4PHDA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp and manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 105
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phdA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phdA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phdA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phdA03
4QWAA 2BGWA 3OSPA 1V9PA 5DGAA 3RJFA 2ZH3A 3GFKB 1H38A 5EWGA 4J9SA 1BGXT 4RNOA 1K1SA 2BQUA 5D4BA 1OU5A 8ICQA 3PW5A 4LT6A 3M9NB 4FHWA 5HRFA 4ED6A 4YR3A 4EEYA 4X4SA 5KFEA 2I1QA 5KFSA 4MFAA 1D9FA 4YQWA 3EZ5A 1TV9A 5HHIA 4RPYA 2FPMA 5L1IA 4BGDA 1TVAA 3SV3A 3M8SA 4RUCA 1TKDA 2AQ4A 2UVVA 3BJYA 3EPIA 3C2KA 7ICIA 2F1JA 1KRPA 4O3OA 3SZ2A 3ZDAA 5J0QA 3M9MB 1JMSA 4DQRA 1R8AA 1VJ7A 3BQ2A 4F5RA 2BCUA 4FBTA 3H7IA 4UD5A 3V72A 1XSLA 4GC7A 2JEIA 1R89A 4R65A 3PW7A 3H8JA 3EWAA 4YVZA 3EPGA 2ALZA 2FMQA 1ZQSA 7ICQA 3ISCA 4PGYA 2ZH5A 3MABA 1XO1A 4QZHA 4C8MA 4DL5A 5KFTA 1UA1A 1ZYQA 4C8LA 2HW3A 5DEDA 4RQ7A 4QZBA 1BPXA 4I2DA 5HP4A 1EXNA 4JV0A 3G6VA 1NZPA 9ICGA 1S76D 1KNYA 1R8CA 2O1PA 2V4QA 3RJKA 4O3NA 3UXPA 5KFGA 4RQ5A 2BCSA 1TFRA 9ICLA 4WBZA 3JPNA 4DL4A 5KFAA 1X9MA 2XGQA 2IMWP 5DG9A 1TK5A 3H38A 4DEZA 4FH5A 5J0PA 3T5LA 4RWQA 1NKCA 4DQPA 4J9NA 3JPTA 4DFJA 5DLGA 1JXLA 1TFYA 3NTUA 9ICXA 5J0RA 1BPDA 8ICOA 3TI0A 4YD1A 5CWRA 3IHQB 4QZFA 3QZ7A 4DSFA 4PGQA 4I29A 4J9QA 4IQWA 1X2IA 4GC6A 3KTQA 4JV1A 2ZH2A 3JZ0A 1B43A 1UT8A 5HMMA 3H4DA 3JYYA 4ED3A 3Q8SB 3RB3A 1JX4A 2KP7A 1TK8A 4RPZA 5IIKA 4QZCA 2ISOA 3OVAA 1ZQHA 4GXJA 1WCLA 1BVSA 5TZVA 1ZQQA 3RR7A 3NYBA 3C21A 4ED8A 4WC7A 3H39A 3PO5A 9ICPA 3H8SA 3IM1A 2NRWA 3PR4A 3C5FA 3HT3A 2Q0ZX 5J2FA 3T5HA 4F4KA 4EBKA 4KLUA 2Q66A 4I2CA 7ICVA 3C23A 1U48A 5J0YA 2JZBB 5J2CA 4Q43A 1L3SA 4UB1A 3V7KA 2R8IA 4MF8A 3PVXA 1DOQA 4PHDA 3HP6A 3C2LA 3RBDA 2JZBA 2ATLA 1ZJMA 4ELVA 4DO9A 4UAZA 4NM1A 4KLTA 4FHVA 4NKTA 4DOAA 4J9PA 2M2WA 1Q79A 2H5XA 5CR0A 4MFCA 2VANA 2GWSA 2UVUA 7ICSA 3RTVA 4DQIA 4KLHA 4ECZA 3N4MB 3PX4A 4QWEA 5HRLA 8ICSA 3Q8KA 2BCRA 2I9GA 1RPLA 7ICJA 3FYHA 2J6TA 3KHGA 3GV5B 4R66A 1U49A 2HHTA 3TAQA 4J9MA 5EWFA 1ZQBA 4IR1A 4M2YA 3PR5B 2DFLA 3E2EA 2V4RA 2ZTEA 4BXOB 4JUZA 3OJSA 3G6XA 4E7XA 3V6JA 8ICWA 3RJHA 3RJEA 4AT7A 2ZH4A 5KG0A 5KFDA 9ICVA 4BXOA 1K1QA 3MGHA 9ICTA 4KLOA 2Y1JA 3RB4A 1VFGA 4B9SA 1SL2A 4DSJA 2O5AA 1RXWA 4IRCA 2ID1A 1U4BA 4F4XA 1DK3A 4IQTA 2J6SA 1ZJNA 2ZH9A 3HWTA 1L3TA 8ICBA 3OV7A 3GILA 4AT9B 1TAUA 5KT4A 3RH4A 3BQTA 4JK1A 4XA5A 5JUMA 1ZQZA 3MFHA 1RXVA 4WCWA 5HC9A 4FH3A 2ZJAA 1NJYA 4F3OA 3JPPA 4DL7A 4I2HA 4AT9A 4M9HA 4DS5A 5KFUA 3C1YA 5J2KA 4QZIA 1NK9A 7ICFA 2FLPA 1XSPA 3WFOA 8ICMA 5J2GA 4B9LA 2DRBA 4YMMA 4ED7A 4M5DA 4X4OA 4WC5A 2ASLA 3ORYA 3MR6A 3QEBZ 4KLGA 4DFMA 4E0DA 2DR5A 1BPEA 3RH6A 3V6HA 2BHNA 4X4QA 5J29A 5J2IA 4RQ0A 1ZETA 1V4AA 1MIWA 5BOLA 4K4IA 3UPSA 1ZQKA 4KLFA 1ZQGA 1NK4A 4DOBA 1KFSA 4IRDA 5L9XA 5DQIA 5KFKA 4XUSA 4E8FA 2P6RA 2Y1IA 3SYZA 4DSKA 2AU0A 3AQKA 3H8WA 1XS9D 3UXOA 2KN7A 4KMUA 3RJGA 3RH5A 2HHUA 3JPQA 4O9MA 4TUPA 4IR9A 5HHHA 8ICXA 3WFQE 3PMNA 4KN4A 4Q8EA 4K4GA 7ICNA 2C2DA 4X0BA 7ICOA 4Z6DA 5J0SA 4XRHA 2DPIA 4ECUA 1NK0A 4FHYA 5F9NA 3RB0A 1LB2B 4F5QA 4I28A 2DVIA 3GIJA 5IINA 2XY5A 3HW8A 2ZUDA 5L1JA 5KFLA 5HRHA 4IG8A 5KTQA 4ECXA 4KITB 1IXRA 4KLDA 1S77D 2P66A 5D49A 4MF2A 2RDIA 4XQ8A 3N97B 9ICAA 5DECA 5KFXA 1BPBA 1D8LA 3WFRE 3ZDBA 4QZEA 3RAXA 2FPKA 3ZDDA 3K4GA 7ICUA 9ICHA 3BDPA 4DQSA 3BQ0A 1S0MA 5L1LA 1ZQJA 4BDPA 4QWDA 3OHBA 4IQVA 3WFSC 3RAQA 3LWMA 5IILA 3RB6A 1TFWA 5DBCA 4M9LA 4WC2A 4NLGA 2KZMA 5HREA 4X5VA 1S0OA 9ICCA 5HRKA 4X4UA 5KFWA 5KFMA 4YR0A 4QWBA 3MR2A 1XC9A 4ED1A 4GXKA 2FMPA 2PFNA 4DSIA 5HNKA 1HJPA 2HHWA 3ZDEA 3AUOA 4YMNA 4NLZA 3KHLA 3T5KA 5IIIA 4YP3A 3RRHA 1T7PA 1L3UA 5CP2A 4Z6EA 2PFQA 2P6UA 4F2RA 4TQRA 1UETA 2W8LA 2ASJA 4DQQA 9ICWA 4EBEA 3C66A 2BQRA 3GDXA 4F5OA 1SKWA 1NKEA 5CJ7A 5IIJA 1QTMA 4RU9A 4Q45A 3TARA 1BPZA 4FS2A 2NRTA 1HUOA 4Q8FA 4JWNA 4RWNA 8ICNA 5HMLA 1RYRA 7ICEA 1T8EA 4M6WB 2KFNA 2M9NA 2BKEA 4RQ3A 1X9WA 1XWLA 3MBYA 1LV5A 4DSEA 2FLNA 4QW9A 3RRGA 2BDPA 8ICTA 1F5AA 2ZHAA 9ICMA 5KG3A 4QW8A 1KTQA 2DR8A 4KLQA 4AT8B 2NRVA 5F9LA 3Q8QB 8ICZA 2WTFA 3C5GA 4F5NA 3PW0A 3THVA 1N56A 9ICIA 3C2MA 2BCQA 8ICGA 2NRKA 4IQUA 4RPXA 4YXMA 4X4TA 2F1HA 2FMSA 1IM4A 5L1KA 5DG7A 4MEXA 4RQ2A 2VA2A 1UEVA 4ATBB 5KG4A 3RJJA 1PZNA 4I2JA 5KT3A 4EYIB 1NKBA 1ZQUA 2BQ3A 2B21A 1C7YA 4ECYA 2BE3A 3AQNA 4PHPA 1JXEA 3GQCA 1KSPA 4LZGA 2JEJA 2ZJ5A 3PV8A 2ZJ8A 1QSSA 7ICMA 4M9NA 4CCHA 2ZH6A 8ICFA 3SV4A 7ICKA 5J0XA 4QZAA 2AJQA 2ZH1A 1JIHA 1R8BA 4ED2A 5HR9A 2ZH8A 4IRKA 4K4HA 3C1ZA 3UXNA 1NO5A 3PX0A 4UB3A 1KEJA 4DL3A 4I2EA 5DG8A 1SZPA 1CUKA 4LZDA 1SL0A 4I2GA 5KFOA 5KG1A 3G6YA 4O3QA 4R63A 4FO6A 2IHMA 4DSLA 1YLQA 4O5CA 4XQ7A 1NJXA 5CHGA 4S3NA 4PH5A 1KFTA 1NJWA 2R8JA 4RT3A 4C8KA 4ECVA 9ICEA 1NK7A 4P4PA 3QZ8A 5KFVA 3PW4A 2DPJA 2FLLA 2HHSA 4BWMA 2C22A 8ICYA 4X0AA 3HJ1A 3PMLA 3PO4A 3T3FA 5KFZA 1ZQNA 2JEGA 1UT5A 4JV2A 2HHXA 3GIMA 3QE9Y 4EBDA 1A77A 4KTQA 4NKUA 2KZ3A 4F8RA 7ICTA 3TAPA 4KLSA 5HRGA 4DL2A 2W9CB 4EZ9A 2ZTDA 3ISBA 5J2JA 4EBCA 4I2AA 2AQ0A 3OHAA 4C8NA 3OSNA 5KFCA 4TQSA 3TFSA 2W9CA 8ICPA 4F92B 4QZDA 1UA0A 2PI5A 4DF8A 4J9RA 4I27A 4M9GA 3WFPA 4KLLA 4KLMA 3Q8MA 2BCVA 1KLNA 2KFZA 4QZGA 2OWOA 5KFNA 3KHRA 3H37A 4M47A 2HHVA 5J2EA 4KN7A 4YXJA 2UVWA 5HRIA 5J2DA 4YCXA 5KFQA 4UAYA 1Y88A 4F5PA 2ZUBA 3M9OB 1NJZA 4ELTA 5EOZA 5DLFA 1CEZA 8ICUA 3OVBA 4TUSA 4F4YA 1ZQEA 4RQ1A 3ZD9A 4PHEA 1L3VA 4WC1A 1TAQA 3HX0A 4X4RA 2XY7A 3B0YA 4YG2A 4UAWA 3MR5A 4ECRA 3UQ2A 3JPSA 9ICNA 1ZQCA 1ZQMA 3MGIA 2F1IA 5DB9A 5DBAA 1N48A 5KT6A 4F4WA 1ZQAA 2IBKA 1MSWD 2XCAA 4X4VA 2IHNA 5KFIA 2V9WA 2AGPA 4DFPA 1S9FA 9ICJA 2M2VA 4RNMA 4RWPA 1SL1A 2KZZA 1Z00B 1ZQXA 1BNPA 1SKRA 7ICRA 1TK0A 2W9BB 3OGUA 4J9LA 3H40A 2KTQA 2MUTB 5DB8A 4UBCA 5KG6A 5IIMA 4YD2A 9ICSA 4G3IA 1Z00A 8ICVA 3RBEA 5KFFA 1SKSA 1MIYA 2W9BA 3MR3A 3BQ1A 4F50A 4P4OA 2MUTA 2R8HA 3TANA 2PI4A 3QEAZ 3HJ4A 2PXIA 4O3PA 3B0XA 4F4ZA 2XCPA 5KFBA 1L5UA 4JWMA 4MEYA 4DL6A 1ZQDA 4KLEA 4X4NA 5DKWA 4UB4A 1ZQRA 8ICHA 5F2VO 4RT2A 4FHXA 4I2FA 5CA7A 2C28A 3V7JA 4YR2A 4DFKA 1X9SA 4F2SA 9ICOA 3H3AA 4EBJA 2M2UA 2VA3A 5DQHA 4C8OA 7ICGA 3LQCB 4WC3A 3ETLA 3M8RA 4NXZA 5J2HA 3TQ1A 4RQ4A 5DDMA 4TUQA 5KG7A 2AGOA 5KFHA 1T3NA 3PY8A 1JN3A 4ED0A 1COOA 3GIKA 1KFDA 1NK6A 5DBBA 4KLJA 3PW2A 9ICKA 1QLNA 4F93B 4O3RA 1PX5A 2XY6A 2BR0A 4B9TA 3V7LA 1WOTA 2MAXA 2DR9A 4R8UB 3PX6A 7ICHA 2PFOA 4J9KA 4LVSA 1XU4A 4R8UA 5BPCA 2JEFA 4GLXA 3AQMA 4DLGA 1ZQLA 1U45A 4X4PA 4Q44A 2LYHA 3MDAA 4RWOA 9ICFA 2HHPA 4UBBA 1ZQIA 3ISDA 3H4BA 4MFFA 1ZQYA 4Z6FA 5C5JA 1BNOA 4M6WA 3EW9A 4QWCA 5HRDA 2R8KA 3KHHA 4ECQA 1ZQOA 7ICLA 2DR7A 3EYZA 5KT5A 1FA0A 1T4GA 5D46A 5EWEA 1NK8A 3C18A 3Q8LA 3UPQA 5DDYA 3LK9A 4HYKA 4I2IA 4O0IA 9ICBA 5HRBA 4WC6A 4DS4A 4AT8A 1JQRA 3NGDA 4BWJA 3Q8RB 2HVIA 8ICKA 2M2TA 2J6UA 4UD4A 4UB5A 3SI8A 5J0OA 1DGSA 1XSNA 3RR8A 3FDSA 3JPRA 2C2EA 1U9LA 4ECSA 4RUAA 4RQ6A 2ASDA 4ECTA 2HVHA 3HPOA 4PGXA 4ATBA 2PBEA 5DGBA 3T5JA 8ICRA 1B22A 4TURA 5KT2A 2NRZA 5DB6A 2W8KA 1D9DA 4P4MA 3ZDCA 4DLEA 8ICEA 4UQGA 3Q8PB 3OJUA 3UQ0A 3GV7B 4O5EA 4Z6CA 1S0VA 1KDHA 4P2HA 2R8GA 4M0AA 4RZRA 4ELUA 4M04A 1HUZA 4GXIA 5IIOA 4KLIA 3PNCA 1ZQFA 3L9DA 1DK2A 3AU6A 2XC9A 2XO7A 2ZH7A 5J2BA 4B9MA 4FHPA 3V6KA 4YMOA 1S10A 4YN4A 4I2BA 2W9MA 3OVSA 2VA8A 1A76A 1AROP 3K75D 3ZD8A 4B9VA 1UEUA 4WBYA 4YFKA 2UVRA 2HHQA 8ICIA 4RQ8A 4UB2A 5KFPA 1BPYA 2ISPA 3AQLA 4AT7B 4ECWA 4O5KA 4FS1A 1JAJA 5KFRA 1RYSA 2BPFA 4M9JA 2AGQA 3LDAA 1WCNA 4NM2A 4E80A 2A1JB 5J2AA 2ZUCA 5KG5A 5CB1A 3LWLA 2RDJA 3GIIA 1MC8A 2A1JA 4ZH4A 1U47A 4R64A 5BOMA 4B9UA 4NLKA 2ZTCA 9ICUA 4RNNA 5KG2A 8ICJA 5J0UA 4PPXA 9ICRA 1ZQWA 5KT7A 1RZTA 4WC0A 1QSYA 1MIVA 3MDCA 1S97A 2XGPA 3AU2A 2ZHBA 2FPLA 2DRAA 1NK5A 5J0TA 3MFIA 5DB7A 4DOCA 2PFPA 4NY8A 5KFJA 4J9OA 1ZQTA 4EYHB 4O3SA 2RFFA 2NRXA 4F91B 3GV8B 1Z3EB 4QZ8A 4DF4A 4WC4A 1NOMA 2C2RA 3RJIA 2IA6A 4EZ6A 8ICAA 4QZ9A 3TFRA 1D8YA 1QSLA 8ICCA 7ICPA 5DQGA 1MQ3A 2W9AA 1ZQVA 1Q78A 3OUYB 8ICLA 1MQ2A 4PHAA 1S0NA 4DWIA 5J0WA 4B9NA 4NLNA 4EP7A 1ZQPA 9ICQA 3OUYA 2BPGA 3HIYA 2BPCA 5KFYA 4FBUA 3JPOA
chains in the Genus database with same CATH superfamily
1ECWA 4QWAA 3CW2C 5DGAA 1H38A 5EWGA 1T3QA 3VC8A 2LHTA 8ICQA 4LT6A 2YMLA 1D9FA 1TV9A 3E0FA 3O0FA 3UMGA 2HI0A 3EPIA 3BJYA 3E58A 4LEZA 1KRPA 5G5GA 4DFDA 3SAGA 1VJ7A 4K9BA 2WF8A 4FBTA 5ALIA 3V72A 3ICXA 4CDGA 2JEIA 3H8JA 4OD0A 1XNSA 7ICQA 1KN5A 5DEDA 4JMUA 4RQ7A 4QZBA 2Y0SF 5AI6A 1S76D 2O1PA 4C4TA 4O3NA 3D2NA 4RQ5A 3MGVA 2WB1C 4EEBA 1X9MA 2XGQA 2AXTU 5DLGA 3CRXA 1K5OA 3NASA 2W7PA 4YD1A 9ICCA 4IQWA 4GC6A 3FAHA 1UT8A 5KNIA 3Q8SB 2KP7A 5IIKA 2JGAA 1ZQHA 4GXJA 4ED8A 3PO5A 2NRWA 3T5HA 4EBKA 3HT3A 2Q0ZX 4O69A 4BX9C 3ONNA 5AM0A 2ZIVB 2ZXHA 1V38A 4OJLA 1L3SA 3H39A 2Q66A 4PHDA 2ATLA 4DO9A 2ZIVA 4DOAA 5CR0A 1LVHA 3RTVA 1MN8A 3AN1A 4DCCA 3Q8KA 2BCRA 4BJQA 2I9GA 1U49A 3TAQA 4M2YA 2MA1A 2YTUA 2ZTEA 4BXOB 8ICWA 4AT7A 5KG0A 4BXOA 3MGHA 2Y1JA 3RB4A 4O67A 1RXWA 2KKPA 2QB1A 2J6SA 3HWTA 3OV7A 4AT9B 5KT4A 3QUQA 1RXVA 5HC9A 1ZQZA 2F76X 4AT9A 4M9HA 2LMRA 1IIPA 1NK9A 7ICFA 2FLPA 2ASLA 4Y2UA 4UASA 3V6HA 2BHNA 1LKYB 4X4QA 2DF4B 3WKCA 1LKYA 5F3XB 2HBLA 4K4IA 3NWIA 5CHEA 2YY6A 4Y2QA 1NK4A 1L7OA 2ZXIA 4NV0A 4E8FA 3M7DA 4DSKA 2HHUA 2LBOA 3WFQE 3PMNA 7ICNA 3SQIA 4JLXA 7ICOA 5J0SA 1SB3C 2DPIA 4ECUA 1X9XA 4FHYA 3SENA 5F9NA 3RB0A 2DVIA 2OXOA 5KFLA 2EH9A 3NUQA 4ECXA 4XQ8A 3N97B 5ALGA 1S0MA 1ZQJA 4QWDA 4IQVA 1TFWA 4U7CA 2KZMA 4X5VA 4CRXA 1XC9A 2PFNA 4ED1A 4K9AA 5HNKA 2HHWA 5JTGA 2AH5A 3ZDEA 3AUOA 3KHLA 5IIIA 3BZCA 3KBBA 2BDUA 1UETA 2JH1A 2ASJA 1TE2A 9ICWA 4EBEA 3C66A 3PHZA 1PVRA 1NKEA 5ALWA 3N7RC 5CJ7A 4RU9A 4Q45A 3TARA 2NRTA 3WU2U 8ICNA 4M6WB 2M9NA 4RQ3A 3A0BU 4DSEA 3RRGA 2ZHAA 2E3TA 1KTQA 4Y2PA 2NRVA 3Q8QB 8ICZA 1V85A 5AI9A 2ZIXB 2WTFA 3C5GA 3PW0A 2BCQA 2NRKA 1SV4A 4X4TA 2ZIXA 2P35A 4RQ2A 1RM6C 4NJ8A 1C7YA 2BQ3A 2B21A 2O6KA 5ALRA 4LZGA 4G9BA 1QSSA 2K4EA 4M9NA 2ZIWA 2Y9UA 1F44A 4QZAA 2AJQA 2KE7A 4I2EA 1SL0A 5KFOA 2IHMA 4DSLA 4O5CA 1NJXA 4K8VA 5ALDA 1KFTA 2R8JA 4RT3A 4C8KA 5ALSA 2HHSA 3KD3A 3T3FA 5KFZA 1OXJA 3GIMA 2EANA 5ALEA 2KMDA 2JR5A 2OM6A 4F8RA 7ICTA 4KLSA 4DL2A 3ISBA 4EBCA 1NI3A 1L8LA 3WK4A 5CFTA 2IHOA 3K1RB 3DEEA 2EZZA 3AM9A 3L3FX 2RQ5A 4QZGA 2HBJA 2OWOA 1T94A 5J2EA 4KN7A 4YCXA 5KFQA 3IP4B 1F5SA 1UQVA 4XJEA 1L3VA 1TAQA 3HX0A 4ECRA 2BBHA 3UQ2A 5JU5A 5DBAA 2IBKA 4F4WA 2XCAA 2V9WA 9ICJA 4C4SA 4LEVA 1SL1A 1ZQXA 1SKRA 5AKXA 2W9BB 5DB8A 2DWQA 4YD2A 2HBMA 4G3IA 4ICAA 2W9BA 4P4OA 2PI4A 2XCPA 4OAFA 5AKEA 5CA7A 2AHOB 2NV3A 1ZOLA 3H3AA 2M2UA 2YB4A 5DQHA 3ETLA 4NXZA 2D8CA 5J2HA 3R9KA 4RQ4A 4TUQA 1KBUA 4FZNA 1JN3A 3WKDA 4ED0A 1NK6A 9ICKA 4F93B 2XY6A 3IG8A 5G5HA 4QIWF 2B4VA 4DLGA 1ZQLA 1U45A 9ICFA 4MFFA 5C5JA 1JROA 4PJ0U 2F2AB 3EYZA 1FA0A 1T4GA 1S8OA 3Q8LA 5B3PA 4HYKA 4I2IA 4DS4A 2F3NA 4BWJA 3Q8RB 8ICKA 1IV8A 2HCFA 1XSNA 3JPRA 1U9LA 4RUAA 2EAMA 5DGBA 5DB6A 1D9DA 4NXWA 8ICEA 3OJUA 3Q8PB 1S0VA 4P2HA 4M0AA 4ELUA 4M04A 1HUZA 1ZQFA 2ZH7A 4Y2RA 4B9MA 3V6KA 2G08A 4I2BA 1A76A 1AROP 3K75D 3ZD8A 4B9VA 4WBYA 2ISPA 1HEKA 4ECWA 4O5KA 1JAJA 3WK5A 2BPFA 4M9JA 3LDAA 4NM2A 2ZUCA 5AKIA 4P0QB 1MC8A 4ZH4A 1L6NA 4R64A 4NLKA 2K8CB 8ICJA 3SD7A 4PPXA 4P0QA 9ICRA 2G06A 1ZQWA 1QSYA 1M6YA 3MDCA 4OAIZ 2FJ6A 3SR6A 2XGPA 1S97A 2DRAA 4NY8A 3GV8B 5EE3A 4QZ8A 2HN1A 5B5EU 4DF4A 2IA6A 8ICAA 7ICPA 5DQGA 1MQ3A 8ICLA 4KMOB 4DWIA 5ALLA 4B9NA 4NLNA 1ZQPA 3HIYA 2DR9A 2WAQF 2KJ9A 2GA9D 1OU5A 5D4BA 3M9NB 5HRFA 4ED6A 4UB8U 4YR3A 4X4SA 5KFEA 2I1QA 1Z4NA 4MFAA 4YQWA 3SV3A 3M8SA 3UMBA 2AQ4A 2B51A 4O3OA 3ZDAA 2HOIA 1R8AA 3BQ2A 2EZYA 1PK3A 1QQ7A 2ALZA 3EWAA 1ZRMA 1WYGA 2FMQA 4PGYA 1MA7A 1XO1A 4C8LA 4C8MA 1UA1A 1NZPA 5HP4A 5AK3A 2V4QA 3KKAC 3UXPA 3RJKA 5KFGA 2BCSA 2QB0B 2Y9TA 4UW9A 1X42A 4AYBF 9ICLA 4DL4A 1A0PA 5DG9A 1TK5A 2IMWP 4FH5A 2QB0A 4CF5A 4WQKA 2JRZA 1NKCA 4J9NA 3JPTA 2E8OA 3A0HU 3JCFA 1L7PA 2HDOA 1VLBA 3IHQB 4PGQA 4I29A 1OW5A 1B43A 5HMMA 2KD1A 3RB3A 3M6ZA 1TK8A 2CRXA 4C7YA 2RP5A 2YN4A 1WCLA 3IM1A 3C5FA 1JRPA 5J2FA 3H0LB 4MKPA 5J0YA 2JZBB 3F5EA 5T14A 3V7KA 3PVXA 4MF8A 9ICEA 3RBDA 2JZBA 2KK0A 1Z1VA 4KLTA 3J81j 4UAZA 4FHVA 1PUZA 2UVUA 3PX4A 5HRLA 8ICSA 3FC4A 1OUQA 2J6TA 3GV5B 2HHTA 4J9MA 4IR1A 1JALA 3QNMA 5AM5A 2DFLA 3BZKA 3E2EA 2K4HA 2WF7A 2ZH4A 5KFDA 9ICVA 1K1QA 1X6IA 1VFGA 4B9SA 1SL2A 2KG5A 2WFAA 5AI5A 4F4XA 4IQTA 8ICBA 4NXTA 5JUMA 4XA5A 2IOFK 3F2BA 2W3RA 4FH3A 1NJYA 3C1YA 4N7RA 3T79A 3WFOA 2KSOB 4M5DA 1RQLA 4X4OA 3MR6A 2CXYA 4KLGA 4DFMA 2KSOA 2W03A 3M6KA 5GTHU 4KLFA 2A3VA 4P0PB 5DQIA 2E8NA 4UATA 2AU0A 4P0PA 3H8WA 1XS9D 3UXOA 3RJGA 5ALYA 4ACOA 2C2DA 5AI8A 4Z6DA 4XRHA 1NK0A 1LB2B 4Y2VA 4F5QA 4I28A 5IINA 3EUB2 5HRHA 4NL9A 1N5WA 3KKAA 4KLDA 3SEIA 3UMCA 2P66A 5D49A 2RDIA 4NWIA 5DECA 3IDWA 3WFRE 3ZDBA 2FPKA 4FFDA 3K4GA 5ALKA 5D63A 3BQ0A 3WFSC 3NVVA 5IILA 1S0OA 5AKGA 5KFMA 4YR0A 3MR2A 4DSIA 2KICA 3T5KA 2NYVA 4YP3A 3RRHA 1T7PA 1D8BA 2RRDA 4C80A 4F2RA 2W8LA 4DQQA 5CFUA 3AEVA 2BQRA 1N2XA 3NVOA 1FEZA 4O3MA 4QNLA 4RWNA 4FS2A 1Z1BA 5HMLA 1T8EA 2KFNA 1X9WA 3MBYA 5AI0A 4QW9A 9ICMA 4KX3A 3THVA 3CP8A 4IQUA 4RPXA 2W55A 1IM4A 2K4IA 5DG7A 2IOFA 2CN1A 5FP0A 4ATBB 4I2JA 1ZQUA 3VCBA 1JXEA 3GQCA 5KL8B 2ZJ5A 2ZJ8A 1URJA 3IG5A 5J0XA 2ZH1A 1X6JA 4K4HA 4DL3A 5DG8A 1SZPA 1CUKA 4LEWA 4R63A 4FO6A 5J8YC 4LEYA 2QARB 4PH5A 2K4PA 1YT3A 3NRWA 3PW4A 4BWMA 2C22A 2QARA 4JLZA 2HSZA 3PMLA 1ZQNA 5E79U 2HHXA 3QE9Y 1A77A 2KZ3A 2W9CB 3QUCA 1RG6A 3KZXA 5KFCA 5AM4A 3OSNA 3TFSA 2W9CA 4UARA 1KW4A 4EX6A 4I27A 4J9RA 4O6AA 2EWRA 3MC1A 4KLLA 3CNHA 2KFZA 2N1RA 4M47A 2HHVA 3AMZA 5J2DA 4X4RA 2ZUBA 3M9OB 1NJZA 8ICUA 4F4YA 3ZD9A 4PHEA 2XY7A 3B0YA 2JH7A 4BUGA 3JPSA 9ICNA 3MGIA 5DB9A 1N48A 4DFPA 5EE1A 5CEHA 4RNMA 4RWPA 2WF5A 2YMQA 2KZZA 1RQNA 4B6JA 2KVCA 7ICRA 2KTQA 3H8MA 4UBCA 2MUTB 5KG6A 5ALJA 2HOQA 8ICVA 3QU5A 1MIYA 2MUTA 5AIBA 2EZXA 5KFBA 1L5UA 4KLEA 4US8A 4X4NA 3LVWA 4GFJA 8ICHA 5D62A 2VKQA 2C28A 2E8PA 2VA3A 1DXSA 4C8OA 3LQCB 4WC3A 2EAPA 1P7DA 5DDMA 2AGOA 5KFHA 4C7ZA 1COOA 5C0YA 4C0ZA 3PW2A 3QUTA 1QLNA 4EX7A 4O3RA 2XI9A 2BR0A 2KKVA 3V7LA 5CRXA 4R8UB 3SMVA 1QH9A 4J9KA 1SIJA 4R8UA 3AQMA 2K8AA 3BS7A 4X4PA 2LYHA 4RWOA 3ISDA 2I5HA 4M6WA 5HRDA 3S6JA 4ECQA 4K97A 2K8BB 3NKUA 3C18A 9ICBA 2W3SA 3CYMA 4PZOA 3NGDA 2CPRA 5J0OA 3RR8A 2ZIUB 2C2EA 2ASDA 2HVHA 4PGXA 2PBEA 2ZIUA 8ICRA 1B22A 5J8YA 2QLTA 3H0RB 1B0XA 1PK1B 4P4MA 3ZDCA 3CK6A 3UQ0A 4O5EA 1PK1A 4Z6CA 1KDHA 2F8LA 5KAFU 3IN5A 2YQEA 4YMOA 1S10A 4YN4A 2W9MA 1ZXIA 1J97A 2VJ5A 4NXXA 4IL6U 4YFKA 2HHQA 8ICIA 2F77X 1O08A 5KAIU 5KFRA 1RYSA 2KVSA 1WCNA 4E80A 3LWLA 3GIIA 1U47A 4B9UA 5AKLA 4RNNA 5KG2A 5J0UA 5AKJA 1MIVA 1N63A 2ODGA 2ZHBA 3MFIA 5DB7A 5KFJA 5AICA 2K60A 1Z3EB 4WC4A 2C2RA 4OJPA 4EZ6A 4QZ9A 3TFRA 8ICCA 3PSTA 3TADC 4OAHA 3OUYB 2FCLA 1S0NA 3FM9A 5J0WA 4EP7A 3OUYA 5KFYA 4FBUA 2DGZA 2BGWA 2ZH3A 4J9SA 3QXGA 1K1SA 3PW5A 4FHWA 5HHIA 2YX8A 2FPMA 5L1IA 4USAA 4BGDA 1TVAA 1TKDA 2UVVA 2F1JA 3SZ2A 5CFSA 1JMSA 3IRUA 3H7IA 4OCZA 1XSLA 4GC7A 1DRGA 1R89A 4R65A 2H3FA 1SWVA 3OPXA 1ZQSA 3ISCA 3WK6A 1ED1A 5KFTA 1ZYQA 1BPXA 4I2DA 1EXNA 4JV0A 3G6VA 9ICGA 1R8CA 1TFRA 4UAUA 3JPNA 5KFAA 4F72A 3H38A 1B4FA 5J0PA 4DQPA 5ALQA 4DFJA 5H2FU 1TFYA 3NTUA 2W04A 3TI0A 4QZFA 4DSFA 4K98A 1X2IA 3KTQA 4JV1A 2ZH2A 3JYYA 4ED3A 4RPZA 4QZCA 2ISOA 3HKZC 3OVAA 3I28A 1BVSA 5TZVA 1ZQQA 3RR7A 4WC7A 9ICPA 3H8SA 3PR4A 4F4KA 4KLUA 4I2CA 4OJ5A 7ICVA 5J2CA 1WWUA 4Q43A 3WK9A 4I0UA 2R8IA 3HP6A 1ZJMA 3C2LA 4NKTA 1Z19A 3ER8C 2M2WA 5ALMA 3N7PD 4MFCA 2GWSA 4DQIA 4KLHA 1SV0C 3N4MB 4QWEA 1RPLA 3QU4A 3FYHA 3KHGA 4R66A 4CGZA 2H3ZA 3QU2A 2V4RA 2RHFA 3V6JA 3RJEA 2NO4A 2GH1A 4KLOA 3KFUF 9ICTA 1NZBA 2O5AA 4IRCA 1U4BA 1GO3F 2G5HB 2ZH9A 1L3TA 3GILA 3TADA 1TAUA 5AKYA 3BQTA 3N28A 4JK1A 4WCWA 4CF4A 2ZJAA 4F3OA 1SGGA 3NS1A 4DL7A 4DS5A 5J2KA 4QZIA 2WF6A 1XSPA 8ICMA 5B66U 4B9LA 2DRBA 3ORYA 4KB6A 1BPEA 3RH6A 5J2IA 2BBJA 2LYBA 3C28A 3UPSA 1KFSA 4DOBA 4IRDA 2B56A 4XUSA 5KFKA 2Y1IA 3QYPA 4ZOHC 4KMUA 2FI1A 4IR9A 1GPJA 1N62A 3NRZA 4KN4A 4K4GA 4Q8EA 2NO5A 1PVPA 3GIJA 2XY5A 5L1JA 4IG8A 4KITB 3BS5B 1Q3VA 4MF2A 5HR6A 3F5AA 5KFXA 2WHEA 1BPBA 1D8LA 3BS5A 3RAXA 7ICUA 9ICHA 3WKBA 1FIQA 4BDPA 3OHBA 3F2CA 3LWMA 3RB6A 2G09A 4M9LA 4NLGA 2YMMA 1HJPA 3QX7A 4YMNA 1L3UA 5CP2A 4Z6EA 2P6UA 4TQRA 2EAOA 1SZHA 3GDXA 4F5OA 5ALOA 4WOYA 1WWVA 1QTMA 4EEKA 4Y2TA 8ICTA 1SV0A 5KG3A 4AT8B 5F9LA 2ZG6A 8ICGA 2H3QA 2F1HA 4UAVA 4MEXA 2GAFD 2DQNB 2LM4A 5TISU 5KT3A 1NKBA 2PMZC 1QQ6A 2BE3A 4PHPA 3NVWA 3QU7A 2JEJA 3PV8A 7ICMA 4CCHA 8ICFA 1NNLA 4Y2XA 4ED2A 5HR9A 2B6GA 2ZH8A 1NO5A 3PX0A 4UB3A 1KEJA 5KG1A 4GIBA 4UB6U 1YZ6A 3TACB 3K7DA 5AI4A 1NJWA 3WKAA 4S3NA 3QZ8A 2KIVA 5KFVA 2DPJA 5AK6A 3PO4A 1V97A 1UT5A 4KTQA 4NKUA 4EGWA 4EENA 4I2AA 2WB1F 4C8NA 3U26A 3K1ZA 4TQSA 8ICPA 4QZDA 2PI5A 4DF8A 2W43A 3F2DA 3WFPA 5AK5A 3UM9A 3Q8MA 2BCVA 5AKZA 2KOBA 3QU9A 5KFNA 5JTIA 3KHRA 3H37A 1UCVA 4YXJA 2UVWA 5HRIA 4IS7A 3PSIA 4F5PA 3AQEA 4ELTA 5DLFA 5HR7A 3DV9A 2E5SA 3N7SC 5AKKA 5KT6A 3RFAA 2IHNA 5KFIA 2KV2A 2AGPA 2MSNA 2M2VA 1Z00B 2E8MA 2HN2A 2YMPA 9ICSA 1Z00A 5KFFA 4F50A 2DBYA 2R8HA 3HJ4A 5DKWA 1ZQRA 5F2VO 4FHXA 4I2FA 3D6JA 4YR2A 1X9SA 4EBJA 7ICGA 5ALHA 2DKXA 1T3NA 3PY8A 1KFDA 3L5KA 3WK8A 1PX5A 4U6PA 2MAXA 3PX6A 3F53A 1XU4A 5GTIU 5ALNA 4GLXA 2HHPA 2G0AA 1ZQYA 4WJ3B 3EW9A 4QWCA 2R8KA 3KHHA 1ZQOA 5A0LA 5AKHA 5D46A 1NK8A 5HRBA 3UPQA 5DDYA 3LK9A 4O0IA 2B0CA 4UD4A 5ALTA 1SWWA 2KHQA 3ALRA 3C29A 4ECSA 4ECTA 4ATBA 3T5JA 3SAHA 2H3IA 4DLEA 4UQGA 1QQ5A 1ZD2P 1ZRNA 4LJXA 5IIOA 4KX5A 3PNCA 3L9DA 1DK2A 2M0NA 1CI4A 5J2BA 2Y0SC 3OVSA 1FFUA 2VA8A 2H3VA 2OH2A 4RQ8A 5KFPA 4AT7B 4FS1A 2AGQA 2A1JB 5J2AA 5KG5A 2A1JA 9ICUA 5BOMA 2DL0A 1RZTA 2KJ8A 4WC0A 3AU2A 5J0TA 4DOCA 4J9OA 4MHVA 3WKEA 1ZQTA 2OYYA 2NRXA 2WF9A 3RJIA 1D8YA 2W9AA 4PHAA 4PL1A 2MU2A 2BPCA 3OSPA 1V9PA 2LYAA 3RJFA 3GFKB 1BGXT 4RNOA 2BQUA 4IC9A 4EEYA 4OO1J 2FE9A 2LM1A 3OTQA 5KFSA 2JHDA 3EZ5A 1KL9A 1N5XA 4US9A 4RPYA 3HJEA 4RUCA 3H0MB 7ICIA 3C2KA 5J0QA 2OEHA 3M9MB 4DQRA 4UD5A 4F5RA 2BCUA 2XIDA 3QUBA 1N60A 3PW7A 3EPGA 4YVZA 4PZNA 4FZLA 4OJOA 2ZH5A 3MABA 2KNJA 4QZHA 4DL5A 2HW3A 5AM3A 1KNYA 1PVQA 2FDRA 2A1AA 2D3DA 5AHXA 1WG8A 3ZI4A 4EELA 4WBZA 2XICA 5AK4A 3TKAA 4DEZA 1ZD4A 3T5LA 4RWQA 3LVVA 1UPHA 1JXLA 2KEYA 2VIXA 9ICXA 5J0RA 1BPDA 8ICOA 5CWRA 1IG6A 3QZ7A 4J9QA 2JXJA 3JZ0A 3B9JA 5ALVA 3H4DA 1JX4A 4JB3A 4EEDA 5ALFA 3SAFA 1RDFA 3NYBA 3ER9B 3PZPA 1Q8KA 3C21A 2LPEA 4NXUA 4J03A 2IOHA 3C23A 1U48A 4UB1A 1DOQA 4ELVA 4NM1A 1FFVA 3M1YA 2A19A 4J9PA 1Q79A 2H5XA 2VANA 2W11A 7ICSA 4OAGA 4ECZA 2F44A 5ALZA 2ZIWB 7ICJA 3AL0B 5ALPA 4HAIA 5EWFA 1ZQBA 1C20A 3PR5B 4E7XA 4AP9A 4JUZA 3OJSA 1ZD3A 1S5LU 3G6XA 3RJHA 3IV6A 2W54A 4DSJA 3DDHA 2ID1A 3LYSA 1DK3A 1ZJNA 4CF3A 3RH4A 3L4PA 3MFHA 2HBKA 3JPPA 4I2HA 5KFUA 2GLEA 1XO0A 5J2GA 5JRTA 4YMMA 4ED7A 4WC5A 3QEBZ 3KZIU 4FO1A 4E0DA 2DR5A 3NVZA 5J29A 4KM5A 4NXVA 4RQMA 2GOLA 4RQ0A 1ZETA 2VJ4A 1V4AA 1MIWA 1JUDA 5BOLA 1ZQKA 3PSPA 1ZQGA 5L9XA 2P6RA 2OCEA 3SYZA 3AQKA 1X40A 2KN7A 3RH5A 3JPQA 2HMXA 4O9MA 4TUPA 3GZFA 3HKZF 5HHHA 8ICXA 3KOOA 4X0BA 3HW8A 2ZUDA 3EF2A 5KTQA 1IXRA 1S77D 3BQ7A 4PL2A 9ICAA 4QZEA 3ZDDA 3WK7A 3BDPA 4DQSA 5L1LA 2KJ5A 2DUYA 3RAQA 2E1EA 5DBCA 4WC2A 1VJ5A 5HREA 5HRKA 3MCRA 4X4UA 5KFWA 4QWBA 2FMPA 4GXKA 4NLZA 4A8EA 5AM1A 4RQNA 3GU3A 2PFQA 3PSFA 1YZ7A 1SKWA 2ES6A 5IIJA 4Q8FA 1BPZA 2D6FC 1N61A 1HUOA 4JWNA 1RYRA 7ICEA 1FO4A 2BKEA 1XWLA 1LV5A 2FLNA 1KQQA 3D2QA 2BDPA 1F5AA 4Y2YA 2E1FA 4QW8A 2DR8A 4KLQA 2LI6A 4F5NA 2ESEA 1N56A 9ICIA 3C2MA 4YXMA 1ZD5A 2MRLA 2R18A 2FMSA 5L1KA 1J2NA 5KL1B 2VA2A 1UEVA 5KG4A 3RJJA 2JV3A 3ETRA 1PZNA 4EYIB 4ECYA 3AQNA 1KSPA 2KHVA 2ZH6A 2XVTA 3SV4A 7ICKA 1JIHA 1R8BA 4WH5A 4IRKA 3C1ZA 3UXNA 3RF9A 4LZDA 2RLTA 4I2GA 3G6YA 4O3QA 1YLQA 4XQ7A 5CHGA 1COKA 4ECVA 1NK7A 4P4PA 4QIWC 8ICYA 2FLLA 1UHUA 4C4RA 2G07A 3HJ1A 3OWGA 1CRXA 2JEGA 4JV2A 4EBDA 2K89A 4CE6A 5HRGA 3TAPA 1F0MA 4EZ9A 2ZTDA 5J2JA 2AQ0A 3OHAA 2OHFA 4F92B 5B3QA 1UA0A 2BZFA 4M9GA 4WQLA 4KLMA 1QCKA 1KLNA 2F8KA 4Y2SA 4UAYA 4X0AA 1Y88A 3OVBA 4QJFB 5EOZA 3D2SA 1CEZA 2JMGA 4TUSA 1ZQEA 4WC1A 4RQ1A 1WUDA 5K4LA 1RYUA 4YG2A 3MR5A 4UAWA 1ZQCA 1ZQMA 2F1IA 1ZQAA 4X4VA 1MSWD 4OJ6A 1SXEA 1S9FA 4EV6A 1BNPA 1TK0A 5ALXA 3OGUA 4J9LA 3H40A 2GO7A 5IIMA 1AQ6A 2EDUA 5EE9A 2EQYA 3RBEA 1SKSA 3BQ1A 3MR3A 3TANA 3QEAZ 2PXIA 4O3PA 3B0XA 4F71A 4F4ZA 2PMZF 4JWMA 4MEYA 4DL6A 1ZQDA 2I6XA 2W7OA 4UB4A 2Q4TA 4RT2A 1L7MA 4NLBA 3V7JA 4DFKA 4F2SA 9ICOA 1KKXA 1HIWA 3M8RA 1TAMA 3TQ1A 5KG7A 3GIKA 5DBBA 4KLJA 4B9TA 1WOTA 7ICHA 4NL9C 2PFOA 4LVSA 2HOFA 5BPCA 2JEFA 4O68A 4Q44A 3HRDD 3MDAA 5EE0A 4UBBA 1ZQIA 2KIWA 3H4BA 1J2MA 1BNOA 4Z6FA 3HILA 2WAQC 7ICLA 5AM2A 2DR7A 5KT5A 4HX0A 2QKQA 5EWEA 1O03A 1JI7A 4WC6A 4AT8A 1JQRA 1X66A 5D61A 2M2TA 2HVIA 5L1MA 2J6UA 3AQFA 4UB5A 3SI8A 1DGSA 5AIAA 3FDSA 2DKZA 4FE3A 4RQ6A 3HPOA 2G5IB 5KT2A 4TURA 2NRZA 2W8KA 3GV7B 4K96A 2R8GA 2LKYA 4RZRA 4KLIA 4GXIA 1L8OA 3AU6A 2XC9A 2XO7A 1A6SA 4FHPA 3NVYA 1UEUA 4FZMA 4NLCA 2UVRA 4UB2A 1BPYA 3AQLA 4K99A 4AYBC 1ZQ1C 5CB1A 2RDJA 2PKEA 1SXDA 2IUBA 2ZTCA 3I1YA 1DGJA 5KT7A 3ERCC 1Q3UA 1L7NA 2FPLA 3ED5A 1NK5A 2PFPA 5ALUA 2YB1A 4EYHB 2Z7JA 4O3SA 1Z4OA 2RFFA 4F91B 1NOMA 1QSLA 4CNQA 1VDVA 1ZQVA 1Q78A 1MQ2A 1Q46A 3I76A 9ICQA 2BPGA 2L5YA 3JPOA 4Y2JA
chains in the Genus database with same CATH topology
4QWAA 2BGWA 3OSPA 1V9PA 5DGAA 3RJFA 2ZH3A 3GFKB 1H38A 5EWGA 4J9SA 1BGXT 4RNOA 1K1SA 2BQUA 5D4BA 1OU5A 8ICQA 3PW5A 4LT6A 3M9NB 4FHWA 5HRFA 4ED6A 4YR3A 4EEYA 4X4SA 5KFEA 2I1QA 5KFSA 4MFAA 1D9FA 4YQWA 3EZ5A 1TV9A 5HHIA 4RPYA 2FPMA 5L1IA 4BGDA 1TVAA 3SV3A 3M8SA 4RUCA 1TKDA 2AQ4A 2UVVA 3BJYA 3EPIA 3C2KA 7ICIA 2F1JA 1KRPA 4O3OA 3SZ2A 3ZDAA 5J0QA 3M9MB 1JMSA 4DQRA 1R8AA 1VJ7A 3BQ2A 4F5RA 2BCUA 4FBTA 3H7IA 4UD5A 3V72A 1XSLA 4GC7A 2JEIA 1R89A 4R65A 3PW7A 3H8JA 3EWAA 4YVZA 3EPGA 2ALZA 2FMQA 1ZQSA 7ICQA 3ISCA 4PGYA 2ZH5A 3MABA 1XO1A 4QZHA 4C8MA 4DL5A 5KFTA 1UA1A 1ZYQA 4C8LA 2HW3A 5DEDA 4RQ7A 4QZBA 1BPXA 4I2DA 5HP4A 1EXNA 4JV0A 3G6VA 1NZPA 9ICGA 1S76D 1KNYA 1R8CA 2O1PA 2V4QA 3RJKA 4O3NA 3UXPA 5KFGA 4RQ5A 2BCSA 1TFRA 9ICLA 4WBZA 3JPNA 4DL4A 5KFAA 1X9MA 2XGQA 2IMWP 5DG9A 1TK5A 3H38A 4DEZA 4FH5A 5J0PA 3T5LA 4RWQA 1NKCA 4DQPA 4J9NA 3JPTA 4DFJA 5DLGA 1JXLA 1TFYA 3NTUA 9ICXA 5J0RA 1BPDA 8ICOA 3TI0A 4YD1A 5CWRA 3IHQB 4QZFA 3QZ7A 4DSFA 4PGQA 4I29A 4J9QA 4IQWA 1X2IA 4GC6A 3KTQA 4JV1A 2ZH2A 3JZ0A 1B43A 1UT8A 5HMMA 3H4DA 3JYYA 4ED3A 3Q8SB 3RB3A 1JX4A 2KP7A 1TK8A 4RPZA 5IIKA 4QZCA 2ISOA 3OVAA 1ZQHA 4GXJA 1WCLA 1BVSA 5TZVA 1ZQQA 3RR7A 3NYBA 3C21A 4ED8A 4WC7A 3H39A 3PO5A 9ICPA 3H8SA 3IM1A 2NRWA 3PR4A 3C5FA 3HT3A 2Q0ZX 5J2FA 3T5HA 4F4KA 4EBKA 4KLUA 2Q66A 4I2CA 7ICVA 3C23A 1U48A 5J0YA 2JZBB 5J2CA 4Q43A 1L3SA 4UB1A 3V7KA 2R8IA 4MF8A 3PVXA 1DOQA 4PHDA 3HP6A 3C2LA 3RBDA 2JZBA 2ATLA 1ZJMA 4ELVA 4DO9A 4UAZA 4NM1A 4KLTA 4FHVA 4NKTA 4DOAA 4J9PA 2M2WA 1Q79A 2H5XA 5CR0A 4MFCA 2VANA 2GWSA 2UVUA 7ICSA 3RTVA 4DQIA 4KLHA 4ECZA 3N4MB 3PX4A 4QWEA 5HRLA 8ICSA 3Q8KA 2BCRA 2I9GA 1RPLA 7ICJA 3FYHA 2J6TA 3KHGA 3GV5B 4R66A 1U49A 2HHTA 3TAQA 4J9MA 5EWFA 1ZQBA 4IR1A 4M2YA 3PR5B 2DFLA 3E2EA 2V4RA 2ZTEA 4BXOB 4JUZA 3OJSA 3G6XA 4E7XA 3V6JA 8ICWA 3RJHA 3RJEA 4AT7A 2ZH4A 5KG0A 5KFDA 9ICVA 4BXOA 1K1QA 3MGHA 9ICTA 4KLOA 2Y1JA 3RB4A 1VFGA 4B9SA 1SL2A 4DSJA 2O5AA 1RXWA 4IRCA 2ID1A 1U4BA 4F4XA 1DK3A 4IQTA 2J6SA 1ZJNA 2ZH9A 3HWTA 1L3TA 8ICBA 3OV7A 3GILA 4AT9B 1TAUA 5KT4A 3RH4A 3BQTA 4JK1A 4XA5A 5JUMA 1ZQZA 3MFHA 1RXVA 4WCWA 5HC9A 4FH3A 2ZJAA 1NJYA 4F3OA 3JPPA 4DL7A 4I2HA 4AT9A 4M9HA 4DS5A 5KFUA 3C1YA 5J2KA 4QZIA 1NK9A 7ICFA 2FLPA 1XSPA 3WFOA 8ICMA 5J2GA 4B9LA 2DRBA 4YMMA 4ED7A 4M5DA 4X4OA 4WC5A 2ASLA 3ORYA 3MR6A 3QEBZ 4KLGA 4DFMA 4E0DA 2DR5A 1BPEA 3RH6A 3V6HA 2BHNA 4X4QA 5J29A 5J2IA 4RQ0A 1ZETA 1V4AA 1MIWA 5BOLA 4K4IA 3UPSA 1ZQKA 4KLFA 1ZQGA 1NK4A 4DOBA 1KFSA 4IRDA 5L9XA 5DQIA 5KFKA 4XUSA 4E8FA 2P6RA 2Y1IA 3SYZA 4DSKA 2AU0A 3AQKA 3H8WA 1XS9D 3UXOA 2KN7A 4KMUA 3RJGA 3RH5A 2HHUA 3JPQA 4O9MA 4TUPA 4IR9A 5HHHA 8ICXA 3WFQE 3PMNA 4KN4A 4Q8EA 4K4GA 7ICNA 2C2DA 4X0BA 7ICOA 4Z6DA 5J0SA 4XRHA 2DPIA 4ECUA 1NK0A 4FHYA 5F9NA 3RB0A 1LB2B 4F5QA 4I28A 2DVIA 3GIJA 5IINA 2XY5A 3HW8A 2ZUDA 5L1JA 5KFLA 5HRHA 4IG8A 5KTQA 4ECXA 4KITB 1IXRA 4KLDA 1S77D 2P66A 5D49A 4MF2A 2RDIA 4XQ8A 3N97B 9ICAA 5DECA 5KFXA 1BPBA 1D8LA 3WFRE 3ZDBA 4QZEA 3RAXA 2FPKA 3ZDDA 3K4GA 7ICUA 9ICHA 3BDPA 4DQSA 3BQ0A 1S0MA 5L1LA 1ZQJA 4BDPA 4QWDA 3OHBA 4IQVA 3WFSC 3RAQA 3LWMA 5IILA 3RB6A 1TFWA 5DBCA 4M9LA 4WC2A 4NLGA 2KZMA 5HREA 4X5VA 1S0OA 9ICCA 5HRKA 4X4UA 5KFWA 5KFMA 4YR0A 4QWBA 3MR2A 1XC9A 4ED1A 4GXKA 2FMPA 2PFNA 4DSIA 5HNKA 1HJPA 2HHWA 3ZDEA 3AUOA 4YMNA 4NLZA 3KHLA 3T5KA 5IIIA 4YP3A 3RRHA 1T7PA 1L3UA 5CP2A 4Z6EA 2PFQA 2P6UA 4F2RA 4TQRA 1UETA 2W8LA 2ASJA 4DQQA 9ICWA 4EBEA 3C66A 2BQRA 3GDXA 4F5OA 1SKWA 1NKEA 5CJ7A 5IIJA 1QTMA 4RU9A 4Q45A 3TARA 1BPZA 4FS2A 2NRTA 1HUOA 4Q8FA 4JWNA 4RWNA 8ICNA 5HMLA 1RYRA 7ICEA 1T8EA 4M6WB 2KFNA 2M9NA 2BKEA 4RQ3A 1X9WA 1XWLA 3MBYA 1LV5A 4DSEA 2FLNA 4QW9A 3RRGA 2BDPA 8ICTA 1F5AA 2ZHAA 9ICMA 5KG3A 4QW8A 1KTQA 2DR8A 4KLQA 4AT8B 2NRVA 5F9LA 3Q8QB 8ICZA 2WTFA 3C5GA 4F5NA 3PW0A 3THVA 1N56A 9ICIA 3C2MA 2BCQA 8ICGA 2NRKA 4IQUA 4RPXA 4YXMA 4X4TA 2F1HA 2FMSA 1IM4A 5L1KA 5DG7A 4MEXA 4RQ2A 2VA2A 1UEVA 4ATBB 5KG4A 3RJJA 1PZNA 4I2JA 5KT3A 4EYIB 1NKBA 1ZQUA 2BQ3A 2B21A 1C7YA 4ECYA 2BE3A 3AQNA 4PHPA 1JXEA 3GQCA 1KSPA 4LZGA 2JEJA 2ZJ5A 3PV8A 2ZJ8A 1QSSA 7ICMA 4M9NA 4CCHA 2ZH6A 8ICFA 3SV4A 7ICKA 5J0XA 4QZAA 2AJQA 2ZH1A 1JIHA 1R8BA 4ED2A 5HR9A 2ZH8A 4IRKA 4K4HA 3C1ZA 3UXNA 1NO5A 3PX0A 4UB3A 1KEJA 4DL3A 4I2EA 5DG8A 1SZPA 1CUKA 4LZDA 1SL0A 4I2GA 5KFOA 5KG1A 3G6YA 4O3QA 4R63A 4FO6A 2IHMA 4DSLA 1YLQA 4O5CA 4XQ7A 1NJXA 5CHGA 4S3NA 4PH5A 1KFTA 1NJWA 2R8JA 4RT3A 4C8KA 4ECVA 9ICEA 1NK7A 4P4PA 3QZ8A 5KFVA 3PW4A 2DPJA 2FLLA 2HHSA 4BWMA 2C22A 8ICYA 4X0AA 3HJ1A 3PMLA 3PO4A 3T3FA 5KFZA 1ZQNA 2JEGA 1UT5A 4JV2A 2HHXA 3GIMA 3QE9Y 4EBDA 1A77A 4KTQA 4NKUA 2KZ3A 4F8RA 7ICTA 3TAPA 4KLSA 5HRGA 4DL2A 2W9CB 4EZ9A 2ZTDA 3ISBA 5J2JA 4EBCA 4I2AA 2AQ0A 3OHAA 4C8NA 3OSNA 5KFCA 4TQSA 3TFSA 2W9CA 8ICPA 4F92B 4QZDA 1UA0A 2PI5A 4DF8A 4J9RA 4I27A 4M9GA 3WFPA 4KLLA 4KLMA 3Q8MA 2BCVA 1KLNA 2KFZA 4QZGA 2OWOA 5KFNA 3KHRA 3H37A 4M47A 2HHVA 5J2EA 4KN7A 4YXJA 2UVWA 5HRIA 5J2DA 4YCXA 5KFQA 4UAYA 1Y88A 4F5PA 2ZUBA 3M9OB 1NJZA 4ELTA 5EOZA 5DLFA 1CEZA 8ICUA 3OVBA 4TUSA 4F4YA 1ZQEA 4RQ1A 3ZD9A 4PHEA 1L3VA 4WC1A 1TAQA 3HX0A 4X4RA 2XY7A 3B0YA 4YG2A 4UAWA 3MR5A 4ECRA 3UQ2A 3JPSA 9ICNA 1ZQCA 1ZQMA 3MGIA 2F1IA 5DB9A 5DBAA 1N48A 5KT6A 4F4WA 1ZQAA 2IBKA 1MSWD 2XCAA 4X4VA 2IHNA 5KFIA 2V9WA 2AGPA 4DFPA 1S9FA 9ICJA 2M2VA 4RNMA 4RWPA 1SL1A 2KZZA 1Z00B 1ZQXA 1BNPA 1SKRA 7ICRA 1TK0A 2W9BB 3OGUA 4J9LA 3H40A 2KTQA 2MUTB 5DB8A 4UBCA 5KG6A 5IIMA 4YD2A 9ICSA 4G3IA 1Z00A 8ICVA 3RBEA 5KFFA 1SKSA 1MIYA 2W9BA 3MR3A 3BQ1A 4F50A 4P4OA 2MUTA 2R8HA 3TANA 2PI4A 3QEAZ 3HJ4A 2PXIA 4O3PA 3B0XA 4F4ZA 2XCPA 5KFBA 1L5UA 4JWMA 4MEYA 4DL6A 1ZQDA 4KLEA 4X4NA 5DKWA 4UB4A 1ZQRA 8ICHA 5F2VO 4RT2A 4FHXA 4I2FA 5CA7A 2C28A 3V7JA 4YR2A 4DFKA 1X9SA 4F2SA 9ICOA 3H3AA 4EBJA 2M2UA 2VA3A 5DQHA 4C8OA 7ICGA 3LQCB 4WC3A 3ETLA 3M8RA 4NXZA 5J2HA 3TQ1A 4RQ4A 5DDMA 4TUQA 5KG7A 2AGOA 5KFHA 1T3NA 3PY8A 1JN3A 4ED0A 1COOA 3GIKA 1KFDA 1NK6A 5DBBA 4KLJA 3PW2A 9ICKA 1QLNA 4F93B 4O3RA 1PX5A 2XY6A 2BR0A 4B9TA 3V7LA 1WOTA 2MAXA 2DR9A 4R8UB 3PX6A 7ICHA 2PFOA 4J9KA 4LVSA 1XU4A 4R8UA 5BPCA 2JEFA 4GLXA 3AQMA 4DLGA 1ZQLA 1U45A 4X4PA 4Q44A 2LYHA 3MDAA 4RWOA 9ICFA 2HHPA 4UBBA 1ZQIA 3ISDA 3H4BA 4MFFA 1ZQYA 4Z6FA 5C5JA 1BNOA 4M6WA 3EW9A 4QWCA 5HRDA 2R8KA 3KHHA 4ECQA 1ZQOA 7ICLA 2DR7A 3EYZA 5KT5A 1FA0A 1T4GA 5D46A 5EWEA 1NK8A 3C18A 3Q8LA 3UPQA 5DDYA 3LK9A 4HYKA 4I2IA 4O0IA 9ICBA 5HRBA 4WC6A 4DS4A 4AT8A 1JQRA 3NGDA 4BWJA 3Q8RB 2HVIA 8ICKA 2M2TA 2J6UA 4UD4A 4UB5A 3SI8A 5J0OA 1DGSA 1XSNA 3RR8A 3FDSA 3JPRA 2C2EA 1U9LA 4ECSA 4RUAA 4RQ6A 2ASDA 4ECTA 2HVHA 3HPOA 4PGXA 4ATBA 2PBEA 5DGBA 3T5JA 8ICRA 1B22A 4TURA 5KT2A 2NRZA 5DB6A 2W8KA 1D9DA 4P4MA 3ZDCA 4DLEA 8ICEA 4UQGA 3Q8PB 3OJUA 3UQ0A 3GV7B 4O5EA 4Z6CA 1S0VA 1KDHA 4P2HA 2R8GA 4M0AA 4RZRA 4ELUA 4M04A 1HUZA 4GXIA 5IIOA 4KLIA 3PNCA 1ZQFA 3L9DA 1DK2A 3AU6A 2XC9A 2XO7A 2ZH7A 5J2BA 4B9MA 4FHPA 3V6KA 4YMOA 1S10A 4YN4A 4I2BA 2W9MA 3OVSA 2VA8A 1A76A 1AROP 3K75D 3ZD8A 4B9VA 1UEUA 4WBYA 4YFKA 2UVRA 2HHQA 8ICIA 4RQ8A 4UB2A 5KFPA 1BPYA 2ISPA 3AQLA 4AT7B 4ECWA 4O5KA 4FS1A 1JAJA 5KFRA 1RYSA 2BPFA 4M9JA 2AGQA 3LDAA 1WCNA 4NM2A 4E80A 2A1JB 5J2AA 2ZUCA 5KG5A 5CB1A 3LWLA 2RDJA 3GIIA 1MC8A 2A1JA 4ZH4A 1U47A 4R64A 5BOMA 4B9UA 4NLKA 2ZTCA 9ICUA 4RNNA 5KG2A 8ICJA 5J0UA 4PPXA 9ICRA 1ZQWA 5KT7A 1RZTA 4WC0A 1QSYA 1MIVA 3MDCA 1S97A 2XGPA 3AU2A 2ZHBA 2FPLA 2DRAA 1NK5A 5J0TA 3MFIA 5DB7A 4DOCA 2PFPA 4NY8A 5KFJA 4J9OA 1ZQTA 4EYHB 4O3SA 2RFFA 2NRXA 4F91B 3GV8B 1Z3EB 4QZ8A 4DF4A 4WC4A 1NOMA 2C2RA 3RJIA 2IA6A 4EZ6A 8ICAA 4QZ9A 3TFRA 1D8YA 1QSLA 8ICCA 7ICPA 5DQGA 1MQ3A 2W9AA 1ZQVA 1Q78A 3OUYB 8ICLA 1MQ2A 4PHAA 1S0NA 4DWIA 5J0WA 4B9NA 4NLNA 4EP7A 1ZQPA 9ICQA 3OUYA 2BPGA 3HIYA 2BPCA 5KFYA 4FBUA 3JPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QWA A;  2BGW A;  3OSP A;  1V9P A;  5DGA A;  3RJF A;  2ZH3 A;  3GFK B;  1H38 A;  5EWG A;  4J9S A;  1BGX T;  4RNO A;  1K1S A;  2BQU A;  5D4B A;  1OU5 A;  8ICQ A;  3PW5 A;  4LT6 A;  3M9N B;  4FHW A;  5HRF A;  4ED6 A;  4YR3 A;  4EEY A;  4X4S A;  5KFE A;  2I1Q A;  5KFS A;  4MFA A;  1D9F A;  4YQW A;  3EZ5 A;  1TV9 A;  5HHI A;  4RPY A;  2FPM A;  5L1I A;  4BGD A;  1TVA A;  3SV3 A;  3M8S A;  4RUC A;  1TKD A;  2AQ4 A;  2UVV A;  3BJY A;  3EPI A;  3C2K A;  7ICI A;  2F1J A;  1KRP A;  4O3O A;  3SZ2 A;  3ZDA A;  5J0Q A;  3M9M B;  1JMS A;  4DQR A;  1R8A A;  1VJ7 A;  3BQ2 A;  4F5R A;  2BCU A;  4FBT A;  3H7I A;  4UD5 A;  3V72 A;  1XSL A;  4GC7 A;  2JEI A;  1R89 A;  4R65 A;  3PW7 A;  3H8J A;  3EWA A;  4YVZ A;  3EPG A;  2ALZ A;  2FMQ A;  1ZQS A;  7ICQ A;  3ISC A;  4PGY A;  2ZH5 A;  3MAB A;  1XO1 A;  4QZH A;  4C8M A;  4DL5 A;  5KFT A;  1UA1 A;  1ZYQ A;  4C8L A;  2HW3 A;  5DED A;  4RQ7 A;  4QZB A;  1BPX A;  4I2D A;  5HP4 A;  1EXN A;  4JV0 A;  3G6V A;  1NZP A;  9ICG A;  1S76 D;  1KNY A;  1R8C A;  2O1P A;  2V4Q A;  3RJK A;  4O3N A;  3UXP A;  5KFG A;  4RQ5 A;  2BCS A;  1TFR A;  9ICL A;  4WBZ A;  3JPN A;  4DL4 A;  5KFA A;  1X9M A;  2XGQ A;  2IMW P;  5DG9 A;  1TK5 A;  3H38 A;  4DEZ A;  4FH5 A;  5J0P A;  3T5L A;  4RWQ A;  1NKC A;  4DQP A;  4J9N A;  3JPT A;  4DFJ A;  5DLG A;  1JXL A;  1TFY A;  3NTU A;  9ICX A;  5J0R A;  1BPD A;  8ICO A;  3TI0 A;  4YD1 A;  5CWR A;  3IHQ B;  4QZF A;  3QZ7 A;  4DSF A;  4PGQ A;  4I29 A;  4J9Q A;  4IQW A;  1X2I A;  4GC6 A;  3KTQ A;  4JV1 A;  2ZH2 A;  3JZ0 A;  1B43 A;  1UT8 A;  5HMM A;  3H4D A;  3JYY A;  4ED3 A;  3Q8S B;  3RB3 A;  1JX4 A;  2KP7 A;  1TK8 A;  4RPZ A;  5IIK A;  4QZC A;  2ISO A;  3OVA A;  1ZQH A;  4GXJ A;  1WCL A;  1BVS A;  5TZV A;  1ZQQ A;  3RR7 A;  3NYB A;  3C21 A;  4ED8 A;  4WC7 A;  3H39 A;  3PO5 A;  9ICP A;  3H8S A;  3IM1 A;  2NRW A;  3PR4 A;  3C5F A;  3HT3 A;  2Q0Z X;  5J2F A;  3T5H A;  4F4K A;  4EBK A;  4KLU A;  2Q66 A;  4I2C A;  7ICV A;  3C23 A;  1U48 A;  5J0Y A;  2JZB B;  5J2C A;  4Q43 A;  1L3S A;  4UB1 A;  3V7K A;  2R8I A;  4MF8 A;  3PVX A;  1DOQ A;  4PHD A;  3HP6 A;  3C2L A;  3RBD A;  2JZB A;  2ATL A;  1ZJM A;  4ELV A;  4DO9 A;  4UAZ A;  4NM1 A;  4KLT A;  4FHV A;  4NKT A;  4DOA A;  4J9P A;  2M2W A;  1Q79 A;  2H5X A;  5CR0 A;  4MFC A;  2VAN A;  2GWS A;  2UVU A;  7ICS A;  3RTV A;  4DQI A;  4KLH A;  4ECZ A;  3N4M B;  3PX4 A;  4QWE A;  5HRL A;  8ICS A;  3Q8K A;  2BCR A;  2I9G A;  1RPL A;  7ICJ A;  3FYH A;  2J6T A;  3KHG A;  3GV5 B;  4R66 A;  1U49 A;  2HHT A;  3TAQ A;  4J9M A;  5EWF A;  1ZQB A;  4IR1 A;  4M2Y A;  3PR5 B;  2DFL A;  3E2E A;  2V4R A;  2ZTE A;  4BXO B;  4JUZ A;  3OJS A;  3G6X A;  4E7X A;  3V6J A;  8ICW A;  3RJH A;  3RJE A;  4AT7 A;  2ZH4 A;  5KG0 A;  5KFD A;  9ICV A;  4BXO A;  1K1Q A;  3MGH A;  9ICT A;  4KLO A;  2Y1J A;  3RB4 A;  1VFG A;  4B9S A;  1SL2 A;  4DSJ A;  2O5A A;  1RXW A;  4IRC A;  2ID1 A;  1U4B A;  4F4X A;  1DK3 A;  4IQT A;  2J6S A;  1ZJN A;  2ZH9 A;  3HWT A;  1L3T A;  8ICB A;  3OV7 A;  3GIL A;  4AT9 B;  1TAU A;  5KT4 A;  3RH4 A;  3BQT A;  4JK1 A;  4XA5 A;  5JUM A;  1ZQZ A;  3MFH A;  1RXV A;  4WCW A;  5HC9 A;  4FH3 A;  2ZJA A;  1NJY A;  4F3O A;  3JPP A;  4DL7 A;  4I2H A;  4AT9 A;  4M9H A;  4DS5 A;  5KFU A;  3C1Y A;  5J2K A;  4QZI A;  1NK9 A;  7ICF A;  2FLP A;  1XSP A;  3WFO A;  8ICM A;  5J2G A;  4B9L A;  2DRB A;  4YMM A;  4ED7 A;  4M5D A;  4X4O A;  4WC5 A;  2ASL A;  3ORY A;  3MR6 A;  3QEB Z;  4KLG A;  4DFM A;  4E0D A;  2DR5 A;  1BPE A;  3RH6 A;  3V6H A;  2BHN A;  4X4Q A;  5J29 A;  5J2I A;  4RQ0 A;  1ZET A;  1V4A A;  1MIW A;  5BOL A;  4K4I A;  3UPS A;  1ZQK A;  4KLF A;  1ZQG A;  1NK4 A;  4DOB A;  1KFS A;  4IRD A;  5L9X A;  5DQI A;  5KFK A;  4XUS A;  4E8F A;  2P6R A;  2Y1I A;  3SYZ A;  4DSK A;  2AU0 A;  3AQK A;  3H8W A;  1XS9 D;  3UXO A;  2KN7 A;  4KMU A;  3RJG A;  3RH5 A;  2HHU A;  3JPQ A;  4O9M A;  4TUP A;  4IR9 A;  5HHH A;  8ICX A;  3WFQ E;  3PMN A;  4KN4 A;  4Q8E A;  4K4G A;  7ICN A;  2C2D A;  4X0B A;  7ICO A;  4Z6D A;  5J0S A;  4XRH A;  2DPI A;  4ECU A;  1NK0 A;  4FHY A;  5F9N A;  3RB0 A;  1LB2 B;  4F5Q A;  4I28 A;  2DVI A;  3GIJ A;  5IIN A;  2XY5 A;  3HW8 A;  2ZUD A;  5L1J A;  5KFL A;  5HRH A;  4IG8 A;  5KTQ A;  4ECX A;  4KIT B;  1IXR A;  4KLD A;  1S77 D;  2P66 A;  5D49 A;  4MF2 A;  2RDI A;  4XQ8 A;  3N97 B;  9ICA A;  5DEC A;  5KFX A;  1BPB A;  1D8L A;  3WFR E;  3ZDB A;  4QZE A;  3RAX A;  2FPK A;  3ZDD A;  3K4G A;  7ICU A;  9ICH A;  3BDP A;  4DQS A;  3BQ0 A;  1S0M A;  5L1L A;  1ZQJ A;  4BDP A;  4QWD A;  3OHB A;  4IQV A;  3WFS C;  3RAQ A;  3LWM A;  5IIL A;  3RB6 A;  1TFW A;  5DBC A;  4M9L A;  4WC2 A;  4NLG A;  2KZM A;  5HRE A;  4X5V A;  1S0O A;  9ICC A;  5HRK A;  4X4U A;  5KFW A;  5KFM A;  4YR0 A;  4QWB A;  3MR2 A;  1XC9 A;  4ED1 A;  4GXK A;  2FMP A;  2PFN A;  4DSI A;  5HNK A;  1HJP A;  2HHW A;  3ZDE A;  3AUO A;  4YMN A;  4NLZ A;  3KHL A;  3T5K A;  5III A;  4YP3 A;  3RRH A;  1T7P A;  1L3U A;  5CP2 A;  4Z6E A;  2PFQ A;  2P6U A;  4F2R A;  4TQR A;  1UET A;  2W8L A;  2ASJ A;  4DQQ A;  9ICW A;  4EBE A;  3C66 A;  2BQR A;  3GDX A;  4F5O A;  1SKW A;  1NKE A;  5CJ7 A;  5IIJ A;  1QTM A;  4RU9 A;  4Q45 A;  3TAR A;  1BPZ A;  4FS2 A;  2NRT A;  1HUO A;  4Q8F A;  4JWN A;  4RWN A;  8ICN A;  5HML A;  1RYR A;  7ICE A;  1T8E A;  4M6W B;  2KFN A;  2M9N A;  2BKE A;  4RQ3 A;  1X9W A;  1XWL A;  3MBY A;  1LV5 A;  4DSE A;  2FLN A;  4QW9 A;  3RRG A;  2BDP A;  8ICT A;  1F5A A;  2ZHA A;  9ICM A;  5KG3 A;  4QW8 A;  1KTQ A;  2DR8 A;  4KLQ A;  4AT8 B;  2NRV A;  5F9L A;  3Q8Q B;  8ICZ A;  2WTF A;  3C5G A;  4F5N A;  3PW0 A;  3THV A;  1N56 A;  9ICI A;  3C2M A;  2BCQ A;  8ICG A;  2NRK A;  4IQU A;  4RPX A;  4YXM A;  4X4T A;  2F1H A;  2FMS A;  1IM4 A;  5L1K A;  5DG7 A;  4MEX A;  4RQ2 A;  2VA2 A;  1UEV A;  4ATB B;  5KG4 A;  3RJJ A;  1PZN A;  4I2J A;  5KT3 A;  4EYI B;  1NKB A;  1ZQU A;  2BQ3 A;  2B21 A;  1C7Y A;  4ECY A;  2BE3 A;  3AQN A;  4PHP A;  1JXE A;  3GQC A;  1KSP A;  4LZG A;  2JEJ A;  2ZJ5 A;  3PV8 A;  2ZJ8 A;  1QSS A;  7ICM A;  4M9N A;  4CCH A;  2ZH6 A;  8ICF A;  3SV4 A;  7ICK A;  5J0X A;  4QZA A;  2AJQ A;  2ZH1 A;  1JIH A;  1R8B A;  4ED2 A;  5HR9 A;  2ZH8 A;  4IRK A;  4K4H A;  3C1Z A;  3UXN A;  1NO5 A;  3PX0 A;  4UB3 A;  1KEJ A;  4DL3 A;  4I2E A;  5DG8 A;  1SZP A;  1CUK A;  4LZD A;  1SL0 A;  4I2G A;  5KFO A;  5KG1 A;  3G6Y A;  4O3Q A;  4R63 A;  4FO6 A;  2IHM A;  4DSL A;  1YLQ A;  4O5C A;  4XQ7 A;  1NJX A;  5CHG A;  4S3N A;  4PH5 A;  1KFT A;  1NJW A;  2R8J A;  4RT3 A;  4C8K A;  4ECV A;  9ICE A;  1NK7 A;  4P4P A;  3QZ8 A;  5KFV A;  3PW4 A;  2DPJ A;  2FLL A;  2HHS A;  4BWM A;  2C22 A;  8ICY A;  4X0A A;  3HJ1 A;  3PML A;  3PO4 A;  3T3F A;  5KFZ A;  1ZQN A;  2JEG A;  1UT5 A;  4JV2 A;  2HHX A;  3GIM A;  3QE9 Y;  4EBD A;  1A77 A;  4KTQ A;  4NKU A;  2KZ3 A;  4F8R A;  7ICT A;  3TAP A;  4KLS A;  5HRG A;  4DL2 A;  2W9C B;  4EZ9 A;  2ZTD A;  3ISB A;  5J2J A;  4EBC A;  4I2A A;  2AQ0 A;  3OHA A;  4C8N A;  3OSN A;  5KFC A;  4TQS A;  3TFS A;  2W9C A;  8ICP A;  4F92 B;  4QZD A;  1UA0 A;  2PI5 A;  4DF8 A;  4J9R A;  4I27 A;  4M9G A;  3WFP A;  4KLL A;  4KLM A;  3Q8M A;  2BCV A;  1KLN A;  2KFZ A;  4QZG A;  2OWO A;  5KFN A;  3KHR A;  3H37 A;  4M47 A;  2HHV A;  5J2E A;  4KN7 A;  4YXJ A;  2UVW A;  5HRI A;  5J2D A;  4YCX A;  5KFQ A;  4UAY A;  1Y88 A;  4F5P A;  2ZUB A;  3M9O B;  1NJZ A;  4ELT A;  5EOZ A;  5DLF A;  1CEZ A;  8ICU A;  3OVB A;  4TUS A;  4F4Y A;  1ZQE A;  4RQ1 A;  3ZD9 A;  4PHE A;  1L3V A;  4WC1 A;  1TAQ A;  3HX0 A;  4X4R A;  2XY7 A;  3B0Y A;  4YG2 A;  4UAW A;  3MR5 A;  4ECR A;  3UQ2 A;  3JPS A;  9ICN A;  1ZQC A;  1ZQM A;  3MGI A;  2F1I A;  5DB9 A;  5DBA A;  1N48 A;  5KT6 A;  4F4W A;  1ZQA A;  2IBK A;  1MSW D;  2XCA A;  4X4V A;  2IHN A;  5KFI A;  2V9W A;  2AGP A;  4DFP A;  1S9F A;  9ICJ A;  2M2V A;  4RNM A;  4RWP A;  1SL1 A;  2KZZ A;  1Z00 B;  1ZQX A;  1BNP A;  1SKR A;  7ICR A;  1TK0 A;  2W9B B;  3OGU A;  4J9L A;  3H40 A;  2KTQ A;  2MUT B;  5DB8 A;  4UBC A;  5KG6 A;  5IIM A;  4YD2 A;  9ICS A;  4G3I A;  1Z00 A;  8ICV A;  3RBE A;  5KFF A;  1SKS A;  1MIY A;  2W9B A;  3MR3 A;  3BQ1 A;  4F50 A;  4P4O A;  2MUT A;  2R8H A;  3TAN A;  2PI4 A;  3QEA Z;  3HJ4 A;  2PXI A;  4O3P A;  3B0X A;  4F4Z A;  2XCP A;  5KFB A;  1L5U A;  4JWM A;  4MEY A;  4DL6 A;  1ZQD A;  4KLE A;  4X4N A;  5DKW A;  4UB4 A;  1ZQR A;  8ICH A;  5F2V O;  4RT2 A;  4FHX A;  4I2F A;  5CA7 A;  2C28 A;  3V7J A;  4YR2 A;  4DFK A;  1X9S A;  4F2S A;  9ICO A;  3H3A A;  4EBJ A;  2M2U A;  2VA3 A;  5DQH A;  4C8O A;  7ICG A;  3LQC B;  4WC3 A;  3ETL A;  3M8R A;  4NXZ A;  5J2H A;  3TQ1 A;  4RQ4 A;  5DDM A;  4TUQ A;  5KG7 A;  2AGO A;  5KFH A;  1T3N A;  3PY8 A;  1JN3 A;  4ED0 A;  1COO A;  3GIK A;  1KFD A;  1NK6 A;  5DBB A;  4KLJ A;  3PW2 A;  9ICK A;  1QLN A;  4F93 B;  4O3R A;  1PX5 A;  2XY6 A;  2BR0 A;  4B9T A;  3V7L A;  1WOT A;  2MAX A;  2DR9 A;  4R8U B;  3PX6 A;  7ICH A;  2PFO A;  4J9K A;  4LVS A;  1XU4 A;  4R8U A;  5BPC A;  2JEF A;  4GLX A;  3AQM A;  4DLG A;  1ZQL A;  1U45 A;  4X4P A;  4Q44 A;  2LYH A;  3MDA A;  4RWO A;  9ICF A;  2HHP A;  4UBB A;  1ZQI A;  3ISD A;  3H4B A;  4MFF A;  1ZQY A;  4Z6F A;  5C5J A;  1BNO A;  4M6W A;  3EW9 A;  4QWC A;  5HRD A;  2R8K A;  3KHH A;  4ECQ A;  1ZQO A;  7ICL A;  2DR7 A;  3EYZ A;  5KT5 A;  1FA0 A;  1T4G A;  5D46 A;  5EWE A;  1NK8 A;  3C18 A;  3Q8L A;  3UPQ A;  5DDY A;  3LK9 A;  4HYK A;  4I2I A;  4O0I A;  9ICB A;  5HRB A;  4WC6 A;  4DS4 A;  4AT8 A;  1JQR A;  3NGD A;  4BWJ A;  3Q8R B;  2HVI A;  8ICK A;  2M2T A;  2J6U A;  4UD4 A;  4UB5 A;  3SI8 A;  5J0O A;  1DGS A;  1XSN A;  3RR8 A;  3FDS A;  3JPR A;  2C2E A;  1U9L A;  4ECS A;  4RUA A;  4RQ6 A;  2ASD A;  4ECT A;  2HVH A;  3HPO A;  4PGX A;  4ATB A;  2PBE A;  5DGB A;  3T5J A;  8ICR A;  1B22 A;  4TUR A;  5KT2 A;  2NRZ A;  5DB6 A;  2W8K A;  1D9D A;  4P4M A;  3ZDC A;  4DLE A;  8ICE A;  4UQG A;  3Q8P B;  3OJU A;  3UQ0 A;  3GV7 B;  4O5E A;  4Z6C A;  1S0V A;  1KDH A;  4P2H A;  2R8G A;  4M0A A;  4RZR A;  4ELU A;  4M04 A;  1HUZ A;  4GXI A;  5IIO A;  4KLI A;  3PNC A;  1ZQF A;  3L9D A;  1DK2 A;  3AU6 A;  2XC9 A;  2XO7 A;  2ZH7 A;  5J2B A;  4B9M A;  4FHP A;  3V6K A;  4YMO A;  1S10 A;  4YN4 A;  4I2B A;  2W9M A;  3OVS A;  2VA8 A;  1A76 A;  1ARO P;  3K75 D;  3ZD8 A;  4B9V A;  1UEU A;  4WBY A;  4YFK A;  2UVR A;  2HHQ A;  8ICI A;  4RQ8 A;  4UB2 A;  5KFP A;  1BPY A;  2ISP A;  3AQL A;  4AT7 B;  4ECW A;  4O5K A;  4FS1 A;  1JAJ A;  5KFR A;  1RYS A;  2BPF A;  4M9J A;  2AGQ A;  3LDA A;  1WCN A;  4NM2 A;  4E80 A;  2A1J B;  5J2A A;  2ZUC A;  5KG5 A;  5CB1 A;  3LWL A;  2RDJ A;  3GII A;  1MC8 A;  2A1J A;  4ZH4 A;  1U47 A;  4R64 A;  5BOM A;  4B9U A;  4NLK A;  2ZTC A;  9ICU A;  4RNN A;  5KG2 A;  8ICJ A;  5J0U A;  4PPX A;  9ICR A;  1ZQW A;  5KT7 A;  1RZT A;  4WC0 A;  1QSY A;  1MIV A;  3MDC A;  1S97 A;  2XGP A;  3AU2 A;  2ZHB A;  2FPL A;  2DRA A;  1NK5 A;  5J0T A;  3MFI A;  5DB7 A;  4DOC A;  2PFP A;  4NY8 A;  5KFJ A;  4J9O A;  1ZQT A;  4EYH B;  4O3S A;  2RFF A;  2NRX A;  4F91 B;  3GV8 B;  1Z3E B;  4QZ8 A;  4DF4 A;  4WC4 A;  1NOM A;  2C2R A;  3RJI A;  2IA6 A;  4EZ6 A;  8ICA A;  4QZ9 A;  3TFR A;  1D8Y A;  1QSL A;  8ICC A;  7ICP A;  5DQG A;  1MQ3 A;  2W9A A;  1ZQV A;  1Q78 A;  3OUY B;  8ICL A;  1MQ2 A;  4PHA A;  1S0N A;  4DWI A;  5J0W A;  4B9N A;  4NLN A;  4EP7 A;  1ZQP A;  9ICQ A;  3OUY A;  2BPG A;  3HIY A;  2BPC A;  5KFY A;  4FBU A;  3JPO A; 
#chains in the Genus database with same CATH topology
 1ECW A;  4QWA A;  3CW2 C;  5DGA A;  1H38 A;  5EWG A;  1T3Q A;  3VC8 A;  2LHT A;  8ICQ A;  4LT6 A;  2YML A;  1D9F A;  1TV9 A;  3E0F A;  3O0F A;  3UMG A;  2HI0 A;  3EPI A;  3BJY A;  3E58 A;  4LEZ A;  1KRP A;  5G5G A;  4DFD A;  3SAG A;  1VJ7 A;  4K9B A;  2WF8 A;  4FBT A;  5ALI A;  3V72 A;  3ICX A;  4CDG A;  2JEI A;  3H8J A;  4OD0 A;  1XNS A;  7ICQ A;  1KN5 A;  5DED A;  4JMU A;  4RQ7 A;  4QZB A;  2Y0S F;  5AI6 A;  1S76 D;  2O1P A;  4C4T A;  4O3N A;  3D2N A;  4RQ5 A;  3MGV A;  2WB1 C;  4EEB A;  1X9M A;  2XGQ A;  2AXT U;  5DLG A;  3CRX A;  1K5O A;  3NAS A;  2W7P A;  4YD1 A;  9ICC A;  4IQW A;  4GC6 A;  3FAH A;  1UT8 A;  5KNI A;  3Q8S B;  2KP7 A;  5IIK A;  2JGA A;  1ZQH A;  4GXJ A;  4ED8 A;  3PO5 A;  2NRW A;  3T5H A;  4EBK A;  3HT3 A;  2Q0Z X;  4O69 A;  4BX9 C;  3ONN A;  5AM0 A;  2ZIV B;  2ZXH A;  1V38 A;  4OJL A;  1L3S A;  3H39 A;  2Q66 A;  4PHD A;  2ATL A;  4DO9 A;  2ZIV A;  4DOA A;  5CR0 A;  1LVH A;  3RTV A;  1MN8 A;  3AN1 A;  4DCC A;  3Q8K A;  2BCR A;  4BJQ A;  2I9G A;  1U49 A;  3TAQ A;  4M2Y A;  2MA1 A;  2YTU A;  2ZTE A;  4BXO B;  8ICW A;  4AT7 A;  5KG0 A;  4BXO A;  3MGH A;  2Y1J A;  3RB4 A;  4O67 A;  1RXW A;  2KKP A;  2QB1 A;  2J6S A;  3HWT A;  3OV7 A;  4AT9 B;  5KT4 A;  3QUQ A;  1RXV A;  5HC9 A;  1ZQZ A;  2F76 X;  4AT9 A;  4M9H A;  2LMR A;  1IIP A;  1NK9 A;  7ICF A;  2FLP A;  2ASL A;  4Y2U A;  4UAS A;  3V6H A;  2BHN A;  1LKY B;  4X4Q A;  2DF4 B;  3WKC A;  1LKY A;  5F3X B;  2HBL A;  4K4I A;  3NWI A;  5CHE A;  2YY6 A;  4Y2Q A;  1NK4 A;  1L7O A;  2ZXI A;  4NV0 A;  4E8F A;  3M7D A;  4DSK A;  2HHU A;  2LBO A;  3WFQ E;  3PMN A;  7ICN A;  3SQI A;  4JLX A;  7ICO A;  5J0S A;  1SB3 C;  2DPI A;  4ECU A;  1X9X A;  4FHY A;  3SEN A;  5F9N A;  3RB0 A;  2DVI A;  2OXO A;  5KFL A;  2EH9 A;  3NUQ A;  4ECX A;  4XQ8 A;  3N97 B;  5ALG A;  1S0M A;  1ZQJ A;  4QWD A;  4IQV A;  1TFW A;  4U7C A;  2KZM A;  4X5V A;  4CRX A;  1XC9 A;  2PFN A;  4ED1 A;  4K9A A;  5HNK A;  2HHW A;  5JTG A;  2AH5 A;  3ZDE A;  3AUO A;  3KHL A;  5III A;  3BZC A;  3KBB A;  2BDU A;  1UET A;  2JH1 A;  2ASJ A;  1TE2 A;  9ICW A;  4EBE A;  3C66 A;  3PHZ A;  1PVR A;  1NKE A;  5ALW A;  3N7R C;  5CJ7 A;  4RU9 A;  4Q45 A;  3TAR A;  2NRT A;  3WU2 U;  8ICN A;  4M6W B;  2M9N A;  4RQ3 A;  3A0B U;  4DSE A;  3RRG A;  2ZHA A;  2E3T A;  1KTQ A;  4Y2P A;  2NRV A;  3Q8Q B;  8ICZ A;  1V85 A;  5AI9 A;  2ZIX B;  2WTF A;  3C5G A;  3PW0 A;  2BCQ A;  2NRK A;  1SV4 A;  4X4T A;  2ZIX A;  2P35 A;  4RQ2 A;  1RM6 C;  4NJ8 A;  1C7Y A;  2BQ3 A;  2B21 A;  2O6K A;  5ALR A;  4LZG A;  4G9B A;  1QSS A;  2K4E A;  4M9N A;  2ZIW A;  2Y9U A;  1F44 A;  4QZA A;  2AJQ A;  2KE7 A;  4I2E A;  1SL0 A;  5KFO A;  2IHM A;  4DSL A;  4O5C A;  1NJX A;  4K8V A;  5ALD A;  1KFT A;  2R8J A;  4RT3 A;  4C8K A;  5ALS A;  2HHS A;  3KD3 A;  3T3F A;  5KFZ A;  1OXJ A;  3GIM A;  2EAN A;  5ALE A;  2KMD A;  2JR5 A;  2OM6 A;  4F8R A;  7ICT A;  4KLS A;  4DL2 A;  3ISB A;  4EBC A;  1NI3 A;  1L8L A;  3WK4 A;  5CFT A;  2IHO A;  3K1R B;  3DEE A;  2EZZ A;  3AM9 A;  3L3F X;  2RQ5 A;  4QZG A;  2HBJ A;  2OWO A;  1T94 A;  5J2E A;  4KN7 A;  4YCX A;  5KFQ A;  3IP4 B;  1F5S A;  1UQV A;  4XJE A;  1L3V A;  1TAQ A;  3HX0 A;  4ECR A;  2BBH A;  3UQ2 A;  5JU5 A;  5DBA A;  2IBK A;  4F4W A;  2XCA A;  2V9W A;  9ICJ A;  4C4S A;  4LEV A;  1SL1 A;  1ZQX A;  1SKR A;  5AKX A;  2W9B B;  5DB8 A;  2DWQ A;  4YD2 A;  2HBM A;  4G3I A;  4ICA A;  2W9B A;  4P4O A;  2PI4 A;  2XCP A;  4OAF A;  5AKE A;  5CA7 A;  2AHO B;  2NV3 A;  1ZOL A;  3H3A A;  2M2U A;  2YB4 A;  5DQH A;  3ETL A;  4NXZ A;  2D8C A;  5J2H A;  3R9K A;  4RQ4 A;  4TUQ A;  1KBU A;  4FZN A;  1JN3 A;  3WKD A;  4ED0 A;  1NK6 A;  9ICK A;  4F93 B;  2XY6 A;  3IG8 A;  5G5H A;  4QIW F;  2B4V A;  4DLG A;  1ZQL A;  1U45 A;  9ICF A;  4MFF A;  5C5J A;  1JRO A;  4PJ0 U;  2F2A B;  3EYZ A;  1FA0 A;  1T4G A;  1S8O A;  3Q8L A;  5B3P A;  4HYK A;  4I2I A;  4DS4 A;  2F3N A;  4BWJ A;  3Q8R B;  8ICK A;  1IV8 A;  2HCF A;  1XSN A;  3JPR A;  1U9L A;  4RUA A;  2EAM A;  5DGB A;  5DB6 A;  1D9D A;  4NXW A;  8ICE A;  3OJU A;  3Q8P B;  1S0V A;  4P2H A;  4M0A A;  4ELU A;  4M04 A;  1HUZ A;  1ZQF A;  2ZH7 A;  4Y2R A;  4B9M A;  3V6K A;  2G08 A;  4I2B A;  1A76 A;  1ARO P;  3K75 D;  3ZD8 A;  4B9V A;  4WBY A;  2ISP A;  1HEK A;  4ECW A;  4O5K A;  1JAJ A;  3WK5 A;  2BPF A;  4M9J A;  3LDA A;  4NM2 A;  2ZUC A;  5AKI A;  4P0Q B;  1MC8 A;  4ZH4 A;  1L6N A;  4R64 A;  4NLK A;  2K8C B;  8ICJ A;  3SD7 A;  4PPX A;  4P0Q A;  9ICR A;  2G06 A;  1ZQW A;  1QSY A;  1M6Y A;  3MDC A;  4OAI Z;  2FJ6 A;  3SR6 A;  2XGP A;  1S97 A;  2DRA A;  4NY8 A;  3GV8 B;  5EE3 A;  4QZ8 A;  2HN1 A;  5B5E U;  4DF4 A;  2IA6 A;  8ICA A;  7ICP A;  5DQG A;  1MQ3 A;  8ICL A;  4KMO B;  4DWI A;  5ALL A;  4B9N A;  4NLN A;  1ZQP A;  3HIY A;  2DR9 A;  2WAQ F;  2KJ9 A;  2GA9 D;  1OU5 A;  5D4B A;  3M9N B;  5HRF A;  4ED6 A;  4UB8 U;  4YR3 A;  4X4S A;  5KFE A;  2I1Q A;  1Z4N A;  4MFA A;  4YQW A;  3SV3 A;  3M8S A;  3UMB A;  2AQ4 A;  2B51 A;  4O3O A;  3ZDA A;  2HOI A;  1R8A A;  3BQ2 A;  2EZY A;  1PK3 A;  1QQ7 A;  2ALZ A;  3EWA A;  1ZRM A;  1WYG A;  2FMQ A;  4PGY A;  1MA7 A;  1XO1 A;  4C8L A;  4C8M A;  1UA1 A;  1NZP A;  5HP4 A;  5AK3 A;  2V4Q A;  3KKA C;  3UXP A;  3RJK A;  5KFG A;  2BCS A;  2QB0 B;  2Y9T A;  4UW9 A;  1X42 A;  4AYB F;  9ICL A;  4DL4 A;  1A0P A;  5DG9 A;  1TK5 A;  2IMW P;  4FH5 A;  2QB0 A;  4CF5 A;  4WQK A;  2JRZ A;  1NKC A;  4J9N A;  3JPT A;  2E8O A;  3A0H U;  3JCF A;  1L7P A;  2HDO A;  1VLB A;  3IHQ B;  4PGQ A;  4I29 A;  1OW5 A;  1B43 A;  5HMM A;  2KD1 A;  3RB3 A;  3M6Z A;  1TK8 A;  2CRX A;  4C7Y A;  2RP5 A;  2YN4 A;  1WCL A;  3IM1 A;  3C5F A;  1JRP A;  5J2F A;  3H0L B;  4MKP A;  5J0Y A;  2JZB B;  3F5E A;  5T14 A;  3V7K A;  3PVX A;  4MF8 A;  9ICE A;  3RBD A;  2JZB A;  2KK0 A;  1Z1V A;  4KLT A;  3J81 j;  4UAZ A;  4FHV A;  1PUZ A;  2UVU A;  3PX4 A;  5HRL A;  8ICS A;  3FC4 A;  1OUQ A;  2J6T A;  3GV5 B;  2HHT A;  4J9M A;  4IR1 A;  1JAL A;  3QNM A;  5AM5 A;  2DFL A;  3BZK A;  3E2E A;  2K4H A;  2WF7 A;  2ZH4 A;  5KFD A;  9ICV A;  1K1Q A;  1X6I A;  1VFG A;  4B9S A;  1SL2 A;  2KG5 A;  2WFA A;  5AI5 A;  4F4X A;  4IQT A;  8ICB A;  4NXT A;  5JUM A;  4XA5 A;  2IOF K;  3F2B A;  2W3R A;  4FH3 A;  1NJY A;  3C1Y A;  4N7R A;  3T79 A;  3WFO A;  2KSO B;  4M5D A;  1RQL A;  4X4O A;  3MR6 A;  2CXY A;  4KLG A;  4DFM A;  2KSO A;  2W03 A;  3M6K A;  5GTH U;  4KLF A;  2A3V A;  4P0P B;  5DQI A;  2E8N A;  4UAT A;  2AU0 A;  4P0P A;  3H8W A;  1XS9 D;  3UXO A;  3RJG A;  5ALY A;  4ACO A;  2C2D A;  5AI8 A;  4Z6D A;  4XRH A;  1NK0 A;  1LB2 B;  4Y2V A;  4F5Q A;  4I28 A;  5IIN A;  3EUB 2;  5HRH A;  4NL9 A;  1N5W A;  3KKA A;  4KLD A;  3SEI A;  3UMC A;  2P66 A;  5D49 A;  2RDI A;  4NWI A;  5DEC A;  3IDW A;  3WFR E;  3ZDB A;  2FPK A;  4FFD A;  3K4G A;  5ALK A;  5D63 A;  3BQ0 A;  3WFS C;  3NVV A;  5IIL A;  1S0O A;  5AKG A;  5KFM A;  4YR0 A;  3MR2 A;  4DSI A;  2KIC A;  3T5K A;  2NYV A;  4YP3 A;  3RRH A;  1T7P A;  1D8B A;  2RRD A;  4C80 A;  4F2R A;  2W8L A;  4DQQ A;  5CFU A;  3AEV A;  2BQR A;  1N2X A;  3NVO A;  1FEZ A;  4O3M A;  4QNL A;  4RWN A;  4FS2 A;  1Z1B A;  5HML A;  1T8E A;  2KFN A;  1X9W A;  3MBY A;  5AI0 A;  4QW9 A;  9ICM A;  4KX3 A;  3THV A;  3CP8 A;  4IQU A;  4RPX A;  2W55 A;  1IM4 A;  2K4I A;  5DG7 A;  2IOF A;  2CN1 A;  5FP0 A;  4ATB B;  4I2J A;  1ZQU A;  3VCB A;  1JXE A;  3GQC A;  5KL8 B;  2ZJ5 A;  2ZJ8 A;  1URJ A;  3IG5 A;  5J0X A;  2ZH1 A;  1X6J A;  4K4H A;  4DL3 A;  5DG8 A;  1SZP A;  1CUK A;  4LEW A;  4R63 A;  4FO6 A;  5J8Y C;  4LEY A;  2QAR B;  4PH5 A;  2K4P A;  1YT3 A;  3NRW A;  3PW4 A;  4BWM A;  2C22 A;  2QAR A;  4JLZ A;  2HSZ A;  3PML A;  1ZQN A;  5E79 U;  2HHX A;  3QE9 Y;  1A77 A;  2KZ3 A;  2W9C B;  3QUC A;  1RG6 A;  3KZX A;  5KFC A;  5AM4 A;  3OSN A;  3TFS A;  2W9C A;  4UAR A;  1KW4 A;  4EX6 A;  4I27 A;  4J9R A;  4O6A A;  2EWR A;  3MC1 A;  4KLL A;  3CNH A;  2KFZ A;  2N1R A;  4M47 A;  2HHV A;  3AMZ A;  5J2D A;  4X4R A;  2ZUB A;  3M9O B;  1NJZ A;  8ICU A;  4F4Y A;  3ZD9 A;  4PHE A;  2XY7 A;  3B0Y A;  2JH7 A;  4BUG A;  3JPS A;  9ICN A;  3MGI A;  5DB9 A;  1N48 A;  4DFP A;  5EE1 A;  5CEH A;  4RNM A;  4RWP A;  2WF5 A;  2YMQ A;  2KZZ A;  1RQN A;  4B6J A;  2KVC A;  7ICR A;  2KTQ A;  3H8M A;  4UBC A;  2MUT B;  5KG6 A;  5ALJ A;  2HOQ A;  8ICV A;  3QU5 A;  1MIY A;  2MUT A;  5AIB A;  2EZX A;  5KFB A;  1L5U A;  4KLE A;  4US8 A;  4X4N A;  3LVW A;  4GFJ A;  8ICH A;  5D62 A;  2VKQ A;  2C28 A;  2E8P A;  2VA3 A;  1DXS A;  4C8O A;  3LQC B;  4WC3 A;  2EAP A;  1P7D A;  5DDM A;  2AGO A;  5KFH A;  4C7Z A;  1COO A;  5C0Y A;  4C0Z A;  3PW2 A;  3QUT A;  1QLN A;  4EX7 A;  4O3R A;  2XI9 A;  2BR0 A;  2KKV A;  3V7L A;  5CRX A;  4R8U B;  3SMV A;  1QH9 A;  4J9K A;  1SIJ A;  4R8U A;  3AQM A;  2K8A A;  3BS7 A;  4X4P A;  2LYH A;  4RWO A;  3ISD A;  2I5H A;  4M6W A;  5HRD A;  3S6J A;  4ECQ A;  4K97 A;  2K8B B;  3NKU A;  3C18 A;  9ICB A;  2W3S A;  3CYM A;  4PZO A;  3NGD A;  2CPR A;  5J0O A;  3RR8 A;  2ZIU B;  2C2E A;  2ASD A;  2HVH A;  4PGX A;  2PBE A;  2ZIU A;  8ICR A;  1B22 A;  5J8Y A;  2QLT A;  3H0R B;  1B0X A;  1PK1 B;  4P4M A;  3ZDC A;  3CK6 A;  3UQ0 A;  4O5E A;  1PK1 A;  4Z6C A;  1KDH A;  2F8L A;  5KAF U;  3IN5 A;  2YQE A;  4YMO A;  1S10 A;  4YN4 A;  2W9M A;  1ZXI A;  1J97 A;  2VJ5 A;  4NXX A;  4IL6 U;  4YFK A;  2HHQ A;  8ICI A;  2F77 X;  1O08 A;  5KAI U;  5KFR A;  1RYS A;  2KVS A;  1WCN A;  4E80 A;  3LWL A;  3GII A;  1U47 A;  4B9U A;  5AKL A;  4RNN A;  5KG2 A;  5J0U A;  5AKJ A;  1MIV A;  1N63 A;  2ODG A;  2ZHB A;  3MFI A;  5DB7 A;  5KFJ A;  5AIC A;  2K60 A;  1Z3E B;  4WC4 A;  2C2R A;  4OJP A;  4EZ6 A;  4QZ9 A;  3TFR A;  8ICC A;  3PST A;  3TAD C;  4OAH A;  3OUY B;  2FCL A;  1S0N A;  3FM9 A;  5J0W A;  4EP7 A;  3OUY A;  5KFY A;  4FBU A;  2DGZ A;  2BGW A;  2ZH3 A;  4J9S A;  3QXG A;  1K1S A;  3PW5 A;  4FHW A;  5HHI A;  2YX8 A;  2FPM A;  5L1I A;  4USA A;  4BGD A;  1TVA A;  1TKD A;  2UVV A;  2F1J A;  3SZ2 A;  5CFS A;  1JMS A;  3IRU A;  3H7I A;  4OCZ A;  1XSL A;  4GC7 A;  1DRG A;  1R89 A;  4R65 A;  2H3F A;  1SWV A;  3OPX A;  1ZQS A;  3ISC A;  3WK6 A;  1ED1 A;  5KFT A;  1ZYQ A;  1BPX A;  4I2D A;  1EXN A;  4JV0 A;  3G6V A;  9ICG A;  1R8C A;  1TFR A;  4UAU A;  3JPN A;  5KFA A;  4F72 A;  3H38 A;  1B4F A;  5J0P A;  4DQP A;  5ALQ A;  4DFJ A;  5H2F U;  1TFY A;  3NTU A;  2W04 A;  3TI0 A;  4QZF A;  4DSF A;  4K98 A;  1X2I A;  3KTQ A;  4JV1 A;  2ZH2 A;  3JYY A;  4ED3 A;  4RPZ A;  4QZC A;  2ISO A;  3HKZ C;  3OVA A;  3I28 A;  1BVS A;  5TZV A;  1ZQQ A;  3RR7 A;  4WC7 A;  9ICP A;  3H8S A;  3PR4 A;  4F4K A;  4KLU A;  4I2C A;  4OJ5 A;  7ICV A;  5J2C A;  1WWU A;  4Q43 A;  3WK9 A;  4I0U A;  2R8I A;  3HP6 A;  1ZJM A;  3C2L A;  4NKT A;  1Z19 A;  3ER8 C;  2M2W A;  5ALM A;  3N7P D;  4MFC A;  2GWS A;  4DQI A;  4KLH A;  1SV0 C;  3N4M B;  4QWE A;  1RPL A;  3QU4 A;  3FYH A;  3KHG A;  4R66 A;  4CGZ A;  2H3Z A;  3QU2 A;  2V4R A;  2RHF A;  3V6J A;  3RJE A;  2NO4 A;  2GH1 A;  4KLO A;  3KFU F;  9ICT A;  1NZB A;  2O5A A;  4IRC A;  1U4B A;  1GO3 F;  2G5H B;  2ZH9 A;  1L3T A;  3GIL A;  3TAD A;  1TAU A;  5AKY A;  3BQT A;  3N28 A;  4JK1 A;  4WCW A;  4CF4 A;  2ZJA A;  4F3O A;  1SGG A;  3NS1 A;  4DL7 A;  4DS5 A;  5J2K A;  4QZI A;  2WF6 A;  1XSP A;  8ICM A;  5B66 U;  4B9L A;  2DRB A;  3ORY A;  4KB6 A;  1BPE A;  3RH6 A;  5J2I A;  2BBJ A;  2LYB A;  3C28 A;  3UPS A;  1KFS A;  4DOB A;  4IRD A;  2B56 A;  4XUS A;  5KFK A;  2Y1I A;  3QYP A;  4ZOH C;  4KMU A;  2FI1 A;  4IR9 A;  1GPJ A;  1N62 A;  3NRZ A;  4KN4 A;  4K4G A;  4Q8E A;  2NO5 A;  1PVP A;  3GIJ A;  2XY5 A;  5L1J A;  4IG8 A;  4KIT B;  3BS5 B;  1Q3V A;  4MF2 A;  5HR6 A;  3F5A A;  5KFX A;  2WHE A;  1BPB A;  1D8L A;  3BS5 A;  3RAX A;  7ICU A;  9ICH A;  3WKB A;  1FIQ A;  4BDP A;  3OHB A;  3F2C A;  3LWM A;  3RB6 A;  2G09 A;  4M9L A;  4NLG A;  2YMM A;  1HJP A;  3QX7 A;  4YMN A;  1L3U A;  5CP2 A;  4Z6E A;  2P6U A;  4TQR A;  2EAO A;  1SZH A;  3GDX A;  4F5O A;  5ALO A;  4WOY A;  1WWV A;  1QTM A;  4EEK A;  4Y2T A;  8ICT A;  1SV0 A;  5KG3 A;  4AT8 B;  5F9L A;  2ZG6 A;  8ICG A;  2H3Q A;  2F1H A;  4UAV A;  4MEX A;  2GAF D;  2DQN B;  2LM4 A;  5TIS U;  5KT3 A;  1NKB A;  2PMZ C;  1QQ6 A;  2BE3 A;  4PHP A;  3NVW A;  3QU7 A;  2JEJ A;  3PV8 A;  7ICM A;  4CCH A;  8ICF A;  1NNL A;  4Y2X A;  4ED2 A;  5HR9 A;  2B6G A;  2ZH8 A;  1NO5 A;  3PX0 A;  4UB3 A;  1KEJ A;  5KG1 A;  4GIB A;  4UB6 U;  1YZ6 A;  3TAC B;  3K7D A;  5AI4 A;  1NJW A;  3WKA A;  4S3N A;  3QZ8 A;  2KIV A;  5KFV A;  2DPJ A;  5AK6 A;  3PO4 A;  1V97 A;  1UT5 A;  4KTQ A;  4NKU A;  4EGW A;  4EEN A;  4I2A A;  2WB1 F;  4C8N A;  3U26 A;  3K1Z A;  4TQS A;  8ICP A;  4QZD A;  2PI5 A;  4DF8 A;  2W43 A;  3F2D A;  3WFP A;  5AK5 A;  3UM9 A;  3Q8M A;  2BCV A;  5AKZ A;  2KOB A;  3QU9 A;  5KFN A;  5JTI A;  3KHR A;  3H37 A;  1UCV A;  4YXJ A;  2UVW A;  5HRI A;  4IS7 A;  3PSI A;  4F5P A;  3AQE A;  4ELT A;  5DLF A;  5HR7 A;  3DV9 A;  2E5S A;  3N7S C;  5AKK A;  5KT6 A;  3RFA A;  2IHN A;  5KFI A;  2KV2 A;  2AGP A;  2MSN A;  2M2V A;  1Z00 B;  2E8M A;  2HN2 A;  2YMP A;  9ICS A;  1Z00 A;  5KFF A;  4F50 A;  2DBY A;  2R8H A;  3HJ4 A;  5DKW A;  1ZQR A;  5F2V O;  4FHX A;  4I2F A;  3D6J A;  4YR2 A;  1X9S A;  4EBJ A;  7ICG A;  5ALH A;  2DKX A;  1T3N A;  3PY8 A;  1KFD A;  3L5K A;  3WK8 A;  1PX5 A;  4U6P A;  2MAX A;  3PX6 A;  3F53 A;  1XU4 A;  5GTI U;  5ALN A;  4GLX A;  2HHP A;  2G0A A;  1ZQY A;  4WJ3 B;  3EW9 A;  4QWC A;  2R8K A;  3KHH A;  1ZQO A;  5A0L A;  5AKH A;  5D46 A;  1NK8 A;  5HRB A;  3UPQ A;  5DDY A;  3LK9 A;  4O0I A;  2B0C A;  4UD4 A;  5ALT A;  1SWW A;  2KHQ A;  3ALR A;  3C29 A;  4ECS A;  4ECT A;  4ATB A;  3T5J A;  3SAH A;  2H3I A;  4DLE A;  4UQG A;  1QQ5 A;  1ZD2 P;  1ZRN A;  4LJX A;  5IIO A;  4KX5 A;  3PNC A;  3L9D A;  1DK2 A;  2M0N A;  1CI4 A;  5J2B A;  2Y0S C;  3OVS A;  1FFU A;  2VA8 A;  2H3V A;  2OH2 A;  4RQ8 A;  5KFP A;  4AT7 B;  4FS1 A;  2AGQ A;  2A1J B;  5J2A A;  5KG5 A;  2A1J A;  9ICU A;  5BOM A;  2DL0 A;  1RZT A;  2KJ8 A;  4WC0 A;  3AU2 A;  5J0T A;  4DOC A;  4J9O A;  4MHV A;  3WKE A;  1ZQT A;  2OYY A;  2NRX A;  2WF9 A;  3RJI A;  1D8Y A;  2W9A A;  4PHA A;  4PL1 A;  2MU2 A;  2BPC A;  3OSP A;  1V9P A;  2LYA A;  3RJF A;  3GFK B;  1BGX T;  4RNO A;  2BQU A;  4IC9 A;  4EEY A;  4OO1 J;  2FE9 A;  2LM1 A;  3OTQ A;  5KFS A;  2JHD A;  3EZ5 A;  1KL9 A;  1N5X A;  4US9 A;  4RPY A;  3HJE A;  4RUC A;  3H0M B;  7ICI A;  3C2K A;  5J0Q A;  2OEH A;  3M9M B;  4DQR A;  4UD5 A;  4F5R A;  2BCU A;  2XID A;  3QUB A;  1N60 A;  3PW7 A;  3EPG A;  4YVZ A;  4PZN A;  4FZL A;  4OJO A;  2ZH5 A;  3MAB A;  2KNJ A;  4QZH A;  4DL5 A;  2HW3 A;  5AM3 A;  1KNY A;  1PVQ A;  2FDR A;  2A1A A;  2D3D A;  5AHX A;  1WG8 A;  3ZI4 A;  4EEL A;  4WBZ A;  2XIC A;  5AK4 A;  3TKA A;  4DEZ A;  1ZD4 A;  3T5L A;  4RWQ A;  3LVV A;  1UPH A;  1JXL A;  2KEY A;  2VIX A;  9ICX A;  5J0R A;  1BPD A;  8ICO A;  5CWR A;  1IG6 A;  3QZ7 A;  4J9Q A;  2JXJ A;  3JZ0 A;  3B9J A;  5ALV A;  3H4D A;  1JX4 A;  4JB3 A;  4EED A;  5ALF A;  3SAF A;  1RDF A;  3NYB A;  3ER9 B;  3PZP A;  1Q8K A;  3C21 A;  2LPE A;  4NXU A;  4J03 A;  2IOH A;  3C23 A;  1U48 A;  4UB1 A;  1DOQ A;  4ELV A;  4NM1 A;  1FFV A;  3M1Y A;  2A19 A;  4J9P A;  1Q79 A;  2H5X A;  2VAN A;  2W11 A;  7ICS A;  4OAG A;  4ECZ A;  2F44 A;  5ALZ A;  2ZIW B;  7ICJ A;  3AL0 B;  5ALP A;  4HAI A;  5EWF A;  1ZQB A;  1C20 A;  3PR5 B;  4E7X A;  4AP9 A;  4JUZ A;  3OJS A;  1ZD3 A;  1S5L U;  3G6X A;  3RJH A;  3IV6 A;  2W54 A;  4DSJ A;  3DDH A;  2ID1 A;  3LYS A;  1DK3 A;  1ZJN A;  4CF3 A;  3RH4 A;  3L4P A;  3MFH A;  2HBK A;  3JPP A;  4I2H A;  5KFU A;  2GLE A;  1XO0 A;  5J2G A;  5JRT A;  4YMM A;  4ED7 A;  4WC5 A;  3QEB Z;  3KZI U;  4FO1 A;  4E0D A;  2DR5 A;  3NVZ A;  5J29 A;  4KM5 A;  4NXV A;  4RQM A;  2GOL A;  4RQ0 A;  1ZET A;  2VJ4 A;  1V4A A;  1MIW A;  1JUD A;  5BOL A;  1ZQK A;  3PSP A;  1ZQG A;  5L9X A;  2P6R A;  2OCE A;  3SYZ A;  3AQK A;  1X40 A;  2KN7 A;  3RH5 A;  3JPQ A;  2HMX A;  4O9M A;  4TUP A;  3GZF A;  3HKZ F;  5HHH A;  8ICX A;  3KOO A;  4X0B A;  3HW8 A;  2ZUD A;  3EF2 A;  5KTQ A;  1IXR A;  1S77 D;  3BQ7 A;  4PL2 A;  9ICA A;  4QZE A;  3ZDD A;  3WK7 A;  3BDP A;  4DQS A;  5L1L A;  2KJ5 A;  2DUY A;  3RAQ A;  2E1E A;  5DBC A;  4WC2 A;  1VJ5 A;  5HRE A;  5HRK A;  3MCR A;  4X4U A;  5KFW A;  4QWB A;  2FMP A;  4GXK A;  4NLZ A;  4A8E A;  5AM1 A;  4RQN A;  3GU3 A;  2PFQ A;  3PSF A;  1YZ7 A;  1SKW A;  2ES6 A;  5IIJ A;  4Q8F A;  1BPZ A;  2D6F C;  1N61 A;  1HUO A;  4JWN A;  1RYR A;  7ICE A;  1FO4 A;  2BKE A;  1XWL A;  1LV5 A;  2FLN A;  1KQQ A;  3D2Q A;  2BDP A;  1F5A A;  4Y2Y A;  2E1F A;  4QW8 A;  2DR8 A;  4KLQ A;  2LI6 A;  4F5N A;  2ESE A;  1N56 A;  9ICI A;  3C2M A;  4YXM A;  1ZD5 A;  2MRL A;  2R18 A;  2FMS A;  5L1K A;  1J2N A;  5KL1 B;  2VA2 A;  1UEV A;  5KG4 A;  3RJJ A;  2JV3 A;  3ETR A;  1PZN A;  4EYI B;  4ECY A;  3AQN A;  1KSP A;  2KHV A;  2ZH6 A;  2XVT A;  3SV4 A;  7ICK A;  1JIH A;  1R8B A;  4WH5 A;  4IRK A;  3C1Z A;  3UXN A;  3RF9 A;  4LZD A;  2RLT A;  4I2G A;  3G6Y A;  4O3Q A;  1YLQ A;  4XQ7 A;  5CHG A;  1COK A;  4ECV A;  1NK7 A;  4P4P A;  4QIW C;  8ICY A;  2FLL A;  1UHU A;  4C4R A;  2G07 A;  3HJ1 A;  3OWG A;  1CRX A;  2JEG A;  4JV2 A;  4EBD A;  2K89 A;  4CE6 A;  5HRG A;  3TAP A;  1F0M A;  4EZ9 A;  2ZTD A;  5J2J A;  2AQ0 A;  3OHA A;  2OHF A;  4F92 B;  5B3Q A;  1UA0 A;  2BZF A;  4M9G A;  4WQL A;  4KLM A;  1QCK A;  1KLN A;  2F8K A;  4Y2S A;  4UAY A;  4X0A A;  1Y88 A;  3OVB A;  4QJF B;  5EOZ A;  3D2S A;  1CEZ A;  2JMG A;  4TUS A;  1ZQE A;  4WC1 A;  4RQ1 A;  1WUD A;  5K4L A;  1RYU A;  4YG2 A;  3MR5 A;  4UAW A;  1ZQC A;  1ZQM A;  2F1I A;  1ZQA A;  4X4V A;  1MSW D;  4OJ6 A;  1SXE A;  1S9F A;  4EV6 A;  1BNP A;  1TK0 A;  5ALX A;  3OGU A;  4J9L A;  3H40 A;  2GO7 A;  5IIM A;  1AQ6 A;  2EDU A;  5EE9 A;  2EQY A;  3RBE A;  1SKS A;  3BQ1 A;  3MR3 A;  3TAN A;  3QEA Z;  2PXI A;  4O3P A;  3B0X A;  4F71 A;  4F4Z A;  2PMZ F;  4JWM A;  4MEY A;  4DL6 A;  1ZQD A;  2I6X A;  2W7O A;  4UB4 A;  2Q4T A;  4RT2 A;  1L7M A;  4NLB A;  3V7J A;  4DFK A;  4F2S A;  9ICO A;  1KKX A;  1HIW A;  3M8R A;  1TAM A;  3TQ1 A;  5KG7 A;  3GIK A;  5DBB A;  4KLJ A;  4B9T A;  1WOT A;  7ICH A;  4NL9 C;  2PFO A;  4LVS A;  2HOF A;  5BPC A;  2JEF A;  4O68 A;  4Q44 A;  3HRD D;  3MDA A;  5EE0 A;  4UBB A;  1ZQI A;  2KIW A;  3H4B A;  1J2M A;  1BNO A;  4Z6F A;  3HIL A;  2WAQ C;  7ICL A;  5AM2 A;  2DR7 A;  5KT5 A;  4HX0 A;  2QKQ A;  5EWE A;  1O03 A;  1JI7 A;  4WC6 A;  4AT8 A;  1JQR A;  1X66 A;  5D61 A;  2M2T A;  2HVI A;  5L1M A;  2J6U A;  3AQF A;  4UB5 A;  3SI8 A;  1DGS A;  5AIA A;  3FDS A;  2DKZ A;  4FE3 A;  4RQ6 A;  3HPO A;  2G5I B;  5KT2 A;  4TUR A;  2NRZ A;  2W8K A;  3GV7 B;  4K96 A;  2R8G A;  2LKY A;  4RZR A;  4KLI A;  4GXI A;  1L8O A;  3AU6 A;  2XC9 A;  2XO7 A;  1A6S A;  4FHP A;  3NVY A;  1UEU A;  4FZM A;  4NLC A;  2UVR A;  4UB2 A;  1BPY A;  3AQL A;  4K99 A;  4AYB C;  1ZQ1 C;  5CB1 A;  2RDJ A;  2PKE A;  1SXD A;  2IUB A;  2ZTC A;  3I1Y A;  1DGJ A;  5KT7 A;  3ERC C;  1Q3U A;  1L7N A;  2FPL A;  3ED5 A;  1NK5 A;  2PFP A;  5ALU A;  2YB1 A;  4EYH B;  2Z7J A;  4O3S A;  1Z4O A;  2RFF A;  4F91 B;  1NOM A;  1QSL A;  4CNQ A;  1VDV A;  1ZQV A;  1Q78 A;  1MQ2 A;  1Q46 A;  3I76 A;  9ICQ A;  2BPG A;  2L5Y A;  3JPO A;  4Y2J A; 
#chains in the Genus database with same CATH homology
 4QWA A;  2BGW A;  3OSP A;  1V9P A;  5DGA A;  3RJF A;  2ZH3 A;  3GFK B;  1H38 A;  5EWG A;  4J9S A;  1BGX T;  4RNO A;  1K1S A;  2BQU A;  5D4B A;  1OU5 A;  8ICQ A;  3PW5 A;  4LT6 A;  3M9N B;  4FHW A;  5HRF A;  4ED6 A;  4YR3 A;  4EEY A;  4X4S A;  5KFE A;  2I1Q A;  5KFS A;  4MFA A;  1D9F A;  4YQW A;  3EZ5 A;  1TV9 A;  5HHI A;  4RPY A;  2FPM A;  5L1I A;  4BGD A;  1TVA A;  3SV3 A;  3M8S A;  4RUC A;  1TKD A;  2AQ4 A;  2UVV A;  3BJY A;  3EPI A;  3C2K A;  7ICI A;  2F1J A;  1KRP A;  4O3O A;  3SZ2 A;  3ZDA A;  5J0Q A;  3M9M B;  1JMS A;  4DQR A;  1R8A A;  1VJ7 A;  3BQ2 A;  4F5R A;  2BCU A;  4FBT A;  3H7I A;  4UD5 A;  3V72 A;  1XSL A;  4GC7 A;  2JEI A;  1R89 A;  4R65 A;  3PW7 A;  3H8J A;  3EWA A;  4YVZ A;  3EPG A;  2ALZ A;  2FMQ A;  1ZQS A;  7ICQ A;  3ISC A;  4PGY A;  2ZH5 A;  3MAB A;  1XO1 A;  4QZH A;  4C8M A;  4DL5 A;  5KFT A;  1UA1 A;  1ZYQ A;  4C8L A;  2HW3 A;  5DED A;  4RQ7 A;  4QZB A;  1BPX A;  4I2D A;  5HP4 A;  1EXN A;  4JV0 A;  3G6V A;  1NZP A;  9ICG A;  1S76 D;  1KNY A;  1R8C A;  2O1P A;  2V4Q A;  3RJK A;  4O3N A;  3UXP A;  5KFG A;  4RQ5 A;  2BCS A;  1TFR A;  9ICL A;  4WBZ A;  3JPN A;  4DL4 A;  5KFA A;  1X9M A;  2XGQ A;  2IMW P;  5DG9 A;  1TK5 A;  3H38 A;  4DEZ A;  4FH5 A;  5J0P A;  3T5L A;  4RWQ A;  1NKC A;  4DQP A;  4J9N A;  3JPT A;  4DFJ A;  5DLG A;  1JXL A;  1TFY A;  3NTU A;  9ICX A;  5J0R A;  1BPD A;  8ICO A;  3TI0 A;  4YD1 A;  5CWR A;  3IHQ B;  4QZF A;  3QZ7 A;  4DSF A;  4PGQ A;  4I29 A;  4J9Q A;  4IQW A;  1X2I A;  4GC6 A;  3KTQ A;  4JV1 A;  2ZH2 A;  3JZ0 A;  1B43 A;  1UT8 A;  5HMM A;  3H4D A;  3JYY A;  4ED3 A;  3Q8S B;  3RB3 A;  1JX4 A;  2KP7 A;  1TK8 A;  4RPZ A;  5IIK A;  4QZC A;  2ISO A;  3OVA A;  1ZQH A;  4GXJ A;  1WCL A;  1BVS A;  5TZV A;  1ZQQ A;  3RR7 A;  3NYB A;  3C21 A;  4ED8 A;  4WC7 A;  3H39 A;  3PO5 A;  9ICP A;  3H8S A;  3IM1 A;  2NRW A;  3PR4 A;  3C5F A;  3HT3 A;  2Q0Z X;  5J2F A;  3T5H A;  4F4K A;  4EBK A;  4KLU A;  2Q66 A;  4I2C A;  7ICV A;  3C23 A;  1U48 A;  5J0Y A;  2JZB B;  5J2C A;  4Q43 A;  1L3S A;  4UB1 A;  3V7K A;  2R8I A;  4MF8 A;  3PVX A;  1DOQ A;  4PHD A;  3HP6 A;  3C2L A;  3RBD A;  2JZB A;  2ATL A;  1ZJM A;  4ELV A;  4DO9 A;  4UAZ A;  4NM1 A;  4KLT A;  4FHV A;  4NKT A;  4DOA A;  4J9P A;  2M2W A;  1Q79 A;  2H5X A;  5CR0 A;  4MFC A;  2VAN A;  2GWS A;  2UVU A;  7ICS A;  3RTV A;  4DQI A;  4KLH A;  4ECZ A;  3N4M B;  3PX4 A;  4QWE A;  5HRL A;  8ICS A;  3Q8K A;  2BCR A;  2I9G A;  1RPL A;  7ICJ A;  3FYH A;  2J6T A;  3KHG A;  3GV5 B;  4R66 A;  1U49 A;  2HHT A;  3TAQ A;  4J9M A;  5EWF A;  1ZQB A;  4IR1 A;  4M2Y A;  3PR5 B;  2DFL A;  3E2E A;  2V4R A;  2ZTE A;  4BXO B;  4JUZ A;  3OJS A;  3G6X A;  4E7X A;  3V6J A;  8ICW A;  3RJH A;  3RJE A;  4AT7 A;  2ZH4 A;  5KG0 A;  5KFD A;  9ICV A;  4BXO A;  1K1Q A;  3MGH A;  9ICT A;  4KLO A;  2Y1J A;  3RB4 A;  1VFG A;  4B9S A;  1SL2 A;  4DSJ A;  2O5A A;  1RXW A;  4IRC A;  2ID1 A;  1U4B A;  4F4X A;  1DK3 A;  4IQT A;  2J6S A;  1ZJN A;  2ZH9 A;  3HWT A;  1L3T A;  8ICB A;  3OV7 A;  3GIL A;  4AT9 B;  1TAU A;  5KT4 A;  3RH4 A;  3BQT A;  4JK1 A;  4XA5 A;  5JUM A;  1ZQZ A;  3MFH A;  1RXV A;  4WCW A;  5HC9 A;  4FH3 A;  2ZJA A;  1NJY A;  4F3O A;  3JPP A;  4DL7 A;  4I2H A;  4AT9 A;  4M9H A;  4DS5 A;  5KFU A;  3C1Y A;  5J2K A;  4QZI A;  1NK9 A;  7ICF A;  2FLP A;  1XSP A;  3WFO A;  8ICM A;  5J2G A;  4B9L A;  2DRB A;  4YMM A;  4ED7 A;  4M5D A;  4X4O A;  4WC5 A;  2ASL A;  3ORY A;  3MR6 A;  3QEB Z;  4KLG A;  4DFM A;  4E0D A;  2DR5 A;  1BPE A;  3RH6 A;  3V6H A;  2BHN A;  4X4Q A;  5J29 A;  5J2I A;  4RQ0 A;  1ZET A;  1V4A A;  1MIW A;  5BOL A;  4K4I A;  3UPS A;  1ZQK A;  4KLF A;  1ZQG A;  1NK4 A;  4DOB A;  1KFS A;  4IRD A;  5L9X A;  5DQI A;  5KFK A;  4XUS A;  4E8F A;  2P6R A;  2Y1I A;  3SYZ A;  4DSK A;  2AU0 A;  3AQK A;  3H8W A;  1XS9 D;  3UXO A;  2KN7 A;  4KMU A;  3RJG A;  3RH5 A;  2HHU A;  3JPQ A;  4O9M A;  4TUP A;  4IR9 A;  5HHH A;  8ICX A;  3WFQ E;  3PMN A;  4KN4 A;  4Q8E A;  4K4G A;  7ICN A;  2C2D A;  4X0B A;  7ICO A;  4Z6D A;  5J0S A;  4XRH A;  2DPI A;  4ECU A;  1NK0 A;  4FHY A;  5F9N A;  3RB0 A;  1LB2 B;  4F5Q A;  4I28 A;  2DVI A;  3GIJ A;  5IIN A;  2XY5 A;  3HW8 A;  2ZUD A;  5L1J A;  5KFL A;  5HRH A;  4IG8 A;  5KTQ A;  4ECX A;  4KIT B;  1IXR A;  4KLD A;  1S77 D;  2P66 A;  5D49 A;  4MF2 A;  2RDI A;  4XQ8 A;  3N97 B;  9ICA A;  5DEC A;  5KFX A;  1BPB A;  1D8L A;  3WFR E;  3ZDB A;  4QZE A;  3RAX A;  2FPK A;  3ZDD A;  3K4G A;  7ICU A;  9ICH A;  3BDP A;  4DQS A;  3BQ0 A;  1S0M A;  5L1L A;  1ZQJ A;  4BDP A;  4QWD A;  3OHB A;  4IQV A;  3WFS C;  3RAQ A;  3LWM A;  5IIL A;  3RB6 A;  1TFW A;  5DBC A;  4M9L A;  4WC2 A;  4NLG A;  2KZM A;  5HRE A;  4X5V A;  1S0O A;  9ICC A;  5HRK A;  4X4U A;  5KFW A;  5KFM A;  4YR0 A;  4QWB A;  3MR2 A;  1XC9 A;  4ED1 A;  4GXK A;  2FMP A;  2PFN A;  4DSI A;  5HNK A;  1HJP A;  2HHW A;  3ZDE A;  3AUO A;  4YMN A;  4NLZ A;  3KHL A;  3T5K A;  5III A;  4YP3 A;  3RRH A;  1T7P A;  1L3U A;  5CP2 A;  4Z6E A;  2PFQ A;  2P6U A;  4F2R A;  4TQR A;  1UET A;  2W8L A;  2ASJ A;  4DQQ A;  9ICW A;  4EBE A;  3C66 A;  2BQR A;  3GDX A;  4F5O A;  1SKW A;  1NKE A;  5CJ7 A;  5IIJ A;  1QTM A;  4RU9 A;  4Q45 A;  3TAR A;  1BPZ A;  4FS2 A;  2NRT A;  1HUO A;  4Q8F A;  4JWN A;  4RWN A;  8ICN A;  5HML A;  1RYR A;  7ICE A;  1T8E A;  4M6W B;  2KFN A;  2M9N A;  2BKE A;  4RQ3 A;  1X9W A;  1XWL A;  3MBY A;  1LV5 A;  4DSE A;  2FLN A;  4QW9 A;  3RRG A;  2BDP A;  8ICT A;  1F5A A;  2ZHA A;  9ICM A;  5KG3 A;  4QW8 A;  1KTQ A;  2DR8 A;  4KLQ A;  4AT8 B;  2NRV A;  5F9L A;  3Q8Q B;  8ICZ A;  2WTF A;  3C5G A;  4F5N A;  3PW0 A;  3THV A;  1N56 A;  9ICI A;  3C2M A;  2BCQ A;  8ICG A;  2NRK A;  4IQU A;  4RPX A;  4YXM A;  4X4T A;  2F1H A;  2FMS A;  1IM4 A;  5L1K A;  5DG7 A;  4MEX A;  4RQ2 A;  2VA2 A;  1UEV A;  4ATB B;  5KG4 A;  3RJJ A;  1PZN A;  4I2J A;  5KT3 A;  4EYI B;  1NKB A;  1ZQU A;  2BQ3 A;  2B21 A;  1C7Y A;  4ECY A;  2BE3 A;  3AQN A;  4PHP A;  1JXE A;  3GQC A;  1KSP A;  4LZG A;  2JEJ A;  2ZJ5 A;  3PV8 A;  2ZJ8 A;  1QSS A;  7ICM A;  4M9N A;  4CCH A;  2ZH6 A;  8ICF A;  3SV4 A;  7ICK A;  5J0X A;  4QZA A;  2AJQ A;  2ZH1 A;  1JIH A;  1R8B A;  4ED2 A;  5HR9 A;  2ZH8 A;  4IRK A;  4K4H A;  3C1Z A;  3UXN A;  1NO5 A;  3PX0 A;  4UB3 A;  1KEJ A;  4DL3 A;  4I2E A;  5DG8 A;  1SZP A;  1CUK A;  4LZD A;  1SL0 A;  4I2G A;  5KFO A;  5KG1 A;  3G6Y A;  4O3Q A;  4R63 A;  4FO6 A;  2IHM A;  4DSL A;  1YLQ A;  4O5C A;  4XQ7 A;  1NJX A;  5CHG A;  4S3N A;  4PH5 A;  1KFT A;  1NJW A;  2R8J A;  4RT3 A;  4C8K A;  4ECV A;  9ICE A;  1NK7 A;  4P4P A;  3QZ8 A;  5KFV A;  3PW4 A;  2DPJ A;  2FLL A;  2HHS A;  4BWM A;  2C22 A;  8ICY A;  4X0A A;  3HJ1 A;  3PML A;  3PO4 A;  3T3F A;  5KFZ A;  1ZQN A;  2JEG A;  1UT5 A;  4JV2 A;  2HHX A;  3GIM A;  3QE9 Y;  4EBD A;  1A77 A;  4KTQ A;  4NKU A;  2KZ3 A;  4F8R A;  7ICT A;  3TAP A;  4KLS A;  5HRG A;  4DL2 A;  2W9C B;  4EZ9 A;  2ZTD A;  3ISB A;  5J2J A;  4EBC A;  4I2A A;  2AQ0 A;  3OHA A;  4C8N A;  3OSN A;  5KFC A;  4TQS A;  3TFS A;  2W9C A;  8ICP A;  4F92 B;  4QZD A;  1UA0 A;  2PI5 A;  4DF8 A;  4J9R A;  4I27 A;  4M9G A;  3WFP A;  4KLL A;  4KLM A;  3Q8M A;  2BCV A;  1KLN A;  2KFZ A;  4QZG A;  2OWO A;  5KFN A;  3KHR A;  3H37 A;  4M47 A;  2HHV A;  5J2E A;  4KN7 A;  4YXJ A;  2UVW A;  5HRI A;  5J2D A;  4YCX A;  5KFQ A;  4UAY A;  1Y88 A;  4F5P A;  2ZUB A;  3M9O B;  1NJZ A;  4ELT A;  5EOZ A;  5DLF A;  1CEZ A;  8ICU A;  3OVB A;  4TUS A;  4F4Y A;  1ZQE A;  4RQ1 A;  3ZD9 A;  4PHE A;  1L3V A;  4WC1 A;  1TAQ A;  3HX0 A;  4X4R A;  2XY7 A;  3B0Y A;  4YG2 A;  4UAW A;  3MR5 A;  4ECR A;  3UQ2 A;  3JPS A;  9ICN A;  1ZQC A;  1ZQM A;  3MGI A;  2F1I A;  5DB9 A;  5DBA A;  1N48 A;  5KT6 A;  4F4W A;  1ZQA A;  2IBK A;  1MSW D;  2XCA A;  4X4V A;  2IHN A;  5KFI A;  2V9W A;  2AGP A;  4DFP A;  1S9F A;  9ICJ A;  2M2V A;  4RNM A;  4RWP A;  1SL1 A;  2KZZ A;  1Z00 B;  1ZQX A;  1BNP A;  1SKR A;  7ICR A;  1TK0 A;  2W9B B;  3OGU A;  4J9L A;  3H40 A;  2KTQ A;  2MUT B;  5DB8 A;  4UBC A;  5KG6 A;  5IIM A;  4YD2 A;  9ICS A;  4G3I A;  1Z00 A;  8ICV A;  3RBE A;  5KFF A;  1SKS A;  1MIY A;  2W9B A;  3MR3 A;  3BQ1 A;  4F50 A;  4P4O A;  2MUT A;  2R8H A;  3TAN A;  2PI4 A;  3QEA Z;  3HJ4 A;  2PXI A;  4O3P A;  3B0X A;  4F4Z A;  2XCP A;  5KFB A;  1L5U A;  4JWM A;  4MEY A;  4DL6 A;  1ZQD A;  4KLE A;  4X4N A;  5DKW A;  4UB4 A;  1ZQR A;  8ICH A;  5F2V O;  4RT2 A;  4FHX A;  4I2F A;  5CA7 A;  2C28 A;  3V7J A;  4YR2 A;  4DFK A;  1X9S A;  4F2S A;  9ICO A;  3H3A A;  4EBJ A;  2M2U A;  2VA3 A;  5DQH A;  4C8O A;  7ICG A;  3LQC B;  4WC3 A;  3ETL A;  3M8R A;  4NXZ A;  5J2H A;  3TQ1 A;  4RQ4 A;  5DDM A;  4TUQ A;  5KG7 A;  2AGO A;  5KFH A;  1T3N A;  3PY8 A;  1JN3 A;  4ED0 A;  1COO A;  3GIK A;  1KFD A;  1NK6 A;  5DBB A;  4KLJ A;  3PW2 A;  9ICK A;  1QLN A;  4F93 B;  4O3R A;  1PX5 A;  2XY6 A;  2BR0 A;  4B9T A;  3V7L A;  1WOT A;  2MAX A;  2DR9 A;  4R8U B;  3PX6 A;  7ICH A;  2PFO A;  4J9K A;  4LVS A;  1XU4 A;  4R8U A;  5BPC A;  2JEF A;  4GLX A;  3AQM A;  4DLG A;  1ZQL A;  1U45 A;  4X4P A;  4Q44 A;  2LYH A;  3MDA A;  4RWO A;  9ICF A;  2HHP A;  4UBB A;  1ZQI A;  3ISD A;  3H4B A;  4MFF A;  1ZQY A;  4Z6F A;  5C5J A;  1BNO A;  4M6W A;  3EW9 A;  4QWC A;  5HRD A;  2R8K A;  3KHH A;  4ECQ A;  1ZQO A;  7ICL A;  2DR7 A;  3EYZ A;  5KT5 A;  1FA0 A;  1T4G A;  5D46 A;  5EWE A;  1NK8 A;  3C18 A;  3Q8L A;  3UPQ A;  5DDY A;  3LK9 A;  4HYK A;  4I2I A;  4O0I A;  9ICB A;  5HRB A;  4WC6 A;  4DS4 A;  4AT8 A;  1JQR A;  3NGD A;  4BWJ A;  3Q8R B;  2HVI A;  8ICK A;  2M2T A;  2J6U A;  4UD4 A;  4UB5 A;  3SI8 A;  5J0O A;  1DGS A;  1XSN A;  3RR8 A;  3FDS A;  3JPR A;  2C2E A;  1U9L A;  4ECS A;  4RUA A;  4RQ6 A;  2ASD A;  4ECT A;  2HVH A;  3HPO A;  4PGX A;  4ATB A;  2PBE A;  5DGB A;  3T5J A;  8ICR A;  1B22 A;  4TUR A;  5KT2 A;  2NRZ A;  5DB6 A;  2W8K A;  1D9D A;  4P4M A;  3ZDC A;  4DLE A;  8ICE A;  4UQG A;  3Q8P B;  3OJU A;  3UQ0 A;  3GV7 B;  4O5E A;  4Z6C A;  1S0V A;  1KDH A;  4P2H A;  2R8G A;  4M0A A;  4RZR A;  4ELU A;  4M04 A;  1HUZ A;  4GXI A;  5IIO A;  4KLI A;  3PNC A;  1ZQF A;  3L9D A;  1DK2 A;  3AU6 A;  2XC9 A;  2XO7 A;  2ZH7 A;  5J2B A;  4B9M A;  4FHP A;  3V6K A;  4YMO A;  1S10 A;  4YN4 A;  4I2B A;  2W9M A;  3OVS A;  2VA8 A;  1A76 A;  1ARO P;  3K75 D;  3ZD8 A;  4B9V A;  1UEU A;  4WBY A;  4YFK A;  2UVR A;  2HHQ A;  8ICI A;  4RQ8 A;  4UB2 A;  5KFP A;  1BPY A;  2ISP A;  3AQL A;  4AT7 B;  4ECW A;  4O5K A;  4FS1 A;  1JAJ A;  5KFR A;  1RYS A;  2BPF A;  4M9J A;  2AGQ A;  3LDA A;  1WCN A;  4NM2 A;  4E80 A;  2A1J B;  5J2A A;  2ZUC A;  5KG5 A;  5CB1 A;  3LWL A;  2RDJ A;  3GII A;  1MC8 A;  2A1J A;  4ZH4 A;  1U47 A;  4R64 A;  5BOM A;  4B9U A;  4NLK A;  2ZTC A;  9ICU A;  4RNN A;  5KG2 A;  8ICJ A;  5J0U A;  4PPX A;  9ICR A;  1ZQW A;  5KT7 A;  1RZT A;  4WC0 A;  1QSY A;  1MIV A;  3MDC A;  1S97 A;  2XGP A;  3AU2 A;  2ZHB A;  2FPL A;  2DRA A;  1NK5 A;  5J0T A;  3MFI A;  5DB7 A;  4DOC A;  2PFP A;  4NY8 A;  5KFJ A;  4J9O A;  1ZQT A;  4EYH B;  4O3S A;  2RFF A;  2NRX A;  4F91 B;  3GV8 B;  1Z3E B;  4QZ8 A;  4DF4 A;  4WC4 A;  1NOM A;  2C2R A;  3RJI A;  2IA6 A;  4EZ6 A;  8ICA A;  4QZ9 A;  3TFR A;  1D8Y A;  1QSL A;  8ICC A;  7ICP A;  5DQG A;  1MQ3 A;  2W9A A;  1ZQV A;  1Q78 A;  3OUY B;  8ICL A;  1MQ2 A;  4PHA A;  1S0N A;  4DWI A;  5J0W A;  4B9N A;  4NLN A;  4EP7 A;  1ZQP A;  9ICQ A;  3OUY A;  2BPG A;  3HIY A;  2BPC A;  5KFY A;  4FBU A;  3JPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...