3EF2A

Structure of the marasmius oreades mushroom lectin (moa) in complex with galalpha(1,3)[fucalpha(1,2)]gal and calcium.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
292
structure length
291
Chain Sequence
b'SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Agglutinin
publication title Structural Characterization of a Lectin from the Mushroom Marasmius oreades in Complex with the Blood Group B Trisaccharide and Calcium.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Sugar binding protein
total genus 89
structure length 291
sequence length 292
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ef2A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ef2A02
3CA1A 1FV3A 2BFHA 4J2KA 1TWMA 3BAGA 3VT0A 1JLYA 4LO7C 2D23A 4LO0A 3PMEA 1IT0A 3V0BA 3BTAA 4XFTA 3W9TA 2QN4A 2ERMA 1BA7A 3WMUA 5D62A 1FN0A 3FJEA 1N4KA 4JQ0A 2Y9XE 2VSAA 1IOBA 1EPWA 3PHZA 2NYYA 5I1BA 1TWEA 1QQKA 5FZYA 4A7KA 4EFPA 1DFQA 2FDBM 3H6RA 3B9UA 8I1BA 1NUNA 2WBCA 1ISVA 1E0OA 3BRGC 1J0SA 4OUJA 3OJVA 1DQGA 3A23A 1Z0HA 2F8XC 4EB2B 4GAIA 5F90A 1IILA 2K4AB 3HBWA 1DFCA 1HCDA 1RY7A 5GAQA 3VSFA 1AVUA 3A07A 4AN6A 4J23B 4QKRA 1DLLA 4H9WA 3O5WB 1I1BA 3WINA 3OJ2A 2BEAA 2LIQA 4Z9WB 3PG0A 21BIA 5EC5A 9ILBA 2Y9WC 2IHOA 1AFCA 3CQAA 4GAFA 1V6UA 2F2FC 3OGGA 1OQLB 1DJSB 1BFGA 3WO4A 7I1BA 3SNVA 3N7MA 4ZA3B 1HWOB 5F8YA 4I37A 2Q9XA 1PC8B 3HMYA 5BXTA 4JKXB 1FMMS 2MIBA 3IAGC 1MD6A 4Q9PA 1FMZA 2VXRA 2D24A 4JPZA 1G9BA 4I7IA 4I1EA 3AH1A 1Q04A 2KI4A 2Q3NB 3O4CA 5DUYA 3UD7A 5BXRA 4I4YA 1PUUB 3N7JA 1IJTA 1DIWA 4A7ZA 4ZLBB 1JT4A 3CAHA 3HSMA 4ZKTB 4OWLA 3R4UA 4IY9A 4OEEA 4LO1C 5HPZA 1G82A 1JLXA 3TC2A 4I4RA 4I0YA 1BASA 2VLCA 3OBTA 2HWMA 2RG9B 3NJ5A 1QXMA 3BRDA 2QYIB 3FUOA 4X3AA 4I4OA 5BP5C 4Q91A 4KEIA 1EVTA 4EEEB 3V0AB 5EG6C 2D1ZA 1T4QA 3AKFA 3HALA 3FUQA 3IM6A 5BQUC 4F34A 3VSZA 1M2TB 4X39A 3CA3A 1S0LA 4EFQA 1ISZA 2FFUA 2ET2A 4HA2A 3WO3A 3POKA 1JY0A 1JT7A 3BX1C 3ZX7A 5E24E 2L5XA 3ZC8A 3BA7A 2E4MC 4I4PA 1HKNA 2HWAA 4DEPA 2FFVA 3FGMA 3IM5A 2ZQOA 1AF9A 4QKSA 4WBCA 3VWCA 2AAIB 2F2FA 3FJDA 3WA1A 1G9AA 1R8OA 1W3AA 1P63A 4I4XA 3I2XA 1CE7B 4GOYA 1QQLA 1SR4C 5FNWA 3S8JA 4G6MA 4J2SA 1AXMA 2LIEA 4XKIA 3KMVA 4I3NA 1T9FA 3IM7A 3ZXGA 1S0EA 3NBCA 1EYLA 3V79C 3CRGA 3RTIB 3AKIA 4QD2B 1YF8B 1ISXA 4IYBA 4KC3A 2NVHA 5F8WA 2KKIA 2K8RA 3O4AA 1XYFA 1DQOA 1FQ9A 3Q7YA 5JLVA 1JQZA 2RSTA 3BRFA 1TTUA 1PUMB 4G9MA 3UD9A 4I8MA 4QBCA 4LO3A 2P23A 4X37A 1W3GA 1S0CA 3E8LC 3FJIA 4LO1A 4P0KA 2VXTI 2ZR1B 3AJ5A 1Q03A 4D0ZA 5DVHA 4H04A 4XFUA 5JMCA 3OBRA 4G6JA 3C9ZA 2ZQNA 5BP5A 1K5VA 2KLLA 3FFZA 3FJCA 4OWJA 4QC4A 4II0A 3WMVA 3ZXDA 3P6JA 4I4QA 1WBAA 3RTJB 5BQUA 1NZKA 1TOOA 2KH2A 3H6QA 2HW9A 1JT3A 3CA0A 1I1EA 2AQZA 2R9KB 6I1BA 4EFRA 3BB2A 2E4MA 4QD2C 2X2TA 3NBDA 2RQ9A 4LO3C 4JKQA 4IQPA 1IRAX 5EHAA 3AZVA 3VT2A 1V6VA 1WBCA 2ESUA 2D7RA 3AH2A 4P0LA 1TP0A 3MPPG 4D8HA 3K1XA 1Q1UA 4GOVA 4G9NA 3NBEA 1PZZA 1G9CA 5BOWA 3O3QA 1EV2A 1SR4A 1FV2A 1JT5A 2Z49A 3MALA 4QBVA 3UDAA 1S0DA 3FJAA 4X38A 4OW4A 3CRHA 1A8DA 1M16A 4XFSA 4QO3A 3CA5A 2YUGA 3V0AA 3A21A 1W3FA 3RMXA 1D0HA 4ISQA 2GO2A 2FO1A 5DSSB 3FJHA 3VT1A 3RMYA 1L2HA 3JUTA 1HWPB 2J3PA 4ZBVB 1SZ6B 1YBIA 2MLLB 3AH4A 2VU9A 3ILAA 4AN7B 1R8NA 5G00A 1PWAA 2GZBA 2VSEA 5F8SA 4HR6C 2Z48A 4OWKA 5BXSA 2X2SA 3QR5A 4TLPA 1WD3A 5FNXA 4Z8SB 3Q7XA 4GP3A 4LO2C 4YOLA 1BARA 1TIEA 1HIBA 2K43A 1FWVA 1AVAC 4EKXB 3BADA 1IRPA 3FJKA 1BFBA 3AKGA 4CJMA 3AZWA 3FJ9A 1V6WA 1IHKA 3O4DA 1HWMB 3UJ4A 2BEBA 1FWUA 4FVVA 3BAVA 3V0BB 1YYNA 3O4BA 1DZCA 3UD8A 1ABRB 1TFMB 4JRAA 4JAWA 3FJBA 3FJJA 3CA6A 4DCKC 3FJFA 1HWNB 3AKHA 1II4A 5BVPI 5D63A 3N0KA 4ZOTA 1UPSA 4ISRA 2P39A 3O4OA 1BLDA 1WD4A 3BA4A 2D7IA 1RMLA 3NBNA 4IZEA 1FGAA 2D44A 1S0FA 4P0JA 3RSJA 3H6RB 4USOA 3OGFA 4I6IA 1GGPB 4GP0A 1JTCA 4L4HA 1ONKB 2D22A 4IY8A 1Z2VA 41BIA 1YTOA 3WO2A 3QYDA 5FZUA 4DENA 2D20A 4D0TA 4I1BA 4JP0A 3EF2A 1DZDA 3OJMA 4IHZA 1F31A 2WRYA 4FGFA 2HZ9A 3PUBA 4LO0C 3R4SA 3I29B 3O44A 1YXWA 2Y9FA 3A22A 3Q7WA 2M49A 1VCLA 3VEQA 1CVSA 4ZFUB 4F83A 2MC2A 3CRIA 1G9DA 2DREA 1HCEA 3IIRA 1ILR1 2NM1A 1AVWB 1ISYA 4IONA 3P6IA 4LO2A 2VUAA 4I4VA 2D43A 2IWTB 4A7YA 1KNMA 1ITBA 4P6AA 3LTQA 4ZFYB 3BAOA 4I4UA 5FZZA 2XOAA 1BFFA 3D7WB 2KI6B 3H6SE 1K5UA 4ZFWB 1Z4SA 1XG6A 3CU1B 4USPA 3T8SA 4LO7B 2DS0A 2DRYA 3CA4A 1MC9A 3F62B 5BXPA 3O49A 1S0GA 4J2YA 1ISWA 2AXMA 1RZOB 4KBBA 5DZUA 4QALA 4L4IA 4I2SA 3VUOA 3F1RA 3WINC 2UUSA 3N7KA 1RG8A 3P53A 4OEFA 3HOMA 3AJ6A 4R6UB 3FJ8A 4I4SA 1S0BA 1XZZA 3HN1A 4ENDA 4I96A 2AFGA 3N7LA 2I1BA 4KEKA 4J2XA 2DRZA 4IZXA 3ZC9A 1BFCA 5D61A 2NP0A 4OEGA 1AVXB 1BLAA 2NTDA 3BA5A 2FGFA 3I2AA 3JRRA 3S8KA 4ZGRB 4LO8B 1V6XA 3BAUA 3BAQA 4HJJA 3BAHA 4KEJA 2NZ9A 4Q9GA 31BIA 1XHBA 3UJ0A 4PC4A 2Y9GA 4G1RA 5B2HA 3LLPA
chains in the Genus database with same CATH superfamily
2BFHA 3C2KA 3BAGA 4X4PA 2BCUA 4LO7C 4AT8A 4RQ2A 4LO0A 3PMEA 1IT0A 4XFTA 3W9TA 4EGWA 4F5OA 1BA7A 4KLFA 3RJEA 3NVOA 4RQ8A 1ZQJA 4JQ0A 7ICSA 1EPWA 5J0RA 7ICQA 4KLMA 4PGXA 4WC0A 1R8AA 4RPZA 4OUJA 4X0BA 3OJVA 3ER8C 3ISCA 8ICLA 1HCDA 5D46A 3A07A 4AN6A 1DLLA 5J0TA 3WINA 3PG0A 8ICKA 21BIA 4X0AA 3MCRA 4DOAA 3OGGA 1OQLB 4I2DA 8ICHA 1BFGA 5CP2A 4ZA3B 4HX0A 4JWMA 5BXTA 8ICWA 4LEVA 4UB5A 3JPTA 3JZ0A 4K97A 4FH5A 2KI4A 3O4CA 3UD7A 1ZQKA 4ZLBB 4YMOA 4OWLA 4MFFA 4IY9A 3TC2A 2HWMA 1V4AA 4X3AA 4QZGA 4M9NA 4I4OA 2VANA 4RWNA 4NXXA 1EVTA 4RWOA 3CK6A 3AKFA 3HALA 3IM6A 4F34A 3VSZA 4RPYA 4WOYA 7ICOA 1KNYA 4MZFB 3JPSA 3BX1C 5BOLA 5IILA 4I2IA 4DEPA 3FGMA 1F5AA 3K75D 1ZQIA 3HX0A 3WFQE 4WBCA 2F2FA 1G9AA 1R8OA 3ERCC 9ICFA 1QQLA 4I2AA 1SR4C 4LZGA 4G6MA 3PNCA 2LIEA 7ICEA 3ZXGA 1S0EA 5IIKA 3NBCA 4R64A 5CWRA 4DOCA 8ICUA 4Z6DA 2DRAA 3CRGA 4K4GA 3RTIB 2FCLA 5HRBA 1FQ9A 9ICKA 4LO3A 4X37A 1JAJA 4QZCA 1RZTA 4P0KA 5IIMA 3AJ5A 1Q03A 4XFUA 2PFOA 1JN3A 4QZDA 9ICIA 4IQVA 3FFZA 3FJCA 4II0A 4XRHA 4I4QA 5J0OA 1NZKA 2AQZA 2R9KB 6I1BA 3WFRE 3BB2A 3NBDA 4LO3C 4JKQA 2IUBA 2M2UA 3AH2A 4P0LA 4D8HA 4M0AA 4IQWA 3HJ4A 4KM5A 3NYBA 4I2HA 4UB2A 1JT5A 2Z49A 3MALA 4NLKA 4X38A 4OW4A 4WC6A 1M16A 1BPEA 4QO3A 2YUGA 3JPRA 3MDAA 9ICSA 3JYYA 3RMYA 8ICNA 1SZ6B 1TVAA 4YD1A 1PWAA 2GZBA 2VSEA 3L9DA 3WFPA 4TUQA 2Z48A 1WD3A 3Q7XA 4GP3A 1XSNA 1IRPA 1AVAC 4EKXB 3BADA 3FJKA 2PFPA 3TFRA 1IHKA 3O4DA 3UJ4A 5DB7A 3BAVA 3V0BB 5J2EA 4JAWA 4DCKC 3FJBA 3FJJA 3CA6A 4LT6A 4I2JA 2ZH5A 1II4A 2FMQA 3N0KA 4UY4A 1ZQAA 4UAZA 1UPSA 3O4OA 1BLDA 4TURA 1WD4A 3BA4A 5DB8A 1RMLA 1MQ2A 1FGAA 2D44A 9ICXA 1JTCA 5HHIA 4IY8A 41BIA 1YTOA 3WO2A 3QYDA 2M2VA 1DZDA 4IHZA 4YMNA 3C66A 2WRYA 7ICNA 7ICHA 3O44A 3PMLA 4MKPA 5JTGA 2MC2A 1HCEA 4WQLA 4LO2A 2M2TA 4WCWA 1ZQVA 4E80A 1BPXA 4I4UA 2XOAA 1BFFA 4RQ6A 4I2BA 3CU1B 1FA0A 4LO7B 2DS0A 2ZH7A 4F5QA 3O49A 4J2YA 3UXPA 1RZOB 4EP7A 5DZUA 2UUSA 3HOMA 4OAHA 4YN4A 4R6UB 3HN1A 2AFGA 4M9HA 3ZC9A 5D49A 1AVXB 3HW8A 1BLAA 2NTDA 7ICTA 3BA5A 2BCQA 4QZ8A 4ZGRB 3BAUA 3BAQA 4HJJA 4QZHA 4XJEA 5IIJA 4PHAA 1XSPA 4LVSA 3CA1A 1FV3A 4J2KA 3OVAA 2D23A 4NM1A 3V0BA 4K9BA 3BTAA 4PHPA 1ZQRA 8ICFA 9ICLA 4KLTA 4UAYA 4QZEA 1UEVA 2DR7A 3AQKA 3AU2A 3FJEA 8ICJA 2Y9XE 1IOBA 5FZYA 4A7KA 4EFPA 1DFQA 3B9UA 4PHDA 3BRGC 2F8XC 5DKWA 4EB2B 3HJ1A 2PFNA 5J2JA 3O5WB 4DO9A 3OJ2A 2BEAA 2LIQA 4WC7A 5EC5A 2Y9WC 4GAFA 5DDYA 3GDXA 2FMPA 4NXTA 4LEWA 4OAGA 3SNVA 3TFSA 5EOZA 3ISDA 1PC8B 2MIBA 5CHEA 1MD6A 4Q9PA 4KLOA 4JPZA 3V7KA 4I7IA 9ICCA 2Q3NB 5BXRA 1PUUB 5HRGA 5HRDA 5HPZA 1JLXA 1BASA 1QXMA 3BRDA 2QYIB 5BP5C 1ZQDA 4EEEB 5EG6C 2D1ZA 1T4QA 3FUQA 4X4SA 1M2TB 4X39A 4OAIZ 3HWTA 3WO3A 3POKA 4P4OA 7ICGA 1JT7A 1R89A 4MF2A 2BPCA 3ZC8A 4NLZA 4I2EA 2ZQOA 4QKSA 7ICJA 2O1PA 4M2YA 5CFTA 3UPSA 4WC4A 3I2XA 1BPZA 1CE7B 4QZFA 4GOYA 2P66A 5B3PA 4K96A 3AQNA 4I3NA 1T9FA 3IM7A 3V79C 1ISXA 2NVHA 8ICZA 4YD2A 2KKIA 4R63A 3Q7YA 4X4UA 3V7LA 3C5FA 4KLJA 2ZR1B 9ICVA 5J2BA 4H04A 4KLEA 5JMCA 4P4PA 4OWJA 4QC4A 3B0YA 3RTJB 8ICXA 9ICMA 2KH2A 4EBKA 1MIWA 3CA0A 4F5RA 4EFRA 4Z6CA 2RQ9A 4FHXA 5IIOA 9ICWA 4IQPA 3AZVA 3JPQA 7ICUA 3MPPG 4QZBA 5DB9A 3RJFA 4G9NA 3NBEA 5BOWA 3O3QA 1SR4A 5B3QA 1A8DA 4XFSA 3RMXA 5J0YA 1HWPB 4K98A 3ILAA 5F8SA 4KLUA 5CA7A 4OWKA 3QR5A 4TLPA 3AUOA 1BARA 1TIEA 7ICKA 1HIBA 3NKUA 1TFYA 3FJ9A 4RQ0A 4IQUA 1Q79A 5J0QA 1YYNA 4UB4A 3UD8A 3FJFA 1HWNB 5D63A 4ZOTA 5BOMA 9ICJA 1ZQSA 2P39A 1BPBA 3OWGA 3H6RB 3OGFA 8ICAA 4I6IA 5J0SA 4L4HA 2D22A 5DBAA 7ICPA 1Z2VA 2HN2A 4DENA 4FHPA 4I1BA 2ID1A 9ICEA 2ZHAA 2BCVA 2HZ9A 1TV9A 8ICGA 4AT9B 1YXWA 3A22A 5HREA 3VEQA 8ICMA 1CVSA 4PGYA 2DREA 4FHWA 4FHVA 1YLQA 3IIRA 1ILR1 4IONA 1ISYA 4F5NA 4LEYA 4A7YA 1KNMA 1ITBA 3BAOA 2O5AA 4WBZA 1Z4SA 1XG6A 4I2GA 3F62B 1S0GA 4XUSA 4L4IA 3F1RA 2W9MA 4NXVA 4WC5A 1RG8A 1TFWA 4FO1A 4RT2A 1S0BA 1XZZA 4ENDA 4X4RA 3N7LA 2I1BA 2DRZA 4KLSA 1BFCA 1HUOA 5J0XA 1ZQTA 3JPOA 5J2CA 3C2LA 4LO8B 1V6XA 9ICPA 3H38A 4Q9GA 31BIA 4MZHA 4G1RA 3LLPA 1TWMA 3RJHA 3VT0A 1JLYA 2QN4A 4PPXA 2HN1A 4O9MA 4R65A 2NYYA 4ATBB 1QQKA 2B56A 2ZH4A 4TUPA 3H6RA 1NUNA 2WBCA 1ISVA 3A23A 1Z0HA 4RQ5A 4OAFA 4GAIA 5F90A 1IILA 2K4AB 5F2VO 3HBWA 1DFCA 3VSFA 5GAQA 3AU6A 1AVUA 4J23B 4H9WA 7ICVA 1I1BA 3UXOA 2PBEA 9ILBA 2IHOA 1AFCA 7I1BA 1HWOB 2DR9A 5F8YA 2M2WA 3HMYA 4PHEA 1FMMS 4XA5A 3IAGC 4I4YA 4F5PA 1IJTA 2ZH8A 3CAHA 4ZKTB 3R4UA 4OEEA 4LO1C 4UB3A 4K9AA 4I0YA 2VLCA 1PX5A 2RG9B 3NJ5A 3FUOA 4XQ7A 4I29A 4Q91A 1ZQLA 5J2IA 3V0AB 3OUYB 5BQUC 1NO5A 4EFQA 4JLZA 2ET2A 2PXIA 1JY0A 4RQ1A 3ZX7A 5E24E 2RFFA 4N7RA 2E4MC 3ISBA 4O69A 1R8CA 4I4PA 4GXKA 4X5VA 9ICHA 4FO6A 2BBJA 4WC2A 4H75A 3FJDA 1KEJA 1Q78A 3ER9B 4J2SA 1AXMA 4XKIA 4P4MA 5DB6A 4NKTA 1EYLA 5J0WA 4UB1A 1YF8B 3OV7A 5F8WA 2K8RA 3O4AA 1XYFA 1DQOA 5JLVA 3BRFA 1TTUA 2RSTA 3UD9A 4QBCA 1W3GA 1S0CA 3E8LC 4RWPA 3OGUA 2VXTI 4E7XA 4D0ZA 5DVHA 9ICAA 3OBRA 2ZQNA 5BP5A 2KLLA 8ICPA 3WMVA 3ZXDA 1OU5A 5J2GA 2B51A 3RJGA 1WBAA 5HRIA 3MDCA 3H6QA 1JT3A 4QZ9A 4QD2C 4Z6EA 1ZQPA 1HUZA 8ICQA 1IRAX 3OVBA 1V6VA 3HIYA 2ESUA 2D7RA 2NRKA 2ZH2A 5HC9A 1TP0A 1Q1UA 1VJ7A 4KLLA 4O68A 4KLGA 4X4OA 1MIYA 4QBVA 1S0DA 3FJAA 2Q66A 7ICMA 3CA5A 3V72A 3V0AA 4WC1A 4K4IA 3A21A 2GAFD 1D0HA 2FO1A 1L2HA 4M47A 3JUTA 4ZBVB 1YBIA 8ICSA 1ZQEA 1ZQMA 2VU9A 1R8NA 3MBYA 4UAWA 5BXSA 1ZQQA 5FNXA 4KB6A 4UD4A 4YOLA 4WC3A 5HRLA 1BFBA 3AKGA 8ICBA 1V6WA 3RH4A 1HWMB 2DR8A 1FWUA 4O6AA 2I9GA 1ZQOA 3O4BA 4FH3A 1TFMB 4JRAA 9ICOA 5CR0A 1RPLA 9ICQA 3C18A 1ZJNA 2D7IA 5J2AA 4IZEA 1S0FA 5DECA 3RSJA 4RT3A 4GP0A 3RJKA 4I27A 5FZUA 2D20A 1ZQXA 2HHPA 5J29A 3EF2A 4NM2A 4MFAA 1F31A 4LO0C 3R4SA 3I29B 3H3AA 1KDHA 2M49A 4F83A 2BBHA 2ISOA 2NM1A 1JMSA 4GXIA 5J2HA 3P6IA 5DEDA 2VUAA 8ICIA 2IWTB 4MZGB 9ICTA 1ZQBA 2NS2A 4ZFYB 9ICNA 2KI6B 1K5UA 4P2HA 2DRYA 5BXPA 1ZJMA 3WFSC 4S3NA 2DR5A 5IIIA 3WINC 3N7KA 1WOTA 4OEFA 3AJ6A 1MIVA 4I4SA 3H37A 4I96A 4KEKA 4IZXA 4M9GA 3UQ0A 5D61A 8ICTA 2BE3A 4JWNA 5D4BA 4M9LA 2NZ9A 1XHBA 3UJ0A 4M5DA 4PC4A 2Y9GA 4QZIA 5B2HA 2DRBA 3UQ2A 1ZQWA 4PH5A 2ERMA 3WMUA 5CJ7A 2BPGA 5HR9A 8ICEA 8ICOA 5D62A 4R66A 5DBBA 1FN0A 4O67A 1N4KA 2VSAA 3LK9A 3PHZA 4XQ8A 4PGQA 5I1BA 1TWEA 4X4QA 4EV6A 2FDBM 8I1BA 1E0OA 1J0SA 1DQGA 1ZQYA 4WBYA 1ZQFA 4KLIA 1RY7A 4QKRA 4NXWA 4Z9WB 2B4VA 4JLXA 3CQAA 9ICBA 4RQ3A 1V6UA 4AT7B 4O5EA 2F2FC 2GA9D 7ICLA 1DJSB 3WO4A 3N7MA 4I37A 4WH5A 3JPPA 4NKUA 2Q9XA 5HRHA 4JKXB 1FMZA 2VXRA 2D24A 1G9BA 8ICCA 4I1EA 3AH1A 1Q04A 4M9JA 3MGHA 5DUYA 4MF8A 4X4VA 3N7JA 4X4TA 1DIWA 4DOBA 4A7ZA 1JT4A 1UEUA 3HSMA 2ZHBA 4I28A 3RJIA 1G82A 4I2CA 4RWQA 2FMSA 4I4RA 3OBTA 8ICRA 4I2FA 4KEIA 1ZQGA 4UBBA 4LZDA 3CA3A 1S0LA 1ISZA 2FFUA 4K99A 4HA2A 3UPQA 2ZH9A 4RQ7A 5HRFA 1ZQUA 4UBCA 2L5XA 3RH5A 3BA7A 1HKNA 1ZQHA 2HWAA 2FFVA 3IM5A 2DVIA 4O5KA 4IG8A 1AF9A 3VWCA 2AAIB 3WFOA 3WA1A 1W3AA 1UETA 4GXJA 1P63A 4I4XA 3PMNA 1BPYA 3MGIA 5FNWA 3S8JA 3RJJA 3KMVA 4IQTA 5HRKA 3AKIA 4QD2B 2IHMA 4IYBA 4KC3A 3OVSA 3H39A 1ZQZA 2BCSA 1R8BA 4WQKA 3JCFA 1JQZA 1PUMB 4G9MA 4I8MA 2P23A 3FJIA 4LO1A 4TUSA 4G6JA 3C9ZA 4AT9A 4AT7A 1K5VA 2ZH1A 9ICRA 3P6JA 5BQUA 1TOOA 2ZH6A 2HW9A 3RH6A 3UXNA 1I1EA 4I0UA 4LEZA 2E4MA 2X2TA 5DDMA 5DBCA 4NY8A 5EHAA 3VT2A 1WBCA 8ICYA 3B0XA 4RPXA 3K1XA 4NLNA 5J2KA 4GOVA 5TZVA 1PZZA 1G9CA 7ICRA 1EV2A 1FV2A 4QZAA 3UDAA 3CRHA 2BCRA 4KLDA 5CFSA 3C2MA 1W3FA 4NXZA 4ISQA 2GO2A 8ICVA 5DSSB 3FJHA 3VT1A 2J3PA 2GWSA 2MLLB 4M04A 2PFQA 3AH4A 4AN7B 5G00A 4HR6C 3LQCB 2X2SA 7ICFA 1NOMA 4K4HA 4Z8SB 4LO2C 2K43A 2BPFA 3JPNA 1FWVA 1MQ3A 9ICUA 1GPJA 4CJMA 1XSLA 3AZWA 2BEBA 4AT8B 4FVVA 7ICIA 1DZCA 1ABRB 1ZQCA 3C5GA 5J0UA 4ATBA 5J0PA 3AKHA 5BVPI 5CHGA 4ISRA 3NBNA 1JQRA 4P0JA 3V7JA 1VFGA 2ZH3A 4USOA 1GGPB 4YCXA 1ONKB 4K8VA 2EWRA 2ISPA 4D0TA 4JP0A 5J2FA 3NWIA 3OJMA 4EEDA 1ZQNA 5CB1A 4FGFA 3PUBA 4NXUA 2Y9FA 3Q7WA 1VCLA 3AQMA 3AQLA 4ZFUB 3CRIA 1G9DA 5J2DA 1AVWB 4UD5A 4FHYA 4E8FA 4O5CA 4I4VA 2D43A 4P6AA 3LTQA 4KLHA 5FZZA 3D7WB 3H6SE 4ZFWB 4USPA 4RQ4A 3T8SA 3CA4A 1MC9A 4YMMA 1ISWA 2AXMA 4KBBA 4QALA 4I2SA 3VUOA 4EBJA 5BPCA 3P53A 3OUYA 3FJ8A 4J2XA 2NP0A 4OEGA 4Z6FA 2FGFA 3I2AA 3JRRA 4MFCA 3S8KA 4KLQA 3BAHA 5HHHA 4KEJA 5IINA 4EEBA 3K7DA 4X4NA 5CFUA 9ICGA 1BPDA
chains in the Genus database with same CATH topology
3CA1A 1FV3A 2BFHA 4J2KA 1TWMA 3BAGA 3VT0A 1JLYA 4LO7C 2D23A 4LO0A 3PMEA 1IT0A 3V0BA 4K9BA 3BTAA 4XFTA 3W9TA 2QN4A 2ERMA 1BA7A 3WMUA 5D62A 1FN0A 4O67A 3FJEA 1N4KA 4JQ0A 2Y9XE 2VSAA 1IOBA 1EPWA 3PHZA 2NYYA 5I1BA 1TWEA 1QQKA 5FZYA 4A7KA 2B56A 4EFPA 1DFQA 2FDBM 3H6RA 3B9UA 8I1BA 1NUNA 2WBCA 1ISVA 1E0OA 3BRGC 1J0SA 4OUJA 3OJVA 1DQGA 3ER8C 3A23A 1Z0HA 4OAFA 2F8XC 4EB2B 4GAIA 5F90A 1IILA 2K4AB 3HBWA 1DFCA 1HCDA 1RY7A 5GAQA 3VSFA 1AVUA 3A07A 4AN6A 4J23B 4QKRA 1DLLA 4NXWA 4H9WA 3O5WB 1I1BA 3WINA 3OJ2A 2BEAA 2LIQA 4Z9WB 3PG0A 2B4VA 4JLXA 21BIA 3MCRA 5EC5A 9ILBA 2Y9WC 2IHOA 1AFCA 3CQAA 4GAFA 1V6UA 4NXTA 2F2FC 4LEWA 4OAGA 3OGGA 1OQLB 2GA9D 1DJSB 1BFGA 3WO4A 7I1BA 3SNVA 3N7MA 4ZA3B 1HWOB 5F8YA 4I37A 4HX0A 4WH5A 2Q9XA 1PC8B 3HMYA 5BXTA 4LEVA 4JKXB 1FMMS 2MIBA 5CHEA 3IAGC 1MD6A 4Q9PA 1FMZA 2VXRA 2D24A 4JPZA 1G9BA 4I7IA 4K97A 4I1EA 3AH1A 1Q04A 2KI4A 2Q3NB 3O4CA 5DUYA 3UD7A 5BXRA 4I4YA 1PUUB 3N7JA 1IJTA 1DIWA 4A7ZA 4ZLBB 1JT4A 3CAHA 3HSMA 4ZKTB 4OWLA 3R4UA 4IY9A 4OEEA 4LO1C 5HPZA 1G82A 1JLXA 4K9AA 3TC2A 4I4RA 4I0YA 1BASA 2VLCA 3OBTA 2HWMA 2RG9B 3NJ5A 1QXMA 3BRDA 2QYIB 3FUOA 4X3AA 4I4OA 5BP5C 4Q91A 4KEIA 4NXXA 1EVTA 4EEEB 3V0AB 5EG6C 2D1ZA 1T4QA 3AKFA 3HALA 3FUQA 3IM6A 5BQUC 4F34A 3VSZA 1M2TB 4X39A 4OAIZ 3CA3A 1S0LA 4WOYA 4EFQA 4JLZA 1ISZA 2FFUA 4K99A 2ET2A 4HA2A 3WO3A 4MZFB 3POKA 1JY0A 1JT7A 3BX1C 3ZX7A 5E24E 2L5XA 4N7RA 3ZC8A 3BA7A 2E4MC 4O69A 4I4PA 1HKNA 2HWAA 4DEPA 2FFVA 3FGMA 3IM5A 2ZQOA 1AF9A 4QKSA 4WBCA 3VWCA 2AAIB 4H75A 2F2FA 3FJDA 3WA1A 1G9AA 1R8OA 1W3AA 5CFTA 1P63A 4I4XA 3ERCC 3I2XA 1CE7B 4GOYA 1QQLA 1SR4C 5FNWA 3S8JA 4G6MA 3ER9B 4J2SA 1AXMA 5B3PA 2LIEA 4XKIA 3KMVA 4K96A 4I3NA 1T9FA 3IM7A 3ZXGA 1S0EA 3NBCA 1EYLA 3V79C 3CRGA 3RTIB 3AKIA 4QD2B 1YF8B 1ISXA 4IYBA 4KC3A 2NVHA 5F8WA 2FCLA 2KKIA 2K8RA 3O4AA 1XYFA 1DQOA 1FQ9A 4WQKA 3Q7YA 5JLVA 1JQZA 2RSTA 3BRFA 1TTUA 1PUMB 4G9MA 3UD9A 4I8MA 4QBCA 4LO3A 2P23A 4X37A 1W3GA 1S0CA 3E8LC 3FJIA 4LO1A 4P0KA 2VXTI 2ZR1B 3AJ5A 1Q03A 4D0ZA 5DVHA 4H04A 4XFUA 5JMCA 3OBRA 4G6JA 3C9ZA 2ZQNA 5BP5A 1K5VA 2KLLA 3FFZA 3FJCA 4OWJA 4QC4A 4II0A 3WMVA 3ZXDA 3P6JA 2B51A 4I4QA 1WBAA 3RTJB 5BQUA 1NZKA 1TOOA 2KH2A 3H6QA 2HW9A 1JT3A 3CA0A 1I1EA 2AQZA 2R9KB 6I1BA 4LEZA 4EFRA 3BB2A 2E4MA 4QD2C 2X2TA 3NBDA 2RQ9A 4LO3C 4JKQA 4IQPA 1IRAX 5EHAA 3AZVA 3VT2A 1V6VA 1WBCA 2ESUA 2D7RA 3AH2A 4P0LA 1TP0A 3MPPG 4D8HA 3K1XA 1Q1UA 4KM5A 4GOVA 4G9NA 3NBEA 1PZZA 1G9CA 4O68A 5BOWA 3O3QA 1EV2A 1SR4A 1FV2A 1JT5A 2Z49A 3MALA 4QBVA 3UDAA 1S0DA 3FJAA 4X38A 4OW4A 3CRHA 5B3QA 1A8DA 1M16A 4XFSA 5CFSA 4QO3A 3CA5A 2YUGA 3V0AA 3A21A 1W3FA 2GAFD 3RMXA 1D0HA 4ISQA 2GO2A 2FO1A 5DSSB 3FJHA 3VT1A 3RMYA 1L2HA 3JUTA 1HWPB 4K98A 2J3PA 4ZBVB 1SZ6B 1YBIA 2MLLB 3AH4A 2VU9A 3ILAA 4AN7B 1R8NA 5G00A 1PWAA 2GZBA 2VSEA 5F8SA 4HR6C 2Z48A 4OWKA 5BXSA 2X2SA 3QR5A 4TLPA 1WD3A 5FNXA 4Z8SB 4KB6A 3Q7XA 4GP3A 4LO2C 4YOLA 1BARA 1TIEA 1HIBA 2K43A 1FWVA 1AVAC 4EKXB 3BADA 1IRPA 3FJKA 1BFBA 3AKGA 1GPJA 4CJMA 3NKUA 3AZWA 3FJ9A 1V6WA 1IHKA 3O4DA 1HWMB 3UJ4A 2BEBA 1FWUA 4FVVA 4O6AA 3BAVA 3V0BB 1YYNA 3O4BA 1DZCA 3UD8A 1ABRB 1TFMB 4JRAA 4JAWA 3FJBA 3FJJA 3CA6A 4DCKC 3FJFA 1HWNB 3AKHA 1II4A 5BVPI 5D63A 3N0KA 4UY4A 4ZOTA 1UPSA 4ISRA 2P39A 3O4OA 1BLDA 1WD4A 3BA4A 2D7IA 1RMLA 3NBNA 4IZEA 1FGAA 2D44A 1S0FA 3OWGA 4P0JA 3RSJA 3H6RB 4USOA 3OGFA 4I6IA 1GGPB 4GP0A 1JTCA 4L4HA 1ONKB 2D22A 4K8VA 4IY8A 1Z2VA 41BIA 2EWRA 1YTOA 3WO2A 3QYDA 5FZUA 4DENA 2D20A 4D0TA 4I1BA 4JP0A 3EF2A 1DZDA 3OJMA 4IHZA 1F31A 2WRYA 4FGFA 2HZ9A 3PUBA 4LO0C 3R4SA 4NXUA 3I29B 3O44A 1YXWA 2Y9FA 3A22A 3Q7WA 2M49A 1VCLA 3VEQA 4MKPA 1CVSA 4ZFUB 4F83A 2MC2A 3CRIA 1G9DA 2DREA 1HCEA 4WQLA 3IIRA 1ILR1 2NM1A 1AVWB 1ISYA 4IONA 3P6IA 4LO2A 2VUAA 4I4VA 2D43A 2IWTB 4MZGB 4LEYA 4A7YA 1KNMA 1ITBA 4P6AA 3LTQA 2NS2A 4ZFYB 3BAOA 4I4UA 5FZZA 2XOAA 1BFFA 3D7WB 2KI6B 3H6SE 1K5UA 4ZFWB 1Z4SA 1XG6A 3CU1B 4USPA 3T8SA 4LO7B 2DS0A 2DRYA 3CA4A 1MC9A 3F62B 5BXPA 3O49A 1S0GA 4J2YA 1ISWA 2AXMA 1RZOB 4KBBA 5DZUA 4QALA 4L4IA 4I2SA 3VUOA 3F1RA 3WINC 2UUSA 4NXVA 3N7KA 1RG8A 3P53A 4OEFA 3HOMA 4OAHA 3AJ6A 4R6UB 3FJ8A 4FO1A 4I4SA 1S0BA 1XZZA 3HN1A 4ENDA 4I96A 2AFGA 3N7LA 2I1BA 4KEKA 4J2XA 2DRZA 4IZXA 3ZC9A 1BFCA 5D61A 2NP0A 4OEGA 1AVXB 1BLAA 2NTDA 3BA5A 2FGFA 3I2AA 3JRRA 3S8KA 4ZGRB 4LO8B 1V6XA 3BAUA 3BAQA 4HJJA 3BAHA 4XJEA 4KEJA 2NZ9A 4Q9GA 31BIA 1XHBA 3K7DA 4MZHA 3UJ0A 4PC4A 5CFUA 2Y9GA 4G1RA 5B2HA 3LLPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CA1 A;  1FV3 A;  2BFH A;  4J2K A;  1TWM A;  3BAG A;  3VT0 A;  1JLY A;  4LO7 C;  2D23 A;  4LO0 A;  3PME A;  1IT0 A;  3V0B A;  3BTA A;  4XFT A;  3W9T A;  2QN4 A;  2ERM A;  1BA7 A;  3WMU A;  5D62 A;  1FN0 A;  3FJE A;  1N4K A;  4JQ0 A;  2Y9X E;  2VSA A;  1IOB A;  1EPW A;  3PHZ A;  2NYY A;  5I1B A;  1TWE A;  1QQK A;  5FZY A;  4A7K A;  4EFP A;  1DFQ A;  2FDB M;  3H6R A;  3B9U A;  8I1B A;  1NUN A;  2WBC A;  1ISV A;  1E0O A;  3BRG C;  1J0S A;  4OUJ A;  3OJV A;  1DQG A;  3A23 A;  1Z0H A;  2F8X C;  4EB2 B;  4GAI A;  5F90 A;  1IIL A;  2K4A B;  3HBW A;  1DFC A;  1HCD A;  1RY7 A;  5GAQ A;  3VSF A;  1AVU A;  3A07 A;  4AN6 A;  4J23 B;  4QKR A;  1DLL A;  4H9W A;  3O5W B;  1I1B A;  3WIN A;  3OJ2 A;  2BEA A;  2LIQ A;  4Z9W B;  3PG0 A;  21BI A;  5EC5 A;  9ILB A;  2Y9W C;  2IHO A;  1AFC A;  3CQA A;  4GAF A;  1V6U A;  2F2F C;  3OGG A;  1OQL B;  1DJS B;  1BFG A;  3WO4 A;  7I1B A;  3SNV A;  3N7M A;  4ZA3 B;  1HWO B;  5F8Y A;  4I37 A;  2Q9X A;  1PC8 B;  3HMY A;  5BXT A;  4JKX B;  1FMM S;  2MIB A;  3IAG C;  1MD6 A;  4Q9P A;  1FMZ A;  2VXR A;  2D24 A;  4JPZ A;  1G9B A;  4I7I A;  4I1E A;  3AH1 A;  1Q04 A;  2KI4 A;  2Q3N B;  3O4C A;  5DUY A;  3UD7 A;  5BXR A;  4I4Y A;  1PUU B;  3N7J A;  1IJT A;  1DIW A;  4A7Z A;  4ZLB B;  1JT4 A;  3CAH A;  3HSM A;  4ZKT B;  4OWL A;  3R4U A;  4IY9 A;  4OEE A;  4LO1 C;  5HPZ A;  1G82 A;  1JLX A;  3TC2 A;  4I4R A;  4I0Y A;  1BAS A;  2VLC A;  3OBT A;  2HWM A;  2RG9 B;  3NJ5 A;  1QXM A;  3BRD A;  2QYI B;  3FUO A;  4X3A A;  4I4O A;  5BP5 C;  4Q91 A;  4KEI A;  1EVT A;  4EEE B;  3V0A B;  5EG6 C;  2D1Z A;  1T4Q A;  3AKF A;  3HAL A;  3FUQ A;  3IM6 A;  5BQU C;  4F34 A;  3VSZ A;  1M2T B;  4X39 A;  3CA3 A;  1S0L A;  4EFQ A;  1ISZ A;  2FFU A;  2ET2 A;  4HA2 A;  3WO3 A;  3POK A;  1JY0 A;  1JT7 A;  3BX1 C;  3ZX7 A;  5E24 E;  2L5X A;  3ZC8 A;  3BA7 A;  2E4M C;  4I4P A;  1HKN A;  2HWA A;  4DEP A;  2FFV A;  3FGM A;  3IM5 A;  2ZQO A;  1AF9 A;  4QKS A;  4WBC A;  3VWC A;  2AAI B;  2F2F A;  3FJD A;  3WA1 A;  1G9A A;  1R8O A;  1W3A A;  1P63 A;  4I4X A;  3I2X A;  1CE7 B;  4GOY A;  1QQL A;  1SR4 C;  5FNW A;  3S8J A;  4G6M A;  4J2S A;  1AXM A;  2LIE A;  4XKI A;  3KMV A;  4I3N A;  1T9F A;  3IM7 A;  3ZXG A;  1S0E A;  3NBC A;  1EYL A;  3V79 C;  3CRG A;  3RTI B;  3AKI A;  4QD2 B;  1YF8 B;  1ISX A;  4IYB A;  4KC3 A;  2NVH A;  5F8W A;  2KKI A;  2K8R A;  3O4A A;  1XYF A;  1DQO A;  1FQ9 A;  3Q7Y A;  5JLV A;  1JQZ A;  2RST A;  3BRF A;  1TTU A;  1PUM B;  4G9M A;  3UD9 A;  4I8M A;  4QBC A;  4LO3 A;  2P23 A;  4X37 A;  1W3G A;  1S0C A;  3E8L C;  3FJI A;  4LO1 A;  4P0K A;  2VXT I;  2ZR1 B;  3AJ5 A;  1Q03 A;  4D0Z A;  5DVH A;  4H04 A;  4XFU A;  5JMC A;  3OBR A;  4G6J A;  3C9Z A;  2ZQN A;  5BP5 A;  1K5V A;  2KLL A;  3FFZ A;  3FJC A;  4OWJ A;  4QC4 A;  4II0 A;  3WMV A;  3ZXD A;  3P6J A;  4I4Q A;  1WBA A;  3RTJ B;  5BQU A;  1NZK A;  1TOO A;  2KH2 A;  3H6Q A;  2HW9 A;  1JT3 A;  3CA0 A;  1I1E A;  2AQZ A;  2R9K B;  6I1B A;  4EFR A;  3BB2 A;  2E4M A;  4QD2 C;  2X2T A;  3NBD A;  2RQ9 A;  4LO3 C;  4JKQ A;  4IQP A;  1IRA X;  5EHA A;  3AZV A;  3VT2 A;  1V6V A;  1WBC A;  2ESU A;  2D7R A;  3AH2 A;  4P0L A;  1TP0 A;  3MPP G;  4D8H A;  3K1X A;  1Q1U A;  4GOV A;  4G9N A;  3NBE A;  1PZZ A;  1G9C A;  5BOW A;  3O3Q A;  1EV2 A;  1SR4 A;  1FV2 A;  1JT5 A;  2Z49 A;  3MAL A;  4QBV A;  3UDA A;  1S0D A;  3FJA A;  4X38 A;  4OW4 A;  3CRH A;  1A8D A;  1M16 A;  4XFS A;  4QO3 A;  3CA5 A;  2YUG A;  3V0A A;  3A21 A;  1W3F A;  3RMX A;  1D0H A;  4ISQ A;  2GO2 A;  2FO1 A;  5DSS B;  3FJH A;  3VT1 A;  3RMY A;  1L2H A;  3JUT A;  1HWP B;  2J3P A;  4ZBV B;  1SZ6 B;  1YBI A;  2MLL B;  3AH4 A;  2VU9 A;  3ILA A;  4AN7 B;  1R8N A;  5G00 A;  1PWA A;  2GZB A;  2VSE A;  5F8S A;  4HR6 C;  2Z48 A;  4OWK A;  5BXS A;  2X2S A;  3QR5 A;  4TLP A;  1WD3 A;  5FNX A;  4Z8S B;  3Q7X A;  4GP3 A;  4LO2 C;  4YOL A;  1BAR A;  1TIE A;  1HIB A;  2K43 A;  1FWV A;  1AVA C;  4EKX B;  3BAD A;  1IRP A;  3FJK A;  1BFB A;  3AKG A;  4CJM A;  3AZW A;  3FJ9 A;  1V6W A;  1IHK A;  3O4D A;  1HWM B;  3UJ4 A;  2BEB A;  1FWU A;  4FVV A;  3BAV A;  3V0B B;  1YYN A;  3O4B A;  1DZC A;  3UD8 A;  1ABR B;  1TFM B;  4JRA A;  4JAW A;  3FJB A;  3FJJ A;  3CA6 A;  4DCK C;  3FJF A;  1HWN B;  3AKH A;  1II4 A;  5BVP I;  5D63 A;  3N0K A;  4ZOT A;  1UPS A;  4ISR A;  2P39 A;  3O4O A;  1BLD A;  1WD4 A;  3BA4 A;  2D7I A;  1RML A;  3NBN A;  4IZE A;  1FGA A;  2D44 A;  1S0F A;  4P0J A;  3RSJ A;  3H6R B;  4USO A;  3OGF A;  4I6I A;  1GGP B;  4GP0 A;  1JTC A;  4L4H A;  1ONK B;  2D22 A;  4IY8 A;  1Z2V A;  41BI A;  1YTO A;  3WO2 A;  3QYD A;  5FZU A;  4DEN A;  2D20 A;  4D0T A;  4I1B A;  4JP0 A;  3EF2 A;  1DZD A;  3OJM A;  4IHZ A;  1F31 A;  2WRY A;  4FGF A;  2HZ9 A;  3PUB A;  4LO0 C;  3R4S A;  3I29 B;  3O44 A;  1YXW A;  2Y9F A;  3A22 A;  3Q7W A;  2M49 A;  1VCL A;  3VEQ A;  1CVS A;  4ZFU B;  4F83 A;  2MC2 A;  3CRI A;  1G9D A;  2DRE A;  1HCE A;  3IIR A;  1ILR 1;  2NM1 A;  1AVW B;  1ISY A;  4ION A;  3P6I A;  4LO2 A;  2VUA A;  4I4V A;  2D43 A;  2IWT B;  4A7Y A;  1KNM A;  1ITB A;  4P6A A;  3LTQ A;  4ZFY B;  3BAO A;  4I4U A;  5FZZ A;  2XOA A;  1BFF A;  3D7W B;  2KI6 B;  3H6S E;  1K5U A;  4ZFW B;  1Z4S A;  1XG6 A;  3CU1 B;  4USP A;  3T8S A;  4LO7 B;  2DS0 A;  2DRY A;  3CA4 A;  1MC9 A;  3F62 B;  5BXP A;  3O49 A;  1S0G A;  4J2Y A;  1ISW A;  2AXM A;  1RZO B;  4KBB A;  5DZU A;  4QAL A;  4L4I A;  4I2S A;  3VUO A;  3F1R A;  3WIN C;  2UUS A;  3N7K A;  1RG8 A;  3P53 A;  4OEF A;  3HOM A;  3AJ6 A;  4R6U B;  3FJ8 A;  4I4S A;  1S0B A;  1XZZ A;  3HN1 A;  4END A;  4I96 A;  2AFG A;  3N7L A;  2I1B A;  4KEK A;  4J2X A;  2DRZ A;  4IZX A;  3ZC9 A;  1BFC A;  5D61 A;  2NP0 A;  4OEG A;  1AVX B;  1BLA A;  2NTD A;  3BA5 A;  2FGF A;  3I2A A;  3JRR A;  3S8K A;  4ZGR B;  4LO8 B;  1V6X A;  3BAU A;  3BAQ A;  4HJJ A;  3BAH A;  4KEJ A;  2NZ9 A;  4Q9G A;  31BI A;  1XHB A;  3UJ0 A;  4PC4 A;  2Y9G A;  4G1R A;  5B2H A;  3LLP A; 
#chains in the Genus database with same CATH topology
 2BFH A;  3C2K A;  3BAG A;  4X4P A;  2BCU A;  4LO7 C;  4AT8 A;  4RQ2 A;  4LO0 A;  3PME A;  1IT0 A;  4XFT A;  3W9T A;  4EGW A;  4F5O A;  1BA7 A;  4KLF A;  3RJE A;  3NVO A;  4RQ8 A;  1ZQJ A;  4JQ0 A;  7ICS A;  1EPW A;  5J0R A;  7ICQ A;  4KLM A;  4PGX A;  4WC0 A;  1R8A A;  4RPZ A;  4OUJ A;  4X0B A;  3OJV A;  3ER8 C;  3ISC A;  8ICL A;  1HCD A;  5D46 A;  3A07 A;  4AN6 A;  1DLL A;  5J0T A;  3WIN A;  3PG0 A;  8ICK A;  21BI A;  4X0A A;  3MCR A;  4DOA A;  3OGG A;  1OQL B;  4I2D A;  8ICH A;  1BFG A;  5CP2 A;  4ZA3 B;  4HX0 A;  4JWM A;  5BXT A;  8ICW A;  4LEV A;  4UB5 A;  3JPT A;  3JZ0 A;  4K97 A;  4FH5 A;  2KI4 A;  3O4C A;  3UD7 A;  1ZQK A;  4ZLB B;  4YMO A;  4OWL A;  4MFF A;  4IY9 A;  3TC2 A;  2HWM A;  1V4A A;  4X3A A;  4QZG A;  4M9N A;  4I4O A;  2VAN A;  4RWN A;  4NXX A;  1EVT A;  4RWO A;  3CK6 A;  3AKF A;  3HAL A;  3IM6 A;  4F34 A;  3VSZ A;  4RPY A;  4WOY A;  7ICO A;  1KNY A;  4MZF B;  3JPS A;  3BX1 C;  5BOL A;  5IIL A;  4I2I A;  4DEP A;  3FGM A;  1F5A A;  3K75 D;  1ZQI A;  3HX0 A;  3WFQ E;  4WBC A;  2F2F A;  1G9A A;  1R8O A;  3ERC C;  9ICF A;  1QQL A;  4I2A A;  1SR4 C;  4LZG A;  4G6M A;  3PNC A;  2LIE A;  7ICE A;  3ZXG A;  1S0E A;  5IIK A;  3NBC A;  4R64 A;  5CWR A;  4DOC A;  8ICU A;  4Z6D A;  2DRA A;  3CRG A;  4K4G A;  3RTI B;  2FCL A;  5HRB A;  1FQ9 A;  9ICK A;  4LO3 A;  4X37 A;  1JAJ A;  4QZC A;  1RZT A;  4P0K A;  5IIM A;  3AJ5 A;  1Q03 A;  4XFU A;  2PFO A;  1JN3 A;  4QZD A;  9ICI A;  4IQV A;  3FFZ A;  3FJC A;  4II0 A;  4XRH A;  4I4Q A;  5J0O A;  1NZK A;  2AQZ A;  2R9K B;  6I1B A;  3WFR E;  3BB2 A;  3NBD A;  4LO3 C;  4JKQ A;  2IUB A;  2M2U A;  3AH2 A;  4P0L A;  4D8H A;  4M0A A;  4IQW A;  3HJ4 A;  4KM5 A;  3NYB A;  4I2H A;  4UB2 A;  1JT5 A;  2Z49 A;  3MAL A;  4NLK A;  4X38 A;  4OW4 A;  4WC6 A;  1M16 A;  1BPE A;  4QO3 A;  2YUG A;  3JPR A;  3MDA A;  9ICS A;  3JYY A;  3RMY A;  8ICN A;  1SZ6 B;  1TVA A;  4YD1 A;  1PWA A;  2GZB A;  2VSE A;  3L9D A;  3WFP A;  4TUQ A;  2Z48 A;  1WD3 A;  3Q7X A;  4GP3 A;  1XSN A;  1IRP A;  1AVA C;  4EKX B;  3BAD A;  3FJK A;  2PFP A;  3TFR A;  1IHK A;  3O4D A;  3UJ4 A;  5DB7 A;  3BAV A;  3V0B B;  5J2E A;  4JAW A;  4DCK C;  3FJB A;  3FJJ A;  3CA6 A;  4LT6 A;  4I2J A;  2ZH5 A;  1II4 A;  2FMQ A;  3N0K A;  4UY4 A;  1ZQA A;  4UAZ A;  1UPS A;  3O4O A;  1BLD A;  4TUR A;  1WD4 A;  3BA4 A;  5DB8 A;  1RML A;  1MQ2 A;  1FGA A;  2D44 A;  9ICX A;  1JTC A;  5HHI A;  4IY8 A;  41BI A;  1YTO A;  3WO2 A;  3QYD A;  2M2V A;  1DZD A;  4IHZ A;  4YMN A;  3C66 A;  2WRY A;  7ICN A;  7ICH A;  3O44 A;  3PML A;  4MKP A;  5JTG A;  2MC2 A;  1HCE A;  4WQL A;  4LO2 A;  2M2T A;  4WCW A;  1ZQV A;  4E80 A;  1BPX A;  4I4U A;  2XOA A;  1BFF A;  4RQ6 A;  4I2B A;  3CU1 B;  1FA0 A;  4LO7 B;  2DS0 A;  2ZH7 A;  4F5Q A;  3O49 A;  4J2Y A;  3UXP A;  1RZO B;  4EP7 A;  5DZU A;  2UUS A;  3HOM A;  4OAH A;  4YN4 A;  4R6U B;  3HN1 A;  2AFG A;  4M9H A;  3ZC9 A;  5D49 A;  1AVX B;  3HW8 A;  1BLA A;  2NTD A;  7ICT A;  3BA5 A;  2BCQ A;  4QZ8 A;  4ZGR B;  3BAU A;  3BAQ A;  4HJJ A;  4QZH A;  4XJE A;  5IIJ A;  4PHA A;  1XSP A;  4LVS A;  3CA1 A;  1FV3 A;  4J2K A;  3OVA A;  2D23 A;  4NM1 A;  3V0B A;  4K9B A;  3BTA A;  4PHP A;  1ZQR A;  8ICF A;  9ICL A;  4KLT A;  4UAY A;  4QZE A;  1UEV A;  2DR7 A;  3AQK A;  3AU2 A;  3FJE A;  8ICJ A;  2Y9X E;  1IOB A;  5FZY A;  4A7K A;  4EFP A;  1DFQ A;  3B9U A;  4PHD A;  3BRG C;  2F8X C;  5DKW A;  4EB2 B;  3HJ1 A;  2PFN A;  5J2J A;  3O5W B;  4DO9 A;  3OJ2 A;  2BEA A;  2LIQ A;  4WC7 A;  5EC5 A;  2Y9W C;  4GAF A;  5DDY A;  3GDX A;  2FMP A;  4NXT A;  4LEW A;  4OAG A;  3SNV A;  3TFS A;  5EOZ A;  3ISD A;  1PC8 B;  2MIB A;  5CHE A;  1MD6 A;  4Q9P A;  4KLO A;  4JPZ A;  3V7K A;  4I7I A;  9ICC A;  2Q3N B;  5BXR A;  1PUU B;  5HRG A;  5HRD A;  5HPZ A;  1JLX A;  1BAS A;  1QXM A;  3BRD A;  2QYI B;  5BP5 C;  1ZQD A;  4EEE B;  5EG6 C;  2D1Z A;  1T4Q A;  3FUQ A;  4X4S A;  1M2T B;  4X39 A;  4OAI Z;  3HWT A;  3WO3 A;  3POK A;  4P4O A;  7ICG A;  1JT7 A;  1R89 A;  4MF2 A;  2BPC A;  3ZC8 A;  4NLZ A;  4I2E A;  2ZQO A;  4QKS A;  7ICJ A;  2O1P A;  4M2Y A;  5CFT A;  3UPS A;  4WC4 A;  3I2X A;  1BPZ A;  1CE7 B;  4QZF A;  4GOY A;  2P66 A;  5B3P A;  4K96 A;  3AQN A;  4I3N A;  1T9F A;  3IM7 A;  3V79 C;  1ISX A;  2NVH A;  8ICZ A;  4YD2 A;  2KKI A;  4R63 A;  3Q7Y A;  4X4U A;  3V7L A;  3C5F A;  4KLJ A;  2ZR1 B;  9ICV A;  5J2B A;  4H04 A;  4KLE A;  5JMC A;  4P4P A;  4OWJ A;  4QC4 A;  3B0Y A;  3RTJ B;  8ICX A;  9ICM A;  2KH2 A;  4EBK A;  1MIW A;  3CA0 A;  4F5R A;  4EFR A;  4Z6C A;  2RQ9 A;  4FHX A;  5IIO A;  9ICW A;  4IQP A;  3AZV A;  3JPQ A;  7ICU A;  3MPP G;  4QZB A;  5DB9 A;  3RJF A;  4G9N A;  3NBE A;  5BOW A;  3O3Q A;  1SR4 A;  5B3Q A;  1A8D A;  4XFS A;  3RMX A;  5J0Y A;  1HWP B;  4K98 A;  3ILA A;  5F8S A;  4KLU A;  5CA7 A;  4OWK A;  3QR5 A;  4TLP A;  3AUO A;  1BAR A;  1TIE A;  7ICK A;  1HIB A;  3NKU A;  1TFY A;  3FJ9 A;  4RQ0 A;  4IQU A;  1Q79 A;  5J0Q A;  1YYN A;  4UB4 A;  3UD8 A;  3FJF A;  1HWN B;  5D63 A;  4ZOT A;  5BOM A;  9ICJ A;  1ZQS A;  2P39 A;  1BPB A;  3OWG A;  3H6R B;  3OGF A;  8ICA A;  4I6I A;  5J0S A;  4L4H A;  2D22 A;  5DBA A;  7ICP A;  1Z2V A;  2HN2 A;  4DEN A;  4FHP A;  4I1B A;  2ID1 A;  9ICE A;  2ZHA A;  2BCV A;  2HZ9 A;  1TV9 A;  8ICG A;  4AT9 B;  1YXW A;  3A22 A;  5HRE A;  3VEQ A;  8ICM A;  1CVS A;  4PGY A;  2DRE A;  4FHW A;  4FHV A;  1YLQ A;  3IIR A;  1ILR 1;  4ION A;  1ISY A;  4F5N A;  4LEY A;  4A7Y A;  1KNM A;  1ITB A;  3BAO A;  2O5A A;  4WBZ A;  1Z4S A;  1XG6 A;  4I2G A;  3F62 B;  1S0G A;  4XUS A;  4L4I A;  3F1R A;  2W9M A;  4NXV A;  4WC5 A;  1RG8 A;  1TFW A;  4FO1 A;  4RT2 A;  1S0B A;  1XZZ A;  4END A;  4X4R A;  3N7L A;  2I1B A;  2DRZ A;  4KLS A;  1BFC A;  1HUO A;  5J0X A;  1ZQT A;  3JPO A;  5J2C A;  3C2L A;  4LO8 B;  1V6X A;  9ICP A;  3H38 A;  4Q9G A;  31BI A;  4MZH A;  4G1R A;  3LLP A;  1TWM A;  3RJH A;  3VT0 A;  1JLY A;  2QN4 A;  4PPX A;  2HN1 A;  4O9M A;  4R65 A;  2NYY A;  4ATB B;  1QQK A;  2B56 A;  2ZH4 A;  4TUP A;  3H6R A;  1NUN A;  2WBC A;  1ISV A;  3A23 A;  1Z0H A;  4RQ5 A;  4OAF A;  4GAI A;  5F90 A;  1IIL A;  2K4A B;  5F2V O;  3HBW A;  1DFC A;  3VSF A;  5GAQ A;  3AU6 A;  1AVU A;  4J23 B;  4H9W A;  7ICV A;  1I1B A;  3UXO A;  2PBE A;  9ILB A;  2IHO A;  1AFC A;  7I1B A;  1HWO B;  2DR9 A;  5F8Y A;  2M2W A;  3HMY A;  4PHE A;  1FMM S;  4XA5 A;  3IAG C;  4I4Y A;  4F5P A;  1IJT A;  2ZH8 A;  3CAH A;  4ZKT B;  3R4U A;  4OEE A;  4LO1 C;  4UB3 A;  4K9A A;  4I0Y A;  2VLC A;  1PX5 A;  2RG9 B;  3NJ5 A;  3FUO A;  4XQ7 A;  4I29 A;  4Q91 A;  1ZQL A;  5J2I A;  3V0A B;  3OUY B;  5BQU C;  1NO5 A;  4EFQ A;  4JLZ A;  2ET2 A;  2PXI A;  1JY0 A;  4RQ1 A;  3ZX7 A;  5E24 E;  2RFF A;  4N7R A;  2E4M C;  3ISB A;  4O69 A;  1R8C A;  4I4P A;  4GXK A;  4X5V A;  9ICH A;  4FO6 A;  2BBJ A;  4WC2 A;  4H75 A;  3FJD A;  1KEJ A;  1Q78 A;  3ER9 B;  4J2S A;  1AXM A;  4XKI A;  4P4M A;  5DB6 A;  4NKT A;  1EYL A;  5J0W A;  4UB1 A;  1YF8 B;  3OV7 A;  5F8W A;  2K8R A;  3O4A A;  1XYF A;  1DQO A;  5JLV A;  3BRF A;  1TTU A;  2RST A;  3UD9 A;  4QBC A;  1W3G A;  1S0C A;  3E8L C;  4RWP A;  3OGU A;  2VXT I;  4E7X A;  4D0Z A;  5DVH A;  9ICA A;  3OBR A;  2ZQN A;  5BP5 A;  2KLL A;  8ICP A;  3WMV A;  3ZXD A;  1OU5 A;  5J2G A;  2B51 A;  3RJG A;  1WBA A;  5HRI A;  3MDC A;  3H6Q A;  1JT3 A;  4QZ9 A;  4QD2 C;  4Z6E A;  1ZQP A;  1HUZ A;  8ICQ A;  1IRA X;  3OVB A;  1V6V A;  3HIY A;  2ESU A;  2D7R A;  2NRK A;  2ZH2 A;  5HC9 A;  1TP0 A;  1Q1U A;  1VJ7 A;  4KLL A;  4O68 A;  4KLG A;  4X4O A;  1MIY A;  4QBV A;  1S0D A;  3FJA A;  2Q66 A;  7ICM A;  3CA5 A;  3V72 A;  3V0A A;  4WC1 A;  4K4I A;  3A21 A;  2GAF D;  1D0H A;  2FO1 A;  1L2H A;  4M47 A;  3JUT A;  4ZBV B;  1YBI A;  8ICS A;  1ZQE A;  1ZQM A;  2VU9 A;  1R8N A;  3MBY A;  4UAW A;  5BXS A;  1ZQQ A;  5FNX A;  4KB6 A;  4UD4 A;  4YOL A;  4WC3 A;  5HRL A;  1BFB A;  3AKG A;  8ICB A;  1V6W A;  3RH4 A;  1HWM B;  2DR8 A;  1FWU A;  4O6A A;  2I9G A;  1ZQO A;  3O4B A;  4FH3 A;  1TFM B;  4JRA A;  9ICO A;  5CR0 A;  1RPL A;  9ICQ A;  3C18 A;  1ZJN A;  2D7I A;  5J2A A;  4IZE A;  1S0F A;  5DEC A;  3RSJ A;  4RT3 A;  4GP0 A;  3RJK A;  4I27 A;  5FZU A;  2D20 A;  1ZQX A;  2HHP A;  5J29 A;  3EF2 A;  4NM2 A;  4MFA A;  1F31 A;  4LO0 C;  3R4S A;  3I29 B;  3H3A A;  1KDH A;  2M49 A;  4F83 A;  2BBH A;  2ISO A;  2NM1 A;  1JMS A;  4GXI A;  5J2H A;  3P6I A;  5DED A;  2VUA A;  8ICI A;  2IWT B;  4MZG B;  9ICT A;  1ZQB A;  2NS2 A;  4ZFY B;  9ICN A;  2KI6 B;  1K5U A;  4P2H A;  2DRY A;  5BXP A;  1ZJM A;  3WFS C;  4S3N A;  2DR5 A;  5III A;  3WIN C;  3N7K A;  1WOT A;  4OEF A;  3AJ6 A;  1MIV A;  4I4S A;  3H37 A;  4I96 A;  4KEK A;  4IZX A;  4M9G A;  3UQ0 A;  5D61 A;  8ICT A;  2BE3 A;  4JWN A;  5D4B A;  4M9L A;  2NZ9 A;  1XHB A;  3UJ0 A;  4M5D A;  4PC4 A;  2Y9G A;  4QZI A;  5B2H A;  2DRB A;  3UQ2 A;  1ZQW A;  4PH5 A;  2ERM A;  3WMU A;  5CJ7 A;  2BPG A;  5HR9 A;  8ICE A;  8ICO A;  5D62 A;  4R66 A;  5DBB A;  1FN0 A;  4O67 A;  1N4K A;  2VSA A;  3LK9 A;  3PHZ A;  4XQ8 A;  4PGQ A;  5I1B A;  1TWE A;  4X4Q A;  4EV6 A;  2FDB M;  8I1B A;  1E0O A;  1J0S A;  1DQG A;  1ZQY A;  4WBY A;  1ZQF A;  4KLI A;  1RY7 A;  4QKR A;  4NXW A;  4Z9W B;  2B4V A;  4JLX A;  3CQA A;  9ICB A;  4RQ3 A;  1V6U A;  4AT7 B;  4O5E A;  2F2F C;  2GA9 D;  7ICL A;  1DJS B;  3WO4 A;  3N7M A;  4I37 A;  4WH5 A;  3JPP A;  4NKU A;  2Q9X A;  5HRH A;  4JKX B;  1FMZ A;  2VXR A;  2D24 A;  1G9B A;  8ICC A;  4I1E A;  3AH1 A;  1Q04 A;  4M9J A;  3MGH A;  5DUY A;  4MF8 A;  4X4V A;  3N7J A;  4X4T A;  1DIW A;  4DOB A;  4A7Z A;  1JT4 A;  1UEU A;  3HSM A;  2ZHB A;  4I28 A;  3RJI A;  1G82 A;  4I2C A;  4RWQ A;  2FMS A;  4I4R A;  3OBT A;  8ICR A;  4I2F A;  4KEI A;  1ZQG A;  4UBB A;  4LZD A;  3CA3 A;  1S0L A;  1ISZ A;  2FFU A;  4K99 A;  4HA2 A;  3UPQ A;  2ZH9 A;  4RQ7 A;  5HRF A;  1ZQU A;  4UBC A;  2L5X A;  3RH5 A;  3BA7 A;  1HKN A;  1ZQH A;  2HWA A;  2FFV A;  3IM5 A;  2DVI A;  4O5K A;  4IG8 A;  1AF9 A;  3VWC A;  2AAI B;  3WFO A;  3WA1 A;  1W3A A;  1UET A;  4GXJ A;  1P63 A;  4I4X A;  3PMN A;  1BPY A;  3MGI A;  5FNW A;  3S8J A;  3RJJ A;  3KMV A;  4IQT A;  5HRK A;  3AKI A;  4QD2 B;  2IHM A;  4IYB A;  4KC3 A;  3OVS A;  3H39 A;  1ZQZ A;  2BCS A;  1R8B A;  4WQK A;  3JCF A;  1JQZ A;  1PUM B;  4G9M A;  4I8M A;  2P23 A;  3FJI A;  4LO1 A;  4TUS A;  4G6J A;  3C9Z A;  4AT9 A;  4AT7 A;  1K5V A;  2ZH1 A;  9ICR A;  3P6J A;  5BQU A;  1TOO A;  2ZH6 A;  2HW9 A;  3RH6 A;  3UXN A;  1I1E A;  4I0U A;  4LEZ A;  2E4M A;  2X2T A;  5DDM A;  5DBC A;  4NY8 A;  5EHA A;  3VT2 A;  1WBC A;  8ICY A;  3B0X A;  4RPX A;  3K1X A;  4NLN A;  5J2K A;  4GOV A;  5TZV A;  1PZZ A;  1G9C A;  7ICR A;  1EV2 A;  1FV2 A;  4QZA A;  3UDA A;  3CRH A;  2BCR A;  4KLD A;  5CFS A;  3C2M A;  1W3F A;  4NXZ A;  4ISQ A;  2GO2 A;  8ICV A;  5DSS B;  3FJH A;  3VT1 A;  2J3P A;  2GWS A;  2MLL B;  4M04 A;  2PFQ A;  3AH4 A;  4AN7 B;  5G00 A;  4HR6 C;  3LQC B;  2X2S A;  7ICF A;  1NOM A;  4K4H A;  4Z8S B;  4LO2 C;  2K43 A;  2BPF A;  3JPN A;  1FWV A;  1MQ3 A;  9ICU A;  1GPJ A;  4CJM A;  1XSL A;  3AZW A;  2BEB A;  4AT8 B;  4FVV A;  7ICI A;  1DZC A;  1ABR B;  1ZQC A;  3C5G A;  5J0U A;  4ATB A;  5J0P A;  3AKH A;  5BVP I;  5CHG A;  4ISR A;  3NBN A;  1JQR A;  4P0J A;  3V7J A;  1VFG A;  2ZH3 A;  4USO A;  1GGP B;  4YCX A;  1ONK B;  4K8V A;  2EWR A;  2ISP A;  4D0T A;  4JP0 A;  5J2F A;  3NWI A;  3OJM A;  4EED A;  1ZQN A;  5CB1 A;  4FGF A;  3PUB A;  4NXU A;  2Y9F A;  3Q7W A;  1VCL A;  3AQM A;  3AQL A;  4ZFU B;  3CRI A;  1G9D A;  5J2D A;  1AVW B;  4UD5 A;  4FHY A;  4E8F A;  4O5C A;  4I4V A;  2D43 A;  4P6A A;  3LTQ A;  4KLH A;  5FZZ A;  3D7W B;  3H6S E;  4ZFW B;  4USP A;  4RQ4 A;  3T8S A;  3CA4 A;  1MC9 A;  4YMM A;  1ISW A;  2AXM A;  4KBB A;  4QAL A;  4I2S A;  3VUO A;  4EBJ A;  5BPC A;  3P53 A;  3OUY A;  3FJ8 A;  4J2X A;  2NP0 A;  4OEG A;  4Z6F A;  2FGF A;  3I2A A;  3JRR A;  4MFC A;  3S8K A;  4KLQ A;  3BAH A;  5HHH A;  4KEJ A;  5IIN A;  4EEB A;  3K7D A;  4X4N A;  5CFU A;  9ICG A;  1BPD A; 
#chains in the Genus database with same CATH homology
 3CA1 A;  1FV3 A;  2BFH A;  4J2K A;  1TWM A;  3BAG A;  3VT0 A;  1JLY A;  4LO7 C;  2D23 A;  4LO0 A;  3PME A;  1IT0 A;  3V0B A;  4K9B A;  3BTA A;  4XFT A;  3W9T A;  2QN4 A;  2ERM A;  1BA7 A;  3WMU A;  5D62 A;  1FN0 A;  4O67 A;  3FJE A;  1N4K A;  4JQ0 A;  2Y9X E;  2VSA A;  1IOB A;  1EPW A;  3PHZ A;  2NYY A;  5I1B A;  1TWE A;  1QQK A;  5FZY A;  4A7K A;  2B56 A;  4EFP A;  1DFQ A;  2FDB M;  3H6R A;  3B9U A;  8I1B A;  1NUN A;  2WBC A;  1ISV A;  1E0O A;  3BRG C;  1J0S A;  4OUJ A;  3OJV A;  1DQG A;  3ER8 C;  3A23 A;  1Z0H A;  4OAF A;  2F8X C;  4EB2 B;  4GAI A;  5F90 A;  1IIL A;  2K4A B;  3HBW A;  1DFC A;  1HCD A;  1RY7 A;  5GAQ A;  3VSF A;  1AVU A;  3A07 A;  4AN6 A;  4J23 B;  4QKR A;  1DLL A;  4NXW A;  4H9W A;  3O5W B;  1I1B A;  3WIN A;  3OJ2 A;  2BEA A;  2LIQ A;  4Z9W B;  3PG0 A;  2B4V A;  4JLX A;  21BI A;  3MCR A;  5EC5 A;  9ILB A;  2Y9W C;  2IHO A;  1AFC A;  3CQA A;  4GAF A;  1V6U A;  4NXT A;  2F2F C;  4LEW A;  4OAG A;  3OGG A;  1OQL B;  2GA9 D;  1DJS B;  1BFG A;  3WO4 A;  7I1B A;  3SNV A;  3N7M A;  4ZA3 B;  1HWO B;  5F8Y A;  4I37 A;  4HX0 A;  4WH5 A;  2Q9X A;  1PC8 B;  3HMY A;  5BXT A;  4LEV A;  4JKX B;  1FMM S;  2MIB A;  5CHE A;  3IAG C;  1MD6 A;  4Q9P A;  1FMZ A;  2VXR A;  2D24 A;  4JPZ A;  1G9B A;  4I7I A;  4K97 A;  4I1E A;  3AH1 A;  1Q04 A;  2KI4 A;  2Q3N B;  3O4C A;  5DUY A;  3UD7 A;  5BXR A;  4I4Y A;  1PUU B;  3N7J A;  1IJT A;  1DIW A;  4A7Z A;  4ZLB B;  1JT4 A;  3CAH A;  3HSM A;  4ZKT B;  4OWL A;  3R4U A;  4IY9 A;  4OEE A;  4LO1 C;  5HPZ A;  1G82 A;  1JLX A;  4K9A A;  3TC2 A;  4I4R A;  4I0Y A;  1BAS A;  2VLC A;  3OBT A;  2HWM A;  2RG9 B;  3NJ5 A;  1QXM A;  3BRD A;  2QYI B;  3FUO A;  4X3A A;  4I4O A;  5BP5 C;  4Q91 A;  4KEI A;  4NXX A;  1EVT A;  4EEE B;  3V0A B;  5EG6 C;  2D1Z A;  1T4Q A;  3AKF A;  3HAL A;  3FUQ A;  3IM6 A;  5BQU C;  4F34 A;  3VSZ A;  1M2T B;  4X39 A;  4OAI Z;  3CA3 A;  1S0L A;  4WOY A;  4EFQ A;  4JLZ A;  1ISZ A;  2FFU A;  4K99 A;  2ET2 A;  4HA2 A;  3WO3 A;  4MZF B;  3POK A;  1JY0 A;  1JT7 A;  3BX1 C;  3ZX7 A;  5E24 E;  2L5X A;  4N7R A;  3ZC8 A;  3BA7 A;  2E4M C;  4O69 A;  4I4P A;  1HKN A;  2HWA A;  4DEP A;  2FFV A;  3FGM A;  3IM5 A;  2ZQO A;  1AF9 A;  4QKS A;  4WBC A;  3VWC A;  2AAI B;  4H75 A;  2F2F A;  3FJD A;  3WA1 A;  1G9A A;  1R8O A;  1W3A A;  5CFT A;  1P63 A;  4I4X A;  3ERC C;  3I2X A;  1CE7 B;  4GOY A;  1QQL A;  1SR4 C;  5FNW A;  3S8J A;  4G6M A;  3ER9 B;  4J2S A;  1AXM A;  5B3P A;  2LIE A;  4XKI A;  3KMV A;  4K96 A;  4I3N A;  1T9F A;  3IM7 A;  3ZXG A;  1S0E A;  3NBC A;  1EYL A;  3V79 C;  3CRG A;  3RTI B;  3AKI A;  4QD2 B;  1YF8 B;  1ISX A;  4IYB A;  4KC3 A;  2NVH A;  5F8W A;  2FCL A;  2KKI A;  2K8R A;  3O4A A;  1XYF A;  1DQO A;  1FQ9 A;  4WQK A;  3Q7Y A;  5JLV A;  1JQZ A;  2RST A;  3BRF A;  1TTU A;  1PUM B;  4G9M A;  3UD9 A;  4I8M A;  4QBC A;  4LO3 A;  2P23 A;  4X37 A;  1W3G A;  1S0C A;  3E8L C;  3FJI A;  4LO1 A;  4P0K A;  2VXT I;  2ZR1 B;  3AJ5 A;  1Q03 A;  4D0Z A;  5DVH A;  4H04 A;  4XFU A;  5JMC A;  3OBR A;  4G6J A;  3C9Z A;  2ZQN A;  5BP5 A;  1K5V A;  2KLL A;  3FFZ A;  3FJC A;  4OWJ A;  4QC4 A;  4II0 A;  3WMV A;  3ZXD A;  3P6J A;  2B51 A;  4I4Q A;  1WBA A;  3RTJ B;  5BQU A;  1NZK A;  1TOO A;  2KH2 A;  3H6Q A;  2HW9 A;  1JT3 A;  3CA0 A;  1I1E A;  2AQZ A;  2R9K B;  6I1B A;  4LEZ A;  4EFR A;  3BB2 A;  2E4M A;  4QD2 C;  2X2T A;  3NBD A;  2RQ9 A;  4LO3 C;  4JKQ A;  4IQP A;  1IRA X;  5EHA A;  3AZV A;  3VT2 A;  1V6V A;  1WBC A;  2ESU A;  2D7R A;  3AH2 A;  4P0L A;  1TP0 A;  3MPP G;  4D8H A;  3K1X A;  1Q1U A;  4KM5 A;  4GOV A;  4G9N A;  3NBE A;  1PZZ A;  1G9C A;  4O68 A;  5BOW A;  3O3Q A;  1EV2 A;  1SR4 A;  1FV2 A;  1JT5 A;  2Z49 A;  3MAL A;  4QBV A;  3UDA A;  1S0D A;  3FJA A;  4X38 A;  4OW4 A;  3CRH A;  5B3Q A;  1A8D A;  1M16 A;  4XFS A;  5CFS A;  4QO3 A;  3CA5 A;  2YUG A;  3V0A A;  3A21 A;  1W3F A;  2GAF D;  3RMX A;  1D0H A;  4ISQ A;  2GO2 A;  2FO1 A;  5DSS B;  3FJH A;  3VT1 A;  3RMY A;  1L2H A;  3JUT A;  1HWP B;  4K98 A;  2J3P A;  4ZBV B;  1SZ6 B;  1YBI A;  2MLL B;  3AH4 A;  2VU9 A;  3ILA A;  4AN7 B;  1R8N A;  5G00 A;  1PWA A;  2GZB A;  2VSE A;  5F8S A;  4HR6 C;  2Z48 A;  4OWK A;  5BXS A;  2X2S A;  3QR5 A;  4TLP A;  1WD3 A;  5FNX A;  4Z8S B;  4KB6 A;  3Q7X A;  4GP3 A;  4LO2 C;  4YOL A;  1BAR A;  1TIE A;  1HIB A;  2K43 A;  1FWV A;  1AVA C;  4EKX B;  3BAD A;  1IRP A;  3FJK A;  1BFB A;  3AKG A;  1GPJ A;  4CJM A;  3NKU A;  3AZW A;  3FJ9 A;  1V6W A;  1IHK A;  3O4D A;  1HWM B;  3UJ4 A;  2BEB A;  1FWU A;  4FVV A;  4O6A A;  3BAV A;  3V0B B;  1YYN A;  3O4B A;  1DZC A;  3UD8 A;  1ABR B;  1TFM B;  4JRA A;  4JAW A;  3FJB A;  3FJJ A;  3CA6 A;  4DCK C;  3FJF A;  1HWN B;  3AKH A;  1II4 A;  5BVP I;  5D63 A;  3N0K A;  4UY4 A;  4ZOT A;  1UPS A;  4ISR A;  2P39 A;  3O4O A;  1BLD A;  1WD4 A;  3BA4 A;  2D7I A;  1RML A;  3NBN A;  4IZE A;  1FGA A;  2D44 A;  1S0F A;  3OWG A;  4P0J A;  3RSJ A;  3H6R B;  4USO A;  3OGF A;  4I6I A;  1GGP B;  4GP0 A;  1JTC A;  4L4H A;  1ONK B;  2D22 A;  4K8V A;  4IY8 A;  1Z2V A;  41BI A;  2EWR A;  1YTO A;  3WO2 A;  3QYD A;  5FZU A;  4DEN A;  2D20 A;  4D0T A;  4I1B A;  4JP0 A;  3EF2 A;  1DZD A;  3OJM A;  4IHZ A;  1F31 A;  2WRY A;  4FGF A;  2HZ9 A;  3PUB A;  4LO0 C;  3R4S A;  4NXU A;  3I29 B;  3O44 A;  1YXW A;  2Y9F A;  3A22 A;  3Q7W A;  2M49 A;  1VCL A;  3VEQ A;  4MKP A;  1CVS A;  4ZFU B;  4F83 A;  2MC2 A;  3CRI A;  1G9D A;  2DRE A;  1HCE A;  4WQL A;  3IIR A;  1ILR 1;  2NM1 A;  1AVW B;  1ISY A;  4ION A;  3P6I A;  4LO2 A;  2VUA A;  4I4V A;  2D43 A;  2IWT B;  4MZG B;  4LEY A;  4A7Y A;  1KNM A;  1ITB A;  4P6A A;  3LTQ A;  2NS2 A;  4ZFY B;  3BAO A;  4I4U A;  5FZZ A;  2XOA A;  1BFF A;  3D7W B;  2KI6 B;  3H6S E;  1K5U A;  4ZFW B;  1Z4S A;  1XG6 A;  3CU1 B;  4USP A;  3T8S A;  4LO7 B;  2DS0 A;  2DRY A;  3CA4 A;  1MC9 A;  3F62 B;  5BXP A;  3O49 A;  1S0G A;  4J2Y A;  1ISW A;  2AXM A;  1RZO B;  4KBB A;  5DZU A;  4QAL A;  4L4I A;  4I2S A;  3VUO A;  3F1R A;  3WIN C;  2UUS A;  4NXV A;  3N7K A;  1RG8 A;  3P53 A;  4OEF A;  3HOM A;  4OAH A;  3AJ6 A;  4R6U B;  3FJ8 A;  4FO1 A;  4I4S A;  1S0B A;  1XZZ A;  3HN1 A;  4END A;  4I96 A;  2AFG A;  3N7L A;  2I1B A;  4KEK A;  4J2X A;  2DRZ A;  4IZX A;  3ZC9 A;  1BFC A;  5D61 A;  2NP0 A;  4OEG A;  1AVX B;  1BLA A;  2NTD A;  3BA5 A;  2FGF A;  3I2A A;  3JRR A;  3S8K A;  4ZGR B;  4LO8 B;  1V6X A;  3BAU A;  3BAQ A;  4HJJ A;  3BAH A;  4XJE A;  4KEJ A;  2NZ9 A;  4Q9G A;  31BI A;  1XHB A;  3K7D A;  4MZH A;  3UJ0 A;  4PC4 A;  5CFU A;  2Y9G A;  4G1R A;  5B2H A;  3LLP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...