3EF2A

Structure of the marasmius oreades mushroom lectin (moa) in complex with galalpha(1,3)[fucalpha(1,2)]gal and calcium.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
292
structure length
291
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of a Lectin from the Mushroom Marasmius oreades in Complex with the Blood Group B Trisaccharide and Calcium.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Sugar binding protein
molecule keywords Agglutinin
total genus 89
structure length 291
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ef2A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ef2A02
3V0AB 1DLLA 2HWMA 4QD2B 3B9UA 4LO2A 1CE7B 2P23A 3AH4A 4JPZA 4IYBA 3FJEA 3F1RA 5D62A 4KBBA 3BB2A 1NZKA 1RY7A 2Y9GA 3WINC 1AVXB 4I37A 2VSAA 1YBIA 1KNMA 3UD8A 3QYDA 3BRGC 1RMLA 4Q9PA 7I1BA 3A21A 2ESUA 3O5WB 4X3AA 2D24A 3CAHA 1D0HA 1HWNB 3POKA 1II4A 4QALA 3RTIB 5BQUC 2F2FC 4F34A 3O4BA 2VXTI 2QYIB 1HWOB 3VSFA 4OUJA 2MIBA 3R4SA 4FVVA 2D1ZA 2VSEA 2AFGA 2ERMA 4GAFA 3H6SE 1GGPB 4QC4A 3FJCA 2VU9A 4ENDA 4EFPA 3VT2A 1JQZA 4G9NA 1F31A 1BLAA 1YF8B 3FUQA 1IOBA 2KKIA 3RSJA 1DJSB 3BA4A 3ZC9A 3HALA 2BEBA 3RTJB 3VT0A 1AF9A 4P0KA 3K1XA 2FDBM 41BIA 2K4AB 5DVHA 1ISVA 3NJ5A 1XYFA 3BTAA 3I2XA 1W3AA 2RG9B 1DIWA 4IZXA 1IRPA 5DZUA 3WO4A 5F90A 3R4UA 4OWLA 3FJ9A 1EV2A 3CA3A 3SNVA 2VXRA 4P0JA 2Y9FA 3VUOA 4G6MA 4ZFWB 1SR4A 2FGFA 3WO3A 3MPPG 5DSSB 1JT5A 5F8YA 3FJJA 4USOA 4I4RA 4QKSA 4P0LA 4XFTA 4EFQA 4HR6C 1ILR1 2AQZA 3CRIA 1HIBA 4I4PA 1ISXA 2F2FA 3Q7YA 1P63A 1DZDA 2NYYA 3LLPA 4YOLA 4J2XA 3IIRA 4J2YA 3BAHA 4G6JA 2D7IA 3N7JA 3TC2A 5FNWA 4I1EA 1S0CA 1IRAX 4LO7B 2RQ9A 2NZ9A 5FZUA 1XHBA 2E4MA 3H6RB 1ONKB 4QKRA 4GP0A 3OBRA 3UDAA 3A22A 5EC5A 2HW9A 1YYNA 4TLPA 1WBAA 1J0SA 1PUMB 5BXTA 1V6WA 3WMUA 2LIQA 1FWVA 3O3QA 3AJ6A 1A8DA 4AN7B 3BRDA 3VT1A 3VSZA 2GZBA 1ISZA 3OJ2A 3NBDA 2XOAA 3CA0A 3S8KA 4JP0A 2DREA 4JRAA 2KI6B 4LO7C 2Z49A 4G9MA 3AH2A 3RMYA 1Z0HA 4LO2C 2Q3NB 1UPSA 1BFGA 1W3FA 3UD7A 5BOWA 1PC8B 1PWAA 3ZXGA 1S0GA 3O4DA 2NVHA 3AKHA 3V0BB 3BA5A 4OEGA 1JLXA 3AZVA 1HWMB 2Z48A 3BA7A 4KEKA 5FZYA 1G9AA 1TOOA 3V0BA 21BIA 3HN1A 1E0OA 1YTOA 1JLYA 1Q1UA 4IZEA 4XFUA 3I2AA 2NM1A 1S0DA 2VLCA 5FZZA 3A07A 4I1BA 5BXPA 3H6RA 1YXWA 3BAUA 4Z8SB 1DFQA 3LTQA 1NUNA 1PUUB 4LO1C 1R8OA 3OGGA 4I4XA 2E4MC 3ZX7A 3WO2A 1IILA 3ZC8A 1R8NA 1WD4A 3N7LA 2KH2A 3H6QA 4X37A 1M16A 2WRYA 31BIA 4HA2A 4ZFYB 3S8JA 2ZQNA 3FJIA 1FMMS 4ZGRB 2IWTB 1Q04A 1HWPB 4I0YA 1BFCA 4I6IA 1BFFA 1JT4A 1V6XA 2DRYA 3BX1C 3BADA 1EYLA 2Q9XA 5BP5C 3I29B 1S0FA 1FN0A 1JTCA 5BQUA 1JT7A 1HCDA 1K5UA 1I1BA 2IHOA 4ZBVB 3WINA 3OJMA 2ZR1B 1G82A 4IONA 1FWUA 4USPA 4X38A 5D63A 4IY8A 3V79C 2F8XC 1AFCA 5JLVA 1L2HA 1MC9A 4EB2B 2FFUA 1AVAC 2P39A 3CA4A 2RSTA 4I7IA 4I4VA 1BASA 1ITBA 4XFSA 4PC4A 5F8WA 5I1BA 3IM7A 4LO8B 4XKIA 1BLDA 3FFZA 1JT3A 2J3PA 6I1BA 2D44A 5B2HA 1IHKA 3FGMA 4Z9WB 1DQOA 1BA7A 3FUOA 3UJ0A 1VCLA 3BAGA 3F62B 4AN6A 3KMVA 1HKNA 4JQ0A 2FFVA 4FGFA 3PHZA 3HMYA 5BXSA 3PG0A 1DQGA 3CRHA 1RZOB 1N4KA 3HBWA 3UD9A 2YUGA 1PZZA 2D23A 4L4IA 3AKIA 2HWAA 3EF2A 5GAQA 3OJVA 3P53A 4L4HA 3AH1A 3CRGA 1QQKA 5EG6C 1MD6A 1JY0A 2L5XA 4GP3A 3N0KA 4I8MA 1V6VA 3FJBA 3HOMA 2AAIB 1TWMA 3ILAA 3AKFA 1FQ9A 4EKXB 1ABRB 3CA5A 3PMEA 3BRFA 3JRRA 4QBCA 2X2TA 4EFRA 1TIEA 3RMXA 1AVWB 4I96A 1S0EA 2QN4A 3UJ4A 2D22A 4OWKA 3N7KA 4KEIA 4EEEB 1DZCA 4I4SA 2ET2A 2KI4A 4I4UA 3C9ZA 2M49A 3BAOA 4GOVA 4LO0A 1RG8A 2D43A 1Z4SA 4WBCA 1DFCA 4OEFA 2LIEA 4DEPA 4Q91A 1G9DA 3FJ8A 4D0ZA 4JKQA 1SZ6B 4I4YA 1AVUA 3O4CA 4I2SA 5D61A 1V6UA 1FMZA 1EVTA 5BVPI 2FO1A 2Y9WC 4D0TA 4D8HA 2AXMA 8I1BA 4IQPA 3FJKA 1WD3A 4J2SA 5F8SA 1TTUA 3FJDA 1W3GA 3BAVA 3NBCA 1Z2VA 5DUYA 4DCKC 1S0BA 4ZA3B 2KLLA 4I4QA 1G9BA 1ISYA 3CA1A 3OBTA 4I3NA 3NBNA 3MALA 4GOYA 4DENA 4LO1A 3T8SA 4LO3C 1BARA 1ISWA 2MLLB 4QBVA 2R9KB 3CQAA 4P6AA 3A23A 4ZLBB 4A7ZA 4ZOTA 4JKXB 5EHAA 4OEEA 3FJFA 2UUSA 1T9FA 4OWJA 1IT0A 4ZKTB 3IM6A 3OGFA 3WMVA 3IM5A 4I4OA 3W9TA 3JUTA 1SR4C 4OW4A 5FNXA 3BAQA 4X39A 9ILBA 5JMCA 2Y9XE 2DS0A 4GAIA 1S0LA 1FV2A 2D7RA 3E8LC 4CJMA 5BP5A 4ISQA 3FJHA 3O4OA 1QQLA 1XG6A 2NP0A 3FJAA 3PUBA 4R6UB 1K5VA 3Q7XA 1OQLB 1TP0A 1XZZA 3Q7WA 3ZXDA 1TFMB 2BFHA 3N7MA 1CVSA 4IHZA 4JAWA 2I1BA 4J23B 1M2TB 2K43A 3V0AA 2X2SA 3CA6A 1TWEA 4II0A 3VEQA 3IAGC 2GO2A 3O44A 2D20A 5HPZA 4IY9A 2VUAA 2K8RA 4QO3A 1IJTA 3O49A 3NBEA 4HJJA 3AJ5A 1AXMA 3D7WB 4ZFUB 2WBCA 4F83A 1BFBA 3AZWA 2NTDA 4KC3A 4LO3A 5BXRA 1FV3A 4A7KA 4QD2C 2MC2A 1G9CA 3VWCA 4H04A 4ISRA 4Q9GA 1WBCA 3WA1A 2BEAA 3CU1B 3O4AA 5E24E 5G00A 3QR5A 1T4QA 3AKGA 2ZQOA 1Q03A 4J2KA 4G1RA 4KEJA 1I1EA 1EPWA 3P6IA 4LO0C 2HZ9A 4H9WA 3P6JA 1QXMA 1HCEA 1FGAA 3HSMA 2DRZA 4A7YA
chains in the Genus database with same CATH superfamily
3V0AB 1DLLA 2HWMA 4QD2B 1BPBA 3B9UA 2DR8A 4WQKA 4LO2A 4TUSA 4E7XA 1CE7B 2P23A 2B56A 2BBHA 2PFOA 4MFAA 3AH4A 4JPZA 1ZQUA 3MGHA 4GXJA 4LEVA 4IYBA 3FJEA 5J0RA 3F1RA 4RWPA 3OGUA 5D62A 4KBBA 3BB2A 1NZKA 4XQ8A 1RY7A 2Y9GA 5DDYA 4R64A 3WINC 5DECA 1AVXB 5JTGA 2O1PA 4I37A 2VSAA 4M9NA 1YBIA 1KNMA 3UD8A 1ZQAA 3QYDA 3BRGC 3LQCB 4K97A 4QZAA 4O67A 1RMLA 4Q9PA 7I1BA 3A21A 2ESUA 3O5WB 4X3AA 3PNCA 4HX0A 2D24A 3CAHA 3C5GA 1D0HA 1HWNB 3POKA 4LEYA 5J2IA 1NO5A 3V7LA 4WBYA 1II4A 4WC6A 4QALA 4WQLA 4O9MA 3RJHA 3RTIB 5BQUC 2F2FC 3MGIA 3ISCA 4F34A 3O4BA 3PMLA 2VXTI 4NXVA 2QYIB 4PH5A 1VFGA 1HWOB 4QZHA 3VSFA 2M2UA 5J2JA 8ICGA 4OUJA 1ZQXA 2MIBA 3R4SA 4FVVA 3H39A 3OUYA 1ZQVA 2D1ZA 4RQ2A 5B3QA 2VSEA 2AFGA 2ERMA 4GAFA 4I27A 3H6SE 1GGPB 8ICXA 4QC4A 2EWRA 3FJCA 4K4GA 7ICIA 2VU9A 4ENDA 4EFPA 3VT2A 1JQZA 4G9NA 1F31A 7ICVA 4YCXA 4O5KA 1BLAA 1YF8B 3FUQA 1IOBA 2KKIA 3RSJA 3ISDA 1DJSB 3BA4A 3ZC9A 4ATBB 4NXZA 3HALA 4O68A 7ICNA 4EV6A 2BEBA 3RTJB 3VT0A 4FH3A 4MKPA 1AF9A 4P0KA 4QZBA 3K1XA 1BPEA 4I0UA 2FDBM 41BIA 5CHGA 4GXKA 4YD1A 2K4AB 5DVHA 1ZJNA 1ISVA 3NJ5A 4FHPA 4ATBA 1XYFA 3BTAA 3I2XA 2HN1A 2ZHBA 3C2LA 4K98A 4KLGA 1W3AA 1ZQEA 4UBBA 9ICEA 2RG9B 1DIWA 4IZXA 1IRPA 3K75D 3V7KA 5DZUA 7ICMA 3WO4A 4F5QA 2ZH9A 5F90A 3RJJA 3R4UA 5HC9A 4AT7A 4OWLA 5IIOA 4KLUA 1YLQA 3FJ9A 1EV2A 2VANA 3CA3A 1ZQBA 1ZQPA 3SNVA 2VXRA 4GXIA 7ICOA 4P0JA 5HRIA 3NWIA 4P4OA 3C66A 3NKUA 2Y9FA 3VUOA 4P4PA 2ZH1A 4G6MA 4ZFWB 2P66A 1SR4A 2B4VA 4RQ7A 2FGFA 3WO3A 4X5VA 3MPPG 5DSSB 1JMSA 4PGXA 1JT5A 4NXTA 4KLQA 5F8YA 4XQ7A 8ICIA 3FJJA 3WFPA 4USOA 4K96A 4I4RA 4QKSA 9ICRA 4P0LA 4XFTA 4EFQA 2W9MA 4HR6C 3C5FA 1ILR1 2AQZA 5HHHA 4M9LA 3CRIA 1HIBA 1Q79A 4I4PA 3TFSA 1KDHA 4KLLA 1ISXA 2F2FA 3Q7YA 1P63A 1PX5A 9ICBA 4TUQA 1DZDA 2NYYA 3LLPA 4YOLA 2FMPA 4O5EA 4KLDA 4J2XA 4K4IA 4YMMA 3IIRA 4J2YA 3BAHA 4IQWA 4G6JA 2D7IA 3N7JA 2M2TA 3TC2A 4KLEA 5FNWA 5IIKA 4KLSA 4I1EA 5HRHA 1S0CA 1IRAX 4LO7B 5HRBA 2BCUA 3RJKA 2RQ9A 5DKWA 2NZ9A 5J0UA 5FZUA 8ICZA 1XHBA 2E4MA 3H6RB 4UD4A 1ONKB 4QKRA 4GP0A 3OBRA 3UDAA 3A22A 5EC5A 4WC1A 1WOTA 2HW9A 4QZ8A 9ICGA 1YYNA 4TLPA 1ZQIA 7ICGA 2DRAA 1WBAA 1J0SA 1PUMB 4K9AA 5BXTA 1V6WA 1ZQFA 3WMUA 2LIQA 1FWVA 3O3QA 5D49A 4MZGB 4I2BA 4YMNA 1MIVA 3AJ6A 1UETA 1A8DA 3HIYA 4AN7B 2PBEA 3HJ4A 4M9HA 3BRDA 3VT1A 4P4MA 3RJEA 3VSZA 2GZBA 1ISZA 3OJ2A 3NBDA 2XOAA 3H37A 5HRLA 3CA0A 4QZCA 1TFYA 3S8KA 4KM5A 4JP0A 1BPZA 2DREA 4JRAA 4I2DA 2KI6B 1ZQSA 4NLKA 4LO7C 8ICSA 9ICNA 2Z49A 4LVSA 4G9MA 3AH2A 3RMYA 7ICFA 1HUZA 1Z0HA 4LO2C 2Q3NB 1ZQLA 4LEZA 1UPSA 1BFGA 1W3FA 1ZQHA 4WC3A 3UD7A 5BOWA 3UXOA 1PC8B 4K99A 2BCQA 1PWAA 3ZXGA 5DB8A 1S0GA 3O4DA 2NVHA 3AKHA 3V0BB 4RWQA 3HX0A 4I28A 1Q78A 7ICHA 3BA5A 4OEGA 2BBJA 5HRDA 5J0OA 4KLOA 1JLXA 3AZVA 1HWMB 5DBBA 3WFQE 2Z48A 3BA7A 3AQNA 4F5OA 7ICLA 4KEKA 8ICHA 4MF8A 5FZYA 1G9AA 4NXWA 1TOOA 1KNYA 3V0BA 2ISPA 3ERCC 4I2IA 3JPQA 4QZDA 21BIA 3HN1A 1E0OA 4PHEA 1YTOA 1JLYA 1Q1UA 4IZEA 4XFUA 1R8CA 4RWOA 3I2AA 2NM1A 1S0DA 4EBJA 3V7JA 4JWNA 2VLCA 5FZZA 4WC5A 2IHMA 5J0QA 5DB9A 4YD2A 1UEVA 4AT8B 4NLZA 3A07A 4I1BA 3RH6A 4RQ3A 1ZQTA 5BXPA 3H6RA 1YXWA 3BAUA 4Z8SB 2FCLA 4O69A 2PFPA 1MQ2A 3AQMA 4FO1A 5EOZA 4YN4A 5IILA 1DFQA 3LTQA 1NUNA 1ZQNA 1PUUB 4LO1C 4Z6FA 1R8OA 9ICUA 4UB1A 3OGGA 4I4XA 5J0SA 4KLFA 2E4MC 3ZX7A 4RQ6A 3WO2A 4X4TA 5DBCA 1IILA 2M2WA 5B3PA 3ZC8A 4I2AA 7ICKA 4MZFB 1ZQJA 1R8NA 1WD4A 3N7LA 2KH2A 3H6QA 4X37A 5J0TA 1M16A 4RQ8A 8ICJA 4XUSA 2WRYA 4OAHA 4QZFA 31BIA 4HA2A 4ZFYB 5CJ7A 3RJIA 3S8JA 2GA9D 5F2VO 2ZQNA 3FJIA 3RJGA 1FMMS 4O5CA 4ZGRB 5CFUA 2PFNA 2IWTB 1Q04A 2DR9A 1HWPB 4KLJA 4K4HA 4I0YA 5CWRA 1BFCA 3C2MA 9ICQA 4M9GA 4I6IA 1NOMA 1BFFA 4KLIA 3K7DA 1JT4A 1V6XA 2DRYA 3BX1C 1MIWA 3BADA 1EYLA 4X4RA 2Q9XA 1JN3A 8ICEA 1ZJMA 5BP5C 9ICSA 3I29B 2GWSA 1S0FA 1FN0A 1JTCA 5BQUA 3JPSA 1XSLA 1JT7A 1TV9A 2ISOA 2ZH2A 1ZQDA 1HCDA 1K5UA 2NS2A 1UEUA 5J29A 2ZH4A 1I1BA 2IHOA 4ZBVB 4X4NA 3WINA 5J0WA 3OJMA 2ZR1B 4WC0A 5J2EA 8ICTA 4FHXA 9ICIA 1G82A 4K9BA 4IONA 4NLNA 3UXNA 1FWUA 4USPA 4X38A 5D63A 1FA0A 4IY8A 3V79C 4H75A 4RQ0A 4UAWA 2DR7A 2F8XC 2Q66A 1AFCA 5JLVA 9ICMA 1L2HA 1MC9A 4EB2B 2FFUA 8ICWA 1AVAC 2P39A 3CA4A 2RSTA 4LZDA 5J2CA 4I7IA 4I4VA 3UQ0A 1BASA 1ITBA 4EGWA 4M9JA 9ICKA 4XFSA 3HJ1A 1BPYA 4X4OA 4F5NA 4PC4A 3NVOA 4K8VA 9ICOA 5IIJA 4I2HA 5F8WA 5I1BA 1MQ3A 3ER8C 3IM7A 5HREA 4LO8B 4MZHA 4XKIA 2BPCA 4OAGA 1BLDA 4WC7A 3FFZA 4JLZA 1JT3A 2J3PA 6I1BA 5J2HA 9ICXA 1OU5A 2D44A 5B2HA 1IHKA 3FGMA 4XRHA 1XSPA 4UD5A 1ZQYA 4I2JA 8ICPA 4Z9WB 1DQOA 1BA7A 3FUOA 3UJ0A 5J0YA 4UB4A 1VCLA 3PMNA 3OUYB 4LZGA 3LK9A 3BAGA 1ZQKA 2I9GA 4NY8A 3F62B 4AN6A 3KMVA 3UPQA 4FO6A 1HKNA 4JQ0A 4NKTA 2BPFA 2FFVA 4FGFA 4IQTA 4Z6CA 4UB5A 8ICRA 7ICEA 3PHZA 9ICHA 3HMYA 5J0PA 3MBYA 2BCRA 5BXSA 3PG0A 4X4QA 3JPTA 5CP2A 1DQGA 3CRHA 5J2KA 1RZOB 4F5RA 4QZEA 1N4KA 4OAFA 5DB6A 8ICBA 3HBWA 4JWMA 4M04A 3UD9A 2YUGA 1PZZA 2ZH8A 4N7RA 2D23A 4I2FA 1ZQMA 9ICAA 4L4IA 1F5AA 3C18A 3UQ2A 1ZQOA 3AKIA 7ICJA 3JZ0A 2HWAA 3EF2A 5GAQA 4RPYA 4TUPA 3OVAA 3OJVA 2HHPA 3P53A 4L4HA 2ZH5A 3AH1A 3CRGA 5J2FA 1QQKA 5EG6C 1MD6A 1JY0A 2L5XA 4GP3A 3N0KA 9ICPA 3JYYA 4I8MA 3AUOA 1V6VA 3FJBA 3HOMA 2AAIB 1TWMA 3ILAA 3AKFA 1FQ9A 4EKXB 4DOAA 1ABRB 3CA5A 3OVSA 4PPXA 3PMEA 4X4VA 1JAJA 4PHPA 3BRFA 4I2CA 3JRRA 4QBCA 2X2TA 4EFRA 3MDCA 1TIEA 3RMXA 2ZHAA 2FMQA 3H3AA 4RWNA 1AVWB 4UAYA 1RZTA 4AT9B 5DBAA 8ICKA 4UAZA 4I96A 4FHYA 4FHWA 1S0EA 4AT8A 3HWTA 4NKUA 2QN4A 3UJ4A 2D22A 4OWKA 3N7KA 4KEIA 5IIMA 4EEBA 9ICCA 4EEEB 1DZCA 4I4SA 2ET2A 3OWGA 8ICUA 4LEWA 4S3NA 2KI4A 4KLTA 4I4UA 3C9ZA 2M49A 3BAOA 4GOVA 4LO0A 1RG8A 5HR9A 4OAIZ 4Z6EA 2D43A 1BPDA 1Z4SA 4WBCA 2ID1A 4RT3A 4X0AA 5J2BA 7ICSA 4WBZA 3JPOA 4RT2A 3H38A 4I29A 1DFCA 4OEFA 4IQVA 2LIEA 4KLMA 4DEPA 4Q91A 2ZH6A 1G9DA 1ZQCA 3FJ8A 4EBKA 4D0ZA 4RPXA 1R8AA 4JKQA 1SZ6B 4I4YA 4F5PA 1AVUA 3O4CA 4I2SA 5D61A 4E80A 5D46A 4PGQA 8ICCA 1V6UA 1FMZA 1EVTA 2GAFD 3GDXA 5BVPI 3AQKA 2FO1A 2Y9WC 4D0TA 4WCWA 3UPSA 4QZIA 4WC2A 4D8HA 4M47A 4UY4A 2AXMA 8I1BA 4IQPA 3FJKA 4R65A 4FH5A 5D4BA 4MFCA 3MCRA 5J2AA 1WD3A 4J2SA 5F8SA 3JCFA 1TTUA 4NM2A 4EP7A 4RQ5A 3ISBA 8ICLA 3FJDA 5TZVA 2PXIA 1W3GA 4DOCA 3BAVA 3NBCA 4M5DA 4X4SA 1Z2VA 9ICWA 5HHIA 1ZQRA 4KLHA 5DUYA 4DCKC 7ICPA 1S0BA 4ZA3B 2ZH7A 2ZH3A 1BPXA 2KLLA 5HRKA 3OV7A 4I4QA 1G9BA 1ISYA 1ZQWA 3CA1A 3OBTA 4I3NA 3NBNA 3MALA 4GOYA 4DENA 4TURA 4LO1A 2BCVA 3WFOA 8ICYA 1R89A 3T8SA 4LO3C 1BARA 1ISWA 2MLLB 4QBVA 5IIIA 5HRFA 2R9KB 3CQAA 3ER9B 4P6AA 4DO9A 3A23A 4ZLBB 8ICVA 4A7ZA 8ICQA 4PGYA 2HN2A 4ZOTA 4JKXB 5CR0A 5J2GA 5EHAA 4OEEA 5J2DA 3FJFA 2UUSA 4XA5A 1T9FA 4OWJA 1IT0A 4ZKTB 3UXPA 4JLXA 3IM6A 3OGFA 5CFTA 5BOMA 4M0AA 3WMVA 4PHAA 3IM5A 4EEDA 4I4OA 4P2HA 3AU6A 3W9TA 3JUTA 5DDMA 1SR4C 3B0YA 5CA7A 4OW4A 5FNXA 4NXUA 4RQ1A 4I2EA 3BAQA 4X39A 9ILBA 5JMCA 2Y9XE 4AT9A 4WC4A 5CHEA 4DOBA 2DS0A 1KEJA 3CK6A 7ICTA 4GAIA 5J0XA 4R63A 7ICQA 1S0LA 1FV2A 2D7RA 3E8LC 4CJMA 5BP5A 1V4AA 4ISQA 3FJHA 1TVAA 4IG8A 1VJ7A 3O4OA 1QQLA 1XG6A 2NP0A 3FJAA 2M2VA 4UBCA 2DVIA 3PUBA 2BPGA 4M2YA 4I2GA 4R6UB 4R66A 1K5VA 3Q7XA 5CB1A 1OQLB 1TP0A 1XZZA 3Q7WA 4Z6DA 3ZXDA 1TFMB 2BFHA 3N7MA 3JPPA 4X4PA 3OVBA 1CVSA 4IHZA 4JAWA 3RH4A 9ICJA 2I1BA 5HRGA 4J23B 1ZQZA 2BE3A 1M2TB 2K43A 2DR5A 1XSNA 2IUBA 3V0AA 2X2SA 9ICTA 3CA6A 1TWEA 4II0A 3VEQA 3IAGC 3V72A 2DRBA 2GO2A 3O44A 2RFFA 2D20A 4WOYA 5HPZA 4IY9A 3NYBA 2VUAA 3AU2A 4AT7B 1R8BA 3RH5A 4RPZA 2K8RA 4LT6A 4UB2A 4PHDA 4QO3A 1IJTA 3HW8A 8ICNA 4FHVA 3C2KA 5DEDA 3O49A 7ICRA 3NBEA 5IINA 4HJJA 3AJ5A 9ICVA 1AXMA 3D7WB 4O6AA 4QZGA 8ICFA 4ZFUB 1MIYA 2WBCA 3MDAA 4F83A 3AQLA 1HUOA 4X4UA 1BFBA 3AZWA 2NTDA 4KC3A 4LO3A 5BXRA 3WFSC 4IQUA 4YMOA 1RPLA 1FV3A 2B51A 4X0BA 4A7KA 4QZ9A 3RJFA 5DB7A 4QD2C 2MC2A 4NXXA 1G9CA 3VWCA 4H04A 4ISRA 4Q9GA 8ICMA 1WBCA 2BCSA 3WA1A 1JQRA 5CFSA 2BEAA 3CU1B 2PFQA 7ICUA 3O4AA 5E24E 4MFFA 1GPJA 3JPRA 8ICAA 5G00A 3QR5A 3WFRE 4NM1A 1T4QA 4UB3A 4MF2A 3AKGA 4KB6A 2ZQOA 1Q03A 5BOLA 8ICOA 4E8FA 4J2KA 1ZQQA 4G1RA 4KEJA 1I1EA 4RQ4A 1EPWA 3L9DA 4WH5A 3P6IA 4LO0C 4XJEA 9ICLA 2HZ9A 9ICFA 4H9WA 3TFRA 3P6JA 1QXMA 3JPNA 1TFWA 1HCEA 1FGAA 3HSMA 2NRKA 2DRZA 2O5AA 3B0XA 2FMSA 4A7YA 1ZQGA 5BPCA
chains in the Genus database with same CATH topology
3V0AB 1DLLA 2HWMA 4QD2B 3B9UA 4WQKA 4LO2A 1CE7B 2P23A 2B56A 3AH4A 4JPZA 4LEVA 4IYBA 3FJEA 3F1RA 5D62A 4KBBA 3BB2A 1NZKA 1RY7A 2Y9GA 3WINC 1AVXB 4I37A 2VSAA 1YBIA 1KNMA 3UD8A 3QYDA 3BRGC 4K97A 4O67A 1RMLA 4Q9PA 7I1BA 3A21A 2ESUA 3O5WB 4X3AA 4HX0A 2D24A 3CAHA 1D0HA 1HWNB 3POKA 4LEYA 1II4A 4QALA 4WQLA 3RTIB 5BQUC 2F2FC 4F34A 3O4BA 2VXTI 4NXVA 2QYIB 1HWOB 3VSFA 4OUJA 2MIBA 3R4SA 4FVVA 2D1ZA 5B3QA 2VSEA 2AFGA 2ERMA 4GAFA 3H6SE 1GGPB 4QC4A 2EWRA 3FJCA 2VU9A 4ENDA 4EFPA 3VT2A 1JQZA 4G9NA 1F31A 1BLAA 1YF8B 3FUQA 1IOBA 2KKIA 3RSJA 1DJSB 3BA4A 3ZC9A 3HALA 4O68A 2BEBA 3RTJB 3VT0A 4MKPA 1AF9A 4P0KA 3K1XA 2FDBM 41BIA 2K4AB 5DVHA 1ISVA 3NJ5A 1XYFA 3BTAA 3I2XA 4K98A 1W3AA 2RG9B 1DIWA 4IZXA 1IRPA 5DZUA 3WO4A 5F90A 3R4UA 4OWLA 3FJ9A 1EV2A 3CA3A 3SNVA 2VXRA 4P0JA 3NKUA 2Y9FA 3VUOA 4G6MA 4ZFWB 1SR4A 2B4VA 2FGFA 3WO3A 3MPPG 5DSSB 1JT5A 4NXTA 5F8YA 3FJJA 4USOA 4K96A 4I4RA 4QKSA 4P0LA 4XFTA 4EFQA 4HR6C 1ILR1 2AQZA 3CRIA 1HIBA 4I4PA 1ISXA 2F2FA 3Q7YA 1P63A 1DZDA 2NYYA 3LLPA 4YOLA 4J2XA 3IIRA 4J2YA 3BAHA 4G6JA 2D7IA 3N7JA 3TC2A 5FNWA 4I1EA 1S0CA 1IRAX 4LO7B 2RQ9A 2NZ9A 5FZUA 1XHBA 2E4MA 3H6RB 1ONKB 4QKRA 4GP0A 3OBRA 3UDAA 3A22A 5EC5A 2HW9A 1YYNA 4TLPA 1WBAA 1J0SA 1PUMB 4K9AA 5BXTA 1V6WA 3WMUA 2LIQA 1FWVA 3O3QA 4MZGB 3AJ6A 1A8DA 4AN7B 3BRDA 3VT1A 3VSZA 2GZBA 1ISZA 3OJ2A 3NBDA 2XOAA 3CA0A 3S8KA 4KM5A 4JP0A 2DREA 4JRAA 2KI6B 4LO7C 2Z49A 4G9MA 3AH2A 3RMYA 1Z0HA 4LO2C 2Q3NB 4LEZA 1UPSA 1BFGA 1W3FA 3UD7A 5BOWA 1PC8B 4K99A 1PWAA 3ZXGA 1S0GA 3O4DA 2NVHA 3AKHA 3V0BB 3BA5A 4OEGA 1JLXA 3AZVA 1HWMB 2Z48A 3BA7A 4KEKA 5FZYA 1G9AA 4NXWA 1TOOA 3V0BA 3ERCC 21BIA 3HN1A 1E0OA 1YTOA 1JLYA 1Q1UA 4IZEA 4XFUA 3I2AA 2NM1A 1S0DA 2VLCA 5FZZA 3A07A 4I1BA 5BXPA 3H6RA 1YXWA 3BAUA 4Z8SB 2FCLA 4O69A 4FO1A 1DFQA 3LTQA 1NUNA 1PUUB 4LO1C 1R8OA 3OGGA 4I4XA 2E4MC 3ZX7A 3WO2A 1IILA 5B3PA 3ZC8A 4MZFB 1R8NA 1WD4A 3N7LA 2KH2A 3H6QA 4X37A 1M16A 2WRYA 4OAHA 31BIA 4HA2A 4ZFYB 3S8JA 2GA9D 2ZQNA 3FJIA 1FMMS 4ZGRB 5CFUA 2IWTB 1Q04A 1HWPB 4I0YA 1BFCA 4I6IA 1BFFA 3K7DA 1JT4A 1V6XA 2DRYA 3BX1C 3BADA 1EYLA 2Q9XA 5BP5C 3I29B 1S0FA 1FN0A 1JTCA 5BQUA 1JT7A 1HCDA 1K5UA 2NS2A 1I1BA 2IHOA 4ZBVB 3WINA 3OJMA 2ZR1B 1G82A 4K9BA 4IONA 1FWUA 4USPA 4X38A 5D63A 4IY8A 3V79C 4H75A 2F8XC 1AFCA 5JLVA 1L2HA 1MC9A 4EB2B 2FFUA 1AVAC 2P39A 3CA4A 2RSTA 4I7IA 4I4VA 1BASA 1ITBA 4XFSA 4PC4A 4K8VA 5F8WA 5I1BA 3ER8C 3IM7A 4LO8B 4MZHA 4XKIA 4OAGA 1BLDA 3FFZA 4JLZA 1JT3A 2J3PA 6I1BA 2D44A 5B2HA 1IHKA 3FGMA 4Z9WB 1DQOA 1BA7A 3FUOA 3UJ0A 1VCLA 3BAGA 3F62B 4AN6A 3KMVA 1HKNA 4JQ0A 2FFVA 4FGFA 3PHZA 3HMYA 5BXSA 3PG0A 1DQGA 3CRHA 1RZOB 1N4KA 4OAFA 3HBWA 3UD9A 2YUGA 1PZZA 4N7RA 2D23A 4L4IA 3AKIA 2HWAA 3EF2A 5GAQA 3OJVA 3P53A 4L4HA 3AH1A 3CRGA 1QQKA 5EG6C 1MD6A 1JY0A 2L5XA 4GP3A 3N0KA 4I8MA 1V6VA 3FJBA 3HOMA 2AAIB 1TWMA 3ILAA 3AKFA 1FQ9A 4EKXB 1ABRB 3CA5A 3PMEA 3BRFA 3JRRA 4QBCA 2X2TA 4EFRA 1TIEA 3RMXA 1AVWB 4I96A 1S0EA 2QN4A 3UJ4A 2D22A 4OWKA 3N7KA 4KEIA 4EEEB 1DZCA 4I4SA 2ET2A 3OWGA 4LEWA 2KI4A 4I4UA 3C9ZA 2M49A 3BAOA 4GOVA 4LO0A 1RG8A 4OAIZ 2D43A 1Z4SA 4WBCA 1DFCA 4OEFA 2LIEA 4DEPA 4Q91A 1G9DA 3FJ8A 4D0ZA 4JKQA 1SZ6B 4I4YA 1AVUA 3O4CA 4I2SA 5D61A 1V6UA 1FMZA 1EVTA 2GAFD 5BVPI 2FO1A 2Y9WC 4D0TA 4D8HA 4UY4A 2AXMA 8I1BA 4IQPA 3FJKA 3MCRA 1WD3A 4J2SA 5F8SA 1TTUA 3FJDA 1W3GA 3BAVA 3NBCA 1Z2VA 5DUYA 4DCKC 1S0BA 4ZA3B 2KLLA 4I4QA 1G9BA 1ISYA 3CA1A 3OBTA 4I3NA 3NBNA 3MALA 4GOYA 4DENA 4LO1A 3T8SA 4LO3C 1BARA 1ISWA 2MLLB 4QBVA 2R9KB 3CQAA 3ER9B 4P6AA 3A23A 4ZLBB 4A7ZA 4ZOTA 4JKXB 5EHAA 4OEEA 3FJFA 2UUSA 1T9FA 4OWJA 1IT0A 4ZKTB 4JLXA 3IM6A 3OGFA 5CFTA 3WMVA 3IM5A 4I4OA 3W9TA 3JUTA 1SR4C 4OW4A 5FNXA 4NXUA 3BAQA 4X39A 9ILBA 5JMCA 2Y9XE 5CHEA 2DS0A 4GAIA 1S0LA 1FV2A 2D7RA 3E8LC 4CJMA 5BP5A 4ISQA 3FJHA 3O4OA 1QQLA 1XG6A 2NP0A 3FJAA 3PUBA 4R6UB 1K5VA 3Q7XA 1OQLB 1TP0A 1XZZA 3Q7WA 3ZXDA 1TFMB 2BFHA 3N7MA 1CVSA 4IHZA 4JAWA 2I1BA 4J23B 1M2TB 2K43A 3V0AA 2X2SA 3CA6A 1TWEA 4II0A 3VEQA 3IAGC 2GO2A 3O44A 2D20A 4WOYA 5HPZA 4IY9A 2VUAA 2K8RA 4QO3A 1IJTA 3O49A 3NBEA 4HJJA 3AJ5A 1AXMA 3D7WB 4O6AA 4ZFUB 2WBCA 4F83A 1BFBA 3AZWA 2NTDA 4KC3A 4LO3A 5BXRA 1FV3A 2B51A 4A7KA 4QD2C 2MC2A 4NXXA 1G9CA 3VWCA 4H04A 4ISRA 4Q9GA 1WBCA 3WA1A 5CFSA 2BEAA 3CU1B 3O4AA 5E24E 1GPJA 5G00A 3QR5A 1T4QA 3AKGA 4KB6A 2ZQOA 1Q03A 4J2KA 4G1RA 4KEJA 1I1EA 1EPWA 4WH5A 3P6IA 4LO0C 4XJEA 2HZ9A 4H9WA 3P6JA 1QXMA 1HCEA 1FGAA 3HSMA 2DRZA 4A7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V0A B;  1DLL A;  2HWM A;  4QD2 B;  3B9U A;  4LO2 A;  1CE7 B;  2P23 A;  3AH4 A;  4JPZ A;  4IYB A;  3FJE A;  3F1R A;  5D62 A;  4KBB A;  3BB2 A;  1NZK A;  1RY7 A;  2Y9G A;  3WIN C;  1AVX B;  4I37 A;  2VSA A;  1YBI A;  1KNM A;  3UD8 A;  3QYD A;  3BRG C;  1RML A;  4Q9P A;  7I1B A;  3A21 A;  2ESU A;  3O5W B;  4X3A A;  2D24 A;  3CAH A;  1D0H A;  1HWN B;  3POK A;  1II4 A;  4QAL A;  3RTI B;  5BQU C;  2F2F C;  4F34 A;  3O4B A;  2VXT I;  2QYI B;  1HWO B;  3VSF A;  4OUJ A;  2MIB A;  3R4S A;  4FVV A;  2D1Z A;  2VSE A;  2AFG A;  2ERM A;  4GAF A;  3H6S E;  1GGP B;  4QC4 A;  3FJC A;  2VU9 A;  4END A;  4EFP A;  3VT2 A;  1JQZ A;  4G9N A;  1F31 A;  1BLA A;  1YF8 B;  3FUQ A;  1IOB A;  2KKI A;  3RSJ A;  1DJS B;  3BA4 A;  3ZC9 A;  3HAL A;  2BEB A;  3RTJ B;  3VT0 A;  1AF9 A;  4P0K A;  3K1X A;  2FDB M;  41BI A;  2K4A B;  5DVH A;  1ISV A;  3NJ5 A;  1XYF A;  3BTA A;  3I2X A;  1W3A A;  2RG9 B;  1DIW A;  4IZX A;  1IRP A;  5DZU A;  3WO4 A;  5F90 A;  3R4U A;  4OWL A;  3FJ9 A;  1EV2 A;  3CA3 A;  3SNV A;  2VXR A;  4P0J A;  2Y9F A;  3VUO A;  4G6M A;  4ZFW B;  1SR4 A;  2FGF A;  3WO3 A;  3MPP G;  5DSS B;  1JT5 A;  5F8Y A;  3FJJ A;  4USO A;  4I4R A;  4QKS A;  4P0L A;  4XFT A;  4EFQ A;  4HR6 C;  1ILR 1;  2AQZ A;  3CRI A;  1HIB A;  4I4P A;  1ISX A;  2F2F A;  3Q7Y A;  1P63 A;  1DZD A;  2NYY A;  3LLP A;  4YOL A;  4J2X A;  3IIR A;  4J2Y A;  3BAH A;  4G6J A;  2D7I A;  3N7J A;  3TC2 A;  5FNW A;  4I1E A;  1S0C A;  1IRA X;  4LO7 B;  2RQ9 A;  2NZ9 A;  5FZU A;  1XHB A;  2E4M A;  3H6R B;  1ONK B;  4QKR A;  4GP0 A;  3OBR A;  3UDA A;  3A22 A;  5EC5 A;  2HW9 A;  1YYN A;  4TLP A;  1WBA A;  1J0S A;  1PUM B;  5BXT A;  1V6W A;  3WMU A;  2LIQ A;  1FWV A;  3O3Q A;  3AJ6 A;  1A8D A;  4AN7 B;  3BRD A;  3VT1 A;  3VSZ A;  2GZB A;  1ISZ A;  3OJ2 A;  3NBD A;  2XOA A;  3CA0 A;  3S8K A;  4JP0 A;  2DRE A;  4JRA A;  2KI6 B;  4LO7 C;  2Z49 A;  4G9M A;  3AH2 A;  3RMY A;  1Z0H A;  4LO2 C;  2Q3N B;  1UPS A;  1BFG A;  1W3F A;  3UD7 A;  5BOW A;  1PC8 B;  1PWA A;  3ZXG A;  1S0G A;  3O4D A;  2NVH A;  3AKH A;  3V0B B;  3BA5 A;  4OEG A;  1JLX A;  3AZV A;  1HWM B;  2Z48 A;  3BA7 A;  4KEK A;  5FZY A;  1G9A A;  1TOO A;  3V0B A;  21BI A;  3HN1 A;  1E0O A;  1YTO A;  1JLY A;  1Q1U A;  4IZE A;  4XFU A;  3I2A A;  2NM1 A;  1S0D A;  2VLC A;  5FZZ A;  3A07 A;  4I1B A;  5BXP A;  3H6R A;  1YXW A;  3BAU A;  4Z8S B;  1DFQ A;  3LTQ A;  1NUN A;  1PUU B;  4LO1 C;  1R8O A;  3OGG A;  4I4X A;  2E4M C;  3ZX7 A;  3WO2 A;  1IIL A;  3ZC8 A;  1R8N A;  1WD4 A;  3N7L A;  2KH2 A;  3H6Q A;  4X37 A;  1M16 A;  2WRY A;  31BI A;  4HA2 A;  4ZFY B;  3S8J A;  2ZQN A;  3FJI A;  1FMM S;  4ZGR B;  2IWT B;  1Q04 A;  1HWP B;  4I0Y A;  1BFC A;  4I6I A;  1BFF A;  1JT4 A;  1V6X A;  2DRY A;  3BX1 C;  3BAD A;  1EYL A;  2Q9X A;  5BP5 C;  3I29 B;  1S0F A;  1FN0 A;  1JTC A;  5BQU A;  1JT7 A;  1HCD A;  1K5U A;  1I1B A;  2IHO A;  4ZBV B;  3WIN A;  3OJM A;  2ZR1 B;  1G82 A;  4ION A;  1FWU A;  4USP A;  4X38 A;  5D63 A;  4IY8 A;  3V79 C;  2F8X C;  1AFC A;  5JLV A;  1L2H A;  1MC9 A;  4EB2 B;  2FFU A;  1AVA C;  2P39 A;  3CA4 A;  2RST A;  4I7I A;  4I4V A;  1BAS A;  1ITB A;  4XFS A;  4PC4 A;  5F8W A;  5I1B A;  3IM7 A;  4LO8 B;  4XKI A;  1BLD A;  3FFZ A;  1JT3 A;  2J3P A;  6I1B A;  2D44 A;  5B2H A;  1IHK A;  3FGM A;  4Z9W B;  1DQO A;  1BA7 A;  3FUO A;  3UJ0 A;  1VCL A;  3BAG A;  3F62 B;  4AN6 A;  3KMV A;  1HKN A;  4JQ0 A;  2FFV A;  4FGF A;  3PHZ A;  3HMY A;  5BXS A;  3PG0 A;  1DQG A;  3CRH A;  1RZO B;  1N4K A;  3HBW A;  3UD9 A;  2YUG A;  1PZZ A;  2D23 A;  4L4I A;  3AKI A;  2HWA A;  3EF2 A;  5GAQ A;  3OJV A;  3P53 A;  4L4H A;  3AH1 A;  3CRG A;  1QQK A;  5EG6 C;  1MD6 A;  1JY0 A;  2L5X A;  4GP3 A;  3N0K A;  4I8M A;  1V6V A;  3FJB A;  3HOM A;  2AAI B;  1TWM A;  3ILA A;  3AKF A;  1FQ9 A;  4EKX B;  1ABR B;  3CA5 A;  3PME A;  3BRF A;  3JRR A;  4QBC A;  2X2T A;  4EFR A;  1TIE A;  3RMX A;  1AVW B;  4I96 A;  1S0E A;  2QN4 A;  3UJ4 A;  2D22 A;  4OWK A;  3N7K A;  4KEI A;  4EEE B;  1DZC A;  4I4S A;  2ET2 A;  2KI4 A;  4I4U A;  3C9Z A;  2M49 A;  3BAO A;  4GOV A;  4LO0 A;  1RG8 A;  2D43 A;  1Z4S A;  4WBC A;  1DFC A;  4OEF A;  2LIE A;  4DEP A;  4Q91 A;  1G9D A;  3FJ8 A;  4D0Z A;  4JKQ A;  1SZ6 B;  4I4Y A;  1AVU A;  3O4C A;  4I2S A;  5D61 A;  1V6U A;  1FMZ A;  1EVT A;  5BVP I;  2FO1 A;  2Y9W C;  4D0T A;  4D8H A;  2AXM A;  8I1B A;  4IQP A;  3FJK A;  1WD3 A;  4J2S A;  5F8S A;  1TTU A;  3FJD A;  1W3G A;  3BAV A;  3NBC A;  1Z2V A;  5DUY A;  4DCK C;  1S0B A;  4ZA3 B;  2KLL A;  4I4Q A;  1G9B A;  1ISY A;  3CA1 A;  3OBT A;  4I3N A;  3NBN A;  3MAL A;  4GOY A;  4DEN A;  4LO1 A;  3T8S A;  4LO3 C;  1BAR A;  1ISW A;  2MLL B;  4QBV A;  2R9K B;  3CQA A;  4P6A A;  3A23 A;  4ZLB B;  4A7Z A;  4ZOT A;  4JKX B;  5EHA A;  4OEE A;  3FJF A;  2UUS A;  1T9F A;  4OWJ A;  1IT0 A;  4ZKT B;  3IM6 A;  3OGF A;  3WMV A;  3IM5 A;  4I4O A;  3W9T A;  3JUT A;  1SR4 C;  4OW4 A;  5FNX A;  3BAQ A;  4X39 A;  9ILB A;  5JMC A;  2Y9X E;  2DS0 A;  4GAI A;  1S0L A;  1FV2 A;  2D7R A;  3E8L C;  4CJM A;  5BP5 A;  4ISQ A;  3FJH A;  3O4O A;  1QQL A;  1XG6 A;  2NP0 A;  3FJA A;  3PUB A;  4R6U B;  1K5V A;  3Q7X A;  1OQL B;  1TP0 A;  1XZZ A;  3Q7W A;  3ZXD A;  1TFM B;  2BFH A;  3N7M A;  1CVS A;  4IHZ A;  4JAW A;  2I1B A;  4J23 B;  1M2T B;  2K43 A;  3V0A A;  2X2S A;  3CA6 A;  1TWE A;  4II0 A;  3VEQ A;  3IAG C;  2GO2 A;  3O44 A;  2D20 A;  5HPZ A;  4IY9 A;  2VUA A;  2K8R A;  4QO3 A;  1IJT A;  3O49 A;  3NBE A;  4HJJ A;  3AJ5 A;  1AXM A;  3D7W B;  4ZFU B;  2WBC A;  4F83 A;  1BFB A;  3AZW A;  2NTD A;  4KC3 A;  4LO3 A;  5BXR A;  1FV3 A;  4A7K A;  4QD2 C;  2MC2 A;  1G9C A;  3VWC A;  4H04 A;  4ISR A;  4Q9G A;  1WBC A;  3WA1 A;  2BEA A;  3CU1 B;  3O4A A;  5E24 E;  5G00 A;  3QR5 A;  1T4Q A;  3AKG A;  2ZQO A;  1Q03 A;  4J2K A;  4G1R A;  4KEJ A;  1I1E A;  1EPW A;  3P6I A;  4LO0 C;  2HZ9 A;  4H9W A;  3P6J A;  1QXM A;  1HCE A;  1FGA A;  3HSM A;  2DRZ A;  4A7Y A; 
#chains in the Genus database with same CATH topology
 3V0A B;  1DLL A;  2HWM A;  4QD2 B;  1BPB A;  3B9U A;  2DR8 A;  4WQK A;  4LO2 A;  4TUS A;  4E7X A;  1CE7 B;  2P23 A;  2B56 A;  2BBH A;  2PFO A;  4MFA A;  3AH4 A;  4JPZ A;  1ZQU A;  3MGH A;  4GXJ A;  4LEV A;  4IYB A;  3FJE A;  5J0R A;  3F1R A;  4RWP A;  3OGU A;  5D62 A;  4KBB A;  3BB2 A;  1NZK A;  4XQ8 A;  1RY7 A;  2Y9G A;  5DDY A;  4R64 A;  3WIN C;  5DEC A;  1AVX B;  5JTG A;  2O1P A;  4I37 A;  2VSA A;  4M9N A;  1YBI A;  1KNM A;  3UD8 A;  1ZQA A;  3QYD A;  3BRG C;  3LQC B;  4K97 A;  4QZA A;  4O67 A;  1RML A;  4Q9P A;  7I1B A;  3A21 A;  2ESU A;  3O5W B;  4X3A A;  3PNC A;  4HX0 A;  2D24 A;  3CAH A;  3C5G A;  1D0H A;  1HWN B;  3POK A;  4LEY A;  5J2I A;  1NO5 A;  3V7L A;  4WBY A;  1II4 A;  4WC6 A;  4QAL A;  4WQL A;  4O9M A;  3RJH A;  3RTI B;  5BQU C;  2F2F C;  3MGI A;  3ISC A;  4F34 A;  3O4B A;  3PML A;  2VXT I;  4NXV A;  2QYI B;  4PH5 A;  1VFG A;  1HWO B;  4QZH A;  3VSF A;  2M2U A;  5J2J A;  8ICG A;  4OUJ A;  1ZQX A;  2MIB A;  3R4S A;  4FVV A;  3H39 A;  3OUY A;  1ZQV A;  2D1Z A;  4RQ2 A;  5B3Q A;  2VSE A;  2AFG A;  2ERM A;  4GAF A;  4I27 A;  3H6S E;  1GGP B;  8ICX A;  4QC4 A;  2EWR A;  3FJC A;  4K4G A;  7ICI A;  2VU9 A;  4END A;  4EFP A;  3VT2 A;  1JQZ A;  4G9N A;  1F31 A;  7ICV A;  4YCX A;  4O5K A;  1BLA A;  1YF8 B;  3FUQ A;  1IOB A;  2KKI A;  3RSJ A;  3ISD A;  1DJS B;  3BA4 A;  3ZC9 A;  4ATB B;  4NXZ A;  3HAL A;  4O68 A;  7ICN A;  4EV6 A;  2BEB A;  3RTJ B;  3VT0 A;  4FH3 A;  4MKP A;  1AF9 A;  4P0K A;  4QZB A;  3K1X A;  1BPE A;  4I0U A;  2FDB M;  41BI A;  5CHG A;  4GXK A;  4YD1 A;  2K4A B;  5DVH A;  1ZJN A;  1ISV A;  3NJ5 A;  4FHP A;  4ATB A;  1XYF A;  3BTA A;  3I2X A;  2HN1 A;  2ZHB A;  3C2L A;  4K98 A;  4KLG A;  1W3A A;  1ZQE A;  4UBB A;  9ICE A;  2RG9 B;  1DIW A;  4IZX A;  1IRP A;  3K75 D;  3V7K A;  5DZU A;  7ICM A;  3WO4 A;  4F5Q A;  2ZH9 A;  5F90 A;  3RJJ A;  3R4U A;  5HC9 A;  4AT7 A;  4OWL A;  5IIO A;  4KLU A;  1YLQ A;  3FJ9 A;  1EV2 A;  2VAN A;  3CA3 A;  1ZQB A;  1ZQP A;  3SNV A;  2VXR A;  4GXI A;  7ICO A;  4P0J A;  5HRI A;  3NWI A;  4P4O A;  3C66 A;  3NKU A;  2Y9F A;  3VUO A;  4P4P A;  2ZH1 A;  4G6M A;  4ZFW B;  2P66 A;  1SR4 A;  2B4V A;  4RQ7 A;  2FGF A;  3WO3 A;  4X5V A;  3MPP G;  5DSS B;  1JMS A;  4PGX A;  1JT5 A;  4NXT A;  4KLQ A;  5F8Y A;  4XQ7 A;  8ICI A;  3FJJ A;  3WFP A;  4USO A;  4K96 A;  4I4R A;  4QKS A;  9ICR A;  4P0L A;  4XFT A;  4EFQ A;  2W9M A;  4HR6 C;  3C5F A;  1ILR 1;  2AQZ A;  5HHH A;  4M9L A;  3CRI A;  1HIB A;  1Q79 A;  4I4P A;  3TFS A;  1KDH A;  4KLL A;  1ISX A;  2F2F A;  3Q7Y A;  1P63 A;  1PX5 A;  9ICB A;  4TUQ A;  1DZD A;  2NYY A;  3LLP A;  4YOL A;  2FMP A;  4O5E A;  4KLD A;  4J2X A;  4K4I A;  4YMM A;  3IIR A;  4J2Y A;  3BAH A;  4IQW A;  4G6J A;  2D7I A;  3N7J A;  2M2T A;  3TC2 A;  4KLE A;  5FNW A;  5IIK A;  4KLS A;  4I1E A;  5HRH A;  1S0C A;  1IRA X;  4LO7 B;  5HRB A;  2BCU A;  3RJK A;  2RQ9 A;  5DKW A;  2NZ9 A;  5J0U A;  5FZU A;  8ICZ A;  1XHB A;  2E4M A;  3H6R B;  4UD4 A;  1ONK B;  4QKR A;  4GP0 A;  3OBR A;  3UDA A;  3A22 A;  5EC5 A;  4WC1 A;  1WOT A;  2HW9 A;  4QZ8 A;  9ICG A;  1YYN A;  4TLP A;  1ZQI A;  7ICG A;  2DRA A;  1WBA A;  1J0S A;  1PUM B;  4K9A A;  5BXT A;  1V6W A;  1ZQF A;  3WMU A;  2LIQ A;  1FWV A;  3O3Q A;  5D49 A;  4MZG B;  4I2B A;  4YMN A;  1MIV A;  3AJ6 A;  1UET A;  1A8D A;  3HIY A;  4AN7 B;  2PBE A;  3HJ4 A;  4M9H A;  3BRD A;  3VT1 A;  4P4M A;  3RJE A;  3VSZ A;  2GZB A;  1ISZ A;  3OJ2 A;  3NBD A;  2XOA A;  3H37 A;  5HRL A;  3CA0 A;  4QZC A;  1TFY A;  3S8K A;  4KM5 A;  4JP0 A;  1BPZ A;  2DRE A;  4JRA A;  4I2D A;  2KI6 B;  1ZQS A;  4NLK A;  4LO7 C;  8ICS A;  9ICN A;  2Z49 A;  4LVS A;  4G9M A;  3AH2 A;  3RMY A;  7ICF A;  1HUZ A;  1Z0H A;  4LO2 C;  2Q3N B;  1ZQL A;  4LEZ A;  1UPS A;  1BFG A;  1W3F A;  1ZQH A;  4WC3 A;  3UD7 A;  5BOW A;  3UXO A;  1PC8 B;  4K99 A;  2BCQ A;  1PWA A;  3ZXG A;  5DB8 A;  1S0G A;  3O4D A;  2NVH A;  3AKH A;  3V0B B;  4RWQ A;  3HX0 A;  4I28 A;  1Q78 A;  7ICH A;  3BA5 A;  4OEG A;  2BBJ A;  5HRD A;  5J0O A;  4KLO A;  1JLX A;  3AZV A;  1HWM B;  5DBB A;  3WFQ E;  2Z48 A;  3BA7 A;  3AQN A;  4F5O A;  7ICL A;  4KEK A;  8ICH A;  4MF8 A;  5FZY A;  1G9A A;  4NXW A;  1TOO A;  1KNY A;  3V0B A;  2ISP A;  3ERC C;  4I2I A;  3JPQ A;  4QZD A;  21BI A;  3HN1 A;  1E0O A;  4PHE A;  1YTO A;  1JLY A;  1Q1U A;  4IZE A;  4XFU A;  1R8C A;  4RWO A;  3I2A A;  2NM1 A;  1S0D A;  4EBJ A;  3V7J A;  4JWN A;  2VLC A;  5FZZ A;  4WC5 A;  2IHM A;  5J0Q A;  5DB9 A;  4YD2 A;  1UEV A;  4AT8 B;  4NLZ A;  3A07 A;  4I1B A;  3RH6 A;  4RQ3 A;  1ZQT A;  5BXP A;  3H6R A;  1YXW A;  3BAU A;  4Z8S B;  2FCL A;  4O69 A;  2PFP A;  1MQ2 A;  3AQM A;  4FO1 A;  5EOZ A;  4YN4 A;  5IIL A;  1DFQ A;  3LTQ A;  1NUN A;  1ZQN A;  1PUU B;  4LO1 C;  4Z6F A;  1R8O A;  9ICU A;  4UB1 A;  3OGG A;  4I4X A;  5J0S A;  4KLF A;  2E4M C;  3ZX7 A;  4RQ6 A;  3WO2 A;  4X4T A;  5DBC A;  1IIL A;  2M2W A;  5B3P A;  3ZC8 A;  4I2A A;  7ICK A;  4MZF B;  1ZQJ A;  1R8N A;  1WD4 A;  3N7L A;  2KH2 A;  3H6Q A;  4X37 A;  5J0T A;  1M16 A;  4RQ8 A;  8ICJ A;  4XUS A;  2WRY A;  4OAH A;  4QZF A;  31BI A;  4HA2 A;  4ZFY B;  5CJ7 A;  3RJI A;  3S8J A;  2GA9 D;  5F2V O;  2ZQN A;  3FJI A;  3RJG A;  1FMM S;  4O5C A;  4ZGR B;  5CFU A;  2PFN A;  2IWT B;  1Q04 A;  2DR9 A;  1HWP B;  4KLJ A;  4K4H A;  4I0Y A;  5CWR A;  1BFC A;  3C2M A;  9ICQ A;  4M9G A;  4I6I A;  1NOM A;  1BFF A;  4KLI A;  3K7D A;  1JT4 A;  1V6X A;  2DRY A;  3BX1 C;  1MIW A;  3BAD A;  1EYL A;  4X4R A;  2Q9X A;  1JN3 A;  8ICE A;  1ZJM A;  5BP5 C;  9ICS A;  3I29 B;  2GWS A;  1S0F A;  1FN0 A;  1JTC A;  5BQU A;  3JPS A;  1XSL A;  1JT7 A;  1TV9 A;  2ISO A;  2ZH2 A;  1ZQD A;  1HCD A;  1K5U A;  2NS2 A;  1UEU A;  5J29 A;  2ZH4 A;  1I1B A;  2IHO A;  4ZBV B;  4X4N A;  3WIN A;  5J0W A;  3OJM A;  2ZR1 B;  4WC0 A;  5J2E A;  8ICT A;  4FHX A;  9ICI A;  1G82 A;  4K9B A;  4ION A;  4NLN A;  3UXN A;  1FWU A;  4USP A;  4X38 A;  5D63 A;  1FA0 A;  4IY8 A;  3V79 C;  4H75 A;  4RQ0 A;  4UAW A;  2DR7 A;  2F8X C;  2Q66 A;  1AFC A;  5JLV A;  9ICM A;  1L2H A;  1MC9 A;  4EB2 B;  2FFU A;  8ICW A;  1AVA C;  2P39 A;  3CA4 A;  2RST A;  4LZD A;  5J2C A;  4I7I A;  4I4V A;  3UQ0 A;  1BAS A;  1ITB A;  4EGW A;  4M9J A;  9ICK A;  4XFS A;  3HJ1 A;  1BPY A;  4X4O A;  4F5N A;  4PC4 A;  3NVO A;  4K8V A;  9ICO A;  5IIJ A;  4I2H A;  5F8W A;  5I1B A;  1MQ3 A;  3ER8 C;  3IM7 A;  5HRE A;  4LO8 B;  4MZH A;  4XKI A;  2BPC A;  4OAG A;  1BLD A;  4WC7 A;  3FFZ A;  4JLZ A;  1JT3 A;  2J3P A;  6I1B A;  5J2H A;  9ICX A;  1OU5 A;  2D44 A;  5B2H A;  1IHK A;  3FGM A;  4XRH A;  1XSP A;  4UD5 A;  1ZQY A;  4I2J A;  8ICP A;  4Z9W B;  1DQO A;  1BA7 A;  3FUO A;  3UJ0 A;  5J0Y A;  4UB4 A;  1VCL A;  3PMN A;  3OUY B;  4LZG A;  3LK9 A;  3BAG A;  1ZQK A;  2I9G A;  4NY8 A;  3F62 B;  4AN6 A;  3KMV A;  3UPQ A;  4FO6 A;  1HKN A;  4JQ0 A;  4NKT A;  2BPF A;  2FFV A;  4FGF A;  4IQT A;  4Z6C A;  4UB5 A;  8ICR A;  7ICE A;  3PHZ A;  9ICH A;  3HMY A;  5J0P A;  3MBY A;  2BCR A;  5BXS A;  3PG0 A;  4X4Q A;  3JPT A;  5CP2 A;  1DQG A;  3CRH A;  5J2K A;  1RZO B;  4F5R A;  4QZE A;  1N4K A;  4OAF A;  5DB6 A;  8ICB A;  3HBW A;  4JWM A;  4M04 A;  3UD9 A;  2YUG A;  1PZZ A;  2ZH8 A;  4N7R A;  2D23 A;  4I2F A;  1ZQM A;  9ICA A;  4L4I A;  1F5A A;  3C18 A;  3UQ2 A;  1ZQO A;  3AKI A;  7ICJ A;  3JZ0 A;  2HWA A;  3EF2 A;  5GAQ A;  4RPY A;  4TUP A;  3OVA A;  3OJV A;  2HHP A;  3P53 A;  4L4H A;  2ZH5 A;  3AH1 A;  3CRG A;  5J2F A;  1QQK A;  5EG6 C;  1MD6 A;  1JY0 A;  2L5X A;  4GP3 A;  3N0K A;  9ICP A;  3JYY A;  4I8M A;  3AUO A;  1V6V A;  3FJB A;  3HOM A;  2AAI B;  1TWM A;  3ILA A;  3AKF A;  1FQ9 A;  4EKX B;  4DOA A;  1ABR B;  3CA5 A;  3OVS A;  4PPX A;  3PME A;  4X4V A;  1JAJ A;  4PHP A;  3BRF A;  4I2C A;  3JRR A;  4QBC A;  2X2T A;  4EFR A;  3MDC A;  1TIE A;  3RMX A;  2ZHA A;  2FMQ A;  3H3A A;  4RWN A;  1AVW B;  4UAY A;  1RZT A;  4AT9 B;  5DBA A;  8ICK A;  4UAZ A;  4I96 A;  4FHY A;  4FHW A;  1S0E A;  4AT8 A;  3HWT A;  4NKU A;  2QN4 A;  3UJ4 A;  2D22 A;  4OWK A;  3N7K A;  4KEI A;  5IIM A;  4EEB A;  9ICC A;  4EEE B;  1DZC A;  4I4S A;  2ET2 A;  3OWG A;  8ICU A;  4LEW A;  4S3N A;  2KI4 A;  4KLT A;  4I4U A;  3C9Z A;  2M49 A;  3BAO A;  4GOV A;  4LO0 A;  1RG8 A;  5HR9 A;  4OAI Z;  4Z6E A;  2D43 A;  1BPD A;  1Z4S A;  4WBC A;  2ID1 A;  4RT3 A;  4X0A A;  5J2B A;  7ICS A;  4WBZ A;  3JPO A;  4RT2 A;  3H38 A;  4I29 A;  1DFC A;  4OEF A;  4IQV A;  2LIE A;  4KLM A;  4DEP A;  4Q91 A;  2ZH6 A;  1G9D A;  1ZQC A;  3FJ8 A;  4EBK A;  4D0Z A;  4RPX A;  1R8A A;  4JKQ A;  1SZ6 B;  4I4Y A;  4F5P A;  1AVU A;  3O4C A;  4I2S A;  5D61 A;  4E80 A;  5D46 A;  4PGQ A;  8ICC A;  1V6U A;  1FMZ A;  1EVT A;  2GAF D;  3GDX A;  5BVP I;  3AQK A;  2FO1 A;  2Y9W C;  4D0T A;  4WCW A;  3UPS A;  4QZI A;  4WC2 A;  4D8H A;  4M47 A;  4UY4 A;  2AXM A;  8I1B A;  4IQP A;  3FJK A;  4R65 A;  4FH5 A;  5D4B A;  4MFC A;  3MCR A;  5J2A A;  1WD3 A;  4J2S A;  5F8S A;  3JCF A;  1TTU A;  4NM2 A;  4EP7 A;  4RQ5 A;  3ISB A;  8ICL A;  3FJD A;  5TZV A;  2PXI A;  1W3G A;  4DOC A;  3BAV A;  3NBC A;  4M5D A;  4X4S A;  1Z2V A;  9ICW A;  5HHI A;  1ZQR A;  4KLH A;  5DUY A;  4DCK C;  7ICP A;  1S0B A;  4ZA3 B;  2ZH7 A;  2ZH3 A;  1BPX A;  2KLL A;  5HRK A;  3OV7 A;  4I4Q A;  1G9B A;  1ISY A;  1ZQW A;  3CA1 A;  3OBT A;  4I3N A;  3NBN A;  3MAL A;  4GOY A;  4DEN A;  4TUR A;  4LO1 A;  2BCV A;  3WFO A;  8ICY A;  1R89 A;  3T8S A;  4LO3 C;  1BAR A;  1ISW A;  2MLL B;  4QBV A;  5III A;  5HRF A;  2R9K B;  3CQA A;  3ER9 B;  4P6A A;  4DO9 A;  3A23 A;  4ZLB B;  8ICV A;  4A7Z A;  8ICQ A;  4PGY A;  2HN2 A;  4ZOT A;  4JKX B;  5CR0 A;  5J2G A;  5EHA A;  4OEE A;  5J2D A;  3FJF A;  2UUS A;  4XA5 A;  1T9F A;  4OWJ A;  1IT0 A;  4ZKT B;  3UXP A;  4JLX A;  3IM6 A;  3OGF A;  5CFT A;  5BOM A;  4M0A A;  3WMV A;  4PHA A;  3IM5 A;  4EED A;  4I4O A;  4P2H A;  3AU6 A;  3W9T A;  3JUT A;  5DDM A;  1SR4 C;  3B0Y A;  5CA7 A;  4OW4 A;  5FNX A;  4NXU A;  4RQ1 A;  4I2E A;  3BAQ A;  4X39 A;  9ILB A;  5JMC A;  2Y9X E;  4AT9 A;  4WC4 A;  5CHE A;  4DOB A;  2DS0 A;  1KEJ A;  3CK6 A;  7ICT A;  4GAI A;  5J0X A;  4R63 A;  7ICQ A;  1S0L A;  1FV2 A;  2D7R A;  3E8L C;  4CJM A;  5BP5 A;  1V4A A;  4ISQ A;  3FJH A;  1TVA A;  4IG8 A;  1VJ7 A;  3O4O A;  1QQL A;  1XG6 A;  2NP0 A;  3FJA A;  2M2V A;  4UBC A;  2DVI A;  3PUB A;  2BPG A;  4M2Y A;  4I2G A;  4R6U B;  4R66 A;  1K5V A;  3Q7X A;  5CB1 A;  1OQL B;  1TP0 A;  1XZZ A;  3Q7W A;  4Z6D A;  3ZXD A;  1TFM B;  2BFH A;  3N7M A;  3JPP A;  4X4P A;  3OVB A;  1CVS A;  4IHZ A;  4JAW A;  3RH4 A;  9ICJ A;  2I1B A;  5HRG A;  4J23 B;  1ZQZ A;  2BE3 A;  1M2T B;  2K43 A;  2DR5 A;  1XSN A;  2IUB A;  3V0A A;  2X2S A;  9ICT A;  3CA6 A;  1TWE A;  4II0 A;  3VEQ A;  3IAG C;  3V72 A;  2DRB A;  2GO2 A;  3O44 A;  2RFF A;  2D20 A;  4WOY A;  5HPZ A;  4IY9 A;  3NYB A;  2VUA A;  3AU2 A;  4AT7 B;  1R8B A;  3RH5 A;  4RPZ A;  2K8R A;  4LT6 A;  4UB2 A;  4PHD A;  4QO3 A;  1IJT A;  3HW8 A;  8ICN A;  4FHV A;  3C2K A;  5DED A;  3O49 A;  7ICR A;  3NBE A;  5IIN A;  4HJJ A;  3AJ5 A;  9ICV A;  1AXM A;  3D7W B;  4O6A A;  4QZG A;  8ICF A;  4ZFU B;  1MIY A;  2WBC A;  3MDA A;  4F83 A;  3AQL A;  1HUO A;  4X4U A;  1BFB A;  3AZW A;  2NTD A;  4KC3 A;  4LO3 A;  5BXR A;  3WFS C;  4IQU A;  4YMO A;  1RPL A;  1FV3 A;  2B51 A;  4X0B A;  4A7K A;  4QZ9 A;  3RJF A;  5DB7 A;  4QD2 C;  2MC2 A;  4NXX A;  1G9C A;  3VWC A;  4H04 A;  4ISR A;  4Q9G A;  8ICM A;  1WBC A;  2BCS A;  3WA1 A;  1JQR A;  5CFS A;  2BEA A;  3CU1 B;  2PFQ A;  7ICU A;  3O4A A;  5E24 E;  4MFF A;  1GPJ A;  3JPR A;  8ICA A;  5G00 A;  3QR5 A;  3WFR E;  4NM1 A;  1T4Q A;  4UB3 A;  4MF2 A;  3AKG A;  4KB6 A;  2ZQO A;  1Q03 A;  5BOL A;  8ICO A;  4E8F A;  4J2K A;  1ZQQ A;  4G1R A;  4KEJ A;  1I1E A;  4RQ4 A;  1EPW A;  3L9D A;  4WH5 A;  3P6I A;  4LO0 C;  4XJE A;  9ICL A;  2HZ9 A;  9ICF A;  4H9W A;  3TFR A;  3P6J A;  1QXM A;  3JPN A;  1TFW A;  1HCE A;  1FGA A;  3HSM A;  2NRK A;  2DRZ A;  2O5A A;  3B0X A;  2FMS A;  4A7Y A;  1ZQG A;  5BPC A; 
#chains in the Genus database with same CATH homology
 3V0A B;  1DLL A;  2HWM A;  4QD2 B;  3B9U A;  4WQK A;  4LO2 A;  1CE7 B;  2P23 A;  2B56 A;  3AH4 A;  4JPZ A;  4LEV A;  4IYB A;  3FJE A;  3F1R A;  5D62 A;  4KBB A;  3BB2 A;  1NZK A;  1RY7 A;  2Y9G A;  3WIN C;  1AVX B;  4I37 A;  2VSA A;  1YBI A;  1KNM A;  3UD8 A;  3QYD A;  3BRG C;  4K97 A;  4O67 A;  1RML A;  4Q9P A;  7I1B A;  3A21 A;  2ESU A;  3O5W B;  4X3A A;  4HX0 A;  2D24 A;  3CAH A;  1D0H A;  1HWN B;  3POK A;  4LEY A;  1II4 A;  4QAL A;  4WQL A;  3RTI B;  5BQU C;  2F2F C;  4F34 A;  3O4B A;  2VXT I;  4NXV A;  2QYI B;  1HWO B;  3VSF A;  4OUJ A;  2MIB A;  3R4S A;  4FVV A;  2D1Z A;  5B3Q A;  2VSE A;  2AFG A;  2ERM A;  4GAF A;  3H6S E;  1GGP B;  4QC4 A;  2EWR A;  3FJC A;  2VU9 A;  4END A;  4EFP A;  3VT2 A;  1JQZ A;  4G9N A;  1F31 A;  1BLA A;  1YF8 B;  3FUQ A;  1IOB A;  2KKI A;  3RSJ A;  1DJS B;  3BA4 A;  3ZC9 A;  3HAL A;  4O68 A;  2BEB A;  3RTJ B;  3VT0 A;  4MKP A;  1AF9 A;  4P0K A;  3K1X A;  2FDB M;  41BI A;  2K4A B;  5DVH A;  1ISV A;  3NJ5 A;  1XYF A;  3BTA A;  3I2X A;  4K98 A;  1W3A A;  2RG9 B;  1DIW A;  4IZX A;  1IRP A;  5DZU A;  3WO4 A;  5F90 A;  3R4U A;  4OWL A;  3FJ9 A;  1EV2 A;  3CA3 A;  3SNV A;  2VXR A;  4P0J A;  3NKU A;  2Y9F A;  3VUO A;  4G6M A;  4ZFW B;  1SR4 A;  2B4V A;  2FGF A;  3WO3 A;  3MPP G;  5DSS B;  1JT5 A;  4NXT A;  5F8Y A;  3FJJ A;  4USO A;  4K96 A;  4I4R A;  4QKS A;  4P0L A;  4XFT A;  4EFQ A;  4HR6 C;  1ILR 1;  2AQZ A;  3CRI A;  1HIB A;  4I4P A;  1ISX A;  2F2F A;  3Q7Y A;  1P63 A;  1DZD A;  2NYY A;  3LLP A;  4YOL A;  4J2X A;  3IIR A;  4J2Y A;  3BAH A;  4G6J A;  2D7I A;  3N7J A;  3TC2 A;  5FNW A;  4I1E A;  1S0C A;  1IRA X;  4LO7 B;  2RQ9 A;  2NZ9 A;  5FZU A;  1XHB A;  2E4M A;  3H6R B;  1ONK B;  4QKR A;  4GP0 A;  3OBR A;  3UDA A;  3A22 A;  5EC5 A;  2HW9 A;  1YYN A;  4TLP A;  1WBA A;  1J0S A;  1PUM B;  4K9A A;  5BXT A;  1V6W A;  3WMU A;  2LIQ A;  1FWV A;  3O3Q A;  4MZG B;  3AJ6 A;  1A8D A;  4AN7 B;  3BRD A;  3VT1 A;  3VSZ A;  2GZB A;  1ISZ A;  3OJ2 A;  3NBD A;  2XOA A;  3CA0 A;  3S8K A;  4KM5 A;  4JP0 A;  2DRE A;  4JRA A;  2KI6 B;  4LO7 C;  2Z49 A;  4G9M A;  3AH2 A;  3RMY A;  1Z0H A;  4LO2 C;  2Q3N B;  4LEZ A;  1UPS A;  1BFG A;  1W3F A;  3UD7 A;  5BOW A;  1PC8 B;  4K99 A;  1PWA A;  3ZXG A;  1S0G A;  3O4D A;  2NVH A;  3AKH A;  3V0B B;  3BA5 A;  4OEG A;  1JLX A;  3AZV A;  1HWM B;  2Z48 A;  3BA7 A;  4KEK A;  5FZY A;  1G9A A;  4NXW A;  1TOO A;  3V0B A;  3ERC C;  21BI A;  3HN1 A;  1E0O A;  1YTO A;  1JLY A;  1Q1U A;  4IZE A;  4XFU A;  3I2A A;  2NM1 A;  1S0D A;  2VLC A;  5FZZ A;  3A07 A;  4I1B A;  5BXP A;  3H6R A;  1YXW A;  3BAU A;  4Z8S B;  2FCL A;  4O69 A;  4FO1 A;  1DFQ A;  3LTQ A;  1NUN A;  1PUU B;  4LO1 C;  1R8O A;  3OGG A;  4I4X A;  2E4M C;  3ZX7 A;  3WO2 A;  1IIL A;  5B3P A;  3ZC8 A;  4MZF B;  1R8N A;  1WD4 A;  3N7L A;  2KH2 A;  3H6Q A;  4X37 A;  1M16 A;  2WRY A;  4OAH A;  31BI A;  4HA2 A;  4ZFY B;  3S8J A;  2GA9 D;  2ZQN A;  3FJI A;  1FMM S;  4ZGR B;  5CFU A;  2IWT B;  1Q04 A;  1HWP B;  4I0Y A;  1BFC A;  4I6I A;  1BFF A;  3K7D A;  1JT4 A;  1V6X A;  2DRY A;  3BX1 C;  3BAD A;  1EYL A;  2Q9X A;  5BP5 C;  3I29 B;  1S0F A;  1FN0 A;  1JTC A;  5BQU A;  1JT7 A;  1HCD A;  1K5U A;  2NS2 A;  1I1B A;  2IHO A;  4ZBV B;  3WIN A;  3OJM A;  2ZR1 B;  1G82 A;  4K9B A;  4ION A;  1FWU A;  4USP A;  4X38 A;  5D63 A;  4IY8 A;  3V79 C;  4H75 A;  2F8X C;  1AFC A;  5JLV A;  1L2H A;  1MC9 A;  4EB2 B;  2FFU A;  1AVA C;  2P39 A;  3CA4 A;  2RST A;  4I7I A;  4I4V A;  1BAS A;  1ITB A;  4XFS A;  4PC4 A;  4K8V A;  5F8W A;  5I1B A;  3ER8 C;  3IM7 A;  4LO8 B;  4MZH A;  4XKI A;  4OAG A;  1BLD A;  3FFZ A;  4JLZ A;  1JT3 A;  2J3P A;  6I1B A;  2D44 A;  5B2H A;  1IHK A;  3FGM A;  4Z9W B;  1DQO A;  1BA7 A;  3FUO A;  3UJ0 A;  1VCL A;  3BAG A;  3F62 B;  4AN6 A;  3KMV A;  1HKN A;  4JQ0 A;  2FFV A;  4FGF A;  3PHZ A;  3HMY A;  5BXS A;  3PG0 A;  1DQG A;  3CRH A;  1RZO B;  1N4K A;  4OAF A;  3HBW A;  3UD9 A;  2YUG A;  1PZZ A;  4N7R A;  2D23 A;  4L4I A;  3AKI A;  2HWA A;  3EF2 A;  5GAQ A;  3OJV A;  3P53 A;  4L4H A;  3AH1 A;  3CRG A;  1QQK A;  5EG6 C;  1MD6 A;  1JY0 A;  2L5X A;  4GP3 A;  3N0K A;  4I8M A;  1V6V A;  3FJB A;  3HOM A;  2AAI B;  1TWM A;  3ILA A;  3AKF A;  1FQ9 A;  4EKX B;  1ABR B;  3CA5 A;  3PME A;  3BRF A;  3JRR A;  4QBC A;  2X2T A;  4EFR A;  1TIE A;  3RMX A;  1AVW B;  4I96 A;  1S0E A;  2QN4 A;  3UJ4 A;  2D22 A;  4OWK A;  3N7K A;  4KEI A;  4EEE B;  1DZC A;  4I4S A;  2ET2 A;  3OWG A;  4LEW A;  2KI4 A;  4I4U A;  3C9Z A;  2M49 A;  3BAO A;  4GOV A;  4LO0 A;  1RG8 A;  4OAI Z;  2D43 A;  1Z4S A;  4WBC A;  1DFC A;  4OEF A;  2LIE A;  4DEP A;  4Q91 A;  1G9D A;  3FJ8 A;  4D0Z A;  4JKQ A;  1SZ6 B;  4I4Y A;  1AVU A;  3O4C A;  4I2S A;  5D61 A;  1V6U A;  1FMZ A;  1EVT A;  2GAF D;  5BVP I;  2FO1 A;  2Y9W C;  4D0T A;  4D8H A;  4UY4 A;  2AXM A;  8I1B A;  4IQP A;  3FJK A;  3MCR A;  1WD3 A;  4J2S A;  5F8S A;  1TTU A;  3FJD A;  1W3G A;  3BAV A;  3NBC A;  1Z2V A;  5DUY A;  4DCK C;  1S0B A;  4ZA3 B;  2KLL A;  4I4Q A;  1G9B A;  1ISY A;  3CA1 A;  3OBT A;  4I3N A;  3NBN A;  3MAL A;  4GOY A;  4DEN A;  4LO1 A;  3T8S A;  4LO3 C;  1BAR A;  1ISW A;  2MLL B;  4QBV A;  2R9K B;  3CQA A;  3ER9 B;  4P6A A;  3A23 A;  4ZLB B;  4A7Z A;  4ZOT A;  4JKX B;  5EHA A;  4OEE A;  3FJF A;  2UUS A;  1T9F A;  4OWJ A;  1IT0 A;  4ZKT B;  4JLX A;  3IM6 A;  3OGF A;  5CFT A;  3WMV A;  3IM5 A;  4I4O A;  3W9T A;  3JUT A;  1SR4 C;  4OW4 A;  5FNX A;  4NXU A;  3BAQ A;  4X39 A;  9ILB A;  5JMC A;  2Y9X E;  5CHE A;  2DS0 A;  4GAI A;  1S0L A;  1FV2 A;  2D7R A;  3E8L C;  4CJM A;  5BP5 A;  4ISQ A;  3FJH A;  3O4O A;  1QQL A;  1XG6 A;  2NP0 A;  3FJA A;  3PUB A;  4R6U B;  1K5V A;  3Q7X A;  1OQL B;  1TP0 A;  1XZZ A;  3Q7W A;  3ZXD A;  1TFM B;  2BFH A;  3N7M A;  1CVS A;  4IHZ A;  4JAW A;  2I1B A;  4J23 B;  1M2T B;  2K43 A;  3V0A A;  2X2S A;  3CA6 A;  1TWE A;  4II0 A;  3VEQ A;  3IAG C;  2GO2 A;  3O44 A;  2D20 A;  4WOY A;  5HPZ A;  4IY9 A;  2VUA A;  2K8R A;  4QO3 A;  1IJT A;  3O49 A;  3NBE A;  4HJJ A;  3AJ5 A;  1AXM A;  3D7W B;  4O6A A;  4ZFU B;  2WBC A;  4F83 A;  1BFB A;  3AZW A;  2NTD A;  4KC3 A;  4LO3 A;  5BXR A;  1FV3 A;  2B51 A;  4A7K A;  4QD2 C;  2MC2 A;  4NXX A;  1G9C A;  3VWC A;  4H04 A;  4ISR A;  4Q9G A;  1WBC A;  3WA1 A;  5CFS A;  2BEA A;  3CU1 B;  3O4A A;  5E24 E;  1GPJ A;  5G00 A;  3QR5 A;  1T4Q A;  3AKG A;  4KB6 A;  2ZQO A;  1Q03 A;  4J2K A;  4G1R A;  4KEJ A;  1I1E A;  1EPW A;  4WH5 A;  3P6I A;  4LO0 C;  4XJE A;  2HZ9 A;  4H9W A;  3P6J A;  1QXM A;  1HCE A;  1FGA A;  3HSM A;  2DRZ A;  4A7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...