1NO5A

Structure of hi0073 from haemophilus influenzae, the nucleotide binding domain of the hi0073/hi0074 two protein nucleotidyl transferase.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
100
structure length
100
Chain Sequence
QLDIKSEELAIVKTILQQLVPDYTVWAFGSRVKGKAKKYSDLDLAIISEEPLDFLARDRLKEAFSESDLPWRVDLLDWATTSEDFREIIRKVYVVIQEKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein HI0073
publication title Structure of HI0073 from Haemophilus influenzae, the nucleotide-binding domain of a two-protein nucleotidyl transferase
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Structural genomics, unknown function
total genus 27
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1no5A00
4WC5A 1XSPA 7ICVA 4QZ8A 4FH3A 4UAZA 2I9GA 4K4HA 7ICMA 5HRHA 1ZQPA 3JPOA 4XUSA 4RWPA 4JWNA 2M2TA 9ICOA 4R63A 3HIYA 9ICBA 5TZVA 4AT7A 4DOAA 4WCWA 4ATBB 4PGYA 2DR9A 4TUSA 3C66A 4DOBA 4O5CA 4KLLA 4FHXA 4X4OA 5J29A 5DB7A 1ZQQA 3H38A 7ICLA 3UQ2A 5J0SA 2HHPA 3JPQA 3RH4A 1TV9A 4P4PA 4X5VA 2BPFA 4FO6A 2FMPA 4NM2A 4I2EA 4PHEA 1PX5A 1ZQVA 4XRHA 3AQNA 4S3NA 1BPXA 3ISDA 4YD1A 1JAJA 1Q79A 4I2BA 5DECA 1ZQKA 1BPBA 8ICXA 2BPGA 4IQWA 9ICWA 3RJGA 4MF8A 9ICAA 2M2VA 1JN3A 8ICFA 4E80A 3LK9A 4MFCA 5J0OA 4P4MA 1ZQFA 5D46A 4RQ3A 5HRIA 5DBAA 4XQ8A 1YLQA 4M9NA 4AT9B 1ZQMA 5J0TA 4DOCA 4RQ2A 9ICLA 5DB8A 5J0QA 4P2HA 3H3AA 3AQKA 4R66A 7ICEA 7ICTA 9ICHA 4RWNA 1BPDA 9ICSA 5J2CA 3UXOA 2ZHAA 4RQ7A 4I2JA 3JPTA 4QZEA 5BOMA 4RWQA 4M9GA 4FHWA 4RQ8A 4RQ1A 2ZH6A 2IHMA 2W9MA 4PH5A 8ICPA 5HC9A 5J0UA 4UB2A 3RJFA 3WFSC 1MIVA 4UBCA 2FMQA 4NKTA 2RFFA 4X0AA 4F5QA 4F5OA 4TUPA 3V7JA 3OGUA 5DEDA 8ICSA 3RJHA 5J0WA 5CJ7A 4X4NA 4AT8A 9ICJA 4XA5A 1TFYA 2DRBA 3WFPA 4O5EA 7ICKA 4WC7A 1ZQHA 4NLZA 3JPRA 4F5PA 4IQVA 1KDHA 1F5AA 3RJKA 2NRKA 4I2FA 4YD2A 5HREA 4TUQA 4M9LA 4QZBA 5BOLA 4M47A 3NYBA 4RQ6A 4GXIA 5DDYA 4MF2A 4FHYA 4F5NA 7ICQA 1R89A 1ZJMA 3C2KA 2ZH8A 3MGHA 3OVSA 7ICJA 9ICCA 3H37A 4WC3A 4I28A 4RWOA 1KNYA 4I2AA 1JMSA 5HRDA 2ZH1A 5CB1A 1BPYA 2PFNA 5J2GA 4I2GA 5J2FA 5J2AA 4I2HA 1R8AA 4KLJA 4Z6DA 4LZGA 4R65A 1ZQDA 4RPZA 8ICBA 4X4UA 4PGXA 3UQ0A 4KLFA 7ICRA 4M2YA 4X4RA 4PGQA 4X4TA 1MQ2A 7ICFA 2BE3A 3TFRA 4K4IA 4UD5A 4NKUA 4ATBA 5IIMA 1ZQGA 4KLDA 9ICPA 2ID1A 4WC4A 4M04A 3AU6A 4RPYA 4XQ7A 4EP7A 4Z6CA 5DKWA 2PBEA 1UEUA 3V7LA 5IIOA 1MIYA 5IIIA 4PHDA 4QZ9A 3OVBA 1ZQAA 2M2WA 1VJ7A 4YN4A 4RQ5A 1BPEA 4UB1A 3AQMA 2ZH9A 3PMLA 3PMNA 5J0YA 5DDMA 3JPNA 2Q66A 5DBCA 1Q78A 5D4BA 4UAYA 5J2EA 3RH5A 9ICIA 5HRFA 4KLSA 1NOMA 1ZQBA 3V7KA 4NXZA 5BPCA 3ISBA 4RQ0A 4AT9A 7ICPA 4LT6A 4P4OA 1ZQIA 5EOZA 2ZH3A 4E7XA 1UETA 4WBYA 5HR9A 3UPSA 3H39A 4NLNA 5J2KA 4RT3A 1ZQSA 3K75D 2ZH5A 9ICNA 3HW8A 5J2DA 2DVIA 8ICCA 1WOTA 4M0AA 1NO5A 4Z6EA 4QZIA 9ICTA 5IINA 8ICHA 1ZQJA 4UD4A 4KLMA 5IILA 2O1PA 4EBKA 4QZAA 8ICAA 4F5RA 5DB6A 4I2CA 4X4QA 3JYYA 1BPZA 1ZQYA 4I2DA 1TFWA 8ICEA 1ZQWA 3MDAA 4WC6A 9ICVA 4KLOA 4AT8B 3AU2A 1ZQZA 8ICNA 4I2IA 2BPCA 5HRGA 1TVAA 1OU5A 3C2LA 3OUYB 1RPLA 3RJJA 4LVSA 3JZ0A 3ISCA 7ICSA 1MIWA 4KLHA 1XSLA 3MBYA 3WFOA 5HRBA 3RJEA 4M9HA 4O5KA 1R8BA 1MQ3A 4LZDA 8ICIA 2M2UA 4YMMA 4QZHA 1ZJNA 3C5GA 4JWMA 7ICUA 4QZCA 2ZH4A 4NM1A 9ICEA 1ZQCA 5HHIA 8ICMA 4FHVA 1HUZA 2BCVA 5IIKA 7ICGA 4KLEA 3C2MA 4NLKA 9ICUA 2BCSA 3AQLA 2DR5A 4Z6FA 3PNCA 4UAWA 4IQUA 4YMNA 4PHAA 2ZHBA 1VFGA 4YCXA 5J2JA 5J2IA 7ICHA 4FH5A 1V4AA 4AT7B 4O9MA 3B0XA 4E8FA 3HWTA 5HRKA 3JPPA 1RZTA 4KLQA 5CHGA 3C5FA 3UXPA 4KLUA 3OVAA 4I27A 4GXKA 1ZQLA 4UB4A 3GDXA 4R64A 1JQRA 4RQ4A 7ICOA 4TURA 4EBJA 3HX0A 1ZQOA 4WC0A 5J2HA 4IG8A 4X4SA 4MFAA 3HJ4A 1ZQRA 3WFRE 8ICJA 3RH6A 2DR8A 4I29A 4WC1A 9ICGA 3L9DA 1XSNA 9ICXA 3C18A 8ICKA 8ICGA 2ISPA 8ICVA 1UEVA 4WBZA 2ISOA 3UXNA 5J0XA 1ZQTA 5HHHA 9ICQA 4UB5A 2ZH7A 2P66A 1HUOA 4YMOA 4QZFA 5D49A 8ICOA 2O5AA 1ZQNA 4PPXA 4MFFA 4X4VA 4NY8A 1R8CA 4M5DA 3WFQE 5DBBA 5CA7A 3LQCB 2DRAA 4GXJA 1ZQXA 4KLIA 4IQTA 1ZQEA 4RT2A 5CP2A 3MDCA 3HJ1A 4KLTA 2BCRA 2VANA 8ICUA 4RPXA 5DB9A 3B0YA 3JPSA 5CWRA 9ICRA 8ICZA 4PHPA 4KLGA 4UBBA 4UB3A 5IIJA 2PFQA 2DR7A 3AUOA 2GWSA 3MGIA 1ZQUA 7ICIA 5CR0A 5J0RA 3UPQA 2PXIA 1KEJA 2BCUA 8ICTA 9ICKA 5F2VO 4K4GA 4X0BA 8ICYA 3RJIA 2PFPA 8ICWA 4QZDA 5J2BA 4WC2A 9ICFA 2BCQA 4X4PA 3OUYA 4DO9A 4QZGA 4M9JA 9ICMA 5HRLA 3OV7A 8ICLA 4FHPA 2ZH2A 8ICQA 7ICNA 1FA0A 2PFOA 8ICRA 2FMSA 5J0PA 3TFSA 3V72A
chains in the Genus database with same CATH superfamily
4WC5A 1XSPA 7ICVA 4QZ8A 4OAGA 4FH3A 4UAZA 2I9GA 4K4HA 7ICMA 5HRHA 1ZQPA 3JPOA 4XUSA 4RWPA 4JWNA 2M2TA 3K7DA 4R63A 3HIYA 9ICOA 9ICBA 2BBJA 5TZVA 4AT7A 4DOAA 4WCWA 4ATBB 4PGYA 3NWIA 2DR9A 4TUSA 3C66A 4DOBA 4O5CA 4KLLA 2GAFD 4FHXA 4X4OA 5J29A 5DB7A 1ZQQA 4FO1A 2GA9D 3H38A 7ICLA 3UQ2A 5J0SA 2HHPA 3JPQA 3RH4A 1TV9A 4P4PA 4X5VA 2BPFA 4FO6A 2FMPA 4NM2A 4I2EA 4PHEA 1PX5A 1ZQVA 4S3NA 3AQNA 4XRHA 1BPXA 3ISDA 4YD1A 1JAJA 1GPJA 1Q79A 4I2BA 5DECA 1ZQKA 1BPBA 8ICXA 2BPGA 4IQWA 9ICWA 3RJGA 4MF8A 4EEBA 9ICAA 4LEWA 2M2VA 1JN3A 8ICFA 4E80A 3LK9A 4MFCA 5CFTA 5J0OA 4P4MA 1ZQFA 5D46A 4RQ3A 5HRIA 5DBAA 4XQ8A 1YLQA 4M9NA 4AT9B 1ZQMA 5J0TA 4DOCA 4RQ2A 9ICLA 5DB8A 5J0QA 4P2HA 3H3AA 3AQKA 4R66A 7ICEA 7ICTA 9ICHA 4RWNA 1BPDA 9ICSA 5J2CA 4NXVA 3UXOA 2ZHAA 4K97A 4RQ7A 4I2JA 4QZEA 3JPTA 5BOMA 4RWQA 4M9GA 4FHWA 4RQ8A 4RQ1A 2ZH6A 2IHMA 2W9MA 4PH5A 8ICPA 5HC9A 5J0UA 4UB2A 3RJFA 3WFSC 1MIVA 4UBCA 2FMQA 4NKTA 4JLXA 2RFFA 4X0AA 4K98A 4F5QA 2HN1A 4F5OA 4TUPA 3V7JA 3OGUA 5DEDA 8ICSA 3RJHA 2B4VA 5J0WA 5CJ7A 4X4NA 4AT8A 9ICJA 4XA5A 1TFYA 3JCFA 2DRBA 3WFPA 4O5EA 7ICKA 4WC7A 1ZQHA 4NLZA 3JPRA 4F5PA 4IQVA 5CHEA 4K9BA 1KDHA 1F5AA 3RJKA 3NKUA 2NRKA 3ER9B 4I2FA 4YD2A 5HREA 4TUQA 4M9LA 4QZBA 3PHZA 5BOLA 4M47A 3NYBA 4RQ6A 4GXIA 5DDYA 5B3QA 4MF2A 4FHYA 5CFUA 4F5NA 7ICQA 1R89A 1ZJMA 3C2KA 2ZH8A 3MGHA 3OVSA 7ICJA 9ICCA 3H37A 4WC3A 4I28A 4RWOA 1KNYA 4I2AA 1JMSA 5HRDA 2ZH1A 5CB1A 1BPYA 2PFNA 5J2GA 4I2GA 5J2FA 5J2AA 4I2HA 1R8AA 4KLJA 3NVOA 4Z6DA 4LZGA 4R65A 1ZQDA 4RPZA 2IUBA 8ICBA 4X4UA 4PGXA 3UQ0A 4KLFA 7ICRA 4M2YA 4X4RA 4PGQA 4X4TA 1MQ2A 4WQKA 7ICFA 2BE3A 3TFRA 4K4IA 4UD5A 4NKUA 4ATBA 5IIMA 1ZQGA 4KLDA 9ICPA 2ID1A 4WC4A 4M04A 3AU6A 4KB6A 4RPYA 4XQ7A 4EP7A 4Z6CA 5DKWA 2PBEA 1UEUA 3V7LA 4N7RA 5IIOA 1MIYA 5IIIA 4PHDA 4QZ9A 4K99A 3OVBA 1ZQAA 2M2WA 1VJ7A 4HX0A 4YN4A 4RQ5A 1BPEA 4UB1A 5B3PA 3AQMA 2ZH9A 3PMLA 3PMNA 5J0YA 5DDMA 3JPNA 2Q66A 5DBCA 1Q78A 5D4BA 4UAYA 4OAHA 5J2EA 3RH5A 9ICIA 5HRFA 4KLSA 1NOMA 1ZQBA 3V7KA 4NXZA 5BPCA 3ISBA 4RQ0A 4AT9A 7ICPA 4LT6A 4P4OA 1ZQIA 3CK6A 5EOZA 2ZH3A 4E7XA 5HR9A 1UETA 4WBYA 3UPSA 3H39A 4NLNA 5J2KA 4RT3A 1ZQSA 3K75D 2ZH5A 9ICNA 3HW8A 4O68A 5J2DA 2DVIA 8ICCA 1WOTA 4M0AA 1NO5A 4Z6EA 4QZIA 9ICTA 5IINA 4EV6A 8ICHA 1ZQJA 4UD4A 4KLMA 5IILA 2O1PA 4EBKA 4QZAA 8ICAA 4F5RA 5DB6A 4I2CA 4X4QA 3JYYA 1BPZA 1ZQYA 4I2DA 1TFWA 8ICEA 1ZQWA 3MDAA 4WC6A 9ICVA 3MCRA 4KLOA 4AT8B 3AU2A 1ZQZA 4O69A 8ICNA 4I2IA 4MKPA 2BPCA 5HRGA 1TVAA 1OU5A 2EWRA 3C2LA 3EF2A 4XJEA 3OUYB 1RPLA 4WQLA 3RJJA 4LVSA 3JZ0A 3ISCA 7ICSA 1MIWA 4KLHA 1XSLA 3MBYA 3WFOA 5HRBA 3RJEA 4M9HA 4O5KA 1R8BA 1MQ3A 4LZDA 8ICIA 2M2UA 4YMMA 4QZHA 1ZJNA 3C5GA 4O6AA 4JWMA 4QZCA 7ICUA 2ZH4A 4NM1A 9ICEA 1ZQCA 5HHIA 4NXWA 8ICMA 4FHVA 1HUZA 2BCVA 5IIKA 7ICGA 4KLEA 3C2MA 4NLKA 9ICUA 2BCSA 3AQLA 2DR5A 4Z6FA 3PNCA 4NXUA 4UAWA 4IQUA 4YMNA 4EGWA 4PHAA 2ZHBA 1VFGA 4YCXA 5J2JA 5J2IA 7ICHA 4FH5A 1V4AA 4AT7B 4O9MA 3B0XA 4E8FA 3HWTA 5HRKA 3JPPA 1RZTA 4KLQA 5CHGA 3C5FA 3UXPA 2B51A 4KLUA 2FCLA 3OVAA 4K9AA 4I27A 4GXKA 2BBHA 4I0UA 1ZQLA 4UB4A 3GDXA 4R64A 4NXTA 1JQRA 3ER8C 4RQ4A 7ICOA 4TURA 5D63A 4EBJA 3HX0A 1ZQOA 4WC0A 5J2HA 4IG8A 4X4SA 4OAIZ 4MFAA 3HJ4A 1ZQRA 3WFRE 8ICJA 3RH6A 2DR8A 4I29A 4WC1A 9ICGA 3L9DA 1XSNA 9ICXA 3C18A 8ICKA 8ICGA 2ISPA 8ICVA 1UEVA 4WBZA 2ISOA 3UXNA 5J0XA 1ZQTA 5HHHA 9ICQA 4UB5A 2ZH7A 2P66A 4K8VA 1HUOA 4YMOA 4KM5A 4EEDA 4QZFA 5D49A 8ICOA 2O5AA 4NXXA 1ZQNA 4PPXA 4LEYA 4MFFA 4X4VA 2IHOA 4NY8A 1R8CA 4OAFA 4M5DA 2B56A 3WFQE 5DBBA 5CA7A 3LQCB 4JLZA 2DRAA 4GXJA 1ZQXA 4KLIA 4IQTA 1ZQEA 4RT2A 4LEVA 5CP2A 3MDCA 3HJ1A 4KLTA 4K96A 2BCRA 2VANA 8ICUA 4RPXA 5DB9A 3B0YA 3JPSA 5CWRA 9ICRA 8ICZA 4PHPA 4LEZA 4KLGA 4UBBA 4UB3A 4WH5A 5IIJA 2PFQA 2DR7A 4O67A 3AUOA 2GWSA 3MGIA 1ZQUA 7ICIA 5CR0A 5J0RA 3UPQA 2PXIA 5D61A 1KEJA 2BCUA 8ICTA 9ICKA 5F2VO 4K4GA 4X0BA 8ICYA 3RJIA 2PFPA 8ICWA 4QZDA 5J2BA 4WC2A 9ICFA 2BCQA 4X4PA 3OUYA 4DO9A 3ERCC 4QZGA 4M9JA 9ICMA 5HRLA 3OV7A 8ICLA 4FHPA 2ZH2A 8ICQA 4WOYA 2HN2A 7ICNA 5CFSA 5JTGA 3OWGA 1FA0A 5D62A 2PFOA 8ICRA 2FMSA 5J0PA 3TFSA 3V72A
chains in the Genus database with same CATH topology
4WC5A 1XSPA 7ICVA 4QZ8A 4FH3A 4UAZA 2I9GA 4K4HA 7ICMA 5HRHA 1ZQPA 3JPOA 4XUSA 4RWPA 4JWNA 2M2TA 9ICOA 4R63A 3HIYA 9ICBA 5TZVA 4AT7A 4DOAA 4WCWA 4ATBB 4PGYA 2DR9A 4TUSA 3C66A 4DOBA 4O5CA 4KLLA 4FHXA 4X4OA 5J29A 5DB7A 1ZQQA 3H38A 7ICLA 3UQ2A 5J0SA 2HHPA 3JPQA 3RH4A 1TV9A 4P4PA 4X5VA 2BPFA 4FO6A 2FMPA 4NM2A 4I2EA 4PHEA 1PX5A 1ZQVA 4XRHA 3AQNA 4S3NA 1BPXA 3ISDA 4YD1A 1JAJA 1Q79A 4I2BA 5DECA 1ZQKA 1BPBA 8ICXA 2BPGA 4IQWA 9ICWA 3RJGA 4MF8A 9ICAA 2M2VA 1JN3A 8ICFA 4E80A 3LK9A 4MFCA 5J0OA 4P4MA 1ZQFA 5D46A 4RQ3A 5HRIA 5DBAA 4XQ8A 1YLQA 4M9NA 4AT9B 1ZQMA 5J0TA 4DOCA 4RQ2A 9ICLA 5DB8A 5J0QA 4P2HA 3H3AA 3AQKA 4R66A 7ICEA 7ICTA 9ICHA 4RWNA 1BPDA 9ICSA 5J2CA 3UXOA 2ZHAA 4RQ7A 4I2JA 3JPTA 4QZEA 5BOMA 4RWQA 4M9GA 4FHWA 4RQ8A 4RQ1A 2ZH6A 2IHMA 2W9MA 4PH5A 8ICPA 5HC9A 5J0UA 4UB2A 3RJFA 3WFSC 1MIVA 4UBCA 2FMQA 4NKTA 2RFFA 4X0AA 4F5QA 4F5OA 4TUPA 3V7JA 3OGUA 5DEDA 8ICSA 3RJHA 5J0WA 5CJ7A 4X4NA 4AT8A 9ICJA 4XA5A 1TFYA 2DRBA 3WFPA 4O5EA 7ICKA 4WC7A 1ZQHA 4NLZA 3JPRA 4F5PA 4IQVA 1KDHA 1F5AA 3RJKA 2NRKA 4I2FA 4YD2A 5HREA 4TUQA 4M9LA 4QZBA 5BOLA 4M47A 3NYBA 4RQ6A 4GXIA 5DDYA 4MF2A 4FHYA 4F5NA 7ICQA 1R89A 1ZJMA 3C2KA 2ZH8A 3MGHA 3OVSA 7ICJA 9ICCA 3H37A 4WC3A 4I28A 4RWOA 1KNYA 4I2AA 1JMSA 5HRDA 2ZH1A 5CB1A 1BPYA 2PFNA 5J2GA 4I2GA 5J2FA 5J2AA 4I2HA 1R8AA 4KLJA 4Z6DA 4LZGA 4R65A 1ZQDA 4RPZA 8ICBA 4X4UA 4PGXA 3UQ0A 4KLFA 7ICRA 4M2YA 4X4RA 4PGQA 4X4TA 1MQ2A 7ICFA 2BE3A 3TFRA 4K4IA 4UD5A 4NKUA 4ATBA 5IIMA 1ZQGA 4KLDA 9ICPA 2ID1A 4WC4A 4M04A 3AU6A 4RPYA 4XQ7A 4EP7A 4Z6CA 5DKWA 2PBEA 1UEUA 3V7LA 5IIOA 1MIYA 5IIIA 4PHDA 4QZ9A 3OVBA 1ZQAA 2M2WA 1VJ7A 4YN4A 4RQ5A 1BPEA 4UB1A 3AQMA 2ZH9A 3PMLA 3PMNA 5J0YA 5DDMA 3JPNA 2Q66A 5DBCA 1Q78A 5D4BA 4UAYA 5J2EA 3RH5A 9ICIA 5HRFA 4KLSA 1NOMA 1ZQBA 3V7KA 4NXZA 5BPCA 3ISBA 4RQ0A 4AT9A 7ICPA 4LT6A 4P4OA 1ZQIA 5EOZA 2ZH3A 4E7XA 1UETA 4WBYA 5HR9A 3UPSA 3H39A 4NLNA 5J2KA 4RT3A 1ZQSA 3K75D 2ZH5A 9ICNA 3HW8A 5J2DA 2DVIA 8ICCA 1WOTA 4M0AA 1NO5A 4Z6EA 4QZIA 9ICTA 5IINA 8ICHA 1ZQJA 4UD4A 4KLMA 5IILA 2O1PA 4EBKA 4QZAA 8ICAA 4F5RA 5DB6A 4I2CA 4X4QA 3JYYA 1BPZA 1ZQYA 4I2DA 1TFWA 8ICEA 1ZQWA 3MDAA 4WC6A 9ICVA 4KLOA 4AT8B 3AU2A 1ZQZA 8ICNA 4I2IA 2BPCA 5HRGA 1TVAA 1OU5A 3C2LA 3OUYB 1RPLA 3RJJA 4LVSA 3JZ0A 3ISCA 7ICSA 1MIWA 4KLHA 1XSLA 3MBYA 3WFOA 5HRBA 3RJEA 4M9HA 4O5KA 1R8BA 1MQ3A 4LZDA 8ICIA 2M2UA 4YMMA 4QZHA 1ZJNA 3C5GA 4JWMA 7ICUA 4QZCA 2ZH4A 4NM1A 9ICEA 1ZQCA 5HHIA 8ICMA 4FHVA 1HUZA 2BCVA 5IIKA 7ICGA 4KLEA 3C2MA 4NLKA 9ICUA 2BCSA 3AQLA 2DR5A 4Z6FA 3PNCA 4UAWA 4IQUA 4YMNA 4PHAA 2ZHBA 1VFGA 4YCXA 5J2JA 5J2IA 7ICHA 4FH5A 1V4AA 4AT7B 4O9MA 3B0XA 4E8FA 3HWTA 5HRKA 3JPPA 1RZTA 4KLQA 5CHGA 3C5FA 3UXPA 4KLUA 3OVAA 4I27A 4GXKA 1ZQLA 4UB4A 3GDXA 4R64A 1JQRA 4RQ4A 7ICOA 4TURA 4EBJA 3HX0A 1ZQOA 4WC0A 5J2HA 4IG8A 4X4SA 4MFAA 3HJ4A 1ZQRA 3WFRE 8ICJA 3RH6A 2DR8A 4I29A 4WC1A 9ICGA 3L9DA 1XSNA 9ICXA 3C18A 8ICKA 8ICGA 2ISPA 8ICVA 1UEVA 4WBZA 2ISOA 3UXNA 5J0XA 1ZQTA 5HHHA 9ICQA 4UB5A 2ZH7A 2P66A 1HUOA 4YMOA 4QZFA 5D49A 8ICOA 2O5AA 1ZQNA 4PPXA 4MFFA 4X4VA 4NY8A 1R8CA 4M5DA 3WFQE 5DBBA 5CA7A 3LQCB 2DRAA 4GXJA 1ZQXA 4KLIA 4IQTA 1ZQEA 4RT2A 5CP2A 3MDCA 3HJ1A 4KLTA 2BCRA 2VANA 8ICUA 4RPXA 5DB9A 3B0YA 3JPSA 5CWRA 9ICRA 8ICZA 4PHPA 4KLGA 4UBBA 4UB3A 5IIJA 2PFQA 2DR7A 3AUOA 2GWSA 3MGIA 1ZQUA 7ICIA 5CR0A 5J0RA 3UPQA 2PXIA 1KEJA 2BCUA 8ICTA 9ICKA 5F2VO 4K4GA 4X0BA 8ICYA 3RJIA 2PFPA 8ICWA 4QZDA 5J2BA 4WC2A 9ICFA 2BCQA 4X4PA 3OUYA 4DO9A 4QZGA 4M9JA 9ICMA 5HRLA 3OV7A 8ICLA 4FHPA 2ZH2A 8ICQA 7ICNA 1FA0A 2PFOA 8ICRA 2FMSA 5J0PA 3TFSA 3V72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WC5 A;  1XSP A;  7ICV A;  4QZ8 A;  4FH3 A;  4UAZ A;  2I9G A;  4K4H A;  7ICM A;  5HRH A;  1ZQP A;  3JPO A;  4XUS A;  4RWP A;  4JWN A;  2M2T A;  9ICO A;  4R63 A;  3HIY A;  9ICB A;  5TZV A;  4AT7 A;  4DOA A;  4WCW A;  4ATB B;  4PGY A;  2DR9 A;  4TUS A;  3C66 A;  4DOB A;  4O5C A;  4KLL A;  4FHX A;  4X4O A;  5J29 A;  5DB7 A;  1ZQQ A;  3H38 A;  7ICL A;  3UQ2 A;  5J0S A;  2HHP A;  3JPQ A;  3RH4 A;  1TV9 A;  4P4P A;  4X5V A;  2BPF A;  4FO6 A;  2FMP A;  4NM2 A;  4I2E A;  4PHE A;  1PX5 A;  1ZQV A;  4XRH A;  3AQN A;  4S3N A;  1BPX A;  3ISD A;  4YD1 A;  1JAJ A;  1Q79 A;  4I2B A;  5DEC A;  1ZQK A;  1BPB A;  8ICX A;  2BPG A;  4IQW A;  9ICW A;  3RJG A;  4MF8 A;  9ICA A;  2M2V A;  1JN3 A;  8ICF A;  4E80 A;  3LK9 A;  4MFC A;  5J0O A;  4P4M A;  1ZQF A;  5D46 A;  4RQ3 A;  5HRI A;  5DBA A;  4XQ8 A;  1YLQ A;  4M9N A;  4AT9 B;  1ZQM A;  5J0T A;  4DOC A;  4RQ2 A;  9ICL A;  5DB8 A;  5J0Q A;  4P2H A;  3H3A A;  3AQK A;  4R66 A;  7ICE A;  7ICT A;  9ICH A;  4RWN A;  1BPD A;  9ICS A;  5J2C A;  3UXO A;  2ZHA A;  4RQ7 A;  4I2J A;  3JPT A;  4QZE A;  5BOM A;  4RWQ A;  4M9G A;  4FHW A;  4RQ8 A;  4RQ1 A;  2ZH6 A;  2IHM A;  2W9M A;  4PH5 A;  8ICP A;  5HC9 A;  5J0U A;  4UB2 A;  3RJF A;  3WFS C;  1MIV A;  4UBC A;  2FMQ A;  4NKT A;  2RFF A;  4X0A A;  4F5Q A;  4F5O A;  4TUP A;  3V7J A;  3OGU A;  5DED A;  8ICS A;  3RJH A;  5J0W A;  5CJ7 A;  4X4N A;  4AT8 A;  9ICJ A;  4XA5 A;  1TFY A;  2DRB A;  3WFP A;  4O5E A;  7ICK A;  4WC7 A;  1ZQH A;  4NLZ A;  3JPR A;  4F5P A;  4IQV A;  1KDH A;  1F5A A;  3RJK A;  2NRK A;  4I2F A;  4YD2 A;  5HRE A;  4TUQ A;  4M9L A;  4QZB A;  5BOL A;  4M47 A;  3NYB A;  4RQ6 A;  4GXI A;  5DDY A;  4MF2 A;  4FHY A;  4F5N A;  7ICQ A;  1R89 A;  1ZJM A;  3C2K A;  2ZH8 A;  3MGH A;  3OVS A;  7ICJ A;  9ICC A;  3H37 A;  4WC3 A;  4I28 A;  4RWO A;  1KNY A;  4I2A A;  1JMS A;  5HRD A;  2ZH1 A;  5CB1 A;  1BPY A;  2PFN A;  5J2G A;  4I2G A;  5J2F A;  5J2A A;  4I2H A;  1R8A A;  4KLJ A;  4Z6D A;  4LZG A;  4R65 A;  1ZQD A;  4RPZ A;  8ICB A;  4X4U A;  4PGX A;  3UQ0 A;  4KLF A;  7ICR A;  4M2Y A;  4X4R A;  4PGQ A;  4X4T A;  1MQ2 A;  7ICF A;  2BE3 A;  3TFR A;  4K4I A;  4UD5 A;  4NKU A;  4ATB A;  5IIM A;  1ZQG A;  4KLD A;  9ICP A;  2ID1 A;  4WC4 A;  4M04 A;  3AU6 A;  4RPY A;  4XQ7 A;  4EP7 A;  4Z6C A;  5DKW A;  2PBE A;  1UEU A;  3V7L A;  5IIO A;  1MIY A;  5III A;  4PHD A;  4QZ9 A;  3OVB A;  1ZQA A;  2M2W A;  1VJ7 A;  4YN4 A;  4RQ5 A;  1BPE A;  4UB1 A;  3AQM A;  2ZH9 A;  3PML A;  3PMN A;  5J0Y A;  5DDM A;  3JPN A;  2Q66 A;  5DBC A;  1Q78 A;  5D4B A;  4UAY A;  5J2E A;  3RH5 A;  9ICI A;  5HRF A;  4KLS A;  1NOM A;  1ZQB A;  3V7K A;  4NXZ A;  5BPC A;  3ISB A;  4RQ0 A;  4AT9 A;  7ICP A;  4LT6 A;  4P4O A;  1ZQI A;  5EOZ A;  2ZH3 A;  4E7X A;  1UET A;  4WBY A;  5HR9 A;  3UPS A;  3H39 A;  4NLN A;  5J2K A;  4RT3 A;  1ZQS A;  3K75 D;  2ZH5 A;  9ICN A;  3HW8 A;  5J2D A;  2DVI A;  8ICC A;  1WOT A;  4M0A A;  1NO5 A;  4Z6E A;  4QZI A;  9ICT A;  5IIN A;  8ICH A;  1ZQJ A;  4UD4 A;  4KLM A;  5IIL A;  2O1P A;  4EBK A;  4QZA A;  8ICA A;  4F5R A;  5DB6 A;  4I2C A;  4X4Q A;  3JYY A;  1BPZ A;  1ZQY A;  4I2D A;  1TFW A;  8ICE A;  1ZQW A;  3MDA A;  4WC6 A;  9ICV A;  4KLO A;  4AT8 B;  3AU2 A;  1ZQZ A;  8ICN A;  4I2I A;  2BPC A;  5HRG A;  1TVA A;  1OU5 A;  3C2L A;  3OUY B;  1RPL A;  3RJJ A;  4LVS A;  3JZ0 A;  3ISC A;  7ICS A;  1MIW A;  4KLH A;  1XSL A;  3MBY A;  3WFO A;  5HRB A;  3RJE A;  4M9H A;  4O5K A;  1R8B A;  1MQ3 A;  4LZD A;  8ICI A;  2M2U A;  4YMM A;  4QZH A;  1ZJN A;  3C5G A;  4JWM A;  7ICU A;  4QZC A;  2ZH4 A;  4NM1 A;  9ICE A;  1ZQC A;  5HHI A;  8ICM A;  4FHV A;  1HUZ A;  2BCV A;  5IIK A;  7ICG A;  4KLE A;  3C2M A;  4NLK A;  9ICU A;  2BCS A;  3AQL A;  2DR5 A;  4Z6F A;  3PNC A;  4UAW A;  4IQU A;  4YMN A;  4PHA A;  2ZHB A;  1VFG A;  4YCX A;  5J2J A;  5J2I A;  7ICH A;  4FH5 A;  1V4A A;  4AT7 B;  4O9M A;  3B0X A;  4E8F A;  3HWT A;  5HRK A;  3JPP A;  1RZT A;  4KLQ A;  5CHG A;  3C5F A;  3UXP A;  4KLU A;  3OVA A;  4I27 A;  4GXK A;  1ZQL A;  4UB4 A;  3GDX A;  4R64 A;  1JQR A;  4RQ4 A;  7ICO A;  4TUR A;  4EBJ A;  3HX0 A;  1ZQO A;  4WC0 A;  5J2H A;  4IG8 A;  4X4S A;  4MFA A;  3HJ4 A;  1ZQR A;  3WFR E;  8ICJ A;  3RH6 A;  2DR8 A;  4I29 A;  4WC1 A;  9ICG A;  3L9D A;  1XSN A;  9ICX A;  3C18 A;  8ICK A;  8ICG A;  2ISP A;  8ICV A;  1UEV A;  4WBZ A;  2ISO A;  3UXN A;  5J0X A;  1ZQT A;  5HHH A;  9ICQ A;  4UB5 A;  2ZH7 A;  2P66 A;  1HUO A;  4YMO A;  4QZF A;  5D49 A;  8ICO A;  2O5A A;  1ZQN A;  4PPX A;  4MFF A;  4X4V A;  4NY8 A;  1R8C A;  4M5D A;  3WFQ E;  5DBB A;  5CA7 A;  3LQC B;  2DRA A;  4GXJ A;  1ZQX A;  4KLI A;  4IQT A;  1ZQE A;  4RT2 A;  5CP2 A;  3MDC A;  3HJ1 A;  4KLT A;  2BCR A;  2VAN A;  8ICU A;  4RPX A;  5DB9 A;  3B0Y A;  3JPS A;  5CWR A;  9ICR A;  8ICZ A;  4PHP A;  4KLG A;  4UBB A;  4UB3 A;  5IIJ A;  2PFQ A;  2DR7 A;  3AUO A;  2GWS A;  3MGI A;  1ZQU A;  7ICI A;  5CR0 A;  5J0R A;  3UPQ A;  2PXI A;  1KEJ A;  2BCU A;  8ICT A;  9ICK A;  5F2V O;  4K4G A;  4X0B A;  8ICY A;  3RJI A;  2PFP A;  8ICW A;  4QZD A;  5J2B A;  4WC2 A;  9ICF A;  2BCQ A;  4X4P A;  3OUY A;  4DO9 A;  4QZG A;  4M9J A;  9ICM A;  5HRL A;  3OV7 A;  8ICL A;  4FHP A;  2ZH2 A;  8ICQ A;  7ICN A;  1FA0 A;  2PFO A;  8ICR A;  2FMS A;  5J0P A;  3TFS A;  3V72 A; 
#chains in the Genus database with same CATH topology
 4WC5 A;  1XSP A;  7ICV A;  4QZ8 A;  4OAG A;  4FH3 A;  4UAZ A;  2I9G A;  4K4H A;  7ICM A;  5HRH A;  1ZQP A;  3JPO A;  4XUS A;  4RWP A;  4JWN A;  2M2T A;  3K7D A;  4R63 A;  3HIY A;  9ICO A;  9ICB A;  2BBJ A;  5TZV A;  4AT7 A;  4DOA A;  4WCW A;  4ATB B;  4PGY A;  3NWI A;  2DR9 A;  4TUS A;  3C66 A;  4DOB A;  4O5C A;  4KLL A;  2GAF D;  4FHX A;  4X4O A;  5J29 A;  5DB7 A;  1ZQQ A;  4FO1 A;  2GA9 D;  3H38 A;  7ICL A;  3UQ2 A;  5J0S A;  2HHP A;  3JPQ A;  3RH4 A;  1TV9 A;  4P4P A;  4X5V A;  2BPF A;  4FO6 A;  2FMP A;  4NM2 A;  4I2E A;  4PHE A;  1PX5 A;  1ZQV A;  4S3N A;  3AQN A;  4XRH A;  1BPX A;  3ISD A;  4YD1 A;  1JAJ A;  1GPJ A;  1Q79 A;  4I2B A;  5DEC A;  1ZQK A;  1BPB A;  8ICX A;  2BPG A;  4IQW A;  9ICW A;  3RJG A;  4MF8 A;  4EEB A;  9ICA A;  4LEW A;  2M2V A;  1JN3 A;  8ICF A;  4E80 A;  3LK9 A;  4MFC A;  5CFT A;  5J0O A;  4P4M A;  1ZQF A;  5D46 A;  4RQ3 A;  5HRI A;  5DBA A;  4XQ8 A;  1YLQ A;  4M9N A;  4AT9 B;  1ZQM A;  5J0T A;  4DOC A;  4RQ2 A;  9ICL A;  5DB8 A;  5J0Q A;  4P2H A;  3H3A A;  3AQK A;  4R66 A;  7ICE A;  7ICT A;  9ICH A;  4RWN A;  1BPD A;  9ICS A;  5J2C A;  4NXV A;  3UXO A;  2ZHA A;  4K97 A;  4RQ7 A;  4I2J A;  4QZE A;  3JPT A;  5BOM A;  4RWQ A;  4M9G A;  4FHW A;  4RQ8 A;  4RQ1 A;  2ZH6 A;  2IHM A;  2W9M A;  4PH5 A;  8ICP A;  5HC9 A;  5J0U A;  4UB2 A;  3RJF A;  3WFS C;  1MIV A;  4UBC A;  2FMQ A;  4NKT A;  4JLX A;  2RFF A;  4X0A A;  4K98 A;  4F5Q A;  2HN1 A;  4F5O A;  4TUP A;  3V7J A;  3OGU A;  5DED A;  8ICS A;  3RJH A;  2B4V A;  5J0W A;  5CJ7 A;  4X4N A;  4AT8 A;  9ICJ A;  4XA5 A;  1TFY A;  3JCF A;  2DRB A;  3WFP A;  4O5E A;  7ICK A;  4WC7 A;  1ZQH A;  4NLZ A;  3JPR A;  4F5P A;  4IQV A;  5CHE A;  4K9B A;  1KDH A;  1F5A A;  3RJK A;  3NKU A;  2NRK A;  3ER9 B;  4I2F A;  4YD2 A;  5HRE A;  4TUQ A;  4M9L A;  4QZB A;  3PHZ A;  5BOL A;  4M47 A;  3NYB A;  4RQ6 A;  4GXI A;  5DDY A;  5B3Q A;  4MF2 A;  4FHY A;  5CFU A;  4F5N A;  7ICQ A;  1R89 A;  1ZJM A;  3C2K A;  2ZH8 A;  3MGH A;  3OVS A;  7ICJ A;  9ICC A;  3H37 A;  4WC3 A;  4I28 A;  4RWO A;  1KNY A;  4I2A A;  1JMS A;  5HRD A;  2ZH1 A;  5CB1 A;  1BPY A;  2PFN A;  5J2G A;  4I2G A;  5J2F A;  5J2A A;  4I2H A;  1R8A A;  4KLJ A;  3NVO A;  4Z6D A;  4LZG A;  4R65 A;  1ZQD A;  4RPZ A;  2IUB A;  8ICB A;  4X4U A;  4PGX A;  3UQ0 A;  4KLF A;  7ICR A;  4M2Y A;  4X4R A;  4PGQ A;  4X4T A;  1MQ2 A;  4WQK A;  7ICF A;  2BE3 A;  3TFR A;  4K4I A;  4UD5 A;  4NKU A;  4ATB A;  5IIM A;  1ZQG A;  4KLD A;  9ICP A;  2ID1 A;  4WC4 A;  4M04 A;  3AU6 A;  4KB6 A;  4RPY A;  4XQ7 A;  4EP7 A;  4Z6C A;  5DKW A;  2PBE A;  1UEU A;  3V7L A;  4N7R A;  5IIO A;  1MIY A;  5III A;  4PHD A;  4QZ9 A;  4K99 A;  3OVB A;  1ZQA A;  2M2W A;  1VJ7 A;  4HX0 A;  4YN4 A;  4RQ5 A;  1BPE A;  4UB1 A;  5B3P A;  3AQM A;  2ZH9 A;  3PML A;  3PMN A;  5J0Y A;  5DDM A;  3JPN A;  2Q66 A;  5DBC A;  1Q78 A;  5D4B A;  4UAY A;  4OAH A;  5J2E A;  3RH5 A;  9ICI A;  5HRF A;  4KLS A;  1NOM A;  1ZQB A;  3V7K A;  4NXZ A;  5BPC A;  3ISB A;  4RQ0 A;  4AT9 A;  7ICP A;  4LT6 A;  4P4O A;  1ZQI A;  3CK6 A;  5EOZ A;  2ZH3 A;  4E7X A;  5HR9 A;  1UET A;  4WBY A;  3UPS A;  3H39 A;  4NLN A;  5J2K A;  4RT3 A;  1ZQS A;  3K75 D;  2ZH5 A;  9ICN A;  3HW8 A;  4O68 A;  5J2D A;  2DVI A;  8ICC A;  1WOT A;  4M0A A;  1NO5 A;  4Z6E A;  4QZI A;  9ICT A;  5IIN A;  4EV6 A;  8ICH A;  1ZQJ A;  4UD4 A;  4KLM A;  5IIL A;  2O1P A;  4EBK A;  4QZA A;  8ICA A;  4F5R A;  5DB6 A;  4I2C A;  4X4Q A;  3JYY A;  1BPZ A;  1ZQY A;  4I2D A;  1TFW A;  8ICE A;  1ZQW A;  3MDA A;  4WC6 A;  9ICV A;  3MCR A;  4KLO A;  4AT8 B;  3AU2 A;  1ZQZ A;  4O69 A;  8ICN A;  4I2I A;  4MKP A;  2BPC A;  5HRG A;  1TVA A;  1OU5 A;  2EWR A;  3C2L A;  3EF2 A;  4XJE A;  3OUY B;  1RPL A;  4WQL A;  3RJJ A;  4LVS A;  3JZ0 A;  3ISC A;  7ICS A;  1MIW A;  4KLH A;  1XSL A;  3MBY A;  3WFO A;  5HRB A;  3RJE A;  4M9H A;  4O5K A;  1R8B A;  1MQ3 A;  4LZD A;  8ICI A;  2M2U A;  4YMM A;  4QZH A;  1ZJN A;  3C5G A;  4O6A A;  4JWM A;  4QZC A;  7ICU A;  2ZH4 A;  4NM1 A;  9ICE A;  1ZQC A;  5HHI A;  4NXW A;  8ICM A;  4FHV A;  1HUZ A;  2BCV A;  5IIK A;  7ICG A;  4KLE A;  3C2M A;  4NLK A;  9ICU A;  2BCS A;  3AQL A;  2DR5 A;  4Z6F A;  3PNC A;  4NXU A;  4UAW A;  4IQU A;  4YMN A;  4EGW A;  4PHA A;  2ZHB A;  1VFG A;  4YCX A;  5J2J A;  5J2I A;  7ICH A;  4FH5 A;  1V4A A;  4AT7 B;  4O9M A;  3B0X A;  4E8F A;  3HWT A;  5HRK A;  3JPP A;  1RZT A;  4KLQ A;  5CHG A;  3C5F A;  3UXP A;  2B51 A;  4KLU A;  2FCL A;  3OVA A;  4K9A A;  4I27 A;  4GXK A;  2BBH A;  4I0U A;  1ZQL A;  4UB4 A;  3GDX A;  4R64 A;  4NXT A;  1JQR A;  3ER8 C;  4RQ4 A;  7ICO A;  4TUR A;  5D63 A;  4EBJ A;  3HX0 A;  1ZQO A;  4WC0 A;  5J2H A;  4IG8 A;  4X4S A;  4OAI Z;  4MFA A;  3HJ4 A;  1ZQR A;  3WFR E;  8ICJ A;  3RH6 A;  2DR8 A;  4I29 A;  4WC1 A;  9ICG A;  3L9D A;  1XSN A;  9ICX A;  3C18 A;  8ICK A;  8ICG A;  2ISP A;  8ICV A;  1UEV A;  4WBZ A;  2ISO A;  3UXN A;  5J0X A;  1ZQT A;  5HHH A;  9ICQ A;  4UB5 A;  2ZH7 A;  2P66 A;  4K8V A;  1HUO A;  4YMO A;  4KM5 A;  4EED A;  4QZF A;  5D49 A;  8ICO A;  2O5A A;  4NXX A;  1ZQN A;  4PPX A;  4LEY A;  4MFF A;  4X4V A;  2IHO A;  4NY8 A;  1R8C A;  4OAF A;  4M5D A;  2B56 A;  3WFQ E;  5DBB A;  5CA7 A;  3LQC B;  4JLZ A;  2DRA A;  4GXJ A;  1ZQX A;  4KLI A;  4IQT A;  1ZQE A;  4RT2 A;  4LEV A;  5CP2 A;  3MDC A;  3HJ1 A;  4KLT A;  4K96 A;  2BCR A;  2VAN A;  8ICU A;  4RPX A;  5DB9 A;  3B0Y A;  3JPS A;  5CWR A;  9ICR A;  8ICZ A;  4PHP A;  4LEZ A;  4KLG A;  4UBB A;  4UB3 A;  4WH5 A;  5IIJ A;  2PFQ A;  2DR7 A;  4O67 A;  3AUO A;  2GWS A;  3MGI A;  1ZQU A;  7ICI A;  5CR0 A;  5J0R A;  3UPQ A;  2PXI A;  5D61 A;  1KEJ A;  2BCU A;  8ICT A;  9ICK A;  5F2V O;  4K4G A;  4X0B A;  8ICY A;  3RJI A;  2PFP A;  8ICW A;  4QZD A;  5J2B A;  4WC2 A;  9ICF A;  2BCQ A;  4X4P A;  3OUY A;  4DO9 A;  3ERC C;  4QZG A;  4M9J A;  9ICM A;  5HRL A;  3OV7 A;  8ICL A;  4FHP A;  2ZH2 A;  8ICQ A;  4WOY A;  2HN2 A;  7ICN A;  5CFS A;  5JTG A;  3OWG A;  1FA0 A;  5D62 A;  2PFO A;  8ICR A;  2FMS A;  5J0P A;  3TFS A;  3V72 A; 
#chains in the Genus database with same CATH homology
 4WC5 A;  1XSP A;  7ICV A;  4QZ8 A;  4FH3 A;  4UAZ A;  2I9G A;  4K4H A;  7ICM A;  5HRH A;  1ZQP A;  3JPO A;  4XUS A;  4RWP A;  4JWN A;  2M2T A;  9ICO A;  4R63 A;  3HIY A;  9ICB A;  5TZV A;  4AT7 A;  4DOA A;  4WCW A;  4ATB B;  4PGY A;  2DR9 A;  4TUS A;  3C66 A;  4DOB A;  4O5C A;  4KLL A;  4FHX A;  4X4O A;  5J29 A;  5DB7 A;  1ZQQ A;  3H38 A;  7ICL A;  3UQ2 A;  5J0S A;  2HHP A;  3JPQ A;  3RH4 A;  1TV9 A;  4P4P A;  4X5V A;  2BPF A;  4FO6 A;  2FMP A;  4NM2 A;  4I2E A;  4PHE A;  1PX5 A;  1ZQV A;  4XRH A;  3AQN A;  4S3N A;  1BPX A;  3ISD A;  4YD1 A;  1JAJ A;  1Q79 A;  4I2B A;  5DEC A;  1ZQK A;  1BPB A;  8ICX A;  2BPG A;  4IQW A;  9ICW A;  3RJG A;  4MF8 A;  9ICA A;  2M2V A;  1JN3 A;  8ICF A;  4E80 A;  3LK9 A;  4MFC A;  5J0O A;  4P4M A;  1ZQF A;  5D46 A;  4RQ3 A;  5HRI A;  5DBA A;  4XQ8 A;  1YLQ A;  4M9N A;  4AT9 B;  1ZQM A;  5J0T A;  4DOC A;  4RQ2 A;  9ICL A;  5DB8 A;  5J0Q A;  4P2H A;  3H3A A;  3AQK A;  4R66 A;  7ICE A;  7ICT A;  9ICH A;  4RWN A;  1BPD A;  9ICS A;  5J2C A;  3UXO A;  2ZHA A;  4RQ7 A;  4I2J A;  3JPT A;  4QZE A;  5BOM A;  4RWQ A;  4M9G A;  4FHW A;  4RQ8 A;  4RQ1 A;  2ZH6 A;  2IHM A;  2W9M A;  4PH5 A;  8ICP A;  5HC9 A;  5J0U A;  4UB2 A;  3RJF A;  3WFS C;  1MIV A;  4UBC A;  2FMQ A;  4NKT A;  2RFF A;  4X0A A;  4F5Q A;  4F5O A;  4TUP A;  3V7J A;  3OGU A;  5DED A;  8ICS A;  3RJH A;  5J0W A;  5CJ7 A;  4X4N A;  4AT8 A;  9ICJ A;  4XA5 A;  1TFY A;  2DRB A;  3WFP A;  4O5E A;  7ICK A;  4WC7 A;  1ZQH A;  4NLZ A;  3JPR A;  4F5P A;  4IQV A;  1KDH A;  1F5A A;  3RJK A;  2NRK A;  4I2F A;  4YD2 A;  5HRE A;  4TUQ A;  4M9L A;  4QZB A;  5BOL A;  4M47 A;  3NYB A;  4RQ6 A;  4GXI A;  5DDY A;  4MF2 A;  4FHY A;  4F5N A;  7ICQ A;  1R89 A;  1ZJM A;  3C2K A;  2ZH8 A;  3MGH A;  3OVS A;  7ICJ A;  9ICC A;  3H37 A;  4WC3 A;  4I28 A;  4RWO A;  1KNY A;  4I2A A;  1JMS A;  5HRD A;  2ZH1 A;  5CB1 A;  1BPY A;  2PFN A;  5J2G A;  4I2G A;  5J2F A;  5J2A A;  4I2H A;  1R8A A;  4KLJ A;  4Z6D A;  4LZG A;  4R65 A;  1ZQD A;  4RPZ A;  8ICB A;  4X4U A;  4PGX A;  3UQ0 A;  4KLF A;  7ICR A;  4M2Y A;  4X4R A;  4PGQ A;  4X4T A;  1MQ2 A;  7ICF A;  2BE3 A;  3TFR A;  4K4I A;  4UD5 A;  4NKU A;  4ATB A;  5IIM A;  1ZQG A;  4KLD A;  9ICP A;  2ID1 A;  4WC4 A;  4M04 A;  3AU6 A;  4RPY A;  4XQ7 A;  4EP7 A;  4Z6C A;  5DKW A;  2PBE A;  1UEU A;  3V7L A;  5IIO A;  1MIY A;  5III A;  4PHD A;  4QZ9 A;  3OVB A;  1ZQA A;  2M2W A;  1VJ7 A;  4YN4 A;  4RQ5 A;  1BPE A;  4UB1 A;  3AQM A;  2ZH9 A;  3PML A;  3PMN A;  5J0Y A;  5DDM A;  3JPN A;  2Q66 A;  5DBC A;  1Q78 A;  5D4B A;  4UAY A;  5J2E A;  3RH5 A;  9ICI A;  5HRF A;  4KLS A;  1NOM A;  1ZQB A;  3V7K A;  4NXZ A;  5BPC A;  3ISB A;  4RQ0 A;  4AT9 A;  7ICP A;  4LT6 A;  4P4O A;  1ZQI A;  5EOZ A;  2ZH3 A;  4E7X A;  1UET A;  4WBY A;  5HR9 A;  3UPS A;  3H39 A;  4NLN A;  5J2K A;  4RT3 A;  1ZQS A;  3K75 D;  2ZH5 A;  9ICN A;  3HW8 A;  5J2D A;  2DVI A;  8ICC A;  1WOT A;  4M0A A;  1NO5 A;  4Z6E A;  4QZI A;  9ICT A;  5IIN A;  8ICH A;  1ZQJ A;  4UD4 A;  4KLM A;  5IIL A;  2O1P A;  4EBK A;  4QZA A;  8ICA A;  4F5R A;  5DB6 A;  4I2C A;  4X4Q A;  3JYY A;  1BPZ A;  1ZQY A;  4I2D A;  1TFW A;  8ICE A;  1ZQW A;  3MDA A;  4WC6 A;  9ICV A;  4KLO A;  4AT8 B;  3AU2 A;  1ZQZ A;  8ICN A;  4I2I A;  2BPC A;  5HRG A;  1TVA A;  1OU5 A;  3C2L A;  3OUY B;  1RPL A;  3RJJ A;  4LVS A;  3JZ0 A;  3ISC A;  7ICS A;  1MIW A;  4KLH A;  1XSL A;  3MBY A;  3WFO A;  5HRB A;  3RJE A;  4M9H A;  4O5K A;  1R8B A;  1MQ3 A;  4LZD A;  8ICI A;  2M2U A;  4YMM A;  4QZH A;  1ZJN A;  3C5G A;  4JWM A;  7ICU A;  4QZC A;  2ZH4 A;  4NM1 A;  9ICE A;  1ZQC A;  5HHI A;  8ICM A;  4FHV A;  1HUZ A;  2BCV A;  5IIK A;  7ICG A;  4KLE A;  3C2M A;  4NLK A;  9ICU A;  2BCS A;  3AQL A;  2DR5 A;  4Z6F A;  3PNC A;  4UAW A;  4IQU A;  4YMN A;  4PHA A;  2ZHB A;  1VFG A;  4YCX A;  5J2J A;  5J2I A;  7ICH A;  4FH5 A;  1V4A A;  4AT7 B;  4O9M A;  3B0X A;  4E8F A;  3HWT A;  5HRK A;  3JPP A;  1RZT A;  4KLQ A;  5CHG A;  3C5F A;  3UXP A;  4KLU A;  3OVA A;  4I27 A;  4GXK A;  1ZQL A;  4UB4 A;  3GDX A;  4R64 A;  1JQR A;  4RQ4 A;  7ICO A;  4TUR A;  4EBJ A;  3HX0 A;  1ZQO A;  4WC0 A;  5J2H A;  4IG8 A;  4X4S A;  4MFA A;  3HJ4 A;  1ZQR A;  3WFR E;  8ICJ A;  3RH6 A;  2DR8 A;  4I29 A;  4WC1 A;  9ICG A;  3L9D A;  1XSN A;  9ICX A;  3C18 A;  8ICK A;  8ICG A;  2ISP A;  8ICV A;  1UEV A;  4WBZ A;  2ISO A;  3UXN A;  5J0X A;  1ZQT A;  5HHH A;  9ICQ A;  4UB5 A;  2ZH7 A;  2P66 A;  1HUO A;  4YMO A;  4QZF A;  5D49 A;  8ICO A;  2O5A A;  1ZQN A;  4PPX A;  4MFF A;  4X4V A;  4NY8 A;  1R8C A;  4M5D A;  3WFQ E;  5DBB A;  5CA7 A;  3LQC B;  2DRA A;  4GXJ A;  1ZQX A;  4KLI A;  4IQT A;  1ZQE A;  4RT2 A;  5CP2 A;  3MDC A;  3HJ1 A;  4KLT A;  2BCR A;  2VAN A;  8ICU A;  4RPX A;  5DB9 A;  3B0Y A;  3JPS A;  5CWR A;  9ICR A;  8ICZ A;  4PHP A;  4KLG A;  4UBB A;  4UB3 A;  5IIJ A;  2PFQ A;  2DR7 A;  3AUO A;  2GWS A;  3MGI A;  1ZQU A;  7ICI A;  5CR0 A;  5J0R A;  3UPQ A;  2PXI A;  1KEJ A;  2BCU A;  8ICT A;  9ICK A;  5F2V O;  4K4G A;  4X0B A;  8ICY A;  3RJI A;  2PFP A;  8ICW A;  4QZD A;  5J2B A;  4WC2 A;  9ICF A;  2BCQ A;  4X4P A;  3OUY A;  4DO9 A;  4QZG A;  4M9J A;  9ICM A;  5HRL A;  3OV7 A;  8ICL A;  4FHP A;  2ZH2 A;  8ICQ A;  7ICN A;  1FA0 A;  2PFO A;  8ICR A;  2FMS A;  5J0P A;  3TFS A;  3V72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...