5CFUA

Crystal structure of ant(2")-ia in complex with adenylyl-2"-tobramycin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
174
structure length
174
Chain Sequence
TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside Nucleotidyltransferase (2")-Ia
publication title Crystal Structure of ANT(2")-Ia in complex with adenylyl-2"-tobramycin
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/antibiotic
total genus 59
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cfuA00
5CFSA 2FCLA 5CFUA 5CFTA 4WQKA 4WH5A 4XJEA 2EWRA 4WQLA 4HX0A 4FO1A
chains in the Genus database with same CATH superfamily
4RT2A 4MFAA 4I28A 4AT8A 1ZQQA 4M9GA 4I2HA 9ICMA 4WC5A 5D63A 4QZBA 3HIYA 7ICJA 4ATBB 3JPTA 4KM5A 5J0XA 4I2CA 4FH5A 3ISDA 4FHWA 5DDMA 4F5PA 1ZQLA 2M2TA 1XSNA 4XA5A 4EEDA 4RWQA 3L9DA 5BOLA 2DRBA 4LT6A 5J0YA 4NLKA 8ICQA 3B0XA 1ZQYA 3AQMA 4WOYA 4F5QA 2ZH4A 3JPOA 2HN1A 1OU5A 3C5FA 4M9JA 5CFSA 4QZHA 2ZH8A 8ICFA 5CJ7A 1ZQHA 5IIKA 3PHZA 4AT7A 1JAJA 8ICEA 5HRDA 2ZH1A 3ERCC 4X4QA 8ICCA 3C2KA 2M2WA 2M2VA 1ZQEA 3RJEA 5DBAA 4QZDA 4OAFA 2BPGA 9ICVA 1R8CA 1V4AA 4O67A 5DKWA 2BCRA 4KLDA 5HRIA 2ISPA 2DRAA 2I9GA 4KLEA 3C2LA 4RWOA 4IQWA 4E80A 4NY8A 4KLQA 2ZH7A 8ICJA 4EP7A 9ICWA 4QZAA 4UB1A 4M5DA 5J2HA 7ICMA 5J2CA 3RH5A 5CB1A 3AQNA 4K96A 3TFSA 4QZCA 2ZHBA 3UXNA 2B51A 7ICSA 4KLSA 3V72A 4GXKA 3NVOA 4RWPA 4OAGA 5D46A 5B3QA 2DR5A 5IILA 5J2DA 2BCQA 1ZQIA 3JPQA 2GAFD 4O69A 3GDXA 1BPXA 5J29A 4K4HA 2BE3A 3TFRA 2IHMA 2O1PA 3MGIA 5DB8A 3ER9B 4X4TA 4IQUA 4RT3A 4YMNA 5CP2A 4RPXA 1BPYA 1ZQRA 4KLTA 4RQ1A 4I2GA 4M47A 3K7DA 3MDCA 1ZQUA 4WBYA 8ICZA 9ICTA 7ICGA 4AT9B 4WC0A 4LVSA 4NXZA 4X4OA 1ZQPA 5DECA 2ISOA 7ICUA 4O5CA 2PFNA 5DDYA 4X4PA 4I2IA 3JPPA 4UB4A 1KDHA 9ICOA 4K4IA 4M0AA 4M9HA 2PBEA 4NLZA 4FHPA 4O68A 1XSPA 3PMNA 1BPBA 3RJKA 1ZJMA 3CK6A 1GPJA 4E7XA 5CFTA 5J2JA 1UEUA 2B56A 5IIIA 4KLGA 5J2FA 3JZ0A 3WFOA 4AT8B 7ICRA 1HUOA 4YN4A 4X4VA 4UB5A 4OAHA 3C66A 1MIWA 4FHVA 4UB3A 5CR0A 1TFWA 4PGQA 8ICUA 2BCSA 4JWMA 4F5RA 4MF2A 4UD4A 4P4MA 4MKPA 4JWNA 4I2BA 9ICFA 4FHXA 4XRHA 3UPSA 4RPYA 2ZH9A 4K4GA 8ICIA 5HRBA 4WC4A 4UB2A 5J0OA 3AQLA 4P4PA 4K9AA 9ICQA 4NXXA 4FO6A 1BPEA 4UD5A 1JMSA 4RQ4A 3RJGA 5CWRA 4UBBA 3HJ1A 4KLHA 5BPCA 9ICBA 1JQRA 2M2UA 4AT7B 4PHEA 4M9NA 4K8VA 4MFCA 8ICVA 4PPXA 4KLLA 1ZQVA 2HHPA 4FO1A 2ZH5A 8ICSA 3PMLA 4FHYA 3HX0A 3RJHA 4NXWA 2O5AA 2ID1A 3V7LA 3OV7A 2FMQA 8ICRA 4LZGA 2FMPA 3RH4A 4N7RA 5DB9A 9ICKA 5D49A 4K99A 3OVSA 4Z6EA 9ICLA 1YLQA 5D62A 1RZTA 4DOAA 3OVAA 5D4BA 9ICAA 4MFFA 3ISBA 1MIVA 4WQLA 4RQ3A 3ER8C 2BPFA 2FMSA 2DVIA 9ICIA 4NXTA 4I2EA 2PFOA 1R89A 4LEWA 2DR7A 1NO5A 4I27A 4P2HA 8ICLA 1ZQJA 4KLIA 4KLOA 7ICNA 4EV6A 9ICCA 4DOBA 5IINA 5CA7A 2IUBA 4QZEA 1RPLA 3NKUA 4WCWA 4X0AA 3RH6A 3NWIA 3UQ2A 4NM1A 7ICVA 3LQCB 5J0PA 2ZH2A 3H38A 5D61A 4PHPA 1KEJA 4QZ9A 1BPDA 7ICKA 4R66A 3OVBA 4XQ7A 3OUYA 7ICEA 4RQ8A 8ICAA 9ICJA 1F5AA 3H3AA 5DEDA 2RFFA 4RQ6A 5J2IA 3WFPA 4X4SA 5J0QA 4JLZA 3JPRA 4I2JA 1WOTA 1TV9A 4PHAA 4X4UA 4O5EA 4NXVA 4KLFA 3LK9A 4X5VA 8ICBA 3UXOA 4DO9A 2ZH6A 4TURA 1ZQOA 7ICQA 4NM2A 4I2FA 1Q78A 4WH5A 4WBZA 4X4RA 4EGWA 4NKTA 3OWGA 2P66A 4QZIA 5J0WA 3ISCA 2PXIA 2BPCA 2BBHA 3C18A 1NOMA 2BCVA 5J2EA 4F5NA 4X4NA 1ZQFA 4NLNA 3HWTA 5IIJA 4IQVA 9ICGA 4NKUA 5J2AA 2BBJA 4TUSA 5HRKA 7ICFA 4LEVA 4IG8A 4PGXA 4Z6FA 4XQ8A 3C2MA 3MGHA 4MF8A 1UEVA 3AU2A 2IHOA 2PFPA 9ICEA 4TUPA 3K75D 4WC1A 3EF2A 2EWRA 5J0RA 3HJ4A 8ICNA 4UAZA 4RWNA 5CHGA 4FH3A 3C5GA 5J0UA 4EEBA 1ZQBA 4WC7A 7ICOA 4UAYA 1ZQMA 4WQKA 3JCFA 4TUQA 1KNYA 4K97A 9ICUA 1ZQGA 4O6AA 7ICTA 4LEZA 1R8BA 5BOMA 1ZQKA 5JTGA 3RJIA 4KLMA 5J2BA 4I29A 4KLJA 1FA0A 9ICPA 4GXIA 8ICMA 9ICRA 1ZQCA 4KB6A 1MIYA 3JPNA 1ZQXA 2BCUA 5HHIA 1ZQTA 4QZFA 4YMOA 5DBBA 1MQ3A 3RJFA 5HRFA 3MDAA 2PFQA 4ATBA 5HRHA 5J2KA 4LEYA 3HW8A 5HRGA 3MCRA 1XSLA 4Z6CA 9ICHA 1PX5A 4EBJA 7ICIA 2Q66A 8ICHA 4I2DA 2NRKA 1ZQAA 4K9BA 2GA9D 5CHEA 2ZH3A 5CFUA 1JN3A 4NXUA 5DB7A 4R64A 4IQTA 9ICSA 2VANA 4YD2A 3OUYB 8ICTA 3WFRE 5IIOA 4M2YA 5F2VO 1ZQWA 4R65A 4R63A 4LZDA 2ZHAA 4JLXA 4YMMA 4UAWA 4S3NA 3UQ0A 4DOCA 1VFGA 4XUSA 3B0YA 3UXPA 5DBCA 7ICLA 9ICXA 1ZQNA 5IIMA 4K98A 1ZQDA 4O5KA 3JPSA 1BPZA 4YCXA 4QZ8A 4RQ2A 3UPQA 2FCLA 1HUZA 8ICYA 3V7KA 5EOZA 4XJEA 4P4OA 3V7JA 5J0TA 4O9MA 4KLUA 9ICNA 3PNCA 3NYBA 3H37A 3AQKA 3AU6A 5DB6A 1ZQSA 5J2GA 3OGUA 4GXJA 3AUOA 8ICXA 1MQ2A 2DR9A 8ICKA 8ICWA 3RJJA 5HR9A 2HN2A 4OAIZ 3MBYA 4RPZA 8ICGA 1TVAA 4RQ7A 2GWSA 2B4VA 1TFYA 4YD1A 4PHDA 4I0UA 8ICOA 4WC3A 7ICHA 1R8AA 4Z6DA 4I2AA 5HHHA 2DR8A 1UETA 1Q79A 4F5OA 4AT9A 4EBKA 5HRLA 4QZGA 5HC9A 3H39A 4PH5A 4RQ5A 1VJ7A 3JYYA 1ZQZA 4E8FA 4WC6A 4M04A 1ZJNA 4HX0A 7ICPA 4M9LA 4PGYA 8ICPA 3WFQE 5B3PA 4RQ0A 4X0BA 5J0SA 2W9MA 5TZVA 3WFSC 4WC2A 5HREA 4UBCA
chains in the Genus database with same CATH topology
4LEZA 4JLXA 3ER9B 5CFSA 4NXTA 4O68A 4K97A 4WH5A 4LEWA 4NXWA 5D63A 3PHZA 3OWGA 4K96A 2IHOA 4K9BA 4KM5A 1GPJA 2GA9D 5CHEA 2B51A 4N7RA 5CFTA 3ERCC 2B56A 2EWRA 3EF2A 4K9AA 3K7DA 4HX0A 4NXXA 5CFUA 4NXUA 4K98A 4KB6A 4OAIZ 4JLZA 4OAGA 4K99A 3NKUA 5B3QA 4OAFA 5B3PA 4OAHA 4O67A 5D62A 2B4VA 2GAFD 4K8VA 5D61A 4O6AA 4LEYA 2FCLA 4NXVA 4O69A 4WQKA 4MKPA 4XJEA 3MCRA 4WOYA 4WQLA 4FO1A 3ER8C 4LEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFS A;  2FCL A;  5CFU A;  5CFT A;  4WQK A;  4WH5 A;  4XJE A;  2EWR A;  4WQL A;  4HX0 A;  4FO1 A; 
#chains in the Genus database with same CATH topology
 4RT2 A;  4MFA A;  4I28 A;  4AT8 A;  1ZQQ A;  4M9G A;  4I2H A;  9ICM A;  4WC5 A;  5D63 A;  4QZB A;  3HIY A;  7ICJ A;  4ATB B;  3JPT A;  4KM5 A;  5J0X A;  4I2C A;  4FH5 A;  3ISD A;  4FHW A;  5DDM A;  4F5P A;  1ZQL A;  2M2T A;  1XSN A;  4XA5 A;  4EED A;  4RWQ A;  3L9D A;  5BOL A;  2DRB A;  4LT6 A;  5J0Y A;  4NLK A;  8ICQ A;  3B0X A;  1ZQY A;  3AQM A;  4WOY A;  4F5Q A;  2ZH4 A;  3JPO A;  2HN1 A;  1OU5 A;  3C5F A;  4M9J A;  5CFS A;  4QZH A;  2ZH8 A;  8ICF A;  5CJ7 A;  1ZQH A;  5IIK A;  3PHZ A;  4AT7 A;  1JAJ A;  8ICE A;  5HRD A;  2ZH1 A;  3ERC C;  4X4Q A;  8ICC A;  3C2K A;  2M2W A;  2M2V A;  1ZQE A;  3RJE A;  5DBA A;  4QZD A;  4OAF A;  2BPG A;  9ICV A;  1R8C A;  1V4A A;  4O67 A;  5DKW A;  2BCR A;  4KLD A;  5HRI A;  2ISP A;  2DRA A;  2I9G A;  4KLE A;  3C2L A;  4RWO A;  4IQW A;  4E80 A;  4NY8 A;  4KLQ A;  2ZH7 A;  8ICJ A;  4EP7 A;  9ICW A;  4QZA A;  4UB1 A;  4M5D A;  5J2H A;  7ICM A;  5J2C A;  3RH5 A;  5CB1 A;  3AQN A;  4K96 A;  3TFS A;  4QZC A;  2ZHB A;  3UXN A;  2B51 A;  7ICS A;  4KLS A;  3V72 A;  4GXK A;  3NVO A;  4RWP A;  4OAG A;  5D46 A;  5B3Q A;  2DR5 A;  5IIL A;  5J2D A;  2BCQ A;  1ZQI A;  3JPQ A;  2GAF D;  4O69 A;  3GDX A;  1BPX A;  5J29 A;  4K4H A;  2BE3 A;  3TFR A;  2IHM A;  2O1P A;  3MGI A;  5DB8 A;  3ER9 B;  4X4T A;  4IQU A;  4RT3 A;  4YMN A;  5CP2 A;  4RPX A;  1BPY A;  1ZQR A;  4KLT A;  4RQ1 A;  4I2G A;  4M47 A;  3K7D A;  3MDC A;  1ZQU A;  4WBY A;  8ICZ A;  9ICT A;  7ICG A;  4AT9 B;  4WC0 A;  4LVS A;  4NXZ A;  4X4O A;  1ZQP A;  5DEC A;  2ISO A;  7ICU A;  4O5C A;  2PFN A;  5DDY A;  4X4P A;  4I2I A;  3JPP A;  4UB4 A;  1KDH A;  9ICO A;  4K4I A;  4M0A A;  4M9H A;  2PBE A;  4NLZ A;  4FHP A;  4O68 A;  1XSP A;  3PMN A;  1BPB A;  3RJK A;  1ZJM A;  3CK6 A;  1GPJ A;  4E7X A;  5CFT A;  5J2J A;  1UEU A;  2B56 A;  5III A;  4KLG A;  5J2F A;  3JZ0 A;  3WFO A;  4AT8 B;  7ICR A;  1HUO A;  4YN4 A;  4X4V A;  4UB5 A;  4OAH A;  3C66 A;  1MIW A;  4FHV A;  4UB3 A;  5CR0 A;  1TFW A;  4PGQ A;  8ICU A;  2BCS A;  4JWM A;  4F5R A;  4MF2 A;  4UD4 A;  4P4M A;  4MKP A;  4JWN A;  4I2B A;  9ICF A;  4FHX A;  4XRH A;  3UPS A;  4RPY A;  2ZH9 A;  4K4G A;  8ICI A;  5HRB A;  4WC4 A;  4UB2 A;  5J0O A;  3AQL A;  4P4P A;  4K9A A;  9ICQ A;  4NXX A;  4FO6 A;  1BPE A;  4UD5 A;  1JMS A;  4RQ4 A;  3RJG A;  5CWR A;  4UBB A;  3HJ1 A;  4KLH A;  5BPC A;  9ICB A;  1JQR A;  2M2U A;  4AT7 B;  4PHE A;  4M9N A;  4K8V A;  4MFC A;  8ICV A;  4PPX A;  4KLL A;  1ZQV A;  2HHP A;  4FO1 A;  2ZH5 A;  8ICS A;  3PML A;  4FHY A;  3HX0 A;  3RJH A;  4NXW A;  2O5A A;  2ID1 A;  3V7L A;  3OV7 A;  2FMQ A;  8ICR A;  4LZG A;  2FMP A;  3RH4 A;  4N7R A;  5DB9 A;  9ICK A;  5D49 A;  4K99 A;  3OVS A;  4Z6E A;  9ICL A;  1YLQ A;  5D62 A;  1RZT A;  4DOA A;  3OVA A;  5D4B A;  9ICA A;  4MFF A;  3ISB A;  1MIV A;  4WQL A;  4RQ3 A;  3ER8 C;  2BPF A;  2FMS A;  2DVI A;  9ICI A;  4NXT A;  4I2E A;  2PFO A;  1R89 A;  4LEW A;  2DR7 A;  1NO5 A;  4I27 A;  4P2H A;  8ICL A;  1ZQJ A;  4KLI A;  4KLO A;  7ICN A;  4EV6 A;  9ICC A;  4DOB A;  5IIN A;  5CA7 A;  2IUB A;  4QZE A;  1RPL A;  3NKU A;  4WCW A;  4X0A A;  3RH6 A;  3NWI A;  3UQ2 A;  4NM1 A;  7ICV A;  3LQC B;  5J0P A;  2ZH2 A;  3H38 A;  5D61 A;  4PHP A;  1KEJ A;  4QZ9 A;  1BPD A;  7ICK A;  4R66 A;  3OVB A;  4XQ7 A;  3OUY A;  7ICE A;  4RQ8 A;  8ICA A;  9ICJ A;  1F5A A;  3H3A A;  5DED A;  2RFF A;  4RQ6 A;  5J2I A;  3WFP A;  4X4S A;  5J0Q A;  4JLZ A;  3JPR A;  4I2J A;  1WOT A;  1TV9 A;  4PHA A;  4X4U A;  4O5E A;  4NXV A;  4KLF A;  3LK9 A;  4X5V A;  8ICB A;  3UXO A;  4DO9 A;  2ZH6 A;  4TUR A;  1ZQO A;  7ICQ A;  4NM2 A;  4I2F A;  1Q78 A;  4WH5 A;  4WBZ A;  4X4R A;  4EGW A;  4NKT A;  3OWG A;  2P66 A;  4QZI A;  5J0W A;  3ISC A;  2PXI A;  2BPC A;  2BBH A;  3C18 A;  1NOM A;  2BCV A;  5J2E A;  4F5N A;  4X4N A;  1ZQF A;  4NLN A;  3HWT A;  5IIJ A;  4IQV A;  9ICG A;  4NKU A;  5J2A A;  2BBJ A;  4TUS A;  5HRK A;  7ICF A;  4LEV A;  4IG8 A;  4PGX A;  4Z6F A;  4XQ8 A;  3C2M A;  3MGH A;  4MF8 A;  1UEV A;  3AU2 A;  2IHO A;  2PFP A;  9ICE A;  4TUP A;  3K75 D;  4WC1 A;  3EF2 A;  2EWR A;  5J0R A;  3HJ4 A;  8ICN A;  4UAZ A;  4RWN A;  5CHG A;  4FH3 A;  3C5G A;  5J0U A;  4EEB A;  1ZQB A;  4WC7 A;  7ICO A;  4UAY A;  1ZQM A;  4WQK A;  3JCF A;  4TUQ A;  1KNY A;  4K97 A;  9ICU A;  1ZQG A;  4O6A A;  7ICT A;  4LEZ A;  1R8B A;  5BOM A;  1ZQK A;  5JTG A;  3RJI A;  4KLM A;  5J2B A;  4I29 A;  4KLJ A;  1FA0 A;  9ICP A;  4GXI A;  8ICM A;  9ICR A;  1ZQC A;  4KB6 A;  1MIY A;  3JPN A;  1ZQX A;  2BCU A;  5HHI A;  1ZQT A;  4QZF A;  4YMO A;  5DBB A;  1MQ3 A;  3RJF A;  5HRF A;  3MDA A;  2PFQ A;  4ATB A;  5HRH A;  5J2K A;  4LEY A;  3HW8 A;  5HRG A;  3MCR A;  1XSL A;  4Z6C A;  9ICH A;  1PX5 A;  4EBJ A;  7ICI A;  2Q66 A;  8ICH A;  4I2D A;  2NRK A;  1ZQA A;  4K9B A;  2GA9 D;  5CHE A;  2ZH3 A;  5CFU A;  1JN3 A;  4NXU A;  5DB7 A;  4R64 A;  4IQT A;  9ICS A;  2VAN A;  4YD2 A;  3OUY B;  8ICT A;  3WFR E;  5IIO A;  4M2Y A;  5F2V O;  1ZQW A;  4R65 A;  4R63 A;  4LZD A;  2ZHA A;  4JLX A;  4YMM A;  4UAW A;  4S3N A;  3UQ0 A;  4DOC A;  1VFG A;  4XUS A;  3B0Y A;  3UXP A;  5DBC A;  7ICL A;  9ICX A;  1ZQN A;  5IIM A;  4K98 A;  1ZQD A;  4O5K A;  3JPS A;  1BPZ A;  4YCX A;  4QZ8 A;  4RQ2 A;  3UPQ A;  2FCL A;  1HUZ A;  8ICY A;  3V7K A;  5EOZ A;  4XJE A;  4P4O A;  3V7J A;  5J0T A;  4O9M A;  4KLU A;  9ICN A;  3PNC A;  3NYB A;  3H37 A;  3AQK A;  3AU6 A;  5DB6 A;  1ZQS A;  5J2G A;  3OGU A;  4GXJ A;  3AUO A;  8ICX A;  1MQ2 A;  2DR9 A;  8ICK A;  8ICW A;  3RJJ A;  5HR9 A;  2HN2 A;  4OAI Z;  3MBY A;  4RPZ A;  8ICG A;  1TVA A;  4RQ7 A;  2GWS A;  2B4V A;  1TFY A;  4YD1 A;  4PHD A;  4I0U A;  8ICO A;  4WC3 A;  7ICH A;  1R8A A;  4Z6D A;  4I2A A;  5HHH A;  2DR8 A;  1UET A;  1Q79 A;  4F5O A;  4AT9 A;  4EBK A;  5HRL A;  4QZG A;  5HC9 A;  3H39 A;  4PH5 A;  4RQ5 A;  1VJ7 A;  3JYY A;  1ZQZ A;  4E8F A;  4WC6 A;  4M04 A;  1ZJN A;  4HX0 A;  7ICP A;  4M9L A;  4PGY A;  8ICP A;  3WFQ E;  5B3P A;  4RQ0 A;  4X0B A;  5J0S A;  2W9M A;  5TZV A;  3WFS C;  4WC2 A;  5HRE A;  4UBC A; 
#chains in the Genus database with same CATH homology
 4LEZ A;  4JLX A;  3ER9 B;  5CFS A;  4NXT A;  4O68 A;  4K97 A;  4WH5 A;  4LEW A;  4NXW A;  5D63 A;  3PHZ A;  3OWG A;  4K96 A;  2IHO A;  4K9B A;  4KM5 A;  1GPJ A;  2GA9 D;  5CHE A;  2B51 A;  4N7R A;  5CFT A;  3ERC C;  2B56 A;  2EWR A;  3EF2 A;  4K9A A;  3K7D A;  4HX0 A;  4NXX A;  5CFU A;  4NXU A;  4K98 A;  4KB6 A;  4OAI Z;  4JLZ A;  4OAG A;  4K99 A;  3NKU A;  5B3Q A;  4OAF A;  5B3P A;  4OAH A;  4O67 A;  5D62 A;  2B4V A;  2GAF D;  4K8V A;  5D61 A;  4O6A A;  4LEY A;  2FCL A;  4NXV A;  4O69 A;  4WQK A;  4MKP A;  4XJE A;  3MCR A;  4WOY A;  4WQL A;  4FO1 A;  3ER8 C;  4LEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...