4WC1A

Structure of trna-processing enzyme with ctp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
382
structure length
364
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
molecule keywords Poly A polymerase
total genus 114
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc1A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc1A01
4P4OA 2FMSA 4PGQA 5IIKA 4GXJA 4P4MA 1Q78A 5CR0A 3C2MA 8ICGA 1ZQRA 4TURA 3JYYA 3ISDA 5J0QA 9ICVA 9ICAA 4QZ9A 2M2VA 4Z6EA 2BCUA 8ICRA 4QZBA 4I2HA 2GWSA 4JWMA 4I2EA 1ZQAA 5J2CA 1JAJA 4DO9A 5DBBA 3H39A 5J2IA 1ZQMA 8ICLA 5J0TA 4X4VA 3JPOA 8ICEA 2ZH9A 5HRLA 4P4PA 5J0WA 5J2JA 4M5DA 4I2JA 1HUZA 4DOCA 4M9NA 4WC3A 1YLQA 2O5AA 4IQUA 5J2DA 4PGYA 2FMPA 5HRDA 2BPGA 4WC5A 4YMOA 3TFRA 4IQVA 1ZQOA 1NO5A 3RJKA 4XA5A 4FO6A 4NLKA 2ZHAA 4AT7B 1MQ2A 8ICCA 3UXPA 4UD4A 5DKWA 4I29A 4UB4A 8ICUA 4F5PA 4KLSA 4UAYA 4UBBA 1MQ3A 4M47A 5CB1A 3V7KA 2Q66A 4M0AA 5HRHA 1KDHA 5F2VO 5J0OA 5IIMA 4PPXA 1ZQCA 4XUSA 4O5EA 4MF2A 5DB7A 5J2HA 4QZGA 4PHAA 5J0YA 4QZIA 1ZQKA 2BCQA 4RT2A 4EBKA 5DB6A 4KLMA 4YMNA 9ICHA 4KLQA 4K4IA 7ICKA 8ICBA 5IIOA 4IG8A 3NYBA 3WFOA 8ICXA 7ICVA 4X4SA 4RWPA 1R8BA 4QZAA 7ICNA 1R8AA 3RH4A 3JPSA 5J2FA 4M9JA 3V7LA 4X4TA 4WCWA 4M9LA 7ICSA 1ZJNA 3AQKA 5HRBA 3C5GA 4QZ8A 8ICIA 4O5CA 1BPEA 4LZDA 4Z6CA 1ZQVA 2DR8A 5J2BA 4NKUA 4UAZA 3OVBA 4AT9B 5TZVA 4AT7A 3RJJA 3UQ0A 1BPYA 2DR9A 3V72A 4I2FA 4E8FA 4O5KA 4WC1A 5J29A 3JPQA 3WFPA 4NM1A 2NRKA 4M2YA 1BPXA 2DR7A 4F5RA 5BOMA 4R65A 4KLEA 5D49A 2RFFA 9ICIA 4UBCA 1XSNA 2BCSA 3HJ4A 3C2LA 1JMSA 4WC2A 1RPLA 4DOBA 9ICMA 4X4QA 4WBYA 1TVAA 2DRAA 4O9MA 2M2TA 3HW8A 1OU5A 3RH6A 4E7XA 4QZFA 2ZH6A 2ZH8A 4KLHA 2PBEA 5CHGA 4X4NA 1ZQLA 4KLDA 4PH5A 2ZH1A 4QZHA 4I2IA 5IIJA 3C18A 9ICEA 4KLTA 1MIYA 3RJEA 4AT9A 5CJ7A 5DBCA 9ICPA 3PMNA 3WFSC 1ZQNA 4I2AA 1ZQZA 4XRHA 1ZQUA 4UB2A 2PFQA 3RJFA 1TFWA 3TFSA 3RH5A 4UB1A 5J2KA 2O1PA 8ICYA 4RQ1A 2P66A 1ZQGA 4LZGA 4YN4A 1TFYA 1ZQXA 3JPPA 4IQWA 4QZEA 8ICAA 3UXNA 1VJ7A 4FHVA 3L9DA 2BPCA 3H37A 4IQTA 2I9GA 3LK9A 9ICBA 7ICOA 1KEJA 1ZQPA 3B0XA 4TUPA 3OVSA 2PFNA 1TV9A 4P2HA 7ICEA 3MDAA 5J0SA 2DR5A 5DEDA 3RJGA 4X0BA 5J0UA 2W9MA 4R66A 5HC9A 1ZQJA 4WBZA 4WC4A 4PGXA 8ICMA 9ICLA 4NLNA 4PHDA 4GXIA 3ISBA 7ICUA 2ZHBA 4X4PA 1BPZA 4KLGA 9ICGA 7ICIA 4FHYA 2BPFA 4JWNA 4PHEA 8ICWA 1ZQQA 3WFRE 4KLFA 3AQNA 1ZQTA 8ICPA 3B0YA 1XSPA 5HR9A 4XQ7A 9ICXA 4LT6A 4MFCA 1FA0A 1MIWA 3PMLA 8ICSA 3H3AA 2DVIA 2ZH3A 4FHXA 5J2GA 7ICMA 3ISCA 9ICFA 4WC0A 1BPDA 3OV7A 5IINA 1ZQSA 3V7JA 1WOTA 5J0PA 5HREA 4YMMA 3UXOA 4I2DA 1ZQYA 4YD2A 5D4BA 8ICZA 3HWTA 4E80A 9ICQA 4R63A 2FMQA 8ICHA 4X0AA 2ZH2A 5J0XA 3JPRA 3AU2A 3AU6A 8ICVA 2PFPA 3JPNA 7ICGA 1V4AA 4KLUA 3PNCA 4RWOA 4F5OA 1BPBA 4EP7A 3MGIA 1ZQBA 2DRBA 4RQ6A 3HX0A 3WFQE 9ICNA 1JN3A 1Q79A 8ICTA 4MFAA 4RQ7A 5HRGA 2PXIA 7ICFA 9ICUA 4AT8B 3C66A 4RQ2A 5J0RA 5DECA 1UEVA 7ICQA 8ICOA 4NXZA 5IILA 5DB9A 5HRKA 4M9HA 3AQLA 7ICRA 2BE3A 9ICJA 5IIIA 4YD1A 4I28A 4RWNA 5EOZA 5DBAA 1ZQFA 4ATBB 3AUOA 3MDCA 7ICLA 4RWQA 4QZDA 3OUYA 2M2WA 3MBYA 3UQ2A 4RQ3A 8ICNA 4WC7A 5J2AA 1R8CA 4TUQA 4UAWA 3UPQA 3K75D 4NM2A 7ICHA 5HRIA 4K4HA 3C2KA 5CA7A 4KLLA 4FHPA 2BCRA 4KLIA 4X4UA 4UB3A 3GDXA 2VANA 4Z6DA 1JQRA 4FH5A 4ATBA 2BCVA 4I27A 1RZTA 3C5FA 4I2CA 5CWRA 2ZH4A 2ISOA 3AQMA 4KLOA 7ICJA 4NKTA 7ICPA 1KNYA 4KLJA 4NY8A 4RQ8A 5BOLA 4TUSA 3HIYA 1NOMA 4I2BA 4AT8A 4EBJA 4RPYA 4RQ4A 4PHPA 4RPXA 2ZH7A 4RQ5A 4M9GA 3HJ1A 9ICWA 4R64A 4GXKA 4MFFA 9ICRA 4FHWA 7ICTA 4DOAA 1HUOA 4WC6A 4FH3A 5HRFA 8ICFA 3RJHA 9ICTA 5CP2A 1ZQDA 3JZ0A 9ICCA 5J2EA 3OGUA 1MIVA 4UB5A 1VFGA 1UEUA 1ZQEA 9ICSA 3JPTA 1ZJMA 4X5VA 4RPZA 1PX5A 8ICJA 4QZCA 4X4OA 2IHMA 1ZQHA 4RQ0A 4X4RA 4MF8A 9ICKA 3UPSA 3MGHA 8ICKA 4UD5A 4RT3A 4NLZA 9ICOA 2HHPA 4I2GA 5DDYA 3OUYB 4Z6FA 2PFOA 3H38A 2ID1A 3RJIA 4F5NA 1ZQIA 5HHIA 4K4GA 4F5QA 1ZQWA 4LVSA 4XQ8A 5HHHA 3LQCB 2M2UA 2ZH5A 1F5AA 4YCXA 5DDMA 1R89A 5DB8A 4M04A 2ISPA 5D46A 1UETA 3OVAA 8ICQA 4S3NA 5BPCA 1XSLA
chains in the Genus database with same CATH superfamily
4P4OA 2FMSA 4O69A 4PGQA 4XJEA 5IIKA 4GXJA 4WH5A 4P4MA 1Q78A 5CR0A 3C2MA 4WQKA 8ICGA 1ZQRA 4TURA 3JYYA 3ISDA 5J0QA 2EWRA 9ICVA 9ICAA 4QZ9A 2M2VA 4Z6EA 2BCUA 4O6AA 8ICRA 4QZBA 5CFSA 4I2HA 2GWSA 4JWMA 3CK6A 4I2EA 1ZQAA 5J2CA 1JAJA 4DO9A 2HN1A 5DBBA 3H39A 5J2IA 1ZQMA 8ICLA 5J0TA 4X4VA 3JPOA 8ICEA 2ZH9A 5HRLA 4P4PA 4HX0A 5J0WA 5J2JA 4M5DA 4I2JA 4LEZA 2FCLA 2GA9D 1HUZA 3EF2A 4DOCA 4M9NA 4JLZA 4WC3A 2IUBA 1YLQA 2O5AA 4IQUA 5J2DA 4PGYA 2FMPA 3OWGA 5HRDA 2BPGA 4WC5A 4YMOA 3TFRA 4IQVA 1ZQOA 1NO5A 3RJKA 4XA5A 4FO6A 4NLKA 2ZHAA 4AT7B 1MQ2A 8ICCA 3UXPA 4UD4A 5DKWA 4I29A 4UB4A 8ICUA 4K97A 5CFUA 4F5PA 4KLSA 4UAYA 4UBBA 1MQ3A 4M47A 3JCFA 5CB1A 3V7KA 2B4VA 2Q66A 4M0AA 3NKUA 5HRHA 1KDHA 5F2VO 5J0OA 5IIMA 4PPXA 1ZQCA 4XUSA 4O5EA 4MF2A 4EV6A 5DB7A 5J2HA 4QZGA 4PHAA 5J0YA 4QZIA 1ZQKA 2BCQA 4RT2A 4EBKA 5DB6A 4KLMA 4YMNA 9ICHA 4KLQA 4K4IA 7ICKA 8ICBA 5IIOA 4IG8A 3NYBA 3WFOA 8ICXA 7ICVA 4X4SA 4RWPA 1R8BA 4QZAA 7ICNA 1R8AA 3RH4A 3JPSA 5J2FA 4OAIZ 5B3QA 4M9JA 3PHZA 3V7LA 4X4TA 4WCWA 4M9LA 7ICSA 1ZJNA 3AQKA 5HRBA 3C5GA 4QZ8A 4NXUA 8ICIA 4O5CA 1BPEA 4LZDA 4Z6CA 1ZQVA 3NVOA 4O68A 5J2BA 2DR8A 4NKUA 4UAZA 3ER9B 3OVBA 4AT9B 5TZVA 4AT7A 3RJJA 3UQ0A 1BPYA 2DR9A 3V72A 4I2FA 4E8FA 4O5KA 4WC1A 5J29A 3JPQA 3WFPA 4LEWA 4NM1A 2NRKA 4M2YA 4NXTA 1BPXA 2DR7A 4F5RA 5BOMA 4R65A 4KLEA 5D49A 2GAFD 2RFFA 9ICIA 4UBCA 1XSNA 2BCSA 3HJ4A 3NWIA 3C2LA 1JMSA 4WC2A 1RPLA 4DOBA 9ICMA 4X4QA 4WBYA 1TVAA 2DRAA 4O9MA 2M2TA 4NXVA 3HW8A 1OU5A 3RH6A 3ERCC 4E7XA 4QZFA 2ZH6A 2ZH8A 4KLHA 2PBEA 5CHGA 4X4NA 1ZQLA 4KLDA 4PH5A 2ZH1A 4QZHA 4I2IA 5IIJA 3C18A 4N7RA 9ICEA 4KLTA 4NXWA 1MIYA 1GPJA 4AT9A 3RJEA 5CJ7A 2B56A 5DBCA 9ICPA 3PMNA 3WFSC 1ZQNA 4I2AA 1ZQZA 4XRHA 1ZQUA 4UB2A 2PFQA 3RJFA 1TFWA 3TFSA 3RH5A 4UB1A 5J2KA 2O1PA 8ICYA 4RQ1A 2P66A 1ZQGA 4LZGA 4YN4A 1TFYA 1ZQXA 3JPPA 4K9AA 4IQWA 4QZEA 8ICAA 3UXNA 1VJ7A 4FHVA 3L9DA 2BPCA 2B51A 3H37A 4IQTA 3LK9A 2I9GA 9ICBA 7ICOA 1KEJA 1ZQPA 3B0XA 4TUPA 3OVSA 2PFNA 1TV9A 4P2HA 7ICEA 3MDAA 5J0SA 2DR5A 5DEDA 3RJGA 4K99A 4X0BA 4LEVA 5J0UA 2W9MA 4R66A 4EEDA 5HC9A 1ZQJA 4WBZA 4OAGA 4WC4A 4PGXA 8ICMA 9ICLA 4NLNA 4PHDA 4GXIA 3ISBA 7ICUA 4K98A 4LEYA 2ZHBA 4X4PA 1BPZA 4KLGA 9ICGA 2BBHA 7ICIA 4FHYA 2BPFA 4JWNA 4PHEA 8ICWA 1ZQQA 3WFRE 4KLFA 3AQNA 1ZQTA 8ICPA 3B0YA 1XSPA 4K8VA 5HR9A 4XQ7A 9ICXA 5CHEA 4LT6A 4MFCA 1FA0A 1MIWA 3PMLA 8ICSA 4FO1A 3H3AA 2DVIA 2ZH3A 4FHXA 5J2GA 7ICMA 3ISCA 9ICFA 4WC0A 1BPDA 3OV7A 5IINA 5D62A 1ZQSA 3V7JA 1WOTA 5J0PA 5HREA 4YMMA 3UXOA 4I2DA 4MKPA 1ZQYA 4YD2A 5D4BA 8ICZA 3HWTA 5D61A 4E80A 9ICQA 4R63A 2FMQA 8ICHA 4X0AA 2ZH2A 5J0XA 3JPRA 3AU2A 3AU6A 4K96A 8ICVA 2PFPA 3JPNA 7ICGA 1V4AA 4KLUA 3PNCA 4RWOA 4F5OA 1BPBA 4EP7A 3MGIA 1ZQBA 2DRBA 4RQ6A 3HX0A 5CFTA 3K7DA 3WFQE 9ICNA 1JN3A 4OAFA 1Q79A 8ICTA 4MFAA 4RQ7A 5HRGA 2PXIA 7ICFA 9ICUA 4AT8B 3C66A 4RQ2A 5J0RA 5DECA 1UEVA 7ICQA 8ICOA 4NXZA 5IILA 5DB9A 5HRKA 4M9HA 3AQLA 7ICRA 2BE3A 9ICJA 5IIIA 4YD1A 4I28A 4RWNA 5EOZA 4WOYA 5DBAA 1ZQFA 4ATBB 3AUOA 3MDCA 7ICLA 5B3PA 4RWQA 4QZDA 3OUYA 2M2WA 3MBYA 3UQ2A 4WQLA 4RQ3A 8ICNA 2BBJA 4WC7A 5J2AA 1R8CA 4TUQA 4UAWA 3UPQA 4EEBA 3K75D 4EGWA 4NM2A 7ICHA 5HRIA 4K4HA 3ER8C 3C2KA 5CA7A 4KLLA 4FHPA 2BCRA 4KLIA 4X4UA 4UB3A 3GDXA 2VANA 4Z6DA 1JQRA 4FH5A 4ATBA 2BCVA 4I27A 5D63A 1RZTA 3C5FA 4I2CA 5CWRA 4K9BA 2ZH4A 2ISOA 3AQMA 4OAHA 4KLOA 7ICJA 4NKTA 7ICPA 1KNYA 4KLJA 4NY8A 4RQ8A 5BOLA 4TUSA 3HIYA 1NOMA 4I2BA 4AT8A 4EBJA 4RPYA 2HN2A 4RQ4A 4PHPA 4RPXA 2ZH7A 4RQ5A 4M9GA 3HJ1A 9ICWA 4R64A 4KB6A 4GXKA 4MFFA 9ICRA 4FHWA 7ICTA 4DOAA 1HUOA 4WC6A 4FH3A 5HRFA 8ICFA 3RJHA 9ICTA 5CP2A 1ZQDA 3JZ0A 9ICCA 5J2EA 3OGUA 1MIVA 4UB5A 1VFGA 1UEUA 1ZQEA 9ICSA 3JPTA 1ZJMA 4X5VA 4RPZA 1PX5A 8ICJA 4QZCA 4X4OA 2IHMA 1ZQHA 4JLXA 4RQ0A 4X4RA 4MF8A 9ICKA 3UPSA 3MGHA 8ICKA 4UD5A 4I0UA 4RT3A 4NLZA 9ICOA 4O67A 2HHPA 4I2GA 5DDYA 3OUYB 4Z6FA 2PFOA 3H38A 2ID1A 3RJIA 2IHOA 4F5NA 1ZQIA 5HHIA 4NXXA 4K4GA 4F5QA 1ZQWA 5JTGA 4LVSA 4XQ8A 5HHHA 3LQCB 2M2UA 2ZH5A 4KM5A 1F5AA 4YCXA 5DDMA 3MCRA 1R89A 5DB8A 4M04A 2ISPA 5D46A 1UETA 3OVAA 8ICQA 4S3NA 5BPCA 1XSLA
chains in the Genus database with same CATH topology
4P4OA 2FMSA 4PGQA 5IIKA 4GXJA 4P4MA 1Q78A 5CR0A 3C2MA 8ICGA 1ZQRA 4TURA 3JYYA 3ISDA 5J0QA 9ICVA 9ICAA 4QZ9A 2M2VA 4Z6EA 2BCUA 8ICRA 4QZBA 4I2HA 2GWSA 4JWMA 4I2EA 1ZQAA 5J2CA 1JAJA 4DO9A 5DBBA 3H39A 5J2IA 1ZQMA 8ICLA 5J0TA 4X4VA 3JPOA 8ICEA 2ZH9A 5HRLA 4P4PA 5J0WA 5J2JA 4M5DA 4I2JA 1HUZA 4DOCA 4M9NA 4WC3A 1YLQA 2O5AA 4IQUA 5J2DA 4PGYA 2FMPA 5HRDA 2BPGA 4WC5A 4YMOA 3TFRA 4IQVA 1ZQOA 1NO5A 3RJKA 4XA5A 4FO6A 4NLKA 2ZHAA 4AT7B 1MQ2A 8ICCA 3UXPA 4UD4A 5DKWA 4I29A 4UB4A 8ICUA 4F5PA 4KLSA 4UAYA 4UBBA 1MQ3A 4M47A 5CB1A 3V7KA 2Q66A 4M0AA 5HRHA 1KDHA 5F2VO 5J0OA 5IIMA 4PPXA 1ZQCA 4XUSA 4O5EA 4MF2A 5DB7A 5J2HA 4QZGA 4PHAA 5J0YA 4QZIA 1ZQKA 2BCQA 4RT2A 4EBKA 5DB6A 4KLMA 4YMNA 9ICHA 4KLQA 4K4IA 7ICKA 8ICBA 5IIOA 4IG8A 3NYBA 3WFOA 8ICXA 7ICVA 4X4SA 4RWPA 1R8BA 4QZAA 7ICNA 1R8AA 3RH4A 3JPSA 5J2FA 4M9JA 3V7LA 4X4TA 4WCWA 4M9LA 7ICSA 1ZJNA 3AQKA 5HRBA 3C5GA 4QZ8A 8ICIA 4O5CA 1BPEA 4LZDA 4Z6CA 1ZQVA 2DR8A 5J2BA 4NKUA 4UAZA 3OVBA 4AT9B 5TZVA 4AT7A 3RJJA 3UQ0A 1BPYA 2DR9A 3V72A 4I2FA 4E8FA 4O5KA 4WC1A 5J29A 3JPQA 3WFPA 4NM1A 2NRKA 4M2YA 1BPXA 2DR7A 4F5RA 5BOMA 4R65A 4KLEA 5D49A 2RFFA 9ICIA 4UBCA 1XSNA 2BCSA 3HJ4A 3C2LA 1JMSA 4WC2A 1RPLA 4DOBA 9ICMA 4X4QA 4WBYA 1TVAA 2DRAA 4O9MA 2M2TA 3HW8A 1OU5A 3RH6A 4E7XA 4QZFA 2ZH6A 2ZH8A 4KLHA 2PBEA 5CHGA 4X4NA 1ZQLA 4KLDA 4PH5A 2ZH1A 4QZHA 4I2IA 5IIJA 3C18A 9ICEA 4KLTA 1MIYA 3RJEA 4AT9A 5CJ7A 5DBCA 9ICPA 3PMNA 3WFSC 1ZQNA 4I2AA 1ZQZA 4XRHA 1ZQUA 4UB2A 2PFQA 3RJFA 1TFWA 3TFSA 3RH5A 4UB1A 5J2KA 2O1PA 8ICYA 4RQ1A 2P66A 1ZQGA 4LZGA 4YN4A 1TFYA 1ZQXA 3JPPA 4IQWA 4QZEA 8ICAA 3UXNA 1VJ7A 4FHVA 3L9DA 2BPCA 3H37A 4IQTA 2I9GA 3LK9A 9ICBA 7ICOA 1KEJA 1ZQPA 3B0XA 4TUPA 3OVSA 2PFNA 1TV9A 4P2HA 7ICEA 3MDAA 5J0SA 2DR5A 5DEDA 3RJGA 4X0BA 5J0UA 2W9MA 4R66A 5HC9A 1ZQJA 4WBZA 4WC4A 4PGXA 8ICMA 9ICLA 4NLNA 4PHDA 4GXIA 3ISBA 7ICUA 2ZHBA 4X4PA 1BPZA 4KLGA 9ICGA 7ICIA 4FHYA 2BPFA 4JWNA 4PHEA 8ICWA 1ZQQA 3WFRE 4KLFA 3AQNA 1ZQTA 8ICPA 3B0YA 1XSPA 5HR9A 4XQ7A 9ICXA 4LT6A 4MFCA 1FA0A 1MIWA 3PMLA 8ICSA 3H3AA 2DVIA 2ZH3A 4FHXA 5J2GA 7ICMA 3ISCA 9ICFA 4WC0A 1BPDA 3OV7A 5IINA 1ZQSA 3V7JA 1WOTA 5J0PA 5HREA 4YMMA 3UXOA 4I2DA 1ZQYA 4YD2A 5D4BA 8ICZA 3HWTA 4E80A 9ICQA 4R63A 2FMQA 8ICHA 4X0AA 2ZH2A 5J0XA 3JPRA 3AU2A 3AU6A 8ICVA 2PFPA 3JPNA 7ICGA 1V4AA 4KLUA 3PNCA 4RWOA 4F5OA 1BPBA 4EP7A 3MGIA 1ZQBA 2DRBA 4RQ6A 3HX0A 3WFQE 9ICNA 1JN3A 1Q79A 8ICTA 4MFAA 4RQ7A 5HRGA 2PXIA 7ICFA 9ICUA 4AT8B 3C66A 4RQ2A 5J0RA 5DECA 1UEVA 7ICQA 8ICOA 4NXZA 5IILA 5DB9A 5HRKA 4M9HA 3AQLA 7ICRA 2BE3A 9ICJA 5IIIA 4YD1A 4I28A 4RWNA 5EOZA 5DBAA 1ZQFA 4ATBB 3AUOA 3MDCA 7ICLA 4RWQA 4QZDA 3OUYA 2M2WA 3MBYA 3UQ2A 4RQ3A 8ICNA 4WC7A 5J2AA 1R8CA 4TUQA 4UAWA 3UPQA 3K75D 4NM2A 7ICHA 5HRIA 4K4HA 3C2KA 5CA7A 4KLLA 4FHPA 2BCRA 4KLIA 4X4UA 4UB3A 3GDXA 2VANA 4Z6DA 1JQRA 4FH5A 4ATBA 2BCVA 4I27A 1RZTA 3C5FA 4I2CA 5CWRA 2ZH4A 2ISOA 3AQMA 4KLOA 7ICJA 4NKTA 7ICPA 1KNYA 4KLJA 4NY8A 4RQ8A 5BOLA 4TUSA 3HIYA 1NOMA 4I2BA 4AT8A 4EBJA 4RPYA 4RQ4A 4PHPA 4RPXA 2ZH7A 4RQ5A 4M9GA 3HJ1A 9ICWA 4R64A 4GXKA 4MFFA 9ICRA 4FHWA 7ICTA 4DOAA 1HUOA 4WC6A 4FH3A 5HRFA 8ICFA 3RJHA 9ICTA 5CP2A 1ZQDA 3JZ0A 9ICCA 5J2EA 3OGUA 1MIVA 4UB5A 1VFGA 1UEUA 1ZQEA 9ICSA 3JPTA 1ZJMA 4X5VA 4RPZA 1PX5A 8ICJA 4QZCA 4X4OA 2IHMA 1ZQHA 4RQ0A 4X4RA 4MF8A 9ICKA 3UPSA 3MGHA 8ICKA 4UD5A 4RT3A 4NLZA 9ICOA 2HHPA 4I2GA 5DDYA 3OUYB 4Z6FA 2PFOA 3H38A 2ID1A 3RJIA 4F5NA 1ZQIA 5HHIA 4K4GA 4F5QA 1ZQWA 4LVSA 4XQ8A 5HHHA 3LQCB 2M2UA 2ZH5A 1F5AA 4YCXA 5DDMA 1R89A 5DB8A 4M04A 2ISPA 5D46A 1UETA 3OVAA 8ICQA 4S3NA 5BPCA 1XSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4O A;  2FMS A;  4PGQ A;  5IIK A;  4GXJ A;  4P4M A;  1Q78 A;  5CR0 A;  3C2M A;  8ICG A;  1ZQR A;  4TUR A;  3JYY A;  3ISD A;  5J0Q A;  9ICV A;  9ICA A;  4QZ9 A;  2M2V A;  4Z6E A;  2BCU A;  8ICR A;  4QZB A;  4I2H A;  2GWS A;  4JWM A;  4I2E A;  1ZQA A;  5J2C A;  1JAJ A;  4DO9 A;  5DBB A;  3H39 A;  5J2I A;  1ZQM A;  8ICL A;  5J0T A;  4X4V A;  3JPO A;  8ICE A;  2ZH9 A;  5HRL A;  4P4P A;  5J0W A;  5J2J A;  4M5D A;  4I2J A;  1HUZ A;  4DOC A;  4M9N A;  4WC3 A;  1YLQ A;  2O5A A;  4IQU A;  5J2D A;  4PGY A;  2FMP A;  5HRD A;  2BPG A;  4WC5 A;  4YMO A;  3TFR A;  4IQV A;  1ZQO A;  1NO5 A;  3RJK A;  4XA5 A;  4FO6 A;  4NLK A;  2ZHA A;  4AT7 B;  1MQ2 A;  8ICC A;  3UXP A;  4UD4 A;  5DKW A;  4I29 A;  4UB4 A;  8ICU A;  4F5P A;  4KLS A;  4UAY A;  4UBB A;  1MQ3 A;  4M47 A;  5CB1 A;  3V7K A;  2Q66 A;  4M0A A;  5HRH A;  1KDH A;  5F2V O;  5J0O A;  5IIM A;  4PPX A;  1ZQC A;  4XUS A;  4O5E A;  4MF2 A;  5DB7 A;  5J2H A;  4QZG A;  4PHA A;  5J0Y A;  4QZI A;  1ZQK A;  2BCQ A;  4RT2 A;  4EBK A;  5DB6 A;  4KLM A;  4YMN A;  9ICH A;  4KLQ A;  4K4I A;  7ICK A;  8ICB A;  5IIO A;  4IG8 A;  3NYB A;  3WFO A;  8ICX A;  7ICV A;  4X4S A;  4RWP A;  1R8B A;  4QZA A;  7ICN A;  1R8A A;  3RH4 A;  3JPS A;  5J2F A;  4M9J A;  3V7L A;  4X4T A;  4WCW A;  4M9L A;  7ICS A;  1ZJN A;  3AQK A;  5HRB A;  3C5G A;  4QZ8 A;  8ICI A;  4O5C A;  1BPE A;  4LZD A;  4Z6C A;  1ZQV A;  2DR8 A;  5J2B A;  4NKU A;  4UAZ A;  3OVB A;  4AT9 B;  5TZV A;  4AT7 A;  3RJJ A;  3UQ0 A;  1BPY A;  2DR9 A;  3V72 A;  4I2F A;  4E8F A;  4O5K A;  4WC1 A;  5J29 A;  3JPQ A;  3WFP A;  4NM1 A;  2NRK A;  4M2Y A;  1BPX A;  2DR7 A;  4F5R A;  5BOM A;  4R65 A;  4KLE A;  5D49 A;  2RFF A;  9ICI A;  4UBC A;  1XSN A;  2BCS A;  3HJ4 A;  3C2L A;  1JMS A;  4WC2 A;  1RPL A;  4DOB A;  9ICM A;  4X4Q A;  4WBY A;  1TVA A;  2DRA A;  4O9M A;  2M2T A;  3HW8 A;  1OU5 A;  3RH6 A;  4E7X A;  4QZF A;  2ZH6 A;  2ZH8 A;  4KLH A;  2PBE A;  5CHG A;  4X4N A;  1ZQL A;  4KLD A;  4PH5 A;  2ZH1 A;  4QZH A;  4I2I A;  5IIJ A;  3C18 A;  9ICE A;  4KLT A;  1MIY A;  3RJE A;  4AT9 A;  5CJ7 A;  5DBC A;  9ICP A;  3PMN A;  3WFS C;  1ZQN A;  4I2A A;  1ZQZ A;  4XRH A;  1ZQU A;  4UB2 A;  2PFQ A;  3RJF A;  1TFW A;  3TFS A;  3RH5 A;  4UB1 A;  5J2K A;  2O1P A;  8ICY A;  4RQ1 A;  2P66 A;  1ZQG A;  4LZG A;  4YN4 A;  1TFY A;  1ZQX A;  3JPP A;  4IQW A;  4QZE A;  8ICA A;  3UXN A;  1VJ7 A;  4FHV A;  3L9D A;  2BPC A;  3H37 A;  4IQT A;  2I9G A;  3LK9 A;  9ICB A;  7ICO A;  1KEJ A;  1ZQP A;  3B0X A;  4TUP A;  3OVS A;  2PFN A;  1TV9 A;  4P2H A;  7ICE A;  3MDA A;  5J0S A;  2DR5 A;  5DED A;  3RJG A;  4X0B A;  5J0U A;  2W9M A;  4R66 A;  5HC9 A;  1ZQJ A;  4WBZ A;  4WC4 A;  4PGX A;  8ICM A;  9ICL A;  4NLN A;  4PHD A;  4GXI A;  3ISB A;  7ICU A;  2ZHB A;  4X4P A;  1BPZ A;  4KLG A;  9ICG A;  7ICI A;  4FHY A;  2BPF A;  4JWN A;  4PHE A;  8ICW A;  1ZQQ A;  3WFR E;  4KLF A;  3AQN A;  1ZQT A;  8ICP A;  3B0Y A;  1XSP A;  5HR9 A;  4XQ7 A;  9ICX A;  4LT6 A;  4MFC A;  1FA0 A;  1MIW A;  3PML A;  8ICS A;  3H3A A;  2DVI A;  2ZH3 A;  4FHX A;  5J2G A;  7ICM A;  3ISC A;  9ICF A;  4WC0 A;  1BPD A;  3OV7 A;  5IIN A;  1ZQS A;  3V7J A;  1WOT A;  5J0P A;  5HRE A;  4YMM A;  3UXO A;  4I2D A;  1ZQY A;  4YD2 A;  5D4B A;  8ICZ A;  3HWT A;  4E80 A;  9ICQ A;  4R63 A;  2FMQ A;  8ICH A;  4X0A A;  2ZH2 A;  5J0X A;  3JPR A;  3AU2 A;  3AU6 A;  8ICV A;  2PFP A;  3JPN A;  7ICG A;  1V4A A;  4KLU A;  3PNC A;  4RWO A;  4F5O A;  1BPB A;  4EP7 A;  3MGI A;  1ZQB A;  2DRB A;  4RQ6 A;  3HX0 A;  3WFQ E;  9ICN A;  1JN3 A;  1Q79 A;  8ICT A;  4MFA A;  4RQ7 A;  5HRG A;  2PXI A;  7ICF A;  9ICU A;  4AT8 B;  3C66 A;  4RQ2 A;  5J0R A;  5DEC A;  1UEV A;  7ICQ A;  8ICO A;  4NXZ A;  5IIL A;  5DB9 A;  5HRK A;  4M9H A;  3AQL A;  7ICR A;  2BE3 A;  9ICJ A;  5III A;  4YD1 A;  4I28 A;  4RWN A;  5EOZ A;  5DBA A;  1ZQF A;  4ATB B;  3AUO A;  3MDC A;  7ICL A;  4RWQ A;  4QZD A;  3OUY A;  2M2W A;  3MBY A;  3UQ2 A;  4RQ3 A;  8ICN A;  4WC7 A;  5J2A A;  1R8C A;  4TUQ A;  4UAW A;  3UPQ A;  3K75 D;  4NM2 A;  7ICH A;  5HRI A;  4K4H A;  3C2K A;  5CA7 A;  4KLL A;  4FHP A;  2BCR A;  4KLI A;  4X4U A;  4UB3 A;  3GDX A;  2VAN A;  4Z6D A;  1JQR A;  4FH5 A;  4ATB A;  2BCV A;  4I27 A;  1RZT A;  3C5F A;  4I2C A;  5CWR A;  2ZH4 A;  2ISO A;  3AQM A;  4KLO A;  7ICJ A;  4NKT A;  7ICP A;  1KNY A;  4KLJ A;  4NY8 A;  4RQ8 A;  5BOL A;  4TUS A;  3HIY A;  1NOM A;  4I2B A;  4AT8 A;  4EBJ A;  4RPY A;  4RQ4 A;  4PHP A;  4RPX A;  2ZH7 A;  4RQ5 A;  4M9G A;  3HJ1 A;  9ICW A;  4R64 A;  4GXK A;  4MFF A;  9ICR A;  4FHW A;  7ICT A;  4DOA A;  1HUO A;  4WC6 A;  4FH3 A;  5HRF A;  8ICF A;  3RJH A;  9ICT A;  5CP2 A;  1ZQD A;  3JZ0 A;  9ICC A;  5J2E A;  3OGU A;  1MIV A;  4UB5 A;  1VFG A;  1UEU A;  1ZQE A;  9ICS A;  3JPT A;  1ZJM A;  4X5V A;  4RPZ A;  1PX5 A;  8ICJ A;  4QZC A;  4X4O A;  2IHM A;  1ZQH A;  4RQ0 A;  4X4R A;  4MF8 A;  9ICK A;  3UPS A;  3MGH A;  8ICK A;  4UD5 A;  4RT3 A;  4NLZ A;  9ICO A;  2HHP A;  4I2G A;  5DDY A;  3OUY B;  4Z6F A;  2PFO A;  3H38 A;  2ID1 A;  3RJI A;  4F5N A;  1ZQI A;  5HHI A;  4K4G A;  4F5Q A;  1ZQW A;  4LVS A;  4XQ8 A;  5HHH A;  3LQC B;  2M2U A;  2ZH5 A;  1F5A A;  4YCX A;  5DDM A;  1R89 A;  5DB8 A;  4M04 A;  2ISP A;  5D46 A;  1UET A;  3OVA A;  8ICQ A;  4S3N A;  5BPC A;  1XSL A; 
#chains in the Genus database with same CATH topology
 4P4O A;  2FMS A;  4O69 A;  4PGQ A;  4XJE A;  5IIK A;  4GXJ A;  4WH5 A;  4P4M A;  1Q78 A;  5CR0 A;  3C2M A;  4WQK A;  8ICG A;  1ZQR A;  4TUR A;  3JYY A;  3ISD A;  5J0Q A;  2EWR A;  9ICV A;  9ICA A;  4QZ9 A;  2M2V A;  4Z6E A;  2BCU A;  4O6A A;  8ICR A;  4QZB A;  5CFS A;  4I2H A;  2GWS A;  4JWM A;  3CK6 A;  4I2E A;  1ZQA A;  5J2C A;  1JAJ A;  4DO9 A;  2HN1 A;  5DBB A;  3H39 A;  5J2I A;  1ZQM A;  8ICL A;  5J0T A;  4X4V A;  3JPO A;  8ICE A;  2ZH9 A;  5HRL A;  4P4P A;  4HX0 A;  5J0W A;  5J2J A;  4M5D A;  4I2J A;  4LEZ A;  2FCL A;  2GA9 D;  1HUZ A;  3EF2 A;  4DOC A;  4M9N A;  4JLZ A;  4WC3 A;  2IUB A;  1YLQ A;  2O5A A;  4IQU A;  5J2D A;  4PGY A;  2FMP A;  3OWG A;  5HRD A;  2BPG A;  4WC5 A;  4YMO A;  3TFR A;  4IQV A;  1ZQO A;  1NO5 A;  3RJK A;  4XA5 A;  4FO6 A;  4NLK A;  2ZHA A;  4AT7 B;  1MQ2 A;  8ICC A;  3UXP A;  4UD4 A;  5DKW A;  4I29 A;  4UB4 A;  8ICU A;  4K97 A;  5CFU A;  4F5P A;  4KLS A;  4UAY A;  4UBB A;  1MQ3 A;  4M47 A;  3JCF A;  5CB1 A;  3V7K A;  2B4V A;  2Q66 A;  4M0A A;  3NKU A;  5HRH A;  1KDH A;  5F2V O;  5J0O A;  5IIM A;  4PPX A;  1ZQC A;  4XUS A;  4O5E A;  4MF2 A;  4EV6 A;  5DB7 A;  5J2H A;  4QZG A;  4PHA A;  5J0Y A;  4QZI A;  1ZQK A;  2BCQ A;  4RT2 A;  4EBK A;  5DB6 A;  4KLM A;  4YMN A;  9ICH A;  4KLQ A;  4K4I A;  7ICK A;  8ICB A;  5IIO A;  4IG8 A;  3NYB A;  3WFO A;  8ICX A;  7ICV A;  4X4S A;  4RWP A;  1R8B A;  4QZA A;  7ICN A;  1R8A A;  3RH4 A;  3JPS A;  5J2F A;  4OAI Z;  5B3Q A;  4M9J A;  3PHZ A;  3V7L A;  4X4T A;  4WCW A;  4M9L A;  7ICS A;  1ZJN A;  3AQK A;  5HRB A;  3C5G A;  4QZ8 A;  4NXU A;  8ICI A;  4O5C A;  1BPE A;  4LZD A;  4Z6C A;  1ZQV A;  3NVO A;  4O68 A;  5J2B A;  2DR8 A;  4NKU A;  4UAZ A;  3ER9 B;  3OVB A;  4AT9 B;  5TZV A;  4AT7 A;  3RJJ A;  3UQ0 A;  1BPY A;  2DR9 A;  3V72 A;  4I2F A;  4E8F A;  4O5K A;  4WC1 A;  5J29 A;  3JPQ A;  3WFP A;  4LEW A;  4NM1 A;  2NRK A;  4M2Y A;  4NXT A;  1BPX A;  2DR7 A;  4F5R A;  5BOM A;  4R65 A;  4KLE A;  5D49 A;  2GAF D;  2RFF A;  9ICI A;  4UBC A;  1XSN A;  2BCS A;  3HJ4 A;  3NWI A;  3C2L A;  1JMS A;  4WC2 A;  1RPL A;  4DOB A;  9ICM A;  4X4Q A;  4WBY A;  1TVA A;  2DRA A;  4O9M A;  2M2T A;  4NXV A;  3HW8 A;  1OU5 A;  3RH6 A;  3ERC C;  4E7X A;  4QZF A;  2ZH6 A;  2ZH8 A;  4KLH A;  2PBE A;  5CHG A;  4X4N A;  1ZQL A;  4KLD A;  4PH5 A;  2ZH1 A;  4QZH A;  4I2I A;  5IIJ A;  3C18 A;  4N7R A;  9ICE A;  4KLT A;  4NXW A;  1MIY A;  1GPJ A;  4AT9 A;  3RJE A;  5CJ7 A;  2B56 A;  5DBC A;  9ICP A;  3PMN A;  3WFS C;  1ZQN A;  4I2A A;  1ZQZ A;  4XRH A;  1ZQU A;  4UB2 A;  2PFQ A;  3RJF A;  1TFW A;  3TFS A;  3RH5 A;  4UB1 A;  5J2K A;  2O1P A;  8ICY A;  4RQ1 A;  2P66 A;  1ZQG A;  4LZG A;  4YN4 A;  1TFY A;  1ZQX A;  3JPP A;  4K9A A;  4IQW A;  4QZE A;  8ICA A;  3UXN A;  1VJ7 A;  4FHV A;  3L9D A;  2BPC A;  2B51 A;  3H37 A;  4IQT A;  3LK9 A;  2I9G A;  9ICB A;  7ICO A;  1KEJ A;  1ZQP A;  3B0X A;  4TUP A;  3OVS A;  2PFN A;  1TV9 A;  4P2H A;  7ICE A;  3MDA A;  5J0S A;  2DR5 A;  5DED A;  3RJG A;  4K99 A;  4X0B A;  4LEV A;  5J0U A;  2W9M A;  4R66 A;  4EED A;  5HC9 A;  1ZQJ A;  4WBZ A;  4OAG A;  4WC4 A;  4PGX A;  8ICM A;  9ICL A;  4NLN A;  4PHD A;  4GXI A;  3ISB A;  7ICU A;  4K98 A;  4LEY A;  2ZHB A;  4X4P A;  1BPZ A;  4KLG A;  9ICG A;  2BBH A;  7ICI A;  4FHY A;  2BPF A;  4JWN A;  4PHE A;  8ICW A;  1ZQQ A;  3WFR E;  4KLF A;  3AQN A;  1ZQT A;  8ICP A;  3B0Y A;  1XSP A;  4K8V A;  5HR9 A;  4XQ7 A;  9ICX A;  5CHE A;  4LT6 A;  4MFC A;  1FA0 A;  1MIW A;  3PML A;  8ICS A;  4FO1 A;  3H3A A;  2DVI A;  2ZH3 A;  4FHX A;  5J2G A;  7ICM A;  3ISC A;  9ICF A;  4WC0 A;  1BPD A;  3OV7 A;  5IIN A;  5D62 A;  1ZQS A;  3V7J A;  1WOT A;  5J0P A;  5HRE A;  4YMM A;  3UXO A;  4I2D A;  4MKP A;  1ZQY A;  4YD2 A;  5D4B A;  8ICZ A;  3HWT A;  5D61 A;  4E80 A;  9ICQ A;  4R63 A;  2FMQ A;  8ICH A;  4X0A A;  2ZH2 A;  5J0X A;  3JPR A;  3AU2 A;  3AU6 A;  4K96 A;  8ICV A;  2PFP A;  3JPN A;  7ICG A;  1V4A A;  4KLU A;  3PNC A;  4RWO A;  4F5O A;  1BPB A;  4EP7 A;  3MGI A;  1ZQB A;  2DRB A;  4RQ6 A;  3HX0 A;  5CFT A;  3K7D A;  3WFQ E;  9ICN A;  1JN3 A;  4OAF A;  1Q79 A;  8ICT A;  4MFA A;  4RQ7 A;  5HRG A;  2PXI A;  7ICF A;  9ICU A;  4AT8 B;  3C66 A;  4RQ2 A;  5J0R A;  5DEC A;  1UEV A;  7ICQ A;  8ICO A;  4NXZ A;  5IIL A;  5DB9 A;  5HRK A;  4M9H A;  3AQL A;  7ICR A;  2BE3 A;  9ICJ A;  5III A;  4YD1 A;  4I28 A;  4RWN A;  5EOZ A;  4WOY A;  5DBA A;  1ZQF A;  4ATB B;  3AUO A;  3MDC A;  7ICL A;  5B3P A;  4RWQ A;  4QZD A;  3OUY A;  2M2W A;  3MBY A;  3UQ2 A;  4WQL A;  4RQ3 A;  8ICN A;  2BBJ A;  4WC7 A;  5J2A A;  1R8C A;  4TUQ A;  4UAW A;  3UPQ A;  4EEB A;  3K75 D;  4EGW A;  4NM2 A;  7ICH A;  5HRI A;  4K4H A;  3ER8 C;  3C2K A;  5CA7 A;  4KLL A;  4FHP A;  2BCR A;  4KLI A;  4X4U A;  4UB3 A;  3GDX A;  2VAN A;  4Z6D A;  1JQR A;  4FH5 A;  4ATB A;  2BCV A;  4I27 A;  5D63 A;  1RZT A;  3C5F A;  4I2C A;  5CWR A;  4K9B A;  2ZH4 A;  2ISO A;  3AQM A;  4OAH A;  4KLO A;  7ICJ A;  4NKT A;  7ICP A;  1KNY A;  4KLJ A;  4NY8 A;  4RQ8 A;  5BOL A;  4TUS A;  3HIY A;  1NOM A;  4I2B A;  4AT8 A;  4EBJ A;  4RPY A;  2HN2 A;  4RQ4 A;  4PHP A;  4RPX A;  2ZH7 A;  4RQ5 A;  4M9G A;  3HJ1 A;  9ICW A;  4R64 A;  4KB6 A;  4GXK A;  4MFF A;  9ICR A;  4FHW A;  7ICT A;  4DOA A;  1HUO A;  4WC6 A;  4FH3 A;  5HRF A;  8ICF A;  3RJH A;  9ICT A;  5CP2 A;  1ZQD A;  3JZ0 A;  9ICC A;  5J2E A;  3OGU A;  1MIV A;  4UB5 A;  1VFG A;  1UEU A;  1ZQE A;  9ICS A;  3JPT A;  1ZJM A;  4X5V A;  4RPZ A;  1PX5 A;  8ICJ A;  4QZC A;  4X4O A;  2IHM A;  1ZQH A;  4JLX A;  4RQ0 A;  4X4R A;  4MF8 A;  9ICK A;  3UPS A;  3MGH A;  8ICK A;  4UD5 A;  4I0U A;  4RT3 A;  4NLZ A;  9ICO A;  4O67 A;  2HHP A;  4I2G A;  5DDY A;  3OUY B;  4Z6F A;  2PFO A;  3H38 A;  2ID1 A;  3RJI A;  2IHO A;  4F5N A;  1ZQI A;  5HHI A;  4NXX A;  4K4G A;  4F5Q A;  1ZQW A;  5JTG A;  4LVS A;  4XQ8 A;  5HHH A;  3LQC B;  2M2U A;  2ZH5 A;  4KM5 A;  1F5A A;  4YCX A;  5DDM A;  3MCR A;  1R89 A;  5DB8 A;  4M04 A;  2ISP A;  5D46 A;  1UET A;  3OVA A;  8ICQ A;  4S3N A;  5BPC A;  1XSL A; 
#chains in the Genus database with same CATH homology
 4P4O A;  2FMS A;  4PGQ A;  5IIK A;  4GXJ A;  4P4M A;  1Q78 A;  5CR0 A;  3C2M A;  8ICG A;  1ZQR A;  4TUR A;  3JYY A;  3ISD A;  5J0Q A;  9ICV A;  9ICA A;  4QZ9 A;  2M2V A;  4Z6E A;  2BCU A;  8ICR A;  4QZB A;  4I2H A;  2GWS A;  4JWM A;  4I2E A;  1ZQA A;  5J2C A;  1JAJ A;  4DO9 A;  5DBB A;  3H39 A;  5J2I A;  1ZQM A;  8ICL A;  5J0T A;  4X4V A;  3JPO A;  8ICE A;  2ZH9 A;  5HRL A;  4P4P A;  5J0W A;  5J2J A;  4M5D A;  4I2J A;  1HUZ A;  4DOC A;  4M9N A;  4WC3 A;  1YLQ A;  2O5A A;  4IQU A;  5J2D A;  4PGY A;  2FMP A;  5HRD A;  2BPG A;  4WC5 A;  4YMO A;  3TFR A;  4IQV A;  1ZQO A;  1NO5 A;  3RJK A;  4XA5 A;  4FO6 A;  4NLK A;  2ZHA A;  4AT7 B;  1MQ2 A;  8ICC A;  3UXP A;  4UD4 A;  5DKW A;  4I29 A;  4UB4 A;  8ICU A;  4F5P A;  4KLS A;  4UAY A;  4UBB A;  1MQ3 A;  4M47 A;  5CB1 A;  3V7K A;  2Q66 A;  4M0A A;  5HRH A;  1KDH A;  5F2V O;  5J0O A;  5IIM A;  4PPX A;  1ZQC A;  4XUS A;  4O5E A;  4MF2 A;  5DB7 A;  5J2H A;  4QZG A;  4PHA A;  5J0Y A;  4QZI A;  1ZQK A;  2BCQ A;  4RT2 A;  4EBK A;  5DB6 A;  4KLM A;  4YMN A;  9ICH A;  4KLQ A;  4K4I A;  7ICK A;  8ICB A;  5IIO A;  4IG8 A;  3NYB A;  3WFO A;  8ICX A;  7ICV A;  4X4S A;  4RWP A;  1R8B A;  4QZA A;  7ICN A;  1R8A A;  3RH4 A;  3JPS A;  5J2F A;  4M9J A;  3V7L A;  4X4T A;  4WCW A;  4M9L A;  7ICS A;  1ZJN A;  3AQK A;  5HRB A;  3C5G A;  4QZ8 A;  8ICI A;  4O5C A;  1BPE A;  4LZD A;  4Z6C A;  1ZQV A;  2DR8 A;  5J2B A;  4NKU A;  4UAZ A;  3OVB A;  4AT9 B;  5TZV A;  4AT7 A;  3RJJ A;  3UQ0 A;  1BPY A;  2DR9 A;  3V72 A;  4I2F A;  4E8F A;  4O5K A;  4WC1 A;  5J29 A;  3JPQ A;  3WFP A;  4NM1 A;  2NRK A;  4M2Y A;  1BPX A;  2DR7 A;  4F5R A;  5BOM A;  4R65 A;  4KLE A;  5D49 A;  2RFF A;  9ICI A;  4UBC A;  1XSN A;  2BCS A;  3HJ4 A;  3C2L A;  1JMS A;  4WC2 A;  1RPL A;  4DOB A;  9ICM A;  4X4Q A;  4WBY A;  1TVA A;  2DRA A;  4O9M A;  2M2T A;  3HW8 A;  1OU5 A;  3RH6 A;  4E7X A;  4QZF A;  2ZH6 A;  2ZH8 A;  4KLH A;  2PBE A;  5CHG A;  4X4N A;  1ZQL A;  4KLD A;  4PH5 A;  2ZH1 A;  4QZH A;  4I2I A;  5IIJ A;  3C18 A;  9ICE A;  4KLT A;  1MIY A;  3RJE A;  4AT9 A;  5CJ7 A;  5DBC A;  9ICP A;  3PMN A;  3WFS C;  1ZQN A;  4I2A A;  1ZQZ A;  4XRH A;  1ZQU A;  4UB2 A;  2PFQ A;  3RJF A;  1TFW A;  3TFS A;  3RH5 A;  4UB1 A;  5J2K A;  2O1P A;  8ICY A;  4RQ1 A;  2P66 A;  1ZQG A;  4LZG A;  4YN4 A;  1TFY A;  1ZQX A;  3JPP A;  4IQW A;  4QZE A;  8ICA A;  3UXN A;  1VJ7 A;  4FHV A;  3L9D A;  2BPC A;  3H37 A;  4IQT A;  2I9G A;  3LK9 A;  9ICB A;  7ICO A;  1KEJ A;  1ZQP A;  3B0X A;  4TUP A;  3OVS A;  2PFN A;  1TV9 A;  4P2H A;  7ICE A;  3MDA A;  5J0S A;  2DR5 A;  5DED A;  3RJG A;  4X0B A;  5J0U A;  2W9M A;  4R66 A;  5HC9 A;  1ZQJ A;  4WBZ A;  4WC4 A;  4PGX A;  8ICM A;  9ICL A;  4NLN A;  4PHD A;  4GXI A;  3ISB A;  7ICU A;  2ZHB A;  4X4P A;  1BPZ A;  4KLG A;  9ICG A;  7ICI A;  4FHY A;  2BPF A;  4JWN A;  4PHE A;  8ICW A;  1ZQQ A;  3WFR E;  4KLF A;  3AQN A;  1ZQT A;  8ICP A;  3B0Y A;  1XSP A;  5HR9 A;  4XQ7 A;  9ICX A;  4LT6 A;  4MFC A;  1FA0 A;  1MIW A;  3PML A;  8ICS A;  3H3A A;  2DVI A;  2ZH3 A;  4FHX A;  5J2G A;  7ICM A;  3ISC A;  9ICF A;  4WC0 A;  1BPD A;  3OV7 A;  5IIN A;  1ZQS A;  3V7J A;  1WOT A;  5J0P A;  5HRE A;  4YMM A;  3UXO A;  4I2D A;  1ZQY A;  4YD2 A;  5D4B A;  8ICZ A;  3HWT A;  4E80 A;  9ICQ A;  4R63 A;  2FMQ A;  8ICH A;  4X0A A;  2ZH2 A;  5J0X A;  3JPR A;  3AU2 A;  3AU6 A;  8ICV A;  2PFP A;  3JPN A;  7ICG A;  1V4A A;  4KLU A;  3PNC A;  4RWO A;  4F5O A;  1BPB A;  4EP7 A;  3MGI A;  1ZQB A;  2DRB A;  4RQ6 A;  3HX0 A;  3WFQ E;  9ICN A;  1JN3 A;  1Q79 A;  8ICT A;  4MFA A;  4RQ7 A;  5HRG A;  2PXI A;  7ICF A;  9ICU A;  4AT8 B;  3C66 A;  4RQ2 A;  5J0R A;  5DEC A;  1UEV A;  7ICQ A;  8ICO A;  4NXZ A;  5IIL A;  5DB9 A;  5HRK A;  4M9H A;  3AQL A;  7ICR A;  2BE3 A;  9ICJ A;  5III A;  4YD1 A;  4I28 A;  4RWN A;  5EOZ A;  5DBA A;  1ZQF A;  4ATB B;  3AUO A;  3MDC A;  7ICL A;  4RWQ A;  4QZD A;  3OUY A;  2M2W A;  3MBY A;  3UQ2 A;  4RQ3 A;  8ICN A;  4WC7 A;  5J2A A;  1R8C A;  4TUQ A;  4UAW A;  3UPQ A;  3K75 D;  4NM2 A;  7ICH A;  5HRI A;  4K4H A;  3C2K A;  5CA7 A;  4KLL A;  4FHP A;  2BCR A;  4KLI A;  4X4U A;  4UB3 A;  3GDX A;  2VAN A;  4Z6D A;  1JQR A;  4FH5 A;  4ATB A;  2BCV A;  4I27 A;  1RZT A;  3C5F A;  4I2C A;  5CWR A;  2ZH4 A;  2ISO A;  3AQM A;  4KLO A;  7ICJ A;  4NKT A;  7ICP A;  1KNY A;  4KLJ A;  4NY8 A;  4RQ8 A;  5BOL A;  4TUS A;  3HIY A;  1NOM A;  4I2B A;  4AT8 A;  4EBJ A;  4RPY A;  4RQ4 A;  4PHP A;  4RPX A;  2ZH7 A;  4RQ5 A;  4M9G A;  3HJ1 A;  9ICW A;  4R64 A;  4GXK A;  4MFF A;  9ICR A;  4FHW A;  7ICT A;  4DOA A;  1HUO A;  4WC6 A;  4FH3 A;  5HRF A;  8ICF A;  3RJH A;  9ICT A;  5CP2 A;  1ZQD A;  3JZ0 A;  9ICC A;  5J2E A;  3OGU A;  1MIV A;  4UB5 A;  1VFG A;  1UEU A;  1ZQE A;  9ICS A;  3JPT A;  1ZJM A;  4X5V A;  4RPZ A;  1PX5 A;  8ICJ A;  4QZC A;  4X4O A;  2IHM A;  1ZQH A;  4RQ0 A;  4X4R A;  4MF8 A;  9ICK A;  3UPS A;  3MGH A;  8ICK A;  4UD5 A;  4RT3 A;  4NLZ A;  9ICO A;  2HHP A;  4I2G A;  5DDY A;  3OUY B;  4Z6F A;  2PFO A;  3H38 A;  2ID1 A;  3RJI A;  4F5N A;  1ZQI A;  5HHI A;  4K4G A;  4F5Q A;  1ZQW A;  4LVS A;  4XQ8 A;  5HHH A;  3LQC B;  2M2U A;  2ZH5 A;  1F5A A;  4YCX A;  5DDM A;  1R89 A;  5DB8 A;  4M04 A;  2ISP A;  5D46 A;  1UET A;  3OVA A;  8ICQ A;  4S3N A;  5BPC A;  1XSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...