4WQLA

Crystal structure of aminoglycoside nucleotidylyltransferase ant(2")-ia, kanamycin-bound
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
175
structure length
175
Chain Sequence
TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2''-aminoglycoside nucleotidyltransferase
publication title Structural and Molecular Basis for Resistance to Aminoglycoside Antibiotics by the Adenylyltransferase ANT(2)-Ia.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase/transferase inhibitor
total genus 61
structure length 175
sequence length 175
ec nomenclature ec 2.7.7.46: Gentamicin 2''-nucleotidyltransferase.
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4wqlA00
5CFSA 4WH5A 5CFTA 5CFUA 4XJEA 2EWRA 4FO1A 4WQLA 4HX0A 4WQKA 2FCLA
chains in the Genus database with same CATH superfamily
2BPFA 2RFFA 8ICAA 2Q66A 9ICAA 3B0YA 2M2WA 4QZFA 5HC9A 9ICNA 1ZQRA 3RJGA 4X4QA 4UB3A 1JMSA 1ZQWA 4IQVA 4M9LA 4LVSA 8ICFA 3HX0A 5HRDA 4HX0A 4XQ7A 1ZQAA 5B3QA 5EOZA 2ZHBA 4RQ1A 1ZQVA 5DB8A 4WC3A 3UPQA 4IQWA 4AT7B 1KEJA 1ZJNA 4K4GA 4XQ8A 2GA9D 4YMNA 4KLLA 4WBYA 4WOYA 2DR7A 5HRLA 1ZQHA 5HRHA 8ICVA 4FO6A 5D63A 8ICNA 1RPLA 1UETA 4GXIA 4RWPA 2PFQA 3OV7A 1JN3A 5J29A 2BCRA 3NYBA 1MQ3A 2HN2A 5J0PA 4FHWA 4K96A 3OVAA 2GWSA 3HJ1A 1ZQPA 5HREA 8ICMA 5HRIA 8ICYA 9ICXA 5DBAA 4WBZA 4MF2A 4QZ8A 9ICGA 4X4UA 3ER8C 3RJKA 4UAZA 7ICKA 4X4OA 1BPZA 4FHXA 2DR5A 7ICVA 2ZH4A 4FHVA 5J0UA 2BE3A 1OU5A 4NXUA 3HIYA 5J2EA 5DEDA 5IINA 3V7LA 4WC1A 1FA0A 4QZEA 1JQRA 3JPRA 2DR9A 4NXWA 4WC7A 4RQ3A 2ZH6A 5HRKA 1Q79A 4YCXA 2BCUA 9ICTA 4PHDA 4KLUA 4PGQA 5D62A 4UBBA 4UAWA 5CA7A 5CHGA 1ZQXA 5J0WA 4KLMA 4YMOA 1ZQZA 4WC5A 3H37A 5IIJA 3C5FA 4I29A 1BPBA 4I2BA 3WFOA 4EP7A 4IQUA 4XUSA 8ICOA 9ICBA 1XSPA 3RJFA 3JYYA 2I9GA 5IIIA 2DR8A 1VJ7A 5J2FA 3AUOA 3MGIA 4FO1A 4DOAA 2FMQA 2NRKA 5HRBA 2DRBA 4X5VA 5J0SA 4R64A 4UB1A 3WFPA 4K4HA 8ICBA 3ER9B 1ZQQA 1ZQBA 4NM2A 4X0BA 5HHHA 4KLGA 3HW8A 2O5AA 1R89A 5J2HA 4MKPA 4YD2A 7ICQA 2BBHA 4MF8A 5J2KA 4S3NA 3ISDA 4RT3A 4PGYA 4F5OA 7ICFA 4Z6CA 8ICGA 9ICSA 5HR9A 3UPSA 7ICTA 2ZH3A 3C18A 8ICEA 4Z6EA 7ICJA 3UQ0A 4ATBA 3V7KA 5J2JA 3JPQA 4OAHA 4M0AA 5CR0A 4K8VA 3H39A 4KLSA 4IG8A 4AT9A 5F2VO 2HHPA 5J0QA 7ICGA 1PX5A 4RPZA 2B56A 4RT2A 4RQ2A 5J0RA 4PGXA 3PMNA 3JPSA 8ICKA 8ICPA 4EGWA 5BPCA 4RPXA 4GXKA 3MDAA 5D61A 3NVOA 9ICPA 4I2IA 4EEBA 4WQLA 4EV6A 8ICZA 8ICHA 8ICSA 2IHOA 3MCRA 9ICMA 8ICQA 5HRFA 1ZQSA 2BCSA 4I27A 8ICRA 2M2TA 3NKUA 4RQ4A 3L9DA 3MGHA 5J2BA 3OUYB 1MIYA 4FHPA 1TFWA 3K7DA 4RWQA 1ZQDA 2PFNA 1JAJA 2EWRA 1UEUA 5DKWA 5IIMA 8ICJA 4TURA 4I2EA 4IQTA 4Z6FA 2M2UA 4QZHA 2BPCA 5D46A 4KM5A 4NY8A 7ICSA 1R8AA 4E80A 4I2FA 1WOTA 4M04A 4RQ7A 5J2IA 4EEDA 5BOMA 5J2GA 3AQLA 4MFCA 5D49A 7ICNA 2PXIA 3TFRA 1XSLA 1ZQNA 1KNYA 3JCFA 9ICRA 5CFUA 4F5PA 5J0YA 4JWNA 2ZH1A 1RZTA 4KLTA 4NXVA 7ICEA 4M9GA 3ERCC 4F5RA 3WFSC 4EBJA 3RH6A 4KLEA 4X0AA 4R66A 4OAIZ 2ISOA 4I2GA 3C2LA 3V72A 2DRAA 4KLOA 5CJ7A 4XRHA 3UQ2A 5J2DA 7ICMA 4K4IA 2IUBA 4WC0A 1HUZA 4LZGA 4LT6A 4RQ8A 4QZIA 1V4AA 4QZBA 1Q78A 4TUSA 1R8BA 3ISBA 2VANA 1KDHA 4RQ6A 1BPXA 3OWGA 4AT7A 1BPDA 4KB6A 8ICUA 1ZQTA 1TFYA 4I2CA 3OGUA 3H38A 3EF2A 9ICCA 4M9JA 5DB7A 3MBYA 3MDCA 8ICTA 9ICIA 3WFQE 4KLIA 2W9MA 5J0XA 3RJHA 2ISPA 4O69A 3JPOA 9ICKA 9ICLA 3PNCA 4X4SA 4TUQA 5IILA 4QZCA 3UXOA 4M5DA 4O6AA 5DDMA 5DDYA 4UB5A 4KLFA 4RWNA 8ICWA 4K97A 5CHEA 1HUOA 1ZQMA 4K99A 4PHAA 1ZQYA 2ZH9A 2HN1A 4PHPA 4I2DA 5JTGA 5DB6A 4LEVA 1XSNA 3AQMA 4X4VA 1MQ2A 4E7XA 4KLHA 3NWIA 4NLKA 8ICCA 4MFFA 3GDXA 3RJJA 4NLZA 4WQKA 4TUPA 3V7JA 2ZH2A 2B4VA 4DOCA 4I0UA 4O5EA 5J2AA 3UXNA 3LK9A 5TZVA 4WC4A 9ICOA 1ZQJA 3AQKA 3RH5A 1UEVA 3RJEA 3HJ4A 5DBBA 1NO5A 4I2AA 4JLXA 9ICHA 3C66A 4QZDA 4LEWA 4WH5A 1TVAA 4AT8A 1ZQIA 4Z6DA 3UXPA 4RQ5A 9ICWA 1MIWA 5DECA 4X4NA 3C2KA 4QZAA 3JZ0A 4OAFA 5IIOA 4M47A 4KLQA 1BPEA 4O9MA 1GPJA 2FCLA 4NKTA 4JWMA 3H3AA 3RH4A 4FHYA 4WC2A 4MFAA 3TFSA 3JPTA 5J0TA 5BOLA 4JLZA 4NKUA 4UBCA 2ZH8A 7ICHA 4UB4A 4WC6A 4FH3A 5DB9A 4NXTA 8ICXA 5J2CA 8ICIA 3RJIA 4NM1A 1R8CA 4K9BA 1YLQA 4LEZA 1MIVA 4RPYA 3ISCA 9ICQA 9ICVA 4NXXA 2BPGA 4ATBB 3AU2A 2PFPA 4I2HA 4YD1A 7ICIA 5IIKA 4UB2A 4K9AA 1ZQCA 4AT9B 2FMSA 7ICLA 4RWOA 4X4PA 1ZQLA 4O67A 4O5KA 5CP2A 4F5QA 2PFOA 4M9NA 2FMPA 4WCWA 7ICPA 2GAFD 5CFSA 1BPYA 1F5AA 4R63A 9ICFA 5B3PA 4OAGA 1TV9A 4X4TA 3WFRE 2M2VA 7ICRA 3OVSA 4O5CA 1ZQUA 2O1PA 4XA5A 4P2HA 5J0OA 3CK6A 4QZ9A 2IHMA 2DVIA 4LZDA 4PH5A 4KLJA 1NOMA 2BBJA 4N7RA 3C5GA 9ICUA 4AT8B 4YMMA 8ICLA 5DBCA 2P66A 5HHIA 5HRGA 3OVBA 1ZQEA 4KLDA 4XJEA 2ZH7A 4M9HA 3HWTA 4FH5A 4X4RA 4NXZA 4UD4A 2ZH5A 2ID1A 3PHZA 4LEYA 7ICUA 9ICEA 4R65A 4PPXA 3PMLA 4I28A 4M2YA 2ZHAA 3JPNA 4PHEA 3AU6A 4I2JA 5CFTA 2B51A 9ICJA 2BCVA 4O68A 4P4PA 4DOBA 1ZQOA 3AQNA 4F5NA 4QZGA 4DO9A 4UAYA 3C2MA 3K75D 3JPPA 5CB1A 4P4MA 4NLNA 4P4OA 4GXJA 5D4BA 1ZJMA 3B0XA 2PBEA 4E8FA 3LQCB 3OUYA 4YN4A 5CWRA 4UD5A 4EBKA 1ZQGA 4K98A 1ZQFA 1ZQKA 2BCQA 7ICOA 4RQ0A 1VFGA
chains in the Genus database with same CATH topology
2B56A 4NXXA 3NKUA 4NXWA 4OAFA 4MKPA 5CFTA 2B51A 4WQKA 2FCLA 2GA9D 1GPJA 4N7RA 4O68A 4WOYA 5CFUA 4K9AA 4O6AA 2B4VA 3ER8C 3K7DA 2EWRA 4O67A 4FO1A 3OWGA 5D63A 4JLZA 4K97A 5CHEA 4KB6A 4NXVA 4K99A 4XJEA 5D61A 3ERCC 4KM5A 2GAFD 4OAHA 4JLXA 3EF2A 4HX0A 4WQLA 5D62A 5CFSA 4LEWA 4NXTA 2IHOA 4K8VA 4WH5A 4OAIZ 3MCRA 5B3QA 3PHZA 4OAGA 4NXUA 5B3PA 4K98A 4K9BA 4LEVA 4LEYA 3ER9B 4LEZA 4O69A 4K96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFS A;  4WH5 A;  5CFT A;  5CFU A;  4XJE A;  2EWR A;  4FO1 A;  4WQL A;  4HX0 A;  4WQK A;  2FCL A; 
#chains in the Genus database with same CATH topology
 2BPF A;  2RFF A;  8ICA A;  2Q66 A;  9ICA A;  3B0Y A;  2M2W A;  4QZF A;  5HC9 A;  9ICN A;  1ZQR A;  3RJG A;  4X4Q A;  4UB3 A;  1JMS A;  1ZQW A;  4IQV A;  4M9L A;  4LVS A;  8ICF A;  3HX0 A;  5HRD A;  4HX0 A;  4XQ7 A;  1ZQA A;  5B3Q A;  5EOZ A;  2ZHB A;  4RQ1 A;  1ZQV A;  5DB8 A;  4WC3 A;  3UPQ A;  4IQW A;  4AT7 B;  1KEJ A;  1ZJN A;  4K4G A;  4XQ8 A;  2GA9 D;  4YMN A;  4KLL A;  4WBY A;  4WOY A;  2DR7 A;  5HRL A;  1ZQH A;  5HRH A;  8ICV A;  4FO6 A;  5D63 A;  8ICN A;  1RPL A;  1UET A;  4GXI A;  4RWP A;  2PFQ A;  3OV7 A;  1JN3 A;  5J29 A;  2BCR A;  3NYB A;  1MQ3 A;  2HN2 A;  5J0P A;  4FHW A;  4K96 A;  3OVA A;  2GWS A;  3HJ1 A;  1ZQP A;  5HRE A;  8ICM A;  5HRI A;  8ICY A;  9ICX A;  5DBA A;  4WBZ A;  4MF2 A;  4QZ8 A;  9ICG A;  4X4U A;  3ER8 C;  3RJK A;  4UAZ A;  7ICK A;  4X4O A;  1BPZ A;  4FHX A;  2DR5 A;  7ICV A;  2ZH4 A;  4FHV A;  5J0U A;  2BE3 A;  1OU5 A;  4NXU A;  3HIY A;  5J2E A;  5DED A;  5IIN A;  3V7L A;  4WC1 A;  1FA0 A;  4QZE A;  1JQR A;  3JPR A;  2DR9 A;  4NXW A;  4WC7 A;  4RQ3 A;  2ZH6 A;  5HRK A;  1Q79 A;  4YCX A;  2BCU A;  9ICT A;  4PHD A;  4KLU A;  4PGQ A;  5D62 A;  4UBB A;  4UAW A;  5CA7 A;  5CHG A;  1ZQX A;  5J0W A;  4KLM A;  4YMO A;  1ZQZ A;  4WC5 A;  3H37 A;  5IIJ A;  3C5F A;  4I29 A;  1BPB A;  4I2B A;  3WFO A;  4EP7 A;  4IQU A;  4XUS A;  8ICO A;  9ICB A;  1XSP A;  3RJF A;  3JYY A;  2I9G A;  5III A;  2DR8 A;  1VJ7 A;  5J2F A;  3AUO A;  3MGI A;  4FO1 A;  4DOA A;  2FMQ A;  2NRK A;  5HRB A;  2DRB A;  4X5V A;  5J0S A;  4R64 A;  4UB1 A;  3WFP A;  4K4H A;  8ICB A;  3ER9 B;  1ZQQ A;  1ZQB A;  4NM2 A;  4X0B A;  5HHH A;  4KLG A;  3HW8 A;  2O5A A;  1R89 A;  5J2H A;  4MKP A;  4YD2 A;  7ICQ A;  2BBH A;  4MF8 A;  5J2K A;  4S3N A;  3ISD A;  4RT3 A;  4PGY A;  4F5O A;  7ICF A;  4Z6C A;  8ICG A;  9ICS A;  5HR9 A;  3UPS A;  7ICT A;  2ZH3 A;  3C18 A;  8ICE A;  4Z6E A;  7ICJ A;  3UQ0 A;  4ATB A;  3V7K A;  5J2J A;  3JPQ A;  4OAH A;  4M0A A;  5CR0 A;  4K8V A;  3H39 A;  4KLS A;  4IG8 A;  4AT9 A;  5F2V O;  2HHP A;  5J0Q A;  7ICG A;  1PX5 A;  4RPZ A;  2B56 A;  4RT2 A;  4RQ2 A;  5J0R A;  4PGX A;  3PMN A;  3JPS A;  8ICK A;  8ICP A;  4EGW A;  5BPC A;  4RPX A;  4GXK A;  3MDA A;  5D61 A;  3NVO A;  9ICP A;  4I2I A;  4EEB A;  4WQL A;  4EV6 A;  8ICZ A;  8ICH A;  8ICS A;  2IHO A;  3MCR A;  9ICM A;  8ICQ A;  5HRF A;  1ZQS A;  2BCS A;  4I27 A;  8ICR A;  2M2T A;  3NKU A;  4RQ4 A;  3L9D A;  3MGH A;  5J2B A;  3OUY B;  1MIY A;  4FHP A;  1TFW A;  3K7D A;  4RWQ A;  1ZQD A;  2PFN A;  1JAJ A;  2EWR A;  1UEU A;  5DKW A;  5IIM A;  8ICJ A;  4TUR A;  4I2E A;  4IQT A;  4Z6F A;  2M2U A;  4QZH A;  2BPC A;  5D46 A;  4KM5 A;  4NY8 A;  7ICS A;  1R8A A;  4E80 A;  4I2F A;  1WOT A;  4M04 A;  4RQ7 A;  5J2I A;  4EED A;  5BOM A;  5J2G A;  3AQL A;  4MFC A;  5D49 A;  7ICN A;  2PXI A;  3TFR A;  1XSL A;  1ZQN A;  1KNY A;  3JCF A;  9ICR A;  5CFU A;  4F5P A;  5J0Y A;  4JWN A;  2ZH1 A;  1RZT A;  4KLT A;  4NXV A;  7ICE A;  4M9G A;  3ERC C;  4F5R A;  3WFS C;  4EBJ A;  3RH6 A;  4KLE A;  4X0A A;  4R66 A;  4OAI Z;  2ISO A;  4I2G A;  3C2L A;  3V72 A;  2DRA A;  4KLO A;  5CJ7 A;  4XRH A;  3UQ2 A;  5J2D A;  7ICM A;  4K4I A;  2IUB A;  4WC0 A;  1HUZ A;  4LZG A;  4LT6 A;  4RQ8 A;  4QZI A;  1V4A A;  4QZB A;  1Q78 A;  4TUS A;  1R8B A;  3ISB A;  2VAN A;  1KDH A;  4RQ6 A;  1BPX A;  3OWG A;  4AT7 A;  1BPD A;  4KB6 A;  8ICU A;  1ZQT A;  1TFY A;  4I2C A;  3OGU A;  3H38 A;  3EF2 A;  9ICC A;  4M9J A;  5DB7 A;  3MBY A;  3MDC A;  8ICT A;  9ICI A;  3WFQ E;  4KLI A;  2W9M A;  5J0X A;  3RJH A;  2ISP A;  4O69 A;  3JPO A;  9ICK A;  9ICL A;  3PNC A;  4X4S A;  4TUQ A;  5IIL A;  4QZC A;  3UXO A;  4M5D A;  4O6A A;  5DDM A;  5DDY A;  4UB5 A;  4KLF A;  4RWN A;  8ICW A;  4K97 A;  5CHE A;  1HUO A;  1ZQM A;  4K99 A;  4PHA A;  1ZQY A;  2ZH9 A;  2HN1 A;  4PHP A;  4I2D A;  5JTG A;  5DB6 A;  4LEV A;  1XSN A;  3AQM A;  4X4V A;  1MQ2 A;  4E7X A;  4KLH A;  3NWI A;  4NLK A;  8ICC A;  4MFF A;  3GDX A;  3RJJ A;  4NLZ A;  4WQK A;  4TUP A;  3V7J A;  2ZH2 A;  2B4V A;  4DOC A;  4I0U A;  4O5E A;  5J2A A;  3UXN A;  3LK9 A;  5TZV A;  4WC4 A;  9ICO A;  1ZQJ A;  3AQK A;  3RH5 A;  1UEV A;  3RJE A;  3HJ4 A;  5DBB A;  1NO5 A;  4I2A A;  4JLX A;  9ICH A;  3C66 A;  4QZD A;  4LEW A;  4WH5 A;  1TVA A;  4AT8 A;  1ZQI A;  4Z6D A;  3UXP A;  4RQ5 A;  9ICW A;  1MIW A;  5DEC A;  4X4N A;  3C2K A;  4QZA A;  3JZ0 A;  4OAF A;  5IIO A;  4M47 A;  4KLQ A;  1BPE A;  4O9M A;  1GPJ A;  2FCL A;  4NKT A;  4JWM A;  3H3A A;  3RH4 A;  4FHY A;  4WC2 A;  4MFA A;  3TFS A;  3JPT A;  5J0T A;  5BOL A;  4JLZ A;  4NKU A;  4UBC A;  2ZH8 A;  7ICH A;  4UB4 A;  4WC6 A;  4FH3 A;  5DB9 A;  4NXT A;  8ICX A;  5J2C A;  8ICI A;  3RJI A;  4NM1 A;  1R8C A;  4K9B A;  1YLQ A;  4LEZ A;  1MIV A;  4RPY A;  3ISC A;  9ICQ A;  9ICV A;  4NXX A;  2BPG A;  4ATB B;  3AU2 A;  2PFP A;  4I2H A;  4YD1 A;  7ICI A;  5IIK A;  4UB2 A;  4K9A A;  1ZQC A;  4AT9 B;  2FMS A;  7ICL A;  4RWO A;  4X4P A;  1ZQL A;  4O67 A;  4O5K A;  5CP2 A;  4F5Q A;  2PFO A;  4M9N A;  2FMP A;  4WCW A;  7ICP A;  2GAF D;  5CFS A;  1BPY A;  1F5A A;  4R63 A;  9ICF A;  5B3P A;  4OAG A;  1TV9 A;  4X4T A;  3WFR E;  2M2V A;  7ICR A;  3OVS A;  4O5C A;  1ZQU A;  2O1P A;  4XA5 A;  4P2H A;  5J0O A;  3CK6 A;  4QZ9 A;  2IHM A;  2DVI A;  4LZD A;  4PH5 A;  4KLJ A;  1NOM A;  2BBJ A;  4N7R A;  3C5G A;  9ICU A;  4AT8 B;  4YMM A;  8ICL A;  5DBC A;  2P66 A;  5HHI A;  5HRG A;  3OVB A;  1ZQE A;  4KLD A;  4XJE A;  2ZH7 A;  4M9H A;  3HWT A;  4FH5 A;  4X4R A;  4NXZ A;  4UD4 A;  2ZH5 A;  2ID1 A;  3PHZ A;  4LEY A;  7ICU A;  9ICE A;  4R65 A;  4PPX A;  3PML A;  4I28 A;  4M2Y A;  2ZHA A;  3JPN A;  4PHE A;  3AU6 A;  4I2J A;  5CFT A;  2B51 A;  9ICJ A;  2BCV A;  4O68 A;  4P4P A;  4DOB A;  1ZQO A;  3AQN A;  4F5N A;  4QZG A;  4DO9 A;  4UAY A;  3C2M A;  3K75 D;  3JPP A;  5CB1 A;  4P4M A;  4NLN A;  4P4O A;  4GXJ A;  5D4B A;  1ZJM A;  3B0X A;  2PBE A;  4E8F A;  3LQC B;  3OUY A;  4YN4 A;  5CWR A;  4UD5 A;  4EBK A;  1ZQG A;  4K98 A;  1ZQF A;  1ZQK A;  2BCQ A;  7ICO A;  4RQ0 A;  1VFG A; 
#chains in the Genus database with same CATH homology
 2B56 A;  4NXX A;  3NKU A;  4NXW A;  4OAF A;  4MKP A;  5CFT A;  2B51 A;  4WQK A;  2FCL A;  2GA9 D;  1GPJ A;  4N7R A;  4O68 A;  4WOY A;  5CFU A;  4K9A A;  4O6A A;  2B4V A;  3ER8 C;  3K7D A;  2EWR A;  4O67 A;  4FO1 A;  3OWG A;  5D63 A;  4JLZ A;  4K97 A;  5CHE A;  4KB6 A;  4NXV A;  4K99 A;  4XJE A;  5D61 A;  3ERC C;  4KM5 A;  2GAF D;  4OAH A;  4JLX A;  3EF2 A;  4HX0 A;  4WQL A;  5D62 A;  5CFS A;  4LEW A;  4NXT A;  2IHO A;  4K8V A;  4WH5 A;  4OAI Z;  3MCR A;  5B3Q A;  3PHZ A;  4OAG A;  4NXU A;  5B3P A;  4K98 A;  4K9B A;  4LEV A;  4LEY A;  3ER9 B;  4LEZ A;  4O69 A;  4K96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...