5CFUA

Crystal structure of ant(2")-ia in complex with adenylyl-2"-tobramycin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
174
structure length
174
Chain Sequence
TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside Nucleotidyltransferase (2")-Ia
publication title Crystal Structure of ANT(2")-Ia in complex with adenylyl-2"-tobramycin
rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/antibiotic
total genus 59
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cfuA00
4WQKA 4XJEA 5CFSA 5CFTA 5CFUA 2FCLA 4WQLA 4HX0A 4FO1A 2EWRA 4WH5A
chains in the Genus database with same CATH superfamily
3NKUA 4NXUA 9ICEA 1UETA 8ICYA 4I2BA 4PHDA 3B0XA 3NYBA 4M9JA 3HX0A 4NXWA 4QZFA 4X4RA 3RJJA 4F5RA 2M2UA 3MGHA 1Q78A 4ATBB 3B0YA 3HW8A 2FMQA 5D61A 3V7JA 1TV9A 4O5CA 8ICRA 9ICQA 3WFOA 4KLTA 4KLHA 4WBYA 4LEZA 4F5QA 4M9GA 3TFRA 1ZQLA 5HRHA 3ERCC 4MFFA 4I2GA 4KLOA 3PHZA 5HHHA 1JN3A 7ICNA 4PGQA 3RJEA 3NWIA 4XQ8A 4EGWA 4QZEA 4UB5A 9ICJA 3JYYA 1GPJA 8ICTA 4WC3A 5CHEA 2BPGA 4RWNA 4WC0A 1JMSA 4I2DA 4JLZA 4EEBA 5J2AA 2ZHAA 3K7DA 4NKUA 4RPZA 4GXKA 1ZQJA 7ICTA 4AT9A 4RQ4A 4FO6A 5DDMA 4NLZA 7ICRA 4AT7B 3PNCA 4QZGA 7ICEA 2ZH8A 4YCXA 2FMSA 4QZ8A 5D49A 8ICKA 4RQ2A 5J0OA 4NXTA 1BPXA 1BPZA 4DOAA 1NO5A 1Q79A 9ICBA 4RWQA 8ICFA 5CB1A 4KLUA 7ICFA 3L9DA 1R8CA 9ICRA 4KLEA 4OAIZ 1ZQBA 4EEDA 3MGIA 5J2EA 4RQ5A 4WOYA 2O5AA 2HN2A 4YD1A 9ICAA 2ZH1A 2ZH4A 9ICVA 4R64A 4I2FA 7ICMA 4KLGA 9ICLA 4WBZA 5TZVA 4KLDA 3OGUA 4KM5A 4WC1A 4KLMA 1VFGA 4WC4A 1WOTA 2ZHBA 3C5FA 8ICPA 5J0RA 3JPPA 7ICOA 2M2TA 4LZDA 3UXPA 5EOZA 7ICQA 3C2MA 1KEJA 3EF2A 3AUOA 9ICMA 1ZQTA 4X4UA 4PPXA 4QZAA 1JAJA 4QZIA 3RJKA 2B56A 4I2CA 1ZQFA 8ICHA 4KLQA 4FHPA 4YMOA 3V7LA 1TFWA 4IQUA 7ICPA 4P4OA 3JPRA 2DR5A 4UAZA 2PXIA 4QZDA 3LK9A 5D63A 2B51A 3RJGA 4QZHA 2IHMA 4O5EA 4NXXA 3ISBA 1ZQVA 4X4NA 7ICGA 2BCVA 2BCUA 4NY8A 1ZQHA 2PFNA 5CFSA 5J2KA 4NLNA 4MF2A 3AQNA 8ICIA 5DB7A 2BCSA 4OAFA 5J0SA 8ICVA 2ZH9A 4WQLA 1FA0A 7ICUA 9ICXA 4DOBA 5B3QA 4RPYA 4AT8A 5JTGA 3RH5A 3OUYA 2DR9A 5IIJA 3AU2A 3ER8C 3C18A 4Z6EA 2ID1A 4E8FA 5CP2A 8ICEA 5CHGA 2I9GA 3C2KA 2PFPA 4WCWA 4XA5A 4PHEA 1ZQPA 2GAFD 1ZQZA 4WC5A 5F2VO 2DRBA 4I2AA 2BBHA 4K9BA 2GWSA 3JCFA 4UAWA 8ICNA 1UEVA 3LQCB 3PMNA 8ICUA 3ER9B 3PMLA 7ICJA 2PBEA 2DR8A 4K9AA 3C5GA 1ZQCA 4RQ1A 5CFTA 4K99A 5DDYA 3WFRE 3MDAA 4XJEA 2ISPA 4KB6A 9ICKA 1ZQIA 1JQRA 1BPBA 2IHOA 4NKTA 3V7KA 4X5VA 5DB9A 4JLXA 4M0AA 3HJ4A 4DOCA 9ICWA 4LZGA 3OVSA 1MQ2A 4YMMA 3RJFA 1MIVA 4NXVA 4FHWA 3RJIA 8ICMA 9ICOA 4RQ6A 3JPQA 4M47A 5J2FA 4I2HA 1ZQDA 4P4MA 5HRDA 4I27A 4K4GA 1MIYA 4RQ0A 4QZCA 4EP7A 5HR9A 4DO9A 3WFQE 1ZQGA 4AT9B 5DBBA 4N7RA 3C66A 5DBCA 4UAYA 4FHYA 1ZQWA 5HRLA 3RH4A 3AQMA 5HHIA 1RZTA 1HUOA 4GXJA 2DVIA 3UQ0A 4EBJA 4I2EA 1TVAA 5HRKA 1R8AA 3H37A 5D46A 3MCRA 1XSNA 1ZQYA 8ICCA 1MIWA 4RWOA 4MKPA 2ZH3A 4P2HA 5IIIA 4M04A 4EBKA 4X0BA 4R66A 4FHVA 4Z6FA 1ZQQA 2BBJA 4UD5A 5HREA 9ICCA 5J2JA 2DRAA 5HRGA 3CK6A 4RPXA 5HRBA 1KDHA 4O9MA 5J2CA 1ZQSA 3OVBA 4O69A 4RQ7A 5HRIA 1ZQEA 3H38A 2FMPA 8ICQA 5B3PA 4JWMA 1ZQOA 4UB4A 5CA7A 4LEWA 2P66A 8ICGA 3HIYA 4UB2A 3AU6A 4YN4A 5J0TA 3UPQA 4HX0A 3UXNA 5D62A 4TUPA 1YLQA 4TURA 3MBYA 4OAGA 4I28A 1VJ7A 4K97A 2FCLA 4F5PA 1XSPA 1BPEA 4WQKA 3C2LA 4IG8A 7ICSA 1ZQXA 2Q66A 3WFPA 4ATBA 4IQWA 5IIKA 4XRHA 1V4AA 4F5OA 5HC9A 9ICSA 1UEUA 8ICAA 4X4OA 5J2HA 4YMNA 5DEDA 2DR7A 5J0PA 3OWGA 5J2BA 7ICHA 4FH5A 4K96A 3RH6A 9ICTA 4X0AA 4WC6A 4EV6A 4PHPA 4P4PA 2ZH2A 3OVAA 8ICWA 1HUZA 4PHAA 1F5AA 4X4TA 2HN1A 4RQ8A 4X4SA 4K4IA 4M2YA 5IINA 4X4PA 8ICXA 3MDCA 4R63A 4K4HA 9ICFA 4M9NA 3AQLA 4KLLA 4LVSA 8ICOA 2ISOA 5DB8A 2VANA 4UB1A 4XUSA 4NXZA 5DB6A 4AT7A 4PH5A 4M9HA 4AT8B 4JWNA 2HHPA 4QZBA 3OUYB 4PGYA 4MF8A 3UXOA 1XSLA 8ICZA 3GDXA 3K75D 2O1PA 4UBBA 3UQ2A 4LT6A 4MFAA 4OAHA 4FO1A 4M9LA 4O68A 4UD4A 2BCQA 4XQ7A 2NRKA 1ZJMA 5CJ7A 1PX5A 4NM1A 4FHXA 1R8BA 2ZH7A 5J0YA 4M5DA 7ICKA 4X4QA 4O6AA 3JPSA 4I2IA 4GXIA 2RFFA 1ZQMA 2GA9D 5J2GA 2BE3A 4YD2A 4UB3A 2M2WA 5DECA 1OU5A 5CFUA 2BCRA 5J29A 4F5NA 4I29A 2PFQA 4K98A 4WC2A 4WC7A 8ICJA 3AQKA 1RPLA 8ICBA 9ICGA 5D4BA 7ICLA 5J0WA 5J2IA 4QZ9A 4WH5A 1NOMA 5BOMA 2BPFA 3H3AA 1KNYA 5HRFA 1ZQKA 1ZJNA 2W9MA 4RQ3A 5IIOA 2ZH5A 3V72A 1ZQAA 3UPSA 1TFYA 5J0QA 3ISDA 3OV7A 4I2JA 4RWPA 5IIMA 4FH3A 4X4VA 4IQVA 3ISCA 1MQ3A 3JPOA 1BPDA 4TUSA 4K8VA 4S3NA 4MFCA 9ICHA 8ICSA 3HJ1A 4PGXA 7ICIA 4Z6DA 5CR0A 4E7XA 1ZQUA 5J2DA 9ICIA 4IQTA 5BPCA 4R65A 2ZH6A 5J0UA 4NLKA 4LEVA 1R89A 3NVOA 4KLFA 4UBCA 4NM2A 5DBAA 3HWTA 3TFSA 1BPYA 9ICPA 9ICUA 2BPCA 2B4VA 3H39A 4KLIA 3WFSC 5DKWA 4TUQA 3RJHA 4RT3A 2EWRA 4I0UA 1ZQNA 4LEYA 5J0XA 1ZQRA 3JZ0A 4RT2A 2IUBA 4E80A 8ICLA 9ICNA 4KLSA 5CWRA 2PFOA 7ICVA 3JPTA 5IILA 3JPNA 4O5KA 4Z6CA 2M2VA 5BOLA 4KLJA 4O67A
chains in the Genus database with same CATH topology
3NKUA 4NXUA 4WQKA 4XJEA 3ERCC 3PHZA 4KB6A 2GAFD 4OAFA 2B56A 4O69A 4N7RA 4WQLA 5CFUA 2IHOA 4OAHA 4FO1A 4JLXA 4NXTA 2B4VA 4NXWA 4O68A 4K98A 5B3PA 4KM5A 4K9BA 5B3QA 4LEWA 2EWRA 1GPJA 4K8VA 4NXVA 4LEYA 3ER9B 5CHEA 5D61A 4O6AA 3OWGA 2B51A 5D63A 3MCRA 3ER8C 4JLZA 4K96A 4HX0A 4OAIZ 4MKPA 4K9AA 5D62A 4WH5A 4WOYA 3K7DA 4NXXA 2GA9D 4OAGA 4LEZA 5CFTA 4O67A 4K99A 4K97A 2FCLA 3EF2A 4LEVA 5CFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WQK A;  4XJE A;  5CFS A;  5CFT A;  5CFU A;  2FCL A;  4WQL A;  4HX0 A;  4FO1 A;  2EWR A;  4WH5 A; 
#chains in the Genus database with same CATH topology
 3NKU A;  4NXU A;  9ICE A;  1UET A;  8ICY A;  4I2B A;  4PHD A;  3B0X A;  3NYB A;  4M9J A;  3HX0 A;  4NXW A;  4QZF A;  4X4R A;  3RJJ A;  4F5R A;  2M2U A;  3MGH A;  1Q78 A;  4ATB B;  3B0Y A;  3HW8 A;  2FMQ A;  5D61 A;  3V7J A;  1TV9 A;  4O5C A;  8ICR A;  9ICQ A;  3WFO A;  4KLT A;  4KLH A;  4WBY A;  4LEZ A;  4F5Q A;  4M9G A;  3TFR A;  1ZQL A;  5HRH A;  3ERC C;  4MFF A;  4I2G A;  4KLO A;  3PHZ A;  5HHH A;  1JN3 A;  7ICN A;  4PGQ A;  3RJE A;  3NWI A;  4XQ8 A;  4EGW A;  4QZE A;  4UB5 A;  9ICJ A;  3JYY A;  1GPJ A;  8ICT A;  4WC3 A;  5CHE A;  2BPG A;  4RWN A;  4WC0 A;  1JMS A;  4I2D A;  4JLZ A;  4EEB A;  5J2A A;  2ZHA A;  3K7D A;  4NKU A;  4RPZ A;  4GXK A;  1ZQJ A;  7ICT A;  4AT9 A;  4RQ4 A;  4FO6 A;  5DDM A;  4NLZ A;  7ICR A;  4AT7 B;  3PNC A;  4QZG A;  7ICE A;  2ZH8 A;  4YCX A;  2FMS A;  4QZ8 A;  5D49 A;  8ICK A;  4RQ2 A;  5J0O A;  4NXT A;  1BPX A;  1BPZ A;  4DOA A;  1NO5 A;  1Q79 A;  9ICB A;  4RWQ A;  8ICF A;  5CB1 A;  4KLU A;  7ICF A;  3L9D A;  1R8C A;  9ICR A;  4KLE A;  4OAI Z;  1ZQB A;  4EED A;  3MGI A;  5J2E A;  4RQ5 A;  4WOY A;  2O5A A;  2HN2 A;  4YD1 A;  9ICA A;  2ZH1 A;  2ZH4 A;  9ICV A;  4R64 A;  4I2F A;  7ICM A;  4KLG A;  9ICL A;  4WBZ A;  5TZV A;  4KLD A;  3OGU A;  4KM5 A;  4WC1 A;  4KLM A;  1VFG A;  4WC4 A;  1WOT A;  2ZHB A;  3C5F A;  8ICP A;  5J0R A;  3JPP A;  7ICO A;  2M2T A;  4LZD A;  3UXP A;  5EOZ A;  7ICQ A;  3C2M A;  1KEJ A;  3EF2 A;  3AUO A;  9ICM A;  1ZQT A;  4X4U A;  4PPX A;  4QZA A;  1JAJ A;  4QZI A;  3RJK A;  2B56 A;  4I2C A;  1ZQF A;  8ICH A;  4KLQ A;  4FHP A;  4YMO A;  3V7L A;  1TFW A;  4IQU A;  7ICP A;  4P4O A;  3JPR A;  2DR5 A;  4UAZ A;  2PXI A;  4QZD A;  3LK9 A;  5D63 A;  2B51 A;  3RJG A;  4QZH A;  2IHM A;  4O5E A;  4NXX A;  3ISB A;  1ZQV A;  4X4N A;  7ICG A;  2BCV A;  2BCU A;  4NY8 A;  1ZQH A;  2PFN A;  5CFS A;  5J2K A;  4NLN A;  4MF2 A;  3AQN A;  8ICI A;  5DB7 A;  2BCS A;  4OAF A;  5J0S A;  8ICV A;  2ZH9 A;  4WQL A;  1FA0 A;  7ICU A;  9ICX A;  4DOB A;  5B3Q A;  4RPY A;  4AT8 A;  5JTG A;  3RH5 A;  3OUY A;  2DR9 A;  5IIJ A;  3AU2 A;  3ER8 C;  3C18 A;  4Z6E A;  2ID1 A;  4E8F A;  5CP2 A;  8ICE A;  5CHG A;  2I9G A;  3C2K A;  2PFP A;  4WCW A;  4XA5 A;  4PHE A;  1ZQP A;  2GAF D;  1ZQZ A;  4WC5 A;  5F2V O;  2DRB A;  4I2A A;  2BBH A;  4K9B A;  2GWS A;  3JCF A;  4UAW A;  8ICN A;  1UEV A;  3LQC B;  3PMN A;  8ICU A;  3ER9 B;  3PML A;  7ICJ A;  2PBE A;  2DR8 A;  4K9A A;  3C5G A;  1ZQC A;  4RQ1 A;  5CFT A;  4K99 A;  5DDY A;  3WFR E;  3MDA A;  4XJE A;  2ISP A;  4KB6 A;  9ICK A;  1ZQI A;  1JQR A;  1BPB A;  2IHO A;  4NKT A;  3V7K A;  4X5V A;  5DB9 A;  4JLX A;  4M0A A;  3HJ4 A;  4DOC A;  9ICW A;  4LZG A;  3OVS A;  1MQ2 A;  4YMM A;  3RJF A;  1MIV A;  4NXV A;  4FHW A;  3RJI A;  8ICM A;  9ICO A;  4RQ6 A;  3JPQ A;  4M47 A;  5J2F A;  4I2H A;  1ZQD A;  4P4M A;  5HRD A;  4I27 A;  4K4G A;  1MIY A;  4RQ0 A;  4QZC A;  4EP7 A;  5HR9 A;  4DO9 A;  3WFQ E;  1ZQG A;  4AT9 B;  5DBB A;  4N7R A;  3C66 A;  5DBC A;  4UAY A;  4FHY A;  1ZQW A;  5HRL A;  3RH4 A;  3AQM A;  5HHI A;  1RZT A;  1HUO A;  4GXJ A;  2DVI A;  3UQ0 A;  4EBJ A;  4I2E A;  1TVA A;  5HRK A;  1R8A A;  3H37 A;  5D46 A;  3MCR A;  1XSN A;  1ZQY A;  8ICC A;  1MIW A;  4RWO A;  4MKP A;  2ZH3 A;  4P2H A;  5III A;  4M04 A;  4EBK A;  4X0B A;  4R66 A;  4FHV A;  4Z6F A;  1ZQQ A;  2BBJ A;  4UD5 A;  5HRE A;  9ICC A;  5J2J A;  2DRA A;  5HRG A;  3CK6 A;  4RPX A;  5HRB A;  1KDH A;  4O9M A;  5J2C A;  1ZQS A;  3OVB A;  4O69 A;  4RQ7 A;  5HRI A;  1ZQE A;  3H38 A;  2FMP A;  8ICQ A;  5B3P A;  4JWM A;  1ZQO A;  4UB4 A;  5CA7 A;  4LEW A;  2P66 A;  8ICG A;  3HIY A;  4UB2 A;  3AU6 A;  4YN4 A;  5J0T A;  3UPQ A;  4HX0 A;  3UXN A;  5D62 A;  4TUP A;  1YLQ A;  4TUR A;  3MBY A;  4OAG A;  4I28 A;  1VJ7 A;  4K97 A;  2FCL A;  4F5P A;  1XSP A;  1BPE A;  4WQK A;  3C2L A;  4IG8 A;  7ICS A;  1ZQX A;  2Q66 A;  3WFP A;  4ATB A;  4IQW A;  5IIK A;  4XRH A;  1V4A A;  4F5O A;  5HC9 A;  9ICS A;  1UEU A;  8ICA A;  4X4O A;  5J2H A;  4YMN A;  5DED A;  2DR7 A;  5J0P A;  3OWG A;  5J2B A;  7ICH A;  4FH5 A;  4K96 A;  3RH6 A;  9ICT A;  4X0A A;  4WC6 A;  4EV6 A;  4PHP A;  4P4P A;  2ZH2 A;  3OVA A;  8ICW A;  1HUZ A;  4PHA A;  1F5A A;  4X4T A;  2HN1 A;  4RQ8 A;  4X4S A;  4K4I A;  4M2Y A;  5IIN A;  4X4P A;  8ICX A;  3MDC A;  4R63 A;  4K4H A;  9ICF A;  4M9N A;  3AQL A;  4KLL A;  4LVS A;  8ICO A;  2ISO A;  5DB8 A;  2VAN A;  4UB1 A;  4XUS A;  4NXZ A;  5DB6 A;  4AT7 A;  4PH5 A;  4M9H A;  4AT8 B;  4JWN A;  2HHP A;  4QZB A;  3OUY B;  4PGY A;  4MF8 A;  3UXO A;  1XSL A;  8ICZ A;  3GDX A;  3K75 D;  2O1P A;  4UBB A;  3UQ2 A;  4LT6 A;  4MFA A;  4OAH A;  4FO1 A;  4M9L A;  4O68 A;  4UD4 A;  2BCQ A;  4XQ7 A;  2NRK A;  1ZJM A;  5CJ7 A;  1PX5 A;  4NM1 A;  4FHX A;  1R8B A;  2ZH7 A;  5J0Y A;  4M5D A;  7ICK A;  4X4Q A;  4O6A A;  3JPS A;  4I2I A;  4GXI A;  2RFF A;  1ZQM A;  2GA9 D;  5J2G A;  2BE3 A;  4YD2 A;  4UB3 A;  2M2W A;  5DEC A;  1OU5 A;  5CFU A;  2BCR A;  5J29 A;  4F5N A;  4I29 A;  2PFQ A;  4K98 A;  4WC2 A;  4WC7 A;  8ICJ A;  3AQK A;  1RPL A;  8ICB A;  9ICG A;  5D4B A;  7ICL A;  5J0W A;  5J2I A;  4QZ9 A;  4WH5 A;  1NOM A;  5BOM A;  2BPF A;  3H3A A;  1KNY A;  5HRF A;  1ZQK A;  1ZJN A;  2W9M A;  4RQ3 A;  5IIO A;  2ZH5 A;  3V72 A;  1ZQA A;  3UPS A;  1TFY A;  5J0Q A;  3ISD A;  3OV7 A;  4I2J A;  4RWP A;  5IIM A;  4FH3 A;  4X4V A;  4IQV A;  3ISC A;  1MQ3 A;  3JPO A;  1BPD A;  4TUS A;  4K8V A;  4S3N A;  4MFC A;  9ICH A;  8ICS A;  3HJ1 A;  4PGX A;  7ICI A;  4Z6D A;  5CR0 A;  4E7X A;  1ZQU A;  5J2D A;  9ICI A;  4IQT A;  5BPC A;  4R65 A;  2ZH6 A;  5J0U A;  4NLK A;  4LEV A;  1R89 A;  3NVO A;  4KLF A;  4UBC A;  4NM2 A;  5DBA A;  3HWT A;  3TFS A;  1BPY A;  9ICP A;  9ICU A;  2BPC A;  2B4V A;  3H39 A;  4KLI A;  3WFS C;  5DKW A;  4TUQ A;  3RJH A;  4RT3 A;  2EWR A;  4I0U A;  1ZQN A;  4LEY A;  5J0X A;  1ZQR A;  3JZ0 A;  4RT2 A;  2IUB A;  4E80 A;  8ICL A;  9ICN A;  4KLS A;  5CWR A;  2PFO A;  7ICV A;  3JPT A;  5IIL A;  3JPN A;  4O5K A;  4Z6C A;  2M2V A;  5BOL A;  4KLJ A;  4O67 A; 
#chains in the Genus database with same CATH homology
 3NKU A;  4NXU A;  4WQK A;  4XJE A;  3ERC C;  3PHZ A;  4KB6 A;  2GAF D;  4OAF A;  2B56 A;  4O69 A;  4N7R A;  4WQL A;  5CFU A;  2IHO A;  4OAH A;  4FO1 A;  4JLX A;  4NXT A;  2B4V A;  4NXW A;  4O68 A;  4K98 A;  5B3P A;  4KM5 A;  4K9B A;  5B3Q A;  4LEW A;  2EWR A;  1GPJ A;  4K8V A;  4NXV A;  4LEY A;  3ER9 B;  5CHE A;  5D61 A;  4O6A A;  3OWG A;  2B51 A;  5D63 A;  3MCR A;  3ER8 C;  4JLZ A;  4K96 A;  4HX0 A;  4OAI Z;  4MKP A;  4K9A A;  5D62 A;  4WH5 A;  4WOY A;  3K7D A;  4NXX A;  2GA9 D;  4OAG A;  4LEZ A;  5CFT A;  4O67 A;  4K99 A;  4K97 A;  2FCL A;  3EF2 A;  4LEV A;  5CFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...