4PHDA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp and manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phdA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phdA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phdA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phdA03
4HYKA 5EWGA 3SI8A 9ICOA 4QZAA 2RDJA 1ZQFA 5HRHA 4MFAA 4M9HA 1ZQMA 3AQNA 5EWFA 2HHXA 1KTQA 3HP6A 8ICUA 4UB4A 5KG4A 1D9DA 1QSLA 2IHNA 1WCLA 2R8HA 5J0UA 4M9LA 1BNPA 2M2UA 4UD4A 4KLMA 5C5JA 3RBDA 1NK0A 5DDYA 2R8IA 1U9LA 4P4OA 4MF2A 3UPSA 1QLNA 4WC6A 5KFMA 3HJ4A 4Q8EA 1LV5A 1HUOA 1U4BA 3ISCA 8ICKA 4O9MA 1S9FA 8ICIA 2XGPA 4R8UA 2BKEA 3H4BA 3V6HA 1X9SA 3T5KA 4MEXA 4MEYA 3TFRA 4RQ6A 3RB3A 1XO1A 1NO5A 4IG8A 5KFEA 3OV7A 2BCQA 1YLQA 4B9SA 1ZQJA 1NJYA 4O3OA 4DS5A 2M2WA 3OUYB 4CCHA 3G6YA 9ICUA 1LB2B 3PR5B 4X4TA 4RU9A 3C5FA 2GWSA 2OWOA 2IMWP 4I2IA 5KT5A 4RNNA 4YVZA 3V7LA 1ZYQA 1RXVA 4ED7A 2VA2A 5J0WA 7ICKA 2V4QA 4YMMA 4ECQA 1TK5A 3GILA 2P66A 2PFQA 3PO4A 2M2TA 4JWNA 2PFNA 1S77D 3Q8PB 5J0SA 3RH6A 4KLDA 7ICUA 4JK1A 4ED6A 7ICOA 1PX5A 1DGSA 5KG2A 3G6VA 5DLFA 5KFTA 1SL1A 4RNOA 1NKBA 3M8RA 1ZQIA 2J6SA 1PZNA 1RZTA 4RQ1A 1RYSA 1ZQSA 2FLNA 2HW3A 8ICXA 5D49A 4DFKA 4PGQA 1ZQWA 2I1QA 4PHAA 1NK8A 1IXRA 1JIHA 3AU6A 1ZQEA 9ICVA 1BNOA 1SZPA 4DS4A 1Z00A 4F93B 5HR9A 5HRIA 4YFKA 1S0OA 1T7PA 2ZH2A 4EYHB 1H38A 1KFSA 1D8LA 1TFWA 7ICRA 4J9OA 1ZQRA 4YR0A 1RXWA 3T5LA 9ICJA 5DBCA 3NGDA 2B21A 1F5AA 2ZUCA 4UBBA 4F4ZA 3MDCA 4BXOB 1NJXA 1NKCA 1Z3EB 4P4PA 8ICFA 1VFGA 4WC4A 5DQHA 3LK9A 1B43A 4YR2A 4RWOA 2BCSA 4J9QA 5DG9A 3HX0A 1ZQKA 4I2BA 3C1ZA 4QZDA 4EYIB 1BVSA 4X5VA 5KFJA 3GIMA 2HHSA 4AT8B 5DQGA 5DLGA 3N4MB 1NZPA 3JPRA 2H5XA 5DDMA 2RFFA 4RPXA 5HHIA 3RR8A 4Q8FA 5KT3A 2AQ0A 1TK0A 4F4XA 4WC7A 4QZ8A 4C8LA 4DLGA 4DL3A 4FO6A 2BQRA 5J29A 4O5CA 3JPPA 4Z6DA 4JV2A 2XC9A 4KLEA 2ZUDA 4FS2A 4KTQA 3GFKB 4DL2A 4O3PA 2HHVA 2AGOA 5HP4A 4F4WA 2ASLA 1XSNA 9ICRA 2MUTA 4J9NA 1KLNA 4AT9A 1EXNA 3WFQE 1HJPA 4J9LA 4LVSA 1KFTA 3RJGA 3RJHA 2AQ4A 5KT7A 1TV9A 4IR9A 7ICMA 4FHXA 4MF8A 2HHQA 4F2SA 8ICMA 2Q66A 2BR0A 4DOBA 5DKWA 3MGIA 4DL4A 5HRLA 3PNCA 4MFCA 2BE3A 2W8KA 4AT7B 1ZQDA 5KFNA 4TQSA 4QZHA 5BOLA 4I2FA 5L1LA 2M9NA 2RDIA 1T4GA 3TFSA 9ICWA 2BPCA 4F2RA 1L3SA 4WBZA 7ICIA 4F4YA 3WFSC 4ED0A 1KDHA 3KTQA 5CP2A 9ICXA 4DQRA 5HRGA 5KFQA 3B0YA 3GV7B 4S3NA 4LT6A 4NM2A 4QZCA 1ZQNA 4YP3A 8ICPA 1TFYA 4PH5A 4KLFA 1JXEA 5KTQA 4I2EA 1SKSA 4BWJA 7ICGA 4FH3A 5IIJA 4I29A 5TZVA 1V4AA 2ZJ8A 4KN4A 3HIYA 4DQSA 1D9FA 5J2JA 5KG1A 1SL2A 3V6JA 2V9WA 3QEBZ 4F4KA 4Z6FA 2Y1IA 5HRBA 3EW9A 3QZ8A 4M9GA 2C22A 8ICJA 3H3AA 3PW0A 4RQ2A 5KG6A 2PBEA 2DRAA 2JEIA 4BDPA 4DOCA 2ZH8A 4F92B 5HRDA 1U49A 1ZQGA 8ICQA 3JPSA 4GXKA 4XA5A 5DGBA 1ZJMA 5J0XA 3WFRE 1NK6A 4C8MA 4BGDA 4QWCA 2Y1JA 2W9CB 7ICEA 1Q79A 3H39A 3THVA 3BQTA 4DFJA 1MQ3A 1JXLA 3KHLA 3NYBA 4QWBA 4NY8A 3JPQA 3C2KA 4YMOA 3H4DA 4K4GA 1COOA 1XSPA 3ZDAA 1A76A 4QZFA 4YD1A 4DSFA 5KFXA 5J2DA 3RJJA 3RJIA 4F5RA 1TKDA 5KFGA 3UXOA 5KFLA 1MC8A 4ED3A 2UVUA 3MGHA 2XCAA 2J6TA 4DQQA 3H40A 3GV5B 1ZQUA 4EBEA 3H37A 5EOZA 5CWRA 5DECA 4YD2A 3OGUA 1TAQA 1K1SA 4UB1A 5BPCA 3HWTA 4IRCA 3TAPA 5D4BA 9ICFA 3UQ2A 3C2MA 4KLLA 4NKUA 4O3QA 4TUPA 1KSPA 1U45A 4FBTA 5CR0A 5KFDA 7ICNA 4X0BA 1XC9A 2J6UA 5KG0A 1ZQPA 2BCRA 5D46A 4NKTA 5KT4A 9ICCA 4DF4A 5DB9A 3K4GA 2W9BA 9ICAA 2JEJA 1KEJA 1NJWA 8ICNA 4J9PA 3PVXA 5J0YA 2VANA 5J2CA 3WFPA 4NLNA 1ZQQA 4WC0A 4DOAA 4R65A 5L1KA 1N56A 3UQ0A 1XSLA 2ZTCA 4TUQA 5J2GA 4TUSA 4M9NA 3V7KA 2DR9A 4X4NA 4M2YA 3EPGA 2DR5A 2NRWA 1ZQZA 4ECWA 1QSYA 2C2RA 4C8KA 4UBCA 3M9OB 2FMPA 3E2EA 4X4OA 3Q8MA 3SYZA 5KFAA 5EWEA 4TURA 2JZBB 5IIIA 5J2AA 4UB3A 2XO7A 3BJYA 4DFMA 4P2HA 5KFHA 4Z6CA 4F50A 2HHUA 9ICMA 7ICHA 2ZH5A 2F1HA 3KHHA 2DVIA 3LWMA 5J2KA 5KFRA 3GIJA 3L9DA 4RWQA 7ICQA 3LDAA 2ZTEA 4X0AA 4QZEA 4X4RA 1R8CA 2ZHAA 3KHGA 4M04A 4F5QA 2KTQA 1UEVA 7ICSA 1NK7A 4FH5A 1BPYA 1JMSA 1R8BA 4GXIA 4IQVA 5J2BA 4Q44A 1ZQLA 3ZD9A 4I2CA 3HJ1A 3OUYA 1NK9A 3OVAA 4EBCA 3EYZA 3V72A 2HHTA 3AQLA 4NLZA 2KP7A 4EBKA 4UAWA 4NXZA 3C21A 4EZ9A 1K1QA 3HW8A 4B9NA 2PFPA 4KITB 3QE9Y 1TAUA 1SKWA 3C66A 4ATBB 3TAQA 2FLPA 2ZUBA 2IBKA 4ECVA 1ZQAA 2R8KA 4J9KA 2BQUA 2HHWA 8ICHA 1IM4A 8ICAA 4C8OA 4KMUA 4DF8A 2AGQA 3RTVA 1ZJNA 2KZZA 4ECXA 3GIKA 1OU5A 4M6WB 4C8NA 8ICYA 2BCUA 1AROP 1Q78A 4GLXA 1NJZA 4DLEA 1NKEA 1S97A 4K4HA 4DSLA 4EZ6A 3WFOA 2DR7A 3GIIA 1JN3A 4F3OA 5KFWA 3PMLA 1UT8A 4RQ7A 3H8SA 3AUOA 9ICPA 3H8WA 1NK4A 4WCWA 2JZBA 4ECYA 5KFVA 4DSEA 3SV4A 3JYYA 2ZH9A 4KLGA 4E8FA 5HMLA 4I28A 8ICWA 3OVSA 2FLLA 5HREA 4PHEA 4RPYA 8ICRA 2ASJA 4O5KA 4IRDA 3NTUA 2DR8A 4I2DA 9ICNA 4BXOA 4LZGA 1JQRA 1QTMA 3C18A 3V7JA 5IINA 2P6RA 9ICIA 2XCPA 1MSWD 3RRGA 1MIWA 1VJ7A 3C1YA 4XRHA 5F9LA 2ZH7A 9ICGA 5DG7A 2DFLA 2DRBA 4AT8A 3B0XA 4RQ8A 1RYRA 2FPLA 2R8GA 4XQ8A 2R8JA 5CA7A 1C7YA 4F5PA 4EEYA 8ICSA 4PGYA 3RBEA 2UVWA 4RWNA 4FHYA 4GC6A 4UAYA 1ZQVA 4RWPA 4PGXA 4E80A 3UPQA 3PY8A 4X4PA 1NK5A 4DQPA 5L1IA 4B9MA 1L3TA 5KG5A 4DSJA 3AU2A 4M6WA 1MIYA 3PW7A 1T8EA 5DEDA 3PX6A 4B9UA 1L5UA 3M9MB 4WC1A 5DBBA 4PHDA 8ICCA 3GDXA 9ICLA 4ED1A 4KLQA 4ED2A 2DPIA 1KFDA 2UVVA 3RAQA 2ZJ5A 5KFIA 1NOMA 4R8UB 3PMNA 3MR6A 3ZDDA 4IQUA 2JEGA 1Y88A 1WCNA 5J0TA 1A77A 4M0AA 4ECUA 4AT7A 5KFFA 1ZQOA 2C2EA 4O0IA 9ICQA 1UA0A 1S0NA 3RJEA 4KLTA 3OHAA 9ICHA 4YCXA 2UVRA 3LQCB 4WC3A 3ZDCA 2BDPA 5KFCA 1U48A 1S10A 4KLIA 3EZ5A 4RNMA 2ATLA 1D8YA 1BPBA 4Z6EA 5HMMA 3BQ0A 4GXJA 4YQWA 4ED8A 1DK2A 4R63A 4DO9A 1FA0A 2ISPA 5HRKA 1X9WA 5J2HA 1ZQHA 3PO5A 4FBUA 4ECTA 5HC9A 5KFOA 3MDAA 4ELTA 3G6XA 1S76D 4FHWA 3IM1A 2FMQA 5J0PA 2IA6A 2F1JA 4YR3A 4ECSA 4UD5A 4EP7A 4X4QA 3SV3A 4AT9B 1TVAA 2ZH6A 3MBYA 2BQ3A 1L3UA 5IIKA 5L1JA 3T3FA 2ZHBA 4I2JA 3PW2A 2F1IA 9ICTA 4BWMA 3TI0A 3AQMA 5F2VO 3FYHA 3T5JA 1BPXA 1B22A 4G3IA 2KZ3A 5KT2A 1Z00B 4M9JA 3UXNA 3RB4A 1KRPA 3QZ7A 1UEUA 3EWAA 3ETLA 8ICTA 8ICEA 3FDSA 4EBJA 4FHVA 3GQCA 2ZJAA 5DB7A 1UETA 2W9CA 2ZH3A 4ECRA 5IIMA 3RJFA 4P4MA 3PW4A 2V4RA 4IRKA 2FMSA 4DSIA 4F8RA 1ZQCA 2KZMA 2P6UA 4DL7A 2A1JB 4DL5A 1TK8A 3H7IA 1MQ2A 3M8SA 5KG7A 2O5AA 4RQ3A 8ICZA 2VA3A 3ISDA 5KFBA 1ZETA 3TANA 3Q8SB 4B9LA 5F9NA 1V9PA 1QSSA 4JWMA 1WOTA 4NLGA 1JX4A 1BGXT 3ZD8A 3MABA 4QZGA 3OJSA 4K4IA 1RPLA 5JUMA 4O5EA 2XGQA 7ICJA 1R89A 3JPNA 2Q0ZX 1SL0A 4EBDA 3BQ2A 5J0RA 3MFIA 4KLSA 1BPDA 3QEAZ 3C2LA 2KN7A 2AGPA 4FHPA 2VA8A 4RT3A 1X2IA 2PFOA 2BHNA 2MAXA 3K75D 7ICVA 4JV0A 4KN7A 5KFZA 3Q8KA 2PI5A 4JV1A 5HRFA 2MUTB 3EPIA 3N97B 3C23A 3HPOA 3Q8LA 1N48A 3PW5A 5J2FA 1XWLA 4DL6A 4M47A 1XS9D 1DK3A 4UB5A 3JZ0A 4JUZA 2ZH1A 2C2DA 4GC7A 7ICTA 3OJUA 8ICLA 1ZQBA 8ICBA 2W8LA 4I2HA 1XU4A 5HNKA 1SKRA 1HUZA 8ICGA 1CEZA 4J9MA 4WBYA 2O1PA 4E0DA 5DQIA 4RUCA 4R66A 2M2VA 4I2GA 4QWAA 3M9NB 2IHMA 2NRVA 9ICSA 4XUSA 2XY7A 5DBAA 4X4UA 1CUKA 2A1JA 3RRHA 5J0QA 1ZQTA 2WTFA 4DSKA 3PR4A 4IR1A 5IILA 4F91B 3TARA 2DPJA 3V6KA 4DFPA 5IIOA 2W9AA 4M5DA 4QZIA 2ZH4A 2FPMA 5CHGA 1L3VA 4PPXA 5DGAA 2XY5A 3RAXA 3ORYA 3RR7A 2XY6A 2BPGA 4IQWA 4F5OA 2I9GA 3TQ1A 9ICBA 5J2IA 3GV8B 3OSNA 5BOMA 2PI4A 1KNYA 3MFHA 8ICOA 1TFRA 3RH4A 3ZDEA 4RUAA 2LYHA 3RH5A 2ID1A 4QZ9A 4UB2A 3KHRA 4X4SA 4YG2A 5L9XA 4QW9A 4E7XA 3Q8RB 5HHHA 3H8JA 4R64A 4QWEA 3OHBA 3RB0A 3C5GA 1ZQXA 2BGWA 3IHQB 3SZ2A 3BDPA 2NRTA 4O3NA 5J0OA 7ICLA 3JPOA 3AQKA 4XQ7A 5KFUA 4QW8A 3RB6A 4YMNA 5KT6A 2HHPA 4WC2A 2NRXA 4DQIA 2AJQA 4X4VA 4NM1A 4F5NA 5CB1A 5CJ7A 1BPZA 1BPEA 4YN4A 4UQGA 5DB8A 3ISBA 1U47A 2BPFA 7ICPA 1R8AA 4ELVA 4O3SA 4DEZA 1S0VA 2KFNA 4ATBA 1UT5A 2ZTDA 2PXIA 4Q43A 1X9MA 3HT3A 4B9TA 3OSPA 1DOQA 3PX0A 2JEFA 5KFPA 9ICEA 3H38A 3PV8A 4RQ0A 3MR2A 4J9SA 4I27A 5KFYA 2ALZA 4RQ4A 2BCVA 4DWIA 5DB6A 2ISOA 4O3RA 5KG3A 1JAJA 4QZBA 4RQ5A 3Q8QB 5KFKA 4B9VA 2ASDA 4QWDA 1ZQYA 4YXMA 3LWLA 7ICFA 3ZDBA 1MIVA 4ELUA 4KLHA 3MR3A 1T3NA 4KLOA 2W9MA 4YXJA 4Q45A 5KFSA 4FS1A 4ZH4A 4KLUA 2HVIA 3UXPA 4IQTA 4NLKA 3MR5A 4RT2A 2W9BB 3JPTA 3RJKA 4WC5A 5DG8A 4I2AA 3PX4A 4ECZA 4RPZA 4UAZA 4MFFA 3T5HA 4TQRA 2C28A 8ICVA 1UA1A 9ICKA 2NRZA 2NRKA 3BQ1A 2KFZA 5J2EA 2FPKA 1S0MA 2HVHA 4PHPA 4RZRA 4KLJA 3OVBA 4J9RA 2AU0A 4LZDA
chains in the Genus database with same CATH superfamily
4HYKA 5EWGA 4CGZA 2E1EA 3QNMA 5AM3A 4LEYA 2ZIXB 1PVQA 5ALDA 3RBDA 1NK0A 5DDYA 2R8IA 1U9LA 4P4OA 4MF2A 2KSOB 3HJ4A 1X42A 4UB6U 4O9MA 8ICIA 3CK6A 4MEXA 3BZCA 3T5KA 1RQNA 4MEYA 1MN8A 3TFRA 3LVWA 4OO1J 1XO1A 2DKZA 2CN1A 5KFEA 3OV7A 2BCQA 2KEYA 4B9SA 4GFJA 3PSPA 4CCHA 4X4TA 4NLBA 3PR5B 2D6FC 3PSTA 2EZXA 4RNNA 4YVZA 3V7LA 4K9BA 3NVOA 2JH7A 4YMMA 4ECQA 2P66A 3PO4A 2M2TA 4NL9A 3RH6A 4KLDA 4JK1A 2J6SA 3M8RA 1RZTA 4RQ1A 3ALRA 2KJ8A 2M0NA 2FLNA 2HW3A 2XVTA 2KICA 8ICXA 2AHOB 1YZ6A 1BNOA 1JIHA 3AN1A 1ZQEA 4C7ZA 4DS4A 2ZIXA 5ALGA 4EYHB 3DEEA 2KSOA 4J9OA 4YR0A 1RXWA 2W43A 5GTHU 3NGDA 4UBBA 4AYBC 3MDCA 1NKCA 4WC4A 5DQHA 2BCSA 3HX0A 5AI8A 4I2BA 4EYIB 4AT8B 1NZPA 3JPRA 2RFFA 5AI6A 5AI5A 3RR8A 4Q8FA 4IL6U 2AQ0A 2K89A 2H3IA 2Y0SF 4DLGA 4FO6A 2BQRA 4Z6DA 3HKZF 4FS2A 4KTQA 5CFUA 4NV0A 4Y2UA 4O3PA 1L8OA 3S6JA 3WKEA 1XSNA 2W04A 1EXNA 3WFQE 4UATA 2AQ4A 5KT7A 4FHXA 3MGVA 5AIBA 2Q66A 4DOBA 4F71A 3MGIA 4MFCA 2BE3A 2YMQA 3N7RC 5D62A 4S3NA 4C4TA 4QZCA 2XIDA 1DXSA 4PH5A 4I2EA 5EE1A 4I29A 1D9FA 5KG1A 5ALEA 3QEBZ 3NWIA 4M9GA 3H3AA 3PW0A 2DRAA 2JEIA 4DOCA 4O6AA 4F92B 1U49A 3JPSA 4BUGA 2JMGA 5B3PA 4C8MA 3H39A 2W9CB 1Q79A 3THVA 1MQ3A 5H2FU 1JXLA 5E79U 4YMOA 1PVPA 1WUDA 4DSFA 1X6JA 5KFGA 1MC8A 3C29A 2XCAA 5ALRA 3C28A 4DQQA 3WKAA 4ICAA 3DDHA 3GV5B 4IC9A 4UB1A 9ICFA 4KLLA 4TUPA 2XI9A 1XC9A 2KHQA 5D46A 5KT4A 9ICCA 4DF4A 5AKKA 1NJWA 2ZG6A 5J2CA 4FZLA 2Q4TA 4UB8U 4NLNA 2LM4A 5AM2A 2B6GA 3EF2A 5KL1B 5L1KA 1N56A 3BS5B 2FMPA 1V85A 5KFAA 5EWEA 5J2AA 4P2HA 3WK8A 2ZH5A 7ICHA 1SWVA 1VLBA 4OAHA 2F1HA 5KFRA 3GIJA 3TKAA 4F72A 7ICQA 3H8MA 4X0AA 4QZEA 2ZHAA 4M04A 2KTQA 3KBBA 1NK7A 4FH5A 1BPYA 5J2BA 4Q44A 4EX7A 3V72A 4NLZA 2KP7A 4EZ9A 3HW8A 4B9NA 4ATBB 1ZQAA 2R8KA 2HHWA 4C8OA 1A6SA 3GIKA 5ALUA 1OU5A 2DL0A 1AROP 2BCUA 2KKVA 1NJZA 2DR7A 2OEHA 4UAUA 2KIWA 1WWVA 1NK4A 4EX6A 2F2AB 4ECYA 3SV4A 1SV0C 2DBYA 3AMZA 8ICWA 1ED1A 5HREA 1RQLA 5IINA 1MSWD 3RRGA 1MIWA 2ZH7A 5AKYA 5DG7A 2FPLA 2R8JA 8ICSA 1PUZA 3MCRA 4RWNA 2WAQC 4RWPA 3UPQA 1YZ7A 5L1IA 1L3TA 5KG5A 1Z4OA 8ICCA 4ED1A 2KJ9A 5AKXA 2ZJ5A 4R8UB 2JEGA 1Y88A 1WCNA 2HBMA 5KFFA 2C2EA 4O0IA 3LQCB 4YCXA 4WC3A 2NO5A 5J8YC 1S10A 4RNMA 1D8YA 2RRDA 3BQ0A 1DK2A 5JRTA 4DO9A 1X9WA 1ZQHA 1S76D 2YN4A 4YR3A 4ECSA 4OJ5A 1TVAA 2BQ3A 2KNJA 2QLTA 3T3FA 2KZ3A 5KT2A 3EWAA 3ETLA 8ICTA 4FHVA 2YMMA 2OH2A 3BS7A 3D2QA 5DB7A 1ZXIA 3ED5A 5IIMA 3RJFA 2ZH3A 4P4MA 3PW4A 2V4RA 2FMSA 1ZQCA 4OJ6A 4RQ3A 8ICZA 3ISDA 2EAMA 4O68A 2JRZA 1BGXT 5AK5A 3MABA 4RQMA 3OJSA 5JUMA 1R89A 1D8BA 3AEVA 2Q0ZX 4EBDA 3BQ2A 5J0RA 3K75D 7ICVA 4KN7A 5KFZA 1JROA 5J2FA 1XWLA 2XICA 3JZ0A 4JUZA 1FO4A 2E8PA 2W8LA 5HNKA 1HUZA 8ICGA 2KE7A 5GTIU 2IHMA 4P0PB 9ICSA 3TARA 3SQIA 4CF4A 2DPJA 3V6KA 5CHGA 3UMGA 1XO0A 2E5SA 1SV4A 3TQ1A 3OWGA 4C4RA 2KV2A 5J2IA 4XJEA 3GV8B 1TFRA 5ALPA 4UASA 4YG2A 4QW9A 1QQ7A 2LYAA 4AP9A 5HHHA 1ZQXA 3JPOA 1C20A 3RB6A 2HHPA 4F5NA 1Z1VA 4LEZA 7ICPA 3SR6A 4B9TA 3T79A 9ICEA 4NXWA 4J9SA 4P0PA 3KOOA 5KFYA 4RQ4A 4O3RA 1SV0A 5EE3A 1DRGA 1X6IA 3Q8QB 2EQYA 4B9VA 3NS1A 5AM4A 1S8OA 3LWLA 3ZDBA 1QH9A 4ELUA 3MR3A 2W9MA 4FS1A 5ALTA 5G5HA 2HVIA 1IG6A 4NLKA 4RT2A 1JI7A 3UMCA 4WC5A 5DG8A 5ALLA 4I2AA 2ODGA 4MFFA 4RPZA 3T5HA 5CRXA 9ICKA 2NRZA 1S0MA 2FPKA 4PHPA 2NV3A 4J9RA 2AU0A 4LZDA 3SI8A 2RDJA 5HRHA 5ALXA 4M9HA 2HHXA 1Q46A 2IHNA 1BNPA 1WCLA 5J0UA 1L7MA 4Q8EA 1HUOA 1U4BA 2BKEA 2P35A 3H4BA 3V6HA 5J8YA 1NO5A 2DF4B 4IG8A 1YLQA 3OUYB 1NJYA 4DS5A 2YQEA 3G6YA 1LB2B 2OWOA 2HOQA 3SAGA 2IMWP 2VA2A 5ALIA 3EUB2 1ZYQA 4ED7A 2HN2A 3ER9B 2PFNA 3Q8PB 7ICOA 4ED6A 1DGSA 1ZQIA 1SL1A 5AM1A 3NRWA 1RYSA 2LPEA 4DFKA 1NK8A 1ZQWA 9ICVA 1Z00A 4F93B 2BDUA 4DCCA 5HR9A 1H38A 7ICRA 1ZQRA 3T5LA 5CFTA 2B21A 1F5AA 2ZUCA 4F4ZA 2AXTU 5DG9A 1ZQKA 4QZDA 3IDWA 2HHSA 3KKAC 4RPXA 5KT3A 1TK0A 4WC7A 2EZZA 3VC8A 4C8LA 4DL3A 4LEVA 2YB4A 3E58A 5J29A 2VIXA 3I1YA 3NVZA 4BX9C 2XC9A 3CRXA 2IOFK 2HHVA 1QCKA 1KLNA 2K4HA 4IR9A 4MF8A 4F2SA 5DKWA 2W8KA 1Q8KA 1ZQDA 4TQSA 4QZHA 4I2FA 2DWQA 2M9NA 3TFSA 2N1RA 2BPCA 4WBZA 3WFSC 4QIWF 4ED0A 1KDHA 3KTQA 4U7CA 9ICXA 5KFQA 2GOLA 1TFYA 4YP3A 3QYPA 2E8NA 4BWJA 5IIJA 3O0FA 2B51A 1KL9A 2ZIVB 1V4AA 4DQSA 3PZPA 3ZI4A 3EW9A 3QZ8A 4RQ2A 1COKA 2KJ5A 4BDPA 2ZH8A 2W03A 2QARB 4GXKA 4XA5A 5DGBA 4EEBA 5ALZA 3F2BA 3N28A 1QQ5A 3BQTA 2ZIWB 3JPQA 3H4DA 4K4GA 1COOA 3ZDAA 1A76A 3F2CA 2BBHA 1GO3F 5J2DA 3ICXA 2IUBA 3RJJA 2UVUA 5KFLA 4ED3A 1O03A 4O67A 1ZQUA 4EELA 1N62A 2WB1C 3HWTA 4NKUA 3UQ2A 3C2MA 4O3QA 5ALFA 1U45A 5CR0A 4FBTA 4FO1A 2FI1A 2WF9A 2J6UA 1ZQPA 3WK4A 5DB9A 1X40A 2QB0A 4K96A 9ICAA 3SENA 1KEJA 8ICNA 3PVXA 4OAIZ 3WFPA 1ZQQA 4DFDA 1WG8A 4C4SA 4R65A 3UQ0A 4TUQA 5J2GA 2ZIWA 2DR9A 4X4NA 2MU2A 3EPGA 1T94A 4UBCA 2A1AA 2W7OA 4WQKA 2HDOA 4K97A 1AQ6A 7ICSA 5KAIU 1JMSA 3HJ1A 4CDGA 3ZD9A 4I2CA 1NK9A 4EBKA 4UAWA 4OJOA 3C66A 3IV6A 2W11A 2FLPA 4ECVA 1IM4A 2AGQA 3RTVA 2K8CB 4C8NA 1HIWA 1Q78A 4GLXA 4DLEA 1N2XA 2G09A 4EZ6A 4F3OA 2KOBA 3AUOA 5K4LA 9ICPA 4I0UA 3H8WA 4Y2JA 3IRUA 4WCWA 3K7DA 1DGJA 5KFVA 4KLGA 4IRDA 4I2DA 4LZGA 3C18A 3KKAA 1QTMA 3C1YA 1ZQ1C 1X66A 2RLTA 3UMBA 2DRBA 4AT8A 3B0XA 2R8GA 4F5PA 3M7DA 4GC6A 4UAYA 1ZQVA 2GLEA 2HBLA 5AKZA 4B9MA 5AI4A 4DSJA 3AU2A 2ZIUB 2A3VA 2LYBA 4WC1A 5DBBA 4KLQA 2K8AA 4ED2A 2UVVA 3RAQA 1T3QA 2H3VA 4EV6A 1A77A 4M0AA 5AKLA 1ZQOA 9ICQA 5AHXA 1YT3A 4WH5A 2BDPA 4Z6EA 4ED8A 5HMMA 1FA0A 1VJ5A 5ALKA 1V38A 2K4EA 5HRKA 5HC9A 4ECTA 5KFOA 5AK4A 4ELTA 4FHWA 3IP4B 5J0PA 1LKYB 4C0ZA 2ZHBA 1ECWA 1FIQA 1RG6A 2F1IA 2JR5A 3KZIU 4BWMA 3AQMA 4Y2QA 3T5JA 1B22A 3N7PD 3UXNA 5G5GA 5AKHA 1UEUA 2B0CA 2W55A 1N5XA 2ZIUA 2W9CA 4F8RA 2KZMA 2A1JB 4DL5A 1TK8A 3H7IA 1MQ2A 3L5KA 5KG7A 1KBUA 3QU4A 2VA3A 1ZETA 4B9LA 1J97A 1QSSA 1WOTA 4O5EA 7ICJA 2FDRA 3WK5A 3H0LB 3QEAZ 5KL8B 2BHNA 2MAXA 2PI5A 2MUTB 3EPIA 2HOIA 3Q8LA 1LKYA 4DL6A 2C2DA 1N61A 1SKRA 4NWIA 4J9MA 4OAFA 3K1ZA 4Y2TA 4R66A 4QWAA 3M9NB 4USAA 2NRVA 2XY7A 2HI0A 2A1JA 5KAFU 5J0QA 2WTFA 2HBKA 3BS5A 4ZOHC 2RP5A 4F91B 5IIOA 4QZIA 5ALNA 1N5WA 5DGAA 3RAXA 1JUDA 2PMZF 3TADC 9ICBA 4OJPA 1LVHA 5BOMA 8ICOA 3RH4A 3ZDEA 4RUAA 2LYHA 3RH5A 2ID1A 5CEHA 1F44A 4R64A 3OHBA 3RB0A 3SZ2A 5KT6A 3UM9A 2NRXA 1RYUA 4IS7A 4FZNA 1JRPA 5CB1A 1BPEA 4Y2PA 1R8AA 4ELVA 1S0VA 4DEZA 4ATBA 2W3RA 5KFPA 3HRDD 4ACOA 5AICA 2WF5A 5KG3A 2F3NA 4QZBA 3K1RB 1KQQA 1IIPA 5KFKA 4WJ3B 2VJ4A 4JB3A 4QWDA 3WK7A 2Z7JA 4KLHA 4Q45A 4K98A 4ZH4A 4KLUA 4IQTA 2W9BB 3RJKA 1Z1BA 3CW2C 4TQRA 5JU5A 1UA1A 3BQ1A 3HJEA 3NASA 5J2EA 4RZRA 3N7SC 4QZAA 1KW4A 3AQNA 5EWFA 2WF8A 8ICUA 4UB4A 5KG4A 4M9LA 4UD4A 2R8HA 4KLMA 5C5JA 1SIJA 3UPSA 1CI4A 1QLNA 1LV5A 2ZXHA 8ICKA 2XGPA 4R8UA 1A0PA 3RB3A 3PSIA 1UCVA 2M2WA 1ZQJA 4BJQA 2WHEA 3GZFA 3C5FA 3FAHA 4I2IA 7ICKA 2YMPA 5J0WA 5L1MA 1TK5A 5AIAA 2PFQA 1S77D 5J0SA 7ICUA 5ALHA 5KG2A 5DLFA 4AT9B 1PZNA 5D49A 4PGQA 4PHAA 2KKPA 5HRIA 2ZH2A 2WAQF 1KFSA 1D8LA 2FE9A 4BXOB 1XNSA 1NJXA 1Z3EB 3LK9A 1B43A 4YR2A 4J9QA 4X5VA 5KFJA 5DQGA 3N4MB 5HHIA 2F77X 4QZ8A 3PSFA 4O5CA 3CNHA 3JPPA 2E8MA 3R9KA 4DL2A 2AGOA 2EAOA 5HP4A 2ASLA 4J9NA 4AT9A 4J9LA 3RJGA 3AM9A 4CF3A 1TV9A 5C0YA 2HHQA 8ICMA 2YMLA 5HR6A 4DL4A 4AT7B 5KFNA 4NLCA 2NYVA 4Y2VA 2RDIA 1ZD2P 1WWUA 7ICIA 2I5HA 4DQRA 3LYSA 3GV7B 4NM2A 8ICPA 3TADA 4KLFA 2FJ6A 4FH3A 7ICGA 1S5LU 3E0FA 4N7RA 2YB1A 4F4KA 4Z6FA 2Y1IA 5HRBA 1RM6C 8ICJA 1PK1B 2B56A 5ALYA 4LEWA 1URJA 5ALOA 1Z19A 1NK6A 4BGDA 7ICEA 4DFJA 4NY8A 3C2KA 1XSPA 4QZFA 4YD1A 5KFXA 1TKDA 2H3FA 4PZOA 5B5EU 3MGHA 2JV3A 4EBEA 1SGGA 5CWRA 5DECA 1TAQA 4IRCA 7ICNA 4X0BA 3FC4A 2L5YA 5KG0A 1PK1A 2LMRA 4PJ0U 2JEJA 4J9PA 5J0YA 1PK3A 2H3ZA 2H3QA 2NRWA 1ZQZA 1QSYA 1M6YA 1NNLA 3E2EA 3SYZA 2E3TA 4WOYA 3SEIA 4DFMA 4GIBA 2XO7A 4F50A 4Z6CA 2DVIA 5J2KA 4OAGA 2HSZA 4X4RA 2BZFA 1R8CA 4F5QA 1UEVA 4NXTA 5AI0A 4IQVA 3OUYA 2HCFA 3F53A 2G08A 3QUQA 3OVAA 3EYZA 3C21A 1K1QA 2PFPA 3QE9Y 2MSNA 1SKWA 3TAQA 2IBKA 8ICHA 8ICAA 4J9KA 1V97A 4KMUA 2WF7A 4ECXA 1TE2A 5AKJA 1NKEA 4K4HA 4DSLA 3WFOA 1F0MA 3IG5A 1UT8A 3H8SA 3QXGA 2KK0A 3JYYA 4E8FA 5HMLA 4I28A 1FEZA 2O6KA 1ZRNA 2K8BB 2FLLA 4PHEA 2MA1A 4RPYA 4OJLA 8ICRA 3NTUA 5CHEA 4KX5A 2RHFA 1NZBA 2KMDA 9ICGA 2MRLA 4Y2YA 2OM6A 1UPHA 4RQ8A 4XQ8A 3NKUA 1C7YA 4PGYA 2UVWA 1F5SA 4FHYA 3PY8A 1NK5A 4DQPA 1ZD4A 2W3SA 4MHVA 2DKXA 1MIYA 5EE9A 3PW7A 3PHZA 2F76X 5DEDA 1L6NA 4B9UA 1L5UA 3M9MB 9ICLA 1KFDA 3D2SA 1FFVA 2GO7A 3MR6A 3ZDDA 4IQUA 3FM9A 2Y0SC 4ECUA 2EWRA 1UA0A 1S0NA 3RJEA 3HKZC 3OHAA 2OCEA 4KLTA 2Y9TA 3ZDCA 1U48A 4KLIA 4UAVA 3EZ5A 1UHUA 4WC0A 1BPBA 4GXJA 4YQWA 4B6JA 5J2HA 5ALVA 3PO5A 4C80A 3G6XA 3QU7A 2ZIVA 2FMQA 2IA6A 4X4QA 2F1JA 4UD5A 2EANA 2ZH6A 5AKIA 5IIKA 3D6JA 5D63A 4I2JA 3PW2A 4K8VA 9ICTA 5F2VO 4JLXA 4M9JA 8ICEA 3FDSA 2QARA 5KNIA 3GQCA 2ZJAA 3H0RB 2P6UA 3ONNA 4RQNA 3M8SA 2O5AA 4Y2XA 5KFBA 1V9PA 3NVVA 1JX4A 2DUYA 1RPLA 2XGQA 4MKPA 1SL0A 3WK9A 2LHTA 3MFIA 2ESEA 3C2LA 2AGPA 3F5EA 4RT3A 5HRFA 5F3XB 3N97B 3C23A 3M6ZA 1N48A 1K5OA 2EZYA 4M47A 1DK3A 4UB5A 2ZH1A 2G0AA 3OTQA 3OJUA 8ICBA 5AKEA 2GA9D 2O1PA 5DQIA 4I2GA 3IN5A 4XUSA 2K4PA 1CUKA 3BZKA 2JHDA 3RRHA 4EENA 3PR4A 4IR1A 5IILA 3QUTA 2F8LA 4M5DA 3QUCA 4IQWA 4PPXA 2KVCA 2XY6A 2BPGA 4F5OA 2I9GA 3OSNA 2PI4A 1KNYA 4QZ9A 4UB2A 5L9XA 1SXEA 4E7XA 4O69A 3Q8RB 3H8JA 2BGWA 3IHQB 2LI6A 3BDPA 2NRTA 7ICLA 4XQ7A 4QW8A 1IV8A 2WB1F 4NXVA 4WC2A 4NM1A 5HRGA 2BPFA 4YN4A 1U47A 3ISBA 3RFAA 4O3SA 2KFNA 4K99A 3WKBA 4Q43A 3OSPA 1DOQA 3PX0A 2JEFA 4G9BA 3PV8A 4DWIA 1L8LA 5DB6A 2ISOA 2W54A 1JAJA 4RQ5A 3OPXA 1ZQYA 4HX0A 5KFSA 1MA7A 2YY6A 2JH1A 4PL1A 3UXPA 3MR5A 2DQNB 4QNLA 1B0XA 3PX4A 4ECZA 4UAZA 8ICVA 2NRKA 1FFUA 2Y9UA 4KLJA 5EE0A 3OVBA 3L9DA 4AYBF 4PZNA 3RF9A 1OUQA 9ICOA 2PMZC 5ALJA 1ZQFA 4MFAA 4KM5A 1ZQMA 3QX7A 2G5HB 1KTQA 3HP6A 1QSLA 1D9DA 2M2UA 4CF5A 4WC6A 3KD3A 5KFMA 3ISCA 1S9FA 1X9SA 1SWWA 4RQ6A 4WQLA 2HBJA 4O3OA 4FE3A 9ICUA 4RU9A 2GWSA 3CYMA 3F2DA 5KT5A 1RXVA 1UQVA 2V4QA 2G07A 3GILA 3BQ7A 4JWNA 2IHOA 1PX5A 1SXDA 3G6VA 1NKBA 5KFTA 4RNOA 4KB6A 1ZQSA 2I1QA 1IXRA 3AU6A 1SZPA 4YFKA 1S0OA 1T7PA 3SAHA 1TFWA 9ICJA 5DBCA 2VKQA 1Z4NA 4P4PA 8ICFA 1VFGA 4RWOA 3U26A 1X9XA 3C1ZA 1BVSA 3GIMA 2ZXIA 5DLGA 2OYYA 2H5XA 5DDMA 5JTGA 2K4IA 4OD0A 4F4XA 1KN5A 4O3MA 4JV2A 4KLEA 1RDFA 2ZUDA 3GFKB 2JXJA 2QKQA 3LVVA 4F4WA 9ICRA 2MUTA 2DGZA 2KHVA 1HJPA 4LVSA 1KFTA 3RJHA 3B9JA 2B4VA 7ICMA 2KVSA 2BR0A 1J2NA 1TAMA 5HRLA 3PNCA 5BOLA 5L1LA 1T4GA 4CRXA 9ICWA 2KD1A 1L3SA 4F2RA 4F4YA 2LKYA 5CP2A 5AKGA 2HMXA 3B0YA 3GU3A 4LT6A 1ZQNA 3NRZA 2R18A 1JXEA 5KTQA 1SKSA 1B4FA 5TZVA 3HIYA 2ZJ8A 4KN4A 2KG5A 5J2JA 4KMOB 1SL2A 3V6JA 2V9WA 4EEKA 5FP0A 2C22A 5KG6A 2PBEA 2F8KA 5HRDA 1ZQGA 8ICQA 1ZJMA 4NJ8A 5J0XA 3WFRE 2Y1JA 4QWCA 3NYBA 2YTUA 3KHLA 4QWBA 3QU5A 1WYGA 1GPJA 5ALQA 3RJIA 4F5RA 3UXOA 2J6TA 2NO4A 3H40A 3H37A 4EEDA 5EOZA 4YD2A 3OGUA 5T14A 1K1SA 5BPCA 2WF6A 5D4BA 3TAPA 3AQEA 1KSPA 3A0HU 5KFDA 3M1YA 3ERCC 2BCRA 4NKTA 1VDVA 4OCZA 3K4GA 2W9BA 2VANA 3JCFA 5A0LA 1ZRMA 4DOAA 3AQFA 1XSLA 2ZTCA 4TUSA 2VJ5A 1Q3UA 4M9NA 3V7KA 4C7YA 4M2YA 4UARA 2PKEA 3WU2U 4US8A 4NXUA 5AM0A 2DR5A 4ECWA 2D8CA 4C8KA 2C2RA 3D2NA 3M9OB 4X4OA 3Q8MA 4TURA 2JZBB 4PL2A 3CP8A 5IIIA 4UB3A 3BJYA 2HHUA 5KFHA 9ICMA 3KHHA 3LWMA 1L7OA 4RWQA 3LDAA 2ZTEA 3L4PA 5CFSA 3NVYA 3KHGA 3NVWA 3NUQA 1R8BA 4GXIA 1ZQLA 2YX8A 3ETRA 1L7PA 4EBCA 2HHTA 3AQLA 2CXYA 4NXZA 4KITB 1TAUA 3DV9A 2ZUBA 1QQ6A 3IG8A 2BQUA 4DF8A 3HILA 1ZJNA 2KZZA 3A0BU 4M6WB 8ICYA 1N63A 3WK6A 1S97A 3GIIA 1JN3A 1HEKA 4FFDA 5KFWA 3PMLA 4RQ7A 2JZBA 4DSEA 2ZH9A 1SZHA 2OXOA 3OVSA 4HAIA 2ASJA 4O5KA 2RQ5A 5AI9A 2DR8A 5JTIA 1CRXA 9ICNA 4BXOA 1JQRA 2HN1A 3V7JA 4QJFB 2P6RA 9ICIA 2A19A 5AM5A 2XCPA 1VJ7A 4XRHA 5F9LA 2DFLA 1RYRA 3WKCA 5CA7A 4JLZA 4EEYA 3RBEA 4A8EA 1Q3VA 2E8OA 2ES6A 3MC1A 4JMUA 4PGXA 4E80A 4X4PA 5ALSA 3KZXA 4M6WA 1T8EA 4Y2SA 3PX6A 4PHDA 3GDXA 2DPIA 5KFIA 1NOMA 3PMNA 2EDUA 5J0TA 4AT7A 9ICHA 2UVRA 4CE6A 5ALMA 5KFCA 2ATLA 4R63A 2ISPA 4FBUA 3MDAA 3F5AA 3IM1A 5B3QA 4EP7A 3SV3A 3SAFA 3MBYA 1L3UA 5L1JA 4CNQA 3I76A 2E1FA 3TI0A 2KIVA 3FYHA 1BPXA 4NL9C 2IOHA 4QIWC 4G3IA 5D61A 1Z00B 1NI3A 1KRPA 3RB4A 2K60A 3QZ7A 4EBJA 4P0QB 1UETA 1L7NA 4ECRA 4IRKA 4DSIA 4DL7A 2CPRA 3TANA 3Q8SB 3ER8C 5F9NA 4JWMA 4NLGA 3ZD8A 3QU9A 4QZGA 4K4IA 3JPNA 3J81j 2BBJA 2D3DA 4KLSA 1BPDA 1OXJA 1PVRA 2KN7A 4FHPA 1O08A 2VA8A 2GH1A 1OW5A 1X2IA 2OHFA 2PFOA 4JV0A 4JV1A 3Q8KA 3HPOA 3PW5A 4Y2RA 1XS9D 4GC7A 3KFUF 7ICTA 8ICLA 1ZQBA 4J03A 4I2HA 1XU4A 5ALWA 2W7PA 1CEZA 4US9A 4WBYA 4P0QA 4E0DA 1ZOLA 3SMVA 4RUCA 2M2VA 1SB3C 3TACB 4X4UA 5DBAA 3H0MB 1ZQTA 4LJXA 4DSKA 3SD7A 2I6XA 4NXXA 4DFPA 3M6KA 2W9AA 2ZH4A 2FPMA 1P7DA 1L3VA 2EH9A 2LBOA 2XY5A 3ORYA 3RR7A 5AK3A 4FZMA 2EAPA 3MFHA 2QB1A 4X4SA 3KHRA 1ZD3A 2FCLA 4QWEA 3C5GA 3AQKA 4O3NA 5J0OA 2GAFD 5KFUA 1J2MA 4YMNA 3I28A 3QUBA 4KX3A 4DQIA 2AJQA 4X4VA 3AL0B 2IOFA 5CJ7A 1BPZA 4UQGA 4U6PA 5DB8A 3QU2A 1UT5A 2ZTDA 2PXIA 1X9MA 3HT3A 2G5IB 4UW9A 3H38A 4RQ0A 3MR2A 2WFAA 4I27A 2ALZA 2BCVA 1ZD5A 5HR7A 1N60A 2ASDA 2HOFA 1KKXA 1JALA 4YXMA 7ICFA 1MIVA 2JGAA 4KLOA 2F44A 1T3NA 4EGWA 4YXJA 5B66U 2CRXA 2QB0B 2LM1A 3JPTA 3VCBA 3WKDA 2C28A 5TISU 4K9AA 3L3FX 2G06A 5AK6A 2KFZA 2AH5A 2HVHA
chains in the Genus database with same CATH topology
4HYKA 5EWGA 3SI8A 9ICOA 4QZAA 2RDJA 1ZQFA 5HRHA 4MFAA 4M9HA 1ZQMA 3AQNA 5EWFA 2HHXA 1KTQA 3HP6A 8ICUA 4UB4A 5KG4A 1D9DA 1QSLA 2IHNA 1WCLA 2R8HA 5J0UA 4M9LA 1BNPA 2M2UA 4UD4A 4KLMA 5C5JA 3RBDA 1NK0A 5DDYA 2R8IA 1U9LA 4P4OA 4MF2A 3UPSA 1QLNA 4WC6A 5KFMA 3HJ4A 4Q8EA 1LV5A 1HUOA 1U4BA 3ISCA 8ICKA 4O9MA 1S9FA 8ICIA 2XGPA 4R8UA 2BKEA 3H4BA 3V6HA 1X9SA 3T5KA 4MEXA 4MEYA 3TFRA 4RQ6A 3RB3A 1XO1A 1NO5A 4IG8A 5KFEA 3OV7A 2BCQA 1YLQA 4B9SA 1ZQJA 1NJYA 4O3OA 4DS5A 2M2WA 3OUYB 4CCHA 3G6YA 9ICUA 1LB2B 3PR5B 4X4TA 4RU9A 3C5FA 2GWSA 2OWOA 2IMWP 4I2IA 5KT5A 4RNNA 4YVZA 3V7LA 1ZYQA 1RXVA 4ED7A 2VA2A 5J0WA 7ICKA 2V4QA 4YMMA 4ECQA 1TK5A 3GILA 2P66A 2PFQA 3PO4A 2M2TA 4JWNA 2PFNA 1S77D 3Q8PB 5J0SA 3RH6A 4KLDA 7ICUA 4JK1A 4ED6A 7ICOA 1PX5A 1DGSA 5KG2A 3G6VA 5DLFA 5KFTA 1SL1A 4RNOA 1NKBA 3M8RA 1ZQIA 2J6SA 1PZNA 1RZTA 4RQ1A 1RYSA 1ZQSA 2FLNA 2HW3A 8ICXA 5D49A 4DFKA 4PGQA 1ZQWA 2I1QA 4PHAA 1NK8A 1IXRA 1JIHA 3AU6A 1ZQEA 9ICVA 1BNOA 1SZPA 4DS4A 1Z00A 4F93B 5HR9A 5HRIA 4YFKA 1S0OA 1T7PA 2ZH2A 4EYHB 1H38A 1KFSA 1D8LA 1TFWA 7ICRA 4J9OA 1ZQRA 4YR0A 1RXWA 3T5LA 9ICJA 5DBCA 3NGDA 2B21A 1F5AA 2ZUCA 4UBBA 4F4ZA 3MDCA 4BXOB 1NJXA 1NKCA 1Z3EB 4P4PA 8ICFA 1VFGA 4WC4A 5DQHA 3LK9A 1B43A 4YR2A 4RWOA 2BCSA 4J9QA 5DG9A 3HX0A 1ZQKA 4I2BA 3C1ZA 4QZDA 4EYIB 1BVSA 4X5VA 5KFJA 3GIMA 2HHSA 4AT8B 5DQGA 5DLGA 3N4MB 1NZPA 3JPRA 2H5XA 5DDMA 2RFFA 4RPXA 5HHIA 3RR8A 4Q8FA 5KT3A 2AQ0A 1TK0A 4F4XA 4WC7A 4QZ8A 4C8LA 4DLGA 4DL3A 4FO6A 2BQRA 5J29A 4O5CA 3JPPA 4Z6DA 4JV2A 2XC9A 4KLEA 2ZUDA 4FS2A 4KTQA 3GFKB 4DL2A 4O3PA 2HHVA 2AGOA 5HP4A 4F4WA 2ASLA 1XSNA 9ICRA 2MUTA 4J9NA 1KLNA 4AT9A 1EXNA 3WFQE 1HJPA 4J9LA 4LVSA 1KFTA 3RJGA 3RJHA 2AQ4A 5KT7A 1TV9A 4IR9A 7ICMA 4FHXA 4MF8A 2HHQA 4F2SA 8ICMA 2Q66A 2BR0A 4DOBA 5DKWA 3MGIA 4DL4A 5HRLA 3PNCA 4MFCA 2BE3A 2W8KA 4AT7B 1ZQDA 5KFNA 4TQSA 4QZHA 5BOLA 4I2FA 5L1LA 2M9NA 2RDIA 1T4GA 3TFSA 9ICWA 2BPCA 4F2RA 1L3SA 4WBZA 7ICIA 4F4YA 3WFSC 4ED0A 1KDHA 3KTQA 5CP2A 9ICXA 4DQRA 5HRGA 5KFQA 3B0YA 3GV7B 4S3NA 4LT6A 4NM2A 4QZCA 1ZQNA 4YP3A 8ICPA 1TFYA 4PH5A 4KLFA 1JXEA 5KTQA 4I2EA 1SKSA 4BWJA 7ICGA 4FH3A 5IIJA 4I29A 5TZVA 1V4AA 2ZJ8A 4KN4A 3HIYA 4DQSA 1D9FA 5J2JA 5KG1A 1SL2A 3V6JA 2V9WA 3QEBZ 4F4KA 4Z6FA 2Y1IA 5HRBA 3EW9A 3QZ8A 4M9GA 2C22A 8ICJA 3H3AA 3PW0A 4RQ2A 5KG6A 2PBEA 2DRAA 2JEIA 4BDPA 4DOCA 2ZH8A 4F92B 5HRDA 1U49A 1ZQGA 8ICQA 3JPSA 4GXKA 4XA5A 5DGBA 1ZJMA 5J0XA 3WFRE 1NK6A 4C8MA 4BGDA 4QWCA 2Y1JA 2W9CB 7ICEA 1Q79A 3H39A 3THVA 3BQTA 4DFJA 1MQ3A 1JXLA 3KHLA 3NYBA 4QWBA 4NY8A 3JPQA 3C2KA 4YMOA 3H4DA 4K4GA 1COOA 1XSPA 3ZDAA 1A76A 4QZFA 4YD1A 4DSFA 5KFXA 5J2DA 3RJJA 3RJIA 4F5RA 1TKDA 5KFGA 3UXOA 5KFLA 1MC8A 4ED3A 2UVUA 3MGHA 2XCAA 2J6TA 4DQQA 3H40A 3GV5B 1ZQUA 4EBEA 3H37A 5EOZA 5CWRA 5DECA 4YD2A 3OGUA 1TAQA 1K1SA 4UB1A 5BPCA 3HWTA 4IRCA 3TAPA 5D4BA 9ICFA 3UQ2A 3C2MA 4KLLA 4NKUA 4O3QA 4TUPA 1KSPA 1U45A 4FBTA 5CR0A 5KFDA 7ICNA 4X0BA 1XC9A 2J6UA 5KG0A 1ZQPA 2BCRA 5D46A 4NKTA 5KT4A 9ICCA 4DF4A 5DB9A 3K4GA 2W9BA 9ICAA 2JEJA 1KEJA 1NJWA 8ICNA 4J9PA 3PVXA 5J0YA 2VANA 5J2CA 3WFPA 4NLNA 1ZQQA 4WC0A 4DOAA 4R65A 5L1KA 1N56A 3UQ0A 1XSLA 2ZTCA 4TUQA 5J2GA 4TUSA 4M9NA 3V7KA 2DR9A 4X4NA 4M2YA 3EPGA 2DR5A 2NRWA 1ZQZA 4ECWA 1QSYA 2C2RA 4C8KA 4UBCA 3M9OB 2FMPA 3E2EA 4X4OA 3Q8MA 3SYZA 5KFAA 5EWEA 4TURA 2JZBB 5IIIA 5J2AA 4UB3A 2XO7A 3BJYA 4DFMA 4P2HA 5KFHA 4Z6CA 4F50A 2HHUA 9ICMA 7ICHA 2ZH5A 2F1HA 3KHHA 2DVIA 3LWMA 5J2KA 5KFRA 3GIJA 3L9DA 4RWQA 7ICQA 3LDAA 2ZTEA 4X0AA 4QZEA 4X4RA 1R8CA 2ZHAA 3KHGA 4M04A 4F5QA 2KTQA 1UEVA 7ICSA 1NK7A 4FH5A 1BPYA 1JMSA 1R8BA 4GXIA 4IQVA 5J2BA 4Q44A 1ZQLA 3ZD9A 4I2CA 3HJ1A 3OUYA 1NK9A 3OVAA 4EBCA 3EYZA 3V72A 2HHTA 3AQLA 4NLZA 2KP7A 4EBKA 4UAWA 4NXZA 3C21A 4EZ9A 1K1QA 3HW8A 4B9NA 2PFPA 4KITB 3QE9Y 1TAUA 1SKWA 3C66A 4ATBB 3TAQA 2FLPA 2ZUBA 2IBKA 4ECVA 1ZQAA 2R8KA 4J9KA 2BQUA 2HHWA 8ICHA 1IM4A 8ICAA 4C8OA 4KMUA 4DF8A 2AGQA 3RTVA 1ZJNA 2KZZA 4ECXA 3GIKA 1OU5A 4M6WB 4C8NA 8ICYA 2BCUA 1AROP 1Q78A 4GLXA 1NJZA 4DLEA 1NKEA 1S97A 4K4HA 4DSLA 4EZ6A 3WFOA 2DR7A 3GIIA 1JN3A 4F3OA 5KFWA 3PMLA 1UT8A 4RQ7A 3H8SA 3AUOA 9ICPA 3H8WA 1NK4A 4WCWA 2JZBA 4ECYA 5KFVA 4DSEA 3SV4A 3JYYA 2ZH9A 4KLGA 4E8FA 5HMLA 4I28A 8ICWA 3OVSA 2FLLA 5HREA 4PHEA 4RPYA 8ICRA 2ASJA 4O5KA 4IRDA 3NTUA 2DR8A 4I2DA 9ICNA 4BXOA 4LZGA 1JQRA 1QTMA 3C18A 3V7JA 5IINA 2P6RA 9ICIA 2XCPA 1MSWD 3RRGA 1MIWA 1VJ7A 3C1YA 4XRHA 5F9LA 2ZH7A 9ICGA 5DG7A 2DFLA 2DRBA 4AT8A 3B0XA 4RQ8A 1RYRA 2FPLA 2R8GA 4XQ8A 2R8JA 5CA7A 1C7YA 4F5PA 4EEYA 8ICSA 4PGYA 3RBEA 2UVWA 4RWNA 4FHYA 4GC6A 4UAYA 1ZQVA 4RWPA 4PGXA 4E80A 3UPQA 3PY8A 4X4PA 1NK5A 4DQPA 5L1IA 4B9MA 1L3TA 5KG5A 4DSJA 3AU2A 4M6WA 1MIYA 3PW7A 1T8EA 5DEDA 3PX6A 4B9UA 1L5UA 3M9MB 4WC1A 5DBBA 4PHDA 8ICCA 3GDXA 9ICLA 4ED1A 4KLQA 4ED2A 2DPIA 1KFDA 2UVVA 3RAQA 2ZJ5A 5KFIA 1NOMA 4R8UB 3PMNA 3MR6A 3ZDDA 4IQUA 2JEGA 1Y88A 1WCNA 5J0TA 1A77A 4M0AA 4ECUA 4AT7A 5KFFA 1ZQOA 2C2EA 4O0IA 9ICQA 1UA0A 1S0NA 3RJEA 4KLTA 3OHAA 9ICHA 4YCXA 2UVRA 3LQCB 4WC3A 3ZDCA 2BDPA 5KFCA 1U48A 1S10A 4KLIA 3EZ5A 4RNMA 2ATLA 1D8YA 1BPBA 4Z6EA 5HMMA 3BQ0A 4GXJA 4YQWA 4ED8A 1DK2A 4R63A 4DO9A 1FA0A 2ISPA 5HRKA 1X9WA 5J2HA 1ZQHA 3PO5A 4FBUA 4ECTA 5HC9A 5KFOA 3MDAA 4ELTA 3G6XA 1S76D 4FHWA 3IM1A 2FMQA 5J0PA 2IA6A 2F1JA 4YR3A 4ECSA 4UD5A 4EP7A 4X4QA 3SV3A 4AT9B 1TVAA 2ZH6A 3MBYA 2BQ3A 1L3UA 5IIKA 5L1JA 3T3FA 2ZHBA 4I2JA 3PW2A 2F1IA 9ICTA 4BWMA 3TI0A 3AQMA 5F2VO 3FYHA 3T5JA 1BPXA 1B22A 4G3IA 2KZ3A 5KT2A 1Z00B 4M9JA 3UXNA 3RB4A 1KRPA 3QZ7A 1UEUA 3EWAA 3ETLA 8ICTA 8ICEA 3FDSA 4EBJA 4FHVA 3GQCA 2ZJAA 5DB7A 1UETA 2W9CA 2ZH3A 4ECRA 5IIMA 3RJFA 4P4MA 3PW4A 2V4RA 4IRKA 2FMSA 4DSIA 4F8RA 1ZQCA 2KZMA 2P6UA 4DL7A 2A1JB 4DL5A 1TK8A 3H7IA 1MQ2A 3M8SA 5KG7A 2O5AA 4RQ3A 8ICZA 2VA3A 3ISDA 5KFBA 1ZETA 3TANA 3Q8SB 4B9LA 5F9NA 1V9PA 1QSSA 4JWMA 1WOTA 4NLGA 1JX4A 1BGXT 3ZD8A 3MABA 4QZGA 3OJSA 4K4IA 1RPLA 5JUMA 4O5EA 2XGQA 7ICJA 1R89A 3JPNA 2Q0ZX 1SL0A 4EBDA 3BQ2A 5J0RA 3MFIA 4KLSA 1BPDA 3QEAZ 3C2LA 2KN7A 2AGPA 4FHPA 2VA8A 4RT3A 1X2IA 2PFOA 2BHNA 2MAXA 3K75D 7ICVA 4JV0A 4KN7A 5KFZA 3Q8KA 2PI5A 4JV1A 5HRFA 2MUTB 3EPIA 3N97B 3C23A 3HPOA 3Q8LA 1N48A 3PW5A 5J2FA 1XWLA 4DL6A 4M47A 1XS9D 1DK3A 4UB5A 3JZ0A 4JUZA 2ZH1A 2C2DA 4GC7A 7ICTA 3OJUA 8ICLA 1ZQBA 8ICBA 2W8LA 4I2HA 1XU4A 5HNKA 1SKRA 1HUZA 8ICGA 1CEZA 4J9MA 4WBYA 2O1PA 4E0DA 5DQIA 4RUCA 4R66A 2M2VA 4I2GA 4QWAA 3M9NB 2IHMA 2NRVA 9ICSA 4XUSA 2XY7A 5DBAA 4X4UA 1CUKA 2A1JA 3RRHA 5J0QA 1ZQTA 2WTFA 4DSKA 3PR4A 4IR1A 5IILA 4F91B 3TARA 2DPJA 3V6KA 4DFPA 5IIOA 2W9AA 4M5DA 4QZIA 2ZH4A 2FPMA 5CHGA 1L3VA 4PPXA 5DGAA 2XY5A 3RAXA 3ORYA 3RR7A 2XY6A 2BPGA 4IQWA 4F5OA 2I9GA 3TQ1A 9ICBA 5J2IA 3GV8B 3OSNA 5BOMA 2PI4A 1KNYA 3MFHA 8ICOA 1TFRA 3RH4A 3ZDEA 4RUAA 2LYHA 3RH5A 2ID1A 4QZ9A 4UB2A 3KHRA 4X4SA 4YG2A 5L9XA 4QW9A 4E7XA 3Q8RB 5HHHA 3H8JA 4R64A 4QWEA 3OHBA 3RB0A 3C5GA 1ZQXA 2BGWA 3IHQB 3SZ2A 3BDPA 2NRTA 4O3NA 5J0OA 7ICLA 3JPOA 3AQKA 4XQ7A 5KFUA 4QW8A 3RB6A 4YMNA 5KT6A 2HHPA 4WC2A 2NRXA 4DQIA 2AJQA 4X4VA 4NM1A 4F5NA 5CB1A 5CJ7A 1BPZA 1BPEA 4YN4A 4UQGA 5DB8A 3ISBA 1U47A 2BPFA 7ICPA 1R8AA 4ELVA 4O3SA 4DEZA 1S0VA 2KFNA 4ATBA 1UT5A 2ZTDA 2PXIA 4Q43A 1X9MA 3HT3A 4B9TA 3OSPA 1DOQA 3PX0A 2JEFA 5KFPA 9ICEA 3H38A 3PV8A 4RQ0A 3MR2A 4J9SA 4I27A 5KFYA 2ALZA 4RQ4A 2BCVA 4DWIA 5DB6A 2ISOA 4O3RA 5KG3A 1JAJA 4QZBA 4RQ5A 3Q8QB 5KFKA 4B9VA 2ASDA 4QWDA 1ZQYA 4YXMA 3LWLA 7ICFA 3ZDBA 1MIVA 4ELUA 4KLHA 3MR3A 1T3NA 4KLOA 2W9MA 4YXJA 4Q45A 5KFSA 4FS1A 4ZH4A 4KLUA 2HVIA 3UXPA 4IQTA 4NLKA 3MR5A 4RT2A 2W9BB 3JPTA 3RJKA 4WC5A 5DG8A 4I2AA 3PX4A 4ECZA 4RPZA 4UAZA 4MFFA 3T5HA 4TQRA 2C28A 8ICVA 1UA1A 9ICKA 2NRZA 2NRKA 3BQ1A 2KFZA 5J2EA 2FPKA 1S0MA 2HVHA 4PHPA 4RZRA 4KLJA 3OVBA 4J9RA 2AU0A 4LZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYK A;  5EWG A;  3SI8 A;  9ICO A;  4QZA A;  2RDJ A;  1ZQF A;  5HRH A;  4MFA A;  4M9H A;  1ZQM A;  3AQN A;  5EWF A;  2HHX A;  1KTQ A;  3HP6 A;  8ICU A;  4UB4 A;  5KG4 A;  1D9D A;  1QSL A;  2IHN A;  1WCL A;  2R8H A;  5J0U A;  4M9L A;  1BNP A;  2M2U A;  4UD4 A;  4KLM A;  5C5J A;  3RBD A;  1NK0 A;  5DDY A;  2R8I A;  1U9L A;  4P4O A;  4MF2 A;  3UPS A;  1QLN A;  4WC6 A;  5KFM A;  3HJ4 A;  4Q8E A;  1LV5 A;  1HUO A;  1U4B A;  3ISC A;  8ICK A;  4O9M A;  1S9F A;  8ICI A;  2XGP A;  4R8U A;  2BKE A;  3H4B A;  3V6H A;  1X9S A;  3T5K A;  4MEX A;  4MEY A;  3TFR A;  4RQ6 A;  3RB3 A;  1XO1 A;  1NO5 A;  4IG8 A;  5KFE A;  3OV7 A;  2BCQ A;  1YLQ A;  4B9S A;  1ZQJ A;  1NJY A;  4O3O A;  4DS5 A;  2M2W A;  3OUY B;  4CCH A;  3G6Y A;  9ICU A;  1LB2 B;  3PR5 B;  4X4T A;  4RU9 A;  3C5F A;  2GWS A;  2OWO A;  2IMW P;  4I2I A;  5KT5 A;  4RNN A;  4YVZ A;  3V7L A;  1ZYQ A;  1RXV A;  4ED7 A;  2VA2 A;  5J0W A;  7ICK A;  2V4Q A;  4YMM A;  4ECQ A;  1TK5 A;  3GIL A;  2P66 A;  2PFQ A;  3PO4 A;  2M2T A;  4JWN A;  2PFN A;  1S77 D;  3Q8P B;  5J0S A;  3RH6 A;  4KLD A;  7ICU A;  4JK1 A;  4ED6 A;  7ICO A;  1PX5 A;  1DGS A;  5KG2 A;  3G6V A;  5DLF A;  5KFT A;  1SL1 A;  4RNO A;  1NKB A;  3M8R A;  1ZQI A;  2J6S A;  1PZN A;  1RZT A;  4RQ1 A;  1RYS A;  1ZQS A;  2FLN A;  2HW3 A;  8ICX A;  5D49 A;  4DFK A;  4PGQ A;  1ZQW A;  2I1Q A;  4PHA A;  1NK8 A;  1IXR A;  1JIH A;  3AU6 A;  1ZQE A;  9ICV A;  1BNO A;  1SZP A;  4DS4 A;  1Z00 A;  4F93 B;  5HR9 A;  5HRI A;  4YFK A;  1S0O A;  1T7P A;  2ZH2 A;  4EYH B;  1H38 A;  1KFS A;  1D8L A;  1TFW A;  7ICR A;  4J9O A;  1ZQR A;  4YR0 A;  1RXW A;  3T5L A;  9ICJ A;  5DBC A;  3NGD A;  2B21 A;  1F5A A;  2ZUC A;  4UBB A;  4F4Z A;  3MDC A;  4BXO B;  1NJX A;  1NKC A;  1Z3E B;  4P4P A;  8ICF A;  1VFG A;  4WC4 A;  5DQH A;  3LK9 A;  1B43 A;  4YR2 A;  4RWO A;  2BCS A;  4J9Q A;  5DG9 A;  3HX0 A;  1ZQK A;  4I2B A;  3C1Z A;  4QZD A;  4EYI B;  1BVS A;  4X5V A;  5KFJ A;  3GIM A;  2HHS A;  4AT8 B;  5DQG A;  5DLG A;  3N4M B;  1NZP A;  3JPR A;  2H5X A;  5DDM A;  2RFF A;  4RPX A;  5HHI A;  3RR8 A;  4Q8F A;  5KT3 A;  2AQ0 A;  1TK0 A;  4F4X A;  4WC7 A;  4QZ8 A;  4C8L A;  4DLG A;  4DL3 A;  4FO6 A;  2BQR A;  5J29 A;  4O5C A;  3JPP A;  4Z6D A;  4JV2 A;  2XC9 A;  4KLE A;  2ZUD A;  4FS2 A;  4KTQ A;  3GFK B;  4DL2 A;  4O3P A;  2HHV A;  2AGO A;  5HP4 A;  4F4W A;  2ASL A;  1XSN A;  9ICR A;  2MUT A;  4J9N A;  1KLN A;  4AT9 A;  1EXN A;  3WFQ E;  1HJP A;  4J9L A;  4LVS A;  1KFT A;  3RJG A;  3RJH A;  2AQ4 A;  5KT7 A;  1TV9 A;  4IR9 A;  7ICM A;  4FHX A;  4MF8 A;  2HHQ A;  4F2S A;  8ICM A;  2Q66 A;  2BR0 A;  4DOB A;  5DKW A;  3MGI A;  4DL4 A;  5HRL A;  3PNC A;  4MFC A;  2BE3 A;  2W8K A;  4AT7 B;  1ZQD A;  5KFN A;  4TQS A;  4QZH A;  5BOL A;  4I2F A;  5L1L A;  2M9N A;  2RDI A;  1T4G A;  3TFS A;  9ICW A;  2BPC A;  4F2R A;  1L3S A;  4WBZ A;  7ICI A;  4F4Y A;  3WFS C;  4ED0 A;  1KDH A;  3KTQ A;  5CP2 A;  9ICX A;  4DQR A;  5HRG A;  5KFQ A;  3B0Y A;  3GV7 B;  4S3N A;  4LT6 A;  4NM2 A;  4QZC A;  1ZQN A;  4YP3 A;  8ICP A;  1TFY A;  4PH5 A;  4KLF A;  1JXE A;  5KTQ A;  4I2E A;  1SKS A;  4BWJ A;  7ICG A;  4FH3 A;  5IIJ A;  4I29 A;  5TZV A;  1V4A A;  2ZJ8 A;  4KN4 A;  3HIY A;  4DQS A;  1D9F A;  5J2J A;  5KG1 A;  1SL2 A;  3V6J A;  2V9W A;  3QEB Z;  4F4K A;  4Z6F A;  2Y1I A;  5HRB A;  3EW9 A;  3QZ8 A;  4M9G A;  2C22 A;  8ICJ A;  3H3A A;  3PW0 A;  4RQ2 A;  5KG6 A;  2PBE A;  2DRA A;  2JEI A;  4BDP A;  4DOC A;  2ZH8 A;  4F92 B;  5HRD A;  1U49 A;  1ZQG A;  8ICQ A;  3JPS A;  4GXK A;  4XA5 A;  5DGB A;  1ZJM A;  5J0X A;  3WFR E;  1NK6 A;  4C8M A;  4BGD A;  4QWC A;  2Y1J A;  2W9C B;  7ICE A;  1Q79 A;  3H39 A;  3THV A;  3BQT A;  4DFJ A;  1MQ3 A;  1JXL A;  3KHL A;  3NYB A;  4QWB A;  4NY8 A;  3JPQ A;  3C2K A;  4YMO A;  3H4D A;  4K4G A;  1COO A;  1XSP A;  3ZDA A;  1A76 A;  4QZF A;  4YD1 A;  4DSF A;  5KFX A;  5J2D A;  3RJJ A;  3RJI A;  4F5R A;  1TKD A;  5KFG A;  3UXO A;  5KFL A;  1MC8 A;  4ED3 A;  2UVU A;  3MGH A;  2XCA A;  2J6T A;  4DQQ A;  3H40 A;  3GV5 B;  1ZQU A;  4EBE A;  3H37 A;  5EOZ A;  5CWR A;  5DEC A;  4YD2 A;  3OGU A;  1TAQ A;  1K1S A;  4UB1 A;  5BPC A;  3HWT A;  4IRC A;  3TAP A;  5D4B A;  9ICF A;  3UQ2 A;  3C2M A;  4KLL A;  4NKU A;  4O3Q A;  4TUP A;  1KSP A;  1U45 A;  4FBT A;  5CR0 A;  5KFD A;  7ICN A;  4X0B A;  1XC9 A;  2J6U A;  5KG0 A;  1ZQP A;  2BCR A;  5D46 A;  4NKT A;  5KT4 A;  9ICC A;  4DF4 A;  5DB9 A;  3K4G A;  2W9B A;  9ICA A;  2JEJ A;  1KEJ A;  1NJW A;  8ICN A;  4J9P A;  3PVX A;  5J0Y A;  2VAN A;  5J2C A;  3WFP A;  4NLN A;  1ZQQ A;  4WC0 A;  4DOA A;  4R65 A;  5L1K A;  1N56 A;  3UQ0 A;  1XSL A;  2ZTC A;  4TUQ A;  5J2G A;  4TUS A;  4M9N A;  3V7K A;  2DR9 A;  4X4N A;  4M2Y A;  3EPG A;  2DR5 A;  2NRW A;  1ZQZ A;  4ECW A;  1QSY A;  2C2R A;  4C8K A;  4UBC A;  3M9O B;  2FMP A;  3E2E A;  4X4O A;  3Q8M A;  3SYZ A;  5KFA A;  5EWE A;  4TUR A;  2JZB B;  5III A;  5J2A A;  4UB3 A;  2XO7 A;  3BJY A;  4DFM A;  4P2H A;  5KFH A;  4Z6C A;  4F50 A;  2HHU A;  9ICM A;  7ICH A;  2ZH5 A;  2F1H A;  3KHH A;  2DVI A;  3LWM A;  5J2K A;  5KFR A;  3GIJ A;  3L9D A;  4RWQ A;  7ICQ A;  3LDA A;  2ZTE A;  4X0A A;  4QZE A;  4X4R A;  1R8C A;  2ZHA A;  3KHG A;  4M04 A;  4F5Q A;  2KTQ A;  1UEV A;  7ICS A;  1NK7 A;  4FH5 A;  1BPY A;  1JMS A;  1R8B A;  4GXI A;  4IQV A;  5J2B A;  4Q44 A;  1ZQL A;  3ZD9 A;  4I2C A;  3HJ1 A;  3OUY A;  1NK9 A;  3OVA A;  4EBC A;  3EYZ A;  3V72 A;  2HHT A;  3AQL A;  4NLZ A;  2KP7 A;  4EBK A;  4UAW A;  4NXZ A;  3C21 A;  4EZ9 A;  1K1Q A;  3HW8 A;  4B9N A;  2PFP A;  4KIT B;  3QE9 Y;  1TAU A;  1SKW A;  3C66 A;  4ATB B;  3TAQ A;  2FLP A;  2ZUB A;  2IBK A;  4ECV A;  1ZQA A;  2R8K A;  4J9K A;  2BQU A;  2HHW A;  8ICH A;  1IM4 A;  8ICA A;  4C8O A;  4KMU A;  4DF8 A;  2AGQ A;  3RTV A;  1ZJN A;  2KZZ A;  4ECX A;  3GIK A;  1OU5 A;  4M6W B;  4C8N A;  8ICY A;  2BCU A;  1ARO P;  1Q78 A;  4GLX A;  1NJZ A;  4DLE A;  1NKE A;  1S97 A;  4K4H A;  4DSL A;  4EZ6 A;  3WFO A;  2DR7 A;  3GII A;  1JN3 A;  4F3O A;  5KFW A;  3PML A;  1UT8 A;  4RQ7 A;  3H8S A;  3AUO A;  9ICP A;  3H8W A;  1NK4 A;  4WCW A;  2JZB A;  4ECY A;  5KFV A;  4DSE A;  3SV4 A;  3JYY A;  2ZH9 A;  4KLG A;  4E8F A;  5HML A;  4I28 A;  8ICW A;  3OVS A;  2FLL A;  5HRE A;  4PHE A;  4RPY A;  8ICR A;  2ASJ A;  4O5K A;  4IRD A;  3NTU A;  2DR8 A;  4I2D A;  9ICN A;  4BXO A;  4LZG A;  1JQR A;  1QTM A;  3C18 A;  3V7J A;  5IIN A;  2P6R A;  9ICI A;  2XCP A;  1MSW D;  3RRG A;  1MIW A;  1VJ7 A;  3C1Y A;  4XRH A;  5F9L A;  2ZH7 A;  9ICG A;  5DG7 A;  2DFL A;  2DRB A;  4AT8 A;  3B0X A;  4RQ8 A;  1RYR A;  2FPL A;  2R8G A;  4XQ8 A;  2R8J A;  5CA7 A;  1C7Y A;  4F5P A;  4EEY A;  8ICS A;  4PGY A;  3RBE A;  2UVW A;  4RWN A;  4FHY A;  4GC6 A;  4UAY A;  1ZQV A;  4RWP A;  4PGX A;  4E80 A;  3UPQ A;  3PY8 A;  4X4P A;  1NK5 A;  4DQP A;  5L1I A;  4B9M A;  1L3T A;  5KG5 A;  4DSJ A;  3AU2 A;  4M6W A;  1MIY A;  3PW7 A;  1T8E A;  5DED A;  3PX6 A;  4B9U A;  1L5U A;  3M9M B;  4WC1 A;  5DBB A;  4PHD A;  8ICC A;  3GDX A;  9ICL A;  4ED1 A;  4KLQ A;  4ED2 A;  2DPI A;  1KFD A;  2UVV A;  3RAQ A;  2ZJ5 A;  5KFI A;  1NOM A;  4R8U B;  3PMN A;  3MR6 A;  3ZDD A;  4IQU A;  2JEG A;  1Y88 A;  1WCN A;  5J0T A;  1A77 A;  4M0A A;  4ECU A;  4AT7 A;  5KFF A;  1ZQO A;  2C2E A;  4O0I A;  9ICQ A;  1UA0 A;  1S0N A;  3RJE A;  4KLT A;  3OHA A;  9ICH A;  4YCX A;  2UVR A;  3LQC B;  4WC3 A;  3ZDC A;  2BDP A;  5KFC A;  1U48 A;  1S10 A;  4KLI A;  3EZ5 A;  4RNM A;  2ATL A;  1D8Y A;  1BPB A;  4Z6E A;  5HMM A;  3BQ0 A;  4GXJ A;  4YQW A;  4ED8 A;  1DK2 A;  4R63 A;  4DO9 A;  1FA0 A;  2ISP A;  5HRK A;  1X9W A;  5J2H A;  1ZQH A;  3PO5 A;  4FBU A;  4ECT A;  5HC9 A;  5KFO A;  3MDA A;  4ELT A;  3G6X A;  1S76 D;  4FHW A;  3IM1 A;  2FMQ A;  5J0P A;  2IA6 A;  2F1J A;  4YR3 A;  4ECS A;  4UD5 A;  4EP7 A;  4X4Q A;  3SV3 A;  4AT9 B;  1TVA A;  2ZH6 A;  3MBY A;  2BQ3 A;  1L3U A;  5IIK A;  5L1J A;  3T3F A;  2ZHB A;  4I2J A;  3PW2 A;  2F1I A;  9ICT A;  4BWM A;  3TI0 A;  3AQM A;  5F2V O;  3FYH A;  3T5J A;  1BPX A;  1B22 A;  4G3I A;  2KZ3 A;  5KT2 A;  1Z00 B;  4M9J A;  3UXN A;  3RB4 A;  1KRP A;  3QZ7 A;  1UEU A;  3EWA A;  3ETL A;  8ICT A;  8ICE A;  3FDS A;  4EBJ A;  4FHV A;  3GQC A;  2ZJA A;  5DB7 A;  1UET A;  2W9C A;  2ZH3 A;  4ECR A;  5IIM A;  3RJF A;  4P4M A;  3PW4 A;  2V4R A;  4IRK A;  2FMS A;  4DSI A;  4F8R A;  1ZQC A;  2KZM A;  2P6U A;  4DL7 A;  2A1J B;  4DL5 A;  1TK8 A;  3H7I A;  1MQ2 A;  3M8S A;  5KG7 A;  2O5A A;  4RQ3 A;  8ICZ A;  2VA3 A;  3ISD A;  5KFB A;  1ZET A;  3TAN A;  3Q8S B;  4B9L A;  5F9N A;  1V9P A;  1QSS A;  4JWM A;  1WOT A;  4NLG A;  1JX4 A;  1BGX T;  3ZD8 A;  3MAB A;  4QZG A;  3OJS A;  4K4I A;  1RPL A;  5JUM A;  4O5E A;  2XGQ A;  7ICJ A;  1R89 A;  3JPN A;  2Q0Z X;  1SL0 A;  4EBD A;  3BQ2 A;  5J0R A;  3MFI A;  4KLS A;  1BPD A;  3QEA Z;  3C2L A;  2KN7 A;  2AGP A;  4FHP A;  2VA8 A;  4RT3 A;  1X2I A;  2PFO A;  2BHN A;  2MAX A;  3K75 D;  7ICV A;  4JV0 A;  4KN7 A;  5KFZ A;  3Q8K A;  2PI5 A;  4JV1 A;  5HRF A;  2MUT B;  3EPI A;  3N97 B;  3C23 A;  3HPO A;  3Q8L A;  1N48 A;  3PW5 A;  5J2F A;  1XWL A;  4DL6 A;  4M47 A;  1XS9 D;  1DK3 A;  4UB5 A;  3JZ0 A;  4JUZ A;  2ZH1 A;  2C2D A;  4GC7 A;  7ICT A;  3OJU A;  8ICL A;  1ZQB A;  8ICB A;  2W8L A;  4I2H A;  1XU4 A;  5HNK A;  1SKR A;  1HUZ A;  8ICG A;  1CEZ A;  4J9M A;  4WBY A;  2O1P A;  4E0D A;  5DQI A;  4RUC A;  4R66 A;  2M2V A;  4I2G A;  4QWA A;  3M9N B;  2IHM A;  2NRV A;  9ICS A;  4XUS A;  2XY7 A;  5DBA A;  4X4U A;  1CUK A;  2A1J A;  3RRH A;  5J0Q A;  1ZQT A;  2WTF A;  4DSK A;  3PR4 A;  4IR1 A;  5IIL A;  4F91 B;  3TAR A;  2DPJ A;  3V6K A;  4DFP A;  5IIO A;  2W9A A;  4M5D A;  4QZI A;  2ZH4 A;  2FPM A;  5CHG A;  1L3V A;  4PPX A;  5DGA A;  2XY5 A;  3RAX A;  3ORY A;  3RR7 A;  2XY6 A;  2BPG A;  4IQW A;  4F5O A;  2I9G A;  3TQ1 A;  9ICB A;  5J2I A;  3GV8 B;  3OSN A;  5BOM A;  2PI4 A;  1KNY A;  3MFH A;  8ICO A;  1TFR A;  3RH4 A;  3ZDE A;  4RUA A;  2LYH A;  3RH5 A;  2ID1 A;  4QZ9 A;  4UB2 A;  3KHR A;  4X4S A;  4YG2 A;  5L9X A;  4QW9 A;  4E7X A;  3Q8R B;  5HHH A;  3H8J A;  4R64 A;  4QWE A;  3OHB A;  3RB0 A;  3C5G A;  1ZQX A;  2BGW A;  3IHQ B;  3SZ2 A;  3BDP A;  2NRT A;  4O3N A;  5J0O A;  7ICL A;  3JPO A;  3AQK A;  4XQ7 A;  5KFU A;  4QW8 A;  3RB6 A;  4YMN A;  5KT6 A;  2HHP A;  4WC2 A;  2NRX A;  4DQI A;  2AJQ A;  4X4V A;  4NM1 A;  4F5N A;  5CB1 A;  5CJ7 A;  1BPZ A;  1BPE A;  4YN4 A;  4UQG A;  5DB8 A;  3ISB A;  1U47 A;  2BPF A;  7ICP A;  1R8A A;  4ELV A;  4O3S A;  4DEZ A;  1S0V A;  2KFN A;  4ATB A;  1UT5 A;  2ZTD A;  2PXI A;  4Q43 A;  1X9M A;  3HT3 A;  4B9T A;  3OSP A;  1DOQ A;  3PX0 A;  2JEF A;  5KFP A;  9ICE A;  3H38 A;  3PV8 A;  4RQ0 A;  3MR2 A;  4J9S A;  4I27 A;  5KFY A;  2ALZ A;  4RQ4 A;  2BCV A;  4DWI A;  5DB6 A;  2ISO A;  4O3R A;  5KG3 A;  1JAJ A;  4QZB A;  4RQ5 A;  3Q8Q B;  5KFK A;  4B9V A;  2ASD A;  4QWD A;  1ZQY A;  4YXM A;  3LWL A;  7ICF A;  3ZDB A;  1MIV A;  4ELU A;  4KLH A;  3MR3 A;  1T3N A;  4KLO A;  2W9M A;  4YXJ A;  4Q45 A;  5KFS A;  4FS1 A;  4ZH4 A;  4KLU A;  2HVI A;  3UXP A;  4IQT A;  4NLK A;  3MR5 A;  4RT2 A;  2W9B B;  3JPT A;  3RJK A;  4WC5 A;  5DG8 A;  4I2A A;  3PX4 A;  4ECZ A;  4RPZ A;  4UAZ A;  4MFF A;  3T5H A;  4TQR A;  2C28 A;  8ICV A;  1UA1 A;  9ICK A;  2NRZ A;  2NRK A;  3BQ1 A;  2KFZ A;  5J2E A;  2FPK A;  1S0M A;  2HVH A;  4PHP A;  4RZR A;  4KLJ A;  3OVB A;  4J9R A;  2AU0 A;  4LZD A; 
#chains in the Genus database with same CATH topology
 4HYK A;  5EWG A;  4CGZ A;  2E1E A;  3QNM A;  5AM3 A;  4LEY A;  2ZIX B;  1PVQ A;  5ALD A;  3RBD A;  1NK0 A;  5DDY A;  2R8I A;  1U9L A;  4P4O A;  4MF2 A;  2KSO B;  3HJ4 A;  1X42 A;  4UB6 U;  4O9M A;  8ICI A;  3CK6 A;  4MEX A;  3BZC A;  3T5K A;  1RQN A;  4MEY A;  1MN8 A;  3TFR A;  3LVW A;  4OO1 J;  1XO1 A;  2DKZ A;  2CN1 A;  5KFE A;  3OV7 A;  2BCQ A;  2KEY A;  4B9S A;  4GFJ A;  3PSP A;  4CCH A;  4X4T A;  4NLB A;  3PR5 B;  2D6F C;  3PST A;  2EZX A;  4RNN A;  4YVZ A;  3V7L A;  4K9B A;  3NVO A;  2JH7 A;  4YMM A;  4ECQ A;  2P66 A;  3PO4 A;  2M2T A;  4NL9 A;  3RH6 A;  4KLD A;  4JK1 A;  2J6S A;  3M8R A;  1RZT A;  4RQ1 A;  3ALR A;  2KJ8 A;  2M0N A;  2FLN A;  2HW3 A;  2XVT A;  2KIC A;  8ICX A;  2AHO B;  1YZ6 A;  1BNO A;  1JIH A;  3AN1 A;  1ZQE A;  4C7Z A;  4DS4 A;  2ZIX A;  5ALG A;  4EYH B;  3DEE A;  2KSO A;  4J9O A;  4YR0 A;  1RXW A;  2W43 A;  5GTH U;  3NGD A;  4UBB A;  4AYB C;  3MDC A;  1NKC A;  4WC4 A;  5DQH A;  2BCS A;  3HX0 A;  5AI8 A;  4I2B A;  4EYI B;  4AT8 B;  1NZP A;  3JPR A;  2RFF A;  5AI6 A;  5AI5 A;  3RR8 A;  4Q8F A;  4IL6 U;  2AQ0 A;  2K89 A;  2H3I A;  2Y0S F;  4DLG A;  4FO6 A;  2BQR A;  4Z6D A;  3HKZ F;  4FS2 A;  4KTQ A;  5CFU A;  4NV0 A;  4Y2U A;  4O3P A;  1L8O A;  3S6J A;  3WKE A;  1XSN A;  2W04 A;  1EXN A;  3WFQ E;  4UAT A;  2AQ4 A;  5KT7 A;  4FHX A;  3MGV A;  5AIB A;  2Q66 A;  4DOB A;  4F71 A;  3MGI A;  4MFC A;  2BE3 A;  2YMQ A;  3N7R C;  5D62 A;  4S3N A;  4C4T A;  4QZC A;  2XID A;  1DXS A;  4PH5 A;  4I2E A;  5EE1 A;  4I29 A;  1D9F A;  5KG1 A;  5ALE A;  3QEB Z;  3NWI A;  4M9G A;  3H3A A;  3PW0 A;  2DRA A;  2JEI A;  4DOC A;  4O6A A;  4F92 B;  1U49 A;  3JPS A;  4BUG A;  2JMG A;  5B3P A;  4C8M A;  3H39 A;  2W9C B;  1Q79 A;  3THV A;  1MQ3 A;  5H2F U;  1JXL A;  5E79 U;  4YMO A;  1PVP A;  1WUD A;  4DSF A;  1X6J A;  5KFG A;  1MC8 A;  3C29 A;  2XCA A;  5ALR A;  3C28 A;  4DQQ A;  3WKA A;  4ICA A;  3DDH A;  3GV5 B;  4IC9 A;  4UB1 A;  9ICF A;  4KLL A;  4TUP A;  2XI9 A;  1XC9 A;  2KHQ A;  5D46 A;  5KT4 A;  9ICC A;  4DF4 A;  5AKK A;  1NJW A;  2ZG6 A;  5J2C A;  4FZL A;  2Q4T A;  4UB8 U;  4NLN A;  2LM4 A;  5AM2 A;  2B6G A;  3EF2 A;  5KL1 B;  5L1K A;  1N56 A;  3BS5 B;  2FMP A;  1V85 A;  5KFA A;  5EWE A;  5J2A A;  4P2H A;  3WK8 A;  2ZH5 A;  7ICH A;  1SWV A;  1VLB A;  4OAH A;  2F1H A;  5KFR A;  3GIJ A;  3TKA A;  4F72 A;  7ICQ A;  3H8M A;  4X0A A;  4QZE A;  2ZHA A;  4M04 A;  2KTQ A;  3KBB A;  1NK7 A;  4FH5 A;  1BPY A;  5J2B A;  4Q44 A;  4EX7 A;  3V72 A;  4NLZ A;  2KP7 A;  4EZ9 A;  3HW8 A;  4B9N A;  4ATB B;  1ZQA A;  2R8K A;  2HHW A;  4C8O A;  1A6S A;  3GIK A;  5ALU A;  1OU5 A;  2DL0 A;  1ARO P;  2BCU A;  2KKV A;  1NJZ A;  2DR7 A;  2OEH A;  4UAU A;  2KIW A;  1WWV A;  1NK4 A;  4EX6 A;  2F2A B;  4ECY A;  3SV4 A;  1SV0 C;  2DBY A;  3AMZ A;  8ICW A;  1ED1 A;  5HRE A;  1RQL A;  5IIN A;  1MSW D;  3RRG A;  1MIW A;  2ZH7 A;  5AKY A;  5DG7 A;  2FPL A;  2R8J A;  8ICS A;  1PUZ A;  3MCR A;  4RWN A;  2WAQ C;  4RWP A;  3UPQ A;  1YZ7 A;  5L1I A;  1L3T A;  5KG5 A;  1Z4O A;  8ICC A;  4ED1 A;  2KJ9 A;  5AKX A;  2ZJ5 A;  4R8U B;  2JEG A;  1Y88 A;  1WCN A;  2HBM A;  5KFF A;  2C2E A;  4O0I A;  3LQC B;  4YCX A;  4WC3 A;  2NO5 A;  5J8Y C;  1S10 A;  4RNM A;  1D8Y A;  2RRD A;  3BQ0 A;  1DK2 A;  5JRT A;  4DO9 A;  1X9W A;  1ZQH A;  1S76 D;  2YN4 A;  4YR3 A;  4ECS A;  4OJ5 A;  1TVA A;  2BQ3 A;  2KNJ A;  2QLT A;  3T3F A;  2KZ3 A;  5KT2 A;  3EWA A;  3ETL A;  8ICT A;  4FHV A;  2YMM A;  2OH2 A;  3BS7 A;  3D2Q A;  5DB7 A;  1ZXI A;  3ED5 A;  5IIM A;  3RJF A;  2ZH3 A;  4P4M A;  3PW4 A;  2V4R A;  2FMS A;  1ZQC A;  4OJ6 A;  4RQ3 A;  8ICZ A;  3ISD A;  2EAM A;  4O68 A;  2JRZ A;  1BGX T;  5AK5 A;  3MAB A;  4RQM A;  3OJS A;  5JUM A;  1R89 A;  1D8B A;  3AEV A;  2Q0Z X;  4EBD A;  3BQ2 A;  5J0R A;  3K75 D;  7ICV A;  4KN7 A;  5KFZ A;  1JRO A;  5J2F A;  1XWL A;  2XIC A;  3JZ0 A;  4JUZ A;  1FO4 A;  2E8P A;  2W8L A;  5HNK A;  1HUZ A;  8ICG A;  2KE7 A;  5GTI U;  2IHM A;  4P0P B;  9ICS A;  3TAR A;  3SQI A;  4CF4 A;  2DPJ A;  3V6K A;  5CHG A;  3UMG A;  1XO0 A;  2E5S A;  1SV4 A;  3TQ1 A;  3OWG A;  4C4R A;  2KV2 A;  5J2I A;  4XJE A;  3GV8 B;  1TFR A;  5ALP A;  4UAS A;  4YG2 A;  4QW9 A;  1QQ7 A;  2LYA A;  4AP9 A;  5HHH A;  1ZQX A;  3JPO A;  1C20 A;  3RB6 A;  2HHP A;  4F5N A;  1Z1V A;  4LEZ A;  7ICP A;  3SR6 A;  4B9T A;  3T79 A;  9ICE A;  4NXW A;  4J9S A;  4P0P A;  3KOO A;  5KFY A;  4RQ4 A;  4O3R A;  1SV0 A;  5EE3 A;  1DRG A;  1X6I A;  3Q8Q B;  2EQY A;  4B9V A;  3NS1 A;  5AM4 A;  1S8O A;  3LWL A;  3ZDB A;  1QH9 A;  4ELU A;  3MR3 A;  2W9M A;  4FS1 A;  5ALT A;  5G5H A;  2HVI A;  1IG6 A;  4NLK A;  4RT2 A;  1JI7 A;  3UMC A;  4WC5 A;  5DG8 A;  5ALL A;  4I2A A;  2ODG A;  4MFF A;  4RPZ A;  3T5H A;  5CRX A;  9ICK A;  2NRZ A;  1S0M A;  2FPK A;  4PHP A;  2NV3 A;  4J9R A;  2AU0 A;  4LZD A;  3SI8 A;  2RDJ A;  5HRH A;  5ALX A;  4M9H A;  2HHX A;  1Q46 A;  2IHN A;  1BNP A;  1WCL A;  5J0U A;  1L7M A;  4Q8E A;  1HUO A;  1U4B A;  2BKE A;  2P35 A;  3H4B A;  3V6H A;  5J8Y A;  1NO5 A;  2DF4 B;  4IG8 A;  1YLQ A;  3OUY B;  1NJY A;  4DS5 A;  2YQE A;  3G6Y A;  1LB2 B;  2OWO A;  2HOQ A;  3SAG A;  2IMW P;  2VA2 A;  5ALI A;  3EUB 2;  1ZYQ A;  4ED7 A;  2HN2 A;  3ER9 B;  2PFN A;  3Q8P B;  7ICO A;  4ED6 A;  1DGS A;  1ZQI A;  1SL1 A;  5AM1 A;  3NRW A;  1RYS A;  2LPE A;  4DFK A;  1NK8 A;  1ZQW A;  9ICV A;  1Z00 A;  4F93 B;  2BDU A;  4DCC A;  5HR9 A;  1H38 A;  7ICR A;  1ZQR A;  3T5L A;  5CFT A;  2B21 A;  1F5A A;  2ZUC A;  4F4Z A;  2AXT U;  5DG9 A;  1ZQK A;  4QZD A;  3IDW A;  2HHS A;  3KKA C;  4RPX A;  5KT3 A;  1TK0 A;  4WC7 A;  2EZZ A;  3VC8 A;  4C8L A;  4DL3 A;  4LEV A;  2YB4 A;  3E58 A;  5J29 A;  2VIX A;  3I1Y A;  3NVZ A;  4BX9 C;  2XC9 A;  3CRX A;  2IOF K;  2HHV A;  1QCK A;  1KLN A;  2K4H A;  4IR9 A;  4MF8 A;  4F2S A;  5DKW A;  2W8K A;  1Q8K A;  1ZQD A;  4TQS A;  4QZH A;  4I2F A;  2DWQ A;  2M9N A;  3TFS A;  2N1R A;  2BPC A;  4WBZ A;  3WFS C;  4QIW F;  4ED0 A;  1KDH A;  3KTQ A;  4U7C A;  9ICX A;  5KFQ A;  2GOL A;  1TFY A;  4YP3 A;  3QYP A;  2E8N A;  4BWJ A;  5IIJ A;  3O0F A;  2B51 A;  1KL9 A;  2ZIV B;  1V4A A;  4DQS A;  3PZP A;  3ZI4 A;  3EW9 A;  3QZ8 A;  4RQ2 A;  1COK A;  2KJ5 A;  4BDP A;  2ZH8 A;  2W03 A;  2QAR B;  4GXK A;  4XA5 A;  5DGB A;  4EEB A;  5ALZ A;  3F2B A;  3N28 A;  1QQ5 A;  3BQT A;  2ZIW B;  3JPQ A;  3H4D A;  4K4G A;  1COO A;  3ZDA A;  1A76 A;  3F2C A;  2BBH A;  1GO3 F;  5J2D A;  3ICX A;  2IUB A;  3RJJ A;  2UVU A;  5KFL A;  4ED3 A;  1O03 A;  4O67 A;  1ZQU A;  4EEL A;  1N62 A;  2WB1 C;  3HWT A;  4NKU A;  3UQ2 A;  3C2M A;  4O3Q A;  5ALF A;  1U45 A;  5CR0 A;  4FBT A;  4FO1 A;  2FI1 A;  2WF9 A;  2J6U A;  1ZQP A;  3WK4 A;  5DB9 A;  1X40 A;  2QB0 A;  4K96 A;  9ICA A;  3SEN A;  1KEJ A;  8ICN A;  3PVX A;  4OAI Z;  3WFP A;  1ZQQ A;  4DFD A;  1WG8 A;  4C4S A;  4R65 A;  3UQ0 A;  4TUQ A;  5J2G A;  2ZIW A;  2DR9 A;  4X4N A;  2MU2 A;  3EPG A;  1T94 A;  4UBC A;  2A1A A;  2W7O A;  4WQK A;  2HDO A;  4K97 A;  1AQ6 A;  7ICS A;  5KAI U;  1JMS A;  3HJ1 A;  4CDG A;  3ZD9 A;  4I2C A;  1NK9 A;  4EBK A;  4UAW A;  4OJO A;  3C66 A;  3IV6 A;  2W11 A;  2FLP A;  4ECV A;  1IM4 A;  2AGQ A;  3RTV A;  2K8C B;  4C8N A;  1HIW A;  1Q78 A;  4GLX A;  4DLE A;  1N2X A;  2G09 A;  4EZ6 A;  4F3O A;  2KOB A;  3AUO A;  5K4L A;  9ICP A;  4I0U A;  3H8W A;  4Y2J A;  3IRU A;  4WCW A;  3K7D A;  1DGJ A;  5KFV A;  4KLG A;  4IRD A;  4I2D A;  4LZG A;  3C18 A;  3KKA A;  1QTM A;  3C1Y A;  1ZQ1 C;  1X66 A;  2RLT A;  3UMB A;  2DRB A;  4AT8 A;  3B0X A;  2R8G A;  4F5P A;  3M7D A;  4GC6 A;  4UAY A;  1ZQV A;  2GLE A;  2HBL A;  5AKZ A;  4B9M A;  5AI4 A;  4DSJ A;  3AU2 A;  2ZIU B;  2A3V A;  2LYB A;  4WC1 A;  5DBB A;  4KLQ A;  2K8A A;  4ED2 A;  2UVV A;  3RAQ A;  1T3Q A;  2H3V A;  4EV6 A;  1A77 A;  4M0A A;  5AKL A;  1ZQO A;  9ICQ A;  5AHX A;  1YT3 A;  4WH5 A;  2BDP A;  4Z6E A;  4ED8 A;  5HMM A;  1FA0 A;  1VJ5 A;  5ALK A;  1V38 A;  2K4E A;  5HRK A;  5HC9 A;  4ECT A;  5KFO A;  5AK4 A;  4ELT A;  4FHW A;  3IP4 B;  5J0P A;  1LKY B;  4C0Z A;  2ZHB A;  1ECW A;  1FIQ A;  1RG6 A;  2F1I A;  2JR5 A;  3KZI U;  4BWM A;  3AQM A;  4Y2Q A;  3T5J A;  1B22 A;  3N7P D;  3UXN A;  5G5G A;  5AKH A;  1UEU A;  2B0C A;  2W55 A;  1N5X A;  2ZIU A;  2W9C A;  4F8R A;  2KZM A;  2A1J B;  4DL5 A;  1TK8 A;  3H7I A;  1MQ2 A;  3L5K A;  5KG7 A;  1KBU A;  3QU4 A;  2VA3 A;  1ZET A;  4B9L A;  1J97 A;  1QSS A;  1WOT A;  4O5E A;  7ICJ A;  2FDR A;  3WK5 A;  3H0L B;  3QEA Z;  5KL8 B;  2BHN A;  2MAX A;  2PI5 A;  2MUT B;  3EPI A;  2HOI A;  3Q8L A;  1LKY A;  4DL6 A;  2C2D A;  1N61 A;  1SKR A;  4NWI A;  4J9M A;  4OAF A;  3K1Z A;  4Y2T A;  4R66 A;  4QWA A;  3M9N B;  4USA A;  2NRV A;  2XY7 A;  2HI0 A;  2A1J A;  5KAF U;  5J0Q A;  2WTF A;  2HBK A;  3BS5 A;  4ZOH C;  2RP5 A;  4F91 B;  5IIO A;  4QZI A;  5ALN A;  1N5W A;  5DGA A;  3RAX A;  1JUD A;  2PMZ F;  3TAD C;  9ICB A;  4OJP A;  1LVH A;  5BOM A;  8ICO A;  3RH4 A;  3ZDE A;  4RUA A;  2LYH A;  3RH5 A;  2ID1 A;  5CEH A;  1F44 A;  4R64 A;  3OHB A;  3RB0 A;  3SZ2 A;  5KT6 A;  3UM9 A;  2NRX A;  1RYU A;  4IS7 A;  4FZN A;  1JRP A;  5CB1 A;  1BPE A;  4Y2P A;  1R8A A;  4ELV A;  1S0V A;  4DEZ A;  4ATB A;  2W3R A;  5KFP A;  3HRD D;  4ACO A;  5AIC A;  2WF5 A;  5KG3 A;  2F3N A;  4QZB A;  3K1R B;  1KQQ A;  1IIP A;  5KFK A;  4WJ3 B;  2VJ4 A;  4JB3 A;  4QWD A;  3WK7 A;  2Z7J A;  4KLH A;  4Q45 A;  4K98 A;  4ZH4 A;  4KLU A;  4IQT A;  2W9B B;  3RJK A;  1Z1B A;  3CW2 C;  4TQR A;  5JU5 A;  1UA1 A;  3BQ1 A;  3HJE A;  3NAS A;  5J2E A;  4RZR A;  3N7S C;  4QZA A;  1KW4 A;  3AQN A;  5EWF A;  2WF8 A;  8ICU A;  4UB4 A;  5KG4 A;  4M9L A;  4UD4 A;  2R8H A;  4KLM A;  5C5J A;  1SIJ A;  3UPS A;  1CI4 A;  1QLN A;  1LV5 A;  2ZXH A;  8ICK A;  2XGP A;  4R8U A;  1A0P A;  3RB3 A;  3PSI A;  1UCV A;  2M2W A;  1ZQJ A;  4BJQ A;  2WHE A;  3GZF A;  3C5F A;  3FAH A;  4I2I A;  7ICK A;  2YMP A;  5J0W A;  5L1M A;  1TK5 A;  5AIA A;  2PFQ A;  1S77 D;  5J0S A;  7ICU A;  5ALH A;  5KG2 A;  5DLF A;  4AT9 B;  1PZN A;  5D49 A;  4PGQ A;  4PHA A;  2KKP A;  5HRI A;  2ZH2 A;  2WAQ F;  1KFS A;  1D8L A;  2FE9 A;  4BXO B;  1XNS A;  1NJX A;  1Z3E B;  3LK9 A;  1B43 A;  4YR2 A;  4J9Q A;  4X5V A;  5KFJ A;  5DQG A;  3N4M B;  5HHI A;  2F77 X;  4QZ8 A;  3PSF A;  4O5C A;  3CNH A;  3JPP A;  2E8M A;  3R9K A;  4DL2 A;  2AGO A;  2EAO A;  5HP4 A;  2ASL A;  4J9N A;  4AT9 A;  4J9L A;  3RJG A;  3AM9 A;  4CF3 A;  1TV9 A;  5C0Y A;  2HHQ A;  8ICM A;  2YML A;  5HR6 A;  4DL4 A;  4AT7 B;  5KFN A;  4NLC A;  2NYV A;  4Y2V A;  2RDI A;  1ZD2 P;  1WWU A;  7ICI A;  2I5H A;  4DQR A;  3LYS A;  3GV7 B;  4NM2 A;  8ICP A;  3TAD A;  4KLF A;  2FJ6 A;  4FH3 A;  7ICG A;  1S5L U;  3E0F A;  4N7R A;  2YB1 A;  4F4K A;  4Z6F A;  2Y1I A;  5HRB A;  1RM6 C;  8ICJ A;  1PK1 B;  2B56 A;  5ALY A;  4LEW A;  1URJ A;  5ALO A;  1Z19 A;  1NK6 A;  4BGD A;  7ICE A;  4DFJ A;  4NY8 A;  3C2K A;  1XSP A;  4QZF A;  4YD1 A;  5KFX A;  1TKD A;  2H3F A;  4PZO A;  5B5E U;  3MGH A;  2JV3 A;  4EBE A;  1SGG A;  5CWR A;  5DEC A;  1TAQ A;  4IRC A;  7ICN A;  4X0B A;  3FC4 A;  2L5Y A;  5KG0 A;  1PK1 A;  2LMR A;  4PJ0 U;  2JEJ A;  4J9P A;  5J0Y A;  1PK3 A;  2H3Z A;  2H3Q A;  2NRW A;  1ZQZ A;  1QSY A;  1M6Y A;  1NNL A;  3E2E A;  3SYZ A;  2E3T A;  4WOY A;  3SEI A;  4DFM A;  4GIB A;  2XO7 A;  4F50 A;  4Z6C A;  2DVI A;  5J2K A;  4OAG A;  2HSZ A;  4X4R A;  2BZF A;  1R8C A;  4F5Q A;  1UEV A;  4NXT A;  5AI0 A;  4IQV A;  3OUY A;  2HCF A;  3F53 A;  2G08 A;  3QUQ A;  3OVA A;  3EYZ A;  3C21 A;  1K1Q A;  2PFP A;  3QE9 Y;  2MSN A;  1SKW A;  3TAQ A;  2IBK A;  8ICH A;  8ICA A;  4J9K A;  1V97 A;  4KMU A;  2WF7 A;  4ECX A;  1TE2 A;  5AKJ A;  1NKE A;  4K4H A;  4DSL A;  3WFO A;  1F0M A;  3IG5 A;  1UT8 A;  3H8S A;  3QXG A;  2KK0 A;  3JYY A;  4E8F A;  5HML A;  4I28 A;  1FEZ A;  2O6K A;  1ZRN A;  2K8B B;  2FLL A;  4PHE A;  2MA1 A;  4RPY A;  4OJL A;  8ICR A;  3NTU A;  5CHE A;  4KX5 A;  2RHF A;  1NZB A;  2KMD A;  9ICG A;  2MRL A;  4Y2Y A;  2OM6 A;  1UPH A;  4RQ8 A;  4XQ8 A;  3NKU A;  1C7Y A;  4PGY A;  2UVW A;  1F5S A;  4FHY A;  3PY8 A;  1NK5 A;  4DQP A;  1ZD4 A;  2W3S A;  4MHV A;  2DKX A;  1MIY A;  5EE9 A;  3PW7 A;  3PHZ A;  2F76 X;  5DED A;  1L6N A;  4B9U A;  1L5U A;  3M9M B;  9ICL A;  1KFD A;  3D2S A;  1FFV A;  2GO7 A;  3MR6 A;  3ZDD A;  4IQU A;  3FM9 A;  2Y0S C;  4ECU A;  2EWR A;  1UA0 A;  1S0N A;  3RJE A;  3HKZ C;  3OHA A;  2OCE A;  4KLT A;  2Y9T A;  3ZDC A;  1U48 A;  4KLI A;  4UAV A;  3EZ5 A;  1UHU A;  4WC0 A;  1BPB A;  4GXJ A;  4YQW A;  4B6J A;  5J2H A;  5ALV A;  3PO5 A;  4C80 A;  3G6X A;  3QU7 A;  2ZIV A;  2FMQ A;  2IA6 A;  4X4Q A;  2F1J A;  4UD5 A;  2EAN A;  2ZH6 A;  5AKI A;  5IIK A;  3D6J A;  5D63 A;  4I2J A;  3PW2 A;  4K8V A;  9ICT A;  5F2V O;  4JLX A;  4M9J A;  8ICE A;  3FDS A;  2QAR A;  5KNI A;  3GQC A;  2ZJA A;  3H0R B;  2P6U A;  3ONN A;  4RQN A;  3M8S A;  2O5A A;  4Y2X A;  5KFB A;  1V9P A;  3NVV A;  1JX4 A;  2DUY A;  1RPL A;  2XGQ A;  4MKP A;  1SL0 A;  3WK9 A;  2LHT A;  3MFI A;  2ESE A;  3C2L A;  2AGP A;  3F5E A;  4RT3 A;  5HRF A;  5F3X B;  3N97 B;  3C23 A;  3M6Z A;  1N48 A;  1K5O A;  2EZY A;  4M47 A;  1DK3 A;  4UB5 A;  2ZH1 A;  2G0A A;  3OTQ A;  3OJU A;  8ICB A;  5AKE A;  2GA9 D;  2O1P A;  5DQI A;  4I2G A;  3IN5 A;  4XUS A;  2K4P A;  1CUK A;  3BZK A;  2JHD A;  3RRH A;  4EEN A;  3PR4 A;  4IR1 A;  5IIL A;  3QUT A;  2F8L A;  4M5D A;  3QUC A;  4IQW A;  4PPX A;  2KVC A;  2XY6 A;  2BPG A;  4F5O A;  2I9G A;  3OSN A;  2PI4 A;  1KNY A;  4QZ9 A;  4UB2 A;  5L9X A;  1SXE A;  4E7X A;  4O69 A;  3Q8R B;  3H8J A;  2BGW A;  3IHQ B;  2LI6 A;  3BDP A;  2NRT A;  7ICL A;  4XQ7 A;  4QW8 A;  1IV8 A;  2WB1 F;  4NXV A;  4WC2 A;  4NM1 A;  5HRG A;  2BPF A;  4YN4 A;  1U47 A;  3ISB A;  3RFA A;  4O3S A;  2KFN A;  4K99 A;  3WKB A;  4Q43 A;  3OSP A;  1DOQ A;  3PX0 A;  2JEF A;  4G9B A;  3PV8 A;  4DWI A;  1L8L A;  5DB6 A;  2ISO A;  2W54 A;  1JAJ A;  4RQ5 A;  3OPX A;  1ZQY A;  4HX0 A;  5KFS A;  1MA7 A;  2YY6 A;  2JH1 A;  4PL1 A;  3UXP A;  3MR5 A;  2DQN B;  4QNL A;  1B0X A;  3PX4 A;  4ECZ A;  4UAZ A;  8ICV A;  2NRK A;  1FFU A;  2Y9U A;  4KLJ A;  5EE0 A;  3OVB A;  3L9D A;  4AYB F;  4PZN A;  3RF9 A;  1OUQ A;  9ICO A;  2PMZ C;  5ALJ A;  1ZQF A;  4MFA A;  4KM5 A;  1ZQM A;  3QX7 A;  2G5H B;  1KTQ A;  3HP6 A;  1QSL A;  1D9D A;  2M2U A;  4CF5 A;  4WC6 A;  3KD3 A;  5KFM A;  3ISC A;  1S9F A;  1X9S A;  1SWW A;  4RQ6 A;  4WQL A;  2HBJ A;  4O3O A;  4FE3 A;  9ICU A;  4RU9 A;  2GWS A;  3CYM A;  3F2D A;  5KT5 A;  1RXV A;  1UQV A;  2V4Q A;  2G07 A;  3GIL A;  3BQ7 A;  4JWN A;  2IHO A;  1PX5 A;  1SXD A;  3G6V A;  1NKB A;  5KFT A;  4RNO A;  4KB6 A;  1ZQS A;  2I1Q A;  1IXR A;  3AU6 A;  1SZP A;  4YFK A;  1S0O A;  1T7P A;  3SAH A;  1TFW A;  9ICJ A;  5DBC A;  2VKQ A;  1Z4N A;  4P4P A;  8ICF A;  1VFG A;  4RWO A;  3U26 A;  1X9X A;  3C1Z A;  1BVS A;  3GIM A;  2ZXI A;  5DLG A;  2OYY A;  2H5X A;  5DDM A;  5JTG A;  2K4I A;  4OD0 A;  4F4X A;  1KN5 A;  4O3M A;  4JV2 A;  4KLE A;  1RDF A;  2ZUD A;  3GFK B;  2JXJ A;  2QKQ A;  3LVV A;  4F4W A;  9ICR A;  2MUT A;  2DGZ A;  2KHV A;  1HJP A;  4LVS A;  1KFT A;  3RJH A;  3B9J A;  2B4V A;  7ICM A;  2KVS A;  2BR0 A;  1J2N A;  1TAM A;  5HRL A;  3PNC A;  5BOL A;  5L1L A;  1T4G A;  4CRX A;  9ICW A;  2KD1 A;  1L3S A;  4F2R A;  4F4Y A;  2LKY A;  5CP2 A;  5AKG A;  2HMX A;  3B0Y A;  3GU3 A;  4LT6 A;  1ZQN A;  3NRZ A;  2R18 A;  1JXE A;  5KTQ A;  1SKS A;  1B4F A;  5TZV A;  3HIY A;  2ZJ8 A;  4KN4 A;  2KG5 A;  5J2J A;  4KMO B;  1SL2 A;  3V6J A;  2V9W A;  4EEK A;  5FP0 A;  2C22 A;  5KG6 A;  2PBE A;  2F8K A;  5HRD A;  1ZQG A;  8ICQ A;  1ZJM A;  4NJ8 A;  5J0X A;  3WFR E;  2Y1J A;  4QWC A;  3NYB A;  2YTU A;  3KHL A;  4QWB A;  3QU5 A;  1WYG A;  1GPJ A;  5ALQ A;  3RJI A;  4F5R A;  3UXO A;  2J6T A;  2NO4 A;  3H40 A;  3H37 A;  4EED A;  5EOZ A;  4YD2 A;  3OGU A;  5T14 A;  1K1S A;  5BPC A;  2WF6 A;  5D4B A;  3TAP A;  3AQE A;  1KSP A;  3A0H U;  5KFD A;  3M1Y A;  3ERC C;  2BCR A;  4NKT A;  1VDV A;  4OCZ A;  3K4G A;  2W9B A;  2VAN A;  3JCF A;  5A0L A;  1ZRM A;  4DOA A;  3AQF A;  1XSL A;  2ZTC A;  4TUS A;  2VJ5 A;  1Q3U A;  4M9N A;  3V7K A;  4C7Y A;  4M2Y A;  4UAR A;  2PKE A;  3WU2 U;  4US8 A;  4NXU A;  5AM0 A;  2DR5 A;  4ECW A;  2D8C A;  4C8K A;  2C2R A;  3D2N A;  3M9O B;  4X4O A;  3Q8M A;  4TUR A;  2JZB B;  4PL2 A;  3CP8 A;  5III A;  4UB3 A;  3BJY A;  2HHU A;  5KFH A;  9ICM A;  3KHH A;  3LWM A;  1L7O A;  4RWQ A;  3LDA A;  2ZTE A;  3L4P A;  5CFS A;  3NVY A;  3KHG A;  3NVW A;  3NUQ A;  1R8B A;  4GXI A;  1ZQL A;  2YX8 A;  3ETR A;  1L7P A;  4EBC A;  2HHT A;  3AQL A;  2CXY A;  4NXZ A;  4KIT B;  1TAU A;  3DV9 A;  2ZUB A;  1QQ6 A;  3IG8 A;  2BQU A;  4DF8 A;  3HIL A;  1ZJN A;  2KZZ A;  3A0B U;  4M6W B;  8ICY A;  1N63 A;  3WK6 A;  1S97 A;  3GII A;  1JN3 A;  1HEK A;  4FFD A;  5KFW A;  3PML A;  4RQ7 A;  2JZB A;  4DSE A;  2ZH9 A;  1SZH A;  2OXO A;  3OVS A;  4HAI A;  2ASJ A;  4O5K A;  2RQ5 A;  5AI9 A;  2DR8 A;  5JTI A;  1CRX A;  9ICN A;  4BXO A;  1JQR A;  2HN1 A;  3V7J A;  4QJF B;  2P6R A;  9ICI A;  2A19 A;  5AM5 A;  2XCP A;  1VJ7 A;  4XRH A;  5F9L A;  2DFL A;  1RYR A;  3WKC A;  5CA7 A;  4JLZ A;  4EEY A;  3RBE A;  4A8E A;  1Q3V A;  2E8O A;  2ES6 A;  3MC1 A;  4JMU A;  4PGX A;  4E80 A;  4X4P A;  5ALS A;  3KZX A;  4M6W A;  1T8E A;  4Y2S A;  3PX6 A;  4PHD A;  3GDX A;  2DPI A;  5KFI A;  1NOM A;  3PMN A;  2EDU A;  5J0T A;  4AT7 A;  9ICH A;  2UVR A;  4CE6 A;  5ALM A;  5KFC A;  2ATL A;  4R63 A;  2ISP A;  4FBU A;  3MDA A;  3F5A A;  3IM1 A;  5B3Q A;  4EP7 A;  3SV3 A;  3SAF A;  3MBY A;  1L3U A;  5L1J A;  4CNQ A;  3I76 A;  2E1F A;  3TI0 A;  2KIV A;  3FYH A;  1BPX A;  4NL9 C;  2IOH A;  4QIW C;  4G3I A;  5D61 A;  1Z00 B;  1NI3 A;  1KRP A;  3RB4 A;  2K60 A;  3QZ7 A;  4EBJ A;  4P0Q B;  1UET A;  1L7N A;  4ECR A;  4IRK A;  4DSI A;  4DL7 A;  2CPR A;  3TAN A;  3Q8S B;  3ER8 C;  5F9N A;  4JWM A;  4NLG A;  3ZD8 A;  3QU9 A;  4QZG A;  4K4I A;  3JPN A;  3J81 j;  2BBJ A;  2D3D A;  4KLS A;  1BPD A;  1OXJ A;  1PVR A;  2KN7 A;  4FHP A;  1O08 A;  2VA8 A;  2GH1 A;  1OW5 A;  1X2I A;  2OHF A;  2PFO A;  4JV0 A;  4JV1 A;  3Q8K A;  3HPO A;  3PW5 A;  4Y2R A;  1XS9 D;  4GC7 A;  3KFU F;  7ICT A;  8ICL A;  1ZQB A;  4J03 A;  4I2H A;  1XU4 A;  5ALW A;  2W7P A;  1CEZ A;  4US9 A;  4WBY A;  4P0Q A;  4E0D A;  1ZOL A;  3SMV A;  4RUC A;  2M2V A;  1SB3 C;  3TAC B;  4X4U A;  5DBA A;  3H0M B;  1ZQT A;  4LJX A;  4DSK A;  3SD7 A;  2I6X A;  4NXX A;  4DFP A;  3M6K A;  2W9A A;  2ZH4 A;  2FPM A;  1P7D A;  1L3V A;  2EH9 A;  2LBO A;  2XY5 A;  3ORY A;  3RR7 A;  5AK3 A;  4FZM A;  2EAP A;  3MFH A;  2QB1 A;  4X4S A;  3KHR A;  1ZD3 A;  2FCL A;  4QWE A;  3C5G A;  3AQK A;  4O3N A;  5J0O A;  2GAF D;  5KFU A;  1J2M A;  4YMN A;  3I28 A;  3QUB A;  4KX3 A;  4DQI A;  2AJQ A;  4X4V A;  3AL0 B;  2IOF A;  5CJ7 A;  1BPZ A;  4UQG A;  4U6P A;  5DB8 A;  3QU2 A;  1UT5 A;  2ZTD A;  2PXI A;  1X9M A;  3HT3 A;  2G5I B;  4UW9 A;  3H38 A;  4RQ0 A;  3MR2 A;  2WFA A;  4I27 A;  2ALZ A;  2BCV A;  1ZD5 A;  5HR7 A;  1N60 A;  2ASD A;  2HOF A;  1KKX A;  1JAL A;  4YXM A;  7ICF A;  1MIV A;  2JGA A;  4KLO A;  2F44 A;  1T3N A;  4EGW A;  4YXJ A;  5B66 U;  2CRX A;  2QB0 B;  2LM1 A;  3JPT A;  3VCB A;  3WKD A;  2C28 A;  5TIS U;  4K9A A;  3L3F X;  2G06 A;  5AK6 A;  2KFZ A;  2AH5 A;  2HVH A; 
#chains in the Genus database with same CATH homology
 4HYK A;  5EWG A;  3SI8 A;  9ICO A;  4QZA A;  2RDJ A;  1ZQF A;  5HRH A;  4MFA A;  4M9H A;  1ZQM A;  3AQN A;  5EWF A;  2HHX A;  1KTQ A;  3HP6 A;  8ICU A;  4UB4 A;  5KG4 A;  1D9D A;  1QSL A;  2IHN A;  1WCL A;  2R8H A;  5J0U A;  4M9L A;  1BNP A;  2M2U A;  4UD4 A;  4KLM A;  5C5J A;  3RBD A;  1NK0 A;  5DDY A;  2R8I A;  1U9L A;  4P4O A;  4MF2 A;  3UPS A;  1QLN A;  4WC6 A;  5KFM A;  3HJ4 A;  4Q8E A;  1LV5 A;  1HUO A;  1U4B A;  3ISC A;  8ICK A;  4O9M A;  1S9F A;  8ICI A;  2XGP A;  4R8U A;  2BKE A;  3H4B A;  3V6H A;  1X9S A;  3T5K A;  4MEX A;  4MEY A;  3TFR A;  4RQ6 A;  3RB3 A;  1XO1 A;  1NO5 A;  4IG8 A;  5KFE A;  3OV7 A;  2BCQ A;  1YLQ A;  4B9S A;  1ZQJ A;  1NJY A;  4O3O A;  4DS5 A;  2M2W A;  3OUY B;  4CCH A;  3G6Y A;  9ICU A;  1LB2 B;  3PR5 B;  4X4T A;  4RU9 A;  3C5F A;  2GWS A;  2OWO A;  2IMW P;  4I2I A;  5KT5 A;  4RNN A;  4YVZ A;  3V7L A;  1ZYQ A;  1RXV A;  4ED7 A;  2VA2 A;  5J0W A;  7ICK A;  2V4Q A;  4YMM A;  4ECQ A;  1TK5 A;  3GIL A;  2P66 A;  2PFQ A;  3PO4 A;  2M2T A;  4JWN A;  2PFN A;  1S77 D;  3Q8P B;  5J0S A;  3RH6 A;  4KLD A;  7ICU A;  4JK1 A;  4ED6 A;  7ICO A;  1PX5 A;  1DGS A;  5KG2 A;  3G6V A;  5DLF A;  5KFT A;  1SL1 A;  4RNO A;  1NKB A;  3M8R A;  1ZQI A;  2J6S A;  1PZN A;  1RZT A;  4RQ1 A;  1RYS A;  1ZQS A;  2FLN A;  2HW3 A;  8ICX A;  5D49 A;  4DFK A;  4PGQ A;  1ZQW A;  2I1Q A;  4PHA A;  1NK8 A;  1IXR A;  1JIH A;  3AU6 A;  1ZQE A;  9ICV A;  1BNO A;  1SZP A;  4DS4 A;  1Z00 A;  4F93 B;  5HR9 A;  5HRI A;  4YFK A;  1S0O A;  1T7P A;  2ZH2 A;  4EYH B;  1H38 A;  1KFS A;  1D8L A;  1TFW A;  7ICR A;  4J9O A;  1ZQR A;  4YR0 A;  1RXW A;  3T5L A;  9ICJ A;  5DBC A;  3NGD A;  2B21 A;  1F5A A;  2ZUC A;  4UBB A;  4F4Z A;  3MDC A;  4BXO B;  1NJX A;  1NKC A;  1Z3E B;  4P4P A;  8ICF A;  1VFG A;  4WC4 A;  5DQH A;  3LK9 A;  1B43 A;  4YR2 A;  4RWO A;  2BCS A;  4J9Q A;  5DG9 A;  3HX0 A;  1ZQK A;  4I2B A;  3C1Z A;  4QZD A;  4EYI B;  1BVS A;  4X5V A;  5KFJ A;  3GIM A;  2HHS A;  4AT8 B;  5DQG A;  5DLG A;  3N4M B;  1NZP A;  3JPR A;  2H5X A;  5DDM A;  2RFF A;  4RPX A;  5HHI A;  3RR8 A;  4Q8F A;  5KT3 A;  2AQ0 A;  1TK0 A;  4F4X A;  4WC7 A;  4QZ8 A;  4C8L A;  4DLG A;  4DL3 A;  4FO6 A;  2BQR A;  5J29 A;  4O5C A;  3JPP A;  4Z6D A;  4JV2 A;  2XC9 A;  4KLE A;  2ZUD A;  4FS2 A;  4KTQ A;  3GFK B;  4DL2 A;  4O3P A;  2HHV A;  2AGO A;  5HP4 A;  4F4W A;  2ASL A;  1XSN A;  9ICR A;  2MUT A;  4J9N A;  1KLN A;  4AT9 A;  1EXN A;  3WFQ E;  1HJP A;  4J9L A;  4LVS A;  1KFT A;  3RJG A;  3RJH A;  2AQ4 A;  5KT7 A;  1TV9 A;  4IR9 A;  7ICM A;  4FHX A;  4MF8 A;  2HHQ A;  4F2S A;  8ICM A;  2Q66 A;  2BR0 A;  4DOB A;  5DKW A;  3MGI A;  4DL4 A;  5HRL A;  3PNC A;  4MFC A;  2BE3 A;  2W8K A;  4AT7 B;  1ZQD A;  5KFN A;  4TQS A;  4QZH A;  5BOL A;  4I2F A;  5L1L A;  2M9N A;  2RDI A;  1T4G A;  3TFS A;  9ICW A;  2BPC A;  4F2R A;  1L3S A;  4WBZ A;  7ICI A;  4F4Y A;  3WFS C;  4ED0 A;  1KDH A;  3KTQ A;  5CP2 A;  9ICX A;  4DQR A;  5HRG A;  5KFQ A;  3B0Y A;  3GV7 B;  4S3N A;  4LT6 A;  4NM2 A;  4QZC A;  1ZQN A;  4YP3 A;  8ICP A;  1TFY A;  4PH5 A;  4KLF A;  1JXE A;  5KTQ A;  4I2E A;  1SKS A;  4BWJ A;  7ICG A;  4FH3 A;  5IIJ A;  4I29 A;  5TZV A;  1V4A A;  2ZJ8 A;  4KN4 A;  3HIY A;  4DQS A;  1D9F A;  5J2J A;  5KG1 A;  1SL2 A;  3V6J A;  2V9W A;  3QEB Z;  4F4K A;  4Z6F A;  2Y1I A;  5HRB A;  3EW9 A;  3QZ8 A;  4M9G A;  2C22 A;  8ICJ A;  3H3A A;  3PW0 A;  4RQ2 A;  5KG6 A;  2PBE A;  2DRA A;  2JEI A;  4BDP A;  4DOC A;  2ZH8 A;  4F92 B;  5HRD A;  1U49 A;  1ZQG A;  8ICQ A;  3JPS A;  4GXK A;  4XA5 A;  5DGB A;  1ZJM A;  5J0X A;  3WFR E;  1NK6 A;  4C8M A;  4BGD A;  4QWC A;  2Y1J A;  2W9C B;  7ICE A;  1Q79 A;  3H39 A;  3THV A;  3BQT A;  4DFJ A;  1MQ3 A;  1JXL A;  3KHL A;  3NYB A;  4QWB A;  4NY8 A;  3JPQ A;  3C2K A;  4YMO A;  3H4D A;  4K4G A;  1COO A;  1XSP A;  3ZDA A;  1A76 A;  4QZF A;  4YD1 A;  4DSF A;  5KFX A;  5J2D A;  3RJJ A;  3RJI A;  4F5R A;  1TKD A;  5KFG A;  3UXO A;  5KFL A;  1MC8 A;  4ED3 A;  2UVU A;  3MGH A;  2XCA A;  2J6T A;  4DQQ A;  3H40 A;  3GV5 B;  1ZQU A;  4EBE A;  3H37 A;  5EOZ A;  5CWR A;  5DEC A;  4YD2 A;  3OGU A;  1TAQ A;  1K1S A;  4UB1 A;  5BPC A;  3HWT A;  4IRC A;  3TAP A;  5D4B A;  9ICF A;  3UQ2 A;  3C2M A;  4KLL A;  4NKU A;  4O3Q A;  4TUP A;  1KSP A;  1U45 A;  4FBT A;  5CR0 A;  5KFD A;  7ICN A;  4X0B A;  1XC9 A;  2J6U A;  5KG0 A;  1ZQP A;  2BCR A;  5D46 A;  4NKT A;  5KT4 A;  9ICC A;  4DF4 A;  5DB9 A;  3K4G A;  2W9B A;  9ICA A;  2JEJ A;  1KEJ A;  1NJW A;  8ICN A;  4J9P A;  3PVX A;  5J0Y A;  2VAN A;  5J2C A;  3WFP A;  4NLN A;  1ZQQ A;  4WC0 A;  4DOA A;  4R65 A;  5L1K A;  1N56 A;  3UQ0 A;  1XSL A;  2ZTC A;  4TUQ A;  5J2G A;  4TUS A;  4M9N A;  3V7K A;  2DR9 A;  4X4N A;  4M2Y A;  3EPG A;  2DR5 A;  2NRW A;  1ZQZ A;  4ECW A;  1QSY A;  2C2R A;  4C8K A;  4UBC A;  3M9O B;  2FMP A;  3E2E A;  4X4O A;  3Q8M A;  3SYZ A;  5KFA A;  5EWE A;  4TUR A;  2JZB B;  5III A;  5J2A A;  4UB3 A;  2XO7 A;  3BJY A;  4DFM A;  4P2H A;  5KFH A;  4Z6C A;  4F50 A;  2HHU A;  9ICM A;  7ICH A;  2ZH5 A;  2F1H A;  3KHH A;  2DVI A;  3LWM A;  5J2K A;  5KFR A;  3GIJ A;  3L9D A;  4RWQ A;  7ICQ A;  3LDA A;  2ZTE A;  4X0A A;  4QZE A;  4X4R A;  1R8C A;  2ZHA A;  3KHG A;  4M04 A;  4F5Q A;  2KTQ A;  1UEV A;  7ICS A;  1NK7 A;  4FH5 A;  1BPY A;  1JMS A;  1R8B A;  4GXI A;  4IQV A;  5J2B A;  4Q44 A;  1ZQL A;  3ZD9 A;  4I2C A;  3HJ1 A;  3OUY A;  1NK9 A;  3OVA A;  4EBC A;  3EYZ A;  3V72 A;  2HHT A;  3AQL A;  4NLZ A;  2KP7 A;  4EBK A;  4UAW A;  4NXZ A;  3C21 A;  4EZ9 A;  1K1Q A;  3HW8 A;  4B9N A;  2PFP A;  4KIT B;  3QE9 Y;  1TAU A;  1SKW A;  3C66 A;  4ATB B;  3TAQ A;  2FLP A;  2ZUB A;  2IBK A;  4ECV A;  1ZQA A;  2R8K A;  4J9K A;  2BQU A;  2HHW A;  8ICH A;  1IM4 A;  8ICA A;  4C8O A;  4KMU A;  4DF8 A;  2AGQ A;  3RTV A;  1ZJN A;  2KZZ A;  4ECX A;  3GIK A;  1OU5 A;  4M6W B;  4C8N A;  8ICY A;  2BCU A;  1ARO P;  1Q78 A;  4GLX A;  1NJZ A;  4DLE A;  1NKE A;  1S97 A;  4K4H A;  4DSL A;  4EZ6 A;  3WFO A;  2DR7 A;  3GII A;  1JN3 A;  4F3O A;  5KFW A;  3PML A;  1UT8 A;  4RQ7 A;  3H8S A;  3AUO A;  9ICP A;  3H8W A;  1NK4 A;  4WCW A;  2JZB A;  4ECY A;  5KFV A;  4DSE A;  3SV4 A;  3JYY A;  2ZH9 A;  4KLG A;  4E8F A;  5HML A;  4I28 A;  8ICW A;  3OVS A;  2FLL A;  5HRE A;  4PHE A;  4RPY A;  8ICR A;  2ASJ A;  4O5K A;  4IRD A;  3NTU A;  2DR8 A;  4I2D A;  9ICN A;  4BXO A;  4LZG A;  1JQR A;  1QTM A;  3C18 A;  3V7J A;  5IIN A;  2P6R A;  9ICI A;  2XCP A;  1MSW D;  3RRG A;  1MIW A;  1VJ7 A;  3C1Y A;  4XRH A;  5F9L A;  2ZH7 A;  9ICG A;  5DG7 A;  2DFL A;  2DRB A;  4AT8 A;  3B0X A;  4RQ8 A;  1RYR A;  2FPL A;  2R8G A;  4XQ8 A;  2R8J A;  5CA7 A;  1C7Y A;  4F5P A;  4EEY A;  8ICS A;  4PGY A;  3RBE A;  2UVW A;  4RWN A;  4FHY A;  4GC6 A;  4UAY A;  1ZQV A;  4RWP A;  4PGX A;  4E80 A;  3UPQ A;  3PY8 A;  4X4P A;  1NK5 A;  4DQP A;  5L1I A;  4B9M A;  1L3T A;  5KG5 A;  4DSJ A;  3AU2 A;  4M6W A;  1MIY A;  3PW7 A;  1T8E A;  5DED A;  3PX6 A;  4B9U A;  1L5U A;  3M9M B;  4WC1 A;  5DBB A;  4PHD A;  8ICC A;  3GDX A;  9ICL A;  4ED1 A;  4KLQ A;  4ED2 A;  2DPI A;  1KFD A;  2UVV A;  3RAQ A;  2ZJ5 A;  5KFI A;  1NOM A;  4R8U B;  3PMN A;  3MR6 A;  3ZDD A;  4IQU A;  2JEG A;  1Y88 A;  1WCN A;  5J0T A;  1A77 A;  4M0A A;  4ECU A;  4AT7 A;  5KFF A;  1ZQO A;  2C2E A;  4O0I A;  9ICQ A;  1UA0 A;  1S0N A;  3RJE A;  4KLT A;  3OHA A;  9ICH A;  4YCX A;  2UVR A;  3LQC B;  4WC3 A;  3ZDC A;  2BDP A;  5KFC A;  1U48 A;  1S10 A;  4KLI A;  3EZ5 A;  4RNM A;  2ATL A;  1D8Y A;  1BPB A;  4Z6E A;  5HMM A;  3BQ0 A;  4GXJ A;  4YQW A;  4ED8 A;  1DK2 A;  4R63 A;  4DO9 A;  1FA0 A;  2ISP A;  5HRK A;  1X9W A;  5J2H A;  1ZQH A;  3PO5 A;  4FBU A;  4ECT A;  5HC9 A;  5KFO A;  3MDA A;  4ELT A;  3G6X A;  1S76 D;  4FHW A;  3IM1 A;  2FMQ A;  5J0P A;  2IA6 A;  2F1J A;  4YR3 A;  4ECS A;  4UD5 A;  4EP7 A;  4X4Q A;  3SV3 A;  4AT9 B;  1TVA A;  2ZH6 A;  3MBY A;  2BQ3 A;  1L3U A;  5IIK A;  5L1J A;  3T3F A;  2ZHB A;  4I2J A;  3PW2 A;  2F1I A;  9ICT A;  4BWM A;  3TI0 A;  3AQM A;  5F2V O;  3FYH A;  3T5J A;  1BPX A;  1B22 A;  4G3I A;  2KZ3 A;  5KT2 A;  1Z00 B;  4M9J A;  3UXN A;  3RB4 A;  1KRP A;  3QZ7 A;  1UEU A;  3EWA A;  3ETL A;  8ICT A;  8ICE A;  3FDS A;  4EBJ A;  4FHV A;  3GQC A;  2ZJA A;  5DB7 A;  1UET A;  2W9C A;  2ZH3 A;  4ECR A;  5IIM A;  3RJF A;  4P4M A;  3PW4 A;  2V4R A;  4IRK A;  2FMS A;  4DSI A;  4F8R A;  1ZQC A;  2KZM A;  2P6U A;  4DL7 A;  2A1J B;  4DL5 A;  1TK8 A;  3H7I A;  1MQ2 A;  3M8S A;  5KG7 A;  2O5A A;  4RQ3 A;  8ICZ A;  2VA3 A;  3ISD A;  5KFB A;  1ZET A;  3TAN A;  3Q8S B;  4B9L A;  5F9N A;  1V9P A;  1QSS A;  4JWM A;  1WOT A;  4NLG A;  1JX4 A;  1BGX T;  3ZD8 A;  3MAB A;  4QZG A;  3OJS A;  4K4I A;  1RPL A;  5JUM A;  4O5E A;  2XGQ A;  7ICJ A;  1R89 A;  3JPN A;  2Q0Z X;  1SL0 A;  4EBD A;  3BQ2 A;  5J0R A;  3MFI A;  4KLS A;  1BPD A;  3QEA Z;  3C2L A;  2KN7 A;  2AGP A;  4FHP A;  2VA8 A;  4RT3 A;  1X2I A;  2PFO A;  2BHN A;  2MAX A;  3K75 D;  7ICV A;  4JV0 A;  4KN7 A;  5KFZ A;  3Q8K A;  2PI5 A;  4JV1 A;  5HRF A;  2MUT B;  3EPI A;  3N97 B;  3C23 A;  3HPO A;  3Q8L A;  1N48 A;  3PW5 A;  5J2F A;  1XWL A;  4DL6 A;  4M47 A;  1XS9 D;  1DK3 A;  4UB5 A;  3JZ0 A;  4JUZ A;  2ZH1 A;  2C2D A;  4GC7 A;  7ICT A;  3OJU A;  8ICL A;  1ZQB A;  8ICB A;  2W8L A;  4I2H A;  1XU4 A;  5HNK A;  1SKR A;  1HUZ A;  8ICG A;  1CEZ A;  4J9M A;  4WBY A;  2O1P A;  4E0D A;  5DQI A;  4RUC A;  4R66 A;  2M2V A;  4I2G A;  4QWA A;  3M9N B;  2IHM A;  2NRV A;  9ICS A;  4XUS A;  2XY7 A;  5DBA A;  4X4U A;  1CUK A;  2A1J A;  3RRH A;  5J0Q A;  1ZQT A;  2WTF A;  4DSK A;  3PR4 A;  4IR1 A;  5IIL A;  4F91 B;  3TAR A;  2DPJ A;  3V6K A;  4DFP A;  5IIO A;  2W9A A;  4M5D A;  4QZI A;  2ZH4 A;  2FPM A;  5CHG A;  1L3V A;  4PPX A;  5DGA A;  2XY5 A;  3RAX A;  3ORY A;  3RR7 A;  2XY6 A;  2BPG A;  4IQW A;  4F5O A;  2I9G A;  3TQ1 A;  9ICB A;  5J2I A;  3GV8 B;  3OSN A;  5BOM A;  2PI4 A;  1KNY A;  3MFH A;  8ICO A;  1TFR A;  3RH4 A;  3ZDE A;  4RUA A;  2LYH A;  3RH5 A;  2ID1 A;  4QZ9 A;  4UB2 A;  3KHR A;  4X4S A;  4YG2 A;  5L9X A;  4QW9 A;  4E7X A;  3Q8R B;  5HHH A;  3H8J A;  4R64 A;  4QWE A;  3OHB A;  3RB0 A;  3C5G A;  1ZQX A;  2BGW A;  3IHQ B;  3SZ2 A;  3BDP A;  2NRT A;  4O3N A;  5J0O A;  7ICL A;  3JPO A;  3AQK A;  4XQ7 A;  5KFU A;  4QW8 A;  3RB6 A;  4YMN A;  5KT6 A;  2HHP A;  4WC2 A;  2NRX A;  4DQI A;  2AJQ A;  4X4V A;  4NM1 A;  4F5N A;  5CB1 A;  5CJ7 A;  1BPZ A;  1BPE A;  4YN4 A;  4UQG A;  5DB8 A;  3ISB A;  1U47 A;  2BPF A;  7ICP A;  1R8A A;  4ELV A;  4O3S A;  4DEZ A;  1S0V A;  2KFN A;  4ATB A;  1UT5 A;  2ZTD A;  2PXI A;  4Q43 A;  1X9M A;  3HT3 A;  4B9T A;  3OSP A;  1DOQ A;  3PX0 A;  2JEF A;  5KFP A;  9ICE A;  3H38 A;  3PV8 A;  4RQ0 A;  3MR2 A;  4J9S A;  4I27 A;  5KFY A;  2ALZ A;  4RQ4 A;  2BCV A;  4DWI A;  5DB6 A;  2ISO A;  4O3R A;  5KG3 A;  1JAJ A;  4QZB A;  4RQ5 A;  3Q8Q B;  5KFK A;  4B9V A;  2ASD A;  4QWD A;  1ZQY A;  4YXM A;  3LWL A;  7ICF A;  3ZDB A;  1MIV A;  4ELU A;  4KLH A;  3MR3 A;  1T3N A;  4KLO A;  2W9M A;  4YXJ A;  4Q45 A;  5KFS A;  4FS1 A;  4ZH4 A;  4KLU A;  2HVI A;  3UXP A;  4IQT A;  4NLK A;  3MR5 A;  4RT2 A;  2W9B B;  3JPT A;  3RJK A;  4WC5 A;  5DG8 A;  4I2A A;  3PX4 A;  4ECZ A;  4RPZ A;  4UAZ A;  4MFF A;  3T5H A;  4TQR A;  2C28 A;  8ICV A;  1UA1 A;  9ICK A;  2NRZ A;  2NRK A;  3BQ1 A;  2KFZ A;  5J2E A;  2FPK A;  1S0M A;  2HVH A;  4PHP A;  4RZR A;  4KLJ A;  3OVB A;  4J9R A;  2AU0 A;  4LZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...