5DB7A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dt
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 100
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db7A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db7A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db7A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db7A03
4EZ9A 1U4BA 4DSIA 4NKUA 5J2GA 1T8EA 2I9GA 4DL5A 1NJXA 1NK9A 2ZH3A 4XQ8A 4RWQA 4ECRA 3ZDEA 4Q44A 4ED7A 1HUZA 3SYZA 4FH3A 3M8SA 2M9NA 3C1YA 3SI8A 2BPCA 1R89A 3N97B 4DOAA 1NKBA 2NRXA 4AT9B 3EWAA 5EWFA 2HVIA 5CP2A 1B43A 4ED1A 3RB4A 3C2MA 1QSSA 4Z6EA 4KLGA 1ZQQA 1ZQOA 8ICJA 4RNOA 1L5UA 3T5JA 5HRKA 4NLZA 1V4AA 2DR9A 3H8JA 1CEZA 2Y1JA 3OVSA 3C1ZA 7ICJA 2BQ3A 3H39A 1ZQLA 3GIJA 3WFRE 2ZTCA 1KTQA 4F93B 1S10A 5J0PA 1UA1A 4UB2A 4IRDA 8ICVA 4DSJA 4DFMA 1KDHA 2ZJ5A 4B9MA 9ICEA 1RPLA 1BPYA 4WC1A 2UVVA 4ATBA 2A1JA 2DVIA 4QZBA 4PPXA 1XWLA 4QZHA 4O3PA 4M47A 4MFFA 1TKDA 4I2GA 7ICQA 4PGQA 4RPYA 5J2EA 1C7YA 1IM4A 3Q8MA 1QSYA 5CR0A 2IHNA 4NY8A 4Q8FA 3UXNA 1XS9D 4IR1A 4DQIA 2HVHA 3JPSA 2W9CA 1ZQGA 2FLLA 9ICTA 4RQ0A 4F91B 5DEDA 4I2IA 1VFGA 3T5KA 4G3IA 4UB4A 2ZHAA 4RQ5A 5KFRA 3GV5B 1TFYA 5KFEA 8ICWA 1HJPA 3ISBA 9ICKA 8ICTA 4MF8A 1ZETA 1TK8A 2M2UA 4UB5A 4DL2A 3E2EA 1JIHA 2ZH9A 2HHQA 9ICLA 2A1JB 7ICTA 2ZTEA 2JZBA 3T5HA 2IA6A 4F5PA 2FMPA 5KG3A 4K4GA 2H5XA 5IILA 3HWTA 1NJYA 1U49A 3UXPA 1ZQNA 4NLKA 7ICKA 3C21A 1BNOA 1MC8A 4RZRA 4RT3A 3MR3A 4I2FA 3H37A 1YLQA 3M8RA 1KLNA 3PMLA 1S0MA 3MFIA 3MR5A 1D9DA 1KFSA 1ZQHA 2FMQA 3H38A 1KFTA 5KFLA 4ECQA 1JMSA 5D4BA 4IRKA 5BOLA 8ICCA 4KN4A 3TFRA 2RDIA 3UPSA 2PFQA 5D46A 2F1JA 4ED3A 1T3NA 8ICYA 4X4NA 3THVA 4R66A 4DQQA 5DQHA 1ZQAA 1NZPA 1JX4A 4RQ3A 9ICCA 1ZQEA 4TUPA 2JZBB 1NK4A 1B22A 5L1LA 4DO9A 1KNYA 3RAXA 4C8MA 2MUTA 5KFGA 4I2EA 5BPCA 3HP6A 4CCHA 3G6YA 3T3FA 5HHHA 4PHDA 2W9BA 8ICEA 3WFOA 3TAPA 5KTQA 5KFFA 3IM1A 3N4MB 4DS4A 4QZGA 2BQRA 1DOQA 3ORYA 8ICQA 4DLEA 1R8AA 3OVBA 3BDPA 9ICAA 4AT8A 4TURA 4DL4A 5KT4A 5KT3A 4I2BA 3BQ0A 1NK5A 5J0RA 1T4GA 3V7KA 3JPRA 3C5FA 4RPZA 1BGXT 2KN7A 4EEYA 5EOZA 4PGYA 5CJ7A 3KHHA 4B9UA 4M5DA 4O9MA 4Q8EA 3H4BA 4J9OA 2BQUA 4RNNA 3GIIA 2AQ0A 3JPPA 3RB3A 4KN7A 1N48A 3ZDBA 1PZNA 4R63A 5DB6A 5DB9A 4M9NA 2C2EA 3PO5A 4GC7A 4C8LA 3BQTA 4M6WB 7ICSA 1FA0A 4IQWA 2M2WA 4K4HA 2M2VA 3RJIA 1JN3A 2HHXA 1SL0A 4KLSA 3PW7A 4IRCA 5IIOA 4X4VA 1ZQCA 4E0DA 4YXMA 4EYIB 4DF8A 2PFOA 4ED8A 4O3QA 1U47A 1D9FA 3ZDAA 4IQUA 5CWRA 4GXIA 4Q43A 1TVAA 1U45A 4J9PA 2V4QA 4DSEA 1SKWA 1KEJA 2W9CB 2DPJA 4FBTA 7ICOA 3QEBZ 5J2IA 9ICOA 4AT8B 3OUYA 3PY8A 2BR0A 2JEJA 4O5EA 9ICNA 4QZCA 4JV0A 2AJQA 3Q8QB 3Q8LA 2ZUCA 3PW0A 1HUOA 3V7LA 2Q66A 5J0WA 4F5QA 4YFKA 4B9NA 3PNCA 1R8CA 4EYHB 5CB1A 1BPZA 3SV3A 4XUSA 1COOA 1ZQIA 3BQ1A 1X9WA 4UBCA 5IIMA 1ZQWA 4B9TA 4ELVA 2ASDA 1RYSA 1ZYQA 1S97A 1NK6A 3NYBA 4O5CA 5DGAA 2MAXA 1JAJA 4BWMA 5DKWA 5L1JA 4TUSA 4YN4A 4WC5A 3RRHA 3C23A 4NLNA 2JEGA 3GFKB 2BPFA 4YXJA 4UAWA 8ICSA 3JYYA 2XGPA 3ZDDA 4GLXA 3RH4A 4I2AA 2KZMA 2W9BB 5HRDA 2HW3A 2BPGA 4BXOB 8ICPA 1EXNA 3RH5A 5KFUA 1S9FA 5KFAA 2BDPA 5KFJA 5CHGA 3PX6A 3K75D 2XCAA 9ICSA 4WC6A 2AGPA 1R8BA 4UD4A 4ATBB 4YMOA 3PR5B 5BOMA 5KFZA 4YR3A 1UT5A 1RZTA 4DQPA 9ICFA 2ZH2A 1A77A 5DDYA 9ICUA 7ICRA 3GIMA 4PGXA 2O1PA 4E8FA 4F50A 4RQ7A 4F8RA 5HRIA 4KLQA 4GXJA 3RAQA 4KLOA 4F92B 5DQIA 3PX4A 5C5JA 7ICVA 1WCNA 3TFSA 4X0AA 4UQGA 2ZH5A 4AT7A 5KG2A 2R8KA 9ICIA 3QEAZ 4I2JA 3HW8A 2UVRA 3G6VA 3KHRA 3MGIA 1RXWA 4X4OA 1Z3EB 4DSKA 5J2KA 1ZQTA 2UVUA 4NM2A 4LZDA 3G6XA 4B9LA 4ECWA 2HHSA 1AROP 2V9WA 2ISPA 4C8OA 1UEUA 1D8LA 2C28A 5DBCA 9ICRA 1Q78A 2IMWP 4HYKA 3HX0A 4DSLA 3RBEA 4GXKA 4F5NA 2AGQA 5KT6A 1S76D 4XA5A 3MABA 3Q8KA 2XCPA 2BCVA 2GWSA 5KG4A 5J0OA 4P4PA 3JPTA 1DGSA 3T5LA 3PW4A 1NO5A 5IIIA 5J0SA 4KLUA 3MDAA 1S0OA 2ZHBA 4WC7A 2DR5A 2O5AA 4KLMA 4RT2A 3AU2A 1NKCA 3SZ2A 4O5KA 5HRGA 4QZEA 3QZ7A 1WCLA 4F5OA 2ISOA 2VA2A 1MIWA 4UB1A 5L9XA 1ZJMA 4KITB 4FHXA 3TI0A 2XY6A 3RH6A 4RQ4A 4RWOA 2MUTB 2R8HA 1NJWA 1TAUA 4IR9A 3MBYA 2J6UA 4JV1A 3OSNA 4F2RA 4LZGA 4M9LA 4MFCA 7ICEA 2AQ4A 1K1QA 4FHWA 5F2VO 4TQRA 4KLHA 1MSWD 4FHYA 1SKRA 5HRFA 8ICHA 4YCXA 2NRWA 1A76A 1ZQSA 2R8IA 3RRGA 3HJ4A 1ZQPA 4M2YA 4DOBA 1NOMA 8ICXA 1DK2A 2ZH8A 2ZH4A 1ZQMA 4JWNA 5HREA 1ZQFA 4KMUA 5F9NA 3EW9A 4O3NA 5F9LA 2W8KA 4DLGA 3JPNA 3MFHA 3M9OB 1T7PA 1XU4A 5J2HA 5KFVA 4EBEA 5KFSA 5KG1A 4DS5A 1MQ3A 2XC9A 9ICJA 3PX0A 1IXRA 4RQ1A 1NJZA 1F5AA 3OHAA 4LT6A 4TUQA 1XSPA 1SL1A 4XQ7A 4M0AA 4WC4A 5KFHA 4S3NA 1S0VA 4QWCA 5J2DA 4KLJA 4QZIA 4R64A 4I2CA 4I2DA 2KP7A 3EPIA 1WOTA 5TZVA 3OJUA 4JV2A 8ICUA 2NRTA 4YG2A 4DL3A 4PHAA 1Z00B 5KFXA 5KFMA 1LV5A 7ICGA 5KT7A 4BWJA 5J0UA 3LWMA 4F2SA 2BE3A 4X4RA 4KLDA 4QW9A 4MEYA 5J2AA 4YR0A 1TK5A 3V6KA 4M6WA 9ICVA 1LB2B 1BNPA 4X0BA 4F4WA 1UEVA 1NK7A 1S77D 4C8NA 5J2FA 2W9MA 3JPOA 4DQSA 4AT7B 3Q8PB 3V6HA 2ZUBA 2BCRA 1XC9A 1D8YA 2FLNA 1S0NA 4F4KA 2M2TA 5HR9A 2FPLA 1V9PA 2Q0ZX 5DG7A 3RJKA 1QLNA 2KZZA 3NGDA 5J0TA 2B21A 4RQ2A 2BCSA 5EWEA 1UT8A 4RUCA 5KG7A 5HHIA 2ZUDA 1Y88A 4RUAA 4ELTA 3JPQA 3TANA 8ICFA 3AQLA 3ETLA 5KFDA 4QZDA 5J2JA 3MGHA 2NRKA 1CUKA 1BPDA 2RDJA 4IQTA 5DDMA 1NKEA 2R8JA 3UQ0A 3K4GA 2BCQA 4MFAA 4X5VA 4DQRA 3QZ8A 4RQ6A 3MR6A 4DFJA 4RQ8A 4DL7A 3RJJA 2JEIA 4LVSA 3PVXA 1TFRA 3OGUA 4FHVA 4DEZA 2HHTA 7ICIA 4X4QA 2ZTDA 5KFWA 4KLLA 3AQKA 8ICRA 3RB0A 1ZQVA 5DBBA 3BJYA 4EZ6A 5CA7A 4J9NA 1JQRA 3LDAA 4Z6FA 2NRZA 4E7XA 5KFCA 4UAZA 2LYHA 3H7IA 3GDXA 5J29A 1MQ2A 2BKEA 3V72A 4ECZA 2JEFA 1MIYA 1KFDA 4DWIA 5KFIA 3RR8A 3RBDA 4MEXA 4O0IA 4I27A 4DSFA 4XRHA 5KT2A 9ICWA 4FS1A 9ICXA 4QWBA 5J2CA 3OHBA 1ZQYA 4M9HA 5HMMA 4J9LA 4GC6A 5DBAA 4WC3A 8ICBA 4FS2A 2W8LA 4F4ZA 4I29A 4KLIA 2F1IA 3PO4A 7ICFA 5KFNA 3C2LA 4J9SA 2BGWA 3OVAA 2V4RA 1ZQKA 3PR4A 2RFFA 4Q45A 5KFTA 3AUOA 8ICOA 4RU9A 1PX5A 3ZD9A 1XSNA 2C22A 5DB7A 5IIKA 4Z6CA 1SL2A 4ECXA 4ECYA 1ZQXA 1JXLA 1SZPA 1ZQJA 3V6JA 2FMSA 2FPMA 2PI4A 4KLTA 8ICLA 5DG9A 5HP4A 7ICPA 5KT5A 4X4TA 4ECSA 4O3OA 3KHLA 3ISCA 2UVWA 4WC0A 1Z00A 5IINA 1X9MA 4ED2A 5DG8A 4EBDA 9ICPA 9ICBA 5DLGA 3C66A 4WBYA 3WFPA 4ECTA 2BCUA 4Z6DA 8ICZA 2HHWA 4QZFA 2AGOA 1MIVA 2DFLA 3H8WA 4DFKA 3QE9Y 3RJGA 2ZJ8A 4ELUA 4WBZA 7ICHA 4FBUA 4F3OA 1DK3A 4RWPA 3UPQA 4P2HA 4PHPA 4YP3A 4TQSA 3H4DA 1JXEA 4C8KA 1BPBA 4QWEA 4DL6A 5HRLA 3B0XA 2ASLA 4M9JA 3OSPA 3OV7A 4ECUA 8ICAA 4ED0A 5KFQA 2HHVA 3TAQA 4B9VA 1KSPA 8ICNA 5HRHA 2ALZA 9ICHA 4QZ8A 5J0XA 4YD2A 1K1SA 2P6RA 4JWMA 3HPOA 3PMNA 4J9QA 4KTQA 3ZDCA 1OU5A 3PV8A 3IHQB 4IQVA 3KHGA 3RJFA 4QZ9A 4NKTA 3ZD8A 4NXZA 2VA3A 2KFZA 3EZ5A 1SKSA 1QSLA 2C2DA 3UQ2A 1ZJNA 1X9SA 5HMLA 3MR2A 3TQ1A 4EBJA 7ICUA 4PH5A 4MF2A 3H8SA 2W9AA 3M9MB 3RJHA 5KG0A 2PBEA 4WC2A 4PHEA 1U48A 3HT3A 3BQ2A 8ICIA 4QWAA 4YMNA 2DPIA 3LK9A 3ISDA 5KG5A 1XSLA 2PFNA 4UAYA 4I2HA 2DR8A 4EP7A 2Y1IA 3AQMA 4E80A 2FLPA 1ZQZA 4FHPA 4QW8A 2BHNA 5KFKA 4YR2A 4DOCA 3OJSA 3RTVA 4O3SA 4M04A 5HRBA 2FPKA 3GV7B 2KZ3A 3OUYB 4QWDA 4YQWA 4R65A 1TV9A 9ICGA 1U9LA 1N56A 4RNMA 4RPXA 2VANA 7ICLA 5DQGA 4BDPA 2ZJAA 5HNKA 2XY7A 4JK1A 5IIJA 2ASJA 2ZH6A 4UB3A 4F4XA 2F1HA 4X4PA 4RWNA 3GIKA 3PW2A 3M9NB 2ID1A 3FDSA 5HC9A 9ICQA 3C18A 5DB8A 3EPGA 1H38A 1UA0A 4JUZA 4UD5A 2DRBA 4R8UB 5J2BA 2HHUA 3H3AA 2IHMA 4K4IA 3AQNA 3HJ1A 3WFQE 4IG8A 5J0YA 4FO6A 4KLFA 2HHPA 4YMMA 4NLGA 4F4YA 1ZQRA 1UETA 1ZQDA 4WCWA 1BPXA 9ICMA 5JUMA 3C2KA 3HIYA 8ICMA 2PFPA 4FH5A 5KFOA 3L9DA 4M9GA 4YVZA 3GILA 2PXIA 3RR7A 8ICGA 1BPEA 4O3RA 1L3UA 2C2RA 3JZ0A 3LQCB 3B0YA 1L3VA 3RB6A 4X4UA 1L3SA 2WTFA 1TAQA 4P4OA 2J6SA 4EBKA 4X4SA 2DR7A 4J9MA 5J0QA 3EYZA 3AU6A 4DFPA 2ATLA 4BXOA 5KG6A 3NTUA 3PW5A 3LWLA 4NM1A 1TK0A 4J9RA 3MDCA 2PI5A 4F5RA 2XY5A 3C5GA 3GV8B 5L1IA 4ED6A 4ZH4A 5D49A 1QTMA 4B9SA 7ICNA 8ICKA 2DRAA 4R8UA 4ECVA 5KFBA 2P66A 3KTQA 4P4MA 5DLFA 5DECA 4BGDA 2NRVA 2OWOA 1NK8A 1VJ7A 5KFYA 1KRPA 1NK0A 3UXOA 4DF4A 1ZQBA 4QZAA 2ZH1A 3FYHA 3GQCA 1BVSA 4KLEA 5KFPA 2AU0A 5L1KA 4J9KA 2IBKA 2R8GA 1Q79A 4AT9A 3RJEA 1ZQUA 2I1QA 3Q8RB 3TARA 5DGBA 5EWGA 4EBCA 1L3TA 4I28A 4YD1A 3SV4A 1RXVA 3V7JA 1XO1A 2XGQA 2KTQA 2VA8A 2ZH7A 3WFSC 4UBBA 1X2IA 1RYRA 2P6UA 7ICMA 1TFWA 2KFNA 3H40A 3Q8SB 2J6TA 2XO7A
chains in the Genus database with same CATH superfamily
5G5HA 5KL1B 2WF5A 4RWQA 4Q44A 1HUZA 1Q8KA 1KKXA 5EWFA 4LEWA 5CP2A 1B43A 4Y2TA 8ICJA 3NKUA 2BQ3A 5KAFU 1OUQA 3GIJA 2ZTCA 3IG5A 1S10A 2R18A 5J0PA 1UA1A 8ICVA 1KDHA 4B9MA 1BPYA 2DF4B 1XWLA 2VKQA 4QZHA 4MFFA 4PGQA 4IR1A 4DQIA 4NLCA 5EE9A 2W9CA 1ZQGA 3NWIA 4F91B 4G3IA 4UB4A 2QARB 4RQ5A 2W3SA 5AICA 2IA6A 5KG3A 4K4GA 2H5XA 3HWTA 1QQ5A 4NLKA 3CP8A 3C21A 5JTIA 1MC8A 4I2FA 4EELA 3SMVA 3MFIA 5JRTA 3H38A 1KFTA 4NL9A 5KFLA 4IRKA 4CNQA 3DEEA 4KN4A 3D2NA 2M0NA 1WG8A 3IRUA 1N5WA 3WKDA 1ZQAA 4RQ3A 3A0HU 1B22A 1TAMA 1ZRMA 5L1LA 4HAIA 2MRLA 2MUTA 5KFGA 3CNHA 4CCHA 4PL1A 3TAPA 5KFFA 3N4MB 4DS4A 2BQRA 4GIBA 2ZIXA 2K8CB 5KT4A 5GTHU 2CRXA 4I2BA 3V7KA 3C5FA 1BGXT 3VCBA 2KN7A 5AKGA 3KHHA 3I28A 3H4BA 2BQUA 3ZDBA 4U7CA 2AQ0A 3RB3A 4NXXA 4M9NA 1JRPA 7ICSA 4K96A 1FA0A 2M2WA 4CDGA 4Y2XA 3HILA 2I6XA 1SL0A 3PW7A 3NUQA 4AP9A 3U26A 4DF8A 4ED8A 2L5YA 4NXWA 5CWRA 4Q43A 4DSEA 2W9CB 3TACB 5CEHA 2BR0A 2JEJA 4QZCA 2AJQA 1RYUA 3Q8LA 3V7LA 2W03A 4NL9C 3PNCA 4B9NA 4EYHB 4UBCA 1NI3A 4B9TA 4ELVA 1RYSA 1S97A 2E8PA 4O5CA 2MAXA 1JAJA 2K60A 2Y0SC 4TUSA 4YN4A 4NLNA 2JEGA 4Y2YA 2HBMA 2BPFA 2LM4A 2XGPA 3BS5A 4GLXA 5FP0A 2W9BB 2OHFA 3QX7A 3F2DA 1EXNA 4WC6A 1WWUA 3AQFA 4UD4A 5KFZA 4YR3A 1RZTA 3CRXA 9ICFA 4C7ZA 4F8RA 4GXJA 4X0AA 3TFSA 4UQGA 5KG2A 4J03A 2KNJA 9ICIA 1PUZA 3G6VA 2IOFK 2QKQA 4K9BA 1Z3EB 4CF4A 2YQEA 1FFVA 3OPXA 4B9LA 5AI0A 4ACOA 4ECWA 1UPHA 2C28A 5DBCA 4EEDA 2IMWP 4F5NA 2OH2A 3Q8KA 2XCPA 3SAFA 5KG4A 5J0SA 4KLUA 3ER8C 2O5AA 4KLMA 1UQVA 1N63A 4F5OA 4UB1A 5L9XA 4FE3A 2XY6A 2IOHA 2MUTB 5AIBA 4IR9A 7ICEA 2RRDA 3OSNA 4LZGA 4JLZA 5T14A 2VJ4A 1MSWD 2OM6A 2WB1F 2NRWA 4K9AA 1ZQPA 2Q4TA 3GZFA 4OJ5A 5KFSA 5KG1A 2XC9A 2B4VA 3SENA 4RQ1A 2QARA 4LT6A 1ZD2P 4TUQA 1XSPA 4XQ7A 4WC4A 4I2DA 2KP7A 1SIJA 3OJUA 1KQQA 5KFMA 5J0UA 1LB2B 1UEVA 3D2SA 5J2FA 1SXDA 3V6HA 2BCRA 1XC9A 1D8YA 4WQKA 3NVOA 2Q0ZX 1A6SA 2H3ZA 3SAGA 2B21A 1RQNA 4RUCA 2ZUDA 4ELTA 5AM1A 3TANA 4UAUA 8ICFA 5AM0A 3AQLA 3L4PA 3MGHA 3UQ0A 2LPEA 3K4GA 4DQRA 4RQ6A 3MR6A 1ECWA 4DL7A 1HIWA 2JEIA 4BJQA 3KKAA 1QCKA 1TFRA 4FHVA 4DEZA 4F71A 1LKYA 4UW9A 5ALRA 2ZIXB 1TE2A 3AM9A 5KFCA 3H7IA 3BQ7A 3KBBA 3KD3A 4EEBA 1X9XA 2E5SA 1MIYA 4N7RA 4DSFA 1V97A 4FS1A 4QWBA 2W8LA 4F4ZA 2F1IA 2JV3A 3C2LA 2BGWA 1SXEA 3PR4A 2RFFA 3AUOA 4RU9A 2C22A 5DB7A 7ICOA 2KVSA 1JXLA 1SZPA 2KV2A 2FMSA 7ICPA 5DG9A 4X4TA 4O3OA 3KHLA 9ICPA 2RQ5A 5AKKA 5ALVA 4Z6DA 8ICZA 4CF5A 4WBZA 3TKAA 2LBOA 4USAA 3UPQA 4QWEA 1T3QA 4ECUA 4ED0A 5AKLA 2RLTA 3QU4A 2N1RA 4QZ8A 3PMNA 3ZDCA 3PV8A 2YX8A 4IQVA 3KHGA 4NXZA 1SKSA 2C2DA 5HMLA 2ZIVB 3MR2A 5AK3A 4MF2A 3M9MB 4WC2A 3FM9A 3HT3A 3ALRA 2DPIA 4LEVA 2Y1IA 1PK1A 4O3MA 2FJ6A 4YR2A 4DOCA 4O3SA 2FPKA 2KZ3A 4QWDA 4YQWA 1U9LA 1N56A 4F72A 4RPXA 4BDPA 5HNKA 2XY7A 5IIJA 2ZH6A 4UB3A 2F1HA 2B0CA 1YT3A 4OCZA 2DBYA 1H38A 3WK9A 5J2BA 5AM3A 1J2MA 3AQNA 1GO3F 4IG8A 2KKPA 4YMMA 4EX7A 4NLGA 1ZQRA 1UETA 1ZQDA 9ICMA 3HRDD 4QIWC 4C4RA 3N7SC 1OXJA 2PFPA 4G9BA 5GTIU 3RR7A 1BPEA 2F44A 2C2RA 2EZZA 2LYAA 2KSOA 3B0YA 3RB6A 2WTFA 4X4SA 2D3DA 3AU6A 1PVRA 2XY5A 3GV8B 5D49A 1QTMA 3C29A 4B9SA 4P0QB 5DLFA 1SWWA 3SEIA 2OWOA 1M6YA 1N5XA 3FYHA 3GQCA 1BVSA 4KLEA 5KFPA 2IBKA 1SZHA 3E58A 2K8BB 1J97A 5EWGA 1L3TA 1RXVA 3SV4A 1RDFA 2Z7JA 3N7PD 2VA8A 4UBBA 4C4TA 1UCVA 3NRZA 2P6UA 2EQYA 4DSIA 4NKUA 5ALOA 3DV9A 4NV0A 2QB1A 1NJXA 2KD1A 4XQ8A 2K4IA 5D63A 3F5AA 3SYZA 4FH3A 4DFDA 2M9NA 2HSZA 3AQEA 4DOAA 2NRXA 4ED1A 3RB4A 1QSSA 4KLGA 2DR9A 1L5UA 3T5JA 4NLZA 3H8JA 3I76A 3OVSA 3C1ZA 3H39A 1ZQLA 4F93B 3WK7A 4DFMA 2ZJ5A 3N7RC 9ICEA 4WC1A 2UVVA 2RP5A 4PPXA 2QB0B 4O3PA 4M47A 2CXYA 4OAFA 2NYVA 1TKDA 7ICQA 4OAGA 1C7YA 5J2EA 1IM4A 2Y9TA 3UXNA 1XS9D 9ICTA 3JPSA 3SAHA 2HN1A 2ZHAA 2IOFA 4BX9C 4NLBA 1HJPA 3ISBA 9ICKA 8ICTA 2M2UA 4ICAA 4UB5A 3E2EA 2GLEA 1FEZA 3EF2A 2HHQA 5ALXA 4F5PA 5AM2A 2FMPA 5E79U 5IILA 1NJYA 3UXPA 5ALZA 1S5LU 1KLNA 3ERCC 5AI5A 2FMQA 4K97A 3C28A 8ICCA 2FI1A 2YMMA 3UPSA 4X4NA 5D46A 1T3NA 2E1EA 3K1RB 4R66A 3J81j 1X40A 4DO9A 4I2EA 3G6YA 3T3FA 8ICEA 3WFOA 4QZGA 1DOQA 8ICQA 2XIDA 2DWQA 9ICAA 2YTUA 4DL4A 3BQ0A 2VIXA 4RPZA 5EOZA 1XNSA 4M5DA 4O9MA 1N48A 4RNNA 4X4PA 2HDOA 3JPPA 4KN7A 5DB6A 4M6WB 4IQWA 4EX6A 4K4HA 2M2VA 2F8KA 1JN3A 3UM9A 2HHXA 3NVYA 4IRCA 5IIOA 3LVVA 4YXMA 4O3QA 1D9FA 4NXUA 4IQUA 4GXIA 1KN5A 1U45A 2V4QA 1SKWA 4FBTA 4AT8B 3QEBZ 5AI4A 3OUYA 2Q66A 2ZIWA 5J8YA 1HUOA 5ALKA 2EZYA 1DXSA 3H0MB 3SV3A 1COOA 1X9WA 2ASDA 1NK6A 1URJA 2W3RA 2MSNA 4BWMA 1X6IA 2NV3A 3GFKB 3NS1A 8ICSA 2KZMA 3RH5A 2BDPA 1S9FA 4CGZA 5KFJA 5CHGA 1R8BA 4YMOA 3PR5B 2ZH2A 1A77A 5DDYA 9ICUA 4F50A 4RQ7A 5HRIA 3RAQA 4KLOA 1JUDA 4OJ6A 5C5JA 4NWIA 5B3QA 5K4LA 2R8KA 3QEAZ 4I2JA 5AM4A 3HW8A 2UVRA 2HN2A 3MGIA 4Y2SA 2KMDA 4Y2PA 2HI0A 4NM2A 3G6XA 1VJ5A 1AROP 1VLBA 1OW5A 2PMZF 1Q46A 4C8OA 9ICRA 3O0FA 1HEKA 2GOLA 4HYKA 4DSLA 2AXTU 4GXKA 3HJEA 1WUDA 4P4PA 5J0OA 3MDAA 2ZHBA 1NKCA 4O5KA 3ETRA 2G5HB 3UMCA 4RQ4A 2R8HA 1TAUA 4M9LA 4F2RA 4EEKA 2AQ4A 4FHYA 2F76X 3K7DA 4YCXA 3RRGA 3HJ4A 4DOBA 5HREA 3WK4A 2XVTA 4C7YA 3QU9A 1DRGA 5F9LA 1T7PA 5AKEA 3MFHA 2H3FA 1MQ3A 2HOQA 5B5EU 3T79A 4M0AA 2KVCA 4KLJA 3NRWA 2W11A 8ICUA 2NRTA 4YG2A 7ICGA 1Q3UA 4BWJA 2BE3A 4X4RA 1Z4NA 1IV8A 3F2CA 1TK5A 3PSIA 4M6WA 1BNPA 3H8MA 3JPOA 4AT7B 3Q8PB 1FFUA 4F4KA 2M2TA 3RJKA 2BCSA 2KK0A 4CE6A 1Y88A 4QZDA 3QU5A 5KFDA 5J2JA 1K5OA 1CUKA 2RDJA 5DDMA 2OCEA 2R8JA 3RJJA 2OXOA 2WF7A 2XI9A 3KKAC 5KFWA 4KLLA 3AQKA 2G09A 8ICRA 3RB0A 5DBBA 3BJYA 3D2QA 4EZ6A 4IC9A 2LYHA 1V38A 2BKEA 2W54A 4ECZA 4Y2VA 3TADC 4CRXA 3RR8A 4O0IA 4XRHA 5KT2A 9ICXA 5J2CA 2ODGA 4M9HA 5HMMA 3M7DA 4J9LA 1MN8A 5DBAA 8ICBA 4O69A 3AMZA 3DDHA 1ZQKA 5KFTA 3ZD9A 3L3FX 4ECXA 4AT8A 2FPMA 5KT5A 2WAQC 3KZIU 4ECSA 3ISCA 4NXVA 4E8FA 4QJFB 3WFPA 2ZJ8A 2CPRA 1DK3A 1YZ6A 4F3OA 4P2HA 4TQSA 4C8KA 4DL6A 2ASLA 2HOFA 3TAQA 8ICNA 5HRHA 9ICHA 3SR6A 5J0XA 1QQ6A 3IHQB 3LVWA 3ZD8A 3EZ5A 1X9SA 1ZJNA 2WF9A 2HCFA 2RHFA 4UAVA 3TQ1A 1Z19A 7ICUA 4PH5A 2W9AA 3RJHA 5KG0A 1U48A 3BQ2A 2K8AA 3ISDA 4UAYA 3AQMA 3M1YA 4FHPA 2HBLA 3F2BA 5AKXA 3N28A 4M04A 3PZPA 2P35A 4K8VA 4RNMA 5DQGA 4JK1A 2ASJA 3M9NB 3FDSA 1UHUA 3C18A 5HC9A 4UD5A 3EPGA 2DRBA 4R8UB 2HHUA 4UB6U 2GAFD 4K4IA 3H3AA 1ZXIA 4FFDA 2JRZA 2HHPA 5AI8A 3AL0B 1SV0A 4FH5A 1WWVA 5KFOA 3K1ZA 3GILA 3ZI4A 3L5KA 3HKZC 2E1FA 3JZ0A 4NXTA 2KJ5A 1L3VA 4X4UA 1L3SA 1TAQA 4P4OA 4EBKA 5J0QA 2ATLA 4BXOA 3NTUA 3PW5A 3LWLA 2DGZA 3MDCA 4J9RA 2PI5A 5L1IA 3BS5B 4US9A 5HR7A 4ED6A 4IS7A 7ICNA 8ICKA 2P66A 5DECA 3SD7A 4DF4A 4AT9A 2G0AA 5EE3A 3RJEA 4Y2RA 2PMZC 5DGBA 4I28A 1CI4A 2KFNA 3ED5A 2J6TA 2JEFA 4EZ9A 1U4BA 1WOTA 5J2GA 1PK1B 3UMGA 4MKPA 1J2NA 1NK9A 2KICA 4ECRA 3NASA 3ZDEA 4ED7A 3M8SA 2E8MA 3SI8A 2JH1A 5C0YA 1L7PA 1ZOLA 3NVVA 4U6PA 2KE7A 2ZH1A 1NKBA 4AT9B 4I0UA 4Z6EA 5H2FU 1ZQQA 5D61A 5KL8B 5ALDA 7ICJA 2Y9UA 2E8OA 1RPLA 1ZD3A 2A1JA 2EANA 4QZBA 1NZBA 1SB3C 4I2GA 4RPYA 1ZQ1C 3Q8MA 1QSYA 2BDUA 2IHNA 4NY8A 4Q8FA 2HVHA 2GO7A 4RQ0A 1VFGA 1L7MA 3T5KA 5KFRA 3E0FA 5KFEA 5B66U 5A0LA 1TK8A 1ZETA 4BUGA 3IDWA 4DL2A 1JIHA 5B3PA 9ICLA 2A1JB 2ZTEA 2OEHA 1PK3A 2F77X 2ZIUA 4WH5A 1U49A 2YY6A 1BNOA 2G5IB 4RZRA 3MR3A 3H37A 3TADA 3M8RA 2OYYA 3PMLA 2A1AA 3MR5A 1D9DA 2MA1A 5AI9A 5ALIA 1ZQHA 2H3QA 5BOLA 3TFRA 4KB6A 2K4EA 4FZLA 2PFQA 4DQQA 1NZPA 5DQHA 2YN4A 4OJPA 3RAXA 1KNYA 4C8MA 3HP6A 1KW4A 4PHDA 2W9BA 4P0PA 3IM1A 4DLEA 3OVBA 2JGAA 4TURA 5KT3A 4OAHA 2W7PA 2ZG6A 1JI7A 3LYSA 5CJ7A 4EENA 1COKA 4Q8EA 4R63A 2EAPA 5DB9A 1SGGA 2VJ5A 4UATA 3RJIA 1GPJA 2ZXIA 2KG5A 4EYIB 2YMPA 2PFOA 3ZDAA 4OO1J 4J9PA 9ICOA 4FZMA 4UARA 4O5EA 3ER9B 3PW0A 3QXGA 4RQMA 5J0WA 4F5QA 4YFKA 3QNMA 1R8CA 1BPZA 3MGVA 3BQ1A 1ZQWA 2I5HA 5DGAA 3FC4A 2F3NA 4WC5A 1O08A 4C80A 2XICA 4RQNA 3JYYA 3ZDDA 3RH4A 4I2AA 5HRDA 4P0QA 2K89A 1L8OA 2BPGA 4BXOB 8ICPA 4XJEA 5KFAA 2DUYA 3MC1A 3K75D 3PX6A 9ICSA 4DQPA 1UT5A 1N61A 1B0XA 7ICRA 3GIMA 4PGXA 3PX4A 4AT7A 1SV4A 2Y0SF 2DL0A 2K4HA 1RXWA 1O03A 4X4OA 4DSKA 5ALQA 5J2KA 4LZDA 4O68A 2FE9A 2HHSA 2V9WA 1D8LA 4B6JA 5KT6A 3MABA 2GWSA 3PW4A 1DGSA 4WC7A 3SZ2A 1LKYB 1MIWA 3TI0A 3RH6A 4MFCA 1K1QA 4KLHA 1ZQSA 5ALGA 3M6KA 4M2YA 8ICXA 1DK2A 1ZQMA 1CRXA 3EW9A 4DLGA 4O3NA 9ICJA 3PX0A 1IXRA 2MU2A 1F5AA 1NJZA 2O6KA 3OHAA 3PHZA 2EAOA 5KFHA 4S3NA 1S0VA 4LEYA 4QZIA 4I2CA 3EPIA 5KAIU 4O6AA 3WK6A 3BZCA 5KFXA 1Z00B 5KT7A 3LWMA 4F2SA 5J2AA 9ICVA 1DGJA 2QLTA 2W9MA 4DQSA 2ZUBA 4C0ZA 2FPLA 1V9PA 2KZZA 3NGDA 5EWEA 1UT8A 2W04A 5HHIA 1QH9A 3JPQA 4GFJA 5AKYA 4IQTA 4RQ8A 1Q3VA 5AM5A 4LVSA 3PVXA 4P0PB 3OGUA 7ICIA 2ZTDA 1F0MA 2LYBA 4J9NA 3FAHA 2NRZA 2B56A 4UAZA 3GDXA 5ALHA 5J29A 5G5GA 3V72A 1KFDA 3WKBA 5KFIA 4A8EA 3RBDA 9ICWA 3I1YA 3OHBA 5ALYA 1FO4A 4GC6A 4FS2A 3BZKA 3SQIA 4KLIA 4JB3A 3PO4A 4J9SA 1B4FA 1PX5A 1SL2A 4PL2A 4Z6CA 1ZQJA 2D8CA 1ZQXA 1N60A 2CN1A 3V6JA 4KLTA 3QU7A 2ZIUB 2BZFA 2UVWA 4OJOA 1L8LA 2KHQA 1X9MA 5DG8A 4EBDA 3C66A 2KHVA 2AH5A 4ECTA 2BCUA 2KIWA 2YB1A 1V85A 3PSTA 2AGOA 3H8WA 4DFKA 3RJGA 4ELUA 7ICHA 4FBUA 4PHPA 3H4DA 1JXEA 5HRLA 1BPBA 5AKZA 3OV7A 3B0XA 3OSPA 4AYBC 4OAIZ 8ICAA 4YD2A 1K1SA 1F44A 4JWMA 3HPOA 4J9QA 3IP4B 2HOIA 1OU5A 5AKHA 4QZ9A 2VA3A 2KFZA 1QSLA 2WFAA 3H8SA 2PBEA 4PHEA 2PFNA 3LK9A 4I2HA 1XSLA 4E80A 4DCCA 3QUBA 2WB1C 3PSPA 3OJSA 3RTVA 2LKYA 1TV9A 2VANA 3S6JA 1SWVA 2ZJAA 3WK5A 4RWNA 3OWGA 3GIKA 2ID1A 2GH1A 5DB8A 4NJ8A 1UA0A 4JUZA 3WFQE 1IG6A 3HJ1A 5J0YA 3WKEA 1L7OA 4O67A 2W55A 3C2KA 8ICMA 3L9DA 3BS7A 5ALTA 2DR7A 4J9MA 1KL9A 3KZXA 3EYZA 4F5RA 2WAQF 4R8UA 5KFBA 5EE1A 1L7NA 4BGDA 4OJLA 2NRVA 2AHOB 1VJ7A 1KRPA 1NK0A 3UXOA 1ZQBA 4QZAA 2F2AB 2AU0A 4J9KA 2R8GA 3Q8RB 4JMUA 2ES6A 2B6GA 5EE0A 4YD1A 3WFSC 4UASA 3V7JA 2EH9A 2XGQA 2ZH7A 5ALMA 2KOBA 1Q78A 3F5EA 3Q8SB 3AN1A 5ALPA 1S8OA 1T8EA 2I9GA 4QNLA 4DL5A 2ZH3A 5AK5A 3B9JA 1F5SA 3C1YA 1N62A 2BPCA 1R89A 3N97B 3EWAA 2HVIA 1P7DA 3ONNA 3C2MA 3RF9A 2KIVA 1T94A 1ZQOA 5HRKA 4RNOA 1V4AA 1CEZA 2Y1JA 1KTQA 1Z4OA 4IRDA 4UB2A 4DSJA 2HBJA 3MCRA 4ATBA 2DVIA 3RFAA 3D6JA 3QUQA 4LJXA 2EZXA 5CR0A 2DQNB 2FLLA 5DEDA 4I2IA 1PVPA 3GV5B 1TFYA 8ICWA 5ALWA 5CRXA 4MF8A 2FDRA 2DKXA 2E8NA 2ZH9A 2JZBA 4MHVA 3T5HA 2WHEA 2EWRA 4WQLA 2ESEA 4UB8U 7ICKA 1ZQNA 1PVQA 4WJ3B 4RT3A 1YLQA 4FO1A 4PZOA 1S0MA 1KFSA 2ZH5A 5D4BA 4ECQA 1JMSA 2YMLA 2RDIA 4ED3A 2F1JA 8ICYA 2KEYA 2LHTA 3THVA 2B51A 4IL6U 1JX4A 9ICCA 1ZQEA 4TUPA 2JZBB 1NK4A 5BPCA 4K99A 5HHHA 2JH7A 5KTQA 3ORYA 2HMXA 1R8AA 3BDPA 5J8YC 1L6NA 5AIAA 1NK5A 5J0RA 1T4GA 3JPRA 4EEYA 4PGYA 4B9UA 4J9OA 3WFRE 3GIIA 1PZNA 2C2EA 1WYGA 3PO5A 4GC7A 4C8LA 1X66A 3BQTA 3IG8A 3CW2C 4KLSA 4X4VA 1ZQCA 4E0DA 1U47A 3NVWA 4K98A 5ALFA 1C20A 1TVAA 1SV0C 2F8LA 4HX0A 3QU2A 2NO5A 1KEJA 2DPJA 5J2IA 3R9KA 3PY8A 1YZ7A 5CFTA 2G08A 9ICNA 2D6FC 4JV0A 3Q8QB 2ZUCA 2FCLA 2GA9D 3H0LB 3PSFA 5CB1A 5ALEA 4WOYA 1XO0A 4XUSA 4OD0A 1ZQIA 1Z1BA 5IIMA 1ZYQA 3NYBA 4Y2QA 2KJ9A 5DKWA 5L1JA 3RRHA 1MA7A 3C23A 1JROA 4YXJA 4UAWA 1D8BA 2HW3A 3WU2U 5KFUA 2ZIWB 3CYMA 5AK4A 2XCAA 5CHEA 5AKJA 2AGPA 2JHDA 4ATBB 5BOMA 3GU3A 1Z1VA 2NO4A 2O1PA 4KLQA 4F92B 3UMBA 5DQIA 7ICVA 1WCNA 1ED1A 2LM1A 3KHRA 1RQLA 1IIPA 1ZQTA 2UVUA 1ZD5A 2BBHA 2ISPA 3QUCA 1UEUA 2EAMA 3HX0A 3RBEA 1S76D 2AGQA 3A0BU 4XA5A 2KSOB 2BCVA 3JPTA 3T5LA 1NO5A 5IIIA 3WK8A 2DR5A 1S0OA 4RT2A 3AU2A 2WF8A 1VDVA 5HRGA 4KM5A 4QZEA 3QZ7A 4QIWF 1WCLA 2VA2A 3IV6A 2ISOA 4PZNA 1ZJMA 2E3TA 4KITB 4LEZA 4FHXA 2ZXHA 4RWOA 1NJWA 4JV1A 3MBYA 2J6UA 3AEVA 4FHWA 5F2VO 2ZIVA 4TQRA 4EGWA 1SKRA 5HRFA 8ICHA 1A76A 2R8IA 5ALSA 1NOMA 2ZH8A 2ZH4A 4JWNA 3WKAA 1ZQFA 4KMUA 5F9NA 2W8KA 1ZRNA 3JPNA 3M9OB 1XU4A 4DS5A 2K4PA 5KFVA 5J2HA 4EBEA 4EV6A 3F53A 1SL1A 4C4SA 4QWCA 5J2DA 1RM6C 4R64A 5TZVA 4JV2A 4DL3A 5AI6A 4PHAA 1LV5A 2IHOA 4KLDA 4QW9A 4MEYA 4YR0A 4X0BA 3V6KA 4F4WA 5ALNA 1NK7A 1S77D 4C8NA 4ZOHC 2FLNA 1S0NA 5HR9A 5DG7A 1QLNA 5J0TA 4RQ2A 5KG7A 4RUAA 1A0PA 2H3IA 3ETLA 2NRKA 3NVZA 1BPDA 4FZNA 1NKEA 5JU5A 2W43A 2BCQA 4MFAA 4X5VA 3QZ8A 3ICXA 4DFJA 2G07A 1X6JA 2A19A 2HHTA 4X4QA 3M6ZA 3QUTA 2YMQA 3IN5A 3VC8A 1ZQVA 1NNLA 4CF3A 5AKIA 5CA7A 1JQRA 3LDAA 4Z6FA 4E7XA 1MQ2A 3EUB2 5JTGA 4DWIA 4MEXA 2HBKA 5CFSA 5F3XB 4I27A 3H0RB 1ZQYA 4WC3A 4I29A 2W7OA 3CK6A 7ICFA 5KFNA 2LI6A 5L1MA 2V4RA 1QQ7A 4Q45A 8ICOA 2LMRA 2KJ8A 1XSNA 7ICTA 5IIKA 4KLFA 4ECYA 2YB4A 2PI4A 8ICLA 5HP4A 5HR6A 4WC0A 1Z00A 5ALJA 5IINA 4ED2A 4WBYA 4US8A 9ICBA 5DLGA 2QB0A 2HHWA 4QZFA 1MIVA 2DFLA 1N2XA 3OVAA 3QE9Y 4JLXA 5ALLA 4RWPA 4YP3A 2DKZA 2BBJA 4M9JA 5AK6A 5KFQA 2HHVA 4B9VA 1KSPA 5D62A 2ALZA 2P6RA 4KTQA 4AYBF 3RJFA 4NKTA 3KFUF 3UQ2A 4EBJA 1JALA 1KBUA 4KMOB 8ICIA 5TISU 4QWAA 4YMNA 2DR8A 5KG5A 4EP7A 2JR5A 2FLPA 1ZQZA 4QW8A 2BHNA 5KFKA 5HRBA 3GV7B 2G06A 3OUYB 4R65A 9ICGA 1RG6A 7ICLA 4F4XA 4Y2UA 1AQ6A 3PW2A 5CFUA 9ICQA 1LVHA 4KX3A 3OTQA 1FIQA 2KKVA 2WF6A 4KX5A 2IHMA 1ZD4A 3JCFA 4FO6A 5ALUA 2JMGA 4F4YA 3QYPA 4Y2JA 4WCWA 1BPXA 5JUMA 2EDUA 3HIYA 2A3VA 5AHXA 4M9GA 4YVZA 2PXIA 8ICGA 4O3RA 1L3UA 3LQCB 3WKCA 5KNIA 2J6SA 2IUBA 2JXJA 4DFPA 5KG6A 4NM1A 1TK0A 3C5GA 4ZH4A 2DRAA 4ECVA 3KTQA 4P4MA 3KOOA 1NK8A 5KFYA 1X42A 4PJ0U 1Q79A 5L1KA 2I1QA 1ZQUA 3TARA 4EBCA 1XO1A 2KTQA 1X2IA 1RYRA 2H3VA 2PKEA 3HKZF 7ICMA 1TFWA 3H40A 2XO7A
chains in the Genus database with same CATH topology
4EZ9A 1U4BA 4DSIA 4NKUA 5J2GA 1T8EA 2I9GA 4DL5A 1NJXA 1NK9A 2ZH3A 4XQ8A 4RWQA 4ECRA 3ZDEA 4Q44A 4ED7A 1HUZA 3SYZA 4FH3A 3M8SA 2M9NA 3C1YA 3SI8A 2BPCA 1R89A 3N97B 4DOAA 1NKBA 2NRXA 4AT9B 3EWAA 5EWFA 2HVIA 5CP2A 1B43A 4ED1A 3RB4A 3C2MA 1QSSA 4Z6EA 4KLGA 1ZQQA 1ZQOA 8ICJA 4RNOA 1L5UA 3T5JA 5HRKA 4NLZA 1V4AA 2DR9A 3H8JA 1CEZA 2Y1JA 3OVSA 3C1ZA 7ICJA 2BQ3A 3H39A 1ZQLA 3GIJA 3WFRE 2ZTCA 1KTQA 4F93B 1S10A 5J0PA 1UA1A 4UB2A 4IRDA 8ICVA 4DSJA 4DFMA 1KDHA 2ZJ5A 4B9MA 9ICEA 1RPLA 1BPYA 4WC1A 2UVVA 4ATBA 2A1JA 2DVIA 4QZBA 4PPXA 1XWLA 4QZHA 4O3PA 4M47A 4MFFA 1TKDA 4I2GA 7ICQA 4PGQA 4RPYA 5J2EA 1C7YA 1IM4A 3Q8MA 1QSYA 5CR0A 2IHNA 4NY8A 4Q8FA 3UXNA 1XS9D 4IR1A 4DQIA 2HVHA 3JPSA 2W9CA 1ZQGA 2FLLA 9ICTA 4RQ0A 4F91B 5DEDA 4I2IA 1VFGA 3T5KA 4G3IA 4UB4A 2ZHAA 4RQ5A 5KFRA 3GV5B 1TFYA 5KFEA 8ICWA 1HJPA 3ISBA 9ICKA 8ICTA 4MF8A 1ZETA 1TK8A 2M2UA 4UB5A 4DL2A 3E2EA 1JIHA 2ZH9A 2HHQA 9ICLA 2A1JB 7ICTA 2ZTEA 2JZBA 3T5HA 2IA6A 4F5PA 2FMPA 5KG3A 4K4GA 2H5XA 5IILA 3HWTA 1NJYA 1U49A 3UXPA 1ZQNA 4NLKA 7ICKA 3C21A 1BNOA 1MC8A 4RZRA 4RT3A 3MR3A 4I2FA 3H37A 1YLQA 3M8RA 1KLNA 3PMLA 1S0MA 3MFIA 3MR5A 1D9DA 1KFSA 1ZQHA 2FMQA 3H38A 1KFTA 5KFLA 4ECQA 1JMSA 5D4BA 4IRKA 5BOLA 8ICCA 4KN4A 3TFRA 2RDIA 3UPSA 2PFQA 5D46A 2F1JA 4ED3A 1T3NA 8ICYA 4X4NA 3THVA 4R66A 4DQQA 5DQHA 1ZQAA 1NZPA 1JX4A 4RQ3A 9ICCA 1ZQEA 4TUPA 2JZBB 1NK4A 1B22A 5L1LA 4DO9A 1KNYA 3RAXA 4C8MA 2MUTA 5KFGA 4I2EA 5BPCA 3HP6A 4CCHA 3G6YA 3T3FA 5HHHA 4PHDA 2W9BA 8ICEA 3WFOA 3TAPA 5KTQA 5KFFA 3IM1A 3N4MB 4DS4A 4QZGA 2BQRA 1DOQA 3ORYA 8ICQA 4DLEA 1R8AA 3OVBA 3BDPA 9ICAA 4AT8A 4TURA 4DL4A 5KT4A 5KT3A 4I2BA 3BQ0A 1NK5A 5J0RA 1T4GA 3V7KA 3JPRA 3C5FA 4RPZA 1BGXT 2KN7A 4EEYA 5EOZA 4PGYA 5CJ7A 3KHHA 4B9UA 4M5DA 4O9MA 4Q8EA 3H4BA 4J9OA 2BQUA 4RNNA 3GIIA 2AQ0A 3JPPA 3RB3A 4KN7A 1N48A 3ZDBA 1PZNA 4R63A 5DB6A 5DB9A 4M9NA 2C2EA 3PO5A 4GC7A 4C8LA 3BQTA 4M6WB 7ICSA 1FA0A 4IQWA 2M2WA 4K4HA 2M2VA 3RJIA 1JN3A 2HHXA 1SL0A 4KLSA 3PW7A 4IRCA 5IIOA 4X4VA 1ZQCA 4E0DA 4YXMA 4EYIB 4DF8A 2PFOA 4ED8A 4O3QA 1U47A 1D9FA 3ZDAA 4IQUA 5CWRA 4GXIA 4Q43A 1TVAA 1U45A 4J9PA 2V4QA 4DSEA 1SKWA 1KEJA 2W9CB 2DPJA 4FBTA 7ICOA 3QEBZ 5J2IA 9ICOA 4AT8B 3OUYA 3PY8A 2BR0A 2JEJA 4O5EA 9ICNA 4QZCA 4JV0A 2AJQA 3Q8QB 3Q8LA 2ZUCA 3PW0A 1HUOA 3V7LA 2Q66A 5J0WA 4F5QA 4YFKA 4B9NA 3PNCA 1R8CA 4EYHB 5CB1A 1BPZA 3SV3A 4XUSA 1COOA 1ZQIA 3BQ1A 1X9WA 4UBCA 5IIMA 1ZQWA 4B9TA 4ELVA 2ASDA 1RYSA 1ZYQA 1S97A 1NK6A 3NYBA 4O5CA 5DGAA 2MAXA 1JAJA 4BWMA 5DKWA 5L1JA 4TUSA 4YN4A 4WC5A 3RRHA 3C23A 4NLNA 2JEGA 3GFKB 2BPFA 4YXJA 4UAWA 8ICSA 3JYYA 2XGPA 3ZDDA 4GLXA 3RH4A 4I2AA 2KZMA 2W9BB 5HRDA 2HW3A 2BPGA 4BXOB 8ICPA 1EXNA 3RH5A 5KFUA 1S9FA 5KFAA 2BDPA 5KFJA 5CHGA 3PX6A 3K75D 2XCAA 9ICSA 4WC6A 2AGPA 1R8BA 4UD4A 4ATBB 4YMOA 3PR5B 5BOMA 5KFZA 4YR3A 1UT5A 1RZTA 4DQPA 9ICFA 2ZH2A 1A77A 5DDYA 9ICUA 7ICRA 3GIMA 4PGXA 2O1PA 4E8FA 4F50A 4RQ7A 4F8RA 5HRIA 4KLQA 4GXJA 3RAQA 4KLOA 4F92B 5DQIA 3PX4A 5C5JA 7ICVA 1WCNA 3TFSA 4X0AA 4UQGA 2ZH5A 4AT7A 5KG2A 2R8KA 9ICIA 3QEAZ 4I2JA 3HW8A 2UVRA 3G6VA 3KHRA 3MGIA 1RXWA 4X4OA 1Z3EB 4DSKA 5J2KA 1ZQTA 2UVUA 4NM2A 4LZDA 3G6XA 4B9LA 4ECWA 2HHSA 1AROP 2V9WA 2ISPA 4C8OA 1UEUA 1D8LA 2C28A 5DBCA 9ICRA 1Q78A 2IMWP 4HYKA 3HX0A 4DSLA 3RBEA 4GXKA 4F5NA 2AGQA 5KT6A 1S76D 4XA5A 3MABA 3Q8KA 2XCPA 2BCVA 2GWSA 5KG4A 5J0OA 4P4PA 3JPTA 1DGSA 3T5LA 3PW4A 1NO5A 5IIIA 5J0SA 4KLUA 3MDAA 1S0OA 2ZHBA 4WC7A 2DR5A 2O5AA 4KLMA 4RT2A 3AU2A 1NKCA 3SZ2A 4O5KA 5HRGA 4QZEA 3QZ7A 1WCLA 4F5OA 2ISOA 2VA2A 1MIWA 4UB1A 5L9XA 1ZJMA 4KITB 4FHXA 3TI0A 2XY6A 3RH6A 4RQ4A 4RWOA 2MUTB 2R8HA 1NJWA 1TAUA 4IR9A 3MBYA 2J6UA 4JV1A 3OSNA 4F2RA 4LZGA 4M9LA 4MFCA 7ICEA 2AQ4A 1K1QA 4FHWA 5F2VO 4TQRA 4KLHA 1MSWD 4FHYA 1SKRA 5HRFA 8ICHA 4YCXA 2NRWA 1A76A 1ZQSA 2R8IA 3RRGA 3HJ4A 1ZQPA 4M2YA 4DOBA 1NOMA 8ICXA 1DK2A 2ZH8A 2ZH4A 1ZQMA 4JWNA 5HREA 1ZQFA 4KMUA 5F9NA 3EW9A 4O3NA 5F9LA 2W8KA 4DLGA 3JPNA 3MFHA 3M9OB 1T7PA 1XU4A 5J2HA 5KFVA 4EBEA 5KFSA 5KG1A 4DS5A 1MQ3A 2XC9A 9ICJA 3PX0A 1IXRA 4RQ1A 1NJZA 1F5AA 3OHAA 4LT6A 4TUQA 1XSPA 1SL1A 4XQ7A 4M0AA 4WC4A 5KFHA 4S3NA 1S0VA 4QWCA 5J2DA 4KLJA 4QZIA 4R64A 4I2CA 4I2DA 2KP7A 3EPIA 1WOTA 5TZVA 3OJUA 4JV2A 8ICUA 2NRTA 4YG2A 4DL3A 4PHAA 1Z00B 5KFXA 5KFMA 1LV5A 7ICGA 5KT7A 4BWJA 5J0UA 3LWMA 4F2SA 2BE3A 4X4RA 4KLDA 4QW9A 4MEYA 5J2AA 4YR0A 1TK5A 3V6KA 4M6WA 9ICVA 1LB2B 1BNPA 4X0BA 4F4WA 1UEVA 1NK7A 1S77D 4C8NA 5J2FA 2W9MA 3JPOA 4DQSA 4AT7B 3Q8PB 3V6HA 2ZUBA 2BCRA 1XC9A 1D8YA 2FLNA 1S0NA 4F4KA 2M2TA 5HR9A 2FPLA 1V9PA 2Q0ZX 5DG7A 3RJKA 1QLNA 2KZZA 3NGDA 5J0TA 2B21A 4RQ2A 2BCSA 5EWEA 1UT8A 4RUCA 5KG7A 5HHIA 2ZUDA 1Y88A 4RUAA 4ELTA 3JPQA 3TANA 8ICFA 3AQLA 3ETLA 5KFDA 4QZDA 5J2JA 3MGHA 2NRKA 1CUKA 1BPDA 2RDJA 4IQTA 5DDMA 1NKEA 2R8JA 3UQ0A 3K4GA 2BCQA 4MFAA 4X5VA 4DQRA 3QZ8A 4RQ6A 3MR6A 4DFJA 4RQ8A 4DL7A 3RJJA 2JEIA 4LVSA 3PVXA 1TFRA 3OGUA 4FHVA 4DEZA 2HHTA 7ICIA 4X4QA 2ZTDA 5KFWA 4KLLA 3AQKA 8ICRA 3RB0A 1ZQVA 5DBBA 3BJYA 4EZ6A 5CA7A 4J9NA 1JQRA 3LDAA 4Z6FA 2NRZA 4E7XA 5KFCA 4UAZA 2LYHA 3H7IA 3GDXA 5J29A 1MQ2A 2BKEA 3V72A 4ECZA 2JEFA 1MIYA 1KFDA 4DWIA 5KFIA 3RR8A 3RBDA 4MEXA 4O0IA 4I27A 4DSFA 4XRHA 5KT2A 9ICWA 4FS1A 9ICXA 4QWBA 5J2CA 3OHBA 1ZQYA 4M9HA 5HMMA 4J9LA 4GC6A 5DBAA 4WC3A 8ICBA 4FS2A 2W8LA 4F4ZA 4I29A 4KLIA 2F1IA 3PO4A 7ICFA 5KFNA 3C2LA 4J9SA 2BGWA 3OVAA 2V4RA 1ZQKA 3PR4A 2RFFA 4Q45A 5KFTA 3AUOA 8ICOA 4RU9A 1PX5A 3ZD9A 1XSNA 2C22A 5DB7A 5IIKA 4Z6CA 1SL2A 4ECXA 4ECYA 1ZQXA 1JXLA 1SZPA 1ZQJA 3V6JA 2FMSA 2FPMA 2PI4A 4KLTA 8ICLA 5DG9A 5HP4A 7ICPA 5KT5A 4X4TA 4ECSA 4O3OA 3KHLA 3ISCA 2UVWA 4WC0A 1Z00A 5IINA 1X9MA 4ED2A 5DG8A 4EBDA 9ICPA 9ICBA 5DLGA 3C66A 4WBYA 3WFPA 4ECTA 2BCUA 4Z6DA 8ICZA 2HHWA 4QZFA 2AGOA 1MIVA 2DFLA 3H8WA 4DFKA 3QE9Y 3RJGA 2ZJ8A 4ELUA 4WBZA 7ICHA 4FBUA 4F3OA 1DK3A 4RWPA 3UPQA 4P2HA 4PHPA 4YP3A 4TQSA 3H4DA 1JXEA 4C8KA 1BPBA 4QWEA 4DL6A 5HRLA 3B0XA 2ASLA 4M9JA 3OSPA 3OV7A 4ECUA 8ICAA 4ED0A 5KFQA 2HHVA 3TAQA 4B9VA 1KSPA 8ICNA 5HRHA 2ALZA 9ICHA 4QZ8A 5J0XA 4YD2A 1K1SA 2P6RA 4JWMA 3HPOA 3PMNA 4J9QA 4KTQA 3ZDCA 1OU5A 3PV8A 3IHQB 4IQVA 3KHGA 3RJFA 4QZ9A 4NKTA 3ZD8A 4NXZA 2VA3A 2KFZA 3EZ5A 1SKSA 1QSLA 2C2DA 3UQ2A 1ZJNA 1X9SA 5HMLA 3MR2A 3TQ1A 4EBJA 7ICUA 4PH5A 4MF2A 3H8SA 2W9AA 3M9MB 3RJHA 5KG0A 2PBEA 4WC2A 4PHEA 1U48A 3HT3A 3BQ2A 8ICIA 4QWAA 4YMNA 2DPIA 3LK9A 3ISDA 5KG5A 1XSLA 2PFNA 4UAYA 4I2HA 2DR8A 4EP7A 2Y1IA 3AQMA 4E80A 2FLPA 1ZQZA 4FHPA 4QW8A 2BHNA 5KFKA 4YR2A 4DOCA 3OJSA 3RTVA 4O3SA 4M04A 5HRBA 2FPKA 3GV7B 2KZ3A 3OUYB 4QWDA 4YQWA 4R65A 1TV9A 9ICGA 1U9LA 1N56A 4RNMA 4RPXA 2VANA 7ICLA 5DQGA 4BDPA 2ZJAA 5HNKA 2XY7A 4JK1A 5IIJA 2ASJA 2ZH6A 4UB3A 4F4XA 2F1HA 4X4PA 4RWNA 3GIKA 3PW2A 3M9NB 2ID1A 3FDSA 5HC9A 9ICQA 3C18A 5DB8A 3EPGA 1H38A 1UA0A 4JUZA 4UD5A 2DRBA 4R8UB 5J2BA 2HHUA 3H3AA 2IHMA 4K4IA 3AQNA 3HJ1A 3WFQE 4IG8A 5J0YA 4FO6A 4KLFA 2HHPA 4YMMA 4NLGA 4F4YA 1ZQRA 1UETA 1ZQDA 4WCWA 1BPXA 9ICMA 5JUMA 3C2KA 3HIYA 8ICMA 2PFPA 4FH5A 5KFOA 3L9DA 4M9GA 4YVZA 3GILA 2PXIA 3RR7A 8ICGA 1BPEA 4O3RA 1L3UA 2C2RA 3JZ0A 3LQCB 3B0YA 1L3VA 3RB6A 4X4UA 1L3SA 2WTFA 1TAQA 4P4OA 2J6SA 4EBKA 4X4SA 2DR7A 4J9MA 5J0QA 3EYZA 3AU6A 4DFPA 2ATLA 4BXOA 5KG6A 3NTUA 3PW5A 3LWLA 4NM1A 1TK0A 4J9RA 3MDCA 2PI5A 4F5RA 2XY5A 3C5GA 3GV8B 5L1IA 4ED6A 4ZH4A 5D49A 1QTMA 4B9SA 7ICNA 8ICKA 2DRAA 4R8UA 4ECVA 5KFBA 2P66A 3KTQA 4P4MA 5DLFA 5DECA 4BGDA 2NRVA 2OWOA 1NK8A 1VJ7A 5KFYA 1KRPA 1NK0A 3UXOA 4DF4A 1ZQBA 4QZAA 2ZH1A 3FYHA 3GQCA 1BVSA 4KLEA 5KFPA 2AU0A 5L1KA 4J9KA 2IBKA 2R8GA 1Q79A 4AT9A 3RJEA 1ZQUA 2I1QA 3Q8RB 3TARA 5DGBA 5EWGA 4EBCA 1L3TA 4I28A 4YD1A 3SV4A 1RXVA 3V7JA 1XO1A 2XGQA 2KTQA 2VA8A 2ZH7A 3WFSC 4UBBA 1X2IA 1RYRA 2P6UA 7ICMA 1TFWA 2KFNA 3H40A 3Q8SB 2J6TA 2XO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZ9 A;  1U4B A;  4DSI A;  4NKU A;  5J2G A;  1T8E A;  2I9G A;  4DL5 A;  1NJX A;  1NK9 A;  2ZH3 A;  4XQ8 A;  4RWQ A;  4ECR A;  3ZDE A;  4Q44 A;  4ED7 A;  1HUZ A;  3SYZ A;  4FH3 A;  3M8S A;  2M9N A;  3C1Y A;  3SI8 A;  2BPC A;  1R89 A;  3N97 B;  4DOA A;  1NKB A;  2NRX A;  4AT9 B;  3EWA A;  5EWF A;  2HVI A;  5CP2 A;  1B43 A;  4ED1 A;  3RB4 A;  3C2M A;  1QSS A;  4Z6E A;  4KLG A;  1ZQQ A;  1ZQO A;  8ICJ A;  4RNO A;  1L5U A;  3T5J A;  5HRK A;  4NLZ A;  1V4A A;  2DR9 A;  3H8J A;  1CEZ A;  2Y1J A;  3OVS A;  3C1Z A;  7ICJ A;  2BQ3 A;  3H39 A;  1ZQL A;  3GIJ A;  3WFR E;  2ZTC A;  1KTQ A;  4F93 B;  1S10 A;  5J0P A;  1UA1 A;  4UB2 A;  4IRD A;  8ICV A;  4DSJ A;  4DFM A;  1KDH A;  2ZJ5 A;  4B9M A;  9ICE A;  1RPL A;  1BPY A;  4WC1 A;  2UVV A;  4ATB A;  2A1J A;  2DVI A;  4QZB A;  4PPX A;  1XWL A;  4QZH A;  4O3P A;  4M47 A;  4MFF A;  1TKD A;  4I2G A;  7ICQ A;  4PGQ A;  4RPY A;  5J2E A;  1C7Y A;  1IM4 A;  3Q8M A;  1QSY A;  5CR0 A;  2IHN A;  4NY8 A;  4Q8F A;  3UXN A;  1XS9 D;  4IR1 A;  4DQI A;  2HVH A;  3JPS A;  2W9C A;  1ZQG A;  2FLL A;  9ICT A;  4RQ0 A;  4F91 B;  5DED A;  4I2I A;  1VFG A;  3T5K A;  4G3I A;  4UB4 A;  2ZHA A;  4RQ5 A;  5KFR A;  3GV5 B;  1TFY A;  5KFE A;  8ICW A;  1HJP A;  3ISB A;  9ICK A;  8ICT A;  4MF8 A;  1ZET A;  1TK8 A;  2M2U A;  4UB5 A;  4DL2 A;  3E2E A;  1JIH A;  2ZH9 A;  2HHQ A;  9ICL A;  2A1J B;  7ICT A;  2ZTE A;  2JZB A;  3T5H A;  2IA6 A;  4F5P A;  2FMP A;  5KG3 A;  4K4G A;  2H5X A;  5IIL A;  3HWT A;  1NJY A;  1U49 A;  3UXP A;  1ZQN A;  4NLK A;  7ICK A;  3C21 A;  1BNO A;  1MC8 A;  4RZR A;  4RT3 A;  3MR3 A;  4I2F A;  3H37 A;  1YLQ A;  3M8R A;  1KLN A;  3PML A;  1S0M A;  3MFI A;  3MR5 A;  1D9D A;  1KFS A;  1ZQH A;  2FMQ A;  3H38 A;  1KFT A;  5KFL A;  4ECQ A;  1JMS A;  5D4B A;  4IRK A;  5BOL A;  8ICC A;  4KN4 A;  3TFR A;  2RDI A;  3UPS A;  2PFQ A;  5D46 A;  2F1J A;  4ED3 A;  1T3N A;  8ICY A;  4X4N A;  3THV A;  4R66 A;  4DQQ A;  5DQH A;  1ZQA A;  1NZP A;  1JX4 A;  4RQ3 A;  9ICC A;  1ZQE A;  4TUP A;  2JZB B;  1NK4 A;  1B22 A;  5L1L A;  4DO9 A;  1KNY A;  3RAX A;  4C8M A;  2MUT A;  5KFG A;  4I2E A;  5BPC A;  3HP6 A;  4CCH A;  3G6Y A;  3T3F A;  5HHH A;  4PHD A;  2W9B A;  8ICE A;  3WFO A;  3TAP A;  5KTQ A;  5KFF A;  3IM1 A;  3N4M B;  4DS4 A;  4QZG A;  2BQR A;  1DOQ A;  3ORY A;  8ICQ A;  4DLE A;  1R8A A;  3OVB A;  3BDP A;  9ICA A;  4AT8 A;  4TUR A;  4DL4 A;  5KT4 A;  5KT3 A;  4I2B A;  3BQ0 A;  1NK5 A;  5J0R A;  1T4G A;  3V7K A;  3JPR A;  3C5F A;  4RPZ A;  1BGX T;  2KN7 A;  4EEY A;  5EOZ A;  4PGY A;  5CJ7 A;  3KHH A;  4B9U A;  4M5D A;  4O9M A;  4Q8E A;  3H4B A;  4J9O A;  2BQU A;  4RNN A;  3GII A;  2AQ0 A;  3JPP A;  3RB3 A;  4KN7 A;  1N48 A;  3ZDB A;  1PZN A;  4R63 A;  5DB6 A;  5DB9 A;  4M9N A;  2C2E A;  3PO5 A;  4GC7 A;  4C8L A;  3BQT A;  4M6W B;  7ICS A;  1FA0 A;  4IQW A;  2M2W A;  4K4H A;  2M2V A;  3RJI A;  1JN3 A;  2HHX A;  1SL0 A;  4KLS A;  3PW7 A;  4IRC A;  5IIO A;  4X4V A;  1ZQC A;  4E0D A;  4YXM A;  4EYI B;  4DF8 A;  2PFO A;  4ED8 A;  4O3Q A;  1U47 A;  1D9F A;  3ZDA A;  4IQU A;  5CWR A;  4GXI A;  4Q43 A;  1TVA A;  1U45 A;  4J9P A;  2V4Q A;  4DSE A;  1SKW A;  1KEJ A;  2W9C B;  2DPJ A;  4FBT A;  7ICO A;  3QEB Z;  5J2I A;  9ICO A;  4AT8 B;  3OUY A;  3PY8 A;  2BR0 A;  2JEJ A;  4O5E A;  9ICN A;  4QZC A;  4JV0 A;  2AJQ A;  3Q8Q B;  3Q8L A;  2ZUC A;  3PW0 A;  1HUO A;  3V7L A;  2Q66 A;  5J0W A;  4F5Q A;  4YFK A;  4B9N A;  3PNC A;  1R8C A;  4EYH B;  5CB1 A;  1BPZ A;  3SV3 A;  4XUS A;  1COO A;  1ZQI A;  3BQ1 A;  1X9W A;  4UBC A;  5IIM A;  1ZQW A;  4B9T A;  4ELV A;  2ASD A;  1RYS A;  1ZYQ A;  1S97 A;  1NK6 A;  3NYB A;  4O5C A;  5DGA A;  2MAX A;  1JAJ A;  4BWM A;  5DKW A;  5L1J A;  4TUS A;  4YN4 A;  4WC5 A;  3RRH A;  3C23 A;  4NLN A;  2JEG A;  3GFK B;  2BPF A;  4YXJ A;  4UAW A;  8ICS A;  3JYY A;  2XGP A;  3ZDD A;  4GLX A;  3RH4 A;  4I2A A;  2KZM A;  2W9B B;  5HRD A;  2HW3 A;  2BPG A;  4BXO B;  8ICP A;  1EXN A;  3RH5 A;  5KFU A;  1S9F A;  5KFA A;  2BDP A;  5KFJ A;  5CHG A;  3PX6 A;  3K75 D;  2XCA A;  9ICS A;  4WC6 A;  2AGP A;  1R8B A;  4UD4 A;  4ATB B;  4YMO A;  3PR5 B;  5BOM A;  5KFZ A;  4YR3 A;  1UT5 A;  1RZT A;  4DQP A;  9ICF A;  2ZH2 A;  1A77 A;  5DDY A;  9ICU A;  7ICR A;  3GIM A;  4PGX A;  2O1P A;  4E8F A;  4F50 A;  4RQ7 A;  4F8R A;  5HRI A;  4KLQ A;  4GXJ A;  3RAQ A;  4KLO A;  4F92 B;  5DQI A;  3PX4 A;  5C5J A;  7ICV A;  1WCN A;  3TFS A;  4X0A A;  4UQG A;  2ZH5 A;  4AT7 A;  5KG2 A;  2R8K A;  9ICI A;  3QEA Z;  4I2J A;  3HW8 A;  2UVR A;  3G6V A;  3KHR A;  3MGI A;  1RXW A;  4X4O A;  1Z3E B;  4DSK A;  5J2K A;  1ZQT A;  2UVU A;  4NM2 A;  4LZD A;  3G6X A;  4B9L A;  4ECW A;  2HHS A;  1ARO P;  2V9W A;  2ISP A;  4C8O A;  1UEU A;  1D8L A;  2C28 A;  5DBC A;  9ICR A;  1Q78 A;  2IMW P;  4HYK A;  3HX0 A;  4DSL A;  3RBE A;  4GXK A;  4F5N A;  2AGQ A;  5KT6 A;  1S76 D;  4XA5 A;  3MAB A;  3Q8K A;  2XCP A;  2BCV A;  2GWS A;  5KG4 A;  5J0O A;  4P4P A;  3JPT A;  1DGS A;  3T5L A;  3PW4 A;  1NO5 A;  5III A;  5J0S A;  4KLU A;  3MDA A;  1S0O A;  2ZHB A;  4WC7 A;  2DR5 A;  2O5A A;  4KLM A;  4RT2 A;  3AU2 A;  1NKC A;  3SZ2 A;  4O5K A;  5HRG A;  4QZE A;  3QZ7 A;  1WCL A;  4F5O A;  2ISO A;  2VA2 A;  1MIW A;  4UB1 A;  5L9X A;  1ZJM A;  4KIT B;  4FHX A;  3TI0 A;  2XY6 A;  3RH6 A;  4RQ4 A;  4RWO A;  2MUT B;  2R8H A;  1NJW A;  1TAU A;  4IR9 A;  3MBY A;  2J6U A;  4JV1 A;  3OSN A;  4F2R A;  4LZG A;  4M9L A;  4MFC A;  7ICE A;  2AQ4 A;  1K1Q A;  4FHW A;  5F2V O;  4TQR A;  4KLH A;  1MSW D;  4FHY A;  1SKR A;  5HRF A;  8ICH A;  4YCX A;  2NRW A;  1A76 A;  1ZQS A;  2R8I A;  3RRG A;  3HJ4 A;  1ZQP A;  4M2Y A;  4DOB A;  1NOM A;  8ICX A;  1DK2 A;  2ZH8 A;  2ZH4 A;  1ZQM A;  4JWN A;  5HRE A;  1ZQF A;  4KMU A;  5F9N A;  3EW9 A;  4O3N A;  5F9L A;  2W8K A;  4DLG A;  3JPN A;  3MFH A;  3M9O B;  1T7P A;  1XU4 A;  5J2H A;  5KFV A;  4EBE A;  5KFS A;  5KG1 A;  4DS5 A;  1MQ3 A;  2XC9 A;  9ICJ A;  3PX0 A;  1IXR A;  4RQ1 A;  1NJZ A;  1F5A A;  3OHA A;  4LT6 A;  4TUQ A;  1XSP A;  1SL1 A;  4XQ7 A;  4M0A A;  4WC4 A;  5KFH A;  4S3N A;  1S0V A;  4QWC A;  5J2D A;  4KLJ A;  4QZI A;  4R64 A;  4I2C A;  4I2D A;  2KP7 A;  3EPI A;  1WOT A;  5TZV A;  3OJU A;  4JV2 A;  8ICU A;  2NRT A;  4YG2 A;  4DL3 A;  4PHA A;  1Z00 B;  5KFX A;  5KFM A;  1LV5 A;  7ICG A;  5KT7 A;  4BWJ A;  5J0U A;  3LWM A;  4F2S A;  2BE3 A;  4X4R A;  4KLD A;  4QW9 A;  4MEY A;  5J2A A;  4YR0 A;  1TK5 A;  3V6K A;  4M6W A;  9ICV A;  1LB2 B;  1BNP A;  4X0B A;  4F4W A;  1UEV A;  1NK7 A;  1S77 D;  4C8N A;  5J2F A;  2W9M A;  3JPO A;  4DQS A;  4AT7 B;  3Q8P B;  3V6H A;  2ZUB A;  2BCR A;  1XC9 A;  1D8Y A;  2FLN A;  1S0N A;  4F4K A;  2M2T A;  5HR9 A;  2FPL A;  1V9P A;  2Q0Z X;  5DG7 A;  3RJK A;  1QLN A;  2KZZ A;  3NGD A;  5J0T A;  2B21 A;  4RQ2 A;  2BCS A;  5EWE A;  1UT8 A;  4RUC A;  5KG7 A;  5HHI A;  2ZUD A;  1Y88 A;  4RUA A;  4ELT A;  3JPQ A;  3TAN A;  8ICF A;  3AQL A;  3ETL A;  5KFD A;  4QZD A;  5J2J A;  3MGH A;  2NRK A;  1CUK A;  1BPD A;  2RDJ A;  4IQT A;  5DDM A;  1NKE A;  2R8J A;  3UQ0 A;  3K4G A;  2BCQ A;  4MFA A;  4X5V A;  4DQR A;  3QZ8 A;  4RQ6 A;  3MR6 A;  4DFJ A;  4RQ8 A;  4DL7 A;  3RJJ A;  2JEI A;  4LVS A;  3PVX A;  1TFR A;  3OGU A;  4FHV A;  4DEZ A;  2HHT A;  7ICI A;  4X4Q A;  2ZTD A;  5KFW A;  4KLL A;  3AQK A;  8ICR A;  3RB0 A;  1ZQV A;  5DBB A;  3BJY A;  4EZ6 A;  5CA7 A;  4J9N A;  1JQR A;  3LDA A;  4Z6F A;  2NRZ A;  4E7X A;  5KFC A;  4UAZ A;  2LYH A;  3H7I A;  3GDX A;  5J29 A;  1MQ2 A;  2BKE A;  3V72 A;  4ECZ A;  2JEF A;  1MIY A;  1KFD A;  4DWI A;  5KFI A;  3RR8 A;  3RBD A;  4MEX A;  4O0I A;  4I27 A;  4DSF A;  4XRH A;  5KT2 A;  9ICW A;  4FS1 A;  9ICX A;  4QWB A;  5J2C A;  3OHB A;  1ZQY A;  4M9H A;  5HMM A;  4J9L A;  4GC6 A;  5DBA A;  4WC3 A;  8ICB A;  4FS2 A;  2W8L A;  4F4Z A;  4I29 A;  4KLI A;  2F1I A;  3PO4 A;  7ICF A;  5KFN A;  3C2L A;  4J9S A;  2BGW A;  3OVA A;  2V4R A;  1ZQK A;  3PR4 A;  2RFF A;  4Q45 A;  5KFT A;  3AUO A;  8ICO A;  4RU9 A;  1PX5 A;  3ZD9 A;  1XSN A;  2C22 A;  5DB7 A;  5IIK A;  4Z6C A;  1SL2 A;  4ECX A;  4ECY A;  1ZQX A;  1JXL A;  1SZP A;  1ZQJ A;  3V6J A;  2FMS A;  2FPM A;  2PI4 A;  4KLT A;  8ICL A;  5DG9 A;  5HP4 A;  7ICP A;  5KT5 A;  4X4T A;  4ECS A;  4O3O A;  3KHL A;  3ISC A;  2UVW A;  4WC0 A;  1Z00 A;  5IIN A;  1X9M A;  4ED2 A;  5DG8 A;  4EBD A;  9ICP A;  9ICB A;  5DLG A;  3C66 A;  4WBY A;  3WFP A;  4ECT A;  2BCU A;  4Z6D A;  8ICZ A;  2HHW A;  4QZF A;  2AGO A;  1MIV A;  2DFL A;  3H8W A;  4DFK A;  3QE9 Y;  3RJG A;  2ZJ8 A;  4ELU A;  4WBZ A;  7ICH A;  4FBU A;  4F3O A;  1DK3 A;  4RWP A;  3UPQ A;  4P2H A;  4PHP A;  4YP3 A;  4TQS A;  3H4D A;  1JXE A;  4C8K A;  1BPB A;  4QWE A;  4DL6 A;  5HRL A;  3B0X A;  2ASL A;  4M9J A;  3OSP A;  3OV7 A;  4ECU A;  8ICA A;  4ED0 A;  5KFQ A;  2HHV A;  3TAQ A;  4B9V A;  1KSP A;  8ICN A;  5HRH A;  2ALZ A;  9ICH A;  4QZ8 A;  5J0X A;  4YD2 A;  1K1S A;  2P6R A;  4JWM A;  3HPO A;  3PMN A;  4J9Q A;  4KTQ A;  3ZDC A;  1OU5 A;  3PV8 A;  3IHQ B;  4IQV A;  3KHG A;  3RJF A;  4QZ9 A;  4NKT A;  3ZD8 A;  4NXZ A;  2VA3 A;  2KFZ A;  3EZ5 A;  1SKS A;  1QSL A;  2C2D A;  3UQ2 A;  1ZJN A;  1X9S A;  5HML A;  3MR2 A;  3TQ1 A;  4EBJ A;  7ICU A;  4PH5 A;  4MF2 A;  3H8S A;  2W9A A;  3M9M B;  3RJH A;  5KG0 A;  2PBE A;  4WC2 A;  4PHE A;  1U48 A;  3HT3 A;  3BQ2 A;  8ICI A;  4QWA A;  4YMN A;  2DPI A;  3LK9 A;  3ISD A;  5KG5 A;  1XSL A;  2PFN A;  4UAY A;  4I2H A;  2DR8 A;  4EP7 A;  2Y1I A;  3AQM A;  4E80 A;  2FLP A;  1ZQZ A;  4FHP A;  4QW8 A;  2BHN A;  5KFK A;  4YR2 A;  4DOC A;  3OJS A;  3RTV A;  4O3S A;  4M04 A;  5HRB A;  2FPK A;  3GV7 B;  2KZ3 A;  3OUY B;  4QWD A;  4YQW A;  4R65 A;  1TV9 A;  9ICG A;  1U9L A;  1N56 A;  4RNM A;  4RPX A;  2VAN A;  7ICL A;  5DQG A;  4BDP A;  2ZJA A;  5HNK A;  2XY7 A;  4JK1 A;  5IIJ A;  2ASJ A;  2ZH6 A;  4UB3 A;  4F4X A;  2F1H A;  4X4P A;  4RWN A;  3GIK A;  3PW2 A;  3M9N B;  2ID1 A;  3FDS A;  5HC9 A;  9ICQ A;  3C18 A;  5DB8 A;  3EPG A;  1H38 A;  1UA0 A;  4JUZ A;  4UD5 A;  2DRB A;  4R8U B;  5J2B A;  2HHU A;  3H3A A;  2IHM A;  4K4I A;  3AQN A;  3HJ1 A;  3WFQ E;  4IG8 A;  5J0Y A;  4FO6 A;  4KLF A;  2HHP A;  4YMM A;  4NLG A;  4F4Y A;  1ZQR A;  1UET A;  1ZQD A;  4WCW A;  1BPX A;  9ICM A;  5JUM A;  3C2K A;  3HIY A;  8ICM A;  2PFP A;  4FH5 A;  5KFO A;  3L9D A;  4M9G A;  4YVZ A;  3GIL A;  2PXI A;  3RR7 A;  8ICG A;  1BPE A;  4O3R A;  1L3U A;  2C2R A;  3JZ0 A;  3LQC B;  3B0Y A;  1L3V A;  3RB6 A;  4X4U A;  1L3S A;  2WTF A;  1TAQ A;  4P4O A;  2J6S A;  4EBK A;  4X4S A;  2DR7 A;  4J9M A;  5J0Q A;  3EYZ A;  3AU6 A;  4DFP A;  2ATL A;  4BXO A;  5KG6 A;  3NTU A;  3PW5 A;  3LWL A;  4NM1 A;  1TK0 A;  4J9R A;  3MDC A;  2PI5 A;  4F5R A;  2XY5 A;  3C5G A;  3GV8 B;  5L1I A;  4ED6 A;  4ZH4 A;  5D49 A;  1QTM A;  4B9S A;  7ICN A;  8ICK A;  2DRA A;  4R8U A;  4ECV A;  5KFB A;  2P66 A;  3KTQ A;  4P4M A;  5DLF A;  5DEC A;  4BGD A;  2NRV A;  2OWO A;  1NK8 A;  1VJ7 A;  5KFY A;  1KRP A;  1NK0 A;  3UXO A;  4DF4 A;  1ZQB A;  4QZA A;  2ZH1 A;  3FYH A;  3GQC A;  1BVS A;  4KLE A;  5KFP A;  2AU0 A;  5L1K A;  4J9K A;  2IBK A;  2R8G A;  1Q79 A;  4AT9 A;  3RJE A;  1ZQU A;  2I1Q A;  3Q8R B;  3TAR A;  5DGB A;  5EWG A;  4EBC A;  1L3T A;  4I28 A;  4YD1 A;  3SV4 A;  1RXV A;  3V7J A;  1XO1 A;  2XGQ A;  2KTQ A;  2VA8 A;  2ZH7 A;  3WFS C;  4UBB A;  1X2I A;  1RYR A;  2P6U A;  7ICM A;  1TFW A;  2KFN A;  3H40 A;  3Q8S B;  2J6T A;  2XO7 A; 
#chains in the Genus database with same CATH topology
 5G5H A;  5KL1 B;  2WF5 A;  4RWQ A;  4Q44 A;  1HUZ A;  1Q8K A;  1KKX A;  5EWF A;  4LEW A;  5CP2 A;  1B43 A;  4Y2T A;  8ICJ A;  3NKU A;  2BQ3 A;  5KAF U;  1OUQ A;  3GIJ A;  2ZTC A;  3IG5 A;  1S10 A;  2R18 A;  5J0P A;  1UA1 A;  8ICV A;  1KDH A;  4B9M A;  1BPY A;  2DF4 B;  1XWL A;  2VKQ A;  4QZH A;  4MFF A;  4PGQ A;  4IR1 A;  4DQI A;  4NLC A;  5EE9 A;  2W9C A;  1ZQG A;  3NWI A;  4F91 B;  4G3I A;  4UB4 A;  2QAR B;  4RQ5 A;  2W3S A;  5AIC A;  2IA6 A;  5KG3 A;  4K4G A;  2H5X A;  3HWT A;  1QQ5 A;  4NLK A;  3CP8 A;  3C21 A;  5JTI A;  1MC8 A;  4I2F A;  4EEL A;  3SMV A;  3MFI A;  5JRT A;  3H38 A;  1KFT A;  4NL9 A;  5KFL A;  4IRK A;  4CNQ A;  3DEE A;  4KN4 A;  3D2N A;  2M0N A;  1WG8 A;  3IRU A;  1N5W A;  3WKD A;  1ZQA A;  4RQ3 A;  3A0H U;  1B22 A;  1TAM A;  1ZRM A;  5L1L A;  4HAI A;  2MRL A;  2MUT A;  5KFG A;  3CNH A;  4CCH A;  4PL1 A;  3TAP A;  5KFF A;  3N4M B;  4DS4 A;  2BQR A;  4GIB A;  2ZIX A;  2K8C B;  5KT4 A;  5GTH U;  2CRX A;  4I2B A;  3V7K A;  3C5F A;  1BGX T;  3VCB A;  2KN7 A;  5AKG A;  3KHH A;  3I28 A;  3H4B A;  2BQU A;  3ZDB A;  4U7C A;  2AQ0 A;  3RB3 A;  4NXX A;  4M9N A;  1JRP A;  7ICS A;  4K96 A;  1FA0 A;  2M2W A;  4CDG A;  4Y2X A;  3HIL A;  2I6X A;  1SL0 A;  3PW7 A;  3NUQ A;  4AP9 A;  3U26 A;  4DF8 A;  4ED8 A;  2L5Y A;  4NXW A;  5CWR A;  4Q43 A;  4DSE A;  2W9C B;  3TAC B;  5CEH A;  2BR0 A;  2JEJ A;  4QZC A;  2AJQ A;  1RYU A;  3Q8L A;  3V7L A;  2W03 A;  4NL9 C;  3PNC A;  4B9N A;  4EYH B;  4UBC A;  1NI3 A;  4B9T A;  4ELV A;  1RYS A;  1S97 A;  2E8P A;  4O5C A;  2MAX A;  1JAJ A;  2K60 A;  2Y0S C;  4TUS A;  4YN4 A;  4NLN A;  2JEG A;  4Y2Y A;  2HBM A;  2BPF A;  2LM4 A;  2XGP A;  3BS5 A;  4GLX A;  5FP0 A;  2W9B B;  2OHF A;  3QX7 A;  3F2D A;  1EXN A;  4WC6 A;  1WWU A;  3AQF A;  4UD4 A;  5KFZ A;  4YR3 A;  1RZT A;  3CRX A;  9ICF A;  4C7Z A;  4F8R A;  4GXJ A;  4X0A A;  3TFS A;  4UQG A;  5KG2 A;  4J03 A;  2KNJ A;  9ICI A;  1PUZ A;  3G6V A;  2IOF K;  2QKQ A;  4K9B A;  1Z3E B;  4CF4 A;  2YQE A;  1FFV A;  3OPX A;  4B9L A;  5AI0 A;  4ACO A;  4ECW A;  1UPH A;  2C28 A;  5DBC A;  4EED A;  2IMW P;  4F5N A;  2OH2 A;  3Q8K A;  2XCP A;  3SAF A;  5KG4 A;  5J0S A;  4KLU A;  3ER8 C;  2O5A A;  4KLM A;  1UQV A;  1N63 A;  4F5O A;  4UB1 A;  5L9X A;  4FE3 A;  2XY6 A;  2IOH A;  2MUT B;  5AIB A;  4IR9 A;  7ICE A;  2RRD A;  3OSN A;  4LZG A;  4JLZ A;  5T14 A;  2VJ4 A;  1MSW D;  2OM6 A;  2WB1 F;  2NRW A;  4K9A A;  1ZQP A;  2Q4T A;  3GZF A;  4OJ5 A;  5KFS A;  5KG1 A;  2XC9 A;  2B4V A;  3SEN A;  4RQ1 A;  2QAR A;  4LT6 A;  1ZD2 P;  4TUQ A;  1XSP A;  4XQ7 A;  4WC4 A;  4I2D A;  2KP7 A;  1SIJ A;  3OJU A;  1KQQ A;  5KFM A;  5J0U A;  1LB2 B;  1UEV A;  3D2S A;  5J2F A;  1SXD A;  3V6H A;  2BCR A;  1XC9 A;  1D8Y A;  4WQK A;  3NVO A;  2Q0Z X;  1A6S A;  2H3Z A;  3SAG A;  2B21 A;  1RQN A;  4RUC A;  2ZUD A;  4ELT A;  5AM1 A;  3TAN A;  4UAU A;  8ICF A;  5AM0 A;  3AQL A;  3L4P A;  3MGH A;  3UQ0 A;  2LPE A;  3K4G A;  4DQR A;  4RQ6 A;  3MR6 A;  1ECW A;  4DL7 A;  1HIW A;  2JEI A;  4BJQ A;  3KKA A;  1QCK A;  1TFR A;  4FHV A;  4DEZ A;  4F71 A;  1LKY A;  4UW9 A;  5ALR A;  2ZIX B;  1TE2 A;  3AM9 A;  5KFC A;  3H7I A;  3BQ7 A;  3KBB A;  3KD3 A;  4EEB A;  1X9X A;  2E5S A;  1MIY A;  4N7R A;  4DSF A;  1V97 A;  4FS1 A;  4QWB A;  2W8L A;  4F4Z A;  2F1I A;  2JV3 A;  3C2L A;  2BGW A;  1SXE A;  3PR4 A;  2RFF A;  3AUO A;  4RU9 A;  2C22 A;  5DB7 A;  7ICO A;  2KVS A;  1JXL A;  1SZP A;  2KV2 A;  2FMS A;  7ICP A;  5DG9 A;  4X4T A;  4O3O A;  3KHL A;  9ICP A;  2RQ5 A;  5AKK A;  5ALV A;  4Z6D A;  8ICZ A;  4CF5 A;  4WBZ A;  3TKA A;  2LBO A;  4USA A;  3UPQ A;  4QWE A;  1T3Q A;  4ECU A;  4ED0 A;  5AKL A;  2RLT A;  3QU4 A;  2N1R A;  4QZ8 A;  3PMN A;  3ZDC A;  3PV8 A;  2YX8 A;  4IQV A;  3KHG A;  4NXZ A;  1SKS A;  2C2D A;  5HML A;  2ZIV B;  3MR2 A;  5AK3 A;  4MF2 A;  3M9M B;  4WC2 A;  3FM9 A;  3HT3 A;  3ALR A;  2DPI A;  4LEV A;  2Y1I A;  1PK1 A;  4O3M A;  2FJ6 A;  4YR2 A;  4DOC A;  4O3S A;  2FPK A;  2KZ3 A;  4QWD A;  4YQW A;  1U9L A;  1N56 A;  4F72 A;  4RPX A;  4BDP A;  5HNK A;  2XY7 A;  5IIJ A;  2ZH6 A;  4UB3 A;  2F1H A;  2B0C A;  1YT3 A;  4OCZ A;  2DBY A;  1H38 A;  3WK9 A;  5J2B A;  5AM3 A;  1J2M A;  3AQN A;  1GO3 F;  4IG8 A;  2KKP A;  4YMM A;  4EX7 A;  4NLG A;  1ZQR A;  1UET A;  1ZQD A;  9ICM A;  3HRD D;  4QIW C;  4C4R A;  3N7S C;  1OXJ A;  2PFP A;  4G9B A;  5GTI U;  3RR7 A;  1BPE A;  2F44 A;  2C2R A;  2EZZ A;  2LYA A;  2KSO A;  3B0Y A;  3RB6 A;  2WTF A;  4X4S A;  2D3D A;  3AU6 A;  1PVR A;  2XY5 A;  3GV8 B;  5D49 A;  1QTM A;  3C29 A;  4B9S A;  4P0Q B;  5DLF A;  1SWW A;  3SEI A;  2OWO A;  1M6Y A;  1N5X A;  3FYH A;  3GQC A;  1BVS A;  4KLE A;  5KFP A;  2IBK A;  1SZH A;  3E58 A;  2K8B B;  1J97 A;  5EWG A;  1L3T A;  1RXV A;  3SV4 A;  1RDF A;  2Z7J A;  3N7P D;  2VA8 A;  4UBB A;  4C4T A;  1UCV A;  3NRZ A;  2P6U A;  2EQY A;  4DSI A;  4NKU A;  5ALO A;  3DV9 A;  4NV0 A;  2QB1 A;  1NJX A;  2KD1 A;  4XQ8 A;  2K4I A;  5D63 A;  3F5A A;  3SYZ A;  4FH3 A;  4DFD A;  2M9N A;  2HSZ A;  3AQE A;  4DOA A;  2NRX A;  4ED1 A;  3RB4 A;  1QSS A;  4KLG A;  2DR9 A;  1L5U A;  3T5J A;  4NLZ A;  3H8J A;  3I76 A;  3OVS A;  3C1Z A;  3H39 A;  1ZQL A;  4F93 B;  3WK7 A;  4DFM A;  2ZJ5 A;  3N7R C;  9ICE A;  4WC1 A;  2UVV A;  2RP5 A;  4PPX A;  2QB0 B;  4O3P A;  4M47 A;  2CXY A;  4OAF A;  2NYV A;  1TKD A;  7ICQ A;  4OAG A;  1C7Y A;  5J2E A;  1IM4 A;  2Y9T A;  3UXN A;  1XS9 D;  9ICT A;  3JPS A;  3SAH A;  2HN1 A;  2ZHA A;  2IOF A;  4BX9 C;  4NLB A;  1HJP A;  3ISB A;  9ICK A;  8ICT A;  2M2U A;  4ICA A;  4UB5 A;  3E2E A;  2GLE A;  1FEZ A;  3EF2 A;  2HHQ A;  5ALX A;  4F5P A;  5AM2 A;  2FMP A;  5E79 U;  5IIL A;  1NJY A;  3UXP A;  5ALZ A;  1S5L U;  1KLN A;  3ERC C;  5AI5 A;  2FMQ A;  4K97 A;  3C28 A;  8ICC A;  2FI1 A;  2YMM A;  3UPS A;  4X4N A;  5D46 A;  1T3N A;  2E1E A;  3K1R B;  4R66 A;  3J81 j;  1X40 A;  4DO9 A;  4I2E A;  3G6Y A;  3T3F A;  8ICE A;  3WFO A;  4QZG A;  1DOQ A;  8ICQ A;  2XID A;  2DWQ A;  9ICA A;  2YTU A;  4DL4 A;  3BQ0 A;  2VIX A;  4RPZ A;  5EOZ A;  1XNS A;  4M5D A;  4O9M A;  1N48 A;  4RNN A;  4X4P A;  2HDO A;  3JPP A;  4KN7 A;  5DB6 A;  4M6W B;  4IQW A;  4EX6 A;  4K4H A;  2M2V A;  2F8K A;  1JN3 A;  3UM9 A;  2HHX A;  3NVY A;  4IRC A;  5IIO A;  3LVV A;  4YXM A;  4O3Q A;  1D9F A;  4NXU A;  4IQU A;  4GXI A;  1KN5 A;  1U45 A;  2V4Q A;  1SKW A;  4FBT A;  4AT8 B;  3QEB Z;  5AI4 A;  3OUY A;  2Q66 A;  2ZIW A;  5J8Y A;  1HUO A;  5ALK A;  2EZY A;  1DXS A;  3H0M B;  3SV3 A;  1COO A;  1X9W A;  2ASD A;  1NK6 A;  1URJ A;  2W3R A;  2MSN A;  4BWM A;  1X6I A;  2NV3 A;  3GFK B;  3NS1 A;  8ICS A;  2KZM A;  3RH5 A;  2BDP A;  1S9F A;  4CGZ A;  5KFJ A;  5CHG A;  1R8B A;  4YMO A;  3PR5 B;  2ZH2 A;  1A77 A;  5DDY A;  9ICU A;  4F50 A;  4RQ7 A;  5HRI A;  3RAQ A;  4KLO A;  1JUD A;  4OJ6 A;  5C5J A;  4NWI A;  5B3Q A;  5K4L A;  2R8K A;  3QEA Z;  4I2J A;  5AM4 A;  3HW8 A;  2UVR A;  2HN2 A;  3MGI A;  4Y2S A;  2KMD A;  4Y2P A;  2HI0 A;  4NM2 A;  3G6X A;  1VJ5 A;  1ARO P;  1VLB A;  1OW5 A;  2PMZ F;  1Q46 A;  4C8O A;  9ICR A;  3O0F A;  1HEK A;  2GOL A;  4HYK A;  4DSL A;  2AXT U;  4GXK A;  3HJE A;  1WUD A;  4P4P A;  5J0O A;  3MDA A;  2ZHB A;  1NKC A;  4O5K A;  3ETR A;  2G5H B;  3UMC A;  4RQ4 A;  2R8H A;  1TAU A;  4M9L A;  4F2R A;  4EEK A;  2AQ4 A;  4FHY A;  2F76 X;  3K7D A;  4YCX A;  3RRG A;  3HJ4 A;  4DOB A;  5HRE A;  3WK4 A;  2XVT A;  4C7Y A;  3QU9 A;  1DRG A;  5F9L A;  1T7P A;  5AKE A;  3MFH A;  2H3F A;  1MQ3 A;  2HOQ A;  5B5E U;  3T79 A;  4M0A A;  2KVC A;  4KLJ A;  3NRW A;  2W11 A;  8ICU A;  2NRT A;  4YG2 A;  7ICG A;  1Q3U A;  4BWJ A;  2BE3 A;  4X4R A;  1Z4N A;  1IV8 A;  3F2C A;  1TK5 A;  3PSI A;  4M6W A;  1BNP A;  3H8M A;  3JPO A;  4AT7 B;  3Q8P B;  1FFU A;  4F4K A;  2M2T A;  3RJK A;  2BCS A;  2KK0 A;  4CE6 A;  1Y88 A;  4QZD A;  3QU5 A;  5KFD A;  5J2J A;  1K5O A;  1CUK A;  2RDJ A;  5DDM A;  2OCE A;  2R8J A;  3RJJ A;  2OXO A;  2WF7 A;  2XI9 A;  3KKA C;  5KFW A;  4KLL A;  3AQK A;  2G09 A;  8ICR A;  3RB0 A;  5DBB A;  3BJY A;  3D2Q A;  4EZ6 A;  4IC9 A;  2LYH A;  1V38 A;  2BKE A;  2W54 A;  4ECZ A;  4Y2V A;  3TAD C;  4CRX A;  3RR8 A;  4O0I A;  4XRH A;  5KT2 A;  9ICX A;  5J2C A;  2ODG A;  4M9H A;  5HMM A;  3M7D A;  4J9L A;  1MN8 A;  5DBA A;  8ICB A;  4O69 A;  3AMZ A;  3DDH A;  1ZQK A;  5KFT A;  3ZD9 A;  3L3F X;  4ECX A;  4AT8 A;  2FPM A;  5KT5 A;  2WAQ C;  3KZI U;  4ECS A;  3ISC A;  4NXV A;  4E8F A;  4QJF B;  3WFP A;  2ZJ8 A;  2CPR A;  1DK3 A;  1YZ6 A;  4F3O A;  4P2H A;  4TQS A;  4C8K A;  4DL6 A;  2ASL A;  2HOF A;  3TAQ A;  8ICN A;  5HRH A;  9ICH A;  3SR6 A;  5J0X A;  1QQ6 A;  3IHQ B;  3LVW A;  3ZD8 A;  3EZ5 A;  1X9S A;  1ZJN A;  2WF9 A;  2HCF A;  2RHF A;  4UAV A;  3TQ1 A;  1Z19 A;  7ICU A;  4PH5 A;  2W9A A;  3RJH A;  5KG0 A;  1U48 A;  3BQ2 A;  2K8A A;  3ISD A;  4UAY A;  3AQM A;  3M1Y A;  4FHP A;  2HBL A;  3F2B A;  5AKX A;  3N28 A;  4M04 A;  3PZP A;  2P35 A;  4K8V A;  4RNM A;  5DQG A;  4JK1 A;  2ASJ A;  3M9N B;  3FDS A;  1UHU A;  3C18 A;  5HC9 A;  4UD5 A;  3EPG A;  2DRB A;  4R8U B;  2HHU A;  4UB6 U;  2GAF D;  4K4I A;  3H3A A;  1ZXI A;  4FFD A;  2JRZ A;  2HHP A;  5AI8 A;  3AL0 B;  1SV0 A;  4FH5 A;  1WWV A;  5KFO A;  3K1Z A;  3GIL A;  3ZI4 A;  3L5K A;  3HKZ C;  2E1F A;  3JZ0 A;  4NXT A;  2KJ5 A;  1L3V A;  4X4U A;  1L3S A;  1TAQ A;  4P4O A;  4EBK A;  5J0Q A;  2ATL A;  4BXO A;  3NTU A;  3PW5 A;  3LWL A;  2DGZ A;  3MDC A;  4J9R A;  2PI5 A;  5L1I A;  3BS5 B;  4US9 A;  5HR7 A;  4ED6 A;  4IS7 A;  7ICN A;  8ICK A;  2P66 A;  5DEC A;  3SD7 A;  4DF4 A;  4AT9 A;  2G0A A;  5EE3 A;  3RJE A;  4Y2R A;  2PMZ C;  5DGB A;  4I28 A;  1CI4 A;  2KFN A;  3ED5 A;  2J6T A;  2JEF A;  4EZ9 A;  1U4B A;  1WOT A;  5J2G A;  1PK1 B;  3UMG A;  4MKP A;  1J2N A;  1NK9 A;  2KIC A;  4ECR A;  3NAS A;  3ZDE A;  4ED7 A;  3M8S A;  2E8M A;  3SI8 A;  2JH1 A;  5C0Y A;  1L7P A;  1ZOL A;  3NVV A;  4U6P A;  2KE7 A;  2ZH1 A;  1NKB A;  4AT9 B;  4I0U A;  4Z6E A;  5H2F U;  1ZQQ A;  5D61 A;  5KL8 B;  5ALD A;  7ICJ A;  2Y9U A;  2E8O A;  1RPL A;  1ZD3 A;  2A1J A;  2EAN A;  4QZB A;  1NZB A;  1SB3 C;  4I2G A;  4RPY A;  1ZQ1 C;  3Q8M A;  1QSY A;  2BDU A;  2IHN A;  4NY8 A;  4Q8F A;  2HVH A;  2GO7 A;  4RQ0 A;  1VFG A;  1L7M A;  3T5K A;  5KFR A;  3E0F A;  5KFE A;  5B66 U;  5A0L A;  1TK8 A;  1ZET A;  4BUG A;  3IDW A;  4DL2 A;  1JIH A;  5B3P A;  9ICL A;  2A1J B;  2ZTE A;  2OEH A;  1PK3 A;  2F77 X;  2ZIU A;  4WH5 A;  1U49 A;  2YY6 A;  1BNO A;  2G5I B;  4RZR A;  3MR3 A;  3H37 A;  3TAD A;  3M8R A;  2OYY A;  3PML A;  2A1A A;  3MR5 A;  1D9D A;  2MA1 A;  5AI9 A;  5ALI A;  1ZQH A;  2H3Q A;  5BOL A;  3TFR A;  4KB6 A;  2K4E A;  4FZL A;  2PFQ A;  4DQQ A;  1NZP A;  5DQH A;  2YN4 A;  4OJP A;  3RAX A;  1KNY A;  4C8M A;  3HP6 A;  1KW4 A;  4PHD A;  2W9B A;  4P0P A;  3IM1 A;  4DLE A;  3OVB A;  2JGA A;  4TUR A;  5KT3 A;  4OAH A;  2W7P A;  2ZG6 A;  1JI7 A;  3LYS A;  5CJ7 A;  4EEN A;  1COK A;  4Q8E A;  4R63 A;  2EAP A;  5DB9 A;  1SGG A;  2VJ5 A;  4UAT A;  3RJI A;  1GPJ A;  2ZXI A;  2KG5 A;  4EYI B;  2YMP A;  2PFO A;  3ZDA A;  4OO1 J;  4J9P A;  9ICO A;  4FZM A;  4UAR A;  4O5E A;  3ER9 B;  3PW0 A;  3QXG A;  4RQM A;  5J0W A;  4F5Q A;  4YFK A;  3QNM A;  1R8C A;  1BPZ A;  3MGV A;  3BQ1 A;  1ZQW A;  2I5H A;  5DGA A;  3FC4 A;  2F3N A;  4WC5 A;  1O08 A;  4C80 A;  2XIC A;  4RQN A;  3JYY A;  3ZDD A;  3RH4 A;  4I2A A;  5HRD A;  4P0Q A;  2K89 A;  1L8O A;  2BPG A;  4BXO B;  8ICP A;  4XJE A;  5KFA A;  2DUY A;  3MC1 A;  3K75 D;  3PX6 A;  9ICS A;  4DQP A;  1UT5 A;  1N61 A;  1B0X A;  7ICR A;  3GIM A;  4PGX A;  3PX4 A;  4AT7 A;  1SV4 A;  2Y0S F;  2DL0 A;  2K4H A;  1RXW A;  1O03 A;  4X4O A;  4DSK A;  5ALQ A;  5J2K A;  4LZD A;  4O68 A;  2FE9 A;  2HHS A;  2V9W A;  1D8L A;  4B6J A;  5KT6 A;  3MAB A;  2GWS A;  3PW4 A;  1DGS A;  4WC7 A;  3SZ2 A;  1LKY B;  1MIW A;  3TI0 A;  3RH6 A;  4MFC A;  1K1Q A;  4KLH A;  1ZQS A;  5ALG A;  3M6K A;  4M2Y A;  8ICX A;  1DK2 A;  1ZQM A;  1CRX A;  3EW9 A;  4DLG A;  4O3N A;  9ICJ A;  3PX0 A;  1IXR A;  2MU2 A;  1F5A A;  1NJZ A;  2O6K A;  3OHA A;  3PHZ A;  2EAO A;  5KFH A;  4S3N A;  1S0V A;  4LEY A;  4QZI A;  4I2C A;  3EPI A;  5KAI U;  4O6A A;  3WK6 A;  3BZC A;  5KFX A;  1Z00 B;  5KT7 A;  3LWM A;  4F2S A;  5J2A A;  9ICV A;  1DGJ A;  2QLT A;  2W9M A;  4DQS A;  2ZUB A;  4C0Z A;  2FPL A;  1V9P A;  2KZZ A;  3NGD A;  5EWE A;  1UT8 A;  2W04 A;  5HHI A;  1QH9 A;  3JPQ A;  4GFJ A;  5AKY A;  4IQT A;  4RQ8 A;  1Q3V A;  5AM5 A;  4LVS A;  3PVX A;  4P0P B;  3OGU A;  7ICI A;  2ZTD A;  1F0M A;  2LYB A;  4J9N A;  3FAH A;  2NRZ A;  2B56 A;  4UAZ A;  3GDX A;  5ALH A;  5J29 A;  5G5G A;  3V72 A;  1KFD A;  3WKB A;  5KFI A;  4A8E A;  3RBD A;  9ICW A;  3I1Y A;  3OHB A;  5ALY A;  1FO4 A;  4GC6 A;  4FS2 A;  3BZK A;  3SQI A;  4KLI A;  4JB3 A;  3PO4 A;  4J9S A;  1B4F A;  1PX5 A;  1SL2 A;  4PL2 A;  4Z6C A;  1ZQJ A;  2D8C A;  1ZQX A;  1N60 A;  2CN1 A;  3V6J A;  4KLT A;  3QU7 A;  2ZIU B;  2BZF A;  2UVW A;  4OJO A;  1L8L A;  2KHQ A;  1X9M A;  5DG8 A;  4EBD A;  3C66 A;  2KHV A;  2AH5 A;  4ECT A;  2BCU A;  2KIW A;  2YB1 A;  1V85 A;  3PST A;  2AGO A;  3H8W A;  4DFK A;  3RJG A;  4ELU A;  7ICH A;  4FBU A;  4PHP A;  3H4D A;  1JXE A;  5HRL A;  1BPB A;  5AKZ A;  3OV7 A;  3B0X A;  3OSP A;  4AYB C;  4OAI Z;  8ICA A;  4YD2 A;  1K1S A;  1F44 A;  4JWM A;  3HPO A;  4J9Q A;  3IP4 B;  2HOI A;  1OU5 A;  5AKH A;  4QZ9 A;  2VA3 A;  2KFZ A;  1QSL A;  2WFA A;  3H8S A;  2PBE A;  4PHE A;  2PFN A;  3LK9 A;  4I2H A;  1XSL A;  4E80 A;  4DCC A;  3QUB A;  2WB1 C;  3PSP A;  3OJS A;  3RTV A;  2LKY A;  1TV9 A;  2VAN A;  3S6J A;  1SWV A;  2ZJA A;  3WK5 A;  4RWN A;  3OWG A;  3GIK A;  2ID1 A;  2GH1 A;  5DB8 A;  4NJ8 A;  1UA0 A;  4JUZ A;  3WFQ E;  1IG6 A;  3HJ1 A;  5J0Y A;  3WKE A;  1L7O A;  4O67 A;  2W55 A;  3C2K A;  8ICM A;  3L9D A;  3BS7 A;  5ALT A;  2DR7 A;  4J9M A;  1KL9 A;  3KZX A;  3EYZ A;  4F5R A;  2WAQ F;  4R8U A;  5KFB A;  5EE1 A;  1L7N A;  4BGD A;  4OJL A;  2NRV A;  2AHO B;  1VJ7 A;  1KRP A;  1NK0 A;  3UXO A;  1ZQB A;  4QZA A;  2F2A B;  2AU0 A;  4J9K A;  2R8G A;  3Q8R B;  4JMU A;  2ES6 A;  2B6G A;  5EE0 A;  4YD1 A;  3WFS C;  4UAS A;  3V7J A;  2EH9 A;  2XGQ A;  2ZH7 A;  5ALM A;  2KOB A;  1Q78 A;  3F5E A;  3Q8S B;  3AN1 A;  5ALP A;  1S8O A;  1T8E A;  2I9G A;  4QNL A;  4DL5 A;  2ZH3 A;  5AK5 A;  3B9J A;  1F5S A;  3C1Y A;  1N62 A;  2BPC A;  1R89 A;  3N97 B;  3EWA A;  2HVI A;  1P7D A;  3ONN A;  3C2M A;  3RF9 A;  2KIV A;  1T94 A;  1ZQO A;  5HRK A;  4RNO A;  1V4A A;  1CEZ A;  2Y1J A;  1KTQ A;  1Z4O A;  4IRD A;  4UB2 A;  4DSJ A;  2HBJ A;  3MCR A;  4ATB A;  2DVI A;  3RFA A;  3D6J A;  3QUQ A;  4LJX A;  2EZX A;  5CR0 A;  2DQN B;  2FLL A;  5DED A;  4I2I A;  1PVP A;  3GV5 B;  1TFY A;  8ICW A;  5ALW A;  5CRX A;  4MF8 A;  2FDR A;  2DKX A;  2E8N A;  2ZH9 A;  2JZB A;  4MHV A;  3T5H A;  2WHE A;  2EWR A;  4WQL A;  2ESE A;  4UB8 U;  7ICK A;  1ZQN A;  1PVQ A;  4WJ3 B;  4RT3 A;  1YLQ A;  4FO1 A;  4PZO A;  1S0M A;  1KFS A;  2ZH5 A;  5D4B A;  4ECQ A;  1JMS A;  2YML A;  2RDI A;  4ED3 A;  2F1J A;  8ICY A;  2KEY A;  2LHT A;  3THV A;  2B51 A;  4IL6 U;  1JX4 A;  9ICC A;  1ZQE A;  4TUP A;  2JZB B;  1NK4 A;  5BPC A;  4K99 A;  5HHH A;  2JH7 A;  5KTQ A;  3ORY A;  2HMX A;  1R8A A;  3BDP A;  5J8Y C;  1L6N A;  5AIA A;  1NK5 A;  5J0R A;  1T4G A;  3JPR A;  4EEY A;  4PGY A;  4B9U A;  4J9O A;  3WFR E;  3GII A;  1PZN A;  2C2E A;  1WYG A;  3PO5 A;  4GC7 A;  4C8L A;  1X66 A;  3BQT A;  3IG8 A;  3CW2 C;  4KLS A;  4X4V A;  1ZQC A;  4E0D A;  1U47 A;  3NVW A;  4K98 A;  5ALF A;  1C20 A;  1TVA A;  1SV0 C;  2F8L A;  4HX0 A;  3QU2 A;  2NO5 A;  1KEJ A;  2DPJ A;  5J2I A;  3R9K A;  3PY8 A;  1YZ7 A;  5CFT A;  2G08 A;  9ICN A;  2D6F C;  4JV0 A;  3Q8Q B;  2ZUC A;  2FCL A;  2GA9 D;  3H0L B;  3PSF A;  5CB1 A;  5ALE A;  4WOY A;  1XO0 A;  4XUS A;  4OD0 A;  1ZQI A;  1Z1B A;  5IIM A;  1ZYQ A;  3NYB A;  4Y2Q A;  2KJ9 A;  5DKW A;  5L1J A;  3RRH A;  1MA7 A;  3C23 A;  1JRO A;  4YXJ A;  4UAW A;  1D8B A;  2HW3 A;  3WU2 U;  5KFU A;  2ZIW B;  3CYM A;  5AK4 A;  2XCA A;  5CHE A;  5AKJ A;  2AGP A;  2JHD A;  4ATB B;  5BOM A;  3GU3 A;  1Z1V A;  2NO4 A;  2O1P A;  4KLQ A;  4F92 B;  3UMB A;  5DQI A;  7ICV A;  1WCN A;  1ED1 A;  2LM1 A;  3KHR A;  1RQL A;  1IIP A;  1ZQT A;  2UVU A;  1ZD5 A;  2BBH A;  2ISP A;  3QUC A;  1UEU A;  2EAM A;  3HX0 A;  3RBE A;  1S76 D;  2AGQ A;  3A0B U;  4XA5 A;  2KSO B;  2BCV A;  3JPT A;  3T5L A;  1NO5 A;  5III A;  3WK8 A;  2DR5 A;  1S0O A;  4RT2 A;  3AU2 A;  2WF8 A;  1VDV A;  5HRG A;  4KM5 A;  4QZE A;  3QZ7 A;  4QIW F;  1WCL A;  2VA2 A;  3IV6 A;  2ISO A;  4PZN A;  1ZJM A;  2E3T A;  4KIT B;  4LEZ A;  4FHX A;  2ZXH A;  4RWO A;  1NJW A;  4JV1 A;  3MBY A;  2J6U A;  3AEV A;  4FHW A;  5F2V O;  2ZIV A;  4TQR A;  4EGW A;  1SKR A;  5HRF A;  8ICH A;  1A76 A;  2R8I A;  5ALS A;  1NOM A;  2ZH8 A;  2ZH4 A;  4JWN A;  3WKA A;  1ZQF A;  4KMU A;  5F9N A;  2W8K A;  1ZRN A;  3JPN A;  3M9O B;  1XU4 A;  4DS5 A;  2K4P A;  5KFV A;  5J2H A;  4EBE A;  4EV6 A;  3F53 A;  1SL1 A;  4C4S A;  4QWC A;  5J2D A;  1RM6 C;  4R64 A;  5TZV A;  4JV2 A;  4DL3 A;  5AI6 A;  4PHA A;  1LV5 A;  2IHO A;  4KLD A;  4QW9 A;  4MEY A;  4YR0 A;  4X0B A;  3V6K A;  4F4W A;  5ALN A;  1NK7 A;  1S77 D;  4C8N A;  4ZOH C;  2FLN A;  1S0N A;  5HR9 A;  5DG7 A;  1QLN A;  5J0T A;  4RQ2 A;  5KG7 A;  4RUA A;  1A0P A;  2H3I A;  3ETL A;  2NRK A;  3NVZ A;  1BPD A;  4FZN A;  1NKE A;  5JU5 A;  2W43 A;  2BCQ A;  4MFA A;  4X5V A;  3QZ8 A;  3ICX A;  4DFJ A;  2G07 A;  1X6J A;  2A19 A;  2HHT A;  4X4Q A;  3M6Z A;  3QUT A;  2YMQ A;  3IN5 A;  3VC8 A;  1ZQV A;  1NNL A;  4CF3 A;  5AKI A;  5CA7 A;  1JQR A;  3LDA A;  4Z6F A;  4E7X A;  1MQ2 A;  3EUB 2;  5JTG A;  4DWI A;  4MEX A;  2HBK A;  5CFS A;  5F3X B;  4I27 A;  3H0R B;  1ZQY A;  4WC3 A;  4I29 A;  2W7O A;  3CK6 A;  7ICF A;  5KFN A;  2LI6 A;  5L1M A;  2V4R A;  1QQ7 A;  4Q45 A;  8ICO A;  2LMR A;  2KJ8 A;  1XSN A;  7ICT A;  5IIK A;  4KLF A;  4ECY A;  2YB4 A;  2PI4 A;  8ICL A;  5HP4 A;  5HR6 A;  4WC0 A;  1Z00 A;  5ALJ A;  5IIN A;  4ED2 A;  4WBY A;  4US8 A;  9ICB A;  5DLG A;  2QB0 A;  2HHW A;  4QZF A;  1MIV A;  2DFL A;  1N2X A;  3OVA A;  3QE9 Y;  4JLX A;  5ALL A;  4RWP A;  4YP3 A;  2DKZ A;  2BBJ A;  4M9J A;  5AK6 A;  5KFQ A;  2HHV A;  4B9V A;  1KSP A;  5D62 A;  2ALZ A;  2P6R A;  4KTQ A;  4AYB F;  3RJF A;  4NKT A;  3KFU F;  3UQ2 A;  4EBJ A;  1JAL A;  1KBU A;  4KMO B;  8ICI A;  5TIS U;  4QWA A;  4YMN A;  2DR8 A;  5KG5 A;  4EP7 A;  2JR5 A;  2FLP A;  1ZQZ A;  4QW8 A;  2BHN A;  5KFK A;  5HRB A;  3GV7 B;  2G06 A;  3OUY B;  4R65 A;  9ICG A;  1RG6 A;  7ICL A;  4F4X A;  4Y2U A;  1AQ6 A;  3PW2 A;  5CFU A;  9ICQ A;  1LVH A;  4KX3 A;  3OTQ A;  1FIQ A;  2KKV A;  2WF6 A;  4KX5 A;  2IHM A;  1ZD4 A;  3JCF A;  4FO6 A;  5ALU A;  2JMG A;  4F4Y A;  3QYP A;  4Y2J A;  4WCW A;  1BPX A;  5JUM A;  2EDU A;  3HIY A;  2A3V A;  5AHX A;  4M9G A;  4YVZ A;  2PXI A;  8ICG A;  4O3R A;  1L3U A;  3LQC B;  3WKC A;  5KNI A;  2J6S A;  2IUB A;  2JXJ A;  4DFP A;  5KG6 A;  4NM1 A;  1TK0 A;  3C5G A;  4ZH4 A;  2DRA A;  4ECV A;  3KTQ A;  4P4M A;  3KOO A;  1NK8 A;  5KFY A;  1X42 A;  4PJ0 U;  1Q79 A;  5L1K A;  2I1Q A;  1ZQU A;  3TAR A;  4EBC A;  1XO1 A;  2KTQ A;  1X2I A;  1RYR A;  2H3V A;  2PKE A;  3HKZ F;  7ICM A;  1TFW A;  3H40 A;  2XO7 A; 
#chains in the Genus database with same CATH homology
 4EZ9 A;  1U4B A;  4DSI A;  4NKU A;  5J2G A;  1T8E A;  2I9G A;  4DL5 A;  1NJX A;  1NK9 A;  2ZH3 A;  4XQ8 A;  4RWQ A;  4ECR A;  3ZDE A;  4Q44 A;  4ED7 A;  1HUZ A;  3SYZ A;  4FH3 A;  3M8S A;  2M9N A;  3C1Y A;  3SI8 A;  2BPC A;  1R89 A;  3N97 B;  4DOA A;  1NKB A;  2NRX A;  4AT9 B;  3EWA A;  5EWF A;  2HVI A;  5CP2 A;  1B43 A;  4ED1 A;  3RB4 A;  3C2M A;  1QSS A;  4Z6E A;  4KLG A;  1ZQQ A;  1ZQO A;  8ICJ A;  4RNO A;  1L5U A;  3T5J A;  5HRK A;  4NLZ A;  1V4A A;  2DR9 A;  3H8J A;  1CEZ A;  2Y1J A;  3OVS A;  3C1Z A;  7ICJ A;  2BQ3 A;  3H39 A;  1ZQL A;  3GIJ A;  3WFR E;  2ZTC A;  1KTQ A;  4F93 B;  1S10 A;  5J0P A;  1UA1 A;  4UB2 A;  4IRD A;  8ICV A;  4DSJ A;  4DFM A;  1KDH A;  2ZJ5 A;  4B9M A;  9ICE A;  1RPL A;  1BPY A;  4WC1 A;  2UVV A;  4ATB A;  2A1J A;  2DVI A;  4QZB A;  4PPX A;  1XWL A;  4QZH A;  4O3P A;  4M47 A;  4MFF A;  1TKD A;  4I2G A;  7ICQ A;  4PGQ A;  4RPY A;  5J2E A;  1C7Y A;  1IM4 A;  3Q8M A;  1QSY A;  5CR0 A;  2IHN A;  4NY8 A;  4Q8F A;  3UXN A;  1XS9 D;  4IR1 A;  4DQI A;  2HVH A;  3JPS A;  2W9C A;  1ZQG A;  2FLL A;  9ICT A;  4RQ0 A;  4F91 B;  5DED A;  4I2I A;  1VFG A;  3T5K A;  4G3I A;  4UB4 A;  2ZHA A;  4RQ5 A;  5KFR A;  3GV5 B;  1TFY A;  5KFE A;  8ICW A;  1HJP A;  3ISB A;  9ICK A;  8ICT A;  4MF8 A;  1ZET A;  1TK8 A;  2M2U A;  4UB5 A;  4DL2 A;  3E2E A;  1JIH A;  2ZH9 A;  2HHQ A;  9ICL A;  2A1J B;  7ICT A;  2ZTE A;  2JZB A;  3T5H A;  2IA6 A;  4F5P A;  2FMP A;  5KG3 A;  4K4G A;  2H5X A;  5IIL A;  3HWT A;  1NJY A;  1U49 A;  3UXP A;  1ZQN A;  4NLK A;  7ICK A;  3C21 A;  1BNO A;  1MC8 A;  4RZR A;  4RT3 A;  3MR3 A;  4I2F A;  3H37 A;  1YLQ A;  3M8R A;  1KLN A;  3PML A;  1S0M A;  3MFI A;  3MR5 A;  1D9D A;  1KFS A;  1ZQH A;  2FMQ A;  3H38 A;  1KFT A;  5KFL A;  4ECQ A;  1JMS A;  5D4B A;  4IRK A;  5BOL A;  8ICC A;  4KN4 A;  3TFR A;  2RDI A;  3UPS A;  2PFQ A;  5D46 A;  2F1J A;  4ED3 A;  1T3N A;  8ICY A;  4X4N A;  3THV A;  4R66 A;  4DQQ A;  5DQH A;  1ZQA A;  1NZP A;  1JX4 A;  4RQ3 A;  9ICC A;  1ZQE A;  4TUP A;  2JZB B;  1NK4 A;  1B22 A;  5L1L A;  4DO9 A;  1KNY A;  3RAX A;  4C8M A;  2MUT A;  5KFG A;  4I2E A;  5BPC A;  3HP6 A;  4CCH A;  3G6Y A;  3T3F A;  5HHH A;  4PHD A;  2W9B A;  8ICE A;  3WFO A;  3TAP A;  5KTQ A;  5KFF A;  3IM1 A;  3N4M B;  4DS4 A;  4QZG A;  2BQR A;  1DOQ A;  3ORY A;  8ICQ A;  4DLE A;  1R8A A;  3OVB A;  3BDP A;  9ICA A;  4AT8 A;  4TUR A;  4DL4 A;  5KT4 A;  5KT3 A;  4I2B A;  3BQ0 A;  1NK5 A;  5J0R A;  1T4G A;  3V7K A;  3JPR A;  3C5F A;  4RPZ A;  1BGX T;  2KN7 A;  4EEY A;  5EOZ A;  4PGY A;  5CJ7 A;  3KHH A;  4B9U A;  4M5D A;  4O9M A;  4Q8E A;  3H4B A;  4J9O A;  2BQU A;  4RNN A;  3GII A;  2AQ0 A;  3JPP A;  3RB3 A;  4KN7 A;  1N48 A;  3ZDB A;  1PZN A;  4R63 A;  5DB6 A;  5DB9 A;  4M9N A;  2C2E A;  3PO5 A;  4GC7 A;  4C8L A;  3BQT A;  4M6W B;  7ICS A;  1FA0 A;  4IQW A;  2M2W A;  4K4H A;  2M2V A;  3RJI A;  1JN3 A;  2HHX A;  1SL0 A;  4KLS A;  3PW7 A;  4IRC A;  5IIO A;  4X4V A;  1ZQC A;  4E0D A;  4YXM A;  4EYI B;  4DF8 A;  2PFO A;  4ED8 A;  4O3Q A;  1U47 A;  1D9F A;  3ZDA A;  4IQU A;  5CWR A;  4GXI A;  4Q43 A;  1TVA A;  1U45 A;  4J9P A;  2V4Q A;  4DSE A;  1SKW A;  1KEJ A;  2W9C B;  2DPJ A;  4FBT A;  7ICO A;  3QEB Z;  5J2I A;  9ICO A;  4AT8 B;  3OUY A;  3PY8 A;  2BR0 A;  2JEJ A;  4O5E A;  9ICN A;  4QZC A;  4JV0 A;  2AJQ A;  3Q8Q B;  3Q8L A;  2ZUC A;  3PW0 A;  1HUO A;  3V7L A;  2Q66 A;  5J0W A;  4F5Q A;  4YFK A;  4B9N A;  3PNC A;  1R8C A;  4EYH B;  5CB1 A;  1BPZ A;  3SV3 A;  4XUS A;  1COO A;  1ZQI A;  3BQ1 A;  1X9W A;  4UBC A;  5IIM A;  1ZQW A;  4B9T A;  4ELV A;  2ASD A;  1RYS A;  1ZYQ A;  1S97 A;  1NK6 A;  3NYB A;  4O5C A;  5DGA A;  2MAX A;  1JAJ A;  4BWM A;  5DKW A;  5L1J A;  4TUS A;  4YN4 A;  4WC5 A;  3RRH A;  3C23 A;  4NLN A;  2JEG A;  3GFK B;  2BPF A;  4YXJ A;  4UAW A;  8ICS A;  3JYY A;  2XGP A;  3ZDD A;  4GLX A;  3RH4 A;  4I2A A;  2KZM A;  2W9B B;  5HRD A;  2HW3 A;  2BPG A;  4BXO B;  8ICP A;  1EXN A;  3RH5 A;  5KFU A;  1S9F A;  5KFA A;  2BDP A;  5KFJ A;  5CHG A;  3PX6 A;  3K75 D;  2XCA A;  9ICS A;  4WC6 A;  2AGP A;  1R8B A;  4UD4 A;  4ATB B;  4YMO A;  3PR5 B;  5BOM A;  5KFZ A;  4YR3 A;  1UT5 A;  1RZT A;  4DQP A;  9ICF A;  2ZH2 A;  1A77 A;  5DDY A;  9ICU A;  7ICR A;  3GIM A;  4PGX A;  2O1P A;  4E8F A;  4F50 A;  4RQ7 A;  4F8R A;  5HRI A;  4KLQ A;  4GXJ A;  3RAQ A;  4KLO A;  4F92 B;  5DQI A;  3PX4 A;  5C5J A;  7ICV A;  1WCN A;  3TFS A;  4X0A A;  4UQG A;  2ZH5 A;  4AT7 A;  5KG2 A;  2R8K A;  9ICI A;  3QEA Z;  4I2J A;  3HW8 A;  2UVR A;  3G6V A;  3KHR A;  3MGI A;  1RXW A;  4X4O A;  1Z3E B;  4DSK A;  5J2K A;  1ZQT A;  2UVU A;  4NM2 A;  4LZD A;  3G6X A;  4B9L A;  4ECW A;  2HHS A;  1ARO P;  2V9W A;  2ISP A;  4C8O A;  1UEU A;  1D8L A;  2C28 A;  5DBC A;  9ICR A;  1Q78 A;  2IMW P;  4HYK A;  3HX0 A;  4DSL A;  3RBE A;  4GXK A;  4F5N A;  2AGQ A;  5KT6 A;  1S76 D;  4XA5 A;  3MAB A;  3Q8K A;  2XCP A;  2BCV A;  2GWS A;  5KG4 A;  5J0O A;  4P4P A;  3JPT A;  1DGS A;  3T5L A;  3PW4 A;  1NO5 A;  5III A;  5J0S A;  4KLU A;  3MDA A;  1S0O A;  2ZHB A;  4WC7 A;  2DR5 A;  2O5A A;  4KLM A;  4RT2 A;  3AU2 A;  1NKC A;  3SZ2 A;  4O5K A;  5HRG A;  4QZE A;  3QZ7 A;  1WCL A;  4F5O A;  2ISO A;  2VA2 A;  1MIW A;  4UB1 A;  5L9X A;  1ZJM A;  4KIT B;  4FHX A;  3TI0 A;  2XY6 A;  3RH6 A;  4RQ4 A;  4RWO A;  2MUT B;  2R8H A;  1NJW A;  1TAU A;  4IR9 A;  3MBY A;  2J6U A;  4JV1 A;  3OSN A;  4F2R A;  4LZG A;  4M9L A;  4MFC A;  7ICE A;  2AQ4 A;  1K1Q A;  4FHW A;  5F2V O;  4TQR A;  4KLH A;  1MSW D;  4FHY A;  1SKR A;  5HRF A;  8ICH A;  4YCX A;  2NRW A;  1A76 A;  1ZQS A;  2R8I A;  3RRG A;  3HJ4 A;  1ZQP A;  4M2Y A;  4DOB A;  1NOM A;  8ICX A;  1DK2 A;  2ZH8 A;  2ZH4 A;  1ZQM A;  4JWN A;  5HRE A;  1ZQF A;  4KMU A;  5F9N A;  3EW9 A;  4O3N A;  5F9L A;  2W8K A;  4DLG A;  3JPN A;  3MFH A;  3M9O B;  1T7P A;  1XU4 A;  5J2H A;  5KFV A;  4EBE A;  5KFS A;  5KG1 A;  4DS5 A;  1MQ3 A;  2XC9 A;  9ICJ A;  3PX0 A;  1IXR A;  4RQ1 A;  1NJZ A;  1F5A A;  3OHA A;  4LT6 A;  4TUQ A;  1XSP A;  1SL1 A;  4XQ7 A;  4M0A A;  4WC4 A;  5KFH A;  4S3N A;  1S0V A;  4QWC A;  5J2D A;  4KLJ A;  4QZI A;  4R64 A;  4I2C A;  4I2D A;  2KP7 A;  3EPI A;  1WOT A;  5TZV A;  3OJU A;  4JV2 A;  8ICU A;  2NRT A;  4YG2 A;  4DL3 A;  4PHA A;  1Z00 B;  5KFX A;  5KFM A;  1LV5 A;  7ICG A;  5KT7 A;  4BWJ A;  5J0U A;  3LWM A;  4F2S A;  2BE3 A;  4X4R A;  4KLD A;  4QW9 A;  4MEY A;  5J2A A;  4YR0 A;  1TK5 A;  3V6K A;  4M6W A;  9ICV A;  1LB2 B;  1BNP A;  4X0B A;  4F4W A;  1UEV A;  1NK7 A;  1S77 D;  4C8N A;  5J2F A;  2W9M A;  3JPO A;  4DQS A;  4AT7 B;  3Q8P B;  3V6H A;  2ZUB A;  2BCR A;  1XC9 A;  1D8Y A;  2FLN A;  1S0N A;  4F4K A;  2M2T A;  5HR9 A;  2FPL A;  1V9P A;  2Q0Z X;  5DG7 A;  3RJK A;  1QLN A;  2KZZ A;  3NGD A;  5J0T A;  2B21 A;  4RQ2 A;  2BCS A;  5EWE A;  1UT8 A;  4RUC A;  5KG7 A;  5HHI A;  2ZUD A;  1Y88 A;  4RUA A;  4ELT A;  3JPQ A;  3TAN A;  8ICF A;  3AQL A;  3ETL A;  5KFD A;  4QZD A;  5J2J A;  3MGH A;  2NRK A;  1CUK A;  1BPD A;  2RDJ A;  4IQT A;  5DDM A;  1NKE A;  2R8J A;  3UQ0 A;  3K4G A;  2BCQ A;  4MFA A;  4X5V A;  4DQR A;  3QZ8 A;  4RQ6 A;  3MR6 A;  4DFJ A;  4RQ8 A;  4DL7 A;  3RJJ A;  2JEI A;  4LVS A;  3PVX A;  1TFR A;  3OGU A;  4FHV A;  4DEZ A;  2HHT A;  7ICI A;  4X4Q A;  2ZTD A;  5KFW A;  4KLL A;  3AQK A;  8ICR A;  3RB0 A;  1ZQV A;  5DBB A;  3BJY A;  4EZ6 A;  5CA7 A;  4J9N A;  1JQR A;  3LDA A;  4Z6F A;  2NRZ A;  4E7X A;  5KFC A;  4UAZ A;  2LYH A;  3H7I A;  3GDX A;  5J29 A;  1MQ2 A;  2BKE A;  3V72 A;  4ECZ A;  2JEF A;  1MIY A;  1KFD A;  4DWI A;  5KFI A;  3RR8 A;  3RBD A;  4MEX A;  4O0I A;  4I27 A;  4DSF A;  4XRH A;  5KT2 A;  9ICW A;  4FS1 A;  9ICX A;  4QWB A;  5J2C A;  3OHB A;  1ZQY A;  4M9H A;  5HMM A;  4J9L A;  4GC6 A;  5DBA A;  4WC3 A;  8ICB A;  4FS2 A;  2W8L A;  4F4Z A;  4I29 A;  4KLI A;  2F1I A;  3PO4 A;  7ICF A;  5KFN A;  3C2L A;  4J9S A;  2BGW A;  3OVA A;  2V4R A;  1ZQK A;  3PR4 A;  2RFF A;  4Q45 A;  5KFT A;  3AUO A;  8ICO A;  4RU9 A;  1PX5 A;  3ZD9 A;  1XSN A;  2C22 A;  5DB7 A;  5IIK A;  4Z6C A;  1SL2 A;  4ECX A;  4ECY A;  1ZQX A;  1JXL A;  1SZP A;  1ZQJ A;  3V6J A;  2FMS A;  2FPM A;  2PI4 A;  4KLT A;  8ICL A;  5DG9 A;  5HP4 A;  7ICP A;  5KT5 A;  4X4T A;  4ECS A;  4O3O A;  3KHL A;  3ISC A;  2UVW A;  4WC0 A;  1Z00 A;  5IIN A;  1X9M A;  4ED2 A;  5DG8 A;  4EBD A;  9ICP A;  9ICB A;  5DLG A;  3C66 A;  4WBY A;  3WFP A;  4ECT A;  2BCU A;  4Z6D A;  8ICZ A;  2HHW A;  4QZF A;  2AGO A;  1MIV A;  2DFL A;  3H8W A;  4DFK A;  3QE9 Y;  3RJG A;  2ZJ8 A;  4ELU A;  4WBZ A;  7ICH A;  4FBU A;  4F3O A;  1DK3 A;  4RWP A;  3UPQ A;  4P2H A;  4PHP A;  4YP3 A;  4TQS A;  3H4D A;  1JXE A;  4C8K A;  1BPB A;  4QWE A;  4DL6 A;  5HRL A;  3B0X A;  2ASL A;  4M9J A;  3OSP A;  3OV7 A;  4ECU A;  8ICA A;  4ED0 A;  5KFQ A;  2HHV A;  3TAQ A;  4B9V A;  1KSP A;  8ICN A;  5HRH A;  2ALZ A;  9ICH A;  4QZ8 A;  5J0X A;  4YD2 A;  1K1S A;  2P6R A;  4JWM A;  3HPO A;  3PMN A;  4J9Q A;  4KTQ A;  3ZDC A;  1OU5 A;  3PV8 A;  3IHQ B;  4IQV A;  3KHG A;  3RJF A;  4QZ9 A;  4NKT A;  3ZD8 A;  4NXZ A;  2VA3 A;  2KFZ A;  3EZ5 A;  1SKS A;  1QSL A;  2C2D A;  3UQ2 A;  1ZJN A;  1X9S A;  5HML A;  3MR2 A;  3TQ1 A;  4EBJ A;  7ICU A;  4PH5 A;  4MF2 A;  3H8S A;  2W9A A;  3M9M B;  3RJH A;  5KG0 A;  2PBE A;  4WC2 A;  4PHE A;  1U48 A;  3HT3 A;  3BQ2 A;  8ICI A;  4QWA A;  4YMN A;  2DPI A;  3LK9 A;  3ISD A;  5KG5 A;  1XSL A;  2PFN A;  4UAY A;  4I2H A;  2DR8 A;  4EP7 A;  2Y1I A;  3AQM A;  4E80 A;  2FLP A;  1ZQZ A;  4FHP A;  4QW8 A;  2BHN A;  5KFK A;  4YR2 A;  4DOC A;  3OJS A;  3RTV A;  4O3S A;  4M04 A;  5HRB A;  2FPK A;  3GV7 B;  2KZ3 A;  3OUY B;  4QWD A;  4YQW A;  4R65 A;  1TV9 A;  9ICG A;  1U9L A;  1N56 A;  4RNM A;  4RPX A;  2VAN A;  7ICL A;  5DQG A;  4BDP A;  2ZJA A;  5HNK A;  2XY7 A;  4JK1 A;  5IIJ A;  2ASJ A;  2ZH6 A;  4UB3 A;  4F4X A;  2F1H A;  4X4P A;  4RWN A;  3GIK A;  3PW2 A;  3M9N B;  2ID1 A;  3FDS A;  5HC9 A;  9ICQ A;  3C18 A;  5DB8 A;  3EPG A;  1H38 A;  1UA0 A;  4JUZ A;  4UD5 A;  2DRB A;  4R8U B;  5J2B A;  2HHU A;  3H3A A;  2IHM A;  4K4I A;  3AQN A;  3HJ1 A;  3WFQ E;  4IG8 A;  5J0Y A;  4FO6 A;  4KLF A;  2HHP A;  4YMM A;  4NLG A;  4F4Y A;  1ZQR A;  1UET A;  1ZQD A;  4WCW A;  1BPX A;  9ICM A;  5JUM A;  3C2K A;  3HIY A;  8ICM A;  2PFP A;  4FH5 A;  5KFO A;  3L9D A;  4M9G A;  4YVZ A;  3GIL A;  2PXI A;  3RR7 A;  8ICG A;  1BPE A;  4O3R A;  1L3U A;  2C2R A;  3JZ0 A;  3LQC B;  3B0Y A;  1L3V A;  3RB6 A;  4X4U A;  1L3S A;  2WTF A;  1TAQ A;  4P4O A;  2J6S A;  4EBK A;  4X4S A;  2DR7 A;  4J9M A;  5J0Q A;  3EYZ A;  3AU6 A;  4DFP A;  2ATL A;  4BXO A;  5KG6 A;  3NTU A;  3PW5 A;  3LWL A;  4NM1 A;  1TK0 A;  4J9R A;  3MDC A;  2PI5 A;  4F5R A;  2XY5 A;  3C5G A;  3GV8 B;  5L1I A;  4ED6 A;  4ZH4 A;  5D49 A;  1QTM A;  4B9S A;  7ICN A;  8ICK A;  2DRA A;  4R8U A;  4ECV A;  5KFB A;  2P66 A;  3KTQ A;  4P4M A;  5DLF A;  5DEC A;  4BGD A;  2NRV A;  2OWO A;  1NK8 A;  1VJ7 A;  5KFY A;  1KRP A;  1NK0 A;  3UXO A;  4DF4 A;  1ZQB A;  4QZA A;  2ZH1 A;  3FYH A;  3GQC A;  1BVS A;  4KLE A;  5KFP A;  2AU0 A;  5L1K A;  4J9K A;  2IBK A;  2R8G A;  1Q79 A;  4AT9 A;  3RJE A;  1ZQU A;  2I1Q A;  3Q8R B;  3TAR A;  5DGB A;  5EWG A;  4EBC A;  1L3T A;  4I28 A;  4YD1 A;  3SV4 A;  1RXV A;  3V7J A;  1XO1 A;  2XGQ A;  2KTQ A;  2VA8 A;  2ZH7 A;  3WFS C;  4UBB A;  1X2I A;  1RYR A;  2P6U A;  7ICM A;  1TFW A;  2KFN A;  3H40 A;  3Q8S B;  2J6T A;  2XO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...