4UB5A

Dna polymerase beta substrate complex with a templating cytosine, incoming 8-oxodgtp, and mn2+, 5 s
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
326
structure length
310
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords 5'-D(*CP*CP*GP*AP*CP*CP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3'
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 310
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub5A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub5A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub5A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub5A03
4O3SA 1KEJA 3C23A 4RT2A 4NLNA 3OHAA 3T5LA 3UXNA 1JX4A 9ICCA 4IR1A 1JAJA 1NZPA 4F4XA 1MQ3A 4Q8FA 4ECRA 1NKEA 5J2DA 4F92B 1JXLA 2HVIA 3KHHA 3BDPA 3UPSA 4QWCA 2WTFA 2FPKA 4X5VA 3GV8B 3RBEA 2DPIA 2P6RA 4F4KA 4KLEA 4KLLA 2F1JA 2M2TA 4FHWA 9ICTA 3C5FA 5KFLA 3EZ5A 5KT3A 4YR3A 3H8JA 2BCVA 5DGBA 2J6SA 4DFPA 2HVHA 4ATBA 3AU2A 1T4GA 4YVZA 2ISPA 1MIYA 2ASDA 2HHPA 4YXMA 4P4PA 4X4UA 1SL0A 4O5CA 2BPCA 3Q8QB 4B9SA 5HRBA 3JPNA 1QLNA 3OUYA 8ICMA 1L3UA 2DPJA 1NK5A 1RYRA 2F1IA 4RQ1A 3MFHA 9ICMA 3PMNA 1UA0A 4DQPA 2LYHA 5DB9A 4UB5A 4I2FA 4FH3A 5HC9A 1S76D 4I2BA 3T5JA 2FLLA 1YLQA 4QZ8A 2V9WA 4QZEA 4YXJA 3OHBA 5EOZA 4FBTA 2HHUA 1WOTA 3RJHA 2P66A 8ICUA 4E8FA 4JWNA 3H39A 4X4NA 4WC2A 3JYYA 4M2YA 5J2FA 1JQRA 1LV5A 5KFHA 1TK0A 4QWDA 1MQ2A 1V9PA 2MUTB 4TQSA 5DQGA 8ICCA 3V7KA 5KFUA 4MFCA 4EEYA 2ZHAA 5HMLA 1WCNA 4M9JA 5KFXA 4RQ8A 4PHAA 4FH5A 4ELUA 3HW8A 2ATLA 1TVAA 5KFOA 1JXEA 3MDCA 5CJ7A 5J2AA 2V4QA 3GQCA 4RWQA 4AT7A 4AT8B 2FMQA 4RQ7A 3G6YA 7ICNA 5EWGA 2BQRA 1B43A 3BQ1A 7ICMA 4YR0A 4EZ6A 7ICHA 1DK2A 3C66A 5TZVA 4EP7A 4B9LA 4HYKA 2H5XA 2ZH9A 3PX0A 4K4HA 5J2CA 4FHPA 9ICFA 2RDIA 1ZQPA 5L1LA 5HRDA 3HJ4A 4I2DA 3MR3A 3Q8SB 9ICNA 2FLPA 5KTQA 5CP2A 1ZQNA 1TKDA 1KSPA 2BDPA 4X0AA 5DB7A 5KFAA 9ICVA 5J0QA 3PX6A 3RJGA 5KFQA 4YQWA 1XS9D 5KT7A 4QZIA 3RTVA 2DRBA 3AQLA 4ECSA 4KLFA 4WC6A 1PZNA 4PHPA 4UAZA 1ZQZA 4R8UA 4F5OA 5JUMA 4Q43A 4TQRA 4C8NA 2XC9A 3E2EA 1NK6A 4BXOB 4DL7A 3RJKA 8ICIA 4R65A 1BPZA 1TAUA 4IQTA 5J0UA 5KT4A 4RNNA 4IQVA 1U49A 1SL2A 4UAWA 3MDAA 3THVA 1H38A 4XUSA 1ZQJA 3NTUA 4QZGA 3UXPA 4YP3A 1C7YA 1KFTA 4RNMA 7ICFA 1ZQFA 5KFZA 3ISCA 4UQGA 2W9MA 2F1HA 2XGQA 4EBJA 1X2IA 3V7LA 4F93B 2JZBA 4DL5A 3UQ2A 3ZDCA 9ICIA 4X4SA 3PR5B 2ZH4A 2BCRA 4DF4A 1NO5A 4JV1A 4Z6DA 2O1PA 4DSJA 2DR9A 2BHNA 1UETA 5CWRA 5DB6A 5KG3A 5DG7A 5BOLA 4FHYA 2AGOA 2ZTDA 5KFTA 1NJZA 4B9VA 3ZDDA 3C2KA 2FPLA 1MIVA 1ZJNA 1A77A 3BQ0A 4I2EA 2PBEA 5KFSA 4ECYA 1HJPA 5J2KA 1NKBA 2M2UA 4KLOA 1B22A 1A76A 3PW2A 1NJXA 2UVVA 4M9NA 3JPRA 4UB1A 4DL6A 1Y88A 1ZQMA 2FMSA 2J6TA 2VA2A 4ZH4A 3RR8A 4LVSA 3PMLA 4FHVA 1NOMA 5KG7A 3JPTA 4ED7A 3HX0A 8ICPA 3C2LA 2ISOA 3C5GA 3UQ0A 4KLQA 3H3AA 1XO1A 4DSLA 3T3FA 4MF8A 4DLEA 3PW4A 2KTQA 4F3OA 2KZMA 4RQ6A 1K1QA 4P4MA 2W9BB 5CR0A 4F4WA 2XY6A 3TARA 3HT3A 4KLDA 3MGIA 2P6UA 3BJYA 1UT5A 4I27A 3JPOA 8ICFA 2A1JA 4RU9A 1EXNA 2DR5A 2BPFA 4RQ3A 7ICRA 4RQ5A 4ED0A 4F4YA 3RB6A 4DQIA 4I2HA 4MF2A 9ICJA 1JN3A 1KNYA 3HWTA 5DG9A 1ZETA 1XC9A 2R8JA 7ICEA 3RB3A 2UVWA 4YD1A 4KLHA 3JPSA 9ICRA 2KZZA 2JEIA 4O5EA 2I1QA 3TAPA 5J0OA 5KFDA 3JPPA 3GIKA 4LT6A 4PGQA 3G6VA 5L1KA 4EBKA 5HRGA 8ICTA 2J6UA 4RWNA 5J2HA 3H40A 4ECZA 5KFEA 1WCLA 1NKCA 1HUZA 2ZUDA 4B9MA 4WC0A 5DB8A 2W9AA 4X4TA 3QZ8A 1BNPA 3ISBA 4F5NA 3IHQB 4Z6CA 2B21A 3HP6A 1L3VA 3H8WA 5IIOA 5DDMA 3UPQA 4FS1A 4DO9A 1L3SA 2PFNA 4F2RA 4X4PA 5IIIA 3M8RA 4X4QA 4MEYA 3WFRE 3M8SA 2NRTA 3RBDA 5J0WA 4IRCA 3RB0A 2BCQA 4G3IA 3AUOA 9ICUA 1Z00A 2RFFA 2R8IA 3PO4A 2ASJA 4CCHA 1MSWD 3GV5B 1SKSA 4FS2A 5J0SA 4B9TA 2NRXA 4BGDA 4XQ8A 4DF8A 1ZQQA 4F50A 2ZH6A 4NM2A 2V4RA 3OUYB 2XGPA 1TK5A 2R8KA 2C22A 8ICBA 4JK1A 3WFQE 4I29A 4IQUA 2PXIA 2PFQA 1ZQVA 4XA5A 4J9MA 4ED2A 8ICEA 1CUKA 2HHXA 8ICQA 2FLNA 4RNOA 4ECTA 1ZQEA 2BPGA 4DFKA 4XQ7A 5C5JA 3OJUA 1AROP 1SL1A 8ICNA 4PHEA 4RPXA 4DLGA 3AQKA 4GXKA 1KFDA 4JUZA 4ED3A 5KFNA 4GC6A 7ICUA 8ICKA 9ICWA 5D49A 7ICGA 4F91B 5J0XA 4DSEA 4WC1A 8ICXA 5HRFA 3OV7A 5KT5A 3Q8MA 2JEJA 3RH4A 1U47A 4NKUA 4KLMA 3Q8RB 1SKWA 2MUTA 7ICOA 2BCUA 4X0BA 4O3RA 1S0VA 3PVXA 3L9DA 4M04A 1BVSA 1HUOA 3MBYA 9ICPA 3QEBZ 3ZDEA 2HHVA 3H8SA 4Z6FA 4QZAA 3NGDA 2UVUA 1CEZA 3PNCA 4AT7B 4M6WA 4QW9A 4RWPA 4QZCA 1S77D 1PX5A 1ZQDA 4M5DA 3K75D 3N4MB 9ICBA 1OU5A 4MFFA 1U48A 4X4OA 2ZJAA 1ZQBA 1NK8A 4O3OA 3OVBA 5KG1A 3ZDBA 1COOA 2DFLA 3IM1A 4GC7A 3KHLA 2OWOA 3LQCB 1BPDA 1JMSA 5HRHA 1DOQA 1XU4A 3G6XA 3WFOA 3TFRA 2IHMA 3EYZA 5J2BA 1D8LA 3H4BA 4YD2A 4RQ0A 3MR5A 1UEVA 3EPIA 5KG2A 2C2EA 5HP4A 1T3NA 5J0RA 1S0MA 4M9LA 4R63A 1VJ7A 4ATBB 4R8UB 2DR8A 2C28A 4NLKA 3H37A 1ZQAA 5J0YA 3TI0A 2I9GA 8ICAA 2ZH1A 4WCWA 1V4AA 4QWBA 4DSIA 5F9NA 5KFVA 2W8KA 5KG5A 4E0DA 2M2VA 2NRKA 4KN4A 8ICYA 5HHHA 3C21A 1TV9A 2BKEA 4QW8A 2W9CA 4WBZA 1TFYA 1R8CA 4P4OA 4GXIA 1XWLA 1S9FA 5KG6A 3JPQA 4J9OA 1LB2B 1QSLA 1R8BA 3WFPA 2JZBB 3GIMA 1U45A 5J29A 4I2JA 4DL3A 3SV3A 1ZQIA 2R8GA 3T5HA 4I2AA 4KLTA 7ICQA 4ED6A 3NYBA 4WC5A 5KFRA 1T7PA 4EYIB 5CB1A 2Y1JA 2VA3A 3RRHA 3B0YA 3N97B 5KFPA 8ICLA 8ICWA 3H38A 4AT9A 1U4BA 2PFPA 3OVSA 4FBUA 3EW9A 4EBEA 4NM1A 2BR0A 2DRAA 9ICOA 4YG2A 4UAYA 3QZ7A 3OSNA 1D9DA 4BDPA 3RJFA 4WC7A 3AQMA 3GILA 3C18A 2NRWA 4J9SA 3GIIA 3GV7B 3PV8A 1NJYA 3ZDAA 3RRGA 4RPYA 3QE9Y 4ECQA 4JV2A 4KLIA 1MC8A 4GXJA 2FPMA 4Q8EA 2NRZA 5HMMA 4F2SA 4KMUA 1ZQYA 3TFSA 1Q79A 1UT8A 3AQNA 1X9SA 3KHRA 4E80A 2ZH8A 4QZBA 3V7JA 5DLFA 1X9MA 4NY8A 4YR2A 1F5AA 5DG8A 2ZTCA 3V72A 1N48A 1ZQCA 3PY8A 4M47A 3ISDA 3PR4A 1NK9A 5DQHA 1QTMA 4RPZA 4DOCA 3SI8A 4UD5A 4BWMA 1ZYQA 1Z3EB 1ZQXA 3V6HA 2XCPA 4ECUA 4MEXA 1ZQLA 2A1JB 4QWEA 4I28A 9ICKA 1ZQSA 9ICQA 4O3NA 2MAXA 1UA1A 3TANA 2FMPA 4NKTA 5DEDA 4PPXA 4KLSA 3AU6A 3OVAA 7ICKA 3RAQA 5KFFA 5DGAA 5DECA 1RXVA 5KFGA 4YMMA 4KN7A 4DQRA 1ZQKA 2IMWP 3HIYA 2Q66A 4QZHA 1SKRA 7ICJA 1JIHA 5DLGA 4XRHA 3V6KA 3EWAA 1RXWA 1R89A 2AU0A 4DS4A 4Q45A 5J2EA 3TQ1A 4UB2A 3C1YA 1T8EA 2IBKA 2AQ4A 8ICOA 2AJQA 1L5UA 5HNKA 2PI4A 3PW7A 4LZGA 1Q78A 8ICHA 1BPYA 1KDHA 7ICPA 1TFWA 1ZQWA 2BGWA 1ZQTA 5KFIA 1ZQGA 2DR7A 3LWMA 3WFSC 4RZRA 4I2CA 2ZH3A 2ZH2A 4M0AA 1ZQUA 4IRKA 3MR6A 3RJIA 5DKWA 3JZ0A 5KFYA 4RUCA 1BPEA 4PGXA 4PH5A 4DFMA 2VA8A 3LWLA 1KLNA 4IG8A 4Q44A 2C2RA 3H4DA 1NK7A 5KG4A 1L3TA 3Q8KA 1Z00B 3PW5A 1BGXT 2M9NA 1K1SA 3Q8LA 3SV4A 3PO5A 4ECXA 4C8OA 9ICLA 3Q8PB 4MFAA 2BQUA 3M9MB 4J9KA 1NK0A 1ZQRA 1KRPA 2JEFA 1TFRA 3UXOA 5KT2A 5KG0A 1ZQOA 5KFWA 4J9NA 4J9QA 4KLGA 3C2MA 5HREA 5KFKA 1IM4A 3C1ZA 2DVIA 3ORYA 3K4GA 4TUPA 4F8RA 2XY7A 5DBBA 3LDAA 1S97A 1KFSA 3BQTA 5J2IA 2ZUBA 4C8MA 2HHQA 2KFNA 3PW0A 2O5AA 3ZD9A 5KT6A 5IIMA 1D8YA 2PFOA 1DK3A 1ZQHA 4ELTA 4R66A 2HW3A 3OGUA 4K4IA 4TUQA 1KTQA 7ICTA 3M9OB 4J9LA 3V6JA 3RH5A 8ICRA 2VANA 4RQ4A 3GFKB 3HJ1A 4WC3A 2XO7A 2RDJA 2UVRA 5EWFA 1S10A 4QZFA 1TK8A 9ICSA 4NLGA 4AT8A 4B9NA 5IIJA 4PHDA 1DGSA 1QSSA 2ASLA 1D9FA 2KN7A 4IRDA 5DBAA 4KTQA 2KP7A 2BQ3A 3MFIA 3MGHA 4KITB 2JEGA 8ICZA 1TAQA 5IINA 4C8LA 8ICJA 1U9LA 5KFCA 4UBBA 5DBCA 4O3PA 3PX4A 4UB4A 4DS5A 4RUAA 4TURA 2KFZA 2AQ0A 4UB3A 8ICVA 4M6WB 4LZDA 4X4VA 4YMOA 3MR2A 1X9WA 4QZ9A 4C8KA 4F5QA 5IIKA 5CA7A 3RJJA 4K4GA 5F9LA 5BPCA 4DWIA 4O9MA 1BPBA 4KLUA 9ICGA 2GWSA 9ICHA 4RT3A 4F5PA 4BXOA 2HHWA 5EWEA 4GLXA 4BWJA 5F2VO 5J2GA 4R64A 4ED8A 5DDYA 4NXZA 2W8LA 3RJEA 1RYSA 1BNOA 5HRKA 3ZD8A 2BE3A 4NLZA 3BQ2A 3SZ2A 1RZTA 4WBYA 4EZ9A 4X4RA 4FHXA 5D46A 3SYZA 1XSPA 4DEZA 3GIJA 4FO6A 4WC4A 3EPGA 2ZUCA 2BCSA 4EBDA 3FYHA 2ZTEA 4YMNA 4IQWA 5HHIA 7ICSA 1R8AA 2AGQA 5D4BA 4YN4A 3KTQA 4P2HA 5KFJA 2W9CB 3HPOA 2AGPA 3RAXA 5HR9A 2Q0ZX 5BOMA 4JV0A 4J9RA 4F5RA 4DOBA 1IXRA 4ED1A 5L9XA 3T5KA 2Y1IA 2IHNA 8ICGA 1MIWA 4JWMA 2HHTA 3FDSA 2R8HA 5L1JA 3OSPA 1NJWA 1S0OA 1BPXA 5L1IA 3OJSA 8ICSA 4AT9B 2ZH7A 4IR9A 3MABA 5J0PA 5KFBA 1UEUA 4KLJA 5HRLA 4QWAA 4DL4A 2ID1A 2ZJ5A 3GDXA 4J9PA 4DL2A 3QEAZ 3ETLA 2C2DA 3RR7A 5J0TA 1ZJMA 4B9UA 1FA0A 4UD4A 2HHSA 5CHGA 2KZ3A 2ALZA 1S0NA 4DSKA 3B0XA 4O5KA 2XY5A 2M2WA 1QSYA 3RH6A 4O3QA 4RWOA 4Z6EA 2W9BA 4TUSA 7ICLA 2PI5A 4I2IA 4DOAA 7ICVA 7ICIA 4EYHB 2ZH5A 4ECWA 1RPLA 4DQQA 9ICEA 4DQSA 3LK9A 3KHGA 2ZJ8A 4E7XA 4ELVA 1XSNA 4YCXA 5KFMA 9ICXA 2XCAA 1NK4A 4RQ2A 2NRVA 4PGYA 4O0IA 3TAQA 5DQIA 1XSLA 5HRIA 4ECVA 4M9HA 9ICAA 1N56A 4I2GA 4S3NA 4M9GA 2ZHBA 5J2JA 2IA6A 4F4ZA 3H7IA 4EBCA 4DSFA 4QZDA 4YFKA 4UBCA 5IILA 4DFJA 3RB4A 1VFGA 1SZPA 3M9NB
chains in the Genus database with same CATH superfamily
1N2XA 3C23A 4NLNA 4EENA 1JX4A 9ICCA 4F4XA 1X9XA 3BS7A 3NRWA 4FE3A 2EDUA 4ECRA 1L8OA 4EX7A 1JXLA 3BDPA 4C7YA 2WTFA 2FPKA 2P6RA 2DPIA 1FFUA 5AKGA 2M2TA 4K96A 3DEEA 2KK0A 2J6SA 4DFPA 2HVHA 3AU2A 3H0LB 2ASDA 4YXMA 4O5CA 2BPCA 2G09A 5AKLA 1QLNA 8ICMA 2DPJA 1RYRA 4O6AA 2F1IA 3MFHA 2QB0A 9ICMA 3SD7A 4UB5A 4I2FA 4FH3A 5HC9A 4FZNA 3T5JA 2DKXA 2FLLA 5EOZA 1WOTA 8ICUA 4E8FA 4WC2A 2KD1A 2KICA 1TK0A 4QWDA 5AKZA 8ICCA 5KFUA 4GFJA 1SXEA 1WCNA 4RQ8A 3HW8A 2ATLA 1TVAA 5KFOA 4RWQA 1V38A 1C20A 2Y0SF 3SEIA 5CFUA 3WFRE 4EZ6A 4B9LA 3QUQA 4HYKA 4K4HA 4FHPA 2EAPA 2FLPA 5CP2A 5ALRA 4X0AA 4EELA 4DFDA 3D2SA 3QU2A 5J0QA 3PX6A 4YQWA 1XS9D 1X42A 4UAZA 3K7DA 4Q43A 4TQRA 4OAFA 1NK6A 5GTIU 4IQTA 5J0UA 2VKQA 5KT4A 4IQVA 1SL2A 1ZQJA 5ALSA 4RNMA 3E0FA 1ZQFA 5KFZA 2BBJA 3F53A 4OD0A 3OWGA 4WQLA 3V7LA 9ICIA 2L5YA 2ZH4A 1QQ6A 1NO5A 2DR9A 2NO4A 5CWRA 3QU7A 4FHYA 2ZTDA 2FDRA 3WKAA 1X6JA 4ECYA 1Z1VA 5J2KA 1NKBA 1B22A 2GAFD 2WAQC 4M9NA 4AP9A 1KBUA 1SGGA 4KB6A 4ZH4A 3RR8A 5EE3A 2MSNA 4FHVA 3UM9A 2EZYA 4EEKA 5KG7A 4ED7A 4OAHA 8ICPA 4KLQA 5AI6A 4DSLA 3A0HU 4MF8A 3C28A 3PW4A 4F3OA 4KLDA 3AQNA 5CR0A 3TARA 2OH2A 3HT3A 8ICFA 2A1JA 2E5SA 2BPFA 2G5HB 5EE0A 4ED0A 2PMZC 4I2HA 3HWTA 2R8JA 4Y2TA 3RB3A 5CFSA 1AQ6A 2K8CB 4YD1A 4KLHA 9ICRA 1L7OA 2JEIA 2DGZA 5KFDA 4LT6A 5L1KA 4EBKA 2YMLA 4BX9C 2DWQA 2YMQA 4ECZA 1NKCA 2AH5A 3ISBA 4F5NA 3IHQB 4Z6CA 2HN1A 4FS1A 2PFNA 1OXJA 4MEYA 3NVYA 2NRTA 5AM1A 3AUOA 9ICUA 5A0LA 3PO4A 2ASJA 3H0MB 4DF8A 3OUYB 2JXJA 1VJ5A 5AKIA 4I29A 4IQUA 2PFQA 4XA5A 3F5AA 2HHXA 2FLNA 5B5EU 2BPGA 4DFKA 3OJUA 1AROP 1SL1A 8ICNA 2KJ8A 1V85A 2BZFA 8ICKA 9ICWA 5ALHA 7ICGA 5ALGA 2XI9A 5HRFA 3Q8RB 2KHQA 3EF2A 3PVXA 2ZIWA 3QEBZ 1CEZA 4WOYA 2UVUA 4M6WA 4QW9A 1ZQDA 3N4MB 4MFFA 2F77X 1NK8A 4NXUA 2DFLA 5B3QA 4GC7A 2OWOA 2AHOB 3L4PA 4NL9A 1XU4A 3G6XA 1DRGA 3WFOA 5AK4A 4YD2A 4RQ0A 1UEVA 2RQ5A 5KG2A 1T3NA 4C4RA 5J0RA 1VJ7A 4R8UB 3SQIA 3QX7A 1ZQAA 1L7MA 5ALPA 3H0RB 3RFAA 4US9A 5KFVA 4KN4A 1TV9A 4QW8A 1TFYA 1HEKA 1R8CA 1S9FA 1D8BA 5KG6A 1LB2B 1MN8A 2H3VA 2JZBB 1U45A 4I2AA 5J29A 4DL3A 2K4EA 4KLTA 5CFTA 2Y1JA 5CB1A 1JALA 3N97B 5KFPA 3WKCA 1PVQA 2PFPA 1TE2A 1X6IA 9ICOA 2ZIUB 3QZ7A 1D9DA 3SR6A 5AM5A 3ZDAA 4XJEA 4JV2A 1MC8A 2NRZA 3DV9A 5HMMA 4MKPA 3KFUF 3KHRA 4LJXA 3ISDA 3PR4A 4RPZA 4G9BA 3SI8A 3V6HA 4BUGA 2FMPA 3AU6A 7ICKA 1WYGA 2K4HA 3MCRA 4KN7A 3HIYA 4QZHA 1JIHA 2RLTA 2KKVA 5DLGA 2OXOA 5ALQA 1RXWA 4O68A 4PL2A 5ALIA 5HNKA 2PI4A 2OYYA 3PW7A 2LBOA 4LZGA 2WF9A 1ZQWA 4RZRA 4NL9C 1ZQUA 3RJIA 5DKWA 3JZ0A 5KFYA 2AXTU 4RUCA 1NK7A 1Z00B 1BGXT 2M9NA 3Q8LA 3PO5A 3SV4A 4ECXA 2HOIA 2BQUA 1NK0A 4J9KA 1KRPA 1ZQRA 2OEHA 4OAIZ 4KLGA 5KFKA 4ZOHC 3C1ZA 3K4GA 2QLTA 4TUPA 5AKHA 2HBKA 1KFSA 4C8MA 2O5AA 1D8YA 1ECWA 1RQNA 4ELTA 4OAGA 7ICTA 2VANA 3GFKB 4CF4A 1DGSA 2D3DA 3UMBA 1Q3UA 4KTQA 2QARA 1LKYB 4KITB 5AI5A 1XNSA 4Y2XA 4C8LA 8ICJA 2E8PA 4DS5A 4CF5A 2KFZA 3WK5A 3MC1A 4YMOA 4HAIA 4QZ9A 4F5QA 3VC8A 3AM9A 5BPCA 4DWIA 4O9MA 1JRPA 9ICGA 4RT3A 4F5PA 2HHWA 4GLXA 2W7PA 4BWJA 5F2VO 4NXZA 4CF3A 3SZ2A 2YN4A 1K5OA 5HHIA 7ICSA 1ZQ1C 2OCEA 3T79A 3KTQA 5JRTA 2AGPA 3HPOA 5HR9A 4F5RA 3OPXA 1IXRA 4U6PA 3KD3A 1MIWA 2R8HA 3OSPA 1S0OA 1BPXA 8ICSA 4IR9A 1UEUA 5ALXA 4PZNA 5HRLA 2ZJ5A 5CHGA 4O5KA 2XIDA 3RH6A 2VJ4A 1SXDA 2MRLA 4UAVA 1ZD2P 7ICLA 2PI5A 2GA9D 1RPLA 2M0NA 1PK1B 4DQSA 2IOFA 3LK9A 1ZD3A 2EH9A 4WQKA 4RQ2A 4PGYA 3TAQA 1UQVA 5ALMA 4ECVA 1NI3A 4M9HA 4I2GA 9ICAA 2ZHBA 5J2JA 4EBCA 2D6FC 1SZPA 1KEJA 4RT2A 3OHAA 4K9BA 3T5LA 3UXNA 1JAJA 3CNHA 1MQ3A 1NKEA 2HVIA 4BJQA 4CDGA 4KLLA 2F1JA 4FHWA 5F3XB 3EZ5A 2BCVA 4PJ0U 2KE7A 3NVWA 2HI0A 1T4GA 2ISPA 2HHPA 2HMXA 4P4PA 4X4UA 1Q46A 3OUYA 1L3UA 1NK5A 2ES6A 3NKUA 4RQ1A 4NXTA 2V9WA 3O0FA 4QZEA 4YXJA 4LEYA 1QQ5A 2HHUA 1L7NA 5H2FU 3WK8A 3PSIA 3H39A 1CI4A 1LV5A 1MQ2A 2NYVA 5DQGA 5AM2A 2ZHAA 4KMOB 1URJA 5HMLA 2W7OA 4K8VA 4ELUA 3HKZC 3MDCA 2W43A 3GQCA 4P0PB 5C0YA 4RQ7A 1WWVA 2A1AA 2G06A 5JU5A 7ICMA 3C66A 4YR0A 5TZVA 2EAOA 2H5XA 5J2CA 9ICFA 2RDIA 4N7RA 5K4LA 5HRDA 3HJ4A 4LEZA 5KTQA 1KSPA 5KFAA 3RJGA 2DRBA 1SZHA 4ECSA 1COKA 4F5OA 1ZQZA 4R8UA 4C8NA 4R65A 1TAUA 1H38A 4XUSA 3NTUA 3UXPA 4YP3A 1FFVA 4EBJA 4F93B 4X4SA 2JZBA 1N63A 2QB1A 5T14A 2BCRA 4DSJA 1UETA 2LI6A 5DB6A 5ALEA 5DG7A 2AGOA 3GU3A 5KFTA 3WK7A 3ZDDA 3FC4A 2KNJA 1ZJNA 2YB1A 3PW2A 5AKEA 4DL6A 1T3QA 1Y88A 3VCBA 3QUTA 3JPTA 3HX0A 3C5GA 3T3FA 2XVTA 4B6JA 4K97A 2XY6A 4P4MA 2W9BB 4F4WA 4JMUA 3K1ZA 2ESEA 2G08A 1UT5A 4I27A 5AI9A 4RU9A 4RQ5A 4F4YA 4MF2A 2YMMA 5JTGA 4RQNA 3TAPA 2MA1A 3WKEA 4PGQA 2EANA 8ICTA 2EWRA 4RWNA 5J2HA 4UASA 2WF8A 5AK6A 3H40A 5KFEA 3NVZA 1HUZA 2ZUDA 5DB8A 5D61A 4X4TA 3QZ8A 5ALKA 4EX6A 2B21A 3H8WA 3UPQA 3F2DA 4I0UA 3L3FX 5J0WA 3RB0A 1Q8KA 1Z00A 2F8LA 1MSWD 2LMRA 3EUB2 2NRXA 4NM2A 2HBLA 1PK3A 2XGPA 1TK5A 8ICBA 4JK1A 3D2QA 2PXIA 4ED2A 8ICQA 4ECTA 1ZQEA 2EQYA 5C5JA 3QU9A 1GPJA 3N7SC 2Q4TA 4GXKA 4GC6A 7ICUA 5J0XA 8ICXA 3RH4A 2MUTA 2QARB 1LKYA 4NWIA 3MBYA 9ICPA 3ZDEA 4QZAA 4AT7B 2E8NA 4RWPA 2ZJAA 2DUYA 3ZDBA 5CRXA 3IM1A 3KHLA 3LQCB 4OJ5A 3CK6A 5HRHA 5G5HA 2IHMA 5J2BA 1QQ7A 2C28A 5ALDA 4NLKA 1RQLA 3TI0A 1SB3C 1V4AA 4DSIA 2NRKA 8ICYA 3U26A 2BKEA 2WAQF 4P4OA 3JPQA 4OJLA 2ZIVA 3T5HA 4WC5A 4EYIB 8ICLA 8ICWA 4EBEA 3QUBA 2BR0A 1B4FA 3OSNA 4BDPA 2EZXA 3GILA 3C18A 2NRWA 3GV7B 5D63A 1NJYA 2K4IA 2IOFK 2PMZF 5ALJA 4C0ZA 3UMGA 1ZQYA 1X9SA 1PK1A 5DLFA 4YR2A 5DG8A 1X66A 3V72A 3PY8A 4M47A 1V97A 5DQHA 1QTMA 4NXWA 2HCFA 1ZYQA 1ZQXA 2Y9TA 4MEXA 1ZQLA 9ICQA 4QWEA 3ERCC 4JLXA 3CP8A 5KFFA 5AI4A 5DECA 1RXVA 3FAHA 4DQRA 2LYAA 2KVSA 3D2NA 4CGZA 3K1RB 4Y2VA 1R89A 3KBBA 5J2EA 2PKEA 2AJQA 4NJ8A 2YTUA 1Q78A 8ICHA 1BPYA 2WF7A 7ICPA 2BGWA 3WFSC 5KFIA 1ZQGA 3WKDA 4M0AA 3MR6A 2Z7JA 4PH5A 3LWLA 1L3TA 3H4DA 1PVPA 4C8OA 3Q8PB 3M9MB 4P0QB 5KT2A 1RYUA 1ZQOA 4J9NA 4K9AA 1HIWA 1SV0C 3WK4A 4F8RA 2XY7A 1S97A 3BQTA 2F76X 1DK3A 1ZQHA 3OGUA 4TUQA 1KTQA 2FJ6A 3V6JA 3RH5A 4WC3A 2UVRA 1SWWA 9ICSA 4P0PA 3E58A 5IIJA 1QSSA 1N62A 1YT3A 3LVWA 2BQ3A 3NVOA 4ICAA 2NO5A 4UBBA 3M1YA 3PSPA 2N1RA 4C8KA 5IIKA 3RJJA 2FE9A 5F9LA 5AM4A 4KLUA 3HJEA 9ICHA 4WJ3B 5J2GA 4R64A 2K60A 5DDYA 4IG8A 5AM3A 2BE3A 3BQ2A 1RZTA 4WBYA 4FHXA 5J8YC 4DEZA 2ZXIA 4FO6A 4CE6A 3EPGA 3F2BA 2ZTEA 2KJ5A 4IQWA 4CRXA 1F0MA 2AGQA 4O3MA 2NV3A 5D4BA 4P2HA 4FO1A 4J9RA 8ICGA 1A6SA 4JWMA 2HHTA 4QJFB 1NJWA 4Y2UA 2H3FA 1UHUA 3OJSA 2ZH7A 4AT9B 2BBHA 5KAIU 2ID1A 4KX3A 4J9PA 4DL2A 1FA0A 2JR5A 1ZJMA 5KL1B 4C4SA 1QSYA 3M6KA 2W9BA 9ICEA 2WF5A 3BZKA 2ZJ8A 4YCXA 2W03A 5KFMA 2NRVA 4O0IA 1XSLA 3BQ7A 5E79U 4S3NA 4DSFA 5IILA 4YFKA 2DF4B 7ICJA 2CRXA 3M9NB 1A0PA 1KKXA 2JH1A 2GO7A 1NZPA 4Q8FA 4F71A 4PZOA 4NXXA 3KHHA 4QWCA 4KLEA 3C5FA 2JMGA 4YR3A 5KAFU 1S5LU 1MIYA 1SL0A 2K8BB 2K8AA 3IRUA 2B51A 1S8OA 2LPEA 2P35A 3PMNA 1UA0A 3M7DA 1ZD4A 1ZXIA 1S76D 4I2BA 4QZ8A 4LEVA 4NLBA 3OHBA 4FBTA 3RJHA 2ZG6A 4JWNA 2JV3A 3ONNA 2ODGA 4M2YA 5J2FA 1JQRA 5KFHA 4JB3A 1MA7A 1F44A 2MUTB 2R18A 4TQSA 1Z4OA 2MU2A 4EEYA 4PHAA 4M5DA 4AT8B 1JXEA 5CJ7A 4UAUA 4AT7A 2FMQA 1J2NA 3G6YA 3N7RC 2BQRA 1B43A 3BQ1A 7ICHA 4A8EA 4EP7A 2W04A 3SAHA 5B66U 1ZQPA 5L1LA 4I2DA 1ZQNA 4US8A 2E8OA 5DB7A 5KFQA 5AI8A 1RM6C 5ALUA 3AQLA 1PZNA 3PHZA 2XC9A 5ALWA 8ICIA 2HSZA 1RDFA 2JH7A 4DL7A 3RJKA 2HHSA 4UAWA 3MDAA 1C7YA 4QZGA 1KFTA 2BDUA 3IG8A 1YZ6A 3ISCA 2F1HA 2XGQA 3ICXA 3UQ2A 3ZDCA 3PR5B 2ZIVB 1O08A 2O1PA 3JCFA 5BOLA 1NJZA 3C2KA 2FPLA 1A77A 4IL6U 2D8CA 5KFSA 2PBEA 1HJPA 3F5EA 1A76A 1N60A 2DBYA 3NS1A 2UVVA 2CN1A 3CYMA 3R9KA 1ZQMA 2VA2A 3PMLA 1NOMA 3C2LA 3UQ0A 3H3AA 2OHFA 2KZMA 1K1QA 3MGIA 2DR5A 4RQ3A 2W3RA 3RB6A 3LVVA 4DQIA 3I28A 1JN3A 1KNYA 5B3PA 5DG9A 1ZETA 1XC9A 2F8KA 1RG6A 3KKAA 3IG5A 2HBJA 4AYBC 5AK3A 2I1QA 3LYSA 3GIKA 3G6VA 2J6UA 3ALRA 2KKPA 4LEWA 2QKQA 4B9MA 2W9AA 1BNPA 3ZI4A 3HP6A 1L3VA 5IIOA 1L3SA 4F2RA 4X4PA 3IN5A 4X4QA 1SWVA 3RBDA 5L1MA 2BCQA 1T94A 2RFFA 2R8IA 2E8MA 3GV5B 1SKSA 3ER9B 3I76A 4P0QA 4BGDA 4XQ8A 2V4RA 3GZFA 4FFDA 1ZQVA 3PSTA 3NUQA 1CUKA 3J81j 4RNOA 4XQ7A 5AICA 3AQKA 1CRXA 1KFDA 3KZXA 2WB1C 3OV7A 3SENA 3WK6A 4KLMA 1S0VA 4M04A 1BVSA 1IV8A 3H8SA 4Z6FA 3NGDA 3PNCA 2F2AB 4OJOA 4QZCA 4O69A 1S77D 3K75D 1DGJA 1U48A 1ZQBA 4O3OA 1JI7A 2KIWA 4OJ6A 3NWIA 3AQEA 1JMSA 3FM9A 2C2EA 5HP4A 1S0MA 3AMZA 4C7ZA 4ATBB 2DR8A 4Y2QA 3H37A 3KKAC 5J0YA 2B6GA 2M2VA 4E0DA 1JUDA 2B56A 5HHHA 3C21A 4WBZA 4GXIA 4J9OA 4NKUA 4I2JA 3SV3A 3NYBA 5KFRA 1T7PA 2IHOA 4QIWC 1U4BA 4AT9A 1UPHA 4FBUA 3OVSA 2K89A 2DRAA 4UAYA 4FZMA 2HOQA 4WC7A 3BS5A 2KSOB 4Y2SA 4J9SA 3PV8A 3RRGA 2RP5A 4RPYA 3QE9Y 2F44A 4KLIA 4GXJA 2FPMA 5ALTA 1M6YA 1Z19A 1Q79A 1UT8A 2H3IA 2W11A 4USAA 4QZBA 3V7JA 3TKAA 4NY8A 2ZTCA 1N48A 2HN2A 3AQFA 4DOCA 1Z3EB 4ECUA 4IC9A 4DCCA 1ZOLA 5KL8B 2MAXA 1UA1A 3TANA 4NKTA 4CNQA 4PPXA 3S6JA 4KLSA 1KQQA 1DXSA 5DGAA 4YMMA 2IMWP 1SKRA 4ACOA 4XRHA 1O03A 4Q45A 3MGVA 2IBKA 1X40A 4Y2PA 1L5UA 4IS7A 3D6JA 1TFWA 5AKXA 5CEHA 5AM0A 2DR7A 3LWMA 4IRKA 1BPEA 4PGXA 3TACB 5KG4A 3Q8KA 1GO3F 1TAMA 9ICLA 2JEFA 3UXOA 5KG0A 4J9QA 3C2MA 5HREA 4EGWA 1IM4A 5D62A 2A3VA 3DDHA 3LDAA 4UW9A 2LHTA 2ZUBA 3SAFA 5J2IA 1Q3VA 2HHQA 3ZD9A 5KT6A 5IIMA 2PFOA 4R66A 2HW3A 4OJPA 4UB8U 3N7PD 8ICRA 2XO7A 2RDJA 5ALOA 1S10A 4AT8A 4B9NA 4PHDA 2ASLA 3HRDD 2DKZA 2I6XA 5DBAA 2KN7A 2KP7A 4IRDA 3MFIA 5AKJA 8ICZA 1TAQA 1U9LA 2AQ0A 1N5XA 2WFAA 4LZDA 4X4VA 2G0AA 2A19A 1BPBA 2LYBA 4RQMA 5HR6A 2GWSA 2Y0SC 4J03A 4PL1A 1BNOA 3RJEA 5HRKA 1RYSA 2I5HA 4NLZA 1SV0A 3QUCA 4EZ9A 4X4RA 3SYZA 1XSPA 1ED1A 4WC4A 4EBDA 4NLCA 1R8AA 2EAMA 2DQNB 2W9CB 5BOMA 4JV0A 3T5KA 4DOBA 4ED1A 2IHNA 4E80A 5L9XA 2Y1IA 3I1YA 3NASA 2KJ9A 3BZCA 5EE1A 1Z1BA 3MABA 5J0PA 4C80A 4KLJA 4QWAA 4DL4A 3QNMA 3GDXA 3QEAZ 3ETLA 5J0TA 4B9UA 4UD4A 2ALZA 2HOFA 2M2WA 3B0XA 2WHEA 4TUSA 4DOAA 7ICVA 5ALLA 4EYHB 7ICIA 2ZH5A 2IOHA 4E7XA 2CPRA 1XSNA 9ICXA 2XCAA 2G5IB 1NK4A 5J8YA 2KMDA 7ICRA 2IA6A 3H8MA 4F4ZA 4QZDA 4UBCA 4DFJA 2BCUA 4O3SA 1KN5A 4EEDA 4IR1A 1SIJA 4WH5A 4C4TA 5J2DA 2W55A 4F92B 3UPSA 4X5VA 4F4KA 3GV8B 3RBEA 2ZIXA 9ICTA 5KFLA 5KT3A 2E1FA 3H8JA 5DGBA 1L8LA 4YVZA 1WUDA 5AK5A 3Q8QB 2EZZA 1WWUA 4B9SA 5HRBA 3JPNA 2H3ZA 3CRXA 3ETRA 4DQPA 2LYHA 5DB9A 1YLQA 4OO1J 1N61A 3IP4B 2P66A 1ZD5A 4X4NA 3JYYA 1V9PA 3V7KA 4MFCA 5JTIA 4M9JA 5KFXA 1J97A 1SV4A 3TADA 5ALFA 4FH5A 2V4QA 5J2AA 7ICNA 1JROA 5AIAA 5EWGA 1DK2A 5TISU 2ZH9A 3PX0A 3WK9A 3QU5A 3MR3A 3Q8SB 2KVCA 3ER8C 2BDPA 1TKDA 1NNLA 4K99A 5GTHU 9ICVA 5KT7A 4QZIA 3RTVA 1QCKA 2LKYA 4KLFA 2CXYA 4ATBA 4PHPA 9ICNA 2FCLA 5JUMA 3E2EA 4BXOB 1BPZA 2E3TA 1U49A 3WU2U 1FO4A 4RNNA 3THVA 1VLBA 4Y2RA 2RHFA 4UQGA 2W9MA 1X2IA 4DL5A 3WKBA 3SMVA 3OTQA 2YB4A 4DF4A 4JV1A 4Z6DA 4GIBA 2BHNA 5ALVA 5KG3A 5ALZA 4B9VA 3ED5A 1MIVA 2OM6A 3BQ0A 4I2EA 2M2UA 2KSOA 4KLOA 3BS5B 1NJXA 3JPRA 4UB1A 2FMSA 2J6TA 4LVSA 2ISOA 1XO1A 2KTQA 4DLEA 4RQ6A 3IV6A 1J2MA 2P6UA 3BJYA 3JPOA 1EXNA 1FIQA 1QH9A 2LM1A 9ICJA 1UCVA 4Y2YA 3IDWA 7ICEA 2UVWA 3JPSA 3TADC 2KZZA 4O5EA 5J0OA 3JPPA 5EE9A 5HRGA 1N5WA 1WCLA 4WC0A 2GOLA 4F72A 3PSFA 5DDMA 4DO9A 5IIIA 3M8RA 1B0XA 3M8SA 4IRCA 4G3IA 4HX0A 3SAGA 4CCHA 3KOOA 4FS2A 5J0SA 4B9TA 1ZQQA 2ZH6A 4F50A 2R8KA 2W54A 2C22A 3WFQE 1ZRMA 8ICEA 2QB0B 4J9MA 2YY6A 2JHDA 4PHEA 4RPXA 4DLGA 3B9JA 2E1EA 2H3QA 3QXGA 4ED3A 4JUZA 5KFNA 2Y9UA 5D49A 4F91B 4WC1A 4DSEA 4K98A 5KT5A 3Q8MA 2JEJA 1U47A 1SKWA 4X0BA 7ICOA 4O3RA 3L9DA 2KIVA 1KL9A 1HUOA 1IG6A 2HHVA 2JGAA 4KX5A 1IIPA 1PX5A 9ICBA 1OU5A 4X4OA 2KHVA 3OVBA 5KG1A 1COOA 2O6KA 3QYPA 1BPDA 1DOQA 3RF9A 3TFRA 3EYZA 1D8LA 3H4BA 2ZXHA 3MR5A 3EPIA 5ALYA 4M9LA 4R63A 4NXVA 2I9GA 8ICAA 2ZH1A 4WCWA 2YQEA 4QWBA 5F9NA 2KV2A 2W8KA 5KG5A 5CHEA 2XICA 2W9CA 1R8BA 2DL0A 1XWLA 1QSLA 3WFPA 3GIMA 1ZQIA 2R8GA 7ICQA 4ED6A 5ALNA 2VA3A 2FI1A 3RRHA 3B0YA 3QU4A 3C29A 3H38A 2B0CA 3AN1A 1KW4A 3EW9A 4NM1A 4YG2A 3N28A 1P7DA 3RJFA 3AQMA 2JRZA 3M6ZA 3UMCA 3GIIA 1Z4NA 2YMPA 4ECQA 4Q8EA 4F2SA 4KMUA 3TFSA 1PUZA 5FP0A 2ZH8A 5G5GA 3AEVA 1LVHA 1X9MA 1F5AA 1ZQCA 4AYBF 1NK9A 4UD5A 4BWMA 3A0BU 4UATA 2XCPA 2A1JB 4I28A 9ICKA 1ZQSA 4O3NA 5DEDA 2KG5A 2B4VA 2LM4A 3OVAA 3RAQA 2KEYA 5KFGA 1ZQKA 2Q66A 3V6KA 3EWAA 5AHXA 2AU0A 4DS4A 3TQ1A 1T8EA 4UB2A 2ZIXB 3C1YA 3F2CA 2AQ4A 8ICOA 2GH1A 4O67A 1KDHA 1ZQTA 4QNLA 4I2CA 3AL0B 2ZH3A 2ZH2A 4MHVA 2K4PA 1OW5A 4DFMA 1KLNA 2VA8A 5AI0A 4Q44A 2C2RA 3KZIU 3PW5A 1K1SA 3HILA 3CW2C 4WC6A 4MFAA 4NV0A 4KM5A 1TFRA 4UB6U 1OUQA 3HKZF 5KFWA 2WB1F 2GLEA 2WF6A 2DVIA 3ORYA 2W3SA 5KNIA 5DBBA 2KFNA 3PW0A 2HBMA 1L7PA 4K4IA 4UARA 3M9OB 4J9LA 1XO0A 2RRDA 5AIBA 4RQ4A 3HJ1A 1VDVA 5EWFA 4QZFA 1TK8A 4NLGA 1F5SA 1D9FA 5AKYA 3MGHA 4JLZA 2ZIWB 2JEGA 5IINA 5KFCA 3PX4A 5DBCA 4O3PA 2YX8A 4UB4A 4RUAA 4TURA 4UB3A 8ICVA 4M6WB 3NVVA 4Y2JA 3MR2A 1X9WA 3L5KA 4FZLA 5CA7A 4K4GA 4OCZA 5HR7A 4EEBA 2HDOA 4BXOA 5EWEA 4ED8A 2W8LA 3ZD8A 5AKKA 1PVRA 5D46A 4QIWF 3GIJA 2BCSA 2ZUCA 3FYHA 4YMNA 4U7CA 4YN4A 5KFJA 3RAXA 2Q0ZX 1L6NA 1YZ7A 3FDSA 5L1JA 1WG8A 5L1IA 3NRZA 5KFBA 2ZIUA 4EV6A 2G07A 2C2DA 3RR7A 1FEZA 2KZ3A 1S0NA 4DSKA 2XY5A 4O3QA 4RWOA 4Z6EA 2IUBA 1ZRNA 2VIXA 4I2IA 4ECWA 2F3NA 4DQQA 2VJ5A 3KHGA 4ELVA 1NZBA 5DQIA 5HRIA 1N56A 2KOBA 3PZPA 4M9GA 7ICFA 3H7IA 3RB4A 1VFGA
chains in the Genus database with same CATH topology
4O3SA 1KEJA 3C23A 4RT2A 4NLNA 3OHAA 3T5LA 3UXNA 1JX4A 9ICCA 4IR1A 1JAJA 1NZPA 4F4XA 1MQ3A 4Q8FA 4ECRA 1NKEA 5J2DA 4F92B 1JXLA 2HVIA 3KHHA 3BDPA 3UPSA 4QWCA 2WTFA 2FPKA 4X5VA 3GV8B 3RBEA 2DPIA 2P6RA 4F4KA 4KLEA 4KLLA 2F1JA 2M2TA 4FHWA 9ICTA 3C5FA 5KFLA 3EZ5A 5KT3A 4YR3A 3H8JA 2BCVA 5DGBA 2J6SA 4DFPA 2HVHA 4ATBA 3AU2A 1T4GA 4YVZA 2ISPA 1MIYA 2ASDA 2HHPA 4YXMA 4P4PA 4X4UA 1SL0A 4O5CA 2BPCA 3Q8QB 4B9SA 5HRBA 3JPNA 1QLNA 3OUYA 8ICMA 1L3UA 2DPJA 1NK5A 1RYRA 2F1IA 4RQ1A 3MFHA 9ICMA 3PMNA 1UA0A 4DQPA 2LYHA 5DB9A 4UB5A 4I2FA 4FH3A 5HC9A 1S76D 4I2BA 3T5JA 2FLLA 1YLQA 4QZ8A 2V9WA 4QZEA 4YXJA 3OHBA 5EOZA 4FBTA 2HHUA 1WOTA 3RJHA 2P66A 8ICUA 4E8FA 4JWNA 3H39A 4X4NA 4WC2A 3JYYA 4M2YA 5J2FA 1JQRA 1LV5A 5KFHA 1TK0A 4QWDA 1MQ2A 1V9PA 2MUTB 4TQSA 5DQGA 8ICCA 3V7KA 5KFUA 4MFCA 4EEYA 2ZHAA 5HMLA 1WCNA 4M9JA 5KFXA 4RQ8A 4PHAA 4FH5A 4ELUA 3HW8A 2ATLA 1TVAA 5KFOA 1JXEA 3MDCA 5CJ7A 5J2AA 2V4QA 3GQCA 4RWQA 4AT7A 4AT8B 2FMQA 4RQ7A 3G6YA 7ICNA 5EWGA 2BQRA 1B43A 3BQ1A 7ICMA 4YR0A 4EZ6A 7ICHA 1DK2A 3C66A 5TZVA 4EP7A 4B9LA 4HYKA 2H5XA 2ZH9A 3PX0A 4K4HA 5J2CA 4FHPA 9ICFA 2RDIA 1ZQPA 5L1LA 5HRDA 3HJ4A 4I2DA 3MR3A 3Q8SB 9ICNA 2FLPA 5KTQA 5CP2A 1ZQNA 1TKDA 1KSPA 2BDPA 4X0AA 5DB7A 5KFAA 9ICVA 5J0QA 3PX6A 3RJGA 5KFQA 4YQWA 1XS9D 5KT7A 4QZIA 3RTVA 2DRBA 3AQLA 4ECSA 4KLFA 4WC6A 1PZNA 4PHPA 4UAZA 1ZQZA 4R8UA 4F5OA 5JUMA 4Q43A 4TQRA 4C8NA 2XC9A 3E2EA 1NK6A 4BXOB 4DL7A 3RJKA 8ICIA 4R65A 1BPZA 1TAUA 4IQTA 5J0UA 5KT4A 4RNNA 4IQVA 1U49A 1SL2A 4UAWA 3MDAA 3THVA 1H38A 4XUSA 1ZQJA 3NTUA 4QZGA 3UXPA 4YP3A 1C7YA 1KFTA 4RNMA 7ICFA 1ZQFA 5KFZA 3ISCA 4UQGA 2W9MA 2F1HA 2XGQA 4EBJA 1X2IA 3V7LA 4F93B 2JZBA 4DL5A 3UQ2A 3ZDCA 9ICIA 4X4SA 3PR5B 2ZH4A 2BCRA 4DF4A 1NO5A 4JV1A 4Z6DA 2O1PA 4DSJA 2DR9A 2BHNA 1UETA 5CWRA 5DB6A 5KG3A 5DG7A 5BOLA 4FHYA 2AGOA 2ZTDA 5KFTA 1NJZA 4B9VA 3ZDDA 3C2KA 2FPLA 1MIVA 1ZJNA 1A77A 3BQ0A 4I2EA 2PBEA 5KFSA 4ECYA 1HJPA 5J2KA 1NKBA 2M2UA 4KLOA 1B22A 1A76A 3PW2A 1NJXA 2UVVA 4M9NA 3JPRA 4UB1A 4DL6A 1Y88A 1ZQMA 2FMSA 2J6TA 2VA2A 4ZH4A 3RR8A 4LVSA 3PMLA 4FHVA 1NOMA 5KG7A 3JPTA 4ED7A 3HX0A 8ICPA 3C2LA 2ISOA 3C5GA 3UQ0A 4KLQA 3H3AA 1XO1A 4DSLA 3T3FA 4MF8A 4DLEA 3PW4A 2KTQA 4F3OA 2KZMA 4RQ6A 1K1QA 4P4MA 2W9BB 5CR0A 4F4WA 2XY6A 3TARA 3HT3A 4KLDA 3MGIA 2P6UA 3BJYA 1UT5A 4I27A 3JPOA 8ICFA 2A1JA 4RU9A 1EXNA 2DR5A 2BPFA 4RQ3A 7ICRA 4RQ5A 4ED0A 4F4YA 3RB6A 4DQIA 4I2HA 4MF2A 9ICJA 1JN3A 1KNYA 3HWTA 5DG9A 1ZETA 1XC9A 2R8JA 7ICEA 3RB3A 2UVWA 4YD1A 4KLHA 3JPSA 9ICRA 2KZZA 2JEIA 4O5EA 2I1QA 3TAPA 5J0OA 5KFDA 3JPPA 3GIKA 4LT6A 4PGQA 3G6VA 5L1KA 4EBKA 5HRGA 8ICTA 2J6UA 4RWNA 5J2HA 3H40A 4ECZA 5KFEA 1WCLA 1NKCA 1HUZA 2ZUDA 4B9MA 4WC0A 5DB8A 2W9AA 4X4TA 3QZ8A 1BNPA 3ISBA 4F5NA 3IHQB 4Z6CA 2B21A 3HP6A 1L3VA 3H8WA 5IIOA 5DDMA 3UPQA 4FS1A 4DO9A 1L3SA 2PFNA 4F2RA 4X4PA 5IIIA 3M8RA 4X4QA 4MEYA 3WFRE 3M8SA 2NRTA 3RBDA 5J0WA 4IRCA 3RB0A 2BCQA 4G3IA 3AUOA 9ICUA 1Z00A 2RFFA 2R8IA 3PO4A 2ASJA 4CCHA 1MSWD 3GV5B 1SKSA 4FS2A 5J0SA 4B9TA 2NRXA 4BGDA 4XQ8A 4DF8A 1ZQQA 4F50A 2ZH6A 4NM2A 2V4RA 3OUYB 2XGPA 1TK5A 2R8KA 2C22A 8ICBA 4JK1A 3WFQE 4I29A 4IQUA 2PXIA 2PFQA 1ZQVA 4XA5A 4J9MA 4ED2A 8ICEA 1CUKA 2HHXA 8ICQA 2FLNA 4RNOA 4ECTA 1ZQEA 2BPGA 4DFKA 4XQ7A 5C5JA 3OJUA 1AROP 1SL1A 8ICNA 4PHEA 4RPXA 4DLGA 3AQKA 4GXKA 1KFDA 4JUZA 4ED3A 5KFNA 4GC6A 7ICUA 8ICKA 9ICWA 5D49A 7ICGA 4F91B 5J0XA 4DSEA 4WC1A 8ICXA 5HRFA 3OV7A 5KT5A 3Q8MA 2JEJA 3RH4A 1U47A 4NKUA 4KLMA 3Q8RB 1SKWA 2MUTA 7ICOA 2BCUA 4X0BA 4O3RA 1S0VA 3PVXA 3L9DA 4M04A 1BVSA 1HUOA 3MBYA 9ICPA 3QEBZ 3ZDEA 2HHVA 3H8SA 4Z6FA 4QZAA 3NGDA 2UVUA 1CEZA 3PNCA 4AT7B 4M6WA 4QW9A 4RWPA 4QZCA 1S77D 1PX5A 1ZQDA 4M5DA 3K75D 3N4MB 9ICBA 1OU5A 4MFFA 1U48A 4X4OA 2ZJAA 1ZQBA 1NK8A 4O3OA 3OVBA 5KG1A 3ZDBA 1COOA 2DFLA 3IM1A 4GC7A 3KHLA 2OWOA 3LQCB 1BPDA 1JMSA 5HRHA 1DOQA 1XU4A 3G6XA 3WFOA 3TFRA 2IHMA 3EYZA 5J2BA 1D8LA 3H4BA 4YD2A 4RQ0A 3MR5A 1UEVA 3EPIA 5KG2A 2C2EA 5HP4A 1T3NA 5J0RA 1S0MA 4M9LA 4R63A 1VJ7A 4ATBB 4R8UB 2DR8A 2C28A 4NLKA 3H37A 1ZQAA 5J0YA 3TI0A 2I9GA 8ICAA 2ZH1A 4WCWA 1V4AA 4QWBA 4DSIA 5F9NA 5KFVA 2W8KA 5KG5A 4E0DA 2M2VA 2NRKA 4KN4A 8ICYA 5HHHA 3C21A 1TV9A 2BKEA 4QW8A 2W9CA 4WBZA 1TFYA 1R8CA 4P4OA 4GXIA 1XWLA 1S9FA 5KG6A 3JPQA 4J9OA 1LB2B 1QSLA 1R8BA 3WFPA 2JZBB 3GIMA 1U45A 5J29A 4I2JA 4DL3A 3SV3A 1ZQIA 2R8GA 3T5HA 4I2AA 4KLTA 7ICQA 4ED6A 3NYBA 4WC5A 5KFRA 1T7PA 4EYIB 5CB1A 2Y1JA 2VA3A 3RRHA 3B0YA 3N97B 5KFPA 8ICLA 8ICWA 3H38A 4AT9A 1U4BA 2PFPA 3OVSA 4FBUA 3EW9A 4EBEA 4NM1A 2BR0A 2DRAA 9ICOA 4YG2A 4UAYA 3QZ7A 3OSNA 1D9DA 4BDPA 3RJFA 4WC7A 3AQMA 3GILA 3C18A 2NRWA 4J9SA 3GIIA 3GV7B 3PV8A 1NJYA 3ZDAA 3RRGA 4RPYA 3QE9Y 4ECQA 4JV2A 4KLIA 1MC8A 4GXJA 2FPMA 4Q8EA 2NRZA 5HMMA 4F2SA 4KMUA 1ZQYA 3TFSA 1Q79A 1UT8A 3AQNA 1X9SA 3KHRA 4E80A 2ZH8A 4QZBA 3V7JA 5DLFA 1X9MA 4NY8A 4YR2A 1F5AA 5DG8A 2ZTCA 3V72A 1N48A 1ZQCA 3PY8A 4M47A 3ISDA 3PR4A 1NK9A 5DQHA 1QTMA 4RPZA 4DOCA 3SI8A 4UD5A 4BWMA 1ZYQA 1Z3EB 1ZQXA 3V6HA 2XCPA 4ECUA 4MEXA 1ZQLA 2A1JB 4QWEA 4I28A 9ICKA 1ZQSA 9ICQA 4O3NA 2MAXA 1UA1A 3TANA 2FMPA 4NKTA 5DEDA 4PPXA 4KLSA 3AU6A 3OVAA 7ICKA 3RAQA 5KFFA 5DGAA 5DECA 1RXVA 5KFGA 4YMMA 4KN7A 4DQRA 1ZQKA 2IMWP 3HIYA 2Q66A 4QZHA 1SKRA 7ICJA 1JIHA 5DLGA 4XRHA 3V6KA 3EWAA 1RXWA 1R89A 2AU0A 4DS4A 4Q45A 5J2EA 3TQ1A 4UB2A 3C1YA 1T8EA 2IBKA 2AQ4A 8ICOA 2AJQA 1L5UA 5HNKA 2PI4A 3PW7A 4LZGA 1Q78A 8ICHA 1BPYA 1KDHA 7ICPA 1TFWA 1ZQWA 2BGWA 1ZQTA 5KFIA 1ZQGA 2DR7A 3LWMA 3WFSC 4RZRA 4I2CA 2ZH3A 2ZH2A 4M0AA 1ZQUA 4IRKA 3MR6A 3RJIA 5DKWA 3JZ0A 5KFYA 4RUCA 1BPEA 4PGXA 4PH5A 4DFMA 2VA8A 3LWLA 1KLNA 4IG8A 4Q44A 2C2RA 3H4DA 1NK7A 5KG4A 1L3TA 3Q8KA 1Z00B 3PW5A 1BGXT 2M9NA 1K1SA 3Q8LA 3SV4A 3PO5A 4ECXA 4C8OA 9ICLA 3Q8PB 4MFAA 2BQUA 3M9MB 4J9KA 1NK0A 1ZQRA 1KRPA 2JEFA 1TFRA 3UXOA 5KT2A 5KG0A 1ZQOA 5KFWA 4J9NA 4J9QA 4KLGA 3C2MA 5HREA 5KFKA 1IM4A 3C1ZA 2DVIA 3ORYA 3K4GA 4TUPA 4F8RA 2XY7A 5DBBA 3LDAA 1S97A 1KFSA 3BQTA 5J2IA 2ZUBA 4C8MA 2HHQA 2KFNA 3PW0A 2O5AA 3ZD9A 5KT6A 5IIMA 1D8YA 2PFOA 1DK3A 1ZQHA 4ELTA 4R66A 2HW3A 3OGUA 4K4IA 4TUQA 1KTQA 7ICTA 3M9OB 4J9LA 3V6JA 3RH5A 8ICRA 2VANA 4RQ4A 3GFKB 3HJ1A 4WC3A 2XO7A 2RDJA 2UVRA 5EWFA 1S10A 4QZFA 1TK8A 9ICSA 4NLGA 4AT8A 4B9NA 5IIJA 4PHDA 1DGSA 1QSSA 2ASLA 1D9FA 2KN7A 4IRDA 5DBAA 4KTQA 2KP7A 2BQ3A 3MFIA 3MGHA 4KITB 2JEGA 8ICZA 1TAQA 5IINA 4C8LA 8ICJA 1U9LA 5KFCA 4UBBA 5DBCA 4O3PA 3PX4A 4UB4A 4DS5A 4RUAA 4TURA 2KFZA 2AQ0A 4UB3A 8ICVA 4M6WB 4LZDA 4X4VA 4YMOA 3MR2A 1X9WA 4QZ9A 4C8KA 4F5QA 5IIKA 5CA7A 3RJJA 4K4GA 5F9LA 5BPCA 4DWIA 4O9MA 1BPBA 4KLUA 9ICGA 2GWSA 9ICHA 4RT3A 4F5PA 4BXOA 2HHWA 5EWEA 4GLXA 4BWJA 5F2VO 5J2GA 4R64A 4ED8A 5DDYA 4NXZA 2W8LA 3RJEA 1RYSA 1BNOA 5HRKA 3ZD8A 2BE3A 4NLZA 3BQ2A 3SZ2A 1RZTA 4WBYA 4EZ9A 4X4RA 4FHXA 5D46A 3SYZA 1XSPA 4DEZA 3GIJA 4FO6A 4WC4A 3EPGA 2ZUCA 2BCSA 4EBDA 3FYHA 2ZTEA 4YMNA 4IQWA 5HHIA 7ICSA 1R8AA 2AGQA 5D4BA 4YN4A 3KTQA 4P2HA 5KFJA 2W9CB 3HPOA 2AGPA 3RAXA 5HR9A 2Q0ZX 5BOMA 4JV0A 4J9RA 4F5RA 4DOBA 1IXRA 4ED1A 5L9XA 3T5KA 2Y1IA 2IHNA 8ICGA 1MIWA 4JWMA 2HHTA 3FDSA 2R8HA 5L1JA 3OSPA 1NJWA 1S0OA 1BPXA 5L1IA 3OJSA 8ICSA 4AT9B 2ZH7A 4IR9A 3MABA 5J0PA 5KFBA 1UEUA 4KLJA 5HRLA 4QWAA 4DL4A 2ID1A 2ZJ5A 3GDXA 4J9PA 4DL2A 3QEAZ 3ETLA 2C2DA 3RR7A 5J0TA 1ZJMA 4B9UA 1FA0A 4UD4A 2HHSA 5CHGA 2KZ3A 2ALZA 1S0NA 4DSKA 3B0XA 4O5KA 2XY5A 2M2WA 1QSYA 3RH6A 4O3QA 4RWOA 4Z6EA 2W9BA 4TUSA 7ICLA 2PI5A 4I2IA 4DOAA 7ICVA 7ICIA 4EYHB 2ZH5A 4ECWA 1RPLA 4DQQA 9ICEA 4DQSA 3LK9A 3KHGA 2ZJ8A 4E7XA 4ELVA 1XSNA 4YCXA 5KFMA 9ICXA 2XCAA 1NK4A 4RQ2A 2NRVA 4PGYA 4O0IA 3TAQA 5DQIA 1XSLA 5HRIA 4ECVA 4M9HA 9ICAA 1N56A 4I2GA 4S3NA 4M9GA 2ZHBA 5J2JA 2IA6A 4F4ZA 3H7IA 4EBCA 4DSFA 4QZDA 4YFKA 4UBCA 5IILA 4DFJA 3RB4A 1VFGA 1SZPA 3M9NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3S A;  1KEJ A;  3C23 A;  4RT2 A;  4NLN A;  3OHA A;  3T5L A;  3UXN A;  1JX4 A;  9ICC A;  4IR1 A;  1JAJ A;  1NZP A;  4F4X A;  1MQ3 A;  4Q8F A;  4ECR A;  1NKE A;  5J2D A;  4F92 B;  1JXL A;  2HVI A;  3KHH A;  3BDP A;  3UPS A;  4QWC A;  2WTF A;  2FPK A;  4X5V A;  3GV8 B;  3RBE A;  2DPI A;  2P6R A;  4F4K A;  4KLE A;  4KLL A;  2F1J A;  2M2T A;  4FHW A;  9ICT A;  3C5F A;  5KFL A;  3EZ5 A;  5KT3 A;  4YR3 A;  3H8J A;  2BCV A;  5DGB A;  2J6S A;  4DFP A;  2HVH A;  4ATB A;  3AU2 A;  1T4G A;  4YVZ A;  2ISP A;  1MIY A;  2ASD A;  2HHP A;  4YXM A;  4P4P A;  4X4U A;  1SL0 A;  4O5C A;  2BPC A;  3Q8Q B;  4B9S A;  5HRB A;  3JPN A;  1QLN A;  3OUY A;  8ICM A;  1L3U A;  2DPJ A;  1NK5 A;  1RYR A;  2F1I A;  4RQ1 A;  3MFH A;  9ICM A;  3PMN A;  1UA0 A;  4DQP A;  2LYH A;  5DB9 A;  4UB5 A;  4I2F A;  4FH3 A;  5HC9 A;  1S76 D;  4I2B A;  3T5J A;  2FLL A;  1YLQ A;  4QZ8 A;  2V9W A;  4QZE A;  4YXJ A;  3OHB A;  5EOZ A;  4FBT A;  2HHU A;  1WOT A;  3RJH A;  2P66 A;  8ICU A;  4E8F A;  4JWN A;  3H39 A;  4X4N A;  4WC2 A;  3JYY A;  4M2Y A;  5J2F A;  1JQR A;  1LV5 A;  5KFH A;  1TK0 A;  4QWD A;  1MQ2 A;  1V9P A;  2MUT B;  4TQS A;  5DQG A;  8ICC A;  3V7K A;  5KFU A;  4MFC A;  4EEY A;  2ZHA A;  5HML A;  1WCN A;  4M9J A;  5KFX A;  4RQ8 A;  4PHA A;  4FH5 A;  4ELU A;  3HW8 A;  2ATL A;  1TVA A;  5KFO A;  1JXE A;  3MDC A;  5CJ7 A;  5J2A A;  2V4Q A;  3GQC A;  4RWQ A;  4AT7 A;  4AT8 B;  2FMQ A;  4RQ7 A;  3G6Y A;  7ICN A;  5EWG A;  2BQR A;  1B43 A;  3BQ1 A;  7ICM A;  4YR0 A;  4EZ6 A;  7ICH A;  1DK2 A;  3C66 A;  5TZV A;  4EP7 A;  4B9L A;  4HYK A;  2H5X A;  2ZH9 A;  3PX0 A;  4K4H A;  5J2C A;  4FHP A;  9ICF A;  2RDI A;  1ZQP A;  5L1L A;  5HRD A;  3HJ4 A;  4I2D A;  3MR3 A;  3Q8S B;  9ICN A;  2FLP A;  5KTQ A;  5CP2 A;  1ZQN A;  1TKD A;  1KSP A;  2BDP A;  4X0A A;  5DB7 A;  5KFA A;  9ICV A;  5J0Q A;  3PX6 A;  3RJG A;  5KFQ A;  4YQW A;  1XS9 D;  5KT7 A;  4QZI A;  3RTV A;  2DRB A;  3AQL A;  4ECS A;  4KLF A;  4WC6 A;  1PZN A;  4PHP A;  4UAZ A;  1ZQZ A;  4R8U A;  4F5O A;  5JUM A;  4Q43 A;  4TQR A;  4C8N A;  2XC9 A;  3E2E A;  1NK6 A;  4BXO B;  4DL7 A;  3RJK A;  8ICI A;  4R65 A;  1BPZ A;  1TAU A;  4IQT A;  5J0U A;  5KT4 A;  4RNN A;  4IQV A;  1U49 A;  1SL2 A;  4UAW A;  3MDA A;  3THV A;  1H38 A;  4XUS A;  1ZQJ A;  3NTU A;  4QZG A;  3UXP A;  4YP3 A;  1C7Y A;  1KFT A;  4RNM A;  7ICF A;  1ZQF A;  5KFZ A;  3ISC A;  4UQG A;  2W9M A;  2F1H A;  2XGQ A;  4EBJ A;  1X2I A;  3V7L A;  4F93 B;  2JZB A;  4DL5 A;  3UQ2 A;  3ZDC A;  9ICI A;  4X4S A;  3PR5 B;  2ZH4 A;  2BCR A;  4DF4 A;  1NO5 A;  4JV1 A;  4Z6D A;  2O1P A;  4DSJ A;  2DR9 A;  2BHN A;  1UET A;  5CWR A;  5DB6 A;  5KG3 A;  5DG7 A;  5BOL A;  4FHY A;  2AGO A;  2ZTD A;  5KFT A;  1NJZ A;  4B9V A;  3ZDD A;  3C2K A;  2FPL A;  1MIV A;  1ZJN A;  1A77 A;  3BQ0 A;  4I2E A;  2PBE A;  5KFS A;  4ECY A;  1HJP A;  5J2K A;  1NKB A;  2M2U A;  4KLO A;  1B22 A;  1A76 A;  3PW2 A;  1NJX A;  2UVV A;  4M9N A;  3JPR A;  4UB1 A;  4DL6 A;  1Y88 A;  1ZQM A;  2FMS A;  2J6T A;  2VA2 A;  4ZH4 A;  3RR8 A;  4LVS A;  3PML A;  4FHV A;  1NOM A;  5KG7 A;  3JPT A;  4ED7 A;  3HX0 A;  8ICP A;  3C2L A;  2ISO A;  3C5G A;  3UQ0 A;  4KLQ A;  3H3A A;  1XO1 A;  4DSL A;  3T3F A;  4MF8 A;  4DLE A;  3PW4 A;  2KTQ A;  4F3O A;  2KZM A;  4RQ6 A;  1K1Q A;  4P4M A;  2W9B B;  5CR0 A;  4F4W A;  2XY6 A;  3TAR A;  3HT3 A;  4KLD A;  3MGI A;  2P6U A;  3BJY A;  1UT5 A;  4I27 A;  3JPO A;  8ICF A;  2A1J A;  4RU9 A;  1EXN A;  2DR5 A;  2BPF A;  4RQ3 A;  7ICR A;  4RQ5 A;  4ED0 A;  4F4Y A;  3RB6 A;  4DQI A;  4I2H A;  4MF2 A;  9ICJ A;  1JN3 A;  1KNY A;  3HWT A;  5DG9 A;  1ZET A;  1XC9 A;  2R8J A;  7ICE A;  3RB3 A;  2UVW A;  4YD1 A;  4KLH A;  3JPS A;  9ICR A;  2KZZ A;  2JEI A;  4O5E A;  2I1Q A;  3TAP A;  5J0O A;  5KFD A;  3JPP A;  3GIK A;  4LT6 A;  4PGQ A;  3G6V A;  5L1K A;  4EBK A;  5HRG A;  8ICT A;  2J6U A;  4RWN A;  5J2H A;  3H40 A;  4ECZ A;  5KFE A;  1WCL A;  1NKC A;  1HUZ A;  2ZUD A;  4B9M A;  4WC0 A;  5DB8 A;  2W9A A;  4X4T A;  3QZ8 A;  1BNP A;  3ISB A;  4F5N A;  3IHQ B;  4Z6C A;  2B21 A;  3HP6 A;  1L3V A;  3H8W A;  5IIO A;  5DDM A;  3UPQ A;  4FS1 A;  4DO9 A;  1L3S A;  2PFN A;  4F2R A;  4X4P A;  5III A;  3M8R A;  4X4Q A;  4MEY A;  3WFR E;  3M8S A;  2NRT A;  3RBD A;  5J0W A;  4IRC A;  3RB0 A;  2BCQ A;  4G3I A;  3AUO A;  9ICU A;  1Z00 A;  2RFF A;  2R8I A;  3PO4 A;  2ASJ A;  4CCH A;  1MSW D;  3GV5 B;  1SKS A;  4FS2 A;  5J0S A;  4B9T A;  2NRX A;  4BGD A;  4XQ8 A;  4DF8 A;  1ZQQ A;  4F50 A;  2ZH6 A;  4NM2 A;  2V4R A;  3OUY B;  2XGP A;  1TK5 A;  2R8K A;  2C22 A;  8ICB A;  4JK1 A;  3WFQ E;  4I29 A;  4IQU A;  2PXI A;  2PFQ A;  1ZQV A;  4XA5 A;  4J9M A;  4ED2 A;  8ICE A;  1CUK A;  2HHX A;  8ICQ A;  2FLN A;  4RNO A;  4ECT A;  1ZQE A;  2BPG A;  4DFK A;  4XQ7 A;  5C5J A;  3OJU A;  1ARO P;  1SL1 A;  8ICN A;  4PHE A;  4RPX A;  4DLG A;  3AQK A;  4GXK A;  1KFD A;  4JUZ A;  4ED3 A;  5KFN A;  4GC6 A;  7ICU A;  8ICK A;  9ICW A;  5D49 A;  7ICG A;  4F91 B;  5J0X A;  4DSE A;  4WC1 A;  8ICX A;  5HRF A;  3OV7 A;  5KT5 A;  3Q8M A;  2JEJ A;  3RH4 A;  1U47 A;  4NKU A;  4KLM A;  3Q8R B;  1SKW A;  2MUT A;  7ICO A;  2BCU A;  4X0B A;  4O3R A;  1S0V A;  3PVX A;  3L9D A;  4M04 A;  1BVS A;  1HUO A;  3MBY A;  9ICP A;  3QEB Z;  3ZDE A;  2HHV A;  3H8S A;  4Z6F A;  4QZA A;  3NGD A;  2UVU A;  1CEZ A;  3PNC A;  4AT7 B;  4M6W A;  4QW9 A;  4RWP A;  4QZC A;  1S77 D;  1PX5 A;  1ZQD A;  4M5D A;  3K75 D;  3N4M B;  9ICB A;  1OU5 A;  4MFF A;  1U48 A;  4X4O A;  2ZJA A;  1ZQB A;  1NK8 A;  4O3O A;  3OVB A;  5KG1 A;  3ZDB A;  1COO A;  2DFL A;  3IM1 A;  4GC7 A;  3KHL A;  2OWO A;  3LQC B;  1BPD A;  1JMS A;  5HRH A;  1DOQ A;  1XU4 A;  3G6X A;  3WFO A;  3TFR A;  2IHM A;  3EYZ A;  5J2B A;  1D8L A;  3H4B A;  4YD2 A;  4RQ0 A;  3MR5 A;  1UEV A;  3EPI A;  5KG2 A;  2C2E A;  5HP4 A;  1T3N A;  5J0R A;  1S0M A;  4M9L A;  4R63 A;  1VJ7 A;  4ATB B;  4R8U B;  2DR8 A;  2C28 A;  4NLK A;  3H37 A;  1ZQA A;  5J0Y A;  3TI0 A;  2I9G A;  8ICA A;  2ZH1 A;  4WCW A;  1V4A A;  4QWB A;  4DSI A;  5F9N A;  5KFV A;  2W8K A;  5KG5 A;  4E0D A;  2M2V A;  2NRK A;  4KN4 A;  8ICY A;  5HHH A;  3C21 A;  1TV9 A;  2BKE A;  4QW8 A;  2W9C A;  4WBZ A;  1TFY A;  1R8C A;  4P4O A;  4GXI A;  1XWL A;  1S9F A;  5KG6 A;  3JPQ A;  4J9O A;  1LB2 B;  1QSL A;  1R8B A;  3WFP A;  2JZB B;  3GIM A;  1U45 A;  5J29 A;  4I2J A;  4DL3 A;  3SV3 A;  1ZQI A;  2R8G A;  3T5H A;  4I2A A;  4KLT A;  7ICQ A;  4ED6 A;  3NYB A;  4WC5 A;  5KFR A;  1T7P A;  4EYI B;  5CB1 A;  2Y1J A;  2VA3 A;  3RRH A;  3B0Y A;  3N97 B;  5KFP A;  8ICL A;  8ICW A;  3H38 A;  4AT9 A;  1U4B A;  2PFP A;  3OVS A;  4FBU A;  3EW9 A;  4EBE A;  4NM1 A;  2BR0 A;  2DRA A;  9ICO A;  4YG2 A;  4UAY A;  3QZ7 A;  3OSN A;  1D9D A;  4BDP A;  3RJF A;  4WC7 A;  3AQM A;  3GIL A;  3C18 A;  2NRW A;  4J9S A;  3GII A;  3GV7 B;  3PV8 A;  1NJY A;  3ZDA A;  3RRG A;  4RPY A;  3QE9 Y;  4ECQ A;  4JV2 A;  4KLI A;  1MC8 A;  4GXJ A;  2FPM A;  4Q8E A;  2NRZ A;  5HMM A;  4F2S A;  4KMU A;  1ZQY A;  3TFS A;  1Q79 A;  1UT8 A;  3AQN A;  1X9S A;  3KHR A;  4E80 A;  2ZH8 A;  4QZB A;  3V7J A;  5DLF A;  1X9M A;  4NY8 A;  4YR2 A;  1F5A A;  5DG8 A;  2ZTC A;  3V72 A;  1N48 A;  1ZQC A;  3PY8 A;  4M47 A;  3ISD A;  3PR4 A;  1NK9 A;  5DQH A;  1QTM A;  4RPZ A;  4DOC A;  3SI8 A;  4UD5 A;  4BWM A;  1ZYQ A;  1Z3E B;  1ZQX A;  3V6H A;  2XCP A;  4ECU A;  4MEX A;  1ZQL A;  2A1J B;  4QWE A;  4I28 A;  9ICK A;  1ZQS A;  9ICQ A;  4O3N A;  2MAX A;  1UA1 A;  3TAN A;  2FMP A;  4NKT A;  5DED A;  4PPX A;  4KLS A;  3AU6 A;  3OVA A;  7ICK A;  3RAQ A;  5KFF A;  5DGA A;  5DEC A;  1RXV A;  5KFG A;  4YMM A;  4KN7 A;  4DQR A;  1ZQK A;  2IMW P;  3HIY A;  2Q66 A;  4QZH A;  1SKR A;  7ICJ A;  1JIH A;  5DLG A;  4XRH A;  3V6K A;  3EWA A;  1RXW A;  1R89 A;  2AU0 A;  4DS4 A;  4Q45 A;  5J2E A;  3TQ1 A;  4UB2 A;  3C1Y A;  1T8E A;  2IBK A;  2AQ4 A;  8ICO A;  2AJQ A;  1L5U A;  5HNK A;  2PI4 A;  3PW7 A;  4LZG A;  1Q78 A;  8ICH A;  1BPY A;  1KDH A;  7ICP A;  1TFW A;  1ZQW A;  2BGW A;  1ZQT A;  5KFI A;  1ZQG A;  2DR7 A;  3LWM A;  3WFS C;  4RZR A;  4I2C A;  2ZH3 A;  2ZH2 A;  4M0A A;  1ZQU A;  4IRK A;  3MR6 A;  3RJI A;  5DKW A;  3JZ0 A;  5KFY A;  4RUC A;  1BPE A;  4PGX A;  4PH5 A;  4DFM A;  2VA8 A;  3LWL A;  1KLN A;  4IG8 A;  4Q44 A;  2C2R A;  3H4D A;  1NK7 A;  5KG4 A;  1L3T A;  3Q8K A;  1Z00 B;  3PW5 A;  1BGX T;  2M9N A;  1K1S A;  3Q8L A;  3SV4 A;  3PO5 A;  4ECX A;  4C8O A;  9ICL A;  3Q8P B;  4MFA A;  2BQU A;  3M9M B;  4J9K A;  1NK0 A;  1ZQR A;  1KRP A;  2JEF A;  1TFR A;  3UXO A;  5KT2 A;  5KG0 A;  1ZQO A;  5KFW A;  4J9N A;  4J9Q A;  4KLG A;  3C2M A;  5HRE A;  5KFK A;  1IM4 A;  3C1Z A;  2DVI A;  3ORY A;  3K4G A;  4TUP A;  4F8R A;  2XY7 A;  5DBB A;  3LDA A;  1S97 A;  1KFS A;  3BQT A;  5J2I A;  2ZUB A;  4C8M A;  2HHQ A;  2KFN A;  3PW0 A;  2O5A A;  3ZD9 A;  5KT6 A;  5IIM A;  1D8Y A;  2PFO A;  1DK3 A;  1ZQH A;  4ELT A;  4R66 A;  2HW3 A;  3OGU A;  4K4I A;  4TUQ A;  1KTQ A;  7ICT A;  3M9O B;  4J9L A;  3V6J A;  3RH5 A;  8ICR A;  2VAN A;  4RQ4 A;  3GFK B;  3HJ1 A;  4WC3 A;  2XO7 A;  2RDJ A;  2UVR A;  5EWF A;  1S10 A;  4QZF A;  1TK8 A;  9ICS A;  4NLG A;  4AT8 A;  4B9N A;  5IIJ A;  4PHD A;  1DGS A;  1QSS A;  2ASL A;  1D9F A;  2KN7 A;  4IRD A;  5DBA A;  4KTQ A;  2KP7 A;  2BQ3 A;  3MFI A;  3MGH A;  4KIT B;  2JEG A;  8ICZ A;  1TAQ A;  5IIN A;  4C8L A;  8ICJ A;  1U9L A;  5KFC A;  4UBB A;  5DBC A;  4O3P A;  3PX4 A;  4UB4 A;  4DS5 A;  4RUA A;  4TUR A;  2KFZ A;  2AQ0 A;  4UB3 A;  8ICV A;  4M6W B;  4LZD A;  4X4V A;  4YMO A;  3MR2 A;  1X9W A;  4QZ9 A;  4C8K A;  4F5Q A;  5IIK A;  5CA7 A;  3RJJ A;  4K4G A;  5F9L A;  5BPC A;  4DWI A;  4O9M A;  1BPB A;  4KLU A;  9ICG A;  2GWS A;  9ICH A;  4RT3 A;  4F5P A;  4BXO A;  2HHW A;  5EWE A;  4GLX A;  4BWJ A;  5F2V O;  5J2G A;  4R64 A;  4ED8 A;  5DDY A;  4NXZ A;  2W8L A;  3RJE A;  1RYS A;  1BNO A;  5HRK A;  3ZD8 A;  2BE3 A;  4NLZ A;  3BQ2 A;  3SZ2 A;  1RZT A;  4WBY A;  4EZ9 A;  4X4R A;  4FHX A;  5D46 A;  3SYZ A;  1XSP A;  4DEZ A;  3GIJ A;  4FO6 A;  4WC4 A;  3EPG A;  2ZUC A;  2BCS A;  4EBD A;  3FYH A;  2ZTE A;  4YMN A;  4IQW A;  5HHI A;  7ICS A;  1R8A A;  2AGQ A;  5D4B A;  4YN4 A;  3KTQ A;  4P2H A;  5KFJ A;  2W9C B;  3HPO A;  2AGP A;  3RAX A;  5HR9 A;  2Q0Z X;  5BOM A;  4JV0 A;  4J9R A;  4F5R A;  4DOB A;  1IXR A;  4ED1 A;  5L9X A;  3T5K A;  2Y1I A;  2IHN A;  8ICG A;  1MIW A;  4JWM A;  2HHT A;  3FDS A;  2R8H A;  5L1J A;  3OSP A;  1NJW A;  1S0O A;  1BPX A;  5L1I A;  3OJS A;  8ICS A;  4AT9 B;  2ZH7 A;  4IR9 A;  3MAB A;  5J0P A;  5KFB A;  1UEU A;  4KLJ A;  5HRL A;  4QWA A;  4DL4 A;  2ID1 A;  2ZJ5 A;  3GDX A;  4J9P A;  4DL2 A;  3QEA Z;  3ETL A;  2C2D A;  3RR7 A;  5J0T A;  1ZJM A;  4B9U A;  1FA0 A;  4UD4 A;  2HHS A;  5CHG A;  2KZ3 A;  2ALZ A;  1S0N A;  4DSK A;  3B0X A;  4O5K A;  2XY5 A;  2M2W A;  1QSY A;  3RH6 A;  4O3Q A;  4RWO A;  4Z6E A;  2W9B A;  4TUS A;  7ICL A;  2PI5 A;  4I2I A;  4DOA A;  7ICV A;  7ICI A;  4EYH B;  2ZH5 A;  4ECW A;  1RPL A;  4DQQ A;  9ICE A;  4DQS A;  3LK9 A;  3KHG A;  2ZJ8 A;  4E7X A;  4ELV A;  1XSN A;  4YCX A;  5KFM A;  9ICX A;  2XCA A;  1NK4 A;  4RQ2 A;  2NRV A;  4PGY A;  4O0I A;  3TAQ A;  5DQI A;  1XSL A;  5HRI A;  4ECV A;  4M9H A;  9ICA A;  1N56 A;  4I2G A;  4S3N A;  4M9G A;  2ZHB A;  5J2J A;  2IA6 A;  4F4Z A;  3H7I A;  4EBC A;  4DSF A;  4QZD A;  4YFK A;  4UBC A;  5IIL A;  4DFJ A;  3RB4 A;  1VFG A;  1SZP A;  3M9N B; 
#chains in the Genus database with same CATH topology
 1N2X A;  3C23 A;  4NLN A;  4EEN A;  1JX4 A;  9ICC A;  4F4X A;  1X9X A;  3BS7 A;  3NRW A;  4FE3 A;  2EDU A;  4ECR A;  1L8O A;  4EX7 A;  1JXL A;  3BDP A;  4C7Y A;  2WTF A;  2FPK A;  2P6R A;  2DPI A;  1FFU A;  5AKG A;  2M2T A;  4K96 A;  3DEE A;  2KK0 A;  2J6S A;  4DFP A;  2HVH A;  3AU2 A;  3H0L B;  2ASD A;  4YXM A;  4O5C A;  2BPC A;  2G09 A;  5AKL A;  1QLN A;  8ICM A;  2DPJ A;  1RYR A;  4O6A A;  2F1I A;  3MFH A;  2QB0 A;  9ICM A;  3SD7 A;  4UB5 A;  4I2F A;  4FH3 A;  5HC9 A;  4FZN A;  3T5J A;  2DKX A;  2FLL A;  5EOZ A;  1WOT A;  8ICU A;  4E8F A;  4WC2 A;  2KD1 A;  2KIC A;  1TK0 A;  4QWD A;  5AKZ A;  8ICC A;  5KFU A;  4GFJ A;  1SXE A;  1WCN A;  4RQ8 A;  3HW8 A;  2ATL A;  1TVA A;  5KFO A;  4RWQ A;  1V38 A;  1C20 A;  2Y0S F;  3SEI A;  5CFU A;  3WFR E;  4EZ6 A;  4B9L A;  3QUQ A;  4HYK A;  4K4H A;  4FHP A;  2EAP A;  2FLP A;  5CP2 A;  5ALR A;  4X0A A;  4EEL A;  4DFD A;  3D2S A;  3QU2 A;  5J0Q A;  3PX6 A;  4YQW A;  1XS9 D;  1X42 A;  4UAZ A;  3K7D A;  4Q43 A;  4TQR A;  4OAF A;  1NK6 A;  5GTI U;  4IQT A;  5J0U A;  2VKQ A;  5KT4 A;  4IQV A;  1SL2 A;  1ZQJ A;  5ALS A;  4RNM A;  3E0F A;  1ZQF A;  5KFZ A;  2BBJ A;  3F53 A;  4OD0 A;  3OWG A;  4WQL A;  3V7L A;  9ICI A;  2L5Y A;  2ZH4 A;  1QQ6 A;  1NO5 A;  2DR9 A;  2NO4 A;  5CWR A;  3QU7 A;  4FHY A;  2ZTD A;  2FDR A;  3WKA A;  1X6J A;  4ECY A;  1Z1V A;  5J2K A;  1NKB A;  1B22 A;  2GAF D;  2WAQ C;  4M9N A;  4AP9 A;  1KBU A;  1SGG A;  4KB6 A;  4ZH4 A;  3RR8 A;  5EE3 A;  2MSN A;  4FHV A;  3UM9 A;  2EZY A;  4EEK A;  5KG7 A;  4ED7 A;  4OAH A;  8ICP A;  4KLQ A;  5AI6 A;  4DSL A;  3A0H U;  4MF8 A;  3C28 A;  3PW4 A;  4F3O A;  4KLD A;  3AQN A;  5CR0 A;  3TAR A;  2OH2 A;  3HT3 A;  8ICF A;  2A1J A;  2E5S A;  2BPF A;  2G5H B;  5EE0 A;  4ED0 A;  2PMZ C;  4I2H A;  3HWT A;  2R8J A;  4Y2T A;  3RB3 A;  5CFS A;  1AQ6 A;  2K8C B;  4YD1 A;  4KLH A;  9ICR A;  1L7O A;  2JEI A;  2DGZ A;  5KFD A;  4LT6 A;  5L1K A;  4EBK A;  2YML A;  4BX9 C;  2DWQ A;  2YMQ A;  4ECZ A;  1NKC A;  2AH5 A;  3ISB A;  4F5N A;  3IHQ B;  4Z6C A;  2HN1 A;  4FS1 A;  2PFN A;  1OXJ A;  4MEY A;  3NVY A;  2NRT A;  5AM1 A;  3AUO A;  9ICU A;  5A0L A;  3PO4 A;  2ASJ A;  3H0M B;  4DF8 A;  3OUY B;  2JXJ A;  1VJ5 A;  5AKI A;  4I29 A;  4IQU A;  2PFQ A;  4XA5 A;  3F5A A;  2HHX A;  2FLN A;  5B5E U;  2BPG A;  4DFK A;  3OJU A;  1ARO P;  1SL1 A;  8ICN A;  2KJ8 A;  1V85 A;  2BZF A;  8ICK A;  9ICW A;  5ALH A;  7ICG A;  5ALG A;  2XI9 A;  5HRF A;  3Q8R B;  2KHQ A;  3EF2 A;  3PVX A;  2ZIW A;  3QEB Z;  1CEZ A;  4WOY A;  2UVU A;  4M6W A;  4QW9 A;  1ZQD A;  3N4M B;  4MFF A;  2F77 X;  1NK8 A;  4NXU A;  2DFL A;  5B3Q A;  4GC7 A;  2OWO A;  2AHO B;  3L4P A;  4NL9 A;  1XU4 A;  3G6X A;  1DRG A;  3WFO A;  5AK4 A;  4YD2 A;  4RQ0 A;  1UEV A;  2RQ5 A;  5KG2 A;  1T3N A;  4C4R A;  5J0R A;  1VJ7 A;  4R8U B;  3SQI A;  3QX7 A;  1ZQA A;  1L7M A;  5ALP A;  3H0R B;  3RFA A;  4US9 A;  5KFV A;  4KN4 A;  1TV9 A;  4QW8 A;  1TFY A;  1HEK A;  1R8C A;  1S9F A;  1D8B A;  5KG6 A;  1LB2 B;  1MN8 A;  2H3V A;  2JZB B;  1U45 A;  4I2A A;  5J29 A;  4DL3 A;  2K4E A;  4KLT A;  5CFT A;  2Y1J A;  5CB1 A;  1JAL A;  3N97 B;  5KFP A;  3WKC A;  1PVQ A;  2PFP A;  1TE2 A;  1X6I A;  9ICO A;  2ZIU B;  3QZ7 A;  1D9D A;  3SR6 A;  5AM5 A;  3ZDA A;  4XJE A;  4JV2 A;  1MC8 A;  2NRZ A;  3DV9 A;  5HMM A;  4MKP A;  3KFU F;  3KHR A;  4LJX A;  3ISD A;  3PR4 A;  4RPZ A;  4G9B A;  3SI8 A;  3V6H A;  4BUG A;  2FMP A;  3AU6 A;  7ICK A;  1WYG A;  2K4H A;  3MCR A;  4KN7 A;  3HIY A;  4QZH A;  1JIH A;  2RLT A;  2KKV A;  5DLG A;  2OXO A;  5ALQ A;  1RXW A;  4O68 A;  4PL2 A;  5ALI A;  5HNK A;  2PI4 A;  2OYY A;  3PW7 A;  2LBO A;  4LZG A;  2WF9 A;  1ZQW A;  4RZR A;  4NL9 C;  1ZQU A;  3RJI A;  5DKW A;  3JZ0 A;  5KFY A;  2AXT U;  4RUC A;  1NK7 A;  1Z00 B;  1BGX T;  2M9N A;  3Q8L A;  3PO5 A;  3SV4 A;  4ECX A;  2HOI A;  2BQU A;  1NK0 A;  4J9K A;  1KRP A;  1ZQR A;  2OEH A;  4OAI Z;  4KLG A;  5KFK A;  4ZOH C;  3C1Z A;  3K4G A;  2QLT A;  4TUP A;  5AKH A;  2HBK A;  1KFS A;  4C8M A;  2O5A A;  1D8Y A;  1ECW A;  1RQN A;  4ELT A;  4OAG A;  7ICT A;  2VAN A;  3GFK B;  4CF4 A;  1DGS A;  2D3D A;  3UMB A;  1Q3U A;  4KTQ A;  2QAR A;  1LKY B;  4KIT B;  5AI5 A;  1XNS A;  4Y2X A;  4C8L A;  8ICJ A;  2E8P A;  4DS5 A;  4CF5 A;  2KFZ A;  3WK5 A;  3MC1 A;  4YMO A;  4HAI A;  4QZ9 A;  4F5Q A;  3VC8 A;  3AM9 A;  5BPC A;  4DWI A;  4O9M A;  1JRP A;  9ICG A;  4RT3 A;  4F5P A;  2HHW A;  4GLX A;  2W7P A;  4BWJ A;  5F2V O;  4NXZ A;  4CF3 A;  3SZ2 A;  2YN4 A;  1K5O A;  5HHI A;  7ICS A;  1ZQ1 C;  2OCE A;  3T79 A;  3KTQ A;  5JRT A;  2AGP A;  3HPO A;  5HR9 A;  4F5R A;  3OPX A;  1IXR A;  4U6P A;  3KD3 A;  1MIW A;  2R8H A;  3OSP A;  1S0O A;  1BPX A;  8ICS A;  4IR9 A;  1UEU A;  5ALX A;  4PZN A;  5HRL A;  2ZJ5 A;  5CHG A;  4O5K A;  2XID A;  3RH6 A;  2VJ4 A;  1SXD A;  2MRL A;  4UAV A;  1ZD2 P;  7ICL A;  2PI5 A;  2GA9 D;  1RPL A;  2M0N A;  1PK1 B;  4DQS A;  2IOF A;  3LK9 A;  1ZD3 A;  2EH9 A;  4WQK A;  4RQ2 A;  4PGY A;  3TAQ A;  1UQV A;  5ALM A;  4ECV A;  1NI3 A;  4M9H A;  4I2G A;  9ICA A;  2ZHB A;  5J2J A;  4EBC A;  2D6F C;  1SZP A;  1KEJ A;  4RT2 A;  3OHA A;  4K9B A;  3T5L A;  3UXN A;  1JAJ A;  3CNH A;  1MQ3 A;  1NKE A;  2HVI A;  4BJQ A;  4CDG A;  4KLL A;  2F1J A;  4FHW A;  5F3X B;  3EZ5 A;  2BCV A;  4PJ0 U;  2KE7 A;  3NVW A;  2HI0 A;  1T4G A;  2ISP A;  2HHP A;  2HMX A;  4P4P A;  4X4U A;  1Q46 A;  3OUY A;  1L3U A;  1NK5 A;  2ES6 A;  3NKU A;  4RQ1 A;  4NXT A;  2V9W A;  3O0F A;  4QZE A;  4YXJ A;  4LEY A;  1QQ5 A;  2HHU A;  1L7N A;  5H2F U;  3WK8 A;  3PSI A;  3H39 A;  1CI4 A;  1LV5 A;  1MQ2 A;  2NYV A;  5DQG A;  5AM2 A;  2ZHA A;  4KMO B;  1URJ A;  5HML A;  2W7O A;  4K8V A;  4ELU A;  3HKZ C;  3MDC A;  2W43 A;  3GQC A;  4P0P B;  5C0Y A;  4RQ7 A;  1WWV A;  2A1A A;  2G06 A;  5JU5 A;  7ICM A;  3C66 A;  4YR0 A;  5TZV A;  2EAO A;  2H5X A;  5J2C A;  9ICF A;  2RDI A;  4N7R A;  5K4L A;  5HRD A;  3HJ4 A;  4LEZ A;  5KTQ A;  1KSP A;  5KFA A;  3RJG A;  2DRB A;  1SZH A;  4ECS A;  1COK A;  4F5O A;  1ZQZ A;  4R8U A;  4C8N A;  4R65 A;  1TAU A;  1H38 A;  4XUS A;  3NTU A;  3UXP A;  4YP3 A;  1FFV A;  4EBJ A;  4F93 B;  4X4S A;  2JZB A;  1N63 A;  2QB1 A;  5T14 A;  2BCR A;  4DSJ A;  1UET A;  2LI6 A;  5DB6 A;  5ALE A;  5DG7 A;  2AGO A;  3GU3 A;  5KFT A;  3WK7 A;  3ZDD A;  3FC4 A;  2KNJ A;  1ZJN A;  2YB1 A;  3PW2 A;  5AKE A;  4DL6 A;  1T3Q A;  1Y88 A;  3VCB A;  3QUT A;  3JPT A;  3HX0 A;  3C5G A;  3T3F A;  2XVT A;  4B6J A;  4K97 A;  2XY6 A;  4P4M A;  2W9B B;  4F4W A;  4JMU A;  3K1Z A;  2ESE A;  2G08 A;  1UT5 A;  4I27 A;  5AI9 A;  4RU9 A;  4RQ5 A;  4F4Y A;  4MF2 A;  2YMM A;  5JTG A;  4RQN A;  3TAP A;  2MA1 A;  3WKE A;  4PGQ A;  2EAN A;  8ICT A;  2EWR A;  4RWN A;  5J2H A;  4UAS A;  2WF8 A;  5AK6 A;  3H40 A;  5KFE A;  3NVZ A;  1HUZ A;  2ZUD A;  5DB8 A;  5D61 A;  4X4T A;  3QZ8 A;  5ALK A;  4EX6 A;  2B21 A;  3H8W A;  3UPQ A;  3F2D A;  4I0U A;  3L3F X;  5J0W A;  3RB0 A;  1Q8K A;  1Z00 A;  2F8L A;  1MSW D;  2LMR A;  3EUB 2;  2NRX A;  4NM2 A;  2HBL A;  1PK3 A;  2XGP A;  1TK5 A;  8ICB A;  4JK1 A;  3D2Q A;  2PXI A;  4ED2 A;  8ICQ A;  4ECT A;  1ZQE A;  2EQY A;  5C5J A;  3QU9 A;  1GPJ A;  3N7S C;  2Q4T A;  4GXK A;  4GC6 A;  7ICU A;  5J0X A;  8ICX A;  3RH4 A;  2MUT A;  2QAR B;  1LKY A;  4NWI A;  3MBY A;  9ICP A;  3ZDE A;  4QZA A;  4AT7 B;  2E8N A;  4RWP A;  2ZJA A;  2DUY A;  3ZDB A;  5CRX A;  3IM1 A;  3KHL A;  3LQC B;  4OJ5 A;  3CK6 A;  5HRH A;  5G5H A;  2IHM A;  5J2B A;  1QQ7 A;  2C28 A;  5ALD A;  4NLK A;  1RQL A;  3TI0 A;  1SB3 C;  1V4A A;  4DSI A;  2NRK A;  8ICY A;  3U26 A;  2BKE A;  2WAQ F;  4P4O A;  3JPQ A;  4OJL A;  2ZIV A;  3T5H A;  4WC5 A;  4EYI B;  8ICL A;  8ICW A;  4EBE A;  3QUB A;  2BR0 A;  1B4F A;  3OSN A;  4BDP A;  2EZX A;  3GIL A;  3C18 A;  2NRW A;  3GV7 B;  5D63 A;  1NJY A;  2K4I A;  2IOF K;  2PMZ F;  5ALJ A;  4C0Z A;  3UMG A;  1ZQY A;  1X9S A;  1PK1 A;  5DLF A;  4YR2 A;  5DG8 A;  1X66 A;  3V72 A;  3PY8 A;  4M47 A;  1V97 A;  5DQH A;  1QTM A;  4NXW A;  2HCF A;  1ZYQ A;  1ZQX A;  2Y9T A;  4MEX A;  1ZQL A;  9ICQ A;  4QWE A;  3ERC C;  4JLX A;  3CP8 A;  5KFF A;  5AI4 A;  5DEC A;  1RXV A;  3FAH A;  4DQR A;  2LYA A;  2KVS A;  3D2N A;  4CGZ A;  3K1R B;  4Y2V A;  1R89 A;  3KBB A;  5J2E A;  2PKE A;  2AJQ A;  4NJ8 A;  2YTU A;  1Q78 A;  8ICH A;  1BPY A;  2WF7 A;  7ICP A;  2BGW A;  3WFS C;  5KFI A;  1ZQG A;  3WKD A;  4M0A A;  3MR6 A;  2Z7J A;  4PH5 A;  3LWL A;  1L3T A;  3H4D A;  1PVP A;  4C8O A;  3Q8P B;  3M9M B;  4P0Q B;  5KT2 A;  1RYU A;  1ZQO A;  4J9N A;  4K9A A;  1HIW A;  1SV0 C;  3WK4 A;  4F8R A;  2XY7 A;  1S97 A;  3BQT A;  2F76 X;  1DK3 A;  1ZQH A;  3OGU A;  4TUQ A;  1KTQ A;  2FJ6 A;  3V6J A;  3RH5 A;  4WC3 A;  2UVR A;  1SWW A;  9ICS A;  4P0P A;  3E58 A;  5IIJ A;  1QSS A;  1N62 A;  1YT3 A;  3LVW A;  2BQ3 A;  3NVO A;  4ICA A;  2NO5 A;  4UBB A;  3M1Y A;  3PSP A;  2N1R A;  4C8K A;  5IIK A;  3RJJ A;  2FE9 A;  5F9L A;  5AM4 A;  4KLU A;  3HJE A;  9ICH A;  4WJ3 B;  5J2G A;  4R64 A;  2K60 A;  5DDY A;  4IG8 A;  5AM3 A;  2BE3 A;  3BQ2 A;  1RZT A;  4WBY A;  4FHX A;  5J8Y C;  4DEZ A;  2ZXI A;  4FO6 A;  4CE6 A;  3EPG A;  3F2B A;  2ZTE A;  2KJ5 A;  4IQW A;  4CRX A;  1F0M A;  2AGQ A;  4O3M A;  2NV3 A;  5D4B A;  4P2H A;  4FO1 A;  4J9R A;  8ICG A;  1A6S A;  4JWM A;  2HHT A;  4QJF B;  1NJW A;  4Y2U A;  2H3F A;  1UHU A;  3OJS A;  2ZH7 A;  4AT9 B;  2BBH A;  5KAI U;  2ID1 A;  4KX3 A;  4J9P A;  4DL2 A;  1FA0 A;  2JR5 A;  1ZJM A;  5KL1 B;  4C4S A;  1QSY A;  3M6K A;  2W9B A;  9ICE A;  2WF5 A;  3BZK A;  2ZJ8 A;  4YCX A;  2W03 A;  5KFM A;  2NRV A;  4O0I A;  1XSL A;  3BQ7 A;  5E79 U;  4S3N A;  4DSF A;  5IIL A;  4YFK A;  2DF4 B;  7ICJ A;  2CRX A;  3M9N B;  1A0P A;  1KKX A;  2JH1 A;  2GO7 A;  1NZP A;  4Q8F A;  4F71 A;  4PZO A;  4NXX A;  3KHH A;  4QWC A;  4KLE A;  3C5F A;  2JMG A;  4YR3 A;  5KAF U;  1S5L U;  1MIY A;  1SL0 A;  2K8B B;  2K8A A;  3IRU A;  2B51 A;  1S8O A;  2LPE A;  2P35 A;  3PMN A;  1UA0 A;  3M7D A;  1ZD4 A;  1ZXI A;  1S76 D;  4I2B A;  4QZ8 A;  4LEV A;  4NLB A;  3OHB A;  4FBT A;  3RJH A;  2ZG6 A;  4JWN A;  2JV3 A;  3ONN A;  2ODG A;  4M2Y A;  5J2F A;  1JQR A;  5KFH A;  4JB3 A;  1MA7 A;  1F44 A;  2MUT B;  2R18 A;  4TQS A;  1Z4O A;  2MU2 A;  4EEY A;  4PHA A;  4M5D A;  4AT8 B;  1JXE A;  5CJ7 A;  4UAU A;  4AT7 A;  2FMQ A;  1J2N A;  3G6Y A;  3N7R C;  2BQR A;  1B43 A;  3BQ1 A;  7ICH A;  4A8E A;  4EP7 A;  2W04 A;  3SAH A;  5B66 U;  1ZQP A;  5L1L A;  4I2D A;  1ZQN A;  4US8 A;  2E8O A;  5DB7 A;  5KFQ A;  5AI8 A;  1RM6 C;  5ALU A;  3AQL A;  1PZN A;  3PHZ A;  2XC9 A;  5ALW A;  8ICI A;  2HSZ A;  1RDF A;  2JH7 A;  4DL7 A;  3RJK A;  2HHS A;  4UAW A;  3MDA A;  1C7Y A;  4QZG A;  1KFT A;  2BDU A;  3IG8 A;  1YZ6 A;  3ISC A;  2F1H A;  2XGQ A;  3ICX A;  3UQ2 A;  3ZDC A;  3PR5 B;  2ZIV B;  1O08 A;  2O1P A;  3JCF A;  5BOL A;  1NJZ A;  3C2K A;  2FPL A;  1A77 A;  4IL6 U;  2D8C A;  5KFS A;  2PBE A;  1HJP A;  3F5E A;  1A76 A;  1N60 A;  2DBY A;  3NS1 A;  2UVV A;  2CN1 A;  3CYM A;  3R9K A;  1ZQM A;  2VA2 A;  3PML A;  1NOM A;  3C2L A;  3UQ0 A;  3H3A A;  2OHF A;  2KZM A;  1K1Q A;  3MGI A;  2DR5 A;  4RQ3 A;  2W3R A;  3RB6 A;  3LVV A;  4DQI A;  3I28 A;  1JN3 A;  1KNY A;  5B3P A;  5DG9 A;  1ZET A;  1XC9 A;  2F8K A;  1RG6 A;  3KKA A;  3IG5 A;  2HBJ A;  4AYB C;  5AK3 A;  2I1Q A;  3LYS A;  3GIK A;  3G6V A;  2J6U A;  3ALR A;  2KKP A;  4LEW A;  2QKQ A;  4B9M A;  2W9A A;  1BNP A;  3ZI4 A;  3HP6 A;  1L3V A;  5IIO A;  1L3S A;  4F2R A;  4X4P A;  3IN5 A;  4X4Q A;  1SWV A;  3RBD A;  5L1M A;  2BCQ A;  1T94 A;  2RFF A;  2R8I A;  2E8M A;  3GV5 B;  1SKS A;  3ER9 B;  3I76 A;  4P0Q A;  4BGD A;  4XQ8 A;  2V4R A;  3GZF A;  4FFD A;  1ZQV A;  3PST A;  3NUQ A;  1CUK A;  3J81 j;  4RNO A;  4XQ7 A;  5AIC A;  3AQK A;  1CRX A;  1KFD A;  3KZX A;  2WB1 C;  3OV7 A;  3SEN A;  3WK6 A;  4KLM A;  1S0V A;  4M04 A;  1BVS A;  1IV8 A;  3H8S A;  4Z6F A;  3NGD A;  3PNC A;  2F2A B;  4OJO A;  4QZC A;  4O69 A;  1S77 D;  3K75 D;  1DGJ A;  1U48 A;  1ZQB A;  4O3O A;  1JI7 A;  2KIW A;  4OJ6 A;  3NWI A;  3AQE A;  1JMS A;  3FM9 A;  2C2E A;  5HP4 A;  1S0M A;  3AMZ A;  4C7Z A;  4ATB B;  2DR8 A;  4Y2Q A;  3H37 A;  3KKA C;  5J0Y A;  2B6G A;  2M2V A;  4E0D A;  1JUD A;  2B56 A;  5HHH A;  3C21 A;  4WBZ A;  4GXI A;  4J9O A;  4NKU A;  4I2J A;  3SV3 A;  3NYB A;  5KFR A;  1T7P A;  2IHO A;  4QIW C;  1U4B A;  4AT9 A;  1UPH A;  4FBU A;  3OVS A;  2K89 A;  2DRA A;  4UAY A;  4FZM A;  2HOQ A;  4WC7 A;  3BS5 A;  2KSO B;  4Y2S A;  4J9S A;  3PV8 A;  3RRG A;  2RP5 A;  4RPY A;  3QE9 Y;  2F44 A;  4KLI A;  4GXJ A;  2FPM A;  5ALT A;  1M6Y A;  1Z19 A;  1Q79 A;  1UT8 A;  2H3I A;  2W11 A;  4USA A;  4QZB A;  3V7J A;  3TKA A;  4NY8 A;  2ZTC A;  1N48 A;  2HN2 A;  3AQF A;  4DOC A;  1Z3E B;  4ECU A;  4IC9 A;  4DCC A;  1ZOL A;  5KL8 B;  2MAX A;  1UA1 A;  3TAN A;  4NKT A;  4CNQ A;  4PPX A;  3S6J A;  4KLS A;  1KQQ A;  1DXS A;  5DGA A;  4YMM A;  2IMW P;  1SKR A;  4ACO A;  4XRH A;  1O03 A;  4Q45 A;  3MGV A;  2IBK A;  1X40 A;  4Y2P A;  1L5U A;  4IS7 A;  3D6J A;  1TFW A;  5AKX A;  5CEH A;  5AM0 A;  2DR7 A;  3LWM A;  4IRK A;  1BPE A;  4PGX A;  3TAC B;  5KG4 A;  3Q8K A;  1GO3 F;  1TAM A;  9ICL A;  2JEF A;  3UXO A;  5KG0 A;  4J9Q A;  3C2M A;  5HRE A;  4EGW A;  1IM4 A;  5D62 A;  2A3V A;  3DDH A;  3LDA A;  4UW9 A;  2LHT A;  2ZUB A;  3SAF A;  5J2I A;  1Q3V A;  2HHQ A;  3ZD9 A;  5KT6 A;  5IIM A;  2PFO A;  4R66 A;  2HW3 A;  4OJP A;  4UB8 U;  3N7P D;  8ICR A;  2XO7 A;  2RDJ A;  5ALO A;  1S10 A;  4AT8 A;  4B9N A;  4PHD A;  2ASL A;  3HRD D;  2DKZ A;  2I6X A;  5DBA A;  2KN7 A;  2KP7 A;  4IRD A;  3MFI A;  5AKJ A;  8ICZ A;  1TAQ A;  1U9L A;  2AQ0 A;  1N5X A;  2WFA A;  4LZD A;  4X4V A;  2G0A A;  2A19 A;  1BPB A;  2LYB A;  4RQM A;  5HR6 A;  2GWS A;  2Y0S C;  4J03 A;  4PL1 A;  1BNO A;  3RJE A;  5HRK A;  1RYS A;  2I5H A;  4NLZ A;  1SV0 A;  3QUC A;  4EZ9 A;  4X4R A;  3SYZ A;  1XSP A;  1ED1 A;  4WC4 A;  4EBD A;  4NLC A;  1R8A A;  2EAM A;  2DQN B;  2W9C B;  5BOM A;  4JV0 A;  3T5K A;  4DOB A;  4ED1 A;  2IHN A;  4E80 A;  5L9X A;  2Y1I A;  3I1Y A;  3NAS A;  2KJ9 A;  3BZC A;  5EE1 A;  1Z1B A;  3MAB A;  5J0P A;  4C80 A;  4KLJ A;  4QWA A;  4DL4 A;  3QNM A;  3GDX A;  3QEA Z;  3ETL A;  5J0T A;  4B9U A;  4UD4 A;  2ALZ A;  2HOF A;  2M2W A;  3B0X A;  2WHE A;  4TUS A;  4DOA A;  7ICV A;  5ALL A;  4EYH B;  7ICI A;  2ZH5 A;  2IOH A;  4E7X A;  2CPR A;  1XSN A;  9ICX A;  2XCA A;  2G5I B;  1NK4 A;  5J8Y A;  2KMD A;  7ICR A;  2IA6 A;  3H8M A;  4F4Z A;  4QZD A;  4UBC A;  4DFJ A;  2BCU A;  4O3S A;  1KN5 A;  4EED A;  4IR1 A;  1SIJ A;  4WH5 A;  4C4T A;  5J2D A;  2W55 A;  4F92 B;  3UPS A;  4X5V A;  4F4K A;  3GV8 B;  3RBE A;  2ZIX A;  9ICT A;  5KFL A;  5KT3 A;  2E1F A;  3H8J A;  5DGB A;  1L8L A;  4YVZ A;  1WUD A;  5AK5 A;  3Q8Q B;  2EZZ A;  1WWU A;  4B9S A;  5HRB A;  3JPN A;  2H3Z A;  3CRX A;  3ETR A;  4DQP A;  2LYH A;  5DB9 A;  1YLQ A;  4OO1 J;  1N61 A;  3IP4 B;  2P66 A;  1ZD5 A;  4X4N A;  3JYY A;  1V9P A;  3V7K A;  4MFC A;  5JTI A;  4M9J A;  5KFX A;  1J97 A;  1SV4 A;  3TAD A;  5ALF A;  4FH5 A;  2V4Q A;  5J2A A;  7ICN A;  1JRO A;  5AIA A;  5EWG A;  1DK2 A;  5TIS U;  2ZH9 A;  3PX0 A;  3WK9 A;  3QU5 A;  3MR3 A;  3Q8S B;  2KVC A;  3ER8 C;  2BDP A;  1TKD A;  1NNL A;  4K99 A;  5GTH U;  9ICV A;  5KT7 A;  4QZI A;  3RTV A;  1QCK A;  2LKY A;  4KLF A;  2CXY A;  4ATB A;  4PHP A;  9ICN A;  2FCL A;  5JUM A;  3E2E A;  4BXO B;  1BPZ A;  2E3T A;  1U49 A;  3WU2 U;  1FO4 A;  4RNN A;  3THV A;  1VLB A;  4Y2R A;  2RHF A;  4UQG A;  2W9M A;  1X2I A;  4DL5 A;  3WKB A;  3SMV A;  3OTQ A;  2YB4 A;  4DF4 A;  4JV1 A;  4Z6D A;  4GIB A;  2BHN A;  5ALV A;  5KG3 A;  5ALZ A;  4B9V A;  3ED5 A;  1MIV A;  2OM6 A;  3BQ0 A;  4I2E A;  2M2U A;  2KSO A;  4KLO A;  3BS5 B;  1NJX A;  3JPR A;  4UB1 A;  2FMS A;  2J6T A;  4LVS A;  2ISO A;  1XO1 A;  2KTQ A;  4DLE A;  4RQ6 A;  3IV6 A;  1J2M A;  2P6U A;  3BJY A;  3JPO A;  1EXN A;  1FIQ A;  1QH9 A;  2LM1 A;  9ICJ A;  1UCV A;  4Y2Y A;  3IDW A;  7ICE A;  2UVW A;  3JPS A;  3TAD C;  2KZZ A;  4O5E A;  5J0O A;  3JPP A;  5EE9 A;  5HRG A;  1N5W A;  1WCL A;  4WC0 A;  2GOL A;  4F72 A;  3PSF A;  5DDM A;  4DO9 A;  5III A;  3M8R A;  1B0X A;  3M8S A;  4IRC A;  4G3I A;  4HX0 A;  3SAG A;  4CCH A;  3KOO A;  4FS2 A;  5J0S A;  4B9T A;  1ZQQ A;  2ZH6 A;  4F50 A;  2R8K A;  2W54 A;  2C22 A;  3WFQ E;  1ZRM A;  8ICE A;  2QB0 B;  4J9M A;  2YY6 A;  2JHD A;  4PHE A;  4RPX A;  4DLG A;  3B9J A;  2E1E A;  2H3Q A;  3QXG A;  4ED3 A;  4JUZ A;  5KFN A;  2Y9U A;  5D49 A;  4F91 B;  4WC1 A;  4DSE A;  4K98 A;  5KT5 A;  3Q8M A;  2JEJ A;  1U47 A;  1SKW A;  4X0B A;  7ICO A;  4O3R A;  3L9D A;  2KIV A;  1KL9 A;  1HUO A;  1IG6 A;  2HHV A;  2JGA A;  4KX5 A;  1IIP A;  1PX5 A;  9ICB A;  1OU5 A;  4X4O A;  2KHV A;  3OVB A;  5KG1 A;  1COO A;  2O6K A;  3QYP A;  1BPD A;  1DOQ A;  3RF9 A;  3TFR A;  3EYZ A;  1D8L A;  3H4B A;  2ZXH A;  3MR5 A;  3EPI A;  5ALY A;  4M9L A;  4R63 A;  4NXV A;  2I9G A;  8ICA A;  2ZH1 A;  4WCW A;  2YQE A;  4QWB A;  5F9N A;  2KV2 A;  2W8K A;  5KG5 A;  5CHE A;  2XIC A;  2W9C A;  1R8B A;  2DL0 A;  1XWL A;  1QSL A;  3WFP A;  3GIM A;  1ZQI A;  2R8G A;  7ICQ A;  4ED6 A;  5ALN A;  2VA3 A;  2FI1 A;  3RRH A;  3B0Y A;  3QU4 A;  3C29 A;  3H38 A;  2B0C A;  3AN1 A;  1KW4 A;  3EW9 A;  4NM1 A;  4YG2 A;  3N28 A;  1P7D A;  3RJF A;  3AQM A;  2JRZ A;  3M6Z A;  3UMC A;  3GII A;  1Z4N A;  2YMP A;  4ECQ A;  4Q8E A;  4F2S A;  4KMU A;  3TFS A;  1PUZ A;  5FP0 A;  2ZH8 A;  5G5G A;  3AEV A;  1LVH A;  1X9M A;  1F5A A;  1ZQC A;  4AYB F;  1NK9 A;  4UD5 A;  4BWM A;  3A0B U;  4UAT A;  2XCP A;  2A1J B;  4I28 A;  9ICK A;  1ZQS A;  4O3N A;  5DED A;  2KG5 A;  2B4V A;  2LM4 A;  3OVA A;  3RAQ A;  2KEY A;  5KFG A;  1ZQK A;  2Q66 A;  3V6K A;  3EWA A;  5AHX A;  2AU0 A;  4DS4 A;  3TQ1 A;  1T8E A;  4UB2 A;  2ZIX B;  3C1Y A;  3F2C A;  2AQ4 A;  8ICO A;  2GH1 A;  4O67 A;  1KDH A;  1ZQT A;  4QNL A;  4I2C A;  3AL0 B;  2ZH3 A;  2ZH2 A;  4MHV A;  2K4P A;  1OW5 A;  4DFM A;  1KLN A;  2VA8 A;  5AI0 A;  4Q44 A;  2C2R A;  3KZI U;  3PW5 A;  1K1S A;  3HIL A;  3CW2 C;  4WC6 A;  4MFA A;  4NV0 A;  4KM5 A;  1TFR A;  4UB6 U;  1OUQ A;  3HKZ F;  5KFW A;  2WB1 F;  2GLE A;  2WF6 A;  2DVI A;  3ORY A;  2W3S A;  5KNI A;  5DBB A;  2KFN A;  3PW0 A;  2HBM A;  1L7P A;  4K4I A;  4UAR A;  3M9O B;  4J9L A;  1XO0 A;  2RRD A;  5AIB A;  4RQ4 A;  3HJ1 A;  1VDV A;  5EWF A;  4QZF A;  1TK8 A;  4NLG A;  1F5S A;  1D9F A;  5AKY A;  3MGH A;  4JLZ A;  2ZIW B;  2JEG A;  5IIN A;  5KFC A;  3PX4 A;  5DBC A;  4O3P A;  2YX8 A;  4UB4 A;  4RUA A;  4TUR A;  4UB3 A;  8ICV A;  4M6W B;  3NVV A;  4Y2J A;  3MR2 A;  1X9W A;  3L5K A;  4FZL A;  5CA7 A;  4K4G A;  4OCZ A;  5HR7 A;  4EEB A;  2HDO A;  4BXO A;  5EWE A;  4ED8 A;  2W8L A;  3ZD8 A;  5AKK A;  1PVR A;  5D46 A;  4QIW F;  3GIJ A;  2BCS A;  2ZUC A;  3FYH A;  4YMN A;  4U7C A;  4YN4 A;  5KFJ A;  3RAX A;  2Q0Z X;  1L6N A;  1YZ7 A;  3FDS A;  5L1J A;  1WG8 A;  5L1I A;  3NRZ A;  5KFB A;  2ZIU A;  4EV6 A;  2G07 A;  2C2D A;  3RR7 A;  1FEZ A;  2KZ3 A;  1S0N A;  4DSK A;  2XY5 A;  4O3Q A;  4RWO A;  4Z6E A;  2IUB A;  1ZRN A;  2VIX A;  4I2I A;  4ECW A;  2F3N A;  4DQQ A;  2VJ5 A;  3KHG A;  4ELV A;  1NZB A;  5DQI A;  5HRI A;  1N56 A;  2KOB A;  3PZP A;  4M9G A;  7ICF A;  3H7I A;  3RB4 A;  1VFG A; 
#chains in the Genus database with same CATH homology
 4O3S A;  1KEJ A;  3C23 A;  4RT2 A;  4NLN A;  3OHA A;  3T5L A;  3UXN A;  1JX4 A;  9ICC A;  4IR1 A;  1JAJ A;  1NZP A;  4F4X A;  1MQ3 A;  4Q8F A;  4ECR A;  1NKE A;  5J2D A;  4F92 B;  1JXL A;  2HVI A;  3KHH A;  3BDP A;  3UPS A;  4QWC A;  2WTF A;  2FPK A;  4X5V A;  3GV8 B;  3RBE A;  2DPI A;  2P6R A;  4F4K A;  4KLE A;  4KLL A;  2F1J A;  2M2T A;  4FHW A;  9ICT A;  3C5F A;  5KFL A;  3EZ5 A;  5KT3 A;  4YR3 A;  3H8J A;  2BCV A;  5DGB A;  2J6S A;  4DFP A;  2HVH A;  4ATB A;  3AU2 A;  1T4G A;  4YVZ A;  2ISP A;  1MIY A;  2ASD A;  2HHP A;  4YXM A;  4P4P A;  4X4U A;  1SL0 A;  4O5C A;  2BPC A;  3Q8Q B;  4B9S A;  5HRB A;  3JPN A;  1QLN A;  3OUY A;  8ICM A;  1L3U A;  2DPJ A;  1NK5 A;  1RYR A;  2F1I A;  4RQ1 A;  3MFH A;  9ICM A;  3PMN A;  1UA0 A;  4DQP A;  2LYH A;  5DB9 A;  4UB5 A;  4I2F A;  4FH3 A;  5HC9 A;  1S76 D;  4I2B A;  3T5J A;  2FLL A;  1YLQ A;  4QZ8 A;  2V9W A;  4QZE A;  4YXJ A;  3OHB A;  5EOZ A;  4FBT A;  2HHU A;  1WOT A;  3RJH A;  2P66 A;  8ICU A;  4E8F A;  4JWN A;  3H39 A;  4X4N A;  4WC2 A;  3JYY A;  4M2Y A;  5J2F A;  1JQR A;  1LV5 A;  5KFH A;  1TK0 A;  4QWD A;  1MQ2 A;  1V9P A;  2MUT B;  4TQS A;  5DQG A;  8ICC A;  3V7K A;  5KFU A;  4MFC A;  4EEY A;  2ZHA A;  5HML A;  1WCN A;  4M9J A;  5KFX A;  4RQ8 A;  4PHA A;  4FH5 A;  4ELU A;  3HW8 A;  2ATL A;  1TVA A;  5KFO A;  1JXE A;  3MDC A;  5CJ7 A;  5J2A A;  2V4Q A;  3GQC A;  4RWQ A;  4AT7 A;  4AT8 B;  2FMQ A;  4RQ7 A;  3G6Y A;  7ICN A;  5EWG A;  2BQR A;  1B43 A;  3BQ1 A;  7ICM A;  4YR0 A;  4EZ6 A;  7ICH A;  1DK2 A;  3C66 A;  5TZV A;  4EP7 A;  4B9L A;  4HYK A;  2H5X A;  2ZH9 A;  3PX0 A;  4K4H A;  5J2C A;  4FHP A;  9ICF A;  2RDI A;  1ZQP A;  5L1L A;  5HRD A;  3HJ4 A;  4I2D A;  3MR3 A;  3Q8S B;  9ICN A;  2FLP A;  5KTQ A;  5CP2 A;  1ZQN A;  1TKD A;  1KSP A;  2BDP A;  4X0A A;  5DB7 A;  5KFA A;  9ICV A;  5J0Q A;  3PX6 A;  3RJG A;  5KFQ A;  4YQW A;  1XS9 D;  5KT7 A;  4QZI A;  3RTV A;  2DRB A;  3AQL A;  4ECS A;  4KLF A;  4WC6 A;  1PZN A;  4PHP A;  4UAZ A;  1ZQZ A;  4R8U A;  4F5O A;  5JUM A;  4Q43 A;  4TQR A;  4C8N A;  2XC9 A;  3E2E A;  1NK6 A;  4BXO B;  4DL7 A;  3RJK A;  8ICI A;  4R65 A;  1BPZ A;  1TAU A;  4IQT A;  5J0U A;  5KT4 A;  4RNN A;  4IQV A;  1U49 A;  1SL2 A;  4UAW A;  3MDA A;  3THV A;  1H38 A;  4XUS A;  1ZQJ A;  3NTU A;  4QZG A;  3UXP A;  4YP3 A;  1C7Y A;  1KFT A;  4RNM A;  7ICF A;  1ZQF A;  5KFZ A;  3ISC A;  4UQG A;  2W9M A;  2F1H A;  2XGQ A;  4EBJ A;  1X2I A;  3V7L A;  4F93 B;  2JZB A;  4DL5 A;  3UQ2 A;  3ZDC A;  9ICI A;  4X4S A;  3PR5 B;  2ZH4 A;  2BCR A;  4DF4 A;  1NO5 A;  4JV1 A;  4Z6D A;  2O1P A;  4DSJ A;  2DR9 A;  2BHN A;  1UET A;  5CWR A;  5DB6 A;  5KG3 A;  5DG7 A;  5BOL A;  4FHY A;  2AGO A;  2ZTD A;  5KFT A;  1NJZ A;  4B9V A;  3ZDD A;  3C2K A;  2FPL A;  1MIV A;  1ZJN A;  1A77 A;  3BQ0 A;  4I2E A;  2PBE A;  5KFS A;  4ECY A;  1HJP A;  5J2K A;  1NKB A;  2M2U A;  4KLO A;  1B22 A;  1A76 A;  3PW2 A;  1NJX A;  2UVV A;  4M9N A;  3JPR A;  4UB1 A;  4DL6 A;  1Y88 A;  1ZQM A;  2FMS A;  2J6T A;  2VA2 A;  4ZH4 A;  3RR8 A;  4LVS A;  3PML A;  4FHV A;  1NOM A;  5KG7 A;  3JPT A;  4ED7 A;  3HX0 A;  8ICP A;  3C2L A;  2ISO A;  3C5G A;  3UQ0 A;  4KLQ A;  3H3A A;  1XO1 A;  4DSL A;  3T3F A;  4MF8 A;  4DLE A;  3PW4 A;  2KTQ A;  4F3O A;  2KZM A;  4RQ6 A;  1K1Q A;  4P4M A;  2W9B B;  5CR0 A;  4F4W A;  2XY6 A;  3TAR A;  3HT3 A;  4KLD A;  3MGI A;  2P6U A;  3BJY A;  1UT5 A;  4I27 A;  3JPO A;  8ICF A;  2A1J A;  4RU9 A;  1EXN A;  2DR5 A;  2BPF A;  4RQ3 A;  7ICR A;  4RQ5 A;  4ED0 A;  4F4Y A;  3RB6 A;  4DQI A;  4I2H A;  4MF2 A;  9ICJ A;  1JN3 A;  1KNY A;  3HWT A;  5DG9 A;  1ZET A;  1XC9 A;  2R8J A;  7ICE A;  3RB3 A;  2UVW A;  4YD1 A;  4KLH A;  3JPS A;  9ICR A;  2KZZ A;  2JEI A;  4O5E A;  2I1Q A;  3TAP A;  5J0O A;  5KFD A;  3JPP A;  3GIK A;  4LT6 A;  4PGQ A;  3G6V A;  5L1K A;  4EBK A;  5HRG A;  8ICT A;  2J6U A;  4RWN A;  5J2H A;  3H40 A;  4ECZ A;  5KFE A;  1WCL A;  1NKC A;  1HUZ A;  2ZUD A;  4B9M A;  4WC0 A;  5DB8 A;  2W9A A;  4X4T A;  3QZ8 A;  1BNP A;  3ISB A;  4F5N A;  3IHQ B;  4Z6C A;  2B21 A;  3HP6 A;  1L3V A;  3H8W A;  5IIO A;  5DDM A;  3UPQ A;  4FS1 A;  4DO9 A;  1L3S A;  2PFN A;  4F2R A;  4X4P A;  5III A;  3M8R A;  4X4Q A;  4MEY A;  3WFR E;  3M8S A;  2NRT A;  3RBD A;  5J0W A;  4IRC A;  3RB0 A;  2BCQ A;  4G3I A;  3AUO A;  9ICU A;  1Z00 A;  2RFF A;  2R8I A;  3PO4 A;  2ASJ A;  4CCH A;  1MSW D;  3GV5 B;  1SKS A;  4FS2 A;  5J0S A;  4B9T A;  2NRX A;  4BGD A;  4XQ8 A;  4DF8 A;  1ZQQ A;  4F50 A;  2ZH6 A;  4NM2 A;  2V4R A;  3OUY B;  2XGP A;  1TK5 A;  2R8K A;  2C22 A;  8ICB A;  4JK1 A;  3WFQ E;  4I29 A;  4IQU A;  2PXI A;  2PFQ A;  1ZQV A;  4XA5 A;  4J9M A;  4ED2 A;  8ICE A;  1CUK A;  2HHX A;  8ICQ A;  2FLN A;  4RNO A;  4ECT A;  1ZQE A;  2BPG A;  4DFK A;  4XQ7 A;  5C5J A;  3OJU A;  1ARO P;  1SL1 A;  8ICN A;  4PHE A;  4RPX A;  4DLG A;  3AQK A;  4GXK A;  1KFD A;  4JUZ A;  4ED3 A;  5KFN A;  4GC6 A;  7ICU A;  8ICK A;  9ICW A;  5D49 A;  7ICG A;  4F91 B;  5J0X A;  4DSE A;  4WC1 A;  8ICX A;  5HRF A;  3OV7 A;  5KT5 A;  3Q8M A;  2JEJ A;  3RH4 A;  1U47 A;  4NKU A;  4KLM A;  3Q8R B;  1SKW A;  2MUT A;  7ICO A;  2BCU A;  4X0B A;  4O3R A;  1S0V A;  3PVX A;  3L9D A;  4M04 A;  1BVS A;  1HUO A;  3MBY A;  9ICP A;  3QEB Z;  3ZDE A;  2HHV A;  3H8S A;  4Z6F A;  4QZA A;  3NGD A;  2UVU A;  1CEZ A;  3PNC A;  4AT7 B;  4M6W A;  4QW9 A;  4RWP A;  4QZC A;  1S77 D;  1PX5 A;  1ZQD A;  4M5D A;  3K75 D;  3N4M B;  9ICB A;  1OU5 A;  4MFF A;  1U48 A;  4X4O A;  2ZJA A;  1ZQB A;  1NK8 A;  4O3O A;  3OVB A;  5KG1 A;  3ZDB A;  1COO A;  2DFL A;  3IM1 A;  4GC7 A;  3KHL A;  2OWO A;  3LQC B;  1BPD A;  1JMS A;  5HRH A;  1DOQ A;  1XU4 A;  3G6X A;  3WFO A;  3TFR A;  2IHM A;  3EYZ A;  5J2B A;  1D8L A;  3H4B A;  4YD2 A;  4RQ0 A;  3MR5 A;  1UEV A;  3EPI A;  5KG2 A;  2C2E A;  5HP4 A;  1T3N A;  5J0R A;  1S0M A;  4M9L A;  4R63 A;  1VJ7 A;  4ATB B;  4R8U B;  2DR8 A;  2C28 A;  4NLK A;  3H37 A;  1ZQA A;  5J0Y A;  3TI0 A;  2I9G A;  8ICA A;  2ZH1 A;  4WCW A;  1V4A A;  4QWB A;  4DSI A;  5F9N A;  5KFV A;  2W8K A;  5KG5 A;  4E0D A;  2M2V A;  2NRK A;  4KN4 A;  8ICY A;  5HHH A;  3C21 A;  1TV9 A;  2BKE A;  4QW8 A;  2W9C A;  4WBZ A;  1TFY A;  1R8C A;  4P4O A;  4GXI A;  1XWL A;  1S9F A;  5KG6 A;  3JPQ A;  4J9O A;  1LB2 B;  1QSL A;  1R8B A;  3WFP A;  2JZB B;  3GIM A;  1U45 A;  5J29 A;  4I2J A;  4DL3 A;  3SV3 A;  1ZQI A;  2R8G A;  3T5H A;  4I2A A;  4KLT A;  7ICQ A;  4ED6 A;  3NYB A;  4WC5 A;  5KFR A;  1T7P A;  4EYI B;  5CB1 A;  2Y1J A;  2VA3 A;  3RRH A;  3B0Y A;  3N97 B;  5KFP A;  8ICL A;  8ICW A;  3H38 A;  4AT9 A;  1U4B A;  2PFP A;  3OVS A;  4FBU A;  3EW9 A;  4EBE A;  4NM1 A;  2BR0 A;  2DRA A;  9ICO A;  4YG2 A;  4UAY A;  3QZ7 A;  3OSN A;  1D9D A;  4BDP A;  3RJF A;  4WC7 A;  3AQM A;  3GIL A;  3C18 A;  2NRW A;  4J9S A;  3GII A;  3GV7 B;  3PV8 A;  1NJY A;  3ZDA A;  3RRG A;  4RPY A;  3QE9 Y;  4ECQ A;  4JV2 A;  4KLI A;  1MC8 A;  4GXJ A;  2FPM A;  4Q8E A;  2NRZ A;  5HMM A;  4F2S A;  4KMU A;  1ZQY A;  3TFS A;  1Q79 A;  1UT8 A;  3AQN A;  1X9S A;  3KHR A;  4E80 A;  2ZH8 A;  4QZB A;  3V7J A;  5DLF A;  1X9M A;  4NY8 A;  4YR2 A;  1F5A A;  5DG8 A;  2ZTC A;  3V72 A;  1N48 A;  1ZQC A;  3PY8 A;  4M47 A;  3ISD A;  3PR4 A;  1NK9 A;  5DQH A;  1QTM A;  4RPZ A;  4DOC A;  3SI8 A;  4UD5 A;  4BWM A;  1ZYQ A;  1Z3E B;  1ZQX A;  3V6H A;  2XCP A;  4ECU A;  4MEX A;  1ZQL A;  2A1J B;  4QWE A;  4I28 A;  9ICK A;  1ZQS A;  9ICQ A;  4O3N A;  2MAX A;  1UA1 A;  3TAN A;  2FMP A;  4NKT A;  5DED A;  4PPX A;  4KLS A;  3AU6 A;  3OVA A;  7ICK A;  3RAQ A;  5KFF A;  5DGA A;  5DEC A;  1RXV A;  5KFG A;  4YMM A;  4KN7 A;  4DQR A;  1ZQK A;  2IMW P;  3HIY A;  2Q66 A;  4QZH A;  1SKR A;  7ICJ A;  1JIH A;  5DLG A;  4XRH A;  3V6K A;  3EWA A;  1RXW A;  1R89 A;  2AU0 A;  4DS4 A;  4Q45 A;  5J2E A;  3TQ1 A;  4UB2 A;  3C1Y A;  1T8E A;  2IBK A;  2AQ4 A;  8ICO A;  2AJQ A;  1L5U A;  5HNK A;  2PI4 A;  3PW7 A;  4LZG A;  1Q78 A;  8ICH A;  1BPY A;  1KDH A;  7ICP A;  1TFW A;  1ZQW A;  2BGW A;  1ZQT A;  5KFI A;  1ZQG A;  2DR7 A;  3LWM A;  3WFS C;  4RZR A;  4I2C A;  2ZH3 A;  2ZH2 A;  4M0A A;  1ZQU A;  4IRK A;  3MR6 A;  3RJI A;  5DKW A;  3JZ0 A;  5KFY A;  4RUC A;  1BPE A;  4PGX A;  4PH5 A;  4DFM A;  2VA8 A;  3LWL A;  1KLN A;  4IG8 A;  4Q44 A;  2C2R A;  3H4D A;  1NK7 A;  5KG4 A;  1L3T A;  3Q8K A;  1Z00 B;  3PW5 A;  1BGX T;  2M9N A;  1K1S A;  3Q8L A;  3SV4 A;  3PO5 A;  4ECX A;  4C8O A;  9ICL A;  3Q8P B;  4MFA A;  2BQU A;  3M9M B;  4J9K A;  1NK0 A;  1ZQR A;  1KRP A;  2JEF A;  1TFR A;  3UXO A;  5KT2 A;  5KG0 A;  1ZQO A;  5KFW A;  4J9N A;  4J9Q A;  4KLG A;  3C2M A;  5HRE A;  5KFK A;  1IM4 A;  3C1Z A;  2DVI A;  3ORY A;  3K4G A;  4TUP A;  4F8R A;  2XY7 A;  5DBB A;  3LDA A;  1S97 A;  1KFS A;  3BQT A;  5J2I A;  2ZUB A;  4C8M A;  2HHQ A;  2KFN A;  3PW0 A;  2O5A A;  3ZD9 A;  5KT6 A;  5IIM A;  1D8Y A;  2PFO A;  1DK3 A;  1ZQH A;  4ELT A;  4R66 A;  2HW3 A;  3OGU A;  4K4I A;  4TUQ A;  1KTQ A;  7ICT A;  3M9O B;  4J9L A;  3V6J A;  3RH5 A;  8ICR A;  2VAN A;  4RQ4 A;  3GFK B;  3HJ1 A;  4WC3 A;  2XO7 A;  2RDJ A;  2UVR A;  5EWF A;  1S10 A;  4QZF A;  1TK8 A;  9ICS A;  4NLG A;  4AT8 A;  4B9N A;  5IIJ A;  4PHD A;  1DGS A;  1QSS A;  2ASL A;  1D9F A;  2KN7 A;  4IRD A;  5DBA A;  4KTQ A;  2KP7 A;  2BQ3 A;  3MFI A;  3MGH A;  4KIT B;  2JEG A;  8ICZ A;  1TAQ A;  5IIN A;  4C8L A;  8ICJ A;  1U9L A;  5KFC A;  4UBB A;  5DBC A;  4O3P A;  3PX4 A;  4UB4 A;  4DS5 A;  4RUA A;  4TUR A;  2KFZ A;  2AQ0 A;  4UB3 A;  8ICV A;  4M6W B;  4LZD A;  4X4V A;  4YMO A;  3MR2 A;  1X9W A;  4QZ9 A;  4C8K A;  4F5Q A;  5IIK A;  5CA7 A;  3RJJ A;  4K4G A;  5F9L A;  5BPC A;  4DWI A;  4O9M A;  1BPB A;  4KLU A;  9ICG A;  2GWS A;  9ICH A;  4RT3 A;  4F5P A;  4BXO A;  2HHW A;  5EWE A;  4GLX A;  4BWJ A;  5F2V O;  5J2G A;  4R64 A;  4ED8 A;  5DDY A;  4NXZ A;  2W8L A;  3RJE A;  1RYS A;  1BNO A;  5HRK A;  3ZD8 A;  2BE3 A;  4NLZ A;  3BQ2 A;  3SZ2 A;  1RZT A;  4WBY A;  4EZ9 A;  4X4R A;  4FHX A;  5D46 A;  3SYZ A;  1XSP A;  4DEZ A;  3GIJ A;  4FO6 A;  4WC4 A;  3EPG A;  2ZUC A;  2BCS A;  4EBD A;  3FYH A;  2ZTE A;  4YMN A;  4IQW A;  5HHI A;  7ICS A;  1R8A A;  2AGQ A;  5D4B A;  4YN4 A;  3KTQ A;  4P2H A;  5KFJ A;  2W9C B;  3HPO A;  2AGP A;  3RAX A;  5HR9 A;  2Q0Z X;  5BOM A;  4JV0 A;  4J9R A;  4F5R A;  4DOB A;  1IXR A;  4ED1 A;  5L9X A;  3T5K A;  2Y1I A;  2IHN A;  8ICG A;  1MIW A;  4JWM A;  2HHT A;  3FDS A;  2R8H A;  5L1J A;  3OSP A;  1NJW A;  1S0O A;  1BPX A;  5L1I A;  3OJS A;  8ICS A;  4AT9 B;  2ZH7 A;  4IR9 A;  3MAB A;  5J0P A;  5KFB A;  1UEU A;  4KLJ A;  5HRL A;  4QWA A;  4DL4 A;  2ID1 A;  2ZJ5 A;  3GDX A;  4J9P A;  4DL2 A;  3QEA Z;  3ETL A;  2C2D A;  3RR7 A;  5J0T A;  1ZJM A;  4B9U A;  1FA0 A;  4UD4 A;  2HHS A;  5CHG A;  2KZ3 A;  2ALZ A;  1S0N A;  4DSK A;  3B0X A;  4O5K A;  2XY5 A;  2M2W A;  1QSY A;  3RH6 A;  4O3Q A;  4RWO A;  4Z6E A;  2W9B A;  4TUS A;  7ICL A;  2PI5 A;  4I2I A;  4DOA A;  7ICV A;  7ICI A;  4EYH B;  2ZH5 A;  4ECW A;  1RPL A;  4DQQ A;  9ICE A;  4DQS A;  3LK9 A;  3KHG A;  2ZJ8 A;  4E7X A;  4ELV A;  1XSN A;  4YCX A;  5KFM A;  9ICX A;  2XCA A;  1NK4 A;  4RQ2 A;  2NRV A;  4PGY A;  4O0I A;  3TAQ A;  5DQI A;  1XSL A;  5HRI A;  4ECV A;  4M9H A;  9ICA A;  1N56 A;  4I2G A;  4S3N A;  4M9G A;  2ZHB A;  5J2J A;  2IA6 A;  4F4Z A;  3H7I A;  4EBC A;  4DSF A;  4QZD A;  4YFK A;  4UBC A;  5IIL A;  4DFJ A;  3RB4 A;  1VFG A;  1SZP A;  3M9N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...