4UB5A

Dna polymerase beta substrate complex with a templating cytosine, incoming 8-oxodgtp, and mn2+, 5 s
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
326
structure length
310
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*GP*AP*CP*CP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3'
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 106
structure length 310
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub5A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub5A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub5A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub5A03
3H37A 1RPLA 1PX5A 4C8LA 9ICEA 5C5JA 1EXNA 1ZQOA 4WC7A 4YMMA 2HHWA 3PVXA 9ICLA 5J0YA 1S0NA 1NJXA 2AU0A 4J9LA 2ATLA 1JXEA 4RNOA 1BPZA 3UXPA 1ZQZA 2BCQA 3RJKA 5J0UA 5J29A 4EYIB 4EEYA 1KEJA 5J0XA 3ISCA 4RWNA 3V6JA 1QSSA 2VA3A 4UBBA 3QZ8A 8ICTA 7ICNA 4FH5A 4X4SA 5HNKA 4M6WB 3FDSA 1ZQXA 3GFKB 4FS2A 3T5KA 1XSNA 4QWBA 1S9FA 4NM1A 1XO1A 3KHRA 3KTQA 4RZRA 3ETLA 1BPXA 2FLNA 4NKUA 3AQLA 4QWCA 8ICZA 1JMSA 5J0WA 4R66A 1KTQA 4UBCA 4XRHA 1NK6A 4KLQA 8ICKA 2Q0ZX 7ICQA 5KT6A 3HJ1A 3TI0A 1L3UA 2C2EA 4JUZA 3UXOA 4O3RA 2FMSA 4IR1A 3C23A 3JYYA 1MIVA 3UPSA 2ZH6A 4I2FA 5J2FA 3EW9A 2BQUA 4YP3A 1NK0A 2FPMA 1HUOA 9ICGA 4KLDA 4B9VA 4ECSA 4RWPA 4F4WA 4DWIA 4M2YA 1ZQJA 5CHGA 3C1ZA 3H40A 4DSEA 7ICHA 3PX4A 2Y1JA 5KG7A 3JPOA 3ZDEA 3GILA 2F1IA 2MUTB 4DSJA 2XY7A 5J2DA 5IIKA 4RQ0A 4M9GA 5DQIA 4UAYA 4ECVA 1FA0A 2KZ3A 3M8RA 1ZQNA 8ICEA 2ZH8A 5KFWA 3OHBA 4K4HA 8ICGA 5J2GA 1KSPA 2MUTA 4YVZA 5L1KA 2M2WA 4I28A 4DFMA 4LVSA 2AGQA 3PV8A 2W9BA 9ICKA 4PGXA 3TFSA 3OJUA 4ED1A 1RZTA 1ZQSA 2R8KA 4FBUA 2HVHA 3H4DA 4NXZA 2JZBA 2ASJA 1XC9A 2XO7A 5KG2A 4O9MA 1ZQVA 2HHXA 5HHHA 3MDCA 4J9NA 3RJEA 8ICBA 1ZQHA 5J2BA 4GXKA 5KT3A 4RPXA 4WC4A 4DOCA 5HRIA 5J2HA 1SZPA 4M9JA 4ATBB 4GC7A 4G3IA 2IMWP 4Q45A 8ICCA 8ICRA 5KFBA 3RAXA 4PH5A 2ZJ8A 3PW2A 1S77D 3MFIA 1UT8A 4XQ7A 1ZQQA 4I2DA 1ZJMA 1NK9A 4FHWA 1VFGA 2DR9A 4BDPA 3RJFA 3EZ5A 1DOQA 3BJYA 5KFFA 4YG2A 4TUQA 2GWSA 3PO4A 4F5NA 4DL7A 4KLGA 1TV9A 2DPIA 1XWLA 4RQ8A 2UVVA 2ZH5A 3QE9Y 9ICMA 2ZH7A 2ZHAA 3ZDBA 7ICPA 2ZH2A 2ZH9A 4Q8EA 3EWAA 5EWGA 1ZQAA 2VA2A 5DG9A 4UB2A 4I2HA 1Q78A 4UAZA 1UETA 4AT7B 4F93B 1XU4A 1UEUA 5DG7A 5KFVA 1RYSA 4O5EA 4QWEA 4Q44A 2V4RA 3KHLA 2BQRA 2W8KA 1QLNA 5D49A 9ICNA 5L1JA 2FMPA 2C22A 4KLUA 3RAQA 1BPYA 5HRDA 3ISBA 2O5AA 2NRXA 7ICUA 2HHUA 2RDIA 4QZGA 4FH3A 4B9UA 4PPXA 4I2JA 1V9PA 5D4BA 3AU2A 4PHAA 5HRKA 4AT9A 5L9XA 4I2IA 4E7XA 4FHVA 4BGDA 5J0RA 4EBDA 2O1PA 1X9MA 2A1JA 4ECWA 4IRDA 2AJQA 5IIMA 4F4ZA 2NRVA 5KFRA 4UB5A 4MEXA 2PFPA 2J6UA 4GXIA 4F5PA 3C18A 8ICLA 3BDPA 2XC9A 5KFNA 3RTVA 1C7YA 4RT3A 1KNYA 1ZQFA 1ZYQA 3T5JA 4DL6A 3TANA 3MR5A 9ICSA 3RH4A 2BE3A 3RR8A 3HX0A 1T7PA 2PI5A 5KFSA 4I2GA 1SKRA 1SKSA 2BDPA 1BPDA 1Z00A 2DR7A 3LWLA 4ECZA 4QW9A 5KFGA 2IHMA 3OVAA 1TK8A 3C1YA 7ICEA 4O3QA 3QZ7A 1X2IA 5KFAA 9ICTA 1B22A 2HHQA 2Y1IA 2ZTEA 4YR2A 4F5OA 1TVAA 7ICRA 1K1SA 9ICVA 3WFRE 5J0TA 4DQPA 1ZQRA 3PR5B 2ZUCA 4J9KA 3EYZA 5DB6A 4ED8A 4DL5A 4K4GA 4KLMA 1R8CA 4J9OA 8ICYA 1NK4A 7ICIA 2KN7A 3RRGA 1R8BA 1RXVA 4XA5A 3MR6A 1ZQGA 8ICWA 4GC6A 3T5HA 9ICJA 5BPCA 5DBAA 3PR4A 3BQ2A 5KFXA 3V7JA 4QZCA 2XGPA 3TAPA 8ICSA 2M2TA 2M9NA 4ED2A 4R64A 3PNCA 3JPRA 8ICHA 4NM2A 2I1QA 4DS5A 3SYZA 3UPQA 4EP7A 4O5KA 4M5DA 4WC3A 2KP7A 5KFTA 5J2EA 2IBKA 1S76D 2ZJ5A 3C2KA 7ICJA 5J0QA 4O3OA 5KG3A 5KFKA 4B9MA 7ICSA 3H7IA 4YR0A 2ZHBA 4YMNA 2BHNA 3HT3A 3WFQE 1TFYA 1LB2B 1K1QA 4JWMA 3V7KA 4Z6EA 5CWRA 2ZTDA 4PGQA 4DQQA 1U47A 4IRCA 7ICMA 4X0BA 5KTQA 2XCPA 4B9TA 4MFFA 3WFSC 5CA7A 4IG8A 3Q8PB 4J9MA 3TAQA 1R89A 3AQNA 5DBCA 4P4OA 1MC8A 4YFKA 5DQHA 4F92B 3MGHA 4B9NA 2ZJAA 4IQWA 4RT2A 5J2CA 1A77A 3M9OB 9ICQA 2W9CA 1S0VA 3RB6A 3ZD8A 5DG8A 2BCSA 4I2AA 2VANA 3C66A 2W9BB 4QZIA 4P4MA 3M8SA 1ZQLA 5DDMA 4WC5A 3MR2A 4RUCA 1D8LA 3B0XA 1BPEA 2JZBB 1ZQIA 2RFFA 1AROP 4J9PA 2Q66A 1NKCA 4F4KA 1WCLA 1NJWA 2C2RA 1ZQUA 4IQTA 5DLFA 8ICMA 2AGOA 9ICOA 1BNOA 4MF8A 1QSLA 1NZPA 2F1HA 4QZHA 3AU6A 3MGIA 2BPCA 1ZQEA 3PW5A 2ZTCA 4PHEA 4RPZA 2DVIA 3SV3A 1U45A 4DF4A 5HRFA 4X4TA 4KLJA 3RH6A 4BWMA 4UQGA 3RJHA 4UB3A 1RXWA 4ELVA 2P66A 1MIYA 3HW8A 4F2SA 2BKEA 4JWNA 5HRLA 3RBDA 2UVUA 9ICUA 1ZQKA 4DQSA 5F2VO 8ICVA 9ICWA 1TFWA 7ICVA 1LV5A 5J2IA 4ELUA 2AQ0A 5IINA 3ZDAA 1KFTA 1B43A 2XY6A 1BVSA 5F9LA 3PO5A 2C2DA 3OVSA 2H5XA 4F4XA 4FBTA 3MDAA 4WCWA 2NRWA 5KFZA 3JPPA 3RB0A 2DRAA 3TFRA 4R65A 7ICLA 4QWDA 4F3OA 3G6VA 4C8NA 2DRBA 2NRTA 4RQ5A 3Q8LA 1ZQBA 2R8HA 4X4NA 4EBJA 5KFOA 4X4VA 3HIYA 4PGYA 3N4MB 2DFLA 7ICFA 1VJ7A 3THVA 3TQ1A 2XY5A 1DK2A 3SI8A 2LYHA 2V4QA 1U49A 4RNMA 4M04A 4RQ1A 4C8MA 2PFNA 3H39A 4AT9B 2JEGA 1UA0A 3AQKA 3ORYA 3EPIA 2A1JB 5KG5A 1L3TA 4YD2A 8ICQA 8ICUA 1D9DA 4KN7A 4UB1A 1KLNA 4FHYA 4WBYA 3PMNA 1KFDA 3LQCB 1F5AA 3QEBZ 3ZDDA 3PY8A 4KLFA 3M9NB 9ICPA 3V6KA 2HHPA 5DLGA 3LWMA 1NJZA 3H8JA 5IIJA 5KFLA 1ZQWA 4YMOA 2HHVA 4ZH4A 4F91B 1T3NA 2HVIA 3Q8QB 2DR8A 4JV1A 4NLGA 1ZQYA 3V6HA 3UQ0A 1D8YA 2IA6A 5KG0A 1JN3A 1Z00B 3ISDA 4HYKA 4BXOA 3HPOA 2VA8A 1RYRA 1H38A 5DB7A 4DEZA 5KFMA 4GLXA 2ID1A 4JV0A 4QWAA 1XSLA 5DEDA 3GIKA 4ECQA 2R8IA 3RB4A 5DGBA 5BOLA 4ED6A 8ICOA 4Z6FA 4KLOA 3RR7A 1UT5A 1V4AA 4YQWA 1WOTA 4YXMA 4LT6A 3OHAA 2P6RA 2JEFA 5IIOA 4DQRA 4ECXA 4QZEA 3H8SA 5HP4A 2PBEA 2B21A 3OSNA 3HP6A 3C5GA 3RJIA 3C2MA 1L5UA 1QSYA 1YLQA 4FHPA 1KRPA 3GV8B 4NLNA 4KLHA 4F5QA 4DF8A 4Q43A 1UA1A 3B0YA 1IXRA 3GV5B 2ASDA 4DOBA 4KLTA 1COOA 3RBEA 2FLLA 4XQ8A 4DL3A 3N97B 4UD4A 7ICOA 4X5VA 4AT8A 1XS9D 4FS1A 3OGUA 3QEAZ 1Z3EB 4RQ6A 4TQSA 4ECTA 4X4PA 4FO6A 4BWJA 4I29A 1JIHA 4RQ3A 2FLPA 4NY8A 4M9HA 1NO5A 4DQIA 5DQGA 4ECRA 2C28A 4WC2A 8ICPA 3K75D 4YN4A 1U9LA 3OSPA 3T3FA 5L1LA 5CB1A 5L1IA 5J2AA 9ICIA 5KG6A 1SL1A 5J0SA 4DLEA 2ASLA 5EWFA 4KLSA 1TAUA 2WTFA 4DL4A 1ZJNA 4RQ7A 1KDHA 4KITB 5KT7A 4IQUA 1MQ2A 4EYHB 5KFCA 5KT4A 5J2KA 1ZQPA 7ICGA 4ED0A 5D46A 4P4PA 1Q79A 4P2HA 2NRKA 4FHXA 1XSPA 4O5CA 2HHSA 9ICBA 2W9MA 3H3AA 3OUYA 3OJSA 4RU9A 2KZMA 3Q8SB 3KHGA 1ZQDA 3RJJA 4YCXA 4QZAA 4RQ4A 4QZBA 4DS4A 1S0OA 3RRHA 1ZQMA 4K4IA 4YR3A 3JPSA 3JPTA 2BCRA 4KLLA 5HHIA 8ICFA 2W9CB 2KZZA 8ICNA 1N56A 2ZUDA 2ALZA 4IRKA 4EBKA 4X4OA 2ZH4A 1SKWA 2W9AA 4TQRA 2DPJA 2M2VA 1JAJA 9ICXA 4EBCA 5HREA 4YD1A 4MFCA 3K4GA 2ZH3A 2KFNA 3GIMA 5DGAA 4CCHA 5CJ7A 3MBYA 3E2EA 3GQCA 5KFIA 1X9WA 4RPYA 1SL0A 4EZ9A 5J0OA 3EPGA 4O3PA 3SZ2A 3PW0A 1ZQTA 2IHNA 4C8KA 5HRBA 9ICFA 5IILA 4RWQA 2DR5A 4M6WA 2AGPA 4KLIA 1BNPA 4NKTA 3BQ1A 5KFUA 3PX6A 3HWTA 5KG1A 1L3VA 3BQ0A 4DSFA 5HR9A 4PHDA 4X4UA 3ZDCA 4O3NA 2XGQA 3IHQB 2R8JA 4UD5A 4WBZA 3UQ2A 4X0AA 3PX0A 1UEVA 2PFOA 2R8GA 3GIIA 4MF2A 2NRZA 4Z6CA 4F8RA 3AUOA 4EBEA 1D9FA 5DB8A 4X4RA 8ICIA 4NLKA 4RWOA 1BPBA 2BR0A 9ICAA 4IR9A 4O3SA 5HRHA 1MIWA 3AQMA 3RB3A 4WC1A 3G6YA 2RDJA 1R8AA 4TUSA 4XUSA 4MFAA 1HJPA 5KT2A 5JUMA 5EWEA 2UVRA 2MAXA 3C5FA 8ICJA 2PXIA 4UB4A 3RJGA 4DSIA 3UXNA 2ISPA 2P6UA 3H4BA 4JV2A 4F5RA 4EZ6A 1QTMA 1OU5A 1NJYA 9ICCA 3GDXA 3PW7A 5DECA 5KFPA 4M9NA 2BPFA 4J9SA 4KLEA 1T8EA 4I2BA 3Q8KA 5CR0A 1U4BA 4RNNA 4R8UB 1NK5A 4ELTA 5KFHA 1A76A 5KT5A 4YXJA 1NKBA 1JQRA 5KG4A 3HJ4A 3FYHA 1KFSA 2BGWA 4IQVA 4GXJA 5DB9A 1CEZA 2V9WA 1NOMA 4B9LA 4ECYA 3JZ0A 5J2JA 5TZVA 2BQ3A 4B9SA 3H8WA 4R8UA 1WCNA 3MABA 4DOAA 1SL2A 3PMLA 2FPLA 7ICTA 4UAWA 5KFQA 1TFRA 4I27A 4RUAA 3IM1A 4J9QA 5CP2A 2BCVA 4ED7A 2KFZA 1S0MA 2W8LA 1MSWD 3H38A 4Z6DA 4BXOB 4ATBA 3NTUA 4QZ8A 4KTQA 3G6XA 4I2EA 4M47A 4WC0A 1HUZA 3T5LA 1N48A 3OV7A 1DK3A 4KMUA 4R63A 9ICRA 4I2CA 4DFJA 3GIJA 2OWOA 3GV7B 1S10A 2M2UA 4WC6A 2ZH1A 4DL2A 3ZD9A 3PW4A 4C8OA 4TUPA 3KHHA 4F50A 4TURA 2UVWA 1ZQCA 4QW8A 1TK5A 4PHPA 4RQ2A 5HMMA 4DLGA 1DGSA 2PFQA 9ICHA 4M0AA 3WFPA 2FMQA 4LZGA 5J0PA 5KFYA 1IM4A 5BOMA 3OVBA 2ZUBA 1NKEA 3JPQA 7ICKA 4E8FA 4ED3A 2HHTA 4QZDA 1BGXT 4AT7A 4JK1A 1U48A 1Y88A 1MQ3A 4QZ9A 4AT8B 4E0DA 1ZETA 2J6TA 3V72A 4E80A 1TAQA 4DO9A 4NLZA 1T4GA 3LDAA 1JXLA 4DSLA 5F9NA 2BPGA 4DSKA 3RH5A 3M9MB 3MFHA 1CUKA 4J9RA 2FPKA 2I9GA 3L9DA 3V7LA 2KTQA 4DFPA 5HC9A 4M9LA 3C2LA 5DKWA 5IIIA 4S3NA 4QZFA 5HMLA 5HRGA 1L3SA 1PZNA 2JEJA 4X4QA 5KFEA 4F4YA 1JX4A 4LZDA 4ECUA 2AQ4A 1TK0A 3SV4A 2BCUA 3MR3A 5EOZA 4DFKA 4MEYA 5DBBA 3Q8RB 3C21A 3Q8MA 1NK8A 2HW3A 3JPNA 3LK9A 3TARA 2F1JA 4KN4A 5DDYA 1S97A 2ISOA 2J6SA 5KFDA 2PI4A 1NK7A 3OUYB 2JEIA 8ICXA 2XCAA 3WFOA 3BQTA 1TKDA 4F2RA 3NGDA 3NYBA 4Q8FA 8ICAA 5KFJA 4O0IA 1X9SA
chains in the Genus database with same CATH superfamily
1PX5A 3PZPA 5C5JA 4WC7A 4YMMA 2HHWA 5EE9A 3PVXA 2R18A 5J0YA 1NJXA 4J9LA 3UXPA 1KEJA 2VA3A 4UBBA 3SAHA 4FH5A 1ZQXA 5AK6A 3T5KA 4QWBA 1S9FA 4RZRA 3QU4A 1JMSA 4XRHA 2IHOA 2Q0ZX 5KT6A 4JUZA 1V38A 1GO3F 3JYYA 3EW9A 2JRZA 9ICGA 4ECSA 4BX9C 3C1ZA 4DSEA 4FE3A 1HEKA 3ZDEA 5J2DA 1Q46A 5IIKA 5AM3A 4RQ0A 4HX0A 5DQIA 4UAYA 2DWQA 5ALPA 4K98A 1ZQNA 8ICEA 2EZYA 4UARA 1PVQA 8ICGA 4OJ5A 5L1KA 4LVSA 5AI5A 3SENA 3TFSA 3OJUA 4ED1A 1ZQSA 2R8KA 2KJ9A 2ASJA 2IOHA 3MDCA 4J9NA 8ICBA 1ZQHA 2I6XA 5J2BA 4GXKA 5KT3A 2JR5A 5HRIA 4M9JA 4Q45A 1QH9A 1N2XA 4PH5A 3MFIA 4MKPA 3QXGA 5KFFA 4F5NA 2ZH5A 2ZH2A 2KG5A 3EWAA 5EWGA 1ZQAA 2VA2A 4UB2A 3AQFA 4AT7B 5JTIA 4F93B 3PSIA 5DG7A 5KFVA 5D49A 5L1JA 2N1RA 2O5AA 3ISBA 4B9UA 3D2SA 5L9XA 3DDHA 4BGDA 4EBDA 5E79U 5AI9A 2O1PA 4ECWA 4F4ZA 3A0HU 2NRVA 5KFRA 4MEXA 2J6UA 4F5PA 1DRGA 2XC9A 3RTVA 1C7YA 4RT3A 4JLXA 1ZQFA 5B3QA 2BE3A 4I2GA 1Z00A 2DR7A 4MHVA 2IHMA 4NXVA 4P0PB 4O3QA 5KFAA 9ICTA 1B22A 2Y1IA 3N7PD 1ZQRA 3PR5B 2ZUCA 3EYZA 3ERCC 2DQNB 1PK1A 1RXVA 2LKYA 2VJ5A 2K4IA 3UMCA 3BQ2A 5KFXA 4K97A 2M2TA 2XIDA 3JPRA 8ICHA 4OO1J 4DS5A 5AKIA 1KN5A 4O5KA 4M5DA 5J2EA 5ALUA 5J0QA 1YT3A 4EX6A 7ICSA 1DGJA 4YMNA 1LB2B 5CFUA 5CWRA 4B9TA 5CA7A 3BQ7A 3TAQA 4BUGA 1R89A 3VC8A 2K8AA 4U6PA 1A77A 4KX3A 4IS7A 3TACB 3RB6A 2PKEA 4I2AA 5ALYA 3M8SA 4WC5A 3BZKA 3EF2A 1D8LA 4O68A 2LM1A 1DXSA 5EE3A 4F4KA 2AGOA 2F1HA 2IOFK 1JALA 1ZQEA 3PW5A 4PHEA 2CN1A 5HRFA 4X4TA 4UB3A 2P66A 2ZIXA 3HW8A 5HRLA 3RBDA 5F2VO 1TFWA 5J2IA 5AKKA 4Y2YA 2XY6A 1BVSA 2ZIWA 3PO5A 5ALKA 2C2DA 2LBOA 2AHOB 2FDRA 3JPPA 4R65A 4USAA 4RQ5A 3Q8LA 4US9A 4EBJA 1SXEA 4XJEA 3N4MB 2DFLA 3THVA 2JV3A 4AT9B 4RQ1A 2PFNA 4PZNA 1UA0A 2MA1A 5AM1A 1SV0C 3NVYA 2WAQF 3I28A 1F5AA 4NJ8A 3M9NB 2EAPA 3K7DA 1NJZA 5KFLA 1ZQYA 3UQ0A 3ISDA 4PZOA 3OWGA 1RYRA 4EV6A 4US8A 2WAQC 5KAFU 5ALRA 2ZIVB 3GIKA 5DEDA 4ED6A 4Z6FA 4GFJA 1UT5A 4YXMA 2JEFA 5IIOA 4DQRA 4ECXA 4QZEA 5HR6A 3H8SA 2L5YA 3RJIA 1L5UA 4OAHA 4KLHA 1A6SA 4F5QA 4X5VA 2E8NA 5AKZA 3OGUA 1J97A 5EE0A 4FO6A 1KKXA 1YZ6A 2KOBA 3K75D 3PSFA 8ICPA 1RYUA 1ZD2P 2Y9UA 5CB1A 1SL1A 4DLEA 2ASLA 5EWFA 4DL4A 1KDHA 3QUTA 4EYHB 4ED0A 5D46A 4P4PA 1P7DA 5AM4A 2W9MA 4RU9A 1B4FA 1FFVA 3Q8SB 4OD0A 3KHGA 1ZQDA 3RJJA 1ZQMA 2NV3A 2NO4A 2HBKA 1MA7A 2ALZA 4IRKA 1FO4A 9ICXA 3NWIA 2ZH3A 5D62A 1RDFA 2DL0A 3GQCA 4RPYA 4EZ9A 3PW0A 5HRBA 9ICFA 4RWQA 5ALLA 3PX6A 2WFAA 1L3VA 5HR9A 2JMGA 2R8JA 4UD5A 4EENA 3JCFA 4LEZA 4X0AA 4X4RA 1RG6A 5DB8A 1BPBA 1SIJA 9ICAA 1MIWA 3G6YA 5AI6A 4TUSA 1HJPA 5EWEA 2MAXA 2G08A 4DSIA 2P6UA 2LM4A 1X6IA 3EUB2 3GDXA 3H0RB 5DECA 2RQ5A 4J9SA 1T8EA 2HN2A 3L5KA 4I2BA 4RNNA 1N62A 4R8UB 4ELTA 5KFHA 1ED1A 1Q8KA 3FYHA 2KICA 1CEZA 4B9LA 2BQ3A 2D6FC 4DOAA 4NXWA 4UAWA 2W04A 4RUAA 1MSWD 4QIWF 1SWWA 1Q3UA 4Z6DA 2ZG6A 3OV7A 1N63A 2EZXA 3WK6A 4DFJA 1S10A 2ESEA 4WC6A 5AKHA 5ALFA 3IG5A 4TUPA 4CF3A 1F0MA 4QIWC 1ZQCA 4QW8A 2EZZA 1TK5A 4RQ2A 1DGSA 4OJOA 4LZGA 5BOMA 3OVBA 2YMMA 1BGXT 4AT7A 4K9BA 2KV2A 4AT8B 4EEDA 1TAQA 1T4GA 3KFUF 2KD1A 4DSKA 3RH5A 4J9RA 2I9GA 2KTQA 4DFPA 5CEHA 4S3NA 3LYSA 5HRGA 4CF5A 2RP5A 4LZDA 3SV4A 2HW3A 3Q8RB 1NZPA 3TARA 2ISOA 5G5GA 5KFDA 1NK7A 5ALTA 2JEIA 3WFOA 4F2RA 4Q8FA 5KFJA 4O0IA 2CRXA 4P0PA 1EXNA 1ZQOA 1ZOLA 4LJXA 2ATLA 1BPZA 1ZQZA 3HKZF 4EYIB 5JRTA 5J0XA 3ISCA 4PJ0U 2HBMA 3V6JA 1JRPA 2E3TA 1UHUA 4C7ZA 5HNKA 5B3PA 5KL8B 4M6WB 4B6JA 2JH7A 4NM1A 1WG8A 1XO1A 3KZXA 3IV6A 2A19A 4NKUA 4QWCA 3HKZC 2CPRA 8ICZA 2A1AA 5AI4A 3HJ1A 3SMVA 2C2EA 3C23A 1MIVA 4I2FA 4KB6A 4YP3A 1KQQA 2A3VA 4B9VA 4F4WA 4DWIA 4G9BA 3PX4A 2F1IA 2MUTB 2XY7A 1TE2A 2ZH8A 4K4HA 3BS5A 5J2GA 1KSPA 2CXYA 3PSTA 4YVZA 1WYGA 2PMZF 3PV8A 4FBUA 1RZTA 2YN4A 3H4DA 5KG2A 3QUBA 1K5OA 5HHHA 3RJEA 4WC4A 1SZPA 1IIPA 2PMZC 4JB3A 1PK3A 3WK9A 4Y2QA 8ICCA 3F5AA 3CW2C 3RAXA 2ZJ8A 3PW2A 2OHFA 4I2DA 1VFGA 2DR9A 4BDPA 3BJYA 2GWSA 4YG2A 3IRUA 4ACOA 3PO4A 4NL9A 3AN1A 2ZH7A 9ICMA 7ICPA 1UETA 4UAZA 3QX7A 1CRXA 1RYSA 2ES6A 4QWEA 3KHLA 4NLCA 9ICNA 3DEEA 4FH3A 2JHDA 1ZD4A 4AT9A 3FM9A 5J0RA 5IIMA 1SWVA 2B51A 4WOYA 1NI3A 3ETRA 1Z4OA 1KNYA 3T5JA 4DL6A 3TANA 3RR8A 1T7PA 1SKRA 4IL6U 1COKA 3QZ7A 1AQ6A 2ZIVA 5J0TA 4DQPA 2E8MA 2F8KA 5DB6A 2QLTA 2BDUA 2H3ZA 2HBLA 4J9OA 1VDVA 1NK4A 1R8BA 2KN7A 3RRGA 2K8BB 4Y2XA 4XA5A 8ICWA 4GC6A 5BPCA 3PR4A 3WKEA 2HSZA 4QZCA 2XGPA 2M9NA 4ED2A 1YZ7A 4R64A 3PNCA 1JUDA 2I1QA 3QUQA 3WK4A 3NRZA 3SYZA 3UPQA 3RFAA 5KFTA 4O3OA 5KG3A 3H7IA 3HT3A 4JWMA 3SD7A 3NASA 3V7KA 1U47A 3K1ZA 7ICMA 4X0BA 3WFSC 5AKGA 4MFFA 3Q8PB 1C20A 4CF4A 5DBCA 2W3SA 1MC8A 4B9NA 3CK6A 4N7RA 3M6ZA 3ZD8A 2W9BB 1ZQLA 5DDMA 3QU7A 3F2CA 1LKYB 2RFFA 2Q66A 2JH1A 2RHFA 1ZQUA 5DLFA 1QSLA 3WK5A 3LVWA 3MGIA 2BPCA 3KKAC 4C4RA 4RPZA 4UASA 4Y2RA 2DVIA 4KLJA 4UQGA 5GTHU 3A0BU 4C4TA 2BKEA 4JWNA 3NVWA 3TADA 9ICWA 4U7CA 7ICVA 5TISU 1X9SA 2KJ5A 1S8OA 4QJFB 2EH9A 4WCWA 2E1FA 1N5WA 2NRWA 3RB0A 3TFRA 4NXUA 7ICLA 2DRBA 2NYVA 2F2AB 2F77X 4X4NA 1HIWA 3HIYA 4PGYA 1VJ7A 7ICFA 2XY5A 1DK2A 2LYHA 2HBJA 2V4QA 4RNMA 4M04A 4C8MA 5AM0A 2GA9D 3EPIA 2A1JB 5KG5A 1L3TA 4YD2A 8ICQA 8ICUA 1D9DA 4WBYA 1KLNA 4FHYA 1SV4A 4EX7A 3UM9A 3QEBZ 4KLFA 9ICPA 3CYMA 3QU9A 3V6KA 1S5LU 3H8JA 5IIJA 2HHVA 4F91B 2VIXA 3Q8QB 4NLGA 2KIWA 3BZCA 2VA8A 5DB7A 4DEZA 4GLXA 3WKAA 3AQEA 5BOLA 4ICAA 2P6RA 5AICA 2PBEA 3C5GA 1IG6A 2KVCA 3GV8B 4NLNA 1ZRNA 4Q43A 3GV5B 1IXRA 2ASDA 1COOA 3RBEA 4AT8A 3N97B 4FS1A 1Z3EB 4ECTA 2FLPA 4M9HA 3E0FA 5DQGA 3NKUA 3OSPA 5J2AA 5J0SA 2QB0B 4Y2VA 4KLSA 1ZJNA 5ALOA 2ZH9A 4RQ7A 4KITB 4IQUA 7ICGA 5KFCA 4P2HA 4FHXA 4O5CA 3H3AA 1A0PA 4UAVA 4QZAA 4RQ4A 1L7PA 1S0OA 3RRHA 4EEBA 8ICFA 2BCRA 1X9XA 2Y9TA 5JTGA 1N56A 4EBKA 2ZH4A 3QUCA 2W03A 2M2VA 4EBCA 4HAIA 2GH1A 4MFCA 5HREA 3K4GA 2B0CA 2HN1A 3KOOA 5KFIA 5AKYA 2YB1A 5J0OA 3EPGA 2IHNA 2LYAA 4M6WA 3ICXA 4KLIA 1BNPA 4NKTA 3BQ1A 5KG1A 2YY6A 3ZDCA 4O3NA 4WBZA 2QARB 2XVTA 3PX0A 2NRZA 4Z6CA 4F8RA 1D9FA 8ICIA 2BR0A 3AQMA 4WC1A 4I0UA 4XUSA 4MFAA 3QNMA 1Z1VA 2PXIA 4UB4A 3RJGA 2W3RA 2ISPA 3H4BA 4JV2A 3PW7A 5KFPA 1O08A 2XICA 4YXJA 2WHEA 2ZIUB 3WKDA 4Y2JA 4IQVA 4GXJA 2M0NA 3JZ0A 5FP0A 4NV0A 4B9SA 3H8WA 3IDWA 1SL2A 3I76A 7ICTA 2GLEA 4P0QA 5CP2A 2W8LA 3NTUA 4QZ8A 4KTQA 3G6XA 4I2EA 2ZXIA 4Y2TA 1ZXIA 3DV9A 1DK3A 2JXJA 3GIJA 3ZD9A 3PW4A 2I5HA 3KHHA 4F50A 4TURA 1XNSA 1SZHA 2PFQA 4NLBA 2FMQA 3L3FX 1IM4A 3FAHA 5AK4A 7ICKA 2HHTA 3E58A 4JK1A 1Y88A 4QZ9A 4E0DA 4E80A 2J6TA 3V72A 4DO9A 5ALIA 1JXLA 5HR7A 3KZIU 1CUKA 2H3VA 5DKWA 5HMLA 1L7MA 1UPHA 1SB3C 5ALNA 1TK0A 2K89A 4DFKA 1X6JA 5AM2A 3LK9A 2F1JA 2PI4A 3HRDD 3BQTA 5J8YA 8ICAA 4A8EA 1O03A 4C8LA 5ALQA 5AKJA 5J0UA 4EEKA 1N5XA 1QSSA 3U26A 3FDSA 4AP9A 4FS2A 1XSNA 3KTQA 1BPXA 3ETLA 4FZLA 2EAOA 3UMGA 4R66A 4FO1A 4KLQA 1L3UA 3C29A 4O3RA 3UPSA 5CFTA 2BQUA 1PVRA 1HUOA 2FPMA 4CNQA 2F76X 4KLDA 3WKBA 4M2YA 1ZQJA 5CHGA 2Y1JA 5KG7A 4DSJA 2ZXHA 2WF7A 4M9GA 4JLZA 1FA0A 5F3XB 3M8RA 2B6GA 1RQNA 3OHBA 2EDUA 3VCBA 4I28A 2W9BA 4PGXA 1XC9A 2K8CB 5ALVA 4O9MA 3AEVA 1ZQVA 4KX5A 4ATBB 5K4LA 2F44A 4UB6U 1S77D 2KKVA 1ZQQA 1NK9A 4FHWA 3RJFA 3EZ5A 4TUQA 4OJLA 2DKXA 1XWLA 4RQ8A 3QE9Y 4Q8EA 4I2HA 5DG9A 2FCLA 1XU4A 2OH2A 2E8OA 4O5EA 4Q44A 3J81j 2BQRA 5JU5A 2C22A 5HRDA 2NRXA 7ICUA 2RDIA 4QZGA 4PPXA 4I2JA 1V9PA 5D4BA 3AU2A 4PHAA 4I2IA 4FHVA 2AJQA 2A1JA 2RRDA 2K4PA 1SGGA 4UB5A 3C18A 1GPJA 1N61A 1Z4NA 5KFNA 1J2NA 3WK8A 9ICSA 1L8OA 3RH4A 2HOIA 5KFSA 1SKSA 2BDPA 1BPDA 3LWLA 4ECZA 3OVAA 3C1YA 1ZRMA 1X2IA 1PK1B 2G0AA 7ICRA 1K1SA 3WFRE 3H0MB 4J9KA 4ED8A 4KLMA 1R8CA 4DL5A 1SXDA 8ICYA 1LVHA 1WWUA 3MR6A 1ZQGA 1KW4A 9ICJA 3T5HA 3ER9B 5D63A 5DBAA 3TAPA 8ICSA 2YMPA 1V97A 5AKLA 1Z19A 2JGAA 4NM2A 4EP7A 2KK0A 4WC3A 2QB1A 2KP7A 2IBKA 2EQYA 7ICJA 5KFKA 3SQIA 4YR0A 2QB0A 1TFYA 4DQQA 4Y2UA 4IRCA 5KTQA 1NZBA 3AQNA 3N28A 4P4OA 4YFKA 2ZJAA 4IQWA 1FEZA 4ZOHC 1S0VA 2VANA 3C66A 4P4MA 3B0XA 1ZQIA 2JZBB 1AROP 1NKCA 1WCLA 2C2RA 4IQTA 8ICMA 5KNIA 3SEIA 4QZHA 1T94A 4Y2PA 2W7PA 3SV3A 4NXXA 3QYPA 1U45A 2DUYA 2QARA 3RH6A 1MIYA 3RJHA 1RXWA 4ELVA 2OYYA 1ZQ1C 1ZQKA 2EANA 1LV5A 2AQ0A 1KFTA 5F9LA 1F5SA 2BBHA 5EE1A 4F4XA 1L6NA 2OXOA 2FJ6A 5KFZA 2DRAA 1V85A 1X42A 3F5EA 4QWDA 4C8NA 4EGWA 4K9AA 2RLTA 1ZQBA 5KFOA 3H8MA 4F71A 3MCRA 3TQ1A 1QQ5A 2DBYA 1J2MA 1PUZA 2KMDA 4KN7A 4UB1A 3PMNA 3ZDDA 2WF9A 2LI6A 5DLGA 3LWMA 5ALMA 1ZQWA 4YMOA 1T3NA 4JV1A 3V6HA 1D8YA 4OJ6A 5KG0A 1JI7A 1JN3A 1XO0A 4NXTA 5CFSA 1H38A 4F72A 2Y0SF 5KFMA 4C7YA 4QWAA 1XSLA 1IV8A 2R8IA 3RB4A 5DGBA 8ICOA 1RM6C 3RR7A 4YQWA 2KSOB 3OHAA 3NVOA 5HP4A 2B21A 3HP6A 1YLQA 4FHPA 3C2MA 2Y0SC 4DF8A 3CP8A 3B0YA 1Q3VA 2FLLA 4XQ8A 3NS1A 1L8LA 1UQVA 4RQ6A 4X4PA 1JIHA 4RQ3A 4DQIA 2C28A 2YMQA 5CRXA 4YN4A 1U9LA 3F2DA 4LEYA 3K1RB 3T3FA 2HCFA 1TAUA 2WTFA 2W43A 4C8KA 1Z1BA 5KT7A 1MQ2A 5KT4A 1Q79A 1XSPA 3PSPA 2OEHA 3PHZA 9ICBA 3OJSA 2KZMA 2W7OA 4C0ZA 3N7SC 2EAMA 4K4IA 3JPSA 8ICNA 2W9CB 2KZZA 3ALRA 2KVSA 4OAGA 1SKWA 2DPJA 1JAJA 4YD1A 4K8VA 3ZI4A 2KFNA 3GIMA 4CCHA 5CJ7A 3MBYA 1SL0A 1VJ5A 4O3PA 4C80A 1ZQTA 1QCKA 3HWTA 3BQ0A 3IP4B 4DSFA 4X4UA 1RQLA 5KL1B 3UQ2A 5A0LA 2H3IA 2PFOA 2R8GA 3AUOA 4RWOA 4NLKA 3KBBA 3R9KA 4IR9A 5HRHA 2G09A 3SAFA 2RDJA 1JROA 2QKQA 2D3DA 4EZ6A 1OU5A 4M9NA 1TAMA 3WKCA 1U4BA 1A76A 4NL9C 5KT5A 1NKBA 2YTUA 5KG4A 3HJ4A 1KFSA 2FE9A 5DB9A 5CHEA 1NOMA 3F53A 5AK5A 4R8UA 3MABA 4OJPA 3PMLA 2FPLA 4UB8U 5KFQA 4I27A 1WWVA 3IM1A 2BCVA 3HJEA 2KFZA 4ED7A 4BXOB 4ATBA 5ALWA 4M47A 4WC0A 4UATA 3T5LA 9ICRA 4PL2A 4OAIZ 2M2UA 4CDGA 2ZH1A 4KMOB 4DL2A 2E8PA 4O67A 2IUBA 4PHPA 9ICHA 4DLGA 3WFPA 4M0AA 3RF9A 2YX8A 3N7RC 1SV0A 1X66A 3QU2A 1NKEA 4E8FA 4ED3A 1MQ3A 3FC4A 1ZETA 4NLZA 2KJ8A 3LDAA 4DSLA 2EWRA 1B0XA 4FZNA 5F9NA 2BPGA 3M9MB 5AKEA 2FPKA 3L9DA 3C2LA 5IIIA 4QZFA 5KFEA 4F4YA 2H3QA 5AHXA 2BCUA 3MR3A 4MEYA 5DBBA 3C21A 3Q8MA 3C28A 5ALGA 1S97A 2J6SA 2GO7A 5D61A 3OUYB 2LHTA 2IOFA 2F8LA 1WUDA 3H37A 1RPLA 4FFDA 9ICEA 2G06A 1L7OA 5AM5A 2MU2A 3CNHA 9ICLA 1S0NA 5KAIU 2AU0A 1JXEA 4RNOA 2E1EA 2BCQA 3OPXA 3RJKA 5J29A 4EEYA 4RWNA 2VJ4A 8ICTA 3QZ8A 7ICNA 4X4SA 3GFKB 3KHRA 3UMBA 2FLNA 3M1YA 3AQLA 5J0WA 1KTQA 4UBCA 1NK6A 8ICKA 7ICQA 3TI0A 2WB1F 3UXOA 2FMSA 4IR1A 2ZH6A 5J2FA 1NK0A 2WF8A 4RWPA 2Z7JA 3H40A 7ICHA 2AH5A 3JPOA 3GILA 1L7NA 3BS5B 2WB1C 1M6YA 2DF4B 4ECVA 2K4HA 2KZ3A 3TADC 5KFWA 2ODGA 2MUTA 2M2WA 4IC9A 4DFMA 2AGQA 9ICKA 2HVHA 2MRLA 4O3MA 4NXZA 2JZBA 1OW5A 2KNJA 2XO7A 2HHXA 5B5EU 4RQMA 2VKQA 3AM9A 4RPXA 4DOCA 5J2HA 1D8BA 5ALJA 4GC7A 2K60A 4G3IA 2IMWP 5ALSA 8ICRA 5KFBA 1UT8A 4XQ7A 3ED5A 1ZJMA 5B66U 1DOQA 4KM5A 2W11A 4KLGA 4DL7A 1TV9A 2DPIA 2UVVA 2ZHAA 3ZDBA 3BS7A 1Q78A 1CI4A 3T79A 1UEUA 2V4RA 2W8KA 1QLNA 2B56A 2BZFA 2FMPA 4KLUA 2KIVA 3RAQA 1BPYA 2HHUA 1ECWA 2DKZA 2B4VA 5HRKA 4E7XA 3I1YA 2WF6A 1X9MA 1QQ6A 4IRDA 2PFPA 3NRWA 4GXIA 8ICLA 3BDPA 1ZYQA 1UCVA 3MR5A 3HX0A 2NO5A 2KE7A 2PI5A 4GIBA 4QW9A 5KFGA 1TK8A 7ICEA 2HHQA 2ZTEA 4YR2A 4F5OA 1TVAA 9ICVA 2KSOA 4K4GA 1FIQA 5AI0A 2KHQA 3TKAA 7ICIA 3O0FA 5AI8A 2FI1A 4OAFA 3V7JA 3ER8C 3MC1A 5AIBA 1PVPA 2KEYA 1S76D 2ZJ5A 3C2KA 2HDOA 4O69A 4B9MA 3NVVA 2ZHBA 2G07A 2BHNA 3B9JA 3WFQE 1K1QA 4Z6EA 2HMXA 2ZTDA 4PGQA 2XCPA 4IG8A 4J9MA 4AYBF 2K4EA 2OCEA 2H3FA 4K96A 5DQHA 3MGHA 4F92B 4RT2A 5J2CA 3M9OB 9ICQA 2W9CA 5T14A 2BCSA 5DG8A 4QZIA 2BBJA 3MR2A 4RUCA 3D2QA 4AYBC 1BPEA 2D8CA 4WQLA 4J9PA 3GZFA 3AMZA 1NJWA 3H0LB 1BNOA 1KL9A 9ICOA 4MF8A 1X40A 4EELA 1LKYA 3AU6A 2ZTCA 3KD3A 4DF4A 4BWMA 4BJQA 4F2SA 1OXJA 2G5HB 2UVUA 4WJ3B 9ICUA 4DQSA 8ICVA 4O6AA 4ELUA 5IINA 3ZDAA 1B43A 3L4PA 3OVSA 2H5XA 4FBTA 3MDAA 4NWIA 4F3OA 3G6VA 4CGZA 2NRTA 4FZMA 5AIAA 2R8HA 4X4VA 2HOQA 3SI8A 1U49A 3H39A 2JEGA 3AQKA 3ORYA 1MN8A 4J03A 5C0YA 3F2BA 1KFDA 5ALXA 3LQCB 2KHVA 3PY8A 2HHPA 3MGVA 4ZH4A 2HVIA 4OCZA 3SAGA 1OUQA 2DR8A 2LPEA 2IA6A 4BXOA 1Z00B 4HYKA 3HPOA 3NUQA 4WQKA 5G5HA 2XI9A 3CRXA 5AK3A 3WU2U 2ID1A 1VLBA 3QU5A 4JV0A 4ECQA 1N60A 2O6KA 2MSNA 4KLOA 1V4AA 1WOTA 4LT6A 4CRXA 3OSNA 1QSYA 1KRPA 3SR6A 2P35A 5J8YC 1UA1A 4DOBA 4KLTA 4Y2SA 4UD4A 4DL3A 7ICOA 2E5SA 1XS9D 3QEAZ 4TQSA 4I29A 4BWJA 4NY8A 1NO5A 5H2FU 4ECRA 4WH5A 4WC2A 2Q4TA 1NNLA 5L1LA 2YB4A 2OM6A 5L1IA 9ICIA 5KG6A 1ZQPA 5J2KA 2NRKA 2HHSA 3OUYA 4YCXA 1ZD3A 4QZBA 4DS4A 4YR3A 4KLLA 3JPTA 5HHIA 2ZUDA 4X4OA 2W9AA 2W54A 4TQRA 3M7DA 2GOLA 3HILA 5DGAA 3E2EA 1X9WA 3SZ2A 2DR5A 5IILA 2AGPA 2F3NA 5KFUA 4PHDA 2XGQA 2AXTU 3IHQB 1F44A 3S6JA 3IN5A 1UEVA 2ZIXB 3GIIA 4MF2A 1T3QA 4JMUA 5ALEA 4EBEA 4DCCA 4O3SA 3OTQA 3RB3A 5ALHA 4DFDA 1R8AA 4UW9A 1FFUA 2ZIWB 5KT2A 5JUMA 2UVRA 8ICJA 3C5FA 3UXNA 4F5RA 2LMRA 1QTMA 1NJYA 9ICCA 2BPFA 4KLEA 1URJA 2WF5A 3D2NA 3Q8KA 5CR0A 3ONNA 5ALZA 1NK5A 3KKAA 1JQRA 2BGWA 4UAUA 4LEWA 4P0QB 2V9WA 3LVVA 4ECYA 5J2JA 5TZVA 2G5IB 4RQNA 1WCNA 2KKPA 3M6KA 2ZIUA 1TFRA 2GAFD 3D6JA 4J9QA 3H38A 1S0MA 4K99A 5AKXA 5ALDA 3WK7A 3NVZA 1HUZA 1N48A 4KMUA 2LYBA 4R63A 4I2CA 2OWOA 3GV7B 3IG8A 4C8OA 2HOFA 2UVWA 5HMMA 5J0PA 5KFYA 2DGZA 2W55A 3GU3A 2YQEA 1QQ7A 2ZUBA 3JPQA 4QZDA 1U48A 3AL0B 4PL1A 5GTIU 4QNLA 4LEVA 3MFHA 3V7LA 5HC9A 4M9LA 2YMLA 1L3SA 1PZNA 2JEJA 4X4QA 1JX4A 4ECUA 2AQ4A 5EOZA 1NK8A 4C4SA 3JPNA 2HI0A 4KN4A 5DDYA 8ICXA 2XCAA 1TKDA 3NYBA 3NGDA 5L1MA 4CE6A 1KBUA 1ZD5A
chains in the Genus database with same CATH topology
3H37A 1RPLA 1PX5A 4C8LA 9ICEA 5C5JA 1EXNA 1ZQOA 4WC7A 4YMMA 2HHWA 3PVXA 9ICLA 5J0YA 1S0NA 1NJXA 2AU0A 4J9LA 2ATLA 1JXEA 4RNOA 1BPZA 3UXPA 1ZQZA 2BCQA 3RJKA 5J0UA 5J29A 4EYIB 4EEYA 1KEJA 5J0XA 3ISCA 4RWNA 3V6JA 1QSSA 2VA3A 4UBBA 3QZ8A 8ICTA 7ICNA 4FH5A 4X4SA 5HNKA 4M6WB 3FDSA 1ZQXA 3GFKB 4FS2A 3T5KA 1XSNA 4QWBA 1S9FA 4NM1A 1XO1A 3KHRA 3KTQA 4RZRA 3ETLA 1BPXA 2FLNA 4NKUA 3AQLA 4QWCA 8ICZA 1JMSA 5J0WA 4R66A 1KTQA 4UBCA 4XRHA 1NK6A 4KLQA 8ICKA 2Q0ZX 7ICQA 5KT6A 3HJ1A 3TI0A 1L3UA 2C2EA 4JUZA 3UXOA 4O3RA 2FMSA 4IR1A 3C23A 3JYYA 1MIVA 3UPSA 2ZH6A 4I2FA 5J2FA 3EW9A 2BQUA 4YP3A 1NK0A 2FPMA 1HUOA 9ICGA 4KLDA 4B9VA 4ECSA 4RWPA 4F4WA 4DWIA 4M2YA 1ZQJA 5CHGA 3C1ZA 3H40A 4DSEA 7ICHA 3PX4A 2Y1JA 5KG7A 3JPOA 3ZDEA 3GILA 2F1IA 2MUTB 4DSJA 2XY7A 5J2DA 5IIKA 4RQ0A 4M9GA 5DQIA 4UAYA 4ECVA 1FA0A 2KZ3A 3M8RA 1ZQNA 8ICEA 2ZH8A 5KFWA 3OHBA 4K4HA 8ICGA 5J2GA 1KSPA 2MUTA 4YVZA 5L1KA 2M2WA 4I28A 4DFMA 4LVSA 2AGQA 3PV8A 2W9BA 9ICKA 4PGXA 3TFSA 3OJUA 4ED1A 1RZTA 1ZQSA 2R8KA 4FBUA 2HVHA 3H4DA 4NXZA 2JZBA 2ASJA 1XC9A 2XO7A 5KG2A 4O9MA 1ZQVA 2HHXA 5HHHA 3MDCA 4J9NA 3RJEA 8ICBA 1ZQHA 5J2BA 4GXKA 5KT3A 4RPXA 4WC4A 4DOCA 5HRIA 5J2HA 1SZPA 4M9JA 4ATBB 4GC7A 4G3IA 2IMWP 4Q45A 8ICCA 8ICRA 5KFBA 3RAXA 4PH5A 2ZJ8A 3PW2A 1S77D 3MFIA 1UT8A 4XQ7A 1ZQQA 4I2DA 1ZJMA 1NK9A 4FHWA 1VFGA 2DR9A 4BDPA 3RJFA 3EZ5A 1DOQA 3BJYA 5KFFA 4YG2A 4TUQA 2GWSA 3PO4A 4F5NA 4DL7A 4KLGA 1TV9A 2DPIA 1XWLA 4RQ8A 2UVVA 2ZH5A 3QE9Y 9ICMA 2ZH7A 2ZHAA 3ZDBA 7ICPA 2ZH2A 2ZH9A 4Q8EA 3EWAA 5EWGA 1ZQAA 2VA2A 5DG9A 4UB2A 4I2HA 1Q78A 4UAZA 1UETA 4AT7B 4F93B 1XU4A 1UEUA 5DG7A 5KFVA 1RYSA 4O5EA 4QWEA 4Q44A 2V4RA 3KHLA 2BQRA 2W8KA 1QLNA 5D49A 9ICNA 5L1JA 2FMPA 2C22A 4KLUA 3RAQA 1BPYA 5HRDA 3ISBA 2O5AA 2NRXA 7ICUA 2HHUA 2RDIA 4QZGA 4FH3A 4B9UA 4PPXA 4I2JA 1V9PA 5D4BA 3AU2A 4PHAA 5HRKA 4AT9A 5L9XA 4I2IA 4E7XA 4FHVA 4BGDA 5J0RA 4EBDA 2O1PA 1X9MA 2A1JA 4ECWA 4IRDA 2AJQA 5IIMA 4F4ZA 2NRVA 5KFRA 4UB5A 4MEXA 2PFPA 2J6UA 4GXIA 4F5PA 3C18A 8ICLA 3BDPA 2XC9A 5KFNA 3RTVA 1C7YA 4RT3A 1KNYA 1ZQFA 1ZYQA 3T5JA 4DL6A 3TANA 3MR5A 9ICSA 3RH4A 2BE3A 3RR8A 3HX0A 1T7PA 2PI5A 5KFSA 4I2GA 1SKRA 1SKSA 2BDPA 1BPDA 1Z00A 2DR7A 3LWLA 4ECZA 4QW9A 5KFGA 2IHMA 3OVAA 1TK8A 3C1YA 7ICEA 4O3QA 3QZ7A 1X2IA 5KFAA 9ICTA 1B22A 2HHQA 2Y1IA 2ZTEA 4YR2A 4F5OA 1TVAA 7ICRA 1K1SA 9ICVA 3WFRE 5J0TA 4DQPA 1ZQRA 3PR5B 2ZUCA 4J9KA 3EYZA 5DB6A 4ED8A 4DL5A 4K4GA 4KLMA 1R8CA 4J9OA 8ICYA 1NK4A 7ICIA 2KN7A 3RRGA 1R8BA 1RXVA 4XA5A 3MR6A 1ZQGA 8ICWA 4GC6A 3T5HA 9ICJA 5BPCA 5DBAA 3PR4A 3BQ2A 5KFXA 3V7JA 4QZCA 2XGPA 3TAPA 8ICSA 2M2TA 2M9NA 4ED2A 4R64A 3PNCA 3JPRA 8ICHA 4NM2A 2I1QA 4DS5A 3SYZA 3UPQA 4EP7A 4O5KA 4M5DA 4WC3A 2KP7A 5KFTA 5J2EA 2IBKA 1S76D 2ZJ5A 3C2KA 7ICJA 5J0QA 4O3OA 5KG3A 5KFKA 4B9MA 7ICSA 3H7IA 4YR0A 2ZHBA 4YMNA 2BHNA 3HT3A 3WFQE 1TFYA 1LB2B 1K1QA 4JWMA 3V7KA 4Z6EA 5CWRA 2ZTDA 4PGQA 4DQQA 1U47A 4IRCA 7ICMA 4X0BA 5KTQA 2XCPA 4B9TA 4MFFA 3WFSC 5CA7A 4IG8A 3Q8PB 4J9MA 3TAQA 1R89A 3AQNA 5DBCA 4P4OA 1MC8A 4YFKA 5DQHA 4F92B 3MGHA 4B9NA 2ZJAA 4IQWA 4RT2A 5J2CA 1A77A 3M9OB 9ICQA 2W9CA 1S0VA 3RB6A 3ZD8A 5DG8A 2BCSA 4I2AA 2VANA 3C66A 2W9BB 4QZIA 4P4MA 3M8SA 1ZQLA 5DDMA 4WC5A 3MR2A 4RUCA 1D8LA 3B0XA 1BPEA 2JZBB 1ZQIA 2RFFA 1AROP 4J9PA 2Q66A 1NKCA 4F4KA 1WCLA 1NJWA 2C2RA 1ZQUA 4IQTA 5DLFA 8ICMA 2AGOA 9ICOA 1BNOA 4MF8A 1QSLA 1NZPA 2F1HA 4QZHA 3AU6A 3MGIA 2BPCA 1ZQEA 3PW5A 2ZTCA 4PHEA 4RPZA 2DVIA 3SV3A 1U45A 4DF4A 5HRFA 4X4TA 4KLJA 3RH6A 4BWMA 4UQGA 3RJHA 4UB3A 1RXWA 4ELVA 2P66A 1MIYA 3HW8A 4F2SA 2BKEA 4JWNA 5HRLA 3RBDA 2UVUA 9ICUA 1ZQKA 4DQSA 5F2VO 8ICVA 9ICWA 1TFWA 7ICVA 1LV5A 5J2IA 4ELUA 2AQ0A 5IINA 3ZDAA 1KFTA 1B43A 2XY6A 1BVSA 5F9LA 3PO5A 2C2DA 3OVSA 2H5XA 4F4XA 4FBTA 3MDAA 4WCWA 2NRWA 5KFZA 3JPPA 3RB0A 2DRAA 3TFRA 4R65A 7ICLA 4QWDA 4F3OA 3G6VA 4C8NA 2DRBA 2NRTA 4RQ5A 3Q8LA 1ZQBA 2R8HA 4X4NA 4EBJA 5KFOA 4X4VA 3HIYA 4PGYA 3N4MB 2DFLA 7ICFA 1VJ7A 3THVA 3TQ1A 2XY5A 1DK2A 3SI8A 2LYHA 2V4QA 1U49A 4RNMA 4M04A 4RQ1A 4C8MA 2PFNA 3H39A 4AT9B 2JEGA 1UA0A 3AQKA 3ORYA 3EPIA 2A1JB 5KG5A 1L3TA 4YD2A 8ICQA 8ICUA 1D9DA 4KN7A 4UB1A 1KLNA 4FHYA 4WBYA 3PMNA 1KFDA 3LQCB 1F5AA 3QEBZ 3ZDDA 3PY8A 4KLFA 3M9NB 9ICPA 3V6KA 2HHPA 5DLGA 3LWMA 1NJZA 3H8JA 5IIJA 5KFLA 1ZQWA 4YMOA 2HHVA 4ZH4A 4F91B 1T3NA 2HVIA 3Q8QB 2DR8A 4JV1A 4NLGA 1ZQYA 3V6HA 3UQ0A 1D8YA 2IA6A 5KG0A 1JN3A 1Z00B 3ISDA 4HYKA 4BXOA 3HPOA 2VA8A 1RYRA 1H38A 5DB7A 4DEZA 5KFMA 4GLXA 2ID1A 4JV0A 4QWAA 1XSLA 5DEDA 3GIKA 4ECQA 2R8IA 3RB4A 5DGBA 5BOLA 4ED6A 8ICOA 4Z6FA 4KLOA 3RR7A 1UT5A 1V4AA 4YQWA 1WOTA 4YXMA 4LT6A 3OHAA 2P6RA 2JEFA 5IIOA 4DQRA 4ECXA 4QZEA 3H8SA 5HP4A 2PBEA 2B21A 3OSNA 3HP6A 3C5GA 3RJIA 3C2MA 1L5UA 1QSYA 1YLQA 4FHPA 1KRPA 3GV8B 4NLNA 4KLHA 4F5QA 4DF8A 4Q43A 1UA1A 3B0YA 1IXRA 3GV5B 2ASDA 4DOBA 4KLTA 1COOA 3RBEA 2FLLA 4XQ8A 4DL3A 3N97B 4UD4A 7ICOA 4X5VA 4AT8A 1XS9D 4FS1A 3OGUA 3QEAZ 1Z3EB 4RQ6A 4TQSA 4ECTA 4X4PA 4FO6A 4BWJA 4I29A 1JIHA 4RQ3A 2FLPA 4NY8A 4M9HA 1NO5A 4DQIA 5DQGA 4ECRA 2C28A 4WC2A 8ICPA 3K75D 4YN4A 1U9LA 3OSPA 3T3FA 5L1LA 5CB1A 5L1IA 5J2AA 9ICIA 5KG6A 1SL1A 5J0SA 4DLEA 2ASLA 5EWFA 4KLSA 1TAUA 2WTFA 4DL4A 1ZJNA 4RQ7A 1KDHA 4KITB 5KT7A 4IQUA 1MQ2A 4EYHB 5KFCA 5KT4A 5J2KA 1ZQPA 7ICGA 4ED0A 5D46A 4P4PA 1Q79A 4P2HA 2NRKA 4FHXA 1XSPA 4O5CA 2HHSA 9ICBA 2W9MA 3H3AA 3OUYA 3OJSA 4RU9A 2KZMA 3Q8SB 3KHGA 1ZQDA 3RJJA 4YCXA 4QZAA 4RQ4A 4QZBA 4DS4A 1S0OA 3RRHA 1ZQMA 4K4IA 4YR3A 3JPSA 3JPTA 2BCRA 4KLLA 5HHIA 8ICFA 2W9CB 2KZZA 8ICNA 1N56A 2ZUDA 2ALZA 4IRKA 4EBKA 4X4OA 2ZH4A 1SKWA 2W9AA 4TQRA 2DPJA 2M2VA 1JAJA 9ICXA 4EBCA 5HREA 4YD1A 4MFCA 3K4GA 2ZH3A 2KFNA 3GIMA 5DGAA 4CCHA 5CJ7A 3MBYA 3E2EA 3GQCA 5KFIA 1X9WA 4RPYA 1SL0A 4EZ9A 5J0OA 3EPGA 4O3PA 3SZ2A 3PW0A 1ZQTA 2IHNA 4C8KA 5HRBA 9ICFA 5IILA 4RWQA 2DR5A 4M6WA 2AGPA 4KLIA 1BNPA 4NKTA 3BQ1A 5KFUA 3PX6A 3HWTA 5KG1A 1L3VA 3BQ0A 4DSFA 5HR9A 4PHDA 4X4UA 3ZDCA 4O3NA 2XGQA 3IHQB 2R8JA 4UD5A 4WBZA 3UQ2A 4X0AA 3PX0A 1UEVA 2PFOA 2R8GA 3GIIA 4MF2A 2NRZA 4Z6CA 4F8RA 3AUOA 4EBEA 1D9FA 5DB8A 4X4RA 8ICIA 4NLKA 4RWOA 1BPBA 2BR0A 9ICAA 4IR9A 4O3SA 5HRHA 1MIWA 3AQMA 3RB3A 4WC1A 3G6YA 2RDJA 1R8AA 4TUSA 4XUSA 4MFAA 1HJPA 5KT2A 5JUMA 5EWEA 2UVRA 2MAXA 3C5FA 8ICJA 2PXIA 4UB4A 3RJGA 4DSIA 3UXNA 2ISPA 2P6UA 3H4BA 4JV2A 4F5RA 4EZ6A 1QTMA 1OU5A 1NJYA 9ICCA 3GDXA 3PW7A 5DECA 5KFPA 4M9NA 2BPFA 4J9SA 4KLEA 1T8EA 4I2BA 3Q8KA 5CR0A 1U4BA 4RNNA 4R8UB 1NK5A 4ELTA 5KFHA 1A76A 5KT5A 4YXJA 1NKBA 1JQRA 5KG4A 3HJ4A 3FYHA 1KFSA 2BGWA 4IQVA 4GXJA 5DB9A 1CEZA 2V9WA 1NOMA 4B9LA 4ECYA 3JZ0A 5J2JA 5TZVA 2BQ3A 4B9SA 3H8WA 4R8UA 1WCNA 3MABA 4DOAA 1SL2A 3PMLA 2FPLA 7ICTA 4UAWA 5KFQA 1TFRA 4I27A 4RUAA 3IM1A 4J9QA 5CP2A 2BCVA 4ED7A 2KFZA 1S0MA 2W8LA 1MSWD 3H38A 4Z6DA 4BXOB 4ATBA 3NTUA 4QZ8A 4KTQA 3G6XA 4I2EA 4M47A 4WC0A 1HUZA 3T5LA 1N48A 3OV7A 1DK3A 4KMUA 4R63A 9ICRA 4I2CA 4DFJA 3GIJA 2OWOA 3GV7B 1S10A 2M2UA 4WC6A 2ZH1A 4DL2A 3ZD9A 3PW4A 4C8OA 4TUPA 3KHHA 4F50A 4TURA 2UVWA 1ZQCA 4QW8A 1TK5A 4PHPA 4RQ2A 5HMMA 4DLGA 1DGSA 2PFQA 9ICHA 4M0AA 3WFPA 2FMQA 4LZGA 5J0PA 5KFYA 1IM4A 5BOMA 3OVBA 2ZUBA 1NKEA 3JPQA 7ICKA 4E8FA 4ED3A 2HHTA 4QZDA 1BGXT 4AT7A 4JK1A 1U48A 1Y88A 1MQ3A 4QZ9A 4AT8B 4E0DA 1ZETA 2J6TA 3V72A 4E80A 1TAQA 4DO9A 4NLZA 1T4GA 3LDAA 1JXLA 4DSLA 5F9NA 2BPGA 4DSKA 3RH5A 3M9MB 3MFHA 1CUKA 4J9RA 2FPKA 2I9GA 3L9DA 3V7LA 2KTQA 4DFPA 5HC9A 4M9LA 3C2LA 5DKWA 5IIIA 4S3NA 4QZFA 5HMLA 5HRGA 1L3SA 1PZNA 2JEJA 4X4QA 5KFEA 4F4YA 1JX4A 4LZDA 4ECUA 2AQ4A 1TK0A 3SV4A 2BCUA 3MR3A 5EOZA 4DFKA 4MEYA 5DBBA 3Q8RB 3C21A 3Q8MA 1NK8A 2HW3A 3JPNA 3LK9A 3TARA 2F1JA 4KN4A 5DDYA 1S97A 2ISOA 2J6SA 5KFDA 2PI4A 1NK7A 3OUYB 2JEIA 8ICXA 2XCAA 3WFOA 3BQTA 1TKDA 4F2RA 3NGDA 3NYBA 4Q8FA 8ICAA 5KFJA 4O0IA 1X9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H37 A;  1RPL A;  1PX5 A;  4C8L A;  9ICE A;  5C5J A;  1EXN A;  1ZQO A;  4WC7 A;  4YMM A;  2HHW A;  3PVX A;  9ICL A;  5J0Y A;  1S0N A;  1NJX A;  2AU0 A;  4J9L A;  2ATL A;  1JXE A;  4RNO A;  1BPZ A;  3UXP A;  1ZQZ A;  2BCQ A;  3RJK A;  5J0U A;  5J29 A;  4EYI B;  4EEY A;  1KEJ A;  5J0X A;  3ISC A;  4RWN A;  3V6J A;  1QSS A;  2VA3 A;  4UBB A;  3QZ8 A;  8ICT A;  7ICN A;  4FH5 A;  4X4S A;  5HNK A;  4M6W B;  3FDS A;  1ZQX A;  3GFK B;  4FS2 A;  3T5K A;  1XSN A;  4QWB A;  1S9F A;  4NM1 A;  1XO1 A;  3KHR A;  3KTQ A;  4RZR A;  3ETL A;  1BPX A;  2FLN A;  4NKU A;  3AQL A;  4QWC A;  8ICZ A;  1JMS A;  5J0W A;  4R66 A;  1KTQ A;  4UBC A;  4XRH A;  1NK6 A;  4KLQ A;  8ICK A;  2Q0Z X;  7ICQ A;  5KT6 A;  3HJ1 A;  3TI0 A;  1L3U A;  2C2E A;  4JUZ A;  3UXO A;  4O3R A;  2FMS A;  4IR1 A;  3C23 A;  3JYY A;  1MIV A;  3UPS A;  2ZH6 A;  4I2F A;  5J2F A;  3EW9 A;  2BQU A;  4YP3 A;  1NK0 A;  2FPM A;  1HUO A;  9ICG A;  4KLD A;  4B9V A;  4ECS A;  4RWP A;  4F4W A;  4DWI A;  4M2Y A;  1ZQJ A;  5CHG A;  3C1Z A;  3H40 A;  4DSE A;  7ICH A;  3PX4 A;  2Y1J A;  5KG7 A;  3JPO A;  3ZDE A;  3GIL A;  2F1I A;  2MUT B;  4DSJ A;  2XY7 A;  5J2D A;  5IIK A;  4RQ0 A;  4M9G A;  5DQI A;  4UAY A;  4ECV A;  1FA0 A;  2KZ3 A;  3M8R A;  1ZQN A;  8ICE A;  2ZH8 A;  5KFW A;  3OHB A;  4K4H A;  8ICG A;  5J2G A;  1KSP A;  2MUT A;  4YVZ A;  5L1K A;  2M2W A;  4I28 A;  4DFM A;  4LVS A;  2AGQ A;  3PV8 A;  2W9B A;  9ICK A;  4PGX A;  3TFS A;  3OJU A;  4ED1 A;  1RZT A;  1ZQS A;  2R8K A;  4FBU A;  2HVH A;  3H4D A;  4NXZ A;  2JZB A;  2ASJ A;  1XC9 A;  2XO7 A;  5KG2 A;  4O9M A;  1ZQV A;  2HHX A;  5HHH A;  3MDC A;  4J9N A;  3RJE A;  8ICB A;  1ZQH A;  5J2B A;  4GXK A;  5KT3 A;  4RPX A;  4WC4 A;  4DOC A;  5HRI A;  5J2H A;  1SZP A;  4M9J A;  4ATB B;  4GC7 A;  4G3I A;  2IMW P;  4Q45 A;  8ICC A;  8ICR A;  5KFB A;  3RAX A;  4PH5 A;  2ZJ8 A;  3PW2 A;  1S77 D;  3MFI A;  1UT8 A;  4XQ7 A;  1ZQQ A;  4I2D A;  1ZJM A;  1NK9 A;  4FHW A;  1VFG A;  2DR9 A;  4BDP A;  3RJF A;  3EZ5 A;  1DOQ A;  3BJY A;  5KFF A;  4YG2 A;  4TUQ A;  2GWS A;  3PO4 A;  4F5N A;  4DL7 A;  4KLG A;  1TV9 A;  2DPI A;  1XWL A;  4RQ8 A;  2UVV A;  2ZH5 A;  3QE9 Y;  9ICM A;  2ZH7 A;  2ZHA A;  3ZDB A;  7ICP A;  2ZH2 A;  2ZH9 A;  4Q8E A;  3EWA A;  5EWG A;  1ZQA A;  2VA2 A;  5DG9 A;  4UB2 A;  4I2H A;  1Q78 A;  4UAZ A;  1UET A;  4AT7 B;  4F93 B;  1XU4 A;  1UEU A;  5DG7 A;  5KFV A;  1RYS A;  4O5E A;  4QWE A;  4Q44 A;  2V4R A;  3KHL A;  2BQR A;  2W8K A;  1QLN A;  5D49 A;  9ICN A;  5L1J A;  2FMP A;  2C22 A;  4KLU A;  3RAQ A;  1BPY A;  5HRD A;  3ISB A;  2O5A A;  2NRX A;  7ICU A;  2HHU A;  2RDI A;  4QZG A;  4FH3 A;  4B9U A;  4PPX A;  4I2J A;  1V9P A;  5D4B A;  3AU2 A;  4PHA A;  5HRK A;  4AT9 A;  5L9X A;  4I2I A;  4E7X A;  4FHV A;  4BGD A;  5J0R A;  4EBD A;  2O1P A;  1X9M A;  2A1J A;  4ECW A;  4IRD A;  2AJQ A;  5IIM A;  4F4Z A;  2NRV A;  5KFR A;  4UB5 A;  4MEX A;  2PFP A;  2J6U A;  4GXI A;  4F5P A;  3C18 A;  8ICL A;  3BDP A;  2XC9 A;  5KFN A;  3RTV A;  1C7Y A;  4RT3 A;  1KNY A;  1ZQF A;  1ZYQ A;  3T5J A;  4DL6 A;  3TAN A;  3MR5 A;  9ICS A;  3RH4 A;  2BE3 A;  3RR8 A;  3HX0 A;  1T7P A;  2PI5 A;  5KFS A;  4I2G A;  1SKR A;  1SKS A;  2BDP A;  1BPD A;  1Z00 A;  2DR7 A;  3LWL A;  4ECZ A;  4QW9 A;  5KFG A;  2IHM A;  3OVA A;  1TK8 A;  3C1Y A;  7ICE A;  4O3Q A;  3QZ7 A;  1X2I A;  5KFA A;  9ICT A;  1B22 A;  2HHQ A;  2Y1I A;  2ZTE A;  4YR2 A;  4F5O A;  1TVA A;  7ICR A;  1K1S A;  9ICV A;  3WFR E;  5J0T A;  4DQP A;  1ZQR A;  3PR5 B;  2ZUC A;  4J9K A;  3EYZ A;  5DB6 A;  4ED8 A;  4DL5 A;  4K4G A;  4KLM A;  1R8C A;  4J9O A;  8ICY A;  1NK4 A;  7ICI A;  2KN7 A;  3RRG A;  1R8B A;  1RXV A;  4XA5 A;  3MR6 A;  1ZQG A;  8ICW A;  4GC6 A;  3T5H A;  9ICJ A;  5BPC A;  5DBA A;  3PR4 A;  3BQ2 A;  5KFX A;  3V7J A;  4QZC A;  2XGP A;  3TAP A;  8ICS A;  2M2T A;  2M9N A;  4ED2 A;  4R64 A;  3PNC A;  3JPR A;  8ICH A;  4NM2 A;  2I1Q A;  4DS5 A;  3SYZ A;  3UPQ A;  4EP7 A;  4O5K A;  4M5D A;  4WC3 A;  2KP7 A;  5KFT A;  5J2E A;  2IBK A;  1S76 D;  2ZJ5 A;  3C2K A;  7ICJ A;  5J0Q A;  4O3O A;  5KG3 A;  5KFK A;  4B9M A;  7ICS A;  3H7I A;  4YR0 A;  2ZHB A;  4YMN A;  2BHN A;  3HT3 A;  3WFQ E;  1TFY A;  1LB2 B;  1K1Q A;  4JWM A;  3V7K A;  4Z6E A;  5CWR A;  2ZTD A;  4PGQ A;  4DQQ A;  1U47 A;  4IRC A;  7ICM A;  4X0B A;  5KTQ A;  2XCP A;  4B9T A;  4MFF A;  3WFS C;  5CA7 A;  4IG8 A;  3Q8P B;  4J9M A;  3TAQ A;  1R89 A;  3AQN A;  5DBC A;  4P4O A;  1MC8 A;  4YFK A;  5DQH A;  4F92 B;  3MGH A;  4B9N A;  2ZJA A;  4IQW A;  4RT2 A;  5J2C A;  1A77 A;  3M9O B;  9ICQ A;  2W9C A;  1S0V A;  3RB6 A;  3ZD8 A;  5DG8 A;  2BCS A;  4I2A A;  2VAN A;  3C66 A;  2W9B B;  4QZI A;  4P4M A;  3M8S A;  1ZQL A;  5DDM A;  4WC5 A;  3MR2 A;  4RUC A;  1D8L A;  3B0X A;  1BPE A;  2JZB B;  1ZQI A;  2RFF A;  1ARO P;  4J9P A;  2Q66 A;  1NKC A;  4F4K A;  1WCL A;  1NJW A;  2C2R A;  1ZQU A;  4IQT A;  5DLF A;  8ICM A;  2AGO A;  9ICO A;  1BNO A;  4MF8 A;  1QSL A;  1NZP A;  2F1H A;  4QZH A;  3AU6 A;  3MGI A;  2BPC A;  1ZQE A;  3PW5 A;  2ZTC A;  4PHE A;  4RPZ A;  2DVI A;  3SV3 A;  1U45 A;  4DF4 A;  5HRF A;  4X4T A;  4KLJ A;  3RH6 A;  4BWM A;  4UQG A;  3RJH A;  4UB3 A;  1RXW A;  4ELV A;  2P66 A;  1MIY A;  3HW8 A;  4F2S A;  2BKE A;  4JWN A;  5HRL A;  3RBD A;  2UVU A;  9ICU A;  1ZQK A;  4DQS A;  5F2V O;  8ICV A;  9ICW A;  1TFW A;  7ICV A;  1LV5 A;  5J2I A;  4ELU A;  2AQ0 A;  5IIN A;  3ZDA A;  1KFT A;  1B43 A;  2XY6 A;  1BVS A;  5F9L A;  3PO5 A;  2C2D A;  3OVS A;  2H5X A;  4F4X A;  4FBT A;  3MDA A;  4WCW A;  2NRW A;  5KFZ A;  3JPP A;  3RB0 A;  2DRA A;  3TFR A;  4R65 A;  7ICL A;  4QWD A;  4F3O A;  3G6V A;  4C8N A;  2DRB A;  2NRT A;  4RQ5 A;  3Q8L A;  1ZQB A;  2R8H A;  4X4N A;  4EBJ A;  5KFO A;  4X4V A;  3HIY A;  4PGY A;  3N4M B;  2DFL A;  7ICF A;  1VJ7 A;  3THV A;  3TQ1 A;  2XY5 A;  1DK2 A;  3SI8 A;  2LYH A;  2V4Q A;  1U49 A;  4RNM A;  4M04 A;  4RQ1 A;  4C8M A;  2PFN A;  3H39 A;  4AT9 B;  2JEG A;  1UA0 A;  3AQK A;  3ORY A;  3EPI A;  2A1J B;  5KG5 A;  1L3T A;  4YD2 A;  8ICQ A;  8ICU A;  1D9D A;  4KN7 A;  4UB1 A;  1KLN A;  4FHY A;  4WBY A;  3PMN A;  1KFD A;  3LQC B;  1F5A A;  3QEB Z;  3ZDD A;  3PY8 A;  4KLF A;  3M9N B;  9ICP A;  3V6K A;  2HHP A;  5DLG A;  3LWM A;  1NJZ A;  3H8J A;  5IIJ A;  5KFL A;  1ZQW A;  4YMO A;  2HHV A;  4ZH4 A;  4F91 B;  1T3N A;  2HVI A;  3Q8Q B;  2DR8 A;  4JV1 A;  4NLG A;  1ZQY A;  3V6H A;  3UQ0 A;  1D8Y A;  2IA6 A;  5KG0 A;  1JN3 A;  1Z00 B;  3ISD A;  4HYK A;  4BXO A;  3HPO A;  2VA8 A;  1RYR A;  1H38 A;  5DB7 A;  4DEZ A;  5KFM A;  4GLX A;  2ID1 A;  4JV0 A;  4QWA A;  1XSL A;  5DED A;  3GIK A;  4ECQ A;  2R8I A;  3RB4 A;  5DGB A;  5BOL A;  4ED6 A;  8ICO A;  4Z6F A;  4KLO A;  3RR7 A;  1UT5 A;  1V4A A;  4YQW A;  1WOT A;  4YXM A;  4LT6 A;  3OHA A;  2P6R A;  2JEF A;  5IIO A;  4DQR A;  4ECX A;  4QZE A;  3H8S A;  5HP4 A;  2PBE A;  2B21 A;  3OSN A;  3HP6 A;  3C5G A;  3RJI A;  3C2M A;  1L5U A;  1QSY A;  1YLQ A;  4FHP A;  1KRP A;  3GV8 B;  4NLN A;  4KLH A;  4F5Q A;  4DF8 A;  4Q43 A;  1UA1 A;  3B0Y A;  1IXR A;  3GV5 B;  2ASD A;  4DOB A;  4KLT A;  1COO A;  3RBE A;  2FLL A;  4XQ8 A;  4DL3 A;  3N97 B;  4UD4 A;  7ICO A;  4X5V A;  4AT8 A;  1XS9 D;  4FS1 A;  3OGU A;  3QEA Z;  1Z3E B;  4RQ6 A;  4TQS A;  4ECT A;  4X4P A;  4FO6 A;  4BWJ A;  4I29 A;  1JIH A;  4RQ3 A;  2FLP A;  4NY8 A;  4M9H A;  1NO5 A;  4DQI A;  5DQG A;  4ECR A;  2C28 A;  4WC2 A;  8ICP A;  3K75 D;  4YN4 A;  1U9L A;  3OSP A;  3T3F A;  5L1L A;  5CB1 A;  5L1I A;  5J2A A;  9ICI A;  5KG6 A;  1SL1 A;  5J0S A;  4DLE A;  2ASL A;  5EWF A;  4KLS A;  1TAU A;  2WTF A;  4DL4 A;  1ZJN A;  4RQ7 A;  1KDH A;  4KIT B;  5KT7 A;  4IQU A;  1MQ2 A;  4EYH B;  5KFC A;  5KT4 A;  5J2K A;  1ZQP A;  7ICG A;  4ED0 A;  5D46 A;  4P4P A;  1Q79 A;  4P2H A;  2NRK A;  4FHX A;  1XSP A;  4O5C A;  2HHS A;  9ICB A;  2W9M A;  3H3A A;  3OUY A;  3OJS A;  4RU9 A;  2KZM A;  3Q8S B;  3KHG A;  1ZQD A;  3RJJ A;  4YCX A;  4QZA A;  4RQ4 A;  4QZB A;  4DS4 A;  1S0O A;  3RRH A;  1ZQM A;  4K4I A;  4YR3 A;  3JPS A;  3JPT A;  2BCR A;  4KLL A;  5HHI A;  8ICF A;  2W9C B;  2KZZ A;  8ICN A;  1N56 A;  2ZUD A;  2ALZ A;  4IRK A;  4EBK A;  4X4O A;  2ZH4 A;  1SKW A;  2W9A A;  4TQR A;  2DPJ A;  2M2V A;  1JAJ A;  9ICX A;  4EBC A;  5HRE A;  4YD1 A;  4MFC A;  3K4G A;  2ZH3 A;  2KFN A;  3GIM A;  5DGA A;  4CCH A;  5CJ7 A;  3MBY A;  3E2E A;  3GQC A;  5KFI A;  1X9W A;  4RPY A;  1SL0 A;  4EZ9 A;  5J0O A;  3EPG A;  4O3P A;  3SZ2 A;  3PW0 A;  1ZQT A;  2IHN A;  4C8K A;  5HRB A;  9ICF A;  5IIL A;  4RWQ A;  2DR5 A;  4M6W A;  2AGP A;  4KLI A;  1BNP A;  4NKT A;  3BQ1 A;  5KFU A;  3PX6 A;  3HWT A;  5KG1 A;  1L3V A;  3BQ0 A;  4DSF A;  5HR9 A;  4PHD A;  4X4U A;  3ZDC A;  4O3N A;  2XGQ A;  3IHQ B;  2R8J A;  4UD5 A;  4WBZ A;  3UQ2 A;  4X0A A;  3PX0 A;  1UEV A;  2PFO A;  2R8G A;  3GII A;  4MF2 A;  2NRZ A;  4Z6C A;  4F8R A;  3AUO A;  4EBE A;  1D9F A;  5DB8 A;  4X4R A;  8ICI A;  4NLK A;  4RWO A;  1BPB A;  2BR0 A;  9ICA A;  4IR9 A;  4O3S A;  5HRH A;  1MIW A;  3AQM A;  3RB3 A;  4WC1 A;  3G6Y A;  2RDJ A;  1R8A A;  4TUS A;  4XUS A;  4MFA A;  1HJP A;  5KT2 A;  5JUM A;  5EWE A;  2UVR A;  2MAX A;  3C5F A;  8ICJ A;  2PXI A;  4UB4 A;  3RJG A;  4DSI A;  3UXN A;  2ISP A;  2P6U A;  3H4B A;  4JV2 A;  4F5R A;  4EZ6 A;  1QTM A;  1OU5 A;  1NJY A;  9ICC A;  3GDX A;  3PW7 A;  5DEC A;  5KFP A;  4M9N A;  2BPF A;  4J9S A;  4KLE A;  1T8E A;  4I2B A;  3Q8K A;  5CR0 A;  1U4B A;  4RNN A;  4R8U B;  1NK5 A;  4ELT A;  5KFH A;  1A76 A;  5KT5 A;  4YXJ A;  1NKB A;  1JQR A;  5KG4 A;  3HJ4 A;  3FYH A;  1KFS A;  2BGW A;  4IQV A;  4GXJ A;  5DB9 A;  1CEZ A;  2V9W A;  1NOM A;  4B9L A;  4ECY A;  3JZ0 A;  5J2J A;  5TZV A;  2BQ3 A;  4B9S A;  3H8W A;  4R8U A;  1WCN A;  3MAB A;  4DOA A;  1SL2 A;  3PML A;  2FPL A;  7ICT A;  4UAW A;  5KFQ A;  1TFR A;  4I27 A;  4RUA A;  3IM1 A;  4J9Q A;  5CP2 A;  2BCV A;  4ED7 A;  2KFZ A;  1S0M A;  2W8L A;  1MSW D;  3H38 A;  4Z6D A;  4BXO B;  4ATB A;  3NTU A;  4QZ8 A;  4KTQ A;  3G6X A;  4I2E A;  4M47 A;  4WC0 A;  1HUZ A;  3T5L A;  1N48 A;  3OV7 A;  1DK3 A;  4KMU A;  4R63 A;  9ICR A;  4I2C A;  4DFJ A;  3GIJ A;  2OWO A;  3GV7 B;  1S10 A;  2M2U A;  4WC6 A;  2ZH1 A;  4DL2 A;  3ZD9 A;  3PW4 A;  4C8O A;  4TUP A;  3KHH A;  4F50 A;  4TUR A;  2UVW A;  1ZQC A;  4QW8 A;  1TK5 A;  4PHP A;  4RQ2 A;  5HMM A;  4DLG A;  1DGS A;  2PFQ A;  9ICH A;  4M0A A;  3WFP A;  2FMQ A;  4LZG A;  5J0P A;  5KFY A;  1IM4 A;  5BOM A;  3OVB A;  2ZUB A;  1NKE A;  3JPQ A;  7ICK A;  4E8F A;  4ED3 A;  2HHT A;  4QZD A;  1BGX T;  4AT7 A;  4JK1 A;  1U48 A;  1Y88 A;  1MQ3 A;  4QZ9 A;  4AT8 B;  4E0D A;  1ZET A;  2J6T A;  3V72 A;  4E80 A;  1TAQ A;  4DO9 A;  4NLZ A;  1T4G A;  3LDA A;  1JXL A;  4DSL A;  5F9N A;  2BPG A;  4DSK A;  3RH5 A;  3M9M B;  3MFH A;  1CUK A;  4J9R A;  2FPK A;  2I9G A;  3L9D A;  3V7L A;  2KTQ A;  4DFP A;  5HC9 A;  4M9L A;  3C2L A;  5DKW A;  5III A;  4S3N A;  4QZF A;  5HML A;  5HRG A;  1L3S A;  1PZN A;  2JEJ A;  4X4Q A;  5KFE A;  4F4Y A;  1JX4 A;  4LZD A;  4ECU A;  2AQ4 A;  1TK0 A;  3SV4 A;  2BCU A;  3MR3 A;  5EOZ A;  4DFK A;  4MEY A;  5DBB A;  3Q8R B;  3C21 A;  3Q8M A;  1NK8 A;  2HW3 A;  3JPN A;  3LK9 A;  3TAR A;  2F1J A;  4KN4 A;  5DDY A;  1S97 A;  2ISO A;  2J6S A;  5KFD A;  2PI4 A;  1NK7 A;  3OUY B;  2JEI A;  8ICX A;  2XCA A;  3WFO A;  3BQT A;  1TKD A;  4F2R A;  3NGD A;  3NYB A;  4Q8F A;  8ICA A;  5KFJ A;  4O0I A;  1X9S A; 
#chains in the Genus database with same CATH topology
 1PX5 A;  3PZP A;  5C5J A;  4WC7 A;  4YMM A;  2HHW A;  5EE9 A;  3PVX A;  2R18 A;  5J0Y A;  1NJX A;  4J9L A;  3UXP A;  1KEJ A;  2VA3 A;  4UBB A;  3SAH A;  4FH5 A;  1ZQX A;  5AK6 A;  3T5K A;  4QWB A;  1S9F A;  4RZR A;  3QU4 A;  1JMS A;  4XRH A;  2IHO A;  2Q0Z X;  5KT6 A;  4JUZ A;  1V38 A;  1GO3 F;  3JYY A;  3EW9 A;  2JRZ A;  9ICG A;  4ECS A;  4BX9 C;  3C1Z A;  4DSE A;  4FE3 A;  1HEK A;  3ZDE A;  5J2D A;  1Q46 A;  5IIK A;  5AM3 A;  4RQ0 A;  4HX0 A;  5DQI A;  4UAY A;  2DWQ A;  5ALP A;  4K98 A;  1ZQN A;  8ICE A;  2EZY A;  4UAR A;  1PVQ A;  8ICG A;  4OJ5 A;  5L1K A;  4LVS A;  5AI5 A;  3SEN A;  3TFS A;  3OJU A;  4ED1 A;  1ZQS A;  2R8K A;  2KJ9 A;  2ASJ A;  2IOH A;  3MDC A;  4J9N A;  8ICB A;  1ZQH A;  2I6X A;  5J2B A;  4GXK A;  5KT3 A;  2JR5 A;  5HRI A;  4M9J A;  4Q45 A;  1QH9 A;  1N2X A;  4PH5 A;  3MFI A;  4MKP A;  3QXG A;  5KFF A;  4F5N A;  2ZH5 A;  2ZH2 A;  2KG5 A;  3EWA A;  5EWG A;  1ZQA A;  2VA2 A;  4UB2 A;  3AQF A;  4AT7 B;  5JTI A;  4F93 B;  3PSI A;  5DG7 A;  5KFV A;  5D49 A;  5L1J A;  2N1R A;  2O5A A;  3ISB A;  4B9U A;  3D2S A;  5L9X A;  3DDH A;  4BGD A;  4EBD A;  5E79 U;  5AI9 A;  2O1P A;  4ECW A;  4F4Z A;  3A0H U;  2NRV A;  5KFR A;  4MEX A;  2J6U A;  4F5P A;  1DRG A;  2XC9 A;  3RTV A;  1C7Y A;  4RT3 A;  4JLX A;  1ZQF A;  5B3Q A;  2BE3 A;  4I2G A;  1Z00 A;  2DR7 A;  4MHV A;  2IHM A;  4NXV A;  4P0P B;  4O3Q A;  5KFA A;  9ICT A;  1B22 A;  2Y1I A;  3N7P D;  1ZQR A;  3PR5 B;  2ZUC A;  3EYZ A;  3ERC C;  2DQN B;  1PK1 A;  1RXV A;  2LKY A;  2VJ5 A;  2K4I A;  3UMC A;  3BQ2 A;  5KFX A;  4K97 A;  2M2T A;  2XID A;  3JPR A;  8ICH A;  4OO1 J;  4DS5 A;  5AKI A;  1KN5 A;  4O5K A;  4M5D A;  5J2E A;  5ALU A;  5J0Q A;  1YT3 A;  4EX6 A;  7ICS A;  1DGJ A;  4YMN A;  1LB2 B;  5CFU A;  5CWR A;  4B9T A;  5CA7 A;  3BQ7 A;  3TAQ A;  4BUG A;  1R89 A;  3VC8 A;  2K8A A;  4U6P A;  1A77 A;  4KX3 A;  4IS7 A;  3TAC B;  3RB6 A;  2PKE A;  4I2A A;  5ALY A;  3M8S A;  4WC5 A;  3BZK A;  3EF2 A;  1D8L A;  4O68 A;  2LM1 A;  1DXS A;  5EE3 A;  4F4K A;  2AGO A;  2F1H A;  2IOF K;  1JAL A;  1ZQE A;  3PW5 A;  4PHE A;  2CN1 A;  5HRF A;  4X4T A;  4UB3 A;  2P66 A;  2ZIX A;  3HW8 A;  5HRL A;  3RBD A;  5F2V O;  1TFW A;  5J2I A;  5AKK A;  4Y2Y A;  2XY6 A;  1BVS A;  2ZIW A;  3PO5 A;  5ALK A;  2C2D A;  2LBO A;  2AHO B;  2FDR A;  3JPP A;  4R65 A;  4USA A;  4RQ5 A;  3Q8L A;  4US9 A;  4EBJ A;  1SXE A;  4XJE A;  3N4M B;  2DFL A;  3THV A;  2JV3 A;  4AT9 B;  4RQ1 A;  2PFN A;  4PZN A;  1UA0 A;  2MA1 A;  5AM1 A;  1SV0 C;  3NVY A;  2WAQ F;  3I28 A;  1F5A A;  4NJ8 A;  3M9N B;  2EAP A;  3K7D A;  1NJZ A;  5KFL A;  1ZQY A;  3UQ0 A;  3ISD A;  4PZO A;  3OWG A;  1RYR A;  4EV6 A;  4US8 A;  2WAQ C;  5KAF U;  5ALR A;  2ZIV B;  3GIK A;  5DED A;  4ED6 A;  4Z6F A;  4GFJ A;  1UT5 A;  4YXM A;  2JEF A;  5IIO A;  4DQR A;  4ECX A;  4QZE A;  5HR6 A;  3H8S A;  2L5Y A;  3RJI A;  1L5U A;  4OAH A;  4KLH A;  1A6S A;  4F5Q A;  4X5V A;  2E8N A;  5AKZ A;  3OGU A;  1J97 A;  5EE0 A;  4FO6 A;  1KKX A;  1YZ6 A;  2KOB A;  3K75 D;  3PSF A;  8ICP A;  1RYU A;  1ZD2 P;  2Y9U A;  5CB1 A;  1SL1 A;  4DLE A;  2ASL A;  5EWF A;  4DL4 A;  1KDH A;  3QUT A;  4EYH B;  4ED0 A;  5D46 A;  4P4P A;  1P7D A;  5AM4 A;  2W9M A;  4RU9 A;  1B4F A;  1FFV A;  3Q8S B;  4OD0 A;  3KHG A;  1ZQD A;  3RJJ A;  1ZQM A;  2NV3 A;  2NO4 A;  2HBK A;  1MA7 A;  2ALZ A;  4IRK A;  1FO4 A;  9ICX A;  3NWI A;  2ZH3 A;  5D62 A;  1RDF A;  2DL0 A;  3GQC A;  4RPY A;  4EZ9 A;  3PW0 A;  5HRB A;  9ICF A;  4RWQ A;  5ALL A;  3PX6 A;  2WFA A;  1L3V A;  5HR9 A;  2JMG A;  2R8J A;  4UD5 A;  4EEN A;  3JCF A;  4LEZ A;  4X0A A;  4X4R A;  1RG6 A;  5DB8 A;  1BPB A;  1SIJ A;  9ICA A;  1MIW A;  3G6Y A;  5AI6 A;  4TUS A;  1HJP A;  5EWE A;  2MAX A;  2G08 A;  4DSI A;  2P6U A;  2LM4 A;  1X6I A;  3EUB 2;  3GDX A;  3H0R B;  5DEC A;  2RQ5 A;  4J9S A;  1T8E A;  2HN2 A;  3L5K A;  4I2B A;  4RNN A;  1N62 A;  4R8U B;  4ELT A;  5KFH A;  1ED1 A;  1Q8K A;  3FYH A;  2KIC A;  1CEZ A;  4B9L A;  2BQ3 A;  2D6F C;  4DOA A;  4NXW A;  4UAW A;  2W04 A;  4RUA A;  1MSW D;  4QIW F;  1SWW A;  1Q3U A;  4Z6D A;  2ZG6 A;  3OV7 A;  1N63 A;  2EZX A;  3WK6 A;  4DFJ A;  1S10 A;  2ESE A;  4WC6 A;  5AKH A;  5ALF A;  3IG5 A;  4TUP A;  4CF3 A;  1F0M A;  4QIW C;  1ZQC A;  4QW8 A;  2EZZ A;  1TK5 A;  4RQ2 A;  1DGS A;  4OJO A;  4LZG A;  5BOM A;  3OVB A;  2YMM A;  1BGX T;  4AT7 A;  4K9B A;  2KV2 A;  4AT8 B;  4EED A;  1TAQ A;  1T4G A;  3KFU F;  2KD1 A;  4DSK A;  3RH5 A;  4J9R A;  2I9G A;  2KTQ A;  4DFP A;  5CEH A;  4S3N A;  3LYS A;  5HRG A;  4CF5 A;  2RP5 A;  4LZD A;  3SV4 A;  2HW3 A;  3Q8R B;  1NZP A;  3TAR A;  2ISO A;  5G5G A;  5KFD A;  1NK7 A;  5ALT A;  2JEI A;  3WFO A;  4F2R A;  4Q8F A;  5KFJ A;  4O0I A;  2CRX A;  4P0P A;  1EXN A;  1ZQO A;  1ZOL A;  4LJX A;  2ATL A;  1BPZ A;  1ZQZ A;  3HKZ F;  4EYI B;  5JRT A;  5J0X A;  3ISC A;  4PJ0 U;  2HBM A;  3V6J A;  1JRP A;  2E3T A;  1UHU A;  4C7Z A;  5HNK A;  5B3P A;  5KL8 B;  4M6W B;  4B6J A;  2JH7 A;  4NM1 A;  1WG8 A;  1XO1 A;  3KZX A;  3IV6 A;  2A19 A;  4NKU A;  4QWC A;  3HKZ C;  2CPR A;  8ICZ A;  2A1A A;  5AI4 A;  3HJ1 A;  3SMV A;  2C2E A;  3C23 A;  1MIV A;  4I2F A;  4KB6 A;  4YP3 A;  1KQQ A;  2A3V A;  4B9V A;  4F4W A;  4DWI A;  4G9B A;  3PX4 A;  2F1I A;  2MUT B;  2XY7 A;  1TE2 A;  2ZH8 A;  4K4H A;  3BS5 A;  5J2G A;  1KSP A;  2CXY A;  3PST A;  4YVZ A;  1WYG A;  2PMZ F;  3PV8 A;  4FBU A;  1RZT A;  2YN4 A;  3H4D A;  5KG2 A;  3QUB A;  1K5O A;  5HHH A;  3RJE A;  4WC4 A;  1SZP A;  1IIP A;  2PMZ C;  4JB3 A;  1PK3 A;  3WK9 A;  4Y2Q A;  8ICC A;  3F5A A;  3CW2 C;  3RAX A;  2ZJ8 A;  3PW2 A;  2OHF A;  4I2D A;  1VFG A;  2DR9 A;  4BDP A;  3BJY A;  2GWS A;  4YG2 A;  3IRU A;  4ACO A;  3PO4 A;  4NL9 A;  3AN1 A;  2ZH7 A;  9ICM A;  7ICP A;  1UET A;  4UAZ A;  3QX7 A;  1CRX A;  1RYS A;  2ES6 A;  4QWE A;  3KHL A;  4NLC A;  9ICN A;  3DEE A;  4FH3 A;  2JHD A;  1ZD4 A;  4AT9 A;  3FM9 A;  5J0R A;  5IIM A;  1SWV A;  2B51 A;  4WOY A;  1NI3 A;  3ETR A;  1Z4O A;  1KNY A;  3T5J A;  4DL6 A;  3TAN A;  3RR8 A;  1T7P A;  1SKR A;  4IL6 U;  1COK A;  3QZ7 A;  1AQ6 A;  2ZIV A;  5J0T A;  4DQP A;  2E8M A;  2F8K A;  5DB6 A;  2QLT A;  2BDU A;  2H3Z A;  2HBL A;  4J9O A;  1VDV A;  1NK4 A;  1R8B A;  2KN7 A;  3RRG A;  2K8B B;  4Y2X A;  4XA5 A;  8ICW A;  4GC6 A;  5BPC A;  3PR4 A;  3WKE A;  2HSZ A;  4QZC A;  2XGP A;  2M9N A;  4ED2 A;  1YZ7 A;  4R64 A;  3PNC A;  1JUD A;  2I1Q A;  3QUQ A;  3WK4 A;  3NRZ A;  3SYZ A;  3UPQ A;  3RFA A;  5KFT A;  4O3O A;  5KG3 A;  3H7I A;  3HT3 A;  4JWM A;  3SD7 A;  3NAS A;  3V7K A;  1U47 A;  3K1Z A;  7ICM A;  4X0B A;  3WFS C;  5AKG A;  4MFF A;  3Q8P B;  1C20 A;  4CF4 A;  5DBC A;  2W3S A;  1MC8 A;  4B9N A;  3CK6 A;  4N7R A;  3M6Z A;  3ZD8 A;  2W9B B;  1ZQL A;  5DDM A;  3QU7 A;  3F2C A;  1LKY B;  2RFF A;  2Q66 A;  2JH1 A;  2RHF A;  1ZQU A;  5DLF A;  1QSL A;  3WK5 A;  3LVW A;  3MGI A;  2BPC A;  3KKA C;  4C4R A;  4RPZ A;  4UAS A;  4Y2R A;  2DVI A;  4KLJ A;  4UQG A;  5GTH U;  3A0B U;  4C4T A;  2BKE A;  4JWN A;  3NVW A;  3TAD A;  9ICW A;  4U7C A;  7ICV A;  5TIS U;  1X9S A;  2KJ5 A;  1S8O A;  4QJF B;  2EH9 A;  4WCW A;  2E1F A;  1N5W A;  2NRW A;  3RB0 A;  3TFR A;  4NXU A;  7ICL A;  2DRB A;  2NYV A;  2F2A B;  2F77 X;  4X4N A;  1HIW A;  3HIY A;  4PGY A;  1VJ7 A;  7ICF A;  2XY5 A;  1DK2 A;  2LYH A;  2HBJ A;  2V4Q A;  4RNM A;  4M04 A;  4C8M A;  5AM0 A;  2GA9 D;  3EPI A;  2A1J B;  5KG5 A;  1L3T A;  4YD2 A;  8ICQ A;  8ICU A;  1D9D A;  4WBY A;  1KLN A;  4FHY A;  1SV4 A;  4EX7 A;  3UM9 A;  3QEB Z;  4KLF A;  9ICP A;  3CYM A;  3QU9 A;  3V6K A;  1S5L U;  3H8J A;  5IIJ A;  2HHV A;  4F91 B;  2VIX A;  3Q8Q B;  4NLG A;  2KIW A;  3BZC A;  2VA8 A;  5DB7 A;  4DEZ A;  4GLX A;  3WKA A;  3AQE A;  5BOL A;  4ICA A;  2P6R A;  5AIC A;  2PBE A;  3C5G A;  1IG6 A;  2KVC A;  3GV8 B;  4NLN A;  1ZRN A;  4Q43 A;  3GV5 B;  1IXR A;  2ASD A;  1COO A;  3RBE A;  4AT8 A;  3N97 B;  4FS1 A;  1Z3E B;  4ECT A;  2FLP A;  4M9H A;  3E0F A;  5DQG A;  3NKU A;  3OSP A;  5J2A A;  5J0S A;  2QB0 B;  4Y2V A;  4KLS A;  1ZJN A;  5ALO A;  2ZH9 A;  4RQ7 A;  4KIT B;  4IQU A;  7ICG A;  5KFC A;  4P2H A;  4FHX A;  4O5C A;  3H3A A;  1A0P A;  4UAV A;  4QZA A;  4RQ4 A;  1L7P A;  1S0O A;  3RRH A;  4EEB A;  8ICF A;  2BCR A;  1X9X A;  2Y9T A;  5JTG A;  1N56 A;  4EBK A;  2ZH4 A;  3QUC A;  2W03 A;  2M2V A;  4EBC A;  4HAI A;  2GH1 A;  4MFC A;  5HRE A;  3K4G A;  2B0C A;  2HN1 A;  3KOO A;  5KFI A;  5AKY A;  2YB1 A;  5J0O A;  3EPG A;  2IHN A;  2LYA A;  4M6W A;  3ICX A;  4KLI A;  1BNP A;  4NKT A;  3BQ1 A;  5KG1 A;  2YY6 A;  3ZDC A;  4O3N A;  4WBZ A;  2QAR B;  2XVT A;  3PX0 A;  2NRZ A;  4Z6C A;  4F8R A;  1D9F A;  8ICI A;  2BR0 A;  3AQM A;  4WC1 A;  4I0U A;  4XUS A;  4MFA A;  3QNM A;  1Z1V A;  2PXI A;  4UB4 A;  3RJG A;  2W3R A;  2ISP A;  3H4B A;  4JV2 A;  3PW7 A;  5KFP A;  1O08 A;  2XIC A;  4YXJ A;  2WHE A;  2ZIU B;  3WKD A;  4Y2J A;  4IQV A;  4GXJ A;  2M0N A;  3JZ0 A;  5FP0 A;  4NV0 A;  4B9S A;  3H8W A;  3IDW A;  1SL2 A;  3I76 A;  7ICT A;  2GLE A;  4P0Q A;  5CP2 A;  2W8L A;  3NTU A;  4QZ8 A;  4KTQ A;  3G6X A;  4I2E A;  2ZXI A;  4Y2T A;  1ZXI A;  3DV9 A;  1DK3 A;  2JXJ A;  3GIJ A;  3ZD9 A;  3PW4 A;  2I5H A;  3KHH A;  4F50 A;  4TUR A;  1XNS A;  1SZH A;  2PFQ A;  4NLB A;  2FMQ A;  3L3F X;  1IM4 A;  3FAH A;  5AK4 A;  7ICK A;  2HHT A;  3E58 A;  4JK1 A;  1Y88 A;  4QZ9 A;  4E0D A;  4E80 A;  2J6T A;  3V72 A;  4DO9 A;  5ALI A;  1JXL A;  5HR7 A;  3KZI U;  1CUK A;  2H3V A;  5DKW A;  5HML A;  1L7M A;  1UPH A;  1SB3 C;  5ALN A;  1TK0 A;  2K89 A;  4DFK A;  1X6J A;  5AM2 A;  3LK9 A;  2F1J A;  2PI4 A;  3HRD D;  3BQT A;  5J8Y A;  8ICA A;  4A8E A;  1O03 A;  4C8L A;  5ALQ A;  5AKJ A;  5J0U A;  4EEK A;  1N5X A;  1QSS A;  3U26 A;  3FDS A;  4AP9 A;  4FS2 A;  1XSN A;  3KTQ A;  1BPX A;  3ETL A;  4FZL A;  2EAO A;  3UMG A;  4R66 A;  4FO1 A;  4KLQ A;  1L3U A;  3C29 A;  4O3R A;  3UPS A;  5CFT A;  2BQU A;  1PVR A;  1HUO A;  2FPM A;  4CNQ A;  2F76 X;  4KLD A;  3WKB A;  4M2Y A;  1ZQJ A;  5CHG A;  2Y1J A;  5KG7 A;  4DSJ A;  2ZXH A;  2WF7 A;  4M9G A;  4JLZ A;  1FA0 A;  5F3X B;  3M8R A;  2B6G A;  1RQN A;  3OHB A;  2EDU A;  3VCB A;  4I28 A;  2W9B A;  4PGX A;  1XC9 A;  2K8C B;  5ALV A;  4O9M A;  3AEV A;  1ZQV A;  4KX5 A;  4ATB B;  5K4L A;  2F44 A;  4UB6 U;  1S77 D;  2KKV A;  1ZQQ A;  1NK9 A;  4FHW A;  3RJF A;  3EZ5 A;  4TUQ A;  4OJL A;  2DKX A;  1XWL A;  4RQ8 A;  3QE9 Y;  4Q8E A;  4I2H A;  5DG9 A;  2FCL A;  1XU4 A;  2OH2 A;  2E8O A;  4O5E A;  4Q44 A;  3J81 j;  2BQR A;  5JU5 A;  2C22 A;  5HRD A;  2NRX A;  7ICU A;  2RDI A;  4QZG A;  4PPX A;  4I2J A;  1V9P A;  5D4B A;  3AU2 A;  4PHA A;  4I2I A;  4FHV A;  2AJQ A;  2A1J A;  2RRD A;  2K4P A;  1SGG A;  4UB5 A;  3C18 A;  1GPJ A;  1N61 A;  1Z4N A;  5KFN A;  1J2N A;  3WK8 A;  9ICS A;  1L8O A;  3RH4 A;  2HOI A;  5KFS A;  1SKS A;  2BDP A;  1BPD A;  3LWL A;  4ECZ A;  3OVA A;  3C1Y A;  1ZRM A;  1X2I A;  1PK1 B;  2G0A A;  7ICR A;  1K1S A;  3WFR E;  3H0M B;  4J9K A;  4ED8 A;  4KLM A;  1R8C A;  4DL5 A;  1SXD A;  8ICY A;  1LVH A;  1WWU A;  3MR6 A;  1ZQG A;  1KW4 A;  9ICJ A;  3T5H A;  3ER9 B;  5D63 A;  5DBA A;  3TAP A;  8ICS A;  2YMP A;  1V97 A;  5AKL A;  1Z19 A;  2JGA A;  4NM2 A;  4EP7 A;  2KK0 A;  4WC3 A;  2QB1 A;  2KP7 A;  2IBK A;  2EQY A;  7ICJ A;  5KFK A;  3SQI A;  4YR0 A;  2QB0 A;  1TFY A;  4DQQ A;  4Y2U A;  4IRC A;  5KTQ A;  1NZB A;  3AQN A;  3N28 A;  4P4O A;  4YFK A;  2ZJA A;  4IQW A;  1FEZ A;  4ZOH C;  1S0V A;  2VAN A;  3C66 A;  4P4M A;  3B0X A;  1ZQI A;  2JZB B;  1ARO P;  1NKC A;  1WCL A;  2C2R A;  4IQT A;  8ICM A;  5KNI A;  3SEI A;  4QZH A;  1T94 A;  4Y2P A;  2W7P A;  3SV3 A;  4NXX A;  3QYP A;  1U45 A;  2DUY A;  2QAR A;  3RH6 A;  1MIY A;  3RJH A;  1RXW A;  4ELV A;  2OYY A;  1ZQ1 C;  1ZQK A;  2EAN A;  1LV5 A;  2AQ0 A;  1KFT A;  5F9L A;  1F5S A;  2BBH A;  5EE1 A;  4F4X A;  1L6N A;  2OXO A;  2FJ6 A;  5KFZ A;  2DRA A;  1V85 A;  1X42 A;  3F5E A;  4QWD A;  4C8N A;  4EGW A;  4K9A A;  2RLT A;  1ZQB A;  5KFO A;  3H8M A;  4F71 A;  3MCR A;  3TQ1 A;  1QQ5 A;  2DBY A;  1J2M A;  1PUZ A;  2KMD A;  4KN7 A;  4UB1 A;  3PMN A;  3ZDD A;  2WF9 A;  2LI6 A;  5DLG A;  3LWM A;  5ALM A;  1ZQW A;  4YMO A;  1T3N A;  4JV1 A;  3V6H A;  1D8Y A;  4OJ6 A;  5KG0 A;  1JI7 A;  1JN3 A;  1XO0 A;  4NXT A;  5CFS A;  1H38 A;  4F72 A;  2Y0S F;  5KFM A;  4C7Y A;  4QWA A;  1XSL A;  1IV8 A;  2R8I A;  3RB4 A;  5DGB A;  8ICO A;  1RM6 C;  3RR7 A;  4YQW A;  2KSO B;  3OHA A;  3NVO A;  5HP4 A;  2B21 A;  3HP6 A;  1YLQ A;  4FHP A;  3C2M A;  2Y0S C;  4DF8 A;  3CP8 A;  3B0Y A;  1Q3V A;  2FLL A;  4XQ8 A;  3NS1 A;  1L8L A;  1UQV A;  4RQ6 A;  4X4P A;  1JIH A;  4RQ3 A;  4DQI A;  2C28 A;  2YMQ A;  5CRX A;  4YN4 A;  1U9L A;  3F2D A;  4LEY A;  3K1R B;  3T3F A;  2HCF A;  1TAU A;  2WTF A;  2W43 A;  4C8K A;  1Z1B A;  5KT7 A;  1MQ2 A;  5KT4 A;  1Q79 A;  1XSP A;  3PSP A;  2OEH A;  3PHZ A;  9ICB A;  3OJS A;  2KZM A;  2W7O A;  4C0Z A;  3N7S C;  2EAM A;  4K4I A;  3JPS A;  8ICN A;  2W9C B;  2KZZ A;  3ALR A;  2KVS A;  4OAG A;  1SKW A;  2DPJ A;  1JAJ A;  4YD1 A;  4K8V A;  3ZI4 A;  2KFN A;  3GIM A;  4CCH A;  5CJ7 A;  3MBY A;  1SL0 A;  1VJ5 A;  4O3P A;  4C80 A;  1ZQT A;  1QCK A;  3HWT A;  3BQ0 A;  3IP4 B;  4DSF A;  4X4U A;  1RQL A;  5KL1 B;  3UQ2 A;  5A0L A;  2H3I A;  2PFO A;  2R8G A;  3AUO A;  4RWO A;  4NLK A;  3KBB A;  3R9K A;  4IR9 A;  5HRH A;  2G09 A;  3SAF A;  2RDJ A;  1JRO A;  2QKQ A;  2D3D A;  4EZ6 A;  1OU5 A;  4M9N A;  1TAM A;  3WKC A;  1U4B A;  1A76 A;  4NL9 C;  5KT5 A;  1NKB A;  2YTU A;  5KG4 A;  3HJ4 A;  1KFS A;  2FE9 A;  5DB9 A;  5CHE A;  1NOM A;  3F53 A;  5AK5 A;  4R8U A;  3MAB A;  4OJP A;  3PML A;  2FPL A;  4UB8 U;  5KFQ A;  4I27 A;  1WWV A;  3IM1 A;  2BCV A;  3HJE A;  2KFZ A;  4ED7 A;  4BXO B;  4ATB A;  5ALW A;  4M47 A;  4WC0 A;  4UAT A;  3T5L A;  9ICR A;  4PL2 A;  4OAI Z;  2M2U A;  4CDG A;  2ZH1 A;  4KMO B;  4DL2 A;  2E8P A;  4O67 A;  2IUB A;  4PHP A;  9ICH A;  4DLG A;  3WFP A;  4M0A A;  3RF9 A;  2YX8 A;  3N7R C;  1SV0 A;  1X66 A;  3QU2 A;  1NKE A;  4E8F A;  4ED3 A;  1MQ3 A;  3FC4 A;  1ZET A;  4NLZ A;  2KJ8 A;  3LDA A;  4DSL A;  2EWR A;  1B0X A;  4FZN A;  5F9N A;  2BPG A;  3M9M B;  5AKE A;  2FPK A;  3L9D A;  3C2L A;  5III A;  4QZF A;  5KFE A;  4F4Y A;  2H3Q A;  5AHX A;  2BCU A;  3MR3 A;  4MEY A;  5DBB A;  3C21 A;  3Q8M A;  3C28 A;  5ALG A;  1S97 A;  2J6S A;  2GO7 A;  5D61 A;  3OUY B;  2LHT A;  2IOF A;  2F8L A;  1WUD A;  3H37 A;  1RPL A;  4FFD A;  9ICE A;  2G06 A;  1L7O A;  5AM5 A;  2MU2 A;  3CNH A;  9ICL A;  1S0N A;  5KAI U;  2AU0 A;  1JXE A;  4RNO A;  2E1E A;  2BCQ A;  3OPX A;  3RJK A;  5J29 A;  4EEY A;  4RWN A;  2VJ4 A;  8ICT A;  3QZ8 A;  7ICN A;  4X4S A;  3GFK B;  3KHR A;  3UMB A;  2FLN A;  3M1Y A;  3AQL A;  5J0W A;  1KTQ A;  4UBC A;  1NK6 A;  8ICK A;  7ICQ A;  3TI0 A;  2WB1 F;  3UXO A;  2FMS A;  4IR1 A;  2ZH6 A;  5J2F A;  1NK0 A;  2WF8 A;  4RWP A;  2Z7J A;  3H40 A;  7ICH A;  2AH5 A;  3JPO A;  3GIL A;  1L7N A;  3BS5 B;  2WB1 C;  1M6Y A;  2DF4 B;  4ECV A;  2K4H A;  2KZ3 A;  3TAD C;  5KFW A;  2ODG A;  2MUT A;  2M2W A;  4IC9 A;  4DFM A;  2AGQ A;  9ICK A;  2HVH A;  2MRL A;  4O3M A;  4NXZ A;  2JZB A;  1OW5 A;  2KNJ A;  2XO7 A;  2HHX A;  5B5E U;  4RQM A;  2VKQ A;  3AM9 A;  4RPX A;  4DOC A;  5J2H A;  1D8B A;  5ALJ A;  4GC7 A;  2K60 A;  4G3I A;  2IMW P;  5ALS A;  8ICR A;  5KFB A;  1UT8 A;  4XQ7 A;  3ED5 A;  1ZJM A;  5B66 U;  1DOQ A;  4KM5 A;  2W11 A;  4KLG A;  4DL7 A;  1TV9 A;  2DPI A;  2UVV A;  2ZHA A;  3ZDB A;  3BS7 A;  1Q78 A;  1CI4 A;  3T79 A;  1UEU A;  2V4R A;  2W8K A;  1QLN A;  2B56 A;  2BZF A;  2FMP A;  4KLU A;  2KIV A;  3RAQ A;  1BPY A;  2HHU A;  1ECW A;  2DKZ A;  2B4V A;  5HRK A;  4E7X A;  3I1Y A;  2WF6 A;  1X9M A;  1QQ6 A;  4IRD A;  2PFP A;  3NRW A;  4GXI A;  8ICL A;  3BDP A;  1ZYQ A;  1UCV A;  3MR5 A;  3HX0 A;  2NO5 A;  2KE7 A;  2PI5 A;  4GIB A;  4QW9 A;  5KFG A;  1TK8 A;  7ICE A;  2HHQ A;  2ZTE A;  4YR2 A;  4F5O A;  1TVA A;  9ICV A;  2KSO A;  4K4G A;  1FIQ A;  5AI0 A;  2KHQ A;  3TKA A;  7ICI A;  3O0F A;  5AI8 A;  2FI1 A;  4OAF A;  3V7J A;  3ER8 C;  3MC1 A;  5AIB A;  1PVP A;  2KEY A;  1S76 D;  2ZJ5 A;  3C2K A;  2HDO A;  4O69 A;  4B9M A;  3NVV A;  2ZHB A;  2G07 A;  2BHN A;  3B9J A;  3WFQ E;  1K1Q A;  4Z6E A;  2HMX A;  2ZTD A;  4PGQ A;  2XCP A;  4IG8 A;  4J9M A;  4AYB F;  2K4E A;  2OCE A;  2H3F A;  4K96 A;  5DQH A;  3MGH A;  4F92 B;  4RT2 A;  5J2C A;  3M9O B;  9ICQ A;  2W9C A;  5T14 A;  2BCS A;  5DG8 A;  4QZI A;  2BBJ A;  3MR2 A;  4RUC A;  3D2Q A;  4AYB C;  1BPE A;  2D8C A;  4WQL A;  4J9P A;  3GZF A;  3AMZ A;  1NJW A;  3H0L B;  1BNO A;  1KL9 A;  9ICO A;  4MF8 A;  1X40 A;  4EEL A;  1LKY A;  3AU6 A;  2ZTC A;  3KD3 A;  4DF4 A;  4BWM A;  4BJQ A;  4F2S A;  1OXJ A;  2G5H B;  2UVU A;  4WJ3 B;  9ICU A;  4DQS A;  8ICV A;  4O6A A;  4ELU A;  5IIN A;  3ZDA A;  1B43 A;  3L4P A;  3OVS A;  2H5X A;  4FBT A;  3MDA A;  4NWI A;  4F3O A;  3G6V A;  4CGZ A;  2NRT A;  4FZM A;  5AIA A;  2R8H A;  4X4V A;  2HOQ A;  3SI8 A;  1U49 A;  3H39 A;  2JEG A;  3AQK A;  3ORY A;  1MN8 A;  4J03 A;  5C0Y A;  3F2B A;  1KFD A;  5ALX A;  3LQC B;  2KHV A;  3PY8 A;  2HHP A;  3MGV A;  4ZH4 A;  2HVI A;  4OCZ A;  3SAG A;  1OUQ A;  2DR8 A;  2LPE A;  2IA6 A;  4BXO A;  1Z00 B;  4HYK A;  3HPO A;  3NUQ A;  4WQK A;  5G5H A;  2XI9 A;  3CRX A;  5AK3 A;  3WU2 U;  2ID1 A;  1VLB A;  3QU5 A;  4JV0 A;  4ECQ A;  1N60 A;  2O6K A;  2MSN A;  4KLO A;  1V4A A;  1WOT A;  4LT6 A;  4CRX A;  3OSN A;  1QSY A;  1KRP A;  3SR6 A;  2P35 A;  5J8Y C;  1UA1 A;  4DOB A;  4KLT A;  4Y2S A;  4UD4 A;  4DL3 A;  7ICO A;  2E5S A;  1XS9 D;  3QEA Z;  4TQS A;  4I29 A;  4BWJ A;  4NY8 A;  1NO5 A;  5H2F U;  4ECR A;  4WH5 A;  4WC2 A;  2Q4T A;  1NNL A;  5L1L A;  2YB4 A;  2OM6 A;  5L1I A;  9ICI A;  5KG6 A;  1ZQP A;  5J2K A;  2NRK A;  2HHS A;  3OUY A;  4YCX A;  1ZD3 A;  4QZB A;  4DS4 A;  4YR3 A;  4KLL A;  3JPT A;  5HHI A;  2ZUD A;  4X4O A;  2W9A A;  2W54 A;  4TQR A;  3M7D A;  2GOL A;  3HIL A;  5DGA A;  3E2E A;  1X9W A;  3SZ2 A;  2DR5 A;  5IIL A;  2AGP A;  2F3N A;  5KFU A;  4PHD A;  2XGQ A;  2AXT U;  3IHQ B;  1F44 A;  3S6J A;  3IN5 A;  1UEV A;  2ZIX B;  3GII A;  4MF2 A;  1T3Q A;  4JMU A;  5ALE A;  4EBE A;  4DCC A;  4O3S A;  3OTQ A;  3RB3 A;  5ALH A;  4DFD A;  1R8A A;  4UW9 A;  1FFU A;  2ZIW B;  5KT2 A;  5JUM A;  2UVR A;  8ICJ A;  3C5F A;  3UXN A;  4F5R A;  2LMR A;  1QTM A;  1NJY A;  9ICC A;  2BPF A;  4KLE A;  1URJ A;  2WF5 A;  3D2N A;  3Q8K A;  5CR0 A;  3ONN A;  5ALZ A;  1NK5 A;  3KKA A;  1JQR A;  2BGW A;  4UAU A;  4LEW A;  4P0Q B;  2V9W A;  3LVV A;  4ECY A;  5J2J A;  5TZV A;  2G5I B;  4RQN A;  1WCN A;  2KKP A;  3M6K A;  2ZIU A;  1TFR A;  2GAF D;  3D6J A;  4J9Q A;  3H38 A;  1S0M A;  4K99 A;  5AKX A;  5ALD A;  3WK7 A;  3NVZ A;  1HUZ A;  1N48 A;  4KMU A;  2LYB A;  4R63 A;  4I2C A;  2OWO A;  3GV7 B;  3IG8 A;  4C8O A;  2HOF A;  2UVW A;  5HMM A;  5J0P A;  5KFY A;  2DGZ A;  2W55 A;  3GU3 A;  2YQE A;  1QQ7 A;  2ZUB A;  3JPQ A;  4QZD A;  1U48 A;  3AL0 B;  4PL1 A;  5GTI U;  4QNL A;  4LEV A;  3MFH A;  3V7L A;  5HC9 A;  4M9L A;  2YML A;  1L3S A;  1PZN A;  2JEJ A;  4X4Q A;  1JX4 A;  4ECU A;  2AQ4 A;  5EOZ A;  1NK8 A;  4C4S A;  3JPN A;  2HI0 A;  4KN4 A;  5DDY A;  8ICX A;  2XCA A;  1TKD A;  3NYB A;  3NGD A;  5L1M A;  4CE6 A;  1KBU A;  1ZD5 A; 
#chains in the Genus database with same CATH homology
 3H37 A;  1RPL A;  1PX5 A;  4C8L A;  9ICE A;  5C5J A;  1EXN A;  1ZQO A;  4WC7 A;  4YMM A;  2HHW A;  3PVX A;  9ICL A;  5J0Y A;  1S0N A;  1NJX A;  2AU0 A;  4J9L A;  2ATL A;  1JXE A;  4RNO A;  1BPZ A;  3UXP A;  1ZQZ A;  2BCQ A;  3RJK A;  5J0U A;  5J29 A;  4EYI B;  4EEY A;  1KEJ A;  5J0X A;  3ISC A;  4RWN A;  3V6J A;  1QSS A;  2VA3 A;  4UBB A;  3QZ8 A;  8ICT A;  7ICN A;  4FH5 A;  4X4S A;  5HNK A;  4M6W B;  3FDS A;  1ZQX A;  3GFK B;  4FS2 A;  3T5K A;  1XSN A;  4QWB A;  1S9F A;  4NM1 A;  1XO1 A;  3KHR A;  3KTQ A;  4RZR A;  3ETL A;  1BPX A;  2FLN A;  4NKU A;  3AQL A;  4QWC A;  8ICZ A;  1JMS A;  5J0W A;  4R66 A;  1KTQ A;  4UBC A;  4XRH A;  1NK6 A;  4KLQ A;  8ICK A;  2Q0Z X;  7ICQ A;  5KT6 A;  3HJ1 A;  3TI0 A;  1L3U A;  2C2E A;  4JUZ A;  3UXO A;  4O3R A;  2FMS A;  4IR1 A;  3C23 A;  3JYY A;  1MIV A;  3UPS A;  2ZH6 A;  4I2F A;  5J2F A;  3EW9 A;  2BQU A;  4YP3 A;  1NK0 A;  2FPM A;  1HUO A;  9ICG A;  4KLD A;  4B9V A;  4ECS A;  4RWP A;  4F4W A;  4DWI A;  4M2Y A;  1ZQJ A;  5CHG A;  3C1Z A;  3H40 A;  4DSE A;  7ICH A;  3PX4 A;  2Y1J A;  5KG7 A;  3JPO A;  3ZDE A;  3GIL A;  2F1I A;  2MUT B;  4DSJ A;  2XY7 A;  5J2D A;  5IIK A;  4RQ0 A;  4M9G A;  5DQI A;  4UAY A;  4ECV A;  1FA0 A;  2KZ3 A;  3M8R A;  1ZQN A;  8ICE A;  2ZH8 A;  5KFW A;  3OHB A;  4K4H A;  8ICG A;  5J2G A;  1KSP A;  2MUT A;  4YVZ A;  5L1K A;  2M2W A;  4I28 A;  4DFM A;  4LVS A;  2AGQ A;  3PV8 A;  2W9B A;  9ICK A;  4PGX A;  3TFS A;  3OJU A;  4ED1 A;  1RZT A;  1ZQS A;  2R8K A;  4FBU A;  2HVH A;  3H4D A;  4NXZ A;  2JZB A;  2ASJ A;  1XC9 A;  2XO7 A;  5KG2 A;  4O9M A;  1ZQV A;  2HHX A;  5HHH A;  3MDC A;  4J9N A;  3RJE A;  8ICB A;  1ZQH A;  5J2B A;  4GXK A;  5KT3 A;  4RPX A;  4WC4 A;  4DOC A;  5HRI A;  5J2H A;  1SZP A;  4M9J A;  4ATB B;  4GC7 A;  4G3I A;  2IMW P;  4Q45 A;  8ICC A;  8ICR A;  5KFB A;  3RAX A;  4PH5 A;  2ZJ8 A;  3PW2 A;  1S77 D;  3MFI A;  1UT8 A;  4XQ7 A;  1ZQQ A;  4I2D A;  1ZJM A;  1NK9 A;  4FHW A;  1VFG A;  2DR9 A;  4BDP A;  3RJF A;  3EZ5 A;  1DOQ A;  3BJY A;  5KFF A;  4YG2 A;  4TUQ A;  2GWS A;  3PO4 A;  4F5N A;  4DL7 A;  4KLG A;  1TV9 A;  2DPI A;  1XWL A;  4RQ8 A;  2UVV A;  2ZH5 A;  3QE9 Y;  9ICM A;  2ZH7 A;  2ZHA A;  3ZDB A;  7ICP A;  2ZH2 A;  2ZH9 A;  4Q8E A;  3EWA A;  5EWG A;  1ZQA A;  2VA2 A;  5DG9 A;  4UB2 A;  4I2H A;  1Q78 A;  4UAZ A;  1UET A;  4AT7 B;  4F93 B;  1XU4 A;  1UEU A;  5DG7 A;  5KFV A;  1RYS A;  4O5E A;  4QWE A;  4Q44 A;  2V4R A;  3KHL A;  2BQR A;  2W8K A;  1QLN A;  5D49 A;  9ICN A;  5L1J A;  2FMP A;  2C22 A;  4KLU A;  3RAQ A;  1BPY A;  5HRD A;  3ISB A;  2O5A A;  2NRX A;  7ICU A;  2HHU A;  2RDI A;  4QZG A;  4FH3 A;  4B9U A;  4PPX A;  4I2J A;  1V9P A;  5D4B A;  3AU2 A;  4PHA A;  5HRK A;  4AT9 A;  5L9X A;  4I2I A;  4E7X A;  4FHV A;  4BGD A;  5J0R A;  4EBD A;  2O1P A;  1X9M A;  2A1J A;  4ECW A;  4IRD A;  2AJQ A;  5IIM A;  4F4Z A;  2NRV A;  5KFR A;  4UB5 A;  4MEX A;  2PFP A;  2J6U A;  4GXI A;  4F5P A;  3C18 A;  8ICL A;  3BDP A;  2XC9 A;  5KFN A;  3RTV A;  1C7Y A;  4RT3 A;  1KNY A;  1ZQF A;  1ZYQ A;  3T5J A;  4DL6 A;  3TAN A;  3MR5 A;  9ICS A;  3RH4 A;  2BE3 A;  3RR8 A;  3HX0 A;  1T7P A;  2PI5 A;  5KFS A;  4I2G A;  1SKR A;  1SKS A;  2BDP A;  1BPD A;  1Z00 A;  2DR7 A;  3LWL A;  4ECZ A;  4QW9 A;  5KFG A;  2IHM A;  3OVA A;  1TK8 A;  3C1Y A;  7ICE A;  4O3Q A;  3QZ7 A;  1X2I A;  5KFA A;  9ICT A;  1B22 A;  2HHQ A;  2Y1I A;  2ZTE A;  4YR2 A;  4F5O A;  1TVA A;  7ICR A;  1K1S A;  9ICV A;  3WFR E;  5J0T A;  4DQP A;  1ZQR A;  3PR5 B;  2ZUC A;  4J9K A;  3EYZ A;  5DB6 A;  4ED8 A;  4DL5 A;  4K4G A;  4KLM A;  1R8C A;  4J9O A;  8ICY A;  1NK4 A;  7ICI A;  2KN7 A;  3RRG A;  1R8B A;  1RXV A;  4XA5 A;  3MR6 A;  1ZQG A;  8ICW A;  4GC6 A;  3T5H A;  9ICJ A;  5BPC A;  5DBA A;  3PR4 A;  3BQ2 A;  5KFX A;  3V7J A;  4QZC A;  2XGP A;  3TAP A;  8ICS A;  2M2T A;  2M9N A;  4ED2 A;  4R64 A;  3PNC A;  3JPR A;  8ICH A;  4NM2 A;  2I1Q A;  4DS5 A;  3SYZ A;  3UPQ A;  4EP7 A;  4O5K A;  4M5D A;  4WC3 A;  2KP7 A;  5KFT A;  5J2E A;  2IBK A;  1S76 D;  2ZJ5 A;  3C2K A;  7ICJ A;  5J0Q A;  4O3O A;  5KG3 A;  5KFK A;  4B9M A;  7ICS A;  3H7I A;  4YR0 A;  2ZHB A;  4YMN A;  2BHN A;  3HT3 A;  3WFQ E;  1TFY A;  1LB2 B;  1K1Q A;  4JWM A;  3V7K A;  4Z6E A;  5CWR A;  2ZTD A;  4PGQ A;  4DQQ A;  1U47 A;  4IRC A;  7ICM A;  4X0B A;  5KTQ A;  2XCP A;  4B9T A;  4MFF A;  3WFS C;  5CA7 A;  4IG8 A;  3Q8P B;  4J9M A;  3TAQ A;  1R89 A;  3AQN A;  5DBC A;  4P4O A;  1MC8 A;  4YFK A;  5DQH A;  4F92 B;  3MGH A;  4B9N A;  2ZJA A;  4IQW A;  4RT2 A;  5J2C A;  1A77 A;  3M9O B;  9ICQ A;  2W9C A;  1S0V A;  3RB6 A;  3ZD8 A;  5DG8 A;  2BCS A;  4I2A A;  2VAN A;  3C66 A;  2W9B B;  4QZI A;  4P4M A;  3M8S A;  1ZQL A;  5DDM A;  4WC5 A;  3MR2 A;  4RUC A;  1D8L A;  3B0X A;  1BPE A;  2JZB B;  1ZQI A;  2RFF A;  1ARO P;  4J9P A;  2Q66 A;  1NKC A;  4F4K A;  1WCL A;  1NJW A;  2C2R A;  1ZQU A;  4IQT A;  5DLF A;  8ICM A;  2AGO A;  9ICO A;  1BNO A;  4MF8 A;  1QSL A;  1NZP A;  2F1H A;  4QZH A;  3AU6 A;  3MGI A;  2BPC A;  1ZQE A;  3PW5 A;  2ZTC A;  4PHE A;  4RPZ A;  2DVI A;  3SV3 A;  1U45 A;  4DF4 A;  5HRF A;  4X4T A;  4KLJ A;  3RH6 A;  4BWM A;  4UQG A;  3RJH A;  4UB3 A;  1RXW A;  4ELV A;  2P66 A;  1MIY A;  3HW8 A;  4F2S A;  2BKE A;  4JWN A;  5HRL A;  3RBD A;  2UVU A;  9ICU A;  1ZQK A;  4DQS A;  5F2V O;  8ICV A;  9ICW A;  1TFW A;  7ICV A;  1LV5 A;  5J2I A;  4ELU A;  2AQ0 A;  5IIN A;  3ZDA A;  1KFT A;  1B43 A;  2XY6 A;  1BVS A;  5F9L A;  3PO5 A;  2C2D A;  3OVS A;  2H5X A;  4F4X A;  4FBT A;  3MDA A;  4WCW A;  2NRW A;  5KFZ A;  3JPP A;  3RB0 A;  2DRA A;  3TFR A;  4R65 A;  7ICL A;  4QWD A;  4F3O A;  3G6V A;  4C8N A;  2DRB A;  2NRT A;  4RQ5 A;  3Q8L A;  1ZQB A;  2R8H A;  4X4N A;  4EBJ A;  5KFO A;  4X4V A;  3HIY A;  4PGY A;  3N4M B;  2DFL A;  7ICF A;  1VJ7 A;  3THV A;  3TQ1 A;  2XY5 A;  1DK2 A;  3SI8 A;  2LYH A;  2V4Q A;  1U49 A;  4RNM A;  4M04 A;  4RQ1 A;  4C8M A;  2PFN A;  3H39 A;  4AT9 B;  2JEG A;  1UA0 A;  3AQK A;  3ORY A;  3EPI A;  2A1J B;  5KG5 A;  1L3T A;  4YD2 A;  8ICQ A;  8ICU A;  1D9D A;  4KN7 A;  4UB1 A;  1KLN A;  4FHY A;  4WBY A;  3PMN A;  1KFD A;  3LQC B;  1F5A A;  3QEB Z;  3ZDD A;  3PY8 A;  4KLF A;  3M9N B;  9ICP A;  3V6K A;  2HHP A;  5DLG A;  3LWM A;  1NJZ A;  3H8J A;  5IIJ A;  5KFL A;  1ZQW A;  4YMO A;  2HHV A;  4ZH4 A;  4F91 B;  1T3N A;  2HVI A;  3Q8Q B;  2DR8 A;  4JV1 A;  4NLG A;  1ZQY A;  3V6H A;  3UQ0 A;  1D8Y A;  2IA6 A;  5KG0 A;  1JN3 A;  1Z00 B;  3ISD A;  4HYK A;  4BXO A;  3HPO A;  2VA8 A;  1RYR A;  1H38 A;  5DB7 A;  4DEZ A;  5KFM A;  4GLX A;  2ID1 A;  4JV0 A;  4QWA A;  1XSL A;  5DED A;  3GIK A;  4ECQ A;  2R8I A;  3RB4 A;  5DGB A;  5BOL A;  4ED6 A;  8ICO A;  4Z6F A;  4KLO A;  3RR7 A;  1UT5 A;  1V4A A;  4YQW A;  1WOT A;  4YXM A;  4LT6 A;  3OHA A;  2P6R A;  2JEF A;  5IIO A;  4DQR A;  4ECX A;  4QZE A;  3H8S A;  5HP4 A;  2PBE A;  2B21 A;  3OSN A;  3HP6 A;  3C5G A;  3RJI A;  3C2M A;  1L5U A;  1QSY A;  1YLQ A;  4FHP A;  1KRP A;  3GV8 B;  4NLN A;  4KLH A;  4F5Q A;  4DF8 A;  4Q43 A;  1UA1 A;  3B0Y A;  1IXR A;  3GV5 B;  2ASD A;  4DOB A;  4KLT A;  1COO A;  3RBE A;  2FLL A;  4XQ8 A;  4DL3 A;  3N97 B;  4UD4 A;  7ICO A;  4X5V A;  4AT8 A;  1XS9 D;  4FS1 A;  3OGU A;  3QEA Z;  1Z3E B;  4RQ6 A;  4TQS A;  4ECT A;  4X4P A;  4FO6 A;  4BWJ A;  4I29 A;  1JIH A;  4RQ3 A;  2FLP A;  4NY8 A;  4M9H A;  1NO5 A;  4DQI A;  5DQG A;  4ECR A;  2C28 A;  4WC2 A;  8ICP A;  3K75 D;  4YN4 A;  1U9L A;  3OSP A;  3T3F A;  5L1L A;  5CB1 A;  5L1I A;  5J2A A;  9ICI A;  5KG6 A;  1SL1 A;  5J0S A;  4DLE A;  2ASL A;  5EWF A;  4KLS A;  1TAU A;  2WTF A;  4DL4 A;  1ZJN A;  4RQ7 A;  1KDH A;  4KIT B;  5KT7 A;  4IQU A;  1MQ2 A;  4EYH B;  5KFC A;  5KT4 A;  5J2K A;  1ZQP A;  7ICG A;  4ED0 A;  5D46 A;  4P4P A;  1Q79 A;  4P2H A;  2NRK A;  4FHX A;  1XSP A;  4O5C A;  2HHS A;  9ICB A;  2W9M A;  3H3A A;  3OUY A;  3OJS A;  4RU9 A;  2KZM A;  3Q8S B;  3KHG A;  1ZQD A;  3RJJ A;  4YCX A;  4QZA A;  4RQ4 A;  4QZB A;  4DS4 A;  1S0O A;  3RRH A;  1ZQM A;  4K4I A;  4YR3 A;  3JPS A;  3JPT A;  2BCR A;  4KLL A;  5HHI A;  8ICF A;  2W9C B;  2KZZ A;  8ICN A;  1N56 A;  2ZUD A;  2ALZ A;  4IRK A;  4EBK A;  4X4O A;  2ZH4 A;  1SKW A;  2W9A A;  4TQR A;  2DPJ A;  2M2V A;  1JAJ A;  9ICX A;  4EBC A;  5HRE A;  4YD1 A;  4MFC A;  3K4G A;  2ZH3 A;  2KFN A;  3GIM A;  5DGA A;  4CCH A;  5CJ7 A;  3MBY A;  3E2E A;  3GQC A;  5KFI A;  1X9W A;  4RPY A;  1SL0 A;  4EZ9 A;  5J0O A;  3EPG A;  4O3P A;  3SZ2 A;  3PW0 A;  1ZQT A;  2IHN A;  4C8K A;  5HRB A;  9ICF A;  5IIL A;  4RWQ A;  2DR5 A;  4M6W A;  2AGP A;  4KLI A;  1BNP A;  4NKT A;  3BQ1 A;  5KFU A;  3PX6 A;  3HWT A;  5KG1 A;  1L3V A;  3BQ0 A;  4DSF A;  5HR9 A;  4PHD A;  4X4U A;  3ZDC A;  4O3N A;  2XGQ A;  3IHQ B;  2R8J A;  4UD5 A;  4WBZ A;  3UQ2 A;  4X0A A;  3PX0 A;  1UEV A;  2PFO A;  2R8G A;  3GII A;  4MF2 A;  2NRZ A;  4Z6C A;  4F8R A;  3AUO A;  4EBE A;  1D9F A;  5DB8 A;  4X4R A;  8ICI A;  4NLK A;  4RWO A;  1BPB A;  2BR0 A;  9ICA A;  4IR9 A;  4O3S A;  5HRH A;  1MIW A;  3AQM A;  3RB3 A;  4WC1 A;  3G6Y A;  2RDJ A;  1R8A A;  4TUS A;  4XUS A;  4MFA A;  1HJP A;  5KT2 A;  5JUM A;  5EWE A;  2UVR A;  2MAX A;  3C5F A;  8ICJ A;  2PXI A;  4UB4 A;  3RJG A;  4DSI A;  3UXN A;  2ISP A;  2P6U A;  3H4B A;  4JV2 A;  4F5R A;  4EZ6 A;  1QTM A;  1OU5 A;  1NJY A;  9ICC A;  3GDX A;  3PW7 A;  5DEC A;  5KFP A;  4M9N A;  2BPF A;  4J9S A;  4KLE A;  1T8E A;  4I2B A;  3Q8K A;  5CR0 A;  1U4B A;  4RNN A;  4R8U B;  1NK5 A;  4ELT A;  5KFH A;  1A76 A;  5KT5 A;  4YXJ A;  1NKB A;  1JQR A;  5KG4 A;  3HJ4 A;  3FYH A;  1KFS A;  2BGW A;  4IQV A;  4GXJ A;  5DB9 A;  1CEZ A;  2V9W A;  1NOM A;  4B9L A;  4ECY A;  3JZ0 A;  5J2J A;  5TZV A;  2BQ3 A;  4B9S A;  3H8W A;  4R8U A;  1WCN A;  3MAB A;  4DOA A;  1SL2 A;  3PML A;  2FPL A;  7ICT A;  4UAW A;  5KFQ A;  1TFR A;  4I27 A;  4RUA A;  3IM1 A;  4J9Q A;  5CP2 A;  2BCV A;  4ED7 A;  2KFZ A;  1S0M A;  2W8L A;  1MSW D;  3H38 A;  4Z6D A;  4BXO B;  4ATB A;  3NTU A;  4QZ8 A;  4KTQ A;  3G6X A;  4I2E A;  4M47 A;  4WC0 A;  1HUZ A;  3T5L A;  1N48 A;  3OV7 A;  1DK3 A;  4KMU A;  4R63 A;  9ICR A;  4I2C A;  4DFJ A;  3GIJ A;  2OWO A;  3GV7 B;  1S10 A;  2M2U A;  4WC6 A;  2ZH1 A;  4DL2 A;  3ZD9 A;  3PW4 A;  4C8O A;  4TUP A;  3KHH A;  4F50 A;  4TUR A;  2UVW A;  1ZQC A;  4QW8 A;  1TK5 A;  4PHP A;  4RQ2 A;  5HMM A;  4DLG A;  1DGS A;  2PFQ A;  9ICH A;  4M0A A;  3WFP A;  2FMQ A;  4LZG A;  5J0P A;  5KFY A;  1IM4 A;  5BOM A;  3OVB A;  2ZUB A;  1NKE A;  3JPQ A;  7ICK A;  4E8F A;  4ED3 A;  2HHT A;  4QZD A;  1BGX T;  4AT7 A;  4JK1 A;  1U48 A;  1Y88 A;  1MQ3 A;  4QZ9 A;  4AT8 B;  4E0D A;  1ZET A;  2J6T A;  3V72 A;  4E80 A;  1TAQ A;  4DO9 A;  4NLZ A;  1T4G A;  3LDA A;  1JXL A;  4DSL A;  5F9N A;  2BPG A;  4DSK A;  3RH5 A;  3M9M B;  3MFH A;  1CUK A;  4J9R A;  2FPK A;  2I9G A;  3L9D A;  3V7L A;  2KTQ A;  4DFP A;  5HC9 A;  4M9L A;  3C2L A;  5DKW A;  5III A;  4S3N A;  4QZF A;  5HML A;  5HRG A;  1L3S A;  1PZN A;  2JEJ A;  4X4Q A;  5KFE A;  4F4Y A;  1JX4 A;  4LZD A;  4ECU A;  2AQ4 A;  1TK0 A;  3SV4 A;  2BCU A;  3MR3 A;  5EOZ A;  4DFK A;  4MEY A;  5DBB A;  3Q8R B;  3C21 A;  3Q8M A;  1NK8 A;  2HW3 A;  3JPN A;  3LK9 A;  3TAR A;  2F1J A;  4KN4 A;  5DDY A;  1S97 A;  2ISO A;  2J6S A;  5KFD A;  2PI4 A;  1NK7 A;  3OUY B;  2JEI A;  8ICX A;  2XCA A;  3WFO A;  3BQT A;  1TKD A;  4F2R A;  3NGD A;  3NYB A;  4Q8F A;  8ICA A;  5KFJ A;  4O0I A;  1X9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...