4MFCA

Structure of human dna polymerase beta complexed with o6mg in the template base paired with incoming non-hydrolyzable ctp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
325
structure length
318
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSEKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 106
structure length 318
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mfcA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mfcA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mfcA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mfcA03
1NKEA 1BPZA 4DSFA 1QTMA 4LZGA 3ZD9A 4TUQA 3GV7B 3AQNA 4NXZA 5J2BA 2XCPA 3KHRA 4ED6A 5KFCA 2BQRA 1ZJMA 7ICQA 1R89A 4KMUA 3BQ2A 5HR9A 2HHTA 4P4OA 2BCVA 1MSWD 4FHVA 7ICKA 5CR0A 3ZDCA 4F5QA 2Y1JA 2PI4A 4XUSA 4MEYA 4CCHA 2RDIA 1U9LA 2ZTCA 2KFNA 4DSKA 1S97A 2F1IA 4F2SA 2LYHA 2P6UA 3C23A 5D46A 4DLEA 3PX4A 3HJ4A 4YVZA 1XSPA 1MQ3A 1ZQKA 8ICFA 4WC0A 4Q44A 8ICBA 8ICPA 4TUSA 5KT2A 4Q8EA 2ZJ5A 4I2IA 5IINA 1LV5A 5J2EA 4J9QA 1L5UA 3V7LA 2BCRA 3C2MA 1XC9A 5F9NA 1L3VA 7ICRA 4XRHA 4B9NA 3V6JA 9ICMA 3OSNA 4KN4A 5HRIA 4QZAA 1ZQBA 3C5FA 5CWRA 2C2RA 5KFOA 1X9MA 1ZQEA 4EZ9A 3QZ7A 8ICQA 4GXJA 1TKDA 5J29A 1IXRA 5KG4A 4F91B 5KFFA 4TQSA 1KFSA 4KLSA 8ICAA 9ICHA 4YXJA 2Q66A 4ELTA 7ICPA 5J2HA 1ZQLA 4NKUA 4EP7A 4O3OA 5DQGA 3JPRA 3OVAA 4O5EA 3Q8PB 5J0QA 3V7JA 4ED7A 3KTQA 1QLNA 2KZZA 1JXEA 2HHXA 3ISDA 4Z6CA 2C28A 3GQCA 5D49A 2ZUDA 4EBJA 3OUYA 2KTQA 8ICWA 4R63A 3Q8RB 1KFTA 4NLZA 2KN7A 4B9LA 4KLHA 3RJGA 1T4GA 4LT6A 1NOMA 5DQIA 4DSJA 4ED3A 2KFZA 4QZ8A 3AQMA 4DL4A 5IIIA 2NRWA 4I2HA 5HRBA 4UAWA 1KSPA 1RXVA 3ZDBA 1JN3A 1JQRA 4EBDA 5CJ7A 4NLKA 3OVSA 5KG2A 2XY6A 4DS5A 8ICZA 3OJSA 4GXKA 4I2AA 4DOBA 4WC4A 3ZDAA 3MGHA 2AJQA 1S77D 4JUZA 2AQ0A 2ASDA 2BGWA 2Y1IA 4MFFA 4ECRA 1TFWA 4DFKA 3V72A 3UXPA 5IIMA 4C8NA 5DB9A 3M9MB 4F50A 2C2EA 2HVHA 2KP7A 5KFDA 1ZQSA 2C22A 1BPEA 8ICYA 1IM4A 2ZJAA 4RZRA 1Q79A 1S9FA 3OVBA 3QEAZ 4O5KA 4YMOA 1ZQYA 4C8OA 4ED1A 4O5CA 5HRFA 2HHVA 2BPGA 5J2AA 4RNNA 1U49A 1SKSA 4WC2A 2Q0ZX 3C1ZA 4YXMA 4DQIA 5HHHA 3PO5A 4X4TA 1KTQA 4RQ5A 1ZETA 4KLGA 1RZTA 1KRPA 3QEBZ 1NK5A 2M9NA 4DFJA 5C5JA 1ZQJA 3HWTA 9ICTA 3TFRA 4NLGA 3ZD8A 1TAQA 4RPZA 1RYSA 4FBUA 4UBCA 8ICSA 4X0BA 1KEJA 3WFPA 4BWMA 3AUOA 4ED2A 4RQ7A 1DK2A 4EZ6A 4K4GA 3V6KA 4I28A 4AT9B 3JYYA 3H38A 4KITB 4R65A 2AU0A 4I2DA 2W8KA 2DR8A 1KDHA 4FHXA 3PW5A 4F2RA 5DB7A 4QZ9A 2W9CB 4DF4A 4X4PA 4G3IA 4M47A 1UA1A 5J0SA 1S0VA 2HHWA 4MF8A 3HPOA 1N56A 1YLQA 4O3RA 1XSNA 1NKBA 8ICEA 4YD1A 7ICHA 1JXLA 5DGAA 2DR9A 2NRXA 4I2CA 2FMPA 4UD4A 2DR5A 1JIHA 1U45A 4WC7A 4B9SA 3K75D 2IHMA 1UT5A 4J9PA 1TK8A 2FLNA 2P66A 4M5DA 1HUZA 1SL0A 4FHYA 4O3PA 1COOA 5EOZA 4J9NA 9ICBA 3ISBA 4J9LA 5HRGA 2P6RA 2O1PA 1D8YA 4MFAA 4EBCA 4KLQA 4F3OA 1PZNA 3C66A 8ICGA 2F1HA 5KFQA 1NJXA 2I1QA 9ICOA 4K4HA 3C21A 4R66A 1AROP 3H4BA 4F4XA 9ICLA 3GIIA 4FH3A 3MDCA 4YN4A 9ICGA 2FLPA 3UQ2A 5J2DA 4DF8A 3RJHA 2XGPA 4KLOA 7ICLA 1CUKA 3ORYA 5KFSA 2V4RA 4DL6A 3PW0A 2AGPA 1NK7A 1RPLA 3LDAA 4YR3A 1N48A 5KFUA 4DSLA 1OU5A 1PX5A 1UA0A 4KLEA 4QZCA 1ZQNA 3RB6A 3MABA 4C8MA 3RB0A 1TK5A 4UD5A 5L9XA 5J2CA 4X4RA 4YR0A 3PV8A 2PFOA 5KFRA 5KT4A 2R8KA 5L1JA 4X4NA 4UB2A 5HRKA 2ZH9A 2F1JA 1TK0A 4I2JA 4Z6DA 3BJYA 1D9FA 8ICLA 3KHHA 5KT7A 4J9MA 4WC3A 4JV0A 4UAYA 3B0YA 2M2TA 4GXIA 3SI8A 4O3QA 2BR0A 3ETLA 1SL1A 4BDPA 3C2KA 4I29A 3UXOA 1B43A 5KFZA 1V9PA 4ZH4A 4RQ2A 1ZQPA 4XQ8A 5KFVA 2ZTEA 1NJYA 1BPBA 1L3UA 1TAUA 9ICJA 3ZDDA 5J0UA 4RWOA 4XQ7A 4F92B 1SKRA 2B21A 5HMMA 4ECXA 4RWPA 3MR2A 3V6HA 3RBDA 5KFPA 7ICIA 5KFAA 4JK1A 4QW9A 4YMMA 4X4OA 2ZH7A 2XY5A 5DDMA 5EWGA 4PGYA 3Q8MA 1ZYQA 2DPIA 5F2VO 5DBCA 4RQ6A 1U48A 1ZQCA 5DG7A 4E8FA 5DB8A 3SV4A 4FHPA 3WFOA 2XGQA 1ZQMA 5HREA 2RFFA 3EPGA 3BQTA 5DLFA 2FPMA 3H8JA 4WC6A 3GIMA 8ICKA 1BPYA 1A76A 2W9BB 4BXOA 4X4SA 1BPDA 4DL5A 3Q8LA 4PHPA 4AT9A 1Y88A 3GV5B 1UETA 1NO5A 4R64A 5L1KA 1S0OA 1ZQIA 5KFYA 3M8SA 5KFIA 3M9OB 5JUMA 1WOTA 2VANA 1Q78A 5J0TA 4O0IA 2W9CA 2ZJ8A 5KG5A 2ISOA 5L1IA 4WBYA 4QZBA 4QZIA 5DG8A 4BGDA 3E2EA 2UVRA 3T5LA 3HJ1A 4UB4A 3RBEA 5HHIA 3RJJA 2HHQA 5J2IA 2W9MA 4X4QA 5HRDA 3C18A 2DRBA 8ICCA 1TFYA 4GC7A 5J0PA 1NKCA 4ED0A 3NTUA 5DG9A 3TQ1A 3PX6A 4UAZA 3PO4A 3FYHA 1R8CA 5KT6A 4I27A 4I2GA 5IILA 2AQ4A 2J6TA 3RR7A 2HHUA 3L9DA 2MUTB 1ZQWA 4PHEA 4ECZA 2ZTDA 3LWMA 5KG7A 1TVAA 1T3NA 3RJFA 2HVIA 4E7XA 8ICMA 3Q8KA 5CA7A 1KLNA 2BE3A 4M9NA 3UQ0A 4IQWA 9ICXA 1DK3A 5CHGA 3TARA 8ICRA 1EXNA 2DFLA 4R8UB 3G6VA 4ECQA 9ICNA 2HHPA 4MFCA 4UB3A 8ICHA 4YD2A 4KLUA 9ICSA 5D4BA 4IR9A 1R8AA 4EBEA 1QSLA 1XWLA 1VJ7A 2XY7A 1S10A 4ATBA 1QSYA 4IQTA 2MAXA 3RH4A 2KZMA 1C7YA 4DQPA 4QZGA 4BXOB 1MC8A 4KLJA 2RDJA 4WBZA 2BQ3A 1ZQUA 5BOMA 4IQUA 3PW4A 1D8LA 2ZH4A 4DS4A 2NRZA 4RQ0A 1X2IA 2ISPA 3UPSA 4DOAA 1NZPA 4M6WB 4KLTA 3N4MB 5DLGA 5J2GA 1UEUA 3GFKB 1WCLA 4RQ3A 4RUAA 4GLXA 7ICMA 3H8WA 3QE9Y 3OHAA 5F9LA 2ASJA 5DBAA 4NM1A 5TZVA 3AQKA 3MR3A 4B9UA 4M9JA 7ICVA 4YG2A 2M2WA 4M04A 4RPXA 5KG6A 2H5XA 4MEXA 3LWLA 4KLDA 4RWNA 1ZQGA 2JEGA 4I2EA 5L1LA 4BWJA 3FDSA 2JEIA 7ICSA 2IMWP 1XU4A 1V4AA 3MR5A 1TFRA 2ZUBA 4TUPA 2R8JA 5HP4A 4YR2A 2XC9A 4YMNA 2WTFA 4E0DA 9ICIA 3B0XA 2KZ3A 3EW9A 4JWNA 5HRHA 2ZUCA 5IIKA 2A1JB 3H40A 4Q8FA 3RR8A 1ZQDA 9ICKA 1UT8A 3PR5B 4DLGA 4ED8A 2XCAA 4F8RA 5KFMA 3RRHA 4P4PA 4Z6EA 1S0MA 2FMSA 3KHGA 4PPXA 3LQCB 3H39A 3JPSA 4ECWA 4KLIA 4I2FA 4M9GA 4RU9A 2W9BA 4ATBB 1KFDA 4DSEA 2ZH6A 4NKTA 2ATLA 4DWIA 9ICPA 5KFHA 2HHSA 3Q8QB 3RRGA 3HIYA 4J9SA 1ZQZA 3GILA 2FLLA 9ICRA 4S3NA 4B9TA 2JEFA 8ICTA 4Z6FA 2IA6A 3RJKA 4O9MA 9ICQA 1SKWA 4DFPA 1MIYA 4EYHB 3Q8SB 4UB5A 2BDPA 4UBBA 4KTQA 4IG8A 1ZQAA 2O5AA 2ZH5A 2DPJA 2HW3A 4NLNA 4M9HA 1ZQTA 3C1YA 4YP3A 2NRVA 3BQ0A 1U4BA 4IRDA 2ID1A 2NRTA 5KFGA 3JPOA 4DL2A 3RJIA 1TV9A 3MGIA 2ZH2A 4LZDA 1RXWA 8ICVA 2M2UA 2BPCA 5J0WA 3NGDA 4RQ8A 4MF2A 8ICJA 1JAJA 2OWOA 2ZH3A 2MUTA 3G6YA 5J2KA 2BHNA 5KFJA 4XA5A 3SV3A 4DO9A 4ECTA 4QZEA 5IIOA 1MQ2A 1DOQA 3EWAA 1MIWA 7ICOA 4ELVA 1L3SA 1MIVA 1S0NA 4ELUA 4F4ZA 4UB1A 5IIJA 3RH6A 4R8UA 3OGUA 3M8RA 3HW8A 4F5RA 4ECUA 4QW8A 1U47A 1K1SA 3ZDEA 4QWDA 1RYRA 2I9GA 1H38A 3EPIA 4C8KA 4IRCA 9ICAA 5DECA 2BPFA 3PW2A 7ICNA 4DSIA 5J0XA 1D9DA 4C8LA 3TAQA 4O3SA 5DQHA 3H37A 1S76D 1ZQOA 3JPQA 4FBTA 4JWMA 5HNKA 3UPQA 1BVSA 4RPYA 4QZHA 4F5OA 4YFKA 4J9OA 4TQRA 2PFQA 8ICOA 4JV1A 2V9WA 3TAPA 2DVIA 4NM2A 4KLMA 4QZFA 3C5GA 3T5KA 4X5VA 2FPLA 2PI5A 4TURA 3PW7A 2FMQA 4M6WA 5HMLA 2VA8A 5DDYA 4RNOA 1NJZA 2J6SA 4KN7A 4AT7A 1VFGA 4AT8B 3AQLA 4DOCA 4M9LA 1XO1A 4B9VA 5KG1A 5KG3A 4ECVA 3H7IA 2PXIA 2IHNA 7ICGA 3NYBA 4PH5A 4X4VA 1T8EA 9ICEA 3SYZA 3IM1A 4RQ4A 3IHQB 3PMLA 2GWSA 2BQUA 4JV2A 9ICWA 2W8LA 2NRKA 2PFPA 4PHAA 1JMSA 3PR4A 2JEJA 5KTQA 5KT3A 4J9RA 4EYIB 2AGQA 1X9WA 2UVWA 1B22A 5HRLA 4GC6A 4QWCA 1R8BA 1Z00A 3H3AA 7ICTA 1QSSA 1Z3EB 2UVVA 2R8HA 5BOLA 1NK9A 1JX4A 3PY8A 4EBKA 1BGXT 3OJUA 2VA3A 4M2YA 3KHLA 1NK6A 4RUCA 3WFRE 1F5AA 5KFNA 4FHWA 1XS9D 9ICCA 1SZPA 3G6XA 1ZQXA 4YQWA 7ICUA 8ICXA 2A1JA 3RTVA 5DB6A 2DR7A 4YCXA 2JZBA 2FPKA 1FA0A 3EYZA 4M0AA 3H8SA 4QWBA 1NK8A 3ISCA 4IQVA 7ICEA 5KFTA 5J0YA 4RT3A 8ICNA 3GIKA 4HYKA 1CEZA 2V4QA 3AU2A 4J9KA 1K1QA 4DQSA 5HC9A 4DEZA 4PGXA 2XO7A 2R8IA 4E80A 3PVXA 2BCQA 5EWEA 4F5PA 1ZQHA 4DQQA 3HP6A 2AGOA 3BDPA 4PHDA 4FS1A 3OSPA 5KG0A 4LVSA 3T5JA 5DBBA 4UQGA 4RNMA 2ALZA 2ZH1A 4AT7B 5DKWA 4RQ1A 4RT2A 3LK9A 2BCUA 1T7PA 4IR1A 4WCWA 5DGBA 4QZDA 2VA2A 5KT5A 8ICIA 3PX0A 1A77A 3QZ8A 3HT3A 2ASLA 3JPNA 1SL2A 4I2BA 4WC5A 3GIJA 5DEDA 4O3NA 1L3TA 3RB3A 1XSLA 5KFWA 4F5NA 3JPPA 2ZHAA 3MR6A 2W9AA 9ICUA 5J2JA 4QWAA 1LB2B 3TI0A 1BNOA 5KFKA 2UVUA 7ICJA 3OUYB 2DRAA 3RJEA 1DGSA 5J0RA 5CB1A 2R8GA 1Z00B 3M9NB 3TFSA 3BQ1A 1ZQVA 2BKEA 4IRKA 4X4UA 4P4MA 3H4DA 3JPTA 2PFNA 3MFIA 4WC1A 5BPCA 3C2LA 4B9MA 5KFXA 4RWQA 3SZ2A 3N97B 5KFBA 4QWEA 3MBYA 3OHBA 1UEVA 3RAXA 4FS2A 4FO6A 2JZBB 3PMNA 3V7KA 1ZQRA 4F4WA 3THVA 2ZH8A 3T5HA 1NJWA 1NK0A 3RAQA 4NY8A 2PBEA 3OV7A 9ICVA 2J6UA 4DFMA 3RB4A 4P2HA 3GV8B 8ICUA 2ZHBA 4ECYA 2M2VA 3PNCA 1ZQFA 4KLFA 4F93B 5CP2A 4X0AA 1BNPA 3HX0A 3GDXA 2C2DA 4EEYA 7ICFA 4KLLA 5KFEA 4Q45A 5J2FA 3MFHA 5J0OA 3UXNA 9ICFA 3K4GA 1KNYA 4AT8A 3T3FA 1HUOA 3TANA 4F4YA 4DL3A 1ZQQA 3RH5A 3WFSC 1HJPA 5KFLA 5EWFA 4PGQA 4ECSA 4Q43A 1X9SA 4F4KA 4K4IA 3AU6A 3WFQE 3EZ5A 3MDAA 4DQRA 1ZJNA 4FH5A 2BCSA 2IBKA 3JZ0A 4DL7A 1WCNA 1BPXA 1NK4A
chains in the Genus database with same CATH superfamily
4DSFA 1QTMA 4LZGA 2XCPA 4ED6A 2BCVA 1ZOLA 7ICKA 2D8CA 1RM6C 4F5QA 2PI4A 1U9LA 3C23A 4YVZA 1XSPA 1ZQKA 2YN4A 1L5UA 5JRTA 5D63A 4AP9A 2WB1C 2C2RA 2Q4TA 5KFOA 2ZHAA 2EZZA 3WK6A 3QZ7A 1TKDA 1IXRA 5KG4A 5AM5A 1N2XA 1QQ7A 3DEEA 5KAIU 5CFSA 3OVAA 4O5EA 5J0QA 3V7JA 3KTQA 2KZZA 3ISDA 2C28A 5D49A 2ZUDA 2KTQA 1X42A 3Q8RB 4KLHA 3RJGA 5DQIA 2KFZA 2E8NA 1RXVA 3ZDBA 4NLKA 3OVSA 4DS5A 4DOBA 4CNQA 2BGWA 2Y1IA 4DFKA 3M9MB 4OAIZ 3S6JA 1Q8KA 3OVBA 1HEKA 3QEAZ 2HN2A 5ALWA 3BZCA 2HHVA 2WAQF 3R9KA 1XNSA 2Q0ZX 3KD3A 2HCFA 1KRPA 9ICTA 4JLZA 1RYSA 4FBUA 4ED2A 1V97A 2F76X 4K8VA 4I2DA 1OUQA 2DR8A 4UAUA 5AM0A 2LI6A 3PW5A 4FHXA 1T3QA 3CW2C 4X4PA 5D62A 4M47A 1UA1A 2W3RA 1YLQA 1PK1B 4O3RA 3LYSA 1JXLA 5DGAA 2FMPA 2DR5A 2OEHA 1UT5A 4JMUA 2K8BB 5ALQA 5AKJA 2LYAA 4KLQA 4F3OA 3NUQA 9ICOA 2I1QA 1O03A 4R66A 9ICLA 4FH3A 4YN4A 2PKEA 4DF8A 1CUKA 5KFSA 1N48A 1RPLA 4YR3A 5KFUA 2BBJA 1UA0A 3MABA 4C8MA 4UD5A 5L9XA 5J2CA 5AI0A 2OM6A 5L1JA 5HRKA 2ZH9A 4I2JA 4Z6DA 4EX7A 4J9MA 2M2TA 4RWNA 1V9PA 1D8BA 9ICJA 2YMMA 4RWPA 3HILA 4K99A 4QW9A 2XY5A 5DDMA 1ZRMA 3E58A 3KKAA 1ZYQA 3T79A 2ZIUB 3EPGA 4BXOA 1BPDA 3I1YA 3GV5B 1ZQIA 1WOTA 2VANA 4UB8U 5L1IA 4QZBA 5DG8A 3HJ1A 2KJ8A 4GC7A 4ED0A 5DG9A 3TQ1A 3FYHA 4A8EA 3IG5A 5T14A 4ECZA 4Y2XA 1T3NA 1TVAA 1JUDA 3F2BA 8ICMA 4B6JA 4IQWA 4ICAA 5CHGA 3TARA 5ALVA 4R8UB 4ECQA 9ICNA 2P35A 4C4TA 4EV6A 4P0QB 1VJ7A 3SENA 4ACOA 2KJ5A 3FAHA 3I76A 4DQPA 1MC8A 4WOYA 2ZH4A 4DS4A 4RQ0A 1X2IA 1S8OA 2E8MA 3UPSA 3NVZA 1N61A 3QU4A 4KLTA 5AKIA 5EE0A 1Q3UA 3GFKB 1WCLA 1N60A 3H8WA 1L7PA 2ASJA 1SXDA 2EANA 5KG6A 2VIXA 2BZFA 3BQ7A 3FDSA 3D2SA 1V4AA 1LVHA 3F2CA 2ZUBA 4TUPA 2IUBA 2YMQA 4JWNA 2ZIUA 5HRHA 1WWVA 1UT8A 4K9BA 2XCAA 4EX6A 5KFMA 4ECWA 4I2FA 4RU9A 2G07A 1A6SA 3CRXA 2ZIWB 2OH2A 4J9SA 2O6KA 2KD1A 4Z6FA 2IA6A 3RJKA 4DFPA 5ALNA 3Q8SB 2ZH5A 3C1YA 2VJ5A 2NRVA 3BQ0A 3RFAA 3MGIA 4GFJA 5J0WA 3NGDA 4MF2A 4XA5A 4QZEA 5IIOA 1MQ2A 1MIVA 3WKCA 5J8YA 4O69A 4F4ZA 3RH6A 5IIJA 2DF4B 4R8UA 4F5RA 2I9GA 5HC9A 4QWDA 2YY6A 9ICAA 2FJ6A 4OO1J 4C8LA 3TAQA 4OJPA 3SQIA 1S76D 5ALYA 2A3VA 3F53A 1WCNA 1BVSA 4J9OA 1NI3A 2V9WA 3TAPA 3T5KA 2JXJA 2FPLA 3GZFA 2FMQA 4RNOA 2G0AA 4USAA 4DOCA 4ECVA 4X4VA 3NYBA 2N1RA 4O3MA 3SYZA 4RQ4A 9ICWA 3NKUA 1S5LU 2BQUA 5KT3A 2UVWA 5HRLA 1Z00A 1RYUA 5BOLA 1JX4A 3PY8A 3SD7A 1BGXT 4M2YA 1SV0A 3WFRE 3JCFA 4RUCA 2EDUA 1F5AA 3G6XA 8ICXA 3PSTA 5AI5A 1WYGA 4M0AA 1MA7A 2W11A 2ZIWA 4CE6A 3IG8A 4QIWC 4HYKA 2V4QA 3BZKA 4DEZA 2R8IA 2HMXA 2BCQA 4QJFB 1KKXA 2ALZA 4IR1A 2BCUA 3D2NA 5KT5A 3PX0A 5AHXA 1SV4A 3QZ8A 3HT3A 3JPNA 1SL2A 4I2BA 3MR6A 2QB0B 1X9XA 2KICA 3ER9B 4UB6U 7ICJA 3OUYB 5AM3A 4FFDA 4RQMA 3BQ1A 3QUQA 2Y0SC 1WWUA 5BPCA 5KFXA 3QU9A 2W43A 3AMZA 3MBYA 3D2QA 2FCLA 1ZQRA 4NLBA 3OV7A 4F71A 9ICVA 5EE9A 2J6UA 2F3NA 4EEDA 2R18A 4P2HA 4KX3A 8ICUA 2DQNB 2GAFD 2H3ZA 3SAFA 2FDRA 5J0OA 2Z7JA 3D6JA 3DV9A 5E79U 1ZQQA 4PGQA 5G5GA 4DQRA 1Z1BA 1JQRA 4DL7A 2JEFA 1NKEA 3ZD9A 3UMGA 3AQNA 5J2BA 1DRGA 1R89A 4KMUA 3BS7A 5HR9A 4CGZA 2DL0A 4XUSA 4CCHA 5HR7A 4IL6U 4F2SA 2LYHA 2P6UA 4WC0A 1N5XA 8ICPA 4TUSA 5KT2A 1URJA 1X40A 4ZOHC 5IINA 4OCZA 3V7LA 4LEYA 2B0CA 3NRWA 4XRHA 3KOOA 9ICMA 2JRZA 4KN4A 1IIPA 4QZAA 3LVWA 1VJ5A 8ICQA 5J29A 5KFFA 4F91B 1KFSA 8ICAA 4ELTA 7ICPA 1ZQLA 2NO4A 3JPRA 4ED7A 1QLNA 2QB0A 2HBMA 2HHXA 3GQCA 3OUYA 1PK3A 1KFTA 2KN7A 4B9LA 1T4GA 1NOMA 4DSJA 2WF5A 5IIIA 4UAWA 2WAQC 4EBDA 5CJ7A 5KG2A 8ICZA 5AKGA 3WKEA 3OJSA 1Z19A 3ZDAA 1T94A 4JUZA 2ASDA 4WH5A 1TFWA 1VLBA 3V72A 3OTQA 5DB9A 2HOIA 2C2EA 2HVHA 1UPHA 1ZQSA 1IM4A 1Q79A 2G5IB 1S9FA 3NRZA 4O5KA 5HRFA 5L1MA 5AKEA 5ALJA 1DXSA 3C1ZA 4DQIA 4X4TA 2GLEA 1ZETA 1GPJA 5JTGA 1ZQJA 3KZIU 1TAQA 8ICSA 5ALEA 5ALGA 2D6FC 1KEJA 3WFPA 1RQNA 1DK2A 4EZ6A 4I28A 1MN8A 4AT9B 3JYYA 3UMBA 4KITB 5A0LA 4O67A 2A1AA 1KDHA 5GTHU 4QZ9A 5J0SA 2HHWA 4MF8A 2K8CB 5G5HA 3CYMA 2NRXA 1IG6A 3K75D 2FLNA 4M5DA 1HUZA 5EOZA 2JH1A 5HRGA 2PMZF 3NVYA 4MFAA 2F1HA 1NJXA 4PL1A 1AROP 3H8MA 3GIIA 9ICGA 5HR6A 1TAMA 3PW0A 1NK7A 2AH5A 4DSLA 5ALIA 1PX5A 4EEKA 3ZI4A 4KLEA 1TK5A 3PV8A 5KFRA 5KT4A 4X4NA 1J2NA 4UB2A 3PSPA 1JALA 5KT7A 4UAYA 3SI8A 4BDPA 3ETLA 3M6KA 1SWWA 4G3IA 4ZH4A 1KQQA 1NJYA 5KFVA 4CF4A 1JI7A 4RWOA 2DKXA 4F92B 1SKRA 3MR2A 1N63A 5CFUA 5KFAA 2KOBA 1YT3A 5F2VO 5DBCA 2LHTA 4RQ6A 1ZQCA 1B0XA 5DB8A 3SV4A 1P7DA 3KKAC 1IV8A 5HREA 2KEYA 3BQTA 3GIMA 8ICKA 1BPYA 2K8AA 4X4SA 4PHPA 4AT9A 1KN5A 5AIAA 1UETA 5ALDA 5KFYA 3M8SA 3L3FX 2M0NA 1Q78A 5J0TA 2ZJ8A 3WK4A 5KG5A 4WBYA 5AK5A 4QZIA 1VDVA 5HHIA 2IOFA 3RBEA 3RJJA 2HHQA 5HRDA 2DRBA 8ICCA 4K9AA 3TACB 2ZIVA 3PO4A 4Y2QA 4UAZA 4I2GA 2AQ4A 3L9DA 2HHUA 2KG5A 2B4VA 3LWMA 5KG7A 3RJFA 4E7XA 3Q8KA 4M9NA 3UQ0A 1DK3A 9ICXA 5K4LA 1EXNA 2DFLA 4UASA 3G6VA 2GOLA 1L7OA 1XWLA 2LM1A 2ESEA 2KKVA 1S10A 2H3VA 2F44A 4Y2RA 2MAXA 2RHFA 3WKBA 4BXOB 4KLJA 4WBZA 2G08A 2BQ3A 5BOMA 1ED1A 1FIQA 2WF6A 3OPXA 4DOAA 1NZPA 5KNIA 3N4MB 3QE9Y 5F9LA 4NM1A 3AQKA 4B9UA 5B5EU 1X66A 3LWLA 1TE2A 2JEGA 4I2EA 4BWJA 2JEIA 1XU4A 1L6NA 2R8JA 1O08A 1OW5A 2WTFA 1M6YA 2KZ3A 3EW9A 2ZUCA 2A1JB 4Q8FA 3RR8A 4EEBA 3SAGA 4DLGA 4ED8A 2KK0A 3LQCB 3KHGA 4M9GA 1L7NA 2E3TA 5ALXA 4NKTA 2HHSA 3Q8QB 3RRGA 3H0MB 1ZQZA 9ICRA 2Y9UA 4S3NA 8ICTA 9ICQA 3K1ZA 1MIYA 1SKWA 4OAGA 5AK3A 3C29A 4EYHB 2O5AA 4U6PA 2DPJA 2EZYA 1J97A 2ID1A 4AYBF 3JPOA 2K4EA 4UW9A 1TV9A 3CK6A 2CXYA 1RXWA 8ICVA 1AQ6A 2BPCA 3IP4B 2B51A 2ZH3A 1PVQA 3G6YA 5KFJA 3SV3A 4DO9A 1DOQA 1HIWA 3OGUA 3M8RA 4PPXA 2XI9A 4QW8A 2ZH1A 4C8KA 2HN1A 1SB3C 4DSIA 4O3SA 3H37A 2OHFA 1ZQOA 3JPQA 4JWMA 2H3FA 3ICXA 5HNKA 2YB4A 2PFQA 8ICOA 2XICA 5AIBA 4KLMA 2PI5A 4TURA 1NJZA 2J6SA 2ES6A 4AT7A 1VFGA 4AT8B 3AQLA 4M9LA 2ZG6A 5KG1A 5AI8A 3H7IA 2PXIA 5F3XB 9ICEA 3PMLA 4JV2A 2W8LA 4NL9C 4PHAA 1JMSA 3QUTA 5KTQA 4J9RA 5ALRA 2F8LA 4GC6A 2UVVA 2VA3A 3OJUA 2EAMA 1NK6A 5KFNA 1XS9D 1SZPA 4YQWA 7ICUA 2A1JA 2JZBA 2FPKA 2K60A 5KFTA 4RT3A 2H3QA 3GIKA 1CEZA 3EF2A 3M7DA 5B3QA 4PGXA 3PVXA 1FO4A 2YB1A 5EWEA 4F5PA 1ZQHA 1COKA 4DQQA 1WG8A 1SZHA 4LVSA 1N5WA 4RQ1A 4RT2A 3LK9A 3TKAA 5DGBA 2FI1A 1XSLA 1NNLA 3K7DA 9ICUA 2B6GA 2WFAA 1LB2B 5KFKA 4WJ3B 2R8GA 1Z00B 3M9NB 3TFSA 3JPTA 4RWQA 4QNLA 3U26A 5KFBA 4QWEA 3OHBA 1KL9A 3PMNA 3V7KA 4F4WA 1NJWA 4NY8A 3RB4A 4Y2YA 3QXGA 4X0AA 4XJEA 1Z4NA 4RQNA 5EE3A 3MFHA 1ZD5A 3K4GA 4AT8A 1HUOA 2GH1A 4DL3A 3MC1A 3RH5A 4ECSA 4Q43A 4F4KA 3AU6A 3MDAA 1ZJNA 2BCSA 3NVVA 3JZ0A 1BPZA 3KHRA 2KE7A 4P4OA 5CR0A 2H3IA 2Y1JA 4MEYA 1F44A 4N7RA 4DSKA 1S97A 4Y2TA 2LPEA 2K4HA 3SMVA 4P0PA 1MQ3A 2QLTA 1DGJA 8ICBA 2LMRA 1B4FA 3WK9A 2YX8A 4Q8EA 1LV5A 2W55A 4J9QA 3PSIA 2B56A 2BCRA 5F9NA 1L3VA 7ICRA 4B9NA 3OSNA 5CWRA 2NYVA 1X9MA 1ZQEA 4EZ9A 4GXJA 2Q66A 9ICHA 4KLSA 3WKAA 2VKQA 2HSZA 4EP7A 4NKUA 4O3OA 1JXEA 2WF9A 2E8OA 8ICWA 4R63A 4NLZA 4LT6A 4EENA 3AEVA 4ED3A 5KL1B 3AQMA 4DL4A 4K96A 2NRWA 1JN3A 2EAOA 2XY6A 4NJ8A 1X6JA 4GXKA 4I2AA 3MGHA 2AQ0A 2Y9TA 3UXPA 4C8NA 4F50A 2KP7A 2HBLA 1BPEA 8ICYA 2ZJAA 4RZRA 5AKZA 4YMOA 5ALPA 1SIJA 4ED1A 4C8OA 2W54A 2BPGA 5J2AA 1SKSA 4EGWA 4YXMA 5ALMA 3AM9A 1KTQA 4RQ5A 5CFTA 2M9NA 3HWTA 4NLGA 3TADC 3KFUF 4BWMA 3AUOA 4RQ7A 1XO0A 3V6KA 3ER8C 3H38A 2PMZC 1Z1VA 4R65A 5DB7A 2W9CB 1XSNA 8ICEA 3N7RC 2CPRA 2DR9A 2ZXHA 3WU2U 2OXOA 4PZOA 4I2CA 1JIHA 3N7PD 2ODGA 2IHMA 4J9PA 2P66A 4FHYA 4O3PA 2RP5A 1COOA 4J9NA 9ICBA 2RQ5A 2P6RA 2O1PA 1D8YA 4EBCA 1CI4A 2JHDA 8ICGA 3AQFA 2DKZA 4K4HA 3C21A 3H4BA 3M6ZA 3MDCA 2E5SA 5J2DA 4WC4A 3RJHA 2XGPA 4KLOA 2KZMA 1F0MA 2V4RA 4DL6A 1OU5A 4QZCA 3RB6A 4Y2UA 4YR0A 1WUDA 4OJ5A 2R8KA 2W7PA 1YZ6A 3BJYA 3KHHA 4LEZA 1J2MA 1KW4A 2MRLA 4GXIA 1SL1A 4I29A 1BNOA 3UXOA 4RQ2A 3QU7A 4XQ7A 4DCCA 3RBDA 5KAFU 5KFPA 7ICIA 4X4OA 1ECWA 4BUGA 3Q8MA 3HKZF 2W04A 1U48A 1QQ6A 5DG7A 5AKLA 1ZRNA 4NXUA 2XGQA 1L8OA 1ZQMA 2E8PA 2FPMA 3H8JA 4WC6A 3IDWA 1A76A 3Q8LA 1Y88A 5AKKA 3UMCA 5ALUA 4R64A 2HOFA 3B9JA 5KFIA 4O0IA 2W9CA 4OAFA 1GO3F 3SR6A 2UVRA 1SWVA 4UB4A 5J2IA 4X4QA 2DUYA 2WF7A 5J0PA 2QKQA 3NTUA 3QU2A 4BX9C 3PHZA 4I27A 5ALFA 5IILA 2MUTB 4PHEA 2JV3A 2ZTDA 1NZBA 4LEWA 2MU2A 3OWGA 5CA7A 1KLNA 2BE3A 3KZXA 1OXJA 8ICRA 3MCRA 4Y2SA 4MFCA 4UB3A 8ICHA 4YD2A 9ICSA 4BJQA 1R8AA 4EBEA 1QSLA 4ATBA 2XY7A 3FC4A 3ALRA 1C7YA 4QZGA 1ZQUA 4IQUA 3PW4A 2NRZA 2ISPA 5AM4A 5AM2A 2EAPA 4RQ3A 4RUAA 3OHAA 5AK4A 5DBAA 3MR3A 4M9JA 2M2WA 4YG2A 4FZMA 4RPXA 2ZIVB 2H5XA 4G9BA 4MEXA 3VCBA 1ZQGA 5L1LA 2G06A 4NXXA 4MKPA 2I6XA 2ZIXA 4YMNA 2JMGA 2YMLA 2DBYA 2VJ4A 5IIKA 9ICKA 3PR5B 4F8RA 7ICTA 4AYBC 3RRHA 1S0MA 4Z6EA 1FFVA 4KLIA 3WK5A 1KFDA 1Q3VA 4DWIA 5AI4A 2DWQA 9ICPA 2KV2A 4B9TA 5JTIA 4O9MA 4UB5A 1V38A 4UBBA 4KTQA 1ZQAA 5KL8B 3NS1A 2EWRA 3E0FA 4YP3A 4IRDA 1U4BA 2NRTA 1RG6A 4DL2A 2ZH2A 1YZ7A 1JAJA 2OWOA 2MUTA 5J2KA 4O6AA 4ECTA 4F72A 1L3SA 4UB1A 1QH9A 3WK8A 1H38A 3EPIA 7ICNA 5J0XA 1D9DA 4J03A 5DQHA 5GTIU 2EH9A 4FBTA 4RPYA 4F5OA 4TQRA 4JV1A 4Y2JA 2YMPA 4NXTA 4QZFA 3C5GA 4X5VA 4UARA 5HMLA 2VA8A 5DDYA 2OYYA 4KN7A 2K4PA 4PJ0U 2IOHA 1XO1A 3QYPA 2IHNA 2JR5A 4LJXA 3AL0B 3SAHA 2GWSA 2NRKA 4EYIB 1B22A 1RQLA 2KHVA 1NK9A 2LM4A 3ETRA 3HJEA 2NO5A 4FHWA 9ICCA 1ZQXA 3RTVA 5DB6A 2D3DA 4YCXA 4IS7A 1NK8A 2F8KA 2YQEA 3QNMA 2A19A 7ICEA 3N28A 8ICNA 4C7ZA 2HBKA 3AU2A 4CDGA 4OD0A 4WQLA 2XO7A 2AGOA 3BDPA 4PHDA 4FS1A 5KG0A 5DBBA 4RNMA 4AT7B 5DKWA 8ICIA 2HDOA 1A77A 2ASLA 2KIWA 1JROA 1L3TA 4PZNA 3RB3A 1K5OA 5J2JA 4QWAA 3TI0A 2UVUA 3RJEA 3EUB2 1DGSA 5J0RA 4X4UA 3H4DA 2QB1A 4B9MA 2G5HB 3N97B 4JLXA 5B3PA 4HX0A 4FZNA 2JZBB 1L8LA 1LKYB 3THVA 3AN1A 3T5HA 1NK0A 3RAQA 2PBEA 4MHVA 4C7YA 3GV8B 3QX7A 2QARB 3PNCA 1ZQFA 5CP2A 2C2DA 3H0RB 4KLLA 5KFEA 5J2FA 3UXNA 3T3FA 1A0PA 3TANA 4F4YA 2XIDA 2KKPA 4K4IA 1UCVA 4KX5A 4FH5A 3KBBA 2IBKA 1SXEA 3C28A 2ZHBA 3PSFA 4TUQA 2HBJA 3GV7B 4NXZA 2BQRA 3A0BU 5KFCA 7ICQA 1ZJMA 3BQ2A 2HHTA 4FHVA 1MSWD 4OJLA 3ZDCA 2KFNA 2RDIA 2ZTCA 2F1IA 5J8YC 5D46A 4DLEA 3HJ4A 3PX4A 3IV6A 8ICFA 4Q44A 2W3SA 1QQ5A 2ZJ5A 4I2IA 2KHQA 5J2EA 3C2MA 1XC9A 2LBOA 3LVVA 5ALZA 4NWIA 3V6JA 4PL2A 5HRIA 2G09A 1ZQBA 3C5FA 4TQSA 4YXJA 5AI9A 4OAHA 4OJOA 5J2HA 5DQGA 3L4PA 3Q8PB 1RDFA 4KM5A 4Z6CA 4EBJA 4C80A 2W03A 5AKHA 4QZ8A 4I2HA 2WB1F 5HRBA 4FE3A 5ALKA 1PUZA 1KSPA 4C4SA 3QUBA 1PK1A 1SV0C 1LKYA 2AJQA 1S77D 4MFFA 4ECRA 4P0PB 5IIMA 5KFDA 2QARA 2C22A 4FO1A 1ZQYA 2JH7A 4O5CA 2HOQA 2F77X 4RNNA 4Y2PA 4HAIA 1U49A 4WC2A 1Q46A 5HHHA 3PO5A 4KLGA 1RZTA 3NWIA 3QEBZ 1NK5A 4DFJA 5C5JA 2EZXA 3TFRA 1ZD3A 3ZD8A 4RPZA 4UBCA 4X0BA 4C0ZA 4I0UA 2LYBA 2KSOB 4K4GA 3IRUA 2I5HA 3WK7A 5AKXA 2AU0A 1UQVA 2W8KA 4F2RA 4DF4A 4Y2VA 1S0VA 3HPOA 2W7OA 1N56A 1F5SA 1NKBA 2HI0A 4YD1A 7ICHA 3HRDD 5AICA 2E1EA 4UD4A 4K98A 1U45A 4WC7A 4B9SA 1TK8A 2KNJA 1SL0A 2RLTA 2CRXA 3ISBA 4J9LA 3NVOA 4US9A 1PZNA 3C66A 5KFQA 4CRXA 2L5YA 3NVWA 4F4XA 3DDHA 1FEZA 2F2AB 4NLCA 2FLPA 3UQ2A 1PVPA 7ICLA 3ORYA 2AGPA 3LDAA 1ZQNA 3RB0A 4X4RA 2PFOA 3HKZC 2F1JA 1TK0A 1D9FA 8ICLA 4WC3A 4JV0A 3B0YA 4O3QA 2BR0A 3BS5B 3C2KA 1B43A 5KFZA 3PZPA 4XQ8A 1ZQPA 2ZTEA 1TAUA 1BPBA 1L3UA 3ZDDA 5J0UA 2WHEA 1SGGA 2B21A 5HMMA 4DFDA 4ECXA 3V6HA 1PVRA 4JK1A 2ZH7A 4YMMA 5EWGA 4PGYA 2DPIA 5FP0A 3ERCC 3H0LB 4E8FA 3WFOA 4P0QA 2RFFA 5TISU 2IHOA 5DLFA 2DGZA 2W9BB 2KSOA 2RRDA 5CEHA 4DL5A 2GO7A 4US8A 1NO5A 5L1KA 1S0OA 3M9OB 5JUMA 2ISOA 4NV0A 4BGDA 3E2EA 4NL9A 3T5LA 2W9MA 4JB3A 3J81j 1TFYA 5AM1A 5H2FU 1NKCA 2FE9A 5ALSA 3PX6A 1R8CA 5KT6A 3CNHA 2J6TA 3RR7A 1ZQWA 2HVIA 2LKYA 1ZQ1C 3AQEA 4FZLA 2HHPA 4KLUA 5D4BA 2YTUA 4NXVA 1X6IA 4IR9A 4CF3A 1QSYA 4IQTA 5CRXA 2JGAA 3RH4A 5ALTA 2RDJA 3NASA 3F5AA 1D8LA 1Z4OA 4CF5A 2KJ9A 4M6WB 5DLGA 5J2GA 1UEUA 4GLXA 7ICMA 3BS5A 5AK6A 5TZVA 1C20A 7ICVA 4M04A 2E1FA 5ALOA 4KLDA 5CHEA 2MSNA 4C4RA 1CRXA 2GA9D 7ICSA 4NXWA 2IMWP 3MR5A 1TFRA 3A0HU 5HP4A 4YR2A 2XC9A 4E0DA 9ICIA 3B0XA 5B66U 3H40A 1ZQDA 3C18A 4U7CA 4P4PA 3RF9A 2FMSA 3H39A 3JPSA 2W9BA 4ATBB 4DSEA 2ZH6A 3O0FA 2ATLA 1L7MA 3ED5A 5KFHA 3GILA 2FLLA 1ZD4A 2AXTU 3M1YA 3F5EA 3UM9A 5DEDA 3F2DA 2BDPA 4IG8A 2HW3A 2OCEA 4NLNA 4M9HA 1ZQTA 5KFGA 3RJIA 4LZDA 2M2UA 1FFUA 4RQ8A 8ICJA 1UHUA 2BHNA 4K97A 3EWAA 2XVTA 7ICOA 4ELVA 1MIWA 3VC8A 1S0NA 1V85A 4ELUA 2KIVA 4GIBA 2ZIXB 4ECUA 3HW8A 1U47A 2MA1A 1RYRA 1K1SA 3ZDEA 4IRCA 5DECA 2BPFA 3PW2A 2ZXIA 2NV3A 3UPQA 4QZHA 4YFKA 4OJ6A 2DVIA 5JU5A 4NM2A 4FHPA 3PW7A 4M6WA 4B9VA 5KG3A 7ICGA 4PH5A 1T8EA 3IM1A 3IHQB 2PFPA 3PR4A 2JEJA 3I28A 1X9WA 2AGQA 1R8BA 4QWCA 2BDUA 3H3AA 1QSSA 1Z3EB 2R8HA 2K4IA 4EBKA 3KHLA 3K1RB 4KB6A 2DR7A 3SEIA 1FA0A 2BBHA 3EYZA 3H8SA 4QWBA 5AI6A 3ISCA 4IQVA 3ONNA 4KMOB 1JRPA 5J0YA 5EE1A 4J9KA 1K1QA 1ZD2P 2KMDA 4DQSA 3QU5A 2K89A 3FM9A 4E80A 2KVSA 3OSPA 3T5JA 2WF8A 3WKDA 4UQGA 4WCWA 1T7PA 4QZDA 2VA2A 3N7SC 3HIYA 3TADA 4WC5A 3GIJA 2EQYA 4O3NA 5KFWA 4F5NA 3JPPA 2W9AA 1N62A 4QIWF 2DRAA 3IN5A 5ALLA 2AHOB 5CB1A 1ZQVA 2BKEA 4IRKA 5AKYA 4P4MA 3CP8A 5ALHA 4UATA 2PFNA 3MFIA 4WC1A 2KVCA 3C2LA 3SZ2A 4EELA 3L5KA 4WQKA 4O68A 1UEVA 3RAXA 4FS2A 4FO6A 2ZH8A 4DFMA 1KBUA 5D61A 1ZXIA 4UAVA 5C0YA 3GU3A 4ECYA 2M2VA 4KLFA 4F93B 1BNPA 2Y0SF 3HX0A 3GDXA 4EEYA 3MGVA 7ICFA 4Q45A 9ICFA 1KNYA 4IC9A 3QUCA 4LEVA 3WFSC 1HJPA 5KFLA 5EWFA 1X9SA 1QCKA 3WFQE 2IOFK 3EZ5A 2CN1A 3HP6A 1BPXA 1NK4A
chains in the Genus database with same CATH topology
1NKEA 1BPZA 4DSFA 1QTMA 4LZGA 3ZD9A 4TUQA 3GV7B 3AQNA 4NXZA 5J2BA 2XCPA 3KHRA 4ED6A 5KFCA 2BQRA 1ZJMA 7ICQA 1R89A 4KMUA 3BQ2A 5HR9A 2HHTA 4P4OA 2BCVA 1MSWD 4FHVA 7ICKA 5CR0A 3ZDCA 4F5QA 2Y1JA 2PI4A 4XUSA 4MEYA 4CCHA 2RDIA 1U9LA 2ZTCA 2KFNA 4DSKA 1S97A 2F1IA 4F2SA 2LYHA 2P6UA 3C23A 5D46A 4DLEA 3PX4A 3HJ4A 4YVZA 1XSPA 1MQ3A 1ZQKA 8ICFA 4WC0A 4Q44A 8ICBA 8ICPA 4TUSA 5KT2A 4Q8EA 2ZJ5A 4I2IA 5IINA 1LV5A 5J2EA 4J9QA 1L5UA 3V7LA 2BCRA 3C2MA 1XC9A 5F9NA 1L3VA 7ICRA 4XRHA 4B9NA 3V6JA 9ICMA 3OSNA 4KN4A 5HRIA 4QZAA 1ZQBA 3C5FA 5CWRA 2C2RA 5KFOA 1X9MA 1ZQEA 4EZ9A 3QZ7A 8ICQA 4GXJA 1TKDA 5J29A 1IXRA 5KG4A 4F91B 5KFFA 4TQSA 1KFSA 4KLSA 8ICAA 9ICHA 4YXJA 2Q66A 4ELTA 7ICPA 5J2HA 1ZQLA 4NKUA 4EP7A 4O3OA 5DQGA 3JPRA 3OVAA 4O5EA 3Q8PB 5J0QA 3V7JA 4ED7A 3KTQA 1QLNA 2KZZA 1JXEA 2HHXA 3ISDA 4Z6CA 2C28A 3GQCA 5D49A 2ZUDA 4EBJA 3OUYA 2KTQA 8ICWA 4R63A 3Q8RB 1KFTA 4NLZA 2KN7A 4B9LA 4KLHA 3RJGA 1T4GA 4LT6A 1NOMA 5DQIA 4DSJA 4ED3A 2KFZA 4QZ8A 3AQMA 4DL4A 5IIIA 2NRWA 4I2HA 5HRBA 4UAWA 1KSPA 1RXVA 3ZDBA 1JN3A 1JQRA 4EBDA 5CJ7A 4NLKA 3OVSA 5KG2A 2XY6A 4DS5A 8ICZA 3OJSA 4GXKA 4I2AA 4DOBA 4WC4A 3ZDAA 3MGHA 2AJQA 1S77D 4JUZA 2AQ0A 2ASDA 2BGWA 2Y1IA 4MFFA 4ECRA 1TFWA 4DFKA 3V72A 3UXPA 5IIMA 4C8NA 5DB9A 3M9MB 4F50A 2C2EA 2HVHA 2KP7A 5KFDA 1ZQSA 2C22A 1BPEA 8ICYA 1IM4A 2ZJAA 4RZRA 1Q79A 1S9FA 3OVBA 3QEAZ 4O5KA 4YMOA 1ZQYA 4C8OA 4ED1A 4O5CA 5HRFA 2HHVA 2BPGA 5J2AA 4RNNA 1U49A 1SKSA 4WC2A 2Q0ZX 3C1ZA 4YXMA 4DQIA 5HHHA 3PO5A 4X4TA 1KTQA 4RQ5A 1ZETA 4KLGA 1RZTA 1KRPA 3QEBZ 1NK5A 2M9NA 4DFJA 5C5JA 1ZQJA 3HWTA 9ICTA 3TFRA 4NLGA 3ZD8A 1TAQA 4RPZA 1RYSA 4FBUA 4UBCA 8ICSA 4X0BA 1KEJA 3WFPA 4BWMA 3AUOA 4ED2A 4RQ7A 1DK2A 4EZ6A 4K4GA 3V6KA 4I28A 4AT9B 3JYYA 3H38A 4KITB 4R65A 2AU0A 4I2DA 2W8KA 2DR8A 1KDHA 4FHXA 3PW5A 4F2RA 5DB7A 4QZ9A 2W9CB 4DF4A 4X4PA 4G3IA 4M47A 1UA1A 5J0SA 1S0VA 2HHWA 4MF8A 3HPOA 1N56A 1YLQA 4O3RA 1XSNA 1NKBA 8ICEA 4YD1A 7ICHA 1JXLA 5DGAA 2DR9A 2NRXA 4I2CA 2FMPA 4UD4A 2DR5A 1JIHA 1U45A 4WC7A 4B9SA 3K75D 2IHMA 1UT5A 4J9PA 1TK8A 2FLNA 2P66A 4M5DA 1HUZA 1SL0A 4FHYA 4O3PA 1COOA 5EOZA 4J9NA 9ICBA 3ISBA 4J9LA 5HRGA 2P6RA 2O1PA 1D8YA 4MFAA 4EBCA 4KLQA 4F3OA 1PZNA 3C66A 8ICGA 2F1HA 5KFQA 1NJXA 2I1QA 9ICOA 4K4HA 3C21A 4R66A 1AROP 3H4BA 4F4XA 9ICLA 3GIIA 4FH3A 3MDCA 4YN4A 9ICGA 2FLPA 3UQ2A 5J2DA 4DF8A 3RJHA 2XGPA 4KLOA 7ICLA 1CUKA 3ORYA 5KFSA 2V4RA 4DL6A 3PW0A 2AGPA 1NK7A 1RPLA 3LDAA 4YR3A 1N48A 5KFUA 4DSLA 1OU5A 1PX5A 1UA0A 4KLEA 4QZCA 1ZQNA 3RB6A 3MABA 4C8MA 3RB0A 1TK5A 4UD5A 5L9XA 5J2CA 4X4RA 4YR0A 3PV8A 2PFOA 5KFRA 5KT4A 2R8KA 5L1JA 4X4NA 4UB2A 5HRKA 2ZH9A 2F1JA 1TK0A 4I2JA 4Z6DA 3BJYA 1D9FA 8ICLA 3KHHA 5KT7A 4J9MA 4WC3A 4JV0A 4UAYA 3B0YA 2M2TA 4GXIA 3SI8A 4O3QA 2BR0A 3ETLA 1SL1A 4BDPA 3C2KA 4I29A 3UXOA 1B43A 5KFZA 1V9PA 4ZH4A 4RQ2A 1ZQPA 4XQ8A 5KFVA 2ZTEA 1NJYA 1BPBA 1L3UA 1TAUA 9ICJA 3ZDDA 5J0UA 4RWOA 4XQ7A 4F92B 1SKRA 2B21A 5HMMA 4ECXA 4RWPA 3MR2A 3V6HA 3RBDA 5KFPA 7ICIA 5KFAA 4JK1A 4QW9A 4YMMA 4X4OA 2ZH7A 2XY5A 5DDMA 5EWGA 4PGYA 3Q8MA 1ZYQA 2DPIA 5F2VO 5DBCA 4RQ6A 1U48A 1ZQCA 5DG7A 4E8FA 5DB8A 3SV4A 4FHPA 3WFOA 2XGQA 1ZQMA 5HREA 2RFFA 3EPGA 3BQTA 5DLFA 2FPMA 3H8JA 4WC6A 3GIMA 8ICKA 1BPYA 1A76A 2W9BB 4BXOA 4X4SA 1BPDA 4DL5A 3Q8LA 4PHPA 4AT9A 1Y88A 3GV5B 1UETA 1NO5A 4R64A 5L1KA 1S0OA 1ZQIA 5KFYA 3M8SA 5KFIA 3M9OB 5JUMA 1WOTA 2VANA 1Q78A 5J0TA 4O0IA 2W9CA 2ZJ8A 5KG5A 2ISOA 5L1IA 4WBYA 4QZBA 4QZIA 5DG8A 4BGDA 3E2EA 2UVRA 3T5LA 3HJ1A 4UB4A 3RBEA 5HHIA 3RJJA 2HHQA 5J2IA 2W9MA 4X4QA 5HRDA 3C18A 2DRBA 8ICCA 1TFYA 4GC7A 5J0PA 1NKCA 4ED0A 3NTUA 5DG9A 3TQ1A 3PX6A 4UAZA 3PO4A 3FYHA 1R8CA 5KT6A 4I27A 4I2GA 5IILA 2AQ4A 2J6TA 3RR7A 2HHUA 3L9DA 2MUTB 1ZQWA 4PHEA 4ECZA 2ZTDA 3LWMA 5KG7A 1TVAA 1T3NA 3RJFA 2HVIA 4E7XA 8ICMA 3Q8KA 5CA7A 1KLNA 2BE3A 4M9NA 3UQ0A 4IQWA 9ICXA 1DK3A 5CHGA 3TARA 8ICRA 1EXNA 2DFLA 4R8UB 3G6VA 4ECQA 9ICNA 2HHPA 4MFCA 4UB3A 8ICHA 4YD2A 4KLUA 9ICSA 5D4BA 4IR9A 1R8AA 4EBEA 1QSLA 1XWLA 1VJ7A 2XY7A 1S10A 4ATBA 1QSYA 4IQTA 2MAXA 3RH4A 2KZMA 1C7YA 4DQPA 4QZGA 4BXOB 1MC8A 4KLJA 2RDJA 4WBZA 2BQ3A 1ZQUA 5BOMA 4IQUA 3PW4A 1D8LA 2ZH4A 4DS4A 2NRZA 4RQ0A 1X2IA 2ISPA 3UPSA 4DOAA 1NZPA 4M6WB 4KLTA 3N4MB 5DLGA 5J2GA 1UEUA 3GFKB 1WCLA 4RQ3A 4RUAA 4GLXA 7ICMA 3H8WA 3QE9Y 3OHAA 5F9LA 2ASJA 5DBAA 4NM1A 5TZVA 3AQKA 3MR3A 4B9UA 4M9JA 7ICVA 4YG2A 2M2WA 4M04A 4RPXA 5KG6A 2H5XA 4MEXA 3LWLA 4KLDA 4RWNA 1ZQGA 2JEGA 4I2EA 5L1LA 4BWJA 3FDSA 2JEIA 7ICSA 2IMWP 1XU4A 1V4AA 3MR5A 1TFRA 2ZUBA 4TUPA 2R8JA 5HP4A 4YR2A 2XC9A 4YMNA 2WTFA 4E0DA 9ICIA 3B0XA 2KZ3A 3EW9A 4JWNA 5HRHA 2ZUCA 5IIKA 2A1JB 3H40A 4Q8FA 3RR8A 1ZQDA 9ICKA 1UT8A 3PR5B 4DLGA 4ED8A 2XCAA 4F8RA 5KFMA 3RRHA 4P4PA 4Z6EA 1S0MA 2FMSA 3KHGA 4PPXA 3LQCB 3H39A 3JPSA 4ECWA 4KLIA 4I2FA 4M9GA 4RU9A 2W9BA 4ATBB 1KFDA 4DSEA 2ZH6A 4NKTA 2ATLA 4DWIA 9ICPA 5KFHA 2HHSA 3Q8QB 3RRGA 3HIYA 4J9SA 1ZQZA 3GILA 2FLLA 9ICRA 4S3NA 4B9TA 2JEFA 8ICTA 4Z6FA 2IA6A 3RJKA 4O9MA 9ICQA 1SKWA 4DFPA 1MIYA 4EYHB 3Q8SB 4UB5A 2BDPA 4UBBA 4KTQA 4IG8A 1ZQAA 2O5AA 2ZH5A 2DPJA 2HW3A 4NLNA 4M9HA 1ZQTA 3C1YA 4YP3A 2NRVA 3BQ0A 1U4BA 4IRDA 2ID1A 2NRTA 5KFGA 3JPOA 4DL2A 3RJIA 1TV9A 3MGIA 2ZH2A 4LZDA 1RXWA 8ICVA 2M2UA 2BPCA 5J0WA 3NGDA 4RQ8A 4MF2A 8ICJA 1JAJA 2OWOA 2ZH3A 2MUTA 3G6YA 5J2KA 2BHNA 5KFJA 4XA5A 3SV3A 4DO9A 4ECTA 4QZEA 5IIOA 1MQ2A 1DOQA 3EWAA 1MIWA 7ICOA 4ELVA 1L3SA 1MIVA 1S0NA 4ELUA 4F4ZA 4UB1A 5IIJA 3RH6A 4R8UA 3OGUA 3M8RA 3HW8A 4F5RA 4ECUA 4QW8A 1U47A 1K1SA 3ZDEA 4QWDA 1RYRA 2I9GA 1H38A 3EPIA 4C8KA 4IRCA 9ICAA 5DECA 2BPFA 3PW2A 7ICNA 4DSIA 5J0XA 1D9DA 4C8LA 3TAQA 4O3SA 5DQHA 3H37A 1S76D 1ZQOA 3JPQA 4FBTA 4JWMA 5HNKA 3UPQA 1BVSA 4RPYA 4QZHA 4F5OA 4YFKA 4J9OA 4TQRA 2PFQA 8ICOA 4JV1A 2V9WA 3TAPA 2DVIA 4NM2A 4KLMA 4QZFA 3C5GA 3T5KA 4X5VA 2FPLA 2PI5A 4TURA 3PW7A 2FMQA 4M6WA 5HMLA 2VA8A 5DDYA 4RNOA 1NJZA 2J6SA 4KN7A 4AT7A 1VFGA 4AT8B 3AQLA 4DOCA 4M9LA 1XO1A 4B9VA 5KG1A 5KG3A 4ECVA 3H7IA 2PXIA 2IHNA 7ICGA 3NYBA 4PH5A 4X4VA 1T8EA 9ICEA 3SYZA 3IM1A 4RQ4A 3IHQB 3PMLA 2GWSA 2BQUA 4JV2A 9ICWA 2W8LA 2NRKA 2PFPA 4PHAA 1JMSA 3PR4A 2JEJA 5KTQA 5KT3A 4J9RA 4EYIB 2AGQA 1X9WA 2UVWA 1B22A 5HRLA 4GC6A 4QWCA 1R8BA 1Z00A 3H3AA 7ICTA 1QSSA 1Z3EB 2UVVA 2R8HA 5BOLA 1NK9A 1JX4A 3PY8A 4EBKA 1BGXT 3OJUA 2VA3A 4M2YA 3KHLA 1NK6A 4RUCA 3WFRE 1F5AA 5KFNA 4FHWA 1XS9D 9ICCA 1SZPA 3G6XA 1ZQXA 4YQWA 7ICUA 8ICXA 2A1JA 3RTVA 5DB6A 2DR7A 4YCXA 2JZBA 2FPKA 1FA0A 3EYZA 4M0AA 3H8SA 4QWBA 1NK8A 3ISCA 4IQVA 7ICEA 5KFTA 5J0YA 4RT3A 8ICNA 3GIKA 4HYKA 1CEZA 2V4QA 3AU2A 4J9KA 1K1QA 4DQSA 5HC9A 4DEZA 4PGXA 2XO7A 2R8IA 4E80A 3PVXA 2BCQA 5EWEA 4F5PA 1ZQHA 4DQQA 3HP6A 2AGOA 3BDPA 4PHDA 4FS1A 3OSPA 5KG0A 4LVSA 3T5JA 5DBBA 4UQGA 4RNMA 2ALZA 2ZH1A 4AT7B 5DKWA 4RQ1A 4RT2A 3LK9A 2BCUA 1T7PA 4IR1A 4WCWA 5DGBA 4QZDA 2VA2A 5KT5A 8ICIA 3PX0A 1A77A 3QZ8A 3HT3A 2ASLA 3JPNA 1SL2A 4I2BA 4WC5A 3GIJA 5DEDA 4O3NA 1L3TA 3RB3A 1XSLA 5KFWA 4F5NA 3JPPA 2ZHAA 3MR6A 2W9AA 9ICUA 5J2JA 4QWAA 1LB2B 3TI0A 1BNOA 5KFKA 2UVUA 7ICJA 3OUYB 2DRAA 3RJEA 1DGSA 5J0RA 5CB1A 2R8GA 1Z00B 3M9NB 3TFSA 3BQ1A 1ZQVA 2BKEA 4IRKA 4X4UA 4P4MA 3H4DA 3JPTA 2PFNA 3MFIA 4WC1A 5BPCA 3C2LA 4B9MA 5KFXA 4RWQA 3SZ2A 3N97B 5KFBA 4QWEA 3MBYA 3OHBA 1UEVA 3RAXA 4FS2A 4FO6A 2JZBB 3PMNA 3V7KA 1ZQRA 4F4WA 3THVA 2ZH8A 3T5HA 1NJWA 1NK0A 3RAQA 4NY8A 2PBEA 3OV7A 9ICVA 2J6UA 4DFMA 3RB4A 4P2HA 3GV8B 8ICUA 2ZHBA 4ECYA 2M2VA 3PNCA 1ZQFA 4KLFA 4F93B 5CP2A 4X0AA 1BNPA 3HX0A 3GDXA 2C2DA 4EEYA 7ICFA 4KLLA 5KFEA 4Q45A 5J2FA 3MFHA 5J0OA 3UXNA 9ICFA 3K4GA 1KNYA 4AT8A 3T3FA 1HUOA 3TANA 4F4YA 4DL3A 1ZQQA 3RH5A 3WFSC 1HJPA 5KFLA 5EWFA 4PGQA 4ECSA 4Q43A 1X9SA 4F4KA 4K4IA 3AU6A 3WFQE 3EZ5A 3MDAA 4DQRA 1ZJNA 4FH5A 2BCSA 2IBKA 3JZ0A 4DL7A 1WCNA 1BPXA 1NK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKE A;  1BPZ A;  4DSF A;  1QTM A;  4LZG A;  3ZD9 A;  4TUQ A;  3GV7 B;  3AQN A;  4NXZ A;  5J2B A;  2XCP A;  3KHR A;  4ED6 A;  5KFC A;  2BQR A;  1ZJM A;  7ICQ A;  1R89 A;  4KMU A;  3BQ2 A;  5HR9 A;  2HHT A;  4P4O A;  2BCV A;  1MSW D;  4FHV A;  7ICK A;  5CR0 A;  3ZDC A;  4F5Q A;  2Y1J A;  2PI4 A;  4XUS A;  4MEY A;  4CCH A;  2RDI A;  1U9L A;  2ZTC A;  2KFN A;  4DSK A;  1S97 A;  2F1I A;  4F2S A;  2LYH A;  2P6U A;  3C23 A;  5D46 A;  4DLE A;  3PX4 A;  3HJ4 A;  4YVZ A;  1XSP A;  1MQ3 A;  1ZQK A;  8ICF A;  4WC0 A;  4Q44 A;  8ICB A;  8ICP A;  4TUS A;  5KT2 A;  4Q8E A;  2ZJ5 A;  4I2I A;  5IIN A;  1LV5 A;  5J2E A;  4J9Q A;  1L5U A;  3V7L A;  2BCR A;  3C2M A;  1XC9 A;  5F9N A;  1L3V A;  7ICR A;  4XRH A;  4B9N A;  3V6J A;  9ICM A;  3OSN A;  4KN4 A;  5HRI A;  4QZA A;  1ZQB A;  3C5F A;  5CWR A;  2C2R A;  5KFO A;  1X9M A;  1ZQE A;  4EZ9 A;  3QZ7 A;  8ICQ A;  4GXJ A;  1TKD A;  5J29 A;  1IXR A;  5KG4 A;  4F91 B;  5KFF A;  4TQS A;  1KFS A;  4KLS A;  8ICA A;  9ICH A;  4YXJ A;  2Q66 A;  4ELT A;  7ICP A;  5J2H A;  1ZQL A;  4NKU A;  4EP7 A;  4O3O A;  5DQG A;  3JPR A;  3OVA A;  4O5E A;  3Q8P B;  5J0Q A;  3V7J A;  4ED7 A;  3KTQ A;  1QLN A;  2KZZ A;  1JXE A;  2HHX A;  3ISD A;  4Z6C A;  2C28 A;  3GQC A;  5D49 A;  2ZUD A;  4EBJ A;  3OUY A;  2KTQ A;  8ICW A;  4R63 A;  3Q8R B;  1KFT A;  4NLZ A;  2KN7 A;  4B9L A;  4KLH A;  3RJG A;  1T4G A;  4LT6 A;  1NOM A;  5DQI A;  4DSJ A;  4ED3 A;  2KFZ A;  4QZ8 A;  3AQM A;  4DL4 A;  5III A;  2NRW A;  4I2H A;  5HRB A;  4UAW A;  1KSP A;  1RXV A;  3ZDB A;  1JN3 A;  1JQR A;  4EBD A;  5CJ7 A;  4NLK A;  3OVS A;  5KG2 A;  2XY6 A;  4DS5 A;  8ICZ A;  3OJS A;  4GXK A;  4I2A A;  4DOB A;  4WC4 A;  3ZDA A;  3MGH A;  2AJQ A;  1S77 D;  4JUZ A;  2AQ0 A;  2ASD A;  2BGW A;  2Y1I A;  4MFF A;  4ECR A;  1TFW A;  4DFK A;  3V72 A;  3UXP A;  5IIM A;  4C8N A;  5DB9 A;  3M9M B;  4F50 A;  2C2E A;  2HVH A;  2KP7 A;  5KFD A;  1ZQS A;  2C22 A;  1BPE A;  8ICY A;  1IM4 A;  2ZJA A;  4RZR A;  1Q79 A;  1S9F A;  3OVB A;  3QEA Z;  4O5K A;  4YMO A;  1ZQY A;  4C8O A;  4ED1 A;  4O5C A;  5HRF A;  2HHV A;  2BPG A;  5J2A A;  4RNN A;  1U49 A;  1SKS A;  4WC2 A;  2Q0Z X;  3C1Z A;  4YXM A;  4DQI A;  5HHH A;  3PO5 A;  4X4T A;  1KTQ A;  4RQ5 A;  1ZET A;  4KLG A;  1RZT A;  1KRP A;  3QEB Z;  1NK5 A;  2M9N A;  4DFJ A;  5C5J A;  1ZQJ A;  3HWT A;  9ICT A;  3TFR A;  4NLG A;  3ZD8 A;  1TAQ A;  4RPZ A;  1RYS A;  4FBU A;  4UBC A;  8ICS A;  4X0B A;  1KEJ A;  3WFP A;  4BWM A;  3AUO A;  4ED2 A;  4RQ7 A;  1DK2 A;  4EZ6 A;  4K4G A;  3V6K A;  4I28 A;  4AT9 B;  3JYY A;  3H38 A;  4KIT B;  4R65 A;  2AU0 A;  4I2D A;  2W8K A;  2DR8 A;  1KDH A;  4FHX A;  3PW5 A;  4F2R A;  5DB7 A;  4QZ9 A;  2W9C B;  4DF4 A;  4X4P A;  4G3I A;  4M47 A;  1UA1 A;  5J0S A;  1S0V A;  2HHW A;  4MF8 A;  3HPO A;  1N56 A;  1YLQ A;  4O3R A;  1XSN A;  1NKB A;  8ICE A;  4YD1 A;  7ICH A;  1JXL A;  5DGA A;  2DR9 A;  2NRX A;  4I2C A;  2FMP A;  4UD4 A;  2DR5 A;  1JIH A;  1U45 A;  4WC7 A;  4B9S A;  3K75 D;  2IHM A;  1UT5 A;  4J9P A;  1TK8 A;  2FLN A;  2P66 A;  4M5D A;  1HUZ A;  1SL0 A;  4FHY A;  4O3P A;  1COO A;  5EOZ A;  4J9N A;  9ICB A;  3ISB A;  4J9L A;  5HRG A;  2P6R A;  2O1P A;  1D8Y A;  4MFA A;  4EBC A;  4KLQ A;  4F3O A;  1PZN A;  3C66 A;  8ICG A;  2F1H A;  5KFQ A;  1NJX A;  2I1Q A;  9ICO A;  4K4H A;  3C21 A;  4R66 A;  1ARO P;  3H4B A;  4F4X A;  9ICL A;  3GII A;  4FH3 A;  3MDC A;  4YN4 A;  9ICG A;  2FLP A;  3UQ2 A;  5J2D A;  4DF8 A;  3RJH A;  2XGP A;  4KLO A;  7ICL A;  1CUK A;  3ORY A;  5KFS A;  2V4R A;  4DL6 A;  3PW0 A;  2AGP A;  1NK7 A;  1RPL A;  3LDA A;  4YR3 A;  1N48 A;  5KFU A;  4DSL A;  1OU5 A;  1PX5 A;  1UA0 A;  4KLE A;  4QZC A;  1ZQN A;  3RB6 A;  3MAB A;  4C8M A;  3RB0 A;  1TK5 A;  4UD5 A;  5L9X A;  5J2C A;  4X4R A;  4YR0 A;  3PV8 A;  2PFO A;  5KFR A;  5KT4 A;  2R8K A;  5L1J A;  4X4N A;  4UB2 A;  5HRK A;  2ZH9 A;  2F1J A;  1TK0 A;  4I2J A;  4Z6D A;  3BJY A;  1D9F A;  8ICL A;  3KHH A;  5KT7 A;  4J9M A;  4WC3 A;  4JV0 A;  4UAY A;  3B0Y A;  2M2T A;  4GXI A;  3SI8 A;  4O3Q A;  2BR0 A;  3ETL A;  1SL1 A;  4BDP A;  3C2K A;  4I29 A;  3UXO A;  1B43 A;  5KFZ A;  1V9P A;  4ZH4 A;  4RQ2 A;  1ZQP A;  4XQ8 A;  5KFV A;  2ZTE A;  1NJY A;  1BPB A;  1L3U A;  1TAU A;  9ICJ A;  3ZDD A;  5J0U A;  4RWO A;  4XQ7 A;  4F92 B;  1SKR A;  2B21 A;  5HMM A;  4ECX A;  4RWP A;  3MR2 A;  3V6H A;  3RBD A;  5KFP A;  7ICI A;  5KFA A;  4JK1 A;  4QW9 A;  4YMM A;  4X4O A;  2ZH7 A;  2XY5 A;  5DDM A;  5EWG A;  4PGY A;  3Q8M A;  1ZYQ A;  2DPI A;  5F2V O;  5DBC A;  4RQ6 A;  1U48 A;  1ZQC A;  5DG7 A;  4E8F A;  5DB8 A;  3SV4 A;  4FHP A;  3WFO A;  2XGQ A;  1ZQM A;  5HRE A;  2RFF A;  3EPG A;  3BQT A;  5DLF A;  2FPM A;  3H8J A;  4WC6 A;  3GIM A;  8ICK A;  1BPY A;  1A76 A;  2W9B B;  4BXO A;  4X4S A;  1BPD A;  4DL5 A;  3Q8L A;  4PHP A;  4AT9 A;  1Y88 A;  3GV5 B;  1UET A;  1NO5 A;  4R64 A;  5L1K A;  1S0O A;  1ZQI A;  5KFY A;  3M8S A;  5KFI A;  3M9O B;  5JUM A;  1WOT A;  2VAN A;  1Q78 A;  5J0T A;  4O0I A;  2W9C A;  2ZJ8 A;  5KG5 A;  2ISO A;  5L1I A;  4WBY A;  4QZB A;  4QZI A;  5DG8 A;  4BGD A;  3E2E A;  2UVR A;  3T5L A;  3HJ1 A;  4UB4 A;  3RBE A;  5HHI A;  3RJJ A;  2HHQ A;  5J2I A;  2W9M A;  4X4Q A;  5HRD A;  3C18 A;  2DRB A;  8ICC A;  1TFY A;  4GC7 A;  5J0P A;  1NKC A;  4ED0 A;  3NTU A;  5DG9 A;  3TQ1 A;  3PX6 A;  4UAZ A;  3PO4 A;  3FYH A;  1R8C A;  5KT6 A;  4I27 A;  4I2G A;  5IIL A;  2AQ4 A;  2J6T A;  3RR7 A;  2HHU A;  3L9D A;  2MUT B;  1ZQW A;  4PHE A;  4ECZ A;  2ZTD A;  3LWM A;  5KG7 A;  1TVA A;  1T3N A;  3RJF A;  2HVI A;  4E7X A;  8ICM A;  3Q8K A;  5CA7 A;  1KLN A;  2BE3 A;  4M9N A;  3UQ0 A;  4IQW A;  9ICX A;  1DK3 A;  5CHG A;  3TAR A;  8ICR A;  1EXN A;  2DFL A;  4R8U B;  3G6V A;  4ECQ A;  9ICN A;  2HHP A;  4MFC A;  4UB3 A;  8ICH A;  4YD2 A;  4KLU A;  9ICS A;  5D4B A;  4IR9 A;  1R8A A;  4EBE A;  1QSL A;  1XWL A;  1VJ7 A;  2XY7 A;  1S10 A;  4ATB A;  1QSY A;  4IQT A;  2MAX A;  3RH4 A;  2KZM A;  1C7Y A;  4DQP A;  4QZG A;  4BXO B;  1MC8 A;  4KLJ A;  2RDJ A;  4WBZ A;  2BQ3 A;  1ZQU A;  5BOM A;  4IQU A;  3PW4 A;  1D8L A;  2ZH4 A;  4DS4 A;  2NRZ A;  4RQ0 A;  1X2I A;  2ISP A;  3UPS A;  4DOA A;  1NZP A;  4M6W B;  4KLT A;  3N4M B;  5DLG A;  5J2G A;  1UEU A;  3GFK B;  1WCL A;  4RQ3 A;  4RUA A;  4GLX A;  7ICM A;  3H8W A;  3QE9 Y;  3OHA A;  5F9L A;  2ASJ A;  5DBA A;  4NM1 A;  5TZV A;  3AQK A;  3MR3 A;  4B9U A;  4M9J A;  7ICV A;  4YG2 A;  2M2W A;  4M04 A;  4RPX A;  5KG6 A;  2H5X A;  4MEX A;  3LWL A;  4KLD A;  4RWN A;  1ZQG A;  2JEG A;  4I2E A;  5L1L A;  4BWJ A;  3FDS A;  2JEI A;  7ICS A;  2IMW P;  1XU4 A;  1V4A A;  3MR5 A;  1TFR A;  2ZUB A;  4TUP A;  2R8J A;  5HP4 A;  4YR2 A;  2XC9 A;  4YMN A;  2WTF A;  4E0D A;  9ICI A;  3B0X A;  2KZ3 A;  3EW9 A;  4JWN A;  5HRH A;  2ZUC A;  5IIK A;  2A1J B;  3H40 A;  4Q8F A;  3RR8 A;  1ZQD A;  9ICK A;  1UT8 A;  3PR5 B;  4DLG A;  4ED8 A;  2XCA A;  4F8R A;  5KFM A;  3RRH A;  4P4P A;  4Z6E A;  1S0M A;  2FMS A;  3KHG A;  4PPX A;  3LQC B;  3H39 A;  3JPS A;  4ECW A;  4KLI A;  4I2F A;  4M9G A;  4RU9 A;  2W9B A;  4ATB B;  1KFD A;  4DSE A;  2ZH6 A;  4NKT A;  2ATL A;  4DWI A;  9ICP A;  5KFH A;  2HHS A;  3Q8Q B;  3RRG A;  3HIY A;  4J9S A;  1ZQZ A;  3GIL A;  2FLL A;  9ICR A;  4S3N A;  4B9T A;  2JEF A;  8ICT A;  4Z6F A;  2IA6 A;  3RJK A;  4O9M A;  9ICQ A;  1SKW A;  4DFP A;  1MIY A;  4EYH B;  3Q8S B;  4UB5 A;  2BDP A;  4UBB A;  4KTQ A;  4IG8 A;  1ZQA A;  2O5A A;  2ZH5 A;  2DPJ A;  2HW3 A;  4NLN A;  4M9H A;  1ZQT A;  3C1Y A;  4YP3 A;  2NRV A;  3BQ0 A;  1U4B A;  4IRD A;  2ID1 A;  2NRT A;  5KFG A;  3JPO A;  4DL2 A;  3RJI A;  1TV9 A;  3MGI A;  2ZH2 A;  4LZD A;  1RXW A;  8ICV A;  2M2U A;  2BPC A;  5J0W A;  3NGD A;  4RQ8 A;  4MF2 A;  8ICJ A;  1JAJ A;  2OWO A;  2ZH3 A;  2MUT A;  3G6Y A;  5J2K A;  2BHN A;  5KFJ A;  4XA5 A;  3SV3 A;  4DO9 A;  4ECT A;  4QZE A;  5IIO A;  1MQ2 A;  1DOQ A;  3EWA A;  1MIW A;  7ICO A;  4ELV A;  1L3S A;  1MIV A;  1S0N A;  4ELU A;  4F4Z A;  4UB1 A;  5IIJ A;  3RH6 A;  4R8U A;  3OGU A;  3M8R A;  3HW8 A;  4F5R A;  4ECU A;  4QW8 A;  1U47 A;  1K1S A;  3ZDE A;  4QWD A;  1RYR A;  2I9G A;  1H38 A;  3EPI A;  4C8K A;  4IRC A;  9ICA A;  5DEC A;  2BPF A;  3PW2 A;  7ICN A;  4DSI A;  5J0X A;  1D9D A;  4C8L A;  3TAQ A;  4O3S A;  5DQH A;  3H37 A;  1S76 D;  1ZQO A;  3JPQ A;  4FBT A;  4JWM A;  5HNK A;  3UPQ A;  1BVS A;  4RPY A;  4QZH A;  4F5O A;  4YFK A;  4J9O A;  4TQR A;  2PFQ A;  8ICO A;  4JV1 A;  2V9W A;  3TAP A;  2DVI A;  4NM2 A;  4KLM A;  4QZF A;  3C5G A;  3T5K A;  4X5V A;  2FPL A;  2PI5 A;  4TUR A;  3PW7 A;  2FMQ A;  4M6W A;  5HML A;  2VA8 A;  5DDY A;  4RNO A;  1NJZ A;  2J6S A;  4KN7 A;  4AT7 A;  1VFG A;  4AT8 B;  3AQL A;  4DOC A;  4M9L A;  1XO1 A;  4B9V A;  5KG1 A;  5KG3 A;  4ECV A;  3H7I A;  2PXI A;  2IHN A;  7ICG A;  3NYB A;  4PH5 A;  4X4V A;  1T8E A;  9ICE A;  3SYZ A;  3IM1 A;  4RQ4 A;  3IHQ B;  3PML A;  2GWS A;  2BQU A;  4JV2 A;  9ICW A;  2W8L A;  2NRK A;  2PFP A;  4PHA A;  1JMS A;  3PR4 A;  2JEJ A;  5KTQ A;  5KT3 A;  4J9R A;  4EYI B;  2AGQ A;  1X9W A;  2UVW A;  1B22 A;  5HRL A;  4GC6 A;  4QWC A;  1R8B A;  1Z00 A;  3H3A A;  7ICT A;  1QSS A;  1Z3E B;  2UVV A;  2R8H A;  5BOL A;  1NK9 A;  1JX4 A;  3PY8 A;  4EBK A;  1BGX T;  3OJU A;  2VA3 A;  4M2Y A;  3KHL A;  1NK6 A;  4RUC A;  3WFR E;  1F5A A;  5KFN A;  4FHW A;  1XS9 D;  9ICC A;  1SZP A;  3G6X A;  1ZQX A;  4YQW A;  7ICU A;  8ICX A;  2A1J A;  3RTV A;  5DB6 A;  2DR7 A;  4YCX A;  2JZB A;  2FPK A;  1FA0 A;  3EYZ A;  4M0A A;  3H8S A;  4QWB A;  1NK8 A;  3ISC A;  4IQV A;  7ICE A;  5KFT A;  5J0Y A;  4RT3 A;  8ICN A;  3GIK A;  4HYK A;  1CEZ A;  2V4Q A;  3AU2 A;  4J9K A;  1K1Q A;  4DQS A;  5HC9 A;  4DEZ A;  4PGX A;  2XO7 A;  2R8I A;  4E80 A;  3PVX A;  2BCQ A;  5EWE A;  4F5P A;  1ZQH A;  4DQQ A;  3HP6 A;  2AGO A;  3BDP A;  4PHD A;  4FS1 A;  3OSP A;  5KG0 A;  4LVS A;  3T5J A;  5DBB A;  4UQG A;  4RNM A;  2ALZ A;  2ZH1 A;  4AT7 B;  5DKW A;  4RQ1 A;  4RT2 A;  3LK9 A;  2BCU A;  1T7P A;  4IR1 A;  4WCW A;  5DGB A;  4QZD A;  2VA2 A;  5KT5 A;  8ICI A;  3PX0 A;  1A77 A;  3QZ8 A;  3HT3 A;  2ASL A;  3JPN A;  1SL2 A;  4I2B A;  4WC5 A;  3GIJ A;  5DED A;  4O3N A;  1L3T A;  3RB3 A;  1XSL A;  5KFW A;  4F5N A;  3JPP A;  2ZHA A;  3MR6 A;  2W9A A;  9ICU A;  5J2J A;  4QWA A;  1LB2 B;  3TI0 A;  1BNO A;  5KFK A;  2UVU A;  7ICJ A;  3OUY B;  2DRA A;  3RJE A;  1DGS A;  5J0R A;  5CB1 A;  2R8G A;  1Z00 B;  3M9N B;  3TFS A;  3BQ1 A;  1ZQV A;  2BKE A;  4IRK A;  4X4U A;  4P4M A;  3H4D A;  3JPT A;  2PFN A;  3MFI A;  4WC1 A;  5BPC A;  3C2L A;  4B9M A;  5KFX A;  4RWQ A;  3SZ2 A;  3N97 B;  5KFB A;  4QWE A;  3MBY A;  3OHB A;  1UEV A;  3RAX A;  4FS2 A;  4FO6 A;  2JZB B;  3PMN A;  3V7K A;  1ZQR A;  4F4W A;  3THV A;  2ZH8 A;  3T5H A;  1NJW A;  1NK0 A;  3RAQ A;  4NY8 A;  2PBE A;  3OV7 A;  9ICV A;  2J6U A;  4DFM A;  3RB4 A;  4P2H A;  3GV8 B;  8ICU A;  2ZHB A;  4ECY A;  2M2V A;  3PNC A;  1ZQF A;  4KLF A;  4F93 B;  5CP2 A;  4X0A A;  1BNP A;  3HX0 A;  3GDX A;  2C2D A;  4EEY A;  7ICF A;  4KLL A;  5KFE A;  4Q45 A;  5J2F A;  3MFH A;  5J0O A;  3UXN A;  9ICF A;  3K4G A;  1KNY A;  4AT8 A;  3T3F A;  1HUO A;  3TAN A;  4F4Y A;  4DL3 A;  1ZQQ A;  3RH5 A;  3WFS C;  1HJP A;  5KFL A;  5EWF A;  4PGQ A;  4ECS A;  4Q43 A;  1X9S A;  4F4K A;  4K4I A;  3AU6 A;  3WFQ E;  3EZ5 A;  3MDA A;  4DQR A;  1ZJN A;  4FH5 A;  2BCS A;  2IBK A;  3JZ0 A;  4DL7 A;  1WCN A;  1BPX A;  1NK4 A; 
#chains in the Genus database with same CATH topology
 4DSF A;  1QTM A;  4LZG A;  2XCP A;  4ED6 A;  2BCV A;  1ZOL A;  7ICK A;  2D8C A;  1RM6 C;  4F5Q A;  2PI4 A;  1U9L A;  3C23 A;  4YVZ A;  1XSP A;  1ZQK A;  2YN4 A;  1L5U A;  5JRT A;  5D63 A;  4AP9 A;  2WB1 C;  2C2R A;  2Q4T A;  5KFO A;  2ZHA A;  2EZZ A;  3WK6 A;  3QZ7 A;  1TKD A;  1IXR A;  5KG4 A;  5AM5 A;  1N2X A;  1QQ7 A;  3DEE A;  5KAI U;  5CFS A;  3OVA A;  4O5E A;  5J0Q A;  3V7J A;  3KTQ A;  2KZZ A;  3ISD A;  2C28 A;  5D49 A;  2ZUD A;  2KTQ A;  1X42 A;  3Q8R B;  4KLH A;  3RJG A;  5DQI A;  2KFZ A;  2E8N A;  1RXV A;  3ZDB A;  4NLK A;  3OVS A;  4DS5 A;  4DOB A;  4CNQ A;  2BGW A;  2Y1I A;  4DFK A;  3M9M B;  4OAI Z;  3S6J A;  1Q8K A;  3OVB A;  1HEK A;  3QEA Z;  2HN2 A;  5ALW A;  3BZC A;  2HHV A;  2WAQ F;  3R9K A;  1XNS A;  2Q0Z X;  3KD3 A;  2HCF A;  1KRP A;  9ICT A;  4JLZ A;  1RYS A;  4FBU A;  4ED2 A;  1V97 A;  2F76 X;  4K8V A;  4I2D A;  1OUQ A;  2DR8 A;  4UAU A;  5AM0 A;  2LI6 A;  3PW5 A;  4FHX A;  1T3Q A;  3CW2 C;  4X4P A;  5D62 A;  4M47 A;  1UA1 A;  2W3R A;  1YLQ A;  1PK1 B;  4O3R A;  3LYS A;  1JXL A;  5DGA A;  2FMP A;  2DR5 A;  2OEH A;  1UT5 A;  4JMU A;  2K8B B;  5ALQ A;  5AKJ A;  2LYA A;  4KLQ A;  4F3O A;  3NUQ A;  9ICO A;  2I1Q A;  1O03 A;  4R66 A;  9ICL A;  4FH3 A;  4YN4 A;  2PKE A;  4DF8 A;  1CUK A;  5KFS A;  1N48 A;  1RPL A;  4YR3 A;  5KFU A;  2BBJ A;  1UA0 A;  3MAB A;  4C8M A;  4UD5 A;  5L9X A;  5J2C A;  5AI0 A;  2OM6 A;  5L1J A;  5HRK A;  2ZH9 A;  4I2J A;  4Z6D A;  4EX7 A;  4J9M A;  2M2T A;  4RWN A;  1V9P A;  1D8B A;  9ICJ A;  2YMM A;  4RWP A;  3HIL A;  4K99 A;  4QW9 A;  2XY5 A;  5DDM A;  1ZRM A;  3E58 A;  3KKA A;  1ZYQ A;  3T79 A;  2ZIU B;  3EPG A;  4BXO A;  1BPD A;  3I1Y A;  3GV5 B;  1ZQI A;  1WOT A;  2VAN A;  4UB8 U;  5L1I A;  4QZB A;  5DG8 A;  3HJ1 A;  2KJ8 A;  4GC7 A;  4ED0 A;  5DG9 A;  3TQ1 A;  3FYH A;  4A8E A;  3IG5 A;  5T14 A;  4ECZ A;  4Y2X A;  1T3N A;  1TVA A;  1JUD A;  3F2B A;  8ICM A;  4B6J A;  4IQW A;  4ICA A;  5CHG A;  3TAR A;  5ALV A;  4R8U B;  4ECQ A;  9ICN A;  2P35 A;  4C4T A;  4EV6 A;  4P0Q B;  1VJ7 A;  3SEN A;  4ACO A;  2KJ5 A;  3FAH A;  3I76 A;  4DQP A;  1MC8 A;  4WOY A;  2ZH4 A;  4DS4 A;  4RQ0 A;  1X2I A;  1S8O A;  2E8M A;  3UPS A;  3NVZ A;  1N61 A;  3QU4 A;  4KLT A;  5AKI A;  5EE0 A;  1Q3U A;  3GFK B;  1WCL A;  1N60 A;  3H8W A;  1L7P A;  2ASJ A;  1SXD A;  2EAN A;  5KG6 A;  2VIX A;  2BZF A;  3BQ7 A;  3FDS A;  3D2S A;  1V4A A;  1LVH A;  3F2C A;  2ZUB A;  4TUP A;  2IUB A;  2YMQ A;  4JWN A;  2ZIU A;  5HRH A;  1WWV A;  1UT8 A;  4K9B A;  2XCA A;  4EX6 A;  5KFM A;  4ECW A;  4I2F A;  4RU9 A;  2G07 A;  1A6S A;  3CRX A;  2ZIW B;  2OH2 A;  4J9S A;  2O6K A;  2KD1 A;  4Z6F A;  2IA6 A;  3RJK A;  4DFP A;  5ALN A;  3Q8S B;  2ZH5 A;  3C1Y A;  2VJ5 A;  2NRV A;  3BQ0 A;  3RFA A;  3MGI A;  4GFJ A;  5J0W A;  3NGD A;  4MF2 A;  4XA5 A;  4QZE A;  5IIO A;  1MQ2 A;  1MIV A;  3WKC A;  5J8Y A;  4O69 A;  4F4Z A;  3RH6 A;  5IIJ A;  2DF4 B;  4R8U A;  4F5R A;  2I9G A;  5HC9 A;  4QWD A;  2YY6 A;  9ICA A;  2FJ6 A;  4OO1 J;  4C8L A;  3TAQ A;  4OJP A;  3SQI A;  1S76 D;  5ALY A;  2A3V A;  3F53 A;  1WCN A;  1BVS A;  4J9O A;  1NI3 A;  2V9W A;  3TAP A;  3T5K A;  2JXJ A;  2FPL A;  3GZF A;  2FMQ A;  4RNO A;  2G0A A;  4USA A;  4DOC A;  4ECV A;  4X4V A;  3NYB A;  2N1R A;  4O3M A;  3SYZ A;  4RQ4 A;  9ICW A;  3NKU A;  1S5L U;  2BQU A;  5KT3 A;  2UVW A;  5HRL A;  1Z00 A;  1RYU A;  5BOL A;  1JX4 A;  3PY8 A;  3SD7 A;  1BGX T;  4M2Y A;  1SV0 A;  3WFR E;  3JCF A;  4RUC A;  2EDU A;  1F5A A;  3G6X A;  8ICX A;  3PST A;  5AI5 A;  1WYG A;  4M0A A;  1MA7 A;  2W11 A;  2ZIW A;  4CE6 A;  3IG8 A;  4QIW C;  4HYK A;  2V4Q A;  3BZK A;  4DEZ A;  2R8I A;  2HMX A;  2BCQ A;  4QJF B;  1KKX A;  2ALZ A;  4IR1 A;  2BCU A;  3D2N A;  5KT5 A;  3PX0 A;  5AHX A;  1SV4 A;  3QZ8 A;  3HT3 A;  3JPN A;  1SL2 A;  4I2B A;  3MR6 A;  2QB0 B;  1X9X A;  2KIC A;  3ER9 B;  4UB6 U;  7ICJ A;  3OUY B;  5AM3 A;  4FFD A;  4RQM A;  3BQ1 A;  3QUQ A;  2Y0S C;  1WWU A;  5BPC A;  5KFX A;  3QU9 A;  2W43 A;  3AMZ A;  3MBY A;  3D2Q A;  2FCL A;  1ZQR A;  4NLB A;  3OV7 A;  4F71 A;  9ICV A;  5EE9 A;  2J6U A;  2F3N A;  4EED A;  2R18 A;  4P2H A;  4KX3 A;  8ICU A;  2DQN B;  2GAF D;  2H3Z A;  3SAF A;  2FDR A;  5J0O A;  2Z7J A;  3D6J A;  3DV9 A;  5E79 U;  1ZQQ A;  4PGQ A;  5G5G A;  4DQR A;  1Z1B A;  1JQR A;  4DL7 A;  2JEF A;  1NKE A;  3ZD9 A;  3UMG A;  3AQN A;  5J2B A;  1DRG A;  1R89 A;  4KMU A;  3BS7 A;  5HR9 A;  4CGZ A;  2DL0 A;  4XUS A;  4CCH A;  5HR7 A;  4IL6 U;  4F2S A;  2LYH A;  2P6U A;  4WC0 A;  1N5X A;  8ICP A;  4TUS A;  5KT2 A;  1URJ A;  1X40 A;  4ZOH C;  5IIN A;  4OCZ A;  3V7L A;  4LEY A;  2B0C A;  3NRW A;  4XRH A;  3KOO A;  9ICM A;  2JRZ A;  4KN4 A;  1IIP A;  4QZA A;  3LVW A;  1VJ5 A;  8ICQ A;  5J29 A;  5KFF A;  4F91 B;  1KFS A;  8ICA A;  4ELT A;  7ICP A;  1ZQL A;  2NO4 A;  3JPR A;  4ED7 A;  1QLN A;  2QB0 A;  2HBM A;  2HHX A;  3GQC A;  3OUY A;  1PK3 A;  1KFT A;  2KN7 A;  4B9L A;  1T4G A;  1NOM A;  4DSJ A;  2WF5 A;  5III A;  4UAW A;  2WAQ C;  4EBD A;  5CJ7 A;  5KG2 A;  8ICZ A;  5AKG A;  3WKE A;  3OJS A;  1Z19 A;  3ZDA A;  1T94 A;  4JUZ A;  2ASD A;  4WH5 A;  1TFW A;  1VLB A;  3V72 A;  3OTQ A;  5DB9 A;  2HOI A;  2C2E A;  2HVH A;  1UPH A;  1ZQS A;  1IM4 A;  1Q79 A;  2G5I B;  1S9F A;  3NRZ A;  4O5K A;  5HRF A;  5L1M A;  5AKE A;  5ALJ A;  1DXS A;  3C1Z A;  4DQI A;  4X4T A;  2GLE A;  1ZET A;  1GPJ A;  5JTG A;  1ZQJ A;  3KZI U;  1TAQ A;  8ICS A;  5ALE A;  5ALG A;  2D6F C;  1KEJ A;  3WFP A;  1RQN A;  1DK2 A;  4EZ6 A;  4I28 A;  1MN8 A;  4AT9 B;  3JYY A;  3UMB A;  4KIT B;  5A0L A;  4O67 A;  2A1A A;  1KDH A;  5GTH U;  4QZ9 A;  5J0S A;  2HHW A;  4MF8 A;  2K8C B;  5G5H A;  3CYM A;  2NRX A;  1IG6 A;  3K75 D;  2FLN A;  4M5D A;  1HUZ A;  5EOZ A;  2JH1 A;  5HRG A;  2PMZ F;  3NVY A;  4MFA A;  2F1H A;  1NJX A;  4PL1 A;  1ARO P;  3H8M A;  3GII A;  9ICG A;  5HR6 A;  1TAM A;  3PW0 A;  1NK7 A;  2AH5 A;  4DSL A;  5ALI A;  1PX5 A;  4EEK A;  3ZI4 A;  4KLE A;  1TK5 A;  3PV8 A;  5KFR A;  5KT4 A;  4X4N A;  1J2N A;  4UB2 A;  3PSP A;  1JAL A;  5KT7 A;  4UAY A;  3SI8 A;  4BDP A;  3ETL A;  3M6K A;  1SWW A;  4G3I A;  4ZH4 A;  1KQQ A;  1NJY A;  5KFV A;  4CF4 A;  1JI7 A;  4RWO A;  2DKX A;  4F92 B;  1SKR A;  3MR2 A;  1N63 A;  5CFU A;  5KFA A;  2KOB A;  1YT3 A;  5F2V O;  5DBC A;  2LHT A;  4RQ6 A;  1ZQC A;  1B0X A;  5DB8 A;  3SV4 A;  1P7D A;  3KKA C;  1IV8 A;  5HRE A;  2KEY A;  3BQT A;  3GIM A;  8ICK A;  1BPY A;  2K8A A;  4X4S A;  4PHP A;  4AT9 A;  1KN5 A;  5AIA A;  1UET A;  5ALD A;  5KFY A;  3M8S A;  3L3F X;  2M0N A;  1Q78 A;  5J0T A;  2ZJ8 A;  3WK4 A;  5KG5 A;  4WBY A;  5AK5 A;  4QZI A;  1VDV A;  5HHI A;  2IOF A;  3RBE A;  3RJJ A;  2HHQ A;  5HRD A;  2DRB A;  8ICC A;  4K9A A;  3TAC B;  2ZIV A;  3PO4 A;  4Y2Q A;  4UAZ A;  4I2G A;  2AQ4 A;  3L9D A;  2HHU A;  2KG5 A;  2B4V A;  3LWM A;  5KG7 A;  3RJF A;  4E7X A;  3Q8K A;  4M9N A;  3UQ0 A;  1DK3 A;  9ICX A;  5K4L A;  1EXN A;  2DFL A;  4UAS A;  3G6V A;  2GOL A;  1L7O A;  1XWL A;  2LM1 A;  2ESE A;  2KKV A;  1S10 A;  2H3V A;  2F44 A;  4Y2R A;  2MAX A;  2RHF A;  3WKB A;  4BXO B;  4KLJ A;  4WBZ A;  2G08 A;  2BQ3 A;  5BOM A;  1ED1 A;  1FIQ A;  2WF6 A;  3OPX A;  4DOA A;  1NZP A;  5KNI A;  3N4M B;  3QE9 Y;  5F9L A;  4NM1 A;  3AQK A;  4B9U A;  5B5E U;  1X66 A;  3LWL A;  1TE2 A;  2JEG A;  4I2E A;  4BWJ A;  2JEI A;  1XU4 A;  1L6N A;  2R8J A;  1O08 A;  1OW5 A;  2WTF A;  1M6Y A;  2KZ3 A;  3EW9 A;  2ZUC A;  2A1J B;  4Q8F A;  3RR8 A;  4EEB A;  3SAG A;  4DLG A;  4ED8 A;  2KK0 A;  3LQC B;  3KHG A;  4M9G A;  1L7N A;  2E3T A;  5ALX A;  4NKT A;  2HHS A;  3Q8Q B;  3RRG A;  3H0M B;  1ZQZ A;  9ICR A;  2Y9U A;  4S3N A;  8ICT A;  9ICQ A;  3K1Z A;  1MIY A;  1SKW A;  4OAG A;  5AK3 A;  3C29 A;  4EYH B;  2O5A A;  4U6P A;  2DPJ A;  2EZY A;  1J97 A;  2ID1 A;  4AYB F;  3JPO A;  2K4E A;  4UW9 A;  1TV9 A;  3CK6 A;  2CXY A;  1RXW A;  8ICV A;  1AQ6 A;  2BPC A;  3IP4 B;  2B51 A;  2ZH3 A;  1PVQ A;  3G6Y A;  5KFJ A;  3SV3 A;  4DO9 A;  1DOQ A;  1HIW A;  3OGU A;  3M8R A;  4PPX A;  2XI9 A;  4QW8 A;  2ZH1 A;  4C8K A;  2HN1 A;  1SB3 C;  4DSI A;  4O3S A;  3H37 A;  2OHF A;  1ZQO A;  3JPQ A;  4JWM A;  2H3F A;  3ICX A;  5HNK A;  2YB4 A;  2PFQ A;  8ICO A;  2XIC A;  5AIB A;  4KLM A;  2PI5 A;  4TUR A;  1NJZ A;  2J6S A;  2ES6 A;  4AT7 A;  1VFG A;  4AT8 B;  3AQL A;  4M9L A;  2ZG6 A;  5KG1 A;  5AI8 A;  3H7I A;  2PXI A;  5F3X B;  9ICE A;  3PML A;  4JV2 A;  2W8L A;  4NL9 C;  4PHA A;  1JMS A;  3QUT A;  5KTQ A;  4J9R A;  5ALR A;  2F8L A;  4GC6 A;  2UVV A;  2VA3 A;  3OJU A;  2EAM A;  1NK6 A;  5KFN A;  1XS9 D;  1SZP A;  4YQW A;  7ICU A;  2A1J A;  2JZB A;  2FPK A;  2K60 A;  5KFT A;  4RT3 A;  2H3Q A;  3GIK A;  1CEZ A;  3EF2 A;  3M7D A;  5B3Q A;  4PGX A;  3PVX A;  1FO4 A;  2YB1 A;  5EWE A;  4F5P A;  1ZQH A;  1COK A;  4DQQ A;  1WG8 A;  1SZH A;  4LVS A;  1N5W A;  4RQ1 A;  4RT2 A;  3LK9 A;  3TKA A;  5DGB A;  2FI1 A;  1XSL A;  1NNL A;  3K7D A;  9ICU A;  2B6G A;  2WFA A;  1LB2 B;  5KFK A;  4WJ3 B;  2R8G A;  1Z00 B;  3M9N B;  3TFS A;  3JPT A;  4RWQ A;  4QNL A;  3U26 A;  5KFB A;  4QWE A;  3OHB A;  1KL9 A;  3PMN A;  3V7K A;  4F4W A;  1NJW A;  4NY8 A;  3RB4 A;  4Y2Y A;  3QXG A;  4X0A A;  4XJE A;  1Z4N A;  4RQN A;  5EE3 A;  3MFH A;  1ZD5 A;  3K4G A;  4AT8 A;  1HUO A;  2GH1 A;  4DL3 A;  3MC1 A;  3RH5 A;  4ECS A;  4Q43 A;  4F4K A;  3AU6 A;  3MDA A;  1ZJN A;  2BCS A;  3NVV A;  3JZ0 A;  1BPZ A;  3KHR A;  2KE7 A;  4P4O A;  5CR0 A;  2H3I A;  2Y1J A;  4MEY A;  1F44 A;  4N7R A;  4DSK A;  1S97 A;  4Y2T A;  2LPE A;  2K4H A;  3SMV A;  4P0P A;  1MQ3 A;  2QLT A;  1DGJ A;  8ICB A;  2LMR A;  1B4F A;  3WK9 A;  2YX8 A;  4Q8E A;  1LV5 A;  2W55 A;  4J9Q A;  3PSI A;  2B56 A;  2BCR A;  5F9N A;  1L3V A;  7ICR A;  4B9N A;  3OSN A;  5CWR A;  2NYV A;  1X9M A;  1ZQE A;  4EZ9 A;  4GXJ A;  2Q66 A;  9ICH A;  4KLS A;  3WKA A;  2VKQ A;  2HSZ A;  4EP7 A;  4NKU A;  4O3O A;  1JXE A;  2WF9 A;  2E8O A;  8ICW A;  4R63 A;  4NLZ A;  4LT6 A;  4EEN A;  3AEV A;  4ED3 A;  5KL1 B;  3AQM A;  4DL4 A;  4K96 A;  2NRW A;  1JN3 A;  2EAO A;  2XY6 A;  4NJ8 A;  1X6J A;  4GXK A;  4I2A A;  3MGH A;  2AQ0 A;  2Y9T A;  3UXP A;  4C8N A;  4F50 A;  2KP7 A;  2HBL A;  1BPE A;  8ICY A;  2ZJA A;  4RZR A;  5AKZ A;  4YMO A;  5ALP A;  1SIJ A;  4ED1 A;  4C8O A;  2W54 A;  2BPG A;  5J2A A;  1SKS A;  4EGW A;  4YXM A;  5ALM A;  3AM9 A;  1KTQ A;  4RQ5 A;  5CFT A;  2M9N A;  3HWT A;  4NLG A;  3TAD C;  3KFU F;  4BWM A;  3AUO A;  4RQ7 A;  1XO0 A;  3V6K A;  3ER8 C;  3H38 A;  2PMZ C;  1Z1V A;  4R65 A;  5DB7 A;  2W9C B;  1XSN A;  8ICE A;  3N7R C;  2CPR A;  2DR9 A;  2ZXH A;  3WU2 U;  2OXO A;  4PZO A;  4I2C A;  1JIH A;  3N7P D;  2ODG A;  2IHM A;  4J9P A;  2P66 A;  4FHY A;  4O3P A;  2RP5 A;  1COO A;  4J9N A;  9ICB A;  2RQ5 A;  2P6R A;  2O1P A;  1D8Y A;  4EBC A;  1CI4 A;  2JHD A;  8ICG A;  3AQF A;  2DKZ A;  4K4H A;  3C21 A;  3H4B A;  3M6Z A;  3MDC A;  2E5S A;  5J2D A;  4WC4 A;  3RJH A;  2XGP A;  4KLO A;  2KZM A;  1F0M A;  2V4R A;  4DL6 A;  1OU5 A;  4QZC A;  3RB6 A;  4Y2U A;  4YR0 A;  1WUD A;  4OJ5 A;  2R8K A;  2W7P A;  1YZ6 A;  3BJY A;  3KHH A;  4LEZ A;  1J2M A;  1KW4 A;  2MRL A;  4GXI A;  1SL1 A;  4I29 A;  1BNO A;  3UXO A;  4RQ2 A;  3QU7 A;  4XQ7 A;  4DCC A;  3RBD A;  5KAF U;  5KFP A;  7ICI A;  4X4O A;  1ECW A;  4BUG A;  3Q8M A;  3HKZ F;  2W04 A;  1U48 A;  1QQ6 A;  5DG7 A;  5AKL A;  1ZRN A;  4NXU A;  2XGQ A;  1L8O A;  1ZQM A;  2E8P A;  2FPM A;  3H8J A;  4WC6 A;  3IDW A;  1A76 A;  3Q8L A;  1Y88 A;  5AKK A;  3UMC A;  5ALU A;  4R64 A;  2HOF A;  3B9J A;  5KFI A;  4O0I A;  2W9C A;  4OAF A;  1GO3 F;  3SR6 A;  2UVR A;  1SWV A;  4UB4 A;  5J2I A;  4X4Q A;  2DUY A;  2WF7 A;  5J0P A;  2QKQ A;  3NTU A;  3QU2 A;  4BX9 C;  3PHZ A;  4I27 A;  5ALF A;  5IIL A;  2MUT B;  4PHE A;  2JV3 A;  2ZTD A;  1NZB A;  4LEW A;  2MU2 A;  3OWG A;  5CA7 A;  1KLN A;  2BE3 A;  3KZX A;  1OXJ A;  8ICR A;  3MCR A;  4Y2S A;  4MFC A;  4UB3 A;  8ICH A;  4YD2 A;  9ICS A;  4BJQ A;  1R8A A;  4EBE A;  1QSL A;  4ATB A;  2XY7 A;  3FC4 A;  3ALR A;  1C7Y A;  4QZG A;  1ZQU A;  4IQU A;  3PW4 A;  2NRZ A;  2ISP A;  5AM4 A;  5AM2 A;  2EAP A;  4RQ3 A;  4RUA A;  3OHA A;  5AK4 A;  5DBA A;  3MR3 A;  4M9J A;  2M2W A;  4YG2 A;  4FZM A;  4RPX A;  2ZIV B;  2H5X A;  4G9B A;  4MEX A;  3VCB A;  1ZQG A;  5L1L A;  2G06 A;  4NXX A;  4MKP A;  2I6X A;  2ZIX A;  4YMN A;  2JMG A;  2YML A;  2DBY A;  2VJ4 A;  5IIK A;  9ICK A;  3PR5 B;  4F8R A;  7ICT A;  4AYB C;  3RRH A;  1S0M A;  4Z6E A;  1FFV A;  4KLI A;  3WK5 A;  1KFD A;  1Q3V A;  4DWI A;  5AI4 A;  2DWQ A;  9ICP A;  2KV2 A;  4B9T A;  5JTI A;  4O9M A;  4UB5 A;  1V38 A;  4UBB A;  4KTQ A;  1ZQA A;  5KL8 B;  3NS1 A;  2EWR A;  3E0F A;  4YP3 A;  4IRD A;  1U4B A;  2NRT A;  1RG6 A;  4DL2 A;  2ZH2 A;  1YZ7 A;  1JAJ A;  2OWO A;  2MUT A;  5J2K A;  4O6A A;  4ECT A;  4F72 A;  1L3S A;  4UB1 A;  1QH9 A;  3WK8 A;  1H38 A;  3EPI A;  7ICN A;  5J0X A;  1D9D A;  4J03 A;  5DQH A;  5GTI U;  2EH9 A;  4FBT A;  4RPY A;  4F5O A;  4TQR A;  4JV1 A;  4Y2J A;  2YMP A;  4NXT A;  4QZF A;  3C5G A;  4X5V A;  4UAR A;  5HML A;  2VA8 A;  5DDY A;  2OYY A;  4KN7 A;  2K4P A;  4PJ0 U;  2IOH A;  1XO1 A;  3QYP A;  2IHN A;  2JR5 A;  4LJX A;  3AL0 B;  3SAH A;  2GWS A;  2NRK A;  4EYI B;  1B22 A;  1RQL A;  2KHV A;  1NK9 A;  2LM4 A;  3ETR A;  3HJE A;  2NO5 A;  4FHW A;  9ICC A;  1ZQX A;  3RTV A;  5DB6 A;  2D3D A;  4YCX A;  4IS7 A;  1NK8 A;  2F8K A;  2YQE A;  3QNM A;  2A19 A;  7ICE A;  3N28 A;  8ICN A;  4C7Z A;  2HBK A;  3AU2 A;  4CDG A;  4OD0 A;  4WQL A;  2XO7 A;  2AGO A;  3BDP A;  4PHD A;  4FS1 A;  5KG0 A;  5DBB A;  4RNM A;  4AT7 B;  5DKW A;  8ICI A;  2HDO A;  1A77 A;  2ASL A;  2KIW A;  1JRO A;  1L3T A;  4PZN A;  3RB3 A;  1K5O A;  5J2J A;  4QWA A;  3TI0 A;  2UVU A;  3RJE A;  3EUB 2;  1DGS A;  5J0R A;  4X4U A;  3H4D A;  2QB1 A;  4B9M A;  2G5H B;  3N97 B;  4JLX A;  5B3P A;  4HX0 A;  4FZN A;  2JZB B;  1L8L A;  1LKY B;  3THV A;  3AN1 A;  3T5H A;  1NK0 A;  3RAQ A;  2PBE A;  4MHV A;  4C7Y A;  3GV8 B;  3QX7 A;  2QAR B;  3PNC A;  1ZQF A;  5CP2 A;  2C2D A;  3H0R B;  4KLL A;  5KFE A;  5J2F A;  3UXN A;  3T3F A;  1A0P A;  3TAN A;  4F4Y A;  2XID A;  2KKP A;  4K4I A;  1UCV A;  4KX5 A;  4FH5 A;  3KBB A;  2IBK A;  1SXE A;  3C28 A;  2ZHB A;  3PSF A;  4TUQ A;  2HBJ A;  3GV7 B;  4NXZ A;  2BQR A;  3A0B U;  5KFC A;  7ICQ A;  1ZJM A;  3BQ2 A;  2HHT A;  4FHV A;  1MSW D;  4OJL A;  3ZDC A;  2KFN A;  2RDI A;  2ZTC A;  2F1I A;  5J8Y C;  5D46 A;  4DLE A;  3HJ4 A;  3PX4 A;  3IV6 A;  8ICF A;  4Q44 A;  2W3S A;  1QQ5 A;  2ZJ5 A;  4I2I A;  2KHQ A;  5J2E A;  3C2M A;  1XC9 A;  2LBO A;  3LVV A;  5ALZ A;  4NWI A;  3V6J A;  4PL2 A;  5HRI A;  2G09 A;  1ZQB A;  3C5F A;  4TQS A;  4YXJ A;  5AI9 A;  4OAH A;  4OJO A;  5J2H A;  5DQG A;  3L4P A;  3Q8P B;  1RDF A;  4KM5 A;  4Z6C A;  4EBJ A;  4C80 A;  2W03 A;  5AKH A;  4QZ8 A;  4I2H A;  2WB1 F;  5HRB A;  4FE3 A;  5ALK A;  1PUZ A;  1KSP A;  4C4S A;  3QUB A;  1PK1 A;  1SV0 C;  1LKY A;  2AJQ A;  1S77 D;  4MFF A;  4ECR A;  4P0P B;  5IIM A;  5KFD A;  2QAR A;  2C22 A;  4FO1 A;  1ZQY A;  2JH7 A;  4O5C A;  2HOQ A;  2F77 X;  4RNN A;  4Y2P A;  4HAI A;  1U49 A;  4WC2 A;  1Q46 A;  5HHH A;  3PO5 A;  4KLG A;  1RZT A;  3NWI A;  3QEB Z;  1NK5 A;  4DFJ A;  5C5J A;  2EZX A;  3TFR A;  1ZD3 A;  3ZD8 A;  4RPZ A;  4UBC A;  4X0B A;  4C0Z A;  4I0U A;  2LYB A;  2KSO B;  4K4G A;  3IRU A;  2I5H A;  3WK7 A;  5AKX A;  2AU0 A;  1UQV A;  2W8K A;  4F2R A;  4DF4 A;  4Y2V A;  1S0V A;  3HPO A;  2W7O A;  1N56 A;  1F5S A;  1NKB A;  2HI0 A;  4YD1 A;  7ICH A;  3HRD D;  5AIC A;  2E1E A;  4UD4 A;  4K98 A;  1U45 A;  4WC7 A;  4B9S A;  1TK8 A;  2KNJ A;  1SL0 A;  2RLT A;  2CRX A;  3ISB A;  4J9L A;  3NVO A;  4US9 A;  1PZN A;  3C66 A;  5KFQ A;  4CRX A;  2L5Y A;  3NVW A;  4F4X A;  3DDH A;  1FEZ A;  2F2A B;  4NLC A;  2FLP A;  3UQ2 A;  1PVP A;  7ICL A;  3ORY A;  2AGP A;  3LDA A;  1ZQN A;  3RB0 A;  4X4R A;  2PFO A;  3HKZ C;  2F1J A;  1TK0 A;  1D9F A;  8ICL A;  4WC3 A;  4JV0 A;  3B0Y A;  4O3Q A;  2BR0 A;  3BS5 B;  3C2K A;  1B43 A;  5KFZ A;  3PZP A;  4XQ8 A;  1ZQP A;  2ZTE A;  1TAU A;  1BPB A;  1L3U A;  3ZDD A;  5J0U A;  2WHE A;  1SGG A;  2B21 A;  5HMM A;  4DFD A;  4ECX A;  3V6H A;  1PVR A;  4JK1 A;  2ZH7 A;  4YMM A;  5EWG A;  4PGY A;  2DPI A;  5FP0 A;  3ERC C;  3H0L B;  4E8F A;  3WFO A;  4P0Q A;  2RFF A;  5TIS U;  2IHO A;  5DLF A;  2DGZ A;  2W9B B;  2KSO A;  2RRD A;  5CEH A;  4DL5 A;  2GO7 A;  4US8 A;  1NO5 A;  5L1K A;  1S0O A;  3M9O B;  5JUM A;  2ISO A;  4NV0 A;  4BGD A;  3E2E A;  4NL9 A;  3T5L A;  2W9M A;  4JB3 A;  3J81 j;  1TFY A;  5AM1 A;  5H2F U;  1NKC A;  2FE9 A;  5ALS A;  3PX6 A;  1R8C A;  5KT6 A;  3CNH A;  2J6T A;  3RR7 A;  1ZQW A;  2HVI A;  2LKY A;  1ZQ1 C;  3AQE A;  4FZL A;  2HHP A;  4KLU A;  5D4B A;  2YTU A;  4NXV A;  1X6I A;  4IR9 A;  4CF3 A;  1QSY A;  4IQT A;  5CRX A;  2JGA A;  3RH4 A;  5ALT A;  2RDJ A;  3NAS A;  3F5A A;  1D8L A;  1Z4O A;  4CF5 A;  2KJ9 A;  4M6W B;  5DLG A;  5J2G A;  1UEU A;  4GLX A;  7ICM A;  3BS5 A;  5AK6 A;  5TZV A;  1C20 A;  7ICV A;  4M04 A;  2E1F A;  5ALO A;  4KLD A;  5CHE A;  2MSN A;  4C4R A;  1CRX A;  2GA9 D;  7ICS A;  4NXW A;  2IMW P;  3MR5 A;  1TFR A;  3A0H U;  5HP4 A;  4YR2 A;  2XC9 A;  4E0D A;  9ICI A;  3B0X A;  5B66 U;  3H40 A;  1ZQD A;  3C18 A;  4U7C A;  4P4P A;  3RF9 A;  2FMS A;  3H39 A;  3JPS A;  2W9B A;  4ATB B;  4DSE A;  2ZH6 A;  3O0F A;  2ATL A;  1L7M A;  3ED5 A;  5KFH A;  3GIL A;  2FLL A;  1ZD4 A;  2AXT U;  3M1Y A;  3F5E A;  3UM9 A;  5DED A;  3F2D A;  2BDP A;  4IG8 A;  2HW3 A;  2OCE A;  4NLN A;  4M9H A;  1ZQT A;  5KFG A;  3RJI A;  4LZD A;  2M2U A;  1FFU A;  4RQ8 A;  8ICJ A;  1UHU A;  2BHN A;  4K97 A;  3EWA A;  2XVT A;  7ICO A;  4ELV A;  1MIW A;  3VC8 A;  1S0N A;  1V85 A;  4ELU A;  2KIV A;  4GIB A;  2ZIX B;  4ECU A;  3HW8 A;  1U47 A;  2MA1 A;  1RYR A;  1K1S A;  3ZDE A;  4IRC A;  5DEC A;  2BPF A;  3PW2 A;  2ZXI A;  2NV3 A;  3UPQ A;  4QZH A;  4YFK A;  4OJ6 A;  2DVI A;  5JU5 A;  4NM2 A;  4FHP A;  3PW7 A;  4M6W A;  4B9V A;  5KG3 A;  7ICG A;  4PH5 A;  1T8E A;  3IM1 A;  3IHQ B;  2PFP A;  3PR4 A;  2JEJ A;  3I28 A;  1X9W A;  2AGQ A;  1R8B A;  4QWC A;  2BDU A;  3H3A A;  1QSS A;  1Z3E B;  2R8H A;  2K4I A;  4EBK A;  3KHL A;  3K1R B;  4KB6 A;  2DR7 A;  3SEI A;  1FA0 A;  2BBH A;  3EYZ A;  3H8S A;  4QWB A;  5AI6 A;  3ISC A;  4IQV A;  3ONN A;  4KMO B;  1JRP A;  5J0Y A;  5EE1 A;  4J9K A;  1K1Q A;  1ZD2 P;  2KMD A;  4DQS A;  3QU5 A;  2K89 A;  3FM9 A;  4E80 A;  2KVS A;  3OSP A;  3T5J A;  2WF8 A;  3WKD A;  4UQG A;  4WCW A;  1T7P A;  4QZD A;  2VA2 A;  3N7S C;  3HIY A;  3TAD A;  4WC5 A;  3GIJ A;  2EQY A;  4O3N A;  5KFW A;  4F5N A;  3JPP A;  2W9A A;  1N62 A;  4QIW F;  2DRA A;  3IN5 A;  5ALL A;  2AHO B;  5CB1 A;  1ZQV A;  2BKE A;  4IRK A;  5AKY A;  4P4M A;  3CP8 A;  5ALH A;  4UAT A;  2PFN A;  3MFI A;  4WC1 A;  2KVC A;  3C2L A;  3SZ2 A;  4EEL A;  3L5K A;  4WQK A;  4O68 A;  1UEV A;  3RAX A;  4FS2 A;  4FO6 A;  2ZH8 A;  4DFM A;  1KBU A;  5D61 A;  1ZXI A;  4UAV A;  5C0Y A;  3GU3 A;  4ECY A;  2M2V A;  4KLF A;  4F93 B;  1BNP A;  2Y0S F;  3HX0 A;  3GDX A;  4EEY A;  3MGV A;  7ICF A;  4Q45 A;  9ICF A;  1KNY A;  4IC9 A;  3QUC A;  4LEV A;  3WFS C;  1HJP A;  5KFL A;  5EWF A;  1X9S A;  1QCK A;  3WFQ E;  2IOF K;  3EZ5 A;  2CN1 A;  3HP6 A;  1BPX A;  1NK4 A; 
#chains in the Genus database with same CATH homology
 1NKE A;  1BPZ A;  4DSF A;  1QTM A;  4LZG A;  3ZD9 A;  4TUQ A;  3GV7 B;  3AQN A;  4NXZ A;  5J2B A;  2XCP A;  3KHR A;  4ED6 A;  5KFC A;  2BQR A;  1ZJM A;  7ICQ A;  1R89 A;  4KMU A;  3BQ2 A;  5HR9 A;  2HHT A;  4P4O A;  2BCV A;  1MSW D;  4FHV A;  7ICK A;  5CR0 A;  3ZDC A;  4F5Q A;  2Y1J A;  2PI4 A;  4XUS A;  4MEY A;  4CCH A;  2RDI A;  1U9L A;  2ZTC A;  2KFN A;  4DSK A;  1S97 A;  2F1I A;  4F2S A;  2LYH A;  2P6U A;  3C23 A;  5D46 A;  4DLE A;  3PX4 A;  3HJ4 A;  4YVZ A;  1XSP A;  1MQ3 A;  1ZQK A;  8ICF A;  4WC0 A;  4Q44 A;  8ICB A;  8ICP A;  4TUS A;  5KT2 A;  4Q8E A;  2ZJ5 A;  4I2I A;  5IIN A;  1LV5 A;  5J2E A;  4J9Q A;  1L5U A;  3V7L A;  2BCR A;  3C2M A;  1XC9 A;  5F9N A;  1L3V A;  7ICR A;  4XRH A;  4B9N A;  3V6J A;  9ICM A;  3OSN A;  4KN4 A;  5HRI A;  4QZA A;  1ZQB A;  3C5F A;  5CWR A;  2C2R A;  5KFO A;  1X9M A;  1ZQE A;  4EZ9 A;  3QZ7 A;  8ICQ A;  4GXJ A;  1TKD A;  5J29 A;  1IXR A;  5KG4 A;  4F91 B;  5KFF A;  4TQS A;  1KFS A;  4KLS A;  8ICA A;  9ICH A;  4YXJ A;  2Q66 A;  4ELT A;  7ICP A;  5J2H A;  1ZQL A;  4NKU A;  4EP7 A;  4O3O A;  5DQG A;  3JPR A;  3OVA A;  4O5E A;  3Q8P B;  5J0Q A;  3V7J A;  4ED7 A;  3KTQ A;  1QLN A;  2KZZ A;  1JXE A;  2HHX A;  3ISD A;  4Z6C A;  2C28 A;  3GQC A;  5D49 A;  2ZUD A;  4EBJ A;  3OUY A;  2KTQ A;  8ICW A;  4R63 A;  3Q8R B;  1KFT A;  4NLZ A;  2KN7 A;  4B9L A;  4KLH A;  3RJG A;  1T4G A;  4LT6 A;  1NOM A;  5DQI A;  4DSJ A;  4ED3 A;  2KFZ A;  4QZ8 A;  3AQM A;  4DL4 A;  5III A;  2NRW A;  4I2H A;  5HRB A;  4UAW A;  1KSP A;  1RXV A;  3ZDB A;  1JN3 A;  1JQR A;  4EBD A;  5CJ7 A;  4NLK A;  3OVS A;  5KG2 A;  2XY6 A;  4DS5 A;  8ICZ A;  3OJS A;  4GXK A;  4I2A A;  4DOB A;  4WC4 A;  3ZDA A;  3MGH A;  2AJQ A;  1S77 D;  4JUZ A;  2AQ0 A;  2ASD A;  2BGW A;  2Y1I A;  4MFF A;  4ECR A;  1TFW A;  4DFK A;  3V72 A;  3UXP A;  5IIM A;  4C8N A;  5DB9 A;  3M9M B;  4F50 A;  2C2E A;  2HVH A;  2KP7 A;  5KFD A;  1ZQS A;  2C22 A;  1BPE A;  8ICY A;  1IM4 A;  2ZJA A;  4RZR A;  1Q79 A;  1S9F A;  3OVB A;  3QEA Z;  4O5K A;  4YMO A;  1ZQY A;  4C8O A;  4ED1 A;  4O5C A;  5HRF A;  2HHV A;  2BPG A;  5J2A A;  4RNN A;  1U49 A;  1SKS A;  4WC2 A;  2Q0Z X;  3C1Z A;  4YXM A;  4DQI A;  5HHH A;  3PO5 A;  4X4T A;  1KTQ A;  4RQ5 A;  1ZET A;  4KLG A;  1RZT A;  1KRP A;  3QEB Z;  1NK5 A;  2M9N A;  4DFJ A;  5C5J A;  1ZQJ A;  3HWT A;  9ICT A;  3TFR A;  4NLG A;  3ZD8 A;  1TAQ A;  4RPZ A;  1RYS A;  4FBU A;  4UBC A;  8ICS A;  4X0B A;  1KEJ A;  3WFP A;  4BWM A;  3AUO A;  4ED2 A;  4RQ7 A;  1DK2 A;  4EZ6 A;  4K4G A;  3V6K A;  4I28 A;  4AT9 B;  3JYY A;  3H38 A;  4KIT B;  4R65 A;  2AU0 A;  4I2D A;  2W8K A;  2DR8 A;  1KDH A;  4FHX A;  3PW5 A;  4F2R A;  5DB7 A;  4QZ9 A;  2W9C B;  4DF4 A;  4X4P A;  4G3I A;  4M47 A;  1UA1 A;  5J0S A;  1S0V A;  2HHW A;  4MF8 A;  3HPO A;  1N56 A;  1YLQ A;  4O3R A;  1XSN A;  1NKB A;  8ICE A;  4YD1 A;  7ICH A;  1JXL A;  5DGA A;  2DR9 A;  2NRX A;  4I2C A;  2FMP A;  4UD4 A;  2DR5 A;  1JIH A;  1U45 A;  4WC7 A;  4B9S A;  3K75 D;  2IHM A;  1UT5 A;  4J9P A;  1TK8 A;  2FLN A;  2P66 A;  4M5D A;  1HUZ A;  1SL0 A;  4FHY A;  4O3P A;  1COO A;  5EOZ A;  4J9N A;  9ICB A;  3ISB A;  4J9L A;  5HRG A;  2P6R A;  2O1P A;  1D8Y A;  4MFA A;  4EBC A;  4KLQ A;  4F3O A;  1PZN A;  3C66 A;  8ICG A;  2F1H A;  5KFQ A;  1NJX A;  2I1Q A;  9ICO A;  4K4H A;  3C21 A;  4R66 A;  1ARO P;  3H4B A;  4F4X A;  9ICL A;  3GII A;  4FH3 A;  3MDC A;  4YN4 A;  9ICG A;  2FLP A;  3UQ2 A;  5J2D A;  4DF8 A;  3RJH A;  2XGP A;  4KLO A;  7ICL A;  1CUK A;  3ORY A;  5KFS A;  2V4R A;  4DL6 A;  3PW0 A;  2AGP A;  1NK7 A;  1RPL A;  3LDA A;  4YR3 A;  1N48 A;  5KFU A;  4DSL A;  1OU5 A;  1PX5 A;  1UA0 A;  4KLE A;  4QZC A;  1ZQN A;  3RB6 A;  3MAB A;  4C8M A;  3RB0 A;  1TK5 A;  4UD5 A;  5L9X A;  5J2C A;  4X4R A;  4YR0 A;  3PV8 A;  2PFO A;  5KFR A;  5KT4 A;  2R8K A;  5L1J A;  4X4N A;  4UB2 A;  5HRK A;  2ZH9 A;  2F1J A;  1TK0 A;  4I2J A;  4Z6D A;  3BJY A;  1D9F A;  8ICL A;  3KHH A;  5KT7 A;  4J9M A;  4WC3 A;  4JV0 A;  4UAY A;  3B0Y A;  2M2T A;  4GXI A;  3SI8 A;  4O3Q A;  2BR0 A;  3ETL A;  1SL1 A;  4BDP A;  3C2K A;  4I29 A;  3UXO A;  1B43 A;  5KFZ A;  1V9P A;  4ZH4 A;  4RQ2 A;  1ZQP A;  4XQ8 A;  5KFV A;  2ZTE A;  1NJY A;  1BPB A;  1L3U A;  1TAU A;  9ICJ A;  3ZDD A;  5J0U A;  4RWO A;  4XQ7 A;  4F92 B;  1SKR A;  2B21 A;  5HMM A;  4ECX A;  4RWP A;  3MR2 A;  3V6H A;  3RBD A;  5KFP A;  7ICI A;  5KFA A;  4JK1 A;  4QW9 A;  4YMM A;  4X4O A;  2ZH7 A;  2XY5 A;  5DDM A;  5EWG A;  4PGY A;  3Q8M A;  1ZYQ A;  2DPI A;  5F2V O;  5DBC A;  4RQ6 A;  1U48 A;  1ZQC A;  5DG7 A;  4E8F A;  5DB8 A;  3SV4 A;  4FHP A;  3WFO A;  2XGQ A;  1ZQM A;  5HRE A;  2RFF A;  3EPG A;  3BQT A;  5DLF A;  2FPM A;  3H8J A;  4WC6 A;  3GIM A;  8ICK A;  1BPY A;  1A76 A;  2W9B B;  4BXO A;  4X4S A;  1BPD A;  4DL5 A;  3Q8L A;  4PHP A;  4AT9 A;  1Y88 A;  3GV5 B;  1UET A;  1NO5 A;  4R64 A;  5L1K A;  1S0O A;  1ZQI A;  5KFY A;  3M8S A;  5KFI A;  3M9O B;  5JUM A;  1WOT A;  2VAN A;  1Q78 A;  5J0T A;  4O0I A;  2W9C A;  2ZJ8 A;  5KG5 A;  2ISO A;  5L1I A;  4WBY A;  4QZB A;  4QZI A;  5DG8 A;  4BGD A;  3E2E A;  2UVR A;  3T5L A;  3HJ1 A;  4UB4 A;  3RBE A;  5HHI A;  3RJJ A;  2HHQ A;  5J2I A;  2W9M A;  4X4Q A;  5HRD A;  3C18 A;  2DRB A;  8ICC A;  1TFY A;  4GC7 A;  5J0P A;  1NKC A;  4ED0 A;  3NTU A;  5DG9 A;  3TQ1 A;  3PX6 A;  4UAZ A;  3PO4 A;  3FYH A;  1R8C A;  5KT6 A;  4I27 A;  4I2G A;  5IIL A;  2AQ4 A;  2J6T A;  3RR7 A;  2HHU A;  3L9D A;  2MUT B;  1ZQW A;  4PHE A;  4ECZ A;  2ZTD A;  3LWM A;  5KG7 A;  1TVA A;  1T3N A;  3RJF A;  2HVI A;  4E7X A;  8ICM A;  3Q8K A;  5CA7 A;  1KLN A;  2BE3 A;  4M9N A;  3UQ0 A;  4IQW A;  9ICX A;  1DK3 A;  5CHG A;  3TAR A;  8ICR A;  1EXN A;  2DFL A;  4R8U B;  3G6V A;  4ECQ A;  9ICN A;  2HHP A;  4MFC A;  4UB3 A;  8ICH A;  4YD2 A;  4KLU A;  9ICS A;  5D4B A;  4IR9 A;  1R8A A;  4EBE A;  1QSL A;  1XWL A;  1VJ7 A;  2XY7 A;  1S10 A;  4ATB A;  1QSY A;  4IQT A;  2MAX A;  3RH4 A;  2KZM A;  1C7Y A;  4DQP A;  4QZG A;  4BXO B;  1MC8 A;  4KLJ A;  2RDJ A;  4WBZ A;  2BQ3 A;  1ZQU A;  5BOM A;  4IQU A;  3PW4 A;  1D8L A;  2ZH4 A;  4DS4 A;  2NRZ A;  4RQ0 A;  1X2I A;  2ISP A;  3UPS A;  4DOA A;  1NZP A;  4M6W B;  4KLT A;  3N4M B;  5DLG A;  5J2G A;  1UEU A;  3GFK B;  1WCL A;  4RQ3 A;  4RUA A;  4GLX A;  7ICM A;  3H8W A;  3QE9 Y;  3OHA A;  5F9L A;  2ASJ A;  5DBA A;  4NM1 A;  5TZV A;  3AQK A;  3MR3 A;  4B9U A;  4M9J A;  7ICV A;  4YG2 A;  2M2W A;  4M04 A;  4RPX A;  5KG6 A;  2H5X A;  4MEX A;  3LWL A;  4KLD A;  4RWN A;  1ZQG A;  2JEG A;  4I2E A;  5L1L A;  4BWJ A;  3FDS A;  2JEI A;  7ICS A;  2IMW P;  1XU4 A;  1V4A A;  3MR5 A;  1TFR A;  2ZUB A;  4TUP A;  2R8J A;  5HP4 A;  4YR2 A;  2XC9 A;  4YMN A;  2WTF A;  4E0D A;  9ICI A;  3B0X A;  2KZ3 A;  3EW9 A;  4JWN A;  5HRH A;  2ZUC A;  5IIK A;  2A1J B;  3H40 A;  4Q8F A;  3RR8 A;  1ZQD A;  9ICK A;  1UT8 A;  3PR5 B;  4DLG A;  4ED8 A;  2XCA A;  4F8R A;  5KFM A;  3RRH A;  4P4P A;  4Z6E A;  1S0M A;  2FMS A;  3KHG A;  4PPX A;  3LQC B;  3H39 A;  3JPS A;  4ECW A;  4KLI A;  4I2F A;  4M9G A;  4RU9 A;  2W9B A;  4ATB B;  1KFD A;  4DSE A;  2ZH6 A;  4NKT A;  2ATL A;  4DWI A;  9ICP A;  5KFH A;  2HHS A;  3Q8Q B;  3RRG A;  3HIY A;  4J9S A;  1ZQZ A;  3GIL A;  2FLL A;  9ICR A;  4S3N A;  4B9T A;  2JEF A;  8ICT A;  4Z6F A;  2IA6 A;  3RJK A;  4O9M A;  9ICQ A;  1SKW A;  4DFP A;  1MIY A;  4EYH B;  3Q8S B;  4UB5 A;  2BDP A;  4UBB A;  4KTQ A;  4IG8 A;  1ZQA A;  2O5A A;  2ZH5 A;  2DPJ A;  2HW3 A;  4NLN A;  4M9H A;  1ZQT A;  3C1Y A;  4YP3 A;  2NRV A;  3BQ0 A;  1U4B A;  4IRD A;  2ID1 A;  2NRT A;  5KFG A;  3JPO A;  4DL2 A;  3RJI A;  1TV9 A;  3MGI A;  2ZH2 A;  4LZD A;  1RXW A;  8ICV A;  2M2U A;  2BPC A;  5J0W A;  3NGD A;  4RQ8 A;  4MF2 A;  8ICJ A;  1JAJ A;  2OWO A;  2ZH3 A;  2MUT A;  3G6Y A;  5J2K A;  2BHN A;  5KFJ A;  4XA5 A;  3SV3 A;  4DO9 A;  4ECT A;  4QZE A;  5IIO A;  1MQ2 A;  1DOQ A;  3EWA A;  1MIW A;  7ICO A;  4ELV A;  1L3S A;  1MIV A;  1S0N A;  4ELU A;  4F4Z A;  4UB1 A;  5IIJ A;  3RH6 A;  4R8U A;  3OGU A;  3M8R A;  3HW8 A;  4F5R A;  4ECU A;  4QW8 A;  1U47 A;  1K1S A;  3ZDE A;  4QWD A;  1RYR A;  2I9G A;  1H38 A;  3EPI A;  4C8K A;  4IRC A;  9ICA A;  5DEC A;  2BPF A;  3PW2 A;  7ICN A;  4DSI A;  5J0X A;  1D9D A;  4C8L A;  3TAQ A;  4O3S A;  5DQH A;  3H37 A;  1S76 D;  1ZQO A;  3JPQ A;  4FBT A;  4JWM A;  5HNK A;  3UPQ A;  1BVS A;  4RPY A;  4QZH A;  4F5O A;  4YFK A;  4J9O A;  4TQR A;  2PFQ A;  8ICO A;  4JV1 A;  2V9W A;  3TAP A;  2DVI A;  4NM2 A;  4KLM A;  4QZF A;  3C5G A;  3T5K A;  4X5V A;  2FPL A;  2PI5 A;  4TUR A;  3PW7 A;  2FMQ A;  4M6W A;  5HML A;  2VA8 A;  5DDY A;  4RNO A;  1NJZ A;  2J6S A;  4KN7 A;  4AT7 A;  1VFG A;  4AT8 B;  3AQL A;  4DOC A;  4M9L A;  1XO1 A;  4B9V A;  5KG1 A;  5KG3 A;  4ECV A;  3H7I A;  2PXI A;  2IHN A;  7ICG A;  3NYB A;  4PH5 A;  4X4V A;  1T8E A;  9ICE A;  3SYZ A;  3IM1 A;  4RQ4 A;  3IHQ B;  3PML A;  2GWS A;  2BQU A;  4JV2 A;  9ICW A;  2W8L A;  2NRK A;  2PFP A;  4PHA A;  1JMS A;  3PR4 A;  2JEJ A;  5KTQ A;  5KT3 A;  4J9R A;  4EYI B;  2AGQ A;  1X9W A;  2UVW A;  1B22 A;  5HRL A;  4GC6 A;  4QWC A;  1R8B A;  1Z00 A;  3H3A A;  7ICT A;  1QSS A;  1Z3E B;  2UVV A;  2R8H A;  5BOL A;  1NK9 A;  1JX4 A;  3PY8 A;  4EBK A;  1BGX T;  3OJU A;  2VA3 A;  4M2Y A;  3KHL A;  1NK6 A;  4RUC A;  3WFR E;  1F5A A;  5KFN A;  4FHW A;  1XS9 D;  9ICC A;  1SZP A;  3G6X A;  1ZQX A;  4YQW A;  7ICU A;  8ICX A;  2A1J A;  3RTV A;  5DB6 A;  2DR7 A;  4YCX A;  2JZB A;  2FPK A;  1FA0 A;  3EYZ A;  4M0A A;  3H8S A;  4QWB A;  1NK8 A;  3ISC A;  4IQV A;  7ICE A;  5KFT A;  5J0Y A;  4RT3 A;  8ICN A;  3GIK A;  4HYK A;  1CEZ A;  2V4Q A;  3AU2 A;  4J9K A;  1K1Q A;  4DQS A;  5HC9 A;  4DEZ A;  4PGX A;  2XO7 A;  2R8I A;  4E80 A;  3PVX A;  2BCQ A;  5EWE A;  4F5P A;  1ZQH A;  4DQQ A;  3HP6 A;  2AGO A;  3BDP A;  4PHD A;  4FS1 A;  3OSP A;  5KG0 A;  4LVS A;  3T5J A;  5DBB A;  4UQG A;  4RNM A;  2ALZ A;  2ZH1 A;  4AT7 B;  5DKW A;  4RQ1 A;  4RT2 A;  3LK9 A;  2BCU A;  1T7P A;  4IR1 A;  4WCW A;  5DGB A;  4QZD A;  2VA2 A;  5KT5 A;  8ICI A;  3PX0 A;  1A77 A;  3QZ8 A;  3HT3 A;  2ASL A;  3JPN A;  1SL2 A;  4I2B A;  4WC5 A;  3GIJ A;  5DED A;  4O3N A;  1L3T A;  3RB3 A;  1XSL A;  5KFW A;  4F5N A;  3JPP A;  2ZHA A;  3MR6 A;  2W9A A;  9ICU A;  5J2J A;  4QWA A;  1LB2 B;  3TI0 A;  1BNO A;  5KFK A;  2UVU A;  7ICJ A;  3OUY B;  2DRA A;  3RJE A;  1DGS A;  5J0R A;  5CB1 A;  2R8G A;  1Z00 B;  3M9N B;  3TFS A;  3BQ1 A;  1ZQV A;  2BKE A;  4IRK A;  4X4U A;  4P4M A;  3H4D A;  3JPT A;  2PFN A;  3MFI A;  4WC1 A;  5BPC A;  3C2L A;  4B9M A;  5KFX A;  4RWQ A;  3SZ2 A;  3N97 B;  5KFB A;  4QWE A;  3MBY A;  3OHB A;  1UEV A;  3RAX A;  4FS2 A;  4FO6 A;  2JZB B;  3PMN A;  3V7K A;  1ZQR A;  4F4W A;  3THV A;  2ZH8 A;  3T5H A;  1NJW A;  1NK0 A;  3RAQ A;  4NY8 A;  2PBE A;  3OV7 A;  9ICV A;  2J6U A;  4DFM A;  3RB4 A;  4P2H A;  3GV8 B;  8ICU A;  2ZHB A;  4ECY A;  2M2V A;  3PNC A;  1ZQF A;  4KLF A;  4F93 B;  5CP2 A;  4X0A A;  1BNP A;  3HX0 A;  3GDX A;  2C2D A;  4EEY A;  7ICF A;  4KLL A;  5KFE A;  4Q45 A;  5J2F A;  3MFH A;  5J0O A;  3UXN A;  9ICF A;  3K4G A;  1KNY A;  4AT8 A;  3T3F A;  1HUO A;  3TAN A;  4F4Y A;  4DL3 A;  1ZQQ A;  3RH5 A;  3WFS C;  1HJP A;  5KFL A;  5EWF A;  4PGQ A;  4ECS A;  4Q43 A;  1X9S A;  4F4K A;  4K4I A;  3AU6 A;  3WFQ E;  3EZ5 A;  3MDA A;  4DQR A;  1ZJN A;  4FH5 A;  2BCS A;  2IBK A;  3JZ0 A;  4DL7 A;  1WCN A;  1BPX A;  1NK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...