4WOYA

Crystal structure and functional analysis of mid49, a receptor for the mitochondrial fission protein drp1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
329
structure length
329
Chain Sequence
TFQERLLAFERKHVITPEAHVTLAKQLAGDIALELQAYLRSKFPELPFGALVPGGPLYDGLQAGTAEHVRLLAPLELEPGLWSLVPGVDTVAAEPRCWAVRRTQLEFHPRGCSPWDRFLVGGYLSSRVLLELLRKALSASVNWPAIGSLLGCLIWPDVASEELLLKVQHECLEFTLAVLMVVPGASTDDRLLLAWPLEGLASNLWLQDLYPVETARLRALDDQDAGTRRRLLLLLCGICRGHPALVRLGWSHLTQVVLHLGEEEVAWTEEALGERFLQALEFLVGSLEQASLPCHFNPSVNLLGNFREEEIDDIGYVLYSGLQVPESLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamics protein MID49
publication title Crystal structure and functional analysis of MiD49, a receptor for the mitochondrial fission protein Drp1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 98
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4woyA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4woyA02
4JLZA 4KB6A 4OAIZ 4WOYA 4ATBB 4AT8B 4OAGA 4K9AA 4LEYA 4AT7B 4OAHA 4AT9A 4NXWA 4NXVA 4LEVA 4KM5A 4O69A 4LEWA 4K98A 4AT9B 4MKPA 4O6AA 4NXTA 4NXXA 4K9BA 4O67A 4K99A 4O68A 4LEZA 4K96A 4ATBA 4AT8A 4K8VA 4JLXA 4OAFA 4AT7A 4NXUA 4K97A
chains in the Genus database with same CATH superfamily
3ER8C 1TFWA 4YMOA 4FHXA 5DDMA 3C18A 9ICSA 4UAWA 3HWTA 4Z6CA 2W9MA 3WFQE 4AT9B 5CA7A 5J0TA 8ICLA 5CFTA 4DOAA 3WFPA 1VFGA 7ICMA 8ICAA 2BCQA 3ER9B 4KLOA 9ICFA 4O68A 7ICIA 4KLDA 3B0XA 4UD4A 2FCLA 4MFFA 2ZH6A 4EEDA 7ICGA 2IHOA 1MQ3A 4NKTA 4RPYA 2GA9D 4RWNA 4NXVA 5HRBA 4I2BA 4RQ0A 3GDXA 5BPCA 4F5NA 4XQ7A 4QZEA 4X4VA 2ZH9A 1MQ2A 4YD2A 9ICEA 4K8VA 5TZVA 4KLMA 3UPSA 4P4OA 4X4OA 4GXKA 4I27A 8ICFA 7ICHA 5HHHA 1ZQPA 4RWQA 4P2HA 3UPQA 2ZH1A 7ICOA 7ICUA 4O69A 2BPGA 3TFRA 5DDYA 4K4HA 9ICKA 1ZQRA 4FHVA 4WC1A 8ICUA 2M2TA 4WC3A 4M9NA 3H38A 4FO6A 4XUSA 4LT6A 1JMSA 1ZQXA 5BOMA 9ICOA 4IG8A 8ICIA 4KLFA 4E8FA 3OVAA 4X0BA 4RQ2A 1TVAA 5CHEA 3UXOA 4RQ5A 1ZQOA 5CWRA 4NM2A 8ICQA 8ICTA 9ICWA 3B0YA 4XQ8A 5B3QA 4MFAA 5JTGA 5J2AA 8ICZA 3OVSA 4PPXA 8ICRA 1UEUA 2GWSA 5CHGA 1YLQA 2ZH3A 4WC0A 5J0WA 5D62A 2BCUA 2ZH7A 3RJJA 1GPJA 5IIIA 2HN1A 2Q66A 3K75D 4M2YA 5HRLA 2ZHAA 4HX0A 3JPQA 1ZQDA 8ICCA 4EP7A 8ICNA 5F2VO 3AU6A 3JYYA 5DBCA 1UETA 1ZQAA 2FMPA 1BPBA 4WBYA 4RQ6A 4FO1A 3AU2A 4RWPA 2DR7A 4E7XA 2ZH5A 4PGYA 4R64A 8ICGA 4JWMA 2ZHBA 5CJ7A 1TV9A 2BPFA 4O6AA 4TUPA 7ICFA 4YD1A 5HRIA 4IQWA 4JWNA 1ZQGA 4EGWA 3MGIA 5J2DA 4UB2A 1ZQHA 3WFRE 8ICJA 1ZQUA 5DB7A 3K7DA 3C5FA 4GXIA 1ZJNA 4ATBB 3C2LA 9ICRA 3NKUA 4Z6EA 4UBCA 1ZQCA 4EBJA 4O5KA 4I2HA 4X4NA 2DRBA 2PFOA 1R89A 1ZQFA 5J0UA 3OVBA 2GAFD 9ICPA 4K99A 1UEVA 4QZCA 7ICNA 1ZQVA 5J29A 2EWRA 5DB6A 1ZQLA 4AT7A 5D61A 4RPXA 3HJ4A 4MF2A 2B51A 3MDAA 5HC9A 3RJHA 5CFSA 4I2AA 4E80A 3AUOA 4F5OA 4NLNA 1Q78A 5IIMA 4MFCA 5IIKA 1BPXA 4XJEA 4LEWA 4KLSA 4I0UA 2BCVA 5J2KA 4PHPA 3MDCA 1OU5A 1ZQQA 1TFYA 2ZH4A 3C66A 4O5EA 4FH5A 4X4PA 3ISBA 9ICVA 4PHEA 3NYBA 4AT8B 4LEYA 4FHYA 5DB9A 1R8AA 4WQLA 2P66A 4IQVA 8ICSA 1ZQJA 4M9GA 8ICYA 4PHAA 8ICHA 2DR9A 1JN3A 1NOMA 1ZQTA 5D4BA 4NKUA 2M2VA 5HRFA 3PNCA 8ICOA 5J2BA 4DOCA 9ICAA 4R66A 4WC5A 4WC6A 2BBHA 3C2KA 4XA5A 4OAFA 4P4MA 1PX5A 3LK9A 3C5GA 2HN2A 4WBZA 4RQ8A 4P4PA 4UB5A 7ICVA 4KB6A 2ZH2A 4EV6A 3RH6A 5J0SA 9ICUA 1ZJMA 4RQ4A 3PHZA 2IUBA 1XSPA 4NLKA 9ICGA 4KM5A 5J0QA 4I2JA 3UXNA 4DOBA 4WH5A 2BCRA 4O9MA 1ZQZA 1KDHA 4KLQA 2ZH8A 5J2CA 4K9BA 4DO9A 4QZBA 3ISCA 3H37A 3OUYA 3MBYA 5J2IA 4M9LA 4YMMA 2ISPA 7ICKA 1XSLA 4F5RA 4K4GA 2RFFA 4TURA 3PMNA 1R8CA 9ICMA 4IQTA 5J2EA 8ICEA 4TUSA 4NXWA 1MIYA 9ICCA 1ZQEA 2PBEA 7ICRA 4X0AA 4WCWA 3TFSA 2O1PA 3WFSC 9ICLA 1R8BA 2ID1A 5HHIA 4S3NA 4RQ1A 5D46A 5J0OA 3V72A 9ICQA 1BPEA 1Q79A 3H3AA 1HUOA 4I2FA 9ICNA 8ICVA 9ICXA 4JLXA 5J0XA 3ISDA 4NXUA 3RJGA 4I2EA 2VANA 3JPNA 4X4UA 4WC2A 2BBJA 4RQ3A 3CK6A 5CP2A 1XSNA 3HIYA 4YMNA 2B56A 4PHDA 4X4SA 4MKPA 5J0YA 4QZIA 5IINA 5IIOA 9ICHA 2PXIA 5DEDA 4I2CA 4I28A 1ZQKA 4UAYA 4M9JA 4RPZA 2HHPA 3HX0A 3JPSA 4LZGA 5J0RA 4I2GA 5J0PA 8ICBA 5J2GA 4I2IA 8ICWA 5CFUA 4QZHA 5IILA 4Z6FA 4FH3A 4WOYA 3H39A 4LZDA 2DR5A 1MIVA 8ICMA 4FHWA 4KLEA 4IQUA 1WOTA 3UXPA 3OWGA 7ICPA 4PH5A 2O5AA 5J2JA 3JZ0A 3PMLA 2ISOA 4X4TA 4M04A 4QZ8A 7ICTA 1ZQSA 1ZQBA 8ICKA 1FA0A 4WC4A 5B3PA 5EOZA 1HUZA 4K4IA 4FHPA 4NXTA 2BE3A 5HRKA 4O5CA 4M5DA 8ICXA 7ICJA 8ICPA 4QZGA 4GXJA 5IIJA 4LEZA 4NLZA 5DECA 3OUYB 3RJFA 4MF8A 1ZQMA 3RH5A 3OGUA 3RH4A 9ICJA 5DB8A 4OAIZ 4XRHA 3AQLA 3UQ0A 1ZQIA 4K9AA 4UAZA 3WFOA 5HR9A 4EBKA 4RQ7A 4M0AA 5CB1A 4RWOA 2DR8A 2DVIA 2IHMA 1KEJA 4KLGA 4LEVA 7ICSA 4QZDA 9ICBA 1ZQYA 5D49A 1RZTA 4KLUA 4PGXA 4KLJA 4M9HA 3NVOA 4F5QA 5DBBA 7ICLA 3L9DA 3EF2A 2DRAA 3HJ1A 4K96A 4ATBA 3RJIA 7ICQA 4KLTA 3OV7A 5HRGA 3V7JA 3RJKA 4JLZA 2PFPA 1F5AA 1BPYA 4QZAA 9ICIA 4WC7A 4AT9A 2FMQA 3JPTA 5CR0A 3MCRA 1JAJA 5D63A 9ICTA 4LVSA 4N7RA 1ZQNA 4UB1A 4M47A 1RPLA 4QZFA 4UBBA 3V7LA 4YN4A 3JPPA 2M2WA 5HREA 4PGQA 4K97A 1V4AA 1JQRA 4NXZA 3AQNA 3RJEA 4NM1A 3LQCB 5BOLA 4AT7B 5HRHA 4R63A 4X4RA 5DKWA 2BCSA 4QZ9A 2NRKA 1BPDA 5J2FA 1NO5A 4K98A 3C2MA 1ZQWA 3AQKA 4TUQA 2I9GA 3ERCC 5J2HA 4RT2A 4I29A 5DBAA 2PFQA 4WQKA 5HRDA 4AT8A 3JPRA 1VJ7A 4UB4A 4KLIA 3V7KA 4YCXA 2PFNA 4OAGA 4RT3A 4X5VA 4OAHA 4Z6DA 2FMSA 7ICEA 1KNYA 4I2DA 4UB3A 4UD5A 3UQ2A 2B4VA 4F5PA 4KLHA 4X4QA 3AQMA 4NXXA 3HW8A 4O67A 3JCFA 4EEBA 4KLLA 4NY8A 3JPOA 2BPCA 1MIWA 3NWIA 2M2UA 3MGHA 4R65A 1BPZA
chains in the Genus database with same CATH topology
4KB6A 2ZH2A 1UETA 4OAIZ 3ER8C 4K9AA 1TFWA 4FHXA 4FO1A 3PHZA 2DR7A 2DR8A 2DVIA 4E7XA 2ZH5A 4KM5A 4LEVA 4AT9B 2ZHBA 4WH5A 5CFTA 4O6AA 2ZH8A 4K9BA 3OUYA 3ER9B 3EF2A 2DRAA 4O68A 3HJ1A 4K96A 4ATBA 4UD4A 3OV7A 3K7DA 1R8CA 4JLZA 1F5AA 2FCLA 4ATBB 2ZH6A 2IHOA 3NKUA 4AT9A 4NKTA 4NXWA 2GA9D 4NXVA 3MCRA 2O1PA 4X4NA 2DRBA 1R8BA 5D63A 4N7RA 1R89A 3OVBA 4X4VA 2ZH9A 2GAFD 1Q79A 4K99A 1UEVA 4K8VA 2EWRA 4JLXA 4AT7A 4NXUA 5D61A 4K97A 4X4OA 3HJ4A 2B51A 4X4UA 5CFSA 4E80A 4AT7B 4X4RA 1Q78A 2ZH1A 3HIYA 4O69A 4XJEA 4LEWA 2B56A 4K98A 4X4SA 4MKPA 3ERCC 4FHVA 2HHPA 4WQKA 4LT6A 4AT8A 1TFYA 2ZH4A 3C66A 5CFUA 4FH5A 4X4PA 4FH3A 3NYBA 4WOYA 2DR5A 4E8FA 4AT8B 4FHWA 3OVAA 4OAGA 4FHYA 1R8AA 4LEYA 4WQLA 3OWGA 5CHEA 4OAHA 4X4TA 5B3QA 4UD5A 3OVSA 1UEUA 2DR9A 1FA0A 2B4VA 4X4QA 2ZH3A 5B3PA 4FHPA 4NXTA 4NXXA 5D62A 2ZH7A 4NKUA 4M5DA 4O67A 1GPJA 2Q66A 4LEZA 2ZHAA 4HX0A 4OAFA 3OUYB 4EP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLZ A;  4KB6 A;  4OAI Z;  4WOY A;  4ATB B;  4AT8 B;  4OAG A;  4K9A A;  4LEY A;  4AT7 B;  4OAH A;  4AT9 A;  4NXW A;  4NXV A;  4LEV A;  4KM5 A;  4O69 A;  4LEW A;  4K98 A;  4AT9 B;  4MKP A;  4O6A A;  4NXT A;  4NXX A;  4K9B A;  4O67 A;  4K99 A;  4O68 A;  4LEZ A;  4K96 A;  4ATB A;  4AT8 A;  4K8V A;  4JLX A;  4OAF A;  4AT7 A;  4NXU A;  4K97 A; 
#chains in the Genus database with same CATH topology
 3ER8 C;  1TFW A;  4YMO A;  4FHX A;  5DDM A;  3C18 A;  9ICS A;  4UAW A;  3HWT A;  4Z6C A;  2W9M A;  3WFQ E;  4AT9 B;  5CA7 A;  5J0T A;  8ICL A;  5CFT A;  4DOA A;  3WFP A;  1VFG A;  7ICM A;  8ICA A;  2BCQ A;  3ER9 B;  4KLO A;  9ICF A;  4O68 A;  7ICI A;  4KLD A;  3B0X A;  4UD4 A;  2FCL A;  4MFF A;  2ZH6 A;  4EED A;  7ICG A;  2IHO A;  1MQ3 A;  4NKT A;  4RPY A;  2GA9 D;  4RWN A;  4NXV A;  5HRB A;  4I2B A;  4RQ0 A;  3GDX A;  5BPC A;  4F5N A;  4XQ7 A;  4QZE A;  4X4V A;  2ZH9 A;  1MQ2 A;  4YD2 A;  9ICE A;  4K8V A;  5TZV A;  4KLM A;  3UPS A;  4P4O A;  4X4O A;  4GXK A;  4I27 A;  8ICF A;  7ICH A;  5HHH A;  1ZQP A;  4RWQ A;  4P2H A;  3UPQ A;  2ZH1 A;  7ICO A;  7ICU A;  4O69 A;  2BPG A;  3TFR A;  5DDY A;  4K4H A;  9ICK A;  1ZQR A;  4FHV A;  4WC1 A;  8ICU A;  2M2T A;  4WC3 A;  4M9N A;  3H38 A;  4FO6 A;  4XUS A;  4LT6 A;  1JMS A;  1ZQX A;  5BOM A;  9ICO A;  4IG8 A;  8ICI A;  4KLF A;  4E8F A;  3OVA A;  4X0B A;  4RQ2 A;  1TVA A;  5CHE A;  3UXO A;  4RQ5 A;  1ZQO A;  5CWR A;  4NM2 A;  8ICQ A;  8ICT A;  9ICW A;  3B0Y A;  4XQ8 A;  5B3Q A;  4MFA A;  5JTG A;  5J2A A;  8ICZ A;  3OVS A;  4PPX A;  8ICR A;  1UEU A;  2GWS A;  5CHG A;  1YLQ A;  2ZH3 A;  4WC0 A;  5J0W A;  5D62 A;  2BCU A;  2ZH7 A;  3RJJ A;  1GPJ A;  5III A;  2HN1 A;  2Q66 A;  3K75 D;  4M2Y A;  5HRL A;  2ZHA A;  4HX0 A;  3JPQ A;  1ZQD A;  8ICC A;  4EP7 A;  8ICN A;  5F2V O;  3AU6 A;  3JYY A;  5DBC A;  1UET A;  1ZQA A;  2FMP A;  1BPB A;  4WBY A;  4RQ6 A;  4FO1 A;  3AU2 A;  4RWP A;  2DR7 A;  4E7X A;  2ZH5 A;  4PGY A;  4R64 A;  8ICG A;  4JWM A;  2ZHB A;  5CJ7 A;  1TV9 A;  2BPF A;  4O6A A;  4TUP A;  7ICF A;  4YD1 A;  5HRI A;  4IQW A;  4JWN A;  1ZQG A;  4EGW A;  3MGI A;  5J2D A;  4UB2 A;  1ZQH A;  3WFR E;  8ICJ A;  1ZQU A;  5DB7 A;  3K7D A;  3C5F A;  4GXI A;  1ZJN A;  4ATB B;  3C2L A;  9ICR A;  3NKU A;  4Z6E A;  4UBC A;  1ZQC A;  4EBJ A;  4O5K A;  4I2H A;  4X4N A;  2DRB A;  2PFO A;  1R89 A;  1ZQF A;  5J0U A;  3OVB A;  2GAF D;  9ICP A;  4K99 A;  1UEV A;  4QZC A;  7ICN A;  1ZQV A;  5J29 A;  2EWR A;  5DB6 A;  1ZQL A;  4AT7 A;  5D61 A;  4RPX A;  3HJ4 A;  4MF2 A;  2B51 A;  3MDA A;  5HC9 A;  3RJH A;  5CFS A;  4I2A A;  4E80 A;  3AUO A;  4F5O A;  4NLN A;  1Q78 A;  5IIM A;  4MFC A;  5IIK A;  1BPX A;  4XJE A;  4LEW A;  4KLS A;  4I0U A;  2BCV A;  5J2K A;  4PHP A;  3MDC A;  1OU5 A;  1ZQQ A;  1TFY A;  2ZH4 A;  3C66 A;  4O5E A;  4FH5 A;  4X4P A;  3ISB A;  9ICV A;  4PHE A;  3NYB A;  4AT8 B;  4LEY A;  4FHY A;  5DB9 A;  1R8A A;  4WQL A;  2P66 A;  4IQV A;  8ICS A;  1ZQJ A;  4M9G A;  8ICY A;  4PHA A;  8ICH A;  2DR9 A;  1JN3 A;  1NOM A;  1ZQT A;  5D4B A;  4NKU A;  2M2V A;  5HRF A;  3PNC A;  8ICO A;  5J2B A;  4DOC A;  9ICA A;  4R66 A;  4WC5 A;  4WC6 A;  2BBH A;  3C2K A;  4XA5 A;  4OAF A;  4P4M A;  1PX5 A;  3LK9 A;  3C5G A;  2HN2 A;  4WBZ A;  4RQ8 A;  4P4P A;  4UB5 A;  7ICV A;  4KB6 A;  2ZH2 A;  4EV6 A;  3RH6 A;  5J0S A;  9ICU A;  1ZJM A;  4RQ4 A;  3PHZ A;  2IUB A;  1XSP A;  4NLK A;  9ICG A;  4KM5 A;  5J0Q A;  4I2J A;  3UXN A;  4DOB A;  4WH5 A;  2BCR A;  4O9M A;  1ZQZ A;  1KDH A;  4KLQ A;  2ZH8 A;  5J2C A;  4K9B A;  4DO9 A;  4QZB A;  3ISC A;  3H37 A;  3OUY A;  3MBY A;  5J2I A;  4M9L A;  4YMM A;  2ISP A;  7ICK A;  1XSL A;  4F5R A;  4K4G A;  2RFF A;  4TUR A;  3PMN A;  1R8C A;  9ICM A;  4IQT A;  5J2E A;  8ICE A;  4TUS A;  4NXW A;  1MIY A;  9ICC A;  1ZQE A;  2PBE A;  7ICR A;  4X0A A;  4WCW A;  3TFS A;  2O1P A;  3WFS C;  9ICL A;  1R8B A;  2ID1 A;  5HHI A;  4S3N A;  4RQ1 A;  5D46 A;  5J0O A;  3V72 A;  9ICQ A;  1BPE A;  1Q79 A;  3H3A A;  1HUO A;  4I2F A;  9ICN A;  8ICV A;  9ICX A;  4JLX A;  5J0X A;  3ISD A;  4NXU A;  3RJG A;  4I2E A;  2VAN A;  3JPN A;  4X4U A;  4WC2 A;  2BBJ A;  4RQ3 A;  3CK6 A;  5CP2 A;  1XSN A;  3HIY A;  4YMN A;  2B56 A;  4PHD A;  4X4S A;  4MKP A;  5J0Y A;  4QZI A;  5IIN A;  5IIO A;  9ICH A;  2PXI A;  5DED A;  4I2C A;  4I28 A;  1ZQK A;  4UAY A;  4M9J A;  4RPZ A;  2HHP A;  3HX0 A;  3JPS A;  4LZG A;  5J0R A;  4I2G A;  5J0P A;  8ICB A;  5J2G A;  4I2I A;  8ICW A;  5CFU A;  4QZH A;  5IIL A;  4Z6F A;  4FH3 A;  4WOY A;  3H39 A;  4LZD A;  2DR5 A;  1MIV A;  8ICM A;  4FHW A;  4KLE A;  4IQU A;  1WOT A;  3UXP A;  3OWG A;  7ICP A;  4PH5 A;  2O5A A;  5J2J A;  3JZ0 A;  3PML A;  2ISO A;  4X4T A;  4M04 A;  4QZ8 A;  7ICT A;  1ZQS A;  1ZQB A;  8ICK A;  1FA0 A;  4WC4 A;  5B3P A;  5EOZ A;  1HUZ A;  4K4I A;  4FHP A;  4NXT A;  2BE3 A;  5HRK A;  4O5C A;  4M5D A;  8ICX A;  7ICJ A;  8ICP A;  4QZG A;  4GXJ A;  5IIJ A;  4LEZ A;  4NLZ A;  5DEC A;  3OUY B;  3RJF A;  4MF8 A;  1ZQM A;  3RH5 A;  3OGU A;  3RH4 A;  9ICJ A;  5DB8 A;  4OAI Z;  4XRH A;  3AQL A;  3UQ0 A;  1ZQI A;  4K9A A;  4UAZ A;  3WFO A;  5HR9 A;  4EBK A;  4RQ7 A;  4M0A A;  5CB1 A;  4RWO A;  2DR8 A;  2DVI A;  2IHM A;  1KEJ A;  4KLG A;  4LEV A;  7ICS A;  4QZD A;  9ICB A;  1ZQY A;  5D49 A;  1RZT A;  4KLU A;  4PGX A;  4KLJ A;  4M9H A;  3NVO A;  4F5Q A;  5DBB A;  7ICL A;  3L9D A;  3EF2 A;  2DRA A;  3HJ1 A;  4K96 A;  4ATB A;  3RJI A;  7ICQ A;  4KLT A;  3OV7 A;  5HRG A;  3V7J A;  3RJK A;  4JLZ A;  2PFP A;  1F5A A;  1BPY A;  4QZA A;  9ICI A;  4WC7 A;  4AT9 A;  2FMQ A;  3JPT A;  5CR0 A;  3MCR A;  1JAJ A;  5D63 A;  9ICT A;  4LVS A;  4N7R A;  1ZQN A;  4UB1 A;  4M47 A;  1RPL A;  4QZF A;  4UBB A;  3V7L A;  4YN4 A;  3JPP A;  2M2W A;  5HRE A;  4PGQ A;  4K97 A;  1V4A A;  1JQR A;  4NXZ A;  3AQN A;  3RJE A;  4NM1 A;  3LQC B;  5BOL A;  4AT7 B;  5HRH A;  4R63 A;  4X4R A;  5DKW A;  2BCS A;  4QZ9 A;  2NRK A;  1BPD A;  5J2F A;  1NO5 A;  4K98 A;  3C2M A;  1ZQW A;  3AQK A;  4TUQ A;  2I9G A;  3ERC C;  5J2H A;  4RT2 A;  4I29 A;  5DBA A;  2PFQ A;  4WQK A;  5HRD A;  4AT8 A;  3JPR A;  1VJ7 A;  4UB4 A;  4KLI A;  3V7K A;  4YCX A;  2PFN A;  4OAG A;  4RT3 A;  4X5V A;  4OAH A;  4Z6D A;  2FMS A;  7ICE A;  1KNY A;  4I2D A;  4UB3 A;  4UD5 A;  3UQ2 A;  2B4V A;  4F5P A;  4KLH A;  4X4Q A;  3AQM A;  4NXX A;  3HW8 A;  4O67 A;  3JCF A;  4EEB A;  4KLL A;  4NY8 A;  3JPO A;  2BPC A;  1MIW A;  3NWI A;  2M2U A;  3MGH A;  4R65 A;  1BPZ A; 
#chains in the Genus database with same CATH homology
 4KB6 A;  2ZH2 A;  1UET A;  4OAI Z;  3ER8 C;  4K9A A;  1TFW A;  4FHX A;  4FO1 A;  3PHZ A;  2DR7 A;  2DR8 A;  2DVI A;  4E7X A;  2ZH5 A;  4KM5 A;  4LEV A;  4AT9 B;  2ZHB A;  4WH5 A;  5CFT A;  4O6A A;  2ZH8 A;  4K9B A;  3OUY A;  3ER9 B;  3EF2 A;  2DRA A;  4O68 A;  3HJ1 A;  4K96 A;  4ATB A;  4UD4 A;  3OV7 A;  3K7D A;  1R8C A;  4JLZ A;  1F5A A;  2FCL A;  4ATB B;  2ZH6 A;  2IHO A;  3NKU A;  4AT9 A;  4NKT A;  4NXW A;  2GA9 D;  4NXV A;  3MCR A;  2O1P A;  4X4N A;  2DRB A;  1R8B A;  5D63 A;  4N7R A;  1R89 A;  3OVB A;  4X4V A;  2ZH9 A;  2GAF D;  1Q79 A;  4K99 A;  1UEV A;  4K8V A;  2EWR A;  4JLX A;  4AT7 A;  4NXU A;  5D61 A;  4K97 A;  4X4O A;  3HJ4 A;  2B51 A;  4X4U A;  5CFS A;  4E80 A;  4AT7 B;  4X4R A;  1Q78 A;  2ZH1 A;  3HIY A;  4O69 A;  4XJE A;  4LEW A;  2B56 A;  4K98 A;  4X4S A;  4MKP A;  3ERC C;  4FHV A;  2HHP A;  4WQK A;  4LT6 A;  4AT8 A;  1TFY A;  2ZH4 A;  3C66 A;  5CFU A;  4FH5 A;  4X4P A;  4FH3 A;  3NYB A;  4WOY A;  2DR5 A;  4E8F A;  4AT8 B;  4FHW A;  3OVA A;  4OAG A;  4FHY A;  1R8A A;  4LEY A;  4WQL A;  3OWG A;  5CHE A;  4OAH A;  4X4T A;  5B3Q A;  4UD5 A;  3OVS A;  1UEU A;  2DR9 A;  1FA0 A;  2B4V A;  4X4Q A;  2ZH3 A;  5B3P A;  4FHP A;  4NXT A;  4NXX A;  5D62 A;  2ZH7 A;  4NKU A;  4M5D A;  4O67 A;  1GPJ A;  2Q66 A;  4LEZ A;  2ZHA A;  4HX0 A;  4OAF A;  3OUY B;  4EP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...