5DB7A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dt
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 100
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db7A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db7A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db7A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db7A03
1U4BA 4J9MA 2BCVA 2BPFA 3WFQE 2ZH2A 5DQGA 2PFPA 3ZDEA 4YFKA 2VA3A 4FBUA 3SYZA 3AU6A 3TAPA 4GXKA 7ICKA 1XSNA 3N97B 2ZH8A 2DPIA 3H8WA 1KFSA 3THVA 4QWAA 3RRGA 1FA0A 5CR0A 3ZDBA 4WC5A 2HHSA 1BPDA 3HP6A 3MGIA 1HUOA 4I27A 3WFRE 5F9LA 4C8LA 1RZTA 4RNMA 3EPGA 3Q8RB 1JN3A 1RPLA 5BPCA 4PGQA 5TZVA 4I2HA 8ICUA 1KEJA 5J0SA 2HHPA 3LDAA 4PHDA 3MR5A 4DOBA 5HRDA 1YLQA 1ZQIA 4MF2A 4BGDA 1XS9D 3GIMA 1BPBA 2BQ3A 1Y88A 4Q8FA 4RU9A 3SV4A 4F5RA 4NKUA 4QZDA 1U47A 3SZ2A 1NK9A 4TQRA 5HP4A 5KFMA 8ICYA 5DKWA 5DDYA 4JK1A 1ZQVA 1U48A 1TKDA 2UVWA 2BCQA 4I2IA 1D9DA 4B9NA 5KG1A 2V4RA 4E80A 1D8LA 3OJSA 4I2AA 4PHEA 4KLMA 1LB2B 4UBBA 5J0XA 2JEGA 2FPLA 4F4KA 5J0PA 5KG5A 4M9NA 4NLGA 1S76D 4FHPA 1JXEA 4QW8A 4UB2A 1S9FA 4ED2A 2ASLA 1XO1A 4QZGA 2C2EA 7ICIA 1UETA 4ED0A 3T5JA 1R8AA 2I1QA 2W8KA 4YR3A 4ECVA 2PFNA 3OUYB 5KG2A 4PPXA 4ECQA 1N48A 9ICGA 4DEZA 2BDPA 1B22A 2H5XA 2XY5A 5KFKA 5HRBA 4AT8A 4DF8A 2XGPA 4ED1A 4RWNA 3OUYA 5HHHA 3OHBA 5L1JA 4RQ5A 4NM1A 2R8IA 9ICWA 3RB4A 2DPJA 4X4NA 4K4IA 1UEVA 7ICJA 5CP2A 4Z6CA 4FHWA 2FMSA 2UVVA 1UEUA 4IRCA 1K1SA 3UXPA 4R66A 2ZUBA 4O3OA 7ICEA 1R8CA 4M04A 3JPPA 5IIIA 4ECUA 3IHQB 1ZQGA 4M6WA 4WC2A 5J0YA 4JV2A 3M8RA 3GIIA 4PHAA 2HHTA 4RNOA 3PV8A 4YVZA 4J9SA 8ICTA 4Z6DA 9ICKA 5KFRA 5KT5A 3HPOA 5HREA 4DL7A 4M9GA 5J2CA 4R64A 8ICJA 3QEAZ 3RJFA 4DSJA 3C18A 4YMNA 2J6TA 5HRIA 4R8UB 1UA1A 8ICVA 2ATLA 1V4AA 2KTQA 1SZPA 4FH5A 5CB1A 3HWTA 4DS5A 4J9NA 2ZTEA 4HYKA 4B9SA 4NKTA 2KZMA 3RBDA 4UD5A 1ZJNA 2O1PA 4I2FA 1SL2A 1T7PA 2HHUA 4P4PA 5J2DA 4M5DA 3L9DA 4YXMA 3AUOA 2ZH3A 3V7LA 5DEDA 1ZQAA 5KT2A 2KZ3A 4LZGA 3MFHA 3V6KA 4UAYA 2IHMA 4B9UA 7ICFA 9ICPA 3PX4A 3RAXA 4I2BA 1BNOA 3TI0A 4RWPA 3RJGA 4EBKA 1ZQSA 5KG6A 4RUCA 2DR5A 4F92B 5KFFA 3KHHA 4IRDA 3JPTA 3H4BA 4NLZA 4XQ7A 2ZHBA 2BGWA 8ICGA 3PVXA 4MEYA 3FYHA 1HJPA 1T4GA 3EZ5A 2Q66A 1ZQYA 5HRKA 5J0WA 1QSSA 2I9GA 2Y1IA 4UQGA 3NYBA 5J0RA 5DGBA 4DLEA 1TFYA 2C2RA 4GC7A 4KLGA 4RWQA 2DVIA 2M2VA 3HW8A 2R8KA 9ICCA 4X4RA 2ASJA 2AGPA 4MFAA 3TFSA 4O0IA 1S97A 3EWAA 3H8SA 3HT3A 4EEYA 3RR7A 1QLNA 4RQ6A 1ZQPA 7ICQA 3WFSC 5HMLA 4RPZA 2C28A 3WFPA 4DF4A 3C23A 4KN4A 5KFYA 5EWGA 5KFUA 4YR0A 4TUQA 1COOA 5JUMA 4GXIA 4DOCA 2AGQA 1QSYA 1D8YA 2BCRA 1KRPA 5J2FA 7ICHA 1A76A 9ICBA 3ISCA 1UT8A 3NGDA 4KMUA 4EZ9A 3N4MB 4KLEA 4RQ1A 4O3PA 2HHVA 3BQ2A 8ICMA 4YD1A 2ZH9A 3Q8PB 5F2VO 5DG8A 1TV9A 4X5VA 1CUKA 2ZJ8A 4EZ6A 4F5NA 5DLGA 1KSPA 4X4QA 5EWEA 1MIYA 1XC9A 3ISBA 4UB5A 4JWNA 5DBAA 1BPXA 1QSLA 8ICRA 2IHNA 1TAUA 4LT6A 3PW4A 4NLNA 4DSKA 1DOQA 3UQ2A 4DFMA 1NOMA 3G6VA 7ICSA 3H8JA 4XQ8A 4F5OA 3EYZA 1A77A 1U49A 4DL4A 1X2IA 1Z3EB 3AU2A 7ICVA 2MAXA 4F93B 4WC4A 5KFZA 1NK4A 4EBEA 2IA6A 3JPRA 4R63A 1SKSA 5KFOA 4R8UA 3E2EA 3C66A 9ICHA 4C8OA 4FHYA 3B0XA 3Q8KA 3RH5A 2VA2A 5DGAA 4XRHA 5KFVA 3PNCA 2W9CB 4DFPA 2W9MA 2FLPA 5HRGA 3HJ4A 5CJ7A 4Q45A 2NRWA 4I28A 2R8GA 2ALZA 4AT7B 4DS4A 5L1KA 3C2LA 2GWSA 4FHVA 2LYHA 1BGXT 1S0VA 2ZUCA 4RQ4A 5DB7A 3PR5B 3PX6A 3PO5A 3H4DA 8ICSA 5HHIA 1ZQOA 4GC6A 2HW3A 2ZH4A 1WCLA 9ICNA 3ZD8A 4ECYA 4KLLA 5J29A 1L3UA 3RR8A 4G3IA 4F5PA 4F2SA 2W9BA 1XSLA 4KITB 4QZFA 5BOLA 4RQ8A 1ZQTA 4B9VA 4I2DA 1KNYA 4QZCA 1RXVA 3ZD9A 1Z00A 2XC9A 1R8BA 1R89A 2ZH7A 4KTQA 1XWLA 1JMSA 1ZQKA 2ZHAA 1KFDA 3OVBA 7ICMA 5DLFA 3BQ0A 5IIKA 3RBEA 2M2UA 3EW9A 3OSNA 3G6YA 4DSEA 5EWFA 3GV5B 4P4MA 4ECRA 3RJHA 4RQ2A 5DB8A 4KLSA 4X4VA 3M9NB 4YMMA 3SV3A 2BQUA 1V9PA 3MGHA 2PI5A 2BE3A 1X9SA 2BKEA 5DQIA 1NJYA 4Q44A 1SL0A 1HUZA 4DFJA 2JZBB 4YQWA 8ICBA 4YN4A 9ICTA 2ISPA 3RJJA 4ED3A 7ICOA 1T8EA 3G6XA 3TFRA 4BDPA 1U9LA 2FPMA 4KLFA 4F5QA 2NRKA 4O3SA 5CHGA 8ICNA 4QZ8A 2WTFA 2AGOA 4DWIA 1NK5A 1MC8A 1ZQFA 4UBCA 5EOZA 2PXIA 3V7JA 1BNPA 2B21A 5KFDA 3UPSA 2XO7A 1BVSA 2RDIA 4Q43A 2ZTCA 4ECSA 2AU0A 2DR9A 8ICKA 4DSLA 3PW7A 4JUZA 3RB0A 1H38A 2DFLA 3TANA 4O5EA 4BXOA 8ICHA 4Z6FA 4RNNA 1RYSA 1TK8A 2JEFA 2JEJA 1F5AA 8ICFA 1MIVA 3UXOA 4QZEA 3ZDDA 5HC9A 2ZTDA 8ICCA 4X4PA 4QZBA 2FPKA 9ICAA 1ZQJA 2M2WA 1JIHA 8ICAA 2W9CA 4FBTA 1ZQWA 2RFFA 4RWOA 1NK7A 4QWCA 2Q0ZX 4IQTA 3V6HA 1IXRA 4DFKA 4C8KA 3QEBZ 2C22A 2FMPA 3BQ1A 5KFWA 3V7KA 4O5CA 1DGSA 7ICUA 1VFGA 1NJXA 5KFIA 3M9MB 4YXJA 5KT3A 2W9BB 3RRHA 5KFTA 4XA5A 2P6RA 4IR1A 4F8RA 3KHRA 4O3RA 4F2RA 2KP7A 1UA0A 5KFSA 3OSPA 4ZH4A 4MEXA 4WBYA 4PHPA 3PX0A 1Z00B 3MR3A 1ZQMA 2NRTA 4YG2A 4RQ3A 5HRFA 4FO6A 5IILA 4J9KA 1ZQRA 1RYRA 3UPQA 5L9XA 5HRHA 4X4UA 1CEZA 1ZYQA 4X4TA 4ED8A 4MF8A 5J2JA 4ED6A 1ZQCA 8ICLA 4UB4A 4J9RA 9ICUA 1Q78A 3SI8A 1NKCA 5IIMA 3C1ZA 4UAWA 3Q8MA 5KFGA 4M9HA 4IG8A 4DSIA 1DK3A 3H7IA 5KFAA 4ELTA 3ETLA 2DRBA 4E0DA 2DR8A 1NK8A 7ICGA 4M9JA 3TQ1A 3RAQA 9ICSA 3GIKA 3BQTA 8ICWA 4AT9B 5KT4A 5KFBA 1S10A 9ICXA 4FH3A 1L3VA 4RT3A 3GDXA 2JZBA 2HVHA 4NM2A 5KG7A 3TARA 3MDAA 3NTUA 3IM1A 3M9OB 1S77D 2A1JA 1UT5A 2NRZA 3OV7A 4QZ9A 3ISDA 1D9FA 3MR6A 5DECA 2ZJ5A 4YCXA 5J2HA 2PFQA 4MFFA 4R65A 3MFIA 1PZNA 5KFPA 3Q8LA 4M2YA 1L5UA 4J9LA 1ZJMA 1NO5A 1PX5A 1MQ3A 4WC7A 5KT7A 3GV8B 3TAQA 4BXOB 5KG0A 2OWOA 5HR9A 2JEIA 1BPEA 2PI4A 9ICVA 2BCSA 4B9MA 2MUTB 4RPXA 4DOAA 4ECTA 3UXNA 4ECZA 1BPZA 3LQCB 3PW2A 3H39A 1NZPA 3GQCA 1Q79A 1DK2A 9ICIA 3MDCA 3GILA 5J0UA 5KFQA 4O9MA 4DQQA 4DL2A 3PO4A 5D4BA 4E7XA 1ZQLA 3JZ0A 3HIYA 3GIJA 2DR7A 1TK5A 8ICQA 1QTMA 2F1IA 5J2AA 4YD2A 2XGQA 2RDJA 4F4WA 1ZQXA 5J2IA 4KLHA 2M2TA 3AQLA 1ZQZA 4RUAA 3JPSA 3V6JA 3ZDCA 1NK0A 4DLGA 4DQPA 4Q8EA 9ICFA 5DBBA 4QZHA 5BOMA 4K4GA 4UAZA 2P6UA 1ZQUA 1KDHA 1L3SA 4IQVA 1KTQA 4ELUA 4RZRA 4I29A 5KT6A 1MQ2A 3QZ8A 3PW0A 5KFXA 2M9NA 4J9OA 2BQRA 1JXLA 4DQIA 1B43A 2W9AA 1SKWA 3V72A 5DBCA 2HVIA 2ASDA 4ED7A 1TK0A 5KFCA 3RJEA 5DB9A 4BWMA 8ICIA 4E8FA 4YMOA 3RH6A 1WOTA 2BPCA 4PGXA 3C5FA 3OVAA 4PH5A 3OJUA 4CCHA 3FDSA 4RPYA 4QZIA 3K4GA 4JV0A 2KN7A 2HHXA 5KG4A 2XY7A 5J2KA 4ELVA 4KLIA 4TUSA 5KTQA 4M0AA 1IM4A 4ATBA 3Q8SB 8ICZA 1SKRA 3M8SA 4I2CA 3C1YA 2ZH1A 3RJIA 5J2EA 1C7YA 2KFNA 5CWRA 2BPGA 4X0BA 9ICOA 2NRVA 1ZETA 4IR9A 4UB1A 3RH4A 9ICRA 3HJ1A 5D49A 4QW9A 5DQHA 2A1JB 5C5JA 4DL5A 4QWDA 3K75D 4AT9A 3WFOA 3T5KA 2AQ0A 4I2JA 4KLOA 5L1IA 1LV5A 4FS1A 1JX4A 1TAQA 5KG3A 3B0YA 4DQRA 2IBKA 3RJKA 3T5HA 4F4XA 4J9PA 2HHWA 3RB6A 5F9NA 1NKBA 1EXNA 1ZQHA 4YR2A 3H40A 4I2GA 5HMMA 2P66A 3AQKA 3OVSA 3C2KA 4KLDA 4TQSA 4M47A 4PGYA 1N56A 2VANA 1BPYA 2DRAA 5J2BA 1TVAA 3PMNA 4UB3A 4NY8A 1VJ7A 4DSFA 4K4HA 2XCAA 4B9TA 4JV1A 4KLUA 9ICQA 4WBZA 5KFEA 2MUTA 3JPOA 5J2GA 2R8JA 3OHAA 2UVRA 1JAJA 4KLJA 4FS2A 3OGUA 2R8HA 2AQ4A 1RXWA 4KLTA 1MSWD 3T5LA 3PR4A 5CA7A 9ICLA 4EBCA 5DDMA 1XSPA 4TURA 3C2MA 2NRXA 3MR2A 4B9LA 5DG7A 4I2EA 4LVSA 1ZQNA 1KFTA 4WC0A 3KHGA 4EP7A 2F1HA 1OU5A 4FHXA 3C5GA 3LWMA 4RQ0A 4QWEA 5HRLA 1K1QA 1NKEA 2IMWP 1S0MA 4AT7A 5IIJA 4X4OA 1NJWA 2Y1JA 2C2DA 3Q8QB 4DL6A 2V9WA 1WCNA 5IIOA 4DO9A 1KLNA 9ICEA 4XUSA 1X9MA 8ICOA 8ICXA 2ID1A 4O3QA 4GXJA 4O3NA 3HX0A 4EBDA 3QZ7A 1ZQBA 3H37A 2BR0A 4S3NA 2J6UA 4KLQA 4F50A 4ATBB 1U45A 2XY6A 3GFKB 5D46A 3JPNA 2PFOA 3JYYA 4UD4A 3ZDAA 1SL1A 2UVUA 2KFZA 2PBEA 1ZQQA 3KTQA 5KFHA 4M9LA 2ZJAA 1TFRA 2XCPA 4F3OA 1L3TA 2HHQA 4C8NA 1X9WA 4WC1A 3PW5A 4IQUA 5J0TA 4TUPA 3LWLA 4EYIB 1T3NA 3T3FA 2J6SA 2AJQA 1JQRA 3BJYA 4NLKA 3KHLA 4P4OA 4RQ7A 4EBJA 4IRKA 3LK9A 1XU4A 5L1LA 5DB6A 9ICMA 1TFWA 4P2HA 7ICLA 4X4SA 4AT8B 4WC6A 3GV7B 3EPIA 2FLNA 4DQSA 2BCUA 2ISOA 1ZQDA 7ICPA 2ZH5A 2O5AA 3RB3A 2KZZA 2F1JA 2ZUDA 4IQWA 4O5KA 4F4ZA 5KFNA 4ECWA 5DG9A 3QE9Y 5J0OA 1MIWA 4X0AA 3AQMA 3MABA 1ZQEA 4KN7A 4JWMA 2VA8A 1AROP 3H38A 3C21A 7ICNA 2ZH6A 3PMLA 4ECXA 4LZDA 5KFLA 5KFJA 4QWBA 4RT2A 9ICJA 7ICRA 4QZAA 2FMQA 4WCWA 4M6WB 7ICTA 5J0QA 1NJZA 3JPQA 3UQ0A 4WC3A 2BHNA 4F91B 4BWJA 4YP3A 1NK6A 3PY8A 3ORYA 2W8LA 2V4QA 3RTVA 3H3AA 3BDPA 1S0OA 4MFCA 4GLXA 8ICEA 4Z6EA 5HNKA 1S0NA 8ICPA 4EYHB 2FLLA 3MBYA 4F4YA 4DL3A 4J9QA 3AQNA 4NXZA 5IINA 4C8MA
chains in the Genus database with same CATH superfamily
4J9MA 2BCVA 4YFKA 5G5HA 3TAPA 1XSNA 2ESEA 1KFSA 1FA0A 2H3IA 3TKAA 2IHOA 5AI8A 4PGQA 5BPCA 4I2HA 5J0SA 4MF2A 4Q8FA 3SV4A 4QZDA 1U47A 1NK9A 4TQRA 1LKYB 2D3DA 4B9NA 1JQRA 4B6JA 1D9DA 2V4RA 4OAGA 4AYBC 5J0XA 1S76D 4OO1J 2G5HB 2IOFK 4UB2A 1VJ7A 4ED0A 4ECVA 1JRPA 4ECQA 9ICGA 4AT8A 5KFKA 2W3SA 4RWNA 3ETRA 3SD7A 1FEZA 5HHHA 3CRXA 4RQ5A 9ICWA 2EZZA 1UHUA 3QUCA 2ZUBA 4O3OA 4OJLA 4AP9A 3JPPA 4ECUA 1ZQGA 1N5WA 2JMGA 4UB6U 1ZRMA 2F76X 4J9SA 5AM5A 3IG8A 3HPOA 5EE3A 4M9GA 8ICJA 4DSJA 4YMNA 2J6TA 4R8UB 1S8OA 4J9NA 4CF4A 3J81j 4P4PA 3GZFA 2LM1A 3L9DA 2OCEA 4NWIA 1WWVA 4LZGA 3CK6A 4RWPA 1BNOA 4FE3A 5D61A 3RJGA 4F92B 4XQ7A 8ICGA 3EZ5A 1WYGA 5D63A 2Y1IA 4UQGA 3WK4A 3KFUF 1SWWA 1N60A 3HW8A 4X4RA 3MC1A 3H8SA 3RR7A 3ER9B 4RQ6A 3T79A 1ZQPA 2PMZF 2E5SA 4M5DA 4DOCA 1URJA 1Q3VA 2BCRA 4WOYA 2B0CA 3NGDA 4KMUA 1PVPA 3BQ2A 3Q8PB 3H8MA 2GAFD 4NXUA 1KSPA 2OEHA 3D6JA 5EWEA 5HR7A 5ALYA 1QH9A 4LT6A 3D2QA 3NUQA 5C0YA 3N7PD 4XQ8A 2GOLA 4DL4A 7ICVA 5KFZA 1TE2A 1SKSA 3C66A 9ICHA 4FHYA 3Q8KA 4CF5A 5DGAA 4XRHA 5HRGA 2W9MA 3E0FA 1HEKA 4Q45A 2VJ4A 3K1ZA 4DS4A 1S0VA 3I76A 1C20A 2MRLA 4ICAA 3H4DA 3WU2U 3WK9A 1ZQOA 4GC6A 1O08A 2E8PA 3RF9A 9ICNA 4G3IA 4ECYA 4BX9C 3NS1A 5J29A 1L3UA 1DXSA 3NVZA 2G07A 2F77X 4QZFA 5BOLA 1ZQTA 4I2DA 4WQLA 1RXVA 1R8BA 2KEYA 4KTQA 5AKJA 3F2CA 1KFDA 5DLFA 5KL1B 5B3PA 3SV3A 2BQUA 2PI5A 2BE3A 1X9SA 2BKEA 5DQIA 1NJYA 1SL0A 1HUZA 4DFJA 3TADA 4ED3A 3DEEA 1Z4OA 3G6XA 1T8EA 4BDPA 1U9LA 4F5QA 1RQLA 2WTFA 3PSTA 4ZOHC 3SAFA 1BNPA 3F53A 3KBBA 2O6KA 1QCKA 2ZTCA 8ICKA 3WKCA 4DCCA 1RDFA 1M6YA 4Z6FA 4RNNA 1F44A 1FFUA 2KHVA 1MIVA 3UXOA 5HC9A 4NL9C 8ICCA 3QUBA 8ICAA 4K98A 3SAGA 5AM1A 3V6HA 2ZIUA 4IQTA 2B6GA 3QEBZ 2C22A 3L4PA 3BQ1A 2EAMA 2JV3A 1DGSA 1NJXA 4KB6A 3M9MB 4O3RA 5KFTA 3KHRA 1UA0A 1ZQMA 3FAHA 4RQ3A 4CDGA 1RYRA 1SB3C 5HRHA 4G9BA 3VC8A 1ZYQA 8ICLA 9ICUA 3IP4B 1D8BA 1NKCA 3M6ZA 4M9HA 5KFGA 4PZNA 5KFAA 2DRBA 2DR8A 3RAQA 2G09A 4AT9B 3SAHA 4FH3A 3GDXA 2JZBA 2HVHA 5KG7A 3TARA 2XI9A 3IM1A 1S77D 2BBHA 2OH2A 1D9FA 2ZJ5A 5J2HA 5AKLA 4R65A 2IOHA 2F44A 3BZKA 1MQ3A 5AM3A 3GV8B 3SQIA 5HR9A 2OWOA 2MUTB 4RPXA 4ECTA 4ECZA 1BPZA 3PW2A 1NZPA 1Q79A 1DK2A 4K97A 3MDCA 4WQKA 3GILA 4O9MA 4DL2A 3NRWA 3HIYA 2ZIUB 2F1IA 5J2AA 2RDJA 1ZQXA 3KKAC 1TFYA 4IG8A 3SEIA 5KNIA 4K4GA 4UAZA 4LEZA 4PL1A 4JV2A 4RZRA 2MSNA 5KT6A 2BQRA 1NI3A 2ASDA 5DB9A 5ALLA 3RH6A 3C5FA 5ALJA 3OJUA 4CCHA 3OWGA 3QU7A 4JV0A 4QZIA 5J2KA 5AKIA 5KTQA 4M0AA 1IM4A 2ZH1A 3Q8SB 8ICZA 1SKRA 1L7NA 1Z1VA 2JRZA 2BPGA 2NRVA 1RYUA 5AIBA 2EDUA 4F72A 4QWDA 3K75D 3WFOA 2ODGA 3T5KA 3UMCA 2EANA 3LVWA 5F9NA 3OVSA 5AHXA 2P66A 4TQSA 3QU2A 5J2BA 1PK1A 5AI5A 2XCAA 4B9TA 4WBZA 9ICQA 1N61A 3JPOA 5J2GA 2UVRA 4KX3A 4KLJA 5CFTA 1KL9A 5J8YC 3O0FA 4Y2RA 1ZOLA 4EBCA 1XSPA 3RFAA 3MR2A 3LWMA 4AT7A 1S0MA 2Y1JA 4DL6A 5IIOA 4O68A 4WBYA 4XUSA 4QIWC 5F3XB 4OJ5A 4O3NA 3HX0A 4EBDA 3QZ7A 2QARA 1ZQBA 4KLQA 4F50A 1U45A 5D46A 3ZDAA 1SL1A 1COKA 1ZQQA 3KTQA 5KFHA 1N63A 4M9LA 3N7RC 2KNJA 2XCPA 1L8OA 4C8NA 1X9WA 3LWLA 1T3NA 3T3FA 2ZG6A 3MCRA 1ZXIA 3TACB 7ICLA 4DQSA 2O5AA 2F1JA 2ZUDA 4IQWA 4X0AA 5KFNA 4ECWA 5DG9A 1YZ7A 4MKPA 3AQMA 4KN7A 4JWMA 1PK1B 3H38A 3PMLA 4ECXA 3I28A 7ICRA 2WFAA 2ZIXA 1SV4A 3UQ0A 4F91B 2FCLA 3IRUA 1KBUA 2V4QA 1S5LU 3WK8A 1Z19A 5HNKA 1S0NA 1FFVA 4C7YA 4Y2TA 4J9QA 4IR9A 1U4BA 3FC4A 4UAVA 2ZH2A 2PFPA 1LVHA 2KICA 2VA3A 3AU6A 4GXKA 7ICKA 3N97B 2DPIA 3THVA 3RRGA 5CR0A 3HP6A 4O67A 4RNMA 3DV9A 2QARB 4Y2PA 1JN3A 1RPLA 3Q8RB 1T3QA 3MR5A 2MU2A 1YLQA 4NXXA 3GIMA 1BPBA 2R18A 1Y88A 5HP4A 8ICYA 1ZQVA 1TKDA 5KG1A 2LHTA 3OJSA 2JEGA 1IG6A 2FPLA 4M9NA 1QQ6A 3CW2C 1XO1A 1UETA 7ICIA 5J8YA 5TISU 2W8KA 4YR3A 2PFNA 4OD0A 1O03A 2Q4TA 2BDPA 2H5XA 1B22A 2XGPA 3OUYA 2ZIXB 5L1JA 4NM1A 2R8IA 1PVRA 3RB4A 4X4NA 4K4IA 4Z6CA 2UVVA 4IRCA 4R66A 7ICEA 3IHQB 4M6WA 5J0YA 4YVZA 2DUYA 3KZXA 5KFRA 4P0PB 4R64A 3NVVA 3RJFA 4C0ZA 1P7DA 3HKZF 2M0NA 4FH5A 4DS5A 4UD5A 2ZTEA 5CRXA 4NKTA 4UAUA 2HHUA 2Y0SF 2EZXA 3S6JA 1SV0C 4YXMA 1JI7A 5DEDA 1ZQAA 5KT2A 2KZ3A 3MFHA 3V6KA 2IHMA 4B9UA 7ICFA 3PX4A 1Q46A 1ZQSA 3QU4A 3AL0B 5KG6A 1UCVA 3IV6A 4RUCA 3KHHA 3JPTA 2ZHBA 1LKYA 1T4GA 2YB1A 1J2NA 2G06A 5DGBA 4I0UA 3GU3A 2KG5A 2KIVA 2E8MA 2I6XA 3IG5A 3TFSA 5AI9A 4Y2YA 3BQ7A 7ICQA 3WFSC 5HMLA 4RPZA 3WFPA 5KFYA 4YR0A 4E0DA 3OUYB 5JUMA 2AGQA 1D8YA 1QSYA 5J2FA 3ISCA 2HSZA 4KLEA 8ICMA 2B56A 4X5VA 2ZJ8A 4EZ6A 2YY6A 5DBAA 4GFJA 3PW4A 4NLNA 1SWVA 3G6VA 3EYZA 1A77A 1Z3EB 2HBJA 2MAXA 5B66U 4DFDA 2IA6A 4EBEA 4R8UA 3E2EA 3RH5A 2VA2A 2D8CA 3CP8A 5KFVA 3PNCA 3AMZA 5CJ7A 3AQEA 2R8GA 2H3QA 2LYHA 3PR5B 4IS7A 2YMMA 3PX6A 5HHIA 2YTUA 3H0RB 2HW3A 2ZH4A 4QJFB 3ZD8A 1WG8A 2W9BA 4RQ8A 1KNYA 3OPXA 1Z00A 2ZH7A 5AI4A 1XWLA 1JMSA 2A1AA 1KN5A 2WF6A 3BQ0A 5IIKA 3RBEA 4IL6U 3EW9A 3OSNA 4DSEA 2EZYA 2M2UA 5EWFA 5AK3A 4ECRA 4RQ2A 3M9NB 5AK4A 2WB1F 3MGHA 4Y2XA 9ICTA 3RJJA 3B9JA 4O69A 4KLFA 3TFRA 5CHGA 2AGOA 4UBCA 3WK5A 2PXIA 5ALXA 5KFDA 4DSLA 3PW7A 2NO5A 3RB0A 1RYSA 1TK8A 2JEJA 1F5AA 8ICFA 2F8LA 4EEKA 2LM4A 4X4PA 9ICAA 4U6PA 1JIHA 2K4PA 2WF8A 4DFKA 1J2MA 4OJPA 1OW5A 2W9BB 2P6RA 4XA5A 4F8RA 8ICXA 4F2RA 1Z00B 4FO6A 4C80A 5IILA 4JB3A 1ZQRA 2ZIWA 3UPQA 4OAFA 5ALSA 4ED6A 1ZQCA 1SGGA 4J9RA 2WAQF 1Q78A 1CRXA 3C1ZA 3Q8MA 1DK3A 2HN1A 3ETLA 2K4HA 3TQ1A 3GIKA 3BQTA 2G08A 4RT3A 4FFDA 5ALKA 3NTUA 2A1JA 3OV7A 4QZ9A 2OHFA 5KAIU 5DECA 2PFQA 4YCXA 3KZIU 1RQNA 4M2YA 3Q8LA 1PX5A 1L5UA 5KT7A 3TAQA 5KG0A 2XIDA 2BCSA 3UXNA 3HJEA 3GQCA 9ICIA 4O6AA 4U7CA 3FM9A 3VCBA 3PO4A 1F0MA 3GIJA 8ICQA 4K99A 4KLHA 2PMZC 2M2TA 3AQLA 1ZQZA 4Q8EA 4DQPA 2KHQA 3U26A 4IQVA 4M47A 2FE9A 4FHXA 5KFXA 5JRTA 4J9OA 2ZIWB 1Q3UA 2HVIA 3RJEA 4ED7A 4OJOA 5KFCA 2KOBA 1KW4A 4YMOA 4C4TA 1WOTA 1IIPA 4PGXA 3OVAA 4PH5A 3K1RB 4RPYA 5H2FU 2E8NA 1AQ6A 4OCZA 4ATBA 1ZD3A 5FP0A 4BJQA 1X9XA 5J2EA 3RJIA 9ICOA 1ZETA 4NXWA 9ICRA 3ALRA 2KJ9A 5D49A 2B51A 2A1JB 5ALRA 2G5IB 4AT9A 2Y9TA 2AQ0A 1LV5A 4FS1A 1TAQA 2K4EA 2IBKA 3RJKA 2JR5A 4F4XA 2JHDA 3RB6A 1MN8A 1RG6A 4YR2A 3H40A 4C4RA 5HMMA 3F2DA 3C2KA 2VANA 3AM9A 2EH9A 2LYAA 4UB3A 4NY8A 5HR6A 4JV1A 2MUTA 5AI6A 4FZLA 2CN1A 3OGUA 2ES6A 4KLTA 3PR4A 5CA7A 5DG7A 1KFTA 4EP7A 1OU5A 4RQ0A 1NKEA 2YX8A 2QKQA 1GPJA 3Q8QB 1Z4NA 9ICEA 2J6UA 4ATBB 2PFOA 3JPNA 4P0QA 2FDRA 1T94A 3PSFA 2K8BB 1DRGA 3PW5A 4IQUA 4TUPA 4LEWA 3BJYA 4NLKA 4EBJA 3LK9A 4PL2A 5GTIU 2RP5A 3GV7B 2JH7A 2BCUA 3RB3A 2YMLA 4KX5A 2Y9UA 4F4ZA 5ALOA 1MIWA 1ZQEA 4EX6A 4MHVA 1AROP 3C21A 4LZDA 5KFJA 4RT2A 5B3QA 1NJZA 1NK6A 5CEHA 2W8LA 4Y2JA 2KK0A 8ICEA 4Z6EA 8ICPA 3AQNA 2BPFA 5DQGA 3ZDEA 2NV3A 3NVYA 3SYZA 2ZH8A 3H8WA 4Y2QA 4QWAA 4RQNA 4WC5A 2VJ5A 3MGIA 4I27A 3WFRE 5F9LA 4C8LA 4K8VA 5AIAA 5TZVA 5AKKA 4KMOB 4DOBA 4P0QB 1ZQIA 3WK6A 4BGDA 2BQ3A 4NKUA 4F5RA 5AKYA 3SZ2A 5KFMA 5DKWA 2DGZA 4JK1A 1U48A 2UVWA 4I2IA 5AM2A 4E80A 2YQEA 4KLMA 5ALWA 3M7DA 4UBBA 1LB2B 2YB4A 5D62A 4F4KA 5J0PA 5KG5A 4FHPA 4NL9A 1JXEA 4UATA 1DGJA 4QW8A 3L5KA 2ASLA 4QZGA 3T5JA 2I1QA 4PPXA 1VJ5A 1N48A 5G5GA 5AKZA 4DEZA 5HRBA 2XY5A 1ZD5A 2KJ5A 2LI6A 3OHBA 4HAIA 4EENA 2DPJA 2HBLA 1UEVA 3NVWA 4FHWA 2FMSA 5IIIA 3CNHA 4UB8U 3GIIA 4RNOA 3PV8A 4Z6DA 4UARA 5J2CA 2KMDA 3QEAZ 3C18A 1UA1A 3IDWA 8ICVA 2IUBA 2KTQA 4X4QA 5CB1A 4HYKA 4K9AA 3A0HU 3RBDA 1ZJNA 4I2FA 1T7PA 2HBKA 3ERCC 4EELA 2ZH3A 4UAYA 5ALMA 9ICPA 1X40A 2H3FA 2WF5A 1X6JA 4IRDA 2YMPA 5EE1A 4LJXA 2BGWA 3PVXA 3FYHA 2Q66A 4US8A 1OXJA 3NYBA 2NO4A 4GC7A 4KLGA 4RWQA 2M2VA 2R8KA 9ICCA 2ASJA 4MFAA 4O0IA 1CI4A 3KKAA 1PVQA 4DF4A 3C23A 4KN4A 5EWGA 4TUQA 5KFUA 4GXIA 1KRPA 2HOIA 3PSIA 7ICHA 1A76A 1UT8A 1XNSA 5ALQA 2ZH9A 5F2VO 4F5NA 2K8CB 1BPXA 2IHNA 2F8KA 5CFSA 1DOQA 1L7PA 3I1YA 1NOMA 7ICSA 4F5OA 1X2IA 2OYYA 4P0PA 3JPRA 4R63A 5KFOA 4C8OA 3B0XA 2RHFA 3NWIA 3HJ4A 2W9CB 4DFPA 3WKDA 3PSPA 4EX7A 4FHVA 1BGXT 2ZUCA 5DB7A 2WHEA 5AKHA 1ECWA 1XO0A 1V38A 1WCLA 4KLLA 3RR8A 4F5PA 4F2SA 1Q8KA 3UM9A 4IC9A 1B0XA 5ALFA 2XC9A 5KAFU 1ZQKA 3OVBA 1FIQA 1L7OA 4KLSA 5DB8A 4X4VA 4YMMA 1V9PA 3PHZA 1KKXA 8ICBA 2GH1A 7ICOA 2FPMA 5B5EU 2DF4B 2NRKA 4O3SA 4QZ8A 2HOQA 4CRXA 2B21A 2WF7A 2XO7A 2RDIA 4ECSA 2DR9A 2H3VA 4JUZA 1H38A 3MGVA 3TANA 2KVSA 4O5EA 4BXOA 8ICHA 3CYMA 1ZD2P 5ALEA 4QZBA 5JTGA 1YT3A 1ZQJA 3E58A 4FBTA 1ZQWA 2RFFA 2E1FA 4RWOA 2EAOA 4QWCA 2Q0ZX 1Z1BA 2FMPA 4C4SA 5KFWA 7ICUA 1VFGA 5KT3A 4IR1A 4NLCA 2EWRA 2W3RA 5KFSA 3OSPA 3PX0A 2NRTA 4J9KA 4X4TA 4ED8A 4QNLA 5J2JA 4MF8A 4UB4A 2YMQA 3BS7A 3AEVA 4UAWA 2VKQA 4DSIA 4ELTA 1NK8A 4M9JA 4JLXA 3HKZC 9ICSA 8ICWA 1S10A 4NM2A 2Y0SC 1UT5A 2NRZA 3ISDA 3MR6A 2HCFA 1WWUA 1PZNA 5KFPA 1NO5A 4J9LA 1ZJMA 3ER8C 4AYBF 4BXOB 2PI4A 3C29A 4B9MA 4DOAA 2AH5A 3LQCB 3H39A 2W7PA 4FO1A 3R9KA 2ZXIA 4UW9A 4E7XA 3JZ0A 2DR7A 1QTMA 4F4WA 5J2IA 2KSOA 1SXDA 4RUAA 3JPSA 3V6JA 3ZDCA 2P35A 5DBBA 1PK3A 4QZHA 5BOMA 2MA1A 2B4VA 1L3SA 3QZ8A 3PW0A 1JXLA 2M9NA 4DQIA 2KKPA 1B43A 1SKWA 5DBCA 8ICIA 1TK0A 4E8FA 4K9BA 1KQQA 2E8OA 2BPCA 2DWQA 5CFUA 4FZMA 3FDSA 4OAHA 4ELVA 2W7OA 2W04A 5CWRA 4EEDA 4X0BA 1SV0A 1OUQA 4QW9A 5DQHA 2XICA 5C5JA 5ALIA 4DL5A 1PUZA 1JX4A 4J9PA 1L6NA 1EXNA 5T14A 2K4IA 4PGYA 2DRAA 4UASA 1TVAA 3PMNA 4K4HA 3OHAA 3M1YA 4FS2A 2KSOB 2R8HA 2F3NA 2K89A 1FO4A 1X42A 3T5LA 4Y2UA 2GO7A 9ICLA 3JCFA 3C2MA 4B9LA 4WC0A 1JROA 3KHGA 3QYPA 2F1HA 2WB1C 5HRLA 2DKZA 3TADC 4X4OA 1NJWA 1KLNA 4CE6A 5EE0A 4DO9A 2ID1A 1JUDA 8ICOA 4GXJA 2VIXA 3F5AA 2EQYA 3WKBA 3GFKB 3N28A 4LEVA 3SR6A 1YZ6A 2ZJAA 2HHQA 4WC1A 1K5OA 5J0TA 2J6SA 2AXTU 3KHLA 4P4OA 1TFWA 9ICMA 5DB6A 4X4SA 4AT8B 4WC6A 3EPIA 2FLNA 2KV2A 1ZQDA 4O5KA 3EF2A 2VA8A 4NXTA 5AK5A 7ICNA 1HIWA 4WCWA 4USAA 9ICJA 1X6IA 4QZAA 3ED5A 2EAPA 7ICTA 3K7DA 5J0QA 3JPQA 2BHNA 1GO3F 2YN4A 3ORYA 2FJ6A 1SZHA 3NVOA 4EYHB 2E3TA 3MBYA 4F4YA 4DL3A 4ELUA 5IINA 4C8MA 5AK6A 4ED2A 2WAQC 3WFQE 4FBUA 4NXVA 5EE9A 1L8LA 3ZDBA 2HHSA 1BPDA 1HUOA 1RZTA 1N2XA 3EPGA 2F2AB 8ICUA 1KEJA 2LMRA 2HHPA 3LDAA 4PHDA 5HRDA 1XS9D 5ALGA 4RU9A 5DDYA 2BCQA 1J97A 2G0AA 2LKYA 5ALZA 1D8LA 4I2AA 4J03A 4PHEA 1X66A 2GLEA 4NLGA 3EUB2 3AQFA 4F71A 4NV0A 3A0BU 1ZQ1C 1S9FA 5A0LA 2QLTA 2GA9D 2C2EA 1R8AA 4WJ3B 4OJ6A 5KG2A 2Z7JA 4DF8A 2QB0A 4ED1A 5ALNA 3WKEA 2N1RA 3L3FX 7ICJA 5CP2A 4XJEA 3F5EA 1UEUA 4ACOA 1K1SA 3UXPA 5K4LA 1R8CA 4M04A 4WC2A 3M8RA 2KIWA 4PHAA 3M6KA 5ALHA 2HHTA 2HMXA 8ICTA 9ICKA 5KT5A 5HREA 4DL7A 1QQ5A 5HRIA 2ATLA 1V4AA 1SZPA 3HWTA 4B9SA 2KZMA 2O1PA 1SL2A 5J2DA 3ONNA 3AUOA 3V7LA 1N5XA 2KJ8A 2ZXHA 4NJ8A 2AHOB 3RAXA 4I2BA 3TI0A 4EBKA 2DR5A 5KFFA 4NLZA 3H4BA 3HILA 4MEYA 1HJPA 1ZQYA 5HRKA 5J0WA 1QSSA 2I9GA 2JXJA 5J0RA 4DLEA 2C2RA 2DVIA 2AGPA 1S97A 3NRZA 3EWAA 5ALUA 3HT3A 1UPHA 4EEYA 1QLNA 2DL0A 2W55A 2QB0B 2C28A 1COOA 3IN5A 3D2NA 5AI0A 9ICBA 4EZ9A 3N4MB 2I5HA 5ALTA 1SIJA 3WK7A 1RM6C 4RQ1A 4O3PA 2HHVA 4YD1A 5DG8A 1TV9A 1CUKA 5DLGA 1MIYA 1XC9A 3ISBA 4UB5A 3H0MB 4JWNA 2PKEA 1ZRNA 1QSLA 2WF9A 8ICRA 1TAUA 4DSKA 5KL8B 3SMVA 4O3MA 3UQ2A 4DFMA 4Y2SA 3H8JA 1V85A 3DDHA 1U49A 3AU2A 4F93B 4WC4A 1NK4A 2BZFA 3LVVA 2FLPA 5AM4A 2RQ5A 2CPRA 2NRWA 4I28A 2ALZA 2QB1A 5L1KA 3C2LA 2GWSA 4RQ4A 3PO5A 8ICSA 5AM0A 5E79U 3OTQA 1SXEA 1XSLA 4KITB 4B9VA 4QZCA 3ZD9A 2L5YA 2CRXA 1R89A 2ZHAA 7ICMA 2W11A 3G6YA 1VDVA 3GV5B 4P4MA 3RJHA 4K96A 2CXYA 5AKGA 2BDUA 4Q44A 2A19A 2JZBB 4YQWA 4YN4A 2ZIVA 2ISPA 2KE7A 4Y2VA 4QIWF 1UQVA 4EGWA 8ICNA 4DWIA 5ALVA 1NK5A 1MC8A 5JU5A 1ZQFA 5EOZA 3V7JA 1VLBA 3UPSA 1BVSA 2AU0A 4Q43A 1ZD4A 2HN2A 3QU9A 1F5SA 2DFLA 2K60A 4GIBA 3ICXA 4RQMA 2JEFA 4QZEA 3ZDDA 4N7RA 2ZTDA 3F2BA 2FPKA 2M2WA 5GTHU 2W9CA 3QUTA 1NK7A 1IXRA 4C8KA 3QX7A 3PZPA 3V7KA 4O5CA 3BS5A 5CHEA 1TAMA 5KFIA 4YXJA 3RRHA 4FZNA 1B4FA 2KP7A 4ZH4A 4MEXA 4JLZA 4PHPA 3AN1A 3MR3A 5HRFA 2DKXA 4YG2A 3QU5A 5L9XA 4X4UA 1CEZA 2BBJA 2KD1A 2FI1A 3SI8A 3BZCA 5IIMA 2HDOA 2DBYA 3QNMA 3H7IA 2ZIVB 7ICGA 5KT4A 5KFBA 9ICXA 1L3VA 4JMUA 4CGZA 3H0LB 3MDAA 4OAIZ 3M9OB 2OXOA 4NLBA 1JALA 3SENA 4MFFA 3MFIA 2A3VA 1A6SA 4WC7A 1ED1A 2JEIA 1BPEA 9ICVA 2E1EA 5J0UA 5KFQA 4DQQA 2KVCA 5D4BA 1IV8A 1ZQLA 1TK5A 3NASA 2XGQA 2HOFA 4YD2A 2JH1A 3BS5B 9ICFA 1NK0A 4DLGA 2P6UA 1ZQUA 1KDHA 4AT7B 1KTQA 4I29A 1MQ2A 2OM6A 2W9AA 3NKUA 3V72A 3QXGA 5ALDA 3KOOA 4BWMA 2H3ZA 1NZBA 4EEBA 2LPEA 4C7ZA 3K4GA 2KN7A 2HHXA 5KG4A 2XY7A 4KLIA 3D2SA 2KKVA 4TUSA 4A8EA 3M8SA 4I2CA 3C1YA 2LYBA 4US9A 1C7YA 2KFNA 3N7SC 4UB1A 3RH4A 3HJ1A 3C28A 1L7MA 3LYSA 3WKAA 4I2JA 1WUDA 4KLOA 5L1IA 2IOFA 5KG3A 3B0YA 4DQRA 3T5HA 2HHWA 1NKBA 2W03A 2HI0A 3ZI4A 1ZQHA 4I2GA 3AQKA 4KLDA 1N56A 1BPYA 2RLTA 4DSFA 4KLUA 5KFEA 3UMBA 2R8JA 1JAJA 3UMGA 2AQ4A 2HBMA 1RXWA 1MSWD 5ALPA 3QUQA 2JGAA 5DDMA 4TURA 4I2EA 2NRXA 4LVSA 2W54A 4BUGA 1ZQNA 4CF3A 4CNQA 4KM5A 3C5GA 4QWEA 1K1QA 3HRDD 2IMWP 5IIJA 2V9WA 2C2DA 1WCNA 1X9MA 4O3QA 2K8AA 1MA7A 3H37A 4S3NA 2BR0A 4WH5A 2W43A 2XY6A 2NYVA 3JYYA 4UD4A 4PZOA 2D6FC 2UVUA 2KFZA 1N62A 2PBEA 5AKXA 1TFRA 4F3OA 1L3TA 4EYIB 2AJQA 5AKEA 5JTIA 4RQ7A 4IRKA 1XU4A 5L1LA 5AICA 2LBOA 4P2HA 1V97A 7ICPA 2ISOA 2ZH5A 4EV6A 2KZZA 2RRDA 5J0OA 3QE9Y 3MABA 2ZH6A 5L1MA 5KFLA 4QWBA 4HX0A 4PJ0U 3KD3A 2FMQA 4M6WB 4WC3A 1A0PA 4BWJA 4YP3A 3PY8A 2XVTA 4LEYA 3RTVA 3H3AA 2DQNB 3BDPA 1S0OA 4MFCA 4GLXA 1QQ7A 2FLLA 1NNLA 4NXZA
chains in the Genus database with same CATH topology
1U4BA 4J9MA 2BCVA 2BPFA 3WFQE 2ZH2A 5DQGA 2PFPA 3ZDEA 4YFKA 2VA3A 4FBUA 3SYZA 3AU6A 3TAPA 4GXKA 7ICKA 1XSNA 3N97B 2ZH8A 2DPIA 3H8WA 1KFSA 3THVA 4QWAA 3RRGA 1FA0A 5CR0A 3ZDBA 4WC5A 2HHSA 1BPDA 3HP6A 3MGIA 1HUOA 4I27A 3WFRE 5F9LA 4C8LA 1RZTA 4RNMA 3EPGA 3Q8RB 1JN3A 1RPLA 5BPCA 4PGQA 5TZVA 4I2HA 8ICUA 1KEJA 5J0SA 2HHPA 3LDAA 4PHDA 3MR5A 4DOBA 5HRDA 1YLQA 1ZQIA 4MF2A 4BGDA 1XS9D 3GIMA 1BPBA 2BQ3A 1Y88A 4Q8FA 4RU9A 3SV4A 4F5RA 4NKUA 4QZDA 1U47A 3SZ2A 1NK9A 4TQRA 5HP4A 5KFMA 8ICYA 5DKWA 5DDYA 4JK1A 1ZQVA 1U48A 1TKDA 2UVWA 2BCQA 4I2IA 1D9DA 4B9NA 5KG1A 2V4RA 4E80A 1D8LA 3OJSA 4I2AA 4PHEA 4KLMA 1LB2B 4UBBA 5J0XA 2JEGA 2FPLA 4F4KA 5J0PA 5KG5A 4M9NA 4NLGA 1S76D 4FHPA 1JXEA 4QW8A 4UB2A 1S9FA 4ED2A 2ASLA 1XO1A 4QZGA 2C2EA 7ICIA 1UETA 4ED0A 3T5JA 1R8AA 2I1QA 2W8KA 4YR3A 4ECVA 2PFNA 3OUYB 5KG2A 4PPXA 4ECQA 1N48A 9ICGA 4DEZA 2BDPA 1B22A 2H5XA 2XY5A 5KFKA 5HRBA 4AT8A 4DF8A 2XGPA 4ED1A 4RWNA 3OUYA 5HHHA 3OHBA 5L1JA 4RQ5A 4NM1A 2R8IA 9ICWA 3RB4A 2DPJA 4X4NA 4K4IA 1UEVA 7ICJA 5CP2A 4Z6CA 4FHWA 2FMSA 2UVVA 1UEUA 4IRCA 1K1SA 3UXPA 4R66A 2ZUBA 4O3OA 7ICEA 1R8CA 4M04A 3JPPA 5IIIA 4ECUA 3IHQB 1ZQGA 4M6WA 4WC2A 5J0YA 4JV2A 3M8RA 3GIIA 4PHAA 2HHTA 4RNOA 3PV8A 4YVZA 4J9SA 8ICTA 4Z6DA 9ICKA 5KFRA 5KT5A 3HPOA 5HREA 4DL7A 4M9GA 5J2CA 4R64A 8ICJA 3QEAZ 3RJFA 4DSJA 3C18A 4YMNA 2J6TA 5HRIA 4R8UB 1UA1A 8ICVA 2ATLA 1V4AA 2KTQA 1SZPA 4FH5A 5CB1A 3HWTA 4DS5A 4J9NA 2ZTEA 4HYKA 4B9SA 4NKTA 2KZMA 3RBDA 4UD5A 1ZJNA 2O1PA 4I2FA 1SL2A 1T7PA 2HHUA 4P4PA 5J2DA 4M5DA 3L9DA 4YXMA 3AUOA 2ZH3A 3V7LA 5DEDA 1ZQAA 5KT2A 2KZ3A 4LZGA 3MFHA 3V6KA 4UAYA 2IHMA 4B9UA 7ICFA 9ICPA 3PX4A 3RAXA 4I2BA 1BNOA 3TI0A 4RWPA 3RJGA 4EBKA 1ZQSA 5KG6A 4RUCA 2DR5A 4F92B 5KFFA 3KHHA 4IRDA 3JPTA 3H4BA 4NLZA 4XQ7A 2ZHBA 2BGWA 8ICGA 3PVXA 4MEYA 3FYHA 1HJPA 1T4GA 3EZ5A 2Q66A 1ZQYA 5HRKA 5J0WA 1QSSA 2I9GA 2Y1IA 4UQGA 3NYBA 5J0RA 5DGBA 4DLEA 1TFYA 2C2RA 4GC7A 4KLGA 4RWQA 2DVIA 2M2VA 3HW8A 2R8KA 9ICCA 4X4RA 2ASJA 2AGPA 4MFAA 3TFSA 4O0IA 1S97A 3EWAA 3H8SA 3HT3A 4EEYA 3RR7A 1QLNA 4RQ6A 1ZQPA 7ICQA 3WFSC 5HMLA 4RPZA 2C28A 3WFPA 4DF4A 3C23A 4KN4A 5KFYA 5EWGA 5KFUA 4YR0A 4TUQA 1COOA 5JUMA 4GXIA 4DOCA 2AGQA 1QSYA 1D8YA 2BCRA 1KRPA 5J2FA 7ICHA 1A76A 9ICBA 3ISCA 1UT8A 3NGDA 4KMUA 4EZ9A 3N4MB 4KLEA 4RQ1A 4O3PA 2HHVA 3BQ2A 8ICMA 4YD1A 2ZH9A 3Q8PB 5F2VO 5DG8A 1TV9A 4X5VA 1CUKA 2ZJ8A 4EZ6A 4F5NA 5DLGA 1KSPA 4X4QA 5EWEA 1MIYA 1XC9A 3ISBA 4UB5A 4JWNA 5DBAA 1BPXA 1QSLA 8ICRA 2IHNA 1TAUA 4LT6A 3PW4A 4NLNA 4DSKA 1DOQA 3UQ2A 4DFMA 1NOMA 3G6VA 7ICSA 3H8JA 4XQ8A 4F5OA 3EYZA 1A77A 1U49A 4DL4A 1X2IA 1Z3EB 3AU2A 7ICVA 2MAXA 4F93B 4WC4A 5KFZA 1NK4A 4EBEA 2IA6A 3JPRA 4R63A 1SKSA 5KFOA 4R8UA 3E2EA 3C66A 9ICHA 4C8OA 4FHYA 3B0XA 3Q8KA 3RH5A 2VA2A 5DGAA 4XRHA 5KFVA 3PNCA 2W9CB 4DFPA 2W9MA 2FLPA 5HRGA 3HJ4A 5CJ7A 4Q45A 2NRWA 4I28A 2R8GA 2ALZA 4AT7B 4DS4A 5L1KA 3C2LA 2GWSA 4FHVA 2LYHA 1BGXT 1S0VA 2ZUCA 4RQ4A 5DB7A 3PR5B 3PX6A 3PO5A 3H4DA 8ICSA 5HHIA 1ZQOA 4GC6A 2HW3A 2ZH4A 1WCLA 9ICNA 3ZD8A 4ECYA 4KLLA 5J29A 1L3UA 3RR8A 4G3IA 4F5PA 4F2SA 2W9BA 1XSLA 4KITB 4QZFA 5BOLA 4RQ8A 1ZQTA 4B9VA 4I2DA 1KNYA 4QZCA 1RXVA 3ZD9A 1Z00A 2XC9A 1R8BA 1R89A 2ZH7A 4KTQA 1XWLA 1JMSA 1ZQKA 2ZHAA 1KFDA 3OVBA 7ICMA 5DLFA 3BQ0A 5IIKA 3RBEA 2M2UA 3EW9A 3OSNA 3G6YA 4DSEA 5EWFA 3GV5B 4P4MA 4ECRA 3RJHA 4RQ2A 5DB8A 4KLSA 4X4VA 3M9NB 4YMMA 3SV3A 2BQUA 1V9PA 3MGHA 2PI5A 2BE3A 1X9SA 2BKEA 5DQIA 1NJYA 4Q44A 1SL0A 1HUZA 4DFJA 2JZBB 4YQWA 8ICBA 4YN4A 9ICTA 2ISPA 3RJJA 4ED3A 7ICOA 1T8EA 3G6XA 3TFRA 4BDPA 1U9LA 2FPMA 4KLFA 4F5QA 2NRKA 4O3SA 5CHGA 8ICNA 4QZ8A 2WTFA 2AGOA 4DWIA 1NK5A 1MC8A 1ZQFA 4UBCA 5EOZA 2PXIA 3V7JA 1BNPA 2B21A 5KFDA 3UPSA 2XO7A 1BVSA 2RDIA 4Q43A 2ZTCA 4ECSA 2AU0A 2DR9A 8ICKA 4DSLA 3PW7A 4JUZA 3RB0A 1H38A 2DFLA 3TANA 4O5EA 4BXOA 8ICHA 4Z6FA 4RNNA 1RYSA 1TK8A 2JEFA 2JEJA 1F5AA 8ICFA 1MIVA 3UXOA 4QZEA 3ZDDA 5HC9A 2ZTDA 8ICCA 4X4PA 4QZBA 2FPKA 9ICAA 1ZQJA 2M2WA 1JIHA 8ICAA 2W9CA 4FBTA 1ZQWA 2RFFA 4RWOA 1NK7A 4QWCA 2Q0ZX 4IQTA 3V6HA 1IXRA 4DFKA 4C8KA 3QEBZ 2C22A 2FMPA 3BQ1A 5KFWA 3V7KA 4O5CA 1DGSA 7ICUA 1VFGA 1NJXA 5KFIA 3M9MB 4YXJA 5KT3A 2W9BB 3RRHA 5KFTA 4XA5A 2P6RA 4IR1A 4F8RA 3KHRA 4O3RA 4F2RA 2KP7A 1UA0A 5KFSA 3OSPA 4ZH4A 4MEXA 4WBYA 4PHPA 3PX0A 1Z00B 3MR3A 1ZQMA 2NRTA 4YG2A 4RQ3A 5HRFA 4FO6A 5IILA 4J9KA 1ZQRA 1RYRA 3UPQA 5L9XA 5HRHA 4X4UA 1CEZA 1ZYQA 4X4TA 4ED8A 4MF8A 5J2JA 4ED6A 1ZQCA 8ICLA 4UB4A 4J9RA 9ICUA 1Q78A 3SI8A 1NKCA 5IIMA 3C1ZA 4UAWA 3Q8MA 5KFGA 4M9HA 4IG8A 4DSIA 1DK3A 3H7IA 5KFAA 4ELTA 3ETLA 2DRBA 4E0DA 2DR8A 1NK8A 7ICGA 4M9JA 3TQ1A 3RAQA 9ICSA 3GIKA 3BQTA 8ICWA 4AT9B 5KT4A 5KFBA 1S10A 9ICXA 4FH3A 1L3VA 4RT3A 3GDXA 2JZBA 2HVHA 4NM2A 5KG7A 3TARA 3MDAA 3NTUA 3IM1A 3M9OB 1S77D 2A1JA 1UT5A 2NRZA 3OV7A 4QZ9A 3ISDA 1D9FA 3MR6A 5DECA 2ZJ5A 4YCXA 5J2HA 2PFQA 4MFFA 4R65A 3MFIA 1PZNA 5KFPA 3Q8LA 4M2YA 1L5UA 4J9LA 1ZJMA 1NO5A 1PX5A 1MQ3A 4WC7A 5KT7A 3GV8B 3TAQA 4BXOB 5KG0A 2OWOA 5HR9A 2JEIA 1BPEA 2PI4A 9ICVA 2BCSA 4B9MA 2MUTB 4RPXA 4DOAA 4ECTA 3UXNA 4ECZA 1BPZA 3LQCB 3PW2A 3H39A 1NZPA 3GQCA 1Q79A 1DK2A 9ICIA 3MDCA 3GILA 5J0UA 5KFQA 4O9MA 4DQQA 4DL2A 3PO4A 5D4BA 4E7XA 1ZQLA 3JZ0A 3HIYA 3GIJA 2DR7A 1TK5A 8ICQA 1QTMA 2F1IA 5J2AA 4YD2A 2XGQA 2RDJA 4F4WA 1ZQXA 5J2IA 4KLHA 2M2TA 3AQLA 1ZQZA 4RUAA 3JPSA 3V6JA 3ZDCA 1NK0A 4DLGA 4DQPA 4Q8EA 9ICFA 5DBBA 4QZHA 5BOMA 4K4GA 4UAZA 2P6UA 1ZQUA 1KDHA 1L3SA 4IQVA 1KTQA 4ELUA 4RZRA 4I29A 5KT6A 1MQ2A 3QZ8A 3PW0A 5KFXA 2M9NA 4J9OA 2BQRA 1JXLA 4DQIA 1B43A 2W9AA 1SKWA 3V72A 5DBCA 2HVIA 2ASDA 4ED7A 1TK0A 5KFCA 3RJEA 5DB9A 4BWMA 8ICIA 4E8FA 4YMOA 3RH6A 1WOTA 2BPCA 4PGXA 3C5FA 3OVAA 4PH5A 3OJUA 4CCHA 3FDSA 4RPYA 4QZIA 3K4GA 4JV0A 2KN7A 2HHXA 5KG4A 2XY7A 5J2KA 4ELVA 4KLIA 4TUSA 5KTQA 4M0AA 1IM4A 4ATBA 3Q8SB 8ICZA 1SKRA 3M8SA 4I2CA 3C1YA 2ZH1A 3RJIA 5J2EA 1C7YA 2KFNA 5CWRA 2BPGA 4X0BA 9ICOA 2NRVA 1ZETA 4IR9A 4UB1A 3RH4A 9ICRA 3HJ1A 5D49A 4QW9A 5DQHA 2A1JB 5C5JA 4DL5A 4QWDA 3K75D 4AT9A 3WFOA 3T5KA 2AQ0A 4I2JA 4KLOA 5L1IA 1LV5A 4FS1A 1JX4A 1TAQA 5KG3A 3B0YA 4DQRA 2IBKA 3RJKA 3T5HA 4F4XA 4J9PA 2HHWA 3RB6A 5F9NA 1NKBA 1EXNA 1ZQHA 4YR2A 3H40A 4I2GA 5HMMA 2P66A 3AQKA 3OVSA 3C2KA 4KLDA 4TQSA 4M47A 4PGYA 1N56A 2VANA 1BPYA 2DRAA 5J2BA 1TVAA 3PMNA 4UB3A 4NY8A 1VJ7A 4DSFA 4K4HA 2XCAA 4B9TA 4JV1A 4KLUA 9ICQA 4WBZA 5KFEA 2MUTA 3JPOA 5J2GA 2R8JA 3OHAA 2UVRA 1JAJA 4KLJA 4FS2A 3OGUA 2R8HA 2AQ4A 1RXWA 4KLTA 1MSWD 3T5LA 3PR4A 5CA7A 9ICLA 4EBCA 5DDMA 1XSPA 4TURA 3C2MA 2NRXA 3MR2A 4B9LA 5DG7A 4I2EA 4LVSA 1ZQNA 1KFTA 4WC0A 3KHGA 4EP7A 2F1HA 1OU5A 4FHXA 3C5GA 3LWMA 4RQ0A 4QWEA 5HRLA 1K1QA 1NKEA 2IMWP 1S0MA 4AT7A 5IIJA 4X4OA 1NJWA 2Y1JA 2C2DA 3Q8QB 4DL6A 2V9WA 1WCNA 5IIOA 4DO9A 1KLNA 9ICEA 4XUSA 1X9MA 8ICOA 8ICXA 2ID1A 4O3QA 4GXJA 4O3NA 3HX0A 4EBDA 3QZ7A 1ZQBA 3H37A 2BR0A 4S3NA 2J6UA 4KLQA 4F50A 4ATBB 1U45A 2XY6A 3GFKB 5D46A 3JPNA 2PFOA 3JYYA 4UD4A 3ZDAA 1SL1A 2UVUA 2KFZA 2PBEA 1ZQQA 3KTQA 5KFHA 4M9LA 2ZJAA 1TFRA 2XCPA 4F3OA 1L3TA 2HHQA 4C8NA 1X9WA 4WC1A 3PW5A 4IQUA 5J0TA 4TUPA 3LWLA 4EYIB 1T3NA 3T3FA 2J6SA 2AJQA 1JQRA 3BJYA 4NLKA 3KHLA 4P4OA 4RQ7A 4EBJA 4IRKA 3LK9A 1XU4A 5L1LA 5DB6A 9ICMA 1TFWA 4P2HA 7ICLA 4X4SA 4AT8B 4WC6A 3GV7B 3EPIA 2FLNA 4DQSA 2BCUA 2ISOA 1ZQDA 7ICPA 2ZH5A 2O5AA 3RB3A 2KZZA 2F1JA 2ZUDA 4IQWA 4O5KA 4F4ZA 5KFNA 4ECWA 5DG9A 3QE9Y 5J0OA 1MIWA 4X0AA 3AQMA 3MABA 1ZQEA 4KN7A 4JWMA 2VA8A 1AROP 3H38A 3C21A 7ICNA 2ZH6A 3PMLA 4ECXA 4LZDA 5KFLA 5KFJA 4QWBA 4RT2A 9ICJA 7ICRA 4QZAA 2FMQA 4WCWA 4M6WB 7ICTA 5J0QA 1NJZA 3JPQA 3UQ0A 4WC3A 2BHNA 4F91B 4BWJA 4YP3A 1NK6A 3PY8A 3ORYA 2W8LA 2V4QA 3RTVA 3H3AA 3BDPA 1S0OA 4MFCA 4GLXA 8ICEA 4Z6EA 5HNKA 1S0NA 8ICPA 4EYHB 2FLLA 3MBYA 4F4YA 4DL3A 4J9QA 3AQNA 4NXZA 5IINA 4C8MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U4B A;  4J9M A;  2BCV A;  2BPF A;  3WFQ E;  2ZH2 A;  5DQG A;  2PFP A;  3ZDE A;  4YFK A;  2VA3 A;  4FBU A;  3SYZ A;  3AU6 A;  3TAP A;  4GXK A;  7ICK A;  1XSN A;  3N97 B;  2ZH8 A;  2DPI A;  3H8W A;  1KFS A;  3THV A;  4QWA A;  3RRG A;  1FA0 A;  5CR0 A;  3ZDB A;  4WC5 A;  2HHS A;  1BPD A;  3HP6 A;  3MGI A;  1HUO A;  4I27 A;  3WFR E;  5F9L A;  4C8L A;  1RZT A;  4RNM A;  3EPG A;  3Q8R B;  1JN3 A;  1RPL A;  5BPC A;  4PGQ A;  5TZV A;  4I2H A;  8ICU A;  1KEJ A;  5J0S A;  2HHP A;  3LDA A;  4PHD A;  3MR5 A;  4DOB A;  5HRD A;  1YLQ A;  1ZQI A;  4MF2 A;  4BGD A;  1XS9 D;  3GIM A;  1BPB A;  2BQ3 A;  1Y88 A;  4Q8F A;  4RU9 A;  3SV4 A;  4F5R A;  4NKU A;  4QZD A;  1U47 A;  3SZ2 A;  1NK9 A;  4TQR A;  5HP4 A;  5KFM A;  8ICY A;  5DKW A;  5DDY A;  4JK1 A;  1ZQV A;  1U48 A;  1TKD A;  2UVW A;  2BCQ A;  4I2I A;  1D9D A;  4B9N A;  5KG1 A;  2V4R A;  4E80 A;  1D8L A;  3OJS A;  4I2A A;  4PHE A;  4KLM A;  1LB2 B;  4UBB A;  5J0X A;  2JEG A;  2FPL A;  4F4K A;  5J0P A;  5KG5 A;  4M9N A;  4NLG A;  1S76 D;  4FHP A;  1JXE A;  4QW8 A;  4UB2 A;  1S9F A;  4ED2 A;  2ASL A;  1XO1 A;  4QZG A;  2C2E A;  7ICI A;  1UET A;  4ED0 A;  3T5J A;  1R8A A;  2I1Q A;  2W8K A;  4YR3 A;  4ECV A;  2PFN A;  3OUY B;  5KG2 A;  4PPX A;  4ECQ A;  1N48 A;  9ICG A;  4DEZ A;  2BDP A;  1B22 A;  2H5X A;  2XY5 A;  5KFK A;  5HRB A;  4AT8 A;  4DF8 A;  2XGP A;  4ED1 A;  4RWN A;  3OUY A;  5HHH A;  3OHB A;  5L1J A;  4RQ5 A;  4NM1 A;  2R8I A;  9ICW A;  3RB4 A;  2DPJ A;  4X4N A;  4K4I A;  1UEV A;  7ICJ A;  5CP2 A;  4Z6C A;  4FHW A;  2FMS A;  2UVV A;  1UEU A;  4IRC A;  1K1S A;  3UXP A;  4R66 A;  2ZUB A;  4O3O A;  7ICE A;  1R8C A;  4M04 A;  3JPP A;  5III A;  4ECU A;  3IHQ B;  1ZQG A;  4M6W A;  4WC2 A;  5J0Y A;  4JV2 A;  3M8R A;  3GII A;  4PHA A;  2HHT A;  4RNO A;  3PV8 A;  4YVZ A;  4J9S A;  8ICT A;  4Z6D A;  9ICK A;  5KFR A;  5KT5 A;  3HPO A;  5HRE A;  4DL7 A;  4M9G A;  5J2C A;  4R64 A;  8ICJ A;  3QEA Z;  3RJF A;  4DSJ A;  3C18 A;  4YMN A;  2J6T A;  5HRI A;  4R8U B;  1UA1 A;  8ICV A;  2ATL A;  1V4A A;  2KTQ A;  1SZP A;  4FH5 A;  5CB1 A;  3HWT A;  4DS5 A;  4J9N A;  2ZTE A;  4HYK A;  4B9S A;  4NKT A;  2KZM A;  3RBD A;  4UD5 A;  1ZJN A;  2O1P A;  4I2F A;  1SL2 A;  1T7P A;  2HHU A;  4P4P A;  5J2D A;  4M5D A;  3L9D A;  4YXM A;  3AUO A;  2ZH3 A;  3V7L A;  5DED A;  1ZQA A;  5KT2 A;  2KZ3 A;  4LZG A;  3MFH A;  3V6K A;  4UAY A;  2IHM A;  4B9U A;  7ICF A;  9ICP A;  3PX4 A;  3RAX A;  4I2B A;  1BNO A;  3TI0 A;  4RWP A;  3RJG A;  4EBK A;  1ZQS A;  5KG6 A;  4RUC A;  2DR5 A;  4F92 B;  5KFF A;  3KHH A;  4IRD A;  3JPT A;  3H4B A;  4NLZ A;  4XQ7 A;  2ZHB A;  2BGW A;  8ICG A;  3PVX A;  4MEY A;  3FYH A;  1HJP A;  1T4G A;  3EZ5 A;  2Q66 A;  1ZQY A;  5HRK A;  5J0W A;  1QSS A;  2I9G A;  2Y1I A;  4UQG A;  3NYB A;  5J0R A;  5DGB A;  4DLE A;  1TFY A;  2C2R A;  4GC7 A;  4KLG A;  4RWQ A;  2DVI A;  2M2V A;  3HW8 A;  2R8K A;  9ICC A;  4X4R A;  2ASJ A;  2AGP A;  4MFA A;  3TFS A;  4O0I A;  1S97 A;  3EWA A;  3H8S A;  3HT3 A;  4EEY A;  3RR7 A;  1QLN A;  4RQ6 A;  1ZQP A;  7ICQ A;  3WFS C;  5HML A;  4RPZ A;  2C28 A;  3WFP A;  4DF4 A;  3C23 A;  4KN4 A;  5KFY A;  5EWG A;  5KFU A;  4YR0 A;  4TUQ A;  1COO A;  5JUM A;  4GXI A;  4DOC A;  2AGQ A;  1QSY A;  1D8Y A;  2BCR A;  1KRP A;  5J2F A;  7ICH A;  1A76 A;  9ICB A;  3ISC A;  1UT8 A;  3NGD A;  4KMU A;  4EZ9 A;  3N4M B;  4KLE A;  4RQ1 A;  4O3P A;  2HHV A;  3BQ2 A;  8ICM A;  4YD1 A;  2ZH9 A;  3Q8P B;  5F2V O;  5DG8 A;  1TV9 A;  4X5V A;  1CUK A;  2ZJ8 A;  4EZ6 A;  4F5N A;  5DLG A;  1KSP A;  4X4Q A;  5EWE A;  1MIY A;  1XC9 A;  3ISB A;  4UB5 A;  4JWN A;  5DBA A;  1BPX A;  1QSL A;  8ICR A;  2IHN A;  1TAU A;  4LT6 A;  3PW4 A;  4NLN A;  4DSK A;  1DOQ A;  3UQ2 A;  4DFM A;  1NOM A;  3G6V A;  7ICS A;  3H8J A;  4XQ8 A;  4F5O A;  3EYZ A;  1A77 A;  1U49 A;  4DL4 A;  1X2I A;  1Z3E B;  3AU2 A;  7ICV A;  2MAX A;  4F93 B;  4WC4 A;  5KFZ A;  1NK4 A;  4EBE A;  2IA6 A;  3JPR A;  4R63 A;  1SKS A;  5KFO A;  4R8U A;  3E2E A;  3C66 A;  9ICH A;  4C8O A;  4FHY A;  3B0X A;  3Q8K A;  3RH5 A;  2VA2 A;  5DGA A;  4XRH A;  5KFV A;  3PNC A;  2W9C B;  4DFP A;  2W9M A;  2FLP A;  5HRG A;  3HJ4 A;  5CJ7 A;  4Q45 A;  2NRW A;  4I28 A;  2R8G A;  2ALZ A;  4AT7 B;  4DS4 A;  5L1K A;  3C2L A;  2GWS A;  4FHV A;  2LYH A;  1BGX T;  1S0V A;  2ZUC A;  4RQ4 A;  5DB7 A;  3PR5 B;  3PX6 A;  3PO5 A;  3H4D A;  8ICS A;  5HHI A;  1ZQO A;  4GC6 A;  2HW3 A;  2ZH4 A;  1WCL A;  9ICN A;  3ZD8 A;  4ECY A;  4KLL A;  5J29 A;  1L3U A;  3RR8 A;  4G3I A;  4F5P A;  4F2S A;  2W9B A;  1XSL A;  4KIT B;  4QZF A;  5BOL A;  4RQ8 A;  1ZQT A;  4B9V A;  4I2D A;  1KNY A;  4QZC A;  1RXV A;  3ZD9 A;  1Z00 A;  2XC9 A;  1R8B A;  1R89 A;  2ZH7 A;  4KTQ A;  1XWL A;  1JMS A;  1ZQK A;  2ZHA A;  1KFD A;  3OVB A;  7ICM A;  5DLF A;  3BQ0 A;  5IIK A;  3RBE A;  2M2U A;  3EW9 A;  3OSN A;  3G6Y A;  4DSE A;  5EWF A;  3GV5 B;  4P4M A;  4ECR A;  3RJH A;  4RQ2 A;  5DB8 A;  4KLS A;  4X4V A;  3M9N B;  4YMM A;  3SV3 A;  2BQU A;  1V9P A;  3MGH A;  2PI5 A;  2BE3 A;  1X9S A;  2BKE A;  5DQI A;  1NJY A;  4Q44 A;  1SL0 A;  1HUZ A;  4DFJ A;  2JZB B;  4YQW A;  8ICB A;  4YN4 A;  9ICT A;  2ISP A;  3RJJ A;  4ED3 A;  7ICO A;  1T8E A;  3G6X A;  3TFR A;  4BDP A;  1U9L A;  2FPM A;  4KLF A;  4F5Q A;  2NRK A;  4O3S A;  5CHG A;  8ICN A;  4QZ8 A;  2WTF A;  2AGO A;  4DWI A;  1NK5 A;  1MC8 A;  1ZQF A;  4UBC A;  5EOZ A;  2PXI A;  3V7J A;  1BNP A;  2B21 A;  5KFD A;  3UPS A;  2XO7 A;  1BVS A;  2RDI A;  4Q43 A;  2ZTC A;  4ECS A;  2AU0 A;  2DR9 A;  8ICK A;  4DSL A;  3PW7 A;  4JUZ A;  3RB0 A;  1H38 A;  2DFL A;  3TAN A;  4O5E A;  4BXO A;  8ICH A;  4Z6F A;  4RNN A;  1RYS A;  1TK8 A;  2JEF A;  2JEJ A;  1F5A A;  8ICF A;  1MIV A;  3UXO A;  4QZE A;  3ZDD A;  5HC9 A;  2ZTD A;  8ICC A;  4X4P A;  4QZB A;  2FPK A;  9ICA A;  1ZQJ A;  2M2W A;  1JIH A;  8ICA A;  2W9C A;  4FBT A;  1ZQW A;  2RFF A;  4RWO A;  1NK7 A;  4QWC A;  2Q0Z X;  4IQT A;  3V6H A;  1IXR A;  4DFK A;  4C8K A;  3QEB Z;  2C22 A;  2FMP A;  3BQ1 A;  5KFW A;  3V7K A;  4O5C A;  1DGS A;  7ICU A;  1VFG A;  1NJX A;  5KFI A;  3M9M B;  4YXJ A;  5KT3 A;  2W9B B;  3RRH A;  5KFT A;  4XA5 A;  2P6R A;  4IR1 A;  4F8R A;  3KHR A;  4O3R A;  4F2R A;  2KP7 A;  1UA0 A;  5KFS A;  3OSP A;  4ZH4 A;  4MEX A;  4WBY A;  4PHP A;  3PX0 A;  1Z00 B;  3MR3 A;  1ZQM A;  2NRT A;  4YG2 A;  4RQ3 A;  5HRF A;  4FO6 A;  5IIL A;  4J9K A;  1ZQR A;  1RYR A;  3UPQ A;  5L9X A;  5HRH A;  4X4U A;  1CEZ A;  1ZYQ A;  4X4T A;  4ED8 A;  4MF8 A;  5J2J A;  4ED6 A;  1ZQC A;  8ICL A;  4UB4 A;  4J9R A;  9ICU A;  1Q78 A;  3SI8 A;  1NKC A;  5IIM A;  3C1Z A;  4UAW A;  3Q8M A;  5KFG A;  4M9H A;  4IG8 A;  4DSI A;  1DK3 A;  3H7I A;  5KFA A;  4ELT A;  3ETL A;  2DRB A;  4E0D A;  2DR8 A;  1NK8 A;  7ICG A;  4M9J A;  3TQ1 A;  3RAQ A;  9ICS A;  3GIK A;  3BQT A;  8ICW A;  4AT9 B;  5KT4 A;  5KFB A;  1S10 A;  9ICX A;  4FH3 A;  1L3V A;  4RT3 A;  3GDX A;  2JZB A;  2HVH A;  4NM2 A;  5KG7 A;  3TAR A;  3MDA A;  3NTU A;  3IM1 A;  3M9O B;  1S77 D;  2A1J A;  1UT5 A;  2NRZ A;  3OV7 A;  4QZ9 A;  3ISD A;  1D9F A;  3MR6 A;  5DEC A;  2ZJ5 A;  4YCX A;  5J2H A;  2PFQ A;  4MFF A;  4R65 A;  3MFI A;  1PZN A;  5KFP A;  3Q8L A;  4M2Y A;  1L5U A;  4J9L A;  1ZJM A;  1NO5 A;  1PX5 A;  1MQ3 A;  4WC7 A;  5KT7 A;  3GV8 B;  3TAQ A;  4BXO B;  5KG0 A;  2OWO A;  5HR9 A;  2JEI A;  1BPE A;  2PI4 A;  9ICV A;  2BCS A;  4B9M A;  2MUT B;  4RPX A;  4DOA A;  4ECT A;  3UXN A;  4ECZ A;  1BPZ A;  3LQC B;  3PW2 A;  3H39 A;  1NZP A;  3GQC A;  1Q79 A;  1DK2 A;  9ICI A;  3MDC A;  3GIL A;  5J0U A;  5KFQ A;  4O9M A;  4DQQ A;  4DL2 A;  3PO4 A;  5D4B A;  4E7X A;  1ZQL A;  3JZ0 A;  3HIY A;  3GIJ A;  2DR7 A;  1TK5 A;  8ICQ A;  1QTM A;  2F1I A;  5J2A A;  4YD2 A;  2XGQ A;  2RDJ A;  4F4W A;  1ZQX A;  5J2I A;  4KLH A;  2M2T A;  3AQL A;  1ZQZ A;  4RUA A;  3JPS A;  3V6J A;  3ZDC A;  1NK0 A;  4DLG A;  4DQP A;  4Q8E A;  9ICF A;  5DBB A;  4QZH A;  5BOM A;  4K4G A;  4UAZ A;  2P6U A;  1ZQU A;  1KDH A;  1L3S A;  4IQV A;  1KTQ A;  4ELU A;  4RZR A;  4I29 A;  5KT6 A;  1MQ2 A;  3QZ8 A;  3PW0 A;  5KFX A;  2M9N A;  4J9O A;  2BQR A;  1JXL A;  4DQI A;  1B43 A;  2W9A A;  1SKW A;  3V72 A;  5DBC A;  2HVI A;  2ASD A;  4ED7 A;  1TK0 A;  5KFC A;  3RJE A;  5DB9 A;  4BWM A;  8ICI A;  4E8F A;  4YMO A;  3RH6 A;  1WOT A;  2BPC A;  4PGX A;  3C5F A;  3OVA A;  4PH5 A;  3OJU A;  4CCH A;  3FDS A;  4RPY A;  4QZI A;  3K4G A;  4JV0 A;  2KN7 A;  2HHX A;  5KG4 A;  2XY7 A;  5J2K A;  4ELV A;  4KLI A;  4TUS A;  5KTQ A;  4M0A A;  1IM4 A;  4ATB A;  3Q8S B;  8ICZ A;  1SKR A;  3M8S A;  4I2C A;  3C1Y A;  2ZH1 A;  3RJI A;  5J2E A;  1C7Y A;  2KFN A;  5CWR A;  2BPG A;  4X0B A;  9ICO A;  2NRV A;  1ZET A;  4IR9 A;  4UB1 A;  3RH4 A;  9ICR A;  3HJ1 A;  5D49 A;  4QW9 A;  5DQH A;  2A1J B;  5C5J A;  4DL5 A;  4QWD A;  3K75 D;  4AT9 A;  3WFO A;  3T5K A;  2AQ0 A;  4I2J A;  4KLO A;  5L1I A;  1LV5 A;  4FS1 A;  1JX4 A;  1TAQ A;  5KG3 A;  3B0Y A;  4DQR A;  2IBK A;  3RJK A;  3T5H A;  4F4X A;  4J9P A;  2HHW A;  3RB6 A;  5F9N A;  1NKB A;  1EXN A;  1ZQH A;  4YR2 A;  3H40 A;  4I2G A;  5HMM A;  2P66 A;  3AQK A;  3OVS A;  3C2K A;  4KLD A;  4TQS A;  4M47 A;  4PGY A;  1N56 A;  2VAN A;  1BPY A;  2DRA A;  5J2B A;  1TVA A;  3PMN A;  4UB3 A;  4NY8 A;  1VJ7 A;  4DSF A;  4K4H A;  2XCA A;  4B9T A;  4JV1 A;  4KLU A;  9ICQ A;  4WBZ A;  5KFE A;  2MUT A;  3JPO A;  5J2G A;  2R8J A;  3OHA A;  2UVR A;  1JAJ A;  4KLJ A;  4FS2 A;  3OGU A;  2R8H A;  2AQ4 A;  1RXW A;  4KLT A;  1MSW D;  3T5L A;  3PR4 A;  5CA7 A;  9ICL A;  4EBC A;  5DDM A;  1XSP A;  4TUR A;  3C2M A;  2NRX A;  3MR2 A;  4B9L A;  5DG7 A;  4I2E A;  4LVS A;  1ZQN A;  1KFT A;  4WC0 A;  3KHG A;  4EP7 A;  2F1H A;  1OU5 A;  4FHX A;  3C5G A;  3LWM A;  4RQ0 A;  4QWE A;  5HRL A;  1K1Q A;  1NKE A;  2IMW P;  1S0M A;  4AT7 A;  5IIJ A;  4X4O A;  1NJW A;  2Y1J A;  2C2D A;  3Q8Q B;  4DL6 A;  2V9W A;  1WCN A;  5IIO A;  4DO9 A;  1KLN A;  9ICE A;  4XUS A;  1X9M A;  8ICO A;  8ICX A;  2ID1 A;  4O3Q A;  4GXJ A;  4O3N A;  3HX0 A;  4EBD A;  3QZ7 A;  1ZQB A;  3H37 A;  2BR0 A;  4S3N A;  2J6U A;  4KLQ A;  4F50 A;  4ATB B;  1U45 A;  2XY6 A;  3GFK B;  5D46 A;  3JPN A;  2PFO A;  3JYY A;  4UD4 A;  3ZDA A;  1SL1 A;  2UVU A;  2KFZ A;  2PBE A;  1ZQQ A;  3KTQ A;  5KFH A;  4M9L A;  2ZJA A;  1TFR A;  2XCP A;  4F3O A;  1L3T A;  2HHQ A;  4C8N A;  1X9W A;  4WC1 A;  3PW5 A;  4IQU A;  5J0T A;  4TUP A;  3LWL A;  4EYI B;  1T3N A;  3T3F A;  2J6S A;  2AJQ A;  1JQR A;  3BJY A;  4NLK A;  3KHL A;  4P4O A;  4RQ7 A;  4EBJ A;  4IRK A;  3LK9 A;  1XU4 A;  5L1L A;  5DB6 A;  9ICM A;  1TFW A;  4P2H A;  7ICL A;  4X4S A;  4AT8 B;  4WC6 A;  3GV7 B;  3EPI A;  2FLN A;  4DQS A;  2BCU A;  2ISO A;  1ZQD A;  7ICP A;  2ZH5 A;  2O5A A;  3RB3 A;  2KZZ A;  2F1J A;  2ZUD A;  4IQW A;  4O5K A;  4F4Z A;  5KFN A;  4ECW A;  5DG9 A;  3QE9 Y;  5J0O A;  1MIW A;  4X0A A;  3AQM A;  3MAB A;  1ZQE A;  4KN7 A;  4JWM A;  2VA8 A;  1ARO P;  3H38 A;  3C21 A;  7ICN A;  2ZH6 A;  3PML A;  4ECX A;  4LZD A;  5KFL A;  5KFJ A;  4QWB A;  4RT2 A;  9ICJ A;  7ICR A;  4QZA A;  2FMQ A;  4WCW A;  4M6W B;  7ICT A;  5J0Q A;  1NJZ A;  3JPQ A;  3UQ0 A;  4WC3 A;  2BHN A;  4F91 B;  4BWJ A;  4YP3 A;  1NK6 A;  3PY8 A;  3ORY A;  2W8L A;  2V4Q A;  3RTV A;  3H3A A;  3BDP A;  1S0O A;  4MFC A;  4GLX A;  8ICE A;  4Z6E A;  5HNK A;  1S0N A;  8ICP A;  4EYH B;  2FLL A;  3MBY A;  4F4Y A;  4DL3 A;  4J9Q A;  3AQN A;  4NXZ A;  5IIN A;  4C8M A; 
#chains in the Genus database with same CATH topology
 4J9M A;  2BCV A;  4YFK A;  5G5H A;  3TAP A;  1XSN A;  2ESE A;  1KFS A;  1FA0 A;  2H3I A;  3TKA A;  2IHO A;  5AI8 A;  4PGQ A;  5BPC A;  4I2H A;  5J0S A;  4MF2 A;  4Q8F A;  3SV4 A;  4QZD A;  1U47 A;  1NK9 A;  4TQR A;  1LKY B;  2D3D A;  4B9N A;  1JQR A;  4B6J A;  1D9D A;  2V4R A;  4OAG A;  4AYB C;  5J0X A;  1S76 D;  4OO1 J;  2G5H B;  2IOF K;  4UB2 A;  1VJ7 A;  4ED0 A;  4ECV A;  1JRP A;  4ECQ A;  9ICG A;  4AT8 A;  5KFK A;  2W3S A;  4RWN A;  3ETR A;  3SD7 A;  1FEZ A;  5HHH A;  3CRX A;  4RQ5 A;  9ICW A;  2EZZ A;  1UHU A;  3QUC A;  2ZUB A;  4O3O A;  4OJL A;  4AP9 A;  3JPP A;  4ECU A;  1ZQG A;  1N5W A;  2JMG A;  4UB6 U;  1ZRM A;  2F76 X;  4J9S A;  5AM5 A;  3IG8 A;  3HPO A;  5EE3 A;  4M9G A;  8ICJ A;  4DSJ A;  4YMN A;  2J6T A;  4R8U B;  1S8O A;  4J9N A;  4CF4 A;  3J81 j;  4P4P A;  3GZF A;  2LM1 A;  3L9D A;  2OCE A;  4NWI A;  1WWV A;  4LZG A;  3CK6 A;  4RWP A;  1BNO A;  4FE3 A;  5D61 A;  3RJG A;  4F92 B;  4XQ7 A;  8ICG A;  3EZ5 A;  1WYG A;  5D63 A;  2Y1I A;  4UQG A;  3WK4 A;  3KFU F;  1SWW A;  1N60 A;  3HW8 A;  4X4R A;  3MC1 A;  3H8S A;  3RR7 A;  3ER9 B;  4RQ6 A;  3T79 A;  1ZQP A;  2PMZ F;  2E5S A;  4M5D A;  4DOC A;  1URJ A;  1Q3V A;  2BCR A;  4WOY A;  2B0C A;  3NGD A;  4KMU A;  1PVP A;  3BQ2 A;  3Q8P B;  3H8M A;  2GAF D;  4NXU A;  1KSP A;  2OEH A;  3D6J A;  5EWE A;  5HR7 A;  5ALY A;  1QH9 A;  4LT6 A;  3D2Q A;  3NUQ A;  5C0Y A;  3N7P D;  4XQ8 A;  2GOL A;  4DL4 A;  7ICV A;  5KFZ A;  1TE2 A;  1SKS A;  3C66 A;  9ICH A;  4FHY A;  3Q8K A;  4CF5 A;  5DGA A;  4XRH A;  5HRG A;  2W9M A;  3E0F A;  1HEK A;  4Q45 A;  2VJ4 A;  3K1Z A;  4DS4 A;  1S0V A;  3I76 A;  1C20 A;  2MRL A;  4ICA A;  3H4D A;  3WU2 U;  3WK9 A;  1ZQO A;  4GC6 A;  1O08 A;  2E8P A;  3RF9 A;  9ICN A;  4G3I A;  4ECY A;  4BX9 C;  3NS1 A;  5J29 A;  1L3U A;  1DXS A;  3NVZ A;  2G07 A;  2F77 X;  4QZF A;  5BOL A;  1ZQT A;  4I2D A;  4WQL A;  1RXV A;  1R8B A;  2KEY A;  4KTQ A;  5AKJ A;  3F2C A;  1KFD A;  5DLF A;  5KL1 B;  5B3P A;  3SV3 A;  2BQU A;  2PI5 A;  2BE3 A;  1X9S A;  2BKE A;  5DQI A;  1NJY A;  1SL0 A;  1HUZ A;  4DFJ A;  3TAD A;  4ED3 A;  3DEE A;  1Z4O A;  3G6X A;  1T8E A;  4BDP A;  1U9L A;  4F5Q A;  1RQL A;  2WTF A;  3PST A;  4ZOH C;  3SAF A;  1BNP A;  3F53 A;  3KBB A;  2O6K A;  1QCK A;  2ZTC A;  8ICK A;  3WKC A;  4DCC A;  1RDF A;  1M6Y A;  4Z6F A;  4RNN A;  1F44 A;  1FFU A;  2KHV A;  1MIV A;  3UXO A;  5HC9 A;  4NL9 C;  8ICC A;  3QUB A;  8ICA A;  4K98 A;  3SAG A;  5AM1 A;  3V6H A;  2ZIU A;  4IQT A;  2B6G A;  3QEB Z;  2C22 A;  3L4P A;  3BQ1 A;  2EAM A;  2JV3 A;  1DGS A;  1NJX A;  4KB6 A;  3M9M B;  4O3R A;  5KFT A;  3KHR A;  1UA0 A;  1ZQM A;  3FAH A;  4RQ3 A;  4CDG A;  1RYR A;  1SB3 C;  5HRH A;  4G9B A;  3VC8 A;  1ZYQ A;  8ICL A;  9ICU A;  3IP4 B;  1D8B A;  1NKC A;  3M6Z A;  4M9H A;  5KFG A;  4PZN A;  5KFA A;  2DRB A;  2DR8 A;  3RAQ A;  2G09 A;  4AT9 B;  3SAH A;  4FH3 A;  3GDX A;  2JZB A;  2HVH A;  5KG7 A;  3TAR A;  2XI9 A;  3IM1 A;  1S77 D;  2BBH A;  2OH2 A;  1D9F A;  2ZJ5 A;  5J2H A;  5AKL A;  4R65 A;  2IOH A;  2F44 A;  3BZK A;  1MQ3 A;  5AM3 A;  3GV8 B;  3SQI A;  5HR9 A;  2OWO A;  2MUT B;  4RPX A;  4ECT A;  4ECZ A;  1BPZ A;  3PW2 A;  1NZP A;  1Q79 A;  1DK2 A;  4K97 A;  3MDC A;  4WQK A;  3GIL A;  4O9M A;  4DL2 A;  3NRW A;  3HIY A;  2ZIU B;  2F1I A;  5J2A A;  2RDJ A;  1ZQX A;  3KKA C;  1TFY A;  4IG8 A;  3SEI A;  5KNI A;  4K4G A;  4UAZ A;  4LEZ A;  4PL1 A;  4JV2 A;  4RZR A;  2MSN A;  5KT6 A;  2BQR A;  1NI3 A;  2ASD A;  5DB9 A;  5ALL A;  3RH6 A;  3C5F A;  5ALJ A;  3OJU A;  4CCH A;  3OWG A;  3QU7 A;  4JV0 A;  4QZI A;  5J2K A;  5AKI A;  5KTQ A;  4M0A A;  1IM4 A;  2ZH1 A;  3Q8S B;  8ICZ A;  1SKR A;  1L7N A;  1Z1V A;  2JRZ A;  2BPG A;  2NRV A;  1RYU A;  5AIB A;  2EDU A;  4F72 A;  4QWD A;  3K75 D;  3WFO A;  2ODG A;  3T5K A;  3UMC A;  2EAN A;  3LVW A;  5F9N A;  3OVS A;  5AHX A;  2P66 A;  4TQS A;  3QU2 A;  5J2B A;  1PK1 A;  5AI5 A;  2XCA A;  4B9T A;  4WBZ A;  9ICQ A;  1N61 A;  3JPO A;  5J2G A;  2UVR A;  4KX3 A;  4KLJ A;  5CFT A;  1KL9 A;  5J8Y C;  3O0F A;  4Y2R A;  1ZOL A;  4EBC A;  1XSP A;  3RFA A;  3MR2 A;  3LWM A;  4AT7 A;  1S0M A;  2Y1J A;  4DL6 A;  5IIO A;  4O68 A;  4WBY A;  4XUS A;  4QIW C;  5F3X B;  4OJ5 A;  4O3N A;  3HX0 A;  4EBD A;  3QZ7 A;  2QAR A;  1ZQB A;  4KLQ A;  4F50 A;  1U45 A;  5D46 A;  3ZDA A;  1SL1 A;  1COK A;  1ZQQ A;  3KTQ A;  5KFH A;  1N63 A;  4M9L A;  3N7R C;  2KNJ A;  2XCP A;  1L8O A;  4C8N A;  1X9W A;  3LWL A;  1T3N A;  3T3F A;  2ZG6 A;  3MCR A;  1ZXI A;  3TAC B;  7ICL A;  4DQS A;  2O5A A;  2F1J A;  2ZUD A;  4IQW A;  4X0A A;  5KFN A;  4ECW A;  5DG9 A;  1YZ7 A;  4MKP A;  3AQM A;  4KN7 A;  4JWM A;  1PK1 B;  3H38 A;  3PML A;  4ECX A;  3I28 A;  7ICR A;  2WFA A;  2ZIX A;  1SV4 A;  3UQ0 A;  4F91 B;  2FCL A;  3IRU A;  1KBU A;  2V4Q A;  1S5L U;  3WK8 A;  1Z19 A;  5HNK A;  1S0N A;  1FFV A;  4C7Y A;  4Y2T A;  4J9Q A;  4IR9 A;  1U4B A;  3FC4 A;  4UAV A;  2ZH2 A;  2PFP A;  1LVH A;  2KIC A;  2VA3 A;  3AU6 A;  4GXK A;  7ICK A;  3N97 B;  2DPI A;  3THV A;  3RRG A;  5CR0 A;  3HP6 A;  4O67 A;  4RNM A;  3DV9 A;  2QAR B;  4Y2P A;  1JN3 A;  1RPL A;  3Q8R B;  1T3Q A;  3MR5 A;  2MU2 A;  1YLQ A;  4NXX A;  3GIM A;  1BPB A;  2R18 A;  1Y88 A;  5HP4 A;  8ICY A;  1ZQV A;  1TKD A;  5KG1 A;  2LHT A;  3OJS A;  2JEG A;  1IG6 A;  2FPL A;  4M9N A;  1QQ6 A;  3CW2 C;  1XO1 A;  1UET A;  7ICI A;  5J8Y A;  5TIS U;  2W8K A;  4YR3 A;  2PFN A;  4OD0 A;  1O03 A;  2Q4T A;  2BDP A;  2H5X A;  1B22 A;  2XGP A;  3OUY A;  2ZIX B;  5L1J A;  4NM1 A;  2R8I A;  1PVR A;  3RB4 A;  4X4N A;  4K4I A;  4Z6C A;  2UVV A;  4IRC A;  4R66 A;  7ICE A;  3IHQ B;  4M6W A;  5J0Y A;  4YVZ A;  2DUY A;  3KZX A;  5KFR A;  4P0P B;  4R64 A;  3NVV A;  3RJF A;  4C0Z A;  1P7D A;  3HKZ F;  2M0N A;  4FH5 A;  4DS5 A;  4UD5 A;  2ZTE A;  5CRX A;  4NKT A;  4UAU A;  2HHU A;  2Y0S F;  2EZX A;  3S6J A;  1SV0 C;  4YXM A;  1JI7 A;  5DED A;  1ZQA A;  5KT2 A;  2KZ3 A;  3MFH A;  3V6K A;  2IHM A;  4B9U A;  7ICF A;  3PX4 A;  1Q46 A;  1ZQS A;  3QU4 A;  3AL0 B;  5KG6 A;  1UCV A;  3IV6 A;  4RUC A;  3KHH A;  3JPT A;  2ZHB A;  1LKY A;  1T4G A;  2YB1 A;  1J2N A;  2G06 A;  5DGB A;  4I0U A;  3GU3 A;  2KG5 A;  2KIV A;  2E8M A;  2I6X A;  3IG5 A;  3TFS A;  5AI9 A;  4Y2Y A;  3BQ7 A;  7ICQ A;  3WFS C;  5HML A;  4RPZ A;  3WFP A;  5KFY A;  4YR0 A;  4E0D A;  3OUY B;  5JUM A;  2AGQ A;  1D8Y A;  1QSY A;  5J2F A;  3ISC A;  2HSZ A;  4KLE A;  8ICM A;  2B56 A;  4X5V A;  2ZJ8 A;  4EZ6 A;  2YY6 A;  5DBA A;  4GFJ A;  3PW4 A;  4NLN A;  1SWV A;  3G6V A;  3EYZ A;  1A77 A;  1Z3E B;  2HBJ A;  2MAX A;  5B66 U;  4DFD A;  2IA6 A;  4EBE A;  4R8U A;  3E2E A;  3RH5 A;  2VA2 A;  2D8C A;  3CP8 A;  5KFV A;  3PNC A;  3AMZ A;  5CJ7 A;  3AQE A;  2R8G A;  2H3Q A;  2LYH A;  3PR5 B;  4IS7 A;  2YMM A;  3PX6 A;  5HHI A;  2YTU A;  3H0R B;  2HW3 A;  2ZH4 A;  4QJF B;  3ZD8 A;  1WG8 A;  2W9B A;  4RQ8 A;  1KNY A;  3OPX A;  1Z00 A;  2ZH7 A;  5AI4 A;  1XWL A;  1JMS A;  2A1A A;  1KN5 A;  2WF6 A;  3BQ0 A;  5IIK A;  3RBE A;  4IL6 U;  3EW9 A;  3OSN A;  4DSE A;  2EZY A;  2M2U A;  5EWF A;  5AK3 A;  4ECR A;  4RQ2 A;  3M9N B;  5AK4 A;  2WB1 F;  3MGH A;  4Y2X A;  9ICT A;  3RJJ A;  3B9J A;  4O69 A;  4KLF A;  3TFR A;  5CHG A;  2AGO A;  4UBC A;  3WK5 A;  2PXI A;  5ALX A;  5KFD A;  4DSL A;  3PW7 A;  2NO5 A;  3RB0 A;  1RYS A;  1TK8 A;  2JEJ A;  1F5A A;  8ICF A;  2F8L A;  4EEK A;  2LM4 A;  4X4P A;  9ICA A;  4U6P A;  1JIH A;  2K4P A;  2WF8 A;  4DFK A;  1J2M A;  4OJP A;  1OW5 A;  2W9B B;  2P6R A;  4XA5 A;  4F8R A;  8ICX A;  4F2R A;  1Z00 B;  4FO6 A;  4C80 A;  5IIL A;  4JB3 A;  1ZQR A;  2ZIW A;  3UPQ A;  4OAF A;  5ALS A;  4ED6 A;  1ZQC A;  1SGG A;  4J9R A;  2WAQ F;  1Q78 A;  1CRX A;  3C1Z A;  3Q8M A;  1DK3 A;  2HN1 A;  3ETL A;  2K4H A;  3TQ1 A;  3GIK A;  3BQT A;  2G08 A;  4RT3 A;  4FFD A;  5ALK A;  3NTU A;  2A1J A;  3OV7 A;  4QZ9 A;  2OHF A;  5KAI U;  5DEC A;  2PFQ A;  4YCX A;  3KZI U;  1RQN A;  4M2Y A;  3Q8L A;  1PX5 A;  1L5U A;  5KT7 A;  3TAQ A;  5KG0 A;  2XID A;  2BCS A;  3UXN A;  3HJE A;  3GQC A;  9ICI A;  4O6A A;  4U7C A;  3FM9 A;  3VCB A;  3PO4 A;  1F0M A;  3GIJ A;  8ICQ A;  4K99 A;  4KLH A;  2PMZ C;  2M2T A;  3AQL A;  1ZQZ A;  4Q8E A;  4DQP A;  2KHQ A;  3U26 A;  4IQV A;  4M47 A;  2FE9 A;  4FHX A;  5KFX A;  5JRT A;  4J9O A;  2ZIW B;  1Q3U A;  2HVI A;  3RJE A;  4ED7 A;  4OJO A;  5KFC A;  2KOB A;  1KW4 A;  4YMO A;  4C4T A;  1WOT A;  1IIP A;  4PGX A;  3OVA A;  4PH5 A;  3K1R B;  4RPY A;  5H2F U;  2E8N A;  1AQ6 A;  4OCZ A;  4ATB A;  1ZD3 A;  5FP0 A;  4BJQ A;  1X9X A;  5J2E A;  3RJI A;  9ICO A;  1ZET A;  4NXW A;  9ICR A;  3ALR A;  2KJ9 A;  5D49 A;  2B51 A;  2A1J B;  5ALR A;  2G5I B;  4AT9 A;  2Y9T A;  2AQ0 A;  1LV5 A;  4FS1 A;  1TAQ A;  2K4E A;  2IBK A;  3RJK A;  2JR5 A;  4F4X A;  2JHD A;  3RB6 A;  1MN8 A;  1RG6 A;  4YR2 A;  3H40 A;  4C4R A;  5HMM A;  3F2D A;  3C2K A;  2VAN A;  3AM9 A;  2EH9 A;  2LYA A;  4UB3 A;  4NY8 A;  5HR6 A;  4JV1 A;  2MUT A;  5AI6 A;  4FZL A;  2CN1 A;  3OGU A;  2ES6 A;  4KLT A;  3PR4 A;  5CA7 A;  5DG7 A;  1KFT A;  4EP7 A;  1OU5 A;  4RQ0 A;  1NKE A;  2YX8 A;  2QKQ A;  1GPJ A;  3Q8Q B;  1Z4N A;  9ICE A;  2J6U A;  4ATB B;  2PFO A;  3JPN A;  4P0Q A;  2FDR A;  1T94 A;  3PSF A;  2K8B B;  1DRG A;  3PW5 A;  4IQU A;  4TUP A;  4LEW A;  3BJY A;  4NLK A;  4EBJ A;  3LK9 A;  4PL2 A;  5GTI U;  2RP5 A;  3GV7 B;  2JH7 A;  2BCU A;  3RB3 A;  2YML A;  4KX5 A;  2Y9U A;  4F4Z A;  5ALO A;  1MIW A;  1ZQE A;  4EX6 A;  4MHV A;  1ARO P;  3C21 A;  4LZD A;  5KFJ A;  4RT2 A;  5B3Q A;  1NJZ A;  1NK6 A;  5CEH A;  2W8L A;  4Y2J A;  2KK0 A;  8ICE A;  4Z6E A;  8ICP A;  3AQN A;  2BPF A;  5DQG A;  3ZDE A;  2NV3 A;  3NVY A;  3SYZ A;  2ZH8 A;  3H8W A;  4Y2Q A;  4QWA A;  4RQN A;  4WC5 A;  2VJ5 A;  3MGI A;  4I27 A;  3WFR E;  5F9L A;  4C8L A;  4K8V A;  5AIA A;  5TZV A;  5AKK A;  4KMO B;  4DOB A;  4P0Q B;  1ZQI A;  3WK6 A;  4BGD A;  2BQ3 A;  4NKU A;  4F5R A;  5AKY A;  3SZ2 A;  5KFM A;  5DKW A;  2DGZ A;  4JK1 A;  1U48 A;  2UVW A;  4I2I A;  5AM2 A;  4E80 A;  2YQE A;  4KLM A;  5ALW A;  3M7D A;  4UBB A;  1LB2 B;  2YB4 A;  5D62 A;  4F4K A;  5J0P A;  5KG5 A;  4FHP A;  4NL9 A;  1JXE A;  4UAT A;  1DGJ A;  4QW8 A;  3L5K A;  2ASL A;  4QZG A;  3T5J A;  2I1Q A;  4PPX A;  1VJ5 A;  1N48 A;  5G5G A;  5AKZ A;  4DEZ A;  5HRB A;  2XY5 A;  1ZD5 A;  2KJ5 A;  2LI6 A;  3OHB A;  4HAI A;  4EEN A;  2DPJ A;  2HBL A;  1UEV A;  3NVW A;  4FHW A;  2FMS A;  5III A;  3CNH A;  4UB8 U;  3GII A;  4RNO A;  3PV8 A;  4Z6D A;  4UAR A;  5J2C A;  2KMD A;  3QEA Z;  3C18 A;  1UA1 A;  3IDW A;  8ICV A;  2IUB A;  2KTQ A;  4X4Q A;  5CB1 A;  4HYK A;  4K9A A;  3A0H U;  3RBD A;  1ZJN A;  4I2F A;  1T7P A;  2HBK A;  3ERC C;  4EEL A;  2ZH3 A;  4UAY A;  5ALM A;  9ICP A;  1X40 A;  2H3F A;  2WF5 A;  1X6J A;  4IRD A;  2YMP A;  5EE1 A;  4LJX A;  2BGW A;  3PVX A;  3FYH A;  2Q66 A;  4US8 A;  1OXJ A;  3NYB A;  2NO4 A;  4GC7 A;  4KLG A;  4RWQ A;  2M2V A;  2R8K A;  9ICC A;  2ASJ A;  4MFA A;  4O0I A;  1CI4 A;  3KKA A;  1PVQ A;  4DF4 A;  3C23 A;  4KN4 A;  5EWG A;  4TUQ A;  5KFU A;  4GXI A;  1KRP A;  2HOI A;  3PSI A;  7ICH A;  1A76 A;  1UT8 A;  1XNS A;  5ALQ A;  2ZH9 A;  5F2V O;  4F5N A;  2K8C B;  1BPX A;  2IHN A;  2F8K A;  5CFS A;  1DOQ A;  1L7P A;  3I1Y A;  1NOM A;  7ICS A;  4F5O A;  1X2I A;  2OYY A;  4P0P A;  3JPR A;  4R63 A;  5KFO A;  4C8O A;  3B0X A;  2RHF A;  3NWI A;  3HJ4 A;  2W9C B;  4DFP A;  3WKD A;  3PSP A;  4EX7 A;  4FHV A;  1BGX T;  2ZUC A;  5DB7 A;  2WHE A;  5AKH A;  1ECW A;  1XO0 A;  1V38 A;  1WCL A;  4KLL A;  3RR8 A;  4F5P A;  4F2S A;  1Q8K A;  3UM9 A;  4IC9 A;  1B0X A;  5ALF A;  2XC9 A;  5KAF U;  1ZQK A;  3OVB A;  1FIQ A;  1L7O A;  4KLS A;  5DB8 A;  4X4V A;  4YMM A;  1V9P A;  3PHZ A;  1KKX A;  8ICB A;  2GH1 A;  7ICO A;  2FPM A;  5B5E U;  2DF4 B;  2NRK A;  4O3S A;  4QZ8 A;  2HOQ A;  4CRX A;  2B21 A;  2WF7 A;  2XO7 A;  2RDI A;  4ECS A;  2DR9 A;  2H3V A;  4JUZ A;  1H38 A;  3MGV A;  3TAN A;  2KVS A;  4O5E A;  4BXO A;  8ICH A;  3CYM A;  1ZD2 P;  5ALE A;  4QZB A;  5JTG A;  1YT3 A;  1ZQJ A;  3E58 A;  4FBT A;  1ZQW A;  2RFF A;  2E1F A;  4RWO A;  2EAO A;  4QWC A;  2Q0Z X;  1Z1B A;  2FMP A;  4C4S A;  5KFW A;  7ICU A;  1VFG A;  5KT3 A;  4IR1 A;  4NLC A;  2EWR A;  2W3R A;  5KFS A;  3OSP A;  3PX0 A;  2NRT A;  4J9K A;  4X4T A;  4ED8 A;  4QNL A;  5J2J A;  4MF8 A;  4UB4 A;  2YMQ A;  3BS7 A;  3AEV A;  4UAW A;  2VKQ A;  4DSI A;  4ELT A;  1NK8 A;  4M9J A;  4JLX A;  3HKZ C;  9ICS A;  8ICW A;  1S10 A;  4NM2 A;  2Y0S C;  1UT5 A;  2NRZ A;  3ISD A;  3MR6 A;  2HCF A;  1WWU A;  1PZN A;  5KFP A;  1NO5 A;  4J9L A;  1ZJM A;  3ER8 C;  4AYB F;  4BXO B;  2PI4 A;  3C29 A;  4B9M A;  4DOA A;  2AH5 A;  3LQC B;  3H39 A;  2W7P A;  4FO1 A;  3R9K A;  2ZXI A;  4UW9 A;  4E7X A;  3JZ0 A;  2DR7 A;  1QTM A;  4F4W A;  5J2I A;  2KSO A;  1SXD A;  4RUA A;  3JPS A;  3V6J A;  3ZDC A;  2P35 A;  5DBB A;  1PK3 A;  4QZH A;  5BOM A;  2MA1 A;  2B4V A;  1L3S A;  3QZ8 A;  3PW0 A;  1JXL A;  2M9N A;  4DQI A;  2KKP A;  1B43 A;  1SKW A;  5DBC A;  8ICI A;  1TK0 A;  4E8F A;  4K9B A;  1KQQ A;  2E8O A;  2BPC A;  2DWQ A;  5CFU A;  4FZM A;  3FDS A;  4OAH A;  4ELV A;  2W7O A;  2W04 A;  5CWR A;  4EED A;  4X0B A;  1SV0 A;  1OUQ A;  4QW9 A;  5DQH A;  2XIC A;  5C5J A;  5ALI A;  4DL5 A;  1PUZ A;  1JX4 A;  4J9P A;  1L6N A;  1EXN A;  5T14 A;  2K4I A;  4PGY A;  2DRA A;  4UAS A;  1TVA A;  3PMN A;  4K4H A;  3OHA A;  3M1Y A;  4FS2 A;  2KSO B;  2R8H A;  2F3N A;  2K89 A;  1FO4 A;  1X42 A;  3T5L A;  4Y2U A;  2GO7 A;  9ICL A;  3JCF A;  3C2M A;  4B9L A;  4WC0 A;  1JRO A;  3KHG A;  3QYP A;  2F1H A;  2WB1 C;  5HRL A;  2DKZ A;  3TAD C;  4X4O A;  1NJW A;  1KLN A;  4CE6 A;  5EE0 A;  4DO9 A;  2ID1 A;  1JUD A;  8ICO A;  4GXJ A;  2VIX A;  3F5A A;  2EQY A;  3WKB A;  3GFK B;  3N28 A;  4LEV A;  3SR6 A;  1YZ6 A;  2ZJA A;  2HHQ A;  4WC1 A;  1K5O A;  5J0T A;  2J6S A;  2AXT U;  3KHL A;  4P4O A;  1TFW A;  9ICM A;  5DB6 A;  4X4S A;  4AT8 B;  4WC6 A;  3EPI A;  2FLN A;  2KV2 A;  1ZQD A;  4O5K A;  3EF2 A;  2VA8 A;  4NXT A;  5AK5 A;  7ICN A;  1HIW A;  4WCW A;  4USA A;  9ICJ A;  1X6I A;  4QZA A;  3ED5 A;  2EAP A;  7ICT A;  3K7D A;  5J0Q A;  3JPQ A;  2BHN A;  1GO3 F;  2YN4 A;  3ORY A;  2FJ6 A;  1SZH A;  3NVO A;  4EYH B;  2E3T A;  3MBY A;  4F4Y A;  4DL3 A;  4ELU A;  5IIN A;  4C8M A;  5AK6 A;  4ED2 A;  2WAQ C;  3WFQ E;  4FBU A;  4NXV A;  5EE9 A;  1L8L A;  3ZDB A;  2HHS A;  1BPD A;  1HUO A;  1RZT A;  1N2X A;  3EPG A;  2F2A B;  8ICU A;  1KEJ A;  2LMR A;  2HHP A;  3LDA A;  4PHD A;  5HRD A;  1XS9 D;  5ALG A;  4RU9 A;  5DDY A;  2BCQ A;  1J97 A;  2G0A A;  2LKY A;  5ALZ A;  1D8L A;  4I2A A;  4J03 A;  4PHE A;  1X66 A;  2GLE A;  4NLG A;  3EUB 2;  3AQF A;  4F71 A;  4NV0 A;  3A0B U;  1ZQ1 C;  1S9F A;  5A0L A;  2QLT A;  2GA9 D;  2C2E A;  1R8A A;  4WJ3 B;  4OJ6 A;  5KG2 A;  2Z7J A;  4DF8 A;  2QB0 A;  4ED1 A;  5ALN A;  3WKE A;  2N1R A;  3L3F X;  7ICJ A;  5CP2 A;  4XJE A;  3F5E A;  1UEU A;  4ACO A;  1K1S A;  3UXP A;  5K4L A;  1R8C A;  4M04 A;  4WC2 A;  3M8R A;  2KIW A;  4PHA A;  3M6K A;  5ALH A;  2HHT A;  2HMX A;  8ICT A;  9ICK A;  5KT5 A;  5HRE A;  4DL7 A;  1QQ5 A;  5HRI A;  2ATL A;  1V4A A;  1SZP A;  3HWT A;  4B9S A;  2KZM A;  2O1P A;  1SL2 A;  5J2D A;  3ONN A;  3AUO A;  3V7L A;  1N5X A;  2KJ8 A;  2ZXH A;  4NJ8 A;  2AHO B;  3RAX A;  4I2B A;  3TI0 A;  4EBK A;  2DR5 A;  5KFF A;  4NLZ A;  3H4B A;  3HIL A;  4MEY A;  1HJP A;  1ZQY A;  5HRK A;  5J0W A;  1QSS A;  2I9G A;  2JXJ A;  5J0R A;  4DLE A;  2C2R A;  2DVI A;  2AGP A;  1S97 A;  3NRZ A;  3EWA A;  5ALU A;  3HT3 A;  1UPH A;  4EEY A;  1QLN A;  2DL0 A;  2W55 A;  2QB0 B;  2C28 A;  1COO A;  3IN5 A;  3D2N A;  5AI0 A;  9ICB A;  4EZ9 A;  3N4M B;  2I5H A;  5ALT A;  1SIJ A;  3WK7 A;  1RM6 C;  4RQ1 A;  4O3P A;  2HHV A;  4YD1 A;  5DG8 A;  1TV9 A;  1CUK A;  5DLG A;  1MIY A;  1XC9 A;  3ISB A;  4UB5 A;  3H0M B;  4JWN A;  2PKE A;  1ZRN A;  1QSL A;  2WF9 A;  8ICR A;  1TAU A;  4DSK A;  5KL8 B;  3SMV A;  4O3M A;  3UQ2 A;  4DFM A;  4Y2S A;  3H8J A;  1V85 A;  3DDH A;  1U49 A;  3AU2 A;  4F93 B;  4WC4 A;  1NK4 A;  2BZF A;  3LVV A;  2FLP A;  5AM4 A;  2RQ5 A;  2CPR A;  2NRW A;  4I28 A;  2ALZ A;  2QB1 A;  5L1K A;  3C2L A;  2GWS A;  4RQ4 A;  3PO5 A;  8ICS A;  5AM0 A;  5E79 U;  3OTQ A;  1SXE A;  1XSL A;  4KIT B;  4B9V A;  4QZC A;  3ZD9 A;  2L5Y A;  2CRX A;  1R89 A;  2ZHA A;  7ICM A;  2W11 A;  3G6Y A;  1VDV A;  3GV5 B;  4P4M A;  3RJH A;  4K96 A;  2CXY A;  5AKG A;  2BDU A;  4Q44 A;  2A19 A;  2JZB B;  4YQW A;  4YN4 A;  2ZIV A;  2ISP A;  2KE7 A;  4Y2V A;  4QIW F;  1UQV A;  4EGW A;  8ICN A;  4DWI A;  5ALV A;  1NK5 A;  1MC8 A;  5JU5 A;  1ZQF A;  5EOZ A;  3V7J A;  1VLB A;  3UPS A;  1BVS A;  2AU0 A;  4Q43 A;  1ZD4 A;  2HN2 A;  3QU9 A;  1F5S A;  2DFL A;  2K60 A;  4GIB A;  3ICX A;  4RQM A;  2JEF A;  4QZE A;  3ZDD A;  4N7R A;  2ZTD A;  3F2B A;  2FPK A;  2M2W A;  5GTH U;  2W9C A;  3QUT A;  1NK7 A;  1IXR A;  4C8K A;  3QX7 A;  3PZP A;  3V7K A;  4O5C A;  3BS5 A;  5CHE A;  1TAM A;  5KFI A;  4YXJ A;  3RRH A;  4FZN A;  1B4F A;  2KP7 A;  4ZH4 A;  4MEX A;  4JLZ A;  4PHP A;  3AN1 A;  3MR3 A;  5HRF A;  2DKX A;  4YG2 A;  3QU5 A;  5L9X A;  4X4U A;  1CEZ A;  2BBJ A;  2KD1 A;  2FI1 A;  3SI8 A;  3BZC A;  5IIM A;  2HDO A;  2DBY A;  3QNM A;  3H7I A;  2ZIV B;  7ICG A;  5KT4 A;  5KFB A;  9ICX A;  1L3V A;  4JMU A;  4CGZ A;  3H0L B;  3MDA A;  4OAI Z;  3M9O B;  2OXO A;  4NLB A;  1JAL A;  3SEN A;  4MFF A;  3MFI A;  2A3V A;  1A6S A;  4WC7 A;  1ED1 A;  2JEI A;  1BPE A;  9ICV A;  2E1E A;  5J0U A;  5KFQ A;  4DQQ A;  2KVC A;  5D4B A;  1IV8 A;  1ZQL A;  1TK5 A;  3NAS A;  2XGQ A;  2HOF A;  4YD2 A;  2JH1 A;  3BS5 B;  9ICF A;  1NK0 A;  4DLG A;  2P6U A;  1ZQU A;  1KDH A;  4AT7 B;  1KTQ A;  4I29 A;  1MQ2 A;  2OM6 A;  2W9A A;  3NKU A;  3V72 A;  3QXG A;  5ALD A;  3KOO A;  4BWM A;  2H3Z A;  1NZB A;  4EEB A;  2LPE A;  4C7Z A;  3K4G A;  2KN7 A;  2HHX A;  5KG4 A;  2XY7 A;  4KLI A;  3D2S A;  2KKV A;  4TUS A;  4A8E A;  3M8S A;  4I2C A;  3C1Y A;  2LYB A;  4US9 A;  1C7Y A;  2KFN A;  3N7S C;  4UB1 A;  3RH4 A;  3HJ1 A;  3C28 A;  1L7M A;  3LYS A;  3WKA A;  4I2J A;  1WUD A;  4KLO A;  5L1I A;  2IOF A;  5KG3 A;  3B0Y A;  4DQR A;  3T5H A;  2HHW A;  1NKB A;  2W03 A;  2HI0 A;  3ZI4 A;  1ZQH A;  4I2G A;  3AQK A;  4KLD A;  1N56 A;  1BPY A;  2RLT A;  4DSF A;  4KLU A;  5KFE A;  3UMB A;  2R8J A;  1JAJ A;  3UMG A;  2AQ4 A;  2HBM A;  1RXW A;  1MSW D;  5ALP A;  3QUQ A;  2JGA A;  5DDM A;  4TUR A;  4I2E A;  2NRX A;  4LVS A;  2W54 A;  4BUG A;  1ZQN A;  4CF3 A;  4CNQ A;  4KM5 A;  3C5G A;  4QWE A;  1K1Q A;  3HRD D;  2IMW P;  5IIJ A;  2V9W A;  2C2D A;  1WCN A;  1X9M A;  4O3Q A;  2K8A A;  1MA7 A;  3H37 A;  4S3N A;  2BR0 A;  4WH5 A;  2W43 A;  2XY6 A;  2NYV A;  3JYY A;  4UD4 A;  4PZO A;  2D6F C;  2UVU A;  2KFZ A;  1N62 A;  2PBE A;  5AKX A;  1TFR A;  4F3O A;  1L3T A;  4EYI B;  2AJQ A;  5AKE A;  5JTI A;  4RQ7 A;  4IRK A;  1XU4 A;  5L1L A;  5AIC A;  2LBO A;  4P2H A;  1V97 A;  7ICP A;  2ISO A;  2ZH5 A;  4EV6 A;  2KZZ A;  2RRD A;  5J0O A;  3QE9 Y;  3MAB A;  2ZH6 A;  5L1M A;  5KFL A;  4QWB A;  4HX0 A;  4PJ0 U;  3KD3 A;  2FMQ A;  4M6W B;  4WC3 A;  1A0P A;  4BWJ A;  4YP3 A;  3PY8 A;  2XVT A;  4LEY A;  3RTV A;  3H3A A;  2DQN B;  3BDP A;  1S0O A;  4MFC A;  4GLX A;  1QQ7 A;  2FLL A;  1NNL A;  4NXZ A; 
#chains in the Genus database with same CATH homology
 1U4B A;  4J9M A;  2BCV A;  2BPF A;  3WFQ E;  2ZH2 A;  5DQG A;  2PFP A;  3ZDE A;  4YFK A;  2VA3 A;  4FBU A;  3SYZ A;  3AU6 A;  3TAP A;  4GXK A;  7ICK A;  1XSN A;  3N97 B;  2ZH8 A;  2DPI A;  3H8W A;  1KFS A;  3THV A;  4QWA A;  3RRG A;  1FA0 A;  5CR0 A;  3ZDB A;  4WC5 A;  2HHS A;  1BPD A;  3HP6 A;  3MGI A;  1HUO A;  4I27 A;  3WFR E;  5F9L A;  4C8L A;  1RZT A;  4RNM A;  3EPG A;  3Q8R B;  1JN3 A;  1RPL A;  5BPC A;  4PGQ A;  5TZV A;  4I2H A;  8ICU A;  1KEJ A;  5J0S A;  2HHP A;  3LDA A;  4PHD A;  3MR5 A;  4DOB A;  5HRD A;  1YLQ A;  1ZQI A;  4MF2 A;  4BGD A;  1XS9 D;  3GIM A;  1BPB A;  2BQ3 A;  1Y88 A;  4Q8F A;  4RU9 A;  3SV4 A;  4F5R A;  4NKU A;  4QZD A;  1U47 A;  3SZ2 A;  1NK9 A;  4TQR A;  5HP4 A;  5KFM A;  8ICY A;  5DKW A;  5DDY A;  4JK1 A;  1ZQV A;  1U48 A;  1TKD A;  2UVW A;  2BCQ A;  4I2I A;  1D9D A;  4B9N A;  5KG1 A;  2V4R A;  4E80 A;  1D8L A;  3OJS A;  4I2A A;  4PHE A;  4KLM A;  1LB2 B;  4UBB A;  5J0X A;  2JEG A;  2FPL A;  4F4K A;  5J0P A;  5KG5 A;  4M9N A;  4NLG A;  1S76 D;  4FHP A;  1JXE A;  4QW8 A;  4UB2 A;  1S9F A;  4ED2 A;  2ASL A;  1XO1 A;  4QZG A;  2C2E A;  7ICI A;  1UET A;  4ED0 A;  3T5J A;  1R8A A;  2I1Q A;  2W8K A;  4YR3 A;  4ECV A;  2PFN A;  3OUY B;  5KG2 A;  4PPX A;  4ECQ A;  1N48 A;  9ICG A;  4DEZ A;  2BDP A;  1B22 A;  2H5X A;  2XY5 A;  5KFK A;  5HRB A;  4AT8 A;  4DF8 A;  2XGP A;  4ED1 A;  4RWN A;  3OUY A;  5HHH A;  3OHB A;  5L1J A;  4RQ5 A;  4NM1 A;  2R8I A;  9ICW A;  3RB4 A;  2DPJ A;  4X4N A;  4K4I A;  1UEV A;  7ICJ A;  5CP2 A;  4Z6C A;  4FHW A;  2FMS A;  2UVV A;  1UEU A;  4IRC A;  1K1S A;  3UXP A;  4R66 A;  2ZUB A;  4O3O A;  7ICE A;  1R8C A;  4M04 A;  3JPP A;  5III A;  4ECU A;  3IHQ B;  1ZQG A;  4M6W A;  4WC2 A;  5J0Y A;  4JV2 A;  3M8R A;  3GII A;  4PHA A;  2HHT A;  4RNO A;  3PV8 A;  4YVZ A;  4J9S A;  8ICT A;  4Z6D A;  9ICK A;  5KFR A;  5KT5 A;  3HPO A;  5HRE A;  4DL7 A;  4M9G A;  5J2C A;  4R64 A;  8ICJ A;  3QEA Z;  3RJF A;  4DSJ A;  3C18 A;  4YMN A;  2J6T A;  5HRI A;  4R8U B;  1UA1 A;  8ICV A;  2ATL A;  1V4A A;  2KTQ A;  1SZP A;  4FH5 A;  5CB1 A;  3HWT A;  4DS5 A;  4J9N A;  2ZTE A;  4HYK A;  4B9S A;  4NKT A;  2KZM A;  3RBD A;  4UD5 A;  1ZJN A;  2O1P A;  4I2F A;  1SL2 A;  1T7P A;  2HHU A;  4P4P A;  5J2D A;  4M5D A;  3L9D A;  4YXM A;  3AUO A;  2ZH3 A;  3V7L A;  5DED A;  1ZQA A;  5KT2 A;  2KZ3 A;  4LZG A;  3MFH A;  3V6K A;  4UAY A;  2IHM A;  4B9U A;  7ICF A;  9ICP A;  3PX4 A;  3RAX A;  4I2B A;  1BNO A;  3TI0 A;  4RWP A;  3RJG A;  4EBK A;  1ZQS A;  5KG6 A;  4RUC A;  2DR5 A;  4F92 B;  5KFF A;  3KHH A;  4IRD A;  3JPT A;  3H4B A;  4NLZ A;  4XQ7 A;  2ZHB A;  2BGW A;  8ICG A;  3PVX A;  4MEY A;  3FYH A;  1HJP A;  1T4G A;  3EZ5 A;  2Q66 A;  1ZQY A;  5HRK A;  5J0W A;  1QSS A;  2I9G A;  2Y1I A;  4UQG A;  3NYB A;  5J0R A;  5DGB A;  4DLE A;  1TFY A;  2C2R A;  4GC7 A;  4KLG A;  4RWQ A;  2DVI A;  2M2V A;  3HW8 A;  2R8K A;  9ICC A;  4X4R A;  2ASJ A;  2AGP A;  4MFA A;  3TFS A;  4O0I A;  1S97 A;  3EWA A;  3H8S A;  3HT3 A;  4EEY A;  3RR7 A;  1QLN A;  4RQ6 A;  1ZQP A;  7ICQ A;  3WFS C;  5HML A;  4RPZ A;  2C28 A;  3WFP A;  4DF4 A;  3C23 A;  4KN4 A;  5KFY A;  5EWG A;  5KFU A;  4YR0 A;  4TUQ A;  1COO A;  5JUM A;  4GXI A;  4DOC A;  2AGQ A;  1QSY A;  1D8Y A;  2BCR A;  1KRP A;  5J2F A;  7ICH A;  1A76 A;  9ICB A;  3ISC A;  1UT8 A;  3NGD A;  4KMU A;  4EZ9 A;  3N4M B;  4KLE A;  4RQ1 A;  4O3P A;  2HHV A;  3BQ2 A;  8ICM A;  4YD1 A;  2ZH9 A;  3Q8P B;  5F2V O;  5DG8 A;  1TV9 A;  4X5V A;  1CUK A;  2ZJ8 A;  4EZ6 A;  4F5N A;  5DLG A;  1KSP A;  4X4Q A;  5EWE A;  1MIY A;  1XC9 A;  3ISB A;  4UB5 A;  4JWN A;  5DBA A;  1BPX A;  1QSL A;  8ICR A;  2IHN A;  1TAU A;  4LT6 A;  3PW4 A;  4NLN A;  4DSK A;  1DOQ A;  3UQ2 A;  4DFM A;  1NOM A;  3G6V A;  7ICS A;  3H8J A;  4XQ8 A;  4F5O A;  3EYZ A;  1A77 A;  1U49 A;  4DL4 A;  1X2I A;  1Z3E B;  3AU2 A;  7ICV A;  2MAX A;  4F93 B;  4WC4 A;  5KFZ A;  1NK4 A;  4EBE A;  2IA6 A;  3JPR A;  4R63 A;  1SKS A;  5KFO A;  4R8U A;  3E2E A;  3C66 A;  9ICH A;  4C8O A;  4FHY A;  3B0X A;  3Q8K A;  3RH5 A;  2VA2 A;  5DGA A;  4XRH A;  5KFV A;  3PNC A;  2W9C B;  4DFP A;  2W9M A;  2FLP A;  5HRG A;  3HJ4 A;  5CJ7 A;  4Q45 A;  2NRW A;  4I28 A;  2R8G A;  2ALZ A;  4AT7 B;  4DS4 A;  5L1K A;  3C2L A;  2GWS A;  4FHV A;  2LYH A;  1BGX T;  1S0V A;  2ZUC A;  4RQ4 A;  5DB7 A;  3PR5 B;  3PX6 A;  3PO5 A;  3H4D A;  8ICS A;  5HHI A;  1ZQO A;  4GC6 A;  2HW3 A;  2ZH4 A;  1WCL A;  9ICN A;  3ZD8 A;  4ECY A;  4KLL A;  5J29 A;  1L3U A;  3RR8 A;  4G3I A;  4F5P A;  4F2S A;  2W9B A;  1XSL A;  4KIT B;  4QZF A;  5BOL A;  4RQ8 A;  1ZQT A;  4B9V A;  4I2D A;  1KNY A;  4QZC A;  1RXV A;  3ZD9 A;  1Z00 A;  2XC9 A;  1R8B A;  1R89 A;  2ZH7 A;  4KTQ A;  1XWL A;  1JMS A;  1ZQK A;  2ZHA A;  1KFD A;  3OVB A;  7ICM A;  5DLF A;  3BQ0 A;  5IIK A;  3RBE A;  2M2U A;  3EW9 A;  3OSN A;  3G6Y A;  4DSE A;  5EWF A;  3GV5 B;  4P4M A;  4ECR A;  3RJH A;  4RQ2 A;  5DB8 A;  4KLS A;  4X4V A;  3M9N B;  4YMM A;  3SV3 A;  2BQU A;  1V9P A;  3MGH A;  2PI5 A;  2BE3 A;  1X9S A;  2BKE A;  5DQI A;  1NJY A;  4Q44 A;  1SL0 A;  1HUZ A;  4DFJ A;  2JZB B;  4YQW A;  8ICB A;  4YN4 A;  9ICT A;  2ISP A;  3RJJ A;  4ED3 A;  7ICO A;  1T8E A;  3G6X A;  3TFR A;  4BDP A;  1U9L A;  2FPM A;  4KLF A;  4F5Q A;  2NRK A;  4O3S A;  5CHG A;  8ICN A;  4QZ8 A;  2WTF A;  2AGO A;  4DWI A;  1NK5 A;  1MC8 A;  1ZQF A;  4UBC A;  5EOZ A;  2PXI A;  3V7J A;  1BNP A;  2B21 A;  5KFD A;  3UPS A;  2XO7 A;  1BVS A;  2RDI A;  4Q43 A;  2ZTC A;  4ECS A;  2AU0 A;  2DR9 A;  8ICK A;  4DSL A;  3PW7 A;  4JUZ A;  3RB0 A;  1H38 A;  2DFL A;  3TAN A;  4O5E A;  4BXO A;  8ICH A;  4Z6F A;  4RNN A;  1RYS A;  1TK8 A;  2JEF A;  2JEJ A;  1F5A A;  8ICF A;  1MIV A;  3UXO A;  4QZE A;  3ZDD A;  5HC9 A;  2ZTD A;  8ICC A;  4X4P A;  4QZB A;  2FPK A;  9ICA A;  1ZQJ A;  2M2W A;  1JIH A;  8ICA A;  2W9C A;  4FBT A;  1ZQW A;  2RFF A;  4RWO A;  1NK7 A;  4QWC A;  2Q0Z X;  4IQT A;  3V6H A;  1IXR A;  4DFK A;  4C8K A;  3QEB Z;  2C22 A;  2FMP A;  3BQ1 A;  5KFW A;  3V7K A;  4O5C A;  1DGS A;  7ICU A;  1VFG A;  1NJX A;  5KFI A;  3M9M B;  4YXJ A;  5KT3 A;  2W9B B;  3RRH A;  5KFT A;  4XA5 A;  2P6R A;  4IR1 A;  4F8R A;  3KHR A;  4O3R A;  4F2R A;  2KP7 A;  1UA0 A;  5KFS A;  3OSP A;  4ZH4 A;  4MEX A;  4WBY A;  4PHP A;  3PX0 A;  1Z00 B;  3MR3 A;  1ZQM A;  2NRT A;  4YG2 A;  4RQ3 A;  5HRF A;  4FO6 A;  5IIL A;  4J9K A;  1ZQR A;  1RYR A;  3UPQ A;  5L9X A;  5HRH A;  4X4U A;  1CEZ A;  1ZYQ A;  4X4T A;  4ED8 A;  4MF8 A;  5J2J A;  4ED6 A;  1ZQC A;  8ICL A;  4UB4 A;  4J9R A;  9ICU A;  1Q78 A;  3SI8 A;  1NKC A;  5IIM A;  3C1Z A;  4UAW A;  3Q8M A;  5KFG A;  4M9H A;  4IG8 A;  4DSI A;  1DK3 A;  3H7I A;  5KFA A;  4ELT A;  3ETL A;  2DRB A;  4E0D A;  2DR8 A;  1NK8 A;  7ICG A;  4M9J A;  3TQ1 A;  3RAQ A;  9ICS A;  3GIK A;  3BQT A;  8ICW A;  4AT9 B;  5KT4 A;  5KFB A;  1S10 A;  9ICX A;  4FH3 A;  1L3V A;  4RT3 A;  3GDX A;  2JZB A;  2HVH A;  4NM2 A;  5KG7 A;  3TAR A;  3MDA A;  3NTU A;  3IM1 A;  3M9O B;  1S77 D;  2A1J A;  1UT5 A;  2NRZ A;  3OV7 A;  4QZ9 A;  3ISD A;  1D9F A;  3MR6 A;  5DEC A;  2ZJ5 A;  4YCX A;  5J2H A;  2PFQ A;  4MFF A;  4R65 A;  3MFI A;  1PZN A;  5KFP A;  3Q8L A;  4M2Y A;  1L5U A;  4J9L A;  1ZJM A;  1NO5 A;  1PX5 A;  1MQ3 A;  4WC7 A;  5KT7 A;  3GV8 B;  3TAQ A;  4BXO B;  5KG0 A;  2OWO A;  5HR9 A;  2JEI A;  1BPE A;  2PI4 A;  9ICV A;  2BCS A;  4B9M A;  2MUT B;  4RPX A;  4DOA A;  4ECT A;  3UXN A;  4ECZ A;  1BPZ A;  3LQC B;  3PW2 A;  3H39 A;  1NZP A;  3GQC A;  1Q79 A;  1DK2 A;  9ICI A;  3MDC A;  3GIL A;  5J0U A;  5KFQ A;  4O9M A;  4DQQ A;  4DL2 A;  3PO4 A;  5D4B A;  4E7X A;  1ZQL A;  3JZ0 A;  3HIY A;  3GIJ A;  2DR7 A;  1TK5 A;  8ICQ A;  1QTM A;  2F1I A;  5J2A A;  4YD2 A;  2XGQ A;  2RDJ A;  4F4W A;  1ZQX A;  5J2I A;  4KLH A;  2M2T A;  3AQL A;  1ZQZ A;  4RUA A;  3JPS A;  3V6J A;  3ZDC A;  1NK0 A;  4DLG A;  4DQP A;  4Q8E A;  9ICF A;  5DBB A;  4QZH A;  5BOM A;  4K4G A;  4UAZ A;  2P6U A;  1ZQU A;  1KDH A;  1L3S A;  4IQV A;  1KTQ A;  4ELU A;  4RZR A;  4I29 A;  5KT6 A;  1MQ2 A;  3QZ8 A;  3PW0 A;  5KFX A;  2M9N A;  4J9O A;  2BQR A;  1JXL A;  4DQI A;  1B43 A;  2W9A A;  1SKW A;  3V72 A;  5DBC A;  2HVI A;  2ASD A;  4ED7 A;  1TK0 A;  5KFC A;  3RJE A;  5DB9 A;  4BWM A;  8ICI A;  4E8F A;  4YMO A;  3RH6 A;  1WOT A;  2BPC A;  4PGX A;  3C5F A;  3OVA A;  4PH5 A;  3OJU A;  4CCH A;  3FDS A;  4RPY A;  4QZI A;  3K4G A;  4JV0 A;  2KN7 A;  2HHX A;  5KG4 A;  2XY7 A;  5J2K A;  4ELV A;  4KLI A;  4TUS A;  5KTQ A;  4M0A A;  1IM4 A;  4ATB A;  3Q8S B;  8ICZ A;  1SKR A;  3M8S A;  4I2C A;  3C1Y A;  2ZH1 A;  3RJI A;  5J2E A;  1C7Y A;  2KFN A;  5CWR A;  2BPG A;  4X0B A;  9ICO A;  2NRV A;  1ZET A;  4IR9 A;  4UB1 A;  3RH4 A;  9ICR A;  3HJ1 A;  5D49 A;  4QW9 A;  5DQH A;  2A1J B;  5C5J A;  4DL5 A;  4QWD A;  3K75 D;  4AT9 A;  3WFO A;  3T5K A;  2AQ0 A;  4I2J A;  4KLO A;  5L1I A;  1LV5 A;  4FS1 A;  1JX4 A;  1TAQ A;  5KG3 A;  3B0Y A;  4DQR A;  2IBK A;  3RJK A;  3T5H A;  4F4X A;  4J9P A;  2HHW A;  3RB6 A;  5F9N A;  1NKB A;  1EXN A;  1ZQH A;  4YR2 A;  3H40 A;  4I2G A;  5HMM A;  2P66 A;  3AQK A;  3OVS A;  3C2K A;  4KLD A;  4TQS A;  4M47 A;  4PGY A;  1N56 A;  2VAN A;  1BPY A;  2DRA A;  5J2B A;  1TVA A;  3PMN A;  4UB3 A;  4NY8 A;  1VJ7 A;  4DSF A;  4K4H A;  2XCA A;  4B9T A;  4JV1 A;  4KLU A;  9ICQ A;  4WBZ A;  5KFE A;  2MUT A;  3JPO A;  5J2G A;  2R8J A;  3OHA A;  2UVR A;  1JAJ A;  4KLJ A;  4FS2 A;  3OGU A;  2R8H A;  2AQ4 A;  1RXW A;  4KLT A;  1MSW D;  3T5L A;  3PR4 A;  5CA7 A;  9ICL A;  4EBC A;  5DDM A;  1XSP A;  4TUR A;  3C2M A;  2NRX A;  3MR2 A;  4B9L A;  5DG7 A;  4I2E A;  4LVS A;  1ZQN A;  1KFT A;  4WC0 A;  3KHG A;  4EP7 A;  2F1H A;  1OU5 A;  4FHX A;  3C5G A;  3LWM A;  4RQ0 A;  4QWE A;  5HRL A;  1K1Q A;  1NKE A;  2IMW P;  1S0M A;  4AT7 A;  5IIJ A;  4X4O A;  1NJW A;  2Y1J A;  2C2D A;  3Q8Q B;  4DL6 A;  2V9W A;  1WCN A;  5IIO A;  4DO9 A;  1KLN A;  9ICE A;  4XUS A;  1X9M A;  8ICO A;  8ICX A;  2ID1 A;  4O3Q A;  4GXJ A;  4O3N A;  3HX0 A;  4EBD A;  3QZ7 A;  1ZQB A;  3H37 A;  2BR0 A;  4S3N A;  2J6U A;  4KLQ A;  4F50 A;  4ATB B;  1U45 A;  2XY6 A;  3GFK B;  5D46 A;  3JPN A;  2PFO A;  3JYY A;  4UD4 A;  3ZDA A;  1SL1 A;  2UVU A;  2KFZ A;  2PBE A;  1ZQQ A;  3KTQ A;  5KFH A;  4M9L A;  2ZJA A;  1TFR A;  2XCP A;  4F3O A;  1L3T A;  2HHQ A;  4C8N A;  1X9W A;  4WC1 A;  3PW5 A;  4IQU A;  5J0T A;  4TUP A;  3LWL A;  4EYI B;  1T3N A;  3T3F A;  2J6S A;  2AJQ A;  1JQR A;  3BJY A;  4NLK A;  3KHL A;  4P4O A;  4RQ7 A;  4EBJ A;  4IRK A;  3LK9 A;  1XU4 A;  5L1L A;  5DB6 A;  9ICM A;  1TFW A;  4P2H A;  7ICL A;  4X4S A;  4AT8 B;  4WC6 A;  3GV7 B;  3EPI A;  2FLN A;  4DQS A;  2BCU A;  2ISO A;  1ZQD A;  7ICP A;  2ZH5 A;  2O5A A;  3RB3 A;  2KZZ A;  2F1J A;  2ZUD A;  4IQW A;  4O5K A;  4F4Z A;  5KFN A;  4ECW A;  5DG9 A;  3QE9 Y;  5J0O A;  1MIW A;  4X0A A;  3AQM A;  3MAB A;  1ZQE A;  4KN7 A;  4JWM A;  2VA8 A;  1ARO P;  3H38 A;  3C21 A;  7ICN A;  2ZH6 A;  3PML A;  4ECX A;  4LZD A;  5KFL A;  5KFJ A;  4QWB A;  4RT2 A;  9ICJ A;  7ICR A;  4QZA A;  2FMQ A;  4WCW A;  4M6W B;  7ICT A;  5J0Q A;  1NJZ A;  3JPQ A;  3UQ0 A;  4WC3 A;  2BHN A;  4F91 B;  4BWJ A;  4YP3 A;  1NK6 A;  3PY8 A;  3ORY A;  2W8L A;  2V4Q A;  3RTV A;  3H3A A;  3BDP A;  1S0O A;  4MFC A;  4GLX A;  8ICE A;  4Z6E A;  5HNK A;  1S0N A;  8ICP A;  4EYH B;  2FLL A;  3MBY A;  4F4Y A;  4DL3 A;  4J9Q A;  3AQN A;  4NXZ A;  5IIN A;  4C8M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...