4PHDA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp and manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 105
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phdA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phdA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phdA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phdA03
3PY8A 4O3QA 2AGQA 1V4AA 4RQ4A 3M8SA 3FDSA 5DB8A 3TARA 5KFMA 5J29A 4LT6A 5DEDA 4RQ3A 3C5GA 3OVSA 2ZH8A 2JEGA 4DFMA 4QWAA 4P4PA 3BQTA 4NM2A 5KFZA 4ECXA 2Y1JA 3M9NB 4PGYA 1QSSA 5IIKA 5J0WA 1S77D 3PNCA 2F1IA 4CCHA 4NLNA 2ATLA 2ZJAA 5D46A 2ZTCA 1PX5A 8ICFA 4FHPA 1Z00B 4RQ1A 2C2DA 3RB3A 4DLGA 1ZQCA 5C5JA 5DG9A 4B9MA 4EBJA 4QWBA 1TFWA 5DLGA 1Z00A 1S0VA 2HVIA 4DQPA 5HRIA 3Q8KA 4J9SA 4E8FA 4DS4A 1K1SA 2JEJA 2PFOA 1TAQA 4RQ7A 5KFDA 1F5AA 3GIJA 4AT7B 4FH3A 4KMUA 1D9FA 1ZQBA 3L9DA 2ZH5A 1ZQTA 8ICOA 3ZDEA 4O0IA 4GLXA 2W9MA 4RT3A 1CUKA 5HP4A 5HHIA 2PXIA 2W9AA 1ZQRA 9ICOA 2FPKA 5J2CA 2XGQA 3RH6A 1V9PA 4F92B 1AROP 2R8IA 3RJEA 4PGXA 5DECA 2O1PA 2M2TA 3RBEA 2Q0ZX 3PX6A 7ICUA 4RT2A 1XO1A 4Q43A 4MEXA 5HREA 3OJUA 2XY6A 2VA2A 3BDPA 4FS1A 3V72A 5J0YA 2BCQA 9ICSA 3MR3A 4NKTA 1VFGA 2R8KA 4IQWA 5L1KA 4RPXA 2NRTA 5TZVA 4IQTA 2BR0A 1L3VA 5DG7A 4B9TA 4BGDA 3V6HA 2AQ4A 3RRGA 5J2JA 4TQRA 3FYHA 2R8HA 5KFAA 8ICHA 1QLNA 3ISDA 4RNNA 1QTMA 4QZDA 1XSPA 2OWOA 1IM4A 4Z6DA 2BCVA 4C8LA 1U47A 4MF2A 4X4SA 3HJ4A 7ICMA 4WC1A 1ZYQA 4FH5A 5L1IA 1UT5A 3RJKA 3OVAA 4GXIA 4KLFA 2AQ0A 3WFOA 4DL5A 2PFQA 4JWMA 3OV7A 1R89A 1ZJNA 1QSYA 4KLIA 2XGPA 1S0NA 3HJ1A 4FHXA 5IIMA 4MFAA 4RNOA 4WC7A 1MSWD 2P6UA 5J0QA 3MGHA 3C2LA 1MIYA 4LZDA 1K1QA 2H5XA 3C2MA 1ZQDA 2IMWP 5DKWA 4M9LA 4R63A 2ZHBA 1SZPA 1TFRA 5IIIA 2XCAA 2W9BB 3V6KA 4ED7A 1T3NA 4UD5A 3EYZA 4KLQA 2ZHAA 2M2VA 2ISOA 2C22A 5DBCA 5KFGA 4ECQA 4KLMA 3PMLA 4P4OA 4DQRA 3TANA 1S97A 1X9MA 2P6RA 3EW9A 5EWGA 1QSLA 3ZDBA 4NKUA 2KZZA 4UB3A 4EZ9A 2ID1A 2W9BA 2DR5A 4PHAA 4S3NA 5DLFA 4WC5A 5DB6A 1U9LA 4J9PA 5HRFA 2F1JA 5CR0A 1BPYA 1OU5A 5KFIA 3GDXA 2HHQA 1DGSA 5F9LA 1ZQUA 1JIHA 5DGBA 4LZGA 4DOAA 4O3PA 4QZAA 1KSPA 2DVIA 4X4TA 8ICGA 3V7JA 3JPPA 2ASDA 1S0MA 4DFKA 5KG3A 1ZQZA 4DL4A 3H39A 3H8SA 4X4OA 3ISCA 3MFHA 4P2HA 5J0RA 3RAQA 1KDHA 5J0SA 7ICOA 1Q78A 3UQ0A 4WC3A 4P4MA 4QZCA 3Q8LA 1S10A 1UT8A 9ICJA 8ICXA 3HX0A 4B9NA 2PFNA 3ZD8A 7ICQA 3H8WA 3OSPA 2W9CB 3H4DA 2AJQA 4J9NA 4RQ6A 3PO4A 4F4KA 4EBKA 4EBCA 2ZH7A 5KFNA 5DB9A 3G6VA 7ICIA 4K4GA 5J0PA 4DQQA 3NTUA 3ISBA 5F2VO 9ICNA 4X4RA 3RJGA 3C1ZA 9ICWA 1MIVA 4YXJA 3C2KA 3OJSA 2W9CA 3RRHA 1BVSA 4WCWA 5KG7A 4UBBA 1JXLA 2KFZA 3T3FA 4QW8A 2FMPA 2B21A 3GV7B 1JQRA 1B22A 5IIJA 3OVBA 3PMNA 2ZH6A 3QZ7A 5DQIA 5KT7A 3OSNA 2UVUA 4QZBA 5CP2A 4M5DA 3E2EA 3SV3A 5HR9A 2FPMA 5CA7A 4F5OA 5KG2A 1JN3A 2NRZA 3PVXA 1SL0A 2IA6A 5KFEA 4UB5A 4R8UB 5J2HA 4ED0A 2P66A 2KP7A 2NRVA 1N48A 2FLNA 4YR3A 3PW2A 3PW7A 1SKWA 3M9OB 4NLKA 4MFCA 4KLTA 4M9GA 2I1QA 5J2AA 9ICMA 4FHWA 3GV5B 3AQMA 3H37A 9ICVA 4I2BA 2ZUCA 5DQGA 3HT3A 2V4RA 1VJ7A 4R8UA 2PBEA 1X9WA 2BKEA 4TUSA 3PR4A 4ELUA 5HHHA 4TQSA 4WC2A 9ICUA 4C8KA 1NK7A 5HRKA 4XUSA 3M9MB 4FS2A 3MBYA 5F9NA 1SL2A 2PFPA 7ICKA 3JPSA 4FBUA 8ICYA 5CWRA 8ICKA 5KFJA 3LWLA 3RB6A 1BPXA 5KG6A 3ZD9A 4DSFA 1NJYA 3AQNA 3LDAA 3RB0A 2BPGA 3JPRA 7ICPA 3GIKA 4RU9A 3KHGA 2ALZA 2R8GA 1S0OA 1NZPA 1UA1A 1Y88A 4X4NA 4M04A 4C8NA 3MR5A 8ICVA 4I2EA 4PH5A 3BQ0A 7ICTA 1ZQEA 4F4WA 1KTQA 4EBEA 9ICKA 9ICLA 4YFKA 3ETLA 5HC9A 3PW4A 5IILA 4AT7A 3C1YA 1MQ2A 4I29A 4I2DA 1BPZA 4KN7A 4F8RA 1NOMA 2HHVA 4YQWA 4DO9A 4MEYA 2KN7A 1ZQSA 9ICHA 3JPTA 1R8BA 4WBZA 1T4GA 5KFOA 3PW0A 4NXZA 4YMOA 3V7KA 1N56A 2ZJ8A 1IXRA 5L9XA 5KFUA 9ICCA 2FPLA 1U49A 1ZQQA 5HRHA 4ECWA 1JAJA 1BGXT 3SV4A 1H38A 1ZQXA 5BPCA 1BPDA 1KRPA 4J9KA 1JMSA 4ELTA 8ICMA 7ICLA 4C8MA 3EZ5A 2HHTA 3RB4A 3H4BA 3V6JA 8ICZA 1SL1A 3T5HA 1RYRA 3JZ0A 2ZH2A 4ED6A 4J9LA 4RQ2A 4O5EA 2FMQA 4EBDA 5EWEA 5IINA 4DSEA 3Q8SB 4RZRA 1BPEA 5J2BA 4ELVA 5J2IA 3TFSA 3N97B 3QEBZ 4KN4A 7ICSA 5J2EA 4I2GA 2J6UA 3UXNA 2AGPA 3WFPA 7ICEA 3M8RA 4F2RA 4B9VA 2RDIA 2XC9A 4Z6EA 2KZMA 4JV0A 4YP3A 4TURA 1SKSA 1ZQYA 2PI5A 1CEZA 5CB1A 3RH5A 5HRDA 1KEJA 4YR2A 5HMLA 3QZ8A 4J9MA 4O3RA 3AUOA 3JPOA 4F4XA 1TAUA 1FA0A 4FHYA 4ECYA 9ICEA 5DBAA 2ZUBA 2J6TA 4DOBA 1NKCA 4KITB 4E7XA 4UB1A 4DF8A 4LVSA 4DSKA 3GILA 1DK2A 4YCXA 4M9HA 4RWQA 4DFJA 5DGAA 2MUTB 3Q8RB 4B9LA 1MIWA 2HHSA 2KZ3A 4TUPA 1NK4A 2M2WA 5HRLA 3BJYA 4I28A 5J0TA 3MABA 1D8LA 3THVA 3GV8B 4B9SA 2JZBB 2NRXA 5KFPA 1L3SA 1UEVA 2Y1IA 2Q66A 5L1LA 2MUTA 2ZH1A 1XU4A 2XCPA 5IIOA 3Q8PB 3TQ1A 4ECTA 7ICFA 9ICAA 3TAPA 4YG2A 2FLLA 4I2CA 4I2IA 4XRHA 4F5PA 2JZBA 2AU0A 2GWSA 1BNPA 1KFTA 1U45A 8ICPA 3EPGA 4UAZA 2C2EA 4XQ7A 1SKRA 3RJIA 3IHQB 2XY5A 4Q44A 3RBDA 2HHUA 1NK0A 2DR8A 3GFKB 1A77A 1TK0A 4DQSA 1X9SA 5KFRA 4QW9A 1ZQLA 2HVHA 4IRDA 4ECZA 4BWMA 1TK5A 4JK1A 4MFFA 8ICBA 9ICPA 4DL7A 1EXNA 2ASJA 4PHDA 3N4MB 4TUQA 5D49A 3MR2A 4IR9A 5KFKA 2RFFA 2BPCA 2ZTDA 2DPJA 4WC0A 4X0AA 2ZH4A 2VANA 1L5UA 1TFYA 5KFSA 4X4VA 1ZJMA 2ZUDA 1KLNA 1MQ3A 4K4HA 4DL3A 2ZH9A 3ORYA 2UVWA 1U48A 2DFLA 3EWAA 4QZ8A 1ZQMA 5CJ7A 4O3SA 4PPXA 3OUYB 1HJPA 5DB7A 1L3TA 2BCRA 4JUZA 4GC6A 3UXPA 4IR1A 5J0OA 1WOTA 5KG5A 3GQCA 4KLGA 2BQRA 2BHNA 4O5CA 5HRGA 3NYBA 1TVAA 4Q45A 3OUYA 4YXMA 1TK8A 1A76A 3V7LA 4RUCA 4R66A 4F50A 4GC7A 5KG4A 3TI0A 3RJHA 3ZDCA 2RDJA 4DSLA 4NM1A 4KLJA 4Q8EA 5BOLA 4DQIA 7ICJA 3K75D 2BGWA 4KLOA 4IG8A 4ECSA 8ICEA 3KHLA 3KHRA 4I27A 5D4BA 4JV2A 5J2DA 3GIMA 3BQ2A 4F3OA 2VA3A 4I2FA 3BQ1A 4DL2A 5KT4A 5HRBA 4IRKA 4R65A 3C18A 3H7IA 3IM1A 5KFYA 2O5AA 1ZETA 3HP6A 2C28A 3LWMA 2HW3A 4E80A 4PHEA 4RQ0A 4KLDA 2LYHA 1TV9A 2F1HA 1TKDA 2AGOA 4Z6FA 4UAWA 1UEUA 4MF8A 3PW5A 4EP7A 3PO5A 7ICNA 2NRWA 9ICIA 1Q79A 4AT8B 4B9UA 1ZQHA 4QZFA 4QWDA 2BCSA 1R8AA 1ZQWA 4F4ZA 1R8CA 2DR7A 8ICCA 4EYIB 1BPBA 4ECUA 8ICUA 2ZJ5A 4DSIA 4UQGA 4DOCA 1NJXA 5J2GA 4F5RA 4WC4A 3RR8A 4AT8A 4KLLA 4F5NA 5HNKA 1UA0A 2R8JA 3OHBA 5KFCA 3T5LA 1D9DA 4F4YA 1ZQAA 5KFHA 4EYHB 4BDPA 4DSJA 3H3AA 5KFXA 3PX0A 4YMNA 3PX4A 4O9MA 3QEAZ 4ED3A 4FO6A 4KLHA 3MR6A 5J0UA 3UPQA 1RZTA 3TAQA 8ICNA 1ZQGA 4M9JA 4XA5A 5KFQA 3HIYA 2DPIA 1WCLA 5J2FA 4ED8A 1S9FA 2I9GA 4G3IA 5DBBA 5KT5A 3K4GA 1C7YA 4O5KA 4GXJA 3QE9Y 1ZQJA 4DWIA 1JXEA 4NLZA 4RNMA 1LV5A 5KT6A 2FMSA 8ICWA 2NRKA 3MDCA 1LB2B 2BDPA 4M6WB 4RWNA 5KFBA 5DG8A 1D8YA 9ICXA 5EOZA 2ZTEA 4HYKA 1NK6A 4C8OA 8ICSA 4DFPA 4X4UA 4I2AA 4UD4A 4FBTA 3B0YA 3T5KA 1XSLA 9ICGA 4DL6A 1XWLA 4EEYA 1S76D 3T5JA 4X5VA 9ICTA 4ECRA 4M6WA 3AU2A 5KTQA 3RTVA 3WFSC 4QWEA 2W8KA 4IQVA 4WBYA 2IBKA 3LK9A 2C2RA 1HUOA 4J9QA 5CHGA 4YMMA 3OHAA 1WCNA 4ED1A 3H8JA 5KFTA 1ZQFA 2UVRA 3RR7A 5BOMA 4K4IA 5KFFA 3NGDA 1NK9A 1RYSA 3SYZA 9ICQA 2XY7A 1DK3A 3H38A 4ECVA 2BCUA 4QZHA 4X4PA 3C23A 3HPOA 3MFIA 4XQ8A 5KT2A 4QZGA 3SI8A 1T7PA 7ICGA 4X4QA 5DDYA 2HHPA 2W8LA 2PI4A 1XC9A 8ICLA 2IHMA 2V4QA 3RAXA 4KLSA 1ZQKA 3MDAA 9ICRA 7ICRA 4YD1A 4QWCA 2VA8A 3C21A 4BXOB 4M9NA 4KLUA 4UBCA 4PGQA 3AU6A 4KLEA 1NK8A 4KTQA 8ICRA 3LQCB 9ICBA 2ISPA 3C66A 1L3UA 3H40A 1JX4A 3AQLA 2UVVA 1NKEA 3UPSA 3Q8QB 2KTQA 1XS9D 3JPNA 4F93B 1UETA 4QZ9A 2BQUA 4QZEA 4NLGA 3B0XA 4BXOA 4IRCA 2M2UA 1KNYA 2DRBA 1RXWA 4DEZA 4YVZA 2WTFA 4DF4A 2M9NA 4YN4A 8ICIA 4FHVA 2DRAA 4E0DA 2J6SA 1NO5A 3RH4A 9ICFA 1MC8A 4ZH4A 3ZDDA 7ICHA 4M47A 2XO7A 4RPYA 4DLEA 5KFWA 3UQ2A 5KFLA 3G6YA 2BE3A 3RJFA 1ZQVA 4RPZA 3KHHA 5KT3A 1B43A 5DQHA 5KG0A 4YD2A 3GIIA 3C5FA 1KFSA 1PZNA 1XSNA 5DDMA 2FLPA 4Q8FA 2KFNA 8ICAA 2A1JB 5HMMA 4M0AA 4RQ8A 5KFVA 2V9WA 8ICQA 4R64A 3MGIA 2BQ3A 4EZ6A 8ICJA 2HHWA 1RPLA 3JPQA 7ICVA 4RWOA 4Z6CA 1ZQPA 3RJJA 1HUZA 5J0XA 1NJZA 4F2SA 1YLQA 4M2YA 3TFRA 3OGUA 2A1JA 2JEFA 1X2IA 4O3NA 8ICTA 1ZQIA 3HWTA 1NKBA 3HW8A 3ZDAA 1NK5A 3EPIA 4X0BA 4I2JA 1ZQNA 2HHXA 3JYYA 5JUMA 4RWPA 5J2KA 4YR0A 3Q8MA 3WFRE 2JEIA 4ATBB 3PR5B 4AT9B 1Z3EB 4F91B 1T8EA 4PHPA 4DS5A 1NJWA 1DOQA 1U4BA 1KFDA 1BNOA 2ZH3A 4JWNA 2ASLA 4RQ5A 4J9RA 2BPFA 5L1JA 4RUAA 4J9OA 4F5QA 3KTQA 1COOA 3UXOA 3AQKA 2IHNA 5EWFA 5KG1A 3SZ2A 1RXVA 4UAYA 4AT9A 3G6XA 4ED2A 4IQUA 4JV1A 4ATBA 4O3OA 4UB4A 4UB2A 4WC6A 2DR9A 4BWJA 4QZIA 1ZQOA 4I2HA 3WFQE 4NY8A 2MAXA 3PV8A 4GXKA
chains in the Genus database with same CATH superfamily
1ECWA 4LT6A 1S8OA 2JEGA 4QWAA 1YZ6A 4P4PA 4NM2A 4EX7A 2Y1JA 1QSSA 5IIKA 5J0WA 1JI7A 1FFVA 1P7DA 2ATLA 2ZJAA 5ALYA 4FHPA 3QXGA 4DLGA 4IS7A 4B9MA 4EBJA 3N7SC 1TFWA 2WF8A 1J97A 1D9FA 4FH3A 3L9DA 2W9MA 2EQYA 5HHIA 2VJ4A 2W9AA 1SGGA 5J2CA 3RH6A 1V9PA 5DECA 2HMXA 3RBEA 2Z7JA 3SEIA 1ZOLA 3OJUA 2XY6A 2VA2A 2EDUA 5B66U 2BCQA 5C0YA 2YB4A 2BBHA 4K9BA 5TZVA 2AQ4A 3RRGA 3FYHA 8ICHA 1QLNA 4OAHA 3EUB2 5AI0A 2OWOA 1U47A 3HJ4A 1ZYQA 4EEBA 4RQMA 1LKYB 5ALOA 4DL5A 1QSYA 5IIMA 5EE1A 2RP5A 3IV6A 3NVYA 2EH9A 5J0QA 4CGZA 2H5XA 4M9LA 4AYBC 5DKWA 2ZHBA 1GO3F 4IC9A 1TFRA 2W9BB 1QQ6A 4KLQA 2ZHAA 3O0FA 5DBCA 4KLMA 3TANA 1S97A 2P6RA 1QSLA 3ZDBA 2KZZA 4EZ9A 2DR5A 4WC5A 5DLFA 3RFAA 3UM9A 1BPYA 1OU5A 1L7PA 4LZGA 5DGBA 1WG8A 8ICGA 3V7JA 5G5HA 4DFKA 1ZQZA 3H39A 3H8SA 2YN4A 3ISCA 5J0SA 7ICOA 3QUBA 3PSIA 4P4MA 1S10A 4OJLA 1C20A 2HOFA 2WB1C 1UQVA 1PVRA 3ZD8A 3E58A 3OSPA 2W9CB 3H4DA 4J9NA 7ICIA 5J0PA 4DQQA 5L1MA 4P0QB 2ZIWA 2KIWA 5AM4A 2FMPA 4NXVA 3BZCA 4NV0A 2QLTA 3WK8A 3OSNA 3BS5A 5CP2A 3E2EA 3SV3A 5EE0A 5CA7A 4F5OA 3PVXA 4UB5A 2P66A 2KP7A 4NLKA 4FHWA 2DKZA 9ICVA 1LVHA 4I2BA 3HT3A 5AKLA 2JXJA 3MBYA 3AQNA 2O6KA 2ALZA 5CFUA 2R8GA 1UA1A 4X4NA 2KSOA 8ICVA 2B6GA 1ZQEA 4N7RA 4EBEA 9ICKA 9ICLA 4O6AA 1PVQA 2AH5A 5IILA 1RQNA 4F8RA 4MEYA 2F44A 1KN5A 3JPTA 2MSNA 4QJFB 4NXZA 1N56A 4CNQA 5JTIA 9ICCA 2KEYA 2KHVA 1ZQQA 5HRHA 3SV4A 5BPCA 1KRPA 2LHTA 4J9KA 4C8MA 3V6JA 1X42A 1RYRA 3JZ0A 1PK3A 2AXTU 5EWEA 1SV0C 3NVZA 1TE2A 2OXOA 5J2IA 4UB6U 3TFSA 3N97B 1IV8A 4KM5A 5J2EA 3UXNA 2AGPA 2XC9A 5AM1A 4Z6EA 2KZMA 4TURA 1ZQYA 2RQ5A 3RH5A 4YR2A 3QZ8A 4J9MA 4O3RA 4P0PA 1KQQA 2AHOB 4E7XA 4UB1A 4DF8A 4RWQA 4AP9A 3Q8RB 4UAUA 4XJEA 2HHSA 3A0BU 4I28A 5J0TA 1D8LA 4B9SA 2NRXA 1L3SA 4PZOA 2MUTA 5AICA 1SWWA 3Q8PB 4ECTA 2GH1A 3QYPA 2GWSA 1U45A 2C2EA 2KIVA 1SKRA 3J81j 3IHQB 5ALNA 2HHUA 2QARB 4OJ5A 1X9SA 1WYGA 5KFRA 4ECZA 4MFFA 9ICPA 5KFKA 1FEZA 5B3PA 1TFYA 4X0AA 5ALGA 5F3XB 2ZH9A 2WAQF 3ORYA 1U48A 1ZQMA 2G5HB 3QU2A 4FE3A 4JUZA 4NXXA 2EAMA 2HN2A 2BQRA 5HRGA 3WKBA 3NYBA 5JU5A 3OUYA 1V97A 2MU2A 3ZDCA 7ICQA 5E79U 4FH5A 5BOLA 3HRDD 5D4BA 3GIMA 4I2FA 3BQ1A 5AK4A 4OCZA 1ZETA 2HW3A 2C28A 2IOHA 1XNSA 4RQ0A 4KLDA 1TV9A 1WWVA 4EP7A 2JH7A 2QB0A 2IUBA 4QZFA 2Y0SC 4OAFA 1NJXA 4AT8A 4F5NA 5HNKA 1UA0A 1D9DA 3HKZC 5ALZA 4BDPA 5AI5A 2GAFD 4ED3A 3MR6A 3UPQA 8ICNA 4LEWA 3HIYA 5J2FA 2I9GA 2F8LA 4GXJA 5CRXA 1O08A 1LB2B 3D2QA 1YT3A 1D8YA 5EOZA 4C8OA 4U7CA 2KE7A 3KKAC 9ICGA 4DL6A 1XWLA 2LI6A 4ECRA 3SAGA 3WFSC 4IQVA 4WBYA 2KVSA 4J9QA 1F5SA 5CHGA 4YMMA 3ER8C 1WCNA 5AIAA 3RR7A 5BOMA 1F44A 3SYZA 1DK3A 3NASA 4ECVA 3H38A 3MFIA 5KT2A 5ALTA 2W8LA 3MDAA 2HSZA 2VA8A 4M9NA 3LQCB 4KLEA 1NK8A 2H3VA 1L3UA 5ALWA 1JX4A 2UVVA 1NKEA 3Q8QB 3QU5A 1UETA 5AK3A 4QZ9A 2BQUA 1KNYA 3B0XA 1ZD3A 2H3FA 1XO0A 2K4EA 1NO5A 2NYVA 7ICHA 4ZH4A 4BX9C 4M47A 4RPYA 5KFWA 3UQ2A 5KFLA 2BE3A 1ZQVA 4RPZA 5DQHA 5KG0A 3H8MA 4OAGA 4M0AA 4RQ8A 3MGIA 3BS7A 2BQ3A 1RPLA 3JPQA 2DKXA 4DFDA 3ALRA 1X6IA 1X2IA 4CF5A 5ALRA 4I2JA 2W11A 3WFRE 3DV9A 2JEIA 2OM6A 4AT9B 1DOQA 1KFDA 4NXWA 4JWNA 2BPFA 2JV3A 5L1JA 5CEHA 1COOA 5KG1A 1RXVA 4IQUA 4JV1A 4K99A 4WC6A 1ZQOA 4NY8A 5HRDA 2F8KA 1URJA 4O3QA 1SXDA 4A8EA 3FDSA 5DB8A 3TARA 2DL0A 5J29A 4RQ3A 5KFZA 4UARA 4PGYA 1S77D 1ZD2P 1N60A 2N1RA 5D46A 3PHZA 3RB3A 5AK6A 1ZQCA 1DXSA 4WH5A 2K60A 1S0VA 5HRIA 1IG6A 1SZHA 3Q8KA 4DS4A 2JEJA 4RQ7A 3GIJA 4AT7B 3QU9A 2ZH5A 1ZQTA 4CE6A 3CK6A 4GLXA 5HP4A 2E1FA 2PXIA 2Y9UA 9ICOA 4NLBA 2XGQA 4K9AA 4PGXA 4NL9A 3TADA 2Q0ZX 3WU2U 1XO1A 4ICAA 4KX5A 4FS1A 3V72A 1Z19A 5J0YA 1VFGA 2R8KA 3A0HU 5L1KA 2BR0A 2NRTA 1L3VA 5ALIA 4B9TA 3V6HA 2KV2A 3ISDA 4RNNA 1QTMA 4QZDA 1XSPA 1UHUA 4C8LA 4LEYA 4X4SA 4WC1A 3FM9A 5L1IA 1RG6A 4KLFA 2AQ0A 3WFOA 2NV3A 2W04A 1R89A 1ZJNA 2XGPA 4FFDA 4QIWC 2WHEA 3EYZA 2M2VA 4ECQA 2KKPA 3KOOA 5HRFA 2F1JA 5KFIA 1DGSA 1ZQUA 1JIHA 4EELA 4LJXA 4AYBF 3N28A 5KG3A 4DL4A 3NVOA 1A0PA 2DBYA 4P2HA 1Q78A 3D2NA 1UT8A 3QNMA 8ICXA 3HX0A 2PFNA 2ZIWB 3H8WA 2ZH7A 5K4LA 4BUGA 5DB9A 2KG5A 4K4GA 3ISBA 4X4RA 1T3QA 3BS5B 5KG7A 1ZRNA 5AKXA 2RRDA 4FZNA 3OVBA 2WB1F 3T79A 3QZ7A 2ZH6A 4QZBA 2DUYA 1JN3A 1SL0A 2IA6A 3HJ1A 5KFEA 2FJ6A 2JR5A 1N48A 3PW2A 5AI9A 4EENA 3M9OB 9ICMA 5J2AA 3M6KA 2NO5A 3GV5B 2D8CA 2YY6A 3LVWA 4PL2A 1VJ7A 2PBEA 2YMPA 2BKEA 3F2DA 4TQSA 9ICUA 5HRKA 5F9NA 2KSOB 2ZIVA 2K4HA 3HILA 5KFJA 1BPXA 1Q8KA 7ICPA 3GIKA 4RU9A 2HBJA 3KHGA 2HI0A 5J8YC 1S0OA 1Y88A 2HOIA 4M04A 4C8NA 3MR5A 4K8VA 1KBUA 3M6ZA 2IOFA 3SR6A 4YFKA 3PW4A 1FFUA 4AT7A 4KN7A 4RQNA 1QH9A 1T4GA 3V7KA 2ZJ8A 5ALDA 5KFUA 2PMZC 1U49A 5A0LA 1BGXT 1H38A 1ZQXA 4ELTA 8ICMA 2VKQA 1JMSA 5AKKA 3EZ5A 2HHTA 2ZIXB 3F5EA 3RB4A 4O67A 4USAA 3N7PD 4FZLA 2OH2A 3T5HA 2ES6A 1QQ5A 4ED6A 4RQ2A 2CRXA 5ALSA 4O5EA 4DSEA 2RHFA 5J2BA 1L8LA 4KN4A 7ICSA 2J6UA 3M8RA 4F2RA 2RDIA 1SV4A 4P0PB 3SAFA 1SKSA 5ALFA 2PI5A 2KJ8A 1CEZA 5CB1A 1TAUA 3WKCA 4FHYA 5DBAA 5EE3A 2ZUBA 5AM2A 1YZ7A 4DFJA 2MUTB 3GU3A 2BBJA 5ALEA 2KZ3A 1NK4A 2L5YA 3BJYA 3MABA 3GV8B 2Y1IA 5L1LA 1XU4A 2XCPA 5IIOA 9ICAA 3TAPA 1Z4OA 4F5PA 1L7OA 2EANA 8ICPA 3EPGA 2HDOA 2XY5A 2I6XA 4CRXA 3GFKB 4DQSA 3MCRA 2FDRA 2ASJA 4TUQA 5D49A 1MN8A 2HOQA 4IL6U 1RQLA 5KFSA 1SXEA 4X4VA 1NNLA 1ZJMA 1KLNA 1MQ3A 4OAIZ 3K1ZA 2VJ5A 2JGAA 3OPXA 3QX7A 4PPXA 3OUYB 4GC6A 3UXPA 5J0OA 4EX6A 3GQCA 4KLGA 4QNLA 2BHNA 4O5CA 1TVAA 2PKEA 4YXMA 4RUCA 3V7LA 4R66A 4GC7A 4DSLA 4KLJA 2RDJA 4Q8EA 2ZIUA 7ICJA 3KZIU 5T14A 3KHLA 8ICEA 4JV2A 5J2DA 3BQ2A 2CN1A 4UB8U 3H7IA 5KFYA 4OO1J 2QB0B 4E80A 3LWMA 2G09A 2E5SA 1TKDA 2AGOA 4UAWA 2EZZA 1UEUA 3PW5A 1K5OA 4AT8B 4B9UA 1R8AA 1R8CA 4QWDA 2DR7A 1ZQWA 3KFUF 4EYIB 2ZJ5A 4KX3A 4UQGA 4F5RA 1S5LU 3RR8A 1L6NA 2E3TA 1QCKA 3H3AA 3QEAZ 1ZQGA 4M9JA 5KFQA 1SV0A 2DPIA 1WCLA 2HBMA 2Y0SF 2HBLA 3K4GA 3QE9Y 1ZQJA 5ALHA 4NLZA 1A6SA 2FMSA 3MDCA 2BDPA 3DEEA 5KL8B 3RF9A 4PZNA 2ZIXA 2ZTEA 3HKZF 8ICSA 3MGVA 4X4UA 1SIJA 3B0YA 4B6JA 1S76D 4M6WA 3AU2A 5KTQA 3RTVA 2W8KA 2FE9A 4KMOB 3LK9A 2G0AA 2C2RA 1HUOA 2M0NA 3OHAA 4ED1A 3H8JA 5KFTA 2UVRA 5AM0A 3R9KA 4K4IA 5KFFA 2KK0A 3AM9A 3NGDA 2BCUA 3AEVA 3C23A 3HPOA 4JMUA 4XQ8A 3SI8A 4X4QA 2HHPA 5AM5A 1XC9A 4KLSA 2D3DA 2GA9D 9ICRA 7ICRA 1J2NA 4PGQA 1B4FA 3C66A 1GPJA 1UCVA 2KTQA 2GLEA 2XIDA 4IRCA 1RXWA 3N7RC 4YVZA 4CDGA 2M9NA 5KAIU 4DF4A 4FHVA 2DRAA 2R18A 1L7MA 3WK6A 4DLEA 3L4PA 2OCEA 4F72A 5ALQA 5KT3A 3F2BA 1XSNA 8ICAA 2XICA 5KFVA 4JB3A 3TACB 8ICJA 2HHWA 2WF7A 2DQNB 2LMRA 4F2SA 1HUZA 5J0XA 2A1JA 2GOLA 8ICTA 3IN5A 3HWTA 1NKBA 3EPIA 3JYYA 4RWPA 4YR0A 3I28A 3PR5B 5EE9A 1NJWA 2I5HA 2ZH3A 1N62A 1F0MA 3D2SA 4J9RA 4RUAA 4J9OA 2F3NA 4CF4A 2IHNA 5EWFA 3SZ2A 4ATBA 3G6XA 4ED2A 3SMVA 4US9A 4UB4A 4Y2TA 3WFQE 4QZIA 3JCFA 2MAXA 4GXKA 3PY8A 2AGQA 3M8SA 5KFMA 5G5GA 1N5WA 3C5GA 1SB3C 4DFMA 3BQTA 1M6YA 2KJ9A 5CFSA 2W7PA 3PNCA 2F1IA 3SD7A 1KW4A 8ICFA 4RQ1A 2C2DA 1FO4A 3SAHA 5C5JA 2MRLA 5DG9A 4NXUA 2EWRA 5DLGA 1Z00A 4LEZA 2ZXHA 4J9SA 4E8FA 3VC8A 5KFDA 1F5AA 4KMUA 4Y2YA 1L7NA 4O0IA 4RT3A 1CUKA 3ONNA 1ZQRA 2G08A 3D6JA 2FPKA 1AROP 2O1PA 2M2TA 1WUDA 3KKAA 2W54A 7ICUA 4Q43A 1Z1BA 3LVVA 5HR7A 5HREA 2IHOA 3BDPA 3MR3A 4NKTA 4IQWA 3HJEA 4NXTA 4BGDA 5J2JA 4TQRA 5AIBA 4Z6DA 1KKXA 1MA7A 5JRTA 2EAPA 1DGJA 7ICMA 1TAMA 1UT5A 2LYAA 3RJKA 4GXIA 3OV7A 1OW5A 4KLIA 1S0NA 4MFAA 3CNHA 4RNOA 1MSWD 2P6UA 3NWIA 1AQ6A 4BJQA 4WC7A 4LZDA 1K1QA 2IMWP 3GZFA 4GFJA 1X66A 4R63A 1SZPA 1L8OA 5IIIA 2XCAA 4UD5A 5D61A 3F5AA 5KFGA 2ODGA 3PMLA 4DQRA 1X9MA 4NKUA 2KMDA 5EWGA 1ZD5A 4PHAA 5DB6A 3K7DA 3GDXA 2HHQA 4QIWF 2DVIA 4DOAA 4QZAA 3JPPA 4LEVA 5J0RA 3RAQA 4QZCA 3Q8LA 5AKZA 4WJ3B 2YQEA 3OWGA 3PO4A 4F4KA 4UATA 3G6VA 4HAIA 2F77X 3NTUA 9ICNA 4EEDA 4YXJA 3C2KA 3OJSA 3RRHA 1BVSA 4UBBA 1JXLA 3DDHA 5H2FU 2KFZA 3T3FA 5IIJA 4DCCA 5KT7A 3NUQA 4M5DA 2DF4B 3ERCC 3IP4B 3ICXA 5KG2A 2NRZA 4MKPA 3UMCA 1PK1A 2NRVA 4UASA 3TKAA 2FLNA 4YR3A 3PW7A 2I1QA 2LM4A 4Y2JA 3AQMA 1QQ7A 3H37A 1Z1VA 2ZUCA 2ZIVB 1Z4NA 4R8UA 1X9WA 2KKVA 4TUSA 4ELUA 3AQEA 4G9BA 1JUDA 1RM6C 1NK7A 4C8KA 5ALLA 1SL2A 2PFPA 7ICKA 3JPSA 4FBUA 3RB6A 3ZD9A 4DSFA 3RB0A 3JPRA 2H3QA 4I2EA 4PH5A 4EV6A 1X9XA 3ETLA 1MQ2A 4I29A 4I2DA 2HHVA 1OUQA 2YMLA 4YQWA 1ZQSA 1R8BA 5KFOA 4Y2PA 3PW0A 4JLXA 4YMOA 3QU4A 5AKHA 5L9XA 2B4VA 1DRGA 2E1EA 2FPLA 1OXJA 1JAJA 7ICLA 3H0RB 1IIPA 1CI4A 1ZRMA 3AL0B 2YX8A 4F71A 8ICZA 1SL1A 3BQ7A 4I0UA 3QUCA 4J9LA 4UAVA 3U26A 3ED5A 4EBDA 4NJ8A 3Q8SB 2DGZA 3KD3A 2PMZF 7ICEA 1V38A 3NVVA 4B9VA 4YP3A 1KEJA 3EF2A 4OJPA 4Y2VA 3AUOA 1Q3UA 5ALKA 4DOBA 2J6TA 4KITB 3ER9B 4LVSA 5ALXA 1DK2A 4YCXA 1O03A 5DGAA 1MIWA 4HX0A 4TUPA 2M2WA 2LYBA 3THVA 1UEVA 2Q66A 5KFPA 4YG2A 2FLLA 1HIWA 4I2CA 4I2IA 4XRHA 1BNPA 2JZBA 1KFTA 1VJ5A 5ALPA 1N61A 2OEHA 4Q44A 2DR8A 1TK0A 4IRDA 8ICBA 3KZXA 4BWMA 1TK5A 4EGWA 2CXYA 2F76X 3N4MB 3MR2A 2B56A 2RFFA 1ZXIA 2BPCA 2ZH4A 4WC0A 4JLZA 2ZUDA 2UVWA 4K96A 4QZ8A 1D8BA 5CJ7A 4O3SA 1HJPA 3H0LB 5DB7A 4ACOA 1WOTA 2ZIUB 2E8OA 5ALUA 1TK8A 1A76A 4F50A 1V85A 5KG4A 2K4PA 4KLOA 2KJ5A 2LKYA 1HEKA 5J8YA 4ECSA 5GTHU 4EEKA 4F3OA 4MHVA 2VA3A 4DL2A 5HRBA 4IRKA 5AM3A 4US8A 3IM1A 4R65A 2O5AA 3C18A 3HP6A 5AI4A 2F1HA 1PVPA 2JHDA 5TISU 4Y2XA 1Q79A 7ICNA 5ALJA 3WKEA 2BCSA 4F4ZA 4DSIA 5AKEA 4FO1A 4WC4A 2W3RA 2B0CA 4Y2RA 3OHBA 4F4YA 1ZQAA 4EYHB 1UPHA 4YMNA 4O9MA 4FO6A 5J0UA 1JRPA 4XA5A 1S9FA 2CPRA 4G3IA 2ZG6A 5KT5A 4O5KA 4DWIA 8ICWA 2JH1A 2NRKA 4RWNA 4M6WB 3L3FX 1CRXA 2HBKA 4HYKA 2Q4TA 1NK6A 5ALMA 3QUTA 5DEDA 4PJ0U 2QKQA 9ICTA 1JALA 1N2XA 3T5JA 2IBKA 2W03A 1ZQFA 9ICQA 1RYSA 2XY7A 4QZHA 4X4PA 3C29A 5DDYA 8ICLA 2IHMA 3RAXA 3C21A 4KLUA 8ICRA 2G5IB 3AU6A 4KTQA 9ICBA 2ISPA 3H40A 3UPSA 3JPNA 4NLGA 4QZEA 3PSTA 4C4SA 4BXOA 2K8AA 2DRBA 8ICIA 4E0DA 2J6SA 3RH4A 1MC8A 3IDWA 2XO7A 3CRXA 2KD1A 2ZH8A 1B43A 3I76A 4YD2A 1KFSA 2A1JB 5HMMA 8ICQA 4EZ6A 4Z6CA 3RJJA 1NJZA 4PL1A 3TFRA 3FC4A 4ZOHC 3F2CA 1ZQIA 3HW8A 3ZDAA 2G06A 1ZQNA 2HHXA 2P35A 3WKAA 4ATBB 4F91B 4PHPA 1U4BA 2ASLA 4RQ5A 2F2AB 3AN1A 3PSPA 4C0ZA 4NWIA 2K8CB 3IG8A 4UAYA 4O3OA 4UB2A 2DR9A 4C7ZA 4BWJA 1SKWA 4KLTA 1V4AA 4RQ4A 3OVSA 5AKIA 2WF9A 4ECXA 3M9NB 4CCHA 4NLNA 3CW2C 1PX5A 2ZTCA 1N5XA 1Z00B 3B9JA 3MC1A 4U6PA 2H3ZA 4QWBA 3IG5A 2HVIA 4DQPA 1K1SA 2PFOA 1TAQA 3PSFA 1X6JA 1ZQBA 3QU7A 5AK5A 8ICOA 3ZDEA 1X40A 4OJ6A 2Y9TA 4F92B 2R8IA 3RJEA 4WQKA 1J2MA 4O68A 3CP8A 3PX6A 4RT2A 4MEXA 2MA1A 4CF3A 9ICSA 1B0XA 4RPXA 4IQTA 5DG7A 2QB1A 4C4RA 2R8HA 5KFAA 5KL1B 3NVWA 1IM4A 2BCVA 4MF2A 2ZXIA 2NO4A 2YMQA 3OVAA 2PFQA 4JWMA 3IRUA 4FHXA 4Y2QA 3C2LA 3MGHA 1MIYA 3C2MA 1ZQDA 1LKYA 3V6KA 4ED7A 1T3NA 1FIQA 2ISOA 2C22A 2BDUA 4P4OA 3NRWA 3EW9A 3LYSA 4UB3A 2ID1A 2W9BA 2EZXA 4S3NA 1U9LA 4J9PA 5CR0A 5F9LA 4O3PA 1KSPA 5FP0A 4X4TA 1S0MA 2ASDA 4X4OA 3MFHA 2WF6A 2LPEA 2K8BB 1KDHA 3WK9A 2W3SA 3UQ0A 4WC3A 1NZBA 9ICJA 5KNIA 4B9NA 2JMGA 3SQIA 2AJQA 2GO7A 4RQ6A 4EBKA 4EBCA 5KFNA 2KHQA 5AKYA 1RYUA 2WFAA 5F2VO 5AKJA 3RJGA 3C1ZA 9ICWA 1MIVA 5HR6A 2W9CA 2HCFA 4WCWA 2YTUA 1COKA 2ESEA 5AI8A 4QW8A 2B21A 3GV7B 1JQRA 2YB1A 3PMNA 1PK1B 5DQIA 2UVUA 4P0QA 5HR9A 2FPMA 3OTQA 4WOYA 5JTGA 4ED0A 4R8UB 5J2HA 5B5EU 4MFCA 4M9GA 5DQGA 2V4RA 5ALVA 4O3MA 3PR4A 5HHHA 4WC2A 4XUSA 3M9MB 4FS2A 8ICKA 8ICYA 5CWRA 3LWLA 5KG6A 1NJYA 2HN1A 3LDAA 2BPGA 2B51A 4OD0A 5CHEA 1NZPA 3BQ0A 7ICTA 3SENA 4F4WA 1KTQA 3UMGA 1Q3VA 4O69A 3C1YA 1BPZA 2LM1A 1NOMA 2YMMA 4DO9A 2RLTA 2KN7A 9ICHA 4WBZA 1ED1A 4GIBA 3PZPA 1IXRA 3NS1A 4ECWA 4FZMA 2FI1A 1BPDA 2H3IA 3H4BA 1SWVA 2ZH2A 2XI9A 2FMQA 5IINA 4NLCA 1VLBA 4RZRA 1BPEA 4ELVA 3I1YA 3QEBZ 1VDVA 3AQFA 4I2GA 3WFPA 4JV0A 3CYMA 2A19A 1N63A 5HMLA 1FA0A 3JPOA 4F4XA 4ECYA 9ICEA 2W55A 1NKCA 4DSKA 3GILA 4M9HA 4B9LA 5HRLA 2DWQA 2JZBB 3QUQA 2ZH1A 3TQ1A 7ICFA 2E8PA 5D63A 3NKUA 2AU0A 4UAZA 4XQ7A 2WAQC 3RJIA 3RBDA 1NK0A 1A77A 1ZQLA 4QW9A 2HVHA 4JK1A 4DL7A 1EXNA 4C80A 4PHDA 4IR9A 3WKDA 2QARA 3AMZA 2ZTDA 2DPJA 2VANA 1L5UA 2KOBA 4K4HA 4DL3A 2LBOA 2DFLA 3EWAA 1L3TA 2BCRA 3L5KA 4IR1A 5AI6A 2VIXA 5KG5A 5D62A 5CFTA 1KL9A 3KBBA 4Q45A 3TI0A 3RJHA 4NM1A 4DQIA 3S6JA 1Q46A 3K75D 2BGWA 4IG8A 3BZKA 3KHRA 4I27A 3K1RB 3M7DA 5KT4A 2BZFA 3F53A 4PHEA 2LYHA 2OYYA 4UW9A 4Z6FA 2EAOA 4OJOA 4MF8A 3PO5A 2NRWA 9ICIA 1ZQHA 1ZQ1C 8ICCA 1BPBA 4ECUA 8ICUA 4DOCA 5J2GA 4KLLA 2R8JA 4Y2UA 5KFCA 3T5LA 4KB6A 4Y2SA 4K98A 5KFHA 4DSJA 5KFXA 3PX0A 3PX4A 3H0MB 4WQLA 1T94A 4KLHA 1RZTA 3TAQA 4C7YA 4ED8A 2IOFK 5DBBA 1C7YA 2FCLA 1JXEA 2K89A 2W43A 4RNMA 5KT6A 1LV5A 2W7OA 5KFBA 5DG8A 9ICXA 2EZYA 4DFPA 4NL9C 4I2AA 3TADC 4FBTA 3T5KA 1XSLA 4EEYA 3E0FA 4X5VA 3M1YA 4QWEA 2KICA 3NRZA 3C28A 2K4IA 2OHFA 5HC9A 3VCBA 1NK9A 5KAFU 4QZGA 7ICGA 1ZD4A 1T7PA 1PUZA 2PI4A 1WWUA 2V4QA 1ZQKA 4C4TA 4YD1A 4QWCA 4BXOB 4UBCA 3WK7A 3AQLA 4J03A 3FAHA 1XS9D 3WK5A 4F93B 3WK4A 2M2UA 1NI3A 4DEZA 2WTFA 4YN4A 9ICFA 3ZDDA 3ZI4A 3G6YA 2A1AA 3RJFA 3KHHA 3C5FA 2D6FC 2FLPA 3GIIA 1B22A 4UD4A 1PZNA 5DDMA 4Q8FA 2KFNA 2KVCA 4K97A 2G07A 2V9WA 4R64A 7ICVA 2A3VA 2XVTA 4RWOA 5AHXA 1ZQPA 1YLQA 4M2YA 3OGUA 1JROA 2JEFA 2JRZA 4O3NA 2WF5A 1NK5A 4X0BA 3ETRA 5JUMA 5J2KA 3Q8MA 3UMBA 1Z3EB 1T8EA 4DS5A 5B3QA 1BNOA 5AKGA 2E8NA 1RDFA 4F5QA 3KTQA 3UXOA 3AQKA 5GTIU 4AT9A 2E8MA 4I2HA 2KNJA 3PV8A
chains in the Genus database with same CATH topology
3PY8A 4O3QA 2AGQA 1V4AA 4RQ4A 3M8SA 3FDSA 5DB8A 3TARA 5KFMA 5J29A 4LT6A 5DEDA 4RQ3A 3C5GA 3OVSA 2ZH8A 2JEGA 4DFMA 4QWAA 4P4PA 3BQTA 4NM2A 5KFZA 4ECXA 2Y1JA 3M9NB 4PGYA 1QSSA 5IIKA 5J0WA 1S77D 3PNCA 2F1IA 4CCHA 4NLNA 2ATLA 2ZJAA 5D46A 2ZTCA 1PX5A 8ICFA 4FHPA 1Z00B 4RQ1A 2C2DA 3RB3A 4DLGA 1ZQCA 5C5JA 5DG9A 4B9MA 4EBJA 4QWBA 1TFWA 5DLGA 1Z00A 1S0VA 2HVIA 4DQPA 5HRIA 3Q8KA 4J9SA 4E8FA 4DS4A 1K1SA 2JEJA 2PFOA 1TAQA 4RQ7A 5KFDA 1F5AA 3GIJA 4AT7B 4FH3A 4KMUA 1D9FA 1ZQBA 3L9DA 2ZH5A 1ZQTA 8ICOA 3ZDEA 4O0IA 4GLXA 2W9MA 4RT3A 1CUKA 5HP4A 5HHIA 2PXIA 2W9AA 1ZQRA 9ICOA 2FPKA 5J2CA 2XGQA 3RH6A 1V9PA 4F92B 1AROP 2R8IA 3RJEA 4PGXA 5DECA 2O1PA 2M2TA 3RBEA 2Q0ZX 3PX6A 7ICUA 4RT2A 1XO1A 4Q43A 4MEXA 5HREA 3OJUA 2XY6A 2VA2A 3BDPA 4FS1A 3V72A 5J0YA 2BCQA 9ICSA 3MR3A 4NKTA 1VFGA 2R8KA 4IQWA 5L1KA 4RPXA 2NRTA 5TZVA 4IQTA 2BR0A 1L3VA 5DG7A 4B9TA 4BGDA 3V6HA 2AQ4A 3RRGA 5J2JA 4TQRA 3FYHA 2R8HA 5KFAA 8ICHA 1QLNA 3ISDA 4RNNA 1QTMA 4QZDA 1XSPA 2OWOA 1IM4A 4Z6DA 2BCVA 4C8LA 1U47A 4MF2A 4X4SA 3HJ4A 7ICMA 4WC1A 1ZYQA 4FH5A 5L1IA 1UT5A 3RJKA 3OVAA 4GXIA 4KLFA 2AQ0A 3WFOA 4DL5A 2PFQA 4JWMA 3OV7A 1R89A 1ZJNA 1QSYA 4KLIA 2XGPA 1S0NA 3HJ1A 4FHXA 5IIMA 4MFAA 4RNOA 4WC7A 1MSWD 2P6UA 5J0QA 3MGHA 3C2LA 1MIYA 4LZDA 1K1QA 2H5XA 3C2MA 1ZQDA 2IMWP 5DKWA 4M9LA 4R63A 2ZHBA 1SZPA 1TFRA 5IIIA 2XCAA 2W9BB 3V6KA 4ED7A 1T3NA 4UD5A 3EYZA 4KLQA 2ZHAA 2M2VA 2ISOA 2C22A 5DBCA 5KFGA 4ECQA 4KLMA 3PMLA 4P4OA 4DQRA 3TANA 1S97A 1X9MA 2P6RA 3EW9A 5EWGA 1QSLA 3ZDBA 4NKUA 2KZZA 4UB3A 4EZ9A 2ID1A 2W9BA 2DR5A 4PHAA 4S3NA 5DLFA 4WC5A 5DB6A 1U9LA 4J9PA 5HRFA 2F1JA 5CR0A 1BPYA 1OU5A 5KFIA 3GDXA 2HHQA 1DGSA 5F9LA 1ZQUA 1JIHA 5DGBA 4LZGA 4DOAA 4O3PA 4QZAA 1KSPA 2DVIA 4X4TA 8ICGA 3V7JA 3JPPA 2ASDA 1S0MA 4DFKA 5KG3A 1ZQZA 4DL4A 3H39A 3H8SA 4X4OA 3ISCA 3MFHA 4P2HA 5J0RA 3RAQA 1KDHA 5J0SA 7ICOA 1Q78A 3UQ0A 4WC3A 4P4MA 4QZCA 3Q8LA 1S10A 1UT8A 9ICJA 8ICXA 3HX0A 4B9NA 2PFNA 3ZD8A 7ICQA 3H8WA 3OSPA 2W9CB 3H4DA 2AJQA 4J9NA 4RQ6A 3PO4A 4F4KA 4EBKA 4EBCA 2ZH7A 5KFNA 5DB9A 3G6VA 7ICIA 4K4GA 5J0PA 4DQQA 3NTUA 3ISBA 5F2VO 9ICNA 4X4RA 3RJGA 3C1ZA 9ICWA 1MIVA 4YXJA 3C2KA 3OJSA 2W9CA 3RRHA 1BVSA 4WCWA 5KG7A 4UBBA 1JXLA 2KFZA 3T3FA 4QW8A 2FMPA 2B21A 3GV7B 1JQRA 1B22A 5IIJA 3OVBA 3PMNA 2ZH6A 3QZ7A 5DQIA 5KT7A 3OSNA 2UVUA 4QZBA 5CP2A 4M5DA 3E2EA 3SV3A 5HR9A 2FPMA 5CA7A 4F5OA 5KG2A 1JN3A 2NRZA 3PVXA 1SL0A 2IA6A 5KFEA 4UB5A 4R8UB 5J2HA 4ED0A 2P66A 2KP7A 2NRVA 1N48A 2FLNA 4YR3A 3PW2A 3PW7A 1SKWA 3M9OB 4NLKA 4MFCA 4KLTA 4M9GA 2I1QA 5J2AA 9ICMA 4FHWA 3GV5B 3AQMA 3H37A 9ICVA 4I2BA 2ZUCA 5DQGA 3HT3A 2V4RA 1VJ7A 4R8UA 2PBEA 1X9WA 2BKEA 4TUSA 3PR4A 4ELUA 5HHHA 4TQSA 4WC2A 9ICUA 4C8KA 1NK7A 5HRKA 4XUSA 3M9MB 4FS2A 3MBYA 5F9NA 1SL2A 2PFPA 7ICKA 3JPSA 4FBUA 8ICYA 5CWRA 8ICKA 5KFJA 3LWLA 3RB6A 1BPXA 5KG6A 3ZD9A 4DSFA 1NJYA 3AQNA 3LDAA 3RB0A 2BPGA 3JPRA 7ICPA 3GIKA 4RU9A 3KHGA 2ALZA 2R8GA 1S0OA 1NZPA 1UA1A 1Y88A 4X4NA 4M04A 4C8NA 3MR5A 8ICVA 4I2EA 4PH5A 3BQ0A 7ICTA 1ZQEA 4F4WA 1KTQA 4EBEA 9ICKA 9ICLA 4YFKA 3ETLA 5HC9A 3PW4A 5IILA 4AT7A 3C1YA 1MQ2A 4I29A 4I2DA 1BPZA 4KN7A 4F8RA 1NOMA 2HHVA 4YQWA 4DO9A 4MEYA 2KN7A 1ZQSA 9ICHA 3JPTA 1R8BA 4WBZA 1T4GA 5KFOA 3PW0A 4NXZA 4YMOA 3V7KA 1N56A 2ZJ8A 1IXRA 5L9XA 5KFUA 9ICCA 2FPLA 1U49A 1ZQQA 5HRHA 4ECWA 1JAJA 1BGXT 3SV4A 1H38A 1ZQXA 5BPCA 1BPDA 1KRPA 4J9KA 1JMSA 4ELTA 8ICMA 7ICLA 4C8MA 3EZ5A 2HHTA 3RB4A 3H4BA 3V6JA 8ICZA 1SL1A 3T5HA 1RYRA 3JZ0A 2ZH2A 4ED6A 4J9LA 4RQ2A 4O5EA 2FMQA 4EBDA 5EWEA 5IINA 4DSEA 3Q8SB 4RZRA 1BPEA 5J2BA 4ELVA 5J2IA 3TFSA 3N97B 3QEBZ 4KN4A 7ICSA 5J2EA 4I2GA 2J6UA 3UXNA 2AGPA 3WFPA 7ICEA 3M8RA 4F2RA 4B9VA 2RDIA 2XC9A 4Z6EA 2KZMA 4JV0A 4YP3A 4TURA 1SKSA 1ZQYA 2PI5A 1CEZA 5CB1A 3RH5A 5HRDA 1KEJA 4YR2A 5HMLA 3QZ8A 4J9MA 4O3RA 3AUOA 3JPOA 4F4XA 1TAUA 1FA0A 4FHYA 4ECYA 9ICEA 5DBAA 2ZUBA 2J6TA 4DOBA 1NKCA 4KITB 4E7XA 4UB1A 4DF8A 4LVSA 4DSKA 3GILA 1DK2A 4YCXA 4M9HA 4RWQA 4DFJA 5DGAA 2MUTB 3Q8RB 4B9LA 1MIWA 2HHSA 2KZ3A 4TUPA 1NK4A 2M2WA 5HRLA 3BJYA 4I28A 5J0TA 3MABA 1D8LA 3THVA 3GV8B 4B9SA 2JZBB 2NRXA 5KFPA 1L3SA 1UEVA 2Y1IA 2Q66A 5L1LA 2MUTA 2ZH1A 1XU4A 2XCPA 5IIOA 3Q8PB 3TQ1A 4ECTA 7ICFA 9ICAA 3TAPA 4YG2A 2FLLA 4I2CA 4I2IA 4XRHA 4F5PA 2JZBA 2AU0A 2GWSA 1BNPA 1KFTA 1U45A 8ICPA 3EPGA 4UAZA 2C2EA 4XQ7A 1SKRA 3RJIA 3IHQB 2XY5A 4Q44A 3RBDA 2HHUA 1NK0A 2DR8A 3GFKB 1A77A 1TK0A 4DQSA 1X9SA 5KFRA 4QW9A 1ZQLA 2HVHA 4IRDA 4ECZA 4BWMA 1TK5A 4JK1A 4MFFA 8ICBA 9ICPA 4DL7A 1EXNA 2ASJA 4PHDA 3N4MB 4TUQA 5D49A 3MR2A 4IR9A 5KFKA 2RFFA 2BPCA 2ZTDA 2DPJA 4WC0A 4X0AA 2ZH4A 2VANA 1L5UA 1TFYA 5KFSA 4X4VA 1ZJMA 2ZUDA 1KLNA 1MQ3A 4K4HA 4DL3A 2ZH9A 3ORYA 2UVWA 1U48A 2DFLA 3EWAA 4QZ8A 1ZQMA 5CJ7A 4O3SA 4PPXA 3OUYB 1HJPA 5DB7A 1L3TA 2BCRA 4JUZA 4GC6A 3UXPA 4IR1A 5J0OA 1WOTA 5KG5A 3GQCA 4KLGA 2BQRA 2BHNA 4O5CA 5HRGA 3NYBA 1TVAA 4Q45A 3OUYA 4YXMA 1TK8A 1A76A 3V7LA 4RUCA 4R66A 4F50A 4GC7A 5KG4A 3TI0A 3RJHA 3ZDCA 2RDJA 4DSLA 4NM1A 4KLJA 4Q8EA 5BOLA 4DQIA 7ICJA 3K75D 2BGWA 4KLOA 4IG8A 4ECSA 8ICEA 3KHLA 3KHRA 4I27A 5D4BA 4JV2A 5J2DA 3GIMA 3BQ2A 4F3OA 2VA3A 4I2FA 3BQ1A 4DL2A 5KT4A 5HRBA 4IRKA 4R65A 3C18A 3H7IA 3IM1A 5KFYA 2O5AA 1ZETA 3HP6A 2C28A 3LWMA 2HW3A 4E80A 4PHEA 4RQ0A 4KLDA 2LYHA 1TV9A 2F1HA 1TKDA 2AGOA 4Z6FA 4UAWA 1UEUA 4MF8A 3PW5A 4EP7A 3PO5A 7ICNA 2NRWA 9ICIA 1Q79A 4AT8B 4B9UA 1ZQHA 4QZFA 4QWDA 2BCSA 1R8AA 1ZQWA 4F4ZA 1R8CA 2DR7A 8ICCA 4EYIB 1BPBA 4ECUA 8ICUA 2ZJ5A 4DSIA 4UQGA 4DOCA 1NJXA 5J2GA 4F5RA 4WC4A 3RR8A 4AT8A 4KLLA 4F5NA 5HNKA 1UA0A 2R8JA 3OHBA 5KFCA 3T5LA 1D9DA 4F4YA 1ZQAA 5KFHA 4EYHB 4BDPA 4DSJA 3H3AA 5KFXA 3PX0A 4YMNA 3PX4A 4O9MA 3QEAZ 4ED3A 4FO6A 4KLHA 3MR6A 5J0UA 3UPQA 1RZTA 3TAQA 8ICNA 1ZQGA 4M9JA 4XA5A 5KFQA 3HIYA 2DPIA 1WCLA 5J2FA 4ED8A 1S9FA 2I9GA 4G3IA 5DBBA 5KT5A 3K4GA 1C7YA 4O5KA 4GXJA 3QE9Y 1ZQJA 4DWIA 1JXEA 4NLZA 4RNMA 1LV5A 5KT6A 2FMSA 8ICWA 2NRKA 3MDCA 1LB2B 2BDPA 4M6WB 4RWNA 5KFBA 5DG8A 1D8YA 9ICXA 5EOZA 2ZTEA 4HYKA 1NK6A 4C8OA 8ICSA 4DFPA 4X4UA 4I2AA 4UD4A 4FBTA 3B0YA 3T5KA 1XSLA 9ICGA 4DL6A 1XWLA 4EEYA 1S76D 3T5JA 4X5VA 9ICTA 4ECRA 4M6WA 3AU2A 5KTQA 3RTVA 3WFSC 4QWEA 2W8KA 4IQVA 4WBYA 2IBKA 3LK9A 2C2RA 1HUOA 4J9QA 5CHGA 4YMMA 3OHAA 1WCNA 4ED1A 3H8JA 5KFTA 1ZQFA 2UVRA 3RR7A 5BOMA 4K4IA 5KFFA 3NGDA 1NK9A 1RYSA 3SYZA 9ICQA 2XY7A 1DK3A 3H38A 4ECVA 2BCUA 4QZHA 4X4PA 3C23A 3HPOA 3MFIA 4XQ8A 5KT2A 4QZGA 3SI8A 1T7PA 7ICGA 4X4QA 5DDYA 2HHPA 2W8LA 2PI4A 1XC9A 8ICLA 2IHMA 2V4QA 3RAXA 4KLSA 1ZQKA 3MDAA 9ICRA 7ICRA 4YD1A 4QWCA 2VA8A 3C21A 4BXOB 4M9NA 4KLUA 4UBCA 4PGQA 3AU6A 4KLEA 1NK8A 4KTQA 8ICRA 3LQCB 9ICBA 2ISPA 3C66A 1L3UA 3H40A 1JX4A 3AQLA 2UVVA 1NKEA 3UPSA 3Q8QB 2KTQA 1XS9D 3JPNA 4F93B 1UETA 4QZ9A 2BQUA 4QZEA 4NLGA 3B0XA 4BXOA 4IRCA 2M2UA 1KNYA 2DRBA 1RXWA 4DEZA 4YVZA 2WTFA 4DF4A 2M9NA 4YN4A 8ICIA 4FHVA 2DRAA 4E0DA 2J6SA 1NO5A 3RH4A 9ICFA 1MC8A 4ZH4A 3ZDDA 7ICHA 4M47A 2XO7A 4RPYA 4DLEA 5KFWA 3UQ2A 5KFLA 3G6YA 2BE3A 3RJFA 1ZQVA 4RPZA 3KHHA 5KT3A 1B43A 5DQHA 5KG0A 4YD2A 3GIIA 3C5FA 1KFSA 1PZNA 1XSNA 5DDMA 2FLPA 4Q8FA 2KFNA 8ICAA 2A1JB 5HMMA 4M0AA 4RQ8A 5KFVA 2V9WA 8ICQA 4R64A 3MGIA 2BQ3A 4EZ6A 8ICJA 2HHWA 1RPLA 3JPQA 7ICVA 4RWOA 4Z6CA 1ZQPA 3RJJA 1HUZA 5J0XA 1NJZA 4F2SA 1YLQA 4M2YA 3TFRA 3OGUA 2A1JA 2JEFA 1X2IA 4O3NA 8ICTA 1ZQIA 3HWTA 1NKBA 3HW8A 3ZDAA 1NK5A 3EPIA 4X0BA 4I2JA 1ZQNA 2HHXA 3JYYA 5JUMA 4RWPA 5J2KA 4YR0A 3Q8MA 3WFRE 2JEIA 4ATBB 3PR5B 4AT9B 1Z3EB 4F91B 1T8EA 4PHPA 4DS5A 1NJWA 1DOQA 1U4BA 1KFDA 1BNOA 2ZH3A 4JWNA 2ASLA 4RQ5A 4J9RA 2BPFA 5L1JA 4RUAA 4J9OA 4F5QA 3KTQA 1COOA 3UXOA 3AQKA 2IHNA 5EWFA 5KG1A 3SZ2A 1RXVA 4UAYA 4AT9A 3G6XA 4ED2A 4IQUA 4JV1A 4ATBA 4O3OA 4UB4A 4UB2A 4WC6A 2DR9A 4BWJA 4QZIA 1ZQOA 4I2HA 3WFQE 4NY8A 2MAXA 3PV8A 4GXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PY8 A;  4O3Q A;  2AGQ A;  1V4A A;  4RQ4 A;  3M8S A;  3FDS A;  5DB8 A;  3TAR A;  5KFM A;  5J29 A;  4LT6 A;  5DED A;  4RQ3 A;  3C5G A;  3OVS A;  2ZH8 A;  2JEG A;  4DFM A;  4QWA A;  4P4P A;  3BQT A;  4NM2 A;  5KFZ A;  4ECX A;  2Y1J A;  3M9N B;  4PGY A;  1QSS A;  5IIK A;  5J0W A;  1S77 D;  3PNC A;  2F1I A;  4CCH A;  4NLN A;  2ATL A;  2ZJA A;  5D46 A;  2ZTC A;  1PX5 A;  8ICF A;  4FHP A;  1Z00 B;  4RQ1 A;  2C2D A;  3RB3 A;  4DLG A;  1ZQC A;  5C5J A;  5DG9 A;  4B9M A;  4EBJ A;  4QWB A;  1TFW A;  5DLG A;  1Z00 A;  1S0V A;  2HVI A;  4DQP A;  5HRI A;  3Q8K A;  4J9S A;  4E8F A;  4DS4 A;  1K1S A;  2JEJ A;  2PFO A;  1TAQ A;  4RQ7 A;  5KFD A;  1F5A A;  3GIJ A;  4AT7 B;  4FH3 A;  4KMU A;  1D9F A;  1ZQB A;  3L9D A;  2ZH5 A;  1ZQT A;  8ICO A;  3ZDE A;  4O0I A;  4GLX A;  2W9M A;  4RT3 A;  1CUK A;  5HP4 A;  5HHI A;  2PXI A;  2W9A A;  1ZQR A;  9ICO A;  2FPK A;  5J2C A;  2XGQ A;  3RH6 A;  1V9P A;  4F92 B;  1ARO P;  2R8I A;  3RJE A;  4PGX A;  5DEC A;  2O1P A;  2M2T A;  3RBE A;  2Q0Z X;  3PX6 A;  7ICU A;  4RT2 A;  1XO1 A;  4Q43 A;  4MEX A;  5HRE A;  3OJU A;  2XY6 A;  2VA2 A;  3BDP A;  4FS1 A;  3V72 A;  5J0Y A;  2BCQ A;  9ICS A;  3MR3 A;  4NKT A;  1VFG A;  2R8K A;  4IQW A;  5L1K A;  4RPX A;  2NRT A;  5TZV A;  4IQT A;  2BR0 A;  1L3V A;  5DG7 A;  4B9T A;  4BGD A;  3V6H A;  2AQ4 A;  3RRG A;  5J2J A;  4TQR A;  3FYH A;  2R8H A;  5KFA A;  8ICH A;  1QLN A;  3ISD A;  4RNN A;  1QTM A;  4QZD A;  1XSP A;  2OWO A;  1IM4 A;  4Z6D A;  2BCV A;  4C8L A;  1U47 A;  4MF2 A;  4X4S A;  3HJ4 A;  7ICM A;  4WC1 A;  1ZYQ A;  4FH5 A;  5L1I A;  1UT5 A;  3RJK A;  3OVA A;  4GXI A;  4KLF A;  2AQ0 A;  3WFO A;  4DL5 A;  2PFQ A;  4JWM A;  3OV7 A;  1R89 A;  1ZJN A;  1QSY A;  4KLI A;  2XGP A;  1S0N A;  3HJ1 A;  4FHX A;  5IIM A;  4MFA A;  4RNO A;  4WC7 A;  1MSW D;  2P6U A;  5J0Q A;  3MGH A;  3C2L A;  1MIY A;  4LZD A;  1K1Q A;  2H5X A;  3C2M A;  1ZQD A;  2IMW P;  5DKW A;  4M9L A;  4R63 A;  2ZHB A;  1SZP A;  1TFR A;  5III A;  2XCA A;  2W9B B;  3V6K A;  4ED7 A;  1T3N A;  4UD5 A;  3EYZ A;  4KLQ A;  2ZHA A;  2M2V A;  2ISO A;  2C22 A;  5DBC A;  5KFG A;  4ECQ A;  4KLM A;  3PML A;  4P4O A;  4DQR A;  3TAN A;  1S97 A;  1X9M A;  2P6R A;  3EW9 A;  5EWG A;  1QSL A;  3ZDB A;  4NKU A;  2KZZ A;  4UB3 A;  4EZ9 A;  2ID1 A;  2W9B A;  2DR5 A;  4PHA A;  4S3N A;  5DLF A;  4WC5 A;  5DB6 A;  1U9L A;  4J9P A;  5HRF A;  2F1J A;  5CR0 A;  1BPY A;  1OU5 A;  5KFI A;  3GDX A;  2HHQ A;  1DGS A;  5F9L A;  1ZQU A;  1JIH A;  5DGB A;  4LZG A;  4DOA A;  4O3P A;  4QZA A;  1KSP A;  2DVI A;  4X4T A;  8ICG A;  3V7J A;  3JPP A;  2ASD A;  1S0M A;  4DFK A;  5KG3 A;  1ZQZ A;  4DL4 A;  3H39 A;  3H8S A;  4X4O A;  3ISC A;  3MFH A;  4P2H A;  5J0R A;  3RAQ A;  1KDH A;  5J0S A;  7ICO A;  1Q78 A;  3UQ0 A;  4WC3 A;  4P4M A;  4QZC A;  3Q8L A;  1S10 A;  1UT8 A;  9ICJ A;  8ICX A;  3HX0 A;  4B9N A;  2PFN A;  3ZD8 A;  7ICQ A;  3H8W A;  3OSP A;  2W9C B;  3H4D A;  2AJQ A;  4J9N A;  4RQ6 A;  3PO4 A;  4F4K A;  4EBK A;  4EBC A;  2ZH7 A;  5KFN A;  5DB9 A;  3G6V A;  7ICI A;  4K4G A;  5J0P A;  4DQQ A;  3NTU A;  3ISB A;  5F2V O;  9ICN A;  4X4R A;  3RJG A;  3C1Z A;  9ICW A;  1MIV A;  4YXJ A;  3C2K A;  3OJS A;  2W9C A;  3RRH A;  1BVS A;  4WCW A;  5KG7 A;  4UBB A;  1JXL A;  2KFZ A;  3T3F A;  4QW8 A;  2FMP A;  2B21 A;  3GV7 B;  1JQR A;  1B22 A;  5IIJ A;  3OVB A;  3PMN A;  2ZH6 A;  3QZ7 A;  5DQI A;  5KT7 A;  3OSN A;  2UVU A;  4QZB A;  5CP2 A;  4M5D A;  3E2E A;  3SV3 A;  5HR9 A;  2FPM A;  5CA7 A;  4F5O A;  5KG2 A;  1JN3 A;  2NRZ A;  3PVX A;  1SL0 A;  2IA6 A;  5KFE A;  4UB5 A;  4R8U B;  5J2H A;  4ED0 A;  2P66 A;  2KP7 A;  2NRV A;  1N48 A;  2FLN A;  4YR3 A;  3PW2 A;  3PW7 A;  1SKW A;  3M9O B;  4NLK A;  4MFC A;  4KLT A;  4M9G A;  2I1Q A;  5J2A A;  9ICM A;  4FHW A;  3GV5 B;  3AQM A;  3H37 A;  9ICV A;  4I2B A;  2ZUC A;  5DQG A;  3HT3 A;  2V4R A;  1VJ7 A;  4R8U A;  2PBE A;  1X9W A;  2BKE A;  4TUS A;  3PR4 A;  4ELU A;  5HHH A;  4TQS A;  4WC2 A;  9ICU A;  4C8K A;  1NK7 A;  5HRK A;  4XUS A;  3M9M B;  4FS2 A;  3MBY A;  5F9N A;  1SL2 A;  2PFP A;  7ICK A;  3JPS A;  4FBU A;  8ICY A;  5CWR A;  8ICK A;  5KFJ A;  3LWL A;  3RB6 A;  1BPX A;  5KG6 A;  3ZD9 A;  4DSF A;  1NJY A;  3AQN A;  3LDA A;  3RB0 A;  2BPG A;  3JPR A;  7ICP A;  3GIK A;  4RU9 A;  3KHG A;  2ALZ A;  2R8G A;  1S0O A;  1NZP A;  1UA1 A;  1Y88 A;  4X4N A;  4M04 A;  4C8N A;  3MR5 A;  8ICV A;  4I2E A;  4PH5 A;  3BQ0 A;  7ICT A;  1ZQE A;  4F4W A;  1KTQ A;  4EBE A;  9ICK A;  9ICL A;  4YFK A;  3ETL A;  5HC9 A;  3PW4 A;  5IIL A;  4AT7 A;  3C1Y A;  1MQ2 A;  4I29 A;  4I2D A;  1BPZ A;  4KN7 A;  4F8R A;  1NOM A;  2HHV A;  4YQW A;  4DO9 A;  4MEY A;  2KN7 A;  1ZQS A;  9ICH A;  3JPT A;  1R8B A;  4WBZ A;  1T4G A;  5KFO A;  3PW0 A;  4NXZ A;  4YMO A;  3V7K A;  1N56 A;  2ZJ8 A;  1IXR A;  5L9X A;  5KFU A;  9ICC A;  2FPL A;  1U49 A;  1ZQQ A;  5HRH A;  4ECW A;  1JAJ A;  1BGX T;  3SV4 A;  1H38 A;  1ZQX A;  5BPC A;  1BPD A;  1KRP A;  4J9K A;  1JMS A;  4ELT A;  8ICM A;  7ICL A;  4C8M A;  3EZ5 A;  2HHT A;  3RB4 A;  3H4B A;  3V6J A;  8ICZ A;  1SL1 A;  3T5H A;  1RYR A;  3JZ0 A;  2ZH2 A;  4ED6 A;  4J9L A;  4RQ2 A;  4O5E A;  2FMQ A;  4EBD A;  5EWE A;  5IIN A;  4DSE A;  3Q8S B;  4RZR A;  1BPE A;  5J2B A;  4ELV A;  5J2I A;  3TFS A;  3N97 B;  3QEB Z;  4KN4 A;  7ICS A;  5J2E A;  4I2G A;  2J6U A;  3UXN A;  2AGP A;  3WFP A;  7ICE A;  3M8R A;  4F2R A;  4B9V A;  2RDI A;  2XC9 A;  4Z6E A;  2KZM A;  4JV0 A;  4YP3 A;  4TUR A;  1SKS A;  1ZQY A;  2PI5 A;  1CEZ A;  5CB1 A;  3RH5 A;  5HRD A;  1KEJ A;  4YR2 A;  5HML A;  3QZ8 A;  4J9M A;  4O3R A;  3AUO A;  3JPO A;  4F4X A;  1TAU A;  1FA0 A;  4FHY A;  4ECY A;  9ICE A;  5DBA A;  2ZUB A;  2J6T A;  4DOB A;  1NKC A;  4KIT B;  4E7X A;  4UB1 A;  4DF8 A;  4LVS A;  4DSK A;  3GIL A;  1DK2 A;  4YCX A;  4M9H A;  4RWQ A;  4DFJ A;  5DGA A;  2MUT B;  3Q8R B;  4B9L A;  1MIW A;  2HHS A;  2KZ3 A;  4TUP A;  1NK4 A;  2M2W A;  5HRL A;  3BJY A;  4I28 A;  5J0T A;  3MAB A;  1D8L A;  3THV A;  3GV8 B;  4B9S A;  2JZB B;  2NRX A;  5KFP A;  1L3S A;  1UEV A;  2Y1I A;  2Q66 A;  5L1L A;  2MUT A;  2ZH1 A;  1XU4 A;  2XCP A;  5IIO A;  3Q8P B;  3TQ1 A;  4ECT A;  7ICF A;  9ICA A;  3TAP A;  4YG2 A;  2FLL A;  4I2C A;  4I2I A;  4XRH A;  4F5P A;  2JZB A;  2AU0 A;  2GWS A;  1BNP A;  1KFT A;  1U45 A;  8ICP A;  3EPG A;  4UAZ A;  2C2E A;  4XQ7 A;  1SKR A;  3RJI A;  3IHQ B;  2XY5 A;  4Q44 A;  3RBD A;  2HHU A;  1NK0 A;  2DR8 A;  3GFK B;  1A77 A;  1TK0 A;  4DQS A;  1X9S A;  5KFR A;  4QW9 A;  1ZQL A;  2HVH A;  4IRD A;  4ECZ A;  4BWM A;  1TK5 A;  4JK1 A;  4MFF A;  8ICB A;  9ICP A;  4DL7 A;  1EXN A;  2ASJ A;  4PHD A;  3N4M B;  4TUQ A;  5D49 A;  3MR2 A;  4IR9 A;  5KFK A;  2RFF A;  2BPC A;  2ZTD A;  2DPJ A;  4WC0 A;  4X0A A;  2ZH4 A;  2VAN A;  1L5U A;  1TFY A;  5KFS A;  4X4V A;  1ZJM A;  2ZUD A;  1KLN A;  1MQ3 A;  4K4H A;  4DL3 A;  2ZH9 A;  3ORY A;  2UVW A;  1U48 A;  2DFL A;  3EWA A;  4QZ8 A;  1ZQM A;  5CJ7 A;  4O3S A;  4PPX A;  3OUY B;  1HJP A;  5DB7 A;  1L3T A;  2BCR A;  4JUZ A;  4GC6 A;  3UXP A;  4IR1 A;  5J0O A;  1WOT A;  5KG5 A;  3GQC A;  4KLG A;  2BQR A;  2BHN A;  4O5C A;  5HRG A;  3NYB A;  1TVA A;  4Q45 A;  3OUY A;  4YXM A;  1TK8 A;  1A76 A;  3V7L A;  4RUC A;  4R66 A;  4F50 A;  4GC7 A;  5KG4 A;  3TI0 A;  3RJH A;  3ZDC A;  2RDJ A;  4DSL A;  4NM1 A;  4KLJ A;  4Q8E A;  5BOL A;  4DQI A;  7ICJ A;  3K75 D;  2BGW A;  4KLO A;  4IG8 A;  4ECS A;  8ICE A;  3KHL A;  3KHR A;  4I27 A;  5D4B A;  4JV2 A;  5J2D A;  3GIM A;  3BQ2 A;  4F3O A;  2VA3 A;  4I2F A;  3BQ1 A;  4DL2 A;  5KT4 A;  5HRB A;  4IRK A;  4R65 A;  3C18 A;  3H7I A;  3IM1 A;  5KFY A;  2O5A A;  1ZET A;  3HP6 A;  2C28 A;  3LWM A;  2HW3 A;  4E80 A;  4PHE A;  4RQ0 A;  4KLD A;  2LYH A;  1TV9 A;  2F1H A;  1TKD A;  2AGO A;  4Z6F A;  4UAW A;  1UEU A;  4MF8 A;  3PW5 A;  4EP7 A;  3PO5 A;  7ICN A;  2NRW A;  9ICI A;  1Q79 A;  4AT8 B;  4B9U A;  1ZQH A;  4QZF A;  4QWD A;  2BCS A;  1R8A A;  1ZQW A;  4F4Z A;  1R8C A;  2DR7 A;  8ICC A;  4EYI B;  1BPB A;  4ECU A;  8ICU A;  2ZJ5 A;  4DSI A;  4UQG A;  4DOC A;  1NJX A;  5J2G A;  4F5R A;  4WC4 A;  3RR8 A;  4AT8 A;  4KLL A;  4F5N A;  5HNK A;  1UA0 A;  2R8J A;  3OHB A;  5KFC A;  3T5L A;  1D9D A;  4F4Y A;  1ZQA A;  5KFH A;  4EYH B;  4BDP A;  4DSJ A;  3H3A A;  5KFX A;  3PX0 A;  4YMN A;  3PX4 A;  4O9M A;  3QEA Z;  4ED3 A;  4FO6 A;  4KLH A;  3MR6 A;  5J0U A;  3UPQ A;  1RZT A;  3TAQ A;  8ICN A;  1ZQG A;  4M9J A;  4XA5 A;  5KFQ A;  3HIY A;  2DPI A;  1WCL A;  5J2F A;  4ED8 A;  1S9F A;  2I9G A;  4G3I A;  5DBB A;  5KT5 A;  3K4G A;  1C7Y A;  4O5K A;  4GXJ A;  3QE9 Y;  1ZQJ A;  4DWI A;  1JXE A;  4NLZ A;  4RNM A;  1LV5 A;  5KT6 A;  2FMS A;  8ICW A;  2NRK A;  3MDC A;  1LB2 B;  2BDP A;  4M6W B;  4RWN A;  5KFB A;  5DG8 A;  1D8Y A;  9ICX A;  5EOZ A;  2ZTE A;  4HYK A;  1NK6 A;  4C8O A;  8ICS A;  4DFP A;  4X4U A;  4I2A A;  4UD4 A;  4FBT A;  3B0Y A;  3T5K A;  1XSL A;  9ICG A;  4DL6 A;  1XWL A;  4EEY A;  1S76 D;  3T5J A;  4X5V A;  9ICT A;  4ECR A;  4M6W A;  3AU2 A;  5KTQ A;  3RTV A;  3WFS C;  4QWE A;  2W8K A;  4IQV A;  4WBY A;  2IBK A;  3LK9 A;  2C2R A;  1HUO A;  4J9Q A;  5CHG A;  4YMM A;  3OHA A;  1WCN A;  4ED1 A;  3H8J A;  5KFT A;  1ZQF A;  2UVR A;  3RR7 A;  5BOM A;  4K4I A;  5KFF A;  3NGD A;  1NK9 A;  1RYS A;  3SYZ A;  9ICQ A;  2XY7 A;  1DK3 A;  3H38 A;  4ECV A;  2BCU A;  4QZH A;  4X4P A;  3C23 A;  3HPO A;  3MFI A;  4XQ8 A;  5KT2 A;  4QZG A;  3SI8 A;  1T7P A;  7ICG A;  4X4Q A;  5DDY A;  2HHP A;  2W8L A;  2PI4 A;  1XC9 A;  8ICL A;  2IHM A;  2V4Q A;  3RAX A;  4KLS A;  1ZQK A;  3MDA A;  9ICR A;  7ICR A;  4YD1 A;  4QWC A;  2VA8 A;  3C21 A;  4BXO B;  4M9N A;  4KLU A;  4UBC A;  4PGQ A;  3AU6 A;  4KLE A;  1NK8 A;  4KTQ A;  8ICR A;  3LQC B;  9ICB A;  2ISP A;  3C66 A;  1L3U A;  3H40 A;  1JX4 A;  3AQL A;  2UVV A;  1NKE A;  3UPS A;  3Q8Q B;  2KTQ A;  1XS9 D;  3JPN A;  4F93 B;  1UET A;  4QZ9 A;  2BQU A;  4QZE A;  4NLG A;  3B0X A;  4BXO A;  4IRC A;  2M2U A;  1KNY A;  2DRB A;  1RXW A;  4DEZ A;  4YVZ A;  2WTF A;  4DF4 A;  2M9N A;  4YN4 A;  8ICI A;  4FHV A;  2DRA A;  4E0D A;  2J6S A;  1NO5 A;  3RH4 A;  9ICF A;  1MC8 A;  4ZH4 A;  3ZDD A;  7ICH A;  4M47 A;  2XO7 A;  4RPY A;  4DLE A;  5KFW A;  3UQ2 A;  5KFL A;  3G6Y A;  2BE3 A;  3RJF A;  1ZQV A;  4RPZ A;  3KHH A;  5KT3 A;  1B43 A;  5DQH A;  5KG0 A;  4YD2 A;  3GII A;  3C5F A;  1KFS A;  1PZN A;  1XSN A;  5DDM A;  2FLP A;  4Q8F A;  2KFN A;  8ICA A;  2A1J B;  5HMM A;  4M0A A;  4RQ8 A;  5KFV A;  2V9W A;  8ICQ A;  4R64 A;  3MGI A;  2BQ3 A;  4EZ6 A;  8ICJ A;  2HHW A;  1RPL A;  3JPQ A;  7ICV A;  4RWO A;  4Z6C A;  1ZQP A;  3RJJ A;  1HUZ A;  5J0X A;  1NJZ A;  4F2S A;  1YLQ A;  4M2Y A;  3TFR A;  3OGU A;  2A1J A;  2JEF A;  1X2I A;  4O3N A;  8ICT A;  1ZQI A;  3HWT A;  1NKB A;  3HW8 A;  3ZDA A;  1NK5 A;  3EPI A;  4X0B A;  4I2J A;  1ZQN A;  2HHX A;  3JYY A;  5JUM A;  4RWP A;  5J2K A;  4YR0 A;  3Q8M A;  3WFR E;  2JEI A;  4ATB B;  3PR5 B;  4AT9 B;  1Z3E B;  4F91 B;  1T8E A;  4PHP A;  4DS5 A;  1NJW A;  1DOQ A;  1U4B A;  1KFD A;  1BNO A;  2ZH3 A;  4JWN A;  2ASL A;  4RQ5 A;  4J9R A;  2BPF A;  5L1J A;  4RUA A;  4J9O A;  4F5Q A;  3KTQ A;  1COO A;  3UXO A;  3AQK A;  2IHN A;  5EWF A;  5KG1 A;  3SZ2 A;  1RXV A;  4UAY A;  4AT9 A;  3G6X A;  4ED2 A;  4IQU A;  4JV1 A;  4ATB A;  4O3O A;  4UB4 A;  4UB2 A;  4WC6 A;  2DR9 A;  4BWJ A;  4QZI A;  1ZQO A;  4I2H A;  3WFQ E;  4NY8 A;  2MAX A;  3PV8 A;  4GXK A; 
#chains in the Genus database with same CATH topology
 1ECW A;  4LT6 A;  1S8O A;  2JEG A;  4QWA A;  1YZ6 A;  4P4P A;  4NM2 A;  4EX7 A;  2Y1J A;  1QSS A;  5IIK A;  5J0W A;  1JI7 A;  1FFV A;  1P7D A;  2ATL A;  2ZJA A;  5ALY A;  4FHP A;  3QXG A;  4DLG A;  4IS7 A;  4B9M A;  4EBJ A;  3N7S C;  1TFW A;  2WF8 A;  1J97 A;  1D9F A;  4FH3 A;  3L9D A;  2W9M A;  2EQY A;  5HHI A;  2VJ4 A;  2W9A A;  1SGG A;  5J2C A;  3RH6 A;  1V9P A;  5DEC A;  2HMX A;  3RBE A;  2Z7J A;  3SEI A;  1ZOL A;  3OJU A;  2XY6 A;  2VA2 A;  2EDU A;  5B66 U;  2BCQ A;  5C0Y A;  2YB4 A;  2BBH A;  4K9B A;  5TZV A;  2AQ4 A;  3RRG A;  3FYH A;  8ICH A;  1QLN A;  4OAH A;  3EUB 2;  5AI0 A;  2OWO A;  1U47 A;  3HJ4 A;  1ZYQ A;  4EEB A;  4RQM A;  1LKY B;  5ALO A;  4DL5 A;  1QSY A;  5IIM A;  5EE1 A;  2RP5 A;  3IV6 A;  3NVY A;  2EH9 A;  5J0Q A;  4CGZ A;  2H5X A;  4M9L A;  4AYB C;  5DKW A;  2ZHB A;  1GO3 F;  4IC9 A;  1TFR A;  2W9B B;  1QQ6 A;  4KLQ A;  2ZHA A;  3O0F A;  5DBC A;  4KLM A;  3TAN A;  1S97 A;  2P6R A;  1QSL A;  3ZDB A;  2KZZ A;  4EZ9 A;  2DR5 A;  4WC5 A;  5DLF A;  3RFA A;  3UM9 A;  1BPY A;  1OU5 A;  1L7P A;  4LZG A;  5DGB A;  1WG8 A;  8ICG A;  3V7J A;  5G5H A;  4DFK A;  1ZQZ A;  3H39 A;  3H8S A;  2YN4 A;  3ISC A;  5J0S A;  7ICO A;  3QUB A;  3PSI A;  4P4M A;  1S10 A;  4OJL A;  1C20 A;  2HOF A;  2WB1 C;  1UQV A;  1PVR A;  3ZD8 A;  3E58 A;  3OSP A;  2W9C B;  3H4D A;  4J9N A;  7ICI A;  5J0P A;  4DQQ A;  5L1M A;  4P0Q B;  2ZIW A;  2KIW A;  5AM4 A;  2FMP A;  4NXV A;  3BZC A;  4NV0 A;  2QLT A;  3WK8 A;  3OSN A;  3BS5 A;  5CP2 A;  3E2E A;  3SV3 A;  5EE0 A;  5CA7 A;  4F5O A;  3PVX A;  4UB5 A;  2P66 A;  2KP7 A;  4NLK A;  4FHW A;  2DKZ A;  9ICV A;  1LVH A;  4I2B A;  3HT3 A;  5AKL A;  2JXJ A;  3MBY A;  3AQN A;  2O6K A;  2ALZ A;  5CFU A;  2R8G A;  1UA1 A;  4X4N A;  2KSO A;  8ICV A;  2B6G A;  1ZQE A;  4N7R A;  4EBE A;  9ICK A;  9ICL A;  4O6A A;  1PVQ A;  2AH5 A;  5IIL A;  1RQN A;  4F8R A;  4MEY A;  2F44 A;  1KN5 A;  3JPT A;  2MSN A;  4QJF B;  4NXZ A;  1N56 A;  4CNQ A;  5JTI A;  9ICC A;  2KEY A;  2KHV A;  1ZQQ A;  5HRH A;  3SV4 A;  5BPC A;  1KRP A;  2LHT A;  4J9K A;  4C8M A;  3V6J A;  1X42 A;  1RYR A;  3JZ0 A;  1PK3 A;  2AXT U;  5EWE A;  1SV0 C;  3NVZ A;  1TE2 A;  2OXO A;  5J2I A;  4UB6 U;  3TFS A;  3N97 B;  1IV8 A;  4KM5 A;  5J2E A;  3UXN A;  2AGP A;  2XC9 A;  5AM1 A;  4Z6E A;  2KZM A;  4TUR A;  1ZQY A;  2RQ5 A;  3RH5 A;  4YR2 A;  3QZ8 A;  4J9M A;  4O3R A;  4P0P A;  1KQQ A;  2AHO B;  4E7X A;  4UB1 A;  4DF8 A;  4RWQ A;  4AP9 A;  3Q8R B;  4UAU A;  4XJE A;  2HHS A;  3A0B U;  4I28 A;  5J0T A;  1D8L A;  4B9S A;  2NRX A;  1L3S A;  4PZO A;  2MUT A;  5AIC A;  1SWW A;  3Q8P B;  4ECT A;  2GH1 A;  3QYP A;  2GWS A;  1U45 A;  2C2E A;  2KIV A;  1SKR A;  3J81 j;  3IHQ B;  5ALN A;  2HHU A;  2QAR B;  4OJ5 A;  1X9S A;  1WYG A;  5KFR A;  4ECZ A;  4MFF A;  9ICP A;  5KFK A;  1FEZ A;  5B3P A;  1TFY A;  4X0A A;  5ALG A;  5F3X B;  2ZH9 A;  2WAQ F;  3ORY A;  1U48 A;  1ZQM A;  2G5H B;  3QU2 A;  4FE3 A;  4JUZ A;  4NXX A;  2EAM A;  2HN2 A;  2BQR A;  5HRG A;  3WKB A;  3NYB A;  5JU5 A;  3OUY A;  1V97 A;  2MU2 A;  3ZDC A;  7ICQ A;  5E79 U;  4FH5 A;  5BOL A;  3HRD D;  5D4B A;  3GIM A;  4I2F A;  3BQ1 A;  5AK4 A;  4OCZ A;  1ZET A;  2HW3 A;  2C28 A;  2IOH A;  1XNS A;  4RQ0 A;  4KLD A;  1TV9 A;  1WWV A;  4EP7 A;  2JH7 A;  2QB0 A;  2IUB A;  4QZF A;  2Y0S C;  4OAF A;  1NJX A;  4AT8 A;  4F5N A;  5HNK A;  1UA0 A;  1D9D A;  3HKZ C;  5ALZ A;  4BDP A;  5AI5 A;  2GAF D;  4ED3 A;  3MR6 A;  3UPQ A;  8ICN A;  4LEW A;  3HIY A;  5J2F A;  2I9G A;  2F8L A;  4GXJ A;  5CRX A;  1O08 A;  1LB2 B;  3D2Q A;  1YT3 A;  1D8Y A;  5EOZ A;  4C8O A;  4U7C A;  2KE7 A;  3KKA C;  9ICG A;  4DL6 A;  1XWL A;  2LI6 A;  4ECR A;  3SAG A;  3WFS C;  4IQV A;  4WBY A;  2KVS A;  4J9Q A;  1F5S A;  5CHG A;  4YMM A;  3ER8 C;  1WCN A;  5AIA A;  3RR7 A;  5BOM A;  1F44 A;  3SYZ A;  1DK3 A;  3NAS A;  4ECV A;  3H38 A;  3MFI A;  5KT2 A;  5ALT A;  2W8L A;  3MDA A;  2HSZ A;  2VA8 A;  4M9N A;  3LQC B;  4KLE A;  1NK8 A;  2H3V A;  1L3U A;  5ALW A;  1JX4 A;  2UVV A;  1NKE A;  3Q8Q B;  3QU5 A;  1UET A;  5AK3 A;  4QZ9 A;  2BQU A;  1KNY A;  3B0X A;  1ZD3 A;  2H3F A;  1XO0 A;  2K4E A;  1NO5 A;  2NYV A;  7ICH A;  4ZH4 A;  4BX9 C;  4M47 A;  4RPY A;  5KFW A;  3UQ2 A;  5KFL A;  2BE3 A;  1ZQV A;  4RPZ A;  5DQH A;  5KG0 A;  3H8M A;  4OAG A;  4M0A A;  4RQ8 A;  3MGI A;  3BS7 A;  2BQ3 A;  1RPL A;  3JPQ A;  2DKX A;  4DFD A;  3ALR A;  1X6I A;  1X2I A;  4CF5 A;  5ALR A;  4I2J A;  2W11 A;  3WFR E;  3DV9 A;  2JEI A;  2OM6 A;  4AT9 B;  1DOQ A;  1KFD A;  4NXW A;  4JWN A;  2BPF A;  2JV3 A;  5L1J A;  5CEH A;  1COO A;  5KG1 A;  1RXV A;  4IQU A;  4JV1 A;  4K99 A;  4WC6 A;  1ZQO A;  4NY8 A;  5HRD A;  2F8K A;  1URJ A;  4O3Q A;  1SXD A;  4A8E A;  3FDS A;  5DB8 A;  3TAR A;  2DL0 A;  5J29 A;  4RQ3 A;  5KFZ A;  4UAR A;  4PGY A;  1S77 D;  1ZD2 P;  1N60 A;  2N1R A;  5D46 A;  3PHZ A;  3RB3 A;  5AK6 A;  1ZQC A;  1DXS A;  4WH5 A;  2K60 A;  1S0V A;  5HRI A;  1IG6 A;  1SZH A;  3Q8K A;  4DS4 A;  2JEJ A;  4RQ7 A;  3GIJ A;  4AT7 B;  3QU9 A;  2ZH5 A;  1ZQT A;  4CE6 A;  3CK6 A;  4GLX A;  5HP4 A;  2E1F A;  2PXI A;  2Y9U A;  9ICO A;  4NLB A;  2XGQ A;  4K9A A;  4PGX A;  4NL9 A;  3TAD A;  2Q0Z X;  3WU2 U;  1XO1 A;  4ICA A;  4KX5 A;  4FS1 A;  3V72 A;  1Z19 A;  5J0Y A;  1VFG A;  2R8K A;  3A0H U;  5L1K A;  2BR0 A;  2NRT A;  1L3V A;  5ALI A;  4B9T A;  3V6H A;  2KV2 A;  3ISD A;  4RNN A;  1QTM A;  4QZD A;  1XSP A;  1UHU A;  4C8L A;  4LEY A;  4X4S A;  4WC1 A;  3FM9 A;  5L1I A;  1RG6 A;  4KLF A;  2AQ0 A;  3WFO A;  2NV3 A;  2W04 A;  1R89 A;  1ZJN A;  2XGP A;  4FFD A;  4QIW C;  2WHE A;  3EYZ A;  2M2V A;  4ECQ A;  2KKP A;  3KOO A;  5HRF A;  2F1J A;  5KFI A;  1DGS A;  1ZQU A;  1JIH A;  4EEL A;  4LJX A;  4AYB F;  3N28 A;  5KG3 A;  4DL4 A;  3NVO A;  1A0P A;  2DBY A;  4P2H A;  1Q78 A;  3D2N A;  1UT8 A;  3QNM A;  8ICX A;  3HX0 A;  2PFN A;  2ZIW B;  3H8W A;  2ZH7 A;  5K4L A;  4BUG A;  5DB9 A;  2KG5 A;  4K4G A;  3ISB A;  4X4R A;  1T3Q A;  3BS5 B;  5KG7 A;  1ZRN A;  5AKX A;  2RRD A;  4FZN A;  3OVB A;  2WB1 F;  3T79 A;  3QZ7 A;  2ZH6 A;  4QZB A;  2DUY A;  1JN3 A;  1SL0 A;  2IA6 A;  3HJ1 A;  5KFE A;  2FJ6 A;  2JR5 A;  1N48 A;  3PW2 A;  5AI9 A;  4EEN A;  3M9O B;  9ICM A;  5J2A A;  3M6K A;  2NO5 A;  3GV5 B;  2D8C A;  2YY6 A;  3LVW A;  4PL2 A;  1VJ7 A;  2PBE A;  2YMP A;  2BKE A;  3F2D A;  4TQS A;  9ICU A;  5HRK A;  5F9N A;  2KSO B;  2ZIV A;  2K4H A;  3HIL A;  5KFJ A;  1BPX A;  1Q8K A;  7ICP A;  3GIK A;  4RU9 A;  2HBJ A;  3KHG A;  2HI0 A;  5J8Y C;  1S0O A;  1Y88 A;  2HOI A;  4M04 A;  4C8N A;  3MR5 A;  4K8V A;  1KBU A;  3M6Z A;  2IOF A;  3SR6 A;  4YFK A;  3PW4 A;  1FFU A;  4AT7 A;  4KN7 A;  4RQN A;  1QH9 A;  1T4G A;  3V7K A;  2ZJ8 A;  5ALD A;  5KFU A;  2PMZ C;  1U49 A;  5A0L A;  1BGX T;  1H38 A;  1ZQX A;  4ELT A;  8ICM A;  2VKQ A;  1JMS A;  5AKK A;  3EZ5 A;  2HHT A;  2ZIX B;  3F5E A;  3RB4 A;  4O67 A;  4USA A;  3N7P D;  4FZL A;  2OH2 A;  3T5H A;  2ES6 A;  1QQ5 A;  4ED6 A;  4RQ2 A;  2CRX A;  5ALS A;  4O5E A;  4DSE A;  2RHF A;  5J2B A;  1L8L A;  4KN4 A;  7ICS A;  2J6U A;  3M8R A;  4F2R A;  2RDI A;  1SV4 A;  4P0P B;  3SAF A;  1SKS A;  5ALF A;  2PI5 A;  2KJ8 A;  1CEZ A;  5CB1 A;  1TAU A;  3WKC A;  4FHY A;  5DBA A;  5EE3 A;  2ZUB A;  5AM2 A;  1YZ7 A;  4DFJ A;  2MUT B;  3GU3 A;  2BBJ A;  5ALE A;  2KZ3 A;  1NK4 A;  2L5Y A;  3BJY A;  3MAB A;  3GV8 B;  2Y1I A;  5L1L A;  1XU4 A;  2XCP A;  5IIO A;  9ICA A;  3TAP A;  1Z4O A;  4F5P A;  1L7O A;  2EAN A;  8ICP A;  3EPG A;  2HDO A;  2XY5 A;  2I6X A;  4CRX A;  3GFK B;  4DQS A;  3MCR A;  2FDR A;  2ASJ A;  4TUQ A;  5D49 A;  1MN8 A;  2HOQ A;  4IL6 U;  1RQL A;  5KFS A;  1SXE A;  4X4V A;  1NNL A;  1ZJM A;  1KLN A;  1MQ3 A;  4OAI Z;  3K1Z A;  2VJ5 A;  2JGA A;  3OPX A;  3QX7 A;  4PPX A;  3OUY B;  4GC6 A;  3UXP A;  5J0O A;  4EX6 A;  3GQC A;  4KLG A;  4QNL A;  2BHN A;  4O5C A;  1TVA A;  2PKE A;  4YXM A;  4RUC A;  3V7L A;  4R66 A;  4GC7 A;  4DSL A;  4KLJ A;  2RDJ A;  4Q8E A;  2ZIU A;  7ICJ A;  3KZI U;  5T14 A;  3KHL A;  8ICE A;  4JV2 A;  5J2D A;  3BQ2 A;  2CN1 A;  4UB8 U;  3H7I A;  5KFY A;  4OO1 J;  2QB0 B;  4E80 A;  3LWM A;  2G09 A;  2E5S A;  1TKD A;  2AGO A;  4UAW A;  2EZZ A;  1UEU A;  3PW5 A;  1K5O A;  4AT8 B;  4B9U A;  1R8A A;  1R8C A;  4QWD A;  2DR7 A;  1ZQW A;  3KFU F;  4EYI B;  2ZJ5 A;  4KX3 A;  4UQG A;  4F5R A;  1S5L U;  3RR8 A;  1L6N A;  2E3T A;  1QCK A;  3H3A A;  3QEA Z;  1ZQG A;  4M9J A;  5KFQ A;  1SV0 A;  2DPI A;  1WCL A;  2HBM A;  2Y0S F;  2HBL A;  3K4G A;  3QE9 Y;  1ZQJ A;  5ALH A;  4NLZ A;  1A6S A;  2FMS A;  3MDC A;  2BDP A;  3DEE A;  5KL8 B;  3RF9 A;  4PZN A;  2ZIX A;  2ZTE A;  3HKZ F;  8ICS A;  3MGV A;  4X4U A;  1SIJ A;  3B0Y A;  4B6J A;  1S76 D;  4M6W A;  3AU2 A;  5KTQ A;  3RTV A;  2W8K A;  2FE9 A;  4KMO B;  3LK9 A;  2G0A A;  2C2R A;  1HUO A;  2M0N A;  3OHA A;  4ED1 A;  3H8J A;  5KFT A;  2UVR A;  5AM0 A;  3R9K A;  4K4I A;  5KFF A;  2KK0 A;  3AM9 A;  3NGD A;  2BCU A;  3AEV A;  3C23 A;  3HPO A;  4JMU A;  4XQ8 A;  3SI8 A;  4X4Q A;  2HHP A;  5AM5 A;  1XC9 A;  4KLS A;  2D3D A;  2GA9 D;  9ICR A;  7ICR A;  1J2N A;  4PGQ A;  1B4F A;  3C66 A;  1GPJ A;  1UCV A;  2KTQ A;  2GLE A;  2XID A;  4IRC A;  1RXW A;  3N7R C;  4YVZ A;  4CDG A;  2M9N A;  5KAI U;  4DF4 A;  4FHV A;  2DRA A;  2R18 A;  1L7M A;  3WK6 A;  4DLE A;  3L4P A;  2OCE A;  4F72 A;  5ALQ A;  5KT3 A;  3F2B A;  1XSN A;  8ICA A;  2XIC A;  5KFV A;  4JB3 A;  3TAC B;  8ICJ A;  2HHW A;  2WF7 A;  2DQN B;  2LMR A;  4F2S A;  1HUZ A;  5J0X A;  2A1J A;  2GOL A;  8ICT A;  3IN5 A;  3HWT A;  1NKB A;  3EPI A;  3JYY A;  4RWP A;  4YR0 A;  3I28 A;  3PR5 B;  5EE9 A;  1NJW A;  2I5H A;  2ZH3 A;  1N62 A;  1F0M A;  3D2S A;  4J9R A;  4RUA A;  4J9O A;  2F3N A;  4CF4 A;  2IHN A;  5EWF A;  3SZ2 A;  4ATB A;  3G6X A;  4ED2 A;  3SMV A;  4US9 A;  4UB4 A;  4Y2T A;  3WFQ E;  4QZI A;  3JCF A;  2MAX A;  4GXK A;  3PY8 A;  2AGQ A;  3M8S A;  5KFM A;  5G5G A;  1N5W A;  3C5G A;  1SB3 C;  4DFM A;  3BQT A;  1M6Y A;  2KJ9 A;  5CFS A;  2W7P A;  3PNC A;  2F1I A;  3SD7 A;  1KW4 A;  8ICF A;  4RQ1 A;  2C2D A;  1FO4 A;  3SAH A;  5C5J A;  2MRL A;  5DG9 A;  4NXU A;  2EWR A;  5DLG A;  1Z00 A;  4LEZ A;  2ZXH A;  4J9S A;  4E8F A;  3VC8 A;  5KFD A;  1F5A A;  4KMU A;  4Y2Y A;  1L7N A;  4O0I A;  4RT3 A;  1CUK A;  3ONN A;  1ZQR A;  2G08 A;  3D6J A;  2FPK A;  1ARO P;  2O1P A;  2M2T A;  1WUD A;  3KKA A;  2W54 A;  7ICU A;  4Q43 A;  1Z1B A;  3LVV A;  5HR7 A;  5HRE A;  2IHO A;  3BDP A;  3MR3 A;  4NKT A;  4IQW A;  3HJE A;  4NXT A;  4BGD A;  5J2J A;  4TQR A;  5AIB A;  4Z6D A;  1KKX A;  1MA7 A;  5JRT A;  2EAP A;  1DGJ A;  7ICM A;  1TAM A;  1UT5 A;  2LYA A;  3RJK A;  4GXI A;  3OV7 A;  1OW5 A;  4KLI A;  1S0N A;  4MFA A;  3CNH A;  4RNO A;  1MSW D;  2P6U A;  3NWI A;  1AQ6 A;  4BJQ A;  4WC7 A;  4LZD A;  1K1Q A;  2IMW P;  3GZF A;  4GFJ A;  1X66 A;  4R63 A;  1SZP A;  1L8O A;  5III A;  2XCA A;  4UD5 A;  5D61 A;  3F5A A;  5KFG A;  2ODG A;  3PML A;  4DQR A;  1X9M A;  4NKU A;  2KMD A;  5EWG A;  1ZD5 A;  4PHA A;  5DB6 A;  3K7D A;  3GDX A;  2HHQ A;  4QIW F;  2DVI A;  4DOA A;  4QZA A;  3JPP A;  4LEV A;  5J0R A;  3RAQ A;  4QZC A;  3Q8L A;  5AKZ A;  4WJ3 B;  2YQE A;  3OWG A;  3PO4 A;  4F4K A;  4UAT A;  3G6V A;  4HAI A;  2F77 X;  3NTU A;  9ICN A;  4EED A;  4YXJ A;  3C2K A;  3OJS A;  3RRH A;  1BVS A;  4UBB A;  1JXL A;  3DDH A;  5H2F U;  2KFZ A;  3T3F A;  5IIJ A;  4DCC A;  5KT7 A;  3NUQ A;  4M5D A;  2DF4 B;  3ERC C;  3IP4 B;  3ICX A;  5KG2 A;  2NRZ A;  4MKP A;  3UMC A;  1PK1 A;  2NRV A;  4UAS A;  3TKA A;  2FLN A;  4YR3 A;  3PW7 A;  2I1Q A;  2LM4 A;  4Y2J A;  3AQM A;  1QQ7 A;  3H37 A;  1Z1V A;  2ZUC A;  2ZIV B;  1Z4N A;  4R8U A;  1X9W A;  2KKV A;  4TUS A;  4ELU A;  3AQE A;  4G9B A;  1JUD A;  1RM6 C;  1NK7 A;  4C8K A;  5ALL A;  1SL2 A;  2PFP A;  7ICK A;  3JPS A;  4FBU A;  3RB6 A;  3ZD9 A;  4DSF A;  3RB0 A;  3JPR A;  2H3Q A;  4I2E A;  4PH5 A;  4EV6 A;  1X9X A;  3ETL A;  1MQ2 A;  4I29 A;  4I2D A;  2HHV A;  1OUQ A;  2YML A;  4YQW A;  1ZQS A;  1R8B A;  5KFO A;  4Y2P A;  3PW0 A;  4JLX A;  4YMO A;  3QU4 A;  5AKH A;  5L9X A;  2B4V A;  1DRG A;  2E1E A;  2FPL A;  1OXJ A;  1JAJ A;  7ICL A;  3H0R B;  1IIP A;  1CI4 A;  1ZRM A;  3AL0 B;  2YX8 A;  4F71 A;  8ICZ A;  1SL1 A;  3BQ7 A;  4I0U A;  3QUC A;  4J9L A;  4UAV A;  3U26 A;  3ED5 A;  4EBD A;  4NJ8 A;  3Q8S B;  2DGZ A;  3KD3 A;  2PMZ F;  7ICE A;  1V38 A;  3NVV A;  4B9V A;  4YP3 A;  1KEJ A;  3EF2 A;  4OJP A;  4Y2V A;  3AUO A;  1Q3U A;  5ALK A;  4DOB A;  2J6T A;  4KIT B;  3ER9 B;  4LVS A;  5ALX A;  1DK2 A;  4YCX A;  1O03 A;  5DGA A;  1MIW A;  4HX0 A;  4TUP A;  2M2W A;  2LYB A;  3THV A;  1UEV A;  2Q66 A;  5KFP A;  4YG2 A;  2FLL A;  1HIW A;  4I2C A;  4I2I A;  4XRH A;  1BNP A;  2JZB A;  1KFT A;  1VJ5 A;  5ALP A;  1N61 A;  2OEH A;  4Q44 A;  2DR8 A;  1TK0 A;  4IRD A;  8ICB A;  3KZX A;  4BWM A;  1TK5 A;  4EGW A;  2CXY A;  2F76 X;  3N4M B;  3MR2 A;  2B56 A;  2RFF A;  1ZXI A;  2BPC A;  2ZH4 A;  4WC0 A;  4JLZ A;  2ZUD A;  2UVW A;  4K96 A;  4QZ8 A;  1D8B A;  5CJ7 A;  4O3S A;  1HJP A;  3H0L B;  5DB7 A;  4ACO A;  1WOT A;  2ZIU B;  2E8O A;  5ALU A;  1TK8 A;  1A76 A;  4F50 A;  1V85 A;  5KG4 A;  2K4P A;  4KLO A;  2KJ5 A;  2LKY A;  1HEK A;  5J8Y A;  4ECS A;  5GTH U;  4EEK A;  4F3O A;  4MHV A;  2VA3 A;  4DL2 A;  5HRB A;  4IRK A;  5AM3 A;  4US8 A;  3IM1 A;  4R65 A;  2O5A A;  3C18 A;  3HP6 A;  5AI4 A;  2F1H A;  1PVP A;  2JHD A;  5TIS U;  4Y2X A;  1Q79 A;  7ICN A;  5ALJ A;  3WKE A;  2BCS A;  4F4Z A;  4DSI A;  5AKE A;  4FO1 A;  4WC4 A;  2W3R A;  2B0C A;  4Y2R A;  3OHB A;  4F4Y A;  1ZQA A;  4EYH B;  1UPH A;  4YMN A;  4O9M A;  4FO6 A;  5J0U A;  1JRP A;  4XA5 A;  1S9F A;  2CPR A;  4G3I A;  2ZG6 A;  5KT5 A;  4O5K A;  4DWI A;  8ICW A;  2JH1 A;  2NRK A;  4RWN A;  4M6W B;  3L3F X;  1CRX A;  2HBK A;  4HYK A;  2Q4T A;  1NK6 A;  5ALM A;  3QUT A;  5DED A;  4PJ0 U;  2QKQ A;  9ICT A;  1JAL A;  1N2X A;  3T5J A;  2IBK A;  2W03 A;  1ZQF A;  9ICQ A;  1RYS A;  2XY7 A;  4QZH A;  4X4P A;  3C29 A;  5DDY A;  8ICL A;  2IHM A;  3RAX A;  3C21 A;  4KLU A;  8ICR A;  2G5I B;  3AU6 A;  4KTQ A;  9ICB A;  2ISP A;  3H40 A;  3UPS A;  3JPN A;  4NLG A;  4QZE A;  3PST A;  4C4S A;  4BXO A;  2K8A A;  2DRB A;  8ICI A;  4E0D A;  2J6S A;  3RH4 A;  1MC8 A;  3IDW A;  2XO7 A;  3CRX A;  2KD1 A;  2ZH8 A;  1B43 A;  3I76 A;  4YD2 A;  1KFS A;  2A1J B;  5HMM A;  8ICQ A;  4EZ6 A;  4Z6C A;  3RJJ A;  1NJZ A;  4PL1 A;  3TFR A;  3FC4 A;  4ZOH C;  3F2C A;  1ZQI A;  3HW8 A;  3ZDA A;  2G06 A;  1ZQN A;  2HHX A;  2P35 A;  3WKA A;  4ATB B;  4F91 B;  4PHP A;  1U4B A;  2ASL A;  4RQ5 A;  2F2A B;  3AN1 A;  3PSP A;  4C0Z A;  4NWI A;  2K8C B;  3IG8 A;  4UAY A;  4O3O A;  4UB2 A;  2DR9 A;  4C7Z A;  4BWJ A;  1SKW A;  4KLT A;  1V4A A;  4RQ4 A;  3OVS A;  5AKI A;  2WF9 A;  4ECX A;  3M9N B;  4CCH A;  4NLN A;  3CW2 C;  1PX5 A;  2ZTC A;  1N5X A;  1Z00 B;  3B9J A;  3MC1 A;  4U6P A;  2H3Z A;  4QWB A;  3IG5 A;  2HVI A;  4DQP A;  1K1S A;  2PFO A;  1TAQ A;  3PSF A;  1X6J A;  1ZQB A;  3QU7 A;  5AK5 A;  8ICO A;  3ZDE A;  1X40 A;  4OJ6 A;  2Y9T A;  4F92 B;  2R8I A;  3RJE A;  4WQK A;  1J2M A;  4O68 A;  3CP8 A;  3PX6 A;  4RT2 A;  4MEX A;  2MA1 A;  4CF3 A;  9ICS A;  1B0X A;  4RPX A;  4IQT A;  5DG7 A;  2QB1 A;  4C4R A;  2R8H A;  5KFA A;  5KL1 B;  3NVW A;  1IM4 A;  2BCV A;  4MF2 A;  2ZXI A;  2NO4 A;  2YMQ A;  3OVA A;  2PFQ A;  4JWM A;  3IRU A;  4FHX A;  4Y2Q A;  3C2L A;  3MGH A;  1MIY A;  3C2M A;  1ZQD A;  1LKY A;  3V6K A;  4ED7 A;  1T3N A;  1FIQ A;  2ISO A;  2C22 A;  2BDU A;  4P4O A;  3NRW A;  3EW9 A;  3LYS A;  4UB3 A;  2ID1 A;  2W9B A;  2EZX A;  4S3N A;  1U9L A;  4J9P A;  5CR0 A;  5F9L A;  4O3P A;  1KSP A;  5FP0 A;  4X4T A;  1S0M A;  2ASD A;  4X4O A;  3MFH A;  2WF6 A;  2LPE A;  2K8B B;  1KDH A;  3WK9 A;  2W3S A;  3UQ0 A;  4WC3 A;  1NZB A;  9ICJ A;  5KNI A;  4B9N A;  2JMG A;  3SQI A;  2AJQ A;  2GO7 A;  4RQ6 A;  4EBK A;  4EBC A;  5KFN A;  2KHQ A;  5AKY A;  1RYU A;  2WFA A;  5F2V O;  5AKJ A;  3RJG A;  3C1Z A;  9ICW A;  1MIV A;  5HR6 A;  2W9C A;  2HCF A;  4WCW A;  2YTU A;  1COK A;  2ESE A;  5AI8 A;  4QW8 A;  2B21 A;  3GV7 B;  1JQR A;  2YB1 A;  3PMN A;  1PK1 B;  5DQI A;  2UVU A;  4P0Q A;  5HR9 A;  2FPM A;  3OTQ A;  4WOY A;  5JTG A;  4ED0 A;  4R8U B;  5J2H A;  5B5E U;  4MFC A;  4M9G A;  5DQG A;  2V4R A;  5ALV A;  4O3M A;  3PR4 A;  5HHH A;  4WC2 A;  4XUS A;  3M9M B;  4FS2 A;  8ICK A;  8ICY A;  5CWR A;  3LWL A;  5KG6 A;  1NJY A;  2HN1 A;  3LDA A;  2BPG A;  2B51 A;  4OD0 A;  5CHE A;  1NZP A;  3BQ0 A;  7ICT A;  3SEN A;  4F4W A;  1KTQ A;  3UMG A;  1Q3V A;  4O69 A;  3C1Y A;  1BPZ A;  2LM1 A;  1NOM A;  2YMM A;  4DO9 A;  2RLT A;  2KN7 A;  9ICH A;  4WBZ A;  1ED1 A;  4GIB A;  3PZP A;  1IXR A;  3NS1 A;  4ECW A;  4FZM A;  2FI1 A;  1BPD A;  2H3I A;  3H4B A;  1SWV A;  2ZH2 A;  2XI9 A;  2FMQ A;  5IIN A;  4NLC A;  1VLB A;  4RZR A;  1BPE A;  4ELV A;  3I1Y A;  3QEB Z;  1VDV A;  3AQF A;  4I2G A;  3WFP A;  4JV0 A;  3CYM A;  2A19 A;  1N63 A;  5HML A;  1FA0 A;  3JPO A;  4F4X A;  4ECY A;  9ICE A;  2W55 A;  1NKC A;  4DSK A;  3GIL A;  4M9H A;  4B9L A;  5HRL A;  2DWQ A;  2JZB B;  3QUQ A;  2ZH1 A;  3TQ1 A;  7ICF A;  2E8P A;  5D63 A;  3NKU A;  2AU0 A;  4UAZ A;  4XQ7 A;  2WAQ C;  3RJI A;  3RBD A;  1NK0 A;  1A77 A;  1ZQL A;  4QW9 A;  2HVH A;  4JK1 A;  4DL7 A;  1EXN A;  4C80 A;  4PHD A;  4IR9 A;  3WKD A;  2QAR A;  3AMZ A;  2ZTD A;  2DPJ A;  2VAN A;  1L5U A;  2KOB A;  4K4H A;  4DL3 A;  2LBO A;  2DFL A;  3EWA A;  1L3T A;  2BCR A;  3L5K A;  4IR1 A;  5AI6 A;  2VIX A;  5KG5 A;  5D62 A;  5CFT A;  1KL9 A;  3KBB A;  4Q45 A;  3TI0 A;  3RJH A;  4NM1 A;  4DQI A;  3S6J A;  1Q46 A;  3K75 D;  2BGW A;  4IG8 A;  3BZK A;  3KHR A;  4I27 A;  3K1R B;  3M7D A;  5KT4 A;  2BZF A;  3F53 A;  4PHE A;  2LYH A;  2OYY A;  4UW9 A;  4Z6F A;  2EAO A;  4OJO A;  4MF8 A;  3PO5 A;  2NRW A;  9ICI A;  1ZQH A;  1ZQ1 C;  8ICC A;  1BPB A;  4ECU A;  8ICU A;  4DOC A;  5J2G A;  4KLL A;  2R8J A;  4Y2U A;  5KFC A;  3T5L A;  4KB6 A;  4Y2S A;  4K98 A;  5KFH A;  4DSJ A;  5KFX A;  3PX0 A;  3PX4 A;  3H0M B;  4WQL A;  1T94 A;  4KLH A;  1RZT A;  3TAQ A;  4C7Y A;  4ED8 A;  2IOF K;  5DBB A;  1C7Y A;  2FCL A;  1JXE A;  2K89 A;  2W43 A;  4RNM A;  5KT6 A;  1LV5 A;  2W7O A;  5KFB A;  5DG8 A;  9ICX A;  2EZY A;  4DFP A;  4NL9 C;  4I2A A;  3TAD C;  4FBT A;  3T5K A;  1XSL A;  4EEY A;  3E0F A;  4X5V A;  3M1Y A;  4QWE A;  2KIC A;  3NRZ A;  3C28 A;  2K4I A;  2OHF A;  5HC9 A;  3VCB A;  1NK9 A;  5KAF U;  4QZG A;  7ICG A;  1ZD4 A;  1T7P A;  1PUZ A;  2PI4 A;  1WWU A;  2V4Q A;  1ZQK A;  4C4T A;  4YD1 A;  4QWC A;  4BXO B;  4UBC A;  3WK7 A;  3AQL A;  4J03 A;  3FAH A;  1XS9 D;  3WK5 A;  4F93 B;  3WK4 A;  2M2U A;  1NI3 A;  4DEZ A;  2WTF A;  4YN4 A;  9ICF A;  3ZDD A;  3ZI4 A;  3G6Y A;  2A1A A;  3RJF A;  3KHH A;  3C5F A;  2D6F C;  2FLP A;  3GII A;  1B22 A;  4UD4 A;  1PZN A;  5DDM A;  4Q8F A;  2KFN A;  2KVC A;  4K97 A;  2G07 A;  2V9W A;  4R64 A;  7ICV A;  2A3V A;  2XVT A;  4RWO A;  5AHX A;  1ZQP A;  1YLQ A;  4M2Y A;  3OGU A;  1JRO A;  2JEF A;  2JRZ A;  4O3N A;  2WF5 A;  1NK5 A;  4X0B A;  3ETR A;  5JUM A;  5J2K A;  3Q8M A;  3UMB A;  1Z3E B;  1T8E A;  4DS5 A;  5B3Q A;  1BNO A;  5AKG A;  2E8N A;  1RDF A;  4F5Q A;  3KTQ A;  3UXO A;  3AQK A;  5GTI U;  4AT9 A;  2E8M A;  4I2H A;  2KNJ A;  3PV8 A; 
#chains in the Genus database with same CATH homology
 3PY8 A;  4O3Q A;  2AGQ A;  1V4A A;  4RQ4 A;  3M8S A;  3FDS A;  5DB8 A;  3TAR A;  5KFM A;  5J29 A;  4LT6 A;  5DED A;  4RQ3 A;  3C5G A;  3OVS A;  2ZH8 A;  2JEG A;  4DFM A;  4QWA A;  4P4P A;  3BQT A;  4NM2 A;  5KFZ A;  4ECX A;  2Y1J A;  3M9N B;  4PGY A;  1QSS A;  5IIK A;  5J0W A;  1S77 D;  3PNC A;  2F1I A;  4CCH A;  4NLN A;  2ATL A;  2ZJA A;  5D46 A;  2ZTC A;  1PX5 A;  8ICF A;  4FHP A;  1Z00 B;  4RQ1 A;  2C2D A;  3RB3 A;  4DLG A;  1ZQC A;  5C5J A;  5DG9 A;  4B9M A;  4EBJ A;  4QWB A;  1TFW A;  5DLG A;  1Z00 A;  1S0V A;  2HVI A;  4DQP A;  5HRI A;  3Q8K A;  4J9S A;  4E8F A;  4DS4 A;  1K1S A;  2JEJ A;  2PFO A;  1TAQ A;  4RQ7 A;  5KFD A;  1F5A A;  3GIJ A;  4AT7 B;  4FH3 A;  4KMU A;  1D9F A;  1ZQB A;  3L9D A;  2ZH5 A;  1ZQT A;  8ICO A;  3ZDE A;  4O0I A;  4GLX A;  2W9M A;  4RT3 A;  1CUK A;  5HP4 A;  5HHI A;  2PXI A;  2W9A A;  1ZQR A;  9ICO A;  2FPK A;  5J2C A;  2XGQ A;  3RH6 A;  1V9P A;  4F92 B;  1ARO P;  2R8I A;  3RJE A;  4PGX A;  5DEC A;  2O1P A;  2M2T A;  3RBE A;  2Q0Z X;  3PX6 A;  7ICU A;  4RT2 A;  1XO1 A;  4Q43 A;  4MEX A;  5HRE A;  3OJU A;  2XY6 A;  2VA2 A;  3BDP A;  4FS1 A;  3V72 A;  5J0Y A;  2BCQ A;  9ICS A;  3MR3 A;  4NKT A;  1VFG A;  2R8K A;  4IQW A;  5L1K A;  4RPX A;  2NRT A;  5TZV A;  4IQT A;  2BR0 A;  1L3V A;  5DG7 A;  4B9T A;  4BGD A;  3V6H A;  2AQ4 A;  3RRG A;  5J2J A;  4TQR A;  3FYH A;  2R8H A;  5KFA A;  8ICH A;  1QLN A;  3ISD A;  4RNN A;  1QTM A;  4QZD A;  1XSP A;  2OWO A;  1IM4 A;  4Z6D A;  2BCV A;  4C8L A;  1U47 A;  4MF2 A;  4X4S A;  3HJ4 A;  7ICM A;  4WC1 A;  1ZYQ A;  4FH5 A;  5L1I A;  1UT5 A;  3RJK A;  3OVA A;  4GXI A;  4KLF A;  2AQ0 A;  3WFO A;  4DL5 A;  2PFQ A;  4JWM A;  3OV7 A;  1R89 A;  1ZJN A;  1QSY A;  4KLI A;  2XGP A;  1S0N A;  3HJ1 A;  4FHX A;  5IIM A;  4MFA A;  4RNO A;  4WC7 A;  1MSW D;  2P6U A;  5J0Q A;  3MGH A;  3C2L A;  1MIY A;  4LZD A;  1K1Q A;  2H5X A;  3C2M A;  1ZQD A;  2IMW P;  5DKW A;  4M9L A;  4R63 A;  2ZHB A;  1SZP A;  1TFR A;  5III A;  2XCA A;  2W9B B;  3V6K A;  4ED7 A;  1T3N A;  4UD5 A;  3EYZ A;  4KLQ A;  2ZHA A;  2M2V A;  2ISO A;  2C22 A;  5DBC A;  5KFG A;  4ECQ A;  4KLM A;  3PML A;  4P4O A;  4DQR A;  3TAN A;  1S97 A;  1X9M A;  2P6R A;  3EW9 A;  5EWG A;  1QSL A;  3ZDB A;  4NKU A;  2KZZ A;  4UB3 A;  4EZ9 A;  2ID1 A;  2W9B A;  2DR5 A;  4PHA A;  4S3N A;  5DLF A;  4WC5 A;  5DB6 A;  1U9L A;  4J9P A;  5HRF A;  2F1J A;  5CR0 A;  1BPY A;  1OU5 A;  5KFI A;  3GDX A;  2HHQ A;  1DGS A;  5F9L A;  1ZQU A;  1JIH A;  5DGB A;  4LZG A;  4DOA A;  4O3P A;  4QZA A;  1KSP A;  2DVI A;  4X4T A;  8ICG A;  3V7J A;  3JPP A;  2ASD A;  1S0M A;  4DFK A;  5KG3 A;  1ZQZ A;  4DL4 A;  3H39 A;  3H8S A;  4X4O A;  3ISC A;  3MFH A;  4P2H A;  5J0R A;  3RAQ A;  1KDH A;  5J0S A;  7ICO A;  1Q78 A;  3UQ0 A;  4WC3 A;  4P4M A;  4QZC A;  3Q8L A;  1S10 A;  1UT8 A;  9ICJ A;  8ICX A;  3HX0 A;  4B9N A;  2PFN A;  3ZD8 A;  7ICQ A;  3H8W A;  3OSP A;  2W9C B;  3H4D A;  2AJQ A;  4J9N A;  4RQ6 A;  3PO4 A;  4F4K A;  4EBK A;  4EBC A;  2ZH7 A;  5KFN A;  5DB9 A;  3G6V A;  7ICI A;  4K4G A;  5J0P A;  4DQQ A;  3NTU A;  3ISB A;  5F2V O;  9ICN A;  4X4R A;  3RJG A;  3C1Z A;  9ICW A;  1MIV A;  4YXJ A;  3C2K A;  3OJS A;  2W9C A;  3RRH A;  1BVS A;  4WCW A;  5KG7 A;  4UBB A;  1JXL A;  2KFZ A;  3T3F A;  4QW8 A;  2FMP A;  2B21 A;  3GV7 B;  1JQR A;  1B22 A;  5IIJ A;  3OVB A;  3PMN A;  2ZH6 A;  3QZ7 A;  5DQI A;  5KT7 A;  3OSN A;  2UVU A;  4QZB A;  5CP2 A;  4M5D A;  3E2E A;  3SV3 A;  5HR9 A;  2FPM A;  5CA7 A;  4F5O A;  5KG2 A;  1JN3 A;  2NRZ A;  3PVX A;  1SL0 A;  2IA6 A;  5KFE A;  4UB5 A;  4R8U B;  5J2H A;  4ED0 A;  2P66 A;  2KP7 A;  2NRV A;  1N48 A;  2FLN A;  4YR3 A;  3PW2 A;  3PW7 A;  1SKW A;  3M9O B;  4NLK A;  4MFC A;  4KLT A;  4M9G A;  2I1Q A;  5J2A A;  9ICM A;  4FHW A;  3GV5 B;  3AQM A;  3H37 A;  9ICV A;  4I2B A;  2ZUC A;  5DQG A;  3HT3 A;  2V4R A;  1VJ7 A;  4R8U A;  2PBE A;  1X9W A;  2BKE A;  4TUS A;  3PR4 A;  4ELU A;  5HHH A;  4TQS A;  4WC2 A;  9ICU A;  4C8K A;  1NK7 A;  5HRK A;  4XUS A;  3M9M B;  4FS2 A;  3MBY A;  5F9N A;  1SL2 A;  2PFP A;  7ICK A;  3JPS A;  4FBU A;  8ICY A;  5CWR A;  8ICK A;  5KFJ A;  3LWL A;  3RB6 A;  1BPX A;  5KG6 A;  3ZD9 A;  4DSF A;  1NJY A;  3AQN A;  3LDA A;  3RB0 A;  2BPG A;  3JPR A;  7ICP A;  3GIK A;  4RU9 A;  3KHG A;  2ALZ A;  2R8G A;  1S0O A;  1NZP A;  1UA1 A;  1Y88 A;  4X4N A;  4M04 A;  4C8N A;  3MR5 A;  8ICV A;  4I2E A;  4PH5 A;  3BQ0 A;  7ICT A;  1ZQE A;  4F4W A;  1KTQ A;  4EBE A;  9ICK A;  9ICL A;  4YFK A;  3ETL A;  5HC9 A;  3PW4 A;  5IIL A;  4AT7 A;  3C1Y A;  1MQ2 A;  4I29 A;  4I2D A;  1BPZ A;  4KN7 A;  4F8R A;  1NOM A;  2HHV A;  4YQW A;  4DO9 A;  4MEY A;  2KN7 A;  1ZQS A;  9ICH A;  3JPT A;  1R8B A;  4WBZ A;  1T4G A;  5KFO A;  3PW0 A;  4NXZ A;  4YMO A;  3V7K A;  1N56 A;  2ZJ8 A;  1IXR A;  5L9X A;  5KFU A;  9ICC A;  2FPL A;  1U49 A;  1ZQQ A;  5HRH A;  4ECW A;  1JAJ A;  1BGX T;  3SV4 A;  1H38 A;  1ZQX A;  5BPC A;  1BPD A;  1KRP A;  4J9K A;  1JMS A;  4ELT A;  8ICM A;  7ICL A;  4C8M A;  3EZ5 A;  2HHT A;  3RB4 A;  3H4B A;  3V6J A;  8ICZ A;  1SL1 A;  3T5H A;  1RYR A;  3JZ0 A;  2ZH2 A;  4ED6 A;  4J9L A;  4RQ2 A;  4O5E A;  2FMQ A;  4EBD A;  5EWE A;  5IIN A;  4DSE A;  3Q8S B;  4RZR A;  1BPE A;  5J2B A;  4ELV A;  5J2I A;  3TFS A;  3N97 B;  3QEB Z;  4KN4 A;  7ICS A;  5J2E A;  4I2G A;  2J6U A;  3UXN A;  2AGP A;  3WFP A;  7ICE A;  3M8R A;  4F2R A;  4B9V A;  2RDI A;  2XC9 A;  4Z6E A;  2KZM A;  4JV0 A;  4YP3 A;  4TUR A;  1SKS A;  1ZQY A;  2PI5 A;  1CEZ A;  5CB1 A;  3RH5 A;  5HRD A;  1KEJ A;  4YR2 A;  5HML A;  3QZ8 A;  4J9M A;  4O3R A;  3AUO A;  3JPO A;  4F4X A;  1TAU A;  1FA0 A;  4FHY A;  4ECY A;  9ICE A;  5DBA A;  2ZUB A;  2J6T A;  4DOB A;  1NKC A;  4KIT B;  4E7X A;  4UB1 A;  4DF8 A;  4LVS A;  4DSK A;  3GIL A;  1DK2 A;  4YCX A;  4M9H A;  4RWQ A;  4DFJ A;  5DGA A;  2MUT B;  3Q8R B;  4B9L A;  1MIW A;  2HHS A;  2KZ3 A;  4TUP A;  1NK4 A;  2M2W A;  5HRL A;  3BJY A;  4I28 A;  5J0T A;  3MAB A;  1D8L A;  3THV A;  3GV8 B;  4B9S A;  2JZB B;  2NRX A;  5KFP A;  1L3S A;  1UEV A;  2Y1I A;  2Q66 A;  5L1L A;  2MUT A;  2ZH1 A;  1XU4 A;  2XCP A;  5IIO A;  3Q8P B;  3TQ1 A;  4ECT A;  7ICF A;  9ICA A;  3TAP A;  4YG2 A;  2FLL A;  4I2C A;  4I2I A;  4XRH A;  4F5P A;  2JZB A;  2AU0 A;  2GWS A;  1BNP A;  1KFT A;  1U45 A;  8ICP A;  3EPG A;  4UAZ A;  2C2E A;  4XQ7 A;  1SKR A;  3RJI A;  3IHQ B;  2XY5 A;  4Q44 A;  3RBD A;  2HHU A;  1NK0 A;  2DR8 A;  3GFK B;  1A77 A;  1TK0 A;  4DQS A;  1X9S A;  5KFR A;  4QW9 A;  1ZQL A;  2HVH A;  4IRD A;  4ECZ A;  4BWM A;  1TK5 A;  4JK1 A;  4MFF A;  8ICB A;  9ICP A;  4DL7 A;  1EXN A;  2ASJ A;  4PHD A;  3N4M B;  4TUQ A;  5D49 A;  3MR2 A;  4IR9 A;  5KFK A;  2RFF A;  2BPC A;  2ZTD A;  2DPJ A;  4WC0 A;  4X0A A;  2ZH4 A;  2VAN A;  1L5U A;  1TFY A;  5KFS A;  4X4V A;  1ZJM A;  2ZUD A;  1KLN A;  1MQ3 A;  4K4H A;  4DL3 A;  2ZH9 A;  3ORY A;  2UVW A;  1U48 A;  2DFL A;  3EWA A;  4QZ8 A;  1ZQM A;  5CJ7 A;  4O3S A;  4PPX A;  3OUY B;  1HJP A;  5DB7 A;  1L3T A;  2BCR A;  4JUZ A;  4GC6 A;  3UXP A;  4IR1 A;  5J0O A;  1WOT A;  5KG5 A;  3GQC A;  4KLG A;  2BQR A;  2BHN A;  4O5C A;  5HRG A;  3NYB A;  1TVA A;  4Q45 A;  3OUY A;  4YXM A;  1TK8 A;  1A76 A;  3V7L A;  4RUC A;  4R66 A;  4F50 A;  4GC7 A;  5KG4 A;  3TI0 A;  3RJH A;  3ZDC A;  2RDJ A;  4DSL A;  4NM1 A;  4KLJ A;  4Q8E A;  5BOL A;  4DQI A;  7ICJ A;  3K75 D;  2BGW A;  4KLO A;  4IG8 A;  4ECS A;  8ICE A;  3KHL A;  3KHR A;  4I27 A;  5D4B A;  4JV2 A;  5J2D A;  3GIM A;  3BQ2 A;  4F3O A;  2VA3 A;  4I2F A;  3BQ1 A;  4DL2 A;  5KT4 A;  5HRB A;  4IRK A;  4R65 A;  3C18 A;  3H7I A;  3IM1 A;  5KFY A;  2O5A A;  1ZET A;  3HP6 A;  2C28 A;  3LWM A;  2HW3 A;  4E80 A;  4PHE A;  4RQ0 A;  4KLD A;  2LYH A;  1TV9 A;  2F1H A;  1TKD A;  2AGO A;  4Z6F A;  4UAW A;  1UEU A;  4MF8 A;  3PW5 A;  4EP7 A;  3PO5 A;  7ICN A;  2NRW A;  9ICI A;  1Q79 A;  4AT8 B;  4B9U A;  1ZQH A;  4QZF A;  4QWD A;  2BCS A;  1R8A A;  1ZQW A;  4F4Z A;  1R8C A;  2DR7 A;  8ICC A;  4EYI B;  1BPB A;  4ECU A;  8ICU A;  2ZJ5 A;  4DSI A;  4UQG A;  4DOC A;  1NJX A;  5J2G A;  4F5R A;  4WC4 A;  3RR8 A;  4AT8 A;  4KLL A;  4F5N A;  5HNK A;  1UA0 A;  2R8J A;  3OHB A;  5KFC A;  3T5L A;  1D9D A;  4F4Y A;  1ZQA A;  5KFH A;  4EYH B;  4BDP A;  4DSJ A;  3H3A A;  5KFX A;  3PX0 A;  4YMN A;  3PX4 A;  4O9M A;  3QEA Z;  4ED3 A;  4FO6 A;  4KLH A;  3MR6 A;  5J0U A;  3UPQ A;  1RZT A;  3TAQ A;  8ICN A;  1ZQG A;  4M9J A;  4XA5 A;  5KFQ A;  3HIY A;  2DPI A;  1WCL A;  5J2F A;  4ED8 A;  1S9F A;  2I9G A;  4G3I A;  5DBB A;  5KT5 A;  3K4G A;  1C7Y A;  4O5K A;  4GXJ A;  3QE9 Y;  1ZQJ A;  4DWI A;  1JXE A;  4NLZ A;  4RNM A;  1LV5 A;  5KT6 A;  2FMS A;  8ICW A;  2NRK A;  3MDC A;  1LB2 B;  2BDP A;  4M6W B;  4RWN A;  5KFB A;  5DG8 A;  1D8Y A;  9ICX A;  5EOZ A;  2ZTE A;  4HYK A;  1NK6 A;  4C8O A;  8ICS A;  4DFP A;  4X4U A;  4I2A A;  4UD4 A;  4FBT A;  3B0Y A;  3T5K A;  1XSL A;  9ICG A;  4DL6 A;  1XWL A;  4EEY A;  1S76 D;  3T5J A;  4X5V A;  9ICT A;  4ECR A;  4M6W A;  3AU2 A;  5KTQ A;  3RTV A;  3WFS C;  4QWE A;  2W8K A;  4IQV A;  4WBY A;  2IBK A;  3LK9 A;  2C2R A;  1HUO A;  4J9Q A;  5CHG A;  4YMM A;  3OHA A;  1WCN A;  4ED1 A;  3H8J A;  5KFT A;  1ZQF A;  2UVR A;  3RR7 A;  5BOM A;  4K4I A;  5KFF A;  3NGD A;  1NK9 A;  1RYS A;  3SYZ A;  9ICQ A;  2XY7 A;  1DK3 A;  3H38 A;  4ECV A;  2BCU A;  4QZH A;  4X4P A;  3C23 A;  3HPO A;  3MFI A;  4XQ8 A;  5KT2 A;  4QZG A;  3SI8 A;  1T7P A;  7ICG A;  4X4Q A;  5DDY A;  2HHP A;  2W8L A;  2PI4 A;  1XC9 A;  8ICL A;  2IHM A;  2V4Q A;  3RAX A;  4KLS A;  1ZQK A;  3MDA A;  9ICR A;  7ICR A;  4YD1 A;  4QWC A;  2VA8 A;  3C21 A;  4BXO B;  4M9N A;  4KLU A;  4UBC A;  4PGQ A;  3AU6 A;  4KLE A;  1NK8 A;  4KTQ A;  8ICR A;  3LQC B;  9ICB A;  2ISP A;  3C66 A;  1L3U A;  3H40 A;  1JX4 A;  3AQL A;  2UVV A;  1NKE A;  3UPS A;  3Q8Q B;  2KTQ A;  1XS9 D;  3JPN A;  4F93 B;  1UET A;  4QZ9 A;  2BQU A;  4QZE A;  4NLG A;  3B0X A;  4BXO A;  4IRC A;  2M2U A;  1KNY A;  2DRB A;  1RXW A;  4DEZ A;  4YVZ A;  2WTF A;  4DF4 A;  2M9N A;  4YN4 A;  8ICI A;  4FHV A;  2DRA A;  4E0D A;  2J6S A;  1NO5 A;  3RH4 A;  9ICF A;  1MC8 A;  4ZH4 A;  3ZDD A;  7ICH A;  4M47 A;  2XO7 A;  4RPY A;  4DLE A;  5KFW A;  3UQ2 A;  5KFL A;  3G6Y A;  2BE3 A;  3RJF A;  1ZQV A;  4RPZ A;  3KHH A;  5KT3 A;  1B43 A;  5DQH A;  5KG0 A;  4YD2 A;  3GII A;  3C5F A;  1KFS A;  1PZN A;  1XSN A;  5DDM A;  2FLP A;  4Q8F A;  2KFN A;  8ICA A;  2A1J B;  5HMM A;  4M0A A;  4RQ8 A;  5KFV A;  2V9W A;  8ICQ A;  4R64 A;  3MGI A;  2BQ3 A;  4EZ6 A;  8ICJ A;  2HHW A;  1RPL A;  3JPQ A;  7ICV A;  4RWO A;  4Z6C A;  1ZQP A;  3RJJ A;  1HUZ A;  5J0X A;  1NJZ A;  4F2S A;  1YLQ A;  4M2Y A;  3TFR A;  3OGU A;  2A1J A;  2JEF A;  1X2I A;  4O3N A;  8ICT A;  1ZQI A;  3HWT A;  1NKB A;  3HW8 A;  3ZDA A;  1NK5 A;  3EPI A;  4X0B A;  4I2J A;  1ZQN A;  2HHX A;  3JYY A;  5JUM A;  4RWP A;  5J2K A;  4YR0 A;  3Q8M A;  3WFR E;  2JEI A;  4ATB B;  3PR5 B;  4AT9 B;  1Z3E B;  4F91 B;  1T8E A;  4PHP A;  4DS5 A;  1NJW A;  1DOQ A;  1U4B A;  1KFD A;  1BNO A;  2ZH3 A;  4JWN A;  2ASL A;  4RQ5 A;  4J9R A;  2BPF A;  5L1J A;  4RUA A;  4J9O A;  4F5Q A;  3KTQ A;  1COO A;  3UXO A;  3AQK A;  2IHN A;  5EWF A;  5KG1 A;  3SZ2 A;  1RXV A;  4UAY A;  4AT9 A;  3G6X A;  4ED2 A;  4IQU A;  4JV1 A;  4ATB A;  4O3O A;  4UB4 A;  4UB2 A;  4WC6 A;  2DR9 A;  4BWJ A;  4QZI A;  1ZQO A;  4I2H A;  3WFQ E;  4NY8 A;  2MAX A;  3PV8 A;  4GXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...