4WOYA

Crystal structure and functional analysis of mid49, a receptor for the mitochondrial fission protein drp1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
329
structure length
329
Chain Sequence
TFQERLLAFERKHVITPEAHVTLAKQLAGDIALELQAYLRSKFPELPFGALVPGGPLYDGLQAGTAEHVRLLAPLELEPGLWSLVPGVDTVAAEPRCWAVRRTQLEFHPRGCSPWDRFLVGGYLSSRVLLELLRKALSASVNWPAIGSLLGCLIWPDVASEELLLKVQHECLEFTLAVLMVVPGASTDDRLLLAWPLEGLASNLWLQDLYPVETARLRALDDQDAGTRRRLLLLLCGICRGHPALVRLGWSHLTQVVLHLGEEEVAWTEEALGERFLQALEFLVGSLEQASLPCHFNPSVNLLGNFREEEIDDIGYVLYSGLQVPESLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitochondrial dynamics protein MID49
publication title Crystal structure and functional analysis of MiD49, a receptor for the mitochondrial fission protein Drp1.
pubmed doi rcsb
source organism Mus musculus
total genus 98
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4woyA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4woyA02
4NXVA 4ATBA 4ATBB 4OAHA 4O69A 4OAIZ 4K98A 4JLXA 4KB6A 4K9AA 4K97A 4K96A 4K8VA 4LEWA 4JLZA 4NXTA 4OAFA 4LEZA 4KM5A 4K99A 4O68A 4OAGA 4WOYA 4O67A 4AT7A 4AT7B 4LEYA 4AT8A 4LEVA 4NXXA 4AT9A 4AT8B 4AT9B 4K9BA 4O6AA 4NXWA 4MKPA 4NXUA
chains in the Genus database with same CATH superfamily
5IILA 7ICVA 5DB8A 1F5AA 1ZQHA 4OAHA 9ICAA 4Z6CA 3V72A 2O1PA 4TUSA 1VFGA 4RPZA 4FHYA 2ZH4A 3UXOA 1TFWA 2ZHAA 5DDYA 4NM1A 4QZAA 4HX0A 4PHAA 1ZQJA 4M9NA 7ICFA 2PFNA 4IQVA 4RQ4A 3C18A 1BPZA 3PMLA 2RFFA 1PX5A 3PMNA 4I2CA 3OGUA 2NRKA 4K98A 4EEBA 3V7KA 1NOMA 1ZQQA 2ISOA 2B56A 4PHDA 4I0UA 4DOCA 7ICQA 5BOLA 3OVAA 3PNCA 8ICHA 5D62A 4UB4A 3C2LA 5DB6A 2ZH1A 4QZCA 9ICBA 3RJFA 7ICUA 9ICFA 4X4VA 5CFUA 4QZIA 2DRBA 4YMMA 4IQUA 7ICSA 3H39A 4PGQA 4KLSA 4UD4A 2W9MA 2EWRA 9ICUA 5DKWA 1UEUA 5J0XA 3MDCA 1MIWA 4S3NA 4JLXA 4RWQA 4UBBA 4O9MA 1ZQUA 4I2HA 4I29A 1JN3A 4UBCA 5J0UA 5HRBA 5HHHA 3WFRE 8ICSA 9ICQA 2GAFD 5J2GA 2GA9D 5J0QA 4F5RA 4O6AA 5J0PA 5DB9A 4KLQA 1ZQKA 3C66A 1R8BA 4NM2A 3ISBA 1BPEA 3WFOA 3RH6A 1ZQNA 2HN1A 1MQ3A 9ICWA 4IG8A 4RQ3A 3HWTA 4PH5A 2O5AA 1BPBA 2BCSA 9ICOA 1ZQBA 2DR5A 3JPPA 4I2DA 1BPYA 2BCRA 4LEWA 4O5EA 8ICMA 4QZHA 5HHIA 4I2AA 4WC4A 7ICOA 1YLQA 5J2KA 4X4OA 3EF2A 4O67A 4WBZA 5DBBA 4LVSA 8ICFA 4RWNA 3WFSC 4AT7A 4KLOA 4UD5A 3JPTA 2ZH6A 2ZH5A 4AT9A 5DDMA 4GXIA 9ICEA 1ZQYA 3AQNA 8ICIA 5J0WA 4UB5A 8ICVA 2PBEA 1KDHA 4MFFA 4K4HA 1HUZA 4NLNA 2M2TA 2ZH7A 1JQRA 4K97A 5B3QA 3NWIA 4DO9A 3RJKA 1ZQAA 4WC5A 1OU5A 3ISCA 4KLEA 4FHWA 3NYBA 4NY8A 1VJ7A 4NXZA 3CK6A 4JWMA 4PGYA 1TV9A 3ERCC 4FH3A 3C5FA 4X5VA 4AT7B 4AT8A 1BPXA 4RWPA 4AT9B 4EBKA 5CFTA 3JZ0A 1Q78A 5B3PA 5HRDA 3K75D 1ZQPA 4WCWA 5CHEA 4WH5A 4RPXA 3UQ2A 5HRGA 3OUYA 2HHPA 3AU6A 4M9HA 4YD1A 2BPGA 1ZJMA 2BPFA 3H37A 2IUBA 4NKTA 4M5DA 4WC6A 2M2VA 4EP7A 4PGXA 1ZJNA 1ZQCA 1MQ2A 5J2BA 1V4AA 3C5GA 3HJ4A 1ZQEA 4O68A 4WOYA 1XSNA 4NKUA 8ICNA 5J0RA 1JMSA 1ZQGA 4NXXA 4AT8B 5CP2A 3JPQA 2HN2A 4EBJA 4XJEA 2BCQA 3OUYB 8ICYA 4KLIA 2DRAA 4KLMA 5DECA 4M9GA 4FO6A 3V7JA 3JPNA 7ICGA 3MDAA 7ICTA 4MFCA 4JWNA 4UB2A 1KEJA 4FHPA 2ZH8A 1R8CA 4UAWA 4E80A 4IQWA 4LEVA 4P2HA 4X0AA 7ICLA 3GDXA 5J2IA 3OVSA 2DR8A 3RH4A 3TFSA 4WBYA 5HRIA 9ICCA 3RH5A 4PHEA 4F5NA 4KLGA 4KM5A 7ICMA 8ICUA 1ZQZA 1GPJA 3NKUA 4GXKA 8ICEA 4KLLA 3UPQA 5D61A 4X4PA 4F5PA 9ICPA 2PFQA 5HC9A 4FHXA 9ICSA 4M2YA 4YCXA 2ZH3A 5J29A 3UPSA 2ISPA 4I2IA 4Z6EA 5CWRA 4RT3A 9ICVA 5IINA 9ICJA 3NVOA 5J2HA 1UETA 5DBAA 4I2BA 4XQ7A 5J2FA 4X0BA 5J0OA 4NLZA 1R89A 4LEYA 4RWOA 4O5KA 1ZQWA 4KLDA 2B4VA 8ICLA 8ICJA 3ER8C 4WC0A 7ICRA 1UEVA 3RJGA 5IIIA 3OWGA 4P4MA 3C2MA 2ZH9A 4KB6A 4YMNA 4K9AA 3HW8A 5HREA 5HRKA 5J0YA 4FH5A 1MIYA 3AUOA 7ICIA 4XQ8A 4I2FA 5IIKA 1HUOA 4I27A 3B0YA 1Q79A 4KLFA 2I9GA 8ICQA 5DB7A 1RZTA 4WC2A 4UAZA 2Q66A 5D49A 4QZDA 4RQ2A 4E7XA 4RQ5A 3MGIA 4YMOA 4PPXA 1XSPA 4TUQA 9ICTA 8ICKA 5CR0A 9ICMA 2DR9A 9ICIA 3ISDA 3ER9B 3MCRA 3JCFA 4K4IA 4XRHA 2M2UA 1FA0A 3OVBA 4R65A 4RQ6A 4OAGA 2DR7A 2IHOA 4WQLA 4LT6A 4QZBA 5HRFA 5CHGA 4K9BA 1ZQTA 4NXWA 4MKPA 5EOZA 4MF8A 8ICAA 8ICZA 2ZH2A 4P4OA 4M47A 4K4GA 3WFPA 1KNYA 1BPDA 7ICNA 2BBHA 5TZVA 5D63A 2FMSA 1ZQDA 1ZQVA 4WC7A 3C2KA 4GXJA 4YN4A 8ICBA 4JLZA 7ICEA 5JTGA 1XSLA 4RQ0A 4QZ8A 4X4UA 5J2JA 2FMQA 4LZGA 2BCVA 3AQMA 4X4RA 3B0XA 8ICPA 4N7RA 4Z6DA 3RJHA 4FO1A 3MGHA 5F2VO 3RJEA 5J2AA 1WOTA 3MBYA 4ATBA 4XA5A 4O69A 4OAIZ 5CJ7A 9ICLA 2BPCA 3K7DA 1ZQOA 7ICPA 2P66A 5CB1A 5J0SA 4E8FA 8ICGA 9ICRA 3AU2A 4I2JA 4MF2A 3LK9A 3LQCB 4X4QA 9ICGA 1ZQLA 2FMPA 4K99A 2ID1A 2BE3A 4YD2A 5BOMA 3V7LA 1JAJA 4TURA 4X4TA 4M0AA 3PHZA 1ZQMA 1RPLA 3H38A 4QZGA 4NXVA 4FHVA 1ZQSA 2M2WA 3JPRA 8ICOA 2B51A 4ATBB 5CA7A 3JPSA 4I28A 4KLJA 3TFRA 5J0TA 4KLUA 9ICNA 4LZDA 4K8VA 3AQKA 5D46A 3UXPA 9ICHA 2PFPA 3H3AA 4M04A 4RQ8A 4R63A 1ZQRA 9ICKA 4UAYA 2BBJA 1TFYA 5HR9A 4I2EA 4RPYA 2BCUA 3HJ1A 5DEDA 2IHMA 4TUPA 4XUSA 4EEDA 4UB1A 4F5QA 5HRHA 4NLKA 1TVAA 1ZQXA 5D4BA 5CFSA 4M9JA 4P4PA 9ICXA 1R8AA 4RT2A 3RJJA 4EV6A 4PHPA 2PFOA 5J2DA 4UB3A 2GWSA 1MIVA 4R66A 5DBCA 4OAFA 4LEZA 3L9DA 2FCLA 5IIOA 3RJIA 4F5OA 7ICHA 3JYYA 4QZFA 4WC3A 8ICXA 4X4NA 5HRLA 4DOBA 4NXUA 4DOAA 5J2CA 1NO5A 4QZ9A 4RQ7A 3HX0A 4QZEA 4X4SA 7ICJA 4WC1A 7ICKA 4Z6FA 4K96A 8ICTA 3JPOA 2ZHBA 3UQ0A 2DVIA 4NXTA 8ICWA 4WQKA 4M9LA 3WFQE 2PXIA 3UXNA 4IQTA 5IIJA 8ICCA 4KLTA 5IIMA 1ZQIA 4O5CA 5BPCA 4KLHA 4MFAA 3HIYA 1ZQFA 4R64A 2VANA 8ICRA 3OV7A 4EGWA 3AQLA 4I2GA 4RQ1A 5J2EA
chains in the Genus database with same CATH topology
4FHXA 4ATBA 1F5AA 4OAHA 4O69A 4OAIZ 2O1PA 2ZH3A 3K7DA 2ZH7A 4K97A 5B3QA 4E8FA 4FHWA 4FHYA 4X4QA 3NYBA 1UETA 2ZH4A 4K99A 1TFWA 2ZHAA 3ERCC 4FH3A 4HX0A 4AT7B 1R89A 4LEYA 4AT8A 4X4TA 4AT9B 3PHZA 5CFTA 1Q78A 5B3PA 2B4VA 5CHEA 4WH5A 4NXVA 2HHPA 3OUYA 4FHVA 3ER8C 1UEVA 2B51A 4ATBB 4K98A 3OWGA 2ZH9A 4KB6A 4K9AA 2B56A 4K8VA 4NKTA 4M5DA 4FH5A 4EP7A 3OVAA 5D62A 3HJ4A 4O68A 4WOYA 2ZH1A 4NKUA 1TFYA 4X4VA 1Q79A 5CFUA 4NXXA 4AT8B 2DRBA 3HJ1A 4UD4A 4XJEA 3OUYB 2EWRA 2Q66A 1UEUA 4E7XA 5CFSA 4JLXA 2DRAA 1R8AA 2DR9A 3ER9B 3MCRA 4OAFA 4LEZA 1FA0A 4FHPA 2ZH8A 3OVBA 2FCLA 1R8CA 4OAGA 2DR7A 4E80A 2IHOA 4WQLA 4LT6A 2GAFD 2GA9D 4LEVA 4X4NA 4K9BA 4O6AA 4NXWA 4MKPA 3C66A 1R8BA 4NXUA 2ZH2A 3OVSA 2DR8A 4X4SA 2DR5A 5D63A 4K96A 2ZHBA 4LEWA 2DVIA 4JLZA 4NXTA 4WQKA 4KM5A 4X4OA 3EF2A 1GPJA 4X4UA 4O67A 3NKUA 4AT7A 4UD5A 2ZH6A 2ZH5A 4AT9A 5D61A 4X4RA 4X4PA 3HIYA 3OV7A 4N7RA 4FO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXV A;  4ATB A;  4ATB B;  4OAH A;  4O69 A;  4OAI Z;  4K98 A;  4JLX A;  4KB6 A;  4K9A A;  4K97 A;  4K96 A;  4K8V A;  4LEW A;  4JLZ A;  4NXT A;  4OAF A;  4LEZ A;  4KM5 A;  4K99 A;  4O68 A;  4OAG A;  4WOY A;  4O67 A;  4AT7 A;  4AT7 B;  4LEY A;  4AT8 A;  4LEV A;  4NXX A;  4AT9 A;  4AT8 B;  4AT9 B;  4K9B A;  4O6A A;  4NXW A;  4MKP A;  4NXU A; 
#chains in the Genus database with same CATH topology
 5IIL A;  7ICV A;  5DB8 A;  1F5A A;  1ZQH A;  4OAH A;  9ICA A;  4Z6C A;  3V72 A;  2O1P A;  4TUS A;  1VFG A;  4RPZ A;  4FHY A;  2ZH4 A;  3UXO A;  1TFW A;  2ZHA A;  5DDY A;  4NM1 A;  4QZA A;  4HX0 A;  4PHA A;  1ZQJ A;  4M9N A;  7ICF A;  2PFN A;  4IQV A;  4RQ4 A;  3C18 A;  1BPZ A;  3PML A;  2RFF A;  1PX5 A;  3PMN A;  4I2C A;  3OGU A;  2NRK A;  4K98 A;  4EEB A;  3V7K A;  1NOM A;  1ZQQ A;  2ISO A;  2B56 A;  4PHD A;  4I0U A;  4DOC A;  7ICQ A;  5BOL A;  3OVA A;  3PNC A;  8ICH A;  5D62 A;  4UB4 A;  3C2L A;  5DB6 A;  2ZH1 A;  4QZC A;  9ICB A;  3RJF A;  7ICU A;  9ICF A;  4X4V A;  5CFU A;  4QZI A;  2DRB A;  4YMM A;  4IQU A;  7ICS A;  3H39 A;  4PGQ A;  4KLS A;  4UD4 A;  2W9M A;  2EWR A;  9ICU A;  5DKW A;  1UEU A;  5J0X A;  3MDC A;  1MIW A;  4S3N A;  4JLX A;  4RWQ A;  4UBB A;  4O9M A;  1ZQU A;  4I2H A;  4I29 A;  1JN3 A;  4UBC A;  5J0U A;  5HRB A;  5HHH A;  3WFR E;  8ICS A;  9ICQ A;  2GAF D;  5J2G A;  2GA9 D;  5J0Q A;  4F5R A;  4O6A A;  5J0P A;  5DB9 A;  4KLQ A;  1ZQK A;  3C66 A;  1R8B A;  4NM2 A;  3ISB A;  1BPE A;  3WFO A;  3RH6 A;  1ZQN A;  2HN1 A;  1MQ3 A;  9ICW A;  4IG8 A;  4RQ3 A;  3HWT A;  4PH5 A;  2O5A A;  1BPB A;  2BCS A;  9ICO A;  1ZQB A;  2DR5 A;  3JPP A;  4I2D A;  1BPY A;  2BCR A;  4LEW A;  4O5E A;  8ICM A;  4QZH A;  5HHI A;  4I2A A;  4WC4 A;  7ICO A;  1YLQ A;  5J2K A;  4X4O A;  3EF2 A;  4O67 A;  4WBZ A;  5DBB A;  4LVS A;  8ICF A;  4RWN A;  3WFS C;  4AT7 A;  4KLO A;  4UD5 A;  3JPT A;  2ZH6 A;  2ZH5 A;  4AT9 A;  5DDM A;  4GXI A;  9ICE A;  1ZQY A;  3AQN A;  8ICI A;  5J0W A;  4UB5 A;  8ICV A;  2PBE A;  1KDH A;  4MFF A;  4K4H A;  1HUZ A;  4NLN A;  2M2T A;  2ZH7 A;  1JQR A;  4K97 A;  5B3Q A;  3NWI A;  4DO9 A;  3RJK A;  1ZQA A;  4WC5 A;  1OU5 A;  3ISC A;  4KLE A;  4FHW A;  3NYB A;  4NY8 A;  1VJ7 A;  4NXZ A;  3CK6 A;  4JWM A;  4PGY A;  1TV9 A;  3ERC C;  4FH3 A;  3C5F A;  4X5V A;  4AT7 B;  4AT8 A;  1BPX A;  4RWP A;  4AT9 B;  4EBK A;  5CFT A;  3JZ0 A;  1Q78 A;  5B3P A;  5HRD A;  3K75 D;  1ZQP A;  4WCW A;  5CHE A;  4WH5 A;  4RPX A;  3UQ2 A;  5HRG A;  3OUY A;  2HHP A;  3AU6 A;  4M9H A;  4YD1 A;  2BPG A;  1ZJM A;  2BPF A;  3H37 A;  2IUB A;  4NKT A;  4M5D A;  4WC6 A;  2M2V A;  4EP7 A;  4PGX A;  1ZJN A;  1ZQC A;  1MQ2 A;  5J2B A;  1V4A A;  3C5G A;  3HJ4 A;  1ZQE A;  4O68 A;  4WOY A;  1XSN A;  4NKU A;  8ICN A;  5J0R A;  1JMS A;  1ZQG A;  4NXX A;  4AT8 B;  5CP2 A;  3JPQ A;  2HN2 A;  4EBJ A;  4XJE A;  2BCQ A;  3OUY B;  8ICY A;  4KLI A;  2DRA A;  4KLM A;  5DEC A;  4M9G A;  4FO6 A;  3V7J A;  3JPN A;  7ICG A;  3MDA A;  7ICT A;  4MFC A;  4JWN A;  4UB2 A;  1KEJ A;  4FHP A;  2ZH8 A;  1R8C A;  4UAW A;  4E80 A;  4IQW A;  4LEV A;  4P2H A;  4X0A A;  7ICL A;  3GDX A;  5J2I A;  3OVS A;  2DR8 A;  3RH4 A;  3TFS A;  4WBY A;  5HRI A;  9ICC A;  3RH5 A;  4PHE A;  4F5N A;  4KLG A;  4KM5 A;  7ICM A;  8ICU A;  1ZQZ A;  1GPJ A;  3NKU A;  4GXK A;  8ICE A;  4KLL A;  3UPQ A;  5D61 A;  4X4P A;  4F5P A;  9ICP A;  2PFQ A;  5HC9 A;  4FHX A;  9ICS A;  4M2Y A;  4YCX A;  2ZH3 A;  5J29 A;  3UPS A;  2ISP A;  4I2I A;  4Z6E A;  5CWR A;  4RT3 A;  9ICV A;  5IIN A;  9ICJ A;  3NVO A;  5J2H A;  1UET A;  5DBA A;  4I2B A;  4XQ7 A;  5J2F A;  4X0B A;  5J0O A;  4NLZ A;  1R89 A;  4LEY A;  4RWO A;  4O5K A;  1ZQW A;  4KLD A;  2B4V A;  8ICL A;  8ICJ A;  3ER8 C;  4WC0 A;  7ICR A;  1UEV A;  3RJG A;  5III A;  3OWG A;  4P4M A;  3C2M A;  2ZH9 A;  4KB6 A;  4YMN A;  4K9A A;  3HW8 A;  5HRE A;  5HRK A;  5J0Y A;  4FH5 A;  1MIY A;  3AUO A;  7ICI A;  4XQ8 A;  4I2F A;  5IIK A;  1HUO A;  4I27 A;  3B0Y A;  1Q79 A;  4KLF A;  2I9G A;  8ICQ A;  5DB7 A;  1RZT A;  4WC2 A;  4UAZ A;  2Q66 A;  5D49 A;  4QZD A;  4RQ2 A;  4E7X A;  4RQ5 A;  3MGI A;  4YMO A;  4PPX A;  1XSP A;  4TUQ A;  9ICT A;  8ICK A;  5CR0 A;  9ICM A;  2DR9 A;  9ICI A;  3ISD A;  3ER9 B;  3MCR A;  3JCF A;  4K4I A;  4XRH A;  2M2U A;  1FA0 A;  3OVB A;  4R65 A;  4RQ6 A;  4OAG A;  2DR7 A;  2IHO A;  4WQL A;  4LT6 A;  4QZB A;  5HRF A;  5CHG A;  4K9B A;  1ZQT A;  4NXW A;  4MKP A;  5EOZ A;  4MF8 A;  8ICA A;  8ICZ A;  2ZH2 A;  4P4O A;  4M47 A;  4K4G A;  3WFP A;  1KNY A;  1BPD A;  7ICN A;  2BBH A;  5TZV A;  5D63 A;  2FMS A;  1ZQD A;  1ZQV A;  4WC7 A;  3C2K A;  4GXJ A;  4YN4 A;  8ICB A;  4JLZ A;  7ICE A;  5JTG A;  1XSL A;  4RQ0 A;  4QZ8 A;  4X4U A;  5J2J A;  2FMQ A;  4LZG A;  2BCV A;  3AQM A;  4X4R A;  3B0X A;  8ICP A;  4N7R A;  4Z6D A;  3RJH A;  4FO1 A;  3MGH A;  5F2V O;  3RJE A;  5J2A A;  1WOT A;  3MBY A;  4ATB A;  4XA5 A;  4O69 A;  4OAI Z;  5CJ7 A;  9ICL A;  2BPC A;  3K7D A;  1ZQO A;  7ICP A;  2P66 A;  5CB1 A;  5J0S A;  4E8F A;  8ICG A;  9ICR A;  3AU2 A;  4I2J A;  4MF2 A;  3LK9 A;  3LQC B;  4X4Q A;  9ICG A;  1ZQL A;  2FMP A;  4K99 A;  2ID1 A;  2BE3 A;  4YD2 A;  5BOM A;  3V7L A;  1JAJ A;  4TUR A;  4X4T A;  4M0A A;  3PHZ A;  1ZQM A;  1RPL A;  3H38 A;  4QZG A;  4NXV A;  4FHV A;  1ZQS A;  2M2W A;  3JPR A;  8ICO A;  2B51 A;  4ATB B;  5CA7 A;  3JPS A;  4I28 A;  4KLJ A;  3TFR A;  5J0T A;  4KLU A;  9ICN A;  4LZD A;  4K8V A;  3AQK A;  5D46 A;  3UXP A;  9ICH A;  2PFP A;  3H3A A;  4M04 A;  4RQ8 A;  4R63 A;  1ZQR A;  9ICK A;  4UAY A;  2BBJ A;  1TFY A;  5HR9 A;  4I2E A;  4RPY A;  2BCU A;  3HJ1 A;  5DED A;  2IHM A;  4TUP A;  4XUS A;  4EED A;  4UB1 A;  4F5Q A;  5HRH A;  4NLK A;  1TVA A;  1ZQX A;  5D4B A;  5CFS A;  4M9J A;  4P4P A;  9ICX A;  1R8A A;  4RT2 A;  3RJJ A;  4EV6 A;  4PHP A;  2PFO A;  5J2D A;  4UB3 A;  2GWS A;  1MIV A;  4R66 A;  5DBC A;  4OAF A;  4LEZ A;  3L9D A;  2FCL A;  5IIO A;  3RJI A;  4F5O A;  7ICH A;  3JYY A;  4QZF A;  4WC3 A;  8ICX A;  4X4N A;  5HRL A;  4DOB A;  4NXU A;  4DOA A;  5J2C A;  1NO5 A;  4QZ9 A;  4RQ7 A;  3HX0 A;  4QZE A;  4X4S A;  7ICJ A;  4WC1 A;  7ICK A;  4Z6F A;  4K96 A;  8ICT A;  3JPO A;  2ZHB A;  3UQ0 A;  2DVI A;  4NXT A;  8ICW A;  4WQK A;  4M9L A;  3WFQ E;  2PXI A;  3UXN A;  4IQT A;  5IIJ A;  8ICC A;  4KLT A;  5IIM A;  1ZQI A;  4O5C A;  5BPC A;  4KLH A;  4MFA A;  3HIY A;  1ZQF A;  4R64 A;  2VAN A;  8ICR A;  3OV7 A;  4EGW A;  3AQL A;  4I2G A;  4RQ1 A;  5J2E A; 
#chains in the Genus database with same CATH homology
 4FHX A;  4ATB A;  1F5A A;  4OAH A;  4O69 A;  4OAI Z;  2O1P A;  2ZH3 A;  3K7D A;  2ZH7 A;  4K97 A;  5B3Q A;  4E8F A;  4FHW A;  4FHY A;  4X4Q A;  3NYB A;  1UET A;  2ZH4 A;  4K99 A;  1TFW A;  2ZHA A;  3ERC C;  4FH3 A;  4HX0 A;  4AT7 B;  1R89 A;  4LEY A;  4AT8 A;  4X4T A;  4AT9 B;  3PHZ A;  5CFT A;  1Q78 A;  5B3P A;  2B4V A;  5CHE A;  4WH5 A;  4NXV A;  2HHP A;  3OUY A;  4FHV A;  3ER8 C;  1UEV A;  2B51 A;  4ATB B;  4K98 A;  3OWG A;  2ZH9 A;  4KB6 A;  4K9A A;  2B56 A;  4K8V A;  4NKT A;  4M5D A;  4FH5 A;  4EP7 A;  3OVA A;  5D62 A;  3HJ4 A;  4O68 A;  4WOY A;  2ZH1 A;  4NKU A;  1TFY A;  4X4V A;  1Q79 A;  5CFU A;  4NXX A;  4AT8 B;  2DRB A;  3HJ1 A;  4UD4 A;  4XJE A;  3OUY B;  2EWR A;  2Q66 A;  1UEU A;  4E7X A;  5CFS A;  4JLX A;  2DRA A;  1R8A A;  2DR9 A;  3ER9 B;  3MCR A;  4OAF A;  4LEZ A;  1FA0 A;  4FHP A;  2ZH8 A;  3OVB A;  2FCL A;  1R8C A;  4OAG A;  2DR7 A;  4E80 A;  2IHO A;  4WQL A;  4LT6 A;  2GAF D;  2GA9 D;  4LEV A;  4X4N A;  4K9B A;  4O6A A;  4NXW A;  4MKP A;  3C66 A;  1R8B A;  4NXU A;  2ZH2 A;  3OVS A;  2DR8 A;  4X4S A;  2DR5 A;  5D63 A;  4K96 A;  2ZHB A;  4LEW A;  2DVI A;  4JLZ A;  4NXT A;  4WQK A;  4KM5 A;  4X4O A;  3EF2 A;  1GPJ A;  4X4U A;  4O67 A;  3NKU A;  4AT7 A;  4UD5 A;  2ZH6 A;  2ZH5 A;  4AT9 A;  5D61 A;  4X4R A;  4X4P A;  3HIY A;  3OV7 A;  4N7R A;  4FO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...