4WOYA

Crystal structure and functional analysis of mid49, a receptor for the mitochondrial fission protein drp1
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
329
structure length
329
Chain Sequence
TFQERLLAFERKHVITPEAHVTLAKQLAGDIALELQAYLRSKFPELPFGALVPGGPLYDGLQAGTAEHVRLLAPLELEPGLWSLVPGVDTVAAEPRCWAVRRTQLEFHPRGCSPWDRFLVGGYLSSRVLLELLRKALSASVNWPAIGSLLGCLIWPDVASEELLLKVQHECLEFTLAVLMVVPGASTDDRLLLAWPLEGLASNLWLQDLYPVETARLRALDDQDAGTRRRLLLLLCGICRGHPALVRLGWSHLTQVVLHLGEEEVAWTEEALGERFLQALEFLVGSLEQASLPCHFNPSVNLLGNFREEEIDDIGYVLYSGLQVPESLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamics protein MID49
publication title Crystal structure and functional analysis of MiD49, a receptor for the mitochondrial fission protein Drp1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 98
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4woyA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4woyA02
4LEVA 4AT9A 4JLXA 4NXWA 4KM5A 4AT7B 4K9AA 4O69A 4WOYA 4NXVA 4O68A 4K96A 4JLZA 4LEZA 4LEYA 4OAGA 4AT8A 4KB6A 4NXTA 4ATBA 4OAIZ 4O6AA 4AT9B 4NXXA 4MKPA 4OAFA 4AT7A 4OAHA 4LEWA 4NXUA 4AT8B 4K97A 4K9BA 4K99A 4O67A 4ATBB 4K8VA 4K98A
chains in the Genus database with same CATH superfamily
7ICMA 3HJ1A 4Z6DA 1R8CA 4R66A 4O69A 2PFNA 4XQ7A 4RPZA 5J0SA 4LT6A 9ICFA 4WH5A 2VANA 5BOLA 4PGYA 3C2KA 4M9NA 4DO9A 1HUZA 3OVSA 8ICKA 4PHAA 5HRDA 2ZH9A 4LEWA 4DOCA 4LZGA 1PX5A 2O1PA 1BPXA 1VJ7A 4I2JA 8ICVA 5J0OA 2BCVA 5DDYA 4F5RA 9ICNA 4FHYA 4KLTA 4KLEA 4GXIA 4UAWA 4RQ0A 4TUQA 2O5AA 3H37A 4FHVA 4RWNA 4OAFA 3OUYB 4YMNA 5HRKA 3ER8C 8ICGA 4AT8B 1BPDA 5IIOA 2DR8A 5D46A 4YMMA 1KNYA 3C2LA 2BCQA 4QZAA 4I2DA 2FMSA 2P66A 4UB2A 4I2EA 2BBHA 2BCRA 5HHIA 5CHGA 9ICQA 2FMPA 3ERCC 5DKWA 4R63A 8ICWA 3RJHA 3OV7A 4QZ8A 1TVAA 4X4SA 2IUBA 9ICOA 4P4PA 3LQCB 4K97A 4DOBA 4K9BA 7ICIA 3ISBA 5HRGA 4RPYA 5J2AA 7ICNA 2W9MA 4RQ8A 1ZQEA 4LEVA 3MGIA 1MQ3A 5CR0A 4KLIA 1ZQHA 7ICUA 8ICJA 4KM5A 4X4RA 2DVIA 4NXZA 4KLUA 1KDHA 4RQ2A 3WFRE 2ID1A 3UXPA 4M0AA 9ICTA 3HX0A 3C5GA 1ZQKA 2ZHAA 2FMQA 7ICOA 4NXXA 4F5OA 5J2EA 2DR7A 2PBEA 2M2WA 4WC0A 5DB9A 4UD4A 4M9LA 5B3QA 5DDMA 4RWQA 2B4VA 4PHDA 3UQ2A 1ZQCA 4FHXA 3UQ0A 2ZH2A 3H39A 4WC4A 5BPCA 2BPFA 3OUYA 3AU2A 1R8AA 1R8BA 5HRIA 4JLZA 3ER9B 5J2JA 4OAGA 4AT8A 1ZQRA 3K7DA 1ZQUA 1ZQYA 5EOZA 3UPSA 5B3PA 1ZQNA 1ZQWA 3GDXA 7ICPA 5J2GA 4NLNA 4X4NA 8ICXA 2GWSA 3B0XA 3H3AA 2GA9D 4F5PA 3MCRA 3HWTA 4I2BA 5IIJA 2BCSA 5D61A 1ZQXA 4UB4A 4IQWA 5DBAA 4LEYA 3PHZA 4QZHA 1FA0A 5DBBA 3HIYA 4AT9B 5DB7A 9ICMA 4E8FA 3OVBA 3TFRA 1ZQVA 4X4PA 7ICEA 4RT3A 5TZVA 4P2HA 5IIIA 1BPZA 4O5KA 5CFTA 4XUSA 9ICSA 2IHMA 3JPTA 8ICTA 3RH4A 4MFFA 4NKUA 2BCUA 4TUSA 3WFOA 5J2FA 8ICSA 4K96A 4PGQA 4O5CA 3JPPA 4PHPA 9ICCA 4PH5A 7ICVA 3TFSA 1MQ2A 8ICYA 5HRBA 1Q78A 4RQ1A 3AUOA 4UAYA 4M9JA 3MDCA 9ICUA 4I27A 4R64A 4YMOA 2M2TA 3K75D 3UPQA 1V4AA 4X4OA 4KLMA 1ZQBA 1R89A 4X4VA 2I9GA 2M2VA 4EEDA 4HX0A 5D4BA 4KLQA 4MFAA 4MF8A 4MFCA 3C66A 7ICHA 4F5NA 5CFUA 7ICJA 5DEDA 2M2UA 4EBKA 5CJ7A 8ICLA 7ICRA 5HRLA 3WFPA 3PMNA 3AQKA 5DB8A 4EGWA 4GXJA 1ZQGA 4EV6A 4RPXA 1ZQLA 1BPBA 1TFWA 1TV9A 8ICNA 1WOTA 9ICEA 5HREA 4OAHA 9ICHA 1ZQIA 9ICGA 7ICGA 4P4MA 1MIWA 5IINA 4FHWA 1ZQZA 2ZH4A 2RFFA 4AT9A 4M9GA 4X0BA 2NRKA 5CFSA 2PXIA 1BPEA 2HN1A 3ISDA 9ICWA 9ICRA 4RQ5A 4RQ3A 8ICAA 1JN3A 4QZGA 4LEZA 3RJFA 3RJJA 4KLLA 8ICZA 1JMSA 4WBYA 1ZQJA 4KB6A 1NO5A 3C5FA 1XSNA 4XA5A 1F5AA 4FH5A 4NLZA 1ZJNA 4RQ4A 4WC1A 4EP7A 5J2BA 4WC5A 4X4QA 4LZDA 4FH3A 4NY8A 4RQ7A 4QZCA 4DOAA 4FO6A 5J0RA 7ICKA 4FHPA 3C18A 7ICQA 4X4TA 4KLSA 4QZEA 4YD2A 3V7KA 2B56A 4R65A 5J0QA 4NM2A 2ISOA 4WC7A 4I28A 4KLDA 2HN2A 7ICTA 5DECA 3NVOA 5D62A 2ISPA 1VFGA 2ZH1A 4YD1A 3V7LA 3HJ4A 3ISCA 4WC3A 2B51A 1TFYA 4QZDA 4QZIA 4JWMA 2DRBA 4KLHA 4O5EA 1UEVA 2GAFD 4FO1A 8ICRA 1ZQAA 4K98A 3AU6A 1RZTA 3MDAA 4I29A 4M2YA 3OVAA 4JLXA 5CWRA 3LK9A 3RJKA 4WBZA 1NOMA 4IQTA 9ICBA 9ICVA 5IIKA 3JZ0A 7ICFA 3RJIA 8ICQA 9ICJA 8ICMA 3MBYA 4NXTA 9ICLA 5HRFA 3RJGA 4QZBA 9ICPA 4RWOA 4Z6EA 4WC2A 4KLOA 8ICPA 4I2HA 4WCWA 3RH5A 4KLGA 3UXNA 2ZH6A 8ICHA 7ICSA 3JCFA 5J0PA 1MIVA 5JTGA 5J2IA 1OU5A 4GXKA 1ZQPA 4X4UA 4NLKA 7ICLA 2EWRA 1XSPA 3AQNA 1ZQSA 9ICXA 1YLQA 4S3NA 1ZQOA 2DRAA 4PGXA 5J2HA 4I0UA 4WC6A 3V72A 5D49A 5HHHA 4WQKA 1UEUA 2BPGA 3L9DA 1ZQDA 4K4IA 2PFQA 4KLJA 3V7JA 4I2GA 4E7XA 5J2DA 5F2VO 4K99A 4O67A 4ATBB 1ZQFA 1ZJMA 4Z6CA 3RH6A 4M47A 4UB5A 3JPOA 8ICCA 3JYYA 4NM1A 4K9AA 4RWPA 4NXVA 4O68A 4N7RA 5J2CA 4IQUA 4UBBA 4JWNA 5HRHA 9ICIA 3NKUA 3JPRA 4K4GA 4O6AA 2PFPA 2FCLA 3JPSA 3NWIA 8ICBA 5HC9A 8ICFA 4M9HA 1BPYA 5BOMA 9ICKA 2BE3A 5CP2A 3OGUA 4E80A 2IHOA 3HW8A 4PHEA 1KEJA 4KLFA 4AT7B 4M04A 3C2MA 3H38A 4WOYA 5HR9A 4PPXA 4RT2A 3UXOA 3B0YA 4XQ8A 3WFSC 2DR9A 4I2IA 5J29A 4UBCA 1ZQQA 4OAIZ 3OWGA 9ICAA 4QZFA 5J2KA 3WFQE 3AQLA 1ZQMA 5IILA 4EBJA 1JAJA 8ICUA 4M5DA 4Z6FA 4O9MA 4TURA 4I2AA 5CA7A 3PMLA 3RJEA 4IQVA 1MIYA 4NXWA 5DB6A 2DR5A 5J0TA 4QZ9A 2BBJA 4WQLA 4XRHA 4EEBA 2HHPA 4K4HA 3PNCA 3NYBA 4ATBA 5IIMA 8ICEA 4MKPA 3CK6A 4XJEA 1HUOA 4UAZA 4NKTA 1GPJA 2ZH7A 5J0UA 5J0WA 2Q66A 1Q79A 4I2CA 4K8VA 3AQMA 4RQ6A 4UD5A 2ZH3A 4UB3A 3JPNA 4MF2A 4TUPA 5DBCA 2ZH8A 4X0AA 4P4OA 4YCXA 4I2FA 5J0XA 2ZHBA 5CHEA 3MGHA 1UETA 1RPLA 5D63A 1JQRA 4AT7A 3EF2A 4LVSA 2BPCA 4NXUA 2ZH5A 4X5VA 4IG8A 2PFOA 8ICOA 5J0YA 4YN4A 3JPQA 1XSLA 4UB1A 1ZQTA 8ICIA 5CB1A 4F5QA
chains in the Genus database with same CATH topology
2ZH4A 4FHXA 4AT9A 2ZH2A 3HJ1A 5CFSA 1R8CA 4K9AA 3OUYA 4O69A 1R8AA 4NXVA 4O68A 4N7RA 1R8BA 4JLZA 4LEZA 3ER9B 4OAGA 4LT6A 4AT8A 3K7DA 4KB6A 5B3PA 3NKUA 4WH5A 1F5AA 4FH5A 4O6AA 2FCLA 3OVSA 4EP7A 2ZH9A 4LEWA 4X4QA 4X4NA 2O1PA 4FH3A 4E80A 2IHOA 2GA9D 4FHPA 3MCRA 4X4TA 4AT7B 2B56A 5D61A 4WOYA 4LEYA 3PHZA 2DR9A 4FHYA 1FA0A 4OAIZ 3OWGA 5D62A 3HIYA 4AT9B 2ZH1A 4FHVA 3HJ4A 4E8FA 3OVBA 4OAFA 2B51A 3OUYB 1TFYA 4X4PA 3ER8C 2DRBA 4AT8B 1UEVA 2GAFD 2DR8A 4M5DA 4FO1A 5CFTA 4K98A 3OVAA 4JLXA 4NXWA 4NKUA 2DR5A 4K96A 4WQLA 2HHPA 4NXTA 3NYBA 4ATBA 3ERCC 1Q78A 4MKPA 4XJEA 3OV7A 4X4OA 2ZH6A 4NKTA 1R89A 4X4SA 1GPJA 4X4VA 2ZH7A 4K97A 4K9BA 2Q66A 4X4UA 1Q79A 2EWRA 4K8VA 4HX0A 4LEVA 4UD5A 2ZH3A 4KM5A 4X4RA 2DRAA 2DVIA 3C66A 5CFUA 2ZH8A 2ZHAA 2ZHBA 4WQKA 5CHEA 4NXXA 1UEUA 1UETA 1TFWA 5D63A 4AT7A 4OAHA 2DR7A 3EF2A 4UD4A 4NXUA 2ZH5A 5B3QA 4E7XA 4FHWA 2B4VA 4K99A 4O67A 4ATBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LEV A;  4AT9 A;  4JLX A;  4NXW A;  4KM5 A;  4AT7 B;  4K9A A;  4O69 A;  4WOY A;  4NXV A;  4O68 A;  4K96 A;  4JLZ A;  4LEZ A;  4LEY A;  4OAG A;  4AT8 A;  4KB6 A;  4NXT A;  4ATB A;  4OAI Z;  4O6A A;  4AT9 B;  4NXX A;  4MKP A;  4OAF A;  4AT7 A;  4OAH A;  4LEW A;  4NXU A;  4AT8 B;  4K97 A;  4K9B A;  4K99 A;  4O67 A;  4ATB B;  4K8V A;  4K98 A; 
#chains in the Genus database with same CATH topology
 7ICM A;  3HJ1 A;  4Z6D A;  1R8C A;  4R66 A;  4O69 A;  2PFN A;  4XQ7 A;  4RPZ A;  5J0S A;  4LT6 A;  9ICF A;  4WH5 A;  2VAN A;  5BOL A;  4PGY A;  3C2K A;  4M9N A;  4DO9 A;  1HUZ A;  3OVS A;  8ICK A;  4PHA A;  5HRD A;  2ZH9 A;  4LEW A;  4DOC A;  4LZG A;  1PX5 A;  2O1P A;  1BPX A;  1VJ7 A;  4I2J A;  8ICV A;  5J0O A;  2BCV A;  5DDY A;  4F5R A;  9ICN A;  4FHY A;  4KLT A;  4KLE A;  4GXI A;  4UAW A;  4RQ0 A;  4TUQ A;  2O5A A;  3H37 A;  4FHV A;  4RWN A;  4OAF A;  3OUY B;  4YMN A;  5HRK A;  3ER8 C;  8ICG A;  4AT8 B;  1BPD A;  5IIO A;  2DR8 A;  5D46 A;  4YMM A;  1KNY A;  3C2L A;  2BCQ A;  4QZA A;  4I2D A;  2FMS A;  2P66 A;  4UB2 A;  4I2E A;  2BBH A;  2BCR A;  5HHI A;  5CHG A;  9ICQ A;  2FMP A;  3ERC C;  5DKW A;  4R63 A;  8ICW A;  3RJH A;  3OV7 A;  4QZ8 A;  1TVA A;  4X4S A;  2IUB A;  9ICO A;  4P4P A;  3LQC B;  4K97 A;  4DOB A;  4K9B A;  7ICI A;  3ISB A;  5HRG A;  4RPY A;  5J2A A;  7ICN A;  2W9M A;  4RQ8 A;  1ZQE A;  4LEV A;  3MGI A;  1MQ3 A;  5CR0 A;  4KLI A;  1ZQH A;  7ICU A;  8ICJ A;  4KM5 A;  4X4R A;  2DVI A;  4NXZ A;  4KLU A;  1KDH A;  4RQ2 A;  3WFR E;  2ID1 A;  3UXP A;  4M0A A;  9ICT A;  3HX0 A;  3C5G A;  1ZQK A;  2ZHA A;  2FMQ A;  7ICO A;  4NXX A;  4F5O A;  5J2E A;  2DR7 A;  2PBE A;  2M2W A;  4WC0 A;  5DB9 A;  4UD4 A;  4M9L A;  5B3Q A;  5DDM A;  4RWQ A;  2B4V A;  4PHD A;  3UQ2 A;  1ZQC A;  4FHX A;  3UQ0 A;  2ZH2 A;  3H39 A;  4WC4 A;  5BPC A;  2BPF A;  3OUY A;  3AU2 A;  1R8A A;  1R8B A;  5HRI A;  4JLZ A;  3ER9 B;  5J2J A;  4OAG A;  4AT8 A;  1ZQR A;  3K7D A;  1ZQU A;  1ZQY A;  5EOZ A;  3UPS A;  5B3P A;  1ZQN A;  1ZQW A;  3GDX A;  7ICP A;  5J2G A;  4NLN A;  4X4N A;  8ICX A;  2GWS A;  3B0X A;  3H3A A;  2GA9 D;  4F5P A;  3MCR A;  3HWT A;  4I2B A;  5IIJ A;  2BCS A;  5D61 A;  1ZQX A;  4UB4 A;  4IQW A;  5DBA A;  4LEY A;  3PHZ A;  4QZH A;  1FA0 A;  5DBB A;  3HIY A;  4AT9 B;  5DB7 A;  9ICM A;  4E8F A;  3OVB A;  3TFR A;  1ZQV A;  4X4P A;  7ICE A;  4RT3 A;  5TZV A;  4P2H A;  5III A;  1BPZ A;  4O5K A;  5CFT A;  4XUS A;  9ICS A;  2IHM A;  3JPT A;  8ICT A;  3RH4 A;  4MFF A;  4NKU A;  2BCU A;  4TUS A;  3WFO A;  5J2F A;  8ICS A;  4K96 A;  4PGQ A;  4O5C A;  3JPP A;  4PHP A;  9ICC A;  4PH5 A;  7ICV A;  3TFS A;  1MQ2 A;  8ICY A;  5HRB A;  1Q78 A;  4RQ1 A;  3AUO A;  4UAY A;  4M9J A;  3MDC A;  9ICU A;  4I27 A;  4R64 A;  4YMO A;  2M2T A;  3K75 D;  3UPQ A;  1V4A A;  4X4O A;  4KLM A;  1ZQB A;  1R89 A;  4X4V A;  2I9G A;  2M2V A;  4EED A;  4HX0 A;  5D4B A;  4KLQ A;  4MFA A;  4MF8 A;  4MFC A;  3C66 A;  7ICH A;  4F5N A;  5CFU A;  7ICJ A;  5DED A;  2M2U A;  4EBK A;  5CJ7 A;  8ICL A;  7ICR A;  5HRL A;  3WFP A;  3PMN A;  3AQK A;  5DB8 A;  4EGW A;  4GXJ A;  1ZQG A;  4EV6 A;  4RPX A;  1ZQL A;  1BPB A;  1TFW A;  1TV9 A;  8ICN A;  1WOT A;  9ICE A;  5HRE A;  4OAH A;  9ICH A;  1ZQI A;  9ICG A;  7ICG A;  4P4M A;  1MIW A;  5IIN A;  4FHW A;  1ZQZ A;  2ZH4 A;  2RFF A;  4AT9 A;  4M9G A;  4X0B A;  2NRK A;  5CFS A;  2PXI A;  1BPE A;  2HN1 A;  3ISD A;  9ICW A;  9ICR A;  4RQ5 A;  4RQ3 A;  8ICA A;  1JN3 A;  4QZG A;  4LEZ A;  3RJF A;  3RJJ A;  4KLL A;  8ICZ A;  1JMS A;  4WBY A;  1ZQJ A;  4KB6 A;  1NO5 A;  3C5F A;  1XSN A;  4XA5 A;  1F5A A;  4FH5 A;  4NLZ A;  1ZJN A;  4RQ4 A;  4WC1 A;  4EP7 A;  5J2B A;  4WC5 A;  4X4Q A;  4LZD A;  4FH3 A;  4NY8 A;  4RQ7 A;  4QZC A;  4DOA A;  4FO6 A;  5J0R A;  7ICK A;  4FHP A;  3C18 A;  7ICQ A;  4X4T A;  4KLS A;  4QZE A;  4YD2 A;  3V7K A;  2B56 A;  4R65 A;  5J0Q A;  4NM2 A;  2ISO A;  4WC7 A;  4I28 A;  4KLD A;  2HN2 A;  7ICT A;  5DEC A;  3NVO A;  5D62 A;  2ISP A;  1VFG A;  2ZH1 A;  4YD1 A;  3V7L A;  3HJ4 A;  3ISC A;  4WC3 A;  2B51 A;  1TFY A;  4QZD A;  4QZI A;  4JWM A;  2DRB A;  4KLH A;  4O5E A;  1UEV A;  2GAF D;  4FO1 A;  8ICR A;  1ZQA A;  4K98 A;  3AU6 A;  1RZT A;  3MDA A;  4I29 A;  4M2Y A;  3OVA A;  4JLX A;  5CWR A;  3LK9 A;  3RJK A;  4WBZ A;  1NOM A;  4IQT A;  9ICB A;  9ICV A;  5IIK A;  3JZ0 A;  7ICF A;  3RJI A;  8ICQ A;  9ICJ A;  8ICM A;  3MBY A;  4NXT A;  9ICL A;  5HRF A;  3RJG A;  4QZB A;  9ICP A;  4RWO A;  4Z6E A;  4WC2 A;  4KLO A;  8ICP A;  4I2H A;  4WCW A;  3RH5 A;  4KLG A;  3UXN A;  2ZH6 A;  8ICH A;  7ICS A;  3JCF A;  5J0P A;  1MIV A;  5JTG A;  5J2I A;  1OU5 A;  4GXK A;  1ZQP A;  4X4U A;  4NLK A;  7ICL A;  2EWR A;  1XSP A;  3AQN A;  1ZQS A;  9ICX A;  1YLQ A;  4S3N A;  1ZQO A;  2DRA A;  4PGX A;  5J2H A;  4I0U A;  4WC6 A;  3V72 A;  5D49 A;  5HHH A;  4WQK A;  1UEU A;  2BPG A;  3L9D A;  1ZQD A;  4K4I A;  2PFQ A;  4KLJ A;  3V7J A;  4I2G A;  4E7X A;  5J2D A;  5F2V O;  4K99 A;  4O67 A;  4ATB B;  1ZQF A;  1ZJM A;  4Z6C A;  3RH6 A;  4M47 A;  4UB5 A;  3JPO A;  8ICC A;  3JYY A;  4NM1 A;  4K9A A;  4RWP A;  4NXV A;  4O68 A;  4N7R A;  5J2C A;  4IQU A;  4UBB A;  4JWN A;  5HRH A;  9ICI A;  3NKU A;  3JPR A;  4K4G A;  4O6A A;  2PFP A;  2FCL A;  3JPS A;  3NWI A;  8ICB A;  5HC9 A;  8ICF A;  4M9H A;  1BPY A;  5BOM A;  9ICK A;  2BE3 A;  5CP2 A;  3OGU A;  4E80 A;  2IHO A;  3HW8 A;  4PHE A;  1KEJ A;  4KLF A;  4AT7 B;  4M04 A;  3C2M A;  3H38 A;  4WOY A;  5HR9 A;  4PPX A;  4RT2 A;  3UXO A;  3B0Y A;  4XQ8 A;  3WFS C;  2DR9 A;  4I2I A;  5J29 A;  4UBC A;  1ZQQ A;  4OAI Z;  3OWG A;  9ICA A;  4QZF A;  5J2K A;  3WFQ E;  3AQL A;  1ZQM A;  5IIL A;  4EBJ A;  1JAJ A;  8ICU A;  4M5D A;  4Z6F A;  4O9M A;  4TUR A;  4I2A A;  5CA7 A;  3PML A;  3RJE A;  4IQV A;  1MIY A;  4NXW A;  5DB6 A;  2DR5 A;  5J0T A;  4QZ9 A;  2BBJ A;  4WQL A;  4XRH A;  4EEB A;  2HHP A;  4K4H A;  3PNC A;  3NYB A;  4ATB A;  5IIM A;  8ICE A;  4MKP A;  3CK6 A;  4XJE A;  1HUO A;  4UAZ A;  4NKT A;  1GPJ A;  2ZH7 A;  5J0U A;  5J0W A;  2Q66 A;  1Q79 A;  4I2C A;  4K8V A;  3AQM A;  4RQ6 A;  4UD5 A;  2ZH3 A;  4UB3 A;  3JPN A;  4MF2 A;  4TUP A;  5DBC A;  2ZH8 A;  4X0A A;  4P4O A;  4YCX A;  4I2F A;  5J0X A;  2ZHB A;  5CHE A;  3MGH A;  1UET A;  1RPL A;  5D63 A;  1JQR A;  4AT7 A;  3EF2 A;  4LVS A;  2BPC A;  4NXU A;  2ZH5 A;  4X5V A;  4IG8 A;  2PFO A;  8ICO A;  5J0Y A;  4YN4 A;  3JPQ A;  1XSL A;  4UB1 A;  1ZQT A;  8ICI A;  5CB1 A;  4F5Q A; 
#chains in the Genus database with same CATH homology
 2ZH4 A;  4FHX A;  4AT9 A;  2ZH2 A;  3HJ1 A;  5CFS A;  1R8C A;  4K9A A;  3OUY A;  4O69 A;  1R8A A;  4NXV A;  4O68 A;  4N7R A;  1R8B A;  4JLZ A;  4LEZ A;  3ER9 B;  4OAG A;  4LT6 A;  4AT8 A;  3K7D A;  4KB6 A;  5B3P A;  3NKU A;  4WH5 A;  1F5A A;  4FH5 A;  4O6A A;  2FCL A;  3OVS A;  4EP7 A;  2ZH9 A;  4LEW A;  4X4Q A;  4X4N A;  2O1P A;  4FH3 A;  4E80 A;  2IHO A;  2GA9 D;  4FHP A;  3MCR A;  4X4T A;  4AT7 B;  2B56 A;  5D61 A;  4WOY A;  4LEY A;  3PHZ A;  2DR9 A;  4FHY A;  1FA0 A;  4OAI Z;  3OWG A;  5D62 A;  3HIY A;  4AT9 B;  2ZH1 A;  4FHV A;  3HJ4 A;  4E8F A;  3OVB A;  4OAF A;  2B51 A;  3OUY B;  1TFY A;  4X4P A;  3ER8 C;  2DRB A;  4AT8 B;  1UEV A;  2GAF D;  2DR8 A;  4M5D A;  4FO1 A;  5CFT A;  4K98 A;  3OVA A;  4JLX A;  4NXW A;  4NKU A;  2DR5 A;  4K96 A;  4WQL A;  2HHP A;  4NXT A;  3NYB A;  4ATB A;  3ERC C;  1Q78 A;  4MKP A;  4XJE A;  3OV7 A;  4X4O A;  2ZH6 A;  4NKT A;  1R89 A;  4X4S A;  1GPJ A;  4X4V A;  2ZH7 A;  4K97 A;  4K9B A;  2Q66 A;  4X4U A;  1Q79 A;  2EWR A;  4K8V A;  4HX0 A;  4LEV A;  4UD5 A;  2ZH3 A;  4KM5 A;  4X4R A;  2DRA A;  2DVI A;  3C66 A;  5CFU A;  2ZH8 A;  2ZHA A;  2ZHB A;  4WQK A;  5CHE A;  4NXX A;  1UEU A;  1UET A;  1TFW A;  5D63 A;  4AT7 A;  4OAH A;  2DR7 A;  3EF2 A;  4UD4 A;  4NXU A;  2ZH5 A;  5B3Q A;  4E7X A;  4FHW A;  2B4V A;  4K99 A;  4O67 A;  4ATB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...