4PHDA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp and manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 105
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phdA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phdA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phdA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phdA03
1BPDA 4ECUA 1LB2B 2BQ3A 1K1QA 4LT6A 3GV5B 4X4PA 5CB1A 3AQKA 3FYHA 1XSLA 3UPQA 4WCWA 2LYHA 2KN7A 5DBCA 5J2KA 4QW8A 3QZ7A 2XO7A 2W9BB 4TQRA 3V6JA 4DL2A 5KG0A 5KT7A 2M2UA 5HREA 2V9WA 4YN4A 5J0OA 8ICJA 3KHHA 5HMLA 4B9VA 3HPOA 3T5HA 4TURA 2PFOA 4UAZA 3H8SA 4M9LA 4I2GA 2HHVA 3KTQA 1JXEA 8ICIA 1UEUA 2MUTA 4PHDA 4F4XA 3Q8LA 3RB6A 1D8LA 1ZQVA 3V72A 3Q8RB 5KFTA 3JZ0A 4XRHA 4J9KA 4XQ8A 4DL3A 5CR0A 1KDHA 5HNKA 3GIJA 2XY7A 1T7PA 5KG5A 3PW5A 4J9LA 5HP4A 3TANA 4F91B 3N97B 2JEJA 3RJHA 3C1YA 5HRFA 7ICFA 3WFOA 4J9PA 2XCAA 1JXLA 2JEFA 2Q66A 4QWAA 5DQIA 4ED0A 1R8CA 4AT7B 4TQSA 5C5JA 4HYKA 4JWNA 4P2HA 1ZQWA 9ICVA 5HRIA 4KLGA 1XS9D 2PFNA 7ICGA 4RWNA 3MDAA 4MFFA 4IRKA 5KFFA 3K75D 2PFPA 4PGYA 4PH5A 5J2FA 3JPRA 2ZH8A 1ZQPA 2DRBA 5J2JA 3RH6A 2ZH7A 4KLQA 5L9XA 1TK8A 3JPOA 3H4BA 4J9QA 5KFXA 5DBAA 2AU0A 7ICMA 3WFRE 2IHNA 9ICNA 3H3AA 1XU4A 4DSEA 3EW9A 3RB4A 3PW4A 9ICQA 2BPGA 4J9RA 4DSKA 5HRDA 3HT3A 4CCHA 4QZDA 3AQNA 3TI0A 2A1JB 1TV9A 4J9NA 5DDMA 4YMNA 1XSPA 4RUAA 2AGQA 9ICAA 5DBBA 4WC4A 3ZDCA 2KZZA 1ZQAA 1C7YA 4IRCA 1UA0A 1SZPA 3BQ0A 4MF2A 2W9MA 4YCXA 4FHPA 2ZH4A 4K4IA 3OVSA 4ECRA 3HJ4A 5J0SA 2BCVA 2ZH1A 1TFYA 4Q8FA 4YMMA 2AJQA 1F5AA 4C8KA 4RUCA 3UXOA 4JV0A 4TUPA 1Q78A 4YD1A 3MGIA 1T8EA 1ZQDA 4FHXA 9ICEA 3MABA 4KLHA 4BWJA 1DK2A 1ZQUA 3C23A 5D49A 3JPPA 4M47A 3H7IA 4O5EA 2FLNA 4K4GA 4NXZA 1DK3A 3AU6A 3H8WA 5DG7A 1HJPA 3KHRA 4MFCA 1NO5A 2J6UA 2BHNA 1ZQBA 5J0WA 3AQMA 3GIMA 1BVSA 4FO6A 1ZQFA 7ICQA 7ICNA 4O5KA 5DG8A 5J2DA 4ED8A 1S9FA 3WFPA 4RQ2A 4X4OA 4DWIA 1JIHA 1FA0A 1U9LA 4DFJA 2ZH3A 5KFSA 3MBYA 1HUOA 2C2RA 1BNOA 5J0XA 3AQLA 2BCQA 2KZ3A 1PX5A 1DOQA 5CA7A 2ZUDA 1Y88A 2R8HA 3C2MA 1L3SA 9ICOA 1MIVA 1TFWA 4NM2A 3V7JA 1RXVA 5DGAA 3WFSC 4NLGA 2ZUCA 3JYYA 2ZTDA 5KFOA 2V4RA 5DB6A 2W9BA 1SL1A 3GFKB 3RR7A 1S76D 4AT7A 2UVVA 2Y1JA 3MFHA 5KFEA 3MFIA 5KFHA 1KLNA 2KFNA 5BOMA 4F4KA 5DECA 3RH4A 2ZH9A 3RAXA 4ATBA 4M6WB 5KG3A 4RQ4A 4FH3A 3RJGA 1KFDA 3RAQA 1AROP 2DPJA 5KG6A 4ELVA 2PI5A 2HHQA 4O3QA 7ICRA 4RQ7A 3G6VA 1V4AA 1ZQEA 1ZQKA 3H38A 4XA5A 4F5PA 4QZIA 3QZ8A 3ISCA 1R89A 4YFKA 3ZD9A 5CP2A 4E80A 1X9SA 4DQIA 9ICXA 2JEGA 2JZBA 2VA8A 2BCUA 8ICAA 4ELTA 4DL6A 3RH5A 4R66A 4Z6FA 1NK9A 2R8GA 4F4ZA 7ICIA 5DLGA 5KG4A 4MEXA 3GDXA 1NKBA 8ICYA 3M9MB 1NJYA 4WC7A 4WC0A 7ICTA 3UXPA 3PNCA 4ED2A 1RXWA 4ECXA 4IQWA 2DRAA 5KT3A 7ICPA 1ZQHA 8ICBA 2KZMA 8ICQA 5KFJA 4X4TA 1X2IA 4I2FA 5KG7A 3SV4A 3OUYB 1UETA 1T3NA 4PPXA 4GLXA 1BPYA 4KLTA 4C8NA 5HR9A 4FHYA 4QZHA 4ECTA 2HHXA 1L5UA 3RB0A 3C21A 3JPSA 4J9OA 4F8RA 2UVRA 1S77D 2AQ0A 3NYBA 3G6XA 1SKSA 1BGXT 4RQ8A 1KEJA 4UB4A 3GILA 2HHTA 5J2HA 1NK7A 8ICSA 9ICUA 1R8BA 2W9CA 4X0AA 2F1JA 1B22A 4ECZA 1N56A 4YXJA 2F1HA 1TK5A 3HX0A 4XQ7A 3ISBA 9ICLA 4I2CA 5IIOA 4EBDA 3OSPA 2ISOA 2W9AA 2BQRA 2GWSA 3RJKA 4KLLA 1BPZA 4Q45A 4QZ8A 2F1IA 4UB2A 4ED3A 4RNNA 8ICUA 4DF4A 5HMMA 4P4PA 1NJWA 3JPTA 3PVXA 2A1JA 8ICTA 2PBEA 4AT8B 2ZTEA 4RQ1A 5J0RA 3GV8B 3OGUA 5J2IA 4GXIA 1NKEA 1VJ7A 4I2HA 4AT9A 5HC9A 3BQ1A 1ZQYA 4B9NA 2NRKA 3AUOA 3EZ5A 4ELUA 2JEIA 2DR7A 4UBCA 3EPIA 4Z6DA 3V7KA 4PHEA 2AGPA 2ZHBA 3PX0A 1XC9A 3MGHA 1KTQA 5DB8A 4IQVA 3ZDBA 3N4MB 4X4UA 8ICGA 5F9LA 2FPMA 4AT9B 4F2SA 1BPXA 2ALZA 8ICKA 2RDJA 3PMNA 3RRGA 5IINA 2FMSA 4I2EA 4RWOA 2P6UA 4QZFA 3OJUA 1ZJNA 2AQ4A 4Q44A 2VA3A 2FPKA 4KMUA 4O3RA 3ZD8A 4DOCA 3OHAA 5TZVA 4RQ0A 3OVAA 4O3NA 4F5RA 1ZQJA 4WC1A 4EBCA 4C8OA 4O0IA 5EWGA 1ZQSA 2M2TA 5F2VO 4NLKA 1UT5A 3T5LA 1JQRA 4O3SA 4NLZA 5KTQA 3PO4A 2ZH5A 1WCNA 1ZYQA 4P4MA 4EP7A 1D8YA 1HUZA 3GQCA 2I9GA 4JV1A 8ICMA 1U4BA 1L3VA 4JK1A 3ISDA 1TFRA 5DQHA 4RU9A 3PX4A 2FMPA 4MFAA 2BDPA 1CEZA 8ICOA 5D46A 3H39A 4F93B 4KN4A 4NM1A 4X4NA 4RWQA 4I2BA 4R8UB 4DSFA 3SV3A 3RRHA 4KLIA 3RJIA 8ICNA 3LQCB 3HIYA 3GIIA 1UA1A 4DEZA 1L3TA 4XUSA 8ICFA 4KTQA 5KFPA 3TARA 2C28A 4NKUA 5KFRA 4M04A 2R8IA 3C5GA 4KLSA 4F4WA 3BQTA 4ED1A 3LWMA 1X9WA 2BCSA 1ZQZA 4F3OA 3RB3A 1K1SA 5KFLA 2M2WA 3C66A 4IR1A 2ISPA 3Q8SB 2I1QA 2DFLA 3MR3A 2ATLA 2KP7A 4WC3A 5KFZA 5L1JA 3MR5A 4EZ9A 4KLMA 4B9LA 1X9MA 4I29A 4QWCA 5KFUA 5EWEA 5JUMA 3BQ2A 4DSLA 4FHVA 4YR3A 5J2GA 5KFKA 5CHGA 5J0TA 2FPLA 4NLNA 4WC5A 1QSLA 3GIKA 2FLPA 4E7XA 5HRGA 2KTQA 2HVIA 2IA6A 2HHPA 4FS1A 5J2BA 3EPGA 5DDYA 4TUQA 4ECWA 2XY6A 4X5VA 2OWOA 1ZQGA 4KLOA 3OV7A 4PGQA 3BDPA 4M6WA 3LWLA 5L1KA 3WFQE 4E8FA 4UB1A 1U47A 4FS2A 3KHGA 4F5OA 4DF8A 3THVA 4IRDA 3HW8A 4EBEA 3T5KA 3TAQA 4ED7A 5DB9A 2BGWA 4EBKA 4YR2A 4ECYA 4X4QA 3MR2A 2BPCA 5KFWA 5KG2A 1NKCA 1LV5A 4M2YA 3TFRA 1KRPA 1NOMA 4O5CA 2BR0A 4GC7A 3TQ1A 4MEYA 1QTMA 1YLQA 3M8SA 3EWAA 4YMOA 9ICMA 8ICWA 2C22A 4C8LA 3M8RA 4IQUA 4NY8A 4QZBA 4F50A 3G6YA 4I2JA 2ASJA 9ICCA 4Z6EA 3PW2A 3RJJA 4M9GA 4WBZA 4BDPA 4RQ3A 1BPBA 1H38A 2KFZA 3H37A 4X4RA 4X4SA 4UBBA 4RZRA 1BPEA 3E2EA 7ICVA 4YR0A 4UQGA 4DS4A 1KFSA 4I2IA 3C2LA 4BXOA 4JWMA 5HRLA 2DR8A 2ID1A 2DR9A 1XWLA 4WBYA 5KFCA 2Q0ZX 9ICPA 3ZDEA 2UVUA 2PXIA 1COOA 3QEAZ 3OHBA 3C2KA 5KFIA 9ICWA 4M5DA 5KFBA 1ZQNA 1NK4A 1TK0A 5J0UA 3NGDA 3AU2A 1S97A 1D9FA 3OJSA 1UT8A 4DLGA 3Q8KA 1D9DA 4UB3A 3RJEA 3EYZA 3UXNA 3PR4A 1NZPA 2R8KA 4DFPA 1RYSA 2BE3A 7ICHA 3SZ2A 1ZQRA 3KHLA 4KLEA 3OSNA 2B21A 3PMLA 4EYIB 4QWBA 4DL5A 4FHWA 4R64A 1S0MA 4M9HA 2ZH6A 1Z00B 2BPFA 4Z6CA 2V4QA 2FLLA 2HHWA 4RNOA 1WOTA 5IILA 4UD5A 4DOAA 1IM4A 3ZDAA 4YG2A 5DKWA 1DGSA 5J2AA 4B9TA 1VFGA 4RT3A 4J9MA 3QEBZ 2M2VA 5HRKA 3OVBA 4X4VA 2ZUBA 2NRZA 4MF8A 5IIMA 4F92B 4PHPA 2NRVA 5KT6A 4YP3A 2ZJ5A 1EXNA 7ICUA 3TFSA 4F5QA 4C8MA 3Q8MA 1S0OA 1ZQCA 1TAQA 2UVWA 4WC2A 1V9PA 4R63A 2RFFA 3SYZA 4DFKA 1QSYA 3RR8A 4GC6A 2FMQA 2DPIA 3ZDDA 2NRTA 4DQPA 1U48A 4O9MA 7ICEA 1JMSA 4GXJA 3UQ0A 4DS5A 2IMWP 1KNYA 3OUYA 1ZETA 4M9JA 5KFNA 3B0YA 4QZEA 4YD2A 3H8JA 2XC9A 5J0PA 4JUZA 4QZAA 3M9OB 5DLFA 5HHHA 1ZJMA 1NK8A 4QWDA 4Q8EA 4X0BA 3PY8A 2MUTB 3NTUA 2W8LA 2BQUA 4DQSA 4I28A 1MSWD 1RZTA 1NK6A 3M9NB 4G3IA 1MC8A 9ICGA 4YXMA 4DOBA 1IXRA 4B9MA 5KT4A 1TKDA 5KG1A 4LZDA 4KN7A 1ZQQA 1QLNA 5CWRA 3H40A 1U49A 5KFMA 3IHQB 3LDAA 3FDSA 4I2DA 4QWEA 1T4GA 3PW0A 1S0VA 5DB7A 2XGPA 9ICJA 4LZGA 8ICVA 2C2DA 2ZJAA 2NRXA 4DSIA 3L9DA 3ETLA 4EZ6A 5DGBA 2DVIA 1KSPA 1Z3EB 4S3NA 1ZQMA 2IBKA 4RWPA 4RPYA 4ED6A 3MDCA 5HRBA 1ZQLA 4J9SA 1SL0A 4B9UA 4DFMA 1TAUA 2WTFA 1MQ2A 4IQTA 3PW7A 5KFDA 1ZQIA 1ZQOA 5J2EA 1KFTA 4AT8A 1CUKA 1TVAA 3PO5A 2ZH2A 3TAPA 4DL4A 4ZH4A 7ICOA 4PHAA 2XY5A 1BNPA 1A77A 1B43A 2W9CB 2HVHA 5BOLA 3T3FA 1S0NA 2R8JA 3JPNA 2H5XA 3V6HA 4ATBB 1OU5A 1NJZA 1WCLA 5EWFA 3V6KA 2AGOA 4B9SA 1JAJA 4BGDA 1N48A 2PI4A 4EEYA 5J0QA 5J2CA 3T5JA 3PX6A 4F5NA 4F4YA 3B0XA 4DLEA 5DQGA 3RBEA 1RYRA 2J6SA 1UEVA 2ASDA 4EBJA 3IM1A 4YQWA 1S10A 5KFGA 5J0YA 1Z00A 3RTVA 1MIWA 5DEDA 3UPSA 4UAWA 2ZHAA 2DR5A 4KLFA 3V7LA 3GV7B 5CJ7A 2JZBB 5L1LA 5IIKA 4RPZA 1NJXA 4BWMA 4RQ5A 4NKTA 3PV8A 4I2AA 4KLDA 4E0DA 2ZTCA 5KFAA 4RNMA 1U45A 2BKEA 4UB5A 4QW9A 3RBDA 4TUSA 2BCRA 4PGXA 4IG8A 1RPLA 2HHUA 3LK9A 2O5AA 2XCPA 5BPCA 1ZQXA 4KLJA 4KITB 3SI8A 3HWTA 4M9NA 4P4OA 5IIJA 4ECQA 1SKRA 1L3UA 4JV2A 1NK0A 1A76A 5HRHA 4YVZA 1NK5A 4DSJA 1MIYA 3C1ZA 5EOZA 3H4DA 2P6RA 2ASLA 9ICBA 7ICLA 2RDIA 5KT2A 2J6TA 4FBUA 2W8KA 3UQ2A 4R8UA 1SL2A 4K4HA 5KT5A 1ZQTA 2P66A 5KFYA 8ICRA 4QZ9A 8ICPA 4FH5A 1XSNA 4EYHB 2M9NA 4DQQA 1R8AA 4UD4A 7ICJA 1SKWA 3Q8QB 9ICKA 5KFQA 5IIIA 8ICLA 4R65A 4ECSA 4ECVA 1PZNA 1QSSA 2PFQA 4FBTA 2IHMA 3HJ1A 5HHIA 2Y1IA 1MQ3A 9ICFA 3BJYA 2C2EA 5L1IA 2MAXA 4O3OA 4RQ6A 4QZGA 4GXKA 2ZJ8A 4KLUA 8ICHA 9ICIA 5D4BA 1XO1A 3HP6A 8ICZA 4F2RA 2VA2A 4UAYA 2O1PA 2VANA 4RPXA 4IR9A 4DO9A 3QE9Y 8ICEA 3K4GA 3C18A 7ICSA 1Q79A 4RT2A 9ICTA 4Q43A 4WC6A 9ICHA 1JX4A 4LVSA 5J29A 8ICCA 3RJFA 4O3PA 3JPQA 3C5FA 4BXOB 3ORYA 2XGQA 2HHSA 1JN3A 4I27A 4DL7A 9ICRA 8ICXA 5F9NA 3PR5B 4M0AA 3Q8PB 4DQRA 2HW3A 4QZCA 3MR6A 2NRWA 5KFVA 7ICKA 5DG9A 9ICSA
chains in the Genus database with same CATH superfamily
4LT6A 3BS5A 5CB1A 1XSLA 1VDVA 5DBCA 5J2KA 2W9BB 4TQRA 3V6JA 5KG0A 5J0OA 4OO1J 4UAUA 3HPOA 3T5HA 4M9LA 4UAZA 4I2GA 2HHVA 3WKEA 3DDHA 3IV6A 2W04A 4PHDA 1L7PA 3V72A 3Q8RB 4XRHA 2XY7A 5HP4A 4F91B 5ALTA 3NVWA 3ALRA 3HKZC 5C5JA 3K7DA 4HYKA 2VJ4A 2PFNA 2GOLA 2YMMA 4IRKA 2ES6A 5KFFA 4CF5A 4PH5A 5J2FA 2Z7JA 3JPRA 5J2JA 2ODGA 2KEYA 9ICNA 3H3AA 1XU4A 3EW9A 1MN8A 4RUAA 5DBBA 1C7YA 3WK8A 4MF2A 2QLTA 3AQFA 4K4IA 3HJ4A 3QUBA 1TFYA 4C8KA 1Q78A 2A19A 1ZQUA 3H7IA 2FLNA 3M7DA 4NXZA 3AU6A 2WF8A 5DG7A 1HJPA 5J8YC 2BHNA 3AQMA 3GIMA 2FCLA 3SAFA 4FO6A 7ICQA 7ICNA 4O5KA 1ZD2P 1HIWA 2ZH3A 2RQ5A 2LYAA 5CA7A 3C2MA 2KSOA 3VC8A 4NM2A 3V7JA 1RXVA 4XJEA 3LVVA 3JYYA 2V4RA 5DB6A 2JV3A 2HOIA 2KFNA 1KLNA 4FZLA 3ETRA 5KG3A 1JROA 3RJGA 2DPJA 5KG6A 4N7RA 2HHQA 1V4AA 1ZQKA 3H38A 4XA5A 3BS5B 1R89A 4WQLA 9ICXA 5ALZA 5ALUA 4ELTA 5JTIA 1NK9A 4OAIZ 1ZD5A 5DLGA 5KG4A 4MEXA 8ICYA 3SR6A 5AK3A 1NJYA 4WC7A 3SD7A 4ED2A 2H3IA 3QYPA 4ECXA 1PK3A 2HOFA 2DBYA 2KZMA 5T14A 4PPXA 4KLTA 5ALVA 3RB0A 3BS7A 2KK0A 4A8EA 5AIBA 2UVRA 2AQ0A 2DQNB 3AQEA 3NYBA 3G6XA 3GILA 4C4TA 5J2HA 1NK7A 4X0AA 4LEYA 1B22A 4ECZA 2E3TA 4F72A 2QB0A 3ISBA 4I2CA 5IIOA 2ISOA 4WQKA 2BQRA 4QZ8A 5AKXA 4RNNA 4DF4A 5HMMA 2GH1A 1K5OA 2ZTEA 1VJ7A 3BQ1A 1ZQYA 3AUOA 3V7KA 3PX0A 1KTQA 1LKYA 2PMZF 2Y0SF 1MA7A 1BPXA 2ALZA 4BJQA 2RDJA 1Z1BA 1B0XA 4QZFA 1JUDA 3OJUA 2GLEA 3OHAA 1ZQJA 2O6KA 3NRWA 3T5LA 3NKUA 2Y0SC 3PO4A 4GFJA 2ZH5A 1WCNA 4P4MA 4EP7A 7ICPA 1HUZA 2I9GA 5EE3A 4MFFA 1SXEA 5F2VO 5DQHA 4MFAA 2A1AA 5D46A 4F93B 4KN4A 4EEDA 4JLZA 4KLIA 1L3TA 4XUSA 8ICFA 5KFPA 3TARA 5KFRA 4M04A 4F4WA 1X9WA 2BCSA 3RB3A 4IR1A 2DFLA 3MR3A 2ATLA 3N7RC 2IOFA 4I29A 5KFUA 5EWEA 5JUMA 4K99A 5KFKA 4OJ5A 1ZRNA 5J2BA 5DDYA 4TUQA 2XY6A 2OWOA 5AKIA 3WFQE 5ALIA 4UB1A 3HW8A 3TAQA 1VLBA 2G0AA 4ECYA 5KG2A 1LV5A 4M2YA 4GC7A 3TQ1A 1QTMA 3EF2A 4YMOA 5CHEA 2VIXA 3B9JA 1X40A 4C4RA 9ICCA 1KKXA 4Z6EA 3PW2A 4WBZA 4BDPA 1H38A 1BPBA 4X4RA 4X4SA 1BPEA 4P0PB 7ICVA 1XWLA 1Z4OA 3NVZA 2LHTA 3D2SA 2JH7A 1D9FA 3H0LB 5ALYA 3Q8KA 5KL8B 1NZPA 4DFPA 3KOOA 4UB6U 3KHLA 2B21A 3PMLA 4EYIB 2D6FC 2NO5A 5C0YA 1S0MA 2KE7A 1SV0A 4Z6CA 4UD5A 2KIWA 3A0BU 3BZCA 3ZDAA 4YG2A 1VFGA 2RLTA 4F71A 4JMUA 4YP3A 3TFSA 4F5QA 2UVWA 2RFFA 1IG6A 4DFKA 3RR8A 4GC6A 2I6XA 2GAFD 4O9MA 3OUYA 4QZEA 3M9OB 2ISPA 1ZJMA 4QWDA 3NTUA 4DQSA 1MSWD 1RZTA 1NK6A 4G3IA 2G09A 1F44A 1QCKA 2LPEA 4LZDA 2WF7A 1ZQQA 1QLNA 3KFUF 1ZQ1C 5CWRA 3H40A 4NV0A 4QWEA 5HRKA 1X6IA 1MIVA 3T79A 2ZJAA 4DSIA 3SQIA 5DGBA 2DVIA 2HCFA 1SL0A 1PVPA 2WTFA 2DGZA 4U6PA 3LYSA 3TAPA 1L8LA 2R8JA 1S0NA 4ATBB 2E5SA 1SV0C 3JPNA 1NJZA 4NL9A 1WCLA 4B9SA 3E58A 2QB0B 4BGDA 2KIVA 1RYRA 3ERCC 3B0XA 5DQGA 4EBJA 1S10A 4CF4A 1MIWA 5KFGA 2KKVA 1N60A 1NJXA 3L4PA 2ZIVB 4RQ5A 4NKTA 3F2DA 4HAIA 2BKEA 4QW9A 3DV9A 2BCRA 4WJ3B 2K4HA 4UASA 4KITB 1AQ6A 1WYGA 4ECQA 1SKRA 3C29A 2JHDA 4YVZA 4DSJA 4WOYA 1UQVA 2RDIA 1UPHA 2W8KA 1SL2A 5KAIU 4Y2VA 1XSNA 4ECSA 1PZNA 3QU4A 3BJYA 2C2EA 1ECWA 2HHPA 3HP6A 2O1PA 4F2RA 4UAYA 3QE9Y 2HSZA 3KZIU 1JX4A 3C5FA 3ORYA 4DQRA 2NRWA 9ICSA 1URJA 2BQ3A 1J2MA 1GPJA 3UPQA 2KN7A 2M2UA 4DL2A 2KD1A 5KT7A 4LJXA 4YN4A 5EE9A 5KL1B 2KHVA 5HMLA 5EE1A 2Y9UA 4TURA 2PFOA 1JXEA 1UEUA 4QIWF 3Q8LA 3RB6A 1L7MA 1KDHA 2ZIXB 3GIJA 3PW5A 3RJHA 4P0PA 4J9PA 2HN2A 3F2CA 2Q66A 2CPRA 4QWAA 4ED0A 4FO1A 1R8CA 4AT7B 4TQSA 4EEBA 4KLGA 1XS9D 7ICGA 3MDAA 3WK9A 2W11A 2PFPA 2YN4A 3RH6A 2ZH7A 1TK8A 4MHVA 5AI6A 2BBJA 3M6ZA 3H4BA 7ICMA 4DSEA 4LEWA 9ICQA 2HBLA 4J9RA 5HRDA 1Z1VA 3HT3A 4QZDA 2EANA 4J9NA 5ALFA 1ZQAA 4RQMA 1UA0A 1SZPA 2PMZC 1T3QA 1L7NA 2E8NA 2YX8A 2MSNA 3OVSA 4ECRA 5J0SA 2BCVA 2B0CA 3J81j 4YMMA 1F5AA 3UXOA 4JV0A 3F5EA 3MGIA 1T8EA 4FHXA 4KLHA 5HR7A 1DK2A 1CRXA 4O5EA 4PJ0U 4K4GA 3H8WA 1NO5A 2J6UA 5J0WA 1SZHA 1SWVA 1VJ5A 1ZQFA 5JTGA 3IG8A 4RQ2A 3L5KA 1JIHA 1FA0A 1U9LA 4DFJA 5KFSA 2C2RA 2HN1A 4K8VA 4RQNA 5AI5A 2BCQA 5E79U 4CRXA 1Z4NA 1DOQA 1L3SA 1Y88A 5CFUA 2H3ZA 1F0MA 4NLGA 2DF4B 3QUQA 1SL1A 2W9BA 1S76D 2LKYA 3RR7A 2Y1JA 3MFHA 3MFIA 2FI1A 4ATBA 4RQ4A 1KFDA 4US8A 1AROP 2KKPA 1ZQEA 5GTIU 4QZIA 3QZ8A 4WH5A 3RFAA 3SEIA 5ALDA 2JZBA 2VA8A 4Y2RA 8ICAA 2YMPA 4WC0A 2W43A 7ICTA 3UXPA 4IQWA 5KT3A 8ICBA 8ICQA 1X2IA 4NL9C 5KG7A 3MC1A 4HX0A 1T3NA 1COKA 3H0RB 4GLXA 1BPYA 2LMRA 4PL2A 4ECTA 1L5UA 3JPSA 3NWIA 4F8RA 1S77D 5AM1A 1SKSA 4UB4A 5B3PA 1KEJA 2HHTA 1OUQA 1TK5A 3HX0A 3D2QA 4EBDA 2W9AA 1BPZA 4Q45A 2F1IA 4UB2A 3PSIA 8ICUA 4P4PA 1NJWA 2KMDA 2G06A 5J2IA 4AT9A 2JEIA 3GZFA 4EX6A 4PHEA 2JH1A 2AGPA 1OXJA 5AKZA 3N4MB 3CK6A 3QU7A 4X4UA 2XICA 5F9LA 2FPMA 4F2SA 4US9A 3N7SC 2HMXA 8ICKA 3ER8C 3RRGA 3AN1A 4I2EA 1L8OA 5ALQA 1ZJNA 4Q44A 2FPKA 4KMUA 4F5RA 4WC1A 2M2TA 5EWGA 1ZQSA 4NLKA 4O3SA 4NLZA 3BZKA 5KTQA 5K4LA 4EELA 1ZYQA 8ICMA 1TFRA 2A3VA 2FMPA 1CEZA 8ICOA 3RF9A 4I2BA 1O08A 4DSFA 3LQCB 8ICNA 3HIYA 3GIIA 2K4IA 4KTQA 3C5GA 4ED1A 2NV3A 3LWMA 2KJ5A 1ZQZA 4C4SA 5J8YA 1K1SA 2YMQA 3C66A 3F2BA 4WC3A 4OJPA 5L1JA 4EZ9A 4KLMA 4QWCA 3ZI4A 5J2GA 2W54A 3CW2C 3WKAA 5CHGA 5J0TA 4NLNA 3GIKA 2W7PA 1XO0A 3BQ7A 2IA6A 3E0FA 1V85A 1ZQGA 1FIQA 3OV7A 1LKYB 1X42A 3THVA 4KX5A 4EBKA 3LVWA 3QUTA 3MR2A 4PZNA 5KFWA 5AI4A 1KRPA 1NOMA 3OPXA 3EWAA 9ICMA 8ICWA 2CN1A 4NLCA 4NY8A 4OAHA 3G6YA 4I2JA 1SXDA 2H3FA 2OHFA 3RJJA 4M9GA 2KFZA 5CFSA 4RZRA 4JWMA 4BXOA 5HRLA 2ID1A 5KFCA 2Q0ZX 2CRXA 2UVUA 2PXIA 9ICWA 2H3VA 2HBJA 5KFBA 1ZQNA 1TK0A 3KKAC 3AU2A 4KM5A 1S97A 1NNLA 3OJSA 4DLGA 4UB3A 1RQLA 3EYZA 3PR4A 1RYSA 3SZ2A 5AI9A 4KLEA 3OSNA 3AM9A 3H8MA 4R64A 1V38A 2V4QA 4RNOA 5IILA 3I28A 4DOAA 4O67A 1DGSA 4J9MA 3QEBZ 3OVBA 4X4VA 2ZUBA 4JB3A 4MF8A 4PHPA 2NRVA 4C0ZA 2IHOA 4C8MA 2OCEA 4R63A 3ZDDA 2FMQA 7ICEA 4OJLA 1U48A 4O3MA 1JMSA 4DS5A 4EX7A 4EV6A 4M9JA 3B0YA 4JLXA 2XC9A 4RWNA 1SB3C 2D3DA 2MUTB 2BQUA 1MC8A 4YXMA 1IXRA 4Y2UA 1TKDA 5KG1A 2I5HA 3IDWA 2GA9D 5KFMA 9ICJA 3PW0A 8ICVA 3L9DA 3ETLA 2EH9A 4ED6A 1ZQLA 4B9UA 1MQ2A 3PW7A 3CNHA 1PUZA 2LM4A 4ZH4A 5L1MA 4K9AA 3SMVA 5ALJA 1A77A 5BOLA 1ZOLA 3QNMA 1OU5A 3V6KA 2AGOA 5J2CA 4C8OA 4DLEA 3H0MB 5AI8A 2ASDA 4FZNA 4Y2QA 5DEDA 5J0YA 1Z00A 2ZHAA 4UAWA 3V7LA 1N5WA 2ZXIA 5L1LA 5IIKA 4E0DA 4NXWA 3KBBA 4RNMA 1U45A 2YTUA 2HHUA 3LK9A 2O5AA 1ZQXA 3SI8A 5AICA 2ZIVA 4OAGA 1L3UA 3NRZA 3I76A 9ICBA 7ICLA 2ASLA 4Y2XA 3PZPA 5AKHA 5KT2A 2J6TA 4K4HA 8ICPA 1ZQTA 5KFYA 4EYHB 1R8AA 7ICJA 1SKWA 4PZOA 4ICAA 4R65A 4ECVA 1QSSA 4K97A 4AYBF 3AMZA 5HHIA 2Y1IA 1MQ3A 2FDRA 2MAXA 4RQ6A 9ICIA 1R8BA 3F5AA 4Y2TA 1XO1A 5D4BA 3VCBA 2ZH4A 2VANA 3K4GA 3PHZA 7ICSA 2K60A 3D2NA 5J29A 4BXOB 8ICXA 5F9NA 3PR5B 4OCZA 2HW3A 3HJEA 2LI6A 3MR6A 7ICKA 1K1QA 3GV5B 4KB6A 2EQYA 2KOBA 3FYHA 4WCWA 2LYHA 1YZ7A 1S8OA 3A0HU 3NASA 4B9VA 3N28A 1SIJA 3NVYA 2B56A 3CYMA 1SV4A 1ZQVA 2QB1A 5KFTA 4J9KA 4DL3A 5CR0A 5HNKA 5KG5A 3N97B 3TANA 7ICFA 2KSOB 2XCAA 4C7YA 1JXLA 2JEFA 3MGVA 3PSPA 3K75D 2K4EA 2G07A 3NVVA 4USAA 3JPOA 3WFRE 5DBAA 2IHNA 3PW4A 2BPGA 2B51A 4DSKA 4CCHA 3TI0A 4LEVA 2A1JB 1TV9A 2MRLA 9ICAA 5DDMA 1N2XA 4IRCA 5D63A 2W9MA 4YCXA 4FHPA 2YB1A 4OD0A 4BUGA 1WWUA 4B6JA 4YD1A 1ZQDA 3WU2U 5AHXA 3MABA 4BWJA 2ESEA 3C23A 3WK4A 4MFCA 1ZQBA 2EZZA 4EEKA 1ED1A 3PSFA 3WFPA 5J2DA 5ALMA 4G9BA 4DWIA 5AM4A 3KD3A 3MBYA 1HUOA 1BNOA 3QU9A 2OM6A 3AQLA 2KZ3A 2F8LA 5DGAA 2WF5A 2KVSA 2ZUCA 5KFOA 1Q46A 2JMGA 4AT7A 3GFKB 5KFEA 2CXYA 5KFHA 2HDOA 2EAOA 2ZH9A 1N63A 4FH3A 4K96A 1RQNA 4ELVA 2PI5A 7ICRA 2FJ6A 3G6VA 4F5PA 4YFKA 3ZD9A 5CP2A 4DQIA 1DRGA 2BCUA 5AKYA 4DL6A 7ICIA 1NKBA 4NXVA 1RXWA 2DRAA 2BBHA 2PKEA 4I2FA 3SV4A 2WAQC 2L5YA 4OAFA 5HR9A 2AHOB 5KAFU 4QZHA 3AL0B 2HHXA 3N7PD 3C21A 2IOHA 4NWIA 5F3XB 2F2AB 4RQ8A 5AM0A 3TKAA 8ICSA 2WHEA 1N56A 2F1HA 4XQ7A 3KZXA 1Z19A 9ICLA 3CP8A 4ED3A 3JPTA 3UMCA 2A1JA 8ICTA 4AT8B 4RQ1A 3GV8B 4GXIA 3OGUA 5HC9A 4B9NA 2NRKA 3EZ5A 1HEKA 3HILA 3EPIA 5G5HA 4Z6DA 2K8AA 4C7ZA 3TACB 3MGHA 4IQVA 4UAVA 1UHUA 4IL6U 1RYUA 1CI4A 2G08A 2WFAA 2AQ4A 4DOCA 4O3NA 4O0IA 1JQRA 1WG8A 2KHQA 1D8YA 3GQCA 3WK6A 5AKLA 4ZOHC 4RU9A 3H39A 2JR5A 4X4NA 1N5XA 2IUBA 3RRHA 1QQ6A 3RJIA 4K9BA 1DGJA 2NYVA 4P0QB 2R8IA 4KLSA 3I1YA 1A0PA 4GIBA 4F3OA 5HR6A 5KFLA 3Q8SB 2I1QA 3MR5A 3IN5A 3WKBA 1X9MA 3DEEA 3BQ2A 4FHVA 4YR3A 2FPLA 4WC5A 1L7OA 2ZXHA 3ICXA 5HRGA 1JALA 4ECWA 1YZ6A 4KLOA 1T94A 2FE9A 2BDUA 4PGQA 1U47A 3KHGA 4F5OA 4IRDA 4EBEA 3T5KA 4ED7A 4CDGA 2EDUA 4X4QA 1L6NA 1NKCA 1YLQA 4EGWA 4MEYA 2DWQA 1WUDA 4F50A 4EENA 2ZIWB 3H37A 4UBBA 4YR0A 4UQGA 4DS4A 4WBYA 3ZDEA 1COOA 2OEHA 5KFIA 1NK4A 5ALGA 3NGDA 4O6AA 1RM6C 2BE3A 7ICHA 1X6JA 1ZQRA 4CNQA 1ZXIA 4FHWA 2ZH6A 1IM4A 1PK1A 5J2AA 1P7DA 3FAHA 4UARA 3JCFA 2NRZA 2ZIWA 4F92B 5KT6A 2ZJ5A 1EXNA 1DXSA 3Q8MA 4WC2A 1V9PA 5KNIA 4DQPA 4GXJA 3UQ0A 2IMWP 1QQ7A 3R9KA 5KFNA 4YD2A 3H8JA 5DLFA 4QZAA 5HHHA 4Q8EA 3PY8A 4CE6A 9ICGA 1D8BA 1Q3UA 5KT4A 3OWGA 2RRDA 4KN7A 2M0NA 5A0LA 4O69A 3IHQB 3O0FA 4I2DA 1S0VA 1KW4A 5DB7A 3TADA 2XGPA 4E80A 1PVQA 4EZ6A 3K1RB 1Z3EB 2IOFK 2BZFA 5H2FU 3QU2A 4J9SA 3WKCA 4IS7A 4DFMA 1X9XA 1ZQIA 5KFDA 1ZQOA 5J2EA 2OH2A 4AT8A 1CUKA 1TVAA 3PO5A 2ZH2A 2DUYA 7ICOA 3SAHA 4PHAA 2XY5A 1BNPA 2W9CB 2W03A 3V6HA 1JAJA 1FFUA 2PI4A 4EEYA 3AQNA 3T5JA 4F5NA 2J6SA 1UEVA 2HBMA 4YQWA 3UPSA 2DR5A 3RTVA 2DKZA 2XI9A 3GV7B 1LVHA 4LEZA 2VKQA 3PV8A 4I2AA 2ZTCA 1QQ5A 5KFAA 2YMLA 1J2NA 4O68A 1N62A 4PGXA 4IG8A 2XCPA 4QJFB 5BPCA 4KLJA 1V97A 3HWTA 4P4OA 3AEVA 4JV2A 1A76A 5HRHA 1MIYA 5CEHA 5EOZA 4E8FA 4OJ6A 3UQ2A 4FH5A 2P66A 2KJ8A 1IIPA 4NLBA 3TADC 1F5SA 4DQQA 5EE0A 3Q8QB 9ICKA 5IIIA 8ICLA 2EZXA 3HJ1A 4KX3A 9ICFA 5L1IA 4GXKA 4KLUA 2ZJ8A 2VA2A 2WB1F 4IR9A 4DO9A 1Q79A 4RT2A 2VJ5A 5ALEA 3IRUA 4WC6A 4LVSA 3RJFA 4O3PA 2B4VA 4U7CA 3HKZF 4QZCA 5AM2A 1ZRMA 5KFVA 1B4FA 4E7XA 2XIDA 1BPDA 4ECUA 1LB2B 2E8PA 3M1YA 4X4PA 3AQKA 4QW8A 3QZ7A 2XO7A 2OYYA 5HREA 5AI0A 2V9WA 2ZIXA 1A6SA 3KHHA 3S6JA 3H8SA 2YQEA 3KTQA 8ICIA 2MUTA 2WAQF 4F4XA 1QH9A 1D8LA 4Y2SA 3JZ0A 4XQ8A 5ALSA 1RDFA 1T7PA 4J9LA 4AYBC 3UMBA 2JEJA 3C1YA 2KICA 5HRFA 1S5LU 3MCRA 3WFOA 5DQIA 3HRDD 4JWNA 4P2HA 1ZQWA 9ICVA 5HRIA 3QUCA 1NI3A 4PGYA 4UATA 2ZH8A 1ZQPA 2DRBA 4KLQA 5L9XA 3ED5A 4J9QA 5KFXA 2AU0A 3RB4A 3D6JA 4Y2JA 2H3QA 1X66A 2F3NA 4WC4A 1XSPA 4YMNA 2AGQA 3ZDCA 2ZIUA 2KZZA 4PL1A 3BQ0A 1GO3F 1OW5A 4C80A 2B6GA 2ZH1A 4Q8FA 2AJQA 4RUCA 4TUPA 9ICEA 2EWRA 3JPPA 5D49A 2LYBA 4M47A 5AK5A 1DK3A 2JXJA 3KHRA 4QIWC 3FC4A 1BVSA 4QNLA 2RP5A 5DG8A 4ED8A 1S9FA 2QARB 1XNSA 4X4OA 1ZD4A 2R18A 5J0XA 4FZMA 1PX5A 2R8HA 2ZUDA 9ICOA 2W3SA 2N1RA 1TFWA 2AH5A 3WFSC 2ZTDA 1PK1B 2DL0A 2D8CA 2UVVA 1SGGA 5BOMA 4F4KA 5DECA 3RH4A 3EUB2 3RAXA 4M6WB 4K98A 2DKXA 2F44A 2K89A 1RG6A 3RAQA 4O3QA 1ZD3A 4RQ7A 2LBOA 4CGZA 4BX9C 3NVOA 3ISCA 1UCVA 2MA1A 4J03A 1X9SA 2JEGA 4I0UA 3RH5A 4R66A 4Z6FA 1NZBA 2R8GA 4F4ZA 2Q4TA 3GDXA 3M9MB 3PNCA 1ZQHA 2G5HB 2F77X 5D61A 5KFJA 4X4TA 2F76X 2HBKA 2K8BB 3OUYB 4DCCA 5ALXA 1UETA 3IG5A 4AP9A 4IC9A 2KVCA 5D62A 4Y2PA 4C8NA 4FHYA 1JI7A 4Y2YA 5FP0A 4J9OA 1KQQA 2E1FA 2E8MA 4UW9A 3UMGA 2E8OA 1BGXT 3K1ZA 2MU2A 9ICUA 2W9CA 2ZG6A 2G5IB 2F1JA 4FFDA 5ALWA 4YXJA 5ALPA 2W7OA 2EZYA 8ICJA 3OSPA 3RJKA 3UM9A 4KLLA 2GWSA 3FM9A 3PVXA 2PBEA 2RHFA 1NKEA 5J0RA 4I2HA 3KKAA 2DR7A 4ELUA 2WF9A 4UBCA 2ZHBA 4KMOB 1XC9A 5DB8A 3ZDBA 2P35A 8ICGA 4AT9B 2JRZA 3PMNA 5IINA 2FMSA 5AK4A 2P6UA 1KBUA 4RWOA 5AKEA 2VA3A 4O3RA 3ZD8A 1N61A 5TZVA 4RQ0A 3OVAA 4EBCA 2KV2A 1UT5A 4ACOA 3C28A 4JV1A 1U4BA 1L3VA 4JK1A 3ISDA 2BDPA 3PX4A 3WK7A 4NM1A 2HOQA 4RWQA 4R8UB 3ER9B 2KG5A 3SV3A 1UA1A 4DEZA 4NKUA 3SAGA 2C28A 3U26A 1WWVA 4UB8U 3BQTA 2JGAA 2WF6A 2M2WA 1Q3VA 1SWWA 2KP7A 5KFZA 4B9LA 5CFTA 1JRPA 2W55A 4DSLA 2LM1A 1FEZA 1QSLA 2FLPA 2KTQA 1O03A 2HVIA 4FS1A 3EPGA 1FFVA 4X5VA 3BDPA 4M6WA 1M6YA 3LWLA 5L1KA 4FS2A 4DF8A 5AKKA 5DB9A 2BGWA 4YR2A 5ALRA 2BPCA 4O5CA 3TFRA 2BR0A 1KL9A 3M8SA 4OJOA 2C22A 4C8LA 3M8RA 4IQUA 4QZBA 2ASJA 5ALHA 2EAPA 2E1EA 4RQ3A 5AKJA 3E2EA 2OXOA 1KFSA 4I2IA 3C2LA 2DR8A 2DR9A 9ICPA 3QEAZ 3OHBA 2ZIUB 3C2KA 3ONNA 4M5DA 5AKGA 5J0UA 2EAMA 3NUQA 2F8KA 1UT8A 1D9DA 3RJEA 3UXNA 2R8KA 3WKDA 5ALNA 4QWBA 4DL5A 4M9HA 3WK5A 1Z00B 2BPFA 2FLLA 2HHWA 1WOTA 2W3RA 5DKWA 4B9TA 2QKQA 4RT3A 2M2VA 1Q8KA 5IIMA 2QARA 7ICUA 5AK6A 1S0OA 1ZQCA 1TAQA 3SYZA 1QSYA 2DPIA 2NRTA 1FO4A 1KNYA 1TE2A 5TISU 2AXTU 1ZETA 2KNJA 4NXTA 5J0PA 4JUZA 1NK8A 4X0BA 3F53A 5AM5A 1IV8A 1YT3A 2W8LA 4I28A 3M9NB 4DOBA 4B9MA 5B66U 4FE3A 1U49A 3LDAA 3FDSA 1T4GA 4LZGA 2C2DA 2NRXA 2YY6A 1KSPA 2K4PA 4S3NA 1ZQMA 2IBKA 1KN5A 4RWPA 1TAMA 3OTQA 4RPYA 3MDCA 5HRBA 4P0QA 1TAUA 4IQTA 3IP4B 1KFTA 5GTHU 4DL4A 4NJ8A 3NS1A 3PSTA 1B43A 4MKPA 2HVHA 3T3FA 2H5XA 5EWFA 1N48A 3PX6A 5J0QA 3RBEA 4F4YA 2KJ9A 3IM1A 4KLFA 3QU5A 5CJ7A 4DFDA 2JZBB 5AM3A 4RPZA 4BWMA 2WB1C 4KLDA 2NO4A 4UB5A 3RBDA 4TUSA 5B3QA 1RPLA 5G5GA 4NXXA 5AIAA 1J97A 5ALLA 4M9NA 1C20A 5IIJA 1NK0A 4NXUA 2YB4A 1NK5A 3C1ZA 3H4DA 2P6RA 4FBUA 4R8UA 8ICRA 5KT5A 5JU5A 4QZ9A 4UD4A 4CF3A 2M9NA 2GO7A 5CRXA 5ALOA 5B5EU 5KFQA 2PFQA 4FBTA 5ALKA 2IHMA 1PVRA 3GU3A 4O3OA 4QZGA 8ICHA 8ICZA 3C18A 4RPXA 3SENA 8ICEA 2Y9TA 3QXGA 3M6KA 9ICTA 4Q43A 3QX7A 3CRXA 9ICHA 2HI0A 8ICCA 3L3FX 3JPQA 2XVTA 2XGQA 2HHSA 1JN3A 4I27A 4DL7A 9ICRA 4M0AA 3Q8PB 5DG9A 2K8CB 5JRTA
chains in the Genus database with same CATH topology
1BPDA 4ECUA 1LB2B 2BQ3A 1K1QA 4LT6A 3GV5B 4X4PA 5CB1A 3AQKA 3FYHA 1XSLA 3UPQA 4WCWA 2LYHA 2KN7A 5DBCA 5J2KA 4QW8A 3QZ7A 2XO7A 2W9BB 4TQRA 3V6JA 4DL2A 5KG0A 5KT7A 2M2UA 5HREA 2V9WA 4YN4A 5J0OA 8ICJA 3KHHA 5HMLA 4B9VA 3HPOA 3T5HA 4TURA 2PFOA 4UAZA 3H8SA 4M9LA 4I2GA 2HHVA 3KTQA 1JXEA 8ICIA 1UEUA 2MUTA 4PHDA 4F4XA 3Q8LA 3RB6A 1D8LA 1ZQVA 3V72A 3Q8RB 5KFTA 3JZ0A 4XRHA 4J9KA 4XQ8A 4DL3A 5CR0A 1KDHA 5HNKA 3GIJA 2XY7A 1T7PA 5KG5A 3PW5A 4J9LA 5HP4A 3TANA 4F91B 3N97B 2JEJA 3RJHA 3C1YA 5HRFA 7ICFA 3WFOA 4J9PA 2XCAA 1JXLA 2JEFA 2Q66A 4QWAA 5DQIA 4ED0A 1R8CA 4AT7B 4TQSA 5C5JA 4HYKA 4JWNA 4P2HA 1ZQWA 9ICVA 5HRIA 4KLGA 1XS9D 2PFNA 7ICGA 4RWNA 3MDAA 4MFFA 4IRKA 5KFFA 3K75D 2PFPA 4PGYA 4PH5A 5J2FA 3JPRA 2ZH8A 1ZQPA 2DRBA 5J2JA 3RH6A 2ZH7A 4KLQA 5L9XA 1TK8A 3JPOA 3H4BA 4J9QA 5KFXA 5DBAA 2AU0A 7ICMA 3WFRE 2IHNA 9ICNA 3H3AA 1XU4A 4DSEA 3EW9A 3RB4A 3PW4A 9ICQA 2BPGA 4J9RA 4DSKA 5HRDA 3HT3A 4CCHA 4QZDA 3AQNA 3TI0A 2A1JB 1TV9A 4J9NA 5DDMA 4YMNA 1XSPA 4RUAA 2AGQA 9ICAA 5DBBA 4WC4A 3ZDCA 2KZZA 1ZQAA 1C7YA 4IRCA 1UA0A 1SZPA 3BQ0A 4MF2A 2W9MA 4YCXA 4FHPA 2ZH4A 4K4IA 3OVSA 4ECRA 3HJ4A 5J0SA 2BCVA 2ZH1A 1TFYA 4Q8FA 4YMMA 2AJQA 1F5AA 4C8KA 4RUCA 3UXOA 4JV0A 4TUPA 1Q78A 4YD1A 3MGIA 1T8EA 1ZQDA 4FHXA 9ICEA 3MABA 4KLHA 4BWJA 1DK2A 1ZQUA 3C23A 5D49A 3JPPA 4M47A 3H7IA 4O5EA 2FLNA 4K4GA 4NXZA 1DK3A 3AU6A 3H8WA 5DG7A 1HJPA 3KHRA 4MFCA 1NO5A 2J6UA 2BHNA 1ZQBA 5J0WA 3AQMA 3GIMA 1BVSA 4FO6A 1ZQFA 7ICQA 7ICNA 4O5KA 5DG8A 5J2DA 4ED8A 1S9FA 3WFPA 4RQ2A 4X4OA 4DWIA 1JIHA 1FA0A 1U9LA 4DFJA 2ZH3A 5KFSA 3MBYA 1HUOA 2C2RA 1BNOA 5J0XA 3AQLA 2BCQA 2KZ3A 1PX5A 1DOQA 5CA7A 2ZUDA 1Y88A 2R8HA 3C2MA 1L3SA 9ICOA 1MIVA 1TFWA 4NM2A 3V7JA 1RXVA 5DGAA 3WFSC 4NLGA 2ZUCA 3JYYA 2ZTDA 5KFOA 2V4RA 5DB6A 2W9BA 1SL1A 3GFKB 3RR7A 1S76D 4AT7A 2UVVA 2Y1JA 3MFHA 5KFEA 3MFIA 5KFHA 1KLNA 2KFNA 5BOMA 4F4KA 5DECA 3RH4A 2ZH9A 3RAXA 4ATBA 4M6WB 5KG3A 4RQ4A 4FH3A 3RJGA 1KFDA 3RAQA 1AROP 2DPJA 5KG6A 4ELVA 2PI5A 2HHQA 4O3QA 7ICRA 4RQ7A 3G6VA 1V4AA 1ZQEA 1ZQKA 3H38A 4XA5A 4F5PA 4QZIA 3QZ8A 3ISCA 1R89A 4YFKA 3ZD9A 5CP2A 4E80A 1X9SA 4DQIA 9ICXA 2JEGA 2JZBA 2VA8A 2BCUA 8ICAA 4ELTA 4DL6A 3RH5A 4R66A 4Z6FA 1NK9A 2R8GA 4F4ZA 7ICIA 5DLGA 5KG4A 4MEXA 3GDXA 1NKBA 8ICYA 3M9MB 1NJYA 4WC7A 4WC0A 7ICTA 3UXPA 3PNCA 4ED2A 1RXWA 4ECXA 4IQWA 2DRAA 5KT3A 7ICPA 1ZQHA 8ICBA 2KZMA 8ICQA 5KFJA 4X4TA 1X2IA 4I2FA 5KG7A 3SV4A 3OUYB 1UETA 1T3NA 4PPXA 4GLXA 1BPYA 4KLTA 4C8NA 5HR9A 4FHYA 4QZHA 4ECTA 2HHXA 1L5UA 3RB0A 3C21A 3JPSA 4J9OA 4F8RA 2UVRA 1S77D 2AQ0A 3NYBA 3G6XA 1SKSA 1BGXT 4RQ8A 1KEJA 4UB4A 3GILA 2HHTA 5J2HA 1NK7A 8ICSA 9ICUA 1R8BA 2W9CA 4X0AA 2F1JA 1B22A 4ECZA 1N56A 4YXJA 2F1HA 1TK5A 3HX0A 4XQ7A 3ISBA 9ICLA 4I2CA 5IIOA 4EBDA 3OSPA 2ISOA 2W9AA 2BQRA 2GWSA 3RJKA 4KLLA 1BPZA 4Q45A 4QZ8A 2F1IA 4UB2A 4ED3A 4RNNA 8ICUA 4DF4A 5HMMA 4P4PA 1NJWA 3JPTA 3PVXA 2A1JA 8ICTA 2PBEA 4AT8B 2ZTEA 4RQ1A 5J0RA 3GV8B 3OGUA 5J2IA 4GXIA 1NKEA 1VJ7A 4I2HA 4AT9A 5HC9A 3BQ1A 1ZQYA 4B9NA 2NRKA 3AUOA 3EZ5A 4ELUA 2JEIA 2DR7A 4UBCA 3EPIA 4Z6DA 3V7KA 4PHEA 2AGPA 2ZHBA 3PX0A 1XC9A 3MGHA 1KTQA 5DB8A 4IQVA 3ZDBA 3N4MB 4X4UA 8ICGA 5F9LA 2FPMA 4AT9B 4F2SA 1BPXA 2ALZA 8ICKA 2RDJA 3PMNA 3RRGA 5IINA 2FMSA 4I2EA 4RWOA 2P6UA 4QZFA 3OJUA 1ZJNA 2AQ4A 4Q44A 2VA3A 2FPKA 4KMUA 4O3RA 3ZD8A 4DOCA 3OHAA 5TZVA 4RQ0A 3OVAA 4O3NA 4F5RA 1ZQJA 4WC1A 4EBCA 4C8OA 4O0IA 5EWGA 1ZQSA 2M2TA 5F2VO 4NLKA 1UT5A 3T5LA 1JQRA 4O3SA 4NLZA 5KTQA 3PO4A 2ZH5A 1WCNA 1ZYQA 4P4MA 4EP7A 1D8YA 1HUZA 3GQCA 2I9GA 4JV1A 8ICMA 1U4BA 1L3VA 4JK1A 3ISDA 1TFRA 5DQHA 4RU9A 3PX4A 2FMPA 4MFAA 2BDPA 1CEZA 8ICOA 5D46A 3H39A 4F93B 4KN4A 4NM1A 4X4NA 4RWQA 4I2BA 4R8UB 4DSFA 3SV3A 3RRHA 4KLIA 3RJIA 8ICNA 3LQCB 3HIYA 3GIIA 1UA1A 4DEZA 1L3TA 4XUSA 8ICFA 4KTQA 5KFPA 3TARA 2C28A 4NKUA 5KFRA 4M04A 2R8IA 3C5GA 4KLSA 4F4WA 3BQTA 4ED1A 3LWMA 1X9WA 2BCSA 1ZQZA 4F3OA 3RB3A 1K1SA 5KFLA 2M2WA 3C66A 4IR1A 2ISPA 3Q8SB 2I1QA 2DFLA 3MR3A 2ATLA 2KP7A 4WC3A 5KFZA 5L1JA 3MR5A 4EZ9A 4KLMA 4B9LA 1X9MA 4I29A 4QWCA 5KFUA 5EWEA 5JUMA 3BQ2A 4DSLA 4FHVA 4YR3A 5J2GA 5KFKA 5CHGA 5J0TA 2FPLA 4NLNA 4WC5A 1QSLA 3GIKA 2FLPA 4E7XA 5HRGA 2KTQA 2HVIA 2IA6A 2HHPA 4FS1A 5J2BA 3EPGA 5DDYA 4TUQA 4ECWA 2XY6A 4X5VA 2OWOA 1ZQGA 4KLOA 3OV7A 4PGQA 3BDPA 4M6WA 3LWLA 5L1KA 3WFQE 4E8FA 4UB1A 1U47A 4FS2A 3KHGA 4F5OA 4DF8A 3THVA 4IRDA 3HW8A 4EBEA 3T5KA 3TAQA 4ED7A 5DB9A 2BGWA 4EBKA 4YR2A 4ECYA 4X4QA 3MR2A 2BPCA 5KFWA 5KG2A 1NKCA 1LV5A 4M2YA 3TFRA 1KRPA 1NOMA 4O5CA 2BR0A 4GC7A 3TQ1A 4MEYA 1QTMA 1YLQA 3M8SA 3EWAA 4YMOA 9ICMA 8ICWA 2C22A 4C8LA 3M8RA 4IQUA 4NY8A 4QZBA 4F50A 3G6YA 4I2JA 2ASJA 9ICCA 4Z6EA 3PW2A 3RJJA 4M9GA 4WBZA 4BDPA 4RQ3A 1BPBA 1H38A 2KFZA 3H37A 4X4RA 4X4SA 4UBBA 4RZRA 1BPEA 3E2EA 7ICVA 4YR0A 4UQGA 4DS4A 1KFSA 4I2IA 3C2LA 4BXOA 4JWMA 5HRLA 2DR8A 2ID1A 2DR9A 1XWLA 4WBYA 5KFCA 2Q0ZX 9ICPA 3ZDEA 2UVUA 2PXIA 1COOA 3QEAZ 3OHBA 3C2KA 5KFIA 9ICWA 4M5DA 5KFBA 1ZQNA 1NK4A 1TK0A 5J0UA 3NGDA 3AU2A 1S97A 1D9FA 3OJSA 1UT8A 4DLGA 3Q8KA 1D9DA 4UB3A 3RJEA 3EYZA 3UXNA 3PR4A 1NZPA 2R8KA 4DFPA 1RYSA 2BE3A 7ICHA 3SZ2A 1ZQRA 3KHLA 4KLEA 3OSNA 2B21A 3PMLA 4EYIB 4QWBA 4DL5A 4FHWA 4R64A 1S0MA 4M9HA 2ZH6A 1Z00B 2BPFA 4Z6CA 2V4QA 2FLLA 2HHWA 4RNOA 1WOTA 5IILA 4UD5A 4DOAA 1IM4A 3ZDAA 4YG2A 5DKWA 1DGSA 5J2AA 4B9TA 1VFGA 4RT3A 4J9MA 3QEBZ 2M2VA 5HRKA 3OVBA 4X4VA 2ZUBA 2NRZA 4MF8A 5IIMA 4F92B 4PHPA 2NRVA 5KT6A 4YP3A 2ZJ5A 1EXNA 7ICUA 3TFSA 4F5QA 4C8MA 3Q8MA 1S0OA 1ZQCA 1TAQA 2UVWA 4WC2A 1V9PA 4R63A 2RFFA 3SYZA 4DFKA 1QSYA 3RR8A 4GC6A 2FMQA 2DPIA 3ZDDA 2NRTA 4DQPA 1U48A 4O9MA 7ICEA 1JMSA 4GXJA 3UQ0A 4DS5A 2IMWP 1KNYA 3OUYA 1ZETA 4M9JA 5KFNA 3B0YA 4QZEA 4YD2A 3H8JA 2XC9A 5J0PA 4JUZA 4QZAA 3M9OB 5DLFA 5HHHA 1ZJMA 1NK8A 4QWDA 4Q8EA 4X0BA 3PY8A 2MUTB 3NTUA 2W8LA 2BQUA 4DQSA 4I28A 1MSWD 1RZTA 1NK6A 3M9NB 4G3IA 1MC8A 9ICGA 4YXMA 4DOBA 1IXRA 4B9MA 5KT4A 1TKDA 5KG1A 4LZDA 4KN7A 1ZQQA 1QLNA 5CWRA 3H40A 1U49A 5KFMA 3IHQB 3LDAA 3FDSA 4I2DA 4QWEA 1T4GA 3PW0A 1S0VA 5DB7A 2XGPA 9ICJA 4LZGA 8ICVA 2C2DA 2ZJAA 2NRXA 4DSIA 3L9DA 3ETLA 4EZ6A 5DGBA 2DVIA 1KSPA 1Z3EB 4S3NA 1ZQMA 2IBKA 4RWPA 4RPYA 4ED6A 3MDCA 5HRBA 1ZQLA 4J9SA 1SL0A 4B9UA 4DFMA 1TAUA 2WTFA 1MQ2A 4IQTA 3PW7A 5KFDA 1ZQIA 1ZQOA 5J2EA 1KFTA 4AT8A 1CUKA 1TVAA 3PO5A 2ZH2A 3TAPA 4DL4A 4ZH4A 7ICOA 4PHAA 2XY5A 1BNPA 1A77A 1B43A 2W9CB 2HVHA 5BOLA 3T3FA 1S0NA 2R8JA 3JPNA 2H5XA 3V6HA 4ATBB 1OU5A 1NJZA 1WCLA 5EWFA 3V6KA 2AGOA 4B9SA 1JAJA 4BGDA 1N48A 2PI4A 4EEYA 5J0QA 5J2CA 3T5JA 3PX6A 4F5NA 4F4YA 3B0XA 4DLEA 5DQGA 3RBEA 1RYRA 2J6SA 1UEVA 2ASDA 4EBJA 3IM1A 4YQWA 1S10A 5KFGA 5J0YA 1Z00A 3RTVA 1MIWA 5DEDA 3UPSA 4UAWA 2ZHAA 2DR5A 4KLFA 3V7LA 3GV7B 5CJ7A 2JZBB 5L1LA 5IIKA 4RPZA 1NJXA 4BWMA 4RQ5A 4NKTA 3PV8A 4I2AA 4KLDA 4E0DA 2ZTCA 5KFAA 4RNMA 1U45A 2BKEA 4UB5A 4QW9A 3RBDA 4TUSA 2BCRA 4PGXA 4IG8A 1RPLA 2HHUA 3LK9A 2O5AA 2XCPA 5BPCA 1ZQXA 4KLJA 4KITB 3SI8A 3HWTA 4M9NA 4P4OA 5IIJA 4ECQA 1SKRA 1L3UA 4JV2A 1NK0A 1A76A 5HRHA 4YVZA 1NK5A 4DSJA 1MIYA 3C1ZA 5EOZA 3H4DA 2P6RA 2ASLA 9ICBA 7ICLA 2RDIA 5KT2A 2J6TA 4FBUA 2W8KA 3UQ2A 4R8UA 1SL2A 4K4HA 5KT5A 1ZQTA 2P66A 5KFYA 8ICRA 4QZ9A 8ICPA 4FH5A 1XSNA 4EYHB 2M9NA 4DQQA 1R8AA 4UD4A 7ICJA 1SKWA 3Q8QB 9ICKA 5KFQA 5IIIA 8ICLA 4R65A 4ECSA 4ECVA 1PZNA 1QSSA 2PFQA 4FBTA 2IHMA 3HJ1A 5HHIA 2Y1IA 1MQ3A 9ICFA 3BJYA 2C2EA 5L1IA 2MAXA 4O3OA 4RQ6A 4QZGA 4GXKA 2ZJ8A 4KLUA 8ICHA 9ICIA 5D4BA 1XO1A 3HP6A 8ICZA 4F2RA 2VA2A 4UAYA 2O1PA 2VANA 4RPXA 4IR9A 4DO9A 3QE9Y 8ICEA 3K4GA 3C18A 7ICSA 1Q79A 4RT2A 9ICTA 4Q43A 4WC6A 9ICHA 1JX4A 4LVSA 5J29A 8ICCA 3RJFA 4O3PA 3JPQA 3C5FA 4BXOB 3ORYA 2XGQA 2HHSA 1JN3A 4I27A 4DL7A 9ICRA 8ICXA 5F9NA 3PR5B 4M0AA 3Q8PB 4DQRA 2HW3A 4QZCA 3MR6A 2NRWA 5KFVA 7ICKA 5DG9A 9ICSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BPD A;  4ECU A;  1LB2 B;  2BQ3 A;  1K1Q A;  4LT6 A;  3GV5 B;  4X4P A;  5CB1 A;  3AQK A;  3FYH A;  1XSL A;  3UPQ A;  4WCW A;  2LYH A;  2KN7 A;  5DBC A;  5J2K A;  4QW8 A;  3QZ7 A;  2XO7 A;  2W9B B;  4TQR A;  3V6J A;  4DL2 A;  5KG0 A;  5KT7 A;  2M2U A;  5HRE A;  2V9W A;  4YN4 A;  5J0O A;  8ICJ A;  3KHH A;  5HML A;  4B9V A;  3HPO A;  3T5H A;  4TUR A;  2PFO A;  4UAZ A;  3H8S A;  4M9L A;  4I2G A;  2HHV A;  3KTQ A;  1JXE A;  8ICI A;  1UEU A;  2MUT A;  4PHD A;  4F4X A;  3Q8L A;  3RB6 A;  1D8L A;  1ZQV A;  3V72 A;  3Q8R B;  5KFT A;  3JZ0 A;  4XRH A;  4J9K A;  4XQ8 A;  4DL3 A;  5CR0 A;  1KDH A;  5HNK A;  3GIJ A;  2XY7 A;  1T7P A;  5KG5 A;  3PW5 A;  4J9L A;  5HP4 A;  3TAN A;  4F91 B;  3N97 B;  2JEJ A;  3RJH A;  3C1Y A;  5HRF A;  7ICF A;  3WFO A;  4J9P A;  2XCA A;  1JXL A;  2JEF A;  2Q66 A;  4QWA A;  5DQI A;  4ED0 A;  1R8C A;  4AT7 B;  4TQS A;  5C5J A;  4HYK A;  4JWN A;  4P2H A;  1ZQW A;  9ICV A;  5HRI A;  4KLG A;  1XS9 D;  2PFN A;  7ICG A;  4RWN A;  3MDA A;  4MFF A;  4IRK A;  5KFF A;  3K75 D;  2PFP A;  4PGY A;  4PH5 A;  5J2F A;  3JPR A;  2ZH8 A;  1ZQP A;  2DRB A;  5J2J A;  3RH6 A;  2ZH7 A;  4KLQ A;  5L9X A;  1TK8 A;  3JPO A;  3H4B A;  4J9Q A;  5KFX A;  5DBA A;  2AU0 A;  7ICM A;  3WFR E;  2IHN A;  9ICN A;  3H3A A;  1XU4 A;  4DSE A;  3EW9 A;  3RB4 A;  3PW4 A;  9ICQ A;  2BPG A;  4J9R A;  4DSK A;  5HRD A;  3HT3 A;  4CCH A;  4QZD A;  3AQN A;  3TI0 A;  2A1J B;  1TV9 A;  4J9N A;  5DDM A;  4YMN A;  1XSP A;  4RUA A;  2AGQ A;  9ICA A;  5DBB A;  4WC4 A;  3ZDC A;  2KZZ A;  1ZQA A;  1C7Y A;  4IRC A;  1UA0 A;  1SZP A;  3BQ0 A;  4MF2 A;  2W9M A;  4YCX A;  4FHP A;  2ZH4 A;  4K4I A;  3OVS A;  4ECR A;  3HJ4 A;  5J0S A;  2BCV A;  2ZH1 A;  1TFY A;  4Q8F A;  4YMM A;  2AJQ A;  1F5A A;  4C8K A;  4RUC A;  3UXO A;  4JV0 A;  4TUP A;  1Q78 A;  4YD1 A;  3MGI A;  1T8E A;  1ZQD A;  4FHX A;  9ICE A;  3MAB A;  4KLH A;  4BWJ A;  1DK2 A;  1ZQU A;  3C23 A;  5D49 A;  3JPP A;  4M47 A;  3H7I A;  4O5E A;  2FLN A;  4K4G A;  4NXZ A;  1DK3 A;  3AU6 A;  3H8W A;  5DG7 A;  1HJP A;  3KHR A;  4MFC A;  1NO5 A;  2J6U A;  2BHN A;  1ZQB A;  5J0W A;  3AQM A;  3GIM A;  1BVS A;  4FO6 A;  1ZQF A;  7ICQ A;  7ICN A;  4O5K A;  5DG8 A;  5J2D A;  4ED8 A;  1S9F A;  3WFP A;  4RQ2 A;  4X4O A;  4DWI A;  1JIH A;  1FA0 A;  1U9L A;  4DFJ A;  2ZH3 A;  5KFS A;  3MBY A;  1HUO A;  2C2R A;  1BNO A;  5J0X A;  3AQL A;  2BCQ A;  2KZ3 A;  1PX5 A;  1DOQ A;  5CA7 A;  2ZUD A;  1Y88 A;  2R8H A;  3C2M A;  1L3S A;  9ICO A;  1MIV A;  1TFW A;  4NM2 A;  3V7J A;  1RXV A;  5DGA A;  3WFS C;  4NLG A;  2ZUC A;  3JYY A;  2ZTD A;  5KFO A;  2V4R A;  5DB6 A;  2W9B A;  1SL1 A;  3GFK B;  3RR7 A;  1S76 D;  4AT7 A;  2UVV A;  2Y1J A;  3MFH A;  5KFE A;  3MFI A;  5KFH A;  1KLN A;  2KFN A;  5BOM A;  4F4K A;  5DEC A;  3RH4 A;  2ZH9 A;  3RAX A;  4ATB A;  4M6W B;  5KG3 A;  4RQ4 A;  4FH3 A;  3RJG A;  1KFD A;  3RAQ A;  1ARO P;  2DPJ A;  5KG6 A;  4ELV A;  2PI5 A;  2HHQ A;  4O3Q A;  7ICR A;  4RQ7 A;  3G6V A;  1V4A A;  1ZQE A;  1ZQK A;  3H38 A;  4XA5 A;  4F5P A;  4QZI A;  3QZ8 A;  3ISC A;  1R89 A;  4YFK A;  3ZD9 A;  5CP2 A;  4E80 A;  1X9S A;  4DQI A;  9ICX A;  2JEG A;  2JZB A;  2VA8 A;  2BCU A;  8ICA A;  4ELT A;  4DL6 A;  3RH5 A;  4R66 A;  4Z6F A;  1NK9 A;  2R8G A;  4F4Z A;  7ICI A;  5DLG A;  5KG4 A;  4MEX A;  3GDX A;  1NKB A;  8ICY A;  3M9M B;  1NJY A;  4WC7 A;  4WC0 A;  7ICT A;  3UXP A;  3PNC A;  4ED2 A;  1RXW A;  4ECX A;  4IQW A;  2DRA A;  5KT3 A;  7ICP A;  1ZQH A;  8ICB A;  2KZM A;  8ICQ A;  5KFJ A;  4X4T A;  1X2I A;  4I2F A;  5KG7 A;  3SV4 A;  3OUY B;  1UET A;  1T3N A;  4PPX A;  4GLX A;  1BPY A;  4KLT A;  4C8N A;  5HR9 A;  4FHY A;  4QZH A;  4ECT A;  2HHX A;  1L5U A;  3RB0 A;  3C21 A;  3JPS A;  4J9O A;  4F8R A;  2UVR A;  1S77 D;  2AQ0 A;  3NYB A;  3G6X A;  1SKS A;  1BGX T;  4RQ8 A;  1KEJ A;  4UB4 A;  3GIL A;  2HHT A;  5J2H A;  1NK7 A;  8ICS A;  9ICU A;  1R8B A;  2W9C A;  4X0A A;  2F1J A;  1B22 A;  4ECZ A;  1N56 A;  4YXJ A;  2F1H A;  1TK5 A;  3HX0 A;  4XQ7 A;  3ISB A;  9ICL A;  4I2C A;  5IIO A;  4EBD A;  3OSP A;  2ISO A;  2W9A A;  2BQR A;  2GWS A;  3RJK A;  4KLL A;  1BPZ A;  4Q45 A;  4QZ8 A;  2F1I A;  4UB2 A;  4ED3 A;  4RNN A;  8ICU A;  4DF4 A;  5HMM A;  4P4P A;  1NJW A;  3JPT A;  3PVX A;  2A1J A;  8ICT A;  2PBE A;  4AT8 B;  2ZTE A;  4RQ1 A;  5J0R A;  3GV8 B;  3OGU A;  5J2I A;  4GXI A;  1NKE A;  1VJ7 A;  4I2H A;  4AT9 A;  5HC9 A;  3BQ1 A;  1ZQY A;  4B9N A;  2NRK A;  3AUO A;  3EZ5 A;  4ELU A;  2JEI A;  2DR7 A;  4UBC A;  3EPI A;  4Z6D A;  3V7K A;  4PHE A;  2AGP A;  2ZHB A;  3PX0 A;  1XC9 A;  3MGH A;  1KTQ A;  5DB8 A;  4IQV A;  3ZDB A;  3N4M B;  4X4U A;  8ICG A;  5F9L A;  2FPM A;  4AT9 B;  4F2S A;  1BPX A;  2ALZ A;  8ICK A;  2RDJ A;  3PMN A;  3RRG A;  5IIN A;  2FMS A;  4I2E A;  4RWO A;  2P6U A;  4QZF A;  3OJU A;  1ZJN A;  2AQ4 A;  4Q44 A;  2VA3 A;  2FPK A;  4KMU A;  4O3R A;  3ZD8 A;  4DOC A;  3OHA A;  5TZV A;  4RQ0 A;  3OVA A;  4O3N A;  4F5R A;  1ZQJ A;  4WC1 A;  4EBC A;  4C8O A;  4O0I A;  5EWG A;  1ZQS A;  2M2T A;  5F2V O;  4NLK A;  1UT5 A;  3T5L A;  1JQR A;  4O3S A;  4NLZ A;  5KTQ A;  3PO4 A;  2ZH5 A;  1WCN A;  1ZYQ A;  4P4M A;  4EP7 A;  1D8Y A;  1HUZ A;  3GQC A;  2I9G A;  4JV1 A;  8ICM A;  1U4B A;  1L3V A;  4JK1 A;  3ISD A;  1TFR A;  5DQH A;  4RU9 A;  3PX4 A;  2FMP A;  4MFA A;  2BDP A;  1CEZ A;  8ICO A;  5D46 A;  3H39 A;  4F93 B;  4KN4 A;  4NM1 A;  4X4N A;  4RWQ A;  4I2B A;  4R8U B;  4DSF A;  3SV3 A;  3RRH A;  4KLI A;  3RJI A;  8ICN A;  3LQC B;  3HIY A;  3GII A;  1UA1 A;  4DEZ A;  1L3T A;  4XUS A;  8ICF A;  4KTQ A;  5KFP A;  3TAR A;  2C28 A;  4NKU A;  5KFR A;  4M04 A;  2R8I A;  3C5G A;  4KLS A;  4F4W A;  3BQT A;  4ED1 A;  3LWM A;  1X9W A;  2BCS A;  1ZQZ A;  4F3O A;  3RB3 A;  1K1S A;  5KFL A;  2M2W A;  3C66 A;  4IR1 A;  2ISP A;  3Q8S B;  2I1Q A;  2DFL A;  3MR3 A;  2ATL A;  2KP7 A;  4WC3 A;  5KFZ A;  5L1J A;  3MR5 A;  4EZ9 A;  4KLM A;  4B9L A;  1X9M A;  4I29 A;  4QWC A;  5KFU A;  5EWE A;  5JUM A;  3BQ2 A;  4DSL A;  4FHV A;  4YR3 A;  5J2G A;  5KFK A;  5CHG A;  5J0T A;  2FPL A;  4NLN A;  4WC5 A;  1QSL A;  3GIK A;  2FLP A;  4E7X A;  5HRG A;  2KTQ A;  2HVI A;  2IA6 A;  2HHP A;  4FS1 A;  5J2B A;  3EPG A;  5DDY A;  4TUQ A;  4ECW A;  2XY6 A;  4X5V A;  2OWO A;  1ZQG A;  4KLO A;  3OV7 A;  4PGQ A;  3BDP A;  4M6W A;  3LWL A;  5L1K A;  3WFQ E;  4E8F A;  4UB1 A;  1U47 A;  4FS2 A;  3KHG A;  4F5O A;  4DF8 A;  3THV A;  4IRD A;  3HW8 A;  4EBE A;  3T5K A;  3TAQ A;  4ED7 A;  5DB9 A;  2BGW A;  4EBK A;  4YR2 A;  4ECY A;  4X4Q A;  3MR2 A;  2BPC A;  5KFW A;  5KG2 A;  1NKC A;  1LV5 A;  4M2Y A;  3TFR A;  1KRP A;  1NOM A;  4O5C A;  2BR0 A;  4GC7 A;  3TQ1 A;  4MEY A;  1QTM A;  1YLQ A;  3M8S A;  3EWA A;  4YMO A;  9ICM A;  8ICW A;  2C22 A;  4C8L A;  3M8R A;  4IQU A;  4NY8 A;  4QZB A;  4F50 A;  3G6Y A;  4I2J A;  2ASJ A;  9ICC A;  4Z6E A;  3PW2 A;  3RJJ A;  4M9G A;  4WBZ A;  4BDP A;  4RQ3 A;  1BPB A;  1H38 A;  2KFZ A;  3H37 A;  4X4R A;  4X4S A;  4UBB A;  4RZR A;  1BPE A;  3E2E A;  7ICV A;  4YR0 A;  4UQG A;  4DS4 A;  1KFS A;  4I2I A;  3C2L A;  4BXO A;  4JWM A;  5HRL A;  2DR8 A;  2ID1 A;  2DR9 A;  1XWL A;  4WBY A;  5KFC A;  2Q0Z X;  9ICP A;  3ZDE A;  2UVU A;  2PXI A;  1COO A;  3QEA Z;  3OHB A;  3C2K A;  5KFI A;  9ICW A;  4M5D A;  5KFB A;  1ZQN A;  1NK4 A;  1TK0 A;  5J0U A;  3NGD A;  3AU2 A;  1S97 A;  1D9F A;  3OJS A;  1UT8 A;  4DLG A;  3Q8K A;  1D9D A;  4UB3 A;  3RJE A;  3EYZ A;  3UXN A;  3PR4 A;  1NZP A;  2R8K A;  4DFP A;  1RYS A;  2BE3 A;  7ICH A;  3SZ2 A;  1ZQR A;  3KHL A;  4KLE A;  3OSN A;  2B21 A;  3PML A;  4EYI B;  4QWB A;  4DL5 A;  4FHW A;  4R64 A;  1S0M A;  4M9H A;  2ZH6 A;  1Z00 B;  2BPF A;  4Z6C A;  2V4Q A;  2FLL A;  2HHW A;  4RNO A;  1WOT A;  5IIL A;  4UD5 A;  4DOA A;  1IM4 A;  3ZDA A;  4YG2 A;  5DKW A;  1DGS A;  5J2A A;  4B9T A;  1VFG A;  4RT3 A;  4J9M A;  3QEB Z;  2M2V A;  5HRK A;  3OVB A;  4X4V A;  2ZUB A;  2NRZ A;  4MF8 A;  5IIM A;  4F92 B;  4PHP A;  2NRV A;  5KT6 A;  4YP3 A;  2ZJ5 A;  1EXN A;  7ICU A;  3TFS A;  4F5Q A;  4C8M A;  3Q8M A;  1S0O A;  1ZQC A;  1TAQ A;  2UVW A;  4WC2 A;  1V9P A;  4R63 A;  2RFF A;  3SYZ A;  4DFK A;  1QSY A;  3RR8 A;  4GC6 A;  2FMQ A;  2DPI A;  3ZDD A;  2NRT A;  4DQP A;  1U48 A;  4O9M A;  7ICE A;  1JMS A;  4GXJ A;  3UQ0 A;  4DS5 A;  2IMW P;  1KNY A;  3OUY A;  1ZET A;  4M9J A;  5KFN A;  3B0Y A;  4QZE A;  4YD2 A;  3H8J A;  2XC9 A;  5J0P A;  4JUZ A;  4QZA A;  3M9O B;  5DLF A;  5HHH A;  1ZJM A;  1NK8 A;  4QWD A;  4Q8E A;  4X0B A;  3PY8 A;  2MUT B;  3NTU A;  2W8L A;  2BQU A;  4DQS A;  4I28 A;  1MSW D;  1RZT A;  1NK6 A;  3M9N B;  4G3I A;  1MC8 A;  9ICG A;  4YXM A;  4DOB A;  1IXR A;  4B9M A;  5KT4 A;  1TKD A;  5KG1 A;  4LZD A;  4KN7 A;  1ZQQ A;  1QLN A;  5CWR A;  3H40 A;  1U49 A;  5KFM A;  3IHQ B;  3LDA A;  3FDS A;  4I2D A;  4QWE A;  1T4G A;  3PW0 A;  1S0V A;  5DB7 A;  2XGP A;  9ICJ A;  4LZG A;  8ICV A;  2C2D A;  2ZJA A;  2NRX A;  4DSI A;  3L9D A;  3ETL A;  4EZ6 A;  5DGB A;  2DVI A;  1KSP A;  1Z3E B;  4S3N A;  1ZQM A;  2IBK A;  4RWP A;  4RPY A;  4ED6 A;  3MDC A;  5HRB A;  1ZQL A;  4J9S A;  1SL0 A;  4B9U A;  4DFM A;  1TAU A;  2WTF A;  1MQ2 A;  4IQT A;  3PW7 A;  5KFD A;  1ZQI A;  1ZQO A;  5J2E A;  1KFT A;  4AT8 A;  1CUK A;  1TVA A;  3PO5 A;  2ZH2 A;  3TAP A;  4DL4 A;  4ZH4 A;  7ICO A;  4PHA A;  2XY5 A;  1BNP A;  1A77 A;  1B43 A;  2W9C B;  2HVH A;  5BOL A;  3T3F A;  1S0N A;  2R8J A;  3JPN A;  2H5X A;  3V6H A;  4ATB B;  1OU5 A;  1NJZ A;  1WCL A;  5EWF A;  3V6K A;  2AGO A;  4B9S A;  1JAJ A;  4BGD A;  1N48 A;  2PI4 A;  4EEY A;  5J0Q A;  5J2C A;  3T5J A;  3PX6 A;  4F5N A;  4F4Y A;  3B0X A;  4DLE A;  5DQG A;  3RBE A;  1RYR A;  2J6S A;  1UEV A;  2ASD A;  4EBJ A;  3IM1 A;  4YQW A;  1S10 A;  5KFG A;  5J0Y A;  1Z00 A;  3RTV A;  1MIW A;  5DED A;  3UPS A;  4UAW A;  2ZHA A;  2DR5 A;  4KLF A;  3V7L A;  3GV7 B;  5CJ7 A;  2JZB B;  5L1L A;  5IIK A;  4RPZ A;  1NJX A;  4BWM A;  4RQ5 A;  4NKT A;  3PV8 A;  4I2A A;  4KLD A;  4E0D A;  2ZTC A;  5KFA A;  4RNM A;  1U45 A;  2BKE A;  4UB5 A;  4QW9 A;  3RBD A;  4TUS A;  2BCR A;  4PGX A;  4IG8 A;  1RPL A;  2HHU A;  3LK9 A;  2O5A A;  2XCP A;  5BPC A;  1ZQX A;  4KLJ A;  4KIT B;  3SI8 A;  3HWT A;  4M9N A;  4P4O A;  5IIJ A;  4ECQ A;  1SKR A;  1L3U A;  4JV2 A;  1NK0 A;  1A76 A;  5HRH A;  4YVZ A;  1NK5 A;  4DSJ A;  1MIY A;  3C1Z A;  5EOZ A;  3H4D A;  2P6R A;  2ASL A;  9ICB A;  7ICL A;  2RDI A;  5KT2 A;  2J6T A;  4FBU A;  2W8K A;  3UQ2 A;  4R8U A;  1SL2 A;  4K4H A;  5KT5 A;  1ZQT A;  2P66 A;  5KFY A;  8ICR A;  4QZ9 A;  8ICP A;  4FH5 A;  1XSN A;  4EYH B;  2M9N A;  4DQQ A;  1R8A A;  4UD4 A;  7ICJ A;  1SKW A;  3Q8Q B;  9ICK A;  5KFQ A;  5III A;  8ICL A;  4R65 A;  4ECS A;  4ECV A;  1PZN A;  1QSS A;  2PFQ A;  4FBT A;  2IHM A;  3HJ1 A;  5HHI A;  2Y1I A;  1MQ3 A;  9ICF A;  3BJY A;  2C2E A;  5L1I A;  2MAX A;  4O3O A;  4RQ6 A;  4QZG A;  4GXK A;  2ZJ8 A;  4KLU A;  8ICH A;  9ICI A;  5D4B A;  1XO1 A;  3HP6 A;  8ICZ A;  4F2R A;  2VA2 A;  4UAY A;  2O1P A;  2VAN A;  4RPX A;  4IR9 A;  4DO9 A;  3QE9 Y;  8ICE A;  3K4G A;  3C18 A;  7ICS A;  1Q79 A;  4RT2 A;  9ICT A;  4Q43 A;  4WC6 A;  9ICH A;  1JX4 A;  4LVS A;  5J29 A;  8ICC A;  3RJF A;  4O3P A;  3JPQ A;  3C5F A;  4BXO B;  3ORY A;  2XGQ A;  2HHS A;  1JN3 A;  4I27 A;  4DL7 A;  9ICR A;  8ICX A;  5F9N A;  3PR5 B;  4M0A A;  3Q8P B;  4DQR A;  2HW3 A;  4QZC A;  3MR6 A;  2NRW A;  5KFV A;  7ICK A;  5DG9 A;  9ICS A; 
#chains in the Genus database with same CATH topology
 4LT6 A;  3BS5 A;  5CB1 A;  1XSL A;  1VDV A;  5DBC A;  5J2K A;  2W9B B;  4TQR A;  3V6J A;  5KG0 A;  5J0O A;  4OO1 J;  4UAU A;  3HPO A;  3T5H A;  4M9L A;  4UAZ A;  4I2G A;  2HHV A;  3WKE A;  3DDH A;  3IV6 A;  2W04 A;  4PHD A;  1L7P A;  3V72 A;  3Q8R B;  4XRH A;  2XY7 A;  5HP4 A;  4F91 B;  5ALT A;  3NVW A;  3ALR A;  3HKZ C;  5C5J A;  3K7D A;  4HYK A;  2VJ4 A;  2PFN A;  2GOL A;  2YMM A;  4IRK A;  2ES6 A;  5KFF A;  4CF5 A;  4PH5 A;  5J2F A;  2Z7J A;  3JPR A;  5J2J A;  2ODG A;  2KEY A;  9ICN A;  3H3A A;  1XU4 A;  3EW9 A;  1MN8 A;  4RUA A;  5DBB A;  1C7Y A;  3WK8 A;  4MF2 A;  2QLT A;  3AQF A;  4K4I A;  3HJ4 A;  3QUB A;  1TFY A;  4C8K A;  1Q78 A;  2A19 A;  1ZQU A;  3H7I A;  2FLN A;  3M7D A;  4NXZ A;  3AU6 A;  2WF8 A;  5DG7 A;  1HJP A;  5J8Y C;  2BHN A;  3AQM A;  3GIM A;  2FCL A;  3SAF A;  4FO6 A;  7ICQ A;  7ICN A;  4O5K A;  1ZD2 P;  1HIW A;  2ZH3 A;  2RQ5 A;  2LYA A;  5CA7 A;  3C2M A;  2KSO A;  3VC8 A;  4NM2 A;  3V7J A;  1RXV A;  4XJE A;  3LVV A;  3JYY A;  2V4R A;  5DB6 A;  2JV3 A;  2HOI A;  2KFN A;  1KLN A;  4FZL A;  3ETR A;  5KG3 A;  1JRO A;  3RJG A;  2DPJ A;  5KG6 A;  4N7R A;  2HHQ A;  1V4A A;  1ZQK A;  3H38 A;  4XA5 A;  3BS5 B;  1R89 A;  4WQL A;  9ICX A;  5ALZ A;  5ALU A;  4ELT A;  5JTI A;  1NK9 A;  4OAI Z;  1ZD5 A;  5DLG A;  5KG4 A;  4MEX A;  8ICY A;  3SR6 A;  5AK3 A;  1NJY A;  4WC7 A;  3SD7 A;  4ED2 A;  2H3I A;  3QYP A;  4ECX A;  1PK3 A;  2HOF A;  2DBY A;  2KZM A;  5T14 A;  4PPX A;  4KLT A;  5ALV A;  3RB0 A;  3BS7 A;  2KK0 A;  4A8E A;  5AIB A;  2UVR A;  2AQ0 A;  2DQN B;  3AQE A;  3NYB A;  3G6X A;  3GIL A;  4C4T A;  5J2H A;  1NK7 A;  4X0A A;  4LEY A;  1B22 A;  4ECZ A;  2E3T A;  4F72 A;  2QB0 A;  3ISB A;  4I2C A;  5IIO A;  2ISO A;  4WQK A;  2BQR A;  4QZ8 A;  5AKX A;  4RNN A;  4DF4 A;  5HMM A;  2GH1 A;  1K5O A;  2ZTE A;  1VJ7 A;  3BQ1 A;  1ZQY A;  3AUO A;  3V7K A;  3PX0 A;  1KTQ A;  1LKY A;  2PMZ F;  2Y0S F;  1MA7 A;  1BPX A;  2ALZ A;  4BJQ A;  2RDJ A;  1Z1B A;  1B0X A;  4QZF A;  1JUD A;  3OJU A;  2GLE A;  3OHA A;  1ZQJ A;  2O6K A;  3NRW A;  3T5L A;  3NKU A;  2Y0S C;  3PO4 A;  4GFJ A;  2ZH5 A;  1WCN A;  4P4M A;  4EP7 A;  7ICP A;  1HUZ A;  2I9G A;  5EE3 A;  4MFF A;  1SXE A;  5F2V O;  5DQH A;  4MFA A;  2A1A A;  5D46 A;  4F93 B;  4KN4 A;  4EED A;  4JLZ A;  4KLI A;  1L3T A;  4XUS A;  8ICF A;  5KFP A;  3TAR A;  5KFR A;  4M04 A;  4F4W A;  1X9W A;  2BCS A;  3RB3 A;  4IR1 A;  2DFL A;  3MR3 A;  2ATL A;  3N7R C;  2IOF A;  4I29 A;  5KFU A;  5EWE A;  5JUM A;  4K99 A;  5KFK A;  4OJ5 A;  1ZRN A;  5J2B A;  5DDY A;  4TUQ A;  2XY6 A;  2OWO A;  5AKI A;  3WFQ E;  5ALI A;  4UB1 A;  3HW8 A;  3TAQ A;  1VLB A;  2G0A A;  4ECY A;  5KG2 A;  1LV5 A;  4M2Y A;  4GC7 A;  3TQ1 A;  1QTM A;  3EF2 A;  4YMO A;  5CHE A;  2VIX A;  3B9J A;  1X40 A;  4C4R A;  9ICC A;  1KKX A;  4Z6E A;  3PW2 A;  4WBZ A;  4BDP A;  1H38 A;  1BPB A;  4X4R A;  4X4S A;  1BPE A;  4P0P B;  7ICV A;  1XWL A;  1Z4O A;  3NVZ A;  2LHT A;  3D2S A;  2JH7 A;  1D9F A;  3H0L B;  5ALY A;  3Q8K A;  5KL8 B;  1NZP A;  4DFP A;  3KOO A;  4UB6 U;  3KHL A;  2B21 A;  3PML A;  4EYI B;  2D6F C;  2NO5 A;  5C0Y A;  1S0M A;  2KE7 A;  1SV0 A;  4Z6C A;  4UD5 A;  2KIW A;  3A0B U;  3BZC A;  3ZDA A;  4YG2 A;  1VFG A;  2RLT A;  4F71 A;  4JMU A;  4YP3 A;  3TFS A;  4F5Q A;  2UVW A;  2RFF A;  1IG6 A;  4DFK A;  3RR8 A;  4GC6 A;  2I6X A;  2GAF D;  4O9M A;  3OUY A;  4QZE A;  3M9O B;  2ISP A;  1ZJM A;  4QWD A;  3NTU A;  4DQS A;  1MSW D;  1RZT A;  1NK6 A;  4G3I A;  2G09 A;  1F44 A;  1QCK A;  2LPE A;  4LZD A;  2WF7 A;  1ZQQ A;  1QLN A;  3KFU F;  1ZQ1 C;  5CWR A;  3H40 A;  4NV0 A;  4QWE A;  5HRK A;  1X6I A;  1MIV A;  3T79 A;  2ZJA A;  4DSI A;  3SQI A;  5DGB A;  2DVI A;  2HCF A;  1SL0 A;  1PVP A;  2WTF A;  2DGZ A;  4U6P A;  3LYS A;  3TAP A;  1L8L A;  2R8J A;  1S0N A;  4ATB B;  2E5S A;  1SV0 C;  3JPN A;  1NJZ A;  4NL9 A;  1WCL A;  4B9S A;  3E58 A;  2QB0 B;  4BGD A;  2KIV A;  1RYR A;  3ERC C;  3B0X A;  5DQG A;  4EBJ A;  1S10 A;  4CF4 A;  1MIW A;  5KFG A;  2KKV A;  1N60 A;  1NJX A;  3L4P A;  2ZIV B;  4RQ5 A;  4NKT A;  3F2D A;  4HAI A;  2BKE A;  4QW9 A;  3DV9 A;  2BCR A;  4WJ3 B;  2K4H A;  4UAS A;  4KIT B;  1AQ6 A;  1WYG A;  4ECQ A;  1SKR A;  3C29 A;  2JHD A;  4YVZ A;  4DSJ A;  4WOY A;  1UQV A;  2RDI A;  1UPH A;  2W8K A;  1SL2 A;  5KAI U;  4Y2V A;  1XSN A;  4ECS A;  1PZN A;  3QU4 A;  3BJY A;  2C2E A;  1ECW A;  2HHP A;  3HP6 A;  2O1P A;  4F2R A;  4UAY A;  3QE9 Y;  2HSZ A;  3KZI U;  1JX4 A;  3C5F A;  3ORY A;  4DQR A;  2NRW A;  9ICS A;  1URJ A;  2BQ3 A;  1J2M A;  1GPJ A;  3UPQ A;  2KN7 A;  2M2U A;  4DL2 A;  2KD1 A;  5KT7 A;  4LJX A;  4YN4 A;  5EE9 A;  5KL1 B;  2KHV A;  5HML A;  5EE1 A;  2Y9U A;  4TUR A;  2PFO A;  1JXE A;  1UEU A;  4QIW F;  3Q8L A;  3RB6 A;  1L7M A;  1KDH A;  2ZIX B;  3GIJ A;  3PW5 A;  3RJH A;  4P0P A;  4J9P A;  2HN2 A;  3F2C A;  2Q66 A;  2CPR A;  4QWA A;  4ED0 A;  4FO1 A;  1R8C A;  4AT7 B;  4TQS A;  4EEB A;  4KLG A;  1XS9 D;  7ICG A;  3MDA A;  3WK9 A;  2W11 A;  2PFP A;  2YN4 A;  3RH6 A;  2ZH7 A;  1TK8 A;  4MHV A;  5AI6 A;  2BBJ A;  3M6Z A;  3H4B A;  7ICM A;  4DSE A;  4LEW A;  9ICQ A;  2HBL A;  4J9R A;  5HRD A;  1Z1V A;  3HT3 A;  4QZD A;  2EAN A;  4J9N A;  5ALF A;  1ZQA A;  4RQM A;  1UA0 A;  1SZP A;  2PMZ C;  1T3Q A;  1L7N A;  2E8N A;  2YX8 A;  2MSN A;  3OVS A;  4ECR A;  5J0S A;  2BCV A;  2B0C A;  3J81 j;  4YMM A;  1F5A A;  3UXO A;  4JV0 A;  3F5E A;  3MGI A;  1T8E A;  4FHX A;  4KLH A;  5HR7 A;  1DK2 A;  1CRX A;  4O5E A;  4PJ0 U;  4K4G A;  3H8W A;  1NO5 A;  2J6U A;  5J0W A;  1SZH A;  1SWV A;  1VJ5 A;  1ZQF A;  5JTG A;  3IG8 A;  4RQ2 A;  3L5K A;  1JIH A;  1FA0 A;  1U9L A;  4DFJ A;  5KFS A;  2C2R A;  2HN1 A;  4K8V A;  4RQN A;  5AI5 A;  2BCQ A;  5E79 U;  4CRX A;  1Z4N A;  1DOQ A;  1L3S A;  1Y88 A;  5CFU A;  2H3Z A;  1F0M A;  4NLG A;  2DF4 B;  3QUQ A;  1SL1 A;  2W9B A;  1S76 D;  2LKY A;  3RR7 A;  2Y1J A;  3MFH A;  3MFI A;  2FI1 A;  4ATB A;  4RQ4 A;  1KFD A;  4US8 A;  1ARO P;  2KKP A;  1ZQE A;  5GTI U;  4QZI A;  3QZ8 A;  4WH5 A;  3RFA A;  3SEI A;  5ALD A;  2JZB A;  2VA8 A;  4Y2R A;  8ICA A;  2YMP A;  4WC0 A;  2W43 A;  7ICT A;  3UXP A;  4IQW A;  5KT3 A;  8ICB A;  8ICQ A;  1X2I A;  4NL9 C;  5KG7 A;  3MC1 A;  4HX0 A;  1T3N A;  1COK A;  3H0R B;  4GLX A;  1BPY A;  2LMR A;  4PL2 A;  4ECT A;  1L5U A;  3JPS A;  3NWI A;  4F8R A;  1S77 D;  5AM1 A;  1SKS A;  4UB4 A;  5B3P A;  1KEJ A;  2HHT A;  1OUQ A;  1TK5 A;  3HX0 A;  3D2Q A;  4EBD A;  2W9A A;  1BPZ A;  4Q45 A;  2F1I A;  4UB2 A;  3PSI A;  8ICU A;  4P4P A;  1NJW A;  2KMD A;  2G06 A;  5J2I A;  4AT9 A;  2JEI A;  3GZF A;  4EX6 A;  4PHE A;  2JH1 A;  2AGP A;  1OXJ A;  5AKZ A;  3N4M B;  3CK6 A;  3QU7 A;  4X4U A;  2XIC A;  5F9L A;  2FPM A;  4F2S A;  4US9 A;  3N7S C;  2HMX A;  8ICK A;  3ER8 C;  3RRG A;  3AN1 A;  4I2E A;  1L8O A;  5ALQ A;  1ZJN A;  4Q44 A;  2FPK A;  4KMU A;  4F5R A;  4WC1 A;  2M2T A;  5EWG A;  1ZQS A;  4NLK A;  4O3S A;  4NLZ A;  3BZK A;  5KTQ A;  5K4L A;  4EEL A;  1ZYQ A;  8ICM A;  1TFR A;  2A3V A;  2FMP A;  1CEZ A;  8ICO A;  3RF9 A;  4I2B A;  1O08 A;  4DSF A;  3LQC B;  8ICN A;  3HIY A;  3GII A;  2K4I A;  4KTQ A;  3C5G A;  4ED1 A;  2NV3 A;  3LWM A;  2KJ5 A;  1ZQZ A;  4C4S A;  5J8Y A;  1K1S A;  2YMQ A;  3C66 A;  3F2B A;  4WC3 A;  4OJP A;  5L1J A;  4EZ9 A;  4KLM A;  4QWC A;  3ZI4 A;  5J2G A;  2W54 A;  3CW2 C;  3WKA A;  5CHG A;  5J0T A;  4NLN A;  3GIK A;  2W7P A;  1XO0 A;  3BQ7 A;  2IA6 A;  3E0F A;  1V85 A;  1ZQG A;  1FIQ A;  3OV7 A;  1LKY B;  1X42 A;  3THV A;  4KX5 A;  4EBK A;  3LVW A;  3QUT A;  3MR2 A;  4PZN A;  5KFW A;  5AI4 A;  1KRP A;  1NOM A;  3OPX A;  3EWA A;  9ICM A;  8ICW A;  2CN1 A;  4NLC A;  4NY8 A;  4OAH A;  3G6Y A;  4I2J A;  1SXD A;  2H3F A;  2OHF A;  3RJJ A;  4M9G A;  2KFZ A;  5CFS A;  4RZR A;  4JWM A;  4BXO A;  5HRL A;  2ID1 A;  5KFC A;  2Q0Z X;  2CRX A;  2UVU A;  2PXI A;  9ICW A;  2H3V A;  2HBJ A;  5KFB A;  1ZQN A;  1TK0 A;  3KKA C;  3AU2 A;  4KM5 A;  1S97 A;  1NNL A;  3OJS A;  4DLG A;  4UB3 A;  1RQL A;  3EYZ A;  3PR4 A;  1RYS A;  3SZ2 A;  5AI9 A;  4KLE A;  3OSN A;  3AM9 A;  3H8M A;  4R64 A;  1V38 A;  2V4Q A;  4RNO A;  5IIL A;  3I28 A;  4DOA A;  4O67 A;  1DGS A;  4J9M A;  3QEB Z;  3OVB A;  4X4V A;  2ZUB A;  4JB3 A;  4MF8 A;  4PHP A;  2NRV A;  4C0Z A;  2IHO A;  4C8M A;  2OCE A;  4R63 A;  3ZDD A;  2FMQ A;  7ICE A;  4OJL A;  1U48 A;  4O3M A;  1JMS A;  4DS5 A;  4EX7 A;  4EV6 A;  4M9J A;  3B0Y A;  4JLX A;  2XC9 A;  4RWN A;  1SB3 C;  2D3D A;  2MUT B;  2BQU A;  1MC8 A;  4YXM A;  1IXR A;  4Y2U A;  1TKD A;  5KG1 A;  2I5H A;  3IDW A;  2GA9 D;  5KFM A;  9ICJ A;  3PW0 A;  8ICV A;  3L9D A;  3ETL A;  2EH9 A;  4ED6 A;  1ZQL A;  4B9U A;  1MQ2 A;  3PW7 A;  3CNH A;  1PUZ A;  2LM4 A;  4ZH4 A;  5L1M A;  4K9A A;  3SMV A;  5ALJ A;  1A77 A;  5BOL A;  1ZOL A;  3QNM A;  1OU5 A;  3V6K A;  2AGO A;  5J2C A;  4C8O A;  4DLE A;  3H0M B;  5AI8 A;  2ASD A;  4FZN A;  4Y2Q A;  5DED A;  5J0Y A;  1Z00 A;  2ZHA A;  4UAW A;  3V7L A;  1N5W A;  2ZXI A;  5L1L A;  5IIK A;  4E0D A;  4NXW A;  3KBB A;  4RNM A;  1U45 A;  2YTU A;  2HHU A;  3LK9 A;  2O5A A;  1ZQX A;  3SI8 A;  5AIC A;  2ZIV A;  4OAG A;  1L3U A;  3NRZ A;  3I76 A;  9ICB A;  7ICL A;  2ASL A;  4Y2X A;  3PZP A;  5AKH A;  5KT2 A;  2J6T A;  4K4H A;  8ICP A;  1ZQT A;  5KFY A;  4EYH B;  1R8A A;  7ICJ A;  1SKW A;  4PZO A;  4ICA A;  4R65 A;  4ECV A;  1QSS A;  4K97 A;  4AYB F;  3AMZ A;  5HHI A;  2Y1I A;  1MQ3 A;  2FDR A;  2MAX A;  4RQ6 A;  9ICI A;  1R8B A;  3F5A A;  4Y2T A;  1XO1 A;  5D4B A;  3VCB A;  2ZH4 A;  2VAN A;  3K4G A;  3PHZ A;  7ICS A;  2K60 A;  3D2N A;  5J29 A;  4BXO B;  8ICX A;  5F9N A;  3PR5 B;  4OCZ A;  2HW3 A;  3HJE A;  2LI6 A;  3MR6 A;  7ICK A;  1K1Q A;  3GV5 B;  4KB6 A;  2EQY A;  2KOB A;  3FYH A;  4WCW A;  2LYH A;  1YZ7 A;  1S8O A;  3A0H U;  3NAS A;  4B9V A;  3N28 A;  1SIJ A;  3NVY A;  2B56 A;  3CYM A;  1SV4 A;  1ZQV A;  2QB1 A;  5KFT A;  4J9K A;  4DL3 A;  5CR0 A;  5HNK A;  5KG5 A;  3N97 B;  3TAN A;  7ICF A;  2KSO B;  2XCA A;  4C7Y A;  1JXL A;  2JEF A;  3MGV A;  3PSP A;  3K75 D;  2K4E A;  2G07 A;  3NVV A;  4USA A;  3JPO A;  3WFR E;  5DBA A;  2IHN A;  3PW4 A;  2BPG A;  2B51 A;  4DSK A;  4CCH A;  3TI0 A;  4LEV A;  2A1J B;  1TV9 A;  2MRL A;  9ICA A;  5DDM A;  1N2X A;  4IRC A;  5D63 A;  2W9M A;  4YCX A;  4FHP A;  2YB1 A;  4OD0 A;  4BUG A;  1WWU A;  4B6J A;  4YD1 A;  1ZQD A;  3WU2 U;  5AHX A;  3MAB A;  4BWJ A;  2ESE A;  3C23 A;  3WK4 A;  4MFC A;  1ZQB A;  2EZZ A;  4EEK A;  1ED1 A;  3PSF A;  3WFP A;  5J2D A;  5ALM A;  4G9B A;  4DWI A;  5AM4 A;  3KD3 A;  3MBY A;  1HUO A;  1BNO A;  3QU9 A;  2OM6 A;  3AQL A;  2KZ3 A;  2F8L A;  5DGA A;  2WF5 A;  2KVS A;  2ZUC A;  5KFO A;  1Q46 A;  2JMG A;  4AT7 A;  3GFK B;  5KFE A;  2CXY A;  5KFH A;  2HDO A;  2EAO A;  2ZH9 A;  1N63 A;  4FH3 A;  4K96 A;  1RQN A;  4ELV A;  2PI5 A;  7ICR A;  2FJ6 A;  3G6V A;  4F5P A;  4YFK A;  3ZD9 A;  5CP2 A;  4DQI A;  1DRG A;  2BCU A;  5AKY A;  4DL6 A;  7ICI A;  1NKB A;  4NXV A;  1RXW A;  2DRA A;  2BBH A;  2PKE A;  4I2F A;  3SV4 A;  2WAQ C;  2L5Y A;  4OAF A;  5HR9 A;  2AHO B;  5KAF U;  4QZH A;  3AL0 B;  2HHX A;  3N7P D;  3C21 A;  2IOH A;  4NWI A;  5F3X B;  2F2A B;  4RQ8 A;  5AM0 A;  3TKA A;  8ICS A;  2WHE A;  1N56 A;  2F1H A;  4XQ7 A;  3KZX A;  1Z19 A;  9ICL A;  3CP8 A;  4ED3 A;  3JPT A;  3UMC A;  2A1J A;  8ICT A;  4AT8 B;  4RQ1 A;  3GV8 B;  4GXI A;  3OGU A;  5HC9 A;  4B9N A;  2NRK A;  3EZ5 A;  1HEK A;  3HIL A;  3EPI A;  5G5H A;  4Z6D A;  2K8A A;  4C7Z A;  3TAC B;  3MGH A;  4IQV A;  4UAV A;  1UHU A;  4IL6 U;  1RYU A;  1CI4 A;  2G08 A;  2WFA A;  2AQ4 A;  4DOC A;  4O3N A;  4O0I A;  1JQR A;  1WG8 A;  2KHQ A;  1D8Y A;  3GQC A;  3WK6 A;  5AKL A;  4ZOH C;  4RU9 A;  3H39 A;  2JR5 A;  4X4N A;  1N5X A;  2IUB A;  3RRH A;  1QQ6 A;  3RJI A;  4K9B A;  1DGJ A;  2NYV A;  4P0Q B;  2R8I A;  4KLS A;  3I1Y A;  1A0P A;  4GIB A;  4F3O A;  5HR6 A;  5KFL A;  3Q8S B;  2I1Q A;  3MR5 A;  3IN5 A;  3WKB A;  1X9M A;  3DEE A;  3BQ2 A;  4FHV A;  4YR3 A;  2FPL A;  4WC5 A;  1L7O A;  2ZXH A;  3ICX A;  5HRG A;  1JAL A;  4ECW A;  1YZ6 A;  4KLO A;  1T94 A;  2FE9 A;  2BDU A;  4PGQ A;  1U47 A;  3KHG A;  4F5O A;  4IRD A;  4EBE A;  3T5K A;  4ED7 A;  4CDG A;  2EDU A;  4X4Q A;  1L6N A;  1NKC A;  1YLQ A;  4EGW A;  4MEY A;  2DWQ A;  1WUD A;  4F50 A;  4EEN A;  2ZIW B;  3H37 A;  4UBB A;  4YR0 A;  4UQG A;  4DS4 A;  4WBY A;  3ZDE A;  1COO A;  2OEH A;  5KFI A;  1NK4 A;  5ALG A;  3NGD A;  4O6A A;  1RM6 C;  2BE3 A;  7ICH A;  1X6J A;  1ZQR A;  4CNQ A;  1ZXI A;  4FHW A;  2ZH6 A;  1IM4 A;  1PK1 A;  5J2A A;  1P7D A;  3FAH A;  4UAR A;  3JCF A;  2NRZ A;  2ZIW A;  4F92 B;  5KT6 A;  2ZJ5 A;  1EXN A;  1DXS A;  3Q8M A;  4WC2 A;  1V9P A;  5KNI A;  4DQP A;  4GXJ A;  3UQ0 A;  2IMW P;  1QQ7 A;  3R9K A;  5KFN A;  4YD2 A;  3H8J A;  5DLF A;  4QZA A;  5HHH A;  4Q8E A;  3PY8 A;  4CE6 A;  9ICG A;  1D8B A;  1Q3U A;  5KT4 A;  3OWG A;  2RRD A;  4KN7 A;  2M0N A;  5A0L A;  4O69 A;  3IHQ B;  3O0F A;  4I2D A;  1S0V A;  1KW4 A;  5DB7 A;  3TAD A;  2XGP A;  4E80 A;  1PVQ A;  4EZ6 A;  3K1R B;  1Z3E B;  2IOF K;  2BZF A;  5H2F U;  3QU2 A;  4J9S A;  3WKC A;  4IS7 A;  4DFM A;  1X9X A;  1ZQI A;  5KFD A;  1ZQO A;  5J2E A;  2OH2 A;  4AT8 A;  1CUK A;  1TVA A;  3PO5 A;  2ZH2 A;  2DUY A;  7ICO A;  3SAH A;  4PHA A;  2XY5 A;  1BNP A;  2W9C B;  2W03 A;  3V6H A;  1JAJ A;  1FFU A;  2PI4 A;  4EEY A;  3AQN A;  3T5J A;  4F5N A;  2J6S A;  1UEV A;  2HBM A;  4YQW A;  3UPS A;  2DR5 A;  3RTV A;  2DKZ A;  2XI9 A;  3GV7 B;  1LVH A;  4LEZ A;  2VKQ A;  3PV8 A;  4I2A A;  2ZTC A;  1QQ5 A;  5KFA A;  2YML A;  1J2N A;  4O68 A;  1N62 A;  4PGX A;  4IG8 A;  2XCP A;  4QJF B;  5BPC A;  4KLJ A;  1V97 A;  3HWT A;  4P4O A;  3AEV A;  4JV2 A;  1A76 A;  5HRH A;  1MIY A;  5CEH A;  5EOZ A;  4E8F A;  4OJ6 A;  3UQ2 A;  4FH5 A;  2P66 A;  2KJ8 A;  1IIP A;  4NLB A;  3TAD C;  1F5S A;  4DQQ A;  5EE0 A;  3Q8Q B;  9ICK A;  5III A;  8ICL A;  2EZX A;  3HJ1 A;  4KX3 A;  9ICF A;  5L1I A;  4GXK A;  4KLU A;  2ZJ8 A;  2VA2 A;  2WB1 F;  4IR9 A;  4DO9 A;  1Q79 A;  4RT2 A;  2VJ5 A;  5ALE A;  3IRU A;  4WC6 A;  4LVS A;  3RJF A;  4O3P A;  2B4V A;  4U7C A;  3HKZ F;  4QZC A;  5AM2 A;  1ZRM A;  5KFV A;  1B4F A;  4E7X A;  2XID A;  1BPD A;  4ECU A;  1LB2 B;  2E8P A;  3M1Y A;  4X4P A;  3AQK A;  4QW8 A;  3QZ7 A;  2XO7 A;  2OYY A;  5HRE A;  5AI0 A;  2V9W A;  2ZIX A;  1A6S A;  3KHH A;  3S6J A;  3H8S A;  2YQE A;  3KTQ A;  8ICI A;  2MUT A;  2WAQ F;  4F4X A;  1QH9 A;  1D8L A;  4Y2S A;  3JZ0 A;  4XQ8 A;  5ALS A;  1RDF A;  1T7P A;  4J9L A;  4AYB C;  3UMB A;  2JEJ A;  3C1Y A;  2KIC A;  5HRF A;  1S5L U;  3MCR A;  3WFO A;  5DQI A;  3HRD D;  4JWN A;  4P2H A;  1ZQW A;  9ICV A;  5HRI A;  3QUC A;  1NI3 A;  4PGY A;  4UAT A;  2ZH8 A;  1ZQP A;  2DRB A;  4KLQ A;  5L9X A;  3ED5 A;  4J9Q A;  5KFX A;  2AU0 A;  3RB4 A;  3D6J A;  4Y2J A;  2H3Q A;  1X66 A;  2F3N A;  4WC4 A;  1XSP A;  4YMN A;  2AGQ A;  3ZDC A;  2ZIU A;  2KZZ A;  4PL1 A;  3BQ0 A;  1GO3 F;  1OW5 A;  4C80 A;  2B6G A;  2ZH1 A;  4Q8F A;  2AJQ A;  4RUC A;  4TUP A;  9ICE A;  2EWR A;  3JPP A;  5D49 A;  2LYB A;  4M47 A;  5AK5 A;  1DK3 A;  2JXJ A;  3KHR A;  4QIW C;  3FC4 A;  1BVS A;  4QNL A;  2RP5 A;  5DG8 A;  4ED8 A;  1S9F A;  2QAR B;  1XNS A;  4X4O A;  1ZD4 A;  2R18 A;  5J0X A;  4FZM A;  1PX5 A;  2R8H A;  2ZUD A;  9ICO A;  2W3S A;  2N1R A;  1TFW A;  2AH5 A;  3WFS C;  2ZTD A;  1PK1 B;  2DL0 A;  2D8C A;  2UVV A;  1SGG A;  5BOM A;  4F4K A;  5DEC A;  3RH4 A;  3EUB 2;  3RAX A;  4M6W B;  4K98 A;  2DKX A;  2F44 A;  2K89 A;  1RG6 A;  3RAQ A;  4O3Q A;  1ZD3 A;  4RQ7 A;  2LBO A;  4CGZ A;  4BX9 C;  3NVO A;  3ISC A;  1UCV A;  2MA1 A;  4J03 A;  1X9S A;  2JEG A;  4I0U A;  3RH5 A;  4R66 A;  4Z6F A;  1NZB A;  2R8G A;  4F4Z A;  2Q4T A;  3GDX A;  3M9M B;  3PNC A;  1ZQH A;  2G5H B;  2F77 X;  5D61 A;  5KFJ A;  4X4T A;  2F76 X;  2HBK A;  2K8B B;  3OUY B;  4DCC A;  5ALX A;  1UET A;  3IG5 A;  4AP9 A;  4IC9 A;  2KVC A;  5D62 A;  4Y2P A;  4C8N A;  4FHY A;  1JI7 A;  4Y2Y A;  5FP0 A;  4J9O A;  1KQQ A;  2E1F A;  2E8M A;  4UW9 A;  3UMG A;  2E8O A;  1BGX T;  3K1Z A;  2MU2 A;  9ICU A;  2W9C A;  2ZG6 A;  2G5I B;  2F1J A;  4FFD A;  5ALW A;  4YXJ A;  5ALP A;  2W7O A;  2EZY A;  8ICJ A;  3OSP A;  3RJK A;  3UM9 A;  4KLL A;  2GWS A;  3FM9 A;  3PVX A;  2PBE A;  2RHF A;  1NKE A;  5J0R A;  4I2H A;  3KKA A;  2DR7 A;  4ELU A;  2WF9 A;  4UBC A;  2ZHB A;  4KMO B;  1XC9 A;  5DB8 A;  3ZDB A;  2P35 A;  8ICG A;  4AT9 B;  2JRZ A;  3PMN A;  5IIN A;  2FMS A;  5AK4 A;  2P6U A;  1KBU A;  4RWO A;  5AKE A;  2VA3 A;  4O3R A;  3ZD8 A;  1N61 A;  5TZV A;  4RQ0 A;  3OVA A;  4EBC A;  2KV2 A;  1UT5 A;  4ACO A;  3C28 A;  4JV1 A;  1U4B A;  1L3V A;  4JK1 A;  3ISD A;  2BDP A;  3PX4 A;  3WK7 A;  4NM1 A;  2HOQ A;  4RWQ A;  4R8U B;  3ER9 B;  2KG5 A;  3SV3 A;  1UA1 A;  4DEZ A;  4NKU A;  3SAG A;  2C28 A;  3U26 A;  1WWV A;  4UB8 U;  3BQT A;  2JGA A;  2WF6 A;  2M2W A;  1Q3V A;  1SWW A;  2KP7 A;  5KFZ A;  4B9L A;  5CFT A;  1JRP A;  2W55 A;  4DSL A;  2LM1 A;  1FEZ A;  1QSL A;  2FLP A;  2KTQ A;  1O03 A;  2HVI A;  4FS1 A;  3EPG A;  1FFV A;  4X5V A;  3BDP A;  4M6W A;  1M6Y A;  3LWL A;  5L1K A;  4FS2 A;  4DF8 A;  5AKK A;  5DB9 A;  2BGW A;  4YR2 A;  5ALR A;  2BPC A;  4O5C A;  3TFR A;  2BR0 A;  1KL9 A;  3M8S A;  4OJO A;  2C22 A;  4C8L A;  3M8R A;  4IQU A;  4QZB A;  2ASJ A;  5ALH A;  2EAP A;  2E1E A;  4RQ3 A;  5AKJ A;  3E2E A;  2OXO A;  1KFS A;  4I2I A;  3C2L A;  2DR8 A;  2DR9 A;  9ICP A;  3QEA Z;  3OHB A;  2ZIU B;  3C2K A;  3ONN A;  4M5D A;  5AKG A;  5J0U A;  2EAM A;  3NUQ A;  2F8K A;  1UT8 A;  1D9D A;  3RJE A;  3UXN A;  2R8K A;  3WKD A;  5ALN A;  4QWB A;  4DL5 A;  4M9H A;  3WK5 A;  1Z00 B;  2BPF A;  2FLL A;  2HHW A;  1WOT A;  2W3R A;  5DKW A;  4B9T A;  2QKQ A;  4RT3 A;  2M2V A;  1Q8K A;  5IIM A;  2QAR A;  7ICU A;  5AK6 A;  1S0O A;  1ZQC A;  1TAQ A;  3SYZ A;  1QSY A;  2DPI A;  2NRT A;  1FO4 A;  1KNY A;  1TE2 A;  5TIS U;  2AXT U;  1ZET A;  2KNJ A;  4NXT A;  5J0P A;  4JUZ A;  1NK8 A;  4X0B A;  3F53 A;  5AM5 A;  1IV8 A;  1YT3 A;  2W8L A;  4I28 A;  3M9N B;  4DOB A;  4B9M A;  5B66 U;  4FE3 A;  1U49 A;  3LDA A;  3FDS A;  1T4G A;  4LZG A;  2C2D A;  2NRX A;  2YY6 A;  1KSP A;  2K4P A;  4S3N A;  1ZQM A;  2IBK A;  1KN5 A;  4RWP A;  1TAM A;  3OTQ A;  4RPY A;  3MDC A;  5HRB A;  4P0Q A;  1TAU A;  4IQT A;  3IP4 B;  1KFT A;  5GTH U;  4DL4 A;  4NJ8 A;  3NS1 A;  3PST A;  1B43 A;  4MKP A;  2HVH A;  3T3F A;  2H5X A;  5EWF A;  1N48 A;  3PX6 A;  5J0Q A;  3RBE A;  4F4Y A;  2KJ9 A;  3IM1 A;  4KLF A;  3QU5 A;  5CJ7 A;  4DFD A;  2JZB B;  5AM3 A;  4RPZ A;  4BWM A;  2WB1 C;  4KLD A;  2NO4 A;  4UB5 A;  3RBD A;  4TUS A;  5B3Q A;  1RPL A;  5G5G A;  4NXX A;  5AIA A;  1J97 A;  5ALL A;  4M9N A;  1C20 A;  5IIJ A;  1NK0 A;  4NXU A;  2YB4 A;  1NK5 A;  3C1Z A;  3H4D A;  2P6R A;  4FBU A;  4R8U A;  8ICR A;  5KT5 A;  5JU5 A;  4QZ9 A;  4UD4 A;  4CF3 A;  2M9N A;  2GO7 A;  5CRX A;  5ALO A;  5B5E U;  5KFQ A;  2PFQ A;  4FBT A;  5ALK A;  2IHM A;  1PVR A;  3GU3 A;  4O3O A;  4QZG A;  8ICH A;  8ICZ A;  3C18 A;  4RPX A;  3SEN A;  8ICE A;  2Y9T A;  3QXG A;  3M6K A;  9ICT A;  4Q43 A;  3QX7 A;  3CRX A;  9ICH A;  2HI0 A;  8ICC A;  3L3F X;  3JPQ A;  2XVT A;  2XGQ A;  2HHS A;  1JN3 A;  4I27 A;  4DL7 A;  9ICR A;  4M0A A;  3Q8P B;  5DG9 A;  2K8C B;  5JRT A; 
#chains in the Genus database with same CATH homology
 1BPD A;  4ECU A;  1LB2 B;  2BQ3 A;  1K1Q A;  4LT6 A;  3GV5 B;  4X4P A;  5CB1 A;  3AQK A;  3FYH A;  1XSL A;  3UPQ A;  4WCW A;  2LYH A;  2KN7 A;  5DBC A;  5J2K A;  4QW8 A;  3QZ7 A;  2XO7 A;  2W9B B;  4TQR A;  3V6J A;  4DL2 A;  5KG0 A;  5KT7 A;  2M2U A;  5HRE A;  2V9W A;  4YN4 A;  5J0O A;  8ICJ A;  3KHH A;  5HML A;  4B9V A;  3HPO A;  3T5H A;  4TUR A;  2PFO A;  4UAZ A;  3H8S A;  4M9L A;  4I2G A;  2HHV A;  3KTQ A;  1JXE A;  8ICI A;  1UEU A;  2MUT A;  4PHD A;  4F4X A;  3Q8L A;  3RB6 A;  1D8L A;  1ZQV A;  3V72 A;  3Q8R B;  5KFT A;  3JZ0 A;  4XRH A;  4J9K A;  4XQ8 A;  4DL3 A;  5CR0 A;  1KDH A;  5HNK A;  3GIJ A;  2XY7 A;  1T7P A;  5KG5 A;  3PW5 A;  4J9L A;  5HP4 A;  3TAN A;  4F91 B;  3N97 B;  2JEJ A;  3RJH A;  3C1Y A;  5HRF A;  7ICF A;  3WFO A;  4J9P A;  2XCA A;  1JXL A;  2JEF A;  2Q66 A;  4QWA A;  5DQI A;  4ED0 A;  1R8C A;  4AT7 B;  4TQS A;  5C5J A;  4HYK A;  4JWN A;  4P2H A;  1ZQW A;  9ICV A;  5HRI A;  4KLG A;  1XS9 D;  2PFN A;  7ICG A;  4RWN A;  3MDA A;  4MFF A;  4IRK A;  5KFF A;  3K75 D;  2PFP A;  4PGY A;  4PH5 A;  5J2F A;  3JPR A;  2ZH8 A;  1ZQP A;  2DRB A;  5J2J A;  3RH6 A;  2ZH7 A;  4KLQ A;  5L9X A;  1TK8 A;  3JPO A;  3H4B A;  4J9Q A;  5KFX A;  5DBA A;  2AU0 A;  7ICM A;  3WFR E;  2IHN A;  9ICN A;  3H3A A;  1XU4 A;  4DSE A;  3EW9 A;  3RB4 A;  3PW4 A;  9ICQ A;  2BPG A;  4J9R A;  4DSK A;  5HRD A;  3HT3 A;  4CCH A;  4QZD A;  3AQN A;  3TI0 A;  2A1J B;  1TV9 A;  4J9N A;  5DDM A;  4YMN A;  1XSP A;  4RUA A;  2AGQ A;  9ICA A;  5DBB A;  4WC4 A;  3ZDC A;  2KZZ A;  1ZQA A;  1C7Y A;  4IRC A;  1UA0 A;  1SZP A;  3BQ0 A;  4MF2 A;  2W9M A;  4YCX A;  4FHP A;  2ZH4 A;  4K4I A;  3OVS A;  4ECR A;  3HJ4 A;  5J0S A;  2BCV A;  2ZH1 A;  1TFY A;  4Q8F A;  4YMM A;  2AJQ A;  1F5A A;  4C8K A;  4RUC A;  3UXO A;  4JV0 A;  4TUP A;  1Q78 A;  4YD1 A;  3MGI A;  1T8E A;  1ZQD A;  4FHX A;  9ICE A;  3MAB A;  4KLH A;  4BWJ A;  1DK2 A;  1ZQU A;  3C23 A;  5D49 A;  3JPP A;  4M47 A;  3H7I A;  4O5E A;  2FLN A;  4K4G A;  4NXZ A;  1DK3 A;  3AU6 A;  3H8W A;  5DG7 A;  1HJP A;  3KHR A;  4MFC A;  1NO5 A;  2J6U A;  2BHN A;  1ZQB A;  5J0W A;  3AQM A;  3GIM A;  1BVS A;  4FO6 A;  1ZQF A;  7ICQ A;  7ICN A;  4O5K A;  5DG8 A;  5J2D A;  4ED8 A;  1S9F A;  3WFP A;  4RQ2 A;  4X4O A;  4DWI A;  1JIH A;  1FA0 A;  1U9L A;  4DFJ A;  2ZH3 A;  5KFS A;  3MBY A;  1HUO A;  2C2R A;  1BNO A;  5J0X A;  3AQL A;  2BCQ A;  2KZ3 A;  1PX5 A;  1DOQ A;  5CA7 A;  2ZUD A;  1Y88 A;  2R8H A;  3C2M A;  1L3S A;  9ICO A;  1MIV A;  1TFW A;  4NM2 A;  3V7J A;  1RXV A;  5DGA A;  3WFS C;  4NLG A;  2ZUC A;  3JYY A;  2ZTD A;  5KFO A;  2V4R A;  5DB6 A;  2W9B A;  1SL1 A;  3GFK B;  3RR7 A;  1S76 D;  4AT7 A;  2UVV A;  2Y1J A;  3MFH A;  5KFE A;  3MFI A;  5KFH A;  1KLN A;  2KFN A;  5BOM A;  4F4K A;  5DEC A;  3RH4 A;  2ZH9 A;  3RAX A;  4ATB A;  4M6W B;  5KG3 A;  4RQ4 A;  4FH3 A;  3RJG A;  1KFD A;  3RAQ A;  1ARO P;  2DPJ A;  5KG6 A;  4ELV A;  2PI5 A;  2HHQ A;  4O3Q A;  7ICR A;  4RQ7 A;  3G6V A;  1V4A A;  1ZQE A;  1ZQK A;  3H38 A;  4XA5 A;  4F5P A;  4QZI A;  3QZ8 A;  3ISC A;  1R89 A;  4YFK A;  3ZD9 A;  5CP2 A;  4E80 A;  1X9S A;  4DQI A;  9ICX A;  2JEG A;  2JZB A;  2VA8 A;  2BCU A;  8ICA A;  4ELT A;  4DL6 A;  3RH5 A;  4R66 A;  4Z6F A;  1NK9 A;  2R8G A;  4F4Z A;  7ICI A;  5DLG A;  5KG4 A;  4MEX A;  3GDX A;  1NKB A;  8ICY A;  3M9M B;  1NJY A;  4WC7 A;  4WC0 A;  7ICT A;  3UXP A;  3PNC A;  4ED2 A;  1RXW A;  4ECX A;  4IQW A;  2DRA A;  5KT3 A;  7ICP A;  1ZQH A;  8ICB A;  2KZM A;  8ICQ A;  5KFJ A;  4X4T A;  1X2I A;  4I2F A;  5KG7 A;  3SV4 A;  3OUY B;  1UET A;  1T3N A;  4PPX A;  4GLX A;  1BPY A;  4KLT A;  4C8N A;  5HR9 A;  4FHY A;  4QZH A;  4ECT A;  2HHX A;  1L5U A;  3RB0 A;  3C21 A;  3JPS A;  4J9O A;  4F8R A;  2UVR A;  1S77 D;  2AQ0 A;  3NYB A;  3G6X A;  1SKS A;  1BGX T;  4RQ8 A;  1KEJ A;  4UB4 A;  3GIL A;  2HHT A;  5J2H A;  1NK7 A;  8ICS A;  9ICU A;  1R8B A;  2W9C A;  4X0A A;  2F1J A;  1B22 A;  4ECZ A;  1N56 A;  4YXJ A;  2F1H A;  1TK5 A;  3HX0 A;  4XQ7 A;  3ISB A;  9ICL A;  4I2C A;  5IIO A;  4EBD A;  3OSP A;  2ISO A;  2W9A A;  2BQR A;  2GWS A;  3RJK A;  4KLL A;  1BPZ A;  4Q45 A;  4QZ8 A;  2F1I A;  4UB2 A;  4ED3 A;  4RNN A;  8ICU A;  4DF4 A;  5HMM A;  4P4P A;  1NJW A;  3JPT A;  3PVX A;  2A1J A;  8ICT A;  2PBE A;  4AT8 B;  2ZTE A;  4RQ1 A;  5J0R A;  3GV8 B;  3OGU A;  5J2I A;  4GXI A;  1NKE A;  1VJ7 A;  4I2H A;  4AT9 A;  5HC9 A;  3BQ1 A;  1ZQY A;  4B9N A;  2NRK A;  3AUO A;  3EZ5 A;  4ELU A;  2JEI A;  2DR7 A;  4UBC A;  3EPI A;  4Z6D A;  3V7K A;  4PHE A;  2AGP A;  2ZHB A;  3PX0 A;  1XC9 A;  3MGH A;  1KTQ A;  5DB8 A;  4IQV A;  3ZDB A;  3N4M B;  4X4U A;  8ICG A;  5F9L A;  2FPM A;  4AT9 B;  4F2S A;  1BPX A;  2ALZ A;  8ICK A;  2RDJ A;  3PMN A;  3RRG A;  5IIN A;  2FMS A;  4I2E A;  4RWO A;  2P6U A;  4QZF A;  3OJU A;  1ZJN A;  2AQ4 A;  4Q44 A;  2VA3 A;  2FPK A;  4KMU A;  4O3R A;  3ZD8 A;  4DOC A;  3OHA A;  5TZV A;  4RQ0 A;  3OVA A;  4O3N A;  4F5R A;  1ZQJ A;  4WC1 A;  4EBC A;  4C8O A;  4O0I A;  5EWG A;  1ZQS A;  2M2T A;  5F2V O;  4NLK A;  1UT5 A;  3T5L A;  1JQR A;  4O3S A;  4NLZ A;  5KTQ A;  3PO4 A;  2ZH5 A;  1WCN A;  1ZYQ A;  4P4M A;  4EP7 A;  1D8Y A;  1HUZ A;  3GQC A;  2I9G A;  4JV1 A;  8ICM A;  1U4B A;  1L3V A;  4JK1 A;  3ISD A;  1TFR A;  5DQH A;  4RU9 A;  3PX4 A;  2FMP A;  4MFA A;  2BDP A;  1CEZ A;  8ICO A;  5D46 A;  3H39 A;  4F93 B;  4KN4 A;  4NM1 A;  4X4N A;  4RWQ A;  4I2B A;  4R8U B;  4DSF A;  3SV3 A;  3RRH A;  4KLI A;  3RJI A;  8ICN A;  3LQC B;  3HIY A;  3GII A;  1UA1 A;  4DEZ A;  1L3T A;  4XUS A;  8ICF A;  4KTQ A;  5KFP A;  3TAR A;  2C28 A;  4NKU A;  5KFR A;  4M04 A;  2R8I A;  3C5G A;  4KLS A;  4F4W A;  3BQT A;  4ED1 A;  3LWM A;  1X9W A;  2BCS A;  1ZQZ A;  4F3O A;  3RB3 A;  1K1S A;  5KFL A;  2M2W A;  3C66 A;  4IR1 A;  2ISP A;  3Q8S B;  2I1Q A;  2DFL A;  3MR3 A;  2ATL A;  2KP7 A;  4WC3 A;  5KFZ A;  5L1J A;  3MR5 A;  4EZ9 A;  4KLM A;  4B9L A;  1X9M A;  4I29 A;  4QWC A;  5KFU A;  5EWE A;  5JUM A;  3BQ2 A;  4DSL A;  4FHV A;  4YR3 A;  5J2G A;  5KFK A;  5CHG A;  5J0T A;  2FPL A;  4NLN A;  4WC5 A;  1QSL A;  3GIK A;  2FLP A;  4E7X A;  5HRG A;  2KTQ A;  2HVI A;  2IA6 A;  2HHP A;  4FS1 A;  5J2B A;  3EPG A;  5DDY A;  4TUQ A;  4ECW A;  2XY6 A;  4X5V A;  2OWO A;  1ZQG A;  4KLO A;  3OV7 A;  4PGQ A;  3BDP A;  4M6W A;  3LWL A;  5L1K A;  3WFQ E;  4E8F A;  4UB1 A;  1U47 A;  4FS2 A;  3KHG A;  4F5O A;  4DF8 A;  3THV A;  4IRD A;  3HW8 A;  4EBE A;  3T5K A;  3TAQ A;  4ED7 A;  5DB9 A;  2BGW A;  4EBK A;  4YR2 A;  4ECY A;  4X4Q A;  3MR2 A;  2BPC A;  5KFW A;  5KG2 A;  1NKC A;  1LV5 A;  4M2Y A;  3TFR A;  1KRP A;  1NOM A;  4O5C A;  2BR0 A;  4GC7 A;  3TQ1 A;  4MEY A;  1QTM A;  1YLQ A;  3M8S A;  3EWA A;  4YMO A;  9ICM A;  8ICW A;  2C22 A;  4C8L A;  3M8R A;  4IQU A;  4NY8 A;  4QZB A;  4F50 A;  3G6Y A;  4I2J A;  2ASJ A;  9ICC A;  4Z6E A;  3PW2 A;  3RJJ A;  4M9G A;  4WBZ A;  4BDP A;  4RQ3 A;  1BPB A;  1H38 A;  2KFZ A;  3H37 A;  4X4R A;  4X4S A;  4UBB A;  4RZR A;  1BPE A;  3E2E A;  7ICV A;  4YR0 A;  4UQG A;  4DS4 A;  1KFS A;  4I2I A;  3C2L A;  4BXO A;  4JWM A;  5HRL A;  2DR8 A;  2ID1 A;  2DR9 A;  1XWL A;  4WBY A;  5KFC A;  2Q0Z X;  9ICP A;  3ZDE A;  2UVU A;  2PXI A;  1COO A;  3QEA Z;  3OHB A;  3C2K A;  5KFI A;  9ICW A;  4M5D A;  5KFB A;  1ZQN A;  1NK4 A;  1TK0 A;  5J0U A;  3NGD A;  3AU2 A;  1S97 A;  1D9F A;  3OJS A;  1UT8 A;  4DLG A;  3Q8K A;  1D9D A;  4UB3 A;  3RJE A;  3EYZ A;  3UXN A;  3PR4 A;  1NZP A;  2R8K A;  4DFP A;  1RYS A;  2BE3 A;  7ICH A;  3SZ2 A;  1ZQR A;  3KHL A;  4KLE A;  3OSN A;  2B21 A;  3PML A;  4EYI B;  4QWB A;  4DL5 A;  4FHW A;  4R64 A;  1S0M A;  4M9H A;  2ZH6 A;  1Z00 B;  2BPF A;  4Z6C A;  2V4Q A;  2FLL A;  2HHW A;  4RNO A;  1WOT A;  5IIL A;  4UD5 A;  4DOA A;  1IM4 A;  3ZDA A;  4YG2 A;  5DKW A;  1DGS A;  5J2A A;  4B9T A;  1VFG A;  4RT3 A;  4J9M A;  3QEB Z;  2M2V A;  5HRK A;  3OVB A;  4X4V A;  2ZUB A;  2NRZ A;  4MF8 A;  5IIM A;  4F92 B;  4PHP A;  2NRV A;  5KT6 A;  4YP3 A;  2ZJ5 A;  1EXN A;  7ICU A;  3TFS A;  4F5Q A;  4C8M A;  3Q8M A;  1S0O A;  1ZQC A;  1TAQ A;  2UVW A;  4WC2 A;  1V9P A;  4R63 A;  2RFF A;  3SYZ A;  4DFK A;  1QSY A;  3RR8 A;  4GC6 A;  2FMQ A;  2DPI A;  3ZDD A;  2NRT A;  4DQP A;  1U48 A;  4O9M A;  7ICE A;  1JMS A;  4GXJ A;  3UQ0 A;  4DS5 A;  2IMW P;  1KNY A;  3OUY A;  1ZET A;  4M9J A;  5KFN A;  3B0Y A;  4QZE A;  4YD2 A;  3H8J A;  2XC9 A;  5J0P A;  4JUZ A;  4QZA A;  3M9O B;  5DLF A;  5HHH A;  1ZJM A;  1NK8 A;  4QWD A;  4Q8E A;  4X0B A;  3PY8 A;  2MUT B;  3NTU A;  2W8L A;  2BQU A;  4DQS A;  4I28 A;  1MSW D;  1RZT A;  1NK6 A;  3M9N B;  4G3I A;  1MC8 A;  9ICG A;  4YXM A;  4DOB A;  1IXR A;  4B9M A;  5KT4 A;  1TKD A;  5KG1 A;  4LZD A;  4KN7 A;  1ZQQ A;  1QLN A;  5CWR A;  3H40 A;  1U49 A;  5KFM A;  3IHQ B;  3LDA A;  3FDS A;  4I2D A;  4QWE A;  1T4G A;  3PW0 A;  1S0V A;  5DB7 A;  2XGP A;  9ICJ A;  4LZG A;  8ICV A;  2C2D A;  2ZJA A;  2NRX A;  4DSI A;  3L9D A;  3ETL A;  4EZ6 A;  5DGB A;  2DVI A;  1KSP A;  1Z3E B;  4S3N A;  1ZQM A;  2IBK A;  4RWP A;  4RPY A;  4ED6 A;  3MDC A;  5HRB A;  1ZQL A;  4J9S A;  1SL0 A;  4B9U A;  4DFM A;  1TAU A;  2WTF A;  1MQ2 A;  4IQT A;  3PW7 A;  5KFD A;  1ZQI A;  1ZQO A;  5J2E A;  1KFT A;  4AT8 A;  1CUK A;  1TVA A;  3PO5 A;  2ZH2 A;  3TAP A;  4DL4 A;  4ZH4 A;  7ICO A;  4PHA A;  2XY5 A;  1BNP A;  1A77 A;  1B43 A;  2W9C B;  2HVH A;  5BOL A;  3T3F A;  1S0N A;  2R8J A;  3JPN A;  2H5X A;  3V6H A;  4ATB B;  1OU5 A;  1NJZ A;  1WCL A;  5EWF A;  3V6K A;  2AGO A;  4B9S A;  1JAJ A;  4BGD A;  1N48 A;  2PI4 A;  4EEY A;  5J0Q A;  5J2C A;  3T5J A;  3PX6 A;  4F5N A;  4F4Y A;  3B0X A;  4DLE A;  5DQG A;  3RBE A;  1RYR A;  2J6S A;  1UEV A;  2ASD A;  4EBJ A;  3IM1 A;  4YQW A;  1S10 A;  5KFG A;  5J0Y A;  1Z00 A;  3RTV A;  1MIW A;  5DED A;  3UPS A;  4UAW A;  2ZHA A;  2DR5 A;  4KLF A;  3V7L A;  3GV7 B;  5CJ7 A;  2JZB B;  5L1L A;  5IIK A;  4RPZ A;  1NJX A;  4BWM A;  4RQ5 A;  4NKT A;  3PV8 A;  4I2A A;  4KLD A;  4E0D A;  2ZTC A;  5KFA A;  4RNM A;  1U45 A;  2BKE A;  4UB5 A;  4QW9 A;  3RBD A;  4TUS A;  2BCR A;  4PGX A;  4IG8 A;  1RPL A;  2HHU A;  3LK9 A;  2O5A A;  2XCP A;  5BPC A;  1ZQX A;  4KLJ A;  4KIT B;  3SI8 A;  3HWT A;  4M9N A;  4P4O A;  5IIJ A;  4ECQ A;  1SKR A;  1L3U A;  4JV2 A;  1NK0 A;  1A76 A;  5HRH A;  4YVZ A;  1NK5 A;  4DSJ A;  1MIY A;  3C1Z A;  5EOZ A;  3H4D A;  2P6R A;  2ASL A;  9ICB A;  7ICL A;  2RDI A;  5KT2 A;  2J6T A;  4FBU A;  2W8K A;  3UQ2 A;  4R8U A;  1SL2 A;  4K4H A;  5KT5 A;  1ZQT A;  2P66 A;  5KFY A;  8ICR A;  4QZ9 A;  8ICP A;  4FH5 A;  1XSN A;  4EYH B;  2M9N A;  4DQQ A;  1R8A A;  4UD4 A;  7ICJ A;  1SKW A;  3Q8Q B;  9ICK A;  5KFQ A;  5III A;  8ICL A;  4R65 A;  4ECS A;  4ECV A;  1PZN A;  1QSS A;  2PFQ A;  4FBT A;  2IHM A;  3HJ1 A;  5HHI A;  2Y1I A;  1MQ3 A;  9ICF A;  3BJY A;  2C2E A;  5L1I A;  2MAX A;  4O3O A;  4RQ6 A;  4QZG A;  4GXK A;  2ZJ8 A;  4KLU A;  8ICH A;  9ICI A;  5D4B A;  1XO1 A;  3HP6 A;  8ICZ A;  4F2R A;  2VA2 A;  4UAY A;  2O1P A;  2VAN A;  4RPX A;  4IR9 A;  4DO9 A;  3QE9 Y;  8ICE A;  3K4G A;  3C18 A;  7ICS A;  1Q79 A;  4RT2 A;  9ICT A;  4Q43 A;  4WC6 A;  9ICH A;  1JX4 A;  4LVS A;  5J29 A;  8ICC A;  3RJF A;  4O3P A;  3JPQ A;  3C5F A;  4BXO B;  3ORY A;  2XGQ A;  2HHS A;  1JN3 A;  4I27 A;  4DL7 A;  9ICR A;  8ICX A;  5F9N A;  3PR5 B;  4M0A A;  3Q8P B;  4DQR A;  2HW3 A;  4QZC A;  3MR6 A;  2NRW A;  5KFV A;  7ICK A;  5DG9 A;  9ICS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...