4M9LA

Dna polymerase beta e295k soaked with dctp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
326
structure length
313
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPVAGEPLPVSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 107
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9lA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9lA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9lA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9lA03
5J2DA 5EWEA 1NK0A 5L1IA 4Z6EA 2F1JA 4KLHA 4IQWA 2HHUA 4RUAA 3JPPA 5J2HA 4YG2A 3PW0A 4AT7B 2XO7A 5KT6A 2BCQA 8ICRA 3TAQA 1R8CA 1ZQZA 4XA5A 3MGIA 4EYHB 4EBJA 4DSKA 4J9KA 3RH5A 2FLNA 2IMWP 3PY8A 1B43A 1QSSA 4DQIA 4IRDA 3EYZA 1ZQYA 4PPXA 3QE9Y 4RT3A 3Q8PB 1UEVA 1RXWA 1ZQXA 5HRLA 2JEJA 1TKDA 2MUTA 3TAPA 2BCUA 4QW8A 2KTQA 2NRWA 1TAUA 1BPEA 4I27A 4YCXA 5KFNA 4ED3A 4KLIA 4KLJA 2HVIA 8ICAA 2ZHAA 4UBBA 1ZQEA 2RDIA 4R63A 3JPNA 1X9MA 1RYSA 4DSJA 3RJGA 3ISCA 3PW5A 1NK9A 3QZ7A 2PI5A 4NM1A 1VJ7A 2V4RA 1ZQJA 2R8JA 2HHPA 5IINA 4P4PA 8ICYA 4UD4A 4KLTA 1BPYA 5CWRA 1B22A 1UETA 2BQRA 1LB2B 7ICUA 4RQ8A 4YR0A 3BQ2A 4TUQA 3KHHA 4QZ8A 4DSIA 5J2JA 4DS4A 4DQRA 2XY5A 5CR0A 3PR4A 2HW3A 1Z3EB 4YVZA 1D9DA 4BXOA 1JXLA 4TURA 3OVSA 2IBKA 3V6JA 9ICWA 4JK1A 3JZ0A 2NRVA 4DLEA 1JQRA 5J2BA 4UB1A 1MIVA 2JZBB 4ED1A 9ICCA 4F93B 4MFAA 2AGPA 3RJEA 9ICJA 4IG8A 1DGSA 3OVBA 5DB6A 1TK5A 2R8HA 3UXPA 4ECVA 4GC6A 1ZQDA 4YMNA 4GXKA 4WC1A 2DPJA 7ICTA 3QEBZ 2Y1JA 3C23A 4YMOA 4WC3A 5DB7A 5L1LA 1BPDA 5KG1A 1FA0A 5DBCA 2J6SA 5DKWA 2KZZA 4R66A 3C5FA 2H5XA 5L9XA 2M2WA 5F9NA 5DBBA 4RQ2A 3PVXA 1HUZA 5KTQA 5J0PA 1WCLA 4GC7A 2O5AA 1RXVA 5KG2A 4Z6CA 5J2IA 2HVHA 5J0XA 4AT9A 3NTUA 1S0VA 2IHNA 4DL5A 4QZAA 2BHNA 3MDCA 4QZGA 4E0DA 4KLEA 4EZ6A 2ZJAA 5HRIA 4O3NA 4O3OA 3LWMA 4XQ8A 2ASJA 3ZDAA 5L1KA 5DDYA 4F8RA 1JX4A 1CEZA 4XQ7A 4FHPA 4X4NA 1H38A 1Z00B 5HMMA 4NY8A 8ICPA 1ZQHA 3SV3A 2DR5A 4WC0A 3MR3A 3UXOA 2ZJ5A 4WC5A 1RPLA 3ZD8A 8ICVA 7ICIA 1K1QA 4EBEA 5D49A 4BDPA 1L3SA 2FPMA 1NOMA 5KG5A 4J9QA 2AQ0A 3TARA 5HRGA 5DDMA 4QWEA 8ICUA 3H38A 1BNOA 2PBEA 2JEIA 3V7LA 4X4VA 2Q66A 3NYBA 5DLFA 4QWCA 2ASDA 5KFSA 4DOCA 4JV2A 4G3IA 1K1SA 3BQ0A 1TK0A 2FMQA 4O5EA 3M9NB 2FMPA 4RWOA 3OHBA 3T5KA 4F5QA 3GV8B 3LQCB 1JMSA 5KFFA 3L9DA 4KLDA 5BOMA 5L1JA 3GILA 4QZFA 4RPZA 2J6UA 4KLOA 2XY6A 3OSPA 1OU5A 4PGQA 3C2LA 3PW2A 2AQ4A 4I2EA 4KN7A 2ZUCA 4S3NA 1QSLA 2PFNA 2JEFA 3JPRA 3AUOA 5HHHA 4Q8EA 1S77D 1ZQVA 2ZUDA 4Z6FA 4KLSA 4I2JA 3MFHA 2KFNA 2ZH7A 4FO6A 5BOLA 1SL2A 1U49A 1NJYA 1BNPA 3AU6A 3HP6A 4ED0A 7ICQA 4PHEA 3GV7B 4WCWA 3TANA 1QSYA 3RJJA 3WFPA 4YD1A 4X0AA 4X4OA 3K75D 4DL6A 2ALZA 5KFEA 1NK5A 4RT2A 4DQQA 2PXIA 4DFMA 4DFKA 4FHVA 4IRKA 7ICRA 3RR7A 5KFGA 5CP2A 3RBDA 1U45A 1NJZA 2B21A 4R64A 3OSNA 3HJ1A 5HRFA 2XCAA 4Q44A 5EOZA 1BPBA 3MDAA 3EPIA 2W9BA 1KFDA 1IM4A 1XC9A 5DEDA 3V7KA 5J2CA 4BWMA 2BDPA 1ZQSA 4DL7A 2NRKA 1ZQOA 2LYHA 4M5DA 4TUSA 4F4YA 1L3TA 3ZDDA 3Q8LA 3WFRE 4GXJA 1ZETA 9ICAA 1XS9D 1UA0A 3E2EA 2P66A 3OUYB 3KTQA 5BPCA 4J9MA 1S97A 4B9UA 9ICTA 4RUCA 4F4XA 5DGAA 5HRKA 3UPQA 3PNCA 4FHYA 3H3AA 4F3OA 2HHTA 5KG6A 2P6UA 1NKBA 3C1ZA 1BVSA 1LV5A 2ZUBA 4YFKA 9ICLA 3AQNA 3OVAA 8ICWA 1NO5A 3RRHA 5KFBA 4RQ6A 1Q79A 4X4SA 1MQ3A 4F5PA 4UAYA 3RH6A 3RTVA 3RB3A 3ZDBA 8ICIA 3OHAA 4CCHA 1JN3A 2DR7A 2ZTEA 4ECUA 4O3SA 1PZNA 8ICHA 9ICFA 2A1JB 4ATBA 3PV8A 1QTMA 2M2TA 4QZHA 4YQWA 4M0AA 2V9WA 4WBZA 1S76D 2UVVA 1RYRA 1T3NA 1UT5A 5KFTA 4NKTA 1SKWA 4XUSA 4RPXA 2ZH2A 4I28A 3M8RA 2XGQA 3RRGA 4I2HA 4UD5A 4DF4A 1R8AA 5EWGA 1KFSA 4M9GA 4RWQA 4YXJA 5KFPA 4O5CA 5J2KA 2R8KA 4YR2A 4KMUA 4C8LA 9ICKA 5DQIA 1NK7A 9ICPA 1V4AA 4FH5A 4LT6A 4EBKA 4KLMA 3PMLA 3M8SA 2AU0A 3B0YA 2BCVA 3PX0A 2PFQA 4K4IA 2PFPA 9ICHA 3EPGA 4F5RA 2BGWA 3AU2A 5CHGA 3M9MB 1S0MA 4LVSA 3IHQB 1ZQMA 1IXRA 3C2KA 1NJWA 2ISPA 2ZH8A 4UB3A 4I2DA 4KN4A 4M9LA 2AGQA 4YR3A 4UBCA 3OJSA 2KFZA 1N56A 3QEAZ 1HJPA 3H8SA 3EZ5A 3G6XA 1ZQNA 4NLGA 8ICGA 8ICLA 4WBYA 1TVAA 5DG8A 1DOQA 1SL1A 3LDAA 4ELVA 4RWPA 4ECZA 1D8LA 4DL2A 3GFKB 4BWJA 4PHAA 5J2AA 2FMSA 8ICBA 2ZH6A 3IM1A 2UVRA 3Q8MA 1ZQGA 4ECTA 2W9AA 4P4MA 9ICSA 3LK9A 4RQ0A 1SL0A 1T4GA 3RB4A 4C8NA 1NK8A 2C28A 5KFQA 2RDJA 7ICKA 4WC4A 4FBTA 1MIYA 4PHDA 2J6TA 4MF2A 5HREA 5KFOA 4XRHA 5KFCA 3MR5A 1U4BA 1NZPA 3EWAA 4EBCA 1ZQUA 4ED2A 1S9FA 3AQKA 3Q8RB 5KFZA 2GWSA 3C21A 5KT4A 5KT2A 4YP3A 3KHRA 4FS1A 3TFRA 3KHLA 4BXOB 4DWIA 4UQGA 8ICSA 9ICUA 1KNYA 4JUZA 4RNNA 3H8JA 2HHSA 4AT8A 5KT5A 4BGDA 3UPSA 1COOA 4DL4A 1KLNA 5TZVA 4R8UA 5KFJA 4FS2A 2BR0A 4LZDA 1TK8A 4Q45A 9ICNA 5HRDA 3BJYA 2W9MA 1KRPA 3AQLA 7ICJA 4J9LA 2ID1A 1C7YA 4X4PA 3UQ2A 4GXIA 4YD2A 3LWLA 4ECRA 5DGBA 7ICSA 4FBUA 7ICOA 2C2EA 5J0YA 2ZJ8A 1T8EA 8ICOA 4JWMA 3H39A 2KN7A 2F1HA 5KT7A 3PW7A 1U47A 4X4RA 3WFSC 5J0TA 4GLXA 2RFFA 1RZTA 3C18A 4RQ3A 5DQGA 5J0WA 2FLLA 4DF8A 4F2SA 4FHXA 2VA8A 4Q43A 4F92B 7ICEA 4KTQA 4AT9B 1ZQKA 4O9MA 3UQ0A 4P4OA 4RQ1A 2AGOA 5J2FA 4RNMA 1S0NA 4J9NA 3C2MA 2C2RA 1UT8A 3JPOA 2W9CA 3T5HA 4ZH4A 3HW8A 4O3QA 1ZQWA 1XSPA 4YN4A 2DRBA 1XU4A 4TUPA 2JEGA 1TAQA 3OUYA 2MAXA 4ED8A 5J0SA 3RH4A 4M9HA 4AT7A 5J0RA 3ZDEA 4DSEA 2R8GA 3MGHA 2W8LA 4QZIA 2BPCA 4FHWA 2NRTA 9ICBA 4WC7A 2I1QA 2DRAA 2KZMA 1TFRA 4DEZA 1XSLA 3Q8KA 1AROP 4ELTA 3RAXA 5KFHA 1ZJMA 8ICNA 8ICKA 3WFOA 1VFGA 4IR1A 4B9NA 3C1YA 4E7XA 5DB9A 3RJHA 5D4BA 1EXNA 3H7IA 2HHVA 4WC6A 5KFLA 3Q8SB 2ZHBA 2M2VA 3RB0A 3TI0A 1XSNA 4YMMA 4M04A 2ZH9A 4QWAA 4QZBA 2BCSA 1CUKA 2C22A 4JV1A 4E8FA 1DK2A 3RBEA 4NLZA 3T5LA 4QWBA 5KG0A 1SKSA 3Q8QB 3OJUA 3GIIA 4PHPA 4ECSA 1KFTA 9ICIA 1A77A 7ICVA 3GQCA 4M6WB 1U48A 4KLUA 3M9OB 4TQSA 5J29A 5J0UA 3OV7A 4KLLA 1MQ2A 1T7PA 3ZD9A 4NLNA 4QZCA 5KFWA 1UA1A 4DL3A 3T5JA 2XGPA 4EP7A 1UEUA 3GDXA 1ZQIA 3MR6A 4AT8B 5J0QA 2Q0ZX 3H4DA 2PI4A 4I2IA 1PX5A 5F2VO 1KEJA 2VANA 1ZQLA 3SI8A 2JZBA 5KFAA 2I9GA 3BDPA 4ECQA 2IHMA 4DFJA 1BPXA 1BGXT 4IR9A 1BPZA 2C2DA 2FPLA 3QZ8A 1Y88A 3SYZA 5KFKA 4KLGA 3HT3A 4DOBA 3N4MB 5DQHA 4J9SA 7ICNA 5DLGA 2F1IA 8ICJA 8ICXA 3SV4A 3WFQE 3V6HA 4K4HA 1ZQTA 3RJFA 2HHWA 1R8BA 2DR8A 5KFXA 2DVIA 4DLGA 2ASLA 2M2UA 5CA7A 4X4UA 4I2CA 3HWTA 5IIMA 8ICFA 2W9BB 4X0BA 5KFDA 3AQMA 2ZTCA 4Z6DA 4PGYA 5KFRA 4QWDA 2OWOA 3RAQA 7ICGA 8ICQA 5KFIA 4Q8FA 4NKUA 3PX4A 4M9NA 4F5NA 5KFVA 3HPOA 4QZ9A 2BPFA 5DG7A 4EBDA 7ICLA 4KLQA 2UVWA 4MEXA 4RPYA 5JUMA 4RQ5A 7ICMA 2WTFA 4IQTA 2BQUA 1Z00A 9ICGA 5KG4A 4KITB 2Y1IA 5HRHA 3V7JA 3JPQA 4M9JA 3ORYA 3UXNA 3ISBA 1L3VA 2BPGA 2ZH3A 5J2GA 4K4GA 3MBYA 3PO4A 3FDSA 4TQRA 4NLKA 4P2HA 9ICXA 3NGDA 4DSLA 4JWNA 3JPTA 2MUTB 2BKEA 1JXEA 4QW9A 5CB1A 1U9LA 1NK4A 4IQUA 4JV0A 3PX6A 3HJ4A 4F4WA 4F91B 1X9WA 4ECXA 4DS5A 3ZDCA 4DQPA 2NRZA 3B0XA 5C5JA 1N48A 4ED6A 4ATBB 3PW4A 2BE3A 4QZDA 4X4QA 4NXZA 4B9VA 1MIWA 2DFLA 1ZQFA 2PFOA 5DECA 2R8IA 2ISOA 3HX0A 4F4ZA 5EWFA 4J9OA 1X2IA 2AJQA 8ICZA 2DPIA 5HMLA 3BQTA 1TFYA 3BQ1A 8ICMA 2KZ3A 5D46A 5HNKA 4HYKA 4F5OA 4RQ7A 4UB2A 4O5KA 5KG3A 1HUOA 5KT3A 1ZJNA 4RNOA 2W8KA 4EZ9A 1Q78A 3H4BA 5KG7A 4EYIB 9ICOA 4PGXA 4X5VA 3PO5A 1ZQPA 4MEYA 1SZPA 2ZH5A 4O0IA 3PR5B 2P6RA 4B9TA 4LZGA 9ICQA 2XCPA 4ECYA 1DK3A 5IIJA 1MSWD 1V9PA 4FH3A 1L5UA 2VA2A 4E80A 5HRBA 3V6KA 3THVA 2O1PA 4RU9A 4B9LA 2DR9A 3MFIA 3TQ1A 3GIMA 9ICMA 3G6YA 1D9FA 3JYYA 4UB5A 1D8YA 3H37A 2XC9A 3MR2A 7ICFA 5J0OA 1XO1A 5HHIA 2BQ3A 1X9SA 1NKCA 1ZQAA 4IRCA 1F5AA 4WC2A 1L3UA 4C8KA 4J9PA 3GIKA 1NK6A 2FLPA 4M2YA 4KLFA 1JAJA 4DQSA 1XWLA 3H8WA 5DB8A 3TFSA 2NRXA 1KTQA 1QLNA 4F50A 1ZYQA 3GV5B 2V4QA 4F2RA 5CJ7A 2HHXA 3HIYA 9ICVA 3N97B 4O3RA 3V72A 4NM2A 2ATLA 5F9LA 1KDHA 7ICPA 2KP7A 8ICCA 4UB4A 4MF8A 3FYHA 2M9NA 3GIJA 5IIKA 4ECWA 1A76A 4DOAA 4M6WA 4B9MA 4I29A 5HR9A 3ETLA 4I2FA 3C5GA 4R65A 2ZH1A 4I2BA 4C8OA 1WCNA 4C8MA 1WOTA 1SKRA 4DSFA 3RB6A 4RWNA 1MC8A 2ZTDA 3C66A 4I2AA 1S0OA 4MFFA 3K4GA 3ISDA 1ZQCA 2UVUA 4R8UB 2XY7A 4F4KA 8ICTA 3KHGA 5IILA 4J9RA 4QZEA 4DO9A 4DFPA 1KSPA 4ED7A 3RJKA 1JIHA 4UAZA 1YLQA 5KFUA 2A1JA 3JPSA 4ELUA 1S10A 4B9SA 5IIIA 5KFMA 5DG9A 9ICRA 4RZRA 3OGUA 4PH5A 2VA3A 1NJXA 4I2GA 1TFWA 5KFYA 5DBAA 1ZQBA 4YXMA 2HHQA 9ICEA 4MFCA 4EEYA 4RQ4A 3SZ2A 1ZQQA 1NKEA 4X4TA 7ICHA 4O3PA 3G6VA 1TV9A 1ZQRA 3T3FA 2IA6A 3RJIA 4M47A 2ZH4A 2BCRA 4UAWA 1R89A 2W9CB 3MABA 3EW9A 5IIOA 3H40A 3PMNA 5HP4A 3RR8A 8ICEA 5HC9A 4IQVA 2FPKA 5J2EA
chains in the Genus database with same CATH superfamily
4RUAA 5J2HA 4AT7B 1JI7A 2CPRA 4XA5A 4EYHB 3PY8A 3Q8PB 2JMGA 2I6XA 5HRLA 1V85A 5EE1A 2HBJA 1TKDA 1TAUA 5KFNA 3IP4B 5AKKA 4KLIA 1Z1VA 1RYSA 4NM1A 4EEBA 2R8JA 2HHPA 8ICYA 4UD4A 4KLTA 2ES6A 5CWRA 1UETA 3QUCA 2BQRA 4C80A 4WOYA 4TUQA 2DBYA 2HW3A 2XY5A 4DQRA 1JXLA 3OVSA 3V6JA 4JK1A 2NV3A 1JQRA 5J2BA 2JZBB 9ICCA 9ICJA 1FIQA 3E58A 1TK5A 1JUDA 3SAGA 4WC1A 4WQKA 2DPJA 3SAFA 3C23A 2HN1A 5DB7A 5CRXA 4O67A 5CFSA 1BPDA 5KG1A 2KZZA 2M2WA 5F9NA 1UHUA 4RQ2A 1HUZA 5J0PA 1WCLA 2LYBA 5KG2A 3NTUA 1S0VA 5HR6A 4E0DA 2BHNA 2ZJAA 1JX4A 5AK4A 2KJ9A 2VJ4A 4LJXA 7ICIA 2AQ0A 5J8YA 2MA1A 2BZFA 1BNOA 2ZIWB 1OUQA 5ALSA 3HJEA 5DLFA 5KFSA 5EE3A 4DOCA 4JV2A 1K1SA 1TK0A 4UAUA 5GTIU 5B3PA 4RWOA 1VLBA 4NXUA 5KFFA 4KLDA 5BOMA 3TACB 2XY6A 3OSPA 4QJFB 4AT8A 2ZXIA 1S77D 2OXOA 2M0NA 3QXGA 4I2JA 4X0AA 1L8LA 5AI5A 3KZIU 4DFMA 4DFKA 4P0PA 3RR7A 3RBDA 1NJZA 3IG5A 1ECWA 5HRFA 4Q44A 5EOZA 3EPIA 2W9BA 1XC9A 1IM4A 3GZFA 3PHZA 2ZIVA 4M5DA 3WFRE 1L3TA 1UA0A 4FO1A 1S97A 4B9UA 3UPQA 4C4TA 2HHTA 1BVSA 3AQNA 2DRBA 1JALA 2W7PA 3RRHA 4RQ6A 1NO5A 4X4SA 1MQ3A 1COKA 3ZDBA 8ICIA 3KZXA 4CCHA 1FEZA 2DR7A 2ZTEA 9ICFA 4YQWA 1TE2A 4WH5A 5KFTA 4NKTA 2EWRA 3B9JA 2ZH2A 3TADA 3CRXA 2KICA 2E8OA 4RWQA 4YXJA 2R8KA 4YR2A 9ICPA 4FH5A 1SGGA 5DQIA 1ED1A 1NK7A 4EBKA 4K4IA 2PFPA 2BGWA 5CHGA 4LVSA 3IHQB 5AKZA 4I2DA 3C66A 4YR3A 2KFZA 8ICGA 1HJPA 3EZ5A 3PSTA 1TVAA 2W7OA 3NVZA 2FMSA 2ZH6A 3ETRA 1ZQGA 2W9AA 9ICSA 3ER8C 1F44A 3RB4A 4C8NA 5KFQA 2ZIUB 2HOFA 4PHDA 5KFOA 4EBCA 1T94A 1S9FA 4ED2A 3AQKA 1J2MA 1ZXIA 3AL0B 4YP3A 4WBZA 2HOIA 2HHSA 1IG6A 4PZOA 4R8UA 5KFJA 3AQLA 3SQIA 2P35A 5ALXA 4J9LA 4X4PA 3LWLA 7ICSA 2ZJ8A 2KN7A 3PW7A 2HN2A 5J0TA 3C18A 4CDGA 4USAA 4Q43A 7ICEA 1ZQKA 4P4OA 4RQ1A 4RNMA 1KL9A 3T5HA 3JPOA 2W9CA 5AK6A 1XSPA 4M9HA 3QU9A 1RQNA 5FP0A 3M6ZA 3UMGA 3BZCA 3Q8KA 1AROP 4ELTA 5KFHA 1ZJMA 4EELA 2KVSA 4LEWA 5DB9A 3H7IA 2HCFA 1WG8A 3K1ZA 2C22A 4JV1A 2GO7A 3RBEA 4NLZA 3ER9B 4K98A 1SKSA 3OJUA 3GIIA 4PHPA 4ECSA 9ICIA 4M6WB 4KLUA 3M9OB 3QUTA 5J29A 4QZCA 1UA1A 2Q0ZX 2I9GA 2D6FC 4DFJA 1J2NA 3L4PA 4KLGA 5KFKA 4DOBA 2A19A 5DLGA 2F1IA 1R8BA 5KFXA 5CA7A 4I2CA 8ICFA 2OWOA 2KKPA 2IHOA 3PX4A 4M9NA 4F5NA 4QZ9A 2BPFA 2WF9A 4EBDA 5DG7A 7ICLA 2UVWA 4F72A 3MGVA 3VC8A 4MEXA 2WTFA 2W54A 5KG4A 2E8MA 5ALUA 1PUZA 2BPGA 2ZH3A 1SB3C 2QKQA 3PO4A 5CHEA 3FAHA 9ICXA 5AM5A 2MUTB 3N7SC 1JXEA 2H3FA 1NK4A 4HAIA 4IQUA 4JV0A 3HJ4A 4F4WA 1X66A 4DQPA 3B0XA 3PW4A 1QQ6A 4CRXA 5AIAA 5DECA 2PFOA 4Y2RA 2B0CA 1X2IA 5A0LA 3BQTA 4O5KA 5KG3A 5KT3A 1ZJNA 2E5SA 4EYIB 2MRLA 9ICOA 5D61A 4MEYA 2ZH5A 2EANA 2P6RA 4ECYA 5IIJA 4FH3A 2BBHA 3IDWA 3MFIA 3GIMA 1L7NA 1Z1BA 9ICMA 1D8YA 3MR2A 3BS5B 2BQ3A 1NKCA 4C8KA 1LKYA 1T3QA 1JAJA 3AM9A 1NZBA 4F50A 5ALDA 3HIYA 1X42A 2ATLA 7ICPA 2E8NA 8ICCA 4UB4A 1S0NA 3FYHA 5IIKA 1A76A 4M6WA 2Y0SC 5AKYA 4R65A 4C8OA 4C8MA 2K89A 2ZG6A 5ALTA 3RB6A 2ZTDA 4UASA 4U6PA 4MFFA 3ISDA 5CEHA 3KHGA 4J9RA 4DFPA 1KSPA 4ED7A 3RJKA 1YLQA 2A1JA 2W43A 2KK0A 1S10A 2KKVA 4PH5A 2EQYA 5KFYA 5DBAA 4F71A 4YXMA 1SWWA 4X4TA 1QQ5A 7ICHA 3G6VA 1F0MA 3T3FA 3RJIA 2ZH4A 2W11A 5HC9A 3PMNA 5HP4A 2IUBA 3C29A 2F8KA 2WHEA 4IQVA 4NLKA 5ALMA 5J2DA 2E1EA 2ZIXB 4KLHA 2F1JA 4IQWA 1NI3A 4YG2A 2BCQA 8ICRA 3TAQA 2H3ZA 1ZQZA 3MCRA 2FLNA 2IMWP 4NXTA 3UMCA 1QQ7A 1B43A 4IRDA 1DGJA 4Y2TA 1UEVA 2MUTA 3ERCC 4I27A 4YCXA 4ED3A 2ZHAA 2RDIA 4KMOB 3JPNA 4JLZA 3L5KA 3PW5A 5ALFA 1NK9A 2YB1A 2PI5A 3CW2C 1VJ7A 5IINA 2HOQA 4RQMA 4YR0A 2EAMA 4DSIA 2OH2A 1SXDA 4BXOA 4TURA 1Z4OA 2F2AB 5JRTA 9ICWA 5ALJA 2NRVA 3SENA 4C0ZA 1MIVA 2PKEA 2AGPA 3OVBA 3UXPA 1ZQDA 3E0FA 4YMNA 1JROA 2FE9A 2Y1JA 1Q3VA 2XI9A 3PSIA 3C5FA 2H5XA 2PMZC 5L9XA 5B66U 5DBBA 2DUYA 2GH1A 5KTQA 2W04A 2HVHA 4Z6CA 4K96A 5J0XA 4AP9A 4QZAA 5HRIA 4EZ6A 2HBMA 4O3OA 4EX6A 4XQ8A 3ZDAA 2B56A 5L1KA 1V97A 4F8RA 1CEZA 4X4NA 3AMZA 4NY8A 8ICPA 5EE0A 4Y2XA 2DR5A 3MR3A 1OW5A 4N7RA 5ALVA 1HEKA 2ZJ5A 4BDPA 5D49A 1IV8A 2FPMA 3WK5A 5KG5A 5DDMA 2K4HA 5F3XB 2YMLA 2JEIA 1N62A 1ZD3A 2ASDA 2ESEA 4QIWF 2K4IA 4O5EA 2FMPA 3BQ7A 3D2SA 1SV0C 3GV8B 4ICAA 4JB3A 1JMSA 3LQCB 3GILA 4RPZA 3WK4A 3C2LA 2KVCA 4S3NA 1QSLA 9ICKA 2JEFA 3JPRA 5ALKA 5HHHA 3AUOA 2ZUDA 4Z6FA 4KLSA 2KFNA 1U49A 1NJYA 1BNPA 4EGWA 4Y2JA 4ACOA 7ICQA 4PHEA 3GV7B 4WCWA 3WFPA 4GFJA 1X40A 3K75D 5AKLA 2KSOB 4DL6A 2EZYA 2G0AA 4DQQA 5AKGA 4UB6U 4IRKA 4R64A 2XCAA 3V7KA 5J2CA 4BWMA 1ZQSA 3H8MA 2RHFA 4GXJA 5CFTA 2P66A 3CK6A 4J9MA 9ICTA 4F4XA 3H3AA 4F3OA 1KW4A 5AM4A 1Q79A 5KFBA 3KOOA 4F5PA 3RH6A 3RTVA 3RB3A 4Y2UA 2GA9D 8ICHA 4ATBA 3PV8A 1QTMA 4QZHA 1UQVA 2EZZA 2HSZA 2LMRA 3M8RA 3RRGA 3I1YA 4UD5A 4DF4A 3WK6A 1R8AA 5AKXA 5KFPA 5CFUA 4KMUA 1V4AA 3F2BA 3QYPA 1RG6A 2PFQA 2AU0A 2BCVA 3PX0A 1FFUA 9ICHA 3QUBA 1IXRA 3C2KA 4O68A 4RQNA 4KN4A 9ICLA 2DR8A 2K60A 4UBCA 1N56A 3U26A 3QEAZ 4NLGA 3G6XA 1VJ5A 4RWPA 2JRZA 2DKXA 1D8LA 3GFKB 4PHAA 5J2AA 1FO4A 2K4PA 3WKCA 4P4MA 4G9BA 4O6AA 1T4GA 1NK8A 2EAOA 1IIPA 1PK3A 7ICKA 2MSNA 2KG5A 3Q8RB 2GWSA 5HRDA 5KT2A 3KHRA 4FS1A 5B3QA 3KHLA 4RNNA 1DXSA 2EH9A 3RF9A 5G5GA 3ALRA 2BR0A 4LZDA 9ICNA 2W9MA 2OYYA 2ID1A 3UQ2A 3WKAA 4GXIA 2KMDA 2RP5A 2WF5A 7ICOA 4X4RA 5KT7A 2KSOA 1O08A 4UATA 5DQGA 1J97A 3SMVA 4KTQA 4AT9B 3OWGA 3UQ0A 3ZI4A 5AKIA 4GIBA 1UT8A 1FFVA 3NKUA 1XU4A 3QX7A 2JEGA 2MAXA 2D3DA 5J0SA 5TISU 4AT7A 4DSEA 2R8GA 4KX5A 5ALWA 4CF5A 4FHWA 2NRTA 2I1QA 2WF7A 2YMQA 2DRAA 2KZMA 4DEZA 3WFOA 1VFGA 8ICKA 4IR1A 4B9NA 4E7XA 5D4BA 1EXNA 3Q8SB 1Q3UA 3RB0A 3TI0A 4M04A 2A3VA 4OAIZ 4QZBA 3HKZC 5KAFU 4E8FA 5KG0A 1A77A 7ICVA 3PSFA 4IS7A 2IOHA 1T7PA 3ZD9A 5KFWA 2XGPA 4NL9A 2WAQF 5J0QA 4I2IA 2VANA 4C7YA 3SI8A 2JZBA 2KIWA 2DQNB 2AH5A 3NRWA 1Y88A 1B0XA 2HBKA 4J9SA 8ICXA 4K4HA 1MN8A 1ZQTA 3RJFA 2HHWA 4NJ8A 4X4UA 2ASLA 5IIMA 2ZTCA 4PGYA 7ICGA 3RAQA 4MKPA 1SV0A 3M6KA 2LYAA 2W03A 4IQTA 2VIXA 2BQUA 5HRHA 4KITB 4M9JA 2F8LA 3JPQA 3UXNA 3ISBA 1L3VA 2OHFA 4K4GA 2DGZA 1A6SA 4TQRA 1S5LU 3NGDA 4JWNA 2BKEA 2LI6A 3PX6A 4F91B 2ZIWA 2NRZA 3H0MB 1N48A 4ED6A 5E79U 2G5IB 4NXZA 4B9VA 3D6JA 2R8IA 2ISOA 4P0QB 3DEEA 4Y2QA 3BQ1A 4HYKA 4F5OA 2W8KA 1Q78A 2LPEA 5KG7A 4X5VA 3F2DA 4Y2PA 1SZPA 4LZGA 1V9PA 2VA2A 4E80A 4PL2A 1O03A 3THVA 3EF2A 4B9LA 2DR9A 3TQ1A 3G6YA 4UB5A 3VCBA 2XC9A 4IRCA 1ZQAA 5JTIA 3GIKA 2HI0A 1XWLA 3H8WA 4Y2YA 5DB8A 2NRXA 1QLNA 4F2RA 4C4SA 4OJOA 3N97B 4O3RA 3V72A 5F9LA 2LM1A 4ECWA 2OCEA 4DOAA 5HR9A 2ZH1A 1WCNA 4DSFA 4RWNA 3QU5A 2RLTA 1ZQCA 2UVUA 4QZEA 2G08A 5KFUA 2D8CA 1L7PA 5AI9A 2QB0B 4HX0A 5DG9A 4UAVA 1F5SA 1ZQBA 2HHQA 2WB1C 9ICEA 3N28A 3SZ2A 1NKEA 5AI6A 2G5HB 4NLBA 2IA6A 2BCRA 2G09A 4EEDA 4UAWA 2KIVA 3RR8A 3MABA 3C28A 1MA7A 5EWEA 1NK0A 3EUB2 2HHUA 5AHXA 1R8CA 2FI1A 2H3QA 4EBJA 1UPHA 4DSKA 4J9KA 3RH5A 1SV4A 3CP8A 1QSSA 1HIWA 4OJPA 1ZQYA 3F2CA 3QE9Y 4RT3A 3IN5A 5JTGA 4K97A 2KTQA 4KLJA 2HVIA 8ICAA 4UBBA 5ALHA 1ZQEA 3TKAA 4R63A 1X9MA 2OEHA 3RJGA 3ISCA 2V4RA 2ZIUA 4P4PA 4Y2VA 3ONNA 3H0LB 2DWQA 1BPYA 3FM9A 1QH9A 1LB2B 7ICUA 4RQ8A 4OAFA 3BQ2A 3HRDD 2HMXA 4QZ8A 3PR4A 3F5EA 2HBLA 1OXJA 2IBKA 2AHOB 4ED1A 4IG8A 1DGSA 5DB6A 4OJ6A 4GXKA 3QEBZ 5ALLA 4YMOA 4OJ5A 3KFUF 4WC3A 5L1LA 2QARB 2J6SA 4GC7A 3WK8A 2FDRA 2IHNA 2YMMA 4DL5A 1PVPA 4QZGA 3H0RB 4O3NA 1N5XA 3M1YA 1Z00B 5AI4A 4I0UA 3NVOA 4WC0A 2A1AA 3UXOA 4WC5A 8ICVA 4EBEA 1GPJA 1L3SA 3TARA 5HRGA 4QWEA 8ICUA 3H38A 1RQLA 4X4VA 3V7LA 3NYBA 3A0BU 4QWCA 4G3IA 3BQ0A 5D62A 2FMQA 3M9NB 3OHBA 3KBBA 3T5KA 4F5QA 3L9DA 5L1JA 4KLOA 4QZFA 4PGQA 3PW2A 4KN7A 4Q8EA 1WWVA 3RFAA 1SZHA 1ZQVA 2ZH7A 5ALNA 4FO6A 2K4EA 3AU6A 3NS1A 3RJJA 4X4OA 2EAPA 5KFEA 1NK5A 4FHVA 2PXIA 2KOBA 7ICRA 5KFGA 3OSNA 3MDAA 5DEDA 5ALOA 4KM5A 4DL7A 1GO3F 2LYHA 4IC9A 3Q8LA 1ZETA 1PK1B 9ICAA 1XS9D 3KTQA 2JHDA 5HRKA 5ALEA 3PNCA 4FHYA 1LV5A 2E8PA 3OVAA 3C1ZA 1CRXA 4YFKA 5JU5A 4UAYA 3MC1A 1KKXA 3OHAA 1JN3A 4O3SA 1PZNA 1WUDA 2UVVA 5AKJA 4O3MA 1T3NA 4RPXA 4I28A 2XGQA 4I2HA 5EWGA 1KFSA 4XJEA 2RRDA 5J2KA 3WU2U 4U7CA 4KLMA 3PMLA 4C7ZA 1N63A 2OM6A 1C20A 3EPGA 4EENA 1S0MA 1NJWA 2ISPA 4FZNA 4M9LA 3KKAA 4WC2A 3AQEA 1ZQNA 4WBYA 8ICLA 3BS5A 1DOQA 1SL1A 1DRGA 3SEIA 4ECZA 4DL2A 2KNJA 2GAFD 8ICBA 2UVRA 3WK7A 4RQ0A 1SL0A 4NL9C 2RDJA 5B5EU 1MIYA 2J6TA 5HREA 4XRHA 2WB1F 1RYUA 1U4BA 1NZPA 1ZQUA 3NRZA 2G07A 2B6GA 8ICSA 3O0FA 3TFRA 4DWIA 9ICUA 1KNYA 4UQGA 4NXWA 4JUZA 3H8JA 1D8BA 4BGDA 3UPSA 2I5HA 2H3IA 1KLNA 2XVTA 4FS2A 4Q45A 1KRPA 2GOLA 1X6IA 1C7YA 4ECRA 4FBUA 2F77X 3WFSC 1L7OA 1U47A 2JXJA 2RFFA 4F2SA 5J0WA 2FLLA 4DF8A 5L1MA 3NVYA 1YT3A 5J2FA 3C2MA 3QU4A 4ZH4A 2KEYA 3HW8A 4O3QA 1ZQWA 4YN4A 3LVWA 1PK1A 1TAQA 2ZIXA 1KN5A 3SAHA 5J0RA 3ZDEA 4EX7A 2B4VA 1SIJA 3MGHA 3DV9A 2BPCA 2LKYA 2E1FA 1TFRA 4PZNA 3RAXA 8ICNA 3C1YA 3I28A 1XNSA 3RJHA 3QUQA 4WC6A 5KFLA 4YMMA 4BJQA 2BCSA 1CUKA 3GQCA 2LM4A 1ZRMA 4KLLA 4NLNA 3T5JA 1UEUA 5AK3A 3GDXA 3MR6A 4AT8B 2PI4A 4WJ3B 1ZQLA 5KFAA 1CI4A 3OPXA 3K1RB 2IHMA 1BGXT 1BPZA 5AKEA 2C2DA 2FPLA 3N4MB 5DQHA 4P0PB 4K9BA 3WFQE 2DVIA 4DLGA 2N1RA 3HWTA 4UARA 2W9BB 1ZD4A 2ZIVB 1N5WA 5ALPA 2CRXA 2YMPA 5KFVA 3HPOA 5AIBA 1RM6C 2Y0SF 7ICMA 1AQ6A 4J03A 9ICGA 2Y1IA 4BX9C 3PSPA 5J2GA 3FDSA 2DL0A 3JPTA 4OD0A 5CB1A 1U9LA 4DS5A 3ZDCA 1QCKA 4CF4A 4QZDA 2BDUA 1MIWA 1ZQFA 3HX0A 4J9OA 8ICZA 2AJQA 8ICMA 4UB2A 4RNOA 4EZ9A 3ED5A 3PO5A 1ZQPA 4O0IA 4US9A 2YN4A 1ZD5A 3K7DA 4JLXA 1L5UA 5HRBA 1N60A 4RU9A 4EV6A 3JYYA 4NXVA 1D9FA 1X9SA 1F5AA 5AI0A 1NK6A 2FLPA 4M2YA 4DQSA 4EEKA 3AN1A 3TFSA 2VJ5A 2KE7A 2YQEA 9ICVA 5K4LA 5KAIU 2EZXA 2FJ6A 4FZMA 1KDHA 4MF8A 3GIJA 1ZOLA 4B9MA 4I29A 2W3RA 3ETLA 4I2BA 1WOTA 1SKRA 1S0OA 5AM1A 4R8UB 4F4KA 8ICTA 5AK5A 3UMBA 5KFMA 9ICRA 2PMZF 4RZRA 3OGUA 2W55A 2XICA 4UW9A 4I2GA 4WQLA 4OJLA 1LVHA 4EEYA 3SR6A 1ZQQA 5AM0A 2F44A 4O3PA 1TV9A 4M47A 2EDUA 2IOFA 1X6JA 2W9CB 8ICEA 3EW9A 3H40A 3SD7A 5L1IA 4Z6EA 3JPPA 3PW0A 2XO7A 5KT6A 2K8BB 3MGIA 4DQIA 5H2FU 3EYZA 4PPXA 3GU3A 1RXWA 1ZQXA 4AYBC 2JEJA 1Q46A 3TAPA 2BCUA 4QW8A 2NRWA 1BPEA 1A0PA 3LVVA 4DSJA 3HILA 4NWIA 3QZ7A 1ZQJA 2CN1A 3LYSA 1B22A 1ZD2P 5GTHU 3KHHA 5J2JA 4DS4A 5CR0A 1Z3EB 4YVZA 1D9DA 4LEYA 1ZRNA 2AXTU 3JZ0A 4DLEA 2JR5A 1K5OA 4UB1A 4ZOHC 3NASA 4F93B 4MFAA 3RJEA 2K8AA 2R8HA 4ECVA 4GC6A 1WWUA 2ODGA 1VDVA 7ICTA 4NLCA 1PVQA 1ZQ1C 2E3TA 1FA0A 5DBCA 5DKWA 4R66A 3JCFA 3PVXA 2O5AA 1RXVA 5J2IA 4AT9A 3DDHA 2YX8A 2GLEA 4KLEA 3MDCA 2WF8A 3LWMA 2ASJA 5DDYA 4XQ7A 4FHPA 1H38A 5HMMA 1ZQHA 5AKHA 3SV3A 5HR7A 2MU2A 5ALYA 1RPLA 3ZD8A 1K1QA 2JGAA 1NOMA 1Z4NA 4J9QA 2PBEA 2Q66A 1YZ7A 2ZXHA 5AI8A 4DCCA 4OAGA 4BUGA 3FC4A 4UB8U 2J6UA 1OU5A 3KKAC 2AQ4A 4I2EA 2ZUCA 1SXEA 2PFNA 3WKEA 3MFHA 2QLTA 5BOLA 1SL2A 3HP6A 4ED0A 5ALRA 3TANA 2JH7A 1QSYA 2DKZA 4YD1A 2ALZA 4RT2A 5KNIA 2YTUA 2F76X 5CP2A 1U45A 2B21A 3HJ1A 4US8A 1LKYB 1BPBA 3N7RC 1KFDA 2BDPA 2NRKA 1ZQOA 4TUSA 4F4YA 3ZDDA 3QU2A 3E2EA 3OUYB 4A8EA 5BPCA 4RUCA 5DGAA 3D2NA 4CF3A 2FCLA 5KG6A 2P6UA 1NKBA 2ZUBA 8ICWA 3WKBA 3KD3A 4K8VA 4IL6U 4ECUA 2A1JB 2M2TA 4M0AA 2V9WA 1S76D 1RYRA 1UT5A 3S6JA 1SKWA 4XUSA 4PJ0U 4P0QA 5D63A 1Z19A 4QIWC 2NO4A 5AM2A 2KD1A 4M9GA 2JH1A 4O5CA 4C8LA 4LT6A 1URJA 4NXXA 3M8SA 3B0YA 3OTQA 2Z7JA 4F5RA 3AU2A 3M9MB 1ZQMA 2ZH8A 1N2XA 4UB3A 1KBUA 3F5AA 3OJSA 3PZPA 2AGQA 4LEVA 2R18A 3H8SA 5ALQA 3I76A 2NO5A 5DG8A 3LDAA 4ELVA 1X9XA 1YZ6A 3L3FX 4NV0A 4BWJA 3IM1A 3Q8MA 3HKZF 4ECTA 2YB4A 3LK9A 4CGZA 4FZLA 1JRPA 3IV6A 2C28A 4K9AA 4WC4A 4FBTA 4MF2A 1L7MA 3MR5A 1SWVA 5KFCA 3EWAA 1XO0A 5KFZA 1L8OA 3C21A 4OAHA 5KT4A 4BXOB 2YY6A 3CNHA 5KT5A 1COOA 1V38A 4DL4A 3NVWA 1KQQA 5TZVA 2KHQA 1TK8A 3BJYA 7ICJA 4OO1J 4YD2A 2NYVA 5DGBA 1Q8KA 3F53A 2C2EA 5J0YA 2QB0A 1T8EA 8ICOA 4JWMA 2DF4B 3H39A 2F1HA 4GLXA 1RZTA 4AYBF 4RQ3A 4FHXA 2VA8A 1UCVA 4K99A 4F92B 4O9MA 2AGOA 4J9NA 4CNQA 2C2RA 1N61A 4TUPA 3OUYA 4ED8A 3RH4A 2W8LA 4QZIA 3AEVA 9ICBA 4WC7A 3T79A 1XSLA 5ALIA 3BZKA 4PL1A 1RDFA 1PVRA 1TAMA 2HHVA 3M7DA 2ZHBA 3IG8A 2M2VA 1XSNA 2ZH9A 4QWAA 3IRUA 3ICXA 1DK2A 4KB6A 3T5LA 2VKQA 4QWBA 1KFTA 3Q8QB 1U48A 4TQSA 5J0UA 3QNMA 3OV7A 1MQ2A 4DL3A 4EP7A 1ZQIA 3H4DA 1S8OA 1PX5A 5F2VO 2K8CB 1KEJA 3BDPA 4ECQA 1BPXA 5J8YC 2H3VA 4IR9A 4QNLA 3CYMA 3SYZA 4FFDA 3QZ8A 3HT3A 7ICNA 8ICJA 3SV4A 5C0YA 2QARA 3V6HA 2LBOA 5T14A 2M2UA 4C4RA 4X0BA 5KFDA 3AQMA 4Z6DA 4QWDA 5KFRA 8ICQA 4NKUA 1L6NA 5KFIA 4Q8FA 1NNLA 2WFAA 3D2QA 4KLQA 3AQFA 4RPYA 5JUMA 4RQ5A 1Z00A 3V7JA 3ORYA 3QU7A 5KL8B 3UM9A 3MBYA 4P2HA 4DSLA 5AM3A 2WF6A 4MHVA 1P7DA 4QW9A 2F3NA 1X9WA 4ECXA 2CXYA 5C5JA 4ATBB 2JV3A 2BBJA 4FE3A 2BE3A 4X4QA 2W3SA 2DFLA 2B51A 4F4ZA 4B6JA 5EWFA 2KJ5A 2DPIA 3BS7A 5HMLA 3WKDA 1TFYA 4Y2SA 2KZ3A 5D46A 5HNKA 4RQ7A 1HUOA 3H4BA 5AICA 2RQ5A 4PGXA 2Q4TA 3J81j 2KJ8A 3PR5B 1DK3A 2WAQC 4CE6A 4B9TA 2XCPA 9ICQA 2L5YA 2HDOA 1MSWD 3V6KA 2O1PA 1WYGA 4LEZA 3H37A 7ICFA 3A0HU 5J0OA 5ALZA 1XO1A 5HHIA 2QB1A 1L3UA 4J9PA 3NVVA 4O69A 3WK9A 4KLFA 2Y9TA 3TADC 1KTQA 2KHVA 1ZYQA 2LHTA 3R9KA 3GV5B 2V4QA 4JMUA 5CJ7A 2HHXA 2Y9UA 1M6YA 4NM2A 2KP7A 3NWIA 2M9NA 4I2FA 3C5GA 1B4FA 1MC8A 5ALGA 4I2AA 3K4GA 2G06A 4KX3A 2XY7A 4OCZA 5IILA 2XIDA 4DO9A 1JIHA 4UAZA 3N7PD 3JPSA 3NUQA 4ELUA 4B9SA 5IIIA 2VA3A 1NJXA 1TFWA 5EE9A 4MFCA 4RQ4A 5KL1B 1ZQRA 2KV2A 2IOFK 2O6KA 4DFDA 1R89A 5IIOA 5G5HA 2FPKA 5J2EA
chains in the Genus database with same CATH topology
5J2DA 5EWEA 1NK0A 5L1IA 4Z6EA 2F1JA 4KLHA 4IQWA 2HHUA 4RUAA 3JPPA 5J2HA 4YG2A 3PW0A 4AT7B 2XO7A 5KT6A 2BCQA 8ICRA 3TAQA 1R8CA 1ZQZA 4XA5A 3MGIA 4EYHB 4EBJA 4DSKA 4J9KA 3RH5A 2FLNA 2IMWP 3PY8A 1B43A 1QSSA 4DQIA 4IRDA 3EYZA 1ZQYA 4PPXA 3QE9Y 4RT3A 3Q8PB 1UEVA 1RXWA 1ZQXA 5HRLA 2JEJA 1TKDA 2MUTA 3TAPA 2BCUA 4QW8A 2KTQA 2NRWA 1TAUA 1BPEA 4I27A 4YCXA 5KFNA 4ED3A 4KLIA 4KLJA 2HVIA 8ICAA 2ZHAA 4UBBA 1ZQEA 2RDIA 4R63A 3JPNA 1X9MA 1RYSA 4DSJA 3RJGA 3ISCA 3PW5A 1NK9A 3QZ7A 2PI5A 4NM1A 1VJ7A 2V4RA 1ZQJA 2R8JA 2HHPA 5IINA 4P4PA 8ICYA 4UD4A 4KLTA 1BPYA 5CWRA 1B22A 1UETA 2BQRA 1LB2B 7ICUA 4RQ8A 4YR0A 3BQ2A 4TUQA 3KHHA 4QZ8A 4DSIA 5J2JA 4DS4A 4DQRA 2XY5A 5CR0A 3PR4A 2HW3A 1Z3EB 4YVZA 1D9DA 4BXOA 1JXLA 4TURA 3OVSA 2IBKA 3V6JA 9ICWA 4JK1A 3JZ0A 2NRVA 4DLEA 1JQRA 5J2BA 4UB1A 1MIVA 2JZBB 4ED1A 9ICCA 4F93B 4MFAA 2AGPA 3RJEA 9ICJA 4IG8A 1DGSA 3OVBA 5DB6A 1TK5A 2R8HA 3UXPA 4ECVA 4GC6A 1ZQDA 4YMNA 4GXKA 4WC1A 2DPJA 7ICTA 3QEBZ 2Y1JA 3C23A 4YMOA 4WC3A 5DB7A 5L1LA 1BPDA 5KG1A 1FA0A 5DBCA 2J6SA 5DKWA 2KZZA 4R66A 3C5FA 2H5XA 5L9XA 2M2WA 5F9NA 5DBBA 4RQ2A 3PVXA 1HUZA 5KTQA 5J0PA 1WCLA 4GC7A 2O5AA 1RXVA 5KG2A 4Z6CA 5J2IA 2HVHA 5J0XA 4AT9A 3NTUA 1S0VA 2IHNA 4DL5A 4QZAA 2BHNA 3MDCA 4QZGA 4E0DA 4KLEA 4EZ6A 2ZJAA 5HRIA 4O3NA 4O3OA 3LWMA 4XQ8A 2ASJA 3ZDAA 5L1KA 5DDYA 4F8RA 1JX4A 1CEZA 4XQ7A 4FHPA 4X4NA 1H38A 1Z00B 5HMMA 4NY8A 8ICPA 1ZQHA 3SV3A 2DR5A 4WC0A 3MR3A 3UXOA 2ZJ5A 4WC5A 1RPLA 3ZD8A 8ICVA 7ICIA 1K1QA 4EBEA 5D49A 4BDPA 1L3SA 2FPMA 1NOMA 5KG5A 4J9QA 2AQ0A 3TARA 5HRGA 5DDMA 4QWEA 8ICUA 3H38A 1BNOA 2PBEA 2JEIA 3V7LA 4X4VA 2Q66A 3NYBA 5DLFA 4QWCA 2ASDA 5KFSA 4DOCA 4JV2A 4G3IA 1K1SA 3BQ0A 1TK0A 2FMQA 4O5EA 3M9NB 2FMPA 4RWOA 3OHBA 3T5KA 4F5QA 3GV8B 3LQCB 1JMSA 5KFFA 3L9DA 4KLDA 5BOMA 5L1JA 3GILA 4QZFA 4RPZA 2J6UA 4KLOA 2XY6A 3OSPA 1OU5A 4PGQA 3C2LA 3PW2A 2AQ4A 4I2EA 4KN7A 2ZUCA 4S3NA 1QSLA 2PFNA 2JEFA 3JPRA 3AUOA 5HHHA 4Q8EA 1S77D 1ZQVA 2ZUDA 4Z6FA 4KLSA 4I2JA 3MFHA 2KFNA 2ZH7A 4FO6A 5BOLA 1SL2A 1U49A 1NJYA 1BNPA 3AU6A 3HP6A 4ED0A 7ICQA 4PHEA 3GV7B 4WCWA 3TANA 1QSYA 3RJJA 3WFPA 4YD1A 4X0AA 4X4OA 3K75D 4DL6A 2ALZA 5KFEA 1NK5A 4RT2A 4DQQA 2PXIA 4DFMA 4DFKA 4FHVA 4IRKA 7ICRA 3RR7A 5KFGA 5CP2A 3RBDA 1U45A 1NJZA 2B21A 4R64A 3OSNA 3HJ1A 5HRFA 2XCAA 4Q44A 5EOZA 1BPBA 3MDAA 3EPIA 2W9BA 1KFDA 1IM4A 1XC9A 5DEDA 3V7KA 5J2CA 4BWMA 2BDPA 1ZQSA 4DL7A 2NRKA 1ZQOA 2LYHA 4M5DA 4TUSA 4F4YA 1L3TA 3ZDDA 3Q8LA 3WFRE 4GXJA 1ZETA 9ICAA 1XS9D 1UA0A 3E2EA 2P66A 3OUYB 3KTQA 5BPCA 4J9MA 1S97A 4B9UA 9ICTA 4RUCA 4F4XA 5DGAA 5HRKA 3UPQA 3PNCA 4FHYA 3H3AA 4F3OA 2HHTA 5KG6A 2P6UA 1NKBA 3C1ZA 1BVSA 1LV5A 2ZUBA 4YFKA 9ICLA 3AQNA 3OVAA 8ICWA 1NO5A 3RRHA 5KFBA 4RQ6A 1Q79A 4X4SA 1MQ3A 4F5PA 4UAYA 3RH6A 3RTVA 3RB3A 3ZDBA 8ICIA 3OHAA 4CCHA 1JN3A 2DR7A 2ZTEA 4ECUA 4O3SA 1PZNA 8ICHA 9ICFA 2A1JB 4ATBA 3PV8A 1QTMA 2M2TA 4QZHA 4YQWA 4M0AA 2V9WA 4WBZA 1S76D 2UVVA 1RYRA 1T3NA 1UT5A 5KFTA 4NKTA 1SKWA 4XUSA 4RPXA 2ZH2A 4I28A 3M8RA 2XGQA 3RRGA 4I2HA 4UD5A 4DF4A 1R8AA 5EWGA 1KFSA 4M9GA 4RWQA 4YXJA 5KFPA 4O5CA 5J2KA 2R8KA 4YR2A 4KMUA 4C8LA 9ICKA 5DQIA 1NK7A 9ICPA 1V4AA 4FH5A 4LT6A 4EBKA 4KLMA 3PMLA 3M8SA 2AU0A 3B0YA 2BCVA 3PX0A 2PFQA 4K4IA 2PFPA 9ICHA 3EPGA 4F5RA 2BGWA 3AU2A 5CHGA 3M9MB 1S0MA 4LVSA 3IHQB 1ZQMA 1IXRA 3C2KA 1NJWA 2ISPA 2ZH8A 4UB3A 4I2DA 4KN4A 4M9LA 2AGQA 4YR3A 4UBCA 3OJSA 2KFZA 1N56A 3QEAZ 1HJPA 3H8SA 3EZ5A 3G6XA 1ZQNA 4NLGA 8ICGA 8ICLA 4WBYA 1TVAA 5DG8A 1DOQA 1SL1A 3LDAA 4ELVA 4RWPA 4ECZA 1D8LA 4DL2A 3GFKB 4BWJA 4PHAA 5J2AA 2FMSA 8ICBA 2ZH6A 3IM1A 2UVRA 3Q8MA 1ZQGA 4ECTA 2W9AA 4P4MA 9ICSA 3LK9A 4RQ0A 1SL0A 1T4GA 3RB4A 4C8NA 1NK8A 2C28A 5KFQA 2RDJA 7ICKA 4WC4A 4FBTA 1MIYA 4PHDA 2J6TA 4MF2A 5HREA 5KFOA 4XRHA 5KFCA 3MR5A 1U4BA 1NZPA 3EWAA 4EBCA 1ZQUA 4ED2A 1S9FA 3AQKA 3Q8RB 5KFZA 2GWSA 3C21A 5KT4A 5KT2A 4YP3A 3KHRA 4FS1A 3TFRA 3KHLA 4BXOB 4DWIA 4UQGA 8ICSA 9ICUA 1KNYA 4JUZA 4RNNA 3H8JA 2HHSA 4AT8A 5KT5A 4BGDA 3UPSA 1COOA 4DL4A 1KLNA 5TZVA 4R8UA 5KFJA 4FS2A 2BR0A 4LZDA 1TK8A 4Q45A 9ICNA 5HRDA 3BJYA 2W9MA 1KRPA 3AQLA 7ICJA 4J9LA 2ID1A 1C7YA 4X4PA 3UQ2A 4GXIA 4YD2A 3LWLA 4ECRA 5DGBA 7ICSA 4FBUA 7ICOA 2C2EA 5J0YA 2ZJ8A 1T8EA 8ICOA 4JWMA 3H39A 2KN7A 2F1HA 5KT7A 3PW7A 1U47A 4X4RA 3WFSC 5J0TA 4GLXA 2RFFA 1RZTA 3C18A 4RQ3A 5DQGA 5J0WA 2FLLA 4DF8A 4F2SA 4FHXA 2VA8A 4Q43A 4F92B 7ICEA 4KTQA 4AT9B 1ZQKA 4O9MA 3UQ0A 4P4OA 4RQ1A 2AGOA 5J2FA 4RNMA 1S0NA 4J9NA 3C2MA 2C2RA 1UT8A 3JPOA 2W9CA 3T5HA 4ZH4A 3HW8A 4O3QA 1ZQWA 1XSPA 4YN4A 2DRBA 1XU4A 4TUPA 2JEGA 1TAQA 3OUYA 2MAXA 4ED8A 5J0SA 3RH4A 4M9HA 4AT7A 5J0RA 3ZDEA 4DSEA 2R8GA 3MGHA 2W8LA 4QZIA 2BPCA 4FHWA 2NRTA 9ICBA 4WC7A 2I1QA 2DRAA 2KZMA 1TFRA 4DEZA 1XSLA 3Q8KA 1AROP 4ELTA 3RAXA 5KFHA 1ZJMA 8ICNA 8ICKA 3WFOA 1VFGA 4IR1A 4B9NA 3C1YA 4E7XA 5DB9A 3RJHA 5D4BA 1EXNA 3H7IA 2HHVA 4WC6A 5KFLA 3Q8SB 2ZHBA 2M2VA 3RB0A 3TI0A 1XSNA 4YMMA 4M04A 2ZH9A 4QWAA 4QZBA 2BCSA 1CUKA 2C22A 4JV1A 4E8FA 1DK2A 3RBEA 4NLZA 3T5LA 4QWBA 5KG0A 1SKSA 3Q8QB 3OJUA 3GIIA 4PHPA 4ECSA 1KFTA 9ICIA 1A77A 7ICVA 3GQCA 4M6WB 1U48A 4KLUA 3M9OB 4TQSA 5J29A 5J0UA 3OV7A 4KLLA 1MQ2A 1T7PA 3ZD9A 4NLNA 4QZCA 5KFWA 1UA1A 4DL3A 3T5JA 2XGPA 4EP7A 1UEUA 3GDXA 1ZQIA 3MR6A 4AT8B 5J0QA 2Q0ZX 3H4DA 2PI4A 4I2IA 1PX5A 5F2VO 1KEJA 2VANA 1ZQLA 3SI8A 2JZBA 5KFAA 2I9GA 3BDPA 4ECQA 2IHMA 4DFJA 1BPXA 1BGXT 4IR9A 1BPZA 2C2DA 2FPLA 3QZ8A 1Y88A 3SYZA 5KFKA 4KLGA 3HT3A 4DOBA 3N4MB 5DQHA 4J9SA 7ICNA 5DLGA 2F1IA 8ICJA 8ICXA 3SV4A 3WFQE 3V6HA 4K4HA 1ZQTA 3RJFA 2HHWA 1R8BA 2DR8A 5KFXA 2DVIA 4DLGA 2ASLA 2M2UA 5CA7A 4X4UA 4I2CA 3HWTA 5IIMA 8ICFA 2W9BB 4X0BA 5KFDA 3AQMA 2ZTCA 4Z6DA 4PGYA 5KFRA 4QWDA 2OWOA 3RAQA 7ICGA 8ICQA 5KFIA 4Q8FA 4NKUA 3PX4A 4M9NA 4F5NA 5KFVA 3HPOA 4QZ9A 2BPFA 5DG7A 4EBDA 7ICLA 4KLQA 2UVWA 4MEXA 4RPYA 5JUMA 4RQ5A 7ICMA 2WTFA 4IQTA 2BQUA 1Z00A 9ICGA 5KG4A 4KITB 2Y1IA 5HRHA 3V7JA 3JPQA 4M9JA 3ORYA 3UXNA 3ISBA 1L3VA 2BPGA 2ZH3A 5J2GA 4K4GA 3MBYA 3PO4A 3FDSA 4TQRA 4NLKA 4P2HA 9ICXA 3NGDA 4DSLA 4JWNA 3JPTA 2MUTB 2BKEA 1JXEA 4QW9A 5CB1A 1U9LA 1NK4A 4IQUA 4JV0A 3PX6A 3HJ4A 4F4WA 4F91B 1X9WA 4ECXA 4DS5A 3ZDCA 4DQPA 2NRZA 3B0XA 5C5JA 1N48A 4ED6A 4ATBB 3PW4A 2BE3A 4QZDA 4X4QA 4NXZA 4B9VA 1MIWA 2DFLA 1ZQFA 2PFOA 5DECA 2R8IA 2ISOA 3HX0A 4F4ZA 5EWFA 4J9OA 1X2IA 2AJQA 8ICZA 2DPIA 5HMLA 3BQTA 1TFYA 3BQ1A 8ICMA 2KZ3A 5D46A 5HNKA 4HYKA 4F5OA 4RQ7A 4UB2A 4O5KA 5KG3A 1HUOA 5KT3A 1ZJNA 4RNOA 2W8KA 4EZ9A 1Q78A 3H4BA 5KG7A 4EYIB 9ICOA 4PGXA 4X5VA 3PO5A 1ZQPA 4MEYA 1SZPA 2ZH5A 4O0IA 3PR5B 2P6RA 4B9TA 4LZGA 9ICQA 2XCPA 4ECYA 1DK3A 5IIJA 1MSWD 1V9PA 4FH3A 1L5UA 2VA2A 4E80A 5HRBA 3V6KA 3THVA 2O1PA 4RU9A 4B9LA 2DR9A 3MFIA 3TQ1A 3GIMA 9ICMA 3G6YA 1D9FA 3JYYA 4UB5A 1D8YA 3H37A 2XC9A 3MR2A 7ICFA 5J0OA 1XO1A 5HHIA 2BQ3A 1X9SA 1NKCA 1ZQAA 4IRCA 1F5AA 4WC2A 1L3UA 4C8KA 4J9PA 3GIKA 1NK6A 2FLPA 4M2YA 4KLFA 1JAJA 4DQSA 1XWLA 3H8WA 5DB8A 3TFSA 2NRXA 1KTQA 1QLNA 4F50A 1ZYQA 3GV5B 2V4QA 4F2RA 5CJ7A 2HHXA 3HIYA 9ICVA 3N97B 4O3RA 3V72A 4NM2A 2ATLA 5F9LA 1KDHA 7ICPA 2KP7A 8ICCA 4UB4A 4MF8A 3FYHA 2M9NA 3GIJA 5IIKA 4ECWA 1A76A 4DOAA 4M6WA 4B9MA 4I29A 5HR9A 3ETLA 4I2FA 3C5GA 4R65A 2ZH1A 4I2BA 4C8OA 1WCNA 4C8MA 1WOTA 1SKRA 4DSFA 3RB6A 4RWNA 1MC8A 2ZTDA 3C66A 4I2AA 1S0OA 4MFFA 3K4GA 3ISDA 1ZQCA 2UVUA 4R8UB 2XY7A 4F4KA 8ICTA 3KHGA 5IILA 4J9RA 4QZEA 4DO9A 4DFPA 1KSPA 4ED7A 3RJKA 1JIHA 4UAZA 1YLQA 5KFUA 2A1JA 3JPSA 4ELUA 1S10A 4B9SA 5IIIA 5KFMA 5DG9A 9ICRA 4RZRA 3OGUA 4PH5A 2VA3A 1NJXA 4I2GA 1TFWA 5KFYA 5DBAA 1ZQBA 4YXMA 2HHQA 9ICEA 4MFCA 4EEYA 4RQ4A 3SZ2A 1ZQQA 1NKEA 4X4TA 7ICHA 4O3PA 3G6VA 1TV9A 1ZQRA 3T3FA 2IA6A 3RJIA 4M47A 2ZH4A 2BCRA 4UAWA 1R89A 2W9CB 3MABA 3EW9A 5IIOA 3H40A 3PMNA 5HP4A 3RR8A 8ICEA 5HC9A 4IQVA 2FPKA 5J2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2D A;  5EWE A;  1NK0 A;  5L1I A;  4Z6E A;  2F1J A;  4KLH A;  4IQW A;  2HHU A;  4RUA A;  3JPP A;  5J2H A;  4YG2 A;  3PW0 A;  4AT7 B;  2XO7 A;  5KT6 A;  2BCQ A;  8ICR A;  3TAQ A;  1R8C A;  1ZQZ A;  4XA5 A;  3MGI A;  4EYH B;  4EBJ A;  4DSK A;  4J9K A;  3RH5 A;  2FLN A;  2IMW P;  3PY8 A;  1B43 A;  1QSS A;  4DQI A;  4IRD A;  3EYZ A;  1ZQY A;  4PPX A;  3QE9 Y;  4RT3 A;  3Q8P B;  1UEV A;  1RXW A;  1ZQX A;  5HRL A;  2JEJ A;  1TKD A;  2MUT A;  3TAP A;  2BCU A;  4QW8 A;  2KTQ A;  2NRW A;  1TAU A;  1BPE A;  4I27 A;  4YCX A;  5KFN A;  4ED3 A;  4KLI A;  4KLJ A;  2HVI A;  8ICA A;  2ZHA A;  4UBB A;  1ZQE A;  2RDI A;  4R63 A;  3JPN A;  1X9M A;  1RYS A;  4DSJ A;  3RJG A;  3ISC A;  3PW5 A;  1NK9 A;  3QZ7 A;  2PI5 A;  4NM1 A;  1VJ7 A;  2V4R A;  1ZQJ A;  2R8J A;  2HHP A;  5IIN A;  4P4P A;  8ICY A;  4UD4 A;  4KLT A;  1BPY A;  5CWR A;  1B22 A;  1UET A;  2BQR A;  1LB2 B;  7ICU A;  4RQ8 A;  4YR0 A;  3BQ2 A;  4TUQ A;  3KHH A;  4QZ8 A;  4DSI A;  5J2J A;  4DS4 A;  4DQR A;  2XY5 A;  5CR0 A;  3PR4 A;  2HW3 A;  1Z3E B;  4YVZ A;  1D9D A;  4BXO A;  1JXL A;  4TUR A;  3OVS A;  2IBK A;  3V6J A;  9ICW A;  4JK1 A;  3JZ0 A;  2NRV A;  4DLE A;  1JQR A;  5J2B A;  4UB1 A;  1MIV A;  2JZB B;  4ED1 A;  9ICC A;  4F93 B;  4MFA A;  2AGP A;  3RJE A;  9ICJ A;  4IG8 A;  1DGS A;  3OVB A;  5DB6 A;  1TK5 A;  2R8H A;  3UXP A;  4ECV A;  4GC6 A;  1ZQD A;  4YMN A;  4GXK A;  4WC1 A;  2DPJ A;  7ICT A;  3QEB Z;  2Y1J A;  3C23 A;  4YMO A;  4WC3 A;  5DB7 A;  5L1L A;  1BPD A;  5KG1 A;  1FA0 A;  5DBC A;  2J6S A;  5DKW A;  2KZZ A;  4R66 A;  3C5F A;  2H5X A;  5L9X A;  2M2W A;  5F9N A;  5DBB A;  4RQ2 A;  3PVX A;  1HUZ A;  5KTQ A;  5J0P A;  1WCL A;  4GC7 A;  2O5A A;  1RXV A;  5KG2 A;  4Z6C A;  5J2I A;  2HVH A;  5J0X A;  4AT9 A;  3NTU A;  1S0V A;  2IHN A;  4DL5 A;  4QZA A;  2BHN A;  3MDC A;  4QZG A;  4E0D A;  4KLE A;  4EZ6 A;  2ZJA A;  5HRI A;  4O3N A;  4O3O A;  3LWM A;  4XQ8 A;  2ASJ A;  3ZDA A;  5L1K A;  5DDY A;  4F8R A;  1JX4 A;  1CEZ A;  4XQ7 A;  4FHP A;  4X4N A;  1H38 A;  1Z00 B;  5HMM A;  4NY8 A;  8ICP A;  1ZQH A;  3SV3 A;  2DR5 A;  4WC0 A;  3MR3 A;  3UXO A;  2ZJ5 A;  4WC5 A;  1RPL A;  3ZD8 A;  8ICV A;  7ICI A;  1K1Q A;  4EBE A;  5D49 A;  4BDP A;  1L3S A;  2FPM A;  1NOM A;  5KG5 A;  4J9Q A;  2AQ0 A;  3TAR A;  5HRG A;  5DDM A;  4QWE A;  8ICU A;  3H38 A;  1BNO A;  2PBE A;  2JEI A;  3V7L A;  4X4V A;  2Q66 A;  3NYB A;  5DLF A;  4QWC A;  2ASD A;  5KFS A;  4DOC A;  4JV2 A;  4G3I A;  1K1S A;  3BQ0 A;  1TK0 A;  2FMQ A;  4O5E A;  3M9N B;  2FMP A;  4RWO A;  3OHB A;  3T5K A;  4F5Q A;  3GV8 B;  3LQC B;  1JMS A;  5KFF A;  3L9D A;  4KLD A;  5BOM A;  5L1J A;  3GIL A;  4QZF A;  4RPZ A;  2J6U A;  4KLO A;  2XY6 A;  3OSP A;  1OU5 A;  4PGQ A;  3C2L A;  3PW2 A;  2AQ4 A;  4I2E A;  4KN7 A;  2ZUC A;  4S3N A;  1QSL A;  2PFN A;  2JEF A;  3JPR A;  3AUO A;  5HHH A;  4Q8E A;  1S77 D;  1ZQV A;  2ZUD A;  4Z6F A;  4KLS A;  4I2J A;  3MFH A;  2KFN A;  2ZH7 A;  4FO6 A;  5BOL A;  1SL2 A;  1U49 A;  1NJY A;  1BNP A;  3AU6 A;  3HP6 A;  4ED0 A;  7ICQ A;  4PHE A;  3GV7 B;  4WCW A;  3TAN A;  1QSY A;  3RJJ A;  3WFP A;  4YD1 A;  4X0A A;  4X4O A;  3K75 D;  4DL6 A;  2ALZ A;  5KFE A;  1NK5 A;  4RT2 A;  4DQQ A;  2PXI A;  4DFM A;  4DFK A;  4FHV A;  4IRK A;  7ICR A;  3RR7 A;  5KFG A;  5CP2 A;  3RBD A;  1U45 A;  1NJZ A;  2B21 A;  4R64 A;  3OSN A;  3HJ1 A;  5HRF A;  2XCA A;  4Q44 A;  5EOZ A;  1BPB A;  3MDA A;  3EPI A;  2W9B A;  1KFD A;  1IM4 A;  1XC9 A;  5DED A;  3V7K A;  5J2C A;  4BWM A;  2BDP A;  1ZQS A;  4DL7 A;  2NRK A;  1ZQO A;  2LYH A;  4M5D A;  4TUS A;  4F4Y A;  1L3T A;  3ZDD A;  3Q8L A;  3WFR E;  4GXJ A;  1ZET A;  9ICA A;  1XS9 D;  1UA0 A;  3E2E A;  2P66 A;  3OUY B;  3KTQ A;  5BPC A;  4J9M A;  1S97 A;  4B9U A;  9ICT A;  4RUC A;  4F4X A;  5DGA A;  5HRK A;  3UPQ A;  3PNC A;  4FHY A;  3H3A A;  4F3O A;  2HHT A;  5KG6 A;  2P6U A;  1NKB A;  3C1Z A;  1BVS A;  1LV5 A;  2ZUB A;  4YFK A;  9ICL A;  3AQN A;  3OVA A;  8ICW A;  1NO5 A;  3RRH A;  5KFB A;  4RQ6 A;  1Q79 A;  4X4S A;  1MQ3 A;  4F5P A;  4UAY A;  3RH6 A;  3RTV A;  3RB3 A;  3ZDB A;  8ICI A;  3OHA A;  4CCH A;  1JN3 A;  2DR7 A;  2ZTE A;  4ECU A;  4O3S A;  1PZN A;  8ICH A;  9ICF A;  2A1J B;  4ATB A;  3PV8 A;  1QTM A;  2M2T A;  4QZH A;  4YQW A;  4M0A A;  2V9W A;  4WBZ A;  1S76 D;  2UVV A;  1RYR A;  1T3N A;  1UT5 A;  5KFT A;  4NKT A;  1SKW A;  4XUS A;  4RPX A;  2ZH2 A;  4I28 A;  3M8R A;  2XGQ A;  3RRG A;  4I2H A;  4UD5 A;  4DF4 A;  1R8A A;  5EWG A;  1KFS A;  4M9G A;  4RWQ A;  4YXJ A;  5KFP A;  4O5C A;  5J2K A;  2R8K A;  4YR2 A;  4KMU A;  4C8L A;  9ICK A;  5DQI A;  1NK7 A;  9ICP A;  1V4A A;  4FH5 A;  4LT6 A;  4EBK A;  4KLM A;  3PML A;  3M8S A;  2AU0 A;  3B0Y A;  2BCV A;  3PX0 A;  2PFQ A;  4K4I A;  2PFP A;  9ICH A;  3EPG A;  4F5R A;  2BGW A;  3AU2 A;  5CHG A;  3M9M B;  1S0M A;  4LVS A;  3IHQ B;  1ZQM A;  1IXR A;  3C2K A;  1NJW A;  2ISP A;  2ZH8 A;  4UB3 A;  4I2D A;  4KN4 A;  4M9L A;  2AGQ A;  4YR3 A;  4UBC A;  3OJS A;  2KFZ A;  1N56 A;  3QEA Z;  1HJP A;  3H8S A;  3EZ5 A;  3G6X A;  1ZQN A;  4NLG A;  8ICG A;  8ICL A;  4WBY A;  1TVA A;  5DG8 A;  1DOQ A;  1SL1 A;  3LDA A;  4ELV A;  4RWP A;  4ECZ A;  1D8L A;  4DL2 A;  3GFK B;  4BWJ A;  4PHA A;  5J2A A;  2FMS A;  8ICB A;  2ZH6 A;  3IM1 A;  2UVR A;  3Q8M A;  1ZQG A;  4ECT A;  2W9A A;  4P4M A;  9ICS A;  3LK9 A;  4RQ0 A;  1SL0 A;  1T4G A;  3RB4 A;  4C8N A;  1NK8 A;  2C28 A;  5KFQ A;  2RDJ A;  7ICK A;  4WC4 A;  4FBT A;  1MIY A;  4PHD A;  2J6T A;  4MF2 A;  5HRE A;  5KFO A;  4XRH A;  5KFC A;  3MR5 A;  1U4B A;  1NZP A;  3EWA A;  4EBC A;  1ZQU A;  4ED2 A;  1S9F A;  3AQK A;  3Q8R B;  5KFZ A;  2GWS A;  3C21 A;  5KT4 A;  5KT2 A;  4YP3 A;  3KHR A;  4FS1 A;  3TFR A;  3KHL A;  4BXO B;  4DWI A;  4UQG A;  8ICS A;  9ICU A;  1KNY A;  4JUZ A;  4RNN A;  3H8J A;  2HHS A;  4AT8 A;  5KT5 A;  4BGD A;  3UPS A;  1COO A;  4DL4 A;  1KLN A;  5TZV A;  4R8U A;  5KFJ A;  4FS2 A;  2BR0 A;  4LZD A;  1TK8 A;  4Q45 A;  9ICN A;  5HRD A;  3BJY A;  2W9M A;  1KRP A;  3AQL A;  7ICJ A;  4J9L A;  2ID1 A;  1C7Y A;  4X4P A;  3UQ2 A;  4GXI A;  4YD2 A;  3LWL A;  4ECR A;  5DGB A;  7ICS A;  4FBU A;  7ICO A;  2C2E A;  5J0Y A;  2ZJ8 A;  1T8E A;  8ICO A;  4JWM A;  3H39 A;  2KN7 A;  2F1H A;  5KT7 A;  3PW7 A;  1U47 A;  4X4R A;  3WFS C;  5J0T A;  4GLX A;  2RFF A;  1RZT A;  3C18 A;  4RQ3 A;  5DQG A;  5J0W A;  2FLL A;  4DF8 A;  4F2S A;  4FHX A;  2VA8 A;  4Q43 A;  4F92 B;  7ICE A;  4KTQ A;  4AT9 B;  1ZQK A;  4O9M A;  3UQ0 A;  4P4O A;  4RQ1 A;  2AGO A;  5J2F A;  4RNM A;  1S0N A;  4J9N A;  3C2M A;  2C2R A;  1UT8 A;  3JPO A;  2W9C A;  3T5H A;  4ZH4 A;  3HW8 A;  4O3Q A;  1ZQW A;  1XSP A;  4YN4 A;  2DRB A;  1XU4 A;  4TUP A;  2JEG A;  1TAQ A;  3OUY A;  2MAX A;  4ED8 A;  5J0S A;  3RH4 A;  4M9H A;  4AT7 A;  5J0R A;  3ZDE A;  4DSE A;  2R8G A;  3MGH A;  2W8L A;  4QZI A;  2BPC A;  4FHW A;  2NRT A;  9ICB A;  4WC7 A;  2I1Q A;  2DRA A;  2KZM A;  1TFR A;  4DEZ A;  1XSL A;  3Q8K A;  1ARO P;  4ELT A;  3RAX A;  5KFH A;  1ZJM A;  8ICN A;  8ICK A;  3WFO A;  1VFG A;  4IR1 A;  4B9N A;  3C1Y A;  4E7X A;  5DB9 A;  3RJH A;  5D4B A;  1EXN A;  3H7I A;  2HHV A;  4WC6 A;  5KFL A;  3Q8S B;  2ZHB A;  2M2V A;  3RB0 A;  3TI0 A;  1XSN A;  4YMM A;  4M04 A;  2ZH9 A;  4QWA A;  4QZB A;  2BCS A;  1CUK A;  2C22 A;  4JV1 A;  4E8F A;  1DK2 A;  3RBE A;  4NLZ A;  3T5L A;  4QWB A;  5KG0 A;  1SKS A;  3Q8Q B;  3OJU A;  3GII A;  4PHP A;  4ECS A;  1KFT A;  9ICI A;  1A77 A;  7ICV A;  3GQC A;  4M6W B;  1U48 A;  4KLU A;  3M9O B;  4TQS A;  5J29 A;  5J0U A;  3OV7 A;  4KLL A;  1MQ2 A;  1T7P A;  3ZD9 A;  4NLN A;  4QZC A;  5KFW A;  1UA1 A;  4DL3 A;  3T5J A;  2XGP A;  4EP7 A;  1UEU A;  3GDX A;  1ZQI A;  3MR6 A;  4AT8 B;  5J0Q A;  2Q0Z X;  3H4D A;  2PI4 A;  4I2I A;  1PX5 A;  5F2V O;  1KEJ A;  2VAN A;  1ZQL A;  3SI8 A;  2JZB A;  5KFA A;  2I9G A;  3BDP A;  4ECQ A;  2IHM A;  4DFJ A;  1BPX A;  1BGX T;  4IR9 A;  1BPZ A;  2C2D A;  2FPL A;  3QZ8 A;  1Y88 A;  3SYZ A;  5KFK A;  4KLG A;  3HT3 A;  4DOB A;  3N4M B;  5DQH A;  4J9S A;  7ICN A;  5DLG A;  2F1I A;  8ICJ A;  8ICX A;  3SV4 A;  3WFQ E;  3V6H A;  4K4H A;  1ZQT A;  3RJF A;  2HHW A;  1R8B A;  2DR8 A;  5KFX A;  2DVI A;  4DLG A;  2ASL A;  2M2U A;  5CA7 A;  4X4U A;  4I2C A;  3HWT A;  5IIM A;  8ICF A;  2W9B B;  4X0B A;  5KFD A;  3AQM A;  2ZTC A;  4Z6D A;  4PGY A;  5KFR A;  4QWD A;  2OWO A;  3RAQ A;  7ICG A;  8ICQ A;  5KFI A;  4Q8F A;  4NKU A;  3PX4 A;  4M9N A;  4F5N A;  5KFV A;  3HPO A;  4QZ9 A;  2BPF A;  5DG7 A;  4EBD A;  7ICL A;  4KLQ A;  2UVW A;  4MEX A;  4RPY A;  5JUM A;  4RQ5 A;  7ICM A;  2WTF A;  4IQT A;  2BQU A;  1Z00 A;  9ICG A;  5KG4 A;  4KIT B;  2Y1I A;  5HRH A;  3V7J A;  3JPQ A;  4M9J A;  3ORY A;  3UXN A;  3ISB A;  1L3V A;  2BPG A;  2ZH3 A;  5J2G A;  4K4G A;  3MBY A;  3PO4 A;  3FDS A;  4TQR A;  4NLK A;  4P2H A;  9ICX A;  3NGD A;  4DSL A;  4JWN A;  3JPT A;  2MUT B;  2BKE A;  1JXE A;  4QW9 A;  5CB1 A;  1U9L A;  1NK4 A;  4IQU A;  4JV0 A;  3PX6 A;  3HJ4 A;  4F4W A;  4F91 B;  1X9W A;  4ECX A;  4DS5 A;  3ZDC A;  4DQP A;  2NRZ A;  3B0X A;  5C5J A;  1N48 A;  4ED6 A;  4ATB B;  3PW4 A;  2BE3 A;  4QZD A;  4X4Q A;  4NXZ A;  4B9V A;  1MIW A;  2DFL A;  1ZQF A;  2PFO A;  5DEC A;  2R8I A;  2ISO A;  3HX0 A;  4F4Z A;  5EWF A;  4J9O A;  1X2I A;  2AJQ A;  8ICZ A;  2DPI A;  5HML A;  3BQT A;  1TFY A;  3BQ1 A;  8ICM A;  2KZ3 A;  5D46 A;  5HNK A;  4HYK A;  4F5O A;  4RQ7 A;  4UB2 A;  4O5K A;  5KG3 A;  1HUO A;  5KT3 A;  1ZJN A;  4RNO A;  2W8K A;  4EZ9 A;  1Q78 A;  3H4B A;  5KG7 A;  4EYI B;  9ICO A;  4PGX A;  4X5V A;  3PO5 A;  1ZQP A;  4MEY A;  1SZP A;  2ZH5 A;  4O0I A;  3PR5 B;  2P6R A;  4B9T A;  4LZG A;  9ICQ A;  2XCP A;  4ECY A;  1DK3 A;  5IIJ A;  1MSW D;  1V9P A;  4FH3 A;  1L5U A;  2VA2 A;  4E80 A;  5HRB A;  3V6K A;  3THV A;  2O1P A;  4RU9 A;  4B9L A;  2DR9 A;  3MFI A;  3TQ1 A;  3GIM A;  9ICM A;  3G6Y A;  1D9F A;  3JYY A;  4UB5 A;  1D8Y A;  3H37 A;  2XC9 A;  3MR2 A;  7ICF A;  5J0O A;  1XO1 A;  5HHI A;  2BQ3 A;  1X9S A;  1NKC A;  1ZQA A;  4IRC A;  1F5A A;  4WC2 A;  1L3U A;  4C8K A;  4J9P A;  3GIK A;  1NK6 A;  2FLP A;  4M2Y A;  4KLF A;  1JAJ A;  4DQS A;  1XWL A;  3H8W A;  5DB8 A;  3TFS A;  2NRX A;  1KTQ A;  1QLN A;  4F50 A;  1ZYQ A;  3GV5 B;  2V4Q A;  4F2R A;  5CJ7 A;  2HHX A;  3HIY A;  9ICV A;  3N97 B;  4O3R A;  3V72 A;  4NM2 A;  2ATL A;  5F9L A;  1KDH A;  7ICP A;  2KP7 A;  8ICC A;  4UB4 A;  4MF8 A;  3FYH A;  2M9N A;  3GIJ A;  5IIK A;  4ECW A;  1A76 A;  4DOA A;  4M6W A;  4B9M A;  4I29 A;  5HR9 A;  3ETL A;  4I2F A;  3C5G A;  4R65 A;  2ZH1 A;  4I2B A;  4C8O A;  1WCN A;  4C8M A;  1WOT A;  1SKR A;  4DSF A;  3RB6 A;  4RWN A;  1MC8 A;  2ZTD A;  3C66 A;  4I2A A;  1S0O A;  4MFF A;  3K4G A;  3ISD A;  1ZQC A;  2UVU A;  4R8U B;  2XY7 A;  4F4K A;  8ICT A;  3KHG A;  5IIL A;  4J9R A;  4QZE A;  4DO9 A;  4DFP A;  1KSP A;  4ED7 A;  3RJK A;  1JIH A;  4UAZ A;  1YLQ A;  5KFU A;  2A1J A;  3JPS A;  4ELU A;  1S10 A;  4B9S A;  5III A;  5KFM A;  5DG9 A;  9ICR A;  4RZR A;  3OGU A;  4PH5 A;  2VA3 A;  1NJX A;  4I2G A;  1TFW A;  5KFY A;  5DBA A;  1ZQB A;  4YXM A;  2HHQ A;  9ICE A;  4MFC A;  4EEY A;  4RQ4 A;  3SZ2 A;  1ZQQ A;  1NKE A;  4X4T A;  7ICH A;  4O3P A;  3G6V A;  1TV9 A;  1ZQR A;  3T3F A;  2IA6 A;  3RJI A;  4M47 A;  2ZH4 A;  2BCR A;  4UAW A;  1R89 A;  2W9C B;  3MAB A;  3EW9 A;  5IIO A;  3H40 A;  3PMN A;  5HP4 A;  3RR8 A;  8ICE A;  5HC9 A;  4IQV A;  2FPK A;  5J2E A; 
#chains in the Genus database with same CATH topology
 4RUA A;  5J2H A;  4AT7 B;  1JI7 A;  2CPR A;  4XA5 A;  4EYH B;  3PY8 A;  3Q8P B;  2JMG A;  2I6X A;  5HRL A;  1V85 A;  5EE1 A;  2HBJ A;  1TKD A;  1TAU A;  5KFN A;  3IP4 B;  5AKK A;  4KLI A;  1Z1V A;  1RYS A;  4NM1 A;  4EEB A;  2R8J A;  2HHP A;  8ICY A;  4UD4 A;  4KLT A;  2ES6 A;  5CWR A;  1UET A;  3QUC A;  2BQR A;  4C80 A;  4WOY A;  4TUQ A;  2DBY A;  2HW3 A;  2XY5 A;  4DQR A;  1JXL A;  3OVS A;  3V6J A;  4JK1 A;  2NV3 A;  1JQR A;  5J2B A;  2JZB B;  9ICC A;  9ICJ A;  1FIQ A;  3E58 A;  1TK5 A;  1JUD A;  3SAG A;  4WC1 A;  4WQK A;  2DPJ A;  3SAF A;  3C23 A;  2HN1 A;  5DB7 A;  5CRX A;  4O67 A;  5CFS A;  1BPD A;  5KG1 A;  2KZZ A;  2M2W A;  5F9N A;  1UHU A;  4RQ2 A;  1HUZ A;  5J0P A;  1WCL A;  2LYB A;  5KG2 A;  3NTU A;  1S0V A;  5HR6 A;  4E0D A;  2BHN A;  2ZJA A;  1JX4 A;  5AK4 A;  2KJ9 A;  2VJ4 A;  4LJX A;  7ICI A;  2AQ0 A;  5J8Y A;  2MA1 A;  2BZF A;  1BNO A;  2ZIW B;  1OUQ A;  5ALS A;  3HJE A;  5DLF A;  5KFS A;  5EE3 A;  4DOC A;  4JV2 A;  1K1S A;  1TK0 A;  4UAU A;  5GTI U;  5B3P A;  4RWO A;  1VLB A;  4NXU A;  5KFF A;  4KLD A;  5BOM A;  3TAC B;  2XY6 A;  3OSP A;  4QJF B;  4AT8 A;  2ZXI A;  1S77 D;  2OXO A;  2M0N A;  3QXG A;  4I2J A;  4X0A A;  1L8L A;  5AI5 A;  3KZI U;  4DFM A;  4DFK A;  4P0P A;  3RR7 A;  3RBD A;  1NJZ A;  3IG5 A;  1ECW A;  5HRF A;  4Q44 A;  5EOZ A;  3EPI A;  2W9B A;  1XC9 A;  1IM4 A;  3GZF A;  3PHZ A;  2ZIV A;  4M5D A;  3WFR E;  1L3T A;  1UA0 A;  4FO1 A;  1S97 A;  4B9U A;  3UPQ A;  4C4T A;  2HHT A;  1BVS A;  3AQN A;  2DRB A;  1JAL A;  2W7P A;  3RRH A;  4RQ6 A;  1NO5 A;  4X4S A;  1MQ3 A;  1COK A;  3ZDB A;  8ICI A;  3KZX A;  4CCH A;  1FEZ A;  2DR7 A;  2ZTE A;  9ICF A;  4YQW A;  1TE2 A;  4WH5 A;  5KFT A;  4NKT A;  2EWR A;  3B9J A;  2ZH2 A;  3TAD A;  3CRX A;  2KIC A;  2E8O A;  4RWQ A;  4YXJ A;  2R8K A;  4YR2 A;  9ICP A;  4FH5 A;  1SGG A;  5DQI A;  1ED1 A;  1NK7 A;  4EBK A;  4K4I A;  2PFP A;  2BGW A;  5CHG A;  4LVS A;  3IHQ B;  5AKZ A;  4I2D A;  3C66 A;  4YR3 A;  2KFZ A;  8ICG A;  1HJP A;  3EZ5 A;  3PST A;  1TVA A;  2W7O A;  3NVZ A;  2FMS A;  2ZH6 A;  3ETR A;  1ZQG A;  2W9A A;  9ICS A;  3ER8 C;  1F44 A;  3RB4 A;  4C8N A;  5KFQ A;  2ZIU B;  2HOF A;  4PHD A;  5KFO A;  4EBC A;  1T94 A;  1S9F A;  4ED2 A;  3AQK A;  1J2M A;  1ZXI A;  3AL0 B;  4YP3 A;  4WBZ A;  2HOI A;  2HHS A;  1IG6 A;  4PZO A;  4R8U A;  5KFJ A;  3AQL A;  3SQI A;  2P35 A;  5ALX A;  4J9L A;  4X4P A;  3LWL A;  7ICS A;  2ZJ8 A;  2KN7 A;  3PW7 A;  2HN2 A;  5J0T A;  3C18 A;  4CDG A;  4USA A;  4Q43 A;  7ICE A;  1ZQK A;  4P4O A;  4RQ1 A;  4RNM A;  1KL9 A;  3T5H A;  3JPO A;  2W9C A;  5AK6 A;  1XSP A;  4M9H A;  3QU9 A;  1RQN A;  5FP0 A;  3M6Z A;  3UMG A;  3BZC A;  3Q8K A;  1ARO P;  4ELT A;  5KFH A;  1ZJM A;  4EEL A;  2KVS A;  4LEW A;  5DB9 A;  3H7I A;  2HCF A;  1WG8 A;  3K1Z A;  2C22 A;  4JV1 A;  2GO7 A;  3RBE A;  4NLZ A;  3ER9 B;  4K98 A;  1SKS A;  3OJU A;  3GII A;  4PHP A;  4ECS A;  9ICI A;  4M6W B;  4KLU A;  3M9O B;  3QUT A;  5J29 A;  4QZC A;  1UA1 A;  2Q0Z X;  2I9G A;  2D6F C;  4DFJ A;  1J2N A;  3L4P A;  4KLG A;  5KFK A;  4DOB A;  2A19 A;  5DLG A;  2F1I A;  1R8B A;  5KFX A;  5CA7 A;  4I2C A;  8ICF A;  2OWO A;  2KKP A;  2IHO A;  3PX4 A;  4M9N A;  4F5N A;  4QZ9 A;  2BPF A;  2WF9 A;  4EBD A;  5DG7 A;  7ICL A;  2UVW A;  4F72 A;  3MGV A;  3VC8 A;  4MEX A;  2WTF A;  2W54 A;  5KG4 A;  2E8M A;  5ALU A;  1PUZ A;  2BPG A;  2ZH3 A;  1SB3 C;  2QKQ A;  3PO4 A;  5CHE A;  3FAH A;  9ICX A;  5AM5 A;  2MUT B;  3N7S C;  1JXE A;  2H3F A;  1NK4 A;  4HAI A;  4IQU A;  4JV0 A;  3HJ4 A;  4F4W A;  1X66 A;  4DQP A;  3B0X A;  3PW4 A;  1QQ6 A;  4CRX A;  5AIA A;  5DEC A;  2PFO A;  4Y2R A;  2B0C A;  1X2I A;  5A0L A;  3BQT A;  4O5K A;  5KG3 A;  5KT3 A;  1ZJN A;  2E5S A;  4EYI B;  2MRL A;  9ICO A;  5D61 A;  4MEY A;  2ZH5 A;  2EAN A;  2P6R A;  4ECY A;  5IIJ A;  4FH3 A;  2BBH A;  3IDW A;  3MFI A;  3GIM A;  1L7N A;  1Z1B A;  9ICM A;  1D8Y A;  3MR2 A;  3BS5 B;  2BQ3 A;  1NKC A;  4C8K A;  1LKY A;  1T3Q A;  1JAJ A;  3AM9 A;  1NZB A;  4F50 A;  5ALD A;  3HIY A;  1X42 A;  2ATL A;  7ICP A;  2E8N A;  8ICC A;  4UB4 A;  1S0N A;  3FYH A;  5IIK A;  1A76 A;  4M6W A;  2Y0S C;  5AKY A;  4R65 A;  4C8O A;  4C8M A;  2K89 A;  2ZG6 A;  5ALT A;  3RB6 A;  2ZTD A;  4UAS A;  4U6P A;  4MFF A;  3ISD A;  5CEH A;  3KHG A;  4J9R A;  4DFP A;  1KSP A;  4ED7 A;  3RJK A;  1YLQ A;  2A1J A;  2W43 A;  2KK0 A;  1S10 A;  2KKV A;  4PH5 A;  2EQY A;  5KFY A;  5DBA A;  4F71 A;  4YXM A;  1SWW A;  4X4T A;  1QQ5 A;  7ICH A;  3G6V A;  1F0M A;  3T3F A;  3RJI A;  2ZH4 A;  2W11 A;  5HC9 A;  3PMN A;  5HP4 A;  2IUB A;  3C29 A;  2F8K A;  2WHE A;  4IQV A;  4NLK A;  5ALM A;  5J2D A;  2E1E A;  2ZIX B;  4KLH A;  2F1J A;  4IQW A;  1NI3 A;  4YG2 A;  2BCQ A;  8ICR A;  3TAQ A;  2H3Z A;  1ZQZ A;  3MCR A;  2FLN A;  2IMW P;  4NXT A;  3UMC A;  1QQ7 A;  1B43 A;  4IRD A;  1DGJ A;  4Y2T A;  1UEV A;  2MUT A;  3ERC C;  4I27 A;  4YCX A;  4ED3 A;  2ZHA A;  2RDI A;  4KMO B;  3JPN A;  4JLZ A;  3L5K A;  3PW5 A;  5ALF A;  1NK9 A;  2YB1 A;  2PI5 A;  3CW2 C;  1VJ7 A;  5IIN A;  2HOQ A;  4RQM A;  4YR0 A;  2EAM A;  4DSI A;  2OH2 A;  1SXD A;  4BXO A;  4TUR A;  1Z4O A;  2F2A B;  5JRT A;  9ICW A;  5ALJ A;  2NRV A;  3SEN A;  4C0Z A;  1MIV A;  2PKE A;  2AGP A;  3OVB A;  3UXP A;  1ZQD A;  3E0F A;  4YMN A;  1JRO A;  2FE9 A;  2Y1J A;  1Q3V A;  2XI9 A;  3PSI A;  3C5F A;  2H5X A;  2PMZ C;  5L9X A;  5B66 U;  5DBB A;  2DUY A;  2GH1 A;  5KTQ A;  2W04 A;  2HVH A;  4Z6C A;  4K96 A;  5J0X A;  4AP9 A;  4QZA A;  5HRI A;  4EZ6 A;  2HBM A;  4O3O A;  4EX6 A;  4XQ8 A;  3ZDA A;  2B56 A;  5L1K A;  1V97 A;  4F8R A;  1CEZ A;  4X4N A;  3AMZ A;  4NY8 A;  8ICP A;  5EE0 A;  4Y2X A;  2DR5 A;  3MR3 A;  1OW5 A;  4N7R A;  5ALV A;  1HEK A;  2ZJ5 A;  4BDP A;  5D49 A;  1IV8 A;  2FPM A;  3WK5 A;  5KG5 A;  5DDM A;  2K4H A;  5F3X B;  2YML A;  2JEI A;  1N62 A;  1ZD3 A;  2ASD A;  2ESE A;  4QIW F;  2K4I A;  4O5E A;  2FMP A;  3BQ7 A;  3D2S A;  1SV0 C;  3GV8 B;  4ICA A;  4JB3 A;  1JMS A;  3LQC B;  3GIL A;  4RPZ A;  3WK4 A;  3C2L A;  2KVC A;  4S3N A;  1QSL A;  9ICK A;  2JEF A;  3JPR A;  5ALK A;  5HHH A;  3AUO A;  2ZUD A;  4Z6F A;  4KLS A;  2KFN A;  1U49 A;  1NJY A;  1BNP A;  4EGW A;  4Y2J A;  4ACO A;  7ICQ A;  4PHE A;  3GV7 B;  4WCW A;  3WFP A;  4GFJ A;  1X40 A;  3K75 D;  5AKL A;  2KSO B;  4DL6 A;  2EZY A;  2G0A A;  4DQQ A;  5AKG A;  4UB6 U;  4IRK A;  4R64 A;  2XCA A;  3V7K A;  5J2C A;  4BWM A;  1ZQS A;  3H8M A;  2RHF A;  4GXJ A;  5CFT A;  2P66 A;  3CK6 A;  4J9M A;  9ICT A;  4F4X A;  3H3A A;  4F3O A;  1KW4 A;  5AM4 A;  1Q79 A;  5KFB A;  3KOO A;  4F5P A;  3RH6 A;  3RTV A;  3RB3 A;  4Y2U A;  2GA9 D;  8ICH A;  4ATB A;  3PV8 A;  1QTM A;  4QZH A;  1UQV A;  2EZZ A;  2HSZ A;  2LMR A;  3M8R A;  3RRG A;  3I1Y A;  4UD5 A;  4DF4 A;  3WK6 A;  1R8A A;  5AKX A;  5KFP A;  5CFU A;  4KMU A;  1V4A A;  3F2B A;  3QYP A;  1RG6 A;  2PFQ A;  2AU0 A;  2BCV A;  3PX0 A;  1FFU A;  9ICH A;  3QUB A;  1IXR A;  3C2K A;  4O68 A;  4RQN A;  4KN4 A;  9ICL A;  2DR8 A;  2K60 A;  4UBC A;  1N56 A;  3U26 A;  3QEA Z;  4NLG A;  3G6X A;  1VJ5 A;  4RWP A;  2JRZ A;  2DKX A;  1D8L A;  3GFK B;  4PHA A;  5J2A A;  1FO4 A;  2K4P A;  3WKC A;  4P4M A;  4G9B A;  4O6A A;  1T4G A;  1NK8 A;  2EAO A;  1IIP A;  1PK3 A;  7ICK A;  2MSN A;  2KG5 A;  3Q8R B;  2GWS A;  5HRD A;  5KT2 A;  3KHR A;  4FS1 A;  5B3Q A;  3KHL A;  4RNN A;  1DXS A;  2EH9 A;  3RF9 A;  5G5G A;  3ALR A;  2BR0 A;  4LZD A;  9ICN A;  2W9M A;  2OYY A;  2ID1 A;  3UQ2 A;  3WKA A;  4GXI A;  2KMD A;  2RP5 A;  2WF5 A;  7ICO A;  4X4R A;  5KT7 A;  2KSO A;  1O08 A;  4UAT A;  5DQG A;  1J97 A;  3SMV A;  4KTQ A;  4AT9 B;  3OWG A;  3UQ0 A;  3ZI4 A;  5AKI A;  4GIB A;  1UT8 A;  1FFV A;  3NKU A;  1XU4 A;  3QX7 A;  2JEG A;  2MAX A;  2D3D A;  5J0S A;  5TIS U;  4AT7 A;  4DSE A;  2R8G A;  4KX5 A;  5ALW A;  4CF5 A;  4FHW A;  2NRT A;  2I1Q A;  2WF7 A;  2YMQ A;  2DRA A;  2KZM A;  4DEZ A;  3WFO A;  1VFG A;  8ICK A;  4IR1 A;  4B9N A;  4E7X A;  5D4B A;  1EXN A;  3Q8S B;  1Q3U A;  3RB0 A;  3TI0 A;  4M04 A;  2A3V A;  4OAI Z;  4QZB A;  3HKZ C;  5KAF U;  4E8F A;  5KG0 A;  1A77 A;  7ICV A;  3PSF A;  4IS7 A;  2IOH A;  1T7P A;  3ZD9 A;  5KFW A;  2XGP A;  4NL9 A;  2WAQ F;  5J0Q A;  4I2I A;  2VAN A;  4C7Y A;  3SI8 A;  2JZB A;  2KIW A;  2DQN B;  2AH5 A;  3NRW A;  1Y88 A;  1B0X A;  2HBK A;  4J9S A;  8ICX A;  4K4H A;  1MN8 A;  1ZQT A;  3RJF A;  2HHW A;  4NJ8 A;  4X4U A;  2ASL A;  5IIM A;  2ZTC A;  4PGY A;  7ICG A;  3RAQ A;  4MKP A;  1SV0 A;  3M6K A;  2LYA A;  2W03 A;  4IQT A;  2VIX A;  2BQU A;  5HRH A;  4KIT B;  4M9J A;  2F8L A;  3JPQ A;  3UXN A;  3ISB A;  1L3V A;  2OHF A;  4K4G A;  2DGZ A;  1A6S A;  4TQR A;  1S5L U;  3NGD A;  4JWN A;  2BKE A;  2LI6 A;  3PX6 A;  4F91 B;  2ZIW A;  2NRZ A;  3H0M B;  1N48 A;  4ED6 A;  5E79 U;  2G5I B;  4NXZ A;  4B9V A;  3D6J A;  2R8I A;  2ISO A;  4P0Q B;  3DEE A;  4Y2Q A;  3BQ1 A;  4HYK A;  4F5O A;  2W8K A;  1Q78 A;  2LPE A;  5KG7 A;  4X5V A;  3F2D A;  4Y2P A;  1SZP A;  4LZG A;  1V9P A;  2VA2 A;  4E80 A;  4PL2 A;  1O03 A;  3THV A;  3EF2 A;  4B9L A;  2DR9 A;  3TQ1 A;  3G6Y A;  4UB5 A;  3VCB A;  2XC9 A;  4IRC A;  1ZQA A;  5JTI A;  3GIK A;  2HI0 A;  1XWL A;  3H8W A;  4Y2Y A;  5DB8 A;  2NRX A;  1QLN A;  4F2R A;  4C4S A;  4OJO A;  3N97 B;  4O3R A;  3V72 A;  5F9L A;  2LM1 A;  4ECW A;  2OCE A;  4DOA A;  5HR9 A;  2ZH1 A;  1WCN A;  4DSF A;  4RWN A;  3QU5 A;  2RLT A;  1ZQC A;  2UVU A;  4QZE A;  2G08 A;  5KFU A;  2D8C A;  1L7P A;  5AI9 A;  2QB0 B;  4HX0 A;  5DG9 A;  4UAV A;  1F5S A;  1ZQB A;  2HHQ A;  2WB1 C;  9ICE A;  3N28 A;  3SZ2 A;  1NKE A;  5AI6 A;  2G5H B;  4NLB A;  2IA6 A;  2BCR A;  2G09 A;  4EED A;  4UAW A;  2KIV A;  3RR8 A;  3MAB A;  3C28 A;  1MA7 A;  5EWE A;  1NK0 A;  3EUB 2;  2HHU A;  5AHX A;  1R8C A;  2FI1 A;  2H3Q A;  4EBJ A;  1UPH A;  4DSK A;  4J9K A;  3RH5 A;  1SV4 A;  3CP8 A;  1QSS A;  1HIW A;  4OJP A;  1ZQY A;  3F2C A;  3QE9 Y;  4RT3 A;  3IN5 A;  5JTG A;  4K97 A;  2KTQ A;  4KLJ A;  2HVI A;  8ICA A;  4UBB A;  5ALH A;  1ZQE A;  3TKA A;  4R63 A;  1X9M A;  2OEH A;  3RJG A;  3ISC A;  2V4R A;  2ZIU A;  4P4P A;  4Y2V A;  3ONN A;  3H0L B;  2DWQ A;  1BPY A;  3FM9 A;  1QH9 A;  1LB2 B;  7ICU A;  4RQ8 A;  4OAF A;  3BQ2 A;  3HRD D;  2HMX A;  4QZ8 A;  3PR4 A;  3F5E A;  2HBL A;  1OXJ A;  2IBK A;  2AHO B;  4ED1 A;  4IG8 A;  1DGS A;  5DB6 A;  4OJ6 A;  4GXK A;  3QEB Z;  5ALL A;  4YMO A;  4OJ5 A;  3KFU F;  4WC3 A;  5L1L A;  2QAR B;  2J6S A;  4GC7 A;  3WK8 A;  2FDR A;  2IHN A;  2YMM A;  4DL5 A;  1PVP A;  4QZG A;  3H0R B;  4O3N A;  1N5X A;  3M1Y A;  1Z00 B;  5AI4 A;  4I0U A;  3NVO A;  4WC0 A;  2A1A A;  3UXO A;  4WC5 A;  8ICV A;  4EBE A;  1GPJ A;  1L3S A;  3TAR A;  5HRG A;  4QWE A;  8ICU A;  3H38 A;  1RQL A;  4X4V A;  3V7L A;  3NYB A;  3A0B U;  4QWC A;  4G3I A;  3BQ0 A;  5D62 A;  2FMQ A;  3M9N B;  3OHB A;  3KBB A;  3T5K A;  4F5Q A;  3L9D A;  5L1J A;  4KLO A;  4QZF A;  4PGQ A;  3PW2 A;  4KN7 A;  4Q8E A;  1WWV A;  3RFA A;  1SZH A;  1ZQV A;  2ZH7 A;  5ALN A;  4FO6 A;  2K4E A;  3AU6 A;  3NS1 A;  3RJJ A;  4X4O A;  2EAP A;  5KFE A;  1NK5 A;  4FHV A;  2PXI A;  2KOB A;  7ICR A;  5KFG A;  3OSN A;  3MDA A;  5DED A;  5ALO A;  4KM5 A;  4DL7 A;  1GO3 F;  2LYH A;  4IC9 A;  3Q8L A;  1ZET A;  1PK1 B;  9ICA A;  1XS9 D;  3KTQ A;  2JHD A;  5HRK A;  5ALE A;  3PNC A;  4FHY A;  1LV5 A;  2E8P A;  3OVA A;  3C1Z A;  1CRX A;  4YFK A;  5JU5 A;  4UAY A;  3MC1 A;  1KKX A;  3OHA A;  1JN3 A;  4O3S A;  1PZN A;  1WUD A;  2UVV A;  5AKJ A;  4O3M A;  1T3N A;  4RPX A;  4I28 A;  2XGQ A;  4I2H A;  5EWG A;  1KFS A;  4XJE A;  2RRD A;  5J2K A;  3WU2 U;  4U7C A;  4KLM A;  3PML A;  4C7Z A;  1N63 A;  2OM6 A;  1C20 A;  3EPG A;  4EEN A;  1S0M A;  1NJW A;  2ISP A;  4FZN A;  4M9L A;  3KKA A;  4WC2 A;  3AQE A;  1ZQN A;  4WBY A;  8ICL A;  3BS5 A;  1DOQ A;  1SL1 A;  1DRG A;  3SEI A;  4ECZ A;  4DL2 A;  2KNJ A;  2GAF D;  8ICB A;  2UVR A;  3WK7 A;  4RQ0 A;  1SL0 A;  4NL9 C;  2RDJ A;  5B5E U;  1MIY A;  2J6T A;  5HRE A;  4XRH A;  2WB1 F;  1RYU A;  1U4B A;  1NZP A;  1ZQU A;  3NRZ A;  2G07 A;  2B6G A;  8ICS A;  3O0F A;  3TFR A;  4DWI A;  9ICU A;  1KNY A;  4UQG A;  4NXW A;  4JUZ A;  3H8J A;  1D8B A;  4BGD A;  3UPS A;  2I5H A;  2H3I A;  1KLN A;  2XVT A;  4FS2 A;  4Q45 A;  1KRP A;  2GOL A;  1X6I A;  1C7Y A;  4ECR A;  4FBU A;  2F77 X;  3WFS C;  1L7O A;  1U47 A;  2JXJ A;  2RFF A;  4F2S A;  5J0W A;  2FLL A;  4DF8 A;  5L1M A;  3NVY A;  1YT3 A;  5J2F A;  3C2M A;  3QU4 A;  4ZH4 A;  2KEY A;  3HW8 A;  4O3Q A;  1ZQW A;  4YN4 A;  3LVW A;  1PK1 A;  1TAQ A;  2ZIX A;  1KN5 A;  3SAH A;  5J0R A;  3ZDE A;  4EX7 A;  2B4V A;  1SIJ A;  3MGH A;  3DV9 A;  2BPC A;  2LKY A;  2E1F A;  1TFR A;  4PZN A;  3RAX A;  8ICN A;  3C1Y A;  3I28 A;  1XNS A;  3RJH A;  3QUQ A;  4WC6 A;  5KFL A;  4YMM A;  4BJQ A;  2BCS A;  1CUK A;  3GQC A;  2LM4 A;  1ZRM A;  4KLL A;  4NLN A;  3T5J A;  1UEU A;  5AK3 A;  3GDX A;  3MR6 A;  4AT8 B;  2PI4 A;  4WJ3 B;  1ZQL A;  5KFA A;  1CI4 A;  3OPX A;  3K1R B;  2IHM A;  1BGX T;  1BPZ A;  5AKE A;  2C2D A;  2FPL A;  3N4M B;  5DQH A;  4P0P B;  4K9B A;  3WFQ E;  2DVI A;  4DLG A;  2N1R A;  3HWT A;  4UAR A;  2W9B B;  1ZD4 A;  2ZIV B;  1N5W A;  5ALP A;  2CRX A;  2YMP A;  5KFV A;  3HPO A;  5AIB A;  1RM6 C;  2Y0S F;  7ICM A;  1AQ6 A;  4J03 A;  9ICG A;  2Y1I A;  4BX9 C;  3PSP A;  5J2G A;  3FDS A;  2DL0 A;  3JPT A;  4OD0 A;  5CB1 A;  1U9L A;  4DS5 A;  3ZDC A;  1QCK A;  4CF4 A;  4QZD A;  2BDU A;  1MIW A;  1ZQF A;  3HX0 A;  4J9O A;  8ICZ A;  2AJQ A;  8ICM A;  4UB2 A;  4RNO A;  4EZ9 A;  3ED5 A;  3PO5 A;  1ZQP A;  4O0I A;  4US9 A;  2YN4 A;  1ZD5 A;  3K7D A;  4JLX A;  1L5U A;  5HRB A;  1N60 A;  4RU9 A;  4EV6 A;  3JYY A;  4NXV A;  1D9F A;  1X9S A;  1F5A A;  5AI0 A;  1NK6 A;  2FLP A;  4M2Y A;  4DQS A;  4EEK A;  3AN1 A;  3TFS A;  2VJ5 A;  2KE7 A;  2YQE A;  9ICV A;  5K4L A;  5KAI U;  2EZX A;  2FJ6 A;  4FZM A;  1KDH A;  4MF8 A;  3GIJ A;  1ZOL A;  4B9M A;  4I29 A;  2W3R A;  3ETL A;  4I2B A;  1WOT A;  1SKR A;  1S0O A;  5AM1 A;  4R8U B;  4F4K A;  8ICT A;  5AK5 A;  3UMB A;  5KFM A;  9ICR A;  2PMZ F;  4RZR A;  3OGU A;  2W55 A;  2XIC A;  4UW9 A;  4I2G A;  4WQL A;  4OJL A;  1LVH A;  4EEY A;  3SR6 A;  1ZQQ A;  5AM0 A;  2F44 A;  4O3P A;  1TV9 A;  4M47 A;  2EDU A;  2IOF A;  1X6J A;  2W9C B;  8ICE A;  3EW9 A;  3H40 A;  3SD7 A;  5L1I A;  4Z6E A;  3JPP A;  3PW0 A;  2XO7 A;  5KT6 A;  2K8B B;  3MGI A;  4DQI A;  5H2F U;  3EYZ A;  4PPX A;  3GU3 A;  1RXW A;  1ZQX A;  4AYB C;  2JEJ A;  1Q46 A;  3TAP A;  2BCU A;  4QW8 A;  2NRW A;  1BPE A;  1A0P A;  3LVV A;  4DSJ A;  3HIL A;  4NWI A;  3QZ7 A;  1ZQJ A;  2CN1 A;  3LYS A;  1B22 A;  1ZD2 P;  5GTH U;  3KHH A;  5J2J A;  4DS4 A;  5CR0 A;  1Z3E B;  4YVZ A;  1D9D A;  4LEY A;  1ZRN A;  2AXT U;  3JZ0 A;  4DLE A;  2JR5 A;  1K5O A;  4UB1 A;  4ZOH C;  3NAS A;  4F93 B;  4MFA A;  3RJE A;  2K8A A;  2R8H A;  4ECV A;  4GC6 A;  1WWU A;  2ODG A;  1VDV A;  7ICT A;  4NLC A;  1PVQ A;  1ZQ1 C;  2E3T A;  1FA0 A;  5DBC A;  5DKW A;  4R66 A;  3JCF A;  3PVX A;  2O5A A;  1RXV A;  5J2I A;  4AT9 A;  3DDH A;  2YX8 A;  2GLE A;  4KLE A;  3MDC A;  2WF8 A;  3LWM A;  2ASJ A;  5DDY A;  4XQ7 A;  4FHP A;  1H38 A;  5HMM A;  1ZQH A;  5AKH A;  3SV3 A;  5HR7 A;  2MU2 A;  5ALY A;  1RPL A;  3ZD8 A;  1K1Q A;  2JGA A;  1NOM A;  1Z4N A;  4J9Q A;  2PBE A;  2Q66 A;  1YZ7 A;  2ZXH A;  5AI8 A;  4DCC A;  4OAG A;  4BUG A;  3FC4 A;  4UB8 U;  2J6U A;  1OU5 A;  3KKA C;  2AQ4 A;  4I2E A;  2ZUC A;  1SXE A;  2PFN A;  3WKE A;  3MFH A;  2QLT A;  5BOL A;  1SL2 A;  3HP6 A;  4ED0 A;  5ALR A;  3TAN A;  2JH7 A;  1QSY A;  2DKZ A;  4YD1 A;  2ALZ A;  4RT2 A;  5KNI A;  2YTU A;  2F76 X;  5CP2 A;  1U45 A;  2B21 A;  3HJ1 A;  4US8 A;  1LKY B;  1BPB A;  3N7R C;  1KFD A;  2BDP A;  2NRK A;  1ZQO A;  4TUS A;  4F4Y A;  3ZDD A;  3QU2 A;  3E2E A;  3OUY B;  4A8E A;  5BPC A;  4RUC A;  5DGA A;  3D2N A;  4CF3 A;  2FCL A;  5KG6 A;  2P6U A;  1NKB A;  2ZUB A;  8ICW A;  3WKB A;  3KD3 A;  4K8V A;  4IL6 U;  4ECU A;  2A1J B;  2M2T A;  4M0A A;  2V9W A;  1S76 D;  1RYR A;  1UT5 A;  3S6J A;  1SKW A;  4XUS A;  4PJ0 U;  4P0Q A;  5D63 A;  1Z19 A;  4QIW C;  2NO4 A;  5AM2 A;  2KD1 A;  4M9G A;  2JH1 A;  4O5C A;  4C8L A;  4LT6 A;  1URJ A;  4NXX A;  3M8S A;  3B0Y A;  3OTQ A;  2Z7J A;  4F5R A;  3AU2 A;  3M9M B;  1ZQM A;  2ZH8 A;  1N2X A;  4UB3 A;  1KBU A;  3F5A A;  3OJS A;  3PZP A;  2AGQ A;  4LEV A;  2R18 A;  3H8S A;  5ALQ A;  3I76 A;  2NO5 A;  5DG8 A;  3LDA A;  4ELV A;  1X9X A;  1YZ6 A;  3L3F X;  4NV0 A;  4BWJ A;  3IM1 A;  3Q8M A;  3HKZ F;  4ECT A;  2YB4 A;  3LK9 A;  4CGZ A;  4FZL A;  1JRP A;  3IV6 A;  2C28 A;  4K9A A;  4WC4 A;  4FBT A;  4MF2 A;  1L7M A;  3MR5 A;  1SWV A;  5KFC A;  3EWA A;  1XO0 A;  5KFZ A;  1L8O A;  3C21 A;  4OAH A;  5KT4 A;  4BXO B;  2YY6 A;  3CNH A;  5KT5 A;  1COO A;  1V38 A;  4DL4 A;  3NVW A;  1KQQ A;  5TZV A;  2KHQ A;  1TK8 A;  3BJY A;  7ICJ A;  4OO1 J;  4YD2 A;  2NYV A;  5DGB A;  1Q8K A;  3F53 A;  2C2E A;  5J0Y A;  2QB0 A;  1T8E A;  8ICO A;  4JWM A;  2DF4 B;  3H39 A;  2F1H A;  4GLX A;  1RZT A;  4AYB F;  4RQ3 A;  4FHX A;  2VA8 A;  1UCV A;  4K99 A;  4F92 B;  4O9M A;  2AGO A;  4J9N A;  4CNQ A;  2C2R A;  1N61 A;  4TUP A;  3OUY A;  4ED8 A;  3RH4 A;  2W8L A;  4QZI A;  3AEV A;  9ICB A;  4WC7 A;  3T79 A;  1XSL A;  5ALI A;  3BZK A;  4PL1 A;  1RDF A;  1PVR A;  1TAM A;  2HHV A;  3M7D A;  2ZHB A;  3IG8 A;  2M2V A;  1XSN A;  2ZH9 A;  4QWA A;  3IRU A;  3ICX A;  1DK2 A;  4KB6 A;  3T5L A;  2VKQ A;  4QWB A;  1KFT A;  3Q8Q B;  1U48 A;  4TQS A;  5J0U A;  3QNM A;  3OV7 A;  1MQ2 A;  4DL3 A;  4EP7 A;  1ZQI A;  3H4D A;  1S8O A;  1PX5 A;  5F2V O;  2K8C B;  1KEJ A;  3BDP A;  4ECQ A;  1BPX A;  5J8Y C;  2H3V A;  4IR9 A;  4QNL A;  3CYM A;  3SYZ A;  4FFD A;  3QZ8 A;  3HT3 A;  7ICN A;  8ICJ A;  3SV4 A;  5C0Y A;  2QAR A;  3V6H A;  2LBO A;  5T14 A;  2M2U A;  4C4R A;  4X0B A;  5KFD A;  3AQM A;  4Z6D A;  4QWD A;  5KFR A;  8ICQ A;  4NKU A;  1L6N A;  5KFI A;  4Q8F A;  1NNL A;  2WFA A;  3D2Q A;  4KLQ A;  3AQF A;  4RPY A;  5JUM A;  4RQ5 A;  1Z00 A;  3V7J A;  3ORY A;  3QU7 A;  5KL8 B;  3UM9 A;  3MBY A;  4P2H A;  4DSL A;  5AM3 A;  2WF6 A;  4MHV A;  1P7D A;  4QW9 A;  2F3N A;  1X9W A;  4ECX A;  2CXY A;  5C5J A;  4ATB B;  2JV3 A;  2BBJ A;  4FE3 A;  2BE3 A;  4X4Q A;  2W3S A;  2DFL A;  2B51 A;  4F4Z A;  4B6J A;  5EWF A;  2KJ5 A;  2DPI A;  3BS7 A;  5HML A;  3WKD A;  1TFY A;  4Y2S A;  2KZ3 A;  5D46 A;  5HNK A;  4RQ7 A;  1HUO A;  3H4B A;  5AIC A;  2RQ5 A;  4PGX A;  2Q4T A;  3J81 j;  2KJ8 A;  3PR5 B;  1DK3 A;  2WAQ C;  4CE6 A;  4B9T A;  2XCP A;  9ICQ A;  2L5Y A;  2HDO A;  1MSW D;  3V6K A;  2O1P A;  1WYG A;  4LEZ A;  3H37 A;  7ICF A;  3A0H U;  5J0O A;  5ALZ A;  1XO1 A;  5HHI A;  2QB1 A;  1L3U A;  4J9P A;  3NVV A;  4O69 A;  3WK9 A;  4KLF A;  2Y9T A;  3TAD C;  1KTQ A;  2KHV A;  1ZYQ A;  2LHT A;  3R9K A;  3GV5 B;  2V4Q A;  4JMU A;  5CJ7 A;  2HHX A;  2Y9U A;  1M6Y A;  4NM2 A;  2KP7 A;  3NWI A;  2M9N A;  4I2F A;  3C5G A;  1B4F A;  1MC8 A;  5ALG A;  4I2A A;  3K4G A;  2G06 A;  4KX3 A;  2XY7 A;  4OCZ A;  5IIL A;  2XID A;  4DO9 A;  1JIH A;  4UAZ A;  3N7P D;  3JPS A;  3NUQ A;  4ELU A;  4B9S A;  5III A;  2VA3 A;  1NJX A;  1TFW A;  5EE9 A;  4MFC A;  4RQ4 A;  5KL1 B;  1ZQR A;  2KV2 A;  2IOF K;  2O6K A;  4DFD A;  1R89 A;  5IIO A;  5G5H A;  2FPK A;  5J2E A; 
#chains in the Genus database with same CATH homology
 5J2D A;  5EWE A;  1NK0 A;  5L1I A;  4Z6E A;  2F1J A;  4KLH A;  4IQW A;  2HHU A;  4RUA A;  3JPP A;  5J2H A;  4YG2 A;  3PW0 A;  4AT7 B;  2XO7 A;  5KT6 A;  2BCQ A;  8ICR A;  3TAQ A;  1R8C A;  1ZQZ A;  4XA5 A;  3MGI A;  4EYH B;  4EBJ A;  4DSK A;  4J9K A;  3RH5 A;  2FLN A;  2IMW P;  3PY8 A;  1B43 A;  1QSS A;  4DQI A;  4IRD A;  3EYZ A;  1ZQY A;  4PPX A;  3QE9 Y;  4RT3 A;  3Q8P B;  1UEV A;  1RXW A;  1ZQX A;  5HRL A;  2JEJ A;  1TKD A;  2MUT A;  3TAP A;  2BCU A;  4QW8 A;  2KTQ A;  2NRW A;  1TAU A;  1BPE A;  4I27 A;  4YCX A;  5KFN A;  4ED3 A;  4KLI A;  4KLJ A;  2HVI A;  8ICA A;  2ZHA A;  4UBB A;  1ZQE A;  2RDI A;  4R63 A;  3JPN A;  1X9M A;  1RYS A;  4DSJ A;  3RJG A;  3ISC A;  3PW5 A;  1NK9 A;  3QZ7 A;  2PI5 A;  4NM1 A;  1VJ7 A;  2V4R A;  1ZQJ A;  2R8J A;  2HHP A;  5IIN A;  4P4P A;  8ICY A;  4UD4 A;  4KLT A;  1BPY A;  5CWR A;  1B22 A;  1UET A;  2BQR A;  1LB2 B;  7ICU A;  4RQ8 A;  4YR0 A;  3BQ2 A;  4TUQ A;  3KHH A;  4QZ8 A;  4DSI A;  5J2J A;  4DS4 A;  4DQR A;  2XY5 A;  5CR0 A;  3PR4 A;  2HW3 A;  1Z3E B;  4YVZ A;  1D9D A;  4BXO A;  1JXL A;  4TUR A;  3OVS A;  2IBK A;  3V6J A;  9ICW A;  4JK1 A;  3JZ0 A;  2NRV A;  4DLE A;  1JQR A;  5J2B A;  4UB1 A;  1MIV A;  2JZB B;  4ED1 A;  9ICC A;  4F93 B;  4MFA A;  2AGP A;  3RJE A;  9ICJ A;  4IG8 A;  1DGS A;  3OVB A;  5DB6 A;  1TK5 A;  2R8H A;  3UXP A;  4ECV A;  4GC6 A;  1ZQD A;  4YMN A;  4GXK A;  4WC1 A;  2DPJ A;  7ICT A;  3QEB Z;  2Y1J A;  3C23 A;  4YMO A;  4WC3 A;  5DB7 A;  5L1L A;  1BPD A;  5KG1 A;  1FA0 A;  5DBC A;  2J6S A;  5DKW A;  2KZZ A;  4R66 A;  3C5F A;  2H5X A;  5L9X A;  2M2W A;  5F9N A;  5DBB A;  4RQ2 A;  3PVX A;  1HUZ A;  5KTQ A;  5J0P A;  1WCL A;  4GC7 A;  2O5A A;  1RXV A;  5KG2 A;  4Z6C A;  5J2I A;  2HVH A;  5J0X A;  4AT9 A;  3NTU A;  1S0V A;  2IHN A;  4DL5 A;  4QZA A;  2BHN A;  3MDC A;  4QZG A;  4E0D A;  4KLE A;  4EZ6 A;  2ZJA A;  5HRI A;  4O3N A;  4O3O A;  3LWM A;  4XQ8 A;  2ASJ A;  3ZDA A;  5L1K A;  5DDY A;  4F8R A;  1JX4 A;  1CEZ A;  4XQ7 A;  4FHP A;  4X4N A;  1H38 A;  1Z00 B;  5HMM A;  4NY8 A;  8ICP A;  1ZQH A;  3SV3 A;  2DR5 A;  4WC0 A;  3MR3 A;  3UXO A;  2ZJ5 A;  4WC5 A;  1RPL A;  3ZD8 A;  8ICV A;  7ICI A;  1K1Q A;  4EBE A;  5D49 A;  4BDP A;  1L3S A;  2FPM A;  1NOM A;  5KG5 A;  4J9Q A;  2AQ0 A;  3TAR A;  5HRG A;  5DDM A;  4QWE A;  8ICU A;  3H38 A;  1BNO A;  2PBE A;  2JEI A;  3V7L A;  4X4V A;  2Q66 A;  3NYB A;  5DLF A;  4QWC A;  2ASD A;  5KFS A;  4DOC A;  4JV2 A;  4G3I A;  1K1S A;  3BQ0 A;  1TK0 A;  2FMQ A;  4O5E A;  3M9N B;  2FMP A;  4RWO A;  3OHB A;  3T5K A;  4F5Q A;  3GV8 B;  3LQC B;  1JMS A;  5KFF A;  3L9D A;  4KLD A;  5BOM A;  5L1J A;  3GIL A;  4QZF A;  4RPZ A;  2J6U A;  4KLO A;  2XY6 A;  3OSP A;  1OU5 A;  4PGQ A;  3C2L A;  3PW2 A;  2AQ4 A;  4I2E A;  4KN7 A;  2ZUC A;  4S3N A;  1QSL A;  2PFN A;  2JEF A;  3JPR A;  3AUO A;  5HHH A;  4Q8E A;  1S77 D;  1ZQV A;  2ZUD A;  4Z6F A;  4KLS A;  4I2J A;  3MFH A;  2KFN A;  2ZH7 A;  4FO6 A;  5BOL A;  1SL2 A;  1U49 A;  1NJY A;  1BNP A;  3AU6 A;  3HP6 A;  4ED0 A;  7ICQ A;  4PHE A;  3GV7 B;  4WCW A;  3TAN A;  1QSY A;  3RJJ A;  3WFP A;  4YD1 A;  4X0A A;  4X4O A;  3K75 D;  4DL6 A;  2ALZ A;  5KFE A;  1NK5 A;  4RT2 A;  4DQQ A;  2PXI A;  4DFM A;  4DFK A;  4FHV A;  4IRK A;  7ICR A;  3RR7 A;  5KFG A;  5CP2 A;  3RBD A;  1U45 A;  1NJZ A;  2B21 A;  4R64 A;  3OSN A;  3HJ1 A;  5HRF A;  2XCA A;  4Q44 A;  5EOZ A;  1BPB A;  3MDA A;  3EPI A;  2W9B A;  1KFD A;  1IM4 A;  1XC9 A;  5DED A;  3V7K A;  5J2C A;  4BWM A;  2BDP A;  1ZQS A;  4DL7 A;  2NRK A;  1ZQO A;  2LYH A;  4M5D A;  4TUS A;  4F4Y A;  1L3T A;  3ZDD A;  3Q8L A;  3WFR E;  4GXJ A;  1ZET A;  9ICA A;  1XS9 D;  1UA0 A;  3E2E A;  2P66 A;  3OUY B;  3KTQ A;  5BPC A;  4J9M A;  1S97 A;  4B9U A;  9ICT A;  4RUC A;  4F4X A;  5DGA A;  5HRK A;  3UPQ A;  3PNC A;  4FHY A;  3H3A A;  4F3O A;  2HHT A;  5KG6 A;  2P6U A;  1NKB A;  3C1Z A;  1BVS A;  1LV5 A;  2ZUB A;  4YFK A;  9ICL A;  3AQN A;  3OVA A;  8ICW A;  1NO5 A;  3RRH A;  5KFB A;  4RQ6 A;  1Q79 A;  4X4S A;  1MQ3 A;  4F5P A;  4UAY A;  3RH6 A;  3RTV A;  3RB3 A;  3ZDB A;  8ICI A;  3OHA A;  4CCH A;  1JN3 A;  2DR7 A;  2ZTE A;  4ECU A;  4O3S A;  1PZN A;  8ICH A;  9ICF A;  2A1J B;  4ATB A;  3PV8 A;  1QTM A;  2M2T A;  4QZH A;  4YQW A;  4M0A A;  2V9W A;  4WBZ A;  1S76 D;  2UVV A;  1RYR A;  1T3N A;  1UT5 A;  5KFT A;  4NKT A;  1SKW A;  4XUS A;  4RPX A;  2ZH2 A;  4I28 A;  3M8R A;  2XGQ A;  3RRG A;  4I2H A;  4UD5 A;  4DF4 A;  1R8A A;  5EWG A;  1KFS A;  4M9G A;  4RWQ A;  4YXJ A;  5KFP A;  4O5C A;  5J2K A;  2R8K A;  4YR2 A;  4KMU A;  4C8L A;  9ICK A;  5DQI A;  1NK7 A;  9ICP A;  1V4A A;  4FH5 A;  4LT6 A;  4EBK A;  4KLM A;  3PML A;  3M8S A;  2AU0 A;  3B0Y A;  2BCV A;  3PX0 A;  2PFQ A;  4K4I A;  2PFP A;  9ICH A;  3EPG A;  4F5R A;  2BGW A;  3AU2 A;  5CHG A;  3M9M B;  1S0M A;  4LVS A;  3IHQ B;  1ZQM A;  1IXR A;  3C2K A;  1NJW A;  2ISP A;  2ZH8 A;  4UB3 A;  4I2D A;  4KN4 A;  4M9L A;  2AGQ A;  4YR3 A;  4UBC A;  3OJS A;  2KFZ A;  1N56 A;  3QEA Z;  1HJP A;  3H8S A;  3EZ5 A;  3G6X A;  1ZQN A;  4NLG A;  8ICG A;  8ICL A;  4WBY A;  1TVA A;  5DG8 A;  1DOQ A;  1SL1 A;  3LDA A;  4ELV A;  4RWP A;  4ECZ A;  1D8L A;  4DL2 A;  3GFK B;  4BWJ A;  4PHA A;  5J2A A;  2FMS A;  8ICB A;  2ZH6 A;  3IM1 A;  2UVR A;  3Q8M A;  1ZQG A;  4ECT A;  2W9A A;  4P4M A;  9ICS A;  3LK9 A;  4RQ0 A;  1SL0 A;  1T4G A;  3RB4 A;  4C8N A;  1NK8 A;  2C28 A;  5KFQ A;  2RDJ A;  7ICK A;  4WC4 A;  4FBT A;  1MIY A;  4PHD A;  2J6T A;  4MF2 A;  5HRE A;  5KFO A;  4XRH A;  5KFC A;  3MR5 A;  1U4B A;  1NZP A;  3EWA A;  4EBC A;  1ZQU A;  4ED2 A;  1S9F A;  3AQK A;  3Q8R B;  5KFZ A;  2GWS A;  3C21 A;  5KT4 A;  5KT2 A;  4YP3 A;  3KHR A;  4FS1 A;  3TFR A;  3KHL A;  4BXO B;  4DWI A;  4UQG A;  8ICS A;  9ICU A;  1KNY A;  4JUZ A;  4RNN A;  3H8J A;  2HHS A;  4AT8 A;  5KT5 A;  4BGD A;  3UPS A;  1COO A;  4DL4 A;  1KLN A;  5TZV A;  4R8U A;  5KFJ A;  4FS2 A;  2BR0 A;  4LZD A;  1TK8 A;  4Q45 A;  9ICN A;  5HRD A;  3BJY A;  2W9M A;  1KRP A;  3AQL A;  7ICJ A;  4J9L A;  2ID1 A;  1C7Y A;  4X4P A;  3UQ2 A;  4GXI A;  4YD2 A;  3LWL A;  4ECR A;  5DGB A;  7ICS A;  4FBU A;  7ICO A;  2C2E A;  5J0Y A;  2ZJ8 A;  1T8E A;  8ICO A;  4JWM A;  3H39 A;  2KN7 A;  2F1H A;  5KT7 A;  3PW7 A;  1U47 A;  4X4R A;  3WFS C;  5J0T A;  4GLX A;  2RFF A;  1RZT A;  3C18 A;  4RQ3 A;  5DQG A;  5J0W A;  2FLL A;  4DF8 A;  4F2S A;  4FHX A;  2VA8 A;  4Q43 A;  4F92 B;  7ICE A;  4KTQ A;  4AT9 B;  1ZQK A;  4O9M A;  3UQ0 A;  4P4O A;  4RQ1 A;  2AGO A;  5J2F A;  4RNM A;  1S0N A;  4J9N A;  3C2M A;  2C2R A;  1UT8 A;  3JPO A;  2W9C A;  3T5H A;  4ZH4 A;  3HW8 A;  4O3Q A;  1ZQW A;  1XSP A;  4YN4 A;  2DRB A;  1XU4 A;  4TUP A;  2JEG A;  1TAQ A;  3OUY A;  2MAX A;  4ED8 A;  5J0S A;  3RH4 A;  4M9H A;  4AT7 A;  5J0R A;  3ZDE A;  4DSE A;  2R8G A;  3MGH A;  2W8L A;  4QZI A;  2BPC A;  4FHW A;  2NRT A;  9ICB A;  4WC7 A;  2I1Q A;  2DRA A;  2KZM A;  1TFR A;  4DEZ A;  1XSL A;  3Q8K A;  1ARO P;  4ELT A;  3RAX A;  5KFH A;  1ZJM A;  8ICN A;  8ICK A;  3WFO A;  1VFG A;  4IR1 A;  4B9N A;  3C1Y A;  4E7X A;  5DB9 A;  3RJH A;  5D4B A;  1EXN A;  3H7I A;  2HHV A;  4WC6 A;  5KFL A;  3Q8S B;  2ZHB A;  2M2V A;  3RB0 A;  3TI0 A;  1XSN A;  4YMM A;  4M04 A;  2ZH9 A;  4QWA A;  4QZB A;  2BCS A;  1CUK A;  2C22 A;  4JV1 A;  4E8F A;  1DK2 A;  3RBE A;  4NLZ A;  3T5L A;  4QWB A;  5KG0 A;  1SKS A;  3Q8Q B;  3OJU A;  3GII A;  4PHP A;  4ECS A;  1KFT A;  9ICI A;  1A77 A;  7ICV A;  3GQC A;  4M6W B;  1U48 A;  4KLU A;  3M9O B;  4TQS A;  5J29 A;  5J0U A;  3OV7 A;  4KLL A;  1MQ2 A;  1T7P A;  3ZD9 A;  4NLN A;  4QZC A;  5KFW A;  1UA1 A;  4DL3 A;  3T5J A;  2XGP A;  4EP7 A;  1UEU A;  3GDX A;  1ZQI A;  3MR6 A;  4AT8 B;  5J0Q A;  2Q0Z X;  3H4D A;  2PI4 A;  4I2I A;  1PX5 A;  5F2V O;  1KEJ A;  2VAN A;  1ZQL A;  3SI8 A;  2JZB A;  5KFA A;  2I9G A;  3BDP A;  4ECQ A;  2IHM A;  4DFJ A;  1BPX A;  1BGX T;  4IR9 A;  1BPZ A;  2C2D A;  2FPL A;  3QZ8 A;  1Y88 A;  3SYZ A;  5KFK A;  4KLG A;  3HT3 A;  4DOB A;  3N4M B;  5DQH A;  4J9S A;  7ICN A;  5DLG A;  2F1I A;  8ICJ A;  8ICX A;  3SV4 A;  3WFQ E;  3V6H A;  4K4H A;  1ZQT A;  3RJF A;  2HHW A;  1R8B A;  2DR8 A;  5KFX A;  2DVI A;  4DLG A;  2ASL A;  2M2U A;  5CA7 A;  4X4U A;  4I2C A;  3HWT A;  5IIM A;  8ICF A;  2W9B B;  4X0B A;  5KFD A;  3AQM A;  2ZTC A;  4Z6D A;  4PGY A;  5KFR A;  4QWD A;  2OWO A;  3RAQ A;  7ICG A;  8ICQ A;  5KFI A;  4Q8F A;  4NKU A;  3PX4 A;  4M9N A;  4F5N A;  5KFV A;  3HPO A;  4QZ9 A;  2BPF A;  5DG7 A;  4EBD A;  7ICL A;  4KLQ A;  2UVW A;  4MEX A;  4RPY A;  5JUM A;  4RQ5 A;  7ICM A;  2WTF A;  4IQT A;  2BQU A;  1Z00 A;  9ICG A;  5KG4 A;  4KIT B;  2Y1I A;  5HRH A;  3V7J A;  3JPQ A;  4M9J A;  3ORY A;  3UXN A;  3ISB A;  1L3V A;  2BPG A;  2ZH3 A;  5J2G A;  4K4G A;  3MBY A;  3PO4 A;  3FDS A;  4TQR A;  4NLK A;  4P2H A;  9ICX A;  3NGD A;  4DSL A;  4JWN A;  3JPT A;  2MUT B;  2BKE A;  1JXE A;  4QW9 A;  5CB1 A;  1U9L A;  1NK4 A;  4IQU A;  4JV0 A;  3PX6 A;  3HJ4 A;  4F4W A;  4F91 B;  1X9W A;  4ECX A;  4DS5 A;  3ZDC A;  4DQP A;  2NRZ A;  3B0X A;  5C5J A;  1N48 A;  4ED6 A;  4ATB B;  3PW4 A;  2BE3 A;  4QZD A;  4X4Q A;  4NXZ A;  4B9V A;  1MIW A;  2DFL A;  1ZQF A;  2PFO A;  5DEC A;  2R8I A;  2ISO A;  3HX0 A;  4F4Z A;  5EWF A;  4J9O A;  1X2I A;  2AJQ A;  8ICZ A;  2DPI A;  5HML A;  3BQT A;  1TFY A;  3BQ1 A;  8ICM A;  2KZ3 A;  5D46 A;  5HNK A;  4HYK A;  4F5O A;  4RQ7 A;  4UB2 A;  4O5K A;  5KG3 A;  1HUO A;  5KT3 A;  1ZJN A;  4RNO A;  2W8K A;  4EZ9 A;  1Q78 A;  3H4B A;  5KG7 A;  4EYI B;  9ICO A;  4PGX A;  4X5V A;  3PO5 A;  1ZQP A;  4MEY A;  1SZP A;  2ZH5 A;  4O0I A;  3PR5 B;  2P6R A;  4B9T A;  4LZG A;  9ICQ A;  2XCP A;  4ECY A;  1DK3 A;  5IIJ A;  1MSW D;  1V9P A;  4FH3 A;  1L5U A;  2VA2 A;  4E80 A;  5HRB A;  3V6K A;  3THV A;  2O1P A;  4RU9 A;  4B9L A;  2DR9 A;  3MFI A;  3TQ1 A;  3GIM A;  9ICM A;  3G6Y A;  1D9F A;  3JYY A;  4UB5 A;  1D8Y A;  3H37 A;  2XC9 A;  3MR2 A;  7ICF A;  5J0O A;  1XO1 A;  5HHI A;  2BQ3 A;  1X9S A;  1NKC A;  1ZQA A;  4IRC A;  1F5A A;  4WC2 A;  1L3U A;  4C8K A;  4J9P A;  3GIK A;  1NK6 A;  2FLP A;  4M2Y A;  4KLF A;  1JAJ A;  4DQS A;  1XWL A;  3H8W A;  5DB8 A;  3TFS A;  2NRX A;  1KTQ A;  1QLN A;  4F50 A;  1ZYQ A;  3GV5 B;  2V4Q A;  4F2R A;  5CJ7 A;  2HHX A;  3HIY A;  9ICV A;  3N97 B;  4O3R A;  3V72 A;  4NM2 A;  2ATL A;  5F9L A;  1KDH A;  7ICP A;  2KP7 A;  8ICC A;  4UB4 A;  4MF8 A;  3FYH A;  2M9N A;  3GIJ A;  5IIK A;  4ECW A;  1A76 A;  4DOA A;  4M6W A;  4B9M A;  4I29 A;  5HR9 A;  3ETL A;  4I2F A;  3C5G A;  4R65 A;  2ZH1 A;  4I2B A;  4C8O A;  1WCN A;  4C8M A;  1WOT A;  1SKR A;  4DSF A;  3RB6 A;  4RWN A;  1MC8 A;  2ZTD A;  3C66 A;  4I2A A;  1S0O A;  4MFF A;  3K4G A;  3ISD A;  1ZQC A;  2UVU A;  4R8U B;  2XY7 A;  4F4K A;  8ICT A;  3KHG A;  5IIL A;  4J9R A;  4QZE A;  4DO9 A;  4DFP A;  1KSP A;  4ED7 A;  3RJK A;  1JIH A;  4UAZ A;  1YLQ A;  5KFU A;  2A1J A;  3JPS A;  4ELU A;  1S10 A;  4B9S A;  5III A;  5KFM A;  5DG9 A;  9ICR A;  4RZR A;  3OGU A;  4PH5 A;  2VA3 A;  1NJX A;  4I2G A;  1TFW A;  5KFY A;  5DBA A;  1ZQB A;  4YXM A;  2HHQ A;  9ICE A;  4MFC A;  4EEY A;  4RQ4 A;  3SZ2 A;  1ZQQ A;  1NKE A;  4X4T A;  7ICH A;  4O3P A;  3G6V A;  1TV9 A;  1ZQR A;  3T3F A;  2IA6 A;  3RJI A;  4M47 A;  2ZH4 A;  2BCR A;  4UAW A;  1R89 A;  2W9C B;  3MAB A;  3EW9 A;  5IIO A;  3H40 A;  3PMN A;  5HP4 A;  3RR8 A;  8ICE A;  5HC9 A;  4IQV A;  2FPK A;  5J2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...