5CFUA

Crystal structure of ant(2")-ia in complex with adenylyl-2"-tobramycin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
174
structure length
174
Chain Sequence
TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Aminoglycoside Nucleotidyltransferase (2")-Ia
publication title Crystal Structure of ANT(2")-Ia in complex with adenylyl-2"-tobramycin
rcsb
source organism Pseudomonas aeruginosa
total genus 59
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cfuA00
5CFTA 2FCLA 4XJEA 4FO1A 4HX0A 4WQKA 2EWRA 4WQLA 4WH5A 5CFSA 5CFUA
chains in the Genus database with same CATH superfamily
5J0YA 4WC1A 4IQVA 8ICWA 3PMNA 9ICGA 4PGYA 4Z6DA 1Q79A 3AQNA 3C5GA 5CP2A 4RT3A 5DB6A 9ICCA 4WC6A 5HR9A 3EF2A 1ZQPA 8ICFA 4TUSA 4X4OA 4Z6EA 8ICVA 4RQ1A 4OAFA 4YCXA 4NXZA 4E7XA 4EBJA 2ZH7A 4WC4A 2ZH5A 4XA5A 4M9HA 4QZIA 8ICZA 5CJ7A 5B3PA 3WFRE 3CK6A 5DBAA 5IIKA 3JCFA 4NXUA 3JPPA 4RWNA 5DDYA 4WBYA 4F5NA 4DOAA 4NXTA 1MQ3A 4RQ8A 2BCUA 4O5CA 4NLKA 3V7JA 4I2CA 5J2GA 4FH5A 8ICJA 2PBEA 5CFTA 3WFPA 3ER8C 3K75D 4X4RA 2HN1A 2ZH4A 4WH5A 4QZDA 5EOZA 1UEVA 1ZQQA 3PHZA 3RJEA 1NO5A 4UAWA 2BPCA 2ZH9A 3UQ0A 4UB1A 3V7KA 4O5EA 4GXIA 5DEDA 4NY8A 1BPEA 2HN2A 3MCRA 5J29A 3OVAA 4LZGA 4ATBA 5CFSA 4UD4A 1XSLA 4AT8A 3JPTA 2ISPA 2B4VA 9ICVA 3PMLA 1VFGA 5D46A 4YMNA 1ZQUA 4LEYA 4I29A 3H3AA 3NVOA 4PH5A 1ZQTA 4WBZA 4EEDA 2FMSA 3NKUA 5HRHA 8ICLA 2PFNA 4QZHA 3JPQA 4KLTA 4PGQA 3WFQE 2B56A 4Z6FA 4RWOA 7ICLA 8ICIA 3MDCA 5HHHA 5HRIA 4FO1A 4I0UA 2ZH1A 5IIMA 2DR5A 8ICMA 3MBYA 1NOMA 4WC2A 2FMQA 5HRBA 4AT9B 4NXXA 9ICSA 3MGIA 4FH3A 3C66A 5CB1A 3WFOA 5J0UA 8ICXA 1ZQWA 1ZQIA 2NRKA 5J2DA 4DO9A 1TFYA 2ZH2A 3MDAA 5J2IA 3RJHA 5D63A 3HIYA 3RJGA 4M47A 4I2FA 1XSPA 4NKUA 4YD1A 2BCVA 3C2LA 3UPSA 4K9BA 3JPRA 4PHPA 1ZQVA 3V7LA 1JAJA 4F5PA 1JN3A 3RJJA 4I2HA 4K98A 7ICSA 1ZQXA 5DB8A 4DOCA 1ZQNA 3RH5A 1TVAA 2Q66A 4XUSA 4UB5A 4QZCA 9ICIA 4K96A 4JWNA 1TV9A 2GA9D 3TFRA 4RQ0A 4X5VA 1PX5A 2RFFA 5J0PA 4QZBA 4O67A 4KLEA 5B3QA 1HUOA 3HJ1A 8ICPA 4PPXA 5F2VO 4WC7A 1Q78A 4NXWA 1ZQCA 3JPOA 2GAFD 4YMOA 1RPLA 4N7RA 9ICBA 7ICMA 4FHWA 4RQ3A 2VANA 3AU2A 3JZ0A 4WQLA 3OVBA 1FA0A 2PFOA 5DBBA 5HREA 8ICCA 4IQUA 2GWSA 1ZQGA 5IIIA 4GXKA 7ICFA 3HJ4A 4LZDA 3RH4A 4RWQA 4NLZA 1MQ2A 1ZJMA 4X4UA 2ISOA 5HRLA 1ZJNA 8ICSA 2BBJA 4AT7A 1ZQLA 1KDHA 3B0YA 1ZQBA 4X4VA 2ZHAA 3C2MA 1XSNA 8ICEA 4P4OA 4ATBB 5DDMA 8ICRA 3ISBA 4AT8B 5D61A 5HRFA 2IHMA 4QZEA 1OU5A 4M0AA 4QZ8A 4KLSA 5J2HA 7ICJA 3HX0A 1KNYA 4OAGA 4M9LA 2M2VA 3L9DA 8ICNA 7ICRA 3H39A 2I9GA 5HRDA 9ICAA 3B0XA 1R89A 4GXJA 1VJ7A 4R65A 4NLNA 3RJKA 4MFAA 4KM5A 1BPXA 4PHEA 4LEWA 2M2TA 3AUOA 3OV7A 4UAZA 4R63A 3TFSA 4KLQA 2DRAA 4XJEA 4M9NA 4MF2A 4YD2A 8ICYA 1MIVA 3OUYA 8ICHA 3WFSC 5D49A 4EP7A 3C18A 1UETA 4UBCA 4X4PA 4KLLA 4KLMA 5CR0A 1JQRA 9ICKA 4JLZA 4EGWA 4RPZA 4I2DA 7ICNA 8ICBA 7ICHA 5IIOA 1R8CA 4I2BA 1YLQA 4I2JA 4LT6A 3GDXA 4X0BA 1BPDA 4KLGA 4OAIZ 4P4PA 9ICHA 2O1PA 2DVIA 1GPJA 4MKPA 4K4GA 5HRKA 5CHEA 8ICGA 2DR7A 9ICEA 9ICLA 2P66A 5BOMA 4WC3A 3LQCB 5J2CA 4QZGA 4RQ7A 3HW8A 4KLIA 5J2FA 2ID1A 3H37A 3JYYA 5DB7A 2BCRA 2BBHA 2ZH8A 1BPYA 4WCWA 2ZH3A 4TUPA 1ZQSA 2BPGA 8ICAA 4KLHA 4KLOA 4YMMA 3ISDA 4F5RA 2O5AA 1V4AA 5D4BA 1ZQEA 4KLDA 2BCSA 1ZQAA 4OAHA 1ZQDA 1KEJA 1WOTA 4M2YA 5IILA 2M2UA 4KLUA 7ICQA 1ZQYA 9ICQA 7ICEA 4HX0A 3C2KA 8ICKA 8ICUA 4F5QA 4PGXA 1BPBA 4M5DA 5CA7A 4I2AA 5J0WA 1TFWA 4RQ4A 4O9MA 4QZAA 5CFUA 5CHGA 1JMSA 4UD5A 4KLJA 3ER9B 4X4TA 4DOBA 4PHAA 7ICPA 4O69A 3AU6A 4NM1A 9ICNA 4LEZA 3AQLA 1ZQRA 5HHIA 5J0QA 4RPXA 3UQ2A 5TZVA 4I27A 9ICXA 4UB3A 4FHPA 4X4QA 4UBBA 4K4IA 2ZHBA 4JLXA 5HRGA 3ERCC 4AT7B 7ICOA 9ICUA 4UB2A 8ICTA 4JWMA 8ICOA 7ICVA 4UAYA 3MGHA 4KB6A 4RQ6A 3LK9A 4K99A 2DR8A 4FHVA 1BPZA 4FHXA 5J2KA 3V72A 4XRHA 4K8VA 3UXOA 4MFCA 9ICWA 1ZQJA 2BPFA 5J2BA 2BE3A 4FHYA 3RJFA 2FCLA 5CWRA 5J2JA 4EV6A 4R64A 1ZQOA 4XQ7A 4RQ5A 4XQ8A 1UEUA 4PHDA 3AQKA 5HC9A 3OUYB 3ISCA 2DR9A 5BPCA 4X4SA 3H38A 4TURA 5J0TA 4RPYA 2EWRA 1R8AA 4S3NA 5J0SA 4M04A 4YN4A 3RH6A 4WC0A 4WOYA 1ZQKA 2BCQA 2PFPA 2HHPA 5DBCA 1F5AA 4KLFA 4O6AA 7ICGA 4WQKA 4IQWA 4NKTA 1ZQHA 4E8FA 4EEBA 4EBKA 4TUQA 5DKWA 1RZTA 5JTGA 4RWPA 3PNCA 4X4NA 4O5KA 2PXIA 2IUBA 3JPSA 4RT2A 4QZ9A 3AQMA 3UXNA 5J0XA 5BOLA 3NWIA 1HUZA 1MIYA 1ZQZA 3UXPA 4IQTA 1ZQMA 5J2AA 4I2EA 4NXVA 4MF8A 4FO6A 2DRBA 4UB4A 9ICTA 5DB9A 7ICUA 4NM2A 4LVSA 3OVSA 5IIJA 2ZH6A 7ICIA 4X0AA 4K9AA 9ICFA 1ZQFA 3UPQA 1MIWA 3K7DA 4O68A 4RQ2A 3NYBA 4WC5A 4P4MA 9ICPA 4I2IA 4F5OA 4MFFA 5J0RA 4E80A 4P2HA 4K4HA 4Z6CA 2W9MA 4R66A 2FMPA 5J0OA 3JPNA 4AT9A 4I28A 2B51A 5D62A 2M2WA 3HWTA 4LEVA 7ICTA 5J2EA 3C5FA 9ICRA 3OGUA 1R8BA 4I2GA 4M9GA 7ICKA 4QZFA 9ICOA 4K97A 4IG8A 3RJIA 2PFQA 9ICJA 5DECA 5IINA 8ICQA 4M9JA 9ICMA 3OWGA 2IHOA
chains in the Genus database with same CATH topology
3NKUA 4JLXA 3ERCC 2FCLA 5B3PA 5D61A 4WOYA 4NXVA 4NXUA 4HX0A 4K96A 2B51A 5D63A 2B56A 4OAGA 2GA9D 5D62A 3MCRA 4JLZA 4NXTA 4O6AA 3OWGA 4LEVA 4FO1A 4WQKA 5CFSA 5CFUA 4KB6A 4K9BA 4K99A 3ER9B 3EF2A 4O67A 4KM5A 5B3QA 4K9AA 4NXXA 4O69A 4K98A 2B4VA 4LEWA 4K97A 3K7DA 4O68A 4LEZA 4NXWA 4OAFA 4OAIZ 5CFTA 2GAFD 4LEYA 4K8VA 4N7RA 4XJEA 4OAHA 3ER8C 2EWRA 1GPJA 4MKPA 4WH5A 4WQLA 5CHEA 3PHZA 2IHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFT A;  2FCL A;  4XJE A;  4FO1 A;  4HX0 A;  4WQK A;  2EWR A;  4WQL A;  4WH5 A;  5CFS A;  5CFU A; 
#chains in the Genus database with same CATH topology
 5J0Y A;  4WC1 A;  4IQV A;  8ICW A;  3PMN A;  9ICG A;  4PGY A;  4Z6D A;  1Q79 A;  3AQN A;  3C5G A;  5CP2 A;  4RT3 A;  5DB6 A;  9ICC A;  4WC6 A;  5HR9 A;  3EF2 A;  1ZQP A;  8ICF A;  4TUS A;  4X4O A;  4Z6E A;  8ICV A;  4RQ1 A;  4OAF A;  4YCX A;  4NXZ A;  4E7X A;  4EBJ A;  2ZH7 A;  4WC4 A;  2ZH5 A;  4XA5 A;  4M9H A;  4QZI A;  8ICZ A;  5CJ7 A;  5B3P A;  3WFR E;  3CK6 A;  5DBA A;  5IIK A;  3JCF A;  4NXU A;  3JPP A;  4RWN A;  5DDY A;  4WBY A;  4F5N A;  4DOA A;  4NXT A;  1MQ3 A;  4RQ8 A;  2BCU A;  4O5C A;  4NLK A;  3V7J A;  4I2C A;  5J2G A;  4FH5 A;  8ICJ A;  2PBE A;  5CFT A;  3WFP A;  3ER8 C;  3K75 D;  4X4R A;  2HN1 A;  2ZH4 A;  4WH5 A;  4QZD A;  5EOZ A;  1UEV A;  1ZQQ A;  3PHZ A;  3RJE A;  1NO5 A;  4UAW A;  2BPC A;  2ZH9 A;  3UQ0 A;  4UB1 A;  3V7K A;  4O5E A;  4GXI A;  5DED A;  4NY8 A;  1BPE A;  2HN2 A;  3MCR A;  5J29 A;  3OVA A;  4LZG A;  4ATB A;  5CFS A;  4UD4 A;  1XSL A;  4AT8 A;  3JPT A;  2ISP A;  2B4V A;  9ICV A;  3PML A;  1VFG A;  5D46 A;  4YMN A;  1ZQU A;  4LEY A;  4I29 A;  3H3A A;  3NVO A;  4PH5 A;  1ZQT A;  4WBZ A;  4EED A;  2FMS A;  3NKU A;  5HRH A;  8ICL A;  2PFN A;  4QZH A;  3JPQ A;  4KLT A;  4PGQ A;  3WFQ E;  2B56 A;  4Z6F A;  4RWO A;  7ICL A;  8ICI A;  3MDC A;  5HHH A;  5HRI A;  4FO1 A;  4I0U A;  2ZH1 A;  5IIM A;  2DR5 A;  8ICM A;  3MBY A;  1NOM A;  4WC2 A;  2FMQ A;  5HRB A;  4AT9 B;  4NXX A;  9ICS A;  3MGI A;  4FH3 A;  3C66 A;  5CB1 A;  3WFO A;  5J0U A;  8ICX A;  1ZQW A;  1ZQI A;  2NRK A;  5J2D A;  4DO9 A;  1TFY A;  2ZH2 A;  3MDA A;  5J2I A;  3RJH A;  5D63 A;  3HIY A;  3RJG A;  4M47 A;  4I2F A;  1XSP A;  4NKU A;  4YD1 A;  2BCV A;  3C2L A;  3UPS A;  4K9B A;  3JPR A;  4PHP A;  1ZQV A;  3V7L A;  1JAJ A;  4F5P A;  1JN3 A;  3RJJ A;  4I2H A;  4K98 A;  7ICS A;  1ZQX A;  5DB8 A;  4DOC A;  1ZQN A;  3RH5 A;  1TVA A;  2Q66 A;  4XUS A;  4UB5 A;  4QZC A;  9ICI A;  4K96 A;  4JWN A;  1TV9 A;  2GA9 D;  3TFR A;  4RQ0 A;  4X5V A;  1PX5 A;  2RFF A;  5J0P A;  4QZB A;  4O67 A;  4KLE A;  5B3Q A;  1HUO A;  3HJ1 A;  8ICP A;  4PPX A;  5F2V O;  4WC7 A;  1Q78 A;  4NXW A;  1ZQC A;  3JPO A;  2GAF D;  4YMO A;  1RPL A;  4N7R A;  9ICB A;  7ICM A;  4FHW A;  4RQ3 A;  2VAN A;  3AU2 A;  3JZ0 A;  4WQL A;  3OVB A;  1FA0 A;  2PFO A;  5DBB A;  5HRE A;  8ICC A;  4IQU A;  2GWS A;  1ZQG A;  5III A;  4GXK A;  7ICF A;  3HJ4 A;  4LZD A;  3RH4 A;  4RWQ A;  4NLZ A;  1MQ2 A;  1ZJM A;  4X4U A;  2ISO A;  5HRL A;  1ZJN A;  8ICS A;  2BBJ A;  4AT7 A;  1ZQL A;  1KDH A;  3B0Y A;  1ZQB A;  4X4V A;  2ZHA A;  3C2M A;  1XSN A;  8ICE A;  4P4O A;  4ATB B;  5DDM A;  8ICR A;  3ISB A;  4AT8 B;  5D61 A;  5HRF A;  2IHM A;  4QZE A;  1OU5 A;  4M0A A;  4QZ8 A;  4KLS A;  5J2H A;  7ICJ A;  3HX0 A;  1KNY A;  4OAG A;  4M9L A;  2M2V A;  3L9D A;  8ICN A;  7ICR A;  3H39 A;  2I9G A;  5HRD A;  9ICA A;  3B0X A;  1R89 A;  4GXJ A;  1VJ7 A;  4R65 A;  4NLN A;  3RJK A;  4MFA A;  4KM5 A;  1BPX A;  4PHE A;  4LEW A;  2M2T A;  3AUO A;  3OV7 A;  4UAZ A;  4R63 A;  3TFS A;  4KLQ A;  2DRA A;  4XJE A;  4M9N A;  4MF2 A;  4YD2 A;  8ICY A;  1MIV A;  3OUY A;  8ICH A;  3WFS C;  5D49 A;  4EP7 A;  3C18 A;  1UET A;  4UBC A;  4X4P A;  4KLL A;  4KLM A;  5CR0 A;  1JQR A;  9ICK A;  4JLZ A;  4EGW A;  4RPZ A;  4I2D A;  7ICN A;  8ICB A;  7ICH A;  5IIO A;  1R8C A;  4I2B A;  1YLQ A;  4I2J A;  4LT6 A;  3GDX A;  4X0B A;  1BPD A;  4KLG A;  4OAI Z;  4P4P A;  9ICH A;  2O1P A;  2DVI A;  1GPJ A;  4MKP A;  4K4G A;  5HRK A;  5CHE A;  8ICG A;  2DR7 A;  9ICE A;  9ICL A;  2P66 A;  5BOM A;  4WC3 A;  3LQC B;  5J2C A;  4QZG A;  4RQ7 A;  3HW8 A;  4KLI A;  5J2F A;  2ID1 A;  3H37 A;  3JYY A;  5DB7 A;  2BCR A;  2BBH A;  2ZH8 A;  1BPY A;  4WCW A;  2ZH3 A;  4TUP A;  1ZQS A;  2BPG A;  8ICA A;  4KLH A;  4KLO A;  4YMM A;  3ISD A;  4F5R A;  2O5A A;  1V4A A;  5D4B A;  1ZQE A;  4KLD A;  2BCS A;  1ZQA A;  4OAH A;  1ZQD A;  1KEJ A;  1WOT A;  4M2Y A;  5IIL A;  2M2U A;  4KLU A;  7ICQ A;  1ZQY A;  9ICQ A;  7ICE A;  4HX0 A;  3C2K A;  8ICK A;  8ICU A;  4F5Q A;  4PGX A;  1BPB A;  4M5D A;  5CA7 A;  4I2A A;  5J0W A;  1TFW A;  4RQ4 A;  4O9M A;  4QZA A;  5CFU A;  5CHG A;  1JMS A;  4UD5 A;  4KLJ A;  3ER9 B;  4X4T A;  4DOB A;  4PHA A;  7ICP A;  4O69 A;  3AU6 A;  4NM1 A;  9ICN A;  4LEZ A;  3AQL A;  1ZQR A;  5HHI A;  5J0Q A;  4RPX A;  3UQ2 A;  5TZV A;  4I27 A;  9ICX A;  4UB3 A;  4FHP A;  4X4Q A;  4UBB A;  4K4I A;  2ZHB A;  4JLX A;  5HRG A;  3ERC C;  4AT7 B;  7ICO A;  9ICU A;  4UB2 A;  8ICT A;  4JWM A;  8ICO A;  7ICV A;  4UAY A;  3MGH A;  4KB6 A;  4RQ6 A;  3LK9 A;  4K99 A;  2DR8 A;  4FHV A;  1BPZ A;  4FHX A;  5J2K A;  3V72 A;  4XRH A;  4K8V A;  3UXO A;  4MFC A;  9ICW A;  1ZQJ A;  2BPF A;  5J2B A;  2BE3 A;  4FHY A;  3RJF A;  2FCL A;  5CWR A;  5J2J A;  4EV6 A;  4R64 A;  1ZQO A;  4XQ7 A;  4RQ5 A;  4XQ8 A;  1UEU A;  4PHD A;  3AQK A;  5HC9 A;  3OUY B;  3ISC A;  2DR9 A;  5BPC A;  4X4S A;  3H38 A;  4TUR A;  5J0T A;  4RPY A;  2EWR A;  1R8A A;  4S3N A;  5J0S A;  4M04 A;  4YN4 A;  3RH6 A;  4WC0 A;  4WOY A;  1ZQK A;  2BCQ A;  2PFP A;  2HHP A;  5DBC A;  1F5A A;  4KLF A;  4O6A A;  7ICG A;  4WQK A;  4IQW A;  4NKT A;  1ZQH A;  4E8F A;  4EEB A;  4EBK A;  4TUQ A;  5DKW A;  1RZT A;  5JTG A;  4RWP A;  3PNC A;  4X4N A;  4O5K A;  2PXI A;  2IUB A;  3JPS A;  4RT2 A;  4QZ9 A;  3AQM A;  3UXN A;  5J0X A;  5BOL A;  3NWI A;  1HUZ A;  1MIY A;  1ZQZ A;  3UXP A;  4IQT A;  1ZQM A;  5J2A A;  4I2E A;  4NXV A;  4MF8 A;  4FO6 A;  2DRB A;  4UB4 A;  9ICT A;  5DB9 A;  7ICU A;  4NM2 A;  4LVS A;  3OVS A;  5IIJ A;  2ZH6 A;  7ICI A;  4X0A A;  4K9A A;  9ICF A;  1ZQF A;  3UPQ A;  1MIW A;  3K7D A;  4O68 A;  4RQ2 A;  3NYB A;  4WC5 A;  4P4M A;  9ICP A;  4I2I A;  4F5O A;  4MFF A;  5J0R A;  4E80 A;  4P2H A;  4K4H A;  4Z6C A;  2W9M A;  4R66 A;  2FMP A;  5J0O A;  3JPN A;  4AT9 A;  4I28 A;  2B51 A;  5D62 A;  2M2W A;  3HWT A;  4LEV A;  7ICT A;  5J2E A;  3C5F A;  9ICR A;  3OGU A;  1R8B A;  4I2G A;  4M9G A;  7ICK A;  4QZF A;  9ICO A;  4K97 A;  4IG8 A;  3RJI A;  2PFQ A;  9ICJ A;  5DEC A;  5IIN A;  8ICQ A;  4M9J A;  9ICM A;  3OWG A;  2IHO A; 
#chains in the Genus database with same CATH homology
 3NKU A;  4JLX A;  3ERC C;  2FCL A;  5B3P A;  5D61 A;  4WOY A;  4NXV A;  4NXU A;  4HX0 A;  4K96 A;  2B51 A;  5D63 A;  2B56 A;  4OAG A;  2GA9 D;  5D62 A;  3MCR A;  4JLZ A;  4NXT A;  4O6A A;  3OWG A;  4LEV A;  4FO1 A;  4WQK A;  5CFS A;  5CFU A;  4KB6 A;  4K9B A;  4K99 A;  3ER9 B;  3EF2 A;  4O67 A;  4KM5 A;  5B3Q A;  4K9A A;  4NXX A;  4O69 A;  4K98 A;  2B4V A;  4LEW A;  4K97 A;  3K7D A;  4O68 A;  4LEZ A;  4NXW A;  4OAF A;  4OAI Z;  5CFT A;  2GAF D;  4LEY A;  4K8V A;  4N7R A;  4XJE A;  4OAH A;  3ER8 C;  2EWR A;  1GPJ A;  4MKP A;  4WH5 A;  4WQL A;  5CHE A;  3PHZ A;  2IHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...