4M9LA

Dna polymerase beta e295k soaked with dctp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
326
structure length
313
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPVAGEPLPVSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 107
structure length 313
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9lA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9lA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9lA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9lA03
1ZQOA 1TK8A 2XCAA 4O5EA 1DOQA 2BCSA 5D49A 4DS5A 3GQCA 3PW2A 2M2VA 9ICAA 8ICCA 4K4GA 3L9DA 2R8GA 1SKSA 3MDAA 1ZQQA 4DL7A 8ICMA 5BOLA 1CEZA 9ICWA 4J9OA 3H39A 3N4MB 2BKEA 4EBKA 4UAYA 4FS1A 2I9GA 2ZH4A 2UVUA 4Z6CA 4PGQA 3Q8PB 5CB1A 3GDXA 8ICYA 3RH4A 4RWNA 4Z6DA 4NY8A 2HHWA 2BQUA 3HPOA 3RRGA 4Z6EA 1NKEA 9ICFA 5HR9A 2LYHA 3RJGA 4O3RA 3RR8A 5KFGA 3QE9Y 2BCQA 3IHQB 3MFIA 4PGYA 3JPQA 4RQ0A 8ICLA 3PMLA 5EWFA 3THVA 4M9NA 2M9NA 3TARA 2UVWA 2ID1A 4UD4A 2P6UA 4QZBA 3GV8B 5HRBA 4YCXA 4DL3A 9ICQA 3HIYA 3GILA 3FDSA 4S3NA 4RQ5A 2DVIA 4M9LA 4J9KA 8ICJA 3HJ1A 3OV7A 1ZQNA 4NLKA 4NM2A 4O3NA 4IQVA 4QZAA 3OGUA 3AUOA 3Q8MA 1BNOA 4FHWA 2AGQA 5EWGA 5HMLA 5IIMA 1TK0A 4I27A 1UA0A 4DLGA 4M0AA 2HHUA 9ICTA 3PVXA 4HYKA 5F2VO 1RPLA 1SZPA 4RZRA 3SZ2A 7ICNA 5J2EA 4WCWA 1NK4A 9ICSA 4KLJA 4R64A 3GIJA 1BPXA 8ICBA 2M2UA 4DOBA 5CJ7A 5J0YA 2BPFA 2ZH9A 5DG8A 4DL6A 2DPIA 1KNYA 4GXKA 4ED0A 4I28A 4ED2A 5KFBA 1TVAA 3AQNA 4PHDA 4GC7A 8ICAA 4KLGA 8ICIA 4BDPA 5KFOA 1ZQWA 4RWQA 2C22A 4YR3A 3QZ8A 4UBBA 2XC9A 1ZQZA 5KFAA 4YXMA 3M9OB 3LWMA 4C8LA 4RQ4A 8ICFA 1QLNA 4F5QA 1CUKA 2VA8A 4UBCA 3C1YA 3SV3A 1ZQAA 4I2AA 1D8YA 5IIOA 2XCPA 4DL2A 3SV4A 3RR7A 2KFNA 2IHNA 1SKWA 1ZQIA 3TI0A 5KFYA 2O1PA 4YVZA 2NRVA 4FHVA 2BCVA 4EZ6A 8ICPA 5KG3A 3T3FA 4R8UB 5L1KA 1JX4A 4YG2A 1JIHA 5KFLA 2BE3A 3H4BA 2ZHBA 2W8KA 2W8LA 3UXPA 1TAQA 2KN7A 2J6SA 2BHNA 2ZTDA 4LZDA 5KFCA 5J0OA 4DSJA 3NGDA 5DEDA 3GV7B 3RRHA 4RNOA 4JUZA 3GFKB 3MR5A 4RPXA 1V9PA 2J6TA 4YMNA 4O9MA 5KG4A 2MAXA 4DFMA 1ZJMA 4IRCA 5KFWA 5J2JA 4ELVA 1UEVA 1KEJA 1TFYA 3C2MA 1U9LA 4ELTA 1ZQXA 3LWLA 1N56A 4NM1A 3HWTA 7ICQA 4ATBB 2FMPA 3TANA 4P4MA 4DOAA 1XSNA 9ICRA 4UD5A 9ICXA 5KFRA 2HVIA 5J0TA 1QTMA 4J9QA 1ZQBA 4KLFA 2C2DA 3LK9A 4PHPA 3C21A 4I2JA 4J9LA 2FMSA 4F5PA 5IINA 4KLIA 4I2BA 4QW8A 3RBEA 2NRTA 4DOCA 4J9MA 3TAQA 3OJSA 4MFCA 4PH5A 4QWAA 2W9AA 5J2AA 1SL2A 2C28A 3RJJA 4KLMA 7ICFA 8ICQA 5HRFA 3B0XA 2VANA 5KG6A 4GLXA 2ZH8A 4Q45A 5KG0A 5KFXA 2P6RA 4R66A 2ZH5A 9ICLA 1NK5A 4J9SA 2KTQA 2FPLA 4F5OA 7ICRA 8ICVA 1MQ3A 4M9JA 2ZH3A 1A76A 5C5JA 4FH5A 3GIIA 2H5XA 4DFKA 4RWOA 1IM4A 1ZQUA 1NJYA 1TAUA 3ZDDA 4KLUA 2HHVA 3EYZA 3T5LA 2BGWA 4YMMA 3MFHA 5KG1A 5L1IA 3Q8LA 2BQRA 1NOMA 1XO1A 4RQ3A 4ECRA 4C8MA 4DSEA 4IQUA 3QZ7A 4EYHB 4M9HA 3LQCB 2J6UA 3ISBA 3RB3A 1ZYQA 5DG7A 3RJIA 5J0SA 5KFEA 3T5JA 4B9VA 3TFRA 4F4YA 5KT4A 4F5RA 3RJKA 3TFSA 4ED8A 2BPCA 4QZFA 3V7KA 4F50A 3PW4A 2Y1JA 4KLHA 4PPXA 1T4GA 5KT3A 2ALZA 4O5KA 4Q8EA 2JEFA 2MUTB 1R8CA 2JZBB 4YD1A 4RNMA 3MBYA 1NJXA 1JMSA 2ZUBA 1KFSA 3KHGA 2VA3A 4KLTA 4M5DA 4MEYA 3BQ0A 7ICUA 3AQKA 1FA0A 3H4DA 2ZTEA 4FHPA 5D4BA 3AQMA 4YFKA 4JV2A 4I2EA 4O3OA 4B9TA 4Z6FA 9ICGA 7ICGA 1T3NA 3QEBZ 3T5KA 4PGXA 2PFNA 1L3UA 4WC2A 1JXEA 4YD2A 4KN4A 4ELUA 1D9FA 5HP4A 4AT9A 4E7XA 4DFJA 4C8KA 2PFPA 3EWAA 5J2BA 8ICRA 8ICGA 8ICHA 4CCHA 5EOZA 4BWJA 1U45A 2FPMA 1KSPA 2PBEA 3ZDBA 4UAWA 2PI4A 3WFOA 4AT7A 4M2YA 3TQ1A 9ICMA 1COOA 5J2FA 3MR2A 5KFZA 4ED1A 1ZQRA 3RJEA 1BPEA 2DR5A 4UQGA 1L3TA 1ZQSA 4AT7B 4B9LA 4KTQA 3PR4A 1NK7A 3E2EA 2HHXA 3NYBA 1IXRA 5J0PA 5KG5A 1MSWD 2FPKA 1UT5A 4EBEA 2IA6A 4F4ZA 4E80A 2Q66A 5KFUA 5DBAA 4DLEA 1ZJNA 1SKRA 2BDPA 1DGSA 7ICOA 3UPSA 4I2GA 4FBTA 2DRBA 1RYRA 1KFDA 5DBBA 4X4NA 4QZDA 4QWBA 3RJHA 4DSKA 4GXIA 3C2LA 3RB4A 4RU9A 4KLQA 5L9XA 1S76D 3WFRE 1KTQA 2JEIA 4WC7A 2AGPA 1Z00B 2ATLA 1EXNA 5KT5A 4P4PA 1ZQTA 4FH3A 4TUQA 4O3SA 1NK0A 2KZZA 4O0IA 1H38A 3H40A 5KTQA 4FHXA 3ZDEA 4J9PA 1TK5A 4BXOB 2KP7A 1VFGA 4KLDA 4WBYA 4YR0A 3ZD9A 5J0XA 3C5GA 2HVHA 4BXOA 1HUOA 5HREA 2M2TA 3OVBA 5IIIA 4PHAA 4DEZA 2FMQA 1XSLA 3EZ5A 4TURA 1DK2A 3H37A 2RDJA 3AQLA 5IILA 2UVVA 1ZQHA 3WFSC 4X4RA 1Y88A 5KFVA 4F8RA 3KHRA 2ZH1A 4EP7A 5L1JA 4X4VA 8ICXA 4EBCA 9ICVA 4IQWA 5HRKA 3C18A 3UQ2A 3PW5A 2DR9A 1X9MA 1ZQCA 4IG8A 3PR5B 4DQRA 4NLNA 3UXNA 2DR8A 5HRDA 3AU6A 2HHPA 3PNCA 4I2HA 2ASLA 5HMMA 4QW9A 1S97A 4F93B 5KFNA 9ICBA 1ZQKA 2RDIA 4RQ7A 5KFTA 3KHLA 1MQ2A 1BPDA 1VJ7A 5DKWA 2F1HA 3OSPA 3RB0A 3RH6A 2AU0A 7ICEA 5DECA 2BQ3A 4GC6A 3M9NB 4NKTA 9ICNA 5J2IA 4DSFA 3IM1A 4YXJA 4F5NA 3H8WA 3GIMA 1X9SA 1X9WA 7ICIA 9ICIA 4EEYA 1BNPA 1BVSA 2AQ4A 1ZQEA 4WC0A 3PMNA 2GWSA 1WCLA 1XS9D 3KHHA 2JEJA 3PY8A 2ASDA 1L3VA 4ECZA 1PZNA 2A1JA 3K4GA 5DB8A 4WC6A 3ISDA 3RAXA 5L1LA 5DQIA 4RWPA 4O3PA 5CA7A 2V9WA 3BDPA 1RXVA 1ZQYA 4O5CA 2ZTCA 4YN4A 4DQPA 2MUTA 3WFPA 4X4SA 4KITB 1NJZA 4WC4A 5DGAA 2KFZA 4XRHA 2V4RA 1Q78A 4ECVA 4M9GA 4MF2A 4UB5A 3JPRA 9ICEA 1XC9A 4MEXA 1WOTA 5KT6A 3H8JA 3M8SA 4ED3A 2Y1IA 5KFPA 4QZIA 4ED7A 1S0VA 3HP6A 5KFKA 2R8KA 4O3QA 2JZBA 1NK8A 1D9DA 1Q79A 3PX6A 4RUCA 2DFLA 4F2RA 4J9NA 4X4PA 5J2DA 3PX4A 3GIKA 4G3IA 4E8FA 4X4UA 4B9MA 3ZDCA 3V7LA 5KT7A 5KT2A 2PI5A 4ECXA 3RJFA 9ICUA 3V6HA 3PW0A 4XA5A 4QZCA 3EPIA 4C8NA 2FLPA 9ICKA 5J29A 1R8BA 5DB6A 4UAZA 3C5FA 4QZ9A 2V4QA 1ZQLA 4TQSA 4YMOA 4DQIA 1ZQGA 1UEUA 3HX0A 3Q8SB 3JPSA 4F91B 1Z3EB 4RQ8A 4UB3A 2M2WA 4NXZA 2ZH2A 3ETLA 4F2SA 2DRAA 3B0YA 4X5VA 4ECSA 5J0WA 2BCRA 4DSLA 2ZUDA 4M47A 4UB2A 4QWDA 1XWLA 4ZH4A 2RFFA 5CP2A 4ED6A 1L5UA 3MGIA 3OUYB 2IMWP 1B22A 4RNNA 3BQ1A 2IBKA 3HJ4A 4WC5A 4TUPA 5J2GA 3JZ0A 3OUYA 3QEAZ 3H8SA 5HHHA 5IIKA 5J0UA 2C2RA 1ZQPA 3H38A 4M6WB 4RT3A 3PX0A 1TV9A 2ISOA 3MGHA 1WCNA 3RH5A 4IRDA 4EBJA 5CHGA 3RB6A 2FLLA 1S0OA 4JWMA 4M6WA 5DGBA 4YQWA 4RQ2A 7ICVA 5KFSA 4FO6A 7ICPA 1U48A 4DQQA 9ICOA 4YP3A 2W9CA 4I29A 3UXOA 2XY5A 1X2IA 2R8JA 9ICHA 5J2KA 4LZGA 5DB7A 4JV1A 4JK1A 2XY7A 4BGDA 1JN3A 1U4BA 4RPZA 4EBDA 2BCUA 1F5AA 5CR0A 1LB2B 4ATBA 2P66A 2NRKA 5BPCA 3GV5B 5JUMA 1HJPA 4DWIA 4B9UA 4QZEA 5J2HA 2XGPA 4RQ1A 3Q8QB 5DG9A 4X0AA 1A77A 4UB1A 2ZUCA 3OSNA 3G6XA 5J0RA 1HUZA 7ICSA 4JV0A 3MDCA 1BGXT 2O5AA 5F9LA 4YR2A 1UETA 4TUSA 1NO5A 4ECTA 5HC9A 4AT8B 1QSYA 2ZH6A 4RT2A 2W9MA 3OJUA 3Q8KA 7ICKA 1NZPA 4TQRA 1XSPA 3KTQA 1R89A 4X4TA 5KFDA 1U49A 2F1IA 3C1ZA 4QZ8A 4R63A 1LV5A 4PHEA 4KN7A 3SYZA 1ZQFA 2IHMA 5DBCA 1JXLA 2HW3A 4EZ9A 2NRXA 2WTFA 2XY6A 1NJWA 3ZDAA 1YLQA 3JYYA 3MABA 4IQTA 1T7PA 1ZQJA 1UT8A 3EPGA 1JAJA 3V7JA 1XU4A 8ICWA 1QSLA 9ICJA 4KLEA 4DL4A 2AQ0A 5CWRA 4XQ8A 4P4OA 1SL1A 1RZTA 1SL0A 3PV8A 3BQ2A 1ZQDA 4WBZA 4DF4A 4LVSA 4ECUA 4KMUA 1S77D 2A1JB 1T8EA 8ICZA 5EWEA 4F92B 5DDYA 3JPNA 1DK3A 2KZ3A 5HRLA 5HNKA 8ICKA 5HRIA 5HRGA 4M04A 1ZETA 5KFHA 3RBDA 3HT3A 4DFPA 1S0NA 4MF8A 4BWMA 2DPJA 3PO4A 1MIWA 5HRHA 3OVSA 2PFQA 4ECQA 1S10A 5DDMA 1BPYA 5DLGA 1NKBA 3UQ0A 1TFWA 3PW7A 2PFOA 4X0BA 7ICMA 3TAPA 4F4KA 2W9BA 1JQRA 4B9SA 1B43A 4ECYA 4AT9B 1QSSA 4K4IA 7ICTA 2BPGA 2W9BB 8ICOA 4RUAA 4MFFA 1K1SA 1ZQVA 3JPTA 4F4XA 4KLOA 5KFIA 2NRWA 5BOMA 5F9NA 2XGQA 2VA2A 5D46A 4DO9A 8ICNA 3C66A 3OVAA 3K75D 4DQSA 4DS4A 4XUSA 4DL5A 8ICSA 3MR3A 3C2KA 4DF8A 8ICTA 2F1JA 1RYSA 5KFFA 2R8IA 3G6YA 3H7IA 3SI8A 4X4OA 1KFTA 4XQ7A 4AT8A 3V72A 1UA1A 2ZH7A 1MC8A 5TZVA 5DB9A 4R65A 2R8HA 1TKDA 2KZMA 3LDAA 3OHBA 4IR1A 4RPYA 8ICEA 3PO5A 1TFRA 5KG2A 3AU2A 3BJYA 3JPOA 3EW9A 1PX5A 1N48A 5DLFA 3C23A 2PXIA 3V6KA 4FHYA 2HHQA 4Q44A 3RAQA 1KRPA 3ORYA 3OHAA 3RTVA 5HHIA 1V4AA 3V6JA 3FYHA 4R8UA 3T5HA 1Z00A 4IR9A 1BPZA 4I2DA 3NTUA 2Q0ZX 3M8RA 4WC3A 3N97B 1ZQMA 4Q43A 4E0DA 2ZHAA 5KFJA 1KLNA 5KFMA 1NK6A 4C8OA 9ICCA 1S9FA 4MFAA 4UB4A 3UPQA 1L3SA 1KDHA 7ICLA 4FBUA 4FS2A 2C2EA 4ECWA 2FLNA 4K4HA 5DQGA 4QZHA 2ASJA 2HHTA 4LT6A 5DQHA 3H3AA 2DR7A 2UVRA 7ICHA 4NLZA 2NRZA 1K1QA 1D8LA 2I1QA 3JPPA 4EYIB 2AJQA 4IRKA 2W9CB 2ZJ5A 5J0QA 2XO7A 2BR0A 5KG7A 4JWNA 2ISPA 1C7YA 4NLGA 1NKCA 4DSIA 3MR6A 4I2FA 1S0MA 4KLSA 2ZJ8A 4RQ6A 2B21A 4QWCA 4QZGA 3M9MB 3HW8A 3Q8RB 4F4WA 2AGOA 1RXWA 4F3OA 5IIJA 3BQTA 3G6VA 4J9RA 1OU5A 3ZD8A 4B9NA 1MIYA 2OWOA 4QWEA 3WFQE 4KLLA 7ICJA 1NK9A 2ZJAA 4NKUA 4I2IA 5KFQA 8ICUA 4I2CA 2JEGA 1BPBA 9ICPA 1U47A 4P2HA 1R8AA 4Q8FA 4GXJA 3ISCA 4X4QA 1MIVA 5J2CA 4WC1A 2HHSA 1AROP
chains in the Genus database with same CATH superfamily
2XCAA 4DS5A 9ICAA 4DL7A 4J9OA 3H39A 3PSIA 2BKEA 4EBKA 2EAOA 2Y9TA 3Q8PB 5CB1A 1SB3C 4RWNA 4NLCA 2E8NA 4UB8U 4EENA 3HPOA 1KQQA 5B5EU 3MFIA 1A0PA 2WF9A 4M9NA 2LYAA 3GV8B 2ZIUA 5HRBA 4QIWC 3GILA 4NL9A 2KSOA 3FDSA 2DVIA 4M9LA 4NM2A 1ZQ1C 4GFJA 4IQVA 4I27A 2P35A 2K4IA 5F2VO 3SZ2A 4WCWA 5J2EA 1FFVA 9ICSA 3GIJA 8ICBA 2WB1C 2BPFA 1KNYA 5KFBA 3AQNA 1FEZA 5B3QA 5ALMA 4BDPA 1ZQWA 3NVVA 2ZXIA 2XC9A 1ZQZA 4CF4A 2VA8A 3C1YA 4I2AA 3PSFA 5AKXA 1D8YA 3O0FA 1QQ7A 5KFYA 2BCVA 4BJQA 4R8UB 4YG2A 1JIHA 2EAMA 2W8LA 1TAQA 2ESEA 2GH1A 2KEYA 3NGDA 3RRHA 4JUZA 1Q8KA 4XJEA 2K60A 5KG4A 4DFMA 4O9MA 1UEVA 3C2MA 2JXJA 3LWLA 2JH1A 2FMPA 3TANA 5KFRA 1QTMA 4J9QA 1ZQBA 3LK9A 5AI8A 3EF2A 4I2BA 5D62A 4FE3A 3RBEA 4J9MA 4MFCA 1Q46A 5AI9A 5ALJA 5KG6A 2A1AA 2ZH8A 4Q45A 5KFXA 4R66A 5AM4A 1DXSA 1NK5A 2G5IB 2KVCA 1A76A 5C5JA 2H5XA 4RWOA 1ZQUA 1TAUA 2HHVA 4FZMA 3EYZA 1XO1A 3SR6A 4RQ3A 4ECRA 4EYHB 2BDUA 3ISBA 2IOHA 3RB3A 5L1MA 5DG7A 3RJIA 5KFEA 3T5JA 2EH9A 2BPCA 4C7YA 3V7KA 3PW4A 2Y1JA 4UAUA 4PPXA 2ALZA 4Q8EA 2JEFA 2MUTB 3H0MB 4YD1A 3MBYA 1JMSA 3HKZC 2EDUA 3BQ0A 3AQKA 4FHPA 3AQMA 4QJFB 4YFKA 1CI4A 3QEBZ 5ALLA 4CF3A 1F0MA 4AT9A 1SGGA 1WUDA 4IC9A 1L7OA 5T14A 5EOZA 1U45A 2FPMA 3SD7A 3KKAC 4AT7A 1COOA 5J2FA 5KFZA 3RJEA 3D2NA 4B9LA 4Y2JA 3PR4A 4O67A 2ZIVA 3NYBA 5KG5A 2IA6A 5AKEA 2Q66A 4OAHA 5DBAA 1SKRA 3UPSA 5GTHU 3F2DA 5DBBA 4DSKA 3C2LA 5AKJA 1S76D 5L9XA 1KTQA 5E79U 4G9BA 1ZQTA 4FH3A 4TUQA 4O3SA 4C4RA 5KTQA 4Y2PA 4J9PA 1TK5A 4K99A 1F44A 2KKVA 2M2TA 5IIIA 2FMQA 3M6ZA 1XSLA 1HIWA 1PK3A 3M6KA 1ZQHA 2E8MA 1Y88A 2KD1A 5KFVA 4LEZA 4EP7A 5L1JA 1PK1A 1ZQCA 2Z7JA 3AU6A 4P0PB 4F93B 1ZQKA 5KFTA 2GO7A 2XIDA 4AYBC 4BUGA 4NKTA 5J2IA 4DSFA 3IM1A 4YXJA 3GIMA 1X9SA 1BVSA 4K8VA 3HKZF 4ECZA 5DB8A 4WC6A 3RAXA 2FCLA 4RWPA 5CA7A 2V9WA 5F3XB 3TADA 2K4PA 1JRPA 4DQPA 4XRHA 1CRXA 1Z1VA 1WOTA 4UB5A 3JPRA 2W7PA 1XC9A 2W43A 2QARB 5KT6A 4QZIA 1NK8A 1Q79A 1PUZA 4RUCA 4X4PA 5J2DA 4PJ0U 4G3IA 4X4UA 4CGZA 3V7LA 3F53A 5KAIU 2PI5A 4QZCA 4C8NA 3MCRA 5J29A 2EAPA 4UAZA 3C5FA 4DQIA 2KK0A 1UEUA 3Q8SB 2QB0A 4NXZA 3ETLA 4F2SA 3B0YA 4X5VA 1MA7A 4M47A 5AI5A 1Z1BA 2XICA 4ZH4A 4WQLA 4EEDA 1B22A 2LHTA 2IBKA 1L7PA 5J2GA 3JZ0A 3OUYA 3QEAZ 1OXJA 3H8SA 2C2RA 4IRDA 3RB6A 3QUCA 5J8YA 4M6WA 3TADC 1U48A 4YP3A 2XY5A 2R8JA 4LZGA 2KV2A 5DB7A 4JK1A 4BGDA 5BPCA 2YMQA 5EE3A 2XGPA 2KIVA 3Q8QB 2W03A 1A77A 2ZUCA 4Y2YA 5J0RA 4JV0A 3MDCA 4TUSA 4Y2SA 4TQRA 1XSPA 3K7DA 2F1IA 3C1ZA 3VC8A 2WTFA 2NO5A 3NWIA 1T7PA 1ZQJA 1UT8A 2MSNA 3DEEA 4P4OA 1ZQDA 4WBZA 2H3IA 4DF4A 1ZRNA 4ECUA 2KKPA 5DDYA 1DK3A 3DV9A 1QQ5A 5HRGA 4M04A 4DFPA 1S0NA 2YX8A 5JU5A 2KJ9A 2HI0A 3UQ0A 2YTUA 3PW7A 7ICMA 4F4KA 2W9BA 3I1YA 4EGWA 1O08A 4ECYA 1QSSA 2BPGA 1K1SA 3UMCA 1UHUA 2NRWA 2VA2A 3K75D 4DS4A 3C2KA 4DF8A 1L8LA 2R8IA 4USAA 4RQNA 1N61A 3ED5A 5AKKA 4X4OA 3A0BU 3ICXA 5DB9A 2K4HA 2R8HA 8ICEA 2EZXA 4RPYA 3AU2A 2YB1A 2PXIA 3V6KA 1X42A 2HHQA 4JLZA 2WAQF 3ORYA 3HRDD 4C7ZA 4IR9A 4Y2QA 2L5YA 2GAFD 1KLNA 4UB4A 1KDHA 3B9JA 4NLZA 1K1QA 3QU7A 2WFAA 4IRKA 2ZJ5A 2D3DA 5ALHA 2BR0A 1X66A 1ED1A 4NL9C 2OH2A 4CE6A 4RQ6A 2B21A 2JH7A 4F4WA 2N1RA 4QWCA 3Q8RB 1RXWA 5IIJA 3QU5A 3WFQE 1NK9A 2ZJAA 4NKUA 4I2CA 5AIAA 4X4QA 2K8CB 5J2CA 1KL9A 1N5WA 5D49A 3PW2A 4K4GA 2R8GA 3MDAA 1KW4A 1CEZA 2ZH4A 3GDXA 8ICYA 3RH4A 1SWVA 2LKYA 2QARA 2BQUA 4Z6EA 3SAGA 9ICFA 2LYHA 3RJGA 1XNSA 3QE9Y 3IV6A 2BCQA 3IHQB 3JPQA 8ICLA 3D2QA 3THVA 2UVWA 1Q3UA 2W7OA 3RF9A 4S3NA 5ALDA 4J9KA 2EWRA 4O3NA 2GLEA 4QZAA 3Q8MA 4M0AA 2F76X 2HDOA 5KL8B 3PVXA 4RZRA 5AKGA 7ICNA 4KLJA 2LM4A 2KJ5A 2NYVA 1TVAA 4PHDA 4GC7A 8ICAA 8ICIA 5KFOA 4UBBA 4YXMA 4C8LA 3H37A 1QLNA 5IIOA 4DL2A 2KFNA 1Z19A 2RQ5A 2O1PA 2ODGA 4CF5A 4EZ6A 3T3FA 5AKYA 4NXXA 5KFLA 2W8KA 3UXPA 1AQ6A 2BHNA 2ZTDA 4LZDA 5KFCA 2RHFA 4RNOA 1V9PA 4KM5A 4JLXA 4IRCA 2MAXA 1ZJMA 3D6JA 1TFYA 4CNQA 4ATBB 4P4MA 4UD5A 9ICRA 9ICXA 5J0TA 2PKEA 2C2DA 2FMSA 4F5PA 5ALZA 4DOCA 1O03A 1T94A 4PH5A 1SL2A 4KLMA 5J2AA 2H3ZA 3LVWA 9ICLA 4FFDA 4ACOA 4F5OA 7ICRA 3N7SC 1V97A 5EE1A 1MQ3A 4M9JA 4FH5A 3GIIA 4DFKA 1NJYA 1J2NA 3ZDDA 2KIWA 4KLUA 4K97A 2ZIXA 1RG6A 2KE7A 1NOMA 4C8MA 4DSEA 5AI4A 4IQUA 4OJLA 3QZ7A 1ZOLA 2DF4B 5J0SA 3QU9A 2HN1A 3RJKA 3N7RC 4ED8A 2LYBA 4O5KA 1R8CA 4KLTA 1URJA 4C4TA 4MEYA 2Q4TA 1GO3F 5D4BA 4O3OA 4B9TA 4Z6FA 2AXTU 1P7DA 4WJ3B 1JXEA 1D9FA 2MA1A 4DFJA 3CP8A 5ALUA 8ICGA 1KSPA 2PI4A 3WFOA 4M2YA 2E1FA 3MR2A 4LEYA 4EEKA 3QXGA 1ZQSA 4AT7B 2KICA 1MSWD 4F4ZA 3UMGA 2OYYA 2ZIVB 5KFUA 7ICOA 2BDPA 4FBTA 2DRBA 4X4NA 3TACB 1FFUA 4GXIA 4RU9A 1RYUA 4WC7A 2AGPA 2GOLA 2ATLA 2B4VA 1EXNA 5KT5A 1NK0A 3CRXA 1H38A 1WG8A 2HOFA 3F5EA 2KP7A 4YR0A 3E58A 3H0RB 3QUBA 3C5GA 5HREA 3OVBA 3H0LB 4PHAA 1NI3A 2KVSA 4TURA 2RDJA 2UVVA 2ZG6A 3KHRA 2ZH1A 8ICXA 4IQWA 1X9MA 2A19A 3K1ZA 4NXUA 2DR8A 2WAQC 2Y9UA 4I2HA 3QU4A 4QNLA 5HMMA 4QW9A 9ICBA 1K5OA 4RQ7A 1MQ2A 1BPDA 5AM1A 2F1HA 4P0PA 3OSPA 3RB0A 2BQ3A 3M9NB 5ALKA 9ICNA 9ICIA 4F5NA 3WK9A 2RLTA 4X4TA 2AQ4A 3QX7A 2ASDA 1L3VA 1PZNA 2A1JA 3K4GA 5L1LA 5DQIA 2NO4A 4O3PA 4KMOB 2HBMA 1ZQYA 4YN4A 2D6FC 2EANA 2MUTA 4KITB 5DGAA 2B0CA 2F8LA 3HILA 4MF2A 9ICEA 2ES6A 3BZKA 4ED3A 5KFPA 4ED7A 1S0VA 2BBHA 5KFKA 2JZBA 1D9DA 1UPHA 2D8CA 2VIXA 3L5KA 2DFLA 2E3TA 4F2RA 4J9NA 2LI6A 3GIKA 3E0FA 3BS5A 1N63A 5KT2A 3RJFA 2W55A 4XA5A 1L8OA 2V4QA 4U6PA 2KHVA 1ZQGA 5HR6A 2HCFA 4UB3A 3NS1A 3NVZA 3WK7A 2ZUDA 2K8BB 3WKCA 2RFFA 2H3FA 2G06A 1L5UA 4O68A 2OEHA 4RNNA 4TUPA 1X9XA 5HHHA 5IIKA 5J0UA 4Y2UA 1TV9A 3MGHA 5CHGA 2FLLA 5DGBA 4YQWA 4RQ2A 7ICVA 5KFSA 1JALA 7ICPA 9ICOA 4I29A 1X2IA 5G5GA 9ICHA 5J2KA 5TISU 5ALPA 3QUQA 1JN3A 1U4BA 2BCUA 1HEKA 5KL1B 2NRKA 5JUMA 3OTQA 4B9UA 4IS7A 5DG9A 4X0AA 4UB1A 3G6XA 1HUZA 2O5AA 5F9LA 4YR2A 2ZIWA 1NO5A 5HC9A 3OJUA 5KFDA 4QZ8A 5H2FU 4PHEA 4KN7A 1ZQFA 3SMVA 5DBCA 1JXLA 2ZIXB 2NRXA 1YLQA 2YMLA 3MABA 4IQTA 3EPGA 3V7JA 1XU4A 2KG5A 4DL4A 5CWRA 1SL0A 1RZTA 3IDWA 2A1JB 5GTIU 3SAHA 1A6SA 4F92B 4OAIZ 1J2MA 5CFUA 5HNKA 2W54A 1ZRMA 3NRZA 8ICKA 3RBDA 1N60A 1RQLA 3BQ7A 1MIWA 3NRWA 5HRHA 1VLBA 4ECQA 1NKBA 1B4FA 1TFWA 4OO1J 4AT9B 2W9BB 4MFFA 1ZQVA 3JPTA 4HAIA 5D46A 4XUSA 4DL5A 3MR3A 3ALRA 2QLTA 5KFFA 2K8AA 3G6YA 3H7IA 2DBYA 1N2XA 1UA1A 2ZH7A 1MC8A 4R65A 1TKDA 4IR1A 3WKAA 5KG2A 2AHOB 5B3PA 4FHYA 3KD3A 1KRPA 3VCBA 3V6JA 1V4AA 3NTUA 3ER9B 2Q0ZX 3N97B 1ZQMA 4E0DA 3NVOA 2KJ8A 2LBOA 5KFMA 1NK6A 4MFAA 4FBUA 4LEVA 2GA9D 2C2EA 4OJ6A 5DQGA 2E1EA 4QZHA 3LYSA 5DQHA 2ASJA 4OAFA 2DR7A 2UVRA 5AI6A 3JPPA 2W9CB 2HBLA 5KG7A 4JWNA 1J97A 1C7YA 1NKCA 3MR6A 4KLSA 2ZJ8A 3QNMA 2NV3A 2AGOA 3HW8A 4J9RA 3ETRA 3ZD8A 1MIYA 2OWOA 4QWEA 4QIWF 1IIPA 2CPRA 2JEGA 9ICPA 1U47A 4P2HA 2PMZC 4GXJA 2DQNB 4ICAA 4UASA 4KLDA 1ZQOA 1KN5A 4O5EA 3GQCA 4CRXA 1SKSA 1ZQQA 9ICWA 5BOLA 2YB4A 4UAYA 4FS1A 2I9GA 4OCZA 4A8EA 4Z6CA 5KNIA 2RRDA 5C0YA 4NY8A 2HHWA 3RRGA 1NKEA 5HR9A 4O3RA 5KFGA 1QQ6A 4PL2A 4PGYA 3PMLA 5ALSA 5EWFA 2ID1A 4UD4A 3NKUA 2IOFA 4QZBA 4YCXA 3UMBA 9ICQA 4K98A 2KHQA 3MC1A 3OV7A 3IN5A 4NLKA 3JCFA 4O69A 3OGUA 1M6YA 3AUOA 1BNOA 2AGQA 5EWGA 5HMLA 5IIMA 1TK0A 2HHUA 4EEBA 4DLGA 9ICTA 4C0ZA 4OJPA 4F71A 4R64A 1BPXA 4UATA 2AH5A 4DOBA 5CJ7A 5J0YA 1N62A 5DG8A 1L6NA 3IRUA 4ED0A 4ED2A 2E5SA 2E8OA 2C22A 1FIQA 4YR3A 3QZ8A 3M9OB 8ICFA 1C20A 4UBCA 3SV3A 2XCPA 3RR7A 1ZD5A 2DKXA 1SKWA 1N5XA 3TI0A 4YVZA 1WWVA 2NRVA 4FHVA 1UQVA 3FM9A 2EQYA 2BE3A 2J6SA 2KN7A 5J0OA 4DSJA 3GV7B 3U26A 4EELA 2J6TA 4YMNA 1X6IA 2CXYA 5KFWA 3AL0B 1KEJA 2A3VA 1U9LA 1KKXA 3HWTA 7ICQA 1XSNA 3QUTA 4NXWA 5K4LA 3F2BA 4KLFA 4PHPA 3C21A 4I2JA 4KLIA 5IINA 2FI1A 2DUYA 7ICFA 2C28A 5KG0A 2P6RA 2ZH5A 4J9SA 2KTQA 1IM4A 2YMMA 3T5LA 2H3QA 4YMMA 3MFHA 5KG1A 5L1IA 2BQRA 5FP0A 1LKYB 3WKBA 2JR5A 3TFRA 4F5RA 4UB6U 3NVWA 3NVYA 1T4GA 2JZBB 4M5DA 3KHGA 2QKQA 5CFSA 7ICUA 1FA0A 2KSOB 4JV2A 1IG6A 1VDVA 7ICGA 1T3NA 4FZNA 1SIJA 1F5SA 4YD2A 4KN4A 2W04A 2VJ5A 1QCKA 5J2BA 3QYPA 1UCVA 4BWJA 2PBEA 3ZDBA 4UAWA 2EZYA 3TQ1A 3WK4A 9ICMA 2DR5A 1ZQRA 4ED1A 3M1YA 5D63A 1RDFA 4CDGA 5ALWA 3E2EA 2HHXA 1IXRA 1UT5A 4EBEA 4E80A 2K4EA 4DLEA 2YMPA 1DGSA 1KFDA 5ALRA 3RJHA 2KNJA 1L7NA 2JEIA 1Z00B 2VJ4A 4P4PA 2KZZA 4O0IA 2I5HA 4WQKA 4FHXA 3H40A 2CRXA 2F44A 3ZDEA 4BXOB 4OAGA 3ZD9A 2HVHA 4BXOA 4DEZA 3EZ5A 2G5HB 1DK2A 3AQLA 3WFSC 2JHDA 5IILA 4F8RA 3UQ2A 3PW5A 4NLBA 4IG8A 4NLNA 5HRDA 3MGVA 2HHPA 5AM5A 4U7CA 2HMXA 2RDIA 3KHLA 1VJ7A 4DFDA 5DKWA 1SXEA 3AM9A 3RH6A 7ICEA 5DECA 5AKZA 2Y0SF 1RQNA 3H8WA 1X9WA 1BNPA 3PZPA 5ALGA 1ZQEA 3PMNA 2GWSA 3KHHA 5ALFA 5ALTA 3ONNA 2OXOA 5ALXA 3UM9A 2ZTCA 5AICA 3WFPA 4X4SA 3WK8A 1NJZA 4RQMA 2KFZA 2V4RA 1X6JA 1Q78A 3I28A 2R8KA 2FDRA 3PX6A 3N7PD 3C29A 4DCCA 4E8FA 2WF5A 3H8MA 9ICUA 3SAFA 2LMRA 3BS5B 3PW0A 3V6HA 4UW9A 5AM0A 4AYBF 2FLPA 2B6GA 4Y2VA 2R18A 3HX0A 3JPSA 4F91B 2DRAA 4ECSA 3ER8C 5J0WA 2BCRA 3AQEA 3LVVA 4DSLA 4UB2A 4QWDA 4PZOA 4ED6A 1ZD4A 3SEIA 4LEWA 3MGIA 3AMZA 3HJ4A 3BQ1A 4WC5A 1Z4NA 4OD0A 3EUB2 3ZI4A 3H38A 3NUQA 4J03A 3PX0A 4EBJA 2F3NA 5AM3A 1S0OA 4JWMA 4FO6A 2W9CA 4K9BA 2M0NA 3UXOA 2KMDA 2LPEA 3PHZA 5EE9A 2XY7A 4EBDA 1F5AA 2XVTA 2K89A 1LB2B 3KOOA 4AP9A 2P66A 3L3FX 3GV5B 4QZEA 7ICSA 5ALQA 1BGXT 1IV8A 1UETA 5AKHA 4AT8B 2ZH6A 7ICKA 4Y2XA 3KTQA 1R89A 1U49A 4R63A 3SYZA 3F5AA 1NJWA 3JYYA 2WF6A 3SENA 2WB1F 1LVHA 1YZ7A 1QSLA 2AQ0A 3QU2A 4XQ8A 1SL1A 3BQ2A 1XO0A 2ZXHA 4KMUA 1T8EA 8ICZA 2KZ3A 5HRIA 1ZETA 5KFHA 2W3SA 3HT3A 3PO4A 1OW5A 5AK6A 4KB6A 5DDMA 2HBKA 2HSZA 4RUAA 2HHSA 4F4XA 2XGQA 3C66A 3PSPA 4DO9A 3K1RB 4K9AA 8ICTA 2F1JA 2OHFA 3CK6A 2RP5A 4OJOA 3V72A 2B56A 1YZ6A 1ZXIA 3KFUF 1VJ5A 4US8A 1JROA 1TFRA 3EW9A 1N48A 5DLFA 3C23A 3RTVA 5HHIA 3FYHA 3T5HA 1Z00A 1BPZA 4I2DA 2JGAA 3M8RA 3IG8A 4WC3A 2ZHAA 9ICCA 2HHTA 4ECWA 4K4HA 4LT6A 4PZNA 2NRZA 4NWIA 2XO7A 2ISPA 2YY6A 1DGJA 2G09A 4QZGA 4C4SA 3BQTA 4B9NA 3DDHA 5ALNA 7ICJA 5KFQA 4Q8FA 4NXTA 1GPJA 4WC1A 1AROP 1TK8A 3WU2U 5ALOA 2ZH2A 1DOQA 2BCSA 2M2VA 8ICCA 3L9DA 4O3MA 8ICMA 1YT3A 5KAFU 3N4MB 1D8BA 2UVUA 4PGQA 3WKDA 3HJEA 4Z6DA 4UAVA 3RR8A 3FAHA 2ZIUB 4RQ0A 1S5LU 4NXVA 2M9NA 3TARA 2P6UA 1Q3VA 2B51A 4P0QB 1ECWA 4DL3A 3HIYA 4RQ5A 3CW2C 8ICJA 3D2SA 3HJ1A 1ZQNA 4KX5A 4FHWA 1UA0A 2W11A 4HYKA 1RPLA 1SZPA 3AQFA 1NK4A 2M2UA 2JRZA 2ZH9A 4DL6A 2DPIA 4GXKA 4I28A 2HN2A 1JUDA 2YQEA 3OWGA 4KLGA 5JTIA 4RWQA 3LWMA 5KFAA 1RM6C 4RQ4A 4F5QA 1CUKA 1ZQAA 3OPXA 3SV4A 2IHNA 1ZQIA 8ICPA 5KG3A 2O6KA 5L1KA 5EE0A 1JX4A 1QH9A 2LM1A 3H4BA 2ZHBA 5DEDA 4KX3A 3GFKB 3MR5A 4RPXA 1WYGA 3NASA 4NV0A 1MN8A 5J2JA 4ELVA 4N7RA 3KZXA 4ELTA 1SV4A 4BX9C 1ZQXA 1N56A 4NM1A 3A0HU 4DOAA 3CYMA 2HVIA 2H3VA 4J9LA 3S6JA 1Z4OA 5JRTA 4Y2RA 4QW8A 4WOYA 2NRTA 2HOIA 1TE2A 3TAQA 3OJSA 3RJJA 4QWAA 2W9AA 8ICQA 5HRFA 4AT8A 3B0XA 2VANA 4GLXA 2FPLA 5AKLA 8ICVA 5AK3A 5AHXA 2IUBA 2BGWA 3Q8LA 4M9HA 3LQCB 1PVRA 2J6UA 3WKEA 1ZYQA 2XI9A 1LKYA 4B9VA 4C80A 5KT4A 4F4YA 4GIBA 3TFSA 1V38A 4QZFA 4F50A 3ERCC 4KLHA 5KT3A 1SV0C 4RNMA 1NJXA 5ALIA 2VA3A 2ZUBA 1KFSA 1R8AA 2HBJA 1X40A 3H4DA 5ALVA 2ZTEA 4I2EA 2WF7A 9ICGA 3T5KA 4PGXA 2WHEA 2PFNA 1L3UA 4WC2A 3J81j 4ELUA 5HP4A 4E7XA 2F77X 4I0UA 4C8KA 2PFPA 3EWAA 8ICRA 8ICHA 4CCHA 2JV3A 5AM2A 1BPEA 4UQGA 1L3TA 5CEHA 4KTQA 1NK7A 1NZBA 5J0PA 5CRXA 5AK4A 2FPKA 5CFTA 1DRGA 1ZJNA 2DKZA 3R9KA 4I2GA 3SQIA 1RYRA 4FZLA 3WK5A 4QZDA 4QWBA 3RB4A 2FE9A 4KLQA 3WFRE 4MHVA 3I76A 4US9A 3AEVA 1SZHA 4MKPA 2DL0A 3TKAA 1VFGA 2F2AB 2YN4A 4WBYA 5J0XA 1ZD2P 5ALEA 1HUOA 1SWWA 4FO1A 5J8YC 3PSTA 1PK1B 4X4RA 4X4VA 4EBCA 9ICVA 5HRKA 3C18A 2OCEA 2DR9A 3PR5B 4DQRA 3UXNA 3PNCA 3BS7A 2ASLA 1S97A 5KFNA 3IG5A 2ZIWB 4O6AA 2AU0A 4GC6A 4UARA 7ICIA 4EEYA 2E8PA 4WC0A 2I6XA 1WCLA 3CNHA 1XS9D 2JEJA 3PY8A 1TAMA 3ISDA 5B66U 2CN1A 2MU2A 3BDPA 3L4PA 1RXVA 4O5CA 4WC4A 2F8KA 4ECVA 4M9GA 1COKA 4MEXA 3H8JA 2FJ6A 3M8SA 2Y1IA 3HP6A 4O3QA 1S8OA 4K96A 3PX4A 3GU3A 3IP4B 4B9MA 3ZDCA 5KT7A 1ZD3A 4ECXA 3EPIA 3N28A 9ICKA 1R8BA 5DB6A 1ZQLA 4QZ9A 2QB0B 4TQSA 4YMOA 1Z3EB 4RQ8A 2M2WA 4Y2TA 3M7DA 4OJ5A 1XWLA 1L7MA 2KOBA 5CP2A 4EX7A 3FC4A 3OUYB 2IMWP 2OM6A 4EV6A 1ZQPA 4M6WB 4RT3A 2ISOA 4EX6A 2BBJA 1WCNA 3RH5A 5G5HA 5JTGA 4DQQA 3T79A 1JI7A 5AK5A 4ZOHC 4JV1A 2G08A 5CHEA 2DGZA 4RPZA 5CR0A 4JMUA 4ATBA 1OUQA 1PVQA 4DWIA 1HJPA 5HR7A 5J2HA 4RQ1A 4WH5A 3OSNA 1SV0A 4HX0A 2IOFK 2VKQA 4ECTA 1QSYA 5AKIA 4RT2A 2W9MA 3Q8KA 1NZPA 3WK6A 5AIBA 1LV5A 2DWQA 2IHMA 2HW3A 4EZ9A 2XY6A 3ZDAA 1JAJA 9ICJA 8ICWA 4KLEA 3PV8A 5AI0A 4LVSA 1S77D 5HRLA 5EWEA 3JPNA 2G0AA 2IHOA 4MF8A 4BWMA 2DPJA 2HOQA 5A0LA 3OVSA 4P0QA 2PFQA 3KZIU 1SXDA 1S10A 1BPYA 5DLGA 2PFOA 4X0BA 3TAPA 4F72A 1JQRA 4B9SA 1B43A 4K4IA 7ICTA 4NJ8A 8ICOA 4KLOA 2MRLA 5KFIA 5BOMA 8ICNA 5F9NA 3OVAA 1FO4A 4DQSA 8ICSA 4JB3A 2Y0SC 1B0XA 1RYSA 1PVPA 3BZCA 2G07A 3SI8A 1KFTA 4XQ7A 2W3RA 4LJXA 5TZVA 2KZMA 3LDAA 3OHBA 3C28A 3PO5A 3BJYA 3JPOA 3AN1A 1PX5A 4B6JA 2JMGA 5ALYA 4Q44A 3RAQA 3OHAA 4R8UA 2PMZF 5D61A 4Q43A 2QB1A 3KBBA 1V85A 3F2CA 5KFJA 4C8OA 1S9FA 3UPQA 1L3SA 7ICLA 1T3QA 4FS2A 2FLNA 3H3AA 7ICHA 3GZFA 1D8LA 2I1QA 4EYIB 2AJQA 5J0QA 4NLGA 4DSIA 4I2FA 1S0MA 3KKAA 3RFAA 4PL1A 4IL6U 4F3OA 3M9MB 2EZZA 2BZFA 3G6VA 1OU5A 2WF8A 4KLLA 1WWUA 4I2IA 8ICUA 1BPBA 1KBUA 3ISCA 1MIVA 1NNLA 2ZH3A
chains in the Genus database with same CATH topology
1ZQOA 1TK8A 2XCAA 4O5EA 1DOQA 2BCSA 5D49A 4DS5A 3GQCA 3PW2A 2M2VA 9ICAA 8ICCA 4K4GA 3L9DA 2R8GA 1SKSA 3MDAA 1ZQQA 4DL7A 8ICMA 5BOLA 1CEZA 9ICWA 4J9OA 3H39A 3N4MB 2BKEA 4EBKA 4UAYA 4FS1A 2I9GA 2ZH4A 2UVUA 4Z6CA 4PGQA 3Q8PB 5CB1A 3GDXA 8ICYA 3RH4A 4RWNA 4Z6DA 4NY8A 2HHWA 2BQUA 3HPOA 3RRGA 4Z6EA 1NKEA 9ICFA 5HR9A 2LYHA 3RJGA 4O3RA 3RR8A 5KFGA 3QE9Y 2BCQA 3IHQB 3MFIA 4PGYA 3JPQA 4RQ0A 8ICLA 3PMLA 5EWFA 3THVA 4M9NA 2M9NA 3TARA 2UVWA 2ID1A 4UD4A 2P6UA 4QZBA 3GV8B 5HRBA 4YCXA 4DL3A 9ICQA 3HIYA 3GILA 3FDSA 4S3NA 4RQ5A 2DVIA 4M9LA 4J9KA 8ICJA 3HJ1A 3OV7A 1ZQNA 4NLKA 4NM2A 4O3NA 4IQVA 4QZAA 3OGUA 3AUOA 3Q8MA 1BNOA 4FHWA 2AGQA 5EWGA 5HMLA 5IIMA 1TK0A 4I27A 1UA0A 4DLGA 4M0AA 2HHUA 9ICTA 3PVXA 4HYKA 5F2VO 1RPLA 1SZPA 4RZRA 3SZ2A 7ICNA 5J2EA 4WCWA 1NK4A 9ICSA 4KLJA 4R64A 3GIJA 1BPXA 8ICBA 2M2UA 4DOBA 5CJ7A 5J0YA 2BPFA 2ZH9A 5DG8A 4DL6A 2DPIA 1KNYA 4GXKA 4ED0A 4I28A 4ED2A 5KFBA 1TVAA 3AQNA 4PHDA 4GC7A 8ICAA 4KLGA 8ICIA 4BDPA 5KFOA 1ZQWA 4RWQA 2C22A 4YR3A 3QZ8A 4UBBA 2XC9A 1ZQZA 5KFAA 4YXMA 3M9OB 3LWMA 4C8LA 4RQ4A 8ICFA 1QLNA 4F5QA 1CUKA 2VA8A 4UBCA 3C1YA 3SV3A 1ZQAA 4I2AA 1D8YA 5IIOA 2XCPA 4DL2A 3SV4A 3RR7A 2KFNA 2IHNA 1SKWA 1ZQIA 3TI0A 5KFYA 2O1PA 4YVZA 2NRVA 4FHVA 2BCVA 4EZ6A 8ICPA 5KG3A 3T3FA 4R8UB 5L1KA 1JX4A 4YG2A 1JIHA 5KFLA 2BE3A 3H4BA 2ZHBA 2W8KA 2W8LA 3UXPA 1TAQA 2KN7A 2J6SA 2BHNA 2ZTDA 4LZDA 5KFCA 5J0OA 4DSJA 3NGDA 5DEDA 3GV7B 3RRHA 4RNOA 4JUZA 3GFKB 3MR5A 4RPXA 1V9PA 2J6TA 4YMNA 4O9MA 5KG4A 2MAXA 4DFMA 1ZJMA 4IRCA 5KFWA 5J2JA 4ELVA 1UEVA 1KEJA 1TFYA 3C2MA 1U9LA 4ELTA 1ZQXA 3LWLA 1N56A 4NM1A 3HWTA 7ICQA 4ATBB 2FMPA 3TANA 4P4MA 4DOAA 1XSNA 9ICRA 4UD5A 9ICXA 5KFRA 2HVIA 5J0TA 1QTMA 4J9QA 1ZQBA 4KLFA 2C2DA 3LK9A 4PHPA 3C21A 4I2JA 4J9LA 2FMSA 4F5PA 5IINA 4KLIA 4I2BA 4QW8A 3RBEA 2NRTA 4DOCA 4J9MA 3TAQA 3OJSA 4MFCA 4PH5A 4QWAA 2W9AA 5J2AA 1SL2A 2C28A 3RJJA 4KLMA 7ICFA 8ICQA 5HRFA 3B0XA 2VANA 5KG6A 4GLXA 2ZH8A 4Q45A 5KG0A 5KFXA 2P6RA 4R66A 2ZH5A 9ICLA 1NK5A 4J9SA 2KTQA 2FPLA 4F5OA 7ICRA 8ICVA 1MQ3A 4M9JA 2ZH3A 1A76A 5C5JA 4FH5A 3GIIA 2H5XA 4DFKA 4RWOA 1IM4A 1ZQUA 1NJYA 1TAUA 3ZDDA 4KLUA 2HHVA 3EYZA 3T5LA 2BGWA 4YMMA 3MFHA 5KG1A 5L1IA 3Q8LA 2BQRA 1NOMA 1XO1A 4RQ3A 4ECRA 4C8MA 4DSEA 4IQUA 3QZ7A 4EYHB 4M9HA 3LQCB 2J6UA 3ISBA 3RB3A 1ZYQA 5DG7A 3RJIA 5J0SA 5KFEA 3T5JA 4B9VA 3TFRA 4F4YA 5KT4A 4F5RA 3RJKA 3TFSA 4ED8A 2BPCA 4QZFA 3V7KA 4F50A 3PW4A 2Y1JA 4KLHA 4PPXA 1T4GA 5KT3A 2ALZA 4O5KA 4Q8EA 2JEFA 2MUTB 1R8CA 2JZBB 4YD1A 4RNMA 3MBYA 1NJXA 1JMSA 2ZUBA 1KFSA 3KHGA 2VA3A 4KLTA 4M5DA 4MEYA 3BQ0A 7ICUA 3AQKA 1FA0A 3H4DA 2ZTEA 4FHPA 5D4BA 3AQMA 4YFKA 4JV2A 4I2EA 4O3OA 4B9TA 4Z6FA 9ICGA 7ICGA 1T3NA 3QEBZ 3T5KA 4PGXA 2PFNA 1L3UA 4WC2A 1JXEA 4YD2A 4KN4A 4ELUA 1D9FA 5HP4A 4AT9A 4E7XA 4DFJA 4C8KA 2PFPA 3EWAA 5J2BA 8ICRA 8ICGA 8ICHA 4CCHA 5EOZA 4BWJA 1U45A 2FPMA 1KSPA 2PBEA 3ZDBA 4UAWA 2PI4A 3WFOA 4AT7A 4M2YA 3TQ1A 9ICMA 1COOA 5J2FA 3MR2A 5KFZA 4ED1A 1ZQRA 3RJEA 1BPEA 2DR5A 4UQGA 1L3TA 1ZQSA 4AT7B 4B9LA 4KTQA 3PR4A 1NK7A 3E2EA 2HHXA 3NYBA 1IXRA 5J0PA 5KG5A 1MSWD 2FPKA 1UT5A 4EBEA 2IA6A 4F4ZA 4E80A 2Q66A 5KFUA 5DBAA 4DLEA 1ZJNA 1SKRA 2BDPA 1DGSA 7ICOA 3UPSA 4I2GA 4FBTA 2DRBA 1RYRA 1KFDA 5DBBA 4X4NA 4QZDA 4QWBA 3RJHA 4DSKA 4GXIA 3C2LA 3RB4A 4RU9A 4KLQA 5L9XA 1S76D 3WFRE 1KTQA 2JEIA 4WC7A 2AGPA 1Z00B 2ATLA 1EXNA 5KT5A 4P4PA 1ZQTA 4FH3A 4TUQA 4O3SA 1NK0A 2KZZA 4O0IA 1H38A 3H40A 5KTQA 4FHXA 3ZDEA 4J9PA 1TK5A 4BXOB 2KP7A 1VFGA 4KLDA 4WBYA 4YR0A 3ZD9A 5J0XA 3C5GA 2HVHA 4BXOA 1HUOA 5HREA 2M2TA 3OVBA 5IIIA 4PHAA 4DEZA 2FMQA 1XSLA 3EZ5A 4TURA 1DK2A 3H37A 2RDJA 3AQLA 5IILA 2UVVA 1ZQHA 3WFSC 4X4RA 1Y88A 5KFVA 4F8RA 3KHRA 2ZH1A 4EP7A 5L1JA 4X4VA 8ICXA 4EBCA 9ICVA 4IQWA 5HRKA 3C18A 3UQ2A 3PW5A 2DR9A 1X9MA 1ZQCA 4IG8A 3PR5B 4DQRA 4NLNA 3UXNA 2DR8A 5HRDA 3AU6A 2HHPA 3PNCA 4I2HA 2ASLA 5HMMA 4QW9A 1S97A 4F93B 5KFNA 9ICBA 1ZQKA 2RDIA 4RQ7A 5KFTA 3KHLA 1MQ2A 1BPDA 1VJ7A 5DKWA 2F1HA 3OSPA 3RB0A 3RH6A 2AU0A 7ICEA 5DECA 2BQ3A 4GC6A 3M9NB 4NKTA 9ICNA 5J2IA 4DSFA 3IM1A 4YXJA 4F5NA 3H8WA 3GIMA 1X9SA 1X9WA 7ICIA 9ICIA 4EEYA 1BNPA 1BVSA 2AQ4A 1ZQEA 4WC0A 3PMNA 2GWSA 1WCLA 1XS9D 3KHHA 2JEJA 3PY8A 2ASDA 1L3VA 4ECZA 1PZNA 2A1JA 3K4GA 5DB8A 4WC6A 3ISDA 3RAXA 5L1LA 5DQIA 4RWPA 4O3PA 5CA7A 2V9WA 3BDPA 1RXVA 1ZQYA 4O5CA 2ZTCA 4YN4A 4DQPA 2MUTA 3WFPA 4X4SA 4KITB 1NJZA 4WC4A 5DGAA 2KFZA 4XRHA 2V4RA 1Q78A 4ECVA 4M9GA 4MF2A 4UB5A 3JPRA 9ICEA 1XC9A 4MEXA 1WOTA 5KT6A 3H8JA 3M8SA 4ED3A 2Y1IA 5KFPA 4QZIA 4ED7A 1S0VA 3HP6A 5KFKA 2R8KA 4O3QA 2JZBA 1NK8A 1D9DA 1Q79A 3PX6A 4RUCA 2DFLA 4F2RA 4J9NA 4X4PA 5J2DA 3PX4A 3GIKA 4G3IA 4E8FA 4X4UA 4B9MA 3ZDCA 3V7LA 5KT7A 5KT2A 2PI5A 4ECXA 3RJFA 9ICUA 3V6HA 3PW0A 4XA5A 4QZCA 3EPIA 4C8NA 2FLPA 9ICKA 5J29A 1R8BA 5DB6A 4UAZA 3C5FA 4QZ9A 2V4QA 1ZQLA 4TQSA 4YMOA 4DQIA 1ZQGA 1UEUA 3HX0A 3Q8SB 3JPSA 4F91B 1Z3EB 4RQ8A 4UB3A 2M2WA 4NXZA 2ZH2A 3ETLA 4F2SA 2DRAA 3B0YA 4X5VA 4ECSA 5J0WA 2BCRA 4DSLA 2ZUDA 4M47A 4UB2A 4QWDA 1XWLA 4ZH4A 2RFFA 5CP2A 4ED6A 1L5UA 3MGIA 3OUYB 2IMWP 1B22A 4RNNA 3BQ1A 2IBKA 3HJ4A 4WC5A 4TUPA 5J2GA 3JZ0A 3OUYA 3QEAZ 3H8SA 5HHHA 5IIKA 5J0UA 2C2RA 1ZQPA 3H38A 4M6WB 4RT3A 3PX0A 1TV9A 2ISOA 3MGHA 1WCNA 3RH5A 4IRDA 4EBJA 5CHGA 3RB6A 2FLLA 1S0OA 4JWMA 4M6WA 5DGBA 4YQWA 4RQ2A 7ICVA 5KFSA 4FO6A 7ICPA 1U48A 4DQQA 9ICOA 4YP3A 2W9CA 4I29A 3UXOA 2XY5A 1X2IA 2R8JA 9ICHA 5J2KA 4LZGA 5DB7A 4JV1A 4JK1A 2XY7A 4BGDA 1JN3A 1U4BA 4RPZA 4EBDA 2BCUA 1F5AA 5CR0A 1LB2B 4ATBA 2P66A 2NRKA 5BPCA 3GV5B 5JUMA 1HJPA 4DWIA 4B9UA 4QZEA 5J2HA 2XGPA 4RQ1A 3Q8QB 5DG9A 4X0AA 1A77A 4UB1A 2ZUCA 3OSNA 3G6XA 5J0RA 1HUZA 7ICSA 4JV0A 3MDCA 1BGXT 2O5AA 5F9LA 4YR2A 1UETA 4TUSA 1NO5A 4ECTA 5HC9A 4AT8B 1QSYA 2ZH6A 4RT2A 2W9MA 3OJUA 3Q8KA 7ICKA 1NZPA 4TQRA 1XSPA 3KTQA 1R89A 4X4TA 5KFDA 1U49A 2F1IA 3C1ZA 4QZ8A 4R63A 1LV5A 4PHEA 4KN7A 3SYZA 1ZQFA 2IHMA 5DBCA 1JXLA 2HW3A 4EZ9A 2NRXA 2WTFA 2XY6A 1NJWA 3ZDAA 1YLQA 3JYYA 3MABA 4IQTA 1T7PA 1ZQJA 1UT8A 3EPGA 1JAJA 3V7JA 1XU4A 8ICWA 1QSLA 9ICJA 4KLEA 4DL4A 2AQ0A 5CWRA 4XQ8A 4P4OA 1SL1A 1RZTA 1SL0A 3PV8A 3BQ2A 1ZQDA 4WBZA 4DF4A 4LVSA 4ECUA 4KMUA 1S77D 2A1JB 1T8EA 8ICZA 5EWEA 4F92B 5DDYA 3JPNA 1DK3A 2KZ3A 5HRLA 5HNKA 8ICKA 5HRIA 5HRGA 4M04A 1ZETA 5KFHA 3RBDA 3HT3A 4DFPA 1S0NA 4MF8A 4BWMA 2DPJA 3PO4A 1MIWA 5HRHA 3OVSA 2PFQA 4ECQA 1S10A 5DDMA 1BPYA 5DLGA 1NKBA 3UQ0A 1TFWA 3PW7A 2PFOA 4X0BA 7ICMA 3TAPA 4F4KA 2W9BA 1JQRA 4B9SA 1B43A 4ECYA 4AT9B 1QSSA 4K4IA 7ICTA 2BPGA 2W9BB 8ICOA 4RUAA 4MFFA 1K1SA 1ZQVA 3JPTA 4F4XA 4KLOA 5KFIA 2NRWA 5BOMA 5F9NA 2XGQA 2VA2A 5D46A 4DO9A 8ICNA 3C66A 3OVAA 3K75D 4DQSA 4DS4A 4XUSA 4DL5A 8ICSA 3MR3A 3C2KA 4DF8A 8ICTA 2F1JA 1RYSA 5KFFA 2R8IA 3G6YA 3H7IA 3SI8A 4X4OA 1KFTA 4XQ7A 4AT8A 3V72A 1UA1A 2ZH7A 1MC8A 5TZVA 5DB9A 4R65A 2R8HA 1TKDA 2KZMA 3LDAA 3OHBA 4IR1A 4RPYA 8ICEA 3PO5A 1TFRA 5KG2A 3AU2A 3BJYA 3JPOA 3EW9A 1PX5A 1N48A 5DLFA 3C23A 2PXIA 3V6KA 4FHYA 2HHQA 4Q44A 3RAQA 1KRPA 3ORYA 3OHAA 3RTVA 5HHIA 1V4AA 3V6JA 3FYHA 4R8UA 3T5HA 1Z00A 4IR9A 1BPZA 4I2DA 3NTUA 2Q0ZX 3M8RA 4WC3A 3N97B 1ZQMA 4Q43A 4E0DA 2ZHAA 5KFJA 1KLNA 5KFMA 1NK6A 4C8OA 9ICCA 1S9FA 4MFAA 4UB4A 3UPQA 1L3SA 1KDHA 7ICLA 4FBUA 4FS2A 2C2EA 4ECWA 2FLNA 4K4HA 5DQGA 4QZHA 2ASJA 2HHTA 4LT6A 5DQHA 3H3AA 2DR7A 2UVRA 7ICHA 4NLZA 2NRZA 1K1QA 1D8LA 2I1QA 3JPPA 4EYIB 2AJQA 4IRKA 2W9CB 2ZJ5A 5J0QA 2XO7A 2BR0A 5KG7A 4JWNA 2ISPA 1C7YA 4NLGA 1NKCA 4DSIA 3MR6A 4I2FA 1S0MA 4KLSA 2ZJ8A 4RQ6A 2B21A 4QWCA 4QZGA 3M9MB 3HW8A 3Q8RB 4F4WA 2AGOA 1RXWA 4F3OA 5IIJA 3BQTA 3G6VA 4J9RA 1OU5A 3ZD8A 4B9NA 1MIYA 2OWOA 4QWEA 3WFQE 4KLLA 7ICJA 1NK9A 2ZJAA 4NKUA 4I2IA 5KFQA 8ICUA 4I2CA 2JEGA 1BPBA 9ICPA 1U47A 4P2HA 1R8AA 4Q8FA 4GXJA 3ISCA 4X4QA 1MIVA 5J2CA 4WC1A 2HHSA 1AROP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQO A;  1TK8 A;  2XCA A;  4O5E A;  1DOQ A;  2BCS A;  5D49 A;  4DS5 A;  3GQC A;  3PW2 A;  2M2V A;  9ICA A;  8ICC A;  4K4G A;  3L9D A;  2R8G A;  1SKS A;  3MDA A;  1ZQQ A;  4DL7 A;  8ICM A;  5BOL A;  1CEZ A;  9ICW A;  4J9O A;  3H39 A;  3N4M B;  2BKE A;  4EBK A;  4UAY A;  4FS1 A;  2I9G A;  2ZH4 A;  2UVU A;  4Z6C A;  4PGQ A;  3Q8P B;  5CB1 A;  3GDX A;  8ICY A;  3RH4 A;  4RWN A;  4Z6D A;  4NY8 A;  2HHW A;  2BQU A;  3HPO A;  3RRG A;  4Z6E A;  1NKE A;  9ICF A;  5HR9 A;  2LYH A;  3RJG A;  4O3R A;  3RR8 A;  5KFG A;  3QE9 Y;  2BCQ A;  3IHQ B;  3MFI A;  4PGY A;  3JPQ A;  4RQ0 A;  8ICL A;  3PML A;  5EWF A;  3THV A;  4M9N A;  2M9N A;  3TAR A;  2UVW A;  2ID1 A;  4UD4 A;  2P6U A;  4QZB A;  3GV8 B;  5HRB A;  4YCX A;  4DL3 A;  9ICQ A;  3HIY A;  3GIL A;  3FDS A;  4S3N A;  4RQ5 A;  2DVI A;  4M9L A;  4J9K A;  8ICJ A;  3HJ1 A;  3OV7 A;  1ZQN A;  4NLK A;  4NM2 A;  4O3N A;  4IQV A;  4QZA A;  3OGU A;  3AUO A;  3Q8M A;  1BNO A;  4FHW A;  2AGQ A;  5EWG A;  5HML A;  5IIM A;  1TK0 A;  4I27 A;  1UA0 A;  4DLG A;  4M0A A;  2HHU A;  9ICT A;  3PVX A;  4HYK A;  5F2V O;  1RPL A;  1SZP A;  4RZR A;  3SZ2 A;  7ICN A;  5J2E A;  4WCW A;  1NK4 A;  9ICS A;  4KLJ A;  4R64 A;  3GIJ A;  1BPX A;  8ICB A;  2M2U A;  4DOB A;  5CJ7 A;  5J0Y A;  2BPF A;  2ZH9 A;  5DG8 A;  4DL6 A;  2DPI A;  1KNY A;  4GXK A;  4ED0 A;  4I28 A;  4ED2 A;  5KFB A;  1TVA A;  3AQN A;  4PHD A;  4GC7 A;  8ICA A;  4KLG A;  8ICI A;  4BDP A;  5KFO A;  1ZQW A;  4RWQ A;  2C22 A;  4YR3 A;  3QZ8 A;  4UBB A;  2XC9 A;  1ZQZ A;  5KFA A;  4YXM A;  3M9O B;  3LWM A;  4C8L A;  4RQ4 A;  8ICF A;  1QLN A;  4F5Q A;  1CUK A;  2VA8 A;  4UBC A;  3C1Y A;  3SV3 A;  1ZQA A;  4I2A A;  1D8Y A;  5IIO A;  2XCP A;  4DL2 A;  3SV4 A;  3RR7 A;  2KFN A;  2IHN A;  1SKW A;  1ZQI A;  3TI0 A;  5KFY A;  2O1P A;  4YVZ A;  2NRV A;  4FHV A;  2BCV A;  4EZ6 A;  8ICP A;  5KG3 A;  3T3F A;  4R8U B;  5L1K A;  1JX4 A;  4YG2 A;  1JIH A;  5KFL A;  2BE3 A;  3H4B A;  2ZHB A;  2W8K A;  2W8L A;  3UXP A;  1TAQ A;  2KN7 A;  2J6S A;  2BHN A;  2ZTD A;  4LZD A;  5KFC A;  5J0O A;  4DSJ A;  3NGD A;  5DED A;  3GV7 B;  3RRH A;  4RNO A;  4JUZ A;  3GFK B;  3MR5 A;  4RPX A;  1V9P A;  2J6T A;  4YMN A;  4O9M A;  5KG4 A;  2MAX A;  4DFM A;  1ZJM A;  4IRC A;  5KFW A;  5J2J A;  4ELV A;  1UEV A;  1KEJ A;  1TFY A;  3C2M A;  1U9L A;  4ELT A;  1ZQX A;  3LWL A;  1N56 A;  4NM1 A;  3HWT A;  7ICQ A;  4ATB B;  2FMP A;  3TAN A;  4P4M A;  4DOA A;  1XSN A;  9ICR A;  4UD5 A;  9ICX A;  5KFR A;  2HVI A;  5J0T A;  1QTM A;  4J9Q A;  1ZQB A;  4KLF A;  2C2D A;  3LK9 A;  4PHP A;  3C21 A;  4I2J A;  4J9L A;  2FMS A;  4F5P A;  5IIN A;  4KLI A;  4I2B A;  4QW8 A;  3RBE A;  2NRT A;  4DOC A;  4J9M A;  3TAQ A;  3OJS A;  4MFC A;  4PH5 A;  4QWA A;  2W9A A;  5J2A A;  1SL2 A;  2C28 A;  3RJJ A;  4KLM A;  7ICF A;  8ICQ A;  5HRF A;  3B0X A;  2VAN A;  5KG6 A;  4GLX A;  2ZH8 A;  4Q45 A;  5KG0 A;  5KFX A;  2P6R A;  4R66 A;  2ZH5 A;  9ICL A;  1NK5 A;  4J9S A;  2KTQ A;  2FPL A;  4F5O A;  7ICR A;  8ICV A;  1MQ3 A;  4M9J A;  2ZH3 A;  1A76 A;  5C5J A;  4FH5 A;  3GII A;  2H5X A;  4DFK A;  4RWO A;  1IM4 A;  1ZQU A;  1NJY A;  1TAU A;  3ZDD A;  4KLU A;  2HHV A;  3EYZ A;  3T5L A;  2BGW A;  4YMM A;  3MFH A;  5KG1 A;  5L1I A;  3Q8L A;  2BQR A;  1NOM A;  1XO1 A;  4RQ3 A;  4ECR A;  4C8M A;  4DSE A;  4IQU A;  3QZ7 A;  4EYH B;  4M9H A;  3LQC B;  2J6U A;  3ISB A;  3RB3 A;  1ZYQ A;  5DG7 A;  3RJI A;  5J0S A;  5KFE A;  3T5J A;  4B9V A;  3TFR A;  4F4Y A;  5KT4 A;  4F5R A;  3RJK A;  3TFS A;  4ED8 A;  2BPC A;  4QZF A;  3V7K A;  4F50 A;  3PW4 A;  2Y1J A;  4KLH A;  4PPX A;  1T4G A;  5KT3 A;  2ALZ A;  4O5K A;  4Q8E A;  2JEF A;  2MUT B;  1R8C A;  2JZB B;  4YD1 A;  4RNM A;  3MBY A;  1NJX A;  1JMS A;  2ZUB A;  1KFS A;  3KHG A;  2VA3 A;  4KLT A;  4M5D A;  4MEY A;  3BQ0 A;  7ICU A;  3AQK A;  1FA0 A;  3H4D A;  2ZTE A;  4FHP A;  5D4B A;  3AQM A;  4YFK A;  4JV2 A;  4I2E A;  4O3O A;  4B9T A;  4Z6F A;  9ICG A;  7ICG A;  1T3N A;  3QEB Z;  3T5K A;  4PGX A;  2PFN A;  1L3U A;  4WC2 A;  1JXE A;  4YD2 A;  4KN4 A;  4ELU A;  1D9F A;  5HP4 A;  4AT9 A;  4E7X A;  4DFJ A;  4C8K A;  2PFP A;  3EWA A;  5J2B A;  8ICR A;  8ICG A;  8ICH A;  4CCH A;  5EOZ A;  4BWJ A;  1U45 A;  2FPM A;  1KSP A;  2PBE A;  3ZDB A;  4UAW A;  2PI4 A;  3WFO A;  4AT7 A;  4M2Y A;  3TQ1 A;  9ICM A;  1COO A;  5J2F A;  3MR2 A;  5KFZ A;  4ED1 A;  1ZQR A;  3RJE A;  1BPE A;  2DR5 A;  4UQG A;  1L3T A;  1ZQS A;  4AT7 B;  4B9L A;  4KTQ A;  3PR4 A;  1NK7 A;  3E2E A;  2HHX A;  3NYB A;  1IXR A;  5J0P A;  5KG5 A;  1MSW D;  2FPK A;  1UT5 A;  4EBE A;  2IA6 A;  4F4Z A;  4E80 A;  2Q66 A;  5KFU A;  5DBA A;  4DLE A;  1ZJN A;  1SKR A;  2BDP A;  1DGS A;  7ICO A;  3UPS A;  4I2G A;  4FBT A;  2DRB A;  1RYR A;  1KFD A;  5DBB A;  4X4N A;  4QZD A;  4QWB A;  3RJH A;  4DSK A;  4GXI A;  3C2L A;  3RB4 A;  4RU9 A;  4KLQ A;  5L9X A;  1S76 D;  3WFR E;  1KTQ A;  2JEI A;  4WC7 A;  2AGP A;  1Z00 B;  2ATL A;  1EXN A;  5KT5 A;  4P4P A;  1ZQT A;  4FH3 A;  4TUQ A;  4O3S A;  1NK0 A;  2KZZ A;  4O0I A;  1H38 A;  3H40 A;  5KTQ A;  4FHX A;  3ZDE A;  4J9P A;  1TK5 A;  4BXO B;  2KP7 A;  1VFG A;  4KLD A;  4WBY A;  4YR0 A;  3ZD9 A;  5J0X A;  3C5G A;  2HVH A;  4BXO A;  1HUO A;  5HRE A;  2M2T A;  3OVB A;  5III A;  4PHA A;  4DEZ A;  2FMQ A;  1XSL A;  3EZ5 A;  4TUR A;  1DK2 A;  3H37 A;  2RDJ A;  3AQL A;  5IIL A;  2UVV A;  1ZQH A;  3WFS C;  4X4R A;  1Y88 A;  5KFV A;  4F8R A;  3KHR A;  2ZH1 A;  4EP7 A;  5L1J A;  4X4V A;  8ICX A;  4EBC A;  9ICV A;  4IQW A;  5HRK A;  3C18 A;  3UQ2 A;  3PW5 A;  2DR9 A;  1X9M A;  1ZQC A;  4IG8 A;  3PR5 B;  4DQR A;  4NLN A;  3UXN A;  2DR8 A;  5HRD A;  3AU6 A;  2HHP A;  3PNC A;  4I2H A;  2ASL A;  5HMM A;  4QW9 A;  1S97 A;  4F93 B;  5KFN A;  9ICB A;  1ZQK A;  2RDI A;  4RQ7 A;  5KFT A;  3KHL A;  1MQ2 A;  1BPD A;  1VJ7 A;  5DKW A;  2F1H A;  3OSP A;  3RB0 A;  3RH6 A;  2AU0 A;  7ICE A;  5DEC A;  2BQ3 A;  4GC6 A;  3M9N B;  4NKT A;  9ICN A;  5J2I A;  4DSF A;  3IM1 A;  4YXJ A;  4F5N A;  3H8W A;  3GIM A;  1X9S A;  1X9W A;  7ICI A;  9ICI A;  4EEY A;  1BNP A;  1BVS A;  2AQ4 A;  1ZQE A;  4WC0 A;  3PMN A;  2GWS A;  1WCL A;  1XS9 D;  3KHH A;  2JEJ A;  3PY8 A;  2ASD A;  1L3V A;  4ECZ A;  1PZN A;  2A1J A;  3K4G A;  5DB8 A;  4WC6 A;  3ISD A;  3RAX A;  5L1L A;  5DQI A;  4RWP A;  4O3P A;  5CA7 A;  2V9W A;  3BDP A;  1RXV A;  1ZQY A;  4O5C A;  2ZTC A;  4YN4 A;  4DQP A;  2MUT A;  3WFP A;  4X4S A;  4KIT B;  1NJZ A;  4WC4 A;  5DGA A;  2KFZ A;  4XRH A;  2V4R A;  1Q78 A;  4ECV A;  4M9G A;  4MF2 A;  4UB5 A;  3JPR A;  9ICE A;  1XC9 A;  4MEX A;  1WOT A;  5KT6 A;  3H8J A;  3M8S A;  4ED3 A;  2Y1I A;  5KFP A;  4QZI A;  4ED7 A;  1S0V A;  3HP6 A;  5KFK A;  2R8K A;  4O3Q A;  2JZB A;  1NK8 A;  1D9D A;  1Q79 A;  3PX6 A;  4RUC A;  2DFL A;  4F2R A;  4J9N A;  4X4P A;  5J2D A;  3PX4 A;  3GIK A;  4G3I A;  4E8F A;  4X4U A;  4B9M A;  3ZDC A;  3V7L A;  5KT7 A;  5KT2 A;  2PI5 A;  4ECX A;  3RJF A;  9ICU A;  3V6H A;  3PW0 A;  4XA5 A;  4QZC A;  3EPI A;  4C8N A;  2FLP A;  9ICK A;  5J29 A;  1R8B A;  5DB6 A;  4UAZ A;  3C5F A;  4QZ9 A;  2V4Q A;  1ZQL A;  4TQS A;  4YMO A;  4DQI A;  1ZQG A;  1UEU A;  3HX0 A;  3Q8S B;  3JPS A;  4F91 B;  1Z3E B;  4RQ8 A;  4UB3 A;  2M2W A;  4NXZ A;  2ZH2 A;  3ETL A;  4F2S A;  2DRA A;  3B0Y A;  4X5V A;  4ECS A;  5J0W A;  2BCR A;  4DSL A;  2ZUD A;  4M47 A;  4UB2 A;  4QWD A;  1XWL A;  4ZH4 A;  2RFF A;  5CP2 A;  4ED6 A;  1L5U A;  3MGI A;  3OUY B;  2IMW P;  1B22 A;  4RNN A;  3BQ1 A;  2IBK A;  3HJ4 A;  4WC5 A;  4TUP A;  5J2G A;  3JZ0 A;  3OUY A;  3QEA Z;  3H8S A;  5HHH A;  5IIK A;  5J0U A;  2C2R A;  1ZQP A;  3H38 A;  4M6W B;  4RT3 A;  3PX0 A;  1TV9 A;  2ISO A;  3MGH A;  1WCN A;  3RH5 A;  4IRD A;  4EBJ A;  5CHG A;  3RB6 A;  2FLL A;  1S0O A;  4JWM A;  4M6W A;  5DGB A;  4YQW A;  4RQ2 A;  7ICV A;  5KFS A;  4FO6 A;  7ICP A;  1U48 A;  4DQQ A;  9ICO A;  4YP3 A;  2W9C A;  4I29 A;  3UXO A;  2XY5 A;  1X2I A;  2R8J A;  9ICH A;  5J2K A;  4LZG A;  5DB7 A;  4JV1 A;  4JK1 A;  2XY7 A;  4BGD A;  1JN3 A;  1U4B A;  4RPZ A;  4EBD A;  2BCU A;  1F5A A;  5CR0 A;  1LB2 B;  4ATB A;  2P66 A;  2NRK A;  5BPC A;  3GV5 B;  5JUM A;  1HJP A;  4DWI A;  4B9U A;  4QZE A;  5J2H A;  2XGP A;  4RQ1 A;  3Q8Q B;  5DG9 A;  4X0A A;  1A77 A;  4UB1 A;  2ZUC A;  3OSN A;  3G6X A;  5J0R A;  1HUZ A;  7ICS A;  4JV0 A;  3MDC A;  1BGX T;  2O5A A;  5F9L A;  4YR2 A;  1UET A;  4TUS A;  1NO5 A;  4ECT A;  5HC9 A;  4AT8 B;  1QSY A;  2ZH6 A;  4RT2 A;  2W9M A;  3OJU A;  3Q8K A;  7ICK A;  1NZP A;  4TQR A;  1XSP A;  3KTQ A;  1R89 A;  4X4T A;  5KFD A;  1U49 A;  2F1I A;  3C1Z A;  4QZ8 A;  4R63 A;  1LV5 A;  4PHE A;  4KN7 A;  3SYZ A;  1ZQF A;  2IHM A;  5DBC A;  1JXL A;  2HW3 A;  4EZ9 A;  2NRX A;  2WTF A;  2XY6 A;  1NJW A;  3ZDA A;  1YLQ A;  3JYY A;  3MAB A;  4IQT A;  1T7P A;  1ZQJ A;  1UT8 A;  3EPG A;  1JAJ A;  3V7J A;  1XU4 A;  8ICW A;  1QSL A;  9ICJ A;  4KLE A;  4DL4 A;  2AQ0 A;  5CWR A;  4XQ8 A;  4P4O A;  1SL1 A;  1RZT A;  1SL0 A;  3PV8 A;  3BQ2 A;  1ZQD A;  4WBZ A;  4DF4 A;  4LVS A;  4ECU A;  4KMU A;  1S77 D;  2A1J B;  1T8E A;  8ICZ A;  5EWE A;  4F92 B;  5DDY A;  3JPN A;  1DK3 A;  2KZ3 A;  5HRL A;  5HNK A;  8ICK A;  5HRI A;  5HRG A;  4M04 A;  1ZET A;  5KFH A;  3RBD A;  3HT3 A;  4DFP A;  1S0N A;  4MF8 A;  4BWM A;  2DPJ A;  3PO4 A;  1MIW A;  5HRH A;  3OVS A;  2PFQ A;  4ECQ A;  1S10 A;  5DDM A;  1BPY A;  5DLG A;  1NKB A;  3UQ0 A;  1TFW A;  3PW7 A;  2PFO A;  4X0B A;  7ICM A;  3TAP A;  4F4K A;  2W9B A;  1JQR A;  4B9S A;  1B43 A;  4ECY A;  4AT9 B;  1QSS A;  4K4I A;  7ICT A;  2BPG A;  2W9B B;  8ICO A;  4RUA A;  4MFF A;  1K1S A;  1ZQV A;  3JPT A;  4F4X A;  4KLO A;  5KFI A;  2NRW A;  5BOM A;  5F9N A;  2XGQ A;  2VA2 A;  5D46 A;  4DO9 A;  8ICN A;  3C66 A;  3OVA A;  3K75 D;  4DQS A;  4DS4 A;  4XUS A;  4DL5 A;  8ICS A;  3MR3 A;  3C2K A;  4DF8 A;  8ICT A;  2F1J A;  1RYS A;  5KFF A;  2R8I A;  3G6Y A;  3H7I A;  3SI8 A;  4X4O A;  1KFT A;  4XQ7 A;  4AT8 A;  3V72 A;  1UA1 A;  2ZH7 A;  1MC8 A;  5TZV A;  5DB9 A;  4R65 A;  2R8H A;  1TKD A;  2KZM A;  3LDA A;  3OHB A;  4IR1 A;  4RPY A;  8ICE A;  3PO5 A;  1TFR A;  5KG2 A;  3AU2 A;  3BJY A;  3JPO A;  3EW9 A;  1PX5 A;  1N48 A;  5DLF A;  3C23 A;  2PXI A;  3V6K A;  4FHY A;  2HHQ A;  4Q44 A;  3RAQ A;  1KRP A;  3ORY A;  3OHA A;  3RTV A;  5HHI A;  1V4A A;  3V6J A;  3FYH A;  4R8U A;  3T5H A;  1Z00 A;  4IR9 A;  1BPZ A;  4I2D A;  3NTU A;  2Q0Z X;  3M8R A;  4WC3 A;  3N97 B;  1ZQM A;  4Q43 A;  4E0D A;  2ZHA A;  5KFJ A;  1KLN A;  5KFM A;  1NK6 A;  4C8O A;  9ICC A;  1S9F A;  4MFA A;  4UB4 A;  3UPQ A;  1L3S A;  1KDH A;  7ICL A;  4FBU A;  4FS2 A;  2C2E A;  4ECW A;  2FLN A;  4K4H A;  5DQG A;  4QZH A;  2ASJ A;  2HHT A;  4LT6 A;  5DQH A;  3H3A A;  2DR7 A;  2UVR A;  7ICH A;  4NLZ A;  2NRZ A;  1K1Q A;  1D8L A;  2I1Q A;  3JPP A;  4EYI B;  2AJQ A;  4IRK A;  2W9C B;  2ZJ5 A;  5J0Q A;  2XO7 A;  2BR0 A;  5KG7 A;  4JWN A;  2ISP A;  1C7Y A;  4NLG A;  1NKC A;  4DSI A;  3MR6 A;  4I2F A;  1S0M A;  4KLS A;  2ZJ8 A;  4RQ6 A;  2B21 A;  4QWC A;  4QZG A;  3M9M B;  3HW8 A;  3Q8R B;  4F4W A;  2AGO A;  1RXW A;  4F3O A;  5IIJ A;  3BQT A;  3G6V A;  4J9R A;  1OU5 A;  3ZD8 A;  4B9N A;  1MIY A;  2OWO A;  4QWE A;  3WFQ E;  4KLL A;  7ICJ A;  1NK9 A;  2ZJA A;  4NKU A;  4I2I A;  5KFQ A;  8ICU A;  4I2C A;  2JEG A;  1BPB A;  9ICP A;  1U47 A;  4P2H A;  1R8A A;  4Q8F A;  4GXJ A;  3ISC A;  4X4Q A;  1MIV A;  5J2C A;  4WC1 A;  2HHS A;  1ARO P; 
#chains in the Genus database with same CATH topology
 2XCA A;  4DS5 A;  9ICA A;  4DL7 A;  4J9O A;  3H39 A;  3PSI A;  2BKE A;  4EBK A;  2EAO A;  2Y9T A;  3Q8P B;  5CB1 A;  1SB3 C;  4RWN A;  4NLC A;  2E8N A;  4UB8 U;  4EEN A;  3HPO A;  1KQQ A;  5B5E U;  3MFI A;  1A0P A;  2WF9 A;  4M9N A;  2LYA A;  3GV8 B;  2ZIU A;  5HRB A;  4QIW C;  3GIL A;  4NL9 A;  2KSO A;  3FDS A;  2DVI A;  4M9L A;  4NM2 A;  1ZQ1 C;  4GFJ A;  4IQV A;  4I27 A;  2P35 A;  2K4I A;  5F2V O;  3SZ2 A;  4WCW A;  5J2E A;  1FFV A;  9ICS A;  3GIJ A;  8ICB A;  2WB1 C;  2BPF A;  1KNY A;  5KFB A;  3AQN A;  1FEZ A;  5B3Q A;  5ALM A;  4BDP A;  1ZQW A;  3NVV A;  2ZXI A;  2XC9 A;  1ZQZ A;  4CF4 A;  2VA8 A;  3C1Y A;  4I2A A;  3PSF A;  5AKX A;  1D8Y A;  3O0F A;  1QQ7 A;  5KFY A;  2BCV A;  4BJQ A;  4R8U B;  4YG2 A;  1JIH A;  2EAM A;  2W8L A;  1TAQ A;  2ESE A;  2GH1 A;  2KEY A;  3NGD A;  3RRH A;  4JUZ A;  1Q8K A;  4XJE A;  2K60 A;  5KG4 A;  4DFM A;  4O9M A;  1UEV A;  3C2M A;  2JXJ A;  3LWL A;  2JH1 A;  2FMP A;  3TAN A;  5KFR A;  1QTM A;  4J9Q A;  1ZQB A;  3LK9 A;  5AI8 A;  3EF2 A;  4I2B A;  5D62 A;  4FE3 A;  3RBE A;  4J9M A;  4MFC A;  1Q46 A;  5AI9 A;  5ALJ A;  5KG6 A;  2A1A A;  2ZH8 A;  4Q45 A;  5KFX A;  4R66 A;  5AM4 A;  1DXS A;  1NK5 A;  2G5I B;  2KVC A;  1A76 A;  5C5J A;  2H5X A;  4RWO A;  1ZQU A;  1TAU A;  2HHV A;  4FZM A;  3EYZ A;  1XO1 A;  3SR6 A;  4RQ3 A;  4ECR A;  4EYH B;  2BDU A;  3ISB A;  2IOH A;  3RB3 A;  5L1M A;  5DG7 A;  3RJI A;  5KFE A;  3T5J A;  2EH9 A;  2BPC A;  4C7Y A;  3V7K A;  3PW4 A;  2Y1J A;  4UAU A;  4PPX A;  2ALZ A;  4Q8E A;  2JEF A;  2MUT B;  3H0M B;  4YD1 A;  3MBY A;  1JMS A;  3HKZ C;  2EDU A;  3BQ0 A;  3AQK A;  4FHP A;  3AQM A;  4QJF B;  4YFK A;  1CI4 A;  3QEB Z;  5ALL A;  4CF3 A;  1F0M A;  4AT9 A;  1SGG A;  1WUD A;  4IC9 A;  1L7O A;  5T14 A;  5EOZ A;  1U45 A;  2FPM A;  3SD7 A;  3KKA C;  4AT7 A;  1COO A;  5J2F A;  5KFZ A;  3RJE A;  3D2N A;  4B9L A;  4Y2J A;  3PR4 A;  4O67 A;  2ZIV A;  3NYB A;  5KG5 A;  2IA6 A;  5AKE A;  2Q66 A;  4OAH A;  5DBA A;  1SKR A;  3UPS A;  5GTH U;  3F2D A;  5DBB A;  4DSK A;  3C2L A;  5AKJ A;  1S76 D;  5L9X A;  1KTQ A;  5E79 U;  4G9B A;  1ZQT A;  4FH3 A;  4TUQ A;  4O3S A;  4C4R A;  5KTQ A;  4Y2P A;  4J9P A;  1TK5 A;  4K99 A;  1F44 A;  2KKV A;  2M2T A;  5III A;  2FMQ A;  3M6Z A;  1XSL A;  1HIW A;  1PK3 A;  3M6K A;  1ZQH A;  2E8M A;  1Y88 A;  2KD1 A;  5KFV A;  4LEZ A;  4EP7 A;  5L1J A;  1PK1 A;  1ZQC A;  2Z7J A;  3AU6 A;  4P0P B;  4F93 B;  1ZQK A;  5KFT A;  2GO7 A;  2XID A;  4AYB C;  4BUG A;  4NKT A;  5J2I A;  4DSF A;  3IM1 A;  4YXJ A;  3GIM A;  1X9S A;  1BVS A;  4K8V A;  3HKZ F;  4ECZ A;  5DB8 A;  4WC6 A;  3RAX A;  2FCL A;  4RWP A;  5CA7 A;  2V9W A;  5F3X B;  3TAD A;  2K4P A;  1JRP A;  4DQP A;  4XRH A;  1CRX A;  1Z1V A;  1WOT A;  4UB5 A;  3JPR A;  2W7P A;  1XC9 A;  2W43 A;  2QAR B;  5KT6 A;  4QZI A;  1NK8 A;  1Q79 A;  1PUZ A;  4RUC A;  4X4P A;  5J2D A;  4PJ0 U;  4G3I A;  4X4U A;  4CGZ A;  3V7L A;  3F53 A;  5KAI U;  2PI5 A;  4QZC A;  4C8N A;  3MCR A;  5J29 A;  2EAP A;  4UAZ A;  3C5F A;  4DQI A;  2KK0 A;  1UEU A;  3Q8S B;  2QB0 A;  4NXZ A;  3ETL A;  4F2S A;  3B0Y A;  4X5V A;  1MA7 A;  4M47 A;  5AI5 A;  1Z1B A;  2XIC A;  4ZH4 A;  4WQL A;  4EED A;  1B22 A;  2LHT A;  2IBK A;  1L7P A;  5J2G A;  3JZ0 A;  3OUY A;  3QEA Z;  1OXJ A;  3H8S A;  2C2R A;  4IRD A;  3RB6 A;  3QUC A;  5J8Y A;  4M6W A;  3TAD C;  1U48 A;  4YP3 A;  2XY5 A;  2R8J A;  4LZG A;  2KV2 A;  5DB7 A;  4JK1 A;  4BGD A;  5BPC A;  2YMQ A;  5EE3 A;  2XGP A;  2KIV A;  3Q8Q B;  2W03 A;  1A77 A;  2ZUC A;  4Y2Y A;  5J0R A;  4JV0 A;  3MDC A;  4TUS A;  4Y2S A;  4TQR A;  1XSP A;  3K7D A;  2F1I A;  3C1Z A;  3VC8 A;  2WTF A;  2NO5 A;  3NWI A;  1T7P A;  1ZQJ A;  1UT8 A;  2MSN A;  3DEE A;  4P4O A;  1ZQD A;  4WBZ A;  2H3I A;  4DF4 A;  1ZRN A;  4ECU A;  2KKP A;  5DDY A;  1DK3 A;  3DV9 A;  1QQ5 A;  5HRG A;  4M04 A;  4DFP A;  1S0N A;  2YX8 A;  5JU5 A;  2KJ9 A;  2HI0 A;  3UQ0 A;  2YTU A;  3PW7 A;  7ICM A;  4F4K A;  2W9B A;  3I1Y A;  4EGW A;  1O08 A;  4ECY A;  1QSS A;  2BPG A;  1K1S A;  3UMC A;  1UHU A;  2NRW A;  2VA2 A;  3K75 D;  4DS4 A;  3C2K A;  4DF8 A;  1L8L A;  2R8I A;  4USA A;  4RQN A;  1N61 A;  3ED5 A;  5AKK A;  4X4O A;  3A0B U;  3ICX A;  5DB9 A;  2K4H A;  2R8H A;  8ICE A;  2EZX A;  4RPY A;  3AU2 A;  2YB1 A;  2PXI A;  3V6K A;  1X42 A;  2HHQ A;  4JLZ A;  2WAQ F;  3ORY A;  3HRD D;  4C7Z A;  4IR9 A;  4Y2Q A;  2L5Y A;  2GAF D;  1KLN A;  4UB4 A;  1KDH A;  3B9J A;  4NLZ A;  1K1Q A;  3QU7 A;  2WFA A;  4IRK A;  2ZJ5 A;  2D3D A;  5ALH A;  2BR0 A;  1X66 A;  1ED1 A;  4NL9 C;  2OH2 A;  4CE6 A;  4RQ6 A;  2B21 A;  2JH7 A;  4F4W A;  2N1R A;  4QWC A;  3Q8R B;  1RXW A;  5IIJ A;  3QU5 A;  3WFQ E;  1NK9 A;  2ZJA A;  4NKU A;  4I2C A;  5AIA A;  4X4Q A;  2K8C B;  5J2C A;  1KL9 A;  1N5W A;  5D49 A;  3PW2 A;  4K4G A;  2R8G A;  3MDA A;  1KW4 A;  1CEZ A;  2ZH4 A;  3GDX A;  8ICY A;  3RH4 A;  1SWV A;  2LKY A;  2QAR A;  2BQU A;  4Z6E A;  3SAG A;  9ICF A;  2LYH A;  3RJG A;  1XNS A;  3QE9 Y;  3IV6 A;  2BCQ A;  3IHQ B;  3JPQ A;  8ICL A;  3D2Q A;  3THV A;  2UVW A;  1Q3U A;  2W7O A;  3RF9 A;  4S3N A;  5ALD A;  4J9K A;  2EWR A;  4O3N A;  2GLE A;  4QZA A;  3Q8M A;  4M0A A;  2F76 X;  2HDO A;  5KL8 B;  3PVX A;  4RZR A;  5AKG A;  7ICN A;  4KLJ A;  2LM4 A;  2KJ5 A;  2NYV A;  1TVA A;  4PHD A;  4GC7 A;  8ICA A;  8ICI A;  5KFO A;  4UBB A;  4YXM A;  4C8L A;  3H37 A;  1QLN A;  5IIO A;  4DL2 A;  2KFN A;  1Z19 A;  2RQ5 A;  2O1P A;  2ODG A;  4CF5 A;  4EZ6 A;  3T3F A;  5AKY A;  4NXX A;  5KFL A;  2W8K A;  3UXP A;  1AQ6 A;  2BHN A;  2ZTD A;  4LZD A;  5KFC A;  2RHF A;  4RNO A;  1V9P A;  4KM5 A;  4JLX A;  4IRC A;  2MAX A;  1ZJM A;  3D6J A;  1TFY A;  4CNQ A;  4ATB B;  4P4M A;  4UD5 A;  9ICR A;  9ICX A;  5J0T A;  2PKE A;  2C2D A;  2FMS A;  4F5P A;  5ALZ A;  4DOC A;  1O03 A;  1T94 A;  4PH5 A;  1SL2 A;  4KLM A;  5J2A A;  2H3Z A;  3LVW A;  9ICL A;  4FFD A;  4ACO A;  4F5O A;  7ICR A;  3N7S C;  1V97 A;  5EE1 A;  1MQ3 A;  4M9J A;  4FH5 A;  3GII A;  4DFK A;  1NJY A;  1J2N A;  3ZDD A;  2KIW A;  4KLU A;  4K97 A;  2ZIX A;  1RG6 A;  2KE7 A;  1NOM A;  4C8M A;  4DSE A;  5AI4 A;  4IQU A;  4OJL A;  3QZ7 A;  1ZOL A;  2DF4 B;  5J0S A;  3QU9 A;  2HN1 A;  3RJK A;  3N7R C;  4ED8 A;  2LYB A;  4O5K A;  1R8C A;  4KLT A;  1URJ A;  4C4T A;  4MEY A;  2Q4T A;  1GO3 F;  5D4B A;  4O3O A;  4B9T A;  4Z6F A;  2AXT U;  1P7D A;  4WJ3 B;  1JXE A;  1D9F A;  2MA1 A;  4DFJ A;  3CP8 A;  5ALU A;  8ICG A;  1KSP A;  2PI4 A;  3WFO A;  4M2Y A;  2E1F A;  3MR2 A;  4LEY A;  4EEK A;  3QXG A;  1ZQS A;  4AT7 B;  2KIC A;  1MSW D;  4F4Z A;  3UMG A;  2OYY A;  2ZIV B;  5KFU A;  7ICO A;  2BDP A;  4FBT A;  2DRB A;  4X4N A;  3TAC B;  1FFU A;  4GXI A;  4RU9 A;  1RYU A;  4WC7 A;  2AGP A;  2GOL A;  2ATL A;  2B4V A;  1EXN A;  5KT5 A;  1NK0 A;  3CRX A;  1H38 A;  1WG8 A;  2HOF A;  3F5E A;  2KP7 A;  4YR0 A;  3E58 A;  3H0R B;  3QUB A;  3C5G A;  5HRE A;  3OVB A;  3H0L B;  4PHA A;  1NI3 A;  2KVS A;  4TUR A;  2RDJ A;  2UVV A;  2ZG6 A;  3KHR A;  2ZH1 A;  8ICX A;  4IQW A;  1X9M A;  2A19 A;  3K1Z A;  4NXU A;  2DR8 A;  2WAQ C;  2Y9U A;  4I2H A;  3QU4 A;  4QNL A;  5HMM A;  4QW9 A;  9ICB A;  1K5O A;  4RQ7 A;  1MQ2 A;  1BPD A;  5AM1 A;  2F1H A;  4P0P A;  3OSP A;  3RB0 A;  2BQ3 A;  3M9N B;  5ALK A;  9ICN A;  9ICI A;  4F5N A;  3WK9 A;  2RLT A;  4X4T A;  2AQ4 A;  3QX7 A;  2ASD A;  1L3V A;  1PZN A;  2A1J A;  3K4G A;  5L1L A;  5DQI A;  2NO4 A;  4O3P A;  4KMO B;  2HBM A;  1ZQY A;  4YN4 A;  2D6F C;  2EAN A;  2MUT A;  4KIT B;  5DGA A;  2B0C A;  2F8L A;  3HIL A;  4MF2 A;  9ICE A;  2ES6 A;  3BZK A;  4ED3 A;  5KFP A;  4ED7 A;  1S0V A;  2BBH A;  5KFK A;  2JZB A;  1D9D A;  1UPH A;  2D8C A;  2VIX A;  3L5K A;  2DFL A;  2E3T A;  4F2R A;  4J9N A;  2LI6 A;  3GIK A;  3E0F A;  3BS5 A;  1N63 A;  5KT2 A;  3RJF A;  2W55 A;  4XA5 A;  1L8O A;  2V4Q A;  4U6P A;  2KHV A;  1ZQG A;  5HR6 A;  2HCF A;  4UB3 A;  3NS1 A;  3NVZ A;  3WK7 A;  2ZUD A;  2K8B B;  3WKC A;  2RFF A;  2H3F A;  2G06 A;  1L5U A;  4O68 A;  2OEH A;  4RNN A;  4TUP A;  1X9X A;  5HHH A;  5IIK A;  5J0U A;  4Y2U A;  1TV9 A;  3MGH A;  5CHG A;  2FLL A;  5DGB A;  4YQW A;  4RQ2 A;  7ICV A;  5KFS A;  1JAL A;  7ICP A;  9ICO A;  4I29 A;  1X2I A;  5G5G A;  9ICH A;  5J2K A;  5TIS U;  5ALP A;  3QUQ A;  1JN3 A;  1U4B A;  2BCU A;  1HEK A;  5KL1 B;  2NRK A;  5JUM A;  3OTQ A;  4B9U A;  4IS7 A;  5DG9 A;  4X0A A;  4UB1 A;  3G6X A;  1HUZ A;  2O5A A;  5F9L A;  4YR2 A;  2ZIW A;  1NO5 A;  5HC9 A;  3OJU A;  5KFD A;  4QZ8 A;  5H2F U;  4PHE A;  4KN7 A;  1ZQF A;  3SMV A;  5DBC A;  1JXL A;  2ZIX B;  2NRX A;  1YLQ A;  2YML A;  3MAB A;  4IQT A;  3EPG A;  3V7J A;  1XU4 A;  2KG5 A;  4DL4 A;  5CWR A;  1SL0 A;  1RZT A;  3IDW A;  2A1J B;  5GTI U;  3SAH A;  1A6S A;  4F92 B;  4OAI Z;  1J2M A;  5CFU A;  5HNK A;  2W54 A;  1ZRM A;  3NRZ A;  8ICK A;  3RBD A;  1N60 A;  1RQL A;  3BQ7 A;  1MIW A;  3NRW A;  5HRH A;  1VLB A;  4ECQ A;  1NKB A;  1B4F A;  1TFW A;  4OO1 J;  4AT9 B;  2W9B B;  4MFF A;  1ZQV A;  3JPT A;  4HAI A;  5D46 A;  4XUS A;  4DL5 A;  3MR3 A;  3ALR A;  2QLT A;  5KFF A;  2K8A A;  3G6Y A;  3H7I A;  2DBY A;  1N2X A;  1UA1 A;  2ZH7 A;  1MC8 A;  4R65 A;  1TKD A;  4IR1 A;  3WKA A;  5KG2 A;  2AHO B;  5B3P A;  4FHY A;  3KD3 A;  1KRP A;  3VCB A;  3V6J A;  1V4A A;  3NTU A;  3ER9 B;  2Q0Z X;  3N97 B;  1ZQM A;  4E0D A;  3NVO A;  2KJ8 A;  2LBO A;  5KFM A;  1NK6 A;  4MFA A;  4FBU A;  4LEV A;  2GA9 D;  2C2E A;  4OJ6 A;  5DQG A;  2E1E A;  4QZH A;  3LYS A;  5DQH A;  2ASJ A;  4OAF A;  2DR7 A;  2UVR A;  5AI6 A;  3JPP A;  2W9C B;  2HBL A;  5KG7 A;  4JWN A;  1J97 A;  1C7Y A;  1NKC A;  3MR6 A;  4KLS A;  2ZJ8 A;  3QNM A;  2NV3 A;  2AGO A;  3HW8 A;  4J9R A;  3ETR A;  3ZD8 A;  1MIY A;  2OWO A;  4QWE A;  4QIW F;  1IIP A;  2CPR A;  2JEG A;  9ICP A;  1U47 A;  4P2H A;  2PMZ C;  4GXJ A;  2DQN B;  4ICA A;  4UAS A;  4KLD A;  1ZQO A;  1KN5 A;  4O5E A;  3GQC A;  4CRX A;  1SKS A;  1ZQQ A;  9ICW A;  5BOL A;  2YB4 A;  4UAY A;  4FS1 A;  2I9G A;  4OCZ A;  4A8E A;  4Z6C A;  5KNI A;  2RRD A;  5C0Y A;  4NY8 A;  2HHW A;  3RRG A;  1NKE A;  5HR9 A;  4O3R A;  5KFG A;  1QQ6 A;  4PL2 A;  4PGY A;  3PML A;  5ALS A;  5EWF A;  2ID1 A;  4UD4 A;  3NKU A;  2IOF A;  4QZB A;  4YCX A;  3UMB A;  9ICQ A;  4K98 A;  2KHQ A;  3MC1 A;  3OV7 A;  3IN5 A;  4NLK A;  3JCF A;  4O69 A;  3OGU A;  1M6Y A;  3AUO A;  1BNO A;  2AGQ A;  5EWG A;  5HML A;  5IIM A;  1TK0 A;  2HHU A;  4EEB A;  4DLG A;  9ICT A;  4C0Z A;  4OJP A;  4F71 A;  4R64 A;  1BPX A;  4UAT A;  2AH5 A;  4DOB A;  5CJ7 A;  5J0Y A;  1N62 A;  5DG8 A;  1L6N A;  3IRU A;  4ED0 A;  4ED2 A;  2E5S A;  2E8O A;  2C22 A;  1FIQ A;  4YR3 A;  3QZ8 A;  3M9O B;  8ICF A;  1C20 A;  4UBC A;  3SV3 A;  2XCP A;  3RR7 A;  1ZD5 A;  2DKX A;  1SKW A;  1N5X A;  3TI0 A;  4YVZ A;  1WWV A;  2NRV A;  4FHV A;  1UQV A;  3FM9 A;  2EQY A;  2BE3 A;  2J6S A;  2KN7 A;  5J0O A;  4DSJ A;  3GV7 B;  3U26 A;  4EEL A;  2J6T A;  4YMN A;  1X6I A;  2CXY A;  5KFW A;  3AL0 B;  1KEJ A;  2A3V A;  1U9L A;  1KKX A;  3HWT A;  7ICQ A;  1XSN A;  3QUT A;  4NXW A;  5K4L A;  3F2B A;  4KLF A;  4PHP A;  3C21 A;  4I2J A;  4KLI A;  5IIN A;  2FI1 A;  2DUY A;  7ICF A;  2C28 A;  5KG0 A;  2P6R A;  2ZH5 A;  4J9S A;  2KTQ A;  1IM4 A;  2YMM A;  3T5L A;  2H3Q A;  4YMM A;  3MFH A;  5KG1 A;  5L1I A;  2BQR A;  5FP0 A;  1LKY B;  3WKB A;  2JR5 A;  3TFR A;  4F5R A;  4UB6 U;  3NVW A;  3NVY A;  1T4G A;  2JZB B;  4M5D A;  3KHG A;  2QKQ A;  5CFS A;  7ICU A;  1FA0 A;  2KSO B;  4JV2 A;  1IG6 A;  1VDV A;  7ICG A;  1T3N A;  4FZN A;  1SIJ A;  1F5S A;  4YD2 A;  4KN4 A;  2W04 A;  2VJ5 A;  1QCK A;  5J2B A;  3QYP A;  1UCV A;  4BWJ A;  2PBE A;  3ZDB A;  4UAW A;  2EZY A;  3TQ1 A;  3WK4 A;  9ICM A;  2DR5 A;  1ZQR A;  4ED1 A;  3M1Y A;  5D63 A;  1RDF A;  4CDG A;  5ALW A;  3E2E A;  2HHX A;  1IXR A;  1UT5 A;  4EBE A;  4E80 A;  2K4E A;  4DLE A;  2YMP A;  1DGS A;  1KFD A;  5ALR A;  3RJH A;  2KNJ A;  1L7N A;  2JEI A;  1Z00 B;  2VJ4 A;  4P4P A;  2KZZ A;  4O0I A;  2I5H A;  4WQK A;  4FHX A;  3H40 A;  2CRX A;  2F44 A;  3ZDE A;  4BXO B;  4OAG A;  3ZD9 A;  2HVH A;  4BXO A;  4DEZ A;  3EZ5 A;  2G5H B;  1DK2 A;  3AQL A;  3WFS C;  2JHD A;  5IIL A;  4F8R A;  3UQ2 A;  3PW5 A;  4NLB A;  4IG8 A;  4NLN A;  5HRD A;  3MGV A;  2HHP A;  5AM5 A;  4U7C A;  2HMX A;  2RDI A;  3KHL A;  1VJ7 A;  4DFD A;  5DKW A;  1SXE A;  3AM9 A;  3RH6 A;  7ICE A;  5DEC A;  5AKZ A;  2Y0S F;  1RQN A;  3H8W A;  1X9W A;  1BNP A;  3PZP A;  5ALG A;  1ZQE A;  3PMN A;  2GWS A;  3KHH A;  5ALF A;  5ALT A;  3ONN A;  2OXO A;  5ALX A;  3UM9 A;  2ZTC A;  5AIC A;  3WFP A;  4X4S A;  3WK8 A;  1NJZ A;  4RQM A;  2KFZ A;  2V4R A;  1X6J A;  1Q78 A;  3I28 A;  2R8K A;  2FDR A;  3PX6 A;  3N7P D;  3C29 A;  4DCC A;  4E8F A;  2WF5 A;  3H8M A;  9ICU A;  3SAF A;  2LMR A;  3BS5 B;  3PW0 A;  3V6H A;  4UW9 A;  5AM0 A;  4AYB F;  2FLP A;  2B6G A;  4Y2V A;  2R18 A;  3HX0 A;  3JPS A;  4F91 B;  2DRA A;  4ECS A;  3ER8 C;  5J0W A;  2BCR A;  3AQE A;  3LVV A;  4DSL A;  4UB2 A;  4QWD A;  4PZO A;  4ED6 A;  1ZD4 A;  3SEI A;  4LEW A;  3MGI A;  3AMZ A;  3HJ4 A;  3BQ1 A;  4WC5 A;  1Z4N A;  4OD0 A;  3EUB 2;  3ZI4 A;  3H38 A;  3NUQ A;  4J03 A;  3PX0 A;  4EBJ A;  2F3N A;  5AM3 A;  1S0O A;  4JWM A;  4FO6 A;  2W9C A;  4K9B A;  2M0N A;  3UXO A;  2KMD A;  2LPE A;  3PHZ A;  5EE9 A;  2XY7 A;  4EBD A;  1F5A A;  2XVT A;  2K89 A;  1LB2 B;  3KOO A;  4AP9 A;  2P66 A;  3L3F X;  3GV5 B;  4QZE A;  7ICS A;  5ALQ A;  1BGX T;  1IV8 A;  1UET A;  5AKH A;  4AT8 B;  2ZH6 A;  7ICK A;  4Y2X A;  3KTQ A;  1R89 A;  1U49 A;  4R63 A;  3SYZ A;  3F5A A;  1NJW A;  3JYY A;  2WF6 A;  3SEN A;  2WB1 F;  1LVH A;  1YZ7 A;  1QSL A;  2AQ0 A;  3QU2 A;  4XQ8 A;  1SL1 A;  3BQ2 A;  1XO0 A;  2ZXH A;  4KMU A;  1T8E A;  8ICZ A;  2KZ3 A;  5HRI A;  1ZET A;  5KFH A;  2W3S A;  3HT3 A;  3PO4 A;  1OW5 A;  5AK6 A;  4KB6 A;  5DDM A;  2HBK A;  2HSZ A;  4RUA A;  2HHS A;  4F4X A;  2XGQ A;  3C66 A;  3PSP A;  4DO9 A;  3K1R B;  4K9A A;  8ICT A;  2F1J A;  2OHF A;  3CK6 A;  2RP5 A;  4OJO A;  3V72 A;  2B56 A;  1YZ6 A;  1ZXI A;  3KFU F;  1VJ5 A;  4US8 A;  1JRO A;  1TFR A;  3EW9 A;  1N48 A;  5DLF A;  3C23 A;  3RTV A;  5HHI A;  3FYH A;  3T5H A;  1Z00 A;  1BPZ A;  4I2D A;  2JGA A;  3M8R A;  3IG8 A;  4WC3 A;  2ZHA A;  9ICC A;  2HHT A;  4ECW A;  4K4H A;  4LT6 A;  4PZN A;  2NRZ A;  4NWI A;  2XO7 A;  2ISP A;  2YY6 A;  1DGJ A;  2G09 A;  4QZG A;  4C4S A;  3BQT A;  4B9N A;  3DDH A;  5ALN A;  7ICJ A;  5KFQ A;  4Q8F A;  4NXT A;  1GPJ A;  4WC1 A;  1ARO P;  1TK8 A;  3WU2 U;  5ALO A;  2ZH2 A;  1DOQ A;  2BCS A;  2M2V A;  8ICC A;  3L9D A;  4O3M A;  8ICM A;  1YT3 A;  5KAF U;  3N4M B;  1D8B A;  2UVU A;  4PGQ A;  3WKD A;  3HJE A;  4Z6D A;  4UAV A;  3RR8 A;  3FAH A;  2ZIU B;  4RQ0 A;  1S5L U;  4NXV A;  2M9N A;  3TAR A;  2P6U A;  1Q3V A;  2B51 A;  4P0Q B;  1ECW A;  4DL3 A;  3HIY A;  4RQ5 A;  3CW2 C;  8ICJ A;  3D2S A;  3HJ1 A;  1ZQN A;  4KX5 A;  4FHW A;  1UA0 A;  2W11 A;  4HYK A;  1RPL A;  1SZP A;  3AQF A;  1NK4 A;  2M2U A;  2JRZ A;  2ZH9 A;  4DL6 A;  2DPI A;  4GXK A;  4I28 A;  2HN2 A;  1JUD A;  2YQE A;  3OWG A;  4KLG A;  5JTI A;  4RWQ A;  3LWM A;  5KFA A;  1RM6 C;  4RQ4 A;  4F5Q A;  1CUK A;  1ZQA A;  3OPX A;  3SV4 A;  2IHN A;  1ZQI A;  8ICP A;  5KG3 A;  2O6K A;  5L1K A;  5EE0 A;  1JX4 A;  1QH9 A;  2LM1 A;  3H4B A;  2ZHB A;  5DED A;  4KX3 A;  3GFK B;  3MR5 A;  4RPX A;  1WYG A;  3NAS A;  4NV0 A;  1MN8 A;  5J2J A;  4ELV A;  4N7R A;  3KZX A;  4ELT A;  1SV4 A;  4BX9 C;  1ZQX A;  1N56 A;  4NM1 A;  3A0H U;  4DOA A;  3CYM A;  2HVI A;  2H3V A;  4J9L A;  3S6J A;  1Z4O A;  5JRT A;  4Y2R A;  4QW8 A;  4WOY A;  2NRT A;  2HOI A;  1TE2 A;  3TAQ A;  3OJS A;  3RJJ A;  4QWA A;  2W9A A;  8ICQ A;  5HRF A;  4AT8 A;  3B0X A;  2VAN A;  4GLX A;  2FPL A;  5AKL A;  8ICV A;  5AK3 A;  5AHX A;  2IUB A;  2BGW A;  3Q8L A;  4M9H A;  3LQC B;  1PVR A;  2J6U A;  3WKE A;  1ZYQ A;  2XI9 A;  1LKY A;  4B9V A;  4C80 A;  5KT4 A;  4F4Y A;  4GIB A;  3TFS A;  1V38 A;  4QZF A;  4F50 A;  3ERC C;  4KLH A;  5KT3 A;  1SV0 C;  4RNM A;  1NJX A;  5ALI A;  2VA3 A;  2ZUB A;  1KFS A;  1R8A A;  2HBJ A;  1X40 A;  3H4D A;  5ALV A;  2ZTE A;  4I2E A;  2WF7 A;  9ICG A;  3T5K A;  4PGX A;  2WHE A;  2PFN A;  1L3U A;  4WC2 A;  3J81 j;  4ELU A;  5HP4 A;  4E7X A;  2F77 X;  4I0U A;  4C8K A;  2PFP A;  3EWA A;  8ICR A;  8ICH A;  4CCH A;  2JV3 A;  5AM2 A;  1BPE A;  4UQG A;  1L3T A;  5CEH A;  4KTQ A;  1NK7 A;  1NZB A;  5J0P A;  5CRX A;  5AK4 A;  2FPK A;  5CFT A;  1DRG A;  1ZJN A;  2DKZ A;  3R9K A;  4I2G A;  3SQI A;  1RYR A;  4FZL A;  3WK5 A;  4QZD A;  4QWB A;  3RB4 A;  2FE9 A;  4KLQ A;  3WFR E;  4MHV A;  3I76 A;  4US9 A;  3AEV A;  1SZH A;  4MKP A;  2DL0 A;  3TKA A;  1VFG A;  2F2A B;  2YN4 A;  4WBY A;  5J0X A;  1ZD2 P;  5ALE A;  1HUO A;  1SWW A;  4FO1 A;  5J8Y C;  3PST A;  1PK1 B;  4X4R A;  4X4V A;  4EBC A;  9ICV A;  5HRK A;  3C18 A;  2OCE A;  2DR9 A;  3PR5 B;  4DQR A;  3UXN A;  3PNC A;  3BS7 A;  2ASL A;  1S97 A;  5KFN A;  3IG5 A;  2ZIW B;  4O6A A;  2AU0 A;  4GC6 A;  4UAR A;  7ICI A;  4EEY A;  2E8P A;  4WC0 A;  2I6X A;  1WCL A;  3CNH A;  1XS9 D;  2JEJ A;  3PY8 A;  1TAM A;  3ISD A;  5B66 U;  2CN1 A;  2MU2 A;  3BDP A;  3L4P A;  1RXV A;  4O5C A;  4WC4 A;  2F8K A;  4ECV A;  4M9G A;  1COK A;  4MEX A;  3H8J A;  2FJ6 A;  3M8S A;  2Y1I A;  3HP6 A;  4O3Q A;  1S8O A;  4K96 A;  3PX4 A;  3GU3 A;  3IP4 B;  4B9M A;  3ZDC A;  5KT7 A;  1ZD3 A;  4ECX A;  3EPI A;  3N28 A;  9ICK A;  1R8B A;  5DB6 A;  1ZQL A;  4QZ9 A;  2QB0 B;  4TQS A;  4YMO A;  1Z3E B;  4RQ8 A;  2M2W A;  4Y2T A;  3M7D A;  4OJ5 A;  1XWL A;  1L7M A;  2KOB A;  5CP2 A;  4EX7 A;  3FC4 A;  3OUY B;  2IMW P;  2OM6 A;  4EV6 A;  1ZQP A;  4M6W B;  4RT3 A;  2ISO A;  4EX6 A;  2BBJ A;  1WCN A;  3RH5 A;  5G5H A;  5JTG A;  4DQQ A;  3T79 A;  1JI7 A;  5AK5 A;  4ZOH C;  4JV1 A;  2G08 A;  5CHE A;  2DGZ A;  4RPZ A;  5CR0 A;  4JMU A;  4ATB A;  1OUQ A;  1PVQ A;  4DWI A;  1HJP A;  5HR7 A;  5J2H A;  4RQ1 A;  4WH5 A;  3OSN A;  1SV0 A;  4HX0 A;  2IOF K;  2VKQ A;  4ECT A;  1QSY A;  5AKI A;  4RT2 A;  2W9M A;  3Q8K A;  1NZP A;  3WK6 A;  5AIB A;  1LV5 A;  2DWQ A;  2IHM A;  2HW3 A;  4EZ9 A;  2XY6 A;  3ZDA A;  1JAJ A;  9ICJ A;  8ICW A;  4KLE A;  3PV8 A;  5AI0 A;  4LVS A;  1S77 D;  5HRL A;  5EWE A;  3JPN A;  2G0A A;  2IHO A;  4MF8 A;  4BWM A;  2DPJ A;  2HOQ A;  5A0L A;  3OVS A;  4P0Q A;  2PFQ A;  3KZI U;  1SXD A;  1S10 A;  1BPY A;  5DLG A;  2PFO A;  4X0B A;  3TAP A;  4F72 A;  1JQR A;  4B9S A;  1B43 A;  4K4I A;  7ICT A;  4NJ8 A;  8ICO A;  4KLO A;  2MRL A;  5KFI A;  5BOM A;  8ICN A;  5F9N A;  3OVA A;  1FO4 A;  4DQS A;  8ICS A;  4JB3 A;  2Y0S C;  1B0X A;  1RYS A;  1PVP A;  3BZC A;  2G07 A;  3SI8 A;  1KFT A;  4XQ7 A;  2W3R A;  4LJX A;  5TZV A;  2KZM A;  3LDA A;  3OHB A;  3C28 A;  3PO5 A;  3BJY A;  3JPO A;  3AN1 A;  1PX5 A;  4B6J A;  2JMG A;  5ALY A;  4Q44 A;  3RAQ A;  3OHA A;  4R8U A;  2PMZ F;  5D61 A;  4Q43 A;  2QB1 A;  3KBB A;  1V85 A;  3F2C A;  5KFJ A;  4C8O A;  1S9F A;  3UPQ A;  1L3S A;  7ICL A;  1T3Q A;  4FS2 A;  2FLN A;  3H3A A;  7ICH A;  3GZF A;  1D8L A;  2I1Q A;  4EYI B;  2AJQ A;  5J0Q A;  4NLG A;  4DSI A;  4I2F A;  1S0M A;  3KKA A;  3RFA A;  4PL1 A;  4IL6 U;  4F3O A;  3M9M B;  2EZZ A;  2BZF A;  3G6V A;  1OU5 A;  2WF8 A;  4KLL A;  1WWU A;  4I2I A;  8ICU A;  1BPB A;  1KBU A;  3ISC A;  1MIV A;  1NNL A;  2ZH3 A; 
#chains in the Genus database with same CATH homology
 1ZQO A;  1TK8 A;  2XCA A;  4O5E A;  1DOQ A;  2BCS A;  5D49 A;  4DS5 A;  3GQC A;  3PW2 A;  2M2V A;  9ICA A;  8ICC A;  4K4G A;  3L9D A;  2R8G A;  1SKS A;  3MDA A;  1ZQQ A;  4DL7 A;  8ICM A;  5BOL A;  1CEZ A;  9ICW A;  4J9O A;  3H39 A;  3N4M B;  2BKE A;  4EBK A;  4UAY A;  4FS1 A;  2I9G A;  2ZH4 A;  2UVU A;  4Z6C A;  4PGQ A;  3Q8P B;  5CB1 A;  3GDX A;  8ICY A;  3RH4 A;  4RWN A;  4Z6D A;  4NY8 A;  2HHW A;  2BQU A;  3HPO A;  3RRG A;  4Z6E A;  1NKE A;  9ICF A;  5HR9 A;  2LYH A;  3RJG A;  4O3R A;  3RR8 A;  5KFG A;  3QE9 Y;  2BCQ A;  3IHQ B;  3MFI A;  4PGY A;  3JPQ A;  4RQ0 A;  8ICL A;  3PML A;  5EWF A;  3THV A;  4M9N A;  2M9N A;  3TAR A;  2UVW A;  2ID1 A;  4UD4 A;  2P6U A;  4QZB A;  3GV8 B;  5HRB A;  4YCX A;  4DL3 A;  9ICQ A;  3HIY A;  3GIL A;  3FDS A;  4S3N A;  4RQ5 A;  2DVI A;  4M9L A;  4J9K A;  8ICJ A;  3HJ1 A;  3OV7 A;  1ZQN A;  4NLK A;  4NM2 A;  4O3N A;  4IQV A;  4QZA A;  3OGU A;  3AUO A;  3Q8M A;  1BNO A;  4FHW A;  2AGQ A;  5EWG A;  5HML A;  5IIM A;  1TK0 A;  4I27 A;  1UA0 A;  4DLG A;  4M0A A;  2HHU A;  9ICT A;  3PVX A;  4HYK A;  5F2V O;  1RPL A;  1SZP A;  4RZR A;  3SZ2 A;  7ICN A;  5J2E A;  4WCW A;  1NK4 A;  9ICS A;  4KLJ A;  4R64 A;  3GIJ A;  1BPX A;  8ICB A;  2M2U A;  4DOB A;  5CJ7 A;  5J0Y A;  2BPF A;  2ZH9 A;  5DG8 A;  4DL6 A;  2DPI A;  1KNY A;  4GXK A;  4ED0 A;  4I28 A;  4ED2 A;  5KFB A;  1TVA A;  3AQN A;  4PHD A;  4GC7 A;  8ICA A;  4KLG A;  8ICI A;  4BDP A;  5KFO A;  1ZQW A;  4RWQ A;  2C22 A;  4YR3 A;  3QZ8 A;  4UBB A;  2XC9 A;  1ZQZ A;  5KFA A;  4YXM A;  3M9O B;  3LWM A;  4C8L A;  4RQ4 A;  8ICF A;  1QLN A;  4F5Q A;  1CUK A;  2VA8 A;  4UBC A;  3C1Y A;  3SV3 A;  1ZQA A;  4I2A A;  1D8Y A;  5IIO A;  2XCP A;  4DL2 A;  3SV4 A;  3RR7 A;  2KFN A;  2IHN A;  1SKW A;  1ZQI A;  3TI0 A;  5KFY A;  2O1P A;  4YVZ A;  2NRV A;  4FHV A;  2BCV A;  4EZ6 A;  8ICP A;  5KG3 A;  3T3F A;  4R8U B;  5L1K A;  1JX4 A;  4YG2 A;  1JIH A;  5KFL A;  2BE3 A;  3H4B A;  2ZHB A;  2W8K A;  2W8L A;  3UXP A;  1TAQ A;  2KN7 A;  2J6S A;  2BHN A;  2ZTD A;  4LZD A;  5KFC A;  5J0O A;  4DSJ A;  3NGD A;  5DED A;  3GV7 B;  3RRH A;  4RNO A;  4JUZ A;  3GFK B;  3MR5 A;  4RPX A;  1V9P A;  2J6T A;  4YMN A;  4O9M A;  5KG4 A;  2MAX A;  4DFM A;  1ZJM A;  4IRC A;  5KFW A;  5J2J A;  4ELV A;  1UEV A;  1KEJ A;  1TFY A;  3C2M A;  1U9L A;  4ELT A;  1ZQX A;  3LWL A;  1N56 A;  4NM1 A;  3HWT A;  7ICQ A;  4ATB B;  2FMP A;  3TAN A;  4P4M A;  4DOA A;  1XSN A;  9ICR A;  4UD5 A;  9ICX A;  5KFR A;  2HVI A;  5J0T A;  1QTM A;  4J9Q A;  1ZQB A;  4KLF A;  2C2D A;  3LK9 A;  4PHP A;  3C21 A;  4I2J A;  4J9L A;  2FMS A;  4F5P A;  5IIN A;  4KLI A;  4I2B A;  4QW8 A;  3RBE A;  2NRT A;  4DOC A;  4J9M A;  3TAQ A;  3OJS A;  4MFC A;  4PH5 A;  4QWA A;  2W9A A;  5J2A A;  1SL2 A;  2C28 A;  3RJJ A;  4KLM A;  7ICF A;  8ICQ A;  5HRF A;  3B0X A;  2VAN A;  5KG6 A;  4GLX A;  2ZH8 A;  4Q45 A;  5KG0 A;  5KFX A;  2P6R A;  4R66 A;  2ZH5 A;  9ICL A;  1NK5 A;  4J9S A;  2KTQ A;  2FPL A;  4F5O A;  7ICR A;  8ICV A;  1MQ3 A;  4M9J A;  2ZH3 A;  1A76 A;  5C5J A;  4FH5 A;  3GII A;  2H5X A;  4DFK A;  4RWO A;  1IM4 A;  1ZQU A;  1NJY A;  1TAU A;  3ZDD A;  4KLU A;  2HHV A;  3EYZ A;  3T5L A;  2BGW A;  4YMM A;  3MFH A;  5KG1 A;  5L1I A;  3Q8L A;  2BQR A;  1NOM A;  1XO1 A;  4RQ3 A;  4ECR A;  4C8M A;  4DSE A;  4IQU A;  3QZ7 A;  4EYH B;  4M9H A;  3LQC B;  2J6U A;  3ISB A;  3RB3 A;  1ZYQ A;  5DG7 A;  3RJI A;  5J0S A;  5KFE A;  3T5J A;  4B9V A;  3TFR A;  4F4Y A;  5KT4 A;  4F5R A;  3RJK A;  3TFS A;  4ED8 A;  2BPC A;  4QZF A;  3V7K A;  4F50 A;  3PW4 A;  2Y1J A;  4KLH A;  4PPX A;  1T4G A;  5KT3 A;  2ALZ A;  4O5K A;  4Q8E A;  2JEF A;  2MUT B;  1R8C A;  2JZB B;  4YD1 A;  4RNM A;  3MBY A;  1NJX A;  1JMS A;  2ZUB A;  1KFS A;  3KHG A;  2VA3 A;  4KLT A;  4M5D A;  4MEY A;  3BQ0 A;  7ICU A;  3AQK A;  1FA0 A;  3H4D A;  2ZTE A;  4FHP A;  5D4B A;  3AQM A;  4YFK A;  4JV2 A;  4I2E A;  4O3O A;  4B9T A;  4Z6F A;  9ICG A;  7ICG A;  1T3N A;  3QEB Z;  3T5K A;  4PGX A;  2PFN A;  1L3U A;  4WC2 A;  1JXE A;  4YD2 A;  4KN4 A;  4ELU A;  1D9F A;  5HP4 A;  4AT9 A;  4E7X A;  4DFJ A;  4C8K A;  2PFP A;  3EWA A;  5J2B A;  8ICR A;  8ICG A;  8ICH A;  4CCH A;  5EOZ A;  4BWJ A;  1U45 A;  2FPM A;  1KSP A;  2PBE A;  3ZDB A;  4UAW A;  2PI4 A;  3WFO A;  4AT7 A;  4M2Y A;  3TQ1 A;  9ICM A;  1COO A;  5J2F A;  3MR2 A;  5KFZ A;  4ED1 A;  1ZQR A;  3RJE A;  1BPE A;  2DR5 A;  4UQG A;  1L3T A;  1ZQS A;  4AT7 B;  4B9L A;  4KTQ A;  3PR4 A;  1NK7 A;  3E2E A;  2HHX A;  3NYB A;  1IXR A;  5J0P A;  5KG5 A;  1MSW D;  2FPK A;  1UT5 A;  4EBE A;  2IA6 A;  4F4Z A;  4E80 A;  2Q66 A;  5KFU A;  5DBA A;  4DLE A;  1ZJN A;  1SKR A;  2BDP A;  1DGS A;  7ICO A;  3UPS A;  4I2G A;  4FBT A;  2DRB A;  1RYR A;  1KFD A;  5DBB A;  4X4N A;  4QZD A;  4QWB A;  3RJH A;  4DSK A;  4GXI A;  3C2L A;  3RB4 A;  4RU9 A;  4KLQ A;  5L9X A;  1S76 D;  3WFR E;  1KTQ A;  2JEI A;  4WC7 A;  2AGP A;  1Z00 B;  2ATL A;  1EXN A;  5KT5 A;  4P4P A;  1ZQT A;  4FH3 A;  4TUQ A;  4O3S A;  1NK0 A;  2KZZ A;  4O0I A;  1H38 A;  3H40 A;  5KTQ A;  4FHX A;  3ZDE A;  4J9P A;  1TK5 A;  4BXO B;  2KP7 A;  1VFG A;  4KLD A;  4WBY A;  4YR0 A;  3ZD9 A;  5J0X A;  3C5G A;  2HVH A;  4BXO A;  1HUO A;  5HRE A;  2M2T A;  3OVB A;  5III A;  4PHA A;  4DEZ A;  2FMQ A;  1XSL A;  3EZ5 A;  4TUR A;  1DK2 A;  3H37 A;  2RDJ A;  3AQL A;  5IIL A;  2UVV A;  1ZQH A;  3WFS C;  4X4R A;  1Y88 A;  5KFV A;  4F8R A;  3KHR A;  2ZH1 A;  4EP7 A;  5L1J A;  4X4V A;  8ICX A;  4EBC A;  9ICV A;  4IQW A;  5HRK A;  3C18 A;  3UQ2 A;  3PW5 A;  2DR9 A;  1X9M A;  1ZQC A;  4IG8 A;  3PR5 B;  4DQR A;  4NLN A;  3UXN A;  2DR8 A;  5HRD A;  3AU6 A;  2HHP A;  3PNC A;  4I2H A;  2ASL A;  5HMM A;  4QW9 A;  1S97 A;  4F93 B;  5KFN A;  9ICB A;  1ZQK A;  2RDI A;  4RQ7 A;  5KFT A;  3KHL A;  1MQ2 A;  1BPD A;  1VJ7 A;  5DKW A;  2F1H A;  3OSP A;  3RB0 A;  3RH6 A;  2AU0 A;  7ICE A;  5DEC A;  2BQ3 A;  4GC6 A;  3M9N B;  4NKT A;  9ICN A;  5J2I A;  4DSF A;  3IM1 A;  4YXJ A;  4F5N A;  3H8W A;  3GIM A;  1X9S A;  1X9W A;  7ICI A;  9ICI A;  4EEY A;  1BNP A;  1BVS A;  2AQ4 A;  1ZQE A;  4WC0 A;  3PMN A;  2GWS A;  1WCL A;  1XS9 D;  3KHH A;  2JEJ A;  3PY8 A;  2ASD A;  1L3V A;  4ECZ A;  1PZN A;  2A1J A;  3K4G A;  5DB8 A;  4WC6 A;  3ISD A;  3RAX A;  5L1L A;  5DQI A;  4RWP A;  4O3P A;  5CA7 A;  2V9W A;  3BDP A;  1RXV A;  1ZQY A;  4O5C A;  2ZTC A;  4YN4 A;  4DQP A;  2MUT A;  3WFP A;  4X4S A;  4KIT B;  1NJZ A;  4WC4 A;  5DGA A;  2KFZ A;  4XRH A;  2V4R A;  1Q78 A;  4ECV A;  4M9G A;  4MF2 A;  4UB5 A;  3JPR A;  9ICE A;  1XC9 A;  4MEX A;  1WOT A;  5KT6 A;  3H8J A;  3M8S A;  4ED3 A;  2Y1I A;  5KFP A;  4QZI A;  4ED7 A;  1S0V A;  3HP6 A;  5KFK A;  2R8K A;  4O3Q A;  2JZB A;  1NK8 A;  1D9D A;  1Q79 A;  3PX6 A;  4RUC A;  2DFL A;  4F2R A;  4J9N A;  4X4P A;  5J2D A;  3PX4 A;  3GIK A;  4G3I A;  4E8F A;  4X4U A;  4B9M A;  3ZDC A;  3V7L A;  5KT7 A;  5KT2 A;  2PI5 A;  4ECX A;  3RJF A;  9ICU A;  3V6H A;  3PW0 A;  4XA5 A;  4QZC A;  3EPI A;  4C8N A;  2FLP A;  9ICK A;  5J29 A;  1R8B A;  5DB6 A;  4UAZ A;  3C5F A;  4QZ9 A;  2V4Q A;  1ZQL A;  4TQS A;  4YMO A;  4DQI A;  1ZQG A;  1UEU A;  3HX0 A;  3Q8S B;  3JPS A;  4F91 B;  1Z3E B;  4RQ8 A;  4UB3 A;  2M2W A;  4NXZ A;  2ZH2 A;  3ETL A;  4F2S A;  2DRA A;  3B0Y A;  4X5V A;  4ECS A;  5J0W A;  2BCR A;  4DSL A;  2ZUD A;  4M47 A;  4UB2 A;  4QWD A;  1XWL A;  4ZH4 A;  2RFF A;  5CP2 A;  4ED6 A;  1L5U A;  3MGI A;  3OUY B;  2IMW P;  1B22 A;  4RNN A;  3BQ1 A;  2IBK A;  3HJ4 A;  4WC5 A;  4TUP A;  5J2G A;  3JZ0 A;  3OUY A;  3QEA Z;  3H8S A;  5HHH A;  5IIK A;  5J0U A;  2C2R A;  1ZQP A;  3H38 A;  4M6W B;  4RT3 A;  3PX0 A;  1TV9 A;  2ISO A;  3MGH A;  1WCN A;  3RH5 A;  4IRD A;  4EBJ A;  5CHG A;  3RB6 A;  2FLL A;  1S0O A;  4JWM A;  4M6W A;  5DGB A;  4YQW A;  4RQ2 A;  7ICV A;  5KFS A;  4FO6 A;  7ICP A;  1U48 A;  4DQQ A;  9ICO A;  4YP3 A;  2W9C A;  4I29 A;  3UXO A;  2XY5 A;  1X2I A;  2R8J A;  9ICH A;  5J2K A;  4LZG A;  5DB7 A;  4JV1 A;  4JK1 A;  2XY7 A;  4BGD A;  1JN3 A;  1U4B A;  4RPZ A;  4EBD A;  2BCU A;  1F5A A;  5CR0 A;  1LB2 B;  4ATB A;  2P66 A;  2NRK A;  5BPC A;  3GV5 B;  5JUM A;  1HJP A;  4DWI A;  4B9U A;  4QZE A;  5J2H A;  2XGP A;  4RQ1 A;  3Q8Q B;  5DG9 A;  4X0A A;  1A77 A;  4UB1 A;  2ZUC A;  3OSN A;  3G6X A;  5J0R A;  1HUZ A;  7ICS A;  4JV0 A;  3MDC A;  1BGX T;  2O5A A;  5F9L A;  4YR2 A;  1UET A;  4TUS A;  1NO5 A;  4ECT A;  5HC9 A;  4AT8 B;  1QSY A;  2ZH6 A;  4RT2 A;  2W9M A;  3OJU A;  3Q8K A;  7ICK A;  1NZP A;  4TQR A;  1XSP A;  3KTQ A;  1R89 A;  4X4T A;  5KFD A;  1U49 A;  2F1I A;  3C1Z A;  4QZ8 A;  4R63 A;  1LV5 A;  4PHE A;  4KN7 A;  3SYZ A;  1ZQF A;  2IHM A;  5DBC A;  1JXL A;  2HW3 A;  4EZ9 A;  2NRX A;  2WTF A;  2XY6 A;  1NJW A;  3ZDA A;  1YLQ A;  3JYY A;  3MAB A;  4IQT A;  1T7P A;  1ZQJ A;  1UT8 A;  3EPG A;  1JAJ A;  3V7J A;  1XU4 A;  8ICW A;  1QSL A;  9ICJ A;  4KLE A;  4DL4 A;  2AQ0 A;  5CWR A;  4XQ8 A;  4P4O A;  1SL1 A;  1RZT A;  1SL0 A;  3PV8 A;  3BQ2 A;  1ZQD A;  4WBZ A;  4DF4 A;  4LVS A;  4ECU A;  4KMU A;  1S77 D;  2A1J B;  1T8E A;  8ICZ A;  5EWE A;  4F92 B;  5DDY A;  3JPN A;  1DK3 A;  2KZ3 A;  5HRL A;  5HNK A;  8ICK A;  5HRI A;  5HRG A;  4M04 A;  1ZET A;  5KFH A;  3RBD A;  3HT3 A;  4DFP A;  1S0N A;  4MF8 A;  4BWM A;  2DPJ A;  3PO4 A;  1MIW A;  5HRH A;  3OVS A;  2PFQ A;  4ECQ A;  1S10 A;  5DDM A;  1BPY A;  5DLG A;  1NKB A;  3UQ0 A;  1TFW A;  3PW7 A;  2PFO A;  4X0B A;  7ICM A;  3TAP A;  4F4K A;  2W9B A;  1JQR A;  4B9S A;  1B43 A;  4ECY A;  4AT9 B;  1QSS A;  4K4I A;  7ICT A;  2BPG A;  2W9B B;  8ICO A;  4RUA A;  4MFF A;  1K1S A;  1ZQV A;  3JPT A;  4F4X A;  4KLO A;  5KFI A;  2NRW A;  5BOM A;  5F9N A;  2XGQ A;  2VA2 A;  5D46 A;  4DO9 A;  8ICN A;  3C66 A;  3OVA A;  3K75 D;  4DQS A;  4DS4 A;  4XUS A;  4DL5 A;  8ICS A;  3MR3 A;  3C2K A;  4DF8 A;  8ICT A;  2F1J A;  1RYS A;  5KFF A;  2R8I A;  3G6Y A;  3H7I A;  3SI8 A;  4X4O A;  1KFT A;  4XQ7 A;  4AT8 A;  3V72 A;  1UA1 A;  2ZH7 A;  1MC8 A;  5TZV A;  5DB9 A;  4R65 A;  2R8H A;  1TKD A;  2KZM A;  3LDA A;  3OHB A;  4IR1 A;  4RPY A;  8ICE A;  3PO5 A;  1TFR A;  5KG2 A;  3AU2 A;  3BJY A;  3JPO A;  3EW9 A;  1PX5 A;  1N48 A;  5DLF A;  3C23 A;  2PXI A;  3V6K A;  4FHY A;  2HHQ A;  4Q44 A;  3RAQ A;  1KRP A;  3ORY A;  3OHA A;  3RTV A;  5HHI A;  1V4A A;  3V6J A;  3FYH A;  4R8U A;  3T5H A;  1Z00 A;  4IR9 A;  1BPZ A;  4I2D A;  3NTU A;  2Q0Z X;  3M8R A;  4WC3 A;  3N97 B;  1ZQM A;  4Q43 A;  4E0D A;  2ZHA A;  5KFJ A;  1KLN A;  5KFM A;  1NK6 A;  4C8O A;  9ICC A;  1S9F A;  4MFA A;  4UB4 A;  3UPQ A;  1L3S A;  1KDH A;  7ICL A;  4FBU A;  4FS2 A;  2C2E A;  4ECW A;  2FLN A;  4K4H A;  5DQG A;  4QZH A;  2ASJ A;  2HHT A;  4LT6 A;  5DQH A;  3H3A A;  2DR7 A;  2UVR A;  7ICH A;  4NLZ A;  2NRZ A;  1K1Q A;  1D8L A;  2I1Q A;  3JPP A;  4EYI B;  2AJQ A;  4IRK A;  2W9C B;  2ZJ5 A;  5J0Q A;  2XO7 A;  2BR0 A;  5KG7 A;  4JWN A;  2ISP A;  1C7Y A;  4NLG A;  1NKC A;  4DSI A;  3MR6 A;  4I2F A;  1S0M A;  4KLS A;  2ZJ8 A;  4RQ6 A;  2B21 A;  4QWC A;  4QZG A;  3M9M B;  3HW8 A;  3Q8R B;  4F4W A;  2AGO A;  1RXW A;  4F3O A;  5IIJ A;  3BQT A;  3G6V A;  4J9R A;  1OU5 A;  3ZD8 A;  4B9N A;  1MIY A;  2OWO A;  4QWE A;  3WFQ E;  4KLL A;  7ICJ A;  1NK9 A;  2ZJA A;  4NKU A;  4I2I A;  5KFQ A;  8ICU A;  4I2C A;  2JEG A;  1BPB A;  9ICP A;  1U47 A;  4P2H A;  1R8A A;  4Q8F A;  4GXJ A;  3ISC A;  4X4Q A;  1MIV A;  5J2C A;  4WC1 A;  2HHS A;  1ARO P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...