5DB7A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a dt
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 100
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db7A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db7A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db7A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db7A03
2P66A 1NKEA 4AT8A 4YVZA 2HHVA 3JPQA 2RDJA 3PNCA 4ED8A 3M9NB 3ISDA 8ICNA 2C28A 7ICUA 1KFSA 3AUOA 8ICSA 1BPXA 4UAYA 5HP4A 5KFEA 4ECRA 1XU4A 1KTQA 2RFFA 5CA7A 3GQCA 5KT2A 4DL2A 2I9GA 3ZD9A 3M9OB 5KFVA 3PW5A 5KT6A 1S97A 1DOQA 2JEJA 3FYHA 4F4WA 4YCXA 3V6JA 4M47A 2AJQA 4DS4A 4O3NA 2JZBB 4FS2A 4ECXA 2BPGA 5HRIA 5KFJA 4Q43A 1D8LA 1ZQAA 3KHRA 5J2HA 5KG7A 1T8EA 1KLNA 1T7PA 2BR0A 5KG0A 4M9JA 4EBDA 1PX5A 3V6HA 2DPJA 4PGQA 1ZQFA 4LZDA 3JPPA 3RRGA 1T4GA 4KLHA 3RB3A 3C5GA 3JYYA 5BPCA 4QWBA 5KFXA 5CJ7A 3HIYA 1COOA 2WTFA 4RU9A 5D49A 3UPSA 3ZDCA 4EBCA 2AU0A 4J9MA 3BQ1A 5DG9A 4TQSA 1TK0A 4B9LA 8ICLA 4FS1A 4YR2A 3M8SA 3V7JA 1S9FA 1ZQTA 3RAXA 1NJYA 2ZH5A 4O3RA 1R8CA 1UT5A 4RQ7A 4NKTA 3PX4A 4I2FA 1N56A 2J6UA 3BQTA 4DFPA 4UB4A 3V6KA 1NJWA 1ZQJA 2DR8A 4YR0A 3TQ1A 4O5KA 2VA3A 4F3OA 5EWGA 3SV3A 3PW0A 4C8OA 4DSJA 5D46A 2ASLA 4F2SA 3UPQA 4CCHA 8ICIA 5IIMA 3QEAZ 2ZTCA 4QW9A 2J6SA 5DG8A 4X4VA 2PFPA 1JMSA 2ID1A 3OJSA 3C1YA 4E80A 4FBTA 4I2HA 4Z6DA 4ECYA 1MQ3A 3PR5B 5J2JA 3NGDA 1X9SA 4X4SA 2F1IA 5KFKA 2RDIA 2FMSA 3MGIA 1ZQMA 4X4RA 2BHNA 4F4XA 4FO6A 1QSLA 4JV0A 7ICGA 5DB7A 3PMNA 2BCRA 4TURA 4C8KA 2ZH6A 3QZ7A 9ICJA 9ICTA 1NK7A 2JEIA 4DOCA 4J9LA 2FMPA 5HRLA 8ICAA 3MFHA 5KFIA 3RBDA 2XCAA 3M8RA 4F5NA 3ZDEA 2XY6A 7ICVA 3PW7A 4LT6A 3T5KA 5F9LA 1DK2A 4DSKA 5KFGA 4K4GA 1KFDA 2KFNA 4TUQA 4KLOA 3WFQE 2W8LA 3MDCA 4XRHA 5J0RA 2R8KA 3RH6A 2HVHA 5HHIA 2KP7A 2W9BA 5DLGA 4RQ4A 3IHQB 9ICVA 4ECWA 1ZJNA 1NZPA 1MIYA 3HP6A 4TUPA 1NK5A 5L1LA 5DQHA 4DFJA 2BCVA 2ZUDA 5IIIA 3EW9A 3B0YA 4O3SA 2ZUBA 4XQ7A 1HUZA 4X4NA 2C22A 1U4BA 2NRTA 4UBCA 3LDAA 3BDPA 1U45A 1JX4A 5KFFA 3AQMA 9ICFA 4DL6A 3LK9A 5KG2A 1LV5A 9ICRA 3HT3A 3EYZA 4R64A 4PHDA 3UXNA 4QWEA 2ZH7A 1ZQBA 1BGXT 3ORYA 3RB4A 4I2AA 5KFHA 4HYKA 8ICVA 1OU5A 5J0OA 4FBUA 2HHSA 1BPBA 4O5CA 9ICQA 1S76D 2ZJ5A 5DG7A 5J2BA 4M9NA 1U47A 4Q8FA 2IMWP 1MC8A 3ZD8A 1Q79A 1CEZA 2FLPA 4M9LA 7ICOA 2P6RA 1MIVA 3Q8SB 2NRVA 4YN4A 2HHPA 9ICCA 2JZBA 4MFAA 3OSNA 4ECQA 4I2JA 3N4MB 4ECZA 4QZCA 4P4MA 1BPYA 4P2HA 1UEUA 2ZH2A 7ICIA 3GIJA 4E8FA 5J0YA 4F93B 3ETLA 2PI5A 7ICPA 8ICRA 1ZQOA 3PW2A 3GV8B 1L3SA 4ECUA 4M0AA 5J2IA 4J9PA 4FHYA 2DR9A 4S3NA 2Q66A 3OSPA 9ICSA 3PW4A 5J0XA 4RQ8A 2DPIA 4UAWA 3TAPA 4TUSA 4I2GA 4MEYA 4Z6CA 4IRDA 3OHBA 9ICWA 4ATBA 4ELTA 2W9AA 8ICWA 5KG6A 3BQ2A 3THVA 1XS9D 2XY5A 1MQ2A 4DQIA 4F50A 2ASJA 2H5XA 4EBKA 1UA0A 1QLNA 3G6YA 1R89A 1RYSA 8ICQA 3MBYA 1RPLA 2J6TA 2B21A 2O1PA 5HMLA 4BWJA 4ATBB 2M2WA 3TAQA 2W8KA 4PHAA 4IQTA 4I2BA 4IRKA 1QSSA 5KG3A 5J2GA 2R8JA 3ISBA 4F5OA 4IR1A 3HPOA 3LWLA 4JV2A 4RQ0A 2BCSA 8ICEA 4B9NA 2HVIA 8ICOA 1WOTA 4YG2A 4WC3A 1KSPA 2ALZA 4RPXA 4UD4A 5DQGA 4DSLA 4KLLA 4IG8A 8ICXA 8ICUA 5J29A 3FDSA 3GFKB 2BDPA 1JXEA 2V9WA 5CWRA 4C8LA 4X4TA 4F4ZA 5CB1A 4WC1A 5J0PA 4EYHB 2C2EA 5HRFA 2AGOA 2KTQA 3AU2A 4K4IA 4RUCA 1D8YA 4IR9A 4QZEA 2R8HA 9ICMA 4M9HA 1R8BA 3IM1A 4J9KA 3M9MB 4C8MA 1SZPA 3Q8KA 4M9GA 1R8AA 5KG5A 5HRBA 1Y88A 2KZZA 5HREA 1NKBA 1DGSA 4KLMA 2UVRA 4QZIA 5KFQA 3RTVA 3RR8A 7ICJA 3RH4A 4J9NA 3OUYB 2ZUCA 4QWCA 5HRGA 4DL5A 4NY8A 8ICYA 1NO5A 2ZH3A 3L9DA 4X4OA 4PPXA 5DGAA 4KLDA 4NLGA 1S77D 7ICLA 4J9OA 2AQ0A 4I2CA 1L3UA 2PXIA 4MF2A 2HHUA 4DF8A 5BOMA 4WBZA 3EPIA 4KLIA 2VANA 1MSWD 4QZ9A 3WFPA 3UXPA 3SYZA 1ZQPA 3PMLA 4JUZA 2V4RA 4O0IA 5KFZA 4IQWA 3MR5A 4J9SA 3SI8A 8ICPA 4EEYA 4RWOA 1VFGA 2I1QA 3H7IA 2DR5A 3V7KA 5D4BA 3HWTA 4JWMA 4DWIA 5IILA 7ICQA 4BDPA 2AGPA 2KFZA 2MAXA 3K75D 4NKUA 5KFDA 3C1ZA 3T5HA 3RH5A 7ICEA 4E7XA 9ICOA 4G3IA 1B43A 3C21A 4ED3A 2A1JB 3H38A 4ED0A 4X0AA 1ZQDA 9ICNA 4JV1A 3RB6A 5KFPA 2BQRA 3UXOA 5IIOA 4MF8A 1SL0A 4KTQA 5KFNA 1TK8A 1ZQEA 1QTMA 4EZ9A 3C18A 4M2YA 1BNOA 3KHLA 4RPYA 1ZQNA 4KN7A 1VJ7A 2ZJAA 4KLEA 5EWFA 4DQPA 3HW8A 5KFTA 3C2MA 4FHVA 4JWNA 8ICFA 5CR0A 1IM4A 4F5QA 3PX0A 1SKRA 2FMQA 1NK0A 1SKSA 4QZBA 3UQ2A 5J2AA 5KFMA 4DFKA 4YD2A 3H4DA 2Y1JA 4E0DA 5KFAA 4P4OA 1QSYA 5HRDA 3V7LA 4ELUA 4FHPA 4IQUA 8ICKA 3RJJA 5HR9A 1T3NA 1XC9A 1ZQQA 3H8JA 5KFUA 5CP2A 3RJHA 4ED1A 1BNPA 4UB3A 3Q8MA 2FLLA 4KLQA 9ICEA 4AT9B 1SKWA 3ZDDA 4DFMA 3C2KA 2PFOA 2NRXA 4FH5A 1U9LA 4ED7A 5DEDA 1BVSA 3Q8LA 2JEGA 2DRAA 1CUKA 1MIWA 3JPSA 2LYHA 4I2IA 4PH5A 4DLGA 4QW8A 2VA2A 3T5JA 1V4AA 1A77A 1NK6A 4O3PA 3ZDBA 5J2DA 4M6WB 4BWMA 2FPMA 1BPDA 4DQSA 1YLQA 2PBEA 3OV7A 7ICSA 2M9NA 2BE3A 4X4UA 5BOLA 4X0BA 4FHXA 5EWEA 5KFCA 1ZQVA 4XQ8A 4WC2A 4EZ6A 5HC9A 4F5PA 2IHMA 4RWQA 3OVAA 1RYRA 1JIHA 5J0TA 2C2RA 3HJ1A 4B9TA 4NM2A 1TFWA 1NJXA 4ECVA 1XO1A 5KFBA 4I2EA 5TZVA 3EWAA 4YFKA 3EPGA 3T3FA 3PX6A 5KG4A 3OVBA 4XA5A 3C5FA 1L3TA 1LB2B 1A76A 3QZ8A 9ICHA 2M2UA 1NJZA 5L9XA 3NTUA 4RZRA 2XO7A 3BQ0A 4EBJA 2UVUA 4YXMA 4ZH4A 3OUYA 4DSEA 3B0XA 9ICUA 3HJ4A 1WCLA 3C23A 5L1KA 4QZGA 2PFQA 4DQRA 4RQ1A 9ICPA 2NRKA 1XSLA 4RNOA 2BKEA 3RRHA 3V72A 3WFOA 4ELVA 4KLJA 2HW3A 3TFRA 1S0MA 4UAZA 4EP7A 1BPEA 2BCUA 2R8GA 8ICGA 7ICHA 4F92B 3OGUA 2ASDA 3JPOA 2DFLA 2F1JA 3GV7B 5C5JA 2PFNA 1TAUA 5HRKA 2ZH4A 4UQGA 2XC9A 3JPTA 1H38A 3ZDAA 7ICTA 1KNYA 4C8NA 1ZQSA 5DB6A 4WCWA 2UVWA 5J0SA 2C2DA 4Q8EA 1TV9A 4PHPA 4EYIB 1S10A 4DEZA 5KG1A 1C7YA 4QZHA 1V9PA 1IXRA 3HX0A 1KRPA 4F2RA 4I28A 4O9MA 4PHEA 5J2CA 4WC0A 1D9FA 5KFRA 1U49A 2ZTEA 2A1JA 4QZDA 2HHQA 9ICBA 3LQCB 4M5DA 8ICCA 2FLNA 5J0QA 7ICMA 3RJKA 1JXLA 1L3VA 9ICAA 2KZMA 3H39A 4WBYA 3OJUA 1X9WA 4NXZA 4DSIA 2XCPA 4PGXA 3T5LA 5KT7A 3QE9Y 5HRHA 3RBEA 4BXOA 4TQRA 5DGBA 4RNMA 3JPRA 2V4QA 2MUTB 2ZTDA 4KITB 1ZQZA 5F9NA 5DB9A 3Q8QB 2HHXA 4X4PA 4UBBA 3TFSA 7ICFA 1B22A 1JQRA 5J0UA 5DBAA 4UB5A 3MGHA 4DL3A 1X9MA 3JZ0A 3ISCA 2ZHAA 4Q44A 3EZ5A 4X4QA 8ICZA 2ZH8A 4Z6EA 4P4PA 3PO4A 9ICGA 3RAQA 1RXWA 3Q8PB 4RPZA 4MEXA 1HJPA 2BGWA 2M2TA 2DR7A 4XUSA 3GDXA 1K1SA 1S0OA 1ZQYA 2VA8A 1ZQHA 1ZQWA 2HHTA 1Z00B 3PR4A 1UA1A 4GXKA 4MFCA 5DKWA 4QZAA 1ZQIA 4AT9A 4RWPA 4MFFA 1ZQRA 2BQUA 4M04A 3RJGA 5KFLA 3C66A 3TI0A 1ZQCA 3KHGA 4ECTA 3MR6A 3TANA 3H3AA 4Q45A 4GLXA 2HHWA 2DVIA 4ECSA 4AT8B 1XWLA 4DS5A 1D9DA 2IBKA 1HUOA 4B9MA 4LVSA 4M6WA 1KFTA 1UETA 5DDYA 4RWNA 3GILA 2W9CA 2GWSA 3MABA 1TAQA 5J2FA 1RXVA 4O3QA 4B9UA 2FPKA 3KHHA 4J9QA 9ICLA 5L1IA 5KFYA 5L1JA 1ZJMA 2ISOA 5IINA 2W9MA 3LWMA 5HMMA 5EOZA 4GC7A 4GC6A 4X5VA 1UEVA 1KEJA 1ZQLA 4BXOB 3G6XA 3MR3A 4I29A 2JEFA 8ICMA 2FPLA 1XSPA 4FHWA 4R8UA 1BPZA 4Z6FA 4QWDA 5KFSA 1TKDA 4NLZA 3C2LA 8ICBA 2ZHBA 4F5RA 1ZQXA 4KLFA 4AT7A 4IQVA 5KFWA 5DDMA 5DBCA 4YR3A 1K1QA 3JPNA 4DSFA 3AU6A 4LZGA 4YQWA 3UQ0A 1SL1A 4DOBA 4R63A 1ZQGA 5KT4A 2AQ4A 3GIIA 5HNKA 4GXJA 4B9VA 4DF4A 1PZNA 1X2IA 4YMOA 2IA6A 4O3OA 4KLGA 2ZH9A 2P6UA 4RQ5A 4PGYA 2BCQA 1FA0A 2KN7A 4DOAA 3RR7A 5KT5A 5JUMA 3H40A 5J0WA 4YD1A 1XSNA 4RUAA 1N48A 1KDHA 1L5UA 2ISPA 4F8RA 1TFRA 2O5AA 2ATLA 5KT3A 1NK9A 3PO5A 2NRZA 3WFRE 1RZTA 5J2KA 5J2EA 5DBBA 2NRWA 2DRBA 3G6VA 3N97B 1ZYQA 3BJYA 1ZQKA 3H8WA 2W9CB 4GXIA 4ED2A 5KTQA 4KLUA 1WCNA 4RT3A 5DECA 4WC6A 3OVSA 4FH3A 3TARA 4YP3A 2KZ3A 2BPFA 4NM1A 4WC7A 8ICTA 3RJFA 5IIJA 1DK3A 4YMMA 5HHHA 4WC5A 1TVAA 1S0VA 3OHAA 4R8UB 2AGQA 3H4BA 1U48A 4WC4A 4DO9A 4YXJA 4KMUA 1Q78A 2OWOA 2M2VA 9ICXA 1NK4A 3NYBA 4AT7B 5F2VO 4QZFA 7ICKA 4QWAA 4K4HA 3H8SA 3GV5B 4F4KA 4JK1A 3RB0A 4RNNA 2Y1IA 2ZJ8A 4QZ8A 4R66A 2BQ3A 4B9SA 1Z3EB 4RT2A 4ED6A 1AROP 3Q8RB 4DQQA 3PVXA 4BGDA 4R65A 3MR2A 4DL7A 3RJEA 3WFSC 1NOMA 5DQIA 4IRCA 2IHNA 2R8IA 2XGQA 4YMNA 3QEBZ 7ICNA 5CHGA 1S0NA 4NLKA 2Q0ZX 4RQ3A 1UT8A 2MUTA 5DLFA 4KLTA 1TK5A 1JN3A 4KN4A 4F4YA 4DLEA 4UB2A 3E2EA 1JAJA 2F1HA 4O5EA 4I2DA 3K4GA 8ICJA 1NKCA 2UVVA 3MDAA 7ICRA 1ZQUA 3AQKA 2W9BB 4NLNA 3PV8A 3PY8A 2XGPA 2PI4A 3AQLA 3SZ2A 4EBEA 1F5AA 4RQ6A 4I27A 2XY7A 1TFYA 9ICIA 3SV4A 9ICKA 5KFOA 1NK8A 4UD5A 4KLSA 1Z00A 2BPCA 2ZH1A 4J9RA 5IIKA 5DB8A 4RQ2A 3MFIA 8ICHA 3KTQA 3RJIA 3AQNA 1SL2A 3GIKA 3H37A 1EXNA 4UB1A 4F91B 4DL4A 3GIMA 1ZETA
chains in the Genus database with same CATH superfamily
3M9NB 2C28A 4ECRA 2RFFA 5AIAA 2KOBA 1KKXA 4O67A 2ZG6A 4O3MA 1S97A 3V6JA 4FS2A 5HRIA 1FFUA 2K4HA 5KFJA 1ZQAA 3ED5A 1T8EA 1T7PA 3A0BU 2DPJA 4LZDA 3JPPA 1JRPA 4WQLA 4KLHA 2EZXA 3JYYA 5BPCA 4QWBA 5KFXA 3HIYA 5GTIU 4RU9A 1KQQA 3ZDCA 3K1ZA 8ICLA 4YR2A 2F3NA 4RQ7A 4NKTA 3GU3A 1ZQ1C 3BQTA 4UB4A 3V6KA 1ZQJA 4YR0A 4F3OA 5EWGA 1DXSA 3QUQA 2ASLA 3KBBA 3UPQA 2KKPA 5KL1B 5DG8A 4X4VA 5ALKA 4K98A 1WG8A 3GZFA 4I2HA 1MQ3A 3NGDA 1FFVA 3MGIA 4F4XA 4C8KA 2BCRA 5CFSA 3QZ7A 4CNQA 4UASA 5HRLA 8ICAA 3MFHA 3FM9A 4EV6A 2JR5A 4F5NA 3ZDEA 7ICVA 1J2NA 4QIWC 2KIWA 2KFNA 3WFQE 3MDCA 4XRHA 5J0RA 2R8KA 3VC8A 2KP7A 3KOOA 2B6GA 4RQ4A 3IHQB 1NZPA 3N7RC 4U6PA 4Y2SA 5JU5A 2ZUDA 5IIIA 4O3SA 3PSFA 2C22A 2HBKA 2NRTA 1U4BA 2YB1A 3LDAA 4X4NA 3HILA 3AQMA 2LM1A 2RLTA 3WK5A 4R64A 3QU7A 5AM3A 4NV0A 4I2AA 3AMZA 4FZNA 1S76D 5DG7A 4M9NA 1UQVA 2KVCA 4M9LA 3OSNA 2O6KA 4ECQA 4P2HA 1UEUA 5ALLA 3GIJA 2A1AA 1C20A 3ETLA 2PI5A 2DUYA 2HI0A 5AI0A 4M0AA 1L3SA 3CW2C 4FHYA 3WKCA 4S3NA 2DR9A 1N61A 1X40A 4Y2YA 4I2GA 4MEYA 4IRDA 9ICWA 3NKUA 4ELTA 1L7NA 3BQ2A 1HIWA 1L6NA 2XY5A 1QLNA 1R89A 3TAQA 4PHAA 4IQTA 4I2BA 1SV0A 5J2GA 4F5OA 4JV2A 2DL0A 2HBMA 1WOTA 2GAFD 2K4EA 4RPXA 2ALZA 2LI6A 8ICXA 2NO5A 4C8LA 4OJ6A 4WC1A 5HRFA 2AGOA 2KTQA 9ICMA 1D8YA 4QZEA 4J9KA 4NL9C 5HRBA 2KZZA 1NKBA 1DGSA 2UVRA 2H3IA 4QZIA 5KFQA 5AKIA 7ICJA 3RH4A 3IG8A 4QWCA 2ZH3A 8ICYA 4C7YA 2E3TA 4KLDA 4LJXA 3WK8A 4NWIA 5ALJA 1L3UA 4DF8A 4KLIA 4RQMA 1T3QA 1SB3C 8ICPA 4EEYA 4RWOA 2I1QA 5ALEA 4NXVA 3HWTA 4JWMA 4DWIA 3K75D 3C1ZA 3T5HA 7ICEA 9ICOA 4G3IA 1X42A 3N7PD 4JV1A 4QIWF 4ZOHC 2KICA 3C18A 5KFNA 1ZQEA 3LYSA 1MN8A 2IOFA 3C2MA 1RQNA 1IM4A 4KMOB 4QZBA 3UQ2A 3WKDA 4E0DA 1QSYA 3V7LA 1SWVA 5KAFU 4K96A 1T3NA 1ZQQA 3H8JA 5KFUA 3RJHA 4ED1A 1FIQA 1SKWA 3ZDDA 2PFOA 2NRXA 2FCLA 2ZIXA 4QW8A 3T5JA 1V4AA 3ZDBA 4M6WB 4DQSA 1BPDA 2BE3A 5BOLA 4FHXA 4OAIZ 5EWEA 5KFCA 1ZQVA 4XQ8A 3HJEA 4RWQA 3OVAA 1TFWA 5AM5A 4QNLA 5TZVA 4YFKA 3EPGA 3FC4A 3T3FA 3OVBA 4XA5A 2A19A 3C5FA 1L3TA 3QZ8A 2W43A 3ER9B 2XO7A 2P35A 3OUYA 3NRWA 4RQ1A 9ICPA 2NRKA 2BKEA 3RRHA 3WFOA 8ICGA 4Y2VA 3JPOA 3GV7B 3SD7A 3JPTA 3ZDAA 7ICTA 1KNYA 2ZIVA 3MC1A 1ZQSA 2W03A 2UVWA 4Q8EA 2VIXA 5A0LA 2JV3A 1MIWA 1KRPA 1V9PA 3AQFA 5J2CA 5AICA 2ZTEA 3S6JA 8ICCA 5J0QA 4NXZA 4DSIA 3K7DA 3A0HU 1FEZA 1GPJA 1ZQZA 4UBBA 3TFSA 1X9MA 5DBAA 5AK4A 3EZ5A 8ICZA 9ICGA 3RAQA 5D62A 3UM9A 2DR7A 1K1SA 1ZQWA 1Z00B 2RHFA 4AT9A 2BQUA 5AM0A 5AM1A 2KG5A 3TANA 3U26A 1KFTA 4OAGA 4EGWA 2WF8A 4FZMA 3B9JA 9ICLA 5L1IA 5KFYA 2ISOA 5IINA 1SZHA 1KEJA 2JEFA 8ICMA 4JLZA 2F2AB 8ICBA 1ZQXA 4LEYA 3HKZC 4KX3A 4IQVA 4GFJA 5CEHA 2LKYA 2KHVA 4KLGA 1PZNA 1X2IA 2IA6A 1UCVA 5ALMA 1A6SA 3WK6A 3OPXA 4RUAA 4F8RA 1L5UA 2IOHA 2ATLA 3WK4A 2EQYA 3WFRE 5J2KA 5HR7A 5GTHU 2OXOA 1RQLA 2G5HB 2W9CB 4ED2A 5KTQA 3DDHA 4RT3A 3H8MA 3RJFA 3L4PA 4YMMA 5HHHA 5ALDA 4C7ZA 2AGQA 4WC4A 2OHFA 5E79U 4AT7B 3WKAA 2ZIWA 4QZ8A 2BQ3A 1Z3EB 4RT2A 4BGDA 3WFSC 3MR2A 1DRGA 4EEBA 3NRZA 4JLXA 7ICNA 5CHGA 4OD0A 5DLFA 1Z4OA 1N60A 4DLEA 4UB2A 4ACOA 5ALIA 4B6JA 1ZQUA 2DGZA 2KJ5A 1S5LU 1IG6A 3UMCA 4RQ6A 1NK8A 3MFIA 3AQNA 3NUQA 2ESEA 4UB1A 2K4IA 4F91B 1ZETA 2P66A 3KKAC 4EEDA 3H0MB 2AXTU 4YVZA 2HHVA 8ICSA 3AM9A 4KB6A 1KTQA 3CP8A 5CA7A 2DF4B 4DL2A 4I0UA 2BPGA 4ECXA 4EX7A 4Q43A 1D8LA 2I6XA 1TE2A 5KG7A 2BR0A 3V6HA 5CFTA 5AM2A 1COOA 3SQIA 5D49A 2F77X 4J9MA 3NVZA 3M8SA 3K1RB 1LKYA 3QUBA 3PX4A 4I2FA 2J6UA 3TQ1A 4IC9A 1OW5A 4P0QA 3SV3A 4C8OA 2B4VA 1L7PA 5D46A 2MRLA 8ICIA 5IIMA 2J6SA 1JMSA 1ZOLA 2H3VA 3C1YA 3TADA 4FBTA 3WK9A 4ECYA 5B5EU 2F1IA 5KFKA 2RDIA 1ZQMA 4FO6A 3IRUA 4JV0A 4TURA 3O0FA 9ICTA 2JEIA 4DOCA 4J9LA 2FMPA 5KFIA 5ALQA 2XCAA 4K9BA 2IUBA 5KFGA 1KFDA 3L3FX 4KLOA 4U7CA 5DLGA 9ICVA 3HRDD 1ZJNA 1MIYA 2QB0A 1NK5A 2XVTA 5DQHA 5L1LA 4DFJA 2CXYA 2ES6A 4PZNA 1HUZA 4LEVA 4UBCA 1U45A 5KFFA 4DL6A 2BBHA 1LV5A 4PHDA 3UXNA 1ZQBA 3ORYA 3RB4A 1YT3A 4HYKA 1OU5A 5J0OA 4FBUA 4O5CA 4K99A 4PL2A 4OO1J 2HDOA 1Q79A 2P6RA 4YN4A 1YZ7A 1N62A 2IHOA 2JZBA 1BPYA 4QZCA 2ZH2A 1KL9A 7ICIA 1JALA 4E8FA 7ICPA 3QU4A 2KIVA 2K8AA 3GV8B 4ECUA 3NVVA 1Q8KA 9ICSA 1M6YA 3E58A 5J0XA 4RQ8A 2DPIA 4Z6CA 2B51A 3OHBA 4Y2UA 8ICWA 3THVA 1B0XA 1URJA 1MQ2A 4DQIA 4NXUA 1QCKA 3MBYA 1RPLA 5HMLA 5JTGA 4ATBB 3NASA 1QSSA 2R8JA 4IR1A 3LWLA 2BCSA 4B9NA 8ICOA 5AK6A 3KZIU 4UD4A 5DQGA 3H0RB 5J8YC 3GFKB 1JXEA 2V9WA 4X4TA 3SMVA 1PK1A 1V38A 2AH5A 3AU2A 2KJ9A 1R8BA 2R8HA 2JMGA 1ZD3A 4M9GA 4FZLA 5KG5A 1Y88A 1J2MA 4C0ZA 4KLMA 3RR8A 5EE1A 1L8OA 2ZUCA 1NO5A 2EAOA 4DL5A 4NY8A 3OUYB 3H0LB 2F8KA 1S77D 1COKA 7ICLA 2HHUA 5BOMA 4WBZA 3EPIA 2VANA 1WWUA 3SAGA 2RRDA 3PMLA 3SAHA 4BJQA 4O0IA 2KE7A 4US9A 2ZIVB 1GO3F 1VFGA 2E8NA 3I1YA 3H7IA 2DR5A 5D4BA 4KM5A 3F2BA 5IILA 7ICQA 2KFZA 4NKUA 4E7XA 4OAHA 3H38A 2HCFA 1SV0C 3RB6A 3UXOA 1L8LA 1TK8A 1QTMA 4M2YA 3KHLA 2ODGA 5EE3A 5H2FU 2ZJAA 1VJ7A 4DQPA 2KHQA 2OM6A 5KFTA 4FHVA 3BZCA 4JWNA 1SKRA 1DGJA 4DFKA 2D6FC 3H4DA 1SXEA 4IL6U 2EAMA 4ELUA 2FI1A 4IQUA 3RJJA 5HR9A 2LMRA 2K89A 1BNPA 3Q8MA 4KLQA 4AT9B 2GOLA 3C2KA 1U9LA 4P0PA 4I2IA 1NK6A 3OV7A 2PBEA 4UB8U 7ICSA 3D6JA 2IHMA 1JIHA 4EX6A 2FDRA 2HMXA 3NWIA 3PX6A 1LB2B 2ZIUA 1NJZA 3NTUA 4RZRA 4EBJA 3WKBA 2UVUA 4ZH4A 5AKHA 2KNJA 3B0XA 9ICUA 3HJ4A 1WCLA 3EUB2 1Q46A 3SAFA 1XSLA 3V72A 1IV8A 1P7DA 4ELVA 4KLJA 3TFRA 1S0MA 2WB1C 4O69A 4EP7A 2R8GA 1V85A 5C5JA 4Y2JA 4UQGA 1H38A 4C8NA 4WCWA 1TV9A 4PHPA 1UPHA 5KG1A 4EELA 4O9MA 4I28A 5B66U 1QQ6A 2ZIWB 1D9FA 5KFRA 2A1JA 3LQCB 2FLNA 7ICMA 2XI9A 1L3VA 2E5SA 3T5LA 5KT7A 2ZXIA 4UW9A 3JPRA 5DGBA 2V4QA 1NI3A 4KITB 1B22A 4UB5A 3MGHA 4DL3A 2AHOB 3ISCA 4X4QA 2ZH8A 4Z6EA 4P4PA 1RXWA 2L5YA 4RPZA 1HJPA 2BGWA 4WH5A 4XUSA 3M1YA 1ZQHA 4K97A 1OXJA 2HOFA 4MFCA 5HR6A 4QZAA 3M6ZA 4RWPA 3RJGA 3TI0A 4FO1A 2Q4TA 3QUTA 4Q45A 3NVWA 2DVIA 4ECSA 2HN2A 2IBKA 1D9DA 2GWSA 3MABA 1TAQA 1RXVA 3KHHA 4J9QA 5HMMA 4GC7A 4GC6A 4X5VA 4BXOB 3MR3A 4I29A 3QUCA 2HOIA 2FPLA 4R8UA 4Z6FA 1TKDA 2ZHBA 4F5RA 4C4TA 5DDMA 5KFWA 2GA9D 1K1QA 4DOBA 4FFDA 3GIIA 4GXJA 4FE3A 4YMOA 5AI5A 5ALNA 4N7RA 5F3XB 2KN7A 3RR7A 5JUMA 4YD1A 1N48A 1LKYB 1TFRA 2KK0A 2KV2A 5KT3A 5J2EA 2NRWA 3G6VA 3N97B 1ZQKA 4GXIA 1JROA 5D61A 3TARA 1AQ6A 4YP3A 2CPRA 2KZ3A 2XICA 3IG5A 4A8EA 1DK3A 5IIJA 2OCEA 5AKEA 4WC5A 3DV9A 3OHAA 2KSOA 4KMUA 2OWOA 2M2VA 4QZFA 5AI9A 4K4HA 1Q3UA 4RNNA 2ZJ8A 4DQQA 1AROP 3Q8RB 1NOMA 2WF9A 4IRCA 2JXJA 2LHTA 4NLKA 2Q0ZX 3N28A 1TK5A 1JN3A 4KN4A 1JAJA 2WB1F 2YMMA 4EENA 5C0YA 2XGPA 2QB0B 2G06A 3SZ2A 4EBEA 4OJOA 1TFYA 8ICHA 3QU5A 4RQ2A 3RJIA 1SL2A 3F2DA 3GIMA 3PNCA 3T79A 7ICUA 3AUOA 5KFEA 1XU4A 1WUDA 3C28A 5KT2A 3M9OB 5KFVA 1DOQA 2JEJA 3NVOA 2LM4A 5K4LA 2JZBB 4Y2TA 1KLNA 3KHRA 5J2HA 3D2QA 5KG0A 4EBDA 1PX5A 1ECWA 3RRGA 1T4GA 3RB3A 3AQEA 4Y2QA 5CJ7A 3UPSA 4B9LA 4TQSA 1TK0A 1S9FA 1ZQTA 3RAXA 1NJYA 3ICXA 4O3RA 1UT5A 5L1MA 1NJWA 2BBJA 2DR8A 3PW0A 4DSJA 2HOQA 1PUZA 5KAIU 4F2SA 2PFPA 3OJSA 2N1RA 4E80A 5EE9A 3PR5B 1X9SA 4X4SA 2WF5A 1CI4A 2BHNA 1QSLA 3CNHA 2LBOA 3PMNA 1PK1B 2JH1A 1F0MA 2EWRA 3RBDA 5AK5A 2GH1A 3M8RA 4LT6A 3T5KA 2LPEA 5F9LA 1DK2A 4DSKA 2OEHA 2WF7A 2W8LA 3RH6A 5HHIA 2OH2A 3HP6A 3EW9A 3B0YA 2ZUBA 3CYMA 2RQ5A 3NS1A 1L7OA 5KG2A 3LK9A 9ICRA 4HX0A 3EYZA 5JTIA 1BGXT 2QARA 2VJ5A 1BPBA 5J2BA 1U47A 4Q8FA 2OYYA 3ZD8A 1MA7A 2FLPA 3Q8SB 2NRVA 9ICCA 4MFAA 3N4MB 4ECZA 4P4MA 1Z1BA 4C80A 3F2CA 8ICRA 3PZPA 3ONNA 1L7MA 1S8OA 3PW4A 3ZI4A 4TUSA 2W9AA 2YX8A 5KG6A 4P0PB 1UHUA 3VCBA 2ASJA 2H5XA 4EBKA 1RYSA 2O1PA 2B21A 4BWJA 5ALOA 1ZD4A 1RDFA 5KG3A 8ICEA 3HPOA 2JGAA 4PZOA 4WC3A 2B0CA 4Y2PA 5KNIA 4GIBA 2MA1A 4IG8A 3PSIA 5J29A 3FDSA 2BDPA 5CWRA 4F4ZA 4K9AA 5AI4A 2C2EA 4RUCA 4IR9A 2DWQA 3IM1A 3M9MB 3AN1A 2ZIUB 5HREA 1NNLA 5AKYA 4J03A 3RTVA 4J9NA 5HRGA 3L9DA 4X4OA 4NLGA 4J9OA 4MF2A 2GO7A 4QZ9A 3UMGA 3UXPA 3SYZA 2E8MA 4JUZA 2V4RA 4IQWA 4DCCA 3JCFA 5AKJA 4J9SA 1O08A 3V7KA 4BDPA 2MAXA 5KFDA 3RH5A 5ALFA 1B43A 3C21A 2A1JB 1ZRNA 4ED0A 1Z1VA 5IIOA 4MF8A 4KTQA 1BNOA 3L5KA 4RPYA 5G5GA 4KLEA 5EWFA 3HW8A 5CR0A 4F5QA 3PX0A 3EF2A 1NK0A 1SKSA 2QKQA 5FP0A 5TISU 2I5HA 5J2AA 2Y1JA 2YQEA 3ALRA 5EE0A 4UAVA 1XNSA 8ICKA 1JUDA 4MHVA 3IN5A 5ALGA 2EZZA 1N63A 5CP2A 2Y0SC 4DFMA 4FH5A 4ED7A 1BVSA 3Q8LA 2JEGA 4OAFA 3JPSA 2LYHA 4DLGA 2VA2A 4LEWA 1A77A 3F53A 2G0AA 3KKAA 5D63A 1B4FA 2M9NA 5HC9A 4EZ6A 2LYBA 4F5PA 1X6JA 2W04A 3HJ1A 4B9TA 4Y2RA 4ECVA 1XO1A 5KFBA 2EZYA 4UAUA 2XIDA 2H3ZA 2LYAA 4K8VA 3BQ0A 2ZIXB 4YXMA 3I76A 2B56A 2PFQA 4DQRA 4RNOA 2NYVA 2PMZC 4F92B 3OGUA 2F1JA 1TAUA 5HRKA 3NVYA 2XC9A 5J0SA 2W7OA 3IDWA 2KSOB 4UD5A 4EYIB 1S10A 4DEZA 3HX0A 4F2RA 4OJPA 2KKVA 1U49A 9ICBA 4QZDA 4M5DA 3QU9A 1JXLA 4WBYA 3OJUA 1X9WA 2XCPA 2Y9TA 4PGXA 5AI8A 5ALZA 3F5EA 5ALSA 3QE9Y 5HRHA 3RBEA 4RNMA 2ZTDA 5DB9A 2KMDA 7ICFA 1JQRA 3JZ0A 2WAQF 3SEIA 3PO4A 1KBUA 2VJ4A 2KJ8A 4MEXA 1ZQYA 3KFUF 3AEVA 3QX7A 2HHTA 3PR4A 1UA1A 1YZ6A 5DKWA 1PVRA 3RFAA 2Y9UA 3C66A 1ZQCA 4ECTA 4GLXA 2HHWA 2E8OA 1XWLA 5KL8B 4DS5A 1UETA 3SENA 3WKEA 2W9CA 4AYBC 4NXWA 5ALHA 5J2FA 4B9UA 5L1JA 4JB3A 1ZRMA 3LWMA 5EOZA 1UEVA 1ZQLA 3G6XA 2YY6A 4US8A 1J97A 5ALWA 5KFSA 5ALXA 2E1EA 4NLZA 4AT7A 2JHDA 3ETRA 1ZD2P 4DSFA 4O5KA 5AK3A 2Y0SF 2QB1A 4YQWA 1SL1A 4R63A 2WHEA 5KT4A 2AQ4A 5HNKA 2G09A 4DF4A 1HEKA 4O3OA 5ALPA 2W3SA 1FA0A 5KT5A 2KD1A 4OJ5A 5J0WA 2ISPA 2O5AA 3C29A 3F5AA 2R18A 3PO5A 2K4PA 2NRZA 1K5OA 2K60A 2DRBA 3D2NA 2NV3A 1ZYQA 3BJYA 4PJ0U 1VJ5A 4KLUA 1WCNA 1NZBA 5DECA 3OVSA 1RM6C 2BPFA 8ICTA 1QQ7A 4AP9A 1S0VA 3LVWA 2KVSA 4DO9A 4WJ3B 2EAPA 4YXJA 9ICXA 1NK4A 3NYBA 5F2VO 7ICKA 4ICAA 5J8YA 3H8SA 3GV5B 4F4KA 4JK1A 1PVPA 5ALYA 4R66A 1F44A 4ED6A 3PVXA 4R65A 4DL7A 3RJEA 5DQIA 2W3RA 2YMQA 4YMNA 2BDUA 1UT8A 2MUTA 4F4YA 4O5EA 3K4GA 1PK3A 1NKCA 3MDAA 2UVVA 3BS5A 2PMZF 4NLNA 3PV8A 3PY8A 2PI4A 3AQLA 1F5AA 1X6IA 2XY7A 3SV4A 5KFOA 2ZH1A 4KLSA 2BPCA 4J9RA 5AKXA 1WWVA 3LVVA 3GIKA 3WU2U 2FE9A 1EXNA 1NKEA 4AT8A 2QARB 3JPQA 2RDJA 4ED8A 2E1FA 3ISDA 8ICNA 5B3QA 4NXXA 1KFSA 1BPXA 4UAYA 5HP4A 2PKEA 3GQCA 2I9GA 3ZD9A 4BX9C 3PW5A 5KT6A 3FYHA 4F4WA 4YCXA 2AJQA 4M47A 4DS4A 4O3NA 4OCZA 4M9JA 3BS7A 4PGQA 1ZQFA 3WK7A 3C5GA 5CHEA 3I28A 2WTFA 4EBCA 2AU0A 3BQ1A 5DG9A 4FS1A 3V7JA 3M6KA 2ZH5A 3CK6A 1R8CA 2YTUA 1N56A 5AHXA 4DFPA 4AYBF 2VA3A 4QJFB 5AIBA 4CCHA 3QEAZ 2WF6A 2ZTCA 4QW9A 4UB6U 2ID1A 1X66A 2IOFK 4Z6DA 5J2JA 2W54A 2FMSA 4X4RA 7ICGA 3DEEA 4BUGA 3PSTA 5DB7A 2ZH6A 5ALUA 9ICJA 1Z19A 1NK7A 2M0NA 3BQ7A 1SIJA 2XY6A 3PW7A 4DFDA 4K4GA 4TUQA 1N2XA 5ALVA 4P0QB 5AKGA 2HVHA 2EH9A 1OUQA 1N5WA 2W9BA 1PVQA 4ECWA 3BZKA 4TUPA 2BCVA 3R9KA 4XQ7A 1VLBA 3BDPA 1JX4A 9ICFA 4WQKA 2A3VA 3E0FA 3HT3A 4QWEA 2ZH7A 5B3PA 1WYGA 5KFHA 8ICVA 9ICQA 4ATBA 2HHSA 4NLBA 2ZJ5A 3IV6A 2IMWP 1MC8A 4NL9A 1CEZA 7ICOA 4WOYA 1MIVA 2HHPA 4NXTA 4I2JA 2BZFA 1IIPA 5J0YA 1ZD5A 4F93B 2DKZA 1ZQOA 3PW2A 5J2IA 4J9PA 2Q66A 1KW4A 3OSPA 4CRXA 4CDGA 2HBJA 4UAWA 3TAPA 1QH9A 1XS9D 2DQNB 1O03A 4F50A 1RG6A 5ALTA 1UA0A 3G6YA 4EEKA 4PL1A 3QXGA 8ICQA 2J6TA 2M2WA 2W8KA 1D8BA 4IRKA 2HN1A 3ISBA 2K8CB 2HVIA 4RQ0A 4YG2A 1CRXA 1KSPA 4CF4A 4DSLA 4KLLA 8ICUA 3UMBA 3D2SA 4O6AA 5CB1A 5J0PA 4EYHB 1ED1A 1N5XA 4K4IA 2YN4A 4C4SA 4M9HA 2HBLA 4C8MA 1SZPA 4CE6A 3Q8KA 1R8AA 2QLTA 4MKPA 5ALRA 4PPXA 5DGAA 1VDVA 4F72A 2AQ0A 4I2CA 2PXIA 1MSWD 3WFPA 3ER8C 4HAIA 1ZQPA 4USAA 5KFZA 2F8LA 3MR5A 3SI8A 3IP4B 3PHZA 2D3DA 2KEYA 2AGPA 4ED3A 2H3QA 4X0AA 1ZQDA 9ICNA 2BQRA 5KFPA 1SL0A 2G07A 1V97A 4EZ9A 4O68A 1ZQNA 3QU2A 2JRZA 4KN7A 5G5HA 2JH7A 8ICFA 2FMQA 1FO4A 5KFMA 4YD2A 2W7PA 3M7DA 5KFAA 4P4OA 5HRDA 4FHPA 1XC9A 4KX5A 3PSPA 4UB3A 2FLLA 3QYPA 9ICEA 4CF3A 1SV4A 5DEDA 2DRAA 1CUKA 4PH5A 4O3PA 2YMLA 5J2DA 2Z7JA 4BWMA 2FPMA 1YLQA 2WFAA 4X4UA 4CGZA 3AL0B 2G08A 4X0BA 3TADC 2MSNA 2DKXA 5AI6A 4WC2A 3OWGA 1RYUA 2G5IB 1RYRA 5J0TA 2C2RA 4NM2A 1NJXA 4RQNA 2YMPA 4I2EA 2HSZA 3EWAA 1JI7A 5KG4A 1A76A 9ICHA 2M2UA 2EANA 5L9XA 3QNMA 5AKKA 4DSEA 3C23A 1TAMA 5L1KA 4QZGA 2HW3A 4UAZA 1BPEA 2ZXHA 2BCUA 7ICHA 4F71A 2ASDA 2DFLA 2CN1A 2PFNA 2ZH4A 1LVHA 4NLCA 1XO0A 1QQ5A 5DB6A 2C2DA 1C7YA 1ZQRA 4QZHA 1IXRA 2RP5A 4PHEA 3FAHA 4WC0A 1KN5A 2F76X 2HHQA 2D8CA 4Y2XA 3RJKA 9ICAA 2KZMA 3H39A 5AKLA 4BXOA 4TQRA 4C4RA 5CFUA 2MUTB 5F9NA 3Q8QB 4X4PA 2ZHAA 5J0UA 3BS5B 4Q44A 4LEZA 4IS7A 2M2TA 3Q8PB 3CRXA 4UARA 1F5SA 3GDXA 1S0OA 2WAQC 2VA8A 4G9BA 2NO4A 4GXKA 1A0PA 1ZQIA 2EDUA 2GLEA 4M04A 5KFLA 4OJLA 3KHGA 3MR6A 3H3AA 3OTQA 4B9MA 1Q3VA 4LVSA 4AT8B 1HUOA 4RWNA 4M6WA 5DDYA 1SWWA 3GILA 4O3QA 2FPKA 1ZJMA 2W9MA 3KD3A 2FJ6A 2E8PA 4XJEA 3HKZF 1XSPA 4FHWA 1T94A 4NJ8A 5AM4A 1BPZA 4UATA 4QWDA 3C2LA 4KLFA 4YR3A 5DBCA 3JPNA 5AKZA 4LZGA 3AU6A 4MFFA 3UQ0A 3J81j 4B9VA 1ZQGA 2ZH9A 2W11A 2P6UA 4RQ5A 1SXDA 4PGYA 2BCQA 4DOAA 1XSNA 2HHXA 3H40A 1Z4NA 1KDHA 2K8BB 3N7SC 2CRXA 5T14A 1NK9A 1RZTA 3MCRA 3TKAA 5DBBA 3RF9A 3H8WA 2F44A 3MGVA 2W55A 2YB4A 4WC6A 4FH3A 4JMUA 2DBYA 2MU2A 4NM1A 4WC7A 2VKQA 1TVAA 4R8UB 3H4BA 1U48A 1Q78A 1ZXIA 4QWAA 3RB0A 2Y1IA 4B9SA 2IHNA 2R8IA 2XGQA 3QEBZ 5CRXA 1S0NA 3SR6A 4CF5A 4RQ3A 5JRTA 4KLTA 3E2EA 2F1HA 4I2DA 8ICJA 7ICRA 1SGGA 3AQKA 3KZXA 2W9BB 4I27A 3ERCC 9ICIA 9ICKA 1Z00A 5IIKA 5DB8A 2H3FA 3KTQA 3H37A 3TACB 4DL4A 1X9XA
chains in the Genus database with same CATH topology
2P66A 1NKEA 4AT8A 4YVZA 2HHVA 3JPQA 2RDJA 3PNCA 4ED8A 3M9NB 3ISDA 8ICNA 2C28A 7ICUA 1KFSA 3AUOA 8ICSA 1BPXA 4UAYA 5HP4A 5KFEA 4ECRA 1XU4A 1KTQA 2RFFA 5CA7A 3GQCA 5KT2A 4DL2A 2I9GA 3ZD9A 3M9OB 5KFVA 3PW5A 5KT6A 1S97A 1DOQA 2JEJA 3FYHA 4F4WA 4YCXA 3V6JA 4M47A 2AJQA 4DS4A 4O3NA 2JZBB 4FS2A 4ECXA 2BPGA 5HRIA 5KFJA 4Q43A 1D8LA 1ZQAA 3KHRA 5J2HA 5KG7A 1T8EA 1KLNA 1T7PA 2BR0A 5KG0A 4M9JA 4EBDA 1PX5A 3V6HA 2DPJA 4PGQA 1ZQFA 4LZDA 3JPPA 3RRGA 1T4GA 4KLHA 3RB3A 3C5GA 3JYYA 5BPCA 4QWBA 5KFXA 5CJ7A 3HIYA 1COOA 2WTFA 4RU9A 5D49A 3UPSA 3ZDCA 4EBCA 2AU0A 4J9MA 3BQ1A 5DG9A 4TQSA 1TK0A 4B9LA 8ICLA 4FS1A 4YR2A 3M8SA 3V7JA 1S9FA 1ZQTA 3RAXA 1NJYA 2ZH5A 4O3RA 1R8CA 1UT5A 4RQ7A 4NKTA 3PX4A 4I2FA 1N56A 2J6UA 3BQTA 4DFPA 4UB4A 3V6KA 1NJWA 1ZQJA 2DR8A 4YR0A 3TQ1A 4O5KA 2VA3A 4F3OA 5EWGA 3SV3A 3PW0A 4C8OA 4DSJA 5D46A 2ASLA 4F2SA 3UPQA 4CCHA 8ICIA 5IIMA 3QEAZ 2ZTCA 4QW9A 2J6SA 5DG8A 4X4VA 2PFPA 1JMSA 2ID1A 3OJSA 3C1YA 4E80A 4FBTA 4I2HA 4Z6DA 4ECYA 1MQ3A 3PR5B 5J2JA 3NGDA 1X9SA 4X4SA 2F1IA 5KFKA 2RDIA 2FMSA 3MGIA 1ZQMA 4X4RA 2BHNA 4F4XA 4FO6A 1QSLA 4JV0A 7ICGA 5DB7A 3PMNA 2BCRA 4TURA 4C8KA 2ZH6A 3QZ7A 9ICJA 9ICTA 1NK7A 2JEIA 4DOCA 4J9LA 2FMPA 5HRLA 8ICAA 3MFHA 5KFIA 3RBDA 2XCAA 3M8RA 4F5NA 3ZDEA 2XY6A 7ICVA 3PW7A 4LT6A 3T5KA 5F9LA 1DK2A 4DSKA 5KFGA 4K4GA 1KFDA 2KFNA 4TUQA 4KLOA 3WFQE 2W8LA 3MDCA 4XRHA 5J0RA 2R8KA 3RH6A 2HVHA 5HHIA 2KP7A 2W9BA 5DLGA 4RQ4A 3IHQB 9ICVA 4ECWA 1ZJNA 1NZPA 1MIYA 3HP6A 4TUPA 1NK5A 5L1LA 5DQHA 4DFJA 2BCVA 2ZUDA 5IIIA 3EW9A 3B0YA 4O3SA 2ZUBA 4XQ7A 1HUZA 4X4NA 2C22A 1U4BA 2NRTA 4UBCA 3LDAA 3BDPA 1U45A 1JX4A 5KFFA 3AQMA 9ICFA 4DL6A 3LK9A 5KG2A 1LV5A 9ICRA 3HT3A 3EYZA 4R64A 4PHDA 3UXNA 4QWEA 2ZH7A 1ZQBA 1BGXT 3ORYA 3RB4A 4I2AA 5KFHA 4HYKA 8ICVA 1OU5A 5J0OA 4FBUA 2HHSA 1BPBA 4O5CA 9ICQA 1S76D 2ZJ5A 5DG7A 5J2BA 4M9NA 1U47A 4Q8FA 2IMWP 1MC8A 3ZD8A 1Q79A 1CEZA 2FLPA 4M9LA 7ICOA 2P6RA 1MIVA 3Q8SB 2NRVA 4YN4A 2HHPA 9ICCA 2JZBA 4MFAA 3OSNA 4ECQA 4I2JA 3N4MB 4ECZA 4QZCA 4P4MA 1BPYA 4P2HA 1UEUA 2ZH2A 7ICIA 3GIJA 4E8FA 5J0YA 4F93B 3ETLA 2PI5A 7ICPA 8ICRA 1ZQOA 3PW2A 3GV8B 1L3SA 4ECUA 4M0AA 5J2IA 4J9PA 4FHYA 2DR9A 4S3NA 2Q66A 3OSPA 9ICSA 3PW4A 5J0XA 4RQ8A 2DPIA 4UAWA 3TAPA 4TUSA 4I2GA 4MEYA 4Z6CA 4IRDA 3OHBA 9ICWA 4ATBA 4ELTA 2W9AA 8ICWA 5KG6A 3BQ2A 3THVA 1XS9D 2XY5A 1MQ2A 4DQIA 4F50A 2ASJA 2H5XA 4EBKA 1UA0A 1QLNA 3G6YA 1R89A 1RYSA 8ICQA 3MBYA 1RPLA 2J6TA 2B21A 2O1PA 5HMLA 4BWJA 4ATBB 2M2WA 3TAQA 2W8KA 4PHAA 4IQTA 4I2BA 4IRKA 1QSSA 5KG3A 5J2GA 2R8JA 3ISBA 4F5OA 4IR1A 3HPOA 3LWLA 4JV2A 4RQ0A 2BCSA 8ICEA 4B9NA 2HVIA 8ICOA 1WOTA 4YG2A 4WC3A 1KSPA 2ALZA 4RPXA 4UD4A 5DQGA 4DSLA 4KLLA 4IG8A 8ICXA 8ICUA 5J29A 3FDSA 3GFKB 2BDPA 1JXEA 2V9WA 5CWRA 4C8LA 4X4TA 4F4ZA 5CB1A 4WC1A 5J0PA 4EYHB 2C2EA 5HRFA 2AGOA 2KTQA 3AU2A 4K4IA 4RUCA 1D8YA 4IR9A 4QZEA 2R8HA 9ICMA 4M9HA 1R8BA 3IM1A 4J9KA 3M9MB 4C8MA 1SZPA 3Q8KA 4M9GA 1R8AA 5KG5A 5HRBA 1Y88A 2KZZA 5HREA 1NKBA 1DGSA 4KLMA 2UVRA 4QZIA 5KFQA 3RTVA 3RR8A 7ICJA 3RH4A 4J9NA 3OUYB 2ZUCA 4QWCA 5HRGA 4DL5A 4NY8A 8ICYA 1NO5A 2ZH3A 3L9DA 4X4OA 4PPXA 5DGAA 4KLDA 4NLGA 1S77D 7ICLA 4J9OA 2AQ0A 4I2CA 1L3UA 2PXIA 4MF2A 2HHUA 4DF8A 5BOMA 4WBZA 3EPIA 4KLIA 2VANA 1MSWD 4QZ9A 3WFPA 3UXPA 3SYZA 1ZQPA 3PMLA 4JUZA 2V4RA 4O0IA 5KFZA 4IQWA 3MR5A 4J9SA 3SI8A 8ICPA 4EEYA 4RWOA 1VFGA 2I1QA 3H7IA 2DR5A 3V7KA 5D4BA 3HWTA 4JWMA 4DWIA 5IILA 7ICQA 4BDPA 2AGPA 2KFZA 2MAXA 3K75D 4NKUA 5KFDA 3C1ZA 3T5HA 3RH5A 7ICEA 4E7XA 9ICOA 4G3IA 1B43A 3C21A 4ED3A 2A1JB 3H38A 4ED0A 4X0AA 1ZQDA 9ICNA 4JV1A 3RB6A 5KFPA 2BQRA 3UXOA 5IIOA 4MF8A 1SL0A 4KTQA 5KFNA 1TK8A 1ZQEA 1QTMA 4EZ9A 3C18A 4M2YA 1BNOA 3KHLA 4RPYA 1ZQNA 4KN7A 1VJ7A 2ZJAA 4KLEA 5EWFA 4DQPA 3HW8A 5KFTA 3C2MA 4FHVA 4JWNA 8ICFA 5CR0A 1IM4A 4F5QA 3PX0A 1SKRA 2FMQA 1NK0A 1SKSA 4QZBA 3UQ2A 5J2AA 5KFMA 4DFKA 4YD2A 3H4DA 2Y1JA 4E0DA 5KFAA 4P4OA 1QSYA 5HRDA 3V7LA 4ELUA 4FHPA 4IQUA 8ICKA 3RJJA 5HR9A 1T3NA 1XC9A 1ZQQA 3H8JA 5KFUA 5CP2A 3RJHA 4ED1A 1BNPA 4UB3A 3Q8MA 2FLLA 4KLQA 9ICEA 4AT9B 1SKWA 3ZDDA 4DFMA 3C2KA 2PFOA 2NRXA 4FH5A 1U9LA 4ED7A 5DEDA 1BVSA 3Q8LA 2JEGA 2DRAA 1CUKA 1MIWA 3JPSA 2LYHA 4I2IA 4PH5A 4DLGA 4QW8A 2VA2A 3T5JA 1V4AA 1A77A 1NK6A 4O3PA 3ZDBA 5J2DA 4M6WB 4BWMA 2FPMA 1BPDA 4DQSA 1YLQA 2PBEA 3OV7A 7ICSA 2M9NA 2BE3A 4X4UA 5BOLA 4X0BA 4FHXA 5EWEA 5KFCA 1ZQVA 4XQ8A 4WC2A 4EZ6A 5HC9A 4F5PA 2IHMA 4RWQA 3OVAA 1RYRA 1JIHA 5J0TA 2C2RA 3HJ1A 4B9TA 4NM2A 1TFWA 1NJXA 4ECVA 1XO1A 5KFBA 4I2EA 5TZVA 3EWAA 4YFKA 3EPGA 3T3FA 3PX6A 5KG4A 3OVBA 4XA5A 3C5FA 1L3TA 1LB2B 1A76A 3QZ8A 9ICHA 2M2UA 1NJZA 5L9XA 3NTUA 4RZRA 2XO7A 3BQ0A 4EBJA 2UVUA 4YXMA 4ZH4A 3OUYA 4DSEA 3B0XA 9ICUA 3HJ4A 1WCLA 3C23A 5L1KA 4QZGA 2PFQA 4DQRA 4RQ1A 9ICPA 2NRKA 1XSLA 4RNOA 2BKEA 3RRHA 3V72A 3WFOA 4ELVA 4KLJA 2HW3A 3TFRA 1S0MA 4UAZA 4EP7A 1BPEA 2BCUA 2R8GA 8ICGA 7ICHA 4F92B 3OGUA 2ASDA 3JPOA 2DFLA 2F1JA 3GV7B 5C5JA 2PFNA 1TAUA 5HRKA 2ZH4A 4UQGA 2XC9A 3JPTA 1H38A 3ZDAA 7ICTA 1KNYA 4C8NA 1ZQSA 5DB6A 4WCWA 2UVWA 5J0SA 2C2DA 4Q8EA 1TV9A 4PHPA 4EYIB 1S10A 4DEZA 5KG1A 1C7YA 4QZHA 1V9PA 1IXRA 3HX0A 1KRPA 4F2RA 4I28A 4O9MA 4PHEA 5J2CA 4WC0A 1D9FA 5KFRA 1U49A 2ZTEA 2A1JA 4QZDA 2HHQA 9ICBA 3LQCB 4M5DA 8ICCA 2FLNA 5J0QA 7ICMA 3RJKA 1JXLA 1L3VA 9ICAA 2KZMA 3H39A 4WBYA 3OJUA 1X9WA 4NXZA 4DSIA 2XCPA 4PGXA 3T5LA 5KT7A 3QE9Y 5HRHA 3RBEA 4BXOA 4TQRA 5DGBA 4RNMA 3JPRA 2V4QA 2MUTB 2ZTDA 4KITB 1ZQZA 5F9NA 5DB9A 3Q8QB 2HHXA 4X4PA 4UBBA 3TFSA 7ICFA 1B22A 1JQRA 5J0UA 5DBAA 4UB5A 3MGHA 4DL3A 1X9MA 3JZ0A 3ISCA 2ZHAA 4Q44A 3EZ5A 4X4QA 8ICZA 2ZH8A 4Z6EA 4P4PA 3PO4A 9ICGA 3RAQA 1RXWA 3Q8PB 4RPZA 4MEXA 1HJPA 2BGWA 2M2TA 2DR7A 4XUSA 3GDXA 1K1SA 1S0OA 1ZQYA 2VA8A 1ZQHA 1ZQWA 2HHTA 1Z00B 3PR4A 1UA1A 4GXKA 4MFCA 5DKWA 4QZAA 1ZQIA 4AT9A 4RWPA 4MFFA 1ZQRA 2BQUA 4M04A 3RJGA 5KFLA 3C66A 3TI0A 1ZQCA 3KHGA 4ECTA 3MR6A 3TANA 3H3AA 4Q45A 4GLXA 2HHWA 2DVIA 4ECSA 4AT8B 1XWLA 4DS5A 1D9DA 2IBKA 1HUOA 4B9MA 4LVSA 4M6WA 1KFTA 1UETA 5DDYA 4RWNA 3GILA 2W9CA 2GWSA 3MABA 1TAQA 5J2FA 1RXVA 4O3QA 4B9UA 2FPKA 3KHHA 4J9QA 9ICLA 5L1IA 5KFYA 5L1JA 1ZJMA 2ISOA 5IINA 2W9MA 3LWMA 5HMMA 5EOZA 4GC7A 4GC6A 4X5VA 1UEVA 1KEJA 1ZQLA 4BXOB 3G6XA 3MR3A 4I29A 2JEFA 8ICMA 2FPLA 1XSPA 4FHWA 4R8UA 1BPZA 4Z6FA 4QWDA 5KFSA 1TKDA 4NLZA 3C2LA 8ICBA 2ZHBA 4F5RA 1ZQXA 4KLFA 4AT7A 4IQVA 5KFWA 5DDMA 5DBCA 4YR3A 1K1QA 3JPNA 4DSFA 3AU6A 4LZGA 4YQWA 3UQ0A 1SL1A 4DOBA 4R63A 1ZQGA 5KT4A 2AQ4A 3GIIA 5HNKA 4GXJA 4B9VA 4DF4A 1PZNA 1X2IA 4YMOA 2IA6A 4O3OA 4KLGA 2ZH9A 2P6UA 4RQ5A 4PGYA 2BCQA 1FA0A 2KN7A 4DOAA 3RR7A 5KT5A 5JUMA 3H40A 5J0WA 4YD1A 1XSNA 4RUAA 1N48A 1KDHA 1L5UA 2ISPA 4F8RA 1TFRA 2O5AA 2ATLA 5KT3A 1NK9A 3PO5A 2NRZA 3WFRE 1RZTA 5J2KA 5J2EA 5DBBA 2NRWA 2DRBA 3G6VA 3N97B 1ZYQA 3BJYA 1ZQKA 3H8WA 2W9CB 4GXIA 4ED2A 5KTQA 4KLUA 1WCNA 4RT3A 5DECA 4WC6A 3OVSA 4FH3A 3TARA 4YP3A 2KZ3A 2BPFA 4NM1A 4WC7A 8ICTA 3RJFA 5IIJA 1DK3A 4YMMA 5HHHA 4WC5A 1TVAA 1S0VA 3OHAA 4R8UB 2AGQA 3H4BA 1U48A 4WC4A 4DO9A 4YXJA 4KMUA 1Q78A 2OWOA 2M2VA 9ICXA 1NK4A 3NYBA 4AT7B 5F2VO 4QZFA 7ICKA 4QWAA 4K4HA 3H8SA 3GV5B 4F4KA 4JK1A 3RB0A 4RNNA 2Y1IA 2ZJ8A 4QZ8A 4R66A 2BQ3A 4B9SA 1Z3EB 4RT2A 4ED6A 1AROP 3Q8RB 4DQQA 3PVXA 4BGDA 4R65A 3MR2A 4DL7A 3RJEA 3WFSC 1NOMA 5DQIA 4IRCA 2IHNA 2R8IA 2XGQA 4YMNA 3QEBZ 7ICNA 5CHGA 1S0NA 4NLKA 2Q0ZX 4RQ3A 1UT8A 2MUTA 5DLFA 4KLTA 1TK5A 1JN3A 4KN4A 4F4YA 4DLEA 4UB2A 3E2EA 1JAJA 2F1HA 4O5EA 4I2DA 3K4GA 8ICJA 1NKCA 2UVVA 3MDAA 7ICRA 1ZQUA 3AQKA 2W9BB 4NLNA 3PV8A 3PY8A 2XGPA 2PI4A 3AQLA 3SZ2A 4EBEA 1F5AA 4RQ6A 4I27A 2XY7A 1TFYA 9ICIA 3SV4A 9ICKA 5KFOA 1NK8A 4UD5A 4KLSA 1Z00A 2BPCA 2ZH1A 4J9RA 5IIKA 5DB8A 4RQ2A 3MFIA 8ICHA 3KTQA 3RJIA 3AQNA 1SL2A 3GIKA 3H37A 1EXNA 4UB1A 4F91B 4DL4A 3GIMA 1ZETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P66 A;  1NKE A;  4AT8 A;  4YVZ A;  2HHV A;  3JPQ A;  2RDJ A;  3PNC A;  4ED8 A;  3M9N B;  3ISD A;  8ICN A;  2C28 A;  7ICU A;  1KFS A;  3AUO A;  8ICS A;  1BPX A;  4UAY A;  5HP4 A;  5KFE A;  4ECR A;  1XU4 A;  1KTQ A;  2RFF A;  5CA7 A;  3GQC A;  5KT2 A;  4DL2 A;  2I9G A;  3ZD9 A;  3M9O B;  5KFV A;  3PW5 A;  5KT6 A;  1S97 A;  1DOQ A;  2JEJ A;  3FYH A;  4F4W A;  4YCX A;  3V6J A;  4M47 A;  2AJQ A;  4DS4 A;  4O3N A;  2JZB B;  4FS2 A;  4ECX A;  2BPG A;  5HRI A;  5KFJ A;  4Q43 A;  1D8L A;  1ZQA A;  3KHR A;  5J2H A;  5KG7 A;  1T8E A;  1KLN A;  1T7P A;  2BR0 A;  5KG0 A;  4M9J A;  4EBD A;  1PX5 A;  3V6H A;  2DPJ A;  4PGQ A;  1ZQF A;  4LZD A;  3JPP A;  3RRG A;  1T4G A;  4KLH A;  3RB3 A;  3C5G A;  3JYY A;  5BPC A;  4QWB A;  5KFX A;  5CJ7 A;  3HIY A;  1COO A;  2WTF A;  4RU9 A;  5D49 A;  3UPS A;  3ZDC A;  4EBC A;  2AU0 A;  4J9M A;  3BQ1 A;  5DG9 A;  4TQS A;  1TK0 A;  4B9L A;  8ICL A;  4FS1 A;  4YR2 A;  3M8S A;  3V7J A;  1S9F A;  1ZQT A;  3RAX A;  1NJY A;  2ZH5 A;  4O3R A;  1R8C A;  1UT5 A;  4RQ7 A;  4NKT A;  3PX4 A;  4I2F A;  1N56 A;  2J6U A;  3BQT A;  4DFP A;  4UB4 A;  3V6K A;  1NJW A;  1ZQJ A;  2DR8 A;  4YR0 A;  3TQ1 A;  4O5K A;  2VA3 A;  4F3O A;  5EWG A;  3SV3 A;  3PW0 A;  4C8O A;  4DSJ A;  5D46 A;  2ASL A;  4F2S A;  3UPQ A;  4CCH A;  8ICI A;  5IIM A;  3QEA Z;  2ZTC A;  4QW9 A;  2J6S A;  5DG8 A;  4X4V A;  2PFP A;  1JMS A;  2ID1 A;  3OJS A;  3C1Y A;  4E80 A;  4FBT A;  4I2H A;  4Z6D A;  4ECY A;  1MQ3 A;  3PR5 B;  5J2J A;  3NGD A;  1X9S A;  4X4S A;  2F1I A;  5KFK A;  2RDI A;  2FMS A;  3MGI A;  1ZQM A;  4X4R A;  2BHN A;  4F4X A;  4FO6 A;  1QSL A;  4JV0 A;  7ICG A;  5DB7 A;  3PMN A;  2BCR A;  4TUR A;  4C8K A;  2ZH6 A;  3QZ7 A;  9ICJ A;  9ICT A;  1NK7 A;  2JEI A;  4DOC A;  4J9L A;  2FMP A;  5HRL A;  8ICA A;  3MFH A;  5KFI A;  3RBD A;  2XCA A;  3M8R A;  4F5N A;  3ZDE A;  2XY6 A;  7ICV A;  3PW7 A;  4LT6 A;  3T5K A;  5F9L A;  1DK2 A;  4DSK A;  5KFG A;  4K4G A;  1KFD A;  2KFN A;  4TUQ A;  4KLO A;  3WFQ E;  2W8L A;  3MDC A;  4XRH A;  5J0R A;  2R8K A;  3RH6 A;  2HVH A;  5HHI A;  2KP7 A;  2W9B A;  5DLG A;  4RQ4 A;  3IHQ B;  9ICV A;  4ECW A;  1ZJN A;  1NZP A;  1MIY A;  3HP6 A;  4TUP A;  1NK5 A;  5L1L A;  5DQH A;  4DFJ A;  2BCV A;  2ZUD A;  5III A;  3EW9 A;  3B0Y A;  4O3S A;  2ZUB A;  4XQ7 A;  1HUZ A;  4X4N A;  2C22 A;  1U4B A;  2NRT A;  4UBC A;  3LDA A;  3BDP A;  1U45 A;  1JX4 A;  5KFF A;  3AQM A;  9ICF A;  4DL6 A;  3LK9 A;  5KG2 A;  1LV5 A;  9ICR A;  3HT3 A;  3EYZ A;  4R64 A;  4PHD A;  3UXN A;  4QWE A;  2ZH7 A;  1ZQB A;  1BGX T;  3ORY A;  3RB4 A;  4I2A A;  5KFH A;  4HYK A;  8ICV A;  1OU5 A;  5J0O A;  4FBU A;  2HHS A;  1BPB A;  4O5C A;  9ICQ A;  1S76 D;  2ZJ5 A;  5DG7 A;  5J2B A;  4M9N A;  1U47 A;  4Q8F A;  2IMW P;  1MC8 A;  3ZD8 A;  1Q79 A;  1CEZ A;  2FLP A;  4M9L A;  7ICO A;  2P6R A;  1MIV A;  3Q8S B;  2NRV A;  4YN4 A;  2HHP A;  9ICC A;  2JZB A;  4MFA A;  3OSN A;  4ECQ A;  4I2J A;  3N4M B;  4ECZ A;  4QZC A;  4P4M A;  1BPY A;  4P2H A;  1UEU A;  2ZH2 A;  7ICI A;  3GIJ A;  4E8F A;  5J0Y A;  4F93 B;  3ETL A;  2PI5 A;  7ICP A;  8ICR A;  1ZQO A;  3PW2 A;  3GV8 B;  1L3S A;  4ECU A;  4M0A A;  5J2I A;  4J9P A;  4FHY A;  2DR9 A;  4S3N A;  2Q66 A;  3OSP A;  9ICS A;  3PW4 A;  5J0X A;  4RQ8 A;  2DPI A;  4UAW A;  3TAP A;  4TUS A;  4I2G A;  4MEY A;  4Z6C A;  4IRD A;  3OHB A;  9ICW A;  4ATB A;  4ELT A;  2W9A A;  8ICW A;  5KG6 A;  3BQ2 A;  3THV A;  1XS9 D;  2XY5 A;  1MQ2 A;  4DQI A;  4F50 A;  2ASJ A;  2H5X A;  4EBK A;  1UA0 A;  1QLN A;  3G6Y A;  1R89 A;  1RYS A;  8ICQ A;  3MBY A;  1RPL A;  2J6T A;  2B21 A;  2O1P A;  5HML A;  4BWJ A;  4ATB B;  2M2W A;  3TAQ A;  2W8K A;  4PHA A;  4IQT A;  4I2B A;  4IRK A;  1QSS A;  5KG3 A;  5J2G A;  2R8J A;  3ISB A;  4F5O A;  4IR1 A;  3HPO A;  3LWL A;  4JV2 A;  4RQ0 A;  2BCS A;  8ICE A;  4B9N A;  2HVI A;  8ICO A;  1WOT A;  4YG2 A;  4WC3 A;  1KSP A;  2ALZ A;  4RPX A;  4UD4 A;  5DQG A;  4DSL A;  4KLL A;  4IG8 A;  8ICX A;  8ICU A;  5J29 A;  3FDS A;  3GFK B;  2BDP A;  1JXE A;  2V9W A;  5CWR A;  4C8L A;  4X4T A;  4F4Z A;  5CB1 A;  4WC1 A;  5J0P A;  4EYH B;  2C2E A;  5HRF A;  2AGO A;  2KTQ A;  3AU2 A;  4K4I A;  4RUC A;  1D8Y A;  4IR9 A;  4QZE A;  2R8H A;  9ICM A;  4M9H A;  1R8B A;  3IM1 A;  4J9K A;  3M9M B;  4C8M A;  1SZP A;  3Q8K A;  4M9G A;  1R8A A;  5KG5 A;  5HRB A;  1Y88 A;  2KZZ A;  5HRE A;  1NKB A;  1DGS A;  4KLM A;  2UVR A;  4QZI A;  5KFQ A;  3RTV A;  3RR8 A;  7ICJ A;  3RH4 A;  4J9N A;  3OUY B;  2ZUC A;  4QWC A;  5HRG A;  4DL5 A;  4NY8 A;  8ICY A;  1NO5 A;  2ZH3 A;  3L9D A;  4X4O A;  4PPX A;  5DGA A;  4KLD A;  4NLG A;  1S77 D;  7ICL A;  4J9O A;  2AQ0 A;  4I2C A;  1L3U A;  2PXI A;  4MF2 A;  2HHU A;  4DF8 A;  5BOM A;  4WBZ A;  3EPI A;  4KLI A;  2VAN A;  1MSW D;  4QZ9 A;  3WFP A;  3UXP A;  3SYZ A;  1ZQP A;  3PML A;  4JUZ A;  2V4R A;  4O0I A;  5KFZ A;  4IQW A;  3MR5 A;  4J9S A;  3SI8 A;  8ICP A;  4EEY A;  4RWO A;  1VFG A;  2I1Q A;  3H7I A;  2DR5 A;  3V7K A;  5D4B A;  3HWT A;  4JWM A;  4DWI A;  5IIL A;  7ICQ A;  4BDP A;  2AGP A;  2KFZ A;  2MAX A;  3K75 D;  4NKU A;  5KFD A;  3C1Z A;  3T5H A;  3RH5 A;  7ICE A;  4E7X A;  9ICO A;  4G3I A;  1B43 A;  3C21 A;  4ED3 A;  2A1J B;  3H38 A;  4ED0 A;  4X0A A;  1ZQD A;  9ICN A;  4JV1 A;  3RB6 A;  5KFP A;  2BQR A;  3UXO A;  5IIO A;  4MF8 A;  1SL0 A;  4KTQ A;  5KFN A;  1TK8 A;  1ZQE A;  1QTM A;  4EZ9 A;  3C18 A;  4M2Y A;  1BNO A;  3KHL A;  4RPY A;  1ZQN A;  4KN7 A;  1VJ7 A;  2ZJA A;  4KLE A;  5EWF A;  4DQP A;  3HW8 A;  5KFT A;  3C2M A;  4FHV A;  4JWN A;  8ICF A;  5CR0 A;  1IM4 A;  4F5Q A;  3PX0 A;  1SKR A;  2FMQ A;  1NK0 A;  1SKS A;  4QZB A;  3UQ2 A;  5J2A A;  5KFM A;  4DFK A;  4YD2 A;  3H4D A;  2Y1J A;  4E0D A;  5KFA A;  4P4O A;  1QSY A;  5HRD A;  3V7L A;  4ELU A;  4FHP A;  4IQU A;  8ICK A;  3RJJ A;  5HR9 A;  1T3N A;  1XC9 A;  1ZQQ A;  3H8J A;  5KFU A;  5CP2 A;  3RJH A;  4ED1 A;  1BNP A;  4UB3 A;  3Q8M A;  2FLL A;  4KLQ A;  9ICE A;  4AT9 B;  1SKW A;  3ZDD A;  4DFM A;  3C2K A;  2PFO A;  2NRX A;  4FH5 A;  1U9L A;  4ED7 A;  5DED A;  1BVS A;  3Q8L A;  2JEG A;  2DRA A;  1CUK A;  1MIW A;  3JPS A;  2LYH A;  4I2I A;  4PH5 A;  4DLG A;  4QW8 A;  2VA2 A;  3T5J A;  1V4A A;  1A77 A;  1NK6 A;  4O3P A;  3ZDB A;  5J2D A;  4M6W B;  4BWM A;  2FPM A;  1BPD A;  4DQS A;  1YLQ A;  2PBE A;  3OV7 A;  7ICS A;  2M9N A;  2BE3 A;  4X4U A;  5BOL A;  4X0B A;  4FHX A;  5EWE A;  5KFC A;  1ZQV A;  4XQ8 A;  4WC2 A;  4EZ6 A;  5HC9 A;  4F5P A;  2IHM A;  4RWQ A;  3OVA A;  1RYR A;  1JIH A;  5J0T A;  2C2R A;  3HJ1 A;  4B9T A;  4NM2 A;  1TFW A;  1NJX A;  4ECV A;  1XO1 A;  5KFB A;  4I2E A;  5TZV A;  3EWA A;  4YFK A;  3EPG A;  3T3F A;  3PX6 A;  5KG4 A;  3OVB A;  4XA5 A;  3C5F A;  1L3T A;  1LB2 B;  1A76 A;  3QZ8 A;  9ICH A;  2M2U A;  1NJZ A;  5L9X A;  3NTU A;  4RZR A;  2XO7 A;  3BQ0 A;  4EBJ A;  2UVU A;  4YXM A;  4ZH4 A;  3OUY A;  4DSE A;  3B0X A;  9ICU A;  3HJ4 A;  1WCL A;  3C23 A;  5L1K A;  4QZG A;  2PFQ A;  4DQR A;  4RQ1 A;  9ICP A;  2NRK A;  1XSL A;  4RNO A;  2BKE A;  3RRH A;  3V72 A;  3WFO A;  4ELV A;  4KLJ A;  2HW3 A;  3TFR A;  1S0M A;  4UAZ A;  4EP7 A;  1BPE A;  2BCU A;  2R8G A;  8ICG A;  7ICH A;  4F92 B;  3OGU A;  2ASD A;  3JPO A;  2DFL A;  2F1J A;  3GV7 B;  5C5J A;  2PFN A;  1TAU A;  5HRK A;  2ZH4 A;  4UQG A;  2XC9 A;  3JPT A;  1H38 A;  3ZDA A;  7ICT A;  1KNY A;  4C8N A;  1ZQS A;  5DB6 A;  4WCW A;  2UVW A;  5J0S A;  2C2D A;  4Q8E A;  1TV9 A;  4PHP A;  4EYI B;  1S10 A;  4DEZ A;  5KG1 A;  1C7Y A;  4QZH A;  1V9P A;  1IXR A;  3HX0 A;  1KRP A;  4F2R A;  4I28 A;  4O9M A;  4PHE A;  5J2C A;  4WC0 A;  1D9F A;  5KFR A;  1U49 A;  2ZTE A;  2A1J A;  4QZD A;  2HHQ A;  9ICB A;  3LQC B;  4M5D A;  8ICC A;  2FLN A;  5J0Q A;  7ICM A;  3RJK A;  1JXL A;  1L3V A;  9ICA A;  2KZM A;  3H39 A;  4WBY A;  3OJU A;  1X9W A;  4NXZ A;  4DSI A;  2XCP A;  4PGX A;  3T5L A;  5KT7 A;  3QE9 Y;  5HRH A;  3RBE A;  4BXO A;  4TQR A;  5DGB A;  4RNM A;  3JPR A;  2V4Q A;  2MUT B;  2ZTD A;  4KIT B;  1ZQZ A;  5F9N A;  5DB9 A;  3Q8Q B;  2HHX A;  4X4P A;  4UBB A;  3TFS A;  7ICF A;  1B22 A;  1JQR A;  5J0U A;  5DBA A;  4UB5 A;  3MGH A;  4DL3 A;  1X9M A;  3JZ0 A;  3ISC A;  2ZHA A;  4Q44 A;  3EZ5 A;  4X4Q A;  8ICZ A;  2ZH8 A;  4Z6E A;  4P4P A;  3PO4 A;  9ICG A;  3RAQ A;  1RXW A;  3Q8P B;  4RPZ A;  4MEX A;  1HJP A;  2BGW A;  2M2T A;  2DR7 A;  4XUS A;  3GDX A;  1K1S A;  1S0O A;  1ZQY A;  2VA8 A;  1ZQH A;  1ZQW A;  2HHT A;  1Z00 B;  3PR4 A;  1UA1 A;  4GXK A;  4MFC A;  5DKW A;  4QZA A;  1ZQI A;  4AT9 A;  4RWP A;  4MFF A;  1ZQR A;  2BQU A;  4M04 A;  3RJG A;  5KFL A;  3C66 A;  3TI0 A;  1ZQC A;  3KHG A;  4ECT A;  3MR6 A;  3TAN A;  3H3A A;  4Q45 A;  4GLX A;  2HHW A;  2DVI A;  4ECS A;  4AT8 B;  1XWL A;  4DS5 A;  1D9D A;  2IBK A;  1HUO A;  4B9M A;  4LVS A;  4M6W A;  1KFT A;  1UET A;  5DDY A;  4RWN A;  3GIL A;  2W9C A;  2GWS A;  3MAB A;  1TAQ A;  5J2F A;  1RXV A;  4O3Q A;  4B9U A;  2FPK A;  3KHH A;  4J9Q A;  9ICL A;  5L1I A;  5KFY A;  5L1J A;  1ZJM A;  2ISO A;  5IIN A;  2W9M A;  3LWM A;  5HMM A;  5EOZ A;  4GC7 A;  4GC6 A;  4X5V A;  1UEV A;  1KEJ A;  1ZQL A;  4BXO B;  3G6X A;  3MR3 A;  4I29 A;  2JEF A;  8ICM A;  2FPL A;  1XSP A;  4FHW A;  4R8U A;  1BPZ A;  4Z6F A;  4QWD A;  5KFS A;  1TKD A;  4NLZ A;  3C2L A;  8ICB A;  2ZHB A;  4F5R A;  1ZQX A;  4KLF A;  4AT7 A;  4IQV A;  5KFW A;  5DDM A;  5DBC A;  4YR3 A;  1K1Q A;  3JPN A;  4DSF A;  3AU6 A;  4LZG A;  4YQW A;  3UQ0 A;  1SL1 A;  4DOB A;  4R63 A;  1ZQG A;  5KT4 A;  2AQ4 A;  3GII A;  5HNK A;  4GXJ A;  4B9V A;  4DF4 A;  1PZN A;  1X2I A;  4YMO A;  2IA6 A;  4O3O A;  4KLG A;  2ZH9 A;  2P6U A;  4RQ5 A;  4PGY A;  2BCQ A;  1FA0 A;  2KN7 A;  4DOA A;  3RR7 A;  5KT5 A;  5JUM A;  3H40 A;  5J0W A;  4YD1 A;  1XSN A;  4RUA A;  1N48 A;  1KDH A;  1L5U A;  2ISP A;  4F8R A;  1TFR A;  2O5A A;  2ATL A;  5KT3 A;  1NK9 A;  3PO5 A;  2NRZ A;  3WFR E;  1RZT A;  5J2K A;  5J2E A;  5DBB A;  2NRW A;  2DRB A;  3G6V A;  3N97 B;  1ZYQ A;  3BJY A;  1ZQK A;  3H8W A;  2W9C B;  4GXI A;  4ED2 A;  5KTQ A;  4KLU A;  1WCN A;  4RT3 A;  5DEC A;  4WC6 A;  3OVS A;  4FH3 A;  3TAR A;  4YP3 A;  2KZ3 A;  2BPF A;  4NM1 A;  4WC7 A;  8ICT A;  3RJF A;  5IIJ A;  1DK3 A;  4YMM A;  5HHH A;  4WC5 A;  1TVA A;  1S0V A;  3OHA A;  4R8U B;  2AGQ A;  3H4B A;  1U48 A;  4WC4 A;  4DO9 A;  4YXJ A;  4KMU A;  1Q78 A;  2OWO A;  2M2V A;  9ICX A;  1NK4 A;  3NYB A;  4AT7 B;  5F2V O;  4QZF A;  7ICK A;  4QWA A;  4K4H A;  3H8S A;  3GV5 B;  4F4K A;  4JK1 A;  3RB0 A;  4RNN A;  2Y1I A;  2ZJ8 A;  4QZ8 A;  4R66 A;  2BQ3 A;  4B9S A;  1Z3E B;  4RT2 A;  4ED6 A;  1ARO P;  3Q8R B;  4DQQ A;  3PVX A;  4BGD A;  4R65 A;  3MR2 A;  4DL7 A;  3RJE A;  3WFS C;  1NOM A;  5DQI A;  4IRC A;  2IHN A;  2R8I A;  2XGQ A;  4YMN A;  3QEB Z;  7ICN A;  5CHG A;  1S0N A;  4NLK A;  2Q0Z X;  4RQ3 A;  1UT8 A;  2MUT A;  5DLF A;  4KLT A;  1TK5 A;  1JN3 A;  4KN4 A;  4F4Y A;  4DLE A;  4UB2 A;  3E2E A;  1JAJ A;  2F1H A;  4O5E A;  4I2D A;  3K4G A;  8ICJ A;  1NKC A;  2UVV A;  3MDA A;  7ICR A;  1ZQU A;  3AQK A;  2W9B B;  4NLN A;  3PV8 A;  3PY8 A;  2XGP A;  2PI4 A;  3AQL A;  3SZ2 A;  4EBE A;  1F5A A;  4RQ6 A;  4I27 A;  2XY7 A;  1TFY A;  9ICI A;  3SV4 A;  9ICK A;  5KFO A;  1NK8 A;  4UD5 A;  4KLS A;  1Z00 A;  2BPC A;  2ZH1 A;  4J9R A;  5IIK A;  5DB8 A;  4RQ2 A;  3MFI A;  8ICH A;  3KTQ A;  3RJI A;  3AQN A;  1SL2 A;  3GIK A;  3H37 A;  1EXN A;  4UB1 A;  4F91 B;  4DL4 A;  3GIM A;  1ZET A; 
#chains in the Genus database with same CATH topology
 3M9N B;  2C28 A;  4ECR A;  2RFF A;  5AIA A;  2KOB A;  1KKX A;  4O67 A;  2ZG6 A;  4O3M A;  1S97 A;  3V6J A;  4FS2 A;  5HRI A;  1FFU A;  2K4H A;  5KFJ A;  1ZQA A;  3ED5 A;  1T8E A;  1T7P A;  3A0B U;  2DPJ A;  4LZD A;  3JPP A;  1JRP A;  4WQL A;  4KLH A;  2EZX A;  3JYY A;  5BPC A;  4QWB A;  5KFX A;  3HIY A;  5GTI U;  4RU9 A;  1KQQ A;  3ZDC A;  3K1Z A;  8ICL A;  4YR2 A;  2F3N A;  4RQ7 A;  4NKT A;  3GU3 A;  1ZQ1 C;  3BQT A;  4UB4 A;  3V6K A;  1ZQJ A;  4YR0 A;  4F3O A;  5EWG A;  1DXS A;  3QUQ A;  2ASL A;  3KBB A;  3UPQ A;  2KKP A;  5KL1 B;  5DG8 A;  4X4V A;  5ALK A;  4K98 A;  1WG8 A;  3GZF A;  4I2H A;  1MQ3 A;  3NGD A;  1FFV A;  3MGI A;  4F4X A;  4C8K A;  2BCR A;  5CFS A;  3QZ7 A;  4CNQ A;  4UAS A;  5HRL A;  8ICA A;  3MFH A;  3FM9 A;  4EV6 A;  2JR5 A;  4F5N A;  3ZDE A;  7ICV A;  1J2N A;  4QIW C;  2KIW A;  2KFN A;  3WFQ E;  3MDC A;  4XRH A;  5J0R A;  2R8K A;  3VC8 A;  2KP7 A;  3KOO A;  2B6G A;  4RQ4 A;  3IHQ B;  1NZP A;  3N7R C;  4U6P A;  4Y2S A;  5JU5 A;  2ZUD A;  5III A;  4O3S A;  3PSF A;  2C22 A;  2HBK A;  2NRT A;  1U4B A;  2YB1 A;  3LDA A;  4X4N A;  3HIL A;  3AQM A;  2LM1 A;  2RLT A;  3WK5 A;  4R64 A;  3QU7 A;  5AM3 A;  4NV0 A;  4I2A A;  3AMZ A;  4FZN A;  1S76 D;  5DG7 A;  4M9N A;  1UQV A;  2KVC A;  4M9L A;  3OSN A;  2O6K A;  4ECQ A;  4P2H A;  1UEU A;  5ALL A;  3GIJ A;  2A1A A;  1C20 A;  3ETL A;  2PI5 A;  2DUY A;  2HI0 A;  5AI0 A;  4M0A A;  1L3S A;  3CW2 C;  4FHY A;  3WKC A;  4S3N A;  2DR9 A;  1N61 A;  1X40 A;  4Y2Y A;  4I2G A;  4MEY A;  4IRD A;  9ICW A;  3NKU A;  4ELT A;  1L7N A;  3BQ2 A;  1HIW A;  1L6N A;  2XY5 A;  1QLN A;  1R89 A;  3TAQ A;  4PHA A;  4IQT A;  4I2B A;  1SV0 A;  5J2G A;  4F5O A;  4JV2 A;  2DL0 A;  2HBM A;  1WOT A;  2GAF D;  2K4E A;  4RPX A;  2ALZ A;  2LI6 A;  8ICX A;  2NO5 A;  4C8L A;  4OJ6 A;  4WC1 A;  5HRF A;  2AGO A;  2KTQ A;  9ICM A;  1D8Y A;  4QZE A;  4J9K A;  4NL9 C;  5HRB A;  2KZZ A;  1NKB A;  1DGS A;  2UVR A;  2H3I A;  4QZI A;  5KFQ A;  5AKI A;  7ICJ A;  3RH4 A;  3IG8 A;  4QWC A;  2ZH3 A;  8ICY A;  4C7Y A;  2E3T A;  4KLD A;  4LJX A;  3WK8 A;  4NWI A;  5ALJ A;  1L3U A;  4DF8 A;  4KLI A;  4RQM A;  1T3Q A;  1SB3 C;  8ICP A;  4EEY A;  4RWO A;  2I1Q A;  5ALE A;  4NXV A;  3HWT A;  4JWM A;  4DWI A;  3K75 D;  3C1Z A;  3T5H A;  7ICE A;  9ICO A;  4G3I A;  1X42 A;  3N7P D;  4JV1 A;  4QIW F;  4ZOH C;  2KIC A;  3C18 A;  5KFN A;  1ZQE A;  3LYS A;  1MN8 A;  2IOF A;  3C2M A;  1RQN A;  1IM4 A;  4KMO B;  4QZB A;  3UQ2 A;  3WKD A;  4E0D A;  1QSY A;  3V7L A;  1SWV A;  5KAF U;  4K96 A;  1T3N A;  1ZQQ A;  3H8J A;  5KFU A;  3RJH A;  4ED1 A;  1FIQ A;  1SKW A;  3ZDD A;  2PFO A;  2NRX A;  2FCL A;  2ZIX A;  4QW8 A;  3T5J A;  1V4A A;  3ZDB A;  4M6W B;  4DQS A;  1BPD A;  2BE3 A;  5BOL A;  4FHX A;  4OAI Z;  5EWE A;  5KFC A;  1ZQV A;  4XQ8 A;  3HJE A;  4RWQ A;  3OVA A;  1TFW A;  5AM5 A;  4QNL A;  5TZV A;  4YFK A;  3EPG A;  3FC4 A;  3T3F A;  3OVB A;  4XA5 A;  2A19 A;  3C5F A;  1L3T A;  3QZ8 A;  2W43 A;  3ER9 B;  2XO7 A;  2P35 A;  3OUY A;  3NRW A;  4RQ1 A;  9ICP A;  2NRK A;  2BKE A;  3RRH A;  3WFO A;  8ICG A;  4Y2V A;  3JPO A;  3GV7 B;  3SD7 A;  3JPT A;  3ZDA A;  7ICT A;  1KNY A;  2ZIV A;  3MC1 A;  1ZQS A;  2W03 A;  2UVW A;  4Q8E A;  2VIX A;  5A0L A;  2JV3 A;  1MIW A;  1KRP A;  1V9P A;  3AQF A;  5J2C A;  5AIC A;  2ZTE A;  3S6J A;  8ICC A;  5J0Q A;  4NXZ A;  4DSI A;  3K7D A;  3A0H U;  1FEZ A;  1GPJ A;  1ZQZ A;  4UBB A;  3TFS A;  1X9M A;  5DBA A;  5AK4 A;  3EZ5 A;  8ICZ A;  9ICG A;  3RAQ A;  5D62 A;  3UM9 A;  2DR7 A;  1K1S A;  1ZQW A;  1Z00 B;  2RHF A;  4AT9 A;  2BQU A;  5AM0 A;  5AM1 A;  2KG5 A;  3TAN A;  3U26 A;  1KFT A;  4OAG A;  4EGW A;  2WF8 A;  4FZM A;  3B9J A;  9ICL A;  5L1I A;  5KFY A;  2ISO A;  5IIN A;  1SZH A;  1KEJ A;  2JEF A;  8ICM A;  4JLZ A;  2F2A B;  8ICB A;  1ZQX A;  4LEY A;  3HKZ C;  4KX3 A;  4IQV A;  4GFJ A;  5CEH A;  2LKY A;  2KHV A;  4KLG A;  1PZN A;  1X2I A;  2IA6 A;  1UCV A;  5ALM A;  1A6S A;  3WK6 A;  3OPX A;  4RUA A;  4F8R A;  1L5U A;  2IOH A;  2ATL A;  3WK4 A;  2EQY A;  3WFR E;  5J2K A;  5HR7 A;  5GTH U;  2OXO A;  1RQL A;  2G5H B;  2W9C B;  4ED2 A;  5KTQ A;  3DDH A;  4RT3 A;  3H8M A;  3RJF A;  3L4P A;  4YMM A;  5HHH A;  5ALD A;  4C7Z A;  2AGQ A;  4WC4 A;  2OHF A;  5E79 U;  4AT7 B;  3WKA A;  2ZIW A;  4QZ8 A;  2BQ3 A;  1Z3E B;  4RT2 A;  4BGD A;  3WFS C;  3MR2 A;  1DRG A;  4EEB A;  3NRZ A;  4JLX A;  7ICN A;  5CHG A;  4OD0 A;  5DLF A;  1Z4O A;  1N60 A;  4DLE A;  4UB2 A;  4ACO A;  5ALI A;  4B6J A;  1ZQU A;  2DGZ A;  2KJ5 A;  1S5L U;  1IG6 A;  3UMC A;  4RQ6 A;  1NK8 A;  3MFI A;  3AQN A;  3NUQ A;  2ESE A;  4UB1 A;  2K4I A;  4F91 B;  1ZET A;  2P66 A;  3KKA C;  4EED A;  3H0M B;  2AXT U;  4YVZ A;  2HHV A;  8ICS A;  3AM9 A;  4KB6 A;  1KTQ A;  3CP8 A;  5CA7 A;  2DF4 B;  4DL2 A;  4I0U A;  2BPG A;  4ECX A;  4EX7 A;  4Q43 A;  1D8L A;  2I6X A;  1TE2 A;  5KG7 A;  2BR0 A;  3V6H A;  5CFT A;  5AM2 A;  1COO A;  3SQI A;  5D49 A;  2F77 X;  4J9M A;  3NVZ A;  3M8S A;  3K1R B;  1LKY A;  3QUB A;  3PX4 A;  4I2F A;  2J6U A;  3TQ1 A;  4IC9 A;  1OW5 A;  4P0Q A;  3SV3 A;  4C8O A;  2B4V A;  1L7P A;  5D46 A;  2MRL A;  8ICI A;  5IIM A;  2J6S A;  1JMS A;  1ZOL A;  2H3V A;  3C1Y A;  3TAD A;  4FBT A;  3WK9 A;  4ECY A;  5B5E U;  2F1I A;  5KFK A;  2RDI A;  1ZQM A;  4FO6 A;  3IRU A;  4JV0 A;  4TUR A;  3O0F A;  9ICT A;  2JEI A;  4DOC A;  4J9L A;  2FMP A;  5KFI A;  5ALQ A;  2XCA A;  4K9B A;  2IUB A;  5KFG A;  1KFD A;  3L3F X;  4KLO A;  4U7C A;  5DLG A;  9ICV A;  3HRD D;  1ZJN A;  1MIY A;  2QB0 A;  1NK5 A;  2XVT A;  5DQH A;  5L1L A;  4DFJ A;  2CXY A;  2ES6 A;  4PZN A;  1HUZ A;  4LEV A;  4UBC A;  1U45 A;  5KFF A;  4DL6 A;  2BBH A;  1LV5 A;  4PHD A;  3UXN A;  1ZQB A;  3ORY A;  3RB4 A;  1YT3 A;  4HYK A;  1OU5 A;  5J0O A;  4FBU A;  4O5C A;  4K99 A;  4PL2 A;  4OO1 J;  2HDO A;  1Q79 A;  2P6R A;  4YN4 A;  1YZ7 A;  1N62 A;  2IHO A;  2JZB A;  1BPY A;  4QZC A;  2ZH2 A;  1KL9 A;  7ICI A;  1JAL A;  4E8F A;  7ICP A;  3QU4 A;  2KIV A;  2K8A A;  3GV8 B;  4ECU A;  3NVV A;  1Q8K A;  9ICS A;  1M6Y A;  3E58 A;  5J0X A;  4RQ8 A;  2DPI A;  4Z6C A;  2B51 A;  3OHB A;  4Y2U A;  8ICW A;  3THV A;  1B0X A;  1URJ A;  1MQ2 A;  4DQI A;  4NXU A;  1QCK A;  3MBY A;  1RPL A;  5HML A;  5JTG A;  4ATB B;  3NAS A;  1QSS A;  2R8J A;  4IR1 A;  3LWL A;  2BCS A;  4B9N A;  8ICO A;  5AK6 A;  3KZI U;  4UD4 A;  5DQG A;  3H0R B;  5J8Y C;  3GFK B;  1JXE A;  2V9W A;  4X4T A;  3SMV A;  1PK1 A;  1V38 A;  2AH5 A;  3AU2 A;  2KJ9 A;  1R8B A;  2R8H A;  2JMG A;  1ZD3 A;  4M9G A;  4FZL A;  5KG5 A;  1Y88 A;  1J2M A;  4C0Z A;  4KLM A;  3RR8 A;  5EE1 A;  1L8O A;  2ZUC A;  1NO5 A;  2EAO A;  4DL5 A;  4NY8 A;  3OUY B;  3H0L B;  2F8K A;  1S77 D;  1COK A;  7ICL A;  2HHU A;  5BOM A;  4WBZ A;  3EPI A;  2VAN A;  1WWU A;  3SAG A;  2RRD A;  3PML A;  3SAH A;  4BJQ A;  4O0I A;  2KE7 A;  4US9 A;  2ZIV B;  1GO3 F;  1VFG A;  2E8N A;  3I1Y A;  3H7I A;  2DR5 A;  5D4B A;  4KM5 A;  3F2B A;  5IIL A;  7ICQ A;  2KFZ A;  4NKU A;  4E7X A;  4OAH A;  3H38 A;  2HCF A;  1SV0 C;  3RB6 A;  3UXO A;  1L8L A;  1TK8 A;  1QTM A;  4M2Y A;  3KHL A;  2ODG A;  5EE3 A;  5H2F U;  2ZJA A;  1VJ7 A;  4DQP A;  2KHQ A;  2OM6 A;  5KFT A;  4FHV A;  3BZC A;  4JWN A;  1SKR A;  1DGJ A;  4DFK A;  2D6F C;  3H4D A;  1SXE A;  4IL6 U;  2EAM A;  4ELU A;  2FI1 A;  4IQU A;  3RJJ A;  5HR9 A;  2LMR A;  2K89 A;  1BNP A;  3Q8M A;  4KLQ A;  4AT9 B;  2GOL A;  3C2K A;  1U9L A;  4P0P A;  4I2I A;  1NK6 A;  3OV7 A;  2PBE A;  4UB8 U;  7ICS A;  3D6J A;  2IHM A;  1JIH A;  4EX6 A;  2FDR A;  2HMX A;  3NWI A;  3PX6 A;  1LB2 B;  2ZIU A;  1NJZ A;  3NTU A;  4RZR A;  4EBJ A;  3WKB A;  2UVU A;  4ZH4 A;  5AKH A;  2KNJ A;  3B0X A;  9ICU A;  3HJ4 A;  1WCL A;  3EUB 2;  1Q46 A;  3SAF A;  1XSL A;  3V72 A;  1IV8 A;  1P7D A;  4ELV A;  4KLJ A;  3TFR A;  1S0M A;  2WB1 C;  4O69 A;  4EP7 A;  2R8G A;  1V85 A;  5C5J A;  4Y2J A;  4UQG A;  1H38 A;  4C8N A;  4WCW A;  1TV9 A;  4PHP A;  1UPH A;  5KG1 A;  4EEL A;  4O9M A;  4I28 A;  5B66 U;  1QQ6 A;  2ZIW B;  1D9F A;  5KFR A;  2A1J A;  3LQC B;  2FLN A;  7ICM A;  2XI9 A;  1L3V A;  2E5S A;  3T5L A;  5KT7 A;  2ZXI A;  4UW9 A;  3JPR A;  5DGB A;  2V4Q A;  1NI3 A;  4KIT B;  1B22 A;  4UB5 A;  3MGH A;  4DL3 A;  2AHO B;  3ISC A;  4X4Q A;  2ZH8 A;  4Z6E A;  4P4P A;  1RXW A;  2L5Y A;  4RPZ A;  1HJP A;  2BGW A;  4WH5 A;  4XUS A;  3M1Y A;  1ZQH A;  4K97 A;  1OXJ A;  2HOF A;  4MFC A;  5HR6 A;  4QZA A;  3M6Z A;  4RWP A;  3RJG A;  3TI0 A;  4FO1 A;  2Q4T A;  3QUT A;  4Q45 A;  3NVW A;  2DVI A;  4ECS A;  2HN2 A;  2IBK A;  1D9D A;  2GWS A;  3MAB A;  1TAQ A;  1RXV A;  3KHH A;  4J9Q A;  5HMM A;  4GC7 A;  4GC6 A;  4X5V A;  4BXO B;  3MR3 A;  4I29 A;  3QUC A;  2HOI A;  2FPL A;  4R8U A;  4Z6F A;  1TKD A;  2ZHB A;  4F5R A;  4C4T A;  5DDM A;  5KFW A;  2GA9 D;  1K1Q A;  4DOB A;  4FFD A;  3GII A;  4GXJ A;  4FE3 A;  4YMO A;  5AI5 A;  5ALN A;  4N7R A;  5F3X B;  2KN7 A;  3RR7 A;  5JUM A;  4YD1 A;  1N48 A;  1LKY B;  1TFR A;  2KK0 A;  2KV2 A;  5KT3 A;  5J2E A;  2NRW A;  3G6V A;  3N97 B;  1ZQK A;  4GXI A;  1JRO A;  5D61 A;  3TAR A;  1AQ6 A;  4YP3 A;  2CPR A;  2KZ3 A;  2XIC A;  3IG5 A;  4A8E A;  1DK3 A;  5IIJ A;  2OCE A;  5AKE A;  4WC5 A;  3DV9 A;  3OHA A;  2KSO A;  4KMU A;  2OWO A;  2M2V A;  4QZF A;  5AI9 A;  4K4H A;  1Q3U A;  4RNN A;  2ZJ8 A;  4DQQ A;  1ARO P;  3Q8R B;  1NOM A;  2WF9 A;  4IRC A;  2JXJ A;  2LHT A;  4NLK A;  2Q0Z X;  3N28 A;  1TK5 A;  1JN3 A;  4KN4 A;  1JAJ A;  2WB1 F;  2YMM A;  4EEN A;  5C0Y A;  2XGP A;  2QB0 B;  2G06 A;  3SZ2 A;  4EBE A;  4OJO A;  1TFY A;  8ICH A;  3QU5 A;  4RQ2 A;  3RJI A;  1SL2 A;  3F2D A;  3GIM A;  3PNC A;  3T79 A;  7ICU A;  3AUO A;  5KFE A;  1XU4 A;  1WUD A;  3C28 A;  5KT2 A;  3M9O B;  5KFV A;  1DOQ A;  2JEJ A;  3NVO A;  2LM4 A;  5K4L A;  2JZB B;  4Y2T A;  1KLN A;  3KHR A;  5J2H A;  3D2Q A;  5KG0 A;  4EBD A;  1PX5 A;  1ECW A;  3RRG A;  1T4G A;  3RB3 A;  3AQE A;  4Y2Q A;  5CJ7 A;  3UPS A;  4B9L A;  4TQS A;  1TK0 A;  1S9F A;  1ZQT A;  3RAX A;  1NJY A;  3ICX A;  4O3R A;  1UT5 A;  5L1M A;  1NJW A;  2BBJ A;  2DR8 A;  3PW0 A;  4DSJ A;  2HOQ A;  1PUZ A;  5KAI U;  4F2S A;  2PFP A;  3OJS A;  2N1R A;  4E80 A;  5EE9 A;  3PR5 B;  1X9S A;  4X4S A;  2WF5 A;  1CI4 A;  2BHN A;  1QSL A;  3CNH A;  2LBO A;  3PMN A;  1PK1 B;  2JH1 A;  1F0M A;  2EWR A;  3RBD A;  5AK5 A;  2GH1 A;  3M8R A;  4LT6 A;  3T5K A;  2LPE A;  5F9L A;  1DK2 A;  4DSK A;  2OEH A;  2WF7 A;  2W8L A;  3RH6 A;  5HHI A;  2OH2 A;  3HP6 A;  3EW9 A;  3B0Y A;  2ZUB A;  3CYM A;  2RQ5 A;  3NS1 A;  1L7O A;  5KG2 A;  3LK9 A;  9ICR A;  4HX0 A;  3EYZ A;  5JTI A;  1BGX T;  2QAR A;  2VJ5 A;  1BPB A;  5J2B A;  1U47 A;  4Q8F A;  2OYY A;  3ZD8 A;  1MA7 A;  2FLP A;  3Q8S B;  2NRV A;  9ICC A;  4MFA A;  3N4M B;  4ECZ A;  4P4M A;  1Z1B A;  4C80 A;  3F2C A;  8ICR A;  3PZP A;  3ONN A;  1L7M A;  1S8O A;  3PW4 A;  3ZI4 A;  4TUS A;  2W9A A;  2YX8 A;  5KG6 A;  4P0P B;  1UHU A;  3VCB A;  2ASJ A;  2H5X A;  4EBK A;  1RYS A;  2O1P A;  2B21 A;  4BWJ A;  5ALO A;  1ZD4 A;  1RDF A;  5KG3 A;  8ICE A;  3HPO A;  2JGA A;  4PZO A;  4WC3 A;  2B0C A;  4Y2P A;  5KNI A;  4GIB A;  2MA1 A;  4IG8 A;  3PSI A;  5J29 A;  3FDS A;  2BDP A;  5CWR A;  4F4Z A;  4K9A A;  5AI4 A;  2C2E A;  4RUC A;  4IR9 A;  2DWQ A;  3IM1 A;  3M9M B;  3AN1 A;  2ZIU B;  5HRE A;  1NNL A;  5AKY A;  4J03 A;  3RTV A;  4J9N A;  5HRG A;  3L9D A;  4X4O A;  4NLG A;  4J9O A;  4MF2 A;  2GO7 A;  4QZ9 A;  3UMG A;  3UXP A;  3SYZ A;  2E8M A;  4JUZ A;  2V4R A;  4IQW A;  4DCC A;  3JCF A;  5AKJ A;  4J9S A;  1O08 A;  3V7K A;  4BDP A;  2MAX A;  5KFD A;  3RH5 A;  5ALF A;  1B43 A;  3C21 A;  2A1J B;  1ZRN A;  4ED0 A;  1Z1V A;  5IIO A;  4MF8 A;  4KTQ A;  1BNO A;  3L5K A;  4RPY A;  5G5G A;  4KLE A;  5EWF A;  3HW8 A;  5CR0 A;  4F5Q A;  3PX0 A;  3EF2 A;  1NK0 A;  1SKS A;  2QKQ A;  5FP0 A;  5TIS U;  2I5H A;  5J2A A;  2Y1J A;  2YQE A;  3ALR A;  5EE0 A;  4UAV A;  1XNS A;  8ICK A;  1JUD A;  4MHV A;  3IN5 A;  5ALG A;  2EZZ A;  1N63 A;  5CP2 A;  2Y0S C;  4DFM A;  4FH5 A;  4ED7 A;  1BVS A;  3Q8L A;  2JEG A;  4OAF A;  3JPS A;  2LYH A;  4DLG A;  2VA2 A;  4LEW A;  1A77 A;  3F53 A;  2G0A A;  3KKA A;  5D63 A;  1B4F A;  2M9N A;  5HC9 A;  4EZ6 A;  2LYB A;  4F5P A;  1X6J A;  2W04 A;  3HJ1 A;  4B9T A;  4Y2R A;  4ECV A;  1XO1 A;  5KFB A;  2EZY A;  4UAU A;  2XID A;  2H3Z A;  2LYA A;  4K8V A;  3BQ0 A;  2ZIX B;  4YXM A;  3I76 A;  2B56 A;  2PFQ A;  4DQR A;  4RNO A;  2NYV A;  2PMZ C;  4F92 B;  3OGU A;  2F1J A;  1TAU A;  5HRK A;  3NVY A;  2XC9 A;  5J0S A;  2W7O A;  3IDW A;  2KSO B;  4UD5 A;  4EYI B;  1S10 A;  4DEZ A;  3HX0 A;  4F2R A;  4OJP A;  2KKV A;  1U49 A;  9ICB A;  4QZD A;  4M5D A;  3QU9 A;  1JXL A;  4WBY A;  3OJU A;  1X9W A;  2XCP A;  2Y9T A;  4PGX A;  5AI8 A;  5ALZ A;  3F5E A;  5ALS A;  3QE9 Y;  5HRH A;  3RBE A;  4RNM A;  2ZTD A;  5DB9 A;  2KMD A;  7ICF A;  1JQR A;  3JZ0 A;  2WAQ F;  3SEI A;  3PO4 A;  1KBU A;  2VJ4 A;  2KJ8 A;  4MEX A;  1ZQY A;  3KFU F;  3AEV A;  3QX7 A;  2HHT A;  3PR4 A;  1UA1 A;  1YZ6 A;  5DKW A;  1PVR A;  3RFA A;  2Y9U A;  3C66 A;  1ZQC A;  4ECT A;  4GLX A;  2HHW A;  2E8O A;  1XWL A;  5KL8 B;  4DS5 A;  1UET A;  3SEN A;  3WKE A;  2W9C A;  4AYB C;  4NXW A;  5ALH A;  5J2F A;  4B9U A;  5L1J A;  4JB3 A;  1ZRM A;  3LWM A;  5EOZ A;  1UEV A;  1ZQL A;  3G6X A;  2YY6 A;  4US8 A;  1J97 A;  5ALW A;  5KFS A;  5ALX A;  2E1E A;  4NLZ A;  4AT7 A;  2JHD A;  3ETR A;  1ZD2 P;  4DSF A;  4O5K A;  5AK3 A;  2Y0S F;  2QB1 A;  4YQW A;  1SL1 A;  4R63 A;  2WHE A;  5KT4 A;  2AQ4 A;  5HNK A;  2G09 A;  4DF4 A;  1HEK A;  4O3O A;  5ALP A;  2W3S A;  1FA0 A;  5KT5 A;  2KD1 A;  4OJ5 A;  5J0W A;  2ISP A;  2O5A A;  3C29 A;  3F5A A;  2R18 A;  3PO5 A;  2K4P A;  2NRZ A;  1K5O A;  2K60 A;  2DRB A;  3D2N A;  2NV3 A;  1ZYQ A;  3BJY A;  4PJ0 U;  1VJ5 A;  4KLU A;  1WCN A;  1NZB A;  5DEC A;  3OVS A;  1RM6 C;  2BPF A;  8ICT A;  1QQ7 A;  4AP9 A;  1S0V A;  3LVW A;  2KVS A;  4DO9 A;  4WJ3 B;  2EAP A;  4YXJ A;  9ICX A;  1NK4 A;  3NYB A;  5F2V O;  7ICK A;  4ICA A;  5J8Y A;  3H8S A;  3GV5 B;  4F4K A;  4JK1 A;  1PVP A;  5ALY A;  4R66 A;  1F44 A;  4ED6 A;  3PVX A;  4R65 A;  4DL7 A;  3RJE A;  5DQI A;  2W3R A;  2YMQ A;  4YMN A;  2BDU A;  1UT8 A;  2MUT A;  4F4Y A;  4O5E A;  3K4G A;  1PK3 A;  1NKC A;  3MDA A;  2UVV A;  3BS5 A;  2PMZ F;  4NLN A;  3PV8 A;  3PY8 A;  2PI4 A;  3AQL A;  1F5A A;  1X6I A;  2XY7 A;  3SV4 A;  5KFO A;  2ZH1 A;  4KLS A;  2BPC A;  4J9R A;  5AKX A;  1WWV A;  3LVV A;  3GIK A;  3WU2 U;  2FE9 A;  1EXN A;  1NKE A;  4AT8 A;  2QAR B;  3JPQ A;  2RDJ A;  4ED8 A;  2E1F A;  3ISD A;  8ICN A;  5B3Q A;  4NXX A;  1KFS A;  1BPX A;  4UAY A;  5HP4 A;  2PKE A;  3GQC A;  2I9G A;  3ZD9 A;  4BX9 C;  3PW5 A;  5KT6 A;  3FYH A;  4F4W A;  4YCX A;  2AJQ A;  4M47 A;  4DS4 A;  4O3N A;  4OCZ A;  4M9J A;  3BS7 A;  4PGQ A;  1ZQF A;  3WK7 A;  3C5G A;  5CHE A;  3I28 A;  2WTF A;  4EBC A;  2AU0 A;  3BQ1 A;  5DG9 A;  4FS1 A;  3V7J A;  3M6K A;  2ZH5 A;  3CK6 A;  1R8C A;  2YTU A;  1N56 A;  5AHX A;  4DFP A;  4AYB F;  2VA3 A;  4QJF B;  5AIB A;  4CCH A;  3QEA Z;  2WF6 A;  2ZTC A;  4QW9 A;  4UB6 U;  2ID1 A;  1X66 A;  2IOF K;  4Z6D A;  5J2J A;  2W54 A;  2FMS A;  4X4R A;  7ICG A;  3DEE A;  4BUG A;  3PST A;  5DB7 A;  2ZH6 A;  5ALU A;  9ICJ A;  1Z19 A;  1NK7 A;  2M0N A;  3BQ7 A;  1SIJ A;  2XY6 A;  3PW7 A;  4DFD A;  4K4G A;  4TUQ A;  1N2X A;  5ALV A;  4P0Q B;  5AKG A;  2HVH A;  2EH9 A;  1OUQ A;  1N5W A;  2W9B A;  1PVQ A;  4ECW A;  3BZK A;  4TUP A;  2BCV A;  3R9K A;  4XQ7 A;  1VLB A;  3BDP A;  1JX4 A;  9ICF A;  4WQK A;  2A3V A;  3E0F A;  3HT3 A;  4QWE A;  2ZH7 A;  5B3P A;  1WYG A;  5KFH A;  8ICV A;  9ICQ A;  4ATB A;  2HHS A;  4NLB A;  2ZJ5 A;  3IV6 A;  2IMW P;  1MC8 A;  4NL9 A;  1CEZ A;  7ICO A;  4WOY A;  1MIV A;  2HHP A;  4NXT A;  4I2J A;  2BZF A;  1IIP A;  5J0Y A;  1ZD5 A;  4F93 B;  2DKZ A;  1ZQO A;  3PW2 A;  5J2I A;  4J9P A;  2Q66 A;  1KW4 A;  3OSP A;  4CRX A;  4CDG A;  2HBJ A;  4UAW A;  3TAP A;  1QH9 A;  1XS9 D;  2DQN B;  1O03 A;  4F50 A;  1RG6 A;  5ALT A;  1UA0 A;  3G6Y A;  4EEK A;  4PL1 A;  3QXG A;  8ICQ A;  2J6T A;  2M2W A;  2W8K A;  1D8B A;  4IRK A;  2HN1 A;  3ISB A;  2K8C B;  2HVI A;  4RQ0 A;  4YG2 A;  1CRX A;  1KSP A;  4CF4 A;  4DSL A;  4KLL A;  8ICU A;  3UMB A;  3D2S A;  4O6A A;  5CB1 A;  5J0P A;  4EYH B;  1ED1 A;  1N5X A;  4K4I A;  2YN4 A;  4C4S A;  4M9H A;  2HBL A;  4C8M A;  1SZP A;  4CE6 A;  3Q8K A;  1R8A A;  2QLT A;  4MKP A;  5ALR A;  4PPX A;  5DGA A;  1VDV A;  4F72 A;  2AQ0 A;  4I2C A;  2PXI A;  1MSW D;  3WFP A;  3ER8 C;  4HAI A;  1ZQP A;  4USA A;  5KFZ A;  2F8L A;  3MR5 A;  3SI8 A;  3IP4 B;  3PHZ A;  2D3D A;  2KEY A;  2AGP A;  4ED3 A;  2H3Q A;  4X0A A;  1ZQD A;  9ICN A;  2BQR A;  5KFP A;  1SL0 A;  2G07 A;  1V97 A;  4EZ9 A;  4O68 A;  1ZQN A;  3QU2 A;  2JRZ A;  4KN7 A;  5G5H A;  2JH7 A;  8ICF A;  2FMQ A;  1FO4 A;  5KFM A;  4YD2 A;  2W7P A;  3M7D A;  5KFA A;  4P4O A;  5HRD A;  4FHP A;  1XC9 A;  4KX5 A;  3PSP A;  4UB3 A;  2FLL A;  3QYP A;  9ICE A;  4CF3 A;  1SV4 A;  5DED A;  2DRA A;  1CUK A;  4PH5 A;  4O3P A;  2YML A;  5J2D A;  2Z7J A;  4BWM A;  2FPM A;  1YLQ A;  2WFA A;  4X4U A;  4CGZ A;  3AL0 B;  2G08 A;  4X0B A;  3TAD C;  2MSN A;  2DKX A;  5AI6 A;  4WC2 A;  3OWG A;  1RYU A;  2G5I B;  1RYR A;  5J0T A;  2C2R A;  4NM2 A;  1NJX A;  4RQN A;  2YMP A;  4I2E A;  2HSZ A;  3EWA A;  1JI7 A;  5KG4 A;  1A76 A;  9ICH A;  2M2U A;  2EAN A;  5L9X A;  3QNM A;  5AKK A;  4DSE A;  3C23 A;  1TAM A;  5L1K A;  4QZG A;  2HW3 A;  4UAZ A;  1BPE A;  2ZXH A;  2BCU A;  7ICH A;  4F71 A;  2ASD A;  2DFL A;  2CN1 A;  2PFN A;  2ZH4 A;  1LVH A;  4NLC A;  1XO0 A;  1QQ5 A;  5DB6 A;  2C2D A;  1C7Y A;  1ZQR A;  4QZH A;  1IXR A;  2RP5 A;  4PHE A;  3FAH A;  4WC0 A;  1KN5 A;  2F76 X;  2HHQ A;  2D8C A;  4Y2X A;  3RJK A;  9ICA A;  2KZM A;  3H39 A;  5AKL A;  4BXO A;  4TQR A;  4C4R A;  5CFU A;  2MUT B;  5F9N A;  3Q8Q B;  4X4P A;  2ZHA A;  5J0U A;  3BS5 B;  4Q44 A;  4LEZ A;  4IS7 A;  2M2T A;  3Q8P B;  3CRX A;  4UAR A;  1F5S A;  3GDX A;  1S0O A;  2WAQ C;  2VA8 A;  4G9B A;  2NO4 A;  4GXK A;  1A0P A;  1ZQI A;  2EDU A;  2GLE A;  4M04 A;  5KFL A;  4OJL A;  3KHG A;  3MR6 A;  3H3A A;  3OTQ A;  4B9M A;  1Q3V A;  4LVS A;  4AT8 B;  1HUO A;  4RWN A;  4M6W A;  5DDY A;  1SWW A;  3GIL A;  4O3Q A;  2FPK A;  1ZJM A;  2W9M A;  3KD3 A;  2FJ6 A;  2E8P A;  4XJE A;  3HKZ F;  1XSP A;  4FHW A;  1T94 A;  4NJ8 A;  5AM4 A;  1BPZ A;  4UAT A;  4QWD A;  3C2L A;  4KLF A;  4YR3 A;  5DBC A;  3JPN A;  5AKZ A;  4LZG A;  3AU6 A;  4MFF A;  3UQ0 A;  3J81 j;  4B9V A;  1ZQG A;  2ZH9 A;  2W11 A;  2P6U A;  4RQ5 A;  1SXD A;  4PGY A;  2BCQ A;  4DOA A;  1XSN A;  2HHX A;  3H40 A;  1Z4N A;  1KDH A;  2K8B B;  3N7S C;  2CRX A;  5T14 A;  1NK9 A;  1RZT A;  3MCR A;  3TKA A;  5DBB A;  3RF9 A;  3H8W A;  2F44 A;  3MGV A;  2W55 A;  2YB4 A;  4WC6 A;  4FH3 A;  4JMU A;  2DBY A;  2MU2 A;  4NM1 A;  4WC7 A;  2VKQ A;  1TVA A;  4R8U B;  3H4B A;  1U48 A;  1Q78 A;  1ZXI A;  4QWA A;  3RB0 A;  2Y1I A;  4B9S A;  2IHN A;  2R8I A;  2XGQ A;  3QEB Z;  5CRX A;  1S0N A;  3SR6 A;  4CF5 A;  4RQ3 A;  5JRT A;  4KLT A;  3E2E A;  2F1H A;  4I2D A;  8ICJ A;  7ICR A;  1SGG A;  3AQK A;  3KZX A;  2W9B B;  4I27 A;  3ERC C;  9ICI A;  9ICK A;  1Z00 A;  5IIK A;  5DB8 A;  2H3F A;  3KTQ A;  3H37 A;  3TAC B;  4DL4 A;  1X9X A; 
#chains in the Genus database with same CATH homology
 2P66 A;  1NKE A;  4AT8 A;  4YVZ A;  2HHV A;  3JPQ A;  2RDJ A;  3PNC A;  4ED8 A;  3M9N B;  3ISD A;  8ICN A;  2C28 A;  7ICU A;  1KFS A;  3AUO A;  8ICS A;  1BPX A;  4UAY A;  5HP4 A;  5KFE A;  4ECR A;  1XU4 A;  1KTQ A;  2RFF A;  5CA7 A;  3GQC A;  5KT2 A;  4DL2 A;  2I9G A;  3ZD9 A;  3M9O B;  5KFV A;  3PW5 A;  5KT6 A;  1S97 A;  1DOQ A;  2JEJ A;  3FYH A;  4F4W A;  4YCX A;  3V6J A;  4M47 A;  2AJQ A;  4DS4 A;  4O3N A;  2JZB B;  4FS2 A;  4ECX A;  2BPG A;  5HRI A;  5KFJ A;  4Q43 A;  1D8L A;  1ZQA A;  3KHR A;  5J2H A;  5KG7 A;  1T8E A;  1KLN A;  1T7P A;  2BR0 A;  5KG0 A;  4M9J A;  4EBD A;  1PX5 A;  3V6H A;  2DPJ A;  4PGQ A;  1ZQF A;  4LZD A;  3JPP A;  3RRG A;  1T4G A;  4KLH A;  3RB3 A;  3C5G A;  3JYY A;  5BPC A;  4QWB A;  5KFX A;  5CJ7 A;  3HIY A;  1COO A;  2WTF A;  4RU9 A;  5D49 A;  3UPS A;  3ZDC A;  4EBC A;  2AU0 A;  4J9M A;  3BQ1 A;  5DG9 A;  4TQS A;  1TK0 A;  4B9L A;  8ICL A;  4FS1 A;  4YR2 A;  3M8S A;  3V7J A;  1S9F A;  1ZQT A;  3RAX A;  1NJY A;  2ZH5 A;  4O3R A;  1R8C A;  1UT5 A;  4RQ7 A;  4NKT A;  3PX4 A;  4I2F A;  1N56 A;  2J6U A;  3BQT A;  4DFP A;  4UB4 A;  3V6K A;  1NJW A;  1ZQJ A;  2DR8 A;  4YR0 A;  3TQ1 A;  4O5K A;  2VA3 A;  4F3O A;  5EWG A;  3SV3 A;  3PW0 A;  4C8O A;  4DSJ A;  5D46 A;  2ASL A;  4F2S A;  3UPQ A;  4CCH A;  8ICI A;  5IIM A;  3QEA Z;  2ZTC A;  4QW9 A;  2J6S A;  5DG8 A;  4X4V A;  2PFP A;  1JMS A;  2ID1 A;  3OJS A;  3C1Y A;  4E80 A;  4FBT A;  4I2H A;  4Z6D A;  4ECY A;  1MQ3 A;  3PR5 B;  5J2J A;  3NGD A;  1X9S A;  4X4S A;  2F1I A;  5KFK A;  2RDI A;  2FMS A;  3MGI A;  1ZQM A;  4X4R A;  2BHN A;  4F4X A;  4FO6 A;  1QSL A;  4JV0 A;  7ICG A;  5DB7 A;  3PMN A;  2BCR A;  4TUR A;  4C8K A;  2ZH6 A;  3QZ7 A;  9ICJ A;  9ICT A;  1NK7 A;  2JEI A;  4DOC A;  4J9L A;  2FMP A;  5HRL A;  8ICA A;  3MFH A;  5KFI A;  3RBD A;  2XCA A;  3M8R A;  4F5N A;  3ZDE A;  2XY6 A;  7ICV A;  3PW7 A;  4LT6 A;  3T5K A;  5F9L A;  1DK2 A;  4DSK A;  5KFG A;  4K4G A;  1KFD A;  2KFN A;  4TUQ A;  4KLO A;  3WFQ E;  2W8L A;  3MDC A;  4XRH A;  5J0R A;  2R8K A;  3RH6 A;  2HVH A;  5HHI A;  2KP7 A;  2W9B A;  5DLG A;  4RQ4 A;  3IHQ B;  9ICV A;  4ECW A;  1ZJN A;  1NZP A;  1MIY A;  3HP6 A;  4TUP A;  1NK5 A;  5L1L A;  5DQH A;  4DFJ A;  2BCV A;  2ZUD A;  5III A;  3EW9 A;  3B0Y A;  4O3S A;  2ZUB A;  4XQ7 A;  1HUZ A;  4X4N A;  2C22 A;  1U4B A;  2NRT A;  4UBC A;  3LDA A;  3BDP A;  1U45 A;  1JX4 A;  5KFF A;  3AQM A;  9ICF A;  4DL6 A;  3LK9 A;  5KG2 A;  1LV5 A;  9ICR A;  3HT3 A;  3EYZ A;  4R64 A;  4PHD A;  3UXN A;  4QWE A;  2ZH7 A;  1ZQB A;  1BGX T;  3ORY A;  3RB4 A;  4I2A A;  5KFH A;  4HYK A;  8ICV A;  1OU5 A;  5J0O A;  4FBU A;  2HHS A;  1BPB A;  4O5C A;  9ICQ A;  1S76 D;  2ZJ5 A;  5DG7 A;  5J2B A;  4M9N A;  1U47 A;  4Q8F A;  2IMW P;  1MC8 A;  3ZD8 A;  1Q79 A;  1CEZ A;  2FLP A;  4M9L A;  7ICO A;  2P6R A;  1MIV A;  3Q8S B;  2NRV A;  4YN4 A;  2HHP A;  9ICC A;  2JZB A;  4MFA A;  3OSN A;  4ECQ A;  4I2J A;  3N4M B;  4ECZ A;  4QZC A;  4P4M A;  1BPY A;  4P2H A;  1UEU A;  2ZH2 A;  7ICI A;  3GIJ A;  4E8F A;  5J0Y A;  4F93 B;  3ETL A;  2PI5 A;  7ICP A;  8ICR A;  1ZQO A;  3PW2 A;  3GV8 B;  1L3S A;  4ECU A;  4M0A A;  5J2I A;  4J9P A;  4FHY A;  2DR9 A;  4S3N A;  2Q66 A;  3OSP A;  9ICS A;  3PW4 A;  5J0X A;  4RQ8 A;  2DPI A;  4UAW A;  3TAP A;  4TUS A;  4I2G A;  4MEY A;  4Z6C A;  4IRD A;  3OHB A;  9ICW A;  4ATB A;  4ELT A;  2W9A A;  8ICW A;  5KG6 A;  3BQ2 A;  3THV A;  1XS9 D;  2XY5 A;  1MQ2 A;  4DQI A;  4F50 A;  2ASJ A;  2H5X A;  4EBK A;  1UA0 A;  1QLN A;  3G6Y A;  1R89 A;  1RYS A;  8ICQ A;  3MBY A;  1RPL A;  2J6T A;  2B21 A;  2O1P A;  5HML A;  4BWJ A;  4ATB B;  2M2W A;  3TAQ A;  2W8K A;  4PHA A;  4IQT A;  4I2B A;  4IRK A;  1QSS A;  5KG3 A;  5J2G A;  2R8J A;  3ISB A;  4F5O A;  4IR1 A;  3HPO A;  3LWL A;  4JV2 A;  4RQ0 A;  2BCS A;  8ICE A;  4B9N A;  2HVI A;  8ICO A;  1WOT A;  4YG2 A;  4WC3 A;  1KSP A;  2ALZ A;  4RPX A;  4UD4 A;  5DQG A;  4DSL A;  4KLL A;  4IG8 A;  8ICX A;  8ICU A;  5J29 A;  3FDS A;  3GFK B;  2BDP A;  1JXE A;  2V9W A;  5CWR A;  4C8L A;  4X4T A;  4F4Z A;  5CB1 A;  4WC1 A;  5J0P A;  4EYH B;  2C2E A;  5HRF A;  2AGO A;  2KTQ A;  3AU2 A;  4K4I A;  4RUC A;  1D8Y A;  4IR9 A;  4QZE A;  2R8H A;  9ICM A;  4M9H A;  1R8B A;  3IM1 A;  4J9K A;  3M9M B;  4C8M A;  1SZP A;  3Q8K A;  4M9G A;  1R8A A;  5KG5 A;  5HRB A;  1Y88 A;  2KZZ A;  5HRE A;  1NKB A;  1DGS A;  4KLM A;  2UVR A;  4QZI A;  5KFQ A;  3RTV A;  3RR8 A;  7ICJ A;  3RH4 A;  4J9N A;  3OUY B;  2ZUC A;  4QWC A;  5HRG A;  4DL5 A;  4NY8 A;  8ICY A;  1NO5 A;  2ZH3 A;  3L9D A;  4X4O A;  4PPX A;  5DGA A;  4KLD A;  4NLG A;  1S77 D;  7ICL A;  4J9O A;  2AQ0 A;  4I2C A;  1L3U A;  2PXI A;  4MF2 A;  2HHU A;  4DF8 A;  5BOM A;  4WBZ A;  3EPI A;  4KLI A;  2VAN A;  1MSW D;  4QZ9 A;  3WFP A;  3UXP A;  3SYZ A;  1ZQP A;  3PML A;  4JUZ A;  2V4R A;  4O0I A;  5KFZ A;  4IQW A;  3MR5 A;  4J9S A;  3SI8 A;  8ICP A;  4EEY A;  4RWO A;  1VFG A;  2I1Q A;  3H7I A;  2DR5 A;  3V7K A;  5D4B A;  3HWT A;  4JWM A;  4DWI A;  5IIL A;  7ICQ A;  4BDP A;  2AGP A;  2KFZ A;  2MAX A;  3K75 D;  4NKU A;  5KFD A;  3C1Z A;  3T5H A;  3RH5 A;  7ICE A;  4E7X A;  9ICO A;  4G3I A;  1B43 A;  3C21 A;  4ED3 A;  2A1J B;  3H38 A;  4ED0 A;  4X0A A;  1ZQD A;  9ICN A;  4JV1 A;  3RB6 A;  5KFP A;  2BQR A;  3UXO A;  5IIO A;  4MF8 A;  1SL0 A;  4KTQ A;  5KFN A;  1TK8 A;  1ZQE A;  1QTM A;  4EZ9 A;  3C18 A;  4M2Y A;  1BNO A;  3KHL A;  4RPY A;  1ZQN A;  4KN7 A;  1VJ7 A;  2ZJA A;  4KLE A;  5EWF A;  4DQP A;  3HW8 A;  5KFT A;  3C2M A;  4FHV A;  4JWN A;  8ICF A;  5CR0 A;  1IM4 A;  4F5Q A;  3PX0 A;  1SKR A;  2FMQ A;  1NK0 A;  1SKS A;  4QZB A;  3UQ2 A;  5J2A A;  5KFM A;  4DFK A;  4YD2 A;  3H4D A;  2Y1J A;  4E0D A;  5KFA A;  4P4O A;  1QSY A;  5HRD A;  3V7L A;  4ELU A;  4FHP A;  4IQU A;  8ICK A;  3RJJ A;  5HR9 A;  1T3N A;  1XC9 A;  1ZQQ A;  3H8J A;  5KFU A;  5CP2 A;  3RJH A;  4ED1 A;  1BNP A;  4UB3 A;  3Q8M A;  2FLL A;  4KLQ A;  9ICE A;  4AT9 B;  1SKW A;  3ZDD A;  4DFM A;  3C2K A;  2PFO A;  2NRX A;  4FH5 A;  1U9L A;  4ED7 A;  5DED A;  1BVS A;  3Q8L A;  2JEG A;  2DRA A;  1CUK A;  1MIW A;  3JPS A;  2LYH A;  4I2I A;  4PH5 A;  4DLG A;  4QW8 A;  2VA2 A;  3T5J A;  1V4A A;  1A77 A;  1NK6 A;  4O3P A;  3ZDB A;  5J2D A;  4M6W B;  4BWM A;  2FPM A;  1BPD A;  4DQS A;  1YLQ A;  2PBE A;  3OV7 A;  7ICS A;  2M9N A;  2BE3 A;  4X4U A;  5BOL A;  4X0B A;  4FHX A;  5EWE A;  5KFC A;  1ZQV A;  4XQ8 A;  4WC2 A;  4EZ6 A;  5HC9 A;  4F5P A;  2IHM A;  4RWQ A;  3OVA A;  1RYR A;  1JIH A;  5J0T A;  2C2R A;  3HJ1 A;  4B9T A;  4NM2 A;  1TFW A;  1NJX A;  4ECV A;  1XO1 A;  5KFB A;  4I2E A;  5TZV A;  3EWA A;  4YFK A;  3EPG A;  3T3F A;  3PX6 A;  5KG4 A;  3OVB A;  4XA5 A;  3C5F A;  1L3T A;  1LB2 B;  1A76 A;  3QZ8 A;  9ICH A;  2M2U A;  1NJZ A;  5L9X A;  3NTU A;  4RZR A;  2XO7 A;  3BQ0 A;  4EBJ A;  2UVU A;  4YXM A;  4ZH4 A;  3OUY A;  4DSE A;  3B0X A;  9ICU A;  3HJ4 A;  1WCL A;  3C23 A;  5L1K A;  4QZG A;  2PFQ A;  4DQR A;  4RQ1 A;  9ICP A;  2NRK A;  1XSL A;  4RNO A;  2BKE A;  3RRH A;  3V72 A;  3WFO A;  4ELV A;  4KLJ A;  2HW3 A;  3TFR A;  1S0M A;  4UAZ A;  4EP7 A;  1BPE A;  2BCU A;  2R8G A;  8ICG A;  7ICH A;  4F92 B;  3OGU A;  2ASD A;  3JPO A;  2DFL A;  2F1J A;  3GV7 B;  5C5J A;  2PFN A;  1TAU A;  5HRK A;  2ZH4 A;  4UQG A;  2XC9 A;  3JPT A;  1H38 A;  3ZDA A;  7ICT A;  1KNY A;  4C8N A;  1ZQS A;  5DB6 A;  4WCW A;  2UVW A;  5J0S A;  2C2D A;  4Q8E A;  1TV9 A;  4PHP A;  4EYI B;  1S10 A;  4DEZ A;  5KG1 A;  1C7Y A;  4QZH A;  1V9P A;  1IXR A;  3HX0 A;  1KRP A;  4F2R A;  4I28 A;  4O9M A;  4PHE A;  5J2C A;  4WC0 A;  1D9F A;  5KFR A;  1U49 A;  2ZTE A;  2A1J A;  4QZD A;  2HHQ A;  9ICB A;  3LQC B;  4M5D A;  8ICC A;  2FLN A;  5J0Q A;  7ICM A;  3RJK A;  1JXL A;  1L3V A;  9ICA A;  2KZM A;  3H39 A;  4WBY A;  3OJU A;  1X9W A;  4NXZ A;  4DSI A;  2XCP A;  4PGX A;  3T5L A;  5KT7 A;  3QE9 Y;  5HRH A;  3RBE A;  4BXO A;  4TQR A;  5DGB A;  4RNM A;  3JPR A;  2V4Q A;  2MUT B;  2ZTD A;  4KIT B;  1ZQZ A;  5F9N A;  5DB9 A;  3Q8Q B;  2HHX A;  4X4P A;  4UBB A;  3TFS A;  7ICF A;  1B22 A;  1JQR A;  5J0U A;  5DBA A;  4UB5 A;  3MGH A;  4DL3 A;  1X9M A;  3JZ0 A;  3ISC A;  2ZHA A;  4Q44 A;  3EZ5 A;  4X4Q A;  8ICZ A;  2ZH8 A;  4Z6E A;  4P4P A;  3PO4 A;  9ICG A;  3RAQ A;  1RXW A;  3Q8P B;  4RPZ A;  4MEX A;  1HJP A;  2BGW A;  2M2T A;  2DR7 A;  4XUS A;  3GDX A;  1K1S A;  1S0O A;  1ZQY A;  2VA8 A;  1ZQH A;  1ZQW A;  2HHT A;  1Z00 B;  3PR4 A;  1UA1 A;  4GXK A;  4MFC A;  5DKW A;  4QZA A;  1ZQI A;  4AT9 A;  4RWP A;  4MFF A;  1ZQR A;  2BQU A;  4M04 A;  3RJG A;  5KFL A;  3C66 A;  3TI0 A;  1ZQC A;  3KHG A;  4ECT A;  3MR6 A;  3TAN A;  3H3A A;  4Q45 A;  4GLX A;  2HHW A;  2DVI A;  4ECS A;  4AT8 B;  1XWL A;  4DS5 A;  1D9D A;  2IBK A;  1HUO A;  4B9M A;  4LVS A;  4M6W A;  1KFT A;  1UET A;  5DDY A;  4RWN A;  3GIL A;  2W9C A;  2GWS A;  3MAB A;  1TAQ A;  5J2F A;  1RXV A;  4O3Q A;  4B9U A;  2FPK A;  3KHH A;  4J9Q A;  9ICL A;  5L1I A;  5KFY A;  5L1J A;  1ZJM A;  2ISO A;  5IIN A;  2W9M A;  3LWM A;  5HMM A;  5EOZ A;  4GC7 A;  4GC6 A;  4X5V A;  1UEV A;  1KEJ A;  1ZQL A;  4BXO B;  3G6X A;  3MR3 A;  4I29 A;  2JEF A;  8ICM A;  2FPL A;  1XSP A;  4FHW A;  4R8U A;  1BPZ A;  4Z6F A;  4QWD A;  5KFS A;  1TKD A;  4NLZ A;  3C2L A;  8ICB A;  2ZHB A;  4F5R A;  1ZQX A;  4KLF A;  4AT7 A;  4IQV A;  5KFW A;  5DDM A;  5DBC A;  4YR3 A;  1K1Q A;  3JPN A;  4DSF A;  3AU6 A;  4LZG A;  4YQW A;  3UQ0 A;  1SL1 A;  4DOB A;  4R63 A;  1ZQG A;  5KT4 A;  2AQ4 A;  3GII A;  5HNK A;  4GXJ A;  4B9V A;  4DF4 A;  1PZN A;  1X2I A;  4YMO A;  2IA6 A;  4O3O A;  4KLG A;  2ZH9 A;  2P6U A;  4RQ5 A;  4PGY A;  2BCQ A;  1FA0 A;  2KN7 A;  4DOA A;  3RR7 A;  5KT5 A;  5JUM A;  3H40 A;  5J0W A;  4YD1 A;  1XSN A;  4RUA A;  1N48 A;  1KDH A;  1L5U A;  2ISP A;  4F8R A;  1TFR A;  2O5A A;  2ATL A;  5KT3 A;  1NK9 A;  3PO5 A;  2NRZ A;  3WFR E;  1RZT A;  5J2K A;  5J2E A;  5DBB A;  2NRW A;  2DRB A;  3G6V A;  3N97 B;  1ZYQ A;  3BJY A;  1ZQK A;  3H8W A;  2W9C B;  4GXI A;  4ED2 A;  5KTQ A;  4KLU A;  1WCN A;  4RT3 A;  5DEC A;  4WC6 A;  3OVS A;  4FH3 A;  3TAR A;  4YP3 A;  2KZ3 A;  2BPF A;  4NM1 A;  4WC7 A;  8ICT A;  3RJF A;  5IIJ A;  1DK3 A;  4YMM A;  5HHH A;  4WC5 A;  1TVA A;  1S0V A;  3OHA A;  4R8U B;  2AGQ A;  3H4B A;  1U48 A;  4WC4 A;  4DO9 A;  4YXJ A;  4KMU A;  1Q78 A;  2OWO A;  2M2V A;  9ICX A;  1NK4 A;  3NYB A;  4AT7 B;  5F2V O;  4QZF A;  7ICK A;  4QWA A;  4K4H A;  3H8S A;  3GV5 B;  4F4K A;  4JK1 A;  3RB0 A;  4RNN A;  2Y1I A;  2ZJ8 A;  4QZ8 A;  4R66 A;  2BQ3 A;  4B9S A;  1Z3E B;  4RT2 A;  4ED6 A;  1ARO P;  3Q8R B;  4DQQ A;  3PVX A;  4BGD A;  4R65 A;  3MR2 A;  4DL7 A;  3RJE A;  3WFS C;  1NOM A;  5DQI A;  4IRC A;  2IHN A;  2R8I A;  2XGQ A;  4YMN A;  3QEB Z;  7ICN A;  5CHG A;  1S0N A;  4NLK A;  2Q0Z X;  4RQ3 A;  1UT8 A;  2MUT A;  5DLF A;  4KLT A;  1TK5 A;  1JN3 A;  4KN4 A;  4F4Y A;  4DLE A;  4UB2 A;  3E2E A;  1JAJ A;  2F1H A;  4O5E A;  4I2D A;  3K4G A;  8ICJ A;  1NKC A;  2UVV A;  3MDA A;  7ICR A;  1ZQU A;  3AQK A;  2W9B B;  4NLN A;  3PV8 A;  3PY8 A;  2XGP A;  2PI4 A;  3AQL A;  3SZ2 A;  4EBE A;  1F5A A;  4RQ6 A;  4I27 A;  2XY7 A;  1TFY A;  9ICI A;  3SV4 A;  9ICK A;  5KFO A;  1NK8 A;  4UD5 A;  4KLS A;  1Z00 A;  2BPC A;  2ZH1 A;  4J9R A;  5IIK A;  5DB8 A;  4RQ2 A;  3MFI A;  8ICH A;  3KTQ A;  3RJI A;  3AQN A;  1SL2 A;  3GIK A;  3H37 A;  1EXN A;  4UB1 A;  4F91 B;  4DL4 A;  3GIM A;  1ZET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...