4PHDA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp and manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
326
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
molecule tags Transferase,lyase/dna
source organism Homo sapiens
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
total genus 105
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phdA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phdA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phdA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phdA03
2W9MA 3Q8PB 2FPLA 1SZPA 2ZH4A 7ICIA 5F2VO 4YP3A 5J2HA 1ZQZA 1XWLA 3EW9A 4EZ6A 4K4HA 4Q8FA 2BDPA 4YN4A 9ICUA 4I2GA 4DSFA 4DEZA 4EYHB 2PBEA 4XQ8A 1BGXT 5CR0A 5J2BA 3MGIA 2W9AA 8ICXA 5KFBA 3V6HA 1UETA 1TFYA 3H39A 4NXZA 4DOCA 2XC9A 2XO7A 5KT6A 1JN3A 4C8LA 4GXKA 2C22A 3UPSA 4JK1A 3NTUA 4O3OA 5F9LA 2JEGA 2PI4A 3SV4A 3UQ2A 4YR0A 3T5KA 4EEYA 4Q44A 3RRHA 4KLJA 3OSNA 2M2VA 5HP4A 3MDAA 4KLTA 4WC3A 7ICNA 4IG8A 2M2TA 1AROP 4RPYA 4DS5A 1RZTA 1SL2A 3PW2A 1ZQJA 4BGDA 1BVSA 5KFOA 4RUCA 4FHXA 4EBJA 4P2HA 4WC4A 4B9NA 4O5KA 5DQHA 4YFKA 2A1JB 5KTQA 3PW4A 1XSNA 1RPLA 2V4RA 4F3OA 5DLFA 4NLKA 3HJ4A 4F93B 2DVIA 1MIWA 3QZ8A 2DR5A 2ZH2A 4NKTA 4C8OA 5KG2A 5DBAA 1SL1A 3G6YA 2ZH6A 1TK0A 2UVRA 3C1ZA 4JV0A 3H38A 3HT3A 2C2DA 2C2RA 2ZUDA 5L9XA 2ISOA 3MFHA 2IHMA 2AGOA 4ATBB 1UT5A 4Z6EA 3EZ5A 2DPJA 2Y1IA 1U48A 3RJKA 2W9CB 2F1JA 4I2EA 4X4VA 2VA3A 4QWCA 4MFFA 3HIYA 3JPRA 4ECSA 1S9FA 4JWNA 2NRVA 1FA0A 1HJPA 4Q45A 2KN7A 4I27A 3QEAZ 7ICSA 3OJUA 9ICBA 4RQ8A 4M47A 4FS1A 4O3NA 3OVSA 4I2CA 1CUKA 3OUYA 4R63A 4EYIB 4FS2A 4ECQA 3RB3A 1NK7A 1MC8A 4UAWA 8ICYA 4XUSA 3KHLA 4F5OA 5HRHA 2KFZA 5DG8A 4YXJA 3GV5B 1JXLA 1HUZA 4KLFA 4RZRA 5J2DA 1LV5A 3ZDBA 3AQLA 1BNPA 5DGBA 2B21A 4QZHA 2BPFA 4ED6A 1RYRA 5L1LA 4UAYA 1NJXA 4IR1A 4M5DA 2PXIA 2HHWA 4YMNA 3PV8A 3FDSA 4FHPA 3H8WA 2FLNA 1RXVA 8ICJA 8ICSA 2MUTB 5HRBA 2NRWA 5CJ7A 4PGQA 3PR5B 4DL2A 4UB1A 4P4OA 1TFWA 5KFZA 5BPCA 8ICEA 2M2UA 1OU5A 3JPTA 5J2FA 4XRHA 2UVVA 2ZJ8A 2BPGA 4IRCA 3C2KA 1S77D 2P66A 4B9UA 9ICXA 3EYZA 4TQSA 4YD1A 3T5LA 3JPSA 7ICHA 1ZQCA 5KFUA 4RQ7A 3OHBA 5HNKA 3MR2A 3C18A 5J0SA 3AQMA 3OV7A 3EPIA 4IQVA 3AU2A 5KFMA 3FYHA 4PHDA 3TFRA 1ZQWA 1ZQGA 4QW8A 4F5PA 2W8LA 1T7PA 4O5CA 4LT6A 1EXNA 3B0XA 3RB4A 1RYSA 5CHGA 4J9KA 2AQ0A 2HHPA 4RWNA 4DF8A 8ICCA 4F4ZA 1QLNA 5KFDA 5DQGA 3JZ0A 3T3FA 3Q8SB 4I28A 8ICIA 8ICLA 3V7KA 4DSKA 2W9CA 9ICNA 1ZQSA 2BGWA 5KFCA 3C2MA 2HVIA 8ICUA 2PFPA 1ZQLA 2ZTDA 1ZQXA 5KFYA 4Z6CA 3BQ2A 2F1HA 2V4QA 3V72A 1RXWA 4F92B 1DK3A 3PW0A 4E7XA 7ICPA 1NKCA 4ECRA 7ICRA 3MBYA 5J2GA 3EWAA 5DB7A 4MEYA 4R65A 4R8UA 4UBCA 3RJIA 9ICPA 4PHAA 4KLGA 4PGXA 2F1IA 3KHHA 1TFRA 5J0QA 1Z00B 4M0AA 1IXRA 1MIYA 2BCRA 1KNYA 4RNOA 2HHTA 3C23A 4QWDA 2ASJA 4LZGA 1JAJA 5HHIA 3ETLA 5TZVA 3RJEA 4XQ7A 4F2SA 1SKSA 4PPXA 4J9SA 5DDYA 4DQQA 3GV7B 4ECXA 8ICRA 2UVUA 4RT3A 3M9MB 2BQ3A 3T5JA 4YG2A 3GILA 4YR3A 5CA7A 3Q8KA 5EOZA 3ZDAA 4KLSA 4M9HA 9ICFA 2ZUBA 4ZH4A 5KT2A 5CB1A 4F4YA 1SKRA 5EWGA 2ZH9A 5D4BA 8ICPA 3OVBA 2PFOA 4G3IA 4F4XA 2ASDA 4KLOA 9ICLA 4QZBA 5HRDA 1UA1A 1NK8A 4DSJA 1ZQVA 5KT4A 4LVSA 1R8BA 4EBKA 3UXNA 3HWTA 1L3UA 1K1QA 2PFQA 1A76A 4AT9B 4JUZA 9ICWA 4BWMA 4ATBA 4O3PA 5J2JA 4Q43A 5HMLA 2BHNA 4J9MA 1Z3EB 5J0YA 4GXJA 2BQUA 1NJZA 1A77A 1MQ3A 4YVZA 1ZQNA 5J0WA 4LZDA 3C2LA 1ZQEA 1UEUA 1D8YA 9ICQA 4DL5A 3PR4A 3GIKA 1BPYA 3THVA 4ECTA 4NY8A 1D9DA 7ICVA 4YMMA 2HW3A 1U4BA 2HHXA 3JYYA 2A1JA 2Y1JA 4KLHA 1NK0A 4X4RA 4UD5A 4RUAA 3JPNA 2NRTA 3KHRA 7ICOA 3WFRE 1L3TA 1IM4A 9ICSA 3RH4A 4DSEA 1BPDA 1C7YA 4F4WA 5EWFA 1XSPA 5IILA 4DFPA 2AU0A 3PX6A 4AT9A 1S97A 2BPCA 4J9LA 2FMSA 5KFVA 4RQ5A 2JEJA 5IIKA 3WFSC 4RQ4A 4X4TA 1D8LA 2Q66A 4ED7A 5KT5A 2V9WA 4B9MA 3LQCB 4WC0A 3G6VA 1L3SA 1ZQOA 4RQ6A 5DB6A 5KG4A 1HUOA 5L1JA 4AT8B 4YMOA 1NK9A 1KTQA 4UB2A 9ICGA 3GFKB 1KLNA 3ISDA 4FO6A 4BXOB 3ZDEA 4X0BA 4Q8EA 4KITB 5KFQA 4KN7A 3HPOA 1KSPA 8ICFA 2NRZA 4DLEA 2J6SA 4QZEA 3L9DA 3PO4A 3RJGA 4QZIA 3BDPA 5EWEA 1WCNA 3MDCA 3QE9Y 4R8UB 2H5XA 3GIJA 3EPGA 4KTQA 9ICKA 5BOLA 4DQPA 3MR5A 4UBBA 4QZFA 3UPQA 5KG7A 5DG9A 4QWAA 4TUQA 2OWOA 1JX4A 5HRKA 4P4PA 4I2FA 3PW5A 4M9GA 5IIOA 2NRKA 1XO1A 1XU4A 4RQ2A 2HVHA 3HJ1A 1JXEA 4DQSA 4RWPA 2IMWP 4I2HA 5J0RA 4PGYA 5J0XA 3SV3A 1U49A 3RR7A 3LDAA 4RNMA 1TAUA 2JZBA 2DRBA 1TV9A 5KFRA 3HW8A 1ZQUA 3MABA 5J0UA 4I2IA 2XGQA 3RJJA 5DEDA 1NOMA 1ZQYA 3ISBA 4DFMA 3K75D 2ZJ5A 2R8GA 2R8JA 8ICGA 4E0DA 4TQRA 1NK4A 1ZQQA 4ECVA 1B43A 2XCAA 4RPZA 3UXPA 3N4MB 4FHVA 1MIVA 4KN4A 2J6TA 4F5RA 4UB3A 1JMSA 4KLMA 3C21A 1XS9D 1X9SA 1JQRA 1UT8A 4ECUA 4KLEA 1X9WA 1YLQA 3RTVA 4QWEA 4J9NA 2IA6A 3N97B 4ED2A 4DFJA 3HP6A 2PFNA 5L1IA 5KFPA 4FH3A 1VFGA 2DR8A 2ZHBA 2JZBB 5DQIA 4MEXA 1L3VA 1QSLA 2IBKA 4B9VA 2BE3A 3TQ1A 5J2KA 4UB5A 4DQIA 3ORYA 3QZ7A 2C28A 2FLLA 4F5NA 4NM1A 4FHYA 7ICJA 2ZJAA 1KEJA 5KG3A 4GC7A 4YD2A 3RH5A 4IRKA 4NLGA 3H37A 2JEIA 2ZH5A 3PX4A 4F8RA 4O3SA 3TAPA 1V9PA 2ALZA 3IHQB 9ICCA 2PI5A 5J2EA 2M9NA 3H7IA 4DFKA 1D9FA 4F5QA 3Q8LA 2HHSA 1LB2B 4M6WA 2MAXA 1KDHA 4QZ8A 1NZPA 4YR2A 1MSWD 1TK8A 2KZZA 4AT7B 4PHEA 5BOMA 4WBYA 4M6WB 3GQCA 5IIJA 2R8IA 1ZQHA 9ICJA 4I2JA 4DF4A 2VANA 4X0AA 2I9GA 4DSIA 4X4SA 1QSYA 3PVXA 1XSLA 1ZQFA 8ICKA 5HREA 4O3RA 5DECA 5J0TA 5L1KA 1XC9A 7ICLA 2XY5A 1ZQAA 4FHWA 5HRLA 2KZ3A 8ICZA 3PMLA 3LWLA 1ZYQA 4JV1A 4GXIA 2DR9A 2DFLA 9ICOA 4E8FA 4X4QA 1ZQBA 4I2BA 3C5FA 2ZTCA 5DGAA 3OJSA 2C2EA 4WCWA 4Z6DA 2BKEA 4R66A 5HMMA 4DLGA 2ZUCA 4PH5A 5F9NA 9ICMA 4WC5A 5KFLA 1T4GA 3SI8A 3TARA 1SL0A 4IQUA 2ID1A 4ELUA 1Z00A 4QZCA 4MFCA 4X4PA 1Q79A 5KFNA 3QEBZ 1TK5A 4KLUA 2R8HA 4J9PA 5IINA 1KFSA 8ICTA 1ZQMA 2GWSA 5D49A 3G6XA 4QZAA 8ICMA 2RFFA 5HRFA 3BQ0A 3OGUA 2I1QA 5KFWA 5KFXA 2BQRA 9ICVA 2RDJA 4C8MA 2BCQA 4DL4A 3TANA 3LK9A 5J0OA 2FPKA 1U45A 1U47A 1ZQDA 3Q8RB 4BDPA 2HHVA 4YQWA 3RBDA 4HYKA 8ICVA 2FPMA 1PZNA 5DLGA 4UB4A 8ICBA 2AJQA 3AU6A 3OUYB 5KFKA 3PMNA 3RBEA 1R8CA 1NK6A 3TI0A 1B22A 1BPEA 5KFFA 5KT7A 2XY6A 1X2IA 3SZ2A 2BCVA 2Q0ZX 4EBDA 4EBEA 1ZQTA 2P6RA 4ECYA 2NRXA 4QZDA 3Q8MA 2VA8A 5KG5A 4DS4A 1N48A 1R89A 4DL6A 4X4OA 7ICGA 5CP2A 3UXOA 5J29A 1QSSA 2VA2A 4QWBA 3PNCA 4M04A 5HRGA 3OVAA 2ZH7A 4X4NA 4IQTA 3RAXA 4X4UA 3MR3A 3KHGA 1TKDA 5KG0A 4K4IA 1WCLA 2BR0A 2O1PA 9ICIA 4J9RA 4B9TA 2MUTA 5KG1A 2LYHA 5KFIA 4C8KA 4DL3A 4C8NA 8ICNA 1NO5A 1JIHA 1ZJNA 4RQ1A 3PY8A 1NJWA 4I2AA 1PX5A 2FMPA 3PX0A 4M9LA 7ICFA 9ICEA 4MF8A 1CEZA 2BCSA 4F2RA 2O5AA 2J6UA 4UAZA 4O9MA 2IHNA 1U9LA 4JWMA 3H3AA 1UA0A 4DQRA 4Z6FA 3M8SA 3V7JA 1S0MA 4ELVA 2ZTEA 4YXMA 3BQ1A 4ELTA 4NM2A 3H40A 4CCHA 7ICUA 3GIMA 3GIIA 5KFGA 4FBTA 1T3NA 1F5AA 4TURA 5HHHA 1ZETA 4RU9A 3H4BA 1BNOA 4S3NA 1BPXA 2KZMA 5HR9A 3WFQE 2BCUA 3WFOA 3PW7A 3RJHA 4BXOA 5C5JA 4RWOA 4ED0A 4RNNA 4DWIA 5IIIA 5KT3A 8ICQA 1ZQIA 4UD4A 4QW9A 1K1SA 8ICOA 3AQKA 3H8JA 4KLIA 1UEVA 4NKUA 4KLDA 1DGSA 4GC6A 4KMUA 2R8KA 1T8EA 9ICTA 5DB8A 5D46A 1DK2A 4B9LA 4EBCA 4FH5A 3H4DA 4RWQA 3ZDDA 5DB9A 1X9MA 2ZH3A 3WFPA 5KFTA 3ZD9A 4O5EA 3OHAA 3E2EA 1VJ7A 2ATLA 3MFIA 4F50A 7ICKA 9ICRA 1R8AA 3Q8QB 3HX0A 2ASLA 4K4GA 4MF2A 5KFHA 4NLZA 5J2AA 5J2CA 3BQTA 3PO5A 4DOAA 1WOTA 4WC2A 1S0OA 1KRPA 3OSPA 3AQNA 2DPIA 5CWRA 3RB6A 2FLPA 3ZDCA 4WC1A 4AT8A 4UQGA 3KTQA 4B9SA 4TUPA 1SKWA 2ISPA 5DBCA 4XA5A 1KFTA 3ZD8A 1Y88A 2AGQA 7ICQA 3MGHA 5KG6A 3BJYA 1H38A 1QTMA 4IRDA 2ZH1A 1BPBA 3RB0A 3RR8A 4JV2A 4NLNA 2HHUA 3C66A 2ZHAA 4ECZA 3H8SA 3LWMA 3C5GA 3T5HA 1S10A 2XGPA 4KLQA 4WC6A 9ICHA 2DRAA 4QZGA 4DSLA 4KLLA 2ZH8A 4O0IA 1S76D 4ED1A 3TFSA 7ICMA 3B0YA 2XY7A 1V4AA 2W9BA 1ZQPA 1ZJMA 3AUOA 4F4KA 3V6JA 2WTFA 4RPXA 4DOBA 5KFSA 4M9JA 3V6KA 2RDIA 4QZ9A 4RQ3A 1KFDA 3M9OB 4ECWA 4ED3A 3RH6A 1NK5A 4IR9A 2M2WA 5HC9A 4PHPA 1Q78A 3GDXA 1MQ2A 4FBUA 4R64A 4WBZA 1S0VA 5DDMA 1N56A 8ICWA 9ICAA 3M9NB 2HHQA 5J2IA 4P4MA 3MR6A 8ICHA 4J9QA 4O3QA 1COOA 4M9NA 2W8KA 4DO9A 1NJYA 2P6UA 5KFAA 3ISCA 5IIMA 4BWJA 3JPQA 2UVWA 4X5VA 3SYZA 4AT7A 1S0NA 3UQ0A 4F91B 3RAQA 3JPPA 1L5UA 5DKWA 2JEFA 2KTQA 1ZQKA 4RQ0A 4I29A 4MFAA 3M8RA 4GLXA 5JUMA 5HRIA 3IM1A 4YCXA 5KFJA 5J0PA 2W9BB 4DL7A 3TAQA 1NKBA 2XCPA 3C1YA 4RT2A 4J9OA 3NYBA 4I2DA 2DR7A 5DBBA 1TAQA 3JPOA 2AQ4A 3K4GA 3RRGA 7ICEA 4E80A 1TVAA 4IQWA 4WC7A 1DOQA 1NKEA 4EP7A 1ZQRA 4TUSA 8ICAA 5KFEA 7ICTA 2FMQA 3GV8B 2KFNA 5DG7A 2KP7A 4EZ9A 1BPZA 3V7LA 4M2YA 3NGDA 3RJFA 4ED8A 2AGPA
chains in the Genus database with same CATH superfamily
2W9MA 1SZPA 5F2VO 5J2HA 4Q8FA 9ICUA 1KL9A 4I2GA 4DEZA 2W43A 4NWIA 1DXSA 1UPHA 3V6HA 1TFYA 4NXZA 4DOCA 2XC9A 4CE6A 2KICA 5KT6A 5F9LA 2JEGA 4EEYA 3RRHA 2JH1A 3MDAA 7ICNA 2M2TA 8ICGA 1RZTA 3HILA 3CNHA 4BGDA 1SWWA 4P2HA 5DQHA 4YFKA 4CDGA 3PW4A 5DLFA 3AM9A 4F93B 4UB6U 4NKTA 3G6YA 3IV6A 3HKZC 4N7RA 2UVRA 3BS7A 2ISOA 2D8CA 2AGOA 3WK6A 5CRXA 4FZMA 2Y1IA 5B66U 2W9CB 4X4VA 2VA3A 4EEDA 1S9FA 1WG8A 4JWNA 1FA0A 3K7DA 3OJUA 4M47A 4FZNA 4I2CA 3OUYA 4FS2A 1MC8A 2WF7A 4XUSA 3SMVA 3DEEA 3NVVA 2W11A 4RZRA 5J2DA 2B21A 2BPFA 3ER8C 4U6PA 2GAFD 1LVHA 4YMNA 1WYGA 2QB0A 3PV8A 1FFUA 3MGVA 3UMCA 2MUTB 4XJEA 2FE9A 1SV0A 2VJ4A 2ZIXB 2LYAA 2ODGA 4B9UA 2B0CA 5HR6A 9ICXA 3JPSA 5AI5A 1ZQCA 1B0XA 3OHBA 2H3FA 3C18A 5J0SA 2PMZF 3OV7A 4OJOA 4K98A 3FYHA 4O5CA 1QQ5A 1T7PA 3NVWA 4C0ZA 2HHPA 4NXTA 4J03A 4F4ZA 4Y2YA 3QXGA 1WUDA 3HRDD 5DQGA 4I28A 2B51A 3V7KA 2W9CA 3QU9A 8ICUA 2HVIA 2PFPA 2FCLA 1Z19A 1ZQLA 2ZTDA 1D8BA 3BQ2A 2F1HA 2V4QA 3V72A 4ECRA 3EWAA 5DB7A 4MEYA 9ICPA 3TACB 4PHAA 1TFRA 4UASA 5JRTA 2DKXA 4M0AA 1MIYA 4LZGA 1JAJA 2WFAA 4NXXA 5DDYA 4DQQA 3GV7B 3U26A 2JHDA 2ZUBA 2HBMA 2KJ8A 1XNSA 8ICPA 3OVBA 4F4XA 2ZIUB 4QZBA 3RFAA 4LVSA 2ZIUA 3UXNA 3HWTA 1A76A 4OAIZ 4JUZA 2HBKA 3QX7A 1Z3EB 5J0YA 1MQ3A 1ZQNA 5AI8A 1D8YA 9ICQA 4NY8A 3QU7A 1KQQA 1U4BA 2HHXA 1L7OA 5EE9A 4UD5A 4RUAA 2RQ5A 3KHRA 5D61A 5ALFA 1C7YA 5EWFA 2HDOA 2BPCA 5KFVA 4ED7A 1LKYB 4YMOA 1KTQA 9ICGA 3SENA 4FO6A 3KFUF 4ZOHC 8ICFA 2J6SA 3HKZF 5EWEA 2G0AA 2H5XA 4KMOB 3GIJA 3WK8A 4QZFA 4TUQA 4KB6A 2OWOA 3BS5A 5HRKA 3HJ1A 1XO1A 1JXEA 5CFTA 2RHFA 3LDAA 2DRBA 1TV9A 5K4LA 1UQVA 1NOMA 3ISBA 2ZJ5A 4LEWA 4TQRA 1NK4A 4ECVA 3BZCA 2XCAA 4RPZA 1JMSA 1X9SA 3MC1A 2CRXA 3BS5B 4QWEA 1DRGA 1RDFA 2IA6A 4ED2A 1NI3A 5ALIA 5AK6A 4UB5A 1GO3F 5KG3A 2JH7A 2QARB 1S5LU 2K8AA 2ALZA 2PI5A 2M9NA 3Q8LA 3M1YA 1OW5A 3A0HU 4QZ8A 1NZPA 4AT7B 2KZZA 4PHEA 2R8IA 1UHUA 4X0AA 2OHFA 3I76A 2FDRA 1CRXA 1FIQA 4O3RA 5J0TA 2Y9UA 2KZ3A 4GXIA 5AKYA 1WWUA 2P35A 1FFVA 4Z6DA 2PKEA 4DLGA 4PH5A 2F76X 1T4GA 4ELUA 1Z00A 4C4RA 4J9PA 1KFSA 8ICTA 1Z1VA 4QZAA 3OGUA 5AKLA 4WQLA 2RDJA 4BDPA 1U45A 3LK9A 1U47A 2FPKA 3RBDA 1Z4NA 4YQWA 5GTHU 4IL6U 1PZNA 3AU6A 5KFKA 1B22A 1BPEA 5KFFA 2BCVA 1TAMA 2XY6A 2Q0ZX 3WKAA 1ZQTA 2F3NA 5B3QA 2NRXA 4QZDA 3Q8MA 5KG5A 1R89A 7ICGA 2VA2A 3UXOA 1QSSA 3QU4A 4OAGA 4IQTA 4K4IA 1TKDA 2O1PA 2BR0A 4K9AA 4OCZA 5KFIA 4C8KA 4DL3A 4C8NA 1NO5A 4Y2TA 4UW9A 4I0UA 1SZHA 3KKAC 1CEZA 2J6UA 2IHNA 2CPRA 3IRUA 4JWMA 1S0MA 4YXMA 4NM2A 1SB3C 5ALRA 5D62A 1ZETA 2KMDA 1BNOA 3H4BA 5HR9A 4NXVA 2BCUA 1J2NA 4RWOA 4ED0A 4DWIA 1N5XA 2G07A 1UEVA 1DGSA 2R8KA 2W54A 1N5WA 1DK2A 1FEZA 4B9LA 3H4DA 4RWQA 3ERCC 3E2EA 2ATLA 7ICKA 9ICRA 4K4GA 3GZFA 4NLZA 2RP5A 5J2CA 4DOAA 5AK3A 5ALVA 3OSPA 2FJ6A 3AQNA 3KZXA 3ZDCA 3KTQA 4TUPA 2ISPA 1KFTA 2AGQA 2B6GA 5KG6A 2ZH1A 4NLNA 4BX9C 2DRAA 4KLLA 2EZYA 4ED1A 3TFSA 4K96A 4M9JA 1TE2A 5AIAA 4QZ9A 4RQ3A 4ED3A 3AN1A 4GFJA 5KAIU 3GDXA 3SD7A 8ICWA 9ICAA 3M9NB 2HHQA 1ZD2P 5J2IA 4P4MA 3MR6A 4J9QA 4FFDA 4DO9A 4WH5A 5IIMA 2UVWA 3UQ0A 3RAQA 3JPPA 2JV3A 3ED5A 3M8RA 5HRIA 4FE3A 2W03A 1TAQA 2AQ4A 7ICEA 3K4GA 2JR5A 4EP7A 1ZQRA 4TUSA 4FO1A 3DDHA 1X42A 2W7PA 2FMQA 2KFNA 3V7LA 3NGDA 3ZDBA 1L8OA 2FPLA 4NL9A 1XWLA 1N60A 4K4HA 2BDPA 4YN4A 2PBEA 2W7OA 1BGXT 2W9AA 2A3VA 4GXKA 3UPSA 4JK1A 3NTUA 4ATBA 2YY6A 3UQ2A 4Q44A 4KLJA 3OSNA 3PSPA 4NJ8A 1PVRA 3D2QA 4RUCA 4P0PB 4WC4A 4O5KA 2A1JB 1XSNA 1RPLA 2V4RA 1YZ6A 3I1YA 1V38A 4NLKA 2DVIA 5ALUA 5KG2A 1SL1A 1RM6C 4C7ZA 2F8LA 2C2DA 2ZUDA 2RRDA 2Y0SC 2DPJA 1U48A 5AICA 1PVPA 2QB0B 3JPRA 1HJPA 3QEAZ 7ICSA 5E79U 3TADC 3PZPA 3ER9B 2K4PA 3OVSA 5G5HA 1NK7A 2ZH9A 4ECQA 3NUQA 8ICYA 3KHLA 2ESEA 4F5OA 2KFZA 3GV5B 1JXLA 1KBUA 5B3PA 2WF8A 1UCVA 1LV5A 5DGBA 5L1LA 3DV9A 4M5DA 4Y2RA 3FDSA 5ALXA 3H8WA 2WHEA 1RXVA 2FLNA 5HRBA 3PR5B 1PVQA 4P4OA 1TFWA 4IC9A 5KFZA 3JPTA 2HN1A 2PMZC 2ZJ8A 2BPGA 2EANA 2P66A 2HBJA 3CW2C 3IP4B 2OYYA 4OJLA 2KJ9A 2GH1A 2KIWA 2YB4A 4IQVA 3TFRA 2LMRA 4QW8A 3RB4A 2XVTA 5KFDA 2E5SA 3Q8SB 5AHXA 8ICLA 2BGWA 3C2MA 5KFYA 4Z6CA 2W04A 2NYVA 7ICPA 1NKCA 7ICRA 4R8UA 4UBCA 3KHHA 2VIXA 1O03A 2HHTA 3C23A 4QWDA 2OM6A 5TZVA 4F2SA 8ICRA 2BQ3A 3M9MB 4NLBA 3GILA 3ZDAA 2XIDA 2DBYA 9ICFA 3IDWA 4ZH4A 5KT2A 1A6SA 1SKRA 5EWGA 5D4BA 2E1FA 2PFOA 1QQ6A 4A8EA 1URJA 2ASDA 4KLOA 5HRDA 4PZNA 4QNLA 1UA1A 4K97A 1NK8A 1ZQVA 1L3UA 4AT9B 4O3PA 4Q43A 2BQUA 5HMLA 2BHNA 1NJZA 2OXOA 3HJEA 4B9MA 1Q78A 4G9BA 5J0WA 1L6NA 5J8YA 3PR4A 2ZXHA 4ECTA 2YTUA 7ICVA 1D9DA 2HW3A 4CNQA 3JYYA 4NL9C 5H2FU 1NK0A 3JPNA 3AEVA 7ICOA 4DSEA 2KHVA 4F4WA 4QIWF 2QKQA 1J97A 2AU0A 1S97A 1D8LA 3QU2A 3G6VA 4UB2A 3GFKB 4BXOB 3EUB2 3KOOA 3HPOA 4KN7A 2NV3A 2IHOA 3PO4A 4KTQA 4R8UB 4C4TA 4Y2UA 4DQPA 3OWGA 4PL1A 4UBBA 3UPQA 5DG9A 4RWPA 4OAFA 4RQ2A 1ECWA 4DQSA 1ZOLA 5J0RA 4PGYA 3SV3A 1U49A 2HOFA 3RR7A 3PHZA 4RNMA 1J2MA 1ZQUA 3MABA 3J81j 2XGQA 1ZQYA 4DFMA 2R8JA 4E0DA 2KE7A 3E58A 3QNMA 1B43A 2JRZA 4FHVA 3N4MB 2AXTU 4ACOA 4KN4A 4EEBA 4KLMA 3D2SA 1XS9D 4UATA 4ECUA 4KLEA 1X9WA 2F44A 5AM3A 5KFPA 4DCCA 1VFGA 3KD3A 2ZHBA 4MEXA 4EELA 5J2KA 4DQIA 4UAVA 4NM1A 7ICJA 2ZJAA 4IRKA 2JEIA 1XO0A 4O3SA 3IHQB 9ICCA 1D9FA 2HHSA 2KD1A 1KDHA 1QQ7A 2KK0A 4YR2A 5AI9A 3GQCA 9ICJA 1ZD4A 2I9GA 4X4SA 2KNJA 3I28A 1XSLA 8ICKA 4O6AA 5DECA 5HRLA 3PMLA 1ZYQA 4JV1A 2DR9A 2K4EA 2DFLA 4CRXA 4E8FA 1Q3UA 1ZQBA 3C5FA 2ZTCA 5DGAA 5AM1A 4R66A 2ZUCA 4WC5A 3SI8A 3ETRA 1SL0A 2ID1A 2KKPA 3AQEA 5KFNA 3QEBZ 4CF5A 1TK5A 2RFFA 8ICMA 5HRFA 1JRPA 5KFWA 9ICVA 4DL4A 5J0OA 1ZQDA 3SQIA 3F2BA 2IOFK 4PJ0U 1KKXA 2E8MA 2DKZA 3OUYB 2YB1A 1R8CA 1NK6A 2KG5A 3TI0A 5KT7A 1ZRMA 4EBEA 3BQ7A 4ECYA 2P6RA 1X6IA 5ALGA 4DS4A 4IS7A 3WK7A 4BUGA 4X4OA 5J29A 4QWBA 1RQNA 4X4NA 3RAXA 1PK1B 3C29A 4B9TA 5KG1A 2LYHA 4Y2QA 4RQ1A 2EDUA 3PY8A 4NV0A 9ICEA 3WK9A 3NVOA 4MF8A 2LBOA 4O9MA 1U9LA 4UB8U 1UA0A 3M8SA 3V7JA 5AK4A 3BQ1A 4ELTA 4CCHA 2OEHA 3QYPA 4FBTA 5HHHA 2HOQA 4S3NA 1KW4A 3WFQE 2B4VA 4BXOA 1Q8KA 4UD4A 8ICQA 1ZQIA 1K1SA 4KLDA 5DB8A 4UARA 2NO5A 3ZDDA 2ZH3A 3WFPA 3Q8QB 4MF2A 5J2AA 4JLXA 3K1RB 2ZG6A 4EV6A 3RB6A 4AT8A 1JROA 2W3RA 3ZD8A 1Y88A 7ICQA 2Q66A 3MGHA 2ZHAA 2KV2A 2XGPA 4WC6A 3QUQA 4QZGA 1X6JA 5CFUA 3WKDA 1N61A 4F4KA 3V6JA 2WTFA 4DOBA 4M04A 3V6KA 3M9OB 5HC9A 4PHPA 4FBUA 3AL0B 5T14A 1A0PA 2BZFA 4OJ6A 1COOA 1JALA 3IG5A 2HN2A 1B4FA 4BWJA 2YMMA 3SYZA 3H0LB 4F91B 1L5UA 2JEFA 4QIWC 2GO7A 2E8PA 4MFAA 5JUMA 4YCXA 5KFJA 3TAQA 4DL7A 2DR7A 3NYBA 3F53A 4RT2A 4AP9A 3RRGA 3NRZA 1TVAA 4WC7A 5AKKA 8ICAA 7ICTA 2KP7A 4EZ9A 4M9NA 2AGPA 3Q8PB 2ZH4A 7ICIA 1ZQZA 3EW9A 3ALRA 2KVCA 4EYHB 1HEKA 4Y2JA 5J2BA 3MGIA 2BBHA 8ICXA 2CN1A 5KFBA 1UETA 1CI4A 1JN3A 2ZIVB 4JV2A 4O3OA 3SV4A 4YR0A 5HP4A 4DS5A 4RPYA 1SL2A 3ONNA 3PW2A 1ZQJA 4LEZA 4B9NA 3WK5A 5KTQA 4F3OA 3HJ4A 1L8LA 2KSOA 1MIWA 3QZ8A 5DBAA 1AQ6A 3C1ZA 4OAHA 1DGJA 3H38A 3HT3A 2C2RA 5L9XA 3L5KA 4OJPA 2IHMA 1VDVA 1UT5A 4Z6EA 3RJKA 2D3DA 4I2EA 2EWRA 2G09A 4QWCA 3GU3A 4ECSA 2NRVA 4Q45A 2KN7A 9ICBA 5AI6A 4FS1A 2KEYA 5AKGA 1CUKA 4R63A 4EYIB 3RB3A 5HRHA 1K5OA 5DG8A 3AQLA 4ED6A 1RYRA 2Z7JA 1NJXA 2YN4A 4LEVA 2PXIA 2HHWA 5TISU 4FHPA 2ZIWA 1Z4OA 3L3FX 2NRWA 1F0MA 1SXDA 2A19A 4WJ3B 2K8BB 3H0MB 2M2UA 1OU5A 5J2FA 2YQEA 2UVVA 1T3QA 3T5LA 2DQNB 7ICHA 1S8OA 5ALDA 3MR2A 3AQMA 4MFCA 4PHDA 5KFMA 1ZQGA 4KLGA 1COKA 4F5PA 2RLTA 1EXNA 3B0XA 4J9KA 2AQ0A 4Y2XA 4RWNA 3B9JA 2DUYA 8ICIA 1QH9A 2EQYA 9ICNA 2ZIXA 3PSFA 1RXWA 3TKAA 1DK3A 2CXYA 1Q46A 2Y0SF 5J2GA 5ALTA 4R65A 3RJIA 5B5EU 3N7RC 3EF2A 1KNYA 2JXJA 4RNOA 2ASJA 5HHIA 5C0YA 3ETLA 3RJEA 1SV4A 4ECXA 1RG6A 3T5JA 3Q8KA 5EOZA 2N1RA 4WOYA 4M9HA 5JTGA 5CB1A 2NO4A 4G3IA 2I5HA 3NASA 9ICLA 3D2NA 5KT4A 4K9BA 3NWIA 1K1QA 4EX7A 4BWMA 5J2JA 4J9MA 4YVZA 1M6YA 3C2LA 1BPYA 5AKIA 4YMMA 2E8NA 5AKJA 2A1JA 2Y1JA 4KLHA 4X4RA 3WFRE 2G5HB 2NRTA 1L3TA 3CRXA 3RH4A 1BPDA 2E8OA 3QUTA 3LYSA 5IILA 3PX6A 3WFSC 3E0FA 4AYBF 4RQ5A 2JEJA 4CF4A 1PK1A 4RQ4A 4WC0A 3LQCB 4LEYA 1L3SA 1JI7A 5KG4A 5L1JA 2HMXA 4X0BA 1KSPA 2NRZA 4RQMA 4DLEA 3L9DA 5AM4A 3ZI4A 2EZXA 3MDCA 1WCNA 3EPGA 1PK3A 3SAGA 1JX4A 4P4PA 3PW5A 2H3VA 3K1ZA 2WB1C 2HVHA 2IMWP 5J0XA 1TAUA 5KFRA 2ZIWB 5J0UA 5DEDA 4I2IA 3NRWA 2R8GA 4UAUA 3M6KA 3UXPA 2J6TA 3C21A 1JQRA 5EE3A 2JGAA 2QLTA 4DFJA 2PFNA 5L1IA 2WAQF 2R18A 5F3XB 2JZBB 3N7SC 1QSLA 4B9VA 1L3VA 2IBKA 2BE3A 2WAQC 1ZD5A 3ORYA 2WF6A 2C28A 4FHYA 4F5NA 4GC7A 3RH5A 4YD2A 1N2XA 2ZH5A 1OUQA 4O3MA 3PX4A 1N62A 3OPXA 3TAPA 5KL1B 4DFKA 3H7IA 4RQNA 3F2DA 1L7MA 2ES6A 1TK8A 5BOMA 4WBYA 1ZQHA 5IIJA 4I2JA 4DF4A 3AMZA 2KKVA 5HREA 7ICLA 2XY5A 1ZQAA 2O6KA 8ICZA 3LWLA 5L1MA 4EENA 9ICOA 3OJSA 2C2EA 2BKEA 4BJQA 5HMMA 3WKCA 4MHVA 5KFLA 2MU2A 4X4PA 1Q79A 1GPJA 2IOHA 2GLEA 2R8HA 3CP8A 1OXJA 2GOLA 2I1QA 5KFXA 2BQRA 4C8MA 2BCQA 3TANA 2HHVA 3Q8RB 5AKHA 2FPMA 5FP0A 3RBEA 3WKEA 2OCEA 1X2IA 2I6XA 2VA8A 4DL6A 3L4PA 2YMQA 4K8VA 9ICIA 2MUTA 2LYBA 1ZJNA 1NJWA 4ICAA 1PX5A 3PX0A 5G5GA 4US8A 2O5AA 4UAZA 3F2CA 3KZIU 3H3AA 2W55A 4Z6FA 2ZTEA 3H40A 1L7NA 3GIMA 5KFGA 3KBBA 3VC8A 3N28A 2YX8A 4RU9A 5AK5A 4NXUA 5C5JA 2WF5A 4RNNA 2E1EA 5IIIA 5KT3A 3AQKA 1ZXIA 3H8JA 1IG6A 1YZ7A 5ALNA 4GC6A 4KMUA 1T8EA 2G5IB 4P0QB 3KKAA 3FM9A 9ICTA 4EBCA 4FH5A 3PSTA 5DB9A 5KFTA 3TADA 3OHAA 1VJ7A 2MRLA 2XICA 1WOTA 1S0OA 1JUDA 2EZZA 5CWRA 2DPIA 4B9SA 1SKWA 5DBCA 4US9A 3BJYA 1QTMA 1X9XA 1BPBA 3RB0A 3RR8A 2HHUA 4ECZA 3C5GA 1S10A 2ZH8A 3QUBA 1S76D 3B0YA 2XY7A 1ZJMA 5KFSA 4ECWA 1KFDA 1NK5A 2M2WA 5AM0A 4R64A 4WBZA 1S0VA 5DDMA 2QARA 1NZBA 2F2AB 4O3QA 2W8KA 1NJYA 5KFAA 3F5EA 1RQLA 4AT7A 2H3QA 1S0NA 2WF9A 4I29A 4GLXA 3T79A 2W9BB 4J9OA 5DBBA 3FC4A 4Y2SA 4IQWA 3H8MA 5KNIA 5KFEA 4LJXA 3GV8B 1O08A 4NXWA 2B56A 1BPZA 3C28A 4M2YA 4P0PA 3R9KA 3AQFA 4JB3A 3NVYA 4YP3A 4EZ6A 2MA1A 4CF3A 1Z1BA 4DSFA 2KHQA 2Y9TA 4XQ8A 5CR0A 3H39A 2F77X 3JCFA 2XO7A 3VCBA 4C8LA 2C22A 5ALOA 5EE0A 2PI4A 3T5KA 4WC3A 2M2VA 4KLTA 4IG8A 1AROP 4EBJA 1BVSA 3M7DA 5KFOA 4FHXA 5GTIU 2F8KA 2LM1A 4CGZA 3SEIA 2DR5A 2ZH2A 5ALSA 4C8OA 5ALZA 2AHOB 2ZH6A 1SXEA 5AIBA 4JV0A 1TK0A 3NS1A 3NKUA 3MFHA 4ATBB 2Q4TA 3EZ5A 4B6JA 2D6FC 2F1JA 3LVWA 4MFFA 3HIYA 5AKXA 4DFDA 5ALYA 4FZLA 4I27A 2XI9A 4RQ8A 5AKZA 4O3NA 1P7DA 4UAWA 5EE1A 4YXJA 1HUZA 4O67A 2K4IA 4KLFA 3ICXA 2EAOA 2L5YA 1BNPA 3WU2U 4QZHA 4C7YA 4UAYA 5ALKA 4IR1A 4HX0A 2HI0A 5AM5A 8ICJA 3QU5A 8ICSA 5CJ7A 4PGQA 4DL2A 5KL8B 4UB1A 5BPCA 8ICEA 4PZOA 4JLZA 2FI1A 4XRHA 2BBJA 4IRCA 3C2KA 1S77D 3EYZA 3M6ZA 3UM9A 4TQSA 4YD1A 2DF4B 5KFUA 2KSOB 4RQ7A 5J8YC 1X66A 5HNKA 3EPIA 3AU2A 8ICOA 3H37A 4LT6A 1ZQWA 2W8LA 1RYSA 5CHGA 3SAFA 4DF8A 8ICCA 1QLNA 3JZ0A 3T3FA 3SR6A 4DSKA 1ZQSA 5KFCA 1ZQXA 4HAIA 3CYMA 4F92B 3PW0A 4E7XA 3MBYA 1ED1A 1SWVA 2HCFA 4PGXA 2F1IA 5J0QA 4USAA 1Z00B 1IXRA 3OTQA 2BCRA 1FO4A 4XQ7A 4OD0A 1SKSA 4PPXA 2M0NA 4J9SA 5ALLA 2UVUA 4OO1J 4RT3A 4YG2A 4YR3A 5CA7A 4KLSA 1SGGA 4MKPA 4EX6A 4F4YA 2E3TA 1L7PA 2H3IA 2HBLA 4DSJA 1R8BA 4EBKA 1F44A 2PFQA 9ICWA 3SAHA 4GXJA 1A77A 4LZDA 1UEUA 1ZQEA 4DL5A 3GIKA 3THVA 1NNLA 2LM4A 2DGZA 2LI6A 1F5SA 3RF9A 1SV0C 4O68A 1IM4A 9ICSA 1XSPA 4DFPA 4AT9A 4J9LA 5A0LA 2FMSA 5IIKA 4X4TA 5KT5A 2V9WA 1N63A 1ZQOA 4RQ6A 2HSZA 5DB6A 1HUOA 4AT8B 2GA9D 1NK9A 5D63A 4AYBC 1KLNA 3ISDA 3ZDEA 4Q8EA 3FAHA 4KITB 5KFQA 5ALJA 4QZEA 2ZXIA 1ZD3A 5ALEA 3RJGA 4QZIA 3BDPA 2G08A 3QE9Y 5AI4A 9ICKA 5BOLA 3MCRA 3MR5A 2HOIA 5KG7A 4QWAA 1Q3VA 4I2FA 4F71A 5IIOA 4M9GA 1XU4A 2NRKA 4I2HA 3NVZA 4C80A 2JZBA 3HW8A 2YMLA 3RJJA 3K75D 1SIJA 1ZQQA 1MIVA 4F72A 5AI0A 4F5RA 4UB3A 5AKEA 1UT8A 1VJ5A 1HIWA 3RTVA 4J9NA 3N97B 3HP6A 1MN8A 2K89A 3WKBA 2DR8A 5DQIA 3A0BU 3TQ1A 3QZ7A 2FLLA 1KEJA 5JU5A 4NLGA 4F8RA 4O69A 1V9PA 1YT3A 2QB1A 2KVSA 5J2EA 4F5QA 1LB2B 4M6WA 1PUZA 2MAXA 2A1AA 1MSWD 4M6WB 2VANA 2VKQA 4DSIA 2JMGA 4EGWA 1QSYA 3PVXA 1ZQFA 3D6JA 5L1KA 1XC9A 4NLCA 4FHWA 1ZRNA 5HR7A 1X40A 4X4QA 3N7PD 4I2BA 4OJ5A 1WWVA 4WCWA 4KM5A 5F9NA 9ICMA 3TARA 4IQUA 4WQKA 4QZCA 4KX5A 4KLUA 4C4SA 5IINA 1ZQMA 2GWSA 2AH5A 5D49A 3G6XA 3BQ0A 2W3SA 2ZIVA 4U7CA 5KAFU 2G06A 8ICVA 4HYKA 1V85A 3IG8A 3S6JA 5DLGA 2AJQA 2IOFA 4UB4A 8ICBA 3PMNA 2KOBA 2EH9A 3SZ2A 4EBDA 5CFSA 4K99A 1N48A 5CP2A 5HRGA 3UMBA 3OVAA 2ZH7A 3PNCA 4X4UA 3MR3A 3KHGA 5KG0A 1WCLA 2MSNA 4J9RA 5ALHA 8ICNA 2LHTA 1JIHA 3LVVA 4I2AA 2FMPA 2YMPA 4M9LA 7ICFA 2BCSA 4F2RA 4JMUA 5ALPA 4DQRA 5ALMA 4ELVA 2DWQA 7ICUA 4GIBA 4QJFB 3GIIA 3CK6A 1T3NA 1F5AA 4TURA 2VJ5A 2KIVA 1BPXA 2KZMA 1IV8A 1V97A 3WFOA 3PW7A 3RJHA 3WK4A 1KN5A 4P0QA 4QW9A 2K4HA 2K8CB 2EAPA 4KLIA 2KJ5A 4NKUA 3O0FA 1ZQ1C 5D46A 1RYUA 3H0RB 2BDUA 1X9MA 3ZD9A 4O5EA 1VLBA 3MFIA 4F50A 1R8AA 3PSIA 3HX0A 2ASLA 5KFHA 3QUCA 3BQTA 3PO5A 1IIPA 4WC2A 4PL2A 1KRPA 5ALQA 4KX3A 2H3ZA 2FLPA 4WC1A 4UQGA 1C20A 2DL0A 5ALWA 4XA5A 5CHEA 2WB1F 1H38A 4IRDA 2K60A 3C66A 4Y2PA 1QCKA 3H8SA 3LWMA 4EEKA 3T5HA 5JTIA 3UMGA 4KLQA 9ICHA 4DSLA 4O0IA 7ICMA 3IN5A 1V4AA 2W9BA 1ZQPA 3AUOA 4RPXA 1YLQA 2RDIA 4FH3A 3RH6A 4IR9A 1MQ2A 1N56A 8ICHA 2OH2A 1LKYA 2P6UA 3ISCA 1T94A 3JPQA 1MA7A 4X5VA 4Y2VA 2LKYA 5AM2A 2EAMA 5CEHA 5DKWA 2KTQA 1ZQKA 4RQ0A 3F5AA 3IM1A 1NKBA 5J0PA 2XCPA 3C1YA 3BZKA 4I2DA 3JPOA 4E80A 2LPEA 1DOQA 1NKEA 2IUBA 5DG7A 3RJFA 4ED8A
chains in the Genus database with same CATH topology
2W9MA 3Q8PB 2FPLA 1SZPA 2ZH4A 7ICIA 5F2VO 4YP3A 5J2HA 1ZQZA 1XWLA 3EW9A 4EZ6A 4K4HA 4Q8FA 2BDPA 4YN4A 9ICUA 4I2GA 4DSFA 4DEZA 4EYHB 2PBEA 4XQ8A 1BGXT 5CR0A 5J2BA 3MGIA 2W9AA 8ICXA 5KFBA 3V6HA 1UETA 1TFYA 3H39A 4NXZA 4DOCA 2XC9A 2XO7A 5KT6A 1JN3A 4C8LA 4GXKA 2C22A 3UPSA 4JK1A 3NTUA 4O3OA 5F9LA 2JEGA 2PI4A 3SV4A 3UQ2A 4YR0A 3T5KA 4EEYA 4Q44A 3RRHA 4KLJA 3OSNA 2M2VA 5HP4A 3MDAA 4KLTA 4WC3A 7ICNA 4IG8A 2M2TA 1AROP 4RPYA 4DS5A 1RZTA 1SL2A 3PW2A 1ZQJA 4BGDA 1BVSA 5KFOA 4RUCA 4FHXA 4EBJA 4P2HA 4WC4A 4B9NA 4O5KA 5DQHA 4YFKA 2A1JB 5KTQA 3PW4A 1XSNA 1RPLA 2V4RA 4F3OA 5DLFA 4NLKA 3HJ4A 4F93B 2DVIA 1MIWA 3QZ8A 2DR5A 2ZH2A 4NKTA 4C8OA 5KG2A 5DBAA 1SL1A 3G6YA 2ZH6A 1TK0A 2UVRA 3C1ZA 4JV0A 3H38A 3HT3A 2C2DA 2C2RA 2ZUDA 5L9XA 2ISOA 3MFHA 2IHMA 2AGOA 4ATBB 1UT5A 4Z6EA 3EZ5A 2DPJA 2Y1IA 1U48A 3RJKA 2W9CB 2F1JA 4I2EA 4X4VA 2VA3A 4QWCA 4MFFA 3HIYA 3JPRA 4ECSA 1S9FA 4JWNA 2NRVA 1FA0A 1HJPA 4Q45A 2KN7A 4I27A 3QEAZ 7ICSA 3OJUA 9ICBA 4RQ8A 4M47A 4FS1A 4O3NA 3OVSA 4I2CA 1CUKA 3OUYA 4R63A 4EYIB 4FS2A 4ECQA 3RB3A 1NK7A 1MC8A 4UAWA 8ICYA 4XUSA 3KHLA 4F5OA 5HRHA 2KFZA 5DG8A 4YXJA 3GV5B 1JXLA 1HUZA 4KLFA 4RZRA 5J2DA 1LV5A 3ZDBA 3AQLA 1BNPA 5DGBA 2B21A 4QZHA 2BPFA 4ED6A 1RYRA 5L1LA 4UAYA 1NJXA 4IR1A 4M5DA 2PXIA 2HHWA 4YMNA 3PV8A 3FDSA 4FHPA 3H8WA 2FLNA 1RXVA 8ICJA 8ICSA 2MUTB 5HRBA 2NRWA 5CJ7A 4PGQA 3PR5B 4DL2A 4UB1A 4P4OA 1TFWA 5KFZA 5BPCA 8ICEA 2M2UA 1OU5A 3JPTA 5J2FA 4XRHA 2UVVA 2ZJ8A 2BPGA 4IRCA 3C2KA 1S77D 2P66A 4B9UA 9ICXA 3EYZA 4TQSA 4YD1A 3T5LA 3JPSA 7ICHA 1ZQCA 5KFUA 4RQ7A 3OHBA 5HNKA 3MR2A 3C18A 5J0SA 3AQMA 3OV7A 3EPIA 4IQVA 3AU2A 5KFMA 3FYHA 4PHDA 3TFRA 1ZQWA 1ZQGA 4QW8A 4F5PA 2W8LA 1T7PA 4O5CA 4LT6A 1EXNA 3B0XA 3RB4A 1RYSA 5CHGA 4J9KA 2AQ0A 2HHPA 4RWNA 4DF8A 8ICCA 4F4ZA 1QLNA 5KFDA 5DQGA 3JZ0A 3T3FA 3Q8SB 4I28A 8ICIA 8ICLA 3V7KA 4DSKA 2W9CA 9ICNA 1ZQSA 2BGWA 5KFCA 3C2MA 2HVIA 8ICUA 2PFPA 1ZQLA 2ZTDA 1ZQXA 5KFYA 4Z6CA 3BQ2A 2F1HA 2V4QA 3V72A 1RXWA 4F92B 1DK3A 3PW0A 4E7XA 7ICPA 1NKCA 4ECRA 7ICRA 3MBYA 5J2GA 3EWAA 5DB7A 4MEYA 4R65A 4R8UA 4UBCA 3RJIA 9ICPA 4PHAA 4KLGA 4PGXA 2F1IA 3KHHA 1TFRA 5J0QA 1Z00B 4M0AA 1IXRA 1MIYA 2BCRA 1KNYA 4RNOA 2HHTA 3C23A 4QWDA 2ASJA 4LZGA 1JAJA 5HHIA 3ETLA 5TZVA 3RJEA 4XQ7A 4F2SA 1SKSA 4PPXA 4J9SA 5DDYA 4DQQA 3GV7B 4ECXA 8ICRA 2UVUA 4RT3A 3M9MB 2BQ3A 3T5JA 4YG2A 3GILA 4YR3A 5CA7A 3Q8KA 5EOZA 3ZDAA 4KLSA 4M9HA 9ICFA 2ZUBA 4ZH4A 5KT2A 5CB1A 4F4YA 1SKRA 5EWGA 2ZH9A 5D4BA 8ICPA 3OVBA 2PFOA 4G3IA 4F4XA 2ASDA 4KLOA 9ICLA 4QZBA 5HRDA 1UA1A 1NK8A 4DSJA 1ZQVA 5KT4A 4LVSA 1R8BA 4EBKA 3UXNA 3HWTA 1L3UA 1K1QA 2PFQA 1A76A 4AT9B 4JUZA 9ICWA 4BWMA 4ATBA 4O3PA 5J2JA 4Q43A 5HMLA 2BHNA 4J9MA 1Z3EB 5J0YA 4GXJA 2BQUA 1NJZA 1A77A 1MQ3A 4YVZA 1ZQNA 5J0WA 4LZDA 3C2LA 1ZQEA 1UEUA 1D8YA 9ICQA 4DL5A 3PR4A 3GIKA 1BPYA 3THVA 4ECTA 4NY8A 1D9DA 7ICVA 4YMMA 2HW3A 1U4BA 2HHXA 3JYYA 2A1JA 2Y1JA 4KLHA 1NK0A 4X4RA 4UD5A 4RUAA 3JPNA 2NRTA 3KHRA 7ICOA 3WFRE 1L3TA 1IM4A 9ICSA 3RH4A 4DSEA 1BPDA 1C7YA 4F4WA 5EWFA 1XSPA 5IILA 4DFPA 2AU0A 3PX6A 4AT9A 1S97A 2BPCA 4J9LA 2FMSA 5KFVA 4RQ5A 2JEJA 5IIKA 3WFSC 4RQ4A 4X4TA 1D8LA 2Q66A 4ED7A 5KT5A 2V9WA 4B9MA 3LQCB 4WC0A 3G6VA 1L3SA 1ZQOA 4RQ6A 5DB6A 5KG4A 1HUOA 5L1JA 4AT8B 4YMOA 1NK9A 1KTQA 4UB2A 9ICGA 3GFKB 1KLNA 3ISDA 4FO6A 4BXOB 3ZDEA 4X0BA 4Q8EA 4KITB 5KFQA 4KN7A 3HPOA 1KSPA 8ICFA 2NRZA 4DLEA 2J6SA 4QZEA 3L9DA 3PO4A 3RJGA 4QZIA 3BDPA 5EWEA 1WCNA 3MDCA 3QE9Y 4R8UB 2H5XA 3GIJA 3EPGA 4KTQA 9ICKA 5BOLA 4DQPA 3MR5A 4UBBA 4QZFA 3UPQA 5KG7A 5DG9A 4QWAA 4TUQA 2OWOA 1JX4A 5HRKA 4P4PA 4I2FA 3PW5A 4M9GA 5IIOA 2NRKA 1XO1A 1XU4A 4RQ2A 2HVHA 3HJ1A 1JXEA 4DQSA 4RWPA 2IMWP 4I2HA 5J0RA 4PGYA 5J0XA 3SV3A 1U49A 3RR7A 3LDAA 4RNMA 1TAUA 2JZBA 2DRBA 1TV9A 5KFRA 3HW8A 1ZQUA 3MABA 5J0UA 4I2IA 2XGQA 3RJJA 5DEDA 1NOMA 1ZQYA 3ISBA 4DFMA 3K75D 2ZJ5A 2R8GA 2R8JA 8ICGA 4E0DA 4TQRA 1NK4A 1ZQQA 4ECVA 1B43A 2XCAA 4RPZA 3UXPA 3N4MB 4FHVA 1MIVA 4KN4A 2J6TA 4F5RA 4UB3A 1JMSA 4KLMA 3C21A 1XS9D 1X9SA 1JQRA 1UT8A 4ECUA 4KLEA 1X9WA 1YLQA 3RTVA 4QWEA 4J9NA 2IA6A 3N97B 4ED2A 4DFJA 3HP6A 2PFNA 5L1IA 5KFPA 4FH3A 1VFGA 2DR8A 2ZHBA 2JZBB 5DQIA 4MEXA 1L3VA 1QSLA 2IBKA 4B9VA 2BE3A 3TQ1A 5J2KA 4UB5A 4DQIA 3ORYA 3QZ7A 2C28A 2FLLA 4F5NA 4NM1A 4FHYA 7ICJA 2ZJAA 1KEJA 5KG3A 4GC7A 4YD2A 3RH5A 4IRKA 4NLGA 3H37A 2JEIA 2ZH5A 3PX4A 4F8RA 4O3SA 3TAPA 1V9PA 2ALZA 3IHQB 9ICCA 2PI5A 5J2EA 2M9NA 3H7IA 4DFKA 1D9FA 4F5QA 3Q8LA 2HHSA 1LB2B 4M6WA 2MAXA 1KDHA 4QZ8A 1NZPA 4YR2A 1MSWD 1TK8A 2KZZA 4AT7B 4PHEA 5BOMA 4WBYA 4M6WB 3GQCA 5IIJA 2R8IA 1ZQHA 9ICJA 4I2JA 4DF4A 2VANA 4X0AA 2I9GA 4DSIA 4X4SA 1QSYA 3PVXA 1XSLA 1ZQFA 8ICKA 5HREA 4O3RA 5DECA 5J0TA 5L1KA 1XC9A 7ICLA 2XY5A 1ZQAA 4FHWA 5HRLA 2KZ3A 8ICZA 3PMLA 3LWLA 1ZYQA 4JV1A 4GXIA 2DR9A 2DFLA 9ICOA 4E8FA 4X4QA 1ZQBA 4I2BA 3C5FA 2ZTCA 5DGAA 3OJSA 2C2EA 4WCWA 4Z6DA 2BKEA 4R66A 5HMMA 4DLGA 2ZUCA 4PH5A 5F9NA 9ICMA 4WC5A 5KFLA 1T4GA 3SI8A 3TARA 1SL0A 4IQUA 2ID1A 4ELUA 1Z00A 4QZCA 4MFCA 4X4PA 1Q79A 5KFNA 3QEBZ 1TK5A 4KLUA 2R8HA 4J9PA 5IINA 1KFSA 8ICTA 1ZQMA 2GWSA 5D49A 3G6XA 4QZAA 8ICMA 2RFFA 5HRFA 3BQ0A 3OGUA 2I1QA 5KFWA 5KFXA 2BQRA 9ICVA 2RDJA 4C8MA 2BCQA 4DL4A 3TANA 3LK9A 5J0OA 2FPKA 1U45A 1U47A 1ZQDA 3Q8RB 4BDPA 2HHVA 4YQWA 3RBDA 4HYKA 8ICVA 2FPMA 1PZNA 5DLGA 4UB4A 8ICBA 2AJQA 3AU6A 3OUYB 5KFKA 3PMNA 3RBEA 1R8CA 1NK6A 3TI0A 1B22A 1BPEA 5KFFA 5KT7A 2XY6A 1X2IA 3SZ2A 2BCVA 2Q0ZX 4EBDA 4EBEA 1ZQTA 2P6RA 4ECYA 2NRXA 4QZDA 3Q8MA 2VA8A 5KG5A 4DS4A 1N48A 1R89A 4DL6A 4X4OA 7ICGA 5CP2A 3UXOA 5J29A 1QSSA 2VA2A 4QWBA 3PNCA 4M04A 5HRGA 3OVAA 2ZH7A 4X4NA 4IQTA 3RAXA 4X4UA 3MR3A 3KHGA 1TKDA 5KG0A 4K4IA 1WCLA 2BR0A 2O1PA 9ICIA 4J9RA 4B9TA 2MUTA 5KG1A 2LYHA 5KFIA 4C8KA 4DL3A 4C8NA 8ICNA 1NO5A 1JIHA 1ZJNA 4RQ1A 3PY8A 1NJWA 4I2AA 1PX5A 2FMPA 3PX0A 4M9LA 7ICFA 9ICEA 4MF8A 1CEZA 2BCSA 4F2RA 2O5AA 2J6UA 4UAZA 4O9MA 2IHNA 1U9LA 4JWMA 3H3AA 1UA0A 4DQRA 4Z6FA 3M8SA 3V7JA 1S0MA 4ELVA 2ZTEA 4YXMA 3BQ1A 4ELTA 4NM2A 3H40A 4CCHA 7ICUA 3GIMA 3GIIA 5KFGA 4FBTA 1T3NA 1F5AA 4TURA 5HHHA 1ZETA 4RU9A 3H4BA 1BNOA 4S3NA 1BPXA 2KZMA 5HR9A 3WFQE 2BCUA 3WFOA 3PW7A 3RJHA 4BXOA 5C5JA 4RWOA 4ED0A 4RNNA 4DWIA 5IIIA 5KT3A 8ICQA 1ZQIA 4UD4A 4QW9A 1K1SA 8ICOA 3AQKA 3H8JA 4KLIA 1UEVA 4NKUA 4KLDA 1DGSA 4GC6A 4KMUA 2R8KA 1T8EA 9ICTA 5DB8A 5D46A 1DK2A 4B9LA 4EBCA 4FH5A 3H4DA 4RWQA 3ZDDA 5DB9A 1X9MA 2ZH3A 3WFPA 5KFTA 3ZD9A 4O5EA 3OHAA 3E2EA 1VJ7A 2ATLA 3MFIA 4F50A 7ICKA 9ICRA 1R8AA 3Q8QB 3HX0A 2ASLA 4K4GA 4MF2A 5KFHA 4NLZA 5J2AA 5J2CA 3BQTA 3PO5A 4DOAA 1WOTA 4WC2A 1S0OA 1KRPA 3OSPA 3AQNA 2DPIA 5CWRA 3RB6A 2FLPA 3ZDCA 4WC1A 4AT8A 4UQGA 3KTQA 4B9SA 4TUPA 1SKWA 2ISPA 5DBCA 4XA5A 1KFTA 3ZD8A 1Y88A 2AGQA 7ICQA 3MGHA 5KG6A 3BJYA 1H38A 1QTMA 4IRDA 2ZH1A 1BPBA 3RB0A 3RR8A 4JV2A 4NLNA 2HHUA 3C66A 2ZHAA 4ECZA 3H8SA 3LWMA 3C5GA 3T5HA 1S10A 2XGPA 4KLQA 4WC6A 9ICHA 2DRAA 4QZGA 4DSLA 4KLLA 2ZH8A 4O0IA 1S76D 4ED1A 3TFSA 7ICMA 3B0YA 2XY7A 1V4AA 2W9BA 1ZQPA 1ZJMA 3AUOA 4F4KA 3V6JA 2WTFA 4RPXA 4DOBA 5KFSA 4M9JA 3V6KA 2RDIA 4QZ9A 4RQ3A 1KFDA 3M9OB 4ECWA 4ED3A 3RH6A 1NK5A 4IR9A 2M2WA 5HC9A 4PHPA 1Q78A 3GDXA 1MQ2A 4FBUA 4R64A 4WBZA 1S0VA 5DDMA 1N56A 8ICWA 9ICAA 3M9NB 2HHQA 5J2IA 4P4MA 3MR6A 8ICHA 4J9QA 4O3QA 1COOA 4M9NA 2W8KA 4DO9A 1NJYA 2P6UA 5KFAA 3ISCA 5IIMA 4BWJA 3JPQA 2UVWA 4X5VA 3SYZA 4AT7A 1S0NA 3UQ0A 4F91B 3RAQA 3JPPA 1L5UA 5DKWA 2JEFA 2KTQA 1ZQKA 4RQ0A 4I29A 4MFAA 3M8RA 4GLXA 5JUMA 5HRIA 3IM1A 4YCXA 5KFJA 5J0PA 2W9BB 4DL7A 3TAQA 1NKBA 2XCPA 3C1YA 4RT2A 4J9OA 3NYBA 4I2DA 2DR7A 5DBBA 1TAQA 3JPOA 2AQ4A 3K4GA 3RRGA 7ICEA 4E80A 1TVAA 4IQWA 4WC7A 1DOQA 1NKEA 4EP7A 1ZQRA 4TUSA 8ICAA 5KFEA 7ICTA 2FMQA 3GV8B 2KFNA 5DG7A 2KP7A 4EZ9A 1BPZA 3V7LA 4M2YA 3NGDA 3RJFA 4ED8A 2AGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W9M A;  3Q8P B;  2FPL A;  1SZP A;  2ZH4 A;  7ICI A;  5F2V O;  4YP3 A;  5J2H A;  1ZQZ A;  1XWL A;  3EW9 A;  4EZ6 A;  4K4H A;  4Q8F A;  2BDP A;  4YN4 A;  9ICU A;  4I2G A;  4DSF A;  4DEZ A;  4EYH B;  2PBE A;  4XQ8 A;  1BGX T;  5CR0 A;  5J2B A;  3MGI A;  2W9A A;  8ICX A;  5KFB A;  3V6H A;  1UET A;  1TFY A;  3H39 A;  4NXZ A;  4DOC A;  2XC9 A;  2XO7 A;  5KT6 A;  1JN3 A;  4C8L A;  4GXK A;  2C22 A;  3UPS A;  4JK1 A;  3NTU A;  4O3O A;  5F9L A;  2JEG A;  2PI4 A;  3SV4 A;  3UQ2 A;  4YR0 A;  3T5K A;  4EEY A;  4Q44 A;  3RRH A;  4KLJ A;  3OSN A;  2M2V A;  5HP4 A;  3MDA A;  4KLT A;  4WC3 A;  7ICN A;  4IG8 A;  2M2T A;  1ARO P;  4RPY A;  4DS5 A;  1RZT A;  1SL2 A;  3PW2 A;  1ZQJ A;  4BGD A;  1BVS A;  5KFO A;  4RUC A;  4FHX A;  4EBJ A;  4P2H A;  4WC4 A;  4B9N A;  4O5K A;  5DQH A;  4YFK A;  2A1J B;  5KTQ A;  3PW4 A;  1XSN A;  1RPL A;  2V4R A;  4F3O A;  5DLF A;  4NLK A;  3HJ4 A;  4F93 B;  2DVI A;  1MIW A;  3QZ8 A;  2DR5 A;  2ZH2 A;  4NKT A;  4C8O A;  5KG2 A;  5DBA A;  1SL1 A;  3G6Y A;  2ZH6 A;  1TK0 A;  2UVR A;  3C1Z A;  4JV0 A;  3H38 A;  3HT3 A;  2C2D A;  2C2R A;  2ZUD A;  5L9X A;  2ISO A;  3MFH A;  2IHM A;  2AGO A;  4ATB B;  1UT5 A;  4Z6E A;  3EZ5 A;  2DPJ A;  2Y1I A;  1U48 A;  3RJK A;  2W9C B;  2F1J A;  4I2E A;  4X4V A;  2VA3 A;  4QWC A;  4MFF A;  3HIY A;  3JPR A;  4ECS A;  1S9F A;  4JWN A;  2NRV A;  1FA0 A;  1HJP A;  4Q45 A;  2KN7 A;  4I27 A;  3QEA Z;  7ICS A;  3OJU A;  9ICB A;  4RQ8 A;  4M47 A;  4FS1 A;  4O3N A;  3OVS A;  4I2C A;  1CUK A;  3OUY A;  4R63 A;  4EYI B;  4FS2 A;  4ECQ A;  3RB3 A;  1NK7 A;  1MC8 A;  4UAW A;  8ICY A;  4XUS A;  3KHL A;  4F5O A;  5HRH A;  2KFZ A;  5DG8 A;  4YXJ A;  3GV5 B;  1JXL A;  1HUZ A;  4KLF A;  4RZR A;  5J2D A;  1LV5 A;  3ZDB A;  3AQL A;  1BNP A;  5DGB A;  2B21 A;  4QZH A;  2BPF A;  4ED6 A;  1RYR A;  5L1L A;  4UAY A;  1NJX A;  4IR1 A;  4M5D A;  2PXI A;  2HHW A;  4YMN A;  3PV8 A;  3FDS A;  4FHP A;  3H8W A;  2FLN A;  1RXV A;  8ICJ A;  8ICS A;  2MUT B;  5HRB A;  2NRW A;  5CJ7 A;  4PGQ A;  3PR5 B;  4DL2 A;  4UB1 A;  4P4O A;  1TFW A;  5KFZ A;  5BPC A;  8ICE A;  2M2U A;  1OU5 A;  3JPT A;  5J2F A;  4XRH A;  2UVV A;  2ZJ8 A;  2BPG A;  4IRC A;  3C2K A;  1S77 D;  2P66 A;  4B9U A;  9ICX A;  3EYZ A;  4TQS A;  4YD1 A;  3T5L A;  3JPS A;  7ICH A;  1ZQC A;  5KFU A;  4RQ7 A;  3OHB A;  5HNK A;  3MR2 A;  3C18 A;  5J0S A;  3AQM A;  3OV7 A;  3EPI A;  4IQV A;  3AU2 A;  5KFM A;  3FYH A;  4PHD A;  3TFR A;  1ZQW A;  1ZQG A;  4QW8 A;  4F5P A;  2W8L A;  1T7P A;  4O5C A;  4LT6 A;  1EXN A;  3B0X A;  3RB4 A;  1RYS A;  5CHG A;  4J9K A;  2AQ0 A;  2HHP A;  4RWN A;  4DF8 A;  8ICC A;  4F4Z A;  1QLN A;  5KFD A;  5DQG A;  3JZ0 A;  3T3F A;  3Q8S B;  4I28 A;  8ICI A;  8ICL A;  3V7K A;  4DSK A;  2W9C A;  9ICN A;  1ZQS A;  2BGW A;  5KFC A;  3C2M A;  2HVI A;  8ICU A;  2PFP A;  1ZQL A;  2ZTD A;  1ZQX A;  5KFY A;  4Z6C A;  3BQ2 A;  2F1H A;  2V4Q A;  3V72 A;  1RXW A;  4F92 B;  1DK3 A;  3PW0 A;  4E7X A;  7ICP A;  1NKC A;  4ECR A;  7ICR A;  3MBY A;  5J2G A;  3EWA A;  5DB7 A;  4MEY A;  4R65 A;  4R8U A;  4UBC A;  3RJI A;  9ICP A;  4PHA A;  4KLG A;  4PGX A;  2F1I A;  3KHH A;  1TFR A;  5J0Q A;  1Z00 B;  4M0A A;  1IXR A;  1MIY A;  2BCR A;  1KNY A;  4RNO A;  2HHT A;  3C23 A;  4QWD A;  2ASJ A;  4LZG A;  1JAJ A;  5HHI A;  3ETL A;  5TZV A;  3RJE A;  4XQ7 A;  4F2S A;  1SKS A;  4PPX A;  4J9S A;  5DDY A;  4DQQ A;  3GV7 B;  4ECX A;  8ICR A;  2UVU A;  4RT3 A;  3M9M B;  2BQ3 A;  3T5J A;  4YG2 A;  3GIL A;  4YR3 A;  5CA7 A;  3Q8K A;  5EOZ A;  3ZDA A;  4KLS A;  4M9H A;  9ICF A;  2ZUB A;  4ZH4 A;  5KT2 A;  5CB1 A;  4F4Y A;  1SKR A;  5EWG A;  2ZH9 A;  5D4B A;  8ICP A;  3OVB A;  2PFO A;  4G3I A;  4F4X A;  2ASD A;  4KLO A;  9ICL A;  4QZB A;  5HRD A;  1UA1 A;  1NK8 A;  4DSJ A;  1ZQV A;  5KT4 A;  4LVS A;  1R8B A;  4EBK A;  3UXN A;  3HWT A;  1L3U A;  1K1Q A;  2PFQ A;  1A76 A;  4AT9 B;  4JUZ A;  9ICW A;  4BWM A;  4ATB A;  4O3P A;  5J2J A;  4Q43 A;  5HML A;  2BHN A;  4J9M A;  1Z3E B;  5J0Y A;  4GXJ A;  2BQU A;  1NJZ A;  1A77 A;  1MQ3 A;  4YVZ A;  1ZQN A;  5J0W A;  4LZD A;  3C2L A;  1ZQE A;  1UEU A;  1D8Y A;  9ICQ A;  4DL5 A;  3PR4 A;  3GIK A;  1BPY A;  3THV A;  4ECT A;  4NY8 A;  1D9D A;  7ICV A;  4YMM A;  2HW3 A;  1U4B A;  2HHX A;  3JYY A;  2A1J A;  2Y1J A;  4KLH A;  1NK0 A;  4X4R A;  4UD5 A;  4RUA A;  3JPN A;  2NRT A;  3KHR A;  7ICO A;  3WFR E;  1L3T A;  1IM4 A;  9ICS A;  3RH4 A;  4DSE A;  1BPD A;  1C7Y A;  4F4W A;  5EWF A;  1XSP A;  5IIL A;  4DFP A;  2AU0 A;  3PX6 A;  4AT9 A;  1S97 A;  2BPC A;  4J9L A;  2FMS A;  5KFV A;  4RQ5 A;  2JEJ A;  5IIK A;  3WFS C;  4RQ4 A;  4X4T A;  1D8L A;  2Q66 A;  4ED7 A;  5KT5 A;  2V9W A;  4B9M A;  3LQC B;  4WC0 A;  3G6V A;  1L3S A;  1ZQO A;  4RQ6 A;  5DB6 A;  5KG4 A;  1HUO A;  5L1J A;  4AT8 B;  4YMO A;  1NK9 A;  1KTQ A;  4UB2 A;  9ICG A;  3GFK B;  1KLN A;  3ISD A;  4FO6 A;  4BXO B;  3ZDE A;  4X0B A;  4Q8E A;  4KIT B;  5KFQ A;  4KN7 A;  3HPO A;  1KSP A;  8ICF A;  2NRZ A;  4DLE A;  2J6S A;  4QZE A;  3L9D A;  3PO4 A;  3RJG A;  4QZI A;  3BDP A;  5EWE A;  1WCN A;  3MDC A;  3QE9 Y;  4R8U B;  2H5X A;  3GIJ A;  3EPG A;  4KTQ A;  9ICK A;  5BOL A;  4DQP A;  3MR5 A;  4UBB A;  4QZF A;  3UPQ A;  5KG7 A;  5DG9 A;  4QWA A;  4TUQ A;  2OWO A;  1JX4 A;  5HRK A;  4P4P A;  4I2F A;  3PW5 A;  4M9G A;  5IIO A;  2NRK A;  1XO1 A;  1XU4 A;  4RQ2 A;  2HVH A;  3HJ1 A;  1JXE A;  4DQS A;  4RWP A;  2IMW P;  4I2H A;  5J0R A;  4PGY A;  5J0X A;  3SV3 A;  1U49 A;  3RR7 A;  3LDA A;  4RNM A;  1TAU A;  2JZB A;  2DRB A;  1TV9 A;  5KFR A;  3HW8 A;  1ZQU A;  3MAB A;  5J0U A;  4I2I A;  2XGQ A;  3RJJ A;  5DED A;  1NOM A;  1ZQY A;  3ISB A;  4DFM A;  3K75 D;  2ZJ5 A;  2R8G A;  2R8J A;  8ICG A;  4E0D A;  4TQR A;  1NK4 A;  1ZQQ A;  4ECV A;  1B43 A;  2XCA A;  4RPZ A;  3UXP A;  3N4M B;  4FHV A;  1MIV A;  4KN4 A;  2J6T A;  4F5R A;  4UB3 A;  1JMS A;  4KLM A;  3C21 A;  1XS9 D;  1X9S A;  1JQR A;  1UT8 A;  4ECU A;  4KLE A;  1X9W A;  1YLQ A;  3RTV A;  4QWE A;  4J9N A;  2IA6 A;  3N97 B;  4ED2 A;  4DFJ A;  3HP6 A;  2PFN A;  5L1I A;  5KFP A;  4FH3 A;  1VFG A;  2DR8 A;  2ZHB A;  2JZB B;  5DQI A;  4MEX A;  1L3V A;  1QSL A;  2IBK A;  4B9V A;  2BE3 A;  3TQ1 A;  5J2K A;  4UB5 A;  4DQI A;  3ORY A;  3QZ7 A;  2C28 A;  2FLL A;  4F5N A;  4NM1 A;  4FHY A;  7ICJ A;  2ZJA A;  1KEJ A;  5KG3 A;  4GC7 A;  4YD2 A;  3RH5 A;  4IRK A;  4NLG A;  3H37 A;  2JEI A;  2ZH5 A;  3PX4 A;  4F8R A;  4O3S A;  3TAP A;  1V9P A;  2ALZ A;  3IHQ B;  9ICC A;  2PI5 A;  5J2E A;  2M9N A;  3H7I A;  4DFK A;  1D9F A;  4F5Q A;  3Q8L A;  2HHS A;  1LB2 B;  4M6W A;  2MAX A;  1KDH A;  4QZ8 A;  1NZP A;  4YR2 A;  1MSW D;  1TK8 A;  2KZZ A;  4AT7 B;  4PHE A;  5BOM A;  4WBY A;  4M6W B;  3GQC A;  5IIJ A;  2R8I A;  1ZQH A;  9ICJ A;  4I2J A;  4DF4 A;  2VAN A;  4X0A A;  2I9G A;  4DSI A;  4X4S A;  1QSY A;  3PVX A;  1XSL A;  1ZQF A;  8ICK A;  5HRE A;  4O3R A;  5DEC A;  5J0T A;  5L1K A;  1XC9 A;  7ICL A;  2XY5 A;  1ZQA A;  4FHW A;  5HRL A;  2KZ3 A;  8ICZ A;  3PML A;  3LWL A;  1ZYQ A;  4JV1 A;  4GXI A;  2DR9 A;  2DFL A;  9ICO A;  4E8F A;  4X4Q A;  1ZQB A;  4I2B A;  3C5F A;  2ZTC A;  5DGA A;  3OJS A;  2C2E A;  4WCW A;  4Z6D A;  2BKE A;  4R66 A;  5HMM A;  4DLG A;  2ZUC A;  4PH5 A;  5F9N A;  9ICM A;  4WC5 A;  5KFL A;  1T4G A;  3SI8 A;  3TAR A;  1SL0 A;  4IQU A;  2ID1 A;  4ELU A;  1Z00 A;  4QZC A;  4MFC A;  4X4P A;  1Q79 A;  5KFN A;  3QEB Z;  1TK5 A;  4KLU A;  2R8H A;  4J9P A;  5IIN A;  1KFS A;  8ICT A;  1ZQM A;  2GWS A;  5D49 A;  3G6X A;  4QZA A;  8ICM A;  2RFF A;  5HRF A;  3BQ0 A;  3OGU A;  2I1Q A;  5KFW A;  5KFX A;  2BQR A;  9ICV A;  2RDJ A;  4C8M A;  2BCQ A;  4DL4 A;  3TAN A;  3LK9 A;  5J0O A;  2FPK A;  1U45 A;  1U47 A;  1ZQD A;  3Q8R B;  4BDP A;  2HHV A;  4YQW A;  3RBD A;  4HYK A;  8ICV A;  2FPM A;  1PZN A;  5DLG A;  4UB4 A;  8ICB A;  2AJQ A;  3AU6 A;  3OUY B;  5KFK A;  3PMN A;  3RBE A;  1R8C A;  1NK6 A;  3TI0 A;  1B22 A;  1BPE A;  5KFF A;  5KT7 A;  2XY6 A;  1X2I A;  3SZ2 A;  2BCV A;  2Q0Z X;  4EBD A;  4EBE A;  1ZQT A;  2P6R A;  4ECY A;  2NRX A;  4QZD A;  3Q8M A;  2VA8 A;  5KG5 A;  4DS4 A;  1N48 A;  1R89 A;  4DL6 A;  4X4O A;  7ICG A;  5CP2 A;  3UXO A;  5J29 A;  1QSS A;  2VA2 A;  4QWB A;  3PNC A;  4M04 A;  5HRG A;  3OVA A;  2ZH7 A;  4X4N A;  4IQT A;  3RAX A;  4X4U A;  3MR3 A;  3KHG A;  1TKD A;  5KG0 A;  4K4I A;  1WCL A;  2BR0 A;  2O1P A;  9ICI A;  4J9R A;  4B9T A;  2MUT A;  5KG1 A;  2LYH A;  5KFI A;  4C8K A;  4DL3 A;  4C8N A;  8ICN A;  1NO5 A;  1JIH A;  1ZJN A;  4RQ1 A;  3PY8 A;  1NJW A;  4I2A A;  1PX5 A;  2FMP A;  3PX0 A;  4M9L A;  7ICF A;  9ICE A;  4MF8 A;  1CEZ A;  2BCS A;  4F2R A;  2O5A A;  2J6U A;  4UAZ A;  4O9M A;  2IHN A;  1U9L A;  4JWM A;  3H3A A;  1UA0 A;  4DQR A;  4Z6F A;  3M8S A;  3V7J A;  1S0M A;  4ELV A;  2ZTE A;  4YXM A;  3BQ1 A;  4ELT A;  4NM2 A;  3H40 A;  4CCH A;  7ICU A;  3GIM A;  3GII A;  5KFG A;  4FBT A;  1T3N A;  1F5A A;  4TUR A;  5HHH A;  1ZET A;  4RU9 A;  3H4B A;  1BNO A;  4S3N A;  1BPX A;  2KZM A;  5HR9 A;  3WFQ E;  2BCU A;  3WFO A;  3PW7 A;  3RJH A;  4BXO A;  5C5J A;  4RWO A;  4ED0 A;  4RNN A;  4DWI A;  5III A;  5KT3 A;  8ICQ A;  1ZQI A;  4UD4 A;  4QW9 A;  1K1S A;  8ICO A;  3AQK A;  3H8J A;  4KLI A;  1UEV A;  4NKU A;  4KLD A;  1DGS A;  4GC6 A;  4KMU A;  2R8K A;  1T8E A;  9ICT A;  5DB8 A;  5D46 A;  1DK2 A;  4B9L A;  4EBC A;  4FH5 A;  3H4D A;  4RWQ A;  3ZDD A;  5DB9 A;  1X9M A;  2ZH3 A;  3WFP A;  5KFT A;  3ZD9 A;  4O5E A;  3OHA A;  3E2E A;  1VJ7 A;  2ATL A;  3MFI A;  4F50 A;  7ICK A;  9ICR A;  1R8A A;  3Q8Q B;  3HX0 A;  2ASL A;  4K4G A;  4MF2 A;  5KFH A;  4NLZ A;  5J2A A;  5J2C A;  3BQT A;  3PO5 A;  4DOA A;  1WOT A;  4WC2 A;  1S0O A;  1KRP A;  3OSP A;  3AQN A;  2DPI A;  5CWR A;  3RB6 A;  2FLP A;  3ZDC A;  4WC1 A;  4AT8 A;  4UQG A;  3KTQ A;  4B9S A;  4TUP A;  1SKW A;  2ISP A;  5DBC A;  4XA5 A;  1KFT A;  3ZD8 A;  1Y88 A;  2AGQ A;  7ICQ A;  3MGH A;  5KG6 A;  3BJY A;  1H38 A;  1QTM A;  4IRD A;  2ZH1 A;  1BPB A;  3RB0 A;  3RR8 A;  4JV2 A;  4NLN A;  2HHU A;  3C66 A;  2ZHA A;  4ECZ A;  3H8S A;  3LWM A;  3C5G A;  3T5H A;  1S10 A;  2XGP A;  4KLQ A;  4WC6 A;  9ICH A;  2DRA A;  4QZG A;  4DSL A;  4KLL A;  2ZH8 A;  4O0I A;  1S76 D;  4ED1 A;  3TFS A;  7ICM A;  3B0Y A;  2XY7 A;  1V4A A;  2W9B A;  1ZQP A;  1ZJM A;  3AUO A;  4F4K A;  3V6J A;  2WTF A;  4RPX A;  4DOB A;  5KFS A;  4M9J A;  3V6K A;  2RDI A;  4QZ9 A;  4RQ3 A;  1KFD A;  3M9O B;  4ECW A;  4ED3 A;  3RH6 A;  1NK5 A;  4IR9 A;  2M2W A;  5HC9 A;  4PHP A;  1Q78 A;  3GDX A;  1MQ2 A;  4FBU A;  4R64 A;  4WBZ A;  1S0V A;  5DDM A;  1N56 A;  8ICW A;  9ICA A;  3M9N B;  2HHQ A;  5J2I A;  4P4M A;  3MR6 A;  8ICH A;  4J9Q A;  4O3Q A;  1COO A;  4M9N A;  2W8K A;  4DO9 A;  1NJY A;  2P6U A;  5KFA A;  3ISC A;  5IIM A;  4BWJ A;  3JPQ A;  2UVW A;  4X5V A;  3SYZ A;  4AT7 A;  1S0N A;  3UQ0 A;  4F91 B;  3RAQ A;  3JPP A;  1L5U A;  5DKW A;  2JEF A;  2KTQ A;  1ZQK A;  4RQ0 A;  4I29 A;  4MFA A;  3M8R A;  4GLX A;  5JUM A;  5HRI A;  3IM1 A;  4YCX A;  5KFJ A;  5J0P A;  2W9B B;  4DL7 A;  3TAQ A;  1NKB A;  2XCP A;  3C1Y A;  4RT2 A;  4J9O A;  3NYB A;  4I2D A;  2DR7 A;  5DBB A;  1TAQ A;  3JPO A;  2AQ4 A;  3K4G A;  3RRG A;  7ICE A;  4E80 A;  1TVA A;  4IQW A;  4WC7 A;  1DOQ A;  1NKE A;  4EP7 A;  1ZQR A;  4TUS A;  8ICA A;  5KFE A;  7ICT A;  2FMQ A;  3GV8 B;  2KFN A;  5DG7 A;  2KP7 A;  4EZ9 A;  1BPZ A;  3V7L A;  4M2Y A;  3NGD A;  3RJF A;  4ED8 A;  2AGP A; 
#chains in the Genus database with same CATH topology
 2W9M A;  1SZP A;  5F2V O;  5J2H A;  4Q8F A;  9ICU A;  1KL9 A;  4I2G A;  4DEZ A;  2W43 A;  4NWI A;  1DXS A;  1UPH A;  3V6H A;  1TFY A;  4NXZ A;  4DOC A;  2XC9 A;  4CE6 A;  2KIC A;  5KT6 A;  5F9L A;  2JEG A;  4EEY A;  3RRH A;  2JH1 A;  3MDA A;  7ICN A;  2M2T A;  8ICG A;  1RZT A;  3HIL A;  3CNH A;  4BGD A;  1SWW A;  4P2H A;  5DQH A;  4YFK A;  4CDG A;  3PW4 A;  5DLF A;  3AM9 A;  4F93 B;  4UB6 U;  4NKT A;  3G6Y A;  3IV6 A;  3HKZ C;  4N7R A;  2UVR A;  3BS7 A;  2ISO A;  2D8C A;  2AGO A;  3WK6 A;  5CRX A;  4FZM A;  2Y1I A;  5B66 U;  2W9C B;  4X4V A;  2VA3 A;  4EED A;  1S9F A;  1WG8 A;  4JWN A;  1FA0 A;  3K7D A;  3OJU A;  4M47 A;  4FZN A;  4I2C A;  3OUY A;  4FS2 A;  1MC8 A;  2WF7 A;  4XUS A;  3SMV A;  3DEE A;  3NVV A;  2W11 A;  4RZR A;  5J2D A;  2B21 A;  2BPF A;  3ER8 C;  4U6P A;  2GAF D;  1LVH A;  4YMN A;  1WYG A;  2QB0 A;  3PV8 A;  1FFU A;  3MGV A;  3UMC A;  2MUT B;  4XJE A;  2FE9 A;  1SV0 A;  2VJ4 A;  2ZIX B;  2LYA A;  2ODG A;  4B9U A;  2B0C A;  5HR6 A;  9ICX A;  3JPS A;  5AI5 A;  1ZQC A;  1B0X A;  3OHB A;  2H3F A;  3C18 A;  5J0S A;  2PMZ F;  3OV7 A;  4OJO A;  4K98 A;  3FYH A;  4O5C A;  1QQ5 A;  1T7P A;  3NVW A;  4C0Z A;  2HHP A;  4NXT A;  4J03 A;  4F4Z A;  4Y2Y A;  3QXG A;  1WUD A;  3HRD D;  5DQG A;  4I28 A;  2B51 A;  3V7K A;  2W9C A;  3QU9 A;  8ICU A;  2HVI A;  2PFP A;  2FCL A;  1Z19 A;  1ZQL A;  2ZTD A;  1D8B A;  3BQ2 A;  2F1H A;  2V4Q A;  3V72 A;  4ECR A;  3EWA A;  5DB7 A;  4MEY A;  9ICP A;  3TAC B;  4PHA A;  1TFR A;  4UAS A;  5JRT A;  2DKX A;  4M0A A;  1MIY A;  4LZG A;  1JAJ A;  2WFA A;  4NXX A;  5DDY A;  4DQQ A;  3GV7 B;  3U26 A;  2JHD A;  2ZUB A;  2HBM A;  2KJ8 A;  1XNS A;  8ICP A;  3OVB A;  4F4X A;  2ZIU B;  4QZB A;  3RFA A;  4LVS A;  2ZIU A;  3UXN A;  3HWT A;  1A76 A;  4OAI Z;  4JUZ A;  2HBK A;  3QX7 A;  1Z3E B;  5J0Y A;  1MQ3 A;  1ZQN A;  5AI8 A;  1D8Y A;  9ICQ A;  4NY8 A;  3QU7 A;  1KQQ A;  1U4B A;  2HHX A;  1L7O A;  5EE9 A;  4UD5 A;  4RUA A;  2RQ5 A;  3KHR A;  5D61 A;  5ALF A;  1C7Y A;  5EWF A;  2HDO A;  2BPC A;  5KFV A;  4ED7 A;  1LKY B;  4YMO A;  1KTQ A;  9ICG A;  3SEN A;  4FO6 A;  3KFU F;  4ZOH C;  8ICF A;  2J6S A;  3HKZ F;  5EWE A;  2G0A A;  2H5X A;  4KMO B;  3GIJ A;  3WK8 A;  4QZF A;  4TUQ A;  4KB6 A;  2OWO A;  3BS5 A;  5HRK A;  3HJ1 A;  1XO1 A;  1JXE A;  5CFT A;  2RHF A;  3LDA A;  2DRB A;  1TV9 A;  5K4L A;  1UQV A;  1NOM A;  3ISB A;  2ZJ5 A;  4LEW A;  4TQR A;  1NK4 A;  4ECV A;  3BZC A;  2XCA A;  4RPZ A;  1JMS A;  1X9S A;  3MC1 A;  2CRX A;  3BS5 B;  4QWE A;  1DRG A;  1RDF A;  2IA6 A;  4ED2 A;  1NI3 A;  5ALI A;  5AK6 A;  4UB5 A;  1GO3 F;  5KG3 A;  2JH7 A;  2QAR B;  1S5L U;  2K8A A;  2ALZ A;  2PI5 A;  2M9N A;  3Q8L A;  3M1Y A;  1OW5 A;  3A0H U;  4QZ8 A;  1NZP A;  4AT7 B;  2KZZ A;  4PHE A;  2R8I A;  1UHU A;  4X0A A;  2OHF A;  3I76 A;  2FDR A;  1CRX A;  1FIQ A;  4O3R A;  5J0T A;  2Y9U A;  2KZ3 A;  4GXI A;  5AKY A;  1WWU A;  2P35 A;  1FFV A;  4Z6D A;  2PKE A;  4DLG A;  4PH5 A;  2F76 X;  1T4G A;  4ELU A;  1Z00 A;  4C4R A;  4J9P A;  1KFS A;  8ICT A;  1Z1V A;  4QZA A;  3OGU A;  5AKL A;  4WQL A;  2RDJ A;  4BDP A;  1U45 A;  3LK9 A;  1U47 A;  2FPK A;  3RBD A;  1Z4N A;  4YQW A;  5GTH U;  4IL6 U;  1PZN A;  3AU6 A;  5KFK A;  1B22 A;  1BPE A;  5KFF A;  2BCV A;  1TAM A;  2XY6 A;  2Q0Z X;  3WKA A;  1ZQT A;  2F3N A;  5B3Q A;  2NRX A;  4QZD A;  3Q8M A;  5KG5 A;  1R89 A;  7ICG A;  2VA2 A;  3UXO A;  1QSS A;  3QU4 A;  4OAG A;  4IQT A;  4K4I A;  1TKD A;  2O1P A;  2BR0 A;  4K9A A;  4OCZ A;  5KFI A;  4C8K A;  4DL3 A;  4C8N A;  1NO5 A;  4Y2T A;  4UW9 A;  4I0U A;  1SZH A;  3KKA C;  1CEZ A;  2J6U A;  2IHN A;  2CPR A;  3IRU A;  4JWM A;  1S0M A;  4YXM A;  4NM2 A;  1SB3 C;  5ALR A;  5D62 A;  1ZET A;  2KMD A;  1BNO A;  3H4B A;  5HR9 A;  4NXV A;  2BCU A;  1J2N A;  4RWO A;  4ED0 A;  4DWI A;  1N5X A;  2G07 A;  1UEV A;  1DGS A;  2R8K A;  2W54 A;  1N5W A;  1DK2 A;  1FEZ A;  4B9L A;  3H4D A;  4RWQ A;  3ERC C;  3E2E A;  2ATL A;  7ICK A;  9ICR A;  4K4G A;  3GZF A;  4NLZ A;  2RP5 A;  5J2C A;  4DOA A;  5AK3 A;  5ALV A;  3OSP A;  2FJ6 A;  3AQN A;  3KZX A;  3ZDC A;  3KTQ A;  4TUP A;  2ISP A;  1KFT A;  2AGQ A;  2B6G A;  5KG6 A;  2ZH1 A;  4NLN A;  4BX9 C;  2DRA A;  4KLL A;  2EZY A;  4ED1 A;  3TFS A;  4K96 A;  4M9J A;  1TE2 A;  5AIA A;  4QZ9 A;  4RQ3 A;  4ED3 A;  3AN1 A;  4GFJ A;  5KAI U;  3GDX A;  3SD7 A;  8ICW A;  9ICA A;  3M9N B;  2HHQ A;  1ZD2 P;  5J2I A;  4P4M A;  3MR6 A;  4J9Q A;  4FFD A;  4DO9 A;  4WH5 A;  5IIM A;  2UVW A;  3UQ0 A;  3RAQ A;  3JPP A;  2JV3 A;  3ED5 A;  3M8R A;  5HRI A;  4FE3 A;  2W03 A;  1TAQ A;  2AQ4 A;  7ICE A;  3K4G A;  2JR5 A;  4EP7 A;  1ZQR A;  4TUS A;  4FO1 A;  3DDH A;  1X42 A;  2W7P A;  2FMQ A;  2KFN A;  3V7L A;  3NGD A;  3ZDB A;  1L8O A;  2FPL A;  4NL9 A;  1XWL A;  1N60 A;  4K4H A;  2BDP A;  4YN4 A;  2PBE A;  2W7O A;  1BGX T;  2W9A A;  2A3V A;  4GXK A;  3UPS A;  4JK1 A;  3NTU A;  4ATB A;  2YY6 A;  3UQ2 A;  4Q44 A;  4KLJ A;  3OSN A;  3PSP A;  4NJ8 A;  1PVR A;  3D2Q A;  4RUC A;  4P0P B;  4WC4 A;  4O5K A;  2A1J B;  1XSN A;  1RPL A;  2V4R A;  1YZ6 A;  3I1Y A;  1V38 A;  4NLK A;  2DVI A;  5ALU A;  5KG2 A;  1SL1 A;  1RM6 C;  4C7Z A;  2F8L A;  2C2D A;  2ZUD A;  2RRD A;  2Y0S C;  2DPJ A;  1U48 A;  5AIC A;  1PVP A;  2QB0 B;  3JPR A;  1HJP A;  3QEA Z;  7ICS A;  5E79 U;  3TAD C;  3PZP A;  3ER9 B;  2K4P A;  3OVS A;  5G5H A;  1NK7 A;  2ZH9 A;  4ECQ A;  3NUQ A;  8ICY A;  3KHL A;  2ESE A;  4F5O A;  2KFZ A;  3GV5 B;  1JXL A;  1KBU A;  5B3P A;  2WF8 A;  1UCV A;  1LV5 A;  5DGB A;  5L1L A;  3DV9 A;  4M5D A;  4Y2R A;  3FDS A;  5ALX A;  3H8W A;  2WHE A;  1RXV A;  2FLN A;  5HRB A;  3PR5 B;  1PVQ A;  4P4O A;  1TFW A;  4IC9 A;  5KFZ A;  3JPT A;  2HN1 A;  2PMZ C;  2ZJ8 A;  2BPG A;  2EAN A;  2P66 A;  2HBJ A;  3CW2 C;  3IP4 B;  2OYY A;  4OJL A;  2KJ9 A;  2GH1 A;  2KIW A;  2YB4 A;  4IQV A;  3TFR A;  2LMR A;  4QW8 A;  3RB4 A;  2XVT A;  5KFD A;  2E5S A;  3Q8S B;  5AHX A;  8ICL A;  2BGW A;  3C2M A;  5KFY A;  4Z6C A;  2W04 A;  2NYV A;  7ICP A;  1NKC A;  7ICR A;  4R8U A;  4UBC A;  3KHH A;  2VIX A;  1O03 A;  2HHT A;  3C23 A;  4QWD A;  2OM6 A;  5TZV A;  4F2S A;  8ICR A;  2BQ3 A;  3M9M B;  4NLB A;  3GIL A;  3ZDA A;  2XID A;  2DBY A;  9ICF A;  3IDW A;  4ZH4 A;  5KT2 A;  1A6S A;  1SKR A;  5EWG A;  5D4B A;  2E1F A;  2PFO A;  1QQ6 A;  4A8E A;  1URJ A;  2ASD A;  4KLO A;  5HRD A;  4PZN A;  4QNL A;  1UA1 A;  4K97 A;  1NK8 A;  1ZQV A;  1L3U A;  4AT9 B;  4O3P A;  4Q43 A;  2BQU A;  5HML A;  2BHN A;  1NJZ A;  2OXO A;  3HJE A;  4B9M A;  1Q78 A;  4G9B A;  5J0W A;  1L6N A;  5J8Y A;  3PR4 A;  2ZXH A;  4ECT A;  2YTU A;  7ICV A;  1D9D A;  2HW3 A;  4CNQ A;  3JYY A;  4NL9 C;  5H2F U;  1NK0 A;  3JPN A;  3AEV A;  7ICO A;  4DSE A;  2KHV A;  4F4W A;  4QIW F;  2QKQ A;  1J97 A;  2AU0 A;  1S97 A;  1D8L A;  3QU2 A;  3G6V A;  4UB2 A;  3GFK B;  4BXO B;  3EUB 2;  3KOO A;  3HPO A;  4KN7 A;  2NV3 A;  2IHO A;  3PO4 A;  4KTQ A;  4R8U B;  4C4T A;  4Y2U A;  4DQP A;  3OWG A;  4PL1 A;  4UBB A;  3UPQ A;  5DG9 A;  4RWP A;  4OAF A;  4RQ2 A;  1ECW A;  4DQS A;  1ZOL A;  5J0R A;  4PGY A;  3SV3 A;  1U49 A;  2HOF A;  3RR7 A;  3PHZ A;  4RNM A;  1J2M A;  1ZQU A;  3MAB A;  3J81 j;  2XGQ A;  1ZQY A;  4DFM A;  2R8J A;  4E0D A;  2KE7 A;  3E58 A;  3QNM A;  1B43 A;  2JRZ A;  4FHV A;  3N4M B;  2AXT U;  4ACO A;  4KN4 A;  4EEB A;  4KLM A;  3D2S A;  1XS9 D;  4UAT A;  4ECU A;  4KLE A;  1X9W A;  2F44 A;  5AM3 A;  5KFP A;  4DCC A;  1VFG A;  3KD3 A;  2ZHB A;  4MEX A;  4EEL A;  5J2K A;  4DQI A;  4UAV A;  4NM1 A;  7ICJ A;  2ZJA A;  4IRK A;  2JEI A;  1XO0 A;  4O3S A;  3IHQ B;  9ICC A;  1D9F A;  2HHS A;  2KD1 A;  1KDH A;  1QQ7 A;  2KK0 A;  4YR2 A;  5AI9 A;  3GQC A;  9ICJ A;  1ZD4 A;  2I9G A;  4X4S A;  2KNJ A;  3I28 A;  1XSL A;  8ICK A;  4O6A A;  5DEC A;  5HRL A;  3PML A;  1ZYQ A;  4JV1 A;  2DR9 A;  2K4E A;  2DFL A;  4CRX A;  4E8F A;  1Q3U A;  1ZQB A;  3C5F A;  2ZTC A;  5DGA A;  5AM1 A;  4R66 A;  2ZUC A;  4WC5 A;  3SI8 A;  3ETR A;  1SL0 A;  2ID1 A;  2KKP A;  3AQE A;  5KFN A;  3QEB Z;  4CF5 A;  1TK5 A;  2RFF A;  8ICM A;  5HRF A;  1JRP A;  5KFW A;  9ICV A;  4DL4 A;  5J0O A;  1ZQD A;  3SQI A;  3F2B A;  2IOF K;  4PJ0 U;  1KKX A;  2E8M A;  2DKZ A;  3OUY B;  2YB1 A;  1R8C A;  1NK6 A;  2KG5 A;  3TI0 A;  5KT7 A;  1ZRM A;  4EBE A;  3BQ7 A;  4ECY A;  2P6R A;  1X6I A;  5ALG A;  4DS4 A;  4IS7 A;  3WK7 A;  4BUG A;  4X4O A;  5J29 A;  4QWB A;  1RQN A;  4X4N A;  3RAX A;  1PK1 B;  3C29 A;  4B9T A;  5KG1 A;  2LYH A;  4Y2Q A;  4RQ1 A;  2EDU A;  3PY8 A;  4NV0 A;  9ICE A;  3WK9 A;  3NVO A;  4MF8 A;  2LBO A;  4O9M A;  1U9L A;  4UB8 U;  1UA0 A;  3M8S A;  3V7J A;  5AK4 A;  3BQ1 A;  4ELT A;  4CCH A;  2OEH A;  3QYP A;  4FBT A;  5HHH A;  2HOQ A;  4S3N A;  1KW4 A;  3WFQ E;  2B4V A;  4BXO A;  1Q8K A;  4UD4 A;  8ICQ A;  1ZQI A;  1K1S A;  4KLD A;  5DB8 A;  4UAR A;  2NO5 A;  3ZDD A;  2ZH3 A;  3WFP A;  3Q8Q B;  4MF2 A;  5J2A A;  4JLX A;  3K1R B;  2ZG6 A;  4EV6 A;  3RB6 A;  4AT8 A;  1JRO A;  2W3R A;  3ZD8 A;  1Y88 A;  7ICQ A;  2Q66 A;  3MGH A;  2ZHA A;  2KV2 A;  2XGP A;  4WC6 A;  3QUQ A;  4QZG A;  1X6J A;  5CFU A;  3WKD A;  1N61 A;  4F4K A;  3V6J A;  2WTF A;  4DOB A;  4M04 A;  3V6K A;  3M9O B;  5HC9 A;  4PHP A;  4FBU A;  3AL0 B;  5T14 A;  1A0P A;  2BZF A;  4OJ6 A;  1COO A;  1JAL A;  3IG5 A;  2HN2 A;  1B4F A;  4BWJ A;  2YMM A;  3SYZ A;  3H0L B;  4F91 B;  1L5U A;  2JEF A;  4QIW C;  2GO7 A;  2E8P A;  4MFA A;  5JUM A;  4YCX A;  5KFJ A;  3TAQ A;  4DL7 A;  2DR7 A;  3NYB A;  3F53 A;  4RT2 A;  4AP9 A;  3RRG A;  3NRZ A;  1TVA A;  4WC7 A;  5AKK A;  8ICA A;  7ICT A;  2KP7 A;  4EZ9 A;  4M9N A;  2AGP A;  3Q8P B;  2ZH4 A;  7ICI A;  1ZQZ A;  3EW9 A;  3ALR A;  2KVC A;  4EYH B;  1HEK A;  4Y2J A;  5J2B A;  3MGI A;  2BBH A;  8ICX A;  2CN1 A;  5KFB A;  1UET A;  1CI4 A;  1JN3 A;  2ZIV B;  4JV2 A;  4O3O A;  3SV4 A;  4YR0 A;  5HP4 A;  4DS5 A;  4RPY A;  1SL2 A;  3ONN A;  3PW2 A;  1ZQJ A;  4LEZ A;  4B9N A;  3WK5 A;  5KTQ A;  4F3O A;  3HJ4 A;  1L8L A;  2KSO A;  1MIW A;  3QZ8 A;  5DBA A;  1AQ6 A;  3C1Z A;  4OAH A;  1DGJ A;  3H38 A;  3HT3 A;  2C2R A;  5L9X A;  3L5K A;  4OJP A;  2IHM A;  1VDV A;  1UT5 A;  4Z6E A;  3RJK A;  2D3D A;  4I2E A;  2EWR A;  2G09 A;  4QWC A;  3GU3 A;  4ECS A;  2NRV A;  4Q45 A;  2KN7 A;  9ICB A;  5AI6 A;  4FS1 A;  2KEY A;  5AKG A;  1CUK A;  4R63 A;  4EYI B;  3RB3 A;  5HRH A;  1K5O A;  5DG8 A;  3AQL A;  4ED6 A;  1RYR A;  2Z7J A;  1NJX A;  2YN4 A;  4LEV A;  2PXI A;  2HHW A;  5TIS U;  4FHP A;  2ZIW A;  1Z4O A;  3L3F X;  2NRW A;  1F0M A;  1SXD A;  2A19 A;  4WJ3 B;  2K8B B;  3H0M B;  2M2U A;  1OU5 A;  5J2F A;  2YQE A;  2UVV A;  1T3Q A;  3T5L A;  2DQN B;  7ICH A;  1S8O A;  5ALD A;  3MR2 A;  3AQM A;  4MFC A;  4PHD A;  5KFM A;  1ZQG A;  4KLG A;  1COK A;  4F5P A;  2RLT A;  1EXN A;  3B0X A;  4J9K A;  2AQ0 A;  4Y2X A;  4RWN A;  3B9J A;  2DUY A;  8ICI A;  1QH9 A;  2EQY A;  9ICN A;  2ZIX A;  3PSF A;  1RXW A;  3TKA A;  1DK3 A;  2CXY A;  1Q46 A;  2Y0S F;  5J2G A;  5ALT A;  4R65 A;  3RJI A;  5B5E U;  3N7R C;  3EF2 A;  1KNY A;  2JXJ A;  4RNO A;  2ASJ A;  5HHI A;  5C0Y A;  3ETL A;  3RJE A;  1SV4 A;  4ECX A;  1RG6 A;  3T5J A;  3Q8K A;  5EOZ A;  2N1R A;  4WOY A;  4M9H A;  5JTG A;  5CB1 A;  2NO4 A;  4G3I A;  2I5H A;  3NAS A;  9ICL A;  3D2N A;  5KT4 A;  4K9B A;  3NWI A;  1K1Q A;  4EX7 A;  4BWM A;  5J2J A;  4J9M A;  4YVZ A;  1M6Y A;  3C2L A;  1BPY A;  5AKI A;  4YMM A;  2E8N A;  5AKJ A;  2A1J A;  2Y1J A;  4KLH A;  4X4R A;  3WFR E;  2G5H B;  2NRT A;  1L3T A;  3CRX A;  3RH4 A;  1BPD A;  2E8O A;  3QUT A;  3LYS A;  5IIL A;  3PX6 A;  3WFS C;  3E0F A;  4AYB F;  4RQ5 A;  2JEJ A;  4CF4 A;  1PK1 A;  4RQ4 A;  4WC0 A;  3LQC B;  4LEY A;  1L3S A;  1JI7 A;  5KG4 A;  5L1J A;  2HMX A;  4X0B A;  1KSP A;  2NRZ A;  4RQM A;  4DLE A;  3L9D A;  5AM4 A;  3ZI4 A;  2EZX A;  3MDC A;  1WCN A;  3EPG A;  1PK3 A;  3SAG A;  1JX4 A;  4P4P A;  3PW5 A;  2H3V A;  3K1Z A;  2WB1 C;  2HVH A;  2IMW P;  5J0X A;  1TAU A;  5KFR A;  2ZIW B;  5J0U A;  5DED A;  4I2I A;  3NRW A;  2R8G A;  4UAU A;  3M6K A;  3UXP A;  2J6T A;  3C21 A;  1JQR A;  5EE3 A;  2JGA A;  2QLT A;  4DFJ A;  2PFN A;  5L1I A;  2WAQ F;  2R18 A;  5F3X B;  2JZB B;  3N7S C;  1QSL A;  4B9V A;  1L3V A;  2IBK A;  2BE3 A;  2WAQ C;  1ZD5 A;  3ORY A;  2WF6 A;  2C28 A;  4FHY A;  4F5N A;  4GC7 A;  3RH5 A;  4YD2 A;  1N2X A;  2ZH5 A;  1OUQ A;  4O3M A;  3PX4 A;  1N62 A;  3OPX A;  3TAP A;  5KL1 B;  4DFK A;  3H7I A;  4RQN A;  3F2D A;  1L7M A;  2ES6 A;  1TK8 A;  5BOM A;  4WBY A;  1ZQH A;  5IIJ A;  4I2J A;  4DF4 A;  3AMZ A;  2KKV A;  5HRE A;  7ICL A;  2XY5 A;  1ZQA A;  2O6K A;  8ICZ A;  3LWL A;  5L1M A;  4EEN A;  9ICO A;  3OJS A;  2C2E A;  2BKE A;  4BJQ A;  5HMM A;  3WKC A;  4MHV A;  5KFL A;  2MU2 A;  4X4P A;  1Q79 A;  1GPJ A;  2IOH A;  2GLE A;  2R8H A;  3CP8 A;  1OXJ A;  2GOL A;  2I1Q A;  5KFX A;  2BQR A;  4C8M A;  2BCQ A;  3TAN A;  2HHV A;  3Q8R B;  5AKH A;  2FPM A;  5FP0 A;  3RBE A;  3WKE A;  2OCE A;  1X2I A;  2I6X A;  2VA8 A;  4DL6 A;  3L4P A;  2YMQ A;  4K8V A;  9ICI A;  2MUT A;  2LYB A;  1ZJN A;  1NJW A;  4ICA A;  1PX5 A;  3PX0 A;  5G5G A;  4US8 A;  2O5A A;  4UAZ A;  3F2C A;  3KZI U;  3H3A A;  2W55 A;  4Z6F A;  2ZTE A;  3H40 A;  1L7N A;  3GIM A;  5KFG A;  3KBB A;  3VC8 A;  3N28 A;  2YX8 A;  4RU9 A;  5AK5 A;  4NXU A;  5C5J A;  2WF5 A;  4RNN A;  2E1E A;  5III A;  5KT3 A;  3AQK A;  1ZXI A;  3H8J A;  1IG6 A;  1YZ7 A;  5ALN A;  4GC6 A;  4KMU A;  1T8E A;  2G5I B;  4P0Q B;  3KKA A;  3FM9 A;  9ICT A;  4EBC A;  4FH5 A;  3PST A;  5DB9 A;  5KFT A;  3TAD A;  3OHA A;  1VJ7 A;  2MRL A;  2XIC A;  1WOT A;  1S0O A;  1JUD A;  2EZZ A;  5CWR A;  2DPI A;  4B9S A;  1SKW A;  5DBC A;  4US9 A;  3BJY A;  1QTM A;  1X9X A;  1BPB A;  3RB0 A;  3RR8 A;  2HHU A;  4ECZ A;  3C5G A;  1S10 A;  2ZH8 A;  3QUB A;  1S76 D;  3B0Y A;  2XY7 A;  1ZJM A;  5KFS A;  4ECW A;  1KFD A;  1NK5 A;  2M2W A;  5AM0 A;  4R64 A;  4WBZ A;  1S0V A;  5DDM A;  2QAR A;  1NZB A;  2F2A B;  4O3Q A;  2W8K A;  1NJY A;  5KFA A;  3F5E A;  1RQL A;  4AT7 A;  2H3Q A;  1S0N A;  2WF9 A;  4I29 A;  4GLX A;  3T79 A;  2W9B B;  4J9O A;  5DBB A;  3FC4 A;  4Y2S A;  4IQW A;  3H8M A;  5KNI A;  5KFE A;  4LJX A;  3GV8 B;  1O08 A;  4NXW A;  2B56 A;  1BPZ A;  3C28 A;  4M2Y A;  4P0P A;  3R9K A;  3AQF A;  4JB3 A;  3NVY A;  4YP3 A;  4EZ6 A;  2MA1 A;  4CF3 A;  1Z1B A;  4DSF A;  2KHQ A;  2Y9T A;  4XQ8 A;  5CR0 A;  3H39 A;  2F77 X;  3JCF A;  2XO7 A;  3VCB A;  4C8L A;  2C22 A;  5ALO A;  5EE0 A;  2PI4 A;  3T5K A;  4WC3 A;  2M2V A;  4KLT A;  4IG8 A;  1ARO P;  4EBJ A;  1BVS A;  3M7D A;  5KFO A;  4FHX A;  5GTI U;  2F8K A;  2LM1 A;  4CGZ A;  3SEI A;  2DR5 A;  2ZH2 A;  5ALS A;  4C8O A;  5ALZ A;  2AHO B;  2ZH6 A;  1SXE A;  5AIB A;  4JV0 A;  1TK0 A;  3NS1 A;  3NKU A;  3MFH A;  4ATB B;  2Q4T A;  3EZ5 A;  4B6J A;  2D6F C;  2F1J A;  3LVW A;  4MFF A;  3HIY A;  5AKX A;  4DFD A;  5ALY A;  4FZL A;  4I27 A;  2XI9 A;  4RQ8 A;  5AKZ A;  4O3N A;  1P7D A;  4UAW A;  5EE1 A;  4YXJ A;  1HUZ A;  4O67 A;  2K4I A;  4KLF A;  3ICX A;  2EAO A;  2L5Y A;  1BNP A;  3WU2 U;  4QZH A;  4C7Y A;  4UAY A;  5ALK A;  4IR1 A;  4HX0 A;  2HI0 A;  5AM5 A;  8ICJ A;  3QU5 A;  8ICS A;  5CJ7 A;  4PGQ A;  4DL2 A;  5KL8 B;  4UB1 A;  5BPC A;  8ICE A;  4PZO A;  4JLZ A;  2FI1 A;  4XRH A;  2BBJ A;  4IRC A;  3C2K A;  1S77 D;  3EYZ A;  3M6Z A;  3UM9 A;  4TQS A;  4YD1 A;  2DF4 B;  5KFU A;  2KSO B;  4RQ7 A;  5J8Y C;  1X66 A;  5HNK A;  3EPI A;  3AU2 A;  8ICO A;  3H37 A;  4LT6 A;  1ZQW A;  2W8L A;  1RYS A;  5CHG A;  3SAF A;  4DF8 A;  8ICC A;  1QLN A;  3JZ0 A;  3T3F A;  3SR6 A;  4DSK A;  1ZQS A;  5KFC A;  1ZQX A;  4HAI A;  3CYM A;  4F92 B;  3PW0 A;  4E7X A;  3MBY A;  1ED1 A;  1SWV A;  2HCF A;  4PGX A;  2F1I A;  5J0Q A;  4USA A;  1Z00 B;  1IXR A;  3OTQ A;  2BCR A;  1FO4 A;  4XQ7 A;  4OD0 A;  1SKS A;  4PPX A;  2M0N A;  4J9S A;  5ALL A;  2UVU A;  4OO1 J;  4RT3 A;  4YG2 A;  4YR3 A;  5CA7 A;  4KLS A;  1SGG A;  4MKP A;  4EX6 A;  4F4Y A;  2E3T A;  1L7P A;  2H3I A;  2HBL A;  4DSJ A;  1R8B A;  4EBK A;  1F44 A;  2PFQ A;  9ICW A;  3SAH A;  4GXJ A;  1A77 A;  4LZD A;  1UEU A;  1ZQE A;  4DL5 A;  3GIK A;  3THV A;  1NNL A;  2LM4 A;  2DGZ A;  2LI6 A;  1F5S A;  3RF9 A;  1SV0 C;  4O68 A;  1IM4 A;  9ICS A;  1XSP A;  4DFP A;  4AT9 A;  4J9L A;  5A0L A;  2FMS A;  5IIK A;  4X4T A;  5KT5 A;  2V9W A;  1N63 A;  1ZQO A;  4RQ6 A;  2HSZ A;  5DB6 A;  1HUO A;  4AT8 B;  2GA9 D;  1NK9 A;  5D63 A;  4AYB C;  1KLN A;  3ISD A;  3ZDE A;  4Q8E A;  3FAH A;  4KIT B;  5KFQ A;  5ALJ A;  4QZE A;  2ZXI A;  1ZD3 A;  5ALE A;  3RJG A;  4QZI A;  3BDP A;  2G08 A;  3QE9 Y;  5AI4 A;  9ICK A;  5BOL A;  3MCR A;  3MR5 A;  2HOI A;  5KG7 A;  4QWA A;  1Q3V A;  4I2F A;  4F71 A;  5IIO A;  4M9G A;  1XU4 A;  2NRK A;  4I2H A;  3NVZ A;  4C80 A;  2JZB A;  3HW8 A;  2YML A;  3RJJ A;  3K75 D;  1SIJ A;  1ZQQ A;  1MIV A;  4F72 A;  5AI0 A;  4F5R A;  4UB3 A;  5AKE A;  1UT8 A;  1VJ5 A;  1HIW A;  3RTV A;  4J9N A;  3N97 B;  3HP6 A;  1MN8 A;  2K89 A;  3WKB A;  2DR8 A;  5DQI A;  3A0B U;  3TQ1 A;  3QZ7 A;  2FLL A;  1KEJ A;  5JU5 A;  4NLG A;  4F8R A;  4O69 A;  1V9P A;  1YT3 A;  2QB1 A;  2KVS A;  5J2E A;  4F5Q A;  1LB2 B;  4M6W A;  1PUZ A;  2MAX A;  2A1A A;  1MSW D;  4M6W B;  2VAN A;  2VKQ A;  4DSI A;  2JMG A;  4EGW A;  1QSY A;  3PVX A;  1ZQF A;  3D6J A;  5L1K A;  1XC9 A;  4NLC A;  4FHW A;  1ZRN A;  5HR7 A;  1X40 A;  4X4Q A;  3N7P D;  4I2B A;  4OJ5 A;  1WWV A;  4WCW A;  4KM5 A;  5F9N A;  9ICM A;  3TAR A;  4IQU A;  4WQK A;  4QZC A;  4KX5 A;  4KLU A;  4C4S A;  5IIN A;  1ZQM A;  2GWS A;  2AH5 A;  5D49 A;  3G6X A;  3BQ0 A;  2W3S A;  2ZIV A;  4U7C A;  5KAF U;  2G06 A;  8ICV A;  4HYK A;  1V85 A;  3IG8 A;  3S6J A;  5DLG A;  2AJQ A;  2IOF A;  4UB4 A;  8ICB A;  3PMN A;  2KOB A;  2EH9 A;  3SZ2 A;  4EBD A;  5CFS A;  4K99 A;  1N48 A;  5CP2 A;  5HRG A;  3UMB A;  3OVA A;  2ZH7 A;  3PNC A;  4X4U A;  3MR3 A;  3KHG A;  5KG0 A;  1WCL A;  2MSN A;  4J9R A;  5ALH A;  8ICN A;  2LHT A;  1JIH A;  3LVV A;  4I2A A;  2FMP A;  2YMP A;  4M9L A;  7ICF A;  2BCS A;  4F2R A;  4JMU A;  5ALP A;  4DQR A;  5ALM A;  4ELV A;  2DWQ A;  7ICU A;  4GIB A;  4QJF B;  3GII A;  3CK6 A;  1T3N A;  1F5A A;  4TUR A;  2VJ5 A;  2KIV A;  1BPX A;  2KZM A;  1IV8 A;  1V97 A;  3WFO A;  3PW7 A;  3RJH A;  3WK4 A;  1KN5 A;  4P0Q A;  4QW9 A;  2K4H A;  2K8C B;  2EAP A;  4KLI A;  2KJ5 A;  4NKU A;  3O0F A;  1ZQ1 C;  5D46 A;  1RYU A;  3H0R B;  2BDU A;  1X9M A;  3ZD9 A;  4O5E A;  1VLB A;  3MFI A;  4F50 A;  1R8A A;  3PSI A;  3HX0 A;  2ASL A;  5KFH A;  3QUC A;  3BQT A;  3PO5 A;  1IIP A;  4WC2 A;  4PL2 A;  1KRP A;  5ALQ A;  4KX3 A;  2H3Z A;  2FLP A;  4WC1 A;  4UQG A;  1C20 A;  2DL0 A;  5ALW A;  4XA5 A;  5CHE A;  2WB1 F;  1H38 A;  4IRD A;  2K60 A;  3C66 A;  4Y2P A;  1QCK A;  3H8S A;  3LWM A;  4EEK A;  3T5H A;  5JTI A;  3UMG A;  4KLQ A;  9ICH A;  4DSL A;  4O0I A;  7ICM A;  3IN5 A;  1V4A A;  2W9B A;  1ZQP A;  3AUO A;  4RPX A;  1YLQ A;  2RDI A;  4FH3 A;  3RH6 A;  4IR9 A;  1MQ2 A;  1N56 A;  8ICH A;  2OH2 A;  1LKY A;  2P6U A;  3ISC A;  1T94 A;  3JPQ A;  1MA7 A;  4X5V A;  4Y2V A;  2LKY A;  5AM2 A;  2EAM A;  5CEH A;  5DKW A;  2KTQ A;  1ZQK A;  4RQ0 A;  3F5A A;  3IM1 A;  1NKB A;  5J0P A;  2XCP A;  3C1Y A;  3BZK A;  4I2D A;  3JPO A;  4E80 A;  2LPE A;  1DOQ A;  1NKE A;  2IUB A;  5DG7 A;  3RJF A;  4ED8 A; 
#chains in the Genus database with same CATH homology
 2W9M A;  3Q8P B;  2FPL A;  1SZP A;  2ZH4 A;  7ICI A;  5F2V O;  4YP3 A;  5J2H A;  1ZQZ A;  1XWL A;  3EW9 A;  4EZ6 A;  4K4H A;  4Q8F A;  2BDP A;  4YN4 A;  9ICU A;  4I2G A;  4DSF A;  4DEZ A;  4EYH B;  2PBE A;  4XQ8 A;  1BGX T;  5CR0 A;  5J2B A;  3MGI A;  2W9A A;  8ICX A;  5KFB A;  3V6H A;  1UET A;  1TFY A;  3H39 A;  4NXZ A;  4DOC A;  2XC9 A;  2XO7 A;  5KT6 A;  1JN3 A;  4C8L A;  4GXK A;  2C22 A;  3UPS A;  4JK1 A;  3NTU A;  4O3O A;  5F9L A;  2JEG A;  2PI4 A;  3SV4 A;  3UQ2 A;  4YR0 A;  3T5K A;  4EEY A;  4Q44 A;  3RRH A;  4KLJ A;  3OSN A;  2M2V A;  5HP4 A;  3MDA A;  4KLT A;  4WC3 A;  7ICN A;  4IG8 A;  2M2T A;  1ARO P;  4RPY A;  4DS5 A;  1RZT A;  1SL2 A;  3PW2 A;  1ZQJ A;  4BGD A;  1BVS A;  5KFO A;  4RUC A;  4FHX A;  4EBJ A;  4P2H A;  4WC4 A;  4B9N A;  4O5K A;  5DQH A;  4YFK A;  2A1J B;  5KTQ A;  3PW4 A;  1XSN A;  1RPL A;  2V4R A;  4F3O A;  5DLF A;  4NLK A;  3HJ4 A;  4F93 B;  2DVI A;  1MIW A;  3QZ8 A;  2DR5 A;  2ZH2 A;  4NKT A;  4C8O A;  5KG2 A;  5DBA A;  1SL1 A;  3G6Y A;  2ZH6 A;  1TK0 A;  2UVR A;  3C1Z A;  4JV0 A;  3H38 A;  3HT3 A;  2C2D A;  2C2R A;  2ZUD A;  5L9X A;  2ISO A;  3MFH A;  2IHM A;  2AGO A;  4ATB B;  1UT5 A;  4Z6E A;  3EZ5 A;  2DPJ A;  2Y1I A;  1U48 A;  3RJK A;  2W9C B;  2F1J A;  4I2E A;  4X4V A;  2VA3 A;  4QWC A;  4MFF A;  3HIY A;  3JPR A;  4ECS A;  1S9F A;  4JWN A;  2NRV A;  1FA0 A;  1HJP A;  4Q45 A;  2KN7 A;  4I27 A;  3QEA Z;  7ICS A;  3OJU A;  9ICB A;  4RQ8 A;  4M47 A;  4FS1 A;  4O3N A;  3OVS A;  4I2C A;  1CUK A;  3OUY A;  4R63 A;  4EYI B;  4FS2 A;  4ECQ A;  3RB3 A;  1NK7 A;  1MC8 A;  4UAW A;  8ICY A;  4XUS A;  3KHL A;  4F5O A;  5HRH A;  2KFZ A;  5DG8 A;  4YXJ A;  3GV5 B;  1JXL A;  1HUZ A;  4KLF A;  4RZR A;  5J2D A;  1LV5 A;  3ZDB A;  3AQL A;  1BNP A;  5DGB A;  2B21 A;  4QZH A;  2BPF A;  4ED6 A;  1RYR A;  5L1L A;  4UAY A;  1NJX A;  4IR1 A;  4M5D A;  2PXI A;  2HHW A;  4YMN A;  3PV8 A;  3FDS A;  4FHP A;  3H8W A;  2FLN A;  1RXV A;  8ICJ A;  8ICS A;  2MUT B;  5HRB A;  2NRW A;  5CJ7 A;  4PGQ A;  3PR5 B;  4DL2 A;  4UB1 A;  4P4O A;  1TFW A;  5KFZ A;  5BPC A;  8ICE A;  2M2U A;  1OU5 A;  3JPT A;  5J2F A;  4XRH A;  2UVV A;  2ZJ8 A;  2BPG A;  4IRC A;  3C2K A;  1S77 D;  2P66 A;  4B9U A;  9ICX A;  3EYZ A;  4TQS A;  4YD1 A;  3T5L A;  3JPS A;  7ICH A;  1ZQC A;  5KFU A;  4RQ7 A;  3OHB A;  5HNK A;  3MR2 A;  3C18 A;  5J0S A;  3AQM A;  3OV7 A;  3EPI A;  4IQV A;  3AU2 A;  5KFM A;  3FYH A;  4PHD A;  3TFR A;  1ZQW A;  1ZQG A;  4QW8 A;  4F5P A;  2W8L A;  1T7P A;  4O5C A;  4LT6 A;  1EXN A;  3B0X A;  3RB4 A;  1RYS A;  5CHG A;  4J9K A;  2AQ0 A;  2HHP A;  4RWN A;  4DF8 A;  8ICC A;  4F4Z A;  1QLN A;  5KFD A;  5DQG A;  3JZ0 A;  3T3F A;  3Q8S B;  4I28 A;  8ICI A;  8ICL A;  3V7K A;  4DSK A;  2W9C A;  9ICN A;  1ZQS A;  2BGW A;  5KFC A;  3C2M A;  2HVI A;  8ICU A;  2PFP A;  1ZQL A;  2ZTD A;  1ZQX A;  5KFY A;  4Z6C A;  3BQ2 A;  2F1H A;  2V4Q A;  3V72 A;  1RXW A;  4F92 B;  1DK3 A;  3PW0 A;  4E7X A;  7ICP A;  1NKC A;  4ECR A;  7ICR A;  3MBY A;  5J2G A;  3EWA A;  5DB7 A;  4MEY A;  4R65 A;  4R8U A;  4UBC A;  3RJI A;  9ICP A;  4PHA A;  4KLG A;  4PGX A;  2F1I A;  3KHH A;  1TFR A;  5J0Q A;  1Z00 B;  4M0A A;  1IXR A;  1MIY A;  2BCR A;  1KNY A;  4RNO A;  2HHT A;  3C23 A;  4QWD A;  2ASJ A;  4LZG A;  1JAJ A;  5HHI A;  3ETL A;  5TZV A;  3RJE A;  4XQ7 A;  4F2S A;  1SKS A;  4PPX A;  4J9S A;  5DDY A;  4DQQ A;  3GV7 B;  4ECX A;  8ICR A;  2UVU A;  4RT3 A;  3M9M B;  2BQ3 A;  3T5J A;  4YG2 A;  3GIL A;  4YR3 A;  5CA7 A;  3Q8K A;  5EOZ A;  3ZDA A;  4KLS A;  4M9H A;  9ICF A;  2ZUB A;  4ZH4 A;  5KT2 A;  5CB1 A;  4F4Y A;  1SKR A;  5EWG A;  2ZH9 A;  5D4B A;  8ICP A;  3OVB A;  2PFO A;  4G3I A;  4F4X A;  2ASD A;  4KLO A;  9ICL A;  4QZB A;  5HRD A;  1UA1 A;  1NK8 A;  4DSJ A;  1ZQV A;  5KT4 A;  4LVS A;  1R8B A;  4EBK A;  3UXN A;  3HWT A;  1L3U A;  1K1Q A;  2PFQ A;  1A76 A;  4AT9 B;  4JUZ A;  9ICW A;  4BWM A;  4ATB A;  4O3P A;  5J2J A;  4Q43 A;  5HML A;  2BHN A;  4J9M A;  1Z3E B;  5J0Y A;  4GXJ A;  2BQU A;  1NJZ A;  1A77 A;  1MQ3 A;  4YVZ A;  1ZQN A;  5J0W A;  4LZD A;  3C2L A;  1ZQE A;  1UEU A;  1D8Y A;  9ICQ A;  4DL5 A;  3PR4 A;  3GIK A;  1BPY A;  3THV A;  4ECT A;  4NY8 A;  1D9D A;  7ICV A;  4YMM A;  2HW3 A;  1U4B A;  2HHX A;  3JYY A;  2A1J A;  2Y1J A;  4KLH A;  1NK0 A;  4X4R A;  4UD5 A;  4RUA A;  3JPN A;  2NRT A;  3KHR A;  7ICO A;  3WFR E;  1L3T A;  1IM4 A;  9ICS A;  3RH4 A;  4DSE A;  1BPD A;  1C7Y A;  4F4W A;  5EWF A;  1XSP A;  5IIL A;  4DFP A;  2AU0 A;  3PX6 A;  4AT9 A;  1S97 A;  2BPC A;  4J9L A;  2FMS A;  5KFV A;  4RQ5 A;  2JEJ A;  5IIK A;  3WFS C;  4RQ4 A;  4X4T A;  1D8L A;  2Q66 A;  4ED7 A;  5KT5 A;  2V9W A;  4B9M A;  3LQC B;  4WC0 A;  3G6V A;  1L3S A;  1ZQO A;  4RQ6 A;  5DB6 A;  5KG4 A;  1HUO A;  5L1J A;  4AT8 B;  4YMO A;  1NK9 A;  1KTQ A;  4UB2 A;  9ICG A;  3GFK B;  1KLN A;  3ISD A;  4FO6 A;  4BXO B;  3ZDE A;  4X0B A;  4Q8E A;  4KIT B;  5KFQ A;  4KN7 A;  3HPO A;  1KSP A;  8ICF A;  2NRZ A;  4DLE A;  2J6S A;  4QZE A;  3L9D A;  3PO4 A;  3RJG A;  4QZI A;  3BDP A;  5EWE A;  1WCN A;  3MDC A;  3QE9 Y;  4R8U B;  2H5X A;  3GIJ A;  3EPG A;  4KTQ A;  9ICK A;  5BOL A;  4DQP A;  3MR5 A;  4UBB A;  4QZF A;  3UPQ A;  5KG7 A;  5DG9 A;  4QWA A;  4TUQ A;  2OWO A;  1JX4 A;  5HRK A;  4P4P A;  4I2F A;  3PW5 A;  4M9G A;  5IIO A;  2NRK A;  1XO1 A;  1XU4 A;  4RQ2 A;  2HVH A;  3HJ1 A;  1JXE A;  4DQS A;  4RWP A;  2IMW P;  4I2H A;  5J0R A;  4PGY A;  5J0X A;  3SV3 A;  1U49 A;  3RR7 A;  3LDA A;  4RNM A;  1TAU A;  2JZB A;  2DRB A;  1TV9 A;  5KFR A;  3HW8 A;  1ZQU A;  3MAB A;  5J0U A;  4I2I A;  2XGQ A;  3RJJ A;  5DED A;  1NOM A;  1ZQY A;  3ISB A;  4DFM A;  3K75 D;  2ZJ5 A;  2R8G A;  2R8J A;  8ICG A;  4E0D A;  4TQR A;  1NK4 A;  1ZQQ A;  4ECV A;  1B43 A;  2XCA A;  4RPZ A;  3UXP A;  3N4M B;  4FHV A;  1MIV A;  4KN4 A;  2J6T A;  4F5R A;  4UB3 A;  1JMS A;  4KLM A;  3C21 A;  1XS9 D;  1X9S A;  1JQR A;  1UT8 A;  4ECU A;  4KLE A;  1X9W A;  1YLQ A;  3RTV A;  4QWE A;  4J9N A;  2IA6 A;  3N97 B;  4ED2 A;  4DFJ A;  3HP6 A;  2PFN A;  5L1I A;  5KFP A;  4FH3 A;  1VFG A;  2DR8 A;  2ZHB A;  2JZB B;  5DQI A;  4MEX A;  1L3V A;  1QSL A;  2IBK A;  4B9V A;  2BE3 A;  3TQ1 A;  5J2K A;  4UB5 A;  4DQI A;  3ORY A;  3QZ7 A;  2C28 A;  2FLL A;  4F5N A;  4NM1 A;  4FHY A;  7ICJ A;  2ZJA A;  1KEJ A;  5KG3 A;  4GC7 A;  4YD2 A;  3RH5 A;  4IRK A;  4NLG A;  3H37 A;  2JEI A;  2ZH5 A;  3PX4 A;  4F8R A;  4O3S A;  3TAP A;  1V9P A;  2ALZ A;  3IHQ B;  9ICC A;  2PI5 A;  5J2E A;  2M9N A;  3H7I A;  4DFK A;  1D9F A;  4F5Q A;  3Q8L A;  2HHS A;  1LB2 B;  4M6W A;  2MAX A;  1KDH A;  4QZ8 A;  1NZP A;  4YR2 A;  1MSW D;  1TK8 A;  2KZZ A;  4AT7 B;  4PHE A;  5BOM A;  4WBY A;  4M6W B;  3GQC A;  5IIJ A;  2R8I A;  1ZQH A;  9ICJ A;  4I2J A;  4DF4 A;  2VAN A;  4X0A A;  2I9G A;  4DSI A;  4X4S A;  1QSY A;  3PVX A;  1XSL A;  1ZQF A;  8ICK A;  5HRE A;  4O3R A;  5DEC A;  5J0T A;  5L1K A;  1XC9 A;  7ICL A;  2XY5 A;  1ZQA A;  4FHW A;  5HRL A;  2KZ3 A;  8ICZ A;  3PML A;  3LWL A;  1ZYQ A;  4JV1 A;  4GXI A;  2DR9 A;  2DFL A;  9ICO A;  4E8F A;  4X4Q A;  1ZQB A;  4I2B A;  3C5F A;  2ZTC A;  5DGA A;  3OJS A;  2C2E A;  4WCW A;  4Z6D A;  2BKE A;  4R66 A;  5HMM A;  4DLG A;  2ZUC A;  4PH5 A;  5F9N A;  9ICM A;  4WC5 A;  5KFL A;  1T4G A;  3SI8 A;  3TAR A;  1SL0 A;  4IQU A;  2ID1 A;  4ELU A;  1Z00 A;  4QZC A;  4MFC A;  4X4P A;  1Q79 A;  5KFN A;  3QEB Z;  1TK5 A;  4KLU A;  2R8H A;  4J9P A;  5IIN A;  1KFS A;  8ICT A;  1ZQM A;  2GWS A;  5D49 A;  3G6X A;  4QZA A;  8ICM A;  2RFF A;  5HRF A;  3BQ0 A;  3OGU A;  2I1Q A;  5KFW A;  5KFX A;  2BQR A;  9ICV A;  2RDJ A;  4C8M A;  2BCQ A;  4DL4 A;  3TAN A;  3LK9 A;  5J0O A;  2FPK A;  1U45 A;  1U47 A;  1ZQD A;  3Q8R B;  4BDP A;  2HHV A;  4YQW A;  3RBD A;  4HYK A;  8ICV A;  2FPM A;  1PZN A;  5DLG A;  4UB4 A;  8ICB A;  2AJQ A;  3AU6 A;  3OUY B;  5KFK A;  3PMN A;  3RBE A;  1R8C A;  1NK6 A;  3TI0 A;  1B22 A;  1BPE A;  5KFF A;  5KT7 A;  2XY6 A;  1X2I A;  3SZ2 A;  2BCV A;  2Q0Z X;  4EBD A;  4EBE A;  1ZQT A;  2P6R A;  4ECY A;  2NRX A;  4QZD A;  3Q8M A;  2VA8 A;  5KG5 A;  4DS4 A;  1N48 A;  1R89 A;  4DL6 A;  4X4O A;  7ICG A;  5CP2 A;  3UXO A;  5J29 A;  1QSS A;  2VA2 A;  4QWB A;  3PNC A;  4M04 A;  5HRG A;  3OVA A;  2ZH7 A;  4X4N A;  4IQT A;  3RAX A;  4X4U A;  3MR3 A;  3KHG A;  1TKD A;  5KG0 A;  4K4I A;  1WCL A;  2BR0 A;  2O1P A;  9ICI A;  4J9R A;  4B9T A;  2MUT A;  5KG1 A;  2LYH A;  5KFI A;  4C8K A;  4DL3 A;  4C8N A;  8ICN A;  1NO5 A;  1JIH A;  1ZJN A;  4RQ1 A;  3PY8 A;  1NJW A;  4I2A A;  1PX5 A;  2FMP A;  3PX0 A;  4M9L A;  7ICF A;  9ICE A;  4MF8 A;  1CEZ A;  2BCS A;  4F2R A;  2O5A A;  2J6U A;  4UAZ A;  4O9M A;  2IHN A;  1U9L A;  4JWM A;  3H3A A;  1UA0 A;  4DQR A;  4Z6F A;  3M8S A;  3V7J A;  1S0M A;  4ELV A;  2ZTE A;  4YXM A;  3BQ1 A;  4ELT A;  4NM2 A;  3H40 A;  4CCH A;  7ICU A;  3GIM A;  3GII A;  5KFG A;  4FBT A;  1T3N A;  1F5A A;  4TUR A;  5HHH A;  1ZET A;  4RU9 A;  3H4B A;  1BNO A;  4S3N A;  1BPX A;  2KZM A;  5HR9 A;  3WFQ E;  2BCU A;  3WFO A;  3PW7 A;  3RJH A;  4BXO A;  5C5J A;  4RWO A;  4ED0 A;  4RNN A;  4DWI A;  5III A;  5KT3 A;  8ICQ A;  1ZQI A;  4UD4 A;  4QW9 A;  1K1S A;  8ICO A;  3AQK A;  3H8J A;  4KLI A;  1UEV A;  4NKU A;  4KLD A;  1DGS A;  4GC6 A;  4KMU A;  2R8K A;  1T8E A;  9ICT A;  5DB8 A;  5D46 A;  1DK2 A;  4B9L A;  4EBC A;  4FH5 A;  3H4D A;  4RWQ A;  3ZDD A;  5DB9 A;  1X9M A;  2ZH3 A;  3WFP A;  5KFT A;  3ZD9 A;  4O5E A;  3OHA A;  3E2E A;  1VJ7 A;  2ATL A;  3MFI A;  4F50 A;  7ICK A;  9ICR A;  1R8A A;  3Q8Q B;  3HX0 A;  2ASL A;  4K4G A;  4MF2 A;  5KFH A;  4NLZ A;  5J2A A;  5J2C A;  3BQT A;  3PO5 A;  4DOA A;  1WOT A;  4WC2 A;  1S0O A;  1KRP A;  3OSP A;  3AQN A;  2DPI A;  5CWR A;  3RB6 A;  2FLP A;  3ZDC A;  4WC1 A;  4AT8 A;  4UQG A;  3KTQ A;  4B9S A;  4TUP A;  1SKW A;  2ISP A;  5DBC A;  4XA5 A;  1KFT A;  3ZD8 A;  1Y88 A;  2AGQ A;  7ICQ A;  3MGH A;  5KG6 A;  3BJY A;  1H38 A;  1QTM A;  4IRD A;  2ZH1 A;  1BPB A;  3RB0 A;  3RR8 A;  4JV2 A;  4NLN A;  2HHU A;  3C66 A;  2ZHA A;  4ECZ A;  3H8S A;  3LWM A;  3C5G A;  3T5H A;  1S10 A;  2XGP A;  4KLQ A;  4WC6 A;  9ICH A;  2DRA A;  4QZG A;  4DSL A;  4KLL A;  2ZH8 A;  4O0I A;  1S76 D;  4ED1 A;  3TFS A;  7ICM A;  3B0Y A;  2XY7 A;  1V4A A;  2W9B A;  1ZQP A;  1ZJM A;  3AUO A;  4F4K A;  3V6J A;  2WTF A;  4RPX A;  4DOB A;  5KFS A;  4M9J A;  3V6K A;  2RDI A;  4QZ9 A;  4RQ3 A;  1KFD A;  3M9O B;  4ECW A;  4ED3 A;  3RH6 A;  1NK5 A;  4IR9 A;  2M2W A;  5HC9 A;  4PHP A;  1Q78 A;  3GDX A;  1MQ2 A;  4FBU A;  4R64 A;  4WBZ A;  1S0V A;  5DDM A;  1N56 A;  8ICW A;  9ICA A;  3M9N B;  2HHQ A;  5J2I A;  4P4M A;  3MR6 A;  8ICH A;  4J9Q A;  4O3Q A;  1COO A;  4M9N A;  2W8K A;  4DO9 A;  1NJY A;  2P6U A;  5KFA A;  3ISC A;  5IIM A;  4BWJ A;  3JPQ A;  2UVW A;  4X5V A;  3SYZ A;  4AT7 A;  1S0N A;  3UQ0 A;  4F91 B;  3RAQ A;  3JPP A;  1L5U A;  5DKW A;  2JEF A;  2KTQ A;  1ZQK A;  4RQ0 A;  4I29 A;  4MFA A;  3M8R A;  4GLX A;  5JUM A;  5HRI A;  3IM1 A;  4YCX A;  5KFJ A;  5J0P A;  2W9B B;  4DL7 A;  3TAQ A;  1NKB A;  2XCP A;  3C1Y A;  4RT2 A;  4J9O A;  3NYB A;  4I2D A;  2DR7 A;  5DBB A;  1TAQ A;  3JPO A;  2AQ4 A;  3K4G A;  3RRG A;  7ICE A;  4E80 A;  1TVA A;  4IQW A;  4WC7 A;  1DOQ A;  1NKE A;  4EP7 A;  1ZQR A;  4TUS A;  8ICA A;  5KFE A;  7ICT A;  2FMQ A;  3GV8 B;  2KFN A;  5DG7 A;  2KP7 A;  4EZ9 A;  1BPZ A;  3V7L A;  4M2Y A;  3NGD A;  3RJF A;  4ED8 A;  2AGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...