5CFUA

Crystal structure of ant(2")-ia in complex with adenylyl-2"-tobramycin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
174
structure length
174
Chain Sequence
b'TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside Nucleotidyltransferase (2")-Ia
publication title Crystal Structure of ANT(2")-Ia in complex with adenylyl-2"-tobramycin
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/antibiotic
total genus 59
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cfuA00
2FCLA 4WQKA 4WH5A 5CFTA 4HX0A 4WQLA 4XJEA 5CFSA 5CFUA 4FO1A 2EWRA
chains in the Genus database with same CATH superfamily
2DRAA 3HX0A 3V7KA 4RT2A 5D46A 5TZVA 2ZH3A 4X4VA 4FHXA 5IILA 4NXVA 4EBKA 2FMPA 2RFFA 4FO6A 4KLEA 2BBHA 8ICEA 1ZQXA 8ICMA 2FCLA 2IHOA 4RQ7A 4UB4A 4F5PA 1XSPA 4XUSA 1GPJA 2HHPA 1BPDA 5DB6A 3JPTA 1TVAA 5DB7A 1R8CA 1ZQMA 1ZQLA 4RQ8A 4PHPA 3MCRA 4DOAA 2FMQA 8ICKA 9ICVA 3RH6A 2B4VA 8ICAA 4UAZA 4KLLA 1ZQWA 5J2EA 3RJGA 3JZ0A 5IIOA 4M5DA 2FMSA 4WQLA 4NLNA 1ZQUA 2ZH8A 2BCRA 4K4GA 2VANA 4AT8B 3V72A 5HRDA 8ICNA 4M9HA 4X0BA 2PFQA 5D4BA 1ZQSA 5J2DA 1MIWA 4I2EA 3RJFA 1JAJA 3OVSA 2W9MA 3JPQA 4WC1A 1RZTA 1MIVA 4QZHA 4NY8A 3H38A 4KLUA 5J2CA 1ZQYA 4KLJA 7ICUA 4LT6A 5HRBA 4WCWA 4PHDA 4TURA 4MFAA 3GDXA 9ICWA 5J0YA 8ICOA 1NOMA 3JCFA 4RT3A 4I2FA 5J0PA 4QZAA 9ICXA 1VJ7A 4KLFA 2HN1A 2ZH7A 4FO1A 5HHIA 4I2IA 4FHPA 4X4UA 4LZDA 4NXTA 3AQMA 3JYYA 8ICTA 9ICAA 4PGYA 2ZH9A 4F5QA 4LVSA 1PX5A 5J29A 4MF2A 3C5GA 4P4MA 3WFPA 3JPSA 4I2HA 4OAHA 1ZQKA 4O5EA 4I2DA 4XA5A 1TFWA 3UPSA 5HRFA 1ZQQA 2M2WA 4NXZA 4TUSA 7ICIA 1RPLA 4R66A 3OVAA 4EEBA 5DKWA 3C66A 1R89A 2M2UA 5IIMA 2ZH4A 9ICNA 2PFPA 4X5VA 5D49A 7ICKA 9ICIA 4EP7A 2BCQA 4YCXA 4E7XA 9ICLA 2DR5A 4RPXA 9ICRA 3HIYA 5CA7A 4I2BA 4AT9B 4X0AA 4DOBA 1BPXA 2DR8A 5BOLA 2NRKA 3NWIA 4UAWA 4I0UA 1ZQTA 3MGIA 3UXPA 8ICFA 1XSNA 4WC2A 4M9GA 2BPFA 5CB1A 1Q78A 3HJ1A 1ZQEA 4LEZA 4RWPA 5HR9A 5F2VO 3OV7A 7ICJA 5DEDA 8ICSA 4XQ8A 3AU2A 3C2KA 4WBZA 4M9JA 4YD2A 3H3AA 5CFTA 2B51A 8ICHA 5D63A 8ICQA 5HREA 4AT8A 4R63A 5J0SA 3MDAA 9ICKA 3H37A 3NKUA 7ICPA 4RQ2A 4Z6FA 2PFOA 4M0AA 5J2IA 4K96A 4O5KA 5CHEA 8ICLA 4EGWA 3ISDA 2ZH6A 3TFSA 3RJJA 3OVBA 5CP2A 4LZGA 4RWOA 5D62A 5CFSA 1ZQGA 4GXJA 2IHMA 3RH5A 4UB1A 2ID1A 4I28A 4X4RA 7ICNA 5J2HA 4XRHA 2DVIA 5DBBA 4K9AA 1TFYA 3EF2A 4KLOA 3V7LA 1ZQNA 4IQWA 8ICRA 4K9BA 4WOYA 1ZQCA 4X4NA 1FA0A 4NXXA 1NO5A 4RWQA 3ISBA 1ZJMA 4IQTA 9ICJA 5DB9A 1V4AA 3HWTA 5DBAA 1BPZA 1JMSA 3B0YA 5CHGA 2O1PA 3TFRA 2DR9A 4WBYA 5CR0A 2P66A 4MFCA 4I29A 4FHVA 1JQRA 9ICCA 4I2GA 9ICUA 5BOMA 2HN2A 8ICIA 3HW8A 2PXIA 4GXIA 2PBEA 4UD5A 4YMOA 4F5OA 4OAGA 3NVOA 2O5AA 4PGQA 3C2LA 1UEUA 4WC7A 7ICVA 5J2JA 1OU5A 4JWMA 3LK9A 3CK6A 4QZ9A 4AT9A 3MBYA 4P4PA 4RWNA 4WC3A 5J0UA 3NYBA 5J2FA 4RPZA 5DECA 4TUPA 3JPPA 7ICRA 5J2KA 5DBCA 4K4HA 1F5AA 4F5NA 4NLZA 2ZHBA 3C2MA 4P4OA 1ZQRA 1XSLA 4NLKA 9ICOA 9ICTA 4RQ5A 3ER9B 4PHEA 4TUQA 2ISPA 9ICHA 9ICEA 1ZQZA 4Z6CA 4K8VA 4QZIA 5CJ7A 2Q66A 2BCUA 4UBCA 8ICCA 4KLDA 4X4QA 4KLMA 4UB5A 4KLGA 4O5CA 4WC5A 4X4TA 4JWNA 9ICMA 2ZHAA 5J0TA 4NKTA 4O69A 3AQNA 4MFFA 7ICTA 4M04A 4QZBA 4UAYA 5D61A 5HRLA 4YN4A 4R65A 1YLQA 1R8BA 4E8FA 8ICJA 4IQVA 1UEVA 8ICWA 4PPXA 4FH3A 2BE3A 5DB8A 4X4OA 3WFQE 8ICZA 4UD4A 3PMNA 4WH5A 4QZCA 4YD1A 4XJEA 5IIIA 8ICPA 4KLTA 1BPYA 2DRBA 4NXWA 3B0XA 4X4SA 4K97A 5DDMA 3PMLA 2PFNA 3C5FA 9ICQA 3L9DA 7ICHA 1ZQVA 3UXOA 2BCVA 4P2HA 4RQ6A 4IQUA 4ATBB 4JLXA 7ICOA 5BPCA 4M9NA 4HX0A 4KLIA 2ZH1A 4NXUA 3AUOA 5HRIA 1Q79A 4LEVA 2BPCA 4NM2A 4AT7B 3WFSC 3UXNA 4O9MA 1ZQIA 5J0WA 4QZGA 4RQ1A 4KLHA 1KNYA 4FH5A 5IIKA 5J0OA 1ZQJA 8ICYA 3ER8C 4UB3A 4UB2A 2GA9D 1ZQFA 4LEWA 3PHZA 3RJIA 4I2CA 8ICUA 4KB6A 5HHHA 9ICBA 7ICLA 5B3QA 5J2BA 4GXKA 4Z6DA 3UPQA 4M9LA 4I2JA 2BBJA 1ZQBA 7ICFA 4YMNA 1MQ2A 4WC0A 4RQ0A 4F5RA 4IG8A 1MIYA 5J0XA 3AQLA 5J0RA 4QZDA 4MF8A 4RQ4A 3H39A 1VFGA 7ICGA 3UQ2A 5J0QA 4I27A 4PGXA 1HUZA 9ICPA 4LEYA 4O67A 4PHAA 2M2TA 8ICBA 7ICEA 4OAIZ 1ZQAA 2I9GA 2BCSA 3LQCB 4UBBA 1ZQPA 3OGUA 4X4PA 2DR7A 3RJHA 4KM5A 5J2GA 4XQ7A 4OAFA 4Z6EA 5HRHA 4FHWA 3PNCA 4NM1A 3WFOA 3MDCA 4EBJA 1JN3A 2M2VA 3JPRA 1BPBA 3JPOA 4R64A 5HC9A 4RQ3A 1ZQHA 3WFRE 5CFUA 5DDYA 4O68A 2EWRA 4QZFA 4QZ8A 4N7RA 3AU6A 7ICMA 1UETA 3JPNA 5EOZA 3RJEA 2ZH2A 2GWSA 5IIJA 8ICXA 7ICQA 4K99A 3AQKA 4QZEA 1TV9A 5CWRA 2GAFD 4FHYA 3C18A 4MKPA 2ZH5A 4S3NA 9ICFA 4M2YA 1WOTA 3K7DA 3UQ0A 3OUYA 4ATBA 7ICSA 4EEDA 4K4IA 5HRKA 3ISCA 5J2AA 1ZQOA 4E80A 5B3PA 3V7JA 1BPEA 2B56A 4WQKA 3RJKA 9ICGA 2IUBA 5HRGA 3ERCC 4WC6A 4KLQA 8ICVA 3MGHA 4DO9A 4WC4A 1MQ3A 4DOCA 3HJ4A 4KLSA 1HUOA 5JTGA 4PH5A 4AT7A 1R8AA 4M47A 3RH4A 4K98A 8ICGA 3OWGA 5IINA 4JLZA 4NKUA 4O6AA 3K75D 4RPYA 4YMMA 1ZJNA 3OUYB 2BPGA 2ISOA 4EV6A 9ICSA 1KEJA 1KDHA 1ZQDA 4I2AA
chains in the Genus database with same CATH topology
4K8VA 2B56A 2GA9D 4LEWA 3PHZA 4NXTA 4WQKA 3ERCC 2B4VA 4NXUA 4KB6A 4LEYA 5D62A 4O67A 5CFSA 5CFUA 5B3QA 4O68A 2EWRA 4OAIZ 4N7RA 4WH5A 5CFTA 4LEVA 2B51A 4NXVA 4WQLA 5D63A 4XJEA 4K99A 4OAHA 4NXWA 4O69A 4K97A 4K9AA 2FCLA 3EF2A 2IHOA 4K98A 3OWGA 4KM5A 5D61A 3NKUA 2GAFD 4MKPA 4K9BA 4OAFA 1GPJA 4WOYA 4JLZA 3K7DA 4O6AA 3ER8C 4JLXA 4NXXA 4K96A 5CHEA 3ER9B 3MCRA 4LEZA 4FO1A 4HX0A 5B3PA 4OAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCL A;  4WQK A;  4WH5 A;  5CFT A;  4HX0 A;  4WQL A;  4XJE A;  5CFS A;  5CFU A;  4FO1 A;  2EWR A; 
#chains in the Genus database with same CATH topology
 2DRA A;  3HX0 A;  3V7K A;  4RT2 A;  5D46 A;  5TZV A;  2ZH3 A;  4X4V A;  4FHX A;  5IIL A;  4NXV A;  4EBK A;  2FMP A;  2RFF A;  4FO6 A;  4KLE A;  2BBH A;  8ICE A;  1ZQX A;  8ICM A;  2FCL A;  2IHO A;  4RQ7 A;  4UB4 A;  4F5P A;  1XSP A;  4XUS A;  1GPJ A;  2HHP A;  1BPD A;  5DB6 A;  3JPT A;  1TVA A;  5DB7 A;  1R8C A;  1ZQM A;  1ZQL A;  4RQ8 A;  4PHP A;  3MCR A;  4DOA A;  2FMQ A;  8ICK A;  9ICV A;  3RH6 A;  2B4V A;  8ICA A;  4UAZ A;  4KLL A;  1ZQW A;  5J2E A;  3RJG A;  3JZ0 A;  5IIO A;  4M5D A;  2FMS A;  4WQL A;  4NLN A;  1ZQU A;  2ZH8 A;  2BCR A;  4K4G A;  2VAN A;  4AT8 B;  3V72 A;  5HRD A;  8ICN A;  4M9H A;  4X0B A;  2PFQ A;  5D4B A;  1ZQS A;  5J2D A;  1MIW A;  4I2E A;  3RJF A;  1JAJ A;  3OVS A;  2W9M A;  3JPQ A;  4WC1 A;  1RZT A;  1MIV A;  4QZH A;  4NY8 A;  3H38 A;  4KLU A;  5J2C A;  1ZQY A;  4KLJ A;  7ICU A;  4LT6 A;  5HRB A;  4WCW A;  4PHD A;  4TUR A;  4MFA A;  3GDX A;  9ICW A;  5J0Y A;  8ICO A;  1NOM A;  3JCF A;  4RT3 A;  4I2F A;  5J0P A;  4QZA A;  9ICX A;  1VJ7 A;  4KLF A;  2HN1 A;  2ZH7 A;  4FO1 A;  5HHI A;  4I2I A;  4FHP A;  4X4U A;  4LZD A;  4NXT A;  3AQM A;  3JYY A;  8ICT A;  9ICA A;  4PGY A;  2ZH9 A;  4F5Q A;  4LVS A;  1PX5 A;  5J29 A;  4MF2 A;  3C5G A;  4P4M A;  3WFP A;  3JPS A;  4I2H A;  4OAH A;  1ZQK A;  4O5E A;  4I2D A;  4XA5 A;  1TFW A;  3UPS A;  5HRF A;  1ZQQ A;  2M2W A;  4NXZ A;  4TUS A;  7ICI A;  1RPL A;  4R66 A;  3OVA A;  4EEB A;  5DKW A;  3C66 A;  1R89 A;  2M2U A;  5IIM A;  2ZH4 A;  9ICN A;  2PFP A;  4X5V A;  5D49 A;  7ICK A;  9ICI A;  4EP7 A;  2BCQ A;  4YCX A;  4E7X A;  9ICL A;  2DR5 A;  4RPX A;  9ICR A;  3HIY A;  5CA7 A;  4I2B A;  4AT9 B;  4X0A A;  4DOB A;  1BPX A;  2DR8 A;  5BOL A;  2NRK A;  3NWI A;  4UAW A;  4I0U A;  1ZQT A;  3MGI A;  3UXP A;  8ICF A;  1XSN A;  4WC2 A;  4M9G A;  2BPF A;  5CB1 A;  1Q78 A;  3HJ1 A;  1ZQE A;  4LEZ A;  4RWP A;  5HR9 A;  5F2V O;  3OV7 A;  7ICJ A;  5DED A;  8ICS A;  4XQ8 A;  3AU2 A;  3C2K A;  4WBZ A;  4M9J A;  4YD2 A;  3H3A A;  5CFT A;  2B51 A;  8ICH A;  5D63 A;  8ICQ A;  5HRE A;  4AT8 A;  4R63 A;  5J0S A;  3MDA A;  9ICK A;  3H37 A;  3NKU A;  7ICP A;  4RQ2 A;  4Z6F A;  2PFO A;  4M0A A;  5J2I A;  4K96 A;  4O5K A;  5CHE A;  8ICL A;  4EGW A;  3ISD A;  2ZH6 A;  3TFS A;  3RJJ A;  3OVB A;  5CP2 A;  4LZG A;  4RWO A;  5D62 A;  5CFS A;  1ZQG A;  4GXJ A;  2IHM A;  3RH5 A;  4UB1 A;  2ID1 A;  4I28 A;  4X4R A;  7ICN A;  5J2H A;  4XRH A;  2DVI A;  5DBB A;  4K9A A;  1TFY A;  3EF2 A;  4KLO A;  3V7L A;  1ZQN A;  4IQW A;  8ICR A;  4K9B A;  4WOY A;  1ZQC A;  4X4N A;  1FA0 A;  4NXX A;  1NO5 A;  4RWQ A;  3ISB A;  1ZJM A;  4IQT A;  9ICJ A;  5DB9 A;  1V4A A;  3HWT A;  5DBA A;  1BPZ A;  1JMS A;  3B0Y A;  5CHG A;  2O1P A;  3TFR A;  2DR9 A;  4WBY A;  5CR0 A;  2P66 A;  4MFC A;  4I29 A;  4FHV A;  1JQR A;  9ICC A;  4I2G A;  9ICU A;  5BOM A;  2HN2 A;  8ICI A;  3HW8 A;  2PXI A;  4GXI A;  2PBE A;  4UD5 A;  4YMO A;  4F5O A;  4OAG A;  3NVO A;  2O5A A;  4PGQ A;  3C2L A;  1UEU A;  4WC7 A;  7ICV A;  5J2J A;  1OU5 A;  4JWM A;  3LK9 A;  3CK6 A;  4QZ9 A;  4AT9 A;  3MBY A;  4P4P A;  4RWN A;  4WC3 A;  5J0U A;  3NYB A;  5J2F A;  4RPZ A;  5DEC A;  4TUP A;  3JPP A;  7ICR A;  5J2K A;  5DBC A;  4K4H A;  1F5A A;  4F5N A;  4NLZ A;  2ZHB A;  3C2M A;  4P4O A;  1ZQR A;  1XSL A;  4NLK A;  9ICO A;  9ICT A;  4RQ5 A;  3ER9 B;  4PHE A;  4TUQ A;  2ISP A;  9ICH A;  9ICE A;  1ZQZ A;  4Z6C A;  4K8V A;  4QZI A;  5CJ7 A;  2Q66 A;  2BCU A;  4UBC A;  8ICC A;  4KLD A;  4X4Q A;  4KLM A;  4UB5 A;  4KLG A;  4O5C A;  4WC5 A;  4X4T A;  4JWN A;  9ICM A;  2ZHA A;  5J0T A;  4NKT A;  4O69 A;  3AQN A;  4MFF A;  7ICT A;  4M04 A;  4QZB A;  4UAY A;  5D61 A;  5HRL A;  4YN4 A;  4R65 A;  1YLQ A;  1R8B A;  4E8F A;  8ICJ A;  4IQV A;  1UEV A;  8ICW A;  4PPX A;  4FH3 A;  2BE3 A;  5DB8 A;  4X4O A;  3WFQ E;  8ICZ A;  4UD4 A;  3PMN A;  4WH5 A;  4QZC A;  4YD1 A;  4XJE A;  5III A;  8ICP A;  4KLT A;  1BPY A;  2DRB A;  4NXW A;  3B0X A;  4X4S A;  4K97 A;  5DDM A;  3PML A;  2PFN A;  3C5F A;  9ICQ A;  3L9D A;  7ICH A;  1ZQV A;  3UXO A;  2BCV A;  4P2H A;  4RQ6 A;  4IQU A;  4ATB B;  4JLX A;  7ICO A;  5BPC A;  4M9N A;  4HX0 A;  4KLI A;  2ZH1 A;  4NXU A;  3AUO A;  5HRI A;  1Q79 A;  4LEV A;  2BPC A;  4NM2 A;  4AT7 B;  3WFS C;  3UXN A;  4O9M A;  1ZQI A;  5J0W A;  4QZG A;  4RQ1 A;  4KLH A;  1KNY A;  4FH5 A;  5IIK A;  5J0O A;  1ZQJ A;  8ICY A;  3ER8 C;  4UB3 A;  4UB2 A;  2GA9 D;  1ZQF A;  4LEW A;  3PHZ A;  3RJI A;  4I2C A;  8ICU A;  4KB6 A;  5HHH A;  9ICB A;  7ICL A;  5B3Q A;  5J2B A;  4GXK A;  4Z6D A;  3UPQ A;  4M9L A;  4I2J A;  2BBJ A;  1ZQB A;  7ICF A;  4YMN A;  1MQ2 A;  4WC0 A;  4RQ0 A;  4F5R A;  4IG8 A;  1MIY A;  5J0X A;  3AQL A;  5J0R A;  4QZD A;  4MF8 A;  4RQ4 A;  3H39 A;  1VFG A;  7ICG A;  3UQ2 A;  5J0Q A;  4I27 A;  4PGX A;  1HUZ A;  9ICP A;  4LEY A;  4O67 A;  4PHA A;  2M2T A;  8ICB A;  7ICE A;  4OAI Z;  1ZQA A;  2I9G A;  2BCS A;  3LQC B;  4UBB A;  1ZQP A;  3OGU A;  4X4P A;  2DR7 A;  3RJH A;  4KM5 A;  5J2G A;  4XQ7 A;  4OAF A;  4Z6E A;  5HRH A;  4FHW A;  3PNC A;  4NM1 A;  3WFO A;  3MDC A;  4EBJ A;  1JN3 A;  2M2V A;  3JPR A;  1BPB A;  3JPO A;  4R64 A;  5HC9 A;  4RQ3 A;  1ZQH A;  3WFR E;  5CFU A;  5DDY A;  4O68 A;  2EWR A;  4QZF A;  4QZ8 A;  4N7R A;  3AU6 A;  7ICM A;  1UET A;  3JPN A;  5EOZ A;  3RJE A;  2ZH2 A;  2GWS A;  5IIJ A;  8ICX A;  7ICQ A;  4K99 A;  3AQK A;  4QZE A;  1TV9 A;  5CWR A;  2GAF D;  4FHY A;  3C18 A;  4MKP A;  2ZH5 A;  4S3N A;  9ICF A;  4M2Y A;  1WOT A;  3K7D A;  3UQ0 A;  3OUY A;  4ATB A;  7ICS A;  4EED A;  4K4I A;  5HRK A;  3ISC A;  5J2A A;  1ZQO A;  4E80 A;  5B3P A;  3V7J A;  1BPE A;  2B56 A;  4WQK A;  3RJK A;  9ICG A;  2IUB A;  5HRG A;  3ERC C;  4WC6 A;  4KLQ A;  8ICV A;  3MGH A;  4DO9 A;  4WC4 A;  1MQ3 A;  4DOC A;  3HJ4 A;  4KLS A;  1HUO A;  5JTG A;  4PH5 A;  4AT7 A;  1R8A A;  4M47 A;  3RH4 A;  4K98 A;  8ICG A;  3OWG A;  5IIN A;  4JLZ A;  4NKU A;  4O6A A;  3K75 D;  4RPY A;  4YMM A;  1ZJN A;  3OUY B;  2BPG A;  2ISO A;  4EV6 A;  9ICS A;  1KEJ A;  1KDH A;  1ZQD A;  4I2A A; 
#chains in the Genus database with same CATH homology
 4K8V A;  2B56 A;  2GA9 D;  4LEW A;  3PHZ A;  4NXT A;  4WQK A;  3ERC C;  2B4V A;  4NXU A;  4KB6 A;  4LEY A;  5D62 A;  4O67 A;  5CFS A;  5CFU A;  5B3Q A;  4O68 A;  2EWR A;  4OAI Z;  4N7R A;  4WH5 A;  5CFT A;  4LEV A;  2B51 A;  4NXV A;  4WQL A;  5D63 A;  4XJE A;  4K99 A;  4OAH A;  4NXW A;  4O69 A;  4K97 A;  4K9A A;  2FCL A;  3EF2 A;  2IHO A;  4K98 A;  3OWG A;  4KM5 A;  5D61 A;  3NKU A;  2GAF D;  4MKP A;  4K9B A;  4OAF A;  1GPJ A;  4WOY A;  4JLZ A;  3K7D A;  4O6A A;  3ER8 C;  4JLX A;  4NXX A;  4K96 A;  5CHE A;  3ER9 B;  3MCR A;  4LEZ A;  4FO1 A;  4HX0 A;  5B3P A;  4OAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...