4M9LA

Dna polymerase beta e295k soaked with dctp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
326
structure length
313
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPVAGEPLPVSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 107
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9lA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9lA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9lA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9lA03
1AROP 4RT2A 3PVXA 2FLPA 1BPEA 3H4DA 4PGYA 4F4XA 4GC7A 4ED3A 1NJYA 1TKDA 2V4RA 1T7PA 1JAJA 4RQ7A 4O3PA 3HIYA 3PV8A 5KTQA 4F5OA 8ICSA 2PBEA 4RU9A 2W9AA 4JV2A 3TI0A 3JPSA 1XC9A 3PY8A 3G6VA 5J2DA 1MSWD 5F2VO 2BCQA 3JPNA 5L1KA 3OGUA 4EYIB 4G3IA 1S10A 3M8SA 3C5GA 1XO1A 2M2TA 1NKCA 2KN7A 4J9MA 1BPBA 4QZDA 1FA0A 2W8LA 2AQ0A 3C2LA 4FS2A 1UT5A 1QSLA 4DSJA 4KLEA 5IIKA 2XY5A 3SV3A 4EYHB 4K4IA 4UQGA 3PX6A 2PFOA 4P4OA 1H38A 2R8KA 3RJFA 2O5AA 4UAWA 4ELTA 2ZUDA 1S97A 3BDPA 1MIVA 2DVIA 3GV8B 3TAQA 4KLGA 4ED8A 9ICKA 5DDMA 3BQ1A 1KSPA 1ZQWA 2NRZA 5DBAA 3ISCA 5HRGA 1F5AA 2NRKA 3M9NB 2BQUA 2O1PA 4QZAA 5J2IA 3OVAA 8ICJA 3JPTA 3MBYA 5HRIA 2C22A 4DL7A 3GQCA 3H8WA 2ZHAA 5KFDA 5DDYA 3MGIA 4YP3A 2BQRA 2ZH2A 4I2IA 5L1IA 4TURA 5J29A 7ICQA 4PGQA 4F5PA 2FPMA 3RJKA 5J0YA 8ICQA 4DSEA 5KT7A 3Q8PB 3BJYA 1U48A 1NK6A 9ICQA 1NK0A 1ZYQA 4C8MA 1D8LA 2FMQA 2KFNA 4X4VA 3KHHA 1ZQNA 4ED0A 4M9LA 4ED7A 1DOQA 1QSSA 2FLLA 1RPLA 4RQ8A 4DLEA 9ICLA 4WC7A 1C7YA 7ICTA 3GV7B 3GIKA 3KHLA 2M2WA 1Q79A 4F92B 4DOCA 3L9DA 1RZTA 2ZH9A 5EWFA 2ZTEA 5CP2A 4QZEA 5CWRA 2BR0A 4F4KA 8ICTA 4F91B 1ZQOA 7ICMA 4UD4A 1JXEA 4KLQA 5F9NA 3HJ4A 4O3NA 4Q44A 4ECQA 1ZQRA 5J0RA 2BHNA 8ICKA 4B9MA 5IIOA 5J2GA 2R8HA 2BGWA 5D46A 4ECYA 2XCPA 1T8EA 5HMLA 3RAXA 4XRHA 4UB5A 3MFIA 2BCRA 4AT7A 4RWOA 5HP4A 2Q66A 2PI4A 4DSLA 8ICNA 4EEYA 9ICMA 5KFUA 4XUSA 4RQ4A 4PGXA 3Q8MA 1TV9A 4I29A 1NZPA 2AGPA 1R8BA 1NK7A 2KZMA 2DR7A 3RR7A 1TK8A 1ZQKA 3B0YA 4KLUA 2PFQA 1B43A 5J2FA 1S77D 1HUOA 2M9NA 1BVSA 1IM4A 1X9MA 3UQ0A 2IA6A 4I28A 4O5KA 4EP7A 3MR5A 2XO7A 4E8FA 2VANA 7ICVA 1JIHA 9ICTA 5J0UA 4UB3A 2P66A 9ICUA 3PR4A 4J9RA 9ICVA 4O0IA 1ZQPA 1ZQSA 4DOBA 3QZ8A 5KFBA 1U45A 4KLSA 1CEZA 4MFCA 5KFHA 4RWPA 5KFTA 2HHSA 5C5JA 8ICLA 1TFRA 4FH3A 4O3OA 3ZDEA 8ICEA 8ICHA 8ICCA 1U49A 2HHUA 4ED6A 4YN4A 5KFRA 3HWTA 3RB3A 1OU5A 5CA7A 5DGAA 2F1HA 2J6TA 2BE3A 8ICAA 4DFKA 4FBTA 4DSKA 4LZDA 4RNOA 3PMNA 1NKEA 3C2KA 3ZDAA 2MUTB 8ICRA 5DB8A 1SKSA 4EBEA 9ICBA 1JMSA 4PHAA 1D9FA 8ICUA 2XGQA 3V7LA 4J9OA 9ICPA 2KZ3A 4KMUA 1Q78A 4NKUA 1KDHA 1BPXA 4UB4A 4I2GA 3N4MB 1TFYA 3GV5B 2I9GA 5BOLA 3PNCA 1Y88A 4PHPA 5KFNA 3EPGA 2AQ4A 1XSLA 2ASJA 2RFFA 4KLIA 4ELVA 2BDPA 4ECZA 1X2IA 4FBUA 4FHVA 4WBZA 8ICWA 1BNOA 3M9OB 8ICFA 2IHMA 4P4PA 5HRFA 2MUTA 4GXKA 4S3NA 2P6UA 5KG0A 5KG7A 5J2JA 4F3OA 4AT8A 2UVUA 4IQTA 4IQUA 1L3VA 5IINA 3RJIA 3PX4A 4R63A 2RDJA 3PO4A 3ZDDA 4Q8EA 3K4GA 4IG8A 3T5JA 1TK5A 2IHNA 1NK9A 1QLNA 4QZIA 4KLFA 4DEZA 4R8UB 4M9HA 1S0MA 3MGHA 1XWLA 4UBBA 5KFLA 1ZQGA 4KLDA 4M9JA 2J6UA 3RBDA 4FS1A 2DR9A 1L3TA 2B21A 3RJHA 5DECA 2ZH6A 3OJUA 4KLHA 3HJ1A 3H38A 1ZQUA 4Q45A 1ZQZA 1XSPA 2WTFA 4F8RA 4DF4A 1S9FA 8ICYA 5HHHA 9ICHA 3H3AA 1A77A 4UAZA 2VA8A 4RQ5A 4KLTA 4RPZA 1QTMA 4NXZA 5KFXA 4J9QA 4F5RA 2ALZA 1UA1A 1JXLA 4YD2A 2HHXA 4X4SA 4R8UA 1BPYA 5KG5A 1KRPA 5JUMA 4RQ1A 3EW9A 4UBCA 5L1JA 5TZVA 4I2DA 4ED2A 1R89A 2JZBB 3WFOA 2Y1IA 4EBCA 3KHRA 4Q8FA 4KN7A 4B9VA 4PPXA 2FPLA 1WCNA 4I2JA 3RTVA 5CR0A 3ISDA 5J0PA 3PW4A 2AGOA 5DLGA 3TFRA 3V7KA 3H8SA 4YVZA 5KFEA 3HPOA 4DQQA 4O3RA 3SI8A 3ZDCA 4B9TA 1NKBA 4LZGA 7ICSA 3AQMA 5J2AA 1SL1A 4IQVA 4YR2A 4R64A 2KFZA 1WOTA 1NO5A 1S76D 4WBYA 4TQSA 5KFOA 4MFFA 4QWCA 4X4PA 1MC8A 2JZBA 3MFHA 2ZH7A 2DPIA 4WC6A 1UA0A 1Z3EB 9ICCA 9ICWA 2ZJAA 3FDSA 4FHXA 5HRBA 4JWNA 1ZQVA 8ICVA 2UVVA 4RQ0A 1ZQEA 4Q43A 2HHWA 4IRCA 4FH5A 5DQGA 2BKEA 5KFYA 3PR5B 1TFWA 1A76A 4MF8A 4RQ2A 4MEXA 4DOAA 1WCLA 2DFLA 9ICRA 4B9LA 1KLNA 4TQRA 3T5HA 2FPKA 3T3FA 4C8OA 2HVIA 2HHQA 1X9WA 3RH5A 5KG4A 3GFKB 4DWIA 2KP7A 9ICJA 4E80A 5KT4A 3RBEA 4M5DA 4YXMA 1CUKA 5KFPA 2H5XA 2XC9A 3T5LA 4M9GA 9ICIA 5DG9A 2F1IA 3UPQA 2BCUA 4KLJA 3JZ0A 1L3UA 4TUQA 2C28A 1SL0A 3H7IA 3NGDA 5HRKA 3G6YA 8ICMA 4GC6A 7ICPA 3OUYB 3QEAZ 1PZNA 3MABA 3AU6A 1TAQA 1X9SA 5CB1A 2JEGA 7ICHA 4X4RA 5DKWA 4F4YA 8ICGA 2M2VA 1JX4A 1ZQQA 2HW3A 3MDCA 1R8AA 1NK8A 2HHPA 4E7XA 5KFCA 2W8KA 1TK0A 2FLNA 4MEYA 4GXJA 3OVSA 3Q8QB 3THVA 2UVWA 1ZQTA 5KT5A 3HP6A 3M8RA 3RB4A 2IBKA 4WC3A 1K1SA 5KFWA 4NY8A 2ISOA 3OHAA 3TANA 1S0NA 3B0XA 1NK5A 4M9NA 7ICOA 5J0TA 3TQ1A 4DO9A 1RXVA 4DSIA 1BNPA 1HJPA 3C18A 4C8NA 1K1QA 4J9KA 7ICIA 3OUYA 2W9CB 4GLXA 1RYRA 5KT3A 4QZHA 4KN4A 4I2BA 3JPRA 5HC9A 4IR9A 7ICNA 4EBJA 1DGSA 4RQ3A 5DLFA 4PH5A 4F93B 4YFKA 4RPXA 4YQWA 4QW9A 3QZ7A 5KFAA 3OSNA 5IIMA 3Q8KA 2C2DA 4E0DA 4M04A 4O5CA 4KLOA 2PXIA 3C5FA 1D9DA 7ICGA 5HRLA 4QWBA 4EZ6A 5J2CA 5KG6A 4TUPA 3MR3A 4FHPA 5KG1A 4HYKA 5EWGA 2ZTDA 4Z6CA 3M9MB 3LDAA 4YCXA 2ZTCA 4PHDA 3UXPA 3QEBZ 1ZQAA 3C1ZA 3ISBA 3V6KA 4BWMA 5KFGA 4R65A 3RRHA 1QSYA 4M0AA 3AQKA 3JPQA 1N56A 2W9CA 1BGXT 3EWAA 4P4MA 4O9MA 2HHVA 9ICOA 1PX5A 5KG3A 3RRGA 4KLLA 3KTQA 3PX0A 3JYYA 4RNNA 4NLGA 4J9LA 4IRKA 2ISPA 4ATBB 3EYZA 3SV4A 5HNKA 2P6RA 4ZH4A 4DSFA 4I2EA 8ICPA 2W9MA 4QZ8A 3C23A 1U4BA 5DQIA 3AU2A 4NM2A 3PW2A 3TAPA 7ICLA 5BOMA 4IRDA 3HX0A 3BQ0A 4O3SA 9ICNA 1MQ3A 4WC1A 4YD1A 2BCVA 4X4OA 3TFSA 3AUOA 3PW7A 4X0AA 1V9PA 4X5VA 3GDXA 3FYHA 3OSPA 4JV0A 5IILA 3EPIA 2ZH1A 4RZRA 1SZPA 1U47A 4F2RA 3C66A 3UXOA 7ICFA 2AJQA 4NLNA 4DQPA 4ATBA 2KZZA 3WFRE 5KG2A 5L9XA 3MR2A 4NM1A 3AQNA 3T5KA 4BDPA 4YR0A 4MF2A 4LVSA 4F2SA 4I2AA 4YMMA 4BWJA 2R8GA 4P2HA 1JN3A 4BGDA 4RNMA 4I27A 2A1JB 4UD5A 3H40A 3H37A 3OVBA 4JV1A 4F4WA 4DL5A 2BPFA 5F9LA 1TAUA 5DB6A 4DQIA 4J9SA 4DL2A 3LQCB 4B9UA 4KTQA 4DF8A 1KFTA 1NJZA 4C8LA 3C2MA 3WFPA 1KEJA 2V4QA 3JPPA 4Z6FA 4WC2A 2NRWA 1MIYA 3SYZA 7ICUA 2MAXA 3PMLA 5D49A 4DFMA 4Z6EA 1Z00B 3ORYA 2A1JA 2XGPA 4FHYA 2M2UA 5BPCA 1UT8A 3V7JA 4C8KA 4X4UA 4YXJA 1ZQDA 5DGBA 1ZETA 2DR5A 4J9PA 4ECWA 2DPJA 4XQ7A 3PW5A 2ZUCA 2NRVA 5KT2A 4DL6A 1IXRA 4PHEA 2XY7A 3BQ2A 4K4HA 3V6HA 1RXWA 1U9LA 2VA3A 9ICXA 1UEVA 2ASLA 5L1LA 3PW0A 4DL3A 4NLZA 9ICGA 3Q8SB 4XA5A 3UPSA 2BQ3A 2NRTA 3HT3A 5KFJA 3OHBA 2R8IA 5J0WA 4QWDA 4ECRA 1Z00A 3RR8A 1RYSA 1UETA 1ZQYA 4QZBA 2W9BB 1ZQCA 5KFSA 1MIWA 3KHGA 2ASDA 1S0VA 3E2EA 3GIIA 4J9NA 1SKWA 4LT6A 1BPZA 2ATLA 4FO6A 5DG8A 1NJWA 4EZ9A 3IM1A 5KFZA 3Q8RB 3GIMA 4X4NA 1EXNA 4M2YA 2ZH8A 2DRBA 5J0SA 4RUAA 5DB9A 2ZUBA 3PO5A 4JK1A 3RB0A 5HREA 4F5QA 4I2FA 3LK9A 4QZCA 3SZ2A 1VJ7A 1HUZA 1L3SA 1SL2A 2DRAA 4M6WB 4F4ZA 4WC0A 2BCSA 1NOMA 1V4AA 5J2EA 1KFDA 7ICJA 4AT9B 1ZQBA 2W9BA 4EBKA 4O5EA 3GIJA 4F5NA 3ETLA 1XS9D 2IMWP 1B22A 5J2KA 9ICFA 1DK3A 4X0BA 9ICSA 5KFKA 1NK4A 1ZQHA 3NTUA 9ICEA 4R66A 2GWSA 5KFFA 4RUCA 1XU4A 5KFMA 4KITB 5KFQA 2PFNA 5J0QA 9ICAA 1LV5A 4O3QA 3C1YA 3ZD9A 1ZQIA 4QZFA 4GXIA 2VA2A 4YMNA 4M6WA 4RT3A 2XY6A 3JPOA 1XSNA 1ZQFA 4ELUA 4QWAA 4AT9A 2Q0ZX 4ECUA 3IHQB 1YLQA 4RWQA 5J0OA 3NYBA 4X4QA 2AU0A 3EZ5A 3K75D 2C2EA 5HHIA 4YG2A 4YMOA 8ICBA 5DQHA 5HR9A 8ICXA 4MFAA 8ICOA 4AT7B 3MDAA 4DFJA 3N97B 3OV7A 2ZJ8A 1ZJMA 2ZH5A 2JEJA 5IIIA 4QZGA 5EOZA 4JWMA 1NJXA 2XCAA 2NRXA 4JUZA 3MR6A 1KTQA 4UAYA 4ECXA 5DG7A 2J6SA 5DEDA 2ZH4A 2DR8A 2ID1A 4B9NA 2HHTA 5HMMA 5KT6A 2Y1JA 3C21A 4FHWA 1MQ2A 4Z6DA 3BQTA 1S0OA 4DQSA 2ZJ5A 4WC4A 2I1QA 2PFPA 4DS4A 2LYHA 1JQRA 1KFSA 4ED1A 1DK2A 3ZD8A 4RQ6A 8ICIA 4QZ9A 5CHGA 2PI5A 3RB6A 4DS5A 2UVRA 5J2BA 4B9SA 5CJ7A 4UB1A 2HVHA 1L5UA 3LWLA 1ZQJA 3RJJA 1BPDA 2FMPA 2OWOA 5HRDA 3AQLA 1VFGA 4ECVA 2KTQA 4I2HA 3HW8A 2F1JA 4ECSA 4M47A 4KLMA 1ZQLA 5DB7A 4DL4A 3RJGA 2JEFA 3V6JA 2RDIA 2R8JA 4RWNA 1KNYA 5DBBA 3GILA 4QW8A 4K4GA 5HRHA 3UXNA 3TARA 3Q8LA 1T3NA 4BXOB 4WCWA 2BPCA 5IIJA 3UQ2A 3RAQA 1TVAA 1ZQMA 5KFVA 2V9WA 4NKTA 5KFIA 8ICZA 1ZQXA 4ECTA 5DBCA 4RPYA 3RH4A 2FMSA 5EWEA 3H39A 4NLKA 4IR1A 2BPGA 4IQWA 5J0XA 7ICEA 3H8JA 4I2CA 3WFQE 4AT8B 3QE9Y 3WFSC 4WC5A 7ICRA 3H4BA 1D8YA 4EBDA 3RJEA 1LB2B 3G6XA 4DFPA 2JEIA 2ZH3A 5D4BA 1COOA 3RH6A 1UEUA 4DQRA 4X4TA 3V72A 1ZJNA 4QWEA 3ZDBA 2C2RA 4BXOA 4YR3A 1R8CA 2ZHBA 4UB2A 1SKRA 1T4GA 1N48A 4TUSA 7ICKA 2AGQA 4CCHA 4F50A 4XQ8A 3OJSA 5J2HA 4DLGA 3LWMA
chains in the Genus database with same CATH superfamily
2FLPA 2GAFD 2FJ6A 3CYMA 4PGYA 4GC7A 4ED3A 1NJYA 3WKDA 3PV8A 3ICXA 5KTQA 2PBEA 5ALIA 4RU9A 2W9AA 3JPSA 1XC9A 3PY8A 1MSWD 5F2VO 2F44A 3JPNA 5L1KA 3M8SA 1XO1A 1DXSA 2M2TA 3AEVA 2KN7A 2W8LA 5GTHU 5G5GA 4FS2A 4KLEA 3SMVA 2XY5A 4EYHB 4UQGA 3PX6A 3RJFA 3TAQA 3H0RB 5JTIA 3BQ1A 1KSPA 2O1PA 5DBAA 5HRGA 1F5AA 4QZAA 3NUQA 3H8WA 2ZHAA 2BQRA 3ALRA 2CPRA 5J29A 2PMZF 4DSEA 5AI4A 2G08A 4K8VA 2LKYA 2KEYA 2D8CA 2KFNA 4X4VA 4ED7A 1RPLA 4UATA 9ICLA 4WC7A 3GV7B 1ZOLA 2M2WA 1Z4OA 2G5HB 4KB6A 5EWFA 2E8PA 8ICTA 1F44A 3M7DA 4UD4A 2WF7A 2H3IA 3R9KA 4UAUA 5J0RA 2BHNA 8ICKA 4K96A 1T8EA 3RAXA 2PMZC 2BCRA 5AM5A 2Q66A 2PI4A 4DSLA 4EEYA 9ICMA 4XJEA 3IDWA 2KZMA 3RR7A 1ZQKA 2E3TA 3B0YA 1IM4A 1X9MA 3UQ0A 2ODGA 3L4PA 2XO7A 1N2XA 2P66A 1L6NA 1GO3F 2DRBA 5KFBA 1CEZA 4MFCA 4RWPA 1AQ6A 3SR6A 8ICLA 1TFRA 1J2MA 1U49A 3HWTA 1Z1VA 4DFKA 2K8BB 4DSKA 3PMNA 4LEZA 3C2KA 2MUTB 3L3FX 4KX3A 1SKSA 4EBEA 4QIWF 2OCEA 4KMUA 4NKUA 2DWQA 3GZFA 5AI6A 1TFYA 3GV5B 1Y88A 5KFNA 2RFFA 5FP0A 3AN1A 4FHVA 8ICFA 2MUTA 2P6UA 5KG7A 5J2JA 3KZIU 2G07A 1L3VA 4OJ6A 3TADA 2W55A 2EAMA 4IG8A 1TK5A 1NK9A 4DEZA 4M9HA 2DR9A 2B21A 5ALTA 1J97A 2ZH6A 3HJ1A 4BX9C 1ZQUA 1S9FA 1A77A 4RPZA 1QTMA 4NXZA 4J9QA 3F2CA 3PHZA 2OEHA 5L1JA 4I2DA 2KHQA 3KHRA 1XNSA 5DLGA 3V7KA 1Q8KA 4DQQA 2QKQA 5ALYA 5J2AA 1SL1A 2KFZA 1NO5A 5B66U 5KFOA 4MFFA 4QWCA 2ZH7A 3ONNA 4WQLA 5HRBA 4JWNA 8ICVA 2HHWA 2D6FC 4IRCA 3RF9A 3QU4A 4DOAA 4U7CA 1SIJA 1SV4A 1UPHA 1Q3UA 3SAHA 5B5EU 2A1AA 3T5HA 2HVIA 4C8OA 3D2NA 4K98A 2H5XA 4M9GA 5DG9A 4ICAA 5HR7A 4NXVA 3UPQA 4KLJA 3QX7A 1SL0A 3NGDA 4GC6A 2HW3A 4E7XA 3WKEA 2W8KA 4K9BA 3OVSA 3Q8QB 1WG8A 3HP6A 3M8RA 1K1SA 4NY8A 2ISOA 2IUBA 1RXVA 4DO9A 2W04A 1HJPA 5CFTA 1RYRA 1N61A 2KJ9A 2VKQA 4I2BA 2KJ8A 4O67A 4EBJA 4NXXA 2C2DA 4NKTA 5KFAA 4E0DA 4C7ZA 2PXIA 1D9DA 4QWBA 4Y2RA 3MR3A 5EWGA 2E8NA 2BBJA 3C1ZA 3RRHA 4GIBA 3UMCA 4P4MA 4WOYA 1JROA 5ALVA 4O9MA 4KLLA 1X6IA 4MKPA 4NLGA 5HNKA 2FCLA 5CFUA 3EF2A 3EUB2 3FAHA 4HAIA 3BQ0A 1X40A 1MQ3A 4WC1A 4YD1A 2BCVA 2B0CA 5IILA 3EPIA 2ZH1A 3C66A 1SZPA 2AJQA 4NM1A 3MR2A 4BDPA 4YR0A 2Y9UA 4P2HA 2R8GA 1SZHA 1NI3A 2A1JB 4Y2PA 1IIPA 4F4WA 2YMLA 3K1ZA 1TAUA 4DQIA 1KBUA 4B9UA 2RHFA 2NRWA 2GO7A 2AH5A 7ICUA 1PVRA 5AKKA 4LJXA 2A1JA 3K1RB 3V7JA 2HN1A 2M0NA 1ZQDA 2Z7JA 2E8OA 2XY7A 1IXRA 4PHEA 4K4HA 2EAPA 9ICXA 1UEVA 5L1LA 4NLZA 5T14A 2BQ3A 4QWDA 3KD3A 2ASDA 3E2EA 3GIIA 4LT6A 3BQ7A 1BPZA 2OM6A 2HBJA 1NJWA 4F71A 4FO1A 3IM1A 4HX0A 4X4NA 1EXNA 4KX5A 4M2YA 4NWIA 4CF3A 3RB0A 5B3QA 1TE2A 4EX6A 1SL2A 2DRAA 4Y2UA 2BCSA 1NOMA 4EBKA 4AT9B 1KFDA 3GIJA 1CI4A 9ICFA 3CW2C 5KFKA 1RDFA 3NTUA 9ICEA 5KFMA 1HIWA 2PFNA 1LV5A 4O3QA 5ALPA 4GXIA 2VA2A 4YMNA 4NJ8A 3JPOA 4AT9A 3IHQB 2HBLA 3NYBA 4X4QA 2AU0A 8ICBA 2LM4A 8ICXA 4DFJA 3OV7A 2WF8A 3IRUA 2JEJA 1NJXA 5DEDA 2J6SA 2DR8A 2E1FA 2QB0B 1L7OA 4CRXA 1ZD2P 4EENA 4WC4A 2I1QA 2LYHA 1QQ7A 1KFSA 2ZXHA 4QZ9A 4B9SA 1Q3VA 5HRDA 1BPDA 1FEZA 4BJQA 5AI8A 3VCBA 4ECSA 5AM0A 2KD1A 4FZLA 2RDIA 2QB0A 5HRHA 3Q8LA 4BXOB 5AICA 4USAA 5IIJA 3HRDD 3RAQA 1ZQMA 5KFVA 4K99A 5DBCA 2MA1A 5EWEA 4PZNA 1RQLA 2KG5A 3H4BA 1D8YA 4EBDA 1SV0A 3IG5A 2JEIA 1UEUA 4C80A 4BXOA 2KOBA 1Z4NA 4F50A 3OJSA 1U47A 3KZXA 3PVXA 3H4DA 1TKDA 1T7PA 2V4RA 4RQ7A 4O3PA 3QU7A 3IN5A 2DL0A 1VLBA 2KICA 1O08A 2XVTA 3QUQA 3DV9A 3C2LA 1QSLA 1UT5A 2O5AA 2HI0A 3F5AA 1SXEA 4UAWA 2ZUDA 2E8MA 3BDPA 1MIVA 1SWWA 2XI9A 2NRZA 5JU5A 2NRKA 2ZXIA 3M9NB 2BQUA 5J2IA 1VDVA 4CNQA 3MBYA 5AM2A 4DL7A 2ZH2A 5KFDA 1URJA 3D6JA 5DDYA 2ESEA 1P7DA 2XIDA 8ICQA 2FPMA 3RFAA 5J0YA 2DGZA 5KT7A 5AI5A 1NK0A 1ZYQA 1D8LA 2CXYA 3KHHA 4ED0A 3ETRA 1QSSA 2FLLA 4RQ8A 3BS7A 3KHLA 1RZTA 5CP2A 4QZEA 5J8YA 2BR0A 4NV0A 7ICMA 1JXEA 4KLQA 2EH9A 4Q44A 4ECQA 1ZQRA 1S5LU 3HKZC 5IIOA 5J2GA 2R8HA 2KJ5A 2XCPA 5HMLA 4XUSA 4RQ4A 4PGXA 3Q8MA 1TV9A 1PK3A 5F3XB 1NK7A 1D8BA 2DR7A 4K9AA 2PFQA 1B43A 1HUOA 1BVSA 4EP7A 3MR5A 2K60A 2NV3A 4US8A 3HILA 9ICUA 2W11A 1ZQSA 3QZ8A 1F0MA 5KFTA 2HBKA 5C5JA 1RQNA 4O3OA 3ZDEA 8ICCA 4YN4A 5KFRA 4P0PB 3RB3A 2FDRA 4JMUA 5CA7A 2J6TA 8ICAA 3S6JA 2OXOA 2YTUA 4LZDA 8ICRA 3WK4A 8ICUA 2XGQA 9ICPA 2KZ3A 1TAMA 2LYBA 1KDHA 1BPXA 3WK7A 1ZQ1C 4UB4A 4I2GA 4P0PA 5ALUA 2I9GA 4CF5A 1XSLA 4KLIA 2BDPA 1X2IA 4FBUA 1Z19A 3KKAA 4OO1J 8ICWA 5KL8B 2IHMA 4P4PA 5HRFA 4GXKA 2HN2A 4F3OA 4AT8A 2UVUA 2RDJA 3K4GA 1QLNA 4UAVA 4R8UB 1S0MA 4M9JA 1DGJA 3AM9A 4FZNA 2JMGA 2WTFA 4F8RA 4DF4A 4KLTA 2L5YA 5ALDA 5EE3A 4F5RA 2ALZA 4YD2A 4R8UA 5KG5A 5JUMA 5TZVA 2JZBB 3WFOA 2Y1IA 3ZI4A 4Q8FA 4KN7A 2FPLA 3N28A 3ISDA 2AGOA 3PW4A 3SAFA 4YVZA 5KFEA 4O3RA 4LZGA 2HDOA 7ICSA 1NKBA 3AQMA 3HJ4A 2I5HA 2F2AB 3SQIA 1NNLA 4U6PA 4TQSA 2A3VA 1MC8A 2JZBA 2KKPA 4WC6A 2ZJAA 3NRWA 1COKA 4O3MA 4RQ0A 1ZQEA 4Q43A 4C0ZA 4I0UA 4CDGA 3PR5B 1X42A 2F3NA 5ALLA 4RQ2A 1WCLA 9ICRA 1ZD5A 1PVPA 4TQRA 2HHQA 2YB1A 1UCVA 9ICJA 4M5DA 2XC9A 3MCRA 3SD7A 2BCUA 3NASA 3G6YA 8ICMA 4EEBA 1PZNA 3MABA 1X9SA 5DKWA 5JTGA 1QCKA 1ZQQA 5AKJA 1MN8A 1TK0A 2EANA 4WC3A 4FZMA 3OHAA 1S0NA 3B0XA 1NK5A 5J0TA 3TQ1A 5AIAA 4DSIA 3C18A 4QZHA 4RQ3A 5DLFA 4PH5A 4QW9A 4YFKA 8ICOA 8ICYA 4KLOA 7ICGA 4EZ6A 4TUPA 1O03A 3M9MB 2ZTDA 1ZQAA 3LDAA 4PHDA 4I28A 3V6KA 4M0AA 3EWAA 2VJ4A 4US9A 2HHVA 9ICOA 1PX5A 5KG3A 1XO0A 3RRGA 3KTQA 3PX0A 1B0XA 4J9LA 4ATBB 2IOFK 3SV4A 4ZH4A 5B3PA 2W9MA 3C23A 5DQIA 4NM2A 7ICLA 5CRXA 4O3SA 3TACB 4KM5A 3TFSA 1FFVA 2EQYA 4UB6U 4F2RA 4EV6A 3UXOA 7ICFA 2YY6A 4DQPA 4ATBA 3WFRE 5KG2A 2ZIUB 4MF2A 5AKIA 4F2SA 4BGDA 1K5OA 2OH2A 2A19A 4JV1A 4QIWC 5DB6A 4J9SA 2V4QA 2LI6A 3SYZA 2ZIUA 3ORYA 5BPCA 1UT8A 4X4UA 1RM6C 5DGBA 1ZETA 2JH1A 2DPJA 2YMPA 4DL6A 2ASLA 2DBYA 1UQVA 3SEIA 5GTIU 4ECRA 3RR8A 1RYSA 2HOIA 1JUDA 2W9BB 3D2QA 5KFSA 3SAGA 3KHGA 2KK0A 1S0VA 4NXTA 5DG8A 3GIMA 2ZH8A 2DUYA 1A0PA 2ZUBA 3PO5A 3NVYA 2QLTA 4I2FA 4F4ZA 1V4AA 1IV8A 2W9BA 2IMWP 1XS9D 5J2KA 5ALGA 2KSOB 1ZQHA 5AK5A 5KFFA 4RUCA 5KFQA 4KITB 9ICAA 1SGGA 4RT3A 2XY6A 3QUTA 4QWAA 2Q0ZX 2W3SA 1SB3C 1YLQA 5AK4A 4YG2A 4YMOA 3VC8A 5DQHA 5HR9A 2KSOA 4AT7B 3MDAA 2EZXA 2ZJ8A 2ZH5A 4JWMA 3PSPA 4EELA 2HCFA 5KAFU 2HHTA 1VJ5A 1MQ2A 4Z6DA 2PFPA 4DS4A 1JQRA 1DK2A 3ZD8A 4RQ6A 8ICIA 4AT7A 5J2BA 3RJJA 3AQLA 2IOHA 1VFGA 4ECVA 1CRXA 2E5SA 1KKXA 4Y2XA 2P35A 1V38A 1RYUA 1ZQLA 2JEFA 2R8JA 1KNYA 2K4HA 3UXNA 3TARA 4N7RA 2BPCA 2V9WA 4ECTA 2JRZA 3H39A 5EE0A 5AHXA 5AI0A 4IQWA 5J0XA 5KL1B 3QE9Y 4WC5A 7ICRA 1LB2B 4OAGA 5D4BA 4DQRA 3V72A 5CFSA 1R8CA 1T4GA 3QYPA 2BDUA 2AGQA 5J2HA 4J9MA 4O5EA 2YQEA 2O6KA 1BPEA 3TKAA 2QARB 4F4XA 3FC4A 2H3VA 3HIYA 4G9BA 8ICSA 4JV2A 2EDUA 2H3ZA 4NL9C 4G3IA 1S10A 3C5GA 1T3QA 1NKCA 1BPBA 4QZDA 3ED5A 2QARA 2AQ0A 5AKEA 4DSJA 3SV3A 2R8KA 4P4OA 1S97A 2DVIA 3GV8B 4OD0A 4ED8A 5DDMA 1ZQWA 3NVZA 5HR6A 8ICJA 3GQCA 4YP3A 4I2IA 2W43A 3I28A 7ICQA 3N7SC 3KOOA 2JXJA 1U48A 1NK6A 3B9JA 2K8AA 2KHVA 2FMQA 1ZQNA 5EE1A 2NO4A 2JR5A 3GIKA 1SWVA 4ACOA 4EEKA 2ZTEA 4F4KA 3H8MA 2EZZA 3LVWA 2BGWA 5D46A 4ECYA 3AMZA 4C4RA 4UB5A 4I29A 1IG6A 2AGPA 1YZ6A 1TK8A 4JLZA 4KLUA 5J2FA 3N7RC 1S77D 2M9NA 2IA6A 4AYBF 5KNIA 7ICVA 1JIHA 1WYGA 2JHDA 1JALA 2G09A 2K4EA 4UB3A 2KVSA 3PR4A 9ICVA 4O0IA 1ZQPA 3H0LB 4DOBA 1U45A 4KLSA 1Z1BA 5KFHA 1J2NA 2Y0SF 3NS1A 8ICHA 4ED6A 1OU5A 5A0LA 2F1HA 3A0HU 5H2FU 4FBTA 3A0BU 4RNOA 3ZDAA 1WUDA 3M1YA 9ICBA 1D9FA 4MHVA 2LM1A 4Y2VA 2RQ5A 3N4MB 5BOLA 3PNCA 4PHPA 5AKXA 1HEKA 3EPGA 2AQ4A 2XICA 4ECZA 4OAFA 4WBZA 2Y0SC 4K97A 5ALEA 5KG0A 3JCFA 2ZIWB 4IQUA 4C4SA 5IINA 3RJIA 3PX4A 4R63A 3ZDDA 3PO4A 4Q8EA 1A6SA 3T5JA 1QQ5A 2IHNA 4KLFA 1B4FA 3MGHA 1X66A 1XWLA 5KFLA 4UBBA 2H3QA 4RQMA 2J6UA 4KLDA 4FS1A 1KW4A 5AKLA 2NYVA 3H38A 4Q45A 3WKAA 9ICHA 5HHHA 3H3AA 4UAZA 2ZIWA 4Y2YA 5KFXA 4RQ1A 2VJ5A 3EW9A 2LHTA 4UBCA 1R89A 4ED2A 3PZPA 4EBCA 4B9VA 3RTVA 2OHFA 4NXUA 5J0PA 5AKYA 1F5SA 4BUGA 3OWGA 4B9TA 3ZDCA 1N5XA 4WCWA 4IQVA 4YR2A 1S76D 3PSFA 1WWUA 4X4PA 5ALXA 2DPIA 1UA0A 1Z3EB 9ICCA 1X9XA 4FHXA 4LEVA 2UVVA 2B56A 4FH5A 5DQGA 1TFWA 1A76A 4MEXA 1KLNA 2FPKA 1QH9A 3RH5A 3GFKB 4DWIA 2KP7A 1YZ7A 3RBEA 4RQNA 9ICIA 1L7PA 1KL9A 3JZ0A 1L3UA 4TUQA 2C28A 3H7IA 3GU3A 7ICPA 3OUYB 3F53A 3AU6A 2DF4B 5CB1A 2JEGA 7ICHA 2M2VA 1JX4A 3MDCA 1R8AA 1NK8A 2GOLA 4GXJA 3THVA 2UVWA 1ZQTA 3O0FA 3QU9A 4PJ0U 4M9NA 1BNPA 4C8NA 7ICIA 3OUYA 4IC9A 2G06A 3BS5B 4KN4A 5HC9A 4IR9A 1DGSA 5CHEA 3QZ7A 4F93B 4RPXA 2EWRA 4C7YA 3Q8KA 4M04A 2ZG6A 4O5CA 4PL1A 3C5FA 5HRLA 5D62A 4WQKA 5J2CA 3F2BA 5KG6A 1L8LA 4FHPA 4HYKA 5HRIA 3UXPA 4YCXA 2ZTCA 3RJKA 4BWMA 5KFGA 1QSYA 3JPQA 1N56A 1L7MA 1BGXT 3BS5A 1JI7A 2E1EA 2WF6A 3LYSA 4IRKA 4IS7A 2P6RA 4DSFA 1V97A 3AU2A 1LKYB 3QXGA 5BOMA 4IRDA 3HX0A 3AUOA 3PW7A 1V9PA 4X5VA 3GDXA 2KV2A 4UB8U 1GPJA 3T5KA 2EAOA 4OAHA 2KNJA 4F72A 4YMMA 4QNLA 5AKGA 4I2AA 4RNMA 1JN3A 2MRLA 5ALRA 4UD5A 3H40A 1LKYA 3OVBA 4DL5A 2BPFA 5F9LA 4UASA 4DL2A 3QU5A 1NJZA 1KEJA 3JPPA 4WC2A 5L1MA 2KIVA 2D3DA 1N60A 2MAXA 4EGWA 3PMLA 5D49A 2WB1F 4C8KA 2JGAA 4QJFB 4J9PA 4ECWA 1N62A 5KT2A 3V6HA 2VA3A 3PW0A 9ICGA 3OTQA 2VIXA 3UPSA 3HT3A 2R8IA 2K8CB 2NRTA 3KBBA 5KFJA 5E79U 3N7PD 4QZBA 5K4LA 3E0FA 3AL0B 1SKWA 1PUZA 3Q8RB 2WAQF 2WB1C 4RUAA 2PKEA 5HREA 4F5QA 3LK9A 3F5EA 1QQ6A 1M6YA 5ALKA 1VJ7A 5J2EA 1S8OA 1ZQBA 2IHOA 4F5NA 3ETLA 4DFDA 2W7PA 1ED1A 3WK6A 4X0BA 9ICSA 3WK9A 5ALZA 1X6JA 5J0QA 3C1YA 1ZQIA 1XSNA 4ELUA 5J0OA 2DKZA 2WAQC 3EZ5A 2YMMA 3K75D 5JRTA 3IV6A 2HOFA 5KAIU 1WWVA 1OXJA 2NRXA 4UAYA 1PK1B 5DG7A 2ZH4A 2BZFA 4FHWA 3SENA 2ZJ5A 1Q46A 5CHGA 2PI5A 4DS5A 4O6AA 1FFUA 5CJ7A 2HVHA 1L5UA 4OJLA 3LWLA 2QB1A 1ZQJA 1PK1A 2KTQA 4I2HA 3HW8A 2NO5A 5DBBA 4QW8A 4K4GA 4NLBA 3U26A 3UQ2A 4UARA 5KFIA 8ICZA 3CK6A 3RH4A 3TADC 4EX7A 3I1YA 4CF4A 4IR1A 2BPGA 7ICEA 3H8JA 4OAIZ 3WFSC 2DQNB 2G5IB 5AI9A 3G6XA 3RH6A 1COOA 4X4TA 3ZDBA 4YR3A 2ZHBA 1SKRA 4TUSA 7ICKA 4CCHA 2FMSA 1AROP 4RT2A 4CGZA 1DRGA 2W3RA 1JAJA 3QU2A 4F5OA 1MA7A 3TI0A 3G6VA 5J2DA 2BCQA 3OGUA 4EYIB 4Y2SA 2MSNA 4ZOHC 5AIBA 1FA0A 1ZD3A 1PVQA 2KKVA 2KIWA 5IIKA 1ZXIA 4LEYA 4K4IA 2PFOA 1H38A 4ELTA 4NLCA 1KQQA 3M6ZA 4WH5A 4KLGA 9ICKA 5ALSA 3ISCA 3OVAA 3JPTA 3D2SA 2C22A 2K4PA 3MGIA 2ZIXB 5L1IA 4TURA 3IP4B 4GFJA 4PGQA 2YB4A 3QNMA 4F5PA 3Q8PB 3BJYA 9ICQA 4C8MA 1JRPA 4M9LA 1DOQA 4CE6A 4DLEA 3I76A 3PSTA 1RG6A 1C7YA 5TISU 2ZIXA 7ICTA 1Q79A 4F92B 4DOCA 3L9DA 2GH1A 5C0YA 2ZH9A 5CWRA 5D61A 2HMXA 4F91B 1ZQOA 2YMQA 4OJ5A 2GLEA 5F9NA 4O3NA 1V85A 4B9MA 4XRHA 3MFIA 4RWOA 3UMGA 5HP4A 8ICNA 1NZPA 5KFUA 2FI1A 4B6JA 1R8BA 2WFAA 2KMDA 4O5KA 4E8FA 2VANA 2GA9D 9ICTA 5J0UA 4J9RA 1N63A 1LVHA 2HHSA 3T79A 4FH3A 8ICEA 2HHUA 4OJPA 3J81j 5DGAA 2BE3A 5AM1A 2JH7A 3WK8A 2CRXA 4IL6U 3BZKA 5AM3A 1NKEA 5ALJA 3E58A 3WKBA 5ALMA 5ALNA 4A8EA 5DB8A 1JMSA 4PHAA 3V7LA 4J9OA 3BZCA 2B6GA 4UW9A 2ES6A 4O68A 2KE7A 2I6XA 5ALFA 3NVOA 2ASJA 3QUBA 4ELVA 1BNOA 3M9OB 4S3NA 3AQFA 4IQTA 4PL2A 4QZIA 2LMRA 1ZQGA 3RBDA 2EZYA 5ALWA 1L3TA 3RJHA 5DECA 5EE9A 3OJUA 4KLHA 1XSPA 1ZQZA 3QUCA 2VA8A 3LVVA 4RQ5A 1ECWA 4LEWA 1UA1A 1JXLA 2HHXA 4X4SA 3IG8A 1BPYA 1KRPA 1C20A 4NXWA 3PSIA 4PPXA 1WCNA 4I2JA 5CR0A 4NL9A 3TFRA 3DDHA 3H8SA 3HPOA 2CN1A 3SI8A 4R64A 4WBYA 3MFHA 3F2DA 4EEDA 2IOFA 2Q4TA 9ICWA 3K7DA 3UM9A 3FDSA 2AHOB 1ZQVA 2BKEA 5KFYA 2FE9A 4MF8A 5AKZA 2DFLA 4B9LA 1NZBA 3T3FA 1X9WA 3NVWA 5AKHA 5KG4A 4JLXA 3CNHA 4E80A 5KT4A 2K89A 4YXMA 1CUKA 5KFPA 3T5LA 3M6KA 3CRXA 2F1IA 5HRKA 2OYYA 2YN4A 3QEAZ 4X4RA 1TAQA 2W54A 2DKXA 4F4YA 8ICGA 3ERCC 4O69A 2HHPA 5KFCA 1N5WA 2FLNA 4MEYA 5KT5A 3RB4A 2IBKA 5KFWA 3TANA 3NWIA 7ICOA 3MGVA 1L7NA 1K1QA 4J9KA 2W03A 4GLXA 2W9CB 5KT3A 1KN5A 2HOQA 3JPRA 7ICNA 4DCCA 5IIMA 1Q78A 4YQWA 3OSNA 1WOTA 3NVVA 4FFDA 5KG1A 4Z6CA 4AP9A 3QEBZ 4WJ3B 3ISBA 4R65A 3AQKA 1SV0C 2W9CA 3C29A 5D63A 4AYBC 2RLTA 3WU2U 4RNNA 3JYYA 2RP5A 2ISPA 3EYZA 2N1RA 2AXTU 4I2EA 8ICPA 2B51A 4QZ8A 1U4BA 3PW2A 3TAPA 2B4VA 9ICNA 4X4OA 3MC1A 4X0AA 2F8KA 3FYHA 3OSPA 2HBMA 5ALHA 4JV0A 4RZRA 2R18A 4NLNA 2KVCA 2KZZA 2YX8A 3AQNA 5L9XA 3H0MB 4LVSA 2F76X 4BWJA 4I27A 1ZRNA 3H37A 3CP8A 4OCZA 3LQCB 4KTQA 1UHUA 4DF8A 1KFTA 4C8LA 3C2MA 3WFPA 4Z6FA 1OUQA 1MIYA 2LBOA 3C28A 4DFMA 4Z6EA 1Z00B 4PZOA 2XGPA 4FHYA 2M2UA 1ZD4A 1L8OA 5AK3A 2WF5A 1FO4A 4YXJA 4C4TA 2DR5A 4XQ7A 3PW5A 2ZUCA 2NRVA 3BQ2A 4J03A 1RXWA 1U9LA 2H3FA 4DL3A 3Q8SB 4XA5A 2F8LA 4Y2QA 3OHBA 5J0WA 5G5HA 1Z00A 3ER9B 1UETA 1T94A 1ZQYA 2G0AA 3OPXA 1ZQCA 2WHEA 3WK5A 1MIWA 4JB3A 4J9NA 2ATLA 4FO6A 4EZ9A 3NKUA 5KFZA 5AM4A 5J8YC 5J0SA 5DB9A 3HKZF 4JK1A 2LYAA 4QZCA 3SZ2A 1HUZA 1L3SA 2WF9A 4M6WB 4WC0A 7ICJA 4Y2TA 3L5KA 1B22A 2Y9TA 1DK3A 1OW5A 3UMBA 1NK4A 2BBHA 4R66A 2GWSA 1XU4A 4KMOB 3ER8C 3ZD9A 4QZFA 4M6WA 2JV3A 2LPEA 1ZQFA 4ECUA 4RWQA 3AQEA 2C2EA 5HHIA 4MFAA 3N97B 1ZJMA 5IIIA 4OJOA 4QZGA 5EOZA 3KFUF 2XCAA 4JUZA 3MR6A 1KTQA 4ECXA 1SXDA 2ID1A 4B9NA 5HMMA 5KT6A 2Y1JA 3C21A 3BQTA 1S0OA 4DQSA 1FIQA 2ZIVB 4ED1A 3RB6A 2UVRA 4UB1A 2FMPA 2OWOA 1ZRMA 2F1JA 4M47A 5ALQA 3RJGA 5DB7A 4DL4A 4KLMA 4RWNA 3V6JA 4Y2JA 3KKAC 3GILA 2ZIVA 1T3NA 4P0QB 5AK6A 1TVAA 5ALOA 1ZQXA 3NRZA 4RPYA 2K4IA 4NLKA 5CEHA 3HJEA 3WFQE 4I2CA 4AT8B 3DEEA 3FM9A 3RJEA 1YT3A 4DFPA 2HSZA 2ZH3A 2W7OA 1ZJNA 2RRDA 3WKCA 4QWEA 2C2RA 4P0QA 4UB2A 2F77X 1N48A 2MU2A 4XQ8A 4DLGA 3LWMA 4FE3A
chains in the Genus database with same CATH topology
1AROP 4RT2A 3PVXA 2FLPA 1BPEA 3H4DA 4PGYA 4F4XA 4GC7A 4ED3A 1NJYA 1TKDA 2V4RA 1T7PA 1JAJA 4RQ7A 4O3PA 3HIYA 3PV8A 5KTQA 4F5OA 8ICSA 2PBEA 4RU9A 2W9AA 4JV2A 3TI0A 3JPSA 1XC9A 3PY8A 3G6VA 5J2DA 1MSWD 5F2VO 2BCQA 3JPNA 5L1KA 3OGUA 4EYIB 4G3IA 1S10A 3M8SA 3C5GA 1XO1A 2M2TA 1NKCA 2KN7A 4J9MA 1BPBA 4QZDA 1FA0A 2W8LA 2AQ0A 3C2LA 4FS2A 1UT5A 1QSLA 4DSJA 4KLEA 5IIKA 2XY5A 3SV3A 4EYHB 4K4IA 4UQGA 3PX6A 2PFOA 4P4OA 1H38A 2R8KA 3RJFA 2O5AA 4UAWA 4ELTA 2ZUDA 1S97A 3BDPA 1MIVA 2DVIA 3GV8B 3TAQA 4KLGA 4ED8A 9ICKA 5DDMA 3BQ1A 1KSPA 1ZQWA 2NRZA 5DBAA 3ISCA 5HRGA 1F5AA 2NRKA 3M9NB 2BQUA 2O1PA 4QZAA 5J2IA 3OVAA 8ICJA 3JPTA 3MBYA 5HRIA 2C22A 4DL7A 3GQCA 3H8WA 2ZHAA 5KFDA 5DDYA 3MGIA 4YP3A 2BQRA 2ZH2A 4I2IA 5L1IA 4TURA 5J29A 7ICQA 4PGQA 4F5PA 2FPMA 3RJKA 5J0YA 8ICQA 4DSEA 5KT7A 3Q8PB 3BJYA 1U48A 1NK6A 9ICQA 1NK0A 1ZYQA 4C8MA 1D8LA 2FMQA 2KFNA 4X4VA 3KHHA 1ZQNA 4ED0A 4M9LA 4ED7A 1DOQA 1QSSA 2FLLA 1RPLA 4RQ8A 4DLEA 9ICLA 4WC7A 1C7YA 7ICTA 3GV7B 3GIKA 3KHLA 2M2WA 1Q79A 4F92B 4DOCA 3L9DA 1RZTA 2ZH9A 5EWFA 2ZTEA 5CP2A 4QZEA 5CWRA 2BR0A 4F4KA 8ICTA 4F91B 1ZQOA 7ICMA 4UD4A 1JXEA 4KLQA 5F9NA 3HJ4A 4O3NA 4Q44A 4ECQA 1ZQRA 5J0RA 2BHNA 8ICKA 4B9MA 5IIOA 5J2GA 2R8HA 2BGWA 5D46A 4ECYA 2XCPA 1T8EA 5HMLA 3RAXA 4XRHA 4UB5A 3MFIA 2BCRA 4AT7A 4RWOA 5HP4A 2Q66A 2PI4A 4DSLA 8ICNA 4EEYA 9ICMA 5KFUA 4XUSA 4RQ4A 4PGXA 3Q8MA 1TV9A 4I29A 1NZPA 2AGPA 1R8BA 1NK7A 2KZMA 2DR7A 3RR7A 1TK8A 1ZQKA 3B0YA 4KLUA 2PFQA 1B43A 5J2FA 1S77D 1HUOA 2M9NA 1BVSA 1IM4A 1X9MA 3UQ0A 2IA6A 4I28A 4O5KA 4EP7A 3MR5A 2XO7A 4E8FA 2VANA 7ICVA 1JIHA 9ICTA 5J0UA 4UB3A 2P66A 9ICUA 3PR4A 4J9RA 9ICVA 4O0IA 1ZQPA 1ZQSA 4DOBA 3QZ8A 5KFBA 1U45A 4KLSA 1CEZA 4MFCA 5KFHA 4RWPA 5KFTA 2HHSA 5C5JA 8ICLA 1TFRA 4FH3A 4O3OA 3ZDEA 8ICEA 8ICHA 8ICCA 1U49A 2HHUA 4ED6A 4YN4A 5KFRA 3HWTA 3RB3A 1OU5A 5CA7A 5DGAA 2F1HA 2J6TA 2BE3A 8ICAA 4DFKA 4FBTA 4DSKA 4LZDA 4RNOA 3PMNA 1NKEA 3C2KA 3ZDAA 2MUTB 8ICRA 5DB8A 1SKSA 4EBEA 9ICBA 1JMSA 4PHAA 1D9FA 8ICUA 2XGQA 3V7LA 4J9OA 9ICPA 2KZ3A 4KMUA 1Q78A 4NKUA 1KDHA 1BPXA 4UB4A 4I2GA 3N4MB 1TFYA 3GV5B 2I9GA 5BOLA 3PNCA 1Y88A 4PHPA 5KFNA 3EPGA 2AQ4A 1XSLA 2ASJA 2RFFA 4KLIA 4ELVA 2BDPA 4ECZA 1X2IA 4FBUA 4FHVA 4WBZA 8ICWA 1BNOA 3M9OB 8ICFA 2IHMA 4P4PA 5HRFA 2MUTA 4GXKA 4S3NA 2P6UA 5KG0A 5KG7A 5J2JA 4F3OA 4AT8A 2UVUA 4IQTA 4IQUA 1L3VA 5IINA 3RJIA 3PX4A 4R63A 2RDJA 3PO4A 3ZDDA 4Q8EA 3K4GA 4IG8A 3T5JA 1TK5A 2IHNA 1NK9A 1QLNA 4QZIA 4KLFA 4DEZA 4R8UB 4M9HA 1S0MA 3MGHA 1XWLA 4UBBA 5KFLA 1ZQGA 4KLDA 4M9JA 2J6UA 3RBDA 4FS1A 2DR9A 1L3TA 2B21A 3RJHA 5DECA 2ZH6A 3OJUA 4KLHA 3HJ1A 3H38A 1ZQUA 4Q45A 1ZQZA 1XSPA 2WTFA 4F8RA 4DF4A 1S9FA 8ICYA 5HHHA 9ICHA 3H3AA 1A77A 4UAZA 2VA8A 4RQ5A 4KLTA 4RPZA 1QTMA 4NXZA 5KFXA 4J9QA 4F5RA 2ALZA 1UA1A 1JXLA 4YD2A 2HHXA 4X4SA 4R8UA 1BPYA 5KG5A 1KRPA 5JUMA 4RQ1A 3EW9A 4UBCA 5L1JA 5TZVA 4I2DA 4ED2A 1R89A 2JZBB 3WFOA 2Y1IA 4EBCA 3KHRA 4Q8FA 4KN7A 4B9VA 4PPXA 2FPLA 1WCNA 4I2JA 3RTVA 5CR0A 3ISDA 5J0PA 3PW4A 2AGOA 5DLGA 3TFRA 3V7KA 3H8SA 4YVZA 5KFEA 3HPOA 4DQQA 4O3RA 3SI8A 3ZDCA 4B9TA 1NKBA 4LZGA 7ICSA 3AQMA 5J2AA 1SL1A 4IQVA 4YR2A 4R64A 2KFZA 1WOTA 1NO5A 1S76D 4WBYA 4TQSA 5KFOA 4MFFA 4QWCA 4X4PA 1MC8A 2JZBA 3MFHA 2ZH7A 2DPIA 4WC6A 1UA0A 1Z3EB 9ICCA 9ICWA 2ZJAA 3FDSA 4FHXA 5HRBA 4JWNA 1ZQVA 8ICVA 2UVVA 4RQ0A 1ZQEA 4Q43A 2HHWA 4IRCA 4FH5A 5DQGA 2BKEA 5KFYA 3PR5B 1TFWA 1A76A 4MF8A 4RQ2A 4MEXA 4DOAA 1WCLA 2DFLA 9ICRA 4B9LA 1KLNA 4TQRA 3T5HA 2FPKA 3T3FA 4C8OA 2HVIA 2HHQA 1X9WA 3RH5A 5KG4A 3GFKB 4DWIA 2KP7A 9ICJA 4E80A 5KT4A 3RBEA 4M5DA 4YXMA 1CUKA 5KFPA 2H5XA 2XC9A 3T5LA 4M9GA 9ICIA 5DG9A 2F1IA 3UPQA 2BCUA 4KLJA 3JZ0A 1L3UA 4TUQA 2C28A 1SL0A 3H7IA 3NGDA 5HRKA 3G6YA 8ICMA 4GC6A 7ICPA 3OUYB 3QEAZ 1PZNA 3MABA 3AU6A 1TAQA 1X9SA 5CB1A 2JEGA 7ICHA 4X4RA 5DKWA 4F4YA 8ICGA 2M2VA 1JX4A 1ZQQA 2HW3A 3MDCA 1R8AA 1NK8A 2HHPA 4E7XA 5KFCA 2W8KA 1TK0A 2FLNA 4MEYA 4GXJA 3OVSA 3Q8QB 3THVA 2UVWA 1ZQTA 5KT5A 3HP6A 3M8RA 3RB4A 2IBKA 4WC3A 1K1SA 5KFWA 4NY8A 2ISOA 3OHAA 3TANA 1S0NA 3B0XA 1NK5A 4M9NA 7ICOA 5J0TA 3TQ1A 4DO9A 1RXVA 4DSIA 1BNPA 1HJPA 3C18A 4C8NA 1K1QA 4J9KA 7ICIA 3OUYA 2W9CB 4GLXA 1RYRA 5KT3A 4QZHA 4KN4A 4I2BA 3JPRA 5HC9A 4IR9A 7ICNA 4EBJA 1DGSA 4RQ3A 5DLFA 4PH5A 4F93B 4YFKA 4RPXA 4YQWA 4QW9A 3QZ7A 5KFAA 3OSNA 5IIMA 3Q8KA 2C2DA 4E0DA 4M04A 4O5CA 4KLOA 2PXIA 3C5FA 1D9DA 7ICGA 5HRLA 4QWBA 4EZ6A 5J2CA 5KG6A 4TUPA 3MR3A 4FHPA 5KG1A 4HYKA 5EWGA 2ZTDA 4Z6CA 3M9MB 3LDAA 4YCXA 2ZTCA 4PHDA 3UXPA 3QEBZ 1ZQAA 3C1ZA 3ISBA 3V6KA 4BWMA 5KFGA 4R65A 3RRHA 1QSYA 4M0AA 3AQKA 3JPQA 1N56A 2W9CA 1BGXT 3EWAA 4P4MA 4O9MA 2HHVA 9ICOA 1PX5A 5KG3A 3RRGA 4KLLA 3KTQA 3PX0A 3JYYA 4RNNA 4NLGA 4J9LA 4IRKA 2ISPA 4ATBB 3EYZA 3SV4A 5HNKA 2P6RA 4ZH4A 4DSFA 4I2EA 8ICPA 2W9MA 4QZ8A 3C23A 1U4BA 5DQIA 3AU2A 4NM2A 3PW2A 3TAPA 7ICLA 5BOMA 4IRDA 3HX0A 3BQ0A 4O3SA 9ICNA 1MQ3A 4WC1A 4YD1A 2BCVA 4X4OA 3TFSA 3AUOA 3PW7A 4X0AA 1V9PA 4X5VA 3GDXA 3FYHA 3OSPA 4JV0A 5IILA 3EPIA 2ZH1A 4RZRA 1SZPA 1U47A 4F2RA 3C66A 3UXOA 7ICFA 2AJQA 4NLNA 4DQPA 4ATBA 2KZZA 3WFRE 5KG2A 5L9XA 3MR2A 4NM1A 3AQNA 3T5KA 4BDPA 4YR0A 4MF2A 4LVSA 4F2SA 4I2AA 4YMMA 4BWJA 2R8GA 4P2HA 1JN3A 4BGDA 4RNMA 4I27A 2A1JB 4UD5A 3H40A 3H37A 3OVBA 4JV1A 4F4WA 4DL5A 2BPFA 5F9LA 1TAUA 5DB6A 4DQIA 4J9SA 4DL2A 3LQCB 4B9UA 4KTQA 4DF8A 1KFTA 1NJZA 4C8LA 3C2MA 3WFPA 1KEJA 2V4QA 3JPPA 4Z6FA 4WC2A 2NRWA 1MIYA 3SYZA 7ICUA 2MAXA 3PMLA 5D49A 4DFMA 4Z6EA 1Z00B 3ORYA 2A1JA 2XGPA 4FHYA 2M2UA 5BPCA 1UT8A 3V7JA 4C8KA 4X4UA 4YXJA 1ZQDA 5DGBA 1ZETA 2DR5A 4J9PA 4ECWA 2DPJA 4XQ7A 3PW5A 2ZUCA 2NRVA 5KT2A 4DL6A 1IXRA 4PHEA 2XY7A 3BQ2A 4K4HA 3V6HA 1RXWA 1U9LA 2VA3A 9ICXA 1UEVA 2ASLA 5L1LA 3PW0A 4DL3A 4NLZA 9ICGA 3Q8SB 4XA5A 3UPSA 2BQ3A 2NRTA 3HT3A 5KFJA 3OHBA 2R8IA 5J0WA 4QWDA 4ECRA 1Z00A 3RR8A 1RYSA 1UETA 1ZQYA 4QZBA 2W9BB 1ZQCA 5KFSA 1MIWA 3KHGA 2ASDA 1S0VA 3E2EA 3GIIA 4J9NA 1SKWA 4LT6A 1BPZA 2ATLA 4FO6A 5DG8A 1NJWA 4EZ9A 3IM1A 5KFZA 3Q8RB 3GIMA 4X4NA 1EXNA 4M2YA 2ZH8A 2DRBA 5J0SA 4RUAA 5DB9A 2ZUBA 3PO5A 4JK1A 3RB0A 5HREA 4F5QA 4I2FA 3LK9A 4QZCA 3SZ2A 1VJ7A 1HUZA 1L3SA 1SL2A 2DRAA 4M6WB 4F4ZA 4WC0A 2BCSA 1NOMA 1V4AA 5J2EA 1KFDA 7ICJA 4AT9B 1ZQBA 2W9BA 4EBKA 4O5EA 3GIJA 4F5NA 3ETLA 1XS9D 2IMWP 1B22A 5J2KA 9ICFA 1DK3A 4X0BA 9ICSA 5KFKA 1NK4A 1ZQHA 3NTUA 9ICEA 4R66A 2GWSA 5KFFA 4RUCA 1XU4A 5KFMA 4KITB 5KFQA 2PFNA 5J0QA 9ICAA 1LV5A 4O3QA 3C1YA 3ZD9A 1ZQIA 4QZFA 4GXIA 2VA2A 4YMNA 4M6WA 4RT3A 2XY6A 3JPOA 1XSNA 1ZQFA 4ELUA 4QWAA 4AT9A 2Q0ZX 4ECUA 3IHQB 1YLQA 4RWQA 5J0OA 3NYBA 4X4QA 2AU0A 3EZ5A 3K75D 2C2EA 5HHIA 4YG2A 4YMOA 8ICBA 5DQHA 5HR9A 8ICXA 4MFAA 8ICOA 4AT7B 3MDAA 4DFJA 3N97B 3OV7A 2ZJ8A 1ZJMA 2ZH5A 2JEJA 5IIIA 4QZGA 5EOZA 4JWMA 1NJXA 2XCAA 2NRXA 4JUZA 3MR6A 1KTQA 4UAYA 4ECXA 5DG7A 2J6SA 5DEDA 2ZH4A 2DR8A 2ID1A 4B9NA 2HHTA 5HMMA 5KT6A 2Y1JA 3C21A 4FHWA 1MQ2A 4Z6DA 3BQTA 1S0OA 4DQSA 2ZJ5A 4WC4A 2I1QA 2PFPA 4DS4A 2LYHA 1JQRA 1KFSA 4ED1A 1DK2A 3ZD8A 4RQ6A 8ICIA 4QZ9A 5CHGA 2PI5A 3RB6A 4DS5A 2UVRA 5J2BA 4B9SA 5CJ7A 4UB1A 2HVHA 1L5UA 3LWLA 1ZQJA 3RJJA 1BPDA 2FMPA 2OWOA 5HRDA 3AQLA 1VFGA 4ECVA 2KTQA 4I2HA 3HW8A 2F1JA 4ECSA 4M47A 4KLMA 1ZQLA 5DB7A 4DL4A 3RJGA 2JEFA 3V6JA 2RDIA 2R8JA 4RWNA 1KNYA 5DBBA 3GILA 4QW8A 4K4GA 5HRHA 3UXNA 3TARA 3Q8LA 1T3NA 4BXOB 4WCWA 2BPCA 5IIJA 3UQ2A 3RAQA 1TVAA 1ZQMA 5KFVA 2V9WA 4NKTA 5KFIA 8ICZA 1ZQXA 4ECTA 5DBCA 4RPYA 3RH4A 2FMSA 5EWEA 3H39A 4NLKA 4IR1A 2BPGA 4IQWA 5J0XA 7ICEA 3H8JA 4I2CA 3WFQE 4AT8B 3QE9Y 3WFSC 4WC5A 7ICRA 3H4BA 1D8YA 4EBDA 3RJEA 1LB2B 3G6XA 4DFPA 2JEIA 2ZH3A 5D4BA 1COOA 3RH6A 1UEUA 4DQRA 4X4TA 3V72A 1ZJNA 4QWEA 3ZDBA 2C2RA 4BXOA 4YR3A 1R8CA 2ZHBA 4UB2A 1SKRA 1T4GA 1N48A 4TUSA 7ICKA 2AGQA 4CCHA 4F50A 4XQ8A 3OJSA 5J2HA 4DLGA 3LWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARO P;  4RT2 A;  3PVX A;  2FLP A;  1BPE A;  3H4D A;  4PGY A;  4F4X A;  4GC7 A;  4ED3 A;  1NJY A;  1TKD A;  2V4R A;  1T7P A;  1JAJ A;  4RQ7 A;  4O3P A;  3HIY A;  3PV8 A;  5KTQ A;  4F5O A;  8ICS A;  2PBE A;  4RU9 A;  2W9A A;  4JV2 A;  3TI0 A;  3JPS A;  1XC9 A;  3PY8 A;  3G6V A;  5J2D A;  1MSW D;  5F2V O;  2BCQ A;  3JPN A;  5L1K A;  3OGU A;  4EYI B;  4G3I A;  1S10 A;  3M8S A;  3C5G A;  1XO1 A;  2M2T A;  1NKC A;  2KN7 A;  4J9M A;  1BPB A;  4QZD A;  1FA0 A;  2W8L A;  2AQ0 A;  3C2L A;  4FS2 A;  1UT5 A;  1QSL A;  4DSJ A;  4KLE A;  5IIK A;  2XY5 A;  3SV3 A;  4EYH B;  4K4I A;  4UQG A;  3PX6 A;  2PFO A;  4P4O A;  1H38 A;  2R8K A;  3RJF A;  2O5A A;  4UAW A;  4ELT A;  2ZUD A;  1S97 A;  3BDP A;  1MIV A;  2DVI A;  3GV8 B;  3TAQ A;  4KLG A;  4ED8 A;  9ICK A;  5DDM A;  3BQ1 A;  1KSP A;  1ZQW A;  2NRZ A;  5DBA A;  3ISC A;  5HRG A;  1F5A A;  2NRK A;  3M9N B;  2BQU A;  2O1P A;  4QZA A;  5J2I A;  3OVA A;  8ICJ A;  3JPT A;  3MBY A;  5HRI A;  2C22 A;  4DL7 A;  3GQC A;  3H8W A;  2ZHA A;  5KFD A;  5DDY A;  3MGI A;  4YP3 A;  2BQR A;  2ZH2 A;  4I2I A;  5L1I A;  4TUR A;  5J29 A;  7ICQ A;  4PGQ A;  4F5P A;  2FPM A;  3RJK A;  5J0Y A;  8ICQ A;  4DSE A;  5KT7 A;  3Q8P B;  3BJY A;  1U48 A;  1NK6 A;  9ICQ A;  1NK0 A;  1ZYQ A;  4C8M A;  1D8L A;  2FMQ A;  2KFN A;  4X4V A;  3KHH A;  1ZQN A;  4ED0 A;  4M9L A;  4ED7 A;  1DOQ A;  1QSS A;  2FLL A;  1RPL A;  4RQ8 A;  4DLE A;  9ICL A;  4WC7 A;  1C7Y A;  7ICT A;  3GV7 B;  3GIK A;  3KHL A;  2M2W A;  1Q79 A;  4F92 B;  4DOC A;  3L9D A;  1RZT A;  2ZH9 A;  5EWF A;  2ZTE A;  5CP2 A;  4QZE A;  5CWR A;  2BR0 A;  4F4K A;  8ICT A;  4F91 B;  1ZQO A;  7ICM A;  4UD4 A;  1JXE A;  4KLQ A;  5F9N A;  3HJ4 A;  4O3N A;  4Q44 A;  4ECQ A;  1ZQR A;  5J0R A;  2BHN A;  8ICK A;  4B9M A;  5IIO A;  5J2G A;  2R8H A;  2BGW A;  5D46 A;  4ECY A;  2XCP A;  1T8E A;  5HML A;  3RAX A;  4XRH A;  4UB5 A;  3MFI A;  2BCR A;  4AT7 A;  4RWO A;  5HP4 A;  2Q66 A;  2PI4 A;  4DSL A;  8ICN A;  4EEY A;  9ICM A;  5KFU A;  4XUS A;  4RQ4 A;  4PGX A;  3Q8M A;  1TV9 A;  4I29 A;  1NZP A;  2AGP A;  1R8B A;  1NK7 A;  2KZM A;  2DR7 A;  3RR7 A;  1TK8 A;  1ZQK A;  3B0Y A;  4KLU A;  2PFQ A;  1B43 A;  5J2F A;  1S77 D;  1HUO A;  2M9N A;  1BVS A;  1IM4 A;  1X9M A;  3UQ0 A;  2IA6 A;  4I28 A;  4O5K A;  4EP7 A;  3MR5 A;  2XO7 A;  4E8F A;  2VAN A;  7ICV A;  1JIH A;  9ICT A;  5J0U A;  4UB3 A;  2P66 A;  9ICU A;  3PR4 A;  4J9R A;  9ICV A;  4O0I A;  1ZQP A;  1ZQS A;  4DOB A;  3QZ8 A;  5KFB A;  1U45 A;  4KLS A;  1CEZ A;  4MFC A;  5KFH A;  4RWP A;  5KFT A;  2HHS A;  5C5J A;  8ICL A;  1TFR A;  4FH3 A;  4O3O A;  3ZDE A;  8ICE A;  8ICH A;  8ICC A;  1U49 A;  2HHU A;  4ED6 A;  4YN4 A;  5KFR A;  3HWT A;  3RB3 A;  1OU5 A;  5CA7 A;  5DGA A;  2F1H A;  2J6T A;  2BE3 A;  8ICA A;  4DFK A;  4FBT A;  4DSK A;  4LZD A;  4RNO A;  3PMN A;  1NKE A;  3C2K A;  3ZDA A;  2MUT B;  8ICR A;  5DB8 A;  1SKS A;  4EBE A;  9ICB A;  1JMS A;  4PHA A;  1D9F A;  8ICU A;  2XGQ A;  3V7L A;  4J9O A;  9ICP A;  2KZ3 A;  4KMU A;  1Q78 A;  4NKU A;  1KDH A;  1BPX A;  4UB4 A;  4I2G A;  3N4M B;  1TFY A;  3GV5 B;  2I9G A;  5BOL A;  3PNC A;  1Y88 A;  4PHP A;  5KFN A;  3EPG A;  2AQ4 A;  1XSL A;  2ASJ A;  2RFF A;  4KLI A;  4ELV A;  2BDP A;  4ECZ A;  1X2I A;  4FBU A;  4FHV A;  4WBZ A;  8ICW A;  1BNO A;  3M9O B;  8ICF A;  2IHM A;  4P4P A;  5HRF A;  2MUT A;  4GXK A;  4S3N A;  2P6U A;  5KG0 A;  5KG7 A;  5J2J A;  4F3O A;  4AT8 A;  2UVU A;  4IQT A;  4IQU A;  1L3V A;  5IIN A;  3RJI A;  3PX4 A;  4R63 A;  2RDJ A;  3PO4 A;  3ZDD A;  4Q8E A;  3K4G A;  4IG8 A;  3T5J A;  1TK5 A;  2IHN A;  1NK9 A;  1QLN A;  4QZI A;  4KLF A;  4DEZ A;  4R8U B;  4M9H A;  1S0M A;  3MGH A;  1XWL A;  4UBB A;  5KFL A;  1ZQG A;  4KLD A;  4M9J A;  2J6U A;  3RBD A;  4FS1 A;  2DR9 A;  1L3T A;  2B21 A;  3RJH A;  5DEC A;  2ZH6 A;  3OJU A;  4KLH A;  3HJ1 A;  3H38 A;  1ZQU A;  4Q45 A;  1ZQZ A;  1XSP A;  2WTF A;  4F8R A;  4DF4 A;  1S9F A;  8ICY A;  5HHH A;  9ICH A;  3H3A A;  1A77 A;  4UAZ A;  2VA8 A;  4RQ5 A;  4KLT A;  4RPZ A;  1QTM A;  4NXZ A;  5KFX A;  4J9Q A;  4F5R A;  2ALZ A;  1UA1 A;  1JXL A;  4YD2 A;  2HHX A;  4X4S A;  4R8U A;  1BPY A;  5KG5 A;  1KRP A;  5JUM A;  4RQ1 A;  3EW9 A;  4UBC A;  5L1J A;  5TZV A;  4I2D A;  4ED2 A;  1R89 A;  2JZB B;  3WFO A;  2Y1I A;  4EBC A;  3KHR A;  4Q8F A;  4KN7 A;  4B9V A;  4PPX A;  2FPL A;  1WCN A;  4I2J A;  3RTV A;  5CR0 A;  3ISD A;  5J0P A;  3PW4 A;  2AGO A;  5DLG A;  3TFR A;  3V7K A;  3H8S A;  4YVZ A;  5KFE A;  3HPO A;  4DQQ A;  4O3R A;  3SI8 A;  3ZDC A;  4B9T A;  1NKB A;  4LZG A;  7ICS A;  3AQM A;  5J2A A;  1SL1 A;  4IQV A;  4YR2 A;  4R64 A;  2KFZ A;  1WOT A;  1NO5 A;  1S76 D;  4WBY A;  4TQS A;  5KFO A;  4MFF A;  4QWC A;  4X4P A;  1MC8 A;  2JZB A;  3MFH A;  2ZH7 A;  2DPI A;  4WC6 A;  1UA0 A;  1Z3E B;  9ICC A;  9ICW A;  2ZJA A;  3FDS A;  4FHX A;  5HRB A;  4JWN A;  1ZQV A;  8ICV A;  2UVV A;  4RQ0 A;  1ZQE A;  4Q43 A;  2HHW A;  4IRC A;  4FH5 A;  5DQG A;  2BKE A;  5KFY A;  3PR5 B;  1TFW A;  1A76 A;  4MF8 A;  4RQ2 A;  4MEX A;  4DOA A;  1WCL A;  2DFL A;  9ICR A;  4B9L A;  1KLN A;  4TQR A;  3T5H A;  2FPK A;  3T3F A;  4C8O A;  2HVI A;  2HHQ A;  1X9W A;  3RH5 A;  5KG4 A;  3GFK B;  4DWI A;  2KP7 A;  9ICJ A;  4E80 A;  5KT4 A;  3RBE A;  4M5D A;  4YXM A;  1CUK A;  5KFP A;  2H5X A;  2XC9 A;  3T5L A;  4M9G A;  9ICI A;  5DG9 A;  2F1I A;  3UPQ A;  2BCU A;  4KLJ A;  3JZ0 A;  1L3U A;  4TUQ A;  2C28 A;  1SL0 A;  3H7I A;  3NGD A;  5HRK A;  3G6Y A;  8ICM A;  4GC6 A;  7ICP A;  3OUY B;  3QEA Z;  1PZN A;  3MAB A;  3AU6 A;  1TAQ A;  1X9S A;  5CB1 A;  2JEG A;  7ICH A;  4X4R A;  5DKW A;  4F4Y A;  8ICG A;  2M2V A;  1JX4 A;  1ZQQ A;  2HW3 A;  3MDC A;  1R8A A;  1NK8 A;  2HHP A;  4E7X A;  5KFC A;  2W8K A;  1TK0 A;  2FLN A;  4MEY A;  4GXJ A;  3OVS A;  3Q8Q B;  3THV A;  2UVW A;  1ZQT A;  5KT5 A;  3HP6 A;  3M8R A;  3RB4 A;  2IBK A;  4WC3 A;  1K1S A;  5KFW A;  4NY8 A;  2ISO A;  3OHA A;  3TAN A;  1S0N A;  3B0X A;  1NK5 A;  4M9N A;  7ICO A;  5J0T A;  3TQ1 A;  4DO9 A;  1RXV A;  4DSI A;  1BNP A;  1HJP A;  3C18 A;  4C8N A;  1K1Q A;  4J9K A;  7ICI A;  3OUY A;  2W9C B;  4GLX A;  1RYR A;  5KT3 A;  4QZH A;  4KN4 A;  4I2B A;  3JPR A;  5HC9 A;  4IR9 A;  7ICN A;  4EBJ A;  1DGS A;  4RQ3 A;  5DLF A;  4PH5 A;  4F93 B;  4YFK A;  4RPX A;  4YQW A;  4QW9 A;  3QZ7 A;  5KFA A;  3OSN A;  5IIM A;  3Q8K A;  2C2D A;  4E0D A;  4M04 A;  4O5C A;  4KLO A;  2PXI A;  3C5F A;  1D9D A;  7ICG A;  5HRL A;  4QWB A;  4EZ6 A;  5J2C A;  5KG6 A;  4TUP A;  3MR3 A;  4FHP A;  5KG1 A;  4HYK A;  5EWG A;  2ZTD A;  4Z6C A;  3M9M B;  3LDA A;  4YCX A;  2ZTC A;  4PHD A;  3UXP A;  3QEB Z;  1ZQA A;  3C1Z A;  3ISB A;  3V6K A;  4BWM A;  5KFG A;  4R65 A;  3RRH A;  1QSY A;  4M0A A;  3AQK A;  3JPQ A;  1N56 A;  2W9C A;  1BGX T;  3EWA A;  4P4M A;  4O9M A;  2HHV A;  9ICO A;  1PX5 A;  5KG3 A;  3RRG A;  4KLL A;  3KTQ A;  3PX0 A;  3JYY A;  4RNN A;  4NLG A;  4J9L A;  4IRK A;  2ISP A;  4ATB B;  3EYZ A;  3SV4 A;  5HNK A;  2P6R A;  4ZH4 A;  4DSF A;  4I2E A;  8ICP A;  2W9M A;  4QZ8 A;  3C23 A;  1U4B A;  5DQI A;  3AU2 A;  4NM2 A;  3PW2 A;  3TAP A;  7ICL A;  5BOM A;  4IRD A;  3HX0 A;  3BQ0 A;  4O3S A;  9ICN A;  1MQ3 A;  4WC1 A;  4YD1 A;  2BCV A;  4X4O A;  3TFS A;  3AUO A;  3PW7 A;  4X0A A;  1V9P A;  4X5V A;  3GDX A;  3FYH A;  3OSP A;  4JV0 A;  5IIL A;  3EPI A;  2ZH1 A;  4RZR A;  1SZP A;  1U47 A;  4F2R A;  3C66 A;  3UXO A;  7ICF A;  2AJQ A;  4NLN A;  4DQP A;  4ATB A;  2KZZ A;  3WFR E;  5KG2 A;  5L9X A;  3MR2 A;  4NM1 A;  3AQN A;  3T5K A;  4BDP A;  4YR0 A;  4MF2 A;  4LVS A;  4F2S A;  4I2A A;  4YMM A;  4BWJ A;  2R8G A;  4P2H A;  1JN3 A;  4BGD A;  4RNM A;  4I27 A;  2A1J B;  4UD5 A;  3H40 A;  3H37 A;  3OVB A;  4JV1 A;  4F4W A;  4DL5 A;  2BPF A;  5F9L A;  1TAU A;  5DB6 A;  4DQI A;  4J9S A;  4DL2 A;  3LQC B;  4B9U A;  4KTQ A;  4DF8 A;  1KFT A;  1NJZ A;  4C8L A;  3C2M A;  3WFP A;  1KEJ A;  2V4Q A;  3JPP A;  4Z6F A;  4WC2 A;  2NRW A;  1MIY A;  3SYZ A;  7ICU A;  2MAX A;  3PML A;  5D49 A;  4DFM A;  4Z6E A;  1Z00 B;  3ORY A;  2A1J A;  2XGP A;  4FHY A;  2M2U A;  5BPC A;  1UT8 A;  3V7J A;  4C8K A;  4X4U A;  4YXJ A;  1ZQD A;  5DGB A;  1ZET A;  2DR5 A;  4J9P A;  4ECW A;  2DPJ A;  4XQ7 A;  3PW5 A;  2ZUC A;  2NRV A;  5KT2 A;  4DL6 A;  1IXR A;  4PHE A;  2XY7 A;  3BQ2 A;  4K4H A;  3V6H A;  1RXW A;  1U9L A;  2VA3 A;  9ICX A;  1UEV A;  2ASL A;  5L1L A;  3PW0 A;  4DL3 A;  4NLZ A;  9ICG A;  3Q8S B;  4XA5 A;  3UPS A;  2BQ3 A;  2NRT A;  3HT3 A;  5KFJ A;  3OHB A;  2R8I A;  5J0W A;  4QWD A;  4ECR A;  1Z00 A;  3RR8 A;  1RYS A;  1UET A;  1ZQY A;  4QZB A;  2W9B B;  1ZQC A;  5KFS A;  1MIW A;  3KHG A;  2ASD A;  1S0V A;  3E2E A;  3GII A;  4J9N A;  1SKW A;  4LT6 A;  1BPZ A;  2ATL A;  4FO6 A;  5DG8 A;  1NJW A;  4EZ9 A;  3IM1 A;  5KFZ A;  3Q8R B;  3GIM A;  4X4N A;  1EXN A;  4M2Y A;  2ZH8 A;  2DRB A;  5J0S A;  4RUA A;  5DB9 A;  2ZUB A;  3PO5 A;  4JK1 A;  3RB0 A;  5HRE A;  4F5Q A;  4I2F A;  3LK9 A;  4QZC A;  3SZ2 A;  1VJ7 A;  1HUZ A;  1L3S A;  1SL2 A;  2DRA A;  4M6W B;  4F4Z A;  4WC0 A;  2BCS A;  1NOM A;  1V4A A;  5J2E A;  1KFD A;  7ICJ A;  4AT9 B;  1ZQB A;  2W9B A;  4EBK A;  4O5E A;  3GIJ A;  4F5N A;  3ETL A;  1XS9 D;  2IMW P;  1B22 A;  5J2K A;  9ICF A;  1DK3 A;  4X0B A;  9ICS A;  5KFK A;  1NK4 A;  1ZQH A;  3NTU A;  9ICE A;  4R66 A;  2GWS A;  5KFF A;  4RUC A;  1XU4 A;  5KFM A;  4KIT B;  5KFQ A;  2PFN A;  5J0Q A;  9ICA A;  1LV5 A;  4O3Q A;  3C1Y A;  3ZD9 A;  1ZQI A;  4QZF A;  4GXI A;  2VA2 A;  4YMN A;  4M6W A;  4RT3 A;  2XY6 A;  3JPO A;  1XSN A;  1ZQF A;  4ELU A;  4QWA A;  4AT9 A;  2Q0Z X;  4ECU A;  3IHQ B;  1YLQ A;  4RWQ A;  5J0O A;  3NYB A;  4X4Q A;  2AU0 A;  3EZ5 A;  3K75 D;  2C2E A;  5HHI A;  4YG2 A;  4YMO A;  8ICB A;  5DQH A;  5HR9 A;  8ICX A;  4MFA A;  8ICO A;  4AT7 B;  3MDA A;  4DFJ A;  3N97 B;  3OV7 A;  2ZJ8 A;  1ZJM A;  2ZH5 A;  2JEJ A;  5III A;  4QZG A;  5EOZ A;  4JWM A;  1NJX A;  2XCA A;  2NRX A;  4JUZ A;  3MR6 A;  1KTQ A;  4UAY A;  4ECX A;  5DG7 A;  2J6S A;  5DED A;  2ZH4 A;  2DR8 A;  2ID1 A;  4B9N A;  2HHT A;  5HMM A;  5KT6 A;  2Y1J A;  3C21 A;  4FHW A;  1MQ2 A;  4Z6D A;  3BQT A;  1S0O A;  4DQS A;  2ZJ5 A;  4WC4 A;  2I1Q A;  2PFP A;  4DS4 A;  2LYH A;  1JQR A;  1KFS A;  4ED1 A;  1DK2 A;  3ZD8 A;  4RQ6 A;  8ICI A;  4QZ9 A;  5CHG A;  2PI5 A;  3RB6 A;  4DS5 A;  2UVR A;  5J2B A;  4B9S A;  5CJ7 A;  4UB1 A;  2HVH A;  1L5U A;  3LWL A;  1ZQJ A;  3RJJ A;  1BPD A;  2FMP A;  2OWO A;  5HRD A;  3AQL A;  1VFG A;  4ECV A;  2KTQ A;  4I2H A;  3HW8 A;  2F1J A;  4ECS A;  4M47 A;  4KLM A;  1ZQL A;  5DB7 A;  4DL4 A;  3RJG A;  2JEF A;  3V6J A;  2RDI A;  2R8J A;  4RWN A;  1KNY A;  5DBB A;  3GIL A;  4QW8 A;  4K4G A;  5HRH A;  3UXN A;  3TAR A;  3Q8L A;  1T3N A;  4BXO B;  4WCW A;  2BPC A;  5IIJ A;  3UQ2 A;  3RAQ A;  1TVA A;  1ZQM A;  5KFV A;  2V9W A;  4NKT A;  5KFI A;  8ICZ A;  1ZQX A;  4ECT A;  5DBC A;  4RPY A;  3RH4 A;  2FMS A;  5EWE A;  3H39 A;  4NLK A;  4IR1 A;  2BPG A;  4IQW A;  5J0X A;  7ICE A;  3H8J A;  4I2C A;  3WFQ E;  4AT8 B;  3QE9 Y;  3WFS C;  4WC5 A;  7ICR A;  3H4B A;  1D8Y A;  4EBD A;  3RJE A;  1LB2 B;  3G6X A;  4DFP A;  2JEI A;  2ZH3 A;  5D4B A;  1COO A;  3RH6 A;  1UEU A;  4DQR A;  4X4T A;  3V72 A;  1ZJN A;  4QWE A;  3ZDB A;  2C2R A;  4BXO A;  4YR3 A;  1R8C A;  2ZHB A;  4UB2 A;  1SKR A;  1T4G A;  1N48 A;  4TUS A;  7ICK A;  2AGQ A;  4CCH A;  4F50 A;  4XQ8 A;  3OJS A;  5J2H A;  4DLG A;  3LWM A; 
#chains in the Genus database with same CATH topology
 2FLP A;  2GAF D;  2FJ6 A;  3CYM A;  4PGY A;  4GC7 A;  4ED3 A;  1NJY A;  3WKD A;  3PV8 A;  3ICX A;  5KTQ A;  2PBE A;  5ALI A;  4RU9 A;  2W9A A;  3JPS A;  1XC9 A;  3PY8 A;  1MSW D;  5F2V O;  2F44 A;  3JPN A;  5L1K A;  3M8S A;  1XO1 A;  1DXS A;  2M2T A;  3AEV A;  2KN7 A;  2W8L A;  5GTH U;  5G5G A;  4FS2 A;  4KLE A;  3SMV A;  2XY5 A;  4EYH B;  4UQG A;  3PX6 A;  3RJF A;  3TAQ A;  3H0R B;  5JTI A;  3BQ1 A;  1KSP A;  2O1P A;  5DBA A;  5HRG A;  1F5A A;  4QZA A;  3NUQ A;  3H8W A;  2ZHA A;  2BQR A;  3ALR A;  2CPR A;  5J29 A;  2PMZ F;  4DSE A;  5AI4 A;  2G08 A;  4K8V A;  2LKY A;  2KEY A;  2D8C A;  2KFN A;  4X4V A;  4ED7 A;  1RPL A;  4UAT A;  9ICL A;  4WC7 A;  3GV7 B;  1ZOL A;  2M2W A;  1Z4O A;  2G5H B;  4KB6 A;  5EWF A;  2E8P A;  8ICT A;  1F44 A;  3M7D A;  4UD4 A;  2WF7 A;  2H3I A;  3R9K A;  4UAU A;  5J0R A;  2BHN A;  8ICK A;  4K96 A;  1T8E A;  3RAX A;  2PMZ C;  2BCR A;  5AM5 A;  2Q66 A;  2PI4 A;  4DSL A;  4EEY A;  9ICM A;  4XJE A;  3IDW A;  2KZM A;  3RR7 A;  1ZQK A;  2E3T A;  3B0Y A;  1IM4 A;  1X9M A;  3UQ0 A;  2ODG A;  3L4P A;  2XO7 A;  1N2X A;  2P66 A;  1L6N A;  1GO3 F;  2DRB A;  5KFB A;  1CEZ A;  4MFC A;  4RWP A;  1AQ6 A;  3SR6 A;  8ICL A;  1TFR A;  1J2M A;  1U49 A;  3HWT A;  1Z1V A;  4DFK A;  2K8B B;  4DSK A;  3PMN A;  4LEZ A;  3C2K A;  2MUT B;  3L3F X;  4KX3 A;  1SKS A;  4EBE A;  4QIW F;  2OCE A;  4KMU A;  4NKU A;  2DWQ A;  3GZF A;  5AI6 A;  1TFY A;  3GV5 B;  1Y88 A;  5KFN A;  2RFF A;  5FP0 A;  3AN1 A;  4FHV A;  8ICF A;  2MUT A;  2P6U A;  5KG7 A;  5J2J A;  3KZI U;  2G07 A;  1L3V A;  4OJ6 A;  3TAD A;  2W55 A;  2EAM A;  4IG8 A;  1TK5 A;  1NK9 A;  4DEZ A;  4M9H A;  2DR9 A;  2B21 A;  5ALT A;  1J97 A;  2ZH6 A;  3HJ1 A;  4BX9 C;  1ZQU A;  1S9F A;  1A77 A;  4RPZ A;  1QTM A;  4NXZ A;  4J9Q A;  3F2C A;  3PHZ A;  2OEH A;  5L1J A;  4I2D A;  2KHQ A;  3KHR A;  1XNS A;  5DLG A;  3V7K A;  1Q8K A;  4DQQ A;  2QKQ A;  5ALY A;  5J2A A;  1SL1 A;  2KFZ A;  1NO5 A;  5B66 U;  5KFO A;  4MFF A;  4QWC A;  2ZH7 A;  3ONN A;  4WQL A;  5HRB A;  4JWN A;  8ICV A;  2HHW A;  2D6F C;  4IRC A;  3RF9 A;  3QU4 A;  4DOA A;  4U7C A;  1SIJ A;  1SV4 A;  1UPH A;  1Q3U A;  3SAH A;  5B5E U;  2A1A A;  3T5H A;  2HVI A;  4C8O A;  3D2N A;  4K98 A;  2H5X A;  4M9G A;  5DG9 A;  4ICA A;  5HR7 A;  4NXV A;  3UPQ A;  4KLJ A;  3QX7 A;  1SL0 A;  3NGD A;  4GC6 A;  2HW3 A;  4E7X A;  3WKE A;  2W8K A;  4K9B A;  3OVS A;  3Q8Q B;  1WG8 A;  3HP6 A;  3M8R A;  1K1S A;  4NY8 A;  2ISO A;  2IUB A;  1RXV A;  4DO9 A;  2W04 A;  1HJP A;  5CFT A;  1RYR A;  1N61 A;  2KJ9 A;  2VKQ A;  4I2B A;  2KJ8 A;  4O67 A;  4EBJ A;  4NXX A;  2C2D A;  4NKT A;  5KFA A;  4E0D A;  4C7Z A;  2PXI A;  1D9D A;  4QWB A;  4Y2R A;  3MR3 A;  5EWG A;  2E8N A;  2BBJ A;  3C1Z A;  3RRH A;  4GIB A;  3UMC A;  4P4M A;  4WOY A;  1JRO A;  5ALV A;  4O9M A;  4KLL A;  1X6I A;  4MKP A;  4NLG A;  5HNK A;  2FCL A;  5CFU A;  3EF2 A;  3EUB 2;  3FAH A;  4HAI A;  3BQ0 A;  1X40 A;  1MQ3 A;  4WC1 A;  4YD1 A;  2BCV A;  2B0C A;  5IIL A;  3EPI A;  2ZH1 A;  3C66 A;  1SZP A;  2AJQ A;  4NM1 A;  3MR2 A;  4BDP A;  4YR0 A;  2Y9U A;  4P2H A;  2R8G A;  1SZH A;  1NI3 A;  2A1J B;  4Y2P A;  1IIP A;  4F4W A;  2YML A;  3K1Z A;  1TAU A;  4DQI A;  1KBU A;  4B9U A;  2RHF A;  2NRW A;  2GO7 A;  2AH5 A;  7ICU A;  1PVR A;  5AKK A;  4LJX A;  2A1J A;  3K1R B;  3V7J A;  2HN1 A;  2M0N A;  1ZQD A;  2Z7J A;  2E8O A;  2XY7 A;  1IXR A;  4PHE A;  4K4H A;  2EAP A;  9ICX A;  1UEV A;  5L1L A;  4NLZ A;  5T14 A;  2BQ3 A;  4QWD A;  3KD3 A;  2ASD A;  3E2E A;  3GII A;  4LT6 A;  3BQ7 A;  1BPZ A;  2OM6 A;  2HBJ A;  1NJW A;  4F71 A;  4FO1 A;  3IM1 A;  4HX0 A;  4X4N A;  1EXN A;  4KX5 A;  4M2Y A;  4NWI A;  4CF3 A;  3RB0 A;  5B3Q A;  1TE2 A;  4EX6 A;  1SL2 A;  2DRA A;  4Y2U A;  2BCS A;  1NOM A;  4EBK A;  4AT9 B;  1KFD A;  3GIJ A;  1CI4 A;  9ICF A;  3CW2 C;  5KFK A;  1RDF A;  3NTU A;  9ICE A;  5KFM A;  1HIW A;  2PFN A;  1LV5 A;  4O3Q A;  5ALP A;  4GXI A;  2VA2 A;  4YMN A;  4NJ8 A;  3JPO A;  4AT9 A;  3IHQ B;  2HBL A;  3NYB A;  4X4Q A;  2AU0 A;  8ICB A;  2LM4 A;  8ICX A;  4DFJ A;  3OV7 A;  2WF8 A;  3IRU A;  2JEJ A;  1NJX A;  5DED A;  2J6S A;  2DR8 A;  2E1F A;  2QB0 B;  1L7O A;  4CRX A;  1ZD2 P;  4EEN A;  4WC4 A;  2I1Q A;  2LYH A;  1QQ7 A;  1KFS A;  2ZXH A;  4QZ9 A;  4B9S A;  1Q3V A;  5HRD A;  1BPD A;  1FEZ A;  4BJQ A;  5AI8 A;  3VCB A;  4ECS A;  5AM0 A;  2KD1 A;  4FZL A;  2RDI A;  2QB0 A;  5HRH A;  3Q8L A;  4BXO B;  5AIC A;  4USA A;  5IIJ A;  3HRD D;  3RAQ A;  1ZQM A;  5KFV A;  4K99 A;  5DBC A;  2MA1 A;  5EWE A;  4PZN A;  1RQL A;  2KG5 A;  3H4B A;  1D8Y A;  4EBD A;  1SV0 A;  3IG5 A;  2JEI A;  1UEU A;  4C80 A;  4BXO A;  2KOB A;  1Z4N A;  4F50 A;  3OJS A;  1U47 A;  3KZX A;  3PVX A;  3H4D A;  1TKD A;  1T7P A;  2V4R A;  4RQ7 A;  4O3P A;  3QU7 A;  3IN5 A;  2DL0 A;  1VLB A;  2KIC A;  1O08 A;  2XVT A;  3QUQ A;  3DV9 A;  3C2L A;  1QSL A;  1UT5 A;  2O5A A;  2HI0 A;  3F5A A;  1SXE A;  4UAW A;  2ZUD A;  2E8M A;  3BDP A;  1MIV A;  1SWW A;  2XI9 A;  2NRZ A;  5JU5 A;  2NRK A;  2ZXI A;  3M9N B;  2BQU A;  5J2I A;  1VDV A;  4CNQ A;  3MBY A;  5AM2 A;  4DL7 A;  2ZH2 A;  5KFD A;  1URJ A;  3D6J A;  5DDY A;  2ESE A;  1P7D A;  2XID A;  8ICQ A;  2FPM A;  3RFA A;  5J0Y A;  2DGZ A;  5KT7 A;  5AI5 A;  1NK0 A;  1ZYQ A;  1D8L A;  2CXY A;  3KHH A;  4ED0 A;  3ETR A;  1QSS A;  2FLL A;  4RQ8 A;  3BS7 A;  3KHL A;  1RZT A;  5CP2 A;  4QZE A;  5J8Y A;  2BR0 A;  4NV0 A;  7ICM A;  1JXE A;  4KLQ A;  2EH9 A;  4Q44 A;  4ECQ A;  1ZQR A;  1S5L U;  3HKZ C;  5IIO A;  5J2G A;  2R8H A;  2KJ5 A;  2XCP A;  5HML A;  4XUS A;  4RQ4 A;  4PGX A;  3Q8M A;  1TV9 A;  1PK3 A;  5F3X B;  1NK7 A;  1D8B A;  2DR7 A;  4K9A A;  2PFQ A;  1B43 A;  1HUO A;  1BVS A;  4EP7 A;  3MR5 A;  2K60 A;  2NV3 A;  4US8 A;  3HIL A;  9ICU A;  2W11 A;  1ZQS A;  3QZ8 A;  1F0M A;  5KFT A;  2HBK A;  5C5J A;  1RQN A;  4O3O A;  3ZDE A;  8ICC A;  4YN4 A;  5KFR A;  4P0P B;  3RB3 A;  2FDR A;  4JMU A;  5CA7 A;  2J6T A;  8ICA A;  3S6J A;  2OXO A;  2YTU A;  4LZD A;  8ICR A;  3WK4 A;  8ICU A;  2XGQ A;  9ICP A;  2KZ3 A;  1TAM A;  2LYB A;  1KDH A;  1BPX A;  3WK7 A;  1ZQ1 C;  4UB4 A;  4I2G A;  4P0P A;  5ALU A;  2I9G A;  4CF5 A;  1XSL A;  4KLI A;  2BDP A;  1X2I A;  4FBU A;  1Z19 A;  3KKA A;  4OO1 J;  8ICW A;  5KL8 B;  2IHM A;  4P4P A;  5HRF A;  4GXK A;  2HN2 A;  4F3O A;  4AT8 A;  2UVU A;  2RDJ A;  3K4G A;  1QLN A;  4UAV A;  4R8U B;  1S0M A;  4M9J A;  1DGJ A;  3AM9 A;  4FZN A;  2JMG A;  2WTF A;  4F8R A;  4DF4 A;  4KLT A;  2L5Y A;  5ALD A;  5EE3 A;  4F5R A;  2ALZ A;  4YD2 A;  4R8U A;  5KG5 A;  5JUM A;  5TZV A;  2JZB B;  3WFO A;  2Y1I A;  3ZI4 A;  4Q8F A;  4KN7 A;  2FPL A;  3N28 A;  3ISD A;  2AGO A;  3PW4 A;  3SAF A;  4YVZ A;  5KFE A;  4O3R A;  4LZG A;  2HDO A;  7ICS A;  1NKB A;  3AQM A;  3HJ4 A;  2I5H A;  2F2A B;  3SQI A;  1NNL A;  4U6P A;  4TQS A;  2A3V A;  1MC8 A;  2JZB A;  2KKP A;  4WC6 A;  2ZJA A;  3NRW A;  1COK A;  4O3M A;  4RQ0 A;  1ZQE A;  4Q43 A;  4C0Z A;  4I0U A;  4CDG A;  3PR5 B;  1X42 A;  2F3N A;  5ALL A;  4RQ2 A;  1WCL A;  9ICR A;  1ZD5 A;  1PVP A;  4TQR A;  2HHQ A;  2YB1 A;  1UCV A;  9ICJ A;  4M5D A;  2XC9 A;  3MCR A;  3SD7 A;  2BCU A;  3NAS A;  3G6Y A;  8ICM A;  4EEB A;  1PZN A;  3MAB A;  1X9S A;  5DKW A;  5JTG A;  1QCK A;  1ZQQ A;  5AKJ A;  1MN8 A;  1TK0 A;  2EAN A;  4WC3 A;  4FZM A;  3OHA A;  1S0N A;  3B0X A;  1NK5 A;  5J0T A;  3TQ1 A;  5AIA A;  4DSI A;  3C18 A;  4QZH A;  4RQ3 A;  5DLF A;  4PH5 A;  4QW9 A;  4YFK A;  8ICO A;  8ICY A;  4KLO A;  7ICG A;  4EZ6 A;  4TUP A;  1O03 A;  3M9M B;  2ZTD A;  1ZQA A;  3LDA A;  4PHD A;  4I28 A;  3V6K A;  4M0A A;  3EWA A;  2VJ4 A;  4US9 A;  2HHV A;  9ICO A;  1PX5 A;  5KG3 A;  1XO0 A;  3RRG A;  3KTQ A;  3PX0 A;  1B0X A;  4J9L A;  4ATB B;  2IOF K;  3SV4 A;  4ZH4 A;  5B3P A;  2W9M A;  3C23 A;  5DQI A;  4NM2 A;  7ICL A;  5CRX A;  4O3S A;  3TAC B;  4KM5 A;  3TFS A;  1FFV A;  2EQY A;  4UB6 U;  4F2R A;  4EV6 A;  3UXO A;  7ICF A;  2YY6 A;  4DQP A;  4ATB A;  3WFR E;  5KG2 A;  2ZIU B;  4MF2 A;  5AKI A;  4F2S A;  4BGD A;  1K5O A;  2OH2 A;  2A19 A;  4JV1 A;  4QIW C;  5DB6 A;  4J9S A;  2V4Q A;  2LI6 A;  3SYZ A;  2ZIU A;  3ORY A;  5BPC A;  1UT8 A;  4X4U A;  1RM6 C;  5DGB A;  1ZET A;  2JH1 A;  2DPJ A;  2YMP A;  4DL6 A;  2ASL A;  2DBY A;  1UQV A;  3SEI A;  5GTI U;  4ECR A;  3RR8 A;  1RYS A;  2HOI A;  1JUD A;  2W9B B;  3D2Q A;  5KFS A;  3SAG A;  3KHG A;  2KK0 A;  1S0V A;  4NXT A;  5DG8 A;  3GIM A;  2ZH8 A;  2DUY A;  1A0P A;  2ZUB A;  3PO5 A;  3NVY A;  2QLT A;  4I2F A;  4F4Z A;  1V4A A;  1IV8 A;  2W9B A;  2IMW P;  1XS9 D;  5J2K A;  5ALG A;  2KSO B;  1ZQH A;  5AK5 A;  5KFF A;  4RUC A;  5KFQ A;  4KIT B;  9ICA A;  1SGG A;  4RT3 A;  2XY6 A;  3QUT A;  4QWA A;  2Q0Z X;  2W3S A;  1SB3 C;  1YLQ A;  5AK4 A;  4YG2 A;  4YMO A;  3VC8 A;  5DQH A;  5HR9 A;  2KSO A;  4AT7 B;  3MDA A;  2EZX A;  2ZJ8 A;  2ZH5 A;  4JWM A;  3PSP A;  4EEL A;  2HCF A;  5KAF U;  2HHT A;  1VJ5 A;  1MQ2 A;  4Z6D A;  2PFP A;  4DS4 A;  1JQR A;  1DK2 A;  3ZD8 A;  4RQ6 A;  8ICI A;  4AT7 A;  5J2B A;  3RJJ A;  3AQL A;  2IOH A;  1VFG A;  4ECV A;  1CRX A;  2E5S A;  1KKX A;  4Y2X A;  2P35 A;  1V38 A;  1RYU A;  1ZQL A;  2JEF A;  2R8J A;  1KNY A;  2K4H A;  3UXN A;  3TAR A;  4N7R A;  2BPC A;  2V9W A;  4ECT A;  2JRZ A;  3H39 A;  5EE0 A;  5AHX A;  5AI0 A;  4IQW A;  5J0X A;  5KL1 B;  3QE9 Y;  4WC5 A;  7ICR A;  1LB2 B;  4OAG A;  5D4B A;  4DQR A;  3V72 A;  5CFS A;  1R8C A;  1T4G A;  3QYP A;  2BDU A;  2AGQ A;  5J2H A;  4J9M A;  4O5E A;  2YQE A;  2O6K A;  1BPE A;  3TKA A;  2QAR B;  4F4X A;  3FC4 A;  2H3V A;  3HIY A;  4G9B A;  8ICS A;  4JV2 A;  2EDU A;  2H3Z A;  4NL9 C;  4G3I A;  1S10 A;  3C5G A;  1T3Q A;  1NKC A;  1BPB A;  4QZD A;  3ED5 A;  2QAR A;  2AQ0 A;  5AKE A;  4DSJ A;  3SV3 A;  2R8K A;  4P4O A;  1S97 A;  2DVI A;  3GV8 B;  4OD0 A;  4ED8 A;  5DDM A;  1ZQW A;  3NVZ A;  5HR6 A;  8ICJ A;  3GQC A;  4YP3 A;  4I2I A;  2W43 A;  3I28 A;  7ICQ A;  3N7S C;  3KOO A;  2JXJ A;  1U48 A;  1NK6 A;  3B9J A;  2K8A A;  2KHV A;  2FMQ A;  1ZQN A;  5EE1 A;  2NO4 A;  2JR5 A;  3GIK A;  1SWV A;  4ACO A;  4EEK A;  2ZTE A;  4F4K A;  3H8M A;  2EZZ A;  3LVW A;  2BGW A;  5D46 A;  4ECY A;  3AMZ A;  4C4R A;  4UB5 A;  4I29 A;  1IG6 A;  2AGP A;  1YZ6 A;  1TK8 A;  4JLZ A;  4KLU A;  5J2F A;  3N7R C;  1S77 D;  2M9N A;  2IA6 A;  4AYB F;  5KNI A;  7ICV A;  1JIH A;  1WYG A;  2JHD A;  1JAL A;  2G09 A;  2K4E A;  4UB3 A;  2KVS A;  3PR4 A;  9ICV A;  4O0I A;  1ZQP A;  3H0L B;  4DOB A;  1U45 A;  4KLS A;  1Z1B A;  5KFH A;  1J2N A;  2Y0S F;  3NS1 A;  8ICH A;  4ED6 A;  1OU5 A;  5A0L A;  2F1H A;  3A0H U;  5H2F U;  4FBT A;  3A0B U;  4RNO A;  3ZDA A;  1WUD A;  3M1Y A;  9ICB A;  1D9F A;  4MHV A;  2LM1 A;  4Y2V A;  2RQ5 A;  3N4M B;  5BOL A;  3PNC A;  4PHP A;  5AKX A;  1HEK A;  3EPG A;  2AQ4 A;  2XIC A;  4ECZ A;  4OAF A;  4WBZ A;  2Y0S C;  4K97 A;  5ALE A;  5KG0 A;  3JCF A;  2ZIW B;  4IQU A;  4C4S A;  5IIN A;  3RJI A;  3PX4 A;  4R63 A;  3ZDD A;  3PO4 A;  4Q8E A;  1A6S A;  3T5J A;  1QQ5 A;  2IHN A;  4KLF A;  1B4F A;  3MGH A;  1X66 A;  1XWL A;  5KFL A;  4UBB A;  2H3Q A;  4RQM A;  2J6U A;  4KLD A;  4FS1 A;  1KW4 A;  5AKL A;  2NYV A;  3H38 A;  4Q45 A;  3WKA A;  9ICH A;  5HHH A;  3H3A A;  4UAZ A;  2ZIW A;  4Y2Y A;  5KFX A;  4RQ1 A;  2VJ5 A;  3EW9 A;  2LHT A;  4UBC A;  1R89 A;  4ED2 A;  3PZP A;  4EBC A;  4B9V A;  3RTV A;  2OHF A;  4NXU A;  5J0P A;  5AKY A;  1F5S A;  4BUG A;  3OWG A;  4B9T A;  3ZDC A;  1N5X A;  4WCW A;  4IQV A;  4YR2 A;  1S76 D;  3PSF A;  1WWU A;  4X4P A;  5ALX A;  2DPI A;  1UA0 A;  1Z3E B;  9ICC A;  1X9X A;  4FHX A;  4LEV A;  2UVV A;  2B56 A;  4FH5 A;  5DQG A;  1TFW A;  1A76 A;  4MEX A;  1KLN A;  2FPK A;  1QH9 A;  3RH5 A;  3GFK B;  4DWI A;  2KP7 A;  1YZ7 A;  3RBE A;  4RQN A;  9ICI A;  1L7P A;  1KL9 A;  3JZ0 A;  1L3U A;  4TUQ A;  2C28 A;  3H7I A;  3GU3 A;  7ICP A;  3OUY B;  3F53 A;  3AU6 A;  2DF4 B;  5CB1 A;  2JEG A;  7ICH A;  2M2V A;  1JX4 A;  3MDC A;  1R8A A;  1NK8 A;  2GOL A;  4GXJ A;  3THV A;  2UVW A;  1ZQT A;  3O0F A;  3QU9 A;  4PJ0 U;  4M9N A;  1BNP A;  4C8N A;  7ICI A;  3OUY A;  4IC9 A;  2G06 A;  3BS5 B;  4KN4 A;  5HC9 A;  4IR9 A;  1DGS A;  5CHE A;  3QZ7 A;  4F93 B;  4RPX A;  2EWR A;  4C7Y A;  3Q8K A;  4M04 A;  2ZG6 A;  4O5C A;  4PL1 A;  3C5F A;  5HRL A;  5D62 A;  4WQK A;  5J2C A;  3F2B A;  5KG6 A;  1L8L A;  4FHP A;  4HYK A;  5HRI A;  3UXP A;  4YCX A;  2ZTC A;  3RJK A;  4BWM A;  5KFG A;  1QSY A;  3JPQ A;  1N56 A;  1L7M A;  1BGX T;  3BS5 A;  1JI7 A;  2E1E A;  2WF6 A;  3LYS A;  4IRK A;  4IS7 A;  2P6R A;  4DSF A;  1V97 A;  3AU2 A;  1LKY B;  3QXG A;  5BOM A;  4IRD A;  3HX0 A;  3AUO A;  3PW7 A;  1V9P A;  4X5V A;  3GDX A;  2KV2 A;  4UB8 U;  1GPJ A;  3T5K A;  2EAO A;  4OAH A;  2KNJ A;  4F72 A;  4YMM A;  4QNL A;  5AKG A;  4I2A A;  4RNM A;  1JN3 A;  2MRL A;  5ALR A;  4UD5 A;  3H40 A;  1LKY A;  3OVB A;  4DL5 A;  2BPF A;  5F9L A;  4UAS A;  4DL2 A;  3QU5 A;  1NJZ A;  1KEJ A;  3JPP A;  4WC2 A;  5L1M A;  2KIV A;  2D3D A;  1N60 A;  2MAX A;  4EGW A;  3PML A;  5D49 A;  2WB1 F;  4C8K A;  2JGA A;  4QJF B;  4J9P A;  4ECW A;  1N62 A;  5KT2 A;  3V6H A;  2VA3 A;  3PW0 A;  9ICG A;  3OTQ A;  2VIX A;  3UPS A;  3HT3 A;  2R8I A;  2K8C B;  2NRT A;  3KBB A;  5KFJ A;  5E79 U;  3N7P D;  4QZB A;  5K4L A;  3E0F A;  3AL0 B;  1SKW A;  1PUZ A;  3Q8R B;  2WAQ F;  2WB1 C;  4RUA A;  2PKE A;  5HRE A;  4F5Q A;  3LK9 A;  3F5E A;  1QQ6 A;  1M6Y A;  5ALK A;  1VJ7 A;  5J2E A;  1S8O A;  1ZQB A;  2IHO A;  4F5N A;  3ETL A;  4DFD A;  2W7P A;  1ED1 A;  3WK6 A;  4X0B A;  9ICS A;  3WK9 A;  5ALZ A;  1X6J A;  5J0Q A;  3C1Y A;  1ZQI A;  1XSN A;  4ELU A;  5J0O A;  2DKZ A;  2WAQ C;  3EZ5 A;  2YMM A;  3K75 D;  5JRT A;  3IV6 A;  2HOF A;  5KAI U;  1WWV A;  1OXJ A;  2NRX A;  4UAY A;  1PK1 B;  5DG7 A;  2ZH4 A;  2BZF A;  4FHW A;  3SEN A;  2ZJ5 A;  1Q46 A;  5CHG A;  2PI5 A;  4DS5 A;  4O6A A;  1FFU A;  5CJ7 A;  2HVH A;  1L5U A;  4OJL A;  3LWL A;  2QB1 A;  1ZQJ A;  1PK1 A;  2KTQ A;  4I2H A;  3HW8 A;  2NO5 A;  5DBB A;  4QW8 A;  4K4G A;  4NLB A;  3U26 A;  3UQ2 A;  4UAR A;  5KFI A;  8ICZ A;  3CK6 A;  3RH4 A;  3TAD C;  4EX7 A;  3I1Y A;  4CF4 A;  4IR1 A;  2BPG A;  7ICE A;  3H8J A;  4OAI Z;  3WFS C;  2DQN B;  2G5I B;  5AI9 A;  3G6X A;  3RH6 A;  1COO A;  4X4T A;  3ZDB A;  4YR3 A;  2ZHB A;  1SKR A;  4TUS A;  7ICK A;  4CCH A;  2FMS A;  1ARO P;  4RT2 A;  4CGZ A;  1DRG A;  2W3R A;  1JAJ A;  3QU2 A;  4F5O A;  1MA7 A;  3TI0 A;  3G6V A;  5J2D A;  2BCQ A;  3OGU A;  4EYI B;  4Y2S A;  2MSN A;  4ZOH C;  5AIB A;  1FA0 A;  1ZD3 A;  1PVQ A;  2KKV A;  2KIW A;  5IIK A;  1ZXI A;  4LEY A;  4K4I A;  2PFO A;  1H38 A;  4ELT A;  4NLC A;  1KQQ A;  3M6Z A;  4WH5 A;  4KLG A;  9ICK A;  5ALS A;  3ISC A;  3OVA A;  3JPT A;  3D2S A;  2C22 A;  2K4P A;  3MGI A;  2ZIX B;  5L1I A;  4TUR A;  3IP4 B;  4GFJ A;  4PGQ A;  2YB4 A;  3QNM A;  4F5P A;  3Q8P B;  3BJY A;  9ICQ A;  4C8M A;  1JRP A;  4M9L A;  1DOQ A;  4CE6 A;  4DLE A;  3I76 A;  3PST A;  1RG6 A;  1C7Y A;  5TIS U;  2ZIX A;  7ICT A;  1Q79 A;  4F92 B;  4DOC A;  3L9D A;  2GH1 A;  5C0Y A;  2ZH9 A;  5CWR A;  5D61 A;  2HMX A;  4F91 B;  1ZQO A;  2YMQ A;  4OJ5 A;  2GLE A;  5F9N A;  4O3N A;  1V85 A;  4B9M A;  4XRH A;  3MFI A;  4RWO A;  3UMG A;  5HP4 A;  8ICN A;  1NZP A;  5KFU A;  2FI1 A;  4B6J A;  1R8B A;  2WFA A;  2KMD A;  4O5K A;  4E8F A;  2VAN A;  2GA9 D;  9ICT A;  5J0U A;  4J9R A;  1N63 A;  1LVH A;  2HHS A;  3T79 A;  4FH3 A;  8ICE A;  2HHU A;  4OJP A;  3J81 j;  5DGA A;  2BE3 A;  5AM1 A;  2JH7 A;  3WK8 A;  2CRX A;  4IL6 U;  3BZK A;  5AM3 A;  1NKE A;  5ALJ A;  3E58 A;  3WKB A;  5ALM A;  5ALN A;  4A8E A;  5DB8 A;  1JMS A;  4PHA A;  3V7L A;  4J9O A;  3BZC A;  2B6G A;  4UW9 A;  2ES6 A;  4O68 A;  2KE7 A;  2I6X A;  5ALF A;  3NVO A;  2ASJ A;  3QUB A;  4ELV A;  1BNO A;  3M9O B;  4S3N A;  3AQF A;  4IQT A;  4PL2 A;  4QZI A;  2LMR A;  1ZQG A;  3RBD A;  2EZY A;  5ALW A;  1L3T A;  3RJH A;  5DEC A;  5EE9 A;  3OJU A;  4KLH A;  1XSP A;  1ZQZ A;  3QUC A;  2VA8 A;  3LVV A;  4RQ5 A;  1ECW A;  4LEW A;  1UA1 A;  1JXL A;  2HHX A;  4X4S A;  3IG8 A;  1BPY A;  1KRP A;  1C20 A;  4NXW A;  3PSI A;  4PPX A;  1WCN A;  4I2J A;  5CR0 A;  4NL9 A;  3TFR A;  3DDH A;  3H8S A;  3HPO A;  2CN1 A;  3SI8 A;  4R64 A;  4WBY A;  3MFH A;  3F2D A;  4EED A;  2IOF A;  2Q4T A;  9ICW A;  3K7D A;  3UM9 A;  3FDS A;  2AHO B;  1ZQV A;  2BKE A;  5KFY A;  2FE9 A;  4MF8 A;  5AKZ A;  2DFL A;  4B9L A;  1NZB A;  3T3F A;  1X9W A;  3NVW A;  5AKH A;  5KG4 A;  4JLX A;  3CNH A;  4E80 A;  5KT4 A;  2K89 A;  4YXM A;  1CUK A;  5KFP A;  3T5L A;  3M6K A;  3CRX A;  2F1I A;  5HRK A;  2OYY A;  2YN4 A;  3QEA Z;  4X4R A;  1TAQ A;  2W54 A;  2DKX A;  4F4Y A;  8ICG A;  3ERC C;  4O69 A;  2HHP A;  5KFC A;  1N5W A;  2FLN A;  4MEY A;  5KT5 A;  3RB4 A;  2IBK A;  5KFW A;  3TAN A;  3NWI A;  7ICO A;  3MGV A;  1L7N A;  1K1Q A;  4J9K A;  2W03 A;  4GLX A;  2W9C B;  5KT3 A;  1KN5 A;  2HOQ A;  3JPR A;  7ICN A;  4DCC A;  5IIM A;  1Q78 A;  4YQW A;  3OSN A;  1WOT A;  3NVV A;  4FFD A;  5KG1 A;  4Z6C A;  4AP9 A;  3QEB Z;  4WJ3 B;  3ISB A;  4R65 A;  3AQK A;  1SV0 C;  2W9C A;  3C29 A;  5D63 A;  4AYB C;  2RLT A;  3WU2 U;  4RNN A;  3JYY A;  2RP5 A;  2ISP A;  3EYZ A;  2N1R A;  2AXT U;  4I2E A;  8ICP A;  2B51 A;  4QZ8 A;  1U4B A;  3PW2 A;  3TAP A;  2B4V A;  9ICN A;  4X4O A;  3MC1 A;  4X0A A;  2F8K A;  3FYH A;  3OSP A;  2HBM A;  5ALH A;  4JV0 A;  4RZR A;  2R18 A;  4NLN A;  2KVC A;  2KZZ A;  2YX8 A;  3AQN A;  5L9X A;  3H0M B;  4LVS A;  2F76 X;  4BWJ A;  4I27 A;  1ZRN A;  3H37 A;  3CP8 A;  4OCZ A;  3LQC B;  4KTQ A;  1UHU A;  4DF8 A;  1KFT A;  4C8L A;  3C2M A;  3WFP A;  4Z6F A;  1OUQ A;  1MIY A;  2LBO A;  3C28 A;  4DFM A;  4Z6E A;  1Z00 B;  4PZO A;  2XGP A;  4FHY A;  2M2U A;  1ZD4 A;  1L8O A;  5AK3 A;  2WF5 A;  1FO4 A;  4YXJ A;  4C4T A;  2DR5 A;  4XQ7 A;  3PW5 A;  2ZUC A;  2NRV A;  3BQ2 A;  4J03 A;  1RXW A;  1U9L A;  2H3F A;  4DL3 A;  3Q8S B;  4XA5 A;  2F8L A;  4Y2Q A;  3OHB A;  5J0W A;  5G5H A;  1Z00 A;  3ER9 B;  1UET A;  1T94 A;  1ZQY A;  2G0A A;  3OPX A;  1ZQC A;  2WHE A;  3WK5 A;  1MIW A;  4JB3 A;  4J9N A;  2ATL A;  4FO6 A;  4EZ9 A;  3NKU A;  5KFZ A;  5AM4 A;  5J8Y C;  5J0S A;  5DB9 A;  3HKZ F;  4JK1 A;  2LYA A;  4QZC A;  3SZ2 A;  1HUZ A;  1L3S A;  2WF9 A;  4M6W B;  4WC0 A;  7ICJ A;  4Y2T A;  3L5K A;  1B22 A;  2Y9T A;  1DK3 A;  1OW5 A;  3UMB A;  1NK4 A;  2BBH A;  4R66 A;  2GWS A;  1XU4 A;  4KMO B;  3ER8 C;  3ZD9 A;  4QZF A;  4M6W A;  2JV3 A;  2LPE A;  1ZQF A;  4ECU A;  4RWQ A;  3AQE A;  2C2E A;  5HHI A;  4MFA A;  3N97 B;  1ZJM A;  5III A;  4OJO A;  4QZG A;  5EOZ A;  3KFU F;  2XCA A;  4JUZ A;  3MR6 A;  1KTQ A;  4ECX A;  1SXD A;  2ID1 A;  4B9N A;  5HMM A;  5KT6 A;  2Y1J A;  3C21 A;  3BQT A;  1S0O A;  4DQS A;  1FIQ A;  2ZIV B;  4ED1 A;  3RB6 A;  2UVR A;  4UB1 A;  2FMP A;  2OWO A;  1ZRM A;  2F1J A;  4M47 A;  5ALQ A;  3RJG A;  5DB7 A;  4DL4 A;  4KLM A;  4RWN A;  3V6J A;  4Y2J A;  3KKA C;  3GIL A;  2ZIV A;  1T3N A;  4P0Q B;  5AK6 A;  1TVA A;  5ALO A;  1ZQX A;  3NRZ A;  4RPY A;  2K4I A;  4NLK A;  5CEH A;  3HJE A;  3WFQ E;  4I2C A;  4AT8 B;  3DEE A;  3FM9 A;  3RJE A;  1YT3 A;  4DFP A;  2HSZ A;  2ZH3 A;  2W7O A;  1ZJN A;  2RRD A;  3WKC A;  4QWE A;  2C2R A;  4P0Q A;  4UB2 A;  2F77 X;  1N48 A;  2MU2 A;  4XQ8 A;  4DLG A;  3LWM A;  4FE3 A; 
#chains in the Genus database with same CATH homology
 1ARO P;  4RT2 A;  3PVX A;  2FLP A;  1BPE A;  3H4D A;  4PGY A;  4F4X A;  4GC7 A;  4ED3 A;  1NJY A;  1TKD A;  2V4R A;  1T7P A;  1JAJ A;  4RQ7 A;  4O3P A;  3HIY A;  3PV8 A;  5KTQ A;  4F5O A;  8ICS A;  2PBE A;  4RU9 A;  2W9A A;  4JV2 A;  3TI0 A;  3JPS A;  1XC9 A;  3PY8 A;  3G6V A;  5J2D A;  1MSW D;  5F2V O;  2BCQ A;  3JPN A;  5L1K A;  3OGU A;  4EYI B;  4G3I A;  1S10 A;  3M8S A;  3C5G A;  1XO1 A;  2M2T A;  1NKC A;  2KN7 A;  4J9M A;  1BPB A;  4QZD A;  1FA0 A;  2W8L A;  2AQ0 A;  3C2L A;  4FS2 A;  1UT5 A;  1QSL A;  4DSJ A;  4KLE A;  5IIK A;  2XY5 A;  3SV3 A;  4EYH B;  4K4I A;  4UQG A;  3PX6 A;  2PFO A;  4P4O A;  1H38 A;  2R8K A;  3RJF A;  2O5A A;  4UAW A;  4ELT A;  2ZUD A;  1S97 A;  3BDP A;  1MIV A;  2DVI A;  3GV8 B;  3TAQ A;  4KLG A;  4ED8 A;  9ICK A;  5DDM A;  3BQ1 A;  1KSP A;  1ZQW A;  2NRZ A;  5DBA A;  3ISC A;  5HRG A;  1F5A A;  2NRK A;  3M9N B;  2BQU A;  2O1P A;  4QZA A;  5J2I A;  3OVA A;  8ICJ A;  3JPT A;  3MBY A;  5HRI A;  2C22 A;  4DL7 A;  3GQC A;  3H8W A;  2ZHA A;  5KFD A;  5DDY A;  3MGI A;  4YP3 A;  2BQR A;  2ZH2 A;  4I2I A;  5L1I A;  4TUR A;  5J29 A;  7ICQ A;  4PGQ A;  4F5P A;  2FPM A;  3RJK A;  5J0Y A;  8ICQ A;  4DSE A;  5KT7 A;  3Q8P B;  3BJY A;  1U48 A;  1NK6 A;  9ICQ A;  1NK0 A;  1ZYQ A;  4C8M A;  1D8L A;  2FMQ A;  2KFN A;  4X4V A;  3KHH A;  1ZQN A;  4ED0 A;  4M9L A;  4ED7 A;  1DOQ A;  1QSS A;  2FLL A;  1RPL A;  4RQ8 A;  4DLE A;  9ICL A;  4WC7 A;  1C7Y A;  7ICT A;  3GV7 B;  3GIK A;  3KHL A;  2M2W A;  1Q79 A;  4F92 B;  4DOC A;  3L9D A;  1RZT A;  2ZH9 A;  5EWF A;  2ZTE A;  5CP2 A;  4QZE A;  5CWR A;  2BR0 A;  4F4K A;  8ICT A;  4F91 B;  1ZQO A;  7ICM A;  4UD4 A;  1JXE A;  4KLQ A;  5F9N A;  3HJ4 A;  4O3N A;  4Q44 A;  4ECQ A;  1ZQR A;  5J0R A;  2BHN A;  8ICK A;  4B9M A;  5IIO A;  5J2G A;  2R8H A;  2BGW A;  5D46 A;  4ECY A;  2XCP A;  1T8E A;  5HML A;  3RAX A;  4XRH A;  4UB5 A;  3MFI A;  2BCR A;  4AT7 A;  4RWO A;  5HP4 A;  2Q66 A;  2PI4 A;  4DSL A;  8ICN A;  4EEY A;  9ICM A;  5KFU A;  4XUS A;  4RQ4 A;  4PGX A;  3Q8M A;  1TV9 A;  4I29 A;  1NZP A;  2AGP A;  1R8B A;  1NK7 A;  2KZM A;  2DR7 A;  3RR7 A;  1TK8 A;  1ZQK A;  3B0Y A;  4KLU A;  2PFQ A;  1B43 A;  5J2F A;  1S77 D;  1HUO A;  2M9N A;  1BVS A;  1IM4 A;  1X9M A;  3UQ0 A;  2IA6 A;  4I28 A;  4O5K A;  4EP7 A;  3MR5 A;  2XO7 A;  4E8F A;  2VAN A;  7ICV A;  1JIH A;  9ICT A;  5J0U A;  4UB3 A;  2P66 A;  9ICU A;  3PR4 A;  4J9R A;  9ICV A;  4O0I A;  1ZQP A;  1ZQS A;  4DOB A;  3QZ8 A;  5KFB A;  1U45 A;  4KLS A;  1CEZ A;  4MFC A;  5KFH A;  4RWP A;  5KFT A;  2HHS A;  5C5J A;  8ICL A;  1TFR A;  4FH3 A;  4O3O A;  3ZDE A;  8ICE A;  8ICH A;  8ICC A;  1U49 A;  2HHU A;  4ED6 A;  4YN4 A;  5KFR A;  3HWT A;  3RB3 A;  1OU5 A;  5CA7 A;  5DGA A;  2F1H A;  2J6T A;  2BE3 A;  8ICA A;  4DFK A;  4FBT A;  4DSK A;  4LZD A;  4RNO A;  3PMN A;  1NKE A;  3C2K A;  3ZDA A;  2MUT B;  8ICR A;  5DB8 A;  1SKS A;  4EBE A;  9ICB A;  1JMS A;  4PHA A;  1D9F A;  8ICU A;  2XGQ A;  3V7L A;  4J9O A;  9ICP A;  2KZ3 A;  4KMU A;  1Q78 A;  4NKU A;  1KDH A;  1BPX A;  4UB4 A;  4I2G A;  3N4M B;  1TFY A;  3GV5 B;  2I9G A;  5BOL A;  3PNC A;  1Y88 A;  4PHP A;  5KFN A;  3EPG A;  2AQ4 A;  1XSL A;  2ASJ A;  2RFF A;  4KLI A;  4ELV A;  2BDP A;  4ECZ A;  1X2I A;  4FBU A;  4FHV A;  4WBZ A;  8ICW A;  1BNO A;  3M9O B;  8ICF A;  2IHM A;  4P4P A;  5HRF A;  2MUT A;  4GXK A;  4S3N A;  2P6U A;  5KG0 A;  5KG7 A;  5J2J A;  4F3O A;  4AT8 A;  2UVU A;  4IQT A;  4IQU A;  1L3V A;  5IIN A;  3RJI A;  3PX4 A;  4R63 A;  2RDJ A;  3PO4 A;  3ZDD A;  4Q8E A;  3K4G A;  4IG8 A;  3T5J A;  1TK5 A;  2IHN A;  1NK9 A;  1QLN A;  4QZI A;  4KLF A;  4DEZ A;  4R8U B;  4M9H A;  1S0M A;  3MGH A;  1XWL A;  4UBB A;  5KFL A;  1ZQG A;  4KLD A;  4M9J A;  2J6U A;  3RBD A;  4FS1 A;  2DR9 A;  1L3T A;  2B21 A;  3RJH A;  5DEC A;  2ZH6 A;  3OJU A;  4KLH A;  3HJ1 A;  3H38 A;  1ZQU A;  4Q45 A;  1ZQZ A;  1XSP A;  2WTF A;  4F8R A;  4DF4 A;  1S9F A;  8ICY A;  5HHH A;  9ICH A;  3H3A A;  1A77 A;  4UAZ A;  2VA8 A;  4RQ5 A;  4KLT A;  4RPZ A;  1QTM A;  4NXZ A;  5KFX A;  4J9Q A;  4F5R A;  2ALZ A;  1UA1 A;  1JXL A;  4YD2 A;  2HHX A;  4X4S A;  4R8U A;  1BPY A;  5KG5 A;  1KRP A;  5JUM A;  4RQ1 A;  3EW9 A;  4UBC A;  5L1J A;  5TZV A;  4I2D A;  4ED2 A;  1R89 A;  2JZB B;  3WFO A;  2Y1I A;  4EBC A;  3KHR A;  4Q8F A;  4KN7 A;  4B9V A;  4PPX A;  2FPL A;  1WCN A;  4I2J A;  3RTV A;  5CR0 A;  3ISD A;  5J0P A;  3PW4 A;  2AGO A;  5DLG A;  3TFR A;  3V7K A;  3H8S A;  4YVZ A;  5KFE A;  3HPO A;  4DQQ A;  4O3R A;  3SI8 A;  3ZDC A;  4B9T A;  1NKB A;  4LZG A;  7ICS A;  3AQM A;  5J2A A;  1SL1 A;  4IQV A;  4YR2 A;  4R64 A;  2KFZ A;  1WOT A;  1NO5 A;  1S76 D;  4WBY A;  4TQS A;  5KFO A;  4MFF A;  4QWC A;  4X4P A;  1MC8 A;  2JZB A;  3MFH A;  2ZH7 A;  2DPI A;  4WC6 A;  1UA0 A;  1Z3E B;  9ICC A;  9ICW A;  2ZJA A;  3FDS A;  4FHX A;  5HRB A;  4JWN A;  1ZQV A;  8ICV A;  2UVV A;  4RQ0 A;  1ZQE A;  4Q43 A;  2HHW A;  4IRC A;  4FH5 A;  5DQG A;  2BKE A;  5KFY A;  3PR5 B;  1TFW A;  1A76 A;  4MF8 A;  4RQ2 A;  4MEX A;  4DOA A;  1WCL A;  2DFL A;  9ICR A;  4B9L A;  1KLN A;  4TQR A;  3T5H A;  2FPK A;  3T3F A;  4C8O A;  2HVI A;  2HHQ A;  1X9W A;  3RH5 A;  5KG4 A;  3GFK B;  4DWI A;  2KP7 A;  9ICJ A;  4E80 A;  5KT4 A;  3RBE A;  4M5D A;  4YXM A;  1CUK A;  5KFP A;  2H5X A;  2XC9 A;  3T5L A;  4M9G A;  9ICI A;  5DG9 A;  2F1I A;  3UPQ A;  2BCU A;  4KLJ A;  3JZ0 A;  1L3U A;  4TUQ A;  2C28 A;  1SL0 A;  3H7I A;  3NGD A;  5HRK A;  3G6Y A;  8ICM A;  4GC6 A;  7ICP A;  3OUY B;  3QEA Z;  1PZN A;  3MAB A;  3AU6 A;  1TAQ A;  1X9S A;  5CB1 A;  2JEG A;  7ICH A;  4X4R A;  5DKW A;  4F4Y A;  8ICG A;  2M2V A;  1JX4 A;  1ZQQ A;  2HW3 A;  3MDC A;  1R8A A;  1NK8 A;  2HHP A;  4E7X A;  5KFC A;  2W8K A;  1TK0 A;  2FLN A;  4MEY A;  4GXJ A;  3OVS A;  3Q8Q B;  3THV A;  2UVW A;  1ZQT A;  5KT5 A;  3HP6 A;  3M8R A;  3RB4 A;  2IBK A;  4WC3 A;  1K1S A;  5KFW A;  4NY8 A;  2ISO A;  3OHA A;  3TAN A;  1S0N A;  3B0X A;  1NK5 A;  4M9N A;  7ICO A;  5J0T A;  3TQ1 A;  4DO9 A;  1RXV A;  4DSI A;  1BNP A;  1HJP A;  3C18 A;  4C8N A;  1K1Q A;  4J9K A;  7ICI A;  3OUY A;  2W9C B;  4GLX A;  1RYR A;  5KT3 A;  4QZH A;  4KN4 A;  4I2B A;  3JPR A;  5HC9 A;  4IR9 A;  7ICN A;  4EBJ A;  1DGS A;  4RQ3 A;  5DLF A;  4PH5 A;  4F93 B;  4YFK A;  4RPX A;  4YQW A;  4QW9 A;  3QZ7 A;  5KFA A;  3OSN A;  5IIM A;  3Q8K A;  2C2D A;  4E0D A;  4M04 A;  4O5C A;  4KLO A;  2PXI A;  3C5F A;  1D9D A;  7ICG A;  5HRL A;  4QWB A;  4EZ6 A;  5J2C A;  5KG6 A;  4TUP A;  3MR3 A;  4FHP A;  5KG1 A;  4HYK A;  5EWG A;  2ZTD A;  4Z6C A;  3M9M B;  3LDA A;  4YCX A;  2ZTC A;  4PHD A;  3UXP A;  3QEB Z;  1ZQA A;  3C1Z A;  3ISB A;  3V6K A;  4BWM A;  5KFG A;  4R65 A;  3RRH A;  1QSY A;  4M0A A;  3AQK A;  3JPQ A;  1N56 A;  2W9C A;  1BGX T;  3EWA A;  4P4M A;  4O9M A;  2HHV A;  9ICO A;  1PX5 A;  5KG3 A;  3RRG A;  4KLL A;  3KTQ A;  3PX0 A;  3JYY A;  4RNN A;  4NLG A;  4J9L A;  4IRK A;  2ISP A;  4ATB B;  3EYZ A;  3SV4 A;  5HNK A;  2P6R A;  4ZH4 A;  4DSF A;  4I2E A;  8ICP A;  2W9M A;  4QZ8 A;  3C23 A;  1U4B A;  5DQI A;  3AU2 A;  4NM2 A;  3PW2 A;  3TAP A;  7ICL A;  5BOM A;  4IRD A;  3HX0 A;  3BQ0 A;  4O3S A;  9ICN A;  1MQ3 A;  4WC1 A;  4YD1 A;  2BCV A;  4X4O A;  3TFS A;  3AUO A;  3PW7 A;  4X0A A;  1V9P A;  4X5V A;  3GDX A;  3FYH A;  3OSP A;  4JV0 A;  5IIL A;  3EPI A;  2ZH1 A;  4RZR A;  1SZP A;  1U47 A;  4F2R A;  3C66 A;  3UXO A;  7ICF A;  2AJQ A;  4NLN A;  4DQP A;  4ATB A;  2KZZ A;  3WFR E;  5KG2 A;  5L9X A;  3MR2 A;  4NM1 A;  3AQN A;  3T5K A;  4BDP A;  4YR0 A;  4MF2 A;  4LVS A;  4F2S A;  4I2A A;  4YMM A;  4BWJ A;  2R8G A;  4P2H A;  1JN3 A;  4BGD A;  4RNM A;  4I27 A;  2A1J B;  4UD5 A;  3H40 A;  3H37 A;  3OVB A;  4JV1 A;  4F4W A;  4DL5 A;  2BPF A;  5F9L A;  1TAU A;  5DB6 A;  4DQI A;  4J9S A;  4DL2 A;  3LQC B;  4B9U A;  4KTQ A;  4DF8 A;  1KFT A;  1NJZ A;  4C8L A;  3C2M A;  3WFP A;  1KEJ A;  2V4Q A;  3JPP A;  4Z6F A;  4WC2 A;  2NRW A;  1MIY A;  3SYZ A;  7ICU A;  2MAX A;  3PML A;  5D49 A;  4DFM A;  4Z6E A;  1Z00 B;  3ORY A;  2A1J A;  2XGP A;  4FHY A;  2M2U A;  5BPC A;  1UT8 A;  3V7J A;  4C8K A;  4X4U A;  4YXJ A;  1ZQD A;  5DGB A;  1ZET A;  2DR5 A;  4J9P A;  4ECW A;  2DPJ A;  4XQ7 A;  3PW5 A;  2ZUC A;  2NRV A;  5KT2 A;  4DL6 A;  1IXR A;  4PHE A;  2XY7 A;  3BQ2 A;  4K4H A;  3V6H A;  1RXW A;  1U9L A;  2VA3 A;  9ICX A;  1UEV A;  2ASL A;  5L1L A;  3PW0 A;  4DL3 A;  4NLZ A;  9ICG A;  3Q8S B;  4XA5 A;  3UPS A;  2BQ3 A;  2NRT A;  3HT3 A;  5KFJ A;  3OHB A;  2R8I A;  5J0W A;  4QWD A;  4ECR A;  1Z00 A;  3RR8 A;  1RYS A;  1UET A;  1ZQY A;  4QZB A;  2W9B B;  1ZQC A;  5KFS A;  1MIW A;  3KHG A;  2ASD A;  1S0V A;  3E2E A;  3GII A;  4J9N A;  1SKW A;  4LT6 A;  1BPZ A;  2ATL A;  4FO6 A;  5DG8 A;  1NJW A;  4EZ9 A;  3IM1 A;  5KFZ A;  3Q8R B;  3GIM A;  4X4N A;  1EXN A;  4M2Y A;  2ZH8 A;  2DRB A;  5J0S A;  4RUA A;  5DB9 A;  2ZUB A;  3PO5 A;  4JK1 A;  3RB0 A;  5HRE A;  4F5Q A;  4I2F A;  3LK9 A;  4QZC A;  3SZ2 A;  1VJ7 A;  1HUZ A;  1L3S A;  1SL2 A;  2DRA A;  4M6W B;  4F4Z A;  4WC0 A;  2BCS A;  1NOM A;  1V4A A;  5J2E A;  1KFD A;  7ICJ A;  4AT9 B;  1ZQB A;  2W9B A;  4EBK A;  4O5E A;  3GIJ A;  4F5N A;  3ETL A;  1XS9 D;  2IMW P;  1B22 A;  5J2K A;  9ICF A;  1DK3 A;  4X0B A;  9ICS A;  5KFK A;  1NK4 A;  1ZQH A;  3NTU A;  9ICE A;  4R66 A;  2GWS A;  5KFF A;  4RUC A;  1XU4 A;  5KFM A;  4KIT B;  5KFQ A;  2PFN A;  5J0Q A;  9ICA A;  1LV5 A;  4O3Q A;  3C1Y A;  3ZD9 A;  1ZQI A;  4QZF A;  4GXI A;  2VA2 A;  4YMN A;  4M6W A;  4RT3 A;  2XY6 A;  3JPO A;  1XSN A;  1ZQF A;  4ELU A;  4QWA A;  4AT9 A;  2Q0Z X;  4ECU A;  3IHQ B;  1YLQ A;  4RWQ A;  5J0O A;  3NYB A;  4X4Q A;  2AU0 A;  3EZ5 A;  3K75 D;  2C2E A;  5HHI A;  4YG2 A;  4YMO A;  8ICB A;  5DQH A;  5HR9 A;  8ICX A;  4MFA A;  8ICO A;  4AT7 B;  3MDA A;  4DFJ A;  3N97 B;  3OV7 A;  2ZJ8 A;  1ZJM A;  2ZH5 A;  2JEJ A;  5III A;  4QZG A;  5EOZ A;  4JWM A;  1NJX A;  2XCA A;  2NRX A;  4JUZ A;  3MR6 A;  1KTQ A;  4UAY A;  4ECX A;  5DG7 A;  2J6S A;  5DED A;  2ZH4 A;  2DR8 A;  2ID1 A;  4B9N A;  2HHT A;  5HMM A;  5KT6 A;  2Y1J A;  3C21 A;  4FHW A;  1MQ2 A;  4Z6D A;  3BQT A;  1S0O A;  4DQS A;  2ZJ5 A;  4WC4 A;  2I1Q A;  2PFP A;  4DS4 A;  2LYH A;  1JQR A;  1KFS A;  4ED1 A;  1DK2 A;  3ZD8 A;  4RQ6 A;  8ICI A;  4QZ9 A;  5CHG A;  2PI5 A;  3RB6 A;  4DS5 A;  2UVR A;  5J2B A;  4B9S A;  5CJ7 A;  4UB1 A;  2HVH A;  1L5U A;  3LWL A;  1ZQJ A;  3RJJ A;  1BPD A;  2FMP A;  2OWO A;  5HRD A;  3AQL A;  1VFG A;  4ECV A;  2KTQ A;  4I2H A;  3HW8 A;  2F1J A;  4ECS A;  4M47 A;  4KLM A;  1ZQL A;  5DB7 A;  4DL4 A;  3RJG A;  2JEF A;  3V6J A;  2RDI A;  2R8J A;  4RWN A;  1KNY A;  5DBB A;  3GIL A;  4QW8 A;  4K4G A;  5HRH A;  3UXN A;  3TAR A;  3Q8L A;  1T3N A;  4BXO B;  4WCW A;  2BPC A;  5IIJ A;  3UQ2 A;  3RAQ A;  1TVA A;  1ZQM A;  5KFV A;  2V9W A;  4NKT A;  5KFI A;  8ICZ A;  1ZQX A;  4ECT A;  5DBC A;  4RPY A;  3RH4 A;  2FMS A;  5EWE A;  3H39 A;  4NLK A;  4IR1 A;  2BPG A;  4IQW A;  5J0X A;  7ICE A;  3H8J A;  4I2C A;  3WFQ E;  4AT8 B;  3QE9 Y;  3WFS C;  4WC5 A;  7ICR A;  3H4B A;  1D8Y A;  4EBD A;  3RJE A;  1LB2 B;  3G6X A;  4DFP A;  2JEI A;  2ZH3 A;  5D4B A;  1COO A;  3RH6 A;  1UEU A;  4DQR A;  4X4T A;  3V72 A;  1ZJN A;  4QWE A;  3ZDB A;  2C2R A;  4BXO A;  4YR3 A;  1R8C A;  2ZHB A;  4UB2 A;  1SKR A;  1T4G A;  1N48 A;  4TUS A;  7ICK A;  2AGQ A;  4CCH A;  4F50 A;  4XQ8 A;  3OJS A;  5J2H A;  4DLG A;  3LWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...