4PHDA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp and manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 105
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phdA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phdA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phdA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phdA03
3HWTA 4DQRA 4I2EA 9ICNA 9ICKA 4X4NA 3H8JA 4BWMA 1ZQUA 4KLHA 3GDXA 2J6SA 4KN4A 4NKTA 4KLMA 1RPLA 5KG5A 3ISCA 5KFGA 1MC8A 3LK9A 3N4MB 3T3FA 2PI4A 5DKWA 3PY8A 4M2YA 1S0VA 2ZTEA 3Q8KA 8ICCA 2M2TA 5KFPA 3UQ2A 2FMSA 2HHVA 8ICAA 2KZZA 1NZPA 5DB8A 2MUTA 2BQRA 1D9DA 2AU0A 4Z6CA 1BPBA 4FS2A 1BVSA 5J2IA 4RQ8A 3G6VA 9ICVA 3RH4A 5KFVA 1SL0A 1JIHA 4Z6DA 1KFSA 3AUOA 2I9GA 5KFDA 2C2EA 4C8NA 5DGBA 2M2VA 4J9NA 2ZH7A 3M8SA 5HHIA 1ZQVA 5HP4A 5D49A 1ZQHA 3RRGA 4RZRA 4DEZA 4RQ2A 4PGXA 4ECUA 4YG2A 1Y88A 2AGPA 9ICGA 1A77A 4RUCA 1NKBA 1KSPA 4I2DA 1OU5A 5KFYA 3TFSA 4WBYA 4RT2A 5L1JA 4DOCA 4QZEA 5KFHA 3QEBZ 5CJ7A 1NK9A 2FPKA 1NK8A 3C2LA 3JYYA 3UPSA 2BPGA 4EZ6A 5J2KA 4ECRA 4DL4A 4DFMA 1SKRA 4NM2A 8ICOA 3RJIA 1NO5A 2JEJA 5DDMA 4FH5A 3KHRA 4R65A 4X5VA 5KG6A 3H3AA 3GIMA 1TK5A 3MGIA 4WC5A 4FBUA 4O5KA 1BGXT 2ZJAA 5CB1A 4S3NA 3RH6A 4BGDA 1QSLA 2KFZA 3C1YA 3LWLA 4P4MA 4EBCA 4G3IA 3B0XA 7ICHA 2BQUA 2HHTA 3Q8QB 4DFPA 2W8KA 1NK6A 4M47A 1XWLA 5KFUA 3TI0A 8ICGA 8ICIA 2ZH9A 9ICAA 4DSFA 4LT6A 4UB1A 9ICSA 3JZ0A 4J9SA 1ZQAA 8ICLA 1U9LA 2R8KA 2O1PA 4WCWA 3LWMA 3THVA 4DLEA 2KZ3A 4JWNA 1WCLA 4M6WA 4RNNA 1ZQOA 5DB7A 3GILA 4WBZA 5KFKA 1X9WA 3H7IA 1B43A 2BCVA 3HPOA 2RFFA 2ZTDA 5L9XA 3OVSA 4R64A 4ECQA 3ZD8A 5J0TA 4P4PA 2HVHA 3SV3A 1KFTA 3RBEA 2XCAA 1BPDA 1IM4A 2FPMA 4UAZA 4DLGA 7ICTA 4X4RA 1L3UA 5D4BA 2BCRA 3ORYA 4DFKA 4O5EA 8ICHA 5IINA 4RUAA 3RR7A 2BCSA 2BR0A 4YR0A 1NKEA 4I2BA 4WC2A 1XS9D 1L5UA 2ZUDA 3WFPA 3PX0A 1D8LA 4B9LA 3K4GA 3IHQB 5EWFA 4YXMA 4PHEA 2HHWA 1MSWD 3Q8MA 1S0OA 4X0AA 2F1HA 2XY6A 4YCXA 1ZQTA 4KLOA 1Q79A 3RTVA 3JPSA 3MR6A 4B9VA 4R66A 2DPIA 5IILA 3BQTA 4ECVA 2V4RA 4DOAA 1TKDA 3V72A 2UVWA 8ICPA 3T5LA 4TQRA 3HP6A 3EPIA 2FMQA 4XA5A 2Y1JA 1BPXA 4I2HA 3RB0A 4M0AA 4KLDA 4YP3A 8ICBA 3H40A 5HMLA 5KFWA 4XUSA 3BQ2A 4DQSA 4F92B 3PO4A 3V6JA 4AT8A 3C18A 5F9NA 5KT6A 3Q8RB 2OWOA 4NLGA 5KFIA 4QWBA 4Q45A 1TFWA 7ICSA 2PI5A 5DBCA 4YFKA 9ICPA 2C2DA 1UT5A 2C2RA 1TK8A 4TQSA 4QZHA 1S0NA 1T4GA 4EBJA 4F4XA 5DLGA 3Q8LA 4P4OA 3C5FA 3UXOA 4PH5A 2XC9A 4AT7B 2ZHBA 1L3TA 2PBEA 1TFRA 2R8JA 1KNYA 4DL5A 1N48A 5HRLA 4WC7A 3OUYA 3H8SA 1MIYA 4YVZA 2ZH6A 2Y1IA 5HC9A 4FH3A 3SYZA 3BQ0A 3V6HA 3OSPA 3RJJA 5D46A 3M9NB 5KG2A 1LV5A 5CP2A 1DGSA 4EBKA 3MABA 9ICTA 3GIIA 4YMOA 7ICLA 1AROP 2GWSA 3RB4A 8ICQA 8ICNA 4O3PA 5KFBA 4J9MA 8ICTA 1R8BA 3ZDEA 4ELUA 4X4TA 4KMUA 2HHSA 4ELTA 4EEYA 4P2HA 4AT9B 5DB6A 2B21A 5KFRA 3OJUA 4I27A 7ICMA 2ZHAA 4PGQA 4Q8EA 3AQNA 2XY7A 1D8YA 9ICEA 1NK0A 1H38A 3UPQA 4EP7A 5HMMA 4LZGA 4ED2A 1ZQKA 1XSLA 1QSYA 4NLZA 4F91B 3KTQA 1U4BA 3PW4A 1HUZA 4RPZA 4QWDA 3AQMA 2P66A 4PHAA 4TUPA 5J2CA 4J9LA 1QLNA 3EWAA 1R89A 2BCQA 5CA7A 5EWGA 1JMSA 2ASJA 3WFOA 1TFYA 4NM1A 4F50A 4DSJA 1JXEA 1XO1A 4DL6A 5HRDA 5IIIA 1RYRA 3IM1A 1C7YA 2DR7A 1X9MA 2DR9A 4KN7A 2IHMA 1JAJA 1PX5A 1Z00B 4GC7A 3JPOA 4BXOA 5HRIA 1BPYA 5L1IA 8ICWA 1MQ3A 4NY8A 3JPQA 4ECZA 1D9FA 2PFNA 2DVIA 3T5HA 4PHPA 5KFLA 4RWQA 1TK0A 4QW9A 5DEDA 2VA8A 4E8FA 5L1LA 9ICCA 5DDYA 1MQ2A 3N97B 3FYHA 3MFIA 3PW5A 4FHVA 4RWPA 5KFJA 1QSSA 2PFQA 4EYHB 5HRHA 2Q66A 3C2KA 4YN4A 2R8HA 1WCNA 2JZBB 3JPTA 1T3NA 2JEGA 4RQ6A 9ICMA 5HRGA 3C21A 5DQHA 4B9TA 4NKUA 4M9HA 5DECA 1UT8A 5HRKA 4KLLA 1ZQPA 2AQ0A 5J0RA 4IRCA 4DFJA 4KLQA 3ISDA 5L1KA 5DBBA 4IRDA 4I2CA 4DL3A 9ICQA 3LQCB 3H8WA 4KLGA 2AGOA 2PFOA 1S76D 3L9DA 4Z6EA 2PXIA 5J0YA 4QZCA 1MIWA 1U49A 2MAXA 1NK4A 4DOBA 3AU2A 3Q8SB 1U45A 1S97A 4ELVA 5C5JA 2FLPA 4I29A 4DSLA 4ED0A 1NK7A 4CCHA 4DWIA 3E2EA 4FBTA 5TZVA 2IBKA 5HNKA 4QZIA 5EWEA 5IIMA 1LB2B 3PO5A 1T8EA 8ICMA 4M9LA 4Z6FA 2VA2A 4E7XA 1ZQRA 1UA0A 2LYHA 9ICFA 3HW8A 4J9RA 4PPXA 4YQWA 8ICXA 3WFQE 4WC6A 5F9LA 4QWAA 7ICIA 4X4QA 5KFEA 4RPXA 4DSIA 4B9MA 4M6WB 4J9QA 2F1IA 4J9PA 3ISBA 3AQLA 3QE9Y 4X4OA 1Z00A 3MBYA 3V7KA 3AU6A 3RH5A 4I2GA 4IG8A 2F1JA 4RU9A 8ICUA 4RWOA 4YR2A 3ETLA 4FHPA 3EPGA 5J0SA 4X4SA 3SV4A 4KLEA 4RQ7A 2AGQA 1NJXA 1F5AA 2ISPA 2VANA 4M5DA 4UD4A 9ICJA 2ZUBA 3C1ZA 4C8KA 5KFTA 3C5GA 4M04A 3ZD9A 5KFZA 5J0UA 3RRHA 5J2FA 3RB3A 1PZNA 3PNCA 1ZQBA 5HHHA 1ZQYA 1L3VA 3PW0A 2PFPA 2XGPA 3MGHA 4M9GA 3ZDDA 3ZDAA 4GXJA 4WC1A 4TUSA 3NGDA 3PW7A 2ZH1A 3UXNA 5J2AA 1XU4A 2KN7A 3PVXA 4YD1A 3SI8A 5JUMA 5KFSA 1ZQZA 2HHQA 3OJSA 4TUQA 3KHHA 2AJQA 7ICGA 1TV9A 3RR8A 3OHAA 4NLKA 4KITB 3T5JA 3MR5A 1DK3A 4O0IA 3FDSA 3HIYA 1N56A 4DS4A 1Z3EB 1COOA 4IQVA 4K4GA 2VA3A 1YLQA 2DR8A 1ZQCA 5KG3A 5KFAA 5KT4A 3EZ5A 4E80A 3PW2A 1MIVA 4ED7A 1KLNA 5J29A 2FPLA 2W9MA 4O3NA 2JEIA 4RNOA 1V4AA 3EW9A 5KFXA 5J2HA 4F93B 8ICSA 2RDJA 3QZ8A 3MDCA 4EZ9A 3RBDA 4DS5A 7ICEA 4DF8A 5J2EA 1U47A 2HVIA 2DRBA 4RQ4A 1ZJNA 4KLTA 4XQ7A 5HR9A 1UEUA 2RDIA 5J2GA 2W9BB 4F2RA 1ZQNA 3T5KA 4DO9A 4EYIB 2BGWA 1RXWA 4ZH4A 5EOZA 4FHYA 4XQ8A 4F4WA 1A76A 2XGQA 3H4BA 4I2IA 9ICHA 2BE3A 3V7JA 3V6KA 4BDPA 4QZFA 2M2UA 2J6UA 2DRAA 4K4IA 2FMPA 1HUOA 5KFNA 4F5RA 4IR1A 4X4UA 4FHWA 2NRTA 4YMMA 1ZQSA 1DOQA 3Q8PB 4MEXA 4IRKA 7ICOA 4O3SA 3GIKA 7ICRA 4FHXA 1IXRA 1KFDA 5KFOA 4HYKA 4IQUA 2ZJ5A 4NLNA 4KTQA 3OGUA 4FO6A 3KHLA 5KFCA 1JX4A 3RAXA 4J9KA 4QZBA 1KDHA 4R8UB 5DLFA 1BNOA 4UB4A 4QWCA 4KLUA 4BWJA 5DG8A 4GC6A 4DQPA 3OV7A 3OVBA 4GXKA 4EBEA 3LDAA 3PX4A 4PGYA 2NRZA 4NXZA 2XO7A 5BPCA 8ICJA 3K75D 3M9OB 5IIKA 4EBDA 1TAUA 2BPCA 4JK1A 4XRHA 2HHUA 4RT3A 2HHPA 1ZQXA 4M9JA 4Q8FA 1ZQWA 2C22A 7ICNA 2M2WA 3WFSC 2BQ3A 2ZJ8A 1KRPA 1FA0A 5HREA 1XSNA 1DK2A 5KTQA 3PR4A 3OHBA 2BPFA 1NJZA 2Q0ZX 4F5NA 3C2MA 5J2DA 1XC9A 2ALZA 1NOMA 2NRXA 1U48A 2W9AA 1S0MA 1K1QA 4R63A 4ED3A 8ICYA 5J0XA 1SKSA 2HW3A 4DQIA 4C8OA 1R8CA 1CUKA 1UETA 2ZH3A 4DSKA 4QZ9A 3PV8A 3BDPA 4AT8B 3TAQA 2NRWA 1SZPA 1TVAA 4IR9A 3G6YA 8ICRA 4WC4A 1SL2A 2UVRA 4I2FA 4UB3A 1ZQMA 4UBCA 2ZH5A 3RJKA 4C8MA 3KHGA 3HJ1A 7ICVA 1ZYQA 2JZBA 5KT5A 4JV2A 3MFHA 2WTFA 4LZDA 4K4HA 2R8GA 3RJHA 4IQTA 1ZQGA 2HHXA 5BOMA 3JPPA 4MFFA 2R8IA 4ECTA 3MR2A 1S9FA 3C66A 4ECWA 3GQCA 4ED1A 3JPNA 1HJPA 4MFAA 3RAQA 4YR3A 4KLJA 1L3SA 2P6UA 2ZTCA 2IA6A 4R8UA 8ICKA 5J0OA 2XY5A 5KFMA 2MUTB 4BXOB 4DF4A 4MF8A 3UQ0A 3C23A 4UBBA 4F5QA 2P6RA 1NJWA 4B9NA 2W8LA 4WC0A 3QZ7A 4LVSA 4QZAA 1RZTA 3HT3A 2W9CB 3MR3A 4F4ZA 4UB2A 3GV8B 2ZH8A 4YD2A 4ECSA 2DR5A 1ZQJA 4RNMA 3NTUA 4UAYA 5CWRA 4IQWA 1UEVA 1RYSA 2UVVA 3WFRE 5IIOA 5KT2A 3TANA 5KT3A 4WC3A 4RQ0A 3PX6A 3V7LA 5DQIA 4RPYA 5KFQA 4UQGA 9ICIA 2ISOA 9ICXA 1B22A 1SL1A 1BNPA 5KG1A 5HRFA 4YMNA 9ICWA 1QTMA 2IHNA 3BQ1A 5DBAA 5KG4A 4ATBA 4RWNA 1TAQA 3ZDCA 3GV5B 5DG7A 2KFNA 1ZQLA 4F3OA 8ICFA 3B0YA 1Q78A 4I28A 4RQ3A 5KFFA 3EYZA 5J0WA 4KLFA 1T7PA 2KTQA 3OSNA 1S77D 3UXPA 2UVUA 4O5CA 1SKWA 4ATBB 4JUZA 4DL2A 3HX0A 2V4QA 2C28A 5IIJA 3JPRA 1VFGA 7ICJA 3M8RA 1WOTA 2I1QA 4QW8A 4YXJA 4UD5A 1KTQA 2ZH2A 1R8AA 2FLNA 2O5AA 1X2IA 4QWEA 2W9BA 3PMNA 5KG0A 1BPZA 1ZQEA 4X4VA 3RB6A 3TAPA 2KP7A 3GV7B 2KZMA 5F2VO 4FS1A 3PR5B 3BJYA 4MF2A 8ICEA 5DG9A 1CEZA 2DFLA 4J9OA 4UB5A 5CR0A 1JN3A 4DL7A 1ZQIA 4B9SA 3H38A 3HJ4A 4ED6A 3QEAZ 4DQQA 4MEYA 1NK5A 2J6TA 3NYBA 4AT9A 3OUYB 4ED8A 4Q44A 4F4YA 9ICOA 9ICLA 2XCPA 4GLXA 2BDPA 2DPJA 1ZJMA 2W9CA 3RJGA 4DSEA 1NJYA 4O9MA 4MFCA 4M9NA 4RQ5A 8ICZA 4UAWA 3H4DA 3AQKA 1X9SA 3TQ1A 4E0DA 1UA1A 4JWMA 4GXIA 2A1JB 5KT7A 1JQRA 1V9PA 2V9WA 8ICVA 2M9NA 4O3QA 1BPEA 5CHGA 5J0PA 4PHDA 4F5OA 1S10A 4B9UA 3H37A 3TARA 3RJEA 3TFRA 4X4PA 2ASLA 4RQ1A 5DGAA 2BCUA 7ICKA 2A1JA 5J2JA 2ASDA 1KEJA 1ZQFA 3GIJA 2FLLA 4F8RA 4O3RA 4F2SA 2ATLA 4KLIA 9ICBA 4X0BA 1K1SA 1ZETA 3OVAA 2NRKA 4QZGA 2IMWP 2BHNA 4Q43A 2ID1A 5BOLA 4ECYA 4F4KA 4KLSA 7ICFA 5DB9A 5KG7A 3SZ2A 3PMLA 7ICPA 1VJ7A 7ICQA 2NRVA 4QZ8A 2JEFA 2H5XA 3M9MB 2AQ4A 9ICUA 1NKCA 4TURA 4O3OA 2ZH4A 2ZUCA 1RXVA 2BKEA 4JV0A 7ICUA 4I2AA 5HRBA 4ECXA 5DQGA 4QZDA 3MDAA 1XSPA 4JV1A 9ICRA 4AT7A 3H39A 1EXNA 5J0QA 3GFKB 3G6XA 3ZDBA 1JXLA 4I2JA 1ZQQA 3RJFA 4C8LA 4F5PA 5J2BA 1ZQDA
chains in the Genus database with same CATH superfamily
3HWTA 3IG8A 3GDXA 3M6KA 4KN4A 1RPLA 3N4MB 3T3FA 3GZFA 5DKWA 3PY8A 2W54A 1QQ6A 1D9DA 3K1ZA 2AU0A 4Z6CA 4FS2A 4RQ8A 1SWVA 2A19A 5KFDA 5DGBA 4J9NA 1ZQVA 3A0HU 5HP4A 4RZRA 1SZHA 1Y88A 4KMOB 4YG2A 1KSPA 5KFYA 5GTIU 4QZEA 5KFHA 3QEBZ 4AP9A 1NK9A 2FPKA 1NK8A 3C2LA 3JYYA 1RYUA 1JALA 5J2KA 4ECRA 4DL4A 5ALJA 1SKRA 5AI5A 2ZIWA 2HSZA 2JEJA 3KHRA 4DFDA 2ZIXB 3E58A 2K4EA 3LYSA 4WC5A 4O5KA 5CB1A 4EBCA 2YN4A 3IRUA 1J97A 3B0XA 3Q8QB 2KE7A 4UB1A 3WKDA 1J2MA 3N7SC 3JZ0A 2KVSA 3H0RB 4RNNA 3F2BA 1ZQOA 5K4LA 1X9WA 2RQ5A 2BCVA 3HPOA 2VJ4A 5L9XA 1L7NA 5J0TA 1KFTA 2XCAA 3TACB 2DKXA 3RR7A 2LBOA 2XVTA 4YR0A 1KKXA 1L5UA 2JH1A 4O67A 3K4GA 1KBUA 4PHEA 2BDUA 1XO0A 5H2FU 4X0AA 1WYGA 3HKZC 3OTQA 5CFUA 2NO4A 4R66A 2DPIA 2HCFA 3WK4A 5HR6A 3SQIA 2O6KA 4XA5A 1N5WA 3CRXA 4YP3A 4C7ZA 4LEYA 3C18A 5KT6A 1TFWA 2PI5A 5DBCA 2C2DA 1TK8A 4TQSA 4P4OA 4PH5A 2ZHBA 2PBEA 2R8JA 4DL5A 3V6HA 2Q4TA 3RJJA 1DGSA 4YMOA 1O03A 2GWSA 8ICQA 5CRXA 2B51A 4Y2TA 4ELTA 2DWQA 4AT9B 3OJUA 1HEKA 5AM2A 3AQNA 4OJOA 4EELA 2XY7A 2B56A 2CPRA 2KKPA 1NK0A 5AKXA 1MN8A 1IV8A 1RQNA 1PK1A 4EEDA 4F91B 3KTQA 3PW4A 2K89A 2P66A 4J9LA 1YZ6A 3WFOA 2ASJA 5G5GA 4PZOA 3E0FA 1XO1A 2B0CA 2OH2A 1C7YA 2DR7A 4KN7A 1PX5A 4UW9A 4BXOA 5HRIA 3I1YA 5L1IA 2H3IA 4NY8A 2HMXA 2DVIA 2KV2A 4PHPA 3FYHA 2NV3A 2W7OA 3MC1A 2PFQA 2KJ8A 2Q66A 1AQ6A 2JZBB 3JPTA 1T3NA 5DQHA 4M9HA 5DECA 5HRKA 3NKUA 1ZQPA 3ISDA 3H8WA 3L9DA 3SAHA 1S76D 4Z6EA 1U49A 5C5JA 1NK7A 4CCHA 4P0QA 4FBTA 2IBKA 4XJEA 2WAQC 1LB2B 3QU4A 2VA2A 3D6JA 2LYHA 8ICXA 1GO3F 3QUTA 2G07A 4RPXA 3QXGA 4J9PA 2F1IA 3AU6A 3MBYA 2IUBA 2HBMA 3EPGA 3SV4A 4RQ7A 1NJXA 1GPJA 2VANA 4C8KA 3ZD9A 3TKAA 2PFPA 3MGHA 3ZDAA 4GXJA 4WC1A 3PW7A 2KN7A 4YD1A 3SI8A 5KFSA 3OJSA 4TUQA 3KHHA 2EANA 3OHAA 4KITB 1OUQA 3MR5A 1PUZA 3FDSA 3F5AA 5AICA 1Z3EB 2DR8A 3EZ5A 3PW2A 2MU2A 3NWIA 1ED1A 4EX6A 1KLNA 8ICSA 2RDJA 2RHFA 1UQVA 2MRLA 4Y2UA 4RQ4A 1JI7A 5T14A 3T5KA 4EYIB 2K8CB 5J8YA 2G09A 4FHYA 2F44A 2KOBA 9ICHA 3V6KA 4JLXA 5KFNA 4F5RA 4IR1A 2YB4A 4X4UA 2XICA 3KHLA 1JX4A 3PHZA 4KLUA 4GC6A 1PK1B 1ZD3A 3D2QA 3OVBA 4LEWA 4EBEA 3WKBA 3LDAA 5AM4A 4PGYA 2NRZA 4NWIA 4HX0A 3D2SA 4EEBA 3K75D 3M9OB 2HHUA 2HHPA 4M9JA 7ICNA 1ZQWA 5ALSA 2YX8A 1KRPA 1DK2A 1V38A 1NJZA 2Q0ZX 4B6JA 4F5NA 2KSOA 4MKPA 5JTGA 1U48A 2NRXA 2ZH3A 5ALIA 4QIWF 2K8BB 4JV2A 5KT5A 2R8GA 4MFFA 4ECWA 3GQCA 1HJPA 4KLJA 8ICKA 2P6UA 4FZMA 4DF4A 1SXDA 4MF8A 3UQ0A 2W8LA 4WC0A 1QQ5A 2W9CB 3MR3A 4F4ZA 5AK6A 4UB2A 2ZH8A 3NTUA 2LYBA 2UVVA 2H3ZA 1BNPA 9ICXA 2ISOA 1SL1A 5HRFA 5KG1A 4YMNA 4DCCA 3ZDCA 1Q78A 2Y9TA 1ZQLA 3B0YA 1P7DA 1O08A 1T7PA 2HOQA 2OYYA 3OSNA 4NXTA 1S77D 3UXPA 2JXJA 2UVUA 2ZIUB 2HN1A 4NXWA 1WOTA 1N62A 1KTQA 4AYBF 4P0QB 1X2IA 4QWEA 2W9BA 3PMNA 1BPZA 3RB6A 3TADA 3GV7B 4WJ3B 2F8LA 1L8OA 4FZLA 4DL7A 2GH1A 3ED5A 4F4YA 2EAPA 3VC8A 3S6JA 2W9CA 1ZJMA 3RJGA 4DSEA 1NJYA 8ICZA 4UAWA 3AQKA 3TQ1A 2F3NA 4JWMA 2KIVA 2A1JB 1NNLA 4O3QA 2KK0A 4F5OA 3RJEA 1F5SA 2ASLA 4LEVA 1ZD5A 5DGAA 7ICKA 2ASDA 4O3RA 3ER9B 5D63A 1ZRMA 4O6AA 4QZGA 2BHNA 1FIQA 7ICFA 7ICPA 3SZ2A 4QZ8A 3M9MB 1RG6A 4WH5A 2XI9A 7ICUA 3WK7A 1SWWA 5HRBA 2K4PA 3SENA 1JXLA 4B9SA 5J2BA 4DQRA 3KKAC 4KM5A 2KMDA 4KLHA 4UAVA 3Q8KA 2HBJA 4K96A 5KFPA 2KZZA 5DB8A 2MUTA 9ICVA 1BPBA 5J2IA 3G6VA 2KVCA 3RH4A 1KFSA 1SL0A 1JIHA 4Z6DA 2HBLA 3IP4B 3RRGA 1ZQHA 4RQ2A 3U26A 1TE2A 1NKBA 1KL9A 2EZZA 2QB0A 3UPSA 3NVVA 1NO5A 5DDMA 1Q3VA 2YB1A 4R65A 3GIMA 2HI0A 3RH6A 4BGDA 2KFZA 5GTHU 4WOYA 2HHTA 4Y2SA 3TI0A 2ZH9A 9ICAA 2W03A 1ZQAA 1URJA 3M6ZA 4QJFB 3CK6A 3OVSA 4R64A 3ZD8A 3SV3A 2IOHA 1IM4A 4OAHA 4X4RA 1OW5A 5D4BA 1L3UA 2BCRA 2G06A 4PZNA 8ICHA 5IINA 4RUAA 2BCSA 3UM9A 4I2BA 4WC2A 2E8PA 2KG5A 1X42A 2ZUDA 3PX0A 1LKYB 5EE3A 5EWFA 1MSWD 1S0OA 2XY6A 1ZQTA 3JPSA 1S5LU 3MR6A 2QLTA 3BQTA 2V4RA 1TKDA 2UVWA 8ICPA 1SV0A 1QH9A 5ALOA 3EPIA 2FMQA 2Y1JA 4I2HA 3RB0A 5HMLA 5KFWA 4XUSA 4DQSA 4F92B 2OWOA 4NLGA 5KFIA 4YFKA 4I0UA 2C2RA 4QZHA 3WK9A 1T4GA 5AI4A 4F4XA 5ALRA 3C28A 3ALRA 2GLEA 4FZNA 5HRLA 4WC7A 4YVZA 3AN1A 2LI6A 3OSPA 1ZRNA 9ICTA 7ICLA 1AROP 3RFAA 8ICNA 4J9MA 1R8BA 4ELUA 2HHSA 3DV9A 1Z1BA 2B21A 5KFRA 4I27A 7ICMA 4OD0A 4PGQA 4Q8EA 1KN5A 9ICEA 2DKZA 5HMMA 3ERCC 4CF3A 4NLZA 1IG6A 2WB1F 4QIWC 4QWDA 1VDVA 5AIAA 1QLNA 2BCQA 5EWGA 1TFYA 4DSJA 4DL6A 2IOFA 1RYRA 2W04A 2DR9A 2WF7A 4C4SA 8ICWA 1MQ3A 3JPQA 4ECZA 3ER8C 3NRZA 1TK0A 4Y2QA 1MQ2A 2ES6A 5ALZA 3N97B 3MFIA 3PW5A 4FHVA 2Y0SC 2FE9A 1QSSA 4EENA 4YN4A 2R8HA 1WCNA 2JEGA 2XIDA 1ZQ1C 4KLLA 4NV0A 4I2CA 2AGOA 2PFOA 3I76A 2PXIA 5J0YA 1MIWA 2MAXA 4DOBA 3Q8SB 5AKGA 4DSLA 4ED0A 2G08A 3E2EA 1N61A 2JR5A 1ZD4A 2DGZA 5TZVA 3PO5A 4C4TA 1B4FA 4M9LA 4Z6FA 2YMPA 3HW8A 4PPXA 4YQWA 3J81j 5F9LA 2ZXIA 4QWAA 4X4QA 1C20A 4GFJA 4J9QA 3AQLA 3QE9Y 3V7KA 2F1JA 8ICUA 3C29A 3F2CA 3CP8A 1PVPA 1F5AA 2E1EA 4U6PA 9ICJA 4M04A 3SAGA 4CGZA 4OO1J 1PZNA 3PNCA 2KHVA 5HHHA 4M9GA 1UPHA 3ZDDA 2QKQA 1XU4A 1YT3A 3PVXA 5AI6A 2W3SA 1ZQZA 2HHQA 4OAGA 2OXOA 4NLCA 3T5JA 3HIYA 1N56A 4K4GA 4IQVA 4EGWA 5KG3A 4E80A 4ED7A 5ALGA 1V4AA 3EW9A 5J2HA 4DS5A 2DRBA 5J2EA 4Y2PA 1ZJNA 4IS7A 2H3QA 2RDIA 2W9BB 1ZQNA 4DO9A 2BGWA 3QUCA 4XQ8A 3H4BA 1L8LA 3V7JA 2LM4A 2FMPA 4Y2JA 2NRTA 3BQ7A 3BZKA 3Q8PB 7ICRA 4O3SA 3GIKA 1KFDA 4HYKA 4IQUA 4NLNA 2GA9D 4K8VA 2RRDA 5DLFA 4QWCA 2JH7A 2RLTA 4BWJA 5DG8A 4UARA 3OV7A 5BPCA 8ICJA 4EBDA 5IIKA 3SEIA 4JK1A 5KAFU 3WFSC 1XSNA 5KTQA 2R18A 3PR4A 3OHBA 2BPFA 4JLZA 5D62A 1YZ7A 1XC9A 1NOMA 8ICYA 2HW3A 1ZXIA 4C8OA 4Y2VA 1CUKA 4QZ9A 3TAQA 2NRWA 4IR9A 3DEEA 8ICRA 4OAIZ 4I2FA 3OWGA 1A0PA 2JZBA 3MFHA 2WTFA 1L7OA 4IQTA 2HHXA 5BOMA 3JPPA 2EZXA 3MR2A 3JPNA 2XY5A 5KFMA 5CFTA 4F5QA 4UBBA 2NYVA 3F2DA 4O3MA 2QB0B 3JCFA 4ECSA 4RNMA 2LM1A 5CWRA 3TANA 4WC3A 4RQ0A 3V7LA 4P0PB 4K9BA 1B22A 2IHNA 2ZIVB 4ATBA 4K99A 4RWNA 4RQ3A 3EYZA 4KLFA 1SKWA 4JUZA 2V4QA 2I1QA 4OCZA 5ALWA 2KKVA 2KNJA 4X4VA 2PKEA 5F2VO 4C0ZA 8ICEA 2NO5A 2QARA 4J9OA 5CR0A 3WK8A 3HJ4A 2VIXA 3QEAZ 1ZOLA 4MEYA 4DQQA 4ED8A 1Z19A 2JRZA 9ICOA 4US9A 1Q3UA 2DPJA 5ALMA 4NXVA 4O9MA 4MFCA 1VJ5A 1UA1A 4GXIA 5KT7A 4EEKA 3QUQA 8ICVA 2M9NA 5J0PA 5CEHA 2BZFA 3HILA 4UB8U 4RQ1A 2EDUA 2A1JA 5J2JA 4F8RA 1KEJA 1ZQFA 4F2SA 2ATLA 1F0MA 1ZETA 3RF9A 2K4HA 3PSTA 4F4KA 4KLSA 5KG7A 1VJ7A 4O68A 9ICUA 2AQ4A 1NKCA 3WK5A 2ZH4A 4O3OA 2EZYA 9ICRA 3HRDD 3MDAA 1XSPA 4JV1A 1EXNA 5J0QA 4I2JA 3RJFA 2F8KA 4C8LA 3AM9A 1PVRA 1ZQDA 4RQMA 2YMMA 1FEZA 4I2EA 5ALDA 9ICKA 5E79U 3H8JA 4BWMA 1ZQUA 5TISU 3SR6A 4NKTA 3ISCA 5KFGA 1MC8A 3LK9A 1S0VA 4M2YA 5AK3A 1N63A 2M2TA 1X9XA 3UQ2A 2HHVA 2KIWA 2G0AA 4C8NA 3UMGA 3M8SA 3HKZF 5D49A 4PGXA 9ICGA 1A77A 4RQNA 4C4RA 4RUCA 4FE3A 4I2DA 4WBYA 3HJEA 5L1JA 3BS7A 5CJ7A 4EZ6A 2YMLA 4DFMA 8ICOA 3CW2C 4X5VA 5KG6A 1X6JA 5AM0A 1TK5A 3MGIA 4FBUA 4S3NA 1BGXT 2GAFD 1QSLA 2DF4B 2BQUA 4DFPA 2W8KA 1NK6A 4M47A 1XWLA 4OJPA 2KHQA 5ALXA 8ICIA 4LT6A 2K4IA 4C80A 4J9SA 4WCWA 3LWMA 2KZ3A 4JWNA 3H0MB 4F71A 4M6WA 3GILA 1B43A 2ODGA 2RFFA 2ZTDA 3N7RC 3N7PD 5ALUA 4KX3A 3RBEA 2FPMA 4DLGA 4UAZA 7ICTA 3LVVA 4KB6A 3M7DA 2LHTA 4JB3A 1HIWA 3ORYA 2WF8A 4BX9C 4NLBA 4B9LA 4OAFA 3IHQB 4YXMA 3DDHA 4YCXA 4KLOA 5AKHA 1Q79A 3RTVA 2KJ5A 2K60A 1NI3A 5JU5A 5IILA 2I6XA 3UMBA 4DOAA 3V72A 4WQKA 2ZG6A 1BPXA 5AKEA 4M0AA 3NRWA 4KLDA 3ETRA 8ICBA 3PO4A 3BQ2A 3V6JA 4AT8A 5F9NA 4CE6A 1TAMA 4Q45A 1S8OA 4Y2XA 1SGGA 9ICPA 5JTIA 1SV4A 3C5FA 2XC9A 4AT7B 1L3TA 5ALQA 3OUYA 2ZH6A 3H8SA 1MIYA 5HC9A 3PSPA 3SYZA 3NVZA 2HOIA 5D46A 1LV5A 5CP2A 3MABA 2QB1A 2KJ9A 3M1YA 4F72A 2YMQA 3F5EA 5KFBA 8ICTA 3ZDEA 3L5KA 3MGVA 1T3QA 2FDRA 1D8YA 2W55A 5B3QA 3UPQA 4LZGA 2JGAA 4ED2A 1XSLA 1ZQKA 1QSYA 2YY6A 3AQFA 4LEZA 3I28A 1HUZA 3IG5A 3AQMA 1DRGA 4BJQA 5J2CA 4Y2RA 5CA7A 1JMSA 1RM6C 5ALKA 4K9AA 4UAUA 4A8EA 1Z00B 4GC7A 3K7DA 3QNMA 1BPYA 1D9FA 5KFLA 5AKJA 3AMZA 4QW9A 5DEDA 4PL1A 4E8FA 2HN2A 4EYHB 5HRHA 3C2KA 9ICMA 2WB1C 4RQ6A 4B9TA 4NKUA 5AM1A 9ICQA 5L1KA 5DBBA 4IRDA 4DL3A 4QZCA 1LKYA 3F53A 3QU9A 4EX7A 3AU2A 1U45A 2G5HB 4DWIA 4QZIA 5HNKA 2VKQA 5EWEA 2ZIXA 3CNHA 8ICMA 2HBKA 4OJ5A 1ZQRA 4J9RA 5EE9A 1WUDA 1RDFA 4B9MA 5ALLA 3ISBA 1Z00A 3RH5A 4I2GA 3AL0B 1QQ7A 3ETLA 4X4SA 1JRPA 2ISPA 3EUB2 5KFTA 2LMRA 3RB3A 5J2FA 1ZQYA 2XGPA 4TUSA 3NGDA 2ZH1A 3UXNA 1Z4NA 2AJQA 7ICGA 1TV9A 2DL0A 4O0IA 2KICA 1COOA 2OHFA 1YLQA 1ZQCA 4EV6A 2IHOA 1MIVA 2JHDA 5J29A 2FPLA 2WF6A 2E3TA 4K97A 4EZ9A 3RBDA 4NL9C 5FP0A 2Y0SF 1U47A 2ZIWB 2BBHA 4KLTA 4XQ7A 5HR9A 5J2GA 4CF4A 2W7PA 3KBBA 4F4WA 1A76A 3A0BU 2M0NA 2BE3A 4QZFA 2M2UA 2DRAA 4K4IA 1HUOA 2PMZC 4YMMA 3KD3A 1DOQA 4MEXA 2E8OA 5KFOA 4USAA 4KTQA 3WKCA 1D8BA 5KFCA 3RAXA 4J9KA 4QZBA 2AXTU 5ALTA 2PMZF 2AH5A 4QNLA 2VJ5A 1Q8KA 4GXKA 3ICXA 3PX4A 4NXZA 1TAUA 4LJXA 4XRHA 4P0PA 5D61A 1FA0A 2ZJ8A 5HREA 1CI4A 3KKAA 3BS5A 3C2MA 2ALZA 1S0MA 5J0XA 1SKSA 1V85A 2JV3A 1UETA 3O0FA 2EQYA 1N60A 4DSKA 3PV8A 4AT8B 1SZPA 4WC4A 1SL2A 2ZH5A 3RJKA 7ICVA 3NVWA 4NXUA 4G9BA 4LZDA 1N2XA 3FM9A 2H3FA 2WF5A 4ECTA 5L1MA 1S9FA 3B9JA 2QARB 4GIBA 4ED1A 4MFAA 3RAQA 1L3SA 2ZTCA 3H0LB 2IA6A 2AHOB 1X66A 2HOFA 2A1AA 2MUTB 2LYAA 3C23A 2P6RA 3QX7A 1NJWA 3QZ7A 1RZTA 3KZIU 3HT3A 1ZQJA 1WWUA 4IQWA 2KEYA 2WFAA 5KT2A 5KT3A 2W11A 4FFDA 5DQIA 4RPYA 5KFQA 4UQGA 9ICWA 1QTMA 5DBAA 5KG4A 1TAQA 4PJ0U 3GV5B 2EH9A 2E8NA 5J0WA 1PVQA 2G5IB 4O5CA 2ZIVA 4ATBB 4DL2A 3HX0A 5IIJA 1VFGA 5ALNA 4QW8A 1JUDA 2ZH2A 1R8AA 5C0YA 1ZQEA 1L6NA 4FS1A 3PR5B 2EAMA 4MF2A 1DGJA 1CEZA 3ONNA 2DFLA 1KW4A 4UB5A 1JN3A 4ED6A 1NK5A 9ICLA 2XCPA 2BDPA 4IL6U 2I5HA 4NJ8A 4M9NA 1UHUA 1X9SA 4E0DA 1S10A 2P35A 3TARA 3TFRA 4X4PA 2ESEA 2Y9UA 4KX5A 2FLLA 2B6GA 4KLIA 9ICBA 4X0BA 1K1SA 3H8MA 1Q46A 4Q43A 5DB9A 3PMLA 2DR5A 7ICQA 3WK6A 2HDOA 4TURA 2ZUCA 1RXVA 2BKEA 1X6IA 4ZOHC 4ECXA 4QZDA 3BS5B 5AI0A 4AT7A 3H39A 1V97A 2E5SA 1ZQQA 1Z4OA 2D6FC 4F5PA 9ICNA 4X4NA 2MSNA 3WKAA 2J6SA 4KLMA 5KG5A 2GO7A 2PI4A 2ZTEA 1IIPA 8ICCA 2FMSA 8ICAA 1NZPA 3KZXA 2BQRA 1PK3A 1BVSA 4EBKA 5KFVA 5EE1A 3AUOA 2I9GA 2C2EA 2M2VA 4CRXA 2ZH7A 5HHIA 1KQQA 4DEZA 4ECUA 2AGPA 1OU5A 3TFSA 4RT2A 4ICAA 4DOCA 2F76X 5ALFA 3TADC 2BPGA 1VLBA 4NM2A 3RJIA 4FH5A 3H3AA 2ZJAA 3NUQA 3C1YA 3GU3A 3LWLA 4P4MA 4G3IA 7ICHA 2EWRA 5KFUA 8ICGA 4DSFA 9ICSA 8ICLA 1U9LA 2R8KA 2O1PA 3D2NA 5AHXA 5F3XB 4DLEA 3THVA 1WCLA 2FI1A 5DB7A 4WBZA 5KFKA 3H7IA 1J2NA 2CRXA 4ECQA 4P4PA 2HVHA 3IV6A 1BPDA 3NVOA 1UCVA 2EAOA 5CHEA 5CFSA 3LVWA 4DFKA 4O5EA 4AYBC 5AI9A 2BR0A 1NKEA 4WQLA 1COKA 1XS9D 2F2AB 3ZI4A 3WFPA 1D8LA 1CRXA 1Z1VA 2HHWA 1L7MA 1X40A 3Q8MA 2F1HA 2DUYA 3AQEA 4B9VA 5ALYA 4ECVA 3T5LA 4TQRA 3HP6A 3H40A 2W3RA 3Q8RB 4US8A 4QWBA 7ICSA 2IOFK 1UT5A 2E8MA 1S0NA 3MCRA 4EBJA 5JRTA 5DLGA 3Q8LA 3UXOA 5EE0A 1SV0C 1TFRA 1KNYA 1N48A 2Y1IA 4FH3A 3BQ0A 3M9NB 1B0XA 4ACOA 5KG2A 4C7YA 3GIIA 5AKYA 1K5OA 3RB4A 2B4VA 3CYMA 4O3PA 4X4TA 4KMUA 4EEYA 4P2HA 5DB6A 2ZHAA 2E1FA 3PZPA 4CNQA 1H38A 4K98A 4EP7A 3BZCA 1L7PA 5AKZA 1U4BA 3OPXA 5AIBA 4RPZA 4PHAA 4TUPA 2L5YA 1JROA 3EWAA 1R89A 5KNIA 2ZIUA 4NM1A 2YTUA 4U7CA 1JXEA 4F50A 5HRDA 2YQEA 5IIIA 2OM6A 3IM1A 1X9MA 2IHMA 1JAJA 1M6YA 3JPOA 5AI8A 2PFNA 3T5HA 3NASA 3QYPA 4RWQA 2VA8A 5L1LA 9ICCA 1QCKA 5DDYA 5J8YC 5KFJA 5AK5A 4RWPA 5HRGA 5ALHA 3C21A 1UT8A 5AKKA 5HR7A 2DQNB 2AQ0A 5J0RA 4IRCA 4DFJA 4KLQA 3LQCB 4MHVA 4KLGA 2F77X 3FAHA 4JMUA 1NK4A 4O69A 2ZXHA 1S97A 4ELVA 1A6SA 3QUBA 2FLPA 4I29A 4BUGA 5IIMA 3N28A 1T8EA 5B3PA 4E7XA 1UA0A 3NVYA 9ICFA 3WFQE 3WKEA 3KOOA 4WC6A 7ICIA 5KFEA 4DSIA 4M6WB 4UB6U 4X4OA 2RP5A 3R9KA 3FC4A 4IG8A 4RU9A 4RWOA 3NS1A 4YR2A 4FHPA 5J0SA 2A3VA 4KLEA 2OEHA 2AGQA 4M5DA 4UD4A 2ZUBA 3C1ZA 3C5GA 5J0UA 5KFZA 3RRHA 1ZQBA 1L3VA 3PW0A 3L4PA 1ZD2P 2MA1A 2LPEA 5J2AA 2WAQF 5JUMA 3RR8A 4NLKA 4UASA 4NXXA 1DK3A 5KL8B 4J03A 4DS4A 2VA3A 5KFAA 5KT4A 3SD7A 2LKYA 2W9MA 4O3NA 2JEIA 3IN5A 4RNOA 5KFXA 2K8AA 4F93B 1LVHA 2OCEA 2Z7JA 3QZ8A 5KAIU 3MDCA 5G5HA 7ICEA 4DF8A 1FFUA 2HVIA 1XNSA 1UEUA 4F2RA 1RXWA 4ZH4A 2FJ6A 5EOZA 2XGQA 4I2IA 3L3FX 4UATA 4BDPA 2J6UA 4Y2YA 4FHWA 1ZQSA 3UMCA 1OXJA 4IRKA 7ICOA 4FHXA 1IXRA 3WU2U 2ZJ5A 3OGUA 4FO6A 4CDGA 3QU2A 1SIJA 3SMVA 1KDHA 4R8UB 1BNOA 4UB4A 4DQPA 3PSFA 2N1RA 2XO7A 4PL2A 4OJ6A 2BPCA 4RT3A 4OJLA 1ZQXA 3QU5A 4Q8FA 2C22A 2M2WA 2D3DA 3IDWA 5B66U 2BQ3A 2BBJA 1T94A 2KD1A 5J2DA 2W9AA 1K1QA 4R63A 4ED3A 4FO1A 4DQIA 1R8CA 4NL9A 5AK4A 1DXSA 3BDPA 5ALPA 1TVAA 3G6YA 1WG8A 2UVRA 3QU7A 4UB3A 1ZQMA 4UBCA 4C8MA 3KHGA 3HJ1A 1ZYQA 1RQLA 2WF9A 4K4HA 3RJHA 1ZQGA 2R8IA 2DBYA 3KFUF 2H3VA 3C66A 4YR3A 1NZBA 4R8UA 2W43A 5J0OA 3K1RB 4BXOB 5AKIA 4B9NA 4LVSA 4QZAA 1SB3C 3GV8B 4YD2A 2GOLA 4UAYA 1N5XA 1UEVA 3WFRE 1RYSA 2CXYA 5IIOA 3PX6A 4N7RA 9ICIA 1MA7A 3PSIA 3BQ1A 3EF2A 5DG7A 2KFNA 4F3OA 8ICFA 4I28A 5KFFA 2KTQA 5KL1B 2C28A 3JPRA 7ICJA 4CF5A 3M8RA 2CN1A 4YXJA 5B5EU 4UD5A 2FLNA 2O5AA 5ALEA 5KG0A 3TAPA 2KP7A 1ECWA 2KZMA 2FCLA 3BJYA 5DG9A 1F44A 4HAIA 1ZQIA 3H38A 1FFVA 2JMGA 5AKLA 3NYBA 2J6TA 4AT9A 2WHEA 3OUYB 4Q44A 2D8CA 5AM5A 4GLXA 5A0LA 4RQ5A 3H4DA 1JQRA 1V9PA 2V9WA 3T79A 1BPEA 5CHGA 4PHDA 4B9UA 3H37A 1FO4A 1SXEA 4IC9A 2BCUA 3GIJA 3OVAA 2NRKA 3AEVA 2IMWP 3SAFA 2ID1A 5BOLA 4ECYA 2NRVA 2JEFA 2H5XA 4JV0A 4I2AA 5AM3A 5DQGA 2KSOB 3GFKB 3G6XA 3ZDBA 3VCBA 1WWVA 5ALVA
chains in the Genus database with same CATH topology
3HWTA 4DQRA 4I2EA 9ICNA 9ICKA 4X4NA 3H8JA 4BWMA 1ZQUA 4KLHA 3GDXA 2J6SA 4KN4A 4NKTA 4KLMA 1RPLA 5KG5A 3ISCA 5KFGA 1MC8A 3LK9A 3N4MB 3T3FA 2PI4A 5DKWA 3PY8A 4M2YA 1S0VA 2ZTEA 3Q8KA 8ICCA 2M2TA 5KFPA 3UQ2A 2FMSA 2HHVA 8ICAA 2KZZA 1NZPA 5DB8A 2MUTA 2BQRA 1D9DA 2AU0A 4Z6CA 1BPBA 4FS2A 1BVSA 5J2IA 4RQ8A 3G6VA 9ICVA 3RH4A 5KFVA 1SL0A 1JIHA 4Z6DA 1KFSA 3AUOA 2I9GA 5KFDA 2C2EA 4C8NA 5DGBA 2M2VA 4J9NA 2ZH7A 3M8SA 5HHIA 1ZQVA 5HP4A 5D49A 1ZQHA 3RRGA 4RZRA 4DEZA 4RQ2A 4PGXA 4ECUA 4YG2A 1Y88A 2AGPA 9ICGA 1A77A 4RUCA 1NKBA 1KSPA 4I2DA 1OU5A 5KFYA 3TFSA 4WBYA 4RT2A 5L1JA 4DOCA 4QZEA 5KFHA 3QEBZ 5CJ7A 1NK9A 2FPKA 1NK8A 3C2LA 3JYYA 3UPSA 2BPGA 4EZ6A 5J2KA 4ECRA 4DL4A 4DFMA 1SKRA 4NM2A 8ICOA 3RJIA 1NO5A 2JEJA 5DDMA 4FH5A 3KHRA 4R65A 4X5VA 5KG6A 3H3AA 3GIMA 1TK5A 3MGIA 4WC5A 4FBUA 4O5KA 1BGXT 2ZJAA 5CB1A 4S3NA 3RH6A 4BGDA 1QSLA 2KFZA 3C1YA 3LWLA 4P4MA 4EBCA 4G3IA 3B0XA 7ICHA 2BQUA 2HHTA 3Q8QB 4DFPA 2W8KA 1NK6A 4M47A 1XWLA 5KFUA 3TI0A 8ICGA 8ICIA 2ZH9A 9ICAA 4DSFA 4LT6A 4UB1A 9ICSA 3JZ0A 4J9SA 1ZQAA 8ICLA 1U9LA 2R8KA 2O1PA 4WCWA 3LWMA 3THVA 4DLEA 2KZ3A 4JWNA 1WCLA 4M6WA 4RNNA 1ZQOA 5DB7A 3GILA 4WBZA 5KFKA 1X9WA 3H7IA 1B43A 2BCVA 3HPOA 2RFFA 2ZTDA 5L9XA 3OVSA 4R64A 4ECQA 3ZD8A 5J0TA 4P4PA 2HVHA 3SV3A 1KFTA 3RBEA 2XCAA 1BPDA 1IM4A 2FPMA 4UAZA 4DLGA 7ICTA 4X4RA 1L3UA 5D4BA 2BCRA 3ORYA 4DFKA 4O5EA 8ICHA 5IINA 4RUAA 3RR7A 2BCSA 2BR0A 4YR0A 1NKEA 4I2BA 4WC2A 1XS9D 1L5UA 2ZUDA 3WFPA 3PX0A 1D8LA 4B9LA 3K4GA 3IHQB 5EWFA 4YXMA 4PHEA 2HHWA 1MSWD 3Q8MA 1S0OA 4X0AA 2F1HA 2XY6A 4YCXA 1ZQTA 4KLOA 1Q79A 3RTVA 3JPSA 3MR6A 4B9VA 4R66A 2DPIA 5IILA 3BQTA 4ECVA 2V4RA 4DOAA 1TKDA 3V72A 2UVWA 8ICPA 3T5LA 4TQRA 3HP6A 3EPIA 2FMQA 4XA5A 2Y1JA 1BPXA 4I2HA 3RB0A 4M0AA 4KLDA 4YP3A 8ICBA 3H40A 5HMLA 5KFWA 4XUSA 3BQ2A 4DQSA 4F92B 3PO4A 3V6JA 4AT8A 3C18A 5F9NA 5KT6A 3Q8RB 2OWOA 4NLGA 5KFIA 4QWBA 4Q45A 1TFWA 7ICSA 2PI5A 5DBCA 4YFKA 9ICPA 2C2DA 1UT5A 2C2RA 1TK8A 4TQSA 4QZHA 1S0NA 1T4GA 4EBJA 4F4XA 5DLGA 3Q8LA 4P4OA 3C5FA 3UXOA 4PH5A 2XC9A 4AT7B 2ZHBA 1L3TA 2PBEA 1TFRA 2R8JA 1KNYA 4DL5A 1N48A 5HRLA 4WC7A 3OUYA 3H8SA 1MIYA 4YVZA 2ZH6A 2Y1IA 5HC9A 4FH3A 3SYZA 3BQ0A 3V6HA 3OSPA 3RJJA 5D46A 3M9NB 5KG2A 1LV5A 5CP2A 1DGSA 4EBKA 3MABA 9ICTA 3GIIA 4YMOA 7ICLA 1AROP 2GWSA 3RB4A 8ICQA 8ICNA 4O3PA 5KFBA 4J9MA 8ICTA 1R8BA 3ZDEA 4ELUA 4X4TA 4KMUA 2HHSA 4ELTA 4EEYA 4P2HA 4AT9B 5DB6A 2B21A 5KFRA 3OJUA 4I27A 7ICMA 2ZHAA 4PGQA 4Q8EA 3AQNA 2XY7A 1D8YA 9ICEA 1NK0A 1H38A 3UPQA 4EP7A 5HMMA 4LZGA 4ED2A 1ZQKA 1XSLA 1QSYA 4NLZA 4F91B 3KTQA 1U4BA 3PW4A 1HUZA 4RPZA 4QWDA 3AQMA 2P66A 4PHAA 4TUPA 5J2CA 4J9LA 1QLNA 3EWAA 1R89A 2BCQA 5CA7A 5EWGA 1JMSA 2ASJA 3WFOA 1TFYA 4NM1A 4F50A 4DSJA 1JXEA 1XO1A 4DL6A 5HRDA 5IIIA 1RYRA 3IM1A 1C7YA 2DR7A 1X9MA 2DR9A 4KN7A 2IHMA 1JAJA 1PX5A 1Z00B 4GC7A 3JPOA 4BXOA 5HRIA 1BPYA 5L1IA 8ICWA 1MQ3A 4NY8A 3JPQA 4ECZA 1D9FA 2PFNA 2DVIA 3T5HA 4PHPA 5KFLA 4RWQA 1TK0A 4QW9A 5DEDA 2VA8A 4E8FA 5L1LA 9ICCA 5DDYA 1MQ2A 3N97B 3FYHA 3MFIA 3PW5A 4FHVA 4RWPA 5KFJA 1QSSA 2PFQA 4EYHB 5HRHA 2Q66A 3C2KA 4YN4A 2R8HA 1WCNA 2JZBB 3JPTA 1T3NA 2JEGA 4RQ6A 9ICMA 5HRGA 3C21A 5DQHA 4B9TA 4NKUA 4M9HA 5DECA 1UT8A 5HRKA 4KLLA 1ZQPA 2AQ0A 5J0RA 4IRCA 4DFJA 4KLQA 3ISDA 5L1KA 5DBBA 4IRDA 4I2CA 4DL3A 9ICQA 3LQCB 3H8WA 4KLGA 2AGOA 2PFOA 1S76D 3L9DA 4Z6EA 2PXIA 5J0YA 4QZCA 1MIWA 1U49A 2MAXA 1NK4A 4DOBA 3AU2A 3Q8SB 1U45A 1S97A 4ELVA 5C5JA 2FLPA 4I29A 4DSLA 4ED0A 1NK7A 4CCHA 4DWIA 3E2EA 4FBTA 5TZVA 2IBKA 5HNKA 4QZIA 5EWEA 5IIMA 1LB2B 3PO5A 1T8EA 8ICMA 4M9LA 4Z6FA 2VA2A 4E7XA 1ZQRA 1UA0A 2LYHA 9ICFA 3HW8A 4J9RA 4PPXA 4YQWA 8ICXA 3WFQE 4WC6A 5F9LA 4QWAA 7ICIA 4X4QA 5KFEA 4RPXA 4DSIA 4B9MA 4M6WB 4J9QA 2F1IA 4J9PA 3ISBA 3AQLA 3QE9Y 4X4OA 1Z00A 3MBYA 3V7KA 3AU6A 3RH5A 4I2GA 4IG8A 2F1JA 4RU9A 8ICUA 4RWOA 4YR2A 3ETLA 4FHPA 3EPGA 5J0SA 4X4SA 3SV4A 4KLEA 4RQ7A 2AGQA 1NJXA 1F5AA 2ISPA 2VANA 4M5DA 4UD4A 9ICJA 2ZUBA 3C1ZA 4C8KA 5KFTA 3C5GA 4M04A 3ZD9A 5KFZA 5J0UA 3RRHA 5J2FA 3RB3A 1PZNA 3PNCA 1ZQBA 5HHHA 1ZQYA 1L3VA 3PW0A 2PFPA 2XGPA 3MGHA 4M9GA 3ZDDA 3ZDAA 4GXJA 4WC1A 4TUSA 3NGDA 3PW7A 2ZH1A 3UXNA 5J2AA 1XU4A 2KN7A 3PVXA 4YD1A 3SI8A 5JUMA 5KFSA 1ZQZA 2HHQA 3OJSA 4TUQA 3KHHA 2AJQA 7ICGA 1TV9A 3RR8A 3OHAA 4NLKA 4KITB 3T5JA 3MR5A 1DK3A 4O0IA 3FDSA 3HIYA 1N56A 4DS4A 1Z3EB 1COOA 4IQVA 4K4GA 2VA3A 1YLQA 2DR8A 1ZQCA 5KG3A 5KFAA 5KT4A 3EZ5A 4E80A 3PW2A 1MIVA 4ED7A 1KLNA 5J29A 2FPLA 2W9MA 4O3NA 2JEIA 4RNOA 1V4AA 3EW9A 5KFXA 5J2HA 4F93B 8ICSA 2RDJA 3QZ8A 3MDCA 4EZ9A 3RBDA 4DS5A 7ICEA 4DF8A 5J2EA 1U47A 2HVIA 2DRBA 4RQ4A 1ZJNA 4KLTA 4XQ7A 5HR9A 1UEUA 2RDIA 5J2GA 2W9BB 4F2RA 1ZQNA 3T5KA 4DO9A 4EYIB 2BGWA 1RXWA 4ZH4A 5EOZA 4FHYA 4XQ8A 4F4WA 1A76A 2XGQA 3H4BA 4I2IA 9ICHA 2BE3A 3V7JA 3V6KA 4BDPA 4QZFA 2M2UA 2J6UA 2DRAA 4K4IA 2FMPA 1HUOA 5KFNA 4F5RA 4IR1A 4X4UA 4FHWA 2NRTA 4YMMA 1ZQSA 1DOQA 3Q8PB 4MEXA 4IRKA 7ICOA 4O3SA 3GIKA 7ICRA 4FHXA 1IXRA 1KFDA 5KFOA 4HYKA 4IQUA 2ZJ5A 4NLNA 4KTQA 3OGUA 4FO6A 3KHLA 5KFCA 1JX4A 3RAXA 4J9KA 4QZBA 1KDHA 4R8UB 5DLFA 1BNOA 4UB4A 4QWCA 4KLUA 4BWJA 5DG8A 4GC6A 4DQPA 3OV7A 3OVBA 4GXKA 4EBEA 3LDAA 3PX4A 4PGYA 2NRZA 4NXZA 2XO7A 5BPCA 8ICJA 3K75D 3M9OB 5IIKA 4EBDA 1TAUA 2BPCA 4JK1A 4XRHA 2HHUA 4RT3A 2HHPA 1ZQXA 4M9JA 4Q8FA 1ZQWA 2C22A 7ICNA 2M2WA 3WFSC 2BQ3A 2ZJ8A 1KRPA 1FA0A 5HREA 1XSNA 1DK2A 5KTQA 3PR4A 3OHBA 2BPFA 1NJZA 2Q0ZX 4F5NA 3C2MA 5J2DA 1XC9A 2ALZA 1NOMA 2NRXA 1U48A 2W9AA 1S0MA 1K1QA 4R63A 4ED3A 8ICYA 5J0XA 1SKSA 2HW3A 4DQIA 4C8OA 1R8CA 1CUKA 1UETA 2ZH3A 4DSKA 4QZ9A 3PV8A 3BDPA 4AT8B 3TAQA 2NRWA 1SZPA 1TVAA 4IR9A 3G6YA 8ICRA 4WC4A 1SL2A 2UVRA 4I2FA 4UB3A 1ZQMA 4UBCA 2ZH5A 3RJKA 4C8MA 3KHGA 3HJ1A 7ICVA 1ZYQA 2JZBA 5KT5A 4JV2A 3MFHA 2WTFA 4LZDA 4K4HA 2R8GA 3RJHA 4IQTA 1ZQGA 2HHXA 5BOMA 3JPPA 4MFFA 2R8IA 4ECTA 3MR2A 1S9FA 3C66A 4ECWA 3GQCA 4ED1A 3JPNA 1HJPA 4MFAA 3RAQA 4YR3A 4KLJA 1L3SA 2P6UA 2ZTCA 2IA6A 4R8UA 8ICKA 5J0OA 2XY5A 5KFMA 2MUTB 4BXOB 4DF4A 4MF8A 3UQ0A 3C23A 4UBBA 4F5QA 2P6RA 1NJWA 4B9NA 2W8LA 4WC0A 3QZ7A 4LVSA 4QZAA 1RZTA 3HT3A 2W9CB 3MR3A 4F4ZA 4UB2A 3GV8B 2ZH8A 4YD2A 4ECSA 2DR5A 1ZQJA 4RNMA 3NTUA 4UAYA 5CWRA 4IQWA 1UEVA 1RYSA 2UVVA 3WFRE 5IIOA 5KT2A 3TANA 5KT3A 4WC3A 4RQ0A 3PX6A 3V7LA 5DQIA 4RPYA 5KFQA 4UQGA 9ICIA 2ISOA 9ICXA 1B22A 1SL1A 1BNPA 5KG1A 5HRFA 4YMNA 9ICWA 1QTMA 2IHNA 3BQ1A 5DBAA 5KG4A 4ATBA 4RWNA 1TAQA 3ZDCA 3GV5B 5DG7A 2KFNA 1ZQLA 4F3OA 8ICFA 3B0YA 1Q78A 4I28A 4RQ3A 5KFFA 3EYZA 5J0WA 4KLFA 1T7PA 2KTQA 3OSNA 1S77D 3UXPA 2UVUA 4O5CA 1SKWA 4ATBB 4JUZA 4DL2A 3HX0A 2V4QA 2C28A 5IIJA 3JPRA 1VFGA 7ICJA 3M8RA 1WOTA 2I1QA 4QW8A 4YXJA 4UD5A 1KTQA 2ZH2A 1R8AA 2FLNA 2O5AA 1X2IA 4QWEA 2W9BA 3PMNA 5KG0A 1BPZA 1ZQEA 4X4VA 3RB6A 3TAPA 2KP7A 3GV7B 2KZMA 5F2VO 4FS1A 3PR5B 3BJYA 4MF2A 8ICEA 5DG9A 1CEZA 2DFLA 4J9OA 4UB5A 5CR0A 1JN3A 4DL7A 1ZQIA 4B9SA 3H38A 3HJ4A 4ED6A 3QEAZ 4DQQA 4MEYA 1NK5A 2J6TA 3NYBA 4AT9A 3OUYB 4ED8A 4Q44A 4F4YA 9ICOA 9ICLA 2XCPA 4GLXA 2BDPA 2DPJA 1ZJMA 2W9CA 3RJGA 4DSEA 1NJYA 4O9MA 4MFCA 4M9NA 4RQ5A 8ICZA 4UAWA 3H4DA 3AQKA 1X9SA 3TQ1A 4E0DA 1UA1A 4JWMA 4GXIA 2A1JB 5KT7A 1JQRA 1V9PA 2V9WA 8ICVA 2M9NA 4O3QA 1BPEA 5CHGA 5J0PA 4PHDA 4F5OA 1S10A 4B9UA 3H37A 3TARA 3RJEA 3TFRA 4X4PA 2ASLA 4RQ1A 5DGAA 2BCUA 7ICKA 2A1JA 5J2JA 2ASDA 1KEJA 1ZQFA 3GIJA 2FLLA 4F8RA 4O3RA 4F2SA 2ATLA 4KLIA 9ICBA 4X0BA 1K1SA 1ZETA 3OVAA 2NRKA 4QZGA 2IMWP 2BHNA 4Q43A 2ID1A 5BOLA 4ECYA 4F4KA 4KLSA 7ICFA 5DB9A 5KG7A 3SZ2A 3PMLA 7ICPA 1VJ7A 7ICQA 2NRVA 4QZ8A 2JEFA 2H5XA 3M9MB 2AQ4A 9ICUA 1NKCA 4TURA 4O3OA 2ZH4A 2ZUCA 1RXVA 2BKEA 4JV0A 7ICUA 4I2AA 5HRBA 4ECXA 5DQGA 4QZDA 3MDAA 1XSPA 4JV1A 9ICRA 4AT7A 3H39A 1EXNA 5J0QA 3GFKB 3G6XA 3ZDBA 1JXLA 4I2JA 1ZQQA 3RJFA 4C8LA 4F5PA 5J2BA 1ZQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HWT A;  4DQR A;  4I2E A;  9ICN A;  9ICK A;  4X4N A;  3H8J A;  4BWM A;  1ZQU A;  4KLH A;  3GDX A;  2J6S A;  4KN4 A;  4NKT A;  4KLM A;  1RPL A;  5KG5 A;  3ISC A;  5KFG A;  1MC8 A;  3LK9 A;  3N4M B;  3T3F A;  2PI4 A;  5DKW A;  3PY8 A;  4M2Y A;  1S0V A;  2ZTE A;  3Q8K A;  8ICC A;  2M2T A;  5KFP A;  3UQ2 A;  2FMS A;  2HHV A;  8ICA A;  2KZZ A;  1NZP A;  5DB8 A;  2MUT A;  2BQR A;  1D9D A;  2AU0 A;  4Z6C A;  1BPB A;  4FS2 A;  1BVS A;  5J2I A;  4RQ8 A;  3G6V A;  9ICV A;  3RH4 A;  5KFV A;  1SL0 A;  1JIH A;  4Z6D A;  1KFS A;  3AUO A;  2I9G A;  5KFD A;  2C2E A;  4C8N A;  5DGB A;  2M2V A;  4J9N A;  2ZH7 A;  3M8S A;  5HHI A;  1ZQV A;  5HP4 A;  5D49 A;  1ZQH A;  3RRG A;  4RZR A;  4DEZ A;  4RQ2 A;  4PGX A;  4ECU A;  4YG2 A;  1Y88 A;  2AGP A;  9ICG A;  1A77 A;  4RUC A;  1NKB A;  1KSP A;  4I2D A;  1OU5 A;  5KFY A;  3TFS A;  4WBY A;  4RT2 A;  5L1J A;  4DOC A;  4QZE A;  5KFH A;  3QEB Z;  5CJ7 A;  1NK9 A;  2FPK A;  1NK8 A;  3C2L A;  3JYY A;  3UPS A;  2BPG A;  4EZ6 A;  5J2K A;  4ECR A;  4DL4 A;  4DFM A;  1SKR A;  4NM2 A;  8ICO A;  3RJI A;  1NO5 A;  2JEJ A;  5DDM A;  4FH5 A;  3KHR A;  4R65 A;  4X5V A;  5KG6 A;  3H3A A;  3GIM A;  1TK5 A;  3MGI A;  4WC5 A;  4FBU A;  4O5K A;  1BGX T;  2ZJA A;  5CB1 A;  4S3N A;  3RH6 A;  4BGD A;  1QSL A;  2KFZ A;  3C1Y A;  3LWL A;  4P4M A;  4EBC A;  4G3I A;  3B0X A;  7ICH A;  2BQU A;  2HHT A;  3Q8Q B;  4DFP A;  2W8K A;  1NK6 A;  4M47 A;  1XWL A;  5KFU A;  3TI0 A;  8ICG A;  8ICI A;  2ZH9 A;  9ICA A;  4DSF A;  4LT6 A;  4UB1 A;  9ICS A;  3JZ0 A;  4J9S A;  1ZQA A;  8ICL A;  1U9L A;  2R8K A;  2O1P A;  4WCW A;  3LWM A;  3THV A;  4DLE A;  2KZ3 A;  4JWN A;  1WCL A;  4M6W A;  4RNN A;  1ZQO A;  5DB7 A;  3GIL A;  4WBZ A;  5KFK A;  1X9W A;  3H7I A;  1B43 A;  2BCV A;  3HPO A;  2RFF A;  2ZTD A;  5L9X A;  3OVS A;  4R64 A;  4ECQ A;  3ZD8 A;  5J0T A;  4P4P A;  2HVH A;  3SV3 A;  1KFT A;  3RBE A;  2XCA A;  1BPD A;  1IM4 A;  2FPM A;  4UAZ A;  4DLG A;  7ICT A;  4X4R A;  1L3U A;  5D4B A;  2BCR A;  3ORY A;  4DFK A;  4O5E A;  8ICH A;  5IIN A;  4RUA A;  3RR7 A;  2BCS A;  2BR0 A;  4YR0 A;  1NKE A;  4I2B A;  4WC2 A;  1XS9 D;  1L5U A;  2ZUD A;  3WFP A;  3PX0 A;  1D8L A;  4B9L A;  3K4G A;  3IHQ B;  5EWF A;  4YXM A;  4PHE A;  2HHW A;  1MSW D;  3Q8M A;  1S0O A;  4X0A A;  2F1H A;  2XY6 A;  4YCX A;  1ZQT A;  4KLO A;  1Q79 A;  3RTV A;  3JPS A;  3MR6 A;  4B9V A;  4R66 A;  2DPI A;  5IIL A;  3BQT A;  4ECV A;  2V4R A;  4DOA A;  1TKD A;  3V72 A;  2UVW A;  8ICP A;  3T5L A;  4TQR A;  3HP6 A;  3EPI A;  2FMQ A;  4XA5 A;  2Y1J A;  1BPX A;  4I2H A;  3RB0 A;  4M0A A;  4KLD A;  4YP3 A;  8ICB A;  3H40 A;  5HML A;  5KFW A;  4XUS A;  3BQ2 A;  4DQS A;  4F92 B;  3PO4 A;  3V6J A;  4AT8 A;  3C18 A;  5F9N A;  5KT6 A;  3Q8R B;  2OWO A;  4NLG A;  5KFI A;  4QWB A;  4Q45 A;  1TFW A;  7ICS A;  2PI5 A;  5DBC A;  4YFK A;  9ICP A;  2C2D A;  1UT5 A;  2C2R A;  1TK8 A;  4TQS A;  4QZH A;  1S0N A;  1T4G A;  4EBJ A;  4F4X A;  5DLG A;  3Q8L A;  4P4O A;  3C5F A;  3UXO A;  4PH5 A;  2XC9 A;  4AT7 B;  2ZHB A;  1L3T A;  2PBE A;  1TFR A;  2R8J A;  1KNY A;  4DL5 A;  1N48 A;  5HRL A;  4WC7 A;  3OUY A;  3H8S A;  1MIY A;  4YVZ A;  2ZH6 A;  2Y1I A;  5HC9 A;  4FH3 A;  3SYZ A;  3BQ0 A;  3V6H A;  3OSP A;  3RJJ A;  5D46 A;  3M9N B;  5KG2 A;  1LV5 A;  5CP2 A;  1DGS A;  4EBK A;  3MAB A;  9ICT A;  3GII A;  4YMO A;  7ICL A;  1ARO P;  2GWS A;  3RB4 A;  8ICQ A;  8ICN A;  4O3P A;  5KFB A;  4J9M A;  8ICT A;  1R8B A;  3ZDE A;  4ELU A;  4X4T A;  4KMU A;  2HHS A;  4ELT A;  4EEY A;  4P2H A;  4AT9 B;  5DB6 A;  2B21 A;  5KFR A;  3OJU A;  4I27 A;  7ICM A;  2ZHA A;  4PGQ A;  4Q8E A;  3AQN A;  2XY7 A;  1D8Y A;  9ICE A;  1NK0 A;  1H38 A;  3UPQ A;  4EP7 A;  5HMM A;  4LZG A;  4ED2 A;  1ZQK A;  1XSL A;  1QSY A;  4NLZ A;  4F91 B;  3KTQ A;  1U4B A;  3PW4 A;  1HUZ A;  4RPZ A;  4QWD A;  3AQM A;  2P66 A;  4PHA A;  4TUP A;  5J2C A;  4J9L A;  1QLN A;  3EWA A;  1R89 A;  2BCQ A;  5CA7 A;  5EWG A;  1JMS A;  2ASJ A;  3WFO A;  1TFY A;  4NM1 A;  4F50 A;  4DSJ A;  1JXE A;  1XO1 A;  4DL6 A;  5HRD A;  5III A;  1RYR A;  3IM1 A;  1C7Y A;  2DR7 A;  1X9M A;  2DR9 A;  4KN7 A;  2IHM A;  1JAJ A;  1PX5 A;  1Z00 B;  4GC7 A;  3JPO A;  4BXO A;  5HRI A;  1BPY A;  5L1I A;  8ICW A;  1MQ3 A;  4NY8 A;  3JPQ A;  4ECZ A;  1D9F A;  2PFN A;  2DVI A;  3T5H A;  4PHP A;  5KFL A;  4RWQ A;  1TK0 A;  4QW9 A;  5DED A;  2VA8 A;  4E8F A;  5L1L A;  9ICC A;  5DDY A;  1MQ2 A;  3N97 B;  3FYH A;  3MFI A;  3PW5 A;  4FHV A;  4RWP A;  5KFJ A;  1QSS A;  2PFQ A;  4EYH B;  5HRH A;  2Q66 A;  3C2K A;  4YN4 A;  2R8H A;  1WCN A;  2JZB B;  3JPT A;  1T3N A;  2JEG A;  4RQ6 A;  9ICM A;  5HRG A;  3C21 A;  5DQH A;  4B9T A;  4NKU A;  4M9H A;  5DEC A;  1UT8 A;  5HRK A;  4KLL A;  1ZQP A;  2AQ0 A;  5J0R A;  4IRC A;  4DFJ A;  4KLQ A;  3ISD A;  5L1K A;  5DBB A;  4IRD A;  4I2C A;  4DL3 A;  9ICQ A;  3LQC B;  3H8W A;  4KLG A;  2AGO A;  2PFO A;  1S76 D;  3L9D A;  4Z6E A;  2PXI A;  5J0Y A;  4QZC A;  1MIW A;  1U49 A;  2MAX A;  1NK4 A;  4DOB A;  3AU2 A;  3Q8S B;  1U45 A;  1S97 A;  4ELV A;  5C5J A;  2FLP A;  4I29 A;  4DSL A;  4ED0 A;  1NK7 A;  4CCH A;  4DWI A;  3E2E A;  4FBT A;  5TZV A;  2IBK A;  5HNK A;  4QZI A;  5EWE A;  5IIM A;  1LB2 B;  3PO5 A;  1T8E A;  8ICM A;  4M9L A;  4Z6F A;  2VA2 A;  4E7X A;  1ZQR A;  1UA0 A;  2LYH A;  9ICF A;  3HW8 A;  4J9R A;  4PPX A;  4YQW A;  8ICX A;  3WFQ E;  4WC6 A;  5F9L A;  4QWA A;  7ICI A;  4X4Q A;  5KFE A;  4RPX A;  4DSI A;  4B9M A;  4M6W B;  4J9Q A;  2F1I A;  4J9P A;  3ISB A;  3AQL A;  3QE9 Y;  4X4O A;  1Z00 A;  3MBY A;  3V7K A;  3AU6 A;  3RH5 A;  4I2G A;  4IG8 A;  2F1J A;  4RU9 A;  8ICU A;  4RWO A;  4YR2 A;  3ETL A;  4FHP A;  3EPG A;  5J0S A;  4X4S A;  3SV4 A;  4KLE A;  4RQ7 A;  2AGQ A;  1NJX A;  1F5A A;  2ISP A;  2VAN A;  4M5D A;  4UD4 A;  9ICJ A;  2ZUB A;  3C1Z A;  4C8K A;  5KFT A;  3C5G A;  4M04 A;  3ZD9 A;  5KFZ A;  5J0U A;  3RRH A;  5J2F A;  3RB3 A;  1PZN A;  3PNC A;  1ZQB A;  5HHH A;  1ZQY A;  1L3V A;  3PW0 A;  2PFP A;  2XGP A;  3MGH A;  4M9G A;  3ZDD A;  3ZDA A;  4GXJ A;  4WC1 A;  4TUS A;  3NGD A;  3PW7 A;  2ZH1 A;  3UXN A;  5J2A A;  1XU4 A;  2KN7 A;  3PVX A;  4YD1 A;  3SI8 A;  5JUM A;  5KFS A;  1ZQZ A;  2HHQ A;  3OJS A;  4TUQ A;  3KHH A;  2AJQ A;  7ICG A;  1TV9 A;  3RR8 A;  3OHA A;  4NLK A;  4KIT B;  3T5J A;  3MR5 A;  1DK3 A;  4O0I A;  3FDS A;  3HIY A;  1N56 A;  4DS4 A;  1Z3E B;  1COO A;  4IQV A;  4K4G A;  2VA3 A;  1YLQ A;  2DR8 A;  1ZQC A;  5KG3 A;  5KFA A;  5KT4 A;  3EZ5 A;  4E80 A;  3PW2 A;  1MIV A;  4ED7 A;  1KLN A;  5J29 A;  2FPL A;  2W9M A;  4O3N A;  2JEI A;  4RNO A;  1V4A A;  3EW9 A;  5KFX A;  5J2H A;  4F93 B;  8ICS A;  2RDJ A;  3QZ8 A;  3MDC A;  4EZ9 A;  3RBD A;  4DS5 A;  7ICE A;  4DF8 A;  5J2E A;  1U47 A;  2HVI A;  2DRB A;  4RQ4 A;  1ZJN A;  4KLT A;  4XQ7 A;  5HR9 A;  1UEU A;  2RDI A;  5J2G A;  2W9B B;  4F2R A;  1ZQN A;  3T5K A;  4DO9 A;  4EYI B;  2BGW A;  1RXW A;  4ZH4 A;  5EOZ A;  4FHY A;  4XQ8 A;  4F4W A;  1A76 A;  2XGQ A;  3H4B A;  4I2I A;  9ICH A;  2BE3 A;  3V7J A;  3V6K A;  4BDP A;  4QZF A;  2M2U A;  2J6U A;  2DRA A;  4K4I A;  2FMP A;  1HUO A;  5KFN A;  4F5R A;  4IR1 A;  4X4U A;  4FHW A;  2NRT A;  4YMM A;  1ZQS A;  1DOQ A;  3Q8P B;  4MEX A;  4IRK A;  7ICO A;  4O3S A;  3GIK A;  7ICR A;  4FHX A;  1IXR A;  1KFD A;  5KFO A;  4HYK A;  4IQU A;  2ZJ5 A;  4NLN A;  4KTQ A;  3OGU A;  4FO6 A;  3KHL A;  5KFC A;  1JX4 A;  3RAX A;  4J9K A;  4QZB A;  1KDH A;  4R8U B;  5DLF A;  1BNO A;  4UB4 A;  4QWC A;  4KLU A;  4BWJ A;  5DG8 A;  4GC6 A;  4DQP A;  3OV7 A;  3OVB A;  4GXK A;  4EBE A;  3LDA A;  3PX4 A;  4PGY A;  2NRZ A;  4NXZ A;  2XO7 A;  5BPC A;  8ICJ A;  3K75 D;  3M9O B;  5IIK A;  4EBD A;  1TAU A;  2BPC A;  4JK1 A;  4XRH A;  2HHU A;  4RT3 A;  2HHP A;  1ZQX A;  4M9J A;  4Q8F A;  1ZQW A;  2C22 A;  7ICN A;  2M2W A;  3WFS C;  2BQ3 A;  2ZJ8 A;  1KRP A;  1FA0 A;  5HRE A;  1XSN A;  1DK2 A;  5KTQ A;  3PR4 A;  3OHB A;  2BPF A;  1NJZ A;  2Q0Z X;  4F5N A;  3C2M A;  5J2D A;  1XC9 A;  2ALZ A;  1NOM A;  2NRX A;  1U48 A;  2W9A A;  1S0M A;  1K1Q A;  4R63 A;  4ED3 A;  8ICY A;  5J0X A;  1SKS A;  2HW3 A;  4DQI A;  4C8O A;  1R8C A;  1CUK A;  1UET A;  2ZH3 A;  4DSK A;  4QZ9 A;  3PV8 A;  3BDP A;  4AT8 B;  3TAQ A;  2NRW A;  1SZP A;  1TVA A;  4IR9 A;  3G6Y A;  8ICR A;  4WC4 A;  1SL2 A;  2UVR A;  4I2F A;  4UB3 A;  1ZQM A;  4UBC A;  2ZH5 A;  3RJK A;  4C8M A;  3KHG A;  3HJ1 A;  7ICV A;  1ZYQ A;  2JZB A;  5KT5 A;  4JV2 A;  3MFH A;  2WTF A;  4LZD A;  4K4H A;  2R8G A;  3RJH A;  4IQT A;  1ZQG A;  2HHX A;  5BOM A;  3JPP A;  4MFF A;  2R8I A;  4ECT A;  3MR2 A;  1S9F A;  3C66 A;  4ECW A;  3GQC A;  4ED1 A;  3JPN A;  1HJP A;  4MFA A;  3RAQ A;  4YR3 A;  4KLJ A;  1L3S A;  2P6U A;  2ZTC A;  2IA6 A;  4R8U A;  8ICK A;  5J0O A;  2XY5 A;  5KFM A;  2MUT B;  4BXO B;  4DF4 A;  4MF8 A;  3UQ0 A;  3C23 A;  4UBB A;  4F5Q A;  2P6R A;  1NJW A;  4B9N A;  2W8L A;  4WC0 A;  3QZ7 A;  4LVS A;  4QZA A;  1RZT A;  3HT3 A;  2W9C B;  3MR3 A;  4F4Z A;  4UB2 A;  3GV8 B;  2ZH8 A;  4YD2 A;  4ECS A;  2DR5 A;  1ZQJ A;  4RNM A;  3NTU A;  4UAY A;  5CWR A;  4IQW A;  1UEV A;  1RYS A;  2UVV A;  3WFR E;  5IIO A;  5KT2 A;  3TAN A;  5KT3 A;  4WC3 A;  4RQ0 A;  3PX6 A;  3V7L A;  5DQI A;  4RPY A;  5KFQ A;  4UQG A;  9ICI A;  2ISO A;  9ICX A;  1B22 A;  1SL1 A;  1BNP A;  5KG1 A;  5HRF A;  4YMN A;  9ICW A;  1QTM A;  2IHN A;  3BQ1 A;  5DBA A;  5KG4 A;  4ATB A;  4RWN A;  1TAQ A;  3ZDC A;  3GV5 B;  5DG7 A;  2KFN A;  1ZQL A;  4F3O A;  8ICF A;  3B0Y A;  1Q78 A;  4I28 A;  4RQ3 A;  5KFF A;  3EYZ A;  5J0W A;  4KLF A;  1T7P A;  2KTQ A;  3OSN A;  1S77 D;  3UXP A;  2UVU A;  4O5C A;  1SKW A;  4ATB B;  4JUZ A;  4DL2 A;  3HX0 A;  2V4Q A;  2C28 A;  5IIJ A;  3JPR A;  1VFG A;  7ICJ A;  3M8R A;  1WOT A;  2I1Q A;  4QW8 A;  4YXJ A;  4UD5 A;  1KTQ A;  2ZH2 A;  1R8A A;  2FLN A;  2O5A A;  1X2I A;  4QWE A;  2W9B A;  3PMN A;  5KG0 A;  1BPZ A;  1ZQE A;  4X4V A;  3RB6 A;  3TAP A;  2KP7 A;  3GV7 B;  2KZM A;  5F2V O;  4FS1 A;  3PR5 B;  3BJY A;  4MF2 A;  8ICE A;  5DG9 A;  1CEZ A;  2DFL A;  4J9O A;  4UB5 A;  5CR0 A;  1JN3 A;  4DL7 A;  1ZQI A;  4B9S A;  3H38 A;  3HJ4 A;  4ED6 A;  3QEA Z;  4DQQ A;  4MEY A;  1NK5 A;  2J6T A;  3NYB A;  4AT9 A;  3OUY B;  4ED8 A;  4Q44 A;  4F4Y A;  9ICO A;  9ICL A;  2XCP A;  4GLX A;  2BDP A;  2DPJ A;  1ZJM A;  2W9C A;  3RJG A;  4DSE A;  1NJY A;  4O9M A;  4MFC A;  4M9N A;  4RQ5 A;  8ICZ A;  4UAW A;  3H4D A;  3AQK A;  1X9S A;  3TQ1 A;  4E0D A;  1UA1 A;  4JWM A;  4GXI A;  2A1J B;  5KT7 A;  1JQR A;  1V9P A;  2V9W A;  8ICV A;  2M9N A;  4O3Q A;  1BPE A;  5CHG A;  5J0P A;  4PHD A;  4F5O A;  1S10 A;  4B9U A;  3H37 A;  3TAR A;  3RJE A;  3TFR A;  4X4P A;  2ASL A;  4RQ1 A;  5DGA A;  2BCU A;  7ICK A;  2A1J A;  5J2J A;  2ASD A;  1KEJ A;  1ZQF A;  3GIJ A;  2FLL A;  4F8R A;  4O3R A;  4F2S A;  2ATL A;  4KLI A;  9ICB A;  4X0B A;  1K1S A;  1ZET A;  3OVA A;  2NRK A;  4QZG A;  2IMW P;  2BHN A;  4Q43 A;  2ID1 A;  5BOL A;  4ECY A;  4F4K A;  4KLS A;  7ICF A;  5DB9 A;  5KG7 A;  3SZ2 A;  3PML A;  7ICP A;  1VJ7 A;  7ICQ A;  2NRV A;  4QZ8 A;  2JEF A;  2H5X A;  3M9M B;  2AQ4 A;  9ICU A;  1NKC A;  4TUR A;  4O3O A;  2ZH4 A;  2ZUC A;  1RXV A;  2BKE A;  4JV0 A;  7ICU A;  4I2A A;  5HRB A;  4ECX A;  5DQG A;  4QZD A;  3MDA A;  1XSP A;  4JV1 A;  9ICR A;  4AT7 A;  3H39 A;  1EXN A;  5J0Q A;  3GFK B;  3G6X A;  3ZDB A;  1JXL A;  4I2J A;  1ZQQ A;  3RJF A;  4C8L A;  4F5P A;  5J2B A;  1ZQD A; 
#chains in the Genus database with same CATH topology
 3HWT A;  3IG8 A;  3GDX A;  3M6K A;  4KN4 A;  1RPL A;  3N4M B;  3T3F A;  3GZF A;  5DKW A;  3PY8 A;  2W54 A;  1QQ6 A;  1D9D A;  3K1Z A;  2AU0 A;  4Z6C A;  4FS2 A;  4RQ8 A;  1SWV A;  2A19 A;  5KFD A;  5DGB A;  4J9N A;  1ZQV A;  3A0H U;  5HP4 A;  4RZR A;  1SZH A;  1Y88 A;  4KMO B;  4YG2 A;  1KSP A;  5KFY A;  5GTI U;  4QZE A;  5KFH A;  3QEB Z;  4AP9 A;  1NK9 A;  2FPK A;  1NK8 A;  3C2L A;  3JYY A;  1RYU A;  1JAL A;  5J2K A;  4ECR A;  4DL4 A;  5ALJ A;  1SKR A;  5AI5 A;  2ZIW A;  2HSZ A;  2JEJ A;  3KHR A;  4DFD A;  2ZIX B;  3E58 A;  2K4E A;  3LYS A;  4WC5 A;  4O5K A;  5CB1 A;  4EBC A;  2YN4 A;  3IRU A;  1J97 A;  3B0X A;  3Q8Q B;  2KE7 A;  4UB1 A;  3WKD A;  1J2M A;  3N7S C;  3JZ0 A;  2KVS A;  3H0R B;  4RNN A;  3F2B A;  1ZQO A;  5K4L A;  1X9W A;  2RQ5 A;  2BCV A;  3HPO A;  2VJ4 A;  5L9X A;  1L7N A;  5J0T A;  1KFT A;  2XCA A;  3TAC B;  2DKX A;  3RR7 A;  2LBO A;  2XVT A;  4YR0 A;  1KKX A;  1L5U A;  2JH1 A;  4O67 A;  3K4G A;  1KBU A;  4PHE A;  2BDU A;  1XO0 A;  5H2F U;  4X0A A;  1WYG A;  3HKZ C;  3OTQ A;  5CFU A;  2NO4 A;  4R66 A;  2DPI A;  2HCF A;  3WK4 A;  5HR6 A;  3SQI A;  2O6K A;  4XA5 A;  1N5W A;  3CRX A;  4YP3 A;  4C7Z A;  4LEY A;  3C18 A;  5KT6 A;  1TFW A;  2PI5 A;  5DBC A;  2C2D A;  1TK8 A;  4TQS A;  4P4O A;  4PH5 A;  2ZHB A;  2PBE A;  2R8J A;  4DL5 A;  3V6H A;  2Q4T A;  3RJJ A;  1DGS A;  4YMO A;  1O03 A;  2GWS A;  8ICQ A;  5CRX A;  2B51 A;  4Y2T A;  4ELT A;  2DWQ A;  4AT9 B;  3OJU A;  1HEK A;  5AM2 A;  3AQN A;  4OJO A;  4EEL A;  2XY7 A;  2B56 A;  2CPR A;  2KKP A;  1NK0 A;  5AKX A;  1MN8 A;  1IV8 A;  1RQN A;  1PK1 A;  4EED A;  4F91 B;  3KTQ A;  3PW4 A;  2K89 A;  2P66 A;  4J9L A;  1YZ6 A;  3WFO A;  2ASJ A;  5G5G A;  4PZO A;  3E0F A;  1XO1 A;  2B0C A;  2OH2 A;  1C7Y A;  2DR7 A;  4KN7 A;  1PX5 A;  4UW9 A;  4BXO A;  5HRI A;  3I1Y A;  5L1I A;  2H3I A;  4NY8 A;  2HMX A;  2DVI A;  2KV2 A;  4PHP A;  3FYH A;  2NV3 A;  2W7O A;  3MC1 A;  2PFQ A;  2KJ8 A;  2Q66 A;  1AQ6 A;  2JZB B;  3JPT A;  1T3N A;  5DQH A;  4M9H A;  5DEC A;  5HRK A;  3NKU A;  1ZQP A;  3ISD A;  3H8W A;  3L9D A;  3SAH A;  1S76 D;  4Z6E A;  1U49 A;  5C5J A;  1NK7 A;  4CCH A;  4P0Q A;  4FBT A;  2IBK A;  4XJE A;  2WAQ C;  1LB2 B;  3QU4 A;  2VA2 A;  3D6J A;  2LYH A;  8ICX A;  1GO3 F;  3QUT A;  2G07 A;  4RPX A;  3QXG A;  4J9P A;  2F1I A;  3AU6 A;  3MBY A;  2IUB A;  2HBM A;  3EPG A;  3SV4 A;  4RQ7 A;  1NJX A;  1GPJ A;  2VAN A;  4C8K A;  3ZD9 A;  3TKA A;  2PFP A;  3MGH A;  3ZDA A;  4GXJ A;  4WC1 A;  3PW7 A;  2KN7 A;  4YD1 A;  3SI8 A;  5KFS A;  3OJS A;  4TUQ A;  3KHH A;  2EAN A;  3OHA A;  4KIT B;  1OUQ A;  3MR5 A;  1PUZ A;  3FDS A;  3F5A A;  5AIC A;  1Z3E B;  2DR8 A;  3EZ5 A;  3PW2 A;  2MU2 A;  3NWI A;  1ED1 A;  4EX6 A;  1KLN A;  8ICS A;  2RDJ A;  2RHF A;  1UQV A;  2MRL A;  4Y2U A;  4RQ4 A;  1JI7 A;  5T14 A;  3T5K A;  4EYI B;  2K8C B;  5J8Y A;  2G09 A;  4FHY A;  2F44 A;  2KOB A;  9ICH A;  3V6K A;  4JLX A;  5KFN A;  4F5R A;  4IR1 A;  2YB4 A;  4X4U A;  2XIC A;  3KHL A;  1JX4 A;  3PHZ A;  4KLU A;  4GC6 A;  1PK1 B;  1ZD3 A;  3D2Q A;  3OVB A;  4LEW A;  4EBE A;  3WKB A;  3LDA A;  5AM4 A;  4PGY A;  2NRZ A;  4NWI A;  4HX0 A;  3D2S A;  4EEB A;  3K75 D;  3M9O B;  2HHU A;  2HHP A;  4M9J A;  7ICN A;  1ZQW A;  5ALS A;  2YX8 A;  1KRP A;  1DK2 A;  1V38 A;  1NJZ A;  2Q0Z X;  4B6J A;  4F5N A;  2KSO A;  4MKP A;  5JTG A;  1U48 A;  2NRX A;  2ZH3 A;  5ALI A;  4QIW F;  2K8B B;  4JV2 A;  5KT5 A;  2R8G A;  4MFF A;  4ECW A;  3GQC A;  1HJP A;  4KLJ A;  8ICK A;  2P6U A;  4FZM A;  4DF4 A;  1SXD A;  4MF8 A;  3UQ0 A;  2W8L A;  4WC0 A;  1QQ5 A;  2W9C B;  3MR3 A;  4F4Z A;  5AK6 A;  4UB2 A;  2ZH8 A;  3NTU A;  2LYB A;  2UVV A;  2H3Z A;  1BNP A;  9ICX A;  2ISO A;  1SL1 A;  5HRF A;  5KG1 A;  4YMN A;  4DCC A;  3ZDC A;  1Q78 A;  2Y9T A;  1ZQL A;  3B0Y A;  1P7D A;  1O08 A;  1T7P A;  2HOQ A;  2OYY A;  3OSN A;  4NXT A;  1S77 D;  3UXP A;  2JXJ A;  2UVU A;  2ZIU B;  2HN1 A;  4NXW A;  1WOT A;  1N62 A;  1KTQ A;  4AYB F;  4P0Q B;  1X2I A;  4QWE A;  2W9B A;  3PMN A;  1BPZ A;  3RB6 A;  3TAD A;  3GV7 B;  4WJ3 B;  2F8L A;  1L8O A;  4FZL A;  4DL7 A;  2GH1 A;  3ED5 A;  4F4Y A;  2EAP A;  3VC8 A;  3S6J A;  2W9C A;  1ZJM A;  3RJG A;  4DSE A;  1NJY A;  8ICZ A;  4UAW A;  3AQK A;  3TQ1 A;  2F3N A;  4JWM A;  2KIV A;  2A1J B;  1NNL A;  4O3Q A;  2KK0 A;  4F5O A;  3RJE A;  1F5S A;  2ASL A;  4LEV A;  1ZD5 A;  5DGA A;  7ICK A;  2ASD A;  4O3R A;  3ER9 B;  5D63 A;  1ZRM A;  4O6A A;  4QZG A;  2BHN A;  1FIQ A;  7ICF A;  7ICP A;  3SZ2 A;  4QZ8 A;  3M9M B;  1RG6 A;  4WH5 A;  2XI9 A;  7ICU A;  3WK7 A;  1SWW A;  5HRB A;  2K4P A;  3SEN A;  1JXL A;  4B9S A;  5J2B A;  4DQR A;  3KKA C;  4KM5 A;  2KMD A;  4KLH A;  4UAV A;  3Q8K A;  2HBJ A;  4K96 A;  5KFP A;  2KZZ A;  5DB8 A;  2MUT A;  9ICV A;  1BPB A;  5J2I A;  3G6V A;  2KVC A;  3RH4 A;  1KFS A;  1SL0 A;  1JIH A;  4Z6D A;  2HBL A;  3IP4 B;  3RRG A;  1ZQH A;  4RQ2 A;  3U26 A;  1TE2 A;  1NKB A;  1KL9 A;  2EZZ A;  2QB0 A;  3UPS A;  3NVV A;  1NO5 A;  5DDM A;  1Q3V A;  2YB1 A;  4R65 A;  3GIM A;  2HI0 A;  3RH6 A;  4BGD A;  2KFZ A;  5GTH U;  4WOY A;  2HHT A;  4Y2S A;  3TI0 A;  2ZH9 A;  9ICA A;  2W03 A;  1ZQA A;  1URJ A;  3M6Z A;  4QJF B;  3CK6 A;  3OVS A;  4R64 A;  3ZD8 A;  3SV3 A;  2IOH A;  1IM4 A;  4OAH A;  4X4R A;  1OW5 A;  5D4B A;  1L3U A;  2BCR A;  2G06 A;  4PZN A;  8ICH A;  5IIN A;  4RUA A;  2BCS A;  3UM9 A;  4I2B A;  4WC2 A;  2E8P A;  2KG5 A;  1X42 A;  2ZUD A;  3PX0 A;  1LKY B;  5EE3 A;  5EWF A;  1MSW D;  1S0O A;  2XY6 A;  1ZQT A;  3JPS A;  1S5L U;  3MR6 A;  2QLT A;  3BQT A;  2V4R A;  1TKD A;  2UVW A;  8ICP A;  1SV0 A;  1QH9 A;  5ALO A;  3EPI A;  2FMQ A;  2Y1J A;  4I2H A;  3RB0 A;  5HML A;  5KFW A;  4XUS A;  4DQS A;  4F92 B;  2OWO A;  4NLG A;  5KFI A;  4YFK A;  4I0U A;  2C2R A;  4QZH A;  3WK9 A;  1T4G A;  5AI4 A;  4F4X A;  5ALR A;  3C28 A;  3ALR A;  2GLE A;  4FZN A;  5HRL A;  4WC7 A;  4YVZ A;  3AN1 A;  2LI6 A;  3OSP A;  1ZRN A;  9ICT A;  7ICL A;  1ARO P;  3RFA A;  8ICN A;  4J9M A;  1R8B A;  4ELU A;  2HHS A;  3DV9 A;  1Z1B A;  2B21 A;  5KFR A;  4I27 A;  7ICM A;  4OD0 A;  4PGQ A;  4Q8E A;  1KN5 A;  9ICE A;  2DKZ A;  5HMM A;  3ERC C;  4CF3 A;  4NLZ A;  1IG6 A;  2WB1 F;  4QIW C;  4QWD A;  1VDV A;  5AIA A;  1QLN A;  2BCQ A;  5EWG A;  1TFY A;  4DSJ A;  4DL6 A;  2IOF A;  1RYR A;  2W04 A;  2DR9 A;  2WF7 A;  4C4S A;  8ICW A;  1MQ3 A;  3JPQ A;  4ECZ A;  3ER8 C;  3NRZ A;  1TK0 A;  4Y2Q A;  1MQ2 A;  2ES6 A;  5ALZ A;  3N97 B;  3MFI A;  3PW5 A;  4FHV A;  2Y0S C;  2FE9 A;  1QSS A;  4EEN A;  4YN4 A;  2R8H A;  1WCN A;  2JEG A;  2XID A;  1ZQ1 C;  4KLL A;  4NV0 A;  4I2C A;  2AGO A;  2PFO A;  3I76 A;  2PXI A;  5J0Y A;  1MIW A;  2MAX A;  4DOB A;  3Q8S B;  5AKG A;  4DSL A;  4ED0 A;  2G08 A;  3E2E A;  1N61 A;  2JR5 A;  1ZD4 A;  2DGZ A;  5TZV A;  3PO5 A;  4C4T A;  1B4F A;  4M9L A;  4Z6F A;  2YMP A;  3HW8 A;  4PPX A;  4YQW A;  3J81 j;  5F9L A;  2ZXI A;  4QWA A;  4X4Q A;  1C20 A;  4GFJ A;  4J9Q A;  3AQL A;  3QE9 Y;  3V7K A;  2F1J A;  8ICU A;  3C29 A;  3F2C A;  3CP8 A;  1PVP A;  1F5A A;  2E1E A;  4U6P A;  9ICJ A;  4M04 A;  3SAG A;  4CGZ A;  4OO1 J;  1PZN A;  3PNC A;  2KHV A;  5HHH A;  4M9G A;  1UPH A;  3ZDD A;  2QKQ A;  1XU4 A;  1YT3 A;  3PVX A;  5AI6 A;  2W3S A;  1ZQZ A;  2HHQ A;  4OAG A;  2OXO A;  4NLC A;  3T5J A;  3HIY A;  1N56 A;  4K4G A;  4IQV A;  4EGW A;  5KG3 A;  4E80 A;  4ED7 A;  5ALG A;  1V4A A;  3EW9 A;  5J2H A;  4DS5 A;  2DRB A;  5J2E A;  4Y2P A;  1ZJN A;  4IS7 A;  2H3Q A;  2RDI A;  2W9B B;  1ZQN A;  4DO9 A;  2BGW A;  3QUC A;  4XQ8 A;  3H4B A;  1L8L A;  3V7J A;  2LM4 A;  2FMP A;  4Y2J A;  2NRT A;  3BQ7 A;  3BZK A;  3Q8P B;  7ICR A;  4O3S A;  3GIK A;  1KFD A;  4HYK A;  4IQU A;  4NLN A;  2GA9 D;  4K8V A;  2RRD A;  5DLF A;  4QWC A;  2JH7 A;  2RLT A;  4BWJ A;  5DG8 A;  4UAR A;  3OV7 A;  5BPC A;  8ICJ A;  4EBD A;  5IIK A;  3SEI A;  4JK1 A;  5KAF U;  3WFS C;  1XSN A;  5KTQ A;  2R18 A;  3PR4 A;  3OHB A;  2BPF A;  4JLZ A;  5D62 A;  1YZ7 A;  1XC9 A;  1NOM A;  8ICY A;  2HW3 A;  1ZXI A;  4C8O A;  4Y2V A;  1CUK A;  4QZ9 A;  3TAQ A;  2NRW A;  4IR9 A;  3DEE A;  8ICR A;  4OAI Z;  4I2F A;  3OWG A;  1A0P A;  2JZB A;  3MFH A;  2WTF A;  1L7O A;  4IQT A;  2HHX A;  5BOM A;  3JPP A;  2EZX A;  3MR2 A;  3JPN A;  2XY5 A;  5KFM A;  5CFT A;  4F5Q A;  4UBB A;  2NYV A;  3F2D A;  4O3M A;  2QB0 B;  3JCF A;  4ECS A;  4RNM A;  2LM1 A;  5CWR A;  3TAN A;  4WC3 A;  4RQ0 A;  3V7L A;  4P0P B;  4K9B A;  1B22 A;  2IHN A;  2ZIV B;  4ATB A;  4K99 A;  4RWN A;  4RQ3 A;  3EYZ A;  4KLF A;  1SKW A;  4JUZ A;  2V4Q A;  2I1Q A;  4OCZ A;  5ALW A;  2KKV A;  2KNJ A;  4X4V A;  2PKE A;  5F2V O;  4C0Z A;  8ICE A;  2NO5 A;  2QAR A;  4J9O A;  5CR0 A;  3WK8 A;  3HJ4 A;  2VIX A;  3QEA Z;  1ZOL A;  4MEY A;  4DQQ A;  4ED8 A;  1Z19 A;  2JRZ A;  9ICO A;  4US9 A;  1Q3U A;  2DPJ A;  5ALM A;  4NXV A;  4O9M A;  4MFC A;  1VJ5 A;  1UA1 A;  4GXI A;  5KT7 A;  4EEK A;  3QUQ A;  8ICV A;  2M9N A;  5J0P A;  5CEH A;  2BZF A;  3HIL A;  4UB8 U;  4RQ1 A;  2EDU A;  2A1J A;  5J2J A;  4F8R A;  1KEJ A;  1ZQF A;  4F2S A;  2ATL A;  1F0M A;  1ZET A;  3RF9 A;  2K4H A;  3PST A;  4F4K A;  4KLS A;  5KG7 A;  1VJ7 A;  4O68 A;  9ICU A;  2AQ4 A;  1NKC A;  3WK5 A;  2ZH4 A;  4O3O A;  2EZY A;  9ICR A;  3HRD D;  3MDA A;  1XSP A;  4JV1 A;  1EXN A;  5J0Q A;  4I2J A;  3RJF A;  2F8K A;  4C8L A;  3AM9 A;  1PVR A;  1ZQD A;  4RQM A;  2YMM A;  1FEZ A;  4I2E A;  5ALD A;  9ICK A;  5E79 U;  3H8J A;  4BWM A;  1ZQU A;  5TIS U;  3SR6 A;  4NKT A;  3ISC A;  5KFG A;  1MC8 A;  3LK9 A;  1S0V A;  4M2Y A;  5AK3 A;  1N63 A;  2M2T A;  1X9X A;  3UQ2 A;  2HHV A;  2KIW A;  2G0A A;  4C8N A;  3UMG A;  3M8S A;  3HKZ F;  5D49 A;  4PGX A;  9ICG A;  1A77 A;  4RQN A;  4C4R A;  4RUC A;  4FE3 A;  4I2D A;  4WBY A;  3HJE A;  5L1J A;  3BS7 A;  5CJ7 A;  4EZ6 A;  2YML A;  4DFM A;  8ICO A;  3CW2 C;  4X5V A;  5KG6 A;  1X6J A;  5AM0 A;  1TK5 A;  3MGI A;  4FBU A;  4S3N A;  1BGX T;  2GAF D;  1QSL A;  2DF4 B;  2BQU A;  4DFP A;  2W8K A;  1NK6 A;  4M47 A;  1XWL A;  4OJP A;  2KHQ A;  5ALX A;  8ICI A;  4LT6 A;  2K4I A;  4C80 A;  4J9S A;  4WCW A;  3LWM A;  2KZ3 A;  4JWN A;  3H0M B;  4F71 A;  4M6W A;  3GIL A;  1B43 A;  2ODG A;  2RFF A;  2ZTD A;  3N7R C;  3N7P D;  5ALU A;  4KX3 A;  3RBE A;  2FPM A;  4DLG A;  4UAZ A;  7ICT A;  3LVV A;  4KB6 A;  3M7D A;  2LHT A;  4JB3 A;  1HIW A;  3ORY A;  2WF8 A;  4BX9 C;  4NLB A;  4B9L A;  4OAF A;  3IHQ B;  4YXM A;  3DDH A;  4YCX A;  4KLO A;  5AKH A;  1Q79 A;  3RTV A;  2KJ5 A;  2K60 A;  1NI3 A;  5JU5 A;  5IIL A;  2I6X A;  3UMB A;  4DOA A;  3V72 A;  4WQK A;  2ZG6 A;  1BPX A;  5AKE A;  4M0A A;  3NRW A;  4KLD A;  3ETR A;  8ICB A;  3PO4 A;  3BQ2 A;  3V6J A;  4AT8 A;  5F9N A;  4CE6 A;  1TAM A;  4Q45 A;  1S8O A;  4Y2X A;  1SGG A;  9ICP A;  5JTI A;  1SV4 A;  3C5F A;  2XC9 A;  4AT7 B;  1L3T A;  5ALQ A;  3OUY A;  2ZH6 A;  3H8S A;  1MIY A;  5HC9 A;  3PSP A;  3SYZ A;  3NVZ A;  2HOI A;  5D46 A;  1LV5 A;  5CP2 A;  3MAB A;  2QB1 A;  2KJ9 A;  3M1Y A;  4F72 A;  2YMQ A;  3F5E A;  5KFB A;  8ICT A;  3ZDE A;  3L5K A;  3MGV A;  1T3Q A;  2FDR A;  1D8Y A;  2W55 A;  5B3Q A;  3UPQ A;  4LZG A;  2JGA A;  4ED2 A;  1XSL A;  1ZQK A;  1QSY A;  2YY6 A;  3AQF A;  4LEZ A;  3I28 A;  1HUZ A;  3IG5 A;  3AQM A;  1DRG A;  4BJQ A;  5J2C A;  4Y2R A;  5CA7 A;  1JMS A;  1RM6 C;  5ALK A;  4K9A A;  4UAU A;  4A8E A;  1Z00 B;  4GC7 A;  3K7D A;  3QNM A;  1BPY A;  1D9F A;  5KFL A;  5AKJ A;  3AMZ A;  4QW9 A;  5DED A;  4PL1 A;  4E8F A;  2HN2 A;  4EYH B;  5HRH A;  3C2K A;  9ICM A;  2WB1 C;  4RQ6 A;  4B9T A;  4NKU A;  5AM1 A;  9ICQ A;  5L1K A;  5DBB A;  4IRD A;  4DL3 A;  4QZC A;  1LKY A;  3F53 A;  3QU9 A;  4EX7 A;  3AU2 A;  1U45 A;  2G5H B;  4DWI A;  4QZI A;  5HNK A;  2VKQ A;  5EWE A;  2ZIX A;  3CNH A;  8ICM A;  2HBK A;  4OJ5 A;  1ZQR A;  4J9R A;  5EE9 A;  1WUD A;  1RDF A;  4B9M A;  5ALL A;  3ISB A;  1Z00 A;  3RH5 A;  4I2G A;  3AL0 B;  1QQ7 A;  3ETL A;  4X4S A;  1JRP A;  2ISP A;  3EUB 2;  5KFT A;  2LMR A;  3RB3 A;  5J2F A;  1ZQY A;  2XGP A;  4TUS A;  3NGD A;  2ZH1 A;  3UXN A;  1Z4N A;  2AJQ A;  7ICG A;  1TV9 A;  2DL0 A;  4O0I A;  2KIC A;  1COO A;  2OHF A;  1YLQ A;  1ZQC A;  4EV6 A;  2IHO A;  1MIV A;  2JHD A;  5J29 A;  2FPL A;  2WF6 A;  2E3T A;  4K97 A;  4EZ9 A;  3RBD A;  4NL9 C;  5FP0 A;  2Y0S F;  1U47 A;  2ZIW B;  2BBH A;  4KLT A;  4XQ7 A;  5HR9 A;  5J2G A;  4CF4 A;  2W7P A;  3KBB A;  4F4W A;  1A76 A;  3A0B U;  2M0N A;  2BE3 A;  4QZF A;  2M2U A;  2DRA A;  4K4I A;  1HUO A;  2PMZ C;  4YMM A;  3KD3 A;  1DOQ A;  4MEX A;  2E8O A;  5KFO A;  4USA A;  4KTQ A;  3WKC A;  1D8B A;  5KFC A;  3RAX A;  4J9K A;  4QZB A;  2AXT U;  5ALT A;  2PMZ F;  2AH5 A;  4QNL A;  2VJ5 A;  1Q8K A;  4GXK A;  3ICX A;  3PX4 A;  4NXZ A;  1TAU A;  4LJX A;  4XRH A;  4P0P A;  5D61 A;  1FA0 A;  2ZJ8 A;  5HRE A;  1CI4 A;  3KKA A;  3BS5 A;  3C2M A;  2ALZ A;  1S0M A;  5J0X A;  1SKS A;  1V85 A;  2JV3 A;  1UET A;  3O0F A;  2EQY A;  1N60 A;  4DSK A;  3PV8 A;  4AT8 B;  1SZP A;  4WC4 A;  1SL2 A;  2ZH5 A;  3RJK A;  7ICV A;  3NVW A;  4NXU A;  4G9B A;  4LZD A;  1N2X A;  3FM9 A;  2H3F A;  2WF5 A;  4ECT A;  5L1M A;  1S9F A;  3B9J A;  2QAR B;  4GIB A;  4ED1 A;  4MFA A;  3RAQ A;  1L3S A;  2ZTC A;  3H0L B;  2IA6 A;  2AHO B;  1X66 A;  2HOF A;  2A1A A;  2MUT B;  2LYA A;  3C23 A;  2P6R A;  3QX7 A;  1NJW A;  3QZ7 A;  1RZT A;  3KZI U;  3HT3 A;  1ZQJ A;  1WWU A;  4IQW A;  2KEY A;  2WFA A;  5KT2 A;  5KT3 A;  2W11 A;  4FFD A;  5DQI A;  4RPY A;  5KFQ A;  4UQG A;  9ICW A;  1QTM A;  5DBA A;  5KG4 A;  1TAQ A;  4PJ0 U;  3GV5 B;  2EH9 A;  2E8N A;  5J0W A;  1PVQ A;  2G5I B;  4O5C A;  2ZIV A;  4ATB B;  4DL2 A;  3HX0 A;  5IIJ A;  1VFG A;  5ALN A;  4QW8 A;  1JUD A;  2ZH2 A;  1R8A A;  5C0Y A;  1ZQE A;  1L6N A;  4FS1 A;  3PR5 B;  2EAM A;  4MF2 A;  1DGJ A;  1CEZ A;  3ONN A;  2DFL A;  1KW4 A;  4UB5 A;  1JN3 A;  4ED6 A;  1NK5 A;  9ICL A;  2XCP A;  2BDP A;  4IL6 U;  2I5H A;  4NJ8 A;  4M9N A;  1UHU A;  1X9S A;  4E0D A;  1S10 A;  2P35 A;  3TAR A;  3TFR A;  4X4P A;  2ESE A;  2Y9U A;  4KX5 A;  2FLL A;  2B6G A;  4KLI A;  9ICB A;  4X0B A;  1K1S A;  3H8M A;  1Q46 A;  4Q43 A;  5DB9 A;  3PML A;  2DR5 A;  7ICQ A;  3WK6 A;  2HDO A;  4TUR A;  2ZUC A;  1RXV A;  2BKE A;  1X6I A;  4ZOH C;  4ECX A;  4QZD A;  3BS5 B;  5AI0 A;  4AT7 A;  3H39 A;  1V97 A;  2E5S A;  1ZQQ A;  1Z4O A;  2D6F C;  4F5P A;  9ICN A;  4X4N A;  2MSN A;  3WKA A;  2J6S A;  4KLM A;  5KG5 A;  2GO7 A;  2PI4 A;  2ZTE A;  1IIP A;  8ICC A;  2FMS A;  8ICA A;  1NZP A;  3KZX A;  2BQR A;  1PK3 A;  1BVS A;  4EBK A;  5KFV A;  5EE1 A;  3AUO A;  2I9G A;  2C2E A;  2M2V A;  4CRX A;  2ZH7 A;  5HHI A;  1KQQ A;  4DEZ A;  4ECU A;  2AGP A;  1OU5 A;  3TFS A;  4RT2 A;  4ICA A;  4DOC A;  2F76 X;  5ALF A;  3TAD C;  2BPG A;  1VLB A;  4NM2 A;  3RJI A;  4FH5 A;  3H3A A;  2ZJA A;  3NUQ A;  3C1Y A;  3GU3 A;  3LWL A;  4P4M A;  4G3I A;  7ICH A;  2EWR A;  5KFU A;  8ICG A;  4DSF A;  9ICS A;  8ICL A;  1U9L A;  2R8K A;  2O1P A;  3D2N A;  5AHX A;  5F3X B;  4DLE A;  3THV A;  1WCL A;  2FI1 A;  5DB7 A;  4WBZ A;  5KFK A;  3H7I A;  1J2N A;  2CRX A;  4ECQ A;  4P4P A;  2HVH A;  3IV6 A;  1BPD A;  3NVO A;  1UCV A;  2EAO A;  5CHE A;  5CFS A;  3LVW A;  4DFK A;  4O5E A;  4AYB C;  5AI9 A;  2BR0 A;  1NKE A;  4WQL A;  1COK A;  1XS9 D;  2F2A B;  3ZI4 A;  3WFP A;  1D8L A;  1CRX A;  1Z1V A;  2HHW A;  1L7M A;  1X40 A;  3Q8M A;  2F1H A;  2DUY A;  3AQE A;  4B9V A;  5ALY A;  4ECV A;  3T5L A;  4TQR A;  3HP6 A;  3H40 A;  2W3R A;  3Q8R B;  4US8 A;  4QWB A;  7ICS A;  2IOF K;  1UT5 A;  2E8M A;  1S0N A;  3MCR A;  4EBJ A;  5JRT A;  5DLG A;  3Q8L A;  3UXO A;  5EE0 A;  1SV0 C;  1TFR A;  1KNY A;  1N48 A;  2Y1I A;  4FH3 A;  3BQ0 A;  3M9N B;  1B0X A;  4ACO A;  5KG2 A;  4C7Y A;  3GII A;  5AKY A;  1K5O A;  3RB4 A;  2B4V A;  3CYM A;  4O3P A;  4X4T A;  4KMU A;  4EEY A;  4P2H A;  5DB6 A;  2ZHA A;  2E1F A;  3PZP A;  4CNQ A;  1H38 A;  4K98 A;  4EP7 A;  3BZC A;  1L7P A;  5AKZ A;  1U4B A;  3OPX A;  5AIB A;  4RPZ A;  4PHA A;  4TUP A;  2L5Y A;  1JRO A;  3EWA A;  1R89 A;  5KNI A;  2ZIU A;  4NM1 A;  2YTU A;  4U7C A;  1JXE A;  4F50 A;  5HRD A;  2YQE A;  5III A;  2OM6 A;  3IM1 A;  1X9M A;  2IHM A;  1JAJ A;  1M6Y A;  3JPO A;  5AI8 A;  2PFN A;  3T5H A;  3NAS A;  3QYP A;  4RWQ A;  2VA8 A;  5L1L A;  9ICC A;  1QCK A;  5DDY A;  5J8Y C;  5KFJ A;  5AK5 A;  4RWP A;  5HRG A;  5ALH A;  3C21 A;  1UT8 A;  5AKK A;  5HR7 A;  2DQN B;  2AQ0 A;  5J0R A;  4IRC A;  4DFJ A;  4KLQ A;  3LQC B;  4MHV A;  4KLG A;  2F77 X;  3FAH A;  4JMU A;  1NK4 A;  4O69 A;  2ZXH A;  1S97 A;  4ELV A;  1A6S A;  3QUB A;  2FLP A;  4I29 A;  4BUG A;  5IIM A;  3N28 A;  1T8E A;  5B3P A;  4E7X A;  1UA0 A;  3NVY A;  9ICF A;  3WFQ E;  3WKE A;  3KOO A;  4WC6 A;  7ICI A;  5KFE A;  4DSI A;  4M6W B;  4UB6 U;  4X4O A;  2RP5 A;  3R9K A;  3FC4 A;  4IG8 A;  4RU9 A;  4RWO A;  3NS1 A;  4YR2 A;  4FHP A;  5J0S A;  2A3V A;  4KLE A;  2OEH A;  2AGQ A;  4M5D A;  4UD4 A;  2ZUB A;  3C1Z A;  3C5G A;  5J0U A;  5KFZ A;  3RRH A;  1ZQB A;  1L3V A;  3PW0 A;  3L4P A;  1ZD2 P;  2MA1 A;  2LPE A;  5J2A A;  2WAQ F;  5JUM A;  3RR8 A;  4NLK A;  4UAS A;  4NXX A;  1DK3 A;  5KL8 B;  4J03 A;  4DS4 A;  2VA3 A;  5KFA A;  5KT4 A;  3SD7 A;  2LKY A;  2W9M A;  4O3N A;  2JEI A;  3IN5 A;  4RNO A;  5KFX A;  2K8A A;  4F93 B;  1LVH A;  2OCE A;  2Z7J A;  3QZ8 A;  5KAI U;  3MDC A;  5G5H A;  7ICE A;  4DF8 A;  1FFU A;  2HVI A;  1XNS A;  1UEU A;  4F2R A;  1RXW A;  4ZH4 A;  2FJ6 A;  5EOZ A;  2XGQ A;  4I2I A;  3L3F X;  4UAT A;  4BDP A;  2J6U A;  4Y2Y A;  4FHW A;  1ZQS A;  3UMC A;  1OXJ A;  4IRK A;  7ICO A;  4FHX A;  1IXR A;  3WU2 U;  2ZJ5 A;  3OGU A;  4FO6 A;  4CDG A;  3QU2 A;  1SIJ A;  3SMV A;  1KDH A;  4R8U B;  1BNO A;  4UB4 A;  4DQP A;  3PSF A;  2N1R A;  2XO7 A;  4PL2 A;  4OJ6 A;  2BPC A;  4RT3 A;  4OJL A;  1ZQX A;  3QU5 A;  4Q8F A;  2C22 A;  2M2W A;  2D3D A;  3IDW A;  5B66 U;  2BQ3 A;  2BBJ A;  1T94 A;  2KD1 A;  5J2D A;  2W9A A;  1K1Q A;  4R63 A;  4ED3 A;  4FO1 A;  4DQI A;  1R8C A;  4NL9 A;  5AK4 A;  1DXS A;  3BDP A;  5ALP A;  1TVA A;  3G6Y A;  1WG8 A;  2UVR A;  3QU7 A;  4UB3 A;  1ZQM A;  4UBC A;  4C8M A;  3KHG A;  3HJ1 A;  1ZYQ A;  1RQL A;  2WF9 A;  4K4H A;  3RJH A;  1ZQG A;  2R8I A;  2DBY A;  3KFU F;  2H3V A;  3C66 A;  4YR3 A;  1NZB A;  4R8U A;  2W43 A;  5J0O A;  3K1R B;  4BXO B;  5AKI A;  4B9N A;  4LVS A;  4QZA A;  1SB3 C;  3GV8 B;  4YD2 A;  2GOL A;  4UAY A;  1N5X A;  1UEV A;  3WFR E;  1RYS A;  2CXY A;  5IIO A;  3PX6 A;  4N7R A;  9ICI A;  1MA7 A;  3PSI A;  3BQ1 A;  3EF2 A;  5DG7 A;  2KFN A;  4F3O A;  8ICF A;  4I28 A;  5KFF A;  2KTQ A;  5KL1 B;  2C28 A;  3JPR A;  7ICJ A;  4CF5 A;  3M8R A;  2CN1 A;  4YXJ A;  5B5E U;  4UD5 A;  2FLN A;  2O5A A;  5ALE A;  5KG0 A;  3TAP A;  2KP7 A;  1ECW A;  2KZM A;  2FCL A;  3BJY A;  5DG9 A;  1F44 A;  4HAI A;  1ZQI A;  3H38 A;  1FFV A;  2JMG A;  5AKL A;  3NYB A;  2J6T A;  4AT9 A;  2WHE A;  3OUY B;  4Q44 A;  2D8C A;  5AM5 A;  4GLX A;  5A0L A;  4RQ5 A;  3H4D A;  1JQR A;  1V9P A;  2V9W A;  3T79 A;  1BPE A;  5CHG A;  4PHD A;  4B9U A;  3H37 A;  1FO4 A;  1SXE A;  4IC9 A;  2BCU A;  3GIJ A;  3OVA A;  2NRK A;  3AEV A;  2IMW P;  3SAF A;  2ID1 A;  5BOL A;  4ECY A;  2NRV A;  2JEF A;  2H5X A;  4JV0 A;  4I2A A;  5AM3 A;  5DQG A;  2KSO B;  3GFK B;  3G6X A;  3ZDB A;  3VCB A;  1WWV A;  5ALV A; 
#chains in the Genus database with same CATH homology
 3HWT A;  4DQR A;  4I2E A;  9ICN A;  9ICK A;  4X4N A;  3H8J A;  4BWM A;  1ZQU A;  4KLH A;  3GDX A;  2J6S A;  4KN4 A;  4NKT A;  4KLM A;  1RPL A;  5KG5 A;  3ISC A;  5KFG A;  1MC8 A;  3LK9 A;  3N4M B;  3T3F A;  2PI4 A;  5DKW A;  3PY8 A;  4M2Y A;  1S0V A;  2ZTE A;  3Q8K A;  8ICC A;  2M2T A;  5KFP A;  3UQ2 A;  2FMS A;  2HHV A;  8ICA A;  2KZZ A;  1NZP A;  5DB8 A;  2MUT A;  2BQR A;  1D9D A;  2AU0 A;  4Z6C A;  1BPB A;  4FS2 A;  1BVS A;  5J2I A;  4RQ8 A;  3G6V A;  9ICV A;  3RH4 A;  5KFV A;  1SL0 A;  1JIH A;  4Z6D A;  1KFS A;  3AUO A;  2I9G A;  5KFD A;  2C2E A;  4C8N A;  5DGB A;  2M2V A;  4J9N A;  2ZH7 A;  3M8S A;  5HHI A;  1ZQV A;  5HP4 A;  5D49 A;  1ZQH A;  3RRG A;  4RZR A;  4DEZ A;  4RQ2 A;  4PGX A;  4ECU A;  4YG2 A;  1Y88 A;  2AGP A;  9ICG A;  1A77 A;  4RUC A;  1NKB A;  1KSP A;  4I2D A;  1OU5 A;  5KFY A;  3TFS A;  4WBY A;  4RT2 A;  5L1J A;  4DOC A;  4QZE A;  5KFH A;  3QEB Z;  5CJ7 A;  1NK9 A;  2FPK A;  1NK8 A;  3C2L A;  3JYY A;  3UPS A;  2BPG A;  4EZ6 A;  5J2K A;  4ECR A;  4DL4 A;  4DFM A;  1SKR A;  4NM2 A;  8ICO A;  3RJI A;  1NO5 A;  2JEJ A;  5DDM A;  4FH5 A;  3KHR A;  4R65 A;  4X5V A;  5KG6 A;  3H3A A;  3GIM A;  1TK5 A;  3MGI A;  4WC5 A;  4FBU A;  4O5K A;  1BGX T;  2ZJA A;  5CB1 A;  4S3N A;  3RH6 A;  4BGD A;  1QSL A;  2KFZ A;  3C1Y A;  3LWL A;  4P4M A;  4EBC A;  4G3I A;  3B0X A;  7ICH A;  2BQU A;  2HHT A;  3Q8Q B;  4DFP A;  2W8K A;  1NK6 A;  4M47 A;  1XWL A;  5KFU A;  3TI0 A;  8ICG A;  8ICI A;  2ZH9 A;  9ICA A;  4DSF A;  4LT6 A;  4UB1 A;  9ICS A;  3JZ0 A;  4J9S A;  1ZQA A;  8ICL A;  1U9L A;  2R8K A;  2O1P A;  4WCW A;  3LWM A;  3THV A;  4DLE A;  2KZ3 A;  4JWN A;  1WCL A;  4M6W A;  4RNN A;  1ZQO A;  5DB7 A;  3GIL A;  4WBZ A;  5KFK A;  1X9W A;  3H7I A;  1B43 A;  2BCV A;  3HPO A;  2RFF A;  2ZTD A;  5L9X A;  3OVS A;  4R64 A;  4ECQ A;  3ZD8 A;  5J0T A;  4P4P A;  2HVH A;  3SV3 A;  1KFT A;  3RBE A;  2XCA A;  1BPD A;  1IM4 A;  2FPM A;  4UAZ A;  4DLG A;  7ICT A;  4X4R A;  1L3U A;  5D4B A;  2BCR A;  3ORY A;  4DFK A;  4O5E A;  8ICH A;  5IIN A;  4RUA A;  3RR7 A;  2BCS A;  2BR0 A;  4YR0 A;  1NKE A;  4I2B A;  4WC2 A;  1XS9 D;  1L5U A;  2ZUD A;  3WFP A;  3PX0 A;  1D8L A;  4B9L A;  3K4G A;  3IHQ B;  5EWF A;  4YXM A;  4PHE A;  2HHW A;  1MSW D;  3Q8M A;  1S0O A;  4X0A A;  2F1H A;  2XY6 A;  4YCX A;  1ZQT A;  4KLO A;  1Q79 A;  3RTV A;  3JPS A;  3MR6 A;  4B9V A;  4R66 A;  2DPI A;  5IIL A;  3BQT A;  4ECV A;  2V4R A;  4DOA A;  1TKD A;  3V72 A;  2UVW A;  8ICP A;  3T5L A;  4TQR A;  3HP6 A;  3EPI A;  2FMQ A;  4XA5 A;  2Y1J A;  1BPX A;  4I2H A;  3RB0 A;  4M0A A;  4KLD A;  4YP3 A;  8ICB A;  3H40 A;  5HML A;  5KFW A;  4XUS A;  3BQ2 A;  4DQS A;  4F92 B;  3PO4 A;  3V6J A;  4AT8 A;  3C18 A;  5F9N A;  5KT6 A;  3Q8R B;  2OWO A;  4NLG A;  5KFI A;  4QWB A;  4Q45 A;  1TFW A;  7ICS A;  2PI5 A;  5DBC A;  4YFK A;  9ICP A;  2C2D A;  1UT5 A;  2C2R A;  1TK8 A;  4TQS A;  4QZH A;  1S0N A;  1T4G A;  4EBJ A;  4F4X A;  5DLG A;  3Q8L A;  4P4O A;  3C5F A;  3UXO A;  4PH5 A;  2XC9 A;  4AT7 B;  2ZHB A;  1L3T A;  2PBE A;  1TFR A;  2R8J A;  1KNY A;  4DL5 A;  1N48 A;  5HRL A;  4WC7 A;  3OUY A;  3H8S A;  1MIY A;  4YVZ A;  2ZH6 A;  2Y1I A;  5HC9 A;  4FH3 A;  3SYZ A;  3BQ0 A;  3V6H A;  3OSP A;  3RJJ A;  5D46 A;  3M9N B;  5KG2 A;  1LV5 A;  5CP2 A;  1DGS A;  4EBK A;  3MAB A;  9ICT A;  3GII A;  4YMO A;  7ICL A;  1ARO P;  2GWS A;  3RB4 A;  8ICQ A;  8ICN A;  4O3P A;  5KFB A;  4J9M A;  8ICT A;  1R8B A;  3ZDE A;  4ELU A;  4X4T A;  4KMU A;  2HHS A;  4ELT A;  4EEY A;  4P2H A;  4AT9 B;  5DB6 A;  2B21 A;  5KFR A;  3OJU A;  4I27 A;  7ICM A;  2ZHA A;  4PGQ A;  4Q8E A;  3AQN A;  2XY7 A;  1D8Y A;  9ICE A;  1NK0 A;  1H38 A;  3UPQ A;  4EP7 A;  5HMM A;  4LZG A;  4ED2 A;  1ZQK A;  1XSL A;  1QSY A;  4NLZ A;  4F91 B;  3KTQ A;  1U4B A;  3PW4 A;  1HUZ A;  4RPZ A;  4QWD A;  3AQM A;  2P66 A;  4PHA A;  4TUP A;  5J2C A;  4J9L A;  1QLN A;  3EWA A;  1R89 A;  2BCQ A;  5CA7 A;  5EWG A;  1JMS A;  2ASJ A;  3WFO A;  1TFY A;  4NM1 A;  4F50 A;  4DSJ A;  1JXE A;  1XO1 A;  4DL6 A;  5HRD A;  5III A;  1RYR A;  3IM1 A;  1C7Y A;  2DR7 A;  1X9M A;  2DR9 A;  4KN7 A;  2IHM A;  1JAJ A;  1PX5 A;  1Z00 B;  4GC7 A;  3JPO A;  4BXO A;  5HRI A;  1BPY A;  5L1I A;  8ICW A;  1MQ3 A;  4NY8 A;  3JPQ A;  4ECZ A;  1D9F A;  2PFN A;  2DVI A;  3T5H A;  4PHP A;  5KFL A;  4RWQ A;  1TK0 A;  4QW9 A;  5DED A;  2VA8 A;  4E8F A;  5L1L A;  9ICC A;  5DDY A;  1MQ2 A;  3N97 B;  3FYH A;  3MFI A;  3PW5 A;  4FHV A;  4RWP A;  5KFJ A;  1QSS A;  2PFQ A;  4EYH B;  5HRH A;  2Q66 A;  3C2K A;  4YN4 A;  2R8H A;  1WCN A;  2JZB B;  3JPT A;  1T3N A;  2JEG A;  4RQ6 A;  9ICM A;  5HRG A;  3C21 A;  5DQH A;  4B9T A;  4NKU A;  4M9H A;  5DEC A;  1UT8 A;  5HRK A;  4KLL A;  1ZQP A;  2AQ0 A;  5J0R A;  4IRC A;  4DFJ A;  4KLQ A;  3ISD A;  5L1K A;  5DBB A;  4IRD A;  4I2C A;  4DL3 A;  9ICQ A;  3LQC B;  3H8W A;  4KLG A;  2AGO A;  2PFO A;  1S76 D;  3L9D A;  4Z6E A;  2PXI A;  5J0Y A;  4QZC A;  1MIW A;  1U49 A;  2MAX A;  1NK4 A;  4DOB A;  3AU2 A;  3Q8S B;  1U45 A;  1S97 A;  4ELV A;  5C5J A;  2FLP A;  4I29 A;  4DSL A;  4ED0 A;  1NK7 A;  4CCH A;  4DWI A;  3E2E A;  4FBT A;  5TZV A;  2IBK A;  5HNK A;  4QZI A;  5EWE A;  5IIM A;  1LB2 B;  3PO5 A;  1T8E A;  8ICM A;  4M9L A;  4Z6F A;  2VA2 A;  4E7X A;  1ZQR A;  1UA0 A;  2LYH A;  9ICF A;  3HW8 A;  4J9R A;  4PPX A;  4YQW A;  8ICX A;  3WFQ E;  4WC6 A;  5F9L A;  4QWA A;  7ICI A;  4X4Q A;  5KFE A;  4RPX A;  4DSI A;  4B9M A;  4M6W B;  4J9Q A;  2F1I A;  4J9P A;  3ISB A;  3AQL A;  3QE9 Y;  4X4O A;  1Z00 A;  3MBY A;  3V7K A;  3AU6 A;  3RH5 A;  4I2G A;  4IG8 A;  2F1J A;  4RU9 A;  8ICU A;  4RWO A;  4YR2 A;  3ETL A;  4FHP A;  3EPG A;  5J0S A;  4X4S A;  3SV4 A;  4KLE A;  4RQ7 A;  2AGQ A;  1NJX A;  1F5A A;  2ISP A;  2VAN A;  4M5D A;  4UD4 A;  9ICJ A;  2ZUB A;  3C1Z A;  4C8K A;  5KFT A;  3C5G A;  4M04 A;  3ZD9 A;  5KFZ A;  5J0U A;  3RRH A;  5J2F A;  3RB3 A;  1PZN A;  3PNC A;  1ZQB A;  5HHH A;  1ZQY A;  1L3V A;  3PW0 A;  2PFP A;  2XGP A;  3MGH A;  4M9G A;  3ZDD A;  3ZDA A;  4GXJ A;  4WC1 A;  4TUS A;  3NGD A;  3PW7 A;  2ZH1 A;  3UXN A;  5J2A A;  1XU4 A;  2KN7 A;  3PVX A;  4YD1 A;  3SI8 A;  5JUM A;  5KFS A;  1ZQZ A;  2HHQ A;  3OJS A;  4TUQ A;  3KHH A;  2AJQ A;  7ICG A;  1TV9 A;  3RR8 A;  3OHA A;  4NLK A;  4KIT B;  3T5J A;  3MR5 A;  1DK3 A;  4O0I A;  3FDS A;  3HIY A;  1N56 A;  4DS4 A;  1Z3E B;  1COO A;  4IQV A;  4K4G A;  2VA3 A;  1YLQ A;  2DR8 A;  1ZQC A;  5KG3 A;  5KFA A;  5KT4 A;  3EZ5 A;  4E80 A;  3PW2 A;  1MIV A;  4ED7 A;  1KLN A;  5J29 A;  2FPL A;  2W9M A;  4O3N A;  2JEI A;  4RNO A;  1V4A A;  3EW9 A;  5KFX A;  5J2H A;  4F93 B;  8ICS A;  2RDJ A;  3QZ8 A;  3MDC A;  4EZ9 A;  3RBD A;  4DS5 A;  7ICE A;  4DF8 A;  5J2E A;  1U47 A;  2HVI A;  2DRB A;  4RQ4 A;  1ZJN A;  4KLT A;  4XQ7 A;  5HR9 A;  1UEU A;  2RDI A;  5J2G A;  2W9B B;  4F2R A;  1ZQN A;  3T5K A;  4DO9 A;  4EYI B;  2BGW A;  1RXW A;  4ZH4 A;  5EOZ A;  4FHY A;  4XQ8 A;  4F4W A;  1A76 A;  2XGQ A;  3H4B A;  4I2I A;  9ICH A;  2BE3 A;  3V7J A;  3V6K A;  4BDP A;  4QZF A;  2M2U A;  2J6U A;  2DRA A;  4K4I A;  2FMP A;  1HUO A;  5KFN A;  4F5R A;  4IR1 A;  4X4U A;  4FHW A;  2NRT A;  4YMM A;  1ZQS A;  1DOQ A;  3Q8P B;  4MEX A;  4IRK A;  7ICO A;  4O3S A;  3GIK A;  7ICR A;  4FHX A;  1IXR A;  1KFD A;  5KFO A;  4HYK A;  4IQU A;  2ZJ5 A;  4NLN A;  4KTQ A;  3OGU A;  4FO6 A;  3KHL A;  5KFC A;  1JX4 A;  3RAX A;  4J9K A;  4QZB A;  1KDH A;  4R8U B;  5DLF A;  1BNO A;  4UB4 A;  4QWC A;  4KLU A;  4BWJ A;  5DG8 A;  4GC6 A;  4DQP A;  3OV7 A;  3OVB A;  4GXK A;  4EBE A;  3LDA A;  3PX4 A;  4PGY A;  2NRZ A;  4NXZ A;  2XO7 A;  5BPC A;  8ICJ A;  3K75 D;  3M9O B;  5IIK A;  4EBD A;  1TAU A;  2BPC A;  4JK1 A;  4XRH A;  2HHU A;  4RT3 A;  2HHP A;  1ZQX A;  4M9J A;  4Q8F A;  1ZQW A;  2C22 A;  7ICN A;  2M2W A;  3WFS C;  2BQ3 A;  2ZJ8 A;  1KRP A;  1FA0 A;  5HRE A;  1XSN A;  1DK2 A;  5KTQ A;  3PR4 A;  3OHB A;  2BPF A;  1NJZ A;  2Q0Z X;  4F5N A;  3C2M A;  5J2D A;  1XC9 A;  2ALZ A;  1NOM A;  2NRX A;  1U48 A;  2W9A A;  1S0M A;  1K1Q A;  4R63 A;  4ED3 A;  8ICY A;  5J0X A;  1SKS A;  2HW3 A;  4DQI A;  4C8O A;  1R8C A;  1CUK A;  1UET A;  2ZH3 A;  4DSK A;  4QZ9 A;  3PV8 A;  3BDP A;  4AT8 B;  3TAQ A;  2NRW A;  1SZP A;  1TVA A;  4IR9 A;  3G6Y A;  8ICR A;  4WC4 A;  1SL2 A;  2UVR A;  4I2F A;  4UB3 A;  1ZQM A;  4UBC A;  2ZH5 A;  3RJK A;  4C8M A;  3KHG A;  3HJ1 A;  7ICV A;  1ZYQ A;  2JZB A;  5KT5 A;  4JV2 A;  3MFH A;  2WTF A;  4LZD A;  4K4H A;  2R8G A;  3RJH A;  4IQT A;  1ZQG A;  2HHX A;  5BOM A;  3JPP A;  4MFF A;  2R8I A;  4ECT A;  3MR2 A;  1S9F A;  3C66 A;  4ECW A;  3GQC A;  4ED1 A;  3JPN A;  1HJP A;  4MFA A;  3RAQ A;  4YR3 A;  4KLJ A;  1L3S A;  2P6U A;  2ZTC A;  2IA6 A;  4R8U A;  8ICK A;  5J0O A;  2XY5 A;  5KFM A;  2MUT B;  4BXO B;  4DF4 A;  4MF8 A;  3UQ0 A;  3C23 A;  4UBB A;  4F5Q A;  2P6R A;  1NJW A;  4B9N A;  2W8L A;  4WC0 A;  3QZ7 A;  4LVS A;  4QZA A;  1RZT A;  3HT3 A;  2W9C B;  3MR3 A;  4F4Z A;  4UB2 A;  3GV8 B;  2ZH8 A;  4YD2 A;  4ECS A;  2DR5 A;  1ZQJ A;  4RNM A;  3NTU A;  4UAY A;  5CWR A;  4IQW A;  1UEV A;  1RYS A;  2UVV A;  3WFR E;  5IIO A;  5KT2 A;  3TAN A;  5KT3 A;  4WC3 A;  4RQ0 A;  3PX6 A;  3V7L A;  5DQI A;  4RPY A;  5KFQ A;  4UQG A;  9ICI A;  2ISO A;  9ICX A;  1B22 A;  1SL1 A;  1BNP A;  5KG1 A;  5HRF A;  4YMN A;  9ICW A;  1QTM A;  2IHN A;  3BQ1 A;  5DBA A;  5KG4 A;  4ATB A;  4RWN A;  1TAQ A;  3ZDC A;  3GV5 B;  5DG7 A;  2KFN A;  1ZQL A;  4F3O A;  8ICF A;  3B0Y A;  1Q78 A;  4I28 A;  4RQ3 A;  5KFF A;  3EYZ A;  5J0W A;  4KLF A;  1T7P A;  2KTQ A;  3OSN A;  1S77 D;  3UXP A;  2UVU A;  4O5C A;  1SKW A;  4ATB B;  4JUZ A;  4DL2 A;  3HX0 A;  2V4Q A;  2C28 A;  5IIJ A;  3JPR A;  1VFG A;  7ICJ A;  3M8R A;  1WOT A;  2I1Q A;  4QW8 A;  4YXJ A;  4UD5 A;  1KTQ A;  2ZH2 A;  1R8A A;  2FLN A;  2O5A A;  1X2I A;  4QWE A;  2W9B A;  3PMN A;  5KG0 A;  1BPZ A;  1ZQE A;  4X4V A;  3RB6 A;  3TAP A;  2KP7 A;  3GV7 B;  2KZM A;  5F2V O;  4FS1 A;  3PR5 B;  3BJY A;  4MF2 A;  8ICE A;  5DG9 A;  1CEZ A;  2DFL A;  4J9O A;  4UB5 A;  5CR0 A;  1JN3 A;  4DL7 A;  1ZQI A;  4B9S A;  3H38 A;  3HJ4 A;  4ED6 A;  3QEA Z;  4DQQ A;  4MEY A;  1NK5 A;  2J6T A;  3NYB A;  4AT9 A;  3OUY B;  4ED8 A;  4Q44 A;  4F4Y A;  9ICO A;  9ICL A;  2XCP A;  4GLX A;  2BDP A;  2DPJ A;  1ZJM A;  2W9C A;  3RJG A;  4DSE A;  1NJY A;  4O9M A;  4MFC A;  4M9N A;  4RQ5 A;  8ICZ A;  4UAW A;  3H4D A;  3AQK A;  1X9S A;  3TQ1 A;  4E0D A;  1UA1 A;  4JWM A;  4GXI A;  2A1J B;  5KT7 A;  1JQR A;  1V9P A;  2V9W A;  8ICV A;  2M9N A;  4O3Q A;  1BPE A;  5CHG A;  5J0P A;  4PHD A;  4F5O A;  1S10 A;  4B9U A;  3H37 A;  3TAR A;  3RJE A;  3TFR A;  4X4P A;  2ASL A;  4RQ1 A;  5DGA A;  2BCU A;  7ICK A;  2A1J A;  5J2J A;  2ASD A;  1KEJ A;  1ZQF A;  3GIJ A;  2FLL A;  4F8R A;  4O3R A;  4F2S A;  2ATL A;  4KLI A;  9ICB A;  4X0B A;  1K1S A;  1ZET A;  3OVA A;  2NRK A;  4QZG A;  2IMW P;  2BHN A;  4Q43 A;  2ID1 A;  5BOL A;  4ECY A;  4F4K A;  4KLS A;  7ICF A;  5DB9 A;  5KG7 A;  3SZ2 A;  3PML A;  7ICP A;  1VJ7 A;  7ICQ A;  2NRV A;  4QZ8 A;  2JEF A;  2H5X A;  3M9M B;  2AQ4 A;  9ICU A;  1NKC A;  4TUR A;  4O3O A;  2ZH4 A;  2ZUC A;  1RXV A;  2BKE A;  4JV0 A;  7ICU A;  4I2A A;  5HRB A;  4ECX A;  5DQG A;  4QZD A;  3MDA A;  1XSP A;  4JV1 A;  9ICR A;  4AT7 A;  3H39 A;  1EXN A;  5J0Q A;  3GFK B;  3G6X A;  3ZDB A;  1JXL A;  4I2J A;  1ZQQ A;  3RJF A;  4C8L A;  4F5P A;  5J2B A;  1ZQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...