3EF2A

Structure of the marasmius oreades mushroom lectin (moa) in complex with galalpha(1,3)[fucalpha(1,2)]gal and calcium.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
292
structure length
291
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Agglutinin
publication title Structural Characterization of a Lectin from the Mushroom Marasmius oreades in Complex with the Blood Group B Trisaccharide and Calcium.
pubmed doi rcsb
source organism Marasmius oreades
total genus 89
structure length 291
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ef2A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ef2A02
2VSAA 3IM7A 3N0KA 4P0KA 3UD7A 5EG6C 3ZX7A 3IAGC 3H6RA 2VSEA 2D22A 3ZC9A 2Z49A 1S0DA 1JT5A 1KNMA 1G9AA 1NZKA 5DSSB 3CRIA 2D44A 2IWTB 1Z2VA 4HA2A 1AF9A 3CA5A 2DREA 3O4OA 4IONA 3IM5A 1DJSB 1PWAA 1EVTA 3CAHA 3UD9A 1SR4A 4I4UA 1G9CA 4JQ0A 4DCKC 3VWCA 1ISZA 1ITBA 1Q03A 1PZZA 3E8LC 3CA0A 3PG0A 3VSFA 2NP0A 4IY8A 1QQLA 3RMYA 3AKFA 4I37A 4ZGRB 3EF2A 4D0TA 1L2HA 1QXMA 3K1XA 3CA6A 4ZOTA 1YBIA 4QALA 2DS0A 3R4UA 4A7ZA 1I1BA 5FZZA 1PC8B 4PC4A 1AFCA 3CA4A 4QBCA 3WINC 1G9BA 5E24E 4I4XA 1HCEA 2F2FC 1Q04A 2HWMA 4I1BA 1XHBA 3AH2A 3IM6A 2D20A 2QN4A 3O5WB 3NJ5A 3HOMA 1S0FA 1SZ6B 3OJVA 1HWMB 1MC9A 3HN1A 4H9WA 4II0A 1NUNA 1YTOA 3BADA 3N7JA 3VUOA 3Q7XA 2BEAA 4G6MA 3T8SA 5D61A 4J23B 1BASA 1V6UA 4DENA 3V0AB 2ZQOA 1BA7A 3WA1A 3A07A 2KI6B 1J0SA 2RG9B 4USOA 3V79C 3S8JA 41BIA 5FZYA 1JTCA 1RMLA 3QYDA 1FQ9A 2NZ9A 3BRGC 2FGFA 3CA3A 4I8MA 3ZC8A 4Z8SB 5F8WA 5BP5A 4I3NA 1MD6A 1FN0A 3BAQA 1HWPB 4Q9GA 3OJ2A 4GAIA 4ZA3B 2KKIA 1W3GA 1W3AA 5DZUA 1JT7A 1XG6A 5G00A 3A21A 2FDBM 3HSMA 3BAHA 3D7WB 4QKSA 1HWOB 3BRFA 4XKIA 1V6WA 1BFFA 4F83A 3O4CA 1T4QA 4JAWA 2D43A 3Q7WA 2ET2A 4OW4A 3BB2A 3UDAA 1SR4C 3NBEA 1BFCA 2WBCA 1BFBA 2K4AB 4X37A 3F62B 1TWEA 3BA7A 1G9DA 4ISQA 3CQAA 5GAQA 2KI4A 3WO2A 3UJ0A 1JQZA 3A22A 4I4VA 4G9MA 4JRAA 4L4HA 4OWLA 2GZBA 4LO1A 5BXTA 1HWNB 1EV2A 3FJFA 3V0BB 2R9KB 5BQUC 3RTIB 3AKHA 3POKA 5FZUA 1FGAA 1F31A 4Q91A 1EYLA 2HZ9A 3MPPG 1FV3A 1ABRB 4I2SA 4XFTA 4ENDA 3N7KA 2DRZA 4DEPA 1IJTA 2Y9WC 3BAVA 1QQKA 1RZOB 3I2XA 5FNXA 3KMVA 2MIBA 2M49A 1K5UA 1DIWA 4IY9A 4AN6A 2RSTA 3FFZA 1Z4SA 3FJDA 2D1ZA 3CRGA 3CRHA 4Q9PA 5BVPI 1I1EA 1FV2A 4EEEB 4OUJA 2HW9A 3JUTA 3VT0A 2Y9XE 1IILA 1IT0A 4KC3A 1AVXB 3FUQA 3BA5A 4HR6C 4J2SA 4LO7C 4IZXA 1YXWA 2D7RA 2P39A 3WMVA 2K43A 3C9ZA 21BIA 4HJJA 4I0YA 1FMZA 3WO3A 4EFQA 3VT1A 1M16A 1BARA 2AAIB 1DQOA 2Q3NB 3NBCA 1TIEA 4I4OA 1TWMA 1S0GA 3AJ6A 3V0AA 1WBCA 3RTJB 5EHAA 3JRRA 3B9UA 2D23A 4IZEA 1EPWA 3O3QA 4I4RA 1FWVA 2BFHA 2VLCA 3P53A 3FJJA 4I6IA 5BXSA 1YYNA 4LO2A 3I2AA 4QD2C 3VT2A 1ILR1 1BLAA 4FVVA 2ZR1B 2NTDA 1AVWB 2K8RA 3FUOA 6I1BA 1D0HA 3I29B 4WBCA 4I96A 1JT3A 3FJAA 2VXTI 3P6IA 3PUBA 4LO0A 1XZZA 4G9NA 2Q9XA 5BXRA 1JLXA 1S0CA 2MLLB 1WD3A 2RQ9A 2ZQNA 2BEBA 3A23A 3FJ8A 4GOVA 4KBBA 3WMUA 3CA1A 3WINA 1UPSA 3FJKA 3AKIA 4USPA 2VUAA 4LO1C 3FJBA 2MC2A 4ZLBB 4LO3A 1ISVA 1PUMB 2Z48A 3O4DA 3O49A 3P6JA 4JKQA 3AH1A 1BLDA 2E4MA 2NVHA 3VSZA 4KEKA 1DFQA 2GO2A 1BFGA 3HALA 5D63A 3OBRA 4I1EA 3VEQA 4EB2B 1II4A 2NM1A 3BAOA 3ILAA 3Q7YA 2FFVA 1IRPA 1ISWA 2Y9FA 4X38A 1CVSA 5FNWA 2NYYA 3FGMA 1DLLA 3FJ9A 3S8KA 1K5VA 3FJIA 3IIRA 4GAFA 4QC4A 1ISYA 1V6XA 4ISRA 4XFUA 1WD4A 1JY0A 2L5XA 3OGGA 4J2KA 4QD2B 1FWUA 4A7YA 1HIBA 4A7KA 1YF8B 2KH2A 4P6AA 2LIQA 3O44A 3AZVA 2YUGA 1S0LA 1JT4A 2J3PA 4X39A 1R8NA 4Z9WB 4P0JA 1OQLB 4JP0A 4OEEA 2FFUA 4I4SA 3N7LA 1IHKA 4GOYA 1XYFA 4IYBA 4JPZA 3N7MA 4FGFA 4D0ZA 1AVUA 5DUYA 1AXMA 5F90A 1TOOA 4KEJA 3H6RB 2UUSA 1G82A 3BA4A 1FMMS 3FJHA 4F34A 4ZFWB 3QR5A 3AJ5A 2Y9GA 3BAUA 3MALA 3PMEA 4J2YA 4OWJA 5HPZA 3HBWA 1WBAA 4I4PA 3RSJA 3H6QA 4LO2C 3PHZA 3OBTA 8I1BA 4TLPA 5I1BA 5JLVA 1DZDA 3AH4A 3BAGA 1S0EA 2LIEA 2I1BA 4LO0C 4ZFUB 1TTUA 2X2TA 2ERMA 1M2TB 3O4BA 2DRYA 4JKXB 3WO4A 4D8HA 5BP5C 1AVAC 4GP3A 4L4IA 1ISXA 1R8OA 3AZWA 3NBNA 5BQUA 1DZCA 4YOLA 2VXRA 4QKRA 3LLPA 5DVHA 4OEGA 3CU1B 2AXMA 2IHOA 4CJMA 4OEFA 1VCLA 3NBDA 2P23A 4LO3C 4AN7B 4EKXB 1Z0HA 3HMYA 7I1BA 3R4SA 1CE7B 3O4AA 2E4MC 31BIA 4LO8B 3TC2A 4I4QA 1TFMB 4IHZA 5JMCA 3UD8A 2QYIB 2WRYA 4OWKA 5F8YA 2FO1A 2KLLA 1RG8A 4I7IA 3OGFA 5F8SA 2X2SA 1DQGA 4J2XA 4EFRA 2F8XC 5B2HA 1T9FA 2XOAA 5D62A 3BTAA 4G1RA 1PUUB 2AFGA 1JLYA 1RY7A 4EFPA 1DFCA 1HCDA 1IOBA 2F2FA 2D7IA 4P0LA 3LTQA 1V6VA 3BX1C 3RMXA 3FJCA 5BOWA 3ZXDA 4G6JA 2ESUA 4LO7B 3H6SE 2AQZA 1Q1UA 3OJMA 4QO3A 5BXPA 1ONKB 4ZKTB 1HKNA 3AKGA 1N4KA 3FJEA 4X3AA 1W3FA 9ILBA 3BRDA 4ZFYB 5EC5A 4I4YA 1S0BA 1GGPB 3SNVA 4QBVA 4H04A 1A8DA 3UJ4A 3F1RA 4XFSA 1TP0A 3V0BA 3W9TA 4KEIA 2VU9A 4IQPA 1IRAX 2D24A 2HWAA 4R6UB 1E0OA 1P63A 4ZBVB 3ZXGA 4GP0A
chains in the Genus database with same CATH superfamily
2VSAA 4GXIA 3OUYA 4MZFB 5EG6C 3NWIA 4P4PA 2BBJA 8ICJA 4OAGA 2VSEA 1S0DA 1JT5A 1R8AA 1G9AA 2VANA 4MFFA 4GXJA 1AF9A 8ICUA 4X0AA 3JPTA 3UD9A 5J2EA 2ZH8A 9ICLA 1Q03A 5HRHA 4X4UA 2ZH9A 3CA0A 4UD4A 3PG0A 4AT9A 5CHGA 4IY8A 4DOAA 3TFRA 4GXKA 1L2HA 1YBIA 2ZH4A 2O1PA 3R4UA 4H75A 5FZZA 1G9BA 2F2FC 2GA9D 9ICIA 3O5WB 1S0FA 3OJVA 4UB4A 5J29A 3VUOA 4J23B 4FO1A 2ZQOA 8ICNA 4P2HA 1ZQJA 2KI6B 1J0SA 2PFQA 2P66A 5JTGA 2PXIA 2FGFA 4LEWA 4I8MA 4Z8SB 5F8WA 1MD6A 1FN0A 1HWPB 4Q9GA 4IQUA 4YMNA 4ZA3B 5DZUA 1XG6A 5G00A 4JWMA 3A21A 4WH5A 4R64A 4X5VA 4EEBA 3Q7WA 2ET2A 7ICGA 4M9LA 3AQKA 2K4AB 4X37A 3CQAA 2KI4A 5CA7A 4G9MA 4LO1A 3ER9B 3FJFA 2W9MA 4KM5A 5BQUC 3AKHA 4Q91A 4IQTA 9ICPA 4ENDA 4YN4A 3N7KA 4X4NA 4DEPA 1IJTA 1RZOB 4KLDA 3WFPA 1K5UA 4AN6A 2RSTA 4WC7A 3V72A 3FFZA 4PGXA 2HHPA 4KLHA 5J2FA 5BVPI 4OUJA 2HW9A 2Y9XE 1ZQNA 4WQKA 4J2SA 3UXOA 4IZXA 1YXWA 4PHPA 2P39A 3WMVA 2K43A 21BIA 3OVSA 5CP2A 3PMNA 1M16A 1BARA 4WOYA 1TIEA 5HR9A 3RTJB 2D23A 1EPWA 3O3QA 4M9GA 2FMQA 4I2AA 1YYNA 3I2AA 4QD2C 1PX5A 3VT2A 4RT2A 4M04A 5DB8A 6I1BA 8ICBA 2ZH7A 5D46A 1RPLA 1JT3A 3AUOA 8ICOA 3PUBA 8ICWA 2Q9XA 5BXRA 2ZQNA 2RQ9A 3A23A 1ZQXA 3CA1A 5BPCA 3WINA 2DVIA 3HW8A 3V7LA 1TFWA 2MC2A 4LO3A 1ISVA 1PUMB 3NKUA 3O4DA 3O49A 5DKWA 4FH5A 3AH1A 2E4MA 3VSZA 4KEKA 1DFQA 2GO2A 3HALA 4X4VA 4PH5A 3Q7YA 4KLSA 5DB9A 1CVSA 4HX0A 3FGMA 3S8KA 3IIRA 5J0PA 4AT7A 3K75D 4XRHA 1V6XA 4ISRA 1WD4A 1ZQQA 4E8FA 4WC4A 4A7KA 1ZQHA 4X39A 2J3PA 4QZ8A 1XYFA 4IYBA 4D0ZA 3RH4A 1HUOA 4KLMA 4TUQA 2UUSA 3AJ5A 3PMEA 4K8VA 4LO2C 3OBTA 4Z6FA 8I1BA 4UAZA 4FO6A 4NLNA 4AT9B 1MQ3A 1OU5A 4JKXB 1AVAC 8ICLA 3MDAA 3H37A 4YOLA 2HN2A 2VXRA 4JLZA 2AXMA 4RQ6A 8ICKA 1VCLA 2P23A 1ZQTA 4EKXB 3HMYA 31BIA 4I4QA 4YD1A 5HHHA 5JMCA 3UD8A 9ICEA 5F8YA 2X2SA 1JN3A 1XSPA 9ICQA 1PUUB 2AFGA 1JLYA 1RY7A 4EGWA 1HCDA 3MGHA 2NRKA 4P0LA 3BX1C 3ZXDA 3JPRA 5CR0A 2I9GA 4ZKTB 3AKGA 4X3AA 5DB7A 1GGPB 4QBVA 3RH6A 5D49A 4UB2A 4IQPA 4R6UB 4WQLA 1E0OA 1P63A 5J0XA 4PHEA 8ICCA 3UD7A 4NLKA 8ICSA 2ID1A 2Z49A 1KNMA 4E7XA 1NZKA 3CRIA 2PFNA 2IWTB 4HA2A 3IM5A 1PWAA 3MGIA 1SR4A 4I4UA 2EWRA 4DCKC 1ISZA 5HHIA 2FCLA 4I37A 4KLJA 3K1XA 3HWTA 8ICAA 1PC8B 4PC4A 1JQRA 3CA4A 4UY4A 1JMSA 4QZFA 1ZQRA 4I4XA 4KLLA 4I1BA 7ICHA 7ICJA 5IINA 4WC1A 3HN1A 4H9WA 1YTOA 3C18A 3Q7XA 8ICHA 1UETA 5CFUA 1BASA 4DENA 5TZVA 3WA1A 9ICXA 4P4OA 4RPYA 2RG9B 5J0YA 3V79C 3S8JA 41BIA 1RMLA 3QYDA 3HIYA 3L9DA 1FQ9A 4M5DA 3UPSA 3ZC8A 5BP5A 1ZQCA 1ZQIA 4X4SA 3OJ2A 2KKIA 3JPQA 1KEJA 3BAHA 1ZQVA 1BFFA 4RWPA 3O4CA 1T4QA 4YMOA 5DBAA 2D43A 4O6AA 3UDAA 4UB5A 3BB2A 9ICVA 3NBEA 2WBCA 4K9BA 1BFBA 1TWEA 2PFOA 5CJ7A 5B3QA 3UJ0A 3NVOA 1BPBA 5HRFA 9ICJA 3C5GA 3K7DA 1HWNB 4RQ3A 4XJEA 5J2DA 1FA0A 2R9KB 4AT7B 9ICNA 3AQMA 4ATBB 5IIKA 3MPPG 1FV3A 3JCFA 2DRZA 2ISOA 3I2XA 2DR9A 7ICTA 4IY9A 4XQ7A 3ISCA 8ICQA 2D1ZA 2B56A 1I1EA 1IT0A 5CWRA 3MBYA 2BPCA 4MZGB 4FHVA 1FMZA 1DQOA 3CK6A 4O9MA 4WCWA 4WC5A 1S0GA 5DDYA 3JRRA 7ICOA 5HRGA 1FWVA 2BFHA 2VLCA 5HRKA 8ICZA 4I6IA 2M2WA 1ILR1 1AVWB 2K8RA 7ICRA 3I29B 5IIOA 4LZDA 4I96A 3FJAA 2VXTI 3C5FA 3C2MA 4LO0A 1XZZA 4G9NA 4KLTA 2MLLB 1WD3A 4KBBA 2BEBA 4LT6A 2BCUA 4YMMA 2VUAA 4LO1C 2Z48A 4JKQA 5J0TA 3OBRA 2ZHBA 1II4A 4K98A 4QZAA 2DR7A 1IRPA 4X38A 4O67A 5FNWA 2NYYA 3FJ9A 2FMSA 9ICGA 1ZQAA 4QC4A 2FMPA 1JY0A 2L5XA 3OGGA 2LIQA 2YUGA 5HREA 1S0LA 1R8NA 4Z9WB 4JP0A 4OEEA 5J2BA 4I4SA 3N7LA 4FGFA 4IG8A 4EBKA 5DB6A 4X4TA 1TOOA 9ICUA 4KLUA 1FMMS 3MALA 2Y9GA 8ICIA 1WBAA 3RSJA 3H6QA 4N7RA 4X4PA 5B3PA 3AH4A 4WBZA 3AQNA 3AU2A 2LIEA 1M2TB 2DRYA 4NM1A 1MIVA 4UAWA 4L4IA 1ISXA 1R8OA 2NS2A 5BQUA 5IIJA 4QKRA 3LLPA 5F2VO 1YLQA 2IHOA 2BCVA 4FHWA 1VFGA 4CJMA 3NBDA 4LO3C 4I2JA 1Z0HA 4LEVA 3O4AA 2E4MC 4XQ8A 4NKTA 5DDMA 4RQ2A 3V7KA 4OWKA 5CFTA 4I7IA 1RG8A 4E80A 1DQGA 8ICTA 1T9FA 4DOBA 3RJKA 2PBEA 2D7IA 1V6VA 2ESUA 2AQZA 4JLXA 3OJMA 2BE3A 4I2GA 5EC5A 4O69A 4MZHA 4H04A 3V7JA 4YCXA 1TP0A 2BPFA 3W9TA 5HRLA 9ICBA 2VU9A 2D24A 7ICNA 2HWAA 4ATBA 5J2JA 4ZBVB 4F5PA 8ICRA 4NLZA 4KLFA 3IM7A 3N0KA 3AQLA 4YD2A 4I2HA 3ZX7A 9ICAA 1TFYA 5DSSB 3CA5A 4EEDA 4IONA 1DJSB 4S3NA 7ICQA 3CAHA 1G9CA 4NXTA 3RJIA 1ZJNA 1ITBA 1PZZA 1MQ2A 2NP0A 1QQLA 4O5EA 3RMYA 3AKFA 4P4MA 4ZGRB 1WOTA 3CA6A 5CHEA 5IILA 4A7ZA 4WC3A 4QBCA 4O5KA 5E24E 1HCEA 2HWMA 1ZQMA 2ZH1A 4K97A 2D20A 1R89A 1MIWA 4RPXA 4II0A 4KLEA 3RJEA 3BADA 7ICVA 3N7JA 3PMLA 3LK9A 2BEAA 4G6MA 3T8SA 9ICTA 3RJFA 1BA7A 4AT8A 3LQCB 1ZQLA 4O68A 5DBBA 3OV7A 4USOA 5DECA 3RH5A 4EV6A 1ZQUA 2B51A 3C66A 1JTCA 4RQ4A 5J0WA 3CA3A 4I3NA 4DOCA 4GAIA 4IQWA 4JWNA 3HSMA 4NM2A 3D7WB 4F83A 4X4QA 4RQ1A 1SR4C 1BFCA 3F62B 1G9DA 1GPJA 4ISQA 5GAQA 5D4BA 3WO2A 2DR5A 2M2VA 7ICUA 1JQZA 4TUPA 1ZQWA 4I4VA 4JRAA 4OWLA 2GZBA 5BOMA 4QZGA 2B4VA 3V0BB 7ICEA 3RTIB 3POKA 5FZUA 1FGAA 2HZ9A 1UEUA 3ER8C 4XFTA 1QQKA 4TUSA 2GWSA 7ICLA 1DIWA 4I2FA 5J0QA 3JYYA 1Z4SA 3FJDA 3H3AA 4Q9PA 1FV2A 4EEEB 4QZBA 3JUTA 3VT0A 4KC3A 3ISDA 1AVXB 4HR6C 2D7RA 3C9ZA 4HJJA 4I0YA 3WO3A 4EFQA 3VT1A 4PHAA 2Q3NB 5J0RA 3AJ6A 3ERCC 3V0AA 5EHAA 4FH3A 3B9UA 4I4RA 4PGQA 4IQVA 5BXSA 3MCRA 3OVAA 4FVVA 4WC0A 4KLQA 4PHDA 1Q79A 1ZQZA 4KB6A 1D0HA 4WBCA 7ICSA 4M0AA 3RJJA 3P6IA 4QZDA 5IIIA 4K4GA 1JLXA 2ZH3A 3FJ8A 1ZQKA 8ICGA 1UPSA 3FJKA 4USPA 4EP7A 4I2IA 3PNCA 4F5OA 4I2DA 3P6JA 1KNYA 8ICVA 2NVHA 1BFGA 4NXVA 5D63A 4QZCA 5J2IA 5HC9A 4I1EA 3VEQA 4MF2A 4LZGA 2FFVA 3C2KA 4I28A 1K5VA 3FJIA 4GAFA 4XFUA 4QD2B 4A7YA 1HIBA 2KH2A 4P6AA 3H39A 4K9AA 9ICSA 3O44A 3AZVA 1JT4A 4P0JA 3ISBA 2FFUA 4WBYA 4JPZA 3N7MA 1AVUA 4EBJA 1ZQDA 2PFPA 4I2BA 4ZFWB 3QR5A 5J2GA 4OWJA 5HPZA 4UBCA 3B0YA 3HBWA 4I4PA 4K4HA 4DO9A 4TLPA 5JLVA 7ICKA 4QZ9A 9ICOA 3OVBA 2I1BA 4LO0C 4ZFUB 2X2TA 2ERMA 4GP3A 5J0SA 3NBNA 1DZCA 5DVHA 4K96A 4OAHA 4X0BA 3HJ1A 8ICMA 4XA5A 1CE7B 4RQ0A 4UBBA 1TFMB 4IHZA 2WRYA 4I29A 4RQ5A 2KLLA 4RWOA 5F8SA 2ZH5A 5J2HA 4J2XA 5B2HA 3MDCA 4G1RA 4EFPA 8ICXA 1IOBA 2F2FA 4AT8B 3FJCA 5BOWA 1NOMA 4G6JA 5BOLA 4LO7B 4NXZA 1Q1UA 4QO3A 5BXPA 1ONKB 5J2CA 3BRDA 9ILBA 4ZFYB 8ICPA 4I4YA 1S0BA 3SNVA 1A8DA 3UJ4A 3B0XA 3V0BA 4NKUA 4KEIA 1IRAX 2M2UA 2ZH2A 4RWNA 4GP0A 4UB1A 4P0KA 3IAGC 3H6RA 1Q78A 1BPXA 5IIMA 2D22A 3ZC9A 4O5CA 2D44A 1Z2VA 2DREA 3O4OA 1EVTA 4KLOA 4FHXA 4JQ0A 3VWCA 3UPQA 1VJ7A 3E8LC 4RWQA 3VSFA 5J2KA 3EF2A 1ZQPA 4D0TA 1QXMA 4ZOTA 4QALA 5EOZA 2DRBA 2DS0A 1I1BA 4F5QA 1AFCA 3WINC 1TVAA 3OGUA 8ICEA 3UQ2A 3TFSA 1Q04A 4WC2A 4F5RA 1XHBA 3AH2A 7ICMA 3IM6A 2QN4A 4NXXA 4UD5A 3NJ5A 3HOMA 1SZ6B 1HWMB 1MC9A 1NUNA 5DBCA 1TV9A 5D61A 3C2LA 1ZJMA 1V6UA 4RPZA 3V0AB 3JPNA 3A07A 2BBHA 4QZEA 4XUSA 4M47A 5FZYA 4I27A 1R8BA 2NZ9A 3BRGC 2BCRA 4UB3A 1JAJA 8ICFA 9ICFA 3BAQA 7ICIA 1W3GA 1W3AA 9ICMA 1JT7A 2FDBM 2BPGA 4PGYA 4QKSA 4I0UA 1HWOB 4LEYA 3BRFA 4XKIA 1V6WA 2DRAA 4R63A 4JAWA 4OW4A 4Z6DA 5HRIA 3WFOA 3WFSC 3BA7A 1RZTA 4M9NA 3A22A 4L4HA 3RJGA 5BXTA 1EV2A 4R65A 4QZHA 1F31A 1EYLA 3HX0A 2HN1A 4RT3A 1ABRB 4I2SA 3RJHA 2Y9WC 4KLGA 3BAVA 5FNXA 3KMVA 2MIBA 2M49A 3OUYB 2M2TA 2BCQA 4M9HA 3CRGA 3CRHA 9ICHA 3AU6A 1IILA 4MKPA 3FUQA 2ISPA 3BA5A 3UQ0A 4LO7C 1BPDA 3WFQE 1UEVA 3OWGA 9ICWA 3HJ4A 2AAIB 3H38A 2ZHAA 3NBCA 1XSLA 4I4OA 1TWMA 1WBCA 4Z6CA 4IZEA 4K4IA 3P53A 2IUBA 3FJJA 4LO2A 1F5AA 1BLAA 2ZR1B 3JPPA 4I2EA 2NTDA 3FUOA 4WC6A 4MFCA 1KDHA 4M2YA 1R8CA 1MIYA 3UXNA 1S0CA 4GOVA 3WMUA 4OAFA 2BCSA 3GDXA 3AKIA 3FJBA 4ZLBB 2Q66A 2GAFD 4NY8A 3UXPA 1BLDA 4X4OA 1ZQFA 4X4RA 4EB2B 2NM1A 3BAOA 3ILAA 9ICRA 1HUZA 4NXUA 4K99A 1ISWA 2Y9FA 4LVSA 1DLLA 1ISYA 4I2CA 3JPSA 4J2KA 1FWUA 1ZQOA 1YF8B 4LEZA 4R66A 1OQLB 1NO5A 1IHKA 4FHYA 4GOYA 2DR8A 5DUYA 1AXMA 4RQ7A 5F90A 1ZQYA 4KEJA 3H6RB 1G82A 3BA4A 3FJHA 4F34A 4TURA 2RFFA 3BAUA 4J2YA 3WFRE 2ZH6A 3PHZA 5HRDA 5I1BA 1DZDA 3BAGA 1S0EA 4QZIA 1TTUA 4F5NA 4RQ8A 3O4BA 3WO4A 4D8HA 5BP5C 4NXWA 5DEDA 3AZWA 4MFAA 4OEGA 3CU1B 4OEFA 9ICCA 4M9JA 4AN7B 7I1BA 5J0OA 4PPXA 3R4SA 2O5AA 3JPOA 3JZ0A 4LO8B 3TC2A 2QYIB 4OAIZ 1ZQSA 2FO1A 3OGFA 4MF8A 2IHMA 4EFRA 2F8XC 5HRBA 2XOAA 1XSNA 5D62A 3BTAA 3NYBA 9ICKA 1DFCA 3LTQA 4FHPA 3RMXA 4KLIA 1BPYA 3H6SE 5CFSA 1ZQEA 5J0UA 8ICYA 1HKNA 1N4KA 3FJEA 1W3FA 1BPEA 4UAYA 1ZQGA 5CB1A 4Z6EA 3F1RA 4XFSA 5J2AA 7ICFA 7ICPA 1BPZA 1ZQBA 3ZXGA 1V4AA
chains in the Genus database with same CATH topology
2VSAA 3IM7A 3N0KA 4P0KA 3UD7A 4MZFB 5EG6C 3ZX7A 3IAGC 3H6RA 4OAGA 2VSEA 2D22A 3ZC9A 2Z49A 1S0DA 1JT5A 1KNMA 1G9AA 1NZKA 5DSSB 3CRIA 2D44A 2IWTB 1Z2VA 4HA2A 1AF9A 3CA5A 2DREA 3O4OA 4IONA 3IM5A 1DJSB 1PWAA 1EVTA 3CAHA 3UD9A 1SR4A 4I4UA 2EWRA 1G9CA 4NXTA 4JQ0A 4DCKC 3VWCA 1ISZA 1ITBA 1Q03A 1PZZA 3E8LC 3CA0A 3PG0A 3VSFA 2NP0A 4IY8A 1QQLA 3RMYA 3AKFA 2FCLA 4I37A 4ZGRB 3EF2A 4D0TA 1L2HA 1QXMA 3K1XA 3CA6A 4ZOTA 1YBIA 5CHEA 4QALA 2DS0A 3R4UA 4H75A 4A7ZA 1I1BA 5FZZA 1PC8B 4PC4A 1AFCA 3CA4A 4QBCA 4UY4A 3WINC 1G9BA 5E24E 4I4XA 1HCEA 2F2FC 1Q04A 2HWMA 4I1BA 2GA9D 1XHBA 3AH2A 3IM6A 4K97A 2D20A 2QN4A 4NXXA 3O5WB 3NJ5A 3HOMA 1S0FA 1SZ6B 3OJVA 1HWMB 1MC9A 3HN1A 4H9WA 4II0A 1NUNA 1YTOA 3BADA 3N7JA 3VUOA 3Q7XA 2BEAA 4G6MA 3T8SA 5D61A 4J23B 5CFUA 1BASA 4FO1A 1V6UA 4DENA 3V0AB 2ZQOA 1BA7A 3WA1A 3A07A 4O68A 2KI6B 1J0SA 2RG9B 4USOA 3V79C 3S8JA 2B51A 41BIA 5FZYA 1JTCA 1RMLA 3QYDA 1FQ9A 2NZ9A 3BRGC 2FGFA 4LEWA 3CA3A 4I8MA 3ZC8A 4Z8SB 5F8WA 5BP5A 4I3NA 1MD6A 1FN0A 3BAQA 1HWPB 4Q9GA 3OJ2A 4GAIA 4ZA3B 2KKIA 1W3GA 1W3AA 5DZUA 1JT7A 1XG6A 5G00A 3A21A 2FDBM 3HSMA 4WH5A 3BAHA 3D7WB 4QKSA 1HWOB 4LEYA 3BRFA 4XKIA 1V6WA 1BFFA 4F83A 3O4CA 1T4QA 4JAWA 2D43A 4O6AA 3Q7WA 2ET2A 4OW4A 3BB2A 3UDAA 1SR4C 3NBEA 1BFCA 2WBCA 4K9BA 1BFBA 2K4AB 4X37A 3F62B 1TWEA 3BA7A 1G9DA 1GPJA 4ISQA 3CQAA 5GAQA 2KI4A 5B3QA 3WO2A 3UJ0A 1JQZA 3A22A 4I4VA 4G9MA 4JRAA 4L4HA 4OWLA 2GZBA 4LO1A 5BXTA 3ER9B 3K7DA 2B4VA 1HWNB 1EV2A 4XJEA 3FJFA 3V0BB 2R9KB 4KM5A 5BQUC 3RTIB 3AKHA 3POKA 5FZUA 1FGAA 1F31A 4Q91A 1EYLA 2HZ9A 3MPPG 3ER8C 1FV3A 1ABRB 4I2SA 4XFTA 4ENDA 3N7KA 2DRZA 4DEPA 1IJTA 2Y9WC 3BAVA 1QQKA 1RZOB 3I2XA 5FNXA 3KMVA 2MIBA 2M49A 1K5UA 1DIWA 4IY9A 4AN6A 2RSTA 3FFZA 1Z4SA 3FJDA 2D1ZA 2B56A 3CRGA 3CRHA 4Q9PA 5BVPI 1I1EA 1FV2A 4EEEB 4OUJA 2HW9A 3JUTA 3VT0A 2Y9XE 1IILA 4MKPA 1IT0A 4KC3A 1AVXB 3FUQA 3BA5A 4WQKA 4HR6C 4J2SA 4LO7C 4IZXA 1YXWA 2D7RA 3OWGA 2P39A 3WMVA 2K43A 3C9ZA 21BIA 4HJJA 4MZGB 4I0YA 1FMZA 3WO3A 4EFQA 3VT1A 1M16A 1BARA 2AAIB 1DQOA 2Q3NB 4WOYA 3NBCA 1TIEA 4I4OA 1TWMA 1S0GA 3AJ6A 3ERCC 3V0AA 1WBCA 3RTJB 5EHAA 3JRRA 3B9UA 2D23A 4IZEA 1EPWA 3O3QA 4I4RA 1FWVA 2BFHA 2VLCA 3P53A 3FJJA 4I6IA 5BXSA 1YYNA 4LO2A 3I2AA 4QD2C 3MCRA 3VT2A 1ILR1 1BLAA 4FVVA 2ZR1B 2NTDA 1AVWB 2K8RA 3FUOA 4KB6A 6I1BA 1D0HA 3I29B 4WBCA 4I96A 1JT3A 3FJAA 2VXTI 3P6IA 3PUBA 4LO0A 1XZZA 4G9NA 2Q9XA 5BXRA 1JLXA 1S0CA 2MLLB 1WD3A 2RQ9A 2ZQNA 2BEBA 3A23A 3FJ8A 4GOVA 4KBBA 3WMUA 4OAFA 3CA1A 3WINA 1UPSA 3FJKA 3AKIA 4USPA 2VUAA 4LO1C 3FJBA 2MC2A 4ZLBB 4LO3A 2GAFD 1ISVA 1PUMB 2Z48A 3NKUA 3O4DA 3O49A 3P6JA 4JKQA 3AH1A 1BLDA 2E4MA 2NVHA 3VSZA 4KEKA 1DFQA 2GO2A 1BFGA 3HALA 5D63A 4NXVA 3OBRA 4I1EA 3VEQA 4EB2B 1II4A 2NM1A 3BAOA 3ILAA 3Q7YA 4K98A 2FFVA 4NXUA 1IRPA 4K99A 1ISWA 2Y9FA 4X38A 1CVSA 5FNWA 4HX0A 4O67A 2NYYA 3FGMA 1DLLA 3FJ9A 3S8KA 1K5VA 3FJIA 3IIRA 4GAFA 4QC4A 1ISYA 1V6XA 4ISRA 4XFUA 1WD4A 1JY0A 2L5XA 3OGGA 4J2KA 4QD2B 1FWUA 4A7YA 1HIBA 4A7KA 1YF8B 2KH2A 4P6AA 2LIQA 4K9AA 4LEZA 3O44A 3AZVA 2YUGA 1S0LA 1JT4A 2J3PA 4X39A 1R8NA 4Z9WB 4P0JA 1OQLB 4JP0A 4OEEA 2FFUA 4I4SA 3N7LA 1IHKA 4GOYA 1XYFA 4IYBA 4JPZA 3N7MA 4FGFA 4D0ZA 1AVUA 5DUYA 1AXMA 5F90A 1TOOA 4KEJA 3H6RB 2UUSA 1G82A 3BA4A 1FMMS 3FJHA 4F34A 4ZFWB 3QR5A 3AJ5A 2Y9GA 3BAUA 3MALA 3PMEA 4J2YA 4OWJA 5HPZA 3HBWA 1WBAA 4I4PA 4K8VA 3RSJA 3H6QA 4N7RA 4LO2C 3PHZA 3OBTA 5B3PA 8I1BA 4TLPA 5I1BA 5JLVA 1DZDA 3AH4A 3BAGA 1S0EA 2LIEA 2I1BA 4LO0C 4ZFUB 1TTUA 2X2TA 2ERMA 1M2TB 3O4BA 2DRYA 4JKXB 3WO4A 4D8HA 5BP5C 1AVAC 4GP3A 4NXWA 4L4IA 1ISXA 1R8OA 2NS2A 3AZWA 5BQUA 3NBNA 4YOLA 1DZCA 2VXRA 4QKRA 4JLZA 3LLPA 5DVHA 4K96A 4OEGA 3CU1B 2AXMA 2IHOA 4CJMA 4OAHA 4OEFA 1VCLA 3NBDA 2P23A 4LO3C 4AN7B 4EKXB 1Z0HA 3HMYA 7I1BA 4LEVA 3R4SA 1CE7B 3O4AA 2E4MC 31BIA 4LO8B 3TC2A 4I4QA 1TFMB 4IHZA 5JMCA 3UD8A 2QYIB 2WRYA 4OWKA 4OAIZ 5F8YA 2FO1A 2KLLA 1RG8A 4I7IA 5CFTA 3OGFA 5F8SA 2X2SA 1DQGA 4J2XA 4EFRA 2F8XC 5B2HA 1T9FA 2XOAA 5D62A 3BTAA 4G1RA 1PUUB 2AFGA 1JLYA 1RY7A 4EFPA 1DFCA 1HCDA 1IOBA 2F2FA 2D7IA 4P0LA 3LTQA 1V6VA 3BX1C 3RMXA 3FJCA 5BOWA 3ZXDA 4G6JA 2ESUA 4LO7B 3H6SE 2AQZA 1Q1UA 5CFSA 4JLXA 3OJMA 4QO3A 5BXPA 1ONKB 4ZKTB 1HKNA 3AKGA 1N4KA 3FJEA 4X3AA 1W3FA 9ILBA 3BRDA 4ZFYB 5EC5A 4I4YA 4O69A 1S0BA 1GGPB 3SNVA 4MZHA 4QBVA 4H04A 1A8DA 3UJ4A 3F1RA 4XFSA 1TP0A 3V0BA 3W9TA 4KEIA 2VU9A 4IQPA 1IRAX 2D24A 2HWAA 4R6UB 4WQLA 1E0OA 1P63A 4ZBVB 3ZXGA 4GP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSA A;  3IM7 A;  3N0K A;  4P0K A;  3UD7 A;  5EG6 C;  3ZX7 A;  3IAG C;  3H6R A;  2VSE A;  2D22 A;  3ZC9 A;  2Z49 A;  1S0D A;  1JT5 A;  1KNM A;  1G9A A;  1NZK A;  5DSS B;  3CRI A;  2D44 A;  2IWT B;  1Z2V A;  4HA2 A;  1AF9 A;  3CA5 A;  2DRE A;  3O4O A;  4ION A;  3IM5 A;  1DJS B;  1PWA A;  1EVT A;  3CAH A;  3UD9 A;  1SR4 A;  4I4U A;  1G9C A;  4JQ0 A;  4DCK C;  3VWC A;  1ISZ A;  1ITB A;  1Q03 A;  1PZZ A;  3E8L C;  3CA0 A;  3PG0 A;  3VSF A;  2NP0 A;  4IY8 A;  1QQL A;  3RMY A;  3AKF A;  4I37 A;  4ZGR B;  3EF2 A;  4D0T A;  1L2H A;  1QXM A;  3K1X A;  3CA6 A;  4ZOT A;  1YBI A;  4QAL A;  2DS0 A;  3R4U A;  4A7Z A;  1I1B A;  5FZZ A;  1PC8 B;  4PC4 A;  1AFC A;  3CA4 A;  4QBC A;  3WIN C;  1G9B A;  5E24 E;  4I4X A;  1HCE A;  2F2F C;  1Q04 A;  2HWM A;  4I1B A;  1XHB A;  3AH2 A;  3IM6 A;  2D20 A;  2QN4 A;  3O5W B;  3NJ5 A;  3HOM A;  1S0F A;  1SZ6 B;  3OJV A;  1HWM B;  1MC9 A;  3HN1 A;  4H9W A;  4II0 A;  1NUN A;  1YTO A;  3BAD A;  3N7J A;  3VUO A;  3Q7X A;  2BEA A;  4G6M A;  3T8S A;  5D61 A;  4J23 B;  1BAS A;  1V6U A;  4DEN A;  3V0A B;  2ZQO A;  1BA7 A;  3WA1 A;  3A07 A;  2KI6 B;  1J0S A;  2RG9 B;  4USO A;  3V79 C;  3S8J A;  41BI A;  5FZY A;  1JTC A;  1RML A;  3QYD A;  1FQ9 A;  2NZ9 A;  3BRG C;  2FGF A;  3CA3 A;  4I8M A;  3ZC8 A;  4Z8S B;  5F8W A;  5BP5 A;  4I3N A;  1MD6 A;  1FN0 A;  3BAQ A;  1HWP B;  4Q9G A;  3OJ2 A;  4GAI A;  4ZA3 B;  2KKI A;  1W3G A;  1W3A A;  5DZU A;  1JT7 A;  1XG6 A;  5G00 A;  3A21 A;  2FDB M;  3HSM A;  3BAH A;  3D7W B;  4QKS A;  1HWO B;  3BRF A;  4XKI A;  1V6W A;  1BFF A;  4F83 A;  3O4C A;  1T4Q A;  4JAW A;  2D43 A;  3Q7W A;  2ET2 A;  4OW4 A;  3BB2 A;  3UDA A;  1SR4 C;  3NBE A;  1BFC A;  2WBC A;  1BFB A;  2K4A B;  4X37 A;  3F62 B;  1TWE A;  3BA7 A;  1G9D A;  4ISQ A;  3CQA A;  5GAQ A;  2KI4 A;  3WO2 A;  3UJ0 A;  1JQZ A;  3A22 A;  4I4V A;  4G9M A;  4JRA A;  4L4H A;  4OWL A;  2GZB A;  4LO1 A;  5BXT A;  1HWN B;  1EV2 A;  3FJF A;  3V0B B;  2R9K B;  5BQU C;  3RTI B;  3AKH A;  3POK A;  5FZU A;  1FGA A;  1F31 A;  4Q91 A;  1EYL A;  2HZ9 A;  3MPP G;  1FV3 A;  1ABR B;  4I2S A;  4XFT A;  4END A;  3N7K A;  2DRZ A;  4DEP A;  1IJT A;  2Y9W C;  3BAV A;  1QQK A;  1RZO B;  3I2X A;  5FNX A;  3KMV A;  2MIB A;  2M49 A;  1K5U A;  1DIW A;  4IY9 A;  4AN6 A;  2RST A;  3FFZ A;  1Z4S A;  3FJD A;  2D1Z A;  3CRG A;  3CRH A;  4Q9P A;  5BVP I;  1I1E A;  1FV2 A;  4EEE B;  4OUJ A;  2HW9 A;  3JUT A;  3VT0 A;  2Y9X E;  1IIL A;  1IT0 A;  4KC3 A;  1AVX B;  3FUQ A;  3BA5 A;  4HR6 C;  4J2S A;  4LO7 C;  4IZX A;  1YXW A;  2D7R A;  2P39 A;  3WMV A;  2K43 A;  3C9Z A;  21BI A;  4HJJ A;  4I0Y A;  1FMZ A;  3WO3 A;  4EFQ A;  3VT1 A;  1M16 A;  1BAR A;  2AAI B;  1DQO A;  2Q3N B;  3NBC A;  1TIE A;  4I4O A;  1TWM A;  1S0G A;  3AJ6 A;  3V0A A;  1WBC A;  3RTJ B;  5EHA A;  3JRR A;  3B9U A;  2D23 A;  4IZE A;  1EPW A;  3O3Q A;  4I4R A;  1FWV A;  2BFH A;  2VLC A;  3P53 A;  3FJJ A;  4I6I A;  5BXS A;  1YYN A;  4LO2 A;  3I2A A;  4QD2 C;  3VT2 A;  1ILR 1;  1BLA A;  4FVV A;  2ZR1 B;  2NTD A;  1AVW B;  2K8R A;  3FUO A;  6I1B A;  1D0H A;  3I29 B;  4WBC A;  4I96 A;  1JT3 A;  3FJA A;  2VXT I;  3P6I A;  3PUB A;  4LO0 A;  1XZZ A;  4G9N A;  2Q9X A;  5BXR A;  1JLX A;  1S0C A;  2MLL B;  1WD3 A;  2RQ9 A;  2ZQN A;  2BEB A;  3A23 A;  3FJ8 A;  4GOV A;  4KBB A;  3WMU A;  3CA1 A;  3WIN A;  1UPS A;  3FJK A;  3AKI A;  4USP A;  2VUA A;  4LO1 C;  3FJB A;  2MC2 A;  4ZLB B;  4LO3 A;  1ISV A;  1PUM B;  2Z48 A;  3O4D A;  3O49 A;  3P6J A;  4JKQ A;  3AH1 A;  1BLD A;  2E4M A;  2NVH A;  3VSZ A;  4KEK A;  1DFQ A;  2GO2 A;  1BFG A;  3HAL A;  5D63 A;  3OBR A;  4I1E A;  3VEQ A;  4EB2 B;  1II4 A;  2NM1 A;  3BAO A;  3ILA A;  3Q7Y A;  2FFV A;  1IRP A;  1ISW A;  2Y9F A;  4X38 A;  1CVS A;  5FNW A;  2NYY A;  3FGM A;  1DLL A;  3FJ9 A;  3S8K A;  1K5V A;  3FJI A;  3IIR A;  4GAF A;  4QC4 A;  1ISY A;  1V6X A;  4ISR A;  4XFU A;  1WD4 A;  1JY0 A;  2L5X A;  3OGG A;  4J2K A;  4QD2 B;  1FWU A;  4A7Y A;  1HIB A;  4A7K A;  1YF8 B;  2KH2 A;  4P6A A;  2LIQ A;  3O44 A;  3AZV A;  2YUG A;  1S0L A;  1JT4 A;  2J3P A;  4X39 A;  1R8N A;  4Z9W B;  4P0J A;  1OQL B;  4JP0 A;  4OEE A;  2FFU A;  4I4S A;  3N7L A;  1IHK A;  4GOY A;  1XYF A;  4IYB A;  4JPZ A;  3N7M A;  4FGF A;  4D0Z A;  1AVU A;  5DUY A;  1AXM A;  5F90 A;  1TOO A;  4KEJ A;  3H6R B;  2UUS A;  1G82 A;  3BA4 A;  1FMM S;  3FJH A;  4F34 A;  4ZFW B;  3QR5 A;  3AJ5 A;  2Y9G A;  3BAU A;  3MAL A;  3PME A;  4J2Y A;  4OWJ A;  5HPZ A;  3HBW A;  1WBA A;  4I4P A;  3RSJ A;  3H6Q A;  4LO2 C;  3PHZ A;  3OBT A;  8I1B A;  4TLP A;  5I1B A;  5JLV A;  1DZD A;  3AH4 A;  3BAG A;  1S0E A;  2LIE A;  2I1B A;  4LO0 C;  4ZFU B;  1TTU A;  2X2T A;  2ERM A;  1M2T B;  3O4B A;  2DRY A;  4JKX B;  3WO4 A;  4D8H A;  5BP5 C;  1AVA C;  4GP3 A;  4L4I A;  1ISX A;  1R8O A;  3AZW A;  3NBN A;  5BQU A;  1DZC A;  4YOL A;  2VXR A;  4QKR A;  3LLP A;  5DVH A;  4OEG A;  3CU1 B;  2AXM A;  2IHO A;  4CJM A;  4OEF A;  1VCL A;  3NBD A;  2P23 A;  4LO3 C;  4AN7 B;  4EKX B;  1Z0H A;  3HMY A;  7I1B A;  3R4S A;  1CE7 B;  3O4A A;  2E4M C;  31BI A;  4LO8 B;  3TC2 A;  4I4Q A;  1TFM B;  4IHZ A;  5JMC A;  3UD8 A;  2QYI B;  2WRY A;  4OWK A;  5F8Y A;  2FO1 A;  2KLL A;  1RG8 A;  4I7I A;  3OGF A;  5F8S A;  2X2S A;  1DQG A;  4J2X A;  4EFR A;  2F8X C;  5B2H A;  1T9F A;  2XOA A;  5D62 A;  3BTA A;  4G1R A;  1PUU B;  2AFG A;  1JLY A;  1RY7 A;  4EFP A;  1DFC A;  1HCD A;  1IOB A;  2F2F A;  2D7I A;  4P0L A;  3LTQ A;  1V6V A;  3BX1 C;  3RMX A;  3FJC A;  5BOW A;  3ZXD A;  4G6J A;  2ESU A;  4LO7 B;  3H6S E;  2AQZ A;  1Q1U A;  3OJM A;  4QO3 A;  5BXP A;  1ONK B;  4ZKT B;  1HKN A;  3AKG A;  1N4K A;  3FJE A;  4X3A A;  1W3F A;  9ILB A;  3BRD A;  4ZFY B;  5EC5 A;  4I4Y A;  1S0B A;  1GGP B;  3SNV A;  4QBV A;  4H04 A;  1A8D A;  3UJ4 A;  3F1R A;  4XFS A;  1TP0 A;  3V0B A;  3W9T A;  4KEI A;  2VU9 A;  4IQP A;  1IRA X;  2D24 A;  2HWA A;  4R6U B;  1E0O A;  1P63 A;  4ZBV B;  3ZXG A;  4GP0 A; 
#chains in the Genus database with same CATH topology
 2VSA A;  4GXI A;  3OUY A;  4MZF B;  5EG6 C;  3NWI A;  4P4P A;  2BBJ A;  8ICJ A;  4OAG A;  2VSE A;  1S0D A;  1JT5 A;  1R8A A;  1G9A A;  2VAN A;  4MFF A;  4GXJ A;  1AF9 A;  8ICU A;  4X0A A;  3JPT A;  3UD9 A;  5J2E A;  2ZH8 A;  9ICL A;  1Q03 A;  5HRH A;  4X4U A;  2ZH9 A;  3CA0 A;  4UD4 A;  3PG0 A;  4AT9 A;  5CHG A;  4IY8 A;  4DOA A;  3TFR A;  4GXK A;  1L2H A;  1YBI A;  2ZH4 A;  2O1P A;  3R4U A;  4H75 A;  5FZZ A;  1G9B A;  2F2F C;  2GA9 D;  9ICI A;  3O5W B;  1S0F A;  3OJV A;  4UB4 A;  5J29 A;  3VUO A;  4J23 B;  4FO1 A;  2ZQO A;  8ICN A;  4P2H A;  1ZQJ A;  2KI6 B;  1J0S A;  2PFQ A;  2P66 A;  5JTG A;  2PXI A;  2FGF A;  4LEW A;  4I8M A;  4Z8S B;  5F8W A;  1MD6 A;  1FN0 A;  1HWP B;  4Q9G A;  4IQU A;  4YMN A;  4ZA3 B;  5DZU A;  1XG6 A;  5G00 A;  4JWM A;  3A21 A;  4WH5 A;  4R64 A;  4X5V A;  4EEB A;  3Q7W A;  2ET2 A;  7ICG A;  4M9L A;  3AQK A;  2K4A B;  4X37 A;  3CQA A;  2KI4 A;  5CA7 A;  4G9M A;  4LO1 A;  3ER9 B;  3FJF A;  2W9M A;  4KM5 A;  5BQU C;  3AKH A;  4Q91 A;  4IQT A;  9ICP A;  4END A;  4YN4 A;  3N7K A;  4X4N A;  4DEP A;  1IJT A;  1RZO B;  4KLD A;  3WFP A;  1K5U A;  4AN6 A;  2RST A;  4WC7 A;  3V72 A;  3FFZ A;  4PGX A;  2HHP A;  4KLH A;  5J2F A;  5BVP I;  4OUJ A;  2HW9 A;  2Y9X E;  1ZQN A;  4WQK A;  4J2S A;  3UXO A;  4IZX A;  1YXW A;  4PHP A;  2P39 A;  3WMV A;  2K43 A;  21BI A;  3OVS A;  5CP2 A;  3PMN A;  1M16 A;  1BAR A;  4WOY A;  1TIE A;  5HR9 A;  3RTJ B;  2D23 A;  1EPW A;  3O3Q A;  4M9G A;  2FMQ A;  4I2A A;  1YYN A;  3I2A A;  4QD2 C;  1PX5 A;  3VT2 A;  4RT2 A;  4M04 A;  5DB8 A;  6I1B A;  8ICB A;  2ZH7 A;  5D46 A;  1RPL A;  1JT3 A;  3AUO A;  8ICO A;  3PUB A;  8ICW A;  2Q9X A;  5BXR A;  2ZQN A;  2RQ9 A;  3A23 A;  1ZQX A;  3CA1 A;  5BPC A;  3WIN A;  2DVI A;  3HW8 A;  3V7L A;  1TFW A;  2MC2 A;  4LO3 A;  1ISV A;  1PUM B;  3NKU A;  3O4D A;  3O49 A;  5DKW A;  4FH5 A;  3AH1 A;  2E4M A;  3VSZ A;  4KEK A;  1DFQ A;  2GO2 A;  3HAL A;  4X4V A;  4PH5 A;  3Q7Y A;  4KLS A;  5DB9 A;  1CVS A;  4HX0 A;  3FGM A;  3S8K A;  3IIR A;  5J0P A;  4AT7 A;  3K75 D;  4XRH A;  1V6X A;  4ISR A;  1WD4 A;  1ZQQ A;  4E8F A;  4WC4 A;  4A7K A;  1ZQH A;  4X39 A;  2J3P A;  4QZ8 A;  1XYF A;  4IYB A;  4D0Z A;  3RH4 A;  1HUO A;  4KLM A;  4TUQ A;  2UUS A;  3AJ5 A;  3PME A;  4K8V A;  4LO2 C;  3OBT A;  4Z6F A;  8I1B A;  4UAZ A;  4FO6 A;  4NLN A;  4AT9 B;  1MQ3 A;  1OU5 A;  4JKX B;  1AVA C;  8ICL A;  3MDA A;  3H37 A;  4YOL A;  2HN2 A;  2VXR A;  4JLZ A;  2AXM A;  4RQ6 A;  8ICK A;  1VCL A;  2P23 A;  1ZQT A;  4EKX B;  3HMY A;  31BI A;  4I4Q A;  4YD1 A;  5HHH A;  5JMC A;  3UD8 A;  9ICE A;  5F8Y A;  2X2S A;  1JN3 A;  1XSP A;  9ICQ A;  1PUU B;  2AFG A;  1JLY A;  1RY7 A;  4EGW A;  1HCD A;  3MGH A;  2NRK A;  4P0L A;  3BX1 C;  3ZXD A;  3JPR A;  5CR0 A;  2I9G A;  4ZKT B;  3AKG A;  4X3A A;  5DB7 A;  1GGP B;  4QBV A;  3RH6 A;  5D49 A;  4UB2 A;  4IQP A;  4R6U B;  4WQL A;  1E0O A;  1P63 A;  5J0X A;  4PHE A;  8ICC A;  3UD7 A;  4NLK A;  8ICS A;  2ID1 A;  2Z49 A;  1KNM A;  4E7X A;  1NZK A;  3CRI A;  2PFN A;  2IWT B;  4HA2 A;  3IM5 A;  1PWA A;  3MGI A;  1SR4 A;  4I4U A;  2EWR A;  4DCK C;  1ISZ A;  5HHI A;  2FCL A;  4I37 A;  4KLJ A;  3K1X A;  3HWT A;  8ICA A;  1PC8 B;  4PC4 A;  1JQR A;  3CA4 A;  4UY4 A;  1JMS A;  4QZF A;  1ZQR A;  4I4X A;  4KLL A;  4I1B A;  7ICH A;  7ICJ A;  5IIN A;  4WC1 A;  3HN1 A;  4H9W A;  1YTO A;  3C18 A;  3Q7X A;  8ICH A;  1UET A;  5CFU A;  1BAS A;  4DEN A;  5TZV A;  3WA1 A;  9ICX A;  4P4O A;  4RPY A;  2RG9 B;  5J0Y A;  3V79 C;  3S8J A;  41BI A;  1RML A;  3QYD A;  3HIY A;  3L9D A;  1FQ9 A;  4M5D A;  3UPS A;  3ZC8 A;  5BP5 A;  1ZQC A;  1ZQI A;  4X4S A;  3OJ2 A;  2KKI A;  3JPQ A;  1KEJ A;  3BAH A;  1ZQV A;  1BFF A;  4RWP A;  3O4C A;  1T4Q A;  4YMO A;  5DBA A;  2D43 A;  4O6A A;  3UDA A;  4UB5 A;  3BB2 A;  9ICV A;  3NBE A;  2WBC A;  4K9B A;  1BFB A;  1TWE A;  2PFO A;  5CJ7 A;  5B3Q A;  3UJ0 A;  3NVO A;  1BPB A;  5HRF A;  9ICJ A;  3C5G A;  3K7D A;  1HWN B;  4RQ3 A;  4XJE A;  5J2D A;  1FA0 A;  2R9K B;  4AT7 B;  9ICN A;  3AQM A;  4ATB B;  5IIK A;  3MPP G;  1FV3 A;  3JCF A;  2DRZ A;  2ISO A;  3I2X A;  2DR9 A;  7ICT A;  4IY9 A;  4XQ7 A;  3ISC A;  8ICQ A;  2D1Z A;  2B56 A;  1I1E A;  1IT0 A;  5CWR A;  3MBY A;  2BPC A;  4MZG B;  4FHV A;  1FMZ A;  1DQO A;  3CK6 A;  4O9M A;  4WCW A;  4WC5 A;  1S0G A;  5DDY A;  3JRR A;  7ICO A;  5HRG A;  1FWV A;  2BFH A;  2VLC A;  5HRK A;  8ICZ A;  4I6I A;  2M2W A;  1ILR 1;  1AVW B;  2K8R A;  7ICR A;  3I29 B;  5IIO A;  4LZD A;  4I96 A;  3FJA A;  2VXT I;  3C5F A;  3C2M A;  4LO0 A;  1XZZ A;  4G9N A;  4KLT A;  2MLL B;  1WD3 A;  4KBB A;  2BEB A;  4LT6 A;  2BCU A;  4YMM A;  2VUA A;  4LO1 C;  2Z48 A;  4JKQ A;  5J0T A;  3OBR A;  2ZHB A;  1II4 A;  4K98 A;  4QZA A;  2DR7 A;  1IRP A;  4X38 A;  4O67 A;  5FNW A;  2NYY A;  3FJ9 A;  2FMS A;  9ICG A;  1ZQA A;  4QC4 A;  2FMP A;  1JY0 A;  2L5X A;  3OGG A;  2LIQ A;  2YUG A;  5HRE A;  1S0L A;  1R8N A;  4Z9W B;  4JP0 A;  4OEE A;  5J2B A;  4I4S A;  3N7L A;  4FGF A;  4IG8 A;  4EBK A;  5DB6 A;  4X4T A;  1TOO A;  9ICU A;  4KLU A;  1FMM S;  3MAL A;  2Y9G A;  8ICI A;  1WBA A;  3RSJ A;  3H6Q A;  4N7R A;  4X4P A;  5B3P A;  3AH4 A;  4WBZ A;  3AQN A;  3AU2 A;  2LIE A;  1M2T B;  2DRY A;  4NM1 A;  1MIV A;  4UAW A;  4L4I A;  1ISX A;  1R8O A;  2NS2 A;  5BQU A;  5IIJ A;  4QKR A;  3LLP A;  5F2V O;  1YLQ A;  2IHO A;  2BCV A;  4FHW A;  1VFG A;  4CJM A;  3NBD A;  4LO3 C;  4I2J A;  1Z0H A;  4LEV A;  3O4A A;  2E4M C;  4XQ8 A;  4NKT A;  5DDM A;  4RQ2 A;  3V7K A;  4OWK A;  5CFT A;  4I7I A;  1RG8 A;  4E80 A;  1DQG A;  8ICT A;  1T9F A;  4DOB A;  3RJK A;  2PBE A;  2D7I A;  1V6V A;  2ESU A;  2AQZ A;  4JLX A;  3OJM A;  2BE3 A;  4I2G A;  5EC5 A;  4O69 A;  4MZH A;  4H04 A;  3V7J A;  4YCX A;  1TP0 A;  2BPF A;  3W9T A;  5HRL A;  9ICB A;  2VU9 A;  2D24 A;  7ICN A;  2HWA A;  4ATB A;  5J2J A;  4ZBV B;  4F5P A;  8ICR A;  4NLZ A;  4KLF A;  3IM7 A;  3N0K A;  3AQL A;  4YD2 A;  4I2H A;  3ZX7 A;  9ICA A;  1TFY A;  5DSS B;  3CA5 A;  4EED A;  4ION A;  1DJS B;  4S3N A;  7ICQ A;  3CAH A;  1G9C A;  4NXT A;  3RJI A;  1ZJN A;  1ITB A;  1PZZ A;  1MQ2 A;  2NP0 A;  1QQL A;  4O5E A;  3RMY A;  3AKF A;  4P4M A;  4ZGR B;  1WOT A;  3CA6 A;  5CHE A;  5IIL A;  4A7Z A;  4WC3 A;  4QBC A;  4O5K A;  5E24 E;  1HCE A;  2HWM A;  1ZQM A;  2ZH1 A;  4K97 A;  2D20 A;  1R89 A;  1MIW A;  4RPX A;  4II0 A;  4KLE A;  3RJE A;  3BAD A;  7ICV A;  3N7J A;  3PML A;  3LK9 A;  2BEA A;  4G6M A;  3T8S A;  9ICT A;  3RJF A;  1BA7 A;  4AT8 A;  3LQC B;  1ZQL A;  4O68 A;  5DBB A;  3OV7 A;  4USO A;  5DEC A;  3RH5 A;  4EV6 A;  1ZQU A;  2B51 A;  3C66 A;  1JTC A;  4RQ4 A;  5J0W A;  3CA3 A;  4I3N A;  4DOC A;  4GAI A;  4IQW A;  4JWN A;  3HSM A;  4NM2 A;  3D7W B;  4F83 A;  4X4Q A;  4RQ1 A;  1SR4 C;  1BFC A;  3F62 B;  1G9D A;  1GPJ A;  4ISQ A;  5GAQ A;  5D4B A;  3WO2 A;  2DR5 A;  2M2V A;  7ICU A;  1JQZ A;  4TUP A;  1ZQW A;  4I4V A;  4JRA A;  4OWL A;  2GZB A;  5BOM A;  4QZG A;  2B4V A;  3V0B B;  7ICE A;  3RTI B;  3POK A;  5FZU A;  1FGA A;  2HZ9 A;  1UEU A;  3ER8 C;  4XFT A;  1QQK A;  4TUS A;  2GWS A;  7ICL A;  1DIW A;  4I2F A;  5J0Q A;  3JYY A;  1Z4S A;  3FJD A;  3H3A A;  4Q9P A;  1FV2 A;  4EEE B;  4QZB A;  3JUT A;  3VT0 A;  4KC3 A;  3ISD A;  1AVX B;  4HR6 C;  2D7R A;  3C9Z A;  4HJJ A;  4I0Y A;  3WO3 A;  4EFQ A;  3VT1 A;  4PHA A;  2Q3N B;  5J0R A;  3AJ6 A;  3ERC C;  3V0A A;  5EHA A;  4FH3 A;  3B9U A;  4I4R A;  4PGQ A;  4IQV A;  5BXS A;  3MCR A;  3OVA A;  4FVV A;  4WC0 A;  4KLQ A;  4PHD A;  1Q79 A;  1ZQZ A;  4KB6 A;  1D0H A;  4WBC A;  7ICS A;  4M0A A;  3RJJ A;  3P6I A;  4QZD A;  5III A;  4K4G A;  1JLX A;  2ZH3 A;  3FJ8 A;  1ZQK A;  8ICG A;  1UPS A;  3FJK A;  4USP A;  4EP7 A;  4I2I A;  3PNC A;  4F5O A;  4I2D A;  3P6J A;  1KNY A;  8ICV A;  2NVH A;  1BFG A;  4NXV A;  5D63 A;  4QZC A;  5J2I A;  5HC9 A;  4I1E A;  3VEQ A;  4MF2 A;  4LZG A;  2FFV A;  3C2K A;  4I28 A;  1K5V A;  3FJI A;  4GAF A;  4XFU A;  4QD2 B;  4A7Y A;  1HIB A;  2KH2 A;  4P6A A;  3H39 A;  4K9A A;  9ICS A;  3O44 A;  3AZV A;  1JT4 A;  4P0J A;  3ISB A;  2FFU A;  4WBY A;  4JPZ A;  3N7M A;  1AVU A;  4EBJ A;  1ZQD A;  2PFP A;  4I2B A;  4ZFW B;  3QR5 A;  5J2G A;  4OWJ A;  5HPZ A;  4UBC A;  3B0Y A;  3HBW A;  4I4P A;  4K4H A;  4DO9 A;  4TLP A;  5JLV A;  7ICK A;  4QZ9 A;  9ICO A;  3OVB A;  2I1B A;  4LO0 C;  4ZFU B;  2X2T A;  2ERM A;  4GP3 A;  5J0S A;  3NBN A;  1DZC A;  5DVH A;  4K96 A;  4OAH A;  4X0B A;  3HJ1 A;  8ICM A;  4XA5 A;  1CE7 B;  4RQ0 A;  4UBB A;  1TFM B;  4IHZ A;  2WRY A;  4I29 A;  4RQ5 A;  2KLL A;  4RWO A;  5F8S A;  2ZH5 A;  5J2H A;  4J2X A;  5B2H A;  3MDC A;  4G1R A;  4EFP A;  8ICX A;  1IOB A;  2F2F A;  4AT8 B;  3FJC A;  5BOW A;  1NOM A;  4G6J A;  5BOL A;  4LO7 B;  4NXZ A;  1Q1U A;  4QO3 A;  5BXP A;  1ONK B;  5J2C A;  3BRD A;  9ILB A;  4ZFY B;  8ICP A;  4I4Y A;  1S0B A;  3SNV A;  1A8D A;  3UJ4 A;  3B0X A;  3V0B A;  4NKU A;  4KEI A;  1IRA X;  2M2U A;  2ZH2 A;  4RWN A;  4GP0 A;  4UB1 A;  4P0K A;  3IAG C;  3H6R A;  1Q78 A;  1BPX A;  5IIM A;  2D22 A;  3ZC9 A;  4O5C A;  2D44 A;  1Z2V A;  2DRE A;  3O4O A;  1EVT A;  4KLO A;  4FHX A;  4JQ0 A;  3VWC A;  3UPQ A;  1VJ7 A;  3E8L C;  4RWQ A;  3VSF A;  5J2K A;  3EF2 A;  1ZQP A;  4D0T A;  1QXM A;  4ZOT A;  4QAL A;  5EOZ A;  2DRB A;  2DS0 A;  1I1B A;  4F5Q A;  1AFC A;  3WIN C;  1TVA A;  3OGU A;  8ICE A;  3UQ2 A;  3TFS A;  1Q04 A;  4WC2 A;  4F5R A;  1XHB A;  3AH2 A;  7ICM A;  3IM6 A;  2QN4 A;  4NXX A;  4UD5 A;  3NJ5 A;  3HOM A;  1SZ6 B;  1HWM B;  1MC9 A;  1NUN A;  5DBC A;  1TV9 A;  5D61 A;  3C2L A;  1ZJM A;  1V6U A;  4RPZ A;  3V0A B;  3JPN A;  3A07 A;  2BBH A;  4QZE A;  4XUS A;  4M47 A;  5FZY A;  4I27 A;  1R8B A;  2NZ9 A;  3BRG C;  2BCR A;  4UB3 A;  1JAJ A;  8ICF A;  9ICF A;  3BAQ A;  7ICI A;  1W3G A;  1W3A A;  9ICM A;  1JT7 A;  2FDB M;  2BPG A;  4PGY A;  4QKS A;  4I0U A;  1HWO B;  4LEY A;  3BRF A;  4XKI A;  1V6W A;  2DRA A;  4R63 A;  4JAW A;  4OW4 A;  4Z6D A;  5HRI A;  3WFO A;  3WFS C;  3BA7 A;  1RZT A;  4M9N A;  3A22 A;  4L4H A;  3RJG A;  5BXT A;  1EV2 A;  4R65 A;  4QZH A;  1F31 A;  1EYL A;  3HX0 A;  2HN1 A;  4RT3 A;  1ABR B;  4I2S A;  3RJH A;  2Y9W C;  4KLG A;  3BAV A;  5FNX A;  3KMV A;  2MIB A;  2M49 A;  3OUY B;  2M2T A;  2BCQ A;  4M9H A;  3CRG A;  3CRH A;  9ICH A;  3AU6 A;  1IIL A;  4MKP A;  3FUQ A;  2ISP A;  3BA5 A;  3UQ0 A;  4LO7 C;  1BPD A;  3WFQ E;  1UEV A;  3OWG A;  9ICW A;  3HJ4 A;  2AAI B;  3H38 A;  2ZHA A;  3NBC A;  1XSL A;  4I4O A;  1TWM A;  1WBC A;  4Z6C A;  4IZE A;  4K4I A;  3P53 A;  2IUB A;  3FJJ A;  4LO2 A;  1F5A A;  1BLA A;  2ZR1 B;  3JPP A;  4I2E A;  2NTD A;  3FUO A;  4WC6 A;  4MFC A;  1KDH A;  4M2Y A;  1R8C A;  1MIY A;  3UXN A;  1S0C A;  4GOV A;  3WMU A;  4OAF A;  2BCS A;  3GDX A;  3AKI A;  3FJB A;  4ZLB B;  2Q66 A;  2GAF D;  4NY8 A;  3UXP A;  1BLD A;  4X4O A;  1ZQF A;  4X4R A;  4EB2 B;  2NM1 A;  3BAO A;  3ILA A;  9ICR A;  1HUZ A;  4NXU A;  4K99 A;  1ISW A;  2Y9F A;  4LVS A;  1DLL A;  1ISY A;  4I2C A;  3JPS A;  4J2K A;  1FWU A;  1ZQO A;  1YF8 B;  4LEZ A;  4R66 A;  1OQL B;  1NO5 A;  1IHK A;  4FHY A;  4GOY A;  2DR8 A;  5DUY A;  1AXM A;  4RQ7 A;  5F90 A;  1ZQY A;  4KEJ A;  3H6R B;  1G82 A;  3BA4 A;  3FJH A;  4F34 A;  4TUR A;  2RFF A;  3BAU A;  4J2Y A;  3WFR E;  2ZH6 A;  3PHZ A;  5HRD A;  5I1B A;  1DZD A;  3BAG A;  1S0E A;  4QZI A;  1TTU A;  4F5N A;  4RQ8 A;  3O4B A;  3WO4 A;  4D8H A;  5BP5 C;  4NXW A;  5DED A;  3AZW A;  4MFA A;  4OEG A;  3CU1 B;  4OEF A;  9ICC A;  4M9J A;  4AN7 B;  7I1B A;  5J0O A;  4PPX A;  3R4S A;  2O5A A;  3JPO A;  3JZ0 A;  4LO8 B;  3TC2 A;  2QYI B;  4OAI Z;  1ZQS A;  2FO1 A;  3OGF A;  4MF8 A;  2IHM A;  4EFR A;  2F8X C;  5HRB A;  2XOA A;  1XSN A;  5D62 A;  3BTA A;  3NYB A;  9ICK A;  1DFC A;  3LTQ A;  4FHP A;  3RMX A;  4KLI A;  1BPY A;  3H6S E;  5CFS A;  1ZQE A;  5J0U A;  8ICY A;  1HKN A;  1N4K A;  3FJE A;  1W3F A;  1BPE A;  4UAY A;  1ZQG A;  5CB1 A;  4Z6E A;  3F1R A;  4XFS A;  5J2A A;  7ICF A;  7ICP A;  1BPZ A;  1ZQB A;  3ZXG A;  1V4A A; 
#chains in the Genus database with same CATH homology
 2VSA A;  3IM7 A;  3N0K A;  4P0K A;  3UD7 A;  4MZF B;  5EG6 C;  3ZX7 A;  3IAG C;  3H6R A;  4OAG A;  2VSE A;  2D22 A;  3ZC9 A;  2Z49 A;  1S0D A;  1JT5 A;  1KNM A;  1G9A A;  1NZK A;  5DSS B;  3CRI A;  2D44 A;  2IWT B;  1Z2V A;  4HA2 A;  1AF9 A;  3CA5 A;  2DRE A;  3O4O A;  4ION A;  3IM5 A;  1DJS B;  1PWA A;  1EVT A;  3CAH A;  3UD9 A;  1SR4 A;  4I4U A;  2EWR A;  1G9C A;  4NXT A;  4JQ0 A;  4DCK C;  3VWC A;  1ISZ A;  1ITB A;  1Q03 A;  1PZZ A;  3E8L C;  3CA0 A;  3PG0 A;  3VSF A;  2NP0 A;  4IY8 A;  1QQL A;  3RMY A;  3AKF A;  2FCL A;  4I37 A;  4ZGR B;  3EF2 A;  4D0T A;  1L2H A;  1QXM A;  3K1X A;  3CA6 A;  4ZOT A;  1YBI A;  5CHE A;  4QAL A;  2DS0 A;  3R4U A;  4H75 A;  4A7Z A;  1I1B A;  5FZZ A;  1PC8 B;  4PC4 A;  1AFC A;  3CA4 A;  4QBC A;  4UY4 A;  3WIN C;  1G9B A;  5E24 E;  4I4X A;  1HCE A;  2F2F C;  1Q04 A;  2HWM A;  4I1B A;  2GA9 D;  1XHB A;  3AH2 A;  3IM6 A;  4K97 A;  2D20 A;  2QN4 A;  4NXX A;  3O5W B;  3NJ5 A;  3HOM A;  1S0F A;  1SZ6 B;  3OJV A;  1HWM B;  1MC9 A;  3HN1 A;  4H9W A;  4II0 A;  1NUN A;  1YTO A;  3BAD A;  3N7J A;  3VUO A;  3Q7X A;  2BEA A;  4G6M A;  3T8S A;  5D61 A;  4J23 B;  5CFU A;  1BAS A;  4FO1 A;  1V6U A;  4DEN A;  3V0A B;  2ZQO A;  1BA7 A;  3WA1 A;  3A07 A;  4O68 A;  2KI6 B;  1J0S A;  2RG9 B;  4USO A;  3V79 C;  3S8J A;  2B51 A;  41BI A;  5FZY A;  1JTC A;  1RML A;  3QYD A;  1FQ9 A;  2NZ9 A;  3BRG C;  2FGF A;  4LEW A;  3CA3 A;  4I8M A;  3ZC8 A;  4Z8S B;  5F8W A;  5BP5 A;  4I3N A;  1MD6 A;  1FN0 A;  3BAQ A;  1HWP B;  4Q9G A;  3OJ2 A;  4GAI A;  4ZA3 B;  2KKI A;  1W3G A;  1W3A A;  5DZU A;  1JT7 A;  1XG6 A;  5G00 A;  3A21 A;  2FDB M;  3HSM A;  4WH5 A;  3BAH A;  3D7W B;  4QKS A;  1HWO B;  4LEY A;  3BRF A;  4XKI A;  1V6W A;  1BFF A;  4F83 A;  3O4C A;  1T4Q A;  4JAW A;  2D43 A;  4O6A A;  3Q7W A;  2ET2 A;  4OW4 A;  3BB2 A;  3UDA A;  1SR4 C;  3NBE A;  1BFC A;  2WBC A;  4K9B A;  1BFB A;  2K4A B;  4X37 A;  3F62 B;  1TWE A;  3BA7 A;  1G9D A;  1GPJ A;  4ISQ A;  3CQA A;  5GAQ A;  2KI4 A;  5B3Q A;  3WO2 A;  3UJ0 A;  1JQZ A;  3A22 A;  4I4V A;  4G9M A;  4JRA A;  4L4H A;  4OWL A;  2GZB A;  4LO1 A;  5BXT A;  3ER9 B;  3K7D A;  2B4V A;  1HWN B;  1EV2 A;  4XJE A;  3FJF A;  3V0B B;  2R9K B;  4KM5 A;  5BQU C;  3RTI B;  3AKH A;  3POK A;  5FZU A;  1FGA A;  1F31 A;  4Q91 A;  1EYL A;  2HZ9 A;  3MPP G;  3ER8 C;  1FV3 A;  1ABR B;  4I2S A;  4XFT A;  4END A;  3N7K A;  2DRZ A;  4DEP A;  1IJT A;  2Y9W C;  3BAV A;  1QQK A;  1RZO B;  3I2X A;  5FNX A;  3KMV A;  2MIB A;  2M49 A;  1K5U A;  1DIW A;  4IY9 A;  4AN6 A;  2RST A;  3FFZ A;  1Z4S A;  3FJD A;  2D1Z A;  2B56 A;  3CRG A;  3CRH A;  4Q9P A;  5BVP I;  1I1E A;  1FV2 A;  4EEE B;  4OUJ A;  2HW9 A;  3JUT A;  3VT0 A;  2Y9X E;  1IIL A;  4MKP A;  1IT0 A;  4KC3 A;  1AVX B;  3FUQ A;  3BA5 A;  4WQK A;  4HR6 C;  4J2S A;  4LO7 C;  4IZX A;  1YXW A;  2D7R A;  3OWG A;  2P39 A;  3WMV A;  2K43 A;  3C9Z A;  21BI A;  4HJJ A;  4MZG B;  4I0Y A;  1FMZ A;  3WO3 A;  4EFQ A;  3VT1 A;  1M16 A;  1BAR A;  2AAI B;  1DQO A;  2Q3N B;  4WOY A;  3NBC A;  1TIE A;  4I4O A;  1TWM A;  1S0G A;  3AJ6 A;  3ERC C;  3V0A A;  1WBC A;  3RTJ B;  5EHA A;  3JRR A;  3B9U A;  2D23 A;  4IZE A;  1EPW A;  3O3Q A;  4I4R A;  1FWV A;  2BFH A;  2VLC A;  3P53 A;  3FJJ A;  4I6I A;  5BXS A;  1YYN A;  4LO2 A;  3I2A A;  4QD2 C;  3MCR A;  3VT2 A;  1ILR 1;  1BLA A;  4FVV A;  2ZR1 B;  2NTD A;  1AVW B;  2K8R A;  3FUO A;  4KB6 A;  6I1B A;  1D0H A;  3I29 B;  4WBC A;  4I96 A;  1JT3 A;  3FJA A;  2VXT I;  3P6I A;  3PUB A;  4LO0 A;  1XZZ A;  4G9N A;  2Q9X A;  5BXR A;  1JLX A;  1S0C A;  2MLL B;  1WD3 A;  2RQ9 A;  2ZQN A;  2BEB A;  3A23 A;  3FJ8 A;  4GOV A;  4KBB A;  3WMU A;  4OAF A;  3CA1 A;  3WIN A;  1UPS A;  3FJK A;  3AKI A;  4USP A;  2VUA A;  4LO1 C;  3FJB A;  2MC2 A;  4ZLB B;  4LO3 A;  2GAF D;  1ISV A;  1PUM B;  2Z48 A;  3NKU A;  3O4D A;  3O49 A;  3P6J A;  4JKQ A;  3AH1 A;  1BLD A;  2E4M A;  2NVH A;  3VSZ A;  4KEK A;  1DFQ A;  2GO2 A;  1BFG A;  3HAL A;  5D63 A;  4NXV A;  3OBR A;  4I1E A;  3VEQ A;  4EB2 B;  1II4 A;  2NM1 A;  3BAO A;  3ILA A;  3Q7Y A;  4K98 A;  2FFV A;  4NXU A;  1IRP A;  4K99 A;  1ISW A;  2Y9F A;  4X38 A;  1CVS A;  5FNW A;  4HX0 A;  4O67 A;  2NYY A;  3FGM A;  1DLL A;  3FJ9 A;  3S8K A;  1K5V A;  3FJI A;  3IIR A;  4GAF A;  4QC4 A;  1ISY A;  1V6X A;  4ISR A;  4XFU A;  1WD4 A;  1JY0 A;  2L5X A;  3OGG A;  4J2K A;  4QD2 B;  1FWU A;  4A7Y A;  1HIB A;  4A7K A;  1YF8 B;  2KH2 A;  4P6A A;  2LIQ A;  4K9A A;  4LEZ A;  3O44 A;  3AZV A;  2YUG A;  1S0L A;  1JT4 A;  2J3P A;  4X39 A;  1R8N A;  4Z9W B;  4P0J A;  1OQL B;  4JP0 A;  4OEE A;  2FFU A;  4I4S A;  3N7L A;  1IHK A;  4GOY A;  1XYF A;  4IYB A;  4JPZ A;  3N7M A;  4FGF A;  4D0Z A;  1AVU A;  5DUY A;  1AXM A;  5F90 A;  1TOO A;  4KEJ A;  3H6R B;  2UUS A;  1G82 A;  3BA4 A;  1FMM S;  3FJH A;  4F34 A;  4ZFW B;  3QR5 A;  3AJ5 A;  2Y9G A;  3BAU A;  3MAL A;  3PME A;  4J2Y A;  4OWJ A;  5HPZ A;  3HBW A;  1WBA A;  4I4P A;  4K8V A;  3RSJ A;  3H6Q A;  4N7R A;  4LO2 C;  3PHZ A;  3OBT A;  5B3P A;  8I1B A;  4TLP A;  5I1B A;  5JLV A;  1DZD A;  3AH4 A;  3BAG A;  1S0E A;  2LIE A;  2I1B A;  4LO0 C;  4ZFU B;  1TTU A;  2X2T A;  2ERM A;  1M2T B;  3O4B A;  2DRY A;  4JKX B;  3WO4 A;  4D8H A;  5BP5 C;  1AVA C;  4GP3 A;  4NXW A;  4L4I A;  1ISX A;  1R8O A;  2NS2 A;  3AZW A;  5BQU A;  3NBN A;  4YOL A;  1DZC A;  2VXR A;  4QKR A;  4JLZ A;  3LLP A;  5DVH A;  4K96 A;  4OEG A;  3CU1 B;  2AXM A;  2IHO A;  4CJM A;  4OAH A;  4OEF A;  1VCL A;  3NBD A;  2P23 A;  4LO3 C;  4AN7 B;  4EKX B;  1Z0H A;  3HMY A;  7I1B A;  4LEV A;  3R4S A;  1CE7 B;  3O4A A;  2E4M C;  31BI A;  4LO8 B;  3TC2 A;  4I4Q A;  1TFM B;  4IHZ A;  5JMC A;  3UD8 A;  2QYI B;  2WRY A;  4OWK A;  4OAI Z;  5F8Y A;  2FO1 A;  2KLL A;  1RG8 A;  4I7I A;  5CFT A;  3OGF A;  5F8S A;  2X2S A;  1DQG A;  4J2X A;  4EFR A;  2F8X C;  5B2H A;  1T9F A;  2XOA A;  5D62 A;  3BTA A;  4G1R A;  1PUU B;  2AFG A;  1JLY A;  1RY7 A;  4EFP A;  1DFC A;  1HCD A;  1IOB A;  2F2F A;  2D7I A;  4P0L A;  3LTQ A;  1V6V A;  3BX1 C;  3RMX A;  3FJC A;  5BOW A;  3ZXD A;  4G6J A;  2ESU A;  4LO7 B;  3H6S E;  2AQZ A;  1Q1U A;  5CFS A;  4JLX A;  3OJM A;  4QO3 A;  5BXP A;  1ONK B;  4ZKT B;  1HKN A;  3AKG A;  1N4K A;  3FJE A;  4X3A A;  1W3F A;  9ILB A;  3BRD A;  4ZFY B;  5EC5 A;  4I4Y A;  4O69 A;  1S0B A;  1GGP B;  3SNV A;  4MZH A;  4QBV A;  4H04 A;  1A8D A;  3UJ4 A;  3F1R A;  4XFS A;  1TP0 A;  3V0B A;  3W9T A;  4KEI A;  2VU9 A;  4IQP A;  1IRA X;  2D24 A;  2HWA A;  4R6U B;  4WQL A;  1E0O A;  1P63 A;  4ZBV B;  3ZXG A;  4GP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...