3EF2A

Structure of the marasmius oreades mushroom lectin (moa) in complex with galalpha(1,3)[fucalpha(1,2)]gal and calcium.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
292
structure length
291
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of a Lectin from the Mushroom Marasmius oreades in Complex with the Blood Group B Trisaccharide and Calcium.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Sugar binding protein
molecule keywords Agglutinin
total genus 89
structure length 291
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ef2A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ef2A02
4P0KA 1HCDA 1S0CA 2KI4A 1SR4C 2FGFA 4QD2C 3CA1A 2P23A 3FJFA 3T8SA 4ZFUB 2ERMA 4XKIA 3OBRA 1G9DA 3S8JA 2WRYA 4USPA 4J2SA 3CRHA 1NUNA 4JP0A 4KEKA 1Q04A 4CJMA 3ZC8A 1FV2A 4L4HA 2D44A 4QBVA 5FZZA 4Q9PA 4HA2A 3D7WB 1IJTA 4LO3A 3BX1C 1AVUA 1N4KA 4IY8A 3AH1A 4EFQA 3BAVA 1IHKA 4I4VA 4QKRA 1E0OA 3I2XA 4IY9A 3WO3A 3BAUA 1XZZA 5DUYA 4FVVA 4XFTA 3AZWA 2RQ9A 3OJVA 5BXSA 4J23B 4KEIA 1BFGA 1TIEA 2D7RA 2KI6B 1FWUA 1FV3A 1KNMA 4HJJA 1AVWB 3K1XA 4GP3A 3V79C 1RMLA 1AVXB 2D20A 3HN1A 4I1BA 3BA7A 4I6IA 1NZKA 5BXTA 2ESUA 1JT7A 3CAHA 4D8HA 3BRFA 1TP0A 5EC5A 2HWAA 4LO7C 4I4PA 3FFZA 3O5WB 1XG6A 3VSFA 1IRPA 3O4OA 3UJ0A 1BFBA 3RSJA 2J3PA 1ONKB 5DZUA 2D1ZA 1I1BA 4WBCA 3LTQA 2FFVA 2ZR1B 4G6MA 3N7KA 3PUBA 4J2XA 3WINC 2MLLB 3FJBA 1TTUA 3B9UA 3CA0A 2D22A 1A8DA 2D7IA 4LO7B 1EPWA 5EHAA 4I7IA 4QKSA 3FJJA 4LO0A 3AKGA 6I1BA 1TWMA 3PG0A 1VCLA 4J2YA 3OJ2A 3Q7XA 2XOAA 1G9AA 1DIWA 4EEEB 1P63A 3V0BA 3HSMA 4DENA 4EFPA 1K5UA 3F1RA 1DLLA 1M2TB 3UD7A 5B2HA 3ZXGA 1I1EA 4I3NA 1V6VA 5D63A 2DRYA 1JLXA 4G9NA 3ZX7A 2X2SA 1TWEA 1IILA 4XFUA 5FZUA 3WMUA 3ZC9A 4GOYA 2YUGA 4JRAA 3VEQA 1QQKA 3CA3A 3MPPG 4HR6C 2GZBA 3UJ4A 5I1BA 1ISYA 2BEAA 1S0LA 3FJDA 2IWTB 3ZXDA 2KLLA 3HOMA 1BLAA 3BADA 3TC2A 1K5VA 3O4CA 1PWAA 3F62B 3IIRA 4QO3A 2NP0A 2M49A 2BEBA 3A07A 3H6QA 2VXRA 4OEEA 3OGGA 1FN0A 4JKQA 3VWCA 3H6RA 4Q9GA 3FJ9A 2NTDA 3RMXA 1JY0A 3CA6A 5D62A 1AVAC 4IZXA 31BIA 2ZQNA 1L2HA 5BOWA 1Q03A 1W3GA 1FMMS 3VSZA 1BFFA 1AXMA 3V0AB 5BXPA 4ZOTA 1FQ9A 41BIA 3FJKA 1G9CA 4KEJA 2L5XA 1YF8B 2LIEA 3FUOA 3RTJB 1FWVA 3O3QA 1AFCA 3N7MA 3O44A 4L4IA 2D24A 1FMZA 3FGMA 4AN7B 1Z2VA 4EB2B 3Q7YA 4USOA 4YOLA 4QALA 1DJSB 1HWPB 2HW9A 1DFQA 1WBAA 1OQLB 3VT2A 3UD8A 5FZYA 4TLPA 5DVHA 1MC9A 4JPZA 3AKIA 1W3FA 1SR4A 1ISXA 2ZQOA 3R4UA 4QBCA 3N0KA 3O4DA 3IM5A 4I4XA 2QYIB 3QR5A 7I1BA 2HWMA 4GP0A 1EVTA 3BB2A 4I4OA 3NBNA 3BAHA 4OWKA 3AH2A 2MIBA 4X38A 2RG9B 1J0SA 1R8OA 1HWMB 4P0LA 1DFCA 3P6JA 1BASA 2ET2A 3S8KA 3V0AA 2BFHA 5F8WA 1ISWA 2NYYA 1YBIA 2AXMA 1Q1UA 1W3AA 1ABRB 4H04A 3Q7WA 1XYFA 1ILR1 2K4AB 2VXTI 4X39A 4PC4A 3QYDA 3UDAA 1DQGA 4JAWA 4I1EA 2NZ9A 2E4MA 2I1BA 3OBTA 4Z8SB 1V6UA 2RSTA 4LO1A 4H9WA 4JKXB 1M16A 4JQ0A 5FNXA 5EG6C 1JLYA 5DSSB 4LO3C 1HWNB 3FJAA 4I4YA 3FJCA 3WINA 4X3AA 5D61A 3BA5A 3AH4A 3RTIB 1BFCA 4I4QA 1GGPB 4I96A 1DQOA 3IM7A 3N7JA 4IONA 3BRDA 4QC4A 3RMYA 3PHZA 4ZFYB 1JT5A 3N7LA 1R8NA 1HIBA 2Y9XE 2AAIB 3VT1A 3E8LC 4G1RA 1YYNA 2VLCA 4IHZA 1PZZA 4LO1C 5BXRA 3BAQA 3OGFA 2Y9FA 3VT0A 2HZ9A 2UUSA 1S0DA 1YTOA 2Z48A 2E4MC 4ZA3B 3EF2A 5G00A 4A7YA 1G9BA 4ZKTB 3I29B 1S0FA 2FDBM 3BTAA 1WBCA 5BQUC 5JLVA 2NVHA 1Z0HA 3AKFA 3HALA 3FJIA 1S0EA 4OEGA 1JT3A 2KH2A 4KBBA 2AFGA 2Q9XA 1AF9A 1II4A 1IRAX 3R4SA 4I4RA 4OWJA 3WMVA 1ITBA 3LLPA 4ZBVB 4ENDA 1PUUB 3NBEA 1UPSA 5HPZA 21BIA 4LO2C 2NM1A 2D43A 3AJ5A 3WA1A 1JT4A 1FGAA 2VU9A 4Z9WB 5BP5C 3P53A 2D23A 4R6UB 4OEFA 2R9KB 1IT0A 3CQAA 4I0YA 4ZLBB 4J2KA 2MC2A 2GO2A 1BA7A 4GAIA 1CE7B 2X2TA 1QQLA 3PMEA 1QXMA 5F90A 1EYLA 2WBCA 4I8MA 4OWLA 1JTCA 3AZVA 4IZEA 1TFMB 2F2FA 2KKIA 4G9MA 1ISVA 1PUMB 4P6AA 3CRGA 1Z4SA 3JRRA 2LIQA 3HBWA 2IHOA 3POKA 3SNVA 3KMVA 4II0A 4D0TA 3CA4A 1WD3A 4OW4A 3WO4A 3O4AA 1WD4A 3O4BA 3WO2A 2FO1A 1DZDA 1S0BA 4FGFA 2DRZA 4GAFA 2F2FC 4I37A 3VUOA 4KC3A 3FJHA 5F8SA 2K8RA 4QD2B 2DREA 2VSEA 2P39A 1F31A 2AQZA 5BVPI 1G82A 1XHBA 1HCEA 2QN4A 3BRGC 3A22A 3FJEA 3IAGC 1RG8A 4I2SA 4P0JA 1BLDA 2FFUA 3CU1B 3ILAA 3AKHA 3JUTA 3NBDA 4DEPA 4ISRA 1EV2A 4A7ZA 4X37A 1JQZA 5GAQA 3H6RB 1ISZA 1BARA 4GOVA 4OUJA 5BP5A 1SZ6B 1HWOB 3FJ8A 4LO8B 1T9FA 4F83A 4LO2A 4IQPA 1YXWA 4I4SA 3CRIA 1TOOA 3A23A 1RZOB 3V0BB 4ISQA 1V6XA 4A7KA 4ZFWB 3HMYA 4XFSA 2Y9GA 2VSAA 1V6WA 2K43A 3A21A 2VUAA 3NJ5A 5F8YA 1DZCA 4F34A 4DCKC 2Y9WC 3BAOA 2DS0A 3BA4A 1S0GA 3OJMA 3UD9A 4I4UA 1IOBA 5BQUA 1MD6A 9ILBA 3IM6A 3C9ZA 5E24E 1PC8B 1D0HA 8I1BA 3P6IA 4AN6A 5FNWA 4G6JA 1HKNA 3O49A 3CA5A 5JMCA 3W9TA 3H6SE 4D0ZA 2Q3NB 4ZGRB 1T4QA 3MALA 3FUQA 4EFRA 2F8XC 3AJ6A 4LO0C 4Q91A 2Z49A 3BAGA 3I2AA 1RY7A 4IYBA 4EKXB 3NBCA 1CVSA
chains in the Genus database with same CATH superfamily
2ISOA 4P0KA 4KLEA 1HCDA 1S0CA 2KI4A 5HHIA 1SR4C 2FGFA 1VJ7A 4LT6A 4QD2C 3CA1A 2P23A 3FJFA 3T8SA 4ZFUB 2ERMA 4EEDA 4XKIA 3OBRA 1G9DA 4WBYA 3S8JA 2WRYA 4TUSA 1MQ3A 4UB4A 1R8AA 4I2JA 5J0XA 3UXNA 4USPA 4J2SA 3CRHA 1NUNA 4JP0A 4KEKA 1ZQVA 1Q04A 4RWPA 4CJMA 3ZC8A 3JPNA 1FV2A 1ZQMA 4L4HA 3C2KA 2D44A 4MZFB 4QBVA 5FZZA 4Q9PA 4HA2A 4EP7A 4R65A 4QZDA 3D7WB 1IJTA 4LO3A 3HX0A 3BX1C 8ICPA 1AVUA 1N4KA 4IY8A 3AH1A 4EFQA 3BAVA 1IHKA 4I4VA 4RQ1A 4RWOA 4QKRA 2PFOA 4E8FA 1E0OA 4KLFA 1ZQNA 3I2XA 4IY9A 3WO3A 5CA7A 4LZGA 8ICOA 3BAUA 5HRLA 1XZZA 5DUYA 5HC9A 2DRAA 4FVVA 1BPBA 8ICSA 1ZQQA 4XFTA 3AZWA 2RQ9A 3OJVA 1KNYA 3AQMA 3UXOA 4PGYA 5BXSA 5DDYA 4J23B 4KEIA 4UAYA 7ICSA 1BFGA 1TIEA 2D7RA 1KDHA 2KI6B 1FWUA 3NVOA 5B3QA 1FV3A 1KNMA 4HJJA 4FH3A 2HN1A 4M9HA 1AVWB 1ZQAA 3K1XA 4DOCA 4GP3A 3V79C 4RT2A 1RMLA 1AVXB 4K4HA 2D20A 3HN1A 4I1BA 1ZQIA 3BA7A 4I6IA 5HRDA 5J2IA 4I28A 4JLZA 3WFSC 1NZKA 5BXTA 4FO6A 2ESUA 2ZH9A 1JT7A 3CAHA 4F5RA 4D8HA 4UB1A 1XSLA 3BRFA 1TP0A 5EC5A 2HWAA 4LO7C 4QZAA 4K96A 4I4PA 3FFZA 3O5WB 3UPSA 3RH6A 1XG6A 3VSFA 1ZQEA 4NXTA 4O5CA 1IRPA 5F2VO 3O4OA 1PX5A 4QZHA 3UJ0A 1BFBA 3RSJA 2J3PA 1ONKB 5DZUA 2D1ZA 5HRHA 1I1BA 2IUBA 4R63A 4KLOA 7ICUA 4WBCA 4XA5A 3LTQA 2FFVA 2ZR1B 4G6MA 3N7KA 2FMSA 3PUBA 4J2XA 2BCRA 3WINC 2MLLB 4E80A 3FJBA 1TTUA 3H37A 1XSNA 3B9UA 5IIMA 3JPPA 3CA0A 9ICUA 2D22A 1A8DA 2D7IA 4LO7B 1EPWA 5EHAA 4I7IA 5CWRA 4MFAA 1GPJA 4KLTA 4QKSA 3FJJA 4XJEA 4LO0A 3AKGA 6I1BA 4DOBA 1TWMA 3PG0A 1VCLA 1ZQXA 4J2YA 2FMQA 4WC3A 4TURA 3OJ2A 3Q7XA 9ICKA 4QZ9A 1ZQLA 2XOAA 1G9AA 4PHDA 1DIWA 4EEEB 1P63A 3RJFA 4P4PA 3V0BA 4NXUA 3HSMA 7ICOA 4DENA 4YMOA 4YN4A 5D46A 4QZGA 4EFPA 1K5UA 4M9JA 4KLUA 2NS2A 4NXZA 4JLXA 4UAWA 3F1RA 2W9MA 1DLLA 1M2TB 4WCWA 4FHPA 1ZQHA 2ZH3A 3UD7A 7ICQA 5B2HA 3ZXGA 1I1EA 4YCXA 4I3NA 4IG8A 1V6VA 5D63A 2DRYA 4X4TA 4RWQA 1JLXA 4G9NA 3V72A 3ZX7A 2X2SA 1TWEA 1IILA 4XFUA 5FZUA 3WMUA 3ZC9A 4GOYA 1UETA 2YUGA 5DECA 4JRAA 3JPRA 3VEQA 4S3NA 9ICGA 1QQKA 3CA3A 3MPPG 4HR6C 2GZBA 3UJ4A 5I1BA 1BPYA 1ISYA 2BEAA 4ATBB 2NRKA 4OAGA 8ICLA 4X0BA 4I2CA 1S0LA 3FJDA 4YMNA 2IWTB 3ZXDA 2GA9D 4M5DA 3RJEA 9ICCA 2KLLA 3HOMA 1BLAA 3JPTA 1ZJNA 5J2GA 3OUYB 3BADA 1BPXA 3TC2A 2ZHAA 4NY8A 8ICQA 5IINA 1ZQSA 1R8BA 4NLKA 1K5VA 3O4CA 3OV7A 3MBYA 1PWAA 3F62B 4I2GA 3IIRA 4QO3A 2NP0A 2M49A 2BEBA 2M2TA 4RT3A 4PGQA 5HRKA 3A07A 3UQ2A 3H6QA 4XUSA 3CK6A 5J2FA 4LZDA 4FHVA 2VXRA 4OEEA 2ZH4A 5BPCA 3ISDA 3OGGA 3V7KA 7ICVA 1FN0A 4JKQA 3VWCA 4I2EA 3H6RA 4PGXA 4Q9GA 1ZQPA 9ICIA 3FJ9A 3LK9A 2NTDA 3JPQA 3K75D 4QZFA 3V7JA 4EEBA 3AUOA 2PFQA 3RMXA 4RQ8A 4FHYA 4JWMA 9ICWA 1JY0A 3CA6A 9ICVA 5D62A 4UAZA 4O5KA 1AVAC 5JTGA 4IZXA 3AQLA 31BIA 5J0PA 8ICZA 2ZQNA 1L2HA 5BOWA 3GDXA 8ICGA 1Q03A 5J2CA 5IIIA 1W3GA 3RJKA 1FMMS 3VSZA 1BFFA 1AXMA 3V0AB 5BXPA 4TUQA 4ZOTA 1ZQBA 1FQ9A 41BIA 3FJKA 4KLHA 1G9CA 4KEJA 5DBAA 2L5XA 1YF8B 2LIEA 4RQ5A 8ICBA 7ICIA 3ER8C 3B0YA 5DEDA 3FUOA 1ZJMA 8ICVA 3RTJB 8ICYA 2ZH8A 1FWVA 3RH5A 3O3QA 1AFCA 3N7MA 3O44A 4L4IA 2D24A 4KLDA 1FMZA 1TFYA 3FGMA 3JCFA 5HRBA 2DR9A 5HRFA 4AN7B 2DVIA 1Z2VA 4R64A 4NLNA 4EB2B 4F5NA 5J0QA 3Q7YA 4USOA 4YOLA 4QALA 1DJSB 1HWPB 2HW9A 3OGUA 4I2FA 1DFQA 1WBAA 1OQLB 3VT2A 8ICAA 3UD8A 5FZYA 4RQ4A 4TLPA 5DVHA 1MC9A 5J2JA 4JPZA 3AKIA 7ICPA 1ZQDA 4QZCA 1ZQGA 1W3FA 1SR4A 5DDMA 1R8CA 4WC0A 1ISXA 2ZHBA 2ZQOA 3R4UA 4QBCA 4F5QA 3N0KA 2ID1A 3O4DA 3IM5A 4LEYA 4I4XA 4RWNA 2QYIB 3QR5A 7I1BA 5J0RA 4Z6EA 4MFFA 2HWMA 1ZQYA 5D4BA 1TFWA 4GP0A 1EVTA 8ICNA 3BB2A 5J0OA 4I4OA 4WH5A 5BOMA 9ICNA 3NBNA 3JPSA 3BAHA 4OWKA 3AH2A 2MIBA 4X38A 2RG9B 1J0SA 1R8OA 4QZEA 4RQ7A 1HWMB 4P0LA 1DFCA 5IIOA 2PXIA 3P6JA 1BASA 2ET2A 3S8KA 3V0AA 2BFHA 5F8WA 4P4OA 5IIKA 5CR0A 5HR9A 4RPXA 1ISWA 3C2LA 2NYYA 3UPQA 3MGHA 1YBIA 3RJJA 2AXMA 4NXVA 4I27A 4NM1A 4LEWA 1Q1UA 7ICNA 1W3AA 1ABRB 4WOYA 4RQ3A 3HIYA 4H04A 9ICTA 3Q7WA 5DB6A 4RQ0A 1XYFA 4I2HA 1ILR1 2ZH2A 4KLMA 2K4AB 2VXTI 4X39A 4PC4A 3JPOA 1ZQOA 3QYDA 3UDAA 1JMSA 1DQGA 4JAWA 4I1EA 2NZ9A 1F5AA 2E4MA 2HHPA 3LQCB 5IIJA 4K98A 1VFGA 3H38A 1MIWA 2I1BA 3OBTA 4Z8SB 4X4PA 4UB3A 1V6UA 2RSTA 4LVSA 4LO1A 3HJ4A 4H9WA 3WFOA 4JKXB 4X4QA 9ICHA 1M16A 7ICRA 4JQ0A 5FNXA 3L9DA 5EG6C 1TV9A 1JLYA 5DSSB 4LO3C 8ICXA 2M2UA 4M47A 1OU5A 1JQRA 1HWNB 4M2YA 3FJAA 2RFFA 4I4YA 3FJCA 2P66A 4NLZA 4MF8A 2ZH1A 3WINA 3AQKA 4X3AA 5D61A 5IILA 3BA5A 7ICGA 1BPZA 4PPXA 4LEVA 3AH4A 3RTIB 2ISPA 1BFCA 4I4QA 1GGPB 4I96A 1NOMA 1DQOA 3IM7A 3N7JA 4IONA 3BRDA 4QC4A 3RMYA 3PHZA 4OAHA 4I2DA 4ZFYB 1JT5A 1ZQUA 2B4VA 3B0XA 4KLLA 3WFRE 3N7LA 1R8NA 1HIBA 2Y9XE 4WC4A 4O69A 2AAIB 3UXPA 3VT1A 3E8LC 4G1RA 4FH5A 4FHWA 1YYNA 4I0UA 4WBZA 2ZH6A 3C5GA 4I2AA 2VLCA 4IHZA 1PZZA 4LO1C 4UD5A 5BXRA 3WFPA 5J0TA 3BAQA 3OGFA 2GAFD 2Y9FA 1BPDA 4K4IA 3H39A 4PHEA 3VT0A 2PBEA 3UQ0A 2DR8A 2HZ9A 4XQ8A 2UUSA 1S0DA 1YTOA 2Z48A 2E4MC 4AT7A 4NKUA 4ZA3B 3EF2A 5G00A 4MFCA 3HJ1A 4A7YA 2BBHA 2O1PA 5CFSA 2DR7A 4HX0A 4F5OA 1G9BA 4Z6CA 8ICTA 4K99A 9ICSA 4I2IA 4ZKTB 5CB1A 4NKTA 4RPYA 3I29B 2B51A 4UB2A 7ICFA 1S0FA 2FDBM 3BTAA 1WBCA 5BQUC 4ATBA 2I9GA 5JLVA 2NVHA 5DB8A 1Z0HA 4LEZA 8ICWA 3AKFA 3HALA 4TUPA 2DR5A 3FJIA 1S0EA 4FHXA 4O6AA 4X4VA 4OEGA 3AQNA 1JT3A 9ICOA 2KH2A 4KBBA 2AFGA 2Q9XA 1AF9A 1II4A 4UY4A 8ICJA 1IRAX 3R4SA 4E7XA 4PHPA 5J0YA 4I4RA 4AT7B 1ZQTA 4OWJA 3WMVA 1ITBA 3LLPA 4QZBA 2PFPA 4ZBVB 2HN2A 2B56A 1ZQCA 3C2MA 1MQ2A 4ENDA 8ICUA 1PUUB 4EBJA 3NBEA 4WC5A 1UPSA 3RJHA 5HPZA 1Q79A 4RQ2A 21BIA 2FMPA 4LO2C 2NM1A 5J2BA 4YD1A 4M9NA 3C5FA 2D43A 4PHAA 3AJ5A 3WA1A 1JT4A 1FGAA 2VU9A 3HW8A 4Z9WB 4NXXA 3NKUA 5BP5C 2BPGA 4KLGA 2EWRA 3RH4A 7ICHA 3MDCA 3P53A 2D23A 5J2AA 4WQKA 2M2VA 5HRIA 5J2KA 3MGIA 4R6UB 2DRBA 8ICKA 8ICRA 4OEFA 2R9KB 4M04A 1IT0A 4GXJA 8ICCA 3CQAA 4I0YA 3HWTA 4ZLBB 4J2KA 2MC2A 2GO2A 5CFUA 1BA7A 4GAIA 1CE7B 1MIYA 2X2TA 1V4AA 1QQLA 3PMEA 1QXMA 5F90A 3MCRA 3NWIA 1EYLA 2ZH7A 4KLIA 2WBCA 4I29A 4I8MA 1ZQWA 4OWLA 1JTCA 4O9MA 4P2HA 3ERCC 4DOAA 4IQWA 3AZVA 2ZH5A 4IZEA 4AT9A 1TFMB 2F2FA 2KKIA 4EV6A 4G9MA 4WC1A 9ICJA 4X4RA 4JWNA 1ISVA 1PUMB 4P6AA 7ICJA 3OVSA 4OAIZ 3C18A 5CFTA 5CHGA 4H75A 1Q78A 4F5PA 1RPLA 3CRGA 3H3AA 4N7RA 9ICXA 1Z4SA 3JRRA 3K7DA 4WC7A 3TFSA 2BCSA 2LIQA 3HBWA 4UB5A 2IHOA 3POKA 3SNVA 3KMVA 4O68A 4NM2A 5HREA 5DKWA 4R66A 4KLSA 4II0A 4D0TA 3CA4A 5HRGA 1WD3A 3PMNA 4OW4A 4KLQA 3WO4A 1BPEA 4QZ8A 4P4MA 4XRHA 9ICPA 3PNCA 4MF2A 3O4AA 8ICEA 8ICFA 1WD4A 3O4BA 5DB9A 4K97A 2BCUA 3WO2A 2FO1A 1DZDA 1S0BA 4X0AA 4FGFA 2DRZA 9ICAA 1YLQA 4FO1A 9ICFA 3PMLA 4GAFA 2F2FC 3ISBA 5DBBA 4I37A 3VUOA 2BPCA 3TFRA 4KC3A 2O5AA 3FJHA 5CHEA 5EOZA 5F8SA 4K9AA 4KLJA 2K8RA 4QD2B 5B3PA 2DREA 9ICEA 4GXIA 2VSEA 4X4SA 2P39A 2BCVA 1F31A 2AQZA 2VANA 4UBBA 4I2BA 5BVPI 3OUYA 4GXKA 4M9LA 7ICMA 1G82A 3RJIA 4X4NA 1XHBA 1HCEA 2QN4A 3BRGC 5J0UA 4X4OA 1UEVA 3A22A 1XSPA 3MDAA 1ZQJA 3RJGA 3FJEA 3IAGC 2BPFA 1RG8A 4I2SA 4P0JA 1BLDA 2FFUA 3CU1B 3ILAA 2PFNA 9ICRA 5DB7A 3AKHA 3JUTA 3NBDA 4DEPA 2BBJA 1NO5A 4ISRA 1EV2A 4EGWA 1HUZA 3OVBA 9ICQA 4KB6A 4O67A 1R89A 3C66A 4A7ZA 8ICIA 4X37A 1JQZA 1WOTA 5CJ7A 5GAQA 4WC2A 7ICLA 3H6RB 4M0AA 1ISZA 3V7LA 1BARA 5DBCA 2FCLA 2BE3A 3JYYA 4GOVA 3ISCA 4OUJA 5BP5A 1SZ6B 1TVAA 3ER9B 1HWOB 3FJ8A 4NXWA 1HUOA 4LO8B 1T9FA 4F83A 4DO9A 4LO2A 4IQPA 1YXWA 4I4SA 3AU2A 3CRIA 5D49A 4RQ6A 4K9BA 2Q66A 1TOOA 3A23A 1ZQRA 4M9GA 1RZOB 4PH5A 3V0BB 4ISQA 3OVAA 8ICMA 1V6XA 4A7KA 4ZFWB 3HMYA 4XFSA 2Y9GA 2VSAA 7ICTA 1FA0A 4MKPA 4YD2A 2GWSA 1V6WA 2K43A 4MZHA 3NYBA 4AT9B 4RPZA 3A21A 4X5VA 4WC6A 4OAFA 4WQLA 5CP2A 2VUAA 3NJ5A 9ICBA 5F8YA 1DZCA 4F34A 4DCKC 4KM5A 2Y9WC 4QZIA 4AT8B 3BAOA 1ZQFA 9ICLA 2DS0A 3BA4A 1S0GA 3OJMA 3AU6A 5J2DA 1KEJA 4Z6DA 9ICMA 1JN3A 3UD9A 4I4UA 1IOBA 5BQUA 5J0SA 1MD6A 9ILBA 1UEUA 4IQVA 3IM6A 3C9ZA 5E24E 5TZVA 2IHMA 4O5EA 1PC8B 5J2HA 8ICHA 4YMMA 1D0HA 8I1BA 5BOLA 3P6IA 4AN6A 5J0WA 5FNWA 2BCQA 4G6JA 1HKNA 4UD4A 4Z6FA 3O49A 3CA5A 4XQ7A 4IQTA 1ZQZA 5JMCA 7ICEA 4MZGB 5J2EA 5HHHA 3W9TA 3H6SE 4D0ZA 4IQUA 4K4GA 2Q3NB 4ZGRB 1T4QA 3MALA 4EBKA 1RZTA 3FUQA 4EFRA 7ICKA 2F8XC 3AJ6A 4LO0C 4Q91A 5J29A 2Z49A 3BAGA 3I2AA 2M2WA 4AT8A 3WFQE 1RY7A 1MIVA 1JAJA 3OWGA 3JZ0A 1ZQKA 4IYBA 4UBCA 4K8VA 4EKXB 4X4UA 3NBCA 1CVSA
chains in the Genus database with same CATH topology
4P0KA 1HCDA 1S0CA 2KI4A 1SR4C 2FGFA 4QD2C 3CA1A 2P23A 3FJFA 3T8SA 4ZFUB 2ERMA 4XKIA 3OBRA 1G9DA 3S8JA 2WRYA 4USPA 4J2SA 3CRHA 1NUNA 4JP0A 4KEKA 1Q04A 4CJMA 3ZC8A 1FV2A 4L4HA 2D44A 4MZFB 4QBVA 5FZZA 4Q9PA 4HA2A 3D7WB 1IJTA 4LO3A 3BX1C 1AVUA 1N4KA 4IY8A 3AH1A 4EFQA 3BAVA 1IHKA 4I4VA 4QKRA 1E0OA 3I2XA 4IY9A 3WO3A 3BAUA 1XZZA 5DUYA 4FVVA 4XFTA 3AZWA 2RQ9A 3OJVA 5BXSA 4J23B 4KEIA 1BFGA 1TIEA 2D7RA 2KI6B 1FWUA 5B3QA 1FV3A 1KNMA 4HJJA 1AVWB 3K1XA 4GP3A 3V79C 1RMLA 1AVXB 2D20A 3HN1A 4I1BA 3BA7A 4I6IA 4JLZA 1NZKA 5BXTA 2ESUA 1JT7A 3CAHA 4D8HA 3BRFA 1TP0A 5EC5A 2HWAA 4LO7C 4K96A 4I4PA 3FFZA 3O5WB 1XG6A 3VSFA 4NXTA 1IRPA 3O4OA 3UJ0A 1BFBA 3RSJA 2J3PA 1ONKB 5DZUA 2D1ZA 1I1BA 4WBCA 3LTQA 2FFVA 2ZR1B 4G6MA 3N7KA 3PUBA 4J2XA 3WINC 2MLLB 3FJBA 1TTUA 3B9UA 3CA0A 2D22A 1A8DA 2D7IA 4LO7B 1EPWA 5EHAA 4I7IA 1GPJA 4QKSA 3FJJA 4XJEA 4LO0A 3AKGA 6I1BA 1TWMA 3PG0A 1VCLA 4J2YA 3OJ2A 3Q7XA 2XOAA 1G9AA 1DIWA 4EEEB 1P63A 3V0BA 4NXUA 3HSMA 4DENA 4EFPA 1K5UA 2NS2A 4JLXA 3F1RA 1DLLA 1M2TB 3UD7A 5B2HA 3ZXGA 1I1EA 4I3NA 1V6VA 5D63A 2DRYA 1JLXA 4G9NA 3ZX7A 2X2SA 1TWEA 1IILA 4XFUA 5FZUA 3WMUA 3ZC9A 4GOYA 2YUGA 4JRAA 3VEQA 1QQKA 3CA3A 3MPPG 4HR6C 2GZBA 3UJ4A 5I1BA 1ISYA 2BEAA 4OAGA 1S0LA 3FJDA 2IWTB 3ZXDA 2GA9D 2KLLA 3HOMA 1BLAA 3BADA 3TC2A 1K5VA 3O4CA 1PWAA 3F62B 3IIRA 4QO3A 2NP0A 2M49A 2BEBA 3A07A 3H6QA 2VXRA 4OEEA 3OGGA 1FN0A 4JKQA 3VWCA 3H6RA 4Q9GA 3FJ9A 2NTDA 3RMXA 1JY0A 3CA6A 5D62A 1AVAC 4IZXA 31BIA 2ZQNA 1L2HA 5BOWA 1Q03A 1W3GA 1FMMS 3VSZA 1BFFA 1AXMA 3V0AB 5BXPA 4ZOTA 1FQ9A 41BIA 3FJKA 1G9CA 4KEJA 2L5XA 1YF8B 2LIEA 3ER8C 3FUOA 3RTJB 1FWVA 3O3QA 1AFCA 3N7MA 3O44A 4L4IA 2D24A 1FMZA 3FGMA 4AN7B 1Z2VA 4EB2B 3Q7YA 4USOA 4YOLA 4QALA 1DJSB 1HWPB 2HW9A 1DFQA 1WBAA 1OQLB 3VT2A 3UD8A 5FZYA 4TLPA 5DVHA 1MC9A 4JPZA 3AKIA 1W3FA 1SR4A 1ISXA 2ZQOA 3R4UA 4QBCA 3N0KA 4LEYA 3O4DA 3IM5A 4I4XA 2QYIB 3QR5A 7I1BA 2HWMA 4GP0A 1EVTA 3BB2A 4I4OA 4WH5A 3NBNA 3BAHA 4OWKA 3AH2A 2MIBA 4X38A 2RG9B 1J0SA 1R8OA 1HWMB 4P0LA 1DFCA 3P6JA 1BASA 2ET2A 3S8KA 3V0AA 2BFHA 5F8WA 1ISWA 2NYYA 1YBIA 2AXMA 4NXVA 4LEWA 1Q1UA 1W3AA 1ABRB 4WOYA 4H04A 3Q7WA 1XYFA 1ILR1 2K4AB 2VXTI 4X39A 4PC4A 3QYDA 3UDAA 1DQGA 4JAWA 4I1EA 2NZ9A 4K98A 2E4MA 2I1BA 3OBTA 4Z8SB 1V6UA 2RSTA 4LO1A 4H9WA 4JKXB 1M16A 4JQ0A 5FNXA 5EG6C 1JLYA 5DSSB 4LO3C 1HWNB 3FJAA 4I4YA 3FJCA 3WINA 4X3AA 5D61A 3BA5A 4LEVA 3AH4A 3RTIB 1BFCA 4I4QA 1GGPB 4I96A 1DQOA 3IM7A 3N7JA 4IONA 3BRDA 4QC4A 3RMYA 3PHZA 4OAHA 4ZFYB 1JT5A 2B4VA 3N7LA 1R8NA 1HIBA 2Y9XE 4O69A 2AAIB 3VT1A 3E8LC 4G1RA 1YYNA 2VLCA 4IHZA 1PZZA 4LO1C 5BXRA 3BAQA 3OGFA 2GAFD 2Y9FA 3VT0A 2HZ9A 2UUSA 1S0DA 1YTOA 2Z48A 2E4MC 4ZA3B 3EF2A 5G00A 4A7YA 5CFSA 4HX0A 1G9BA 4K99A 4ZKTB 3I29B 2B51A 1S0FA 2FDBM 3BTAA 1WBCA 5BQUC 5JLVA 2NVHA 1Z0HA 4LEZA 3AKFA 3HALA 3FJIA 1S0EA 4O6AA 4OEGA 1JT3A 2KH2A 4KBBA 2AFGA 2Q9XA 1AF9A 1II4A 4UY4A 1IRAX 3R4SA 4I4RA 4OWJA 3WMVA 1ITBA 3LLPA 4ZBVB 2B56A 4ENDA 1PUUB 3NBEA 1UPSA 5HPZA 21BIA 4LO2C 2NM1A 2D43A 3AJ5A 3WA1A 1JT4A 1FGAA 2VU9A 4Z9WB 4NXXA 3NKUA 5BP5C 2EWRA 3P53A 2D23A 4WQKA 4R6UB 4OEFA 2R9KB 1IT0A 3CQAA 4I0YA 4ZLBB 4J2KA 2MC2A 2GO2A 5CFUA 1BA7A 4GAIA 1CE7B 2X2TA 1QQLA 3PMEA 1QXMA 5F90A 3MCRA 1EYLA 2WBCA 4I8MA 4OWLA 1JTCA 3ERCC 3AZVA 4IZEA 1TFMB 2F2FA 2KKIA 4G9MA 1ISVA 1PUMB 4P6AA 4OAIZ 5CFTA 4H75A 3CRGA 4N7RA 1Z4SA 3JRRA 3K7DA 2LIQA 3HBWA 2IHOA 3POKA 3SNVA 3KMVA 4O68A 4II0A 4D0TA 3CA4A 1WD3A 4OW4A 3WO4A 3O4AA 1WD4A 3O4BA 4K97A 3WO2A 2FO1A 1DZDA 1S0BA 4FGFA 2DRZA 4FO1A 4GAFA 2F2FC 4I37A 3VUOA 4KC3A 5CHEA 3FJHA 4K9AA 5F8SA 2K8RA 4QD2B 5B3PA 2DREA 2VSEA 2P39A 1F31A 2AQZA 5BVPI 1G82A 1XHBA 1HCEA 2QN4A 3BRGC 3A22A 3FJEA 3IAGC 1RG8A 4I2SA 4P0JA 1BLDA 2FFUA 3CU1B 3ILAA 3AKHA 3JUTA 3NBDA 4DEPA 4ISRA 1EV2A 4KB6A 4O67A 4A7ZA 4X37A 1JQZA 5GAQA 3H6RB 1ISZA 1BARA 2FCLA 4GOVA 4OUJA 5BP5A 1SZ6B 3ER9B 1HWOB 3FJ8A 4NXWA 4LO8B 1T9FA 4F83A 4LO2A 4IQPA 1YXWA 4I4SA 3CRIA 4K9BA 1TOOA 3A23A 1RZOB 3V0BB 4ISQA 1V6XA 4A7KA 4ZFWB 3HMYA 4XFSA 2Y9GA 2VSAA 4MKPA 1V6WA 2K43A 4MZHA 3A21A 4OAFA 4WQLA 2VUAA 3NJ5A 5F8YA 1DZCA 4F34A 4DCKC 4KM5A 2Y9WC 3BAOA 2DS0A 3BA4A 1S0GA 3OJMA 3UD9A 4I4UA 1IOBA 5BQUA 1MD6A 9ILBA 3IM6A 3C9ZA 5E24E 1PC8B 1D0HA 8I1BA 3P6IA 4AN6A 5FNWA 4G6JA 1HKNA 3O49A 3CA5A 5JMCA 4MZGB 3W9TA 3H6SE 4D0ZA 2Q3NB 4ZGRB 1T4QA 3MALA 3FUQA 4EFRA 2F8XC 3AJ6A 4LO0C 4Q91A 2Z49A 3BAGA 3I2AA 1RY7A 3OWGA 4IYBA 4K8VA 4EKXB 3NBCA 1CVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0K A;  1HCD A;  1S0C A;  2KI4 A;  1SR4 C;  2FGF A;  4QD2 C;  3CA1 A;  2P23 A;  3FJF A;  3T8S A;  4ZFU B;  2ERM A;  4XKI A;  3OBR A;  1G9D A;  3S8J A;  2WRY A;  4USP A;  4J2S A;  3CRH A;  1NUN A;  4JP0 A;  4KEK A;  1Q04 A;  4CJM A;  3ZC8 A;  1FV2 A;  4L4H A;  2D44 A;  4QBV A;  5FZZ A;  4Q9P A;  4HA2 A;  3D7W B;  1IJT A;  4LO3 A;  3BX1 C;  1AVU A;  1N4K A;  4IY8 A;  3AH1 A;  4EFQ A;  3BAV A;  1IHK A;  4I4V A;  4QKR A;  1E0O A;  3I2X A;  4IY9 A;  3WO3 A;  3BAU A;  1XZZ A;  5DUY A;  4FVV A;  4XFT A;  3AZW A;  2RQ9 A;  3OJV A;  5BXS A;  4J23 B;  4KEI A;  1BFG A;  1TIE A;  2D7R A;  2KI6 B;  1FWU A;  1FV3 A;  1KNM A;  4HJJ A;  1AVW B;  3K1X A;  4GP3 A;  3V79 C;  1RML A;  1AVX B;  2D20 A;  3HN1 A;  4I1B A;  3BA7 A;  4I6I A;  1NZK A;  5BXT A;  2ESU A;  1JT7 A;  3CAH A;  4D8H A;  3BRF A;  1TP0 A;  5EC5 A;  2HWA A;  4LO7 C;  4I4P A;  3FFZ A;  3O5W B;  1XG6 A;  3VSF A;  1IRP A;  3O4O A;  3UJ0 A;  1BFB A;  3RSJ A;  2J3P A;  1ONK B;  5DZU A;  2D1Z A;  1I1B A;  4WBC A;  3LTQ A;  2FFV A;  2ZR1 B;  4G6M A;  3N7K A;  3PUB A;  4J2X A;  3WIN C;  2MLL B;  3FJB A;  1TTU A;  3B9U A;  3CA0 A;  2D22 A;  1A8D A;  2D7I A;  4LO7 B;  1EPW A;  5EHA A;  4I7I A;  4QKS A;  3FJJ A;  4LO0 A;  3AKG A;  6I1B A;  1TWM A;  3PG0 A;  1VCL A;  4J2Y A;  3OJ2 A;  3Q7X A;  2XOA A;  1G9A A;  1DIW A;  4EEE B;  1P63 A;  3V0B A;  3HSM A;  4DEN A;  4EFP A;  1K5U A;  3F1R A;  1DLL A;  1M2T B;  3UD7 A;  5B2H A;  3ZXG A;  1I1E A;  4I3N A;  1V6V A;  5D63 A;  2DRY A;  1JLX A;  4G9N A;  3ZX7 A;  2X2S A;  1TWE A;  1IIL A;  4XFU A;  5FZU A;  3WMU A;  3ZC9 A;  4GOY A;  2YUG A;  4JRA A;  3VEQ A;  1QQK A;  3CA3 A;  3MPP G;  4HR6 C;  2GZB A;  3UJ4 A;  5I1B A;  1ISY A;  2BEA A;  1S0L A;  3FJD A;  2IWT B;  3ZXD A;  2KLL A;  3HOM A;  1BLA A;  3BAD A;  3TC2 A;  1K5V A;  3O4C A;  1PWA A;  3F62 B;  3IIR A;  4QO3 A;  2NP0 A;  2M49 A;  2BEB A;  3A07 A;  3H6Q A;  2VXR A;  4OEE A;  3OGG A;  1FN0 A;  4JKQ A;  3VWC A;  3H6R A;  4Q9G A;  3FJ9 A;  2NTD A;  3RMX A;  1JY0 A;  3CA6 A;  5D62 A;  1AVA C;  4IZX A;  31BI A;  2ZQN A;  1L2H A;  5BOW A;  1Q03 A;  1W3G A;  1FMM S;  3VSZ A;  1BFF A;  1AXM A;  3V0A B;  5BXP A;  4ZOT A;  1FQ9 A;  41BI A;  3FJK A;  1G9C A;  4KEJ A;  2L5X A;  1YF8 B;  2LIE A;  3FUO A;  3RTJ B;  1FWV A;  3O3Q A;  1AFC A;  3N7M A;  3O44 A;  4L4I A;  2D24 A;  1FMZ A;  3FGM A;  4AN7 B;  1Z2V A;  4EB2 B;  3Q7Y A;  4USO A;  4YOL A;  4QAL A;  1DJS B;  1HWP B;  2HW9 A;  1DFQ A;  1WBA A;  1OQL B;  3VT2 A;  3UD8 A;  5FZY A;  4TLP A;  5DVH A;  1MC9 A;  4JPZ A;  3AKI A;  1W3F A;  1SR4 A;  1ISX A;  2ZQO A;  3R4U A;  4QBC A;  3N0K A;  3O4D A;  3IM5 A;  4I4X A;  2QYI B;  3QR5 A;  7I1B A;  2HWM A;  4GP0 A;  1EVT A;  3BB2 A;  4I4O A;  3NBN A;  3BAH A;  4OWK A;  3AH2 A;  2MIB A;  4X38 A;  2RG9 B;  1J0S A;  1R8O A;  1HWM B;  4P0L A;  1DFC A;  3P6J A;  1BAS A;  2ET2 A;  3S8K A;  3V0A A;  2BFH A;  5F8W A;  1ISW A;  2NYY A;  1YBI A;  2AXM A;  1Q1U A;  1W3A A;  1ABR B;  4H04 A;  3Q7W A;  1XYF A;  1ILR 1;  2K4A B;  2VXT I;  4X39 A;  4PC4 A;  3QYD A;  3UDA A;  1DQG A;  4JAW A;  4I1E A;  2NZ9 A;  2E4M A;  2I1B A;  3OBT A;  4Z8S B;  1V6U A;  2RST A;  4LO1 A;  4H9W A;  4JKX B;  1M16 A;  4JQ0 A;  5FNX A;  5EG6 C;  1JLY A;  5DSS B;  4LO3 C;  1HWN B;  3FJA A;  4I4Y A;  3FJC A;  3WIN A;  4X3A A;  5D61 A;  3BA5 A;  3AH4 A;  3RTI B;  1BFC A;  4I4Q A;  1GGP B;  4I96 A;  1DQO A;  3IM7 A;  3N7J A;  4ION A;  3BRD A;  4QC4 A;  3RMY A;  3PHZ A;  4ZFY B;  1JT5 A;  3N7L A;  1R8N A;  1HIB A;  2Y9X E;  2AAI B;  3VT1 A;  3E8L C;  4G1R A;  1YYN A;  2VLC A;  4IHZ A;  1PZZ A;  4LO1 C;  5BXR A;  3BAQ A;  3OGF A;  2Y9F A;  3VT0 A;  2HZ9 A;  2UUS A;  1S0D A;  1YTO A;  2Z48 A;  2E4M C;  4ZA3 B;  3EF2 A;  5G00 A;  4A7Y A;  1G9B A;  4ZKT B;  3I29 B;  1S0F A;  2FDB M;  3BTA A;  1WBC A;  5BQU C;  5JLV A;  2NVH A;  1Z0H A;  3AKF A;  3HAL A;  3FJI A;  1S0E A;  4OEG A;  1JT3 A;  2KH2 A;  4KBB A;  2AFG A;  2Q9X A;  1AF9 A;  1II4 A;  1IRA X;  3R4S A;  4I4R A;  4OWJ A;  3WMV A;  1ITB A;  3LLP A;  4ZBV B;  4END A;  1PUU B;  3NBE A;  1UPS A;  5HPZ A;  21BI A;  4LO2 C;  2NM1 A;  2D43 A;  3AJ5 A;  3WA1 A;  1JT4 A;  1FGA A;  2VU9 A;  4Z9W B;  5BP5 C;  3P53 A;  2D23 A;  4R6U B;  4OEF A;  2R9K B;  1IT0 A;  3CQA A;  4I0Y A;  4ZLB B;  4J2K A;  2MC2 A;  2GO2 A;  1BA7 A;  4GAI A;  1CE7 B;  2X2T A;  1QQL A;  3PME A;  1QXM A;  5F90 A;  1EYL A;  2WBC A;  4I8M A;  4OWL A;  1JTC A;  3AZV A;  4IZE A;  1TFM B;  2F2F A;  2KKI A;  4G9M A;  1ISV A;  1PUM B;  4P6A A;  3CRG A;  1Z4S A;  3JRR A;  2LIQ A;  3HBW A;  2IHO A;  3POK A;  3SNV A;  3KMV A;  4II0 A;  4D0T A;  3CA4 A;  1WD3 A;  4OW4 A;  3WO4 A;  3O4A A;  1WD4 A;  3O4B A;  3WO2 A;  2FO1 A;  1DZD A;  1S0B A;  4FGF A;  2DRZ A;  4GAF A;  2F2F C;  4I37 A;  3VUO A;  4KC3 A;  3FJH A;  5F8S A;  2K8R A;  4QD2 B;  2DRE A;  2VSE A;  2P39 A;  1F31 A;  2AQZ A;  5BVP I;  1G82 A;  1XHB A;  1HCE A;  2QN4 A;  3BRG C;  3A22 A;  3FJE A;  3IAG C;  1RG8 A;  4I2S A;  4P0J A;  1BLD A;  2FFU A;  3CU1 B;  3ILA A;  3AKH A;  3JUT A;  3NBD A;  4DEP A;  4ISR A;  1EV2 A;  4A7Z A;  4X37 A;  1JQZ A;  5GAQ A;  3H6R B;  1ISZ A;  1BAR A;  4GOV A;  4OUJ A;  5BP5 A;  1SZ6 B;  1HWO B;  3FJ8 A;  4LO8 B;  1T9F A;  4F83 A;  4LO2 A;  4IQP A;  1YXW A;  4I4S A;  3CRI A;  1TOO A;  3A23 A;  1RZO B;  3V0B B;  4ISQ A;  1V6X A;  4A7K A;  4ZFW B;  3HMY A;  4XFS A;  2Y9G A;  2VSA A;  1V6W A;  2K43 A;  3A21 A;  2VUA A;  3NJ5 A;  5F8Y A;  1DZC A;  4F34 A;  4DCK C;  2Y9W C;  3BAO A;  2DS0 A;  3BA4 A;  1S0G A;  3OJM A;  3UD9 A;  4I4U A;  1IOB A;  5BQU A;  1MD6 A;  9ILB A;  3IM6 A;  3C9Z A;  5E24 E;  1PC8 B;  1D0H A;  8I1B A;  3P6I A;  4AN6 A;  5FNW A;  4G6J A;  1HKN A;  3O49 A;  3CA5 A;  5JMC A;  3W9T A;  3H6S E;  4D0Z A;  2Q3N B;  4ZGR B;  1T4Q A;  3MAL A;  3FUQ A;  4EFR A;  2F8X C;  3AJ6 A;  4LO0 C;  4Q91 A;  2Z49 A;  3BAG A;  3I2A A;  1RY7 A;  4IYB A;  4EKX B;  3NBC A;  1CVS A; 
#chains in the Genus database with same CATH topology
 2ISO A;  4P0K A;  4KLE A;  1HCD A;  1S0C A;  2KI4 A;  5HHI A;  1SR4 C;  2FGF A;  1VJ7 A;  4LT6 A;  4QD2 C;  3CA1 A;  2P23 A;  3FJF A;  3T8S A;  4ZFU B;  2ERM A;  4EED A;  4XKI A;  3OBR A;  1G9D A;  4WBY A;  3S8J A;  2WRY A;  4TUS A;  1MQ3 A;  4UB4 A;  1R8A A;  4I2J A;  5J0X A;  3UXN A;  4USP A;  4J2S A;  3CRH A;  1NUN A;  4JP0 A;  4KEK A;  1ZQV A;  1Q04 A;  4RWP A;  4CJM A;  3ZC8 A;  3JPN A;  1FV2 A;  1ZQM A;  4L4H A;  3C2K A;  2D44 A;  4MZF B;  4QBV A;  5FZZ A;  4Q9P A;  4HA2 A;  4EP7 A;  4R65 A;  4QZD A;  3D7W B;  1IJT A;  4LO3 A;  3HX0 A;  3BX1 C;  8ICP A;  1AVU A;  1N4K A;  4IY8 A;  3AH1 A;  4EFQ A;  3BAV A;  1IHK A;  4I4V A;  4RQ1 A;  4RWO A;  4QKR A;  2PFO A;  4E8F A;  1E0O A;  4KLF A;  1ZQN A;  3I2X A;  4IY9 A;  3WO3 A;  5CA7 A;  4LZG A;  8ICO A;  3BAU A;  5HRL A;  1XZZ A;  5DUY A;  5HC9 A;  2DRA A;  4FVV A;  1BPB A;  8ICS A;  1ZQQ A;  4XFT A;  3AZW A;  2RQ9 A;  3OJV A;  1KNY A;  3AQM A;  3UXO A;  4PGY A;  5BXS A;  5DDY A;  4J23 B;  4KEI A;  4UAY A;  7ICS A;  1BFG A;  1TIE A;  2D7R A;  1KDH A;  2KI6 B;  1FWU A;  3NVO A;  5B3Q A;  1FV3 A;  1KNM A;  4HJJ A;  4FH3 A;  2HN1 A;  4M9H A;  1AVW B;  1ZQA A;  3K1X A;  4DOC A;  4GP3 A;  3V79 C;  4RT2 A;  1RML A;  1AVX B;  4K4H A;  2D20 A;  3HN1 A;  4I1B A;  1ZQI A;  3BA7 A;  4I6I A;  5HRD A;  5J2I A;  4I28 A;  4JLZ A;  3WFS C;  1NZK A;  5BXT A;  4FO6 A;  2ESU A;  2ZH9 A;  1JT7 A;  3CAH A;  4F5R A;  4D8H A;  4UB1 A;  1XSL A;  3BRF A;  1TP0 A;  5EC5 A;  2HWA A;  4LO7 C;  4QZA A;  4K96 A;  4I4P A;  3FFZ A;  3O5W B;  3UPS A;  3RH6 A;  1XG6 A;  3VSF A;  1ZQE A;  4NXT A;  4O5C A;  1IRP A;  5F2V O;  3O4O A;  1PX5 A;  4QZH A;  3UJ0 A;  1BFB A;  3RSJ A;  2J3P A;  1ONK B;  5DZU A;  2D1Z A;  5HRH A;  1I1B A;  2IUB A;  4R63 A;  4KLO A;  7ICU A;  4WBC A;  4XA5 A;  3LTQ A;  2FFV A;  2ZR1 B;  4G6M A;  3N7K A;  2FMS A;  3PUB A;  4J2X A;  2BCR A;  3WIN C;  2MLL B;  4E80 A;  3FJB A;  1TTU A;  3H37 A;  1XSN A;  3B9U A;  5IIM A;  3JPP A;  3CA0 A;  9ICU A;  2D22 A;  1A8D A;  2D7I A;  4LO7 B;  1EPW A;  5EHA A;  4I7I A;  5CWR A;  4MFA A;  1GPJ A;  4KLT A;  4QKS A;  3FJJ A;  4XJE A;  4LO0 A;  3AKG A;  6I1B A;  4DOB A;  1TWM A;  3PG0 A;  1VCL A;  1ZQX A;  4J2Y A;  2FMQ A;  4WC3 A;  4TUR A;  3OJ2 A;  3Q7X A;  9ICK A;  4QZ9 A;  1ZQL A;  2XOA A;  1G9A A;  4PHD A;  1DIW A;  4EEE B;  1P63 A;  3RJF A;  4P4P A;  3V0B A;  4NXU A;  3HSM A;  7ICO A;  4DEN A;  4YMO A;  4YN4 A;  5D46 A;  4QZG A;  4EFP A;  1K5U A;  4M9J A;  4KLU A;  2NS2 A;  4NXZ A;  4JLX A;  4UAW A;  3F1R A;  2W9M A;  1DLL A;  1M2T B;  4WCW A;  4FHP A;  1ZQH A;  2ZH3 A;  3UD7 A;  7ICQ A;  5B2H A;  3ZXG A;  1I1E A;  4YCX A;  4I3N A;  4IG8 A;  1V6V A;  5D63 A;  2DRY A;  4X4T A;  4RWQ A;  1JLX A;  4G9N A;  3V72 A;  3ZX7 A;  2X2S A;  1TWE A;  1IIL A;  4XFU A;  5FZU A;  3WMU A;  3ZC9 A;  4GOY A;  1UET A;  2YUG A;  5DEC A;  4JRA A;  3JPR A;  3VEQ A;  4S3N A;  9ICG A;  1QQK A;  3CA3 A;  3MPP G;  4HR6 C;  2GZB A;  3UJ4 A;  5I1B A;  1BPY A;  1ISY A;  2BEA A;  4ATB B;  2NRK A;  4OAG A;  8ICL A;  4X0B A;  4I2C A;  1S0L A;  3FJD A;  4YMN A;  2IWT B;  3ZXD A;  2GA9 D;  4M5D A;  3RJE A;  9ICC A;  2KLL A;  3HOM A;  1BLA A;  3JPT A;  1ZJN A;  5J2G A;  3OUY B;  3BAD A;  1BPX A;  3TC2 A;  2ZHA A;  4NY8 A;  8ICQ A;  5IIN A;  1ZQS A;  1R8B A;  4NLK A;  1K5V A;  3O4C A;  3OV7 A;  3MBY A;  1PWA A;  3F62 B;  4I2G A;  3IIR A;  4QO3 A;  2NP0 A;  2M49 A;  2BEB A;  2M2T A;  4RT3 A;  4PGQ A;  5HRK A;  3A07 A;  3UQ2 A;  3H6Q A;  4XUS A;  3CK6 A;  5J2F A;  4LZD A;  4FHV A;  2VXR A;  4OEE A;  2ZH4 A;  5BPC A;  3ISD A;  3OGG A;  3V7K A;  7ICV A;  1FN0 A;  4JKQ A;  3VWC A;  4I2E A;  3H6R A;  4PGX A;  4Q9G A;  1ZQP A;  9ICI A;  3FJ9 A;  3LK9 A;  2NTD A;  3JPQ A;  3K75 D;  4QZF A;  3V7J A;  4EEB A;  3AUO A;  2PFQ A;  3RMX A;  4RQ8 A;  4FHY A;  4JWM A;  9ICW A;  1JY0 A;  3CA6 A;  9ICV A;  5D62 A;  4UAZ A;  4O5K A;  1AVA C;  5JTG A;  4IZX A;  3AQL A;  31BI A;  5J0P A;  8ICZ A;  2ZQN A;  1L2H A;  5BOW A;  3GDX A;  8ICG A;  1Q03 A;  5J2C A;  5III A;  1W3G A;  3RJK A;  1FMM S;  3VSZ A;  1BFF A;  1AXM A;  3V0A B;  5BXP A;  4TUQ A;  4ZOT A;  1ZQB A;  1FQ9 A;  41BI A;  3FJK A;  4KLH A;  1G9C A;  4KEJ A;  5DBA A;  2L5X A;  1YF8 B;  2LIE A;  4RQ5 A;  8ICB A;  7ICI A;  3ER8 C;  3B0Y A;  5DED A;  3FUO A;  1ZJM A;  8ICV A;  3RTJ B;  8ICY A;  2ZH8 A;  1FWV A;  3RH5 A;  3O3Q A;  1AFC A;  3N7M A;  3O44 A;  4L4I A;  2D24 A;  4KLD A;  1FMZ A;  1TFY A;  3FGM A;  3JCF A;  5HRB A;  2DR9 A;  5HRF A;  4AN7 B;  2DVI A;  1Z2V A;  4R64 A;  4NLN A;  4EB2 B;  4F5N A;  5J0Q A;  3Q7Y A;  4USO A;  4YOL A;  4QAL A;  1DJS B;  1HWP B;  2HW9 A;  3OGU A;  4I2F A;  1DFQ A;  1WBA A;  1OQL B;  3VT2 A;  8ICA A;  3UD8 A;  5FZY A;  4RQ4 A;  4TLP A;  5DVH A;  1MC9 A;  5J2J A;  4JPZ A;  3AKI A;  7ICP A;  1ZQD A;  4QZC A;  1ZQG A;  1W3F A;  1SR4 A;  5DDM A;  1R8C A;  4WC0 A;  1ISX A;  2ZHB A;  2ZQO A;  3R4U A;  4QBC A;  4F5Q A;  3N0K A;  2ID1 A;  3O4D A;  3IM5 A;  4LEY A;  4I4X A;  4RWN A;  2QYI B;  3QR5 A;  7I1B A;  5J0R A;  4Z6E A;  4MFF A;  2HWM A;  1ZQY A;  5D4B A;  1TFW A;  4GP0 A;  1EVT A;  8ICN A;  3BB2 A;  5J0O A;  4I4O A;  4WH5 A;  5BOM A;  9ICN A;  3NBN A;  3JPS A;  3BAH A;  4OWK A;  3AH2 A;  2MIB A;  4X38 A;  2RG9 B;  1J0S A;  1R8O A;  4QZE A;  4RQ7 A;  1HWM B;  4P0L A;  1DFC A;  5IIO A;  2PXI A;  3P6J A;  1BAS A;  2ET2 A;  3S8K A;  3V0A A;  2BFH A;  5F8W A;  4P4O A;  5IIK A;  5CR0 A;  5HR9 A;  4RPX A;  1ISW A;  3C2L A;  2NYY A;  3UPQ A;  3MGH A;  1YBI A;  3RJJ A;  2AXM A;  4NXV A;  4I27 A;  4NM1 A;  4LEW A;  1Q1U A;  7ICN A;  1W3A A;  1ABR B;  4WOY A;  4RQ3 A;  3HIY A;  4H04 A;  9ICT A;  3Q7W A;  5DB6 A;  4RQ0 A;  1XYF A;  4I2H A;  1ILR 1;  2ZH2 A;  4KLM A;  2K4A B;  2VXT I;  4X39 A;  4PC4 A;  3JPO A;  1ZQO A;  3QYD A;  3UDA A;  1JMS A;  1DQG A;  4JAW A;  4I1E A;  2NZ9 A;  1F5A A;  2E4M A;  2HHP A;  3LQC B;  5IIJ A;  4K98 A;  1VFG A;  3H38 A;  1MIW A;  2I1B A;  3OBT A;  4Z8S B;  4X4P A;  4UB3 A;  1V6U A;  2RST A;  4LVS A;  4LO1 A;  3HJ4 A;  4H9W A;  3WFO A;  4JKX B;  4X4Q A;  9ICH A;  1M16 A;  7ICR A;  4JQ0 A;  5FNX A;  3L9D A;  5EG6 C;  1TV9 A;  1JLY A;  5DSS B;  4LO3 C;  8ICX A;  2M2U A;  4M47 A;  1OU5 A;  1JQR A;  1HWN B;  4M2Y A;  3FJA A;  2RFF A;  4I4Y A;  3FJC A;  2P66 A;  4NLZ A;  4MF8 A;  2ZH1 A;  3WIN A;  3AQK A;  4X3A A;  5D61 A;  5IIL A;  3BA5 A;  7ICG A;  1BPZ A;  4PPX A;  4LEV A;  3AH4 A;  3RTI B;  2ISP A;  1BFC A;  4I4Q A;  1GGP B;  4I96 A;  1NOM A;  1DQO A;  3IM7 A;  3N7J A;  4ION A;  3BRD A;  4QC4 A;  3RMY A;  3PHZ A;  4OAH A;  4I2D A;  4ZFY B;  1JT5 A;  1ZQU A;  2B4V A;  3B0X A;  4KLL A;  3WFR E;  3N7L A;  1R8N A;  1HIB A;  2Y9X E;  4WC4 A;  4O69 A;  2AAI B;  3UXP A;  3VT1 A;  3E8L C;  4G1R A;  4FH5 A;  4FHW A;  1YYN A;  4I0U A;  4WBZ A;  2ZH6 A;  3C5G A;  4I2A A;  2VLC A;  4IHZ A;  1PZZ A;  4LO1 C;  4UD5 A;  5BXR A;  3WFP A;  5J0T A;  3BAQ A;  3OGF A;  2GAF D;  2Y9F A;  1BPD A;  4K4I A;  3H39 A;  4PHE A;  3VT0 A;  2PBE A;  3UQ0 A;  2DR8 A;  2HZ9 A;  4XQ8 A;  2UUS A;  1S0D A;  1YTO A;  2Z48 A;  2E4M C;  4AT7 A;  4NKU A;  4ZA3 B;  3EF2 A;  5G00 A;  4MFC A;  3HJ1 A;  4A7Y A;  2BBH A;  2O1P A;  5CFS A;  2DR7 A;  4HX0 A;  4F5O A;  1G9B A;  4Z6C A;  8ICT A;  4K99 A;  9ICS A;  4I2I A;  4ZKT B;  5CB1 A;  4NKT A;  4RPY A;  3I29 B;  2B51 A;  4UB2 A;  7ICF A;  1S0F A;  2FDB M;  3BTA A;  1WBC A;  5BQU C;  4ATB A;  2I9G A;  5JLV A;  2NVH A;  5DB8 A;  1Z0H A;  4LEZ A;  8ICW A;  3AKF A;  3HAL A;  4TUP A;  2DR5 A;  3FJI A;  1S0E A;  4FHX A;  4O6A A;  4X4V A;  4OEG A;  3AQN A;  1JT3 A;  9ICO A;  2KH2 A;  4KBB A;  2AFG A;  2Q9X A;  1AF9 A;  1II4 A;  4UY4 A;  8ICJ A;  1IRA X;  3R4S A;  4E7X A;  4PHP A;  5J0Y A;  4I4R A;  4AT7 B;  1ZQT A;  4OWJ A;  3WMV A;  1ITB A;  3LLP A;  4QZB A;  2PFP A;  4ZBV B;  2HN2 A;  2B56 A;  1ZQC A;  3C2M A;  1MQ2 A;  4END A;  8ICU A;  1PUU B;  4EBJ A;  3NBE A;  4WC5 A;  1UPS A;  3RJH A;  5HPZ A;  1Q79 A;  4RQ2 A;  21BI A;  2FMP A;  4LO2 C;  2NM1 A;  5J2B A;  4YD1 A;  4M9N A;  3C5F A;  2D43 A;  4PHA A;  3AJ5 A;  3WA1 A;  1JT4 A;  1FGA A;  2VU9 A;  3HW8 A;  4Z9W B;  4NXX A;  3NKU A;  5BP5 C;  2BPG A;  4KLG A;  2EWR A;  3RH4 A;  7ICH A;  3MDC A;  3P53 A;  2D23 A;  5J2A A;  4WQK A;  2M2V A;  5HRI A;  5J2K A;  3MGI A;  4R6U B;  2DRB A;  8ICK A;  8ICR A;  4OEF A;  2R9K B;  4M04 A;  1IT0 A;  4GXJ A;  8ICC A;  3CQA A;  4I0Y A;  3HWT A;  4ZLB B;  4J2K A;  2MC2 A;  2GO2 A;  5CFU A;  1BA7 A;  4GAI A;  1CE7 B;  1MIY A;  2X2T A;  1V4A A;  1QQL A;  3PME A;  1QXM A;  5F90 A;  3MCR A;  3NWI A;  1EYL A;  2ZH7 A;  4KLI A;  2WBC A;  4I29 A;  4I8M A;  1ZQW A;  4OWL A;  1JTC A;  4O9M A;  4P2H A;  3ERC C;  4DOA A;  4IQW A;  3AZV A;  2ZH5 A;  4IZE A;  4AT9 A;  1TFM B;  2F2F A;  2KKI A;  4EV6 A;  4G9M A;  4WC1 A;  9ICJ A;  4X4R A;  4JWN A;  1ISV A;  1PUM B;  4P6A A;  7ICJ A;  3OVS A;  4OAI Z;  3C18 A;  5CFT A;  5CHG A;  4H75 A;  1Q78 A;  4F5P A;  1RPL A;  3CRG A;  3H3A A;  4N7R A;  9ICX A;  1Z4S A;  3JRR A;  3K7D A;  4WC7 A;  3TFS A;  2BCS A;  2LIQ A;  3HBW A;  4UB5 A;  2IHO A;  3POK A;  3SNV A;  3KMV A;  4O68 A;  4NM2 A;  5HRE A;  5DKW A;  4R66 A;  4KLS A;  4II0 A;  4D0T A;  3CA4 A;  5HRG A;  1WD3 A;  3PMN A;  4OW4 A;  4KLQ A;  3WO4 A;  1BPE A;  4QZ8 A;  4P4M A;  4XRH A;  9ICP A;  3PNC A;  4MF2 A;  3O4A A;  8ICE A;  8ICF A;  1WD4 A;  3O4B A;  5DB9 A;  4K97 A;  2BCU A;  3WO2 A;  2FO1 A;  1DZD A;  1S0B A;  4X0A A;  4FGF A;  2DRZ A;  9ICA A;  1YLQ A;  4FO1 A;  9ICF A;  3PML A;  4GAF A;  2F2F C;  3ISB A;  5DBB A;  4I37 A;  3VUO A;  2BPC A;  3TFR A;  4KC3 A;  2O5A A;  3FJH A;  5CHE A;  5EOZ A;  5F8S A;  4K9A A;  4KLJ A;  2K8R A;  4QD2 B;  5B3P A;  2DRE A;  9ICE A;  4GXI A;  2VSE A;  4X4S A;  2P39 A;  2BCV A;  1F31 A;  2AQZ A;  2VAN A;  4UBB A;  4I2B A;  5BVP I;  3OUY A;  4GXK A;  4M9L A;  7ICM A;  1G82 A;  3RJI A;  4X4N A;  1XHB A;  1HCE A;  2QN4 A;  3BRG C;  5J0U A;  4X4O A;  1UEV A;  3A22 A;  1XSP A;  3MDA A;  1ZQJ A;  3RJG A;  3FJE A;  3IAG C;  2BPF A;  1RG8 A;  4I2S A;  4P0J A;  1BLD A;  2FFU A;  3CU1 B;  3ILA A;  2PFN A;  9ICR A;  5DB7 A;  3AKH A;  3JUT A;  3NBD A;  4DEP A;  2BBJ A;  1NO5 A;  4ISR A;  1EV2 A;  4EGW A;  1HUZ A;  3OVB A;  9ICQ A;  4KB6 A;  4O67 A;  1R89 A;  3C66 A;  4A7Z A;  8ICI A;  4X37 A;  1JQZ A;  1WOT A;  5CJ7 A;  5GAQ A;  4WC2 A;  7ICL A;  3H6R B;  4M0A A;  1ISZ A;  3V7L A;  1BAR A;  5DBC A;  2FCL A;  2BE3 A;  3JYY A;  4GOV A;  3ISC A;  4OUJ A;  5BP5 A;  1SZ6 B;  1TVA A;  3ER9 B;  1HWO B;  3FJ8 A;  4NXW A;  1HUO A;  4LO8 B;  1T9F A;  4F83 A;  4DO9 A;  4LO2 A;  4IQP A;  1YXW A;  4I4S A;  3AU2 A;  3CRI A;  5D49 A;  4RQ6 A;  4K9B A;  2Q66 A;  1TOO A;  3A23 A;  1ZQR A;  4M9G A;  1RZO B;  4PH5 A;  3V0B B;  4ISQ A;  3OVA A;  8ICM A;  1V6X A;  4A7K A;  4ZFW B;  3HMY A;  4XFS A;  2Y9G A;  2VSA A;  7ICT A;  1FA0 A;  4MKP A;  4YD2 A;  2GWS A;  1V6W A;  2K43 A;  4MZH A;  3NYB A;  4AT9 B;  4RPZ A;  3A21 A;  4X5V A;  4WC6 A;  4OAF A;  4WQL A;  5CP2 A;  2VUA A;  3NJ5 A;  9ICB A;  5F8Y A;  1DZC A;  4F34 A;  4DCK C;  4KM5 A;  2Y9W C;  4QZI A;  4AT8 B;  3BAO A;  1ZQF A;  9ICL A;  2DS0 A;  3BA4 A;  1S0G A;  3OJM A;  3AU6 A;  5J2D A;  1KEJ A;  4Z6D A;  9ICM A;  1JN3 A;  3UD9 A;  4I4U A;  1IOB A;  5BQU A;  5J0S A;  1MD6 A;  9ILB A;  1UEU A;  4IQV A;  3IM6 A;  3C9Z A;  5E24 E;  5TZV A;  2IHM A;  4O5E A;  1PC8 B;  5J2H A;  8ICH A;  4YMM A;  1D0H A;  8I1B A;  5BOL A;  3P6I A;  4AN6 A;  5J0W A;  5FNW A;  2BCQ A;  4G6J A;  1HKN A;  4UD4 A;  4Z6F A;  3O49 A;  3CA5 A;  4XQ7 A;  4IQT A;  1ZQZ A;  5JMC A;  7ICE A;  4MZG B;  5J2E A;  5HHH A;  3W9T A;  3H6S E;  4D0Z A;  4IQU A;  4K4G A;  2Q3N B;  4ZGR B;  1T4Q A;  3MAL A;  4EBK A;  1RZT A;  3FUQ A;  4EFR A;  7ICK A;  2F8X C;  3AJ6 A;  4LO0 C;  4Q91 A;  5J29 A;  2Z49 A;  3BAG A;  3I2A A;  2M2W A;  4AT8 A;  3WFQ E;  1RY7 A;  1MIV A;  1JAJ A;  3OWG A;  3JZ0 A;  1ZQK A;  4IYB A;  4UBC A;  4K8V A;  4EKX B;  4X4U A;  3NBC A;  1CVS A; 
#chains in the Genus database with same CATH homology
 4P0K A;  1HCD A;  1S0C A;  2KI4 A;  1SR4 C;  2FGF A;  4QD2 C;  3CA1 A;  2P23 A;  3FJF A;  3T8S A;  4ZFU B;  2ERM A;  4XKI A;  3OBR A;  1G9D A;  3S8J A;  2WRY A;  4USP A;  4J2S A;  3CRH A;  1NUN A;  4JP0 A;  4KEK A;  1Q04 A;  4CJM A;  3ZC8 A;  1FV2 A;  4L4H A;  2D44 A;  4MZF B;  4QBV A;  5FZZ A;  4Q9P A;  4HA2 A;  3D7W B;  1IJT A;  4LO3 A;  3BX1 C;  1AVU A;  1N4K A;  4IY8 A;  3AH1 A;  4EFQ A;  3BAV A;  1IHK A;  4I4V A;  4QKR A;  1E0O A;  3I2X A;  4IY9 A;  3WO3 A;  3BAU A;  1XZZ A;  5DUY A;  4FVV A;  4XFT A;  3AZW A;  2RQ9 A;  3OJV A;  5BXS A;  4J23 B;  4KEI A;  1BFG A;  1TIE A;  2D7R A;  2KI6 B;  1FWU A;  5B3Q A;  1FV3 A;  1KNM A;  4HJJ A;  1AVW B;  3K1X A;  4GP3 A;  3V79 C;  1RML A;  1AVX B;  2D20 A;  3HN1 A;  4I1B A;  3BA7 A;  4I6I A;  4JLZ A;  1NZK A;  5BXT A;  2ESU A;  1JT7 A;  3CAH A;  4D8H A;  3BRF A;  1TP0 A;  5EC5 A;  2HWA A;  4LO7 C;  4K96 A;  4I4P A;  3FFZ A;  3O5W B;  1XG6 A;  3VSF A;  4NXT A;  1IRP A;  3O4O A;  3UJ0 A;  1BFB A;  3RSJ A;  2J3P A;  1ONK B;  5DZU A;  2D1Z A;  1I1B A;  4WBC A;  3LTQ A;  2FFV A;  2ZR1 B;  4G6M A;  3N7K A;  3PUB A;  4J2X A;  3WIN C;  2MLL B;  3FJB A;  1TTU A;  3B9U A;  3CA0 A;  2D22 A;  1A8D A;  2D7I A;  4LO7 B;  1EPW A;  5EHA A;  4I7I A;  1GPJ A;  4QKS A;  3FJJ A;  4XJE A;  4LO0 A;  3AKG A;  6I1B A;  1TWM A;  3PG0 A;  1VCL A;  4J2Y A;  3OJ2 A;  3Q7X A;  2XOA A;  1G9A A;  1DIW A;  4EEE B;  1P63 A;  3V0B A;  4NXU A;  3HSM A;  4DEN A;  4EFP A;  1K5U A;  2NS2 A;  4JLX A;  3F1R A;  1DLL A;  1M2T B;  3UD7 A;  5B2H A;  3ZXG A;  1I1E A;  4I3N A;  1V6V A;  5D63 A;  2DRY A;  1JLX A;  4G9N A;  3ZX7 A;  2X2S A;  1TWE A;  1IIL A;  4XFU A;  5FZU A;  3WMU A;  3ZC9 A;  4GOY A;  2YUG A;  4JRA A;  3VEQ A;  1QQK A;  3CA3 A;  3MPP G;  4HR6 C;  2GZB A;  3UJ4 A;  5I1B A;  1ISY A;  2BEA A;  4OAG A;  1S0L A;  3FJD A;  2IWT B;  3ZXD A;  2GA9 D;  2KLL A;  3HOM A;  1BLA A;  3BAD A;  3TC2 A;  1K5V A;  3O4C A;  1PWA A;  3F62 B;  3IIR A;  4QO3 A;  2NP0 A;  2M49 A;  2BEB A;  3A07 A;  3H6Q A;  2VXR A;  4OEE A;  3OGG A;  1FN0 A;  4JKQ A;  3VWC A;  3H6R A;  4Q9G A;  3FJ9 A;  2NTD A;  3RMX A;  1JY0 A;  3CA6 A;  5D62 A;  1AVA C;  4IZX A;  31BI A;  2ZQN A;  1L2H A;  5BOW A;  1Q03 A;  1W3G A;  1FMM S;  3VSZ A;  1BFF A;  1AXM A;  3V0A B;  5BXP A;  4ZOT A;  1FQ9 A;  41BI A;  3FJK A;  1G9C A;  4KEJ A;  2L5X A;  1YF8 B;  2LIE A;  3ER8 C;  3FUO A;  3RTJ B;  1FWV A;  3O3Q A;  1AFC A;  3N7M A;  3O44 A;  4L4I A;  2D24 A;  1FMZ A;  3FGM A;  4AN7 B;  1Z2V A;  4EB2 B;  3Q7Y A;  4USO A;  4YOL A;  4QAL A;  1DJS B;  1HWP B;  2HW9 A;  1DFQ A;  1WBA A;  1OQL B;  3VT2 A;  3UD8 A;  5FZY A;  4TLP A;  5DVH A;  1MC9 A;  4JPZ A;  3AKI A;  1W3F A;  1SR4 A;  1ISX A;  2ZQO A;  3R4U A;  4QBC A;  3N0K A;  4LEY A;  3O4D A;  3IM5 A;  4I4X A;  2QYI B;  3QR5 A;  7I1B A;  2HWM A;  4GP0 A;  1EVT A;  3BB2 A;  4I4O A;  4WH5 A;  3NBN A;  3BAH A;  4OWK A;  3AH2 A;  2MIB A;  4X38 A;  2RG9 B;  1J0S A;  1R8O A;  1HWM B;  4P0L A;  1DFC A;  3P6J A;  1BAS A;  2ET2 A;  3S8K A;  3V0A A;  2BFH A;  5F8W A;  1ISW A;  2NYY A;  1YBI A;  2AXM A;  4NXV A;  4LEW A;  1Q1U A;  1W3A A;  1ABR B;  4WOY A;  4H04 A;  3Q7W A;  1XYF A;  1ILR 1;  2K4A B;  2VXT I;  4X39 A;  4PC4 A;  3QYD A;  3UDA A;  1DQG A;  4JAW A;  4I1E A;  2NZ9 A;  4K98 A;  2E4M A;  2I1B A;  3OBT A;  4Z8S B;  1V6U A;  2RST A;  4LO1 A;  4H9W A;  4JKX B;  1M16 A;  4JQ0 A;  5FNX A;  5EG6 C;  1JLY A;  5DSS B;  4LO3 C;  1HWN B;  3FJA A;  4I4Y A;  3FJC A;  3WIN A;  4X3A A;  5D61 A;  3BA5 A;  4LEV A;  3AH4 A;  3RTI B;  1BFC A;  4I4Q A;  1GGP B;  4I96 A;  1DQO A;  3IM7 A;  3N7J A;  4ION A;  3BRD A;  4QC4 A;  3RMY A;  3PHZ A;  4OAH A;  4ZFY B;  1JT5 A;  2B4V A;  3N7L A;  1R8N A;  1HIB A;  2Y9X E;  4O69 A;  2AAI B;  3VT1 A;  3E8L C;  4G1R A;  1YYN A;  2VLC A;  4IHZ A;  1PZZ A;  4LO1 C;  5BXR A;  3BAQ A;  3OGF A;  2GAF D;  2Y9F A;  3VT0 A;  2HZ9 A;  2UUS A;  1S0D A;  1YTO A;  2Z48 A;  2E4M C;  4ZA3 B;  3EF2 A;  5G00 A;  4A7Y A;  5CFS A;  4HX0 A;  1G9B A;  4K99 A;  4ZKT B;  3I29 B;  2B51 A;  1S0F A;  2FDB M;  3BTA A;  1WBC A;  5BQU C;  5JLV A;  2NVH A;  1Z0H A;  4LEZ A;  3AKF A;  3HAL A;  3FJI A;  1S0E A;  4O6A A;  4OEG A;  1JT3 A;  2KH2 A;  4KBB A;  2AFG A;  2Q9X A;  1AF9 A;  1II4 A;  4UY4 A;  1IRA X;  3R4S A;  4I4R A;  4OWJ A;  3WMV A;  1ITB A;  3LLP A;  4ZBV B;  2B56 A;  4END A;  1PUU B;  3NBE A;  1UPS A;  5HPZ A;  21BI A;  4LO2 C;  2NM1 A;  2D43 A;  3AJ5 A;  3WA1 A;  1JT4 A;  1FGA A;  2VU9 A;  4Z9W B;  4NXX A;  3NKU A;  5BP5 C;  2EWR A;  3P53 A;  2D23 A;  4WQK A;  4R6U B;  4OEF A;  2R9K B;  1IT0 A;  3CQA A;  4I0Y A;  4ZLB B;  4J2K A;  2MC2 A;  2GO2 A;  5CFU A;  1BA7 A;  4GAI A;  1CE7 B;  2X2T A;  1QQL A;  3PME A;  1QXM A;  5F90 A;  3MCR A;  1EYL A;  2WBC A;  4I8M A;  4OWL A;  1JTC A;  3ERC C;  3AZV A;  4IZE A;  1TFM B;  2F2F A;  2KKI A;  4G9M A;  1ISV A;  1PUM B;  4P6A A;  4OAI Z;  5CFT A;  4H75 A;  3CRG A;  4N7R A;  1Z4S A;  3JRR A;  3K7D A;  2LIQ A;  3HBW A;  2IHO A;  3POK A;  3SNV A;  3KMV A;  4O68 A;  4II0 A;  4D0T A;  3CA4 A;  1WD3 A;  4OW4 A;  3WO4 A;  3O4A A;  1WD4 A;  3O4B A;  4K97 A;  3WO2 A;  2FO1 A;  1DZD A;  1S0B A;  4FGF A;  2DRZ A;  4FO1 A;  4GAF A;  2F2F C;  4I37 A;  3VUO A;  4KC3 A;  5CHE A;  3FJH A;  4K9A A;  5F8S A;  2K8R A;  4QD2 B;  5B3P A;  2DRE A;  2VSE A;  2P39 A;  1F31 A;  2AQZ A;  5BVP I;  1G82 A;  1XHB A;  1HCE A;  2QN4 A;  3BRG C;  3A22 A;  3FJE A;  3IAG C;  1RG8 A;  4I2S A;  4P0J A;  1BLD A;  2FFU A;  3CU1 B;  3ILA A;  3AKH A;  3JUT A;  3NBD A;  4DEP A;  4ISR A;  1EV2 A;  4KB6 A;  4O67 A;  4A7Z A;  4X37 A;  1JQZ A;  5GAQ A;  3H6R B;  1ISZ A;  1BAR A;  2FCL A;  4GOV A;  4OUJ A;  5BP5 A;  1SZ6 B;  3ER9 B;  1HWO B;  3FJ8 A;  4NXW A;  4LO8 B;  1T9F A;  4F83 A;  4LO2 A;  4IQP A;  1YXW A;  4I4S A;  3CRI A;  4K9B A;  1TOO A;  3A23 A;  1RZO B;  3V0B B;  4ISQ A;  1V6X A;  4A7K A;  4ZFW B;  3HMY A;  4XFS A;  2Y9G A;  2VSA A;  4MKP A;  1V6W A;  2K43 A;  4MZH A;  3A21 A;  4OAF A;  4WQL A;  2VUA A;  3NJ5 A;  5F8Y A;  1DZC A;  4F34 A;  4DCK C;  4KM5 A;  2Y9W C;  3BAO A;  2DS0 A;  3BA4 A;  1S0G A;  3OJM A;  3UD9 A;  4I4U A;  1IOB A;  5BQU A;  1MD6 A;  9ILB A;  3IM6 A;  3C9Z A;  5E24 E;  1PC8 B;  1D0H A;  8I1B A;  3P6I A;  4AN6 A;  5FNW A;  4G6J A;  1HKN A;  3O49 A;  3CA5 A;  5JMC A;  4MZG B;  3W9T A;  3H6S E;  4D0Z A;  2Q3N B;  4ZGR B;  1T4Q A;  3MAL A;  3FUQ A;  4EFR A;  2F8X C;  3AJ6 A;  4LO0 C;  4Q91 A;  2Z49 A;  3BAG A;  3I2A A;  1RY7 A;  3OWG A;  4IYB A;  4K8V A;  4EKX B;  3NBC A;  1CVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...