4NXVA

Crystal structure of the cytosolic domain of human mid51
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
331
structure length
330
Chain Sequence
RMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 330
sequence length 331
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxvA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxvA02
4LEYA 4K9BA 4MKPA 4K8VA 4AT8A 4LEVA 4NXUA 4O6AA 4NXTA 4AT8B 4KB6A 4O69A 4OAGA 4AT9A 4NXVA 4AT9B 4KM5A 4LEZA 4NXXA 4O68A 4JLXA 4OAFA 4OAHA 4ATBA 4ATBB 4WOYA 4AT7A 4K96A 4AT7B 4LEWA 4K9AA 4OAIZ 4NXWA 4K98A 4K97A 4K99A 4JLZA 4O67A
chains in the Genus database with same CATH superfamily
4FO1A 3UXOA 4LZGA 9ICQA 4FH5A 4RPXA 4X0BA 5J2FA 4X4NA 4M9GA 4S3NA 2P66A 1UEVA 4RWNA 8ICPA 4WBYA 4I0UA 3H3AA 9ICEA 8ICQA 4RWPA 2B51A 4WC6A 1WOTA 1BPBA 4FH3A 1ZQUA 4NKUA 4FHPA 4F5QA 4WOYA 3WFOA 9ICCA 4E80A 4KLSA 3AU6A 1XSNA 1BPZA 9ICMA 4XRHA 4KLDA 4I2BA 1RPLA 3RH6A 1NOMA 5CFSA 3C2LA 3WFRE 4UB1A 3C66A 7ICNA 3L9DA 1ZQSA 4KLIA 1R89A 5J2DA 8ICVA 5HRHA 1ZQQA 5CHGA 4UAYA 5J0SA 9ICTA 5HRKA 3JCFA 4X4RA 3MGHA 5J0XA 1ZQKA 5D49A 1TVAA 3JYYA 2FMQA 5J2IA 4OAIZ 4RT2A 8ICHA 5CHEA 4M5DA 4WC0A 9ICHA 9ICUA 4O6AA 4M47A 5HREA 3NYBA 4X4TA 4O68A 5CB1A 5J2KA 4X4SA 4WH5A 5DEDA 8ICFA 2ZH9A 7ICGA 5BOLA 4O5KA 1VFGA 4K97A 1ZQXA 3NWIA 1ZQNA 2B56A 5J0OA 4M9NA 4M0AA 9ICSA 4P4PA 9ICJA 3H38A 2RFFA 7ICRA 4KB6A 2IHMA 9ICRA 4AT9A 5DKWA 2PFQA 3JPOA 4NM2A 4I27A 4RQ7A 2HN1A 4WQKA 8ICWA 5J2CA 5DB9A 4MFFA 9ICOA 4X0AA 2BCUA 1ZQJA 3UXPA 1TFYA 4UBBA 4WBZA 4QZDA 4WC2A 3MCRA 7ICVA 4UD4A 1JQRA 7ICUA 1JAJA 1KEJA 9ICVA 5DB8A 8ICUA 2ISOA 3AQNA 1MIWA 5CWRA 4FO6A 4M9HA 3UPSA 3HJ4A 4Z6FA 1ZQYA 5BPCA 1ZQMA 3H39A 1BPYA 4QZIA 1ZQAA 2ID1A 4X4OA 4X4PA 2ZH3A 4YD1A 3WFPA 5J29A 3C5GA 4IQUA 4UAZA 3PMLA 2ZH6A 3MDCA 4EEBA 3HWTA 3LQCB 5CJ7A 8ICTA 1ZQGA 4KLOA 5HRIA 1ZJNA 4PGQA 9ICGA 5J0YA 4LEVA 2IUBA 3RH4A 2M2WA 5IILA 3OUYB 3TFRA 5DBAA 3LK9A 4PH5A 5HRLA 4NXZA 4JWNA 4I2JA 4I2AA 3PMNA 3UQ0A 2BBJA 3V7LA 3JPTA 4TURA 8ICZA 2HHPA 2DR9A 4WQLA 4UBCA 1R8BA 5DB7A 4MFCA 9ICIA 4NKTA 4K4HA 4K98A 3RJIA 4JLXA 7ICLA 4QZHA 4I2CA 3HIYA 4RQ3A 3ER8C 2BCQA 9ICPA 4X4VA 3NKUA 1JN3A 2VANA 4AT8A 9ICLA 3UQ2A 4NXUA 1HUZA 5J2GA 4KLUA 4AT9B 4WC7A 1RZTA 5J2EA 4GXKA 4IQTA 1XSPA 4X4UA 5B3PA 4F5RA 4PPXA 3OV7A 1ZQPA 4XQ8A 4JWMA 5D61A 3C5FA 4NM1A 3JPQA 3JPPA 4PHDA 1ZQLA 5J0TA 1MQ3A 2GA9D 3HJ1A 2EWRA 2PFPA 5TZVA 3WFQE 2DRBA 2IHOA 4WCWA 5JTGA 4MKPA 4I2FA 3C2MA 1TV9A 5DBCA 5DDYA 4NXVA 3OVBA 3NVOA 5J2HA 1ZQIA 8ICIA 3TFSA 3AQLA 2W9MA 2I9GA 7ICHA 3B0YA 1V4AA 4KLJA 2ZHBA 2DR7A 2O1PA 4KLLA 5HHIA 1ZJMA 3PHZA 4IQWA 8ICEA 4FHYA 4UB3A 4MF2A 4O5CA 8ICKA 4XQ7A 4I2IA 4NLNA 2BCRA 4EEDA 9ICAA 3WFSC 4UAWA 4P4MA 4TUSA 5BOMA 3EF2A 5J2JA 9ICKA 4FHXA 4QZBA 1BPXA 5J0PA 5J2BA 2BPCA 3HW8A 4K8VA 4FHWA 4M2YA 4NXTA 4IQVA 1YLQA 4UB4A 5HRFA 4M04A 2ZH1A 2FMPA 4UB2A 1ZQEA 1MQ2A 4YMMA 1F5AA 5HC9A 4ATBA 3UPQA 4I2EA 4QZGA 7ICQA 4YMNA 4AT7A 1ZQBA 4NY8A 4LEWA 2NRKA 5B3QA 2BCSA 1OU5A 4NXWA 5CP2A 5J0QA 8ICYA 3V72A 3OVSA 4R63A 3ISDA 3JPSA 4Z6EA 4O5EA 7ICOA 3JPNA 5CFUA 1ZQRA 4P4OA 4QZ9A 7ICKA 8ICRA 1KNYA 1JMSA 4AT8B 8ICNA 5HR9A 1Q79A 2GWSA 9ICWA 4RQ4A 4Z6CA 3AQKA 3RH5A 4F5NA 4Z6DA 1R8AA 4R66A 4DOAA 4LT6A 2DRAA 4P2HA 3OGUA 1ZQWA 4TUPA 3RJFA 8ICXA 4PHAA 2ISPA 4EBKA 7ICFA 4WC1A 5D4BA 3RJGA 4E8FA 5CR0A 5CFTA 2BPFA 9ICFA 4KLFA 4X4QA 2ZH5A 5F2VO 4DOCA 5DECA 2DVIA 4NLZA 2ZHAA 4RQ1A 4O9MA 4F5OA 4N7RA 5IIMA 4I29A 1KDHA 2ZH8A 5CA7A 7ICSA 4OAGA 2BCVA 4GXIA 5DDMA 8ICGA 1FA0A 3B0XA 1PX5A 4YD2A 2M2TA 3AU2A 3AUOA 3JZ0A 4KLMA 4LVSA 9ICXA 4WC3A 2ZH7A 2ZH2A 5IIOA 5EOZA 1HUOA 1Q78A 3ISBA 3H37A 4KLQA 4WC4A 1MIYA 5D46A 2PBEA 4RQ5A 3CK6A 4I2HA 3MGIA 2GAFD 3AQMA 1ZQDA 8ICAA 5IIKA 5HRDA 4ATBB 4QZCA 4K96A 4AT7B 4MFAA 2HN2A 3OVAA 4KLEA 4O67A 4RPZA 4NLKA 4LZDA 4KLHA 8ICSA 5J2AA 2DR5A 4E7XA 7ICIA 2M2VA 4O69A 4EP7A 4M9LA 4XA5A 1ZQOA 3ER9B 2ZH4A 4UD5A 4NXXA 1MIVA 4RPYA 3V7JA 2M2UA 4DO9A 4WC5A 4TUQA 3C2KA 3ERCC 2O5AA 4RQ6A 4KLGA 4K4GA 4EBJA 3K7DA 3HX0A 4DOBA 1R8CA 4I2DA 4F5PA 4R64A 5D62A 3RJEA 1BPDA 2BE3A 3C18A 4IG8A 1UETA 3PNCA 1GPJA 3GDXA 4RQ8A 4PHPA 4RWOA 2BBHA 4YN4A 1ZQCA 5HHHA 3JPRA 5IIIA 3OUYA 8ICBA 9ICBA 5J0RA 3OWGA 4RT3A 4LEZA 4PGYA 1ZQFA 4I28A 3MBYA 5DBBA 2FCLA 2FMSA 3RJKA 4XJEA 4YCXA 4RQ2A 7ICJA 3K75D 2DR8A 4M9JA 5DB6A 4EV6A 3MDAA 1BPEA 4HX0A 1ZQZA 4QZAA 8ICCA 4RWQA 4YMOA 2PXIA 3V7KA 3ISCA 1UEUA 5IINA 2PFNA 4EGWA 4K4IA 5HRGA 4KLTA 4I2GA 8ICLA 1XSLA 4MF8A 4FHVA 4UB5A 4OAHA 7ICPA 1TFWA 8ICJA 4K9AA 1VJ7A 4PHEA 8ICMA 3RJHA 7ICTA 5IIJA 5J0WA 4RQ0A 4QZFA 2Q66A 4QZEA 4PGXA 4GXJA 1ZQHA 4LEYA 4K9BA 5D63A 7ICMA 1NO5A 1ZQTA 5J0UA 9ICNA 4KM5A 4QZ8A 5HRBA 1ZQVA 3UXNA 3RJJA 4OAFA 2BPGA 4X5VA 4R65A 4XUSA 2B4VA 8ICOA 4K99A 4JLZA 2PFOA 7ICEA
chains in the Genus database with same CATH topology
4FO1A 4UD4A 3EF2A 4FHXA 4FH5A 2DR5A 4X4NA 4E7XA 4K8VA 4FHWA 4NXTA 1UEVA 4O69A 4EP7A 2ZH1A 2ZH4A 4UD5A 4NXXA 3ER9B 3HJ4A 2B51A 3ERCC 4FH3A 1F5AA 4ATBA 4NKUA 4FHPA 4WOYA 4AT7A 3K7DA 4LEWA 4E80A 1R8CA 4X4OA 4X4PA 2ZH3A 5B3QA 4NXWA 5D62A 2ZH6A 3OVSA 1UETA 1GPJA 5CFSA 5CFUA 3C66A 4LEVA 4AT8B 3OUYA 3OUYB 3OWGA 1Q79A 4LEZA 1R89A 2FCLA 1R8AA 4XJEA 2DR8A 4LT6A 2DRAA 2HHPA 2DR9A 4WQLA 4X4RA 1R8BA 4NKTA 4HX0A 4E8FA 4K98A 5CFTA 4OAIZ 4JLXA 4X4QA 5CHEA 2ZH5A 1UEUA 4M5DA 3HIYA 2DVIA 3ER8C 4X4VA 3NKUA 2ZHAA 4AT8A 4N7RA 4NXUA 4O6AA 2ZH8A 4OAGA 4AT9B 3NYBA 4X4TA 4O68A 1FA0A 4FHVA 4X4SA 4X4UA 5B3PA 4WH5A 4OAHA 3OV7A 1TFWA 2ZH9A 5D61A 4K9AA 2ZH7A 2ZH2A 4K97A 2Q66A 2B56A 2GA9D 3HJ1A 2EWRA 1Q78A 4LEYA 2DRBA 4K9BA 2IHOA 5D63A 4MKPA 4KB6A 4AT9A 4NXVA 3OVBA 4KM5A 2GAFD 4OAFA 2ZHBA 2DR7A 2O1PA 4WQKA 3PHZA 4ATBB 4FHYA 2B4VA 4K96A 4AT7B 1TFYA 3OVAA 4K99A 4JLZA 3MCRA 4O67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LEY A;  4K9B A;  4MKP A;  4K8V A;  4AT8 A;  4LEV A;  4NXU A;  4O6A A;  4NXT A;  4AT8 B;  4KB6 A;  4O69 A;  4OAG A;  4AT9 A;  4NXV A;  4AT9 B;  4KM5 A;  4LEZ A;  4NXX A;  4O68 A;  4JLX A;  4OAF A;  4OAH A;  4ATB A;  4ATB B;  4WOY A;  4AT7 A;  4K96 A;  4AT7 B;  4LEW A;  4K9A A;  4OAI Z;  4NXW A;  4K98 A;  4K97 A;  4K99 A;  4JLZ A;  4O67 A; 
#chains in the Genus database with same CATH topology
 4FO1 A;  3UXO A;  4LZG A;  9ICQ A;  4FH5 A;  4RPX A;  4X0B A;  5J2F A;  4X4N A;  4M9G A;  4S3N A;  2P66 A;  1UEV A;  4RWN A;  8ICP A;  4WBY A;  4I0U A;  3H3A A;  9ICE A;  8ICQ A;  4RWP A;  2B51 A;  4WC6 A;  1WOT A;  1BPB A;  4FH3 A;  1ZQU A;  4NKU A;  4FHP A;  4F5Q A;  4WOY A;  3WFO A;  9ICC A;  4E80 A;  4KLS A;  3AU6 A;  1XSN A;  1BPZ A;  9ICM A;  4XRH A;  4KLD A;  4I2B A;  1RPL A;  3RH6 A;  1NOM A;  5CFS A;  3C2L A;  3WFR E;  4UB1 A;  3C66 A;  7ICN A;  3L9D A;  1ZQS A;  4KLI A;  1R89 A;  5J2D A;  8ICV A;  5HRH A;  1ZQQ A;  5CHG A;  4UAY A;  5J0S A;  9ICT A;  5HRK A;  3JCF A;  4X4R A;  3MGH A;  5J0X A;  1ZQK A;  5D49 A;  1TVA A;  3JYY A;  2FMQ A;  5J2I A;  4OAI Z;  4RT2 A;  8ICH A;  5CHE A;  4M5D A;  4WC0 A;  9ICH A;  9ICU A;  4O6A A;  4M47 A;  5HRE A;  3NYB A;  4X4T A;  4O68 A;  5CB1 A;  5J2K A;  4X4S A;  4WH5 A;  5DED A;  8ICF A;  2ZH9 A;  7ICG A;  5BOL A;  4O5K A;  1VFG A;  4K97 A;  1ZQX A;  3NWI A;  1ZQN A;  2B56 A;  5J0O A;  4M9N A;  4M0A A;  9ICS A;  4P4P A;  9ICJ A;  3H38 A;  2RFF A;  7ICR A;  4KB6 A;  2IHM A;  9ICR A;  4AT9 A;  5DKW A;  2PFQ A;  3JPO A;  4NM2 A;  4I27 A;  4RQ7 A;  2HN1 A;  4WQK A;  8ICW A;  5J2C A;  5DB9 A;  4MFF A;  9ICO A;  4X0A A;  2BCU A;  1ZQJ A;  3UXP A;  1TFY A;  4UBB A;  4WBZ A;  4QZD A;  4WC2 A;  3MCR A;  7ICV A;  4UD4 A;  1JQR A;  7ICU A;  1JAJ A;  1KEJ A;  9ICV A;  5DB8 A;  8ICU A;  2ISO A;  3AQN A;  1MIW A;  5CWR A;  4FO6 A;  4M9H A;  3UPS A;  3HJ4 A;  4Z6F A;  1ZQY A;  5BPC A;  1ZQM A;  3H39 A;  1BPY A;  4QZI A;  1ZQA A;  2ID1 A;  4X4O A;  4X4P A;  2ZH3 A;  4YD1 A;  3WFP A;  5J29 A;  3C5G A;  4IQU A;  4UAZ A;  3PML A;  2ZH6 A;  3MDC A;  4EEB A;  3HWT A;  3LQC B;  5CJ7 A;  8ICT A;  1ZQG A;  4KLO A;  5HRI A;  1ZJN A;  4PGQ A;  9ICG A;  5J0Y A;  4LEV A;  2IUB A;  3RH4 A;  2M2W A;  5IIL A;  3OUY B;  3TFR A;  5DBA A;  3LK9 A;  4PH5 A;  5HRL A;  4NXZ A;  4JWN A;  4I2J A;  4I2A A;  3PMN A;  3UQ0 A;  2BBJ A;  3V7L A;  3JPT A;  4TUR A;  8ICZ A;  2HHP A;  2DR9 A;  4WQL A;  4UBC A;  1R8B A;  5DB7 A;  4MFC A;  9ICI A;  4NKT A;  4K4H A;  4K98 A;  3RJI A;  4JLX A;  7ICL A;  4QZH A;  4I2C A;  3HIY A;  4RQ3 A;  3ER8 C;  2BCQ A;  9ICP A;  4X4V A;  3NKU A;  1JN3 A;  2VAN A;  4AT8 A;  9ICL A;  3UQ2 A;  4NXU A;  1HUZ A;  5J2G A;  4KLU A;  4AT9 B;  4WC7 A;  1RZT A;  5J2E A;  4GXK A;  4IQT A;  1XSP A;  4X4U A;  5B3P A;  4F5R A;  4PPX A;  3OV7 A;  1ZQP A;  4XQ8 A;  4JWM A;  5D61 A;  3C5F A;  4NM1 A;  3JPQ A;  3JPP A;  4PHD A;  1ZQL A;  5J0T A;  1MQ3 A;  2GA9 D;  3HJ1 A;  2EWR A;  2PFP A;  5TZV A;  3WFQ E;  2DRB A;  2IHO A;  4WCW A;  5JTG A;  4MKP A;  4I2F A;  3C2M A;  1TV9 A;  5DBC A;  5DDY A;  4NXV A;  3OVB A;  3NVO A;  5J2H A;  1ZQI A;  8ICI A;  3TFS A;  3AQL A;  2W9M A;  2I9G A;  7ICH A;  3B0Y A;  1V4A A;  4KLJ A;  2ZHB A;  2DR7 A;  2O1P A;  4KLL A;  5HHI A;  1ZJM A;  3PHZ A;  4IQW A;  8ICE A;  4FHY A;  4UB3 A;  4MF2 A;  4O5C A;  8ICK A;  4XQ7 A;  4I2I A;  4NLN A;  2BCR A;  4EED A;  9ICA A;  3WFS C;  4UAW A;  4P4M A;  4TUS A;  5BOM A;  3EF2 A;  5J2J A;  9ICK A;  4FHX A;  4QZB A;  1BPX A;  5J0P A;  5J2B A;  2BPC A;  3HW8 A;  4K8V A;  4FHW A;  4M2Y A;  4NXT A;  4IQV A;  1YLQ A;  4UB4 A;  5HRF A;  4M04 A;  2ZH1 A;  2FMP A;  4UB2 A;  1ZQE A;  1MQ2 A;  4YMM A;  1F5A A;  5HC9 A;  4ATB A;  3UPQ A;  4I2E A;  4QZG A;  7ICQ A;  4YMN A;  4AT7 A;  1ZQB A;  4NY8 A;  4LEW A;  2NRK A;  5B3Q A;  2BCS A;  1OU5 A;  4NXW A;  5CP2 A;  5J0Q A;  8ICY A;  3V72 A;  3OVS A;  4R63 A;  3ISD A;  3JPS A;  4Z6E A;  4O5E A;  7ICO A;  3JPN A;  5CFU A;  1ZQR A;  4P4O A;  4QZ9 A;  7ICK A;  8ICR A;  1KNY A;  1JMS A;  4AT8 B;  8ICN A;  5HR9 A;  1Q79 A;  2GWS A;  9ICW A;  4RQ4 A;  4Z6C A;  3AQK A;  3RH5 A;  4F5N A;  4Z6D A;  1R8A A;  4R66 A;  4DOA A;  4LT6 A;  2DRA A;  4P2H A;  3OGU A;  1ZQW A;  4TUP A;  3RJF A;  8ICX A;  4PHA A;  2ISP A;  4EBK A;  7ICF A;  4WC1 A;  5D4B A;  3RJG A;  4E8F A;  5CR0 A;  5CFT A;  2BPF A;  9ICF A;  4KLF A;  4X4Q A;  2ZH5 A;  5F2V O;  4DOC A;  5DEC A;  2DVI A;  4NLZ A;  2ZHA A;  4RQ1 A;  4O9M A;  4F5O A;  4N7R A;  5IIM A;  4I29 A;  1KDH A;  2ZH8 A;  5CA7 A;  7ICS A;  4OAG A;  2BCV A;  4GXI A;  5DDM A;  8ICG A;  1FA0 A;  3B0X A;  1PX5 A;  4YD2 A;  2M2T A;  3AU2 A;  3AUO A;  3JZ0 A;  4KLM A;  4LVS A;  9ICX A;  4WC3 A;  2ZH7 A;  2ZH2 A;  5IIO A;  5EOZ A;  1HUO A;  1Q78 A;  3ISB A;  3H37 A;  4KLQ A;  4WC4 A;  1MIY A;  5D46 A;  2PBE A;  4RQ5 A;  3CK6 A;  4I2H A;  3MGI A;  2GAF D;  3AQM A;  1ZQD A;  8ICA A;  5IIK A;  5HRD A;  4ATB B;  4QZC A;  4K96 A;  4AT7 B;  4MFA A;  2HN2 A;  3OVA A;  4KLE A;  4O67 A;  4RPZ A;  4NLK A;  4LZD A;  4KLH A;  8ICS A;  5J2A A;  2DR5 A;  4E7X A;  7ICI A;  2M2V A;  4O69 A;  4EP7 A;  4M9L A;  4XA5 A;  1ZQO A;  3ER9 B;  2ZH4 A;  4UD5 A;  4NXX A;  1MIV A;  4RPY A;  3V7J A;  2M2U A;  4DO9 A;  4WC5 A;  4TUQ A;  3C2K A;  3ERC C;  2O5A A;  4RQ6 A;  4KLG A;  4K4G A;  4EBJ A;  3K7D A;  3HX0 A;  4DOB A;  1R8C A;  4I2D A;  4F5P A;  4R64 A;  5D62 A;  3RJE A;  1BPD A;  2BE3 A;  3C18 A;  4IG8 A;  1UET A;  3PNC A;  1GPJ A;  3GDX A;  4RQ8 A;  4PHP A;  4RWO A;  2BBH A;  4YN4 A;  1ZQC A;  5HHH A;  3JPR A;  5III A;  3OUY A;  8ICB A;  9ICB A;  5J0R A;  3OWG A;  4RT3 A;  4LEZ A;  4PGY A;  1ZQF A;  4I28 A;  3MBY A;  5DBB A;  2FCL A;  2FMS A;  3RJK A;  4XJE A;  4YCX A;  4RQ2 A;  7ICJ A;  3K75 D;  2DR8 A;  4M9J A;  5DB6 A;  4EV6 A;  3MDA A;  1BPE A;  4HX0 A;  1ZQZ A;  4QZA A;  8ICC A;  4RWQ A;  4YMO A;  2PXI A;  3V7K A;  3ISC A;  1UEU A;  5IIN A;  2PFN A;  4EGW A;  4K4I A;  5HRG A;  4KLT A;  4I2G A;  8ICL A;  1XSL A;  4MF8 A;  4FHV A;  4UB5 A;  4OAH A;  7ICP A;  1TFW A;  8ICJ A;  4K9A A;  1VJ7 A;  4PHE A;  8ICM A;  3RJH A;  7ICT A;  5IIJ A;  5J0W A;  4RQ0 A;  4QZF A;  2Q66 A;  4QZE A;  4PGX A;  4GXJ A;  1ZQH A;  4LEY A;  4K9B A;  5D63 A;  7ICM A;  1NO5 A;  1ZQT A;  5J0U A;  9ICN A;  4KM5 A;  4QZ8 A;  5HRB A;  1ZQV A;  3UXN A;  3RJJ A;  4OAF A;  2BPG A;  4X5V A;  4R65 A;  4XUS A;  2B4V A;  8ICO A;  4K99 A;  4JLZ A;  2PFO A;  7ICE A; 
#chains in the Genus database with same CATH homology
 4FO1 A;  4UD4 A;  3EF2 A;  4FHX A;  4FH5 A;  2DR5 A;  4X4N A;  4E7X A;  4K8V A;  4FHW A;  4NXT A;  1UEV A;  4O69 A;  4EP7 A;  2ZH1 A;  2ZH4 A;  4UD5 A;  4NXX A;  3ER9 B;  3HJ4 A;  2B51 A;  3ERC C;  4FH3 A;  1F5A A;  4ATB A;  4NKU A;  4FHP A;  4WOY A;  4AT7 A;  3K7D A;  4LEW A;  4E80 A;  1R8C A;  4X4O A;  4X4P A;  2ZH3 A;  5B3Q A;  4NXW A;  5D62 A;  2ZH6 A;  3OVS A;  1UET A;  1GPJ A;  5CFS A;  5CFU A;  3C66 A;  4LEV A;  4AT8 B;  3OUY A;  3OUY B;  3OWG A;  1Q79 A;  4LEZ A;  1R89 A;  2FCL A;  1R8A A;  4XJE A;  2DR8 A;  4LT6 A;  2DRA A;  2HHP A;  2DR9 A;  4WQL A;  4X4R A;  1R8B A;  4NKT A;  4HX0 A;  4E8F A;  4K98 A;  5CFT A;  4OAI Z;  4JLX A;  4X4Q A;  5CHE A;  2ZH5 A;  1UEU A;  4M5D A;  3HIY A;  2DVI A;  3ER8 C;  4X4V A;  3NKU A;  2ZHA A;  4AT8 A;  4N7R A;  4NXU A;  4O6A A;  2ZH8 A;  4OAG A;  4AT9 B;  3NYB A;  4X4T A;  4O68 A;  1FA0 A;  4FHV A;  4X4S A;  4X4U A;  5B3P A;  4WH5 A;  4OAH A;  3OV7 A;  1TFW A;  2ZH9 A;  5D61 A;  4K9A A;  2ZH7 A;  2ZH2 A;  4K97 A;  2Q66 A;  2B56 A;  2GA9 D;  3HJ1 A;  2EWR A;  1Q78 A;  4LEY A;  2DRB A;  4K9B A;  2IHO A;  5D63 A;  4MKP A;  4KB6 A;  4AT9 A;  4NXV A;  3OVB A;  4KM5 A;  2GAF D;  4OAF A;  2ZHB A;  2DR7 A;  2O1P A;  4WQK A;  3PHZ A;  4ATB B;  4FHY A;  2B4V A;  4K96 A;  4AT7 B;  1TFY A;  3OVA A;  4K99 A;  4JLZ A;  3MCR A;  4O67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...