U49 A;  4NKU A;  2UVW A;  1ZQM A;  1XWL A;  3SAH A;  5AK3 A;  4MFA A;  1C7Y A;  1UEU A;  2EDU A;  4LEW A;  1R8C A;  8ICF A;  4ECR A;  7ICN A;  7ICK A;  4EYH B;  1HJP A;  2IA6 A;  4YR3 A;  1QSS A;  4DFM A;  3N97 B;  4Z6E A;  3N28 A;  4DL2 A;  3ZDD A;  2FDR A;  2LMR A;  2DGZ A;  4UB2 A;  2NRX A;  2GWS A;  4RQ1 A;  5D63 A;  1KN5 A;  2RRD A;  2KG5 A;  1JIH A;  3TQ1 A;  2QLT A;  5KFI A;  2JRZ A;  1Z00 B;  1AQ6 A;  4DSK A;  4M0A A;  4X0B A;  5AKZ A;  5ALU A;  3ETL A;  5H2F U;  2MSN A;  1FA0 A;  4US8 A;  4DFJ A;  2HHS A;  4CDG A;  3Q8S B;  1WUD A;  2NRZ A;  5TIS U;  2BQU A;  2OEH A;  1V97 A;  2GA9 D;  3AQN A;  2DQN B;  5KFY A;  3TAQ A;  1N60 A;  4F2S A;  3H0R B;  5IIO A;  5CJ7 A;  3QEB Z;  1RXV A;  2ID1 A;  1CEZ A;  3CRX A;  4X4Q A;  1FO4 A;  2HN2 A;  4PHA A;  4CCH A;  4KLD A;  3LWM A;  2ZH5 A;  3KD3 A;  1N61 A;  3HJE A;  5J2G A;  1RPL A;  3BZC A;  4JK1 A;  5ALZ A;  4KX5 A;  3K4G A;  4I2C A;  5L1M A;  3AL0 B;  1F5S A;  4I28 A;  4QZB A;  2IUB A;  3NWI A;  4Y2J A; 
#chains in the Genus database with same CATH homology
 1ZQQ A;  1ZQP A;  1KTQ A;  2HHU A;  4FH5 A;  4P4O A;  3SZ2 A;  3LK9 A;  2BPF A;  8ICT A;  8ICU A;  4FS2 A;  4F4W A;  4TUS A;  5J2F A;  4NLG A;  5HRG A;  4E7X A;  1LB2 B;  4GC6 A;  3OSP A;  3GIJ A;  4O3R A;  5J0X A;  4YXJ A;  4WC1 A;  1TKD A;  1L3V A;  2R8G A;  9ICF A;  4DWI A;  4MF8 A;  4I2I A;  2AQ0 A;  2F1H A;  5DLF A;  4DF4 A;  3RR7 A;  1D8L A;  2B21 A;  4RU9 A;  1KDH A;  5IIJ A;  5L1K A;  4J9S A;  5L1J A;  4ECS A;  3Q8R B;  1ZQS A;  1HUO A;  2OWO A;  2O1P A;  1ZQU A;  3MDA A;  1MQ2 A;  1TVA A;  1SL2 A;  4I2D A;  2NRW A;  3ZD9 A;  3H8J A;  5KG2 A;  2ZUC A;  3TFR A;  4Q8E A;  2I1Q A;  1BGX T;  4R64 A;  2P66 A;  4PHP A;  2FPL A;  3RH5 A;  7ICS A;  4RZR A;  1EXN A;  3BQ2 A;  4DLG A;  3RR8 A;  5III A;  3Q8P B;  3G6Y A;  1DK3 A;  4FHY A;  4LT6 A;  5KT7 A;  2KFN A;  2V4R A;  1X9M A;  2AQ4 A;  2O5A A;  3C23 A;  2BPC A;  3RJI A;  4EBJ A;  3PO4 A;  3OJS A;  3H4D A;  1SKS A;  3MGI A;  1TV9 A;  5KFF A;  5KFW A;  4ED1 A;  2C28 A;  3LQC B;  4FBT A;  4M5D A;  2DRB A;  4P2H A;  8ICR A;  1HUZ A;  3RJG A;  4AT7 B;  5KG7 A;  1XSP A;  3H3A A;  4KLI A;  2BCU A;  1MIV A;  4QZA A;  4JV2 A;  4KMU A;  3GDX A;  4ATB A;  5HNK A;  1ZQW A;  3C1Y A;  4IQU A;  3HWT A;  3Q8K A;  1UA1 A;  4M9L A;  1JAJ A;  1D8Y A;  4YR0 A;  8ICX A;  4ECQ A;  2ASJ A;  5KT6 A;  4KLH A;  4KLQ A;  4QWC A;  4O0I A;  2UVU A;  5J2I A;  3EYZ A;  1ZJM A;  3OVB A;  5HHH A;  4E80 A;  5D4B A;  1COO A;  5EWF A;  1ZQE A;  1SKW A;  2ZH8 A;  4BWJ A;  1N56 A;  1A76 A;  5J0T A;  3HX0 A;  4LVS A;  5KFD A;  5CP2 A;  1ZQF A;  4B9U A;  2HHW A;  1VJ7 A;  1D9D A;  1NKE A;  3QEA Z;  4R63 A;  8ICZ A;  3HW8 A;  4X4S A;  1NJW A;  5DBA A;  3AQM A;  5DG7 A;  2KTQ A;  4J9L A;  4TUP A;  5DBC A;  1S10 A;  2ASD A;  2BGW A;  1KFT A;  4FHX A;  8ICP A;  4UB5 A;  8ICJ A;  3ZDB A;  1NZP A;  4B9N A;  4WBY A;  2XGQ A;  4X4R A;  5IIN A;  3HJ4 A;  3H7I A;  1L5U A;  2R8K A;  4DL4 A;  2AGP A;  1BPY A;  5KT4 A;  2FLN A;  4PH5 A;  1ZQJ A;  4FH3 A;  1RZT A;  2J6S A;  3GV8 B;  1Y88 A;  1B22 A;  2W9A A;  3Q8M A;  5HRE A;  3C5G A;  1JN3 A;  1NOM A;  1QSY A;  3GFK B;  4DOB A;  7ICR A;  1WOT A;  1BNP A;  2F1I A;  4RNN A;  2Q0Z X;  4UAW A;  4RQ2 A;  4B9T A;  9ICA A;  4DOA A;  4WC5 A;  5KFB A;  1L3S A;  4C8L A;  4AT9 B;  3FDS A;  4P4M A;  1BPE A;  5C5J A;  4XA5 A;  4FHV A;  3C66 A;  4Z6C A;  3EWA A;  1SKR A;  3JPO A;  4QZC A;  5KFU A;  3B0X A;  3PV8 A;  2MUT B;  2XY6 A;  2AGO A;  4J9M A;  5HRF A;  3JPP A;  3H38 A;  3WFR E;  1MC8 A;  1T3N A;  1QTM A;  4WC7 A;  4O9M A;  4F4X A;  7ICU A;  5KT5 A;  5L1I A;  1R8B A;  2W9B A;  2PFO A;  5KG6 A;  4QWB A;  7ICI A;  3M9O B;  3PMN A;  3BQ0 A;  3T5J A;  4Q43 A;  2W9C B;  4M9G A;  3SYZ A;  1U9L A;  2HHV A;  5KFX A;  9ICL A;  4Q44 A;  4DO9 A;  4QZH A;  3V72 A;  3RBE A;  2ZH9 A;  3OJU A;  4GC7 A;  3Q8L A;  2KP7 A;  1BPD A;  2HHQ A;  3Q8Q B;  4RWP A;  1MSW D;  7ICQ A;  3V7L A;  4F92 B;  1S0O A;  2BCR A;  4DSL A;  3MFI A;  2DR8 A;  4GLX A;  5DQG A;  2HW3 A;  8ICQ A;  1T8E A;  2ZH1 A;  1CUK A;  4J9R A;  3TAR A;  3RAX A;  1KSP A;  2DR7 A;  4GXI A;  2DRA A;  3BDP A;  9ICK A;  4JV1 A;  2VAN A;  3PX6 A;  4I2F A;  4MFF A;  4QZ8 A;  9ICT A;  5CR0 A;  3ISC A;  4KLO A;  2C22 A;  3KTQ A;  5DBB A;  2FLL A;  5HMM A;  4DEZ A;  4RT2 A;  4F5O A;  8ICY A;  1UET A;  1QSL A;  4KLU A;  2AU0 A;  2C2D A;  7ICO A;  7ICT A;  1K1Q A;  5CB1 A;  3RTV A;  4KIT B;  2ALZ A;  2JEJ A;  3ZDA A;  7ICJ A;  4IQW A;  1Z3E B;  5DDY A;  3THV A;  3JPR A;  3UXO A;  3RJK A;  2XC9 A;  7ICG A;  3RJE A;  4XQ8 A;  4F93 B;  1T7P A;  2AJQ A;  1PX5 A;  8ICV A;  4ED3 A;  4ECW A;  3HIY A;  5CHG A;  2DR5 A;  2F1J A;  2ZTD A;  4YFK A;  1ZQL A;  3SV4 A;  5TZV A;  3T5K A;  3PO5 A;  9ICQ A;  2BPG A;  3LWL A;  3SV3 A;  3T5H A;  3OVA A;  1SL0 A;  2BQ3 A;  4O3N A;  4QWE A;  1KEJ A;  1KFS A;  3WFP A;  4F50 A;  9ICU A;  4FS1 A;  5IIL A;  5KFC A;  4ATB B;  4DSJ A;  2VA3 A;  4KLT A;  1SZP A;  3EW9 A;  3NTU A;  3JPT A;  2RDJ A;  4RWQ A;  8ICK A;  1X9S A;  5KFM A;  4C8O A;  5DB7 A;  5CWR A;  4RQ4 A;  5HRL A;  2DPJ A;  4NKT A;  4X4N A;  4XRH A;  4BDP A;  5KG4 A;  4RNM A;  5J2C A;  4X5V A;  8ICB A;  4DLE A;  3B0Y A;  3V7J A;  4RQ7 A;  4RQ8 A;  1T4G A;  4RPZ A;  2XY7 A;  2ISP A;  2KZZ A;  1F5A A;  4WC4 A;  3M8R A;  3WFQ E;  4RPX A;  1TAU A;  2H5X A;  4EBE A;  1WCN A;  5KFG A;  4ECY A;  4DSE A;  3RB3 A;  2BQR A;  3GIK A;  9ICP A;  7ICV A;  1ZQI A;  2Q66 A;  4I29 A;  1ZQA A;  3AQK A;  4ED8 A;  2ISO A;  9ICW A;  3H8S A;  3JPN A;  2IMW P;  3AU6 A;  3PVX A;  1UT8 A;  5KTQ A;  2XO7 A;  2PFQ A;  4O3S A;  3H37 A;  3HJ1 A;  4J9N A;  3LDA A;  5J0U A;  4B9S A;  4NM2 A;  4B9V A;  1PZN A;  5J2K A;  4TQR A;  4FHW A;  3UXP A;  5KFS A;  2BDP A;  2RFF A;  1TFY A;  4JUZ A;  4RUC A;  4UAZ A;  4YN4 A;  4DF8 A;  4YR2 A;  5J29 A;  4QW8 A;  5BOM A;  3RJJ A;  3BQT A;  2PBE A;  3JYY A;  4FHP A;  1SL1 A;  2FLP A;  2MAX A;  1N48 A;  1UT5 A;  4YMM A;  4NM1 A;  5KFK A;  1DOQ A;  9ICO A;  2DVI A;  3ZDC A;  4QZE A;  5DKW A;  5L1L A;  5IIK A;  2NRK A;  5HP4 A;  3IM1 A;  3AQL A;  3C18 A;  1S97 A;  5DED A;  1BPX A;  2PI5 A;  3KHG A;  1H38 A;  2IHM A;  4DQQ A;  1ZYQ A;  3OUY B;  8ICS A;  4DQI A;  9ICE A;  5DGB A;  4YQW A;  4I2J A;  3GIM A;  3MAB A;  4DL6 A;  4MFC A;  2NRT A;  2W9B B;  3ISD A;  1S0M A;  1ZQN A;  1RYS A;  1ZQB A;  4I27 A;  9ICM A;  1YLQ A;  4I2H A;  4NY8 A;  4ELV A;  2A1J B;  3C2K A;  1MIY A;  1V9P A;  2M9N A;  5KFO A;  1ARO P;  2ZJ8 A;  3G6V A;  4ECV A;  4UD5 A;  1BPB A;  4RQ0 A;  3NGD A;  2PFN A;  2ZJ5 A;  4IQT A;  4F4Y A;  5DB6 A;  1ZQC A;  4F4K A;  4ECX A;  4ZH4 A;  8ICA A;  4O5C A;  4UBB A;  3V6J A;  2IHN A;  4QW9 A;  3RB4 A;  3QE9 Y;  4I2E A;  5DB8 A;  3T5L A;  4ECZ A;  1DGS A;  9ICR A;  2V4Q A;  1S0V A;  4ED2 A;  4UAY A;  3HT3 A;  3MR2 A;  2JZB A;  4IRC A;  3PW7 A;  3MBY A;  4E0D A;  1TAQ A;  5KFR A;  2XGP A;  2R8I A;  4F5Q A;  2LYH A;  1ZJN A;  3PR5 B;  3MFH A;  4IR9 A;  4O5E A;  3KHL A;  5J0S A;  2NRV A;  5DDM A;  3OSN A;  1NK0 A;  4WC6 A;  4KLE A;  3JZ0 A;  3KHR A;  1XSN A;  4J9O A;  3PR4 A;  2ZUB A;  3V7K A;  4F3O A;  4G3I A;  4BXO B;  1NKC A;  2W9M A;  4ELU A;  4HYK A;  3E2E A;  4KLJ A;  1Q78 A;  4XUS A;  2ZHA A;  1S0N A;  1MIW A;  2XY5 A;  1ZQV A;  4PHE A;  5KFL A;  1ZQZ A;  4ECT A;  2I9G A;  4RUA A;  5DB9 A;  2ZTC A;  4PGX A;  2FPM A;  4KLM A;  5HRD A;  1U48 A;  3PY8 A;  2HHX A;  2FMQ A;  3TAN A;  5HRB A;  2P6U A;  4DL7 A;  2ZH2 A;  5KFA A;  2HVH A;  4RQ3 A;  5KFN A;  4EBK A;  4UB4 A;  3SI8 A;  5EWE A;  2JEI A;  3QZ7 A;  2PI4 A;  4S3N A;  1B43 A;  4IRK A;  2R8J A;  3UXN A;  2JEF A;  1R8A A;  2ZH3 A;  4QWD A;  4YMO A;  3K75 D;  2ASL A;  3TI0 A;  2M2V A;  2BKE A;  4PGY A;  5KT2 A;  5J0Y A;  4M47 A;  5J0Q A;  1NK4 A;  3UPQ A;  3V6K A;  3RH4 A;  4K4I A;  3MR6 A;  3MDC A;  1U45 A;  5J0W A;  1ZQK A;  5J2D A;  9ICV A;  2VA2 A;  5F2V O;  4XQ7 A;  4FBU A;  4Z6D A;  4NLK A;  4DL5 A;  4O5K A;  2DPI A;  1TK0 A;  1D9F A;  4JWN A;  5F9L A;  4EYI B;  5HML A;  3H39 A;  4WC3 A;  4UBC A;  3MGH A;  2P6R A;  4M9J A;  4IQV A;  3HPO A;  1L3U A;  4M9N A;  9ICN A;  1XSL A;  3PW0 A;  5KFQ A;  5CA7 A;  1XC9 A;  1IXR A;  2KZ3 A;  1MQ3 A;  2ZTE A;  4KLF A;  2DR9 A;  5JUM A;  4QZD A;  5J0P A;  4JWM A;  2ZUD A;  2HVI A;  4F5R A;  1JMS A;  4RNO A;  1UEV A;  1KRP A;  3WFO A;  5DQH A;  3OV7 A;  3G6X A;  5HRI A;  1Z00 A;  4ECU A;  3AU2 A;  3HP6 A;  4DS5 A;  2ATL A;  4O3Q A;  5KG0 A;  3RBD A;  8ICI A;  4X0A A;  3GV5 B;  4DS4 A;  1ZQT A;  1KNY A;  2ZH7 A;  2FMP A;  2KN7 A;  4F8R A;  3M9M B;  1NJY A;  9ICH A;  4I2G A;  1NJZ A;  8ICW A;  4YMN A;  3H4B A;  4UB1 A;  9ICC A;  4X4V A;  4TQS A;  3UPS A;  4M6W A;  4K4G A;  2DFL A;  2M2T A;  4F2R A;  2BCV A;  3MR3 A;  4M2Y A;  3OHA A;  5KFJ A;  4QZ9 A;  3WFS C;  5EWG A;  4YP3 A;  4DFK A;  3PW2 A;  4UD4 A;  2W9C A;  5J2J A;  1KLN A;  5J2A A;  4LZG A;  4JV0 A;  5J0O A;  8ICH A;  7ICF A;  4WCW A;  1K1S A;  5J2H A;  4K4H A;  5HRK A;  4DSI A;  3C21 A;  4O3O A;  2Y1J A;  1Q79 A;  5KFH A;  5J0R A;  4M04 A;  1NO5 A;  2ZH4 A;  4C8M A;  4DFP A;  3N4M B;  1U47 A;  3ISB A;  3RRH A;  1NKB A;  7ICM A;  9ICS A;  1JXE A;  4DQR A;  4FO6 A;  1S9F A;  9ICG A;  2FMS A;  4R8U A;  1ZET A;  1NK6 A;  2KZM A;  5DLG A;  4AT8 A;  1XO1 A;  5EOZ A;  1BNO A;  3NYB A;  5J2B A;  2BHN A;  2R8H A;  2PXI A;  2C2R A;  2JZB B;  4ED7 A;  4B9L A;  1TFW A;  4KLG A;  9ICX A;  1UA0 A;  2BCQ A;  3RB0 A;  4MF2 A;  1QLN A;  5BOL A;  8ICC A;  1BPZ A;  5KFZ A;  2ZJA A;  1S77 D;  5D46 A;  4MEX A;  4EP7 A;  4YG2 A;  4EEY A;  1VFG A;  3PX0 A;  3PW4 A;  2UVR A;  1LV5 A;  2V9W A;  4Q8F A;  8ICM A;  2ZH6 A;  4F91 B;  3PX4 A;  4KLS A;  3GII A;  4EBD A;  4RWO A;  2C2E A;  3PNC A;  3QZ8 A;  4J9P A;  3RH6 A;  5J2E A;  1JXL A;  3AUO A;  3RJF A;  4X4T A;  1FA0 A;  4DSF A;  5KT3 A;  2W8K A;  2HHP A;  3H8W A;  4DQP A;  4YD2 A;  3OHB A;  2WTF A;  4QZG A;  5DGA A;  1TK8 A;  5DEC A;  2M2U A;  1ZQO A;  1TFR A;  2FPK A;  4RQ5 A;  4IR1 A;  2BR0 A;  4NXZ A;  1U49 A;  4KLL A;  4PHD A;  4YD1 A;  1NK8 A;  4GXJ A;  4NKU A;  2UVW A;  1ZQM A;  1XWL A;  7ICE A;  3RJH A;  4YCX A;  5KFP A;  4MFA A;  1NK9 A;  1C7Y A;  2PFP A;  8ICG A;  3ZDE A;  5BPC A;  1UEU A;  2UVV A;  3BQ1 A;  8ICN A;  4KN7 A;  1R8C A;  3JPQ A;  4C8N A;  5KFT A;  4BGD A;  4KN4 A;  4RT3 A;  8ICF A;  4PGQ A;  4LZD A;  4ECR A;  2HHT A;  7ICK A;  4EYH B;  1HJP A;  2IA6 A;  4TUR A;  3MR5 A;  7ICN A;  9ICI A;  4YR3 A;  7ICH A;  4J9Q A;  3FYH A;  1QSS A;  3TFS A;  1KFD A;  2VA8 A;  1XU4 A;  3GV7 B;  4DL3 A;  3TAP A;  5KFE A;  3UQ0 A;  8ICO A;  1NK5 A;  4DFM A;  4F4Z A;  4Z6E A;  3N97 B;  4DL2 A;  3EPI A;  5D49 A;  2XCP A;  3ZDD A;  4X4U A;  5KG5 A;  3L9D A;  5HHI A;  4DOC A;  3UQ2 A;  3M9N B;  4UB2 A;  2Y1I A;  2NRX A;  5F9N A;  2GWS A;  4I2A A;  2W8L A;  4RQ1 A;  1IM4 A;  4R65 A;  4RQ6 A;  1X9W A;  4C8K A;  2M2W A;  4EZ9 A;  1DK2 A;  2ZHB A;  1NK7 A;  1JX4 A;  5KG1 A;  1L3T A;  4MEY A;  4AT7 A;  4X4P A;  1JIH A;  3EZ5 A;  3C1Z A;  3TQ1 A;  4P4P A;  1TK5 A;  4IG8 A;  4WC2 A;  5KFI A;  1Z00 B;  3JPS A;  4QZF A;  4Z6F A;  5L9X A;  4DSK A;  4M0A A;  5DG9 A;  4X0B A;  1XS9 D;  4Q45 A;  2J6U A;  3IHQ B;  4PPX A;  4ELT A;  8ICL A;  1X2I A;  3ETL A;  4UB3 A;  1U4B A;  4DQS A;  3OUY A;  4F5P A;  5DQI A;  3EPG A;  4ED6 A;  4M6W B;  4DFJ A;  2HHS A;  3ORY A;  4YVZ A;  4ED0 A;  5IIM A;  9ICJ A;  4GXK A;  4I2B A;  4EBC A;  3Q8S B;  2NRZ A;  2BQU A;  3AQN A;  2A1J A;  3ZD8 A;  3BJY A;  3C2M A;  4EZ6 A;  5HRH A;  1JQR A;  3M8S A;  1ZQG A;  1V4A A;  4RPY A;  5KG3 A;  2BE3 A;  2RDI A;  4BWM A;  1OU5 A;  5KFY A;  2KFZ A;  4KTQ A;  7ICP A;  4QWA A;  3RAQ A;  4F5N A;  3TAQ A;  7ICL A;  3PML A;  3C5F A;  1WCL A;  4J9K A;  2J6T A;  5IIO A;  5CJ7 A;  2IBK A;  4F2S A;  3RB6 A;  3QEB Z;  5HR9 A;  4R8U B;  1RXV A;  1RYR A;  3GIL A;  1CEZ A;  1R89 A;  2ID1 A;  4R66 A;  4AT8 B;  4O3P A;  1NJX A;  4X4Q A;  4UQG A;  3H40 A;  5KFV A;  4TUQ A;  3GQC A;  9ICB A;  4WC0 A;  4X4O A;  3V6H A;  4E8F A;  3OVS A;  4PHA A;  3OGU A;  4CCH A;  2BCS A;  4KLD A;  3LWM A;  2JEG A;  5HC9 A;  2ZH5 A;  2XCA A;  4NLZ A;  1BVS A;  5J2G A;  4YXM A;  1RPL A;  4QZI A;  4AT9 A;  1ZQR A;  4NLN A;  1ZQX A;  1ZQY A;  1S76 D;  4JK1 A;  3KHH A;  3PW5 A;  3RRG A;  1RXW A;  3K4G A;  1ZQD A;  4I2C A;  3T3F A;  4BXO A;  4WBZ A;  2MUT A;  2AGQ A;  4M9H A;  4I28 A;  4QZB A;  5DG8 A;  1ZQH A;  1A77 A;  8ICE A;  4IRD A;  4RWN A;  4B9M A;  3C2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...