4NXVA

Crystal structure of the cytosolic domain of human mid51
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
331
structure length
330
Chain Sequence
RMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 330
sequence length 331
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxvA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxvA02
4NXUA 4K8VA 4K97A 4AT7A 4WOYA 4K99A 4ATBB 4K98A 4OAIZ 4O67A 4AT9A 4JLZA 4LEWA 4OAHA 4AT8A 4NXVA 4LEVA 4OAFA 4OAGA 4LEYA 4KM5A 4AT7B 4O68A 4NXWA 4NXTA 4ATBA 4LEZA 4JLXA 4O69A 4AT9B 4NXXA 4AT8B 4K96A 4K9BA 4MKPA 4KB6A 4O6AA 4K9AA
chains in the Genus database with same CATH superfamily
8ICLA 4K97A 9ICOA 4QZAA 5DBCA 5BOMA 5JTGA 4YD2A 3H39A 2PBEA 5J0XA 8ICCA 3C18A 1ZQYA 9ICMA 3OVAA 3ERCC 2B56A 3K75D 4FH5A 4MFAA 4Z6CA 4KLEA 2FMSA 4O5EA 8ICIA 9ICJA 5CWRA 4LZDA 9ICAA 4RWPA 4UB5A 3JPTA 7ICFA 4K9AA 1BPDA 7ICMA 1BPXA 4WC6A 4IQTA 4WQLA 4I2IA 5DECA 1ZJMA 8ICGA 1ZQJA 4S3NA 4KLHA 4JLZA 1ZQNA 1R89A 4EV6A 1ZQQA 1FA0A 5HRBA 5J0QA 4KLFA 5HRFA 5J2GA 2ZH4A 5CFSA 8ICSA 3AQLA 4F5PA 3JPNA 1BPEA 5CB1A 5B3QA 4RQ7A 5IINA 4QZDA 1MIVA 5TZVA 1XSNA 1ZQRA 3RJGA 4XQ8A 8ICYA 4FO6A 4WOYA 9ICXA 2ZH9A 3RJJA 9ICBA 4X4RA 4QZHA 2BPGA 9ICVA 4YCXA 4UB4A 7ICOA 3WFPA 3AU2A 1WOTA 2FMQA 4YN4A 1VFGA 1MIWA 1ZQAA 4M04A 2ZH3A 5IIOA 5J2IA 4NXTA 5D63A 5BOLA 7ICTA 7ICIA 5CFUA 4RT3A 4RT2A 5DKWA 5HRIA 3NVOA 3HJ1A 4AT9B 4YD1A 2FMPA 8ICFA 4M9JA 4M9HA 7ICEA 1UEUA 2BCUA 4JWMA 3B0XA 4NLKA 4OAIZ 1MQ2A 3JPRA 4KLDA 4X4TA 1JMSA 1JQRA 4OAGA 5J2KA 4KLIA 4YMNA 7ICPA 3V72A 3C66A 4LZGA 2ZH2A 4ATBA 4KLMA 5DDMA 4UAYA 1R8BA 2ISPA 4UAZA 5CFTA 3UXOA 4WC3A 3RJIA 9ICQA 3OWGA 2DRAA 4R64A 4NXUA 4XUSA 4TUPA 8ICZA 1HUZA 3RH6A 2ZH5A 7ICSA 5J2DA 4RWQA 5J2BA 4DO9A 1ZQTA 8ICMA 4NXVA 8ICVA 3C2MA 5HRGA 1UEVA 4WH5A 2BCRA 4IQWA 4EEBA 4QZEA 3AQNA 7ICNA 3ISDA 8ICUA 1BPZA 2BCVA 4I0UA 4MF2A 3EF2A 5DB7A 1VJ7A 1ZQLA 5CR0A 4E8FA 4P2HA 4WC5A 4EBKA 7ICLA 5HRHA 4WBYA 1ZQFA 2BCSA 3OV7A 5J0UA 3RH5A 3PMNA 1KNYA 1BPBA 1GPJA 4X5VA 4RPYA 2BCQA 3C2KA 8ICRA 4GXIA 9ICWA 2DR8A 3H3AA 5HRDA 3ER9B 5DBAA 4E7XA 2HN1A 5D49A 3JPQA 4YMMA 3MDAA 4X4PA 3AQMA 4FHPA 4P4MA 4MKPA 4FHXA 4WBZA 5HC9A 3OUYA 1BPYA 4K8VA 5DEDA 4EBJA 3HW8A 3MGIA 3AU6A 5B3PA 8ICWA 1RPLA 4KLGA 4IQVA 4ATBB 5DB6A 9ICPA 4FO1A 3JZ0A 4M9GA 4RQ1A 5DDYA 4Z6DA 2PFPA 1TFWA 5J0SA 1NO5A 1V4AA 4GXJA 4PHPA 8ICEA 3C2LA 4UD5A 4JWNA 5J0RA 5J0WA 4UBBA 1XSLA 1ZQBA 4PPXA 2HN2A 5J29A 3PNCA 3K7DA 4TUSA 3NKUA 5F2VO 4O6AA 4NLZA 4RQ2A 1ZJNA 2W9MA 2DVIA 3HWTA 1RZTA 3RJFA 1XSPA 2IHMA 5HRKA 5J2HA 2M2TA 4RPXA 3JCFA 5J2JA 4M0AA 4F5RA 4EGWA 4I2AA 3B0YA 4NXWA 4WC2A 3OGUA 5HRLA 7ICUA 2ZH1A 4P4OA 5CA7A 3TFRA 4I2GA 4M9LA 3TFSA 4KLUA 3MDCA 9ICKA 1ZQMA 1F5AA 3LQCB 4RQ6A 4LT6A 9ICIA 4HX0A 4QZCA 3GDXA 4FH3A 4Z6EA 4I28A 8ICBA 4O5KA 4TUQA 5DB9A 2PXIA 3UQ0A 4K4HA 4RQ4A 4KLSA 8ICTA 5IIIA 1MQ3A 5BPCA 4NKUA 3NYBA 1ZQSA 4M9NA 7ICHA 4I2DA 4RQ5A 4DOBA 4E80A 4UAWA 2ZH7A 9ICGA 4XJEA 4M47A 4TURA 3V7LA 4QZ8A 5J0YA 7ICQA 3JPSA 9ICCA 3HJ4A 5IILA 3RH4A 4RWOA 3NWIA 5D4BA 5J0PA 3JPPA 4EEDA 4X4SA 2DR5A 5HHHA 4R65A 3WFRE 2ID1A 4RPZA 4OAFA 5CP2A 4O68A 5HR9A 1OU5A 4X4VA 4R63A 2DR7A 1ZQOA 4LVSA 4PHAA 2ZH6A 4N7RA 5J0OA 4NM2A 3C5FA 1KEJA 4PGXA 4NXZA 2ISOA 3JYYA 3V7KA 3WFOA 9ICNA 4X4UA 3UPQA 4O67A 4PGQA 3HX0A 1ZQPA 1ZQXA 4I2FA 3AUOA 4WC1A 7ICKA 4UB3A 1YLQA 4P4PA 2GWSA 2B51A 4X0BA 1ZQCA 4PH5A 2M2UA 4I27A 8ICKA 7ICVA 4NXXA 4X0AA 4XQ7A 4M2YA 4QZGA 3AQKA 2M2WA 4UD4A 8ICJA 1JAJA 4AT7A 3UPSA 3LK9A 1ZQWA 9ICRA 9ICEA 2EWRA 3WFQE 7ICJA 4AT9A 4EP7A 4XA5A 4OAHA 1ZQEA 5CHEA 1TFYA 2FCLA 3V7JA 5D61A 2VANA 2M2VA 1R8AA 2BE3A 4I2CA 5D46A 4UBCA 1UETA 4PHDA 8ICQA 5J2CA 2RFFA 4GXKA 4X4QA 4LEZA 1HUOA 5HREA 4Z6FA 3ISCA 1ZQGA 1NOMA 3C5GA 4NLNA 4I2BA 3RJHA 4UB1A 4K99A 2NRKA 4MF8A 5EOZA 4LEWA 3H37A 2B4VA 4QZFA 1ZQKA 4RQ3A 2IUBA 3RJEA 3JPOA 3L9DA 2O5AA 1ZQUA 3OVSA 4PGYA 4KLOA 2PFOA 4X4NA 4O69A 9ICHA 1ZQHA 4WC0A 3PMLA 2BPFA 3ISBA 3UXPA 4KLJA 1JN3A 4KB6A 4I2JA 5D62A 2GAFD 5J0TA 4DOCA 7ICGA 3UQ2A 4YMOA 4NY8A 2P66A 4KLQA 3MGHA 4RWNA 2I9GA 9ICLA 4UB2A 4K98A 2DR9A 1ZQZA 2ZH8A 4MFFA 4AT8A 3UXNA 5J2FA 4LEYA 5J2EA 2PFNA 3OUYB 4PHEA 4I29A 2DRBA 4FHVA 2BBHA 4AT7B 4WC7A 4QZ9A 1ZQDA 2O1PA 4K4IA 5DB8A 8ICHA 5CJ7A 3HIYA 3RJKA 8ICOA 4F5OA 3PHZA 2BBJA 4K9BA 4WCWA 5HHIA 4NM1A 2BPCA 1R8CA 5IIMA 2Q66A 4M5DA 4KLTA 4QZIA 4WQKA 4R66A 4FHWA 4KLLA 4X4OA 5DBBA 3CK6A 9ICUA 4DOAA 4LEVA 2PFQA 1MIYA 1ZQIA 5IIJA 2IHOA 4KM5A 2ZHBA 4WC4A 4O5CA 4RQ8A 4F5QA 3MBYA 1ZQVA 7ICRA 2ZHAA 8ICXA 4JLXA 5J2AA 9ICTA 8ICPA 4K4GA 1PX5A 3H38A 9ICSA 4XRHA 4FHYA 4QZBA 4IG8A 1TVAA 8ICAA 8ICNA 4F5NA 4RQ0A 1Q78A 3MCRA 5CHGA 3WFSC 4O9MA 4IQUA 5IIKA 1TV9A 4MFCA 9ICFA 1Q79A 3ER8C 2GA9D 1KDHA 3OVBA 2HHPA 4I2HA 4AT8B 4K96A 4NKTA 4I2EA
chains in the Genus database with same CATH topology
4NXUA 4K97A 1F5AA 4LT6A 4K99A 4HX0A 4FH3A 2ZH5A 4LEWA 4NXVA 3OVAA 3ERCC 2B56A 1UEVA 4WH5A 2B4VA 4FH5A 4NKUA 3OVSA 3NYBA 4X4NA 4O69A 4E80A 3EF2A 2ZH7A 4KB6A 4XJEA 4E8FA 4K9AA 5D62A 2GAFD 3HJ4A 4WQLA 4K98A 3OV7A 2DR9A 2ZH8A 1GPJA 4JLZA 1R89A 4AT8A 4X4SA 2DR5A 1FA0A 2DR8A 4OAFA 3ER9B 4LEYA 3OUYB 2DRBA 4FHVA 2ZH4A 5CFSA 4AT7B 4O68A 4E7XA 2O1PA 5B3QA 4X4VA 2DR7A 4X4PA 3HIYA 4FHPA 3PHZA 2ZH6A 4K9BA 4MKPA 4FHXA 4N7RA 3OUYA 4K8VA 1R8CA 2Q66A 4M5DA 5B3PA 4WOYA 4WQKA 4FHWA 2ZH9A 4ATBB 4X4UA 4X4RA 4X4OA 4FO1A 4O67A 4LEVA 2B51A 1TFWA 4KM5A 2IHOA 2ZHBA 2ZH3A 4NXTA 5D63A 5CFUA 4UD5A 2ZHAA 4JLXA 3HJ1A 4AT9B 4NXXA 3K7DA 3NKUA 4O6AA 4UD4A 1UEUA 4AT7A 4FHYA 2DVIA 2EWRA 4OAIZ 4AT9A 4EP7A 4OAHA 1Q78A 4X4TA 3MCRA 5CHEA 1TFYA 2FCLA 5D61A 4OAGA 1R8AA 1UETA 4NXWA 3C66A 1Q79A 3ER8C 4X4QA 2ZH1A 2ZH2A 4ATBA 2GA9D 4LEZA 1R8BA 3OVBA 2HHPA 4AT8B 4K96A 4NKTA 5CFTA 3OWGA 2DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXU A;  4K8V A;  4K97 A;  4AT7 A;  4WOY A;  4K99 A;  4ATB B;  4K98 A;  4OAI Z;  4O67 A;  4AT9 A;  4JLZ A;  4LEW A;  4OAH A;  4AT8 A;  4NXV A;  4LEV A;  4OAF A;  4OAG A;  4LEY A;  4KM5 A;  4AT7 B;  4O68 A;  4NXW A;  4NXT A;  4ATB A;  4LEZ A;  4JLX A;  4O69 A;  4AT9 B;  4NXX A;  4AT8 B;  4K96 A;  4K9B A;  4MKP A;  4KB6 A;  4O6A A;  4K9A A; 
#chains in the Genus database with same CATH topology
 8ICL A;  4K97 A;  9ICO A;  4QZA A;  5DBC A;  5BOM A;  5JTG A;  4YD2 A;  3H39 A;  2PBE A;  5J0X A;  8ICC A;  3C18 A;  1ZQY A;  9ICM A;  3OVA A;  3ERC C;  2B56 A;  3K75 D;  4FH5 A;  4MFA A;  4Z6C A;  4KLE A;  2FMS A;  4O5E A;  8ICI A;  9ICJ A;  5CWR A;  4LZD A;  9ICA A;  4RWP A;  4UB5 A;  3JPT A;  7ICF A;  4K9A A;  1BPD A;  7ICM A;  1BPX A;  4WC6 A;  4IQT A;  4WQL A;  4I2I A;  5DEC A;  1ZJM A;  8ICG A;  1ZQJ A;  4S3N A;  4KLH A;  4JLZ A;  1ZQN A;  1R89 A;  4EV6 A;  1ZQQ A;  1FA0 A;  5HRB A;  5J0Q A;  4KLF A;  5HRF A;  5J2G A;  2ZH4 A;  5CFS A;  8ICS A;  3AQL A;  4F5P A;  3JPN A;  1BPE A;  5CB1 A;  5B3Q A;  4RQ7 A;  5IIN A;  4QZD A;  1MIV A;  5TZV A;  1XSN A;  1ZQR A;  3RJG A;  4XQ8 A;  8ICY A;  4FO6 A;  4WOY A;  9ICX A;  2ZH9 A;  3RJJ A;  9ICB A;  4X4R A;  4QZH A;  2BPG A;  9ICV A;  4YCX A;  4UB4 A;  7ICO A;  3WFP A;  3AU2 A;  1WOT A;  2FMQ A;  4YN4 A;  1VFG A;  1MIW A;  1ZQA A;  4M04 A;  2ZH3 A;  5IIO A;  5J2I A;  4NXT A;  5D63 A;  5BOL A;  7ICT A;  7ICI A;  5CFU A;  4RT3 A;  4RT2 A;  5DKW A;  5HRI A;  3NVO A;  3HJ1 A;  4AT9 B;  4YD1 A;  2FMP A;  8ICF A;  4M9J A;  4M9H A;  7ICE A;  1UEU A;  2BCU A;  4JWM A;  3B0X A;  4NLK A;  4OAI Z;  1MQ2 A;  3JPR A;  4KLD A;  4X4T A;  1JMS A;  1JQR A;  4OAG A;  5J2K A;  4KLI A;  4YMN A;  7ICP A;  3V72 A;  3C66 A;  4LZG A;  2ZH2 A;  4ATB A;  4KLM A;  5DDM A;  4UAY A;  1R8B A;  2ISP A;  4UAZ A;  5CFT A;  3UXO A;  4WC3 A;  3RJI A;  9ICQ A;  3OWG A;  2DRA A;  4R64 A;  4NXU A;  4XUS A;  4TUP A;  8ICZ A;  1HUZ A;  3RH6 A;  2ZH5 A;  7ICS A;  5J2D A;  4RWQ A;  5J2B A;  4DO9 A;  1ZQT A;  8ICM A;  4NXV A;  8ICV A;  3C2M A;  5HRG A;  1UEV A;  4WH5 A;  2BCR A;  4IQW A;  4EEB A;  4QZE A;  3AQN A;  7ICN A;  3ISD A;  8ICU A;  1BPZ A;  2BCV A;  4I0U A;  4MF2 A;  3EF2 A;  5DB7 A;  1VJ7 A;  1ZQL A;  5CR0 A;  4E8F A;  4P2H A;  4WC5 A;  4EBK A;  7ICL A;  5HRH A;  4WBY A;  1ZQF A;  2BCS A;  3OV7 A;  5J0U A;  3RH5 A;  3PMN A;  1KNY A;  1BPB A;  1GPJ A;  4X5V A;  4RPY A;  2BCQ A;  3C2K A;  8ICR A;  4GXI A;  9ICW A;  2DR8 A;  3H3A A;  5HRD A;  3ER9 B;  5DBA A;  4E7X A;  2HN1 A;  5D49 A;  3JPQ A;  4YMM A;  3MDA A;  4X4P A;  3AQM A;  4FHP A;  4P4M A;  4MKP A;  4FHX A;  4WBZ A;  5HC9 A;  3OUY A;  1BPY A;  4K8V A;  5DED A;  4EBJ A;  3HW8 A;  3MGI A;  3AU6 A;  5B3P A;  8ICW A;  1RPL A;  4KLG A;  4IQV A;  4ATB B;  5DB6 A;  9ICP A;  4FO1 A;  3JZ0 A;  4M9G A;  4RQ1 A;  5DDY A;  4Z6D A;  2PFP A;  1TFW A;  5J0S A;  1NO5 A;  1V4A A;  4GXJ A;  4PHP A;  8ICE A;  3C2L A;  4UD5 A;  4JWN A;  5J0R A;  5J0W A;  4UBB A;  1XSL A;  1ZQB A;  4PPX A;  2HN2 A;  5J29 A;  3PNC A;  3K7D A;  4TUS A;  3NKU A;  5F2V O;  4O6A A;  4NLZ A;  4RQ2 A;  1ZJN A;  2W9M A;  2DVI A;  3HWT A;  1RZT A;  3RJF A;  1XSP A;  2IHM A;  5HRK A;  5J2H A;  2M2T A;  4RPX A;  3JCF A;  5J2J A;  4M0A A;  4F5R A;  4EGW A;  4I2A A;  3B0Y A;  4NXW A;  4WC2 A;  3OGU A;  5HRL A;  7ICU A;  2ZH1 A;  4P4O A;  5CA7 A;  3TFR A;  4I2G A;  4M9L A;  3TFS A;  4KLU A;  3MDC A;  9ICK A;  1ZQM A;  1F5A A;  3LQC B;  4RQ6 A;  4LT6 A;  9ICI A;  4HX0 A;  4QZC A;  3GDX A;  4FH3 A;  4Z6E A;  4I28 A;  8ICB A;  4O5K A;  4TUQ A;  5DB9 A;  2PXI A;  3UQ0 A;  4K4H A;  4RQ4 A;  4KLS A;  8ICT A;  5III A;  1MQ3 A;  5BPC A;  4NKU A;  3NYB A;  1ZQS A;  4M9N A;  7ICH A;  4I2D A;  4RQ5 A;  4DOB A;  4E80 A;  4UAW A;  2ZH7 A;  9ICG A;  4XJE A;  4M47 A;  4TUR A;  3V7L A;  4QZ8 A;  5J0Y A;  7ICQ A;  3JPS A;  9ICC A;  3HJ4 A;  5IIL A;  3RH4 A;  4RWO A;  3NWI A;  5D4B A;  5J0P A;  3JPP A;  4EED A;  4X4S A;  2DR5 A;  5HHH A;  4R65 A;  3WFR E;  2ID1 A;  4RPZ A;  4OAF A;  5CP2 A;  4O68 A;  5HR9 A;  1OU5 A;  4X4V A;  4R63 A;  2DR7 A;  1ZQO A;  4LVS A;  4PHA A;  2ZH6 A;  4N7R A;  5J0O A;  4NM2 A;  3C5F A;  1KEJ A;  4PGX A;  4NXZ A;  2ISO A;  3JYY A;  3V7K A;  3WFO A;  9ICN A;  4X4U A;  3UPQ A;  4O67 A;  4PGQ A;  3HX0 A;  1ZQP A;  1ZQX A;  4I2F A;  3AUO A;  4WC1 A;  7ICK A;  4UB3 A;  1YLQ A;  4P4P A;  2GWS A;  2B51 A;  4X0B A;  1ZQC A;  4PH5 A;  2M2U A;  4I27 A;  8ICK A;  7ICV A;  4NXX A;  4X0A A;  4XQ7 A;  4M2Y A;  4QZG A;  3AQK A;  2M2W A;  4UD4 A;  8ICJ A;  1JAJ A;  4AT7 A;  3UPS A;  3LK9 A;  1ZQW A;  9ICR A;  9ICE A;  2EWR A;  3WFQ E;  7ICJ A;  4AT9 A;  4EP7 A;  4XA5 A;  4OAH A;  1ZQE A;  5CHE A;  1TFY A;  2FCL A;  3V7J A;  5D61 A;  2VAN A;  2M2V A;  1R8A A;  2BE3 A;  4I2C A;  5D46 A;  4UBC A;  1UET A;  4PHD A;  8ICQ A;  5J2C A;  2RFF A;  4GXK A;  4X4Q A;  4LEZ A;  1HUO A;  5HRE A;  4Z6F A;  3ISC A;  1ZQG A;  1NOM A;  3C5G A;  4NLN A;  4I2B A;  3RJH A;  4UB1 A;  4K99 A;  2NRK A;  4MF8 A;  5EOZ A;  4LEW A;  3H37 A;  2B4V A;  4QZF A;  1ZQK A;  4RQ3 A;  2IUB A;  3RJE A;  3JPO A;  3L9D A;  2O5A A;  1ZQU A;  3OVS A;  4PGY A;  4KLO A;  2PFO A;  4X4N A;  4O69 A;  9ICH A;  1ZQH A;  4WC0 A;  3PML A;  2BPF A;  3ISB A;  3UXP A;  4KLJ A;  1JN3 A;  4KB6 A;  4I2J A;  5D62 A;  2GAF D;  5J0T A;  4DOC A;  7ICG A;  3UQ2 A;  4YMO A;  4NY8 A;  2P66 A;  4KLQ A;  3MGH A;  4RWN A;  2I9G A;  9ICL A;  4UB2 A;  4K98 A;  2DR9 A;  1ZQZ A;  2ZH8 A;  4MFF A;  4AT8 A;  3UXN A;  5J2F A;  4LEY A;  5J2E A;  2PFN A;  3OUY B;  4PHE A;  4I29 A;  2DRB A;  4FHV A;  2BBH A;  4AT7 B;  4WC7 A;  4QZ9 A;  1ZQD A;  2O1P A;  4K4I A;  5DB8 A;  8ICH A;  5CJ7 A;  3HIY A;  3RJK A;  8ICO A;  4F5O A;  3PHZ A;  2BBJ A;  4K9B A;  4WCW A;  5HHI A;  4NM1 A;  2BPC A;  1R8C A;  5IIM A;  2Q66 A;  4M5D A;  4KLT A;  4QZI A;  4WQK A;  4R66 A;  4FHW A;  4KLL A;  4X4O A;  5DBB A;  3CK6 A;  9ICU A;  4DOA A;  4LEV A;  2PFQ A;  1MIY A;  1ZQI A;  5IIJ A;  2IHO A;  4KM5 A;  2ZHB A;  4WC4 A;  4O5C A;  4RQ8 A;  4F5Q A;  3MBY A;  1ZQV A;  7ICR A;  2ZHA A;  8ICX A;  4JLX A;  5J2A A;  9ICT A;  8ICP A;  4K4G A;  1PX5 A;  3H38 A;  9ICS A;  4XRH A;  4FHY A;  4QZB A;  4IG8 A;  1TVA A;  8ICA A;  8ICN A;  4F5N A;  4RQ0 A;  1Q78 A;  3MCR A;  5CHG A;  3WFS C;  4O9M A;  4IQU A;  5IIK A;  1TV9 A;  4MFC A;  9ICF A;  1Q79 A;  3ER8 C;  2GA9 D;  1KDH A;  3OVB A;  2HHP A;  4I2H A;  4AT8 B;  4K96 A;  4NKT A;  4I2E A; 
#chains in the Genus database with same CATH homology
 4NXU A;  4K97 A;  1F5A A;  4LT6 A;  4K99 A;  4HX0 A;  4FH3 A;  2ZH5 A;  4LEW A;  4NXV A;  3OVA A;  3ERC C;  2B56 A;  1UEV A;  4WH5 A;  2B4V A;  4FH5 A;  4NKU A;  3OVS A;  3NYB A;  4X4N A;  4O69 A;  4E80 A;  3EF2 A;  2ZH7 A;  4KB6 A;  4XJE A;  4E8F A;  4K9A A;  5D62 A;  2GAF D;  3HJ4 A;  4WQL A;  4K98 A;  3OV7 A;  2DR9 A;  2ZH8 A;  1GPJ A;  4JLZ A;  1R89 A;  4AT8 A;  4X4S A;  2DR5 A;  1FA0 A;  2DR8 A;  4OAF A;  3ER9 B;  4LEY A;  3OUY B;  2DRB A;  4FHV A;  2ZH4 A;  5CFS A;  4AT7 B;  4O68 A;  4E7X A;  2O1P A;  5B3Q A;  4X4V A;  2DR7 A;  4X4P A;  3HIY A;  4FHP A;  3PHZ A;  2ZH6 A;  4K9B A;  4MKP A;  4FHX A;  4N7R A;  3OUY A;  4K8V A;  1R8C A;  2Q66 A;  4M5D A;  5B3P A;  4WOY A;  4WQK A;  4FHW A;  2ZH9 A;  4ATB B;  4X4U A;  4X4R A;  4X4O A;  4FO1 A;  4O67 A;  4LEV A;  2B51 A;  1TFW A;  4KM5 A;  2IHO A;  2ZHB A;  2ZH3 A;  4NXT A;  5D63 A;  5CFU A;  4UD5 A;  2ZHA A;  4JLX A;  3HJ1 A;  4AT9 B;  4NXX A;  3K7D A;  3NKU A;  4O6A A;  4UD4 A;  1UEU A;  4AT7 A;  4FHY A;  2DVI A;  2EWR A;  4OAI Z;  4AT9 A;  4EP7 A;  4OAH A;  1Q78 A;  4X4T A;  3MCR A;  5CHE A;  1TFY A;  2FCL A;  5D61 A;  4OAG A;  1R8A A;  1UET A;  4NXW A;  3C66 A;  1Q79 A;  3ER8 C;  4X4Q A;  2ZH1 A;  2ZH2 A;  4ATB A;  2GA9 D;  4LEZ A;  1R8B A;  3OVB A;  2HHP A;  4AT8 B;  4K96 A;  4NKT A;  5CFT A;  3OWG A;  2DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...