4WC1A

Structure of trna-processing enzyme with ctp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
382
structure length
364
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
molecule keywords Poly A polymerase
total genus 114
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc1A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc1A01
4M9HA 4UB5A 4S3NA 4I2GA 5J2IA 4PH5A 4LZDA 3TFSA 2ZH8A 9ICUA 3UPSA 3JZ0A 1HUOA 4QZDA 4P4MA 2DR8A 9ICXA 4KLLA 2PFNA 4ATBA 4PGXA 5J2EA 4F5OA 4WC3A 1KEJA 4RT3A 7ICPA 4WC2A 3JPNA 3C2KA 1ZQJA 4E8FA 3B0YA 3V7KA 3RJFA 4KLSA 2W9MA 4X4SA 5IIJA 1ZQEA 3HJ4A 4FHVA 1BPDA 3H3AA 2O1PA 5IILA 5DDYA 7ICEA 4JWMA 3UXPA 5CWRA 8ICVA 9ICPA 1ZQKA 1JQRA 1R89A 2P66A 5J2CA 8ICMA 1UEUA 4NY8A 5J2DA 2ZH5A 3V7JA 3OVAA 4DO9A 5J2HA 4K4IA 4UB3A 4O9MA 5J29A 4MF8A 4F5PA 9ICLA 4EBJA 2DRBA 1Q79A 4F5RA 8ICHA 2BCRA 2DVIA 3UQ0A 3AU6A 4M47A 2Q66A 4UBCA 9ICOA 3C2MA 3JPRA 1KNYA 1Q78A 4RQ2A 4GXJA 5HRDA 4XQ8A 3RJEA 2ZHAA 1R8CA 1BPXA 1KDHA 7ICRA 2ZH4A 4QZEA 5CB1A 4RQ0A 3AU2A 4FHYA 1R8BA 1JN3A 1ZQVA 8ICPA 9ICAA 4QZ8A 4QZCA 4JWNA 1TVAA 1ZQFA 8ICNA 4MFAA 3WFQE 3WFOA 9ICTA 5CP2A 2ISPA 8ICWA 3RJGA 3OV7A 1ZJMA 1ZQNA 1ZQRA 2I9GA 8ICFA 5DB8A 1F5AA 2BPCA 9ICVA 4NM1A 5IINA 3JPOA 1MIYA 4TUQA 5J2JA 8ICJA 5CR0A 4WC5A 3HIYA 1TFWA 3WFRE 3WFPA 4XRHA 5HREA 9ICWA 8ICUA 9ICBA 2BCSA 4RQ8A 3JPTA 2BCVA 4FH3A 4KLQA 3H38A 5J0OA 5IIOA 4KLHA 5CJ7A 4R65A 4RQ4A 4I2AA 5J2GA 9ICKA 4I2HA 4QZGA 4I2IA 7ICOA 1ZQXA 1VFGA 4X4PA 1VJ7A 1ZQMA 4UB2A 8ICGA 4I29A 3AQNA 4GXKA 2NRKA 5D46A 4UB1A 4YMNA 5J0QA 4X4VA 4K4GA 2BPFA 3ISDA 3MBYA 3C5GA 9ICGA 7ICSA 9ICJA 4I2FA 4AT8A 3C18A 8ICIA 2PBEA 7ICHA 2PFPA 3JYYA 2ZH6A 4X4OA 9ICIA 4R63A 5HHIA 4FHXA 4I27A 4I28A 1PX5A 5DEDA 7ICQA 4RWNA 5HR9A 3UXOA 5J0YA 2ZH1A 4X5VA 4PPXA 5BOMA 4M04A 5D4BA 8ICEA 4Z6DA 4YMMA 5J0RA 7ICMA 4RPYA 1BPBA 4X0BA 1HUZA 4KLDA 4O5KA 4KLGA 5J0XA 3PNCA 1ZQTA 1NOMA 4IQTA 5DECA 3LQCB 8ICLA 3RH4A 4QZ9A 3HX0A 4Z6EA 1BPEA 1ZQDA 4WC4A 2O5AA 1MQ3A 4NKTA 4IQWA 5DKWA 1ZJNA 5DDMA 1UETA 2M2UA 1ZQOA 3GDXA 4M9LA 9ICCA 4R64A 4YN4A 1ZQBA 4UD5A 7ICVA 4UAWA 4IG8A 2M2TA 4WCWA 4NLKA 3MGHA 2PFOA 5DBBA 4XA5A 4YD1A 4GXIA 1ZQUA 4RPXA 2PFQA 4E80A 1ZQHA 2FMSA 1ZQYA 3OGUA 4WC6A 4O5CA 8ICBA 1MIWA 4PHPA 4M9NA 9ICFA 9ICHA 5DBAA 1TFYA 5HHHA 1WOTA 1MIVA 5DB7A 1ZQLA 4DOBA 2RFFA 4R66A 4IQUA 4KLMA 3OUYB 4NLNA 2VANA 4FO6A 1ZQQA 2IHMA 3UXNA 4QZFA 4FHPA 4KLUA 2BCQA 3AQMA 4AT9A 2BPGA 4K4HA 4Z6FA 3ISBA 4DOCA 8ICZA 5IIIA 3UQ2A 3B0XA 1ZQIA 4AT9B 3RH5A 7ICJA 7ICLA 5HRHA 1BPZA 2PXIA 4MF2A 4M0AA 8ICQA 5HRBA 4AT7B 3MDCA 3MGIA 3AUOA 4UB4A 4O5EA 5J0SA 4X4QA 4KLEA 1ZQCA 4WC1A 4RWOA 4DOAA 4FH5A 4P4PA 8ICYA 7ICNA 4PGYA 4I2DA 5J0WA 1V4AA 4KLTA 8ICTA 8ICKA 4M9GA 4QZIA 4PHDA 4WBZA 3H37A 4KLFA 2DR9A 8ICCA 2FMQA 5BPCA 1OU5A 2DR7A 5DB9A 5D49A 5HRFA 7ICFA 1XSNA 3PMLA 3RJHA 3AQLA 5HRLA 4RQ1A 4EBKA 4LVSA 2ZH2A 1JMSA 4WC0A 3ISCA 1TV9A 3OVSA 4XQ7A 4X4NA 3L9DA 1FA0A 5HC9A 4X0AA 4NXZA 4MFCA 4WC7A 5HRIA 2ZH9A 4QZBA 4I2CA 9ICRA 3HJ1A 1ZQSA 4RQ5A 7ICIA 1RZTA 4I2BA 1XSLA 4TUPA 7ICTA 5TZVA 3C66A 5DBCA 7ICUA 3JPSA 3WFSC 9ICNA 4RWQA 3H39A 4FHWA 4P4OA 1MQ2A 1XSPA 4MFFA 8ICOA 1JAJA 3JPQA 4YCXA 2ZHBA 4RT2A 3HW8A 4AT7A 5BOLA 4PGQA 3RJJA 8ICRA 4YMOA 2ID1A 4E7XA 3HWTA 3NYBA 4X4RA 7ICKA 4IQVA 5J2KA 3RJIA 3C5FA 5EOZA 1ZQPA 4X4TA 4KLIA 9ICQA 4F5NA 2DRAA 3LK9A 2ISOA 4KLOA 5J2AA 3OUYA 4KLJA 3TFRA 2BE3A 4RQ3A 9ICMA 9ICSA 5HRKA 4X4UA 1R8AA 4RPZA 3C2LA 2GWSA 1YLQA 4RWPA 5CHGA 1ZQAA 3V72A 8ICAA 4NM2A 1NO5A 4AT8B 2ZH3A 2ZH7A 4UAYA 5J2BA 3RH6A 5J0PA 1ZQWA 1BPYA 4UAZA 4PHAA 4QZAA 3OVBA 7ICGA 5HRGA 2FMPA 4TURA 3AQKA 3RJKA 4WBYA 2M2WA 5CA7A 1RPLA 5F2VO 8ICXA 4YD2A 8ICSA 4PHEA 2DR5A 4TUSA 4M5DA 2M2VA 3V7LA 1ZQGA 4NKUA 4QZHA 5IIKA 4ATBB 5J0UA 2BCUA 4P2HA 5J2FA 4M2YA 4RQ6A 4EP7A 5IIMA 2HHPA 4NLZA 9ICEA 1ZQZA 4XUSA 4UD4A 5DB6A 3K75D 4LZGA 4LT6A 4F5QA 3JPPA 5J0TA 4Z6CA 1UEVA 4RQ7A 3MDAA 4I2JA 3PMNA 4I2EA 3UPQA 4UBBA 4M9JA
chains in the Genus database with same CATH superfamily
4M9HA 4UB5A 4S3NA 4I2GA 5J2IA 4PH5A 4LZDA 3TFSA 2ZH8A 9ICUA 3UPSA 3JZ0A 1HUOA 4QZDA 4P4MA 3ER9B 2DR8A 4KLLA 4JLXA 9ICXA 2PFNA 4ATBA 4PGXA 5J2EA 4F5OA 4WC3A 1KEJA 4RT3A 7ICPA 4WC2A 3CK6A 3JPNA 3C2KA 1ZQJA 4E8FA 3B0YA 3V7KA 3RJFA 4KLSA 2W9MA 5D63A 4X4SA 5IIJA 1ZQEA 3HJ4A 4FHVA 1BPDA 4NXXA 3H3AA 2O1PA 5IILA 5DDYA 7ICEA 4JWMA 3UXPA 5CWRA 8ICVA 9ICPA 1ZQKA 1JQRA 1R89A 2P66A 5J2CA 8ICMA 1UEUA 4NY8A 5J2DA 2ZH5A 3V7JA 3OVAA 4DO9A 5J2HA 5D61A 4K4IA 4UB3A 4O9MA 5J29A 4MF8A 4F5PA 9ICLA 4EBJA 2DRBA 1Q79A 4F5RA 8ICHA 2BCRA 3NVOA 2DVIA 3UQ0A 3AU6A 3NWIA 3MCRA 4M47A 2Q66A 4UBCA 9ICOA 2BBHA 4NXWA 3C2MA 3JPRA 1KNYA 1Q78A 4RQ2A 4GXJA 5HRDA 4XQ8A 3RJEA 1GPJA 2ZHAA 1R8CA 1BPXA 1KDHA 7ICRA 2ZH4A 4QZEA 5CB1A 4RQ0A 3AU2A 4FHYA 1R8BA 1JN3A 1ZQVA 4EEDA 8ICPA 9ICAA 4QZ8A 4QZCA 4LEZA 4JWNA 5CFUA 1TVAA 1ZQFA 8ICNA 4MFAA 3WFQE 3WFOA 9ICTA 5CP2A 2ISPA 8ICWA 3RJGA 3OV7A 1ZJMA 1ZQNA 1ZQRA 2I9GA 8ICFA 5DB8A 1F5AA 2BPCA 9ICVA 4NM1A 5IINA 3JPOA 1MIYA 4TUQA 5J2JA 8ICJA 5CR0A 4K9AA 4WC5A 3HIYA 5B3QA 3WFRE 3WFPA 4XRHA 5HREA 1TFWA 9ICWA 8ICUA 9ICBA 4KM5A 4OAIZ 2BCSA 5D62A 4RQ8A 3JPTA 2BCVA 4FH3A 4KLQA 3H38A 5J0OA 5IIOA 4KLHA 5CJ7A 4R65A 4RQ4A 4I2AA 5J2GA 9ICKA 4I2HA 4QZGA 4I2IA 7ICOA 1ZQXA 1VFGA 4X4PA 1VJ7A 1ZQMA 4UB2A 8ICGA 4I29A 3AQNA 4GXKA 2NRKA 5D46A 4UB1A 4YMNA 5J0QA 4X4VA 4K4GA 2BPFA 3ISDA 3MBYA 3C5GA 9ICGA 7ICSA 9ICJA 4O68A 4I2FA 4AT8A 3NKUA 3C18A 4K98A 8ICIA 2PBEA 7ICHA 2PFPA 3JYYA 2ZH6A 4LEYA 4X4OA 9ICIA 4R63A 5HHIA 4FHXA 4I27A 4I28A 1PX5A 5DEDA 7ICQA 4RWNA 5HR9A 3UXOA 5J0YA 2ZH1A 4X5VA 4PPXA 5BOMA 4M04A 5D4BA 8ICEA 4Z6DA 4YMMA 4K8VA 5J0RA 7ICMA 4RPYA 1BPBA 4X0BA 1HUZA 4O67A 4KLDA 4O5KA 4KLGA 4WH5A 4K99A 5J0XA 3PNCA 1ZQTA 1NOMA 4IQTA 4O69A 5DECA 3LQCB 8ICLA 3RH4A 4QZ9A 3HX0A 4Z6EA 2IHOA 1BPEA 1ZQDA 4WC4A 2O5AA 1MQ3A 4NKTA 4IQWA 5DKWA 1ZJNA 5DDMA 1UETA 2M2UA 4WQLA 1ZQOA 3GDXA 4M9LA 9ICCA 4R64A 4YN4A 4N7RA 5CFTA 1ZQBA 4UD5A 4K96A 7ICVA 4UAWA 4IG8A 2M2TA 4WCWA 4NLKA 3MGHA 2PFOA 5DBBA 4XA5A 4JLZA 4YD1A 4GXIA 1ZQUA 4RPXA 2PFQA 4E80A 1ZQHA 2FMSA 1ZQYA 3ERCC 4K97A 4OAGA 3OGUA 4WC6A 4O5CA 8ICBA 1MIWA 2B56A 4PHPA 4M9NA 9ICFA 9ICHA 2EWRA 5DBAA 1TFYA 5HHHA 1WOTA 1MIVA 5DB7A 1ZQLA 4DOBA 2RFFA 4R66A 4IQUA 4LEWA 4KLMA 3OUYB 4NLNA 2VANA 4FO6A 1ZQQA 2IHMA 3UXNA 4QZFA 4FHPA 4KLUA 2BCQA 2IUBA 5JTGA 3AQMA 5CHEA 4AT9A 2BPGA 4K4HA 4Z6FA 4NXTA 3ISBA 4DOCA 8ICZA 5IIIA 3UQ2A 3B0XA 1ZQIA 4AT9B 3RH5A 7ICJA 7ICLA 4EV6A 5HRHA 1BPZA 2PXIA 4MF2A 4M0AA 2B51A 8ICQA 2HN1A 5HRBA 4AT7B 3MDCA 3MGIA 3AUOA 4UB4A 4O5EA 5J0SA 4X4QA 4KLEA 1ZQCA 4WC1A 4RWOA 4DOAA 4FH5A 4P4PA 8ICYA 7ICNA 3ER8C 4PGYA 4I2DA 5J0WA 1V4AA 4KLTA 2GAFD 8ICTA 8ICKA 4M9GA 4QZIA 4PHDA 4WBZA 3H37A 4KLFA 2DR9A 8ICCA 4EGWA 2FMQA 5BPCA 1OU5A 2DR7A 5DB9A 5D49A 5HRFA 7ICFA 1XSNA 3PMLA 3RJHA 3AQLA 5HRLA 2B4VA 4EBKA 4RQ1A 2ZH2A 4LVSA 1JMSA 4WC0A 3ISCA 1TV9A 4WOYA 3OVSA 4XQ7A 4X4NA 3L9DA 1FA0A 5HC9A 4X0AA 4NXZA 4MFCA 4WC7A 5HRIA 2ZH9A 4QZBA 4I2CA 9ICRA 3HJ1A 1ZQSA 4RQ5A 7ICIA 1RZTA 4I2BA 1XSLA 4TUPA 7ICTA 5TZVA 4WQKA 3C66A 3PHZA 5DBCA 7ICUA 3JPSA 3WFSC 9ICNA 3OWGA 4RWQA 3H39A 4FHWA 4P4OA 1MQ2A 1XSPA 4MFFA 8ICOA 1JAJA 3JPQA 4YCXA 2ZHBA 3EF2A 4RT2A 3HW8A 4AT7A 5CFSA 5BOLA 4PGQA 3RJJA 4LEVA 8ICRA 4MKPA 5B3PA 4YMOA 2ID1A 4E7XA 3HWTA 4KB6A 3NYBA 4X4RA 7ICKA 4IQVA 5J2KA 3RJIA 3C5FA 5EOZA 1ZQPA 4X4TA 2FCLA 4KLIA 9ICQA 4XJEA 4F5NA 2DRAA 3LK9A 2ISOA 4KLOA 4NXUA 5J2AA 3OUYA 4KLJA 3TFRA 2BE3A 4RQ3A 9ICMA 9ICSA 5HRKA 4X4UA 1R8AA 4RPZA 3C2LA 2GWSA 1YLQA 4RWPA 2GA9D 5CHGA 1ZQAA 4EEBA 3V72A 8ICAA 4NM2A 1NO5A 4AT8B 4HX0A 4NXVA 2ZH3A 2ZH7A 4UAYA 3JCFA 5J2BA 3K7DA 3RH6A 5J0PA 1ZQWA 1BPYA 4UAZA 4PHAA 4QZAA 3OVBA 7ICGA 5HRGA 2FMPA 2BBJA 4FO1A 3AQKA 4TURA 3RJKA 4WBYA 2M2WA 5CA7A 1RPLA 2HN2A 4O6AA 5F2VO 8ICXA 4YD2A 8ICSA 4OAHA 4PHEA 2DR5A 4TUSA 4M5DA 2M2VA 3V7LA 1ZQGA 4K9BA 4NKUA 4QZHA 5IIKA 4ATBB 5J0UA 2BCUA 4P2HA 5J2FA 4M2YA 4RQ6A 4EP7A 5IIMA 2HHPA 4NLZA 9ICEA 1ZQZA 4I0UA 4XUSA 4UD4A 5DB6A 3K75D 4LZGA 4LT6A 4OAFA 4F5QA 3JPPA 5J0TA 4Z6CA 1UEVA 4RQ7A 3MDAA 4I2JA 3PMNA 4I2EA 3UPQA 4UBBA 4M9JA
chains in the Genus database with same CATH topology
4M9HA 4UB5A 4S3NA 4I2GA 5J2IA 4PH5A 4LZDA 3TFSA 2ZH8A 9ICUA 3UPSA 3JZ0A 1HUOA 4QZDA 4P4MA 2DR8A 9ICXA 4KLLA 2PFNA 4ATBA 4PGXA 5J2EA 4F5OA 4WC3A 1KEJA 4RT3A 7ICPA 4WC2A 3JPNA 3C2KA 1ZQJA 4E8FA 3B0YA 3V7KA 3RJFA 4KLSA 2W9MA 4X4SA 5IIJA 1ZQEA 3HJ4A 4FHVA 1BPDA 3H3AA 2O1PA 5IILA 5DDYA 7ICEA 4JWMA 3UXPA 5CWRA 8ICVA 9ICPA 1ZQKA 1JQRA 1R89A 2P66A 5J2CA 8ICMA 1UEUA 4NY8A 5J2DA 2ZH5A 3V7JA 3OVAA 4DO9A 5J2HA 4K4IA 4UB3A 4O9MA 5J29A 4MF8A 4F5PA 9ICLA 4EBJA 2DRBA 1Q79A 4F5RA 8ICHA 2BCRA 2DVIA 3UQ0A 3AU6A 4M47A 2Q66A 4UBCA 9ICOA 3C2MA 3JPRA 1KNYA 1Q78A 4RQ2A 4GXJA 5HRDA 4XQ8A 3RJEA 2ZHAA 1R8CA 1BPXA 1KDHA 7ICRA 2ZH4A 4QZEA 5CB1A 4RQ0A 3AU2A 4FHYA 1R8BA 1JN3A 1ZQVA 8ICPA 9ICAA 4QZ8A 4QZCA 4JWNA 1TVAA 1ZQFA 8ICNA 4MFAA 3WFQE 3WFOA 9ICTA 5CP2A 2ISPA 8ICWA 3RJGA 3OV7A 1ZJMA 1ZQNA 1ZQRA 2I9GA 8ICFA 5DB8A 1F5AA 2BPCA 9ICVA 4NM1A 5IINA 3JPOA 1MIYA 4TUQA 5J2JA 8ICJA 5CR0A 4WC5A 3HIYA 1TFWA 3WFRE 3WFPA 4XRHA 5HREA 9ICWA 8ICUA 9ICBA 2BCSA 4RQ8A 3JPTA 2BCVA 4FH3A 4KLQA 3H38A 5J0OA 5IIOA 4KLHA 5CJ7A 4R65A 4RQ4A 4I2AA 5J2GA 9ICKA 4I2HA 4QZGA 4I2IA 7ICOA 1ZQXA 1VFGA 4X4PA 1VJ7A 1ZQMA 4UB2A 8ICGA 4I29A 3AQNA 4GXKA 2NRKA 5D46A 4UB1A 4YMNA 5J0QA 4X4VA 4K4GA 2BPFA 3ISDA 3MBYA 3C5GA 9ICGA 7ICSA 9ICJA 4I2FA 4AT8A 3C18A 8ICIA 2PBEA 7ICHA 2PFPA 3JYYA 2ZH6A 4X4OA 9ICIA 4R63A 5HHIA 4FHXA 4I27A 4I28A 1PX5A 5DEDA 7ICQA 4RWNA 5HR9A 3UXOA 5J0YA 2ZH1A 4X5VA 4PPXA 5BOMA 4M04A 5D4BA 8ICEA 4Z6DA 4YMMA 5J0RA 7ICMA 4RPYA 1BPBA 4X0BA 1HUZA 4KLDA 4O5KA 4KLGA 5J0XA 3PNCA 1ZQTA 1NOMA 4IQTA 5DECA 3LQCB 8ICLA 3RH4A 4QZ9A 3HX0A 4Z6EA 1BPEA 1ZQDA 4WC4A 2O5AA 1MQ3A 4NKTA 4IQWA 5DKWA 1ZJNA 5DDMA 1UETA 2M2UA 1ZQOA 3GDXA 4M9LA 9ICCA 4R64A 4YN4A 1ZQBA 4UD5A 7ICVA 4UAWA 4IG8A 2M2TA 4WCWA 4NLKA 3MGHA 2PFOA 5DBBA 4XA5A 4YD1A 4GXIA 1ZQUA 4RPXA 2PFQA 4E80A 1ZQHA 2FMSA 1ZQYA 3OGUA 4WC6A 4O5CA 8ICBA 1MIWA 4PHPA 4M9NA 9ICFA 9ICHA 5DBAA 1TFYA 5HHHA 1WOTA 1MIVA 5DB7A 1ZQLA 4DOBA 2RFFA 4R66A 4IQUA 4KLMA 3OUYB 4NLNA 2VANA 4FO6A 1ZQQA 2IHMA 3UXNA 4QZFA 4FHPA 4KLUA 2BCQA 3AQMA 4AT9A 2BPGA 4K4HA 4Z6FA 3ISBA 4DOCA 8ICZA 5IIIA 3UQ2A 3B0XA 1ZQIA 4AT9B 3RH5A 7ICJA 7ICLA 5HRHA 1BPZA 2PXIA 4MF2A 4M0AA 8ICQA 5HRBA 4AT7B 3MDCA 3MGIA 3AUOA 4UB4A 4O5EA 5J0SA 4X4QA 4KLEA 1ZQCA 4WC1A 4RWOA 4DOAA 4FH5A 4P4PA 8ICYA 7ICNA 4PGYA 4I2DA 5J0WA 1V4AA 4KLTA 8ICTA 8ICKA 4M9GA 4QZIA 4PHDA 4WBZA 3H37A 4KLFA 2DR9A 8ICCA 2FMQA 5BPCA 1OU5A 2DR7A 5DB9A 5D49A 5HRFA 7ICFA 1XSNA 3PMLA 3RJHA 3AQLA 5HRLA 4RQ1A 4EBKA 4LVSA 2ZH2A 1JMSA 4WC0A 3ISCA 1TV9A 3OVSA 4XQ7A 4X4NA 3L9DA 1FA0A 5HC9A 4X0AA 4NXZA 4MFCA 4WC7A 5HRIA 2ZH9A 4QZBA 4I2CA 9ICRA 3HJ1A 1ZQSA 4RQ5A 7ICIA 1RZTA 4I2BA 1XSLA 4TUPA 7ICTA 5TZVA 3C66A 5DBCA 7ICUA 3JPSA 3WFSC 9ICNA 4RWQA 3H39A 4FHWA 4P4OA 1MQ2A 1XSPA 4MFFA 8ICOA 1JAJA 3JPQA 4YCXA 2ZHBA 4RT2A 3HW8A 4AT7A 5BOLA 4PGQA 3RJJA 8ICRA 4YMOA 2ID1A 4E7XA 3HWTA 3NYBA 4X4RA 7ICKA 4IQVA 5J2KA 3RJIA 3C5FA 5EOZA 1ZQPA 4X4TA 4KLIA 9ICQA 4F5NA 2DRAA 3LK9A 2ISOA 4KLOA 5J2AA 3OUYA 4KLJA 3TFRA 2BE3A 4RQ3A 9ICMA 9ICSA 5HRKA 4X4UA 1R8AA 4RPZA 3C2LA 2GWSA 1YLQA 4RWPA 5CHGA 1ZQAA 3V72A 8ICAA 4NM2A 1NO5A 4AT8B 2ZH3A 2ZH7A 4UAYA 5J2BA 3RH6A 5J0PA 1ZQWA 1BPYA 4UAZA 4PHAA 4QZAA 3OVBA 7ICGA 5HRGA 2FMPA 4TURA 3AQKA 3RJKA 4WBYA 2M2WA 5CA7A 1RPLA 5F2VO 8ICXA 4YD2A 8ICSA 4PHEA 2DR5A 4TUSA 4M5DA 2M2VA 3V7LA 1ZQGA 4NKUA 4QZHA 5IIKA 4ATBB 5J0UA 2BCUA 4P2HA 5J2FA 4M2YA 4RQ6A 4EP7A 5IIMA 2HHPA 4NLZA 9ICEA 1ZQZA 4XUSA 4UD4A 5DB6A 3K75D 4LZGA 4LT6A 4F5QA 3JPPA 5J0TA 4Z6CA 1UEVA 4RQ7A 3MDAA 4I2JA 3PMNA 4I2EA 3UPQA 4UBBA 4M9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9H A;  4UB5 A;  4S3N A;  4I2G A;  5J2I A;  4PH5 A;  4LZD A;  3TFS A;  2ZH8 A;  9ICU A;  3UPS A;  3JZ0 A;  1HUO A;  4QZD A;  4P4M A;  2DR8 A;  9ICX A;  4KLL A;  2PFN A;  4ATB A;  4PGX A;  5J2E A;  4F5O A;  4WC3 A;  1KEJ A;  4RT3 A;  7ICP A;  4WC2 A;  3JPN A;  3C2K A;  1ZQJ A;  4E8F A;  3B0Y A;  3V7K A;  3RJF A;  4KLS A;  2W9M A;  4X4S A;  5IIJ A;  1ZQE A;  3HJ4 A;  4FHV A;  1BPD A;  3H3A A;  2O1P A;  5IIL A;  5DDY A;  7ICE A;  4JWM A;  3UXP A;  5CWR A;  8ICV A;  9ICP A;  1ZQK A;  1JQR A;  1R89 A;  2P66 A;  5J2C A;  8ICM A;  1UEU A;  4NY8 A;  5J2D A;  2ZH5 A;  3V7J A;  3OVA A;  4DO9 A;  5J2H A;  4K4I A;  4UB3 A;  4O9M A;  5J29 A;  4MF8 A;  4F5P A;  9ICL A;  4EBJ A;  2DRB A;  1Q79 A;  4F5R A;  8ICH A;  2BCR A;  2DVI A;  3UQ0 A;  3AU6 A;  4M47 A;  2Q66 A;  4UBC A;  9ICO A;  3C2M A;  3JPR A;  1KNY A;  1Q78 A;  4RQ2 A;  4GXJ A;  5HRD A;  4XQ8 A;  3RJE A;  2ZHA A;  1R8C A;  1BPX A;  1KDH A;  7ICR A;  2ZH4 A;  4QZE A;  5CB1 A;  4RQ0 A;  3AU2 A;  4FHY A;  1R8B A;  1JN3 A;  1ZQV A;  8ICP A;  9ICA A;  4QZ8 A;  4QZC A;  4JWN A;  1TVA A;  1ZQF A;  8ICN A;  4MFA A;  3WFQ E;  3WFO A;  9ICT A;  5CP2 A;  2ISP A;  8ICW A;  3RJG A;  3OV7 A;  1ZJM A;  1ZQN A;  1ZQR A;  2I9G A;  8ICF A;  5DB8 A;  1F5A A;  2BPC A;  9ICV A;  4NM1 A;  5IIN A;  3JPO A;  1MIY A;  4TUQ A;  5J2J A;  8ICJ A;  5CR0 A;  4WC5 A;  3HIY A;  1TFW A;  3WFR E;  3WFP A;  4XRH A;  5HRE A;  9ICW A;  8ICU A;  9ICB A;  2BCS A;  4RQ8 A;  3JPT A;  2BCV A;  4FH3 A;  4KLQ A;  3H38 A;  5J0O A;  5IIO A;  4KLH A;  5CJ7 A;  4R65 A;  4RQ4 A;  4I2A A;  5J2G A;  9ICK A;  4I2H A;  4QZG A;  4I2I A;  7ICO A;  1ZQX A;  1VFG A;  4X4P A;  1VJ7 A;  1ZQM A;  4UB2 A;  8ICG A;  4I29 A;  3AQN A;  4GXK A;  2NRK A;  5D46 A;  4UB1 A;  4YMN A;  5J0Q A;  4X4V A;  4K4G A;  2BPF A;  3ISD A;  3MBY A;  3C5G A;  9ICG A;  7ICS A;  9ICJ A;  4I2F A;  4AT8 A;  3C18 A;  8ICI A;  2PBE A;  7ICH A;  2PFP A;  3JYY A;  2ZH6 A;  4X4O A;  9ICI A;  4R63 A;  5HHI A;  4FHX A;  4I27 A;  4I28 A;  1PX5 A;  5DED A;  7ICQ A;  4RWN A;  5HR9 A;  3UXO A;  5J0Y A;  2ZH1 A;  4X5V A;  4PPX A;  5BOM A;  4M04 A;  5D4B A;  8ICE A;  4Z6D A;  4YMM A;  5J0R A;  7ICM A;  4RPY A;  1BPB A;  4X0B A;  1HUZ A;  4KLD A;  4O5K A;  4KLG A;  5J0X A;  3PNC A;  1ZQT A;  1NOM A;  4IQT A;  5DEC A;  3LQC B;  8ICL A;  3RH4 A;  4QZ9 A;  3HX0 A;  4Z6E A;  1BPE A;  1ZQD A;  4WC4 A;  2O5A A;  1MQ3 A;  4NKT A;  4IQW A;  5DKW A;  1ZJN A;  5DDM A;  1UET A;  2M2U A;  1ZQO A;  3GDX A;  4M9L A;  9ICC A;  4R64 A;  4YN4 A;  1ZQB A;  4UD5 A;  7ICV A;  4UAW A;  4IG8 A;  2M2T A;  4WCW A;  4NLK A;  3MGH A;  2PFO A;  5DBB A;  4XA5 A;  4YD1 A;  4GXI A;  1ZQU A;  4RPX A;  2PFQ A;  4E80 A;  1ZQH A;  2FMS A;  1ZQY A;  3OGU A;  4WC6 A;  4O5C A;  8ICB A;  1MIW A;  4PHP A;  4M9N A;  9ICF A;  9ICH A;  5DBA A;  1TFY A;  5HHH A;  1WOT A;  1MIV A;  5DB7 A;  1ZQL A;  4DOB A;  2RFF A;  4R66 A;  4IQU A;  4KLM A;  3OUY B;  4NLN A;  2VAN A;  4FO6 A;  1ZQQ A;  2IHM A;  3UXN A;  4QZF A;  4FHP A;  4KLU A;  2BCQ A;  3AQM A;  4AT9 A;  2BPG A;  4K4H A;  4Z6F A;  3ISB A;  4DOC A;  8ICZ A;  5III A;  3UQ2 A;  3B0X A;  1ZQI A;  4AT9 B;  3RH5 A;  7ICJ A;  7ICL A;  5HRH A;  1BPZ A;  2PXI A;  4MF2 A;  4M0A A;  8ICQ A;  5HRB A;  4AT7 B;  3MDC A;  3MGI A;  3AUO A;  4UB4 A;  4O5E A;  5J0S A;  4X4Q A;  4KLE A;  1ZQC A;  4WC1 A;  4RWO A;  4DOA A;  4FH5 A;  4P4P A;  8ICY A;  7ICN A;  4PGY A;  4I2D A;  5J0W A;  1V4A A;  4KLT A;  8ICT A;  8ICK A;  4M9G A;  4QZI A;  4PHD A;  4WBZ A;  3H37 A;  4KLF A;  2DR9 A;  8ICC A;  2FMQ A;  5BPC A;  1OU5 A;  2DR7 A;  5DB9 A;  5D49 A;  5HRF A;  7ICF A;  1XSN A;  3PML A;  3RJH A;  3AQL A;  5HRL A;  4RQ1 A;  4EBK A;  4LVS A;  2ZH2 A;  1JMS A;  4WC0 A;  3ISC A;  1TV9 A;  3OVS A;  4XQ7 A;  4X4N A;  3L9D A;  1FA0 A;  5HC9 A;  4X0A A;  4NXZ A;  4MFC A;  4WC7 A;  5HRI A;  2ZH9 A;  4QZB A;  4I2C A;  9ICR A;  3HJ1 A;  1ZQS A;  4RQ5 A;  7ICI A;  1RZT A;  4I2B A;  1XSL A;  4TUP A;  7ICT A;  5TZV A;  3C66 A;  5DBC A;  7ICU A;  3JPS A;  3WFS C;  9ICN A;  4RWQ A;  3H39 A;  4FHW A;  4P4O A;  1MQ2 A;  1XSP A;  4MFF A;  8ICO A;  1JAJ A;  3JPQ A;  4YCX A;  2ZHB A;  4RT2 A;  3HW8 A;  4AT7 A;  5BOL A;  4PGQ A;  3RJJ A;  8ICR A;  4YMO A;  2ID1 A;  4E7X A;  3HWT A;  3NYB A;  4X4R A;  7ICK A;  4IQV A;  5J2K A;  3RJI A;  3C5F A;  5EOZ A;  1ZQP A;  4X4T A;  4KLI A;  9ICQ A;  4F5N A;  2DRA A;  3LK9 A;  2ISO A;  4KLO A;  5J2A A;  3OUY A;  4KLJ A;  3TFR A;  2BE3 A;  4RQ3 A;  9ICM A;  9ICS A;  5HRK A;  4X4U A;  1R8A A;  4RPZ A;  3C2L A;  2GWS A;  1YLQ A;  4RWP A;  5CHG A;  1ZQA A;  3V72 A;  8ICA A;  4NM2 A;  1NO5 A;  4AT8 B;  2ZH3 A;  2ZH7 A;  4UAY A;  5J2B A;  3RH6 A;  5J0P A;  1ZQW A;  1BPY A;  4UAZ A;  4PHA A;  4QZA A;  3OVB A;  7ICG A;  5HRG A;  2FMP A;  4TUR A;  3AQK A;  3RJK A;  4WBY A;  2M2W A;  5CA7 A;  1RPL A;  5F2V O;  8ICX A;  4YD2 A;  8ICS A;  4PHE A;  2DR5 A;  4TUS A;  4M5D A;  2M2V A;  3V7L A;  1ZQG A;  4NKU A;  4QZH A;  5IIK A;  4ATB B;  5J0U A;  2BCU A;  4P2H A;  5J2F A;  4M2Y A;  4RQ6 A;  4EP7 A;  5IIM A;  2HHP A;  4NLZ A;  9ICE A;  1ZQZ A;  4XUS A;  4UD4 A;  5DB6 A;  3K75 D;  4LZG A;  4LT6 A;  4F5Q A;  3JPP A;  5J0T A;  4Z6C A;  1UEV A;  4RQ7 A;  3MDA A;  4I2J A;  3PMN A;  4I2E A;  3UPQ A;  4UBB A;  4M9J A; 
#chains in the Genus database with same CATH topology
 4M9H A;  4UB5 A;  4S3N A;  4I2G A;  5J2I A;  4PH5 A;  4LZD A;  3TFS A;  2ZH8 A;  9ICU A;  3UPS A;  3JZ0 A;  1HUO A;  4QZD A;  4P4M A;  3ER9 B;  2DR8 A;  4KLL A;  4JLX A;  9ICX A;  2PFN A;  4ATB A;  4PGX A;  5J2E A;  4F5O A;  4WC3 A;  1KEJ A;  4RT3 A;  7ICP A;  4WC2 A;  3CK6 A;  3JPN A;  3C2K A;  1ZQJ A;  4E8F A;  3B0Y A;  3V7K A;  3RJF A;  4KLS A;  2W9M A;  5D63 A;  4X4S A;  5IIJ A;  1ZQE A;  3HJ4 A;  4FHV A;  1BPD A;  4NXX A;  3H3A A;  2O1P A;  5IIL A;  5DDY A;  7ICE A;  4JWM A;  3UXP A;  5CWR A;  8ICV A;  9ICP A;  1ZQK A;  1JQR A;  1R89 A;  2P66 A;  5J2C A;  8ICM A;  1UEU A;  4NY8 A;  5J2D A;  2ZH5 A;  3V7J A;  3OVA A;  4DO9 A;  5J2H A;  5D61 A;  4K4I A;  4UB3 A;  4O9M A;  5J29 A;  4MF8 A;  4F5P A;  9ICL A;  4EBJ A;  2DRB A;  1Q79 A;  4F5R A;  8ICH A;  2BCR A;  3NVO A;  2DVI A;  3UQ0 A;  3AU6 A;  3NWI A;  3MCR A;  4M47 A;  2Q66 A;  4UBC A;  9ICO A;  2BBH A;  4NXW A;  3C2M A;  3JPR A;  1KNY A;  1Q78 A;  4RQ2 A;  4GXJ A;  5HRD A;  4XQ8 A;  3RJE A;  1GPJ A;  2ZHA A;  1R8C A;  1BPX A;  1KDH A;  7ICR A;  2ZH4 A;  4QZE A;  5CB1 A;  4RQ0 A;  3AU2 A;  4FHY A;  1R8B A;  1JN3 A;  1ZQV A;  4EED A;  8ICP A;  9ICA A;  4QZ8 A;  4QZC A;  4LEZ A;  4JWN A;  5CFU A;  1TVA A;  1ZQF A;  8ICN A;  4MFA A;  3WFQ E;  3WFO A;  9ICT A;  5CP2 A;  2ISP A;  8ICW A;  3RJG A;  3OV7 A;  1ZJM A;  1ZQN A;  1ZQR A;  2I9G A;  8ICF A;  5DB8 A;  1F5A A;  2BPC A;  9ICV A;  4NM1 A;  5IIN A;  3JPO A;  1MIY A;  4TUQ A;  5J2J A;  8ICJ A;  5CR0 A;  4K9A A;  4WC5 A;  3HIY A;  5B3Q A;  3WFR E;  3WFP A;  4XRH A;  5HRE A;  1TFW A;  9ICW A;  8ICU A;  9ICB A;  4KM5 A;  4OAI Z;  2BCS A;  5D62 A;  4RQ8 A;  3JPT A;  2BCV A;  4FH3 A;  4KLQ A;  3H38 A;  5J0O A;  5IIO A;  4KLH A;  5CJ7 A;  4R65 A;  4RQ4 A;  4I2A A;  5J2G A;  9ICK A;  4I2H A;  4QZG A;  4I2I A;  7ICO A;  1ZQX A;  1VFG A;  4X4P A;  1VJ7 A;  1ZQM A;  4UB2 A;  8ICG A;  4I29 A;  3AQN A;  4GXK A;  2NRK A;  5D46 A;  4UB1 A;  4YMN A;  5J0Q A;  4X4V A;  4K4G A;  2BPF A;  3ISD A;  3MBY A;  3C5G A;  9ICG A;  7ICS A;  9ICJ A;  4O68 A;  4I2F A;  4AT8 A;  3NKU A;  3C18 A;  4K98 A;  8ICI A;  2PBE A;  7ICH A;  2PFP A;  3JYY A;  2ZH6 A;  4LEY A;  4X4O A;  9ICI A;  4R63 A;  5HHI A;  4FHX A;  4I27 A;  4I28 A;  1PX5 A;  5DED A;  7ICQ A;  4RWN A;  5HR9 A;  3UXO A;  5J0Y A;  2ZH1 A;  4X5V A;  4PPX A;  5BOM A;  4M04 A;  5D4B A;  8ICE A;  4Z6D A;  4YMM A;  4K8V A;  5J0R A;  7ICM A;  4RPY A;  1BPB A;  4X0B A;  1HUZ A;  4O67 A;  4KLD A;  4O5K A;  4KLG A;  4WH5 A;  4K99 A;  5J0X A;  3PNC A;  1ZQT A;  1NOM A;  4IQT A;  4O69 A;  5DEC A;  3LQC B;  8ICL A;  3RH4 A;  4QZ9 A;  3HX0 A;  4Z6E A;  2IHO A;  1BPE A;  1ZQD A;  4WC4 A;  2O5A A;  1MQ3 A;  4NKT A;  4IQW A;  5DKW A;  1ZJN A;  5DDM A;  1UET A;  2M2U A;  4WQL A;  1ZQO A;  3GDX A;  4M9L A;  9ICC A;  4R64 A;  4YN4 A;  4N7R A;  5CFT A;  1ZQB A;  4UD5 A;  4K96 A;  7ICV A;  4UAW A;  4IG8 A;  2M2T A;  4WCW A;  4NLK A;  3MGH A;  2PFO A;  5DBB A;  4XA5 A;  4JLZ A;  4YD1 A;  4GXI A;  1ZQU A;  4RPX A;  2PFQ A;  4E80 A;  1ZQH A;  2FMS A;  1ZQY A;  3ERC C;  4K97 A;  4OAG A;  3OGU A;  4WC6 A;  4O5C A;  8ICB A;  1MIW A;  2B56 A;  4PHP A;  4M9N A;  9ICF A;  9ICH A;  2EWR A;  5DBA A;  1TFY A;  5HHH A;  1WOT A;  1MIV A;  5DB7 A;  1ZQL A;  4DOB A;  2RFF A;  4R66 A;  4IQU A;  4LEW A;  4KLM A;  3OUY B;  4NLN A;  2VAN A;  4FO6 A;  1ZQQ A;  2IHM A;  3UXN A;  4QZF A;  4FHP A;  4KLU A;  2BCQ A;  2IUB A;  5JTG A;  3AQM A;  5CHE A;  4AT9 A;  2BPG A;  4K4H A;  4Z6F A;  4NXT A;  3ISB A;  4DOC A;  8ICZ A;  5III A;  3UQ2 A;  3B0X A;  1ZQI A;  4AT9 B;  3RH5 A;  7ICJ A;  7ICL A;  4EV6 A;  5HRH A;  1BPZ A;  2PXI A;  4MF2 A;  4M0A A;  2B51 A;  8ICQ A;  2HN1 A;  5HRB A;  4AT7 B;  3MDC A;  3MGI A;  3AUO A;  4UB4 A;  4O5E A;  5J0S A;  4X4Q A;  4KLE A;  1ZQC A;  4WC1 A;  4RWO A;  4DOA A;  4FH5 A;  4P4P A;  8ICY A;  7ICN A;  3ER8 C;  4PGY A;  4I2D A;  5J0W A;  1V4A A;  4KLT A;  2GAF D;  8ICT A;  8ICK A;  4M9G A;  4QZI A;  4PHD A;  4WBZ A;  3H37 A;  4KLF A;  2DR9 A;  8ICC A;  4EGW A;  2FMQ A;  5BPC A;  1OU5 A;  2DR7 A;  5DB9 A;  5D49 A;  5HRF A;  7ICF A;  1XSN A;  3PML A;  3RJH A;  3AQL A;  5HRL A;  2B4V A;  4EBK A;  4RQ1 A;  2ZH2 A;  4LVS A;  1JMS A;  4WC0 A;  3ISC A;  1TV9 A;  4WOY A;  3OVS A;  4XQ7 A;  4X4N A;  3L9D A;  1FA0 A;  5HC9 A;  4X0A A;  4NXZ A;  4MFC A;  4WC7 A;  5HRI A;  2ZH9 A;  4QZB A;  4I2C A;  9ICR A;  3HJ1 A;  1ZQS A;  4RQ5 A;  7ICI A;  1RZT A;  4I2B A;  1XSL A;  4TUP A;  7ICT A;  5TZV A;  4WQK A;  3C66 A;  3PHZ A;  5DBC A;  7ICU A;  3JPS A;  3WFS C;  9ICN A;  3OWG A;  4RWQ A;  3H39 A;  4FHW A;  4P4O A;  1MQ2 A;  1XSP A;  4MFF A;  8ICO A;  1JAJ A;  3JPQ A;  4YCX A;  2ZHB A;  3EF2 A;  4RT2 A;  3HW8 A;  4AT7 A;  5CFS A;  5BOL A;  4PGQ A;  3RJJ A;  4LEV A;  8ICR A;  4MKP A;  5B3P A;  4YMO A;  2ID1 A;  4E7X A;  3HWT A;  4KB6 A;  3NYB A;  4X4R A;  7ICK A;  4IQV A;  5J2K A;  3RJI A;  3C5F A;  5EOZ A;  1ZQP A;  4X4T A;  2FCL A;  4KLI A;  9ICQ A;  4XJE A;  4F5N A;  2DRA A;  3LK9 A;  2ISO A;  4KLO A;  4NXU A;  5J2A A;  3OUY A;  4KLJ A;  3TFR A;  2BE3 A;  4RQ3 A;  9ICM A;  9ICS A;  5HRK A;  4X4U A;  1R8A A;  4RPZ A;  3C2L A;  2GWS A;  1YLQ A;  4RWP A;  2GA9 D;  5CHG A;  1ZQA A;  4EEB A;  3V72 A;  8ICA A;  4NM2 A;  1NO5 A;  4AT8 B;  4HX0 A;  4NXV A;  2ZH3 A;  2ZH7 A;  4UAY A;  3JCF A;  5J2B A;  3K7D A;  3RH6 A;  5J0P A;  1ZQW A;  1BPY A;  4UAZ A;  4PHA A;  4QZA A;  3OVB A;  7ICG A;  5HRG A;  2FMP A;  2BBJ A;  4FO1 A;  3AQK A;  4TUR A;  3RJK A;  4WBY A;  2M2W A;  5CA7 A;  1RPL A;  2HN2 A;  4O6A A;  5F2V O;  8ICX A;  4YD2 A;  8ICS A;  4OAH A;  4PHE A;  2DR5 A;  4TUS A;  4M5D A;  2M2V A;  3V7L A;  1ZQG A;  4K9B A;  4NKU A;  4QZH A;  5IIK A;  4ATB B;  5J0U A;  2BCU A;  4P2H A;  5J2F A;  4M2Y A;  4RQ6 A;  4EP7 A;  5IIM A;  2HHP A;  4NLZ A;  9ICE A;  1ZQZ A;  4I0U A;  4XUS A;  4UD4 A;  5DB6 A;  3K75 D;  4LZG A;  4LT6 A;  4OAF A;  4F5Q A;  3JPP A;  5J0T A;  4Z6C A;  1UEV A;  4RQ7 A;  3MDA A;  4I2J A;  3PMN A;  4I2E A;  3UPQ A;  4UBB A;  4M9J A; 
#chains in the Genus database with same CATH homology
 4M9H A;  4UB5 A;  4S3N A;  4I2G A;  5J2I A;  4PH5 A;  4LZD A;  3TFS A;  2ZH8 A;  9ICU A;  3UPS A;  3JZ0 A;  1HUO A;  4QZD A;  4P4M A;  2DR8 A;  9ICX A;  4KLL A;  2PFN A;  4ATB A;  4PGX A;  5J2E A;  4F5O A;  4WC3 A;  1KEJ A;  4RT3 A;  7ICP A;  4WC2 A;  3JPN A;  3C2K A;  1ZQJ A;  4E8F A;  3B0Y A;  3V7K A;  3RJF A;  4KLS A;  2W9M A;  4X4S A;  5IIJ A;  1ZQE A;  3HJ4 A;  4FHV A;  1BPD A;  3H3A A;  2O1P A;  5IIL A;  5DDY A;  7ICE A;  4JWM A;  3UXP A;  5CWR A;  8ICV A;  9ICP A;  1ZQK A;  1JQR A;  1R89 A;  2P66 A;  5J2C A;  8ICM A;  1UEU A;  4NY8 A;  5J2D A;  2ZH5 A;  3V7J A;  3OVA A;  4DO9 A;  5J2H A;  4K4I A;  4UB3 A;  4O9M A;  5J29 A;  4MF8 A;  4F5P A;  9ICL A;  4EBJ A;  2DRB A;  1Q79 A;  4F5R A;  8ICH A;  2BCR A;  2DVI A;  3UQ0 A;  3AU6 A;  4M47 A;  2Q66 A;  4UBC A;  9ICO A;  3C2M A;  3JPR A;  1KNY A;  1Q78 A;  4RQ2 A;  4GXJ A;  5HRD A;  4XQ8 A;  3RJE A;  2ZHA A;  1R8C A;  1BPX A;  1KDH A;  7ICR A;  2ZH4 A;  4QZE A;  5CB1 A;  4RQ0 A;  3AU2 A;  4FHY A;  1R8B A;  1JN3 A;  1ZQV A;  8ICP A;  9ICA A;  4QZ8 A;  4QZC A;  4JWN A;  1TVA A;  1ZQF A;  8ICN A;  4MFA A;  3WFQ E;  3WFO A;  9ICT A;  5CP2 A;  2ISP A;  8ICW A;  3RJG A;  3OV7 A;  1ZJM A;  1ZQN A;  1ZQR A;  2I9G A;  8ICF A;  5DB8 A;  1F5A A;  2BPC A;  9ICV A;  4NM1 A;  5IIN A;  3JPO A;  1MIY A;  4TUQ A;  5J2J A;  8ICJ A;  5CR0 A;  4WC5 A;  3HIY A;  1TFW A;  3WFR E;  3WFP A;  4XRH A;  5HRE A;  9ICW A;  8ICU A;  9ICB A;  2BCS A;  4RQ8 A;  3JPT A;  2BCV A;  4FH3 A;  4KLQ A;  3H38 A;  5J0O A;  5IIO A;  4KLH A;  5CJ7 A;  4R65 A;  4RQ4 A;  4I2A A;  5J2G A;  9ICK A;  4I2H A;  4QZG A;  4I2I A;  7ICO A;  1ZQX A;  1VFG A;  4X4P A;  1VJ7 A;  1ZQM A;  4UB2 A;  8ICG A;  4I29 A;  3AQN A;  4GXK A;  2NRK A;  5D46 A;  4UB1 A;  4YMN A;  5J0Q A;  4X4V A;  4K4G A;  2BPF A;  3ISD A;  3MBY A;  3C5G A;  9ICG A;  7ICS A;  9ICJ A;  4I2F A;  4AT8 A;  3C18 A;  8ICI A;  2PBE A;  7ICH A;  2PFP A;  3JYY A;  2ZH6 A;  4X4O A;  9ICI A;  4R63 A;  5HHI A;  4FHX A;  4I27 A;  4I28 A;  1PX5 A;  5DED A;  7ICQ A;  4RWN A;  5HR9 A;  3UXO A;  5J0Y A;  2ZH1 A;  4X5V A;  4PPX A;  5BOM A;  4M04 A;  5D4B A;  8ICE A;  4Z6D A;  4YMM A;  5J0R A;  7ICM A;  4RPY A;  1BPB A;  4X0B A;  1HUZ A;  4KLD A;  4O5K A;  4KLG A;  5J0X A;  3PNC A;  1ZQT A;  1NOM A;  4IQT A;  5DEC A;  3LQC B;  8ICL A;  3RH4 A;  4QZ9 A;  3HX0 A;  4Z6E A;  1BPE A;  1ZQD A;  4WC4 A;  2O5A A;  1MQ3 A;  4NKT A;  4IQW A;  5DKW A;  1ZJN A;  5DDM A;  1UET A;  2M2U A;  1ZQO A;  3GDX A;  4M9L A;  9ICC A;  4R64 A;  4YN4 A;  1ZQB A;  4UD5 A;  7ICV A;  4UAW A;  4IG8 A;  2M2T A;  4WCW A;  4NLK A;  3MGH A;  2PFO A;  5DBB A;  4XA5 A;  4YD1 A;  4GXI A;  1ZQU A;  4RPX A;  2PFQ A;  4E80 A;  1ZQH A;  2FMS A;  1ZQY A;  3OGU A;  4WC6 A;  4O5C A;  8ICB A;  1MIW A;  4PHP A;  4M9N A;  9ICF A;  9ICH A;  5DBA A;  1TFY A;  5HHH A;  1WOT A;  1MIV A;  5DB7 A;  1ZQL A;  4DOB A;  2RFF A;  4R66 A;  4IQU A;  4KLM A;  3OUY B;  4NLN A;  2VAN A;  4FO6 A;  1ZQQ A;  2IHM A;  3UXN A;  4QZF A;  4FHP A;  4KLU A;  2BCQ A;  3AQM A;  4AT9 A;  2BPG A;  4K4H A;  4Z6F A;  3ISB A;  4DOC A;  8ICZ A;  5III A;  3UQ2 A;  3B0X A;  1ZQI A;  4AT9 B;  3RH5 A;  7ICJ A;  7ICL A;  5HRH A;  1BPZ A;  2PXI A;  4MF2 A;  4M0A A;  8ICQ A;  5HRB A;  4AT7 B;  3MDC A;  3MGI A;  3AUO A;  4UB4 A;  4O5E A;  5J0S A;  4X4Q A;  4KLE A;  1ZQC A;  4WC1 A;  4RWO A;  4DOA A;  4FH5 A;  4P4P A;  8ICY A;  7ICN A;  4PGY A;  4I2D A;  5J0W A;  1V4A A;  4KLT A;  8ICT A;  8ICK A;  4M9G A;  4QZI A;  4PHD A;  4WBZ A;  3H37 A;  4KLF A;  2DR9 A;  8ICC A;  2FMQ A;  5BPC A;  1OU5 A;  2DR7 A;  5DB9 A;  5D49 A;  5HRF A;  7ICF A;  1XSN A;  3PML A;  3RJH A;  3AQL A;  5HRL A;  4RQ1 A;  4EBK A;  4LVS A;  2ZH2 A;  1JMS A;  4WC0 A;  3ISC A;  1TV9 A;  3OVS A;  4XQ7 A;  4X4N A;  3L9D A;  1FA0 A;  5HC9 A;  4X0A A;  4NXZ A;  4MFC A;  4WC7 A;  5HRI A;  2ZH9 A;  4QZB A;  4I2C A;  9ICR A;  3HJ1 A;  1ZQS A;  4RQ5 A;  7ICI A;  1RZT A;  4I2B A;  1XSL A;  4TUP A;  7ICT A;  5TZV A;  3C66 A;  5DBC A;  7ICU A;  3JPS A;  3WFS C;  9ICN A;  4RWQ A;  3H39 A;  4FHW A;  4P4O A;  1MQ2 A;  1XSP A;  4MFF A;  8ICO A;  1JAJ A;  3JPQ A;  4YCX A;  2ZHB A;  4RT2 A;  3HW8 A;  4AT7 A;  5BOL A;  4PGQ A;  3RJJ A;  8ICR A;  4YMO A;  2ID1 A;  4E7X A;  3HWT A;  3NYB A;  4X4R A;  7ICK A;  4IQV A;  5J2K A;  3RJI A;  3C5F A;  5EOZ A;  1ZQP A;  4X4T A;  4KLI A;  9ICQ A;  4F5N A;  2DRA A;  3LK9 A;  2ISO A;  4KLO A;  5J2A A;  3OUY A;  4KLJ A;  3TFR A;  2BE3 A;  4RQ3 A;  9ICM A;  9ICS A;  5HRK A;  4X4U A;  1R8A A;  4RPZ A;  3C2L A;  2GWS A;  1YLQ A;  4RWP A;  5CHG A;  1ZQA A;  3V72 A;  8ICA A;  4NM2 A;  1NO5 A;  4AT8 B;  2ZH3 A;  2ZH7 A;  4UAY A;  5J2B A;  3RH6 A;  5J0P A;  1ZQW A;  1BPY A;  4UAZ A;  4PHA A;  4QZA A;  3OVB A;  7ICG A;  5HRG A;  2FMP A;  4TUR A;  3AQK A;  3RJK A;  4WBY A;  2M2W A;  5CA7 A;  1RPL A;  5F2V O;  8ICX A;  4YD2 A;  8ICS A;  4PHE A;  2DR5 A;  4TUS A;  4M5D A;  2M2V A;  3V7L A;  1ZQG A;  4NKU A;  4QZH A;  5IIK A;  4ATB B;  5J0U A;  2BCU A;  4P2H A;  5J2F A;  4M2Y A;  4RQ6 A;  4EP7 A;  5IIM A;  2HHP A;  4NLZ A;  9ICE A;  1ZQZ A;  4XUS A;  4UD4 A;  5DB6 A;  3K75 D;  4LZG A;  4LT6 A;  4F5Q A;  3JPP A;  5J0T A;  4Z6C A;  1UEV A;  4RQ7 A;  3MDA A;  4I2J A;  3PMN A;  4I2E A;  3UPQ A;  4UBB A;  4M9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...