4WC1A

Structure of trna-processing enzyme with ctp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
382
structure length
364
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 114
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc1A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc1A01
1ZQXA 4UD4A 3AQNA 3JPQA 4ATBB 3HJ1A 3V7LA 5DBCA 4M9GA 2PFPA 4F5PA 1ZQIA 1RPLA 4K4HA 5HRBA 5BOLA 1KNYA 2HHPA 5BPCA 3RJEA 7ICVA 3AQMA 4RQ3A 4WC7A 4FHYA 4M9LA 4M2YA 2Q66A 4WC0A 5TZVA 7ICJA 3TFSA 1XSPA 4RQ5A 3ISCA 5DEDA 9ICOA 9ICGA 9ICIA 2DRAA 2ZH2A 4ATBA 4LZDA 4QZEA 1R8CA 1ZQQA 1UETA 5J0WA 4RQ4A 5J2DA 2DR8A 1BPBA 4F5QA 3HIYA 2ID1A 3ISBA 4QZCA 4MFFA 2ZH8A 3H37A 1HUOA 1ZQRA 1Q78A 8ICEA 3RJHA 3UQ0A 2O1PA 4KLTA 3JYYA 4X4OA 5J29A 3OUYB 4X4PA 4M9NA 8ICGA 4LZGA 4YMNA 8ICPA 4X4QA 4I2FA 4WC5A 3MBYA 5DDMA 4E7XA 3C5GA 4NLNA 5DB6A 7ICMA 3UXNA 5HRGA 4UB1A 9ICEA 4P4OA 5IIMA 4I2IA 4M9HA 5J0SA 1YLQA 2BCQA 9ICAA 2ZHAA 3V72A 5J0XA 5D4BA 1KEJA 4KLEA 1V4AA 4RWPA 4PGXA 1NO5A 3TFRA 4IQTA 4TUSA 1BPYA 4PHAA 1BPEA 4WC3A 9ICTA 2DVIA 8ICAA 3OVAA 4I29A 2DR5A 4DOCA 1R89A 2BCUA 4RQ8A 3RH5A 1ZQOA 2I9GA 8ICRA 4WBZA 4RQ7A 9ICPA 3C2LA 4NLZA 1R8AA 4X4TA 1ZQMA 3C5FA 4TUPA 8ICWA 4UAWA 4Z6DA 7ICHA 5J0QA 1MIVA 2BCSA 3HX0A 5HRLA 4FH3A 5DB9A 4NXZA 1TFWA 4R66A 1ZQJA 5J2FA 4UB3A 5HRKA 4QZGA 7ICFA 9ICMA 5HC9A 4WC6A 1ZQHA 4FHVA 5DKWA 5CWRA 3OVBA 9ICKA 4RWQA 1ZQGA 3UPQA 4PGYA 7ICOA 5DBBA 9ICWA 3UPSA 3WFOA 4KLOA 5IIIA 2ZH3A 5D49A 4IQWA 4QZDA 3L9DA 4TUQA 4RWNA 4MFCA 5BOMA 5F2VO 4JWMA 4DOAA 4GXIA 8ICBA 4K4GA 1ZQSA 1BPDA 4I2BA 8ICLA 5J0TA 3B0YA 3HWTA 9ICCA 4I2EA 4F5NA 5J2EA 2PBEA 4M0AA 3RH4A 4UAZA 4XRHA 4MFAA 4P2HA 1FA0A 4KLUA 2PXIA 3GDXA 4WC2A 2ZH5A 4YMOA 3C2KA 1JMSA 8ICFA 4M9JA 4E80A 1ZQUA 4QZ9A 3OVSA 1KDHA 3JPTA 3V7KA 3MGIA 1XSNA 5CA7A 4UB2A 1PX5A 4WC1A 3WFPA 3PNCA 3RJJA 1TFYA 4FHWA 4GXJA 4XA5A 2ZH9A 9ICLA 4LT6A 9ICRA 3JPSA 3AU6A 3RJIA 1OU5A 3PMNA 4P4PA 5J0PA 4RQ0A 3AQKA 4I27A 9ICSA 4NM1A 2DRBA 1JQRA 2ZH7A 9ICHA 5CR0A 5DB8A 4O9MA 4YD1A 9ICVA 4UB5A 4EBJA 3AQLA 3RH6A 2BE3A 8ICCA 4X0BA 2ISPA 8ICYA 1RZTA 1XSLA 8ICKA 5J2BA 4NKUA 8ICUA 2VANA 9ICXA 3OUYA 5J2GA 1ZQKA 4I2JA 5CB1A 7ICLA 4XQ7A 1ZQZA 3UQ2A 1TVAA 4M47A 9ICFA 5J2KA 5J0UA 3ISDA 4RPZA 1MIWA 4PHPA 7ICKA 4LVSA 8ICVA 3JPRA 3HJ4A 4MF8A 4IQVA 4QZ8A 3H38A 5J0RA 8ICQA 4QZIA 4I2GA 4QZHA 4X4RA 3MDCA 4RQ1A 4PHEA 3RJFA 4NM2A 1JAJA 2DR7A 5J0OA 4UAYA 4RPYA 5J2CA 3RJGA 2ZH1A 4NY8A 5HRFA 4MF2A 7ICQA 4RT2A 2BCRA 4UD5A 7ICGA 4R65A 1MQ2A 7ICPA 4RT3A 4UB4A 3MDAA 4YN4A 1ZQPA 4S3NA 4AT7B 9ICBA 4FO6A 5HHIA 4RWOA 8ICHA 5EOZA 4KLFA 3WFQE 2PFOA 7ICSA 4PH5A 7ICUA 3LK9A 5CJ7A 1HUZA 4F5OA 1ZQYA 3B0XA 3WFRE 4NKTA 2BPCA 9ICQA 1TV9A 5HR9A 5CP2A 2P66A 4O5KA 3UXOA 1UEUA 5J2HA 4KLJA 4R64A 4I2AA 3NYBA 4PGQA 7ICTA 4NLKA 3V7JA 8ICTA 3OV7A 4XUSA 4YD2A 3K75D 5J2JA 1F5AA 2FMQA 2GWSA 2M2VA 7ICNA 1ZQVA 4KLIA 9ICNA 2O5AA 4DO9A 4IG8A 2M2UA 3PMLA 3JPOA 4DOBA 4X4NA 1Q79A 4QZFA 1ZQWA 2ZHBA 1ZQTA 4PPXA 4IQUA 4FHXA 1ZQBA 5HREA 1VJ7A 9ICUA 3AUOA 5IIKA 7ICIA 1ZQCA 4WBYA 2PFNA 3WFSC 5D46A 5J2AA 3JPNA 4QZAA 1BPZA 4E8FA 4WCWA 8ICSA 4AT9B 4FHPA 3MGHA 3LQCB 1MIYA 4X0AA 8ICZA 5HRDA 5IIJA 4XQ8A 4RQ6A 1UEVA 4X5VA 4KLLA 4KLQA 4KLGA 1BPXA 3HW8A 1ZQDA 2BCVA 4I2DA 4GXKA 2M2WA 2BPFA 4JWNA 2W9MA 4X4VA 3C2MA 4RQ2A 1NOMA 3AU2A 5DB7A 1ZQFA 4AT9A 5CHGA 4M5DA 1R8BA 5IIOA 4YMMA 5J0YA 1ZQAA 1ZJMA 4I2CA 4O5CA 5DDYA 3RJKA 1VFGA 4Z6FA 4EP7A 3UXPA 1ZQNA 8ICIA 4K4IA 2FMSA 5IILA 2ISOA 4R63A 4WC4A 4AT8B 8ICJA 4P4MA 4QZBA 5HHHA 4O5EA 3C18A 3JZ0A 5J2IA 4Z6CA 2M2TA 1ZQLA 4M04A 4EBKA 4RPXA 4F5RA 8ICOA 4X4SA 3C66A 5HRIA 1ZQEA 2DR9A 4KLMA 2IHMA 4Z6EA 4KLDA 2NRKA 4PHDA 8ICMA 2FMPA 4KLSA 4YCXA 2PFQA 3OGUA 2RFFA 3JPPA 8ICNA 3H3AA 5DBAA 5DECA 1JN3A 4UBCA 7ICRA 4I28A 5IINA 4X4UA 2ZH4A 4AT8A 9ICJA 3H39A 2ZH6A 7ICEA 4I2HA 8ICXA 4TURA 4FH5A 4KLHA 4UBBA 1WOTA 5HRHA 4AT7A 1MQ3A 1ZJNA 2BPGA
chains in the Genus database with same CATH superfamily
1ZQXA 4UD4A 3AQNA 3JPQA 4ATBB 3HJ1A 3V7LA 5DBCA 4M9GA 2PFPA 4F5PA 1ZQIA 1RPLA 4K4HA 5HRBA 5BOLA 4K9BA 1KNYA 2HHPA 5BPCA 3RJEA 7ICVA 3AQMA 4RQ3A 4WC7A 4FHYA 4M9LA 4M2YA 2Q66A 4WC0A 5TZVA 7ICJA 4OAGA 3TFSA 1XSPA 4RQ5A 3ISCA 5DEDA 9ICOA 9ICGA 9ICIA 2DRAA 2ZH2A 3OWGA 4ATBA 4LZDA 4QZEA 1R8CA 1ZQQA 1UETA 5J0WA 4EV6A 4RQ4A 5J2DA 2DR8A 1BPBA 4F5QA 3HIYA 4I0UA 2ID1A 3ISBA 4QZCA 4MFFA 2ZH8A 3H37A 1HUOA 1ZQRA 1Q78A 8ICEA 3RJHA 3UQ0A 2O1PA 4KLTA 4NXWA 3JYYA 4X4OA 5J29A 3OUYB 5D63A 4X4PA 4M9NA 8ICGA 4LZGA 4YMNA 8ICPA 4X4QA 4I2FA 4WC5A 3MBYA 5DDMA 4E7XA 3C5GA 4NLNA 5DB6A 7ICMA 3UXNA 5HRGA 4UB1A 9ICEA 4P4OA 5IIMA 4I2IA 4M9HA 5J0SA 1YLQA 2BCQA 9ICAA 2ZHAA 3V72A 5J0XA 5D4BA 1KEJA 4KLEA 1V4AA 4RWPA 4PGXA 1NO5A 3TFRA 4IQTA 2FCLA 4TUSA 1BPYA 4PHAA 1BPEA 4WC3A 9ICTA 2DVIA 8ICAA 3OVAA 4I29A 5CHEA 4DOCA 1R89A 2DR5A 2BCUA 4RQ8A 3RH5A 1ZQOA 2I9GA 8ICRA 4WBZA 4RQ7A 9ICPA 3C2LA 4NLZA 1R8AA 4X4TA 1ZQMA 3C5FA 3ER8C 4TUPA 8ICWA 4UAWA 4Z6DA 7ICHA 5J0QA 1MIVA 2BCSA 3HX0A 5HRLA 4FH3A 5DB9A 4NXZA 1TFWA 4WOYA 4R66A 1ZQJA 5J2FA 4UB3A 3ER9B 5HRKA 2HN1A 4QZGA 7ICFA 9ICMA 5HC9A 4WC6A 1ZQHA 4FHVA 5DKWA 5CWRA 3OVBA 9ICKA 4RWQA 1ZQGA 3UPQA 4PGYA 7ICOA 5DBBA 9ICWA 5CFUA 3UPSA 3WFOA 4KLOA 5IIIA 2ZH3A 5D49A 4IQWA 4QZDA 3L9DA 4TUQA 4K99A 4RWNA 4FO1A 4MFCA 5BOMA 5F2VO 4WQKA 4JWMA 4DOAA 3NWIA 4GXIA 8ICBA 4K4GA 1ZQSA 1BPDA 4I2BA 8ICLA 5J0TA 3B0YA 3HWTA 9ICCA 4I2EA 4F5NA 5J2EA 2PBEA 4M0AA 3RH4A 4UAZA 3NVOA 4XRHA 4MFAA 4P2HA 1FA0A 4KLUA 2PXIA 3GDXA 4WC2A 4WQLA 2ZH5A 4YMOA 3C2KA 1JMSA 8ICFA 4M9JA 4E80A 4K8VA 1ZQUA 4QZ9A 4JLXA 3OVSA 1KDHA 4O69A 3JPTA 3V7KA 4NXXA 3MGIA 1XSNA 5CA7A 4UB2A 1PX5A 4WC1A 3WFPA 3PNCA 3RJJA 1TFYA 4FHWA 3MCRA 4GXJA 4XA5A 2ZH9A 9ICLA 2B51A 4LT6A 9ICRA 3JPSA 3AU6A 3RJIA 1OU5A 5CFTA 3PMNA 4LEYA 4P4PA 5J0PA 4RQ0A 3AQKA 4I27A 9ICSA 4NM1A 2DRBA 1JQRA 2ZH7A 9ICHA 5CR0A 5DB8A 4O9MA 4YD1A 9ICVA 4UB5A 4EBJA 3AQLA 3RH6A 2BE3A 2GAFD 8ICCA 4X0BA 2ISPA 4WH5A 8ICYA 1RZTA 1XSLA 4NXVA 5JTGA 8ICKA 5J2BA 4NKUA 4K97A 8ICUA 2VANA 9ICXA 3OUYA 5J2GA 1ZQKA 4I2JA 5CB1A 7ICLA 4O6AA 4XQ7A 1ZQZA 4K9AA 3UQ2A 1TVAA 4M47A 9ICFA 5J2KA 5J0UA 3ISDA 4RPZA 1MIWA 4PHPA 7ICKA 4LVSA 8ICVA 3JPRA 3ERCC 2GA9D 3HJ4A 4MF8A 4IQVA 4QZ8A 3H38A 5J0RA 8ICQA 4QZIA 4I2GA 4QZHA 4X4RA 3MDCA 4RQ1A 4PHEA 3RJFA 4NM2A 1JAJA 2DR7A 5J0OA 2IUBA 4JLZA 4UAYA 4RPYA 5J2CA 3RJGA 2BBJA 2ZH1A 2B56A 5B3QA 4NY8A 5HRFA 4KM5A 4MF2A 7ICQA 5D61A 4RT2A 2BCRA 4UD5A 4O67A 7ICGA 4R65A 1MQ2A 7ICPA 4RT3A 4UB4A 3MDAA 4YN4A 1ZQPA 4S3NA 4AT7B 9ICBA 4FO6A 5HHIA 4RWOA 4OAIZ 8ICHA 5EOZA 4KLFA 3WFQE 2PFOA 7ICSA 4PH5A 4K98A 3LK9A 7ICUA 5CJ7A 1GPJA 1HUZA 4F5OA 1ZQYA 4N7RA 3B0XA 5D62A 3WFRE 4NKTA 2BPCA 9ICQA 1TV9A 4NXUA 5HR9A 5CFSA 2HN2A 5CP2A 2P66A 4O5KA 3UXOA 1UEUA 5J2HA 4KLJA 4R64A 4I2AA 3CK6A 3NYBA 4PGQA 7ICTA 4NLKA 3V7JA 4EEBA 8ICTA 3OV7A 4XUSA 4YD2A 3K75D 5J2JA 1F5AA 4LEVA 2FMQA 2GWSA 2M2VA 7ICNA 2BBHA 1ZQVA 4KLIA 4NXTA 9ICNA 2O5AA 4DO9A 4IG8A 2M2UA 3PMLA 3JPOA 4DOBA 4X4NA 1Q79A 4QZFA 1ZQWA 2ZHBA 1ZQTA 4PPXA 4IQUA 4FHXA 1ZQBA 5HREA 1VJ7A 9ICUA 3AUOA 5IIKA 7ICIA 1ZQCA 4WBYA 4OAFA 4EGWA 2PFNA 5D46A 3WFSC 3JCFA 5J2AA 3JPNA 4QZAA 1BPZA 4E8FA 4WCWA 4LEZA 8ICSA 5B3PA 4K96A 4AT9B 4FHPA 3MGHA 3LQCB 1MIYA 4X0AA 8ICZA 5HRDA 5IIJA 4XQ8A 4RQ6A 1UEVA 4X5VA 2IHOA 4KLLA 4KLQA 4KLGA 1BPXA 3PHZA 3HW8A 1ZQDA 2BCVA 4I2DA 4GXKA 2M2WA 2BPFA 4JWNA 2W9MA 4X4VA 3C2MA 4RQ2A 1NOMA 4OAHA 3AU2A 4MKPA 5DB7A 1ZQFA 4AT9A 5CHGA 4M5DA 1R8BA 5IIOA 4YMMA 5J0YA 1ZQAA 1ZJMA 4I2CA 4O5CA 5DDYA 4XJEA 3RJKA 1VFGA 4Z6FA 4EP7A 3UXPA 1ZQNA 2B4VA 8ICIA 4EEDA 4KB6A 4K4IA 2FMSA 5IILA 2ISOA 4R63A 4WC4A 4AT8B 3K7DA 8ICJA 4P4MA 4QZBA 5HHHA 4O5EA 3C18A 3JZ0A 5J2IA 4Z6CA 2M2TA 2EWRA 1ZQLA 4M04A 4EBKA 4RPXA 4F5RA 8ICOA 4X4SA 3C66A 5HRIA 1ZQEA 2DR9A 4KLMA 3NKUA 2IHMA 4Z6EA 4KLDA 2NRKA 4PHDA 8ICMA 2FMPA 4KLSA 4YCXA 2PFQA 3OGUA 2RFFA 3JPPA 8ICNA 4LEWA 3H3AA 5DBAA 5DECA 1JN3A 4UBCA 7ICRA 4I28A 5IINA 4X4UA 2ZH4A 4AT8A 9ICJA 3H39A 4HX0A 2ZH6A 7ICEA 4I2HA 8ICXA 4O68A 4TURA 4FH5A 4KLHA 4UBBA 1WOTA 5HRHA 3EF2A 4AT7A 1MQ3A 1ZJNA 2BPGA
chains in the Genus database with same CATH topology
1ZQXA 4UD4A 3AQNA 3JPQA 4ATBB 3HJ1A 3V7LA 5DBCA 4M9GA 2PFPA 4F5PA 1ZQIA 1RPLA 4K4HA 5HRBA 5BOLA 1KNYA 2HHPA 5BPCA 3RJEA 7ICVA 3AQMA 4RQ3A 4WC7A 4FHYA 4M9LA 4M2YA 2Q66A 4WC0A 5TZVA 7ICJA 3TFSA 1XSPA 4RQ5A 3ISCA 5DEDA 9ICOA 9ICGA 9ICIA 2DRAA 2ZH2A 4ATBA 4LZDA 4QZEA 1R8CA 1ZQQA 1UETA 5J0WA 4RQ4A 5J2DA 2DR8A 1BPBA 4F5QA 3HIYA 2ID1A 3ISBA 4QZCA 4MFFA 2ZH8A 3H37A 1HUOA 1ZQRA 1Q78A 8ICEA 3RJHA 3UQ0A 2O1PA 4KLTA 3JYYA 4X4OA 5J29A 3OUYB 4X4PA 4M9NA 8ICGA 4LZGA 4YMNA 8ICPA 4X4QA 4I2FA 4WC5A 3MBYA 5DDMA 4E7XA 3C5GA 4NLNA 5DB6A 7ICMA 3UXNA 5HRGA 4UB1A 9ICEA 4P4OA 5IIMA 4I2IA 4M9HA 5J0SA 1YLQA 2BCQA 9ICAA 2ZHAA 3V72A 5J0XA 5D4BA 1KEJA 4KLEA 1V4AA 4RWPA 4PGXA 1NO5A 3TFRA 4IQTA 4TUSA 1BPYA 4PHAA 1BPEA 4WC3A 9ICTA 2DVIA 8ICAA 3OVAA 4I29A 2DR5A 4DOCA 1R89A 2BCUA 4RQ8A 3RH5A 1ZQOA 2I9GA 8ICRA 4WBZA 4RQ7A 9ICPA 3C2LA 4NLZA 1R8AA 4X4TA 1ZQMA 3C5FA 4TUPA 8ICWA 4UAWA 4Z6DA 7ICHA 5J0QA 1MIVA 2BCSA 3HX0A 5HRLA 4FH3A 5DB9A 4NXZA 1TFWA 4R66A 1ZQJA 5J2FA 4UB3A 5HRKA 4QZGA 7ICFA 9ICMA 5HC9A 4WC6A 1ZQHA 4FHVA 5DKWA 5CWRA 3OVBA 9ICKA 4RWQA 1ZQGA 3UPQA 4PGYA 7ICOA 5DBBA 9ICWA 3UPSA 3WFOA 4KLOA 5IIIA 2ZH3A 5D49A 4IQWA 4QZDA 3L9DA 4TUQA 4RWNA 4MFCA 5BOMA 5F2VO 4JWMA 4DOAA 4GXIA 8ICBA 4K4GA 1ZQSA 1BPDA 4I2BA 8ICLA 5J0TA 3B0YA 3HWTA 9ICCA 4I2EA 4F5NA 5J2EA 2PBEA 4M0AA 3RH4A 4UAZA 4XRHA 4MFAA 4P2HA 1FA0A 4KLUA 2PXIA 3GDXA 4WC2A 2ZH5A 4YMOA 3C2KA 1JMSA 8ICFA 4M9JA 4E80A 1ZQUA 4QZ9A 3OVSA 1KDHA 3JPTA 3V7KA 3MGIA 1XSNA 5CA7A 4UB2A 1PX5A 4WC1A 3WFPA 3PNCA 3RJJA 1TFYA 4FHWA 4GXJA 4XA5A 2ZH9A 9ICLA 4LT6A 9ICRA 3JPSA 3AU6A 3RJIA 1OU5A 3PMNA 4P4PA 5J0PA 4RQ0A 3AQKA 4I27A 9ICSA 4NM1A 2DRBA 1JQRA 2ZH7A 9ICHA 5CR0A 5DB8A 4O9MA 4YD1A 9ICVA 4UB5A 4EBJA 3AQLA 3RH6A 2BE3A 8ICCA 4X0BA 2ISPA 8ICYA 1RZTA 1XSLA 8ICKA 5J2BA 4NKUA 8ICUA 2VANA 9ICXA 3OUYA 5J2GA 1ZQKA 4I2JA 5CB1A 7ICLA 4XQ7A 1ZQZA 3UQ2A 1TVAA 4M47A 9ICFA 5J2KA 5J0UA 3ISDA 4RPZA 1MIWA 4PHPA 7ICKA 4LVSA 8ICVA 3JPRA 3HJ4A 4MF8A 4IQVA 4QZ8A 3H38A 5J0RA 8ICQA 4QZIA 4I2GA 4QZHA 4X4RA 3MDCA 4RQ1A 4PHEA 3RJFA 4NM2A 1JAJA 2DR7A 5J0OA 4UAYA 4RPYA 5J2CA 3RJGA 2ZH1A 4NY8A 5HRFA 4MF2A 7ICQA 4RT2A 2BCRA 4UD5A 7ICGA 4R65A 1MQ2A 7ICPA 4RT3A 4UB4A 3MDAA 4YN4A 1ZQPA 4S3NA 4AT7B 9ICBA 4FO6A 5HHIA 4RWOA 8ICHA 5EOZA 4KLFA 3WFQE 2PFOA 7ICSA 4PH5A 7ICUA 3LK9A 5CJ7A 1HUZA 4F5OA 1ZQYA 3B0XA 3WFRE 4NKTA 2BPCA 9ICQA 1TV9A 5HR9A 5CP2A 2P66A 4O5KA 3UXOA 1UEUA 5J2HA 4KLJA 4R64A 4I2AA 3NYBA 4PGQA 7ICTA 4NLKA 3V7JA 8ICTA 3OV7A 4XUSA 4YD2A 3K75D 5J2JA 1F5AA 2FMQA 2GWSA 2M2VA 7ICNA 1ZQVA 4KLIA 9ICNA 2O5AA 4DO9A 4IG8A 2M2UA 3PMLA 3JPOA 4DOBA 4X4NA 1Q79A 4QZFA 1ZQWA 2ZHBA 1ZQTA 4PPXA 4IQUA 4FHXA 1ZQBA 5HREA 1VJ7A 9ICUA 3AUOA 5IIKA 7ICIA 1ZQCA 4WBYA 2PFNA 3WFSC 5D46A 5J2AA 3JPNA 4QZAA 1BPZA 4E8FA 4WCWA 8ICSA 4AT9B 4FHPA 3MGHA 3LQCB 1MIYA 4X0AA 8ICZA 5HRDA 5IIJA 4XQ8A 4RQ6A 1UEVA 4X5VA 4KLLA 4KLQA 4KLGA 1BPXA 3HW8A 1ZQDA 2BCVA 4I2DA 4GXKA 2M2WA 2BPFA 4JWNA 2W9MA 4X4VA 3C2MA 4RQ2A 1NOMA 3AU2A 5DB7A 1ZQFA 4AT9A 5CHGA 4M5DA 1R8BA 5IIOA 4YMMA 5J0YA 1ZQAA 1ZJMA 4I2CA 4O5CA 5DDYA 3RJKA 1VFGA 4Z6FA 4EP7A 3UXPA 1ZQNA 8ICIA 4K4IA 2FMSA 5IILA 2ISOA 4R63A 4WC4A 4AT8B 8ICJA 4P4MA 4QZBA 5HHHA 4O5EA 3C18A 3JZ0A 5J2IA 4Z6CA 2M2TA 1ZQLA 4M04A 4EBKA 4RPXA 4F5RA 8ICOA 4X4SA 3C66A 5HRIA 1ZQEA 2DR9A 4KLMA 2IHMA 4Z6EA 4KLDA 2NRKA 4PHDA 8ICMA 2FMPA 4KLSA 4YCXA 2PFQA 3OGUA 2RFFA 3JPPA 8ICNA 3H3AA 5DBAA 5DECA 1JN3A 4UBCA 7ICRA 4I28A 5IINA 4X4UA 2ZH4A 4AT8A 9ICJA 3H39A 2ZH6A 7ICEA 4I2HA 8ICXA 4TURA 4FH5A 4KLHA 4UBBA 1WOTA 5HRHA 4AT7A 1MQ3A 1ZJNA 2BPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQX A;  4UD4 A;  3AQN A;  3JPQ A;  4ATB B;  3HJ1 A;  3V7L A;  5DBC A;  4M9G A;  2PFP A;  4F5P A;  1ZQI A;  1RPL A;  4K4H A;  5HRB A;  5BOL A;  1KNY A;  2HHP A;  5BPC A;  3RJE A;  7ICV A;  3AQM A;  4RQ3 A;  4WC7 A;  4FHY A;  4M9L A;  4M2Y A;  2Q66 A;  4WC0 A;  5TZV A;  7ICJ A;  3TFS A;  1XSP A;  4RQ5 A;  3ISC A;  5DED A;  9ICO A;  9ICG A;  9ICI A;  2DRA A;  2ZH2 A;  4ATB A;  4LZD A;  4QZE A;  1R8C A;  1ZQQ A;  1UET A;  5J0W A;  4RQ4 A;  5J2D A;  2DR8 A;  1BPB A;  4F5Q A;  3HIY A;  2ID1 A;  3ISB A;  4QZC A;  4MFF A;  2ZH8 A;  3H37 A;  1HUO A;  1ZQR A;  1Q78 A;  8ICE A;  3RJH A;  3UQ0 A;  2O1P A;  4KLT A;  3JYY A;  4X4O A;  5J29 A;  3OUY B;  4X4P A;  4M9N A;  8ICG A;  4LZG A;  4YMN A;  8ICP A;  4X4Q A;  4I2F A;  4WC5 A;  3MBY A;  5DDM A;  4E7X A;  3C5G A;  4NLN A;  5DB6 A;  7ICM A;  3UXN A;  5HRG A;  4UB1 A;  9ICE A;  4P4O A;  5IIM A;  4I2I A;  4M9H A;  5J0S A;  1YLQ A;  2BCQ A;  9ICA A;  2ZHA A;  3V72 A;  5J0X A;  5D4B A;  1KEJ A;  4KLE A;  1V4A A;  4RWP A;  4PGX A;  1NO5 A;  3TFR A;  4IQT A;  4TUS A;  1BPY A;  4PHA A;  1BPE A;  4WC3 A;  9ICT A;  2DVI A;  8ICA A;  3OVA A;  4I29 A;  2DR5 A;  4DOC A;  1R89 A;  2BCU A;  4RQ8 A;  3RH5 A;  1ZQO A;  2I9G A;  8ICR A;  4WBZ A;  4RQ7 A;  9ICP A;  3C2L A;  4NLZ A;  1R8A A;  4X4T A;  1ZQM A;  3C5F A;  4TUP A;  8ICW A;  4UAW A;  4Z6D A;  7ICH A;  5J0Q A;  1MIV A;  2BCS A;  3HX0 A;  5HRL A;  4FH3 A;  5DB9 A;  4NXZ A;  1TFW A;  4R66 A;  1ZQJ A;  5J2F A;  4UB3 A;  5HRK A;  4QZG A;  7ICF A;  9ICM A;  5HC9 A;  4WC6 A;  1ZQH A;  4FHV A;  5DKW A;  5CWR A;  3OVB A;  9ICK A;  4RWQ A;  1ZQG A;  3UPQ A;  4PGY A;  7ICO A;  5DBB A;  9ICW A;  3UPS A;  3WFO A;  4KLO A;  5III A;  2ZH3 A;  5D49 A;  4IQW A;  4QZD A;  3L9D A;  4TUQ A;  4RWN A;  4MFC A;  5BOM A;  5F2V O;  4JWM A;  4DOA A;  4GXI A;  8ICB A;  4K4G A;  1ZQS A;  1BPD A;  4I2B A;  8ICL A;  5J0T A;  3B0Y A;  3HWT A;  9ICC A;  4I2E A;  4F5N A;  5J2E A;  2PBE A;  4M0A A;  3RH4 A;  4UAZ A;  4XRH A;  4MFA A;  4P2H A;  1FA0 A;  4KLU A;  2PXI A;  3GDX A;  4WC2 A;  2ZH5 A;  4YMO A;  3C2K A;  1JMS A;  8ICF A;  4M9J A;  4E80 A;  1ZQU A;  4QZ9 A;  3OVS A;  1KDH A;  3JPT A;  3V7K A;  3MGI A;  1XSN A;  5CA7 A;  4UB2 A;  1PX5 A;  4WC1 A;  3WFP A;  3PNC A;  3RJJ A;  1TFY A;  4FHW A;  4GXJ A;  4XA5 A;  2ZH9 A;  9ICL A;  4LT6 A;  9ICR A;  3JPS A;  3AU6 A;  3RJI A;  1OU5 A;  3PMN A;  4P4P A;  5J0P A;  4RQ0 A;  3AQK A;  4I27 A;  9ICS A;  4NM1 A;  2DRB A;  1JQR A;  2ZH7 A;  9ICH A;  5CR0 A;  5DB8 A;  4O9M A;  4YD1 A;  9ICV A;  4UB5 A;  4EBJ A;  3AQL A;  3RH6 A;  2BE3 A;  8ICC A;  4X0B A;  2ISP A;  8ICY A;  1RZT A;  1XSL A;  8ICK A;  5J2B A;  4NKU A;  8ICU A;  2VAN A;  9ICX A;  3OUY A;  5J2G A;  1ZQK A;  4I2J A;  5CB1 A;  7ICL A;  4XQ7 A;  1ZQZ A;  3UQ2 A;  1TVA A;  4M47 A;  9ICF A;  5J2K A;  5J0U A;  3ISD A;  4RPZ A;  1MIW A;  4PHP A;  7ICK A;  4LVS A;  8ICV A;  3JPR A;  3HJ4 A;  4MF8 A;  4IQV A;  4QZ8 A;  3H38 A;  5J0R A;  8ICQ A;  4QZI A;  4I2G A;  4QZH A;  4X4R A;  3MDC A;  4RQ1 A;  4PHE A;  3RJF A;  4NM2 A;  1JAJ A;  2DR7 A;  5J0O A;  4UAY A;  4RPY A;  5J2C A;  3RJG A;  2ZH1 A;  4NY8 A;  5HRF A;  4MF2 A;  7ICQ A;  4RT2 A;  2BCR A;  4UD5 A;  7ICG A;  4R65 A;  1MQ2 A;  7ICP A;  4RT3 A;  4UB4 A;  3MDA A;  4YN4 A;  1ZQP A;  4S3N A;  4AT7 B;  9ICB A;  4FO6 A;  5HHI A;  4RWO A;  8ICH A;  5EOZ A;  4KLF A;  3WFQ E;  2PFO A;  7ICS A;  4PH5 A;  7ICU A;  3LK9 A;  5CJ7 A;  1HUZ A;  4F5O A;  1ZQY A;  3B0X A;  3WFR E;  4NKT A;  2BPC A;  9ICQ A;  1TV9 A;  5HR9 A;  5CP2 A;  2P66 A;  4O5K A;  3UXO A;  1UEU A;  5J2H A;  4KLJ A;  4R64 A;  4I2A A;  3NYB A;  4PGQ A;  7ICT A;  4NLK A;  3V7J A;  8ICT A;  3OV7 A;  4XUS A;  4YD2 A;  3K75 D;  5J2J A;  1F5A A;  2FMQ A;  2GWS A;  2M2V A;  7ICN A;  1ZQV A;  4KLI A;  9ICN A;  2O5A A;  4DO9 A;  4IG8 A;  2M2U A;  3PML A;  3JPO A;  4DOB A;  4X4N A;  1Q79 A;  4QZF A;  1ZQW A;  2ZHB A;  1ZQT A;  4PPX A;  4IQU A;  4FHX A;  1ZQB A;  5HRE A;  1VJ7 A;  9ICU A;  3AUO A;  5IIK A;  7ICI A;  1ZQC A;  4WBY A;  2PFN A;  3WFS C;  5D46 A;  5J2A A;  3JPN A;  4QZA A;  1BPZ A;  4E8F A;  4WCW A;  8ICS A;  4AT9 B;  4FHP A;  3MGH A;  3LQC B;  1MIY A;  4X0A A;  8ICZ A;  5HRD A;  5IIJ A;  4XQ8 A;  4RQ6 A;  1UEV A;  4X5V A;  4KLL A;  4KLQ A;  4KLG A;  1BPX A;  3HW8 A;  1ZQD A;  2BCV A;  4I2D A;  4GXK A;  2M2W A;  2BPF A;  4JWN A;  2W9M A;  4X4V A;  3C2M A;  4RQ2 A;  1NOM A;  3AU2 A;  5DB7 A;  1ZQF A;  4AT9 A;  5CHG A;  4M5D A;  1R8B A;  5IIO A;  4YMM A;  5J0Y A;  1ZQA A;  1ZJM A;  4I2C A;  4O5C A;  5DDY A;  3RJK A;  1VFG A;  4Z6F A;  4EP7 A;  3UXP A;  1ZQN A;  8ICI A;  4K4I A;  2FMS A;  5IIL A;  2ISO A;  4R63 A;  4WC4 A;  4AT8 B;  8ICJ A;  4P4M A;  4QZB A;  5HHH A;  4O5E A;  3C18 A;  3JZ0 A;  5J2I A;  4Z6C A;  2M2T A;  1ZQL A;  4M04 A;  4EBK A;  4RPX A;  4F5R A;  8ICO A;  4X4S A;  3C66 A;  5HRI A;  1ZQE A;  2DR9 A;  4KLM A;  2IHM A;  4Z6E A;  4KLD A;  2NRK A;  4PHD A;  8ICM A;  2FMP A;  4KLS A;  4YCX A;  2PFQ A;  3OGU A;  2RFF A;  3JPP A;  8ICN A;  3H3A A;  5DBA A;  5DEC A;  1JN3 A;  4UBC A;  7ICR A;  4I28 A;  5IIN A;  4X4U A;  2ZH4 A;  4AT8 A;  9ICJ A;  3H39 A;  2ZH6 A;  7ICE A;  4I2H A;  8ICX A;  4TUR A;  4FH5 A;  4KLH A;  4UBB A;  1WOT A;  5HRH A;  4AT7 A;  1MQ3 A;  1ZJN A;  2BPG A; 
#chains in the Genus database with same CATH topology
 1ZQX A;  4UD4 A;  3AQN A;  3JPQ A;  4ATB B;  3HJ1 A;  3V7L A;  5DBC A;  4M9G A;  2PFP A;  4F5P A;  1ZQI A;  1RPL A;  4K4H A;  5HRB A;  5BOL A;  4K9B A;  1KNY A;  2HHP A;  5BPC A;  3RJE A;  7ICV A;  3AQM A;  4RQ3 A;  4WC7 A;  4FHY A;  4M9L A;  4M2Y A;  2Q66 A;  4WC0 A;  5TZV A;  7ICJ A;  4OAG A;  3TFS A;  1XSP A;  4RQ5 A;  3ISC A;  5DED A;  9ICO A;  9ICG A;  9ICI A;  2DRA A;  2ZH2 A;  3OWG A;  4ATB A;  4LZD A;  4QZE A;  1R8C A;  1ZQQ A;  1UET A;  5J0W A;  4EV6 A;  4RQ4 A;  5J2D A;  2DR8 A;  1BPB A;  4F5Q A;  3HIY A;  4I0U A;  2ID1 A;  3ISB A;  4QZC A;  4MFF A;  2ZH8 A;  3H37 A;  1HUO A;  1ZQR A;  1Q78 A;  8ICE A;  3RJH A;  3UQ0 A;  2O1P A;  4KLT A;  4NXW A;  3JYY A;  4X4O A;  5J29 A;  3OUY B;  5D63 A;  4X4P A;  4M9N A;  8ICG A;  4LZG A;  4YMN A;  8ICP A;  4X4Q A;  4I2F A;  4WC5 A;  3MBY A;  5DDM A;  4E7X A;  3C5G A;  4NLN A;  5DB6 A;  7ICM A;  3UXN A;  5HRG A;  4UB1 A;  9ICE A;  4P4O A;  5IIM A;  4I2I A;  4M9H A;  5J0S A;  1YLQ A;  2BCQ A;  9ICA A;  2ZHA A;  3V72 A;  5J0X A;  5D4B A;  1KEJ A;  4KLE A;  1V4A A;  4RWP A;  4PGX A;  1NO5 A;  3TFR A;  4IQT A;  2FCL A;  4TUS A;  1BPY A;  4PHA A;  1BPE A;  4WC3 A;  9ICT A;  2DVI A;  8ICA A;  3OVA A;  4I29 A;  5CHE A;  4DOC A;  1R89 A;  2DR5 A;  2BCU A;  4RQ8 A;  3RH5 A;  1ZQO A;  2I9G A;  8ICR A;  4WBZ A;  4RQ7 A;  9ICP A;  3C2L A;  4NLZ A;  1R8A A;  4X4T A;  1ZQM A;  3C5F A;  3ER8 C;  4TUP A;  8ICW A;  4UAW A;  4Z6D A;  7ICH A;  5J0Q A;  1MIV A;  2BCS A;  3HX0 A;  5HRL A;  4FH3 A;  5DB9 A;  4NXZ A;  1TFW A;  4WOY A;  4R66 A;  1ZQJ A;  5J2F A;  4UB3 A;  3ER9 B;  5HRK A;  2HN1 A;  4QZG A;  7ICF A;  9ICM A;  5HC9 A;  4WC6 A;  1ZQH A;  4FHV A;  5DKW A;  5CWR A;  3OVB A;  9ICK A;  4RWQ A;  1ZQG A;  3UPQ A;  4PGY A;  7ICO A;  5DBB A;  9ICW A;  5CFU A;  3UPS A;  3WFO A;  4KLO A;  5III A;  2ZH3 A;  5D49 A;  4IQW A;  4QZD A;  3L9D A;  4TUQ A;  4K99 A;  4RWN A;  4FO1 A;  4MFC A;  5BOM A;  5F2V O;  4WQK A;  4JWM A;  4DOA A;  3NWI A;  4GXI A;  8ICB A;  4K4G A;  1ZQS A;  1BPD A;  4I2B A;  8ICL A;  5J0T A;  3B0Y A;  3HWT A;  9ICC A;  4I2E A;  4F5N A;  5J2E A;  2PBE A;  4M0A A;  3RH4 A;  4UAZ A;  3NVO A;  4XRH A;  4MFA A;  4P2H A;  1FA0 A;  4KLU A;  2PXI A;  3GDX A;  4WC2 A;  4WQL A;  2ZH5 A;  4YMO A;  3C2K A;  1JMS A;  8ICF A;  4M9J A;  4E80 A;  4K8V A;  1ZQU A;  4QZ9 A;  4JLX A;  3OVS A;  1KDH A;  4O69 A;  3JPT A;  3V7K A;  4NXX A;  3MGI A;  1XSN A;  5CA7 A;  4UB2 A;  1PX5 A;  4WC1 A;  3WFP A;  3PNC A;  3RJJ A;  1TFY A;  4FHW A;  3MCR A;  4GXJ A;  4XA5 A;  2ZH9 A;  9ICL A;  2B51 A;  4LT6 A;  9ICR A;  3JPS A;  3AU6 A;  3RJI A;  1OU5 A;  5CFT A;  3PMN A;  4LEY A;  4P4P A;  5J0P A;  4RQ0 A;  3AQK A;  4I27 A;  9ICS A;  4NM1 A;  2DRB A;  1JQR A;  2ZH7 A;  9ICH A;  5CR0 A;  5DB8 A;  4O9M A;  4YD1 A;  9ICV A;  4UB5 A;  4EBJ A;  3AQL A;  3RH6 A;  2BE3 A;  2GAF D;  8ICC A;  4X0B A;  2ISP A;  4WH5 A;  8ICY A;  1RZT A;  1XSL A;  4NXV A;  5JTG A;  8ICK A;  5J2B A;  4NKU A;  4K97 A;  8ICU A;  2VAN A;  9ICX A;  3OUY A;  5J2G A;  1ZQK A;  4I2J A;  5CB1 A;  7ICL A;  4O6A A;  4XQ7 A;  1ZQZ A;  4K9A A;  3UQ2 A;  1TVA A;  4M47 A;  9ICF A;  5J2K A;  5J0U A;  3ISD A;  4RPZ A;  1MIW A;  4PHP A;  7ICK A;  4LVS A;  8ICV A;  3JPR A;  3ERC C;  2GA9 D;  3HJ4 A;  4MF8 A;  4IQV A;  4QZ8 A;  3H38 A;  5J0R A;  8ICQ A;  4QZI A;  4I2G A;  4QZH A;  4X4R A;  3MDC A;  4RQ1 A;  4PHE A;  3RJF A;  4NM2 A;  1JAJ A;  2DR7 A;  5J0O A;  2IUB A;  4JLZ A;  4UAY A;  4RPY A;  5J2C A;  3RJG A;  2BBJ A;  2ZH1 A;  2B56 A;  5B3Q A;  4NY8 A;  5HRF A;  4KM5 A;  4MF2 A;  7ICQ A;  5D61 A;  4RT2 A;  2BCR A;  4UD5 A;  4O67 A;  7ICG A;  4R65 A;  1MQ2 A;  7ICP A;  4RT3 A;  4UB4 A;  3MDA A;  4YN4 A;  1ZQP A;  4S3N A;  4AT7 B;  9ICB A;  4FO6 A;  5HHI A;  4RWO A;  4OAI Z;  8ICH A;  5EOZ A;  4KLF A;  3WFQ E;  2PFO A;  7ICS A;  4PH5 A;  4K98 A;  3LK9 A;  7ICU A;  5CJ7 A;  1GPJ A;  1HUZ A;  4F5O A;  1ZQY A;  4N7R A;  3B0X A;  5D62 A;  3WFR E;  4NKT A;  2BPC A;  9ICQ A;  1TV9 A;  4NXU A;  5HR9 A;  5CFS A;  2HN2 A;  5CP2 A;  2P66 A;  4O5K A;  3UXO A;  1UEU A;  5J2H A;  4KLJ A;  4R64 A;  4I2A A;  3CK6 A;  3NYB A;  4PGQ A;  7ICT A;  4NLK A;  3V7J A;  4EEB A;  8ICT A;  3OV7 A;  4XUS A;  4YD2 A;  3K75 D;  5J2J A;  1F5A A;  4LEV A;  2FMQ A;  2GWS A;  2M2V A;  7ICN A;  2BBH A;  1ZQV A;  4KLI A;  4NXT A;  9ICN A;  2O5A A;  4DO9 A;  4IG8 A;  2M2U A;  3PML A;  3JPO A;  4DOB A;  4X4N A;  1Q79 A;  4QZF A;  1ZQW A;  2ZHB A;  1ZQT A;  4PPX A;  4IQU A;  4FHX A;  1ZQB A;  5HRE A;  1VJ7 A;  9ICU A;  3AUO A;  5IIK A;  7ICI A;  1ZQC A;  4WBY A;  4OAF A;  4EGW A;  2PFN A;  5D46 A;  3WFS C;  3JCF A;  5J2A A;  3JPN A;  4QZA A;  1BPZ A;  4E8F A;  4WCW A;  4LEZ A;  8ICS A;  5B3P A;  4K96 A;  4AT9 B;  4FHP A;  3MGH A;  3LQC B;  1MIY A;  4X0A A;  8ICZ A;  5HRD A;  5IIJ A;  4XQ8 A;  4RQ6 A;  1UEV A;  4X5V A;  2IHO A;  4KLL A;  4KLQ A;  4KLG A;  1BPX A;  3PHZ A;  3HW8 A;  1ZQD A;  2BCV A;  4I2D A;  4GXK A;  2M2W A;  2BPF A;  4JWN A;  2W9M A;  4X4V A;  3C2M A;  4RQ2 A;  1NOM A;  4OAH A;  3AU2 A;  4MKP A;  5DB7 A;  1ZQF A;  4AT9 A;  5CHG A;  4M5D A;  1R8B A;  5IIO A;  4YMM A;  5J0Y A;  1ZQA A;  1ZJM A;  4I2C A;  4O5C A;  5DDY A;  4XJE A;  3RJK A;  1VFG A;  4Z6F A;  4EP7 A;  3UXP A;  1ZQN A;  2B4V A;  8ICI A;  4EED A;  4KB6 A;  4K4I A;  2FMS A;  5IIL A;  2ISO A;  4R63 A;  4WC4 A;  4AT8 B;  3K7D A;  8ICJ A;  4P4M A;  4QZB A;  5HHH A;  4O5E A;  3C18 A;  3JZ0 A;  5J2I A;  4Z6C A;  2M2T A;  2EWR A;  1ZQL A;  4M04 A;  4EBK A;  4RPX A;  4F5R A;  8ICO A;  4X4S A;  3C66 A;  5HRI A;  1ZQE A;  2DR9 A;  4KLM A;  3NKU A;  2IHM A;  4Z6E A;  4KLD A;  2NRK A;  4PHD A;  8ICM A;  2FMP A;  4KLS A;  4YCX A;  2PFQ A;  3OGU A;  2RFF A;  3JPP A;  8ICN A;  4LEW A;  3H3A A;  5DBA A;  5DEC A;  1JN3 A;  4UBC A;  7ICR A;  4I28 A;  5IIN A;  4X4U A;  2ZH4 A;  4AT8 A;  9ICJ A;  3H39 A;  4HX0 A;  2ZH6 A;  7ICE A;  4I2H A;  8ICX A;  4O68 A;  4TUR A;  4FH5 A;  4KLH A;  4UBB A;  1WOT A;  5HRH A;  3EF2 A;  4AT7 A;  1MQ3 A;  1ZJN A;  2BPG A; 
#chains in the Genus database with same CATH homology
 1ZQX A;  4UD4 A;  3AQN A;  3JPQ A;  4ATB B;  3HJ1 A;  3V7L A;  5DBC A;  4M9G A;  2PFP A;  4F5P A;  1ZQI A;  1RPL A;  4K4H A;  5HRB A;  5BOL A;  1KNY A;  2HHP A;  5BPC A;  3RJE A;  7ICV A;  3AQM A;  4RQ3 A;  4WC7 A;  4FHY A;  4M9L A;  4M2Y A;  2Q66 A;  4WC0 A;  5TZV A;  7ICJ A;  3TFS A;  1XSP A;  4RQ5 A;  3ISC A;  5DED A;  9ICO A;  9ICG A;  9ICI A;  2DRA A;  2ZH2 A;  4ATB A;  4LZD A;  4QZE A;  1R8C A;  1ZQQ A;  1UET A;  5J0W A;  4RQ4 A;  5J2D A;  2DR8 A;  1BPB A;  4F5Q A;  3HIY A;  2ID1 A;  3ISB A;  4QZC A;  4MFF A;  2ZH8 A;  3H37 A;  1HUO A;  1ZQR A;  1Q78 A;  8ICE A;  3RJH A;  3UQ0 A;  2O1P A;  4KLT A;  3JYY A;  4X4O A;  5J29 A;  3OUY B;  4X4P A;  4M9N A;  8ICG A;  4LZG A;  4YMN A;  8ICP A;  4X4Q A;  4I2F A;  4WC5 A;  3MBY A;  5DDM A;  4E7X A;  3C5G A;  4NLN A;  5DB6 A;  7ICM A;  3UXN A;  5HRG A;  4UB1 A;  9ICE A;  4P4O A;  5IIM A;  4I2I A;  4M9H A;  5J0S A;  1YLQ A;  2BCQ A;  9ICA A;  2ZHA A;  3V72 A;  5J0X A;  5D4B A;  1KEJ A;  4KLE A;  1V4A A;  4RWP A;  4PGX A;  1NO5 A;  3TFR A;  4IQT A;  4TUS A;  1BPY A;  4PHA A;  1BPE A;  4WC3 A;  9ICT A;  2DVI A;  8ICA A;  3OVA A;  4I29 A;  2DR5 A;  4DOC A;  1R89 A;  2BCU A;  4RQ8 A;  3RH5 A;  1ZQO A;  2I9G A;  8ICR A;  4WBZ A;  4RQ7 A;  9ICP A;  3C2L A;  4NLZ A;  1R8A A;  4X4T A;  1ZQM A;  3C5F A;  4TUP A;  8ICW A;  4UAW A;  4Z6D A;  7ICH A;  5J0Q A;  1MIV A;  2BCS A;  3HX0 A;  5HRL A;  4FH3 A;  5DB9 A;  4NXZ A;  1TFW A;  4R66 A;  1ZQJ A;  5J2F A;  4UB3 A;  5HRK A;  4QZG A;  7ICF A;  9ICM A;  5HC9 A;  4WC6 A;  1ZQH A;  4FHV A;  5DKW A;  5CWR A;  3OVB A;  9ICK A;  4RWQ A;  1ZQG A;  3UPQ A;  4PGY A;  7ICO A;  5DBB A;  9ICW A;  3UPS A;  3WFO A;  4KLO A;  5III A;  2ZH3 A;  5D49 A;  4IQW A;  4QZD A;  3L9D A;  4TUQ A;  4RWN A;  4MFC A;  5BOM A;  5F2V O;  4JWM A;  4DOA A;  4GXI A;  8ICB A;  4K4G A;  1ZQS A;  1BPD A;  4I2B A;  8ICL A;  5J0T A;  3B0Y A;  3HWT A;  9ICC A;  4I2E A;  4F5N A;  5J2E A;  2PBE A;  4M0A A;  3RH4 A;  4UAZ A;  4XRH A;  4MFA A;  4P2H A;  1FA0 A;  4KLU A;  2PXI A;  3GDX A;  4WC2 A;  2ZH5 A;  4YMO A;  3C2K A;  1JMS A;  8ICF A;  4M9J A;  4E80 A;  1ZQU A;  4QZ9 A;  3OVS A;  1KDH A;  3JPT A;  3V7K A;  3MGI A;  1XSN A;  5CA7 A;  4UB2 A;  1PX5 A;  4WC1 A;  3WFP A;  3PNC A;  3RJJ A;  1TFY A;  4FHW A;  4GXJ A;  4XA5 A;  2ZH9 A;  9ICL A;  4LT6 A;  9ICR A;  3JPS A;  3AU6 A;  3RJI A;  1OU5 A;  3PMN A;  4P4P A;  5J0P A;  4RQ0 A;  3AQK A;  4I27 A;  9ICS A;  4NM1 A;  2DRB A;  1JQR A;  2ZH7 A;  9ICH A;  5CR0 A;  5DB8 A;  4O9M A;  4YD1 A;  9ICV A;  4UB5 A;  4EBJ A;  3AQL A;  3RH6 A;  2BE3 A;  8ICC A;  4X0B A;  2ISP A;  8ICY A;  1RZT A;  1XSL A;  8ICK A;  5J2B A;  4NKU A;  8ICU A;  2VAN A;  9ICX A;  3OUY A;  5J2G A;  1ZQK A;  4I2J A;  5CB1 A;  7ICL A;  4XQ7 A;  1ZQZ A;  3UQ2 A;  1TVA A;  4M47 A;  9ICF A;  5J2K A;  5J0U A;  3ISD A;  4RPZ A;  1MIW A;  4PHP A;  7ICK A;  4LVS A;  8ICV A;  3JPR A;  3HJ4 A;  4MF8 A;  4IQV A;  4QZ8 A;  3H38 A;  5J0R A;  8ICQ A;  4QZI A;  4I2G A;  4QZH A;  4X4R A;  3MDC A;  4RQ1 A;  4PHE A;  3RJF A;  4NM2 A;  1JAJ A;  2DR7 A;  5J0O A;  4UAY A;  4RPY A;  5J2C A;  3RJG A;  2ZH1 A;  4NY8 A;  5HRF A;  4MF2 A;  7ICQ A;  4RT2 A;  2BCR A;  4UD5 A;  7ICG A;  4R65 A;  1MQ2 A;  7ICP A;  4RT3 A;  4UB4 A;  3MDA A;  4YN4 A;  1ZQP A;  4S3N A;  4AT7 B;  9ICB A;  4FO6 A;  5HHI A;  4RWO A;  8ICH A;  5EOZ A;  4KLF A;  3WFQ E;  2PFO A;  7ICS A;  4PH5 A;  7ICU A;  3LK9 A;  5CJ7 A;  1HUZ A;  4F5O A;  1ZQY A;  3B0X A;  3WFR E;  4NKT A;  2BPC A;  9ICQ A;  1TV9 A;  5HR9 A;  5CP2 A;  2P66 A;  4O5K A;  3UXO A;  1UEU A;  5J2H A;  4KLJ A;  4R64 A;  4I2A A;  3NYB A;  4PGQ A;  7ICT A;  4NLK A;  3V7J A;  8ICT A;  3OV7 A;  4XUS A;  4YD2 A;  3K75 D;  5J2J A;  1F5A A;  2FMQ A;  2GWS A;  2M2V A;  7ICN A;  1ZQV A;  4KLI A;  9ICN A;  2O5A A;  4DO9 A;  4IG8 A;  2M2U A;  3PML A;  3JPO A;  4DOB A;  4X4N A;  1Q79 A;  4QZF A;  1ZQW A;  2ZHB A;  1ZQT A;  4PPX A;  4IQU A;  4FHX A;  1ZQB A;  5HRE A;  1VJ7 A;  9ICU A;  3AUO A;  5IIK A;  7ICI A;  1ZQC A;  4WBY A;  2PFN A;  3WFS C;  5D46 A;  5J2A A;  3JPN A;  4QZA A;  1BPZ A;  4E8F A;  4WCW A;  8ICS A;  4AT9 B;  4FHP A;  3MGH A;  3LQC B;  1MIY A;  4X0A A;  8ICZ A;  5HRD A;  5IIJ A;  4XQ8 A;  4RQ6 A;  1UEV A;  4X5V A;  4KLL A;  4KLQ A;  4KLG A;  1BPX A;  3HW8 A;  1ZQD A;  2BCV A;  4I2D A;  4GXK A;  2M2W A;  2BPF A;  4JWN A;  2W9M A;  4X4V A;  3C2M A;  4RQ2 A;  1NOM A;  3AU2 A;  5DB7 A;  1ZQF A;  4AT9 A;  5CHG A;  4M5D A;  1R8B A;  5IIO A;  4YMM A;  5J0Y A;  1ZQA A;  1ZJM A;  4I2C A;  4O5C A;  5DDY A;  3RJK A;  1VFG A;  4Z6F A;  4EP7 A;  3UXP A;  1ZQN A;  8ICI A;  4K4I A;  2FMS A;  5IIL A;  2ISO A;  4R63 A;  4WC4 A;  4AT8 B;  8ICJ A;  4P4M A;  4QZB A;  5HHH A;  4O5E A;  3C18 A;  3JZ0 A;  5J2I A;  4Z6C A;  2M2T A;  1ZQL A;  4M04 A;  4EBK A;  4RPX A;  4F5R A;  8ICO A;  4X4S A;  3C66 A;  5HRI A;  1ZQE A;  2DR9 A;  4KLM A;  2IHM A;  4Z6E A;  4KLD A;  2NRK A;  4PHD A;  8ICM A;  2FMP A;  4KLS A;  4YCX A;  2PFQ A;  3OGU A;  2RFF A;  3JPP A;  8ICN A;  3H3A A;  5DBA A;  5DEC A;  1JN3 A;  4UBC A;  7ICR A;  4I28 A;  5IIN A;  4X4U A;  2ZH4 A;  4AT8 A;  9ICJ A;  3H39 A;  2ZH6 A;  7ICE A;  4I2H A;  8ICX A;  4TUR A;  4FH5 A;  4KLH A;  4UBB A;  1WOT A;  5HRH A;  4AT7 A;  1MQ3 A;  1ZJN A;  2BPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...