5DB7A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dt
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db7A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db7A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db7A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db7A03
2VANA 3OHAA 4QWEA 1LB2B 3FDSA 3M9OB 4QWDA 5HHIA 5KFLA 2IHNA 4DQQA 1ZQOA 2BCQA 2ASDA 5IINA 1QTMA 2IMWP 2JEIA 1TAUA 7ICEA 1DK2A 4JV0A 5D49A 8ICBA 3GDXA 3ISDA 2AQ4A 4M04A 2F1HA 3EPGA 4R63A 3ZD9A 2DR7A 4MFAA 5IILA 3PX4A 4RU9A 4BWMA 4QZAA 4ED0A 7ICSA 3KTQA 1KLNA 5J2GA 4ED6A 3WFRE 4QZFA 3UXNA 1ZQDA 5L9XA 2JEFA 1JXEA 1RZTA 5KFOA 3EW9A 3MFIA 2F1IA 3AQLA 2P66A 2HHTA 4IR1A 2HHPA 4QZGA 3MGIA 4MEYA 2W9BA 5L1IA 4ECUA 5DLFA 3G6YA 4NLNA 4TUPA 4AT8B 3RAQA 3T3FA 4X0AA 1ZQFA 2ZTDA 3HW8A 4ECXA 1RYRA 2KZZA 8ICMA 4M9NA 4B9LA 5DQGA 5J0YA 8ICRA 3H37A 2KZ3A 1S0OA 5KFMA 3Q8LA 2MUTB 5KTQA 4DSFA 1KTQA 5DLGA 4BXOA 7ICVA 4ATBB 4M5DA 5CB1A 5DB9A 2BCSA 5J0QA 1AROP 4I2DA 1RXWA 1ZQPA 4TQRA 1CEZA 3TFRA 4MFCA 5KG4A 5KT7A 7ICKA 3MR2A 2ZJAA 3KHLA 2ALZA 2C2DA 2BDPA 4M9GA 4M2YA 2AJQA 1UT5A 4NLKA 4YP3A 3C5FA 1Q78A 2R8HA 2ZTEA 5D46A 4UQGA 4P4PA 3WFOA 1BPZA 2NRKA 1NK8A 2HHSA 5DBBA 4DF8A 2XGQA 3QZ7A 3LWLA 4F4WA 4DL3A 3BQTA 5F9NA 1QSSA 4I2AA 4KLOA 4KN7A 4J9NA 3Q8RB 4RT2A 4X4NA 5J2KA 3RH4A 1ZQKA 2BPCA 2GWSA 1KFTA 5HRGA 4X4QA 8ICNA 2PFPA 2C22A 3GIIA 4ED3A 4FO6A 4EBKA 1Z00A 5KFYA 4UB5A 1MQ2A 4TURA 3RB3A 5DG7A 7ICPA 3OUYA 3KHRA 2FPMA 5KFVA 1WOTA 1TK8A 4XQ8A 1XU4A 3NTUA 4PHAA 4YMNA 1CUKA 2A1JB 2FPKA 4YXJA 4PHDA 4GLXA 3C2LA 3AU6A 3RTVA 5HRLA 3ORYA 3EPIA 5KT5A 3E2EA 4ECZA 5TZVA 1COOA 5J0SA 1ZQTA 5J0PA 1TKDA 8ICAA 4WC0A 2AQ0A 1KFDA 2XCAA 4PGQA 2W8LA 1NK9A 3MDAA 4O3NA 2BKEA 1SKSA 4X4RA 3AUOA 4IQWA 2NRWA 3Q8PB 3C5GA 4FHWA 5HR9A 5DB7A 5HRKA 5DB8A 4J9QA 4FS2A 4K4HA 4FS1A 4I28A 2IHMA 4ELTA 8ICCA 2PI4A 5L1LA 3ZDEA 1BPBA 2JZBA 3SV4A 5L1KA 4M9LA 3UXPA 1TFRA 1X2IA 4I2IA 3OJSA 3KHHA 5EWFA 3H38A 3UPQA 1JX4A 4I29A 3WFPA 4QWCA 4IRCA 4FHYA 3LDAA 4KITB 3C66A 5DG8A 2XO7A 4YG2A 5KFGA 4C8KA 1ZQXA 5J0RA 5KG2A 5HRIA 3PR5B 2BQRA 5D4BA 5EOZA 5KFEA 4DSEA 3H39A 4DEZA 9ICNA 4WC2A 1H38A 2ZH1A 3ISBA 1RPLA 2J6SA 3TI0A 1JQRA 3RAXA 2R8GA 4K4GA 5J2DA 7ICIA 1X9MA 2P6RA 1TAQA 2W8KA 2M2VA 3GIKA 4F4ZA 1QSYA 2KP7A 3PO5A 4F92B 2Y1IA 1PX5A 1D9DA 5KFJA 3NGDA 4Z6EA 4IG8A 4AT9B 1R89A 2BHNA 4DS5A 2XC9A 2ZUBA 3B0YA 4YMOA 4I2JA 4KLFA 4F93B 5KFUA 5CA7A 4YXMA 2P6UA 4R64A 3OHBA 5KFTA 2ZH6A 4RQ0A 2O5AA 2NRZA 4I2GA 1SZPA 3AQKA 5KG3A 1ZQZA 1U48A 1L3UA 4B9VA 2M2WA 4RNNA 4C8LA 7ICUA 3GV8B 4EBCA 2KFNA 3UXOA 3UQ0A 8ICKA 7ICHA 3H3AA 3WFQE 1BNOA 4DFPA 4J9RA 2MAXA 2M9NA 5J2FA 1NKCA 7ICMA 1DGSA 1BPDA 2WTFA 4GXKA 2XCPA 3PW5A 1PZNA 1ZQJA 2F1JA 5KFKA 1S9FA 4ECVA 1U4BA 3PY8A 5KFBA 4DSLA 8ICGA 1U9LA 4YVZA 4RZRA 3M8RA 3RJIA 2AGPA 4DSJA 4F91B 2VA8A 4Q44A 4EZ9A 4B9TA 3BQ0A 4WBYA 2V9WA 5J29A 4ED7A 2HHVA 2R8IA 4QZCA 9ICRA 2DR8A 4YMMA 3OSPA 1ZYQA 2UVWA 1ZQHA 1L3SA 4F5RA 3OSNA 4GC7A 3G6VA 4PGYA 2Q0ZX 1RXVA 2BCUA 1Z3EB 5KFXA 4J9PA 4MF2A 4NM2A 9ICLA 5CWRA 3HX0A 1UT8A 4QW9A 9ICPA 2RFFA 3H4DA 8ICLA 5J2CA 4B9SA 3MFHA 8ICQA 5HREA 4HYKA 3RRHA 1D9FA 4KLTA 2C2RA 2PBEA 3OVBA 3RJFA 3GFKB 2H5XA 2DR5A 4BXOB 5IIMA 5J2EA 1MIWA 4JK1A 3BDPA 3H8WA 2PI5A 1ZQMA 2XY5A 4AT7B 1T8EA 4CCHA 2ZH2A 4I2HA 4YN4A 4B9UA 1ZQQA 4K4IA 2HHQA 1T4GA 4UBBA 4BDPA 4QZ9A 5KFFA 4ECWA 1ZJNA 4O9MA 1BVSA 5HRHA 4I2CA 4F5PA 4X4TA 3ZDCA 4BWJA 2J6UA 4DOCA 5HRBA 1JAJA 8ICTA 4ECYA 2IBKA 5HC9A 3N4MB 1MSWD 2M2TA 1MIVA 4I2FA 4QZ8A 1KDHA 1B22A 1KNYA 3JPOA 3PR4A 4NKTA 4RT3A 4O0IA 4KLMA 4XA5A 4O3OA 1BPEA 5KFQA 3T5LA 1JIHA 2FMSA 4S3NA 1EXNA 1XO1A 1Z00B 1ZQUA 5HMLA 3THVA 4EYIB 1ZQAA 1ZQNA 4DSIA 9ICXA 3RH6A 9ICUA 3OUYB 4WC5A 3C2MA 2NRVA 1ZQEA 4IQUA 1U49A 1ZQYA 1HUOA 4O5KA 2HVIA 4YD2A 9ICBA 4WCWA 2Q66A 5KFSA 4AT8A 4XRHA 3RR8A 4XQ7A 4KTQA 4RQ5A 3OVAA 2DVIA 1S77D 5DGBA 3OGUA 4RPYA 3ETLA 5BPCA 4RPZA 4YR2A 3LK9A 3QZ8A 4F8RA 4QWAA 3GILA 4M9JA 2C2EA 3NYBA 3M8SA 4DFJA 4ATBA 1F5AA 1ZQLA 9ICKA 1ZQIA 4IQTA 1BGXT 4RQ1A 3C1YA 4UB3A 1S0MA 4DQRA 4F4KA 1R8AA 4X4VA 3TAPA 4X5VA 5F9LA 1S76D 3GV5B 4RNMA 5HMMA 2JEJA 4NKUA 5KG1A 4RUCA 3JPQA 2ASLA 2W9CB 2JZBB 4M47A 4M6WA 5KG6A 1NK4A 3JPPA 2JEGA 3RJEA 4LT6A 1UA0A 2ZJ5A 4UBCA 4MF8A 2RDIA 5J0XA 1ZQRA 9ICIA 1V4AA 4UB2A 1TK5A 3JZ0A 3JPSA 4P2HA 4UB1A 1D8LA 4DLEA 5EWEA 5J2AA 3MR5A 4DQIA 3B0XA 4KLDA 4O3SA 3LQCB 3HJ4A 2PFQA 3SZ2A 2XY7A 4EP7A 2W9MA 4DO9A 2ZTCA 4J9MA 8ICHA 4UAYA 1K1QA 4IQVA 1U47A 4R65A 3EWAA 2BQ3A 3AQNA 4UD4A 5C5JA 1MC8A 5DDYA 4F5OA 1U45A 1S0NA 8ICZA 3RRGA 4TQSA 3FYHA 4NLGA 2I1QA 3OVSA 4UAWA 5DQHA 4RUAA 3EZ5A 4JWMA 3JYYA 4C8NA 4C8MA 1T3NA 1NJYA 3M9NB 3PV8A 1VJ7A 2VA3A 2ID1A 9ICJA 4ECQA 4UB4A 4ECTA 1BNPA 4X0BA 4B9NA 3TARA 4X4PA 2FMQA 2BE3A 2ZH7A 4ECRA 3TFSA 3L9DA 4RQ7A 1IXRA 5KFZA 4QZBA 2R8KA 1UA1A 5KG7A 5KT3A 5DB6A 7ICOA 4FH3A 3MBYA 5IIKA 4J9KA 5KFHA 5KT6A 3Q8QB 5DG9A 5J2BA 4DFKA 4J9SA 4DLGA 3QE9Y 2UVRA 2ZH3A 1XWLA 3GIMA 3BQ2A 4Z6FA 4BGDA 4GXIA 4NXZA 4KLHA 1NOMA 5IIJA 5DBCA 4F5QA 7ICFA 5J2IA 1QLNA 3IHQB 1XC9A 4KLUA 4UAZA 3JPNA 4NM1A 4DSKA 3H8JA 3N97B 4GXJA 2ASJA 3IM1A 7ICRA 4RWQA 1R8BA 1NJWA 2ZJ8A 5KFDA 3V6HA 2UVVA 3PO4A 4E0DA 3EYZA 3PX0A 8ICFA 4DL4A 3JPTA 2PFNA 4KLQA 8ICWA 1JMSA 2LYHA 2ZH8A 5J0OA 4KLGA 4JV2A 4RWPA 1SKWA 3BQ1A 3PW2A 5HNKA 1TFYA 3RJJA 3V72A 1NK7A 4ELVA 9ICGA 4KLLA 5BOLA 1YLQA 2ZH5A 3ZD8A 5CP2A 2NRTA 2XY6A 3H8SA 2DRAA 4O3PA 5KT4A 3MR6A 4QWBA 2ZUCA 3PW0A 1NK5A 2W9BB 1TK0A 1HUZA 3ZDBA 2BGWA 3ZDDA 2NRXA 2M2UA 2PXIA 4EBEA 3QEBZ 4FHPA 3QEAZ 4WBZA 1LV5A 4R8UA 4RQ4A 3V6KA 2DPJA 4KLJA 8ICUA 4ECSA 5KFNA 4O5CA 4EZ6A 3RB4A 3HJ1A 1ZQBA 7ICJA 4X4UA 3T5JA 1V9PA 3Q8SB 3H7IA 2ISOA 5DBAA 2KFZA 4NLZA 3HWTA 2BCVA 1SL1A 8ICPA 3ISCA 1JN3A 2W9AA 4J9LA 4Q45A 3MABA 1KSPA 2IA6A 7ICTA 8ICEA 4E7XA 3TANA 5BOMA 3V7LA 1R8CA 4FHVA 4RQ3A 5J2HA 4DL5A 1B43A 5EWGA 2I9GA 4JV1A 4UD5A 4DOAA 3BJYA 5HP4A 4F5NA 4DQPA 9ICHA 3C23A 3V7JA 4DF4A 1L3TA 2BR0A 2DRBA 3OJUA 1DK3A 1UEVA 3G6XA 1K1SA 4F4YA 2ZH9A 4P4OA 4KN4A 2BCRA 2J6TA 3Q8KA 1SKRA 1KRPA 4I27A 4WC6A 5IIIA 4TUSA 3HP6A 4ED2A 3RBDA 7ICLA 4DOBA 2V4RA 3AQMA 2BPGA 3C18A 3SYZA 9ICTA 1MQ3A 8ICIA 3C1ZA 1UEUA 3PVXA 4IRDA 4FHXA 1XSPA 4WC1A 1N56A 3GV7B 5KFIA 3MDCA 3H4BA 4EBDA 5KFCA 4GC6A 4DFMA 3RB6A 3LWMA 1S97A 1SL0A 4QW8A 8ICJA 5IIOA 4Z6DA 3V6JA 1JXLA 4ED1A 2DR9A 4O3RA 3PMLA 4IRKA 4WC7A 4TUQA 1ZQGA 4EBJA 4KMUA 1NKBA 2MUTA 4M6WB 5DKWA 4QZEA 2V4QA 1L3VA 1BPYA 4MFFA 5F2VO 2ZHBA 4J9OA 5J0TA 3HIYA 8ICSA 4X4SA 3T5HA 1IM4A 3HT3A 1TVAA 1KFSA 1ZQWA 2UVUA 2FLPA 4ELUA 7ICQA 3RB0A 3AU2A 4O3QA 2B21A 4RQ2A 1NJZA 1D8YA 1X9SA 4PPXA 9ICFA 4YCXA 3RJHA 5KG0A 1OU5A 4EYHB 3TAQA 4I2EA 3V7KA 4MEXA 1C7YA 1S0VA 5HRFA 2BPFA 9ICMA 9ICVA 9ICEA 9ICQA 1WCLA 3RJKA 5L1JA 1FA0A 4QZHA 4WC3A 4Q43A 5KFWA 2FMPA 3RBEA 4ZH4A 1ZQSA 2DPIA 2ATLA 2HVHA 3JPRA 5KT2A 2R8JA 8ICOA 5KFPA 2DFLA 5KFAA 1ZETA 2C28A 4DQSA 4YD1A 3KHGA 7ICGA 4P4MA 2KTQA 1A77A 4PH5A 2AGQA 1TFWA 3M9MB 2ZUDA 4YR0A 4ED8A 3TQ1A 4YR3A 3PNCA 4F50A 4F4XA 9ICAA 2HHWA 4RWOA 1NK0A 3PX6A 5CR0A 2Y1JA 7ICNA 5J0UA 1XSNA 2OWOA 2A1JA 2AGOA 1UETA 4WC4A 1ZQCA 5KG5A 3H40A 4JUZA 2BQUA 9ICSA 4R66A 3MR3A 3C21A 1RYSA 4G3IA 3T5KA 3PMNA 4QZDA 3MGHA 2W9CA 4F3OA 4M0AA 9ICWA 1MIYA 2ZH4A 4DL7A 1NK6A 5DECA 1NO5A 1XS9D 3HPOA 1NJXA 5HRDA 2VA2A 3SI8A 3K4GA 3RR7A 4XUSA 4JWNA 4LVSA 2HW3A 8ICVA 4DL2A 1XSLA 5DEDA 1ZQVA 1L5UA 1QSLA 4QZIA 4M9HA 4LZDA 1DOQA 4RWNA 3OV7A 4RNOA 4F2SA 3SV3A 2HHXA 2ISPA 3WFSC 5J0WA 1A76A 3C2KA 4KLSA 3UPSA 5J2JA 1NKEA 9ICCA 1X9WA 3PW7A 4IR9A 2AU0A 3GQCA 2PFOA 4B9MA 2HHUA 5DQIA 4YQWA 1NZPA 4EEYA 3RH5A 3Q8MA 1KEJA 2RDJA 4X4OA 5KFRA 4NY8A 4E80A 5DGAA 4PGXA 4RPXA 4O5EA 9ICOA 1TV9A 3UQ2A 5CHGA 2KZMA 1WCNA 5JUMA 4DWIA 2FPLA 1ZJMA 2ZHAA 3RJGA 3GIJA 4R8UB 4E8FA 8ICYA 1VFGA 1BPXA 4Q8EA 2XGPA 1HJPA 2FLNA 1T7PA 1N48A 4Z6CA 4AT9A 4C8OA 4FBUA 8ICXA 4KLIA 4AT7A 3PW4A 1S10A 4I2BA 4PHEA 4F2RA 4PHPA 3ZDAA 4LZGA 1Y88A 5CJ7A 5HHHA 2FLLA 4YFKA 3K75D 4FH5A 2KN7A 4FBTA 4Q8FA 4RQ8A 1SL2A 4DL6A 4DS4A 5DDMA 4KLEA 1Q79A 2O1PA 4RQ6A
chains in the Genus database with same CATH superfamily
3OHAA 3FDSA 3M9OB 4CGZA 7ICEA 8ICBA 3GDXA 3ISDA 3EPGA 3ZD9A 2DR7A 5ALLA 3PX4A 4BWMA 4ED0A 3KTQA 4ED6A 5KNIA 4QZFA 1PK1B 1KKXA 5AHXA 2KJ8A 2P66A 2HHTA 2HHPA 3BS5A 4AT8B 5AK6A 5L1IA 2LYBA 4B9LA 2K4PA 5J0YA 8ICRA 3IN5A 5KFMA 5AI9A 1KTQA 7ICVA 3ONNA 4M5DA 4GFJA 5DB9A 4X0BA 1RXWA 5E79U 2XIDA 1J2MA 2ALZA 2PMZC 5D46A 1L7MA 2NRKA 1ZRNA 1NK8A 4DF8A 4DL3A 4KLOA 5F9NA 1QSSA 4OCZA 4RT2A 4X4NA 2YB1A 4EBKA 2HBLA 4HX0A 3A0BU 3RB3A 3KHRA 2FPMA 1TK8A 4XQ8A 4I0UA 5G5HA 3NVVA 2FPKA 1N62A 3C2LA 3AU6A 3E2EA 5TZVA 3RF9A 3NVWA 2ZIXA 4CF5A 2XCAA 2YB4A 4OD0A 5B5EU 3C5GA 5HR9A 4FHWA 5HRKA 4J9QA 4FS2A 1NI3A 2JMGA 4I28A 4ELTA 4P0QA 4M9LA 1ZXIA 1TFRA 3OJSA 5ALEA 1JX4A 4I29A 3WFPA 4IRCA 5AICA 4KITB 3HKZC 3ER8C 1Z4OA 4LEZA 3D2NA 5D4BA 1RG6A 2WAQC 5EOZA 4DEZA 2HI0A 5AM5A 2ZH1A 2J6SA 2R8GA 1X66A 3GIKA 2KP7A 5D61A 1ED1A 1PX5A 1D9DA 1OUQA 4AT9B 1R89A 5CA7A 4OAGA 3OHBA 1N60A 2ZH6A 2R18A 2O5AA 3RFAA 4RNNA 5C0YA 3GV8B 8ICKA 3AEVA 3H3AA 1WUDA 3KKAA 1BNOA 4UATA 4J9RA 1B4FA 4IS7A 3F5AA 4X4SA 1BPDA 1ZQJA 5KFKA 3I1YA 2KJ9A 1U9LA 3AMZA 4YVZA 2AGPA 1VJ5A 4Q44A 2A19A 1MA7A 3UMBA 4C4TA 4ED7A 2EZXA 1ZYQA 2UVWA 3G6VA 4PGYA 1RXVA 4RQMA 4NXTA 2P35A 1UT8A 3H4DA 3H0RB 2DKXA 3OVBA 3C28A 2H5XA 4I2HA 2HHQA 5AIAA 5KFFA 4ECWA 1ZJNA 5HRHA 2YMPA 1JAJA 5HC9A 3M6KA 5AI0A 1MSWD 3ETRA 1MIVA 5G5GA 1B22A 4NKTA 4O0IA 4KLMA 4XA5A 1O03A 5KFQA 3T5LA 4S3NA 1HIWA 3OUYB 4C7YA 1ZQEA 4IQUA 1HUOA 9ICBA 3H0LB 4YD2A 4AT8A 4OJLA 3OVAA 2E8MA 3WKCA 3ETLA 4Y2QA 4F8RA 5AK4A 2YY6A 1F5AA 2KE7A 1ZQIA 4UB3A 2VJ4A 4DQRA 3TAPA 5F9LA 3CNHA 4NKUA 4M47A 2JZBB 2JEGA 3RJEA 5AKJA 2LM1A 1S5LU 4UBCA 4MF8A 2RDIA 1ZQRA 1V4AA 5TISU 3J81j 5J2AA 3LQCB 3SZ2A 2KVSA 3GZFA 4Y2UA 4J9MA 8ICHA 1K1QA 4R65A 4QIWC 4ZOHC 2BQ3A 1SV0C 3KZXA 2G0AA 4F5OA 1COKA 3FYHA 5ALDA 4RUAA 4JWMA 2KV2A 4JB3A 4C8NA 3NRZA 4EEKA 1VJ7A 4ECQA 3TARA 5A0LA 4X4PA 5AKXA 4ECRA 1IXRA 5KG7A 5KT3A 7ICOA 4DFKA 2WF5A 4DLGA 4C0ZA 1XWLA 4BGDA 5IIJA 7ICFA 1JALA 4F5QA 5J2IA 4DSKA 3H8JA 3WK5A 4K98A 7ICRA 4RWQA 1R8BA 1NJWA 2ZJ8A 2IUBA 8ICFA 3QNMA 3EYZA 4DL4A 3IV6A 1WYGA 4KLQA 4LJXA 4CF3A 2ZH8A 4IL6U 4KLGA 2LPEA 5AKEA 3QU5A 5AKKA 3V72A 1YLQA 4KLLA 5CP2A 3H8SA 3PW0A 2ZUCA 1NK5A 3ZDBA 3ZDDA 4WCWA 4FHPA 4R8UA 3V6KA 4EV6A 4CNQA 3HJ1A 3H7IA 2KFZA 3HWTA 5ALFA 4CF4A 8ICPA 2W9AA 4B6JA 4FHVA 2LMRA 4RQ3A 1QQ5A 4UD5A 1DRGA 4DQPA 3V7JA 3WKBA 1L7PA 2DRBA 1URJA 2YMMA 2OXOA 4I27A 3HP6A 7ICLA 4DOBA 5B66U 3WKAA 2EANA 1NZBA 3PVXA 2ESEA 2MSNA 1N56A 3GV7B 2Y0SC 2QKQA 5KFCA 4QW8A 2QLTA 3V6JA 3UMGA 3PMLA 4KMUA 5DKWA 4QZEA 2V4QA 1L3VA 1BPYA 5F2VO 1PVQA 2HBMA 3T5HA 3R9KA 1KFSA 2UVUA 3TADC 2FLPA 7ICQA 4UARA 1NJZA 2RP5A 1X9SA 4PPXA 3RJHA 2LKYA 4EYHB 4I2EA 3V7KA 3NVZA 1C7YA 2KIWA 5HRFA 2BPFA 9ICMA 9ICVA 9ICEA 3RJKA 4KM5A 4QZHA 5KFWA 2DPIA 3JPRA 4EEDA 5KFAA 3KHGA 4P4MA 2AGQA 1ZOLA 2I5HA 3O0FA 4YR3A 3PNCA 5KL8B 2K8CB 5CR0A 1XSNA 2A1JA 3UM9A 2AGOA 1UETA 4WC4A 2I6XA 9ICSA 4R66A 3C21A 4G3IA 4M0AA 2GLEA 5GTIU 2ZH4A 1NK6A 1NO5A 1XS9D 5T14A 1NJXA 5HRDA 2VA2A 1RQNA 8ICVA 3ALRA 4M9HA 2FJ6A 4RWNA 3OV7A 1L8LA 4RNOA 3SV3A 4KLSA 3UPSA 4Y2YA 3LYSA 3SENA 2AU0A 4B9MA 2HHUA 4CE6A 4EEYA 4PJ0U 3Q8MA 1KEJA 4E80A 3OWGA 4RPXA 4FZNA 4O5EA 1TV9A 3UQ2A 2KZMA 1HEKA 2FPLA 3GIJA 4E8FA 1VFGA 1X6JA 2XGPA 1N48A 4Y2JA 4FBUA 4F2RA 3ZDAA 1Y88A 1Z19A 3K75D 2KN7A 3GU3A 3SD7A 4Q8FA 4RQ8A 2YTUA 3KOOA 1ZQOA 4KLEA 4RQ6A 2ZH5A 2G06A 2VANA 4OAFA 4QWDA 5D62A 2IHNA 2ASDA 2IMWP 1QTMA 3B9JA 5D49A 2F77X 2AQ4A 4R63A 2Y0SF 4RU9A 4P0PB 3UXNA 5L9XA 2HCFA 4CDGA 4J03A 1F44A 4UAVA 4IR1A 3OTQA 4QZGA 4MEYA 5DLFA 4ECUA 4TUPA 1X6IA 4X0AA 2KZZA 1RYRA 3HW8A 4ECXA 3H37A 2KZ3A 3Q8LA 2MUTB 4DSFA 5DLGA 2WHEA 4BXOA 2BCSA 1CEZA 1AROP 4I2DA 4AT7A 4TQRA 7ICKA 5KG4A 5KT7A 3MR2A 2ZIUB 2Y9TA 3KHLA 2AJQA 4M2YA 1Q3UA 1TAMA 3WU2U 2GOLA 5ALGA 3QU7A 3LVVA 3QZ7A 4J9NA 1ZRMA 5J2KA 5HRGA 1ZQKA 2GWSA 2Q4TA 2KEYA 3GIIA 1MQ2A 2VJ5A 4TURA 1KL9A 1PVPA 5ALPA 3SQIA 3BZKA 5KFVA 1WOTA 3PSPA 1CUKA 4GLXA 5HRLA 5AKIA 4G9BA 4ECZA 1A6SA 2NO4A 2QB0A 5J0SA 8ICAA 1KFDA 4PGQA 4O3NA 4X4RA 3NKUA 4O67A 4IQWA 2NRWA 3MGVA 1Z4NA 8ICCA 2PI4A 3ZDEA 5L1KA 4EX6A 3KHHA 5EWFA 4QWCA 4FHYA 3C66A 4YG2A 4C8KA 3PR5B 2BQRA 5KFEA 4DSEA 3H39A 2FI1A 2OCEA 1JQRA 4US9A 3RAXA 2P6RA 2W8KA 3HRDD 2YX8A 3PO5A 2Y1IA 4UB8U 3NGDA 1UPHA 4OJ6A 4KLFA 4F93B 2Z7JA 4YXMA 5KFTA 5K4LA 3AQKA 1ZQZA 2DKZA 4B9VA 3DEEA 1OW5A 3UXOA 7ICHA 1FEZA 5CEHA 4DFPA 7ICMA 4GXKA 2DWQA 2XCPA 3PY8A 5ALIA 4C8OA 7ICGA 4WQLA 1ZD2P 1U4BA 5KFBA 2RHFA 2IHOA 3M8RA 3RJIA 4F91B 2VA8A 4EZ9A 4B9TA 9ICRA 2WF8A 2DR8A 4YMMA 2DUYA 2ODGA 1ZQHA 2BCUA 2Q0ZX 1Z3EB 4J9PA 4NM2A 5CWRA 3HX0A 5JTGA 8ICLA 5J2CA 3F2BA 3MFHA 3NWIA 2N1RA 3M1YA 4HYKA 5HREA 2PBEA 2C2RA 4CRXA 2DR5A 5J2EA 1MIWA 3BQ7A 4JK1A 3H8WA 3PZPA 3BDPA 2PI5A 1T8EA 1ZQQA 4K4IA 1ZD5A 3NS1A 3PSIA 1BVSA 5AKHA 5HRBA 3DDHA 2LYAA 4FZMA 4I2FA 1KN5A 4QZ8A 1KDHA 1KNYA 3JPOA 1QQ7A 5AKYA 1BPEA 2ZIWA 1XO1A 1Z00B 1ZQAA 4DSIA 2CN1A 3C2MA 2F8LA 2Q66A 4O5KA 2HVIA 3DV9A 4RQNA 2DVIA 5JRTA 1S77D 3OGUA 2YMQA 4RPYA 3NYBA 1N61A 2C2EA 3M8SA 4Y2RA 3TADA 4IQTA 1S76D 3GV5B 2GH1A 3SR6A 5KG1A 2W9CB 2BDUA 3QUCA 4LT6A 5J0XA 4O69A 3JZ0A 2HSZA 1D8LA 5EWEA 3MR5A 4DQIA 3B0XA 3WK4A 2PFQA 2XY7A 3M7DA 4DO9A 5B3PA 2YN4A 4UAYA 4Y2XA 1LKYB 3QYPA 4PZNA 4IQVA 3EWAA 1PVRA 1MC8A 2KSOB 4NLGA 1JRPA 3AM9A 3JYYA 3M9NB 1GO3F 2VA3A 9ICJA 2ID1A 4UB4A 4B9NA 2BE3A 2ZH7A 3MCRA 2R8KA 4FH3A 2JH1A 1Q46A 4J9KA 5KFHA 2UVRA 5DG9A 5J2BA 4J9SA 3QE9Y 3GIMA 4WOYA 1GPJA 3ED5A 5AI6A 4KLUA 4UAZA 2HDOA 2QARB 2KICA 2WF7A 3NASA 1L7OA 2G5IB 4DCCA 2XVTA 2LYHA 3TACB 4JV2A 2F2AB 1SKWA 4BJQA 4KB6A 3JCFA 3PW2A 3RJJA 2W55A 5ALOA 2NRTA 2WFAA 5KT4A 1Z1VA 2W9BB 3NRWA 4HAIA 4EBEA 1SB3C 3QEBZ 4WBZA 3CK6A 3FAHA 4EX7A 4RQ4A 4KLJA 4ECSA 3D2QA 4X4UA 1ZQBA 7ICJA 1V9PA 2ISOA 2O6KA 2D6FC 4NLZA 2BBHA 2BCVA 3ISCA 4Q45A 5J2HA 1B43A 4JV1A 4DOAA 3IG5A 3SAHA 4DF4A 4OJOA 2BR0A 2YQEA 2A1AA 1DK3A 3G6XA 4KN4A 2BCRA 3Q8KA 4WC6A 4TUSA 3OPXA 3C18A 4JLXA 3SYZA 3WK7A 2K89A 1PK1A 5AI4A 1N63A 3C1ZA 1UEUA 4KX5A 4IRDA 3AN1A 1XSPA 4WC1A 2AH5A 3MDCA 5CFSA 3IRUA 4DFMA 2F8KA 3LWMA 1SL0A 8ICJA 3EF2A 1JXLA 3VCBA 4ED1A 4JMUA 4M6WB 5J0TA 2GA9D 4K99A 4PL2A 5AM1A 1TVAA 1MN8A 5AM0A 3AU2A 4RQ2A 2B21A 3RB0A 3PHZA 1OU5A 3TAQA 4MKPA 1FA0A 4FZLA 4NJ8A 4Q43A 1ZQSA 4ZH4A 3NUQA 1ZETA 4N7RA 1TFWA 1A77A 3SAGA 1QQ6A 4YR0A 1JI7A 4USAA 3C29A 3ERCC 1AQ6A 5KG5A 3H40A 4JUZA 2BQUA 3MC1A 9ICWA 3MGHA 2W9CA 5DECA 5ALMA 3QX7A 4JWNA 4DL2A 1XSLA 1L5UA 1QSLA 4LZDA 3N7RC 4F2SA 2HHXA 3C2KA 3N28A 2WF9A 1NKEA 5EE0A 9ICCA 1X9WA 1NZPA 3GQCA 5DQIA 4YQWA 3RH5A 4UAUA 2RDJA 2BBJA 5KFRA 4PGXA 1IIPA 3UMCA 1WCNA 1ZJMA 2ZHAA 5CFTA 1RDFA 2KKPA 4AT9A 2DBYA 5EE3A 4KLIA 3PW4A 1S10A 4LZGA 1IG6A 5HHHA 4YFKA 3QU2A 3IDWA 4DS4A 5DDMA 4O3OA 1RZTA 1KBUA 1Q79A 2O1PA 1VLBA 4PL1A 1LB2B 5HHIA 5KFLA 3H8MA 4EENA 2BCQA 2JEIA 1TAUA 4UB6U 2F76X 4M04A 2F1HA 1L8OA 4MFAA 7ICSA 4QZAA 2IOFK 2JEFA 1JXEA 3AQLA 3IP4B 2W9BA 3MGIA 2B51A 3AQFA 1JROA 3T3FA 3D6JA 3F2CA 8ICMA 2HBJA 2WB1F 4M9NA 2ES6A 1V97A 1JUDA 5KTQA 4ATBB 1RQLA 5CB1A 2FDRA 5J0QA 1ZQPA 3TFRA 4BUGA 2ZJAA 2C2DA 1SXDA 5ALSA 1Q8KA 3C5FA 4UQGA 1FFVA 5CHEA 2HHSA 5DBBA 3LWLA 4F4WA 5ALRA 3BQTA 1OXJA 2WF6A 4KN7A 3RH4A 1T94A 2CXYA 2C22A 4FO6A 5KFYA 1X40A 3OUYA 1N5WA 2F44A 3NTUA 1P7DA 4YMNA 5AM4A 4PHDA 1PK3A 3RTVA 3ORYA 2CRXA 3EPIA 2LM4A 3I28A 2FE9A 1COOA 5J0PA 2F3NA 3BZCA 1UQVA 4WC0A 4NV0A 1NK9A 3MDAA 2BKEA 2OHFA 4K4HA 1BPBA 2JZBA 2LI6A 1Q3VA 3UXPA 2KMDA 1X2IA 4K9AA 4OAIZ 3F2DA 2E8PA 1FIQA 4OJPA 3S6JA 5KFGA 5J0RA 4U6PA 5HRIA 5ALTA 1O08A 9ICNA 1RPLA 3WKEA 3TI0A 2M2VA 4FFDA 4F4ZA 2H3ZA 2AXTU 4Z6EA 2KK0A 3B0YA 2K4IA 4YMOA 5AM3A 5KFUA 2KJ5A 4R64A 1Z1BA 4RQ0A 2NRZA 4I2GA 1SZPA 5KG3A 1U48A 4F71A 4C8LA 1LVHA 1WG8A 2EDUA 4EBCA 3UQ0A 1S8OA 3KBBA 3WFQE 2MAXA 5J2FA 1NKCA 1PZNA 8ICGA 4DSLA 4RZRA 4DSJA 4WBYA 3F5EA 2XI9A 4Y2VA 2R8IA 2E5SA 3OSPA 1L3SA 3OSNA 4GC7A 3BS5B 4MF2A 3CW2C 4NXXA 1A0PA 2G08A 2G09A 4K9BA 4NXWA 4B9SA 8ICQA 1D9FA 4KLTA 3U26A 2KIVA 2B6GA 2XY5A 4O6AA 2ZH2A 4B9UA 2VKQA 4UBBA 1WWUA 2GAFD 4F5PA 2W43A 4BWJA 2OYYA 4NLBA 8ICTA 2IBKA 1YZ6A 3N4MB 1PUZA 2JGAA 4RT3A 5ALXA 3ER9B 1JIHA 3N7PD 2FMSA 1ZQUA 4EYIB 1ZQNA 1N5XA 4C4RA 1XO0A 4BX9C 5HR7A 2NRVA 1ZQYA 3WK8A 4US8A 5KFSA 1UHUA 4XRHA 4XQ7A 4KTQA 2ZG6A 5BPCA 3LK9A 3QZ8A 2ZIXB 2NO5A 4DFJA 4ATBA 1ZQLA 9ICKA 2W3RA 5ALWA 1BGXT 1R8AA 3C1YA 1K5OA 2ZXIA 4F4KA 4X5VA 4RNMA 4GIBA 5GTHU 3JPQA 4P0QB 2ASLA 2KHQA 3M6ZA 5KG6A 1NK4A 5AKZA 4ICAA 4UB2A 1TK5A 3JPSA 4P2HA 4UB1A 4DLEA 4O3SA 4EP7A 2W9MA 2ZTCA 2HBKA 4K96A 2K8BB 2KHVA 5DDYA 1U45A 1UCVA 2JHDA 3RRGA 2I1QA 3OVSA 4UAWA 3EZ5A 5DQHA 1YT3A 4C8MA 3K1RB 1T3NA 2KG5A 2RLTA 4ECTA 5J8YC 2RQ5A 3ICXA 2FMQA 3CP8A 2MRLA 3L9DA 1YZ7A 4RQ7A 5KFZA 4QZBA 1UA1A 5DB6A 1TE2A 1L7NA 5IIKA 4DFDA 5KT6A 4WC7A 3Q8QB 2ZH3A 3HJEA 4Z6FA 4KLHA 2EZYA 3IHQB 4FO1A 4GXJA 3IM1A 4EELA 2UVVA 5KFDA 3V6HA 8ICWA 4NL9C 4EEBA 2HOFA 4RWPA 1KW4A 1NK7A 1SWVA 5BOLA 2XY6A 2DRAA 1HUZA 2M2UA 2NRXA 2PXIA 3QEAZ 4AYBC 3QUBA 4EZ6A 3AQEA 3T5JA 3Q8SB 2RRDA 1JN3A 2IA6A 4J9LA 3NVOA 3TANA 5BOMA 2I9GA 4DL5A 5EWGA 3BJYA 4F5NA 3C23A 2ZIVB 3OJUA 1UEVA 2ZH9A 2J6TA 5EE9A 4ED2A 4P0PA 2OM6A 3QXGA 8ICIA 2GO7A 4O3MA 4FHXA 4KX3A 5F3XB 3H4BA 4EBDA 5ALHA 3RB6A 1S97A 5KAFU 5IIOA 4O3RA 4EBJA 1NKBA 2MUTA 2QB1A 4MFFA 2ZHBA 3HIYA 3HT3A 2ZIUA 3BS7A 4ELUA 9ICFA 1D8YA 5KG0A 2LHTA 4C80A 5EE1A 1ZQ1C 2W3SA 3RBEA 8ICOA 1QH9A 5KT2A 5KFPA 2C28A 2KTQA 2ZUDA 2EAOA 3TQ1A 9ICAA 4F50A 2HHWA 4RWOA 1NK0A 3TKAA 5AM2A 3PSTA 2OWOA 1RYUA 2M0NA 3MR3A 1MIYA 4DL7A 3RR7A 2EWRA 2HW3A 5DEDA 1ZQVA 2EAPA 2H3IA 2MA1A 5J2JA 1SZHA 4IR9A 2PFOA 4QJFB 4AYBF 2K4HA 4X4OA 1V85A 5DGAA 5CHGA 4DWIA 3A0HU 3RJGA 4R8UB 3SMVA 5CFUA 1T7PA 2KVCA 4A8EA 4I2BA 3F53A 2FLLA 4FH5A 1FFUA 5ALKA 1SXEA 4OO1J 1SV4A 4DL6A 4QWEA 2E8NA 4DQQA 2KKVA 5ALYA 5IINA 1DK2A 4JV0A 2B4VA 3WK6A 2KD1A 5IILA 1KLNA 5J2GA 3WFRE 3L3FX 1ZQDA 2K60A 2EAMA 5KFOA 2B0CA 2HOQA 3EW9A 3MFIA 2F1IA 1CI4A 1J97A 2PMZF 3G6YA 4NLNA 3RAQA 1ZQFA 2ZTDA 5AK5A 1WWVA 5DQGA 1F0MA 1S0OA 3L4PA 2JH7A 3N7SC 4MFCA 1ZD4A 2BDPA 4M9GA 1UT5A 4NLKA 4YP3A 1Q78A 2R8HA 2ZTEA 4P4PA 3WFOA 5ALZA 2ZIVA 1BPZA 1SGGA 2XGQA 2WB1C 4I2AA 3Q8RB 3NVYA 4X4QA 1KFTA 2BPCA 4Y2SA 8ICNA 2PFPA 2JXJA 4LEWA 4ED3A 1X42A 3E0FA 1Z00A 4NWIA 4UB5A 5DG7A 7ICPA 1X9XA 1FO4A 1XU4A 4PHAA 2A1JB 2H3VA 4YXJA 3QUQA 5KT5A 3SEIA 2DQNB 3HKZF 3CYMA 1ZQTA 1TKDA 2AQ0A 1VDVA 2W8LA 4C7ZA 2WAQF 1SKSA 3AUOA 3Q8PB 4AP9A 5DB7A 5DB8A 4NXUA 4FS1A 3QUTA 2IHMA 1L6NA 5L1LA 3SV4A 2BZFA 4LEYA 2H3FA 2HN1A 4I2IA 3H38A 3UPQA 2MU2A 3LDAA 3QU4A 5DG8A 2XO7A 5FP0A 1ZQXA 5KG2A 3IG8A 3FC4A 5JU5A 4LEVA 3I76A 1LKYA 5J8YA 1SIJA 5CRXA 1H38A 3ISBA 4C4SA 5JTIA 4K4GA 5J2DA 7ICIA 1X9MA 2KSOA 1TAQA 1QSYA 2W7PA 4F92B 2AHOB 1V38A 5KFJA 4PZOA 4IG8A 2EH9A 2BHNA 4DS5A 2XC9A 2ZUBA 4I2JA 2P6UA 3QU9A 1L3UA 2M2WA 7ICUA 3H0MB 5AI5A 2KFNA 2HN2A 2EQYA 1DXSA 1C20A 2M9NA 4NL9A 3E58A 1DGSA 2WTFA 3PW5A 4OJ5A 2F1JA 1S9FA 4ECVA 3WK9A 2JRZA 2QARA 4ACOA 3BQ0A 2V9WA 5J29A 2DGZA 2HHVA 4QZCA 1QCKA 4F5RA 9ICQA 2YMLA 5KFXA 1M6YA 1J2NA 2Y9UA 2G07A 9ICLA 9ICPA 2RFFA 4QW9A 4JLZA 2DF4B 3RRHA 3RJFA 3GFKB 2NV3A 4BXOB 5IIMA 1D8BA 2E3TA 1ZQMA 4K97A 4AT7B 4CCHA 1CRXA 4YN4A 2E1EA 1T4GA 4BDPA 4QZ9A 2K4EA 2W04A 4O9MA 4I2CA 4X4TA 3ZDCA 5KL1B 2J6UA 2W11A 4DOCA 4ECYA 2OEHA 1N2XA 2M2TA 3PR4A 2HOIA 1EXNA 5HMLA 3THVA 2D8CA 9ICXA 2XICA 1KQQA 3RH6A 9ICUA 4WC5A 2NYVA 1U49A 3RR8A 4RQ5A 3KZIU 5DGBA 2QB0B 4YR2A 4RPZA 4M9JA 4QWAA 3GILA 2H3QA 1T3QA 2JV3A 4QIWF 4RQ1A 4X4VA 1S0MA 2JEJA 5HMMA 2KOBA 3HILA 4RUCA 2PKEA 4M6WA 3JPPA 1UA0A 2ZJ5A 9ICIA 4KLDA 2W7OA 3HJ4A 3KD3A 4Y2PA 1U47A 3AQNA 4UD4A 5C5JA 2ZXHA 2W54A 8ICZA 1S0NA 2W03A 4TQSA 2CPRA 2KNJA 4UW9A 1NJYA 3PV8A 1BNPA 1NNLA 3T79A 4K8VA 3SAFA 5AI8A 3TFSA 4WQKA 3AL0B 3MBYA 1DGJA 5ALNA 3BQ2A 4GXIA 4NXZA 1QLNA 1NOMA 5DBCA 1XNSA 5ALJA 4XJEA 5AK3A 1XC9A 3JPNA 4NM1A 3CRXA 5L1MA 3N97B 4IC9A 2ASJA 3PO4A 4E0DA 3PX0A 2PFNA 3JPTA 3KKAC 4OAHA 1JMSA 5J0OA 4FE3A 3BQ1A 4O68A 1B0XA 5HNKA 1TFYA 4ELVA 9ICGA 3ZD8A 3K7DA 4O3PA 1ECWA 3MR6A 4QWBA 5KAIU 1TK0A 2BGWA 1LV5A 2DPJA 4Y2TA 8ICUA 5KFNA 4O5CA 3EUB2 3RB4A 5DBAA 3FM9A 1SL1A 4E7XA 1KSPA 1IV8A 3MABA 7ICTA 8ICEA 3V7LA 1R8CA 3L5KA 3VC8A 2ZIWB 5HP4A 9ICHA 1L3TA 2E1FA 1ZD3A 1K1SA 4F4YA 2FCLA 4P4OA 2G5HB 1SKRA 1KRPA 5IIIA 3RBDA 2V4RA 3AQMA 2BPGA 9ICTA 4EGWA 1F5SA 1MQ3A 2IOHA 4KMOB 3K1ZA 5KFIA 5AKLA 4GC6A 4NLCA 4Z6DA 4IRKA 4TUQA 1ZQGA 2DL0A 5HR6A 4J9OA 3LVWA 4U7CA 8ICSA 4QNLA 2LBOA 1IM4A 4WJ3B 1ZQWA 4O3QA 4YCXA 2OH2A 5AIBA 4MEXA 1S0VA 1WCLA 5L1JA 2IOFA 4WC3A 2FMPA 2D3DA 2HVHA 2ATLA 2R8JA 3KFUF 2DFLA 4DQSA 4YD1A 4PH5A 4F72A 3M9MB 4ED8A 4WH5A 4F4XA 1SWWA 3PX6A 7ICNA 2Y1JA 5J0UA 3PSFA 1ZQCA 4NXVA 2A3VA 2DR9A 3WKDA 1RYSA 3T5KA 3PMNA 4QZDA 4F3OA 1SV0A 3HPOA 2B56A 2EZZA 2K8AA 3K4GA 3SI8A 5H2FU 4XUSA 4LVSA 5B3QA 4QZIA 1DOQA 2ISPA 2E8OA 3WFSC 5J0WA 1A76A 2HMXA 3PW7A 4UASA 2VIXA 4NY8A 5AKGA 9ICOA 5ALQA 5JUMA 3ZI4A 3D2SA 8ICYA 1BPXA 4Q8EA 1HJPA 2FLNA 4MHVA 4Z6CA 8ICXA 5ALUA 4PHEA 4PHPA 5CJ7A 5D63A 1RM6C 4FBTA 2L5YA 1SL2A 2JR5A 5ALVA 4WC2A
chains in the Genus database with same CATH topology
2VANA 3OHAA 4QWEA 1LB2B 3FDSA 3M9OB 4QWDA 5HHIA 5KFLA 2IHNA 4DQQA 1ZQOA 2BCQA 2ASDA 5IINA 1QTMA 2IMWP 2JEIA 1TAUA 7ICEA 1DK2A 4JV0A 5D49A 8ICBA 3GDXA 3ISDA 2AQ4A 4M04A 2F1HA 3EPGA 4R63A 3ZD9A 2DR7A 4MFAA 5IILA 3PX4A 4RU9A 4BWMA 4QZAA 4ED0A 7ICSA 3KTQA 1KLNA 5J2GA 4ED6A 3WFRE 4QZFA 3UXNA 1ZQDA 5L9XA 2JEFA 1JXEA 1RZTA 5KFOA 3EW9A 3MFIA 2F1IA 3AQLA 2P66A 2HHTA 4IR1A 2HHPA 4QZGA 3MGIA 4MEYA 2W9BA 5L1IA 4ECUA 5DLFA 3G6YA 4NLNA 4TUPA 4AT8B 3RAQA 3T3FA 4X0AA 1ZQFA 2ZTDA 3HW8A 4ECXA 1RYRA 2KZZA 8ICMA 4M9NA 4B9LA 5DQGA 5J0YA 8ICRA 3H37A 2KZ3A 1S0OA 5KFMA 3Q8LA 2MUTB 5KTQA 4DSFA 1KTQA 5DLGA 4BXOA 7ICVA 4ATBB 4M5DA 5CB1A 5DB9A 2BCSA 5J0QA 1AROP 4I2DA 1RXWA 1ZQPA 4TQRA 1CEZA 3TFRA 4MFCA 5KG4A 5KT7A 7ICKA 3MR2A 2ZJAA 3KHLA 2ALZA 2C2DA 2BDPA 4M9GA 4M2YA 2AJQA 1UT5A 4NLKA 4YP3A 3C5FA 1Q78A 2R8HA 2ZTEA 5D46A 4UQGA 4P4PA 3WFOA 1BPZA 2NRKA 1NK8A 2HHSA 5DBBA 4DF8A 2XGQA 3QZ7A 3LWLA 4F4WA 4DL3A 3BQTA 5F9NA 1QSSA 4I2AA 4KLOA 4KN7A 4J9NA 3Q8RB 4RT2A 4X4NA 5J2KA 3RH4A 1ZQKA 2BPCA 2GWSA 1KFTA 5HRGA 4X4QA 8ICNA 2PFPA 2C22A 3GIIA 4ED3A 4FO6A 4EBKA 1Z00A 5KFYA 4UB5A 1MQ2A 4TURA 3RB3A 5DG7A 7ICPA 3OUYA 3KHRA 2FPMA 5KFVA 1WOTA 1TK8A 4XQ8A 1XU4A 3NTUA 4PHAA 4YMNA 1CUKA 2A1JB 2FPKA 4YXJA 4PHDA 4GLXA 3C2LA 3AU6A 3RTVA 5HRLA 3ORYA 3EPIA 5KT5A 3E2EA 4ECZA 5TZVA 1COOA 5J0SA 1ZQTA 5J0PA 1TKDA 8ICAA 4WC0A 2AQ0A 1KFDA 2XCAA 4PGQA 2W8LA 1NK9A 3MDAA 4O3NA 2BKEA 1SKSA 4X4RA 3AUOA 4IQWA 2NRWA 3Q8PB 3C5GA 4FHWA 5HR9A 5DB7A 5HRKA 5DB8A 4J9QA 4FS2A 4K4HA 4FS1A 4I28A 2IHMA 4ELTA 8ICCA 2PI4A 5L1LA 3ZDEA 1BPBA 2JZBA 3SV4A 5L1KA 4M9LA 3UXPA 1TFRA 1X2IA 4I2IA 3OJSA 3KHHA 5EWFA 3H38A 3UPQA 1JX4A 4I29A 3WFPA 4QWCA 4IRCA 4FHYA 3LDAA 4KITB 3C66A 5DG8A 2XO7A 4YG2A 5KFGA 4C8KA 1ZQXA 5J0RA 5KG2A 5HRIA 3PR5B 2BQRA 5D4BA 5EOZA 5KFEA 4DSEA 3H39A 4DEZA 9ICNA 4WC2A 1H38A 2ZH1A 3ISBA 1RPLA 2J6SA 3TI0A 1JQRA 3RAXA 2R8GA 4K4GA 5J2DA 7ICIA 1X9MA 2P6RA 1TAQA 2W8KA 2M2VA 3GIKA 4F4ZA 1QSYA 2KP7A 3PO5A 4F92B 2Y1IA 1PX5A 1D9DA 5KFJA 3NGDA 4Z6EA 4IG8A 4AT9B 1R89A 2BHNA 4DS5A 2XC9A 2ZUBA 3B0YA 4YMOA 4I2JA 4KLFA 4F93B 5KFUA 5CA7A 4YXMA 2P6UA 4R64A 3OHBA 5KFTA 2ZH6A 4RQ0A 2O5AA 2NRZA 4I2GA 1SZPA 3AQKA 5KG3A 1ZQZA 1U48A 1L3UA 4B9VA 2M2WA 4RNNA 4C8LA 7ICUA 3GV8B 4EBCA 2KFNA 3UXOA 3UQ0A 8ICKA 7ICHA 3H3AA 3WFQE 1BNOA 4DFPA 4J9RA 2MAXA 2M9NA 5J2FA 1NKCA 7ICMA 1DGSA 1BPDA 2WTFA 4GXKA 2XCPA 3PW5A 1PZNA 1ZQJA 2F1JA 5KFKA 1S9FA 4ECVA 1U4BA 3PY8A 5KFBA 4DSLA 8ICGA 1U9LA 4YVZA 4RZRA 3M8RA 3RJIA 2AGPA 4DSJA 4F91B 2VA8A 4Q44A 4EZ9A 4B9TA 3BQ0A 4WBYA 2V9WA 5J29A 4ED7A 2HHVA 2R8IA 4QZCA 9ICRA 2DR8A 4YMMA 3OSPA 1ZYQA 2UVWA 1ZQHA 1L3SA 4F5RA 3OSNA 4GC7A 3G6VA 4PGYA 2Q0ZX 1RXVA 2BCUA 1Z3EB 5KFXA 4J9PA 4MF2A 4NM2A 9ICLA 5CWRA 3HX0A 1UT8A 4QW9A 9ICPA 2RFFA 3H4DA 8ICLA 5J2CA 4B9SA 3MFHA 8ICQA 5HREA 4HYKA 3RRHA 1D9FA 4KLTA 2C2RA 2PBEA 3OVBA 3RJFA 3GFKB 2H5XA 2DR5A 4BXOB 5IIMA 5J2EA 1MIWA 4JK1A 3BDPA 3H8WA 2PI5A 1ZQMA 2XY5A 4AT7B 1T8EA 4CCHA 2ZH2A 4I2HA 4YN4A 4B9UA 1ZQQA 4K4IA 2HHQA 1T4GA 4UBBA 4BDPA 4QZ9A 5KFFA 4ECWA 1ZJNA 4O9MA 1BVSA 5HRHA 4I2CA 4F5PA 4X4TA 3ZDCA 4BWJA 2J6UA 4DOCA 5HRBA 1JAJA 8ICTA 4ECYA 2IBKA 5HC9A 3N4MB 1MSWD 2M2TA 1MIVA 4I2FA 4QZ8A 1KDHA 1B22A 1KNYA 3JPOA 3PR4A 4NKTA 4RT3A 4O0IA 4KLMA 4XA5A 4O3OA 1BPEA 5KFQA 3T5LA 1JIHA 2FMSA 4S3NA 1EXNA 1XO1A 1Z00B 1ZQUA 5HMLA 3THVA 4EYIB 1ZQAA 1ZQNA 4DSIA 9ICXA 3RH6A 9ICUA 3OUYB 4WC5A 3C2MA 2NRVA 1ZQEA 4IQUA 1U49A 1ZQYA 1HUOA 4O5KA 2HVIA 4YD2A 9ICBA 4WCWA 2Q66A 5KFSA 4AT8A 4XRHA 3RR8A 4XQ7A 4KTQA 4RQ5A 3OVAA 2DVIA 1S77D 5DGBA 3OGUA 4RPYA 3ETLA 5BPCA 4RPZA 4YR2A 3LK9A 3QZ8A 4F8RA 4QWAA 3GILA 4M9JA 2C2EA 3NYBA 3M8SA 4DFJA 4ATBA 1F5AA 1ZQLA 9ICKA 1ZQIA 4IQTA 1BGXT 4RQ1A 3C1YA 4UB3A 1S0MA 4DQRA 4F4KA 1R8AA 4X4VA 3TAPA 4X5VA 5F9LA 1S76D 3GV5B 4RNMA 5HMMA 2JEJA 4NKUA 5KG1A 4RUCA 3JPQA 2ASLA 2W9CB 2JZBB 4M47A 4M6WA 5KG6A 1NK4A 3JPPA 2JEGA 3RJEA 4LT6A 1UA0A 2ZJ5A 4UBCA 4MF8A 2RDIA 5J0XA 1ZQRA 9ICIA 1V4AA 4UB2A 1TK5A 3JZ0A 3JPSA 4P2HA 4UB1A 1D8LA 4DLEA 5EWEA 5J2AA 3MR5A 4DQIA 3B0XA 4KLDA 4O3SA 3LQCB 3HJ4A 2PFQA 3SZ2A 2XY7A 4EP7A 2W9MA 4DO9A 2ZTCA 4J9MA 8ICHA 4UAYA 1K1QA 4IQVA 1U47A 4R65A 3EWAA 2BQ3A 3AQNA 4UD4A 5C5JA 1MC8A 5DDYA 4F5OA 1U45A 1S0NA 8ICZA 3RRGA 4TQSA 3FYHA 4NLGA 2I1QA 3OVSA 4UAWA 5DQHA 4RUAA 3EZ5A 4JWMA 3JYYA 4C8NA 4C8MA 1T3NA 1NJYA 3M9NB 3PV8A 1VJ7A 2VA3A 2ID1A 9ICJA 4ECQA 4UB4A 4ECTA 1BNPA 4X0BA 4B9NA 3TARA 4X4PA 2FMQA 2BE3A 2ZH7A 4ECRA 3TFSA 3L9DA 4RQ7A 1IXRA 5KFZA 4QZBA 2R8KA 1UA1A 5KG7A 5KT3A 5DB6A 7ICOA 4FH3A 3MBYA 5IIKA 4J9KA 5KFHA 5KT6A 3Q8QB 5DG9A 5J2BA 4DFKA 4J9SA 4DLGA 3QE9Y 2UVRA 2ZH3A 1XWLA 3GIMA 3BQ2A 4Z6FA 4BGDA 4GXIA 4NXZA 4KLHA 1NOMA 5IIJA 5DBCA 4F5QA 7ICFA 5J2IA 1QLNA 3IHQB 1XC9A 4KLUA 4UAZA 3JPNA 4NM1A 4DSKA 3H8JA 3N97B 4GXJA 2ASJA 3IM1A 7ICRA 4RWQA 1R8BA 1NJWA 2ZJ8A 5KFDA 3V6HA 2UVVA 3PO4A 4E0DA 3EYZA 3PX0A 8ICFA 4DL4A 3JPTA 2PFNA 4KLQA 8ICWA 1JMSA 2LYHA 2ZH8A 5J0OA 4KLGA 4JV2A 4RWPA 1SKWA 3BQ1A 3PW2A 5HNKA 1TFYA 3RJJA 3V72A 1NK7A 4ELVA 9ICGA 4KLLA 5BOLA 1YLQA 2ZH5A 3ZD8A 5CP2A 2NRTA 2XY6A 3H8SA 2DRAA 4O3PA 5KT4A 3MR6A 4QWBA 2ZUCA 3PW0A 1NK5A 2W9BB 1TK0A 1HUZA 3ZDBA 2BGWA 3ZDDA 2NRXA 2M2UA 2PXIA 4EBEA 3QEBZ 4FHPA 3QEAZ 4WBZA 1LV5A 4R8UA 4RQ4A 3V6KA 2DPJA 4KLJA 8ICUA 4ECSA 5KFNA 4O5CA 4EZ6A 3RB4A 3HJ1A 1ZQBA 7ICJA 4X4UA 3T5JA 1V9PA 3Q8SB 3H7IA 2ISOA 5DBAA 2KFZA 4NLZA 3HWTA 2BCVA 1SL1A 8ICPA 3ISCA 1JN3A 2W9AA 4J9LA 4Q45A 3MABA 1KSPA 2IA6A 7ICTA 8ICEA 4E7XA 3TANA 5BOMA 3V7LA 1R8CA 4FHVA 4RQ3A 5J2HA 4DL5A 1B43A 5EWGA 2I9GA 4JV1A 4UD5A 4DOAA 3BJYA 5HP4A 4F5NA 4DQPA 9ICHA 3C23A 3V7JA 4DF4A 1L3TA 2BR0A 2DRBA 3OJUA 1DK3A 1UEVA 3G6XA 1K1SA 4F4YA 2ZH9A 4P4OA 4KN4A 2BCRA 2J6TA 3Q8KA 1SKRA 1KRPA 4I27A 4WC6A 5IIIA 4TUSA 3HP6A 4ED2A 3RBDA 7ICLA 4DOBA 2V4RA 3AQMA 2BPGA 3C18A 3SYZA 9ICTA 1MQ3A 8ICIA 3C1ZA 1UEUA 3PVXA 4IRDA 4FHXA 1XSPA 4WC1A 1N56A 3GV7B 5KFIA 3MDCA 3H4BA 4EBDA 5KFCA 4GC6A 4DFMA 3RB6A 3LWMA 1S97A 1SL0A 4QW8A 8ICJA 5IIOA 4Z6DA 3V6JA 1JXLA 4ED1A 2DR9A 4O3RA 3PMLA 4IRKA 4WC7A 4TUQA 1ZQGA 4EBJA 4KMUA 1NKBA 2MUTA 4M6WB 5DKWA 4QZEA 2V4QA 1L3VA 1BPYA 4MFFA 5F2VO 2ZHBA 4J9OA 5J0TA 3HIYA 8ICSA 4X4SA 3T5HA 1IM4A 3HT3A 1TVAA 1KFSA 1ZQWA 2UVUA 2FLPA 4ELUA 7ICQA 3RB0A 3AU2A 4O3QA 2B21A 4RQ2A 1NJZA 1D8YA 1X9SA 4PPXA 9ICFA 4YCXA 3RJHA 5KG0A 1OU5A 4EYHB 3TAQA 4I2EA 3V7KA 4MEXA 1C7YA 1S0VA 5HRFA 2BPFA 9ICMA 9ICVA 9ICEA 9ICQA 1WCLA 3RJKA 5L1JA 1FA0A 4QZHA 4WC3A 4Q43A 5KFWA 2FMPA 3RBEA 4ZH4A 1ZQSA 2DPIA 2ATLA 2HVHA 3JPRA 5KT2A 2R8JA 8ICOA 5KFPA 2DFLA 5KFAA 1ZETA 2C28A 4DQSA 4YD1A 3KHGA 7ICGA 4P4MA 2KTQA 1A77A 4PH5A 2AGQA 1TFWA 3M9MB 2ZUDA 4YR0A 4ED8A 3TQ1A 4YR3A 3PNCA 4F50A 4F4XA 9ICAA 2HHWA 4RWOA 1NK0A 3PX6A 5CR0A 2Y1JA 7ICNA 5J0UA 1XSNA 2OWOA 2A1JA 2AGOA 1UETA 4WC4A 1ZQCA 5KG5A 3H40A 4JUZA 2BQUA 9ICSA 4R66A 3MR3A 3C21A 1RYSA 4G3IA 3T5KA 3PMNA 4QZDA 3MGHA 2W9CA 4F3OA 4M0AA 9ICWA 1MIYA 2ZH4A 4DL7A 1NK6A 5DECA 1NO5A 1XS9D 3HPOA 1NJXA 5HRDA 2VA2A 3SI8A 3K4GA 3RR7A 4XUSA 4JWNA 4LVSA 2HW3A 8ICVA 4DL2A 1XSLA 5DEDA 1ZQVA 1L5UA 1QSLA 4QZIA 4M9HA 4LZDA 1DOQA 4RWNA 3OV7A 4RNOA 4F2SA 3SV3A 2HHXA 2ISPA 3WFSC 5J0WA 1A76A 3C2KA 4KLSA 3UPSA 5J2JA 1NKEA 9ICCA 1X9WA 3PW7A 4IR9A 2AU0A 3GQCA 2PFOA 4B9MA 2HHUA 5DQIA 4YQWA 1NZPA 4EEYA 3RH5A 3Q8MA 1KEJA 2RDJA 4X4OA 5KFRA 4NY8A 4E80A 5DGAA 4PGXA 4RPXA 4O5EA 9ICOA 1TV9A 3UQ2A 5CHGA 2KZMA 1WCNA 5JUMA 4DWIA 2FPLA 1ZJMA 2ZHAA 3RJGA 3GIJA 4R8UB 4E8FA 8ICYA 1VFGA 1BPXA 4Q8EA 2XGPA 1HJPA 2FLNA 1T7PA 1N48A 4Z6CA 4AT9A 4C8OA 4FBUA 8ICXA 4KLIA 4AT7A 3PW4A 1S10A 4I2BA 4PHEA 4F2RA 4PHPA 3ZDAA 4LZGA 1Y88A 5CJ7A 5HHHA 2FLLA 4YFKA 3K75D 4FH5A 2KN7A 4FBTA 4Q8FA 4RQ8A 1SL2A 4DL6A 4DS4A 5DDMA 4KLEA 1Q79A 2O1PA 4RQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VAN A;  3OHA A;  4QWE A;  1LB2 B;  3FDS A;  3M9O B;  4QWD A;  5HHI A;  5KFL A;  2IHN A;  4DQQ A;  1ZQO A;  2BCQ A;  2ASD A;  5IIN A;  1QTM A;  2IMW P;  2JEI A;  1TAU A;  7ICE A;  1DK2 A;  4JV0 A;  5D49 A;  8ICB A;  3GDX A;  3ISD A;  2AQ4 A;  4M04 A;  2F1H A;  3EPG A;  4R63 A;  3ZD9 A;  2DR7 A;  4MFA A;  5IIL A;  3PX4 A;  4RU9 A;  4BWM A;  4QZA A;  4ED0 A;  7ICS A;  3KTQ A;  1KLN A;  5J2G A;  4ED6 A;  3WFR E;  4QZF A;  3UXN A;  1ZQD A;  5L9X A;  2JEF A;  1JXE A;  1RZT A;  5KFO A;  3EW9 A;  3MFI A;  2F1I A;  3AQL A;  2P66 A;  2HHT A;  4IR1 A;  2HHP A;  4QZG A;  3MGI A;  4MEY A;  2W9B A;  5L1I A;  4ECU A;  5DLF A;  3G6Y A;  4NLN A;  4TUP A;  4AT8 B;  3RAQ A;  3T3F A;  4X0A A;  1ZQF A;  2ZTD A;  3HW8 A;  4ECX A;  1RYR A;  2KZZ A;  8ICM A;  4M9N A;  4B9L A;  5DQG A;  5J0Y A;  8ICR A;  3H37 A;  2KZ3 A;  1S0O A;  5KFM A;  3Q8L A;  2MUT B;  5KTQ A;  4DSF A;  1KTQ A;  5DLG A;  4BXO A;  7ICV A;  4ATB B;  4M5D A;  5CB1 A;  5DB9 A;  2BCS A;  5J0Q A;  1ARO P;  4I2D A;  1RXW A;  1ZQP A;  4TQR A;  1CEZ A;  3TFR A;  4MFC A;  5KG4 A;  5KT7 A;  7ICK A;  3MR2 A;  2ZJA A;  3KHL A;  2ALZ A;  2C2D A;  2BDP A;  4M9G A;  4M2Y A;  2AJQ A;  1UT5 A;  4NLK A;  4YP3 A;  3C5F A;  1Q78 A;  2R8H A;  2ZTE A;  5D46 A;  4UQG A;  4P4P A;  3WFO A;  1BPZ A;  2NRK A;  1NK8 A;  2HHS A;  5DBB A;  4DF8 A;  2XGQ A;  3QZ7 A;  3LWL A;  4F4W A;  4DL3 A;  3BQT A;  5F9N A;  1QSS A;  4I2A A;  4KLO A;  4KN7 A;  4J9N A;  3Q8R B;  4RT2 A;  4X4N A;  5J2K A;  3RH4 A;  1ZQK A;  2BPC A;  2GWS A;  1KFT A;  5HRG A;  4X4Q A;  8ICN A;  2PFP A;  2C22 A;  3GII A;  4ED3 A;  4FO6 A;  4EBK A;  1Z00 A;  5KFY A;  4UB5 A;  1MQ2 A;  4TUR A;  3RB3 A;  5DG7 A;  7ICP A;  3OUY A;  3KHR A;  2FPM A;  5KFV A;  1WOT A;  1TK8 A;  4XQ8 A;  1XU4 A;  3NTU A;  4PHA A;  4YMN A;  1CUK A;  2A1J B;  2FPK A;  4YXJ A;  4PHD A;  4GLX A;  3C2L A;  3AU6 A;  3RTV A;  5HRL A;  3ORY A;  3EPI A;  5KT5 A;  3E2E A;  4ECZ A;  5TZV A;  1COO A;  5J0S A;  1ZQT A;  5J0P A;  1TKD A;  8ICA A;  4WC0 A;  2AQ0 A;  1KFD A;  2XCA A;  4PGQ A;  2W8L A;  1NK9 A;  3MDA A;  4O3N A;  2BKE A;  1SKS A;  4X4R A;  3AUO A;  4IQW A;  2NRW A;  3Q8P B;  3C5G A;  4FHW A;  5HR9 A;  5DB7 A;  5HRK A;  5DB8 A;  4J9Q A;  4FS2 A;  4K4H A;  4FS1 A;  4I28 A;  2IHM A;  4ELT A;  8ICC A;  2PI4 A;  5L1L A;  3ZDE A;  1BPB A;  2JZB A;  3SV4 A;  5L1K A;  4M9L A;  3UXP A;  1TFR A;  1X2I A;  4I2I A;  3OJS A;  3KHH A;  5EWF A;  3H38 A;  3UPQ A;  1JX4 A;  4I29 A;  3WFP A;  4QWC A;  4IRC A;  4FHY A;  3LDA A;  4KIT B;  3C66 A;  5DG8 A;  2XO7 A;  4YG2 A;  5KFG A;  4C8K A;  1ZQX A;  5J0R A;  5KG2 A;  5HRI A;  3PR5 B;  2BQR A;  5D4B A;  5EOZ A;  5KFE A;  4DSE A;  3H39 A;  4DEZ A;  9ICN A;  4WC2 A;  1H38 A;  2ZH1 A;  3ISB A;  1RPL A;  2J6S A;  3TI0 A;  1JQR A;  3RAX A;  2R8G A;  4K4G A;  5J2D A;  7ICI A;  1X9M A;  2P6R A;  1TAQ A;  2W8K A;  2M2V A;  3GIK A;  4F4Z A;  1QSY A;  2KP7 A;  3PO5 A;  4F92 B;  2Y1I A;  1PX5 A;  1D9D A;  5KFJ A;  3NGD A;  4Z6E A;  4IG8 A;  4AT9 B;  1R89 A;  2BHN A;  4DS5 A;  2XC9 A;  2ZUB A;  3B0Y A;  4YMO A;  4I2J A;  4KLF A;  4F93 B;  5KFU A;  5CA7 A;  4YXM A;  2P6U A;  4R64 A;  3OHB A;  5KFT A;  2ZH6 A;  4RQ0 A;  2O5A A;  2NRZ A;  4I2G A;  1SZP A;  3AQK A;  5KG3 A;  1ZQZ A;  1U48 A;  1L3U A;  4B9V A;  2M2W A;  4RNN A;  4C8L A;  7ICU A;  3GV8 B;  4EBC A;  2KFN A;  3UXO A;  3UQ0 A;  8ICK A;  7ICH A;  3H3A A;  3WFQ E;  1BNO A;  4DFP A;  4J9R A;  2MAX A;  2M9N A;  5J2F A;  1NKC A;  7ICM A;  1DGS A;  1BPD A;  2WTF A;  4GXK A;  2XCP A;  3PW5 A;  1PZN A;  1ZQJ A;  2F1J A;  5KFK A;  1S9F A;  4ECV A;  1U4B A;  3PY8 A;  5KFB A;  4DSL A;  8ICG A;  1U9L A;  4YVZ A;  4RZR A;  3M8R A;  3RJI A;  2AGP A;  4DSJ A;  4F91 B;  2VA8 A;  4Q44 A;  4EZ9 A;  4B9T A;  3BQ0 A;  4WBY A;  2V9W A;  5J29 A;  4ED7 A;  2HHV A;  2R8I A;  4QZC A;  9ICR A;  2DR8 A;  4YMM A;  3OSP A;  1ZYQ A;  2UVW A;  1ZQH A;  1L3S A;  4F5R A;  3OSN A;  4GC7 A;  3G6V A;  4PGY A;  2Q0Z X;  1RXV A;  2BCU A;  1Z3E B;  5KFX A;  4J9P A;  4MF2 A;  4NM2 A;  9ICL A;  5CWR A;  3HX0 A;  1UT8 A;  4QW9 A;  9ICP A;  2RFF A;  3H4D A;  8ICL A;  5J2C A;  4B9S A;  3MFH A;  8ICQ A;  5HRE A;  4HYK A;  3RRH A;  1D9F A;  4KLT A;  2C2R A;  2PBE A;  3OVB A;  3RJF A;  3GFK B;  2H5X A;  2DR5 A;  4BXO B;  5IIM A;  5J2E A;  1MIW A;  4JK1 A;  3BDP A;  3H8W A;  2PI5 A;  1ZQM A;  2XY5 A;  4AT7 B;  1T8E A;  4CCH A;  2ZH2 A;  4I2H A;  4YN4 A;  4B9U A;  1ZQQ A;  4K4I A;  2HHQ A;  1T4G A;  4UBB A;  4BDP A;  4QZ9 A;  5KFF A;  4ECW A;  1ZJN A;  4O9M A;  1BVS A;  5HRH A;  4I2C A;  4F5P A;  4X4T A;  3ZDC A;  4BWJ A;  2J6U A;  4DOC A;  5HRB A;  1JAJ A;  8ICT A;  4ECY A;  2IBK A;  5HC9 A;  3N4M B;  1MSW D;  2M2T A;  1MIV A;  4I2F A;  4QZ8 A;  1KDH A;  1B22 A;  1KNY A;  3JPO A;  3PR4 A;  4NKT A;  4RT3 A;  4O0I A;  4KLM A;  4XA5 A;  4O3O A;  1BPE A;  5KFQ A;  3T5L A;  1JIH A;  2FMS A;  4S3N A;  1EXN A;  1XO1 A;  1Z00 B;  1ZQU A;  5HML A;  3THV A;  4EYI B;  1ZQA A;  1ZQN A;  4DSI A;  9ICX A;  3RH6 A;  9ICU A;  3OUY B;  4WC5 A;  3C2M A;  2NRV A;  1ZQE A;  4IQU A;  1U49 A;  1ZQY A;  1HUO A;  4O5K A;  2HVI A;  4YD2 A;  9ICB A;  4WCW A;  2Q66 A;  5KFS A;  4AT8 A;  4XRH A;  3RR8 A;  4XQ7 A;  4KTQ A;  4RQ5 A;  3OVA A;  2DVI A;  1S77 D;  5DGB A;  3OGU A;  4RPY A;  3ETL A;  5BPC A;  4RPZ A;  4YR2 A;  3LK9 A;  3QZ8 A;  4F8R A;  4QWA A;  3GIL A;  4M9J A;  2C2E A;  3NYB A;  3M8S A;  4DFJ A;  4ATB A;  1F5A A;  1ZQL A;  9ICK A;  1ZQI A;  4IQT A;  1BGX T;  4RQ1 A;  3C1Y A;  4UB3 A;  1S0M A;  4DQR A;  4F4K A;  1R8A A;  4X4V A;  3TAP A;  4X5V A;  5F9L A;  1S76 D;  3GV5 B;  4RNM A;  5HMM A;  2JEJ A;  4NKU A;  5KG1 A;  4RUC A;  3JPQ A;  2ASL A;  2W9C B;  2JZB B;  4M47 A;  4M6W A;  5KG6 A;  1NK4 A;  3JPP A;  2JEG A;  3RJE A;  4LT6 A;  1UA0 A;  2ZJ5 A;  4UBC A;  4MF8 A;  2RDI A;  5J0X A;  1ZQR A;  9ICI A;  1V4A A;  4UB2 A;  1TK5 A;  3JZ0 A;  3JPS A;  4P2H A;  4UB1 A;  1D8L A;  4DLE A;  5EWE A;  5J2A A;  3MR5 A;  4DQI A;  3B0X A;  4KLD A;  4O3S A;  3LQC B;  3HJ4 A;  2PFQ A;  3SZ2 A;  2XY7 A;  4EP7 A;  2W9M A;  4DO9 A;  2ZTC A;  4J9M A;  8ICH A;  4UAY A;  1K1Q A;  4IQV A;  1U47 A;  4R65 A;  3EWA A;  2BQ3 A;  3AQN A;  4UD4 A;  5C5J A;  1MC8 A;  5DDY A;  4F5O A;  1U45 A;  1S0N A;  8ICZ A;  3RRG A;  4TQS A;  3FYH A;  4NLG A;  2I1Q A;  3OVS A;  4UAW A;  5DQH A;  4RUA A;  3EZ5 A;  4JWM A;  3JYY A;  4C8N A;  4C8M A;  1T3N A;  1NJY A;  3M9N B;  3PV8 A;  1VJ7 A;  2VA3 A;  2ID1 A;  9ICJ A;  4ECQ A;  4UB4 A;  4ECT A;  1BNP A;  4X0B A;  4B9N A;  3TAR A;  4X4P A;  2FMQ A;  2BE3 A;  2ZH7 A;  4ECR A;  3TFS A;  3L9D A;  4RQ7 A;  1IXR A;  5KFZ A;  4QZB A;  2R8K A;  1UA1 A;  5KG7 A;  5KT3 A;  5DB6 A;  7ICO A;  4FH3 A;  3MBY A;  5IIK A;  4J9K A;  5KFH A;  5KT6 A;  3Q8Q B;  5DG9 A;  5J2B A;  4DFK A;  4J9S A;  4DLG A;  3QE9 Y;  2UVR A;  2ZH3 A;  1XWL A;  3GIM A;  3BQ2 A;  4Z6F A;  4BGD A;  4GXI A;  4NXZ A;  4KLH A;  1NOM A;  5IIJ A;  5DBC A;  4F5Q A;  7ICF A;  5J2I A;  1QLN A;  3IHQ B;  1XC9 A;  4KLU A;  4UAZ A;  3JPN A;  4NM1 A;  4DSK A;  3H8J A;  3N97 B;  4GXJ A;  2ASJ A;  3IM1 A;  7ICR A;  4RWQ A;  1R8B A;  1NJW A;  2ZJ8 A;  5KFD A;  3V6H A;  2UVV A;  3PO4 A;  4E0D A;  3EYZ A;  3PX0 A;  8ICF A;  4DL4 A;  3JPT A;  2PFN A;  4KLQ A;  8ICW A;  1JMS A;  2LYH A;  2ZH8 A;  5J0O A;  4KLG A;  4JV2 A;  4RWP A;  1SKW A;  3BQ1 A;  3PW2 A;  5HNK A;  1TFY A;  3RJJ A;  3V72 A;  1NK7 A;  4ELV A;  9ICG A;  4KLL A;  5BOL A;  1YLQ A;  2ZH5 A;  3ZD8 A;  5CP2 A;  2NRT A;  2XY6 A;  3H8S A;  2DRA A;  4O3P A;  5KT4 A;  3MR6 A;  4QWB A;  2ZUC A;  3PW0 A;  1NK5 A;  2W9B B;  1TK0 A;  1HUZ A;  3ZDB A;  2BGW A;  3ZDD A;  2NRX A;  2M2U A;  2PXI A;  4EBE A;  3QEB Z;  4FHP A;  3QEA Z;  4WBZ A;  1LV5 A;  4R8U A;  4RQ4 A;  3V6K A;  2DPJ A;  4KLJ A;  8ICU A;  4ECS A;  5KFN A;  4O5C A;  4EZ6 A;  3RB4 A;  3HJ1 A;  1ZQB A;  7ICJ A;  4X4U A;  3T5J A;  1V9P A;  3Q8S B;  3H7I A;  2ISO A;  5DBA A;  2KFZ A;  4NLZ A;  3HWT A;  2BCV A;  1SL1 A;  8ICP A;  3ISC A;  1JN3 A;  2W9A A;  4J9L A;  4Q45 A;  3MAB A;  1KSP A;  2IA6 A;  7ICT A;  8ICE A;  4E7X A;  3TAN A;  5BOM A;  3V7L A;  1R8C A;  4FHV A;  4RQ3 A;  5J2H A;  4DL5 A;  1B43 A;  5EWG A;  2I9G A;  4JV1 A;  4UD5 A;  4DOA A;  3BJY A;  5HP4 A;  4F5N A;  4DQP A;  9ICH A;  3C23 A;  3V7J A;  4DF4 A;  1L3T A;  2BR0 A;  2DRB A;  3OJU A;  1DK3 A;  1UEV A;  3G6X A;  1K1S A;  4F4Y A;  2ZH9 A;  4P4O A;  4KN4 A;  2BCR A;  2J6T A;  3Q8K A;  1SKR A;  1KRP A;  4I27 A;  4WC6 A;  5III A;  4TUS A;  3HP6 A;  4ED2 A;  3RBD A;  7ICL A;  4DOB A;  2V4R A;  3AQM A;  2BPG A;  3C18 A;  3SYZ A;  9ICT A;  1MQ3 A;  8ICI A;  3C1Z A;  1UEU A;  3PVX A;  4IRD A;  4FHX A;  1XSP A;  4WC1 A;  1N56 A;  3GV7 B;  5KFI A;  3MDC A;  3H4B A;  4EBD A;  5KFC A;  4GC6 A;  4DFM A;  3RB6 A;  3LWM A;  1S97 A;  1SL0 A;  4QW8 A;  8ICJ A;  5IIO A;  4Z6D A;  3V6J A;  1JXL A;  4ED1 A;  2DR9 A;  4O3R A;  3PML A;  4IRK A;  4WC7 A;  4TUQ A;  1ZQG A;  4EBJ A;  4KMU A;  1NKB A;  2MUT A;  4M6W B;  5DKW A;  4QZE A;  2V4Q A;  1L3V A;  1BPY A;  4MFF A;  5F2V O;  2ZHB A;  4J9O A;  5J0T A;  3HIY A;  8ICS A;  4X4S A;  3T5H A;  1IM4 A;  3HT3 A;  1TVA A;  1KFS A;  1ZQW A;  2UVU A;  2FLP A;  4ELU A;  7ICQ A;  3RB0 A;  3AU2 A;  4O3Q A;  2B21 A;  4RQ2 A;  1NJZ A;  1D8Y A;  1X9S A;  4PPX A;  9ICF A;  4YCX A;  3RJH A;  5KG0 A;  1OU5 A;  4EYH B;  3TAQ A;  4I2E A;  3V7K A;  4MEX A;  1C7Y A;  1S0V A;  5HRF A;  2BPF A;  9ICM A;  9ICV A;  9ICE A;  9ICQ A;  1WCL A;  3RJK A;  5L1J A;  1FA0 A;  4QZH A;  4WC3 A;  4Q43 A;  5KFW A;  2FMP A;  3RBE A;  4ZH4 A;  1ZQS A;  2DPI A;  2ATL A;  2HVH A;  3JPR A;  5KT2 A;  2R8J A;  8ICO A;  5KFP A;  2DFL A;  5KFA A;  1ZET A;  2C28 A;  4DQS A;  4YD1 A;  3KHG A;  7ICG A;  4P4M A;  2KTQ A;  1A77 A;  4PH5 A;  2AGQ A;  1TFW A;  3M9M B;  2ZUD A;  4YR0 A;  4ED8 A;  3TQ1 A;  4YR3 A;  3PNC A;  4F50 A;  4F4X A;  9ICA A;  2HHW A;  4RWO A;  1NK0 A;  3PX6 A;  5CR0 A;  2Y1J A;  7ICN A;  5J0U A;  1XSN A;  2OWO A;  2A1J A;  2AGO A;  1UET A;  4WC4 A;  1ZQC A;  5KG5 A;  3H40 A;  4JUZ A;  2BQU A;  9ICS A;  4R66 A;  3MR3 A;  3C21 A;  1RYS A;  4G3I A;  3T5K A;  3PMN A;  4QZD A;  3MGH A;  2W9C A;  4F3O A;  4M0A A;  9ICW A;  1MIY A;  2ZH4 A;  4DL7 A;  1NK6 A;  5DEC A;  1NO5 A;  1XS9 D;  3HPO A;  1NJX A;  5HRD A;  2VA2 A;  3SI8 A;  3K4G A;  3RR7 A;  4XUS A;  4JWN A;  4LVS A;  2HW3 A;  8ICV A;  4DL2 A;  1XSL A;  5DED A;  1ZQV A;  1L5U A;  1QSL A;  4QZI A;  4M9H A;  4LZD A;  1DOQ A;  4RWN A;  3OV7 A;  4RNO A;  4F2S A;  3SV3 A;  2HHX A;  2ISP A;  3WFS C;  5J0W A;  1A76 A;  3C2K A;  4KLS A;  3UPS A;  5J2J A;  1NKE A;  9ICC A;  1X9W A;  3PW7 A;  4IR9 A;  2AU0 A;  3GQC A;  2PFO A;  4B9M A;  2HHU A;  5DQI A;  4YQW A;  1NZP A;  4EEY A;  3RH5 A;  3Q8M A;  1KEJ A;  2RDJ A;  4X4O A;  5KFR A;  4NY8 A;  4E80 A;  5DGA A;  4PGX A;  4RPX A;  4O5E A;  9ICO A;  1TV9 A;  3UQ2 A;  5CHG A;  2KZM A;  1WCN A;  5JUM A;  4DWI A;  2FPL A;  1ZJM A;  2ZHA A;  3RJG A;  3GIJ A;  4R8U B;  4E8F A;  8ICY A;  1VFG A;  1BPX A;  4Q8E A;  2XGP A;  1HJP A;  2FLN A;  1T7P A;  1N48 A;  4Z6C A;  4AT9 A;  4C8O A;  4FBU A;  8ICX A;  4KLI A;  4AT7 A;  3PW4 A;  1S10 A;  4I2B A;  4PHE A;  4F2R A;  4PHP A;  3ZDA A;  4LZG A;  1Y88 A;  5CJ7 A;  5HHH A;  2FLL A;  4YFK A;  3K75 D;  4FH5 A;  2KN7 A;  4FBT A;  4Q8F A;  4RQ8 A;  1SL2 A;  4DL6 A;  4DS4 A;  5DDM A;  4KLE A;  1Q79 A;  2O1P A;  4RQ6 A; 
#chains in the Genus database with same CATH topology
 3OHA A;  3FDS A;  3M9O B;  4CGZ A;  7ICE A;  8ICB A;  3GDX A;  3ISD A;  3EPG A;  3ZD9 A;  2DR7 A;  5ALL A;  3PX4 A;  4BWM A;  4ED0 A;  3KTQ A;  4ED6 A;  5KNI A;  4QZF A;  1PK1 B;  1KKX A;  5AHX A;  2KJ8 A;  2P66 A;  2HHT A;  2HHP A;  3BS5 A;  4AT8 B;  5AK6 A;  5L1I A;  2LYB A;  4B9L A;  2K4P A;  5J0Y A;  8ICR A;  3IN5 A;  5KFM A;  5AI9 A;  1KTQ A;  7ICV A;  3ONN A;  4M5D A;  4GFJ A;  5DB9 A;  4X0B A;  1RXW A;  5E79 U;  2XID A;  1J2M A;  2ALZ A;  2PMZ C;  5D46 A;  1L7M A;  2NRK A;  1ZRN A;  1NK8 A;  4DF8 A;  4DL3 A;  4KLO A;  5F9N A;  1QSS A;  4OCZ A;  4RT2 A;  4X4N A;  2YB1 A;  4EBK A;  2HBL A;  4HX0 A;  3A0B U;  3RB3 A;  3KHR A;  2FPM A;  1TK8 A;  4XQ8 A;  4I0U A;  5G5H A;  3NVV A;  2FPK A;  1N62 A;  3C2L A;  3AU6 A;  3E2E A;  5TZV A;  3RF9 A;  3NVW A;  2ZIX A;  4CF5 A;  2XCA A;  2YB4 A;  4OD0 A;  5B5E U;  3C5G A;  5HR9 A;  4FHW A;  5HRK A;  4J9Q A;  4FS2 A;  1NI3 A;  2JMG A;  4I28 A;  4ELT A;  4P0Q A;  4M9L A;  1ZXI A;  1TFR A;  3OJS A;  5ALE A;  1JX4 A;  4I29 A;  3WFP A;  4IRC A;  5AIC A;  4KIT B;  3HKZ C;  3ER8 C;  1Z4O A;  4LEZ A;  3D2N A;  5D4B A;  1RG6 A;  2WAQ C;  5EOZ A;  4DEZ A;  2HI0 A;  5AM5 A;  2ZH1 A;  2J6S A;  2R8G A;  1X66 A;  3GIK A;  2KP7 A;  5D61 A;  1ED1 A;  1PX5 A;  1D9D A;  1OUQ A;  4AT9 B;  1R89 A;  5CA7 A;  4OAG A;  3OHB A;  1N60 A;  2ZH6 A;  2R18 A;  2O5A A;  3RFA A;  4RNN A;  5C0Y A;  3GV8 B;  8ICK A;  3AEV A;  3H3A A;  1WUD A;  3KKA A;  1BNO A;  4UAT A;  4J9R A;  1B4F A;  4IS7 A;  3F5A A;  4X4S A;  1BPD A;  1ZQJ A;  5KFK A;  3I1Y A;  2KJ9 A;  1U9L A;  3AMZ A;  4YVZ A;  2AGP A;  1VJ5 A;  4Q44 A;  2A19 A;  1MA7 A;  3UMB A;  4C4T A;  4ED7 A;  2EZX A;  1ZYQ A;  2UVW A;  3G6V A;  4PGY A;  1RXV A;  4RQM A;  4NXT A;  2P35 A;  1UT8 A;  3H4D A;  3H0R B;  2DKX A;  3OVB A;  3C28 A;  2H5X A;  4I2H A;  2HHQ A;  5AIA A;  5KFF A;  4ECW A;  1ZJN A;  5HRH A;  2YMP A;  1JAJ A;  5HC9 A;  3M6K A;  5AI0 A;  1MSW D;  3ETR A;  1MIV A;  5G5G A;  1B22 A;  4NKT A;  4O0I A;  4KLM A;  4XA5 A;  1O03 A;  5KFQ A;  3T5L A;  4S3N A;  1HIW A;  3OUY B;  4C7Y A;  1ZQE A;  4IQU A;  1HUO A;  9ICB A;  3H0L B;  4YD2 A;  4AT8 A;  4OJL A;  3OVA A;  2E8M A;  3WKC A;  3ETL A;  4Y2Q A;  4F8R A;  5AK4 A;  2YY6 A;  1F5A A;  2KE7 A;  1ZQI A;  4UB3 A;  2VJ4 A;  4DQR A;  3TAP A;  5F9L A;  3CNH A;  4NKU A;  4M47 A;  2JZB B;  2JEG A;  3RJE A;  5AKJ A;  2LM1 A;  1S5L U;  4UBC A;  4MF8 A;  2RDI A;  1ZQR A;  1V4A A;  5TIS U;  3J81 j;  5J2A A;  3LQC B;  3SZ2 A;  2KVS A;  3GZF A;  4Y2U A;  4J9M A;  8ICH A;  1K1Q A;  4R65 A;  4QIW C;  4ZOH C;  2BQ3 A;  1SV0 C;  3KZX A;  2G0A A;  4F5O A;  1COK A;  3FYH A;  5ALD A;  4RUA A;  4JWM A;  2KV2 A;  4JB3 A;  4C8N A;  3NRZ A;  4EEK A;  1VJ7 A;  4ECQ A;  3TAR A;  5A0L A;  4X4P A;  5AKX A;  4ECR A;  1IXR A;  5KG7 A;  5KT3 A;  7ICO A;  4DFK A;  2WF5 A;  4DLG A;  4C0Z A;  1XWL A;  4BGD A;  5IIJ A;  7ICF A;  1JAL A;  4F5Q A;  5J2I A;  4DSK A;  3H8J A;  3WK5 A;  4K98 A;  7ICR A;  4RWQ A;  1R8B A;  1NJW A;  2ZJ8 A;  2IUB A;  8ICF A;  3QNM A;  3EYZ A;  4DL4 A;  3IV6 A;  1WYG A;  4KLQ A;  4LJX A;  4CF3 A;  2ZH8 A;  4IL6 U;  4KLG A;  2LPE A;  5AKE A;  3QU5 A;  5AKK A;  3V72 A;  1YLQ A;  4KLL A;  5CP2 A;  3H8S A;  3PW0 A;  2ZUC A;  1NK5 A;  3ZDB A;  3ZDD A;  4WCW A;  4FHP A;  4R8U A;  3V6K A;  4EV6 A;  4CNQ A;  3HJ1 A;  3H7I A;  2KFZ A;  3HWT A;  5ALF A;  4CF4 A;  8ICP A;  2W9A A;  4B6J A;  4FHV A;  2LMR A;  4RQ3 A;  1QQ5 A;  4UD5 A;  1DRG A;  4DQP A;  3V7J A;  3WKB A;  1L7P A;  2DRB A;  1URJ A;  2YMM A;  2OXO A;  4I27 A;  3HP6 A;  7ICL A;  4DOB A;  5B66 U;  3WKA A;  2EAN A;  1NZB A;  3PVX A;  2ESE A;  2MSN A;  1N56 A;  3GV7 B;  2Y0S C;  2QKQ A;  5KFC A;  4QW8 A;  2QLT A;  3V6J A;  3UMG A;  3PML A;  4KMU A;  5DKW A;  4QZE A;  2V4Q A;  1L3V A;  1BPY A;  5F2V O;  1PVQ A;  2HBM A;  3T5H A;  3R9K A;  1KFS A;  2UVU A;  3TAD C;  2FLP A;  7ICQ A;  4UAR A;  1NJZ A;  2RP5 A;  1X9S A;  4PPX A;  3RJH A;  2LKY A;  4EYH B;  4I2E A;  3V7K A;  3NVZ A;  1C7Y A;  2KIW A;  5HRF A;  2BPF A;  9ICM A;  9ICV A;  9ICE A;  3RJK A;  4KM5 A;  4QZH A;  5KFW A;  2DPI A;  3JPR A;  4EED A;  5KFA A;  3KHG A;  4P4M A;  2AGQ A;  1ZOL A;  2I5H A;  3O0F A;  4YR3 A;  3PNC A;  5KL8 B;  2K8C B;  5CR0 A;  1XSN A;  2A1J A;  3UM9 A;  2AGO A;  1UET A;  4WC4 A;  2I6X A;  9ICS A;  4R66 A;  3C21 A;  4G3I A;  4M0A A;  2GLE A;  5GTI U;  2ZH4 A;  1NK6 A;  1NO5 A;  1XS9 D;  5T14 A;  1NJX A;  5HRD A;  2VA2 A;  1RQN A;  8ICV A;  3ALR A;  4M9H A;  2FJ6 A;  4RWN A;  3OV7 A;  1L8L A;  4RNO A;  3SV3 A;  4KLS A;  3UPS A;  4Y2Y A;  3LYS A;  3SEN A;  2AU0 A;  4B9M A;  2HHU A;  4CE6 A;  4EEY A;  4PJ0 U;  3Q8M A;  1KEJ A;  4E80 A;  3OWG A;  4RPX A;  4FZN A;  4O5E A;  1TV9 A;  3UQ2 A;  2KZM A;  1HEK A;  2FPL A;  3GIJ A;  4E8F A;  1VFG A;  1X6J A;  2XGP A;  1N48 A;  4Y2J A;  4FBU A;  4F2R A;  3ZDA A;  1Y88 A;  1Z19 A;  3K75 D;  2KN7 A;  3GU3 A;  3SD7 A;  4Q8F A;  4RQ8 A;  2YTU A;  3KOO A;  1ZQO A;  4KLE A;  4RQ6 A;  2ZH5 A;  2G06 A;  2VAN A;  4OAF A;  4QWD A;  5D62 A;  2IHN A;  2ASD A;  2IMW P;  1QTM A;  3B9J A;  5D49 A;  2F77 X;  2AQ4 A;  4R63 A;  2Y0S F;  4RU9 A;  4P0P B;  3UXN A;  5L9X A;  2HCF A;  4CDG A;  4J03 A;  1F44 A;  4UAV A;  4IR1 A;  3OTQ A;  4QZG A;  4MEY A;  5DLF A;  4ECU A;  4TUP A;  1X6I A;  4X0A A;  2KZZ A;  1RYR A;  3HW8 A;  4ECX A;  3H37 A;  2KZ3 A;  3Q8L A;  2MUT B;  4DSF A;  5DLG A;  2WHE A;  4BXO A;  2BCS A;  1CEZ A;  1ARO P;  4I2D A;  4AT7 A;  4TQR A;  7ICK A;  5KG4 A;  5KT7 A;  3MR2 A;  2ZIU B;  2Y9T A;  3KHL A;  2AJQ A;  4M2Y A;  1Q3U A;  1TAM A;  3WU2 U;  2GOL A;  5ALG A;  3QU7 A;  3LVV A;  3QZ7 A;  4J9N A;  1ZRM A;  5J2K A;  5HRG A;  1ZQK A;  2GWS A;  2Q4T A;  2KEY A;  3GII A;  1MQ2 A;  2VJ5 A;  4TUR A;  1KL9 A;  1PVP A;  5ALP A;  3SQI A;  3BZK A;  5KFV A;  1WOT A;  3PSP A;  1CUK A;  4GLX A;  5HRL A;  5AKI A;  4G9B A;  4ECZ A;  1A6S A;  2NO4 A;  2QB0 A;  5J0S A;  8ICA A;  1KFD A;  4PGQ A;  4O3N A;  4X4R A;  3NKU A;  4O67 A;  4IQW A;  2NRW A;  3MGV A;  1Z4N A;  8ICC A;  2PI4 A;  3ZDE A;  5L1K A;  4EX6 A;  3KHH A;  5EWF A;  4QWC A;  4FHY A;  3C66 A;  4YG2 A;  4C8K A;  3PR5 B;  2BQR A;  5KFE A;  4DSE A;  3H39 A;  2FI1 A;  2OCE A;  1JQR A;  4US9 A;  3RAX A;  2P6R A;  2W8K A;  3HRD D;  2YX8 A;  3PO5 A;  2Y1I A;  4UB8 U;  3NGD A;  1UPH A;  4OJ6 A;  4KLF A;  4F93 B;  2Z7J A;  4YXM A;  5KFT A;  5K4L A;  3AQK A;  1ZQZ A;  2DKZ A;  4B9V A;  3DEE A;  1OW5 A;  3UXO A;  7ICH A;  1FEZ A;  5CEH A;  4DFP A;  7ICM A;  4GXK A;  2DWQ A;  2XCP A;  3PY8 A;  5ALI A;  4C8O A;  7ICG A;  4WQL A;  1ZD2 P;  1U4B A;  5KFB A;  2RHF A;  2IHO A;  3M8R A;  3RJI A;  4F91 B;  2VA8 A;  4EZ9 A;  4B9T A;  9ICR A;  2WF8 A;  2DR8 A;  4YMM A;  2DUY A;  2ODG A;  1ZQH A;  2BCU A;  2Q0Z X;  1Z3E B;  4J9P A;  4NM2 A;  5CWR A;  3HX0 A;  5JTG A;  8ICL A;  5J2C A;  3F2B A;  3MFH A;  3NWI A;  2N1R A;  3M1Y A;  4HYK A;  5HRE A;  2PBE A;  2C2R A;  4CRX A;  2DR5 A;  5J2E A;  1MIW A;  3BQ7 A;  4JK1 A;  3H8W A;  3PZP A;  3BDP A;  2PI5 A;  1T8E A;  1ZQQ A;  4K4I A;  1ZD5 A;  3NS1 A;  3PSI A;  1BVS A;  5AKH A;  5HRB A;  3DDH A;  2LYA A;  4FZM A;  4I2F A;  1KN5 A;  4QZ8 A;  1KDH A;  1KNY A;  3JPO A;  1QQ7 A;  5AKY A;  1BPE A;  2ZIW A;  1XO1 A;  1Z00 B;  1ZQA A;  4DSI A;  2CN1 A;  3C2M A;  2F8L A;  2Q66 A;  4O5K A;  2HVI A;  3DV9 A;  4RQN A;  2DVI A;  5JRT A;  1S77 D;  3OGU A;  2YMQ A;  4RPY A;  3NYB A;  1N61 A;  2C2E A;  3M8S A;  4Y2R A;  3TAD A;  4IQT A;  1S76 D;  3GV5 B;  2GH1 A;  3SR6 A;  5KG1 A;  2W9C B;  2BDU A;  3QUC A;  4LT6 A;  5J0X A;  4O69 A;  3JZ0 A;  2HSZ A;  1D8L A;  5EWE A;  3MR5 A;  4DQI A;  3B0X A;  3WK4 A;  2PFQ A;  2XY7 A;  3M7D A;  4DO9 A;  5B3P A;  2YN4 A;  4UAY A;  4Y2X A;  1LKY B;  3QYP A;  4PZN A;  4IQV A;  3EWA A;  1PVR A;  1MC8 A;  2KSO B;  4NLG A;  1JRP A;  3AM9 A;  3JYY A;  3M9N B;  1GO3 F;  2VA3 A;  9ICJ A;  2ID1 A;  4UB4 A;  4B9N A;  2BE3 A;  2ZH7 A;  3MCR A;  2R8K A;  4FH3 A;  2JH1 A;  1Q46 A;  4J9K A;  5KFH A;  2UVR A;  5DG9 A;  5J2B A;  4J9S A;  3QE9 Y;  3GIM A;  4WOY A;  1GPJ A;  3ED5 A;  5AI6 A;  4KLU A;  4UAZ A;  2HDO A;  2QAR B;  2KIC A;  2WF7 A;  3NAS A;  1L7O A;  2G5I B;  4DCC A;  2XVT A;  2LYH A;  3TAC B;  4JV2 A;  2F2A B;  1SKW A;  4BJQ A;  4KB6 A;  3JCF A;  3PW2 A;  3RJJ A;  2W55 A;  5ALO A;  2NRT A;  2WFA A;  5KT4 A;  1Z1V A;  2W9B B;  3NRW A;  4HAI A;  4EBE A;  1SB3 C;  3QEB Z;  4WBZ A;  3CK6 A;  3FAH A;  4EX7 A;  4RQ4 A;  4KLJ A;  4ECS A;  3D2Q A;  4X4U A;  1ZQB A;  7ICJ A;  1V9P A;  2ISO A;  2O6K A;  2D6F C;  4NLZ A;  2BBH A;  2BCV A;  3ISC A;  4Q45 A;  5J2H A;  1B43 A;  4JV1 A;  4DOA A;  3IG5 A;  3SAH A;  4DF4 A;  4OJO A;  2BR0 A;  2YQE A;  2A1A A;  1DK3 A;  3G6X A;  4KN4 A;  2BCR A;  3Q8K A;  4WC6 A;  4TUS A;  3OPX A;  3C18 A;  4JLX A;  3SYZ A;  3WK7 A;  2K89 A;  1PK1 A;  5AI4 A;  1N63 A;  3C1Z A;  1UEU A;  4KX5 A;  4IRD A;  3AN1 A;  1XSP A;  4WC1 A;  2AH5 A;  3MDC A;  5CFS A;  3IRU A;  4DFM A;  2F8K A;  3LWM A;  1SL0 A;  8ICJ A;  3EF2 A;  1JXL A;  3VCB A;  4ED1 A;  4JMU A;  4M6W B;  5J0T A;  2GA9 D;  4K99 A;  4PL2 A;  5AM1 A;  1TVA A;  1MN8 A;  5AM0 A;  3AU2 A;  4RQ2 A;  2B21 A;  3RB0 A;  3PHZ A;  1OU5 A;  3TAQ A;  4MKP A;  1FA0 A;  4FZL A;  4NJ8 A;  4Q43 A;  1ZQS A;  4ZH4 A;  3NUQ A;  1ZET A;  4N7R A;  1TFW A;  1A77 A;  3SAG A;  1QQ6 A;  4YR0 A;  1JI7 A;  4USA A;  3C29 A;  3ERC C;  1AQ6 A;  5KG5 A;  3H40 A;  4JUZ A;  2BQU A;  3MC1 A;  9ICW A;  3MGH A;  2W9C A;  5DEC A;  5ALM A;  3QX7 A;  4JWN A;  4DL2 A;  1XSL A;  1L5U A;  1QSL A;  4LZD A;  3N7R C;  4F2S A;  2HHX A;  3C2K A;  3N28 A;  2WF9 A;  1NKE A;  5EE0 A;  9ICC A;  1X9W A;  1NZP A;  3GQC A;  5DQI A;  4YQW A;  3RH5 A;  4UAU A;  2RDJ A;  2BBJ A;  5KFR A;  4PGX A;  1IIP A;  3UMC A;  1WCN A;  1ZJM A;  2ZHA A;  5CFT A;  1RDF A;  2KKP A;  4AT9 A;  2DBY A;  5EE3 A;  4KLI A;  3PW4 A;  1S10 A;  4LZG A;  1IG6 A;  5HHH A;  4YFK A;  3QU2 A;  3IDW A;  4DS4 A;  5DDM A;  4O3O A;  1RZT A;  1KBU A;  1Q79 A;  2O1P A;  1VLB A;  4PL1 A;  1LB2 B;  5HHI A;  5KFL A;  3H8M A;  4EEN A;  2BCQ A;  2JEI A;  1TAU A;  4UB6 U;  2F76 X;  4M04 A;  2F1H A;  1L8O A;  4MFA A;  7ICS A;  4QZA A;  2IOF K;  2JEF A;  1JXE A;  3AQL A;  3IP4 B;  2W9B A;  3MGI A;  2B51 A;  3AQF A;  1JRO A;  3T3F A;  3D6J A;  3F2C A;  8ICM A;  2HBJ A;  2WB1 F;  4M9N A;  2ES6 A;  1V97 A;  1JUD A;  5KTQ A;  4ATB B;  1RQL A;  5CB1 A;  2FDR A;  5J0Q A;  1ZQP A;  3TFR A;  4BUG A;  2ZJA A;  2C2D A;  1SXD A;  5ALS A;  1Q8K A;  3C5F A;  4UQG A;  1FFV A;  5CHE A;  2HHS A;  5DBB A;  3LWL A;  4F4W A;  5ALR A;  3BQT A;  1OXJ A;  2WF6 A;  4KN7 A;  3RH4 A;  1T94 A;  2CXY A;  2C22 A;  4FO6 A;  5KFY A;  1X40 A;  3OUY A;  1N5W A;  2F44 A;  3NTU A;  1P7D A;  4YMN A;  5AM4 A;  4PHD A;  1PK3 A;  3RTV A;  3ORY A;  2CRX A;  3EPI A;  2LM4 A;  3I28 A;  2FE9 A;  1COO A;  5J0P A;  2F3N A;  3BZC A;  1UQV A;  4WC0 A;  4NV0 A;  1NK9 A;  3MDA A;  2BKE A;  2OHF A;  4K4H A;  1BPB A;  2JZB A;  2LI6 A;  1Q3V A;  3UXP A;  2KMD A;  1X2I A;  4K9A A;  4OAI Z;  3F2D A;  2E8P A;  1FIQ A;  4OJP A;  3S6J A;  5KFG A;  5J0R A;  4U6P A;  5HRI A;  5ALT A;  1O08 A;  9ICN A;  1RPL A;  3WKE A;  3TI0 A;  2M2V A;  4FFD A;  4F4Z A;  2H3Z A;  2AXT U;  4Z6E A;  2KK0 A;  3B0Y A;  2K4I A;  4YMO A;  5AM3 A;  5KFU A;  2KJ5 A;  4R64 A;  1Z1B A;  4RQ0 A;  2NRZ A;  4I2G A;  1SZP A;  5KG3 A;  1U48 A;  4F71 A;  4C8L A;  1LVH A;  1WG8 A;  2EDU A;  4EBC A;  3UQ0 A;  1S8O A;  3KBB A;  3WFQ E;  2MAX A;  5J2F A;  1NKC A;  1PZN A;  8ICG A;  4DSL A;  4RZR A;  4DSJ A;  4WBY A;  3F5E A;  2XI9 A;  4Y2V A;  2R8I A;  2E5S A;  3OSP A;  1L3S A;  3OSN A;  4GC7 A;  3BS5 B;  4MF2 A;  3CW2 C;  4NXX A;  1A0P A;  2G08 A;  2G09 A;  4K9B A;  4NXW A;  4B9S A;  8ICQ A;  1D9F A;  4KLT A;  3U26 A;  2KIV A;  2B6G A;  2XY5 A;  4O6A A;  2ZH2 A;  4B9U A;  2VKQ A;  4UBB A;  1WWU A;  2GAF D;  4F5P A;  2W43 A;  4BWJ A;  2OYY A;  4NLB A;  8ICT A;  2IBK A;  1YZ6 A;  3N4M B;  1PUZ A;  2JGA A;  4RT3 A;  5ALX A;  3ER9 B;  1JIH A;  3N7P D;  2FMS A;  1ZQU A;  4EYI B;  1ZQN A;  1N5X A;  4C4R A;  1XO0 A;  4BX9 C;  5HR7 A;  2NRV A;  1ZQY A;  3WK8 A;  4US8 A;  5KFS A;  1UHU A;  4XRH A;  4XQ7 A;  4KTQ A;  2ZG6 A;  5BPC A;  3LK9 A;  3QZ8 A;  2ZIX B;  2NO5 A;  4DFJ A;  4ATB A;  1ZQL A;  9ICK A;  2W3R A;  5ALW A;  1BGX T;  1R8A A;  3C1Y A;  1K5O A;  2ZXI A;  4F4K A;  4X5V A;  4RNM A;  4GIB A;  5GTH U;  3JPQ A;  4P0Q B;  2ASL A;  2KHQ A;  3M6Z A;  5KG6 A;  1NK4 A;  5AKZ A;  4ICA A;  4UB2 A;  1TK5 A;  3JPS A;  4P2H A;  4UB1 A;  4DLE A;  4O3S A;  4EP7 A;  2W9M A;  2ZTC A;  2HBK A;  4K96 A;  2K8B B;  2KHV A;  5DDY A;  1U45 A;  1UCV A;  2JHD A;  3RRG A;  2I1Q A;  3OVS A;  4UAW A;  3EZ5 A;  5DQH A;  1YT3 A;  4C8M A;  3K1R B;  1T3N A;  2KG5 A;  2RLT A;  4ECT A;  5J8Y C;  2RQ5 A;  3ICX A;  2FMQ A;  3CP8 A;  2MRL A;  3L9D A;  1YZ7 A;  4RQ7 A;  5KFZ A;  4QZB A;  1UA1 A;  5DB6 A;  1TE2 A;  1L7N A;  5IIK A;  4DFD A;  5KT6 A;  4WC7 A;  3Q8Q B;  2ZH3 A;  3HJE A;  4Z6F A;  4KLH A;  2EZY A;  3IHQ B;  4FO1 A;  4GXJ A;  3IM1 A;  4EEL A;  2UVV A;  5KFD A;  3V6H A;  8ICW A;  4NL9 C;  4EEB A;  2HOF A;  4RWP A;  1KW4 A;  1NK7 A;  1SWV A;  5BOL A;  2XY6 A;  2DRA A;  1HUZ A;  2M2U A;  2NRX A;  2PXI A;  3QEA Z;  4AYB C;  3QUB A;  4EZ6 A;  3AQE A;  3T5J A;  3Q8S B;  2RRD A;  1JN3 A;  2IA6 A;  4J9L A;  3NVO A;  3TAN A;  5BOM A;  2I9G A;  4DL5 A;  5EWG A;  3BJY A;  4F5N A;  3C23 A;  2ZIV B;  3OJU A;  1UEV A;  2ZH9 A;  2J6T A;  5EE9 A;  4ED2 A;  4P0P A;  2OM6 A;  3QXG A;  8ICI A;  2GO7 A;  4O3M A;  4FHX A;  4KX3 A;  5F3X B;  3H4B A;  4EBD A;  5ALH A;  3RB6 A;  1S97 A;  5KAF U;  5IIO A;  4O3R A;  4EBJ A;  1NKB A;  2MUT A;  2QB1 A;  4MFF A;  2ZHB A;  3HIY A;  3HT3 A;  2ZIU A;  3BS7 A;  4ELU A;  9ICF A;  1D8Y A;  5KG0 A;  2LHT A;  4C80 A;  5EE1 A;  1ZQ1 C;  2W3S A;  3RBE A;  8ICO A;  1QH9 A;  5KT2 A;  5KFP A;  2C28 A;  2KTQ A;  2ZUD A;  2EAO A;  3TQ1 A;  9ICA A;  4F50 A;  2HHW A;  4RWO A;  1NK0 A;  3TKA A;  5AM2 A;  3PST A;  2OWO A;  1RYU A;  2M0N A;  3MR3 A;  1MIY A;  4DL7 A;  3RR7 A;  2EWR A;  2HW3 A;  5DED A;  1ZQV A;  2EAP A;  2H3I A;  2MA1 A;  5J2J A;  1SZH A;  4IR9 A;  2PFO A;  4QJF B;  4AYB F;  2K4H A;  4X4O A;  1V85 A;  5DGA A;  5CHG A;  4DWI A;  3A0H U;  3RJG A;  4R8U B;  3SMV A;  5CFU A;  1T7P A;  2KVC A;  4A8E A;  4I2B A;  3F53 A;  2FLL A;  4FH5 A;  1FFU A;  5ALK A;  1SXE A;  4OO1 J;  1SV4 A;  4DL6 A;  4QWE A;  2E8N A;  4DQQ A;  2KKV A;  5ALY A;  5IIN A;  1DK2 A;  4JV0 A;  2B4V A;  3WK6 A;  2KD1 A;  5IIL A;  1KLN A;  5J2G A;  3WFR E;  3L3F X;  1ZQD A;  2K60 A;  2EAM A;  5KFO A;  2B0C A;  2HOQ A;  3EW9 A;  3MFI A;  2F1I A;  1CI4 A;  1J97 A;  2PMZ F;  3G6Y A;  4NLN A;  3RAQ A;  1ZQF A;  2ZTD A;  5AK5 A;  1WWV A;  5DQG A;  1F0M A;  1S0O A;  3L4P A;  2JH7 A;  3N7S C;  4MFC A;  1ZD4 A;  2BDP A;  4M9G A;  1UT5 A;  4NLK A;  4YP3 A;  1Q78 A;  2R8H A;  2ZTE A;  4P4P A;  3WFO A;  5ALZ A;  2ZIV A;  1BPZ A;  1SGG A;  2XGQ A;  2WB1 C;  4I2A A;  3Q8R B;  3NVY A;  4X4Q A;  1KFT A;  2BPC A;  4Y2S A;  8ICN A;  2PFP A;  2JXJ A;  4LEW A;  4ED3 A;  1X42 A;  3E0F A;  1Z00 A;  4NWI A;  4UB5 A;  5DG7 A;  7ICP A;  1X9X A;  1FO4 A;  1XU4 A;  4PHA A;  2A1J B;  2H3V A;  4YXJ A;  3QUQ A;  5KT5 A;  3SEI A;  2DQN B;  3HKZ F;  3CYM A;  1ZQT A;  1TKD A;  2AQ0 A;  1VDV A;  2W8L A;  4C7Z A;  2WAQ F;  1SKS A;  3AUO A;  3Q8P B;  4AP9 A;  5DB7 A;  5DB8 A;  4NXU A;  4FS1 A;  3QUT A;  2IHM A;  1L6N A;  5L1L A;  3SV4 A;  2BZF A;  4LEY A;  2H3F A;  2HN1 A;  4I2I A;  3H38 A;  3UPQ A;  2MU2 A;  3LDA A;  3QU4 A;  5DG8 A;  2XO7 A;  5FP0 A;  1ZQX A;  5KG2 A;  3IG8 A;  3FC4 A;  5JU5 A;  4LEV A;  3I76 A;  1LKY A;  5J8Y A;  1SIJ A;  5CRX A;  1H38 A;  3ISB A;  4C4S A;  5JTI A;  4K4G A;  5J2D A;  7ICI A;  1X9M A;  2KSO A;  1TAQ A;  1QSY A;  2W7P A;  4F92 B;  2AHO B;  1V38 A;  5KFJ A;  4PZO A;  4IG8 A;  2EH9 A;  2BHN A;  4DS5 A;  2XC9 A;  2ZUB A;  4I2J A;  2P6U A;  3QU9 A;  1L3U A;  2M2W A;  7ICU A;  3H0M B;  5AI5 A;  2KFN A;  2HN2 A;  2EQY A;  1DXS A;  1C20 A;  2M9N A;  4NL9 A;  3E58 A;  1DGS A;  2WTF A;  3PW5 A;  4OJ5 A;  2F1J A;  1S9F A;  4ECV A;  3WK9 A;  2JRZ A;  2QAR A;  4ACO A;  3BQ0 A;  2V9W A;  5J29 A;  2DGZ A;  2HHV A;  4QZC A;  1QCK A;  4F5R A;  9ICQ A;  2YML A;  5KFX A;  1M6Y A;  1J2N A;  2Y9U A;  2G07 A;  9ICL A;  9ICP A;  2RFF A;  4QW9 A;  4JLZ A;  2DF4 B;  3RRH A;  3RJF A;  3GFK B;  2NV3 A;  4BXO B;  5IIM A;  1D8B A;  2E3T A;  1ZQM A;  4K97 A;  4AT7 B;  4CCH A;  1CRX A;  4YN4 A;  2E1E A;  1T4G A;  4BDP A;  4QZ9 A;  2K4E A;  2W04 A;  4O9M A;  4I2C A;  4X4T A;  3ZDC A;  5KL1 B;  2J6U A;  2W11 A;  4DOC A;  4ECY A;  2OEH A;  1N2X A;  2M2T A;  3PR4 A;  2HOI A;  1EXN A;  5HML A;  3THV A;  2D8C A;  9ICX A;  2XIC A;  1KQQ A;  3RH6 A;  9ICU A;  4WC5 A;  2NYV A;  1U49 A;  3RR8 A;  4RQ5 A;  3KZI U;  5DGB A;  2QB0 B;  4YR2 A;  4RPZ A;  4M9J A;  4QWA A;  3GIL A;  2H3Q A;  1T3Q A;  2JV3 A;  4QIW F;  4RQ1 A;  4X4V A;  1S0M A;  2JEJ A;  5HMM A;  2KOB A;  3HIL A;  4RUC A;  2PKE A;  4M6W A;  3JPP A;  1UA0 A;  2ZJ5 A;  9ICI A;  4KLD A;  2W7O A;  3HJ4 A;  3KD3 A;  4Y2P A;  1U47 A;  3AQN A;  4UD4 A;  5C5J A;  2ZXH A;  2W54 A;  8ICZ A;  1S0N A;  2W03 A;  4TQS A;  2CPR A;  2KNJ A;  4UW9 A;  1NJY A;  3PV8 A;  1BNP A;  1NNL A;  3T79 A;  4K8V A;  3SAF A;  5AI8 A;  3TFS A;  4WQK A;  3AL0 B;  3MBY A;  1DGJ A;  5ALN A;  3BQ2 A;  4GXI A;  4NXZ A;  1QLN A;  1NOM A;  5DBC A;  1XNS A;  5ALJ A;  4XJE A;  5AK3 A;  1XC9 A;  3JPN A;  4NM1 A;  3CRX A;  5L1M A;  3N97 B;  4IC9 A;  2ASJ A;  3PO4 A;  4E0D A;  3PX0 A;  2PFN A;  3JPT A;  3KKA C;  4OAH A;  1JMS A;  5J0O A;  4FE3 A;  3BQ1 A;  4O68 A;  1B0X A;  5HNK A;  1TFY A;  4ELV A;  9ICG A;  3ZD8 A;  3K7D A;  4O3P A;  1ECW A;  3MR6 A;  4QWB A;  5KAI U;  1TK0 A;  2BGW A;  1LV5 A;  2DPJ A;  4Y2T A;  8ICU A;  5KFN A;  4O5C A;  3EUB 2;  3RB4 A;  5DBA A;  3FM9 A;  1SL1 A;  4E7X A;  1KSP A;  1IV8 A;  3MAB A;  7ICT A;  8ICE A;  3V7L A;  1R8C A;  3L5K A;  3VC8 A;  2ZIW B;  5HP4 A;  9ICH A;  1L3T A;  2E1F A;  1ZD3 A;  1K1S A;  4F4Y A;  2FCL A;  4P4O A;  2G5H B;  1SKR A;  1KRP A;  5III A;  3RBD A;  2V4R A;  3AQM A;  2BPG A;  9ICT A;  4EGW A;  1F5S A;  1MQ3 A;  2IOH A;  4KMO B;  3K1Z A;  5KFI A;  5AKL A;  4GC6 A;  4NLC A;  4Z6D A;  4IRK A;  4TUQ A;  1ZQG A;  2DL0 A;  5HR6 A;  4J9O A;  3LVW A;  4U7C A;  8ICS A;  4QNL A;  2LBO A;  1IM4 A;  4WJ3 B;  1ZQW A;  4O3Q A;  4YCX A;  2OH2 A;  5AIB A;  4MEX A;  1S0V A;  1WCL A;  5L1J A;  2IOF A;  4WC3 A;  2FMP A;  2D3D A;  2HVH A;  2ATL A;  2R8J A;  3KFU F;  2DFL A;  4DQS A;  4YD1 A;  4PH5 A;  4F72 A;  3M9M B;  4ED8 A;  4WH5 A;  4F4X A;  1SWW A;  3PX6 A;  7ICN A;  2Y1J A;  5J0U A;  3PSF A;  1ZQC A;  4NXV A;  2A3V A;  2DR9 A;  3WKD A;  1RYS A;  3T5K A;  3PMN A;  4QZD A;  4F3O A;  1SV0 A;  3HPO A;  2B56 A;  2EZZ A;  2K8A A;  3K4G A;  3SI8 A;  5H2F U;  4XUS A;  4LVS A;  5B3Q A;  4QZI A;  1DOQ A;  2ISP A;  2E8O A;  3WFS C;  5J0W A;  1A76 A;  2HMX A;  3PW7 A;  4UAS A;  2VIX A;  4NY8 A;  5AKG A;  9ICO A;  5ALQ A;  5JUM A;  3ZI4 A;  3D2S A;  8ICY A;  1BPX A;  4Q8E A;  1HJP A;  2FLN A;  4MHV A;  4Z6C A;  8ICX A;  5ALU A;  4PHE A;  4PHP A;  5CJ7 A;  5D63 A;  1RM6 C;  4FBT A;  2L5Y A;  1SL2 A;  2JR5 A;  5ALV A;  4WC2 A; 
#chains in the Genus database with same CATH homology
 2VAN A;  3OHA A;  4QWE A;  1LB2 B;  3FDS A;  3M9O B;  4QWD A;  5HHI A;  5KFL A;  2IHN A;  4DQQ A;  1ZQO A;  2BCQ A;  2ASD A;  5IIN A;  1QTM A;  2IMW P;  2JEI A;  1TAU A;  7ICE A;  1DK2 A;  4JV0 A;  5D49 A;  8ICB A;  3GDX A;  3ISD A;  2AQ4 A;  4M04 A;  2F1H A;  3EPG A;  4R63 A;  3ZD9 A;  2DR7 A;  4MFA A;  5IIL A;  3PX4 A;  4RU9 A;  4BWM A;  4QZA A;  4ED0 A;  7ICS A;  3KTQ A;  1KLN A;  5J2G A;  4ED6 A;  3WFR E;  4QZF A;  3UXN A;  1ZQD A;  5L9X A;  2JEF A;  1JXE A;  1RZT A;  5KFO A;  3EW9 A;  3MFI A;  2F1I A;  3AQL A;  2P66 A;  2HHT A;  4IR1 A;  2HHP A;  4QZG A;  3MGI A;  4MEY A;  2W9B A;  5L1I A;  4ECU A;  5DLF A;  3G6Y A;  4NLN A;  4TUP A;  4AT8 B;  3RAQ A;  3T3F A;  4X0A A;  1ZQF A;  2ZTD A;  3HW8 A;  4ECX A;  1RYR A;  2KZZ A;  8ICM A;  4M9N A;  4B9L A;  5DQG A;  5J0Y A;  8ICR A;  3H37 A;  2KZ3 A;  1S0O A;  5KFM A;  3Q8L A;  2MUT B;  5KTQ A;  4DSF A;  1KTQ A;  5DLG A;  4BXO A;  7ICV A;  4ATB B;  4M5D A;  5CB1 A;  5DB9 A;  2BCS A;  5J0Q A;  1ARO P;  4I2D A;  1RXW A;  1ZQP A;  4TQR A;  1CEZ A;  3TFR A;  4MFC A;  5KG4 A;  5KT7 A;  7ICK A;  3MR2 A;  2ZJA A;  3KHL A;  2ALZ A;  2C2D A;  2BDP A;  4M9G A;  4M2Y A;  2AJQ A;  1UT5 A;  4NLK A;  4YP3 A;  3C5F A;  1Q78 A;  2R8H A;  2ZTE A;  5D46 A;  4UQG A;  4P4P A;  3WFO A;  1BPZ A;  2NRK A;  1NK8 A;  2HHS A;  5DBB A;  4DF8 A;  2XGQ A;  3QZ7 A;  3LWL A;  4F4W A;  4DL3 A;  3BQT A;  5F9N A;  1QSS A;  4I2A A;  4KLO A;  4KN7 A;  4J9N A;  3Q8R B;  4RT2 A;  4X4N A;  5J2K A;  3RH4 A;  1ZQK A;  2BPC A;  2GWS A;  1KFT A;  5HRG A;  4X4Q A;  8ICN A;  2PFP A;  2C22 A;  3GII A;  4ED3 A;  4FO6 A;  4EBK A;  1Z00 A;  5KFY A;  4UB5 A;  1MQ2 A;  4TUR A;  3RB3 A;  5DG7 A;  7ICP A;  3OUY A;  3KHR A;  2FPM A;  5KFV A;  1WOT A;  1TK8 A;  4XQ8 A;  1XU4 A;  3NTU A;  4PHA A;  4YMN A;  1CUK A;  2A1J B;  2FPK A;  4YXJ A;  4PHD A;  4GLX A;  3C2L A;  3AU6 A;  3RTV A;  5HRL A;  3ORY A;  3EPI A;  5KT5 A;  3E2E A;  4ECZ A;  5TZV A;  1COO A;  5J0S A;  1ZQT A;  5J0P A;  1TKD A;  8ICA A;  4WC0 A;  2AQ0 A;  1KFD A;  2XCA A;  4PGQ A;  2W8L A;  1NK9 A;  3MDA A;  4O3N A;  2BKE A;  1SKS A;  4X4R A;  3AUO A;  4IQW A;  2NRW A;  3Q8P B;  3C5G A;  4FHW A;  5HR9 A;  5DB7 A;  5HRK A;  5DB8 A;  4J9Q A;  4FS2 A;  4K4H A;  4FS1 A;  4I28 A;  2IHM A;  4ELT A;  8ICC A;  2PI4 A;  5L1L A;  3ZDE A;  1BPB A;  2JZB A;  3SV4 A;  5L1K A;  4M9L A;  3UXP A;  1TFR A;  1X2I A;  4I2I A;  3OJS A;  3KHH A;  5EWF A;  3H38 A;  3UPQ A;  1JX4 A;  4I29 A;  3WFP A;  4QWC A;  4IRC A;  4FHY A;  3LDA A;  4KIT B;  3C66 A;  5DG8 A;  2XO7 A;  4YG2 A;  5KFG A;  4C8K A;  1ZQX A;  5J0R A;  5KG2 A;  5HRI A;  3PR5 B;  2BQR A;  5D4B A;  5EOZ A;  5KFE A;  4DSE A;  3H39 A;  4DEZ A;  9ICN A;  4WC2 A;  1H38 A;  2ZH1 A;  3ISB A;  1RPL A;  2J6S A;  3TI0 A;  1JQR A;  3RAX A;  2R8G A;  4K4G A;  5J2D A;  7ICI A;  1X9M A;  2P6R A;  1TAQ A;  2W8K A;  2M2V A;  3GIK A;  4F4Z A;  1QSY A;  2KP7 A;  3PO5 A;  4F92 B;  2Y1I A;  1PX5 A;  1D9D A;  5KFJ A;  3NGD A;  4Z6E A;  4IG8 A;  4AT9 B;  1R89 A;  2BHN A;  4DS5 A;  2XC9 A;  2ZUB A;  3B0Y A;  4YMO A;  4I2J A;  4KLF A;  4F93 B;  5KFU A;  5CA7 A;  4YXM A;  2P6U A;  4R64 A;  3OHB A;  5KFT A;  2ZH6 A;  4RQ0 A;  2O5A A;  2NRZ A;  4I2G A;  1SZP A;  3AQK A;  5KG3 A;  1ZQZ A;  1U48 A;  1L3U A;  4B9V A;  2M2W A;  4RNN A;  4C8L A;  7ICU A;  3GV8 B;  4EBC A;  2KFN A;  3UXO A;  3UQ0 A;  8ICK A;  7ICH A;  3H3A A;  3WFQ E;  1BNO A;  4DFP A;  4J9R A;  2MAX A;  2M9N A;  5J2F A;  1NKC A;  7ICM A;  1DGS A;  1BPD A;  2WTF A;  4GXK A;  2XCP A;  3PW5 A;  1PZN A;  1ZQJ A;  2F1J A;  5KFK A;  1S9F A;  4ECV A;  1U4B A;  3PY8 A;  5KFB A;  4DSL A;  8ICG A;  1U9L A;  4YVZ A;  4RZR A;  3M8R A;  3RJI A;  2AGP A;  4DSJ A;  4F91 B;  2VA8 A;  4Q44 A;  4EZ9 A;  4B9T A;  3BQ0 A;  4WBY A;  2V9W A;  5J29 A;  4ED7 A;  2HHV A;  2R8I A;  4QZC A;  9ICR A;  2DR8 A;  4YMM A;  3OSP A;  1ZYQ A;  2UVW A;  1ZQH A;  1L3S A;  4F5R A;  3OSN A;  4GC7 A;  3G6V A;  4PGY A;  2Q0Z X;  1RXV A;  2BCU A;  1Z3E B;  5KFX A;  4J9P A;  4MF2 A;  4NM2 A;  9ICL A;  5CWR A;  3HX0 A;  1UT8 A;  4QW9 A;  9ICP A;  2RFF A;  3H4D A;  8ICL A;  5J2C A;  4B9S A;  3MFH A;  8ICQ A;  5HRE A;  4HYK A;  3RRH A;  1D9F A;  4KLT A;  2C2R A;  2PBE A;  3OVB A;  3RJF A;  3GFK B;  2H5X A;  2DR5 A;  4BXO B;  5IIM A;  5J2E A;  1MIW A;  4JK1 A;  3BDP A;  3H8W A;  2PI5 A;  1ZQM A;  2XY5 A;  4AT7 B;  1T8E A;  4CCH A;  2ZH2 A;  4I2H A;  4YN4 A;  4B9U A;  1ZQQ A;  4K4I A;  2HHQ A;  1T4G A;  4UBB A;  4BDP A;  4QZ9 A;  5KFF A;  4ECW A;  1ZJN A;  4O9M A;  1BVS A;  5HRH A;  4I2C A;  4F5P A;  4X4T A;  3ZDC A;  4BWJ A;  2J6U A;  4DOC A;  5HRB A;  1JAJ A;  8ICT A;  4ECY A;  2IBK A;  5HC9 A;  3N4M B;  1MSW D;  2M2T A;  1MIV A;  4I2F A;  4QZ8 A;  1KDH A;  1B22 A;  1KNY A;  3JPO A;  3PR4 A;  4NKT A;  4RT3 A;  4O0I A;  4KLM A;  4XA5 A;  4O3O A;  1BPE A;  5KFQ A;  3T5L A;  1JIH A;  2FMS A;  4S3N A;  1EXN A;  1XO1 A;  1Z00 B;  1ZQU A;  5HML A;  3THV A;  4EYI B;  1ZQA A;  1ZQN A;  4DSI A;  9ICX A;  3RH6 A;  9ICU A;  3OUY B;  4WC5 A;  3C2M A;  2NRV A;  1ZQE A;  4IQU A;  1U49 A;  1ZQY A;  1HUO A;  4O5K A;  2HVI A;  4YD2 A;  9ICB A;  4WCW A;  2Q66 A;  5KFS A;  4AT8 A;  4XRH A;  3RR8 A;  4XQ7 A;  4KTQ A;  4RQ5 A;  3OVA A;  2DVI A;  1S77 D;  5DGB A;  3OGU A;  4RPY A;  3ETL A;  5BPC A;  4RPZ A;  4YR2 A;  3LK9 A;  3QZ8 A;  4F8R A;  4QWA A;  3GIL A;  4M9J A;  2C2E A;  3NYB A;  3M8S A;  4DFJ A;  4ATB A;  1F5A A;  1ZQL A;  9ICK A;  1ZQI A;  4IQT A;  1BGX T;  4RQ1 A;  3C1Y A;  4UB3 A;  1S0M A;  4DQR A;  4F4K A;  1R8A A;  4X4V A;  3TAP A;  4X5V A;  5F9L A;  1S76 D;  3GV5 B;  4RNM A;  5HMM A;  2JEJ A;  4NKU A;  5KG1 A;  4RUC A;  3JPQ A;  2ASL A;  2W9C B;  2JZB B;  4M47 A;  4M6W A;  5KG6 A;  1NK4 A;  3JPP A;  2JEG A;  3RJE A;  4LT6 A;  1UA0 A;  2ZJ5 A;  4UBC A;  4MF8 A;  2RDI A;  5J0X A;  1ZQR A;  9ICI A;  1V4A A;  4UB2 A;  1TK5 A;  3JZ0 A;  3JPS A;  4P2H A;  4UB1 A;  1D8L A;  4DLE A;  5EWE A;  5J2A A;  3MR5 A;  4DQI A;  3B0X A;  4KLD A;  4O3S A;  3LQC B;  3HJ4 A;  2PFQ A;  3SZ2 A;  2XY7 A;  4EP7 A;  2W9M A;  4DO9 A;  2ZTC A;  4J9M A;  8ICH A;  4UAY A;  1K1Q A;  4IQV A;  1U47 A;  4R65 A;  3EWA A;  2BQ3 A;  3AQN A;  4UD4 A;  5C5J A;  1MC8 A;  5DDY A;  4F5O A;  1U45 A;  1S0N A;  8ICZ A;  3RRG A;  4TQS A;  3FYH A;  4NLG A;  2I1Q A;  3OVS A;  4UAW A;  5DQH A;  4RUA A;  3EZ5 A;  4JWM A;  3JYY A;  4C8N A;  4C8M A;  1T3N A;  1NJY A;  3M9N B;  3PV8 A;  1VJ7 A;  2VA3 A;  2ID1 A;  9ICJ A;  4ECQ A;  4UB4 A;  4ECT A;  1BNP A;  4X0B A;  4B9N A;  3TAR A;  4X4P A;  2FMQ A;  2BE3 A;  2ZH7 A;  4ECR A;  3TFS A;  3L9D A;  4RQ7 A;  1IXR A;  5KFZ A;  4QZB A;  2R8K A;  1UA1 A;  5KG7 A;  5KT3 A;  5DB6 A;  7ICO A;  4FH3 A;  3MBY A;  5IIK A;  4J9K A;  5KFH A;  5KT6 A;  3Q8Q B;  5DG9 A;  5J2B A;  4DFK A;  4J9S A;  4DLG A;  3QE9 Y;  2UVR A;  2ZH3 A;  1XWL A;  3GIM A;  3BQ2 A;  4Z6F A;  4BGD A;  4GXI A;  4NXZ A;  4KLH A;  1NOM A;  5IIJ A;  5DBC A;  4F5Q A;  7ICF A;  5J2I A;  1QLN A;  3IHQ B;  1XC9 A;  4KLU A;  4UAZ A;  3JPN A;  4NM1 A;  4DSK A;  3H8J A;  3N97 B;  4GXJ A;  2ASJ A;  3IM1 A;  7ICR A;  4RWQ A;  1R8B A;  1NJW A;  2ZJ8 A;  5KFD A;  3V6H A;  2UVV A;  3PO4 A;  4E0D A;  3EYZ A;  3PX0 A;  8ICF A;  4DL4 A;  3JPT A;  2PFN A;  4KLQ A;  8ICW A;  1JMS A;  2LYH A;  2ZH8 A;  5J0O A;  4KLG A;  4JV2 A;  4RWP A;  1SKW A;  3BQ1 A;  3PW2 A;  5HNK A;  1TFY A;  3RJJ A;  3V72 A;  1NK7 A;  4ELV A;  9ICG A;  4KLL A;  5BOL A;  1YLQ A;  2ZH5 A;  3ZD8 A;  5CP2 A;  2NRT A;  2XY6 A;  3H8S A;  2DRA A;  4O3P A;  5KT4 A;  3MR6 A;  4QWB A;  2ZUC A;  3PW0 A;  1NK5 A;  2W9B B;  1TK0 A;  1HUZ A;  3ZDB A;  2BGW A;  3ZDD A;  2NRX A;  2M2U A;  2PXI A;  4EBE A;  3QEB Z;  4FHP A;  3QEA Z;  4WBZ A;  1LV5 A;  4R8U A;  4RQ4 A;  3V6K A;  2DPJ A;  4KLJ A;  8ICU A;  4ECS A;  5KFN A;  4O5C A;  4EZ6 A;  3RB4 A;  3HJ1 A;  1ZQB A;  7ICJ A;  4X4U A;  3T5J A;  1V9P A;  3Q8S B;  3H7I A;  2ISO A;  5DBA A;  2KFZ A;  4NLZ A;  3HWT A;  2BCV A;  1SL1 A;  8ICP A;  3ISC A;  1JN3 A;  2W9A A;  4J9L A;  4Q45 A;  3MAB A;  1KSP A;  2IA6 A;  7ICT A;  8ICE A;  4E7X A;  3TAN A;  5BOM A;  3V7L A;  1R8C A;  4FHV A;  4RQ3 A;  5J2H A;  4DL5 A;  1B43 A;  5EWG A;  2I9G A;  4JV1 A;  4UD5 A;  4DOA A;  3BJY A;  5HP4 A;  4F5N A;  4DQP A;  9ICH A;  3C23 A;  3V7J A;  4DF4 A;  1L3T A;  2BR0 A;  2DRB A;  3OJU A;  1DK3 A;  1UEV A;  3G6X A;  1K1S A;  4F4Y A;  2ZH9 A;  4P4O A;  4KN4 A;  2BCR A;  2J6T A;  3Q8K A;  1SKR A;  1KRP A;  4I27 A;  4WC6 A;  5III A;  4TUS A;  3HP6 A;  4ED2 A;  3RBD A;  7ICL A;  4DOB A;  2V4R A;  3AQM A;  2BPG A;  3C18 A;  3SYZ A;  9ICT A;  1MQ3 A;  8ICI A;  3C1Z A;  1UEU A;  3PVX A;  4IRD A;  4FHX A;  1XSP A;  4WC1 A;  1N56 A;  3GV7 B;  5KFI A;  3MDC A;  3H4B A;  4EBD A;  5KFC A;  4GC6 A;  4DFM A;  3RB6 A;  3LWM A;  1S97 A;  1SL0 A;  4QW8 A;  8ICJ A;  5IIO A;  4Z6D A;  3V6J A;  1JXL A;  4ED1 A;  2DR9 A;  4O3R A;  3PML A;  4IRK A;  4WC7 A;  4TUQ A;  1ZQG A;  4EBJ A;  4KMU A;  1NKB A;  2MUT A;  4M6W B;  5DKW A;  4QZE A;  2V4Q A;  1L3V A;  1BPY A;  4MFF A;  5F2V O;  2ZHB A;  4J9O A;  5J0T A;  3HIY A;  8ICS A;  4X4S A;  3T5H A;  1IM4 A;  3HT3 A;  1TVA A;  1KFS A;  1ZQW A;  2UVU A;  2FLP A;  4ELU A;  7ICQ A;  3RB0 A;  3AU2 A;  4O3Q A;  2B21 A;  4RQ2 A;  1NJZ A;  1D8Y A;  1X9S A;  4PPX A;  9ICF A;  4YCX A;  3RJH A;  5KG0 A;  1OU5 A;  4EYH B;  3TAQ A;  4I2E A;  3V7K A;  4MEX A;  1C7Y A;  1S0V A;  5HRF A;  2BPF A;  9ICM A;  9ICV A;  9ICE A;  9ICQ A;  1WCL A;  3RJK A;  5L1J A;  1FA0 A;  4QZH A;  4WC3 A;  4Q43 A;  5KFW A;  2FMP A;  3RBE A;  4ZH4 A;  1ZQS A;  2DPI A;  2ATL A;  2HVH A;  3JPR A;  5KT2 A;  2R8J A;  8ICO A;  5KFP A;  2DFL A;  5KFA A;  1ZET A;  2C28 A;  4DQS A;  4YD1 A;  3KHG A;  7ICG A;  4P4M A;  2KTQ A;  1A77 A;  4PH5 A;  2AGQ A;  1TFW A;  3M9M B;  2ZUD A;  4YR0 A;  4ED8 A;  3TQ1 A;  4YR3 A;  3PNC A;  4F50 A;  4F4X A;  9ICA A;  2HHW A;  4RWO A;  1NK0 A;  3PX6 A;  5CR0 A;  2Y1J A;  7ICN A;  5J0U A;  1XSN A;  2OWO A;  2A1J A;  2AGO A;  1UET A;  4WC4 A;  1ZQC A;  5KG5 A;  3H40 A;  4JUZ A;  2BQU A;  9ICS A;  4R66 A;  3MR3 A;  3C21 A;  1RYS A;  4G3I A;  3T5K A;  3PMN A;  4QZD A;  3MGH A;  2W9C A;  4F3O A;  4M0A A;  9ICW A;  1MIY A;  2ZH4 A;  4DL7 A;  1NK6 A;  5DEC A;  1NO5 A;  1XS9 D;  3HPO A;  1NJX A;  5HRD A;  2VA2 A;  3SI8 A;  3K4G A;  3RR7 A;  4XUS A;  4JWN A;  4LVS A;  2HW3 A;  8ICV A;  4DL2 A;  1XSL A;  5DED A;  1ZQV A;  1L5U A;  1QSL A;  4QZI A;  4M9H A;  4LZD A;  1DOQ A;  4RWN A;  3OV7 A;  4RNO A;  4F2S A;  3SV3 A;  2HHX A;  2ISP A;  3WFS C;  5J0W A;  1A76 A;  3C2K A;  4KLS A;  3UPS A;  5J2J A;  1NKE A;  9ICC A;  1X9W A;  3PW7 A;  4IR9 A;  2AU0 A;  3GQC A;  2PFO A;  4B9M A;  2HHU A;  5DQI A;  4YQW A;  1NZP A;  4EEY A;  3RH5 A;  3Q8M A;  1KEJ A;  2RDJ A;  4X4O A;  5KFR A;  4NY8 A;  4E80 A;  5DGA A;  4PGX A;  4RPX A;  4O5E A;  9ICO A;  1TV9 A;  3UQ2 A;  5CHG A;  2KZM A;  1WCN A;  5JUM A;  4DWI A;  2FPL A;  1ZJM A;  2ZHA A;  3RJG A;  3GIJ A;  4R8U B;  4E8F A;  8ICY A;  1VFG A;  1BPX A;  4Q8E A;  2XGP A;  1HJP A;  2FLN A;  1T7P A;  1N48 A;  4Z6C A;  4AT9 A;  4C8O A;  4FBU A;  8ICX A;  4KLI A;  4AT7 A;  3PW4 A;  1S10 A;  4I2B A;  4PHE A;  4F2R A;  4PHP A;  3ZDA A;  4LZG A;  1Y88 A;  5CJ7 A;  5HHH A;  2FLL A;  4YFK A;  3K75 D;  4FH5 A;  2KN7 A;  4FBT A;  4Q8F A;  4RQ8 A;  1SL2 A;  4DL6 A;  4DS4 A;  5DDM A;  4KLE A;  1Q79 A;  2O1P A;  4RQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...