4PHDA

Structure of human dna polymerase beta complexed with a in the template base paired with incoming non-hydrolyzable ctp and manganese
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The spontaneous replication error and the mismatch discrimination mechanisms of human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 105
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4phdA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4phdA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4phdA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4phdA03
1X9MA 3EZ5A 2I1QA 2AGQA 1ZQHA 5HR9A 4DF8A 4GC7A 3C18A 5DKWA 4FS2A 3AU6A 2VANA 2ZH9A 4M0AA 5HREA 4EP7A 4TUPA 4X4QA 1JIHA 2R8HA 5J0TA 3ORYA 4YXMA 4Q44A 4ELVA 4WC2A 4IRDA 2LYHA 4XQ8A 4DL6A 3QE9Y 2FLPA 2A1JA 4LZDA 5J29A 1MQ2A 4JWMA 2NRVA 4NKTA 3RTVA 1NJYA 4F5QA 4FHYA 3V6JA 4F50A 1KLNA 4PGQA 1KDHA 3OV7A 1T8EA 1RYSA 5KG6A 5DECA 1AROP 3PR4A 5EWGA 9ICLA 3UXNA 5L1LA 1NKBA 4UQGA 2BPGA 4UBCA 2MAXA 4F92B 1SKSA 3OGUA 4I2EA 2P6RA 5DDMA 5DB9A 3RRHA 4B9TA 9ICVA 9ICQA 9ICFA 5DEDA 3HIYA 1ZQXA 3RJEA 5KFWA 4XQ7A 4BWMA 3V72A 3H4BA 3C5FA 4ATBA 5L1KA 5HMLA 1N56A 3NTUA 2ASLA 2BPFA 4IR1A 4Q8EA 3L9DA 2ZH4A 1S97A 1WOTA 4YMNA 1QTMA 1TV9A 4X4RA 3AU2A 1S0MA 3HJ1A 3HW8A 4DOCA 4ED7A 3WFRE 1XO1A 1S76D 2XY7A 1SKWA 7ICUA 5J0OA 3PW5A 5KT3A 4MEYA 4KLOA 1ZQUA 4I2IA 4Q8FA 2ZH3A 3BQ2A 1ZQIA 5J2CA 5DB6A 3ZD8A 4C8LA 4F4ZA 1TK5A 2IHNA 2PI4A 5CA7A 4K4HA 1K1SA 1QLNA 9ICNA 2HHUA 8ICKA 8ICBA 2I9GA 1MIVA 1UA0A 2V9WA 4C8MA 8ICSA 5HRFA 8ICZA 1BNOA 5C5JA 4WC4A 4UBBA 5J0QA 4JUZA 4IQTA 4EBKA 3RJIA 1WCNA 3ZDCA 7ICVA 2ZH6A 2F1HA 2VA3A 4M2YA 2RDJA 3C2KA 3H39A 3PO4A 3RR8A 2HHTA 2O1PA 1Z3EB 2HHPA 1QSLA 2M2UA 2JEGA 4F2RA 3E2EA 3BQ1A 2NRZA 4Z6FA 1XU4A 2PFOA 5KFOA 3RJFA 1A76A 4DL4A 3OUYB 4KTQA 4ED3A 4KLHA 1VJ7A 4BWJA 4K4GA 4DQSA 1VFGA 4RWQA 3NYBA 1DGSA 5F9NA 1S0VA 1LB2B 2XC9A 2HVHA 1EXNA 1BVSA 4PHAA 4Q45A 4J9MA 2V4RA 5L1IA 3Q8RB 1U49A 4YVZA 3M8SA 4DO9A 4YMMA 3OHBA 1B43A 5IIKA 4IQUA 5DBBA 3HP6A 1TAQA 1UT5A 9ICWA 2A1JB 3MDCA 3N97B 2KZZA 2DVIA 2M9NA 4QWBA 2Q66A 4MFAA 1L3UA 4DL2A 3UQ2A 8ICWA 1JXLA 8ICTA 4RPYA 1NJXA 4HYKA 1TFWA 4KN7A 4F4XA 4QWCA 4QWEA 4M9NA 9ICTA 4B9UA 1V9PA 5KG7A 4R63A 3V7JA 5IIOA 3MR2A 2FLNA 4DF4A 4YFKA 2PFNA 4JV2A 5J0SA 5HHIA 4RPZA 3AQKA 2DR8A 3JPOA 3N4MB 5KFHA 3MGHA 2DR7A 2PFPA 3TI0A 1NKEA 2W9MA 3T3FA 3UXOA 2J6UA 1D9FA 1JQRA 7ICRA 2UVUA 4ATBB 1KEJA 2ZUBA 5KG1A 3GV5B 5KFJA 1MQ3A 3BDPA 3WFPA 4PPXA 7ICFA 5HC9A 1CEZA 1U47A 3C1YA 5F2VO 3KHRA 4YR0A 4QW8A 4WC6A 2MUTA 8ICFA 3V6HA 1RXWA 4B9VA 4J9NA 4P4PA 5DG8A 4F2SA 1UEUA 4X4VA 4WBZA 5KFKA 1D8LA 5KFYA 4FBUA 4RWPA 1ZQKA 5KFIA 4RT3A 5KFDA 4X4SA 3OVSA 3K75D 5KFTA 4F4YA 4ECRA 2AQ0A 2C2DA 1BGXT 3PMLA 4KLTA 3RJJA 1COOA 1YLQA 2VA8A 4IG8A 1D9DA 4I2FA 3H8JA 1S77D 4X0AA 2ZH2A 4DQQA 2XGPA 4PHPA 4ELUA 2C2EA 4LVSA 8ICGA 4TUSA 4B9LA 4C8KA 1NO5A 4ECVA 5D49A 2ZH8A 2IA6A 4DS4A 4M9GA 4DEZA 3SZ2A 2FMQA 1B22A 3OSNA 5DQIA 3SYZA 4DQPA 4DLEA 5DGBA 5HRIA 3MBYA 3FDSA 1Q78A 4ED0A 4I2JA 4RNNA 3G6XA 4ECUA 4DSIA 2R8IA 4X5VA 3ISBA 1HJPA 2OWOA 3C21A 3HWTA 4ECTA 2RFFA 3C5GA 1HUOA 4G3IA 4ECQA 1ZQJA 8ICXA 4Z6EA 3TARA 9ICMA 4WBYA 4DFMA 4TQRA 4X4TA 1ZQWA 3RAQA 1X9WA 2DRBA 4QZAA 3TANA 3RJHA 1R89A 4PHDA 1NZPA 3C2LA 2JZBB 3OSPA 4KMUA 4M04A 3MFHA 2KZMA 9ICGA 4X4UA 3RR7A 4P4OA 3H8SA 4ECWA 1RYRA 4FHPA 4GLXA 4RQ2A 2BCQA 5DG7A 3THVA 4FS1A 2DR5A 1ZQCA 8ICPA 3OVBA 5DDYA 3PW7A 2ISOA 2XY5A 4KLQA 4YR2A 8ICOA 3ZDEA 1Z00A 4I2DA 2FMSA 4O3PA 5J2IA 8ICEA 4YCXA 4X4NA 4O3QA 8ICNA 4YD1A 2KZ3A 3RH6A 5J2BA 2ALZA 3UPSA 1RZTA 8ICYA 5J0UA 3RB6A 4K4IA 2VA2A 1NJWA 1NOMA 5DQGA 2ATLA 2NRKA 3C2MA 4RZRA 1T7PA 4KLJA 4MFCA 5HP4A 4RWNA 2UVRA 2FLLA 2ZJAA 3PR5B 5KFBA 3PX4A 3BQ0A 3PO5A 2W9AA 4FH5A 7ICJA 3LWMA 1TFYA 2HHQA 5HRGA 3RJGA 2DFLA 5J2EA 3UXPA 1QSSA 1JXEA 3RJKA 2C22A 5J0PA 1ZQTA 9ICCA 3LK9A 5KTQA 2ZHAA 4QZIA 5J2AA 1ZQSA 2PXIA 4MFFA 1R8BA 2B21A 4I2GA 4RNOA 1XWLA 5CHGA 4PH5A 4YD2A 4IQWA 4BXOA 3ZDBA 7ICMA 2V4QA 4PGYA 3UPQA 4EZ9A 1WCLA 1NKCA 2R8GA 2ZH1A 8ICAA 4O0IA 2DPJA 4M6WB 5KFMA 3LQCB 3ZDDA 1ZQNA 9ICUA 5KFNA 2XCPA 8ICVA 3RH4A 5IILA 3PV8A 1FA0A 4S3NA 1S9FA 4QW9A 3PNCA 2RDIA 4XRHA 2W9CB 5KFEA 4EBDA 1BPXA 4BDPA 9ICIA 1ZQDA 1ZQQA 4UB2A 4QZGA 5J2KA 1L3VA 4FHXA 1BPBA 5KG3A 5KFZA 7ICSA 5IIJA 4O9MA 9ICXA 4RT2A 2UVWA 4QZBA 4UAYA 1ZQBA 3Q8MA 2IBKA 1K1QA 4M47A 5DLFA 4O5KA 4I27A 3SV4A 1XSLA 4IRKA 9ICHA 2F1JA 4JV0A 2BQ3A 2ZJ8A 1ZQZA 1ZQFA 3ETLA 4UB1A 4O3RA 2ZUDA 3LDAA 4F93B 4RQ4A 2ZH5A 2HHSA 3RB0A 3WFQE 3OVAA 2KP7A 9ICJA 3RRGA 2PBEA 4ECZA 2C28A 4P2HA 2FPLA 3H7IA 2ZHBA 3EPGA 5J0WA 4O3NA 1A77A 5KT2A 5BPCA 3RBEA 1XSPA 1RPLA 9ICEA 1ZQPA 4J9PA 5BOMA 2AU0A 3ZDAA 5KG5A 9ICOA 2KTQA 4TQSA 1R8CA 3PW4A 4P4MA 1JAJA 4UAZA 4AT7A 4EBCA 1NK5A 1TKDA 4PGXA 3AQMA 4WC3A 3EW9A 4RQ5A 3LWLA 3BJYA 4ED6A 3V6KA 4MF2A 3H8WA 3MGIA 5KFVA 4RQ1A 3HPOA 3KHGA 8ICMA 3H3AA 2JZBA 7ICIA 3Q8LA 3PVXA 2P6UA 4GC6A 4DLGA 1S0OA 4I2BA 3GV8B 5EWFA 1KFTA 4Q43A 3RBDA 1U9LA 4RQ3A 1N48A 7ICPA 4PHEA 5KFRA 4JK1A 3MR6A 2XO7A 2MUTB 4MEXA 4NLKA 5JUMA 1SKRA 2HHWA 2W9BA 4F4WA 1PX5A 3Q8PB 4DFPA 3KTQA 4YP3A 2Y1IA 1UA1A 5IIMA 8ICLA 4UD5A 4DSFA 4WC7A 1JN3A 1X2IA 5J0XA 4QZFA 1U4BA 4RU9A 4C8OA 2Q0ZX 4DQIA 3QZ8A 4XUSA 3PX6A 4I2AA 4R8UB 3RB3A 4FH3A 1H38A 1KTQA 3GILA 1LV5A 3B0YA 4YXJA 3T5LA 2FPKA 3OJUA 2XY6A 4DSEA 1L3TA 4B9NA 3QEAZ 1TFRA 4B9MA 4JWNA 4EYHB 4LT6A 2ZJ5A 4J9OA 8ICHA 5KT6A 1ZQEA 4RNMA 3RH5A 2O5AA 5BOLA 2BPCA 4F5OA 4ED8A 3B0XA 3ISCA 1ZETA 4GXJA 4YQWA 4DSJA 4EYIB 4F91B 4QZHA 5D4BA 5DLGA 1U45A 1QSYA 2UVVA 8ICUA 1T3NA 3ZD9A 4AT8A 9ICSA 4EZ6A 1NK4A 3TQ1A 1SZPA 4J9SA 4J9LA 3GIKA 1ZYQA 3H37A 4I2HA 2FPMA 5HRKA 1Q79A 1JX4A 5CP2A 1T4GA 1NJZA 4AT8B 5IINA 2BCUA 9ICAA 4FHVA 3GV7B 4WC5A 4M6WA 2BHNA 3IM1A 3OUYA 4DS5A 3PW2A 4TUQA 3Q8KA 1TAUA 4UB5A 3AQLA 1NK7A 4X4OA 1TK8A 4YMOA 3T5HA 2ID1A 4F5NA 2W9CA 4F4KA 5J2FA 3OJSA 5HRHA 4XA5A 2M2WA 2BCRA 1DOQA 5KT7A 5KFLA 4NM1A 4QWAA 9ICKA 5HHHA 2ASDA 1MSWD 4Z6DA 3JZ0A 1SL2A 3H4DA 8ICIA 4IQVA 5CWRA 4RQ0A 5DBAA 2ZTEA 5CB1A 1S10A 3JPNA 4R65A 3TAQA 4R64A 4M9LA 9ICPA 4DSKA 2ZTDA 4J9RA 4EBEA 4KLLA 3JPSA 4DL7A 4DWIA 2M2VA 7ICQA 1NK9A 3JYYA 4NKUA 5KFXA 4FBTA 1JMSA 4DL3A 3JPRA 3EPIA 4KLDA 4ECYA 2BGWA 5F9LA 1ZQYA 2ISPA 4KITB 1ZQAA 1D8YA 4QZEA 3NGDA 3MR3A 3RB4A 4DFKA 2AGPA 7ICTA 1R8AA 5KFCA 3C66A 4NY8A 2ZH7A 4DFJA 3PY8A 4RQ7A 2F1IA 3M9MB 1ZQOA 4QZDA 1MIYA 1BNPA 3M8RA 1SL0A 4BXOB 9ICBA 1BPZA 4AT9B 2FMPA 1L5UA 3GDXA 4O5CA 2HW3A 3H38A 2H5XA 1NK8A 1Y88A 4DQRA 4QZ9A 1NK6A 2BKEA 4O3SA 5J0RA 1BPYA 2AJQA 3C1ZA 4NM2A 8ICRA 5HRLA 5DG9A 7ICHA 5KFGA 5KG2A 3T5JA 2BR0A 2R8JA 3QEBZ 4R8UA 3AUOA 2W8KA 5D46A 3HX0A 3SV3A 4RUCA 4ECXA 5DGAA 3WFSC 3HT3A 4YN4A 4KLMA 3TFSA 4I29A 4UB3A 3MABA 5DBCA 5DQHA 4DOBA 4ECSA 4M9HA 4X4PA 4RQ8A 5KFAA 2NRTA 3M9NB 2W9BB 2KFNA 4FHWA 4E80A 2C2RA 2DR9A 3RAXA 4CCHA 5EOZA 2BDPA 5HRDA 2J6TA 4QZCA 5KFPA 4RQ6A 3C23A 4Z6CA 5KFQA 1ZJMA 3H40A 5IIIA 4DL5A 5DB7A 2Y1JA 1BPDA 3MFIA 3OHAA 3M9OB 2PFQA 4UB4A 3GIIA 3T5KA 1ZQGA 1F5AA 1U48A 2HVIA 1C7YA 4LZGA 4F5PA 3Q8SB 1IM4A 3JPPA 1ZQRA 4KN4A 4JV1A 3K4GA 2KFZA 1DK2A 4M5DA 4AT9A 2P66A 4F8RA 8ICQA 1UEVA 4B9SA 4ZH4A 1KFDA 4MF8A 3ISDA 1IXRA 5L1JA 3TAPA 1KRPA 1X9SA 3GIMA 4KLFA 3FYHA 4NXZA 3QZ7A 3MR5A 3BQTA 4KLEA 5KG4A 4YR3A 2PI5A 3Q8QB 4E0DA 2BE3A 5J2JA 4NLNA 4C8NA 4RUAA 7ICLA 2M2TA 2GWSA 2JEIA 2NRXA 4YG2A 5HMMA 5J0YA 2KN7A 3KHHA 1KSPA 1KFSA 4R66A 2BCSA 1OU5A 4J9KA 4EBJA 3JPTA 4IRCA 4I28A 5CR0A 1KNYA 3G6VA 4O5EA 5J2GA 7ICOA 4WC0A 3G6YA 3TFRA 1ZQMA 5CJ7A 5HNKA 4WC1A 3MDAA 4FO6A 4BGDA 2IHMA 3GQCA 1V4AA 2AGOA 1RXVA 1MC8A 5J2HA 1PZNA 4I2CA 3PX0A 4KLSA 3KHLA 3UQ0A 2BQUA 4RPXA 2ASJA 3PMNA 4EEYA 2DPIA 2JEJA 4J9QA 1ZQVA 1XC9A 2R8KA 7ICNA 5KFUA 4O3OA 3V7LA 2XCAA 7ICGA 4M9JA 2BQRA 2ZTCA 4F5RA 5KFSA 5EWEA 1XSNA 3GFKB 4GXIA 2AQ4A 3HJ4A 5KFFA 4UD4A 4QWDA 4RWOA 8ICCA 1HUZA 4QZ8A 3V7KA 1S0NA 5DB8A 4ED2A 4E7XA 4GXKA 4ED1A 1NK0A 1SL1A 1L3SA 2BCVA 5J2DA 9ICRA 4E8FA 4X0BA 4DSLA 1Z00B 1TVAA 4WCWA 5KT5A 4ELTA 1XS9D 3EYZA 5HRBA 2W8LA 2NRWA 2ZUCA 2WTFA 2DRAA 3SI8A 2JEFA 1BPEA 1UT8A 1TK0A 1UETA 2HHXA 4KLUA 1MIWA 8ICJA 4AT7B 4NLZA 3IHQB 5L9XA 1ZJNA 4IR9A 4UAWA 5KG0A 4KLGA 3WFOA 4KLIA 2XGQA 3JPQA 4TURA 4F3OA 7ICKA 5TZVA 3EWAA 5KT4A 1ZQLA 3AQNA 3GIJA 4DOAA 4NLGA 7ICEA 1CUKA 2J6SA 3PW0A 1DK3A 2IMWP 2HHVA
chains in the Genus database with same CATH superfamily
5CFTA 2AGQA 5HR9A 4O67A 4DF8A 2ZH9A 2IHOA 4EP7A 2R8HA 2WAQF 3ORYA 4ELVA 4IRDA 2LYHA 3QE9Y 4DL6A 4FH3A 4LZDA 1MQ2A 4NKTA 4F50A 4PGQA 3OV7A 2P35A 3PR4A 2EZYA 4EX6A 9ICLA 5L1LA 1NKBA 4UQGA 4UBCA 9ICVA 3RRHA 1ZQXA 5KFWA 1ZQ1C 3UMGA 5JTIA 4YMNA 2ESEA 3WFRE 4EELA 1XO1A 5T14A 2R18A 5KT3A 1ZQUA 4I2IA 4J03A 2IHNA 2PI4A 1QLNA 5CA7A 3F2DA 2V9WA 8ICSA 2E8PA 1BNOA 3AEVA 5C5JA 4WC4A 4EBKA 2L5YA 4F72A 2VA3A 2WF7A 1WUDA 5AK6A 2HHPA 3DEEA 1T3QA 1QSLA 2IUBA 2NRZA 4Z6FA 5KFOA 1COKA 5EE3A 3OUYB 5C0YA 4DQSA 1DGSA 4OCZA 4C4RA 1EXNA 1BVSA 1PK3A 1L7PA 3Q8RB 1U49A 4DO9A 4YMMA 3OHBA 2QKQA 2EANA 4K9AA 3AL0B 4MFAA 8ICTA 5ALHA 1NJXA 4HYKA 4QWCA 1Z19A 4C7ZA 4R63A 1O03A 3UM9A 3MR2A 4YFKA 2PFNA 3AQKA 2DR8A 3OTQA 3DV9A 1KW4A 2PFPA 2EQYA 3TI0A 2UVUA 5ALPA 2ZUBA 4FE3A 3N7RC 1SXDA 4ZOHC 5F2VO 4RQMA 1LKYB 2JHDA 4OD0A 3F2CA 4P0PA 3CNHA 4P4PA 1YZ6A 4RT3A 4F4YA 4OJ6A 4O3MA 1BGXT 1COOA 4UB6U 4I2FA 4X0AA 4ELUA 2C2EA 2XIDA 4LVSA 4C8KA 2ZH8A 4M9GA 4P0QA 3SZ2A 1B22A 5HRIA 3QXGA 1ZD4A 4ECUA 2XICA 1V38A 1HJPA 5AKLA 4ECTA 3C5GA 4G3IA 8ICXA 4WBYA 3NVWA 4X4TA 2VKQA 4QZAA 3RJHA 4Y2RA 3OSPA 9ICGA 4X4UA 1N2XA 4P4OA 2FCLA 4RQ2A 3THVA 2DR5A 5ALUA 8ICPA 3OVBA 4KLQA 1Z00A 4I2DA 5J2IA 8ICEA 1VDVA 3RH6A 1XO0A 4K4IA 2KJ5A 1NJWA 2NRKA 2ATLA 3C2MA 4KLJA 3PR5B 2O6KA 3PX4A 5ALMA 2DWQA 3RJGA 3RJKA 9ICCA 5KTQA 4QZIA 4K9BA 2IOFA 4QIWF 4I2GA 4PH5A 4PGYA 3UPQA 1NKCA 1JUDA 2HBMA 4M6WB 5H2FU 3ZDDA 2GA9D 3IG5A 5KFNA 8ICVA 3RH4A 5IILA 4UW9A 4XRHA 3CP8A 1BPXA 9ICIA 4FHXA 2KK0A 1ZQBA 2IBKA 5DLFA 3H0MB 1FO4A 1NZBA 2JMGA 2BQ3A 4O6AA 3ETLA 3PZPA 2ZH5A 2HHSA 3RB0A 3WFQE 4CRXA 2KP7A 9ICJA 2FPLA 3K1RB 2D6FC 5J0WA 1A77A 3RBEA 5BPCA 1RPLA 1ZQPA 4WQLA 2OEHA 2RQ5A 5ALIA 3PW4A 5G5HA 4AT7A 1TKDA 3BQ7A 1QQ7A 4RQ1A 8ICMA 3H3AA 2JZBA 3BS5B 3PVXA 4DLGA 3GV8B 4Q43A 4I0UA 1ZD3A 2K4HA 1KQQA 3MR6A 5JTGA 2HHWA 3VCBA 2K8AA 2OYYA 1UA1A 5IIMA 1X2IA 5J0XA 2VJ5A 3B0YA 4YXJA 2XY6A 4B9NA 4KM5A 1S8OA 3EF2A 4J9OA 2FJ6A 3IRUA 3ER9B 2YMMA 4F5OA 4ED8A 5KL1B 3B0XA 3ISCA 2IOHA 1N60A 3M6ZA 1LVHA 4F91B 4EYIB 1QSYA 2A3VA 8ICUA 2HMXA 3ZD9A 1NK4A 4AT8B 5IINA 4M6WA 2KV2A 4OJLA 2NYVA 2FE9A 4YMOA 2BDUA 4F4KA 5J2FA 5AKHA 5EE0A 2K4PA 2ASDA 1MSWD 1X40A 8ICIA 4RQ0A 2K89A 4M9LA 3F5AA 3ONNA 2GLEA 3EPIA 2BGWA 1ZQYA 4KX5A 7ICTA 1SV0A 2LM4A 1R8AA 4NY8A 2F1IA 3M9MB 3M8RA 1URJA 4DQRA 5J0RA 4FZNA 3C1ZA 5DG9A 5KFGA 2BR0A 3AUOA 4RUCA 3HKZF 5DQHA 4M9HA 4X4PA 1B4FA 2J6TA 4QZCA 1SZHA 5KFQA 1ZJMA 4DL5A 2K60A 3HILA 2F77X 2PFQA 4UB4A 3GIIA 1ZQGA 4F5PA 3JPPA 3E0FA 3ICXA 4KN4A 4JV1A 4F8RA 4OJPA 4ZH4A 1KFDA 3ISDA 1IXRA 5L1JA 2KJ9A 3FYHA 3MR5A 3QZ7A 4UB8U 4KLEA 2PI5A 4E0DA 2WFAA 4C8NA 2NRXA 4YG2A 3KHHA 1KSPA 4R66A 5ALOA 1QCKA 5CR0A 3G6VA 2I6XA 4OAFA 3WK4A 5HNKA 4FO6A 3I28A 2AGOA 1RXVA 1MC8A 4KLSA 3AQEA 4RPXA 2ASJA 3PMNA 2DPIA 1XC9A 3WKEA 4WOYA 4O3OA 2XCAA 5A0LA 5KFSA 3GFKB 4UD4A 8ICCA 1S0NA 5DB8A 4ED1A 1NK0A 5J2DA 4E8FA 4DSLA 4NLBA 3HKZC 4WCWA 5KT5A 4ELTA 5HRBA 2W8LA 2ZUCA 2WTFA 1UETA 4AT7B 5AKZA 4KLUA 1L8LA 1JRPA 4Y2UA 1A6SA 4NLGA 2J6SA 3J81j 2IMWP 2HHVA 1ZQHA 4AYBF 4GC7A 3C18A 4WC2A 1P7DA 5J29A 2NRVA 3RTVA 1NJYA 4F5QA 3QU7A 3V6JA 1KLNA 4BUGA 5KG6A 5ALRA 1N61A 2BPGA 4O5EA 2MAXA 4F92B 3NYBA 3OGUA 5DEDA 1MA7A 2CXYA 9ICQA 9ICFA 3HIYA 2WAQC 4BWMA 5KL8B 1N56A 4Q8EA 3L9DA 1WOTA 3N7SC 2BBJA 1NNLA 2KKPA 3AU2A 5AHXA 1S0MA 4ED7A 3T79A 3L4PA 2XY7A 3FM9A 1SKWA 7ICUA 5J0OA 4KLOA 2PMZC 4Q8FA 3BQ2A 4IC9A 1ZQIA 5J2CA 5DB6A 4K4HA 4C0ZA 1O08A 3LYSA 8ICKA 1MIVA 5HRFA 8ICZA 4UBBA 4JUZA 1WCNA 5AM3A 1RDFA 2ZH6A 4B6JA 1SXEA 4NV0A 3PO4A 5AICA 3TACB 2HHTA 2K4EA 1Z3EB 4OAGA 1FIQA 4Y2VA 2JEGA 4F2RA 3EUB2 4UATA 4BWJA 4RWQA 5F9NA 1S0VA 1SB3C 1LB2B 2XC9A 3SQIA 1X66A 2KEYA 4J9MA 1RYUA 5L1IA 3K7DA 5IIKA 3HP6A 1TAQA 2A1JB 3MDCA 3UQ2A 3NUQA 3B9JA 4KN7A 2PMZF 3L3FX 4B9UA 1V9PA 5KG7A 3V7JA 4JV2A 5HHIA 1L6NA 5ALVA 3JPOA 3N4MB 3LVVA 3MGHA 2DR7A 4ATBB 3GV5B 3NRZA 3WFPA 4PPXA 2JGAA 4QJFB 3ZI4A 2QB0B 3AM9A 4K99A 4YR0A 2MUTA 3V6HA 5KAIU 4B9VA 4J9NA 4JLZA 5DG8A 1UEUA 5KFYA 4RWPA 1ZQKA 2NO5A 4X4SA 2HI0A 2KD1A 3K75D 2C2DA 1HEKA 1SWWA 2VA8A 1D9DA 1S77D 4AYBC 4TUSA 3M1YA 5D49A 2IA6A 3BS7A 5DQIA 4DQPA 2G0AA 5DGBA 3QUBA 3MBYA 2OH2A 4DSIA 3WKAA 3ISBA 3N28A 3C21A 1N5WA 3A0HU 3OPXA 2ZIUA 5KAFU 1HUOA 4ECQA 2DUYA 4Z6EA 3TARA 4TQRA 2KIVA 1NZPA 3C2LA 2KICA 2BCQA 5DG7A 4WQKA 1DXSA 1N62A 5DDYA 3PW7A 8ICOA 3ZDEA 2GH1A 4O3PA 1UQVA 4YCXA 4O3QA 4YD1A 2H3QA 5ALQA 5AIAA 1RZTA 5J0UA 2N1RA 2VA2A 1HIWA 3SR6A 4BJQA 2FLLA 2ZJAA 4NXUA 3BQ0A 3PO5A 1YZ7A 2W9AA 4FH5A 1KL9A 2HHQA 5HRGA 1RQNA 5J2EA 1JXEA 2C22A 1ZQTA 3LK9A 2QB1A 1ZQSA 3PSPA 2K8CB 2B21A 4RNOA 5CHGA 3NKUA 3F2BA 4BXOA 3QU4A 4US9A 5HR7A 3H8MA 1WCLA 2ZH1A 4NL9C 3UMBA 3R9KA 4U6PA 1S9FA 4OO1J 3PNCA 2RDIA 4EBDA 2JH1A 1SWVA 4UB2A 5FP0A 1BPBA 1Q46A 4QZBA 2JR5A 1K1QA 3SV4A 5AM5A 1XSLA 4Y2QA 2VIXA 2ZJ8A 1ZQZA 5ALSA 4UB1A 2EAPA 3LDAA 4RQ4A 5AM2A 1N5XA 3FAHA 2G07A 2E8OA 3MGVA 4XJEA 2EZXA 4ECZA 3CK6A 3EPGA 2WB1C 3IG8A 5F3XB 5AM1A 9ICEA 4J9PA 2JXJA 5BOMA 2AU0A 9ICOA 1R8CA 1JAJA 4WC3A 4JMUA 3LWLA 3H8WA 7ICIA 4GC6A 1S0OA 1KFTA 2KSOB 3RBDA 4EENA 3GZFA 4PHEA 2XO7A 2MUTB 5AI5A 1VJ5A 2CPRA 8ICLA 4DSFA 3KOOA 4XUSA 3RB3A 2G5HB 2XI9A 2FPKA 4DSEA 3QEAZ 3AN1A 5AK3A 4JWNA 3PSTA 5KT6A 1X6JA 4BX9C 5BOLA 4OJOA 5L1MA 1ZETA 1U45A 2UVVA 2E1EA 5J8YC 3GIKA 1ZYQA 2E1FA 1JX4A 2RLTA 5CP2A 1T4GA 2WF8A 9ICAA 3GV7B 2LHTA 2ZXIA 1TAUA 2YMPA 2GOLA 2ID1A 1WWUA 2W9CA 5HRHA 1DOQA 4QWAA 4NJ8A 9ICKA 5HHHA 2VJ4A 2DBYA 4IQVA 1MN8A 1V85A 4C80A 4R64A 2M2VA 3JYYA 4NKUA 1NK9A 5KFXA 1KKXA 3CW2C 1JALA 4KLDA 2ISPA 4KITB 3MR3A 3RB4A 3C66A 2W43A 3QUQA 4DFJA 2G08A 4RQ7A 1ZQOA 1MIYA 1BNPA 3KFUF 4BXOB 1Z4OA 1L5UA 4O5CA 2HW3A 2KJ8A 4QZ9A 1BPYA 2NV3A 3T5JA 2YX8A 5AI0A 5KG2A 2R8JA 3QEBZ 2OXOA 4C4TA 2W8KA 5D46A 3SV3A 4ECXA 3WFSC 5DGAA 2ODGA 3TFSA 4UB3A 3MABA 5DBCA 5KFAA 2NRTA 3M9NB 2W9BB 4FHWA 4E80A 3KZIU 3RAXA 4CCHA 5HRDA 2BDPA 1SGGA 5KFPA 4U7CA 4RQ6A 2B4VA 3S6JA 3C23A 4NXVA 3H40A 5DB7A 1F44A 2HVIA 3SENA 4LZGA 2DKXA 1DK2A 5B66U 3K4GA 4AT9A 2H3IA 4JLXA 5K4LA 3TAPA 1KRPA 3BQTA 4YR3A 2BE3A 2ZIWB 5J2JA 4NLNA 2AXTU 3JCFA 5J0YA 3ETRA 4IRCA 4I28A 1NI3A 2JRZA 4DFDA 5CHEA 7ICOA 4WC0A 4PJ0U 3TFRA 3PSIA 2RHFA 5CJ7A 2B0CA 2IHMA 1J2NA 1A0PA 5J2HA 4EEYA 7ICNA 2LMRA 5EWEA 4GXIA 4PZNA 2AQ4A 2KNJA 3PSFA 3N7PD 2HDOA 2QARA 4NL9A 2LYBA 4QZ8A 2Z7JA 4GXKA 9ICRA 3QUTA 2EDUA 1JROA 1QQ5A 1XS9D 1VLBA 1UT8A 1SV0C 1MIWA 8ICJA 1L8OA 5L9XA 3WFOA 2QARB 1ZJNA 5D61A 4KLIA 1AQ6A 4TURA 3JPQA 5KT4A 2Y9TA 3GIJA 1CUKA 1X42A 4WC5A 3EZ5A 2E3TA 2LPEA 5DKWA 2VANA 4M0AA 4TUPA 1JIHA 2YQEA 4YXMA 2M0NA 3BZCA 2FLPA 2A1JA 4JWMA 1QQ6A 1T94A 4UARA 3A0BU 4FHYA 1GO3F 2K8BB 3SEIA 1T8EA 1RYSA 5DECA 1AROP 2KG5A 5EWGA 3UXNA 2ZIWA 4HX0A 5DB9A 2MA1A 2HBJA 5GTIU 3C5FA 2ZH4A 4IR1A 2ASLA 1S97A 1QTMA 1TV9A 4X4RA 3HJ1A 4DOCA 3WK5A 1V97A 4WH5A 5AI6A 3PW5A 3MC1A 5GTHU 3NVVA 4C8LA 9ICNA 4F4ZA 3IP4B 1UA0A 5J0QA 4IQTA 3RJIA 3TADC 4M2YA 2RDJA 3H39A 3RR8A 2AHOB 3HRDD 2M2UA 2PFOA 3RJFA 1A76A 2B56A 4DL4A 3SAHA 4KTQA 4ED3A 1VJ7A 4K4GA 4UASA 4CF5A 2HVHA 2RRDA 2V4RA 4YVZA 3M8SA 1X6IA 1L7OA 4NXWA 1B43A 4IQUA 1UT5A 1IV8A 2KZZA 2M9NA 4JB3A 3QX7A 4QWEA 5IIOA 3ERCC 2FLNA 4RPZA 1Q3UA 4AP9A 1NKEA 2W9MA 3T3FA 3UXOA 1JQRA 1KEJA 5KFJA 3BDPA 7ICFA 5HC9A 1CEZA 1Z1BA 1U47A 3KHRA 4QW8A 4K98A 1RXWA 3CRXA 4F2SA 4X4VA 1ZRMA 5KFDA 1SV4A 2W7PA 3OVSA 2AQ0A 5ALXA 4KMOB 3RJJA 1YLQA 1L7MA 2ZH2A 3QNMA 8ICGA 2YB4A 1NO5A 4DS4A 4DEZA 3SYZA 4DLEA 3WKCA 1Q78A 3F53A 4ED0A 4I2JA 4RNNA 3G6XA 2OWOA 3HWTA 2W55A 3NRWA 9ICMA 4K97A 4DFMA 1ZQWA 5AKEA 2DRBA 1R89A 3TANA 2KZMA 3MFHA 3RR7A 3H8SA 1RYRA 3L5KA 4GLXA 1PK1B 5AKJA 4FS1A 1DGJA 2XY5A 4G9BA 3RF9A 2FMSA 3SD7A 1L7NA 4MHVA 2KZ3A 2ALZA 4CNQA 4GIBA 3UPSA 8ICYA 3RB6A 1NOMA 4MFCA 4RZRA 1T7PA 5HP4A 4RWNA 2FI1A 2LYAA 1ZOLA 5CFUA 7ICJA 1TFYA 1QSSA 3UXPA 4CF4A 2KKVA 5J0PA 1ZXIA 5J2AA 4ACOA 2PXIA 4MFFA 1R8BA 4O69A 1UHUA 5D62A 2LKYA 2MSNA 8ICAA 4O0IA 2DPJA 3LQCB 3AMZA 2XCPA 2EH9A 2H3VA 4QW9A 2W9CB 2Q4TA 4BDPA 1ZQDA 1ZQQA 4QZGA 1L3VA 5KG3A 5KFZA 1B0XA 4UAYA 3Q8MA 3BZKA 4I27A 2F1JA 4JV0A 1ZQFA 4EX7A 4O3RA 4F93B 3RRGA 3U26A 2ZHBA 2ZG6A 2A1AA 4O3NA 5KT2A 1XSPA 2DKZA 4IL6U 3ZDAA 4P4MA 4UAZA 1NK5A 2F76X 4PGXA 3ED5A 1ED1A 2DF4B 2W3SA 4ED6A 3EW9A 3BJYA 3V6KA 3AQMA 3MGIA 5KFVA 3HPOA 5AKYA 3Q8LA 2P6UA 3KBBA 5EWFA 4RQ3A 7ICPA 4MEXA 4NLKA 5JUMA 5ALKA 4YP3A 2KVSA 4KX3A 4WC7A 4UD5A 1JN3A 1UCVA 1U4BA 4C8OA 3PX6A 4R8UB 1Q8KA 1H38A 1KTQA 3GILA 3T5LA 4LT6A 1TFRA 4EYHB 2XVTA 2ZJ5A 3GU3A 3UMCA 4RNMA 3K1ZA 3RH5A 2G5IB 4OAHA 5ALDA 4YQWA 4GXJA 4DSJA 3QUCA 5D4BA 5DLGA 3KKAC 1T3NA 4AT8A 4EZ6A 3TQ1A 1J97A 4J9LA 3H37A 4I2HA 2FPMA 2YMQA 3D2SA 5HRKA 1NJZA 2IOFK 4FHVA 1F5SA 2GO7A 3IM1A 3OUYA 3PW2A 4TUQA 4Y2SA 3AQLA 4F5NA 2A19A 3OJSA 4XA5A 5KNIA 2M2WA 2BCRA 3NVOA 2QLTA 4NM1A 2DL0A 5E79U 2W03A 3JZ0A 1SL2A 2YB1A 5CWRA 3C29A 2ZXHA 2ZTEA 2YTUA 5DBAA 1S10A 3JPNA 3I1YA 4R65A 3TAQA 3FC4A 1CRXA 4EBEA 3JPSA 1OUQA 4DWIA 3QU5A 7ICQA 3ER8C 4FBTA 4Y2PA 4DL3A 2NO4A 3JPRA 4ECYA 5F9LA 3NVZA 1ZQAA 1D8YA 4DFKA 1CI4A 3GDXA 4HAIA 3H38A 1NK6A 8ICRA 2AJQA 4MKPA 4NM2A 3HJEA 7ICHA 2WHEA 5AKXA 1KN5A 4R8UA 3HX0A 3HT3A 5CEHA 4I29A 3WK8A 4WJ3B 4EEDA 4DOBA 4ECSA 4RQ8A 2KFNA 2DR9A 5EOZA 2W3RA 4OAIZ 1M6YA 2CN1A 4CE6A 5IIIA 1BPDA 3MFIA 2ZIVA 3M9OB 3T5KA 1F5AA 1U48A 1C7YA 3Q8SB 1IM4A 1PUZA 2ZIUB 2KFZA 4M5DA 2P66A 1KBUA 1UEVA 4B9SA 4KB6A 2HN2A 3O0FA 3GIMA 5AIBA 4KLFA 5KG4A 5ALFA 5AK4A 1ZD5A 2M2TA 7ICLA 4RUAA 1IIPA 3C28A 3QYPA 4Y2TA 5HMMA 1KFSA 1OU5A 4Y2XA 2BCSA 2G09A 3KD3A 3JPTA 1KNYA 2W54A 5G5GA 2BZFA 1ZQMA 4IS7A 3MDAA 3GQCA 5ALGA 4I2CA 1Z4NA 3IDWA 3PX0A 3KHLA 3UQ0A 2BQUA 1UPHA 1ZQVA 1OW5A 2W11A 3KZXA 5KFUA 2KOBA 4M9JA 2BQRA 1RG6A 1XSNA 2Y0SF 3HJ4A 5KFFA 4RWOA 3V7KA 2D3DA 4ED2A 3M7DA 3SAGA 2BCVA 1SL1A 1IG6A 1Z00B 2ES6A 4US8A 3EYZA 2NRWA 2JEFA 1TK0A 3IHQB 3WK9A 4IR9A 5KG0A 2DGZA 2KIWA 4PZOA 7ICKA 4F3OA 2WF6A 3EWAA 1ZQLA 4DOAA 2RP5A 7ICEA 2EWRA 3PW0A 4NWIA 1X9MA 2I1QA 2EZZA 4FS2A 3AU6A 5HREA 4X4QA 5J0TA 4Q44A 3F5EA 2MU2A 5AM4A 4XQ8A 1K5OA 4FFDA 1DRGA 1KDHA 2KMDA 4USAA 1Q3VA 2D8CA 2KHVA 4I2EA 1SKSA 2B51A 1PX5A 2P6RA 5DDMA 4B9TA 3RJEA 4XQ7A 3V72A 3H4BA 4ATBA 5AKIA 5HMLA 5L1KA 3NTUA 2BPFA 3MCRA 2YMLA 3HW8A 4CF3A 1S76D 1WYGA 2JV3A 4MEYA 2ZH3A 3ZD8A 1TK5A 2OHFA 1K1SA 2HHUA 2Y9UA 8ICBA 2I9GA 4C8MA 3SAFA 3ZDCA 5EE9A 5J8YA 7ICVA 2F1HA 5AM0A 3C2KA 5ALYA 1YT3A 3WKBA 2O1PA 5JRTA 2OM6A 4LEZA 3BQ1A 1XU4A 4F71A 5B5EU 4KLHA 4OJ5A 1VFGA 2H3ZA 5ALZA 2HCFA 4PHAA 4Q45A 4UAVA 2HSZA 5DBBA 2CRXA 5B3PA 9ICWA 1D8BA 3N97B 2DVIA 4QWBA 2Q66A 2F3NA 1L3UA 4DL2A 8ICWA 1JXLA 4QIWC 4RPYA 2E8NA 1TFWA 4F4XA 4M9NA 9ICTA 2ZIXA 4CGZA 4DF4A 5J0SA 5KFHA 2J6UA 1D9FA 7ICRA 2LM1A 1PVPA 5KG1A 1MQ3A 3D2NA 2HOQA 3C1YA 2KVCA 2E5SA 4WC6A 3NWIA 8ICFA 1WG8A 3AQFA 2B6GA 4WBZA 5KFKA 1D8LA 4FBUA 4LEVA 5KFIA 2KE7A 2ZIVB 3IV6A 4ECRA 5KFTA 3PMLA 4KLTA 1TE2A 4CDGA 4IG8A 1X9XA 3H8JA 3OWGA 4DQQA 2XGPA 4PHPA 4B9LA 2FDRA 2HN1A 4ECVA 2FMQA 5CFSA 1QH9A 3OSNA 5AKKA 3FDSA 2R8IA 4X5VA 5CRXA 2KHQA 3SMVA 2RFFA 1ZQJA 2W04A 3RAQA 1X9WA 2WF9A 4EEKA 3E58A 4PHDA 4M04A 2JZBB 3BS5A 4KMUA 3TADA 4ECWA 4FHPA 5TISU 1JI7A 4GFJA 1ZQCA 2ISOA 4YR2A 5ALTA 4FO1A 4X4NA 4Y2JA 8ICNA 2HBLA 5J2BA 5AI4A 5DQGA 2PKEA 1F0MA 2UVRA 1RM6C 3WU2U 5KFBA 3LWMA 1GPJA 2DFLA 2F44A 2ZHAA 5JU5A 2DQNB 2GAFD 1XWLA 4YD2A 5D63A 4IQWA 3ZDBA 7ICMA 2V4QA 3VC8A 4EZ9A 2I5HA 2R8GA 1PVRA 5KFMA 1ZQNA 9ICUA 2F2AB 3PV8A 1FA0A 2Y0SC 4S3NA 5KFEA 5J2KA 5IIJA 4O9MA 9ICXA 4RT2A 5ALNA 3WK6A 2UVWA 4P0QB 4M47A 4O5KA 4IRKA 9ICHA 2ZUDA 1SIJA 3ALRA 3OVAA 2PBEA 5ALWA 2C28A 4P2HA 3H7IA 2G06A 5HR6A 4P0PB 5KG5A 2KTQA 4TQSA 4EBCA 1C20A 4RQ5A 2LI6A 4MF2A 3KHGA 3KKAA 4I2BA 1U9LA 1N48A 5B3QA 5KFRA 4JK1A 1SKRA 2W9BA 3QU2A 4F4WA 3Q8PB 4DFPA 3KTQA 2BBHA 2Y1IA 5AI9A 2EAOA 4LJXA 4QZFA 2EAMA 4DQIA 4RU9A 2Q0ZX 2WB1F 3QZ8A 4I2AA 3CYMA 3DDHA 2LBOA 1LV5A 3WK7A 3OJUA 7ICSA 1L3TA 4B9MA 1PK1A 4EEBA 1FFVA 2F8LA 2ZIXB 8ICHA 2HBKA 1ZQEA 4C7YA 2O5AA 2BPCA 3RFAA 5AI8A 3E2EA 4QZHA 9ICSA 2W7OA 1SZPA 4J9SA 1LKYA 1Q79A 5AKGA 1XNSA 2BCUA 2OCEA 2BHNA 2K4IA 4DS5A 3Q8KA 4LEYA 4UB5A 3IN5A 1NK7A 4X4OA 1TK8A 3T5HA 5EE1A 1OXJA 3H0LB 5KT7A 5KFLA 4Z6DA 1Z1VA 4EGWA 3H4DA 4FZLA 5CB1A 4NXTA 9ICPA 4DSKA 2ZTDA 4J9RA 5ALLA 4KLLA 4DL7A 1PVQA 1JMSA 3TKAA 3NS1A 1ZD2P 4QZEA 3NGDA 2AGPA 5KFCA 2ZH7A 3PY8A 4QZDA 1TAMA 1SL0A 9ICBA 4NLCA 1BPZA 2FMPA 2HOIA 4AT9B 2H5XA 1NK8A 1Y88A 2BKEA 4O3SA 5HRLA 2QB0A 4C4SA 2WF5A 1J2MA 3D2QA 4PL1A 4YN4A 2MRLA 4KLMA 2H3FA 1FFUA 4PL2A 2YY6A 2C2RA 3PHZA 4DCCA 4Z6CA 4ICAA 2YN4A 2Y1JA 1ECWA 3OHAA 1N63A 3WKDA 4FZMA 1ZQRA 4QNLA 1ZRNA 3H0RB 2AH5A 3D6JA 8ICQA 3NASA 4MF8A 5AK5A 5ALJA 1X9SA 4NXZA 4RQNA 4A8EA 3Q8QB 4LEWA 2GWSA 2JEIA 2KN7A 4J9KA 4EBJA 2JH7A 3M6KA 4NXXA 5J2GA 5ALEA 3G6YA 4WC1A 3QU9A 4BGDA 1V4AA 1PZNA 2JEJA 4J9QA 2R8KA 4UAUA 4EV6A 2E8MA 3V7LA 7ICGA 4K8VA 2ZTCA 4F5RA 1WWVA 4QWDA 2KSOA 1HUZA 2HOFA 4E7XA 1L3SA 4X0BA 1S5LU 1TVAA 4Y2YA 4K96A 4O68A 2DRAA 3SI8A 1BPEA 3I76A 3LVWA 2HHXA 4NLZA 3NVYA 4KLGA 1RQLA 4UAWA 2XGQA 5TZVA 3AQNA 2F8KA 1FEZA 4N7RA 1DK3A
chains in the Genus database with same CATH topology
1X9MA 3EZ5A 2I1QA 2AGQA 1ZQHA 5HR9A 4DF8A 4GC7A 3C18A 5DKWA 4FS2A 3AU6A 2VANA 2ZH9A 4M0AA 5HREA 4EP7A 4TUPA 4X4QA 1JIHA 2R8HA 5J0TA 3ORYA 4YXMA 4Q44A 4ELVA 4WC2A 4IRDA 2LYHA 4XQ8A 4DL6A 3QE9Y 2FLPA 2A1JA 4LZDA 5J29A 1MQ2A 4JWMA 2NRVA 4NKTA 3RTVA 1NJYA 4F5QA 4FHYA 3V6JA 4F50A 1KLNA 4PGQA 1KDHA 3OV7A 1T8EA 1RYSA 5KG6A 5DECA 1AROP 3PR4A 5EWGA 9ICLA 3UXNA 5L1LA 1NKBA 4UQGA 2BPGA 4UBCA 2MAXA 4F92B 1SKSA 3OGUA 4I2EA 2P6RA 5DDMA 5DB9A 3RRHA 4B9TA 9ICVA 9ICQA 9ICFA 5DEDA 3HIYA 1ZQXA 3RJEA 5KFWA 4XQ7A 4BWMA 3V72A 3H4BA 3C5FA 4ATBA 5L1KA 5HMLA 1N56A 3NTUA 2ASLA 2BPFA 4IR1A 4Q8EA 3L9DA 2ZH4A 1S97A 1WOTA 4YMNA 1QTMA 1TV9A 4X4RA 3AU2A 1S0MA 3HJ1A 3HW8A 4DOCA 4ED7A 3WFRE 1XO1A 1S76D 2XY7A 1SKWA 7ICUA 5J0OA 3PW5A 5KT3A 4MEYA 4KLOA 1ZQUA 4I2IA 4Q8FA 2ZH3A 3BQ2A 1ZQIA 5J2CA 5DB6A 3ZD8A 4C8LA 4F4ZA 1TK5A 2IHNA 2PI4A 5CA7A 4K4HA 1K1SA 1QLNA 9ICNA 2HHUA 8ICKA 8ICBA 2I9GA 1MIVA 1UA0A 2V9WA 4C8MA 8ICSA 5HRFA 8ICZA 1BNOA 5C5JA 4WC4A 4UBBA 5J0QA 4JUZA 4IQTA 4EBKA 3RJIA 1WCNA 3ZDCA 7ICVA 2ZH6A 2F1HA 2VA3A 4M2YA 2RDJA 3C2KA 3H39A 3PO4A 3RR8A 2HHTA 2O1PA 1Z3EB 2HHPA 1QSLA 2M2UA 2JEGA 4F2RA 3E2EA 3BQ1A 2NRZA 4Z6FA 1XU4A 2PFOA 5KFOA 3RJFA 1A76A 4DL4A 3OUYB 4KTQA 4ED3A 4KLHA 1VJ7A 4BWJA 4K4GA 4DQSA 1VFGA 4RWQA 3NYBA 1DGSA 5F9NA 1S0VA 1LB2B 2XC9A 2HVHA 1EXNA 1BVSA 4PHAA 4Q45A 4J9MA 2V4RA 5L1IA 3Q8RB 1U49A 4YVZA 3M8SA 4DO9A 4YMMA 3OHBA 1B43A 5IIKA 4IQUA 5DBBA 3HP6A 1TAQA 1UT5A 9ICWA 2A1JB 3MDCA 3N97B 2KZZA 2DVIA 2M9NA 4QWBA 2Q66A 4MFAA 1L3UA 4DL2A 3UQ2A 8ICWA 1JXLA 8ICTA 4RPYA 1NJXA 4HYKA 1TFWA 4KN7A 4F4XA 4QWCA 4QWEA 4M9NA 9ICTA 4B9UA 1V9PA 5KG7A 4R63A 3V7JA 5IIOA 3MR2A 2FLNA 4DF4A 4YFKA 2PFNA 4JV2A 5J0SA 5HHIA 4RPZA 3AQKA 2DR8A 3JPOA 3N4MB 5KFHA 3MGHA 2DR7A 2PFPA 3TI0A 1NKEA 2W9MA 3T3FA 3UXOA 2J6UA 1D9FA 1JQRA 7ICRA 2UVUA 4ATBB 1KEJA 2ZUBA 5KG1A 3GV5B 5KFJA 1MQ3A 3BDPA 3WFPA 4PPXA 7ICFA 5HC9A 1CEZA 1U47A 3C1YA 5F2VO 3KHRA 4YR0A 4QW8A 4WC6A 2MUTA 8ICFA 3V6HA 1RXWA 4B9VA 4J9NA 4P4PA 5DG8A 4F2SA 1UEUA 4X4VA 4WBZA 5KFKA 1D8LA 5KFYA 4FBUA 4RWPA 1ZQKA 5KFIA 4RT3A 5KFDA 4X4SA 3OVSA 3K75D 5KFTA 4F4YA 4ECRA 2AQ0A 2C2DA 1BGXT 3PMLA 4KLTA 3RJJA 1COOA 1YLQA 2VA8A 4IG8A 1D9DA 4I2FA 3H8JA 1S77D 4X0AA 2ZH2A 4DQQA 2XGPA 4PHPA 4ELUA 2C2EA 4LVSA 8ICGA 4TUSA 4B9LA 4C8KA 1NO5A 4ECVA 5D49A 2ZH8A 2IA6A 4DS4A 4M9GA 4DEZA 3SZ2A 2FMQA 1B22A 3OSNA 5DQIA 3SYZA 4DQPA 4DLEA 5DGBA 5HRIA 3MBYA 3FDSA 1Q78A 4ED0A 4I2JA 4RNNA 3G6XA 4ECUA 4DSIA 2R8IA 4X5VA 3ISBA 1HJPA 2OWOA 3C21A 3HWTA 4ECTA 2RFFA 3C5GA 1HUOA 4G3IA 4ECQA 1ZQJA 8ICXA 4Z6EA 3TARA 9ICMA 4WBYA 4DFMA 4TQRA 4X4TA 1ZQWA 3RAQA 1X9WA 2DRBA 4QZAA 3TANA 3RJHA 1R89A 4PHDA 1NZPA 3C2LA 2JZBB 3OSPA 4KMUA 4M04A 3MFHA 2KZMA 9ICGA 4X4UA 3RR7A 4P4OA 3H8SA 4ECWA 1RYRA 4FHPA 4GLXA 4RQ2A 2BCQA 5DG7A 3THVA 4FS1A 2DR5A 1ZQCA 8ICPA 3OVBA 5DDYA 3PW7A 2ISOA 2XY5A 4KLQA 4YR2A 8ICOA 3ZDEA 1Z00A 4I2DA 2FMSA 4O3PA 5J2IA 8ICEA 4YCXA 4X4NA 4O3QA 8ICNA 4YD1A 2KZ3A 3RH6A 5J2BA 2ALZA 3UPSA 1RZTA 8ICYA 5J0UA 3RB6A 4K4IA 2VA2A 1NJWA 1NOMA 5DQGA 2ATLA 2NRKA 3C2MA 4RZRA 1T7PA 4KLJA 4MFCA 5HP4A 4RWNA 2UVRA 2FLLA 2ZJAA 3PR5B 5KFBA 3PX4A 3BQ0A 3PO5A 2W9AA 4FH5A 7ICJA 3LWMA 1TFYA 2HHQA 5HRGA 3RJGA 2DFLA 5J2EA 3UXPA 1QSSA 1JXEA 3RJKA 2C22A 5J0PA 1ZQTA 9ICCA 3LK9A 5KTQA 2ZHAA 4QZIA 5J2AA 1ZQSA 2PXIA 4MFFA 1R8BA 2B21A 4I2GA 4RNOA 1XWLA 5CHGA 4PH5A 4YD2A 4IQWA 4BXOA 3ZDBA 7ICMA 2V4QA 4PGYA 3UPQA 4EZ9A 1WCLA 1NKCA 2R8GA 2ZH1A 8ICAA 4O0IA 2DPJA 4M6WB 5KFMA 3LQCB 3ZDDA 1ZQNA 9ICUA 5KFNA 2XCPA 8ICVA 3RH4A 5IILA 3PV8A 1FA0A 4S3NA 1S9FA 4QW9A 3PNCA 2RDIA 4XRHA 2W9CB 5KFEA 4EBDA 1BPXA 4BDPA 9ICIA 1ZQDA 1ZQQA 4UB2A 4QZGA 5J2KA 1L3VA 4FHXA 1BPBA 5KG3A 5KFZA 7ICSA 5IIJA 4O9MA 9ICXA 4RT2A 2UVWA 4QZBA 4UAYA 1ZQBA 3Q8MA 2IBKA 1K1QA 4M47A 5DLFA 4O5KA 4I27A 3SV4A 1XSLA 4IRKA 9ICHA 2F1JA 4JV0A 2BQ3A 2ZJ8A 1ZQZA 1ZQFA 3ETLA 4UB1A 4O3RA 2ZUDA 3LDAA 4F93B 4RQ4A 2ZH5A 2HHSA 3RB0A 3WFQE 3OVAA 2KP7A 9ICJA 3RRGA 2PBEA 4ECZA 2C28A 4P2HA 2FPLA 3H7IA 2ZHBA 3EPGA 5J0WA 4O3NA 1A77A 5KT2A 5BPCA 3RBEA 1XSPA 1RPLA 9ICEA 1ZQPA 4J9PA 5BOMA 2AU0A 3ZDAA 5KG5A 9ICOA 2KTQA 4TQSA 1R8CA 3PW4A 4P4MA 1JAJA 4UAZA 4AT7A 4EBCA 1NK5A 1TKDA 4PGXA 3AQMA 4WC3A 3EW9A 4RQ5A 3LWLA 3BJYA 4ED6A 3V6KA 4MF2A 3H8WA 3MGIA 5KFVA 4RQ1A 3HPOA 3KHGA 8ICMA 3H3AA 2JZBA 7ICIA 3Q8LA 3PVXA 2P6UA 4GC6A 4DLGA 1S0OA 4I2BA 3GV8B 5EWFA 1KFTA 4Q43A 3RBDA 1U9LA 4RQ3A 1N48A 7ICPA 4PHEA 5KFRA 4JK1A 3MR6A 2XO7A 2MUTB 4MEXA 4NLKA 5JUMA 1SKRA 2HHWA 2W9BA 4F4WA 1PX5A 3Q8PB 4DFPA 3KTQA 4YP3A 2Y1IA 1UA1A 5IIMA 8ICLA 4UD5A 4DSFA 4WC7A 1JN3A 1X2IA 5J0XA 4QZFA 1U4BA 4RU9A 4C8OA 2Q0ZX 4DQIA 3QZ8A 4XUSA 3PX6A 4I2AA 4R8UB 3RB3A 4FH3A 1H38A 1KTQA 3GILA 1LV5A 3B0YA 4YXJA 3T5LA 2FPKA 3OJUA 2XY6A 4DSEA 1L3TA 4B9NA 3QEAZ 1TFRA 4B9MA 4JWNA 4EYHB 4LT6A 2ZJ5A 4J9OA 8ICHA 5KT6A 1ZQEA 4RNMA 3RH5A 2O5AA 5BOLA 2BPCA 4F5OA 4ED8A 3B0XA 3ISCA 1ZETA 4GXJA 4YQWA 4DSJA 4EYIB 4F91B 4QZHA 5D4BA 5DLGA 1U45A 1QSYA 2UVVA 8ICUA 1T3NA 3ZD9A 4AT8A 9ICSA 4EZ6A 1NK4A 3TQ1A 1SZPA 4J9SA 4J9LA 3GIKA 1ZYQA 3H37A 4I2HA 2FPMA 5HRKA 1Q79A 1JX4A 5CP2A 1T4GA 1NJZA 4AT8B 5IINA 2BCUA 9ICAA 4FHVA 3GV7B 4WC5A 4M6WA 2BHNA 3IM1A 3OUYA 4DS5A 3PW2A 4TUQA 3Q8KA 1TAUA 4UB5A 3AQLA 1NK7A 4X4OA 1TK8A 4YMOA 3T5HA 2ID1A 4F5NA 2W9CA 4F4KA 5J2FA 3OJSA 5HRHA 4XA5A 2M2WA 2BCRA 1DOQA 5KT7A 5KFLA 4NM1A 4QWAA 9ICKA 5HHHA 2ASDA 1MSWD 4Z6DA 3JZ0A 1SL2A 3H4DA 8ICIA 4IQVA 5CWRA 4RQ0A 5DBAA 2ZTEA 5CB1A 1S10A 3JPNA 4R65A 3TAQA 4R64A 4M9LA 9ICPA 4DSKA 2ZTDA 4J9RA 4EBEA 4KLLA 3JPSA 4DL7A 4DWIA 2M2VA 7ICQA 1NK9A 3JYYA 4NKUA 5KFXA 4FBTA 1JMSA 4DL3A 3JPRA 3EPIA 4KLDA 4ECYA 2BGWA 5F9LA 1ZQYA 2ISPA 4KITB 1ZQAA 1D8YA 4QZEA 3NGDA 3MR3A 3RB4A 4DFKA 2AGPA 7ICTA 1R8AA 5KFCA 3C66A 4NY8A 2ZH7A 4DFJA 3PY8A 4RQ7A 2F1IA 3M9MB 1ZQOA 4QZDA 1MIYA 1BNPA 3M8RA 1SL0A 4BXOB 9ICBA 1BPZA 4AT9B 2FMPA 1L5UA 3GDXA 4O5CA 2HW3A 3H38A 2H5XA 1NK8A 1Y88A 4DQRA 4QZ9A 1NK6A 2BKEA 4O3SA 5J0RA 1BPYA 2AJQA 3C1ZA 4NM2A 8ICRA 5HRLA 5DG9A 7ICHA 5KFGA 5KG2A 3T5JA 2BR0A 2R8JA 3QEBZ 4R8UA 3AUOA 2W8KA 5D46A 3HX0A 3SV3A 4RUCA 4ECXA 5DGAA 3WFSC 3HT3A 4YN4A 4KLMA 3TFSA 4I29A 4UB3A 3MABA 5DBCA 5DQHA 4DOBA 4ECSA 4M9HA 4X4PA 4RQ8A 5KFAA 2NRTA 3M9NB 2W9BB 2KFNA 4FHWA 4E80A 2C2RA 2DR9A 3RAXA 4CCHA 5EOZA 2BDPA 5HRDA 2J6TA 4QZCA 5KFPA 4RQ6A 3C23A 4Z6CA 5KFQA 1ZJMA 3H40A 5IIIA 4DL5A 5DB7A 2Y1JA 1BPDA 3MFIA 3OHAA 3M9OB 2PFQA 4UB4A 3GIIA 3T5KA 1ZQGA 1F5AA 1U48A 2HVIA 1C7YA 4LZGA 4F5PA 3Q8SB 1IM4A 3JPPA 1ZQRA 4KN4A 4JV1A 3K4GA 2KFZA 1DK2A 4M5DA 4AT9A 2P66A 4F8RA 8ICQA 1UEVA 4B9SA 4ZH4A 1KFDA 4MF8A 3ISDA 1IXRA 5L1JA 3TAPA 1KRPA 1X9SA 3GIMA 4KLFA 3FYHA 4NXZA 3QZ7A 3MR5A 3BQTA 4KLEA 5KG4A 4YR3A 2PI5A 3Q8QB 4E0DA 2BE3A 5J2JA 4NLNA 4C8NA 4RUAA 7ICLA 2M2TA 2GWSA 2JEIA 2NRXA 4YG2A 5HMMA 5J0YA 2KN7A 3KHHA 1KSPA 1KFSA 4R66A 2BCSA 1OU5A 4J9KA 4EBJA 3JPTA 4IRCA 4I28A 5CR0A 1KNYA 3G6VA 4O5EA 5J2GA 7ICOA 4WC0A 3G6YA 3TFRA 1ZQMA 5CJ7A 5HNKA 4WC1A 3MDAA 4FO6A 4BGDA 2IHMA 3GQCA 1V4AA 2AGOA 1RXVA 1MC8A 5J2HA 1PZNA 4I2CA 3PX0A 4KLSA 3KHLA 3UQ0A 2BQUA 4RPXA 2ASJA 3PMNA 4EEYA 2DPIA 2JEJA 4J9QA 1ZQVA 1XC9A 2R8KA 7ICNA 5KFUA 4O3OA 3V7LA 2XCAA 7ICGA 4M9JA 2BQRA 2ZTCA 4F5RA 5KFSA 5EWEA 1XSNA 3GFKB 4GXIA 2AQ4A 3HJ4A 5KFFA 4UD4A 4QWDA 4RWOA 8ICCA 1HUZA 4QZ8A 3V7KA 1S0NA 5DB8A 4ED2A 4E7XA 4GXKA 4ED1A 1NK0A 1SL1A 1L3SA 2BCVA 5J2DA 9ICRA 4E8FA 4X0BA 4DSLA 1Z00B 1TVAA 4WCWA 5KT5A 4ELTA 1XS9D 3EYZA 5HRBA 2W8LA 2NRWA 2ZUCA 2WTFA 2DRAA 3SI8A 2JEFA 1BPEA 1UT8A 1TK0A 1UETA 2HHXA 4KLUA 1MIWA 8ICJA 4AT7B 4NLZA 3IHQB 5L9XA 1ZJNA 4IR9A 4UAWA 5KG0A 4KLGA 3WFOA 4KLIA 2XGQA 3JPQA 4TURA 4F3OA 7ICKA 5TZVA 3EWAA 5KT4A 1ZQLA 3AQNA 3GIJA 4DOAA 4NLGA 7ICEA 1CUKA 2J6SA 3PW0A 1DK3A 2IMWP 2HHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X9M A;  3EZ5 A;  2I1Q A;  2AGQ A;  1ZQH A;  5HR9 A;  4DF8 A;  4GC7 A;  3C18 A;  5DKW A;  4FS2 A;  3AU6 A;  2VAN A;  2ZH9 A;  4M0A A;  5HRE A;  4EP7 A;  4TUP A;  4X4Q A;  1JIH A;  2R8H A;  5J0T A;  3ORY A;  4YXM A;  4Q44 A;  4ELV A;  4WC2 A;  4IRD A;  2LYH A;  4XQ8 A;  4DL6 A;  3QE9 Y;  2FLP A;  2A1J A;  4LZD A;  5J29 A;  1MQ2 A;  4JWM A;  2NRV A;  4NKT A;  3RTV A;  1NJY A;  4F5Q A;  4FHY A;  3V6J A;  4F50 A;  1KLN A;  4PGQ A;  1KDH A;  3OV7 A;  1T8E A;  1RYS A;  5KG6 A;  5DEC A;  1ARO P;  3PR4 A;  5EWG A;  9ICL A;  3UXN A;  5L1L A;  1NKB A;  4UQG A;  2BPG A;  4UBC A;  2MAX A;  4F92 B;  1SKS A;  3OGU A;  4I2E A;  2P6R A;  5DDM A;  5DB9 A;  3RRH A;  4B9T A;  9ICV A;  9ICQ A;  9ICF A;  5DED A;  3HIY A;  1ZQX A;  3RJE A;  5KFW A;  4XQ7 A;  4BWM A;  3V72 A;  3H4B A;  3C5F A;  4ATB A;  5L1K A;  5HML A;  1N56 A;  3NTU A;  2ASL A;  2BPF A;  4IR1 A;  4Q8E A;  3L9D A;  2ZH4 A;  1S97 A;  1WOT A;  4YMN A;  1QTM A;  1TV9 A;  4X4R A;  3AU2 A;  1S0M A;  3HJ1 A;  3HW8 A;  4DOC A;  4ED7 A;  3WFR E;  1XO1 A;  1S76 D;  2XY7 A;  1SKW A;  7ICU A;  5J0O A;  3PW5 A;  5KT3 A;  4MEY A;  4KLO A;  1ZQU A;  4I2I A;  4Q8F A;  2ZH3 A;  3BQ2 A;  1ZQI A;  5J2C A;  5DB6 A;  3ZD8 A;  4C8L A;  4F4Z A;  1TK5 A;  2IHN A;  2PI4 A;  5CA7 A;  4K4H A;  1K1S A;  1QLN A;  9ICN A;  2HHU A;  8ICK A;  8ICB A;  2I9G A;  1MIV A;  1UA0 A;  2V9W A;  4C8M A;  8ICS A;  5HRF A;  8ICZ A;  1BNO A;  5C5J A;  4WC4 A;  4UBB A;  5J0Q A;  4JUZ A;  4IQT A;  4EBK A;  3RJI A;  1WCN A;  3ZDC A;  7ICV A;  2ZH6 A;  2F1H A;  2VA3 A;  4M2Y A;  2RDJ A;  3C2K A;  3H39 A;  3PO4 A;  3RR8 A;  2HHT A;  2O1P A;  1Z3E B;  2HHP A;  1QSL A;  2M2U A;  2JEG A;  4F2R A;  3E2E A;  3BQ1 A;  2NRZ A;  4Z6F A;  1XU4 A;  2PFO A;  5KFO A;  3RJF A;  1A76 A;  4DL4 A;  3OUY B;  4KTQ A;  4ED3 A;  4KLH A;  1VJ7 A;  4BWJ A;  4K4G A;  4DQS A;  1VFG A;  4RWQ A;  3NYB A;  1DGS A;  5F9N A;  1S0V A;  1LB2 B;  2XC9 A;  2HVH A;  1EXN A;  1BVS A;  4PHA A;  4Q45 A;  4J9M A;  2V4R A;  5L1I A;  3Q8R B;  1U49 A;  4YVZ A;  3M8S A;  4DO9 A;  4YMM A;  3OHB A;  1B43 A;  5IIK A;  4IQU A;  5DBB A;  3HP6 A;  1TAQ A;  1UT5 A;  9ICW A;  2A1J B;  3MDC A;  3N97 B;  2KZZ A;  2DVI A;  2M9N A;  4QWB A;  2Q66 A;  4MFA A;  1L3U A;  4DL2 A;  3UQ2 A;  8ICW A;  1JXL A;  8ICT A;  4RPY A;  1NJX A;  4HYK A;  1TFW A;  4KN7 A;  4F4X A;  4QWC A;  4QWE A;  4M9N A;  9ICT A;  4B9U A;  1V9P A;  5KG7 A;  4R63 A;  3V7J A;  5IIO A;  3MR2 A;  2FLN A;  4DF4 A;  4YFK A;  2PFN A;  4JV2 A;  5J0S A;  5HHI A;  4RPZ A;  3AQK A;  2DR8 A;  3JPO A;  3N4M B;  5KFH A;  3MGH A;  2DR7 A;  2PFP A;  3TI0 A;  1NKE A;  2W9M A;  3T3F A;  3UXO A;  2J6U A;  1D9F A;  1JQR A;  7ICR A;  2UVU A;  4ATB B;  1KEJ A;  2ZUB A;  5KG1 A;  3GV5 B;  5KFJ A;  1MQ3 A;  3BDP A;  3WFP A;  4PPX A;  7ICF A;  5HC9 A;  1CEZ A;  1U47 A;  3C1Y A;  5F2V O;  3KHR A;  4YR0 A;  4QW8 A;  4WC6 A;  2MUT A;  8ICF A;  3V6H A;  1RXW A;  4B9V A;  4J9N A;  4P4P A;  5DG8 A;  4F2S A;  1UEU A;  4X4V A;  4WBZ A;  5KFK A;  1D8L A;  5KFY A;  4FBU A;  4RWP A;  1ZQK A;  5KFI A;  4RT3 A;  5KFD A;  4X4S A;  3OVS A;  3K75 D;  5KFT A;  4F4Y A;  4ECR A;  2AQ0 A;  2C2D A;  1BGX T;  3PML A;  4KLT A;  3RJJ A;  1COO A;  1YLQ A;  2VA8 A;  4IG8 A;  1D9D A;  4I2F A;  3H8J A;  1S77 D;  4X0A A;  2ZH2 A;  4DQQ A;  2XGP A;  4PHP A;  4ELU A;  2C2E A;  4LVS A;  8ICG A;  4TUS A;  4B9L A;  4C8K A;  1NO5 A;  4ECV A;  5D49 A;  2ZH8 A;  2IA6 A;  4DS4 A;  4M9G A;  4DEZ A;  3SZ2 A;  2FMQ A;  1B22 A;  3OSN A;  5DQI A;  3SYZ A;  4DQP A;  4DLE A;  5DGB A;  5HRI A;  3MBY A;  3FDS A;  1Q78 A;  4ED0 A;  4I2J A;  4RNN A;  3G6X A;  4ECU A;  4DSI A;  2R8I A;  4X5V A;  3ISB A;  1HJP A;  2OWO A;  3C21 A;  3HWT A;  4ECT A;  2RFF A;  3C5G A;  1HUO A;  4G3I A;  4ECQ A;  1ZQJ A;  8ICX A;  4Z6E A;  3TAR A;  9ICM A;  4WBY A;  4DFM A;  4TQR A;  4X4T A;  1ZQW A;  3RAQ A;  1X9W A;  2DRB A;  4QZA A;  3TAN A;  3RJH A;  1R89 A;  4PHD A;  1NZP A;  3C2L A;  2JZB B;  3OSP A;  4KMU A;  4M04 A;  3MFH A;  2KZM A;  9ICG A;  4X4U A;  3RR7 A;  4P4O A;  3H8S A;  4ECW A;  1RYR A;  4FHP A;  4GLX A;  4RQ2 A;  2BCQ A;  5DG7 A;  3THV A;  4FS1 A;  2DR5 A;  1ZQC A;  8ICP A;  3OVB A;  5DDY A;  3PW7 A;  2ISO A;  2XY5 A;  4KLQ A;  4YR2 A;  8ICO A;  3ZDE A;  1Z00 A;  4I2D A;  2FMS A;  4O3P A;  5J2I A;  8ICE A;  4YCX A;  4X4N A;  4O3Q A;  8ICN A;  4YD1 A;  2KZ3 A;  3RH6 A;  5J2B A;  2ALZ A;  3UPS A;  1RZT A;  8ICY A;  5J0U A;  3RB6 A;  4K4I A;  2VA2 A;  1NJW A;  1NOM A;  5DQG A;  2ATL A;  2NRK A;  3C2M A;  4RZR A;  1T7P A;  4KLJ A;  4MFC A;  5HP4 A;  4RWN A;  2UVR A;  2FLL A;  2ZJA A;  3PR5 B;  5KFB A;  3PX4 A;  3BQ0 A;  3PO5 A;  2W9A A;  4FH5 A;  7ICJ A;  3LWM A;  1TFY A;  2HHQ A;  5HRG A;  3RJG A;  2DFL A;  5J2E A;  3UXP A;  1QSS A;  1JXE A;  3RJK A;  2C22 A;  5J0P A;  1ZQT A;  9ICC A;  3LK9 A;  5KTQ A;  2ZHA A;  4QZI A;  5J2A A;  1ZQS A;  2PXI A;  4MFF A;  1R8B A;  2B21 A;  4I2G A;  4RNO A;  1XWL A;  5CHG A;  4PH5 A;  4YD2 A;  4IQW A;  4BXO A;  3ZDB A;  7ICM A;  2V4Q A;  4PGY A;  3UPQ A;  4EZ9 A;  1WCL A;  1NKC A;  2R8G A;  2ZH1 A;  8ICA A;  4O0I A;  2DPJ A;  4M6W B;  5KFM A;  3LQC B;  3ZDD A;  1ZQN A;  9ICU A;  5KFN A;  2XCP A;  8ICV A;  3RH4 A;  5IIL A;  3PV8 A;  1FA0 A;  4S3N A;  1S9F A;  4QW9 A;  3PNC A;  2RDI A;  4XRH A;  2W9C B;  5KFE A;  4EBD A;  1BPX A;  4BDP A;  9ICI A;  1ZQD A;  1ZQQ A;  4UB2 A;  4QZG A;  5J2K A;  1L3V A;  4FHX A;  1BPB A;  5KG3 A;  5KFZ A;  7ICS A;  5IIJ A;  4O9M A;  9ICX A;  4RT2 A;  2UVW A;  4QZB A;  4UAY A;  1ZQB A;  3Q8M A;  2IBK A;  1K1Q A;  4M47 A;  5DLF A;  4O5K A;  4I27 A;  3SV4 A;  1XSL A;  4IRK A;  9ICH A;  2F1J A;  4JV0 A;  2BQ3 A;  2ZJ8 A;  1ZQZ A;  1ZQF A;  3ETL A;  4UB1 A;  4O3R A;  2ZUD A;  3LDA A;  4F93 B;  4RQ4 A;  2ZH5 A;  2HHS A;  3RB0 A;  3WFQ E;  3OVA A;  2KP7 A;  9ICJ A;  3RRG A;  2PBE A;  4ECZ A;  2C28 A;  4P2H A;  2FPL A;  3H7I A;  2ZHB A;  3EPG A;  5J0W A;  4O3N A;  1A77 A;  5KT2 A;  5BPC A;  3RBE A;  1XSP A;  1RPL A;  9ICE A;  1ZQP A;  4J9P A;  5BOM A;  2AU0 A;  3ZDA A;  5KG5 A;  9ICO A;  2KTQ A;  4TQS A;  1R8C A;  3PW4 A;  4P4M A;  1JAJ A;  4UAZ A;  4AT7 A;  4EBC A;  1NK5 A;  1TKD A;  4PGX A;  3AQM A;  4WC3 A;  3EW9 A;  4RQ5 A;  3LWL A;  3BJY A;  4ED6 A;  3V6K A;  4MF2 A;  3H8W A;  3MGI A;  5KFV A;  4RQ1 A;  3HPO A;  3KHG A;  8ICM A;  3H3A A;  2JZB A;  7ICI A;  3Q8L A;  3PVX A;  2P6U A;  4GC6 A;  4DLG A;  1S0O A;  4I2B A;  3GV8 B;  5EWF A;  1KFT A;  4Q43 A;  3RBD A;  1U9L A;  4RQ3 A;  1N48 A;  7ICP A;  4PHE A;  5KFR A;  4JK1 A;  3MR6 A;  2XO7 A;  2MUT B;  4MEX A;  4NLK A;  5JUM A;  1SKR A;  2HHW A;  2W9B A;  4F4W A;  1PX5 A;  3Q8P B;  4DFP A;  3KTQ A;  4YP3 A;  2Y1I A;  1UA1 A;  5IIM A;  8ICL A;  4UD5 A;  4DSF A;  4WC7 A;  1JN3 A;  1X2I A;  5J0X A;  4QZF A;  1U4B A;  4RU9 A;  4C8O A;  2Q0Z X;  4DQI A;  3QZ8 A;  4XUS A;  3PX6 A;  4I2A A;  4R8U B;  3RB3 A;  4FH3 A;  1H38 A;  1KTQ A;  3GIL A;  1LV5 A;  3B0Y A;  4YXJ A;  3T5L A;  2FPK A;  3OJU A;  2XY6 A;  4DSE A;  1L3T A;  4B9N A;  3QEA Z;  1TFR A;  4B9M A;  4JWN A;  4EYH B;  4LT6 A;  2ZJ5 A;  4J9O A;  8ICH A;  5KT6 A;  1ZQE A;  4RNM A;  3RH5 A;  2O5A A;  5BOL A;  2BPC A;  4F5O A;  4ED8 A;  3B0X A;  3ISC A;  1ZET A;  4GXJ A;  4YQW A;  4DSJ A;  4EYI B;  4F91 B;  4QZH A;  5D4B A;  5DLG A;  1U45 A;  1QSY A;  2UVV A;  8ICU A;  1T3N A;  3ZD9 A;  4AT8 A;  9ICS A;  4EZ6 A;  1NK4 A;  3TQ1 A;  1SZP A;  4J9S A;  4J9L A;  3GIK A;  1ZYQ A;  3H37 A;  4I2H A;  2FPM A;  5HRK A;  1Q79 A;  1JX4 A;  5CP2 A;  1T4G A;  1NJZ A;  4AT8 B;  5IIN A;  2BCU A;  9ICA A;  4FHV A;  3GV7 B;  4WC5 A;  4M6W A;  2BHN A;  3IM1 A;  3OUY A;  4DS5 A;  3PW2 A;  4TUQ A;  3Q8K A;  1TAU A;  4UB5 A;  3AQL A;  1NK7 A;  4X4O A;  1TK8 A;  4YMO A;  3T5H A;  2ID1 A;  4F5N A;  2W9C A;  4F4K A;  5J2F A;  3OJS A;  5HRH A;  4XA5 A;  2M2W A;  2BCR A;  1DOQ A;  5KT7 A;  5KFL A;  4NM1 A;  4QWA A;  9ICK A;  5HHH A;  2ASD A;  1MSW D;  4Z6D A;  3JZ0 A;  1SL2 A;  3H4D A;  8ICI A;  4IQV A;  5CWR A;  4RQ0 A;  5DBA A;  2ZTE A;  5CB1 A;  1S10 A;  3JPN A;  4R65 A;  3TAQ A;  4R64 A;  4M9L A;  9ICP A;  4DSK A;  2ZTD A;  4J9R A;  4EBE A;  4KLL A;  3JPS A;  4DL7 A;  4DWI A;  2M2V A;  7ICQ A;  1NK9 A;  3JYY A;  4NKU A;  5KFX A;  4FBT A;  1JMS A;  4DL3 A;  3JPR A;  3EPI A;  4KLD A;  4ECY A;  2BGW A;  5F9L A;  1ZQY A;  2ISP A;  4KIT B;  1ZQA A;  1D8Y A;  4QZE A;  3NGD A;  3MR3 A;  3RB4 A;  4DFK A;  2AGP A;  7ICT A;  1R8A A;  5KFC A;  3C66 A;  4NY8 A;  2ZH7 A;  4DFJ A;  3PY8 A;  4RQ7 A;  2F1I A;  3M9M B;  1ZQO A;  4QZD A;  1MIY A;  1BNP A;  3M8R A;  1SL0 A;  4BXO B;  9ICB A;  1BPZ A;  4AT9 B;  2FMP A;  1L5U A;  3GDX A;  4O5C A;  2HW3 A;  3H38 A;  2H5X A;  1NK8 A;  1Y88 A;  4DQR A;  4QZ9 A;  1NK6 A;  2BKE A;  4O3S A;  5J0R A;  1BPY A;  2AJQ A;  3C1Z A;  4NM2 A;  8ICR A;  5HRL A;  5DG9 A;  7ICH A;  5KFG A;  5KG2 A;  3T5J A;  2BR0 A;  2R8J A;  3QEB Z;  4R8U A;  3AUO A;  2W8K A;  5D46 A;  3HX0 A;  3SV3 A;  4RUC A;  4ECX A;  5DGA A;  3WFS C;  3HT3 A;  4YN4 A;  4KLM A;  3TFS A;  4I29 A;  4UB3 A;  3MAB A;  5DBC A;  5DQH A;  4DOB A;  4ECS A;  4M9H A;  4X4P A;  4RQ8 A;  5KFA A;  2NRT A;  3M9N B;  2W9B B;  2KFN A;  4FHW A;  4E80 A;  2C2R A;  2DR9 A;  3RAX A;  4CCH A;  5EOZ A;  2BDP A;  5HRD A;  2J6T A;  4QZC A;  5KFP A;  4RQ6 A;  3C23 A;  4Z6C A;  5KFQ A;  1ZJM A;  3H40 A;  5III A;  4DL5 A;  5DB7 A;  2Y1J A;  1BPD A;  3MFI A;  3OHA A;  3M9O B;  2PFQ A;  4UB4 A;  3GII A;  3T5K A;  1ZQG A;  1F5A A;  1U48 A;  2HVI A;  1C7Y A;  4LZG A;  4F5P A;  3Q8S B;  1IM4 A;  3JPP A;  1ZQR A;  4KN4 A;  4JV1 A;  3K4G A;  2KFZ A;  1DK2 A;  4M5D A;  4AT9 A;  2P66 A;  4F8R A;  8ICQ A;  1UEV A;  4B9S A;  4ZH4 A;  1KFD A;  4MF8 A;  3ISD A;  1IXR A;  5L1J A;  3TAP A;  1KRP A;  1X9S A;  3GIM A;  4KLF A;  3FYH A;  4NXZ A;  3QZ7 A;  3MR5 A;  3BQT A;  4KLE A;  5KG4 A;  4YR3 A;  2PI5 A;  3Q8Q B;  4E0D A;  2BE3 A;  5J2J A;  4NLN A;  4C8N A;  4RUA A;  7ICL A;  2M2T A;  2GWS A;  2JEI A;  2NRX A;  4YG2 A;  5HMM A;  5J0Y A;  2KN7 A;  3KHH A;  1KSP A;  1KFS A;  4R66 A;  2BCS A;  1OU5 A;  4J9K A;  4EBJ A;  3JPT A;  4IRC A;  4I28 A;  5CR0 A;  1KNY A;  3G6V A;  4O5E A;  5J2G A;  7ICO A;  4WC0 A;  3G6Y A;  3TFR A;  1ZQM A;  5CJ7 A;  5HNK A;  4WC1 A;  3MDA A;  4FO6 A;  4BGD A;  2IHM A;  3GQC A;  1V4A A;  2AGO A;  1RXV A;  1MC8 A;  5J2H A;  1PZN A;  4I2C A;  3PX0 A;  4KLS A;  3KHL A;  3UQ0 A;  2BQU A;  4RPX A;  2ASJ A;  3PMN A;  4EEY A;  2DPI A;  2JEJ A;  4J9Q A;  1ZQV A;  1XC9 A;  2R8K A;  7ICN A;  5KFU A;  4O3O A;  3V7L A;  2XCA A;  7ICG A;  4M9J A;  2BQR A;  2ZTC A;  4F5R A;  5KFS A;  5EWE A;  1XSN A;  3GFK B;  4GXI A;  2AQ4 A;  3HJ4 A;  5KFF A;  4UD4 A;  4QWD A;  4RWO A;  8ICC A;  1HUZ A;  4QZ8 A;  3V7K A;  1S0N A;  5DB8 A;  4ED2 A;  4E7X A;  4GXK A;  4ED1 A;  1NK0 A;  1SL1 A;  1L3S A;  2BCV A;  5J2D A;  9ICR A;  4E8F A;  4X0B A;  4DSL A;  1Z00 B;  1TVA A;  4WCW A;  5KT5 A;  4ELT A;  1XS9 D;  3EYZ A;  5HRB A;  2W8L A;  2NRW A;  2ZUC A;  2WTF A;  2DRA A;  3SI8 A;  2JEF A;  1BPE A;  1UT8 A;  1TK0 A;  1UET A;  2HHX A;  4KLU A;  1MIW A;  8ICJ A;  4AT7 B;  4NLZ A;  3IHQ B;  5L9X A;  1ZJN A;  4IR9 A;  4UAW A;  5KG0 A;  4KLG A;  3WFO A;  4KLI A;  2XGQ A;  3JPQ A;  4TUR A;  4F3O A;  7ICK A;  5TZV A;  3EWA A;  5KT4 A;  1ZQL A;  3AQN A;  3GIJ A;  4DOA A;  4NLG A;  7ICE A;  1CUK A;  2J6S A;  3PW0 A;  1DK3 A;  2IMW P;  2HHV A; 
#chains in the Genus database with same CATH topology
 5CFT A;  2AGQ A;  5HR9 A;  4O67 A;  4DF8 A;  2ZH9 A;  2IHO A;  4EP7 A;  2R8H A;  2WAQ F;  3ORY A;  4ELV A;  4IRD A;  2LYH A;  3QE9 Y;  4DL6 A;  4FH3 A;  4LZD A;  1MQ2 A;  4NKT A;  4F50 A;  4PGQ A;  3OV7 A;  2P35 A;  3PR4 A;  2EZY A;  4EX6 A;  9ICL A;  5L1L A;  1NKB A;  4UQG A;  4UBC A;  9ICV A;  3RRH A;  1ZQX A;  5KFW A;  1ZQ1 C;  3UMG A;  5JTI A;  4YMN A;  2ESE A;  3WFR E;  4EEL A;  1XO1 A;  5T14 A;  2R18 A;  5KT3 A;  1ZQU A;  4I2I A;  4J03 A;  2IHN A;  2PI4 A;  1QLN A;  5CA7 A;  3F2D A;  2V9W A;  8ICS A;  2E8P A;  1BNO A;  3AEV A;  5C5J A;  4WC4 A;  4EBK A;  2L5Y A;  4F72 A;  2VA3 A;  2WF7 A;  1WUD A;  5AK6 A;  2HHP A;  3DEE A;  1T3Q A;  1QSL A;  2IUB A;  2NRZ A;  4Z6F A;  5KFO A;  1COK A;  5EE3 A;  3OUY B;  5C0Y A;  4DQS A;  1DGS A;  4OCZ A;  4C4R A;  1EXN A;  1BVS A;  1PK3 A;  1L7P A;  3Q8R B;  1U49 A;  4DO9 A;  4YMM A;  3OHB A;  2QKQ A;  2EAN A;  4K9A A;  3AL0 B;  4MFA A;  8ICT A;  5ALH A;  1NJX A;  4HYK A;  4QWC A;  1Z19 A;  4C7Z A;  4R63 A;  1O03 A;  3UM9 A;  3MR2 A;  4YFK A;  2PFN A;  3AQK A;  2DR8 A;  3OTQ A;  3DV9 A;  1KW4 A;  2PFP A;  2EQY A;  3TI0 A;  2UVU A;  5ALP A;  2ZUB A;  4FE3 A;  3N7R C;  1SXD A;  4ZOH C;  5F2V O;  4RQM A;  1LKY B;  2JHD A;  4OD0 A;  3F2C A;  4P0P A;  3CNH A;  4P4P A;  1YZ6 A;  4RT3 A;  4F4Y A;  4OJ6 A;  4O3M A;  1BGX T;  1COO A;  4UB6 U;  4I2F A;  4X0A A;  4ELU A;  2C2E A;  2XID A;  4LVS A;  4C8K A;  2ZH8 A;  4M9G A;  4P0Q A;  3SZ2 A;  1B22 A;  5HRI A;  3QXG A;  1ZD4 A;  4ECU A;  2XIC A;  1V38 A;  1HJP A;  5AKL A;  4ECT A;  3C5G A;  4G3I A;  8ICX A;  4WBY A;  3NVW A;  4X4T A;  2VKQ A;  4QZA A;  3RJH A;  4Y2R A;  3OSP A;  9ICG A;  4X4U A;  1N2X A;  4P4O A;  2FCL A;  4RQ2 A;  3THV A;  2DR5 A;  5ALU A;  8ICP A;  3OVB A;  4KLQ A;  1Z00 A;  4I2D A;  5J2I A;  8ICE A;  1VDV A;  3RH6 A;  1XO0 A;  4K4I A;  2KJ5 A;  1NJW A;  2NRK A;  2ATL A;  3C2M A;  4KLJ A;  3PR5 B;  2O6K A;  3PX4 A;  5ALM A;  2DWQ A;  3RJG A;  3RJK A;  9ICC A;  5KTQ A;  4QZI A;  4K9B A;  2IOF A;  4QIW F;  4I2G A;  4PH5 A;  4PGY A;  3UPQ A;  1NKC A;  1JUD A;  2HBM A;  4M6W B;  5H2F U;  3ZDD A;  2GA9 D;  3IG5 A;  5KFN A;  8ICV A;  3RH4 A;  5IIL A;  4UW9 A;  4XRH A;  3CP8 A;  1BPX A;  9ICI A;  4FHX A;  2KK0 A;  1ZQB A;  2IBK A;  5DLF A;  3H0M B;  1FO4 A;  1NZB A;  2JMG A;  2BQ3 A;  4O6A A;  3ETL A;  3PZP A;  2ZH5 A;  2HHS A;  3RB0 A;  3WFQ E;  4CRX A;  2KP7 A;  9ICJ A;  2FPL A;  3K1R B;  2D6F C;  5J0W A;  1A77 A;  3RBE A;  5BPC A;  1RPL A;  1ZQP A;  4WQL A;  2OEH A;  2RQ5 A;  5ALI A;  3PW4 A;  5G5H A;  4AT7 A;  1TKD A;  3BQ7 A;  1QQ7 A;  4RQ1 A;  8ICM A;  3H3A A;  2JZB A;  3BS5 B;  3PVX A;  4DLG A;  3GV8 B;  4Q43 A;  4I0U A;  1ZD3 A;  2K4H A;  1KQQ A;  3MR6 A;  5JTG A;  2HHW A;  3VCB A;  2K8A A;  2OYY A;  1UA1 A;  5IIM A;  1X2I A;  5J0X A;  2VJ5 A;  3B0Y A;  4YXJ A;  2XY6 A;  4B9N A;  4KM5 A;  1S8O A;  3EF2 A;  4J9O A;  2FJ6 A;  3IRU A;  3ER9 B;  2YMM A;  4F5O A;  4ED8 A;  5KL1 B;  3B0X A;  3ISC A;  2IOH A;  1N60 A;  3M6Z A;  1LVH A;  4F91 B;  4EYI B;  1QSY A;  2A3V A;  8ICU A;  2HMX A;  3ZD9 A;  1NK4 A;  4AT8 B;  5IIN A;  4M6W A;  2KV2 A;  4OJL A;  2NYV A;  2FE9 A;  4YMO A;  2BDU A;  4F4K A;  5J2F A;  5AKH A;  5EE0 A;  2K4P A;  2ASD A;  1MSW D;  1X40 A;  8ICI A;  4RQ0 A;  2K89 A;  4M9L A;  3F5A A;  3ONN A;  2GLE A;  3EPI A;  2BGW A;  1ZQY A;  4KX5 A;  7ICT A;  1SV0 A;  2LM4 A;  1R8A A;  4NY8 A;  2F1I A;  3M9M B;  3M8R A;  1URJ A;  4DQR A;  5J0R A;  4FZN A;  3C1Z A;  5DG9 A;  5KFG A;  2BR0 A;  3AUO A;  4RUC A;  3HKZ F;  5DQH A;  4M9H A;  4X4P A;  1B4F A;  2J6T A;  4QZC A;  1SZH A;  5KFQ A;  1ZJM A;  4DL5 A;  2K60 A;  3HIL A;  2F77 X;  2PFQ A;  4UB4 A;  3GII A;  1ZQG A;  4F5P A;  3JPP A;  3E0F A;  3ICX A;  4KN4 A;  4JV1 A;  4F8R A;  4OJP A;  4ZH4 A;  1KFD A;  3ISD A;  1IXR A;  5L1J A;  2KJ9 A;  3FYH A;  3MR5 A;  3QZ7 A;  4UB8 U;  4KLE A;  2PI5 A;  4E0D A;  2WFA A;  4C8N A;  2NRX A;  4YG2 A;  3KHH A;  1KSP A;  4R66 A;  5ALO A;  1QCK A;  5CR0 A;  3G6V A;  2I6X A;  4OAF A;  3WK4 A;  5HNK A;  4FO6 A;  3I28 A;  2AGO A;  1RXV A;  1MC8 A;  4KLS A;  3AQE A;  4RPX A;  2ASJ A;  3PMN A;  2DPI A;  1XC9 A;  3WKE A;  4WOY A;  4O3O A;  2XCA A;  5A0L A;  5KFS A;  3GFK B;  4UD4 A;  8ICC A;  1S0N A;  5DB8 A;  4ED1 A;  1NK0 A;  5J2D A;  4E8F A;  4DSL A;  4NLB A;  3HKZ C;  4WCW A;  5KT5 A;  4ELT A;  5HRB A;  2W8L A;  2ZUC A;  2WTF A;  1UET A;  4AT7 B;  5AKZ A;  4KLU A;  1L8L A;  1JRP A;  4Y2U A;  1A6S A;  4NLG A;  2J6S A;  3J81 j;  2IMW P;  2HHV A;  1ZQH A;  4AYB F;  4GC7 A;  3C18 A;  4WC2 A;  1P7D A;  5J29 A;  2NRV A;  3RTV A;  1NJY A;  4F5Q A;  3QU7 A;  3V6J A;  1KLN A;  4BUG A;  5KG6 A;  5ALR A;  1N61 A;  2BPG A;  4O5E A;  2MAX A;  4F92 B;  3NYB A;  3OGU A;  5DED A;  1MA7 A;  2CXY A;  9ICQ A;  9ICF A;  3HIY A;  2WAQ C;  4BWM A;  5KL8 B;  1N56 A;  4Q8E A;  3L9D A;  1WOT A;  3N7S C;  2BBJ A;  1NNL A;  2KKP A;  3AU2 A;  5AHX A;  1S0M A;  4ED7 A;  3T79 A;  3L4P A;  2XY7 A;  3FM9 A;  1SKW A;  7ICU A;  5J0O A;  4KLO A;  2PMZ C;  4Q8F A;  3BQ2 A;  4IC9 A;  1ZQI A;  5J2C A;  5DB6 A;  4K4H A;  4C0Z A;  1O08 A;  3LYS A;  8ICK A;  1MIV A;  5HRF A;  8ICZ A;  4UBB A;  4JUZ A;  1WCN A;  5AM3 A;  1RDF A;  2ZH6 A;  4B6J A;  1SXE A;  4NV0 A;  3PO4 A;  5AIC A;  3TAC B;  2HHT A;  2K4E A;  1Z3E B;  4OAG A;  1FIQ A;  4Y2V A;  2JEG A;  4F2R A;  3EUB 2;  4UAT A;  4BWJ A;  4RWQ A;  5F9N A;  1S0V A;  1SB3 C;  1LB2 B;  2XC9 A;  3SQI A;  1X66 A;  2KEY A;  4J9M A;  1RYU A;  5L1I A;  3K7D A;  5IIK A;  3HP6 A;  1TAQ A;  2A1J B;  3MDC A;  3UQ2 A;  3NUQ A;  3B9J A;  4KN7 A;  2PMZ F;  3L3F X;  4B9U A;  1V9P A;  5KG7 A;  3V7J A;  4JV2 A;  5HHI A;  1L6N A;  5ALV A;  3JPO A;  3N4M B;  3LVV A;  3MGH A;  2DR7 A;  4ATB B;  3GV5 B;  3NRZ A;  3WFP A;  4PPX A;  2JGA A;  4QJF B;  3ZI4 A;  2QB0 B;  3AM9 A;  4K99 A;  4YR0 A;  2MUT A;  3V6H A;  5KAI U;  4B9V A;  4J9N A;  4JLZ A;  5DG8 A;  1UEU A;  5KFY A;  4RWP A;  1ZQK A;  2NO5 A;  4X4S A;  2HI0 A;  2KD1 A;  3K75 D;  2C2D A;  1HEK A;  1SWW A;  2VA8 A;  1D9D A;  1S77 D;  4AYB C;  4TUS A;  3M1Y A;  5D49 A;  2IA6 A;  3BS7 A;  5DQI A;  4DQP A;  2G0A A;  5DGB A;  3QUB A;  3MBY A;  2OH2 A;  4DSI A;  3WKA A;  3ISB A;  3N28 A;  3C21 A;  1N5W A;  3A0H U;  3OPX A;  2ZIU A;  5KAF U;  1HUO A;  4ECQ A;  2DUY A;  4Z6E A;  3TAR A;  4TQR A;  2KIV A;  1NZP A;  3C2L A;  2KIC A;  2BCQ A;  5DG7 A;  4WQK A;  1DXS A;  1N62 A;  5DDY A;  3PW7 A;  8ICO A;  3ZDE A;  2GH1 A;  4O3P A;  1UQV A;  4YCX A;  4O3Q A;  4YD1 A;  2H3Q A;  5ALQ A;  5AIA A;  1RZT A;  5J0U A;  2N1R A;  2VA2 A;  1HIW A;  3SR6 A;  4BJQ A;  2FLL A;  2ZJA A;  4NXU A;  3BQ0 A;  3PO5 A;  1YZ7 A;  2W9A A;  4FH5 A;  1KL9 A;  2HHQ A;  5HRG A;  1RQN A;  5J2E A;  1JXE A;  2C22 A;  1ZQT A;  3LK9 A;  2QB1 A;  1ZQS A;  3PSP A;  2K8C B;  2B21 A;  4RNO A;  5CHG A;  3NKU A;  3F2B A;  4BXO A;  3QU4 A;  4US9 A;  5HR7 A;  3H8M A;  1WCL A;  2ZH1 A;  4NL9 C;  3UMB A;  3R9K A;  4U6P A;  1S9F A;  4OO1 J;  3PNC A;  2RDI A;  4EBD A;  2JH1 A;  1SWV A;  4UB2 A;  5FP0 A;  1BPB A;  1Q46 A;  4QZB A;  2JR5 A;  1K1Q A;  3SV4 A;  5AM5 A;  1XSL A;  4Y2Q A;  2VIX A;  2ZJ8 A;  1ZQZ A;  5ALS A;  4UB1 A;  2EAP A;  3LDA A;  4RQ4 A;  5AM2 A;  1N5X A;  3FAH A;  2G07 A;  2E8O A;  3MGV A;  4XJE A;  2EZX A;  4ECZ A;  3CK6 A;  3EPG A;  2WB1 C;  3IG8 A;  5F3X B;  5AM1 A;  9ICE A;  4J9P A;  2JXJ A;  5BOM A;  2AU0 A;  9ICO A;  1R8C A;  1JAJ A;  4WC3 A;  4JMU A;  3LWL A;  3H8W A;  7ICI A;  4GC6 A;  1S0O A;  1KFT A;  2KSO B;  3RBD A;  4EEN A;  3GZF A;  4PHE A;  2XO7 A;  2MUT B;  5AI5 A;  1VJ5 A;  2CPR A;  8ICL A;  4DSF A;  3KOO A;  4XUS A;  3RB3 A;  2G5H B;  2XI9 A;  2FPK A;  4DSE A;  3QEA Z;  3AN1 A;  5AK3 A;  4JWN A;  3PST A;  5KT6 A;  1X6J A;  4BX9 C;  5BOL A;  4OJO A;  5L1M A;  1ZET A;  1U45 A;  2UVV A;  2E1E A;  5J8Y C;  3GIK A;  1ZYQ A;  2E1F A;  1JX4 A;  2RLT A;  5CP2 A;  1T4G A;  2WF8 A;  9ICA A;  3GV7 B;  2LHT A;  2ZXI A;  1TAU A;  2YMP A;  2GOL A;  2ID1 A;  1WWU A;  2W9C A;  5HRH A;  1DOQ A;  4QWA A;  4NJ8 A;  9ICK A;  5HHH A;  2VJ4 A;  2DBY A;  4IQV A;  1MN8 A;  1V85 A;  4C80 A;  4R64 A;  2M2V A;  3JYY A;  4NKU A;  1NK9 A;  5KFX A;  1KKX A;  3CW2 C;  1JAL A;  4KLD A;  2ISP A;  4KIT B;  3MR3 A;  3RB4 A;  3C66 A;  2W43 A;  3QUQ A;  4DFJ A;  2G08 A;  4RQ7 A;  1ZQO A;  1MIY A;  1BNP A;  3KFU F;  4BXO B;  1Z4O A;  1L5U A;  4O5C A;  2HW3 A;  2KJ8 A;  4QZ9 A;  1BPY A;  2NV3 A;  3T5J A;  2YX8 A;  5AI0 A;  5KG2 A;  2R8J A;  3QEB Z;  2OXO A;  4C4T A;  2W8K A;  5D46 A;  3SV3 A;  4ECX A;  3WFS C;  5DGA A;  2ODG A;  3TFS A;  4UB3 A;  3MAB A;  5DBC A;  5KFA A;  2NRT A;  3M9N B;  2W9B B;  4FHW A;  4E80 A;  3KZI U;  3RAX A;  4CCH A;  5HRD A;  2BDP A;  1SGG A;  5KFP A;  4U7C A;  4RQ6 A;  2B4V A;  3S6J A;  3C23 A;  4NXV A;  3H40 A;  5DB7 A;  1F44 A;  2HVI A;  3SEN A;  4LZG A;  2DKX A;  1DK2 A;  5B66 U;  3K4G A;  4AT9 A;  2H3I A;  4JLX A;  5K4L A;  3TAP A;  1KRP A;  3BQT A;  4YR3 A;  2BE3 A;  2ZIW B;  5J2J A;  4NLN A;  2AXT U;  3JCF A;  5J0Y A;  3ETR A;  4IRC A;  4I28 A;  1NI3 A;  2JRZ A;  4DFD A;  5CHE A;  7ICO A;  4WC0 A;  4PJ0 U;  3TFR A;  3PSI A;  2RHF A;  5CJ7 A;  2B0C A;  2IHM A;  1J2N A;  1A0P A;  5J2H A;  4EEY A;  7ICN A;  2LMR A;  5EWE A;  4GXI A;  4PZN A;  2AQ4 A;  2KNJ A;  3PSF A;  3N7P D;  2HDO A;  2QAR A;  4NL9 A;  2LYB A;  4QZ8 A;  2Z7J A;  4GXK A;  9ICR A;  3QUT A;  2EDU A;  1JRO A;  1QQ5 A;  1XS9 D;  1VLB A;  1UT8 A;  1SV0 C;  1MIW A;  8ICJ A;  1L8O A;  5L9X A;  3WFO A;  2QAR B;  1ZJN A;  5D61 A;  4KLI A;  1AQ6 A;  4TUR A;  3JPQ A;  5KT4 A;  2Y9T A;  3GIJ A;  1CUK A;  1X42 A;  4WC5 A;  3EZ5 A;  2E3T A;  2LPE A;  5DKW A;  2VAN A;  4M0A A;  4TUP A;  1JIH A;  2YQE A;  4YXM A;  2M0N A;  3BZC A;  2FLP A;  2A1J A;  4JWM A;  1QQ6 A;  1T94 A;  4UAR A;  3A0B U;  4FHY A;  1GO3 F;  2K8B B;  3SEI A;  1T8E A;  1RYS A;  5DEC A;  1ARO P;  2KG5 A;  5EWG A;  3UXN A;  2ZIW A;  4HX0 A;  5DB9 A;  2MA1 A;  2HBJ A;  5GTI U;  3C5F A;  2ZH4 A;  4IR1 A;  2ASL A;  1S97 A;  1QTM A;  1TV9 A;  4X4R A;  3HJ1 A;  4DOC A;  3WK5 A;  1V97 A;  4WH5 A;  5AI6 A;  3PW5 A;  3MC1 A;  5GTH U;  3NVV A;  4C8L A;  9ICN A;  4F4Z A;  3IP4 B;  1UA0 A;  5J0Q A;  4IQT A;  3RJI A;  3TAD C;  4M2Y A;  2RDJ A;  3H39 A;  3RR8 A;  2AHO B;  3HRD D;  2M2U A;  2PFO A;  3RJF A;  1A76 A;  2B56 A;  4DL4 A;  3SAH A;  4KTQ A;  4ED3 A;  1VJ7 A;  4K4G A;  4UAS A;  4CF5 A;  2HVH A;  2RRD A;  2V4R A;  4YVZ A;  3M8S A;  1X6I A;  1L7O A;  4NXW A;  1B43 A;  4IQU A;  1UT5 A;  1IV8 A;  2KZZ A;  2M9N A;  4JB3 A;  3QX7 A;  4QWE A;  5IIO A;  3ERC C;  2FLN A;  4RPZ A;  1Q3U A;  4AP9 A;  1NKE A;  2W9M A;  3T3F A;  3UXO A;  1JQR A;  1KEJ A;  5KFJ A;  3BDP A;  7ICF A;  5HC9 A;  1CEZ A;  1Z1B A;  1U47 A;  3KHR A;  4QW8 A;  4K98 A;  1RXW A;  3CRX A;  4F2S A;  4X4V A;  1ZRM A;  5KFD A;  1SV4 A;  2W7P A;  3OVS A;  2AQ0 A;  5ALX A;  4KMO B;  3RJJ A;  1YLQ A;  1L7M A;  2ZH2 A;  3QNM A;  8ICG A;  2YB4 A;  1NO5 A;  4DS4 A;  4DEZ A;  3SYZ A;  4DLE A;  3WKC A;  1Q78 A;  3F53 A;  4ED0 A;  4I2J A;  4RNN A;  3G6X A;  2OWO A;  3HWT A;  2W55 A;  3NRW A;  9ICM A;  4K97 A;  4DFM A;  1ZQW A;  5AKE A;  2DRB A;  1R89 A;  3TAN A;  2KZM A;  3MFH A;  3RR7 A;  3H8S A;  1RYR A;  3L5K A;  4GLX A;  1PK1 B;  5AKJ A;  4FS1 A;  1DGJ A;  2XY5 A;  4G9B A;  3RF9 A;  2FMS A;  3SD7 A;  1L7N A;  4MHV A;  2KZ3 A;  2ALZ A;  4CNQ A;  4GIB A;  3UPS A;  8ICY A;  3RB6 A;  1NOM A;  4MFC A;  4RZR A;  1T7P A;  5HP4 A;  4RWN A;  2FI1 A;  2LYA A;  1ZOL A;  5CFU A;  7ICJ A;  1TFY A;  1QSS A;  3UXP A;  4CF4 A;  2KKV A;  5J0P A;  1ZXI A;  5J2A A;  4ACO A;  2PXI A;  4MFF A;  1R8B A;  4O69 A;  1UHU A;  5D62 A;  2LKY A;  2MSN A;  8ICA A;  4O0I A;  2DPJ A;  3LQC B;  3AMZ A;  2XCP A;  2EH9 A;  2H3V A;  4QW9 A;  2W9C B;  2Q4T A;  4BDP A;  1ZQD A;  1ZQQ A;  4QZG A;  1L3V A;  5KG3 A;  5KFZ A;  1B0X A;  4UAY A;  3Q8M A;  3BZK A;  4I27 A;  2F1J A;  4JV0 A;  1ZQF A;  4EX7 A;  4O3R A;  4F93 B;  3RRG A;  3U26 A;  2ZHB A;  2ZG6 A;  2A1A A;  4O3N A;  5KT2 A;  1XSP A;  2DKZ A;  4IL6 U;  3ZDA A;  4P4M A;  4UAZ A;  1NK5 A;  2F76 X;  4PGX A;  3ED5 A;  1ED1 A;  2DF4 B;  2W3S A;  4ED6 A;  3EW9 A;  3BJY A;  3V6K A;  3AQM A;  3MGI A;  5KFV A;  3HPO A;  5AKY A;  3Q8L A;  2P6U A;  3KBB A;  5EWF A;  4RQ3 A;  7ICP A;  4MEX A;  4NLK A;  5JUM A;  5ALK A;  4YP3 A;  2KVS A;  4KX3 A;  4WC7 A;  4UD5 A;  1JN3 A;  1UCV A;  1U4B A;  4C8O A;  3PX6 A;  4R8U B;  1Q8K A;  1H38 A;  1KTQ A;  3GIL A;  3T5L A;  4LT6 A;  1TFR A;  4EYH B;  2XVT A;  2ZJ5 A;  3GU3 A;  3UMC A;  4RNM A;  3K1Z A;  3RH5 A;  2G5I B;  4OAH A;  5ALD A;  4YQW A;  4GXJ A;  4DSJ A;  3QUC A;  5D4B A;  5DLG A;  3KKA C;  1T3N A;  4AT8 A;  4EZ6 A;  3TQ1 A;  1J97 A;  4J9L A;  3H37 A;  4I2H A;  2FPM A;  2YMQ A;  3D2S A;  5HRK A;  1NJZ A;  2IOF K;  4FHV A;  1F5S A;  2GO7 A;  3IM1 A;  3OUY A;  3PW2 A;  4TUQ A;  4Y2S A;  3AQL A;  4F5N A;  2A19 A;  3OJS A;  4XA5 A;  5KNI A;  2M2W A;  2BCR A;  3NVO A;  2QLT A;  4NM1 A;  2DL0 A;  5E79 U;  2W03 A;  3JZ0 A;  1SL2 A;  2YB1 A;  5CWR A;  3C29 A;  2ZXH A;  2ZTE A;  2YTU A;  5DBA A;  1S10 A;  3JPN A;  3I1Y A;  4R65 A;  3TAQ A;  3FC4 A;  1CRX A;  4EBE A;  3JPS A;  1OUQ A;  4DWI A;  3QU5 A;  7ICQ A;  3ER8 C;  4FBT A;  4Y2P A;  4DL3 A;  2NO4 A;  3JPR A;  4ECY A;  5F9L A;  3NVZ A;  1ZQA A;  1D8Y A;  4DFK A;  1CI4 A;  3GDX A;  4HAI A;  3H38 A;  1NK6 A;  8ICR A;  2AJQ A;  4MKP A;  4NM2 A;  3HJE A;  7ICH A;  2WHE A;  5AKX A;  1KN5 A;  4R8U A;  3HX0 A;  3HT3 A;  5CEH A;  4I29 A;  3WK8 A;  4WJ3 B;  4EED A;  4DOB A;  4ECS A;  4RQ8 A;  2KFN A;  2DR9 A;  5EOZ A;  2W3R A;  4OAI Z;  1M6Y A;  2CN1 A;  4CE6 A;  5III A;  1BPD A;  3MFI A;  2ZIV A;  3M9O B;  3T5K A;  1F5A A;  1U48 A;  1C7Y A;  3Q8S B;  1IM4 A;  1PUZ A;  2ZIU B;  2KFZ A;  4M5D A;  2P66 A;  1KBU A;  1UEV A;  4B9S A;  4KB6 A;  2HN2 A;  3O0F A;  3GIM A;  5AIB A;  4KLF A;  5KG4 A;  5ALF A;  5AK4 A;  1ZD5 A;  2M2T A;  7ICL A;  4RUA A;  1IIP A;  3C28 A;  3QYP A;  4Y2T A;  5HMM A;  1KFS A;  1OU5 A;  4Y2X A;  2BCS A;  2G09 A;  3KD3 A;  3JPT A;  1KNY A;  2W54 A;  5G5G A;  2BZF A;  1ZQM A;  4IS7 A;  3MDA A;  3GQC A;  5ALG A;  4I2C A;  1Z4N A;  3IDW A;  3PX0 A;  3KHL A;  3UQ0 A;  2BQU A;  1UPH A;  1ZQV A;  1OW5 A;  2W11 A;  3KZX A;  5KFU A;  2KOB A;  4M9J A;  2BQR A;  1RG6 A;  1XSN A;  2Y0S F;  3HJ4 A;  5KFF A;  4RWO A;  3V7K A;  2D3D A;  4ED2 A;  3M7D A;  3SAG A;  2BCV A;  1SL1 A;  1IG6 A;  1Z00 B;  2ES6 A;  4US8 A;  3EYZ A;  2NRW A;  2JEF A;  1TK0 A;  3IHQ B;  3WK9 A;  4IR9 A;  5KG0 A;  2DGZ A;  2KIW A;  4PZO A;  7ICK A;  4F3O A;  2WF6 A;  3EWA A;  1ZQL A;  4DOA A;  2RP5 A;  7ICE A;  2EWR A;  3PW0 A;  4NWI A;  1X9M A;  2I1Q A;  2EZZ A;  4FS2 A;  3AU6 A;  5HRE A;  4X4Q A;  5J0T A;  4Q44 A;  3F5E A;  2MU2 A;  5AM4 A;  4XQ8 A;  1K5O A;  4FFD A;  1DRG A;  1KDH A;  2KMD A;  4USA A;  1Q3V A;  2D8C A;  2KHV A;  4I2E A;  1SKS A;  2B51 A;  1PX5 A;  2P6R A;  5DDM A;  4B9T A;  3RJE A;  4XQ7 A;  3V72 A;  3H4B A;  4ATB A;  5AKI A;  5HML A;  5L1K A;  3NTU A;  2BPF A;  3MCR A;  2YML A;  3HW8 A;  4CF3 A;  1S76 D;  1WYG A;  2JV3 A;  4MEY A;  2ZH3 A;  3ZD8 A;  1TK5 A;  2OHF A;  1K1S A;  2HHU A;  2Y9U A;  8ICB A;  2I9G A;  4C8M A;  3SAF A;  3ZDC A;  5EE9 A;  5J8Y A;  7ICV A;  2F1H A;  5AM0 A;  3C2K A;  5ALY A;  1YT3 A;  3WKB A;  2O1P A;  5JRT A;  2OM6 A;  4LEZ A;  3BQ1 A;  1XU4 A;  4F71 A;  5B5E U;  4KLH A;  4OJ5 A;  1VFG A;  2H3Z A;  5ALZ A;  2HCF A;  4PHA A;  4Q45 A;  4UAV A;  2HSZ A;  5DBB A;  2CRX A;  5B3P A;  9ICW A;  1D8B A;  3N97 B;  2DVI A;  4QWB A;  2Q66 A;  2F3N A;  1L3U A;  4DL2 A;  8ICW A;  1JXL A;  4QIW C;  4RPY A;  2E8N A;  1TFW A;  4F4X A;  4M9N A;  9ICT A;  2ZIX A;  4CGZ A;  4DF4 A;  5J0S A;  5KFH A;  2J6U A;  1D9F A;  7ICR A;  2LM1 A;  1PVP A;  5KG1 A;  1MQ3 A;  3D2N A;  2HOQ A;  3C1Y A;  2KVC A;  2E5S A;  4WC6 A;  3NWI A;  8ICF A;  1WG8 A;  3AQF A;  2B6G A;  4WBZ A;  5KFK A;  1D8L A;  4FBU A;  4LEV A;  5KFI A;  2KE7 A;  2ZIV B;  3IV6 A;  4ECR A;  5KFT A;  3PML A;  4KLT A;  1TE2 A;  4CDG A;  4IG8 A;  1X9X A;  3H8J A;  3OWG A;  4DQQ A;  2XGP A;  4PHP A;  4B9L A;  2FDR A;  2HN1 A;  4ECV A;  2FMQ A;  5CFS A;  1QH9 A;  3OSN A;  5AKK A;  3FDS A;  2R8I A;  4X5V A;  5CRX A;  2KHQ A;  3SMV A;  2RFF A;  1ZQJ A;  2W04 A;  3RAQ A;  1X9W A;  2WF9 A;  4EEK A;  3E58 A;  4PHD A;  4M04 A;  2JZB B;  3BS5 A;  4KMU A;  3TAD A;  4ECW A;  4FHP A;  5TIS U;  1JI7 A;  4GFJ A;  1ZQC A;  2ISO A;  4YR2 A;  5ALT A;  4FO1 A;  4X4N A;  4Y2J A;  8ICN A;  2HBL A;  5J2B A;  5AI4 A;  5DQG A;  2PKE A;  1F0M A;  2UVR A;  1RM6 C;  3WU2 U;  5KFB A;  3LWM A;  1GPJ A;  2DFL A;  2F44 A;  2ZHA A;  5JU5 A;  2DQN B;  2GAF D;  1XWL A;  4YD2 A;  5D63 A;  4IQW A;  3ZDB A;  7ICM A;  2V4Q A;  3VC8 A;  4EZ9 A;  2I5H A;  2R8G A;  1PVR A;  5KFM A;  1ZQN A;  9ICU A;  2F2A B;  3PV8 A;  1FA0 A;  2Y0S C;  4S3N A;  5KFE A;  5J2K A;  5IIJ A;  4O9M A;  9ICX A;  4RT2 A;  5ALN A;  3WK6 A;  2UVW A;  4P0Q B;  4M47 A;  4O5K A;  4IRK A;  9ICH A;  2ZUD A;  1SIJ A;  3ALR A;  3OVA A;  2PBE A;  5ALW A;  2C28 A;  4P2H A;  3H7I A;  2G06 A;  5HR6 A;  4P0P B;  5KG5 A;  2KTQ A;  4TQS A;  4EBC A;  1C20 A;  4RQ5 A;  2LI6 A;  4MF2 A;  3KHG A;  3KKA A;  4I2B A;  1U9L A;  1N48 A;  5B3Q A;  5KFR A;  4JK1 A;  1SKR A;  2W9B A;  3QU2 A;  4F4W A;  3Q8P B;  4DFP A;  3KTQ A;  2BBH A;  2Y1I A;  5AI9 A;  2EAO A;  4LJX A;  4QZF A;  2EAM A;  4DQI A;  4RU9 A;  2Q0Z X;  2WB1 F;  3QZ8 A;  4I2A A;  3CYM A;  3DDH A;  2LBO A;  1LV5 A;  3WK7 A;  3OJU A;  7ICS A;  1L3T A;  4B9M A;  1PK1 A;  4EEB A;  1FFV A;  2F8L A;  2ZIX B;  8ICH A;  2HBK A;  1ZQE A;  4C7Y A;  2O5A A;  2BPC A;  3RFA A;  5AI8 A;  3E2E A;  4QZH A;  9ICS A;  2W7O A;  1SZP A;  4J9S A;  1LKY A;  1Q79 A;  5AKG A;  1XNS A;  2BCU A;  2OCE A;  2BHN A;  2K4I A;  4DS5 A;  3Q8K A;  4LEY A;  4UB5 A;  3IN5 A;  1NK7 A;  4X4O A;  1TK8 A;  3T5H A;  5EE1 A;  1OXJ A;  3H0L B;  5KT7 A;  5KFL A;  4Z6D A;  1Z1V A;  4EGW A;  3H4D A;  4FZL A;  5CB1 A;  4NXT A;  9ICP A;  4DSK A;  2ZTD A;  4J9R A;  5ALL A;  4KLL A;  4DL7 A;  1PVQ A;  1JMS A;  3TKA A;  3NS1 A;  1ZD2 P;  4QZE A;  3NGD A;  2AGP A;  5KFC A;  2ZH7 A;  3PY8 A;  4QZD A;  1TAM A;  1SL0 A;  9ICB A;  4NLC A;  1BPZ A;  2FMP A;  2HOI A;  4AT9 B;  2H5X A;  1NK8 A;  1Y88 A;  2BKE A;  4O3S A;  5HRL A;  2QB0 A;  4C4S A;  2WF5 A;  1J2M A;  3D2Q A;  4PL1 A;  4YN4 A;  2MRL A;  4KLM A;  2H3F A;  1FFU A;  4PL2 A;  2YY6 A;  2C2R A;  3PHZ A;  4DCC A;  4Z6C A;  4ICA A;  2YN4 A;  2Y1J A;  1ECW A;  3OHA A;  1N63 A;  3WKD A;  4FZM A;  1ZQR A;  4QNL A;  1ZRN A;  3H0R B;  2AH5 A;  3D6J A;  8ICQ A;  3NAS A;  4MF8 A;  5AK5 A;  5ALJ A;  1X9S A;  4NXZ A;  4RQN A;  4A8E A;  3Q8Q B;  4LEW A;  2GWS A;  2JEI A;  2KN7 A;  4J9K A;  4EBJ A;  2JH7 A;  3M6K A;  4NXX A;  5J2G A;  5ALE A;  3G6Y A;  4WC1 A;  3QU9 A;  4BGD A;  1V4A A;  1PZN A;  2JEJ A;  4J9Q A;  2R8K A;  4UAU A;  4EV6 A;  2E8M A;  3V7L A;  7ICG A;  4K8V A;  2ZTC A;  4F5R A;  1WWV A;  4QWD A;  2KSO A;  1HUZ A;  2HOF A;  4E7X A;  1L3S A;  4X0B A;  1S5L U;  1TVA A;  4Y2Y A;  4K96 A;  4O68 A;  2DRA A;  3SI8 A;  1BPE A;  3I76 A;  3LVW A;  2HHX A;  4NLZ A;  3NVY A;  4KLG A;  1RQL A;  4UAW A;  2XGQ A;  5TZV A;  3AQN A;  2F8K A;  1FEZ A;  4N7R A;  1DK3 A; 
#chains in the Genus database with same CATH homology
 1X9M A;  3EZ5 A;  2I1Q A;  2AGQ A;  1ZQH A;  5HR9 A;  4DF8 A;  4GC7 A;  3C18 A;  5DKW A;  4FS2 A;  3AU6 A;  2VAN A;  2ZH9 A;  4M0A A;  5HRE A;  4EP7 A;  4TUP A;  4X4Q A;  1JIH A;  2R8H A;  5J0T A;  3ORY A;  4YXM A;  4Q44 A;  4ELV A;  4WC2 A;  4IRD A;  2LYH A;  4XQ8 A;  4DL6 A;  3QE9 Y;  2FLP A;  2A1J A;  4LZD A;  5J29 A;  1MQ2 A;  4JWM A;  2NRV A;  4NKT A;  3RTV A;  1NJY A;  4F5Q A;  4FHY A;  3V6J A;  4F50 A;  1KLN A;  4PGQ A;  1KDH A;  3OV7 A;  1T8E A;  1RYS A;  5KG6 A;  5DEC A;  1ARO P;  3PR4 A;  5EWG A;  9ICL A;  3UXN A;  5L1L A;  1NKB A;  4UQG A;  2BPG A;  4UBC A;  2MAX A;  4F92 B;  1SKS A;  3OGU A;  4I2E A;  2P6R A;  5DDM A;  5DB9 A;  3RRH A;  4B9T A;  9ICV A;  9ICQ A;  9ICF A;  5DED A;  3HIY A;  1ZQX A;  3RJE A;  5KFW A;  4XQ7 A;  4BWM A;  3V72 A;  3H4B A;  3C5F A;  4ATB A;  5L1K A;  5HML A;  1N56 A;  3NTU A;  2ASL A;  2BPF A;  4IR1 A;  4Q8E A;  3L9D A;  2ZH4 A;  1S97 A;  1WOT A;  4YMN A;  1QTM A;  1TV9 A;  4X4R A;  3AU2 A;  1S0M A;  3HJ1 A;  3HW8 A;  4DOC A;  4ED7 A;  3WFR E;  1XO1 A;  1S76 D;  2XY7 A;  1SKW A;  7ICU A;  5J0O A;  3PW5 A;  5KT3 A;  4MEY A;  4KLO A;  1ZQU A;  4I2I A;  4Q8F A;  2ZH3 A;  3BQ2 A;  1ZQI A;  5J2C A;  5DB6 A;  3ZD8 A;  4C8L A;  4F4Z A;  1TK5 A;  2IHN A;  2PI4 A;  5CA7 A;  4K4H A;  1K1S A;  1QLN A;  9ICN A;  2HHU A;  8ICK A;  8ICB A;  2I9G A;  1MIV A;  1UA0 A;  2V9W A;  4C8M A;  8ICS A;  5HRF A;  8ICZ A;  1BNO A;  5C5J A;  4WC4 A;  4UBB A;  5J0Q A;  4JUZ A;  4IQT A;  4EBK A;  3RJI A;  1WCN A;  3ZDC A;  7ICV A;  2ZH6 A;  2F1H A;  2VA3 A;  4M2Y A;  2RDJ A;  3C2K A;  3H39 A;  3PO4 A;  3RR8 A;  2HHT A;  2O1P A;  1Z3E B;  2HHP A;  1QSL A;  2M2U A;  2JEG A;  4F2R A;  3E2E A;  3BQ1 A;  2NRZ A;  4Z6F A;  1XU4 A;  2PFO A;  5KFO A;  3RJF A;  1A76 A;  4DL4 A;  3OUY B;  4KTQ A;  4ED3 A;  4KLH A;  1VJ7 A;  4BWJ A;  4K4G A;  4DQS A;  1VFG A;  4RWQ A;  3NYB A;  1DGS A;  5F9N A;  1S0V A;  1LB2 B;  2XC9 A;  2HVH A;  1EXN A;  1BVS A;  4PHA A;  4Q45 A;  4J9M A;  2V4R A;  5L1I A;  3Q8R B;  1U49 A;  4YVZ A;  3M8S A;  4DO9 A;  4YMM A;  3OHB A;  1B43 A;  5IIK A;  4IQU A;  5DBB A;  3HP6 A;  1TAQ A;  1UT5 A;  9ICW A;  2A1J B;  3MDC A;  3N97 B;  2KZZ A;  2DVI A;  2M9N A;  4QWB A;  2Q66 A;  4MFA A;  1L3U A;  4DL2 A;  3UQ2 A;  8ICW A;  1JXL A;  8ICT A;  4RPY A;  1NJX A;  4HYK A;  1TFW A;  4KN7 A;  4F4X A;  4QWC A;  4QWE A;  4M9N A;  9ICT A;  4B9U A;  1V9P A;  5KG7 A;  4R63 A;  3V7J A;  5IIO A;  3MR2 A;  2FLN A;  4DF4 A;  4YFK A;  2PFN A;  4JV2 A;  5J0S A;  5HHI A;  4RPZ A;  3AQK A;  2DR8 A;  3JPO A;  3N4M B;  5KFH A;  3MGH A;  2DR7 A;  2PFP A;  3TI0 A;  1NKE A;  2W9M A;  3T3F A;  3UXO A;  2J6U A;  1D9F A;  1JQR A;  7ICR A;  2UVU A;  4ATB B;  1KEJ A;  2ZUB A;  5KG1 A;  3GV5 B;  5KFJ A;  1MQ3 A;  3BDP A;  3WFP A;  4PPX A;  7ICF A;  5HC9 A;  1CEZ A;  1U47 A;  3C1Y A;  5F2V O;  3KHR A;  4YR0 A;  4QW8 A;  4WC6 A;  2MUT A;  8ICF A;  3V6H A;  1RXW A;  4B9V A;  4J9N A;  4P4P A;  5DG8 A;  4F2S A;  1UEU A;  4X4V A;  4WBZ A;  5KFK A;  1D8L A;  5KFY A;  4FBU A;  4RWP A;  1ZQK A;  5KFI A;  4RT3 A;  5KFD A;  4X4S A;  3OVS A;  3K75 D;  5KFT A;  4F4Y A;  4ECR A;  2AQ0 A;  2C2D A;  1BGX T;  3PML A;  4KLT A;  3RJJ A;  1COO A;  1YLQ A;  2VA8 A;  4IG8 A;  1D9D A;  4I2F A;  3H8J A;  1S77 D;  4X0A A;  2ZH2 A;  4DQQ A;  2XGP A;  4PHP A;  4ELU A;  2C2E A;  4LVS A;  8ICG A;  4TUS A;  4B9L A;  4C8K A;  1NO5 A;  4ECV A;  5D49 A;  2ZH8 A;  2IA6 A;  4DS4 A;  4M9G A;  4DEZ A;  3SZ2 A;  2FMQ A;  1B22 A;  3OSN A;  5DQI A;  3SYZ A;  4DQP A;  4DLE A;  5DGB A;  5HRI A;  3MBY A;  3FDS A;  1Q78 A;  4ED0 A;  4I2J A;  4RNN A;  3G6X A;  4ECU A;  4DSI A;  2R8I A;  4X5V A;  3ISB A;  1HJP A;  2OWO A;  3C21 A;  3HWT A;  4ECT A;  2RFF A;  3C5G A;  1HUO A;  4G3I A;  4ECQ A;  1ZQJ A;  8ICX A;  4Z6E A;  3TAR A;  9ICM A;  4WBY A;  4DFM A;  4TQR A;  4X4T A;  1ZQW A;  3RAQ A;  1X9W A;  2DRB A;  4QZA A;  3TAN A;  3RJH A;  1R89 A;  4PHD A;  1NZP A;  3C2L A;  2JZB B;  3OSP A;  4KMU A;  4M04 A;  3MFH A;  2KZM A;  9ICG A;  4X4U A;  3RR7 A;  4P4O A;  3H8S A;  4ECW A;  1RYR A;  4FHP A;  4GLX A;  4RQ2 A;  2BCQ A;  5DG7 A;  3THV A;  4FS1 A;  2DR5 A;  1ZQC A;  8ICP A;  3OVB A;  5DDY A;  3PW7 A;  2ISO A;  2XY5 A;  4KLQ A;  4YR2 A;  8ICO A;  3ZDE A;  1Z00 A;  4I2D A;  2FMS A;  4O3P A;  5J2I A;  8ICE A;  4YCX A;  4X4N A;  4O3Q A;  8ICN A;  4YD1 A;  2KZ3 A;  3RH6 A;  5J2B A;  2ALZ A;  3UPS A;  1RZT A;  8ICY A;  5J0U A;  3RB6 A;  4K4I A;  2VA2 A;  1NJW A;  1NOM A;  5DQG A;  2ATL A;  2NRK A;  3C2M A;  4RZR A;  1T7P A;  4KLJ A;  4MFC A;  5HP4 A;  4RWN A;  2UVR A;  2FLL A;  2ZJA A;  3PR5 B;  5KFB A;  3PX4 A;  3BQ0 A;  3PO5 A;  2W9A A;  4FH5 A;  7ICJ A;  3LWM A;  1TFY A;  2HHQ A;  5HRG A;  3RJG A;  2DFL A;  5J2E A;  3UXP A;  1QSS A;  1JXE A;  3RJK A;  2C22 A;  5J0P A;  1ZQT A;  9ICC A;  3LK9 A;  5KTQ A;  2ZHA A;  4QZI A;  5J2A A;  1ZQS A;  2PXI A;  4MFF A;  1R8B A;  2B21 A;  4I2G A;  4RNO A;  1XWL A;  5CHG A;  4PH5 A;  4YD2 A;  4IQW A;  4BXO A;  3ZDB A;  7ICM A;  2V4Q A;  4PGY A;  3UPQ A;  4EZ9 A;  1WCL A;  1NKC A;  2R8G A;  2ZH1 A;  8ICA A;  4O0I A;  2DPJ A;  4M6W B;  5KFM A;  3LQC B;  3ZDD A;  1ZQN A;  9ICU A;  5KFN A;  2XCP A;  8ICV A;  3RH4 A;  5IIL A;  3PV8 A;  1FA0 A;  4S3N A;  1S9F A;  4QW9 A;  3PNC A;  2RDI A;  4XRH A;  2W9C B;  5KFE A;  4EBD A;  1BPX A;  4BDP A;  9ICI A;  1ZQD A;  1ZQQ A;  4UB2 A;  4QZG A;  5J2K A;  1L3V A;  4FHX A;  1BPB A;  5KG3 A;  5KFZ A;  7ICS A;  5IIJ A;  4O9M A;  9ICX A;  4RT2 A;  2UVW A;  4QZB A;  4UAY A;  1ZQB A;  3Q8M A;  2IBK A;  1K1Q A;  4M47 A;  5DLF A;  4O5K A;  4I27 A;  3SV4 A;  1XSL A;  4IRK A;  9ICH A;  2F1J A;  4JV0 A;  2BQ3 A;  2ZJ8 A;  1ZQZ A;  1ZQF A;  3ETL A;  4UB1 A;  4O3R A;  2ZUD A;  3LDA A;  4F93 B;  4RQ4 A;  2ZH5 A;  2HHS A;  3RB0 A;  3WFQ E;  3OVA A;  2KP7 A;  9ICJ A;  3RRG A;  2PBE A;  4ECZ A;  2C28 A;  4P2H A;  2FPL A;  3H7I A;  2ZHB A;  3EPG A;  5J0W A;  4O3N A;  1A77 A;  5KT2 A;  5BPC A;  3RBE A;  1XSP A;  1RPL A;  9ICE A;  1ZQP A;  4J9P A;  5BOM A;  2AU0 A;  3ZDA A;  5KG5 A;  9ICO A;  2KTQ A;  4TQS A;  1R8C A;  3PW4 A;  4P4M A;  1JAJ A;  4UAZ A;  4AT7 A;  4EBC A;  1NK5 A;  1TKD A;  4PGX A;  3AQM A;  4WC3 A;  3EW9 A;  4RQ5 A;  3LWL A;  3BJY A;  4ED6 A;  3V6K A;  4MF2 A;  3H8W A;  3MGI A;  5KFV A;  4RQ1 A;  3HPO A;  3KHG A;  8ICM A;  3H3A A;  2JZB A;  7ICI A;  3Q8L A;  3PVX A;  2P6U A;  4GC6 A;  4DLG A;  1S0O A;  4I2B A;  3GV8 B;  5EWF A;  1KFT A;  4Q43 A;  3RBD A;  1U9L A;  4RQ3 A;  1N48 A;  7ICP A;  4PHE A;  5KFR A;  4JK1 A;  3MR6 A;  2XO7 A;  2MUT B;  4MEX A;  4NLK A;  5JUM A;  1SKR A;  2HHW A;  2W9B A;  4F4W A;  1PX5 A;  3Q8P B;  4DFP A;  3KTQ A;  4YP3 A;  2Y1I A;  1UA1 A;  5IIM A;  8ICL A;  4UD5 A;  4DSF A;  4WC7 A;  1JN3 A;  1X2I A;  5J0X A;  4QZF A;  1U4B A;  4RU9 A;  4C8O A;  2Q0Z X;  4DQI A;  3QZ8 A;  4XUS A;  3PX6 A;  4I2A A;  4R8U B;  3RB3 A;  4FH3 A;  1H38 A;  1KTQ A;  3GIL A;  1LV5 A;  3B0Y A;  4YXJ A;  3T5L A;  2FPK A;  3OJU A;  2XY6 A;  4DSE A;  1L3T A;  4B9N A;  3QEA Z;  1TFR A;  4B9M A;  4JWN A;  4EYH B;  4LT6 A;  2ZJ5 A;  4J9O A;  8ICH A;  5KT6 A;  1ZQE A;  4RNM A;  3RH5 A;  2O5A A;  5BOL A;  2BPC A;  4F5O A;  4ED8 A;  3B0X A;  3ISC A;  1ZET A;  4GXJ A;  4YQW A;  4DSJ A;  4EYI B;  4F91 B;  4QZH A;  5D4B A;  5DLG A;  1U45 A;  1QSY A;  2UVV A;  8ICU A;  1T3N A;  3ZD9 A;  4AT8 A;  9ICS A;  4EZ6 A;  1NK4 A;  3TQ1 A;  1SZP A;  4J9S A;  4J9L A;  3GIK A;  1ZYQ A;  3H37 A;  4I2H A;  2FPM A;  5HRK A;  1Q79 A;  1JX4 A;  5CP2 A;  1T4G A;  1NJZ A;  4AT8 B;  5IIN A;  2BCU A;  9ICA A;  4FHV A;  3GV7 B;  4WC5 A;  4M6W A;  2BHN A;  3IM1 A;  3OUY A;  4DS5 A;  3PW2 A;  4TUQ A;  3Q8K A;  1TAU A;  4UB5 A;  3AQL A;  1NK7 A;  4X4O A;  1TK8 A;  4YMO A;  3T5H A;  2ID1 A;  4F5N A;  2W9C A;  4F4K A;  5J2F A;  3OJS A;  5HRH A;  4XA5 A;  2M2W A;  2BCR A;  1DOQ A;  5KT7 A;  5KFL A;  4NM1 A;  4QWA A;  9ICK A;  5HHH A;  2ASD A;  1MSW D;  4Z6D A;  3JZ0 A;  1SL2 A;  3H4D A;  8ICI A;  4IQV A;  5CWR A;  4RQ0 A;  5DBA A;  2ZTE A;  5CB1 A;  1S10 A;  3JPN A;  4R65 A;  3TAQ A;  4R64 A;  4M9L A;  9ICP A;  4DSK A;  2ZTD A;  4J9R A;  4EBE A;  4KLL A;  3JPS A;  4DL7 A;  4DWI A;  2M2V A;  7ICQ A;  1NK9 A;  3JYY A;  4NKU A;  5KFX A;  4FBT A;  1JMS A;  4DL3 A;  3JPR A;  3EPI A;  4KLD A;  4ECY A;  2BGW A;  5F9L A;  1ZQY A;  2ISP A;  4KIT B;  1ZQA A;  1D8Y A;  4QZE A;  3NGD A;  3MR3 A;  3RB4 A;  4DFK A;  2AGP A;  7ICT A;  1R8A A;  5KFC A;  3C66 A;  4NY8 A;  2ZH7 A;  4DFJ A;  3PY8 A;  4RQ7 A;  2F1I A;  3M9M B;  1ZQO A;  4QZD A;  1MIY A;  1BNP A;  3M8R A;  1SL0 A;  4BXO B;  9ICB A;  1BPZ A;  4AT9 B;  2FMP A;  1L5U A;  3GDX A;  4O5C A;  2HW3 A;  3H38 A;  2H5X A;  1NK8 A;  1Y88 A;  4DQR A;  4QZ9 A;  1NK6 A;  2BKE A;  4O3S A;  5J0R A;  1BPY A;  2AJQ A;  3C1Z A;  4NM2 A;  8ICR A;  5HRL A;  5DG9 A;  7ICH A;  5KFG A;  5KG2 A;  3T5J A;  2BR0 A;  2R8J A;  3QEB Z;  4R8U A;  3AUO A;  2W8K A;  5D46 A;  3HX0 A;  3SV3 A;  4RUC A;  4ECX A;  5DGA A;  3WFS C;  3HT3 A;  4YN4 A;  4KLM A;  3TFS A;  4I29 A;  4UB3 A;  3MAB A;  5DBC A;  5DQH A;  4DOB A;  4ECS A;  4M9H A;  4X4P A;  4RQ8 A;  5KFA A;  2NRT A;  3M9N B;  2W9B B;  2KFN A;  4FHW A;  4E80 A;  2C2R A;  2DR9 A;  3RAX A;  4CCH A;  5EOZ A;  2BDP A;  5HRD A;  2J6T A;  4QZC A;  5KFP A;  4RQ6 A;  3C23 A;  4Z6C A;  5KFQ A;  1ZJM A;  3H40 A;  5III A;  4DL5 A;  5DB7 A;  2Y1J A;  1BPD A;  3MFI A;  3OHA A;  3M9O B;  2PFQ A;  4UB4 A;  3GII A;  3T5K A;  1ZQG A;  1F5A A;  1U48 A;  2HVI A;  1C7Y A;  4LZG A;  4F5P A;  3Q8S B;  1IM4 A;  3JPP A;  1ZQR A;  4KN4 A;  4JV1 A;  3K4G A;  2KFZ A;  1DK2 A;  4M5D A;  4AT9 A;  2P66 A;  4F8R A;  8ICQ A;  1UEV A;  4B9S A;  4ZH4 A;  1KFD A;  4MF8 A;  3ISD A;  1IXR A;  5L1J A;  3TAP A;  1KRP A;  1X9S A;  3GIM A;  4KLF A;  3FYH A;  4NXZ A;  3QZ7 A;  3MR5 A;  3BQT A;  4KLE A;  5KG4 A;  4YR3 A;  2PI5 A;  3Q8Q B;  4E0D A;  2BE3 A;  5J2J A;  4NLN A;  4C8N A;  4RUA A;  7ICL A;  2M2T A;  2GWS A;  2JEI A;  2NRX A;  4YG2 A;  5HMM A;  5J0Y A;  2KN7 A;  3KHH A;  1KSP A;  1KFS A;  4R66 A;  2BCS A;  1OU5 A;  4J9K A;  4EBJ A;  3JPT A;  4IRC A;  4I28 A;  5CR0 A;  1KNY A;  3G6V A;  4O5E A;  5J2G A;  7ICO A;  4WC0 A;  3G6Y A;  3TFR A;  1ZQM A;  5CJ7 A;  5HNK A;  4WC1 A;  3MDA A;  4FO6 A;  4BGD A;  2IHM A;  3GQC A;  1V4A A;  2AGO A;  1RXV A;  1MC8 A;  5J2H A;  1PZN A;  4I2C A;  3PX0 A;  4KLS A;  3KHL A;  3UQ0 A;  2BQU A;  4RPX A;  2ASJ A;  3PMN A;  4EEY A;  2DPI A;  2JEJ A;  4J9Q A;  1ZQV A;  1XC9 A;  2R8K A;  7ICN A;  5KFU A;  4O3O A;  3V7L A;  2XCA A;  7ICG A;  4M9J A;  2BQR A;  2ZTC A;  4F5R A;  5KFS A;  5EWE A;  1XSN A;  3GFK B;  4GXI A;  2AQ4 A;  3HJ4 A;  5KFF A;  4UD4 A;  4QWD A;  4RWO A;  8ICC A;  1HUZ A;  4QZ8 A;  3V7K A;  1S0N A;  5DB8 A;  4ED2 A;  4E7X A;  4GXK A;  4ED1 A;  1NK0 A;  1SL1 A;  1L3S A;  2BCV A;  5J2D A;  9ICR A;  4E8F A;  4X0B A;  4DSL A;  1Z00 B;  1TVA A;  4WCW A;  5KT5 A;  4ELT A;  1XS9 D;  3EYZ A;  5HRB A;  2W8L A;  2NRW A;  2ZUC A;  2WTF A;  2DRA A;  3SI8 A;  2JEF A;  1BPE A;  1UT8 A;  1TK0 A;  1UET A;  2HHX A;  4KLU A;  1MIW A;  8ICJ A;  4AT7 B;  4NLZ A;  3IHQ B;  5L9X A;  1ZJN A;  4IR9 A;  4UAW A;  5KG0 A;  4KLG A;  3WFO A;  4KLI A;  2XGQ A;  3JPQ A;  4TUR A;  4F3O A;  7ICK A;  5TZV A;  3EWA A;  5KT4 A;  1ZQL A;  3AQN A;  3GIJ A;  4DOA A;  4NLG A;  7ICE A;  1CUK A;  2J6S A;  3PW0 A;  1DK3 A;  2IMW P;  2HHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...