5DBAA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a dt
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 114
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbaA03
4ED7A 3V6JA 4KLHA 3TANA 3PY8A 1A77A 2KZ3A 2F1JA 4I2BA 5JUMA 3V6HA 2C22A 4QZ9A 4X4VA 5HHHA 7ICIA 1MIYA 4I2GA 1FA0A 3MFIA 5KFYA 3OGUA 4IRCA 4NM2A 5KFEA 2V4QA 1F5AA 3JPRA 1R8BA 2ZJ5A 1N56A 2FLNA 4Q8FA 3N97B 3SI8A 1COOA 4M9NA 2RDIA 4YQWA 4KLGA 9ICFA 4I2DA 3THVA 4BDPA 1RPLA 2KFZA 2HHVA 3KHHA 8ICQA 1WOTA 5KFBA 4UB4A 4DFMA 3JYYA 1T8EA 4YFKA 4KLTA 3AQKA 2O5AA 1JAJA 5F2VO 4NLZA 1NK0A 1WCNA 4F4XA 3PW7A 3PW5A 2ZH7A 1X9MA 4YD1A 3EW9A 3PO4A 4DL2A 2KFNA 2VANA 2KP7A 1ZQYA 4I27A 1K1QA 3OJSA 3GV7B 5J2EA 2HVHA 9ICXA 1ZQQA 3KHRA 8ICEA 4K4IA 3WFQE 2NRKA 4FH3A 4YR2A 2XGQA 4NKUA 2BPCA 3NTUA 4RNMA 4WC6A 4QWBA 3TI0A 5KFPA 4DQQA 3BQ1A 1ZQKA 3ZDDA 4DOCA 1KNYA 4KN7A 4S3NA 4F4KA 3RJEA 3HIYA 3OUYA 1S0MA 5J0XA 1Y88A 4XA5A 8ICYA 5J2IA 1S0VA 7ICRA 4QZAA 3IHQB 5J0PA 4IQTA 3MR6A 5IIKA 4K4HA 1CEZA 4DL4A 4M04A 4QZFA 4YMOA 2ZTDA 4YP3A 4EBKA 4UB5A 3H3AA 4X4SA 1L3SA 5BPCA 1NJZA 1OU5A 3C18A 3WFPA 7ICSA 2B21A 2C2DA 4KLUA 3LDAA 4ECSA 1NKCA 3ISDA 2JEGA 3Q8QB 4IQWA 4M5DA 9ICQA 4NLGA 2ISPA 4X0AA 5D46A 2XC9A 1ZQCA 5KFSA 3H40A 2AGPA 3H4DA 4ED2A 9ICBA 1KRPA 8ICUA 4WC1A 2H5XA 4QZEA 3QZ7A 5J0OA 1KSPA 2R8KA 1NZPA 4QZ8A 3SYZA 2IHMA 4UAZA 4GC6A 3ZD8A 1XSLA 1RYRA 9ICKA 3TQ1A 1S10A 4XQ8A 4QZIA 4DLEA 3RB6A 4DLGA 4FO6A 1ZQIA 4LZGA 4IQVA 9ICRA 4DFKA 2M2UA 1Z00A 3M8SA 4X5VA 4BWMA 1S9FA 4DF4A 1N48A 1ZETA 1UETA 5KT7A 5KFWA 1XU4A 2DRBA 4RQ3A 3H4BA 1ZQSA 3PV8A 4G3IA 5J2JA 2HHWA 3RJHA 4RWOA 4AT9B 2ZUBA 3EZ5A 3NGDA 4C8KA 1UT8A 5KFIA 3LK9A 3KHGA 1KDHA 2JZBB 4DEZA 5DB8A 5J0SA 5IIMA 5J29A 8ICBA 4IG8A 4KMUA 3G6XA 3BQ0A 1R89A 2ZUCA 4MEXA 2FMQA 5L1LA 4FBTA 4MFFA 4ECQA 4KTQA 5DQIA 4O0IA 3Q8KA 1NJXA 1ZQMA 3M9NB 4NM1A 4O5KA 3RJGA 2XY6A 5D49A 3EWAA 5KFZA 4DQSA 1R8CA 4X4RA 4RNOA 3T5JA 5TZVA 4HYKA 4FS1A 2DR7A 4KLDA 4RQ7A 4LZDA 1T7PA 5KFUA 3RJJA 1KTQA 2ALZA 5HRHA 4B9MA 1WCLA 4YG2A 5KFJA 4ECRA 1L5UA 4TQRA 4R65A 2WTFA 4DL6A 3PW4A 2DR5A 2J6SA 4J9LA 8ICOA 2V9WA 3WFSC 5KG4A 1A76A 5KT4A 5EWFA 1ZYQA 2BCSA 1R8AA 4PHAA 2BCRA 4F2RA 5KT5A 3M9MB 1XWLA 5DQGA 3GV5B 1RXVA 4BGDA 4GXIA 4ECZA 4EBDA 3IM1A 4ED0A 1ZQTA 9ICHA 2FPLA 3LQCB 3AQMA 1UA0A 1U9LA 4E8FA 2AQ0A 4WC2A 5DG7A 3HX0A 5KG3A 5J2DA 2BCUA 3AU2A 2JZBA 3PNCA 5KFRA 2BQ3A 2BPFA 1S97A 4DWIA 3G6YA 4NLKA 3PMLA 1HUOA 1L3UA 5DBCA 2KZMA 2DPIA 3K4GA 5IIJA 3GIKA 4YR3A 1ZQBA 5HP4A 1MQ3A 2PFQA 2HHXA 5DLFA 3ORYA 2IA6A 4F5QA 4F8RA 4JUZA 4C8NA 2FPMA 4O3QA 3RB4A 5J0RA 4M9HA 8ICXA 2AQ4A 5EOZA 1EXNA 4UAWA 1BPDA 2KN7A 3RB0A 4EBEA 3ETLA 3ZDCA 2ZH8A 4QW8A 5KG5A 4DSEA 3BDPA 3T5LA 4B9VA 4O3RA 1RZTA 7ICNA 1NKBA 2BGWA 4JV1A 1UEUA 2GWSA 5BOMA 3BJYA 1T3NA 8ICJA 1U48A 3N4MB 5HRDA 3B0XA 3RAQA 4QWAA 1DK3A 4QZDA 5KTQA 1SL1A 5L9XA 1C7YA 3G6VA 4O3PA 8ICCA 4WCWA 1QSSA 4UB1A 2W9AA 4RNNA 1L3VA 2ZH1A 2HHUA 4Z6EA 5J2CA 3QZ8A 1ZQUA 3JPSA 1XC9A 5KFHA 4F4WA 2UVVA 7ICFA 4RQ1A 2KTQA 4X4NA 4TUQA 3LWMA 4DSKA 1TK0A 1RYSA 5J2BA 2ZTCA 3Q8LA 4AT7B 4RQ6A 2Y1JA 4I29A 1MIWA 9ICAA 4R64A 3C5FA 2ZTEA 4J9KA 1T4GA 3FDSA 3AU6A 4QZCA 4EYHB 4KLMA 2IHNA 2J6UA 2PI4A 2HHTA 8ICMA 1BPXA 9ICTA 4KLEA 4LT6A 3GIMA 4IRKA 1Q79A 4PHPA 4YMMA 5CJ7A 5HR9A 2R8IA 4WBZA 3GV8B 3GIIA 4Z6FA 3UXNA 4C8MA 1UA1A 5EWEA 5CHGA 2NRVA 3T3FA 1QSLA 2I9GA 4M9LA 8ICVA 3OUYB 3H8WA 2HHQA 1NK8A 2XCPA 4B9TA 4JWMA 2XY5A 2BCVA 3RJIA 5CA7A 1B22A 2ZH4A 2DRAA 2PI5A 3RH6A 3QEBZ 2BQRA 5HREA 3RH5A 1ZQGA 9ICWA 5J0WA 1JX4A 2UVUA 4DQIA 2AU0A 3Q8MA 4F50A 4ECTA 3C1YA 5KT3A 2ID1A 2PFPA 1AROP 3RBDA 4KITB 4DL3A 4O9MA 2HW3A 9ICOA 3L9DA 1B43A 5KFKA 4QZHA 4UBBA 1PZNA 5DG9A 4RQ8A 3UXPA 4DO9A 1ZQEA 1LB2B 4DSIA 1TAUA 4TQSA 2M2VA 2RDJA 2Y1IA 4RUCA 3MR2A 3H7IA 4F4YA 4I28A 4RZRA 7ICKA 8ICFA 5HRFA 9ICLA 2ZH3A 4QWCA 2W8LA 1SL0A 5L1IA 2C28A 1BGXT 1JIHA 2NRTA 7ICLA 2BCQA 5KT2A 2KZZA 1BPBA 4FHVA 1NJYA 2LYHA 4YVZA 4M9GA 3PMNA 5KFTA 4NKTA 4XQ7A 4ELTA 1LV5A 3WFOA 3LWLA 3C2LA 1D8LA 1ZQXA 2DFLA 2W9MA 4P2HA 3OHBA 2ZHAA 4GC7A 4UD5A 4RU9A 4M6WB 3RBEA 2P6UA 1ZQPA 4X0BA 2Q66A 1DGSA 2BKEA 3RH4A 5J2AA 4RWPA 5DKWA 7ICPA 3Q8PB 2ISOA 2JEJA 2ASLA 3KTQA 1TFYA 4DQPA 5KFFA 4KLFA 3KHLA 3RB3A 8ICZA 5C5JA 4ATBB 2XY7A 4J9NA 5IINA 3H39A 1BPZA 4DL5A 2M2TA 5J2KA 3ZDBA 4CCHA 4DSLA 3K75D 4F92B 5J0UA 1MC8A 3HP6A 8ICNA 5DEDA 3RJKA 4YMNA 4RPXA 4GLXA 3OVSA 5IIOA 7ICQA 4F5NA 4RQ5A 3HWTA 2ASDA 4YXMA 3UQ2A 3MDCA 7ICOA 5DLGA 4UBCA 4DOAA 5HNKA 1V4AA 8ICHA 3C23A 3OV7A 1TK8A 5KFMA 4UQGA 4RPZA 4ED1A 5DECA 4LVSA 1ZQAA 8ICTA 2ZJAA 4R8UB 2BR0A 1XO1A 8ICSA 2NRXA 4I2FA 4QZGA 1KFTA 4E7XA 4QWDA 1NO5A 4TUPA 1H38A 2PFOA 1K1SA 5HRBA 2A1JB 4M6WA 3FYHA 4O5EA 1SL2A 4X4TA 4RUAA 4RQ0A 1JXEA 9ICCA 1ZQNA 4B9LA 7ICGA 5KFGA 4WC0A 4QWEA 7ICHA 4GXKA 4KLSA 1ZQVA 5DQHA 5KG1A 3C21A 1X2IA 1SKWA 1SKRA 2M2WA 4AT7A 4C8OA 3OVAA 1NK7A 1XSPA 2PXIA 1KLNA 2MAXA 4B9NA 5IIIA 4IRDA 4RWQA 1KFSA 2XGPA 4DFPA 4MF8A 3OSNA 5KG2A 3M8RA 5J2HA 3V72A 1CUKA 3RR7A 4IR1A 3PW0A 3V7LA 4DSJA 4M47A 4KLOA 5HC9A 4GXJA 1NK6A 4I2CA 4X4OA 4TURA 1TVAA 1ZQZA 2W9CB 5L1KA 3QE9Y 4B9SA 1QSYA 4M0AA 2IMWP 2F1HA 4I2EA 5L1JA 4EEYA 8ICLA 5DDYA 2FPKA 4DQRA 1TFRA 4ZH4A 4ECWA 4EBJA 1DOQA 1HUZA 4M2YA 4FHPA 1PX5A 1S76D 4Z6CA 5CR0A 2NRZA 4RT2A 3MBYA 4ED6A 1ZJMA 1XS9D 3OJUA 4E80A 4P4PA 4FBUA 3UPQA 3GDXA 5HRGA 3BQTA 4J9QA 8ICRA 5J2GA 4P4MA 1NJWA 1D9DA 1ZQHA 5KFDA 2HHSA 9ICGA 4Q8EA 5HMLA 3RR8A 2DR8A 4NXZA 4EZ6A 4J9MA 2BQUA 4F3OA 5J2FA 2DR9A 2P6RA 3JPPA 4UD4A 4TUSA 4KLJA 4YR0A 3MABA 5HHIA 2VA3A 5DB6A 2HHPA 4YD2A 4WC5A 2DVIA 1NK9A 2JEIA 1BNOA 3MGIA 5KFQA 5EWGA 3C2KA 4KLQA 2F1IA 5CWRA 4XRHA 1D9FA 4M9JA 9ICUA 4FHYA 4P4OA 4JWNA 8ICAA 3TAPA 4QW9A 2W9CA 2XCAA 1TK5A 3UXOA 4RPYA 4J9RA 2IBKA 3JPQA 1U49A 4MEYA 5KFAA 3V6KA 3JZ0A 2O1PA 5KFOA 2VA2A 5J0TA 1X9SA 2ZJ8A 3MR3A 3Q8RB 2VA8A 5KG0A 1UT5A 4Z6DA 2V4RA 4R63A 3TFSA 1NK4A 4B9UA 1TAQA 4ATBA 3PR4A 3HT3A 4AT8B 4F5PA 8ICGA 4DOBA 2XO7A 1RXWA 9ICPA 3AQNA 1ZQWA 4PGYA 1Q78A 1TFWA 1DK2A 3EPIA 4DS4A 4ECXA 1L3TA 5KFLA 4PHEA 3Q8SB 4ED8A 4FHXA 5IILA 2FLLA 4UB3A 3H8JA 4R66A 1S0NA 1KFDA 4RT3A 4Q44A 3AUOA 2ZH2A 5HMMA 3ZD9A 1JN3A 5KFNA 3TAQA 1JXLA 1QLNA 8ICWA 3AQLA 3EPGA 1NOMA 4DSFA 3TARA 2ATLA 4DF8A 2FMPA 4JV2A 2BE3A 4FHWA 4IR9A 2JEFA 4R8UA 8ICPA 4DL7A 2OWOA 4F5RA 4X4PA 4FH5A 1ZQDA 3PW2A 4O3NA 3RRHA 1U47A 5DDMA 3C1ZA 4J9SA 4ED3A 2A1JA 5J0QA 4O5CA 8ICIA 1BNPA 2DPJA 3B0YA 9ICSA 4EP7A 4J9OA 4JK1A 3PR5B 5HRLA 2UVWA 4EZ9A 3NYBA 2ASJA 2BHNA 4WBYA 4X4QA 3RJFA 4WC3A 2PBEA 1BPEA 4I2IA 3SV3A 1YLQA 3C5GA 3ISCA 2W8KA 5D4BA 3RRGA 3OVBA 2R8GA 3PVXA 2J6TA 5DBBA 9ICNA 1JQRA 2M9NA 5DGAA 4F2SA 4E0DA 4RWNA 7ICTA 2MUTA 2NRWA 5KT6A 5DBAA 4F4ZA 3E2EA 4KLIA 3C66A 4DFJA 3MFHA 2MUTB 5KFXA 3PX0A 2FLPA 4ELUA 4I2HA 9ICJA 2W9BB 2BDPA 4X4UA 3BQ2A 3H38A 1HJPA 3HW8A 2P66A 5BOLA 1UEVA 1TV9A 4QZBA 4UB2A 3MR5A 3C2MA 4PGXA 5KG7A 3JPTA 3V7KA 1ZQJA 2ZH9A 5F9NA 1U4BA 1SKSA 4O3SA 1D8YA 5DB9A 4BXOB 3GQCA 4AT9A 4ECVA 3EYZA 4BXOA 5DG8A 3RAXA 1NKEA 1ZQOA 4F93B 3UQ0A 4C8LA 4EBCA 4I2AA 4NLNA 5HRKA 9ICMA 4K4GA 1KEJA 1MIVA 4YCXA 3PO5A 4F5OA 5KFCA 1MSWD 5J0YA 2ZHBA 3WFRE 5KG6A 9ICIA 3ZDAA 4PH5A 1Z3EB 4MFCA 7ICVA 4JV0A 2BPGA 3QEAZ 4KN4A 2RFFA 4ECUA 2PFNA 1IXRA 4IQUA 3HJ4A 5F9LA 1QTMA 4RQ2A 2C2RA 7ICUA 5KFVA 2ZH5A 1X9WA 7ICEA 9ICEA 3H8SA 2HVIA 3OHAA 3V7JA 3TFRA 2ZH6A 1VFGA 4WC7A 1ZQFA 5CP2A 4YN4A 1ZJNA 4BWJA 3T5KA 1XSNA 4J9PA 4UAYA 4DS5A 1IM4A 5HRIA 2R8JA 4Q43A 4Q45A 3JPNA 2W9BA 4ECYA 1NK5A 1S77D 3SV4A 4PGQA 1ZQRA 5CB1A 1V9PA 3MGHA 1Z00B 4O3OA 3JPOA 1MQ2A 3PX4A 3RTVA 3SZ2A 3MDAA 3T5HA 3PX6A 4I2JA 1TKDA 4NY8A 2I1QA 1SZPA 3GFKB 2FMSA 3M9OB 4F91B 1BPYA 1ZQLA 4PPXA 7ICMA 8ICKA 4AT8A 2ZUDA 3ISBA 5DGBA 2AJQA 4EYIB 5DB7A 4YXJA 3GIJA 4MFAA 2R8HA 3ZDEA 1VJ7A 1U45A 1JMSA 4RQ4A 3HPOA 2Q0ZX 7ICJA 9ICVA 3HJ1A 4XUSA 3UPSA 4ELVA 2C2EA 1S0OA 4PHDA 4KLLA 2UVRA 3GILA 1BVSA 4FS2A 2AGOA 4MF2A 3H37A 2AGQA 3OSPA 4WC4A
chains in the Genus database with same CATH superfamily
3TANA 2F1JA 1IIPA 2LMRA 1FA0A 3I28A 4IRCA 4NM2A 5KFEA 1F5AA 3MC1A 1R8BA 1VLBA 2FLNA 1COOA 3IDWA 2RDIA 3QUCA 4YQWA 4I2DA 3WU2U 3THVA 2KFZA 2HHVA 3KHHA 5KFBA 4UB4A 5EE0A 1JAJA 4NLZA 1N60A 4F4XA 2ZIXA 2ZH7A 1X9MA 2KFNA 5ALMA 1NZBA 5J2EA 1ECWA 1ZQQA 4K4IA 3NTUA 5AKZA 1HIWA 3ZDDA 3SD7A 4S3NA 3PSIA 3OUYA 1UQVA 2D3DA 3IHQB 4K4HA 2F8KA 4YMOA 2ZTDA 4UATA 1JUDA 5AHXA 1X40A 3WFPA 2B21A 5AI9A 4M5DA 3LDAA 9ICQA 4NLGA 9ICBA 8ICUA 2JXJA 3QYPA 5AI8A 1XSLA 3TACB 4XQ8A 2E8NA 3RB6A 9ICRA 1Z00A 4X5VA 1UETA 2KVSA 4KMOB 2W43A 2K4HA 4Y2SA 3RJHA 1QQ7A 2ZUBA 3EZ5A 1UT8A 3LK9A 4DEZA 5DB8A 5J0SA 5IIMA 5HR6A 2ZIVA 4MEXA 2FMQA 4FBTA 3RJGA 2XY6A 2WF6A 2YTUA 5D49A 1R8CA 1ED1A 5TZVA 4FS1A 1T7PA 5KFUA 2ALZA 4R65A 1Z19A 2J6SA 8ICOA 2BCSA 1R8AA 4F2RA 3GV5B 1RXVA 5DQGA 4BGDA 4ED0A 4ECZA 3AQMA 2FPLA 1UA0A 1U9LA 2HSZA 2KKVA 2BCUA 2BPFA 1L3UA 5DBCA 3GIKA 5IIJA 2XIDA 4F5QA 4C0ZA 4O3QA 5CFTA 2AH5A 2VJ5A 5GTIU 7ICNA 1NKBA 1UPHA 3CRXA 1UEUA 3QUQA 1T3NA 1DK3A 5KTQA 1SL1A 2YMMA 1C7YA 1ZD4A 2WB1C 3QXGA 4RNNA 2WHEA 2HHUA 2WF7A 4I0UA 4CF3A 2JR5A 4QJFB 4RQ1A 1TAMA 1RYSA 4OAFA 5JRTA 5ALJA 2Y1JA 9ICAA 4J9KA 1T4GA 3FDSA 4QZCA 4U6PA 3ED5A 2J6UA 1SV0C 8ICMA 9ICTA 2HCFA 4YMMA 5ALNA 1QCKA 1UA1A 5AM4A 1P7DA 2HHQA 4JWMA 2BCVA 3RJIA 5CA7A 2QB1A 2PI5A 2BQRA 1VDVA 3Q8MA 2ID1A 2PFPA 1AROP 2I6XA 2K4EA 1PZNA 1TAUA 4WOYA 5CFSA 4O3MA 4JLXA 2JGAA 3IG8A 2YMQA 1NJYA 3PMNA 4NKTA 4Y2JA 1LV5A 4U7CA 3WFOA 3LWLA 1ZRNA 1COKA 3HKZC 3OHBA 2W7OA 4GC7A 4RU9A 4UD5A 1ZQPA 2Q66A 2KSOA 2BKEA 5J2AA 3KOOA 2WFAA 2JEJA 2YN4A 3M1YA 4FE3A 3C29A 8ICZA 4J9NA 3L4PA 3H39A 3L5KA 2G5HB 5J2KA 4CCHA 5J0UA 3RJKA 3WKCA 2FCLA 3F2CA 2KKPA 1V4AA 3SEIA 5HNKA 1K5OA 3C23A 4ED1A 3NKUA 4R8UB 3B9JA 2BR0A 4I2FA 4QZGA 1KFTA 4QWDA 1L7NA 4NXTA 1OW5A 2EZXA 2A1JB 3FYHA 4RQ0A 1JXEA 2YMPA 5KFGA 1SKWA 3PHZA 3C21A 1X2IA 4AT7A 1NK7A 4RWQA 4UB8U 2GOLA 4MF8A 3OSNA 5J2HA 4IR1A 4WC0A 3IV6A 3PW0A 4DSJA 4M47A 4GXJA 1NK6A 2WF9A 1QSYA 1S8OA 8ICLA 4ICAA 2KJ5A 2XICA 4ECWA 4O69A 3DV9A 5HRGA 3BQTA 1NJWA 5ALKA 5KFDA 3AMZA 3KKAC 5HHIA 1NK9A 3MGIA 3QUTA 1MN8A 4P4OA 4JWNA 1M6YA 4QW9A 4Y2TA 2O1PA 1B0XA 3Q8RB 1UT5A 5KG0A 3QU4A 1NK4A 4B9UA 1TAQA 3PR4A 3HT3A 4F5PA 3R9KA 2Y0SF 2QARA 3Q8SB 4ED8A 2K4IA 4UB3A 2GO7A 4RT3A 4LEZA 3ZD9A 5KFNA 2DR8A 4WQKA 3EPGA 4DSFA 4FHWA 3KZXA 2N1RA 4JV2A 2KOBA 3WK4A 2Y9TA 3PW2A 4O3NA 1U47A 3ALRA 5DDMA 4J9SA 4ED3A 8ICIA 4EP7A 9ICSA 3B0YA 5EE3A 4WBYA 4K98A 3RJFA 3C5GA 5B66U 5DBBA 5AKXA 2MUTA 4KX5A 5DBAA 4US8A 3C66A 3PX0A 1ZD3A 1RG6A 4X4UA 2KIWA 2LBOA 5BOLA 1UEVA 2HOQA 2YQEA 4UB2A 2JRZA 2KMDA 4O3SA 5ALGA 5ALPA 4BXOB 3PSPA 2YY6A 3L3FX 1KL9A 5DG8A 4CDGA 4NLNA 4F93B 5B5EU 4EBCA 4HX0A 4YCXA 3WFRE 5FP0A 2KHQA 1Z3EB 4MFCA 3F2BA 4KN4A 2VJ4A 2PFNA 3HJ4A 1X9WA 5GTHU 3H8SA 1SV0A 1N5XA 3SAHA 1ZQFA 4YN4A 3WKEA 4BWJA 4K9BA 1XSNA 1IM4A 3JPNA 4ECYA 1NK5A 1S77D 5ALTA 5CB1A 2FE9A 5G5HA 3LYSA 1MQ2A 4O3OA 3SZ2A 2KJ8A 1Z1BA 2HBMA 1QQ6A 1BPYA 7ICMA 4AT8A 3ISBA 3FAHA 4EYIB 3ZDEA 1U45A 2F77X 3UPSA 2C2EA 4KLLA 4AYBC 4FS2A 2A3VA 1SWVA 3RFAA 3V6JA 4UARA 4KLHA 3PY8A 1JRPA 2B4VA 2KZ3A 5JUMA 3V6HA 4QZ9A 7ICIA 1MIYA 4C7YA 5EE1A 3OGUA 4KX3A 3JPRA 4EX6A 2ZJ5A 3ZI4A 2F8LA 3SI8A 4KLGA 2GLEA 1RPLA 3WK6A 2RHFA 2E5SA 1L8LA 1T8EA 2ZIXB 2DQNB 1WCNA 1ZXIA 3EW9A 3PO4A 4DL2A 1WYGA 3K7DA 3GV7B 9ICXA 3KHRA 3WFQE 4FH3A 1TE2A 4JMUA 4OJ5A 4RNMA 5KFPA 4DQQA 3BQ1A 1KNYA 1UCVA 4F4KA 3RJEA 2AHOB 1S0MA 1Y88A 4XA5A 4NXVA 5J0PA 3MR6A 4DL4A 4YP3A 4EBKA 4X4SA 5BPCA 3AM9A 4KLUA 5JTIA 1ZQCA 1N61A 3HILA 3H40A 1KRPA 5ALFA 2IHOA 4WC1A 4QZEA 5J0OA 1KSPA 4QZ8A 3SYZA 4UAZA 3WK7A 3ZD8A 4DFKA 1KQQA 3M8SA 1S9FA 5D61A 1N48A 1ZETA 4USAA 1J2MA 4G3IA 4P0PA 3GU3A 5AM3A 4AT9B 2DL0A 2A19A 5J29A 1Q3VA 3E0FA 4MFFA 4F72A 4KTQA 4C80A 4DCCA 4NM1A 3QUBA 2EZYA 5KFZA 3OTQA 3T5JA 4JLZA 4HYKA 2DR7A 4KLDA 3RJJA 4LZDA 2W54A 2OEHA 2GH1A 2W11A 5ALDA 4OO1J 4B9MA 4YG2A 5KFJA 4ECRA 4TQRA 1MA7A 2KE7A 3PW4A 4DL6A 2V9WA 1FIQA 5KT4A 5EWFA 1Q3UA 4CGZA 4GXIA 3IM1A 2AQ0A 2EAPA 5KG3A 2HOFA 5KFRA 3G6YA 3K4GA 1ZQBA 2XVTA 5HP4A 3OWGA 1WG8A 3SAFA 2DKXA 4JUZA 4C8NA 3RB4A 4M9HA 2LPEA 4UAWA 3ZDCA 3RB0A 3ETLA 4Y2QA 5ALHA 5KNIA 3BDPA 3T5LA 2RLTA 1F44A 2BGWA 2GWSA 5BOMA 1U48A 3N4MB 3B0XA 3RAQA 2F44A 4EGWA 2LM4A 2K8CB 4QZDA 5L9XA 4UB1A 1L3VA 2ZH1A 3K1ZA 4Z6EA 3QZ8A 3JPSA 4X4NA 4F4WA 4TUQA 3LWMA 3KZIU 1TK0A 1PUZA 3M6KA 1X66A 2KD1A 4I29A 3TKAA 4EYHB 4OJLA 2IHNA 2MRLA 1BPXA 4KLEA 4LT6A 4IRKA 1Q79A 5CFUA 5HR9A 1WUDA 2KHVA 3GV8B 4C8MA 3OUYB 5EWEA 2NRVA 2I9GA 2XCPA 4B9TA 2XY5A 5AI5A 5HREA 4BX9C 3RH5A 1JX4A 2UVUA 1SB3C 3C1YA 5KT3A 4ECTA 3F5EA 4O9MA 4DO9A 5AKLA 4UBBA 1ZQEA 2M2VA 2RDJA 4RUCA 3MR2A 4C4TA 4CNQA 9ICLA 4QWCA 2W8LA 5L1IA 1JIHA 2LYHA 5JU5A 2HOIA 1S5LU 5AK6A 5ALOA 3DEEA 3C2LA 2W9MA 2VIXA 4NV0A 4P0QB 2P6UA 2Q4TA 3RH4A 1L8OA 2ISOA 1IV8A 4MKPA 4KLFA 2KVCA 4EENA 3RB3A 2IOFK 4ATBB 1FFUA 1BPZA 4Y2RA 3ZDBA 5J8YA 3K75D 4F92B 8ICNA 3HP6A 5AK4A 4GLXA 1F0MA 2ASDA 4YXMA 3UQ2A 7ICOA 3D2SA 8ICHA 1SXEA 1TK8A 5KFMA 4UQGA 2QB0B 1ZD5A 1ZQAA 2ZJAA 5ALYA 1XO1A 8ICSA 2PFOA 5HRBA 2ZIUB 4O5EA 4X4TA 4RUAA 1PVRA 3NVZA 9ICCA 4A8EA 1ZQVA 2RP5A 3A0BU 5DQHA 2M2WA 1VJ5A 1KLNA 2MAXA 5IIIA 5J8YC 2GA9D 3H3AA 3RR7A 4KLOA 5AK5A 4X4OA 1LKYA 2W9CB 5L1KA 2IMWP 2F1HA 4I2EA 5L1JA 2BDUA 2OXOA 4EBJA 5CR0A 1ZJMA 1XS9D 2ODGA 4P4PA 3GDXA 5J2GA 1ZQHA 3NASA 1PVQA 2BQUA 1DRGA 3HRDD 2DR9A 4UD4A 4TUSA 1CRXA 2DVIA 5L1MA 2KICA 5KFQA 2F1IA 4XRHA 4FHYA 8ICAA 3RF9A 5KAFU 1LKYB 2W9CA 4RPYA 1X6JA 2W7PA 5KFAA 2D6FC 4OJPA 3NRZA 2VA2A 1X9SA 2ZJ8A 3MR3A 5EE9A 2VA8A 2V4RA 3E58A 2MU2A 3TFSA 2QARB 8ICGA 9ICPA 3A0HU 1L3TA 3AQFA 3KFUF 1AQ6A 4R66A 3BS5B 1KFDA 4Q44A 2WF5A 5AKEA 4PZNA 1JXLA 1JN3A 3TARA 2BE3A 2FMPA 2DUYA 4IR9A 2JEFA 4WH5A 4F5RA 1SZHA 2E1FA 3RRHA 3C1ZA 3PR5B 2ASJA 4WC3A 1X9XA 3OVBA 3PVXA 9ICNA 2M9NA 5DGAA 2NRWA 5KT6A 3E2EA 1XO0A 2K89A 9ICJA 2BDPA 1Z4NA 3H38A 2P66A 2JV3A 3SMVA 3N7RC 5DB9A 3IG5A 4RWOA 1NKEA 1ZQOA 5HRKA 4I2AA 4FFDA 5KFCA 2IOFA 3ZDAA 4PH5A 3UMBA 2EH9A 4OJ6A 1D8BA 4IQUA 5F9LA 2IUBA 7ICEA 9ICEA 1VFGA 3V7JA 2ZH6A 4CE6A 4UAYA 4J9PA 4DS5A 2B51A 3N28A 4Q43A 2IOHA 4PGQA 1ZQRA 2DBYA 1Z00B 2G08A 3PX6A 2K60A 3MDAA 4UW9A 4I2JA 2I1QA 1SZPA 4LEYA 2LKYA 1ZQLA 4PPXA 1Q46A 2ZUDA 5DGBA 3HPOA 4RQ4A 2Q0ZX 9ICVA 3F5AA 4ELVA 5AKHA 4PHDA 2AGOA 2W03A 4WC4A 4ED7A 4EEKA 1A77A 3WKBA 4I2BA 2C22A 4X4VA 2EZZA 4I2GA 3MFIA 3MCRA 5KFYA 2Z7JA 4Q8FA 3OPXA 8ICQA 4DFMA 3JYYA 4KLTA 5CRXA 1NK0A 2FJ6A 3PW7A 2VKQA 3ER9B 1K1QA 2WAQF 4G9BA 3F53A 5AM2A 2HVHA 8ICEA 3N7PD 2LYAA 4YR2A 2XGQA 4NKUA 1JALA 5ALIA 4KN7A 5AIAA 5J0XA 7ICRA 1S0VA 4IQTA 5IIKA 3AQEA 4M04A 1UHUA 4QZFA 2NO4A 1A0PA 3SENA 4UB5A 3H0RB 1OU5A 3C18A 7ICSA 2C2DA 3CW2C 1NKCA 3ISDA 4QIWC 3Q8QB 2ISPA 4X0AA 1LVHA 5D46A 2XC9A 5KFSA 2K8BB 1NZPA 3QZ7A 2R8KA 4GC6A 1RYRA 5HR7A 3ERCC 2KNJA 4DLGA 2M2UA 1ZQIA 4IQVA 2H3IA 4BWMA 1X42A 2L5YA 4CF4A 2DRBA 4RQ3A 3H4BA 5J2JA 2HHWA 1PK1A 2E8PA 3KHGA 4IG8A 2NO5A 4KMUA 3BQ0A 1R89A 2ZUCA 3IN5A 2JMGA 5L1LA 4ECQA 4NWIA 5DQIA 1ZQMA 3M9NB 3ONNA 4O5KA 2O6KA 3EWAA 4FZMA 1XNSA 2K4PA 3M6ZA 4QNLA 2OH2A 3KBBA 1KTQA 3LVWA 2QKQA 4J9LA 3WFSC 1ZYQA 4PHAA 3M9MB 1ZQTA 9ICHA 3BS7A 2E8OA 3NWIA 3AU2A 2HBLA 2BQ3A 4DWIA 1S97A 3PMLA 3NVVA 1RQNA 4RQNA 1MQ3A 4O68A 3ORYA 2IA6A 2FPMA 5J0RA 5EOZA 3M7DA 5KL8B 2KN7A 2ZH8A 3D6JA 2KV2A 4DSEA 4BJQA 1RZTA 5TISU 1WWVA 4JV1A 3BJYA 2G5IB 3G6VA 4O3PA 4K99A 3NUQA 4WCWA 4K97A 2CN1A 2B0CA 5J2CA 1ZQUA 1XC9A 2UVVA 7ICFA 4DSKA 5ALEA 4Y2VA 2G06A 2ZTCA 3Q8LA 4AT7B 2QLTA 1MIWA 4R64A 2WF8A 3AU6A 2ZTEA 3JCFA 3GIMA 4PHPA 4EV6A 3VCBA 2R8IA 4WBZA 5T14A 2ZXHA 5AKIA 3UXNA 2RQ5A 3WKAA 1QSLA 5CHGA 4M9LA 3H0LB 3H8WA 3H8MA 2ZH4A 2DRAA 3IP4B 2WB1F 5H2FU 3QEBZ 3RH6A 5D62A 1ZQGA 5J0WA 4DQIA 2AU0A 4DL3A 1C20A 1B43A 5KFKA 1Z1VA 4UASA 5DG9A 4UAUA 4DSIA 4E7XA 1LB2B 2G09A 4TQSA 8ICFA 3H7IA 4RZRA 1SL0A 2C28A 1BGXT 7ICLA 2BCQA 5KT2A 4OD0A 4YVZA 2G07A 4WJ3B 2G0AA 1JI7A 4XQ7A 1N63A 1J97A 2HI0A 4P0QA 1ZOLA 1D8LA 4P2HA 2ZHAA 4M6WB 2OM6A 2ASLA 1NNLA 1TFYA 4DQPA 2E3TA 5C5JA 2YMLA 3BZCA 5IINA 2D8CA 2M2TA 4DSLA 1MC8A 5DEDA 3OVSA 4YMNA 1GPJA 5IIOA 7ICQA 3HWTA 1QH9A 5DLGA 4DOAA 2QB0A 5DECA 4LVSA 8ICTA 3KD3A 3I76A 1NO5A 4TUPA 2F3NA 2KEYA 4M6WA 3LVVA 1N5WA 1KN5A 1J2NA 2JHDA 5K4LA 7ICHA 4GXKA 4PL1A 3WKDA 4C8OA 1XSPA 2PXIA 4B9NA 4IRDA 5AM1A 1WWUA 4PZOA 1CUKA 3V7LA 2WAQC 4TURA 1TVAA 1ZQZA 1RDFA 5DDYA 5AKYA 2FPKA 1DOQA 1HUZA 4M2YA 1PX5A 1S76D 4Z6CA 2NRZA 3MBYA 4ED6A 2HN1A 3TADC 3OJUA 1YT3A 4E80A 4FBUA 3UPQA 2HHSA 9ICGA 4Q8EA 3CYMA 4NXZA 3MGVA 4J9MA 2FDRA 2P6RA 4YR0A 3MABA 2VA3A 5DB6A 3QU5A 2JEIA 1BNOA 1ZQ1C 4EEDA 5EWGA 3C2KA 1D9FA 2ESEA 3BQ7A 2BBHA 1TK5A 2IBKA 3AN1A 3JPQA 1Z4OA 4O67A 5KFOA 3DDHA 3IRUA 5J0TA 3BZKA 2YB1A 4R63A 3PSTA 4AT8B 2DWQA 4EX7A 2XO7A 5F3XB 3WK8A 3AQNA 1DK2A 3EPIA 5KFLA 4FHXA 5IILA 3H8JA 1O03A 1OXJA 4RQMA 2RRDA 1QQ5A 3AUOA 1V85A 5HMMA 8ICWA 3AQLA 1QLNA 1NOMA 4DF8A 1X6IA 4R8UA 8ICPA 4DL7A 3SR6A 2OWOA 1O08A 4FH5A 3CNHA 2ZIWB 1FO4A 3F2DA 2A1JA 3NRWA 1BNPA 2DPJA 3C28A 4J9OA 4JK1A 2DGZA 2PBEA 1BPEA 4I2IA 5D4BA 3RRGA 2BBJA 3PSFA 1JQRA 4F2SA 1GO3F 4RWNA 4F4ZA 3MFHA 5KFXA 4ELUA 4I2HA 2W9BB 3BQ2A 3HW8A 1TV9A 4QZBA 3C2MA 3H0MB 4PGXA 5KG7A 3V7KA 2ZH9A 5F9NA 3QU7A 4ACOA 5AKJA 3GQCA 4C8LA 3J81j 3UQ0A 9ICMA 2BZFA 4K4GA 1KEJA 3PO5A 4F5OA 5KG6A 9ICIA 5AM5A 2EAOA 4JV0A 1DGJA 2OCEA 4FZLA 4RQ2A 5KFVA 2HVIA 3OHAA 3TFRA 5CP2A 1ZJNA 5HRIA 4Q45A 2W9BA 2MA1A 2W3RA 3MGHA 3JPOA 3RTVA 3FM9A 4NY8A 5B3PA 4FZNA 2HMXA 2LHTA 2FMSA 5KAIU 8ICKA 2AJQA 4YXJA 4MFAA 1VJ7A 1JMSA 7ICJA 1FEZA 1S0OA 4FO1A 1BVSA 1N62A 2KJ9A 2EQYA 3HJEA 3OSPA 4IL6U 2ZXIA 1DXSA 4AP9A 2Y0SC 5HHHA 4EEBA 2V4QA 2DF4B 1N56A 3N97B 3O0FA 2P35A 4M9NA 9ICFA 3I1YA 4Y2YA 1WOTA 2JH1A 2KG5A 1YZ7A 4YFKA 3AQKA 1T94A 2O5AA 2H3VA 5F2VO 2HN2A 2CXYA 3PW5A 4YD1A 2KP7A 2VANA 1ZQYA 4I27A 3OJSA 1RM6C 2NRKA 1SV4A 2BPCA 4WC6A 4QWBA 3TI0A 3NVOA 1ZQKA 3WK9A 4ZOHC 4DOCA 2PMZF 8ICYA 5J2IA 2NV3A 4QZAA 4US9A 3NVWA 1NI3A 1CEZA 2E1EA 3FC4A 3D2NA 1L3SA 1F5SA 1NJZA 5AI4A 2ZG6A 1OUQA 4ECSA 2JEGA 4IQWA 2M0NA 3QU9A 1CI4A 4NXXA 2W3SA 2AGPA 3H4DA 4ED2A 3U26A 5B3QA 2NYVA 2W55A 2H5XA 2Y9UA 5ALSA 2IHMA 2E8MA 9ICKA 3TQ1A 1S10A 3SQIA 4QZIA 4DLEA 4FO6A 4LZGA 3UMGA 4DF4A 5KT7A 5KFWA 1XU4A 5CEHA 1PK1B 1ZQSA 3PV8A 4UB6U 4GIBA 4C7ZA 3NGDA 5KFIA 5AI0A 4BDPA 1KDHA 4JB3A 2JZBB 4C8KA 8ICBA 3G6XA 5CHEA 2PKEA 4BUGA 4LJXA 1RYUA 4J03A 2CPRA 4OAGA 2ZIVB 5ALZA 4O0IA 3Q8KA 1NJXA 5JTGA 1HEKA 1L7OA 4X4RA 4DQSA 4RNOA 4EELA 5ALWA 4RQ7A 3CP8A 5HRHA 1WCLA 1L5UA 4LEVA 2WTFA 2DR5A 5KG4A 1A76A 5D63A 2BCRA 4F71A 5KT5A 1XWLA 3QNMA 3WK5A 4EBDA 3LQCB 4WC2A 4E8FA 5DG7A 3HX0A 5J2DA 2JZBA 3PNCA 4CRXA 3S6JA 4NLKA 1HUOA 2KZMA 2DPIA 2HHXA 4YR3A 2PFQA 1SIJA 5DLFA 4F8RA 2GAFD 4C4RA 8ICXA 4NLBA 2AQ4A 1EXNA 1BPDA 4EBEA 1IG6A 3K1RB 4QW8A 5KG5A 1ZRMA 1B4FA 4B9VA 4O3RA 8ICJA 5HRDA 4QWAA 4K96A 8ICCA 1RQLA 3AEVA 1QSSA 2W9AA 2LM1A 3EF2A 5KFHA 2KTQA 5J2BA 3UM9A 3SAGA 4RQ6A 3C5FA 4KLMA 2PI4A 2HHTA 1A6SA 5CJ7A 3GIIA 4PL2A 4Z6FA 1FFVA 3T3FA 8ICVA 2F2AB 1KW4A 1NK8A 1B22A 2ES6A 2HDOA 9ICWA 4F50A 3ETRA 3RBDA 4KITB 2HW3A 9ICOA 3L9DA 3ER8C 2DKZA 4QZHA 1PVPA 3HIYA 3UXPA 4RQ8A 2F76X 4GFJA 2Y1IA 7ICKA 2ZH3A 5ALLA 4F4YA 4I28A 5HRFA 2NRTA 2KZZA 1BPBA 1SGGA 4FHVA 5ALRA 4M9GA 5KFTA 5ALVA 3QX7A 1ZQXA 2DFLA 1PK3A 3RBEA 2H3ZA 4X0BA 1DGSA 2I5HA 4RWPA 5DKWA 2KSOB 7ICPA 3VC8A 3Q8PB 4Y2UA 3KTQA 5KFFA 1L7PA 3KHLA 2XY7A 4DL5A 2LI6A 4NLCA 2CRXA 4RPXA 4Y2PA 4F5NA 4RQ5A 2JH7A 3MDCA 4UBCA 3OV7A 2B56A 4RPZA 5E79U 2NRXA 5G5GA 4AYBF 1H38A 1K1SA 5ALQA 1SL2A 1ZQNA 4B9LA 7ICGA 4QWEA 4Y2XA 4KLSA 4OAHA 5KG1A 1SKRA 4IS7A 3OVAA 4OAIZ 2OHFA 4XJEA 1KFSA 2XGPA 4DFPA 3M8RA 5KG2A 4N7RA 3V72A 5HC9A 4I2CA 4B9SA 3QE9Y 4NXUA 5ALXA 4M0AA 4OCZA 2EDUA 4CF5A 4EEYA 4DQRA 1TFRA 4ZH4A 4DFDA 4FHPA 3KKAA 1N2XA 4RT2A 2KIVA 3D2QA 1L7MA 8ICRA 4J9QA 4P4MA 1D9DA 2W04A 5HMLA 3RR8A 4EZ6A 4F3OA 5J2FA 2PMZC 3TADA 3JPPA 4MHVA 4KLJA 3ICXA 2HHPA 1KKXA 4YD2A 4WC5A 3HKZF 3PZPA 3UMCA 4KLQA 5AIBA 5CWRA 4LEWA 4M9JA 2YB4A 9ICUA 3TAPA 2XCAA 3UXOA 3CK6A 4J9RA 1U49A 4MEYA 3V6KA 3JZ0A 2OYYA 4KM5A 1URJA 1YZ6A 4C4SA 5AKGA 2A1AA 4Z6DA 5AI6A 1V38A 2LYBA 4ATBA 2EAMA 4DOBA 1RXWA 1TFWA 1ZQWA 4PGYA 1Q78A 2EWRA 4DS4A 4ECXA 4PHEA 2KK0A 3EUB2 2FLLA 2H3FA 1S0NA 3NVYA 2ZH2A 4KB6A 3TAQA 2FI1A 4NL9A 2ATLA 5ALUA 1T3QA 4X4PA 2ZIWA 1ZQDA 5AM0A 2ZIUA 5J0QA 4O5CA 5HRLA 3NYBA 2UVWA 4EZ9A 4X4QA 2BHNA 1L6NA 3SV3A 1YLQA 4NXWA 3ISCA 2W8KA 2R8GA 5AKKA 2J6TA 4UAVA 4E0DA 1KBUA 3N7SC 7ICTA 4K8VA 5AK3A 4KLIA 4DFJA 2MUTB 1JROA 2FLPA 4IC9A 4K9AA 2B6GA 1Q8KA 5C0YA 1HJPA 4NL9C 3MR5A 2YX8A 3JPTA 1ZQJA 1U4BA 1SKSA 4P0PB 1D8YA 5KL1B 4AT9A 4HAIA 4ECVA 3EYZA 4BXOA 3RAXA 5AICA 2EANA 2MSNA 3NS1A 1MIVA 1MSWD 2ZHBA 5J0YA 2AXTU 4QIWF 4WQLA 7ICVA 2BPGA 3QEAZ 2RFFA 4ECUA 1IXRA 1QTMA 2C2RA 7ICUA 2ZH5A 4PJ0U 4WC7A 3QU2A 2XI9A 2HBJA 3T5KA 1ZD2P 3T79A 2R8JA 3AL0B 3SV4A 1V9PA 2R18A 1V97A 4O6AA 1SXDA 3PX4A 1TKDA 3T5HA 4OJOA 3GFKB 3M9OB 4F91B 4NJ8A 5DB7A 3GIJA 2HBKA 2R8HA 1SWWA 3HJ1A 4XUSA 2H3QA 2UVRA 3GILA 3BS5A 5A0LA 3GZFA 2K8AA 2AGQA 4MF2A 4ELTA 3H37A 4B6JA
chains in the Genus database with same CATH topology
4ED7A 3V6JA 4KLHA 3TANA 3PY8A 1A77A 2KZ3A 2F1JA 4I2BA 5JUMA 3V6HA 2C22A 4QZ9A 4X4VA 5HHHA 7ICIA 1MIYA 4I2GA 1FA0A 3MFIA 5KFYA 3OGUA 4IRCA 4NM2A 5KFEA 2V4QA 1F5AA 3JPRA 1R8BA 2ZJ5A 1N56A 2FLNA 4Q8FA 3N97B 3SI8A 1COOA 4M9NA 2RDIA 4YQWA 4KLGA 9ICFA 4I2DA 3THVA 4BDPA 1RPLA 2KFZA 2HHVA 3KHHA 8ICQA 1WOTA 5KFBA 4UB4A 4DFMA 3JYYA 1T8EA 4YFKA 4KLTA 3AQKA 2O5AA 1JAJA 5F2VO 4NLZA 1NK0A 1WCNA 4F4XA 3PW7A 3PW5A 2ZH7A 1X9MA 4YD1A 3EW9A 3PO4A 4DL2A 2KFNA 2VANA 2KP7A 1ZQYA 4I27A 1K1QA 3OJSA 3GV7B 5J2EA 2HVHA 9ICXA 1ZQQA 3KHRA 8ICEA 4K4IA 3WFQE 2NRKA 4FH3A 4YR2A 2XGQA 4NKUA 2BPCA 3NTUA 4RNMA 4WC6A 4QWBA 3TI0A 5KFPA 4DQQA 3BQ1A 1ZQKA 3ZDDA 4DOCA 1KNYA 4KN7A 4S3NA 4F4KA 3RJEA 3HIYA 3OUYA 1S0MA 5J0XA 1Y88A 4XA5A 8ICYA 5J2IA 1S0VA 7ICRA 4QZAA 3IHQB 5J0PA 4IQTA 3MR6A 5IIKA 4K4HA 1CEZA 4DL4A 4M04A 4QZFA 4YMOA 2ZTDA 4YP3A 4EBKA 4UB5A 3H3AA 4X4SA 1L3SA 5BPCA 1NJZA 1OU5A 3C18A 3WFPA 7ICSA 2B21A 2C2DA 4KLUA 3LDAA 4ECSA 1NKCA 3ISDA 2JEGA 3Q8QB 4IQWA 4M5DA 9ICQA 4NLGA 2ISPA 4X0AA 5D46A 2XC9A 1ZQCA 5KFSA 3H40A 2AGPA 3H4DA 4ED2A 9ICBA 1KRPA 8ICUA 4WC1A 2H5XA 4QZEA 3QZ7A 5J0OA 1KSPA 2R8KA 1NZPA 4QZ8A 3SYZA 2IHMA 4UAZA 4GC6A 3ZD8A 1XSLA 1RYRA 9ICKA 3TQ1A 1S10A 4XQ8A 4QZIA 4DLEA 3RB6A 4DLGA 4FO6A 1ZQIA 4LZGA 4IQVA 9ICRA 4DFKA 2M2UA 1Z00A 3M8SA 4X5VA 4BWMA 1S9FA 4DF4A 1N48A 1ZETA 1UETA 5KT7A 5KFWA 1XU4A 2DRBA 4RQ3A 3H4BA 1ZQSA 3PV8A 4G3IA 5J2JA 2HHWA 3RJHA 4RWOA 4AT9B 2ZUBA 3EZ5A 3NGDA 4C8KA 1UT8A 5KFIA 3LK9A 3KHGA 1KDHA 2JZBB 4DEZA 5DB8A 5J0SA 5IIMA 5J29A 8ICBA 4IG8A 4KMUA 3G6XA 3BQ0A 1R89A 2ZUCA 4MEXA 2FMQA 5L1LA 4FBTA 4MFFA 4ECQA 4KTQA 5DQIA 4O0IA 3Q8KA 1NJXA 1ZQMA 3M9NB 4NM1A 4O5KA 3RJGA 2XY6A 5D49A 3EWAA 5KFZA 4DQSA 1R8CA 4X4RA 4RNOA 3T5JA 5TZVA 4HYKA 4FS1A 2DR7A 4KLDA 4RQ7A 4LZDA 1T7PA 5KFUA 3RJJA 1KTQA 2ALZA 5HRHA 4B9MA 1WCLA 4YG2A 5KFJA 4ECRA 1L5UA 4TQRA 4R65A 2WTFA 4DL6A 3PW4A 2DR5A 2J6SA 4J9LA 8ICOA 2V9WA 3WFSC 5KG4A 1A76A 5KT4A 5EWFA 1ZYQA 2BCSA 1R8AA 4PHAA 2BCRA 4F2RA 5KT5A 3M9MB 1XWLA 5DQGA 3GV5B 1RXVA 4BGDA 4GXIA 4ECZA 4EBDA 3IM1A 4ED0A 1ZQTA 9ICHA 2FPLA 3LQCB 3AQMA 1UA0A 1U9LA 4E8FA 2AQ0A 4WC2A 5DG7A 3HX0A 5KG3A 5J2DA 2BCUA 3AU2A 2JZBA 3PNCA 5KFRA 2BQ3A 2BPFA 1S97A 4DWIA 3G6YA 4NLKA 3PMLA 1HUOA 1L3UA 5DBCA 2KZMA 2DPIA 3K4GA 5IIJA 3GIKA 4YR3A 1ZQBA 5HP4A 1MQ3A 2PFQA 2HHXA 5DLFA 3ORYA 2IA6A 4F5QA 4F8RA 4JUZA 4C8NA 2FPMA 4O3QA 3RB4A 5J0RA 4M9HA 8ICXA 2AQ4A 5EOZA 1EXNA 4UAWA 1BPDA 2KN7A 3RB0A 4EBEA 3ETLA 3ZDCA 2ZH8A 4QW8A 5KG5A 4DSEA 3BDPA 3T5LA 4B9VA 4O3RA 1RZTA 7ICNA 1NKBA 2BGWA 4JV1A 1UEUA 2GWSA 5BOMA 3BJYA 1T3NA 8ICJA 1U48A 3N4MB 5HRDA 3B0XA 3RAQA 4QWAA 1DK3A 4QZDA 5KTQA 1SL1A 5L9XA 1C7YA 3G6VA 4O3PA 8ICCA 4WCWA 1QSSA 4UB1A 2W9AA 4RNNA 1L3VA 2ZH1A 2HHUA 4Z6EA 5J2CA 3QZ8A 1ZQUA 3JPSA 1XC9A 5KFHA 4F4WA 2UVVA 7ICFA 4RQ1A 2KTQA 4X4NA 4TUQA 3LWMA 4DSKA 1TK0A 1RYSA 5J2BA 2ZTCA 3Q8LA 4AT7B 4RQ6A 2Y1JA 4I29A 1MIWA 9ICAA 4R64A 3C5FA 2ZTEA 4J9KA 1T4GA 3FDSA 3AU6A 4QZCA 4EYHB 4KLMA 2IHNA 2J6UA 2PI4A 2HHTA 8ICMA 1BPXA 9ICTA 4KLEA 4LT6A 3GIMA 4IRKA 1Q79A 4PHPA 4YMMA 5CJ7A 5HR9A 2R8IA 4WBZA 3GV8B 3GIIA 4Z6FA 3UXNA 4C8MA 1UA1A 5EWEA 5CHGA 2NRVA 3T3FA 1QSLA 2I9GA 4M9LA 8ICVA 3OUYB 3H8WA 2HHQA 1NK8A 2XCPA 4B9TA 4JWMA 2XY5A 2BCVA 3RJIA 5CA7A 1B22A 2ZH4A 2DRAA 2PI5A 3RH6A 3QEBZ 2BQRA 5HREA 3RH5A 1ZQGA 9ICWA 5J0WA 1JX4A 2UVUA 4DQIA 2AU0A 3Q8MA 4F50A 4ECTA 3C1YA 5KT3A 2ID1A 2PFPA 1AROP 3RBDA 4KITB 4DL3A 4O9MA 2HW3A 9ICOA 3L9DA 1B43A 5KFKA 4QZHA 4UBBA 1PZNA 5DG9A 4RQ8A 3UXPA 4DO9A 1ZQEA 1LB2B 4DSIA 1TAUA 4TQSA 2M2VA 2RDJA 2Y1IA 4RUCA 3MR2A 3H7IA 4F4YA 4I28A 4RZRA 7ICKA 8ICFA 5HRFA 9ICLA 2ZH3A 4QWCA 2W8LA 1SL0A 5L1IA 2C28A 1BGXT 1JIHA 2NRTA 7ICLA 2BCQA 5KT2A 2KZZA 1BPBA 4FHVA 1NJYA 2LYHA 4YVZA 4M9GA 3PMNA 5KFTA 4NKTA 4XQ7A 4ELTA 1LV5A 3WFOA 3LWLA 3C2LA 1D8LA 1ZQXA 2DFLA 2W9MA 4P2HA 3OHBA 2ZHAA 4GC7A 4UD5A 4RU9A 4M6WB 3RBEA 2P6UA 1ZQPA 4X0BA 2Q66A 1DGSA 2BKEA 3RH4A 5J2AA 4RWPA 5DKWA 7ICPA 3Q8PB 2ISOA 2JEJA 2ASLA 3KTQA 1TFYA 4DQPA 5KFFA 4KLFA 3KHLA 3RB3A 8ICZA 5C5JA 4ATBB 2XY7A 4J9NA 5IINA 3H39A 1BPZA 4DL5A 2M2TA 5J2KA 3ZDBA 4CCHA 4DSLA 3K75D 4F92B 5J0UA 1MC8A 3HP6A 8ICNA 5DEDA 3RJKA 4YMNA 4RPXA 4GLXA 3OVSA 5IIOA 7ICQA 4F5NA 4RQ5A 3HWTA 2ASDA 4YXMA 3UQ2A 3MDCA 7ICOA 5DLGA 4UBCA 4DOAA 5HNKA 1V4AA 8ICHA 3C23A 3OV7A 1TK8A 5KFMA 4UQGA 4RPZA 4ED1A 5DECA 4LVSA 1ZQAA 8ICTA 2ZJAA 4R8UB 2BR0A 1XO1A 8ICSA 2NRXA 4I2FA 4QZGA 1KFTA 4E7XA 4QWDA 1NO5A 4TUPA 1H38A 2PFOA 1K1SA 5HRBA 2A1JB 4M6WA 3FYHA 4O5EA 1SL2A 4X4TA 4RUAA 4RQ0A 1JXEA 9ICCA 1ZQNA 4B9LA 7ICGA 5KFGA 4WC0A 4QWEA 7ICHA 4GXKA 4KLSA 1ZQVA 5DQHA 5KG1A 3C21A 1X2IA 1SKWA 1SKRA 2M2WA 4AT7A 4C8OA 3OVAA 1NK7A 1XSPA 2PXIA 1KLNA 2MAXA 4B9NA 5IIIA 4IRDA 4RWQA 1KFSA 2XGPA 4DFPA 4MF8A 3OSNA 5KG2A 3M8RA 5J2HA 3V72A 1CUKA 3RR7A 4IR1A 3PW0A 3V7LA 4DSJA 4M47A 4KLOA 5HC9A 4GXJA 1NK6A 4I2CA 4X4OA 4TURA 1TVAA 1ZQZA 2W9CB 5L1KA 3QE9Y 4B9SA 1QSYA 4M0AA 2IMWP 2F1HA 4I2EA 5L1JA 4EEYA 8ICLA 5DDYA 2FPKA 4DQRA 1TFRA 4ZH4A 4ECWA 4EBJA 1DOQA 1HUZA 4M2YA 4FHPA 1PX5A 1S76D 4Z6CA 5CR0A 2NRZA 4RT2A 3MBYA 4ED6A 1ZJMA 1XS9D 3OJUA 4E80A 4P4PA 4FBUA 3UPQA 3GDXA 5HRGA 3BQTA 4J9QA 8ICRA 5J2GA 4P4MA 1NJWA 1D9DA 1ZQHA 5KFDA 2HHSA 9ICGA 4Q8EA 5HMLA 3RR8A 2DR8A 4NXZA 4EZ6A 4J9MA 2BQUA 4F3OA 5J2FA 2DR9A 2P6RA 3JPPA 4UD4A 4TUSA 4KLJA 4YR0A 3MABA 5HHIA 2VA3A 5DB6A 2HHPA 4YD2A 4WC5A 2DVIA 1NK9A 2JEIA 1BNOA 3MGIA 5KFQA 5EWGA 3C2KA 4KLQA 2F1IA 5CWRA 4XRHA 1D9FA 4M9JA 9ICUA 4FHYA 4P4OA 4JWNA 8ICAA 3TAPA 4QW9A 2W9CA 2XCAA 1TK5A 3UXOA 4RPYA 4J9RA 2IBKA 3JPQA 1U49A 4MEYA 5KFAA 3V6KA 3JZ0A 2O1PA 5KFOA 2VA2A 5J0TA 1X9SA 2ZJ8A 3MR3A 3Q8RB 2VA8A 5KG0A 1UT5A 4Z6DA 2V4RA 4R63A 3TFSA 1NK4A 4B9UA 1TAQA 4ATBA 3PR4A 3HT3A 4AT8B 4F5PA 8ICGA 4DOBA 2XO7A 1RXWA 9ICPA 3AQNA 1ZQWA 4PGYA 1Q78A 1TFWA 1DK2A 3EPIA 4DS4A 4ECXA 1L3TA 5KFLA 4PHEA 3Q8SB 4ED8A 4FHXA 5IILA 2FLLA 4UB3A 3H8JA 4R66A 1S0NA 1KFDA 4RT3A 4Q44A 3AUOA 2ZH2A 5HMMA 3ZD9A 1JN3A 5KFNA 3TAQA 1JXLA 1QLNA 8ICWA 3AQLA 3EPGA 1NOMA 4DSFA 3TARA 2ATLA 4DF8A 2FMPA 4JV2A 2BE3A 4FHWA 4IR9A 2JEFA 4R8UA 8ICPA 4DL7A 2OWOA 4F5RA 4X4PA 4FH5A 1ZQDA 3PW2A 4O3NA 3RRHA 1U47A 5DDMA 3C1ZA 4J9SA 4ED3A 2A1JA 5J0QA 4O5CA 8ICIA 1BNPA 2DPJA 3B0YA 9ICSA 4EP7A 4J9OA 4JK1A 3PR5B 5HRLA 2UVWA 4EZ9A 3NYBA 2ASJA 2BHNA 4WBYA 4X4QA 3RJFA 4WC3A 2PBEA 1BPEA 4I2IA 3SV3A 1YLQA 3C5GA 3ISCA 2W8KA 5D4BA 3RRGA 3OVBA 2R8GA 3PVXA 2J6TA 5DBBA 9ICNA 1JQRA 2M9NA 5DGAA 4F2SA 4E0DA 4RWNA 7ICTA 2MUTA 2NRWA 5KT6A 5DBAA 4F4ZA 3E2EA 4KLIA 3C66A 4DFJA 3MFHA 2MUTB 5KFXA 3PX0A 2FLPA 4ELUA 4I2HA 9ICJA 2W9BB 2BDPA 4X4UA 3BQ2A 3H38A 1HJPA 3HW8A 2P66A 5BOLA 1UEVA 1TV9A 4QZBA 4UB2A 3MR5A 3C2MA 4PGXA 5KG7A 3JPTA 3V7KA 1ZQJA 2ZH9A 5F9NA 1U4BA 1SKSA 4O3SA 1D8YA 5DB9A 4BXOB 3GQCA 4AT9A 4ECVA 3EYZA 4BXOA 5DG8A 3RAXA 1NKEA 1ZQOA 4F93B 3UQ0A 4C8LA 4EBCA 4I2AA 4NLNA 5HRKA 9ICMA 4K4GA 1KEJA 1MIVA 4YCXA 3PO5A 4F5OA 5KFCA 1MSWD 5J0YA 2ZHBA 3WFRE 5KG6A 9ICIA 3ZDAA 4PH5A 1Z3EB 4MFCA 7ICVA 4JV0A 2BPGA 3QEAZ 4KN4A 2RFFA 4ECUA 2PFNA 1IXRA 4IQUA 3HJ4A 5F9LA 1QTMA 4RQ2A 2C2RA 7ICUA 5KFVA 2ZH5A 1X9WA 7ICEA 9ICEA 3H8SA 2HVIA 3OHAA 3V7JA 3TFRA 2ZH6A 1VFGA 4WC7A 1ZQFA 5CP2A 4YN4A 1ZJNA 4BWJA 3T5KA 1XSNA 4J9PA 4UAYA 4DS5A 1IM4A 5HRIA 2R8JA 4Q43A 4Q45A 3JPNA 2W9BA 4ECYA 1NK5A 1S77D 3SV4A 4PGQA 1ZQRA 5CB1A 1V9PA 3MGHA 1Z00B 4O3OA 3JPOA 1MQ2A 3PX4A 3RTVA 3SZ2A 3MDAA 3T5HA 3PX6A 4I2JA 1TKDA 4NY8A 2I1QA 1SZPA 3GFKB 2FMSA 3M9OB 4F91B 1BPYA 1ZQLA 4PPXA 7ICMA 8ICKA 4AT8A 2ZUDA 3ISBA 5DGBA 2AJQA 4EYIB 5DB7A 4YXJA 3GIJA 4MFAA 2R8HA 3ZDEA 1VJ7A 1U45A 1JMSA 4RQ4A 3HPOA 2Q0ZX 7ICJA 9ICVA 3HJ1A 4XUSA 3UPSA 4ELVA 2C2EA 1S0OA 4PHDA 4KLLA 2UVRA 3GILA 1BVSA 4FS2A 2AGOA 4MF2A 3H37A 2AGQA 3OSPA 4WC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ED7 A;  3V6J A;  4KLH A;  3TAN A;  3PY8 A;  1A77 A;  2KZ3 A;  2F1J A;  4I2B A;  5JUM A;  3V6H A;  2C22 A;  4QZ9 A;  4X4V A;  5HHH A;  7ICI A;  1MIY A;  4I2G A;  1FA0 A;  3MFI A;  5KFY A;  3OGU A;  4IRC A;  4NM2 A;  5KFE A;  2V4Q A;  1F5A A;  3JPR A;  1R8B A;  2ZJ5 A;  1N56 A;  2FLN A;  4Q8F A;  3N97 B;  3SI8 A;  1COO A;  4M9N A;  2RDI A;  4YQW A;  4KLG A;  9ICF A;  4I2D A;  3THV A;  4BDP A;  1RPL A;  2KFZ A;  2HHV A;  3KHH A;  8ICQ A;  1WOT A;  5KFB A;  4UB4 A;  4DFM A;  3JYY A;  1T8E A;  4YFK A;  4KLT A;  3AQK A;  2O5A A;  1JAJ A;  5F2V O;  4NLZ A;  1NK0 A;  1WCN A;  4F4X A;  3PW7 A;  3PW5 A;  2ZH7 A;  1X9M A;  4YD1 A;  3EW9 A;  3PO4 A;  4DL2 A;  2KFN A;  2VAN A;  2KP7 A;  1ZQY A;  4I27 A;  1K1Q A;  3OJS A;  3GV7 B;  5J2E A;  2HVH A;  9ICX A;  1ZQQ A;  3KHR A;  8ICE A;  4K4I A;  3WFQ E;  2NRK A;  4FH3 A;  4YR2 A;  2XGQ A;  4NKU A;  2BPC A;  3NTU A;  4RNM A;  4WC6 A;  4QWB A;  3TI0 A;  5KFP A;  4DQQ A;  3BQ1 A;  1ZQK A;  3ZDD A;  4DOC A;  1KNY A;  4KN7 A;  4S3N A;  4F4K A;  3RJE A;  3HIY A;  3OUY A;  1S0M A;  5J0X A;  1Y88 A;  4XA5 A;  8ICY A;  5J2I A;  1S0V A;  7ICR A;  4QZA A;  3IHQ B;  5J0P A;  4IQT A;  3MR6 A;  5IIK A;  4K4H A;  1CEZ A;  4DL4 A;  4M04 A;  4QZF A;  4YMO A;  2ZTD A;  4YP3 A;  4EBK A;  4UB5 A;  3H3A A;  4X4S A;  1L3S A;  5BPC A;  1NJZ A;  1OU5 A;  3C18 A;  3WFP A;  7ICS A;  2B21 A;  2C2D A;  4KLU A;  3LDA A;  4ECS A;  1NKC A;  3ISD A;  2JEG A;  3Q8Q B;  4IQW A;  4M5D A;  9ICQ A;  4NLG A;  2ISP A;  4X0A A;  5D46 A;  2XC9 A;  1ZQC A;  5KFS A;  3H40 A;  2AGP A;  3H4D A;  4ED2 A;  9ICB A;  1KRP A;  8ICU A;  4WC1 A;  2H5X A;  4QZE A;  3QZ7 A;  5J0O A;  1KSP A;  2R8K A;  1NZP A;  4QZ8 A;  3SYZ A;  2IHM A;  4UAZ A;  4GC6 A;  3ZD8 A;  1XSL A;  1RYR A;  9ICK A;  3TQ1 A;  1S10 A;  4XQ8 A;  4QZI A;  4DLE A;  3RB6 A;  4DLG A;  4FO6 A;  1ZQI A;  4LZG A;  4IQV A;  9ICR A;  4DFK A;  2M2U A;  1Z00 A;  3M8S A;  4X5V A;  4BWM A;  1S9F A;  4DF4 A;  1N48 A;  1ZET A;  1UET A;  5KT7 A;  5KFW A;  1XU4 A;  2DRB A;  4RQ3 A;  3H4B A;  1ZQS A;  3PV8 A;  4G3I A;  5J2J A;  2HHW A;  3RJH A;  4RWO A;  4AT9 B;  2ZUB A;  3EZ5 A;  3NGD A;  4C8K A;  1UT8 A;  5KFI A;  3LK9 A;  3KHG A;  1KDH A;  2JZB B;  4DEZ A;  5DB8 A;  5J0S A;  5IIM A;  5J29 A;  8ICB A;  4IG8 A;  4KMU A;  3G6X A;  3BQ0 A;  1R89 A;  2ZUC A;  4MEX A;  2FMQ A;  5L1L A;  4FBT A;  4MFF A;  4ECQ A;  4KTQ A;  5DQI A;  4O0I A;  3Q8K A;  1NJX A;  1ZQM A;  3M9N B;  4NM1 A;  4O5K A;  3RJG A;  2XY6 A;  5D49 A;  3EWA A;  5KFZ A;  4DQS A;  1R8C A;  4X4R A;  4RNO A;  3T5J A;  5TZV A;  4HYK A;  4FS1 A;  2DR7 A;  4KLD A;  4RQ7 A;  4LZD A;  1T7P A;  5KFU A;  3RJJ A;  1KTQ A;  2ALZ A;  5HRH A;  4B9M A;  1WCL A;  4YG2 A;  5KFJ A;  4ECR A;  1L5U A;  4TQR A;  4R65 A;  2WTF A;  4DL6 A;  3PW4 A;  2DR5 A;  2J6S A;  4J9L A;  8ICO A;  2V9W A;  3WFS C;  5KG4 A;  1A76 A;  5KT4 A;  5EWF A;  1ZYQ A;  2BCS A;  1R8A A;  4PHA A;  2BCR A;  4F2R A;  5KT5 A;  3M9M B;  1XWL A;  5DQG A;  3GV5 B;  1RXV A;  4BGD A;  4GXI A;  4ECZ A;  4EBD A;  3IM1 A;  4ED0 A;  1ZQT A;  9ICH A;  2FPL A;  3LQC B;  3AQM A;  1UA0 A;  1U9L A;  4E8F A;  2AQ0 A;  4WC2 A;  5DG7 A;  3HX0 A;  5KG3 A;  5J2D A;  2BCU A;  3AU2 A;  2JZB A;  3PNC A;  5KFR A;  2BQ3 A;  2BPF A;  1S97 A;  4DWI A;  3G6Y A;  4NLK A;  3PML A;  1HUO A;  1L3U A;  5DBC A;  2KZM A;  2DPI A;  3K4G A;  5IIJ A;  3GIK A;  4YR3 A;  1ZQB A;  5HP4 A;  1MQ3 A;  2PFQ A;  2HHX A;  5DLF A;  3ORY A;  2IA6 A;  4F5Q A;  4F8R A;  4JUZ A;  4C8N A;  2FPM A;  4O3Q A;  3RB4 A;  5J0R A;  4M9H A;  8ICX A;  2AQ4 A;  5EOZ A;  1EXN A;  4UAW A;  1BPD A;  2KN7 A;  3RB0 A;  4EBE A;  3ETL A;  3ZDC A;  2ZH8 A;  4QW8 A;  5KG5 A;  4DSE A;  3BDP A;  3T5L A;  4B9V A;  4O3R A;  1RZT A;  7ICN A;  1NKB A;  2BGW A;  4JV1 A;  1UEU A;  2GWS A;  5BOM A;  3BJY A;  1T3N A;  8ICJ A;  1U48 A;  3N4M B;  5HRD A;  3B0X A;  3RAQ A;  4QWA A;  1DK3 A;  4QZD A;  5KTQ A;  1SL1 A;  5L9X A;  1C7Y A;  3G6V A;  4O3P A;  8ICC A;  4WCW A;  1QSS A;  4UB1 A;  2W9A A;  4RNN A;  1L3V A;  2ZH1 A;  2HHU A;  4Z6E A;  5J2C A;  3QZ8 A;  1ZQU A;  3JPS A;  1XC9 A;  5KFH A;  4F4W A;  2UVV A;  7ICF A;  4RQ1 A;  2KTQ A;  4X4N A;  4TUQ A;  3LWM A;  4DSK A;  1TK0 A;  1RYS A;  5J2B A;  2ZTC A;  3Q8L A;  4AT7 B;  4RQ6 A;  2Y1J A;  4I29 A;  1MIW A;  9ICA A;  4R64 A;  3C5F A;  2ZTE A;  4J9K A;  1T4G A;  3FDS A;  3AU6 A;  4QZC A;  4EYH B;  4KLM A;  2IHN A;  2J6U A;  2PI4 A;  2HHT A;  8ICM A;  1BPX A;  9ICT A;  4KLE A;  4LT6 A;  3GIM A;  4IRK A;  1Q79 A;  4PHP A;  4YMM A;  5CJ7 A;  5HR9 A;  2R8I A;  4WBZ A;  3GV8 B;  3GII A;  4Z6F A;  3UXN A;  4C8M A;  1UA1 A;  5EWE A;  5CHG A;  2NRV A;  3T3F A;  1QSL A;  2I9G A;  4M9L A;  8ICV A;  3OUY B;  3H8W A;  2HHQ A;  1NK8 A;  2XCP A;  4B9T A;  4JWM A;  2XY5 A;  2BCV A;  3RJI A;  5CA7 A;  1B22 A;  2ZH4 A;  2DRA A;  2PI5 A;  3RH6 A;  3QEB Z;  2BQR A;  5HRE A;  3RH5 A;  1ZQG A;  9ICW A;  5J0W A;  1JX4 A;  2UVU A;  4DQI A;  2AU0 A;  3Q8M A;  4F50 A;  4ECT A;  3C1Y A;  5KT3 A;  2ID1 A;  2PFP A;  1ARO P;  3RBD A;  4KIT B;  4DL3 A;  4O9M A;  2HW3 A;  9ICO A;  3L9D A;  1B43 A;  5KFK A;  4QZH A;  4UBB A;  1PZN A;  5DG9 A;  4RQ8 A;  3UXP A;  4DO9 A;  1ZQE A;  1LB2 B;  4DSI A;  1TAU A;  4TQS A;  2M2V A;  2RDJ A;  2Y1I A;  4RUC A;  3MR2 A;  3H7I A;  4F4Y A;  4I28 A;  4RZR A;  7ICK A;  8ICF A;  5HRF A;  9ICL A;  2ZH3 A;  4QWC A;  2W8L A;  1SL0 A;  5L1I A;  2C28 A;  1BGX T;  1JIH A;  2NRT A;  7ICL A;  2BCQ A;  5KT2 A;  2KZZ A;  1BPB A;  4FHV A;  1NJY A;  2LYH A;  4YVZ A;  4M9G A;  3PMN A;  5KFT A;  4NKT A;  4XQ7 A;  4ELT A;  1LV5 A;  3WFO A;  3LWL A;  3C2L A;  1D8L A;  1ZQX A;  2DFL A;  2W9M A;  4P2H A;  3OHB A;  2ZHA A;  4GC7 A;  4UD5 A;  4RU9 A;  4M6W B;  3RBE A;  2P6U A;  1ZQP A;  4X0B A;  2Q66 A;  1DGS A;  2BKE A;  3RH4 A;  5J2A A;  4RWP A;  5DKW A;  7ICP A;  3Q8P B;  2ISO A;  2JEJ A;  2ASL A;  3KTQ A;  1TFY A;  4DQP A;  5KFF A;  4KLF A;  3KHL A;  3RB3 A;  8ICZ A;  5C5J A;  4ATB B;  2XY7 A;  4J9N A;  5IIN A;  3H39 A;  1BPZ A;  4DL5 A;  2M2T A;  5J2K A;  3ZDB A;  4CCH A;  4DSL A;  3K75 D;  4F92 B;  5J0U A;  1MC8 A;  3HP6 A;  8ICN A;  5DED A;  3RJK A;  4YMN A;  4RPX A;  4GLX A;  3OVS A;  5IIO A;  7ICQ A;  4F5N A;  4RQ5 A;  3HWT A;  2ASD A;  4YXM A;  3UQ2 A;  3MDC A;  7ICO A;  5DLG A;  4UBC A;  4DOA A;  5HNK A;  1V4A A;  8ICH A;  3C23 A;  3OV7 A;  1TK8 A;  5KFM A;  4UQG A;  4RPZ A;  4ED1 A;  5DEC A;  4LVS A;  1ZQA A;  8ICT A;  2ZJA A;  4R8U B;  2BR0 A;  1XO1 A;  8ICS A;  2NRX A;  4I2F A;  4QZG A;  1KFT A;  4E7X A;  4QWD A;  1NO5 A;  4TUP A;  1H38 A;  2PFO A;  1K1S A;  5HRB A;  2A1J B;  4M6W A;  3FYH A;  4O5E A;  1SL2 A;  4X4T A;  4RUA A;  4RQ0 A;  1JXE A;  9ICC A;  1ZQN A;  4B9L A;  7ICG A;  5KFG A;  4WC0 A;  4QWE A;  7ICH A;  4GXK A;  4KLS A;  1ZQV A;  5DQH A;  5KG1 A;  3C21 A;  1X2I A;  1SKW A;  1SKR A;  2M2W A;  4AT7 A;  4C8O A;  3OVA A;  1NK7 A;  1XSP A;  2PXI A;  1KLN A;  2MAX A;  4B9N A;  5III A;  4IRD A;  4RWQ A;  1KFS A;  2XGP A;  4DFP A;  4MF8 A;  3OSN A;  5KG2 A;  3M8R A;  5J2H A;  3V72 A;  1CUK A;  3RR7 A;  4IR1 A;  3PW0 A;  3V7L A;  4DSJ A;  4M47 A;  4KLO A;  5HC9 A;  4GXJ A;  1NK6 A;  4I2C A;  4X4O A;  4TUR A;  1TVA A;  1ZQZ A;  2W9C B;  5L1K A;  3QE9 Y;  4B9S A;  1QSY A;  4M0A A;  2IMW P;  2F1H A;  4I2E A;  5L1J A;  4EEY A;  8ICL A;  5DDY A;  2FPK A;  4DQR A;  1TFR A;  4ZH4 A;  4ECW A;  4EBJ A;  1DOQ A;  1HUZ A;  4M2Y A;  4FHP A;  1PX5 A;  1S76 D;  4Z6C A;  5CR0 A;  2NRZ A;  4RT2 A;  3MBY A;  4ED6 A;  1ZJM A;  1XS9 D;  3OJU A;  4E80 A;  4P4P A;  4FBU A;  3UPQ A;  3GDX A;  5HRG A;  3BQT A;  4J9Q A;  8ICR A;  5J2G A;  4P4M A;  1NJW A;  1D9D A;  1ZQH A;  5KFD A;  2HHS A;  9ICG A;  4Q8E A;  5HML A;  3RR8 A;  2DR8 A;  4NXZ A;  4EZ6 A;  4J9M A;  2BQU A;  4F3O A;  5J2F A;  2DR9 A;  2P6R A;  3JPP A;  4UD4 A;  4TUS A;  4KLJ A;  4YR0 A;  3MAB A;  5HHI A;  2VA3 A;  5DB6 A;  2HHP A;  4YD2 A;  4WC5 A;  2DVI A;  1NK9 A;  2JEI A;  1BNO A;  3MGI A;  5KFQ A;  5EWG A;  3C2K A;  4KLQ A;  2F1I A;  5CWR A;  4XRH A;  1D9F A;  4M9J A;  9ICU A;  4FHY A;  4P4O A;  4JWN A;  8ICA A;  3TAP A;  4QW9 A;  2W9C A;  2XCA A;  1TK5 A;  3UXO A;  4RPY A;  4J9R A;  2IBK A;  3JPQ A;  1U49 A;  4MEY A;  5KFA A;  3V6K A;  3JZ0 A;  2O1P A;  5KFO A;  2VA2 A;  5J0T A;  1X9S A;  2ZJ8 A;  3MR3 A;  3Q8R B;  2VA8 A;  5KG0 A;  1UT5 A;  4Z6D A;  2V4R A;  4R63 A;  3TFS A;  1NK4 A;  4B9U A;  1TAQ A;  4ATB A;  3PR4 A;  3HT3 A;  4AT8 B;  4F5P A;  8ICG A;  4DOB A;  2XO7 A;  1RXW A;  9ICP A;  3AQN A;  1ZQW A;  4PGY A;  1Q78 A;  1TFW A;  1DK2 A;  3EPI A;  4DS4 A;  4ECX A;  1L3T A;  5KFL A;  4PHE A;  3Q8S B;  4ED8 A;  4FHX A;  5IIL A;  2FLL A;  4UB3 A;  3H8J A;  4R66 A;  1S0N A;  1KFD A;  4RT3 A;  4Q44 A;  3AUO A;  2ZH2 A;  5HMM A;  3ZD9 A;  1JN3 A;  5KFN A;  3TAQ A;  1JXL A;  1QLN A;  8ICW A;  3AQL A;  3EPG A;  1NOM A;  4DSF A;  3TAR A;  2ATL A;  4DF8 A;  2FMP A;  4JV2 A;  2BE3 A;  4FHW A;  4IR9 A;  2JEF A;  4R8U A;  8ICP A;  4DL7 A;  2OWO A;  4F5R A;  4X4P A;  4FH5 A;  1ZQD A;  3PW2 A;  4O3N A;  3RRH A;  1U47 A;  5DDM A;  3C1Z A;  4J9S A;  4ED3 A;  2A1J A;  5J0Q A;  4O5C A;  8ICI A;  1BNP A;  2DPJ A;  3B0Y A;  9ICS A;  4EP7 A;  4J9O A;  4JK1 A;  3PR5 B;  5HRL A;  2UVW A;  4EZ9 A;  3NYB A;  2ASJ A;  2BHN A;  4WBY A;  4X4Q A;  3RJF A;  4WC3 A;  2PBE A;  1BPE A;  4I2I A;  3SV3 A;  1YLQ A;  3C5G A;  3ISC A;  2W8K A;  5D4B A;  3RRG A;  3OVB A;  2R8G A;  3PVX A;  2J6T A;  5DBB A;  9ICN A;  1JQR A;  2M9N A;  5DGA A;  4F2S A;  4E0D A;  4RWN A;  7ICT A;  2MUT A;  2NRW A;  5KT6 A;  5DBA A;  4F4Z A;  3E2E A;  4KLI A;  3C66 A;  4DFJ A;  3MFH A;  2MUT B;  5KFX A;  3PX0 A;  2FLP A;  4ELU A;  4I2H A;  9ICJ A;  2W9B B;  2BDP A;  4X4U A;  3BQ2 A;  3H38 A;  1HJP A;  3HW8 A;  2P66 A;  5BOL A;  1UEV A;  1TV9 A;  4QZB A;  4UB2 A;  3MR5 A;  3C2M A;  4PGX A;  5KG7 A;  3JPT A;  3V7K A;  1ZQJ A;  2ZH9 A;  5F9N A;  1U4B A;  1SKS A;  4O3S A;  1D8Y A;  5DB9 A;  4BXO B;  3GQC A;  4AT9 A;  4ECV A;  3EYZ A;  4BXO A;  5DG8 A;  3RAX A;  1NKE A;  1ZQO A;  4F93 B;  3UQ0 A;  4C8L A;  4EBC A;  4I2A A;  4NLN A;  5HRK A;  9ICM A;  4K4G A;  1KEJ A;  1MIV A;  4YCX A;  3PO5 A;  4F5O A;  5KFC A;  1MSW D;  5J0Y A;  2ZHB A;  3WFR E;  5KG6 A;  9ICI A;  3ZDA A;  4PH5 A;  1Z3E B;  4MFC A;  7ICV A;  4JV0 A;  2BPG A;  3QEA Z;  4KN4 A;  2RFF A;  4ECU A;  2PFN A;  1IXR A;  4IQU A;  3HJ4 A;  5F9L A;  1QTM A;  4RQ2 A;  2C2R A;  7ICU A;  5KFV A;  2ZH5 A;  1X9W A;  7ICE A;  9ICE A;  3H8S A;  2HVI A;  3OHA A;  3V7J A;  3TFR A;  2ZH6 A;  1VFG A;  4WC7 A;  1ZQF A;  5CP2 A;  4YN4 A;  1ZJN A;  4BWJ A;  3T5K A;  1XSN A;  4J9P A;  4UAY A;  4DS5 A;  1IM4 A;  5HRI A;  2R8J A;  4Q43 A;  4Q45 A;  3JPN A;  2W9B A;  4ECY A;  1NK5 A;  1S77 D;  3SV4 A;  4PGQ A;  1ZQR A;  5CB1 A;  1V9P A;  3MGH A;  1Z00 B;  4O3O A;  3JPO A;  1MQ2 A;  3PX4 A;  3RTV A;  3SZ2 A;  3MDA A;  3T5H A;  3PX6 A;  4I2J A;  1TKD A;  4NY8 A;  2I1Q A;  1SZP A;  3GFK B;  2FMS A;  3M9O B;  4F91 B;  1BPY A;  1ZQL A;  4PPX A;  7ICM A;  8ICK A;  4AT8 A;  2ZUD A;  3ISB A;  5DGB A;  2AJQ A;  4EYI B;  5DB7 A;  4YXJ A;  3GIJ A;  4MFA A;  2R8H A;  3ZDE A;  1VJ7 A;  1U45 A;  1JMS A;  4RQ4 A;  3HPO A;  2Q0Z X;  7ICJ A;  9ICV A;  3HJ1 A;  4XUS A;  3UPS A;  4ELV A;  2C2E A;  1S0O A;  4PHD A;  4KLL A;  2UVR A;  3GIL A;  1BVS A;  4FS2 A;  2AGO A;  4MF2 A;  3H37 A;  2AGQ A;  3OSP A;  4WC4 A; 
#chains in the Genus database with same CATH topology
 3TAN A;  2F1J A;  1IIP A;  2LMR A;  1FA0 A;  3I28 A;  4IRC A;  4NM2 A;  5KFE A;  1F5A A;  3MC1 A;  1R8B A;  1VLB A;  2FLN A;  1COO A;  3IDW A;  2RDI A;  3QUC A;  4YQW A;  4I2D A;  3WU2 U;  3THV A;  2KFZ A;  2HHV A;  3KHH A;  5KFB A;  4UB4 A;  5EE0 A;  1JAJ A;  4NLZ A;  1N60 A;  4F4X A;  2ZIX A;  2ZH7 A;  1X9M A;  2KFN A;  5ALM A;  1NZB A;  5J2E A;  1ECW A;  1ZQQ A;  4K4I A;  3NTU A;  5AKZ A;  1HIW A;  3ZDD A;  3SD7 A;  4S3N A;  3PSI A;  3OUY A;  1UQV A;  2D3D A;  3IHQ B;  4K4H A;  2F8K A;  4YMO A;  2ZTD A;  4UAT A;  1JUD A;  5AHX A;  1X40 A;  3WFP A;  2B21 A;  5AI9 A;  4M5D A;  3LDA A;  9ICQ A;  4NLG A;  9ICB A;  8ICU A;  2JXJ A;  3QYP A;  5AI8 A;  1XSL A;  3TAC B;  4XQ8 A;  2E8N A;  3RB6 A;  9ICR A;  1Z00 A;  4X5V A;  1UET A;  2KVS A;  4KMO B;  2W43 A;  2K4H A;  4Y2S A;  3RJH A;  1QQ7 A;  2ZUB A;  3EZ5 A;  1UT8 A;  3LK9 A;  4DEZ A;  5DB8 A;  5J0S A;  5IIM A;  5HR6 A;  2ZIV A;  4MEX A;  2FMQ A;  4FBT A;  3RJG A;  2XY6 A;  2WF6 A;  2YTU A;  5D49 A;  1R8C A;  1ED1 A;  5TZV A;  4FS1 A;  1T7P A;  5KFU A;  2ALZ A;  4R65 A;  1Z19 A;  2J6S A;  8ICO A;  2BCS A;  1R8A A;  4F2R A;  3GV5 B;  1RXV A;  5DQG A;  4BGD A;  4ED0 A;  4ECZ A;  3AQM A;  2FPL A;  1UA0 A;  1U9L A;  2HSZ A;  2KKV A;  2BCU A;  2BPF A;  1L3U A;  5DBC A;  3GIK A;  5IIJ A;  2XID A;  4F5Q A;  4C0Z A;  4O3Q A;  5CFT A;  2AH5 A;  2VJ5 A;  5GTI U;  7ICN A;  1NKB A;  1UPH A;  3CRX A;  1UEU A;  3QUQ A;  1T3N A;  1DK3 A;  5KTQ A;  1SL1 A;  2YMM A;  1C7Y A;  1ZD4 A;  2WB1 C;  3QXG A;  4RNN A;  2WHE A;  2HHU A;  2WF7 A;  4I0U A;  4CF3 A;  2JR5 A;  4QJF B;  4RQ1 A;  1TAM A;  1RYS A;  4OAF A;  5JRT A;  5ALJ A;  2Y1J A;  9ICA A;  4J9K A;  1T4G A;  3FDS A;  4QZC A;  4U6P A;  3ED5 A;  2J6U A;  1SV0 C;  8ICM A;  9ICT A;  2HCF A;  4YMM A;  5ALN A;  1QCK A;  1UA1 A;  5AM4 A;  1P7D A;  2HHQ A;  4JWM A;  2BCV A;  3RJI A;  5CA7 A;  2QB1 A;  2PI5 A;  2BQR A;  1VDV A;  3Q8M A;  2ID1 A;  2PFP A;  1ARO P;  2I6X A;  2K4E A;  1PZN A;  1TAU A;  4WOY A;  5CFS A;  4O3M A;  4JLX A;  2JGA A;  3IG8 A;  2YMQ A;  1NJY A;  3PMN A;  4NKT A;  4Y2J A;  1LV5 A;  4U7C A;  3WFO A;  3LWL A;  1ZRN A;  1COK A;  3HKZ C;  3OHB A;  2W7O A;  4GC7 A;  4RU9 A;  4UD5 A;  1ZQP A;  2Q66 A;  2KSO A;  2BKE A;  5J2A A;  3KOO A;  2WFA A;  2JEJ A;  2YN4 A;  3M1Y A;  4FE3 A;  3C29 A;  8ICZ A;  4J9N A;  3L4P A;  3H39 A;  3L5K A;  2G5H B;  5J2K A;  4CCH A;  5J0U A;  3RJK A;  3WKC A;  2FCL A;  3F2C A;  2KKP A;  1V4A A;  3SEI A;  5HNK A;  1K5O A;  3C23 A;  4ED1 A;  3NKU A;  4R8U B;  3B9J A;  2BR0 A;  4I2F A;  4QZG A;  1KFT A;  4QWD A;  1L7N A;  4NXT A;  1OW5 A;  2EZX A;  2A1J B;  3FYH A;  4RQ0 A;  1JXE A;  2YMP A;  5KFG A;  1SKW A;  3PHZ A;  3C21 A;  1X2I A;  4AT7 A;  1NK7 A;  4RWQ A;  4UB8 U;  2GOL A;  4MF8 A;  3OSN A;  5J2H A;  4IR1 A;  4WC0 A;  3IV6 A;  3PW0 A;  4DSJ A;  4M47 A;  4GXJ A;  1NK6 A;  2WF9 A;  1QSY A;  1S8O A;  8ICL A;  4ICA A;  2KJ5 A;  2XIC A;  4ECW A;  4O69 A;  3DV9 A;  5HRG A;  3BQT A;  1NJW A;  5ALK A;  5KFD A;  3AMZ A;  3KKA C;  5HHI A;  1NK9 A;  3MGI A;  3QUT A;  1MN8 A;  4P4O A;  4JWN A;  1M6Y A;  4QW9 A;  4Y2T A;  2O1P A;  1B0X A;  3Q8R B;  1UT5 A;  5KG0 A;  3QU4 A;  1NK4 A;  4B9U A;  1TAQ A;  3PR4 A;  3HT3 A;  4F5P A;  3R9K A;  2Y0S F;  2QAR A;  3Q8S B;  4ED8 A;  2K4I A;  4UB3 A;  2GO7 A;  4RT3 A;  4LEZ A;  3ZD9 A;  5KFN A;  2DR8 A;  4WQK A;  3EPG A;  4DSF A;  4FHW A;  3KZX A;  2N1R A;  4JV2 A;  2KOB A;  3WK4 A;  2Y9T A;  3PW2 A;  4O3N A;  1U47 A;  3ALR A;  5DDM A;  4J9S A;  4ED3 A;  8ICI A;  4EP7 A;  9ICS A;  3B0Y A;  5EE3 A;  4WBY A;  4K98 A;  3RJF A;  3C5G A;  5B66 U;  5DBB A;  5AKX A;  2MUT A;  4KX5 A;  5DBA A;  4US8 A;  3C66 A;  3PX0 A;  1ZD3 A;  1RG6 A;  4X4U A;  2KIW A;  2LBO A;  5BOL A;  1UEV A;  2HOQ A;  2YQE A;  4UB2 A;  2JRZ A;  2KMD A;  4O3S A;  5ALG A;  5ALP A;  4BXO B;  3PSP A;  2YY6 A;  3L3F X;  1KL9 A;  5DG8 A;  4CDG A;  4NLN A;  4F93 B;  5B5E U;  4EBC A;  4HX0 A;  4YCX A;  3WFR E;  5FP0 A;  2KHQ A;  1Z3E B;  4MFC A;  3F2B A;  4KN4 A;  2VJ4 A;  2PFN A;  3HJ4 A;  1X9W A;  5GTH U;  3H8S A;  1SV0 A;  1N5X A;  3SAH A;  1ZQF A;  4YN4 A;  3WKE A;  4BWJ A;  4K9B A;  1XSN A;  1IM4 A;  3JPN A;  4ECY A;  1NK5 A;  1S77 D;  5ALT A;  5CB1 A;  2FE9 A;  5G5H A;  3LYS A;  1MQ2 A;  4O3O A;  3SZ2 A;  2KJ8 A;  1Z1B A;  2HBM A;  1QQ6 A;  1BPY A;  7ICM A;  4AT8 A;  3ISB A;  3FAH A;  4EYI B;  3ZDE A;  1U45 A;  2F77 X;  3UPS A;  2C2E A;  4KLL A;  4AYB C;  4FS2 A;  2A3V A;  1SWV A;  3RFA A;  3V6J A;  4UAR A;  4KLH A;  3PY8 A;  1JRP A;  2B4V A;  2KZ3 A;  5JUM A;  3V6H A;  4QZ9 A;  7ICI A;  1MIY A;  4C7Y A;  5EE1 A;  3OGU A;  4KX3 A;  3JPR A;  4EX6 A;  2ZJ5 A;  3ZI4 A;  2F8L A;  3SI8 A;  4KLG A;  2GLE A;  1RPL A;  3WK6 A;  2RHF A;  2E5S A;  1L8L A;  1T8E A;  2ZIX B;  2DQN B;  1WCN A;  1ZXI A;  3EW9 A;  3PO4 A;  4DL2 A;  1WYG A;  3K7D A;  3GV7 B;  9ICX A;  3KHR A;  3WFQ E;  4FH3 A;  1TE2 A;  4JMU A;  4OJ5 A;  4RNM A;  5KFP A;  4DQQ A;  3BQ1 A;  1KNY A;  1UCV A;  4F4K A;  3RJE A;  2AHO B;  1S0M A;  1Y88 A;  4XA5 A;  4NXV A;  5J0P A;  3MR6 A;  4DL4 A;  4YP3 A;  4EBK A;  4X4S A;  5BPC A;  3AM9 A;  4KLU A;  5JTI A;  1ZQC A;  1N61 A;  3HIL A;  3H40 A;  1KRP A;  5ALF A;  2IHO A;  4WC1 A;  4QZE A;  5J0O A;  1KSP A;  4QZ8 A;  3SYZ A;  4UAZ A;  3WK7 A;  3ZD8 A;  4DFK A;  1KQQ A;  3M8S A;  1S9F A;  5D61 A;  1N48 A;  1ZET A;  4USA A;  1J2M A;  4G3I A;  4P0P A;  3GU3 A;  5AM3 A;  4AT9 B;  2DL0 A;  2A19 A;  5J29 A;  1Q3V A;  3E0F A;  4MFF A;  4F72 A;  4KTQ A;  4C80 A;  4DCC A;  4NM1 A;  3QUB A;  2EZY A;  5KFZ A;  3OTQ A;  3T5J A;  4JLZ A;  4HYK A;  2DR7 A;  4KLD A;  3RJJ A;  4LZD A;  2W54 A;  2OEH A;  2GH1 A;  2W11 A;  5ALD A;  4OO1 J;  4B9M A;  4YG2 A;  5KFJ A;  4ECR A;  4TQR A;  1MA7 A;  2KE7 A;  3PW4 A;  4DL6 A;  2V9W A;  1FIQ A;  5KT4 A;  5EWF A;  1Q3U A;  4CGZ A;  4GXI A;  3IM1 A;  2AQ0 A;  2EAP A;  5KG3 A;  2HOF A;  5KFR A;  3G6Y A;  3K4G A;  1ZQB A;  2XVT A;  5HP4 A;  3OWG A;  1WG8 A;  3SAF A;  2DKX A;  4JUZ A;  4C8N A;  3RB4 A;  4M9H A;  2LPE A;  4UAW A;  3ZDC A;  3RB0 A;  3ETL A;  4Y2Q A;  5ALH A;  5KNI A;  3BDP A;  3T5L A;  2RLT A;  1F44 A;  2BGW A;  2GWS A;  5BOM A;  1U48 A;  3N4M B;  3B0X A;  3RAQ A;  2F44 A;  4EGW A;  2LM4 A;  2K8C B;  4QZD A;  5L9X A;  4UB1 A;  1L3V A;  2ZH1 A;  3K1Z A;  4Z6E A;  3QZ8 A;  3JPS A;  4X4N A;  4F4W A;  4TUQ A;  3LWM A;  3KZI U;  1TK0 A;  1PUZ A;  3M6K A;  1X66 A;  2KD1 A;  4I29 A;  3TKA A;  4EYH B;  4OJL A;  2IHN A;  2MRL A;  1BPX A;  4KLE A;  4LT6 A;  4IRK A;  1Q79 A;  5CFU A;  5HR9 A;  1WUD A;  2KHV A;  3GV8 B;  4C8M A;  3OUY B;  5EWE A;  2NRV A;  2I9G A;  2XCP A;  4B9T A;  2XY5 A;  5AI5 A;  5HRE A;  4BX9 C;  3RH5 A;  1JX4 A;  2UVU A;  1SB3 C;  3C1Y A;  5KT3 A;  4ECT A;  3F5E A;  4O9M A;  4DO9 A;  5AKL A;  4UBB A;  1ZQE A;  2M2V A;  2RDJ A;  4RUC A;  3MR2 A;  4C4T A;  4CNQ A;  9ICL A;  4QWC A;  2W8L A;  5L1I A;  1JIH A;  2LYH A;  5JU5 A;  2HOI A;  1S5L U;  5AK6 A;  5ALO A;  3DEE A;  3C2L A;  2W9M A;  2VIX A;  4NV0 A;  4P0Q B;  2P6U A;  2Q4T A;  3RH4 A;  1L8O A;  2ISO A;  1IV8 A;  4MKP A;  4KLF A;  2KVC A;  4EEN A;  3RB3 A;  2IOF K;  4ATB B;  1FFU A;  1BPZ A;  4Y2R A;  3ZDB A;  5J8Y A;  3K75 D;  4F92 B;  8ICN A;  3HP6 A;  5AK4 A;  4GLX A;  1F0M A;  2ASD A;  4YXM A;  3UQ2 A;  7ICO A;  3D2S A;  8ICH A;  1SXE A;  1TK8 A;  5KFM A;  4UQG A;  2QB0 B;  1ZD5 A;  1ZQA A;  2ZJA A;  5ALY A;  1XO1 A;  8ICS A;  2PFO A;  5HRB A;  2ZIU B;  4O5E A;  4X4T A;  4RUA A;  1PVR A;  3NVZ A;  9ICC A;  4A8E A;  1ZQV A;  2RP5 A;  3A0B U;  5DQH A;  2M2W A;  1VJ5 A;  1KLN A;  2MAX A;  5III A;  5J8Y C;  2GA9 D;  3H3A A;  3RR7 A;  4KLO A;  5AK5 A;  4X4O A;  1LKY A;  2W9C B;  5L1K A;  2IMW P;  2F1H A;  4I2E A;  5L1J A;  2BDU A;  2OXO A;  4EBJ A;  5CR0 A;  1ZJM A;  1XS9 D;  2ODG A;  4P4P A;  3GDX A;  5J2G A;  1ZQH A;  3NAS A;  1PVQ A;  2BQU A;  1DRG A;  3HRD D;  2DR9 A;  4UD4 A;  4TUS A;  1CRX A;  2DVI A;  5L1M A;  2KIC A;  5KFQ A;  2F1I A;  4XRH A;  4FHY A;  8ICA A;  3RF9 A;  5KAF U;  1LKY B;  2W9C A;  4RPY A;  1X6J A;  2W7P A;  5KFA A;  2D6F C;  4OJP A;  3NRZ A;  2VA2 A;  1X9S A;  2ZJ8 A;  3MR3 A;  5EE9 A;  2VA8 A;  2V4R A;  3E58 A;  2MU2 A;  3TFS A;  2QAR B;  8ICG A;  9ICP A;  3A0H U;  1L3T A;  3AQF A;  3KFU F;  1AQ6 A;  4R66 A;  3BS5 B;  1KFD A;  4Q44 A;  2WF5 A;  5AKE A;  4PZN A;  1JXL A;  1JN3 A;  3TAR A;  2BE3 A;  2FMP A;  2DUY A;  4IR9 A;  2JEF A;  4WH5 A;  4F5R A;  1SZH A;  2E1F A;  3RRH A;  3C1Z A;  3PR5 B;  2ASJ A;  4WC3 A;  1X9X A;  3OVB A;  3PVX A;  9ICN A;  2M9N A;  5DGA A;  2NRW A;  5KT6 A;  3E2E A;  1XO0 A;  2K89 A;  9ICJ A;  2BDP A;  1Z4N A;  3H38 A;  2P66 A;  2JV3 A;  3SMV A;  3N7R C;  5DB9 A;  3IG5 A;  4RWO A;  1NKE A;  1ZQO A;  5HRK A;  4I2A A;  4FFD A;  5KFC A;  2IOF A;  3ZDA A;  4PH5 A;  3UMB A;  2EH9 A;  4OJ6 A;  1D8B A;  4IQU A;  5F9L A;  2IUB A;  7ICE A;  9ICE A;  1VFG A;  3V7J A;  2ZH6 A;  4CE6 A;  4UAY A;  4J9P A;  4DS5 A;  2B51 A;  3N28 A;  4Q43 A;  2IOH A;  4PGQ A;  1ZQR A;  2DBY A;  1Z00 B;  2G08 A;  3PX6 A;  2K60 A;  3MDA A;  4UW9 A;  4I2J A;  2I1Q A;  1SZP A;  4LEY A;  2LKY A;  1ZQL A;  4PPX A;  1Q46 A;  2ZUD A;  5DGB A;  3HPO A;  4RQ4 A;  2Q0Z X;  9ICV A;  3F5A A;  4ELV A;  5AKH A;  4PHD A;  2AGO A;  2W03 A;  4WC4 A;  4ED7 A;  4EEK A;  1A77 A;  3WKB A;  4I2B A;  2C22 A;  4X4V A;  2EZZ A;  4I2G A;  3MFI A;  3MCR A;  5KFY A;  2Z7J A;  4Q8F A;  3OPX A;  8ICQ A;  4DFM A;  3JYY A;  4KLT A;  5CRX A;  1NK0 A;  2FJ6 A;  3PW7 A;  2VKQ A;  3ER9 B;  1K1Q A;  2WAQ F;  4G9B A;  3F53 A;  5AM2 A;  2HVH A;  8ICE A;  3N7P D;  2LYA A;  4YR2 A;  2XGQ A;  4NKU A;  1JAL A;  5ALI A;  4KN7 A;  5AIA A;  5J0X A;  7ICR A;  1S0V A;  4IQT A;  5IIK A;  3AQE A;  4M04 A;  1UHU A;  4QZF A;  2NO4 A;  1A0P A;  3SEN A;  4UB5 A;  3H0R B;  1OU5 A;  3C18 A;  7ICS A;  2C2D A;  3CW2 C;  1NKC A;  3ISD A;  4QIW C;  3Q8Q B;  2ISP A;  4X0A A;  1LVH A;  5D46 A;  2XC9 A;  5KFS A;  2K8B B;  1NZP A;  3QZ7 A;  2R8K A;  4GC6 A;  1RYR A;  5HR7 A;  3ERC C;  2KNJ A;  4DLG A;  2M2U A;  1ZQI A;  4IQV A;  2H3I A;  4BWM A;  1X42 A;  2L5Y A;  4CF4 A;  2DRB A;  4RQ3 A;  3H4B A;  5J2J A;  2HHW A;  1PK1 A;  2E8P A;  3KHG A;  4IG8 A;  2NO5 A;  4KMU A;  3BQ0 A;  1R89 A;  2ZUC A;  3IN5 A;  2JMG A;  5L1L A;  4ECQ A;  4NWI A;  5DQI A;  1ZQM A;  3M9N B;  3ONN A;  4O5K A;  2O6K A;  3EWA A;  4FZM A;  1XNS A;  2K4P A;  3M6Z A;  4QNL A;  2OH2 A;  3KBB A;  1KTQ A;  3LVW A;  2QKQ A;  4J9L A;  3WFS C;  1ZYQ A;  4PHA A;  3M9M B;  1ZQT A;  9ICH A;  3BS7 A;  2E8O A;  3NWI A;  3AU2 A;  2HBL A;  2BQ3 A;  4DWI A;  1S97 A;  3PML A;  3NVV A;  1RQN A;  4RQN A;  1MQ3 A;  4O68 A;  3ORY A;  2IA6 A;  2FPM A;  5J0R A;  5EOZ A;  3M7D A;  5KL8 B;  2KN7 A;  2ZH8 A;  3D6J A;  2KV2 A;  4DSE A;  4BJQ A;  1RZT A;  5TIS U;  1WWV A;  4JV1 A;  3BJY A;  2G5I B;  3G6V A;  4O3P A;  4K99 A;  3NUQ A;  4WCW A;  4K97 A;  2CN1 A;  2B0C A;  5J2C A;  1ZQU A;  1XC9 A;  2UVV A;  7ICF A;  4DSK A;  5ALE A;  4Y2V A;  2G06 A;  2ZTC A;  3Q8L A;  4AT7 B;  2QLT A;  1MIW A;  4R64 A;  2WF8 A;  3AU6 A;  2ZTE A;  3JCF A;  3GIM A;  4PHP A;  4EV6 A;  3VCB A;  2R8I A;  4WBZ A;  5T14 A;  2ZXH A;  5AKI A;  3UXN A;  2RQ5 A;  3WKA A;  1QSL A;  5CHG A;  4M9L A;  3H0L B;  3H8W A;  3H8M A;  2ZH4 A;  2DRA A;  3IP4 B;  2WB1 F;  5H2F U;  3QEB Z;  3RH6 A;  5D62 A;  1ZQG A;  5J0W A;  4DQI A;  2AU0 A;  4DL3 A;  1C20 A;  1B43 A;  5KFK A;  1Z1V A;  4UAS A;  5DG9 A;  4UAU A;  4DSI A;  4E7X A;  1LB2 B;  2G09 A;  4TQS A;  8ICF A;  3H7I A;  4RZR A;  1SL0 A;  2C28 A;  1BGX T;  7ICL A;  2BCQ A;  5KT2 A;  4OD0 A;  4YVZ A;  2G07 A;  4WJ3 B;  2G0A A;  1JI7 A;  4XQ7 A;  1N63 A;  1J97 A;  2HI0 A;  4P0Q A;  1ZOL A;  1D8L A;  4P2H A;  2ZHA A;  4M6W B;  2OM6 A;  2ASL A;  1NNL A;  1TFY A;  4DQP A;  2E3T A;  5C5J A;  2YML A;  3BZC A;  5IIN A;  2D8C A;  2M2T A;  4DSL A;  1MC8 A;  5DED A;  3OVS A;  4YMN A;  1GPJ A;  5IIO A;  7ICQ A;  3HWT A;  1QH9 A;  5DLG A;  4DOA A;  2QB0 A;  5DEC A;  4LVS A;  8ICT A;  3KD3 A;  3I76 A;  1NO5 A;  4TUP A;  2F3N A;  2KEY A;  4M6W A;  3LVV A;  1N5W A;  1KN5 A;  1J2N A;  2JHD A;  5K4L A;  7ICH A;  4GXK A;  4PL1 A;  3WKD A;  4C8O A;  1XSP A;  2PXI A;  4B9N A;  4IRD A;  5AM1 A;  1WWU A;  4PZO A;  1CUK A;  3V7L A;  2WAQ C;  4TUR A;  1TVA A;  1ZQZ A;  1RDF A;  5DDY A;  5AKY A;  2FPK A;  1DOQ A;  1HUZ A;  4M2Y A;  1PX5 A;  1S76 D;  4Z6C A;  2NRZ A;  3MBY A;  4ED6 A;  2HN1 A;  3TAD C;  3OJU A;  1YT3 A;  4E80 A;  4FBU A;  3UPQ A;  2HHS A;  9ICG A;  4Q8E A;  3CYM A;  4NXZ A;  3MGV A;  4J9M A;  2FDR A;  2P6R A;  4YR0 A;  3MAB A;  2VA3 A;  5DB6 A;  3QU5 A;  2JEI A;  1BNO A;  1ZQ1 C;  4EED A;  5EWG A;  3C2K A;  1D9F A;  2ESE A;  3BQ7 A;  2BBH A;  1TK5 A;  2IBK A;  3AN1 A;  3JPQ A;  1Z4O A;  4O67 A;  5KFO A;  3DDH A;  3IRU A;  5J0T A;  3BZK A;  2YB1 A;  4R63 A;  3PST A;  4AT8 B;  2DWQ A;  4EX7 A;  2XO7 A;  5F3X B;  3WK8 A;  3AQN A;  1DK2 A;  3EPI A;  5KFL A;  4FHX A;  5IIL A;  3H8J A;  1O03 A;  1OXJ A;  4RQM A;  2RRD A;  1QQ5 A;  3AUO A;  1V85 A;  5HMM A;  8ICW A;  3AQL A;  1QLN A;  1NOM A;  4DF8 A;  1X6I A;  4R8U A;  8ICP A;  4DL7 A;  3SR6 A;  2OWO A;  1O08 A;  4FH5 A;  3CNH A;  2ZIW B;  1FO4 A;  3F2D A;  2A1J A;  3NRW A;  1BNP A;  2DPJ A;  3C28 A;  4J9O A;  4JK1 A;  2DGZ A;  2PBE A;  1BPE A;  4I2I A;  5D4B A;  3RRG A;  2BBJ A;  3PSF A;  1JQR A;  4F2S A;  1GO3 F;  4RWN A;  4F4Z A;  3MFH A;  5KFX A;  4ELU A;  4I2H A;  2W9B B;  3BQ2 A;  3HW8 A;  1TV9 A;  4QZB A;  3C2M A;  3H0M B;  4PGX A;  5KG7 A;  3V7K A;  2ZH9 A;  5F9N A;  3QU7 A;  4ACO A;  5AKJ A;  3GQC A;  4C8L A;  3J81 j;  3UQ0 A;  9ICM A;  2BZF A;  4K4G A;  1KEJ A;  3PO5 A;  4F5O A;  5KG6 A;  9ICI A;  5AM5 A;  2EAO A;  4JV0 A;  1DGJ A;  2OCE A;  4FZL A;  4RQ2 A;  5KFV A;  2HVI A;  3OHA A;  3TFR A;  5CP2 A;  1ZJN A;  5HRI A;  4Q45 A;  2W9B A;  2MA1 A;  2W3R A;  3MGH A;  3JPO A;  3RTV A;  3FM9 A;  4NY8 A;  5B3P A;  4FZN A;  2HMX A;  2LHT A;  2FMS A;  5KAI U;  8ICK A;  2AJQ A;  4YXJ A;  4MFA A;  1VJ7 A;  1JMS A;  7ICJ A;  1FEZ A;  1S0O A;  4FO1 A;  1BVS A;  1N62 A;  2KJ9 A;  2EQY A;  3HJE A;  3OSP A;  4IL6 U;  2ZXI A;  1DXS A;  4AP9 A;  2Y0S C;  5HHH A;  4EEB A;  2V4Q A;  2DF4 B;  1N56 A;  3N97 B;  3O0F A;  2P35 A;  4M9N A;  9ICF A;  3I1Y A;  4Y2Y A;  1WOT A;  2JH1 A;  2KG5 A;  1YZ7 A;  4YFK A;  3AQK A;  1T94 A;  2O5A A;  2H3V A;  5F2V O;  2HN2 A;  2CXY A;  3PW5 A;  4YD1 A;  2KP7 A;  2VAN A;  1ZQY A;  4I27 A;  3OJS A;  1RM6 C;  2NRK A;  1SV4 A;  2BPC A;  4WC6 A;  4QWB A;  3TI0 A;  3NVO A;  1ZQK A;  3WK9 A;  4ZOH C;  4DOC A;  2PMZ F;  8ICY A;  5J2I A;  2NV3 A;  4QZA A;  4US9 A;  3NVW A;  1NI3 A;  1CEZ A;  2E1E A;  3FC4 A;  3D2N A;  1L3S A;  1F5S A;  1NJZ A;  5AI4 A;  2ZG6 A;  1OUQ A;  4ECS A;  2JEG A;  4IQW A;  2M0N A;  3QU9 A;  1CI4 A;  4NXX A;  2W3S A;  2AGP A;  3H4D A;  4ED2 A;  3U26 A;  5B3Q A;  2NYV A;  2W55 A;  2H5X A;  2Y9U A;  5ALS A;  2IHM A;  2E8M A;  9ICK A;  3TQ1 A;  1S10 A;  3SQI A;  4QZI A;  4DLE A;  4FO6 A;  4LZG A;  3UMG A;  4DF4 A;  5KT7 A;  5KFW A;  1XU4 A;  5CEH A;  1PK1 B;  1ZQS A;  3PV8 A;  4UB6 U;  4GIB A;  4C7Z A;  3NGD A;  5KFI A;  5AI0 A;  4BDP A;  1KDH A;  4JB3 A;  2JZB B;  4C8K A;  8ICB A;  3G6X A;  5CHE A;  2PKE A;  4BUG A;  4LJX A;  1RYU A;  4J03 A;  2CPR A;  4OAG A;  2ZIV B;  5ALZ A;  4O0I A;  3Q8K A;  1NJX A;  5JTG A;  1HEK A;  1L7O A;  4X4R A;  4DQS A;  4RNO A;  4EEL A;  5ALW A;  4RQ7 A;  3CP8 A;  5HRH A;  1WCL A;  1L5U A;  4LEV A;  2WTF A;  2DR5 A;  5KG4 A;  1A76 A;  5D63 A;  2BCR A;  4F71 A;  5KT5 A;  1XWL A;  3QNM A;  3WK5 A;  4EBD A;  3LQC B;  4WC2 A;  4E8F A;  5DG7 A;  3HX0 A;  5J2D A;  2JZB A;  3PNC A;  4CRX A;  3S6J A;  4NLK A;  1HUO A;  2KZM A;  2DPI A;  2HHX A;  4YR3 A;  2PFQ A;  1SIJ A;  5DLF A;  4F8R A;  2GAF D;  4C4R A;  8ICX A;  4NLB A;  2AQ4 A;  1EXN A;  1BPD A;  4EBE A;  1IG6 A;  3K1R B;  4QW8 A;  5KG5 A;  1ZRM A;  1B4F A;  4B9V A;  4O3R A;  8ICJ A;  5HRD A;  4QWA A;  4K96 A;  8ICC A;  1RQL A;  3AEV A;  1QSS A;  2W9A A;  2LM1 A;  3EF2 A;  5KFH A;  2KTQ A;  5J2B A;  3UM9 A;  3SAG A;  4RQ6 A;  3C5F A;  4KLM A;  2PI4 A;  2HHT A;  1A6S A;  5CJ7 A;  3GII A;  4PL2 A;  4Z6F A;  1FFV A;  3T3F A;  8ICV A;  2F2A B;  1KW4 A;  1NK8 A;  1B22 A;  2ES6 A;  2HDO A;  9ICW A;  4F50 A;  3ETR A;  3RBD A;  4KIT B;  2HW3 A;  9ICO A;  3L9D A;  3ER8 C;  2DKZ A;  4QZH A;  1PVP A;  3HIY A;  3UXP A;  4RQ8 A;  2F76 X;  4GFJ A;  2Y1I A;  7ICK A;  2ZH3 A;  5ALL A;  4F4Y A;  4I28 A;  5HRF A;  2NRT A;  2KZZ A;  1BPB A;  1SGG A;  4FHV A;  5ALR A;  4M9G A;  5KFT A;  5ALV A;  3QX7 A;  1ZQX A;  2DFL A;  1PK3 A;  3RBE A;  2H3Z A;  4X0B A;  1DGS A;  2I5H A;  4RWP A;  5DKW A;  2KSO B;  7ICP A;  3VC8 A;  3Q8P B;  4Y2U A;  3KTQ A;  5KFF A;  1L7P A;  3KHL A;  2XY7 A;  4DL5 A;  2LI6 A;  4NLC A;  2CRX A;  4RPX A;  4Y2P A;  4F5N A;  4RQ5 A;  2JH7 A;  3MDC A;  4UBC A;  3OV7 A;  2B56 A;  4RPZ A;  5E79 U;  2NRX A;  5G5G A;  4AYB F;  1H38 A;  1K1S A;  5ALQ A;  1SL2 A;  1ZQN A;  4B9L A;  7ICG A;  4QWE A;  4Y2X A;  4KLS A;  4OAH A;  5KG1 A;  1SKR A;  4IS7 A;  3OVA A;  4OAI Z;  2OHF A;  4XJE A;  1KFS A;  2XGP A;  4DFP A;  3M8R A;  5KG2 A;  4N7R A;  3V72 A;  5HC9 A;  4I2C A;  4B9S A;  3QE9 Y;  4NXU A;  5ALX A;  4M0A A;  4OCZ A;  2EDU A;  4CF5 A;  4EEY A;  4DQR A;  1TFR A;  4ZH4 A;  4DFD A;  4FHP A;  3KKA A;  1N2X A;  4RT2 A;  2KIV A;  3D2Q A;  1L7M A;  8ICR A;  4J9Q A;  4P4M A;  1D9D A;  2W04 A;  5HML A;  3RR8 A;  4EZ6 A;  4F3O A;  5J2F A;  2PMZ C;  3TAD A;  3JPP A;  4MHV A;  4KLJ A;  3ICX A;  2HHP A;  1KKX A;  4YD2 A;  4WC5 A;  3HKZ F;  3PZP A;  3UMC A;  4KLQ A;  5AIB A;  5CWR A;  4LEW A;  4M9J A;  2YB4 A;  9ICU A;  3TAP A;  2XCA A;  3UXO A;  3CK6 A;  4J9R A;  1U49 A;  4MEY A;  3V6K A;  3JZ0 A;  2OYY A;  4KM5 A;  1URJ A;  1YZ6 A;  4C4S A;  5AKG A;  2A1A A;  4Z6D A;  5AI6 A;  1V38 A;  2LYB A;  4ATB A;  2EAM A;  4DOB A;  1RXW A;  1TFW A;  1ZQW A;  4PGY A;  1Q78 A;  2EWR A;  4DS4 A;  4ECX A;  4PHE A;  2KK0 A;  3EUB 2;  2FLL A;  2H3F A;  1S0N A;  3NVY A;  2ZH2 A;  4KB6 A;  3TAQ A;  2FI1 A;  4NL9 A;  2ATL A;  5ALU A;  1T3Q A;  4X4P A;  2ZIW A;  1ZQD A;  5AM0 A;  2ZIU A;  5J0Q A;  4O5C A;  5HRL A;  3NYB A;  2UVW A;  4EZ9 A;  4X4Q A;  2BHN A;  1L6N A;  3SV3 A;  1YLQ A;  4NXW A;  3ISC A;  2W8K A;  2R8G A;  5AKK A;  2J6T A;  4UAV A;  4E0D A;  1KBU A;  3N7S C;  7ICT A;  4K8V A;  5AK3 A;  4KLI A;  4DFJ A;  2MUT B;  1JRO A;  2FLP A;  4IC9 A;  4K9A A;  2B6G A;  1Q8K A;  5C0Y A;  1HJP A;  4NL9 C;  3MR5 A;  2YX8 A;  3JPT A;  1ZQJ A;  1U4B A;  1SKS A;  4P0P B;  1D8Y A;  5KL1 B;  4AT9 A;  4HAI A;  4ECV A;  3EYZ A;  4BXO A;  3RAX A;  5AIC A;  2EAN A;  2MSN A;  3NS1 A;  1MIV A;  1MSW D;  2ZHB A;  5J0Y A;  2AXT U;  4QIW F;  4WQL A;  7ICV A;  2BPG A;  3QEA Z;  2RFF A;  4ECU A;  1IXR A;  1QTM A;  2C2R A;  7ICU A;  2ZH5 A;  4PJ0 U;  4WC7 A;  3QU2 A;  2XI9 A;  2HBJ A;  3T5K A;  1ZD2 P;  3T79 A;  2R8J A;  3AL0 B;  3SV4 A;  1V9P A;  2R18 A;  1V97 A;  4O6A A;  1SXD A;  3PX4 A;  1TKD A;  3T5H A;  4OJO A;  3GFK B;  3M9O B;  4F91 B;  4NJ8 A;  5DB7 A;  3GIJ A;  2HBK A;  2R8H A;  1SWW A;  3HJ1 A;  4XUS A;  2H3Q A;  2UVR A;  3GIL A;  3BS5 A;  5A0L A;  3GZF A;  2K8A A;  2AGQ A;  4MF2 A;  4ELT A;  3H37 A;  4B6J A; 
#chains in the Genus database with same CATH homology
 4ED7 A;  3V6J A;  4KLH A;  3TAN A;  3PY8 A;  1A77 A;  2KZ3 A;  2F1J A;  4I2B A;  5JUM A;  3V6H A;  2C22 A;  4QZ9 A;  4X4V A;  5HHH A;  7ICI A;  1MIY A;  4I2G A;  1FA0 A;  3MFI A;  5KFY A;  3OGU A;  4IRC A;  4NM2 A;  5KFE A;  2V4Q A;  1F5A A;  3JPR A;  1R8B A;  2ZJ5 A;  1N56 A;  2FLN A;  4Q8F A;  3N97 B;  3SI8 A;  1COO A;  4M9N A;  2RDI A;  4YQW A;  4KLG A;  9ICF A;  4I2D A;  3THV A;  4BDP A;  1RPL A;  2KFZ A;  2HHV A;  3KHH A;  8ICQ A;  1WOT A;  5KFB A;  4UB4 A;  4DFM A;  3JYY A;  1T8E A;  4YFK A;  4KLT A;  3AQK A;  2O5A A;  1JAJ A;  5F2V O;  4NLZ A;  1NK0 A;  1WCN A;  4F4X A;  3PW7 A;  3PW5 A;  2ZH7 A;  1X9M A;  4YD1 A;  3EW9 A;  3PO4 A;  4DL2 A;  2KFN A;  2VAN A;  2KP7 A;  1ZQY A;  4I27 A;  1K1Q A;  3OJS A;  3GV7 B;  5J2E A;  2HVH A;  9ICX A;  1ZQQ A;  3KHR A;  8ICE A;  4K4I A;  3WFQ E;  2NRK A;  4FH3 A;  4YR2 A;  2XGQ A;  4NKU A;  2BPC A;  3NTU A;  4RNM A;  4WC6 A;  4QWB A;  3TI0 A;  5KFP A;  4DQQ A;  3BQ1 A;  1ZQK A;  3ZDD A;  4DOC A;  1KNY A;  4KN7 A;  4S3N A;  4F4K A;  3RJE A;  3HIY A;  3OUY A;  1S0M A;  5J0X A;  1Y88 A;  4XA5 A;  8ICY A;  5J2I A;  1S0V A;  7ICR A;  4QZA A;  3IHQ B;  5J0P A;  4IQT A;  3MR6 A;  5IIK A;  4K4H A;  1CEZ A;  4DL4 A;  4M04 A;  4QZF A;  4YMO A;  2ZTD A;  4YP3 A;  4EBK A;  4UB5 A;  3H3A A;  4X4S A;  1L3S A;  5BPC A;  1NJZ A;  1OU5 A;  3C18 A;  3WFP A;  7ICS A;  2B21 A;  2C2D A;  4KLU A;  3LDA A;  4ECS A;  1NKC A;  3ISD A;  2JEG A;  3Q8Q B;  4IQW A;  4M5D A;  9ICQ A;  4NLG A;  2ISP A;  4X0A A;  5D46 A;  2XC9 A;  1ZQC A;  5KFS A;  3H40 A;  2AGP A;  3H4D A;  4ED2 A;  9ICB A;  1KRP A;  8ICU A;  4WC1 A;  2H5X A;  4QZE A;  3QZ7 A;  5J0O A;  1KSP A;  2R8K A;  1NZP A;  4QZ8 A;  3SYZ A;  2IHM A;  4UAZ A;  4GC6 A;  3ZD8 A;  1XSL A;  1RYR A;  9ICK A;  3TQ1 A;  1S10 A;  4XQ8 A;  4QZI A;  4DLE A;  3RB6 A;  4DLG A;  4FO6 A;  1ZQI A;  4LZG A;  4IQV A;  9ICR A;  4DFK A;  2M2U A;  1Z00 A;  3M8S A;  4X5V A;  4BWM A;  1S9F A;  4DF4 A;  1N48 A;  1ZET A;  1UET A;  5KT7 A;  5KFW A;  1XU4 A;  2DRB A;  4RQ3 A;  3H4B A;  1ZQS A;  3PV8 A;  4G3I A;  5J2J A;  2HHW A;  3RJH A;  4RWO A;  4AT9 B;  2ZUB A;  3EZ5 A;  3NGD A;  4C8K A;  1UT8 A;  5KFI A;  3LK9 A;  3KHG A;  1KDH A;  2JZB B;  4DEZ A;  5DB8 A;  5J0S A;  5IIM A;  5J29 A;  8ICB A;  4IG8 A;  4KMU A;  3G6X A;  3BQ0 A;  1R89 A;  2ZUC A;  4MEX A;  2FMQ A;  5L1L A;  4FBT A;  4MFF A;  4ECQ A;  4KTQ A;  5DQI A;  4O0I A;  3Q8K A;  1NJX A;  1ZQM A;  3M9N B;  4NM1 A;  4O5K A;  3RJG A;  2XY6 A;  5D49 A;  3EWA A;  5KFZ A;  4DQS A;  1R8C A;  4X4R A;  4RNO A;  3T5J A;  5TZV A;  4HYK A;  4FS1 A;  2DR7 A;  4KLD A;  4RQ7 A;  4LZD A;  1T7P A;  5KFU A;  3RJJ A;  1KTQ A;  2ALZ A;  5HRH A;  4B9M A;  1WCL A;  4YG2 A;  5KFJ A;  4ECR A;  1L5U A;  4TQR A;  4R65 A;  2WTF A;  4DL6 A;  3PW4 A;  2DR5 A;  2J6S A;  4J9L A;  8ICO A;  2V9W A;  3WFS C;  5KG4 A;  1A76 A;  5KT4 A;  5EWF A;  1ZYQ A;  2BCS A;  1R8A A;  4PHA A;  2BCR A;  4F2R A;  5KT5 A;  3M9M B;  1XWL A;  5DQG A;  3GV5 B;  1RXV A;  4BGD A;  4GXI A;  4ECZ A;  4EBD A;  3IM1 A;  4ED0 A;  1ZQT A;  9ICH A;  2FPL A;  3LQC B;  3AQM A;  1UA0 A;  1U9L A;  4E8F A;  2AQ0 A;  4WC2 A;  5DG7 A;  3HX0 A;  5KG3 A;  5J2D A;  2BCU A;  3AU2 A;  2JZB A;  3PNC A;  5KFR A;  2BQ3 A;  2BPF A;  1S97 A;  4DWI A;  3G6Y A;  4NLK A;  3PML A;  1HUO A;  1L3U A;  5DBC A;  2KZM A;  2DPI A;  3K4G A;  5IIJ A;  3GIK A;  4YR3 A;  1ZQB A;  5HP4 A;  1MQ3 A;  2PFQ A;  2HHX A;  5DLF A;  3ORY A;  2IA6 A;  4F5Q A;  4F8R A;  4JUZ A;  4C8N A;  2FPM A;  4O3Q A;  3RB4 A;  5J0R A;  4M9H A;  8ICX A;  2AQ4 A;  5EOZ A;  1EXN A;  4UAW A;  1BPD A;  2KN7 A;  3RB0 A;  4EBE A;  3ETL A;  3ZDC A;  2ZH8 A;  4QW8 A;  5KG5 A;  4DSE A;  3BDP A;  3T5L A;  4B9V A;  4O3R A;  1RZT A;  7ICN A;  1NKB A;  2BGW A;  4JV1 A;  1UEU A;  2GWS A;  5BOM A;  3BJY A;  1T3N A;  8ICJ A;  1U48 A;  3N4M B;  5HRD A;  3B0X A;  3RAQ A;  4QWA A;  1DK3 A;  4QZD A;  5KTQ A;  1SL1 A;  5L9X A;  1C7Y A;  3G6V A;  4O3P A;  8ICC A;  4WCW A;  1QSS A;  4UB1 A;  2W9A A;  4RNN A;  1L3V A;  2ZH1 A;  2HHU A;  4Z6E A;  5J2C A;  3QZ8 A;  1ZQU A;  3JPS A;  1XC9 A;  5KFH A;  4F4W A;  2UVV A;  7ICF A;  4RQ1 A;  2KTQ A;  4X4N A;  4TUQ A;  3LWM A;  4DSK A;  1TK0 A;  1RYS A;  5J2B A;  2ZTC A;  3Q8L A;  4AT7 B;  4RQ6 A;  2Y1J A;  4I29 A;  1MIW A;  9ICA A;  4R64 A;  3C5F A;  2ZTE A;  4J9K A;  1T4G A;  3FDS A;  3AU6 A;  4QZC A;  4EYH B;  4KLM A;  2IHN A;  2J6U A;  2PI4 A;  2HHT A;  8ICM A;  1BPX A;  9ICT A;  4KLE A;  4LT6 A;  3GIM A;  4IRK A;  1Q79 A;  4PHP A;  4YMM A;  5CJ7 A;  5HR9 A;  2R8I A;  4WBZ A;  3GV8 B;  3GII A;  4Z6F A;  3UXN A;  4C8M A;  1UA1 A;  5EWE A;  5CHG A;  2NRV A;  3T3F A;  1QSL A;  2I9G A;  4M9L A;  8ICV A;  3OUY B;  3H8W A;  2HHQ A;  1NK8 A;  2XCP A;  4B9T A;  4JWM A;  2XY5 A;  2BCV A;  3RJI A;  5CA7 A;  1B22 A;  2ZH4 A;  2DRA A;  2PI5 A;  3RH6 A;  3QEB Z;  2BQR A;  5HRE A;  3RH5 A;  1ZQG A;  9ICW A;  5J0W A;  1JX4 A;  2UVU A;  4DQI A;  2AU0 A;  3Q8M A;  4F50 A;  4ECT A;  3C1Y A;  5KT3 A;  2ID1 A;  2PFP A;  1ARO P;  3RBD A;  4KIT B;  4DL3 A;  4O9M A;  2HW3 A;  9ICO A;  3L9D A;  1B43 A;  5KFK A;  4QZH A;  4UBB A;  1PZN A;  5DG9 A;  4RQ8 A;  3UXP A;  4DO9 A;  1ZQE A;  1LB2 B;  4DSI A;  1TAU A;  4TQS A;  2M2V A;  2RDJ A;  2Y1I A;  4RUC A;  3MR2 A;  3H7I A;  4F4Y A;  4I28 A;  4RZR A;  7ICK A;  8ICF A;  5HRF A;  9ICL A;  2ZH3 A;  4QWC A;  2W8L A;  1SL0 A;  5L1I A;  2C28 A;  1BGX T;  1JIH A;  2NRT A;  7ICL A;  2BCQ A;  5KT2 A;  2KZZ A;  1BPB A;  4FHV A;  1NJY A;  2LYH A;  4YVZ A;  4M9G A;  3PMN A;  5KFT A;  4NKT A;  4XQ7 A;  4ELT A;  1LV5 A;  3WFO A;  3LWL A;  3C2L A;  1D8L A;  1ZQX A;  2DFL A;  2W9M A;  4P2H A;  3OHB A;  2ZHA A;  4GC7 A;  4UD5 A;  4RU9 A;  4M6W B;  3RBE A;  2P6U A;  1ZQP A;  4X0B A;  2Q66 A;  1DGS A;  2BKE A;  3RH4 A;  5J2A A;  4RWP A;  5DKW A;  7ICP A;  3Q8P B;  2ISO A;  2JEJ A;  2ASL A;  3KTQ A;  1TFY A;  4DQP A;  5KFF A;  4KLF A;  3KHL A;  3RB3 A;  8ICZ A;  5C5J A;  4ATB B;  2XY7 A;  4J9N A;  5IIN A;  3H39 A;  1BPZ A;  4DL5 A;  2M2T A;  5J2K A;  3ZDB A;  4CCH A;  4DSL A;  3K75 D;  4F92 B;  5J0U A;  1MC8 A;  3HP6 A;  8ICN A;  5DED A;  3RJK A;  4YMN A;  4RPX A;  4GLX A;  3OVS A;  5IIO A;  7ICQ A;  4F5N A;  4RQ5 A;  3HWT A;  2ASD A;  4YXM A;  3UQ2 A;  3MDC A;  7ICO A;  5DLG A;  4UBC A;  4DOA A;  5HNK A;  1V4A A;  8ICH A;  3C23 A;  3OV7 A;  1TK8 A;  5KFM A;  4UQG A;  4RPZ A;  4ED1 A;  5DEC A;  4LVS A;  1ZQA A;  8ICT A;  2ZJA A;  4R8U B;  2BR0 A;  1XO1 A;  8ICS A;  2NRX A;  4I2F A;  4QZG A;  1KFT A;  4E7X A;  4QWD A;  1NO5 A;  4TUP A;  1H38 A;  2PFO A;  1K1S A;  5HRB A;  2A1J B;  4M6W A;  3FYH A;  4O5E A;  1SL2 A;  4X4T A;  4RUA A;  4RQ0 A;  1JXE A;  9ICC A;  1ZQN A;  4B9L A;  7ICG A;  5KFG A;  4WC0 A;  4QWE A;  7ICH A;  4GXK A;  4KLS A;  1ZQV A;  5DQH A;  5KG1 A;  3C21 A;  1X2I A;  1SKW A;  1SKR A;  2M2W A;  4AT7 A;  4C8O A;  3OVA A;  1NK7 A;  1XSP A;  2PXI A;  1KLN A;  2MAX A;  4B9N A;  5III A;  4IRD A;  4RWQ A;  1KFS A;  2XGP A;  4DFP A;  4MF8 A;  3OSN A;  5KG2 A;  3M8R A;  5J2H A;  3V72 A;  1CUK A;  3RR7 A;  4IR1 A;  3PW0 A;  3V7L A;  4DSJ A;  4M47 A;  4KLO A;  5HC9 A;  4GXJ A;  1NK6 A;  4I2C A;  4X4O A;  4TUR A;  1TVA A;  1ZQZ A;  2W9C B;  5L1K A;  3QE9 Y;  4B9S A;  1QSY A;  4M0A A;  2IMW P;  2F1H A;  4I2E A;  5L1J A;  4EEY A;  8ICL A;  5DDY A;  2FPK A;  4DQR A;  1TFR A;  4ZH4 A;  4ECW A;  4EBJ A;  1DOQ A;  1HUZ A;  4M2Y A;  4FHP A;  1PX5 A;  1S76 D;  4Z6C A;  5CR0 A;  2NRZ A;  4RT2 A;  3MBY A;  4ED6 A;  1ZJM A;  1XS9 D;  3OJU A;  4E80 A;  4P4P A;  4FBU A;  3UPQ A;  3GDX A;  5HRG A;  3BQT A;  4J9Q A;  8ICR A;  5J2G A;  4P4M A;  1NJW A;  1D9D A;  1ZQH A;  5KFD A;  2HHS A;  9ICG A;  4Q8E A;  5HML A;  3RR8 A;  2DR8 A;  4NXZ A;  4EZ6 A;  4J9M A;  2BQU A;  4F3O A;  5J2F A;  2DR9 A;  2P6R A;  3JPP A;  4UD4 A;  4TUS A;  4KLJ A;  4YR0 A;  3MAB A;  5HHI A;  2VA3 A;  5DB6 A;  2HHP A;  4YD2 A;  4WC5 A;  2DVI A;  1NK9 A;  2JEI A;  1BNO A;  3MGI A;  5KFQ A;  5EWG A;  3C2K A;  4KLQ A;  2F1I A;  5CWR A;  4XRH A;  1D9F A;  4M9J A;  9ICU A;  4FHY A;  4P4O A;  4JWN A;  8ICA A;  3TAP A;  4QW9 A;  2W9C A;  2XCA A;  1TK5 A;  3UXO A;  4RPY A;  4J9R A;  2IBK A;  3JPQ A;  1U49 A;  4MEY A;  5KFA A;  3V6K A;  3JZ0 A;  2O1P A;  5KFO A;  2VA2 A;  5J0T A;  1X9S A;  2ZJ8 A;  3MR3 A;  3Q8R B;  2VA8 A;  5KG0 A;  1UT5 A;  4Z6D A;  2V4R A;  4R63 A;  3TFS A;  1NK4 A;  4B9U A;  1TAQ A;  4ATB A;  3PR4 A;  3HT3 A;  4AT8 B;  4F5P A;  8ICG A;  4DOB A;  2XO7 A;  1RXW A;  9ICP A;  3AQN A;  1ZQW A;  4PGY A;  1Q78 A;  1TFW A;  1DK2 A;  3EPI A;  4DS4 A;  4ECX A;  1L3T A;  5KFL A;  4PHE A;  3Q8S B;  4ED8 A;  4FHX A;  5IIL A;  2FLL A;  4UB3 A;  3H8J A;  4R66 A;  1S0N A;  1KFD A;  4RT3 A;  4Q44 A;  3AUO A;  2ZH2 A;  5HMM A;  3ZD9 A;  1JN3 A;  5KFN A;  3TAQ A;  1JXL A;  1QLN A;  8ICW A;  3AQL A;  3EPG A;  1NOM A;  4DSF A;  3TAR A;  2ATL A;  4DF8 A;  2FMP A;  4JV2 A;  2BE3 A;  4FHW A;  4IR9 A;  2JEF A;  4R8U A;  8ICP A;  4DL7 A;  2OWO A;  4F5R A;  4X4P A;  4FH5 A;  1ZQD A;  3PW2 A;  4O3N A;  3RRH A;  1U47 A;  5DDM A;  3C1Z A;  4J9S A;  4ED3 A;  2A1J A;  5J0Q A;  4O5C A;  8ICI A;  1BNP A;  2DPJ A;  3B0Y A;  9ICS A;  4EP7 A;  4J9O A;  4JK1 A;  3PR5 B;  5HRL A;  2UVW A;  4EZ9 A;  3NYB A;  2ASJ A;  2BHN A;  4WBY A;  4X4Q A;  3RJF A;  4WC3 A;  2PBE A;  1BPE A;  4I2I A;  3SV3 A;  1YLQ A;  3C5G A;  3ISC A;  2W8K A;  5D4B A;  3RRG A;  3OVB A;  2R8G A;  3PVX A;  2J6T A;  5DBB A;  9ICN A;  1JQR A;  2M9N A;  5DGA A;  4F2S A;  4E0D A;  4RWN A;  7ICT A;  2MUT A;  2NRW A;  5KT6 A;  5DBA A;  4F4Z A;  3E2E A;  4KLI A;  3C66 A;  4DFJ A;  3MFH A;  2MUT B;  5KFX A;  3PX0 A;  2FLP A;  4ELU A;  4I2H A;  9ICJ A;  2W9B B;  2BDP A;  4X4U A;  3BQ2 A;  3H38 A;  1HJP A;  3HW8 A;  2P66 A;  5BOL A;  1UEV A;  1TV9 A;  4QZB A;  4UB2 A;  3MR5 A;  3C2M A;  4PGX A;  5KG7 A;  3JPT A;  3V7K A;  1ZQJ A;  2ZH9 A;  5F9N A;  1U4B A;  1SKS A;  4O3S A;  1D8Y A;  5DB9 A;  4BXO B;  3GQC A;  4AT9 A;  4ECV A;  3EYZ A;  4BXO A;  5DG8 A;  3RAX A;  1NKE A;  1ZQO A;  4F93 B;  3UQ0 A;  4C8L A;  4EBC A;  4I2A A;  4NLN A;  5HRK A;  9ICM A;  4K4G A;  1KEJ A;  1MIV A;  4YCX A;  3PO5 A;  4F5O A;  5KFC A;  1MSW D;  5J0Y A;  2ZHB A;  3WFR E;  5KG6 A;  9ICI A;  3ZDA A;  4PH5 A;  1Z3E B;  4MFC A;  7ICV A;  4JV0 A;  2BPG A;  3QEA Z;  4KN4 A;  2RFF A;  4ECU A;  2PFN A;  1IXR A;  4IQU A;  3HJ4 A;  5F9L A;  1QTM A;  4RQ2 A;  2C2R A;  7ICU A;  5KFV A;  2ZH5 A;  1X9W A;  7ICE A;  9ICE A;  3H8S A;  2HVI A;  3OHA A;  3V7J A;  3TFR A;  2ZH6 A;  1VFG A;  4WC7 A;  1ZQF A;  5CP2 A;  4YN4 A;  1ZJN A;  4BWJ A;  3T5K A;  1XSN A;  4J9P A;  4UAY A;  4DS5 A;  1IM4 A;  5HRI A;  2R8J A;  4Q43 A;  4Q45 A;  3JPN A;  2W9B A;  4ECY A;  1NK5 A;  1S77 D;  3SV4 A;  4PGQ A;  1ZQR A;  5CB1 A;  1V9P A;  3MGH A;  1Z00 B;  4O3O A;  3JPO A;  1MQ2 A;  3PX4 A;  3RTV A;  3SZ2 A;  3MDA A;  3T5H A;  3PX6 A;  4I2J A;  1TKD A;  4NY8 A;  2I1Q A;  1SZP A;  3GFK B;  2FMS A;  3M9O B;  4F91 B;  1BPY A;  1ZQL A;  4PPX A;  7ICM A;  8ICK A;  4AT8 A;  2ZUD A;  3ISB A;  5DGB A;  2AJQ A;  4EYI B;  5DB7 A;  4YXJ A;  3GIJ A;  4MFA A;  2R8H A;  3ZDE A;  1VJ7 A;  1U45 A;  1JMS A;  4RQ4 A;  3HPO A;  2Q0Z X;  7ICJ A;  9ICV A;  3HJ1 A;  4XUS A;  3UPS A;  4ELV A;  2C2E A;  1S0O A;  4PHD A;  4KLL A;  2UVR A;  3GIL A;  1BVS A;  4FS2 A;  2AGO A;  4MF2 A;  3H37 A;  2AGQ A;  3OSP A;  4WC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...