4M9LA

Dna polymerase beta e295k soaked with dctp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
326
structure length
313
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPVAGEPLPVSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9lA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9lA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9lA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9lA03
4C8NA 1ZQNA 3BQ0A 2J6SA 8ICJA 2KZZA 1FA0A 1T8EA 1Y88A 3GDXA 1EXNA 2XO7A 2VA2A 4F8RA 7ICUA 1D8YA 5J2JA 2M2TA 4E7XA 5HMLA 3TFSA 2PXIA 5DQHA 3LQCB 3M8SA 1U4BA 3ZD9A 3OSPA 1SZPA 2BKEA 4O3RA 9ICPA 2R8IA 3TANA 5KFPA 3BQ1A 1MQ3A 4NXZA 2P66A 1U45A 2NRKA 4X4OA 5KFGA 9ICSA 5DLGA 4QW8A 2PBEA 1ZQPA 3Q8LA 4X0AA 4ED3A 4DFJA 4TQRA 4JV0A 3QE9Y 4KLMA 4PGQA 4BGDA 3GFKB 4I2EA 2AU0A 1ZQOA 2R8HA 2C2EA 1ZQAA 3ZDCA 2XY5A 4E0DA 4WBYA 4RQ2A 3TAQA 4WC6A 4YN4A 3T5HA 2UVUA 3OUYB 1TV9A 9ICNA 2M9NA 4DL4A 3AQMA 2DFLA 4DSKA 5J0TA 3SYZA 1ZQJA 3Q8QB 5KT5A 4DFMA 4PHAA 3AU6A 3C2MA 2LYHA 2BDPA 1K1QA 2JEFA 3C18A 1MC8A 4F2RA 3UQ2A 5IIKA 4J9PA 4B9TA 2AQ0A 4KLOA 2RDJA 2DPIA 1U48A 1S0VA 3ISDA 1MIVA 4RT3A 4KLJA 2ZH1A 3RB3A 5KFDA 3PR4A 8ICRA 5J0YA 4ATBA 1OU5A 2V4QA 4DSJA 4RZRA 4EBEA 2OWOA 2FLPA 8ICAA 1WOTA 2XY7A 9ICQA 5CJ7A 2UVWA 3N4MB 2W9BA 3GIIA 5J2KA 4J9SA 4MEXA 2HHQA 4YP3A 4YMMA 3UXOA 4DOBA 1XC9A 4F2SA 4MF2A 4M04A 1V4AA 4I2DA 2ZTDA 5KG3A 4C8OA 4MFCA 1KFTA 4RWPA 2W9CB 5HMMA 1ZQKA 9ICHA 2O1PA 1XWLA 3GV8B 5CP2A 4F5OA 3PVXA 8ICIA 4PPXA 4EBKA 4NLKA 3HJ4A 4ED1A 5KFCA 1BPYA 4FH5A 3JPQA 5DGBA 3Q8PB 3RH4A 5KFLA 5KFAA 4RQ6A 2XGPA 3ISCA 1ZQCA 3UXPA 3SI8A 1YLQA 1ZQEA 2IBKA 4EZ9A 4JWNA 5J0WA 5KFXA 5KFUA 2Y1JA 2BCUA 4RUAA 2P6RA 2HHPA 5HP4A 2FPLA 1NK6A 1MQ2A 4R63A 2WTFA 3Q8MA 4PHDA 4YMNA 1Q79A 8ICQA 3QZ8A 4GC6A 4EBCA 4DL3A 1UA1A 1TK0A 3ZD8A 5F9NA 5L1IA 1QSSA 4KN7A 1Z00A 3ZDAA 4M5DA 4NM2A 4RQ7A 2ZH8A 4P4OA 4UAYA 5L1LA 1PZNA 2JEJA 4DFKA 3JPNA 1NK4A 4FHVA 1S0OA 5KT3A 4O0IA 1NJWA 9ICXA 4DQSA 4ED6A 4X4TA 3OVAA 4QWDA 5HRBA 4KMUA 1JMSA 2VA8A 4RWQA 4TUQA 3FYHA 4O5KA 1XS9D 4KLHA 3PR5B 2O5AA 3BQ2A 4IQWA 4QZEA 1ZQUA 4ATBB 4ECUA 5HRLA 3H40A 1ZQIA 4M2YA 4RQ1A 3C2KA 7ICNA 4M9JA 2XY6A 1MIYA 2W9MA 1NZPA 2C22A 2W9BB 4DOCA 5DLFA 4EEYA 4IRKA 4QZIA 4GC7A 4JV1A 9ICMA 5J0OA 2FMSA 1D9FA 1ZQTA 7ICGA 2F1JA 3KHHA 5KFKA 4F50A 2C2RA 4J9NA 3LWLA 1PX5A 5D46A 3HWTA 4QWEA 4PGXA 3RTVA 4X0BA 2DR9A 5KFOA 3RAXA 8ICXA 4X5VA 4J9OA 3MBYA 5C5JA 1ZQRA 7ICTA 4KITB 5L1KA 2ISOA 1DK3A 3OHAA 1ZQLA 5CB1A 4KN4A 3MABA 5HRHA 3PMNA 4KLEA 8ICBA 3M9OB 4DL6A 1A77A 4TUPA 4Z6FA 4P2HA 3PX4A 4RUCA 4G3IA 1QSYA 4Q44A 4NKUA 3ZDEA 2PFPA 4FS1A 5J0RA 4QZ8A 2ALZA 3UQ0A 2W8LA 4IG8A 3PO5A 2M2WA 5J0QA 4KLSA 1JQRA 3WFOA 3QEAZ 4LZGA 4R8UB 4I2AA 4KTQA 5HRFA 4QWAA 4NLNA 3PX6A 1Z00B 9ICJA 3PMLA 4X4VA 2A1JA 4JWMA 3SV3A 4EYIB 4UQGA 5IILA 3AUOA 4Q45A 4KLDA 1R8AA 5KT4A 5KG2A 1ZQZA 3JPOA 3PY8A 3H4BA 4ECTA 5HREA 4FHXA 5J2FA 3B0YA 3LWMA 4O3PA 4DOAA 3WFQE 5BPCA 4MFAA 5CHGA 4FHWA 1B22A 3OV7A 4ECYA 4YR2A 1ZQQA 1KLNA 5J2GA 3SV4A 3C1YA 4UB5A 1SKRA 4FBTA 4RQ8A 1UT8A 3M9NB 5HC9A 4R65A 5J29A 3V7LA 4F3OA 1JXEA 1TAQA 2ZH2A 4K4HA 3MGHA 1IM4A 2C2DA 3UPQA 4C8MA 4QZCA 3ZDDA 5J0XA 4WC0A 7ICFA 3Q8KA 3PW5A 2ASJA 4TURA 4M6WA 3RJKA 2HHWA 7ICEA 5DECA 5KG1A 2ZUBA 3IM1A 1B43A 3HW8A 1U49A 4PHPA 2XGQA 1DK2A 3C66A 3ZDBA 4UD5A 7ICVA 4IQTA 3MR2A 2ZJAA 4DQQA 3PW0A 2HHVA 9ICRA 4KLQA 4UB1A 9ICIA 2DR5A 4MF8A 4QZHA 2AGPA 2BQUA 2RDIA 3NYBA 4DL2A 2ATLA 1QLNA 3C5GA 4P4MA 2MUTA 2NRXA 2ZH4A 3H8SA 5TZVA 4RU9A 4YR3A 3PO4A 1X2IA 4F5QA 2A1JB 3GIMA 1NO5A 3GV5B 3GQCA 3HX0A 3HPOA 7ICRA 4LT6A 3GIKA 3KHLA 4RQ3A 4J9KA 7ICSA 3HIYA 3WFPA 4AT9B 1U47A 9ICOA 1AROP 4UB3A 8ICZA 2BQ3A 4AT7A 2NRVA 4DF4A 2PFOA 2HW3A 2R8GA 3RJIA 4M47A 3ISBA 4E8FA 7ICHA 2ZHAA 4M9LA 1Z3EB 4NM1A 1BGXT 8ICMA 5HR9A 4F5RA 4F4YA 1SL0A 3UPSA 4UBBA 2Q0ZX 3H7IA 5KFFA 3T5KA 5DQIA 2ID1A 3OVBA 2F1IA 2FPMA 1RYSA 4I29A 3GIJA 1X9SA 1S97A 5DDYA 5HHHA 1NKEA 1KRPA 5KG4A 5J2BA 5CR0A 9ICUA 1KFDA 1RXVA 3HJ1A 5DG7A 4RQ0A 1RPLA 4FHYA 1ZQDA 3C2LA 2XCPA 3MR5A 2IHNA 4NKTA 4WBZA 4FHPA 1UEUA 4M6WB 4UAZA 4Q43A 1RXWA 4BXOA 8ICHA 2BPCA 8ICWA 1R8CA 4WCWA 4ECQA 5DGAA 3KHGA 5DQGA 4RPZA 2BCRA 5KFYA 1X9MA 5KT6A 1S10A 2ZH7A 3K75D 2PFQA 4KLLA 1DGSA 3SZ2A 2B21A 4DSEA 5EWFA 3MR6A 4O3QA 3G6VA 1UA0A 1HUZA 5IIMA 4DLEA 3H8JA 5KG6A 2V4RA 4RT2A 5IINA 2BCSA 2DR8A 3H4DA 2AQ4A 4DSFA 4E80A 1TFYA 3JZ0A 2MUTB 3BJYA 4CCHA 1S77D 1VJ7A 3AQKA 4Z6EA 1NK8A 4K4GA 3T3FA 2XC9A 5DBBA 1R8BA 4QZ9A 1NK5A 2FMQA 1T7PA 1NKBA 4X4SA 5IIOA 2HHXA 4I2GA 4B9MA 3E2EA 4WC4A 1BVSA 3B0XA 3ORYA 3MGIA 3RB0A 2BCVA 4JV2A 2NRTA 4F4WA 2C28A 2AGOA 4I27A 4XA5A 5BOMA 3AQNA 2PI5A 3JPTA 9ICVA 2M2UA 4JK1A 5KG7A 3TFRA 4GXIA 1JIHA 4JUZA 5D49A 4QZAA 4QW9A 2I1QA 4QWBA 3GILA 5D4BA 2BPFA 5KFIA 4IQVA 2JEGA 2DRAA 1QSLA 2AJQA 4R64A 4DLGA 4DWIA 4O3NA 1ZQHA 1BNOA 4YR0A 3OGUA 4YCXA 4RPXA 2DPJA 2FMPA 4IR1A 7ICMA 1TFRA 9ICGA 1K1SA 3OSNA 4QWCA 3JPRA 3LK9A 3MDCA 5DBAA 4BXOB 4X4NA 3TI0A 4UBCA 5HNKA 5EOZA 5J2EA 2KZ3A 9ICWA 4X4RA 2ZHBA 3OVSA 1ZQFA 2DVIA 1ZQSA 1CEZA 2ZTEA 1ZQWA 5DBCA 9ICFA 3MDAA 4I2FA 2KFNA 5KFEA 4UB4A 4KLUA 3V6KA 4MEYA 5J2DA 3MR3A 2V9WA 4DO9A 3V6JA 3RJFA 2BCQA 5HRDA 1BPXA 2J6TA 4I2BA 8ICUA 5J2IA 1NK9A 3RBEA 5J0UA 1L3UA 4ED2A 5DB9A 7ICJA 2Y1IA 2P6UA 1BPZA 4FH3A 4C8LA 4AT7B 2FLLA 1NJXA 2ZUCA 3KTQA 5KFJA 3RAQA 4YMOA 2NRZA 4EBJA 1ZETA 4DL7A 4PGYA 8ICSA 5J2HA 5J2AA 3THVA 4QZBA 1D9DA 4DF8A 5KFWA 1ZJNA 3ETLA 5DKWA 1JX4A 4B9LA 2XCAA 2PFNA 3WFRE 7ICQA 5HRGA 5EWGA 5JUMA 4F5PA 1NJYA 3C5FA 4R66A 4M9HA 5KFMA 4EZ6A 2MAXA 4BWMA 3QZ7A 8ICYA 5EWEA 1NK0A 9ICEA 2KP7A 4Z6CA 1R89A 3JYYA 2DR7A 3RH6A 1KEJA 1TK5A 4DQPA 1KNYA 1SKSA 4O9MA 4RNOA 4ECZA 3EWAA 2PI4A 2KZMA 2IMWP 4HYKA 4XUSA 1WCLA 3PW7A 3K4GA 1X9WA 4YXMA 4QZDA 4UD4A 4WC2A 3AU2A 1QTMA 4ED7A 1U9LA 1BPEA 3H39A 3KHRA 3HP6A 3FDSA 4F4XA 1ZQXA 2ASDA 3C1ZA 3H37A 4XQ8A 8ICLA 2BGWA 1TVAA 4I2JA 2W9CA 3RJEA 5KFZA 3RJHA 5HHIA 3IHQB 3AQLA 4UB2A 3OHBA 4LVSA 4I2HA 4ECVA 1S9FA 2GWSA 3G6XA 3RB4A 4MFFA 4O3SA 4YFKA 4YD2A 8ICKA 1TK8A 1V9PA 5DB6A 4DQRA 1UETA 4EYHB 1LB2B 5L1JA 1KTQA 2BHNA 4F92B 4M0AA 5DG9A 4J9RA 1ZQVA 4XRHA 4KLFA 1TAUA 1UT5A 3T5JA 2BQRA 4RPYA 7ICIA 5L9XA 5KFNA 2VANA 4KLTA 4I2IA 1KDHA 4YG2A 4QZFA 4Z6DA 5KT2A 1UEVA 1ZQMA 3Q8SB 3H8WA 3JPSA 1NJZA 3M8RA 1JXLA 1Q78A 4ED8A 4DFPA 4F91B 3RRGA 5IIJA 3OJUA 4F4ZA 9ICBA 3RR8A 1ZJMA 4ELUA 2HVIA 4J9MA 2F1HA 4ECRA 3T5LA 3MFIA 1H38A 4M9GA 3EYZA 2ZJ5A 4ZH4A 4WC5A 4ECWA 4X4QA 9ICTA 2FLNA 9ICCA 3PW2A 4X4UA 4GLXA 4DSLA 1NOMA 3RJGA 8ICGA 3JPPA 5HRKA 4B9NA 4ECSA 1A76A 2NRWA 3BDPA 1XSPA 3H38A 8ICVA 2J6UA 1F5AA 2M2VA 4IR9A 1XSLA 3V72A 2ZH9A 3UXNA 4LZDA 4IRDA 1ZQYA 4I2CA 4B9VA 3TQ1A 3OJSA 4EBDA 1BNPA 4BWJA 5DEDA 3TARA 4F93B 8ICCA 1S0MA 2HHSA 4YXJA 5BOLA 3RRHA 5KT7A 4ECXA 5KFBA 1RZTA 3PNCA 4YVZA 1XSNA 4Q8FA 3RR7A 2R8JA 1JAJA 4DEZA 4IQUA 5KFVA 1ZQBA 2BPGA 7ICOA 1DOQA 3MFHA 4AT8A 4FBUA 4M9NA 1NK7A 4BDPA 1TFWA 3C21A 4EP7A 4RQ4A 2IHMA 3N97B 5KFTA 7ICLA 1IXRA 4WC1A 2W8KA 1L3VA 4NY8A 2JZBA 3EW9A 4TQSA 4R8UA 1LV5A 5F2VO 2ASLA 4KLGA 3C23A 5KG0A 5J0PA 4NLGA 1XU4A 4F5NA 1N48A 3PW4A 2BR0A 4C8KA 4WC3A 1NKCA 4J9QA 2ZH3A 1N56A 4O3OA 5KFHA 3V7KA 5CWRA 1S76D 2UVVA 3WFSC 5J2CA 1RYRA 4Q8EA 1MIWA 5DDMA 1L5UA 8ICPA 2KFZA 5CA7A 8ICFA 1VFGA 1KSPA 1COOA 3BQTA 2ZUDA 4P4PA 4ELTA 4O5CA 4K4IA 3L9DA 4FO6A 4B9SA 1C7YA 5KFSA 2ZH6A 7ICPA 4YD1A 4DS4A 1SKWA 2ZJ8A 4FS2A 4DS5A 9ICAA 2KN7A 2DRBA 5IIIA 5DB7A 4YQWA 4ED0A 3V7JA 3EZ5A 2I9GA 2HHTA 4S3NA 3PV8A 4IRCA 2KTQA 4TUSA 2IA6A 3Q8RB 9ICLA 4RNMA 2W9AA 5F9LA 3RBDA 5KTQA 4X4PA 2ISPA 3G6YA 2HHUA 5KFRA 1KFSA 1BPDA 1ZQGA 7ICKA 4DQIA 4RWOA 4GXJA 8ICTA 2ZH5A 2Q66A 3PX0A 1BPBA 3EPGA 4RWNA 2H5XA 2RFFA 2R8KA 5DG8A 2HVHA 3TAPA 1SL1A 4F4KA 5J0SA 1D8LA 2ZTCA 1JN3A 5KG5A 4J9LA 1HUOA 4DSIA 4AT8B 4PH5A 3RB6A 1SL2A 4RQ5A 2UVRA 3OUYA 4O5EA 4NLZA 1WCNA 1T4GA 8ICNA 3LDAA 4RNNA 3EPIA 2VA3A 4XQ7A 2FPKA 3RJJA 1CUKA 2JZBB 4UAWA 4DL5A 4GXKA 4ELVA 4I28A 4KLIA 1HJPA 3NTUA 3V6HA 4WC7A 3M9MB 1T3NA 1S0NA 1L3TA 5KFQA 5DB8A 4QZGA 2AGQA 1TKDA 4B9UA 1MSWD 9ICKA 1L3SA 5HRIA 4AT9A 3GV7B 3HT3A 4PHEA 3RH5A 3NGDA 8ICOA 2BE3A 2JEIA 1XO1A 3QEBZ 3H3AA 8ICEA 1ZYQA
chains in the Genus database with same CATH superfamily
3BQ0A 1FA0A 2E8MA 4F8RA 1IG6A 7ICUA 1D8YA 5J2JA 2K4HA 3QU9A 3LQCB 3M8SA 3PHZA 4U7CA 5KFPA 2P66A 1MQ3A 5KFGA 5DLGA 4QW8A 4X0AA 3EF2A 4KLMA 4PGQA 2AU0A 1ZQOA 2R8HA 2C2EA 1N60A 3BZKA 3ZDCA 3H0MB 2FJ6A 4RQ2A 3TAQA 2KHVA 2QARB 2UVUA 1KL9A 3OUYB 2M9NA 4DL4A 5J0TA 3PSFA 2K8CB 3AU6A 5A0LA 5AKGA 2LYHA 2BDPA 4F2RA 3UQ2A 1JRPA 4KLOA 1S0VA 2WF9A 4KLJA 3RB3A 1UPHA 2V4QA 4DSJA 2I6XA 4LEWA 2UVWA 5J2KA 4MEXA 2KOBA 4F2SA 4C8OA 2ZTDA 4NXTA 4RWPA 2H3FA 2W9CB 2LI6A 9ICHA 2O1PA 2CXYA 8ICIA 4F5OA 3HJ4A 3JPQA 5KFAA 5KFXA 2BCUA 2D8CA 4RUAA 2HHPA 5HP4A 2FPLA 1NK6A 4FZNA 3Q8MA 8ICQA 1TK0A 3ZD8A 3ZDAA 1QSSA 4M5DA 4KN7A 1JALA 4NM2A 5AK4A 2DF4B 4P4OA 3TADC 2JEJA 5ALHA 2WF8A 3OVAA 4QWDA 3NVWA 1ZQ1C 1FIQA 2K60A 2O5AA 4IQWA 1ZQUA 5HRLA 4M9JA 2XY6A 4P0QB 3NRWA 4CF3A 9ICMA 4DOCA 3SAHA 4FE3A 4X0BA 3HWTA 4J03A 3RAXA 4J9OA 4KN4A 4KLEA 4P2HA 1KW4A 3ZDEA 2B6GA 2G0AA 4Y2TA 4KX3A 4KTQA 2DKXA 3PX6A 2A1JA 4JWMA 3CNHA 4KLDA 1ZQZA 3JPOA 1YT3A 3H4BA 4K98A 5CHGA 4FHWA 1DGJA 5AIBA 2ZIVA 4YR2A 1ZQQA 1SGGA 4JLZA 4FBTA 4RQ8A 3SD7A 4OO1J 2W3SA 1GPJA 3V7LA 4F3OA 2ZH2A 2PMZC 3MGHA 2C2DA 3ZDDA 1QQ5A 2HSZA 3PW5A 4M6WA 2HHWA 2H3VA 1B43A 1U49A 2XGQA 1J2NA 3E58A 5J8YC 3ZDBA 2ZJAA 4DQQA 1S8OA 9ICRA 1DXSA 4UB1A 2ATLA 3DDHA 2K8BB 2ZH4A 3H8SA 4RU9A 4YR3A 1ZRMA 1RG6A 2A1JB 3IDWA 5AM2A 3HPOA 3GIKA 3HIYA 5AKHA 3OTQA 4DF4A 5B66U 4Y2QA 4KB6A 2WF5A 7ICHA 5ALKA 1Z3EB 4NM1A 1BGXT 5HR9A 3OVBA 2EANA 4I29A 3GIJA 1S97A 2EQYA 2KMDA 5DDYA 4LZGA 1KRPA 5CR0A 1KFDA 3HJ1A 4FHYA 2QLTA 3C2LA 2XCPA 2IHNA 4WBZA 4NKTA 4FHPA 4M6WB 3QU5A 1RXWA 4BXOA 4ICAA 5AI0A 2E1EA 2JXJA 3SZ2A 2B0CA 4DSEA 1X9XA 4DLEA 2V4RA 5IINA 3H4DA 3S6JA 4E80A 1TFYA 2E5SA 2DUYA 1L8LA 4Z6EA 1L7MA 2M0NA 3J81j 3M6ZA 1NK5A 4PZOA 4Y2RA 4B9MA 3E2EA 2OYYA 3MGIA 4I27A 2LPEA 2EH9A 1QH9A 4XA5A 5AI9A 3JPTA 9ICVA 2M2UA 1NI3A 3TFRA 3RB0A 4GXIA 5D4BA 2BCVA 4QZAA 2I1QA 2JEGA 2DRAA 2AJQA 4OAHA 4DWIA 1ZQHA 4QWCA 3JPRA 3LK9A 4CNQA 4BXOB 4UBCA 2KZ3A 5JU5A 2DVIA 1L7PA 5DBCA 9ICFA 3MDAA 2KFNA 4KLUA 5J2DA 2V9WA 4DO9A 2BCQA 2G5HB 5J2IA 2Y1IA 4C8LA 3KTQA 3RAQA 2YX8A 5J2HA 1D9DA 1T3QA 2XCAA 1Q3UA 2B56A 7ICQA 5HRGA 2MU2A 4EZ6A 2MAXA 8ICYA 3JYYA 2A3VA 9ICEA 4NXXA 2FDRA 4DQPA 5GTHU 1J2MA 3IRUA 4RNOA 4ECZA 2KZMA 2IMWP 4XJEA 2G07A 3PW7A 4YXMA 2WF7A 2ZIXA 2NO4A 1U9LA 1BPEA 4F4XA 2WB1F 4C7YA 1KN5A 3C1ZA 2KNJA 4XQ8A 3WK9A 3RJEA 3RJHA 3N7PD 1FFVA 1PVQA 4LVSA 4O3SA 4MFFA 2HBJA 8ICKA 1V9PA 4O67A 4DQRA 2IUBA 1LB2B 1KTQA 2BHNA 4F92B 5DG9A 1ZQVA 4KLFA 1UT5A 4RPYA 2VJ4A 2DKZA 2DBYA 5L9XA 2VANA 2FE9A 1UEVA 1ZQMA 3H8WA 3OPXA 3WK5A 4F72A 1NJZA 4F91B 3RRGA 2YMQA 1KQQA 2W04A 1ZJMA 5ALLA 4M9GA 1H38A 4ZH4A 5AHXA 4ECWA 3PW2A 3SEIA 5D63A 3TACB 1NNLA 4ECSA 1A76A 3BDPA 2ZIXB 2F3NA 2J6UA 1F5AA 1L7OA 1IV8A 3HKZC 3V72A 4PL1A 2ZH9A 5KL1B 4IL6U 4BWJA 1FO4A 2HHSA 4EEBA 3L4PA 3PNCA 3QU7A 3QU2A 1ZQBA 3PSPA 7ICOA 4AT8A 3MFHA 4FBUA 2LYAA 3AEVA 1WWUA 3EW9A 4R8UA 2JRZA 1XU4A 4F5NA 2KVCA 2ZIWA 4WC3A 4O3OA 1S76D 2UVVA 5AM3A 5J2CA 2KFZA 1JI7A 4EGWA 4FO6A 2DWQA 4DS4A 2RRDA 9ICAA 1S5LU 4YQWA 3EZ5A 3L3FX 1X40A 3PV8A 2KTQA 5EE3A 2IA6A 5EE0A 4EELA 3Q8RB 5L1MA 3ER8C 4Y2PA 4DQIA 4RWOA 2QB0A 5DG8A 5G5HA 3TAPA 2W54A 1SL1A 1N63A 5KG5A 1HUOA 4AT8B 2LBOA 2UVRA 2WF6A 4CF4A 4NLZA 2O6KA 3EPIA 3BQ7A 4OJLA 3M9MB 5KFQA 5DB8A 4B9UA 2ZH1A 1MSWD 3NGDA 2Y0SC 1TAMA 2WAQC 1ZQNA 2J6SA 2G08A 3HILA 8ICJA 3BS5A 2KZZA 1T8EA 1HEKA 1EXNA 1YZ7A 4E7XA 2PXIA 4O3MA 3OSPA 2E1FA 5EE9A 4X4OA 2A19A 9ICSA 4U6PA 2HBMA 1M6YA 3Q8LA 3HJEA 3CW2C 4TQRA 4IC9A 4BGDA 4I2EA 1Z1BA 1MA7A 4E0DA 4YN4A 9ICNA 3C29A 2G5IB 3SYZA 3Q8QB 5KT5A 4DFMA 3C2MA 3C18A 1K1QA 2JEFA 2RDJA 1MIVA 4P0PA 5AK6A 4FZLA 5KFDA 2OWOA 2FLPA 1WOTA 2OCEA 5CJ7A 3BS5B 4OAGA 4J9SA 2FI1A 4MF2A 3A0HU 4NWIA 1XWLA 3GV8B 1N5XA 1PVRA 4NLKA 5KFCA 5E79U 4MKPA 5EE1A 5DGBA 3Q8PB 3RH4A 3QUCA 5KFLA 5B5EU 2H3ZA 5AKLA 3WK6A 3UXPA 1YLQA 4EZ9A 4JWNA 3ONNA 4EENA 5J0WA 2P6RA 3QYPA 5ALFA 1DRGA 3PSTA 2KK0A 4YMNA 5ALZA 2NYVA 2RLTA 4DFKA 3JPNA 1NK4A 5H2FU 2GAFD 3EUB2 4DQSA 4ED6A 4X4TA 2VA8A 4KLHA 4P0PB 2ZXHA 4PJ0U 3BQ2A 2JR5A 4QZEA 1ZQIA 3C2KA 4Y2XA 1NZPA 1FEZA 4IRKA 4BUGA 4JV1A 3M7DA 5J0OA 2FMSA 7ICGA 2C2RA 4F50A 3F5EA 3M6KA 3NVOA 3MBYA 5C5JA 1DK3A 1XNSA 4EX6A 5CB1A 4Z6FA 2NO5A 1QSYA 4FS1A 5J0RA 1KBUA 4DCCA 1NZBA 5J0QA 4ZOHC 3QEAZ 4I2AA 2KHQA 3PMLA 4X4VA 3SV3A 4UQGA 3AUOA 5KT4A 2F77X 4EV6A 5HREA 3B0YA 4O3PA 4DOAA 4NLCA 3WFQE 5BPCA 4MFAA 3OV7A 4RQNA 4ECYA 1C20A 4UB5A 1FFUA 4R65A 3K1ZA 1PK1B 2RQ5A 1JXEA 1VDVA 3WK8A 3LVWA 4C8MA 3IG8A 3NKUA 5J0XA 2D3DA 3M1YA 2EZXA 4OD0A 7ICFA 5KG1A 3HW8A 4PHPA 3FM9A 5G5GA 4UD5A 3WK7A 7ICVA 5TISU 5ALQA 2HHVA 3UM9A 9ICIA 2DR5A 2BQUA 4DL2A 3N7SC 3C5GA 4P4MA 2NRXA 4UASA 3GV5B 1UHUA 7ICRA 2YY6A 4J9KA 3QUQA 5AK3A 4UB3A 5B3PA 4AT7A 5D61A 1JUDA 3E0FA 4M9LA 4F4YA 3UPSA 4UBBA 5ALYA 2AH5A 2KV2A 1X42A 2HBLA 2F1IA 1X9SA 1NKEA 1ZD3A 5CEHA 1RXVA 4C4SA 5DG7A 4RQ0A 3CYMA 1RPLA 3NRZA 5AICA 1ZQDA 2KIWA 1RQLA 5AI6A 1A6SA 4X4UA 4Q43A 8ICWA 2OM6A 3NVVA 5AK5A 1X9MA 4OCZA 4KLLA 4O3QA 5IIMA 1Q8KA 3D2NA 1VJ7A 4K96A 3T3FA 2GOLA 1ZXIA 3DEEA 4KM5A 4NXUA 2FMQA 1NKBA 2Y9UA 4Y2YA 5ALPA 2HHXA 3ORYA 4JV2A 4AT7B 5ALEA 2PKEA 5CFUA 5ALJA 3AQNA 5BOMA 2NV3A 5D49A 4QWBA 2BPFA 5KFIA 4IQVA 4R64A 4QJFB 4YCXA 4RPXA 4IR1A 7ICMA 2AHOB 3MDCA 5DBAA 5CRXA 3TI0A 4X4RA 2ZHBA 1L7NA 5ALVA 4I2FA 5KFEA 5ALTA 3V6JA 3RJFA 1BPXA 3IP4B 5KNIA 4ED2A 7ICJA 4FH3A 2P6UA 1NJXA 2ZUCA 2IOFK 5JTIA 4WQLA 4EBJA 1ZETA 3F5AA 1WWVA 1ZD4A 5J2AA 4DF8A 2ZXIA 1GO3F 3ETLA 4C0ZA 4F5PA 4BWMA 2DR7A 1R89A 1KEJA 3CP8A 3GZFA 1TK5A 1XO0A 1SKSA 4O9MA 2B4VA 2Q4TA 4HYKA 4XUSA 2DGZA 1N2XA 2F8LA 3IG5A 3H39A 3KHRA 3HP6A 1ZQXA 2WFAA 2Y0SF 2W7PA 8ICLA 5KFZA 2KVSA 3VC8A 5HHIA 4UB2A 4QIWC 4I2HA 1ECWA 1S9FA 2GWSA 2KJ5A 2OXOA 3KOOA 5L1JA 2AXTU 2L5YA 1RYUA 4XRHA 3T5JA 1SXEA 7ICIA 2ZIVB 4KLTA 4I2IA 3ALRA 4QZFA 2F76X 5KT2A 2OH2A 3VCBA 3Q8SB 1L8OA 2E3TA 2YTUA 5ALXA 4ED8A 4DFPA 5IIJA 3OJUA 4F4ZA 9ICBA 4C80A 3T5LA 4X4QA 2FLNA 9ICCA 4OJ5A 3JPPA 3D6JA 3H38A 2NRWA 8ICVA 2M2VA 4IR9A 3SAFA 1SV0A 5KL8B 3UXNA 2Y9TA 1ZQYA 3TQ1A 5ALMA 4EBDA 8ICCA 3RRHA 3ERCC 5KFBA 1RZTA 4YVZA 1JAJA 3PSIA 2E8PA 4EP7A 4RQ4A 4OAFA 3KZXA 5KFTA 1IXRA 7ICLA 2K4EA 4WC1A 2I5HA 4TQSA 1IIPA 4KLGA 3ETRA 5KG0A 4NLGA 3QUTA 3KKAC 1ZOLA 2BR0A 2KICA 3QXGA 3N7RC 3KKAA 3WFSC 4Q8EA 1MIWA 1VFGA 8ICPA 5CA7A 8ICFA 4P4PA 4ELTA 4B9SA 5ALUA 3H8MA 2ZJ8A 4FS2A 4DS5A 1OXJA 4IRCA 5KTQA 2HHUA 2KJ8A 5GTIU 1TE2A 3PX0A 1BPBA 5KAFU 2ODGA 5J0SA 3I28A 3WKAA 2ZTCA 3KFUF 4K9BA 4DSIA 4HAIA 3RB6A 3D2SA 4RQ5A 3QX7A 2VA3A 3KBBA 2FPKA 1CUKA 1X66A 1KKXA 4DL5A 4I28A 1LKYA 1T3NA 1S0NA 4QZGA 1TKDA 5HRIA 4AT9A 3LYSA 2BE3A 2HHTA 3QEBZ 1ZYQA 2HOQA 1F0MA 5ALWA 3GDXA 2VA2A 2M2TA 3TFSA 1Z4NA 5DQHA 1SZPA 3UMCA 2NRKA 2R8IA 3TANA 1U45A 4AP9A 2PBEA 2HBKA 1ZQPA 4ED3A 2EWRA 4JV0A 2YMMA 3GFKB 1ZRNA 2ES6A 3B9JA 2XY5A 2K4PA 5ALDA 3AQMA 3RF9A 1ZQJA 4PHAA 2XIDA 5IIKA 1LKYB 3ISDA 4RT3A 2K4IA 1VJ5A 2JGAA 2RP5A 5J0YA 3PR4A 1OU5A 4RZRA 2XY7A 9ICQA 3N4MB 2W9BA 3GIIA 2HHQA 3UXOA 4DOBA 1XC9A 4K8VA 4M04A 1V4AA 4I2DA 5KG3A 1KFTA 5HMMA 1ZQKA 3PVXA 2W43A 2LHTA 4PPXA 4EBKA 4ED1A 4FZMA 1BPYA 1JROA 4HX0A 4GFJA 4RQ6A 3ISCA 1ZQCA 1ZQEA 5KFUA 4R63A 2WTFA 4PHDA 1Q79A 4LJXA 5T14A 1Z19A 3QZ8A 1UA1A 4DL3A 5L1IA 1Z00A 4NJ8A 4RQ7A 2ZH8A 2BBHA 1PZNA 1Z1VA 2BBJA 1S0OA 2W55A 1NJWA 1O03A 4RQMA 4CF5A 1SWWA 5HRBA 4KMUA 1JMSA 4KX5A 4NXVA 4TUQA 3FYHA 1XS9D 3PR5B 1LVHA 3H40A 2W11A 4M2YA 7ICNA 2W9MA 4NV0A 4UW9A 2C22A 2W9BB 4EEYA 5DLFA 4UB6U 4QZIA 4GC7A 3BZCA 5ALSA 1ZQTA 3FC4A 1URJA 2F1JA 3KHHA 4X4SA 4J9NA 2HDOA 1PX5A 5D46A 2W7OA 2DR9A 3RTVA 8ICXA 4X5VA 1ZQRA 2HN2A 7ICTA 4KITB 2ISOA 3OHAA 1ZQLA 3MABA 8ICBA 4DL6A 1A77A 4TUPA 3PX4A 4Q44A 4QZ8A 4IG8A 2W8LA 2M2WA 4C4RA 3DV9A 4KLSA 1JQRA 3AQFA 4R8UB 1Z00B 2E8OA 3C28A 2ZIWB 5IILA 4Q45A 2JHDA 4JB3A 5KG2A 3PY8A 4FHXA 4ECTA 5J2FA 3LWMA 1V38A 5ALIA 4PZNA 1KLNA 1SKRA 1ZD5A 5HC9A 5FP0A 3AMZA 3ZI4A 4K4HA 1D8BA 2KEYA 3JCFA 3UPQA 4QZCA 4NXWA 4WC0A 3Q8KA 4TURA 7ICEA 5DECA 2PMZF 3SQIA 1DK2A 2N1RA 3C66A 2QB0B 1Z4OA 3NASA 1K5OA 4UB8U 2JH7A 5K4LA 4IQTA 3PW0A 1HIWA 4QZHA 2RDIA 3NYBA 2GLEA 1QLNA 3PO4A 4F5QA 3GIMA 1NO5A 3GQCA 3HX0A 3WFPA 4RQ3A 1U47A 4IS7A 4QIWF 9ICOA 2XICA 2NRVA 2WHEA 3RJIA 5CHEA 3ISBA 4E8FA 8ICMA 1T94A 4F5RA 1SL0A 2Q0ZX 5KFFA 2ID1A 5DQIA 1RYSA 5J2BA 9ICUA 4B6JA 3MR5A 1UEUA 1B4FA 5DGAA 3KHGA 2BCRA 5KFYA 5KT6A 1S10A 2DL0A 4UARA 3MR6A 3SAGA 3SMVA 1HUZA 1SV4A 5KG6A 4RT2A 2BCSA 2AQ4A 3JZ0A 5F3XB 4MHVA 3UMGA 5DBBA 1R8BA 1T7PA 3LVVA 2BZFA 4I2GA 3L5KA 2DQNB 2B51A 4WC4A 4LEVA 2CRXA 2PI5A 8ICUA 4JUZA 2VJ5A 4AYBC 4DLGA 2BDUA 4O3NA 4NL9A 4YR0A 2DPJA 2VKQA 1Q3VA 9ICGA 1K1SA 4X4NA 5EOZA 5J2EA 1B0XA 3OWGA 4BX9C 2Z7JA 4OJPA 1ZQFA 1ZQSA 1CEZA 2ZTEA 1ZQWA 1V85A 3V6KA 4MEYA 3NVZA 2J6TA 4I2BA 5J0UA 2ZG6A 3WKBA 4PL2A 3AL0B 2FLLA 2YN4A 4OJOA 4YMOA 2NRZA 3H0RB 4DL7A 4PGYA 2OEHA 8ICSA 4QZBA 1ZJNA 1WUDA 5KFWA 5DKWA 4B9LA 3WFRE 2HI0A 3T79A 5JUMA 1CRXA 1NJYA 2YQEA 3C5FA 4R66A 3QZ7A 1NK0A 4Z6CA 3QNMA 1KNYA 3KZIU 3EWAA 2PI4A 3IN5A 1X9WA 3ED5A 3AU2A 4ED7A 2ASDA 4WOYA 2BGWA 4I2JA 2W9CA 3IHQB 2XVTA 3OHBA 1ED1A 4ECVA 1QQ6A 3G6XA 2CPRA 3RB4A 4GIBA 5DB6A 4O6AA 1UETA 5AKIA 2MA1A 1TAUA 1F5SA 2G06A 2ZIUA 1KDHA 5AKYA 3JPSA 5AIAA 4EEDA 3RR8A 2HVIA 2F1HA 4NLBA 3MFIA 2ZJ5A 4WC5A 4Y2VA 4GLXA 1NOMA 2GO7A 4P0QA 3R9KA 1XSLA 4LZDA 3AM9A 4I2CA 3OJSA 5BOLA 5AM5A 3H0LB 4ECXA 1XSNA 3RR7A 3HKZF 5AKJA 1WG8A 2R8JA 4DEZA 4IQUA 2BPGA 4M9NA 1NK7A 4BDPA 1TFWA 2IHMA 3N97B 2W8KA 1L3VA 2JZBA 5F2VO 1LV5A 2ASLA 3C23A 5J0PA 4K9AA 2ZIUB 4FFDA 5AKZA 4C8KA 2LM4A 1NKCA 2ZH3A 1PVPA 5KFHA 5D62A 3QU4A 3U26A 2MSNA 3TADA 5CFSA 5DDMA 3BQTA 3ER9B 3AQEA 1C7YA 5KFSA 2KIVA 2YB1A 7ICPA 2KN7A 2DRBA 1AQ6A 5IIIA 5AKKA 3V7JA 2I9GA 4S3NA 9ICLA 2W9AA 3RBDA 2ISPA 3G6YA 1KFSA 3AN1A 1ZQGA 4FO1A 2JMGA 4LEYA 1WYGA 1YZ6A 2ZH5A 1VLBA 2Q66A 4JMUA 4RWNA 2HVHA 4CGZA 4J9LA 1JN3A 2K8AA 4CDGA 4OJ6A 4PH5A 5AM1A 4O5EA 1WCNA 2EZZA 8ICNA 3LDAA 4RNNA 4N7RA 3RJJA 2JZBB 1QCKA 5ALRA 3V6HA 1L3TA 4KMOB 2AGQA 1L3SA 2R18A 3HT3A 4PHEA 3GV7B 3RH5A 3MGVA 2KKVA 8ICEA 2HCFA 4C8NA 1N61A 1Y88A 3PZPA 2XO7A 5HMLA 3F2BA 2EAOA 1PUZA 2KD1A 1U4BA 2WAQF 3ZD9A 1J97A 2BKEA 4O3RA 1CI4A 9ICPA 3BQ1A 4NXZA 4DFJA 3KD3A 3QE9Y 1ZQAA 3WU2U 3NUQA 4US8A 4WBYA 4WC6A 3T5HA 1TV9A 5AI5A 5J8YA 2DFLA 4DSKA 2IOHA 1SWVA 2JH1A 1F44A 1MC8A 2P35A 2A1AA 4J9PA 4UAVA 2AQ0A 3F2CA 4B9TA 2DPIA 3RFAA 1U48A 4ACOA 8ICRA 2OHFA 4ATBA 4UATA 4EBEA 8ICAA 1SV0C 4YP3A 4YMMA 3CK6A 4JLXA 4MFCA 1SXDA 5CP2A 5JRTA 4F71A 4FH5A 2XGPA 3SI8A 1ZD2P 2IBKA 3WKDA 2Y1JA 1MQ2A 5B3QA 4K97A 4EBCA 4GC6A 5F9NA 2EAPA 2LKYA 4UAYA 2JV3A 5L1LA 2W3RA 4FHVA 2GH1A 5KT3A 4O0IA 3MC1A 9ICXA 1MN8A 1SIJA 4O5KA 4ATBB 4ECUA 4RQ1A 1V97A 1MIYA 3QUBA 1COKA 3A0BU 5AKEA 1D9FA 2RHFA 5KFKA 4USAA 5HR6A 1O08A 3LWLA 4QWEA 4PGXA 2EZYA 5KFOA 2F44A 4I0UA 5L1KA 2KKPA 3PMNA 5HRHA 3M9OB 4G3IA 4RUCA 4AYBF 4NKUA 2PFPA 2ALZA 3UQ0A 1PK3A 3PO5A 3GU3A 3WFOA 5HRFA 2H3IA 4QWAA 4NLNA 2EAMA 9ICJA 3O0FA 4EYIB 1R8AA 1A0PA 4BJQA 1B22A 1P7DA 1Q46A 5J2GA 3SV4A 3C1YA 1UT8A 3M9NB 3IV6A 2KG5A 3SENA 5J29A 1TAQA 1IM4A 2XI9A 2YB4A 3SR6A 3N28A 5ALOA 3NS1A 2ASJA 3RJKA 3FAHA 2ZUBA 3IM1A 2F8KA 4O68A 3MR2A 4KLQA 3MCRA 4MF8A 3NVYA 2AGPA 1OW5A 4OAIZ 2D6FC 2MUTA 5TZVA 1X2IA 3TKAA 4LT6A 3KHLA 7ICSA 1SB3C 4AT9B 4CE6A 1AROP 8ICZA 2YMPA 2BQ3A 2PFOA 2HW3A 2R8GA 4M47A 2ZHAA 4US9A 3H7IA 3T5KA 1RDFA 2FPMA 5HHHA 5KG4A 3WKCA 4CRXA 4WQKA 4UAZA 3I76A 1R8CA 8ICHA 4WCWA 2BPCA 4ECQA 5DQGA 4RPZA 5AM0A 2ZH7A 3K75D 2PFQA 2KE7A 1DGSA 2B21A 5EWFA 3UMBA 3F53A 3G6VA 1UA0A 2LM1A 2HMXA 3H8JA 4C7ZA 2DR8A 4DSFA 4WH5A 1SZHA 2MUTB 3BJYA 4CCHA 1S77D 3AQKA 1NK8A 4K4GA 2XC9A 4QZ9A 1N62A 1UQVA 4Y2JA 5IIOA 4EX7A 1BVSA 1QQ7A 3B0XA 4QNLA 2NRTA 4F4WA 2C28A 2AGOA 3K1RB 4JK1A 5KG7A 1JIHA 4QW9A 3GILA 4K99A 4G9BA 4Y2SA 1QSLA 2FCLA 1BNOA 3OGUA 2CN1A 5ALNA 2FMPA 1TFRA 3OSNA 5HNKA 9ICWA 3OVSA 3ICXA 2KSOA 4UB4A 3MR3A 3HRDD 5HRDA 5AM4A 2QKQA 1NK9A 3RBEA 1L3UA 5DB9A 1BPZA 4C4TA 5KFJA 5KAIU 3THVA 1JX4A 2PFNA 2LMRA 4LEZA 5EWGA 5AI8A 4M9HA 5KFMA 2KP7A 5EWEA 3RH6A 3WK4A 2HOFA 2H3QA 1WCLA 3K4GA 3CRXA 4QZDA 4UD4A 4WC2A 1QTMA 3FDSA 3H37A 4WJ3B 4O69A 1TVAA 2IOFA 3AQLA 2KSOB 4YFKA 4YD2A 1TK8A 4EYHB 5HR7A 4M0AA 3K7DA 4J9RA 2KJ9A 2BQRA 3WKEA 5KFNA 4YG2A 3BS7A 4Z6DA 3M8RA 1JXLA 1Q78A 1L6NA 4ELUA 4J9MA 4ECRA 3EYZA 9ICTA 4EEKA 4DSLA 5JTGA 3RJGA 8ICGA 5HRKA 4B9NA 1XSPA 1X6JA 4IRDA 1BNPA 2MRLA 4B9VA 5DEDA 3TARA 4F93B 1S0MA 2VIXA 4YXJA 5KT7A 2W03A 4Q8FA 5CFTA 5KFVA 1DOQA 1RQNA 2E8NA 3C21A 5AI4A 2HOIA 4NY8A 4A8EA 1UCVA 3NWIA 1N48A 3PW4A 1OUQA 2K89A 4J9QA 1N56A 3V7KA 4NL9C 5CWRA 2G09A 1RYRA 1L5UA 2EDUA 1KSPA 1COOA 4O5CA 2ZUDA 3L9DA 4K4IA 5ALGA 2ZH6A 4YD1A 1SKWA 2ESEA 1PK1A 5DB7A 4ED0A 3F2DA 4TUSA 4RNMA 2F2AB 5F9LA 2HN1A 4X4PA 5KFRA 1BPDA 7ICKA 4GXJA 8ICTA 3EPGA 3I1YA 2H5XA 2RFFA 2R8KA 2GA9D 4F4KA 1D8LA 2QARA 3OUYA 1SL2A 4DFDA 2LYBA 1RM6C 5AKXA 1T4GA 1X6IA 4XQ7A 4Y2UA 3D2QA 4UAWA 4GXKA 4ELVA 4KLIA 1HJPA 1N5WA 3NTUA 2IHOA 2QB1A 4WC7A 2YMLA 4UAUA 9ICKA 5C0YA 8ICOA 4RWQA 2WB1C 3H3AA 2JEIA 1XO1A
chains in the Genus database with same CATH topology
4C8NA 1ZQNA 3BQ0A 2J6SA 8ICJA 2KZZA 1FA0A 1T8EA 1Y88A 3GDXA 1EXNA 2XO7A 2VA2A 4F8RA 7ICUA 1D8YA 5J2JA 2M2TA 4E7XA 5HMLA 3TFSA 2PXIA 5DQHA 3LQCB 3M8SA 1U4BA 3ZD9A 3OSPA 1SZPA 2BKEA 4O3RA 9ICPA 2R8IA 3TANA 5KFPA 3BQ1A 1MQ3A 4NXZA 2P66A 1U45A 2NRKA 4X4OA 5KFGA 9ICSA 5DLGA 4QW8A 2PBEA 1ZQPA 3Q8LA 4X0AA 4ED3A 4DFJA 4TQRA 4JV0A 3QE9Y 4KLMA 4PGQA 4BGDA 3GFKB 4I2EA 2AU0A 1ZQOA 2R8HA 2C2EA 1ZQAA 3ZDCA 2XY5A 4E0DA 4WBYA 4RQ2A 3TAQA 4WC6A 4YN4A 3T5HA 2UVUA 3OUYB 1TV9A 9ICNA 2M9NA 4DL4A 3AQMA 2DFLA 4DSKA 5J0TA 3SYZA 1ZQJA 3Q8QB 5KT5A 4DFMA 4PHAA 3AU6A 3C2MA 2LYHA 2BDPA 1K1QA 2JEFA 3C18A 1MC8A 4F2RA 3UQ2A 5IIKA 4J9PA 4B9TA 2AQ0A 4KLOA 2RDJA 2DPIA 1U48A 1S0VA 3ISDA 1MIVA 4RT3A 4KLJA 2ZH1A 3RB3A 5KFDA 3PR4A 8ICRA 5J0YA 4ATBA 1OU5A 2V4QA 4DSJA 4RZRA 4EBEA 2OWOA 2FLPA 8ICAA 1WOTA 2XY7A 9ICQA 5CJ7A 2UVWA 3N4MB 2W9BA 3GIIA 5J2KA 4J9SA 4MEXA 2HHQA 4YP3A 4YMMA 3UXOA 4DOBA 1XC9A 4F2SA 4MF2A 4M04A 1V4AA 4I2DA 2ZTDA 5KG3A 4C8OA 4MFCA 1KFTA 4RWPA 2W9CB 5HMMA 1ZQKA 9ICHA 2O1PA 1XWLA 3GV8B 5CP2A 4F5OA 3PVXA 8ICIA 4PPXA 4EBKA 4NLKA 3HJ4A 4ED1A 5KFCA 1BPYA 4FH5A 3JPQA 5DGBA 3Q8PB 3RH4A 5KFLA 5KFAA 4RQ6A 2XGPA 3ISCA 1ZQCA 3UXPA 3SI8A 1YLQA 1ZQEA 2IBKA 4EZ9A 4JWNA 5J0WA 5KFXA 5KFUA 2Y1JA 2BCUA 4RUAA 2P6RA 2HHPA 5HP4A 2FPLA 1NK6A 1MQ2A 4R63A 2WTFA 3Q8MA 4PHDA 4YMNA 1Q79A 8ICQA 3QZ8A 4GC6A 4EBCA 4DL3A 1UA1A 1TK0A 3ZD8A 5F9NA 5L1IA 1QSSA 4KN7A 1Z00A 3ZDAA 4M5DA 4NM2A 4RQ7A 2ZH8A 4P4OA 4UAYA 5L1LA 1PZNA 2JEJA 4DFKA 3JPNA 1NK4A 4FHVA 1S0OA 5KT3A 4O0IA 1NJWA 9ICXA 4DQSA 4ED6A 4X4TA 3OVAA 4QWDA 5HRBA 4KMUA 1JMSA 2VA8A 4RWQA 4TUQA 3FYHA 4O5KA 1XS9D 4KLHA 3PR5B 2O5AA 3BQ2A 4IQWA 4QZEA 1ZQUA 4ATBB 4ECUA 5HRLA 3H40A 1ZQIA 4M2YA 4RQ1A 3C2KA 7ICNA 4M9JA 2XY6A 1MIYA 2W9MA 1NZPA 2C22A 2W9BB 4DOCA 5DLFA 4EEYA 4IRKA 4QZIA 4GC7A 4JV1A 9ICMA 5J0OA 2FMSA 1D9FA 1ZQTA 7ICGA 2F1JA 3KHHA 5KFKA 4F50A 2C2RA 4J9NA 3LWLA 1PX5A 5D46A 3HWTA 4QWEA 4PGXA 3RTVA 4X0BA 2DR9A 5KFOA 3RAXA 8ICXA 4X5VA 4J9OA 3MBYA 5C5JA 1ZQRA 7ICTA 4KITB 5L1KA 2ISOA 1DK3A 3OHAA 1ZQLA 5CB1A 4KN4A 3MABA 5HRHA 3PMNA 4KLEA 8ICBA 3M9OB 4DL6A 1A77A 4TUPA 4Z6FA 4P2HA 3PX4A 4RUCA 4G3IA 1QSYA 4Q44A 4NKUA 3ZDEA 2PFPA 4FS1A 5J0RA 4QZ8A 2ALZA 3UQ0A 2W8LA 4IG8A 3PO5A 2M2WA 5J0QA 4KLSA 1JQRA 3WFOA 3QEAZ 4LZGA 4R8UB 4I2AA 4KTQA 5HRFA 4QWAA 4NLNA 3PX6A 1Z00B 9ICJA 3PMLA 4X4VA 2A1JA 4JWMA 3SV3A 4EYIB 4UQGA 5IILA 3AUOA 4Q45A 4KLDA 1R8AA 5KT4A 5KG2A 1ZQZA 3JPOA 3PY8A 3H4BA 4ECTA 5HREA 4FHXA 5J2FA 3B0YA 3LWMA 4O3PA 4DOAA 3WFQE 5BPCA 4MFAA 5CHGA 4FHWA 1B22A 3OV7A 4ECYA 4YR2A 1ZQQA 1KLNA 5J2GA 3SV4A 3C1YA 4UB5A 1SKRA 4FBTA 4RQ8A 1UT8A 3M9NB 5HC9A 4R65A 5J29A 3V7LA 4F3OA 1JXEA 1TAQA 2ZH2A 4K4HA 3MGHA 1IM4A 2C2DA 3UPQA 4C8MA 4QZCA 3ZDDA 5J0XA 4WC0A 7ICFA 3Q8KA 3PW5A 2ASJA 4TURA 4M6WA 3RJKA 2HHWA 7ICEA 5DECA 5KG1A 2ZUBA 3IM1A 1B43A 3HW8A 1U49A 4PHPA 2XGQA 1DK2A 3C66A 3ZDBA 4UD5A 7ICVA 4IQTA 3MR2A 2ZJAA 4DQQA 3PW0A 2HHVA 9ICRA 4KLQA 4UB1A 9ICIA 2DR5A 4MF8A 4QZHA 2AGPA 2BQUA 2RDIA 3NYBA 4DL2A 2ATLA 1QLNA 3C5GA 4P4MA 2MUTA 2NRXA 2ZH4A 3H8SA 5TZVA 4RU9A 4YR3A 3PO4A 1X2IA 4F5QA 2A1JB 3GIMA 1NO5A 3GV5B 3GQCA 3HX0A 3HPOA 7ICRA 4LT6A 3GIKA 3KHLA 4RQ3A 4J9KA 7ICSA 3HIYA 3WFPA 4AT9B 1U47A 9ICOA 1AROP 4UB3A 8ICZA 2BQ3A 4AT7A 2NRVA 4DF4A 2PFOA 2HW3A 2R8GA 3RJIA 4M47A 3ISBA 4E8FA 7ICHA 2ZHAA 4M9LA 1Z3EB 4NM1A 1BGXT 8ICMA 5HR9A 4F5RA 4F4YA 1SL0A 3UPSA 4UBBA 2Q0ZX 3H7IA 5KFFA 3T5KA 5DQIA 2ID1A 3OVBA 2F1IA 2FPMA 1RYSA 4I29A 3GIJA 1X9SA 1S97A 5DDYA 5HHHA 1NKEA 1KRPA 5KG4A 5J2BA 5CR0A 9ICUA 1KFDA 1RXVA 3HJ1A 5DG7A 4RQ0A 1RPLA 4FHYA 1ZQDA 3C2LA 2XCPA 3MR5A 2IHNA 4NKTA 4WBZA 4FHPA 1UEUA 4M6WB 4UAZA 4Q43A 1RXWA 4BXOA 8ICHA 2BPCA 8ICWA 1R8CA 4WCWA 4ECQA 5DGAA 3KHGA 5DQGA 4RPZA 2BCRA 5KFYA 1X9MA 5KT6A 1S10A 2ZH7A 3K75D 2PFQA 4KLLA 1DGSA 3SZ2A 2B21A 4DSEA 5EWFA 3MR6A 4O3QA 3G6VA 1UA0A 1HUZA 5IIMA 4DLEA 3H8JA 5KG6A 2V4RA 4RT2A 5IINA 2BCSA 2DR8A 3H4DA 2AQ4A 4DSFA 4E80A 1TFYA 3JZ0A 2MUTB 3BJYA 4CCHA 1S77D 1VJ7A 3AQKA 4Z6EA 1NK8A 4K4GA 3T3FA 2XC9A 5DBBA 1R8BA 4QZ9A 1NK5A 2FMQA 1T7PA 1NKBA 4X4SA 5IIOA 2HHXA 4I2GA 4B9MA 3E2EA 4WC4A 1BVSA 3B0XA 3ORYA 3MGIA 3RB0A 2BCVA 4JV2A 2NRTA 4F4WA 2C28A 2AGOA 4I27A 4XA5A 5BOMA 3AQNA 2PI5A 3JPTA 9ICVA 2M2UA 4JK1A 5KG7A 3TFRA 4GXIA 1JIHA 4JUZA 5D49A 4QZAA 4QW9A 2I1QA 4QWBA 3GILA 5D4BA 2BPFA 5KFIA 4IQVA 2JEGA 2DRAA 1QSLA 2AJQA 4R64A 4DLGA 4DWIA 4O3NA 1ZQHA 1BNOA 4YR0A 3OGUA 4YCXA 4RPXA 2DPJA 2FMPA 4IR1A 7ICMA 1TFRA 9ICGA 1K1SA 3OSNA 4QWCA 3JPRA 3LK9A 3MDCA 5DBAA 4BXOB 4X4NA 3TI0A 4UBCA 5HNKA 5EOZA 5J2EA 2KZ3A 9ICWA 4X4RA 2ZHBA 3OVSA 1ZQFA 2DVIA 1ZQSA 1CEZA 2ZTEA 1ZQWA 5DBCA 9ICFA 3MDAA 4I2FA 2KFNA 5KFEA 4UB4A 4KLUA 3V6KA 4MEYA 5J2DA 3MR3A 2V9WA 4DO9A 3V6JA 3RJFA 2BCQA 5HRDA 1BPXA 2J6TA 4I2BA 8ICUA 5J2IA 1NK9A 3RBEA 5J0UA 1L3UA 4ED2A 5DB9A 7ICJA 2Y1IA 2P6UA 1BPZA 4FH3A 4C8LA 4AT7B 2FLLA 1NJXA 2ZUCA 3KTQA 5KFJA 3RAQA 4YMOA 2NRZA 4EBJA 1ZETA 4DL7A 4PGYA 8ICSA 5J2HA 5J2AA 3THVA 4QZBA 1D9DA 4DF8A 5KFWA 1ZJNA 3ETLA 5DKWA 1JX4A 4B9LA 2XCAA 2PFNA 3WFRE 7ICQA 5HRGA 5EWGA 5JUMA 4F5PA 1NJYA 3C5FA 4R66A 4M9HA 5KFMA 4EZ6A 2MAXA 4BWMA 3QZ7A 8ICYA 5EWEA 1NK0A 9ICEA 2KP7A 4Z6CA 1R89A 3JYYA 2DR7A 3RH6A 1KEJA 1TK5A 4DQPA 1KNYA 1SKSA 4O9MA 4RNOA 4ECZA 3EWAA 2PI4A 2KZMA 2IMWP 4HYKA 4XUSA 1WCLA 3PW7A 3K4GA 1X9WA 4YXMA 4QZDA 4UD4A 4WC2A 3AU2A 1QTMA 4ED7A 1U9LA 1BPEA 3H39A 3KHRA 3HP6A 3FDSA 4F4XA 1ZQXA 2ASDA 3C1ZA 3H37A 4XQ8A 8ICLA 2BGWA 1TVAA 4I2JA 2W9CA 3RJEA 5KFZA 3RJHA 5HHIA 3IHQB 3AQLA 4UB2A 3OHBA 4LVSA 4I2HA 4ECVA 1S9FA 2GWSA 3G6XA 3RB4A 4MFFA 4O3SA 4YFKA 4YD2A 8ICKA 1TK8A 1V9PA 5DB6A 4DQRA 1UETA 4EYHB 1LB2B 5L1JA 1KTQA 2BHNA 4F92B 4M0AA 5DG9A 4J9RA 1ZQVA 4XRHA 4KLFA 1TAUA 1UT5A 3T5JA 2BQRA 4RPYA 7ICIA 5L9XA 5KFNA 2VANA 4KLTA 4I2IA 1KDHA 4YG2A 4QZFA 4Z6DA 5KT2A 1UEVA 1ZQMA 3Q8SB 3H8WA 3JPSA 1NJZA 3M8RA 1JXLA 1Q78A 4ED8A 4DFPA 4F91B 3RRGA 5IIJA 3OJUA 4F4ZA 9ICBA 3RR8A 1ZJMA 4ELUA 2HVIA 4J9MA 2F1HA 4ECRA 3T5LA 3MFIA 1H38A 4M9GA 3EYZA 2ZJ5A 4ZH4A 4WC5A 4ECWA 4X4QA 9ICTA 2FLNA 9ICCA 3PW2A 4X4UA 4GLXA 4DSLA 1NOMA 3RJGA 8ICGA 3JPPA 5HRKA 4B9NA 4ECSA 1A76A 2NRWA 3BDPA 1XSPA 3H38A 8ICVA 2J6UA 1F5AA 2M2VA 4IR9A 1XSLA 3V72A 2ZH9A 3UXNA 4LZDA 4IRDA 1ZQYA 4I2CA 4B9VA 3TQ1A 3OJSA 4EBDA 1BNPA 4BWJA 5DEDA 3TARA 4F93B 8ICCA 1S0MA 2HHSA 4YXJA 5BOLA 3RRHA 5KT7A 4ECXA 5KFBA 1RZTA 3PNCA 4YVZA 1XSNA 4Q8FA 3RR7A 2R8JA 1JAJA 4DEZA 4IQUA 5KFVA 1ZQBA 2BPGA 7ICOA 1DOQA 3MFHA 4AT8A 4FBUA 4M9NA 1NK7A 4BDPA 1TFWA 3C21A 4EP7A 4RQ4A 2IHMA 3N97B 5KFTA 7ICLA 1IXRA 4WC1A 2W8KA 1L3VA 4NY8A 2JZBA 3EW9A 4TQSA 4R8UA 1LV5A 5F2VO 2ASLA 4KLGA 3C23A 5KG0A 5J0PA 4NLGA 1XU4A 4F5NA 1N48A 3PW4A 2BR0A 4C8KA 4WC3A 1NKCA 4J9QA 2ZH3A 1N56A 4O3OA 5KFHA 3V7KA 5CWRA 1S76D 2UVVA 3WFSC 5J2CA 1RYRA 4Q8EA 1MIWA 5DDMA 1L5UA 8ICPA 2KFZA 5CA7A 8ICFA 1VFGA 1KSPA 1COOA 3BQTA 2ZUDA 4P4PA 4ELTA 4O5CA 4K4IA 3L9DA 4FO6A 4B9SA 1C7YA 5KFSA 2ZH6A 7ICPA 4YD1A 4DS4A 1SKWA 2ZJ8A 4FS2A 4DS5A 9ICAA 2KN7A 2DRBA 5IIIA 5DB7A 4YQWA 4ED0A 3V7JA 3EZ5A 2I9GA 2HHTA 4S3NA 3PV8A 4IRCA 2KTQA 4TUSA 2IA6A 3Q8RB 9ICLA 4RNMA 2W9AA 5F9LA 3RBDA 5KTQA 4X4PA 2ISPA 3G6YA 2HHUA 5KFRA 1KFSA 1BPDA 1ZQGA 7ICKA 4DQIA 4RWOA 4GXJA 8ICTA 2ZH5A 2Q66A 3PX0A 1BPBA 3EPGA 4RWNA 2H5XA 2RFFA 2R8KA 5DG8A 2HVHA 3TAPA 1SL1A 4F4KA 5J0SA 1D8LA 2ZTCA 1JN3A 5KG5A 4J9LA 1HUOA 4DSIA 4AT8B 4PH5A 3RB6A 1SL2A 4RQ5A 2UVRA 3OUYA 4O5EA 4NLZA 1WCNA 1T4GA 8ICNA 3LDAA 4RNNA 3EPIA 2VA3A 4XQ7A 2FPKA 3RJJA 1CUKA 2JZBB 4UAWA 4DL5A 4GXKA 4ELVA 4I28A 4KLIA 1HJPA 3NTUA 3V6HA 4WC7A 3M9MB 1T3NA 1S0NA 1L3TA 5KFQA 5DB8A 4QZGA 2AGQA 1TKDA 4B9UA 1MSWD 9ICKA 1L3SA 5HRIA 4AT9A 3GV7B 3HT3A 4PHEA 3RH5A 3NGDA 8ICOA 2BE3A 2JEIA 1XO1A 3QEBZ 3H3AA 8ICEA 1ZYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8N A;  1ZQN A;  3BQ0 A;  2J6S A;  8ICJ A;  2KZZ A;  1FA0 A;  1T8E A;  1Y88 A;  3GDX A;  1EXN A;  2XO7 A;  2VA2 A;  4F8R A;  7ICU A;  1D8Y A;  5J2J A;  2M2T A;  4E7X A;  5HML A;  3TFS A;  2PXI A;  5DQH A;  3LQC B;  3M8S A;  1U4B A;  3ZD9 A;  3OSP A;  1SZP A;  2BKE A;  4O3R A;  9ICP A;  2R8I A;  3TAN A;  5KFP A;  3BQ1 A;  1MQ3 A;  4NXZ A;  2P66 A;  1U45 A;  2NRK A;  4X4O A;  5KFG A;  9ICS A;  5DLG A;  4QW8 A;  2PBE A;  1ZQP A;  3Q8L A;  4X0A A;  4ED3 A;  4DFJ A;  4TQR A;  4JV0 A;  3QE9 Y;  4KLM A;  4PGQ A;  4BGD A;  3GFK B;  4I2E A;  2AU0 A;  1ZQO A;  2R8H A;  2C2E A;  1ZQA A;  3ZDC A;  2XY5 A;  4E0D A;  4WBY A;  4RQ2 A;  3TAQ A;  4WC6 A;  4YN4 A;  3T5H A;  2UVU A;  3OUY B;  1TV9 A;  9ICN A;  2M9N A;  4DL4 A;  3AQM A;  2DFL A;  4DSK A;  5J0T A;  3SYZ A;  1ZQJ A;  3Q8Q B;  5KT5 A;  4DFM A;  4PHA A;  3AU6 A;  3C2M A;  2LYH A;  2BDP A;  1K1Q A;  2JEF A;  3C18 A;  1MC8 A;  4F2R A;  3UQ2 A;  5IIK A;  4J9P A;  4B9T A;  2AQ0 A;  4KLO A;  2RDJ A;  2DPI A;  1U48 A;  1S0V A;  3ISD A;  1MIV A;  4RT3 A;  4KLJ A;  2ZH1 A;  3RB3 A;  5KFD A;  3PR4 A;  8ICR A;  5J0Y A;  4ATB A;  1OU5 A;  2V4Q A;  4DSJ A;  4RZR A;  4EBE A;  2OWO A;  2FLP A;  8ICA A;  1WOT A;  2XY7 A;  9ICQ A;  5CJ7 A;  2UVW A;  3N4M B;  2W9B A;  3GII A;  5J2K A;  4J9S A;  4MEX A;  2HHQ A;  4YP3 A;  4YMM A;  3UXO A;  4DOB A;  1XC9 A;  4F2S A;  4MF2 A;  4M04 A;  1V4A A;  4I2D A;  2ZTD A;  5KG3 A;  4C8O A;  4MFC A;  1KFT A;  4RWP A;  2W9C B;  5HMM A;  1ZQK A;  9ICH A;  2O1P A;  1XWL A;  3GV8 B;  5CP2 A;  4F5O A;  3PVX A;  8ICI A;  4PPX A;  4EBK A;  4NLK A;  3HJ4 A;  4ED1 A;  5KFC A;  1BPY A;  4FH5 A;  3JPQ A;  5DGB A;  3Q8P B;  3RH4 A;  5KFL A;  5KFA A;  4RQ6 A;  2XGP A;  3ISC A;  1ZQC A;  3UXP A;  3SI8 A;  1YLQ A;  1ZQE A;  2IBK A;  4EZ9 A;  4JWN A;  5J0W A;  5KFX A;  5KFU A;  2Y1J A;  2BCU A;  4RUA A;  2P6R A;  2HHP A;  5HP4 A;  2FPL A;  1NK6 A;  1MQ2 A;  4R63 A;  2WTF A;  3Q8M A;  4PHD A;  4YMN A;  1Q79 A;  8ICQ A;  3QZ8 A;  4GC6 A;  4EBC A;  4DL3 A;  1UA1 A;  1TK0 A;  3ZD8 A;  5F9N A;  5L1I A;  1QSS A;  4KN7 A;  1Z00 A;  3ZDA A;  4M5D A;  4NM2 A;  4RQ7 A;  2ZH8 A;  4P4O A;  4UAY A;  5L1L A;  1PZN A;  2JEJ A;  4DFK A;  3JPN A;  1NK4 A;  4FHV A;  1S0O A;  5KT3 A;  4O0I A;  1NJW A;  9ICX A;  4DQS A;  4ED6 A;  4X4T A;  3OVA A;  4QWD A;  5HRB A;  4KMU A;  1JMS A;  2VA8 A;  4RWQ A;  4TUQ A;  3FYH A;  4O5K A;  1XS9 D;  4KLH A;  3PR5 B;  2O5A A;  3BQ2 A;  4IQW A;  4QZE A;  1ZQU A;  4ATB B;  4ECU A;  5HRL A;  3H40 A;  1ZQI A;  4M2Y A;  4RQ1 A;  3C2K A;  7ICN A;  4M9J A;  2XY6 A;  1MIY A;  2W9M A;  1NZP A;  2C22 A;  2W9B B;  4DOC A;  5DLF A;  4EEY A;  4IRK A;  4QZI A;  4GC7 A;  4JV1 A;  9ICM A;  5J0O A;  2FMS A;  1D9F A;  1ZQT A;  7ICG A;  2F1J A;  3KHH A;  5KFK A;  4F50 A;  2C2R A;  4J9N A;  3LWL A;  1PX5 A;  5D46 A;  3HWT A;  4QWE A;  4PGX A;  3RTV A;  4X0B A;  2DR9 A;  5KFO A;  3RAX A;  8ICX A;  4X5V A;  4J9O A;  3MBY A;  5C5J A;  1ZQR A;  7ICT A;  4KIT B;  5L1K A;  2ISO A;  1DK3 A;  3OHA A;  1ZQL A;  5CB1 A;  4KN4 A;  3MAB A;  5HRH A;  3PMN A;  4KLE A;  8ICB A;  3M9O B;  4DL6 A;  1A77 A;  4TUP A;  4Z6F A;  4P2H A;  3PX4 A;  4RUC A;  4G3I A;  1QSY A;  4Q44 A;  4NKU A;  3ZDE A;  2PFP A;  4FS1 A;  5J0R A;  4QZ8 A;  2ALZ A;  3UQ0 A;  2W8L A;  4IG8 A;  3PO5 A;  2M2W A;  5J0Q A;  4KLS A;  1JQR A;  3WFO A;  3QEA Z;  4LZG A;  4R8U B;  4I2A A;  4KTQ A;  5HRF A;  4QWA A;  4NLN A;  3PX6 A;  1Z00 B;  9ICJ A;  3PML A;  4X4V A;  2A1J A;  4JWM A;  3SV3 A;  4EYI B;  4UQG A;  5IIL A;  3AUO A;  4Q45 A;  4KLD A;  1R8A A;  5KT4 A;  5KG2 A;  1ZQZ A;  3JPO A;  3PY8 A;  3H4B A;  4ECT A;  5HRE A;  4FHX A;  5J2F A;  3B0Y A;  3LWM A;  4O3P A;  4DOA A;  3WFQ E;  5BPC A;  4MFA A;  5CHG A;  4FHW A;  1B22 A;  3OV7 A;  4ECY A;  4YR2 A;  1ZQQ A;  1KLN A;  5J2G A;  3SV4 A;  3C1Y A;  4UB5 A;  1SKR A;  4FBT A;  4RQ8 A;  1UT8 A;  3M9N B;  5HC9 A;  4R65 A;  5J29 A;  3V7L A;  4F3O A;  1JXE A;  1TAQ A;  2ZH2 A;  4K4H A;  3MGH A;  1IM4 A;  2C2D A;  3UPQ A;  4C8M A;  4QZC A;  3ZDD A;  5J0X A;  4WC0 A;  7ICF A;  3Q8K A;  3PW5 A;  2ASJ A;  4TUR A;  4M6W A;  3RJK A;  2HHW A;  7ICE A;  5DEC A;  5KG1 A;  2ZUB A;  3IM1 A;  1B43 A;  3HW8 A;  1U49 A;  4PHP A;  2XGQ A;  1DK2 A;  3C66 A;  3ZDB A;  4UD5 A;  7ICV A;  4IQT A;  3MR2 A;  2ZJA A;  4DQQ A;  3PW0 A;  2HHV A;  9ICR A;  4KLQ A;  4UB1 A;  9ICI A;  2DR5 A;  4MF8 A;  4QZH A;  2AGP A;  2BQU A;  2RDI A;  3NYB A;  4DL2 A;  2ATL A;  1QLN A;  3C5G A;  4P4M A;  2MUT A;  2NRX A;  2ZH4 A;  3H8S A;  5TZV A;  4RU9 A;  4YR3 A;  3PO4 A;  1X2I A;  4F5Q A;  2A1J B;  3GIM A;  1NO5 A;  3GV5 B;  3GQC A;  3HX0 A;  3HPO A;  7ICR A;  4LT6 A;  3GIK A;  3KHL A;  4RQ3 A;  4J9K A;  7ICS A;  3HIY A;  3WFP A;  4AT9 B;  1U47 A;  9ICO A;  1ARO P;  4UB3 A;  8ICZ A;  2BQ3 A;  4AT7 A;  2NRV A;  4DF4 A;  2PFO A;  2HW3 A;  2R8G A;  3RJI A;  4M47 A;  3ISB A;  4E8F A;  7ICH A;  2ZHA A;  4M9L A;  1Z3E B;  4NM1 A;  1BGX T;  8ICM A;  5HR9 A;  4F5R A;  4F4Y A;  1SL0 A;  3UPS A;  4UBB A;  2Q0Z X;  3H7I A;  5KFF A;  3T5K A;  5DQI A;  2ID1 A;  3OVB A;  2F1I A;  2FPM A;  1RYS A;  4I29 A;  3GIJ A;  1X9S A;  1S97 A;  5DDY A;  5HHH A;  1NKE A;  1KRP A;  5KG4 A;  5J2B A;  5CR0 A;  9ICU A;  1KFD A;  1RXV A;  3HJ1 A;  5DG7 A;  4RQ0 A;  1RPL A;  4FHY A;  1ZQD A;  3C2L A;  2XCP A;  3MR5 A;  2IHN A;  4NKT A;  4WBZ A;  4FHP A;  1UEU A;  4M6W B;  4UAZ A;  4Q43 A;  1RXW A;  4BXO A;  8ICH A;  2BPC A;  8ICW A;  1R8C A;  4WCW A;  4ECQ A;  5DGA A;  3KHG A;  5DQG A;  4RPZ A;  2BCR A;  5KFY A;  1X9M A;  5KT6 A;  1S10 A;  2ZH7 A;  3K75 D;  2PFQ A;  4KLL A;  1DGS A;  3SZ2 A;  2B21 A;  4DSE A;  5EWF A;  3MR6 A;  4O3Q A;  3G6V A;  1UA0 A;  1HUZ A;  5IIM A;  4DLE A;  3H8J A;  5KG6 A;  2V4R A;  4RT2 A;  5IIN A;  2BCS A;  2DR8 A;  3H4D A;  2AQ4 A;  4DSF A;  4E80 A;  1TFY A;  3JZ0 A;  2MUT B;  3BJY A;  4CCH A;  1S77 D;  1VJ7 A;  3AQK A;  4Z6E A;  1NK8 A;  4K4G A;  3T3F A;  2XC9 A;  5DBB A;  1R8B A;  4QZ9 A;  1NK5 A;  2FMQ A;  1T7P A;  1NKB A;  4X4S A;  5IIO A;  2HHX A;  4I2G A;  4B9M A;  3E2E A;  4WC4 A;  1BVS A;  3B0X A;  3ORY A;  3MGI A;  3RB0 A;  2BCV A;  4JV2 A;  2NRT A;  4F4W A;  2C28 A;  2AGO A;  4I27 A;  4XA5 A;  5BOM A;  3AQN A;  2PI5 A;  3JPT A;  9ICV A;  2M2U A;  4JK1 A;  5KG7 A;  3TFR A;  4GXI A;  1JIH A;  4JUZ A;  5D49 A;  4QZA A;  4QW9 A;  2I1Q A;  4QWB A;  3GIL A;  5D4B A;  2BPF A;  5KFI A;  4IQV A;  2JEG A;  2DRA A;  1QSL A;  2AJQ A;  4R64 A;  4DLG A;  4DWI A;  4O3N A;  1ZQH A;  1BNO A;  4YR0 A;  3OGU A;  4YCX A;  4RPX A;  2DPJ A;  2FMP A;  4IR1 A;  7ICM A;  1TFR A;  9ICG A;  1K1S A;  3OSN A;  4QWC A;  3JPR A;  3LK9 A;  3MDC A;  5DBA A;  4BXO B;  4X4N A;  3TI0 A;  4UBC A;  5HNK A;  5EOZ A;  5J2E A;  2KZ3 A;  9ICW A;  4X4R A;  2ZHB A;  3OVS A;  1ZQF A;  2DVI A;  1ZQS A;  1CEZ A;  2ZTE A;  1ZQW A;  5DBC A;  9ICF A;  3MDA A;  4I2F A;  2KFN A;  5KFE A;  4UB4 A;  4KLU A;  3V6K A;  4MEY A;  5J2D A;  3MR3 A;  2V9W A;  4DO9 A;  3V6J A;  3RJF A;  2BCQ A;  5HRD A;  1BPX A;  2J6T A;  4I2B A;  8ICU A;  5J2I A;  1NK9 A;  3RBE A;  5J0U A;  1L3U A;  4ED2 A;  5DB9 A;  7ICJ A;  2Y1I A;  2P6U A;  1BPZ A;  4FH3 A;  4C8L A;  4AT7 B;  2FLL A;  1NJX A;  2ZUC A;  3KTQ A;  5KFJ A;  3RAQ A;  4YMO A;  2NRZ A;  4EBJ A;  1ZET A;  4DL7 A;  4PGY A;  8ICS A;  5J2H A;  5J2A A;  3THV A;  4QZB A;  1D9D A;  4DF8 A;  5KFW A;  1ZJN A;  3ETL A;  5DKW A;  1JX4 A;  4B9L A;  2XCA A;  2PFN A;  3WFR E;  7ICQ A;  5HRG A;  5EWG A;  5JUM A;  4F5P A;  1NJY A;  3C5F A;  4R66 A;  4M9H A;  5KFM A;  4EZ6 A;  2MAX A;  4BWM A;  3QZ7 A;  8ICY A;  5EWE A;  1NK0 A;  9ICE A;  2KP7 A;  4Z6C A;  1R89 A;  3JYY A;  2DR7 A;  3RH6 A;  1KEJ A;  1TK5 A;  4DQP A;  1KNY A;  1SKS A;  4O9M A;  4RNO A;  4ECZ A;  3EWA A;  2PI4 A;  2KZM A;  2IMW P;  4HYK A;  4XUS A;  1WCL A;  3PW7 A;  3K4G A;  1X9W A;  4YXM A;  4QZD A;  4UD4 A;  4WC2 A;  3AU2 A;  1QTM A;  4ED7 A;  1U9L A;  1BPE A;  3H39 A;  3KHR A;  3HP6 A;  3FDS A;  4F4X A;  1ZQX A;  2ASD A;  3C1Z A;  3H37 A;  4XQ8 A;  8ICL A;  2BGW A;  1TVA A;  4I2J A;  2W9C A;  3RJE A;  5KFZ A;  3RJH A;  5HHI A;  3IHQ B;  3AQL A;  4UB2 A;  3OHB A;  4LVS A;  4I2H A;  4ECV A;  1S9F A;  2GWS A;  3G6X A;  3RB4 A;  4MFF A;  4O3S A;  4YFK A;  4YD2 A;  8ICK A;  1TK8 A;  1V9P A;  5DB6 A;  4DQR A;  1UET A;  4EYH B;  1LB2 B;  5L1J A;  1KTQ A;  2BHN A;  4F92 B;  4M0A A;  5DG9 A;  4J9R A;  1ZQV A;  4XRH A;  4KLF A;  1TAU A;  1UT5 A;  3T5J A;  2BQR A;  4RPY A;  7ICI A;  5L9X A;  5KFN A;  2VAN A;  4KLT A;  4I2I A;  1KDH A;  4YG2 A;  4QZF A;  4Z6D A;  5KT2 A;  1UEV A;  1ZQM A;  3Q8S B;  3H8W A;  3JPS A;  1NJZ A;  3M8R A;  1JXL A;  1Q78 A;  4ED8 A;  4DFP A;  4F91 B;  3RRG A;  5IIJ A;  3OJU A;  4F4Z A;  9ICB A;  3RR8 A;  1ZJM A;  4ELU A;  2HVI A;  4J9M A;  2F1H A;  4ECR A;  3T5L A;  3MFI A;  1H38 A;  4M9G A;  3EYZ A;  2ZJ5 A;  4ZH4 A;  4WC5 A;  4ECW A;  4X4Q A;  9ICT A;  2FLN A;  9ICC A;  3PW2 A;  4X4U A;  4GLX A;  4DSL A;  1NOM A;  3RJG A;  8ICG A;  3JPP A;  5HRK A;  4B9N A;  4ECS A;  1A76 A;  2NRW A;  3BDP A;  1XSP A;  3H38 A;  8ICV A;  2J6U A;  1F5A A;  2M2V A;  4IR9 A;  1XSL A;  3V72 A;  2ZH9 A;  3UXN A;  4LZD A;  4IRD A;  1ZQY A;  4I2C A;  4B9V A;  3TQ1 A;  3OJS A;  4EBD A;  1BNP A;  4BWJ A;  5DED A;  3TAR A;  4F93 B;  8ICC A;  1S0M A;  2HHS A;  4YXJ A;  5BOL A;  3RRH A;  5KT7 A;  4ECX A;  5KFB A;  1RZT A;  3PNC A;  4YVZ A;  1XSN A;  4Q8F A;  3RR7 A;  2R8J A;  1JAJ A;  4DEZ A;  4IQU A;  5KFV A;  1ZQB A;  2BPG A;  7ICO A;  1DOQ A;  3MFH A;  4AT8 A;  4FBU A;  4M9N A;  1NK7 A;  4BDP A;  1TFW A;  3C21 A;  4EP7 A;  4RQ4 A;  2IHM A;  3N97 B;  5KFT A;  7ICL A;  1IXR A;  4WC1 A;  2W8K A;  1L3V A;  4NY8 A;  2JZB A;  3EW9 A;  4TQS A;  4R8U A;  1LV5 A;  5F2V O;  2ASL A;  4KLG A;  3C23 A;  5KG0 A;  5J0P A;  4NLG A;  1XU4 A;  4F5N A;  1N48 A;  3PW4 A;  2BR0 A;  4C8K A;  4WC3 A;  1NKC A;  4J9Q A;  2ZH3 A;  1N56 A;  4O3O A;  5KFH A;  3V7K A;  5CWR A;  1S76 D;  2UVV A;  3WFS C;  5J2C A;  1RYR A;  4Q8E A;  1MIW A;  5DDM A;  1L5U A;  8ICP A;  2KFZ A;  5CA7 A;  8ICF A;  1VFG A;  1KSP A;  1COO A;  3BQT A;  2ZUD A;  4P4P A;  4ELT A;  4O5C A;  4K4I A;  3L9D A;  4FO6 A;  4B9S A;  1C7Y A;  5KFS A;  2ZH6 A;  7ICP A;  4YD1 A;  4DS4 A;  1SKW A;  2ZJ8 A;  4FS2 A;  4DS5 A;  9ICA A;  2KN7 A;  2DRB A;  5III A;  5DB7 A;  4YQW A;  4ED0 A;  3V7J A;  3EZ5 A;  2I9G A;  2HHT A;  4S3N A;  3PV8 A;  4IRC A;  2KTQ A;  4TUS A;  2IA6 A;  3Q8R B;  9ICL A;  4RNM A;  2W9A A;  5F9L A;  3RBD A;  5KTQ A;  4X4P A;  2ISP A;  3G6Y A;  2HHU A;  5KFR A;  1KFS A;  1BPD A;  1ZQG A;  7ICK A;  4DQI A;  4RWO A;  4GXJ A;  8ICT A;  2ZH5 A;  2Q66 A;  3PX0 A;  1BPB A;  3EPG A;  4RWN A;  2H5X A;  2RFF A;  2R8K A;  5DG8 A;  2HVH A;  3TAP A;  1SL1 A;  4F4K A;  5J0S A;  1D8L A;  2ZTC A;  1JN3 A;  5KG5 A;  4J9L A;  1HUO A;  4DSI A;  4AT8 B;  4PH5 A;  3RB6 A;  1SL2 A;  4RQ5 A;  2UVR A;  3OUY A;  4O5E A;  4NLZ A;  1WCN A;  1T4G A;  8ICN A;  3LDA A;  4RNN A;  3EPI A;  2VA3 A;  4XQ7 A;  2FPK A;  3RJJ A;  1CUK A;  2JZB B;  4UAW A;  4DL5 A;  4GXK A;  4ELV A;  4I28 A;  4KLI A;  1HJP A;  3NTU A;  3V6H A;  4WC7 A;  3M9M B;  1T3N A;  1S0N A;  1L3T A;  5KFQ A;  5DB8 A;  4QZG A;  2AGQ A;  1TKD A;  4B9U A;  1MSW D;  9ICK A;  1L3S A;  5HRI A;  4AT9 A;  3GV7 B;  3HT3 A;  4PHE A;  3RH5 A;  3NGD A;  8ICO A;  2BE3 A;  2JEI A;  1XO1 A;  3QEB Z;  3H3A A;  8ICE A;  1ZYQ A; 
#chains in the Genus database with same CATH topology
 3BQ0 A;  1FA0 A;  2E8M A;  4F8R A;  1IG6 A;  7ICU A;  1D8Y A;  5J2J A;  2K4H A;  3QU9 A;  3LQC B;  3M8S A;  3PHZ A;  4U7C A;  5KFP A;  2P66 A;  1MQ3 A;  5KFG A;  5DLG A;  4QW8 A;  4X0A A;  3EF2 A;  4KLM A;  4PGQ A;  2AU0 A;  1ZQO A;  2R8H A;  2C2E A;  1N60 A;  3BZK A;  3ZDC A;  3H0M B;  2FJ6 A;  4RQ2 A;  3TAQ A;  2KHV A;  2QAR B;  2UVU A;  1KL9 A;  3OUY B;  2M9N A;  4DL4 A;  5J0T A;  3PSF A;  2K8C B;  3AU6 A;  5A0L A;  5AKG A;  2LYH A;  2BDP A;  4F2R A;  3UQ2 A;  1JRP A;  4KLO A;  1S0V A;  2WF9 A;  4KLJ A;  3RB3 A;  1UPH A;  2V4Q A;  4DSJ A;  2I6X A;  4LEW A;  2UVW A;  5J2K A;  4MEX A;  2KOB A;  4F2S A;  4C8O A;  2ZTD A;  4NXT A;  4RWP A;  2H3F A;  2W9C B;  2LI6 A;  9ICH A;  2O1P A;  2CXY A;  8ICI A;  4F5O A;  3HJ4 A;  3JPQ A;  5KFA A;  5KFX A;  2BCU A;  2D8C A;  4RUA A;  2HHP A;  5HP4 A;  2FPL A;  1NK6 A;  4FZN A;  3Q8M A;  8ICQ A;  1TK0 A;  3ZD8 A;  3ZDA A;  1QSS A;  4M5D A;  4KN7 A;  1JAL A;  4NM2 A;  5AK4 A;  2DF4 B;  4P4O A;  3TAD C;  2JEJ A;  5ALH A;  2WF8 A;  3OVA A;  4QWD A;  3NVW A;  1ZQ1 C;  1FIQ A;  2K60 A;  2O5A A;  4IQW A;  1ZQU A;  5HRL A;  4M9J A;  2XY6 A;  4P0Q B;  3NRW A;  4CF3 A;  9ICM A;  4DOC A;  3SAH A;  4FE3 A;  4X0B A;  3HWT A;  4J03 A;  3RAX A;  4J9O A;  4KN4 A;  4KLE A;  4P2H A;  1KW4 A;  3ZDE A;  2B6G A;  2G0A A;  4Y2T A;  4KX3 A;  4KTQ A;  2DKX A;  3PX6 A;  2A1J A;  4JWM A;  3CNH A;  4KLD A;  1ZQZ A;  3JPO A;  1YT3 A;  3H4B A;  4K98 A;  5CHG A;  4FHW A;  1DGJ A;  5AIB A;  2ZIV A;  4YR2 A;  1ZQQ A;  1SGG A;  4JLZ A;  4FBT A;  4RQ8 A;  3SD7 A;  4OO1 J;  2W3S A;  1GPJ A;  3V7L A;  4F3O A;  2ZH2 A;  2PMZ C;  3MGH A;  2C2D A;  3ZDD A;  1QQ5 A;  2HSZ A;  3PW5 A;  4M6W A;  2HHW A;  2H3V A;  1B43 A;  1U49 A;  2XGQ A;  1J2N A;  3E58 A;  5J8Y C;  3ZDB A;  2ZJA A;  4DQQ A;  1S8O A;  9ICR A;  1DXS A;  4UB1 A;  2ATL A;  3DDH A;  2K8B B;  2ZH4 A;  3H8S A;  4RU9 A;  4YR3 A;  1ZRM A;  1RG6 A;  2A1J B;  3IDW A;  5AM2 A;  3HPO A;  3GIK A;  3HIY A;  5AKH A;  3OTQ A;  4DF4 A;  5B66 U;  4Y2Q A;  4KB6 A;  2WF5 A;  7ICH A;  5ALK A;  1Z3E B;  4NM1 A;  1BGX T;  5HR9 A;  3OVB A;  2EAN A;  4I29 A;  3GIJ A;  1S97 A;  2EQY A;  2KMD A;  5DDY A;  4LZG A;  1KRP A;  5CR0 A;  1KFD A;  3HJ1 A;  4FHY A;  2QLT A;  3C2L A;  2XCP A;  2IHN A;  4WBZ A;  4NKT A;  4FHP A;  4M6W B;  3QU5 A;  1RXW A;  4BXO A;  4ICA A;  5AI0 A;  2E1E A;  2JXJ A;  3SZ2 A;  2B0C A;  4DSE A;  1X9X A;  4DLE A;  2V4R A;  5IIN A;  3H4D A;  3S6J A;  4E80 A;  1TFY A;  2E5S A;  2DUY A;  1L8L A;  4Z6E A;  1L7M A;  2M0N A;  3J81 j;  3M6Z A;  1NK5 A;  4PZO A;  4Y2R A;  4B9M A;  3E2E A;  2OYY A;  3MGI A;  4I27 A;  2LPE A;  2EH9 A;  1QH9 A;  4XA5 A;  5AI9 A;  3JPT A;  9ICV A;  2M2U A;  1NI3 A;  3TFR A;  3RB0 A;  4GXI A;  5D4B A;  2BCV A;  4QZA A;  2I1Q A;  2JEG A;  2DRA A;  2AJQ A;  4OAH A;  4DWI A;  1ZQH A;  4QWC A;  3JPR A;  3LK9 A;  4CNQ A;  4BXO B;  4UBC A;  2KZ3 A;  5JU5 A;  2DVI A;  1L7P A;  5DBC A;  9ICF A;  3MDA A;  2KFN A;  4KLU A;  5J2D A;  2V9W A;  4DO9 A;  2BCQ A;  2G5H B;  5J2I A;  2Y1I A;  4C8L A;  3KTQ A;  3RAQ A;  2YX8 A;  5J2H A;  1D9D A;  1T3Q A;  2XCA A;  1Q3U A;  2B56 A;  7ICQ A;  5HRG A;  2MU2 A;  4EZ6 A;  2MAX A;  8ICY A;  3JYY A;  2A3V A;  9ICE A;  4NXX A;  2FDR A;  4DQP A;  5GTH U;  1J2M A;  3IRU A;  4RNO A;  4ECZ A;  2KZM A;  2IMW P;  4XJE A;  2G07 A;  3PW7 A;  4YXM A;  2WF7 A;  2ZIX A;  2NO4 A;  1U9L A;  1BPE A;  4F4X A;  2WB1 F;  4C7Y A;  1KN5 A;  3C1Z A;  2KNJ A;  4XQ8 A;  3WK9 A;  3RJE A;  3RJH A;  3N7P D;  1FFV A;  1PVQ A;  4LVS A;  4O3S A;  4MFF A;  2HBJ A;  8ICK A;  1V9P A;  4O67 A;  4DQR A;  2IUB A;  1LB2 B;  1KTQ A;  2BHN A;  4F92 B;  5DG9 A;  1ZQV A;  4KLF A;  1UT5 A;  4RPY A;  2VJ4 A;  2DKZ A;  2DBY A;  5L9X A;  2VAN A;  2FE9 A;  1UEV A;  1ZQM A;  3H8W A;  3OPX A;  3WK5 A;  4F72 A;  1NJZ A;  4F91 B;  3RRG A;  2YMQ A;  1KQQ A;  2W04 A;  1ZJM A;  5ALL A;  4M9G A;  1H38 A;  4ZH4 A;  5AHX A;  4ECW A;  3PW2 A;  3SEI A;  5D63 A;  3TAC B;  1NNL A;  4ECS A;  1A76 A;  3BDP A;  2ZIX B;  2F3N A;  2J6U A;  1F5A A;  1L7O A;  1IV8 A;  3HKZ C;  3V72 A;  4PL1 A;  2ZH9 A;  5KL1 B;  4IL6 U;  4BWJ A;  1FO4 A;  2HHS A;  4EEB A;  3L4P A;  3PNC A;  3QU7 A;  3QU2 A;  1ZQB A;  3PSP A;  7ICO A;  4AT8 A;  3MFH A;  4FBU A;  2LYA A;  3AEV A;  1WWU A;  3EW9 A;  4R8U A;  2JRZ A;  1XU4 A;  4F5N A;  2KVC A;  2ZIW A;  4WC3 A;  4O3O A;  1S76 D;  2UVV A;  5AM3 A;  5J2C A;  2KFZ A;  1JI7 A;  4EGW A;  4FO6 A;  2DWQ A;  4DS4 A;  2RRD A;  9ICA A;  1S5L U;  4YQW A;  3EZ5 A;  3L3F X;  1X40 A;  3PV8 A;  2KTQ A;  5EE3 A;  2IA6 A;  5EE0 A;  4EEL A;  3Q8R B;  5L1M A;  3ER8 C;  4Y2P A;  4DQI A;  4RWO A;  2QB0 A;  5DG8 A;  5G5H A;  3TAP A;  2W54 A;  1SL1 A;  1N63 A;  5KG5 A;  1HUO A;  4AT8 B;  2LBO A;  2UVR A;  2WF6 A;  4CF4 A;  4NLZ A;  2O6K A;  3EPI A;  3BQ7 A;  4OJL A;  3M9M B;  5KFQ A;  5DB8 A;  4B9U A;  2ZH1 A;  1MSW D;  3NGD A;  2Y0S C;  1TAM A;  2WAQ C;  1ZQN A;  2J6S A;  2G08 A;  3HIL A;  8ICJ A;  3BS5 A;  2KZZ A;  1T8E A;  1HEK A;  1EXN A;  1YZ7 A;  4E7X A;  2PXI A;  4O3M A;  3OSP A;  2E1F A;  5EE9 A;  4X4O A;  2A19 A;  9ICS A;  4U6P A;  2HBM A;  1M6Y A;  3Q8L A;  3HJE A;  3CW2 C;  4TQR A;  4IC9 A;  4BGD A;  4I2E A;  1Z1B A;  1MA7 A;  4E0D A;  4YN4 A;  9ICN A;  3C29 A;  2G5I B;  3SYZ A;  3Q8Q B;  5KT5 A;  4DFM A;  3C2M A;  3C18 A;  1K1Q A;  2JEF A;  2RDJ A;  1MIV A;  4P0P A;  5AK6 A;  4FZL A;  5KFD A;  2OWO A;  2FLP A;  1WOT A;  2OCE A;  5CJ7 A;  3BS5 B;  4OAG A;  4J9S A;  2FI1 A;  4MF2 A;  3A0H U;  4NWI A;  1XWL A;  3GV8 B;  1N5X A;  1PVR A;  4NLK A;  5KFC A;  5E79 U;  4MKP A;  5EE1 A;  5DGB A;  3Q8P B;  3RH4 A;  3QUC A;  5KFL A;  5B5E U;  2H3Z A;  5AKL A;  3WK6 A;  3UXP A;  1YLQ A;  4EZ9 A;  4JWN A;  3ONN A;  4EEN A;  5J0W A;  2P6R A;  3QYP A;  5ALF A;  1DRG A;  3PST A;  2KK0 A;  4YMN A;  5ALZ A;  2NYV A;  2RLT A;  4DFK A;  3JPN A;  1NK4 A;  5H2F U;  2GAF D;  3EUB 2;  4DQS A;  4ED6 A;  4X4T A;  2VA8 A;  4KLH A;  4P0P B;  2ZXH A;  4PJ0 U;  3BQ2 A;  2JR5 A;  4QZE A;  1ZQI A;  3C2K A;  4Y2X A;  1NZP A;  1FEZ A;  4IRK A;  4BUG A;  4JV1 A;  3M7D A;  5J0O A;  2FMS A;  7ICG A;  2C2R A;  4F50 A;  3F5E A;  3M6K A;  3NVO A;  3MBY A;  5C5J A;  1DK3 A;  1XNS A;  4EX6 A;  5CB1 A;  4Z6F A;  2NO5 A;  1QSY A;  4FS1 A;  5J0R A;  1KBU A;  4DCC A;  1NZB A;  5J0Q A;  4ZOH C;  3QEA Z;  4I2A A;  2KHQ A;  3PML A;  4X4V A;  3SV3 A;  4UQG A;  3AUO A;  5KT4 A;  2F77 X;  4EV6 A;  5HRE A;  3B0Y A;  4O3P A;  4DOA A;  4NLC A;  3WFQ E;  5BPC A;  4MFA A;  3OV7 A;  4RQN A;  4ECY A;  1C20 A;  4UB5 A;  1FFU A;  4R65 A;  3K1Z A;  1PK1 B;  2RQ5 A;  1JXE A;  1VDV A;  3WK8 A;  3LVW A;  4C8M A;  3IG8 A;  3NKU A;  5J0X A;  2D3D A;  3M1Y A;  2EZX A;  4OD0 A;  7ICF A;  5KG1 A;  3HW8 A;  4PHP A;  3FM9 A;  5G5G A;  4UD5 A;  3WK7 A;  7ICV A;  5TIS U;  5ALQ A;  2HHV A;  3UM9 A;  9ICI A;  2DR5 A;  2BQU A;  4DL2 A;  3N7S C;  3C5G A;  4P4M A;  2NRX A;  4UAS A;  3GV5 B;  1UHU A;  7ICR A;  2YY6 A;  4J9K A;  3QUQ A;  5AK3 A;  4UB3 A;  5B3P A;  4AT7 A;  5D61 A;  1JUD A;  3E0F A;  4M9L A;  4F4Y A;  3UPS A;  4UBB A;  5ALY A;  2AH5 A;  2KV2 A;  1X42 A;  2HBL A;  2F1I A;  1X9S A;  1NKE A;  1ZD3 A;  5CEH A;  1RXV A;  4C4S A;  5DG7 A;  4RQ0 A;  3CYM A;  1RPL A;  3NRZ A;  5AIC A;  1ZQD A;  2KIW A;  1RQL A;  5AI6 A;  1A6S A;  4X4U A;  4Q43 A;  8ICW A;  2OM6 A;  3NVV A;  5AK5 A;  1X9M A;  4OCZ A;  4KLL A;  4O3Q A;  5IIM A;  1Q8K A;  3D2N A;  1VJ7 A;  4K96 A;  3T3F A;  2GOL A;  1ZXI A;  3DEE A;  4KM5 A;  4NXU A;  2FMQ A;  1NKB A;  2Y9U A;  4Y2Y A;  5ALP A;  2HHX A;  3ORY A;  4JV2 A;  4AT7 B;  5ALE A;  2PKE A;  5CFU A;  5ALJ A;  3AQN A;  5BOM A;  2NV3 A;  5D49 A;  4QWB A;  2BPF A;  5KFI A;  4IQV A;  4R64 A;  4QJF B;  4YCX A;  4RPX A;  4IR1 A;  7ICM A;  2AHO B;  3MDC A;  5DBA A;  5CRX A;  3TI0 A;  4X4R A;  2ZHB A;  1L7N A;  5ALV A;  4I2F A;  5KFE A;  5ALT A;  3V6J A;  3RJF A;  1BPX A;  3IP4 B;  5KNI A;  4ED2 A;  7ICJ A;  4FH3 A;  2P6U A;  1NJX A;  2ZUC A;  2IOF K;  5JTI A;  4WQL A;  4EBJ A;  1ZET A;  3F5A A;  1WWV A;  1ZD4 A;  5J2A A;  4DF8 A;  2ZXI A;  1GO3 F;  3ETL A;  4C0Z A;  4F5P A;  4BWM A;  2DR7 A;  1R89 A;  1KEJ A;  3CP8 A;  3GZF A;  1TK5 A;  1XO0 A;  1SKS A;  4O9M A;  2B4V A;  2Q4T A;  4HYK A;  4XUS A;  2DGZ A;  1N2X A;  2F8L A;  3IG5 A;  3H39 A;  3KHR A;  3HP6 A;  1ZQX A;  2WFA A;  2Y0S F;  2W7P A;  8ICL A;  5KFZ A;  2KVS A;  3VC8 A;  5HHI A;  4UB2 A;  4QIW C;  4I2H A;  1ECW A;  1S9F A;  2GWS A;  2KJ5 A;  2OXO A;  3KOO A;  5L1J A;  2AXT U;  2L5Y A;  1RYU A;  4XRH A;  3T5J A;  1SXE A;  7ICI A;  2ZIV B;  4KLT A;  4I2I A;  3ALR A;  4QZF A;  2F76 X;  5KT2 A;  2OH2 A;  3VCB A;  3Q8S B;  1L8O A;  2E3T A;  2YTU A;  5ALX A;  4ED8 A;  4DFP A;  5IIJ A;  3OJU A;  4F4Z A;  9ICB A;  4C80 A;  3T5L A;  4X4Q A;  2FLN A;  9ICC A;  4OJ5 A;  3JPP A;  3D6J A;  3H38 A;  2NRW A;  8ICV A;  2M2V A;  4IR9 A;  3SAF A;  1SV0 A;  5KL8 B;  3UXN A;  2Y9T A;  1ZQY A;  3TQ1 A;  5ALM A;  4EBD A;  8ICC A;  3RRH A;  3ERC C;  5KFB A;  1RZT A;  4YVZ A;  1JAJ A;  3PSI A;  2E8P A;  4EP7 A;  4RQ4 A;  4OAF A;  3KZX A;  5KFT A;  1IXR A;  7ICL A;  2K4E A;  4WC1 A;  2I5H A;  4TQS A;  1IIP A;  4KLG A;  3ETR A;  5KG0 A;  4NLG A;  3QUT A;  3KKA C;  1ZOL A;  2BR0 A;  2KIC A;  3QXG A;  3N7R C;  3KKA A;  3WFS C;  4Q8E A;  1MIW A;  1VFG A;  8ICP A;  5CA7 A;  8ICF A;  4P4P A;  4ELT A;  4B9S A;  5ALU A;  3H8M A;  2ZJ8 A;  4FS2 A;  4DS5 A;  1OXJ A;  4IRC A;  5KTQ A;  2HHU A;  2KJ8 A;  5GTI U;  1TE2 A;  3PX0 A;  1BPB A;  5KAF U;  2ODG A;  5J0S A;  3I28 A;  3WKA A;  2ZTC A;  3KFU F;  4K9B A;  4DSI A;  4HAI A;  3RB6 A;  3D2S A;  4RQ5 A;  3QX7 A;  2VA3 A;  3KBB A;  2FPK A;  1CUK A;  1X66 A;  1KKX A;  4DL5 A;  4I28 A;  1LKY A;  1T3N A;  1S0N A;  4QZG A;  1TKD A;  5HRI A;  4AT9 A;  3LYS A;  2BE3 A;  2HHT A;  3QEB Z;  1ZYQ A;  2HOQ A;  1F0M A;  5ALW A;  3GDX A;  2VA2 A;  2M2T A;  3TFS A;  1Z4N A;  5DQH A;  1SZP A;  3UMC A;  2NRK A;  2R8I A;  3TAN A;  1U45 A;  4AP9 A;  2PBE A;  2HBK A;  1ZQP A;  4ED3 A;  2EWR A;  4JV0 A;  2YMM A;  3GFK B;  1ZRN A;  2ES6 A;  3B9J A;  2XY5 A;  2K4P A;  5ALD A;  3AQM A;  3RF9 A;  1ZQJ A;  4PHA A;  2XID A;  5IIK A;  1LKY B;  3ISD A;  4RT3 A;  2K4I A;  1VJ5 A;  2JGA A;  2RP5 A;  5J0Y A;  3PR4 A;  1OU5 A;  4RZR A;  2XY7 A;  9ICQ A;  3N4M B;  2W9B A;  3GII A;  2HHQ A;  3UXO A;  4DOB A;  1XC9 A;  4K8V A;  4M04 A;  1V4A A;  4I2D A;  5KG3 A;  1KFT A;  5HMM A;  1ZQK A;  3PVX A;  2W43 A;  2LHT A;  4PPX A;  4EBK A;  4ED1 A;  4FZM A;  1BPY A;  1JRO A;  4HX0 A;  4GFJ A;  4RQ6 A;  3ISC A;  1ZQC A;  1ZQE A;  5KFU A;  4R63 A;  2WTF A;  4PHD A;  1Q79 A;  4LJX A;  5T14 A;  1Z19 A;  3QZ8 A;  1UA1 A;  4DL3 A;  5L1I A;  1Z00 A;  4NJ8 A;  4RQ7 A;  2ZH8 A;  2BBH A;  1PZN A;  1Z1V A;  2BBJ A;  1S0O A;  2W55 A;  1NJW A;  1O03 A;  4RQM A;  4CF5 A;  1SWW A;  5HRB A;  4KMU A;  1JMS A;  4KX5 A;  4NXV A;  4TUQ A;  3FYH A;  1XS9 D;  3PR5 B;  1LVH A;  3H40 A;  2W11 A;  4M2Y A;  7ICN A;  2W9M A;  4NV0 A;  4UW9 A;  2C22 A;  2W9B B;  4EEY A;  5DLF A;  4UB6 U;  4QZI A;  4GC7 A;  3BZC A;  5ALS A;  1ZQT A;  3FC4 A;  1URJ A;  2F1J A;  3KHH A;  4X4S A;  4J9N A;  2HDO A;  1PX5 A;  5D46 A;  2W7O A;  2DR9 A;  3RTV A;  8ICX A;  4X5V A;  1ZQR A;  2HN2 A;  7ICT A;  4KIT B;  2ISO A;  3OHA A;  1ZQL A;  3MAB A;  8ICB A;  4DL6 A;  1A77 A;  4TUP A;  3PX4 A;  4Q44 A;  4QZ8 A;  4IG8 A;  2W8L A;  2M2W A;  4C4R A;  3DV9 A;  4KLS A;  1JQR A;  3AQF A;  4R8U B;  1Z00 B;  2E8O A;  3C28 A;  2ZIW B;  5IIL A;  4Q45 A;  2JHD A;  4JB3 A;  5KG2 A;  3PY8 A;  4FHX A;  4ECT A;  5J2F A;  3LWM A;  1V38 A;  5ALI A;  4PZN A;  1KLN A;  1SKR A;  1ZD5 A;  5HC9 A;  5FP0 A;  3AMZ A;  3ZI4 A;  4K4H A;  1D8B A;  2KEY A;  3JCF A;  3UPQ A;  4QZC A;  4NXW A;  4WC0 A;  3Q8K A;  4TUR A;  7ICE A;  5DEC A;  2PMZ F;  3SQI A;  1DK2 A;  2N1R A;  3C66 A;  2QB0 B;  1Z4O A;  3NAS A;  1K5O A;  4UB8 U;  2JH7 A;  5K4L A;  4IQT A;  3PW0 A;  1HIW A;  4QZH A;  2RDI A;  3NYB A;  2GLE A;  1QLN A;  3PO4 A;  4F5Q A;  3GIM A;  1NO5 A;  3GQC A;  3HX0 A;  3WFP A;  4RQ3 A;  1U47 A;  4IS7 A;  4QIW F;  9ICO A;  2XIC A;  2NRV A;  2WHE A;  3RJI A;  5CHE A;  3ISB A;  4E8F A;  8ICM A;  1T94 A;  4F5R A;  1SL0 A;  2Q0Z X;  5KFF A;  2ID1 A;  5DQI A;  1RYS A;  5J2B A;  9ICU A;  4B6J A;  3MR5 A;  1UEU A;  1B4F A;  5DGA A;  3KHG A;  2BCR A;  5KFY A;  5KT6 A;  1S10 A;  2DL0 A;  4UAR A;  3MR6 A;  3SAG A;  3SMV A;  1HUZ A;  1SV4 A;  5KG6 A;  4RT2 A;  2BCS A;  2AQ4 A;  3JZ0 A;  5F3X B;  4MHV A;  3UMG A;  5DBB A;  1R8B A;  1T7P A;  3LVV A;  2BZF A;  4I2G A;  3L5K A;  2DQN B;  2B51 A;  4WC4 A;  4LEV A;  2CRX A;  2PI5 A;  8ICU A;  4JUZ A;  2VJ5 A;  4AYB C;  4DLG A;  2BDU A;  4O3N A;  4NL9 A;  4YR0 A;  2DPJ A;  2VKQ A;  1Q3V A;  9ICG A;  1K1S A;  4X4N A;  5EOZ A;  5J2E A;  1B0X A;  3OWG A;  4BX9 C;  2Z7J A;  4OJP A;  1ZQF A;  1ZQS A;  1CEZ A;  2ZTE A;  1ZQW A;  1V85 A;  3V6K A;  4MEY A;  3NVZ A;  2J6T A;  4I2B A;  5J0U A;  2ZG6 A;  3WKB A;  4PL2 A;  3AL0 B;  2FLL A;  2YN4 A;  4OJO A;  4YMO A;  2NRZ A;  3H0R B;  4DL7 A;  4PGY A;  2OEH A;  8ICS A;  4QZB A;  1ZJN A;  1WUD A;  5KFW A;  5DKW A;  4B9L A;  3WFR E;  2HI0 A;  3T79 A;  5JUM A;  1CRX A;  1NJY A;  2YQE A;  3C5F A;  4R66 A;  3QZ7 A;  1NK0 A;  4Z6C A;  3QNM A;  1KNY A;  3KZI U;  3EWA A;  2PI4 A;  3IN5 A;  1X9W A;  3ED5 A;  3AU2 A;  4ED7 A;  2ASD A;  4WOY A;  2BGW A;  4I2J A;  2W9C A;  3IHQ B;  2XVT A;  3OHB A;  1ED1 A;  4ECV A;  1QQ6 A;  3G6X A;  2CPR A;  3RB4 A;  4GIB A;  5DB6 A;  4O6A A;  1UET A;  5AKI A;  2MA1 A;  1TAU A;  1F5S A;  2G06 A;  2ZIU A;  1KDH A;  5AKY A;  3JPS A;  5AIA A;  4EED A;  3RR8 A;  2HVI A;  2F1H A;  4NLB A;  3MFI A;  2ZJ5 A;  4WC5 A;  4Y2V A;  4GLX A;  1NOM A;  2GO7 A;  4P0Q A;  3R9K A;  1XSL A;  4LZD A;  3AM9 A;  4I2C A;  3OJS A;  5BOL A;  5AM5 A;  3H0L B;  4ECX A;  1XSN A;  3RR7 A;  3HKZ F;  5AKJ A;  1WG8 A;  2R8J A;  4DEZ A;  4IQU A;  2BPG A;  4M9N A;  1NK7 A;  4BDP A;  1TFW A;  2IHM A;  3N97 B;  2W8K A;  1L3V A;  2JZB A;  5F2V O;  1LV5 A;  2ASL A;  3C23 A;  5J0P A;  4K9A A;  2ZIU B;  4FFD A;  5AKZ A;  4C8K A;  2LM4 A;  1NKC A;  2ZH3 A;  1PVP A;  5KFH A;  5D62 A;  3QU4 A;  3U26 A;  2MSN A;  3TAD A;  5CFS A;  5DDM A;  3BQT A;  3ER9 B;  3AQE A;  1C7Y A;  5KFS A;  2KIV A;  2YB1 A;  7ICP A;  2KN7 A;  2DRB A;  1AQ6 A;  5III A;  5AKK A;  3V7J A;  2I9G A;  4S3N A;  9ICL A;  2W9A A;  3RBD A;  2ISP A;  3G6Y A;  1KFS A;  3AN1 A;  1ZQG A;  4FO1 A;  2JMG A;  4LEY A;  1WYG A;  1YZ6 A;  2ZH5 A;  1VLB A;  2Q66 A;  4JMU A;  4RWN A;  2HVH A;  4CGZ A;  4J9L A;  1JN3 A;  2K8A A;  4CDG A;  4OJ6 A;  4PH5 A;  5AM1 A;  4O5E A;  1WCN A;  2EZZ A;  8ICN A;  3LDA A;  4RNN A;  4N7R A;  3RJJ A;  2JZB B;  1QCK A;  5ALR A;  3V6H A;  1L3T A;  4KMO B;  2AGQ A;  1L3S A;  2R18 A;  3HT3 A;  4PHE A;  3GV7 B;  3RH5 A;  3MGV A;  2KKV A;  8ICE A;  2HCF A;  4C8N A;  1N61 A;  1Y88 A;  3PZP A;  2XO7 A;  5HML A;  3F2B A;  2EAO A;  1PUZ A;  2KD1 A;  1U4B A;  2WAQ F;  3ZD9 A;  1J97 A;  2BKE A;  4O3R A;  1CI4 A;  9ICP A;  3BQ1 A;  4NXZ A;  4DFJ A;  3KD3 A;  3QE9 Y;  1ZQA A;  3WU2 U;  3NUQ A;  4US8 A;  4WBY A;  4WC6 A;  3T5H A;  1TV9 A;  5AI5 A;  5J8Y A;  2DFL A;  4DSK A;  2IOH A;  1SWV A;  2JH1 A;  1F44 A;  1MC8 A;  2P35 A;  2A1A A;  4J9P A;  4UAV A;  2AQ0 A;  3F2C A;  4B9T A;  2DPI A;  3RFA A;  1U48 A;  4ACO A;  8ICR A;  2OHF A;  4ATB A;  4UAT A;  4EBE A;  8ICA A;  1SV0 C;  4YP3 A;  4YMM A;  3CK6 A;  4JLX A;  4MFC A;  1SXD A;  5CP2 A;  5JRT A;  4F71 A;  4FH5 A;  2XGP A;  3SI8 A;  1ZD2 P;  2IBK A;  3WKD A;  2Y1J A;  1MQ2 A;  5B3Q A;  4K97 A;  4EBC A;  4GC6 A;  5F9N A;  2EAP A;  2LKY A;  4UAY A;  2JV3 A;  5L1L A;  2W3R A;  4FHV A;  2GH1 A;  5KT3 A;  4O0I A;  3MC1 A;  9ICX A;  1MN8 A;  1SIJ A;  4O5K A;  4ATB B;  4ECU A;  4RQ1 A;  1V97 A;  1MIY A;  3QUB A;  1COK A;  3A0B U;  5AKE A;  1D9F A;  2RHF A;  5KFK A;  4USA A;  5HR6 A;  1O08 A;  3LWL A;  4QWE A;  4PGX A;  2EZY A;  5KFO A;  2F44 A;  4I0U A;  5L1K A;  2KKP A;  3PMN A;  5HRH A;  3M9O B;  4G3I A;  4RUC A;  4AYB F;  4NKU A;  2PFP A;  2ALZ A;  3UQ0 A;  1PK3 A;  3PO5 A;  3GU3 A;  3WFO A;  5HRF A;  2H3I A;  4QWA A;  4NLN A;  2EAM A;  9ICJ A;  3O0F A;  4EYI B;  1R8A A;  1A0P A;  4BJQ A;  1B22 A;  1P7D A;  1Q46 A;  5J2G A;  3SV4 A;  3C1Y A;  1UT8 A;  3M9N B;  3IV6 A;  2KG5 A;  3SEN A;  5J29 A;  1TAQ A;  1IM4 A;  2XI9 A;  2YB4 A;  3SR6 A;  3N28 A;  5ALO A;  3NS1 A;  2ASJ A;  3RJK A;  3FAH A;  2ZUB A;  3IM1 A;  2F8K A;  4O68 A;  3MR2 A;  4KLQ A;  3MCR A;  4MF8 A;  3NVY A;  2AGP A;  1OW5 A;  4OAI Z;  2D6F C;  2MUT A;  5TZV A;  1X2I A;  3TKA A;  4LT6 A;  3KHL A;  7ICS A;  1SB3 C;  4AT9 B;  4CE6 A;  1ARO P;  8ICZ A;  2YMP A;  2BQ3 A;  2PFO A;  2HW3 A;  2R8G A;  4M47 A;  2ZHA A;  4US9 A;  3H7I A;  3T5K A;  1RDF A;  2FPM A;  5HHH A;  5KG4 A;  3WKC A;  4CRX A;  4WQK A;  4UAZ A;  3I76 A;  1R8C A;  8ICH A;  4WCW A;  2BPC A;  4ECQ A;  5DQG A;  4RPZ A;  5AM0 A;  2ZH7 A;  3K75 D;  2PFQ A;  2KE7 A;  1DGS A;  2B21 A;  5EWF A;  3UMB A;  3F53 A;  3G6V A;  1UA0 A;  2LM1 A;  2HMX A;  3H8J A;  4C7Z A;  2DR8 A;  4DSF A;  4WH5 A;  1SZH A;  2MUT B;  3BJY A;  4CCH A;  1S77 D;  3AQK A;  1NK8 A;  4K4G A;  2XC9 A;  4QZ9 A;  1N62 A;  1UQV A;  4Y2J A;  5IIO A;  4EX7 A;  1BVS A;  1QQ7 A;  3B0X A;  4QNL A;  2NRT A;  4F4W A;  2C28 A;  2AGO A;  3K1R B;  4JK1 A;  5KG7 A;  1JIH A;  4QW9 A;  3GIL A;  4K99 A;  4G9B A;  4Y2S A;  1QSL A;  2FCL A;  1BNO A;  3OGU A;  2CN1 A;  5ALN A;  2FMP A;  1TFR A;  3OSN A;  5HNK A;  9ICW A;  3OVS A;  3ICX A;  2KSO A;  4UB4 A;  3MR3 A;  3HRD D;  5HRD A;  5AM4 A;  2QKQ A;  1NK9 A;  3RBE A;  1L3U A;  5DB9 A;  1BPZ A;  4C4T A;  5KFJ A;  5KAI U;  3THV A;  1JX4 A;  2PFN A;  2LMR A;  4LEZ A;  5EWG A;  5AI8 A;  4M9H A;  5KFM A;  2KP7 A;  5EWE A;  3RH6 A;  3WK4 A;  2HOF A;  2H3Q A;  1WCL A;  3K4G A;  3CRX A;  4QZD A;  4UD4 A;  4WC2 A;  1QTM A;  3FDS A;  3H37 A;  4WJ3 B;  4O69 A;  1TVA A;  2IOF A;  3AQL A;  2KSO B;  4YFK A;  4YD2 A;  1TK8 A;  4EYH B;  5HR7 A;  4M0A A;  3K7D A;  4J9R A;  2KJ9 A;  2BQR A;  3WKE A;  5KFN A;  4YG2 A;  3BS7 A;  4Z6D A;  3M8R A;  1JXL A;  1Q78 A;  1L6N A;  4ELU A;  4J9M A;  4ECR A;  3EYZ A;  9ICT A;  4EEK A;  4DSL A;  5JTG A;  3RJG A;  8ICG A;  5HRK A;  4B9N A;  1XSP A;  1X6J A;  4IRD A;  1BNP A;  2MRL A;  4B9V A;  5DED A;  3TAR A;  4F93 B;  1S0M A;  2VIX A;  4YXJ A;  5KT7 A;  2W03 A;  4Q8F A;  5CFT A;  5KFV A;  1DOQ A;  1RQN A;  2E8N A;  3C21 A;  5AI4 A;  2HOI A;  4NY8 A;  4A8E A;  1UCV A;  3NWI A;  1N48 A;  3PW4 A;  1OUQ A;  2K89 A;  4J9Q A;  1N56 A;  3V7K A;  4NL9 C;  5CWR A;  2G09 A;  1RYR A;  1L5U A;  2EDU A;  1KSP A;  1COO A;  4O5C A;  2ZUD A;  3L9D A;  4K4I A;  5ALG A;  2ZH6 A;  4YD1 A;  1SKW A;  2ESE A;  1PK1 A;  5DB7 A;  4ED0 A;  3F2D A;  4TUS A;  4RNM A;  2F2A B;  5F9L A;  2HN1 A;  4X4P A;  5KFR A;  1BPD A;  7ICK A;  4GXJ A;  8ICT A;  3EPG A;  3I1Y A;  2H5X A;  2RFF A;  2R8K A;  2GA9 D;  4F4K A;  1D8L A;  2QAR A;  3OUY A;  1SL2 A;  4DFD A;  2LYB A;  1RM6 C;  5AKX A;  1T4G A;  1X6I A;  4XQ7 A;  4Y2U A;  3D2Q A;  4UAW A;  4GXK A;  4ELV A;  4KLI A;  1HJP A;  1N5W A;  3NTU A;  2IHO A;  2QB1 A;  4WC7 A;  2YML A;  4UAU A;  9ICK A;  5C0Y A;  8ICO A;  4RWQ A;  2WB1 C;  3H3A A;  2JEI A;  1XO1 A; 
#chains in the Genus database with same CATH homology
 4C8N A;  1ZQN A;  3BQ0 A;  2J6S A;  8ICJ A;  2KZZ A;  1FA0 A;  1T8E A;  1Y88 A;  3GDX A;  1EXN A;  2XO7 A;  2VA2 A;  4F8R A;  7ICU A;  1D8Y A;  5J2J A;  2M2T A;  4E7X A;  5HML A;  3TFS A;  2PXI A;  5DQH A;  3LQC B;  3M8S A;  1U4B A;  3ZD9 A;  3OSP A;  1SZP A;  2BKE A;  4O3R A;  9ICP A;  2R8I A;  3TAN A;  5KFP A;  3BQ1 A;  1MQ3 A;  4NXZ A;  2P66 A;  1U45 A;  2NRK A;  4X4O A;  5KFG A;  9ICS A;  5DLG A;  4QW8 A;  2PBE A;  1ZQP A;  3Q8L A;  4X0A A;  4ED3 A;  4DFJ A;  4TQR A;  4JV0 A;  3QE9 Y;  4KLM A;  4PGQ A;  4BGD A;  3GFK B;  4I2E A;  2AU0 A;  1ZQO A;  2R8H A;  2C2E A;  1ZQA A;  3ZDC A;  2XY5 A;  4E0D A;  4WBY A;  4RQ2 A;  3TAQ A;  4WC6 A;  4YN4 A;  3T5H A;  2UVU A;  3OUY B;  1TV9 A;  9ICN A;  2M9N A;  4DL4 A;  3AQM A;  2DFL A;  4DSK A;  5J0T A;  3SYZ A;  1ZQJ A;  3Q8Q B;  5KT5 A;  4DFM A;  4PHA A;  3AU6 A;  3C2M A;  2LYH A;  2BDP A;  1K1Q A;  2JEF A;  3C18 A;  1MC8 A;  4F2R A;  3UQ2 A;  5IIK A;  4J9P A;  4B9T A;  2AQ0 A;  4KLO A;  2RDJ A;  2DPI A;  1U48 A;  1S0V A;  3ISD A;  1MIV A;  4RT3 A;  4KLJ A;  2ZH1 A;  3RB3 A;  5KFD A;  3PR4 A;  8ICR A;  5J0Y A;  4ATB A;  1OU5 A;  2V4Q A;  4DSJ A;  4RZR A;  4EBE A;  2OWO A;  2FLP A;  8ICA A;  1WOT A;  2XY7 A;  9ICQ A;  5CJ7 A;  2UVW A;  3N4M B;  2W9B A;  3GII A;  5J2K A;  4J9S A;  4MEX A;  2HHQ A;  4YP3 A;  4YMM A;  3UXO A;  4DOB A;  1XC9 A;  4F2S A;  4MF2 A;  4M04 A;  1V4A A;  4I2D A;  2ZTD A;  5KG3 A;  4C8O A;  4MFC A;  1KFT A;  4RWP A;  2W9C B;  5HMM A;  1ZQK A;  9ICH A;  2O1P A;  1XWL A;  3GV8 B;  5CP2 A;  4F5O A;  3PVX A;  8ICI A;  4PPX A;  4EBK A;  4NLK A;  3HJ4 A;  4ED1 A;  5KFC A;  1BPY A;  4FH5 A;  3JPQ A;  5DGB A;  3Q8P B;  3RH4 A;  5KFL A;  5KFA A;  4RQ6 A;  2XGP A;  3ISC A;  1ZQC A;  3UXP A;  3SI8 A;  1YLQ A;  1ZQE A;  2IBK A;  4EZ9 A;  4JWN A;  5J0W A;  5KFX A;  5KFU A;  2Y1J A;  2BCU A;  4RUA A;  2P6R A;  2HHP A;  5HP4 A;  2FPL A;  1NK6 A;  1MQ2 A;  4R63 A;  2WTF A;  3Q8M A;  4PHD A;  4YMN A;  1Q79 A;  8ICQ A;  3QZ8 A;  4GC6 A;  4EBC A;  4DL3 A;  1UA1 A;  1TK0 A;  3ZD8 A;  5F9N A;  5L1I A;  1QSS A;  4KN7 A;  1Z00 A;  3ZDA A;  4M5D A;  4NM2 A;  4RQ7 A;  2ZH8 A;  4P4O A;  4UAY A;  5L1L A;  1PZN A;  2JEJ A;  4DFK A;  3JPN A;  1NK4 A;  4FHV A;  1S0O A;  5KT3 A;  4O0I A;  1NJW A;  9ICX A;  4DQS A;  4ED6 A;  4X4T A;  3OVA A;  4QWD A;  5HRB A;  4KMU A;  1JMS A;  2VA8 A;  4RWQ A;  4TUQ A;  3FYH A;  4O5K A;  1XS9 D;  4KLH A;  3PR5 B;  2O5A A;  3BQ2 A;  4IQW A;  4QZE A;  1ZQU A;  4ATB B;  4ECU A;  5HRL A;  3H40 A;  1ZQI A;  4M2Y A;  4RQ1 A;  3C2K A;  7ICN A;  4M9J A;  2XY6 A;  1MIY A;  2W9M A;  1NZP A;  2C22 A;  2W9B B;  4DOC A;  5DLF A;  4EEY A;  4IRK A;  4QZI A;  4GC7 A;  4JV1 A;  9ICM A;  5J0O A;  2FMS A;  1D9F A;  1ZQT A;  7ICG A;  2F1J A;  3KHH A;  5KFK A;  4F50 A;  2C2R A;  4J9N A;  3LWL A;  1PX5 A;  5D46 A;  3HWT A;  4QWE A;  4PGX A;  3RTV A;  4X0B A;  2DR9 A;  5KFO A;  3RAX A;  8ICX A;  4X5V A;  4J9O A;  3MBY A;  5C5J A;  1ZQR A;  7ICT A;  4KIT B;  5L1K A;  2ISO A;  1DK3 A;  3OHA A;  1ZQL A;  5CB1 A;  4KN4 A;  3MAB A;  5HRH A;  3PMN A;  4KLE A;  8ICB A;  3M9O B;  4DL6 A;  1A77 A;  4TUP A;  4Z6F A;  4P2H A;  3PX4 A;  4RUC A;  4G3I A;  1QSY A;  4Q44 A;  4NKU A;  3ZDE A;  2PFP A;  4FS1 A;  5J0R A;  4QZ8 A;  2ALZ A;  3UQ0 A;  2W8L A;  4IG8 A;  3PO5 A;  2M2W A;  5J0Q A;  4KLS A;  1JQR A;  3WFO A;  3QEA Z;  4LZG A;  4R8U B;  4I2A A;  4KTQ A;  5HRF A;  4QWA A;  4NLN A;  3PX6 A;  1Z00 B;  9ICJ A;  3PML A;  4X4V A;  2A1J A;  4JWM A;  3SV3 A;  4EYI B;  4UQG A;  5IIL A;  3AUO A;  4Q45 A;  4KLD A;  1R8A A;  5KT4 A;  5KG2 A;  1ZQZ A;  3JPO A;  3PY8 A;  3H4B A;  4ECT A;  5HRE A;  4FHX A;  5J2F A;  3B0Y A;  3LWM A;  4O3P A;  4DOA A;  3WFQ E;  5BPC A;  4MFA A;  5CHG A;  4FHW A;  1B22 A;  3OV7 A;  4ECY A;  4YR2 A;  1ZQQ A;  1KLN A;  5J2G A;  3SV4 A;  3C1Y A;  4UB5 A;  1SKR A;  4FBT A;  4RQ8 A;  1UT8 A;  3M9N B;  5HC9 A;  4R65 A;  5J29 A;  3V7L A;  4F3O A;  1JXE A;  1TAQ A;  2ZH2 A;  4K4H A;  3MGH A;  1IM4 A;  2C2D A;  3UPQ A;  4C8M A;  4QZC A;  3ZDD A;  5J0X A;  4WC0 A;  7ICF A;  3Q8K A;  3PW5 A;  2ASJ A;  4TUR A;  4M6W A;  3RJK A;  2HHW A;  7ICE A;  5DEC A;  5KG1 A;  2ZUB A;  3IM1 A;  1B43 A;  3HW8 A;  1U49 A;  4PHP A;  2XGQ A;  1DK2 A;  3C66 A;  3ZDB A;  4UD5 A;  7ICV A;  4IQT A;  3MR2 A;  2ZJA A;  4DQQ A;  3PW0 A;  2HHV A;  9ICR A;  4KLQ A;  4UB1 A;  9ICI A;  2DR5 A;  4MF8 A;  4QZH A;  2AGP A;  2BQU A;  2RDI A;  3NYB A;  4DL2 A;  2ATL A;  1QLN A;  3C5G A;  4P4M A;  2MUT A;  2NRX A;  2ZH4 A;  3H8S A;  5TZV A;  4RU9 A;  4YR3 A;  3PO4 A;  1X2I A;  4F5Q A;  2A1J B;  3GIM A;  1NO5 A;  3GV5 B;  3GQC A;  3HX0 A;  3HPO A;  7ICR A;  4LT6 A;  3GIK A;  3KHL A;  4RQ3 A;  4J9K A;  7ICS A;  3HIY A;  3WFP A;  4AT9 B;  1U47 A;  9ICO A;  1ARO P;  4UB3 A;  8ICZ A;  2BQ3 A;  4AT7 A;  2NRV A;  4DF4 A;  2PFO A;  2HW3 A;  2R8G A;  3RJI A;  4M47 A;  3ISB A;  4E8F A;  7ICH A;  2ZHA A;  4M9L A;  1Z3E B;  4NM1 A;  1BGX T;  8ICM A;  5HR9 A;  4F5R A;  4F4Y A;  1SL0 A;  3UPS A;  4UBB A;  2Q0Z X;  3H7I A;  5KFF A;  3T5K A;  5DQI A;  2ID1 A;  3OVB A;  2F1I A;  2FPM A;  1RYS A;  4I29 A;  3GIJ A;  1X9S A;  1S97 A;  5DDY A;  5HHH A;  1NKE A;  1KRP A;  5KG4 A;  5J2B A;  5CR0 A;  9ICU A;  1KFD A;  1RXV A;  3HJ1 A;  5DG7 A;  4RQ0 A;  1RPL A;  4FHY A;  1ZQD A;  3C2L A;  2XCP A;  3MR5 A;  2IHN A;  4NKT A;  4WBZ A;  4FHP A;  1UEU A;  4M6W B;  4UAZ A;  4Q43 A;  1RXW A;  4BXO A;  8ICH A;  2BPC A;  8ICW A;  1R8C A;  4WCW A;  4ECQ A;  5DGA A;  3KHG A;  5DQG A;  4RPZ A;  2BCR A;  5KFY A;  1X9M A;  5KT6 A;  1S10 A;  2ZH7 A;  3K75 D;  2PFQ A;  4KLL A;  1DGS A;  3SZ2 A;  2B21 A;  4DSE A;  5EWF A;  3MR6 A;  4O3Q A;  3G6V A;  1UA0 A;  1HUZ A;  5IIM A;  4DLE A;  3H8J A;  5KG6 A;  2V4R A;  4RT2 A;  5IIN A;  2BCS A;  2DR8 A;  3H4D A;  2AQ4 A;  4DSF A;  4E80 A;  1TFY A;  3JZ0 A;  2MUT B;  3BJY A;  4CCH A;  1S77 D;  1VJ7 A;  3AQK A;  4Z6E A;  1NK8 A;  4K4G A;  3T3F A;  2XC9 A;  5DBB A;  1R8B A;  4QZ9 A;  1NK5 A;  2FMQ A;  1T7P A;  1NKB A;  4X4S A;  5IIO A;  2HHX A;  4I2G A;  4B9M A;  3E2E A;  4WC4 A;  1BVS A;  3B0X A;  3ORY A;  3MGI A;  3RB0 A;  2BCV A;  4JV2 A;  2NRT A;  4F4W A;  2C28 A;  2AGO A;  4I27 A;  4XA5 A;  5BOM A;  3AQN A;  2PI5 A;  3JPT A;  9ICV A;  2M2U A;  4JK1 A;  5KG7 A;  3TFR A;  4GXI A;  1JIH A;  4JUZ A;  5D49 A;  4QZA A;  4QW9 A;  2I1Q A;  4QWB A;  3GIL A;  5D4B A;  2BPF A;  5KFI A;  4IQV A;  2JEG A;  2DRA A;  1QSL A;  2AJQ A;  4R64 A;  4DLG A;  4DWI A;  4O3N A;  1ZQH A;  1BNO A;  4YR0 A;  3OGU A;  4YCX A;  4RPX A;  2DPJ A;  2FMP A;  4IR1 A;  7ICM A;  1TFR A;  9ICG A;  1K1S A;  3OSN A;  4QWC A;  3JPR A;  3LK9 A;  3MDC A;  5DBA A;  4BXO B;  4X4N A;  3TI0 A;  4UBC A;  5HNK A;  5EOZ A;  5J2E A;  2KZ3 A;  9ICW A;  4X4R A;  2ZHB A;  3OVS A;  1ZQF A;  2DVI A;  1ZQS A;  1CEZ A;  2ZTE A;  1ZQW A;  5DBC A;  9ICF A;  3MDA A;  4I2F A;  2KFN A;  5KFE A;  4UB4 A;  4KLU A;  3V6K A;  4MEY A;  5J2D A;  3MR3 A;  2V9W A;  4DO9 A;  3V6J A;  3RJF A;  2BCQ A;  5HRD A;  1BPX A;  2J6T A;  4I2B A;  8ICU A;  5J2I A;  1NK9 A;  3RBE A;  5J0U A;  1L3U A;  4ED2 A;  5DB9 A;  7ICJ A;  2Y1I A;  2P6U A;  1BPZ A;  4FH3 A;  4C8L A;  4AT7 B;  2FLL A;  1NJX A;  2ZUC A;  3KTQ A;  5KFJ A;  3RAQ A;  4YMO A;  2NRZ A;  4EBJ A;  1ZET A;  4DL7 A;  4PGY A;  8ICS A;  5J2H A;  5J2A A;  3THV A;  4QZB A;  1D9D A;  4DF8 A;  5KFW A;  1ZJN A;  3ETL A;  5DKW A;  1JX4 A;  4B9L A;  2XCA A;  2PFN A;  3WFR E;  7ICQ A;  5HRG A;  5EWG A;  5JUM A;  4F5P A;  1NJY A;  3C5F A;  4R66 A;  4M9H A;  5KFM A;  4EZ6 A;  2MAX A;  4BWM A;  3QZ7 A;  8ICY A;  5EWE A;  1NK0 A;  9ICE A;  2KP7 A;  4Z6C A;  1R89 A;  3JYY A;  2DR7 A;  3RH6 A;  1KEJ A;  1TK5 A;  4DQP A;  1KNY A;  1SKS A;  4O9M A;  4RNO A;  4ECZ A;  3EWA A;  2PI4 A;  2KZM A;  2IMW P;  4HYK A;  4XUS A;  1WCL A;  3PW7 A;  3K4G A;  1X9W A;  4YXM A;  4QZD A;  4UD4 A;  4WC2 A;  3AU2 A;  1QTM A;  4ED7 A;  1U9L A;  1BPE A;  3H39 A;  3KHR A;  3HP6 A;  3FDS A;  4F4X A;  1ZQX A;  2ASD A;  3C1Z A;  3H37 A;  4XQ8 A;  8ICL A;  2BGW A;  1TVA A;  4I2J A;  2W9C A;  3RJE A;  5KFZ A;  3RJH A;  5HHI A;  3IHQ B;  3AQL A;  4UB2 A;  3OHB A;  4LVS A;  4I2H A;  4ECV A;  1S9F A;  2GWS A;  3G6X A;  3RB4 A;  4MFF A;  4O3S A;  4YFK A;  4YD2 A;  8ICK A;  1TK8 A;  1V9P A;  5DB6 A;  4DQR A;  1UET A;  4EYH B;  1LB2 B;  5L1J A;  1KTQ A;  2BHN A;  4F92 B;  4M0A A;  5DG9 A;  4J9R A;  1ZQV A;  4XRH A;  4KLF A;  1TAU A;  1UT5 A;  3T5J A;  2BQR A;  4RPY A;  7ICI A;  5L9X A;  5KFN A;  2VAN A;  4KLT A;  4I2I A;  1KDH A;  4YG2 A;  4QZF A;  4Z6D A;  5KT2 A;  1UEV A;  1ZQM A;  3Q8S B;  3H8W A;  3JPS A;  1NJZ A;  3M8R A;  1JXL A;  1Q78 A;  4ED8 A;  4DFP A;  4F91 B;  3RRG A;  5IIJ A;  3OJU A;  4F4Z A;  9ICB A;  3RR8 A;  1ZJM A;  4ELU A;  2HVI A;  4J9M A;  2F1H A;  4ECR A;  3T5L A;  3MFI A;  1H38 A;  4M9G A;  3EYZ A;  2ZJ5 A;  4ZH4 A;  4WC5 A;  4ECW A;  4X4Q A;  9ICT A;  2FLN A;  9ICC A;  3PW2 A;  4X4U A;  4GLX A;  4DSL A;  1NOM A;  3RJG A;  8ICG A;  3JPP A;  5HRK A;  4B9N A;  4ECS A;  1A76 A;  2NRW A;  3BDP A;  1XSP A;  3H38 A;  8ICV A;  2J6U A;  1F5A A;  2M2V A;  4IR9 A;  1XSL A;  3V72 A;  2ZH9 A;  3UXN A;  4LZD A;  4IRD A;  1ZQY A;  4I2C A;  4B9V A;  3TQ1 A;  3OJS A;  4EBD A;  1BNP A;  4BWJ A;  5DED A;  3TAR A;  4F93 B;  8ICC A;  1S0M A;  2HHS A;  4YXJ A;  5BOL A;  3RRH A;  5KT7 A;  4ECX A;  5KFB A;  1RZT A;  3PNC A;  4YVZ A;  1XSN A;  4Q8F A;  3RR7 A;  2R8J A;  1JAJ A;  4DEZ A;  4IQU A;  5KFV A;  1ZQB A;  2BPG A;  7ICO A;  1DOQ A;  3MFH A;  4AT8 A;  4FBU A;  4M9N A;  1NK7 A;  4BDP A;  1TFW A;  3C21 A;  4EP7 A;  4RQ4 A;  2IHM A;  3N97 B;  5KFT A;  7ICL A;  1IXR A;  4WC1 A;  2W8K A;  1L3V A;  4NY8 A;  2JZB A;  3EW9 A;  4TQS A;  4R8U A;  1LV5 A;  5F2V O;  2ASL A;  4KLG A;  3C23 A;  5KG0 A;  5J0P A;  4NLG A;  1XU4 A;  4F5N A;  1N48 A;  3PW4 A;  2BR0 A;  4C8K A;  4WC3 A;  1NKC A;  4J9Q A;  2ZH3 A;  1N56 A;  4O3O A;  5KFH A;  3V7K A;  5CWR A;  1S76 D;  2UVV A;  3WFS C;  5J2C A;  1RYR A;  4Q8E A;  1MIW A;  5DDM A;  1L5U A;  8ICP A;  2KFZ A;  5CA7 A;  8ICF A;  1VFG A;  1KSP A;  1COO A;  3BQT A;  2ZUD A;  4P4P A;  4ELT A;  4O5C A;  4K4I A;  3L9D A;  4FO6 A;  4B9S A;  1C7Y A;  5KFS A;  2ZH6 A;  7ICP A;  4YD1 A;  4DS4 A;  1SKW A;  2ZJ8 A;  4FS2 A;  4DS5 A;  9ICA A;  2KN7 A;  2DRB A;  5III A;  5DB7 A;  4YQW A;  4ED0 A;  3V7J A;  3EZ5 A;  2I9G A;  2HHT A;  4S3N A;  3PV8 A;  4IRC A;  2KTQ A;  4TUS A;  2IA6 A;  3Q8R B;  9ICL A;  4RNM A;  2W9A A;  5F9L A;  3RBD A;  5KTQ A;  4X4P A;  2ISP A;  3G6Y A;  2HHU A;  5KFR A;  1KFS A;  1BPD A;  1ZQG A;  7ICK A;  4DQI A;  4RWO A;  4GXJ A;  8ICT A;  2ZH5 A;  2Q66 A;  3PX0 A;  1BPB A;  3EPG A;  4RWN A;  2H5X A;  2RFF A;  2R8K A;  5DG8 A;  2HVH A;  3TAP A;  1SL1 A;  4F4K A;  5J0S A;  1D8L A;  2ZTC A;  1JN3 A;  5KG5 A;  4J9L A;  1HUO A;  4DSI A;  4AT8 B;  4PH5 A;  3RB6 A;  1SL2 A;  4RQ5 A;  2UVR A;  3OUY A;  4O5E A;  4NLZ A;  1WCN A;  1T4G A;  8ICN A;  3LDA A;  4RNN A;  3EPI A;  2VA3 A;  4XQ7 A;  2FPK A;  3RJJ A;  1CUK A;  2JZB B;  4UAW A;  4DL5 A;  4GXK A;  4ELV A;  4I28 A;  4KLI A;  1HJP A;  3NTU A;  3V6H A;  4WC7 A;  3M9M B;  1T3N A;  1S0N A;  1L3T A;  5KFQ A;  5DB8 A;  4QZG A;  2AGQ A;  1TKD A;  4B9U A;  1MSW D;  9ICK A;  1L3S A;  5HRI A;  4AT9 A;  3GV7 B;  3HT3 A;  4PHE A;  3RH5 A;  3NGD A;  8ICO A;  2BE3 A;  2JEI A;  1XO1 A;  3QEB Z;  3H3A A;  8ICE A;  1ZYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...