4UB5A

Dna polymerase beta substrate complex with a templating cytosine, incoming 8-oxodgtp, and mn2+, 5 s
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
326
structure length
310
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*CP*GP*AP*CP*CP*GP*CP*GP*CP*AP*TP*CP*AP*GP*C)-3'
publication title Uncovering the polymerase-induced cytotoxicity of an oxidized nucleotide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 106
structure length 310
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ub5A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ub5A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ub5A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ub5A03
3GV7B 4ECSA 2PI4A 4KLHA 4JUZA 5KFPA 4O3NA 2PFOA 3TFRA 4YXMA 1K1SA 2V4QA 4KLMA 4DSFA 4M2YA 1MIYA 3PV8A 3ZD8A 2FLPA 3PO5A 5J0UA 1S0NA 5F2VO 3NYBA 1NK7A 4B9SA 3HJ4A 3OVBA 3V6JA 3IHQB 5J2AA 5KFNA 2UVUA 1NOMA 4YVZA 2JEFA 4J9MA 3C2LA 1NJXA 2XC9A 1RPLA 5J29A 4K4HA 4M0AA 4P4OA 7ICVA 1DOQA 5KFEA 2MAXA 5KFFA 4LVSA 2DR9A 4J9NA 2ZH9A 1NJWA 2BPGA 4DWIA 4ED2A 4M6WA 7ICJA 3MGHA 1RXVA 2J6TA 1BPXA 4LZGA 4KLTA 8ICYA 3C66A 4GC7A 4YXJA 2M9NA 4NLNA 4F5OA 4MEYA 8ICXA 4X0BA 2FMPA 2FLLA 4FS2A 4BDPA 5HRFA 3C21A 1ZQNA 1KLNA 3HIYA 3PW5A 5J2HA 4Z6EA 1R8CA 3G6XA 4PH5A 5IIMA 5HNKA 2O5AA 1UT5A 3PVXA 2W9BA 4J9KA 4ED7A 3Q8MA 4FBTA 4UD4A 2ID1A 3Q8RB 2DR5A 4ED0A 4WC6A 3OUYB 2JEJA 3HJ1A 4KLQA 3C2KA 4PGXA 5J0QA 3K75D 4KMUA 3OHBA 1XSNA 4F4ZA 1MIWA 4S3NA 1Z3EB 4TQSA 3BQ0A 5TZVA 3MR5A 3EPIA 4EEYA 3C23A 4KN4A 3ZDCA 1U48A 2OWOA 7ICMA 5CJ7A 9ICCA 1DK3A 3BQTA 5IIJA 2JZBB 2BQUA 1N48A 3T5JA 4RNMA 5J0PA 5KT5A 1MQ2A 2DPJA 2WTFA 4WC4A 5D4BA 4B9VA 3RR8A 5BOMA 1COOA 4YG2A 1ZQQA 3M8SA 3UXOA 3RH4A 1T7PA 3RJJA 3WFSC 3RB4A 4MFAA 4F50A 3GFKB 9ICEA 1ZQHA 4EYHB 1KDHA 1FA0A 5L1LA 3HPOA 1BPEA 1D8LA 4DOAA 4KLJA 9ICHA 3ISBA 2V4RA 3EYZA 2PFNA 3EPGA 3H8JA 1SL1A 1SKWA 2JEGA 4E80A 4O5CA 1X9SA 2R8HA 4Q8EA 5KFOA 3H39A 5HRHA 3OVAA 1CUKA 1TFWA 2UVRA 3FDSA 4Q43A 2C2EA 4O9MA 3GIKA 4BWMA 5KFLA 4C8NA 4QZ8A 2XCPA 3H40A 1AROP 4UD5A 2FPMA 4B9MA 4R8UA 3JPSA 3MR3A 1ZJMA 4RZRA 4QZHA 4M6WB 4NKUA 4RQ1A 3T3FA 3PX6A 1L3TA 2VA2A 4YCXA 4B9TA 4IR1A 2GWSA 3V72A 4GXJA 4DL4A 1MSWD 5IIIA 3ZD9A 3PMLA 3PNCA 4ECUA 4I2JA 1NK5A 4KLSA 1BGXT 2ZUBA 4B9UA 2W8LA 2BQRA 1UA1A 8ICSA 4PHAA 4TURA 1BPYA 4O3SA 4DQIA 5CR0A 2BHNA 5CA7A 4X4VA 4BGDA 4PHPA 3GIMA 7ICGA 4M9GA 8ICWA 2W9BB 4X4TA 1S76D 2DFLA 3OV7A 1JIHA 4F4YA 3N4MB 1TAQA 4RU9A 1ZQGA 4K4GA 3TANA 2ZH4A 1ZQLA 5DB6A 2M2VA 1BVSA 4Q45A 3GQCA 5IIKA 1Z00B 3Q8KA 3RJHA 4YD1A 1X9MA 1ZQIA 4WC3A 4UAWA 4M9LA 2JEIA 2V9WA 4RWQA 1U9LA 1HUOA 4M9NA 4LT6A 1UEVA 4DS4A 1SL0A 7ICHA 2AGQA 2AQ0A 5BOLA 5KFZA 4UB4A 1BPDA 4HYKA 4WC2A 3T5HA 3JPRA 4XA5A 3MR2A 1LV5A 4IRCA 4NY8A 3AQNA 3JYYA 3H8SA 2HHVA 9ICUA 2ZJAA 1ZQXA 5EWEA 4RQ0A 5KFTA 3OUYA 1BNOA 2VANA 5J0XA 3HW8A 2R8GA 4QZDA 3MR6A 8ICGA 1TAUA 2ZTCA 2LYHA 1ZQSA 4TUPA 4ECYA 2HHTA 4RWOA 2ZHBA 1ZQJA 4JWMA 4B9LA 4F93B 4O3RA 4R8UB 3QE9Y 1ZQYA 2ZH8A 4KTQA 3MDAA 3OJUA 4DL3A 4DL5A 2BCSA 4Z6FA 4F91B 4ED8A 5DLGA 2ASLA 3KHLA 4JV2A 4ECRA 4E0DA 5J2FA 2ASDA 1ZQZA 7ICLA 1U45A 2IA6A 2ZTDA 1WCLA 2AGPA 4WC5A 3KHHA 2MUTA 4RUCA 5KG7A 1PZNA 3TQ1A 4M9JA 1VFGA 3JPQA 1NKCA 4Q44A 9ICNA 2ASJA 1T8EA 3JZ0A 1NK4A 2ZUCA 3HT3A 1XC9A 4ELVA 5J2EA 1D8YA 1TFRA 4IQTA 4IQUA 4DO9A 1U49A 1NK0A 3ZDAA 3PW0A 3Q8PB 4F92B 4RQ7A 2VA8A 4DFMA 4IRDA 4MFCA 3OSPA 1NK9A 2ISOA 4DL2A 5J0YA 1XSLA 4FHXA 4FS1A 1WCNA 5KFXA 4EBDA 3UQ0A 1D9DA 2AGOA 2PFPA 2W9CA 4YR0A 7ICRA 5HMLA 3ISDA 5J2CA 1ZYQA 4YMMA 2NRWA 4WC0A 3AQLA 3PR4A 1KSPA 5L1JA 5HREA 3HWTA 3RR7A 1ZQFA 3NGDA 4EP7A 3NTUA 1ZQMA 5HHHA 1XSPA 3TAQA 2FLNA 4NLKA 5J2JA 3C2MA 4ED6A 1ZQPA 4NLZA 1DK2A 1T4GA 4RPZA 4UBBA 3ZDEA 4YFKA 4M9HA 2HHWA 4DFJA 1CEZA 2Y1IA 4KLIA 1ZQKA 5KG6A 9ICWA 5DKWA 5J2GA 5BPCA 3C5GA 3H4BA 4DSKA 1U4BA 2HHQA 7ICQA 1L3VA 5DDYA 1SL2A 3RB3A 2J6SA 1ZQRA 1JQRA 2ZHAA 2ZUDA 4KLGA 2ZH1A 4P4PA 5CWRA 2Q66A 4X4PA 4FH5A 4QZFA 3LK9A 3MABA 5KFRA 1R8BA 3EW9A 4QZIA 4O0IA 1V9PA 4RWNA 3BJYA 5CP2A 4DL7A 1S9FA 4I2HA 1L5UA 1QTMA 4KLOA 7ICOA 4QWDA 2HHXA 2O1PA 2PI5A 4BWJA 9ICAA 4J9OA 2Y1JA 4O3PA 3PW7A 3V6HA 2AQ4A 3RAXA 3SI8A 5DBAA 5KT7A 3T5LA 2KFZA 5KFYA 5J0TA 2BPFA 2XY6A 4X4RA 4KITB 4EBCA 4AT8A 7ICFA 3OHAA 9ICTA 2NRKA 2F1JA 4F5RA 2M2WA 2MUTB 4MEXA 2KTQA 2P6RA 2R8JA 8ICFA 5IIOA 4DSJA 3MFIA 2RDJA 4WBYA 2FPKA 4RPXA 2C28A 3UXPA 4YQWA 1L3SA 4YN4A 4ECWA 4XRHA 1RXWA 3JPOA 4B9NA 4E7XA 8ICIA 4KLDA 4QZEA 3ISCA 3GDXA 1TK5A 5HP4A 4IQWA 3C1ZA 4UB3A 2BE3A 3RJGA 9ICJA 4F5PA 4O5EA 1NKEA 2UVVA 3PY8A 4BXOA 2W9CB 1ZETA 4Q8FA 8ICPA 1S0VA 4RQ8A 3UPQA 5IINA 4E8FA 4DFPA 1YLQA 4DL6A 8ICHA 4EBKA 5J0OA 2VA3A 4MF2A 4QW9A 5DBCA 3V7JA 4TUSA 3MFHA 4G3IA 5HRGA 3KHGA 2W8KA 3M9NB 5KG2A 4YMNA 4DQRA 1TKDA 1DGSA 4ECTA 5J2KA 4QZCA 3RB0A 1BNPA 1RZTA 3RTVA 4I2GA 4F8RA 4GLXA 1Q78A 4AT7A 5KTQA 3OGUA 3PW4A 2F1IA 4DOBA 2RDIA 1A76A 2BDPA 2W9MA 4C8MA 4RPYA 9ICBA 1S0OA 3AQKA 4J9RA 5J2IA 2A1JA 4KLLA 4IR9A 2M2UA 4RT2A 5HRLA 7ICKA 2I9GA 1A77A 5EWGA 5J0RA 3HP6A 1MQ3A 4PPXA 3LWMA 4NM2A 5KFGA 3T5KA 4CCHA 5IILA 4RT3A 1TK8A 5C5JA 2BCRA 4ELTA 4P2HA 2NRZA 3RBDA 2ISPA 1N56A 8ICTA 2NRTA 7ICUA 2KZ3A 5EWFA 2ZH5A 1Y88A 4QZ9A 4TUQA 5DGAA 4RQ4A 4EBEA 9ICGA 4AT8B 7ICNA 3K4GA 4PGYA 2HHUA 4YR3A 2KFNA 1X2IA 3G6YA 4KLFA 1RYSA 3THVA 3GV5B 8ICKA 5DG9A 1UA0A 4FHPA 2ZH6A 4X4NA 4XUSA 4KLUA 3JPPA 3WFQE 3PX4A 3RJFA 4RQ6A 4GXKA 3RRGA 4C8OA 4MFFA 3B0YA 4RUAA 2C2DA 1JX4A 4M04A 5KT6A 4RQ5A 2ZTEA 7ICIA 4ELUA 1EXNA 8ICBA 2IHNA 4IQVA 4O5KA 5KFVA 5DG8A 1HJPA 5DB8A 3Q8QB 5DQIA 1BPBA 1S0MA 1RYRA 1QSSA 4BXOB 7ICPA 3LQCB 5KG1A 1XU4A 1KTQA 5DGBA 3GIJA 5DECA 4ECZA 7ICSA 5HRKA 4QZAA 1H38A 8ICLA 3GIIA 2UVWA 4YMOA 4X4QA 1OU5A 4IG8A 4DQQA 5KFSA 2BCQA 3V7LA 5KFCA 9ICKA 5DBBA 4M5DA 3M9MB 4AT7B 2DRAA 5L1KA 5J2BA 3ETLA 1ZQAA 2XCAA 4FO6A 4GXIA 1ZQDA 3OVSA 3GILA 3EZ5A 5DLFA 4DSLA 9ICOA 3PR5B 4DQPA 3AU6A 2DR7A 3H7IA 2A1JB 4NM1A 5J2DA 3H4DA 3LDAA 3RBEA 1ZQUA 3PO4A 3TAPA 4I2BA 3SV4A 3AQMA 4DLEA 2XGPA 4UB2A 4R64A 1NJZA 2ALZA 4QWBA 5KFDA 3KTQA 4DEZA 3RJIA 4F4WA 2DPIA 9ICMA 1TFYA 3MDCA 4AT9A 9ICXA 3E2EA 3L9DA 2C22A 3BQ2A 2AJQA 4PHDA 4X4OA 1D9FA 3ZDBA 2HVHA 8ICJA 2XGQA 1KNYA 4FHVA 4NKTA 3TARA 5KG0A 2F1HA 1XS9D 4KLEA 1VJ7A 4J9QA 3QZ8A 2BCVA 4DSIA 2ZH3A 1KFDA 4ECQA 1JMSA 2H5XA 3M8RA 5CHGA 4DLGA 2KZZA 5HMMA 4J9LA 5KFKA 3AU2A 3RJKA 3V6KA 4J9PA 4QZBA 4TQRA 3Q8LA 1ZQTA 5KT4A 5KFBA 4GC6A 2Q0ZX 4DF4A 4F3OA 5KFMA 5DB7A 4EYIB 4IRKA 4RWPA 2FMSA 5D49A 3OSNA 5HRBA 3M9OB 2ZJ5A 1KEJA 5HC9A 4QWEA 1WOTA 4PGQA 4R63A 4DOCA 3N97B 2DRBA 3TI0A 8ICEA 2R8IA 4ATBA 3JPTA 4I2EA 4F2SA 4F5QA 2BR0A 9ICLA 4NXZA 4X5VA 2ZJ8A 2FMQA 3ORYA 1PX5A 4WC1A 2J6UA 1SKRA 3BQ1A 9ICFA 2BKEA 3SV3A 1QLNA 5F9NA 3RAQA 8ICNA 3B0XA 4JV0A 1NK8A 2P66A 3RRHA 3BDPA 4K4IA 4RQ3A 2M2TA 1Q79A 3KHRA 4ECXA 2ZH2A 4P4MA 4R66A 4I28A 1JN3A 1TVAA 4NLGA 3MGIA 1F5AA 4YP3A 2IMWP 4I27A 3H3AA 1K1QA 2PFQA 3C18A 4RQ2A 3C1YA 4I2CA 4YR2A 2HVIA 4ED1A 3PMNA 7ICTA 5HRIA 9ICIA 2P6UA 2HHPA 4AT9B 4QW8A 2KP7A 3WFOA 4Z6DA 5DDMA 3C5FA 4F5NA 5KFJA 4DFKA 1XWLA 2XY7A 1QSYA 1MIVA 1R89A 8ICOA 2ZH7A 4I2AA 5KG5A 3FYHA 1XO1A 4PHEA 2HW3A 1UEUA 3H37A 4X4SA 1NK6A 1ZQCA 3ZDDA 4ZH4A 2I1QA 5KFHA 4DQSA 2KZMA 8ICCA 4JK1A 4DSEA 8ICMA 5KT3A 2W9AA 3IM1A 3MBYA 1ZQWA 5D46A 3QEBZ 3H8WA 1S77D 4UAYA 4QWCA 1V4AA 4I2IA 9ICVA 4EBJA 4F2RA 4WCWA 2AU0A 2NRXA 4C8LA 4M47A 3LWLA 5DEDA 4MF8A 1Z00A 5DG7A 4X4UA 3RH6A 1ZJNA 2BQ3A 1TV9A 1JXLA 3H38A 4I2DA 3JPNA 2IHMA 1NZPA 4R65A 2XO7A 5KFQA 1ZQBA 8ICRA 5HR9A 3QZ7A 3Q8SB 4ATBB 7ICEA 4DF8A 3RH5A 1IM4A 1T3NA 1UETA 4FHWA 2FPLA 5KFWA 5KFAA 1QSLA 3G6VA 4C8KA 1UT8A 2PXIA 1L3UA 1KFSA 1KRPA 9ICSA 8ICZA 4Z6CA 2PBEA 3PW2A 5DB9A 3AUOA 1TK0A 4UBCA 1ZQOA 4FHYA 1JXEA 4LZDA 4XQ7A 5HHIA 3TFSA 3UXNA 5DQGA 2KN7A 2IBKA 4YD2A 9ICRA 1NO5A 4EZ9A 1U47A 2C2RA 4RNOA 4EZ6A 2HHSA 4WBZA 2DR8A 3WFPA 5F9LA 8ICUA 2BGWA 2BCUA 1BPZA 1R8AA 1NKBA 5KT2A 3OJSA 3GV8B 9ICPA 4WC7A 1IXRA 4X0AA 5JUMA 3PX0A 5KFUA 2RFFA 4FBUA 1B22A 3SYZA 2R8KA 5CB1A 5L1IA 4FH3A 1S97A 4KN7A 3SZ2A 3EWAA 3UPSA 1JAJA 1NJYA 4UQGA 5J0SA 2NRVA 4UB1A 4QWAA 3V7KA 4F4KA 3QEAZ 5KG3A 5KFIA 5DQHA 4QZGA 4UAZA 8ICVA 4I29A 1X9WA 4DS5A 4ECVA 9ICQA 2B21A 1SKSA 4JV1A 1HUZA 1KFTA 5J0WA 4RNNA 1LB2B 8ICQA 4O3OA 3RB6A 8ICAA 4O3QA 2ATLA 1B43A 1S10A 1ZQVA 5L9XA 4UB5A 2JZBA 3HX0A 3WFRE 5HRDA 4I2FA 4JWNA 2XY5A 1MC8A 1SZPA 4XQ8A 3UQ2A 1ZQEA 3RJEA 2DVIA 4F4XA 4J9SA 5EOZA 4ED3A 5KG4A 2BPCA 1C7YA
chains in the Genus database with same CATH superfamily
3GV7B 4KLHA 3NVWA 4YXMA 4KLMA 4M2YA 3PV8A 1KL9A 3WK5A 3OVBA 3IHQB 2UVUA 2YB4A 2KEYA 4FZNA 1NJXA 5J29A 1DOQA 2MAXA 5KFFA 4LVSA 4J9NA 1MN8A 2ZH9A 1NJWA 4CNQA 4ED2A 4M6WA 7ICJA 2W43A 4AYBF 2J6TA 4LZGA 4GC7A 3T79A 4NLNA 1L7NA 3C21A 1ZQNA 1KLNA 3HIYA 3PW5A 1R8CA 3PVXA 2W9BA 4HX0A 5ALPA 2ID1A 4PGXA 5J0QA 4KMUA 5ALDA 3TADA 9ICCA 3BQTA 2JZBB 2DF4B 3T5JA 4RNMA 2DPJA 3KKAC 4B9VA 5BOMA 3M8SA 4NLCA 9ICEA 1ZQHA 4EYHB 1KDHA 5L1LA 5ALLA 2PFNA 4E80A 3WU2U 3BS5B 4O5CA 1X9SA 1YZ6A 3QUCA 1Q3VA 2UVRA 3FDSA 4Q43A 2C2EA 4UATA 5KFLA 5AM5A 4HAIA 1ZJMA 2F77X 4QZHA 4M6WB 1V85A 3KZXA 1L3TA 2VA2A 4O3MA 2GWSA 1MSWD 3ZD9A 1NK5A 4EX7A 4KLSA 5KAFU 4PHAA 4O3SA 1JROA 3KZIU 1N5XA 1SWWA 2HOFA 4M9GA 2W9BB 1S76D 3OV7A 4F4YA 4K4GA 4RU9A 5HR6A 4PL1A 1BVSA 4YD1A 1QH9A 5AI6A 4UARA 4UAWA 2H3VA 2D8CA 2AH5A 4O69A 5AIBA 1SL0A 2AQ0A 4UB4A 5KFZA 3IP4B 3JYYA 3AQNA 5EWEA 5KFTA 5ALOA 1X42A 3HRDD 4QIWF 1JRPA 3GZFA 2R8GA 1TAUA 4ECYA 4RWOA 1ZQJA 5D62A 4FE3A 4QJFB 2ZH8A 4JV2A 5DLGA 3KHLA 3WK9A 4E0DA 1NNLA 7ICLA 2AHOB 2F76X 4WC5A 1VFGA 1NKCA 2ASJA 1T8EA 4ELVA 5J2EA 1TFRA 4IQTA 1NK0A 4F92B 4DFMA 2LBOA 1NK9A 2ISOA 2A3VA 4EBDA 4YR0A 5J2CA 5ALMA 2LI6A 3NGDA 4EP7A 2K4IA 1XSPA 5J2JA 3ZDEA 4YFKA 2OYYA 1N62A 1Z4OA 1ZQKA 5KG6A 5DKWA 1S8OA 1U4BA 1L3VA 4KLGA 2DR9A 5KFRA 1R8BA 4QZIA 1L8LA 4I2HA 2YB1A 2HHXA 9ICAA 4O3PA 1IIPA 3WK8A 3V6HA 3SI8A 5DBAA 2MA1A 2HBKA 4EBCA 4AT8A 3QUQA 5KNIA 2N1RA 4F5RA 2P6RA 2PKEA 8ICFA 3MFIA 4O6AA 1L3SA 4YN4A 4B9NA 3JPOA 4KLDA 5F3XB 2KOBA 2BE3A 3PY8A 8ICPA 1Z4NA 2GH1A 5IINA 1YLQA 4DL6A 4EBKA 5B5EU 4QW9A 3MFHA 4RQMA 1P7DA 4DQRA 4ECTA 4QZCA 1RZTA 4I2GA 1Q78A 2WAQC 3L3FX 3PW4A 2H3QA 2F1IA 4DOBA 3N7RC 2W9MA 3AQKA 4J9RA 5J2IA 4KM5A 1SXDA 2M2UA 2I9GA 1A77A 4U6PA 3LWMA 3T5KA 2LKYA 4B6JA 1KBUA 2BCRA 4ELTA 2KV2A 2KZ3A 3JCFA 2HDOA 1Y88A 1AQ6A 9ICGA 4AT8B 3NVOA 3K4GA 4YR3A 3G6YA 4KLFA 4WQLA 1F5SA 4FHPA 3GV5B 4K96A 5B3PA 2IUBA 3WFQE 5TISU 3PX4A 3RJFA 3RRGA 2C2DA 4LEVA 5KT6A 2ZTEA 5AM0A 4ELUA 2IHNA 5KFVA 5DG8A 5DB8A 3Q8QB 1BPBA 3LQCB 1KTQA 2ZIUA 7ICSA 1SV0C 4QZAA 4X4QA 4IG8A 2F8KA 4AP9A 4EEBA 4M5DA 5DBBA 4GXIA 2K4HA 3GILA 1PK3A 5DLFA 2DR7A 3AU6A 4NM1A 5J2DA 2DKXA 1SIJA 1ZQUA 4I2BA 4Y2RA 4UB2A 1N63A 1SZHA 2ALZA 2O6KA 5ALIA 2YY6A 3QU4A 2E8NA 2MRLA 3BQ2A 2YX8A 1KNYA 1IV8A 3QUBA 3TARA 2B51A 2ZIVA 2KIWA 1Q46A 2F1HA 3FM9A 5EE0A 2ZH3A 1KFDA 5CFUA 1JMSA 2WHEA 4DLGA 5KFKA 3RJKA 3V6KA 4GC6A 5KT4A 1VLBA 1CRXA 3OSNA 3M9OB 2PMZF 2R8IA 3JPTA 4G9BA 9ICLA 3WKDA 5H2FU 1PX5A 4WC1A 2J6UA 1SKRA 1DRGA 3B0XA 3RRHA 3BDPA 1FFUA 4FZMA 1Q79A 2ZH2A 4P4MA 4AYBC 5EE9A 4YP3A 2PFQA 2ESEA 4WQKA 3PMNA 7ICTA 9ICIA 2WF9A 4DFKA 1MIVA 3IG8A 3FYHA 1XO1A 2ZIVB 3NVVA 1NK6A 3CYMA 3ZDDA 4ZH4A 8ICCA 5KT3A 3L5KA 4EBJA 4F2RA 4OJ6A 4C7ZA 3B9JA 5AI4A 3LWLA 3MC1A 1TV9A 4KX5A 2XIDA 1ZQBA 4P0PA 2JH1A 4UAUA 2KMDA 1UETA 3GU3A 2K60A 5KFAA 9ICSA 1KFSA 2PXIA 1URJA 8ICZA 1XNSA 5DB9A 3AUOA 1ZQOA 2FCLA 4OAFA 1JXEA 2Z7JA 1L8OA 1NO5A 4EZ9A 4EZ6A 3J81j 1SXEA 8ICUA 3DEEA 2ZIXA 2BGWA 4ZOHC 3HKZC 5KAIU 1R8AA 5KT2A 2KICA 3A0HU 2EDUA 1IXRA 3KFUF 4X0AA 5JUMA 4CF4A 5KFUA 4CDGA 4FBUA 1B22A 2QLTA 5L1IA 4FH3A 1B0XA 4A8EA 2I6XA 5KFIA 5DQHA 4QZGA 4UAZA 4N7RA 9ICQA 1N61A 2Q4TA 1HUZA 2H3ZA 2W54A 4O3QA 2ATLA 1B43A 3HX0A 4UB5A 4UAVA 5JTIA 5HRDA 4I2FA 2KKPA 5EOZA 2BPCA 1C7YA 4ECSA 2PI4A 4JUZA 1DGJA 5KFPA 4O3NA 3R9KA 4P0PB 1K1SA 2QARA 3ZD8A 5J0UA 1S0NA 1SB3C 1A6SA 3HJ4A 3VC8A 3QU7A 4CF5A 4C80A 4QIWC 5ALWA 4YVZA 2JEFA 2XC9A 1ZQ1C 2BPGA 2W7PA 4K9AA 8ICYA 4YXJA 2ZIXB 2FLLA 4BDPA 5HRFA 2ZIWA 2NV3A 5J2HA 4WJ3B 2O5AA 4NV0A 3HILA 3Q8MA 3Q8RB 3EF2A 3N7PD 3OUYB 3HJ1A 4KLQA 2QB0A 1MIWA 4K99A 4S3NA 3EPIA 3C23A 1U48A 5IIJA 2BQUA 5D4BA 1ZQQA 4YG2A 3UXOA 3RH4A 1O03A 3RB4A 2A1AA 1CI4A 4KLJA 1D8LA 4C4RA 2QARB 1SL1A 1SKWA 3CK6A 4Q8EA 5KFOA 3OVAA 1CUKA 2G06A 4O9MA 4QZ8A 2XCPA 1AROP 1WG8A 4B9MA 3JPSA 3MR3A 2F3NA 1QQ6A 4DL4A 5ALGA 3PNCA 1KQQA 2GAFD 1NI3A 1VDVA 4TURA 2LMRA 5CR0A 2BHNA 2CRXA 7ICGA 8ICWA 2F8LA 1YZ7A 3N4MB 1TAQA 3F5EA 2VIXA 2QB0B 3D2QA 5ALZA 4Q45A 3OTQA 1Z00B 5J8YA 3Q8KA 1ZQIA 2YN4A 2JEIA 2KHVA 1UEVA 1NZBA 4Y2SA 7ICHA 2AGQA 2XVTA 1BPDA 4WC2A 3T5HA 2IOFK 5AI9A 3JPRA 1LV5A 5AKLA 3H8SA 9ICUA 2ZJAA 1ZQXA 4RQ0A 4JMUA 4K98A 8ICGA 3MR6A 4TUPA 4F93B 4O3RA 2M0NA 3QE9Y 2YTUA 3MDAA 3F2DA 3OJUA 4GFJA 4NXTA 4Z6FA 2ASLA 3N7SC 2ASDA 2IA6A 1WCLA 2AGPA 4JB3A 3BS5A 4RUCA 3TQ1A 3PZPA 3JZ0A 3ZDAA 1QLNA 2KVCA 3M7DA 4DCCA 3OSPA 5ALUA 2HSZA 5KFXA 3UQ0A 2PFPA 2W9CA 5JTGA 1ZYQA 3AQLA 5HREA 1ZQFA 5HHHA 2GO7A 2FLNA 1ZQPA 1C20A 1T4GA 2HHWA 2KIVA 3NUQA 4DFJA 2Y1IA 9ICWA 5J2GA 5BPCA 4MHVA 2HHQA 2JV3A 7ICQA 2JMGA 1JQRA 2ZUDA 3D2NA 2ZH1A 4P4PA 5AM3A 5CWRA 3AMZA 2Q66A 4FH5A 3LK9A 4RWNA 3MABA 3BJYA 1S9FA 7ICOA 4KLOA 1RYUA 2O1PA 4BWJA 4J9OA 3ER8C 1SGGA 2D3DA 3T5LA 2XY6A 7ICFA 3OHAA 2NRKA 2F1JA 2M2WA 4QNLA 2EAPA 3VCBA 5AKJA 4WBYA 3C28A 2OHFA 3IV6A 3UXPA 4E7XA 1RXWA 5A0LA 3KKAA 3ISCA 3GDXA 3WK7A 3RJGA 1F44A 4O5EA 9ICJA 2R18A 4BXOA 2W9CB 2VJ4A 3ALRA 3UPQA 3H0RB 3ONNA 2PMZC 8ICHA 5J0OA 5DBCA 4G3IA 3KHGA 1PUZA 4F71A 3D2SA 1TKDA 4NWIA 4F8RA 4GLXA 4CF3A 2RDIA 4RPYA 9ICBA 4NXVA 2A1JA 3N28A 1MQ3A 2EAOA 4CCHA 4RT3A 5C5JA 1RG6A 4Y2PA 4PZNA 2ISPA 1N56A 2ZH5A 5DGAA 4EBEA 2HHUA 2E8PA 5L1MA 2RQ5A 3THVA 5DG9A 4XUSA 2HOIA 1ZD4A 4GXKA 3B0YA 4RUAA 2B4VA 4P0QB 1JX4A 4M04A 4LEWA 4RQ5A 8ICBA 4IQVA 2F2AB 5DQIA 1S0MA 1RYRA 4BXOB 7ICPA 4NL9C 5KG1A 1XU4A 5DECA 5DGBA 3GIJA 4ECZA 2DWQA 8ICLA 3GIIA 1OU5A 4DQQA 5KFSA 3V7LA 3QYPA 4FO6A 1ZQDA 1FFVA 5E79U 4OJPA 3H7IA 2A1JB 2VJ5A 3RBEA 3LDAA 2YMMA 3D6JA 3TAPA 3UMBA 4DLEA 2XGPA 3O0FA 4R64A 5AKYA 5KFDA 9ICMA 4AT9A 9ICXA 3E2EA 3L9DA 1KN5A 3ZDBA 8ICJA 4NKTA 1XS9D 1MA7A 3QZ8A 4DSIA 5CHGA 5HMMA 4J9LA 3AU2A 2KE7A 3Q8LA 1WYGA 5KFBA 2FMSA 2BDUA 2ZJ5A 5HC9A 4PGQA 3N97B 3AQFA 3TI0A 1JUDA 4ATBA 4F5QA 2FMQA 1UQVA 2WB1F 5FP0A 3PSIA 4OAIZ 2ZXHA 5AK6A 2P66A 4Y2YA 4PJ0U 4R66A 4K8VA 2KJ8A 5CEHA 2IMWP 4I27A 3H3AA 1K1QA 3SAFA 4I2CA 4YR2A 2HVIA 5ALTA 4AT9B 1OUQA 3WFOA 5KFJA 3WKCA 1R89A 4LEYA 3K1ZA 5AHXA 2OH2A 3SD7A 2K89A 1ZQCA 4DQSA 2KZMA 1OW5A 3MBYA 5D46A 1S77D 4UAYA 4QWCA 5AKZA 3PSPA 1X40A 3WK4A 2IHMA 3JPNA 4R65A 5KFQA 1ZD2P 2EANA 4ATBB 7ICEA 3RH5A 2IOHA 5KFWA 3QU9A 1QSLA 3E58A 1L3UA 4OO1J 2EWRA 5ALRA 2QB1A 1JI7A 2MU2A 2BZFA 4FHYA 1O08A 4F72A 4CE6A 4O68A 5AM2A 5HHIA 2HBLA 3UXNA 2F44A 4WBZA 4NXUA 2W3RA 3WFPA 2I5HA 3S6JA 5F9LA 3AL0B 1BPZA 3OJSA 3GV8B 9ICPA 2B0CA 2R8KA 1S97A 3SZ2A 1ZXIA 3NKUA 3UPSA 4Y2QA 4UB1A 4QWAA 3BQ7A 1X9WA 4OAHA 4DS5A 2LPEA 3QX7A 5J0WA 4RNNA 1KFTA 2KSOA 4O3OA 1ZQVA 4GIBA 1T3QA 3EUB2 1SV0A 3SR6A 3RFAA 1MC8A 2XY5A 4XQ8A 2DVIA 4C4SA 4ED3A 5EWGA 3ER9B 2NO5A 2PFOA 1QCKA 2V4QA 4DSFA 1MIYA 3PO5A 3NYBA 1NK7A 3V6JA 1NOMA 1Q8KA 4IC9A 1RPLA 4P4OA 5KFEA 4Y2XA 4DWIA 1KKXA 8ICXA 4X0BA 2FMPA 1Z1BA 2DKZA 2G0AA 4Z6EA 3G6XA 1RDFA 4PH5A 1UT5A 4WH5A 4J9KA 2DR5A 3C2KA 4F4ZA 4C7YA 1Z3EB 3ZDCA 5TZVA 2KSOB 4ICAA 2OWOA 5CJ7A 1DK3A 1N48A 2KK0A 5KT5A 3RR8A 1COOA 2FJ6A 1T7PA 3RJJA 3WFSC 2E1FA 2YMQA 5AI8A 4MFAA 3GFKB 1PVPA 3HPOA 1BPEA 3ISBA 2JEGA 4OJ5A 2HBMA 3H39A 5HRHA 1TFWA 2Y0SF 4BWMA 2EZZA 4C8NA 1HIWA 3H40A 4NKUA 3PX6A 4GXJA 4OCZA 5IIIA 3WK6A 1BGXT 2HCFA 2ZUBA 2W8LA 2BQRA 3CW2C 8ICSA 4U7CA 2JH7A 2RP5A 5AIAA 3KD3A 2G5HB 5AKIA 4X4VA 4WOYA 4BGDA 3GIMA 4X4TA 2DFLA 1ZQGA 2GLEA 4LEZA 2ZH4A 1ZQLA 2M2VA 5IIKA 3M6KA 3RJHA 1X9MA 4WC3A 5ALXA 4M9LA 2K8AA 2V9WA 4RWQA 1U9LA 4M9NA 3KBBA 3TACB 4LT6A 1DXSA 2Y9UA 5BOLA 4EENA 4IRCA 4NY8A 2JHDA 2HHVA 5AK3A 3OUYA 5AK4A 1BNOA 2VANA 5J0XA 4QZDA 2HHTA 4BX9C 4B9LA 3NRZA 3AEVA 1ZQYA 3IG5A 4KTQA 4K97A 1VJ5A 1D8BA 1X9XA 4DL5A 2BCSA 4F91B 4ECRA 3WKAA 1ZQZA 1U45A 4OJOA 4Y2JA 3KHHA 4M9JA 3JPQA 9ICNA 1NK4A 2ZUCA 2YMPA 1XC9A 3ED5A 1D8YA 2G07A 4IQUA 1U49A 3Q8PB 4RQ7A 2VA8A 4MFCA 5B3QA 4RQNA 4FS1A 1WCNA 1D9DA 7ICRA 3ISDA 2WFAA 3PR4A 3HWTA 3NTUA 1ZQMA 5AKGA 4ED6A 1DK2A 4RPZA 4M9HA 4FO1A 1CEZA 4KLIA 1QQ7A 3C5GA 3AQEA 4DSKA 1QQ5A 2J6SA 1ZQRA 2ZHAA 2K4EA 4X4PA 4QZFA 1V9PA 1IG6A 5G5GA 3H0LB 5CP2A 3QU2A 4DL7A 1L5UA 1QTMA 4QWDA 2PI5A 2E1EA 2HBJA 2KFZA 5J0TA 2BPFA 4FZLA 1ZRMA 4JLZA 2Y9TA 4MEXA 2KTQA 3BS7A 2R8JA 5IIOA 2RDJA 1OXJA 2C28A 4YQWA 4ECWA 4XRHA 3I28A 1L6NA 1TK5A 5HP4A 4IQWA 3C1ZA 4F5PA 3C29A 4LJXA 1S0VA 4E8FA 3V7JA 2LYBA 5CFSA 2W8KA 4BUGA 3L4PA 5KG2A 4YMNA 3RB0A 2WF8A 3K1RB 1BNPA 5GTIU 4AT7A 2WF6A 5KTQA 1B4FA 4EGWA 2IHOA 4C8MA 1S0OA 4KLLA 2KVSA 4RT2A 5HRLA 5D61A 4PPXA 5J0RA 3HP6A 2LYAA 5CRXA 5KFGA 1TK8A 4P2HA 5AICA 2NRZA 8ICTA 5EWFA 2B56A 4TUQA 7ICNA 2KFNA 1X2IA 1N2XA 8ICKA 1UA0A 2ZH6A 5AKXA 4X4NA 4KLUA 1S5LU 4RQ6A 3LVWA 4C8OA 4MFFA 5AK5A 2KNJA 7ICIA 1Q3UA 2LM4A 3NVZA 3F53A 1ZD3A 2K8CB 3SENA 4US9A 5HRKA 2H3FA 1H38A 3ETRA 2UVWA 5ALQA 4YMOA 2MSNA 2BCQA 2DRAA 3M9MB 4AT7B 5L1KA 5D63A 1ZQAA 2XCAA 9ICOA 4DSLA 2KKVA 4DQPA 1YT3A 3PO4A 3SV4A 3AQMA 2AXTU 3KTQA 3RJIA 1TFYA 5KL1B 1Z1VA 2C22A 2XICA 4C4TA 4PHDA 1D9FA 2HVHA 3K7DA 4CRXA 5KG0A 4ECQA 2H5XA 3M8RA 4J9PA 3KOOA 4QZBA 4TQRA 1ECWA 1ZQTA 2ZG6A 2Q0ZX 5DB7A 4EYIB 4UB6U 4RWPA 5D49A 3TKAA 1KEJA 5G5HA 4R63A 3TADC 4DOCA 2DRBA 8ICEA 5HR7A 4NXZA 4X5VA 2ZJ8A 3I1YA 2W03A 2BKEA 3SV3A 3H0MB 5F9NA 5AKHA 1GO3F 3PSTA 2M2TA 2HN2A 3KHRA 4P0QA 1JN3A 1TVAA 4NLGA 3MGIA 1F5AA 5ALSA 2RLTA 4RQ2A 2W55A 3C1YA 1J97A 3LYSA 2ODGA 2OEHA 1LVHA 2HHPA 3QXGA 4QW8A 2KP7A 4Z6DA 5DDMA 3C5FA 2XY7A 4USAA 1XWLA 1QSYA 8ICOA 3PHZA 2ZH7A 5KG5A 4PHEA 2HW3A 3H37A 2HN1A 3IM1A 3QEBZ 3SAHA 1V4AA 4I2IA 4WCWA 1KW4A 3PSFA 2NRXA 4IS7A 4C8LA 5DG7A 3HKZF 3RH6A 4X4UA 1ZJNA 4UW9A 3H38A 4I2DA 2EQYA 8ICRA 3Q8SB 1IM4A 4FHWA 2NYVA 3AN1A 2FPLA 4MKPA 2JXJA 3MCRA 4C8KA 1UT8A 1KRPA 4EEKA 1GPJA 3A0BU 4Z6CA 1L7PA 1PVRA 2Y0SC 2LHTA 4EV6A 5C0YA 4LZDA 4XQ7A 2W7OA 2IBKA 2BBJA 4K9BA 2C2RA 4RNOA 2DR8A 2YQEA 2FI1A 2BCUA 2KG5A 1NKBA 4WC7A 3QU5A 3PX0A 2RFFA 3SYZA 3HJEA 2OCEA 2DL0A 5J0SA 2NRVA 4UQGA 4F4KA 3ICXA 3QEAZ 8ICVA 4I29A 2FDRA 4ECVA 2B21A 3M6ZA 4I0UA 5EE1A 1LB2B 5K4LA 3RB6A 4NL9A 3SQIA 2DQNB 5L9XA 3ERCC 2E8OA 5ALFA 4JWNA 1SZPA 1ZQEA 4F4XA 4J9SA 5HNKA 1FEZA 2RRDA 5ALJA 2RHFA 3TFRA 1SWVA 2FLPA 5F2VO 2EAMA 2EZYA 4B9SA 5J2AA 5KFNA 5ALHA 3C2LA 4J9MA 2HOQA 4K4HA 4M0AA 7ICVA 4JLXA 3MGHA 1RXVA 1TAMA 4EELA 1BPXA 4KLTA 3C66A 1ED1A 2M9NA 2EH9A 4F5OA 4MEYA 4FS2A 1UHUA 2CN1A 2WF5A 5IIMA 2ZXIA 3QNMA 4BJQA 1WWUA 4ED7A 4FBTA 4UD4A 4ED0A 4WC6A 2JEJA 1JALA 2QKQA 3K75D 3OHBA 1XSNA 2KJ5A 2W3SA 4TQSA 3BQ0A 4EEYA 3MR5A 4KN4A 2IOFA 7ICMA 1ZOLA 5J0PA 1MQ2A 4EEDA 2WTFA 4WC4A 5ALNA 3SAGA 4F50A 3IRUA 1FA0A 4DOAA 3FAHA 3UMGA 3EYZA 2V4RA 9ICHA 3EPGA 3H8JA 2R8HA 1X66A 2B6GA 1K5OA 3GIKA 4UD5A 1WWVA 2FPMA 4R8UA 4RZRA 2E8MA 4IL6U 4RQ1A 3T3FA 4YCXA 4B9TA 4IR1A 3V72A 3PMLA 4ECUA 4I2JA 4B9UA 4FFDA 1UA1A 1N60A 1BPYA 1V38A 4DFDA 5CA7A 4DQIA 4PHPA 3UM9A 3F5AA 1JIHA 3TANA 5DB6A 3GQCA 3SMVA 2G09A 3SEIA 1LKYA 1RQLA 1HUOA 3WKBA 4DS4A 1PVQA 3CRXA 4KX3A 4HYKA 5AI0A 4XA5A 3MR2A 2WF7A 4Y2VA 1A0PA 2ES6A 2JGAA 3HW8A 4EX6A 2ZTCA 2LYHA 1ZQSA 2ZHBA 4JWMA 4R8UB 5T14A 4OD0A 4DL3A 4US8A 4O67A 4ED8A 5GTHU 5CHEA 5J2FA 5ALEA 2ZTDA 2MUTA 5KG7A 1PZNA 4Q44A 2W11A 4C0ZA 5JU5A 3HT3A 4DO9A 3PW0A 4IRDA 4DL2A 5J0YA 1XSLA 4FHXA 2AGOA 1LKYB 5HMLA 3CP8A 4YMMA 2NRWA 4WC0A 1KSPA 2HMXA 5L1JA 3RR7A 1L7OA 1SV4A 3TAQA 4NLKA 3C2MA 2P35A 4NLZA 1UCVA 4UBBA 3UMCA 4KB6A 3H4BA 1WUDA 2GOLA 5DDYA 1SL2A 1L7MA 3RB3A 1X6JA 3EW9A 4O0IA 4PL2A 2Y1JA 2XI9A 2H3IA 3PW7A 2AQ4A 3RAXA 2ZIUB 5KT7A 5KFYA 4X4RA 4KITB 4NLBA 9ICTA 1J2MA 2MUTB 4DSJA 2FPKA 4RPXA 3NS1A 1T94A 3DV9A 8ICIA 4QZEA 4UB3A 1NKEA 2UVVA 1ZETA 4Q8FA 5CFTA 4RQ8A 4CGZA 3IDWA 4DFPA 5KL8B 2VA3A 4MF2A 3F2CA 4TUSA 5HRGA 1J2NA 1X6IA 3M9NB 2K4PA 2JR5A 1DGSA 5J2KA 2G5IB 3RTVA 3OGUA 3LVVA 2BDPA 3NASA 1A76A 5AM4A 2GA9D 2LM1A 1ZRNA 4IR9A 1FIQA 7ICKA 4OJLA 2KD1A 4NM2A 4KMOB 5IILA 1COKA 3BZKA 3RBDA 2NRTA 7ICUA 1XO0A 4QZ9A 4RQ4A 1TE2A 4PGYA 2G08A 3NWIA 3WKEA 1RYSA 5JRTA 2EZXA 4NJ8A 5B66U 3JPPA 1Z19A 3DDHA 2KHQA 2VKQA 1EXNA 4O5KA 1HJPA 2W04A 1QSSA 3BZCA 5ALYA 2D6FC 3NRWA 5KFCA 9ICKA 2DGZA 5J2BA 3ETLA 4ACOA 4Y2TA 3OVSA 3EZ5A 3PR5B 3H4DA 1N5WA 1NJZA 4PZOA 4QWBA 4DEZA 3U26A 4F4WA 2DPIA 3MDCA 1M6YA 1ZD5A 5AM1A 3IN5A 2AJQA 4X4OA 4FHVA 2XGQA 2NO4A 1UPHA 4KLEA 1VJ7A 4J9QA 2BCVA 4Y2UA 2KZZA 2DUYA 3OWGA 4DF4A 4F3OA 3E0FA 5KFMA 1PK1A 4IRKA 1V97A 3F2BA 5HRBA 2JRZA 2OXOA 3H8MA 4QWEA 1WOTA 2KJ9A 2YMLA 4I2EA 1RQNA 4F2SA 2BR0A 2DBYA 1HEKA 3ORYA 4UASA 3BQ1A 2WAQF 3I76A 9ICFA 8ICNA 3RAQA 4JV0A 1NK8A 4K4IA 4RQ3A 4ECXA 4I28A 2OM6A 2A19A 2CXYA 3C18A 4NXXA 4ED1A 5AI5A 5HRIA 2P6UA 4J03A 4F5NA 3OPXA 2WB1C 4I2AA 3QUTA 1UEUA 4X4SA 5KFHA 2I1QA 3AM9A 4JK1A 4DSEA 8ICMA 2W9AA 1F0MA 5EE3A 1ZQWA 3ZI4A 5ALVA 3H8WA 9ICVA 2E3TA 2FE9A 2AU0A 2E5SA 4M47A 1PK1B 5DEDA 4MF8A 1Z00A 3FC4A 2BQ3A 1JXLA 5J8YC 4OAGA 1NZPA 2ZIWB 2XO7A 5HR9A 2L5YA 3QZ7A 4DF8A 4UB8U 1T3NA 5AKEA 3G6VA 1RM6C 4XJEA 2PBEA 3PW2A 1TK0A 4UBCA 3TFSA 5DQGA 2KN7A 3NVYA 2CPRA 4YD2A 9ICRA 1U47A 2K8BB 2HHSA 3CNHA 5ALKA 3M1YA 2BBHA 5CB1A 4KN7A 3EWAA 1JAJA 3MGVA 1NJYA 3V7KA 5KG3A 1SKSA 4JV1A 8ICQA 8ICAA 1S10A 2HI0A 3WFRE 2JZBA 4NXWA 5AKKA 1FO4A 3UQ2A 3RJEA 5KG4A 3RF9A
chains in the Genus database with same CATH topology
3GV7B 4ECSA 2PI4A 4KLHA 4JUZA 5KFPA 4O3NA 2PFOA 3TFRA 4YXMA 1K1SA 2V4QA 4KLMA 4DSFA 4M2YA 1MIYA 3PV8A 3ZD8A 2FLPA 3PO5A 5J0UA 1S0NA 5F2VO 3NYBA 1NK7A 4B9SA 3HJ4A 3OVBA 3V6JA 3IHQB 5J2AA 5KFNA 2UVUA 1NOMA 4YVZA 2JEFA 4J9MA 3C2LA 1NJXA 2XC9A 1RPLA 5J29A 4K4HA 4M0AA 4P4OA 7ICVA 1DOQA 5KFEA 2MAXA 5KFFA 4LVSA 2DR9A 4J9NA 2ZH9A 1NJWA 2BPGA 4DWIA 4ED2A 4M6WA 7ICJA 3MGHA 1RXVA 2J6TA 1BPXA 4LZGA 4KLTA 8ICYA 3C66A 4GC7A 4YXJA 2M9NA 4NLNA 4F5OA 4MEYA 8ICXA 4X0BA 2FMPA 2FLLA 4FS2A 4BDPA 5HRFA 3C21A 1ZQNA 1KLNA 3HIYA 3PW5A 5J2HA 4Z6EA 1R8CA 3G6XA 4PH5A 5IIMA 5HNKA 2O5AA 1UT5A 3PVXA 2W9BA 4J9KA 4ED7A 3Q8MA 4FBTA 4UD4A 2ID1A 3Q8RB 2DR5A 4ED0A 4WC6A 3OUYB 2JEJA 3HJ1A 4KLQA 3C2KA 4PGXA 5J0QA 3K75D 4KMUA 3OHBA 1XSNA 4F4ZA 1MIWA 4S3NA 1Z3EB 4TQSA 3BQ0A 5TZVA 3MR5A 3EPIA 4EEYA 3C23A 4KN4A 3ZDCA 1U48A 2OWOA 7ICMA 5CJ7A 9ICCA 1DK3A 3BQTA 5IIJA 2JZBB 2BQUA 1N48A 3T5JA 4RNMA 5J0PA 5KT5A 1MQ2A 2DPJA 2WTFA 4WC4A 5D4BA 4B9VA 3RR8A 5BOMA 1COOA 4YG2A 1ZQQA 3M8SA 3UXOA 3RH4A 1T7PA 3RJJA 3WFSC 3RB4A 4MFAA 4F50A 3GFKB 9ICEA 1ZQHA 4EYHB 1KDHA 1FA0A 5L1LA 3HPOA 1BPEA 1D8LA 4DOAA 4KLJA 9ICHA 3ISBA 2V4RA 3EYZA 2PFNA 3EPGA 3H8JA 1SL1A 1SKWA 2JEGA 4E80A 4O5CA 1X9SA 2R8HA 4Q8EA 5KFOA 3H39A 5HRHA 3OVAA 1CUKA 1TFWA 2UVRA 3FDSA 4Q43A 2C2EA 4O9MA 3GIKA 4BWMA 5KFLA 4C8NA 4QZ8A 2XCPA 3H40A 1AROP 4UD5A 2FPMA 4B9MA 4R8UA 3JPSA 3MR3A 1ZJMA 4RZRA 4QZHA 4M6WB 4NKUA 4RQ1A 3T3FA 3PX6A 1L3TA 2VA2A 4YCXA 4B9TA 4IR1A 2GWSA 3V72A 4GXJA 4DL4A 1MSWD 5IIIA 3ZD9A 3PMLA 3PNCA 4ECUA 4I2JA 1NK5A 4KLSA 1BGXT 2ZUBA 4B9UA 2W8LA 2BQRA 1UA1A 8ICSA 4PHAA 4TURA 1BPYA 4O3SA 4DQIA 5CR0A 2BHNA 5CA7A 4X4VA 4BGDA 4PHPA 3GIMA 7ICGA 4M9GA 8ICWA 2W9BB 4X4TA 1S76D 2DFLA 3OV7A 1JIHA 4F4YA 3N4MB 1TAQA 4RU9A 1ZQGA 4K4GA 3TANA 2ZH4A 1ZQLA 5DB6A 2M2VA 1BVSA 4Q45A 3GQCA 5IIKA 1Z00B 3Q8KA 3RJHA 4YD1A 1X9MA 1ZQIA 4WC3A 4UAWA 4M9LA 2JEIA 2V9WA 4RWQA 1U9LA 1HUOA 4M9NA 4LT6A 1UEVA 4DS4A 1SL0A 7ICHA 2AGQA 2AQ0A 5BOLA 5KFZA 4UB4A 1BPDA 4HYKA 4WC2A 3T5HA 3JPRA 4XA5A 3MR2A 1LV5A 4IRCA 4NY8A 3AQNA 3JYYA 3H8SA 2HHVA 9ICUA 2ZJAA 1ZQXA 5EWEA 4RQ0A 5KFTA 3OUYA 1BNOA 2VANA 5J0XA 3HW8A 2R8GA 4QZDA 3MR6A 8ICGA 1TAUA 2ZTCA 2LYHA 1ZQSA 4TUPA 4ECYA 2HHTA 4RWOA 2ZHBA 1ZQJA 4JWMA 4B9LA 4F93B 4O3RA 4R8UB 3QE9Y 1ZQYA 2ZH8A 4KTQA 3MDAA 3OJUA 4DL3A 4DL5A 2BCSA 4Z6FA 4F91B 4ED8A 5DLGA 2ASLA 3KHLA 4JV2A 4ECRA 4E0DA 5J2FA 2ASDA 1ZQZA 7ICLA 1U45A 2IA6A 2ZTDA 1WCLA 2AGPA 4WC5A 3KHHA 2MUTA 4RUCA 5KG7A 1PZNA 3TQ1A 4M9JA 1VFGA 3JPQA 1NKCA 4Q44A 9ICNA 2ASJA 1T8EA 3JZ0A 1NK4A 2ZUCA 3HT3A 1XC9A 4ELVA 5J2EA 1D8YA 1TFRA 4IQTA 4IQUA 4DO9A 1U49A 1NK0A 3ZDAA 3PW0A 3Q8PB 4F92B 4RQ7A 2VA8A 4DFMA 4IRDA 4MFCA 3OSPA 1NK9A 2ISOA 4DL2A 5J0YA 1XSLA 4FHXA 4FS1A 1WCNA 5KFXA 4EBDA 3UQ0A 1D9DA 2AGOA 2PFPA 2W9CA 4YR0A 7ICRA 5HMLA 3ISDA 5J2CA 1ZYQA 4YMMA 2NRWA 4WC0A 3AQLA 3PR4A 1KSPA 5L1JA 5HREA 3HWTA 3RR7A 1ZQFA 3NGDA 4EP7A 3NTUA 1ZQMA 5HHHA 1XSPA 3TAQA 2FLNA 4NLKA 5J2JA 3C2MA 4ED6A 1ZQPA 4NLZA 1DK2A 1T4GA 4RPZA 4UBBA 3ZDEA 4YFKA 4M9HA 2HHWA 4DFJA 1CEZA 2Y1IA 4KLIA 1ZQKA 5KG6A 9ICWA 5DKWA 5J2GA 5BPCA 3C5GA 3H4BA 4DSKA 1U4BA 2HHQA 7ICQA 1L3VA 5DDYA 1SL2A 3RB3A 2J6SA 1ZQRA 1JQRA 2ZHAA 2ZUDA 4KLGA 2ZH1A 4P4PA 5CWRA 2Q66A 4X4PA 4FH5A 4QZFA 3LK9A 3MABA 5KFRA 1R8BA 3EW9A 4QZIA 4O0IA 1V9PA 4RWNA 3BJYA 5CP2A 4DL7A 1S9FA 4I2HA 1L5UA 1QTMA 4KLOA 7ICOA 4QWDA 2HHXA 2O1PA 2PI5A 4BWJA 9ICAA 4J9OA 2Y1JA 4O3PA 3PW7A 3V6HA 2AQ4A 3RAXA 3SI8A 5DBAA 5KT7A 3T5LA 2KFZA 5KFYA 5J0TA 2BPFA 2XY6A 4X4RA 4KITB 4EBCA 4AT8A 7ICFA 3OHAA 9ICTA 2NRKA 2F1JA 4F5RA 2M2WA 2MUTB 4MEXA 2KTQA 2P6RA 2R8JA 8ICFA 5IIOA 4DSJA 3MFIA 2RDJA 4WBYA 2FPKA 4RPXA 2C28A 3UXPA 4YQWA 1L3SA 4YN4A 4ECWA 4XRHA 1RXWA 3JPOA 4B9NA 4E7XA 8ICIA 4KLDA 4QZEA 3ISCA 3GDXA 1TK5A 5HP4A 4IQWA 3C1ZA 4UB3A 2BE3A 3RJGA 9ICJA 4F5PA 4O5EA 1NKEA 2UVVA 3PY8A 4BXOA 2W9CB 1ZETA 4Q8FA 8ICPA 1S0VA 4RQ8A 3UPQA 5IINA 4E8FA 4DFPA 1YLQA 4DL6A 8ICHA 4EBKA 5J0OA 2VA3A 4MF2A 4QW9A 5DBCA 3V7JA 4TUSA 3MFHA 4G3IA 5HRGA 3KHGA 2W8KA 3M9NB 5KG2A 4YMNA 4DQRA 1TKDA 1DGSA 4ECTA 5J2KA 4QZCA 3RB0A 1BNPA 1RZTA 3RTVA 4I2GA 4F8RA 4GLXA 1Q78A 4AT7A 5KTQA 3OGUA 3PW4A 2F1IA 4DOBA 2RDIA 1A76A 2BDPA 2W9MA 4C8MA 4RPYA 9ICBA 1S0OA 3AQKA 4J9RA 5J2IA 2A1JA 4KLLA 4IR9A 2M2UA 4RT2A 5HRLA 7ICKA 2I9GA 1A77A 5EWGA 5J0RA 3HP6A 1MQ3A 4PPXA 3LWMA 4NM2A 5KFGA 3T5KA 4CCHA 5IILA 4RT3A 1TK8A 5C5JA 2BCRA 4ELTA 4P2HA 2NRZA 3RBDA 2ISPA 1N56A 8ICTA 2NRTA 7ICUA 2KZ3A 5EWFA 2ZH5A 1Y88A 4QZ9A 4TUQA 5DGAA 4RQ4A 4EBEA 9ICGA 4AT8B 7ICNA 3K4GA 4PGYA 2HHUA 4YR3A 2KFNA 1X2IA 3G6YA 4KLFA 1RYSA 3THVA 3GV5B 8ICKA 5DG9A 1UA0A 4FHPA 2ZH6A 4X4NA 4XUSA 4KLUA 3JPPA 3WFQE 3PX4A 3RJFA 4RQ6A 4GXKA 3RRGA 4C8OA 4MFFA 3B0YA 4RUAA 2C2DA 1JX4A 4M04A 5KT6A 4RQ5A 2ZTEA 7ICIA 4ELUA 1EXNA 8ICBA 2IHNA 4IQVA 4O5KA 5KFVA 5DG8A 1HJPA 5DB8A 3Q8QB 5DQIA 1BPBA 1S0MA 1RYRA 1QSSA 4BXOB 7ICPA 3LQCB 5KG1A 1XU4A 1KTQA 5DGBA 3GIJA 5DECA 4ECZA 7ICSA 5HRKA 4QZAA 1H38A 8ICLA 3GIIA 2UVWA 4YMOA 4X4QA 1OU5A 4IG8A 4DQQA 5KFSA 2BCQA 3V7LA 5KFCA 9ICKA 5DBBA 4M5DA 3M9MB 4AT7B 2DRAA 5L1KA 5J2BA 3ETLA 1ZQAA 2XCAA 4FO6A 4GXIA 1ZQDA 3OVSA 3GILA 3EZ5A 5DLFA 4DSLA 9ICOA 3PR5B 4DQPA 3AU6A 2DR7A 3H7IA 2A1JB 4NM1A 5J2DA 3H4DA 3LDAA 3RBEA 1ZQUA 3PO4A 3TAPA 4I2BA 3SV4A 3AQMA 4DLEA 2XGPA 4UB2A 4R64A 1NJZA 2ALZA 4QWBA 5KFDA 3KTQA 4DEZA 3RJIA 4F4WA 2DPIA 9ICMA 1TFYA 3MDCA 4AT9A 9ICXA 3E2EA 3L9DA 2C22A 3BQ2A 2AJQA 4PHDA 4X4OA 1D9FA 3ZDBA 2HVHA 8ICJA 2XGQA 1KNYA 4FHVA 4NKTA 3TARA 5KG0A 2F1HA 1XS9D 4KLEA 1VJ7A 4J9QA 3QZ8A 2BCVA 4DSIA 2ZH3A 1KFDA 4ECQA 1JMSA 2H5XA 3M8RA 5CHGA 4DLGA 2KZZA 5HMMA 4J9LA 5KFKA 3AU2A 3RJKA 3V6KA 4J9PA 4QZBA 4TQRA 3Q8LA 1ZQTA 5KT4A 5KFBA 4GC6A 2Q0ZX 4DF4A 4F3OA 5KFMA 5DB7A 4EYIB 4IRKA 4RWPA 2FMSA 5D49A 3OSNA 5HRBA 3M9OB 2ZJ5A 1KEJA 5HC9A 4QWEA 1WOTA 4PGQA 4R63A 4DOCA 3N97B 2DRBA 3TI0A 8ICEA 2R8IA 4ATBA 3JPTA 4I2EA 4F2SA 4F5QA 2BR0A 9ICLA 4NXZA 4X5VA 2ZJ8A 2FMQA 3ORYA 1PX5A 4WC1A 2J6UA 1SKRA 3BQ1A 9ICFA 2BKEA 3SV3A 1QLNA 5F9NA 3RAQA 8ICNA 3B0XA 4JV0A 1NK8A 2P66A 3RRHA 3BDPA 4K4IA 4RQ3A 2M2TA 1Q79A 3KHRA 4ECXA 2ZH2A 4P4MA 4R66A 4I28A 1JN3A 1TVAA 4NLGA 3MGIA 1F5AA 4YP3A 2IMWP 4I27A 3H3AA 1K1QA 2PFQA 3C18A 4RQ2A 3C1YA 4I2CA 4YR2A 2HVIA 4ED1A 3PMNA 7ICTA 5HRIA 9ICIA 2P6UA 2HHPA 4AT9B 4QW8A 2KP7A 3WFOA 4Z6DA 5DDMA 3C5FA 4F5NA 5KFJA 4DFKA 1XWLA 2XY7A 1QSYA 1MIVA 1R89A 8ICOA 2ZH7A 4I2AA 5KG5A 3FYHA 1XO1A 4PHEA 2HW3A 1UEUA 3H37A 4X4SA 1NK6A 1ZQCA 3ZDDA 4ZH4A 2I1QA 5KFHA 4DQSA 2KZMA 8ICCA 4JK1A 4DSEA 8ICMA 5KT3A 2W9AA 3IM1A 3MBYA 1ZQWA 5D46A 3QEBZ 3H8WA 1S77D 4UAYA 4QWCA 1V4AA 4I2IA 9ICVA 4EBJA 4F2RA 4WCWA 2AU0A 2NRXA 4C8LA 4M47A 3LWLA 5DEDA 4MF8A 1Z00A 5DG7A 4X4UA 3RH6A 1ZJNA 2BQ3A 1TV9A 1JXLA 3H38A 4I2DA 3JPNA 2IHMA 1NZPA 4R65A 2XO7A 5KFQA 1ZQBA 8ICRA 5HR9A 3QZ7A 3Q8SB 4ATBB 7ICEA 4DF8A 3RH5A 1IM4A 1T3NA 1UETA 4FHWA 2FPLA 5KFWA 5KFAA 1QSLA 3G6VA 4C8KA 1UT8A 2PXIA 1L3UA 1KFSA 1KRPA 9ICSA 8ICZA 4Z6CA 2PBEA 3PW2A 5DB9A 3AUOA 1TK0A 4UBCA 1ZQOA 4FHYA 1JXEA 4LZDA 4XQ7A 5HHIA 3TFSA 3UXNA 5DQGA 2KN7A 2IBKA 4YD2A 9ICRA 1NO5A 4EZ9A 1U47A 2C2RA 4RNOA 4EZ6A 2HHSA 4WBZA 2DR8A 3WFPA 5F9LA 8ICUA 2BGWA 2BCUA 1BPZA 1R8AA 1NKBA 5KT2A 3OJSA 3GV8B 9ICPA 4WC7A 1IXRA 4X0AA 5JUMA 3PX0A 5KFUA 2RFFA 4FBUA 1B22A 3SYZA 2R8KA 5CB1A 5L1IA 4FH3A 1S97A 4KN7A 3SZ2A 3EWAA 3UPSA 1JAJA 1NJYA 4UQGA 5J0SA 2NRVA 4UB1A 4QWAA 3V7KA 4F4KA 3QEAZ 5KG3A 5KFIA 5DQHA 4QZGA 4UAZA 8ICVA 4I29A 1X9WA 4DS5A 4ECVA 9ICQA 2B21A 1SKSA 4JV1A 1HUZA 1KFTA 5J0WA 4RNNA 1LB2B 8ICQA 4O3OA 3RB6A 8ICAA 4O3QA 2ATLA 1B43A 1S10A 1ZQVA 5L9XA 4UB5A 2JZBA 3HX0A 3WFRE 5HRDA 4I2FA 4JWNA 2XY5A 1MC8A 1SZPA 4XQ8A 3UQ2A 1ZQEA 3RJEA 2DVIA 4F4XA 4J9SA 5EOZA 4ED3A 5KG4A 2BPCA 1C7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV7 B;  4ECS A;  2PI4 A;  4KLH A;  4JUZ A;  5KFP A;  4O3N A;  2PFO A;  3TFR A;  4YXM A;  1K1S A;  2V4Q A;  4KLM A;  4DSF A;  4M2Y A;  1MIY A;  3PV8 A;  3ZD8 A;  2FLP A;  3PO5 A;  5J0U A;  1S0N A;  5F2V O;  3NYB A;  1NK7 A;  4B9S A;  3HJ4 A;  3OVB A;  3V6J A;  3IHQ B;  5J2A A;  5KFN A;  2UVU A;  1NOM A;  4YVZ A;  2JEF A;  4J9M A;  3C2L A;  1NJX A;  2XC9 A;  1RPL A;  5J29 A;  4K4H A;  4M0A A;  4P4O A;  7ICV A;  1DOQ A;  5KFE A;  2MAX A;  5KFF A;  4LVS A;  2DR9 A;  4J9N A;  2ZH9 A;  1NJW A;  2BPG A;  4DWI A;  4ED2 A;  4M6W A;  7ICJ A;  3MGH A;  1RXV A;  2J6T A;  1BPX A;  4LZG A;  4KLT A;  8ICY A;  3C66 A;  4GC7 A;  4YXJ A;  2M9N A;  4NLN A;  4F5O A;  4MEY A;  8ICX A;  4X0B A;  2FMP A;  2FLL A;  4FS2 A;  4BDP A;  5HRF A;  3C21 A;  1ZQN A;  1KLN A;  3HIY A;  3PW5 A;  5J2H A;  4Z6E A;  1R8C A;  3G6X A;  4PH5 A;  5IIM A;  5HNK A;  2O5A A;  1UT5 A;  3PVX A;  2W9B A;  4J9K A;  4ED7 A;  3Q8M A;  4FBT A;  4UD4 A;  2ID1 A;  3Q8R B;  2DR5 A;  4ED0 A;  4WC6 A;  3OUY B;  2JEJ A;  3HJ1 A;  4KLQ A;  3C2K A;  4PGX A;  5J0Q A;  3K75 D;  4KMU A;  3OHB A;  1XSN A;  4F4Z A;  1MIW A;  4S3N A;  1Z3E B;  4TQS A;  3BQ0 A;  5TZV A;  3MR5 A;  3EPI A;  4EEY A;  3C23 A;  4KN4 A;  3ZDC A;  1U48 A;  2OWO A;  7ICM A;  5CJ7 A;  9ICC A;  1DK3 A;  3BQT A;  5IIJ A;  2JZB B;  2BQU A;  1N48 A;  3T5J A;  4RNM A;  5J0P A;  5KT5 A;  1MQ2 A;  2DPJ A;  2WTF A;  4WC4 A;  5D4B A;  4B9V A;  3RR8 A;  5BOM A;  1COO A;  4YG2 A;  1ZQQ A;  3M8S A;  3UXO A;  3RH4 A;  1T7P A;  3RJJ A;  3WFS C;  3RB4 A;  4MFA A;  4F50 A;  3GFK B;  9ICE A;  1ZQH A;  4EYH B;  1KDH A;  1FA0 A;  5L1L A;  3HPO A;  1BPE A;  1D8L A;  4DOA A;  4KLJ A;  9ICH A;  3ISB A;  2V4R A;  3EYZ A;  2PFN A;  3EPG A;  3H8J A;  1SL1 A;  1SKW A;  2JEG A;  4E80 A;  4O5C A;  1X9S A;  2R8H A;  4Q8E A;  5KFO A;  3H39 A;  5HRH A;  3OVA A;  1CUK A;  1TFW A;  2UVR A;  3FDS A;  4Q43 A;  2C2E A;  4O9M A;  3GIK A;  4BWM A;  5KFL A;  4C8N A;  4QZ8 A;  2XCP A;  3H40 A;  1ARO P;  4UD5 A;  2FPM A;  4B9M A;  4R8U A;  3JPS A;  3MR3 A;  1ZJM A;  4RZR A;  4QZH A;  4M6W B;  4NKU A;  4RQ1 A;  3T3F A;  3PX6 A;  1L3T A;  2VA2 A;  4YCX A;  4B9T A;  4IR1 A;  2GWS A;  3V72 A;  4GXJ A;  4DL4 A;  1MSW D;  5III A;  3ZD9 A;  3PML A;  3PNC A;  4ECU A;  4I2J A;  1NK5 A;  4KLS A;  1BGX T;  2ZUB A;  4B9U A;  2W8L A;  2BQR A;  1UA1 A;  8ICS A;  4PHA A;  4TUR A;  1BPY A;  4O3S A;  4DQI A;  5CR0 A;  2BHN A;  5CA7 A;  4X4V A;  4BGD A;  4PHP A;  3GIM A;  7ICG A;  4M9G A;  8ICW A;  2W9B B;  4X4T A;  1S76 D;  2DFL A;  3OV7 A;  1JIH A;  4F4Y A;  3N4M B;  1TAQ A;  4RU9 A;  1ZQG A;  4K4G A;  3TAN A;  2ZH4 A;  1ZQL A;  5DB6 A;  2M2V A;  1BVS A;  4Q45 A;  3GQC A;  5IIK A;  1Z00 B;  3Q8K A;  3RJH A;  4YD1 A;  1X9M A;  1ZQI A;  4WC3 A;  4UAW A;  4M9L A;  2JEI A;  2V9W A;  4RWQ A;  1U9L A;  1HUO A;  4M9N A;  4LT6 A;  1UEV A;  4DS4 A;  1SL0 A;  7ICH A;  2AGQ A;  2AQ0 A;  5BOL A;  5KFZ A;  4UB4 A;  1BPD A;  4HYK A;  4WC2 A;  3T5H A;  3JPR A;  4XA5 A;  3MR2 A;  1LV5 A;  4IRC A;  4NY8 A;  3AQN A;  3JYY A;  3H8S A;  2HHV A;  9ICU A;  2ZJA A;  1ZQX A;  5EWE A;  4RQ0 A;  5KFT A;  3OUY A;  1BNO A;  2VAN A;  5J0X A;  3HW8 A;  2R8G A;  4QZD A;  3MR6 A;  8ICG A;  1TAU A;  2ZTC A;  2LYH A;  1ZQS A;  4TUP A;  4ECY A;  2HHT A;  4RWO A;  2ZHB A;  1ZQJ A;  4JWM A;  4B9L A;  4F93 B;  4O3R A;  4R8U B;  3QE9 Y;  1ZQY A;  2ZH8 A;  4KTQ A;  3MDA A;  3OJU A;  4DL3 A;  4DL5 A;  2BCS A;  4Z6F A;  4F91 B;  4ED8 A;  5DLG A;  2ASL A;  3KHL A;  4JV2 A;  4ECR A;  4E0D A;  5J2F A;  2ASD A;  1ZQZ A;  7ICL A;  1U45 A;  2IA6 A;  2ZTD A;  1WCL A;  2AGP A;  4WC5 A;  3KHH A;  2MUT A;  4RUC A;  5KG7 A;  1PZN A;  3TQ1 A;  4M9J A;  1VFG A;  3JPQ A;  1NKC A;  4Q44 A;  9ICN A;  2ASJ A;  1T8E A;  3JZ0 A;  1NK4 A;  2ZUC A;  3HT3 A;  1XC9 A;  4ELV A;  5J2E A;  1D8Y A;  1TFR A;  4IQT A;  4IQU A;  4DO9 A;  1U49 A;  1NK0 A;  3ZDA A;  3PW0 A;  3Q8P B;  4F92 B;  4RQ7 A;  2VA8 A;  4DFM A;  4IRD A;  4MFC A;  3OSP A;  1NK9 A;  2ISO A;  4DL2 A;  5J0Y A;  1XSL A;  4FHX A;  4FS1 A;  1WCN A;  5KFX A;  4EBD A;  3UQ0 A;  1D9D A;  2AGO A;  2PFP A;  2W9C A;  4YR0 A;  7ICR A;  5HML A;  3ISD A;  5J2C A;  1ZYQ A;  4YMM A;  2NRW A;  4WC0 A;  3AQL A;  3PR4 A;  1KSP A;  5L1J A;  5HRE A;  3HWT A;  3RR7 A;  1ZQF A;  3NGD A;  4EP7 A;  3NTU A;  1ZQM A;  5HHH A;  1XSP A;  3TAQ A;  2FLN A;  4NLK A;  5J2J A;  3C2M A;  4ED6 A;  1ZQP A;  4NLZ A;  1DK2 A;  1T4G A;  4RPZ A;  4UBB A;  3ZDE A;  4YFK A;  4M9H A;  2HHW A;  4DFJ A;  1CEZ A;  2Y1I A;  4KLI A;  1ZQK A;  5KG6 A;  9ICW A;  5DKW A;  5J2G A;  5BPC A;  3C5G A;  3H4B A;  4DSK A;  1U4B A;  2HHQ A;  7ICQ A;  1L3V A;  5DDY A;  1SL2 A;  3RB3 A;  2J6S A;  1ZQR A;  1JQR A;  2ZHA A;  2ZUD A;  4KLG A;  2ZH1 A;  4P4P A;  5CWR A;  2Q66 A;  4X4P A;  4FH5 A;  4QZF A;  3LK9 A;  3MAB A;  5KFR A;  1R8B A;  3EW9 A;  4QZI A;  4O0I A;  1V9P A;  4RWN A;  3BJY A;  5CP2 A;  4DL7 A;  1S9F A;  4I2H A;  1L5U A;  1QTM A;  4KLO A;  7ICO A;  4QWD A;  2HHX A;  2O1P A;  2PI5 A;  4BWJ A;  9ICA A;  4J9O A;  2Y1J A;  4O3P A;  3PW7 A;  3V6H A;  2AQ4 A;  3RAX A;  3SI8 A;  5DBA A;  5KT7 A;  3T5L A;  2KFZ A;  5KFY A;  5J0T A;  2BPF A;  2XY6 A;  4X4R A;  4KIT B;  4EBC A;  4AT8 A;  7ICF A;  3OHA A;  9ICT A;  2NRK A;  2F1J A;  4F5R A;  2M2W A;  2MUT B;  4MEX A;  2KTQ A;  2P6R A;  2R8J A;  8ICF A;  5IIO A;  4DSJ A;  3MFI A;  2RDJ A;  4WBY A;  2FPK A;  4RPX A;  2C28 A;  3UXP A;  4YQW A;  1L3S A;  4YN4 A;  4ECW A;  4XRH A;  1RXW A;  3JPO A;  4B9N A;  4E7X A;  8ICI A;  4KLD A;  4QZE A;  3ISC A;  3GDX A;  1TK5 A;  5HP4 A;  4IQW A;  3C1Z A;  4UB3 A;  2BE3 A;  3RJG A;  9ICJ A;  4F5P A;  4O5E A;  1NKE A;  2UVV A;  3PY8 A;  4BXO A;  2W9C B;  1ZET A;  4Q8F A;  8ICP A;  1S0V A;  4RQ8 A;  3UPQ A;  5IIN A;  4E8F A;  4DFP A;  1YLQ A;  4DL6 A;  8ICH A;  4EBK A;  5J0O A;  2VA3 A;  4MF2 A;  4QW9 A;  5DBC A;  3V7J A;  4TUS A;  3MFH A;  4G3I A;  5HRG A;  3KHG A;  2W8K A;  3M9N B;  5KG2 A;  4YMN A;  4DQR A;  1TKD A;  1DGS A;  4ECT A;  5J2K A;  4QZC A;  3RB0 A;  1BNP A;  1RZT A;  3RTV A;  4I2G A;  4F8R A;  4GLX A;  1Q78 A;  4AT7 A;  5KTQ A;  3OGU A;  3PW4 A;  2F1I A;  4DOB A;  2RDI A;  1A76 A;  2BDP A;  2W9M A;  4C8M A;  4RPY A;  9ICB A;  1S0O A;  3AQK A;  4J9R A;  5J2I A;  2A1J A;  4KLL A;  4IR9 A;  2M2U A;  4RT2 A;  5HRL A;  7ICK A;  2I9G A;  1A77 A;  5EWG A;  5J0R A;  3HP6 A;  1MQ3 A;  4PPX A;  3LWM A;  4NM2 A;  5KFG A;  3T5K A;  4CCH A;  5IIL A;  4RT3 A;  1TK8 A;  5C5J A;  2BCR A;  4ELT A;  4P2H A;  2NRZ A;  3RBD A;  2ISP A;  1N56 A;  8ICT A;  2NRT A;  7ICU A;  2KZ3 A;  5EWF A;  2ZH5 A;  1Y88 A;  4QZ9 A;  4TUQ A;  5DGA A;  4RQ4 A;  4EBE A;  9ICG A;  4AT8 B;  7ICN A;  3K4G A;  4PGY A;  2HHU A;  4YR3 A;  2KFN A;  1X2I A;  3G6Y A;  4KLF A;  1RYS A;  3THV A;  3GV5 B;  8ICK A;  5DG9 A;  1UA0 A;  4FHP A;  2ZH6 A;  4X4N A;  4XUS A;  4KLU A;  3JPP A;  3WFQ E;  3PX4 A;  3RJF A;  4RQ6 A;  4GXK A;  3RRG A;  4C8O A;  4MFF A;  3B0Y A;  4RUA A;  2C2D A;  1JX4 A;  4M04 A;  5KT6 A;  4RQ5 A;  2ZTE A;  7ICI A;  4ELU A;  1EXN A;  8ICB A;  2IHN A;  4IQV A;  4O5K A;  5KFV A;  5DG8 A;  1HJP A;  5DB8 A;  3Q8Q B;  5DQI A;  1BPB A;  1S0M A;  1RYR A;  1QSS A;  4BXO B;  7ICP A;  3LQC B;  5KG1 A;  1XU4 A;  1KTQ A;  5DGB A;  3GIJ A;  5DEC A;  4ECZ A;  7ICS A;  5HRK A;  4QZA A;  1H38 A;  8ICL A;  3GII A;  2UVW A;  4YMO A;  4X4Q A;  1OU5 A;  4IG8 A;  4DQQ A;  5KFS A;  2BCQ A;  3V7L A;  5KFC A;  9ICK A;  5DBB A;  4M5D A;  3M9M B;  4AT7 B;  2DRA A;  5L1K A;  5J2B A;  3ETL A;  1ZQA A;  2XCA A;  4FO6 A;  4GXI A;  1ZQD A;  3OVS A;  3GIL A;  3EZ5 A;  5DLF A;  4DSL A;  9ICO A;  3PR5 B;  4DQP A;  3AU6 A;  2DR7 A;  3H7I A;  2A1J B;  4NM1 A;  5J2D A;  3H4D A;  3LDA A;  3RBE A;  1ZQU A;  3PO4 A;  3TAP A;  4I2B A;  3SV4 A;  3AQM A;  4DLE A;  2XGP A;  4UB2 A;  4R64 A;  1NJZ A;  2ALZ A;  4QWB A;  5KFD A;  3KTQ A;  4DEZ A;  3RJI A;  4F4W A;  2DPI A;  9ICM A;  1TFY A;  3MDC A;  4AT9 A;  9ICX A;  3E2E A;  3L9D A;  2C22 A;  3BQ2 A;  2AJQ A;  4PHD A;  4X4O A;  1D9F A;  3ZDB A;  2HVH A;  8ICJ A;  2XGQ A;  1KNY A;  4FHV A;  4NKT A;  3TAR A;  5KG0 A;  2F1H A;  1XS9 D;  4KLE A;  1VJ7 A;  4J9Q A;  3QZ8 A;  2BCV A;  4DSI A;  2ZH3 A;  1KFD A;  4ECQ A;  1JMS A;  2H5X A;  3M8R A;  5CHG A;  4DLG A;  2KZZ A;  5HMM A;  4J9L A;  5KFK A;  3AU2 A;  3RJK A;  3V6K A;  4J9P A;  4QZB A;  4TQR A;  3Q8L A;  1ZQT A;  5KT4 A;  5KFB A;  4GC6 A;  2Q0Z X;  4DF4 A;  4F3O A;  5KFM A;  5DB7 A;  4EYI B;  4IRK A;  4RWP A;  2FMS A;  5D49 A;  3OSN A;  5HRB A;  3M9O B;  2ZJ5 A;  1KEJ A;  5HC9 A;  4QWE A;  1WOT A;  4PGQ A;  4R63 A;  4DOC A;  3N97 B;  2DRB A;  3TI0 A;  8ICE A;  2R8I A;  4ATB A;  3JPT A;  4I2E A;  4F2S A;  4F5Q A;  2BR0 A;  9ICL A;  4NXZ A;  4X5V A;  2ZJ8 A;  2FMQ A;  3ORY A;  1PX5 A;  4WC1 A;  2J6U A;  1SKR A;  3BQ1 A;  9ICF A;  2BKE A;  3SV3 A;  1QLN A;  5F9N A;  3RAQ A;  8ICN A;  3B0X A;  4JV0 A;  1NK8 A;  2P66 A;  3RRH A;  3BDP A;  4K4I A;  4RQ3 A;  2M2T A;  1Q79 A;  3KHR A;  4ECX A;  2ZH2 A;  4P4M A;  4R66 A;  4I28 A;  1JN3 A;  1TVA A;  4NLG A;  3MGI A;  1F5A A;  4YP3 A;  2IMW P;  4I27 A;  3H3A A;  1K1Q A;  2PFQ A;  3C18 A;  4RQ2 A;  3C1Y A;  4I2C A;  4YR2 A;  2HVI A;  4ED1 A;  3PMN A;  7ICT A;  5HRI A;  9ICI A;  2P6U A;  2HHP A;  4AT9 B;  4QW8 A;  2KP7 A;  3WFO A;  4Z6D A;  5DDM A;  3C5F A;  4F5N A;  5KFJ A;  4DFK A;  1XWL A;  2XY7 A;  1QSY A;  1MIV A;  1R89 A;  8ICO A;  2ZH7 A;  4I2A A;  5KG5 A;  3FYH A;  1XO1 A;  4PHE A;  2HW3 A;  1UEU A;  3H37 A;  4X4S A;  1NK6 A;  1ZQC A;  3ZDD A;  4ZH4 A;  2I1Q A;  5KFH A;  4DQS A;  2KZM A;  8ICC A;  4JK1 A;  4DSE A;  8ICM A;  5KT3 A;  2W9A A;  3IM1 A;  3MBY A;  1ZQW A;  5D46 A;  3QEB Z;  3H8W A;  1S77 D;  4UAY A;  4QWC A;  1V4A A;  4I2I A;  9ICV A;  4EBJ A;  4F2R A;  4WCW A;  2AU0 A;  2NRX A;  4C8L A;  4M47 A;  3LWL A;  5DED A;  4MF8 A;  1Z00 A;  5DG7 A;  4X4U A;  3RH6 A;  1ZJN A;  2BQ3 A;  1TV9 A;  1JXL A;  3H38 A;  4I2D A;  3JPN A;  2IHM A;  1NZP A;  4R65 A;  2XO7 A;  5KFQ A;  1ZQB A;  8ICR A;  5HR9 A;  3QZ7 A;  3Q8S B;  4ATB B;  7ICE A;  4DF8 A;  3RH5 A;  1IM4 A;  1T3N A;  1UET A;  4FHW A;  2FPL A;  5KFW A;  5KFA A;  1QSL A;  3G6V A;  4C8K A;  1UT8 A;  2PXI A;  1L3U A;  1KFS A;  1KRP A;  9ICS A;  8ICZ A;  4Z6C A;  2PBE A;  3PW2 A;  5DB9 A;  3AUO A;  1TK0 A;  4UBC A;  1ZQO A;  4FHY A;  1JXE A;  4LZD A;  4XQ7 A;  5HHI A;  3TFS A;  3UXN A;  5DQG A;  2KN7 A;  2IBK A;  4YD2 A;  9ICR A;  1NO5 A;  4EZ9 A;  1U47 A;  2C2R A;  4RNO A;  4EZ6 A;  2HHS A;  4WBZ A;  2DR8 A;  3WFP A;  5F9L A;  8ICU A;  2BGW A;  2BCU A;  1BPZ A;  1R8A A;  1NKB A;  5KT2 A;  3OJS A;  3GV8 B;  9ICP A;  4WC7 A;  1IXR A;  4X0A A;  5JUM A;  3PX0 A;  5KFU A;  2RFF A;  4FBU A;  1B22 A;  3SYZ A;  2R8K A;  5CB1 A;  5L1I A;  4FH3 A;  1S97 A;  4KN7 A;  3SZ2 A;  3EWA A;  3UPS A;  1JAJ A;  1NJY A;  4UQG A;  5J0S A;  2NRV A;  4UB1 A;  4QWA A;  3V7K A;  4F4K A;  3QEA Z;  5KG3 A;  5KFI A;  5DQH A;  4QZG A;  4UAZ A;  8ICV A;  4I29 A;  1X9W A;  4DS5 A;  4ECV A;  9ICQ A;  2B21 A;  1SKS A;  4JV1 A;  1HUZ A;  1KFT A;  5J0W A;  4RNN A;  1LB2 B;  8ICQ A;  4O3O A;  3RB6 A;  8ICA A;  4O3Q A;  2ATL A;  1B43 A;  1S10 A;  1ZQV A;  5L9X A;  4UB5 A;  2JZB A;  3HX0 A;  3WFR E;  5HRD A;  4I2F A;  4JWN A;  2XY5 A;  1MC8 A;  1SZP A;  4XQ8 A;  3UQ2 A;  1ZQE A;  3RJE A;  2DVI A;  4F4X A;  4J9S A;  5EOZ A;  4ED3 A;  5KG4 A;  2BPC A;  1C7Y A; 
#chains in the Genus database with same CATH topology
 3GV7 B;  4KLH A;  3NVW A;  4YXM A;  4KLM A;  4M2Y A;  3PV8 A;  1KL9 A;  3WK5 A;  3OVB A;  3IHQ B;  2UVU A;  2YB4 A;  2KEY A;  4FZN A;  1NJX A;  5J29 A;  1DOQ A;  2MAX A;  5KFF A;  4LVS A;  4J9N A;  1MN8 A;  2ZH9 A;  1NJW A;  4CNQ A;  4ED2 A;  4M6W A;  7ICJ A;  2W43 A;  4AYB F;  2J6T A;  4LZG A;  4GC7 A;  3T79 A;  4NLN A;  1L7N A;  3C21 A;  1ZQN A;  1KLN A;  3HIY A;  3PW5 A;  1R8C A;  3PVX A;  2W9B A;  4HX0 A;  5ALP A;  2ID1 A;  4PGX A;  5J0Q A;  4KMU A;  5ALD A;  3TAD A;  9ICC A;  3BQT A;  2JZB B;  2DF4 B;  3T5J A;  4RNM A;  2DPJ A;  3KKA C;  4B9V A;  5BOM A;  3M8S A;  4NLC A;  9ICE A;  1ZQH A;  4EYH B;  1KDH A;  5L1L A;  5ALL A;  2PFN A;  4E80 A;  3WU2 U;  3BS5 B;  4O5C A;  1X9S A;  1YZ6 A;  3QUC A;  1Q3V A;  2UVR A;  3FDS A;  4Q43 A;  2C2E A;  4UAT A;  5KFL A;  5AM5 A;  4HAI A;  1ZJM A;  2F77 X;  4QZH A;  4M6W B;  1V85 A;  3KZX A;  1L3T A;  2VA2 A;  4O3M A;  2GWS A;  1MSW D;  3ZD9 A;  1NK5 A;  4EX7 A;  4KLS A;  5KAF U;  4PHA A;  4O3S A;  1JRO A;  3KZI U;  1N5X A;  1SWW A;  2HOF A;  4M9G A;  2W9B B;  1S76 D;  3OV7 A;  4F4Y A;  4K4G A;  4RU9 A;  5HR6 A;  4PL1 A;  1BVS A;  4YD1 A;  1QH9 A;  5AI6 A;  4UAR A;  4UAW A;  2H3V A;  2D8C A;  2AH5 A;  4O69 A;  5AIB A;  1SL0 A;  2AQ0 A;  4UB4 A;  5KFZ A;  3IP4 B;  3JYY A;  3AQN A;  5EWE A;  5KFT A;  5ALO A;  1X42 A;  3HRD D;  4QIW F;  1JRP A;  3GZF A;  2R8G A;  1TAU A;  4ECY A;  4RWO A;  1ZQJ A;  5D62 A;  4FE3 A;  4QJF B;  2ZH8 A;  4JV2 A;  5DLG A;  3KHL A;  3WK9 A;  4E0D A;  1NNL A;  7ICL A;  2AHO B;  2F76 X;  4WC5 A;  1VFG A;  1NKC A;  2ASJ A;  1T8E A;  4ELV A;  5J2E A;  1TFR A;  4IQT A;  1NK0 A;  4F92 B;  4DFM A;  2LBO A;  1NK9 A;  2ISO A;  2A3V A;  4EBD A;  4YR0 A;  5J2C A;  5ALM A;  2LI6 A;  3NGD A;  4EP7 A;  2K4I A;  1XSP A;  5J2J A;  3ZDE A;  4YFK A;  2OYY A;  1N62 A;  1Z4O A;  1ZQK A;  5KG6 A;  5DKW A;  1S8O A;  1U4B A;  1L3V A;  4KLG A;  2DR9 A;  5KFR A;  1R8B A;  4QZI A;  1L8L A;  4I2H A;  2YB1 A;  2HHX A;  9ICA A;  4O3P A;  1IIP A;  3WK8 A;  3V6H A;  3SI8 A;  5DBA A;  2MA1 A;  2HBK A;  4EBC A;  4AT8 A;  3QUQ A;  5KNI A;  2N1R A;  4F5R A;  2P6R A;  2PKE A;  8ICF A;  3MFI A;  4O6A A;  1L3S A;  4YN4 A;  4B9N A;  3JPO A;  4KLD A;  5F3X B;  2KOB A;  2BE3 A;  3PY8 A;  8ICP A;  1Z4N A;  2GH1 A;  5IIN A;  1YLQ A;  4DL6 A;  4EBK A;  5B5E U;  4QW9 A;  3MFH A;  4RQM A;  1P7D A;  4DQR A;  4ECT A;  4QZC A;  1RZT A;  4I2G A;  1Q78 A;  2WAQ C;  3L3F X;  3PW4 A;  2H3Q A;  2F1I A;  4DOB A;  3N7R C;  2W9M A;  3AQK A;  4J9R A;  5J2I A;  4KM5 A;  1SXD A;  2M2U A;  2I9G A;  1A77 A;  4U6P A;  3LWM A;  3T5K A;  2LKY A;  4B6J A;  1KBU A;  2BCR A;  4ELT A;  2KV2 A;  2KZ3 A;  3JCF A;  2HDO A;  1Y88 A;  1AQ6 A;  9ICG A;  4AT8 B;  3NVO A;  3K4G A;  4YR3 A;  3G6Y A;  4KLF A;  4WQL A;  1F5S A;  4FHP A;  3GV5 B;  4K96 A;  5B3P A;  2IUB A;  3WFQ E;  5TIS U;  3PX4 A;  3RJF A;  3RRG A;  2C2D A;  4LEV A;  5KT6 A;  2ZTE A;  5AM0 A;  4ELU A;  2IHN A;  5KFV A;  5DG8 A;  5DB8 A;  3Q8Q B;  1BPB A;  3LQC B;  1KTQ A;  2ZIU A;  7ICS A;  1SV0 C;  4QZA A;  4X4Q A;  4IG8 A;  2F8K A;  4AP9 A;  4EEB A;  4M5D A;  5DBB A;  4GXI A;  2K4H A;  3GIL A;  1PK3 A;  5DLF A;  2DR7 A;  3AU6 A;  4NM1 A;  5J2D A;  2DKX A;  1SIJ A;  1ZQU A;  4I2B A;  4Y2R A;  4UB2 A;  1N63 A;  1SZH A;  2ALZ A;  2O6K A;  5ALI A;  2YY6 A;  3QU4 A;  2E8N A;  2MRL A;  3BQ2 A;  2YX8 A;  1KNY A;  1IV8 A;  3QUB A;  3TAR A;  2B51 A;  2ZIV A;  2KIW A;  1Q46 A;  2F1H A;  3FM9 A;  5EE0 A;  2ZH3 A;  1KFD A;  5CFU A;  1JMS A;  2WHE A;  4DLG A;  5KFK A;  3RJK A;  3V6K A;  4GC6 A;  5KT4 A;  1VLB A;  1CRX A;  3OSN A;  3M9O B;  2PMZ F;  2R8I A;  3JPT A;  4G9B A;  9ICL A;  3WKD A;  5H2F U;  1PX5 A;  4WC1 A;  2J6U A;  1SKR A;  1DRG A;  3B0X A;  3RRH A;  3BDP A;  1FFU A;  4FZM A;  1Q79 A;  2ZH2 A;  4P4M A;  4AYB C;  5EE9 A;  4YP3 A;  2PFQ A;  2ESE A;  4WQK A;  3PMN A;  7ICT A;  9ICI A;  2WF9 A;  4DFK A;  1MIV A;  3IG8 A;  3FYH A;  1XO1 A;  2ZIV B;  3NVV A;  1NK6 A;  3CYM A;  3ZDD A;  4ZH4 A;  8ICC A;  5KT3 A;  3L5K A;  4EBJ A;  4F2R A;  4OJ6 A;  4C7Z A;  3B9J A;  5AI4 A;  3LWL A;  3MC1 A;  1TV9 A;  4KX5 A;  2XID A;  1ZQB A;  4P0P A;  2JH1 A;  4UAU A;  2KMD A;  1UET A;  3GU3 A;  2K60 A;  5KFA A;  9ICS A;  1KFS A;  2PXI A;  1URJ A;  8ICZ A;  1XNS A;  5DB9 A;  3AUO A;  1ZQO A;  2FCL A;  4OAF A;  1JXE A;  2Z7J A;  1L8O A;  1NO5 A;  4EZ9 A;  4EZ6 A;  3J81 j;  1SXE A;  8ICU A;  3DEE A;  2ZIX A;  2BGW A;  4ZOH C;  3HKZ C;  5KAI U;  1R8A A;  5KT2 A;  2KIC A;  3A0H U;  2EDU A;  1IXR A;  3KFU F;  4X0A A;  5JUM A;  4CF4 A;  5KFU A;  4CDG A;  4FBU A;  1B22 A;  2QLT A;  5L1I A;  4FH3 A;  1B0X A;  4A8E A;  2I6X A;  5KFI A;  5DQH A;  4QZG A;  4UAZ A;  4N7R A;  9ICQ A;  1N61 A;  2Q4T A;  1HUZ A;  2H3Z A;  2W54 A;  4O3Q A;  2ATL A;  1B43 A;  3HX0 A;  4UB5 A;  4UAV A;  5JTI A;  5HRD A;  4I2F A;  2KKP A;  5EOZ A;  2BPC A;  1C7Y A;  4ECS A;  2PI4 A;  4JUZ A;  1DGJ A;  5KFP A;  4O3N A;  3R9K A;  4P0P B;  1K1S A;  2QAR A;  3ZD8 A;  5J0U A;  1S0N A;  1SB3 C;  1A6S A;  3HJ4 A;  3VC8 A;  3QU7 A;  4CF5 A;  4C80 A;  4QIW C;  5ALW A;  4YVZ A;  2JEF A;  2XC9 A;  1ZQ1 C;  2BPG A;  2W7P A;  4K9A A;  8ICY A;  4YXJ A;  2ZIX B;  2FLL A;  4BDP A;  5HRF A;  2ZIW A;  2NV3 A;  5J2H A;  4WJ3 B;  2O5A A;  4NV0 A;  3HIL A;  3Q8M A;  3Q8R B;  3EF2 A;  3N7P D;  3OUY B;  3HJ1 A;  4KLQ A;  2QB0 A;  1MIW A;  4K99 A;  4S3N A;  3EPI A;  3C23 A;  1U48 A;  5IIJ A;  2BQU A;  5D4B A;  1ZQQ A;  4YG2 A;  3UXO A;  3RH4 A;  1O03 A;  3RB4 A;  2A1A A;  1CI4 A;  4KLJ A;  1D8L A;  4C4R A;  2QAR B;  1SL1 A;  1SKW A;  3CK6 A;  4Q8E A;  5KFO A;  3OVA A;  1CUK A;  2G06 A;  4O9M A;  4QZ8 A;  2XCP A;  1ARO P;  1WG8 A;  4B9M A;  3JPS A;  3MR3 A;  2F3N A;  1QQ6 A;  4DL4 A;  5ALG A;  3PNC A;  1KQQ A;  2GAF D;  1NI3 A;  1VDV A;  4TUR A;  2LMR A;  5CR0 A;  2BHN A;  2CRX A;  7ICG A;  8ICW A;  2F8L A;  1YZ7 A;  3N4M B;  1TAQ A;  3F5E A;  2VIX A;  2QB0 B;  3D2Q A;  5ALZ A;  4Q45 A;  3OTQ A;  1Z00 B;  5J8Y A;  3Q8K A;  1ZQI A;  2YN4 A;  2JEI A;  2KHV A;  1UEV A;  1NZB A;  4Y2S A;  7ICH A;  2AGQ A;  2XVT A;  1BPD A;  4WC2 A;  3T5H A;  2IOF K;  5AI9 A;  3JPR A;  1LV5 A;  5AKL A;  3H8S A;  9ICU A;  2ZJA A;  1ZQX A;  4RQ0 A;  4JMU A;  4K98 A;  8ICG A;  3MR6 A;  4TUP A;  4F93 B;  4O3R A;  2M0N A;  3QE9 Y;  2YTU A;  3MDA A;  3F2D A;  3OJU A;  4GFJ A;  4NXT A;  4Z6F A;  2ASL A;  3N7S C;  2ASD A;  2IA6 A;  1WCL A;  2AGP A;  4JB3 A;  3BS5 A;  4RUC A;  3TQ1 A;  3PZP A;  3JZ0 A;  3ZDA A;  1QLN A;  2KVC A;  3M7D A;  4DCC A;  3OSP A;  5ALU A;  2HSZ A;  5KFX A;  3UQ0 A;  2PFP A;  2W9C A;  5JTG A;  1ZYQ A;  3AQL A;  5HRE A;  1ZQF A;  5HHH A;  2GO7 A;  2FLN A;  1ZQP A;  1C20 A;  1T4G A;  2HHW A;  2KIV A;  3NUQ A;  4DFJ A;  2Y1I A;  9ICW A;  5J2G A;  5BPC A;  4MHV A;  2HHQ A;  2JV3 A;  7ICQ A;  2JMG A;  1JQR A;  2ZUD A;  3D2N A;  2ZH1 A;  4P4P A;  5AM3 A;  5CWR A;  3AMZ A;  2Q66 A;  4FH5 A;  3LK9 A;  4RWN A;  3MAB A;  3BJY A;  1S9F A;  7ICO A;  4KLO A;  1RYU A;  2O1P A;  4BWJ A;  4J9O A;  3ER8 C;  1SGG A;  2D3D A;  3T5L A;  2XY6 A;  7ICF A;  3OHA A;  2NRK A;  2F1J A;  2M2W A;  4QNL A;  2EAP A;  3VCB A;  5AKJ A;  4WBY A;  3C28 A;  2OHF A;  3IV6 A;  3UXP A;  4E7X A;  1RXW A;  5A0L A;  3KKA A;  3ISC A;  3GDX A;  3WK7 A;  3RJG A;  1F44 A;  4O5E A;  9ICJ A;  2R18 A;  4BXO A;  2W9C B;  2VJ4 A;  3ALR A;  3UPQ A;  3H0R B;  3ONN A;  2PMZ C;  8ICH A;  5J0O A;  5DBC A;  4G3I A;  3KHG A;  1PUZ A;  4F71 A;  3D2S A;  1TKD A;  4NWI A;  4F8R A;  4GLX A;  4CF3 A;  2RDI A;  4RPY A;  9ICB A;  4NXV A;  2A1J A;  3N28 A;  1MQ3 A;  2EAO A;  4CCH A;  4RT3 A;  5C5J A;  1RG6 A;  4Y2P A;  4PZN A;  2ISP A;  1N56 A;  2ZH5 A;  5DGA A;  4EBE A;  2HHU A;  2E8P A;  5L1M A;  2RQ5 A;  3THV A;  5DG9 A;  4XUS A;  2HOI A;  1ZD4 A;  4GXK A;  3B0Y A;  4RUA A;  2B4V A;  4P0Q B;  1JX4 A;  4M04 A;  4LEW A;  4RQ5 A;  8ICB A;  4IQV A;  2F2A B;  5DQI A;  1S0M A;  1RYR A;  4BXO B;  7ICP A;  4NL9 C;  5KG1 A;  1XU4 A;  5DEC A;  5DGB A;  3GIJ A;  4ECZ A;  2DWQ A;  8ICL A;  3GII A;  1OU5 A;  4DQQ A;  5KFS A;  3V7L A;  3QYP A;  4FO6 A;  1ZQD A;  1FFV A;  5E79 U;  4OJP A;  3H7I A;  2A1J B;  2VJ5 A;  3RBE A;  3LDA A;  2YMM A;  3D6J A;  3TAP A;  3UMB A;  4DLE A;  2XGP A;  3O0F A;  4R64 A;  5AKY A;  5KFD A;  9ICM A;  4AT9 A;  9ICX A;  3E2E A;  3L9D A;  1KN5 A;  3ZDB A;  8ICJ A;  4NKT A;  1XS9 D;  1MA7 A;  3QZ8 A;  4DSI A;  5CHG A;  5HMM A;  4J9L A;  3AU2 A;  2KE7 A;  3Q8L A;  1WYG A;  5KFB A;  2FMS A;  2BDU A;  2ZJ5 A;  5HC9 A;  4PGQ A;  3N97 B;  3AQF A;  3TI0 A;  1JUD A;  4ATB A;  4F5Q A;  2FMQ A;  1UQV A;  2WB1 F;  5FP0 A;  3PSI A;  4OAI Z;  2ZXH A;  5AK6 A;  2P66 A;  4Y2Y A;  4PJ0 U;  4R66 A;  4K8V A;  2KJ8 A;  5CEH A;  2IMW P;  4I27 A;  3H3A A;  1K1Q A;  3SAF A;  4I2C A;  4YR2 A;  2HVI A;  5ALT A;  4AT9 B;  1OUQ A;  3WFO A;  5KFJ A;  3WKC A;  1R89 A;  4LEY A;  3K1Z A;  5AHX A;  2OH2 A;  3SD7 A;  2K89 A;  1ZQC A;  4DQS A;  2KZM A;  1OW5 A;  3MBY A;  5D46 A;  1S77 D;  4UAY A;  4QWC A;  5AKZ A;  3PSP A;  1X40 A;  3WK4 A;  2IHM A;  3JPN A;  4R65 A;  5KFQ A;  1ZD2 P;  2EAN A;  4ATB B;  7ICE A;  3RH5 A;  2IOH A;  5KFW A;  3QU9 A;  1QSL A;  3E58 A;  1L3U A;  4OO1 J;  2EWR A;  5ALR A;  2QB1 A;  1JI7 A;  2MU2 A;  2BZF A;  4FHY A;  1O08 A;  4F72 A;  4CE6 A;  4O68 A;  5AM2 A;  5HHI A;  2HBL A;  3UXN A;  2F44 A;  4WBZ A;  4NXU A;  2W3R A;  3WFP A;  2I5H A;  3S6J A;  5F9L A;  3AL0 B;  1BPZ A;  3OJS A;  3GV8 B;  9ICP A;  2B0C A;  2R8K A;  1S97 A;  3SZ2 A;  1ZXI A;  3NKU A;  3UPS A;  4Y2Q A;  4UB1 A;  4QWA A;  3BQ7 A;  1X9W A;  4OAH A;  4DS5 A;  2LPE A;  3QX7 A;  5J0W A;  4RNN A;  1KFT A;  2KSO A;  4O3O A;  1ZQV A;  4GIB A;  1T3Q A;  3EUB 2;  1SV0 A;  3SR6 A;  3RFA A;  1MC8 A;  2XY5 A;  4XQ8 A;  2DVI A;  4C4S A;  4ED3 A;  5EWG A;  3ER9 B;  2NO5 A;  2PFO A;  1QCK A;  2V4Q A;  4DSF A;  1MIY A;  3PO5 A;  3NYB A;  1NK7 A;  3V6J A;  1NOM A;  1Q8K A;  4IC9 A;  1RPL A;  4P4O A;  5KFE A;  4Y2X A;  4DWI A;  1KKX A;  8ICX A;  4X0B A;  2FMP A;  1Z1B A;  2DKZ A;  2G0A A;  4Z6E A;  3G6X A;  1RDF A;  4PH5 A;  1UT5 A;  4WH5 A;  4J9K A;  2DR5 A;  3C2K A;  4F4Z A;  4C7Y A;  1Z3E B;  3ZDC A;  5TZV A;  2KSO B;  4ICA A;  2OWO A;  5CJ7 A;  1DK3 A;  1N48 A;  2KK0 A;  5KT5 A;  3RR8 A;  1COO A;  2FJ6 A;  1T7P A;  3RJJ A;  3WFS C;  2E1F A;  2YMQ A;  5AI8 A;  4MFA A;  3GFK B;  1PVP A;  3HPO A;  1BPE A;  3ISB A;  2JEG A;  4OJ5 A;  2HBM A;  3H39 A;  5HRH A;  1TFW A;  2Y0S F;  4BWM A;  2EZZ A;  4C8N A;  1HIW A;  3H40 A;  4NKU A;  3PX6 A;  4GXJ A;  4OCZ A;  5III A;  3WK6 A;  1BGX T;  2HCF A;  2ZUB A;  2W8L A;  2BQR A;  3CW2 C;  8ICS A;  4U7C A;  2JH7 A;  2RP5 A;  5AIA A;  3KD3 A;  2G5H B;  5AKI A;  4X4V A;  4WOY A;  4BGD A;  3GIM A;  4X4T A;  2DFL A;  1ZQG A;  2GLE A;  4LEZ A;  2ZH4 A;  1ZQL A;  2M2V A;  5IIK A;  3M6K A;  3RJH A;  1X9M A;  4WC3 A;  5ALX A;  4M9L A;  2K8A A;  2V9W A;  4RWQ A;  1U9L A;  4M9N A;  3KBB A;  3TAC B;  4LT6 A;  1DXS A;  2Y9U A;  5BOL A;  4EEN A;  4IRC A;  4NY8 A;  2JHD A;  2HHV A;  5AK3 A;  3OUY A;  5AK4 A;  1BNO A;  2VAN A;  5J0X A;  4QZD A;  2HHT A;  4BX9 C;  4B9L A;  3NRZ A;  3AEV A;  1ZQY A;  3IG5 A;  4KTQ A;  4K97 A;  1VJ5 A;  1D8B A;  1X9X A;  4DL5 A;  2BCS A;  4F91 B;  4ECR A;  3WKA A;  1ZQZ A;  1U45 A;  4OJO A;  4Y2J A;  3KHH A;  4M9J A;  3JPQ A;  9ICN A;  1NK4 A;  2ZUC A;  2YMP A;  1XC9 A;  3ED5 A;  1D8Y A;  2G07 A;  4IQU A;  1U49 A;  3Q8P B;  4RQ7 A;  2VA8 A;  4MFC A;  5B3Q A;  4RQN A;  4FS1 A;  1WCN A;  1D9D A;  7ICR A;  3ISD A;  2WFA A;  3PR4 A;  3HWT A;  3NTU A;  1ZQM A;  5AKG A;  4ED6 A;  1DK2 A;  4RPZ A;  4M9H A;  4FO1 A;  1CEZ A;  4KLI A;  1QQ7 A;  3C5G A;  3AQE A;  4DSK A;  1QQ5 A;  2J6S A;  1ZQR A;  2ZHA A;  2K4E A;  4X4P A;  4QZF A;  1V9P A;  1IG6 A;  5G5G A;  3H0L B;  5CP2 A;  3QU2 A;  4DL7 A;  1L5U A;  1QTM A;  4QWD A;  2PI5 A;  2E1E A;  2HBJ A;  2KFZ A;  5J0T A;  2BPF A;  4FZL A;  1ZRM A;  4JLZ A;  2Y9T A;  4MEX A;  2KTQ A;  3BS7 A;  2R8J A;  5IIO A;  2RDJ A;  1OXJ A;  2C28 A;  4YQW A;  4ECW A;  4XRH A;  3I28 A;  1L6N A;  1TK5 A;  5HP4 A;  4IQW A;  3C1Z A;  4F5P A;  3C29 A;  4LJX A;  1S0V A;  4E8F A;  3V7J A;  2LYB A;  5CFS A;  2W8K A;  4BUG A;  3L4P A;  5KG2 A;  4YMN A;  3RB0 A;  2WF8 A;  3K1R B;  1BNP A;  5GTI U;  4AT7 A;  2WF6 A;  5KTQ A;  1B4F A;  4EGW A;  2IHO A;  4C8M A;  1S0O A;  4KLL A;  2KVS A;  4RT2 A;  5HRL A;  5D61 A;  4PPX A;  5J0R A;  3HP6 A;  2LYA A;  5CRX A;  5KFG A;  1TK8 A;  4P2H A;  5AIC A;  2NRZ A;  8ICT A;  5EWF A;  2B56 A;  4TUQ A;  7ICN A;  2KFN A;  1X2I A;  1N2X A;  8ICK A;  1UA0 A;  2ZH6 A;  5AKX A;  4X4N A;  4KLU A;  1S5L U;  4RQ6 A;  3LVW A;  4C8O A;  4MFF A;  5AK5 A;  2KNJ A;  7ICI A;  1Q3U A;  2LM4 A;  3NVZ A;  3F53 A;  1ZD3 A;  2K8C B;  3SEN A;  4US9 A;  5HRK A;  2H3F A;  1H38 A;  3ETR A;  2UVW A;  5ALQ A;  4YMO A;  2MSN A;  2BCQ A;  2DRA A;  3M9M B;  4AT7 B;  5L1K A;  5D63 A;  1ZQA A;  2XCA A;  9ICO A;  4DSL A;  2KKV A;  4DQP A;  1YT3 A;  3PO4 A;  3SV4 A;  3AQM A;  2AXT U;  3KTQ A;  3RJI A;  1TFY A;  5KL1 B;  1Z1V A;  2C22 A;  2XIC A;  4C4T A;  4PHD A;  1D9F A;  2HVH A;  3K7D A;  4CRX A;  5KG0 A;  4ECQ A;  2H5X A;  3M8R A;  4J9P A;  3KOO A;  4QZB A;  4TQR A;  1ECW A;  1ZQT A;  2ZG6 A;  2Q0Z X;  5DB7 A;  4EYI B;  4UB6 U;  4RWP A;  5D49 A;  3TKA A;  1KEJ A;  5G5H A;  4R63 A;  3TAD C;  4DOC A;  2DRB A;  8ICE A;  5HR7 A;  4NXZ A;  4X5V A;  2ZJ8 A;  3I1Y A;  2W03 A;  2BKE A;  3SV3 A;  3H0M B;  5F9N A;  5AKH A;  1GO3 F;  3PST A;  2M2T A;  2HN2 A;  3KHR A;  4P0Q A;  1JN3 A;  1TVA A;  4NLG A;  3MGI A;  1F5A A;  5ALS A;  2RLT A;  4RQ2 A;  2W55 A;  3C1Y A;  1J97 A;  3LYS A;  2ODG A;  2OEH A;  1LVH A;  2HHP A;  3QXG A;  4QW8 A;  2KP7 A;  4Z6D A;  5DDM A;  3C5F A;  2XY7 A;  4USA A;  1XWL A;  1QSY A;  8ICO A;  3PHZ A;  2ZH7 A;  5KG5 A;  4PHE A;  2HW3 A;  3H37 A;  2HN1 A;  3IM1 A;  3QEB Z;  3SAH A;  1V4A A;  4I2I A;  4WCW A;  1KW4 A;  3PSF A;  2NRX A;  4IS7 A;  4C8L A;  5DG7 A;  3HKZ F;  3RH6 A;  4X4U A;  1ZJN A;  4UW9 A;  3H38 A;  4I2D A;  2EQY A;  8ICR A;  3Q8S B;  1IM4 A;  4FHW A;  2NYV A;  3AN1 A;  2FPL A;  4MKP A;  2JXJ A;  3MCR A;  4C8K A;  1UT8 A;  1KRP A;  4EEK A;  1GPJ A;  3A0B U;  4Z6C A;  1L7P A;  1PVR A;  2Y0S C;  2LHT A;  4EV6 A;  5C0Y A;  4LZD A;  4XQ7 A;  2W7O A;  2IBK A;  2BBJ A;  4K9B A;  2C2R A;  4RNO A;  2DR8 A;  2YQE A;  2FI1 A;  2BCU A;  2KG5 A;  1NKB A;  4WC7 A;  3QU5 A;  3PX0 A;  2RFF A;  3SYZ A;  3HJE A;  2OCE A;  2DL0 A;  5J0S A;  2NRV A;  4UQG A;  4F4K A;  3ICX A;  3QEA Z;  8ICV A;  4I29 A;  2FDR A;  4ECV A;  2B21 A;  3M6Z A;  4I0U A;  5EE1 A;  1LB2 B;  5K4L A;  3RB6 A;  4NL9 A;  3SQI A;  2DQN B;  5L9X A;  3ERC C;  2E8O A;  5ALF A;  4JWN A;  1SZP A;  1ZQE A;  4F4X A;  4J9S A;  5HNK A;  1FEZ A;  2RRD A;  5ALJ A;  2RHF A;  3TFR A;  1SWV A;  2FLP A;  5F2V O;  2EAM A;  2EZY A;  4B9S A;  5J2A A;  5KFN A;  5ALH A;  3C2L A;  4J9M A;  2HOQ A;  4K4H A;  4M0A A;  7ICV A;  4JLX A;  3MGH A;  1RXV A;  1TAM A;  4EEL A;  1BPX A;  4KLT A;  3C66 A;  1ED1 A;  2M9N A;  2EH9 A;  4F5O A;  4MEY A;  4FS2 A;  1UHU A;  2CN1 A;  2WF5 A;  5IIM A;  2ZXI A;  3QNM A;  4BJQ A;  1WWU A;  4ED7 A;  4FBT A;  4UD4 A;  4ED0 A;  4WC6 A;  2JEJ A;  1JAL A;  2QKQ A;  3K75 D;  3OHB A;  1XSN A;  2KJ5 A;  2W3S A;  4TQS A;  3BQ0 A;  4EEY A;  3MR5 A;  4KN4 A;  2IOF A;  7ICM A;  1ZOL A;  5J0P A;  1MQ2 A;  4EED A;  2WTF A;  4WC4 A;  5ALN A;  3SAG A;  4F50 A;  3IRU A;  1FA0 A;  4DOA A;  3FAH A;  3UMG A;  3EYZ A;  2V4R A;  9ICH A;  3EPG A;  3H8J A;  2R8H A;  1X66 A;  2B6G A;  1K5O A;  3GIK A;  4UD5 A;  1WWV A;  2FPM A;  4R8U A;  4RZR A;  2E8M A;  4IL6 U;  4RQ1 A;  3T3F A;  4YCX A;  4B9T A;  4IR1 A;  3V72 A;  3PML A;  4ECU A;  4I2J A;  4B9U A;  4FFD A;  1UA1 A;  1N60 A;  1BPY A;  1V38 A;  4DFD A;  5CA7 A;  4DQI A;  4PHP A;  3UM9 A;  3F5A A;  1JIH A;  3TAN A;  5DB6 A;  3GQC A;  3SMV A;  2G09 A;  3SEI A;  1LKY A;  1RQL A;  1HUO A;  3WKB A;  4DS4 A;  1PVQ A;  3CRX A;  4KX3 A;  4HYK A;  5AI0 A;  4XA5 A;  3MR2 A;  2WF7 A;  4Y2V A;  1A0P A;  2ES6 A;  2JGA A;  3HW8 A;  4EX6 A;  2ZTC A;  2LYH A;  1ZQS A;  2ZHB A;  4JWM A;  4R8U B;  5T14 A;  4OD0 A;  4DL3 A;  4US8 A;  4O67 A;  4ED8 A;  5GTH U;  5CHE A;  5J2F A;  5ALE A;  2ZTD A;  2MUT A;  5KG7 A;  1PZN A;  4Q44 A;  2W11 A;  4C0Z A;  5JU5 A;  3HT3 A;  4DO9 A;  3PW0 A;  4IRD A;  4DL2 A;  5J0Y A;  1XSL A;  4FHX A;  2AGO A;  1LKY B;  5HML A;  3CP8 A;  4YMM A;  2NRW A;  4WC0 A;  1KSP A;  2HMX A;  5L1J A;  3RR7 A;  1L7O A;  1SV4 A;  3TAQ A;  4NLK A;  3C2M A;  2P35 A;  4NLZ A;  1UCV A;  4UBB A;  3UMC A;  4KB6 A;  3H4B A;  1WUD A;  2GOL A;  5DDY A;  1SL2 A;  1L7M A;  3RB3 A;  1X6J A;  3EW9 A;  4O0I A;  4PL2 A;  2Y1J A;  2XI9 A;  2H3I A;  3PW7 A;  2AQ4 A;  3RAX A;  2ZIU B;  5KT7 A;  5KFY A;  4X4R A;  4KIT B;  4NLB A;  9ICT A;  1J2M A;  2MUT B;  4DSJ A;  2FPK A;  4RPX A;  3NS1 A;  1T94 A;  3DV9 A;  8ICI A;  4QZE A;  4UB3 A;  1NKE A;  2UVV A;  1ZET A;  4Q8F A;  5CFT A;  4RQ8 A;  4CGZ A;  3IDW A;  4DFP A;  5KL8 B;  2VA3 A;  4MF2 A;  3F2C A;  4TUS A;  5HRG A;  1J2N A;  1X6I A;  3M9N B;  2K4P A;  2JR5 A;  1DGS A;  5J2K A;  2G5I B;  3RTV A;  3OGU A;  3LVV A;  2BDP A;  3NAS A;  1A76 A;  5AM4 A;  2GA9 D;  2LM1 A;  1ZRN A;  4IR9 A;  1FIQ A;  7ICK A;  4OJL A;  2KD1 A;  4NM2 A;  4KMO B;  5IIL A;  1COK A;  3BZK A;  3RBD A;  2NRT A;  7ICU A;  1XO0 A;  4QZ9 A;  4RQ4 A;  1TE2 A;  4PGY A;  2G08 A;  3NWI A;  3WKE A;  1RYS A;  5JRT A;  2EZX A;  4NJ8 A;  5B66 U;  3JPP A;  1Z19 A;  3DDH A;  2KHQ A;  2VKQ A;  1EXN A;  4O5K A;  1HJP A;  2W04 A;  1QSS A;  3BZC A;  5ALY A;  2D6F C;  3NRW A;  5KFC A;  9ICK A;  2DGZ A;  5J2B A;  3ETL A;  4ACO A;  4Y2T A;  3OVS A;  3EZ5 A;  3PR5 B;  3H4D A;  1N5W A;  1NJZ A;  4PZO A;  4QWB A;  4DEZ A;  3U26 A;  4F4W A;  2DPI A;  3MDC A;  1M6Y A;  1ZD5 A;  5AM1 A;  3IN5 A;  2AJQ A;  4X4O A;  4FHV A;  2XGQ A;  2NO4 A;  1UPH A;  4KLE A;  1VJ7 A;  4J9Q A;  2BCV A;  4Y2U A;  2KZZ A;  2DUY A;  3OWG A;  4DF4 A;  4F3O A;  3E0F A;  5KFM A;  1PK1 A;  4IRK A;  1V97 A;  3F2B A;  5HRB A;  2JRZ A;  2OXO A;  3H8M A;  4QWE A;  1WOT A;  2KJ9 A;  2YML A;  4I2E A;  1RQN A;  4F2S A;  2BR0 A;  2DBY A;  1HEK A;  3ORY A;  4UAS A;  3BQ1 A;  2WAQ F;  3I76 A;  9ICF A;  8ICN A;  3RAQ A;  4JV0 A;  1NK8 A;  4K4I A;  4RQ3 A;  4ECX A;  4I28 A;  2OM6 A;  2A19 A;  2CXY A;  3C18 A;  4NXX A;  4ED1 A;  5AI5 A;  5HRI A;  2P6U A;  4J03 A;  4F5N A;  3OPX A;  2WB1 C;  4I2A A;  3QUT A;  1UEU A;  4X4S A;  5KFH A;  2I1Q A;  3AM9 A;  4JK1 A;  4DSE A;  8ICM A;  2W9A A;  1F0M A;  5EE3 A;  1ZQW A;  3ZI4 A;  5ALV A;  3H8W A;  9ICV A;  2E3T A;  2FE9 A;  2AU0 A;  2E5S A;  4M47 A;  1PK1 B;  5DED A;  4MF8 A;  1Z00 A;  3FC4 A;  2BQ3 A;  1JXL A;  5J8Y C;  4OAG A;  1NZP A;  2ZIW B;  2XO7 A;  5HR9 A;  2L5Y A;  3QZ7 A;  4DF8 A;  4UB8 U;  1T3N A;  5AKE A;  3G6V A;  1RM6 C;  4XJE A;  2PBE A;  3PW2 A;  1TK0 A;  4UBC A;  3TFS A;  5DQG A;  2KN7 A;  3NVY A;  2CPR A;  4YD2 A;  9ICR A;  1U47 A;  2K8B B;  2HHS A;  3CNH A;  5ALK A;  3M1Y A;  2BBH A;  5CB1 A;  4KN7 A;  3EWA A;  1JAJ A;  3MGV A;  1NJY A;  3V7K A;  5KG3 A;  1SKS A;  4JV1 A;  8ICQ A;  8ICA A;  1S10 A;  2HI0 A;  3WFR E;  2JZB A;  4NXW A;  5AKK A;  1FO4 A;  3UQ2 A;  3RJE A;  5KG4 A;  3RF9 A; 
#chains in the Genus database with same CATH homology
 3GV7 B;  4ECS A;  2PI4 A;  4KLH A;  4JUZ A;  5KFP A;  4O3N A;  2PFO A;  3TFR A;  4YXM A;  1K1S A;  2V4Q A;  4KLM A;  4DSF A;  4M2Y A;  1MIY A;  3PV8 A;  3ZD8 A;  2FLP A;  3PO5 A;  5J0U A;  1S0N A;  5F2V O;  3NYB A;  1NK7 A;  4B9S A;  3HJ4 A;  3OVB A;  3V6J A;  3IHQ B;  5J2A A;  5KFN A;  2UVU A;  1NOM A;  4YVZ A;  2JEF A;  4J9M A;  3C2L A;  1NJX A;  2XC9 A;  1RPL A;  5J29 A;  4K4H A;  4M0A A;  4P4O A;  7ICV A;  1DOQ A;  5KFE A;  2MAX A;  5KFF A;  4LVS A;  2DR9 A;  4J9N A;  2ZH9 A;  1NJW A;  2BPG A;  4DWI A;  4ED2 A;  4M6W A;  7ICJ A;  3MGH A;  1RXV A;  2J6T A;  1BPX A;  4LZG A;  4KLT A;  8ICY A;  3C66 A;  4GC7 A;  4YXJ A;  2M9N A;  4NLN A;  4F5O A;  4MEY A;  8ICX A;  4X0B A;  2FMP A;  2FLL A;  4FS2 A;  4BDP A;  5HRF A;  3C21 A;  1ZQN A;  1KLN A;  3HIY A;  3PW5 A;  5J2H A;  4Z6E A;  1R8C A;  3G6X A;  4PH5 A;  5IIM A;  5HNK A;  2O5A A;  1UT5 A;  3PVX A;  2W9B A;  4J9K A;  4ED7 A;  3Q8M A;  4FBT A;  4UD4 A;  2ID1 A;  3Q8R B;  2DR5 A;  4ED0 A;  4WC6 A;  3OUY B;  2JEJ A;  3HJ1 A;  4KLQ A;  3C2K A;  4PGX A;  5J0Q A;  3K75 D;  4KMU A;  3OHB A;  1XSN A;  4F4Z A;  1MIW A;  4S3N A;  1Z3E B;  4TQS A;  3BQ0 A;  5TZV A;  3MR5 A;  3EPI A;  4EEY A;  3C23 A;  4KN4 A;  3ZDC A;  1U48 A;  2OWO A;  7ICM A;  5CJ7 A;  9ICC A;  1DK3 A;  3BQT A;  5IIJ A;  2JZB B;  2BQU A;  1N48 A;  3T5J A;  4RNM A;  5J0P A;  5KT5 A;  1MQ2 A;  2DPJ A;  2WTF A;  4WC4 A;  5D4B A;  4B9V A;  3RR8 A;  5BOM A;  1COO A;  4YG2 A;  1ZQQ A;  3M8S A;  3UXO A;  3RH4 A;  1T7P A;  3RJJ A;  3WFS C;  3RB4 A;  4MFA A;  4F50 A;  3GFK B;  9ICE A;  1ZQH A;  4EYH B;  1KDH A;  1FA0 A;  5L1L A;  3HPO A;  1BPE A;  1D8L A;  4DOA A;  4KLJ A;  9ICH A;  3ISB A;  2V4R A;  3EYZ A;  2PFN A;  3EPG A;  3H8J A;  1SL1 A;  1SKW A;  2JEG A;  4E80 A;  4O5C A;  1X9S A;  2R8H A;  4Q8E A;  5KFO A;  3H39 A;  5HRH A;  3OVA A;  1CUK A;  1TFW A;  2UVR A;  3FDS A;  4Q43 A;  2C2E A;  4O9M A;  3GIK A;  4BWM A;  5KFL A;  4C8N A;  4QZ8 A;  2XCP A;  3H40 A;  1ARO P;  4UD5 A;  2FPM A;  4B9M A;  4R8U A;  3JPS A;  3MR3 A;  1ZJM A;  4RZR A;  4QZH A;  4M6W B;  4NKU A;  4RQ1 A;  3T3F A;  3PX6 A;  1L3T A;  2VA2 A;  4YCX A;  4B9T A;  4IR1 A;  2GWS A;  3V72 A;  4GXJ A;  4DL4 A;  1MSW D;  5III A;  3ZD9 A;  3PML A;  3PNC A;  4ECU A;  4I2J A;  1NK5 A;  4KLS A;  1BGX T;  2ZUB A;  4B9U A;  2W8L A;  2BQR A;  1UA1 A;  8ICS A;  4PHA A;  4TUR A;  1BPY A;  4O3S A;  4DQI A;  5CR0 A;  2BHN A;  5CA7 A;  4X4V A;  4BGD A;  4PHP A;  3GIM A;  7ICG A;  4M9G A;  8ICW A;  2W9B B;  4X4T A;  1S76 D;  2DFL A;  3OV7 A;  1JIH A;  4F4Y A;  3N4M B;  1TAQ A;  4RU9 A;  1ZQG A;  4K4G A;  3TAN A;  2ZH4 A;  1ZQL A;  5DB6 A;  2M2V A;  1BVS A;  4Q45 A;  3GQC A;  5IIK A;  1Z00 B;  3Q8K A;  3RJH A;  4YD1 A;  1X9M A;  1ZQI A;  4WC3 A;  4UAW A;  4M9L A;  2JEI A;  2V9W A;  4RWQ A;  1U9L A;  1HUO A;  4M9N A;  4LT6 A;  1UEV A;  4DS4 A;  1SL0 A;  7ICH A;  2AGQ A;  2AQ0 A;  5BOL A;  5KFZ A;  4UB4 A;  1BPD A;  4HYK A;  4WC2 A;  3T5H A;  3JPR A;  4XA5 A;  3MR2 A;  1LV5 A;  4IRC A;  4NY8 A;  3AQN A;  3JYY A;  3H8S A;  2HHV A;  9ICU A;  2ZJA A;  1ZQX A;  5EWE A;  4RQ0 A;  5KFT A;  3OUY A;  1BNO A;  2VAN A;  5J0X A;  3HW8 A;  2R8G A;  4QZD A;  3MR6 A;  8ICG A;  1TAU A;  2ZTC A;  2LYH A;  1ZQS A;  4TUP A;  4ECY A;  2HHT A;  4RWO A;  2ZHB A;  1ZQJ A;  4JWM A;  4B9L A;  4F93 B;  4O3R A;  4R8U B;  3QE9 Y;  1ZQY A;  2ZH8 A;  4KTQ A;  3MDA A;  3OJU A;  4DL3 A;  4DL5 A;  2BCS A;  4Z6F A;  4F91 B;  4ED8 A;  5DLG A;  2ASL A;  3KHL A;  4JV2 A;  4ECR A;  4E0D A;  5J2F A;  2ASD A;  1ZQZ A;  7ICL A;  1U45 A;  2IA6 A;  2ZTD A;  1WCL A;  2AGP A;  4WC5 A;  3KHH A;  2MUT A;  4RUC A;  5KG7 A;  1PZN A;  3TQ1 A;  4M9J A;  1VFG A;  3JPQ A;  1NKC A;  4Q44 A;  9ICN A;  2ASJ A;  1T8E A;  3JZ0 A;  1NK4 A;  2ZUC A;  3HT3 A;  1XC9 A;  4ELV A;  5J2E A;  1D8Y A;  1TFR A;  4IQT A;  4IQU A;  4DO9 A;  1U49 A;  1NK0 A;  3ZDA A;  3PW0 A;  3Q8P B;  4F92 B;  4RQ7 A;  2VA8 A;  4DFM A;  4IRD A;  4MFC A;  3OSP A;  1NK9 A;  2ISO A;  4DL2 A;  5J0Y A;  1XSL A;  4FHX A;  4FS1 A;  1WCN A;  5KFX A;  4EBD A;  3UQ0 A;  1D9D A;  2AGO A;  2PFP A;  2W9C A;  4YR0 A;  7ICR A;  5HML A;  3ISD A;  5J2C A;  1ZYQ A;  4YMM A;  2NRW A;  4WC0 A;  3AQL A;  3PR4 A;  1KSP A;  5L1J A;  5HRE A;  3HWT A;  3RR7 A;  1ZQF A;  3NGD A;  4EP7 A;  3NTU A;  1ZQM A;  5HHH A;  1XSP A;  3TAQ A;  2FLN A;  4NLK A;  5J2J A;  3C2M A;  4ED6 A;  1ZQP A;  4NLZ A;  1DK2 A;  1T4G A;  4RPZ A;  4UBB A;  3ZDE A;  4YFK A;  4M9H A;  2HHW A;  4DFJ A;  1CEZ A;  2Y1I A;  4KLI A;  1ZQK A;  5KG6 A;  9ICW A;  5DKW A;  5J2G A;  5BPC A;  3C5G A;  3H4B A;  4DSK A;  1U4B A;  2HHQ A;  7ICQ A;  1L3V A;  5DDY A;  1SL2 A;  3RB3 A;  2J6S A;  1ZQR A;  1JQR A;  2ZHA A;  2ZUD A;  4KLG A;  2ZH1 A;  4P4P A;  5CWR A;  2Q66 A;  4X4P A;  4FH5 A;  4QZF A;  3LK9 A;  3MAB A;  5KFR A;  1R8B A;  3EW9 A;  4QZI A;  4O0I A;  1V9P A;  4RWN A;  3BJY A;  5CP2 A;  4DL7 A;  1S9F A;  4I2H A;  1L5U A;  1QTM A;  4KLO A;  7ICO A;  4QWD A;  2HHX A;  2O1P A;  2PI5 A;  4BWJ A;  9ICA A;  4J9O A;  2Y1J A;  4O3P A;  3PW7 A;  3V6H A;  2AQ4 A;  3RAX A;  3SI8 A;  5DBA A;  5KT7 A;  3T5L A;  2KFZ A;  5KFY A;  5J0T A;  2BPF A;  2XY6 A;  4X4R A;  4KIT B;  4EBC A;  4AT8 A;  7ICF A;  3OHA A;  9ICT A;  2NRK A;  2F1J A;  4F5R A;  2M2W A;  2MUT B;  4MEX A;  2KTQ A;  2P6R A;  2R8J A;  8ICF A;  5IIO A;  4DSJ A;  3MFI A;  2RDJ A;  4WBY A;  2FPK A;  4RPX A;  2C28 A;  3UXP A;  4YQW A;  1L3S A;  4YN4 A;  4ECW A;  4XRH A;  1RXW A;  3JPO A;  4B9N A;  4E7X A;  8ICI A;  4KLD A;  4QZE A;  3ISC A;  3GDX A;  1TK5 A;  5HP4 A;  4IQW A;  3C1Z A;  4UB3 A;  2BE3 A;  3RJG A;  9ICJ A;  4F5P A;  4O5E A;  1NKE A;  2UVV A;  3PY8 A;  4BXO A;  2W9C B;  1ZET A;  4Q8F A;  8ICP A;  1S0V A;  4RQ8 A;  3UPQ A;  5IIN A;  4E8F A;  4DFP A;  1YLQ A;  4DL6 A;  8ICH A;  4EBK A;  5J0O A;  2VA3 A;  4MF2 A;  4QW9 A;  5DBC A;  3V7J A;  4TUS A;  3MFH A;  4G3I A;  5HRG A;  3KHG A;  2W8K A;  3M9N B;  5KG2 A;  4YMN A;  4DQR A;  1TKD A;  1DGS A;  4ECT A;  5J2K A;  4QZC A;  3RB0 A;  1BNP A;  1RZT A;  3RTV A;  4I2G A;  4F8R A;  4GLX A;  1Q78 A;  4AT7 A;  5KTQ A;  3OGU A;  3PW4 A;  2F1I A;  4DOB A;  2RDI A;  1A76 A;  2BDP A;  2W9M A;  4C8M A;  4RPY A;  9ICB A;  1S0O A;  3AQK A;  4J9R A;  5J2I A;  2A1J A;  4KLL A;  4IR9 A;  2M2U A;  4RT2 A;  5HRL A;  7ICK A;  2I9G A;  1A77 A;  5EWG A;  5J0R A;  3HP6 A;  1MQ3 A;  4PPX A;  3LWM A;  4NM2 A;  5KFG A;  3T5K A;  4CCH A;  5IIL A;  4RT3 A;  1TK8 A;  5C5J A;  2BCR A;  4ELT A;  4P2H A;  2NRZ A;  3RBD A;  2ISP A;  1N56 A;  8ICT A;  2NRT A;  7ICU A;  2KZ3 A;  5EWF A;  2ZH5 A;  1Y88 A;  4QZ9 A;  4TUQ A;  5DGA A;  4RQ4 A;  4EBE A;  9ICG A;  4AT8 B;  7ICN A;  3K4G A;  4PGY A;  2HHU A;  4YR3 A;  2KFN A;  1X2I A;  3G6Y A;  4KLF A;  1RYS A;  3THV A;  3GV5 B;  8ICK A;  5DG9 A;  1UA0 A;  4FHP A;  2ZH6 A;  4X4N A;  4XUS A;  4KLU A;  3JPP A;  3WFQ E;  3PX4 A;  3RJF A;  4RQ6 A;  4GXK A;  3RRG A;  4C8O A;  4MFF A;  3B0Y A;  4RUA A;  2C2D A;  1JX4 A;  4M04 A;  5KT6 A;  4RQ5 A;  2ZTE A;  7ICI A;  4ELU A;  1EXN A;  8ICB A;  2IHN A;  4IQV A;  4O5K A;  5KFV A;  5DG8 A;  1HJP A;  5DB8 A;  3Q8Q B;  5DQI A;  1BPB A;  1S0M A;  1RYR A;  1QSS A;  4BXO B;  7ICP A;  3LQC B;  5KG1 A;  1XU4 A;  1KTQ A;  5DGB A;  3GIJ A;  5DEC A;  4ECZ A;  7ICS A;  5HRK A;  4QZA A;  1H38 A;  8ICL A;  3GII A;  2UVW A;  4YMO A;  4X4Q A;  1OU5 A;  4IG8 A;  4DQQ A;  5KFS A;  2BCQ A;  3V7L A;  5KFC A;  9ICK A;  5DBB A;  4M5D A;  3M9M B;  4AT7 B;  2DRA A;  5L1K A;  5J2B A;  3ETL A;  1ZQA A;  2XCA A;  4FO6 A;  4GXI A;  1ZQD A;  3OVS A;  3GIL A;  3EZ5 A;  5DLF A;  4DSL A;  9ICO A;  3PR5 B;  4DQP A;  3AU6 A;  2DR7 A;  3H7I A;  2A1J B;  4NM1 A;  5J2D A;  3H4D A;  3LDA A;  3RBE A;  1ZQU A;  3PO4 A;  3TAP A;  4I2B A;  3SV4 A;  3AQM A;  4DLE A;  2XGP A;  4UB2 A;  4R64 A;  1NJZ A;  2ALZ A;  4QWB A;  5KFD A;  3KTQ A;  4DEZ A;  3RJI A;  4F4W A;  2DPI A;  9ICM A;  1TFY A;  3MDC A;  4AT9 A;  9ICX A;  3E2E A;  3L9D A;  2C22 A;  3BQ2 A;  2AJQ A;  4PHD A;  4X4O A;  1D9F A;  3ZDB A;  2HVH A;  8ICJ A;  2XGQ A;  1KNY A;  4FHV A;  4NKT A;  3TAR A;  5KG0 A;  2F1H A;  1XS9 D;  4KLE A;  1VJ7 A;  4J9Q A;  3QZ8 A;  2BCV A;  4DSI A;  2ZH3 A;  1KFD A;  4ECQ A;  1JMS A;  2H5X A;  3M8R A;  5CHG A;  4DLG A;  2KZZ A;  5HMM A;  4J9L A;  5KFK A;  3AU2 A;  3RJK A;  3V6K A;  4J9P A;  4QZB A;  4TQR A;  3Q8L A;  1ZQT A;  5KT4 A;  5KFB A;  4GC6 A;  2Q0Z X;  4DF4 A;  4F3O A;  5KFM A;  5DB7 A;  4EYI B;  4IRK A;  4RWP A;  2FMS A;  5D49 A;  3OSN A;  5HRB A;  3M9O B;  2ZJ5 A;  1KEJ A;  5HC9 A;  4QWE A;  1WOT A;  4PGQ A;  4R63 A;  4DOC A;  3N97 B;  2DRB A;  3TI0 A;  8ICE A;  2R8I A;  4ATB A;  3JPT A;  4I2E A;  4F2S A;  4F5Q A;  2BR0 A;  9ICL A;  4NXZ A;  4X5V A;  2ZJ8 A;  2FMQ A;  3ORY A;  1PX5 A;  4WC1 A;  2J6U A;  1SKR A;  3BQ1 A;  9ICF A;  2BKE A;  3SV3 A;  1QLN A;  5F9N A;  3RAQ A;  8ICN A;  3B0X A;  4JV0 A;  1NK8 A;  2P66 A;  3RRH A;  3BDP A;  4K4I A;  4RQ3 A;  2M2T A;  1Q79 A;  3KHR A;  4ECX A;  2ZH2 A;  4P4M A;  4R66 A;  4I28 A;  1JN3 A;  1TVA A;  4NLG A;  3MGI A;  1F5A A;  4YP3 A;  2IMW P;  4I27 A;  3H3A A;  1K1Q A;  2PFQ A;  3C18 A;  4RQ2 A;  3C1Y A;  4I2C A;  4YR2 A;  2HVI A;  4ED1 A;  3PMN A;  7ICT A;  5HRI A;  9ICI A;  2P6U A;  2HHP A;  4AT9 B;  4QW8 A;  2KP7 A;  3WFO A;  4Z6D A;  5DDM A;  3C5F A;  4F5N A;  5KFJ A;  4DFK A;  1XWL A;  2XY7 A;  1QSY A;  1MIV A;  1R89 A;  8ICO A;  2ZH7 A;  4I2A A;  5KG5 A;  3FYH A;  1XO1 A;  4PHE A;  2HW3 A;  1UEU A;  3H37 A;  4X4S A;  1NK6 A;  1ZQC A;  3ZDD A;  4ZH4 A;  2I1Q A;  5KFH A;  4DQS A;  2KZM A;  8ICC A;  4JK1 A;  4DSE A;  8ICM A;  5KT3 A;  2W9A A;  3IM1 A;  3MBY A;  1ZQW A;  5D46 A;  3QEB Z;  3H8W A;  1S77 D;  4UAY A;  4QWC A;  1V4A A;  4I2I A;  9ICV A;  4EBJ A;  4F2R A;  4WCW A;  2AU0 A;  2NRX A;  4C8L A;  4M47 A;  3LWL A;  5DED A;  4MF8 A;  1Z00 A;  5DG7 A;  4X4U A;  3RH6 A;  1ZJN A;  2BQ3 A;  1TV9 A;  1JXL A;  3H38 A;  4I2D A;  3JPN A;  2IHM A;  1NZP A;  4R65 A;  2XO7 A;  5KFQ A;  1ZQB A;  8ICR A;  5HR9 A;  3QZ7 A;  3Q8S B;  4ATB B;  7ICE A;  4DF8 A;  3RH5 A;  1IM4 A;  1T3N A;  1UET A;  4FHW A;  2FPL A;  5KFW A;  5KFA A;  1QSL A;  3G6V A;  4C8K A;  1UT8 A;  2PXI A;  1L3U A;  1KFS A;  1KRP A;  9ICS A;  8ICZ A;  4Z6C A;  2PBE A;  3PW2 A;  5DB9 A;  3AUO A;  1TK0 A;  4UBC A;  1ZQO A;  4FHY A;  1JXE A;  4LZD A;  4XQ7 A;  5HHI A;  3TFS A;  3UXN A;  5DQG A;  2KN7 A;  2IBK A;  4YD2 A;  9ICR A;  1NO5 A;  4EZ9 A;  1U47 A;  2C2R A;  4RNO A;  4EZ6 A;  2HHS A;  4WBZ A;  2DR8 A;  3WFP A;  5F9L A;  8ICU A;  2BGW A;  2BCU A;  1BPZ A;  1R8A A;  1NKB A;  5KT2 A;  3OJS A;  3GV8 B;  9ICP A;  4WC7 A;  1IXR A;  4X0A A;  5JUM A;  3PX0 A;  5KFU A;  2RFF A;  4FBU A;  1B22 A;  3SYZ A;  2R8K A;  5CB1 A;  5L1I A;  4FH3 A;  1S97 A;  4KN7 A;  3SZ2 A;  3EWA A;  3UPS A;  1JAJ A;  1NJY A;  4UQG A;  5J0S A;  2NRV A;  4UB1 A;  4QWA A;  3V7K A;  4F4K A;  3QEA Z;  5KG3 A;  5KFI A;  5DQH A;  4QZG A;  4UAZ A;  8ICV A;  4I29 A;  1X9W A;  4DS5 A;  4ECV A;  9ICQ A;  2B21 A;  1SKS A;  4JV1 A;  1HUZ A;  1KFT A;  5J0W A;  4RNN A;  1LB2 B;  8ICQ A;  4O3O A;  3RB6 A;  8ICA A;  4O3Q A;  2ATL A;  1B43 A;  1S10 A;  1ZQV A;  5L9X A;  4UB5 A;  2JZB A;  3HX0 A;  3WFR E;  5HRD A;  4I2F A;  4JWN A;  2XY5 A;  1MC8 A;  1SZP A;  4XQ8 A;  3UQ2 A;  1ZQE A;  3RJE A;  2DVI A;  4F4X A;  4J9S A;  5EOZ A;  4ED3 A;  5KG4 A;  2BPC A;  1C7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...