4M9LA

Dna polymerase beta e295k soaked with dctp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
326
structure length
313
Chain Sequence
b'TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPVAGEPLPVSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 107
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9lA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9lA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9lA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9lA03
3V6KA 1QSLA 3QZ8A 4QZCA 3T5JA 1KRPA 4QZEA 4M6WB 4DSKA 3Q8MA 4XRHA 5KG1A 5DGBA 1TFYA 1ZQAA 4Q8EA 1T4GA 1DGSA 1RPLA 4PGQA 2ISPA 3ZDAA 1BNPA 2DR8A 1B22A 1D8LA 4RPXA 3JPQA 3TAQA 2F1HA 5CHGA 4X4UA 1NJZA 2Y1JA 2M2VA 1NKBA 3UPSA 4DWIA 4EBDA 1MSWD 4LT6A 5KFDA 4ELUA 1KEJA 3GILA 3V7LA 4P4OA 4IQVA 4DOAA 4J9SA 3PX6A 5HRHA 2VA2A 4KLTA 8ICGA 2BCSA 5KFYA 3V7KA 2FPKA 4MEXA 5KFZA 5J2AA 3C1YA 3OJUA 2AQ4A 9ICFA 1NJXA 4UD4A 4ATBA 1Q78A 4P4PA 5KT6A 4YFKA 4RNOA 3RJJA 3H40A 4RQ4A 3T5KA 4IQUA 2IHNA 2BGWA 4BXOB 4I27A 3RBDA 4WC3A 4C8NA 3PV8A 2MUTB 4I2CA 4DSFA 5KG6A 1R89A 2ZTEA 3C2MA 1UA1A 4XA5A 3RRGA 4JWMA 4X4QA 4C8MA 5KFIA 2BQ3A 1S97A 4DOBA 4ECTA 3ZDEA 3GV5B 4M47A 1S0VA 1KFTA 5DGAA 2H5XA 3UPQA 4E7XA 4EBCA 2PXIA 2IA6A 4B9MA 1JXEA 4ECZA 4QZ8A 4O3OA 4YD1A 2M2WA 3H3AA 4ED1A 1COOA 4QZBA 3LWLA 1N56A 4AT7A 2DRBA 4TQRA 2O5AA 8ICOA 2AU0A 2ZHBA 2ZH4A 3TAPA 2ZTCA 2IBKA 4DFKA 3E2EA 4R65A 1TV9A 4X4NA 4C8OA 5KFFA 1JQRA 3PNCA 5KG4A 3T3FA 3PW0A 5KG7A 1NJWA 4EYIB 4GXIA 2VA8A 4I2AA 9ICOA 2ZH9A 5IIKA 3RJKA 3ZDDA 4RZRA 4JWNA 4KLDA 1ZJNA 1Z00B 2FPMA 2BKEA 4O3NA 5CJ7A 5CR0A 5L9XA 3JPTA 2HHVA 2NRZA 3ISDA 4WC7A 2F1JA 9ICJA 4RQ3A 5CA7A 2DPJA 2M2TA 5J2IA 9ICXA 5J0WA 1MIVA 3BQ1A 3HP6A 1ZQDA 5KFHA 4DL5A 4O5CA 5EOZA 2W9MA 4QWBA 4ELTA 4KITB 4FHPA 8ICFA 4QZIA 4F93B 1IXRA 3M8SA 3AU6A 3HIYA 5J0RA 4DFJA 3C5FA 4AT9B 4QW9A 3PY8A 4J9KA 4KLJA 4ED0A 4NLKA 2XO7A 4BWMA 4IQWA 2M2UA 1HJPA 4MF8A 4PHDA 4TUSA 5HREA 4DF4A 2AGOA 3JYYA 4KLMA 1KTQA 1H38A 5CB1A 2RFFA 1KFDA 1MQ3A 5IIOA 3LWMA 4E0DA 3EW9A 1ZQKA 5KFXA 4DSEA 2FLNA 5EWEA 8ICYA 1TK8A 4WBZA 4RPYA 2ASDA 4DL3A 2BQRA 5KFWA 1HUOA 3OVSA 4DS4A 4MF2A 4M9NA 3SYZA 5DBBA 2MAXA 1WOTA 4WC4A 1ZQEA 4DL4A 4IG8A 1U9LA 1S0NA 1NK8A 5D49A 2HHTA 5J0QA 1ZETA 2ASLA 3OHBA 3AU2A 4FHVA 4J9MA 1XC9A 5KT5A 4M9GA 4WBYA 3UXNA 3NYBA 4M5DA 2FMPA 3OV7A 5F9LA 3V6HA 5J0TA 5J2BA 4M0AA 1K1QA 5DB7A 4KLEA 4NKTA 4EEYA 8ICSA 5J29A 1UEVA 3H39A 4ATBB 3Q8KA 2R8IA 2R8KA 5DB6A 3C23A 4IRCA 5J0SA 3OVBA 1ZQLA 3HWTA 9ICLA 4F50A 1R8CA 4RWQA 2FLPA 2XY6A 1D8YA 2J6UA 1SL0A 1ZQWA 4WC1A 4UAZA 4RU9A 3M9NB 3KHGA 4KN4A 1L5UA 9ICQA 3C2LA 3QEAZ 1SL1A 4ZH4A 4X4SA 5KG5A 8ICRA 9ICIA 1UETA 5DB8A 2PBEA 1UT8A 1XU4A 1DOQA 2V4RA 1NZPA 5HRIA 1ZQTA 4J9NA 1ZQIA 2UVVA 4M04A 4I2BA 4MFFA 4I28A 2NRKA 3UQ0A 4KN7A 4UQGA 4AT9A 3C5GA 1TAQA 9ICAA 3KHRA 4AT7B 4BWJA 2ZH8A 5KFCA 4UB3A 4K4GA 5DECA 3IHQB 2C22A 1JXLA 4FBUA 1NJYA 2R8GA 3V7JA 4B9NA 8ICMA 4DS5A 5HRBA 5HRFA 4E8FA 4DL2A 2NRTA 5DG9A 4ED6A 4DF8A 2VA3A 3QE9Y 5KFQA 9ICUA 4NKUA 3TFRA 1X9SA 5DG7A 4BGDA 4DFMA 2HHSA 1TFWA 4RUAA 2BPGA 1PX5A 1IM4A 5DQIA 4ECQA 4DO9A 8ICWA 1XSNA 5DKWA 4YXJA 4KLIA 5J0OA 3KHLA 4I2DA 1L3VA 5D46A 2ZHAA 1WCLA 3PO5A 1FA0A 4I2JA 8ICKA 5KFNA 1S0OA 4I2EA 1S77D 3M9MB 2XCAA 4B9UA 4JV1A 1U45A 1BGXT 4YMNA 9ICKA 3AQLA 3H38A 4RQ5A 3B0XA 4ECUA 4HYKA 1LV5A 4KLGA 3BJYA 3LK9A 3TFSA 4RQ0A 5KFEA 5DBCA 1TK0A 2DR5A 2JEIA 4NLGA 4F8RA 3V6JA 2ZJAA 8ICIA 5KFBA 1AROP 1ZQUA 5DQHA 4G3IA 2ZUBA 3RR8A 5KT3A 5J0PA 2W9BB 2ATLA 4FHWA 4NXZA 3PW7A 3C21A 8ICVA 1ZQSA 4KLHA 2ZJ8A 5CP2A 4F4ZA 4R64A 4F5NA 3PW5A 4QZDA 4UAYA 2BCUA 3TI0A 5KT7A 1L3SA 2DFLA 5J2HA 1CUKA 3MFIA 2RDIA 2A1JA 4RPZA 1BPZA 4F92B 5KFUA 4RQ7A 1T7PA 4IRDA 4WC6A 3FYHA 4MFCA 7ICPA 1QLNA 7ICRA 2HHUA 9ICSA 1ZQOA 4RT3A 2ISOA 4DOCA 4UBCA 3H4DA 1N48A 5KFRA 3JPPA 5KTQA 4UB5A 4FBTA 4NM1A 4ECRA 3HJ1A 3WFOA 1JMSA 1U49A 3OHAA 4CCHA 5J2CA 5KFVA 1S9FA 2IMWP 2HW3A 3C66A 5L1IA 1R8BA 5IIJA 3RB0A 4M9HA 5IINA 4UB1A 3QZ7A 8ICLA 4Z6DA 4DL6A 5J2DA 4YR0A 3PR4A 4X0AA 5BPCA 1RXWA 2ZH7A 4YG2A 2LYHA 3MR6A 3EPIA 2NRWA 3JPNA 4J9PA 2UVWA 4TUQA 2PFPA 2O1PA 4PGXA 5L1LA 4PGYA 2RDJA 1V9PA 1ZQXA 4MEYA 4LVSA 4Q45A 1L3TA 2M9NA 5HHHA 4F4WA 1TAUA 3UXOA 3JPRA 5HMLA 2C28A 9ICWA 3PVXA 4IQTA 2Y1IA 1BVSA 2C2RA 3PO4A 8ICTA 3MBYA 2W9BA 4F5QA 9ICTA 4FH5A 4EBEA 1X9WA 2JEFA 3ISBA 5L1JA 3UXPA 4F3OA 4DQRA 7ICVA 1Z3EB 4DSLA 1ZQHA 3HW8A 2IHMA 9ICNA 2JEJA 5C5JA 2PI5A 3H37A 4F91B 4RQ1A 3MR2A 3OSNA 3GQCA 4DLEA 2I9GA 1F5AA 3OUYB 3AQNA 2PFOA 4RQ8A 2XCPA 3V72A 2XC9A 1RYRA 1RZTA 3Q8QB 8ICBA 4O3SA 4F5OA 4KLLA 2XY5A 2B21A 2BCQA 2W9CA 2DVIA 4Q44A 1RXVA 1SKRA 4EYHB 3GDXA 1X2IA 4P2HA 3ZD9A 9ICRA 5DLFA 4YMMA 2UVUA 3EYZA 4GLXA 4YVZA 9ICPA 4X4TA 1S10A 4ED7A 4F4YA 1Q79A 1WCNA 3AQKA 3G6YA 4PPXA 1Y88A 1ZQYA 3PMLA 3BQTA 4XQ8A 5KFPA 2AGQA 3MDAA 2PFNA 2P6UA 1JN3A 5F9NA 1BNOA 3WFQE 1XWLA 2R8HA 1QTMA 4O5EA 1KNYA 3C18A 1ZYQA 5F2VO 4NLNA 4EZ9A 4QWAA 2I1QA 1RYSA 4NY8A 2V9WA 9ICHA 2HHXA 1NO5A 1XSPA 4UB2A 1KLNA 2ID1A 1EXNA 3M8RA 2C2DA 2R8JA 9ICMA 3TARA 1NK4A 3Q8LA 1ZQZA 3EZ5A 5BOLA 4DQPA 3GV7B 4J9RA 4AT8A 5J0YA 2JEGA 4X0BA 4TQSA 3RTVA 5HC9A 2A1JB 5HHIA 2Q0ZX 2ZH1A 2HHQA 2PI4A 2HVIA 3ORYA 5DG8A 2BCRA 1QSYA 4R8UA 3RJHA 4GC7A 3C1ZA 3GFKB 3MABA 3JZ0A 4I29A 4UD5A 1ZQGA 7ICIA 2OWOA 1BPYA 3RH4A 4FHXA 4NM2A 1ZQQA 4EBKA 4TUPA 1UT5A 4Z6CA 3TQ1A 3MR5A 1SL2A 4R66A 3MFHA 8ICNA 2J6SA 1NKCA 2NRVA 7ICNA 3RJGA 5EWFA 4M2YA 3KTQA 2BHNA 3N97B 1ZQFA 2KTQA 1VJ7A 7ICTA 3OUYA 2NRXA 4JV2A 1ZQJA 4UBBA 2HHPA 2ZH3A 4X4VA 5L1KA 4K4HA 3IM1A 7ICQA 4J9OA 4ED2A 1MQ2A 3HJ4A 5J0UA 5DDYA 3RR7A 5HR9A 4GXKA 4PHAA 5J0XA 4YP3A 4ECYA 2ALZA 2KZMA 8ICZA 4FS2A 2ZH6A 3RAXA 3ZD8A 5IILA 1T8EA 2FLLA 5DBAA 3Q8RB 5HP4A 4RQ6A 7ICEA 1DK3A 2BDPA 3GIKA 2Q66A 1NOMA 4LZDA 5CWRA 4B9LA 4QWEA 2JZBA 1NK6A 4I2GA 8ICHA 3ZDCA 5HNKA 3H8SA 4FO6A 4DSJA 1K1SA 5IIMA 1U48A 1PZNA 3FDSA 4Z6EA 2FMQA 4XQ7A 5BOMA 7ICUA 4O3PA 3MDCA 3PX4A 2BQUA 3BQ0A 1TK5A 1TKDA 1SKWA 9ICBA 3HX0A 5KT2A 4B9SA 3G6XA 8ICCA 8ICPA 7ICLA 1TVAA 4X4RA 1BPBA 8ICXA 4F2RA 1KSPA 2KFNA 2ZH5A 1LB2B 4RUCA 3PX0A 1B43A 4NLZA 2W8LA 1NK7A 4EBJA 4RWOA 4DLGA 3L9DA 3RJFA 3Q8SB 1ZQRA 1HUZA 4I2FA 3RB6A 1JX4A 4RNMA 2WTFA 1KDHA 2ZUDA 3WFRE 4X5VA 4FHYA 1D9DA 3KHHA 2ZUCA 5HMMA 2BPCA 3H8JA 2XGPA 2W9CB 4M9LA 3GIMA 1YLQA 3RJIA 4YQWA 5KG3A 3OSPA 2W8KA 1KFSA 4KLSA 3ZDBA 2KFZA 4EP7A 1C7YA 2BR0A 1ZQVA 5J2JA 3RH5A 3RRHA 4RWPA 4YMOA 5HRLA 4O9MA 4DSIA 2J6TA 4QWCA 1R8AA 4ED8A 4DQSA 3N4MB 2P66A 2F1IA 3LDAA 3QEBZ 1TFRA 4C8LA 1JIHA 2KZZA 4WC0A 3RB3A 1BPDA 4KLOA 1XSLA 4B9VA 4P4MA 3PMNA 1U47A 7ICGA 2KZ3A 7ICSA 1DK2A 1NK9A 1ZQPA 4ECVA 9ICVA 3JPOA 4I2HA 3ISCA 4R63A 4IRKA 2XGQA 4RT2A 2AQ0A 4E80A 4QZAA 4KLUA 4MFAA 2FPLA 4AT8B 8ICJA 5J2KA 9ICEA 5KFOA 4X4PA 1NK0A 3OVAA 3H7IA 5DQGA 4GC6A 5KFSA 4QZHA 4J9LA 3T5LA 5KFTA 2ZTDA 4XUSA 5HRKA 4M6WA 4R8UB 4YR3A 4KTQA 1OU5A 4RQ2A 4O5KA 4WCWA 5DEDA 4WC5A 3EWAA 1A77A 4QZGA 2BCVA 3EPGA 2VANA 4PHEA 3K4GA 4JK1A 5KFGA 4QZ9A 3H4BA 2P6RA 4LZGA 7ICHA 1XS9D 4QZFA 4K4IA 3BDPA 1X9MA 3RJEA 4DEZA 5KT4A 1BPXA 4B9TA 4FH3A 4DFPA 1XO1A 4RWNA 4F2SA 1MC8A 1NKEA 3G6VA 4F4XA 5D4BA 3PW2A 3OJSA 5KG2A 4EZ6A 4YR2A 3SI8A 7ICKA 5HRGA 5DDMA 2HVHA 1S0MA 3OGUA 1L3UA 8ICAA 4FS1A 8ICQA 3GIIA 1UA0A 3RH6A 4UAWA 1ZQNA 2ZJ5A 2UVRA 4J9QA 3ETLA 4BXOA 3MGIA 7ICMA 5KFLA 2JZBB 5KFJA 7ICOA 4TURA 1D9FA 5J2EA 2GWSA 2MUTA 2PFQA 4F4KA 4I2IA 4KLFA 5HRDA 5TZVA 4PHPA 5KFKA 1MIWA 1T3NA 3Q8PB 1ZJMA 4JUZA 5IIIA 4UB4A 3AUOA 1NK5A 5DLGA 2DR9A 3PW4A 3C2KA 3THVA 2AGPA 3SZ2A 1MIYA 2DPIA 4O3QA 4S3NA 3PR5B 4YN4A 2KP7A 4ECSA 8ICUA 4ECXA 4GXJA 2AJQA 4DQQA 4JV0A 4YD2A 4QW8A 5J2FA 4DQIA 4KMUA 3NTUA 9ICGA 1S76D 3WFSC 3BQ2A 1SZPA 3HT3A 4PH5A 2BPFA 3B0YA 4IR1A 7ICJA 3HPOA 1ZQMA 1ZQBA 4IR9A 5KFMA 2V4QA 9ICCA 3K75D 5KFAA 4QWDA 1UEUA 5KG0A 4O0IA 4WC2A 1QSSA 2C2EA 3WFPA 4Q8FA 3GV8B 1CEZA 2ASJA 1VFGA 4F5PA 5EWGA 3H8WA 3SV4A 2KN7A 1Z00A 3RB4A 5J2GA 3GIJA 3TANA 1SKSA 4BDPA 1BPEA 5DB9A 2XY7A 3MR3A 4KLQA 1V4AA 4ELVA 4DL7A 4YXMA 2FMSA 4X4OA 3NGDA 3RBEA 5JUMA 4M9JA 3JPSA 2DR7A 3SV3A 4F5RA 7ICFA 2HHWA 2BE3A 4Q43A 3LQCB 3AQMA 1A76A 4Z6FA 4RNNA 2DRAA 1ZQCA 4O3RA 3MGHA 8ICEA 4C8KA 3RAQA 4YCXA 1JAJA 2W9AA 1U4BA 3UQ2A 4ED3A 3T5HA 4ECWA 2ZH2A 3M9OB
chains in the Genus database with same CATH superfamily
1QSLA 3T5JA 4QZEA 4M6WB 1SV0A 2AHOB 3BZKA 5AM5A 1RPLA 4PGQA 1B22A 1D8LA 3JPQA 3TAQA 1NJZA 1J2MA 5AI6A 5KFDA 3V7LA 3PX6A 2VA2A 4KX3A 4NXUA 5A0LA 4RQNA 3LVVA 4P0PA 5KFZA 3C1YA 1N61A 3OJUA 2AQ4A 4WQKA 3RJJA 3H40A 4BXOB 2IHNA 5ALIA 2OM6A 3PV8A 4JWMA 4X4QA 1Z4OA 2BQ3A 1S97A 4DOBA 2Z7JA 1KFTA 2QB0B 1DRGA 3N7PD 2EAOA 2KE7A 2PXIA 4Y2JA 4QZBA 8ICOA 2AU0A 2ZTCA 3E2EA 1XNSA 2XI9A 1TV9A 1NZBA 5B3QA 4C8OA 4X4NA 3OTQA 1JQRA 2NYVA 1N2XA 4GXIA 2ZH9A 2VA8A 1ZJNA 1Z00B 5AKIA 5CR0A 4NWIA 3JPTA 2HHVA 4EENA 4CF3A 2DPJA 3UM9A 5J2IA 3L3FX 2WF9A 3AMZA 3B9JA 4DL5A 3FC4A 2Y9UA 4F93B 4QNLA 2KHQA 3HIYA 4DFJA 4LEZA 2GOLA 4AT9B 4QW9A 4ED0A 4BWMA 2M2UA 4KLMA 1KTQA 3M7DA 3F5EA 1ZQKA 5KFXA 2JH1A 5EWEA 5TISU 2A19A 3OVSA 5DBBA 4IG8A 1S0NA 1NK8A 2HHTA 2B0CA 3AU2A 4O6AA 5KT5A 4P0PB 3NYBA 4C4SA 5F9LA 5J0TA 5J2BA 5DB7A 4KLEA 8ICSA 3H39A 2M0NA 2R8IA 4LEYA 3OVBA 1ZQLA 4RWQA 3FAHA 4Y2VA 5ALXA 4RU9A 1L5UA 4ZH4A 5KG5A 8ICRA 1UETA 1L8OA 2PBEA 1XU4A 1DOQA 1VDVA 5HRIA 2NRKA 4I28A 4PL1A 2JH7A 9ICAA 3KHRA 2ZH8A 5KFCA 1ED1A 3V7JA 4C4RA 2NRTA 3LVWA 2VA3A 5KFQA 4K96A 4NKUA 1VLBA 1TFWA 2HHSA 4RUAA 4ECQA 5DQIA 1PK3A 8ICWA 3KKAC 4KLIA 3KHLA 3PO5A 5J8YA 1SGGA 2HBMA 3BS7A 5KFNA 2H3IA 4B9UA 2NV3A 4JV1A 3EF2A 1IG6A 4RQ5A 2YMPA 5DBCA 1TK0A 3O0FA 2W43A 1DXSA 2W9BB 4JLZA 2YB4A 4UW9A 5EE9A 2KHVA 4F5NA 3PW5A 2LKYA 4UAYA 4O69A 2IOFA 1PVRA 3D2NA 5E79U 3NVVA 1CUKA 2W3SA 1GO3F 1BPZA 4Y2SA 4F92B 5B5EU 3FYHA 4RT3A 4OJ5A 5KTQA 5D61A 5ALDA 3ER8C 4NM1A 1PVPA 4CCHA 5KFVA 1S9FA 2HW3A 2I5HA 4M9HA 4UB1A 8ICLA 4Z6DA 1KN5A 5BPCA 1RXWA 3EPIA 2LYHA 4FO1A 2G5HB 1ZD5A 3JPNA 1X9XA 2O1PA 1X6JA 1ZQXA 2M9NA 5HHHA 5HMLA 3ETRA 4LEWA 1FFVA 8ICTA 4F5QA 2NO4A 2JEFA 4FH5A 1UPHA 3UXPA 4Y2YA 7ICVA 1Z3EB 3MCRA 4DSLA 9ICNA 4DLEA 4PZNA 2YMQA 3AQNA 4RQ8A 2XCPA 2ZIXA 3Q8QB 4F5OA 3F2CA 2DVIA 1V97A 1SKRA 9ICRA 4X4TA 1S10A 4F4YA 1WCNA 2MA1A 3G6YA 3BQTA 2AGQA 1JN3A 1BNOA 3WFQE 2HBJA 2R8HA 1KNYA 5AICA 3C18A 1X66A 2V9WA 1NO5A 1XSPA 5AHXA 9ICMA 2H3FA 3TARA 3Q8LA 4Y2QA 1B4FA 2JEGA 2PKEA 5HHIA 2PI4A 1IIPA 2HVIA 4R8UA 4GC7A 3GFKB 3N7SC 1ZQGA 1BPYA 4NM2A 4TUPA 1UT5A 1TE2A 1SL2A 3NVYA 1VJ7A 3OUYA 4JV2A 4UAUA 1ZRNA 4WQLA 3IM1A 7ICQA 4MHVA 4J9OA 4MKPA 2KIWA 3BQ7A 4YP3A 3AQEA 1PUZA 4FS2A 1F0MA 3RAXA 2W03A 5DBAA 4RQ6A 1DK3A 2Q66A 4LZDA 4B9LA 4I2GA 4X0BA 4XQ7A 3PX4A 1SKWA 3HRDD 3HX0A 5KT2A 4P0QB 7ICLA 4RUCA 1B43A 4DLGA 4RNMA 3SENA 2WTFA 1KDHA 2ZIXB 2ZUDA 3WFRE 3KHHA 2ZUCA 2EAMA 1KFSA 4KLSA 3CK6A 3H0MB 3F5AA 3RRHA 4YMOA 2DKZA 1R8AA 3LDAA 1TFRA 2OYYA 4WC0A 3RB3A 1BPDA 7ICGA 5AI0A 7ICSA 1NK9A 1URJA 9ICVA 4Y2UA 4R63A 3PSIA 2B6GA 4RT2A 2AQ0A 3KOOA 3H7IA 5DQGA 4GC6A 2XIDA 5KFSA 4QZHA 5KFTA 4R8UB 4KTQA 4WC5A 4O5KA 4OCZA 3EPGA 4PHEA 5KFGA 2P6RA 3H4BA 4LZGA 1XS9D 4QZFA 4K4IA 3AQFA 3BDPA 1X9MA 1WWVA 3EUB2 1BPXA 4B9TA 4DFPA 4RWNA 5AKJA 3G6VA 4F4XA 3OJSA 3SI8A 1KQQA 3CRXA 5EE0A 1L3UA 3GIIA 2GH1A 2W04A 1SV0C 2ZJ5A 4J9QA 3MGIA 2HOIA 5L1MA 5KFJA 5J2EA 4I2IA 4UB4A 2DR9A 2ZIUA 3PW4A 2G07A 3THVA 4S3NA 2KP7A 4ECXA 2F3NA 5J2FA 2HI0A 3CW2C 5G5GA 4PH5A 4IR1A 3SEIA 3HPOA 1ZQMA 4IR9A 1UEUA 5AI9A 1QSSA 3WFPA 5CFUA 1CEZA 2ASJA 1M6YA 2Y0SC 1SV4A 1UCVA 2VJ5A 4WH5A 4CRXA 1SKSA 3MR3A 4DL7A 4YXMA 1GPJA 1Z1VA 3JPSA 3SV3A 2HHWA 3AQMA 1JAJA 3MGHA 3RAQA 2HN2A 4PJ0U 1U4BA 4Y2XA 2ZH2A 3M9OB 3QZ8A 1MA7A 3Q8MA 1TFYA 4ZOHC 1T4GA 1DGSA 2ISPA 5FP0A 1N62A 2BBJA 3IP4B 2KKVA 2F1HA 5CHGA 2Y1JA 1NKBA 2ZIWA 3OWGA 1PK1A 4P4OA 4J9SA 2E8NA 8ICGA 3WK5A 5KFYA 2FPKA 3PSFA 3NRZA 4MEXA 5J2AA 2ODGA 5B3PA 9ICFA 1Q78A 2O6KA 2NO5A 4I27A 1A0PA 4IQUA 2IOFK 2BGWA 3RBDA 3IDWA 3KZIU 5KG6A 2ZTEA 3C2MA 2ZIUB 3ZDEA 2WB1C 5DGAA 3JCFA 2H5XA 3UPQA 2A3VA 4B9MA 4O3OA 2M2WA 2ZH5A 4ED1A 2Y0SF 3KD3A 3M1YA 2ZHBA 4RQMA 1P7DA 3TAPA 5C0YA 5KFFA 1NJWA 4EYIB 2RRDA 5IIKA 4KLDA 2D6FC 1ZD3A 2GLEA 2FPMA 3QX7A 3ISDA 3HKZC 4RQ3A 3K7DA 3HP6A 1ZQDA 5AK5A 2W9MA 4ELTA 1F5SA 4KITB 2W55A 8ICFA 4QZIA 4UB6U 3M8SA 2JXJA 1D8BA 2FI1A 4NLKA 4IQWA 4UD5A 4PHDA 5HREA 2AGOA 4F72A 1MQ3A 3C29A 4E0DA 8ICYA 4DFDA 2VIXA 1K5OA 5KFWA 4MF2A 2ZIWB 3SYZA 5AM3A 1ZQEA 3KZXA 5D49A 5J0QA 3OHBA 3M6ZA 2YTUA 4J9MA 1XC9A 1WG8A 4M5DA 3V6HA 4Y2RA 1K1QA 4NKTA 5J29A 1UEVA 3K1RB 2WB1F 3HWTA 4F50A 1SL0A 5AKKA 3M9NB 4KN4A 5ALOA 1JUDA 5DB8A 1UT8A 4M04A 4J9NA 4AT9A 2WF5A 4KN7A 2B51A 2KV2A 1N63A 1TAQA 4QJFB 5DECA 4E8FA 3SQIA 4B9NA 8ICMA 2YQEA 4ED6A 3QE9Y 3HKZF 4DFMA 2BPGA 1IM4A 5ALPA 1JI7A 5ALTA 2DL0A 2K4PA 4YXJA 4I2DA 2KJ5A 1L3VA 2QB1A 5AM0A 1FA0A 4NXTA 1S0OA 4I2EA 3H8MA 4WC3A 3PHZA 4HYKA 1ECWA 2EQYA 3TFSA 3LK9A 2DR5A 2JEIA 2K8CB 8ICIA 2KMDA 1AROP 5KFBA 4G3IA 5KT3A 3TADC 4FHWA 4NXZA 4KM5A 8ICVA 5AK6A 5CP2A 2W7PA 3RFAA 5AKEA 2K8AA 5KT7A 5G5HA 3SR6A 5AKXA 3SAHA 5KFUA 4RQ7A 7ICPA 5ALGA 3MGVA 7ICRA 2HHUA 4GIBA 4UBCA 5KFRA 4UB5A 4IC9A 2JV3A 2KNJA 1U49A 2D8CA 3OHAA 4EGWA 5J2CA 3C66A 4KB6A 3KBBA 5IIJA 3QZ7A 5J2DA 3FM9A 3PR4A 3MR6A 4J9PA 4TUQA 4FE3A 4EEKA 5L1LA 5ALKA 2AXTU 1V9PA 4OD0A 5KAIU 4NLBA 1L3TA 1TAUA 3WK4A 3UXOA 3JPRA 4IQTA 3PO4A 3MBYA 2W9BA 4EBEA 3ISBA 1CI4A 4DQRA 1N5WA 3HW8A 2IHMA 2JEJA 5C5JA 2CRXA 3WKCA 5ALJA 2PFOA 3V72A 1RYRA 1HEKA 2B21A 2XY5A 2BCQA 2WF7A 4Q44A 1RXVA 4OAIZ 3QU9A 5JTIA 4EYHB 3NS1A 2D3DA 3ZD9A 3L4PA 9ICPA 2H3VA 1JROA 4ED7A 3OPXA 4PPXA 1ZQYA 5AM2A 5F9NA 1XWLA 1QTMA 4O5EA 4OJOA 1ZYQA 5F2VO 4NLNA 4EZ9A 2I1QA 4NY8A 3ED5A 1KLNA 2ID1A 2DQNB 2C2DA 2F77X 3EZ5A 5BOLA 4DQPA 2HHQA 4UARA 5DG8A 1QSYA 3RJHA 2GAFD 3C1ZA 3UMGA 3RH4A 3TQ1A 4Z6CA 3MR5A 3MFHA 8ICNA 2J6SA 2NRVA 7ICNA 3SAGA 3KTQA 1ZQFA 2KTQA 3IG8A 1ZQJA 4UBBA 2ZH3A 4NL9C 4X4VA 3QXGA 4K4HA 4GXKA 5IILA 5HP4A 2BDPA 5CWRA 5AI5A 2XICA 2JZBA 1NK6A 5IIMA 3MDCA 3M6KA 3QU4A 3BQ0A 1TKDA 4B9SA 4X4RA 1BPBA 1KSPA 2K4EA 1LB2B 3A0BU 1A6SA 4EBJA 3RJFA 1ZQRA 4I2FA 3RB6A 2QARB 4K97A 1D9DA 2XGPA 3H8JA 3L5KA 3OSPA 2BDUA 3ZDBA 2BR0A 5HRLA 2WF8A 4O9MA 2J6TA 5KAFU 4C7YA 4DQSA 3N4MB 2F1IA 4OAFA 3QEBZ 4B9VA 1U47A 2KZ3A 4ECVA 3JPOA 3S6JA 3ISCA 1ZOLA 4E80A 1QQ6A 4QZAA 4OJPA 2FPLA 5ALFA 8ICJA 3OVAA 9ICEA 1NK0A 5ALUA 2ZTDA 4XUSA 4YR3A 1OU5A 4K99A 4RQ2A 4P0QA 2EZYA 5GTHU 4EV6A 1VJ5A 2JR5A 3H0LB 1Z1BA 1XO1A 4F2SA 1MC8A 3PW2A 5KG2A 1LKYA 1S0MA 8ICAA 2MSNA 8ICQA 4OAHA 5GTIU 1UA0A 1ZQNA 2UVRA 7ICMA 3ETLA 2JZBB 1D9FA 2GWSA 2K8BB 2MUTA 4KLFA 1T3NA 2P35A 2N1RA 5DLGA 2AGPA 1TAMA 4ECSA 3NRWA 5HR7A 2AJQA 4QW8A 3ALRA 4KMUA 3NTUA 9ICGA 3WFSC 7ICJA 2KICA 5KFMA 2V4QA 2F76X 3K75D 9ICCA 5CFSA 2CPRA 4O0IA 4Q8FA 5K4LA 1AQ6A 4F5PA 5AM1A 3H8WA 3SV4A 2KN7A 2XY7A 4ELVA 4WOYA 2FMSA 4M9JA 3LYSA 2DR7A 2F8LA 4F5RA 5ALZA 3D2SA 2JHDA 2BE3A 3LQCB 4Z6FA 1ZQCA 4O3RA 4N7RA 4YCXA 2HOQA 3T5HA 3V6KA 2RP5A 2MRLA 4QZCA 1KRPA 2KK0A 4XRHA 1ZQAA 1BNPA 2DR8A 4RPXA 3ZI4A 4X4UA 3QU7A 2M2VA 3UPSA 4LT6A 4EBDA 1MSWD 4ELUA 1KEJA 3GILA 2EZXA 5HRHA 2RLTA 3HJEA 1LKYB 2G06A 3H0RB 1NJXA 4ATBA 4FZMA 4YFKA 4RQ4A 3T5KA 4C8NA 2HOFA 2MUTB 3F2BA 4DSFA 1R89A 3RRGA 1UA1A 4XA5A 3ONNA 5KFIA 4CF5A 4NXXA 4EX7A 5AKGA 4M47A 4EBCA 1JXEA 1ZQ1C 4QZ8A 4C4TA 4AT7A 1COOA 3LWLA 1N56A 2DRBA 2O5AA 2IBKA 4R65A 3PNCA 3I28A 2W3RA 3K1ZA 2OHFA 4I2AA 9ICOA 5ALYA 3ZDDA 4JWNA 4RZRA 2OEHA 5JU5A 4O3NA 5L9XA 9ICJA 1SZHA 2LHTA 1MIVA 3KKAA 2WFAA 2YB1A 4O5CA 5EOZA 4FHPA 1JRPA 2FCLA 1IXRA 3AU6A 4LEVA 4J9KA 4KLJA 4MF8A 3D2QA 3JYYA 4I0UA 4JLXA 5CB1A 2RFFA 5IIOA 3EW9A 2FLNA 5CEHA 1X40A 3N28A 4WBZA 4NLCA 2ASDA 4DL3A 2BQRA 4DS4A 2MAXA 1ZXIA 5ALMA 1X6IA 1ZD4A 2ZIVB 3AN1A 4JB3A 1KL9A 3SMVA 4EEYA 4ATBB 3Q8KA 5DB6A 5J0SA 9ICLA 1R8CA 4WC1A 3QUTA 1D8YA 2J6UA 1ZQWA 4UAZA 3KHGA 9ICQA 3QEAZ 5ALVA 4Y2PA 4CGZA 1NZPA 2V4RA 1ZQTA 4Y2TA 4I2BA 2K60A 3U26A 2YMLA 4HX0A 3UQ0A 3C5GA 4AT7B 1KW4A 4BWJA 2BBHA 2GA9D 4UB3A 3NVOA 1IV8A 2C22A 1JXLA 4DS5A 5HRBA 4DL2A 1Q3UA 2WAQC 5DG7A 1PX5A 4DO9A 1X42A 2ZHAA 1UQVA 4I2JA 8ICKA 1U45A 1BGXT 3PSTA 3B0XA 4ECUA 1LV5A 1CRXA 4RQ0A 2DUYA 5KFEA 4F8RA 2ZJAA 4OO1J 1ZQUA 2OH2A 5J0PA 2KJ9A 2ATLA 3PW7A 1ZQSA 4F4ZA 3NWIA 4USAA 4R64A 1L3SA 3QU2A 2I6XA 2QLTA 2RDIA 4RPZA 3AL0B 1T7PA 2ISOA 1NI3A 3H4DA 3SAFA 3NUQA 4ECRA 3WFOA 1JMSA 5D62A 5ALHA 3VC8A 4ICAA 5L1IA 1R8BA 5IINA 1L7NA 2W7OA 2ZH7A 4YG2A 2NRWA 2UVWA 1UHUA 2G09A 5AKLA 2RDJA 4Q45A 2H3ZA 2HMXA 5D63A 2WAQF 4C0ZA 9ICTA 1X9WA 5ALSA 4EELA 2KOBA 1ZQHA 2KD1A 5KL1B 4F91B 4RQ1A 3GQCA 3OSNA 2E3TA 2KVSA 1FFUA 5J8YC 3ER9B 2Q4TA 4KLLA 1FEZA 3GDXA 4P2HA 1ZRMA 4YMMA 5DLFA 3EYZA 4GLXA 2UVUA 4QIWC 2CXYA 1NNLA 2QKQA 5KFPA 2P6UA 3QU5A 3BZCA 3QUQA 5CFTA 5AKHA 4QWAA 2HHXA 2LI6A 3M8RA 2R8JA 1NK4A 1ZQZA 4AT8A 4J9RA 4TQSA 3ORYA 4K9AA 5ALRA 3MABA 3IG5A 7ICIA 2OWOA 1ZQQA 1COKA 3I76A 3RJGA 4M2YA 2BHNA 2ZXIA 2NRXA 3PZPA 4PL2A 5AK3A 5L1KA 1MQ2A 4ED2A 3HJ4A 2KIVA 5J0UA 3RR7A 5HR9A 8ICZA 2ALZA 2KZMA 3NVZA 7ICEA 5ALLA 4QWEA 3ZDCA 3H8SA 4FO6A 4DSJA 1K1SA 1U48A 3FDSA 4Z6EA 2FMQA 5ALEA 2BQUA 1TK5A 2HCFA 2JRZA 8ICXA 2W8LA 1NK7A 4RWOA 4EX6A 1HUZA 2EAPA 4QIWF 3WK6A 4FHYA 1RM6C 4DCCA 5HMMA 4AYBC 2DF4B 2LM4A 4M9LA 4FZLA 3RJIA 4YQWA 5KG3A 2VJ4A 1S8OA 4EP7A 5J2JA 4C7ZA 4DSIA 1L7OA 4QWCA 3D6JA 2P66A 2A1AA 4EEBA 4KLOA 3PMNA 1DK2A 1ZQPA 1OUQA 4I2HA 4IRKA 2XGQA 1LVHA 3J81j 1N60A 5AM4A 4MFAA 4KLUA 4AT8B 5J2KA 4X4PA 5KFOA 3KFUF 2EH9A 5HRKA 4WCWA 5DEDA 5ALQA 2BCVA 1S5LU 3K4GA 4QZ9A 7ICHA 2OXOA 1F44A 3RJEA 4KMOB 5KT4A 1O03A 2H3QA 2F8KA 2QARA 5D4BA 4EZ6A 7ICKA 4NV0A 4BUGA 1T94A 5DDMA 1KBUA 2ZXHA 4FS1A 4K8VA 3R9KA 3RH6A 4UAWA 5KFLA 2G5IB 4TURA 1MIWA 5HRDA 5TZVA 4JUZA 1NK5A 3C2KA 1MIYA 3SZ2A 2DPIA 4O3QA 2EWRA 3PR5B 3IN5A 5AKYA 8ICUA 4GXJA 4DQQA 4G9BA 2FE9A 4AYBF 4YD2A 3ICXA 4DQIA 4UB8U 1S76D 3BQ2A 3B0YA 3QNMA 2OCEA 1ZQBA 1RQNA 4A8EA 3NKUA 3TKAA 5KG0A 4LJXA 4WC2A 2C2EA 1VFGA 4CNQA 2DGZA 2HBLA 3WK8A 5EWGA 3GU3A 3GIJA 2K4HA 4BDPA 5ALWA 1SXDA 1V4AA 2YX8A 4KLQA 1Q8KA 3NGDA 3WKAA 5AK4A 7ICFA 4Q43A 5AKZA 1A76A 3WU2U 2DRAA 4C8KA 1SB3C 4ED3A 4O3MA 2CN1A 2IHOA 4U7CA 3MC1A 4DSKA 2KSOA 3GZFA 5KG1A 5DGBA 4J03A 4Q8EA 1Q46A 3ZDAA 1FO4A 2ES6A 3DV9A 1Z4NA 3RF9A 2LYBA 3F53A 2YN4A 4DWIA 1PVQA 4IQVA 4DOAA 4KLTA 2BCSA 3V7KA 4UD4A 3PSPA 2KEYA 5JRTA 4P4PA 5KT6A 4RNOA 4OJLA 1O08A 3DEEA 3AEVA 3CNHA 4I2CA 2F44A 4B6JA 4C8MA 4EEDA 4ECTA 2DKXA 3GV5B 5HR6A 4NXWA 1S0VA 4E7XA 2IA6A 4ECZA 2EDUA 4YD1A 3H3AA 4TQRA 4O68A 2ZH4A 5AI8A 4DFKA 1N5XA 2PMZC 5H2FU 5KG4A 3T3FA 3NVWA 3PW0A 5KG7A 3RJKA 2JMGA 2BKEA 5CJ7A 4WC7A 2NRZA 2F1JA 3T79A 5CA7A 2M2TA 9ICXA 4HAIA 5J0WA 3BQ1A 5KFHA 4AP9A 4QWBA 2HDOA 5J0RA 1J97A 3C5FA 2E1FA 1RG6A 2XVTA 3PY8A 2EANA 4O67A 2XO7A 1HJPA 4TUSA 4DF4A 2E8OA 3VCBA 4ACOA 1H38A 1KFDA 2WF6A 2KSOB 3LWMA 4CF4A 3TADA 4DSEA 3IRUA 1TK8A 4RPYA 1HUOA 1WWUA 4US9A 4M9NA 1WOTA 4WC4A 4DL4A 2K89A 1U9LA 1ZETA 2ASLA 4FHVA 1V38A 4M9GA 4WBYA 3UXNA 2FMPA 3OV7A 4M0AA 4US8A 2R8KA 3C23A 4IRCA 2RHFA 2FLPA 2XY6A 2VKQA 5AI4A 3C2LA 1SL1A 4K98A 4X4SA 9ICIA 3QUCA 1ZD2P 5KL8B 2LBOA 1ZQIA 2UVVA 4MFFA 2PMZF 4FZNA 4UQGA 1XO0A 1FIQA 1Q3VA 4K4GA 3IHQB 4FBUA 1NJYA 2R8GA 5HRFA 4DF8A 5DG9A 4GFJA 4NXVA 1SIJA 9ICUA 4F71A 3TFRA 1X9SA 4BGDA 1XSNA 5DKWA 2KG5A 5J0OA 5D46A 1WCLA 2ZG6A 1S77D 2LYAA 3M9MB 2XCAA 9ICKA 4YMNA 1RYUA 3AQLA 3H38A 2W11A 3N7RC 1T3QA 4KLGA 2ZIVA 3BJYA 4NLGA 2BZFA 3V6JA 1L7MA 2YMMA 5DQHA 2ZUBA 3IV6A 3RR8A 4CDGA 2B56A 3C21A 2ESEA 4KLHA 2ZJ8A 3NASA 1SWVA 4QZDA 2BCUA 3TI0A 2DFLA 5J2HA 3MFIA 2A1JA 4IRDA 4WC6A 4MFCA 4IL6U 1QLNA 9ICSA 1ZQOA 2KKPA 2E1EA 4DOCA 1N48A 3JPPA 5CRXA 1C20A 2R18A 4FBTA 3HJ1A 2F2AB 2IMWP 2IUBA 2G08A 2FJ6A 3RB0A 3BS5A 1QH9A 4DL6A 4YR0A 4OAGA 4X0AA 4IS7A 3CP8A 2PFPA 4BX9C 4PGXA 2WHEA 4NL9A 2G0AA 3WKEA 4PGYA 3WK9A 4MEYA 4LVSA 4F4WA 2C28A 9ICWA 3PVXA 2Y1IA 1BVSA 2C2RA 5L1JA 1WUDA 4F3OA 4UAVA 2IOHA 2Y9TA 4OJ6A 5B66U 1L7PA 2PI5A 3H37A 1F5AA 3MR2A 2I9GA 3OUYB 2XC9A 2HN1A 1RQLA 1RZTA 8ICBA 4O3SA 1V85A 2W9CA 5JTGA 2E8PA 1X2IA 4YVZA 3WK7A 1Q79A 3AQKA 1Y88A 2FDRA 3PMLA 2E8MA 4XQ8A 2EZZA 3MDAA 2PFNA 3C28A 1B0XA 3WKDA 4NJ8A 2K4IA 1YZ7A 3SD7A 1RYSA 1OW5A 9ICHA 4WJ3B 4UATA 4UB2A 3E0FA 1EXNA 2JGAA 3GV7B 5J0YA 3RTVA 5HC9A 2A1JB 2ZH1A 2Q0ZX 2BCRA 5AIAA 3JZ0A 5ALNA 4I29A 2KVCA 4FHXA 1DGJA 4EBKA 4R66A 1NKCA 5AIBA 5EWFA 3N97B 7ICTA 3ERCC 2HHPA 3BS5B 1J2NA 1WYGA 5DDYA 4PHAA 5J0XA 4ECYA 2ZH6A 4JMUA 1HIWA 3ZD8A 1T8EA 2FLLA 3Q8RB 5T14A 3GIKA 1NOMA 3CYMA 1YZ6A 8ICHA 2E5SA 1Z19A 1SWWA 5HNKA 1PZNA 5BOMA 7ICUA 4O3PA 9ICBA 8ICCA 5CHEA 3G6XA 8ICPA 1TVAA 4F2RA 2KFNA 3PX0A 2HSZA 4NLZA 4UASA 3L9DA 1MN8A 3Q8SB 1SXEA 2KJ8A 1JX4A 4X5VA 1L8LA 2BPCA 2W9CB 4FFDA 1YLQA 3GIMA 3E58A 2LM1A 3I1YA 2W8KA 2KFZA 1C7YA 1ZQVA 3RH5A 4RWPA 4BJQA 3AM9A 2LMRA 4ED8A 4C8LA 2KZZA 1JIHA 1KKXA 4XJEA 4K9BA 1XSLA 4P4MA 4CE6A 4J9LA 3T5LA 3QYPA 4M6WA 4U6PA 3UMBA 3WKBA 2MU2A 1A77A 2YY6A 3EWAA 4QZGA 2VANA 4JK1A 3DDHA 4KX5A 1YT3A 4DEZA 4FH3A 2RQ5A 1NKEA 4YR2A 5HRGA 2HVHA 3OGUA 2DBYA 2GO7A 3TACB 3A0HU 4BXOA 2HBKA 2B4VA 7ICOA 4F4KA 2PFQA 1JALA 3F2DA 4PHPA 5KFKA 3Q8PB 1ZJMA 1OXJA 2W54A 5IIIA 3AUOA 1L6NA 3UMCA 2QB0A 4YN4A 1QQ7A 4JV0A 2LPEA 1PK1B 2L5YA 4C80A 5F3XB 2BPFA 1SZPA 3HT3A 5EE1A 1RDFA 5KFAA 4QWDA 3QUBA 4PZOA 5KNIA 2DWQA 3GV8B 1Z00A 3RB4A 1QQ5A 5J2GA 3TANA 1BPEA 5DB9A 3HILA 4X4OA 5EE3A 3RBEA 5JUMA 2AH5A 1QCKA 4RNNA 8ICEA 2W9AA 3UQ2A 4ECWA
chains in the Genus database with same CATH topology
3V6KA 1QSLA 3QZ8A 4QZCA 3T5JA 1KRPA 4QZEA 4M6WB 4DSKA 3Q8MA 4XRHA 5KG1A 5DGBA 1TFYA 1ZQAA 4Q8EA 1T4GA 1DGSA 1RPLA 4PGQA 2ISPA 3ZDAA 1BNPA 2DR8A 1B22A 1D8LA 4RPXA 3JPQA 3TAQA 2F1HA 5CHGA 4X4UA 1NJZA 2Y1JA 2M2VA 1NKBA 3UPSA 4DWIA 4EBDA 1MSWD 4LT6A 5KFDA 4ELUA 1KEJA 3GILA 3V7LA 4P4OA 4IQVA 4DOAA 4J9SA 3PX6A 5HRHA 2VA2A 4KLTA 8ICGA 2BCSA 5KFYA 3V7KA 2FPKA 4MEXA 5KFZA 5J2AA 3C1YA 3OJUA 2AQ4A 9ICFA 1NJXA 4UD4A 4ATBA 1Q78A 4P4PA 5KT6A 4YFKA 4RNOA 3RJJA 3H40A 4RQ4A 3T5KA 4IQUA 2IHNA 2BGWA 4BXOB 4I27A 3RBDA 4WC3A 4C8NA 3PV8A 2MUTB 4I2CA 4DSFA 5KG6A 1R89A 2ZTEA 3C2MA 1UA1A 4XA5A 3RRGA 4JWMA 4X4QA 4C8MA 5KFIA 2BQ3A 1S97A 4DOBA 4ECTA 3ZDEA 3GV5B 4M47A 1S0VA 1KFTA 5DGAA 2H5XA 3UPQA 4E7XA 4EBCA 2PXIA 2IA6A 4B9MA 1JXEA 4ECZA 4QZ8A 4O3OA 4YD1A 2M2WA 3H3AA 4ED1A 1COOA 4QZBA 3LWLA 1N56A 4AT7A 2DRBA 4TQRA 2O5AA 8ICOA 2AU0A 2ZHBA 2ZH4A 3TAPA 2ZTCA 2IBKA 4DFKA 3E2EA 4R65A 1TV9A 4X4NA 4C8OA 5KFFA 1JQRA 3PNCA 5KG4A 3T3FA 3PW0A 5KG7A 1NJWA 4EYIB 4GXIA 2VA8A 4I2AA 9ICOA 2ZH9A 5IIKA 3RJKA 3ZDDA 4RZRA 4JWNA 4KLDA 1ZJNA 1Z00B 2FPMA 2BKEA 4O3NA 5CJ7A 5CR0A 5L9XA 3JPTA 2HHVA 2NRZA 3ISDA 4WC7A 2F1JA 9ICJA 4RQ3A 5CA7A 2DPJA 2M2TA 5J2IA 9ICXA 5J0WA 1MIVA 3BQ1A 3HP6A 1ZQDA 5KFHA 4DL5A 4O5CA 5EOZA 2W9MA 4QWBA 4ELTA 4KITB 4FHPA 8ICFA 4QZIA 4F93B 1IXRA 3M8SA 3AU6A 3HIYA 5J0RA 4DFJA 3C5FA 4AT9B 4QW9A 3PY8A 4J9KA 4KLJA 4ED0A 4NLKA 2XO7A 4BWMA 4IQWA 2M2UA 1HJPA 4MF8A 4PHDA 4TUSA 5HREA 4DF4A 2AGOA 3JYYA 4KLMA 1KTQA 1H38A 5CB1A 2RFFA 1KFDA 1MQ3A 5IIOA 3LWMA 4E0DA 3EW9A 1ZQKA 5KFXA 4DSEA 2FLNA 5EWEA 8ICYA 1TK8A 4WBZA 4RPYA 2ASDA 4DL3A 2BQRA 5KFWA 1HUOA 3OVSA 4DS4A 4MF2A 4M9NA 3SYZA 5DBBA 2MAXA 1WOTA 4WC4A 1ZQEA 4DL4A 4IG8A 1U9LA 1S0NA 1NK8A 5D49A 2HHTA 5J0QA 1ZETA 2ASLA 3OHBA 3AU2A 4FHVA 4J9MA 1XC9A 5KT5A 4M9GA 4WBYA 3UXNA 3NYBA 4M5DA 2FMPA 3OV7A 5F9LA 3V6HA 5J0TA 5J2BA 4M0AA 1K1QA 5DB7A 4KLEA 4NKTA 4EEYA 8ICSA 5J29A 1UEVA 3H39A 4ATBB 3Q8KA 2R8IA 2R8KA 5DB6A 3C23A 4IRCA 5J0SA 3OVBA 1ZQLA 3HWTA 9ICLA 4F50A 1R8CA 4RWQA 2FLPA 2XY6A 1D8YA 2J6UA 1SL0A 1ZQWA 4WC1A 4UAZA 4RU9A 3M9NB 3KHGA 4KN4A 1L5UA 9ICQA 3C2LA 3QEAZ 1SL1A 4ZH4A 4X4SA 5KG5A 8ICRA 9ICIA 1UETA 5DB8A 2PBEA 1UT8A 1XU4A 1DOQA 2V4RA 1NZPA 5HRIA 1ZQTA 4J9NA 1ZQIA 2UVVA 4M04A 4I2BA 4MFFA 4I28A 2NRKA 3UQ0A 4KN7A 4UQGA 4AT9A 3C5GA 1TAQA 9ICAA 3KHRA 4AT7B 4BWJA 2ZH8A 5KFCA 4UB3A 4K4GA 5DECA 3IHQB 2C22A 1JXLA 4FBUA 1NJYA 2R8GA 3V7JA 4B9NA 8ICMA 4DS5A 5HRBA 5HRFA 4E8FA 4DL2A 2NRTA 5DG9A 4ED6A 4DF8A 2VA3A 3QE9Y 5KFQA 9ICUA 4NKUA 3TFRA 1X9SA 5DG7A 4BGDA 4DFMA 2HHSA 1TFWA 4RUAA 2BPGA 1PX5A 1IM4A 5DQIA 4ECQA 4DO9A 8ICWA 1XSNA 5DKWA 4YXJA 4KLIA 5J0OA 3KHLA 4I2DA 1L3VA 5D46A 2ZHAA 1WCLA 3PO5A 1FA0A 4I2JA 8ICKA 5KFNA 1S0OA 4I2EA 1S77D 3M9MB 2XCAA 4B9UA 4JV1A 1U45A 1BGXT 4YMNA 9ICKA 3AQLA 3H38A 4RQ5A 3B0XA 4ECUA 4HYKA 1LV5A 4KLGA 3BJYA 3LK9A 3TFSA 4RQ0A 5KFEA 5DBCA 1TK0A 2DR5A 2JEIA 4NLGA 4F8RA 3V6JA 2ZJAA 8ICIA 5KFBA 1AROP 1ZQUA 5DQHA 4G3IA 2ZUBA 3RR8A 5KT3A 5J0PA 2W9BB 2ATLA 4FHWA 4NXZA 3PW7A 3C21A 8ICVA 1ZQSA 4KLHA 2ZJ8A 5CP2A 4F4ZA 4R64A 4F5NA 3PW5A 4QZDA 4UAYA 2BCUA 3TI0A 5KT7A 1L3SA 2DFLA 5J2HA 1CUKA 3MFIA 2RDIA 2A1JA 4RPZA 1BPZA 4F92B 5KFUA 4RQ7A 1T7PA 4IRDA 4WC6A 3FYHA 4MFCA 7ICPA 1QLNA 7ICRA 2HHUA 9ICSA 1ZQOA 4RT3A 2ISOA 4DOCA 4UBCA 3H4DA 1N48A 5KFRA 3JPPA 5KTQA 4UB5A 4FBTA 4NM1A 4ECRA 3HJ1A 3WFOA 1JMSA 1U49A 3OHAA 4CCHA 5J2CA 5KFVA 1S9FA 2IMWP 2HW3A 3C66A 5L1IA 1R8BA 5IIJA 3RB0A 4M9HA 5IINA 4UB1A 3QZ7A 8ICLA 4Z6DA 4DL6A 5J2DA 4YR0A 3PR4A 4X0AA 5BPCA 1RXWA 2ZH7A 4YG2A 2LYHA 3MR6A 3EPIA 2NRWA 3JPNA 4J9PA 2UVWA 4TUQA 2PFPA 2O1PA 4PGXA 5L1LA 4PGYA 2RDJA 1V9PA 1ZQXA 4MEYA 4LVSA 4Q45A 1L3TA 2M9NA 5HHHA 4F4WA 1TAUA 3UXOA 3JPRA 5HMLA 2C28A 9ICWA 3PVXA 4IQTA 2Y1IA 1BVSA 2C2RA 3PO4A 8ICTA 3MBYA 2W9BA 4F5QA 9ICTA 4FH5A 4EBEA 1X9WA 2JEFA 3ISBA 5L1JA 3UXPA 4F3OA 4DQRA 7ICVA 1Z3EB 4DSLA 1ZQHA 3HW8A 2IHMA 9ICNA 2JEJA 5C5JA 2PI5A 3H37A 4F91B 4RQ1A 3MR2A 3OSNA 3GQCA 4DLEA 2I9GA 1F5AA 3OUYB 3AQNA 2PFOA 4RQ8A 2XCPA 3V72A 2XC9A 1RYRA 1RZTA 3Q8QB 8ICBA 4O3SA 4F5OA 4KLLA 2XY5A 2B21A 2BCQA 2W9CA 2DVIA 4Q44A 1RXVA 1SKRA 4EYHB 3GDXA 1X2IA 4P2HA 3ZD9A 9ICRA 5DLFA 4YMMA 2UVUA 3EYZA 4GLXA 4YVZA 9ICPA 4X4TA 1S10A 4ED7A 4F4YA 1Q79A 1WCNA 3AQKA 3G6YA 4PPXA 1Y88A 1ZQYA 3PMLA 3BQTA 4XQ8A 5KFPA 2AGQA 3MDAA 2PFNA 2P6UA 1JN3A 5F9NA 1BNOA 3WFQE 1XWLA 2R8HA 1QTMA 4O5EA 1KNYA 3C18A 1ZYQA 5F2VO 4NLNA 4EZ9A 4QWAA 2I1QA 1RYSA 4NY8A 2V9WA 9ICHA 2HHXA 1NO5A 1XSPA 4UB2A 1KLNA 2ID1A 1EXNA 3M8RA 2C2DA 2R8JA 9ICMA 3TARA 1NK4A 3Q8LA 1ZQZA 3EZ5A 5BOLA 4DQPA 3GV7B 4J9RA 4AT8A 5J0YA 2JEGA 4X0BA 4TQSA 3RTVA 5HC9A 2A1JB 5HHIA 2Q0ZX 2ZH1A 2HHQA 2PI4A 2HVIA 3ORYA 5DG8A 2BCRA 1QSYA 4R8UA 3RJHA 4GC7A 3C1ZA 3GFKB 3MABA 3JZ0A 4I29A 4UD5A 1ZQGA 7ICIA 2OWOA 1BPYA 3RH4A 4FHXA 4NM2A 1ZQQA 4EBKA 4TUPA 1UT5A 4Z6CA 3TQ1A 3MR5A 1SL2A 4R66A 3MFHA 8ICNA 2J6SA 1NKCA 2NRVA 7ICNA 3RJGA 5EWFA 4M2YA 3KTQA 2BHNA 3N97B 1ZQFA 2KTQA 1VJ7A 7ICTA 3OUYA 2NRXA 4JV2A 1ZQJA 4UBBA 2HHPA 2ZH3A 4X4VA 5L1KA 4K4HA 3IM1A 7ICQA 4J9OA 4ED2A 1MQ2A 3HJ4A 5J0UA 5DDYA 3RR7A 5HR9A 4GXKA 4PHAA 5J0XA 4YP3A 4ECYA 2ALZA 2KZMA 8ICZA 4FS2A 2ZH6A 3RAXA 3ZD8A 5IILA 1T8EA 2FLLA 5DBAA 3Q8RB 5HP4A 4RQ6A 7ICEA 1DK3A 2BDPA 3GIKA 2Q66A 1NOMA 4LZDA 5CWRA 4B9LA 4QWEA 2JZBA 1NK6A 4I2GA 8ICHA 3ZDCA 5HNKA 3H8SA 4FO6A 4DSJA 1K1SA 5IIMA 1U48A 1PZNA 3FDSA 4Z6EA 2FMQA 4XQ7A 5BOMA 7ICUA 4O3PA 3MDCA 3PX4A 2BQUA 3BQ0A 1TK5A 1TKDA 1SKWA 9ICBA 3HX0A 5KT2A 4B9SA 3G6XA 8ICCA 8ICPA 7ICLA 1TVAA 4X4RA 1BPBA 8ICXA 4F2RA 1KSPA 2KFNA 2ZH5A 1LB2B 4RUCA 3PX0A 1B43A 4NLZA 2W8LA 1NK7A 4EBJA 4RWOA 4DLGA 3L9DA 3RJFA 3Q8SB 1ZQRA 1HUZA 4I2FA 3RB6A 1JX4A 4RNMA 2WTFA 1KDHA 2ZUDA 3WFRE 4X5VA 4FHYA 1D9DA 3KHHA 2ZUCA 5HMMA 2BPCA 3H8JA 2XGPA 2W9CB 4M9LA 3GIMA 1YLQA 3RJIA 4YQWA 5KG3A 3OSPA 2W8KA 1KFSA 4KLSA 3ZDBA 2KFZA 4EP7A 1C7YA 2BR0A 1ZQVA 5J2JA 3RH5A 3RRHA 4RWPA 4YMOA 5HRLA 4O9MA 4DSIA 2J6TA 4QWCA 1R8AA 4ED8A 4DQSA 3N4MB 2P66A 2F1IA 3LDAA 3QEBZ 1TFRA 4C8LA 1JIHA 2KZZA 4WC0A 3RB3A 1BPDA 4KLOA 1XSLA 4B9VA 4P4MA 3PMNA 1U47A 7ICGA 2KZ3A 7ICSA 1DK2A 1NK9A 1ZQPA 4ECVA 9ICVA 3JPOA 4I2HA 3ISCA 4R63A 4IRKA 2XGQA 4RT2A 2AQ0A 4E80A 4QZAA 4KLUA 4MFAA 2FPLA 4AT8B 8ICJA 5J2KA 9ICEA 5KFOA 4X4PA 1NK0A 3OVAA 3H7IA 5DQGA 4GC6A 5KFSA 4QZHA 4J9LA 3T5LA 5KFTA 2ZTDA 4XUSA 5HRKA 4M6WA 4R8UB 4YR3A 4KTQA 1OU5A 4RQ2A 4O5KA 4WCWA 5DEDA 4WC5A 3EWAA 1A77A 4QZGA 2BCVA 3EPGA 2VANA 4PHEA 3K4GA 4JK1A 5KFGA 4QZ9A 3H4BA 2P6RA 4LZGA 7ICHA 1XS9D 4QZFA 4K4IA 3BDPA 1X9MA 3RJEA 4DEZA 5KT4A 1BPXA 4B9TA 4FH3A 4DFPA 1XO1A 4RWNA 4F2SA 1MC8A 1NKEA 3G6VA 4F4XA 5D4BA 3PW2A 3OJSA 5KG2A 4EZ6A 4YR2A 3SI8A 7ICKA 5HRGA 5DDMA 2HVHA 1S0MA 3OGUA 1L3UA 8ICAA 4FS1A 8ICQA 3GIIA 1UA0A 3RH6A 4UAWA 1ZQNA 2ZJ5A 2UVRA 4J9QA 3ETLA 4BXOA 3MGIA 7ICMA 5KFLA 2JZBB 5KFJA 7ICOA 4TURA 1D9FA 5J2EA 2GWSA 2MUTA 2PFQA 4F4KA 4I2IA 4KLFA 5HRDA 5TZVA 4PHPA 5KFKA 1MIWA 1T3NA 3Q8PB 1ZJMA 4JUZA 5IIIA 4UB4A 3AUOA 1NK5A 5DLGA 2DR9A 3PW4A 3C2KA 3THVA 2AGPA 3SZ2A 1MIYA 2DPIA 4O3QA 4S3NA 3PR5B 4YN4A 2KP7A 4ECSA 8ICUA 4ECXA 4GXJA 2AJQA 4DQQA 4JV0A 4YD2A 4QW8A 5J2FA 4DQIA 4KMUA 3NTUA 9ICGA 1S76D 3WFSC 3BQ2A 1SZPA 3HT3A 4PH5A 2BPFA 3B0YA 4IR1A 7ICJA 3HPOA 1ZQMA 1ZQBA 4IR9A 5KFMA 2V4QA 9ICCA 3K75D 5KFAA 4QWDA 1UEUA 5KG0A 4O0IA 4WC2A 1QSSA 2C2EA 3WFPA 4Q8FA 3GV8B 1CEZA 2ASJA 1VFGA 4F5PA 5EWGA 3H8WA 3SV4A 2KN7A 1Z00A 3RB4A 5J2GA 3GIJA 3TANA 1SKSA 4BDPA 1BPEA 5DB9A 2XY7A 3MR3A 4KLQA 1V4AA 4ELVA 4DL7A 4YXMA 2FMSA 4X4OA 3NGDA 3RBEA 5JUMA 4M9JA 3JPSA 2DR7A 3SV3A 4F5RA 7ICFA 2HHWA 2BE3A 4Q43A 3LQCB 3AQMA 1A76A 4Z6FA 4RNNA 2DRAA 1ZQCA 4O3RA 3MGHA 8ICEA 4C8KA 3RAQA 4YCXA 1JAJA 2W9AA 1U4BA 3UQ2A 4ED3A 3T5HA 4ECWA 2ZH2A 3M9OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6K A;  1QSL A;  3QZ8 A;  4QZC A;  3T5J A;  1KRP A;  4QZE A;  4M6W B;  4DSK A;  3Q8M A;  4XRH A;  5KG1 A;  5DGB A;  1TFY A;  1ZQA A;  4Q8E A;  1T4G A;  1DGS A;  1RPL A;  4PGQ A;  2ISP A;  3ZDA A;  1BNP A;  2DR8 A;  1B22 A;  1D8L A;  4RPX A;  3JPQ A;  3TAQ A;  2F1H A;  5CHG A;  4X4U A;  1NJZ A;  2Y1J A;  2M2V A;  1NKB A;  3UPS A;  4DWI A;  4EBD A;  1MSW D;  4LT6 A;  5KFD A;  4ELU A;  1KEJ A;  3GIL A;  3V7L A;  4P4O A;  4IQV A;  4DOA A;  4J9S A;  3PX6 A;  5HRH A;  2VA2 A;  4KLT A;  8ICG A;  2BCS A;  5KFY A;  3V7K A;  2FPK A;  4MEX A;  5KFZ A;  5J2A A;  3C1Y A;  3OJU A;  2AQ4 A;  9ICF A;  1NJX A;  4UD4 A;  4ATB A;  1Q78 A;  4P4P A;  5KT6 A;  4YFK A;  4RNO A;  3RJJ A;  3H40 A;  4RQ4 A;  3T5K A;  4IQU A;  2IHN A;  2BGW A;  4BXO B;  4I27 A;  3RBD A;  4WC3 A;  4C8N A;  3PV8 A;  2MUT B;  4I2C A;  4DSF A;  5KG6 A;  1R89 A;  2ZTE A;  3C2M A;  1UA1 A;  4XA5 A;  3RRG A;  4JWM A;  4X4Q A;  4C8M A;  5KFI A;  2BQ3 A;  1S97 A;  4DOB A;  4ECT A;  3ZDE A;  3GV5 B;  4M47 A;  1S0V A;  1KFT A;  5DGA A;  2H5X A;  3UPQ A;  4E7X A;  4EBC A;  2PXI A;  2IA6 A;  4B9M A;  1JXE A;  4ECZ A;  4QZ8 A;  4O3O A;  4YD1 A;  2M2W A;  3H3A A;  4ED1 A;  1COO A;  4QZB A;  3LWL A;  1N56 A;  4AT7 A;  2DRB A;  4TQR A;  2O5A A;  8ICO A;  2AU0 A;  2ZHB A;  2ZH4 A;  3TAP A;  2ZTC A;  2IBK A;  4DFK A;  3E2E A;  4R65 A;  1TV9 A;  4X4N A;  4C8O A;  5KFF A;  1JQR A;  3PNC A;  5KG4 A;  3T3F A;  3PW0 A;  5KG7 A;  1NJW A;  4EYI B;  4GXI A;  2VA8 A;  4I2A A;  9ICO A;  2ZH9 A;  5IIK A;  3RJK A;  3ZDD A;  4RZR A;  4JWN A;  4KLD A;  1ZJN A;  1Z00 B;  2FPM A;  2BKE A;  4O3N A;  5CJ7 A;  5CR0 A;  5L9X A;  3JPT A;  2HHV A;  2NRZ A;  3ISD A;  4WC7 A;  2F1J A;  9ICJ A;  4RQ3 A;  5CA7 A;  2DPJ A;  2M2T A;  5J2I A;  9ICX A;  5J0W A;  1MIV A;  3BQ1 A;  3HP6 A;  1ZQD A;  5KFH A;  4DL5 A;  4O5C A;  5EOZ A;  2W9M A;  4QWB A;  4ELT A;  4KIT B;  4FHP A;  8ICF A;  4QZI A;  4F93 B;  1IXR A;  3M8S A;  3AU6 A;  3HIY A;  5J0R A;  4DFJ A;  3C5F A;  4AT9 B;  4QW9 A;  3PY8 A;  4J9K A;  4KLJ A;  4ED0 A;  4NLK A;  2XO7 A;  4BWM A;  4IQW A;  2M2U A;  1HJP A;  4MF8 A;  4PHD A;  4TUS A;  5HRE A;  4DF4 A;  2AGO A;  3JYY A;  4KLM A;  1KTQ A;  1H38 A;  5CB1 A;  2RFF A;  1KFD A;  1MQ3 A;  5IIO A;  3LWM A;  4E0D A;  3EW9 A;  1ZQK A;  5KFX A;  4DSE A;  2FLN A;  5EWE A;  8ICY A;  1TK8 A;  4WBZ A;  4RPY A;  2ASD A;  4DL3 A;  2BQR A;  5KFW A;  1HUO A;  3OVS A;  4DS4 A;  4MF2 A;  4M9N A;  3SYZ A;  5DBB A;  2MAX A;  1WOT A;  4WC4 A;  1ZQE A;  4DL4 A;  4IG8 A;  1U9L A;  1S0N A;  1NK8 A;  5D49 A;  2HHT A;  5J0Q A;  1ZET A;  2ASL A;  3OHB A;  3AU2 A;  4FHV A;  4J9M A;  1XC9 A;  5KT5 A;  4M9G A;  4WBY A;  3UXN A;  3NYB A;  4M5D A;  2FMP A;  3OV7 A;  5F9L A;  3V6H A;  5J0T A;  5J2B A;  4M0A A;  1K1Q A;  5DB7 A;  4KLE A;  4NKT A;  4EEY A;  8ICS A;  5J29 A;  1UEV A;  3H39 A;  4ATB B;  3Q8K A;  2R8I A;  2R8K A;  5DB6 A;  3C23 A;  4IRC A;  5J0S A;  3OVB A;  1ZQL A;  3HWT A;  9ICL A;  4F50 A;  1R8C A;  4RWQ A;  2FLP A;  2XY6 A;  1D8Y A;  2J6U A;  1SL0 A;  1ZQW A;  4WC1 A;  4UAZ A;  4RU9 A;  3M9N B;  3KHG A;  4KN4 A;  1L5U A;  9ICQ A;  3C2L A;  3QEA Z;  1SL1 A;  4ZH4 A;  4X4S A;  5KG5 A;  8ICR A;  9ICI A;  1UET A;  5DB8 A;  2PBE A;  1UT8 A;  1XU4 A;  1DOQ A;  2V4R A;  1NZP A;  5HRI A;  1ZQT A;  4J9N A;  1ZQI A;  2UVV A;  4M04 A;  4I2B A;  4MFF A;  4I28 A;  2NRK A;  3UQ0 A;  4KN7 A;  4UQG A;  4AT9 A;  3C5G A;  1TAQ A;  9ICA A;  3KHR A;  4AT7 B;  4BWJ A;  2ZH8 A;  5KFC A;  4UB3 A;  4K4G A;  5DEC A;  3IHQ B;  2C22 A;  1JXL A;  4FBU A;  1NJY A;  2R8G A;  3V7J A;  4B9N A;  8ICM A;  4DS5 A;  5HRB A;  5HRF A;  4E8F A;  4DL2 A;  2NRT A;  5DG9 A;  4ED6 A;  4DF8 A;  2VA3 A;  3QE9 Y;  5KFQ A;  9ICU A;  4NKU A;  3TFR A;  1X9S A;  5DG7 A;  4BGD A;  4DFM A;  2HHS A;  1TFW A;  4RUA A;  2BPG A;  1PX5 A;  1IM4 A;  5DQI A;  4ECQ A;  4DO9 A;  8ICW A;  1XSN A;  5DKW A;  4YXJ A;  4KLI A;  5J0O A;  3KHL A;  4I2D A;  1L3V A;  5D46 A;  2ZHA A;  1WCL A;  3PO5 A;  1FA0 A;  4I2J A;  8ICK A;  5KFN A;  1S0O A;  4I2E A;  1S77 D;  3M9M B;  2XCA A;  4B9U A;  4JV1 A;  1U45 A;  1BGX T;  4YMN A;  9ICK A;  3AQL A;  3H38 A;  4RQ5 A;  3B0X A;  4ECU A;  4HYK A;  1LV5 A;  4KLG A;  3BJY A;  3LK9 A;  3TFS A;  4RQ0 A;  5KFE A;  5DBC A;  1TK0 A;  2DR5 A;  2JEI A;  4NLG A;  4F8R A;  3V6J A;  2ZJA A;  8ICI A;  5KFB A;  1ARO P;  1ZQU A;  5DQH A;  4G3I A;  2ZUB A;  3RR8 A;  5KT3 A;  5J0P A;  2W9B B;  2ATL A;  4FHW A;  4NXZ A;  3PW7 A;  3C21 A;  8ICV A;  1ZQS A;  4KLH A;  2ZJ8 A;  5CP2 A;  4F4Z A;  4R64 A;  4F5N A;  3PW5 A;  4QZD A;  4UAY A;  2BCU A;  3TI0 A;  5KT7 A;  1L3S A;  2DFL A;  5J2H A;  1CUK A;  3MFI A;  2RDI A;  2A1J A;  4RPZ A;  1BPZ A;  4F92 B;  5KFU A;  4RQ7 A;  1T7P A;  4IRD A;  4WC6 A;  3FYH A;  4MFC A;  7ICP A;  1QLN A;  7ICR A;  2HHU A;  9ICS A;  1ZQO A;  4RT3 A;  2ISO A;  4DOC A;  4UBC A;  3H4D A;  1N48 A;  5KFR A;  3JPP A;  5KTQ A;  4UB5 A;  4FBT A;  4NM1 A;  4ECR A;  3HJ1 A;  3WFO A;  1JMS A;  1U49 A;  3OHA A;  4CCH A;  5J2C A;  5KFV A;  1S9F A;  2IMW P;  2HW3 A;  3C66 A;  5L1I A;  1R8B A;  5IIJ A;  3RB0 A;  4M9H A;  5IIN A;  4UB1 A;  3QZ7 A;  8ICL A;  4Z6D A;  4DL6 A;  5J2D A;  4YR0 A;  3PR4 A;  4X0A A;  5BPC A;  1RXW A;  2ZH7 A;  4YG2 A;  2LYH A;  3MR6 A;  3EPI A;  2NRW A;  3JPN A;  4J9P A;  2UVW A;  4TUQ A;  2PFP A;  2O1P A;  4PGX A;  5L1L A;  4PGY A;  2RDJ A;  1V9P A;  1ZQX A;  4MEY A;  4LVS A;  4Q45 A;  1L3T A;  2M9N A;  5HHH A;  4F4W A;  1TAU A;  3UXO A;  3JPR A;  5HML A;  2C28 A;  9ICW A;  3PVX A;  4IQT A;  2Y1I A;  1BVS A;  2C2R A;  3PO4 A;  8ICT A;  3MBY A;  2W9B A;  4F5Q A;  9ICT A;  4FH5 A;  4EBE A;  1X9W A;  2JEF A;  3ISB A;  5L1J A;  3UXP A;  4F3O A;  4DQR A;  7ICV A;  1Z3E B;  4DSL A;  1ZQH A;  3HW8 A;  2IHM A;  9ICN A;  2JEJ A;  5C5J A;  2PI5 A;  3H37 A;  4F91 B;  4RQ1 A;  3MR2 A;  3OSN A;  3GQC A;  4DLE A;  2I9G A;  1F5A A;  3OUY B;  3AQN A;  2PFO A;  4RQ8 A;  2XCP A;  3V72 A;  2XC9 A;  1RYR A;  1RZT A;  3Q8Q B;  8ICB A;  4O3S A;  4F5O A;  4KLL A;  2XY5 A;  2B21 A;  2BCQ A;  2W9C A;  2DVI A;  4Q44 A;  1RXV A;  1SKR A;  4EYH B;  3GDX A;  1X2I A;  4P2H A;  3ZD9 A;  9ICR A;  5DLF A;  4YMM A;  2UVU A;  3EYZ A;  4GLX A;  4YVZ A;  9ICP A;  4X4T A;  1S10 A;  4ED7 A;  4F4Y A;  1Q79 A;  1WCN A;  3AQK A;  3G6Y A;  4PPX A;  1Y88 A;  1ZQY A;  3PML A;  3BQT A;  4XQ8 A;  5KFP A;  2AGQ A;  3MDA A;  2PFN A;  2P6U A;  1JN3 A;  5F9N A;  1BNO A;  3WFQ E;  1XWL A;  2R8H A;  1QTM A;  4O5E A;  1KNY A;  3C18 A;  1ZYQ A;  5F2V O;  4NLN A;  4EZ9 A;  4QWA A;  2I1Q A;  1RYS A;  4NY8 A;  2V9W A;  9ICH A;  2HHX A;  1NO5 A;  1XSP A;  4UB2 A;  1KLN A;  2ID1 A;  1EXN A;  3M8R A;  2C2D A;  2R8J A;  9ICM A;  3TAR A;  1NK4 A;  3Q8L A;  1ZQZ A;  3EZ5 A;  5BOL A;  4DQP A;  3GV7 B;  4J9R A;  4AT8 A;  5J0Y A;  2JEG A;  4X0B A;  4TQS A;  3RTV A;  5HC9 A;  2A1J B;  5HHI A;  2Q0Z X;  2ZH1 A;  2HHQ A;  2PI4 A;  2HVI A;  3ORY A;  5DG8 A;  2BCR A;  1QSY A;  4R8U A;  3RJH A;  4GC7 A;  3C1Z A;  3GFK B;  3MAB A;  3JZ0 A;  4I29 A;  4UD5 A;  1ZQG A;  7ICI A;  2OWO A;  1BPY A;  3RH4 A;  4FHX A;  4NM2 A;  1ZQQ A;  4EBK A;  4TUP A;  1UT5 A;  4Z6C A;  3TQ1 A;  3MR5 A;  1SL2 A;  4R66 A;  3MFH A;  8ICN A;  2J6S A;  1NKC A;  2NRV A;  7ICN A;  3RJG A;  5EWF A;  4M2Y A;  3KTQ A;  2BHN A;  3N97 B;  1ZQF A;  2KTQ A;  1VJ7 A;  7ICT A;  3OUY A;  2NRX A;  4JV2 A;  1ZQJ A;  4UBB A;  2HHP A;  2ZH3 A;  4X4V A;  5L1K A;  4K4H A;  3IM1 A;  7ICQ A;  4J9O A;  4ED2 A;  1MQ2 A;  3HJ4 A;  5J0U A;  5DDY A;  3RR7 A;  5HR9 A;  4GXK A;  4PHA A;  5J0X A;  4YP3 A;  4ECY A;  2ALZ A;  2KZM A;  8ICZ A;  4FS2 A;  2ZH6 A;  3RAX A;  3ZD8 A;  5IIL A;  1T8E A;  2FLL A;  5DBA A;  3Q8R B;  5HP4 A;  4RQ6 A;  7ICE A;  1DK3 A;  2BDP A;  3GIK A;  2Q66 A;  1NOM A;  4LZD A;  5CWR A;  4B9L A;  4QWE A;  2JZB A;  1NK6 A;  4I2G A;  8ICH A;  3ZDC A;  5HNK A;  3H8S A;  4FO6 A;  4DSJ A;  1K1S A;  5IIM A;  1U48 A;  1PZN A;  3FDS A;  4Z6E A;  2FMQ A;  4XQ7 A;  5BOM A;  7ICU A;  4O3P A;  3MDC A;  3PX4 A;  2BQU A;  3BQ0 A;  1TK5 A;  1TKD A;  1SKW A;  9ICB A;  3HX0 A;  5KT2 A;  4B9S A;  3G6X A;  8ICC A;  8ICP A;  7ICL A;  1TVA A;  4X4R A;  1BPB A;  8ICX A;  4F2R A;  1KSP A;  2KFN A;  2ZH5 A;  1LB2 B;  4RUC A;  3PX0 A;  1B43 A;  4NLZ A;  2W8L A;  1NK7 A;  4EBJ A;  4RWO A;  4DLG A;  3L9D A;  3RJF A;  3Q8S B;  1ZQR A;  1HUZ A;  4I2F A;  3RB6 A;  1JX4 A;  4RNM A;  2WTF A;  1KDH A;  2ZUD A;  3WFR E;  4X5V A;  4FHY A;  1D9D A;  3KHH A;  2ZUC A;  5HMM A;  2BPC A;  3H8J A;  2XGP A;  2W9C B;  4M9L A;  3GIM A;  1YLQ A;  3RJI A;  4YQW A;  5KG3 A;  3OSP A;  2W8K A;  1KFS A;  4KLS A;  3ZDB A;  2KFZ A;  4EP7 A;  1C7Y A;  2BR0 A;  1ZQV A;  5J2J A;  3RH5 A;  3RRH A;  4RWP A;  4YMO A;  5HRL A;  4O9M A;  4DSI A;  2J6T A;  4QWC A;  1R8A A;  4ED8 A;  4DQS A;  3N4M B;  2P66 A;  2F1I A;  3LDA A;  3QEB Z;  1TFR A;  4C8L A;  1JIH A;  2KZZ A;  4WC0 A;  3RB3 A;  1BPD A;  4KLO A;  1XSL A;  4B9V A;  4P4M A;  3PMN A;  1U47 A;  7ICG A;  2KZ3 A;  7ICS A;  1DK2 A;  1NK9 A;  1ZQP A;  4ECV A;  9ICV A;  3JPO A;  4I2H A;  3ISC A;  4R63 A;  4IRK A;  2XGQ A;  4RT2 A;  2AQ0 A;  4E80 A;  4QZA A;  4KLU A;  4MFA A;  2FPL A;  4AT8 B;  8ICJ A;  5J2K A;  9ICE A;  5KFO A;  4X4P A;  1NK0 A;  3OVA A;  3H7I A;  5DQG A;  4GC6 A;  5KFS A;  4QZH A;  4J9L A;  3T5L A;  5KFT A;  2ZTD A;  4XUS A;  5HRK A;  4M6W A;  4R8U B;  4YR3 A;  4KTQ A;  1OU5 A;  4RQ2 A;  4O5K A;  4WCW A;  5DED A;  4WC5 A;  3EWA A;  1A77 A;  4QZG A;  2BCV A;  3EPG A;  2VAN A;  4PHE A;  3K4G A;  4JK1 A;  5KFG A;  4QZ9 A;  3H4B A;  2P6R A;  4LZG A;  7ICH A;  1XS9 D;  4QZF A;  4K4I A;  3BDP A;  1X9M A;  3RJE A;  4DEZ A;  5KT4 A;  1BPX A;  4B9T A;  4FH3 A;  4DFP A;  1XO1 A;  4RWN A;  4F2S A;  1MC8 A;  1NKE A;  3G6V A;  4F4X A;  5D4B A;  3PW2 A;  3OJS A;  5KG2 A;  4EZ6 A;  4YR2 A;  3SI8 A;  7ICK A;  5HRG A;  5DDM A;  2HVH A;  1S0M A;  3OGU A;  1L3U A;  8ICA A;  4FS1 A;  8ICQ A;  3GII A;  1UA0 A;  3RH6 A;  4UAW A;  1ZQN A;  2ZJ5 A;  2UVR A;  4J9Q A;  3ETL A;  4BXO A;  3MGI A;  7ICM A;  5KFL A;  2JZB B;  5KFJ A;  7ICO A;  4TUR A;  1D9F A;  5J2E A;  2GWS A;  2MUT A;  2PFQ A;  4F4K A;  4I2I A;  4KLF A;  5HRD A;  5TZV A;  4PHP A;  5KFK A;  1MIW A;  1T3N A;  3Q8P B;  1ZJM A;  4JUZ A;  5III A;  4UB4 A;  3AUO A;  1NK5 A;  5DLG A;  2DR9 A;  3PW4 A;  3C2K A;  3THV A;  2AGP A;  3SZ2 A;  1MIY A;  2DPI A;  4O3Q A;  4S3N A;  3PR5 B;  4YN4 A;  2KP7 A;  4ECS A;  8ICU A;  4ECX A;  4GXJ A;  2AJQ A;  4DQQ A;  4JV0 A;  4YD2 A;  4QW8 A;  5J2F A;  4DQI A;  4KMU A;  3NTU A;  9ICG A;  1S76 D;  3WFS C;  3BQ2 A;  1SZP A;  3HT3 A;  4PH5 A;  2BPF A;  3B0Y A;  4IR1 A;  7ICJ A;  3HPO A;  1ZQM A;  1ZQB A;  4IR9 A;  5KFM A;  2V4Q A;  9ICC A;  3K75 D;  5KFA A;  4QWD A;  1UEU A;  5KG0 A;  4O0I A;  4WC2 A;  1QSS A;  2C2E A;  3WFP A;  4Q8F A;  3GV8 B;  1CEZ A;  2ASJ A;  1VFG A;  4F5P A;  5EWG A;  3H8W A;  3SV4 A;  2KN7 A;  1Z00 A;  3RB4 A;  5J2G A;  3GIJ A;  3TAN A;  1SKS A;  4BDP A;  1BPE A;  5DB9 A;  2XY7 A;  3MR3 A;  4KLQ A;  1V4A A;  4ELV A;  4DL7 A;  4YXM A;  2FMS A;  4X4O A;  3NGD A;  3RBE A;  5JUM A;  4M9J A;  3JPS A;  2DR7 A;  3SV3 A;  4F5R A;  7ICF A;  2HHW A;  2BE3 A;  4Q43 A;  3LQC B;  3AQM A;  1A76 A;  4Z6F A;  4RNN A;  2DRA A;  1ZQC A;  4O3R A;  3MGH A;  8ICE A;  4C8K A;  3RAQ A;  4YCX A;  1JAJ A;  2W9A A;  1U4B A;  3UQ2 A;  4ED3 A;  3T5H A;  4ECW A;  2ZH2 A;  3M9O B; 
#chains in the Genus database with same CATH topology
 1QSL A;  3T5J A;  4QZE A;  4M6W B;  1SV0 A;  2AHO B;  3BZK A;  5AM5 A;  1RPL A;  4PGQ A;  1B22 A;  1D8L A;  3JPQ A;  3TAQ A;  1NJZ A;  1J2M A;  5AI6 A;  5KFD A;  3V7L A;  3PX6 A;  2VA2 A;  4KX3 A;  4NXU A;  5A0L A;  4RQN A;  3LVV A;  4P0P A;  5KFZ A;  3C1Y A;  1N61 A;  3OJU A;  2AQ4 A;  4WQK A;  3RJJ A;  3H40 A;  4BXO B;  2IHN A;  5ALI A;  2OM6 A;  3PV8 A;  4JWM A;  4X4Q A;  1Z4O A;  2BQ3 A;  1S97 A;  4DOB A;  2Z7J A;  1KFT A;  2QB0 B;  1DRG A;  3N7P D;  2EAO A;  2KE7 A;  2PXI A;  4Y2J A;  4QZB A;  8ICO A;  2AU0 A;  2ZTC A;  3E2E A;  1XNS A;  2XI9 A;  1TV9 A;  1NZB A;  5B3Q A;  4C8O A;  4X4N A;  3OTQ A;  1JQR A;  2NYV A;  1N2X A;  4GXI A;  2ZH9 A;  2VA8 A;  1ZJN A;  1Z00 B;  5AKI A;  5CR0 A;  4NWI A;  3JPT A;  2HHV A;  4EEN A;  4CF3 A;  2DPJ A;  3UM9 A;  5J2I A;  3L3F X;  2WF9 A;  3AMZ A;  3B9J A;  4DL5 A;  3FC4 A;  2Y9U A;  4F93 B;  4QNL A;  2KHQ A;  3HIY A;  4DFJ A;  4LEZ A;  2GOL A;  4AT9 B;  4QW9 A;  4ED0 A;  4BWM A;  2M2U A;  4KLM A;  1KTQ A;  3M7D A;  3F5E A;  1ZQK A;  5KFX A;  2JH1 A;  5EWE A;  5TIS U;  2A19 A;  3OVS A;  5DBB A;  4IG8 A;  1S0N A;  1NK8 A;  2HHT A;  2B0C A;  3AU2 A;  4O6A A;  5KT5 A;  4P0P B;  3NYB A;  4C4S A;  5F9L A;  5J0T A;  5J2B A;  5DB7 A;  4KLE A;  8ICS A;  3H39 A;  2M0N A;  2R8I A;  4LEY A;  3OVB A;  1ZQL A;  4RWQ A;  3FAH A;  4Y2V A;  5ALX A;  4RU9 A;  1L5U A;  4ZH4 A;  5KG5 A;  8ICR A;  1UET A;  1L8O A;  2PBE A;  1XU4 A;  1DOQ A;  1VDV A;  5HRI A;  2NRK A;  4I28 A;  4PL1 A;  2JH7 A;  9ICA A;  3KHR A;  2ZH8 A;  5KFC A;  1ED1 A;  3V7J A;  4C4R A;  2NRT A;  3LVW A;  2VA3 A;  5KFQ A;  4K96 A;  4NKU A;  1VLB A;  1TFW A;  2HHS A;  4RUA A;  4ECQ A;  5DQI A;  1PK3 A;  8ICW A;  3KKA C;  4KLI A;  3KHL A;  3PO5 A;  5J8Y A;  1SGG A;  2HBM A;  3BS7 A;  5KFN A;  2H3I A;  4B9U A;  2NV3 A;  4JV1 A;  3EF2 A;  1IG6 A;  4RQ5 A;  2YMP A;  5DBC A;  1TK0 A;  3O0F A;  2W43 A;  1DXS A;  2W9B B;  4JLZ A;  2YB4 A;  4UW9 A;  5EE9 A;  2KHV A;  4F5N A;  3PW5 A;  2LKY A;  4UAY A;  4O69 A;  2IOF A;  1PVR A;  3D2N A;  5E79 U;  3NVV A;  1CUK A;  2W3S A;  1GO3 F;  1BPZ A;  4Y2S A;  4F92 B;  5B5E U;  3FYH A;  4RT3 A;  4OJ5 A;  5KTQ A;  5D61 A;  5ALD A;  3ER8 C;  4NM1 A;  1PVP A;  4CCH A;  5KFV A;  1S9F A;  2HW3 A;  2I5H A;  4M9H A;  4UB1 A;  8ICL A;  4Z6D A;  1KN5 A;  5BPC A;  1RXW A;  3EPI A;  2LYH A;  4FO1 A;  2G5H B;  1ZD5 A;  3JPN A;  1X9X A;  2O1P A;  1X6J A;  1ZQX A;  2M9N A;  5HHH A;  5HML A;  3ETR A;  4LEW A;  1FFV A;  8ICT A;  4F5Q A;  2NO4 A;  2JEF A;  4FH5 A;  1UPH A;  3UXP A;  4Y2Y A;  7ICV A;  1Z3E B;  3MCR A;  4DSL A;  9ICN A;  4DLE A;  4PZN A;  2YMQ A;  3AQN A;  4RQ8 A;  2XCP A;  2ZIX A;  3Q8Q B;  4F5O A;  3F2C A;  2DVI A;  1V97 A;  1SKR A;  9ICR A;  4X4T A;  1S10 A;  4F4Y A;  1WCN A;  2MA1 A;  3G6Y A;  3BQT A;  2AGQ A;  1JN3 A;  1BNO A;  3WFQ E;  2HBJ A;  2R8H A;  1KNY A;  5AIC A;  3C18 A;  1X66 A;  2V9W A;  1NO5 A;  1XSP A;  5AHX A;  9ICM A;  2H3F A;  3TAR A;  3Q8L A;  4Y2Q A;  1B4F A;  2JEG A;  2PKE A;  5HHI A;  2PI4 A;  1IIP A;  2HVI A;  4R8U A;  4GC7 A;  3GFK B;  3N7S C;  1ZQG A;  1BPY A;  4NM2 A;  4TUP A;  1UT5 A;  1TE2 A;  1SL2 A;  3NVY A;  1VJ7 A;  3OUY A;  4JV2 A;  4UAU A;  1ZRN A;  4WQL A;  3IM1 A;  7ICQ A;  4MHV A;  4J9O A;  4MKP A;  2KIW A;  3BQ7 A;  4YP3 A;  3AQE A;  1PUZ A;  4FS2 A;  1F0M A;  3RAX A;  2W03 A;  5DBA A;  4RQ6 A;  1DK3 A;  2Q66 A;  4LZD A;  4B9L A;  4I2G A;  4X0B A;  4XQ7 A;  3PX4 A;  1SKW A;  3HRD D;  3HX0 A;  5KT2 A;  4P0Q B;  7ICL A;  4RUC A;  1B43 A;  4DLG A;  4RNM A;  3SEN A;  2WTF A;  1KDH A;  2ZIX B;  2ZUD A;  3WFR E;  3KHH A;  2ZUC A;  2EAM A;  1KFS A;  4KLS A;  3CK6 A;  3H0M B;  3F5A A;  3RRH A;  4YMO A;  2DKZ A;  1R8A A;  3LDA A;  1TFR A;  2OYY A;  4WC0 A;  3RB3 A;  1BPD A;  7ICG A;  5AI0 A;  7ICS A;  1NK9 A;  1URJ A;  9ICV A;  4Y2U A;  4R63 A;  3PSI A;  2B6G A;  4RT2 A;  2AQ0 A;  3KOO A;  3H7I A;  5DQG A;  4GC6 A;  2XID A;  5KFS A;  4QZH A;  5KFT A;  4R8U B;  4KTQ A;  4WC5 A;  4O5K A;  4OCZ A;  3EPG A;  4PHE A;  5KFG A;  2P6R A;  3H4B A;  4LZG A;  1XS9 D;  4QZF A;  4K4I A;  3AQF A;  3BDP A;  1X9M A;  1WWV A;  3EUB 2;  1BPX A;  4B9T A;  4DFP A;  4RWN A;  5AKJ A;  3G6V A;  4F4X A;  3OJS A;  3SI8 A;  1KQQ A;  3CRX A;  5EE0 A;  1L3U A;  3GII A;  2GH1 A;  2W04 A;  1SV0 C;  2ZJ5 A;  4J9Q A;  3MGI A;  2HOI A;  5L1M A;  5KFJ A;  5J2E A;  4I2I A;  4UB4 A;  2DR9 A;  2ZIU A;  3PW4 A;  2G07 A;  3THV A;  4S3N A;  2KP7 A;  4ECX A;  2F3N A;  5J2F A;  2HI0 A;  3CW2 C;  5G5G A;  4PH5 A;  4IR1 A;  3SEI A;  3HPO A;  1ZQM A;  4IR9 A;  1UEU A;  5AI9 A;  1QSS A;  3WFP A;  5CFU A;  1CEZ A;  2ASJ A;  1M6Y A;  2Y0S C;  1SV4 A;  1UCV A;  2VJ5 A;  4WH5 A;  4CRX A;  1SKS A;  3MR3 A;  4DL7 A;  4YXM A;  1GPJ A;  1Z1V A;  3JPS A;  3SV3 A;  2HHW A;  3AQM A;  1JAJ A;  3MGH A;  3RAQ A;  2HN2 A;  4PJ0 U;  1U4B A;  4Y2X A;  2ZH2 A;  3M9O B;  3QZ8 A;  1MA7 A;  3Q8M A;  1TFY A;  4ZOH C;  1T4G A;  1DGS A;  2ISP A;  5FP0 A;  1N62 A;  2BBJ A;  3IP4 B;  2KKV A;  2F1H A;  5CHG A;  2Y1J A;  1NKB A;  2ZIW A;  3OWG A;  1PK1 A;  4P4O A;  4J9S A;  2E8N A;  8ICG A;  3WK5 A;  5KFY A;  2FPK A;  3PSF A;  3NRZ A;  4MEX A;  5J2A A;  2ODG A;  5B3P A;  9ICF A;  1Q78 A;  2O6K A;  2NO5 A;  4I27 A;  1A0P A;  4IQU A;  2IOF K;  2BGW A;  3RBD A;  3IDW A;  3KZI U;  5KG6 A;  2ZTE A;  3C2M A;  2ZIU B;  3ZDE A;  2WB1 C;  5DGA A;  3JCF A;  2H5X A;  3UPQ A;  2A3V A;  4B9M A;  4O3O A;  2M2W A;  2ZH5 A;  4ED1 A;  2Y0S F;  3KD3 A;  3M1Y A;  2ZHB A;  4RQM A;  1P7D A;  3TAP A;  5C0Y A;  5KFF A;  1NJW A;  4EYI B;  2RRD A;  5IIK A;  4KLD A;  2D6F C;  1ZD3 A;  2GLE A;  2FPM A;  3QX7 A;  3ISD A;  3HKZ C;  4RQ3 A;  3K7D A;  3HP6 A;  1ZQD A;  5AK5 A;  2W9M A;  4ELT A;  1F5S A;  4KIT B;  2W55 A;  8ICF A;  4QZI A;  4UB6 U;  3M8S A;  2JXJ A;  1D8B A;  2FI1 A;  4NLK A;  4IQW A;  4UD5 A;  4PHD A;  5HRE A;  2AGO A;  4F72 A;  1MQ3 A;  3C29 A;  4E0D A;  8ICY A;  4DFD A;  2VIX A;  1K5O A;  5KFW A;  4MF2 A;  2ZIW B;  3SYZ A;  5AM3 A;  1ZQE A;  3KZX A;  5D49 A;  5J0Q A;  3OHB A;  3M6Z A;  2YTU A;  4J9M A;  1XC9 A;  1WG8 A;  4M5D A;  3V6H A;  4Y2R A;  1K1Q A;  4NKT A;  5J29 A;  1UEV A;  3K1R B;  2WB1 F;  3HWT A;  4F50 A;  1SL0 A;  5AKK A;  3M9N B;  4KN4 A;  5ALO A;  1JUD A;  5DB8 A;  1UT8 A;  4M04 A;  4J9N A;  4AT9 A;  2WF5 A;  4KN7 A;  2B51 A;  2KV2 A;  1N63 A;  1TAQ A;  4QJF B;  5DEC A;  4E8F A;  3SQI A;  4B9N A;  8ICM A;  2YQE A;  4ED6 A;  3QE9 Y;  3HKZ F;  4DFM A;  2BPG A;  1IM4 A;  5ALP A;  1JI7 A;  5ALT A;  2DL0 A;  2K4P A;  4YXJ A;  4I2D A;  2KJ5 A;  1L3V A;  2QB1 A;  5AM0 A;  1FA0 A;  4NXT A;  1S0O A;  4I2E A;  3H8M A;  4WC3 A;  3PHZ A;  4HYK A;  1ECW A;  2EQY A;  3TFS A;  3LK9 A;  2DR5 A;  2JEI A;  2K8C B;  8ICI A;  2KMD A;  1ARO P;  5KFB A;  4G3I A;  5KT3 A;  3TAD C;  4FHW A;  4NXZ A;  4KM5 A;  8ICV A;  5AK6 A;  5CP2 A;  2W7P A;  3RFA A;  5AKE A;  2K8A A;  5KT7 A;  5G5H A;  3SR6 A;  5AKX A;  3SAH A;  5KFU A;  4RQ7 A;  7ICP A;  5ALG A;  3MGV A;  7ICR A;  2HHU A;  4GIB A;  4UBC A;  5KFR A;  4UB5 A;  4IC9 A;  2JV3 A;  2KNJ A;  1U49 A;  2D8C A;  3OHA A;  4EGW A;  5J2C A;  3C66 A;  4KB6 A;  3KBB A;  5IIJ A;  3QZ7 A;  5J2D A;  3FM9 A;  3PR4 A;  3MR6 A;  4J9P A;  4TUQ A;  4FE3 A;  4EEK A;  5L1L A;  5ALK A;  2AXT U;  1V9P A;  4OD0 A;  5KAI U;  4NLB A;  1L3T A;  1TAU A;  3WK4 A;  3UXO A;  3JPR A;  4IQT A;  3PO4 A;  3MBY A;  2W9B A;  4EBE A;  3ISB A;  1CI4 A;  4DQR A;  1N5W A;  3HW8 A;  2IHM A;  2JEJ A;  5C5J A;  2CRX A;  3WKC A;  5ALJ A;  2PFO A;  3V72 A;  1RYR A;  1HEK A;  2B21 A;  2XY5 A;  2BCQ A;  2WF7 A;  4Q44 A;  1RXV A;  4OAI Z;  3QU9 A;  5JTI A;  4EYH B;  3NS1 A;  2D3D A;  3ZD9 A;  3L4P A;  9ICP A;  2H3V A;  1JRO A;  4ED7 A;  3OPX A;  4PPX A;  1ZQY A;  5AM2 A;  5F9N A;  1XWL A;  1QTM A;  4O5E A;  4OJO A;  1ZYQ A;  5F2V O;  4NLN A;  4EZ9 A;  2I1Q A;  4NY8 A;  3ED5 A;  1KLN A;  2ID1 A;  2DQN B;  2C2D A;  2F77 X;  3EZ5 A;  5BOL A;  4DQP A;  2HHQ A;  4UAR A;  5DG8 A;  1QSY A;  3RJH A;  2GAF D;  3C1Z A;  3UMG A;  3RH4 A;  3TQ1 A;  4Z6C A;  3MR5 A;  3MFH A;  8ICN A;  2J6S A;  2NRV A;  7ICN A;  3SAG A;  3KTQ A;  1ZQF A;  2KTQ A;  3IG8 A;  1ZQJ A;  4UBB A;  2ZH3 A;  4NL9 C;  4X4V A;  3QXG A;  4K4H A;  4GXK A;  5IIL A;  5HP4 A;  2BDP A;  5CWR A;  5AI5 A;  2XIC A;  2JZB A;  1NK6 A;  5IIM A;  3MDC A;  3M6K A;  3QU4 A;  3BQ0 A;  1TKD A;  4B9S A;  4X4R A;  1BPB A;  1KSP A;  2K4E A;  1LB2 B;  3A0B U;  1A6S A;  4EBJ A;  3RJF A;  1ZQR A;  4I2F A;  3RB6 A;  2QAR B;  4K97 A;  1D9D A;  2XGP A;  3H8J A;  3L5K A;  3OSP A;  2BDU A;  3ZDB A;  2BR0 A;  5HRL A;  2WF8 A;  4O9M A;  2J6T A;  5KAF U;  4C7Y A;  4DQS A;  3N4M B;  2F1I A;  4OAF A;  3QEB Z;  4B9V A;  1U47 A;  2KZ3 A;  4ECV A;  3JPO A;  3S6J A;  3ISC A;  1ZOL A;  4E80 A;  1QQ6 A;  4QZA A;  4OJP A;  2FPL A;  5ALF A;  8ICJ A;  3OVA A;  9ICE A;  1NK0 A;  5ALU A;  2ZTD A;  4XUS A;  4YR3 A;  1OU5 A;  4K99 A;  4RQ2 A;  4P0Q A;  2EZY A;  5GTH U;  4EV6 A;  1VJ5 A;  2JR5 A;  3H0L B;  1Z1B A;  1XO1 A;  4F2S A;  1MC8 A;  3PW2 A;  5KG2 A;  1LKY A;  1S0M A;  8ICA A;  2MSN A;  8ICQ A;  4OAH A;  5GTI U;  1UA0 A;  1ZQN A;  2UVR A;  7ICM A;  3ETL A;  2JZB B;  1D9F A;  2GWS A;  2K8B B;  2MUT A;  4KLF A;  1T3N A;  2P35 A;  2N1R A;  5DLG A;  2AGP A;  1TAM A;  4ECS A;  3NRW A;  5HR7 A;  2AJQ A;  4QW8 A;  3ALR A;  4KMU A;  3NTU A;  9ICG A;  3WFS C;  7ICJ A;  2KIC A;  5KFM A;  2V4Q A;  2F76 X;  3K75 D;  9ICC A;  5CFS A;  2CPR A;  4O0I A;  4Q8F A;  5K4L A;  1AQ6 A;  4F5P A;  5AM1 A;  3H8W A;  3SV4 A;  2KN7 A;  2XY7 A;  4ELV A;  4WOY A;  2FMS A;  4M9J A;  3LYS A;  2DR7 A;  2F8L A;  4F5R A;  5ALZ A;  3D2S A;  2JHD A;  2BE3 A;  3LQC B;  4Z6F A;  1ZQC A;  4O3R A;  4N7R A;  4YCX A;  2HOQ A;  3T5H A;  3V6K A;  2RP5 A;  2MRL A;  4QZC A;  1KRP A;  2KK0 A;  4XRH A;  1ZQA A;  1BNP A;  2DR8 A;  4RPX A;  3ZI4 A;  4X4U A;  3QU7 A;  2M2V A;  3UPS A;  4LT6 A;  4EBD A;  1MSW D;  4ELU A;  1KEJ A;  3GIL A;  2EZX A;  5HRH A;  2RLT A;  3HJE A;  1LKY B;  2G06 A;  3H0R B;  1NJX A;  4ATB A;  4FZM A;  4YFK A;  4RQ4 A;  3T5K A;  4C8N A;  2HOF A;  2MUT B;  3F2B A;  4DSF A;  1R89 A;  3RRG A;  1UA1 A;  4XA5 A;  3ONN A;  5KFI A;  4CF5 A;  4NXX A;  4EX7 A;  5AKG A;  4M47 A;  4EBC A;  1JXE A;  1ZQ1 C;  4QZ8 A;  4C4T A;  4AT7 A;  1COO A;  3LWL A;  1N56 A;  2DRB A;  2O5A A;  2IBK A;  4R65 A;  3PNC A;  3I28 A;  2W3R A;  3K1Z A;  2OHF A;  4I2A A;  9ICO A;  5ALY A;  3ZDD A;  4JWN A;  4RZR A;  2OEH A;  5JU5 A;  4O3N A;  5L9X A;  9ICJ A;  1SZH A;  2LHT A;  1MIV A;  3KKA A;  2WFA A;  2YB1 A;  4O5C A;  5EOZ A;  4FHP A;  1JRP A;  2FCL A;  1IXR A;  3AU6 A;  4LEV A;  4J9K A;  4KLJ A;  4MF8 A;  3D2Q A;  3JYY A;  4I0U A;  4JLX A;  5CB1 A;  2RFF A;  5IIO A;  3EW9 A;  2FLN A;  5CEH A;  1X40 A;  3N28 A;  4WBZ A;  4NLC A;  2ASD A;  4DL3 A;  2BQR A;  4DS4 A;  2MAX A;  1ZXI A;  5ALM A;  1X6I A;  1ZD4 A;  2ZIV B;  3AN1 A;  4JB3 A;  1KL9 A;  3SMV A;  4EEY A;  4ATB B;  3Q8K A;  5DB6 A;  5J0S A;  9ICL A;  1R8C A;  4WC1 A;  3QUT A;  1D8Y A;  2J6U A;  1ZQW A;  4UAZ A;  3KHG A;  9ICQ A;  3QEA Z;  5ALV A;  4Y2P A;  4CGZ A;  1NZP A;  2V4R A;  1ZQT A;  4Y2T A;  4I2B A;  2K60 A;  3U26 A;  2YML A;  4HX0 A;  3UQ0 A;  3C5G A;  4AT7 B;  1KW4 A;  4BWJ A;  2BBH A;  2GA9 D;  4UB3 A;  3NVO A;  1IV8 A;  2C22 A;  1JXL A;  4DS5 A;  5HRB A;  4DL2 A;  1Q3U A;  2WAQ C;  5DG7 A;  1PX5 A;  4DO9 A;  1X42 A;  2ZHA A;  1UQV A;  4I2J A;  8ICK A;  1U45 A;  1BGX T;  3PST A;  3B0X A;  4ECU A;  1LV5 A;  1CRX A;  4RQ0 A;  2DUY A;  5KFE A;  4F8R A;  2ZJA A;  4OO1 J;  1ZQU A;  2OH2 A;  5J0P A;  2KJ9 A;  2ATL A;  3PW7 A;  1ZQS A;  4F4Z A;  3NWI A;  4USA A;  4R64 A;  1L3S A;  3QU2 A;  2I6X A;  2QLT A;  2RDI A;  4RPZ A;  3AL0 B;  1T7P A;  2ISO A;  1NI3 A;  3H4D A;  3SAF A;  3NUQ A;  4ECR A;  3WFO A;  1JMS A;  5D62 A;  5ALH A;  3VC8 A;  4ICA A;  5L1I A;  1R8B A;  5IIN A;  1L7N A;  2W7O A;  2ZH7 A;  4YG2 A;  2NRW A;  2UVW A;  1UHU A;  2G09 A;  5AKL A;  2RDJ A;  4Q45 A;  2H3Z A;  2HMX A;  5D63 A;  2WAQ F;  4C0Z A;  9ICT A;  1X9W A;  5ALS A;  4EEL A;  2KOB A;  1ZQH A;  2KD1 A;  5KL1 B;  4F91 B;  4RQ1 A;  3GQC A;  3OSN A;  2E3T A;  2KVS A;  1FFU A;  5J8Y C;  3ER9 B;  2Q4T A;  4KLL A;  1FEZ A;  3GDX A;  4P2H A;  1ZRM A;  4YMM A;  5DLF A;  3EYZ A;  4GLX A;  2UVU A;  4QIW C;  2CXY A;  1NNL A;  2QKQ A;  5KFP A;  2P6U A;  3QU5 A;  3BZC A;  3QUQ A;  5CFT A;  5AKH A;  4QWA A;  2HHX A;  2LI6 A;  3M8R A;  2R8J A;  1NK4 A;  1ZQZ A;  4AT8 A;  4J9R A;  4TQS A;  3ORY A;  4K9A A;  5ALR A;  3MAB A;  3IG5 A;  7ICI A;  2OWO A;  1ZQQ A;  1COK A;  3I76 A;  3RJG A;  4M2Y A;  2BHN A;  2ZXI A;  2NRX A;  3PZP A;  4PL2 A;  5AK3 A;  5L1K A;  1MQ2 A;  4ED2 A;  3HJ4 A;  2KIV A;  5J0U A;  3RR7 A;  5HR9 A;  8ICZ A;  2ALZ A;  2KZM A;  3NVZ A;  7ICE A;  5ALL A;  4QWE A;  3ZDC A;  3H8S A;  4FO6 A;  4DSJ A;  1K1S A;  1U48 A;  3FDS A;  4Z6E A;  2FMQ A;  5ALE A;  2BQU A;  1TK5 A;  2HCF A;  2JRZ A;  8ICX A;  2W8L A;  1NK7 A;  4RWO A;  4EX6 A;  1HUZ A;  2EAP A;  4QIW F;  3WK6 A;  4FHY A;  1RM6 C;  4DCC A;  5HMM A;  4AYB C;  2DF4 B;  2LM4 A;  4M9L A;  4FZL A;  3RJI A;  4YQW A;  5KG3 A;  2VJ4 A;  1S8O A;  4EP7 A;  5J2J A;  4C7Z A;  4DSI A;  1L7O A;  4QWC A;  3D6J A;  2P66 A;  2A1A A;  4EEB A;  4KLO A;  3PMN A;  1DK2 A;  1ZQP A;  1OUQ A;  4I2H A;  4IRK A;  2XGQ A;  1LVH A;  3J81 j;  1N60 A;  5AM4 A;  4MFA A;  4KLU A;  4AT8 B;  5J2K A;  4X4P A;  5KFO A;  3KFU F;  2EH9 A;  5HRK A;  4WCW A;  5DED A;  5ALQ A;  2BCV A;  1S5L U;  3K4G A;  4QZ9 A;  7ICH A;  2OXO A;  1F44 A;  3RJE A;  4KMO B;  5KT4 A;  1O03 A;  2H3Q A;  2F8K A;  2QAR A;  5D4B A;  4EZ6 A;  7ICK A;  4NV0 A;  4BUG A;  1T94 A;  5DDM A;  1KBU A;  2ZXH A;  4FS1 A;  4K8V A;  3R9K A;  3RH6 A;  4UAW A;  5KFL A;  2G5I B;  4TUR A;  1MIW A;  5HRD A;  5TZV A;  4JUZ A;  1NK5 A;  3C2K A;  1MIY A;  3SZ2 A;  2DPI A;  4O3Q A;  2EWR A;  3PR5 B;  3IN5 A;  5AKY A;  8ICU A;  4GXJ A;  4DQQ A;  4G9B A;  2FE9 A;  4AYB F;  4YD2 A;  3ICX A;  4DQI A;  4UB8 U;  1S76 D;  3BQ2 A;  3B0Y A;  3QNM A;  2OCE A;  1ZQB A;  1RQN A;  4A8E A;  3NKU A;  3TKA A;  5KG0 A;  4LJX A;  4WC2 A;  2C2E A;  1VFG A;  4CNQ A;  2DGZ A;  2HBL A;  3WK8 A;  5EWG A;  3GU3 A;  3GIJ A;  2K4H A;  4BDP A;  5ALW A;  1SXD A;  1V4A A;  2YX8 A;  4KLQ A;  1Q8K A;  3NGD A;  3WKA A;  5AK4 A;  7ICF A;  4Q43 A;  5AKZ A;  1A76 A;  3WU2 U;  2DRA A;  4C8K A;  1SB3 C;  4ED3 A;  4O3M A;  2CN1 A;  2IHO A;  4U7C A;  3MC1 A;  4DSK A;  2KSO A;  3GZF A;  5KG1 A;  5DGB A;  4J03 A;  4Q8E A;  1Q46 A;  3ZDA A;  1FO4 A;  2ES6 A;  3DV9 A;  1Z4N A;  3RF9 A;  2LYB A;  3F53 A;  2YN4 A;  4DWI A;  1PVQ A;  4IQV A;  4DOA A;  4KLT A;  2BCS A;  3V7K A;  4UD4 A;  3PSP A;  2KEY A;  5JRT A;  4P4P A;  5KT6 A;  4RNO A;  4OJL A;  1O08 A;  3DEE A;  3AEV A;  3CNH A;  4I2C A;  2F44 A;  4B6J A;  4C8M A;  4EED A;  4ECT A;  2DKX A;  3GV5 B;  5HR6 A;  4NXW A;  1S0V A;  4E7X A;  2IA6 A;  4ECZ A;  2EDU A;  4YD1 A;  3H3A A;  4TQR A;  4O68 A;  2ZH4 A;  5AI8 A;  4DFK A;  1N5X A;  2PMZ C;  5H2F U;  5KG4 A;  3T3F A;  3NVW A;  3PW0 A;  5KG7 A;  3RJK A;  2JMG A;  2BKE A;  5CJ7 A;  4WC7 A;  2NRZ A;  2F1J A;  3T79 A;  5CA7 A;  2M2T A;  9ICX A;  4HAI A;  5J0W A;  3BQ1 A;  5KFH A;  4AP9 A;  4QWB A;  2HDO A;  5J0R A;  1J97 A;  3C5F A;  2E1F A;  1RG6 A;  2XVT A;  3PY8 A;  2EAN A;  4O67 A;  2XO7 A;  1HJP A;  4TUS A;  4DF4 A;  2E8O A;  3VCB A;  4ACO A;  1H38 A;  1KFD A;  2WF6 A;  2KSO B;  3LWM A;  4CF4 A;  3TAD A;  4DSE A;  3IRU A;  1TK8 A;  4RPY A;  1HUO A;  1WWU A;  4US9 A;  4M9N A;  1WOT A;  4WC4 A;  4DL4 A;  2K89 A;  1U9L A;  1ZET A;  2ASL A;  4FHV A;  1V38 A;  4M9G A;  4WBY A;  3UXN A;  2FMP A;  3OV7 A;  4M0A A;  4US8 A;  2R8K A;  3C23 A;  4IRC A;  2RHF A;  2FLP A;  2XY6 A;  2VKQ A;  5AI4 A;  3C2L A;  1SL1 A;  4K98 A;  4X4S A;  9ICI A;  3QUC A;  1ZD2 P;  5KL8 B;  2LBO A;  1ZQI A;  2UVV A;  4MFF A;  2PMZ F;  4FZN A;  4UQG A;  1XO0 A;  1FIQ A;  1Q3V A;  4K4G A;  3IHQ B;  4FBU A;  1NJY A;  2R8G A;  5HRF A;  4DF8 A;  5DG9 A;  4GFJ A;  4NXV A;  1SIJ A;  9ICU A;  4F71 A;  3TFR A;  1X9S A;  4BGD A;  1XSN A;  5DKW A;  2KG5 A;  5J0O A;  5D46 A;  1WCL A;  2ZG6 A;  1S77 D;  2LYA A;  3M9M B;  2XCA A;  9ICK A;  4YMN A;  1RYU A;  3AQL A;  3H38 A;  2W11 A;  3N7R C;  1T3Q A;  4KLG A;  2ZIV A;  3BJY A;  4NLG A;  2BZF A;  3V6J A;  1L7M A;  2YMM A;  5DQH A;  2ZUB A;  3IV6 A;  3RR8 A;  4CDG A;  2B56 A;  3C21 A;  2ESE A;  4KLH A;  2ZJ8 A;  3NAS A;  1SWV A;  4QZD A;  2BCU A;  3TI0 A;  2DFL A;  5J2H A;  3MFI A;  2A1J A;  4IRD A;  4WC6 A;  4MFC A;  4IL6 U;  1QLN A;  9ICS A;  1ZQO A;  2KKP A;  2E1E A;  4DOC A;  1N48 A;  3JPP A;  5CRX A;  1C20 A;  2R18 A;  4FBT A;  3HJ1 A;  2F2A B;  2IMW P;  2IUB A;  2G08 A;  2FJ6 A;  3RB0 A;  3BS5 A;  1QH9 A;  4DL6 A;  4YR0 A;  4OAG A;  4X0A A;  4IS7 A;  3CP8 A;  2PFP A;  4BX9 C;  4PGX A;  2WHE A;  4NL9 A;  2G0A A;  3WKE A;  4PGY A;  3WK9 A;  4MEY A;  4LVS A;  4F4W A;  2C28 A;  9ICW A;  3PVX A;  2Y1I A;  1BVS A;  2C2R A;  5L1J A;  1WUD A;  4F3O A;  4UAV A;  2IOH A;  2Y9T A;  4OJ6 A;  5B66 U;  1L7P A;  2PI5 A;  3H37 A;  1F5A A;  3MR2 A;  2I9G A;  3OUY B;  2XC9 A;  2HN1 A;  1RQL A;  1RZT A;  8ICB A;  4O3S A;  1V85 A;  2W9C A;  5JTG A;  2E8P A;  1X2I A;  4YVZ A;  3WK7 A;  1Q79 A;  3AQK A;  1Y88 A;  2FDR A;  3PML A;  2E8M A;  4XQ8 A;  2EZZ A;  3MDA A;  2PFN A;  3C28 A;  1B0X A;  3WKD A;  4NJ8 A;  2K4I A;  1YZ7 A;  3SD7 A;  1RYS A;  1OW5 A;  9ICH A;  4WJ3 B;  4UAT A;  4UB2 A;  3E0F A;  1EXN A;  2JGA A;  3GV7 B;  5J0Y A;  3RTV A;  5HC9 A;  2A1J B;  2ZH1 A;  2Q0Z X;  2BCR A;  5AIA A;  3JZ0 A;  5ALN A;  4I29 A;  2KVC A;  4FHX A;  1DGJ A;  4EBK A;  4R66 A;  1NKC A;  5AIB A;  5EWF A;  3N97 B;  7ICT A;  3ERC C;  2HHP A;  3BS5 B;  1J2N A;  1WYG A;  5DDY A;  4PHA A;  5J0X A;  4ECY A;  2ZH6 A;  4JMU A;  1HIW A;  3ZD8 A;  1T8E A;  2FLL A;  3Q8R B;  5T14 A;  3GIK A;  1NOM A;  3CYM A;  1YZ6 A;  8ICH A;  2E5S A;  1Z19 A;  1SWW A;  5HNK A;  1PZN A;  5BOM A;  7ICU A;  4O3P A;  9ICB A;  8ICC A;  5CHE A;  3G6X A;  8ICP A;  1TVA A;  4F2R A;  2KFN A;  3PX0 A;  2HSZ A;  4NLZ A;  4UAS A;  3L9D A;  1MN8 A;  3Q8S B;  1SXE A;  2KJ8 A;  1JX4 A;  4X5V A;  1L8L A;  2BPC A;  2W9C B;  4FFD A;  1YLQ A;  3GIM A;  3E58 A;  2LM1 A;  3I1Y A;  2W8K A;  2KFZ A;  1C7Y A;  1ZQV A;  3RH5 A;  4RWP A;  4BJQ A;  3AM9 A;  2LMR A;  4ED8 A;  4C8L A;  2KZZ A;  1JIH A;  1KKX A;  4XJE A;  4K9B A;  1XSL A;  4P4M A;  4CE6 A;  4J9L A;  3T5L A;  3QYP A;  4M6W A;  4U6P A;  3UMB A;  3WKB A;  2MU2 A;  1A77 A;  2YY6 A;  3EWA A;  4QZG A;  2VAN A;  4JK1 A;  3DDH A;  4KX5 A;  1YT3 A;  4DEZ A;  4FH3 A;  2RQ5 A;  1NKE A;  4YR2 A;  5HRG A;  2HVH A;  3OGU A;  2DBY A;  2GO7 A;  3TAC B;  3A0H U;  4BXO A;  2HBK A;  2B4V A;  7ICO A;  4F4K A;  2PFQ A;  1JAL A;  3F2D A;  4PHP A;  5KFK A;  3Q8P B;  1ZJM A;  1OXJ A;  2W54 A;  5III A;  3AUO A;  1L6N A;  3UMC A;  2QB0 A;  4YN4 A;  1QQ7 A;  4JV0 A;  2LPE A;  1PK1 B;  2L5Y A;  4C80 A;  5F3X B;  2BPF A;  1SZP A;  3HT3 A;  5EE1 A;  1RDF A;  5KFA A;  4QWD A;  3QUB A;  4PZO A;  5KNI A;  2DWQ A;  3GV8 B;  1Z00 A;  3RB4 A;  1QQ5 A;  5J2G A;  3TAN A;  1BPE A;  5DB9 A;  3HIL A;  4X4O A;  5EE3 A;  3RBE A;  5JUM A;  2AH5 A;  1QCK A;  4RNN A;  8ICE A;  2W9A A;  3UQ2 A;  4ECW A; 
#chains in the Genus database with same CATH homology
 3V6K A;  1QSL A;  3QZ8 A;  4QZC A;  3T5J A;  1KRP A;  4QZE A;  4M6W B;  4DSK A;  3Q8M A;  4XRH A;  5KG1 A;  5DGB A;  1TFY A;  1ZQA A;  4Q8E A;  1T4G A;  1DGS A;  1RPL A;  4PGQ A;  2ISP A;  3ZDA A;  1BNP A;  2DR8 A;  1B22 A;  1D8L A;  4RPX A;  3JPQ A;  3TAQ A;  2F1H A;  5CHG A;  4X4U A;  1NJZ A;  2Y1J A;  2M2V A;  1NKB A;  3UPS A;  4DWI A;  4EBD A;  1MSW D;  4LT6 A;  5KFD A;  4ELU A;  1KEJ A;  3GIL A;  3V7L A;  4P4O A;  4IQV A;  4DOA A;  4J9S A;  3PX6 A;  5HRH A;  2VA2 A;  4KLT A;  8ICG A;  2BCS A;  5KFY A;  3V7K A;  2FPK A;  4MEX A;  5KFZ A;  5J2A A;  3C1Y A;  3OJU A;  2AQ4 A;  9ICF A;  1NJX A;  4UD4 A;  4ATB A;  1Q78 A;  4P4P A;  5KT6 A;  4YFK A;  4RNO A;  3RJJ A;  3H40 A;  4RQ4 A;  3T5K A;  4IQU A;  2IHN A;  2BGW A;  4BXO B;  4I27 A;  3RBD A;  4WC3 A;  4C8N A;  3PV8 A;  2MUT B;  4I2C A;  4DSF A;  5KG6 A;  1R89 A;  2ZTE A;  3C2M A;  1UA1 A;  4XA5 A;  3RRG A;  4JWM A;  4X4Q A;  4C8M A;  5KFI A;  2BQ3 A;  1S97 A;  4DOB A;  4ECT A;  3ZDE A;  3GV5 B;  4M47 A;  1S0V A;  1KFT A;  5DGA A;  2H5X A;  3UPQ A;  4E7X A;  4EBC A;  2PXI A;  2IA6 A;  4B9M A;  1JXE A;  4ECZ A;  4QZ8 A;  4O3O A;  4YD1 A;  2M2W A;  3H3A A;  4ED1 A;  1COO A;  4QZB A;  3LWL A;  1N56 A;  4AT7 A;  2DRB A;  4TQR A;  2O5A A;  8ICO A;  2AU0 A;  2ZHB A;  2ZH4 A;  3TAP A;  2ZTC A;  2IBK A;  4DFK A;  3E2E A;  4R65 A;  1TV9 A;  4X4N A;  4C8O A;  5KFF A;  1JQR A;  3PNC A;  5KG4 A;  3T3F A;  3PW0 A;  5KG7 A;  1NJW A;  4EYI B;  4GXI A;  2VA8 A;  4I2A A;  9ICO A;  2ZH9 A;  5IIK A;  3RJK A;  3ZDD A;  4RZR A;  4JWN A;  4KLD A;  1ZJN A;  1Z00 B;  2FPM A;  2BKE A;  4O3N A;  5CJ7 A;  5CR0 A;  5L9X A;  3JPT A;  2HHV A;  2NRZ A;  3ISD A;  4WC7 A;  2F1J A;  9ICJ A;  4RQ3 A;  5CA7 A;  2DPJ A;  2M2T A;  5J2I A;  9ICX A;  5J0W A;  1MIV A;  3BQ1 A;  3HP6 A;  1ZQD A;  5KFH A;  4DL5 A;  4O5C A;  5EOZ A;  2W9M A;  4QWB A;  4ELT A;  4KIT B;  4FHP A;  8ICF A;  4QZI A;  4F93 B;  1IXR A;  3M8S A;  3AU6 A;  3HIY A;  5J0R A;  4DFJ A;  3C5F A;  4AT9 B;  4QW9 A;  3PY8 A;  4J9K A;  4KLJ A;  4ED0 A;  4NLK A;  2XO7 A;  4BWM A;  4IQW A;  2M2U A;  1HJP A;  4MF8 A;  4PHD A;  4TUS A;  5HRE A;  4DF4 A;  2AGO A;  3JYY A;  4KLM A;  1KTQ A;  1H38 A;  5CB1 A;  2RFF A;  1KFD A;  1MQ3 A;  5IIO A;  3LWM A;  4E0D A;  3EW9 A;  1ZQK A;  5KFX A;  4DSE A;  2FLN A;  5EWE A;  8ICY A;  1TK8 A;  4WBZ A;  4RPY A;  2ASD A;  4DL3 A;  2BQR A;  5KFW A;  1HUO A;  3OVS A;  4DS4 A;  4MF2 A;  4M9N A;  3SYZ A;  5DBB A;  2MAX A;  1WOT A;  4WC4 A;  1ZQE A;  4DL4 A;  4IG8 A;  1U9L A;  1S0N A;  1NK8 A;  5D49 A;  2HHT A;  5J0Q A;  1ZET A;  2ASL A;  3OHB A;  3AU2 A;  4FHV A;  4J9M A;  1XC9 A;  5KT5 A;  4M9G A;  4WBY A;  3UXN A;  3NYB A;  4M5D A;  2FMP A;  3OV7 A;  5F9L A;  3V6H A;  5J0T A;  5J2B A;  4M0A A;  1K1Q A;  5DB7 A;  4KLE A;  4NKT A;  4EEY A;  8ICS A;  5J29 A;  1UEV A;  3H39 A;  4ATB B;  3Q8K A;  2R8I A;  2R8K A;  5DB6 A;  3C23 A;  4IRC A;  5J0S A;  3OVB A;  1ZQL A;  3HWT A;  9ICL A;  4F50 A;  1R8C A;  4RWQ A;  2FLP A;  2XY6 A;  1D8Y A;  2J6U A;  1SL0 A;  1ZQW A;  4WC1 A;  4UAZ A;  4RU9 A;  3M9N B;  3KHG A;  4KN4 A;  1L5U A;  9ICQ A;  3C2L A;  3QEA Z;  1SL1 A;  4ZH4 A;  4X4S A;  5KG5 A;  8ICR A;  9ICI A;  1UET A;  5DB8 A;  2PBE A;  1UT8 A;  1XU4 A;  1DOQ A;  2V4R A;  1NZP A;  5HRI A;  1ZQT A;  4J9N A;  1ZQI A;  2UVV A;  4M04 A;  4I2B A;  4MFF A;  4I28 A;  2NRK A;  3UQ0 A;  4KN7 A;  4UQG A;  4AT9 A;  3C5G A;  1TAQ A;  9ICA A;  3KHR A;  4AT7 B;  4BWJ A;  2ZH8 A;  5KFC A;  4UB3 A;  4K4G A;  5DEC A;  3IHQ B;  2C22 A;  1JXL A;  4FBU A;  1NJY A;  2R8G A;  3V7J A;  4B9N A;  8ICM A;  4DS5 A;  5HRB A;  5HRF A;  4E8F A;  4DL2 A;  2NRT A;  5DG9 A;  4ED6 A;  4DF8 A;  2VA3 A;  3QE9 Y;  5KFQ A;  9ICU A;  4NKU A;  3TFR A;  1X9S A;  5DG7 A;  4BGD A;  4DFM A;  2HHS A;  1TFW A;  4RUA A;  2BPG A;  1PX5 A;  1IM4 A;  5DQI A;  4ECQ A;  4DO9 A;  8ICW A;  1XSN A;  5DKW A;  4YXJ A;  4KLI A;  5J0O A;  3KHL A;  4I2D A;  1L3V A;  5D46 A;  2ZHA A;  1WCL A;  3PO5 A;  1FA0 A;  4I2J A;  8ICK A;  5KFN A;  1S0O A;  4I2E A;  1S77 D;  3M9M B;  2XCA A;  4B9U A;  4JV1 A;  1U45 A;  1BGX T;  4YMN A;  9ICK A;  3AQL A;  3H38 A;  4RQ5 A;  3B0X A;  4ECU A;  4HYK A;  1LV5 A;  4KLG A;  3BJY A;  3LK9 A;  3TFS A;  4RQ0 A;  5KFE A;  5DBC A;  1TK0 A;  2DR5 A;  2JEI A;  4NLG A;  4F8R A;  3V6J A;  2ZJA A;  8ICI A;  5KFB A;  1ARO P;  1ZQU A;  5DQH A;  4G3I A;  2ZUB A;  3RR8 A;  5KT3 A;  5J0P A;  2W9B B;  2ATL A;  4FHW A;  4NXZ A;  3PW7 A;  3C21 A;  8ICV A;  1ZQS A;  4KLH A;  2ZJ8 A;  5CP2 A;  4F4Z A;  4R64 A;  4F5N A;  3PW5 A;  4QZD A;  4UAY A;  2BCU A;  3TI0 A;  5KT7 A;  1L3S A;  2DFL A;  5J2H A;  1CUK A;  3MFI A;  2RDI A;  2A1J A;  4RPZ A;  1BPZ A;  4F92 B;  5KFU A;  4RQ7 A;  1T7P A;  4IRD A;  4WC6 A;  3FYH A;  4MFC A;  7ICP A;  1QLN A;  7ICR A;  2HHU A;  9ICS A;  1ZQO A;  4RT3 A;  2ISO A;  4DOC A;  4UBC A;  3H4D A;  1N48 A;  5KFR A;  3JPP A;  5KTQ A;  4UB5 A;  4FBT A;  4NM1 A;  4ECR A;  3HJ1 A;  3WFO A;  1JMS A;  1U49 A;  3OHA A;  4CCH A;  5J2C A;  5KFV A;  1S9F A;  2IMW P;  2HW3 A;  3C66 A;  5L1I A;  1R8B A;  5IIJ A;  3RB0 A;  4M9H A;  5IIN A;  4UB1 A;  3QZ7 A;  8ICL A;  4Z6D A;  4DL6 A;  5J2D A;  4YR0 A;  3PR4 A;  4X0A A;  5BPC A;  1RXW A;  2ZH7 A;  4YG2 A;  2LYH A;  3MR6 A;  3EPI A;  2NRW A;  3JPN A;  4J9P A;  2UVW A;  4TUQ A;  2PFP A;  2O1P A;  4PGX A;  5L1L A;  4PGY A;  2RDJ A;  1V9P A;  1ZQX A;  4MEY A;  4LVS A;  4Q45 A;  1L3T A;  2M9N A;  5HHH A;  4F4W A;  1TAU A;  3UXO A;  3JPR A;  5HML A;  2C28 A;  9ICW A;  3PVX A;  4IQT A;  2Y1I A;  1BVS A;  2C2R A;  3PO4 A;  8ICT A;  3MBY A;  2W9B A;  4F5Q A;  9ICT A;  4FH5 A;  4EBE A;  1X9W A;  2JEF A;  3ISB A;  5L1J A;  3UXP A;  4F3O A;  4DQR A;  7ICV A;  1Z3E B;  4DSL A;  1ZQH A;  3HW8 A;  2IHM A;  9ICN A;  2JEJ A;  5C5J A;  2PI5 A;  3H37 A;  4F91 B;  4RQ1 A;  3MR2 A;  3OSN A;  3GQC A;  4DLE A;  2I9G A;  1F5A A;  3OUY B;  3AQN A;  2PFO A;  4RQ8 A;  2XCP A;  3V72 A;  2XC9 A;  1RYR A;  1RZT A;  3Q8Q B;  8ICB A;  4O3S A;  4F5O A;  4KLL A;  2XY5 A;  2B21 A;  2BCQ A;  2W9C A;  2DVI A;  4Q44 A;  1RXV A;  1SKR A;  4EYH B;  3GDX A;  1X2I A;  4P2H A;  3ZD9 A;  9ICR A;  5DLF A;  4YMM A;  2UVU A;  3EYZ A;  4GLX A;  4YVZ A;  9ICP A;  4X4T A;  1S10 A;  4ED7 A;  4F4Y A;  1Q79 A;  1WCN A;  3AQK A;  3G6Y A;  4PPX A;  1Y88 A;  1ZQY A;  3PML A;  3BQT A;  4XQ8 A;  5KFP A;  2AGQ A;  3MDA A;  2PFN A;  2P6U A;  1JN3 A;  5F9N A;  1BNO A;  3WFQ E;  1XWL A;  2R8H A;  1QTM A;  4O5E A;  1KNY A;  3C18 A;  1ZYQ A;  5F2V O;  4NLN A;  4EZ9 A;  4QWA A;  2I1Q A;  1RYS A;  4NY8 A;  2V9W A;  9ICH A;  2HHX A;  1NO5 A;  1XSP A;  4UB2 A;  1KLN A;  2ID1 A;  1EXN A;  3M8R A;  2C2D A;  2R8J A;  9ICM A;  3TAR A;  1NK4 A;  3Q8L A;  1ZQZ A;  3EZ5 A;  5BOL A;  4DQP A;  3GV7 B;  4J9R A;  4AT8 A;  5J0Y A;  2JEG A;  4X0B A;  4TQS A;  3RTV A;  5HC9 A;  2A1J B;  5HHI A;  2Q0Z X;  2ZH1 A;  2HHQ A;  2PI4 A;  2HVI A;  3ORY A;  5DG8 A;  2BCR A;  1QSY A;  4R8U A;  3RJH A;  4GC7 A;  3C1Z A;  3GFK B;  3MAB A;  3JZ0 A;  4I29 A;  4UD5 A;  1ZQG A;  7ICI A;  2OWO A;  1BPY A;  3RH4 A;  4FHX A;  4NM2 A;  1ZQQ A;  4EBK A;  4TUP A;  1UT5 A;  4Z6C A;  3TQ1 A;  3MR5 A;  1SL2 A;  4R66 A;  3MFH A;  8ICN A;  2J6S A;  1NKC A;  2NRV A;  7ICN A;  3RJG A;  5EWF A;  4M2Y A;  3KTQ A;  2BHN A;  3N97 B;  1ZQF A;  2KTQ A;  1VJ7 A;  7ICT A;  3OUY A;  2NRX A;  4JV2 A;  1ZQJ A;  4UBB A;  2HHP A;  2ZH3 A;  4X4V A;  5L1K A;  4K4H A;  3IM1 A;  7ICQ A;  4J9O A;  4ED2 A;  1MQ2 A;  3HJ4 A;  5J0U A;  5DDY A;  3RR7 A;  5HR9 A;  4GXK A;  4PHA A;  5J0X A;  4YP3 A;  4ECY A;  2ALZ A;  2KZM A;  8ICZ A;  4FS2 A;  2ZH6 A;  3RAX A;  3ZD8 A;  5IIL A;  1T8E A;  2FLL A;  5DBA A;  3Q8R B;  5HP4 A;  4RQ6 A;  7ICE A;  1DK3 A;  2BDP A;  3GIK A;  2Q66 A;  1NOM A;  4LZD A;  5CWR A;  4B9L A;  4QWE A;  2JZB A;  1NK6 A;  4I2G A;  8ICH A;  3ZDC A;  5HNK A;  3H8S A;  4FO6 A;  4DSJ A;  1K1S A;  5IIM A;  1U48 A;  1PZN A;  3FDS A;  4Z6E A;  2FMQ A;  4XQ7 A;  5BOM A;  7ICU A;  4O3P A;  3MDC A;  3PX4 A;  2BQU A;  3BQ0 A;  1TK5 A;  1TKD A;  1SKW A;  9ICB A;  3HX0 A;  5KT2 A;  4B9S A;  3G6X A;  8ICC A;  8ICP A;  7ICL A;  1TVA A;  4X4R A;  1BPB A;  8ICX A;  4F2R A;  1KSP A;  2KFN A;  2ZH5 A;  1LB2 B;  4RUC A;  3PX0 A;  1B43 A;  4NLZ A;  2W8L A;  1NK7 A;  4EBJ A;  4RWO A;  4DLG A;  3L9D A;  3RJF A;  3Q8S B;  1ZQR A;  1HUZ A;  4I2F A;  3RB6 A;  1JX4 A;  4RNM A;  2WTF A;  1KDH A;  2ZUD A;  3WFR E;  4X5V A;  4FHY A;  1D9D A;  3KHH A;  2ZUC A;  5HMM A;  2BPC A;  3H8J A;  2XGP A;  2W9C B;  4M9L A;  3GIM A;  1YLQ A;  3RJI A;  4YQW A;  5KG3 A;  3OSP A;  2W8K A;  1KFS A;  4KLS A;  3ZDB A;  2KFZ A;  4EP7 A;  1C7Y A;  2BR0 A;  1ZQV A;  5J2J A;  3RH5 A;  3RRH A;  4RWP A;  4YMO A;  5HRL A;  4O9M A;  4DSI A;  2J6T A;  4QWC A;  1R8A A;  4ED8 A;  4DQS A;  3N4M B;  2P66 A;  2F1I A;  3LDA A;  3QEB Z;  1TFR A;  4C8L A;  1JIH A;  2KZZ A;  4WC0 A;  3RB3 A;  1BPD A;  4KLO A;  1XSL A;  4B9V A;  4P4M A;  3PMN A;  1U47 A;  7ICG A;  2KZ3 A;  7ICS A;  1DK2 A;  1NK9 A;  1ZQP A;  4ECV A;  9ICV A;  3JPO A;  4I2H A;  3ISC A;  4R63 A;  4IRK A;  2XGQ A;  4RT2 A;  2AQ0 A;  4E80 A;  4QZA A;  4KLU A;  4MFA A;  2FPL A;  4AT8 B;  8ICJ A;  5J2K A;  9ICE A;  5KFO A;  4X4P A;  1NK0 A;  3OVA A;  3H7I A;  5DQG A;  4GC6 A;  5KFS A;  4QZH A;  4J9L A;  3T5L A;  5KFT A;  2ZTD A;  4XUS A;  5HRK A;  4M6W A;  4R8U B;  4YR3 A;  4KTQ A;  1OU5 A;  4RQ2 A;  4O5K A;  4WCW A;  5DED A;  4WC5 A;  3EWA A;  1A77 A;  4QZG A;  2BCV A;  3EPG A;  2VAN A;  4PHE A;  3K4G A;  4JK1 A;  5KFG A;  4QZ9 A;  3H4B A;  2P6R A;  4LZG A;  7ICH A;  1XS9 D;  4QZF A;  4K4I A;  3BDP A;  1X9M A;  3RJE A;  4DEZ A;  5KT4 A;  1BPX A;  4B9T A;  4FH3 A;  4DFP A;  1XO1 A;  4RWN A;  4F2S A;  1MC8 A;  1NKE A;  3G6V A;  4F4X A;  5D4B A;  3PW2 A;  3OJS A;  5KG2 A;  4EZ6 A;  4YR2 A;  3SI8 A;  7ICK A;  5HRG A;  5DDM A;  2HVH A;  1S0M A;  3OGU A;  1L3U A;  8ICA A;  4FS1 A;  8ICQ A;  3GII A;  1UA0 A;  3RH6 A;  4UAW A;  1ZQN A;  2ZJ5 A;  2UVR A;  4J9Q A;  3ETL A;  4BXO A;  3MGI A;  7ICM A;  5KFL A;  2JZB B;  5KFJ A;  7ICO A;  4TUR A;  1D9F A;  5J2E A;  2GWS A;  2MUT A;  2PFQ A;  4F4K A;  4I2I A;  4KLF A;  5HRD A;  5TZV A;  4PHP A;  5KFK A;  1MIW A;  1T3N A;  3Q8P B;  1ZJM A;  4JUZ A;  5III A;  4UB4 A;  3AUO A;  1NK5 A;  5DLG A;  2DR9 A;  3PW4 A;  3C2K A;  3THV A;  2AGP A;  3SZ2 A;  1MIY A;  2DPI A;  4O3Q A;  4S3N A;  3PR5 B;  4YN4 A;  2KP7 A;  4ECS A;  8ICU A;  4ECX A;  4GXJ A;  2AJQ A;  4DQQ A;  4JV0 A;  4YD2 A;  4QW8 A;  5J2F A;  4DQI A;  4KMU A;  3NTU A;  9ICG A;  1S76 D;  3WFS C;  3BQ2 A;  1SZP A;  3HT3 A;  4PH5 A;  2BPF A;  3B0Y A;  4IR1 A;  7ICJ A;  3HPO A;  1ZQM A;  1ZQB A;  4IR9 A;  5KFM A;  2V4Q A;  9ICC A;  3K75 D;  5KFA A;  4QWD A;  1UEU A;  5KG0 A;  4O0I A;  4WC2 A;  1QSS A;  2C2E A;  3WFP A;  4Q8F A;  3GV8 B;  1CEZ A;  2ASJ A;  1VFG A;  4F5P A;  5EWG A;  3H8W A;  3SV4 A;  2KN7 A;  1Z00 A;  3RB4 A;  5J2G A;  3GIJ A;  3TAN A;  1SKS A;  4BDP A;  1BPE A;  5DB9 A;  2XY7 A;  3MR3 A;  4KLQ A;  1V4A A;  4ELV A;  4DL7 A;  4YXM A;  2FMS A;  4X4O A;  3NGD A;  3RBE A;  5JUM A;  4M9J A;  3JPS A;  2DR7 A;  3SV3 A;  4F5R A;  7ICF A;  2HHW A;  2BE3 A;  4Q43 A;  3LQC B;  3AQM A;  1A76 A;  4Z6F A;  4RNN A;  2DRA A;  1ZQC A;  4O3R A;  3MGH A;  8ICE A;  4C8K A;  3RAQ A;  4YCX A;  1JAJ A;  2W9A A;  1U4B A;  3UQ2 A;  4ED3 A;  3T5H A;  4ECW A;  2ZH2 A;  3M9O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...