4M9LA

Dna polymerase beta e295k soaked with dctp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
326
structure length
313
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPVAGEPLPVSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 107
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9lA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9lA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9lA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9lA03
3AU2A 3RAQA 2IA6A 2ZUBA 4B9NA 1KDHA 7ICUA 5KFUA 4YR3A 4FBUA 3EYZA 5J2EA 3MDCA 5C5JA 4ECWA 7ICMA 5HRGA 5J2FA 4GXIA 3RRHA 4IRKA 2XC9A 1NKEA 3G6YA 2HHWA 2PFNA 3JPOA 1HUOA 3JPNA 4P4OA 1QSLA 5KG5A 4RQ4A 5F2VO 4RQ3A 3PMLA 4YCXA 3BDPA 1Z00B 4JWMA 4WC6A 4QWCA 4I28A 5DQHA 4ELUA 2JZBB 3TAQA 2BKEA 7ICLA 1TAQA 1S0OA 3LWLA 3H4BA 4GC7A 3ZDBA 4ECQA 4DL6A 2JEJA 4QZIA 4XRHA 1IM4A 1EXNA 5HMLA 4QZCA 8ICKA 4C8OA 4YN4A 4PPXA 2HHVA 2ZHAA 3WFPA 1RXVA 2AQ0A 3GILA 4FHVA 8ICSA 4RPYA 1Y88A 1NJXA 2FLNA 1XU4A 1BPXA 5KFLA 2FPMA 4WC4A 5L1KA 5KTQA 2FPKA 4DQSA 5DQIA 2KFZA 2KZ3A 4FHPA 4O0IA 4JWNA 1T4GA 4I2FA 2NRWA 5DDMA 2R8GA 5KT6A 1LB2B 1ZQGA 1ZQNA 3RTVA 2HVIA 3GFKB 1UEVA 4NKTA 2JZBA 4DLGA 4YQWA 4UBCA 4M9JA 9ICAA 1N56A 3UPQA 4I2BA 3HWTA 1U45A 5KFAA 3PX6A 7ICRA 2M2WA 2KZMA 4AT9B 4JK1A 4PH5A 3MGHA 1KRPA 4QZBA 5CWRA 1RPLA 1SKRA 8ICVA 4PGYA 4F93B 4KLIA 4ELTA 4JV2A 1ZQTA 2ATLA 4NLZA 1X9WA 5JUMA 2FLPA 1ZYQA 1A77A 4C8KA 1QLNA 5EOZA 4UAZA 7ICEA 2HHPA 4FHWA 5KG2A 1BPEA 2ASDA 1ZQYA 5KFIA 3PVXA 4S3NA 5HMMA 1H38A 2J6TA 3TFRA 4FH5A 5J0YA 4Z6FA 4DS4A 2NRTA 1L5UA 1RZTA 1RYRA 4DFKA 1XSLA 4ECUA 7ICSA 2O1PA 3G6XA 4IR1A 3EPIA 2HHUA 4O3RA 5J29A 4F5NA 8ICBA 1L3UA 3BQ1A 2XY7A 4WC7A 4R66A 5DECA 1SKSA 4RU9A 4F5OA 1BNOA 4RT2A 4UB5A 4J9SA 2W9CB 5DLFA 2M2UA 5J0XA 3OVAA 1XO1A 4F5QA 4DSKA 5HRKA 5L9XA 3ZDDA 2ZH6A 5IINA 5KG3A 5EWGA 5KFRA 8ICFA 1BPZA 5KFQA 4E8FA 5DB6A 4KLTA 4UB3A 3PR5B 5KFWA 3TI0A 1ZQMA 1DOQA 2IBKA 4KLLA 4B9VA 3OHAA 5KT4A 2AGQA 2UVWA 1S77D 2KFNA 2KP7A 3EW9A 1MSWD 4AT8B 4KLOA 4RNOA 9ICIA 3H39A 1ZQZA 4DFJA 5J0UA 4ED3A 4B9SA 3C1YA 5KT5A 3RJKA 4I27A 8ICIA 3QEBZ 2JEIA 4LT6A 2W8LA 3AQLA 3NGDA 4EP7A 4XQ8A 1D8YA 1FA0A 4ATBB 5KFMA 4ECVA 4RUAA 5HREA 1NK7A 3LK9A 2Q66A 2P6RA 1V9PA 2PFOA 3OSNA 9ICKA 9ICEA 3OUYA 1ZQJA 5HHIA 1NZPA 3UQ0A 5KFNA 4RPZA 7ICHA 5IIKA 4XA5A 4KMUA 5DB8A 3RR8A 4WC3A 9ICJA 1SZPA 8ICLA 1UA0A 3RB4A 3RJEA 4DQIA 4M9GA 1ZQRA 5DB9A 4KLDA 2XY5A 1Q79A 4RWQA 3KTQA 1XSNA 1D9DA 4DQRA 4FHXA 3WFOA 2VA8A 4E80A 5J2KA 3PW4A 4QZGA 5CJ7A 4P4MA 5D49A 5CR0A 2I9GA 4BXOB 4QZHA 3TQ1A 1LV5A 3GIIA 1MQ2A 2DR5A 2HHXA 3SZ2A 3RB0A 3V7KA 2ZH1A 5KFBA 3HT3A 3GIJA 3T5HA 3EPGA 1TV9A 2H5XA 2UVVA 2BCVA 3PX4A 4FS1A 3NTUA 3TANA 3Q8MA 4G3IA 3T3FA 1NJYA 2BPCA 3MR5A 1S0VA 1R89A 3KHHA 3NYBA 2ISOA 2HVHA 4X4NA 1KLNA 4M5DA 4YXJA 8ICGA 4DSJA 7ICGA 5HRFA 2ZTCA 3GIMA 5D4BA 4RQ5A 4ZH4A 2R8IA 5DQGA 4E0DA 4Z6CA 4LZGA 4NLGA 4RQ1A 1JQRA 1MIYA 4KTQA 4QWAA 4Q8EA 3C2LA 3H38A 2NRVA 5HNKA 3C5GA 2XY6A 2DR8A 4UB2A 3K75D 5KFXA 4QZEA 3GQCA 4DSFA 4BXOA 4PHDA 5HP4A 4DQPA 4NLNA 7ICKA 4O3OA 1CEZA 1MQ3A 3ISCA 4M2YA 1BPDA 2W9MA 4XQ7A 4X4VA 4MEYA 5DG7A 4QWBA 1S97A 3H8SA 3H3AA 1S9FA 5DGBA 5DKWA 1KTQA 2R8HA 3BJYA 2FMQA 5BPCA 4F5RA 1ZQDA 4NY8A 2M2TA 8ICMA 1VFGA 4UBBA 4DLEA 1R8CA 3PX0A 1JXLA 2ZH7A 2BCUA 3TFSA 1IXRA 3G6VA 4KLQA 3JZ0A 5KFKA 4ECXA 8ICRA 2ZH4A 4Q45A 4X4UA 4YXMA 2V4QA 4DF8A 5J2HA 4DOAA 4Q8FA 4UD4A 4X4SA 4NM1A 3ZDAA 4I2HA 4O5EA 2PI4A 4FO6A 2IHNA 3JPTA 8ICWA 9ICSA 2BCSA 4RZRA 9ICRA 5F9NA 1MIVA 4FH3A 4ED7A 3V6KA 3EWAA 3HPOA 4GLXA 4EBDA 3RJHA 3RB6A 4QZDA 2XCPA 3GV5B 4RT3A 2ZTEA 4EYHB 4TUPA 4EBEA 2Y1JA 4K4GA 4P2HA 7ICNA 3PW7A 1V4AA 1AROP 3HW8A 3T5KA 4M6WA 4EBCA 7ICFA 1ZQWA 3PMNA 4F8RA 2ZH2A 5L1IA 1KNYA 1S0NA 4DL3A 3MBYA 2C2RA 3ORYA 4J9LA 4M9LA 2PXIA 4P4PA 1TKDA 4KLGA 9ICMA 2JEGA 2W9CA 4MFFA 3M8RA 2W8KA 1NKBA 1TK0A 2LYHA 1U4BA 1D8LA 2R8JA 5D46A 3GV7B 3RH6A 4ECRA 1BGXT 1ZQHA 2XGQA 3THVA 3HX0A 1ZQEA 4IRDA 4IQWA 4M04A 1JX4A 1ZETA 1ZQAA 4RQ7A 4C8MA 3H4DA 2VANA 4X5VA 2JEFA 4C8LA 4DF4A 4E7XA 1TK5A 4DL7A 2PBEA 2MUTB 2C2DA 7ICTA 3QEAZ 1BPBA 4F91B 2KN7A 4GC6A 2C2EA 1T8EA 2UVUA 2R8KA 5HRHA 3N4MB 5HRDA 4F3OA 4C8NA 1ZQFA 4DWIA 4RQ6A 3PY8A 4ELVA 3C18A 2F1JA 3OVBA 4QWDA 3OSPA 3V7JA 4FHYA 4BGDA 3SV3A 3IHQB 4R8UA 2AU0A 2DPIA 2RDJA 3E2EA 4EBJA 2MAXA 2ZUCA 2BQUA 4EYIB 4PHAA 9ICCA 4DFMA 4F4ZA 5L1LA 5J2JA 3JPQA 5KFHA 1TVAA 5KFPA 4F4KA 4ED0A 5HC9A 3V7LA 9ICVA 3H7IA 3OHBA 4DL2A 2FMSA 4F2SA 3M9OB 9ICLA 4KLEA 4QW9A 1BNPA 4KLJA 1U48A 4F50A 1DK3A 4TUSA 4TURA 1ZQCA 2AQ4A 1NK9A 4UQGA 3MGIA 3PV8A 3GDXA 1XSPA 4LVSA 3HJ1A 5KT3A 9ICNA 1F5AA 1K1QA 1ZQPA 1UEUA 1KFDA 1ZJNA 1NJZA 5DLGA 4Q43A 4I2JA 4I2EA 3T5LA 9ICWA 4RNNA 4J9QA 9ICHA 4EZ9A 4ECTA 1SL0A 5HHHA 4YP3A 3BQ0A 5J0RA 4F5PA 4ED1A 3Q8LA 4KLHA 5KFTA 2KTQA 4I2CA 1ZQLA 4IR9A 1NK0A 4F4XA 4DS5A 5DG8A 1X9SA 1NK5A 1OU5A 9ICBA 4RUCA 2ZH9A 2ZH3A 4J9KA 5DDYA 3BQ2A 2M9NA 4O3QA 3RB3A 1L3TA 3OVSA 4MF8A 1XC9A 4I2GA 4QZAA 1KFTA 4NKUA 5J0OA 4QW8A 2VA2A 4J9PA 1NK6A 4R63A 1RYSA 2BHNA 2ZUDA 8ICEA 3PW2A 3ISBA 4IQUA 4JUZA 2ASLA 4IQTA 2V4RA 2NRXA 3RJJA 2RDIA 4I2DA 1NJWA 9ICQA 2HW3A 4PGXA 2ZHBA 3BQTA 4KITB 4YR0A 3SI8A 1ZQBA 1WCLA 5F9LA 1ZQIA 8ICAA 3UPSA 2DR9A 3Q8SB 4RQ0A 3OV7A 4KLUA 1QSYA 3V6HA 5CA7A 2J6SA 3KHLA 2ZTDA 4X0AA 3L9DA 4M47A 3B0XA 4DOBA 4O3PA 1QTMA 3RBEA 5HRLA 4KN4A 4RQ8A 3KHRA 4UAYA 2WTFA 4MF2A 3C2MA 2AGPA 2VA3A 1ZQUA 4J9MA 1U49A 4JV0A 3RAXA 5KT2A 4J9OA 2C28A 2A1JA 1COOA 3M9NB 1XWLA 1S10A 3ZDEA 4B9TA 3T5JA 4PGQA 4O5CA 4DL5A 2DPJA 9ICFA 5KFGA 2O5AA 5KG4A 4QZ9A 5KFCA 3UQ2A 5KFZA 2DRAA 4LZDA 4M0AA 4RWPA 4RNMA 1PZNA 3FYHA 3C2KA 3MR3A 5IIMA 4KLMA 3QZ7A 5J0QA 1JXEA 4F4YA 1UT8A 3QE9Y 5KFSA 1R8AA 2I1QA 4DSIA 9ICUA 1TFYA 2FLLA 3RH5A 5DEDA 3PNCA 2PFPA 2AJQA 1DK2A 5HRBA 1TK8A 5J2IA 2KZZA 3RRGA 2B21A 1JMSA 3C5FA 4DSLA 1VJ7A 3HIYA 8ICPA 1JIHA 4M9HA 5IILA 4F92B 1L3SA 5KFOA 3C1ZA 4EBKA 4X4OA 1MC8A 5TZVA 1D9FA 1K1SA 4KLSA 2ZJ5A 4B9MA 7ICIA 1N48A 5CB1A 5CHGA 5J0PA 1BPYA 4AT7A 3WFQE 1ZQQA 3M8SA 3N97B 2ZH8A 4NXZA 5DGAA 5J2GA 4ECZA 4AT9A 4XUSA 2BGWA 5KFFA 2XO7A 2ASJA 3JYYA 4BDPA 8ICOA 3GV8B 3TAPA 4I29A 4BWMA 3UXNA 2DFLA 1ZQOA 2HHTA 1QSSA 4K4IA 5KFJA 1T7PA 4O5KA 4GXJA 7ICVA 5J2BA 4ECSA 4YD1A 1S76D 1U47A 4EZ6A 4Q44A 2W9BA 2BPGA 2IMWP 4Z6EA 2C22A 3MFHA 1S0MA 4IQVA 4PHEA 2UVRA 1NK8A 3RJFA 1TAUA 3TARA 3Q8KA 2BQRA 1L3VA 5CP2A 1ZQSA 1KSPA 5J2DA 4RWNA 1KEJA 2HHSA 4PHPA 4RPXA 3LDAA 3UXPA 5KG1A 4YMMA 5IIOA 3H8WA 3RJIA 4ECYA 4I2AA 4UB4A 4ED6A 3RJGA 4YFKA 3AUOA 4O3NA 3C21A 8ICYA 3MABA 3MDAA 1BVSA 2Y1IA 3ZD8A 1WCNA 4WC0A 1TFWA 1T3NA 1SL1A 3Q8PB 3JPSA 8ICUA 1A76A 4CCHA 4RQ2A 4MFCA 4J9NA 4TQRA 1SL2A 2IHMA 3OJSA 8ICCA 1ZQVA 4YMNA 1CUKA 5KT7A 3HP6A 2P66A 3C23A 8ICQA 9ICOA 3C66A 1NK4A 2NRKA 4IRCA 5HRIA 1U9LA 4AT7B 5BOLA 4QZ8A 3JPPA 3Q8QB 4DSEA 4X4RA 4DFPA 4YR2A 2OWOA 2BCQA 2XGPA 9ICXA 1HUZA 8ICTA 3Q8RB 4TQSA 4ED2A 4R64A 4K4HA 1UETA 2BQ3A 2ZJ8A 3V6JA 5J2AA 1DGSA 3FDSA 3RR7A 7ICQA 2BE3A 3OJUA 8ICXA 4WBYA 2BDPA 3GIKA 4WC2A 3AQMA 3PW0A 5KFDA 2XCAA 3MR6A 1C7YA 5KG0A 3PR4A 2DVIA 4QWEA 3ZD9A 2A1JB 4GXKA 4M6WB 4QZFA 3LWMA 1JAJA 4EEYA 4O3SA 1X2IA 4KN7A 3ETLA 4BWJA 4F4WA 4ATBA 3V72A 4HYKA 4R8UB 3OGUA 5KFVA 3PO5A 4O9MA 1ZQKA 2DRBA 5J2CA 2ALZA 3WFRE 3OUYB 3SV4A 4TUQA 5KFYA 1JN3A 5BOMA 4FBTA 4UAWA 1NKCA 1UT5A 5J0SA 2BCRA 1NOMA 3RBDA 3H40A 3RH4A 7ICOA 4Z6DA 1B22A 1HJPA 4ED8A 2BPFA 2MUTA 2PI5A 3AQNA 2DR7A 2NRZA 2GWSA 4X4QA 4DQQA 4F2RA 4WC5A 1ZQXA 4MFAA 3QZ8A 1ZJMA 5J0WA 2FMPA 7ICJA 1RXWA 1PX5A 4KLFA 4R65A 3H37A 9ICGA 1Q78A 4M9NA 8ICJA 1B43A 3K4GA 4WBZA 3B0YA 4WCWA 8ICZA 5HR9A 3ISDA 4B9LA 4JV1A 3PO4A 8ICNA 4UD5A 3UXOA 4FS2A 2HHQA 1R8BA 2M2VA 5IIIA 5EWFA 2FPLA 4YMOA 1X9MA 4MEXA 4X4PA 3WFSC 4DO9A 3IM1A 2BR0A 1SKWA 3H8JA 3LQCB 1Z00A 5J0TA 4YD2A 5IIJA 5DBCA 3MFIA 5L1JA 3AU6A 1XS9D 2ISPA 2V9WA 2PFQA 3MR2A 3HJ4A 3SYZA 4X0BA 2ID1A 1YLQA 2W9BB 4DEZA 4YVZA 2J6UA 4RWOA 4YG2A 5EWEA 2Q0ZX 4NM2A 3M9MB 2W9AA 4B9UA 1MIWA 1WOTA 1Z3EB 2F1IA 2F1HA 2P6UA 4NLKA 8ICHA 4I2IA 4IG8A 3AQKA 5DG9A 4DL4A 1UA1A 5DBBA 2ZH5A 2ZJAA 2RFFA 1TFRA 1KFSA 4X4TA 5DBAA 3EZ5A 5KG6A 1NO5A 4WC1A 3JPRA 3PW5A 2AGOA 9ICPA 5KG7A 4J9RA 9ICTA 4DOCA 3ZDCA 4UB1A 3KHGA 4AT8A 7ICPA 5DB7A 5KFEA
chains in the Genus database with same CATH superfamily
3RAQA 4B9NA 7ICUA 4YR3A 2WFAA 2VKQA 4ECWA 7ICMA 4P4OA 5F2VO 2EAPA 4WC6A 1SWWA 4ELUA 2JZBB 2OCEA 2BKEA 3KZXA 1TAQA 5AM4A 1S0OA 2EQYA 4Y2TA 2JEJA 1EXNA 4C8OA 2HSZA 4RPYA 1XU4A 2FPMA 5KTQA 2KFZA 5ALOA 3RFAA 2KZ3A 4FHPA 1ZQGA 3L3FX 2WF6A 5AM1A 2G5HB 1HIWA 4YQWA 2NO4A 4UBCA 5AHXA 3AMZA 1CRXA 7ICRA 4AT9B 4JK1A 1PVRA 1RPLA 1SKRA 4PGYA 1DGJA 1ZQ1C 1N5WA 2PKEA 2ATLA 5ALIA 1X9WA 5JUMA 4NLZA 1A77A 2KIVA 1ZQYA 2HI0A 2KHVA 4FH5A 4Z6FA 4ECUA 2LM1A 1XO0A 1L3UA 2H3IA 2LM4A 4WC7A 2HN1A 4UB5A 5DLFA 3OVAA 5EWGA 4K96A 1N60A 2OHFA 3TI0A 1DOQA 4QNLA 3ER9B 1S77D 1C20A 4RNOA 9ICIA 3H39A 4DFJA 5J0UA 5KT5A 2E1EA 2JEIA 3AQLA 4XQ8A 5HREA 5GTIU 3LK9A 3F53A 2NO5A 3OSNA 2H3FA 9ICEA 2WAQF 1ZQJA 7ICHA 4Y2UA 2MSNA 2ZIWB 2XY5A 4RWQA 1D9DA 1JRPA 4QZGA 5D49A 2I9GA 3NS1A 3AL0B 4OCZA 3GIIA 1MQ2A 4IL6U 2ZH1A 3V7KA 5KFBA 3ICXA 2HBLA 2H5XA 2UVVA 4CF5A 2BCVA 4G3IA 1UQVA 3ONNA 2G08A 2KICA 4X4NA 4RQ5A 5DQGA 4Z6CA 3A0BU 2QKQA 3H38A 3E58A 4QWAA 3C2LA 2XY6A 2EDUA 2WF7A 5KFXA 5KL8B 4BXOA 4DQPA 4O3OA 3WK4A 1MQ3A 4P0QB 3BS5A 3ZI4A 3WK5A 3WU2U 4MEYA 1S97A 3H8SA 3QUCA 1X6JA 2I6XA 5DKWA 1KTQA 4B6JA 4NY8A 4F5RA 8ICMA 4AYBF 2ZIWA 1JXLA 2BCUA 4ICAA 3F2BA 2LHTA 4ECXA 5AKYA 2ZH4A 1QQ5A 4X4SA 9ICSA 2D8CA 9ICRA 1L7MA 4RZRA 5B3PA 4GLXA 4UASA 2L5YA 3GV5B 4RT3A 4TUPA 4K4GA 3I76A 5L1IA 1KNYA 2JV3A 4P4PA 2QARB 1O03A 5D63A 4DFDA 3M8RA 1WYGA 5D46A 3THVA 1OW5A 3HX0A 4IRDA 4IQWA 3HILA 3HRDD 4U7CA 4RQ7A 4DF4A 2QB0A 2W11A 5ALKA 2G5IB 2MUTB 1BPBA 1T8EA 2R8KA 3QU9A 4C8NA 4DWIA 3PY8A 1FFUA 1F5SA 3V7JA 2AU0A 3E2EA 2ZUCA 4DFMA 5J2JA 3JPQA 5KFHA 5KFPA 4AP9A 1ZD4A 5G5HA 4F2SA 4QW9A 1U48A 2K4IA 1X9XA 4TURA 4P0PA 2AXTU 1X40A 1KFDA 1NJZA 4WH5A 4RNNA 4J9QA 9ICHA 4ECTA 1SL0A 5HHHA 4YP3A 3BQ0A 4UAVA 4KLHA 2RHFA 4I2CA 2ZH3A 4FO1A 2M9NA 1L3TA 3CRXA 1XC9A 1KFTA 4QIWC 4LJXA 1NK6A 3SQIA 1KW4A 4LEYA 8ICEA 5AI8A 2ASLA 2LYBA 2WF9A 4IQTA 5ALGA 4OAIZ 5AIAA 4I2DA 9ICQA 3QU5A 3SAGA 1VJ5A 5CHEA 3BZCA 3SI8A 1Z19A 2DR9A 4RQ0A 2J6SA 5ALZA 3B0XA 4QIWF 3C2MA 5ALHA 2AGPA 2C28A 5KT2A 4J9OA 2G09A 4B9TA 3GZFA 4JMUA 2GA9D 4RWPA 3MR3A 3QZ7A 3QE9Y 3SEIA 4DSIA 2HMXA 1N62A 1TFYA 5DEDA 5J2IA 3RRGA 4DSLA 1JMSA 3HIYA 2A3VA 2XVTA 5IILA 4EBKA 1MC8A 4ZOHC 2WHEA 2ZJ5A 1BPYA 5AK6A 4NXZA 1YZ6A 4LEZA 2I5HA 5J2GA 4XUSA 2BGWA 4O67A 2F76X 2XO7A 3SAHA 4BDPA 4OAHA 4OJ5A 3TAPA 4I29A 5D61A 2DFLA 2ZIUB 3JCFA 3U26A 4GXJA 1S76D 3SR6A 1U47A 4EZ6A 3UMCA 4Q44A 2W9BA 3CK6A 2IMWP 4Z6EA 4WQKA 2YMLA 4NXUA 2BQRA 4Y2SA 4US9A 2JMGA 4NL9C 3LDAA 5KG1A 3H8WA 3LVWA 3RJGA 3QU4A 3AUOA 3MABA 1TFWA 1SL1A 3Q8PB 8ICUA 1A76A 4CCHA 4RQ2A 4MFCA 4TQRA 1ZQVA 4J03A 3HP6A 8ICQA 2NYVA 4IRCA 1X66A 4QZ8A 3JPPA 3IV6A 2JRZA 9ICXA 1HUZA 2Q4TA 1UETA 4GFJA 7ICQA 8ICXA 4WC2A 3AQMA 1PK1A 1C7YA 4M6WB 1JAJA 4O3SA 1X2IA 4F4WA 4BWJA 1N2XA 4BUGA 5J2CA 2PMZF 3KBBA 5AM3A 4FBTA 4P0QA 3NVYA 5ALRA 5J0SA 3H40A 5E79U 4Z6DA 1HJPA 2MUTA 2PI5A 3AQNA 2DR7A 4X4QA 5F3XB 7ICJA 5AI6A 2K8CB 3ETRA 4M9NA 2W43A 8ICJA 3ISDA 4JV1A 3A0HU 4UD5A 3UXOA 2HHQA 1R8BA 5IIIA 2FPLA 2BR0A 3LQCB 3ER8C 3L5KA 3BZKA 3MFIA 4YD2A 2V9WA 3F2CA 5C0YA 3HKZC 4DEZA 1WG8A 4RWOA 3F2DA 3M9MB 4NLKA 4I2IA 1UA1A 5DBBA 2ZJAA 1TFRA 5DBAA 3EZ5A 3JPRA 5KG7A 4DOCA 4UB1A 3KHGA 4AT8A 7ICPA 5DB7A 1NI3A 1FFVA 5AI9A 2IA6A 4FFDA 4OJ6A 5J2EA 1L7OA 4AYBC 2MU2A 4GXIA 3RRHA 5ALMA 1NKEA 1QSLA 1T94A 3PMLA 3CYMA 3BDPA 1Z00B 3TKAA 4JWMA 4QWCA 4I28A 4CGZA 3UMGA 3LWLA 3H4BA 4Y2PA 4GC7A 5B3QA 3ZDBA 3PSIA 4QZIA 4XRHA 2K4EA 4UW9A 8ICKA 1RXVA 2AQ0A 8ICSA 1FEZA 1ZRNA 5L1KA 5DQIA 3AN1A 3MGVA 2W04A 4O0IA 2R8GA 2D6FC 3H0RB 4Y2VA 1ZQNA 2YMQA 2HVIA 3EF2A 3PX6A 2KKVA 5T14A 4CF3A 2KZMA 1N63A 1RM6C 2W7PA 4EGWA 4F93B 4ELTA 3NASA 2W7OA 4C8KA 5ALYA 5KG2A 1BPEA 4S3NA 3PVXA 5HMMA 2AH5A 1KN5A 4DS4A 2Z7JA 1L5UA 1YT3A 4DFKA 7ICSA 2O1PA 2HHUA 3LYSA 4O3RA 3BQ1A 2XY7A 3AEVA 4OJLA 5J0XA 1KBUA 2M2UA 4F5QA 4MKPA 3NVZA 3PSFA 3ZDDA 5KG3A 1BPZA 1L8LA 4B9VA 3RF9A 1L7PA 3EW9A 1MSWD 4AT8B 1IG6A 2EANA 4B9SA 3C1YA 3RJKA 8ICIA 4FE3A 2BBJA 1ZD2P 2FCLA 2G0AA 3IG5A 4LT6A 3NGDA 3D2NA 3CW2C 4ATBB 1FA0A 5KFMA 4ECVA 2P6RA 4RPZA 5AM0A 1SZPA 3RJEA 4NWIA 5DB9A 1Q79A 5AKJA 4DQRA 3PW4A 2DKZA 4A8EA 4BXOB 5CR0A 1LV5A 1SIJA 3RB0A 5CEHA 4NXXA 3EPGA 1KKXA 4FS1A 3NTUA 3TANA 3Q8MA 2EZYA 2BPCA 1K5OA 2JXJA 1R89A 3KHHA 2ISOA 1KLNA 5HRFA 2ZTCA 5D4BA 1MIYA 1JQRA 3CNHA 2M0NA 2Y0SF 2NRVA 3C5GA 4UB2A 3NRWA 4NLNA 1CEZA 2KNJA 4KB6A 1BPDA 4XQ7A 4X4VA 1SV0A 2FMQA 1ZQDA 1VFGA 2M2TA 2ZH7A 3TFSA 1IXRA 4KLQA 3JZ0A 8ICRA 4Q45A 2V4QA 4DF8A 5J2HA 3N7SC 4DOAA 4UD4A 2XICA 1RG6A 2ODGA 4NM1A 4I2HA 4O5EA 4FO6A 2IHNA 4FZLA 5F9NA 3HKZF 4FH3A 3V6KA 4FZMA 3HPOA 4CNQA 2GO7A 4EBDA 3RB6A 4QZDA 4EBEA 4USAA 5ALNA 2Y1JA 3PW7A 5ALEA 4M6WA 7ICFA 1J97A 2ZH2A 1D8BA 1S0NA 3MBYA 1B0XA 2PXIA 2W9CA 1TK0A 1U4BA 1D8LA 3GV7B 3RH6A 1ZQHA 3AQEA 2G06A 2XGQA 3H4DA 4C8LA 4X5VA 1L6NA 3NKUA 4UAUA 4GIBA 3QEAZ 4GC6A 2UVUA 4F3OA 1ZQFA 1Q8KA 3C18A 3VCBA 3SV3A 3IHQB 1OUQA 1V38A 4EYIB 9ICCA 5L1LA 4F4KA 2E8MA 5HC9A 9ICVA 3H7IA 3OHBA 2GH1A 3M9OB 1TAMA 4KLEA 1BNPA 5ALPA 2DUYA 2AQ4A 1NK9A 4UQGA 3MGIA 3PV8A 3H8MA 3GDXA 4LVSA 3IP4B 4I2JA 1GO3F 3T5LA 4F5PA 5J0RA 3Q8LA 4EV6A 5KFTA 1UCVA 1ZQLA 4G9BA 4F4XA 2OYYA 4NXTA 4DS5A 5DG8A 1X9SA 2ZH9A 1QQ6A 4RUCA 1ZD5A 4O3QA 1X42A 2WAQC 4MF8A 4QZAA 5J0OA 2BHNA 4UB6U 3PW2A 2V4RA 2EZXA 4C80A 2IHOA 3QX7A 4NL9A 4PGXA 2ZHBA 2DBYA 4YR0A 8ICAA 5F9LA 2Y9UA 5ALXA 4CE6A 4X0AA 3DV9A 4K99A 2HOFA 2ZXHA 4MF2A 3H0LB 1PK1B 4J9MA 3RAXA 1AQ6A 5ALSA 2HOQA 2E5SA 1MN8A 3T5JA 4O5CA 5KG4A 4QZ9A 5J8YA 2DRAA 1Q46A 2KJ8A 4M0AA 1PZNA 3KZIU 3C2KA 5IIMA 1UT8A 5CFUA 2I1QA 2FLLA 2PFPA 5HRBA 1A0PA 1TK8A 2KSOA 3C5FA 8ICPA 4WOYA 2JR5A 3BQ7A 4EX6A 4RQMA 1F44A 4X4OA 1K1SA 5ALUA 3M1YA 7ICIA 1N48A 5CB1A 5J8YC 5CHGA 5J0PA 4AT7A 2JGAA 1B4FA 3N97B 5DGAA 5KFFA 2K8BB 3JYYA 3VC8A 8ICOA 1FIQA 4BWMA 3IDWA 4K4IA 5KFJA 3PSTA 1PK3A 5J2BA 1J2MA 2BPGA 2C22A 2HBJA 1S0MA 5H2FU 2OM6A 3TARA 1KSPA 5J2DA 4RWNA 4PHPA 5K4LA 3UXPA 2EWRA 3SMVA 4C4TA 2YTUA 1Z1VA 2K4PA 3MDAA 2Y1IA 1WCNA 4WC0A 4CDGA 4J9NA 2IHMA 2K4HA 3OJSA 3C66A 1CUKA 5KT7A 3WK9A 4WJ3B 4AT7B 5BOLA 3Q8QB 2XIDA 3OWGA 4X4RA 4YR2A 1SV4A 4UATA 3Q8RB 4TQSA 5CRXA 4OO1J 1L7NA 3UM9A 3PW0A 3PR4A 4QWEA 2VJ4A 3ZD9A 1N61A 4ATBA 4HYKA 2DRBA 3OUYB 1URJA 4TUQA 4P0PB 5ALJA 1WUDA 1L8OA 2YQEA 3RH4A 1B22A 2BPFA 2GWSA 1ZQXA 3QZ8A 1RYUA 1VLBA 1RXWA 1PX5A 1JALA 2PMZC 2KEYA 3B0YA 2ZXIA 3PO4A 8ICNA 2KSOB 3KD3A 5ALTA 4OAGA 2M2VA 5EWFA 1X9MA 4X4PA 4PZNA 5J0TA 1XS9D 3AU6A 2ISPA 5AI4A 2PFQA 3HJ4A 3SYZA 3WK6A 2W9BB 4YVZA 4YG2A 4B9UA 1Z3EB 2F1HA 8ICHA 3AQKA 4DL4A 3SENA 2ZIUA 1KFSA 2YMPA 3KFUF 5AI0A 5KFEA 5KAFU 3SD7A 2NV3A 1COKA 2E8NA 2ZUBA 5KFUA 4FBUA 3EYZA 1UHUA 5KL1B 5C5JA 2D3DA 5J2FA 2XC9A 2HHWA 2PFNA 1UPHA 4EEKA 5KG5A 4RQ4A 4RQ3A 1ZXIA 5DQHA 3TAQA 7ICLA 5CFSA 2QB0B 4ECQA 4DL6A 4QZCA 2QARA 5HMLA 4YN4A 2ZHAA 2HHVA 1ZRMA 3GILA 2YN4A 1Y88A 2FLNA 1BPXA 5KFLA 4WC4A 2MA1A 4DQSA 3J81j 1T4GA 2NRWA 5DDMA 5KT6A 1LB2B 3BS7A 2JH7A 3GFKB 4NKTA 4PJ0U 1YZ7A 1N56A 3UPQA 1J2NA 2M2WA 3TADC 3MGHA 3WKEA 4QZBA 4UB8U 5ALLA 8ICVA 5D62A 4JV2A 2FLPA 1ZYQA 5EOZA 7ICEA 4FHWA 5KNIA 2ASDA 2KVSA 3I28A 1H38A 2J6TA 1CI4A 2H3ZA 2NRTA 1RZTA 1RYRA 4IR1A 8ICBA 5EE9A 4R66A 5DECA 2HDOA 4F5OA 4RT2A 5L1MA 2B6GA 2HN2A 5HRKA 5L9XA 2ZH6A 5IINA 2EAOA 5KFQA 4E8FA 5DB6A 4UB3A 3PR5B 3E0FA 2IBKA 2AGQA 5KT4A 2KFNA 2KP7A 1M6YA 4CRXA 2F8LA 3N7RC 3QEBZ 4EP7A 2W3RA 4NV0A 2Q66A 1V9PA 9ICKA 4BJQA 4C7ZA 3QNMA 5HHIA 5IIKA 3RR8A 4KMUA 3RB4A 4M9GA 1ZQRA 2ZG6A 3WFOA 2K60A 1XSNA 3KTQA 4E80A 3ERCC 5J2KA 5AICA 2YB4A 3IG8A 3TACB 3SZ2A 3BS5B 3HT3A 3GIJA 3PX4A 3N28A 4WC3A 3KOOA 3MR5A 4YXJA 4DSJA 3GIMA 4NLGA 4U6PA 5EE1A 2DR8A 4DSFA 3GQCA 7ICKA 4PHDA 5HP4A 1SGGA 3ISCA 4Y2JA 2W9MA 4K98A 1ZD3A 3H3AA 4QWBA 1S9FA 5DGBA 3BJYA 5BPCA 2CRXA 1R8CA 2Y0SC 3PX0A 2LMRA 5ALDA 2BDUA 5KFKA 5AKZA 4X4UA 3FM9A 2KKPA 1RDFA 2QLTA 3ZDAA 3JPTA 1MIVA 2JH1A 4ED7A 3EWAA 1RQNA 2F8KA 2XCPA 2ZTEA 4P2HA 3T5KA 1ZQWA 3PMNA 2C2RA 3ORYA 4J9LA 4M9LA 4KLGA 9ICMA 1V85A 4WQLA 4EELA 2W8KA 1Z1BA 1XNSA 1NKBA 1SWVA 1BGXT 1PVPA 4M04A 1JX4A 1ZETA 4C8MA 1TK5A 2DWQA 3R9KA 2C2DA 7ICTA 2LBOA 4F91B 2KN7A 2KVCA 5HRHA 3N4MB 4ELVA 2F1JA 4QWDA 3OSPA 4FHYA 1LVHA 2EH9A 2RDJA 4EBJA 2F77X 2BQUA 4PHAA 4KX5A 3QUQA 4ED0A 3AM9A 9ICLA 4KLJA 5AKKA 1ZQCA 3HJ1A 9ICNA 1ZQPA 5ALVA 1ZJNA 1TE2A 2DL0A 5DLGA 9ICWA 4CF4A 3FC4A 3PZPA 1Z4OA 4EZ9A 2W03A 1QCKA 4IR9A 5TISU 3NUQA 1OU5A 1NK5A 5AI5A 4JB3A 5DDYA 5B5EU 3BQ2A 4KMOB 3RB3A 3OVSA 4I2GA 4NKUA 2H3QA 4J9PA 4R63A 2YB1A 1RYSA 4C7YA 2ZUDA 3ISBA 1NJWA 2LKYA 3BQTA 1ZQIA 2DGZA 1WCLA 3Q8SB 3OV7A 4KLUA 5CA7A 2IUBA 4DOBA 1OXJA 1S5LU 3RBEA 2N1RA 4PL1A 4UAYA 1ZQUA 4OJPA 1U49A 4JV0A 2A1JA 1COOA 1XWLA 5AKLA 1S10A 3ZDEA 4DCCA 4PGQA 5KFGA 2O5AA 3UQ2A 5KFZA 4LZDA 2RP5A 3FYHA 3LVVA 1QH9A 5J0QA 2FE9A 3IN5A 4OAFA 9ICUA 2IOFA 2AJQA 3WKCA 2KZZA 2B21A 1IV8A 1VJ7A 1JIHA 4M9HA 2ZIXA 4F92B 1L3SA 3C1ZA 4K9BA 5TZVA 1D9FA 2AHOB 4KLSA 3K1RB 4B9MA 1ZQQA 2ZH8A 2KJ9A 3S6JA 1SXDA 3GV8B 4HX0A 4ACOA 2KHQA 1ZQOA 1DXSA 1QSSA 2JHDA 2A19A 7ICVA 4YD1A 3KKAA 1A6SA 3AQFA 3MFHA 2DQNB 4IQVA 3Q8KA 1ZQSA 3WKAA 3OPXA 3EUB2 2HHSA 4YMMA 4ECYA 4UB4A 4ED6A 4QJFB 4YFKA 8ICYA 1BVSA 1SV0C 1GPJA 1SL2A 8ICCA 2P66A 1NK4A 2NRKA 4DSEA 2E8PA 2OWOA 8ICTA 1O08A 2ZJ8A 5J2AA 1DGSA 3RR7A 4WBYA 2EZZA 2BDPA 3OTQA 5KFDA 2XCAA 3MR6A 2DVIA 3LWMA 4EEYA 5JU5A 3ETLA 2LI6A 4LEWA 4R8UB 3OGUA 3PO5A 4O9MA 2K8AA 2ALZA 3WFRE 3SV4A 1ED1A 5BOMA 5FP0A 1NKCA 1UT5A 4O69A 1NOMA 2GOLA 4F72A 3RBDA 7ICOA 4KM5A 2NRZA 4F2RA 1ZJMA 5AKGA 4F71A 5J0WA 4KLFA 5HR7A 1Q78A 2P35A 4WBZA 4WCWA 8ICZA 5HR9A 5B66U 3H0MB 4MEXA 2KJ5A 2E1FA 3NVWA 3IM1A 3H8JA 1Z00A 3CP8A 5AK5A 2WF5A 4X0BA 2F3NA 1YLQA 2J6UA 5EWEA 2W9AA 1MIWA 2GAFD 3F5AA 2F1IA 2P6UA 3QU7A 2ZH5A 4NXVA 2RFFA 1PVQA 4WC1A 2AGOA 9ICPA 3ZDCA 3O0FA 2IOHA 3AU2A 1KDHA 3WK7A 3MDCA 3MCRA 5HRGA 4IRKA 1NNLA 2OH2A 3G6YA 2YX8A 3JPOA 1HUOA 3JPNA 1Q3UA 1HEKA 4YCXA 3KKAC 2LPEA 5JTGA 2HCFA 1IM4A 4LEVA 4PPXA 2E8OA 3WFPA 4FHVA 1NJXA 1NZBA 4KX3A 2FPKA 1T3QA 4FZNA 2ES6A 4JWNA 4I2FA 3M7DA 1LKYA 1SB3C 3RTVA 1UEVA 2R18A 2JZBA 4DLGA 4M9JA 9ICAA 1JROA 5ALWA 4I2BA 3HWTA 1U45A 5KFAA 3SAFA 4PH5A 1KRPA 5CWRA 1SXEA 4KLIA 1ZQTA 1QLNA 4OJOA 4UAZA 2HHPA 2RLTA 3C28A 2KG5A 5KFIA 3TFRA 5J0YA 1Z4NA 3UMBA 1XSLA 3G6XA 3EPIA 5AK3A 5J29A 4F5NA 4N7RA 1SKSA 2BZFA 4RU9A 1BNOA 4J9SA 2W9CB 1XO1A 4DSKA 5AIBA 5KFRA 8ICFA 2KMDA 4KLTA 1ZQMA 3PSPA 5KFWA 5G5GA 4KLLA 3OHAA 2UVWA 4KLOA 4US8A 1ZQZA 4ED3A 2VJ5A 4I27A 2W8LA 2QB1A 1D8YA 5JTIA 2KIWA 4RUAA 1NK7A 3I1YA 2PFOA 3OUYA 1IIPA 1NZPA 4O68A 5JRTA 3UQ0A 5KFNA 3ALRA 4XA5A 5DB8A 9ICJA 8ICLA 1UA0A 4DQIA 4KLDA 4FHXA 2VA8A 2KD1A 3NWIA 5GTHU 4RQNA 5CJ7A 4P4MA 2HBMA 4QZHA 3TQ1A 2DR5A 1DRGA 2HHXA 4NLBA 3D6JA 3T5HA 1TV9A 2EAMA 3T3FA 1NJYA 2WF8A 2YMMA 1S0VA 3F5EA 1X6IA 3NYBA 2FDRA 2HVHA 4M5DA 8ICGA 7ICGA 4ZH4A 2R8IA 4LZGA 4E0DA 4RQ1A 4KTQA 4Q8EA 1ECWA 4NJ8A 4EENA 5HNKA 3K75D 4QZEA 2XI9A 3TADA 4M2YA 4NLCA 2HOIA 5DG7A 2KK0A 2R8HA 3NRZA 2CN1A 4JLXA 4O3MA 4UBBA 4DLEA 3D2QA 3G6VA 1SZHA 4YXMA 4Q8FA 4JLZA 2PI4A 4HAIA 8ICWA 2BCSA 2W3SA 3FAHA 3RJHA 4UARA 4EYHB 7ICNA 3DDHA 1V4AA 1AROP 3HW8A 2IOFK 4EBCA 4F8RA 4DL3A 1TKDA 2JEGA 4PL2A 4MFFA 2LYAA 2LYHA 2R8JA 4OD0A 4ECRA 5EE3A 1ZQEA 2WB1C 1ZQAA 2VANA 2JEFA 4E7XA 4DL7A 5AM2A 1QQ7A 2PBEA 1FO4A 5AKIA 2C2EA 5HRDA 4NXWA 5AKHA 4Y2XA 4RQ6A 3OVBA 4BGDA 2F44A 5AK4A 4R8UA 2DPIA 2MAXA 4Y2RA 2B0CA 5A0LA 4F4ZA 1LKYB 2CXYA 1TVAA 3V7LA 3QUBA 2FMSA 4DL2A 3HJEA 1DK3A 5ALFA 4TUSA 4F50A 5AKXA 1XSPA 3WK8A 2OXOA 2BBHA 5KT3A 1F5AA 5ALQA 1K1QA 1UEUA 4Q43A 4I2EA 2CPRA 4ED1A 2KTQA 3IRUA 2W54A 1NK0A 1KQQA 9ICBA 4J9KA 5KAIU 2B4VA 2E3TA 4QW8A 4BX9C 2VA2A 4C4RA 4IS7A 4IQUA 4JUZA 2NRXA 3RJJA 2RDIA 4I0UA 2HW3A 4KITB 1ZQBA 1QSYA 3V6HA 3KHLA 2ZTDA 5HR6A 2HBKA 3L9DA 4M47A 4MHVA 3M6ZA 4O3PA 2G07A 1QTMA 5HRLA 4KN4A 4RQ8A 3KHRA 2WTFA 3MC1A 4Y2QA 2VA3A 2ZIXB 3M9NB 3T79A 2F2AB 2MRLA 4DL5A 2DPJA 9ICFA 5KFCA 1F0MA 3C29A 4EEBA 4RNMA 4KLMA 1JXEA 4F4YA 3GU3A 2FJ6A 5KFSA 1R8AA 3RH5A 4EEDA 3PNCA 4O6AA 1DK2A 4Y2YA 1P7DA 2H3VA 5AM5A 5KFOA 1ZOLA 3L4PA 1KL9A 3WFQE 2RRDA 3M8SA 4ECZA 4AT9A 3B9JA 2ASJA 3UXNA 2HHTA 1T7PA 3QU2A 4O5KA 4ECSA 3D2SA 4PHEA 2ZIVA 1NK8A 2UVRA 4C0ZA 3RJFA 1TAUA 1L3VA 3QYPA 5CP2A 4K9AA 1KEJA 2B56A 1PUZA 4RPXA 5IIOA 3RJIA 4I2AA 4O3NA 3C21A 2W55A 2OEHA 3ZD8A 2Y9TA 1T3NA 3QXGA 3K7DA 3JPSA 3WKDA 1MA7A 1VDVA 2DKXA 2ESEA 4YMNA 9ICOA 3C23A 2K89A 5HRIA 1U9LA 1WWVA 3M6KA 2KV2A 2RQ5A 4DFPA 2BCQA 2XGPA 3PHZA 4ED2A 4R64A 4K4HA 2BQ3A 3V6JA 3FDSA 2BE3A 3OJUA 3WKBA 3GIKA 3K1ZA 5KG0A 2KOBA 2A1JB 2A1AA 2VIXA 4QZFA 4GXKA 4K97A 3N7PD 5CFTA 1S8OA 4KN7A 2DF4B 2O6KA 3QUTA 3V72A 2WB1F 5KFVA 1ZQKA 2YY6A 5KFYA 2GLEA 1JN3A 1Q3VA 4UAWA 3NVOA 2BCRA 4K8VA 4C4SA 5AKEA 4ED8A 1JUDA 3ED5A 4DQQA 4WC5A 4EX7A 4MFAA 2FMPA 4R65A 3H37A 9ICGA 1WWUA 1B43A 3K4GA 1JI7A 4IC9A 4B9LA 4FS2A 3DEEA 3WFSC 4YMOA 1V97A 4DO9A 1SKWA 2B51A 3UPSA 4X4TA 5IIJA 5DBCA 5L1JA 3MR2A 2ID1A 2KE7A 2Q0ZX 4NM2A 1WOTA 4IG8A 3NVVA 4XJEA 5DG9A 2FI1A 1NO5A 5KG6A 1RQLA 4PZOA 3PW5A 4J9RA 9ICTA 5EE0A 1N5XA 2ZIVB
chains in the Genus database with same CATH topology
3AU2A 3RAQA 2IA6A 2ZUBA 4B9NA 1KDHA 7ICUA 5KFUA 4YR3A 4FBUA 3EYZA 5J2EA 3MDCA 5C5JA 4ECWA 7ICMA 5HRGA 5J2FA 4GXIA 3RRHA 4IRKA 2XC9A 1NKEA 3G6YA 2HHWA 2PFNA 3JPOA 1HUOA 3JPNA 4P4OA 1QSLA 5KG5A 4RQ4A 5F2VO 4RQ3A 3PMLA 4YCXA 3BDPA 1Z00B 4JWMA 4WC6A 4QWCA 4I28A 5DQHA 4ELUA 2JZBB 3TAQA 2BKEA 7ICLA 1TAQA 1S0OA 3LWLA 3H4BA 4GC7A 3ZDBA 4ECQA 4DL6A 2JEJA 4QZIA 4XRHA 1IM4A 1EXNA 5HMLA 4QZCA 8ICKA 4C8OA 4YN4A 4PPXA 2HHVA 2ZHAA 3WFPA 1RXVA 2AQ0A 3GILA 4FHVA 8ICSA 4RPYA 1Y88A 1NJXA 2FLNA 1XU4A 1BPXA 5KFLA 2FPMA 4WC4A 5L1KA 5KTQA 2FPKA 4DQSA 5DQIA 2KFZA 2KZ3A 4FHPA 4O0IA 4JWNA 1T4GA 4I2FA 2NRWA 5DDMA 2R8GA 5KT6A 1LB2B 1ZQGA 1ZQNA 3RTVA 2HVIA 3GFKB 1UEVA 4NKTA 2JZBA 4DLGA 4YQWA 4UBCA 4M9JA 9ICAA 1N56A 3UPQA 4I2BA 3HWTA 1U45A 5KFAA 3PX6A 7ICRA 2M2WA 2KZMA 4AT9B 4JK1A 4PH5A 3MGHA 1KRPA 4QZBA 5CWRA 1RPLA 1SKRA 8ICVA 4PGYA 4F93B 4KLIA 4ELTA 4JV2A 1ZQTA 2ATLA 4NLZA 1X9WA 5JUMA 2FLPA 1ZYQA 1A77A 4C8KA 1QLNA 5EOZA 4UAZA 7ICEA 2HHPA 4FHWA 5KG2A 1BPEA 2ASDA 1ZQYA 5KFIA 3PVXA 4S3NA 5HMMA 1H38A 2J6TA 3TFRA 4FH5A 5J0YA 4Z6FA 4DS4A 2NRTA 1L5UA 1RZTA 1RYRA 4DFKA 1XSLA 4ECUA 7ICSA 2O1PA 3G6XA 4IR1A 3EPIA 2HHUA 4O3RA 5J29A 4F5NA 8ICBA 1L3UA 3BQ1A 2XY7A 4WC7A 4R66A 5DECA 1SKSA 4RU9A 4F5OA 1BNOA 4RT2A 4UB5A 4J9SA 2W9CB 5DLFA 2M2UA 5J0XA 3OVAA 1XO1A 4F5QA 4DSKA 5HRKA 5L9XA 3ZDDA 2ZH6A 5IINA 5KG3A 5EWGA 5KFRA 8ICFA 1BPZA 5KFQA 4E8FA 5DB6A 4KLTA 4UB3A 3PR5B 5KFWA 3TI0A 1ZQMA 1DOQA 2IBKA 4KLLA 4B9VA 3OHAA 5KT4A 2AGQA 2UVWA 1S77D 2KFNA 2KP7A 3EW9A 1MSWD 4AT8B 4KLOA 4RNOA 9ICIA 3H39A 1ZQZA 4DFJA 5J0UA 4ED3A 4B9SA 3C1YA 5KT5A 3RJKA 4I27A 8ICIA 3QEBZ 2JEIA 4LT6A 2W8LA 3AQLA 3NGDA 4EP7A 4XQ8A 1D8YA 1FA0A 4ATBB 5KFMA 4ECVA 4RUAA 5HREA 1NK7A 3LK9A 2Q66A 2P6RA 1V9PA 2PFOA 3OSNA 9ICKA 9ICEA 3OUYA 1ZQJA 5HHIA 1NZPA 3UQ0A 5KFNA 4RPZA 7ICHA 5IIKA 4XA5A 4KMUA 5DB8A 3RR8A 4WC3A 9ICJA 1SZPA 8ICLA 1UA0A 3RB4A 3RJEA 4DQIA 4M9GA 1ZQRA 5DB9A 4KLDA 2XY5A 1Q79A 4RWQA 3KTQA 1XSNA 1D9DA 4DQRA 4FHXA 3WFOA 2VA8A 4E80A 5J2KA 3PW4A 4QZGA 5CJ7A 4P4MA 5D49A 5CR0A 2I9GA 4BXOB 4QZHA 3TQ1A 1LV5A 3GIIA 1MQ2A 2DR5A 2HHXA 3SZ2A 3RB0A 3V7KA 2ZH1A 5KFBA 3HT3A 3GIJA 3T5HA 3EPGA 1TV9A 2H5XA 2UVVA 2BCVA 3PX4A 4FS1A 3NTUA 3TANA 3Q8MA 4G3IA 3T3FA 1NJYA 2BPCA 3MR5A 1S0VA 1R89A 3KHHA 3NYBA 2ISOA 2HVHA 4X4NA 1KLNA 4M5DA 4YXJA 8ICGA 4DSJA 7ICGA 5HRFA 2ZTCA 3GIMA 5D4BA 4RQ5A 4ZH4A 2R8IA 5DQGA 4E0DA 4Z6CA 4LZGA 4NLGA 4RQ1A 1JQRA 1MIYA 4KTQA 4QWAA 4Q8EA 3C2LA 3H38A 2NRVA 5HNKA 3C5GA 2XY6A 2DR8A 4UB2A 3K75D 5KFXA 4QZEA 3GQCA 4DSFA 4BXOA 4PHDA 5HP4A 4DQPA 4NLNA 7ICKA 4O3OA 1CEZA 1MQ3A 3ISCA 4M2YA 1BPDA 2W9MA 4XQ7A 4X4VA 4MEYA 5DG7A 4QWBA 1S97A 3H8SA 3H3AA 1S9FA 5DGBA 5DKWA 1KTQA 2R8HA 3BJYA 2FMQA 5BPCA 4F5RA 1ZQDA 4NY8A 2M2TA 8ICMA 1VFGA 4UBBA 4DLEA 1R8CA 3PX0A 1JXLA 2ZH7A 2BCUA 3TFSA 1IXRA 3G6VA 4KLQA 3JZ0A 5KFKA 4ECXA 8ICRA 2ZH4A 4Q45A 4X4UA 4YXMA 2V4QA 4DF8A 5J2HA 4DOAA 4Q8FA 4UD4A 4X4SA 4NM1A 3ZDAA 4I2HA 4O5EA 2PI4A 4FO6A 2IHNA 3JPTA 8ICWA 9ICSA 2BCSA 4RZRA 9ICRA 5F9NA 1MIVA 4FH3A 4ED7A 3V6KA 3EWAA 3HPOA 4GLXA 4EBDA 3RJHA 3RB6A 4QZDA 2XCPA 3GV5B 4RT3A 2ZTEA 4EYHB 4TUPA 4EBEA 2Y1JA 4K4GA 4P2HA 7ICNA 3PW7A 1V4AA 1AROP 3HW8A 3T5KA 4M6WA 4EBCA 7ICFA 1ZQWA 3PMNA 4F8RA 2ZH2A 5L1IA 1KNYA 1S0NA 4DL3A 3MBYA 2C2RA 3ORYA 4J9LA 4M9LA 2PXIA 4P4PA 1TKDA 4KLGA 9ICMA 2JEGA 2W9CA 4MFFA 3M8RA 2W8KA 1NKBA 1TK0A 2LYHA 1U4BA 1D8LA 2R8JA 5D46A 3GV7B 3RH6A 4ECRA 1BGXT 1ZQHA 2XGQA 3THVA 3HX0A 1ZQEA 4IRDA 4IQWA 4M04A 1JX4A 1ZETA 1ZQAA 4RQ7A 4C8MA 3H4DA 2VANA 4X5VA 2JEFA 4C8LA 4DF4A 4E7XA 1TK5A 4DL7A 2PBEA 2MUTB 2C2DA 7ICTA 3QEAZ 1BPBA 4F91B 2KN7A 4GC6A 2C2EA 1T8EA 2UVUA 2R8KA 5HRHA 3N4MB 5HRDA 4F3OA 4C8NA 1ZQFA 4DWIA 4RQ6A 3PY8A 4ELVA 3C18A 2F1JA 3OVBA 4QWDA 3OSPA 3V7JA 4FHYA 4BGDA 3SV3A 3IHQB 4R8UA 2AU0A 2DPIA 2RDJA 3E2EA 4EBJA 2MAXA 2ZUCA 2BQUA 4EYIB 4PHAA 9ICCA 4DFMA 4F4ZA 5L1LA 5J2JA 3JPQA 5KFHA 1TVAA 5KFPA 4F4KA 4ED0A 5HC9A 3V7LA 9ICVA 3H7IA 3OHBA 4DL2A 2FMSA 4F2SA 3M9OB 9ICLA 4KLEA 4QW9A 1BNPA 4KLJA 1U48A 4F50A 1DK3A 4TUSA 4TURA 1ZQCA 2AQ4A 1NK9A 4UQGA 3MGIA 3PV8A 3GDXA 1XSPA 4LVSA 3HJ1A 5KT3A 9ICNA 1F5AA 1K1QA 1ZQPA 1UEUA 1KFDA 1ZJNA 1NJZA 5DLGA 4Q43A 4I2JA 4I2EA 3T5LA 9ICWA 4RNNA 4J9QA 9ICHA 4EZ9A 4ECTA 1SL0A 5HHHA 4YP3A 3BQ0A 5J0RA 4F5PA 4ED1A 3Q8LA 4KLHA 5KFTA 2KTQA 4I2CA 1ZQLA 4IR9A 1NK0A 4F4XA 4DS5A 5DG8A 1X9SA 1NK5A 1OU5A 9ICBA 4RUCA 2ZH9A 2ZH3A 4J9KA 5DDYA 3BQ2A 2M9NA 4O3QA 3RB3A 1L3TA 3OVSA 4MF8A 1XC9A 4I2GA 4QZAA 1KFTA 4NKUA 5J0OA 4QW8A 2VA2A 4J9PA 1NK6A 4R63A 1RYSA 2BHNA 2ZUDA 8ICEA 3PW2A 3ISBA 4IQUA 4JUZA 2ASLA 4IQTA 2V4RA 2NRXA 3RJJA 2RDIA 4I2DA 1NJWA 9ICQA 2HW3A 4PGXA 2ZHBA 3BQTA 4KITB 4YR0A 3SI8A 1ZQBA 1WCLA 5F9LA 1ZQIA 8ICAA 3UPSA 2DR9A 3Q8SB 4RQ0A 3OV7A 4KLUA 1QSYA 3V6HA 5CA7A 2J6SA 3KHLA 2ZTDA 4X0AA 3L9DA 4M47A 3B0XA 4DOBA 4O3PA 1QTMA 3RBEA 5HRLA 4KN4A 4RQ8A 3KHRA 4UAYA 2WTFA 4MF2A 3C2MA 2AGPA 2VA3A 1ZQUA 4J9MA 1U49A 4JV0A 3RAXA 5KT2A 4J9OA 2C28A 2A1JA 1COOA 3M9NB 1XWLA 1S10A 3ZDEA 4B9TA 3T5JA 4PGQA 4O5CA 4DL5A 2DPJA 9ICFA 5KFGA 2O5AA 5KG4A 4QZ9A 5KFCA 3UQ2A 5KFZA 2DRAA 4LZDA 4M0AA 4RWPA 4RNMA 1PZNA 3FYHA 3C2KA 3MR3A 5IIMA 4KLMA 3QZ7A 5J0QA 1JXEA 4F4YA 1UT8A 3QE9Y 5KFSA 1R8AA 2I1QA 4DSIA 9ICUA 1TFYA 2FLLA 3RH5A 5DEDA 3PNCA 2PFPA 2AJQA 1DK2A 5HRBA 1TK8A 5J2IA 2KZZA 3RRGA 2B21A 1JMSA 3C5FA 4DSLA 1VJ7A 3HIYA 8ICPA 1JIHA 4M9HA 5IILA 4F92B 1L3SA 5KFOA 3C1ZA 4EBKA 4X4OA 1MC8A 5TZVA 1D9FA 1K1SA 4KLSA 2ZJ5A 4B9MA 7ICIA 1N48A 5CB1A 5CHGA 5J0PA 1BPYA 4AT7A 3WFQE 1ZQQA 3M8SA 3N97B 2ZH8A 4NXZA 5DGAA 5J2GA 4ECZA 4AT9A 4XUSA 2BGWA 5KFFA 2XO7A 2ASJA 3JYYA 4BDPA 8ICOA 3GV8B 3TAPA 4I29A 4BWMA 3UXNA 2DFLA 1ZQOA 2HHTA 1QSSA 4K4IA 5KFJA 1T7PA 4O5KA 4GXJA 7ICVA 5J2BA 4ECSA 4YD1A 1S76D 1U47A 4EZ6A 4Q44A 2W9BA 2BPGA 2IMWP 4Z6EA 2C22A 3MFHA 1S0MA 4IQVA 4PHEA 2UVRA 1NK8A 3RJFA 1TAUA 3TARA 3Q8KA 2BQRA 1L3VA 5CP2A 1ZQSA 1KSPA 5J2DA 4RWNA 1KEJA 2HHSA 4PHPA 4RPXA 3LDAA 3UXPA 5KG1A 4YMMA 5IIOA 3H8WA 3RJIA 4ECYA 4I2AA 4UB4A 4ED6A 3RJGA 4YFKA 3AUOA 4O3NA 3C21A 8ICYA 3MABA 3MDAA 1BVSA 2Y1IA 3ZD8A 1WCNA 4WC0A 1TFWA 1T3NA 1SL1A 3Q8PB 3JPSA 8ICUA 1A76A 4CCHA 4RQ2A 4MFCA 4J9NA 4TQRA 1SL2A 2IHMA 3OJSA 8ICCA 1ZQVA 4YMNA 1CUKA 5KT7A 3HP6A 2P66A 3C23A 8ICQA 9ICOA 3C66A 1NK4A 2NRKA 4IRCA 5HRIA 1U9LA 4AT7B 5BOLA 4QZ8A 3JPPA 3Q8QB 4DSEA 4X4RA 4DFPA 4YR2A 2OWOA 2BCQA 2XGPA 9ICXA 1HUZA 8ICTA 3Q8RB 4TQSA 4ED2A 4R64A 4K4HA 1UETA 2BQ3A 2ZJ8A 3V6JA 5J2AA 1DGSA 3FDSA 3RR7A 7ICQA 2BE3A 3OJUA 8ICXA 4WBYA 2BDPA 3GIKA 4WC2A 3AQMA 3PW0A 5KFDA 2XCAA 3MR6A 1C7YA 5KG0A 3PR4A 2DVIA 4QWEA 3ZD9A 2A1JB 4GXKA 4M6WB 4QZFA 3LWMA 1JAJA 4EEYA 4O3SA 1X2IA 4KN7A 3ETLA 4BWJA 4F4WA 4ATBA 3V72A 4HYKA 4R8UB 3OGUA 5KFVA 3PO5A 4O9MA 1ZQKA 2DRBA 5J2CA 2ALZA 3WFRE 3OUYB 3SV4A 4TUQA 5KFYA 1JN3A 5BOMA 4FBTA 4UAWA 1NKCA 1UT5A 5J0SA 2BCRA 1NOMA 3RBDA 3H40A 3RH4A 7ICOA 4Z6DA 1B22A 1HJPA 4ED8A 2BPFA 2MUTA 2PI5A 3AQNA 2DR7A 2NRZA 2GWSA 4X4QA 4DQQA 4F2RA 4WC5A 1ZQXA 4MFAA 3QZ8A 1ZJMA 5J0WA 2FMPA 7ICJA 1RXWA 1PX5A 4KLFA 4R65A 3H37A 9ICGA 1Q78A 4M9NA 8ICJA 1B43A 3K4GA 4WBZA 3B0YA 4WCWA 8ICZA 5HR9A 3ISDA 4B9LA 4JV1A 3PO4A 8ICNA 4UD5A 3UXOA 4FS2A 2HHQA 1R8BA 2M2VA 5IIIA 5EWFA 2FPLA 4YMOA 1X9MA 4MEXA 4X4PA 3WFSC 4DO9A 3IM1A 2BR0A 1SKWA 3H8JA 3LQCB 1Z00A 5J0TA 4YD2A 5IIJA 5DBCA 3MFIA 5L1JA 3AU6A 1XS9D 2ISPA 2V9WA 2PFQA 3MR2A 3HJ4A 3SYZA 4X0BA 2ID1A 1YLQA 2W9BB 4DEZA 4YVZA 2J6UA 4RWOA 4YG2A 5EWEA 2Q0ZX 4NM2A 3M9MB 2W9AA 4B9UA 1MIWA 1WOTA 1Z3EB 2F1IA 2F1HA 2P6UA 4NLKA 8ICHA 4I2IA 4IG8A 3AQKA 5DG9A 4DL4A 1UA1A 5DBBA 2ZH5A 2ZJAA 2RFFA 1TFRA 1KFSA 4X4TA 5DBAA 3EZ5A 5KG6A 1NO5A 4WC1A 3JPRA 3PW5A 2AGOA 9ICPA 5KG7A 4J9RA 9ICTA 4DOCA 3ZDCA 4UB1A 3KHGA 4AT8A 7ICPA 5DB7A 5KFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU2 A;  3RAQ A;  2IA6 A;  2ZUB A;  4B9N A;  1KDH A;  7ICU A;  5KFU A;  4YR3 A;  4FBU A;  3EYZ A;  5J2E A;  3MDC A;  5C5J A;  4ECW A;  7ICM A;  5HRG A;  5J2F A;  4GXI A;  3RRH A;  4IRK A;  2XC9 A;  1NKE A;  3G6Y A;  2HHW A;  2PFN A;  3JPO A;  1HUO A;  3JPN A;  4P4O A;  1QSL A;  5KG5 A;  4RQ4 A;  5F2V O;  4RQ3 A;  3PML A;  4YCX A;  3BDP A;  1Z00 B;  4JWM A;  4WC6 A;  4QWC A;  4I28 A;  5DQH A;  4ELU A;  2JZB B;  3TAQ A;  2BKE A;  7ICL A;  1TAQ A;  1S0O A;  3LWL A;  3H4B A;  4GC7 A;  3ZDB A;  4ECQ A;  4DL6 A;  2JEJ A;  4QZI A;  4XRH A;  1IM4 A;  1EXN A;  5HML A;  4QZC A;  8ICK A;  4C8O A;  4YN4 A;  4PPX A;  2HHV A;  2ZHA A;  3WFP A;  1RXV A;  2AQ0 A;  3GIL A;  4FHV A;  8ICS A;  4RPY A;  1Y88 A;  1NJX A;  2FLN A;  1XU4 A;  1BPX A;  5KFL A;  2FPM A;  4WC4 A;  5L1K A;  5KTQ A;  2FPK A;  4DQS A;  5DQI A;  2KFZ A;  2KZ3 A;  4FHP A;  4O0I A;  4JWN A;  1T4G A;  4I2F A;  2NRW A;  5DDM A;  2R8G A;  5KT6 A;  1LB2 B;  1ZQG A;  1ZQN A;  3RTV A;  2HVI A;  3GFK B;  1UEV A;  4NKT A;  2JZB A;  4DLG A;  4YQW A;  4UBC A;  4M9J A;  9ICA A;  1N56 A;  3UPQ A;  4I2B A;  3HWT A;  1U45 A;  5KFA A;  3PX6 A;  7ICR A;  2M2W A;  2KZM A;  4AT9 B;  4JK1 A;  4PH5 A;  3MGH A;  1KRP A;  4QZB A;  5CWR A;  1RPL A;  1SKR A;  8ICV A;  4PGY A;  4F93 B;  4KLI A;  4ELT A;  4JV2 A;  1ZQT A;  2ATL A;  4NLZ A;  1X9W A;  5JUM A;  2FLP A;  1ZYQ A;  1A77 A;  4C8K A;  1QLN A;  5EOZ A;  4UAZ A;  7ICE A;  2HHP A;  4FHW A;  5KG2 A;  1BPE A;  2ASD A;  1ZQY A;  5KFI A;  3PVX A;  4S3N A;  5HMM A;  1H38 A;  2J6T A;  3TFR A;  4FH5 A;  5J0Y A;  4Z6F A;  4DS4 A;  2NRT A;  1L5U A;  1RZT A;  1RYR A;  4DFK A;  1XSL A;  4ECU A;  7ICS A;  2O1P A;  3G6X A;  4IR1 A;  3EPI A;  2HHU A;  4O3R A;  5J29 A;  4F5N A;  8ICB A;  1L3U A;  3BQ1 A;  2XY7 A;  4WC7 A;  4R66 A;  5DEC A;  1SKS A;  4RU9 A;  4F5O A;  1BNO A;  4RT2 A;  4UB5 A;  4J9S A;  2W9C B;  5DLF A;  2M2U A;  5J0X A;  3OVA A;  1XO1 A;  4F5Q A;  4DSK A;  5HRK A;  5L9X A;  3ZDD A;  2ZH6 A;  5IIN A;  5KG3 A;  5EWG A;  5KFR A;  8ICF A;  1BPZ A;  5KFQ A;  4E8F A;  5DB6 A;  4KLT A;  4UB3 A;  3PR5 B;  5KFW A;  3TI0 A;  1ZQM A;  1DOQ A;  2IBK A;  4KLL A;  4B9V A;  3OHA A;  5KT4 A;  2AGQ A;  2UVW A;  1S77 D;  2KFN A;  2KP7 A;  3EW9 A;  1MSW D;  4AT8 B;  4KLO A;  4RNO A;  9ICI A;  3H39 A;  1ZQZ A;  4DFJ A;  5J0U A;  4ED3 A;  4B9S A;  3C1Y A;  5KT5 A;  3RJK A;  4I27 A;  8ICI A;  3QEB Z;  2JEI A;  4LT6 A;  2W8L A;  3AQL A;  3NGD A;  4EP7 A;  4XQ8 A;  1D8Y A;  1FA0 A;  4ATB B;  5KFM A;  4ECV A;  4RUA A;  5HRE A;  1NK7 A;  3LK9 A;  2Q66 A;  2P6R A;  1V9P A;  2PFO A;  3OSN A;  9ICK A;  9ICE A;  3OUY A;  1ZQJ A;  5HHI A;  1NZP A;  3UQ0 A;  5KFN A;  4RPZ A;  7ICH A;  5IIK A;  4XA5 A;  4KMU A;  5DB8 A;  3RR8 A;  4WC3 A;  9ICJ A;  1SZP A;  8ICL A;  1UA0 A;  3RB4 A;  3RJE A;  4DQI A;  4M9G A;  1ZQR A;  5DB9 A;  4KLD A;  2XY5 A;  1Q79 A;  4RWQ A;  3KTQ A;  1XSN A;  1D9D A;  4DQR A;  4FHX A;  3WFO A;  2VA8 A;  4E80 A;  5J2K A;  3PW4 A;  4QZG A;  5CJ7 A;  4P4M A;  5D49 A;  5CR0 A;  2I9G A;  4BXO B;  4QZH A;  3TQ1 A;  1LV5 A;  3GII A;  1MQ2 A;  2DR5 A;  2HHX A;  3SZ2 A;  3RB0 A;  3V7K A;  2ZH1 A;  5KFB A;  3HT3 A;  3GIJ A;  3T5H A;  3EPG A;  1TV9 A;  2H5X A;  2UVV A;  2BCV A;  3PX4 A;  4FS1 A;  3NTU A;  3TAN A;  3Q8M A;  4G3I A;  3T3F A;  1NJY A;  2BPC A;  3MR5 A;  1S0V A;  1R89 A;  3KHH A;  3NYB A;  2ISO A;  2HVH A;  4X4N A;  1KLN A;  4M5D A;  4YXJ A;  8ICG A;  4DSJ A;  7ICG A;  5HRF A;  2ZTC A;  3GIM A;  5D4B A;  4RQ5 A;  4ZH4 A;  2R8I A;  5DQG A;  4E0D A;  4Z6C A;  4LZG A;  4NLG A;  4RQ1 A;  1JQR A;  1MIY A;  4KTQ A;  4QWA A;  4Q8E A;  3C2L A;  3H38 A;  2NRV A;  5HNK A;  3C5G A;  2XY6 A;  2DR8 A;  4UB2 A;  3K75 D;  5KFX A;  4QZE A;  3GQC A;  4DSF A;  4BXO A;  4PHD A;  5HP4 A;  4DQP A;  4NLN A;  7ICK A;  4O3O A;  1CEZ A;  1MQ3 A;  3ISC A;  4M2Y A;  1BPD A;  2W9M A;  4XQ7 A;  4X4V A;  4MEY A;  5DG7 A;  4QWB A;  1S97 A;  3H8S A;  3H3A A;  1S9F A;  5DGB A;  5DKW A;  1KTQ A;  2R8H A;  3BJY A;  2FMQ A;  5BPC A;  4F5R A;  1ZQD A;  4NY8 A;  2M2T A;  8ICM A;  1VFG A;  4UBB A;  4DLE A;  1R8C A;  3PX0 A;  1JXL A;  2ZH7 A;  2BCU A;  3TFS A;  1IXR A;  3G6V A;  4KLQ A;  3JZ0 A;  5KFK A;  4ECX A;  8ICR A;  2ZH4 A;  4Q45 A;  4X4U A;  4YXM A;  2V4Q A;  4DF8 A;  5J2H A;  4DOA A;  4Q8F A;  4UD4 A;  4X4S A;  4NM1 A;  3ZDA A;  4I2H A;  4O5E A;  2PI4 A;  4FO6 A;  2IHN A;  3JPT A;  8ICW A;  9ICS A;  2BCS A;  4RZR A;  9ICR A;  5F9N A;  1MIV A;  4FH3 A;  4ED7 A;  3V6K A;  3EWA A;  3HPO A;  4GLX A;  4EBD A;  3RJH A;  3RB6 A;  4QZD A;  2XCP A;  3GV5 B;  4RT3 A;  2ZTE A;  4EYH B;  4TUP A;  4EBE A;  2Y1J A;  4K4G A;  4P2H A;  7ICN A;  3PW7 A;  1V4A A;  1ARO P;  3HW8 A;  3T5K A;  4M6W A;  4EBC A;  7ICF A;  1ZQW A;  3PMN A;  4F8R A;  2ZH2 A;  5L1I A;  1KNY A;  1S0N A;  4DL3 A;  3MBY A;  2C2R A;  3ORY A;  4J9L A;  4M9L A;  2PXI A;  4P4P A;  1TKD A;  4KLG A;  9ICM A;  2JEG A;  2W9C A;  4MFF A;  3M8R A;  2W8K A;  1NKB A;  1TK0 A;  2LYH A;  1U4B A;  1D8L A;  2R8J A;  5D46 A;  3GV7 B;  3RH6 A;  4ECR A;  1BGX T;  1ZQH A;  2XGQ A;  3THV A;  3HX0 A;  1ZQE A;  4IRD A;  4IQW A;  4M04 A;  1JX4 A;  1ZET A;  1ZQA A;  4RQ7 A;  4C8M A;  3H4D A;  2VAN A;  4X5V A;  2JEF A;  4C8L A;  4DF4 A;  4E7X A;  1TK5 A;  4DL7 A;  2PBE A;  2MUT B;  2C2D A;  7ICT A;  3QEA Z;  1BPB A;  4F91 B;  2KN7 A;  4GC6 A;  2C2E A;  1T8E A;  2UVU A;  2R8K A;  5HRH A;  3N4M B;  5HRD A;  4F3O A;  4C8N A;  1ZQF A;  4DWI A;  4RQ6 A;  3PY8 A;  4ELV A;  3C18 A;  2F1J A;  3OVB A;  4QWD A;  3OSP A;  3V7J A;  4FHY A;  4BGD A;  3SV3 A;  3IHQ B;  4R8U A;  2AU0 A;  2DPI A;  2RDJ A;  3E2E A;  4EBJ A;  2MAX A;  2ZUC A;  2BQU A;  4EYI B;  4PHA A;  9ICC A;  4DFM A;  4F4Z A;  5L1L A;  5J2J A;  3JPQ A;  5KFH A;  1TVA A;  5KFP A;  4F4K A;  4ED0 A;  5HC9 A;  3V7L A;  9ICV A;  3H7I A;  3OHB A;  4DL2 A;  2FMS A;  4F2S A;  3M9O B;  9ICL A;  4KLE A;  4QW9 A;  1BNP A;  4KLJ A;  1U48 A;  4F50 A;  1DK3 A;  4TUS A;  4TUR A;  1ZQC A;  2AQ4 A;  1NK9 A;  4UQG A;  3MGI A;  3PV8 A;  3GDX A;  1XSP A;  4LVS A;  3HJ1 A;  5KT3 A;  9ICN A;  1F5A A;  1K1Q A;  1ZQP A;  1UEU A;  1KFD A;  1ZJN A;  1NJZ A;  5DLG A;  4Q43 A;  4I2J A;  4I2E A;  3T5L A;  9ICW A;  4RNN A;  4J9Q A;  9ICH A;  4EZ9 A;  4ECT A;  1SL0 A;  5HHH A;  4YP3 A;  3BQ0 A;  5J0R A;  4F5P A;  4ED1 A;  3Q8L A;  4KLH A;  5KFT A;  2KTQ A;  4I2C A;  1ZQL A;  4IR9 A;  1NK0 A;  4F4X A;  4DS5 A;  5DG8 A;  1X9S A;  1NK5 A;  1OU5 A;  9ICB A;  4RUC A;  2ZH9 A;  2ZH3 A;  4J9K A;  5DDY A;  3BQ2 A;  2M9N A;  4O3Q A;  3RB3 A;  1L3T A;  3OVS A;  4MF8 A;  1XC9 A;  4I2G A;  4QZA A;  1KFT A;  4NKU A;  5J0O A;  4QW8 A;  2VA2 A;  4J9P A;  1NK6 A;  4R63 A;  1RYS A;  2BHN A;  2ZUD A;  8ICE A;  3PW2 A;  3ISB A;  4IQU A;  4JUZ A;  2ASL A;  4IQT A;  2V4R A;  2NRX A;  3RJJ A;  2RDI A;  4I2D A;  1NJW A;  9ICQ A;  2HW3 A;  4PGX A;  2ZHB A;  3BQT A;  4KIT B;  4YR0 A;  3SI8 A;  1ZQB A;  1WCL A;  5F9L A;  1ZQI A;  8ICA A;  3UPS A;  2DR9 A;  3Q8S B;  4RQ0 A;  3OV7 A;  4KLU A;  1QSY A;  3V6H A;  5CA7 A;  2J6S A;  3KHL A;  2ZTD A;  4X0A A;  3L9D A;  4M47 A;  3B0X A;  4DOB A;  4O3P A;  1QTM A;  3RBE A;  5HRL A;  4KN4 A;  4RQ8 A;  3KHR A;  4UAY A;  2WTF A;  4MF2 A;  3C2M A;  2AGP A;  2VA3 A;  1ZQU A;  4J9M A;  1U49 A;  4JV0 A;  3RAX A;  5KT2 A;  4J9O A;  2C28 A;  2A1J A;  1COO A;  3M9N B;  1XWL A;  1S10 A;  3ZDE A;  4B9T A;  3T5J A;  4PGQ A;  4O5C A;  4DL5 A;  2DPJ A;  9ICF A;  5KFG A;  2O5A A;  5KG4 A;  4QZ9 A;  5KFC A;  3UQ2 A;  5KFZ A;  2DRA A;  4LZD A;  4M0A A;  4RWP A;  4RNM A;  1PZN A;  3FYH A;  3C2K A;  3MR3 A;  5IIM A;  4KLM A;  3QZ7 A;  5J0Q A;  1JXE A;  4F4Y A;  1UT8 A;  3QE9 Y;  5KFS A;  1R8A A;  2I1Q A;  4DSI A;  9ICU A;  1TFY A;  2FLL A;  3RH5 A;  5DED A;  3PNC A;  2PFP A;  2AJQ A;  1DK2 A;  5HRB A;  1TK8 A;  5J2I A;  2KZZ A;  3RRG A;  2B21 A;  1JMS A;  3C5F A;  4DSL A;  1VJ7 A;  3HIY A;  8ICP A;  1JIH A;  4M9H A;  5IIL A;  4F92 B;  1L3S A;  5KFO A;  3C1Z A;  4EBK A;  4X4O A;  1MC8 A;  5TZV A;  1D9F A;  1K1S A;  4KLS A;  2ZJ5 A;  4B9M A;  7ICI A;  1N48 A;  5CB1 A;  5CHG A;  5J0P A;  1BPY A;  4AT7 A;  3WFQ E;  1ZQQ A;  3M8S A;  3N97 B;  2ZH8 A;  4NXZ A;  5DGA A;  5J2G A;  4ECZ A;  4AT9 A;  4XUS A;  2BGW A;  5KFF A;  2XO7 A;  2ASJ A;  3JYY A;  4BDP A;  8ICO A;  3GV8 B;  3TAP A;  4I29 A;  4BWM A;  3UXN A;  2DFL A;  1ZQO A;  2HHT A;  1QSS A;  4K4I A;  5KFJ A;  1T7P A;  4O5K A;  4GXJ A;  7ICV A;  5J2B A;  4ECS A;  4YD1 A;  1S76 D;  1U47 A;  4EZ6 A;  4Q44 A;  2W9B A;  2BPG A;  2IMW P;  4Z6E A;  2C22 A;  3MFH A;  1S0M A;  4IQV A;  4PHE A;  2UVR A;  1NK8 A;  3RJF A;  1TAU A;  3TAR A;  3Q8K A;  2BQR A;  1L3V A;  5CP2 A;  1ZQS A;  1KSP A;  5J2D A;  4RWN A;  1KEJ A;  2HHS A;  4PHP A;  4RPX A;  3LDA A;  3UXP A;  5KG1 A;  4YMM A;  5IIO A;  3H8W A;  3RJI A;  4ECY A;  4I2A A;  4UB4 A;  4ED6 A;  3RJG A;  4YFK A;  3AUO A;  4O3N A;  3C21 A;  8ICY A;  3MAB A;  3MDA A;  1BVS A;  2Y1I A;  3ZD8 A;  1WCN A;  4WC0 A;  1TFW A;  1T3N A;  1SL1 A;  3Q8P B;  3JPS A;  8ICU A;  1A76 A;  4CCH A;  4RQ2 A;  4MFC A;  4J9N A;  4TQR A;  1SL2 A;  2IHM A;  3OJS A;  8ICC A;  1ZQV A;  4YMN A;  1CUK A;  5KT7 A;  3HP6 A;  2P66 A;  3C23 A;  8ICQ A;  9ICO A;  3C66 A;  1NK4 A;  2NRK A;  4IRC A;  5HRI A;  1U9L A;  4AT7 B;  5BOL A;  4QZ8 A;  3JPP A;  3Q8Q B;  4DSE A;  4X4R A;  4DFP A;  4YR2 A;  2OWO A;  2BCQ A;  2XGP A;  9ICX A;  1HUZ A;  8ICT A;  3Q8R B;  4TQS A;  4ED2 A;  4R64 A;  4K4H A;  1UET A;  2BQ3 A;  2ZJ8 A;  3V6J A;  5J2A A;  1DGS A;  3FDS A;  3RR7 A;  7ICQ A;  2BE3 A;  3OJU A;  8ICX A;  4WBY A;  2BDP A;  3GIK A;  4WC2 A;  3AQM A;  3PW0 A;  5KFD A;  2XCA A;  3MR6 A;  1C7Y A;  5KG0 A;  3PR4 A;  2DVI A;  4QWE A;  3ZD9 A;  2A1J B;  4GXK A;  4M6W B;  4QZF A;  3LWM A;  1JAJ A;  4EEY A;  4O3S A;  1X2I A;  4KN7 A;  3ETL A;  4BWJ A;  4F4W A;  4ATB A;  3V72 A;  4HYK A;  4R8U B;  3OGU A;  5KFV A;  3PO5 A;  4O9M A;  1ZQK A;  2DRB A;  5J2C A;  2ALZ A;  3WFR E;  3OUY B;  3SV4 A;  4TUQ A;  5KFY A;  1JN3 A;  5BOM A;  4FBT A;  4UAW A;  1NKC A;  1UT5 A;  5J0S A;  2BCR A;  1NOM A;  3RBD A;  3H40 A;  3RH4 A;  7ICO A;  4Z6D A;  1B22 A;  1HJP A;  4ED8 A;  2BPF A;  2MUT A;  2PI5 A;  3AQN A;  2DR7 A;  2NRZ A;  2GWS A;  4X4Q A;  4DQQ A;  4F2R A;  4WC5 A;  1ZQX A;  4MFA A;  3QZ8 A;  1ZJM A;  5J0W A;  2FMP A;  7ICJ A;  1RXW A;  1PX5 A;  4KLF A;  4R65 A;  3H37 A;  9ICG A;  1Q78 A;  4M9N A;  8ICJ A;  1B43 A;  3K4G A;  4WBZ A;  3B0Y A;  4WCW A;  8ICZ A;  5HR9 A;  3ISD A;  4B9L A;  4JV1 A;  3PO4 A;  8ICN A;  4UD5 A;  3UXO A;  4FS2 A;  2HHQ A;  1R8B A;  2M2V A;  5III A;  5EWF A;  2FPL A;  4YMO A;  1X9M A;  4MEX A;  4X4P A;  3WFS C;  4DO9 A;  3IM1 A;  2BR0 A;  1SKW A;  3H8J A;  3LQC B;  1Z00 A;  5J0T A;  4YD2 A;  5IIJ A;  5DBC A;  3MFI A;  5L1J A;  3AU6 A;  1XS9 D;  2ISP A;  2V9W A;  2PFQ A;  3MR2 A;  3HJ4 A;  3SYZ A;  4X0B A;  2ID1 A;  1YLQ A;  2W9B B;  4DEZ A;  4YVZ A;  2J6U A;  4RWO A;  4YG2 A;  5EWE A;  2Q0Z X;  4NM2 A;  3M9M B;  2W9A A;  4B9U A;  1MIW A;  1WOT A;  1Z3E B;  2F1I A;  2F1H A;  2P6U A;  4NLK A;  8ICH A;  4I2I A;  4IG8 A;  3AQK A;  5DG9 A;  4DL4 A;  1UA1 A;  5DBB A;  2ZH5 A;  2ZJA A;  2RFF A;  1TFR A;  1KFS A;  4X4T A;  5DBA A;  3EZ5 A;  5KG6 A;  1NO5 A;  4WC1 A;  3JPR A;  3PW5 A;  2AGO A;  9ICP A;  5KG7 A;  4J9R A;  9ICT A;  4DOC A;  3ZDC A;  4UB1 A;  3KHG A;  4AT8 A;  7ICP A;  5DB7 A;  5KFE A; 
#chains in the Genus database with same CATH topology
 3RAQ A;  4B9N A;  7ICU A;  4YR3 A;  2WFA A;  2VKQ A;  4ECW A;  7ICM A;  4P4O A;  5F2V O;  2EAP A;  4WC6 A;  1SWW A;  4ELU A;  2JZB B;  2OCE A;  2BKE A;  3KZX A;  1TAQ A;  5AM4 A;  1S0O A;  2EQY A;  4Y2T A;  2JEJ A;  1EXN A;  4C8O A;  2HSZ A;  4RPY A;  1XU4 A;  2FPM A;  5KTQ A;  2KFZ A;  5ALO A;  3RFA A;  2KZ3 A;  4FHP A;  1ZQG A;  3L3F X;  2WF6 A;  5AM1 A;  2G5H B;  1HIW A;  4YQW A;  2NO4 A;  4UBC A;  5AHX A;  3AMZ A;  1CRX A;  7ICR A;  4AT9 B;  4JK1 A;  1PVR A;  1RPL A;  1SKR A;  4PGY A;  1DGJ A;  1ZQ1 C;  1N5W A;  2PKE A;  2ATL A;  5ALI A;  1X9W A;  5JUM A;  4NLZ A;  1A77 A;  2KIV A;  1ZQY A;  2HI0 A;  2KHV A;  4FH5 A;  4Z6F A;  4ECU A;  2LM1 A;  1XO0 A;  1L3U A;  2H3I A;  2LM4 A;  4WC7 A;  2HN1 A;  4UB5 A;  5DLF A;  3OVA A;  5EWG A;  4K96 A;  1N60 A;  2OHF A;  3TI0 A;  1DOQ A;  4QNL A;  3ER9 B;  1S77 D;  1C20 A;  4RNO A;  9ICI A;  3H39 A;  4DFJ A;  5J0U A;  5KT5 A;  2E1E A;  2JEI A;  3AQL A;  4XQ8 A;  5HRE A;  5GTI U;  3LK9 A;  3F53 A;  2NO5 A;  3OSN A;  2H3F A;  9ICE A;  2WAQ F;  1ZQJ A;  7ICH A;  4Y2U A;  2MSN A;  2ZIW B;  2XY5 A;  4RWQ A;  1D9D A;  1JRP A;  4QZG A;  5D49 A;  2I9G A;  3NS1 A;  3AL0 B;  4OCZ A;  3GII A;  1MQ2 A;  4IL6 U;  2ZH1 A;  3V7K A;  5KFB A;  3ICX A;  2HBL A;  2H5X A;  2UVV A;  4CF5 A;  2BCV A;  4G3I A;  1UQV A;  3ONN A;  2G08 A;  2KIC A;  4X4N A;  4RQ5 A;  5DQG A;  4Z6C A;  3A0B U;  2QKQ A;  3H38 A;  3E58 A;  4QWA A;  3C2L A;  2XY6 A;  2EDU A;  2WF7 A;  5KFX A;  5KL8 B;  4BXO A;  4DQP A;  4O3O A;  3WK4 A;  1MQ3 A;  4P0Q B;  3BS5 A;  3ZI4 A;  3WK5 A;  3WU2 U;  4MEY A;  1S97 A;  3H8S A;  3QUC A;  1X6J A;  2I6X A;  5DKW A;  1KTQ A;  4B6J A;  4NY8 A;  4F5R A;  8ICM A;  4AYB F;  2ZIW A;  1JXL A;  2BCU A;  4ICA A;  3F2B A;  2LHT A;  4ECX A;  5AKY A;  2ZH4 A;  1QQ5 A;  4X4S A;  9ICS A;  2D8C A;  9ICR A;  1L7M A;  4RZR A;  5B3P A;  4GLX A;  4UAS A;  2L5Y A;  3GV5 B;  4RT3 A;  4TUP A;  4K4G A;  3I76 A;  5L1I A;  1KNY A;  2JV3 A;  4P4P A;  2QAR B;  1O03 A;  5D63 A;  4DFD A;  3M8R A;  1WYG A;  5D46 A;  3THV A;  1OW5 A;  3HX0 A;  4IRD A;  4IQW A;  3HIL A;  3HRD D;  4U7C A;  4RQ7 A;  4DF4 A;  2QB0 A;  2W11 A;  5ALK A;  2G5I B;  2MUT B;  1BPB A;  1T8E A;  2R8K A;  3QU9 A;  4C8N A;  4DWI A;  3PY8 A;  1FFU A;  1F5S A;  3V7J A;  2AU0 A;  3E2E A;  2ZUC A;  4DFM A;  5J2J A;  3JPQ A;  5KFH A;  5KFP A;  4AP9 A;  1ZD4 A;  5G5H A;  4F2S A;  4QW9 A;  1U48 A;  2K4I A;  1X9X A;  4TUR A;  4P0P A;  2AXT U;  1X40 A;  1KFD A;  1NJZ A;  4WH5 A;  4RNN A;  4J9Q A;  9ICH A;  4ECT A;  1SL0 A;  5HHH A;  4YP3 A;  3BQ0 A;  4UAV A;  4KLH A;  2RHF A;  4I2C A;  2ZH3 A;  4FO1 A;  2M9N A;  1L3T A;  3CRX A;  1XC9 A;  1KFT A;  4QIW C;  4LJX A;  1NK6 A;  3SQI A;  1KW4 A;  4LEY A;  8ICE A;  5AI8 A;  2ASL A;  2LYB A;  2WF9 A;  4IQT A;  5ALG A;  4OAI Z;  5AIA A;  4I2D A;  9ICQ A;  3QU5 A;  3SAG A;  1VJ5 A;  5CHE A;  3BZC A;  3SI8 A;  1Z19 A;  2DR9 A;  4RQ0 A;  2J6S A;  5ALZ A;  3B0X A;  4QIW F;  3C2M A;  5ALH A;  2AGP A;  2C28 A;  5KT2 A;  4J9O A;  2G09 A;  4B9T A;  3GZF A;  4JMU A;  2GA9 D;  4RWP A;  3MR3 A;  3QZ7 A;  3QE9 Y;  3SEI A;  4DSI A;  2HMX A;  1N62 A;  1TFY A;  5DED A;  5J2I A;  3RRG A;  4DSL A;  1JMS A;  3HIY A;  2A3V A;  2XVT A;  5IIL A;  4EBK A;  1MC8 A;  4ZOH C;  2WHE A;  2ZJ5 A;  1BPY A;  5AK6 A;  4NXZ A;  1YZ6 A;  4LEZ A;  2I5H A;  5J2G A;  4XUS A;  2BGW A;  4O67 A;  2F76 X;  2XO7 A;  3SAH A;  4BDP A;  4OAH A;  4OJ5 A;  3TAP A;  4I29 A;  5D61 A;  2DFL A;  2ZIU B;  3JCF A;  3U26 A;  4GXJ A;  1S76 D;  3SR6 A;  1U47 A;  4EZ6 A;  3UMC A;  4Q44 A;  2W9B A;  3CK6 A;  2IMW P;  4Z6E A;  4WQK A;  2YML A;  4NXU A;  2BQR A;  4Y2S A;  4US9 A;  2JMG A;  4NL9 C;  3LDA A;  5KG1 A;  3H8W A;  3LVW A;  3RJG A;  3QU4 A;  3AUO A;  3MAB A;  1TFW A;  1SL1 A;  3Q8P B;  8ICU A;  1A76 A;  4CCH A;  4RQ2 A;  4MFC A;  4TQR A;  1ZQV A;  4J03 A;  3HP6 A;  8ICQ A;  2NYV A;  4IRC A;  1X66 A;  4QZ8 A;  3JPP A;  3IV6 A;  2JRZ A;  9ICX A;  1HUZ A;  2Q4T A;  1UET A;  4GFJ A;  7ICQ A;  8ICX A;  4WC2 A;  3AQM A;  1PK1 A;  1C7Y A;  4M6W B;  1JAJ A;  4O3S A;  1X2I A;  4F4W A;  4BWJ A;  1N2X A;  4BUG A;  5J2C A;  2PMZ F;  3KBB A;  5AM3 A;  4FBT A;  4P0Q A;  3NVY A;  5ALR A;  5J0S A;  3H40 A;  5E79 U;  4Z6D A;  1HJP A;  2MUT A;  2PI5 A;  3AQN A;  2DR7 A;  4X4Q A;  5F3X B;  7ICJ A;  5AI6 A;  2K8C B;  3ETR A;  4M9N A;  2W43 A;  8ICJ A;  3ISD A;  4JV1 A;  3A0H U;  4UD5 A;  3UXO A;  2HHQ A;  1R8B A;  5III A;  2FPL A;  2BR0 A;  3LQC B;  3ER8 C;  3L5K A;  3BZK A;  3MFI A;  4YD2 A;  2V9W A;  3F2C A;  5C0Y A;  3HKZ C;  4DEZ A;  1WG8 A;  4RWO A;  3F2D A;  3M9M B;  4NLK A;  4I2I A;  1UA1 A;  5DBB A;  2ZJA A;  1TFR A;  5DBA A;  3EZ5 A;  3JPR A;  5KG7 A;  4DOC A;  4UB1 A;  3KHG A;  4AT8 A;  7ICP A;  5DB7 A;  1NI3 A;  1FFV A;  5AI9 A;  2IA6 A;  4FFD A;  4OJ6 A;  5J2E A;  1L7O A;  4AYB C;  2MU2 A;  4GXI A;  3RRH A;  5ALM A;  1NKE A;  1QSL A;  1T94 A;  3PML A;  3CYM A;  3BDP A;  1Z00 B;  3TKA A;  4JWM A;  4QWC A;  4I28 A;  4CGZ A;  3UMG A;  3LWL A;  3H4B A;  4Y2P A;  4GC7 A;  5B3Q A;  3ZDB A;  3PSI A;  4QZI A;  4XRH A;  2K4E A;  4UW9 A;  8ICK A;  1RXV A;  2AQ0 A;  8ICS A;  1FEZ A;  1ZRN A;  5L1K A;  5DQI A;  3AN1 A;  3MGV A;  2W04 A;  4O0I A;  2R8G A;  2D6F C;  3H0R B;  4Y2V A;  1ZQN A;  2YMQ A;  2HVI A;  3EF2 A;  3PX6 A;  2KKV A;  5T14 A;  4CF3 A;  2KZM A;  1N63 A;  1RM6 C;  2W7P A;  4EGW A;  4F93 B;  4ELT A;  3NAS A;  2W7O A;  4C8K A;  5ALY A;  5KG2 A;  1BPE A;  4S3N A;  3PVX A;  5HMM A;  2AH5 A;  1KN5 A;  4DS4 A;  2Z7J A;  1L5U A;  1YT3 A;  4DFK A;  7ICS A;  2O1P A;  2HHU A;  3LYS A;  4O3R A;  3BQ1 A;  2XY7 A;  3AEV A;  4OJL A;  5J0X A;  1KBU A;  2M2U A;  4F5Q A;  4MKP A;  3NVZ A;  3PSF A;  3ZDD A;  5KG3 A;  1BPZ A;  1L8L A;  4B9V A;  3RF9 A;  1L7P A;  3EW9 A;  1MSW D;  4AT8 B;  1IG6 A;  2EAN A;  4B9S A;  3C1Y A;  3RJK A;  8ICI A;  4FE3 A;  2BBJ A;  1ZD2 P;  2FCL A;  2G0A A;  3IG5 A;  4LT6 A;  3NGD A;  3D2N A;  3CW2 C;  4ATB B;  1FA0 A;  5KFM A;  4ECV A;  2P6R A;  4RPZ A;  5AM0 A;  1SZP A;  3RJE A;  4NWI A;  5DB9 A;  1Q79 A;  5AKJ A;  4DQR A;  3PW4 A;  2DKZ A;  4A8E A;  4BXO B;  5CR0 A;  1LV5 A;  1SIJ A;  3RB0 A;  5CEH A;  4NXX A;  3EPG A;  1KKX A;  4FS1 A;  3NTU A;  3TAN A;  3Q8M A;  2EZY A;  2BPC A;  1K5O A;  2JXJ A;  1R89 A;  3KHH A;  2ISO A;  1KLN A;  5HRF A;  2ZTC A;  5D4B A;  1MIY A;  1JQR A;  3CNH A;  2M0N A;  2Y0S F;  2NRV A;  3C5G A;  4UB2 A;  3NRW A;  4NLN A;  1CEZ A;  2KNJ A;  4KB6 A;  1BPD A;  4XQ7 A;  4X4V A;  1SV0 A;  2FMQ A;  1ZQD A;  1VFG A;  2M2T A;  2ZH7 A;  3TFS A;  1IXR A;  4KLQ A;  3JZ0 A;  8ICR A;  4Q45 A;  2V4Q A;  4DF8 A;  5J2H A;  3N7S C;  4DOA A;  4UD4 A;  2XIC A;  1RG6 A;  2ODG A;  4NM1 A;  4I2H A;  4O5E A;  4FO6 A;  2IHN A;  4FZL A;  5F9N A;  3HKZ F;  4FH3 A;  3V6K A;  4FZM A;  3HPO A;  4CNQ A;  2GO7 A;  4EBD A;  3RB6 A;  4QZD A;  4EBE A;  4USA A;  5ALN A;  2Y1J A;  3PW7 A;  5ALE A;  4M6W A;  7ICF A;  1J97 A;  2ZH2 A;  1D8B A;  1S0N A;  3MBY A;  1B0X A;  2PXI A;  2W9C A;  1TK0 A;  1U4B A;  1D8L A;  3GV7 B;  3RH6 A;  1ZQH A;  3AQE A;  2G06 A;  2XGQ A;  3H4D A;  4C8L A;  4X5V A;  1L6N A;  3NKU A;  4UAU A;  4GIB A;  3QEA Z;  4GC6 A;  2UVU A;  4F3O A;  1ZQF A;  1Q8K A;  3C18 A;  3VCB A;  3SV3 A;  3IHQ B;  1OUQ A;  1V38 A;  4EYI B;  9ICC A;  5L1L A;  4F4K A;  2E8M A;  5HC9 A;  9ICV A;  3H7I A;  3OHB A;  2GH1 A;  3M9O B;  1TAM A;  4KLE A;  1BNP A;  5ALP A;  2DUY A;  2AQ4 A;  1NK9 A;  4UQG A;  3MGI A;  3PV8 A;  3H8M A;  3GDX A;  4LVS A;  3IP4 B;  4I2J A;  1GO3 F;  3T5L A;  4F5P A;  5J0R A;  3Q8L A;  4EV6 A;  5KFT A;  1UCV A;  1ZQL A;  4G9B A;  4F4X A;  2OYY A;  4NXT A;  4DS5 A;  5DG8 A;  1X9S A;  2ZH9 A;  1QQ6 A;  4RUC A;  1ZD5 A;  4O3Q A;  1X42 A;  2WAQ C;  4MF8 A;  4QZA A;  5J0O A;  2BHN A;  4UB6 U;  3PW2 A;  2V4R A;  2EZX A;  4C80 A;  2IHO A;  3QX7 A;  4NL9 A;  4PGX A;  2ZHB A;  2DBY A;  4YR0 A;  8ICA A;  5F9L A;  2Y9U A;  5ALX A;  4CE6 A;  4X0A A;  3DV9 A;  4K99 A;  2HOF A;  2ZXH A;  4MF2 A;  3H0L B;  1PK1 B;  4J9M A;  3RAX A;  1AQ6 A;  5ALS A;  2HOQ A;  2E5S A;  1MN8 A;  3T5J A;  4O5C A;  5KG4 A;  4QZ9 A;  5J8Y A;  2DRA A;  1Q46 A;  2KJ8 A;  4M0A A;  1PZN A;  3KZI U;  3C2K A;  5IIM A;  1UT8 A;  5CFU A;  2I1Q A;  2FLL A;  2PFP A;  5HRB A;  1A0P A;  1TK8 A;  2KSO A;  3C5F A;  8ICP A;  4WOY A;  2JR5 A;  3BQ7 A;  4EX6 A;  4RQM A;  1F44 A;  4X4O A;  1K1S A;  5ALU A;  3M1Y A;  7ICI A;  1N48 A;  5CB1 A;  5J8Y C;  5CHG A;  5J0P A;  4AT7 A;  2JGA A;  1B4F A;  3N97 B;  5DGA A;  5KFF A;  2K8B B;  3JYY A;  3VC8 A;  8ICO A;  1FIQ A;  4BWM A;  3IDW A;  4K4I A;  5KFJ A;  3PST A;  1PK3 A;  5J2B A;  1J2M A;  2BPG A;  2C22 A;  2HBJ A;  1S0M A;  5H2F U;  2OM6 A;  3TAR A;  1KSP A;  5J2D A;  4RWN A;  4PHP A;  5K4L A;  3UXP A;  2EWR A;  3SMV A;  4C4T A;  2YTU A;  1Z1V A;  2K4P A;  3MDA A;  2Y1I A;  1WCN A;  4WC0 A;  4CDG A;  4J9N A;  2IHM A;  2K4H A;  3OJS A;  3C66 A;  1CUK A;  5KT7 A;  3WK9 A;  4WJ3 B;  4AT7 B;  5BOL A;  3Q8Q B;  2XID A;  3OWG A;  4X4R A;  4YR2 A;  1SV4 A;  4UAT A;  3Q8R B;  4TQS A;  5CRX A;  4OO1 J;  1L7N A;  3UM9 A;  3PW0 A;  3PR4 A;  4QWE A;  2VJ4 A;  3ZD9 A;  1N61 A;  4ATB A;  4HYK A;  2DRB A;  3OUY B;  1URJ A;  4TUQ A;  4P0P B;  5ALJ A;  1WUD A;  1L8O A;  2YQE A;  3RH4 A;  1B22 A;  2BPF A;  2GWS A;  1ZQX A;  3QZ8 A;  1RYU A;  1VLB A;  1RXW A;  1PX5 A;  1JAL A;  2PMZ C;  2KEY A;  3B0Y A;  2ZXI A;  3PO4 A;  8ICN A;  2KSO B;  3KD3 A;  5ALT A;  4OAG A;  2M2V A;  5EWF A;  1X9M A;  4X4P A;  4PZN A;  5J0T A;  1XS9 D;  3AU6 A;  2ISP A;  5AI4 A;  2PFQ A;  3HJ4 A;  3SYZ A;  3WK6 A;  2W9B B;  4YVZ A;  4YG2 A;  4B9U A;  1Z3E B;  2F1H A;  8ICH A;  3AQK A;  4DL4 A;  3SEN A;  2ZIU A;  1KFS A;  2YMP A;  3KFU F;  5AI0 A;  5KFE A;  5KAF U;  3SD7 A;  2NV3 A;  1COK A;  2E8N A;  2ZUB A;  5KFU A;  4FBU A;  3EYZ A;  1UHU A;  5KL1 B;  5C5J A;  2D3D A;  5J2F A;  2XC9 A;  2HHW A;  2PFN A;  1UPH A;  4EEK A;  5KG5 A;  4RQ4 A;  4RQ3 A;  1ZXI A;  5DQH A;  3TAQ A;  7ICL A;  5CFS A;  2QB0 B;  4ECQ A;  4DL6 A;  4QZC A;  2QAR A;  5HML A;  4YN4 A;  2ZHA A;  2HHV A;  1ZRM A;  3GIL A;  2YN4 A;  1Y88 A;  2FLN A;  1BPX A;  5KFL A;  4WC4 A;  2MA1 A;  4DQS A;  3J81 j;  1T4G A;  2NRW A;  5DDM A;  5KT6 A;  1LB2 B;  3BS7 A;  2JH7 A;  3GFK B;  4NKT A;  4PJ0 U;  1YZ7 A;  1N56 A;  3UPQ A;  1J2N A;  2M2W A;  3TAD C;  3MGH A;  3WKE A;  4QZB A;  4UB8 U;  5ALL A;  8ICV A;  5D62 A;  4JV2 A;  2FLP A;  1ZYQ A;  5EOZ A;  7ICE A;  4FHW A;  5KNI A;  2ASD A;  2KVS A;  3I28 A;  1H38 A;  2J6T A;  1CI4 A;  2H3Z A;  2NRT A;  1RZT A;  1RYR A;  4IR1 A;  8ICB A;  5EE9 A;  4R66 A;  5DEC A;  2HDO A;  4F5O A;  4RT2 A;  5L1M A;  2B6G A;  2HN2 A;  5HRK A;  5L9X A;  2ZH6 A;  5IIN A;  2EAO A;  5KFQ A;  4E8F A;  5DB6 A;  4UB3 A;  3PR5 B;  3E0F A;  2IBK A;  2AGQ A;  5KT4 A;  2KFN A;  2KP7 A;  1M6Y A;  4CRX A;  2F8L A;  3N7R C;  3QEB Z;  4EP7 A;  2W3R A;  4NV0 A;  2Q66 A;  1V9P A;  9ICK A;  4BJQ A;  4C7Z A;  3QNM A;  5HHI A;  5IIK A;  3RR8 A;  4KMU A;  3RB4 A;  4M9G A;  1ZQR A;  2ZG6 A;  3WFO A;  2K60 A;  1XSN A;  3KTQ A;  4E80 A;  3ERC C;  5J2K A;  5AIC A;  2YB4 A;  3IG8 A;  3TAC B;  3SZ2 A;  3BS5 B;  3HT3 A;  3GIJ A;  3PX4 A;  3N28 A;  4WC3 A;  3KOO A;  3MR5 A;  4YXJ A;  4DSJ A;  3GIM A;  4NLG A;  4U6P A;  5EE1 A;  2DR8 A;  4DSF A;  3GQC A;  7ICK A;  4PHD A;  5HP4 A;  1SGG A;  3ISC A;  4Y2J A;  2W9M A;  4K98 A;  1ZD3 A;  3H3A A;  4QWB A;  1S9F A;  5DGB A;  3BJY A;  5BPC A;  2CRX A;  1R8C A;  2Y0S C;  3PX0 A;  2LMR A;  5ALD A;  2BDU A;  5KFK A;  5AKZ A;  4X4U A;  3FM9 A;  2KKP A;  1RDF A;  2QLT A;  3ZDA A;  3JPT A;  1MIV A;  2JH1 A;  4ED7 A;  3EWA A;  1RQN A;  2F8K A;  2XCP A;  2ZTE A;  4P2H A;  3T5K A;  1ZQW A;  3PMN A;  2C2R A;  3ORY A;  4J9L A;  4M9L A;  4KLG A;  9ICM A;  1V85 A;  4WQL A;  4EEL A;  2W8K A;  1Z1B A;  1XNS A;  1NKB A;  1SWV A;  1BGX T;  1PVP A;  4M04 A;  1JX4 A;  1ZET A;  4C8M A;  1TK5 A;  2DWQ A;  3R9K A;  2C2D A;  7ICT A;  2LBO A;  4F91 B;  2KN7 A;  2KVC A;  5HRH A;  3N4M B;  4ELV A;  2F1J A;  4QWD A;  3OSP A;  4FHY A;  1LVH A;  2EH9 A;  2RDJ A;  4EBJ A;  2F77 X;  2BQU A;  4PHA A;  4KX5 A;  3QUQ A;  4ED0 A;  3AM9 A;  9ICL A;  4KLJ A;  5AKK A;  1ZQC A;  3HJ1 A;  9ICN A;  1ZQP A;  5ALV A;  1ZJN A;  1TE2 A;  2DL0 A;  5DLG A;  9ICW A;  4CF4 A;  3FC4 A;  3PZP A;  1Z4O A;  4EZ9 A;  2W03 A;  1QCK A;  4IR9 A;  5TIS U;  3NUQ A;  1OU5 A;  1NK5 A;  5AI5 A;  4JB3 A;  5DDY A;  5B5E U;  3BQ2 A;  4KMO B;  3RB3 A;  3OVS A;  4I2G A;  4NKU A;  2H3Q A;  4J9P A;  4R63 A;  2YB1 A;  1RYS A;  4C7Y A;  2ZUD A;  3ISB A;  1NJW A;  2LKY A;  3BQT A;  1ZQI A;  2DGZ A;  1WCL A;  3Q8S B;  3OV7 A;  4KLU A;  5CA7 A;  2IUB A;  4DOB A;  1OXJ A;  1S5L U;  3RBE A;  2N1R A;  4PL1 A;  4UAY A;  1ZQU A;  4OJP A;  1U49 A;  4JV0 A;  2A1J A;  1COO A;  1XWL A;  5AKL A;  1S10 A;  3ZDE A;  4DCC A;  4PGQ A;  5KFG A;  2O5A A;  3UQ2 A;  5KFZ A;  4LZD A;  2RP5 A;  3FYH A;  3LVV A;  1QH9 A;  5J0Q A;  2FE9 A;  3IN5 A;  4OAF A;  9ICU A;  2IOF A;  2AJQ A;  3WKC A;  2KZZ A;  2B21 A;  1IV8 A;  1VJ7 A;  1JIH A;  4M9H A;  2ZIX A;  4F92 B;  1L3S A;  3C1Z A;  4K9B A;  5TZV A;  1D9F A;  2AHO B;  4KLS A;  3K1R B;  4B9M A;  1ZQQ A;  2ZH8 A;  2KJ9 A;  3S6J A;  1SXD A;  3GV8 B;  4HX0 A;  4ACO A;  2KHQ A;  1ZQO A;  1DXS A;  1QSS A;  2JHD A;  2A19 A;  7ICV A;  4YD1 A;  3KKA A;  1A6S A;  3AQF A;  3MFH A;  2DQN B;  4IQV A;  3Q8K A;  1ZQS A;  3WKA A;  3OPX A;  3EUB 2;  2HHS A;  4YMM A;  4ECY A;  4UB4 A;  4ED6 A;  4QJF B;  4YFK A;  8ICY A;  1BVS A;  1SV0 C;  1GPJ A;  1SL2 A;  8ICC A;  2P66 A;  1NK4 A;  2NRK A;  4DSE A;  2E8P A;  2OWO A;  8ICT A;  1O08 A;  2ZJ8 A;  5J2A A;  1DGS A;  3RR7 A;  4WBY A;  2EZZ A;  2BDP A;  3OTQ A;  5KFD A;  2XCA A;  3MR6 A;  2DVI A;  3LWM A;  4EEY A;  5JU5 A;  3ETL A;  2LI6 A;  4LEW A;  4R8U B;  3OGU A;  3PO5 A;  4O9M A;  2K8A A;  2ALZ A;  3WFR E;  3SV4 A;  1ED1 A;  5BOM A;  5FP0 A;  1NKC A;  1UT5 A;  4O69 A;  1NOM A;  2GOL A;  4F72 A;  3RBD A;  7ICO A;  4KM5 A;  2NRZ A;  4F2R A;  1ZJM A;  5AKG A;  4F71 A;  5J0W A;  4KLF A;  5HR7 A;  1Q78 A;  2P35 A;  4WBZ A;  4WCW A;  8ICZ A;  5HR9 A;  5B66 U;  3H0M B;  4MEX A;  2KJ5 A;  2E1F A;  3NVW A;  3IM1 A;  3H8J A;  1Z00 A;  3CP8 A;  5AK5 A;  2WF5 A;  4X0B A;  2F3N A;  1YLQ A;  2J6U A;  5EWE A;  2W9A A;  1MIW A;  2GAF D;  3F5A A;  2F1I A;  2P6U A;  3QU7 A;  2ZH5 A;  4NXV A;  2RFF A;  1PVQ A;  4WC1 A;  2AGO A;  9ICP A;  3ZDC A;  3O0F A;  2IOH A;  3AU2 A;  1KDH A;  3WK7 A;  3MDC A;  3MCR A;  5HRG A;  4IRK A;  1NNL A;  2OH2 A;  3G6Y A;  2YX8 A;  3JPO A;  1HUO A;  3JPN A;  1Q3U A;  1HEK A;  4YCX A;  3KKA C;  2LPE A;  5JTG A;  2HCF A;  1IM4 A;  4LEV A;  4PPX A;  2E8O A;  3WFP A;  4FHV A;  1NJX A;  1NZB A;  4KX3 A;  2FPK A;  1T3Q A;  4FZN A;  2ES6 A;  4JWN A;  4I2F A;  3M7D A;  1LKY A;  1SB3 C;  3RTV A;  1UEV A;  2R18 A;  2JZB A;  4DLG A;  4M9J A;  9ICA A;  1JRO A;  5ALW A;  4I2B A;  3HWT A;  1U45 A;  5KFA A;  3SAF A;  4PH5 A;  1KRP A;  5CWR A;  1SXE A;  4KLI A;  1ZQT A;  1QLN A;  4OJO A;  4UAZ A;  2HHP A;  2RLT A;  3C28 A;  2KG5 A;  5KFI A;  3TFR A;  5J0Y A;  1Z4N A;  3UMB A;  1XSL A;  3G6X A;  3EPI A;  5AK3 A;  5J29 A;  4F5N A;  4N7R A;  1SKS A;  2BZF A;  4RU9 A;  1BNO A;  4J9S A;  2W9C B;  1XO1 A;  4DSK A;  5AIB A;  5KFR A;  8ICF A;  2KMD A;  4KLT A;  1ZQM A;  3PSP A;  5KFW A;  5G5G A;  4KLL A;  3OHA A;  2UVW A;  4KLO A;  4US8 A;  1ZQZ A;  4ED3 A;  2VJ5 A;  4I27 A;  2W8L A;  2QB1 A;  1D8Y A;  5JTI A;  2KIW A;  4RUA A;  1NK7 A;  3I1Y A;  2PFO A;  3OUY A;  1IIP A;  1NZP A;  4O68 A;  5JRT A;  3UQ0 A;  5KFN A;  3ALR A;  4XA5 A;  5DB8 A;  9ICJ A;  8ICL A;  1UA0 A;  4DQI A;  4KLD A;  4FHX A;  2VA8 A;  2KD1 A;  3NWI A;  5GTH U;  4RQN A;  5CJ7 A;  4P4M A;  2HBM A;  4QZH A;  3TQ1 A;  2DR5 A;  1DRG A;  2HHX A;  4NLB A;  3D6J A;  3T5H A;  1TV9 A;  2EAM A;  3T3F A;  1NJY A;  2WF8 A;  2YMM A;  1S0V A;  3F5E A;  1X6I A;  3NYB A;  2FDR A;  2HVH A;  4M5D A;  8ICG A;  7ICG A;  4ZH4 A;  2R8I A;  4LZG A;  4E0D A;  4RQ1 A;  4KTQ A;  4Q8E A;  1ECW A;  4NJ8 A;  4EEN A;  5HNK A;  3K75 D;  4QZE A;  2XI9 A;  3TAD A;  4M2Y A;  4NLC A;  2HOI A;  5DG7 A;  2KK0 A;  2R8H A;  3NRZ A;  2CN1 A;  4JLX A;  4O3M A;  4UBB A;  4DLE A;  3D2Q A;  3G6V A;  1SZH A;  4YXM A;  4Q8F A;  4JLZ A;  2PI4 A;  4HAI A;  8ICW A;  2BCS A;  2W3S A;  3FAH A;  3RJH A;  4UAR A;  4EYH B;  7ICN A;  3DDH A;  1V4A A;  1ARO P;  3HW8 A;  2IOF K;  4EBC A;  4F8R A;  4DL3 A;  1TKD A;  2JEG A;  4PL2 A;  4MFF A;  2LYA A;  2LYH A;  2R8J A;  4OD0 A;  4ECR A;  5EE3 A;  1ZQE A;  2WB1 C;  1ZQA A;  2VAN A;  2JEF A;  4E7X A;  4DL7 A;  5AM2 A;  1QQ7 A;  2PBE A;  1FO4 A;  5AKI A;  2C2E A;  5HRD A;  4NXW A;  5AKH A;  4Y2X A;  4RQ6 A;  3OVB A;  4BGD A;  2F44 A;  5AK4 A;  4R8U A;  2DPI A;  2MAX A;  4Y2R A;  2B0C A;  5A0L A;  4F4Z A;  1LKY B;  2CXY A;  1TVA A;  3V7L A;  3QUB A;  2FMS A;  4DL2 A;  3HJE A;  1DK3 A;  5ALF A;  4TUS A;  4F50 A;  5AKX A;  1XSP A;  3WK8 A;  2OXO A;  2BBH A;  5KT3 A;  1F5A A;  5ALQ A;  1K1Q A;  1UEU A;  4Q43 A;  4I2E A;  2CPR A;  4ED1 A;  2KTQ A;  3IRU A;  2W54 A;  1NK0 A;  1KQQ A;  9ICB A;  4J9K A;  5KAI U;  2B4V A;  2E3T A;  4QW8 A;  4BX9 C;  2VA2 A;  4C4R A;  4IS7 A;  4IQU A;  4JUZ A;  2NRX A;  3RJJ A;  2RDI A;  4I0U A;  2HW3 A;  4KIT B;  1ZQB A;  1QSY A;  3V6H A;  3KHL A;  2ZTD A;  5HR6 A;  2HBK A;  3L9D A;  4M47 A;  4MHV A;  3M6Z A;  4O3P A;  2G07 A;  1QTM A;  5HRL A;  4KN4 A;  4RQ8 A;  3KHR A;  2WTF A;  3MC1 A;  4Y2Q A;  2VA3 A;  2ZIX B;  3M9N B;  3T79 A;  2F2A B;  2MRL A;  4DL5 A;  2DPJ A;  9ICF A;  5KFC A;  1F0M A;  3C29 A;  4EEB A;  4RNM A;  4KLM A;  1JXE A;  4F4Y A;  3GU3 A;  2FJ6 A;  5KFS A;  1R8A A;  3RH5 A;  4EED A;  3PNC A;  4O6A A;  1DK2 A;  4Y2Y A;  1P7D A;  2H3V A;  5AM5 A;  5KFO A;  1ZOL A;  3L4P A;  1KL9 A;  3WFQ E;  2RRD A;  3M8S A;  4ECZ A;  4AT9 A;  3B9J A;  2ASJ A;  3UXN A;  2HHT A;  1T7P A;  3QU2 A;  4O5K A;  4ECS A;  3D2S A;  4PHE A;  2ZIV A;  1NK8 A;  2UVR A;  4C0Z A;  3RJF A;  1TAU A;  1L3V A;  3QYP A;  5CP2 A;  4K9A A;  1KEJ A;  2B56 A;  1PUZ A;  4RPX A;  5IIO A;  3RJI A;  4I2A A;  4O3N A;  3C21 A;  2W55 A;  2OEH A;  3ZD8 A;  2Y9T A;  1T3N A;  3QXG A;  3K7D A;  3JPS A;  3WKD A;  1MA7 A;  1VDV A;  2DKX A;  2ESE A;  4YMN A;  9ICO A;  3C23 A;  2K89 A;  5HRI A;  1U9L A;  1WWV A;  3M6K A;  2KV2 A;  2RQ5 A;  4DFP A;  2BCQ A;  2XGP A;  3PHZ A;  4ED2 A;  4R64 A;  4K4H A;  2BQ3 A;  3V6J A;  3FDS A;  2BE3 A;  3OJU A;  3WKB A;  3GIK A;  3K1Z A;  5KG0 A;  2KOB A;  2A1J B;  2A1A A;  2VIX A;  4QZF A;  4GXK A;  4K97 A;  3N7P D;  5CFT A;  1S8O A;  4KN7 A;  2DF4 B;  2O6K A;  3QUT A;  3V72 A;  2WB1 F;  5KFV A;  1ZQK A;  2YY6 A;  5KFY A;  2GLE A;  1JN3 A;  1Q3V A;  4UAW A;  3NVO A;  2BCR A;  4K8V A;  4C4S A;  5AKE A;  4ED8 A;  1JUD A;  3ED5 A;  4DQQ A;  4WC5 A;  4EX7 A;  4MFA A;  2FMP A;  4R65 A;  3H37 A;  9ICG A;  1WWU A;  1B43 A;  3K4G A;  1JI7 A;  4IC9 A;  4B9L A;  4FS2 A;  3DEE A;  3WFS C;  4YMO A;  1V97 A;  4DO9 A;  1SKW A;  2B51 A;  3UPS A;  4X4T A;  5IIJ A;  5DBC A;  5L1J A;  3MR2 A;  2ID1 A;  2KE7 A;  2Q0Z X;  4NM2 A;  1WOT A;  4IG8 A;  3NVV A;  4XJE A;  5DG9 A;  2FI1 A;  1NO5 A;  5KG6 A;  1RQL A;  4PZO A;  3PW5 A;  4J9R A;  9ICT A;  5EE0 A;  1N5X A;  2ZIV B; 
#chains in the Genus database with same CATH homology
 3AU2 A;  3RAQ A;  2IA6 A;  2ZUB A;  4B9N A;  1KDH A;  7ICU A;  5KFU A;  4YR3 A;  4FBU A;  3EYZ A;  5J2E A;  3MDC A;  5C5J A;  4ECW A;  7ICM A;  5HRG A;  5J2F A;  4GXI A;  3RRH A;  4IRK A;  2XC9 A;  1NKE A;  3G6Y A;  2HHW A;  2PFN A;  3JPO A;  1HUO A;  3JPN A;  4P4O A;  1QSL A;  5KG5 A;  4RQ4 A;  5F2V O;  4RQ3 A;  3PML A;  4YCX A;  3BDP A;  1Z00 B;  4JWM A;  4WC6 A;  4QWC A;  4I28 A;  5DQH A;  4ELU A;  2JZB B;  3TAQ A;  2BKE A;  7ICL A;  1TAQ A;  1S0O A;  3LWL A;  3H4B A;  4GC7 A;  3ZDB A;  4ECQ A;  4DL6 A;  2JEJ A;  4QZI A;  4XRH A;  1IM4 A;  1EXN A;  5HML A;  4QZC A;  8ICK A;  4C8O A;  4YN4 A;  4PPX A;  2HHV A;  2ZHA A;  3WFP A;  1RXV A;  2AQ0 A;  3GIL A;  4FHV A;  8ICS A;  4RPY A;  1Y88 A;  1NJX A;  2FLN A;  1XU4 A;  1BPX A;  5KFL A;  2FPM A;  4WC4 A;  5L1K A;  5KTQ A;  2FPK A;  4DQS A;  5DQI A;  2KFZ A;  2KZ3 A;  4FHP A;  4O0I A;  4JWN A;  1T4G A;  4I2F A;  2NRW A;  5DDM A;  2R8G A;  5KT6 A;  1LB2 B;  1ZQG A;  1ZQN A;  3RTV A;  2HVI A;  3GFK B;  1UEV A;  4NKT A;  2JZB A;  4DLG A;  4YQW A;  4UBC A;  4M9J A;  9ICA A;  1N56 A;  3UPQ A;  4I2B A;  3HWT A;  1U45 A;  5KFA A;  3PX6 A;  7ICR A;  2M2W A;  2KZM A;  4AT9 B;  4JK1 A;  4PH5 A;  3MGH A;  1KRP A;  4QZB A;  5CWR A;  1RPL A;  1SKR A;  8ICV A;  4PGY A;  4F93 B;  4KLI A;  4ELT A;  4JV2 A;  1ZQT A;  2ATL A;  4NLZ A;  1X9W A;  5JUM A;  2FLP A;  1ZYQ A;  1A77 A;  4C8K A;  1QLN A;  5EOZ A;  4UAZ A;  7ICE A;  2HHP A;  4FHW A;  5KG2 A;  1BPE A;  2ASD A;  1ZQY A;  5KFI A;  3PVX A;  4S3N A;  5HMM A;  1H38 A;  2J6T A;  3TFR A;  4FH5 A;  5J0Y A;  4Z6F A;  4DS4 A;  2NRT A;  1L5U A;  1RZT A;  1RYR A;  4DFK A;  1XSL A;  4ECU A;  7ICS A;  2O1P A;  3G6X A;  4IR1 A;  3EPI A;  2HHU A;  4O3R A;  5J29 A;  4F5N A;  8ICB A;  1L3U A;  3BQ1 A;  2XY7 A;  4WC7 A;  4R66 A;  5DEC A;  1SKS A;  4RU9 A;  4F5O A;  1BNO A;  4RT2 A;  4UB5 A;  4J9S A;  2W9C B;  5DLF A;  2M2U A;  5J0X A;  3OVA A;  1XO1 A;  4F5Q A;  4DSK A;  5HRK A;  5L9X A;  3ZDD A;  2ZH6 A;  5IIN A;  5KG3 A;  5EWG A;  5KFR A;  8ICF A;  1BPZ A;  5KFQ A;  4E8F A;  5DB6 A;  4KLT A;  4UB3 A;  3PR5 B;  5KFW A;  3TI0 A;  1ZQM A;  1DOQ A;  2IBK A;  4KLL A;  4B9V A;  3OHA A;  5KT4 A;  2AGQ A;  2UVW A;  1S77 D;  2KFN A;  2KP7 A;  3EW9 A;  1MSW D;  4AT8 B;  4KLO A;  4RNO A;  9ICI A;  3H39 A;  1ZQZ A;  4DFJ A;  5J0U A;  4ED3 A;  4B9S A;  3C1Y A;  5KT5 A;  3RJK A;  4I27 A;  8ICI A;  3QEB Z;  2JEI A;  4LT6 A;  2W8L A;  3AQL A;  3NGD A;  4EP7 A;  4XQ8 A;  1D8Y A;  1FA0 A;  4ATB B;  5KFM A;  4ECV A;  4RUA A;  5HRE A;  1NK7 A;  3LK9 A;  2Q66 A;  2P6R A;  1V9P A;  2PFO A;  3OSN A;  9ICK A;  9ICE A;  3OUY A;  1ZQJ A;  5HHI A;  1NZP A;  3UQ0 A;  5KFN A;  4RPZ A;  7ICH A;  5IIK A;  4XA5 A;  4KMU A;  5DB8 A;  3RR8 A;  4WC3 A;  9ICJ A;  1SZP A;  8ICL A;  1UA0 A;  3RB4 A;  3RJE A;  4DQI A;  4M9G A;  1ZQR A;  5DB9 A;  4KLD A;  2XY5 A;  1Q79 A;  4RWQ A;  3KTQ A;  1XSN A;  1D9D A;  4DQR A;  4FHX A;  3WFO A;  2VA8 A;  4E80 A;  5J2K A;  3PW4 A;  4QZG A;  5CJ7 A;  4P4M A;  5D49 A;  5CR0 A;  2I9G A;  4BXO B;  4QZH A;  3TQ1 A;  1LV5 A;  3GII A;  1MQ2 A;  2DR5 A;  2HHX A;  3SZ2 A;  3RB0 A;  3V7K A;  2ZH1 A;  5KFB A;  3HT3 A;  3GIJ A;  3T5H A;  3EPG A;  1TV9 A;  2H5X A;  2UVV A;  2BCV A;  3PX4 A;  4FS1 A;  3NTU A;  3TAN A;  3Q8M A;  4G3I A;  3T3F A;  1NJY A;  2BPC A;  3MR5 A;  1S0V A;  1R89 A;  3KHH A;  3NYB A;  2ISO A;  2HVH A;  4X4N A;  1KLN A;  4M5D A;  4YXJ A;  8ICG A;  4DSJ A;  7ICG A;  5HRF A;  2ZTC A;  3GIM A;  5D4B A;  4RQ5 A;  4ZH4 A;  2R8I A;  5DQG A;  4E0D A;  4Z6C A;  4LZG A;  4NLG A;  4RQ1 A;  1JQR A;  1MIY A;  4KTQ A;  4QWA A;  4Q8E A;  3C2L A;  3H38 A;  2NRV A;  5HNK A;  3C5G A;  2XY6 A;  2DR8 A;  4UB2 A;  3K75 D;  5KFX A;  4QZE A;  3GQC A;  4DSF A;  4BXO A;  4PHD A;  5HP4 A;  4DQP A;  4NLN A;  7ICK A;  4O3O A;  1CEZ A;  1MQ3 A;  3ISC A;  4M2Y A;  1BPD A;  2W9M A;  4XQ7 A;  4X4V A;  4MEY A;  5DG7 A;  4QWB A;  1S97 A;  3H8S A;  3H3A A;  1S9F A;  5DGB A;  5DKW A;  1KTQ A;  2R8H A;  3BJY A;  2FMQ A;  5BPC A;  4F5R A;  1ZQD A;  4NY8 A;  2M2T A;  8ICM A;  1VFG A;  4UBB A;  4DLE A;  1R8C A;  3PX0 A;  1JXL A;  2ZH7 A;  2BCU A;  3TFS A;  1IXR A;  3G6V A;  4KLQ A;  3JZ0 A;  5KFK A;  4ECX A;  8ICR A;  2ZH4 A;  4Q45 A;  4X4U A;  4YXM A;  2V4Q A;  4DF8 A;  5J2H A;  4DOA A;  4Q8F A;  4UD4 A;  4X4S A;  4NM1 A;  3ZDA A;  4I2H A;  4O5E A;  2PI4 A;  4FO6 A;  2IHN A;  3JPT A;  8ICW A;  9ICS A;  2BCS A;  4RZR A;  9ICR A;  5F9N A;  1MIV A;  4FH3 A;  4ED7 A;  3V6K A;  3EWA A;  3HPO A;  4GLX A;  4EBD A;  3RJH A;  3RB6 A;  4QZD A;  2XCP A;  3GV5 B;  4RT3 A;  2ZTE A;  4EYH B;  4TUP A;  4EBE A;  2Y1J A;  4K4G A;  4P2H A;  7ICN A;  3PW7 A;  1V4A A;  1ARO P;  3HW8 A;  3T5K A;  4M6W A;  4EBC A;  7ICF A;  1ZQW A;  3PMN A;  4F8R A;  2ZH2 A;  5L1I A;  1KNY A;  1S0N A;  4DL3 A;  3MBY A;  2C2R A;  3ORY A;  4J9L A;  4M9L A;  2PXI A;  4P4P A;  1TKD A;  4KLG A;  9ICM A;  2JEG A;  2W9C A;  4MFF A;  3M8R A;  2W8K A;  1NKB A;  1TK0 A;  2LYH A;  1U4B A;  1D8L A;  2R8J A;  5D46 A;  3GV7 B;  3RH6 A;  4ECR A;  1BGX T;  1ZQH A;  2XGQ A;  3THV A;  3HX0 A;  1ZQE A;  4IRD A;  4IQW A;  4M04 A;  1JX4 A;  1ZET A;  1ZQA A;  4RQ7 A;  4C8M A;  3H4D A;  2VAN A;  4X5V A;  2JEF A;  4C8L A;  4DF4 A;  4E7X A;  1TK5 A;  4DL7 A;  2PBE A;  2MUT B;  2C2D A;  7ICT A;  3QEA Z;  1BPB A;  4F91 B;  2KN7 A;  4GC6 A;  2C2E A;  1T8E A;  2UVU A;  2R8K A;  5HRH A;  3N4M B;  5HRD A;  4F3O A;  4C8N A;  1ZQF A;  4DWI A;  4RQ6 A;  3PY8 A;  4ELV A;  3C18 A;  2F1J A;  3OVB A;  4QWD A;  3OSP A;  3V7J A;  4FHY A;  4BGD A;  3SV3 A;  3IHQ B;  4R8U A;  2AU0 A;  2DPI A;  2RDJ A;  3E2E A;  4EBJ A;  2MAX A;  2ZUC A;  2BQU A;  4EYI B;  4PHA A;  9ICC A;  4DFM A;  4F4Z A;  5L1L A;  5J2J A;  3JPQ A;  5KFH A;  1TVA A;  5KFP A;  4F4K A;  4ED0 A;  5HC9 A;  3V7L A;  9ICV A;  3H7I A;  3OHB A;  4DL2 A;  2FMS A;  4F2S A;  3M9O B;  9ICL A;  4KLE A;  4QW9 A;  1BNP A;  4KLJ A;  1U48 A;  4F50 A;  1DK3 A;  4TUS A;  4TUR A;  1ZQC A;  2AQ4 A;  1NK9 A;  4UQG A;  3MGI A;  3PV8 A;  3GDX A;  1XSP A;  4LVS A;  3HJ1 A;  5KT3 A;  9ICN A;  1F5A A;  1K1Q A;  1ZQP A;  1UEU A;  1KFD A;  1ZJN A;  1NJZ A;  5DLG A;  4Q43 A;  4I2J A;  4I2E A;  3T5L A;  9ICW A;  4RNN A;  4J9Q A;  9ICH A;  4EZ9 A;  4ECT A;  1SL0 A;  5HHH A;  4YP3 A;  3BQ0 A;  5J0R A;  4F5P A;  4ED1 A;  3Q8L A;  4KLH A;  5KFT A;  2KTQ A;  4I2C A;  1ZQL A;  4IR9 A;  1NK0 A;  4F4X A;  4DS5 A;  5DG8 A;  1X9S A;  1NK5 A;  1OU5 A;  9ICB A;  4RUC A;  2ZH9 A;  2ZH3 A;  4J9K A;  5DDY A;  3BQ2 A;  2M9N A;  4O3Q A;  3RB3 A;  1L3T A;  3OVS A;  4MF8 A;  1XC9 A;  4I2G A;  4QZA A;  1KFT A;  4NKU A;  5J0O A;  4QW8 A;  2VA2 A;  4J9P A;  1NK6 A;  4R63 A;  1RYS A;  2BHN A;  2ZUD A;  8ICE A;  3PW2 A;  3ISB A;  4IQU A;  4JUZ A;  2ASL A;  4IQT A;  2V4R A;  2NRX A;  3RJJ A;  2RDI A;  4I2D A;  1NJW A;  9ICQ A;  2HW3 A;  4PGX A;  2ZHB A;  3BQT A;  4KIT B;  4YR0 A;  3SI8 A;  1ZQB A;  1WCL A;  5F9L A;  1ZQI A;  8ICA A;  3UPS A;  2DR9 A;  3Q8S B;  4RQ0 A;  3OV7 A;  4KLU A;  1QSY A;  3V6H A;  5CA7 A;  2J6S A;  3KHL A;  2ZTD A;  4X0A A;  3L9D A;  4M47 A;  3B0X A;  4DOB A;  4O3P A;  1QTM A;  3RBE A;  5HRL A;  4KN4 A;  4RQ8 A;  3KHR A;  4UAY A;  2WTF A;  4MF2 A;  3C2M A;  2AGP A;  2VA3 A;  1ZQU A;  4J9M A;  1U49 A;  4JV0 A;  3RAX A;  5KT2 A;  4J9O A;  2C28 A;  2A1J A;  1COO A;  3M9N B;  1XWL A;  1S10 A;  3ZDE A;  4B9T A;  3T5J A;  4PGQ A;  4O5C A;  4DL5 A;  2DPJ A;  9ICF A;  5KFG A;  2O5A A;  5KG4 A;  4QZ9 A;  5KFC A;  3UQ2 A;  5KFZ A;  2DRA A;  4LZD A;  4M0A A;  4RWP A;  4RNM A;  1PZN A;  3FYH A;  3C2K A;  3MR3 A;  5IIM A;  4KLM A;  3QZ7 A;  5J0Q A;  1JXE A;  4F4Y A;  1UT8 A;  3QE9 Y;  5KFS A;  1R8A A;  2I1Q A;  4DSI A;  9ICU A;  1TFY A;  2FLL A;  3RH5 A;  5DED A;  3PNC A;  2PFP A;  2AJQ A;  1DK2 A;  5HRB A;  1TK8 A;  5J2I A;  2KZZ A;  3RRG A;  2B21 A;  1JMS A;  3C5F A;  4DSL A;  1VJ7 A;  3HIY A;  8ICP A;  1JIH A;  4M9H A;  5IIL A;  4F92 B;  1L3S A;  5KFO A;  3C1Z A;  4EBK A;  4X4O A;  1MC8 A;  5TZV A;  1D9F A;  1K1S A;  4KLS A;  2ZJ5 A;  4B9M A;  7ICI A;  1N48 A;  5CB1 A;  5CHG A;  5J0P A;  1BPY A;  4AT7 A;  3WFQ E;  1ZQQ A;  3M8S A;  3N97 B;  2ZH8 A;  4NXZ A;  5DGA A;  5J2G A;  4ECZ A;  4AT9 A;  4XUS A;  2BGW A;  5KFF A;  2XO7 A;  2ASJ A;  3JYY A;  4BDP A;  8ICO A;  3GV8 B;  3TAP A;  4I29 A;  4BWM A;  3UXN A;  2DFL A;  1ZQO A;  2HHT A;  1QSS A;  4K4I A;  5KFJ A;  1T7P A;  4O5K A;  4GXJ A;  7ICV A;  5J2B A;  4ECS A;  4YD1 A;  1S76 D;  1U47 A;  4EZ6 A;  4Q44 A;  2W9B A;  2BPG A;  2IMW P;  4Z6E A;  2C22 A;  3MFH A;  1S0M A;  4IQV A;  4PHE A;  2UVR A;  1NK8 A;  3RJF A;  1TAU A;  3TAR A;  3Q8K A;  2BQR A;  1L3V A;  5CP2 A;  1ZQS A;  1KSP A;  5J2D A;  4RWN A;  1KEJ A;  2HHS A;  4PHP A;  4RPX A;  3LDA A;  3UXP A;  5KG1 A;  4YMM A;  5IIO A;  3H8W A;  3RJI A;  4ECY A;  4I2A A;  4UB4 A;  4ED6 A;  3RJG A;  4YFK A;  3AUO A;  4O3N A;  3C21 A;  8ICY A;  3MAB A;  3MDA A;  1BVS A;  2Y1I A;  3ZD8 A;  1WCN A;  4WC0 A;  1TFW A;  1T3N A;  1SL1 A;  3Q8P B;  3JPS A;  8ICU A;  1A76 A;  4CCH A;  4RQ2 A;  4MFC A;  4J9N A;  4TQR A;  1SL2 A;  2IHM A;  3OJS A;  8ICC A;  1ZQV A;  4YMN A;  1CUK A;  5KT7 A;  3HP6 A;  2P66 A;  3C23 A;  8ICQ A;  9ICO A;  3C66 A;  1NK4 A;  2NRK A;  4IRC A;  5HRI A;  1U9L A;  4AT7 B;  5BOL A;  4QZ8 A;  3JPP A;  3Q8Q B;  4DSE A;  4X4R A;  4DFP A;  4YR2 A;  2OWO A;  2BCQ A;  2XGP A;  9ICX A;  1HUZ A;  8ICT A;  3Q8R B;  4TQS A;  4ED2 A;  4R64 A;  4K4H A;  1UET A;  2BQ3 A;  2ZJ8 A;  3V6J A;  5J2A A;  1DGS A;  3FDS A;  3RR7 A;  7ICQ A;  2BE3 A;  3OJU A;  8ICX A;  4WBY A;  2BDP A;  3GIK A;  4WC2 A;  3AQM A;  3PW0 A;  5KFD A;  2XCA A;  3MR6 A;  1C7Y A;  5KG0 A;  3PR4 A;  2DVI A;  4QWE A;  3ZD9 A;  2A1J B;  4GXK A;  4M6W B;  4QZF A;  3LWM A;  1JAJ A;  4EEY A;  4O3S A;  1X2I A;  4KN7 A;  3ETL A;  4BWJ A;  4F4W A;  4ATB A;  3V72 A;  4HYK A;  4R8U B;  3OGU A;  5KFV A;  3PO5 A;  4O9M A;  1ZQK A;  2DRB A;  5J2C A;  2ALZ A;  3WFR E;  3OUY B;  3SV4 A;  4TUQ A;  5KFY A;  1JN3 A;  5BOM A;  4FBT A;  4UAW A;  1NKC A;  1UT5 A;  5J0S A;  2BCR A;  1NOM A;  3RBD A;  3H40 A;  3RH4 A;  7ICO A;  4Z6D A;  1B22 A;  1HJP A;  4ED8 A;  2BPF A;  2MUT A;  2PI5 A;  3AQN A;  2DR7 A;  2NRZ A;  2GWS A;  4X4Q A;  4DQQ A;  4F2R A;  4WC5 A;  1ZQX A;  4MFA A;  3QZ8 A;  1ZJM A;  5J0W A;  2FMP A;  7ICJ A;  1RXW A;  1PX5 A;  4KLF A;  4R65 A;  3H37 A;  9ICG A;  1Q78 A;  4M9N A;  8ICJ A;  1B43 A;  3K4G A;  4WBZ A;  3B0Y A;  4WCW A;  8ICZ A;  5HR9 A;  3ISD A;  4B9L A;  4JV1 A;  3PO4 A;  8ICN A;  4UD5 A;  3UXO A;  4FS2 A;  2HHQ A;  1R8B A;  2M2V A;  5III A;  5EWF A;  2FPL A;  4YMO A;  1X9M A;  4MEX A;  4X4P A;  3WFS C;  4DO9 A;  3IM1 A;  2BR0 A;  1SKW A;  3H8J A;  3LQC B;  1Z00 A;  5J0T A;  4YD2 A;  5IIJ A;  5DBC A;  3MFI A;  5L1J A;  3AU6 A;  1XS9 D;  2ISP A;  2V9W A;  2PFQ A;  3MR2 A;  3HJ4 A;  3SYZ A;  4X0B A;  2ID1 A;  1YLQ A;  2W9B B;  4DEZ A;  4YVZ A;  2J6U A;  4RWO A;  4YG2 A;  5EWE A;  2Q0Z X;  4NM2 A;  3M9M B;  2W9A A;  4B9U A;  1MIW A;  1WOT A;  1Z3E B;  2F1I A;  2F1H A;  2P6U A;  4NLK A;  8ICH A;  4I2I A;  4IG8 A;  3AQK A;  5DG9 A;  4DL4 A;  1UA1 A;  5DBB A;  2ZH5 A;  2ZJA A;  2RFF A;  1TFR A;  1KFS A;  4X4T A;  5DBA A;  3EZ5 A;  5KG6 A;  1NO5 A;  4WC1 A;  3JPR A;  3PW5 A;  2AGO A;  9ICP A;  5KG7 A;  4J9R A;  9ICT A;  4DOC A;  3ZDC A;  4UB1 A;  3KHG A;  4AT8 A;  7ICP A;  5DB7 A;  5KFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...