4WQLA

Crystal structure of aminoglycoside nucleotidylyltransferase ant(2")-ia, kanamycin-bound
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
175
structure length
175
Chain Sequence
TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2''-aminoglycoside nucleotidyltransferase
publication title Structural and Molecular Basis for Resistance to Aminoglycoside Antibiotics by the Adenylyltransferase ANT(2)-Ia.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase/transferase inhibitor
total genus 61
structure length 175
sequence length 175
ec nomenclature ec 2.7.7.46: Gentamicin 2''-nucleotidyltransferase.
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4wqlA00
2FCLA 5CFSA 5CFUA 4HX0A 4XJEA 4WQLA 5CFTA 2EWRA 4WH5A 4WQKA 4FO1A
chains in the Genus database with same CATH superfamily
4NXVA 4RT3A 5CFUA 2FMQA 3C2LA 3OUYA 4NXWA 2B56A 4E80A 3UPSA 9ICKA 5D62A 2BCQA 3HWTA 4EEDA 3NVOA 1MQ2A 4P2HA 7ICKA 4X4SA 4PHAA 4X4QA 5CP2A 7ICFA 2ZHAA 4HX0A 4UB1A 1JQRA 8ICVA 4FH3A 3V7JA 5J2AA 3RH6A 1RZTA 3RJHA 3K75D 4LT6A 4QZCA 4I27A 3HX0A 4K4HA 2ISPA 5CFTA 1XSPA 4P4MA 4TUQA 1ZQKA 3CK6A 4JLXA 4P4PA 2PXIA 4NLNA 4YCXA 1ZQZA 4OAHA 1ZQPA 4TURA 7ICOA 3LQCB 3C66A 4QZEA 4XUSA 9ICCA 5J2CA 2DR5A 4IQWA 1JMSA 4KB6A 4K4IA 4RQ6A 5BPCA 3H38A 3HJ1A 8ICLA 2PFPA 2ISOA 4O67A 3MDCA 4UAWA 4I29A 9ICAA 3UXNA 4AT8B 4QZDA 5HRKA 4R63A 1V4AA 7ICMA 1ZQMA 5D49A 1JAJA 4I2DA 4IQVA 7ICIA 4FO6A 4LEYA 4KLHA 4MFCA 9ICJA 4DOCA 3WFPA 3JYYA 3WFOA 4PGXA 5HRBA 4F5OA 4RPYA 3RJGA 3AQMA 4KLMA 5CHGA 4F5RA 4EGWA 1TFYA 7ICRA 5TZVA 4WH5A 3PMNA 9ICFA 4UBBA 4YMMA 4K8VA 3WFRE 4PHPA 4E7XA 5CB1A 1R89A 3UPQA 5J2FA 9ICWA 1ZQUA 3C2MA 3MCRA 4FHVA 4I2FA 4XQ8A 4M2YA 9ICEA 5DB9A 4X4UA 5J0QA 4RWPA 1UETA 4O5CA 5DB6A 3TFSA 2FMSA 5HRHA 2GAFD 4IQTA 5J0SA 9ICGA 2Q66A 3PNCA 4PPXA 4LVSA 1ZQCA 4WBYA 3K7DA 2HN1A 4QZBA 5HRDA 3GDXA 1XSLA 1R8CA 4K4GA 4WC2A 2DVIA 4UB2A 4FO1A 4UB5A 4RQ0A 4OAFA 4X4VA 5HRLA 3PHZA 4QZAA 5B3PA 4QZGA 2IUBA 4KM5A 3TFRA 4RQ7A 4I2BA 8ICRA 4X5VA 1F5AA 2DR7A 1BPDA 1NOMA 4K9AA 3RH5A 4RPZA 1Q79A 4M9LA 4LZDA 5DECA 4LEZA 5J2BA 4X4TA 1ZQEA 5J29A 4RPXA 3PMLA 5HHHA 4PHEA 3OVSA 8ICWA 1JN3A 5B3QA 5CR0A 5D61A 5IIKA 4K99A 2BCRA 2DRAA 4NY8A 2PFQA 4NXXA 4WQKA 4M9HA 4RT2A 7ICVA 4RQ4A 4AT7A 3H37A 3B0XA 7ICJA 5CFSA 4NKUA 4AT8A 1R8BA 5J0UA 4WQLA 4KLGA 1HUOA 4O68A 2GA9D 1ZQJA 3NWIA 3ISDA 4KLDA 3UXOA 8ICFA 3HIYA 5J2JA 2DRBA 3JPRA 4Z6CA 1ZQBA 7ICPA 2DR8A 3RH4A 1KNYA 1ZQVA 1FA0A 5CHEA 2M2UA 4PH5A 4NXTA 1TVAA 2EWRA 2FMPA 4YD1A 9ICPA 2VANA 3NYBA 2PFOA 4ATBA 2BPFA 5HR9A 4WC7A 3WFSC 8ICIA 4AT7B 3MGHA 3AQKA 4Z6FA 3AUOA 4Z6EA 4O5KA 3HJ4A 5IINA 8ICSA 1TV9A 4I2CA 1UEUA 4PGYA 1KDHA 1ZQGA 5DBAA 2HHPA 7ICEA 3RJFA 4K9BA 1NO5A 8ICPA 5D4BA 4XQ7A 1TFWA 3ERCC 8ICUA 3MGIA 4NM1A 4Z6DA 4YMOA 2ZH4A 4QZHA 4I2GA 3OV7A 4KLEA 1ZQDA 4R65A 4FHYA 5DBBA 1BPXA 4EBKA 4ATBB 1ZQRA 5DKWA 4FHPA 4NXUA 4TUSA 4KLQA 4UBCA 5J0TA 1BPZA 4WOYA 4GXJA 2ZH3A 4M0AA 1ZQNA 1WOTA 1ZQXA 4K96A 2M2TA 7ICHA 5D46A 2NRKA 4XJEA 8ICQA 4MF2A 4I28A 4TUPA 4X4OA 1ZQSA 4NM2A 3V7LA 3LK9A 3UQ0A 4EBJA 5J0RA 5IIOA 3ISBA 4IG8A 4M47A 3EF2A 4RQ8A 4QZ8A 5HRGA 7ICLA 1BPEA 4RWNA 5HC9A 5DBCA 4WC0A 4PGQA 2ZHBA 3JPTA 1OU5A 5F2VO 8ICKA 4YMNA 2BPGA 5CA7A 1PX5A 4S3NA 4LZGA 4NKTA 5J0PA 4OAIZ 1BPYA 1ZQAA 4YN4A 4GXIA 9ICSA 3AU2A 4DOAA 3AQLA 1UEVA 4O5EA 5HRIA 4E8FA 4WC1A 3AQNA 1ZQTA 4RQ2A 3OGUA 4R64A 8ICZA 1ZJMA 2IHOA 1R8AA 2O1PA 3JCFA 2ZH5A 9ICRA 4P4OA 2BBJA 4IQUA 4WC4A 5J2EA 4EEBA 1VFGA 9ICLA 2ZH2A 4O6AA 2ZH7A 4M9JA 1HUZA 4NLZA 1ZQWA 5HHIA 4FHXA 5IIJA 5J2GA 3ER9B 9ICHA 4JWMA 4WCWA 7ICTA 4DOBA 4AT9B 2RFFA 4O69A 1Q78A 8ICAA 5DB8A 1ZQYA 5IIIA 1RPLA 4I2AA 5J0XA 2ZH9A 7ICNA 2O5AA 4UB4A 3RJIA 5BOLA 9ICQA 3H3AA 5J2HA 4UAYA 4QZFA 3H39A 4KLTA 8ICJA 5J0OA 4M9NA 5IIMA 4K98A 3C18A 4RQ5A 4EV6A 1ZJNA 9ICBA 1YLQA 4K97A 4KLFA 4OAGA 1MQ3A 4JLZA 4MFAA 2I9GA 3ER8C 4M04A 4MF8A 3JPOA 4KLJA 4DO9A 5EOZA 4MKPA 3OUYB 9ICTA 5D63A 5DB7A 2ZH1A 4M5DA 4FHWA 9ICVA 3JZ0A 3RJKA 2PFNA 2P66A 4X4RA 2GWSA 4WC5A 9ICNA 2BE3A 4EP7A 3JPQA 5DDMA 7ICGA 9ICMA 1BPBA 3L9DA 4X0BA 5J2KA 4RWQA 5BOMA 5J0YA 1ZQQA 8ICYA 3UQ2A 3MBYA 3UXPA 3JPSA 2BBHA 4PHDA 7ICUA 2BCVA 1ZQIA 2B4VA 4XRHA 3MDAA 4X4NA 1MIVA 8ICNA 4UD5A 3JPPA 4F5PA 3B0YA 2ID1A 5HRFA 3OVBA 4X4PA 4I0UA 4LEWA 4QZ9A 2HN2A 5CJ7A 8ICMA 4N7RA 4UD4A 3OVAA 8ICGA 5J0WA 2B51A 4I2HA 4I2EA 4RQ3A 2DR9A 1VJ7A 4UB3A 7ICSA 4NXZA 4QZIA 3OWGA 4NLKA 4I2JA 4RWOA 9ICIA 3RJJA 4X0AA 2BPCA 4M9GA 1MIWA 3AU6A 2PBEA 4O9MA 3V7KA 4FH5A 8ICOA 3ISCA 2BCSA 1GPJA 4I2IA 1ZQFA 4LEVA 3JPNA 5J2IA 5J2DA 5IILA 4F5NA 7ICQA 4WBZA 1MIYA 4UAZA 4AT9A 4WC3A 3NKUA 5HREA 4RQ1A 3V72A 2BCUA 4KLOA 3WFQE 5CWRA 3C2KA 2IHMA 5JTGA 4F5QA 4KLLA 2M2VA 2W9MA 3C5FA 8ICBA 2ZH6A 1XSNA 8ICCA 8ICHA 1ZQLA 1ZQOA 4GXKA 8ICEA 4XA5A 3C5GA 3RJEA 4YD2A 4R66A 4KLUA 4JWNA 9ICUA 4KLSA 1ZQHA 1KEJA 5DEDA 4WC6A 2FCLA 8ICTA 8ICXA 2ZH8A 9ICOA 9ICXA 2M2WA 5DDYA 4KLIA 4MFFA 3HW8A
chains in the Genus database with same CATH topology
4NXVA 4K9AA 5CFUA 4OAGA 4O69A 4JLZA 5CFTA 4LEZA 3OWGA 3ER8C 3K7DA 4NXWA 4K8VA 2B56A 4NXUA 4K97A 4JLXA 4MKPA 3MCRA 3EF2A 4WOYA 5B3QA 5D63A 4K9BA 4LEYA 2B4VA 2IHOA 4OAHA 5D61A 4K99A 4FO1A 4K96A 5CHEA 5D62A 4OAFA 4NXTA 4XJEA 4NXXA 2EWRA 3ERCC 1GPJA 4WQKA 3PHZA 4LEVA 4LEWA 5B3PA 4KB6A 4K98A 4O6AA 4KM5A 2GAFD 2FCLA 5CFSA 4HX0A 4N7RA 4WQLA 4O67A 3NKUA 4WH5A 3ER9B 2B51A 4O68A 4OAIZ 2GA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCL A;  5CFS A;  5CFU A;  4HX0 A;  4XJE A;  4WQL A;  5CFT A;  2EWR A;  4WH5 A;  4WQK A;  4FO1 A; 
#chains in the Genus database with same CATH topology
 4NXV A;  4RT3 A;  5CFU A;  2FMQ A;  3C2L A;  3OUY A;  4NXW A;  2B56 A;  4E80 A;  3UPS A;  9ICK A;  5D62 A;  2BCQ A;  3HWT A;  4EED A;  3NVO A;  1MQ2 A;  4P2H A;  7ICK A;  4X4S A;  4PHA A;  4X4Q A;  5CP2 A;  7ICF A;  2ZHA A;  4HX0 A;  4UB1 A;  1JQR A;  8ICV A;  4FH3 A;  3V7J A;  5J2A A;  3RH6 A;  1RZT A;  3RJH A;  3K75 D;  4LT6 A;  4QZC A;  4I27 A;  3HX0 A;  4K4H A;  2ISP A;  5CFT A;  1XSP A;  4P4M A;  4TUQ A;  1ZQK A;  3CK6 A;  4JLX A;  4P4P A;  2PXI A;  4NLN A;  4YCX A;  1ZQZ A;  4OAH A;  1ZQP A;  4TUR A;  7ICO A;  3LQC B;  3C66 A;  4QZE A;  4XUS A;  9ICC A;  5J2C A;  2DR5 A;  4IQW A;  1JMS A;  4KB6 A;  4K4I A;  4RQ6 A;  5BPC A;  3H38 A;  3HJ1 A;  8ICL A;  2PFP A;  2ISO A;  4O67 A;  3MDC A;  4UAW A;  4I29 A;  9ICA A;  3UXN A;  4AT8 B;  4QZD A;  5HRK A;  4R63 A;  1V4A A;  7ICM A;  1ZQM A;  5D49 A;  1JAJ A;  4I2D A;  4IQV A;  7ICI A;  4FO6 A;  4LEY A;  4KLH A;  4MFC A;  9ICJ A;  4DOC A;  3WFP A;  3JYY A;  3WFO A;  4PGX A;  5HRB A;  4F5O A;  4RPY A;  3RJG A;  3AQM A;  4KLM A;  5CHG A;  4F5R A;  4EGW A;  1TFY A;  7ICR A;  5TZV A;  4WH5 A;  3PMN A;  9ICF A;  4UBB A;  4YMM A;  4K8V A;  3WFR E;  4PHP A;  4E7X A;  5CB1 A;  1R89 A;  3UPQ A;  5J2F A;  9ICW A;  1ZQU A;  3C2M A;  3MCR A;  4FHV A;  4I2F A;  4XQ8 A;  4M2Y A;  9ICE A;  5DB9 A;  4X4U A;  5J0Q A;  4RWP A;  1UET A;  4O5C A;  5DB6 A;  3TFS A;  2FMS A;  5HRH A;  2GAF D;  4IQT A;  5J0S A;  9ICG A;  2Q66 A;  3PNC A;  4PPX A;  4LVS A;  1ZQC A;  4WBY A;  3K7D A;  2HN1 A;  4QZB A;  5HRD A;  3GDX A;  1XSL A;  1R8C A;  4K4G A;  4WC2 A;  2DVI A;  4UB2 A;  4FO1 A;  4UB5 A;  4RQ0 A;  4OAF A;  4X4V A;  5HRL A;  3PHZ A;  4QZA A;  5B3P A;  4QZG A;  2IUB A;  4KM5 A;  3TFR A;  4RQ7 A;  4I2B A;  8ICR A;  4X5V A;  1F5A A;  2DR7 A;  1BPD A;  1NOM A;  4K9A A;  3RH5 A;  4RPZ A;  1Q79 A;  4M9L A;  4LZD A;  5DEC A;  4LEZ A;  5J2B A;  4X4T A;  1ZQE A;  5J29 A;  4RPX A;  3PML A;  5HHH A;  4PHE A;  3OVS A;  8ICW A;  1JN3 A;  5B3Q A;  5CR0 A;  5D61 A;  5IIK A;  4K99 A;  2BCR A;  2DRA A;  4NY8 A;  2PFQ A;  4NXX A;  4WQK A;  4M9H A;  4RT2 A;  7ICV A;  4RQ4 A;  4AT7 A;  3H37 A;  3B0X A;  7ICJ A;  5CFS A;  4NKU A;  4AT8 A;  1R8B A;  5J0U A;  4WQL A;  4KLG A;  1HUO A;  4O68 A;  2GA9 D;  1ZQJ A;  3NWI A;  3ISD A;  4KLD A;  3UXO A;  8ICF A;  3HIY A;  5J2J A;  2DRB A;  3JPR A;  4Z6C A;  1ZQB A;  7ICP A;  2DR8 A;  3RH4 A;  1KNY A;  1ZQV A;  1FA0 A;  5CHE A;  2M2U A;  4PH5 A;  4NXT A;  1TVA A;  2EWR A;  2FMP A;  4YD1 A;  9ICP A;  2VAN A;  3NYB A;  2PFO A;  4ATB A;  2BPF A;  5HR9 A;  4WC7 A;  3WFS C;  8ICI A;  4AT7 B;  3MGH A;  3AQK A;  4Z6F A;  3AUO A;  4Z6E A;  4O5K A;  3HJ4 A;  5IIN A;  8ICS A;  1TV9 A;  4I2C A;  1UEU A;  4PGY A;  1KDH A;  1ZQG A;  5DBA A;  2HHP A;  7ICE A;  3RJF A;  4K9B A;  1NO5 A;  8ICP A;  5D4B A;  4XQ7 A;  1TFW A;  3ERC C;  8ICU A;  3MGI A;  4NM1 A;  4Z6D A;  4YMO A;  2ZH4 A;  4QZH A;  4I2G A;  3OV7 A;  4KLE A;  1ZQD A;  4R65 A;  4FHY A;  5DBB A;  1BPX A;  4EBK A;  4ATB B;  1ZQR A;  5DKW A;  4FHP A;  4NXU A;  4TUS A;  4KLQ A;  4UBC A;  5J0T A;  1BPZ A;  4WOY A;  4GXJ A;  2ZH3 A;  4M0A A;  1ZQN A;  1WOT A;  1ZQX A;  4K96 A;  2M2T A;  7ICH A;  5D46 A;  2NRK A;  4XJE A;  8ICQ A;  4MF2 A;  4I28 A;  4TUP A;  4X4O A;  1ZQS A;  4NM2 A;  3V7L A;  3LK9 A;  3UQ0 A;  4EBJ A;  5J0R A;  5IIO A;  3ISB A;  4IG8 A;  4M47 A;  3EF2 A;  4RQ8 A;  4QZ8 A;  5HRG A;  7ICL A;  1BPE A;  4RWN A;  5HC9 A;  5DBC A;  4WC0 A;  4PGQ A;  2ZHB A;  3JPT A;  1OU5 A;  5F2V O;  8ICK A;  4YMN A;  2BPG A;  5CA7 A;  1PX5 A;  4S3N A;  4LZG A;  4NKT A;  5J0P A;  4OAI Z;  1BPY A;  1ZQA A;  4YN4 A;  4GXI A;  9ICS A;  3AU2 A;  4DOA A;  3AQL A;  1UEV A;  4O5E A;  5HRI A;  4E8F A;  4WC1 A;  3AQN A;  1ZQT A;  4RQ2 A;  3OGU A;  4R64 A;  8ICZ A;  1ZJM A;  2IHO A;  1R8A A;  2O1P A;  3JCF A;  2ZH5 A;  9ICR A;  4P4O A;  2BBJ A;  4IQU A;  4WC4 A;  5J2E A;  4EEB A;  1VFG A;  9ICL A;  2ZH2 A;  4O6A A;  2ZH7 A;  4M9J A;  1HUZ A;  4NLZ A;  1ZQW A;  5HHI A;  4FHX A;  5IIJ A;  5J2G A;  3ER9 B;  9ICH A;  4JWM A;  4WCW A;  7ICT A;  4DOB A;  4AT9 B;  2RFF A;  4O69 A;  1Q78 A;  8ICA A;  5DB8 A;  1ZQY A;  5III A;  1RPL A;  4I2A A;  5J0X A;  2ZH9 A;  7ICN A;  2O5A A;  4UB4 A;  3RJI A;  5BOL A;  9ICQ A;  3H3A A;  5J2H A;  4UAY A;  4QZF A;  3H39 A;  4KLT A;  8ICJ A;  5J0O A;  4M9N A;  5IIM A;  4K98 A;  3C18 A;  4RQ5 A;  4EV6 A;  1ZJN A;  9ICB A;  1YLQ A;  4K97 A;  4KLF A;  4OAG A;  1MQ3 A;  4JLZ A;  4MFA A;  2I9G A;  3ER8 C;  4M04 A;  4MF8 A;  3JPO A;  4KLJ A;  4DO9 A;  5EOZ A;  4MKP A;  3OUY B;  9ICT A;  5D63 A;  5DB7 A;  2ZH1 A;  4M5D A;  4FHW A;  9ICV A;  3JZ0 A;  3RJK A;  2PFN A;  2P66 A;  4X4R A;  2GWS A;  4WC5 A;  9ICN A;  2BE3 A;  4EP7 A;  3JPQ A;  5DDM A;  7ICG A;  9ICM A;  1BPB A;  3L9D A;  4X0B A;  5J2K A;  4RWQ A;  5BOM A;  5J0Y A;  1ZQQ A;  8ICY A;  3UQ2 A;  3MBY A;  3UXP A;  3JPS A;  2BBH A;  4PHD A;  7ICU A;  2BCV A;  1ZQI A;  2B4V A;  4XRH A;  3MDA A;  4X4N A;  1MIV A;  8ICN A;  4UD5 A;  3JPP A;  4F5P A;  3B0Y A;  2ID1 A;  5HRF A;  3OVB A;  4X4P A;  4I0U A;  4LEW A;  4QZ9 A;  2HN2 A;  5CJ7 A;  8ICM A;  4N7R A;  4UD4 A;  3OVA A;  8ICG A;  5J0W A;  2B51 A;  4I2H A;  4I2E A;  4RQ3 A;  2DR9 A;  1VJ7 A;  4UB3 A;  7ICS A;  4NXZ A;  4QZI A;  3OWG A;  4NLK A;  4I2J A;  4RWO A;  9ICI A;  3RJJ A;  4X0A A;  2BPC A;  4M9G A;  1MIW A;  3AU6 A;  2PBE A;  4O9M A;  3V7K A;  4FH5 A;  8ICO A;  3ISC A;  2BCS A;  1GPJ A;  4I2I A;  1ZQF A;  4LEV A;  3JPN A;  5J2I A;  5J2D A;  5IIL A;  4F5N A;  7ICQ A;  4WBZ A;  1MIY A;  4UAZ A;  4AT9 A;  4WC3 A;  3NKU A;  5HRE A;  4RQ1 A;  3V72 A;  2BCU A;  4KLO A;  3WFQ E;  5CWR A;  3C2K A;  2IHM A;  5JTG A;  4F5Q A;  4KLL A;  2M2V A;  2W9M A;  3C5F A;  8ICB A;  2ZH6 A;  1XSN A;  8ICC A;  8ICH A;  1ZQL A;  1ZQO A;  4GXK A;  8ICE A;  4XA5 A;  3C5G A;  3RJE A;  4YD2 A;  4R66 A;  4KLU A;  4JWN A;  9ICU A;  4KLS A;  1ZQH A;  1KEJ A;  5DED A;  4WC6 A;  2FCL A;  8ICT A;  8ICX A;  2ZH8 A;  9ICO A;  9ICX A;  2M2W A;  5DDY A;  4KLI A;  4MFF A;  3HW8 A; 
#chains in the Genus database with same CATH homology
 4NXV A;  4K9A A;  5CFU A;  4OAG A;  4O69 A;  4JLZ A;  5CFT A;  4LEZ A;  3OWG A;  3ER8 C;  3K7D A;  4NXW A;  4K8V A;  2B56 A;  4NXU A;  4K97 A;  4JLX A;  4MKP A;  3MCR A;  3EF2 A;  4WOY A;  5B3Q A;  5D63 A;  4K9B A;  4LEY A;  2B4V A;  2IHO A;  4OAH A;  5D61 A;  4K99 A;  4FO1 A;  4K96 A;  5CHE A;  5D62 A;  4OAF A;  4NXT A;  4XJE A;  4NXX A;  2EWR A;  3ERC C;  1GPJ A;  4WQK A;  3PHZ A;  4LEV A;  4LEW A;  5B3P A;  4KB6 A;  4K98 A;  4O6A A;  4KM5 A;  2GAF D;  2FCL A;  5CFS A;  4HX0 A;  4N7R A;  4WQL A;  4O67 A;  3NKU A;  4WH5 A;  3ER9 B;  2B51 A;  4O68 A;  4OAI Z;  2GA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...