3EF2A

Structure of the marasmius oreades mushroom lectin (moa) in complex with galalpha(1,3)[fucalpha(1,2)]gal and calcium.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
292
structure length
291
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Agglutinin
publication title Structural Characterization of a Lectin from the Mushroom Marasmius oreades in Complex with the Blood Group B Trisaccharide and Calcium.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Sugar binding protein
total genus 89
structure length 291
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ef2A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ef2A02
1BASA 1V6XA 5BXTA 2DS0A 3AH4A 4P0LA 2LIEA 3ZC8A 3BAVA 2HZ9A 1M2TB 1FMMS 4I6IA 5B2HA 1ISXA 5JLVA 3O4AA 4FVVA 2RG9B 3WO2A 4LO2A 5BOWA 3CRIA 1S0EA 1Q1UA 4IHZA 2AFGA 1AVWB 2IHOA 2VSEA 1AVAC 3BRGC 4P0KA 2NM1A 1HCEA 4JPZA 1JT3A 3HMYA 4G1RA 4LO0C 4XKIA 1YTOA 1FWUA 2Q9XA 2FFUA 4I2SA 4I4UA 4LO0A 1JT5A 3B9UA 1MC9A 4Q91A 4D8HA 3H6QA 2AQZA 3CA5A 5HPZA 2YUGA 3FUOA 4J2YA 3P6IA 3UD8A 4Q9PA 2D1ZA 3W9TA 2K4AB 3FJCA 4EEEB 3OJMA 1DZDA 3A07A 3O44A 4IZXA 4AN6A 3FJAA 3ZXGA 1M16A 3OGFA 3POKA 1QXMA 3JUTA 4GAFA 1W3AA 4J2SA 3VT0A 1RZOB 3H6RA 3FJ8A 1IT0A 1PWAA 1V6WA 3BADA 4I3NA 4I96A 4X38A 1TWMA 1WBAA 1JLYA 1T4QA 2D44A 1EV2A 4D0TA 3F1RA 3LTQA 1XZZA 2VLCA 1II4A 2X2TA 1BFGA 1W3FA 3AKIA 3IM7A 2D23A 2K43A 1YF8B 2D22A 3V0BA 4JQ0A 1IJTA 3AH2A 1HWPB 4IZEA 1JQZA 2KKIA 4QO3A 3WA1A 7I1BA 2I1BA 3JRRA 4OWLA 3MPPG 2P39A 3AKFA 3CA0A 1TIEA 2KI4A 1XG6A 2KI6B 3CA3A 1DFCA 3CQAA 1DLLA 5EG6C 2DREA 2BFHA 1K5VA 2HWAA 3IM5A 3N7MA 1OQLB 4X37A 3FJKA 2NVHA 3FJHA 1IILA 1DQGA 3HBWA 1R8OA 3R4UA 4GOVA 4A7KA 4ZFYB 4G6JA 2FO1A 4EFPA 1RY7A 4USOA 3V0AB 3ZC9A 1EYLA 1Z4SA 4OW4A 4J2KA 3CRGA 5GAQA 4J23B 2D24A 41BIA 4ZA3B 1F31A 3O5WB 5F8YA 5DSSB 3E8LC 2FFVA 4I1EA 1SZ6B 3ILAA 2QYIB 1PC8B 4QBCA 3HOMA 1CVSA 3BX1C 3HN1A 3O4CA 3BA5A 3WO3A 1CE7B 3P6JA 1QQKA 3PHZA 4II0A 3LLPA 4JKXB 5BXSA 3PG0A 1YBIA 3R4SA 4EKXB 4QKSA 1J0SA 1A8DA 4EFQA 1G82A 4GOYA 1JTCA 4XFUA 3D7WB 6I1BA 1ISYA 1G9AA 9ILBA 1G9DA 1NUNA 3BAQA 3BAUA 2RSTA 3OBRA 3RTIB 2Y9FA 1ISZA 3V79C 3FJBA 2E4MC 1S0FA 1IRAX 2E4MA 1XYFA 1W3GA 1RG8A 3BAGA 1I1BA 2F2FC 2Z49A 4KEKA 1Q04A 4IY9A 4QALA 2F2FA 2AXMA 2LIQA 3A22A 3K1XA 1BARA 3NBEA 1WBCA 5FNWA 1HCDA 4KEJA 3NBCA 3PUBA 5FNXA 3CA1A 2VSAA 3H6SE 3WINC 2R9KB 3BB2A 3SNVA 3WINA 1DJSB 3BAOA 4JAWA 3VT2A 4OWJA 1AXMA 1WD3A 3TC2A 3FJJA 1FV2A 3AKHA 5EHAA 4LO7C 4OEGA 4IYBA 3NBNA 3WO4A 5BXPA 3AKGA 3FJDA 2P23A 1NZKA 1ITBA 4H9WA 2K8RA 2J3PA 1UPSA 2UUSA 4JRAA 1AVXB 1ISVA 1E0OA 3QR5A 5BQUC 3S8KA 4EFRA 1FQ9A 4FGFA 5BP5C 2WBCA 1YXWA 4ENDA 1G9BA 3AJ6A 5BP5A 4LO8B 1L2HA 4LO3C 1BA7A 3P53A 1VCLA 3OGGA 4CJMA 5D62A 3IM6A 4KC3A 3UD9A 1DFQA 3MALA 3BA7A 1AF9A 1TFMB 3N0KA 3N7JA 3AZWA 4XFSA 1FGAA 1ILR1 3VSFA 1KNMA 2GZBA 4DENA 3BA4A 2ESUA 3A23A 4DCKC 3RMXA 2D20A 4I4VA 3BRFA 2M49A 2HW9A 4Z9WB 4DEPA 4GP3A 2VXRA 4G6MA 3HALA 4I4QA 3FJFA 4LO1C 1HWNB 3V0AA 1AFCA 4IQPA 4G9MA 4I1BA 4TLPA 2MC2A 4I4OA 4ZOTA 4I4PA 2RQ9A 4HJJA 1T9FA 2MLLB 4L4HA 1BLDA 2GO2A 1Z0HA 1HKNA 4KBBA 1BFFA 5F90A 1PUMB 1EPWA 1XHBA 2Y9GA 3BTAA 4Z8SB 3WMUA 5JMCA 2ERMA 4QBVA 3O4OA 4A7YA 4OUJA 1HWOB 2XOAA 1FMZA 4I8MA 1FN0A 2WRYA 4AN7B 2L5XA 3FJEA 3PMEA 1ONKB 5FZUA 1HIBA 2VUAA 3FUQA 3ZX7A 3IIRA 3UD7A 2X2SA 3FJIA 4PC4A 21BIA 3F62B 2FDBM 4ZKTB 2BEAA 4IY8A 4QKRA 4Q9GA 2NYYA 1DZCA 5BXRA 1DQOA 1BFCA 3O3QA 2Y9XE 3O49A 1V6VA 4F34A 2DRYA 3O4DA 3HSMA 4P6AA 4QD2B 3OBTA 4YOLA 31BIA 5DZUA 1Q03A 3FGMA 3Q7XA 3AZVA 3O4BA 1D0HA 1IRPA 1ABRB 4WBCA 3FJ9A 4IONA 1JT4A 4LO2C 2D43A 3I2XA 1IOBA 1G9CA 1JT7A 5DUYA 4KEIA 4I7IA 4ZBVB 4OEEA 1SR4C 4H04A 2NP0A 1FV3A 2VU9A 1SR4A 2Z48A 3N7LA 2BEBA 1I1EA 3I29B 4J2XA 4ISQA 3VWCA 2D7IA 1GGPB 4G9NA 5E24E 3BRDA 4L4IA 4I4YA 3CRHA 4I37A 2VXTI 3ZXDA 4F83A 3CAHA 1FWVA 4OEFA 4P0JA 3T8SA 1QQLA 3C9ZA 4I4RA 4GP0A 3WMVA 5BQUA 2QN4A 3VT1A 1K5UA 4X3AA 3S8JA 2Y9WC 5F8SA 3I2AA 4A7ZA 4HA2A 4LO3A 5DVHA 3UJ4A 1N4KA 3AH1A 3FFZA 2IWTB 2F8XC 1TP0A 4JP0A 1AVUA 5I1BA 4QC4A 4LO7B 5F8WA 1PUUB 1Z2VA 1BFBA 8I1BA 4ZLBB 1TTUA 3Q7YA 5EC5A 3H6RB 3VSZA 2NTDA 1WD4A 2ZR1B 3VUOA 1HWMB 1MD6A 3N7KA 3OJVA 2NZ9A 4ISRA 2Q3NB 3NJ5A 5D63A 2ZQNA 2FGFA 5D61A 1YYNA 1TWEA 5G00A 1JY0A 1S0GA 4LO1A 2MIBA 4ZGRB 1JLXA 3EF2A 1S0LA 2KH2A 4R6UB 3V0BB 3UJ0A 2ET2A 3CA4A 1V6UA 4GAIA 4X39A 3CU1B 3IAGC 4D0ZA 3AJ5A 4I4SA 3NBDA 3OJ2A 1S0DA 1RMLA 3QYDA 4JKQA 5FZZA 2HWMA 3CA6A 1BLAA 5FZYA 4OWKA 4XFTA 1DIWA 1ISWA 1PZZA 3UDAA 3A21A 1IHKA 3BAHA 4ZFWB 4HR6C 1R8NA 4I0YA 2AAIB 4USPA 4EB2B 5BVPI 3Q7WA 1S0BA 1TOOA 3RSJA 1P63A 4QD2C 2DRZA 2KLLA 2D7RA 3KMVA 3VEQA 1EVTA 1S0CA 3RTJB 4I4XA 3RMYA 4ZFUB 2ZQOA
chains in the Genus database with same CATH superfamily
1BASA 2LIEA 1BPXA 2HZ9A 1M2TB 4YMMA 4TUPA 5B2HA 4NM2A 5HHIA 1BPEA 4P0KA 4JPZA 1JT3A 4YMOA 4G1RA 4XKIA 1YTOA 1ZQPA 2B51A 2Q9XA 2FFUA 4UB5A 2GWSA 3RJGA 2AQZA 3CA5A 1JAJA 2YUGA 2ZH7A 2BBHA 4NXXA 1V4AA 4DO9A 5DB8A 4Z6EA 2IHMA 2ISPA 2RFFA 3JUTA 4J2SA 4WQKA 1BPBA 2BCVA 3FJ8A 4O5CA 1PWAA 1V6WA 4JWMA 1TWMA 7ICFA 2D44A 4OAIZ 9ICAA 1II4A 5B3PA 4JWNA 5F2VO 3UXOA 3V0BA 5J0PA 2O5AA 1JQZA 2KKIA 3JRRA 3MPPG 3B0YA 2P66A 3CA0A 3RJEA 1DLLA 5EG6C 2DREA 3AQNA 5J2GA 3FJKA 1XSNA 2NVHA 1XSPA 4UAYA 3HBWA 4GOVA 1ZQSA 1RY7A 4KLFA 3ERCC 3ZC9A 4X4UA 4M9NA 4K96A 7ICNA 4TURA 5BPCA 4ZA3B 5DSSB 2FFVA 2BCUA 9ICCA 1SZ6B 2QYIB 4DOCA 1PC8B 3BX1C 1CE7B 3P6JA 3JPOA 4H75A 1ZQBA 4GOYA 4XFUA 4WQLA 4TUSA 1NUNA 3BAQA 4HX0A 3MDCA 2Y9FA 4EBKA 4QZGA 2E4MA 5DDMA 8ICCA 1Q04A 2AXMA 2LIQA 3K1XA 4EP7A 5IIIA 4RQ4A 1ZQCA 3PUBA 8ICZA 2VSAA 2PFPA 4IQTA 4KLLA 1DJSB 2Q66A 4LO7C 3WFPA 5BXPA 2EWRA 3AKGA 4H9WA 4IQUA 4R66A 1ISVA 3S8KA 5HRFA 4EFRA 1FQ9A 5CA7A 4MF2A 5BP5C 2WBCA 4RQ6A 4MFFA 2PFQA 1ZQNA 4KB6A 8ICQA 4RPZA 3MALA 3N0KA 4XFSA 3AZWA 2BCQA 3VSFA 1PX5A 4DCKC 3RMXA 2PXIA 4I4QA 2PFNA 3PMNA 1HWNB 3V0AA 4IQPA 4I1BA 3WFOA 2ZH2A 4I4PA 4KLOA 3ISDA 2RQ9A 2BCRA 1HKNA 5CFTA 4QBVA 4E7XA 4A7YA 2DVIA 1FMZA 2WRYA 3FJEA 5HRKA 3UD7A 2X2SA 3MGIA 7ICKA 4ZKTB 2BEAA 4M5DA 3OGUA 1DZCA 1XSLA 3O3QA 5J2DA 1ZQVA 3O49A 3HSMA 4MFAA 3OBTA 4YOLA 31BIA 4NLZA 3Q7XA 4WH5A 2BPCA 3I2XA 4KEIA 4ZBVB 2IUBA 3V72A 2Z48A 4RQ1A 4J2XA 2D7IA 4I2GA 1GGPB 4FH5A 4FHVA 3C5GA 4I37A 4NLKA 8ICSA 1ZQOA 3C9ZA 3ISBA 9ICFA 2QN4A 3VT1A 3S8JA 4A7ZA 4HA2A 1RPLA 4LO3A 3UJ4A 1TVAA 9ICNA 1TP0A 4JP0A 5I1BA 4QC4A 1ZQJA 7ICUA 3Q7YA 3VSZA 2NTDA 8ICFA 2BCSA 4I2JA 1F5AA 5D61A 1YYNA 5G00A 4LO1A 1JN3A 1JLXA 3EF2A 4AT9A 3CA4A 1V6UA 4GAIA 3IAGC 4D0ZA 3OJ2A 1S0DA 5J0TA 4OWKA 4WC7A 4XFTA 1ISWA 4EEBA 4HR6C 4K97A 8ICJA 2NRKA 2AAIB 5BVPI 1S0BA 2GA9D 9ICUA 7ICMA 3RSJA 2DRZA 2KLLA 4PHAA 4ZFUB 2ZQOA 4AT7A 4RWQA 1ZQDA 3O4AA 4LZGA 1R89A 1ZQYA 4LO2A 3OVSA 5BOWA 1S0EA 2M2UA 4LEVA 4IHZA 1AVWB 2IHOA 2VSEA 3B0XA 3WFQE 1HCEA 3HMYA 1NOMA 4LO0C 4JLXA 2ZHBA 5HRDA 4I2SA 4I4UA 3H6QA 4I27A 4R64A 4J2YA 2D1ZA 4M9HA 3FJCA 1KNYA 3OJMA 1DZDA 8ICXA 3ZXGA 3POKA 7ICTA 4GAFA 4OAHA 1RZOB 3H6RA 1T4QA 1EV2A 4JLZA 3F1RA 1ZQLA 2VLCA 3JPTA 1W3FA 4R65A 3IM7A 2D23A 2K43A 4IQVA 1YF8B 9ICXA 8ICLA 3WA1A 2KI4A 2KI6B 3H3AA 4PHDA 3N7MA 4X37A 3UQ0A 4MFCA 3FJHA 4OW4A 3CRGA 4PPXA 4KLHA 5BOMA 4J23B 3E8LC 4RPXA 4I1EA 7ICQA 4ATBA 4QZIA 4I29A 1CVSA 3HN1A 3O4CA 5D46A 4UAWA 3PHZA 4PGYA 3LLPA 5BXSA 3PG0A 1TV9A 5HR9A 4QKSA 1J0SA 1A8DA 1JTCA 3UXPA 1G9AA 1UETA 9ILBA 2ZH1A 3OBRA 1ISZA 3V79C 3FJBA 7ICEA 1S0FA 8ICKA 2F2FC 2Z49A 4IY9A 4QALA 4RQ2A 1BARA 3NBEA 4OAFA 5FNXA 1ZQRA 5DB7A 4AT7B 3RJIA 1VJ7A 2B4VA 3SNVA 3WINA 4YCXA 5CB1A 1WD3A 3TC2A 9ICWA 3AKHA 4WBZA 4OEGA 4IYBA 3WO4A 7ICRA 4UBCA 3V7JA 2UUSA 4O9MA 1AVXB 4WC0A 1YXWA 4LO3C 9ICIA 4WC4A 4GXKA 2DR8A 9ICQA 4KLSA 4CJMA 4LEZA 2BE3A 1DFQA 3BA7A 1AF9A 3AQMA 3N7JA 1ILR1 4LEWA 2GZBA 2ESUA 4KM5A 3OV7A 4I4VA 4Z9WB 4DEPA 2GAFD 4G6MA 3HALA 3FJFA 4LO1C 4I4OA 4RWNA 4I2HA 5J2HA 1T9FA 2MLLB 4O5EA 1EPWA 1XHBA 2Y9GA 3BTAA 2ERMA 4X4QA 4QZEA 4OUJA 4AN7B 2ZH3A 1HIBA 1KEJA 4I2FA 4PC4A 4I2CA 2DR7A 4Q9GA 2NYYA 2HHPA 5IIKA 3AUOA 7ICLA 4QZ8A 4QD2B 5DZUA 1Q03A 5HRBA 3O4BA 5DDYA 3FJ9A 4LO2C 1IOBA 1G9CA 1SR4C 4H04A 2NP0A 4PHEA 1ZQIA 2VU9A 4XA5A 2BEBA 5J0YA 4M0AA 3I29B 4ISQA 4NM1A 4G9NA 3BRDA 7ICPA 2VXTI 4F83A 4OEFA 1JMSA 4GP0A 3WMVA 5BQUA 5IILA 3AH1A 1NO5A 1AVUA 4KLQA 4P4MA 4M2YA 5F8WA 1ZQFA 4P4PA 8I1BA 2BPFA 4O5KA 3JPRA 1MD6A 4PHPA 4ISRA 4YN4A 4X5VA 5D63A 4X0AA 1ZQEA 3MGHA 4NY8A 2KH2A 1UEVA 4R6UB 3V0BB 4X39A 4DOAA 8ICIA 3CU1B 9ICBA 4WC6A 3AJ5A 4I4SA 3NBDA 5CFSA 3QYDA 5IIOA 3RJFA 4RQ0A 3CA6A 5FZYA 1DIWA 4RQ3A 3HWTA 3GDXA 4WC5A 3BAHA 3C2KA 3V7LA 4EB2B 2I9GA 1P63A 4QD2C 1ZQWA 3VEQA 1EVTA 4QZCA 4F5RA 4I4XA 3RMYA 4FH3A 8ICPA 1V6XA 5DB9A 5BXTA 4XQ8A 2DS0A 3AH4A 3BAVA 1FMMS 4I6IA 4M9LA 4FVVA 2RG9B 3WO2A 1GPJA 1AVAC 8ICEA 3BRGC 8ICTA 4Z6DA 2NM1A 3NYBA 9ICSA 3H39A 9ICMA 3JYYA 3B9UA 2W9MA 1BPYA 4D8HA 5J2EA 3C5FA 3UQ2A 5DKWA 3P6IA 4NXZA 3UD8A 4Q9PA 3W9TA 8ICUA 4EEEB 3RJJA 4KLJA 4IZXA 4AN6A 3FJAA 4E80A 4RWPA 3VT0A 5DBBA 1TFYA 4UAZA 1IT0A 3NWIA 3BADA 9ICLA 2ZHAA 4PH5A 3RH6A 1WBAA 1JLYA 4K8VA 4O69A 4D0TA 5J2AA 1XZZA 3MBYA 4X4SA 1BFGA 4QZDA 4IZEA 4QO3A 5J2FA 9ICVA 1R8BA 4IQWA 3JCFA 8ICNA 3CA3A 3RJKA 4KLMA 1K5VA 4XRHA 3IM5A 3WFRE 1DQGA 3R4UA 4A7KA 4ZFYB 4G6JA 4XJEA 4EFPA 4USOA 3V0AB 2DRAA 7ICGA 4J2KA 1MIWA 5IIJA 3ILAA 2B56A 4EGWA 4FO6A 3WO3A 3BA5A 3UPSA 4K9AA 4II0A 4FHXA 4JKXB 1ZQMA 4UB2A 4M47A 1G82A 4UD4A 5J2BA 5CFUA 4MZFB 3MDAA 6I1BA 5HHHA 2BBJA 4WOYA 2RSTA 4FHWA 3K7DA 4UY4A 2E4MC 2ID1A 1XYFA 3OVBA 3BAGA 1I1BA 4KEKA 4NXVA 3A22A 4KEJA 3NBCA 4I2AA 3CA1A 3HJ4A 2R9KB 1ZQUA 2DR9A 1WOTA 4OWJA 2ZH4A 4NKUA 2FMSA 5EHAA 3FJDA 2P23A 4QZHA 4RT3A 4EEDA 3AQKA 4JRAA 4MZGB 4LT6A 5BQUC 2M2VA 4DOBA 4ENDA 3AJ6A 5BP5A 1ZQTA 9ICJA 1BA7A 3P53A 1VCLA 3PMLA 5D62A 4KC3A 3UD9A 4QZFA 1FGAA 1KNMA 2FCLA 3BA4A 4X4VA 3H37A 3MCRA 2M49A 2HW9A 8ICWA 4GP3A 1ZJNA 5J2CA 7ICVA 3HIYA 3JPSA 4G9MA 4Z6CA 3NVOA 3H38A 4XQ7A 4HJJA 1ZJMA 4AT9B 4L4HA 2GO2A 4KBBA 5HC9A 4Z8SB 5JMCA 5DEDA 3WMUA 3C2LA 1VFGA 3ER9B 1HWOB 2XOAA 5J0RA 4NXTA 4XUSA 3FUQA 3ZX7A 4O68A 2FDBM 4RT2A 4IY8A 3HJ1A 5BXRA 2ZH5A 1V6VA 4F34A 2DRYA 3O4DA 4P6AA 3JPNA 1UEUA 1D0HA 4KLIA 1ABRB 4WBCA 4IONA 2ISOA 1JT4A 2D43A 1JT7A 2NS2A 4I7IA 4OEEA 4I2EA 1YLQA 4KLDA 3N7LA 1I1EA 9ICHA 3VWCA 5IIMA 7ICIA 2FMQA 5E24E 1FA0A 3CAHA 1FWVA 4P0JA 1QQLA 3RJHA 4LZDA 4I2BA 1Q79A 4MF8A 4LEYA 4I2IA 5J0OA 4X3AA 2Y9WC 3I2AA 1R8CA 1N4KA 4X4NA 2IWTB 2F8XC 4IG8A 1MQ2A 5EOZA 4LO7B 9ICRA 1PUUB 1Z2VA 1BFBA 4ZLBB 3H6RB 3VUOA 1HWMB 1BPZA 3OJVA 2Q3NB 1ZQXA 3NJ5A 2ZQNA 2FGFA 3C2MA 2MIBA 4ZGRB 5HRGA 4GXIA 4KLTA 3UJ0A 3C66A 1OU5A 3OWGA 3L9DA 4JKQA 5HREA 1ZQGA 5FZZA 5J0QA 4MZHA 3NKUA 2ZH9A 4YD1A 3UDAA 1PZZA 4M04A 1IHKA 4F5NA 4PGQA 1R8NA 4USPA 5DBAA 3Q7WA 1TOOA 8ICMA 3RH5A 8ICHA 3RTJB 4GXJA 4ATBB 4NLNA 4P0LA 3ZC8A 4RQ5A 4X4TA 4LVSA 1KDHA 5DB6A 1ISXA 5JLVA 4X4RA 2DRBA 4K4IA 4WCWA 4K98A 3CRIA 1Q1UA 2AFGA 1R8AA 3HW8A 1FWUA 4LO0A 1JT5A 8ICYA 1MC9A 4Q91A 5HPZA 4M9JA 5CR0A 3FUOA 4NKTA 2K4AB 3A07A 3UPQA 3O44A 4P4OA 1M16A 3OGFA 1QXMA 3UXNA 1W3AA 4PGXA 4I3NA 4I96A 4X38A 4YD2A 4O67A 3LTQA 4AT8A 2ZH6A 2X2TA 1ZQAA 2ZH8A 3AKIA 2D22A 1HUZA 4JQ0A 1IJTA 3AH2A 1HWPB 2VANA 5J2KA 7I1BA 2I1BA 4OWLA 2P39A 5CHEA 3AKFA 7ICHA 1TIEA 1XG6A 1DFCA 3CQAA 2BFHA 3LQCB 1MIYA 2HWAA 2M2TA 4UB1A 5J29A 1OQLB 5HRHA 1IILA 1R8OA 2FO1A 4M9GA 1HUOA 4Z6FA 9ICTA 4FHPA 1EYLA 1Z4SA 5GAQA 2D24A 41BIA 1F31A 3O5WB 5F8YA 3OUYA 4I2DA 4QBCA 3HOMA 1ZQKA 4F5QA 5J0XA 1QQKA 1Q78A 1YBIA 3R4SA 4EKXB 4EFQA 2DR5A 4P2HA 5TZVA 3D7WB 1ISYA 1G9DA 3HX0A 4RPYA 3BAUA 3RTIB 1MIVA 3LK9A 1IRAX 1W3GA 1RG8A 5CWRA 2F2FA 1WBCA 5FNWA 1HCDA 4KLUA 5B3QA 4K4HA 3H6SE 7ICOA 3WINC 3BB2A 3BAOA 4JAWA 3VT2A 1AXMA 4MKPA 3FJJA 3K75D 4K99A 1FV2A 3ISCA 3NBNA 1NZKA 1ITBA 2K8RA 2J3PA 1UPSA 1E0OA 3QR5A 3CK6A 4FGFA 8ICBA 2HN1A 1G9BA 4F5OA 1MQ3A 4LO8B 1L2HA 1JQRA 5J0WA 4S3NA 4RQ8A 4X4OA 3OGGA 3IM6A 2M2WA 1ZQHA 1TFMB 4FHYA 4DENA 3TFSA 5DECA 3A23A 4OAGA 2D20A 9ICPA 3BRFA 2VXRA 8ICRA 3OVAA 3AQLA 4WC3A 1AFCA 4AT8B 4TLPA 2MC2A 4F5PA 4X0BA 5IINA 4ZOTA 8ICGA 3WFSC 1BLDA 1Z0HA 1BFFA 5F90A 1PUMB 5BOLA 3O4OA 5JTGA 3JPPA 5DBCA 4I8MA 3AU6A 1FN0A 7ICJA 2L5XA 4QZ9A 4QZBA 4X4PA 3PMEA 2FMPA 1ONKB 5FZUA 2VUAA 5J2JA 3IIRA 3FJIA 21BIA 3F62B 4KLGA 4WC1A 4QKRA 5CJ7A 4K4GA 1DQOA 1BFCA 2Y9XE 1ZQQA 3OUYB 5CHGA 4UD5A 9ICGA 3FGMA 3AZVA 1IRPA 3C18A 4FO1A 5DUYA 4N7RA 2HN2A 1FV3A 1SR4A 4UB4A 7ICSA 4NXWA 5HRIA 9ICKA 4L4IA 4I4YA 3CRHA 3ZXDA 2O1PA 3T8SA 3V7KA 3RH4A 4I4RA 4EBJA 9ICOA 1TFWA 4YMNA 1K5UA 5J2IA 5F8SA 5DVHA 3FFZA 4TUQA 5D4BA 1TTUA 5EC5A 1WD4A 2ZR1B 3N7KA 1ZQZA 4WBYA 5D49A 4K9BA 1TWEA 1JY0A 1S0GA 4KLEA 4I0UA 2PBEA 5J0UA 4RWOA 8ICOA 1S0LA 4UB3A 2ET2A 4UBBA 4E8FA 2BPGA 2PFOA 3TFRA 3PNCA 3AU2A 1RMLA 5HRLA 3JPQA 4R63A 2HWMA 5CP2A 4WC2A 4O6AA 1BLAA 4I28A 1RZTA 3ER8C 8ICAA 1BPDA 3A21A 4NXUA 4ZFWB 3JZ0A 4I0YA 4QZAA 8ICVA 4EV6A 4RQ7A 2D7RA 3KMVA 5J0SA 1S0CA 9ICEA 2NZ9A
chains in the Genus database with same CATH topology
1BASA 1V6XA 5BXTA 2DS0A 3AH4A 4P0LA 2LIEA 3ZC8A 3BAVA 2HZ9A 1M2TB 1FMMS 4I6IA 5B2HA 1ISXA 5JLVA 3O4AA 4FVVA 2RG9B 3WO2A 4LO2A 5BOWA 4K98A 3CRIA 1S0EA 1GPJA 1Q1UA 4IHZA 2AFGA 4LEVA 1AVWB 2IHOA 2VSEA 1AVAC 3BRGC 4P0KA 2NM1A 1HCEA 4JPZA 1JT3A 3HMYA 4G1RA 4LO0C 4XKIA 4JLXA 1YTOA 1FWUA 2B51A 2Q9XA 2FFUA 4I2SA 4I4UA 4LO0A 1JT5A 3B9UA 1MC9A 4Q91A 4D8HA 3H6QA 2AQZA 3CA5A 5HPZA 2YUGA 3FUOA 4J2YA 3P6IA 3UD8A 4Q9PA 2D1ZA 4NXXA 3W9TA 2K4AB 3FJCA 4EEEB 3OJMA 1DZDA 3A07A 3O44A 4IZXA 4AN6A 3FJAA 3ZXGA 1M16A 3OGFA 3POKA 1QXMA 3JUTA 4GAFA 1W3AA 4J2SA 3VT0A 4OAHA 1RZOB 4WQKA 3H6RA 3FJ8A 1IT0A 1PWAA 1V6WA 3BADA 4I3NA 4I96A 4X38A 1TWMA 1WBAA 1JLYA 1T4QA 2D44A 4K8VA 4O67A 1EV2A 4O69A 4D0TA 4JLZA 3F1RA 4OAIZ 3LTQA 1XZZA 2VLCA 1II4A 5B3PA 2X2TA 1BFGA 1W3FA 3AKIA 3IM7A 2D23A 2K43A 1YF8B 2D22A 3V0BA 4JQ0A 1IJTA 3AH2A 1HWPB 4IZEA 1JQZA 2KKIA 4QO3A 3WA1A 7I1BA 2I1BA 3JRRA 4OWLA 3MPPG 2P39A 5CHEA 3AKFA 3CA0A 1TIEA 2KI4A 1XG6A 2KI6B 3CA3A 1DFCA 3CQAA 1DLLA 5EG6C 2DREA 2BFHA 1K5VA 2HWAA 3IM5A 3N7MA 1OQLB 4X37A 3FJKA 2NVHA 3FJHA 1IILA 1DQGA 3HBWA 1R8OA 3R4UA 4GOVA 4A7KA 4ZFYB 4G6JA 2FO1A 4XJEA 4EFPA 1RY7A 4USOA 3V0AB 3ERCC 3ZC9A 1EYLA 1Z4SA 4K96A 4OW4A 4J2KA 3CRGA 5GAQA 4J23B 2D24A 41BIA 4ZA3B 1F31A 3O5WB 5F8YA 5DSSB 3E8LC 2FFVA 4I1EA 1SZ6B 3ILAA 2B56A 2QYIB 1PC8B 4QBCA 3HOMA 1CVSA 3BX1C 3HN1A 3O4CA 3BA5A 3WO3A 1CE7B 3P6JA 1QQKA 4K9AA 4H75A 3PHZA 4II0A 3LLPA 4JKXB 5BXSA 3PG0A 1YBIA 3R4SA 4EKXB 4QKSA 1J0SA 1A8DA 4EFQA 1G82A 4GOYA 1JTCA 4XFUA 4WQLA 5CFUA 4MZFB 3D7WB 6I1BA 1ISYA 1G9AA 9ILBA 1G9DA 1NUNA 3BAQA 4WOYA 4HX0A 3BAUA 2RSTA 3OBRA 3RTIB 3K7DA 4UY4A 2Y9FA 1ISZA 3V79C 3FJBA 2E4MC 1S0FA 1IRAX 2E4MA 1XYFA 1W3GA 1RG8A 3BAGA 1I1BA 2F2FC 2Z49A 4KEKA 1Q04A 4IY9A 4NXVA 4QALA 2F2FA 2AXMA 2LIQA 3A22A 3K1XA 1BARA 3NBEA 1WBCA 5FNWA 1HCDA 4KEJA 4OAFA 3NBCA 3PUBA 5FNXA 3CA1A 2VSAA 5B3QA 3H6SE 3WINC 2R9KB 2B4VA 3BB2A 3SNVA 3WINA 1DJSB 3BAOA 4JAWA 3VT2A 4OWJA 1AXMA 1WD3A 4MKPA 3TC2A 3FJJA 4K99A 1FV2A 3AKHA 5EHAA 4LO7C 4OEGA 4IYBA 3NBNA 3WO4A 5BXPA 2EWRA 3AKGA 3FJDA 2P23A 1NZKA 1ITBA 4H9WA 2K8RA 2J3PA 1UPSA 2UUSA 4JRAA 4MZGB 1AVXB 1ISVA 1E0OA 3QR5A 5BQUC 3S8KA 4EFRA 1FQ9A 4FGFA 5BP5C 2WBCA 1YXWA 4ENDA 1G9BA 3AJ6A 5BP5A 4LO8B 1L2HA 4LO3C 1BA7A 4KB6A 3P53A 1VCLA 3OGGA 4CJMA 5D62A 3IM6A 4KC3A 4LEZA 3UD9A 1DFQA 3MALA 3BA7A 1AF9A 1TFMB 3N0KA 3N7JA 3AZWA 4XFSA 1FGAA 1ILR1 3VSFA 1KNMA 4LEWA 2GZBA 4DENA 2FCLA 3BA4A 2ESUA 3A23A 4KM5A 4DCKC 4OAGA 3RMXA 2D20A 4I4VA 3MCRA 3BRFA 2M49A 2HW9A 4Z9WB 4DEPA 2GAFD 4GP3A 2VXRA 4G6MA 3HALA 4I4QA 3FJFA 4LO1C 1HWNB 3V0AA 1AFCA 4IQPA 4G9MA 4I1BA 4TLPA 2MC2A 4I4OA 4ZOTA 4I4PA 2RQ9A 4HJJA 1T9FA 2MLLB 4L4HA 1BLDA 2GO2A 1Z0HA 1HKNA 4KBBA 1BFFA 5F90A 5CFTA 1PUMB 1EPWA 1XHBA 2Y9GA 3BTAA 4Z8SB 3WMUA 5JMCA 2ERMA 4QBVA 3O4OA 3ER9B 4A7YA 4OUJA 1HWOB 2XOAA 1FMZA 4I8MA 1FN0A 2WRYA 4AN7B 2L5XA 3FJEA 3PMEA 4NXTA 1ONKB 5FZUA 1HIBA 2VUAA 3FUQA 3ZX7A 3IIRA 3UD7A 4O68A 2X2SA 3FJIA 4PC4A 21BIA 3F62B 2FDBM 4ZKTB 2BEAA 4IY8A 4QKRA 4Q9GA 2NYYA 1DZCA 5BXRA 1DQOA 1BFCA 3O3QA 2Y9XE 3O49A 1V6VA 4F34A 2DRYA 3O4DA 3HSMA 4P6AA 4QD2B 3OBTA 4YOLA 31BIA 5DZUA 1Q03A 3FGMA 3Q7XA 3AZVA 4WH5A 3O4BA 1D0HA 1IRPA 1ABRB 4WBCA 4FO1A 3FJ9A 4IONA 1JT4A 4LO2C 2D43A 3I2XA 1IOBA 1G9CA 1JT7A 5DUYA 4KEIA 2NS2A 4N7RA 4I7IA 4ZBVB 4OEEA 1SR4C 4H04A 2NP0A 1FV3A 2VU9A 1SR4A 2Z48A 3N7LA 2BEBA 1I1EA 3I29B 4J2XA 4ISQA 3VWCA 2D7IA 1GGPB 4NXWA 4G9NA 5E24E 3BRDA 4L4IA 4I4YA 3CRHA 4I37A 2VXTI 3ZXDA 4F83A 3CAHA 1FWVA 4OEFA 4P0JA 3T8SA 1QQLA 3C9ZA 4I4RA 4GP0A 3WMVA 5BQUA 2QN4A 4LEYA 3VT1A 1K5UA 4X3AA 3S8JA 2Y9WC 5F8SA 3I2AA 4A7ZA 4HA2A 4LO3A 5DVHA 3UJ4A 1N4KA 3AH1A 3FFZA 2IWTB 2F8XC 1TP0A 4JP0A 1AVUA 5I1BA 4QC4A 4LO7B 5F8WA 1PUUB 1Z2VA 1BFBA 8I1BA 4ZLBB 1TTUA 3Q7YA 5EC5A 3H6RB 3VSZA 2NTDA 1WD4A 2ZR1B 3VUOA 1HWMB 1MD6A 3N7KA 3OJVA 2NZ9A 4ISRA 2Q3NB 3NJ5A 5D63A 2ZQNA 2FGFA 4K9BA 5D61A 1YYNA 1TWEA 5G00A 1JY0A 1S0GA 4LO1A 2MIBA 4ZGRB 1JLXA 3EF2A 1S0LA 2KH2A 4R6UB 3V0BB 3UJ0A 2ET2A 3CA4A 1V6UA 4GAIA 4X39A 3CU1B 3IAGC 4D0ZA 3AJ5A 4I4SA 3OWGA 3NBDA 3OJ2A 5CFSA 1S0DA 1RMLA 3QYDA 4JKQA 5FZZA 2HWMA 3CA6A 1BLAA 4O6AA 4MZHA 5FZYA 4OWKA 3NKUA 4XFTA 3ER8C 1DIWA 1ISWA 1PZZA 3UDAA 3A21A 1IHKA 3BAHA 4ZFWB 4NXUA 4HR6C 1R8NA 4K97A 4I0YA 2AAIB 4USPA 4EB2B 5BVPI 3Q7WA 1S0BA 1TOOA 2GA9D 3RSJA 1P63A 4QD2C 2DRZA 2KLLA 2D7RA 3KMVA 3VEQA 1EVTA 1S0CA 3RTJB 4I4XA 3RMYA 4ZFUB 2ZQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAS A;  1V6X A;  5BXT A;  2DS0 A;  3AH4 A;  4P0L A;  2LIE A;  3ZC8 A;  3BAV A;  2HZ9 A;  1M2T B;  1FMM S;  4I6I A;  5B2H A;  1ISX A;  5JLV A;  3O4A A;  4FVV A;  2RG9 B;  3WO2 A;  4LO2 A;  5BOW A;  3CRI A;  1S0E A;  1Q1U A;  4IHZ A;  2AFG A;  1AVW B;  2IHO A;  2VSE A;  1AVA C;  3BRG C;  4P0K A;  2NM1 A;  1HCE A;  4JPZ A;  1JT3 A;  3HMY A;  4G1R A;  4LO0 C;  4XKI A;  1YTO A;  1FWU A;  2Q9X A;  2FFU A;  4I2S A;  4I4U A;  4LO0 A;  1JT5 A;  3B9U A;  1MC9 A;  4Q91 A;  4D8H A;  3H6Q A;  2AQZ A;  3CA5 A;  5HPZ A;  2YUG A;  3FUO A;  4J2Y A;  3P6I A;  3UD8 A;  4Q9P A;  2D1Z A;  3W9T A;  2K4A B;  3FJC A;  4EEE B;  3OJM A;  1DZD A;  3A07 A;  3O44 A;  4IZX A;  4AN6 A;  3FJA A;  3ZXG A;  1M16 A;  3OGF A;  3POK A;  1QXM A;  3JUT A;  4GAF A;  1W3A A;  4J2S A;  3VT0 A;  1RZO B;  3H6R A;  3FJ8 A;  1IT0 A;  1PWA A;  1V6W A;  3BAD A;  4I3N A;  4I96 A;  4X38 A;  1TWM A;  1WBA A;  1JLY A;  1T4Q A;  2D44 A;  1EV2 A;  4D0T A;  3F1R A;  3LTQ A;  1XZZ A;  2VLC A;  1II4 A;  2X2T A;  1BFG A;  1W3F A;  3AKI A;  3IM7 A;  2D23 A;  2K43 A;  1YF8 B;  2D22 A;  3V0B A;  4JQ0 A;  1IJT A;  3AH2 A;  1HWP B;  4IZE A;  1JQZ A;  2KKI A;  4QO3 A;  3WA1 A;  7I1B A;  2I1B A;  3JRR A;  4OWL A;  3MPP G;  2P39 A;  3AKF A;  3CA0 A;  1TIE A;  2KI4 A;  1XG6 A;  2KI6 B;  3CA3 A;  1DFC A;  3CQA A;  1DLL A;  5EG6 C;  2DRE A;  2BFH A;  1K5V A;  2HWA A;  3IM5 A;  3N7M A;  1OQL B;  4X37 A;  3FJK A;  2NVH A;  3FJH A;  1IIL A;  1DQG A;  3HBW A;  1R8O A;  3R4U A;  4GOV A;  4A7K A;  4ZFY B;  4G6J A;  2FO1 A;  4EFP A;  1RY7 A;  4USO A;  3V0A B;  3ZC9 A;  1EYL A;  1Z4S A;  4OW4 A;  4J2K A;  3CRG A;  5GAQ A;  4J23 B;  2D24 A;  41BI A;  4ZA3 B;  1F31 A;  3O5W B;  5F8Y A;  5DSS B;  3E8L C;  2FFV A;  4I1E A;  1SZ6 B;  3ILA A;  2QYI B;  1PC8 B;  4QBC A;  3HOM A;  1CVS A;  3BX1 C;  3HN1 A;  3O4C A;  3BA5 A;  3WO3 A;  1CE7 B;  3P6J A;  1QQK A;  3PHZ A;  4II0 A;  3LLP A;  4JKX B;  5BXS A;  3PG0 A;  1YBI A;  3R4S A;  4EKX B;  4QKS A;  1J0S A;  1A8D A;  4EFQ A;  1G82 A;  4GOY A;  1JTC A;  4XFU A;  3D7W B;  6I1B A;  1ISY A;  1G9A A;  9ILB A;  1G9D A;  1NUN A;  3BAQ A;  3BAU A;  2RST A;  3OBR A;  3RTI B;  2Y9F A;  1ISZ A;  3V79 C;  3FJB A;  2E4M C;  1S0F A;  1IRA X;  2E4M A;  1XYF A;  1W3G A;  1RG8 A;  3BAG A;  1I1B A;  2F2F C;  2Z49 A;  4KEK A;  1Q04 A;  4IY9 A;  4QAL A;  2F2F A;  2AXM A;  2LIQ A;  3A22 A;  3K1X A;  1BAR A;  3NBE A;  1WBC A;  5FNW A;  1HCD A;  4KEJ A;  3NBC A;  3PUB A;  5FNX A;  3CA1 A;  2VSA A;  3H6S E;  3WIN C;  2R9K B;  3BB2 A;  3SNV A;  3WIN A;  1DJS B;  3BAO A;  4JAW A;  3VT2 A;  4OWJ A;  1AXM A;  1WD3 A;  3TC2 A;  3FJJ A;  1FV2 A;  3AKH A;  5EHA A;  4LO7 C;  4OEG A;  4IYB A;  3NBN A;  3WO4 A;  5BXP A;  3AKG A;  3FJD A;  2P23 A;  1NZK A;  1ITB A;  4H9W A;  2K8R A;  2J3P A;  1UPS A;  2UUS A;  4JRA A;  1AVX B;  1ISV A;  1E0O A;  3QR5 A;  5BQU C;  3S8K A;  4EFR A;  1FQ9 A;  4FGF A;  5BP5 C;  2WBC A;  1YXW A;  4END A;  1G9B A;  3AJ6 A;  5BP5 A;  4LO8 B;  1L2H A;  4LO3 C;  1BA7 A;  3P53 A;  1VCL A;  3OGG A;  4CJM A;  5D62 A;  3IM6 A;  4KC3 A;  3UD9 A;  1DFQ A;  3MAL A;  3BA7 A;  1AF9 A;  1TFM B;  3N0K A;  3N7J A;  3AZW A;  4XFS A;  1FGA A;  1ILR 1;  3VSF A;  1KNM A;  2GZB A;  4DEN A;  3BA4 A;  2ESU A;  3A23 A;  4DCK C;  3RMX A;  2D20 A;  4I4V A;  3BRF A;  2M49 A;  2HW9 A;  4Z9W B;  4DEP A;  4GP3 A;  2VXR A;  4G6M A;  3HAL A;  4I4Q A;  3FJF A;  4LO1 C;  1HWN B;  3V0A A;  1AFC A;  4IQP A;  4G9M A;  4I1B A;  4TLP A;  2MC2 A;  4I4O A;  4ZOT A;  4I4P A;  2RQ9 A;  4HJJ A;  1T9F A;  2MLL B;  4L4H A;  1BLD A;  2GO2 A;  1Z0H A;  1HKN A;  4KBB A;  1BFF A;  5F90 A;  1PUM B;  1EPW A;  1XHB A;  2Y9G A;  3BTA A;  4Z8S B;  3WMU A;  5JMC A;  2ERM A;  4QBV A;  3O4O A;  4A7Y A;  4OUJ A;  1HWO B;  2XOA A;  1FMZ A;  4I8M A;  1FN0 A;  2WRY A;  4AN7 B;  2L5X A;  3FJE A;  3PME A;  1ONK B;  5FZU A;  1HIB A;  2VUA A;  3FUQ A;  3ZX7 A;  3IIR A;  3UD7 A;  2X2S A;  3FJI A;  4PC4 A;  21BI A;  3F62 B;  2FDB M;  4ZKT B;  2BEA A;  4IY8 A;  4QKR A;  4Q9G A;  2NYY A;  1DZC A;  5BXR A;  1DQO A;  1BFC A;  3O3Q A;  2Y9X E;  3O49 A;  1V6V A;  4F34 A;  2DRY A;  3O4D A;  3HSM A;  4P6A A;  4QD2 B;  3OBT A;  4YOL A;  31BI A;  5DZU A;  1Q03 A;  3FGM A;  3Q7X A;  3AZV A;  3O4B A;  1D0H A;  1IRP A;  1ABR B;  4WBC A;  3FJ9 A;  4ION A;  1JT4 A;  4LO2 C;  2D43 A;  3I2X A;  1IOB A;  1G9C A;  1JT7 A;  5DUY A;  4KEI A;  4I7I A;  4ZBV B;  4OEE A;  1SR4 C;  4H04 A;  2NP0 A;  1FV3 A;  2VU9 A;  1SR4 A;  2Z48 A;  3N7L A;  2BEB A;  1I1E A;  3I29 B;  4J2X A;  4ISQ A;  3VWC A;  2D7I A;  1GGP B;  4G9N A;  5E24 E;  3BRD A;  4L4I A;  4I4Y A;  3CRH A;  4I37 A;  2VXT I;  3ZXD A;  4F83 A;  3CAH A;  1FWV A;  4OEF A;  4P0J A;  3T8S A;  1QQL A;  3C9Z A;  4I4R A;  4GP0 A;  3WMV A;  5BQU A;  2QN4 A;  3VT1 A;  1K5U A;  4X3A A;  3S8J A;  2Y9W C;  5F8S A;  3I2A A;  4A7Z A;  4HA2 A;  4LO3 A;  5DVH A;  3UJ4 A;  1N4K A;  3AH1 A;  3FFZ A;  2IWT B;  2F8X C;  1TP0 A;  4JP0 A;  1AVU A;  5I1B A;  4QC4 A;  4LO7 B;  5F8W A;  1PUU B;  1Z2V A;  1BFB A;  8I1B A;  4ZLB B;  1TTU A;  3Q7Y A;  5EC5 A;  3H6R B;  3VSZ A;  2NTD A;  1WD4 A;  2ZR1 B;  3VUO A;  1HWM B;  1MD6 A;  3N7K A;  3OJV A;  2NZ9 A;  4ISR A;  2Q3N B;  3NJ5 A;  5D63 A;  2ZQN A;  2FGF A;  5D61 A;  1YYN A;  1TWE A;  5G00 A;  1JY0 A;  1S0G A;  4LO1 A;  2MIB A;  4ZGR B;  1JLX A;  3EF2 A;  1S0L A;  2KH2 A;  4R6U B;  3V0B B;  3UJ0 A;  2ET2 A;  3CA4 A;  1V6U A;  4GAI A;  4X39 A;  3CU1 B;  3IAG C;  4D0Z A;  3AJ5 A;  4I4S A;  3NBD A;  3OJ2 A;  1S0D A;  1RML A;  3QYD A;  4JKQ A;  5FZZ A;  2HWM A;  3CA6 A;  1BLA A;  5FZY A;  4OWK A;  4XFT A;  1DIW A;  1ISW A;  1PZZ A;  3UDA A;  3A21 A;  1IHK A;  3BAH A;  4ZFW B;  4HR6 C;  1R8N A;  4I0Y A;  2AAI B;  4USP A;  4EB2 B;  5BVP I;  3Q7W A;  1S0B A;  1TOO A;  3RSJ A;  1P63 A;  4QD2 C;  2DRZ A;  2KLL A;  2D7R A;  3KMV A;  3VEQ A;  1EVT A;  1S0C A;  3RTJ B;  4I4X A;  3RMY A;  4ZFU B;  2ZQO A; 
#chains in the Genus database with same CATH topology
 1BAS A;  2LIE A;  1BPX A;  2HZ9 A;  1M2T B;  4YMM A;  4TUP A;  5B2H A;  4NM2 A;  5HHI A;  1BPE A;  4P0K A;  4JPZ A;  1JT3 A;  4YMO A;  4G1R A;  4XKI A;  1YTO A;  1ZQP A;  2B51 A;  2Q9X A;  2FFU A;  4UB5 A;  2GWS A;  3RJG A;  2AQZ A;  3CA5 A;  1JAJ A;  2YUG A;  2ZH7 A;  2BBH A;  4NXX A;  1V4A A;  4DO9 A;  5DB8 A;  4Z6E A;  2IHM A;  2ISP A;  2RFF A;  3JUT A;  4J2S A;  4WQK A;  1BPB A;  2BCV A;  3FJ8 A;  4O5C A;  1PWA A;  1V6W A;  4JWM A;  1TWM A;  7ICF A;  2D44 A;  4OAI Z;  9ICA A;  1II4 A;  5B3P A;  4JWN A;  5F2V O;  3UXO A;  3V0B A;  5J0P A;  2O5A A;  1JQZ A;  2KKI A;  3JRR A;  3MPP G;  3B0Y A;  2P66 A;  3CA0 A;  3RJE A;  1DLL A;  5EG6 C;  2DRE A;  3AQN A;  5J2G A;  3FJK A;  1XSN A;  2NVH A;  1XSP A;  4UAY A;  3HBW A;  4GOV A;  1ZQS A;  1RY7 A;  4KLF A;  3ERC C;  3ZC9 A;  4X4U A;  4M9N A;  4K96 A;  7ICN A;  4TUR A;  5BPC A;  4ZA3 B;  5DSS B;  2FFV A;  2BCU A;  9ICC A;  1SZ6 B;  2QYI B;  4DOC A;  1PC8 B;  3BX1 C;  1CE7 B;  3P6J A;  3JPO A;  4H75 A;  1ZQB A;  4GOY A;  4XFU A;  4WQL A;  4TUS A;  1NUN A;  3BAQ A;  4HX0 A;  3MDC A;  2Y9F A;  4EBK A;  4QZG A;  2E4M A;  5DDM A;  8ICC A;  1Q04 A;  2AXM A;  2LIQ A;  3K1X A;  4EP7 A;  5III A;  4RQ4 A;  1ZQC A;  3PUB A;  8ICZ A;  2VSA A;  2PFP A;  4IQT A;  4KLL A;  1DJS B;  2Q66 A;  4LO7 C;  3WFP A;  5BXP A;  2EWR A;  3AKG A;  4H9W A;  4IQU A;  4R66 A;  1ISV A;  3S8K A;  5HRF A;  4EFR A;  1FQ9 A;  5CA7 A;  4MF2 A;  5BP5 C;  2WBC A;  4RQ6 A;  4MFF A;  2PFQ A;  1ZQN A;  4KB6 A;  8ICQ A;  4RPZ A;  3MAL A;  3N0K A;  4XFS A;  3AZW A;  2BCQ A;  3VSF A;  1PX5 A;  4DCK C;  3RMX A;  2PXI A;  4I4Q A;  2PFN A;  3PMN A;  1HWN B;  3V0A A;  4IQP A;  4I1B A;  3WFO A;  2ZH2 A;  4I4P A;  4KLO A;  3ISD A;  2RQ9 A;  2BCR A;  1HKN A;  5CFT A;  4QBV A;  4E7X A;  4A7Y A;  2DVI A;  1FMZ A;  2WRY A;  3FJE A;  5HRK A;  3UD7 A;  2X2S A;  3MGI A;  7ICK A;  4ZKT B;  2BEA A;  4M5D A;  3OGU A;  1DZC A;  1XSL A;  3O3Q A;  5J2D A;  1ZQV A;  3O49 A;  3HSM A;  4MFA A;  3OBT A;  4YOL A;  31BI A;  4NLZ A;  3Q7X A;  4WH5 A;  2BPC A;  3I2X A;  4KEI A;  4ZBV B;  2IUB A;  3V72 A;  2Z48 A;  4RQ1 A;  4J2X A;  2D7I A;  4I2G A;  1GGP B;  4FH5 A;  4FHV A;  3C5G A;  4I37 A;  4NLK A;  8ICS A;  1ZQO A;  3C9Z A;  3ISB A;  9ICF A;  2QN4 A;  3VT1 A;  3S8J A;  4A7Z A;  4HA2 A;  1RPL A;  4LO3 A;  3UJ4 A;  1TVA A;  9ICN A;  1TP0 A;  4JP0 A;  5I1B A;  4QC4 A;  1ZQJ A;  7ICU A;  3Q7Y A;  3VSZ A;  2NTD A;  8ICF A;  2BCS A;  4I2J A;  1F5A A;  5D61 A;  1YYN A;  5G00 A;  4LO1 A;  1JN3 A;  1JLX A;  3EF2 A;  4AT9 A;  3CA4 A;  1V6U A;  4GAI A;  3IAG C;  4D0Z A;  3OJ2 A;  1S0D A;  5J0T A;  4OWK A;  4WC7 A;  4XFT A;  1ISW A;  4EEB A;  4HR6 C;  4K97 A;  8ICJ A;  2NRK A;  2AAI B;  5BVP I;  1S0B A;  2GA9 D;  9ICU A;  7ICM A;  3RSJ A;  2DRZ A;  2KLL A;  4PHA A;  4ZFU B;  2ZQO A;  4AT7 A;  4RWQ A;  1ZQD A;  3O4A A;  4LZG A;  1R89 A;  1ZQY A;  4LO2 A;  3OVS A;  5BOW A;  1S0E A;  2M2U A;  4LEV A;  4IHZ A;  1AVW B;  2IHO A;  2VSE A;  3B0X A;  3WFQ E;  1HCE A;  3HMY A;  1NOM A;  4LO0 C;  4JLX A;  2ZHB A;  5HRD A;  4I2S A;  4I4U A;  3H6Q A;  4I27 A;  4R64 A;  4J2Y A;  2D1Z A;  4M9H A;  3FJC A;  1KNY A;  3OJM A;  1DZD A;  8ICX A;  3ZXG A;  3POK A;  7ICT A;  4GAF A;  4OAH A;  1RZO B;  3H6R A;  1T4Q A;  1EV2 A;  4JLZ A;  3F1R A;  1ZQL A;  2VLC A;  3JPT A;  1W3F A;  4R65 A;  3IM7 A;  2D23 A;  2K43 A;  4IQV A;  1YF8 B;  9ICX A;  8ICL A;  3WA1 A;  2KI4 A;  2KI6 B;  3H3A A;  4PHD A;  3N7M A;  4X37 A;  3UQ0 A;  4MFC A;  3FJH A;  4OW4 A;  3CRG A;  4PPX A;  4KLH A;  5BOM A;  4J23 B;  3E8L C;  4RPX A;  4I1E A;  7ICQ A;  4ATB A;  4QZI A;  4I29 A;  1CVS A;  3HN1 A;  3O4C A;  5D46 A;  4UAW A;  3PHZ A;  4PGY A;  3LLP A;  5BXS A;  3PG0 A;  1TV9 A;  5HR9 A;  4QKS A;  1J0S A;  1A8D A;  1JTC A;  3UXP A;  1G9A A;  1UET A;  9ILB A;  2ZH1 A;  3OBR A;  1ISZ A;  3V79 C;  3FJB A;  7ICE A;  1S0F A;  8ICK A;  2F2F C;  2Z49 A;  4IY9 A;  4QAL A;  4RQ2 A;  1BAR A;  3NBE A;  4OAF A;  5FNX A;  1ZQR A;  5DB7 A;  4AT7 B;  3RJI A;  1VJ7 A;  2B4V A;  3SNV A;  3WIN A;  4YCX A;  5CB1 A;  1WD3 A;  3TC2 A;  9ICW A;  3AKH A;  4WBZ A;  4OEG A;  4IYB A;  3WO4 A;  7ICR A;  4UBC A;  3V7J A;  2UUS A;  4O9M A;  1AVX B;  4WC0 A;  1YXW A;  4LO3 C;  9ICI A;  4WC4 A;  4GXK A;  2DR8 A;  9ICQ A;  4KLS A;  4CJM A;  4LEZ A;  2BE3 A;  1DFQ A;  3BA7 A;  1AF9 A;  3AQM A;  3N7J A;  1ILR 1;  4LEW A;  2GZB A;  2ESU A;  4KM5 A;  3OV7 A;  4I4V A;  4Z9W B;  4DEP A;  2GAF D;  4G6M A;  3HAL A;  3FJF A;  4LO1 C;  4I4O A;  4RWN A;  4I2H A;  5J2H A;  1T9F A;  2MLL B;  4O5E A;  1EPW A;  1XHB A;  2Y9G A;  3BTA A;  2ERM A;  4X4Q A;  4QZE A;  4OUJ A;  4AN7 B;  2ZH3 A;  1HIB A;  1KEJ A;  4I2F A;  4PC4 A;  4I2C A;  2DR7 A;  4Q9G A;  2NYY A;  2HHP A;  5IIK A;  3AUO A;  7ICL A;  4QZ8 A;  4QD2 B;  5DZU A;  1Q03 A;  5HRB A;  3O4B A;  5DDY A;  3FJ9 A;  4LO2 C;  1IOB A;  1G9C A;  1SR4 C;  4H04 A;  2NP0 A;  4PHE A;  1ZQI A;  2VU9 A;  4XA5 A;  2BEB A;  5J0Y A;  4M0A A;  3I29 B;  4ISQ A;  4NM1 A;  4G9N A;  3BRD A;  7ICP A;  2VXT I;  4F83 A;  4OEF A;  1JMS A;  4GP0 A;  3WMV A;  5BQU A;  5IIL A;  3AH1 A;  1NO5 A;  1AVU A;  4KLQ A;  4P4M A;  4M2Y A;  5F8W A;  1ZQF A;  4P4P A;  8I1B A;  2BPF A;  4O5K A;  3JPR A;  1MD6 A;  4PHP A;  4ISR A;  4YN4 A;  4X5V A;  5D63 A;  4X0A A;  1ZQE A;  3MGH A;  4NY8 A;  2KH2 A;  1UEV A;  4R6U B;  3V0B B;  4X39 A;  4DOA A;  8ICI A;  3CU1 B;  9ICB A;  4WC6 A;  3AJ5 A;  4I4S A;  3NBD A;  5CFS A;  3QYD A;  5IIO A;  3RJF A;  4RQ0 A;  3CA6 A;  5FZY A;  1DIW A;  4RQ3 A;  3HWT A;  3GDX A;  4WC5 A;  3BAH A;  3C2K A;  3V7L A;  4EB2 B;  2I9G A;  1P63 A;  4QD2 C;  1ZQW A;  3VEQ A;  1EVT A;  4QZC A;  4F5R A;  4I4X A;  3RMY A;  4FH3 A;  8ICP A;  1V6X A;  5DB9 A;  5BXT A;  4XQ8 A;  2DS0 A;  3AH4 A;  3BAV A;  1FMM S;  4I6I A;  4M9L A;  4FVV A;  2RG9 B;  3WO2 A;  1GPJ A;  1AVA C;  8ICE A;  3BRG C;  8ICT A;  4Z6D A;  2NM1 A;  3NYB A;  9ICS A;  3H39 A;  9ICM A;  3JYY A;  3B9U A;  2W9M A;  1BPY A;  4D8H A;  5J2E A;  3C5F A;  3UQ2 A;  5DKW A;  3P6I A;  4NXZ A;  3UD8 A;  4Q9P A;  3W9T A;  8ICU A;  4EEE B;  3RJJ A;  4KLJ A;  4IZX A;  4AN6 A;  3FJA A;  4E80 A;  4RWP A;  3VT0 A;  5DBB A;  1TFY A;  4UAZ A;  1IT0 A;  3NWI A;  3BAD A;  9ICL A;  2ZHA A;  4PH5 A;  3RH6 A;  1WBA A;  1JLY A;  4K8V A;  4O69 A;  4D0T A;  5J2A A;  1XZZ A;  3MBY A;  4X4S A;  1BFG A;  4QZD A;  4IZE A;  4QO3 A;  5J2F A;  9ICV A;  1R8B A;  4IQW A;  3JCF A;  8ICN A;  3CA3 A;  3RJK A;  4KLM A;  1K5V A;  4XRH A;  3IM5 A;  3WFR E;  1DQG A;  3R4U A;  4A7K A;  4ZFY B;  4G6J A;  4XJE A;  4EFP A;  4USO A;  3V0A B;  2DRA A;  7ICG A;  4J2K A;  1MIW A;  5IIJ A;  3ILA A;  2B56 A;  4EGW A;  4FO6 A;  3WO3 A;  3BA5 A;  3UPS A;  4K9A A;  4II0 A;  4FHX A;  4JKX B;  1ZQM A;  4UB2 A;  4M47 A;  1G82 A;  4UD4 A;  5J2B A;  5CFU A;  4MZF B;  3MDA A;  6I1B A;  5HHH A;  2BBJ A;  4WOY A;  2RST A;  4FHW A;  3K7D A;  4UY4 A;  2E4M C;  2ID1 A;  1XYF A;  3OVB A;  3BAG A;  1I1B A;  4KEK A;  4NXV A;  3A22 A;  4KEJ A;  3NBC A;  4I2A A;  3CA1 A;  3HJ4 A;  2R9K B;  1ZQU A;  2DR9 A;  1WOT A;  4OWJ A;  2ZH4 A;  4NKU A;  2FMS A;  5EHA A;  3FJD A;  2P23 A;  4QZH A;  4RT3 A;  4EED A;  3AQK A;  4JRA A;  4MZG B;  4LT6 A;  5BQU C;  2M2V A;  4DOB A;  4END A;  3AJ6 A;  5BP5 A;  1ZQT A;  9ICJ A;  1BA7 A;  3P53 A;  1VCL A;  3PML A;  5D62 A;  4KC3 A;  3UD9 A;  4QZF A;  1FGA A;  1KNM A;  2FCL A;  3BA4 A;  4X4V A;  3H37 A;  3MCR A;  2M49 A;  2HW9 A;  8ICW A;  4GP3 A;  1ZJN A;  5J2C A;  7ICV A;  3HIY A;  3JPS A;  4G9M A;  4Z6C A;  3NVO A;  3H38 A;  4XQ7 A;  4HJJ A;  1ZJM A;  4AT9 B;  4L4H A;  2GO2 A;  4KBB A;  5HC9 A;  4Z8S B;  5JMC A;  5DED A;  3WMU A;  3C2L A;  1VFG A;  3ER9 B;  1HWO B;  2XOA A;  5J0R A;  4NXT A;  4XUS A;  3FUQ A;  3ZX7 A;  4O68 A;  2FDB M;  4RT2 A;  4IY8 A;  3HJ1 A;  5BXR A;  2ZH5 A;  1V6V A;  4F34 A;  2DRY A;  3O4D A;  4P6A A;  3JPN A;  1UEU A;  1D0H A;  4KLI A;  1ABR B;  4WBC A;  4ION A;  2ISO A;  1JT4 A;  2D43 A;  1JT7 A;  2NS2 A;  4I7I A;  4OEE A;  4I2E A;  1YLQ A;  4KLD A;  3N7L A;  1I1E A;  9ICH A;  3VWC A;  5IIM A;  7ICI A;  2FMQ A;  5E24 E;  1FA0 A;  3CAH A;  1FWV A;  4P0J A;  1QQL A;  3RJH A;  4LZD A;  4I2B A;  1Q79 A;  4MF8 A;  4LEY A;  4I2I A;  5J0O A;  4X3A A;  2Y9W C;  3I2A A;  1R8C A;  1N4K A;  4X4N A;  2IWT B;  2F8X C;  4IG8 A;  1MQ2 A;  5EOZ A;  4LO7 B;  9ICR A;  1PUU B;  1Z2V A;  1BFB A;  4ZLB B;  3H6R B;  3VUO A;  1HWM B;  1BPZ A;  3OJV A;  2Q3N B;  1ZQX A;  3NJ5 A;  2ZQN A;  2FGF A;  3C2M A;  2MIB A;  4ZGR B;  5HRG A;  4GXI A;  4KLT A;  3UJ0 A;  3C66 A;  1OU5 A;  3OWG A;  3L9D A;  4JKQ A;  5HRE A;  1ZQG A;  5FZZ A;  5J0Q A;  4MZH A;  3NKU A;  2ZH9 A;  4YD1 A;  3UDA A;  1PZZ A;  4M04 A;  1IHK A;  4F5N A;  4PGQ A;  1R8N A;  4USP A;  5DBA A;  3Q7W A;  1TOO A;  8ICM A;  3RH5 A;  8ICH A;  3RTJ B;  4GXJ A;  4ATB B;  4NLN A;  4P0L A;  3ZC8 A;  4RQ5 A;  4X4T A;  4LVS A;  1KDH A;  5DB6 A;  1ISX A;  5JLV A;  4X4R A;  2DRB A;  4K4I A;  4WCW A;  4K98 A;  3CRI A;  1Q1U A;  2AFG A;  1R8A A;  3HW8 A;  1FWU A;  4LO0 A;  1JT5 A;  8ICY A;  1MC9 A;  4Q91 A;  5HPZ A;  4M9J A;  5CR0 A;  3FUO A;  4NKT A;  2K4A B;  3A07 A;  3UPQ A;  3O44 A;  4P4O A;  1M16 A;  3OGF A;  1QXM A;  3UXN A;  1W3A A;  4PGX A;  4I3N A;  4I96 A;  4X38 A;  4YD2 A;  4O67 A;  3LTQ A;  4AT8 A;  2ZH6 A;  2X2T A;  1ZQA A;  2ZH8 A;  3AKI A;  2D22 A;  1HUZ A;  4JQ0 A;  1IJT A;  3AH2 A;  1HWP B;  2VAN A;  5J2K A;  7I1B A;  2I1B A;  4OWL A;  2P39 A;  5CHE A;  3AKF A;  7ICH A;  1TIE A;  1XG6 A;  1DFC A;  3CQA A;  2BFH A;  3LQC B;  1MIY A;  2HWA A;  2M2T A;  4UB1 A;  5J29 A;  1OQL B;  5HRH A;  1IIL A;  1R8O A;  2FO1 A;  4M9G A;  1HUO A;  4Z6F A;  9ICT A;  4FHP A;  1EYL A;  1Z4S A;  5GAQ A;  2D24 A;  41BI A;  1F31 A;  3O5W B;  5F8Y A;  3OUY A;  4I2D A;  4QBC A;  3HOM A;  1ZQK A;  4F5Q A;  5J0X A;  1QQK A;  1Q78 A;  1YBI A;  3R4S A;  4EKX B;  4EFQ A;  2DR5 A;  4P2H A;  5TZV A;  3D7W B;  1ISY A;  1G9D A;  3HX0 A;  4RPY A;  3BAU A;  3RTI B;  1MIV A;  3LK9 A;  1IRA X;  1W3G A;  1RG8 A;  5CWR A;  2F2F A;  1WBC A;  5FNW A;  1HCD A;  4KLU A;  5B3Q A;  4K4H A;  3H6S E;  7ICO A;  3WIN C;  3BB2 A;  3BAO A;  4JAW A;  3VT2 A;  1AXM A;  4MKP A;  3FJJ A;  3K75 D;  4K99 A;  1FV2 A;  3ISC A;  3NBN A;  1NZK A;  1ITB A;  2K8R A;  2J3P A;  1UPS A;  1E0O A;  3QR5 A;  3CK6 A;  4FGF A;  8ICB A;  2HN1 A;  1G9B A;  4F5O A;  1MQ3 A;  4LO8 B;  1L2H A;  1JQR A;  5J0W A;  4S3N A;  4RQ8 A;  4X4O A;  3OGG A;  3IM6 A;  2M2W A;  1ZQH A;  1TFM B;  4FHY A;  4DEN A;  3TFS A;  5DEC A;  3A23 A;  4OAG A;  2D20 A;  9ICP A;  3BRF A;  2VXR A;  8ICR A;  3OVA A;  3AQL A;  4WC3 A;  1AFC A;  4AT8 B;  4TLP A;  2MC2 A;  4F5P A;  4X0B A;  5IIN A;  4ZOT A;  8ICG A;  3WFS C;  1BLD A;  1Z0H A;  1BFF A;  5F90 A;  1PUM B;  5BOL A;  3O4O A;  5JTG A;  3JPP A;  5DBC A;  4I8M A;  3AU6 A;  1FN0 A;  7ICJ A;  2L5X A;  4QZ9 A;  4QZB A;  4X4P A;  3PME A;  2FMP A;  1ONK B;  5FZU A;  2VUA A;  5J2J A;  3IIR A;  3FJI A;  21BI A;  3F62 B;  4KLG A;  4WC1 A;  4QKR A;  5CJ7 A;  4K4G A;  1DQO A;  1BFC A;  2Y9X E;  1ZQQ A;  3OUY B;  5CHG A;  4UD5 A;  9ICG A;  3FGM A;  3AZV A;  1IRP A;  3C18 A;  4FO1 A;  5DUY A;  4N7R A;  2HN2 A;  1FV3 A;  1SR4 A;  4UB4 A;  7ICS A;  4NXW A;  5HRI A;  9ICK A;  4L4I A;  4I4Y A;  3CRH A;  3ZXD A;  2O1P A;  3T8S A;  3V7K A;  3RH4 A;  4I4R A;  4EBJ A;  9ICO A;  1TFW A;  4YMN A;  1K5U A;  5J2I A;  5F8S A;  5DVH A;  3FFZ A;  4TUQ A;  5D4B A;  1TTU A;  5EC5 A;  1WD4 A;  2ZR1 B;  3N7K A;  1ZQZ A;  4WBY A;  5D49 A;  4K9B A;  1TWE A;  1JY0 A;  1S0G A;  4KLE A;  4I0U A;  2PBE A;  5J0U A;  4RWO A;  8ICO A;  1S0L A;  4UB3 A;  2ET2 A;  4UBB A;  4E8F A;  2BPG A;  2PFO A;  3TFR A;  3PNC A;  3AU2 A;  1RML A;  5HRL A;  3JPQ A;  4R63 A;  2HWM A;  5CP2 A;  4WC2 A;  4O6A A;  1BLA A;  4I28 A;  1RZT A;  3ER8 C;  8ICA A;  1BPD A;  3A21 A;  4NXU A;  4ZFW B;  3JZ0 A;  4I0Y A;  4QZA A;  8ICV A;  4EV6 A;  4RQ7 A;  2D7R A;  3KMV A;  5J0S A;  1S0C A;  9ICE A;  2NZ9 A; 
#chains in the Genus database with same CATH homology
 1BAS A;  1V6X A;  5BXT A;  2DS0 A;  3AH4 A;  4P0L A;  2LIE A;  3ZC8 A;  3BAV A;  2HZ9 A;  1M2T B;  1FMM S;  4I6I A;  5B2H A;  1ISX A;  5JLV A;  3O4A A;  4FVV A;  2RG9 B;  3WO2 A;  4LO2 A;  5BOW A;  4K98 A;  3CRI A;  1S0E A;  1GPJ A;  1Q1U A;  4IHZ A;  2AFG A;  4LEV A;  1AVW B;  2IHO A;  2VSE A;  1AVA C;  3BRG C;  4P0K A;  2NM1 A;  1HCE A;  4JPZ A;  1JT3 A;  3HMY A;  4G1R A;  4LO0 C;  4XKI A;  4JLX A;  1YTO A;  1FWU A;  2B51 A;  2Q9X A;  2FFU A;  4I2S A;  4I4U A;  4LO0 A;  1JT5 A;  3B9U A;  1MC9 A;  4Q91 A;  4D8H A;  3H6Q A;  2AQZ A;  3CA5 A;  5HPZ A;  2YUG A;  3FUO A;  4J2Y A;  3P6I A;  3UD8 A;  4Q9P A;  2D1Z A;  4NXX A;  3W9T A;  2K4A B;  3FJC A;  4EEE B;  3OJM A;  1DZD A;  3A07 A;  3O44 A;  4IZX A;  4AN6 A;  3FJA A;  3ZXG A;  1M16 A;  3OGF A;  3POK A;  1QXM A;  3JUT A;  4GAF A;  1W3A A;  4J2S A;  3VT0 A;  4OAH A;  1RZO B;  4WQK A;  3H6R A;  3FJ8 A;  1IT0 A;  1PWA A;  1V6W A;  3BAD A;  4I3N A;  4I96 A;  4X38 A;  1TWM A;  1WBA A;  1JLY A;  1T4Q A;  2D44 A;  4K8V A;  4O67 A;  1EV2 A;  4O69 A;  4D0T A;  4JLZ A;  3F1R A;  4OAI Z;  3LTQ A;  1XZZ A;  2VLC A;  1II4 A;  5B3P A;  2X2T A;  1BFG A;  1W3F A;  3AKI A;  3IM7 A;  2D23 A;  2K43 A;  1YF8 B;  2D22 A;  3V0B A;  4JQ0 A;  1IJT A;  3AH2 A;  1HWP B;  4IZE A;  1JQZ A;  2KKI A;  4QO3 A;  3WA1 A;  7I1B A;  2I1B A;  3JRR A;  4OWL A;  3MPP G;  2P39 A;  5CHE A;  3AKF A;  3CA0 A;  1TIE A;  2KI4 A;  1XG6 A;  2KI6 B;  3CA3 A;  1DFC A;  3CQA A;  1DLL A;  5EG6 C;  2DRE A;  2BFH A;  1K5V A;  2HWA A;  3IM5 A;  3N7M A;  1OQL B;  4X37 A;  3FJK A;  2NVH A;  3FJH A;  1IIL A;  1DQG A;  3HBW A;  1R8O A;  3R4U A;  4GOV A;  4A7K A;  4ZFY B;  4G6J A;  2FO1 A;  4XJE A;  4EFP A;  1RY7 A;  4USO A;  3V0A B;  3ERC C;  3ZC9 A;  1EYL A;  1Z4S A;  4K96 A;  4OW4 A;  4J2K A;  3CRG A;  5GAQ A;  4J23 B;  2D24 A;  41BI A;  4ZA3 B;  1F31 A;  3O5W B;  5F8Y A;  5DSS B;  3E8L C;  2FFV A;  4I1E A;  1SZ6 B;  3ILA A;  2B56 A;  2QYI B;  1PC8 B;  4QBC A;  3HOM A;  1CVS A;  3BX1 C;  3HN1 A;  3O4C A;  3BA5 A;  3WO3 A;  1CE7 B;  3P6J A;  1QQK A;  4K9A A;  4H75 A;  3PHZ A;  4II0 A;  3LLP A;  4JKX B;  5BXS A;  3PG0 A;  1YBI A;  3R4S A;  4EKX B;  4QKS A;  1J0S A;  1A8D A;  4EFQ A;  1G82 A;  4GOY A;  1JTC A;  4XFU A;  4WQL A;  5CFU A;  4MZF B;  3D7W B;  6I1B A;  1ISY A;  1G9A A;  9ILB A;  1G9D A;  1NUN A;  3BAQ A;  4WOY A;  4HX0 A;  3BAU A;  2RST A;  3OBR A;  3RTI B;  3K7D A;  4UY4 A;  2Y9F A;  1ISZ A;  3V79 C;  3FJB A;  2E4M C;  1S0F A;  1IRA X;  2E4M A;  1XYF A;  1W3G A;  1RG8 A;  3BAG A;  1I1B A;  2F2F C;  2Z49 A;  4KEK A;  1Q04 A;  4IY9 A;  4NXV A;  4QAL A;  2F2F A;  2AXM A;  2LIQ A;  3A22 A;  3K1X A;  1BAR A;  3NBE A;  1WBC A;  5FNW A;  1HCD A;  4KEJ A;  4OAF A;  3NBC A;  3PUB A;  5FNX A;  3CA1 A;  2VSA A;  5B3Q A;  3H6S E;  3WIN C;  2R9K B;  2B4V A;  3BB2 A;  3SNV A;  3WIN A;  1DJS B;  3BAO A;  4JAW A;  3VT2 A;  4OWJ A;  1AXM A;  1WD3 A;  4MKP A;  3TC2 A;  3FJJ A;  4K99 A;  1FV2 A;  3AKH A;  5EHA A;  4LO7 C;  4OEG A;  4IYB A;  3NBN A;  3WO4 A;  5BXP A;  2EWR A;  3AKG A;  3FJD A;  2P23 A;  1NZK A;  1ITB A;  4H9W A;  2K8R A;  2J3P A;  1UPS A;  2UUS A;  4JRA A;  4MZG B;  1AVX B;  1ISV A;  1E0O A;  3QR5 A;  5BQU C;  3S8K A;  4EFR A;  1FQ9 A;  4FGF A;  5BP5 C;  2WBC A;  1YXW A;  4END A;  1G9B A;  3AJ6 A;  5BP5 A;  4LO8 B;  1L2H A;  4LO3 C;  1BA7 A;  4KB6 A;  3P53 A;  1VCL A;  3OGG A;  4CJM A;  5D62 A;  3IM6 A;  4KC3 A;  4LEZ A;  3UD9 A;  1DFQ A;  3MAL A;  3BA7 A;  1AF9 A;  1TFM B;  3N0K A;  3N7J A;  3AZW A;  4XFS A;  1FGA A;  1ILR 1;  3VSF A;  1KNM A;  4LEW A;  2GZB A;  4DEN A;  2FCL A;  3BA4 A;  2ESU A;  3A23 A;  4KM5 A;  4DCK C;  4OAG A;  3RMX A;  2D20 A;  4I4V A;  3MCR A;  3BRF A;  2M49 A;  2HW9 A;  4Z9W B;  4DEP A;  2GAF D;  4GP3 A;  2VXR A;  4G6M A;  3HAL A;  4I4Q A;  3FJF A;  4LO1 C;  1HWN B;  3V0A A;  1AFC A;  4IQP A;  4G9M A;  4I1B A;  4TLP A;  2MC2 A;  4I4O A;  4ZOT A;  4I4P A;  2RQ9 A;  4HJJ A;  1T9F A;  2MLL B;  4L4H A;  1BLD A;  2GO2 A;  1Z0H A;  1HKN A;  4KBB A;  1BFF A;  5F90 A;  5CFT A;  1PUM B;  1EPW A;  1XHB A;  2Y9G A;  3BTA A;  4Z8S B;  3WMU A;  5JMC A;  2ERM A;  4QBV A;  3O4O A;  3ER9 B;  4A7Y A;  4OUJ A;  1HWO B;  2XOA A;  1FMZ A;  4I8M A;  1FN0 A;  2WRY A;  4AN7 B;  2L5X A;  3FJE A;  3PME A;  4NXT A;  1ONK B;  5FZU A;  1HIB A;  2VUA A;  3FUQ A;  3ZX7 A;  3IIR A;  3UD7 A;  4O68 A;  2X2S A;  3FJI A;  4PC4 A;  21BI A;  3F62 B;  2FDB M;  4ZKT B;  2BEA A;  4IY8 A;  4QKR A;  4Q9G A;  2NYY A;  1DZC A;  5BXR A;  1DQO A;  1BFC A;  3O3Q A;  2Y9X E;  3O49 A;  1V6V A;  4F34 A;  2DRY A;  3O4D A;  3HSM A;  4P6A A;  4QD2 B;  3OBT A;  4YOL A;  31BI A;  5DZU A;  1Q03 A;  3FGM A;  3Q7X A;  3AZV A;  4WH5 A;  3O4B A;  1D0H A;  1IRP A;  1ABR B;  4WBC A;  4FO1 A;  3FJ9 A;  4ION A;  1JT4 A;  4LO2 C;  2D43 A;  3I2X A;  1IOB A;  1G9C A;  1JT7 A;  5DUY A;  4KEI A;  2NS2 A;  4N7R A;  4I7I A;  4ZBV B;  4OEE A;  1SR4 C;  4H04 A;  2NP0 A;  1FV3 A;  2VU9 A;  1SR4 A;  2Z48 A;  3N7L A;  2BEB A;  1I1E A;  3I29 B;  4J2X A;  4ISQ A;  3VWC A;  2D7I A;  1GGP B;  4NXW A;  4G9N A;  5E24 E;  3BRD A;  4L4I A;  4I4Y A;  3CRH A;  4I37 A;  2VXT I;  3ZXD A;  4F83 A;  3CAH A;  1FWV A;  4OEF A;  4P0J A;  3T8S A;  1QQL A;  3C9Z A;  4I4R A;  4GP0 A;  3WMV A;  5BQU A;  2QN4 A;  4LEY A;  3VT1 A;  1K5U A;  4X3A A;  3S8J A;  2Y9W C;  5F8S A;  3I2A A;  4A7Z A;  4HA2 A;  4LO3 A;  5DVH A;  3UJ4 A;  1N4K A;  3AH1 A;  3FFZ A;  2IWT B;  2F8X C;  1TP0 A;  4JP0 A;  1AVU A;  5I1B A;  4QC4 A;  4LO7 B;  5F8W A;  1PUU B;  1Z2V A;  1BFB A;  8I1B A;  4ZLB B;  1TTU A;  3Q7Y A;  5EC5 A;  3H6R B;  3VSZ A;  2NTD A;  1WD4 A;  2ZR1 B;  3VUO A;  1HWM B;  1MD6 A;  3N7K A;  3OJV A;  2NZ9 A;  4ISR A;  2Q3N B;  3NJ5 A;  5D63 A;  2ZQN A;  2FGF A;  4K9B A;  5D61 A;  1YYN A;  1TWE A;  5G00 A;  1JY0 A;  1S0G A;  4LO1 A;  2MIB A;  4ZGR B;  1JLX A;  3EF2 A;  1S0L A;  2KH2 A;  4R6U B;  3V0B B;  3UJ0 A;  2ET2 A;  3CA4 A;  1V6U A;  4GAI A;  4X39 A;  3CU1 B;  3IAG C;  4D0Z A;  3AJ5 A;  4I4S A;  3OWG A;  3NBD A;  3OJ2 A;  5CFS A;  1S0D A;  1RML A;  3QYD A;  4JKQ A;  5FZZ A;  2HWM A;  3CA6 A;  1BLA A;  4O6A A;  4MZH A;  5FZY A;  4OWK A;  3NKU A;  4XFT A;  3ER8 C;  1DIW A;  1ISW A;  1PZZ A;  3UDA A;  3A21 A;  1IHK A;  3BAH A;  4ZFW B;  4NXU A;  4HR6 C;  1R8N A;  4K97 A;  4I0Y A;  2AAI B;  4USP A;  4EB2 B;  5BVP I;  3Q7W A;  1S0B A;  1TOO A;  2GA9 D;  3RSJ A;  1P63 A;  4QD2 C;  2DRZ A;  2KLL A;  2D7R A;  3KMV A;  3VEQ A;  1EVT A;  1S0C A;  3RTJ B;  4I4X A;  3RMY A;  4ZFU B;  2ZQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...