4MFCA

Structure of human dna polymerase beta complexed with o6mg in the template base paired with incoming non-hydrolyzable ctp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
325
structure length
318
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSEKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 318
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mfcA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mfcA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mfcA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mfcA03
3HWTA 1QSYA 3TQ1A 3RBDA 1BGXT 4DWIA 1K1QA 7ICHA 4WBZA 4ELUA 3C21A 2R8GA 4K4GA 2IBKA 5HHHA 2W8KA 4J9QA 2BQUA 5HREA 4HYKA 3TI0A 3RJIA 4RQ6A 4YP3A 4F2RA 4RQ2A 4TQSA 3TARA 1L5UA 4ED6A 1MSWD 4AT8B 2XY6A 5J2IA 7ICEA 5IIOA 2FPLA 2HHPA 2RFFA 4RNMA 4ED2A 5HMMA 4XA5A 4TUSA 3RJJA 3T3FA 2KP7A 5JUMA 5J2EA 2KZ3A 4DEZA 5D4BA 4XQ8A 4DOAA 1RYSA 4QZ8A 2HHWA 1TAUA 4C8KA 5F2VO 4P4MA 3TAPA 5HRFA 2FMSA 1D8LA 4RZRA 4IR9A 1SZPA 4DS5A 4QWDA 5KG7A 4KLOA 7ICNA 1R8BA 7ICRA 4DLEA 3H3AA 5HR9A 4AT9B 2PI5A 3BQ0A 3QEAZ 9ICCA 5HNKA 4LZGA 4NKUA 1KFTA 4O3PA 3T5LA 3PMNA 4F3OA 3PV8A 2F1HA 4KN7A 3JPTA 4YR2A 5EOZA 1CEZA 2W9CB 4UD5A 3T5HA 1HJPA 3SV4A 3M9MB 3V7LA 3KHHA 7ICVA 4YXMA 8ICQA 3LK9A 4ELVA 3OSNA 7ICQA 5CHGA 1TV9A 5HRDA 5TZVA 4KN4A 4F4XA 4MFCA 3UQ2A 2DVIA 2JEIA 4EYIB 4MFAA 3C5FA 4M9JA 5HRGA 4WC3A 3OGUA 2A1JA 3H39A 3MBYA 3OVBA 3NYBA 4I2BA 3QZ8A 1ZQHA 1TK5A 4QZEA 9ICUA 1B43A 1NK6A 4ED7A 1KFSA 2RDJA 3HW8A 4LT6A 4DFMA 4X4VA 4F93B 4MF2A 5KFRA 3H40A 4J9OA 3AQLA 4NM1A 2R8HA 4DFJA 3HP6A 4GXKA 4EBJA 1ZQMA 3C66A 4R8UB 5KFUA 4X0AA 1Y88A 3K4GA 3GDXA 1TVAA 1NJYA 2ATLA 3RJHA 2PFQA 5HRLA 5L1LA 1ZJMA 8ICVA 4X4TA 4Q43A 2R8IA 4XUSA 7ICFA 4NM2A 3H4DA 2BCQA 4AT8A 3UXOA 5F9LA 4XRHA 4EP7A 5J0YA 2ZUBA 3RRHA 4UAWA 2BGWA 4WC0A 1UA0A 4X4NA 4O5CA 5J29A 1TFWA 2F1JA 1S97A 3QZ7A 4TUPA 1RZTA 1ZQKA 7ICJA 2GWSA 4MFFA 5J2GA 5DB9A 4RU9A 3RR7A 1V4AA 4RQ1A 2P6RA 1HUZA 4MF8A 4ECZA 4KLHA 4AT9A 5DGBA 3PY8A 3GILA 5KFNA 3TFSA 4MEYA 1NOMA 9ICAA 3JPQA 3C5GA 1ZQOA 1QLNA 3C18A 4RWNA 2ZTDA 1ZQLA 4KMUA 1SKRA 2BPCA 4YG2A 3H4BA 1V9PA 1UA1A 4KLIA 8ICNA 1S0MA 4J9LA 4DQPA 4FO6A 4IQWA 2HHTA 4WC1A 4I2IA 3PO4A 3RH4A 2VA8A 4KLUA 4DLGA 2ZH4A 2ZH8A 3HT3A 2XGPA 7ICGA 3HJ1A 2V4QA 5DB7A 4ATBB 4Z6DA 1TKDA 3GQCA 3JPPA 1KDHA 4M04A 1LV5A 4RQ0A 5KFGA 2BPGA 1NJZA 2AQ0A 2ZUCA 2XCAA 1ZQJA 7ICSA 4FS2A 4KLQA 1L3SA 1BPEA 1MIWA 1PX5A 5KG3A 4JUZA 5J2JA 5J0WA 3RB4A 5EWFA 4R66A 2Y1JA 1TK8A 4J9RA 3T5KA 2JEGA 3MFIA 4M9GA 3OVAA 4R8UA 4YD2A 4QW8A 5KFCA 3JPRA 2BCSA 1COOA 5DBBA 4RPZA 4R64A 2IA6A 2J6SA 4TUQA 4NLNA 4I2DA 1BPXA 4O3QA 8ICRA 4XQ7A 9ICTA 3MDCA 3OJSA 2O1PA 4WC5A 3MGIA 5KFEA 1JAJA 4YMOA 3KHRA 3V72A 1KSPA 3UPSA 1ZETA 4PGQA 4QZIA 9ICEA 5J0XA 2C2DA 1S0NA 1ZQNA 4QWAA 2DR7A 3M9NB 3MR2A 3OHAA 1SL0A 2ZHAA 1Q79A 2W9BB 5KT6A 4FS1A 1ZQFA 2ZH5A 2XGQA 4DSJA 1IM4A 4RQ8A 5J2CA 3LWLA 4F5OA 1S0OA 9ICMA 5J2DA 1ZQPA 1S9FA 3LDAA 2UVUA 5DBAA 1ZQEA 2HVIA 4DS4A 8ICJA 2BQ3A 1NZPA 3BJYA 3RJFA 4RUAA 2KZZA 5J0UA 3AQKA 1JXEA 2ZHBA 4PHEA 4M9HA 4ECXA 3V6JA 2HHVA 3KHLA 1SKSA 5KFPA 1TK0A 2J6UA 3M8SA 1L3UA 3RRGA 3C2LA 5DB6A 1KLNA 2IHMA 2KZMA 8ICLA 1HUOA 1SL2A 3Q8LA 3ZDEA 5CJ7A 4GC7A 4B9LA 1KEJA 5KFVA 3ISCA 9ICSA 3H7IA 1UT5A 3EPGA 2C28A 3BDPA 4KLJA 2FLPA 4NLKA 4R63A 1NJWA 1UETA 7ICKA 3C23A 1XSLA 1XS9D 4UQGA 4M5DA 3RR8A 9ICPA 2P6UA 4Q44A 3ISBA 4I2HA 3ZD8A 3PX0A 2ZH7A 3Q8KA 5KTQA 4J9PA 7ICPA 1VJ7A 2PFOA 5J2HA 1ZQXA 3LWMA 3V6HA 2DRBA 1T4GA 3AU6A 3UQ0A 7ICIA 2Y1IA 1D9FA 3HPOA 1MQ2A 5J0RA 2V9WA 5CB1A 5KFFA 4BGDA 1X9MA 3C2KA 2W9MA 1ZQQA 3MFHA 4KLGA 5KFWA 3BQ1A 3RB3A 3WFOA 4DQIA 4QZAA 3MR3A 3RB6A 1R8CA 4UB3A 3MDAA 4R65A 2ZJAA 3GIMA 1ZYQA 2DPJA 1TAQA 5KG1A 4O3SA 2XC9A 3HIYA 3B0YA 2ZJ8A 4KLEA 1MIYA 4RQ4A 2W9BA 1DOQA 1BPDA 4GLXA 8ICUA 5HRIA 2WTFA 3JZ0A 2JZBA 3KHGA 2KN7A 5J0PA 2UVVA 4EBDA 4ECWA 1QSLA 4E0DA 2BCUA 3V7KA 2VA3A 5L1JA 2BHNA 4ED8A 4E8FA 3G6YA 1VFGA 2I9GA 4QWEA 1X9SA 3PMLA 4O9MA 4F5RA 2JEFA 4JV2A 2KFZA 4F5PA 1WCNA 1SKWA 4AT7A 3H37A 4ED1A 4IRDA 8ICEA 2ZTCA 4X4OA 2KTQA 2M2TA 4RQ3A 2I1QA 5IILA 1ZQZA 3N97B 4I2JA 5J0QA 3GIJA 4QWBA 4I2CA 2NRKA 2ZUDA 1R8AA 8ICMA 8ICWA 4Z6FA 5KFLA 3PW4A 3SV3A 1ZQAA 2ALZA 5KG4A 3ETLA 3PNCA 5J2KA 2XCPA 4O5EA 1UEVA 2PBEA 5KFOA 4DFKA 2HW3A 4EZ9A 2V4RA 4WC4A 5BPCA 5HP4A 4O5KA 9ICVA 2BDPA 4PH5A 4DF8A 5KFXA 2FMQA 4FHVA 4B9TA 2NRTA 1JMSA 4UAYA 4F4YA 4I2AA 9ICXA 2DR5A 4Z6EA 3PX6A 3RJKA 5EWEA 4FH5A 2O5AA 4DO9A 4ECRA 4NXZA 4DSKA 5DQGA 2VA2A 8ICSA 1XC9A 4FHYA 2ASLA 3ZDAA 4M2YA 5DLGA 3Q8PB 2ISOA 4NLGA 3E2EA 7ICMA 3H38A 5KFKA 5KT7A 3N4MB 4I29A 2BPFA 8ICOA 8ICXA 1L3VA 2C2RA 5J2BA 4EEYA 1TFYA 5DDMA 3ISDA 9ICIA 4IQUA 2NRWA 4LZDA 4RQ7A 4Q8EA 1MC8A 4PHPA 5KFMA 4YD1A 5KG2A 4J9NA 1NKBA 3M9OB 3ZDCA 3EZ5A 3SI8A 2ZJ5A 1S77D 4DQSA 2C22A 2R8KA 8ICBA 2NRXA 5KG5A 3ZD9A 4O0IA 2MAXA 4WCWA 2NRZA 4WC7A 3HJ4A 2LYHA 1T8EA 2HVHA 1KRPA 4F8RA 1XO1A 7ICUA 5HRKA 3MR5A 1PZNA 4IQTA 5L1KA 5D46A 3G6VA 2BQRA 2BKEA 5EWGA 4YCXA 1Z00B 5DG7A 1X9WA 1ZQIA 2ZH6A 5J0SA 3OJUA 1T7PA 4ZH4A 3B0XA 8ICCA 9ICWA 1IXRA 4RPYA 2HHQA 2ZH1A 3ZDDA 3ORYA 5CA7A 4J9SA 1QSSA 2BCRA 4RWQA 5HMLA 1KFDA 3GIIA 2FMPA 3NTUA 1RYRA 1H38A 4I28A 2Q66A 4ECSA 4P2HA 9ICBA 4C8LA 1B22A 5KFAA 5BOLA 4EBEA 1NJXA 4IRKA 4F91B 5J0TA 4JWMA 4GXJA 3QEBZ 4JWNA 4P4PA 4K4HA 1JQRA 4QZBA 8ICHA 9ICFA 4YQWA 1EXNA 4TURA 3RJEA 1BPBA 2JZBB 2C2EA 5IIIA 5J2FA 4Q45A 9ICNA 2NRVA 4RNOA 1WOTA 4CCHA 4O3NA 4F5QA 4I2GA 5DDYA 3FDSA 9ICHA 9ICQA 4WC6A 4X4PA 9ICJA 4I2EA 4QZHA 2XY5A 3PX4A 3TFRA 1ZQDA 3ZDBA 4DF4A 2Q0ZX 1NK7A 2UVWA 2W9AA 3PVXA 3RJGA 3LQCB 4AT7B 5D49A 1U45A 4DFPA 2F1IA 4NKTA 4YR0A 1S76D 3MGHA 5IIJA 2DR9A 4M6WA 3OSPA 2VANA 3IHQB 4J9MA 4RT2A 4JV1A 1UT8A 9ICRA 4UD4A 3SYZA 2ISPA 4FBUA 5HRBA 5J2AA 2XO7A 1BNOA 1FA0A 2B21A 9ICGA 5DEDA 3QE9Y 5KFZA 1Z00A 5KG6A 2DFLA 5CWRA 1AROP 4Z6CA 8ICKA 8ICTA 3AU2A 4ATBA 2DR8A 2FPMA 3BQTA 4ED3A 3RTVA 5DKWA 4B9NA 5C5JA 1QTMA 4UBCA 5DG8A 4IG8A 3V6KA 2M2UA 4KLDA 4YN4A 2PFNA 2JEJA 4PGXA 3K75D 1S0VA 1XU4A 4DSIA 4X0BA 2HHXA 4M9LA 2ZH2A 1LB2B 1ZQYA 5KFJA 4YMMA 5BOMA 4JV0A 5KFSA 3AQMA 2H5XA 4KITB 3RBEA 4IQVA 5DQHA 4YVZA 5KFTA 1ZQUA 3FYHA 4F2SA 3EYZA 4X4RA 4GC6A 4QZFA 3MR6A 1X2IA 3C1ZA 3GV8B 2PXIA 4EZ6A 8ICIA 4G3IA 2BE3A 5KT4A 5CR0A 5KT3A 5DG9A 1YLQA 4X4SA 2DRAA 4ED0A 4C8NA 7ICLA 4KLFA 1ZQCA 3EPIA 3RB0A 2M2VA 2M2WA 4ECVA 3WFQE 5HRHA 5HC9A 4M47A 5DGAA 4JK1A 1NK9A 4Q8FA 3RH5A 2IHNA 4YR3A 3OV7A 4KLMA 3WFRE 1BPZA 4E7XA 3NGDA 2XY7A 7ICTA 4E80A 3AUOA 3UXPA 1NK5A 1C7YA 4DL3A 2FLLA 1MIVA 4RWOA 1A77A 1BVSA 5DB8A 4DL5A 3OVSA 4MEXA 3TANA 1CUKA 4RNNA 3JPNA 3G6XA 5DBCA 3T5JA 4DL7A 4M9NA 8ICFA 3C1YA 1JN3A 4UB1A 2MUTB 4KLLA 2FPKA 4QZCA 4KLTA 9ICOA 4NLZA 4B9UA 1Q78A 4K4IA 5IIKA 2PFPA 4F50A 4B9SA 3H8JA 1JXLA 1BNPA 9ICLA 1SL1A 4FBTA 1RPLA 3PW0A 4IR1A 1JX4A 1S10A 4YXJA 4DL2A 4DSFA 2ASDA 3IM1A 3PW5A 1UEUA 2IMWP 1NK0A 4DQRA 5KFDA 3Q8SB 4EYHB 1D8YA 3PO5A 5DECA 4EBKA 3HX0A 1ZJNA 4QW9A 1ZQRA 8ICYA 3MABA 2AU0A 1KNYA 4ECQA 2W8LA 2AJQA 1U48A 3Q8QB 4C8OA 2AGQA 4F4WA 3KTQA 8ICAA 4F4ZA 4I2FA 2AGOA 1NK4A 1L3TA 4UB4A 4FHXA 1A76A 1R89A 4KTQA 2BCVA 2BR0A 2ZTEA 3OUYB 4M6WB 4ECYA 4DSLA 4UAZA 2HHUA 1U9LA 3SZ2A 1NKEA 1MQ3A 1KTQA 4P4OA 4IRCA 4DL4A 4BXOB 7ICOA 3PR4A 1BPYA 2RDIA 5DLFA 4WC2A 2ZH9A 1XSPA 1XSNA 4NY8A 3RAQA 3AQNA 4YMNA 4TQRA 4ECUA 3EW9A 4I27A 1DK2A 3JPSA 2ID1A 5IINA 2W9CA 3EWAA 8ICZA 2HHSA 2R8JA 4DSEA 3BQ2A 3Q8MA 4YFKA 4X5VA 8ICPA 2FLNA 3GIKA 3RAXA 1U47A 1JIHA 4UBBA 2ASJA 5CP2A 4PGYA 3H8SA 5KG0A 1Z3EB 1XWLA 5L9XA 2MUTA 5KFIA 4LVSA 4O3RA 5KFHA 2PI4A 4F92B 4PHAA 1NK8A 1ZQSA 3V7JA 1RXWA 4B9VA 3RH6A 3WFSC 1ZQWA 4BWMA 4FH3A 4O3OA 4UB5A 1N48A 4ELTA 4PHDA 5IIMA 4BDPA 4RPXA 2ZH3A 3Q8RB 2OWOA 4QZGA 4RT3A 3TAQA 1NO5A 5KT2A 4BWJA 1ZQGA 5KT5A 3C2MA 3UPQA 4EBCA 1NKCA 1ZQBA 4C8MA 4QZ9A 1U4BA 4PPXA 2M9NA 3GFKB 4DOCA 4DQQA 4UB2A 4M0AA 4X4UA 1DGSA 4QWCA 1ZQTA 1T3NA 9ICKA 8ICGA 4KLSA 4F4KA 1D9DA 4B9MA 3WFPA 5L1IA 5KFBA 3JPOA 3UXNA 3JYYA 2DPIA 3PR5B 3OUYA 4RUCA 4FHPA 5F9NA 3PW2A 2KFNA 3THVA 5KFQA 4S3NA 1WCLA 1F5AA 4RQ5A 3OHBA 4BXOA 4GXIA 4RWPA 5DQIA 3H8WA 2AGPA 2AQ4A 4ECTA 3PW7A 2P66A 4WBYA 1TFRA 2A1JB 5KFYA 5HHIA 5J0OA 1DK3A 1N56A 4X4QA 4QZDA 4J9KA 1RXVA 1OU5A 2J6TA 4DL6A 3GV7B 3L9DA 4DOBA 2UVRA 1K1SA 3GV5B 4F5NA 3M8RA 1U49A 4FHWA 1ZQVA
chains in the Genus database with same CATH superfamily
3HWTA 7ICHA 4ELUA 2IBKA 2EZZA 5HHHA 5HREA 4XJEA 4HYKA 4YP3A 4F2RA 2WF9A 1L5UA 1MSWD 2XVTA 7ICEA 5IIOA 4RNMA 4ED2A 5ALTA 3T3FA 3WK8A 5J2EA 4DEZA 3C28A 2HHWA 4OD0A 4OAGA 5EE0A 1QCKA 2FMSA 4IR9A 3L3FX 4QWDA 7ICNA 7ICRA 4AT9B 4LZGA 4MHVA 4O3PA 3PV8A 2F1HA 3JPTA 2W9CB 2HBJA 2KICA 3KHHA 2YMQA 4ELVA 1TV9A 5TZVA 4F4XA 2IHOA 2EH9A 5HRGA 3C5FA 3OGUA 3NKUA 4FZLA 1B43A 1AQ6A 2HN2A 2RDJA 2KHVA 4F93B 3M7DA 4G9BA 2R8HA 1ZQMA 3K4GA 1TVAA 3RJHA 1COKA 1IIPA 5HRLA 3VC8A 8ICVA 5AKYA 2HBKA 2R8IA 7ICFA 4AT8A 3UXOA 4OJ6A 5J0YA 2ZUBA 2BGWA 4TUPA 2GWSA 5J2GA 5DB9A 5ALPA 3RR7A 4RQ1A 4MF8A 1SV0A 1ZD5A 3OTQA 2VJ5A 3TFSA 4MEYA 1QLNA 3C18A 4CF5A 2OEHA 4YG2A 3H4BA 3F5AA 1MA7A 1S0MA 4DQPA 2HHTA 4WC1A 4UAVA 3RH4A 4DLGA 2ZH8A 3UMGA 2XGPA 7ICGA 5DB7A 1X9XA 1LV5A 4RQ0A 5CRXA 5AI4A 5B5EU 3NWIA 2XCAA 4FS2A 2CXYA 3TKAA 1BPEA 4J9RA 3T5KA 4M9GA 4R8UA 3JPRA 2ZIUA 8ICRA 4O3QA 4EX7A 2O1PA 1JAJA 4U7CA 1KSPA 4QZIA 5AKIA 1S0NA 1SL0A 4FS1A 1ZD3A 5J2CA 3LWLA 3JCFA 9ICMA 2UVUA 5DBAA 4DS4A 3NRZA 2WAQC 4RUAA 3T79A 1UPHA 4M9HA 4JLZA 3QU7A 1SKSA 4N7RA 2IHMA 5ALLA 5DB6A 2KZMA 9ICSA 1KEJA 4R63A 7ICKA 3CRXA 3ZD8A 4LEWA 5KTQA 2PFOA 1C20A 4QIWC 2CN1A 3C2KA 1ZQQA 5KFWA 2E8PA 3BQ1A 3MR3A 4UB3A 3GIMA 2ZJAA 2ZJ8A 4KLEA 4RQ4A 2W9BA 2QARA 4GLXA 8ICUA 3JZ0A 2K4HA 5J0PA 2W55A 2BCUA 3V7KA 2VA3A 5L1JA 4UARA 1VFGA 2I9GA 1X9SA 3PMLA 5ALWA 4F5RA 3H37A 1V85A 4ED1A 2ZTCA 5IILA 1ZQZA 4NXXA 2NRKA 3AQFA 2ZIUB 1ECWA 3OPXA 4I2CA 1R8AA 5KG4A 3WFPA 2FJ6A 4NJ8A 4O5KA 2BDPA 2WFAA 3D2NA 2NRTA 4F4YA 3KZXA 4FH5A 2O5AA 5DQGA 3ZDAA 1N61A 3NVWA 4NLGA 5AKHA 3QU2A 1YZ7A 1PVQA 4IQUA 5AI9A 4Q8EA 4YD1A 3KD3A 3M9OB 3ZDCA 4O6AA 4DQSA 2NRXA 5KG5A 4EV6A 1JRPA 4WC7A 4EENA 4F8RA 1XO1A 5HRKA 5L1KA 1PZNA 4IQTA 2VA2A 3G6VA 4YCXA 5DG7A 2OH2A 4ZH4A 2LMRA 1IXRA 2ZXIA 3SEIA 5CA7A 4J9SA 4RWQA 5HMLA 2WF5A 2Q66A 5ALYA 4NLBA 9ICBA 1B22A 1NJXA 4EBEA 4IRKA 3H8MA 5J0TA 4K4HA 1A6SA 8ICHA 4Q45A 1FEZA 3ER9B 4CCHA 4I2GA 3FDSA 3PZPA 3MCRA 3PX4A 3ZDBA 3RJGA 4DF4A 4DFPA 2F1IA 5IIJA 3OSPA 2YTUA 5HR6A 5DEDA 2B21A 4CDGA 5CWRA 4Z6CA 8ICTA 4EEBA 4ED3A 3RTVA 4B9NA 2F3NA 3V6KA 3ONNA 4ACOA 2VJ4A 3WK4A 2HHXA 5AK3A 1ZQYA 2KKPA 3AQMA 2HN1A 4KITB 2H5XA 1RM6C 1JALA 5ALKA 2KKVA 4X4RA 4CE6A 1X2IA 1IG6A 4EZ6A 3K1ZA 4G3IA 5CR0A 5KT3A 2DRAA 2G07A 4C8NA 1ZQCA 3EPIA 3WFQE 2ES6A 2QKQA 5HRHA 2ZIWB 1NK9A 3A0BU 1UCVA 4NL9C 2FLLA 1MIVA 4FZNA 1A77A 4LEVA 4F71A 4MEXA 4M9NA 2OYYA 1KW4A 4UB1A 3F2DA 3PSPA 5IIKA 3HILA 4JMUA 3H8JA 5T14A 3PW0A 2GAFD 3CYMA 2LM1A 5DECA 1PK1B 1ZD2P 3QX7A 8ICYA 5L1MA 3ZI4A 2Y0SF 4ECQA 3Q8QB 2F2AB 3WU2U 2AGOA 1L3TA 3SAHA 4UB4A 4KTQA 1L7PA 2BR0A 5AM0A 4DSLA 1U9LA 5J8YC 1KTQA 3PR4A 2RDIA 4ECUA 1KQQA 2ID1A 2CPRA 3EWAA 3B9JA 4DSEA 3Q8MA 4X5VA 8ICPA 5JU5A 2ODGA 3I76A 1Z1BA 4CF3A 3AMZA 2K89A 5KFHA 4PHAA 1NK8A 3D6JA 3RH6A 4WJ3B 5G5HA 4JLXA 4UB5A 4EGWA 2ZH3A 3GZFA 4RT3A 3KKAA 3C2MA 3PSFA 4C8MA 2G0AA 4DOCA 4X4UA 1DGSA 4B9MA 4FHPA 5F9NA 3PW2A 2DBYA 2WB1F 4C7YA 2KIWA 1JI7A 4RWPA 2AQ4A 2P66A 1DK3A 4Y2QA 5HHIA 5J0OA 1OU5A 1RXVA 2XI9A 2J6TA 3L9DA 1K1SA 2DPJA 3TQ1A 5AICA 4K98A 4WBZA 3C21A 2R8GA 5TISU 3TADC 2W8KA 3TI0A 2WHEA 3GU3A 4RQ6A 3J81j 4PL1A 3CW2C 3TARA 3UMCA 5AM1A 2WAQF 4TUSA 4NXVA 4QZ8A 1TAUA 5F2VO 2XIDA 4P4MA 4DFDA 3BQ0A 9ICCA 2BBHA 4F3OA 4YR2A 3FAHA 3T5HA 2N1RA 2LM4A 5AI8A 3M9MB 7ICVA 4YXMA 8ICQA 5AK6A 2DQNB 3LK9A 2LHTA 4M9JA 4WC3A 4BJQA 3MBYA 3NYBA 2LPEA 4I2BA 2KJ5A 5AKGA 4QZEA 1KN5A 2W43A 4ED7A 1KFSA 3ER8C 4MF2A 1XO0A 4X0AA 3GDXA 2PFQA 5L1LA 1ZJMA 4Q43A 3DEEA 3H4DA 2BCQA 5F9LA 3RRHA 2YMLA 2RHFA 1WG8A 2NO4A 4X4NA 5J29A 1TFWA 2F1JA 1S97A 3QZ7A 4FZMA 5G5GA 3IG5A 1V4AA 2P6RA 1HUZA 4AT9A 5DGBA 3HKZC 5KFNA 2I6XA 1ZQOA 1WWVA 2BPCA 3H0RB 1V9PA 4C4TA 1UA1A 4KLIA 4F72A 2E1EA 1Z1VA 5EE9A 3HT3A 1SXEA 2V4QA 4Z6DA 1DXSA 3GQCA 3JPPA 1ZRMA 2BBJA 3SAGA 1ZQJA 1MIWA 5KG3A 5J2JA 5J0WA 3RB4A 4R66A 3OVAA 2EAMA 4QW8A 5KFCA 2IA6A 4IG8A 5DBBA 4NLNA 4EBKA 4I2DA 3MDCA 2B0CA 4CGZA 4AP9A 2E3TA 3QU5A 1ZETA 4PGQA 3UPSA 1ZQNA 4QWAA 2GOLA 3M9NB 2DR7A 1ZQFA 2ZH5A 4K96A 4RQ8A 2G5IB 4F5OA 1ZQPA 3LDAA 5ALJA 3F2BA 3AQKA 4PHEA 5KNIA 2HHVA 1JUDA 2J6UA 3RRGA 1KNYA 1Z4OA 2A3VA 3ZDEA 4GC7A 5KFVA 3DDHA 3H7IA 3EPGA 5CHEA 1XSLA 4M5DA 4UQGA 9ICPA 4I2HA 1Z19A 3PX0A 5J2HA 2DRBA 1T4GA 3AU6A 3UQ0A 1D9FA 1MQ2A 5KFFA 2W9MA 4KLGA 5ALSA 3WFOA 2DUYA 4PL2A 3MDAA 2RRDA 3U26A 2P35A 4O3SA 1QQ6A 3B0YA 5AK5A 1CRXA 4LJXA 4B6JA 3KHGA 4Y2JA 2KN7A 4ECWA 5EE1A 4E0DA 2ZG6A 5B3QA 3G6YA 3AM9A 2K4IA 2JEFA 8ICEA 4X4OA 2KTQA 2M2TA 4BX9C 5ALMA 2I1QA 4RQ3A 3N97B 4I2JA 3ED5A 4QWBA 1Z4NA 3F5EA 4KM5A 4Z6FA 2ALZA 3UMBA 2FE9A 3ETLA 5J2KA 1UEVA 4O5EA 5KFOA 3E58A 1QQ5A 4K9AA 2KVSA 2MU2A 2HDOA 5BPCA 5HP4A 4PH5A 2LYAA 1GPJA 1JMSA 2GH1A 3M6ZA 3RJKA 4KB6A 4EX6A 5EWEA 2L5YA 8ICSA 1XC9A 7ICMA 5ALUA 8ICOA 3WK5A 2BPFA 3PSTA 2C2RA 5J2BA 4EEYA 2MRLA 9ICIA 5KFMA 1SZHA 4J9NA 2ZXHA 3SI8A 2ZJ5A 2C22A 2R8KA 2KIVA 8ICBA 3ZD9A 4WCWA 4OJOA 1T8EA 2HVHA 4NV0A 2H3ZA 3F2CA 2BQRA 5D46A 2ZH6A 4O3MA 2BKEA 2KK0A 1Z00B 5ALDA 8ICCA 1O03A 3BQ7A 3CNHA 3D2SA 1URJA 3NTUA 1RYRA 1H38A 4P2HA 5KFAA 5BOLA 2B51A 4JWMA 2A1AA 4JWNA 2PMZC 2ZIVA 4YQWA 4TURA 3RJEA 5J2FA 2DGZA 2HMXA 4O3NA 9ICHA 9ICJA 4I2EA 3TFRA 1ZQDA 4Y2UA 4KMOB 2UVWA 2DKZA 5D49A 2KD1A 4NKTA 2RLTA 2HI0A 1J2MA 3BZCA 1LVHA 4JB3A 3IHQB 2JMGA 3SYZA 4FBUA 5HRBA 2BDUA 4C4RA 3KBBA 5KFZA 5KG6A 1AROP 4Y2TA 1QTMA 4UBCA 3HJEA 2M2UA 2JEJA 3K75D 2M0NA 4X0BA 4M9LA 2EANA 1LB2B 5KFJA 2H3FA 5AIBA 5ALNA 4JV0A 2EQYA 3A0HU 3RBEA 4IQVA 4YVZA 3FYHA 4F2SA 5CFSA 1JROA 3MR6A 3E0FA 3SAFA 2PXIA 8ICIA 2G09A 4KLFA 5B3PA 5AM2A 1A0PA 4UATA 3KOOA 1SGGA 2LYBA 3RH5A 4Q8FA 3OV7A 2AH5A 4KLMA 3WFRE 4E7XA 3NGDA 4E80A 3UXPA 2YMPA 1VLBA 3I28A 1RYUA 1ZOLA 4QZCA 9ICOA 1Q78A 3K7DA 4B9SA 4Y2PA 1BNPA 9ICLA 1SL1A 4FBTA 1JX4A 1S10A 4DL2A 1XNSA 3IM1A 1UEUA 2OXOA 2ZIVB 5AI5A 3Q8SB 4QW9A 1ZQRA 2AU0A 2W8LA 1M6YA 4F4ZA 1NK4A 2DL0A 4FHXA 3VCBA 2YY6A 2ZTEA 3OUYB 1FFUA 1KL9A 4PZOA 4KX5A 5AIAA 5ALXA 3SZ2A 4P4OA 5AK4A 4IRCA 2ZIWA 1BPYA 3WKBA 4O67A 5AM4A 4USAA 3RAQA 1ZQVA 2G5HB 1NNLA 1YZ6A 2Q4TA 1F5SA 3AQEA 4C7ZA 5IINA 2E8MA 1U47A 1JIHA 4UBBA 2ASJA 3H8SA 3NVZA 3QYPA 5L9XA 4O3RA 2PI4A 2ZIXB 1ZQSA 4RQNA 1MN8A 3IN5A 1DGJA 1RXWA 4I0UA 2H3VA 4PHDA 4BDPA 1PK1A 4J03A 4QZGA 5AKLA 1NO5A 5KT2A 4BWJA 2EZXA 1ZQGA 1S5LU 1ZQBA 3UPQA 3GFKB 2K4PA 4UB2A 5B66U 3R9KA 4KLSA 1D9DA 3JPOA 2DPIA 2VIXA 3TACB 4P0PB 4RQ5A 1VJ5A 4WBYA 2A1JB 5KFYA 4J9KA 4NL9A 1QSLA 3M8RA 2WF7A 2H3QA 4Y2YA 4C80A 1QSYA 3RBDA 1BGXT 3EF2A 4DWIA 1K1QA 4U6PA 1N63A 1B0XA 2KE7A 4J9QA 3RJIA 4RQ2A 1N5XA 4ED6A 2KHQA 2FPLA 2HHPA 3F53A 4CRXA 4XA5A 2EAOA 5D4BA 5E79U 2E5SA 4DOAA 2LBOA 3TAPA 1R8BA 3H3AA 2D3DA 4DLEA 3MC1A 2W54A 2H3IA 3T5LA 5D62A 4KN7A 5EOZA 3QUTA 4OO1J 2JHDA 5HRDA 4MFCA 3UQ2A 2EAPA 4OJLA 3SENA 5AKJA 1SIJA 1J97A 1TK5A 9ICUA 4K97A 3H0MB 3HW8A 4LT6A 4K9BA 5KFRA 3H40A 4DFJA 5EE3A 3HP6A 5KFUA 1Y88A 2ATLA 4Y2XA 4X4TA 2EDUA 4WC0A 3FM9A 1P7DA 2GO7A 1RZTA 7ICJA 4RU9A 1Q46A 4KLHA 3GILA 9ICAA 4RWNA 1OUQA 3JPQA 3C5GA 5ALRA 1ZQLA 1TE2A 4KMUA 1SKRA 4WH5A 8ICNA 5AKEA 4J9LA 3QXGA 4O68A 3PO4A 4KX3A 1K5OA 4ATBB 1KDHA 4M04A 4UASA 3N28A 4UW9A 2BPGA 1NJZA 1L3SA 4JUZA 5EWFA 2Y1JA 4YD2A 1COOA 4TUQA 1BPXA 4XQ7A 1X6IA 2F8LA 1V97A 4WC5A 2K8AA 5KFEA 1X42A 2EZYA 9ICEA 5FP0A 1WYGA 3OHAA 2ZHAA 2HOQA 5GTIU 5KT6A 4DSJA 2KV2A 2DWQA 5ALIA 1ZQEA 2HVIA 8ICJA 2KZZA 4EEKA 4ECXA 3M8SA 2G06A 5A0LA 1SL2A 3Q8LA 2B4VA 3ISCA 2CRXA 3BDPA 4KLJA 2FLPA 4NLKA 1NJWA 1UETA 3C23A 1XS9D 3QUCA 2Y9TA 3RR8A 2P6UA 3ISBA 4K99A 1PK3A 2ZH7A 4J9PA 1VJ7A 4P0QB 1ZQXA 2LKYA 7ICIA 2Y1IA 2RP5A 3HPOA 5J0RA 5CB1A 4US8A 3O0FA 3RB3A 4DQIA 1R8CA 1N2XA 4R65A 1F44A 5JTGA 2XC9A 2W11A 3HIYA 5HR7A 4FO1A 1DOQA 2W04A 5HRIA 1Q8KA 1X66A 2KSOA 4QIWF 3RFAA 2BHNA 3BS5B 3EUB2 1PVRA 2A19A 2KFZA 1WCNA 4AT7A 1ZD4A 2KNJA 5J0QA 5CFUA 2ZUDA 8ICMA 8ICWA 5KFLA 3PW4A 2XCPA 3PNCA 2PBEA 4DFKA 2HW3A 2GLEA 4EZ9A 4WC4A 5ALVA 4DF8A 4B9TA 4UAYA 9ICXA 4Z6EA 3PX6A 3BS7A 4DO9A 4ECRA 4NXZA 4DSKA 1WUDA 4M2YA 3E2EA 2ISOA 5KFKA 5KT7A 4BUGA 4I29A 8ICXA 3QNMA 4QJFB 1TFYA 5ALOA 5DDMA 4RQ7A 1MC8A 5KG2A 1NKBA 3EZ5A 5AHXA 1OW5A 1S77D 1N5WA 4O0IA 2MAXA 2NRZA 3HJ4A 2LYHA 3L4PA 2D6FC 1D8BA 1KRPA 3ETRA 3MR5A 4JV2A 1X9WA 5EWGA 4IC9A 9ICWA 4QNLA 3ZDDA 3ORYA 4EELA 2K8BB 1GO3F 2BCRA 1KFDA 3GIIA 5AKZA 2FMPA 4I28A 2RQ5A 3HRDD 4GXJA 3QEBZ 2JH7A 4QZBA 1RG6A 2WF6A 9ICNA 2KSOB 1WOTA 4F5QA 4X4PA 4WC6A 9ICQA 4C4SA 3NUQA 2XY5A 3LQCB 2Q0ZX 4AT7B 1U45A 4YR0A 3MGHA 4M6WA 2QB1A 2VANA 4J9MA 9ICRA 4JV1A 1UT8A 4UD4A 2ISPA 2XO7A 2FCLA 9ICGA 1SV4A 3WKAA 1Z00A 3AU2A 1T3QA 2DKXA 2DR8A 2FPMA 3WKEA 3M6KA 5C5JA 4CNQA 1ZXIA 5ALZA 4YN4A 2PFNA 4OAFA 1LKYB 4DSIA 4Y2SA 1SWVA 5KFTA 3PSIA 4GC6A 4WQKA 2AHOB 3C1ZA 2MA1A 5AKXA 5KT4A 5DG9A 4ED0A 2PKEA 7ICLA 3RB0A 5ALGA 4ECVA 4Y2RA 2YMMA 4M47A 5KAFU 4K8VA 5DGAA 4JK1A 3ERCC 2IHNA 4YR3A 1QH9A 3AUOA 1C7YA 4DL3A 4RWOA 1BVSA 3OVSA 3N7RC 3TANA 4RNNA 3JPNA 3T5JA 5DBCA 1RQLA 2Y0SC 5KAIU 2MUTB 3LYSA 4F50A 1QQ7A 1JXLA 5CFTA 3KFUF 4IR1A 4YXJA 4DSFA 3PW5A 3IV6A 5JTIA 2IMWP 2IUBA 1NK0A 1F0MA 1D8YA 4PZNA 3HX0A 1UHUA 1ZJNA 3MABA 2IOFA 5H2FU 2AGQA 4F4WA 8ICAA 2E8OA 4I2FA 3KZIU 1R89A 3RF9A 3NVOA 4M6WB 2K8CB 1NKEA 1MQ3A 4WQLA 4BXOB 7ICOA 1N62A 1RDFA 5DLFA 3NRWA 1XSNA 4OJ5A 2HBLA 3AQNA 2W03A 4YMNA 4I27A 8ICZA 2FLNA 3RAXA 5CP2A 1SWWA 4AYBC 5KG0A 4GFJA 5KFIA 4HAIA 4F92B 3V7JA 2JH1A 5JRTA 4B9VA 3WFSC 4BWMA 4FH3A 4ELTA 3MGVA 2WB1C 2OWOA 1KKXA 2IOHA 2KVCA 5KT5A 4EBCA 1U4BA 1SV0C 1V38A 4DQQA 4M0AA 4QWCA 8ICGA 5L1IA 5KFBA 2QLTA 3JYYA 3OUYA 1UQVA 2KFNA 3QU9A 5KFQA 1F5AA 4GXIA 5DQIA 3H8WA 2AGPA 1T94A 4ECTA 3IP4B 2EWRA 4UB6U 1N56A 5GTHU 4X4QA 4QZDA 4DL6A 4DOBA 1U49A 3GV5B 4C0ZA 2NV3A 1J2NA 3H0LB 4K4GA 2BQUA 2ZIXA 2W7PA 4TQSA 2KOBA 4AT8B 2XY6A 5J2IA 2G08A 2RFFA 1L7NA 5HMMA 2KP7A 3RJJA 1PUZA 5JUMA 2KZ3A 4XQ8A 1RYSA 4C8KA 2HOIA 5HRFA 1D8LA 4RZRA 3OWGA 1SZPA 4DS5A 4KLOA 5KG7A 2K60A 5HR9A 1L7OA 2PI5A 3QEAZ 5HNKA 4NKUA 1KFTA 3PMNA 1HEKA 1CEZA 2E1FA 4UD5A 1HJPA 3SV4A 4OJPA 4GIBA 3V7LA 5AM3A 4P0PA 7ICQA 3OSNA 5CHGA 4KN4A 2DVIA 2JEIA 4EYIB 4MFAA 2A1JA 3OVBA 2YB1A 2QB0A 3QZ8A 1ZQHA 1NK6A 3M1YA 4DFMA 4X4VA 1FO4A 3LVVA 4J9OA 4NM1A 3AQLA 4EBJA 4GXKA 3C66A 4R8UB 1L8OA 1NJYA 1X40A 4XUSA 4NM2A 4ICAA 4XRHA 4EP7A 2OM6A 4UAWA 1UA0A 4O5CA 1ZQKA 2YX8A 3AL0B 1ZQ1C 4MFFA 2KMDA 3WK6A 1KBUA 4ECZA 3WKCA 3PY8A 3CK6A 2NO5A 1NOMA 2F44A 2ZTDA 2YQEA 1N60A 4FO6A 4IQWA 2KG5A 4I2IA 2VA8A 2WF8A 2JR5A 4KLUA 4NXUA 2ZH4A 2K4EA 5KL8B 1L8LA 3HJ1A 3QU4A 3HKZF 1TKDA 2OHFA 5KFGA 7ICSA 2AQ0A 2ZUCA 3NASA 4KLQA 1PX5A 2HBMA 2ZH2A 1TK8A 2JEGA 1X6JA 3MFIA 2J6SA 4UB8U 2BCSA 4RPZA 4R64A 2IOFK 3AEVA 9ICTA 3OJSA 3MGIA 2HCFA 4YMOA 3KHRA 3V72A 5J0XA 2C2DA 3MR2A 1Q79A 2W9BB 2Z7JA 2QARB 4NWIA 2XGQA 1IM4A 1S0OA 5J2DA 4ZOHC 1S9FA 2QB0B 2KEYA 2BQ3A 1NZPA 3BJYA 3RJFA 5J0UA 1JXEA 2ZHBA 3V6JA 2W3RA 4NXTA 3KHLA 5KFPA 1TK0A 1L3UA 3C2LA 8ICLA 1KLNA 4MKPA 1HUOA 2F76X 4B9LA 5CJ7A 4DCCA 4UAUA 4ATBA 1UT5A 2C28A 1TAMA 2ESEA 4Q44A 3ICXA 3Q8KA 7ICPA 3V6HA 3LWMA 4IS7A 5ALHA 2V9WA 1S8OA 4BGDA 1X9MA 3MFHA 4QZAA 3RB6A 5ALFA 1ZYQA 1TAQA 5KG1A 1MIYA 3WK9A 1O08A 4A8EA 5J8YA 1BPDA 2WTFA 2JZBA 4NXWA 3IRUA 2UVVA 4EBDA 2DF4B 4ED8A 4E8FA 3NVYA 4QWEA 4FE3A 4O9MA 4F5PA 1SKWA 1FFVA 4IRDA 2XICA 2KJ8A 3GIJA 2FDRA 1ZQAA 3SV3A 5AI6A 3SR6A 4OAHA 2V4RA 4FHVA 9ICVA 2FMQA 5KFXA 3N7SC 4P0QA 4I2AA 2DR5A 1PVPA 2JXJA 4FHYA 2AXTU 2ASLA 5DLGA 3Q8PB 5D61A 4WOYA 3H38A 3ALRA 3N4MB 5K4LA 3K1RB 1Q3UA 1WWUA 1L3VA 3I1YA 3FC4A 3ISDA 2NRWA 4LZDA 4PHPA 3PHZA 2YN4A 1ED1A 1SXDA 4OAIZ 3CP8A 2O6KA 3BS5A 2R18A 7ICUA 1ZQIA 5J0SA 3OJUA 2LI6A 1T7PA 3NVVA 3B0XA 2HHQA 4RPYA 2ZH1A 1B4FA 3TADA 1QSSA 4IL6U 1IV8A 4ECSA 4C8LA 2KJ9A 1NZBA 4F91B 3C29A 1JQRA 4US9A 4P4PA 2F8KA 3IDWA 9ICFA 1EXNA 1BPBA 2JZBB 2C2EA 5IIIA 2NRVA 4RNOA 4AYBF 5DDYA 4PJ0U 2HSZA 4QZHA 1YT3A 3L5KA 1NK7A 2W9AA 3PVXA 2PMZF 4O69A 2YB4A 1S76D 2DR9A 4LEZA 4RT2A 1L6NA 1Q3VA 5J2AA 1BNOA 1RQNA 2OCEA 1FA0A 3QE9Y 8ICKA 2DFLA 5AI0A 3IG8A 3BQTA 5DKWA 3AN1A 5DG8A 4KLDA 3DV9A 4PGXA 1S0VA 1XU4A 4YMMA 3QUQA 2W3SA 3KKAC 5BOMA 5KFSA 2NYVA 5DQHA 1NI3A 1ZQUA 3EYZA 4QZFA 5ALEA 2I5HA 3GV8B 3BZKA 2BE3A 4X4SA 1YLQA 3WK7A 2M2VA 2M2WA 3QUBA 5HC9A 5F3XB 1DRGA 4CF4A 4HX0A 1BPZA 2XY7A 7ICTA 1NK5A 1HIWA 4DL5A 5DB8A 1CUKA 3G6XA 5ALQA 4DL7A 8ICFA 3C1YA 1JN3A 4OCZA 4EEDA 4KLLA 2FPKA 4KLTA 2B6GA 4NLZA 4B9UA 4K4IA 3SMVA 2PFPA 1RPLA 2ASDA 1LKYA 5D63A 4DQRA 4LEYA 5KFDA 4EYHB 3PO5A 1L7MA 2Y9UA 3WKDA 2B56A 2AJQA 1U48A 4C8OA 3KTQA 3D2QA 1A76A 1CI4A 2HOFA 2BCVA 2E8NA 3UM9A 2JGAA 4ECYA 2HHUA 4UAZA 4DL4A 5CEHA 4WC2A 2ZH9A 1XSPA 4NY8A 5C0YA 4TQRA 3EW9A 1DK2A 1SB3C 4FFDA 3JPSA 2W7OA 2W9CA 1VDVA 2HHSA 2R8JA 3BQ2A 4YFKA 2BZFA 1OXJA 3GIKA 4PGYA 1Z3EB 1XWLA 2JV3A 2MUTA 4LVSA 1FIQA 3NS1A 3SQIA 4RQMA 3S6JA 1ZQWA 4O3OA 2FI1A 1N48A 4NLCA 5IIMA 4RPXA 2D8CA 2F77X 3Q8RB 3TAQA 5AKKA 2JRZA 1NKCA 4QZ9A 4PPXA 2M9NA 5KL1B 5AM5A 1ZQTA 1T3NA 9ICKA 4F4KA 3UXNA 2GA9D 3PR5B 4RUCA 3THVA 2VKQA 4S3NA 1WCLA 3OHBA 4BXOA 1ZRNA 3PW7A 3SD7A 1TFRA 4Y2VA 3LVWA 3N7PD 3GV7B 2UVRA 4FHWA 4F5NA 3H39A 2MSNA
chains in the Genus database with same CATH topology
3HWTA 1QSYA 3TQ1A 3RBDA 1BGXT 4DWIA 1K1QA 7ICHA 4WBZA 4ELUA 3C21A 2R8GA 4K4GA 2IBKA 5HHHA 2W8KA 4J9QA 2BQUA 5HREA 4HYKA 3TI0A 3RJIA 4RQ6A 4YP3A 4F2RA 4RQ2A 4TQSA 3TARA 1L5UA 4ED6A 1MSWD 4AT8B 2XY6A 5J2IA 7ICEA 5IIOA 2FPLA 2HHPA 2RFFA 4RNMA 4ED2A 5HMMA 4XA5A 4TUSA 3RJJA 3T3FA 2KP7A 5JUMA 5J2EA 2KZ3A 4DEZA 5D4BA 4XQ8A 4DOAA 1RYSA 4QZ8A 2HHWA 1TAUA 4C8KA 5F2VO 4P4MA 3TAPA 5HRFA 2FMSA 1D8LA 4RZRA 4IR9A 1SZPA 4DS5A 4QWDA 5KG7A 4KLOA 7ICNA 1R8BA 7ICRA 4DLEA 3H3AA 5HR9A 4AT9B 2PI5A 3BQ0A 3QEAZ 9ICCA 5HNKA 4LZGA 4NKUA 1KFTA 4O3PA 3T5LA 3PMNA 4F3OA 3PV8A 2F1HA 4KN7A 3JPTA 4YR2A 5EOZA 1CEZA 2W9CB 4UD5A 3T5HA 1HJPA 3SV4A 3M9MB 3V7LA 3KHHA 7ICVA 4YXMA 8ICQA 3LK9A 4ELVA 3OSNA 7ICQA 5CHGA 1TV9A 5HRDA 5TZVA 4KN4A 4F4XA 4MFCA 3UQ2A 2DVIA 2JEIA 4EYIB 4MFAA 3C5FA 4M9JA 5HRGA 4WC3A 3OGUA 2A1JA 3H39A 3MBYA 3OVBA 3NYBA 4I2BA 3QZ8A 1ZQHA 1TK5A 4QZEA 9ICUA 1B43A 1NK6A 4ED7A 1KFSA 2RDJA 3HW8A 4LT6A 4DFMA 4X4VA 4F93B 4MF2A 5KFRA 3H40A 4J9OA 3AQLA 4NM1A 2R8HA 4DFJA 3HP6A 4GXKA 4EBJA 1ZQMA 3C66A 4R8UB 5KFUA 4X0AA 1Y88A 3K4GA 3GDXA 1TVAA 1NJYA 2ATLA 3RJHA 2PFQA 5HRLA 5L1LA 1ZJMA 8ICVA 4X4TA 4Q43A 2R8IA 4XUSA 7ICFA 4NM2A 3H4DA 2BCQA 4AT8A 3UXOA 5F9LA 4XRHA 4EP7A 5J0YA 2ZUBA 3RRHA 4UAWA 2BGWA 4WC0A 1UA0A 4X4NA 4O5CA 5J29A 1TFWA 2F1JA 1S97A 3QZ7A 4TUPA 1RZTA 1ZQKA 7ICJA 2GWSA 4MFFA 5J2GA 5DB9A 4RU9A 3RR7A 1V4AA 4RQ1A 2P6RA 1HUZA 4MF8A 4ECZA 4KLHA 4AT9A 5DGBA 3PY8A 3GILA 5KFNA 3TFSA 4MEYA 1NOMA 9ICAA 3JPQA 3C5GA 1ZQOA 1QLNA 3C18A 4RWNA 2ZTDA 1ZQLA 4KMUA 1SKRA 2BPCA 4YG2A 3H4BA 1V9PA 1UA1A 4KLIA 8ICNA 1S0MA 4J9LA 4DQPA 4FO6A 4IQWA 2HHTA 4WC1A 4I2IA 3PO4A 3RH4A 2VA8A 4KLUA 4DLGA 2ZH4A 2ZH8A 3HT3A 2XGPA 7ICGA 3HJ1A 2V4QA 5DB7A 4ATBB 4Z6DA 1TKDA 3GQCA 3JPPA 1KDHA 4M04A 1LV5A 4RQ0A 5KFGA 2BPGA 1NJZA 2AQ0A 2ZUCA 2XCAA 1ZQJA 7ICSA 4FS2A 4KLQA 1L3SA 1BPEA 1MIWA 1PX5A 5KG3A 4JUZA 5J2JA 5J0WA 3RB4A 5EWFA 4R66A 2Y1JA 1TK8A 4J9RA 3T5KA 2JEGA 3MFIA 4M9GA 3OVAA 4R8UA 4YD2A 4QW8A 5KFCA 3JPRA 2BCSA 1COOA 5DBBA 4RPZA 4R64A 2IA6A 2J6SA 4TUQA 4NLNA 4I2DA 1BPXA 4O3QA 8ICRA 4XQ7A 9ICTA 3MDCA 3OJSA 2O1PA 4WC5A 3MGIA 5KFEA 1JAJA 4YMOA 3KHRA 3V72A 1KSPA 3UPSA 1ZETA 4PGQA 4QZIA 9ICEA 5J0XA 2C2DA 1S0NA 1ZQNA 4QWAA 2DR7A 3M9NB 3MR2A 3OHAA 1SL0A 2ZHAA 1Q79A 2W9BB 5KT6A 4FS1A 1ZQFA 2ZH5A 2XGQA 4DSJA 1IM4A 4RQ8A 5J2CA 3LWLA 4F5OA 1S0OA 9ICMA 5J2DA 1ZQPA 1S9FA 3LDAA 2UVUA 5DBAA 1ZQEA 2HVIA 4DS4A 8ICJA 2BQ3A 1NZPA 3BJYA 3RJFA 4RUAA 2KZZA 5J0UA 3AQKA 1JXEA 2ZHBA 4PHEA 4M9HA 4ECXA 3V6JA 2HHVA 3KHLA 1SKSA 5KFPA 1TK0A 2J6UA 3M8SA 1L3UA 3RRGA 3C2LA 5DB6A 1KLNA 2IHMA 2KZMA 8ICLA 1HUOA 1SL2A 3Q8LA 3ZDEA 5CJ7A 4GC7A 4B9LA 1KEJA 5KFVA 3ISCA 9ICSA 3H7IA 1UT5A 3EPGA 2C28A 3BDPA 4KLJA 2FLPA 4NLKA 4R63A 1NJWA 1UETA 7ICKA 3C23A 1XSLA 1XS9D 4UQGA 4M5DA 3RR8A 9ICPA 2P6UA 4Q44A 3ISBA 4I2HA 3ZD8A 3PX0A 2ZH7A 3Q8KA 5KTQA 4J9PA 7ICPA 1VJ7A 2PFOA 5J2HA 1ZQXA 3LWMA 3V6HA 2DRBA 1T4GA 3AU6A 3UQ0A 7ICIA 2Y1IA 1D9FA 3HPOA 1MQ2A 5J0RA 2V9WA 5CB1A 5KFFA 4BGDA 1X9MA 3C2KA 2W9MA 1ZQQA 3MFHA 4KLGA 5KFWA 3BQ1A 3RB3A 3WFOA 4DQIA 4QZAA 3MR3A 3RB6A 1R8CA 4UB3A 3MDAA 4R65A 2ZJAA 3GIMA 1ZYQA 2DPJA 1TAQA 5KG1A 4O3SA 2XC9A 3HIYA 3B0YA 2ZJ8A 4KLEA 1MIYA 4RQ4A 2W9BA 1DOQA 1BPDA 4GLXA 8ICUA 5HRIA 2WTFA 3JZ0A 2JZBA 3KHGA 2KN7A 5J0PA 2UVVA 4EBDA 4ECWA 1QSLA 4E0DA 2BCUA 3V7KA 2VA3A 5L1JA 2BHNA 4ED8A 4E8FA 3G6YA 1VFGA 2I9GA 4QWEA 1X9SA 3PMLA 4O9MA 4F5RA 2JEFA 4JV2A 2KFZA 4F5PA 1WCNA 1SKWA 4AT7A 3H37A 4ED1A 4IRDA 8ICEA 2ZTCA 4X4OA 2KTQA 2M2TA 4RQ3A 2I1QA 5IILA 1ZQZA 3N97B 4I2JA 5J0QA 3GIJA 4QWBA 4I2CA 2NRKA 2ZUDA 1R8AA 8ICMA 8ICWA 4Z6FA 5KFLA 3PW4A 3SV3A 1ZQAA 2ALZA 5KG4A 3ETLA 3PNCA 5J2KA 2XCPA 4O5EA 1UEVA 2PBEA 5KFOA 4DFKA 2HW3A 4EZ9A 2V4RA 4WC4A 5BPCA 5HP4A 4O5KA 9ICVA 2BDPA 4PH5A 4DF8A 5KFXA 2FMQA 4FHVA 4B9TA 2NRTA 1JMSA 4UAYA 4F4YA 4I2AA 9ICXA 2DR5A 4Z6EA 3PX6A 3RJKA 5EWEA 4FH5A 2O5AA 4DO9A 4ECRA 4NXZA 4DSKA 5DQGA 2VA2A 8ICSA 1XC9A 4FHYA 2ASLA 3ZDAA 4M2YA 5DLGA 3Q8PB 2ISOA 4NLGA 3E2EA 7ICMA 3H38A 5KFKA 5KT7A 3N4MB 4I29A 2BPFA 8ICOA 8ICXA 1L3VA 2C2RA 5J2BA 4EEYA 1TFYA 5DDMA 3ISDA 9ICIA 4IQUA 2NRWA 4LZDA 4RQ7A 4Q8EA 1MC8A 4PHPA 5KFMA 4YD1A 5KG2A 4J9NA 1NKBA 3M9OB 3ZDCA 3EZ5A 3SI8A 2ZJ5A 1S77D 4DQSA 2C22A 2R8KA 8ICBA 2NRXA 5KG5A 3ZD9A 4O0IA 2MAXA 4WCWA 2NRZA 4WC7A 3HJ4A 2LYHA 1T8EA 2HVHA 1KRPA 4F8RA 1XO1A 7ICUA 5HRKA 3MR5A 1PZNA 4IQTA 5L1KA 5D46A 3G6VA 2BQRA 2BKEA 5EWGA 4YCXA 1Z00B 5DG7A 1X9WA 1ZQIA 2ZH6A 5J0SA 3OJUA 1T7PA 4ZH4A 3B0XA 8ICCA 9ICWA 1IXRA 4RPYA 2HHQA 2ZH1A 3ZDDA 3ORYA 5CA7A 4J9SA 1QSSA 2BCRA 4RWQA 5HMLA 1KFDA 3GIIA 2FMPA 3NTUA 1RYRA 1H38A 4I28A 2Q66A 4ECSA 4P2HA 9ICBA 4C8LA 1B22A 5KFAA 5BOLA 4EBEA 1NJXA 4IRKA 4F91B 5J0TA 4JWMA 4GXJA 3QEBZ 4JWNA 4P4PA 4K4HA 1JQRA 4QZBA 8ICHA 9ICFA 4YQWA 1EXNA 4TURA 3RJEA 1BPBA 2JZBB 2C2EA 5IIIA 5J2FA 4Q45A 9ICNA 2NRVA 4RNOA 1WOTA 4CCHA 4O3NA 4F5QA 4I2GA 5DDYA 3FDSA 9ICHA 9ICQA 4WC6A 4X4PA 9ICJA 4I2EA 4QZHA 2XY5A 3PX4A 3TFRA 1ZQDA 3ZDBA 4DF4A 2Q0ZX 1NK7A 2UVWA 2W9AA 3PVXA 3RJGA 3LQCB 4AT7B 5D49A 1U45A 4DFPA 2F1IA 4NKTA 4YR0A 1S76D 3MGHA 5IIJA 2DR9A 4M6WA 3OSPA 2VANA 3IHQB 4J9MA 4RT2A 4JV1A 1UT8A 9ICRA 4UD4A 3SYZA 2ISPA 4FBUA 5HRBA 5J2AA 2XO7A 1BNOA 1FA0A 2B21A 9ICGA 5DEDA 3QE9Y 5KFZA 1Z00A 5KG6A 2DFLA 5CWRA 1AROP 4Z6CA 8ICKA 8ICTA 3AU2A 4ATBA 2DR8A 2FPMA 3BQTA 4ED3A 3RTVA 5DKWA 4B9NA 5C5JA 1QTMA 4UBCA 5DG8A 4IG8A 3V6KA 2M2UA 4KLDA 4YN4A 2PFNA 2JEJA 4PGXA 3K75D 1S0VA 1XU4A 4DSIA 4X0BA 2HHXA 4M9LA 2ZH2A 1LB2B 1ZQYA 5KFJA 4YMMA 5BOMA 4JV0A 5KFSA 3AQMA 2H5XA 4KITB 3RBEA 4IQVA 5DQHA 4YVZA 5KFTA 1ZQUA 3FYHA 4F2SA 3EYZA 4X4RA 4GC6A 4QZFA 3MR6A 1X2IA 3C1ZA 3GV8B 2PXIA 4EZ6A 8ICIA 4G3IA 2BE3A 5KT4A 5CR0A 5KT3A 5DG9A 1YLQA 4X4SA 2DRAA 4ED0A 4C8NA 7ICLA 4KLFA 1ZQCA 3EPIA 3RB0A 2M2VA 2M2WA 4ECVA 3WFQE 5HRHA 5HC9A 4M47A 5DGAA 4JK1A 1NK9A 4Q8FA 3RH5A 2IHNA 4YR3A 3OV7A 4KLMA 3WFRE 1BPZA 4E7XA 3NGDA 2XY7A 7ICTA 4E80A 3AUOA 3UXPA 1NK5A 1C7YA 4DL3A 2FLLA 1MIVA 4RWOA 1A77A 1BVSA 5DB8A 4DL5A 3OVSA 4MEXA 3TANA 1CUKA 4RNNA 3JPNA 3G6XA 5DBCA 3T5JA 4DL7A 4M9NA 8ICFA 3C1YA 1JN3A 4UB1A 2MUTB 4KLLA 2FPKA 4QZCA 4KLTA 9ICOA 4NLZA 4B9UA 1Q78A 4K4IA 5IIKA 2PFPA 4F50A 4B9SA 3H8JA 1JXLA 1BNPA 9ICLA 1SL1A 4FBTA 1RPLA 3PW0A 4IR1A 1JX4A 1S10A 4YXJA 4DL2A 4DSFA 2ASDA 3IM1A 3PW5A 1UEUA 2IMWP 1NK0A 4DQRA 5KFDA 3Q8SB 4EYHB 1D8YA 3PO5A 5DECA 4EBKA 3HX0A 1ZJNA 4QW9A 1ZQRA 8ICYA 3MABA 2AU0A 1KNYA 4ECQA 2W8LA 2AJQA 1U48A 3Q8QB 4C8OA 2AGQA 4F4WA 3KTQA 8ICAA 4F4ZA 4I2FA 2AGOA 1NK4A 1L3TA 4UB4A 4FHXA 1A76A 1R89A 4KTQA 2BCVA 2BR0A 2ZTEA 3OUYB 4M6WB 4ECYA 4DSLA 4UAZA 2HHUA 1U9LA 3SZ2A 1NKEA 1MQ3A 1KTQA 4P4OA 4IRCA 4DL4A 4BXOB 7ICOA 3PR4A 1BPYA 2RDIA 5DLFA 4WC2A 2ZH9A 1XSPA 1XSNA 4NY8A 3RAQA 3AQNA 4YMNA 4TQRA 4ECUA 3EW9A 4I27A 1DK2A 3JPSA 2ID1A 5IINA 2W9CA 3EWAA 8ICZA 2HHSA 2R8JA 4DSEA 3BQ2A 3Q8MA 4YFKA 4X5VA 8ICPA 2FLNA 3GIKA 3RAXA 1U47A 1JIHA 4UBBA 2ASJA 5CP2A 4PGYA 3H8SA 5KG0A 1Z3EB 1XWLA 5L9XA 2MUTA 5KFIA 4LVSA 4O3RA 5KFHA 2PI4A 4F92B 4PHAA 1NK8A 1ZQSA 3V7JA 1RXWA 4B9VA 3RH6A 3WFSC 1ZQWA 4BWMA 4FH3A 4O3OA 4UB5A 1N48A 4ELTA 4PHDA 5IIMA 4BDPA 4RPXA 2ZH3A 3Q8RB 2OWOA 4QZGA 4RT3A 3TAQA 1NO5A 5KT2A 4BWJA 1ZQGA 5KT5A 3C2MA 3UPQA 4EBCA 1NKCA 1ZQBA 4C8MA 4QZ9A 1U4BA 4PPXA 2M9NA 3GFKB 4DOCA 4DQQA 4UB2A 4M0AA 4X4UA 1DGSA 4QWCA 1ZQTA 1T3NA 9ICKA 8ICGA 4KLSA 4F4KA 1D9DA 4B9MA 3WFPA 5L1IA 5KFBA 3JPOA 3UXNA 3JYYA 2DPIA 3PR5B 3OUYA 4RUCA 4FHPA 5F9NA 3PW2A 2KFNA 3THVA 5KFQA 4S3NA 1WCLA 1F5AA 4RQ5A 3OHBA 4BXOA 4GXIA 4RWPA 5DQIA 3H8WA 2AGPA 2AQ4A 4ECTA 3PW7A 2P66A 4WBYA 1TFRA 2A1JB 5KFYA 5HHIA 5J0OA 1DK3A 1N56A 4X4QA 4QZDA 4J9KA 1RXVA 1OU5A 2J6TA 4DL6A 3GV7B 3L9DA 4DOBA 2UVRA 1K1SA 3GV5B 4F5NA 3M8RA 1U49A 4FHWA 1ZQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HWT A;  1QSY A;  3TQ1 A;  3RBD A;  1BGX T;  4DWI A;  1K1Q A;  7ICH A;  4WBZ A;  4ELU A;  3C21 A;  2R8G A;  4K4G A;  2IBK A;  5HHH A;  2W8K A;  4J9Q A;  2BQU A;  5HRE A;  4HYK A;  3TI0 A;  3RJI A;  4RQ6 A;  4YP3 A;  4F2R A;  4RQ2 A;  4TQS A;  3TAR A;  1L5U A;  4ED6 A;  1MSW D;  4AT8 B;  2XY6 A;  5J2I A;  7ICE A;  5IIO A;  2FPL A;  2HHP A;  2RFF A;  4RNM A;  4ED2 A;  5HMM A;  4XA5 A;  4TUS A;  3RJJ A;  3T3F A;  2KP7 A;  5JUM A;  5J2E A;  2KZ3 A;  4DEZ A;  5D4B A;  4XQ8 A;  4DOA A;  1RYS A;  4QZ8 A;  2HHW A;  1TAU A;  4C8K A;  5F2V O;  4P4M A;  3TAP A;  5HRF A;  2FMS A;  1D8L A;  4RZR A;  4IR9 A;  1SZP A;  4DS5 A;  4QWD A;  5KG7 A;  4KLO A;  7ICN A;  1R8B A;  7ICR A;  4DLE A;  3H3A A;  5HR9 A;  4AT9 B;  2PI5 A;  3BQ0 A;  3QEA Z;  9ICC A;  5HNK A;  4LZG A;  4NKU A;  1KFT A;  4O3P A;  3T5L A;  3PMN A;  4F3O A;  3PV8 A;  2F1H A;  4KN7 A;  3JPT A;  4YR2 A;  5EOZ A;  1CEZ A;  2W9C B;  4UD5 A;  3T5H A;  1HJP A;  3SV4 A;  3M9M B;  3V7L A;  3KHH A;  7ICV A;  4YXM A;  8ICQ A;  3LK9 A;  4ELV A;  3OSN A;  7ICQ A;  5CHG A;  1TV9 A;  5HRD A;  5TZV A;  4KN4 A;  4F4X A;  4MFC A;  3UQ2 A;  2DVI A;  2JEI A;  4EYI B;  4MFA A;  3C5F A;  4M9J A;  5HRG A;  4WC3 A;  3OGU A;  2A1J A;  3H39 A;  3MBY A;  3OVB A;  3NYB A;  4I2B A;  3QZ8 A;  1ZQH A;  1TK5 A;  4QZE A;  9ICU A;  1B43 A;  1NK6 A;  4ED7 A;  1KFS A;  2RDJ A;  3HW8 A;  4LT6 A;  4DFM A;  4X4V A;  4F93 B;  4MF2 A;  5KFR A;  3H40 A;  4J9O A;  3AQL A;  4NM1 A;  2R8H A;  4DFJ A;  3HP6 A;  4GXK A;  4EBJ A;  1ZQM A;  3C66 A;  4R8U B;  5KFU A;  4X0A A;  1Y88 A;  3K4G A;  3GDX A;  1TVA A;  1NJY A;  2ATL A;  3RJH A;  2PFQ A;  5HRL A;  5L1L A;  1ZJM A;  8ICV A;  4X4T A;  4Q43 A;  2R8I A;  4XUS A;  7ICF A;  4NM2 A;  3H4D A;  2BCQ A;  4AT8 A;  3UXO A;  5F9L A;  4XRH A;  4EP7 A;  5J0Y A;  2ZUB A;  3RRH A;  4UAW A;  2BGW A;  4WC0 A;  1UA0 A;  4X4N A;  4O5C A;  5J29 A;  1TFW A;  2F1J A;  1S97 A;  3QZ7 A;  4TUP A;  1RZT A;  1ZQK A;  7ICJ A;  2GWS A;  4MFF A;  5J2G A;  5DB9 A;  4RU9 A;  3RR7 A;  1V4A A;  4RQ1 A;  2P6R A;  1HUZ A;  4MF8 A;  4ECZ A;  4KLH A;  4AT9 A;  5DGB A;  3PY8 A;  3GIL A;  5KFN A;  3TFS A;  4MEY A;  1NOM A;  9ICA A;  3JPQ A;  3C5G A;  1ZQO A;  1QLN A;  3C18 A;  4RWN A;  2ZTD A;  1ZQL A;  4KMU A;  1SKR A;  2BPC A;  4YG2 A;  3H4B A;  1V9P A;  1UA1 A;  4KLI A;  8ICN A;  1S0M A;  4J9L A;  4DQP A;  4FO6 A;  4IQW A;  2HHT A;  4WC1 A;  4I2I A;  3PO4 A;  3RH4 A;  2VA8 A;  4KLU A;  4DLG A;  2ZH4 A;  2ZH8 A;  3HT3 A;  2XGP A;  7ICG A;  3HJ1 A;  2V4Q A;  5DB7 A;  4ATB B;  4Z6D A;  1TKD A;  3GQC A;  3JPP A;  1KDH A;  4M04 A;  1LV5 A;  4RQ0 A;  5KFG A;  2BPG A;  1NJZ A;  2AQ0 A;  2ZUC A;  2XCA A;  1ZQJ A;  7ICS A;  4FS2 A;  4KLQ A;  1L3S A;  1BPE A;  1MIW A;  1PX5 A;  5KG3 A;  4JUZ A;  5J2J A;  5J0W A;  3RB4 A;  5EWF A;  4R66 A;  2Y1J A;  1TK8 A;  4J9R A;  3T5K A;  2JEG A;  3MFI A;  4M9G A;  3OVA A;  4R8U A;  4YD2 A;  4QW8 A;  5KFC A;  3JPR A;  2BCS A;  1COO A;  5DBB A;  4RPZ A;  4R64 A;  2IA6 A;  2J6S A;  4TUQ A;  4NLN A;  4I2D A;  1BPX A;  4O3Q A;  8ICR A;  4XQ7 A;  9ICT A;  3MDC A;  3OJS A;  2O1P A;  4WC5 A;  3MGI A;  5KFE A;  1JAJ A;  4YMO A;  3KHR A;  3V72 A;  1KSP A;  3UPS A;  1ZET A;  4PGQ A;  4QZI A;  9ICE A;  5J0X A;  2C2D A;  1S0N A;  1ZQN A;  4QWA A;  2DR7 A;  3M9N B;  3MR2 A;  3OHA A;  1SL0 A;  2ZHA A;  1Q79 A;  2W9B B;  5KT6 A;  4FS1 A;  1ZQF A;  2ZH5 A;  2XGQ A;  4DSJ A;  1IM4 A;  4RQ8 A;  5J2C A;  3LWL A;  4F5O A;  1S0O A;  9ICM A;  5J2D A;  1ZQP A;  1S9F A;  3LDA A;  2UVU A;  5DBA A;  1ZQE A;  2HVI A;  4DS4 A;  8ICJ A;  2BQ3 A;  1NZP A;  3BJY A;  3RJF A;  4RUA A;  2KZZ A;  5J0U A;  3AQK A;  1JXE A;  2ZHB A;  4PHE A;  4M9H A;  4ECX A;  3V6J A;  2HHV A;  3KHL A;  1SKS A;  5KFP A;  1TK0 A;  2J6U A;  3M8S A;  1L3U A;  3RRG A;  3C2L A;  5DB6 A;  1KLN A;  2IHM A;  2KZM A;  8ICL A;  1HUO A;  1SL2 A;  3Q8L A;  3ZDE A;  5CJ7 A;  4GC7 A;  4B9L A;  1KEJ A;  5KFV A;  3ISC A;  9ICS A;  3H7I A;  1UT5 A;  3EPG A;  2C28 A;  3BDP A;  4KLJ A;  2FLP A;  4NLK A;  4R63 A;  1NJW A;  1UET A;  7ICK A;  3C23 A;  1XSL A;  1XS9 D;  4UQG A;  4M5D A;  3RR8 A;  9ICP A;  2P6U A;  4Q44 A;  3ISB A;  4I2H A;  3ZD8 A;  3PX0 A;  2ZH7 A;  3Q8K A;  5KTQ A;  4J9P A;  7ICP A;  1VJ7 A;  2PFO A;  5J2H A;  1ZQX A;  3LWM A;  3V6H A;  2DRB A;  1T4G A;  3AU6 A;  3UQ0 A;  7ICI A;  2Y1I A;  1D9F A;  3HPO A;  1MQ2 A;  5J0R A;  2V9W A;  5CB1 A;  5KFF A;  4BGD A;  1X9M A;  3C2K A;  2W9M A;  1ZQQ A;  3MFH A;  4KLG A;  5KFW A;  3BQ1 A;  3RB3 A;  3WFO A;  4DQI A;  4QZA A;  3MR3 A;  3RB6 A;  1R8C A;  4UB3 A;  3MDA A;  4R65 A;  2ZJA A;  3GIM A;  1ZYQ A;  2DPJ A;  1TAQ A;  5KG1 A;  4O3S A;  2XC9 A;  3HIY A;  3B0Y A;  2ZJ8 A;  4KLE A;  1MIY A;  4RQ4 A;  2W9B A;  1DOQ A;  1BPD A;  4GLX A;  8ICU A;  5HRI A;  2WTF A;  3JZ0 A;  2JZB A;  3KHG A;  2KN7 A;  5J0P A;  2UVV A;  4EBD A;  4ECW A;  1QSL A;  4E0D A;  2BCU A;  3V7K A;  2VA3 A;  5L1J A;  2BHN A;  4ED8 A;  4E8F A;  3G6Y A;  1VFG A;  2I9G A;  4QWE A;  1X9S A;  3PML A;  4O9M A;  4F5R A;  2JEF A;  4JV2 A;  2KFZ A;  4F5P A;  1WCN A;  1SKW A;  4AT7 A;  3H37 A;  4ED1 A;  4IRD A;  8ICE A;  2ZTC A;  4X4O A;  2KTQ A;  2M2T A;  4RQ3 A;  2I1Q A;  5IIL A;  1ZQZ A;  3N97 B;  4I2J A;  5J0Q A;  3GIJ A;  4QWB A;  4I2C A;  2NRK A;  2ZUD A;  1R8A A;  8ICM A;  8ICW A;  4Z6F A;  5KFL A;  3PW4 A;  3SV3 A;  1ZQA A;  2ALZ A;  5KG4 A;  3ETL A;  3PNC A;  5J2K A;  2XCP A;  4O5E A;  1UEV A;  2PBE A;  5KFO A;  4DFK A;  2HW3 A;  4EZ9 A;  2V4R A;  4WC4 A;  5BPC A;  5HP4 A;  4O5K A;  9ICV A;  2BDP A;  4PH5 A;  4DF8 A;  5KFX A;  2FMQ A;  4FHV A;  4B9T A;  2NRT A;  1JMS A;  4UAY A;  4F4Y A;  4I2A A;  9ICX A;  2DR5 A;  4Z6E A;  3PX6 A;  3RJK A;  5EWE A;  4FH5 A;  2O5A A;  4DO9 A;  4ECR A;  4NXZ A;  4DSK A;  5DQG A;  2VA2 A;  8ICS A;  1XC9 A;  4FHY A;  2ASL A;  3ZDA A;  4M2Y A;  5DLG A;  3Q8P B;  2ISO A;  4NLG A;  3E2E A;  7ICM A;  3H38 A;  5KFK A;  5KT7 A;  3N4M B;  4I29 A;  2BPF A;  8ICO A;  8ICX A;  1L3V A;  2C2R A;  5J2B A;  4EEY A;  1TFY A;  5DDM A;  3ISD A;  9ICI A;  4IQU A;  2NRW A;  4LZD A;  4RQ7 A;  4Q8E A;  1MC8 A;  4PHP A;  5KFM A;  4YD1 A;  5KG2 A;  4J9N A;  1NKB A;  3M9O B;  3ZDC A;  3EZ5 A;  3SI8 A;  2ZJ5 A;  1S77 D;  4DQS A;  2C22 A;  2R8K A;  8ICB A;  2NRX A;  5KG5 A;  3ZD9 A;  4O0I A;  2MAX A;  4WCW A;  2NRZ A;  4WC7 A;  3HJ4 A;  2LYH A;  1T8E A;  2HVH A;  1KRP A;  4F8R A;  1XO1 A;  7ICU A;  5HRK A;  3MR5 A;  1PZN A;  4IQT A;  5L1K A;  5D46 A;  3G6V A;  2BQR A;  2BKE A;  5EWG A;  4YCX A;  1Z00 B;  5DG7 A;  1X9W A;  1ZQI A;  2ZH6 A;  5J0S A;  3OJU A;  1T7P A;  4ZH4 A;  3B0X A;  8ICC A;  9ICW A;  1IXR A;  4RPY A;  2HHQ A;  2ZH1 A;  3ZDD A;  3ORY A;  5CA7 A;  4J9S A;  1QSS A;  2BCR A;  4RWQ A;  5HML A;  1KFD A;  3GII A;  2FMP A;  3NTU A;  1RYR A;  1H38 A;  4I28 A;  2Q66 A;  4ECS A;  4P2H A;  9ICB A;  4C8L A;  1B22 A;  5KFA A;  5BOL A;  4EBE A;  1NJX A;  4IRK A;  4F91 B;  5J0T A;  4JWM A;  4GXJ A;  3QEB Z;  4JWN A;  4P4P A;  4K4H A;  1JQR A;  4QZB A;  8ICH A;  9ICF A;  4YQW A;  1EXN A;  4TUR A;  3RJE A;  1BPB A;  2JZB B;  2C2E A;  5III A;  5J2F A;  4Q45 A;  9ICN A;  2NRV A;  4RNO A;  1WOT A;  4CCH A;  4O3N A;  4F5Q A;  4I2G A;  5DDY A;  3FDS A;  9ICH A;  9ICQ A;  4WC6 A;  4X4P A;  9ICJ A;  4I2E A;  4QZH A;  2XY5 A;  3PX4 A;  3TFR A;  1ZQD A;  3ZDB A;  4DF4 A;  2Q0Z X;  1NK7 A;  2UVW A;  2W9A A;  3PVX A;  3RJG A;  3LQC B;  4AT7 B;  5D49 A;  1U45 A;  4DFP A;  2F1I A;  4NKT A;  4YR0 A;  1S76 D;  3MGH A;  5IIJ A;  2DR9 A;  4M6W A;  3OSP A;  2VAN A;  3IHQ B;  4J9M A;  4RT2 A;  4JV1 A;  1UT8 A;  9ICR A;  4UD4 A;  3SYZ A;  2ISP A;  4FBU A;  5HRB A;  5J2A A;  2XO7 A;  1BNO A;  1FA0 A;  2B21 A;  9ICG A;  5DED A;  3QE9 Y;  5KFZ A;  1Z00 A;  5KG6 A;  2DFL A;  5CWR A;  1ARO P;  4Z6C A;  8ICK A;  8ICT A;  3AU2 A;  4ATB A;  2DR8 A;  2FPM A;  3BQT A;  4ED3 A;  3RTV A;  5DKW A;  4B9N A;  5C5J A;  1QTM A;  4UBC A;  5DG8 A;  4IG8 A;  3V6K A;  2M2U A;  4KLD A;  4YN4 A;  2PFN A;  2JEJ A;  4PGX A;  3K75 D;  1S0V A;  1XU4 A;  4DSI A;  4X0B A;  2HHX A;  4M9L A;  2ZH2 A;  1LB2 B;  1ZQY A;  5KFJ A;  4YMM A;  5BOM A;  4JV0 A;  5KFS A;  3AQM A;  2H5X A;  4KIT B;  3RBE A;  4IQV A;  5DQH A;  4YVZ A;  5KFT A;  1ZQU A;  3FYH A;  4F2S A;  3EYZ A;  4X4R A;  4GC6 A;  4QZF A;  3MR6 A;  1X2I A;  3C1Z A;  3GV8 B;  2PXI A;  4EZ6 A;  8ICI A;  4G3I A;  2BE3 A;  5KT4 A;  5CR0 A;  5KT3 A;  5DG9 A;  1YLQ A;  4X4S A;  2DRA A;  4ED0 A;  4C8N A;  7ICL A;  4KLF A;  1ZQC A;  3EPI A;  3RB0 A;  2M2V A;  2M2W A;  4ECV A;  3WFQ E;  5HRH A;  5HC9 A;  4M47 A;  5DGA A;  4JK1 A;  1NK9 A;  4Q8F A;  3RH5 A;  2IHN A;  4YR3 A;  3OV7 A;  4KLM A;  3WFR E;  1BPZ A;  4E7X A;  3NGD A;  2XY7 A;  7ICT A;  4E80 A;  3AUO A;  3UXP A;  1NK5 A;  1C7Y A;  4DL3 A;  2FLL A;  1MIV A;  4RWO A;  1A77 A;  1BVS A;  5DB8 A;  4DL5 A;  3OVS A;  4MEX A;  3TAN A;  1CUK A;  4RNN A;  3JPN A;  3G6X A;  5DBC A;  3T5J A;  4DL7 A;  4M9N A;  8ICF A;  3C1Y A;  1JN3 A;  4UB1 A;  2MUT B;  4KLL A;  2FPK A;  4QZC A;  4KLT A;  9ICO A;  4NLZ A;  4B9U A;  1Q78 A;  4K4I A;  5IIK A;  2PFP A;  4F50 A;  4B9S A;  3H8J A;  1JXL A;  1BNP A;  9ICL A;  1SL1 A;  4FBT A;  1RPL A;  3PW0 A;  4IR1 A;  1JX4 A;  1S10 A;  4YXJ A;  4DL2 A;  4DSF A;  2ASD A;  3IM1 A;  3PW5 A;  1UEU A;  2IMW P;  1NK0 A;  4DQR A;  5KFD A;  3Q8S B;  4EYH B;  1D8Y A;  3PO5 A;  5DEC A;  4EBK A;  3HX0 A;  1ZJN A;  4QW9 A;  1ZQR A;  8ICY A;  3MAB A;  2AU0 A;  1KNY A;  4ECQ A;  2W8L A;  2AJQ A;  1U48 A;  3Q8Q B;  4C8O A;  2AGQ A;  4F4W A;  3KTQ A;  8ICA A;  4F4Z A;  4I2F A;  2AGO A;  1NK4 A;  1L3T A;  4UB4 A;  4FHX A;  1A76 A;  1R89 A;  4KTQ A;  2BCV A;  2BR0 A;  2ZTE A;  3OUY B;  4M6W B;  4ECY A;  4DSL A;  4UAZ A;  2HHU A;  1U9L A;  3SZ2 A;  1NKE A;  1MQ3 A;  1KTQ A;  4P4O A;  4IRC A;  4DL4 A;  4BXO B;  7ICO A;  3PR4 A;  1BPY A;  2RDI A;  5DLF A;  4WC2 A;  2ZH9 A;  1XSP A;  1XSN A;  4NY8 A;  3RAQ A;  3AQN A;  4YMN A;  4TQR A;  4ECU A;  3EW9 A;  4I27 A;  1DK2 A;  3JPS A;  2ID1 A;  5IIN A;  2W9C A;  3EWA A;  8ICZ A;  2HHS A;  2R8J A;  4DSE A;  3BQ2 A;  3Q8M A;  4YFK A;  4X5V A;  8ICP A;  2FLN A;  3GIK A;  3RAX A;  1U47 A;  1JIH A;  4UBB A;  2ASJ A;  5CP2 A;  4PGY A;  3H8S A;  5KG0 A;  1Z3E B;  1XWL A;  5L9X A;  2MUT A;  5KFI A;  4LVS A;  4O3R A;  5KFH A;  2PI4 A;  4F92 B;  4PHA A;  1NK8 A;  1ZQS A;  3V7J A;  1RXW A;  4B9V A;  3RH6 A;  3WFS C;  1ZQW A;  4BWM A;  4FH3 A;  4O3O A;  4UB5 A;  1N48 A;  4ELT A;  4PHD A;  5IIM A;  4BDP A;  4RPX A;  2ZH3 A;  3Q8R B;  2OWO A;  4QZG A;  4RT3 A;  3TAQ A;  1NO5 A;  5KT2 A;  4BWJ A;  1ZQG A;  5KT5 A;  3C2M A;  3UPQ A;  4EBC A;  1NKC A;  1ZQB A;  4C8M A;  4QZ9 A;  1U4B A;  4PPX A;  2M9N A;  3GFK B;  4DOC A;  4DQQ A;  4UB2 A;  4M0A A;  4X4U A;  1DGS A;  4QWC A;  1ZQT A;  1T3N A;  9ICK A;  8ICG A;  4KLS A;  4F4K A;  1D9D A;  4B9M A;  3WFP A;  5L1I A;  5KFB A;  3JPO A;  3UXN A;  3JYY A;  2DPI A;  3PR5 B;  3OUY A;  4RUC A;  4FHP A;  5F9N A;  3PW2 A;  2KFN A;  3THV A;  5KFQ A;  4S3N A;  1WCL A;  1F5A A;  4RQ5 A;  3OHB A;  4BXO A;  4GXI A;  4RWP A;  5DQI A;  3H8W A;  2AGP A;  2AQ4 A;  4ECT A;  3PW7 A;  2P66 A;  4WBY A;  1TFR A;  2A1J B;  5KFY A;  5HHI A;  5J0O A;  1DK3 A;  1N56 A;  4X4Q A;  4QZD A;  4J9K A;  1RXV A;  1OU5 A;  2J6T A;  4DL6 A;  3GV7 B;  3L9D A;  4DOB A;  2UVR A;  1K1S A;  3GV5 B;  4F5N A;  3M8R A;  1U49 A;  4FHW A;  1ZQV A; 
#chains in the Genus database with same CATH topology
 3HWT A;  7ICH A;  4ELU A;  2IBK A;  2EZZ A;  5HHH A;  5HRE A;  4XJE A;  4HYK A;  4YP3 A;  4F2R A;  2WF9 A;  1L5U A;  1MSW D;  2XVT A;  7ICE A;  5IIO A;  4RNM A;  4ED2 A;  5ALT A;  3T3F A;  3WK8 A;  5J2E A;  4DEZ A;  3C28 A;  2HHW A;  4OD0 A;  4OAG A;  5EE0 A;  1QCK A;  2FMS A;  4IR9 A;  3L3F X;  4QWD A;  7ICN A;  7ICR A;  4AT9 B;  4LZG A;  4MHV A;  4O3P A;  3PV8 A;  2F1H A;  3JPT A;  2W9C B;  2HBJ A;  2KIC A;  3KHH A;  2YMQ A;  4ELV A;  1TV9 A;  5TZV A;  4F4X A;  2IHO A;  2EH9 A;  5HRG A;  3C5F A;  3OGU A;  3NKU A;  4FZL A;  1B43 A;  1AQ6 A;  2HN2 A;  2RDJ A;  2KHV A;  4F93 B;  3M7D A;  4G9B A;  2R8H A;  1ZQM A;  3K4G A;  1TVA A;  3RJH A;  1COK A;  1IIP A;  5HRL A;  3VC8 A;  8ICV A;  5AKY A;  2HBK A;  2R8I A;  7ICF A;  4AT8 A;  3UXO A;  4OJ6 A;  5J0Y A;  2ZUB A;  2BGW A;  4TUP A;  2GWS A;  5J2G A;  5DB9 A;  5ALP A;  3RR7 A;  4RQ1 A;  4MF8 A;  1SV0 A;  1ZD5 A;  3OTQ A;  2VJ5 A;  3TFS A;  4MEY A;  1QLN A;  3C18 A;  4CF5 A;  2OEH A;  4YG2 A;  3H4B A;  3F5A A;  1MA7 A;  1S0M A;  4DQP A;  2HHT A;  4WC1 A;  4UAV A;  3RH4 A;  4DLG A;  2ZH8 A;  3UMG A;  2XGP A;  7ICG A;  5DB7 A;  1X9X A;  1LV5 A;  4RQ0 A;  5CRX A;  5AI4 A;  5B5E U;  3NWI A;  2XCA A;  4FS2 A;  2CXY A;  3TKA A;  1BPE A;  4J9R A;  3T5K A;  4M9G A;  4R8U A;  3JPR A;  2ZIU A;  8ICR A;  4O3Q A;  4EX7 A;  2O1P A;  1JAJ A;  4U7C A;  1KSP A;  4QZI A;  5AKI A;  1S0N A;  1SL0 A;  4FS1 A;  1ZD3 A;  5J2C A;  3LWL A;  3JCF A;  9ICM A;  2UVU A;  5DBA A;  4DS4 A;  3NRZ A;  2WAQ C;  4RUA A;  3T79 A;  1UPH A;  4M9H A;  4JLZ A;  3QU7 A;  1SKS A;  4N7R A;  2IHM A;  5ALL A;  5DB6 A;  2KZM A;  9ICS A;  1KEJ A;  4R63 A;  7ICK A;  3CRX A;  3ZD8 A;  4LEW A;  5KTQ A;  2PFO A;  1C20 A;  4QIW C;  2CN1 A;  3C2K A;  1ZQQ A;  5KFW A;  2E8P A;  3BQ1 A;  3MR3 A;  4UB3 A;  3GIM A;  2ZJA A;  2ZJ8 A;  4KLE A;  4RQ4 A;  2W9B A;  2QAR A;  4GLX A;  8ICU A;  3JZ0 A;  2K4H A;  5J0P A;  2W55 A;  2BCU A;  3V7K A;  2VA3 A;  5L1J A;  4UAR A;  1VFG A;  2I9G A;  1X9S A;  3PML A;  5ALW A;  4F5R A;  3H37 A;  1V85 A;  4ED1 A;  2ZTC A;  5IIL A;  1ZQZ A;  4NXX A;  2NRK A;  3AQF A;  2ZIU B;  1ECW A;  3OPX A;  4I2C A;  1R8A A;  5KG4 A;  3WFP A;  2FJ6 A;  4NJ8 A;  4O5K A;  2BDP A;  2WFA A;  3D2N A;  2NRT A;  4F4Y A;  3KZX A;  4FH5 A;  2O5A A;  5DQG A;  3ZDA A;  1N61 A;  3NVW A;  4NLG A;  5AKH A;  3QU2 A;  1YZ7 A;  1PVQ A;  4IQU A;  5AI9 A;  4Q8E A;  4YD1 A;  3KD3 A;  3M9O B;  3ZDC A;  4O6A A;  4DQS A;  2NRX A;  5KG5 A;  4EV6 A;  1JRP A;  4WC7 A;  4EEN A;  4F8R A;  1XO1 A;  5HRK A;  5L1K A;  1PZN A;  4IQT A;  2VA2 A;  3G6V A;  4YCX A;  5DG7 A;  2OH2 A;  4ZH4 A;  2LMR A;  1IXR A;  2ZXI A;  3SEI A;  5CA7 A;  4J9S A;  4RWQ A;  5HML A;  2WF5 A;  2Q66 A;  5ALY A;  4NLB A;  9ICB A;  1B22 A;  1NJX A;  4EBE A;  4IRK A;  3H8M A;  5J0T A;  4K4H A;  1A6S A;  8ICH A;  4Q45 A;  1FEZ A;  3ER9 B;  4CCH A;  4I2G A;  3FDS A;  3PZP A;  3MCR A;  3PX4 A;  3ZDB A;  3RJG A;  4DF4 A;  4DFP A;  2F1I A;  5IIJ A;  3OSP A;  2YTU A;  5HR6 A;  5DED A;  2B21 A;  4CDG A;  5CWR A;  4Z6C A;  8ICT A;  4EEB A;  4ED3 A;  3RTV A;  4B9N A;  2F3N A;  3V6K A;  3ONN A;  4ACO A;  2VJ4 A;  3WK4 A;  2HHX A;  5AK3 A;  1ZQY A;  2KKP A;  3AQM A;  2HN1 A;  4KIT B;  2H5X A;  1RM6 C;  1JAL A;  5ALK A;  2KKV A;  4X4R A;  4CE6 A;  1X2I A;  1IG6 A;  4EZ6 A;  3K1Z A;  4G3I A;  5CR0 A;  5KT3 A;  2DRA A;  2G07 A;  4C8N A;  1ZQC A;  3EPI A;  3WFQ E;  2ES6 A;  2QKQ A;  5HRH A;  2ZIW B;  1NK9 A;  3A0B U;  1UCV A;  4NL9 C;  2FLL A;  1MIV A;  4FZN A;  1A77 A;  4LEV A;  4F71 A;  4MEX A;  4M9N A;  2OYY A;  1KW4 A;  4UB1 A;  3F2D A;  3PSP A;  5IIK A;  3HIL A;  4JMU A;  3H8J A;  5T14 A;  3PW0 A;  2GAF D;  3CYM A;  2LM1 A;  5DEC A;  1PK1 B;  1ZD2 P;  3QX7 A;  8ICY A;  5L1M A;  3ZI4 A;  2Y0S F;  4ECQ A;  3Q8Q B;  2F2A B;  3WU2 U;  2AGO A;  1L3T A;  3SAH A;  4UB4 A;  4KTQ A;  1L7P A;  2BR0 A;  5AM0 A;  4DSL A;  1U9L A;  5J8Y C;  1KTQ A;  3PR4 A;  2RDI A;  4ECU A;  1KQQ A;  2ID1 A;  2CPR A;  3EWA A;  3B9J A;  4DSE A;  3Q8M A;  4X5V A;  8ICP A;  5JU5 A;  2ODG A;  3I76 A;  1Z1B A;  4CF3 A;  3AMZ A;  2K89 A;  5KFH A;  4PHA A;  1NK8 A;  3D6J A;  3RH6 A;  4WJ3 B;  5G5H A;  4JLX A;  4UB5 A;  4EGW A;  2ZH3 A;  3GZF A;  4RT3 A;  3KKA A;  3C2M A;  3PSF A;  4C8M A;  2G0A A;  4DOC A;  4X4U A;  1DGS A;  4B9M A;  4FHP A;  5F9N A;  3PW2 A;  2DBY A;  2WB1 F;  4C7Y A;  2KIW A;  1JI7 A;  4RWP A;  2AQ4 A;  2P66 A;  1DK3 A;  4Y2Q A;  5HHI A;  5J0O A;  1OU5 A;  1RXV A;  2XI9 A;  2J6T A;  3L9D A;  1K1S A;  2DPJ A;  3TQ1 A;  5AIC A;  4K98 A;  4WBZ A;  3C21 A;  2R8G A;  5TIS U;  3TAD C;  2W8K A;  3TI0 A;  2WHE A;  3GU3 A;  4RQ6 A;  3J81 j;  4PL1 A;  3CW2 C;  3TAR A;  3UMC A;  5AM1 A;  2WAQ F;  4TUS A;  4NXV A;  4QZ8 A;  1TAU A;  5F2V O;  2XID A;  4P4M A;  4DFD A;  3BQ0 A;  9ICC A;  2BBH A;  4F3O A;  4YR2 A;  3FAH A;  3T5H A;  2N1R A;  2LM4 A;  5AI8 A;  3M9M B;  7ICV A;  4YXM A;  8ICQ A;  5AK6 A;  2DQN B;  3LK9 A;  2LHT A;  4M9J A;  4WC3 A;  4BJQ A;  3MBY A;  3NYB A;  2LPE A;  4I2B A;  2KJ5 A;  5AKG A;  4QZE A;  1KN5 A;  2W43 A;  4ED7 A;  1KFS A;  3ER8 C;  4MF2 A;  1XO0 A;  4X0A A;  3GDX A;  2PFQ A;  5L1L A;  1ZJM A;  4Q43 A;  3DEE A;  3H4D A;  2BCQ A;  5F9L A;  3RRH A;  2YML A;  2RHF A;  1WG8 A;  2NO4 A;  4X4N A;  5J29 A;  1TFW A;  2F1J A;  1S97 A;  3QZ7 A;  4FZM A;  5G5G A;  3IG5 A;  1V4A A;  2P6R A;  1HUZ A;  4AT9 A;  5DGB A;  3HKZ C;  5KFN A;  2I6X A;  1ZQO A;  1WWV A;  2BPC A;  3H0R B;  1V9P A;  4C4T A;  1UA1 A;  4KLI A;  4F72 A;  2E1E A;  1Z1V A;  5EE9 A;  3HT3 A;  1SXE A;  2V4Q A;  4Z6D A;  1DXS A;  3GQC A;  3JPP A;  1ZRM A;  2BBJ A;  3SAG A;  1ZQJ A;  1MIW A;  5KG3 A;  5J2J A;  5J0W A;  3RB4 A;  4R66 A;  3OVA A;  2EAM A;  4QW8 A;  5KFC A;  2IA6 A;  4IG8 A;  5DBB A;  4NLN A;  4EBK A;  4I2D A;  3MDC A;  2B0C A;  4CGZ A;  4AP9 A;  2E3T A;  3QU5 A;  1ZET A;  4PGQ A;  3UPS A;  1ZQN A;  4QWA A;  2GOL A;  3M9N B;  2DR7 A;  1ZQF A;  2ZH5 A;  4K96 A;  4RQ8 A;  2G5I B;  4F5O A;  1ZQP A;  3LDA A;  5ALJ A;  3F2B A;  3AQK A;  4PHE A;  5KNI A;  2HHV A;  1JUD A;  2J6U A;  3RRG A;  1KNY A;  1Z4O A;  2A3V A;  3ZDE A;  4GC7 A;  5KFV A;  3DDH A;  3H7I A;  3EPG A;  5CHE A;  1XSL A;  4M5D A;  4UQG A;  9ICP A;  4I2H A;  1Z19 A;  3PX0 A;  5J2H A;  2DRB A;  1T4G A;  3AU6 A;  3UQ0 A;  1D9F A;  1MQ2 A;  5KFF A;  2W9M A;  4KLG A;  5ALS A;  3WFO A;  2DUY A;  4PL2 A;  3MDA A;  2RRD A;  3U26 A;  2P35 A;  4O3S A;  1QQ6 A;  3B0Y A;  5AK5 A;  1CRX A;  4LJX A;  4B6J A;  3KHG A;  4Y2J A;  2KN7 A;  4ECW A;  5EE1 A;  4E0D A;  2ZG6 A;  5B3Q A;  3G6Y A;  3AM9 A;  2K4I A;  2JEF A;  8ICE A;  4X4O A;  2KTQ A;  2M2T A;  4BX9 C;  5ALM A;  2I1Q A;  4RQ3 A;  3N97 B;  4I2J A;  3ED5 A;  4QWB A;  1Z4N A;  3F5E A;  4KM5 A;  4Z6F A;  2ALZ A;  3UMB A;  2FE9 A;  3ETL A;  5J2K A;  1UEV A;  4O5E A;  5KFO A;  3E58 A;  1QQ5 A;  4K9A A;  2KVS A;  2MU2 A;  2HDO A;  5BPC A;  5HP4 A;  4PH5 A;  2LYA A;  1GPJ A;  1JMS A;  2GH1 A;  3M6Z A;  3RJK A;  4KB6 A;  4EX6 A;  5EWE A;  2L5Y A;  8ICS A;  1XC9 A;  7ICM A;  5ALU A;  8ICO A;  3WK5 A;  2BPF A;  3PST A;  2C2R A;  5J2B A;  4EEY A;  2MRL A;  9ICI A;  5KFM A;  1SZH A;  4J9N A;  2ZXH A;  3SI8 A;  2ZJ5 A;  2C22 A;  2R8K A;  2KIV A;  8ICB A;  3ZD9 A;  4WCW A;  4OJO A;  1T8E A;  2HVH A;  4NV0 A;  2H3Z A;  3F2C A;  2BQR A;  5D46 A;  2ZH6 A;  4O3M A;  2BKE A;  2KK0 A;  1Z00 B;  5ALD A;  8ICC A;  1O03 A;  3BQ7 A;  3CNH A;  3D2S A;  1URJ A;  3NTU A;  1RYR A;  1H38 A;  4P2H A;  5KFA A;  5BOL A;  2B51 A;  4JWM A;  2A1A A;  4JWN A;  2PMZ C;  2ZIV A;  4YQW A;  4TUR A;  3RJE A;  5J2F A;  2DGZ A;  2HMX A;  4O3N A;  9ICH A;  9ICJ A;  4I2E A;  3TFR A;  1ZQD A;  4Y2U A;  4KMO B;  2UVW A;  2DKZ A;  5D49 A;  2KD1 A;  4NKT A;  2RLT A;  2HI0 A;  1J2M A;  3BZC A;  1LVH A;  4JB3 A;  3IHQ B;  2JMG A;  3SYZ A;  4FBU A;  5HRB A;  2BDU A;  4C4R A;  3KBB A;  5KFZ A;  5KG6 A;  1ARO P;  4Y2T A;  1QTM A;  4UBC A;  3HJE A;  2M2U A;  2JEJ A;  3K75 D;  2M0N A;  4X0B A;  4M9L A;  2EAN A;  1LB2 B;  5KFJ A;  2H3F A;  5AIB A;  5ALN A;  4JV0 A;  2EQY A;  3A0H U;  3RBE A;  4IQV A;  4YVZ A;  3FYH A;  4F2S A;  5CFS A;  1JRO A;  3MR6 A;  3E0F A;  3SAF A;  2PXI A;  8ICI A;  2G09 A;  4KLF A;  5B3P A;  5AM2 A;  1A0P A;  4UAT A;  3KOO A;  1SGG A;  2LYB A;  3RH5 A;  4Q8F A;  3OV7 A;  2AH5 A;  4KLM A;  3WFR E;  4E7X A;  3NGD A;  4E80 A;  3UXP A;  2YMP A;  1VLB A;  3I28 A;  1RYU A;  1ZOL A;  4QZC A;  9ICO A;  1Q78 A;  3K7D A;  4B9S A;  4Y2P A;  1BNP A;  9ICL A;  1SL1 A;  4FBT A;  1JX4 A;  1S10 A;  4DL2 A;  1XNS A;  3IM1 A;  1UEU A;  2OXO A;  2ZIV B;  5AI5 A;  3Q8S B;  4QW9 A;  1ZQR A;  2AU0 A;  2W8L A;  1M6Y A;  4F4Z A;  1NK4 A;  2DL0 A;  4FHX A;  3VCB A;  2YY6 A;  2ZTE A;  3OUY B;  1FFU A;  1KL9 A;  4PZO A;  4KX5 A;  5AIA A;  5ALX A;  3SZ2 A;  4P4O A;  5AK4 A;  4IRC A;  2ZIW A;  1BPY A;  3WKB A;  4O67 A;  5AM4 A;  4USA A;  3RAQ A;  1ZQV A;  2G5H B;  1NNL A;  1YZ6 A;  2Q4T A;  1F5S A;  3AQE A;  4C7Z A;  5IIN A;  2E8M A;  1U47 A;  1JIH A;  4UBB A;  2ASJ A;  3H8S A;  3NVZ A;  3QYP A;  5L9X A;  4O3R A;  2PI4 A;  2ZIX B;  1ZQS A;  4RQN A;  1MN8 A;  3IN5 A;  1DGJ A;  1RXW A;  4I0U A;  2H3V A;  4PHD A;  4BDP A;  1PK1 A;  4J03 A;  4QZG A;  5AKL A;  1NO5 A;  5KT2 A;  4BWJ A;  2EZX A;  1ZQG A;  1S5L U;  1ZQB A;  3UPQ A;  3GFK B;  2K4P A;  4UB2 A;  5B66 U;  3R9K A;  4KLS A;  1D9D A;  3JPO A;  2DPI A;  2VIX A;  3TAC B;  4P0P B;  4RQ5 A;  1VJ5 A;  4WBY A;  2A1J B;  5KFY A;  4J9K A;  4NL9 A;  1QSL A;  3M8R A;  2WF7 A;  2H3Q A;  4Y2Y A;  4C80 A;  1QSY A;  3RBD A;  1BGX T;  3EF2 A;  4DWI A;  1K1Q A;  4U6P A;  1N63 A;  1B0X A;  2KE7 A;  4J9Q A;  3RJI A;  4RQ2 A;  1N5X A;  4ED6 A;  2KHQ A;  2FPL A;  2HHP A;  3F53 A;  4CRX A;  4XA5 A;  2EAO A;  5D4B A;  5E79 U;  2E5S A;  4DOA A;  2LBO A;  3TAP A;  1R8B A;  3H3A A;  2D3D A;  4DLE A;  3MC1 A;  2W54 A;  2H3I A;  3T5L A;  5D62 A;  4KN7 A;  5EOZ A;  3QUT A;  4OO1 J;  2JHD A;  5HRD A;  4MFC A;  3UQ2 A;  2EAP A;  4OJL A;  3SEN A;  5AKJ A;  1SIJ A;  1J97 A;  1TK5 A;  9ICU A;  4K97 A;  3H0M B;  3HW8 A;  4LT6 A;  4K9B A;  5KFR A;  3H40 A;  4DFJ A;  5EE3 A;  3HP6 A;  5KFU A;  1Y88 A;  2ATL A;  4Y2X A;  4X4T A;  2EDU A;  4WC0 A;  3FM9 A;  1P7D A;  2GO7 A;  1RZT A;  7ICJ A;  4RU9 A;  1Q46 A;  4KLH A;  3GIL A;  9ICA A;  4RWN A;  1OUQ A;  3JPQ A;  3C5G A;  5ALR A;  1ZQL A;  1TE2 A;  4KMU A;  1SKR A;  4WH5 A;  8ICN A;  5AKE A;  4J9L A;  3QXG A;  4O68 A;  3PO4 A;  4KX3 A;  1K5O A;  4ATB B;  1KDH A;  4M04 A;  4UAS A;  3N28 A;  4UW9 A;  2BPG A;  1NJZ A;  1L3S A;  4JUZ A;  5EWF A;  2Y1J A;  4YD2 A;  1COO A;  4TUQ A;  1BPX A;  4XQ7 A;  1X6I A;  2F8L A;  1V97 A;  4WC5 A;  2K8A A;  5KFE A;  1X42 A;  2EZY A;  9ICE A;  5FP0 A;  1WYG A;  3OHA A;  2ZHA A;  2HOQ A;  5GTI U;  5KT6 A;  4DSJ A;  2KV2 A;  2DWQ A;  5ALI A;  1ZQE A;  2HVI A;  8ICJ A;  2KZZ A;  4EEK A;  4ECX A;  3M8S A;  2G06 A;  5A0L A;  1SL2 A;  3Q8L A;  2B4V A;  3ISC A;  2CRX A;  3BDP A;  4KLJ A;  2FLP A;  4NLK A;  1NJW A;  1UET A;  3C23 A;  1XS9 D;  3QUC A;  2Y9T A;  3RR8 A;  2P6U A;  3ISB A;  4K99 A;  1PK3 A;  2ZH7 A;  4J9P A;  1VJ7 A;  4P0Q B;  1ZQX A;  2LKY A;  7ICI A;  2Y1I A;  2RP5 A;  3HPO A;  5J0R A;  5CB1 A;  4US8 A;  3O0F A;  3RB3 A;  4DQI A;  1R8C A;  1N2X A;  4R65 A;  1F44 A;  5JTG A;  2XC9 A;  2W11 A;  3HIY A;  5HR7 A;  4FO1 A;  1DOQ A;  2W04 A;  5HRI A;  1Q8K A;  1X66 A;  2KSO A;  4QIW F;  3RFA A;  2BHN A;  3BS5 B;  3EUB 2;  1PVR A;  2A19 A;  2KFZ A;  1WCN A;  4AT7 A;  1ZD4 A;  2KNJ A;  5J0Q A;  5CFU A;  2ZUD A;  8ICM A;  8ICW A;  5KFL A;  3PW4 A;  2XCP A;  3PNC A;  2PBE A;  4DFK A;  2HW3 A;  2GLE A;  4EZ9 A;  4WC4 A;  5ALV A;  4DF8 A;  4B9T A;  4UAY A;  9ICX A;  4Z6E A;  3PX6 A;  3BS7 A;  4DO9 A;  4ECR A;  4NXZ A;  4DSK A;  1WUD A;  4M2Y A;  3E2E A;  2ISO A;  5KFK A;  5KT7 A;  4BUG A;  4I29 A;  8ICX A;  3QNM A;  4QJF B;  1TFY A;  5ALO A;  5DDM A;  4RQ7 A;  1MC8 A;  5KG2 A;  1NKB A;  3EZ5 A;  5AHX A;  1OW5 A;  1S77 D;  1N5W A;  4O0I A;  2MAX A;  2NRZ A;  3HJ4 A;  2LYH A;  3L4P A;  2D6F C;  1D8B A;  1KRP A;  3ETR A;  3MR5 A;  4JV2 A;  1X9W A;  5EWG A;  4IC9 A;  9ICW A;  4QNL A;  3ZDD A;  3ORY A;  4EEL A;  2K8B B;  1GO3 F;  2BCR A;  1KFD A;  3GII A;  5AKZ A;  2FMP A;  4I28 A;  2RQ5 A;  3HRD D;  4GXJ A;  3QEB Z;  2JH7 A;  4QZB A;  1RG6 A;  2WF6 A;  9ICN A;  2KSO B;  1WOT A;  4F5Q A;  4X4P A;  4WC6 A;  9ICQ A;  4C4S A;  3NUQ A;  2XY5 A;  3LQC B;  2Q0Z X;  4AT7 B;  1U45 A;  4YR0 A;  3MGH A;  4M6W A;  2QB1 A;  2VAN A;  4J9M A;  9ICR A;  4JV1 A;  1UT8 A;  4UD4 A;  2ISP A;  2XO7 A;  2FCL A;  9ICG A;  1SV4 A;  3WKA A;  1Z00 A;  3AU2 A;  1T3Q A;  2DKX A;  2DR8 A;  2FPM A;  3WKE A;  3M6K A;  5C5J A;  4CNQ A;  1ZXI A;  5ALZ A;  4YN4 A;  2PFN A;  4OAF A;  1LKY B;  4DSI A;  4Y2S A;  1SWV A;  5KFT A;  3PSI A;  4GC6 A;  4WQK A;  2AHO B;  3C1Z A;  2MA1 A;  5AKX A;  5KT4 A;  5DG9 A;  4ED0 A;  2PKE A;  7ICL A;  3RB0 A;  5ALG A;  4ECV A;  4Y2R A;  2YMM A;  4M47 A;  5KAF U;  4K8V A;  5DGA A;  4JK1 A;  3ERC C;  2IHN A;  4YR3 A;  1QH9 A;  3AUO A;  1C7Y A;  4DL3 A;  4RWO A;  1BVS A;  3OVS A;  3N7R C;  3TAN A;  4RNN A;  3JPN A;  3T5J A;  5DBC A;  1RQL A;  2Y0S C;  5KAI U;  2MUT B;  3LYS A;  4F50 A;  1QQ7 A;  1JXL A;  5CFT A;  3KFU F;  4IR1 A;  4YXJ A;  4DSF A;  3PW5 A;  3IV6 A;  5JTI A;  2IMW P;  2IUB A;  1NK0 A;  1F0M A;  1D8Y A;  4PZN A;  3HX0 A;  1UHU A;  1ZJN A;  3MAB A;  2IOF A;  5H2F U;  2AGQ A;  4F4W A;  8ICA A;  2E8O A;  4I2F A;  3KZI U;  1R89 A;  3RF9 A;  3NVO A;  4M6W B;  2K8C B;  1NKE A;  1MQ3 A;  4WQL A;  4BXO B;  7ICO A;  1N62 A;  1RDF A;  5DLF A;  3NRW A;  1XSN A;  4OJ5 A;  2HBL A;  3AQN A;  2W03 A;  4YMN A;  4I27 A;  8ICZ A;  2FLN A;  3RAX A;  5CP2 A;  1SWW A;  4AYB C;  5KG0 A;  4GFJ A;  5KFI A;  4HAI A;  4F92 B;  3V7J A;  2JH1 A;  5JRT A;  4B9V A;  3WFS C;  4BWM A;  4FH3 A;  4ELT A;  3MGV A;  2WB1 C;  2OWO A;  1KKX A;  2IOH A;  2KVC A;  5KT5 A;  4EBC A;  1U4B A;  1SV0 C;  1V38 A;  4DQQ A;  4M0A A;  4QWC A;  8ICG A;  5L1I A;  5KFB A;  2QLT A;  3JYY A;  3OUY A;  1UQV A;  2KFN A;  3QU9 A;  5KFQ A;  1F5A A;  4GXI A;  5DQI A;  3H8W A;  2AGP A;  1T94 A;  4ECT A;  3IP4 B;  2EWR A;  4UB6 U;  1N56 A;  5GTH U;  4X4Q A;  4QZD A;  4DL6 A;  4DOB A;  1U49 A;  3GV5 B;  4C0Z A;  2NV3 A;  1J2N A;  3H0L B;  4K4G A;  2BQU A;  2ZIX A;  2W7P A;  4TQS A;  2KOB A;  4AT8 B;  2XY6 A;  5J2I A;  2G08 A;  2RFF A;  1L7N A;  5HMM A;  2KP7 A;  3RJJ A;  1PUZ A;  5JUM A;  2KZ3 A;  4XQ8 A;  1RYS A;  4C8K A;  2HOI A;  5HRF A;  1D8L A;  4RZR A;  3OWG A;  1SZP A;  4DS5 A;  4KLO A;  5KG7 A;  2K60 A;  5HR9 A;  1L7O A;  2PI5 A;  3QEA Z;  5HNK A;  4NKU A;  1KFT A;  3PMN A;  1HEK A;  1CEZ A;  2E1F A;  4UD5 A;  1HJP A;  3SV4 A;  4OJP A;  4GIB A;  3V7L A;  5AM3 A;  4P0P A;  7ICQ A;  3OSN A;  5CHG A;  4KN4 A;  2DVI A;  2JEI A;  4EYI B;  4MFA A;  2A1J A;  3OVB A;  2YB1 A;  2QB0 A;  3QZ8 A;  1ZQH A;  1NK6 A;  3M1Y A;  4DFM A;  4X4V A;  1FO4 A;  3LVV A;  4J9O A;  4NM1 A;  3AQL A;  4EBJ A;  4GXK A;  3C66 A;  4R8U B;  1L8O A;  1NJY A;  1X40 A;  4XUS A;  4NM2 A;  4ICA A;  4XRH A;  4EP7 A;  2OM6 A;  4UAW A;  1UA0 A;  4O5C A;  1ZQK A;  2YX8 A;  3AL0 B;  1ZQ1 C;  4MFF A;  2KMD A;  3WK6 A;  1KBU A;  4ECZ A;  3WKC A;  3PY8 A;  3CK6 A;  2NO5 A;  1NOM A;  2F44 A;  2ZTD A;  2YQE A;  1N60 A;  4FO6 A;  4IQW A;  2KG5 A;  4I2I A;  2VA8 A;  2WF8 A;  2JR5 A;  4KLU A;  4NXU A;  2ZH4 A;  2K4E A;  5KL8 B;  1L8L A;  3HJ1 A;  3QU4 A;  3HKZ F;  1TKD A;  2OHF A;  5KFG A;  7ICS A;  2AQ0 A;  2ZUC A;  3NAS A;  4KLQ A;  1PX5 A;  2HBM A;  2ZH2 A;  1TK8 A;  2JEG A;  1X6J A;  3MFI A;  2J6S A;  4UB8 U;  2BCS A;  4RPZ A;  4R64 A;  2IOF K;  3AEV A;  9ICT A;  3OJS A;  3MGI A;  2HCF A;  4YMO A;  3KHR A;  3V72 A;  5J0X A;  2C2D A;  3MR2 A;  1Q79 A;  2W9B B;  2Z7J A;  2QAR B;  4NWI A;  2XGQ A;  1IM4 A;  1S0O A;  5J2D A;  4ZOH C;  1S9F A;  2QB0 B;  2KEY A;  2BQ3 A;  1NZP A;  3BJY A;  3RJF A;  5J0U A;  1JXE A;  2ZHB A;  3V6J A;  2W3R A;  4NXT A;  3KHL A;  5KFP A;  1TK0 A;  1L3U A;  3C2L A;  8ICL A;  1KLN A;  4MKP A;  1HUO A;  2F76 X;  4B9L A;  5CJ7 A;  4DCC A;  4UAU A;  4ATB A;  1UT5 A;  2C28 A;  1TAM A;  2ESE A;  4Q44 A;  3ICX A;  3Q8K A;  7ICP A;  3V6H A;  3LWM A;  4IS7 A;  5ALH A;  2V9W A;  1S8O A;  4BGD A;  1X9M A;  3MFH A;  4QZA A;  3RB6 A;  5ALF A;  1ZYQ A;  1TAQ A;  5KG1 A;  1MIY A;  3WK9 A;  1O08 A;  4A8E A;  5J8Y A;  1BPD A;  2WTF A;  2JZB A;  4NXW A;  3IRU A;  2UVV A;  4EBD A;  2DF4 B;  4ED8 A;  4E8F A;  3NVY A;  4QWE A;  4FE3 A;  4O9M A;  4F5P A;  1SKW A;  1FFV A;  4IRD A;  2XIC A;  2KJ8 A;  3GIJ A;  2FDR A;  1ZQA A;  3SV3 A;  5AI6 A;  3SR6 A;  4OAH A;  2V4R A;  4FHV A;  9ICV A;  2FMQ A;  5KFX A;  3N7S C;  4P0Q A;  4I2A A;  2DR5 A;  1PVP A;  2JXJ A;  4FHY A;  2AXT U;  2ASL A;  5DLG A;  3Q8P B;  5D61 A;  4WOY A;  3H38 A;  3ALR A;  3N4M B;  5K4L A;  3K1R B;  1Q3U A;  1WWU A;  1L3V A;  3I1Y A;  3FC4 A;  3ISD A;  2NRW A;  4LZD A;  4PHP A;  3PHZ A;  2YN4 A;  1ED1 A;  1SXD A;  4OAI Z;  3CP8 A;  2O6K A;  3BS5 A;  2R18 A;  7ICU A;  1ZQI A;  5J0S A;  3OJU A;  2LI6 A;  1T7P A;  3NVV A;  3B0X A;  2HHQ A;  4RPY A;  2ZH1 A;  1B4F A;  3TAD A;  1QSS A;  4IL6 U;  1IV8 A;  4ECS A;  4C8L A;  2KJ9 A;  1NZB A;  4F91 B;  3C29 A;  1JQR A;  4US9 A;  4P4P A;  2F8K A;  3IDW A;  9ICF A;  1EXN A;  1BPB A;  2JZB B;  2C2E A;  5III A;  2NRV A;  4RNO A;  4AYB F;  5DDY A;  4PJ0 U;  2HSZ A;  4QZH A;  1YT3 A;  3L5K A;  1NK7 A;  2W9A A;  3PVX A;  2PMZ F;  4O69 A;  2YB4 A;  1S76 D;  2DR9 A;  4LEZ A;  4RT2 A;  1L6N A;  1Q3V A;  5J2A A;  1BNO A;  1RQN A;  2OCE A;  1FA0 A;  3QE9 Y;  8ICK A;  2DFL A;  5AI0 A;  3IG8 A;  3BQT A;  5DKW A;  3AN1 A;  5DG8 A;  4KLD A;  3DV9 A;  4PGX A;  1S0V A;  1XU4 A;  4YMM A;  3QUQ A;  2W3S A;  3KKA C;  5BOM A;  5KFS A;  2NYV A;  5DQH A;  1NI3 A;  1ZQU A;  3EYZ A;  4QZF A;  5ALE A;  2I5H A;  3GV8 B;  3BZK A;  2BE3 A;  4X4S A;  1YLQ A;  3WK7 A;  2M2V A;  2M2W A;  3QUB A;  5HC9 A;  5F3X B;  1DRG A;  4CF4 A;  4HX0 A;  1BPZ A;  2XY7 A;  7ICT A;  1NK5 A;  1HIW A;  4DL5 A;  5DB8 A;  1CUK A;  3G6X A;  5ALQ A;  4DL7 A;  8ICF A;  3C1Y A;  1JN3 A;  4OCZ A;  4EED A;  4KLL A;  2FPK A;  4KLT A;  2B6G A;  4NLZ A;  4B9U A;  4K4I A;  3SMV A;  2PFP A;  1RPL A;  2ASD A;  1LKY A;  5D63 A;  4DQR A;  4LEY A;  5KFD A;  4EYH B;  3PO5 A;  1L7M A;  2Y9U A;  3WKD A;  2B56 A;  2AJQ A;  1U48 A;  4C8O A;  3KTQ A;  3D2Q A;  1A76 A;  1CI4 A;  2HOF A;  2BCV A;  2E8N A;  3UM9 A;  2JGA A;  4ECY A;  2HHU A;  4UAZ A;  4DL4 A;  5CEH A;  4WC2 A;  2ZH9 A;  1XSP A;  4NY8 A;  5C0Y A;  4TQR A;  3EW9 A;  1DK2 A;  1SB3 C;  4FFD A;  3JPS A;  2W7O A;  2W9C A;  1VDV A;  2HHS A;  2R8J A;  3BQ2 A;  4YFK A;  2BZF A;  1OXJ A;  3GIK A;  4PGY A;  1Z3E B;  1XWL A;  2JV3 A;  2MUT A;  4LVS A;  1FIQ A;  3NS1 A;  3SQI A;  4RQM A;  3S6J A;  1ZQW A;  4O3O A;  2FI1 A;  1N48 A;  4NLC A;  5IIM A;  4RPX A;  2D8C A;  2F77 X;  3Q8R B;  3TAQ A;  5AKK A;  2JRZ A;  1NKC A;  4QZ9 A;  4PPX A;  2M9N A;  5KL1 B;  5AM5 A;  1ZQT A;  1T3N A;  9ICK A;  4F4K A;  3UXN A;  2GA9 D;  3PR5 B;  4RUC A;  3THV A;  2VKQ A;  4S3N A;  1WCL A;  3OHB A;  4BXO A;  1ZRN A;  3PW7 A;  3SD7 A;  1TFR A;  4Y2V A;  3LVW A;  3N7P D;  3GV7 B;  2UVR A;  4FHW A;  4F5N A;  3H39 A;  2MSN A; 
#chains in the Genus database with same CATH homology
 3HWT A;  1QSY A;  3TQ1 A;  3RBD A;  1BGX T;  4DWI A;  1K1Q A;  7ICH A;  4WBZ A;  4ELU A;  3C21 A;  2R8G A;  4K4G A;  2IBK A;  5HHH A;  2W8K A;  4J9Q A;  2BQU A;  5HRE A;  4HYK A;  3TI0 A;  3RJI A;  4RQ6 A;  4YP3 A;  4F2R A;  4RQ2 A;  4TQS A;  3TAR A;  1L5U A;  4ED6 A;  1MSW D;  4AT8 B;  2XY6 A;  5J2I A;  7ICE A;  5IIO A;  2FPL A;  2HHP A;  2RFF A;  4RNM A;  4ED2 A;  5HMM A;  4XA5 A;  4TUS A;  3RJJ A;  3T3F A;  2KP7 A;  5JUM A;  5J2E A;  2KZ3 A;  4DEZ A;  5D4B A;  4XQ8 A;  4DOA A;  1RYS A;  4QZ8 A;  2HHW A;  1TAU A;  4C8K A;  5F2V O;  4P4M A;  3TAP A;  5HRF A;  2FMS A;  1D8L A;  4RZR A;  4IR9 A;  1SZP A;  4DS5 A;  4QWD A;  5KG7 A;  4KLO A;  7ICN A;  1R8B A;  7ICR A;  4DLE A;  3H3A A;  5HR9 A;  4AT9 B;  2PI5 A;  3BQ0 A;  3QEA Z;  9ICC A;  5HNK A;  4LZG A;  4NKU A;  1KFT A;  4O3P A;  3T5L A;  3PMN A;  4F3O A;  3PV8 A;  2F1H A;  4KN7 A;  3JPT A;  4YR2 A;  5EOZ A;  1CEZ A;  2W9C B;  4UD5 A;  3T5H A;  1HJP A;  3SV4 A;  3M9M B;  3V7L A;  3KHH A;  7ICV A;  4YXM A;  8ICQ A;  3LK9 A;  4ELV A;  3OSN A;  7ICQ A;  5CHG A;  1TV9 A;  5HRD A;  5TZV A;  4KN4 A;  4F4X A;  4MFC A;  3UQ2 A;  2DVI A;  2JEI A;  4EYI B;  4MFA A;  3C5F A;  4M9J A;  5HRG A;  4WC3 A;  3OGU A;  2A1J A;  3H39 A;  3MBY A;  3OVB A;  3NYB A;  4I2B A;  3QZ8 A;  1ZQH A;  1TK5 A;  4QZE A;  9ICU A;  1B43 A;  1NK6 A;  4ED7 A;  1KFS A;  2RDJ A;  3HW8 A;  4LT6 A;  4DFM A;  4X4V A;  4F93 B;  4MF2 A;  5KFR A;  3H40 A;  4J9O A;  3AQL A;  4NM1 A;  2R8H A;  4DFJ A;  3HP6 A;  4GXK A;  4EBJ A;  1ZQM A;  3C66 A;  4R8U B;  5KFU A;  4X0A A;  1Y88 A;  3K4G A;  3GDX A;  1TVA A;  1NJY A;  2ATL A;  3RJH A;  2PFQ A;  5HRL A;  5L1L A;  1ZJM A;  8ICV A;  4X4T A;  4Q43 A;  2R8I A;  4XUS A;  7ICF A;  4NM2 A;  3H4D A;  2BCQ A;  4AT8 A;  3UXO A;  5F9L A;  4XRH A;  4EP7 A;  5J0Y A;  2ZUB A;  3RRH A;  4UAW A;  2BGW A;  4WC0 A;  1UA0 A;  4X4N A;  4O5C A;  5J29 A;  1TFW A;  2F1J A;  1S97 A;  3QZ7 A;  4TUP A;  1RZT A;  1ZQK A;  7ICJ A;  2GWS A;  4MFF A;  5J2G A;  5DB9 A;  4RU9 A;  3RR7 A;  1V4A A;  4RQ1 A;  2P6R A;  1HUZ A;  4MF8 A;  4ECZ A;  4KLH A;  4AT9 A;  5DGB A;  3PY8 A;  3GIL A;  5KFN A;  3TFS A;  4MEY A;  1NOM A;  9ICA A;  3JPQ A;  3C5G A;  1ZQO A;  1QLN A;  3C18 A;  4RWN A;  2ZTD A;  1ZQL A;  4KMU A;  1SKR A;  2BPC A;  4YG2 A;  3H4B A;  1V9P A;  1UA1 A;  4KLI A;  8ICN A;  1S0M A;  4J9L A;  4DQP A;  4FO6 A;  4IQW A;  2HHT A;  4WC1 A;  4I2I A;  3PO4 A;  3RH4 A;  2VA8 A;  4KLU A;  4DLG A;  2ZH4 A;  2ZH8 A;  3HT3 A;  2XGP A;  7ICG A;  3HJ1 A;  2V4Q A;  5DB7 A;  4ATB B;  4Z6D A;  1TKD A;  3GQC A;  3JPP A;  1KDH A;  4M04 A;  1LV5 A;  4RQ0 A;  5KFG A;  2BPG A;  1NJZ A;  2AQ0 A;  2ZUC A;  2XCA A;  1ZQJ A;  7ICS A;  4FS2 A;  4KLQ A;  1L3S A;  1BPE A;  1MIW A;  1PX5 A;  5KG3 A;  4JUZ A;  5J2J A;  5J0W A;  3RB4 A;  5EWF A;  4R66 A;  2Y1J A;  1TK8 A;  4J9R A;  3T5K A;  2JEG A;  3MFI A;  4M9G A;  3OVA A;  4R8U A;  4YD2 A;  4QW8 A;  5KFC A;  3JPR A;  2BCS A;  1COO A;  5DBB A;  4RPZ A;  4R64 A;  2IA6 A;  2J6S A;  4TUQ A;  4NLN A;  4I2D A;  1BPX A;  4O3Q A;  8ICR A;  4XQ7 A;  9ICT A;  3MDC A;  3OJS A;  2O1P A;  4WC5 A;  3MGI A;  5KFE A;  1JAJ A;  4YMO A;  3KHR A;  3V72 A;  1KSP A;  3UPS A;  1ZET A;  4PGQ A;  4QZI A;  9ICE A;  5J0X A;  2C2D A;  1S0N A;  1ZQN A;  4QWA A;  2DR7 A;  3M9N B;  3MR2 A;  3OHA A;  1SL0 A;  2ZHA A;  1Q79 A;  2W9B B;  5KT6 A;  4FS1 A;  1ZQF A;  2ZH5 A;  2XGQ A;  4DSJ A;  1IM4 A;  4RQ8 A;  5J2C A;  3LWL A;  4F5O A;  1S0O A;  9ICM A;  5J2D A;  1ZQP A;  1S9F A;  3LDA A;  2UVU A;  5DBA A;  1ZQE A;  2HVI A;  4DS4 A;  8ICJ A;  2BQ3 A;  1NZP A;  3BJY A;  3RJF A;  4RUA A;  2KZZ A;  5J0U A;  3AQK A;  1JXE A;  2ZHB A;  4PHE A;  4M9H A;  4ECX A;  3V6J A;  2HHV A;  3KHL A;  1SKS A;  5KFP A;  1TK0 A;  2J6U A;  3M8S A;  1L3U A;  3RRG A;  3C2L A;  5DB6 A;  1KLN A;  2IHM A;  2KZM A;  8ICL A;  1HUO A;  1SL2 A;  3Q8L A;  3ZDE A;  5CJ7 A;  4GC7 A;  4B9L A;  1KEJ A;  5KFV A;  3ISC A;  9ICS A;  3H7I A;  1UT5 A;  3EPG A;  2C28 A;  3BDP A;  4KLJ A;  2FLP A;  4NLK A;  4R63 A;  1NJW A;  1UET A;  7ICK A;  3C23 A;  1XSL A;  1XS9 D;  4UQG A;  4M5D A;  3RR8 A;  9ICP A;  2P6U A;  4Q44 A;  3ISB A;  4I2H A;  3ZD8 A;  3PX0 A;  2ZH7 A;  3Q8K A;  5KTQ A;  4J9P A;  7ICP A;  1VJ7 A;  2PFO A;  5J2H A;  1ZQX A;  3LWM A;  3V6H A;  2DRB A;  1T4G A;  3AU6 A;  3UQ0 A;  7ICI A;  2Y1I A;  1D9F A;  3HPO A;  1MQ2 A;  5J0R A;  2V9W A;  5CB1 A;  5KFF A;  4BGD A;  1X9M A;  3C2K A;  2W9M A;  1ZQQ A;  3MFH A;  4KLG A;  5KFW A;  3BQ1 A;  3RB3 A;  3WFO A;  4DQI A;  4QZA A;  3MR3 A;  3RB6 A;  1R8C A;  4UB3 A;  3MDA A;  4R65 A;  2ZJA A;  3GIM A;  1ZYQ A;  2DPJ A;  1TAQ A;  5KG1 A;  4O3S A;  2XC9 A;  3HIY A;  3B0Y A;  2ZJ8 A;  4KLE A;  1MIY A;  4RQ4 A;  2W9B A;  1DOQ A;  1BPD A;  4GLX A;  8ICU A;  5HRI A;  2WTF A;  3JZ0 A;  2JZB A;  3KHG A;  2KN7 A;  5J0P A;  2UVV A;  4EBD A;  4ECW A;  1QSL A;  4E0D A;  2BCU A;  3V7K A;  2VA3 A;  5L1J A;  2BHN A;  4ED8 A;  4E8F A;  3G6Y A;  1VFG A;  2I9G A;  4QWE A;  1X9S A;  3PML A;  4O9M A;  4F5R A;  2JEF A;  4JV2 A;  2KFZ A;  4F5P A;  1WCN A;  1SKW A;  4AT7 A;  3H37 A;  4ED1 A;  4IRD A;  8ICE A;  2ZTC A;  4X4O A;  2KTQ A;  2M2T A;  4RQ3 A;  2I1Q A;  5IIL A;  1ZQZ A;  3N97 B;  4I2J A;  5J0Q A;  3GIJ A;  4QWB A;  4I2C A;  2NRK A;  2ZUD A;  1R8A A;  8ICM A;  8ICW A;  4Z6F A;  5KFL A;  3PW4 A;  3SV3 A;  1ZQA A;  2ALZ A;  5KG4 A;  3ETL A;  3PNC A;  5J2K A;  2XCP A;  4O5E A;  1UEV A;  2PBE A;  5KFO A;  4DFK A;  2HW3 A;  4EZ9 A;  2V4R A;  4WC4 A;  5BPC A;  5HP4 A;  4O5K A;  9ICV A;  2BDP A;  4PH5 A;  4DF8 A;  5KFX A;  2FMQ A;  4FHV A;  4B9T A;  2NRT A;  1JMS A;  4UAY A;  4F4Y A;  4I2A A;  9ICX A;  2DR5 A;  4Z6E A;  3PX6 A;  3RJK A;  5EWE A;  4FH5 A;  2O5A A;  4DO9 A;  4ECR A;  4NXZ A;  4DSK A;  5DQG A;  2VA2 A;  8ICS A;  1XC9 A;  4FHY A;  2ASL A;  3ZDA A;  4M2Y A;  5DLG A;  3Q8P B;  2ISO A;  4NLG A;  3E2E A;  7ICM A;  3H38 A;  5KFK A;  5KT7 A;  3N4M B;  4I29 A;  2BPF A;  8ICO A;  8ICX A;  1L3V A;  2C2R A;  5J2B A;  4EEY A;  1TFY A;  5DDM A;  3ISD A;  9ICI A;  4IQU A;  2NRW A;  4LZD A;  4RQ7 A;  4Q8E A;  1MC8 A;  4PHP A;  5KFM A;  4YD1 A;  5KG2 A;  4J9N A;  1NKB A;  3M9O B;  3ZDC A;  3EZ5 A;  3SI8 A;  2ZJ5 A;  1S77 D;  4DQS A;  2C22 A;  2R8K A;  8ICB A;  2NRX A;  5KG5 A;  3ZD9 A;  4O0I A;  2MAX A;  4WCW A;  2NRZ A;  4WC7 A;  3HJ4 A;  2LYH A;  1T8E A;  2HVH A;  1KRP A;  4F8R A;  1XO1 A;  7ICU A;  5HRK A;  3MR5 A;  1PZN A;  4IQT A;  5L1K A;  5D46 A;  3G6V A;  2BQR A;  2BKE A;  5EWG A;  4YCX A;  1Z00 B;  5DG7 A;  1X9W A;  1ZQI A;  2ZH6 A;  5J0S A;  3OJU A;  1T7P A;  4ZH4 A;  3B0X A;  8ICC A;  9ICW A;  1IXR A;  4RPY A;  2HHQ A;  2ZH1 A;  3ZDD A;  3ORY A;  5CA7 A;  4J9S A;  1QSS A;  2BCR A;  4RWQ A;  5HML A;  1KFD A;  3GII A;  2FMP A;  3NTU A;  1RYR A;  1H38 A;  4I28 A;  2Q66 A;  4ECS A;  4P2H A;  9ICB A;  4C8L A;  1B22 A;  5KFA A;  5BOL A;  4EBE A;  1NJX A;  4IRK A;  4F91 B;  5J0T A;  4JWM A;  4GXJ A;  3QEB Z;  4JWN A;  4P4P A;  4K4H A;  1JQR A;  4QZB A;  8ICH A;  9ICF A;  4YQW A;  1EXN A;  4TUR A;  3RJE A;  1BPB A;  2JZB B;  2C2E A;  5III A;  5J2F A;  4Q45 A;  9ICN A;  2NRV A;  4RNO A;  1WOT A;  4CCH A;  4O3N A;  4F5Q A;  4I2G A;  5DDY A;  3FDS A;  9ICH A;  9ICQ A;  4WC6 A;  4X4P A;  9ICJ A;  4I2E A;  4QZH A;  2XY5 A;  3PX4 A;  3TFR A;  1ZQD A;  3ZDB A;  4DF4 A;  2Q0Z X;  1NK7 A;  2UVW A;  2W9A A;  3PVX A;  3RJG A;  3LQC B;  4AT7 B;  5D49 A;  1U45 A;  4DFP A;  2F1I A;  4NKT A;  4YR0 A;  1S76 D;  3MGH A;  5IIJ A;  2DR9 A;  4M6W A;  3OSP A;  2VAN A;  3IHQ B;  4J9M A;  4RT2 A;  4JV1 A;  1UT8 A;  9ICR A;  4UD4 A;  3SYZ A;  2ISP A;  4FBU A;  5HRB A;  5J2A A;  2XO7 A;  1BNO A;  1FA0 A;  2B21 A;  9ICG A;  5DED A;  3QE9 Y;  5KFZ A;  1Z00 A;  5KG6 A;  2DFL A;  5CWR A;  1ARO P;  4Z6C A;  8ICK A;  8ICT A;  3AU2 A;  4ATB A;  2DR8 A;  2FPM A;  3BQT A;  4ED3 A;  3RTV A;  5DKW A;  4B9N A;  5C5J A;  1QTM A;  4UBC A;  5DG8 A;  4IG8 A;  3V6K A;  2M2U A;  4KLD A;  4YN4 A;  2PFN A;  2JEJ A;  4PGX A;  3K75 D;  1S0V A;  1XU4 A;  4DSI A;  4X0B A;  2HHX A;  4M9L A;  2ZH2 A;  1LB2 B;  1ZQY A;  5KFJ A;  4YMM A;  5BOM A;  4JV0 A;  5KFS A;  3AQM A;  2H5X A;  4KIT B;  3RBE A;  4IQV A;  5DQH A;  4YVZ A;  5KFT A;  1ZQU A;  3FYH A;  4F2S A;  3EYZ A;  4X4R A;  4GC6 A;  4QZF A;  3MR6 A;  1X2I A;  3C1Z A;  3GV8 B;  2PXI A;  4EZ6 A;  8ICI A;  4G3I A;  2BE3 A;  5KT4 A;  5CR0 A;  5KT3 A;  5DG9 A;  1YLQ A;  4X4S A;  2DRA A;  4ED0 A;  4C8N A;  7ICL A;  4KLF A;  1ZQC A;  3EPI A;  3RB0 A;  2M2V A;  2M2W A;  4ECV A;  3WFQ E;  5HRH A;  5HC9 A;  4M47 A;  5DGA A;  4JK1 A;  1NK9 A;  4Q8F A;  3RH5 A;  2IHN A;  4YR3 A;  3OV7 A;  4KLM A;  3WFR E;  1BPZ A;  4E7X A;  3NGD A;  2XY7 A;  7ICT A;  4E80 A;  3AUO A;  3UXP A;  1NK5 A;  1C7Y A;  4DL3 A;  2FLL A;  1MIV A;  4RWO A;  1A77 A;  1BVS A;  5DB8 A;  4DL5 A;  3OVS A;  4MEX A;  3TAN A;  1CUK A;  4RNN A;  3JPN A;  3G6X A;  5DBC A;  3T5J A;  4DL7 A;  4M9N A;  8ICF A;  3C1Y A;  1JN3 A;  4UB1 A;  2MUT B;  4KLL A;  2FPK A;  4QZC A;  4KLT A;  9ICO A;  4NLZ A;  4B9U A;  1Q78 A;  4K4I A;  5IIK A;  2PFP A;  4F50 A;  4B9S A;  3H8J A;  1JXL A;  1BNP A;  9ICL A;  1SL1 A;  4FBT A;  1RPL A;  3PW0 A;  4IR1 A;  1JX4 A;  1S10 A;  4YXJ A;  4DL2 A;  4DSF A;  2ASD A;  3IM1 A;  3PW5 A;  1UEU A;  2IMW P;  1NK0 A;  4DQR A;  5KFD A;  3Q8S B;  4EYH B;  1D8Y A;  3PO5 A;  5DEC A;  4EBK A;  3HX0 A;  1ZJN A;  4QW9 A;  1ZQR A;  8ICY A;  3MAB A;  2AU0 A;  1KNY A;  4ECQ A;  2W8L A;  2AJQ A;  1U48 A;  3Q8Q B;  4C8O A;  2AGQ A;  4F4W A;  3KTQ A;  8ICA A;  4F4Z A;  4I2F A;  2AGO A;  1NK4 A;  1L3T A;  4UB4 A;  4FHX A;  1A76 A;  1R89 A;  4KTQ A;  2BCV A;  2BR0 A;  2ZTE A;  3OUY B;  4M6W B;  4ECY A;  4DSL A;  4UAZ A;  2HHU A;  1U9L A;  3SZ2 A;  1NKE A;  1MQ3 A;  1KTQ A;  4P4O A;  4IRC A;  4DL4 A;  4BXO B;  7ICO A;  3PR4 A;  1BPY A;  2RDI A;  5DLF A;  4WC2 A;  2ZH9 A;  1XSP A;  1XSN A;  4NY8 A;  3RAQ A;  3AQN A;  4YMN A;  4TQR A;  4ECU A;  3EW9 A;  4I27 A;  1DK2 A;  3JPS A;  2ID1 A;  5IIN A;  2W9C A;  3EWA A;  8ICZ A;  2HHS A;  2R8J A;  4DSE A;  3BQ2 A;  3Q8M A;  4YFK A;  4X5V A;  8ICP A;  2FLN A;  3GIK A;  3RAX A;  1U47 A;  1JIH A;  4UBB A;  2ASJ A;  5CP2 A;  4PGY A;  3H8S A;  5KG0 A;  1Z3E B;  1XWL A;  5L9X A;  2MUT A;  5KFI A;  4LVS A;  4O3R A;  5KFH A;  2PI4 A;  4F92 B;  4PHA A;  1NK8 A;  1ZQS A;  3V7J A;  1RXW A;  4B9V A;  3RH6 A;  3WFS C;  1ZQW A;  4BWM A;  4FH3 A;  4O3O A;  4UB5 A;  1N48 A;  4ELT A;  4PHD A;  5IIM A;  4BDP A;  4RPX A;  2ZH3 A;  3Q8R B;  2OWO A;  4QZG A;  4RT3 A;  3TAQ A;  1NO5 A;  5KT2 A;  4BWJ A;  1ZQG A;  5KT5 A;  3C2M A;  3UPQ A;  4EBC A;  1NKC A;  1ZQB A;  4C8M A;  4QZ9 A;  1U4B A;  4PPX A;  2M9N A;  3GFK B;  4DOC A;  4DQQ A;  4UB2 A;  4M0A A;  4X4U A;  1DGS A;  4QWC A;  1ZQT A;  1T3N A;  9ICK A;  8ICG A;  4KLS A;  4F4K A;  1D9D A;  4B9M A;  3WFP A;  5L1I A;  5KFB A;  3JPO A;  3UXN A;  3JYY A;  2DPI A;  3PR5 B;  3OUY A;  4RUC A;  4FHP A;  5F9N A;  3PW2 A;  2KFN A;  3THV A;  5KFQ A;  4S3N A;  1WCL A;  1F5A A;  4RQ5 A;  3OHB A;  4BXO A;  4GXI A;  4RWP A;  5DQI A;  3H8W A;  2AGP A;  2AQ4 A;  4ECT A;  3PW7 A;  2P66 A;  4WBY A;  1TFR A;  2A1J B;  5KFY A;  5HHI A;  5J0O A;  1DK3 A;  1N56 A;  4X4Q A;  4QZD A;  4J9K A;  1RXV A;  1OU5 A;  2J6T A;  4DL6 A;  3GV7 B;  3L9D A;  4DOB A;  2UVR A;  1K1S A;  3GV5 B;  4F5N A;  3M8R A;  1U49 A;  4FHW A;  1ZQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...