1NO5A

Structure of hi0073 from haemophilus influenzae, the nucleotide binding domain of the hi0073/hi0074 two protein nucleotidyl transferase.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
QLDIKSEELAIVKTILQQLVPDYTVWAFGSRVKGKAKKYSDLDLAIISEEPLDFLARDRLKEAFSESDLPWRVDLLDWATTSEDFREIIRKVYVVIQEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein HI0073
publication title Structure of HI0073 from Haemophilus influenzae, the nucleotide-binding domain of a two-protein nucleotidyl transferase
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 27
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1no5A00
4UD4A 4LVSA 5DDYA 1ZQJA 3UPQA 4M9JA 1BPDA 5J2JA 4X5VA 4PGQA 5HREA 5HRKA 1R8BA 1R89A 5DKWA 1ZQQA 5HRIA 5CJ7A 4YMNA 5DB8A 1ZQPA 3RJKA 4ATBA 4TUSA 7ICLA 8ICXA 3C2LA 5DDMA 2ZH7A 2BCQA 3C5GA 3JZ0A 2GWSA 7ICQA 4RPYA 1KNYA 1XSPA 2PFOA 4WBZA 5CHGA 5D49A 4XUSA 9ICCA 1VJ7A 9ICIA 9ICOA 2IHMA 4RQ2A 4KLGA 4S3NA 3C5FA 4NLNA 5J0UA 3WFQE 5DBAA 3HJ1A 3H37A 5HHIA 4QZBA 1UEUA 4FHYA 9ICQA 5HHHA 4P4MA 4MF2A 4X4SA 4UBCA 4I2JA 3LK9A 2DR5A 4R66A 8ICTA 4XRHA 5CB1A 2BCUA 2W9MA 1HUZA 4WCWA 4QZ9A 8ICAA 8ICEA 3TFSA 5EOZA 1R8AA 2FMQA 1VFGA 4X0BA 4M5DA 4M2YA 5F2VO 4I2EA 3OVBA 5J2KA 4WBYA 8ICZA 8ICGA 2FMPA 2ISOA 5BOLA 4EBJA 4WC5A 3OUYA 3UQ2A 4FHVA 3C18A 8ICBA 7ICEA 2BCSA 4YCXA 4QZ8A 4QZCA 3OVSA 5J0XA 2ZH1A 1ZQMA 4O5CA 4JWNA 2ZH8A 4Z6FA 5IINA 4QZHA 4UB2A 3V7KA 5J2FA 5J0QA 4NM1A 1MQ2A 4PH5A 1JQRA 9ICTA 2BCVA 1ZQFA 4KLLA 2VANA 4X4VA 2PXIA 4AT9B 2HHPA 4FHXA 4IQUA 4GXJA 5J0PA 4AT7A 4R64A 8ICHA 7ICOA 3H3AA 4FH3A 4P2HA 5J2DA 4RPZA 1TVAA 3WFRE 4KLQA 2ID1A 4RWOA 4X4QA 4RWQA 7ICSA 8ICMA 1NO5A 4NXZA 1RPLA 5J2AA 1ZJMA 4YMMA 5J2GA 3C66A 8ICOA 9ICUA 5IIOA 5J2EA 3WFSC 8ICPA 9ICBA 3AU6A 3PMLA 4M0AA 3AQMA 4RQ3A 1BPEA 2M2TA 4TUQA 3RJIA 4EBKA 3L9DA 3RJFA 4I2AA 1PX5A 4LZDA 2DRAA 1V4AA 1ZQXA 4RT3A 5J2IA 3MBYA 5IIMA 4FHPA 1ZQDA 3LQCB 2DR7A 4KLMA 5BPCA 4UAWA 9ICXA 1ZQAA 4O5KA 3JPSA 2M2VA 4KLHA 4KLDA 4UAZA 5D4BA 4QZFA 3HIYA 4UD5A 4WC7A 5HRGA 8ICCA 4PPXA 2BPGA 4RWNA 4RQ7A 4K4GA 5J0TA 4M9HA 4E80A 8ICJA 4R63A 4K4IA 8ICYA 2I9GA 4P4OA 4O9MA 1MIWA 3JPQA 5J0YA 4UB1A 4I2CA 8ICVA 1FA0A 5HC9A 1ZQRA 2ZH6A 4I2HA 3HWTA 4DO9A 7ICNA 5IIJA 1ZQZA 9ICLA 4Z6DA 2PFNA 1ZQYA 1KDHA 4AT8B 9ICSA 3OGUA 1Q78A 1ZQEA 5HR9A 8ICWA 5DB6A 3C2KA 9ICHA 1ZQLA 1R8CA 4DOAA 1ZQCA 5J2CA 3WFOA 2BE3A 4IQWA 2BPCA 4X4RA 5J0SA 4I2FA 3HJ4A 3UXPA 7ICJA 2RFFA 4GXIA 7ICPA 4X4NA 3AQNA 5TZVA 9ICKA 1UEVA 4YN4A 1ZQNA 3V7LA 1BPYA 4X0AA 3H39A 1RZTA 3RJEA 4I2IA 3UXNA 3H38A 7ICTA 7ICHA 5J0RA 4WC2A 3PMNA 4YD1A 4I2BA 1TFWA 5DEDA 1XSLA 1MQ3A 4X4TA 4M9NA 4PGXA 5HRHA 4IG8A 3B0YA 4MFCA 3JPNA 1KEJA 5CWRA 4PHEA 4UB3A 1NOMA 1ZQBA 3UPSA 1JN3A 3WFPA 8ICIA 5J0OA 4YMOA 4RQ5A 7ICMA 2DVIA 1ZQHA 5D46A 4I2DA 5HRFA 4KLFA 4F5NA 3AQLA 4F5RA 4AT9A 4PHAA 2O1PA 3JPRA 9ICEA 5HRLA 3AU2A 2DR8A 4RQ0A 3RH5A 2NRKA 3K75D 4F5QA 4TUPA 2ZH5A 4QZDA 9ICWA 3RJHA 4ATBB 4XA5A 4MFFA 8ICUA 4E7XA 4R65A 4RQ4A 2PFPA 3TFRA 2ZH9A 1XSNA 4M9GA 4LZGA 1HUOA 3RH4A 3AQKA 4RQ1A 3RJJA 5IIIA 3C2MA 4LT6A 3GDXA 1ZQGA 4X4PA 2DRBA 1BPBA 5DBBA 5DECA 1MIVA 9ICJA 4KLUA 4NLKA 4QZAA 4UBBA 4EP7A 4IQTA 1ZQWA 1F5AA 2PFQA 4PHDA 4KLSA 9ICMA 4UB4A 5DBCA 7ICUA 4MF8A 7ICGA 5CP2A 2BPFA 4F5PA 4NY8A 4TURA 5HRBA 7ICFA 2DR9A 2O5AA 4KLTA 7ICRA 1MIYA 1ZQOA 8ICSA 4QZIA 3OUYB 4XQ7A 4M9LA 3HW8A 1JMSA 4RQ8A 7ICVA 1BPXA 5DB9A 3RJGA 7ICKA 4WC4A 3B0XA 4RWPA 1ZQUA 4X4UA 1ZJNA 5HRDA 2P66A 4RPXA 1TV9A 3JYYA 2ZH4A 4NLZA 1ZQSA 4M47A 7ICIA 9ICFA 4AT8A 5J2BA 5DB7A 3V72A 4NKTA 4WC0A 3JPOA 5J0WA 4KLIA 3JPTA 2BCRA 4AT7B 4QZGA 3ISCA 8ICKA 4MFAA 5CR0A 4Z6EA 9ICGA 4E8FA 8ICRA 5J2HA 4RQ6A 1TFYA 4WC1A 5IILA 2ZHAA 3MDAA 1BPZA 9ICAA 8ICQA 4DOCA 4K4HA 3OV7A 2ZH2A 4GXKA 4NM2A 3NYBA 9ICRA 4I29A 4KLEA 4O5EA 4QZEA 5J29A 1ZQTA 9ICNA 2ZH3A 4NKUA 3JPPA 5IIKA 1ZQKA 2Q66A 1OU5A 4WC6A 4PHPA 9ICPA 4RT2A 8ICNA 2FMSA 1UETA 1Q79A 1WOTA 1JAJA 3V7JA 3PNCA 3MGIA 4UB5A 5CA7A 4WC3A 2ISPA 4PGYA 2M2WA 4XQ8A 4I27A 4I2GA 4P4PA 4KLJA 4DOBA 4I28A 9ICVA 3HX0A 4X4OA 4F5OA 4FO6A 4KLOA 5BOMA 3ISBA 4JWMA 8ICLA 4Z6CA 1ZQVA 2PBEA 2M2UA 3MGHA 3UQ0A 3MDCA 2ZHBA 3UXOA 3OVAA 4M04A 4FH5A 3ISDA 3RH6A 4FHWA 4IQVA 4UAYA 8ICFA 4YD2A 1ZQIA 3AUOA 1YLQA
chains in the Genus database with same CATH superfamily
4UD4A 4LVSA 5DDYA 1ZQJA 3UPQA 4M9JA 1BPDA 2GAFD 5J2JA 4X5VA 4PGQA 5HREA 5HRKA 1R8BA 1R89A 5DKWA 4O67A 5HRIA 5CJ7A 4YMNA 1ZQQA 5DB8A 1ZQPA 3RJKA 4ATBA 4TUSA 7ICLA 8ICXA 3C2LA 5CFUA 4JLZA 5DDMA 2ZH7A 2BCQA 4MKPA 4EEDA 3C5GA 3JZ0A 2GWSA 7ICQA 4RPYA 1KNYA 1XSPA 2PFOA 4WBZA 5CHGA 4O68A 5D49A 4XUSA 9ICCA 1VJ7A 2GA9D 9ICIA 9ICOA 2IHMA 4RQ2A 4KLGA 4S3NA 3C5FA 4NLNA 5J0UA 3WFQE 3ER8C 5DBAA 3HJ1A 3H37A 5HHIA 4QZBA 1UEUA 4FHYA 9ICQA 2BBJA 5HHHA 4P4MA 4MF2A 4X4SA 4UBCA 4I2JA 3LK9A 2DR5A 4O69A 3EF2A 4R66A 2B56A 8ICTA 5D62A 4XRHA 5CB1A 2BCUA 2W9MA 1HUZA 4WCWA 4QZ9A 4WOYA 8ICAA 8ICEA 3TFSA 5EOZA 1R8AA 2FMQA 1VFGA 3K7DA 4X0BA 4M5DA 4K9BA 4M2YA 5F2VO 4I2EA 3OVBA 5CFSA 5J2KA 4WBYA 8ICZA 8ICGA 2FMPA 2ISOA 5BOLA 4EBJA 4WC5A 3OUYA 3UQ2A 4FHVA 3C18A 8ICBA 7ICEA 2BCSA 4NXWA 4YCXA 4QZ8A 4QZCA 3OVSA 5J0XA 2ZH1A 1ZQMA 4OAFA 4O5CA 5D61A 3NVOA 4NXXA 4JWNA 2ZH8A 4Z6FA 5IINA 4QZHA 4UB2A 3V7KA 4KM5A 5J2FA 5J0QA 4NM1A 2HN1A 1MQ2A 4PH5A 1JQRA 9ICTA 2BCVA 1ZQFA 4KLLA 2VANA 4X4VA 2PXIA 4AT9B 2HHPA 4FHXA 4OAGA 4IQUA 4GXJA 5J0PA 4AT7A 4R64A 8ICHA 7ICOA 3H3AA 4FH3A 4P2HA 5J2DA 4I0UA 4RPZA 1TVAA 3WFRE 4KLQA 2ID1A 4RWOA 4X4QA 4RWQA 5B3QA 7ICSA 8ICMA 1NO5A 4NXZA 1RPLA 5J2AA 1ZJMA 5B3PA 4YMMA 5J2GA 3C66A 8ICOA 9ICUA 5IIOA 5J2EA 3WFSC 8ICPA 4HX0A 9ICBA 4EV6A 3AU6A 3PMLA 4M0AA 3AQMA 4RQ3A 1BPEA 2M2TA 4TUQA 3RJIA 4EBKA 3L9DA 4NXVA 3RJFA 4I2AA 1PX5A 4LZDA 2DRAA 1V4AA 1ZQXA 4RT3A 5J2IA 3MBYA 5IIMA 4FHPA 1ZQDA 3LQCB 2DR7A 4KLMA 5BPCA 4UAWA 9ICXA 4NXTA 1ZQAA 4O5KA 3JPSA 2M2VA 4KLHA 4KLDA 4UAZA 5D4BA 4EGWA 4QZFA 3HIYA 4UD5A 4WC7A 5HRGA 3ERCC 8ICCA 4PPXA 2BPGA 4RWNA 4RQ7A 4K4GA 5J0TA 4M9HA 4E80A 8ICJA 4R63A 4K4IA 8ICYA 2I9GA 4P4OA 4O9MA 1MIWA 3JPQA 5J0YA 4UB1A 4I2CA 8ICVA 1FA0A 5HC9A 1ZQRA 2ZH6A 4I2HA 3HWTA 4DO9A 7ICNA 5IIJA 1ZQZA 9ICLA 4Z6DA 2PFNA 1ZQYA 1KDHA 4AT8B 9ICSA 3OGUA 1Q78A 1ZQEA 5HR9A 4EEBA 8ICWA 5DB6A 3C2KA 9ICHA 4WQLA 1ZQLA 1R8CA 4DOAA 1ZQCA 5J2CA 3WFOA 4XJEA 2BE3A 5JTGA 3MCRA 4IQWA 2BPCA 4X4RA 5J0SA 4I2FA 3HJ4A 3UXPA 7ICJA 2RFFA 4GXIA 4K96A 7ICPA 4X4NA 3AQNA 5TZVA 9ICKA 1UEVA 4YN4A 2B51A 1ZQNA 3V7LA 1BPYA 4X0AA 2EWRA 2IUBA 3H39A 1RZTA 3RJEA 4I2IA 3UXNA 3H38A 7ICTA 7ICHA 5J0RA 4WC2A 3PHZA 3PMNA 5CHEA 4YD1A 4I2BA 1TFWA 5DEDA 1XSLA 1MQ3A 4X4TA 4M9NA 4PGXA 5HRHA 4IG8A 3B0YA 4MFCA 3JPNA 1KEJA 4LEZA 5CWRA 4PHEA 4UB3A 1NOMA 1ZQBA 3UPSA 1JN3A 3WFPA 8ICIA 5J0OA 4YMOA 2HN2A 4RQ5A 7ICMA 2DVIA 1ZQHA 4OAHA 5D46A 4I2DA 5HRFA 4KLFA 4F5NA 3AQLA 4F5RA 4AT9A 4PHAA 3NKUA 2O1PA 2FCLA 3JPRA 9ICEA 5HRLA 3AU2A 2DR8A 4RQ0A 3RH5A 2NRKA 3K75D 4F5QA 3JCFA 4TUPA 2ZH5A 4K97A 4K9AA 4QZDA 9ICWA 3RJHA 4ATBB 4XA5A 4MFFA 8ICUA 4E7XA 4R65A 4RQ4A 2PFPA 3TFRA 2ZH9A 1XSNA 4M9GA 4LZGA 4LEYA 1HUOA 4O6AA 3RH4A 3AQKA 4RQ1A 3RJJA 5IIIA 4K8VA 3C2MA 4LT6A 3GDXA 1ZQGA 4X4PA 2DRBA 1BPBA 5DBBA 5DECA 2BBHA 2IHOA 1MIVA 1GPJA 9ICJA 4KLUA 4NLKA 4QZAA 4UBBA 4EP7A 4IQTA 2B4VA 1ZQWA 1F5AA 2PFQA 4PHDA 4WH5A 4KLSA 9ICMA 4UB4A 5DBCA 7ICUA 4MF8A 7ICGA 5CP2A 2BPFA 4F5PA 4NY8A 4TURA 3ER9B 5HRBA 7ICFA 2DR9A 2O5AA 4KLTA 7ICRA 1MIYA 1ZQOA 8ICSA 4QZIA 3OUYB 4XQ7A 4M9LA 4WQKA 3HW8A 1JMSA 4RQ8A 7ICVA 1BPXA 5DB9A 3RJGA 7ICKA 4WC4A 3B0XA 4LEWA 4K99A 4RWPA 1ZQUA 4X4UA 4KB6A 1ZJNA 5HRDA 2P66A 4RPXA 4LEVA 1TV9A 3JYYA 2ZH4A 4NLZA 1ZQSA 4M47A 7ICIA 9ICFA 4AT8A 5J2BA 5DB7A 3V72A 4NKTA 4WC0A 3JPOA 3OWGA 5J0WA 5D63A 4KLIA 3JPTA 2BCRA 4AT7B 4QZGA 3ISCA 8ICKA 4MFAA 5CR0A 4K98A 4NXUA 4Z6EA 9ICGA 4E8FA 8ICRA 5J2HA 4RQ6A 1TFYA 4WC1A 5IILA 2ZHAA 3MDAA 1BPZA 9ICAA 8ICQA 4DOCA 4K4HA 3OV7A 2ZH2A 4GXKA 4NM2A 3NYBA 9ICRA 4I29A 4KLEA 4O5EA 4QZEA 5J29A 1ZQTA 9ICNA 4FO1A 2ZH3A 3NWIA 4NKUA 3JPPA 5IIKA 1ZQKA 2Q66A 1OU5A 4WC6A 4PHPA 9ICPA 4RT2A 8ICNA 2FMSA 1UETA 1Q79A 1WOTA 1JAJA 3V7JA 4JLXA 3PNCA 3MGIA 4UB5A 4N7RA 5CA7A 4WC3A 2ISPA 4PGYA 2M2WA 4XQ8A 4I27A 4I2GA 4P4PA 4KLJA 4DOBA 4I28A 9ICVA 3HX0A 4X4OA 4F5OA 4FO6A 4KLOA 5BOMA 3ISBA 4JWMA 8ICLA 4Z6CA 1ZQVA 2PBEA 2M2UA 3MGHA 3UQ0A 3CK6A 3MDCA 2ZHBA 5CFTA 3UXOA 4OAIZ 3OVAA 4M04A 4FH5A 3ISDA 3RH6A 4FHWA 4IQVA 4UAYA 8ICFA 4YD2A 1ZQIA 3AUOA 1YLQA
chains in the Genus database with same CATH topology
4UD4A 4LVSA 5DDYA 1ZQJA 3UPQA 4M9JA 1BPDA 5J2JA 4X5VA 4PGQA 5HREA 5HRKA 1R8BA 1R89A 5DKWA 1ZQQA 5HRIA 5CJ7A 4YMNA 5DB8A 1ZQPA 3RJKA 4ATBA 4TUSA 7ICLA 8ICXA 3C2LA 5DDMA 2ZH7A 2BCQA 3C5GA 3JZ0A 2GWSA 7ICQA 4RPYA 1KNYA 1XSPA 2PFOA 4WBZA 5CHGA 5D49A 4XUSA 9ICCA 1VJ7A 9ICIA 9ICOA 2IHMA 4RQ2A 4KLGA 4S3NA 3C5FA 4NLNA 5J0UA 3WFQE 5DBAA 3HJ1A 3H37A 5HHIA 4QZBA 1UEUA 4FHYA 9ICQA 5HHHA 4P4MA 4MF2A 4X4SA 4UBCA 4I2JA 3LK9A 2DR5A 4R66A 8ICTA 4XRHA 5CB1A 2BCUA 2W9MA 1HUZA 4WCWA 4QZ9A 8ICAA 8ICEA 3TFSA 5EOZA 1R8AA 2FMQA 1VFGA 4X0BA 4M5DA 4M2YA 5F2VO 4I2EA 3OVBA 5J2KA 4WBYA 8ICZA 8ICGA 2FMPA 2ISOA 5BOLA 4EBJA 4WC5A 3OUYA 3UQ2A 4FHVA 3C18A 8ICBA 7ICEA 2BCSA 4YCXA 4QZ8A 4QZCA 3OVSA 5J0XA 2ZH1A 1ZQMA 4O5CA 4JWNA 2ZH8A 4Z6FA 5IINA 4QZHA 4UB2A 3V7KA 5J2FA 5J0QA 4NM1A 1MQ2A 4PH5A 1JQRA 9ICTA 2BCVA 1ZQFA 4KLLA 2VANA 4X4VA 2PXIA 4AT9B 2HHPA 4FHXA 4IQUA 4GXJA 5J0PA 4AT7A 4R64A 8ICHA 7ICOA 3H3AA 4FH3A 4P2HA 5J2DA 4RPZA 1TVAA 3WFRE 4KLQA 2ID1A 4RWOA 4X4QA 4RWQA 7ICSA 8ICMA 1NO5A 4NXZA 1RPLA 5J2AA 1ZJMA 4YMMA 5J2GA 3C66A 8ICOA 9ICUA 5IIOA 5J2EA 3WFSC 8ICPA 9ICBA 3AU6A 3PMLA 4M0AA 3AQMA 4RQ3A 1BPEA 2M2TA 4TUQA 3RJIA 4EBKA 3L9DA 3RJFA 4I2AA 1PX5A 4LZDA 2DRAA 1V4AA 1ZQXA 4RT3A 5J2IA 3MBYA 5IIMA 4FHPA 1ZQDA 3LQCB 2DR7A 4KLMA 5BPCA 4UAWA 9ICXA 1ZQAA 4O5KA 3JPSA 2M2VA 4KLHA 4KLDA 4UAZA 5D4BA 4QZFA 3HIYA 4UD5A 4WC7A 5HRGA 8ICCA 4PPXA 2BPGA 4RWNA 4RQ7A 4K4GA 5J0TA 4M9HA 4E80A 8ICJA 4R63A 4K4IA 8ICYA 2I9GA 4P4OA 4O9MA 1MIWA 3JPQA 5J0YA 4UB1A 4I2CA 8ICVA 1FA0A 5HC9A 1ZQRA 2ZH6A 4I2HA 3HWTA 4DO9A 7ICNA 5IIJA 1ZQZA 9ICLA 4Z6DA 2PFNA 1ZQYA 1KDHA 4AT8B 9ICSA 3OGUA 1Q78A 1ZQEA 5HR9A 8ICWA 5DB6A 3C2KA 9ICHA 1ZQLA 1R8CA 4DOAA 1ZQCA 5J2CA 3WFOA 2BE3A 4IQWA 2BPCA 4X4RA 5J0SA 4I2FA 3HJ4A 3UXPA 7ICJA 2RFFA 4GXIA 7ICPA 4X4NA 3AQNA 5TZVA 9ICKA 1UEVA 4YN4A 1ZQNA 3V7LA 1BPYA 4X0AA 3H39A 1RZTA 3RJEA 4I2IA 3UXNA 3H38A 7ICTA 7ICHA 5J0RA 4WC2A 3PMNA 4YD1A 4I2BA 1TFWA 5DEDA 1XSLA 1MQ3A 4X4TA 4M9NA 4PGXA 5HRHA 4IG8A 3B0YA 4MFCA 3JPNA 1KEJA 5CWRA 4PHEA 4UB3A 1NOMA 1ZQBA 3UPSA 1JN3A 3WFPA 8ICIA 5J0OA 4YMOA 4RQ5A 7ICMA 2DVIA 1ZQHA 5D46A 4I2DA 5HRFA 4KLFA 4F5NA 3AQLA 4F5RA 4AT9A 4PHAA 2O1PA 3JPRA 9ICEA 5HRLA 3AU2A 2DR8A 4RQ0A 3RH5A 2NRKA 3K75D 4F5QA 4TUPA 2ZH5A 4QZDA 9ICWA 3RJHA 4ATBB 4XA5A 4MFFA 8ICUA 4E7XA 4R65A 4RQ4A 2PFPA 3TFRA 2ZH9A 1XSNA 4M9GA 4LZGA 1HUOA 3RH4A 3AQKA 4RQ1A 3RJJA 5IIIA 3C2MA 4LT6A 3GDXA 1ZQGA 4X4PA 2DRBA 1BPBA 5DBBA 5DECA 1MIVA 9ICJA 4KLUA 4NLKA 4QZAA 4UBBA 4EP7A 4IQTA 1ZQWA 1F5AA 2PFQA 4PHDA 4KLSA 9ICMA 4UB4A 5DBCA 7ICUA 4MF8A 7ICGA 5CP2A 2BPFA 4F5PA 4NY8A 4TURA 5HRBA 7ICFA 2DR9A 2O5AA 4KLTA 7ICRA 1MIYA 1ZQOA 8ICSA 4QZIA 3OUYB 4XQ7A 4M9LA 3HW8A 1JMSA 4RQ8A 7ICVA 1BPXA 5DB9A 3RJGA 7ICKA 4WC4A 3B0XA 4RWPA 1ZQUA 4X4UA 1ZJNA 5HRDA 2P66A 4RPXA 1TV9A 3JYYA 2ZH4A 4NLZA 1ZQSA 4M47A 7ICIA 9ICFA 4AT8A 5J2BA 5DB7A 3V72A 4NKTA 4WC0A 3JPOA 5J0WA 4KLIA 3JPTA 2BCRA 4AT7B 4QZGA 3ISCA 8ICKA 4MFAA 5CR0A 4Z6EA 9ICGA 4E8FA 8ICRA 5J2HA 4RQ6A 1TFYA 4WC1A 5IILA 2ZHAA 3MDAA 1BPZA 9ICAA 8ICQA 4DOCA 4K4HA 3OV7A 2ZH2A 4GXKA 4NM2A 3NYBA 9ICRA 4I29A 4KLEA 4O5EA 4QZEA 5J29A 1ZQTA 9ICNA 2ZH3A 4NKUA 3JPPA 5IIKA 1ZQKA 2Q66A 1OU5A 4WC6A 4PHPA 9ICPA 4RT2A 8ICNA 2FMSA 1UETA 1Q79A 1WOTA 1JAJA 3V7JA 3PNCA 3MGIA 4UB5A 5CA7A 4WC3A 2ISPA 4PGYA 2M2WA 4XQ8A 4I27A 4I2GA 4P4PA 4KLJA 4DOBA 4I28A 9ICVA 3HX0A 4X4OA 4F5OA 4FO6A 4KLOA 5BOMA 3ISBA 4JWMA 8ICLA 4Z6CA 1ZQVA 2PBEA 2M2UA 3MGHA 3UQ0A 3MDCA 2ZHBA 3UXOA 3OVAA 4M04A 4FH5A 3ISDA 3RH6A 4FHWA 4IQVA 4UAYA 8ICFA 4YD2A 1ZQIA 3AUOA 1YLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UD4 A;  4LVS A;  5DDY A;  1ZQJ A;  3UPQ A;  4M9J A;  1BPD A;  5J2J A;  4X5V A;  4PGQ A;  5HRE A;  5HRK A;  1R8B A;  1R89 A;  5DKW A;  1ZQQ A;  5HRI A;  5CJ7 A;  4YMN A;  5DB8 A;  1ZQP A;  3RJK A;  4ATB A;  4TUS A;  7ICL A;  8ICX A;  3C2L A;  5DDM A;  2ZH7 A;  2BCQ A;  3C5G A;  3JZ0 A;  2GWS A;  7ICQ A;  4RPY A;  1KNY A;  1XSP A;  2PFO A;  4WBZ A;  5CHG A;  5D49 A;  4XUS A;  9ICC A;  1VJ7 A;  9ICI A;  9ICO A;  2IHM A;  4RQ2 A;  4KLG A;  4S3N A;  3C5F A;  4NLN A;  5J0U A;  3WFQ E;  5DBA A;  3HJ1 A;  3H37 A;  5HHI A;  4QZB A;  1UEU A;  4FHY A;  9ICQ A;  5HHH A;  4P4M A;  4MF2 A;  4X4S A;  4UBC A;  4I2J A;  3LK9 A;  2DR5 A;  4R66 A;  8ICT A;  4XRH A;  5CB1 A;  2BCU A;  2W9M A;  1HUZ A;  4WCW A;  4QZ9 A;  8ICA A;  8ICE A;  3TFS A;  5EOZ A;  1R8A A;  2FMQ A;  1VFG A;  4X0B A;  4M5D A;  4M2Y A;  5F2V O;  4I2E A;  3OVB A;  5J2K A;  4WBY A;  8ICZ A;  8ICG A;  2FMP A;  2ISO A;  5BOL A;  4EBJ A;  4WC5 A;  3OUY A;  3UQ2 A;  4FHV A;  3C18 A;  8ICB A;  7ICE A;  2BCS A;  4YCX A;  4QZ8 A;  4QZC A;  3OVS A;  5J0X A;  2ZH1 A;  1ZQM A;  4O5C A;  4JWN A;  2ZH8 A;  4Z6F A;  5IIN A;  4QZH A;  4UB2 A;  3V7K A;  5J2F A;  5J0Q A;  4NM1 A;  1MQ2 A;  4PH5 A;  1JQR A;  9ICT A;  2BCV A;  1ZQF A;  4KLL A;  2VAN A;  4X4V A;  2PXI A;  4AT9 B;  2HHP A;  4FHX A;  4IQU A;  4GXJ A;  5J0P A;  4AT7 A;  4R64 A;  8ICH A;  7ICO A;  3H3A A;  4FH3 A;  4P2H A;  5J2D A;  4RPZ A;  1TVA A;  3WFR E;  4KLQ A;  2ID1 A;  4RWO A;  4X4Q A;  4RWQ A;  7ICS A;  8ICM A;  1NO5 A;  4NXZ A;  1RPL A;  5J2A A;  1ZJM A;  4YMM A;  5J2G A;  3C66 A;  8ICO A;  9ICU A;  5IIO A;  5J2E A;  3WFS C;  8ICP A;  9ICB A;  3AU6 A;  3PML A;  4M0A A;  3AQM A;  4RQ3 A;  1BPE A;  2M2T A;  4TUQ A;  3RJI A;  4EBK A;  3L9D A;  3RJF A;  4I2A A;  1PX5 A;  4LZD A;  2DRA A;  1V4A A;  1ZQX A;  4RT3 A;  5J2I A;  3MBY A;  5IIM A;  4FHP A;  1ZQD A;  3LQC B;  2DR7 A;  4KLM A;  5BPC A;  4UAW A;  9ICX A;  1ZQA A;  4O5K A;  3JPS A;  2M2V A;  4KLH A;  4KLD A;  4UAZ A;  5D4B A;  4QZF A;  3HIY A;  4UD5 A;  4WC7 A;  5HRG A;  8ICC A;  4PPX A;  2BPG A;  4RWN A;  4RQ7 A;  4K4G A;  5J0T A;  4M9H A;  4E80 A;  8ICJ A;  4R63 A;  4K4I A;  8ICY A;  2I9G A;  4P4O A;  4O9M A;  1MIW A;  3JPQ A;  5J0Y A;  4UB1 A;  4I2C A;  8ICV A;  1FA0 A;  5HC9 A;  1ZQR A;  2ZH6 A;  4I2H A;  3HWT A;  4DO9 A;  7ICN A;  5IIJ A;  1ZQZ A;  9ICL A;  4Z6D A;  2PFN A;  1ZQY A;  1KDH A;  4AT8 B;  9ICS A;  3OGU A;  1Q78 A;  1ZQE A;  5HR9 A;  8ICW A;  5DB6 A;  3C2K A;  9ICH A;  1ZQL A;  1R8C A;  4DOA A;  1ZQC A;  5J2C A;  3WFO A;  2BE3 A;  4IQW A;  2BPC A;  4X4R A;  5J0S A;  4I2F A;  3HJ4 A;  3UXP A;  7ICJ A;  2RFF A;  4GXI A;  7ICP A;  4X4N A;  3AQN A;  5TZV A;  9ICK A;  1UEV A;  4YN4 A;  1ZQN A;  3V7L A;  1BPY A;  4X0A A;  3H39 A;  1RZT A;  3RJE A;  4I2I A;  3UXN A;  3H38 A;  7ICT A;  7ICH A;  5J0R A;  4WC2 A;  3PMN A;  4YD1 A;  4I2B A;  1TFW A;  5DED A;  1XSL A;  1MQ3 A;  4X4T A;  4M9N A;  4PGX A;  5HRH A;  4IG8 A;  3B0Y A;  4MFC A;  3JPN A;  1KEJ A;  5CWR A;  4PHE A;  4UB3 A;  1NOM A;  1ZQB A;  3UPS A;  1JN3 A;  3WFP A;  8ICI A;  5J0O A;  4YMO A;  4RQ5 A;  7ICM A;  2DVI A;  1ZQH A;  5D46 A;  4I2D A;  5HRF A;  4KLF A;  4F5N A;  3AQL A;  4F5R A;  4AT9 A;  4PHA A;  2O1P A;  3JPR A;  9ICE A;  5HRL A;  3AU2 A;  2DR8 A;  4RQ0 A;  3RH5 A;  2NRK A;  3K75 D;  4F5Q A;  4TUP A;  2ZH5 A;  4QZD A;  9ICW A;  3RJH A;  4ATB B;  4XA5 A;  4MFF A;  8ICU A;  4E7X A;  4R65 A;  4RQ4 A;  2PFP A;  3TFR A;  2ZH9 A;  1XSN A;  4M9G A;  4LZG A;  1HUO A;  3RH4 A;  3AQK A;  4RQ1 A;  3RJJ A;  5III A;  3C2M A;  4LT6 A;  3GDX A;  1ZQG A;  4X4P A;  2DRB A;  1BPB A;  5DBB A;  5DEC A;  1MIV A;  9ICJ A;  4KLU A;  4NLK A;  4QZA A;  4UBB A;  4EP7 A;  4IQT A;  1ZQW A;  1F5A A;  2PFQ A;  4PHD A;  4KLS A;  9ICM A;  4UB4 A;  5DBC A;  7ICU A;  4MF8 A;  7ICG A;  5CP2 A;  2BPF A;  4F5P A;  4NY8 A;  4TUR A;  5HRB A;  7ICF A;  2DR9 A;  2O5A A;  4KLT A;  7ICR A;  1MIY A;  1ZQO A;  8ICS A;  4QZI A;  3OUY B;  4XQ7 A;  4M9L A;  3HW8 A;  1JMS A;  4RQ8 A;  7ICV A;  1BPX A;  5DB9 A;  3RJG A;  7ICK A;  4WC4 A;  3B0X A;  4RWP A;  1ZQU A;  4X4U A;  1ZJN A;  5HRD A;  2P66 A;  4RPX A;  1TV9 A;  3JYY A;  2ZH4 A;  4NLZ A;  1ZQS A;  4M47 A;  7ICI A;  9ICF A;  4AT8 A;  5J2B A;  5DB7 A;  3V72 A;  4NKT A;  4WC0 A;  3JPO A;  5J0W A;  4KLI A;  3JPT A;  2BCR A;  4AT7 B;  4QZG A;  3ISC A;  8ICK A;  4MFA A;  5CR0 A;  4Z6E A;  9ICG A;  4E8F A;  8ICR A;  5J2H A;  4RQ6 A;  1TFY A;  4WC1 A;  5IIL A;  2ZHA A;  3MDA A;  1BPZ A;  9ICA A;  8ICQ A;  4DOC A;  4K4H A;  3OV7 A;  2ZH2 A;  4GXK A;  4NM2 A;  3NYB A;  9ICR A;  4I29 A;  4KLE A;  4O5E A;  4QZE A;  5J29 A;  1ZQT A;  9ICN A;  2ZH3 A;  4NKU A;  3JPP A;  5IIK A;  1ZQK A;  2Q66 A;  1OU5 A;  4WC6 A;  4PHP A;  9ICP A;  4RT2 A;  8ICN A;  2FMS A;  1UET A;  1Q79 A;  1WOT A;  1JAJ A;  3V7J A;  3PNC A;  3MGI A;  4UB5 A;  5CA7 A;  4WC3 A;  2ISP A;  4PGY A;  2M2W A;  4XQ8 A;  4I27 A;  4I2G A;  4P4P A;  4KLJ A;  4DOB A;  4I28 A;  9ICV A;  3HX0 A;  4X4O A;  4F5O A;  4FO6 A;  4KLO A;  5BOM A;  3ISB A;  4JWM A;  8ICL A;  4Z6C A;  1ZQV A;  2PBE A;  2M2U A;  3MGH A;  3UQ0 A;  3MDC A;  2ZHB A;  3UXO A;  3OVA A;  4M04 A;  4FH5 A;  3ISD A;  3RH6 A;  4FHW A;  4IQV A;  4UAY A;  8ICF A;  4YD2 A;  1ZQI A;  3AUO A;  1YLQ A; 
#chains in the Genus database with same CATH topology
 4UD4 A;  4LVS A;  5DDY A;  1ZQJ A;  3UPQ A;  4M9J A;  1BPD A;  2GAF D;  5J2J A;  4X5V A;  4PGQ A;  5HRE A;  5HRK A;  1R8B A;  1R89 A;  5DKW A;  4O67 A;  5HRI A;  5CJ7 A;  4YMN A;  1ZQQ A;  5DB8 A;  1ZQP A;  3RJK A;  4ATB A;  4TUS A;  7ICL A;  8ICX A;  3C2L A;  5CFU A;  4JLZ A;  5DDM A;  2ZH7 A;  2BCQ A;  4MKP A;  4EED A;  3C5G A;  3JZ0 A;  2GWS A;  7ICQ A;  4RPY A;  1KNY A;  1XSP A;  2PFO A;  4WBZ A;  5CHG A;  4O68 A;  5D49 A;  4XUS A;  9ICC A;  1VJ7 A;  2GA9 D;  9ICI A;  9ICO A;  2IHM A;  4RQ2 A;  4KLG A;  4S3N A;  3C5F A;  4NLN A;  5J0U A;  3WFQ E;  3ER8 C;  5DBA A;  3HJ1 A;  3H37 A;  5HHI A;  4QZB A;  1UEU A;  4FHY A;  9ICQ A;  2BBJ A;  5HHH A;  4P4M A;  4MF2 A;  4X4S A;  4UBC A;  4I2J A;  3LK9 A;  2DR5 A;  4O69 A;  3EF2 A;  4R66 A;  2B56 A;  8ICT A;  5D62 A;  4XRH A;  5CB1 A;  2BCU A;  2W9M A;  1HUZ A;  4WCW A;  4QZ9 A;  4WOY A;  8ICA A;  8ICE A;  3TFS A;  5EOZ A;  1R8A A;  2FMQ A;  1VFG A;  3K7D A;  4X0B A;  4M5D A;  4K9B A;  4M2Y A;  5F2V O;  4I2E A;  3OVB A;  5CFS A;  5J2K A;  4WBY A;  8ICZ A;  8ICG A;  2FMP A;  2ISO A;  5BOL A;  4EBJ A;  4WC5 A;  3OUY A;  3UQ2 A;  4FHV A;  3C18 A;  8ICB A;  7ICE A;  2BCS A;  4NXW A;  4YCX A;  4QZ8 A;  4QZC A;  3OVS A;  5J0X A;  2ZH1 A;  1ZQM A;  4OAF A;  4O5C A;  5D61 A;  3NVO A;  4NXX A;  4JWN A;  2ZH8 A;  4Z6F A;  5IIN A;  4QZH A;  4UB2 A;  3V7K A;  4KM5 A;  5J2F A;  5J0Q A;  4NM1 A;  2HN1 A;  1MQ2 A;  4PH5 A;  1JQR A;  9ICT A;  2BCV A;  1ZQF A;  4KLL A;  2VAN A;  4X4V A;  2PXI A;  4AT9 B;  2HHP A;  4FHX A;  4OAG A;  4IQU A;  4GXJ A;  5J0P A;  4AT7 A;  4R64 A;  8ICH A;  7ICO A;  3H3A A;  4FH3 A;  4P2H A;  5J2D A;  4I0U A;  4RPZ A;  1TVA A;  3WFR E;  4KLQ A;  2ID1 A;  4RWO A;  4X4Q A;  4RWQ A;  5B3Q A;  7ICS A;  8ICM A;  1NO5 A;  4NXZ A;  1RPL A;  5J2A A;  1ZJM A;  5B3P A;  4YMM A;  5J2G A;  3C66 A;  8ICO A;  9ICU A;  5IIO A;  5J2E A;  3WFS C;  8ICP A;  4HX0 A;  9ICB A;  4EV6 A;  3AU6 A;  3PML A;  4M0A A;  3AQM A;  4RQ3 A;  1BPE A;  2M2T A;  4TUQ A;  3RJI A;  4EBK A;  3L9D A;  4NXV A;  3RJF A;  4I2A A;  1PX5 A;  4LZD A;  2DRA A;  1V4A A;  1ZQX A;  4RT3 A;  5J2I A;  3MBY A;  5IIM A;  4FHP A;  1ZQD A;  3LQC B;  2DR7 A;  4KLM A;  5BPC A;  4UAW A;  9ICX A;  4NXT A;  1ZQA A;  4O5K A;  3JPS A;  2M2V A;  4KLH A;  4KLD A;  4UAZ A;  5D4B A;  4EGW A;  4QZF A;  3HIY A;  4UD5 A;  4WC7 A;  5HRG A;  3ERC C;  8ICC A;  4PPX A;  2BPG A;  4RWN A;  4RQ7 A;  4K4G A;  5J0T A;  4M9H A;  4E80 A;  8ICJ A;  4R63 A;  4K4I A;  8ICY A;  2I9G A;  4P4O A;  4O9M A;  1MIW A;  3JPQ A;  5J0Y A;  4UB1 A;  4I2C A;  8ICV A;  1FA0 A;  5HC9 A;  1ZQR A;  2ZH6 A;  4I2H A;  3HWT A;  4DO9 A;  7ICN A;  5IIJ A;  1ZQZ A;  9ICL A;  4Z6D A;  2PFN A;  1ZQY A;  1KDH A;  4AT8 B;  9ICS A;  3OGU A;  1Q78 A;  1ZQE A;  5HR9 A;  4EEB A;  8ICW A;  5DB6 A;  3C2K A;  9ICH A;  4WQL A;  1ZQL A;  1R8C A;  4DOA A;  1ZQC A;  5J2C A;  3WFO A;  4XJE A;  2BE3 A;  5JTG A;  3MCR A;  4IQW A;  2BPC A;  4X4R A;  5J0S A;  4I2F A;  3HJ4 A;  3UXP A;  7ICJ A;  2RFF A;  4GXI A;  4K96 A;  7ICP A;  4X4N A;  3AQN A;  5TZV A;  9ICK A;  1UEV A;  4YN4 A;  2B51 A;  1ZQN A;  3V7L A;  1BPY A;  4X0A A;  2EWR A;  2IUB A;  3H39 A;  1RZT A;  3RJE A;  4I2I A;  3UXN A;  3H38 A;  7ICT A;  7ICH A;  5J0R A;  4WC2 A;  3PHZ A;  3PMN A;  5CHE A;  4YD1 A;  4I2B A;  1TFW A;  5DED A;  1XSL A;  1MQ3 A;  4X4T A;  4M9N A;  4PGX A;  5HRH A;  4IG8 A;  3B0Y A;  4MFC A;  3JPN A;  1KEJ A;  4LEZ A;  5CWR A;  4PHE A;  4UB3 A;  1NOM A;  1ZQB A;  3UPS A;  1JN3 A;  3WFP A;  8ICI A;  5J0O A;  4YMO A;  2HN2 A;  4RQ5 A;  7ICM A;  2DVI A;  1ZQH A;  4OAH A;  5D46 A;  4I2D A;  5HRF A;  4KLF A;  4F5N A;  3AQL A;  4F5R A;  4AT9 A;  4PHA A;  3NKU A;  2O1P A;  2FCL A;  3JPR A;  9ICE A;  5HRL A;  3AU2 A;  2DR8 A;  4RQ0 A;  3RH5 A;  2NRK A;  3K75 D;  4F5Q A;  3JCF A;  4TUP A;  2ZH5 A;  4K97 A;  4K9A A;  4QZD A;  9ICW A;  3RJH A;  4ATB B;  4XA5 A;  4MFF A;  8ICU A;  4E7X A;  4R65 A;  4RQ4 A;  2PFP A;  3TFR A;  2ZH9 A;  1XSN A;  4M9G A;  4LZG A;  4LEY A;  1HUO A;  4O6A A;  3RH4 A;  3AQK A;  4RQ1 A;  3RJJ A;  5III A;  4K8V A;  3C2M A;  4LT6 A;  3GDX A;  1ZQG A;  4X4P A;  2DRB A;  1BPB A;  5DBB A;  5DEC A;  2BBH A;  2IHO A;  1MIV A;  1GPJ A;  9ICJ A;  4KLU A;  4NLK A;  4QZA A;  4UBB A;  4EP7 A;  4IQT A;  2B4V A;  1ZQW A;  1F5A A;  2PFQ A;  4PHD A;  4WH5 A;  4KLS A;  9ICM A;  4UB4 A;  5DBC A;  7ICU A;  4MF8 A;  7ICG A;  5CP2 A;  2BPF A;  4F5P A;  4NY8 A;  4TUR A;  3ER9 B;  5HRB A;  7ICF A;  2DR9 A;  2O5A A;  4KLT A;  7ICR A;  1MIY A;  1ZQO A;  8ICS A;  4QZI A;  3OUY B;  4XQ7 A;  4M9L A;  4WQK A;  3HW8 A;  1JMS A;  4RQ8 A;  7ICV A;  1BPX A;  5DB9 A;  3RJG A;  7ICK A;  4WC4 A;  3B0X A;  4LEW A;  4K99 A;  4RWP A;  1ZQU A;  4X4U A;  4KB6 A;  1ZJN A;  5HRD A;  2P66 A;  4RPX A;  4LEV A;  1TV9 A;  3JYY A;  2ZH4 A;  4NLZ A;  1ZQS A;  4M47 A;  7ICI A;  9ICF A;  4AT8 A;  5J2B A;  5DB7 A;  3V72 A;  4NKT A;  4WC0 A;  3JPO A;  3OWG A;  5J0W A;  5D63 A;  4KLI A;  3JPT A;  2BCR A;  4AT7 B;  4QZG A;  3ISC A;  8ICK A;  4MFA A;  5CR0 A;  4K98 A;  4NXU A;  4Z6E A;  9ICG A;  4E8F A;  8ICR A;  5J2H A;  4RQ6 A;  1TFY A;  4WC1 A;  5IIL A;  2ZHA A;  3MDA A;  1BPZ A;  9ICA A;  8ICQ A;  4DOC A;  4K4H A;  3OV7 A;  2ZH2 A;  4GXK A;  4NM2 A;  3NYB A;  9ICR A;  4I29 A;  4KLE A;  4O5E A;  4QZE A;  5J29 A;  1ZQT A;  9ICN A;  4FO1 A;  2ZH3 A;  3NWI A;  4NKU A;  3JPP A;  5IIK A;  1ZQK A;  2Q66 A;  1OU5 A;  4WC6 A;  4PHP A;  9ICP A;  4RT2 A;  8ICN A;  2FMS A;  1UET A;  1Q79 A;  1WOT A;  1JAJ A;  3V7J A;  4JLX A;  3PNC A;  3MGI A;  4UB5 A;  4N7R A;  5CA7 A;  4WC3 A;  2ISP A;  4PGY A;  2M2W A;  4XQ8 A;  4I27 A;  4I2G A;  4P4P A;  4KLJ A;  4DOB A;  4I28 A;  9ICV A;  3HX0 A;  4X4O A;  4F5O A;  4FO6 A;  4KLO A;  5BOM A;  3ISB A;  4JWM A;  8ICL A;  4Z6C A;  1ZQV A;  2PBE A;  2M2U A;  3MGH A;  3UQ0 A;  3CK6 A;  3MDC A;  2ZHB A;  5CFT A;  3UXO A;  4OAI Z;  3OVA A;  4M04 A;  4FH5 A;  3ISD A;  3RH6 A;  4FHW A;  4IQV A;  4UAY A;  8ICF A;  4YD2 A;  1ZQI A;  3AUO A;  1YLQ A; 
#chains in the Genus database with same CATH homology
 4UD4 A;  4LVS A;  5DDY A;  1ZQJ A;  3UPQ A;  4M9J A;  1BPD A;  5J2J A;  4X5V A;  4PGQ A;  5HRE A;  5HRK A;  1R8B A;  1R89 A;  5DKW A;  1ZQQ A;  5HRI A;  5CJ7 A;  4YMN A;  5DB8 A;  1ZQP A;  3RJK A;  4ATB A;  4TUS A;  7ICL A;  8ICX A;  3C2L A;  5DDM A;  2ZH7 A;  2BCQ A;  3C5G A;  3JZ0 A;  2GWS A;  7ICQ A;  4RPY A;  1KNY A;  1XSP A;  2PFO A;  4WBZ A;  5CHG A;  5D49 A;  4XUS A;  9ICC A;  1VJ7 A;  9ICI A;  9ICO A;  2IHM A;  4RQ2 A;  4KLG A;  4S3N A;  3C5F A;  4NLN A;  5J0U A;  3WFQ E;  5DBA A;  3HJ1 A;  3H37 A;  5HHI A;  4QZB A;  1UEU A;  4FHY A;  9ICQ A;  5HHH A;  4P4M A;  4MF2 A;  4X4S A;  4UBC A;  4I2J A;  3LK9 A;  2DR5 A;  4R66 A;  8ICT A;  4XRH A;  5CB1 A;  2BCU A;  2W9M A;  1HUZ A;  4WCW A;  4QZ9 A;  8ICA A;  8ICE A;  3TFS A;  5EOZ A;  1R8A A;  2FMQ A;  1VFG A;  4X0B A;  4M5D A;  4M2Y A;  5F2V O;  4I2E A;  3OVB A;  5J2K A;  4WBY A;  8ICZ A;  8ICG A;  2FMP A;  2ISO A;  5BOL A;  4EBJ A;  4WC5 A;  3OUY A;  3UQ2 A;  4FHV A;  3C18 A;  8ICB A;  7ICE A;  2BCS A;  4YCX A;  4QZ8 A;  4QZC A;  3OVS A;  5J0X A;  2ZH1 A;  1ZQM A;  4O5C A;  4JWN A;  2ZH8 A;  4Z6F A;  5IIN A;  4QZH A;  4UB2 A;  3V7K A;  5J2F A;  5J0Q A;  4NM1 A;  1MQ2 A;  4PH5 A;  1JQR A;  9ICT A;  2BCV A;  1ZQF A;  4KLL A;  2VAN A;  4X4V A;  2PXI A;  4AT9 B;  2HHP A;  4FHX A;  4IQU A;  4GXJ A;  5J0P A;  4AT7 A;  4R64 A;  8ICH A;  7ICO A;  3H3A A;  4FH3 A;  4P2H A;  5J2D A;  4RPZ A;  1TVA A;  3WFR E;  4KLQ A;  2ID1 A;  4RWO A;  4X4Q A;  4RWQ A;  7ICS A;  8ICM A;  1NO5 A;  4NXZ A;  1RPL A;  5J2A A;  1ZJM A;  4YMM A;  5J2G A;  3C66 A;  8ICO A;  9ICU A;  5IIO A;  5J2E A;  3WFS C;  8ICP A;  9ICB A;  3AU6 A;  3PML A;  4M0A A;  3AQM A;  4RQ3 A;  1BPE A;  2M2T A;  4TUQ A;  3RJI A;  4EBK A;  3L9D A;  3RJF A;  4I2A A;  1PX5 A;  4LZD A;  2DRA A;  1V4A A;  1ZQX A;  4RT3 A;  5J2I A;  3MBY A;  5IIM A;  4FHP A;  1ZQD A;  3LQC B;  2DR7 A;  4KLM A;  5BPC A;  4UAW A;  9ICX A;  1ZQA A;  4O5K A;  3JPS A;  2M2V A;  4KLH A;  4KLD A;  4UAZ A;  5D4B A;  4QZF A;  3HIY A;  4UD5 A;  4WC7 A;  5HRG A;  8ICC A;  4PPX A;  2BPG A;  4RWN A;  4RQ7 A;  4K4G A;  5J0T A;  4M9H A;  4E80 A;  8ICJ A;  4R63 A;  4K4I A;  8ICY A;  2I9G A;  4P4O A;  4O9M A;  1MIW A;  3JPQ A;  5J0Y A;  4UB1 A;  4I2C A;  8ICV A;  1FA0 A;  5HC9 A;  1ZQR A;  2ZH6 A;  4I2H A;  3HWT A;  4DO9 A;  7ICN A;  5IIJ A;  1ZQZ A;  9ICL A;  4Z6D A;  2PFN A;  1ZQY A;  1KDH A;  4AT8 B;  9ICS A;  3OGU A;  1Q78 A;  1ZQE A;  5HR9 A;  8ICW A;  5DB6 A;  3C2K A;  9ICH A;  1ZQL A;  1R8C A;  4DOA A;  1ZQC A;  5J2C A;  3WFO A;  2BE3 A;  4IQW A;  2BPC A;  4X4R A;  5J0S A;  4I2F A;  3HJ4 A;  3UXP A;  7ICJ A;  2RFF A;  4GXI A;  7ICP A;  4X4N A;  3AQN A;  5TZV A;  9ICK A;  1UEV A;  4YN4 A;  1ZQN A;  3V7L A;  1BPY A;  4X0A A;  3H39 A;  1RZT A;  3RJE A;  4I2I A;  3UXN A;  3H38 A;  7ICT A;  7ICH A;  5J0R A;  4WC2 A;  3PMN A;  4YD1 A;  4I2B A;  1TFW A;  5DED A;  1XSL A;  1MQ3 A;  4X4T A;  4M9N A;  4PGX A;  5HRH A;  4IG8 A;  3B0Y A;  4MFC A;  3JPN A;  1KEJ A;  5CWR A;  4PHE A;  4UB3 A;  1NOM A;  1ZQB A;  3UPS A;  1JN3 A;  3WFP A;  8ICI A;  5J0O A;  4YMO A;  4RQ5 A;  7ICM A;  2DVI A;  1ZQH A;  5D46 A;  4I2D A;  5HRF A;  4KLF A;  4F5N A;  3AQL A;  4F5R A;  4AT9 A;  4PHA A;  2O1P A;  3JPR A;  9ICE A;  5HRL A;  3AU2 A;  2DR8 A;  4RQ0 A;  3RH5 A;  2NRK A;  3K75 D;  4F5Q A;  4TUP A;  2ZH5 A;  4QZD A;  9ICW A;  3RJH A;  4ATB B;  4XA5 A;  4MFF A;  8ICU A;  4E7X A;  4R65 A;  4RQ4 A;  2PFP A;  3TFR A;  2ZH9 A;  1XSN A;  4M9G A;  4LZG A;  1HUO A;  3RH4 A;  3AQK A;  4RQ1 A;  3RJJ A;  5III A;  3C2M A;  4LT6 A;  3GDX A;  1ZQG A;  4X4P A;  2DRB A;  1BPB A;  5DBB A;  5DEC A;  1MIV A;  9ICJ A;  4KLU A;  4NLK A;  4QZA A;  4UBB A;  4EP7 A;  4IQT A;  1ZQW A;  1F5A A;  2PFQ A;  4PHD A;  4KLS A;  9ICM A;  4UB4 A;  5DBC A;  7ICU A;  4MF8 A;  7ICG A;  5CP2 A;  2BPF A;  4F5P A;  4NY8 A;  4TUR A;  5HRB A;  7ICF A;  2DR9 A;  2O5A A;  4KLT A;  7ICR A;  1MIY A;  1ZQO A;  8ICS A;  4QZI A;  3OUY B;  4XQ7 A;  4M9L A;  3HW8 A;  1JMS A;  4RQ8 A;  7ICV A;  1BPX A;  5DB9 A;  3RJG A;  7ICK A;  4WC4 A;  3B0X A;  4RWP A;  1ZQU A;  4X4U A;  1ZJN A;  5HRD A;  2P66 A;  4RPX A;  1TV9 A;  3JYY A;  2ZH4 A;  4NLZ A;  1ZQS A;  4M47 A;  7ICI A;  9ICF A;  4AT8 A;  5J2B A;  5DB7 A;  3V72 A;  4NKT A;  4WC0 A;  3JPO A;  5J0W A;  4KLI A;  3JPT A;  2BCR A;  4AT7 B;  4QZG A;  3ISC A;  8ICK A;  4MFA A;  5CR0 A;  4Z6E A;  9ICG A;  4E8F A;  8ICR A;  5J2H A;  4RQ6 A;  1TFY A;  4WC1 A;  5IIL A;  2ZHA A;  3MDA A;  1BPZ A;  9ICA A;  8ICQ A;  4DOC A;  4K4H A;  3OV7 A;  2ZH2 A;  4GXK A;  4NM2 A;  3NYB A;  9ICR A;  4I29 A;  4KLE A;  4O5E A;  4QZE A;  5J29 A;  1ZQT A;  9ICN A;  2ZH3 A;  4NKU A;  3JPP A;  5IIK A;  1ZQK A;  2Q66 A;  1OU5 A;  4WC6 A;  4PHP A;  9ICP A;  4RT2 A;  8ICN A;  2FMS A;  1UET A;  1Q79 A;  1WOT A;  1JAJ A;  3V7J A;  3PNC A;  3MGI A;  4UB5 A;  5CA7 A;  4WC3 A;  2ISP A;  4PGY A;  2M2W A;  4XQ8 A;  4I27 A;  4I2G A;  4P4P A;  4KLJ A;  4DOB A;  4I28 A;  9ICV A;  3HX0 A;  4X4O A;  4F5O A;  4FO6 A;  4KLO A;  5BOM A;  3ISB A;  4JWM A;  8ICL A;  4Z6C A;  1ZQV A;  2PBE A;  2M2U A;  3MGH A;  3UQ0 A;  3MDC A;  2ZHB A;  3UXO A;  3OVA A;  4M04 A;  4FH5 A;  3ISD A;  3RH6 A;  4FHW A;  4IQV A;  4UAY A;  8ICF A;  4YD2 A;  1ZQI A;  3AUO A;  1YLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...