4WQLA

Crystal structure of aminoglycoside nucleotidylyltransferase ant(2")-ia, kanamycin-bound
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
175
structure length
175
Chain Sequence
TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 2''-aminoglycoside nucleotidyltransferase
publication title Structural and Molecular Basis for Resistance to Aminoglycoside Antibiotics by the Adenylyltransferase ANT(2)-Ia.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 61
structure length 175
sequence length 175
ec nomenclature ec 2.7.7.46: Gentamicin 2''-nucleotidyltransferase.
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4wqlA00
4WQLA 4FO1A 5CFSA 4WQKA 4HX0A 4WH5A 4XJEA 5CFTA 2FCLA 5CFUA 2EWRA
chains in the Genus database with same CATH superfamily
4I0UA 4K8VA 4WOYA 3ISCA 3H39A 3NKUA 4KLSA 2B56A 5DB9A 4NXVA 5CP2A 8ICHA 3V72A 4K9BA 4AT8A 3C5FA 2ISOA 3MGIA 3JPSA 4UBCA 4KLIA 4IQVA 1YLQA 3UXOA 3AQKA 3JPPA 4UD4A 1HUOA 1ZQDA 5DKWA 4K97A 2ZH5A 4LVSA 4QZCA 4P2HA 3WFPA 3AUOA 4AT8B 4X4NA 9ICBA 1Q78A 3MBYA 9ICGA 2PFNA 1F5AA 3RJHA 1BPZA 4GXIA 4FHPA 2ZH4A 5J0PA 4M47A 5D62A 4O5KA 1ZQYA 8ICAA 1WOTA 4KLLA 3JPNA 3HJ4A 5CFSA 1ZQKA 3JPOA 1ZQRA 3JPQA 5J0QA 9ICCA 4Z6DA 2I9GA 3ER8C 4QZIA 7ICKA 4O9MA 3AQMA 1TFWA 4OAHA 5CFTA 4QZEA 3H37A 3ISDA 3RJJA 4PGXA 4EBJA 4I2IA 1ZJMA 3LK9A 3RJEA 1BPDA 4NLKA 4RWPA 7ICRA 2P66A 4FH5A 4XA5A 3TFSA 1RZTA 4JLZA 5J2FA 4FHVA 4RWNA 4FHWA 4I28A 8ICXA 4M9HA 4MF8A 4X4VA 2B4VA 5F2VO 4WC7A 5J2BA 4QZBA 3ISBA 2M2VA 4RQ6A 8ICBA 5DECA 4K4IA 2BCRA 4KLMA 1JMSA 1KEJA 4QZ8A 4P4OA 5CWRA 1TV9A 3LQCB 5IIJA 9ICUA 4UB4A 4F5PA 2ZH1A 4XQ8A 5DEDA 4LEZA 4X4TA 7ICNA 4EEDA 4DO9A 3RH5A 4IQTA 4FHYA 3C2KA 2GAFD 5HC9A 4XUSA 5DBBA 4QZGA 4UD5A 4YD2A 5J2EA 4MF2A 5DDMA 4Z6EA 4O69A 2DVIA 8ICLA 4IG8A 3K7DA 4LZDA 4R66A 5CB1A 1BPYA 2FMSA 4M9GA 4FO1A 2DRAA 8ICZA 4I2CA 4KLEA 5DDYA 4FHXA 4E8FA 7ICMA 4I29A 4RWOA 5D46A 1ZQNA 4MKPA 4RWQA 4YMNA 9ICOA 4WC4A 4OAGA 4N7RA 1MIVA 3UQ0A 1PX5A 3WFQE 7ICGA 5HREA 9ICNA 4IQWA 2ZH7A 4E7XA 4GXJA 3HJ1A 4DOBA 4RPYA 3C2MA 3AQNA 3OVBA 4QZDA 2PXIA 3RH4A 2IUBA 5HR9A 4JWMA 5HRFA 9ICFA 1ZQUA 4X0AA 5J0OA 3OGUA 9ICWA 9ICKA 4R65A 4KLUA 4X4SA 4M0AA 5CFUA 1MIWA 3MDCA 2ZH2A 4WBYA 7ICLA 3AQLA 4YMMA 2M2WA 3V7LA 5HRIA 4KLTA 4TUQA 1UEVA 1ZQCA 5J2CA 4XJEA 7ICHA 2NRKA 1ZQTA 8ICUA 4RQ3A 3UQ2A 1R8AA 2DR5A 2Q66A 3JPRA 3B0XA 3ER9B 4MFAA 7ICVA 2GWSA 1ZQIA 3H3AA 4NM1A 4RPZA 4WCWA 5J29A 5B3QA 8ICTA 1ZQZA 5J0TA 5IINA 4O5CA 4YN4A 5J0RA 1ZQXA 2BCUA 4I2DA 4I2FA 2ID1A 1ZQVA 3OUYA 4I2AA 4F5OA 4WH5A 1ZQWA 4YCXA 2BPGA 5HHHA 4PGYA 1NO5A 4UAYA 1OU5A 2BBHA 4QZAA 4UB5A 1XSNA 1UEUA 3WFSC 4RQ0A 4KM5A 4NM2A 2ZH9A 1NOMA 1BPXA 2HN1A 4GXKA 8ICVA 5CA7A 5J2JA 5J2HA 7ICFA 3RH6A 5DBAA 2ZH8A 3C2LA 3NVOA 4EGWA 4TURA 4I27A 8ICGA 3AU2A 3UPSA 3C18A 3OUYB 1ZQBA 4K4GA 4RPXA 2BBJA 5DB8A 4PHDA 7ICTA 4UB3A 3PMLA 4KLJA 4O67A 3L9DA 2PBEA 4WQLA 4E80A 5TZVA 4WC3A 4FO6A 4K4HA 8ICOA 1TFYA 2ZH3A 4OAIZ 1XSPA 3CK6A 4QZ9A 4EP7A 4WC1A 1V4AA 1BPBA 1R89A 4ATBA 1R8BA 8ICIA 4I2GA 4P4MA 8ICPA 9ICLA 4XRHA 2BPCA 5CR0A 3PHZA 3NYBA 2IHOA 4EEBA 4O6AA 5J2GA 2EWRA 5J2AA 4K9AA 3B0YA 4IQUA 2O1PA 5CHGA 5BPCA 2FMPA 4I2JA 4NLZA 1R8CA 5IIOA 1ZQAA 4ATBB 4I2EA 7ICSA 3HX0A 7ICQA 3AU6A 1BPEA 4PGQA 4I2BA 3MDAA 3UXPA 4O5EA 1ZQLA 4UBBA 4K96A 3JYYA 4YMOA 4RQ4A 5IIIA 2GA9D 9ICQA 3HIYA 4KB6A 4WQKA 4FH3A 4EBKA 1ZQEA 4X4UA 2M2UA 2BCSA 4F5NA 1ZQOA 1FA0A 5J0XA 4R63A 2ZHAA 1ZQGA 4LT6A 3PMNA 4KLFA 4RQ8A 5HHIA 5HRHA 1GPJA 5BOLA 4RQ5A 1UETA 4M9NA 1KDHA 1MQ3A 3OWGA 8ICMA 4NXUA 8ICNA 4X5VA 2O5AA 4F5RA 4RQ7A 4M9LA 9ICRA 4DOAA 4TUSA 1TVAA 4NXWA 4WC5A 2ZHBA 8ICFA 7ICIA 5HRLA 4WC6A 1ZQSA 1ZQHA 2PFOA 5JTGA 2DRBA 3H38A 4QZHA 1XSLA 7ICEA 4NLNA 5IIKA 4Z6CA 3WFRE 4X0BA 2DR7A 3RJFA 4AT7A 4NKUA 5DB6A 3UPQA 4MFCA 2BCVA 4RT2A 1KNYA 3JPTA 4LZGA 7ICJA 2FCLA 1RPLA 9ICXA 3PNCA 5HRGA 5J2KA 5BOMA 3HWTA 8ICJA 4KLGA 9ICSA 1ZQQA 4P4PA 4OAFA 9ICHA 3ERCC 3RJGA 5B3PA 5J0YA 4AT7B 3UXNA 4KLHA 5DBCA 4M9JA 4KLQA 4WBZA 4X4QA 3C5GA 4NXTA 1ZJNA 4PHAA 1ZQPA 4M04A 3V7JA 9ICVA 5D49A 4X4OA 2W9MA 5IIMA 5D4BA 2DR9A 5CJ7A 3WFOA 4TUPA 3RJIA 4JWNA 2B51A 4WC0A 1ZQFA 1Q79A 5J0SA 2VANA 4S3NA 2DR8A 2BCQA 8ICCA 9ICMA 2BPFA 3RJKA 5D63A 4PH5A 4PHEA 4K98A 5CHEA 3V7KA 4NXZA 3OVAA 8ICYA 3TFRA 8ICSA 4QZFA 2PFQA 8ICWA 4I2HA 1ZQJA 4MFFA 4HX0A 4LEWA 5J0UA 4KLDA 9ICEA 2PFPA 4PHPA 3OV7A 4PPXA 5IILA 3C66A 5EOZA 5J2IA 4Z6FA 4YD1A 1VJ7A 3JCFA 4NXXA 3K75D 5J0WA 4O68A 4XQ7A 7ICUA 3HW8A 9ICIA 2FMQA 4UB1A 4UB2A 5HRDA 3EF2A 3GDXA 4AT9A 2IHMA 4R64A 7ICOA 2ZH6A 4UAZA 3MCRA 1JN3A 4LEVA 9ICTA 4WC2A 4X4RA 2BE3A 5HRBA 1MQ2A 5D61A 4NKTA 4UAWA 8ICEA 9ICAA 4LEYA 3NWIA 3MGHA 9ICPA 4M2YA 4RT3A 2HHPA 8ICRA 1JQRA 5HRKA 4RQ2A 3OVSA 4F5QA 9ICJA 5DB7A 4AT9B 4JLXA 4RQ1A 1HUZA 2ISPA 1MIYA 8ICQA 3JZ0A 4NY8A 2RFFA 4KLOA 1JAJA 2M2TA 4EV6A 1VFGA 4X4PA 2HN2A 1ZQMA 7ICPA 8ICKA 4K99A 4M5DA 4DOCA 5J2DA
chains in the Genus database with same CATH topology
4K8VA 2B51A 4WOYA 4K97A 4K96A 4OAHA 4NXWA 4NXXA 4XJEA 5D61A 5CFTA 4LEYA 4O68A 3NKUA 4O69A 3PHZA 3K7DA 2B56A 2GA9D 4FO1A 4NXVA 5D63A 4WQKA 5CHEA 2IHOA 4OAFA 4KB6A 4K98A 3ERCC 4WH5A 4K9BA 4JLXA 4O6AA 2EWRA 5B3PA 4K9AA 4O67A 3EF2A 4WQLA 4LEZA 4HX0A 4KM5A 4LEWA 3ER9B 4MKPA 4OAIZ 4JLZA 4NXTA 5D62A 5CFUA 3MCRA 4LEVA 4OAGA 2GAFD 4N7RA 1GPJA 5CFSA 3ER8C 2B4VA 3OWGA 2FCLA 4NXUA 5B3QA 4K99A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQL A;  4FO1 A;  5CFS A;  4WQK A;  4HX0 A;  4WH5 A;  4XJE A;  5CFT A;  2FCL A;  5CFU A;  2EWR A; 
#chains in the Genus database with same CATH topology
 4I0U A;  4K8V A;  4WOY A;  3ISC A;  3H39 A;  3NKU A;  4KLS A;  2B56 A;  5DB9 A;  4NXV A;  5CP2 A;  8ICH A;  3V72 A;  4K9B A;  4AT8 A;  3C5F A;  2ISO A;  3MGI A;  3JPS A;  4UBC A;  4KLI A;  4IQV A;  1YLQ A;  3UXO A;  3AQK A;  3JPP A;  4UD4 A;  1HUO A;  1ZQD A;  5DKW A;  4K97 A;  2ZH5 A;  4LVS A;  4QZC A;  4P2H A;  3WFP A;  3AUO A;  4AT8 B;  4X4N A;  9ICB A;  1Q78 A;  3MBY A;  9ICG A;  2PFN A;  1F5A A;  3RJH A;  1BPZ A;  4GXI A;  4FHP A;  2ZH4 A;  5J0P A;  4M47 A;  5D62 A;  4O5K A;  1ZQY A;  8ICA A;  1WOT A;  4KLL A;  3JPN A;  3HJ4 A;  5CFS A;  1ZQK A;  3JPO A;  1ZQR A;  3JPQ A;  5J0Q A;  9ICC A;  4Z6D A;  2I9G A;  3ER8 C;  4QZI A;  7ICK A;  4O9M A;  3AQM A;  1TFW A;  4OAH A;  5CFT A;  4QZE A;  3H37 A;  3ISD A;  3RJJ A;  4PGX A;  4EBJ A;  4I2I A;  1ZJM A;  3LK9 A;  3RJE A;  1BPD A;  4NLK A;  4RWP A;  7ICR A;  2P66 A;  4FH5 A;  4XA5 A;  3TFS A;  1RZT A;  4JLZ A;  5J2F A;  4FHV A;  4RWN A;  4FHW A;  4I28 A;  8ICX A;  4M9H A;  4MF8 A;  4X4V A;  2B4V A;  5F2V O;  4WC7 A;  5J2B A;  4QZB A;  3ISB A;  2M2V A;  4RQ6 A;  8ICB A;  5DEC A;  4K4I A;  2BCR A;  4KLM A;  1JMS A;  1KEJ A;  4QZ8 A;  4P4O A;  5CWR A;  1TV9 A;  3LQC B;  5IIJ A;  9ICU A;  4UB4 A;  4F5P A;  2ZH1 A;  4XQ8 A;  5DED A;  4LEZ A;  4X4T A;  7ICN A;  4EED A;  4DO9 A;  3RH5 A;  4IQT A;  4FHY A;  3C2K A;  2GAF D;  5HC9 A;  4XUS A;  5DBB A;  4QZG A;  4UD5 A;  4YD2 A;  5J2E A;  4MF2 A;  5DDM A;  4Z6E A;  4O69 A;  2DVI A;  8ICL A;  4IG8 A;  3K7D A;  4LZD A;  4R66 A;  5CB1 A;  1BPY A;  2FMS A;  4M9G A;  4FO1 A;  2DRA A;  8ICZ A;  4I2C A;  4KLE A;  5DDY A;  4FHX A;  4E8F A;  7ICM A;  4I29 A;  4RWO A;  5D46 A;  1ZQN A;  4MKP A;  4RWQ A;  4YMN A;  9ICO A;  4WC4 A;  4OAG A;  4N7R A;  1MIV A;  3UQ0 A;  1PX5 A;  3WFQ E;  7ICG A;  5HRE A;  9ICN A;  4IQW A;  2ZH7 A;  4E7X A;  4GXJ A;  3HJ1 A;  4DOB A;  4RPY A;  3C2M A;  3AQN A;  3OVB A;  4QZD A;  2PXI A;  3RH4 A;  2IUB A;  5HR9 A;  4JWM A;  5HRF A;  9ICF A;  1ZQU A;  4X0A A;  5J0O A;  3OGU A;  9ICW A;  9ICK A;  4R65 A;  4KLU A;  4X4S A;  4M0A A;  5CFU A;  1MIW A;  3MDC A;  2ZH2 A;  4WBY A;  7ICL A;  3AQL A;  4YMM A;  2M2W A;  3V7L A;  5HRI A;  4KLT A;  4TUQ A;  1UEV A;  1ZQC A;  5J2C A;  4XJE A;  7ICH A;  2NRK A;  1ZQT A;  8ICU A;  4RQ3 A;  3UQ2 A;  1R8A A;  2DR5 A;  2Q66 A;  3JPR A;  3B0X A;  3ER9 B;  4MFA A;  7ICV A;  2GWS A;  1ZQI A;  3H3A A;  4NM1 A;  4RPZ A;  4WCW A;  5J29 A;  5B3Q A;  8ICT A;  1ZQZ A;  5J0T A;  5IIN A;  4O5C A;  4YN4 A;  5J0R A;  1ZQX A;  2BCU A;  4I2D A;  4I2F A;  2ID1 A;  1ZQV A;  3OUY A;  4I2A A;  4F5O A;  4WH5 A;  1ZQW A;  4YCX A;  2BPG A;  5HHH A;  4PGY A;  1NO5 A;  4UAY A;  1OU5 A;  2BBH A;  4QZA A;  4UB5 A;  1XSN A;  1UEU A;  3WFS C;  4RQ0 A;  4KM5 A;  4NM2 A;  2ZH9 A;  1NOM A;  1BPX A;  2HN1 A;  4GXK A;  8ICV A;  5CA7 A;  5J2J A;  5J2H A;  7ICF A;  3RH6 A;  5DBA A;  2ZH8 A;  3C2L A;  3NVO A;  4EGW A;  4TUR A;  4I27 A;  8ICG A;  3AU2 A;  3UPS A;  3C18 A;  3OUY B;  1ZQB A;  4K4G A;  4RPX A;  2BBJ A;  5DB8 A;  4PHD A;  7ICT A;  4UB3 A;  3PML A;  4KLJ A;  4O67 A;  3L9D A;  2PBE A;  4WQL A;  4E80 A;  5TZV A;  4WC3 A;  4FO6 A;  4K4H A;  8ICO A;  1TFY A;  2ZH3 A;  4OAI Z;  1XSP A;  3CK6 A;  4QZ9 A;  4EP7 A;  4WC1 A;  1V4A A;  1BPB A;  1R89 A;  4ATB A;  1R8B A;  8ICI A;  4I2G A;  4P4M A;  8ICP A;  9ICL A;  4XRH A;  2BPC A;  5CR0 A;  3PHZ A;  3NYB A;  2IHO A;  4EEB A;  4O6A A;  5J2G A;  2EWR A;  5J2A A;  4K9A A;  3B0Y A;  4IQU A;  2O1P A;  5CHG A;  5BPC A;  2FMP A;  4I2J A;  4NLZ A;  1R8C A;  5IIO A;  1ZQA A;  4ATB B;  4I2E A;  7ICS A;  3HX0 A;  7ICQ A;  3AU6 A;  1BPE A;  4PGQ A;  4I2B A;  3MDA A;  3UXP A;  4O5E A;  1ZQL A;  4UBB A;  4K96 A;  3JYY A;  4YMO A;  4RQ4 A;  5III A;  2GA9 D;  9ICQ A;  3HIY A;  4KB6 A;  4WQK A;  4FH3 A;  4EBK A;  1ZQE A;  4X4U A;  2M2U A;  2BCS A;  4F5N A;  1ZQO A;  1FA0 A;  5J0X A;  4R63 A;  2ZHA A;  1ZQG A;  4LT6 A;  3PMN A;  4KLF A;  4RQ8 A;  5HHI A;  5HRH A;  1GPJ A;  5BOL A;  4RQ5 A;  1UET A;  4M9N A;  1KDH A;  1MQ3 A;  3OWG A;  8ICM A;  4NXU A;  8ICN A;  4X5V A;  2O5A A;  4F5R A;  4RQ7 A;  4M9L A;  9ICR A;  4DOA A;  4TUS A;  1TVA A;  4NXW A;  4WC5 A;  2ZHB A;  8ICF A;  7ICI A;  5HRL A;  4WC6 A;  1ZQS A;  1ZQH A;  2PFO A;  5JTG A;  2DRB A;  3H38 A;  4QZH A;  1XSL A;  7ICE A;  4NLN A;  5IIK A;  4Z6C A;  3WFR E;  4X0B A;  2DR7 A;  3RJF A;  4AT7 A;  4NKU A;  5DB6 A;  3UPQ A;  4MFC A;  2BCV A;  4RT2 A;  1KNY A;  3JPT A;  4LZG A;  7ICJ A;  2FCL A;  1RPL A;  9ICX A;  3PNC A;  5HRG A;  5J2K A;  5BOM A;  3HWT A;  8ICJ A;  4KLG A;  9ICS A;  1ZQQ A;  4P4P A;  4OAF A;  9ICH A;  3ERC C;  3RJG A;  5B3P A;  5J0Y A;  4AT7 B;  3UXN A;  4KLH A;  5DBC A;  4M9J A;  4KLQ A;  4WBZ A;  4X4Q A;  3C5G A;  4NXT A;  1ZJN A;  4PHA A;  1ZQP A;  4M04 A;  3V7J A;  9ICV A;  5D49 A;  4X4O A;  2W9M A;  5IIM A;  5D4B A;  2DR9 A;  5CJ7 A;  3WFO A;  4TUP A;  3RJI A;  4JWN A;  2B51 A;  4WC0 A;  1ZQF A;  1Q79 A;  5J0S A;  2VAN A;  4S3N A;  2DR8 A;  2BCQ A;  8ICC A;  9ICM A;  2BPF A;  3RJK A;  5D63 A;  4PH5 A;  4PHE A;  4K98 A;  5CHE A;  3V7K A;  4NXZ A;  3OVA A;  8ICY A;  3TFR A;  8ICS A;  4QZF A;  2PFQ A;  8ICW A;  4I2H A;  1ZQJ A;  4MFF A;  4HX0 A;  4LEW A;  5J0U A;  4KLD A;  9ICE A;  2PFP A;  4PHP A;  3OV7 A;  4PPX A;  5IIL A;  3C66 A;  5EOZ A;  5J2I A;  4Z6F A;  4YD1 A;  1VJ7 A;  3JCF A;  4NXX A;  3K75 D;  5J0W A;  4O68 A;  4XQ7 A;  7ICU A;  3HW8 A;  9ICI A;  2FMQ A;  4UB1 A;  4UB2 A;  5HRD A;  3EF2 A;  3GDX A;  4AT9 A;  2IHM A;  4R64 A;  7ICO A;  2ZH6 A;  4UAZ A;  3MCR A;  1JN3 A;  4LEV A;  9ICT A;  4WC2 A;  4X4R A;  2BE3 A;  5HRB A;  1MQ2 A;  5D61 A;  4NKT A;  4UAW A;  8ICE A;  9ICA A;  4LEY A;  3NWI A;  3MGH A;  9ICP A;  4M2Y A;  4RT3 A;  2HHP A;  8ICR A;  1JQR A;  5HRK A;  4RQ2 A;  3OVS A;  4F5Q A;  9ICJ A;  5DB7 A;  4AT9 B;  4JLX A;  4RQ1 A;  1HUZ A;  2ISP A;  1MIY A;  8ICQ A;  3JZ0 A;  4NY8 A;  2RFF A;  4KLO A;  1JAJ A;  2M2T A;  4EV6 A;  1VFG A;  4X4P A;  2HN2 A;  1ZQM A;  7ICP A;  8ICK A;  4K99 A;  4M5D A;  4DOC A;  5J2D A; 
#chains in the Genus database with same CATH homology
 4K8V A;  2B51 A;  4WOY A;  4K97 A;  4K96 A;  4OAH A;  4NXW A;  4NXX A;  4XJE A;  5D61 A;  5CFT A;  4LEY A;  4O68 A;  3NKU A;  4O69 A;  3PHZ A;  3K7D A;  2B56 A;  2GA9 D;  4FO1 A;  4NXV A;  5D63 A;  4WQK A;  5CHE A;  2IHO A;  4OAF A;  4KB6 A;  4K98 A;  3ERC C;  4WH5 A;  4K9B A;  4JLX A;  4O6A A;  2EWR A;  5B3P A;  4K9A A;  4O67 A;  3EF2 A;  4WQL A;  4LEZ A;  4HX0 A;  4KM5 A;  4LEW A;  3ER9 B;  4MKP A;  4OAI Z;  4JLZ A;  4NXT A;  5D62 A;  5CFU A;  3MCR A;  4LEV A;  4OAG A;  2GAF D;  4N7R A;  1GPJ A;  5CFS A;  3ER8 C;  2B4V A;  3OWG A;  2FCL A;  4NXU A;  5B3Q A;  4K99 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...