4WC1A

Structure of trna-processing enzyme with ctp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
382
structure length
364
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 114
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc1A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc1A01
3WFOA 5J0XA 4IQVA 4M0AA 8ICYA 1ZQNA 3HWTA 1JMSA 4NLKA 3OGUA 3TFSA 4F5OA 3AQKA 4NM2A 3JYYA 4WCWA 5J2JA 3AU6A 3C2KA 5J0UA 5D49A 3AQNA 4KLSA 1WOTA 3B0XA 4QZ8A 5HR9A 4I2JA 3UXNA 3OVBA 9ICKA 4MFAA 4K4HA 3RH5A 1KNYA 3OVAA 1R89A 5HRLA 1ZQZA 4RQ2A 3RH4A 4YN4A 4P4MA 5DEDA 4PHPA 1BPEA 7ICUA 3C2MA 2Q66A 1UEUA 2ID1A 5HRDA 5J0YA 4PGXA 1BPDA 4RWOA 5HRFA 3RJIA 2DRAA 4K4GA 8ICWA 4M9GA 4FHYA 3V72A 4LVSA 9ICWA 4I2AA 4JWMA 1OU5A 4WC1A 3PMNA 2ZH1A 5DB6A 2DVIA 1XSLA 5IILA 2ZH4A 4LZDA 4RPZA 8ICPA 9ICMA 2HHPA 1Q78A 9ICUA 4K4IA 2ZHAA 4NXZA 5HHHA 4PPXA 5J2BA 4RQ3A 4X4NA 2PFQA 4NLZA 1ZQXA 1FA0A 2ZH9A 4E8FA 3JPOA 3H37A 8ICZA 7ICPA 1ZQRA 4QZHA 3RJKA 4RT2A 3RJFA 5J0QA 4WBZA 2ZH7A 4PHAA 3JPQA 4O9MA 2I9GA 4RQ0A 4I2GA 2BE3A 5HRIA 4RQ6A 3RJJA 5HRGA 4UAZA 4NY8A 4UB5A 2ZHBA 3MGIA 1ZQOA 4YMMA 4TURA 3NYBA 8ICUA 2DR7A 1PX5A 2GWSA 4JWNA 2ISPA 3OUYB 4AT8B 4I2FA 4UBBA 3UQ2A 3C5FA 3B0YA 4XUSA 4O5CA 3RJEA 5BOMA 4M9JA 5F2VO 3L9DA 3JPPA 1KEJA 3RJGA 4DO9A 1TFWA 9ICJA 3V7LA 4XA5A 9ICOA 4WC6A 3UQ0A 4XQ8A 4KLQA 4IQWA 2ZH3A 4MF8A 2PXIA 1TFYA 5J0PA 4RQ5A 7ICKA 4P2HA 4GXIA 3WFRE 1V4AA 4I2CA 3C66A 1TVAA 2ZH8A 2BPCA 4DOBA 5J0SA 3H38A 4XRHA 4I2DA 1VJ7A 4YCXA 9ICNA 8ICMA 5J2AA 8ICJA 4X4OA 4QZIA 5J0WA 4M2YA 5DB9A 1R8BA 4QZ9A 5BPCA 4DOAA 2BCSA 3WFQE 4I2IA 1ZQJA 5J2EA 4RPXA 4TUPA 5IIKA 5HRHA 4UD4A 3MGHA 4M9LA 5J2FA 4YMOA 5BOLA 1HUZA 8ICKA 3JPRA 4FHVA 2M2VA 2O1PA 4E7XA 4DOCA 7ICVA 1ZQEA 5J29A 3RJHA 4M5DA 4QZCA 2FMSA 7ICRA 5IIOA 4UB3A 1ZQFA 7ICQA 2NRKA 3TFRA 1BPXA 5HREA 5CHGA 5J2DA 3UXOA 1ZQGA 4AT7B 5HHIA 1ZQHA 4I2HA 4KLEA 8ICHA 2FMQA 7ICSA 8ICFA 4FHWA 4X5VA 1ZQBA 2ZH2A 4M04A 7ICHA 2BPFA 2ZH5A 8ICSA 2PFPA 3UXPA 4WC4A 9ICTA 4F5PA 9ICGA 3C5GA 2DR9A 1ZJNA 8ICXA 5HRBA 3OVSA 4P4OA 1HUOA 7ICTA 1TV9A 4YD1A 4LZGA 4WC5A 9ICPA 4GXKA 4Z6CA 2ISOA 3C2LA 4F5NA 1ZQVA 4XQ7A 4WC3A 4E80A 9ICEA 1F5AA 4KLHA 7ICOA 3OUYA 4AT8A 3AU2A 4EP7A 3MDAA 1ZQTA 2M2WA 3V7JA 4QZGA 1ZQWA 4RQ4A 4F5QA 1ZQUA 1NOMA 5J2CA 4KLJA 1MQ2A 9ICVA 8ICEA 3WFSC 4UB4A 1JN3A 4UAYA 4KLLA 4NKUA 4R63A 3LQCB 1MIVA 4X4RA 4EBKA 4X0BA 3HW8A 4ATBB 5CJ7A 3JPTA 4KLIA 5D46A 1ZQCA 4PHEA 4RQ8A 2BCQA 4Z6FA 2FMPA 4AT9B 3ISCA 8ICGA 5DDMA 1XSPA 4IG8A 4FH3A 3MBYA 8ICBA 1NO5A 3HX0A 5J2KA 5DB7A 4M9NA 8ICTA 4WC0A 1BPZA 1ZQYA 9ICFA 4FHPA 5J2HA 1ZQIA 4R66A 4PGYA 5CWRA 7ICFA 9ICLA 5CR0A 3HIYA 2ZH6A 4UD5A 3LK9A 4R65A 4PGQA 1JQRA 2BPGA 2RFFA 4UB1A 4LT6A 4RWPA 4RQ1A 2M2TA 2O5AA 4KLTA 2DRBA 3UPQA 2BCVA 7ICEA 1Q79A 1ZQAA 5J0OA 1R8CA 4KLMA 5HC9A 4Z6DA 3WFPA 5TZVA 4QZFA 4KLUA 3GDXA 4WC7A 1ZQDA 9ICSA 4WC2A 2PFNA 4QZAA 2DR8A 5J2GA 4MFCA 4RQ7A 4FO6A 2BCRA 4M47A 4RWNA 4S3NA 2VANA 4PHDA 3JZ0A 4AT7A 9ICBA 4X4QA 5CB1A 1ZQMA 4I2BA 4UBCA 5J0RA 4WBYA 5EOZA 4KLFA 4X4SA 4O5KA 3ISDA 4EBJA 7ICNA 4RWQA 5DBAA 3ISBA 8ICQA 8ICAA 7ICMA 4QZDA 4X0AA 4KLOA 4R64A 4M9HA 4RPYA 2W9MA 1MIWA 3UPSA 2PFOA 8ICOA 3HJ1A 4FH5A 3PNCA 1ZQSA 1ZQLA 4UB2A 2DR5A 5CP2A 3H39A 5IINA 4FHXA 4I29A 4YD2A 4MFFA 4X4UA 5DBCA 3JPNA 4KLGA 5DECA 5J0TA 8ICVA 8ICNA 1UETA 4I27A 4I2EA 4P4PA 4O5EA 3OV7A 3MDCA 4PH5A 3C18A 3HJ4A 5HRKA 4KLDA 1ZQKA 4X4TA 1XSNA 3AQLA 9ICCA 7ICGA 7ICIA 4NM1A 1ZQQA 4X4VA 4QZBA 8ICIA 4ATBA 4TUSA 4UAWA 5IIJA 1BPYA 4Z6EA 4AT9A 5DKWA 1ZJMA 8ICCA 1YLQA 9ICAA 3JPSA 5DB8A 2P66A 5IIMA 5J2IA 4QZEA 3AQMA 4RT3A 3V7KA 3AUOA 5D4BA 2IHMA 4GXJA 1JAJA 8ICRA 3PMLA 4X4PA 4IQTA 1R8AA 1RZTA 2M2UA 1VFGA 5IIIA 9ICHA 1MQ3A 3K75D 9ICIA 9ICQA 4IQUA 1RPLA 1MIYA 4I28A 1KDHA 4NKTA 5DDYA 4YMNA 4NLNA 7ICJA 4F5RA 1UEVA 2PBEA 8ICLA 5CA7A 3RH6A 5DBBA 2BCUA 4MF2A 4TUQA 9ICRA 9ICXA 7ICLA 3H3AA 1ZQPA 1BPBA
chains in the Genus database with same CATH superfamily
4EV6A 3WFOA 5J0XA 4IQVA 4M0AA 8ICYA 1ZQNA 3HWTA 1JMSA 4NLKA 3OGUA 3TFSA 4F5OA 3AQKA 4NM2A 3JYYA 4NXTA 4WCWA 5J2JA 3AU6A 3C2KA 5J0UA 5D49A 3AQNA 4KLSA 2IUBA 4NXVA 1WOTA 3B0XA 4QZ8A 5HR9A 4I2JA 3UXNA 3OVBA 9ICKA 4MFAA 4K4HA 3RH5A 1KNYA 3OVAA 1R89A 2EWRA 5HRLA 1ZQZA 4RQ2A 3RH4A 4YN4A 3NVOA 4P4MA 5DEDA 4PHPA 1BPEA 7ICUA 4FO1A 3C2MA 2Q66A 1UEUA 4NXXA 2ID1A 5HRDA 5J0YA 4PGXA 1BPDA 4RWOA 5HRFA 3RJIA 2DRAA 2BBJA 4K4GA 8ICWA 4M9GA 4FHYA 3V72A 4LVSA 9ICWA 4I2AA 2BBHA 4JWMA 1OU5A 4WC1A 3PMNA 2ZH1A 5DB6A 3ER8C 2DVIA 1XSLA 5IILA 2ZH4A 4LEWA 4LZDA 4RPZA 8ICPA 9ICMA 2HHPA 1Q78A 9ICUA 4K4IA 2ZHAA 4NXZA 5HHHA 4PPXA 5J2BA 4RQ3A 4X4NA 2PFQA 4NLZA 1ZQXA 1FA0A 2ZH9A 4E8FA 5B3PA 3JPOA 3H37A 8ICZA 7ICPA 1ZQRA 4QZHA 3RJKA 4RT2A 2FCLA 3RJFA 5J0QA 4WQKA 4WBZA 2ZH7A 4PHAA 3K7DA 3JPQA 4O9MA 2I9GA 4RQ0A 4I2GA 2BE3A 5HRIA 4RQ6A 3RJJA 5CHEA 5HRGA 4UAZA 4EEDA 4NY8A 4UB5A 2ZHBA 3MGIA 1ZQOA 4YMMA 4TURA 3NYBA 8ICUA 2DR7A 1PX5A 4K9BA 2GWSA 4JWNA 2ISPA 3OUYB 4AT8B 4I2FA 4UBBA 3UQ2A 3C5FA 3B0YA 3PHZA 4XUSA 4O5CA 3RJEA 5BOMA 4M9JA 5F2VO 3L9DA 3JPPA 1KEJA 3RJGA 4DO9A 3ERCC 1TFWA 9ICJA 3V7LA 4XA5A 9ICOA 4WC6A 4JLXA 3UQ0A 4XQ8A 4O67A 4KLQA 4IQWA 4K96A 2ZH3A 4MF8A 2PXIA 1TFYA 5J0PA 4RQ5A 7ICKA 4P2HA 4GXIA 3WFRE 1V4AA 4I2CA 3C66A 1TVAA 2ZH8A 3OWGA 2BPCA 4DOBA 4OAGA 5J0SA 4KM5A 5B3QA 3H38A 4O6AA 4XRHA 4I2DA 1VJ7A 4YCXA 9ICNA 8ICMA 5J2AA 8ICJA 4X4OA 4QZIA 5D63A 3NKUA 5J0WA 4M2YA 5DB9A 1R8BA 4QZ9A 5BPCA 4DOAA 4LEVA 2BCSA 3WFQE 4I2IA 2GA9D 1ZQJA 5J2EA 4RPXA 4TUPA 5IIKA 5HRHA 4UD4A 3MGHA 4M9LA 5J2FA 4YMOA 5BOLA 3NWIA 1HUZA 4EEBA 8ICKA 3JPRA 4FHVA 2M2VA 2O1PA 4E7XA 4DOCA 7ICVA 1ZQEA 5J29A 3RJHA 4M5DA 4QZCA 5CFSA 2FMSA 7ICRA 5IIOA 4UB3A 1ZQFA 7ICQA 2NRKA 3TFRA 1BPXA 5HREA 5CHGA 5J2DA 2GAFD 3UXOA 4AT7B 1ZQGA 5HHIA 1ZQHA 4I2HA 4KLEA 8ICHA 2FMQA 1GPJA 7ICSA 4KB6A 8ICFA 4FHWA 4X5VA 1ZQBA 2ZH2A 4M04A 7ICHA 2BPFA 2ZH5A 8ICSA 2PFPA 4K99A 3UXPA 4WC4A 4HX0A 9ICTA 4F5PA 9ICGA 3C5GA 2DR9A 1ZJNA 8ICXA 5HRBA 3OVSA 4P4OA 4LEYA 1HUOA 7ICTA 1TV9A 4YD1A 4LZGA 4WC5A 9ICPA 4GXKA 4Z6CA 2ISOA 3C2LA 4F5NA 1ZQVA 4XQ7A 4WC3A 4E80A 9ICEA 1F5AA 4KLHA 7ICOA 3OUYA 4AT8A 3AU2A 4EP7A 3MDAA 1ZQTA 2M2WA 3V7JA 4QZGA 1ZQWA 4RQ4A 4F5QA 1ZQUA 1NOMA 5J2CA 4KLJA 1MQ2A 9ICVA 8ICEA 3WFSC 4UB4A 1JN3A 2HN2A 4UAYA 4KLLA 4NKUA 4R63A 4OAHA 4XJEA 3LQCB 1MIVA 4X4RA 4EBKA 4X0BA 3HW8A 4ATBB 5CJ7A 3JPTA 4KLIA 5D46A 4NXUA 1ZQCA 4PHEA 4RQ8A 2BCQA 4Z6FA 2FMPA 4AT9B 3ISCA 8ICGA 5DDMA 1XSPA 4WH5A 4I0UA 4IG8A 2B51A 5D62A 4FH3A 3MBYA 3EF2A 1NO5A 3CK6A 4JLZA 3HX0A 8ICBA 5J2KA 5DB7A 4M9NA 4K97A 8ICTA 4WC0A 1BPZA 1ZQYA 9ICFA 4FHPA 5J2HA 1ZQIA 4R66A 4PGYA 5CWRA 7ICFA 9ICLA 5CR0A 3HIYA 2ZH6A 4UD5A 3LK9A 4R65A 4PGQA 1JQRA 2BPGA 4O69A 2RFFA 4UB1A 4LT6A 4RWPA 4RQ1A 4OAFA 2M2TA 2O5AA 4KLTA 3ER9B 2DRBA 3UPQA 4N7RA 2BCVA 1Q79A 1ZQAA 7ICEA 5J0OA 1R8CA 4KLMA 5HC9A 4Z6DA 4MKPA 3WFPA 3MCRA 5TZVA 4QZFA 4K98A 4EGWA 4KLUA 4WQLA 3GDXA 4WC7A 1ZQDA 9ICSA 4WC2A 2PFNA 4QZAA 2DR8A 5J2GA 4MFCA 4RQ7A 4FO6A 2BCRA 4M47A 4OAIZ 4RWNA 3JCFA 4S3NA 2VANA 4PHDA 3JZ0A 4AT7A 9ICBA 4X4QA 5CB1A 1ZQMA 4I2BA 4LEZA 4UBCA 5J0RA 4WBYA 5EOZA 4KLFA 4X4SA 4O5KA 3ISDA 4EBJA 7ICNA 4RWQA 5DBAA 3ISBA 8ICQA 5CFUA 7ICMA 8ICAA 4QZDA 4X0AA 4KLOA 4R64A 4M9HA 5D61A 4RPYA 2W9MA 5CFTA 1MIWA 3UPSA 2PFOA 8ICOA 2IHOA 3HJ1A 4FH5A 3PNCA 1ZQSA 1ZQLA 4UB2A 2DR5A 5CP2A 3H39A 4K8VA 5IINA 4FHXA 4I29A 4YD2A 4MFFA 5JTGA 4X4UA 5DBCA 3JPNA 4KLGA 5DECA 5J0TA 8ICVA 8ICNA 1UETA 4I27A 4I2EA 4P4PA 4O5EA 3OV7A 3MDCA 4PH5A 3C18A 3HJ4A 5HRKA 4KLDA 1ZQKA 2B4VA 4X4TA 1XSNA 3AQLA 9ICCA 7ICGA 7ICIA 4NM1A 1ZQQA 2B56A 4X4VA 4QZBA 8ICIA 4ATBA 4TUSA 4UAWA 4NXWA 5IIJA 1BPYA 4Z6EA 4AT9A 5DKWA 1ZJMA 8ICCA 1YLQA 9ICAA 3JPSA 5DB8A 2P66A 5IIMA 5J2IA 2HN1A 4QZEA 3AQMA 4RT3A 3V7KA 3AUOA 4K9AA 5D4BA 2IHMA 4GXJA 1JAJA 8ICRA 3PMLA 4X4PA 4IQTA 1R8AA 1RZTA 2M2UA 1VFGA 5IIIA 9ICHA 1MQ3A 3K75D 9ICIA 9ICQA 4IQUA 1RPLA 1MIYA 4I28A 1KDHA 4NKTA 5DDYA 4WOYA 4YMNA 4NLNA 7ICJA 4F5RA 1UEVA 2PBEA 8ICLA 5CA7A 3RH6A 5DBBA 4O68A 2BCUA 4MF2A 4TUQA 9ICRA 9ICXA 7ICLA 3H3AA 1ZQPA 1BPBA
chains in the Genus database with same CATH topology
3WFOA 5J0XA 4IQVA 4M0AA 8ICYA 1ZQNA 3HWTA 1JMSA 4NLKA 3OGUA 3TFSA 4F5OA 3AQKA 4NM2A 3JYYA 4WCWA 5J2JA 3AU6A 3C2KA 5J0UA 5D49A 3AQNA 4KLSA 1WOTA 3B0XA 4QZ8A 5HR9A 4I2JA 3UXNA 3OVBA 9ICKA 4MFAA 4K4HA 3RH5A 1KNYA 3OVAA 1R89A 5HRLA 1ZQZA 4RQ2A 3RH4A 4YN4A 4P4MA 5DEDA 4PHPA 1BPEA 7ICUA 3C2MA 2Q66A 1UEUA 2ID1A 5HRDA 5J0YA 4PGXA 1BPDA 4RWOA 5HRFA 3RJIA 2DRAA 4K4GA 8ICWA 4M9GA 4FHYA 3V72A 4LVSA 9ICWA 4I2AA 4JWMA 1OU5A 4WC1A 3PMNA 2ZH1A 5DB6A 2DVIA 1XSLA 5IILA 2ZH4A 4LZDA 4RPZA 8ICPA 9ICMA 2HHPA 1Q78A 9ICUA 4K4IA 2ZHAA 4NXZA 5HHHA 4PPXA 5J2BA 4RQ3A 4X4NA 2PFQA 4NLZA 1ZQXA 1FA0A 2ZH9A 4E8FA 3JPOA 3H37A 8ICZA 7ICPA 1ZQRA 4QZHA 3RJKA 4RT2A 3RJFA 5J0QA 4WBZA 2ZH7A 4PHAA 3JPQA 4O9MA 2I9GA 4RQ0A 4I2GA 2BE3A 5HRIA 4RQ6A 3RJJA 5HRGA 4UAZA 4NY8A 4UB5A 2ZHBA 3MGIA 1ZQOA 4YMMA 4TURA 3NYBA 8ICUA 2DR7A 1PX5A 2GWSA 4JWNA 2ISPA 3OUYB 4AT8B 4I2FA 4UBBA 3UQ2A 3C5FA 3B0YA 4XUSA 4O5CA 3RJEA 5BOMA 4M9JA 5F2VO 3L9DA 3JPPA 1KEJA 3RJGA 4DO9A 1TFWA 9ICJA 3V7LA 4XA5A 9ICOA 4WC6A 3UQ0A 4XQ8A 4KLQA 4IQWA 2ZH3A 4MF8A 2PXIA 1TFYA 5J0PA 4RQ5A 7ICKA 4P2HA 4GXIA 3WFRE 1V4AA 4I2CA 3C66A 1TVAA 2ZH8A 2BPCA 4DOBA 5J0SA 3H38A 4XRHA 4I2DA 1VJ7A 4YCXA 9ICNA 8ICMA 5J2AA 8ICJA 4X4OA 4QZIA 5J0WA 4M2YA 5DB9A 1R8BA 4QZ9A 5BPCA 4DOAA 2BCSA 3WFQE 4I2IA 1ZQJA 5J2EA 4RPXA 4TUPA 5IIKA 5HRHA 4UD4A 3MGHA 4M9LA 5J2FA 4YMOA 5BOLA 1HUZA 8ICKA 3JPRA 4FHVA 2M2VA 2O1PA 4E7XA 4DOCA 7ICVA 1ZQEA 5J29A 3RJHA 4M5DA 4QZCA 2FMSA 7ICRA 5IIOA 4UB3A 1ZQFA 7ICQA 2NRKA 3TFRA 1BPXA 5HREA 5CHGA 5J2DA 3UXOA 1ZQGA 4AT7B 5HHIA 1ZQHA 4I2HA 4KLEA 8ICHA 2FMQA 7ICSA 8ICFA 4FHWA 4X5VA 1ZQBA 2ZH2A 4M04A 7ICHA 2BPFA 2ZH5A 8ICSA 2PFPA 3UXPA 4WC4A 9ICTA 4F5PA 9ICGA 3C5GA 2DR9A 1ZJNA 8ICXA 5HRBA 3OVSA 4P4OA 1HUOA 7ICTA 1TV9A 4YD1A 4LZGA 4WC5A 9ICPA 4GXKA 4Z6CA 2ISOA 3C2LA 4F5NA 1ZQVA 4XQ7A 4WC3A 4E80A 9ICEA 1F5AA 4KLHA 7ICOA 3OUYA 4AT8A 3AU2A 4EP7A 3MDAA 1ZQTA 2M2WA 3V7JA 4QZGA 1ZQWA 4RQ4A 4F5QA 1ZQUA 1NOMA 5J2CA 4KLJA 1MQ2A 9ICVA 8ICEA 3WFSC 4UB4A 1JN3A 4UAYA 4KLLA 4NKUA 4R63A 3LQCB 1MIVA 4X4RA 4EBKA 4X0BA 3HW8A 4ATBB 5CJ7A 3JPTA 4KLIA 5D46A 1ZQCA 4PHEA 4RQ8A 2BCQA 4Z6FA 2FMPA 4AT9B 3ISCA 8ICGA 5DDMA 1XSPA 4IG8A 4FH3A 3MBYA 8ICBA 1NO5A 3HX0A 5J2KA 5DB7A 4M9NA 8ICTA 4WC0A 1BPZA 1ZQYA 9ICFA 4FHPA 5J2HA 1ZQIA 4R66A 4PGYA 5CWRA 7ICFA 9ICLA 5CR0A 3HIYA 2ZH6A 4UD5A 3LK9A 4R65A 4PGQA 1JQRA 2BPGA 2RFFA 4UB1A 4LT6A 4RWPA 4RQ1A 2M2TA 2O5AA 4KLTA 2DRBA 3UPQA 2BCVA 7ICEA 1Q79A 1ZQAA 5J0OA 1R8CA 4KLMA 5HC9A 4Z6DA 3WFPA 5TZVA 4QZFA 4KLUA 3GDXA 4WC7A 1ZQDA 9ICSA 4WC2A 2PFNA 4QZAA 2DR8A 5J2GA 4MFCA 4RQ7A 4FO6A 2BCRA 4M47A 4RWNA 4S3NA 2VANA 4PHDA 3JZ0A 4AT7A 9ICBA 4X4QA 5CB1A 1ZQMA 4I2BA 4UBCA 5J0RA 4WBYA 5EOZA 4KLFA 4X4SA 4O5KA 3ISDA 4EBJA 7ICNA 4RWQA 5DBAA 3ISBA 8ICQA 8ICAA 7ICMA 4QZDA 4X0AA 4KLOA 4R64A 4M9HA 4RPYA 2W9MA 1MIWA 3UPSA 2PFOA 8ICOA 3HJ1A 4FH5A 3PNCA 1ZQSA 1ZQLA 4UB2A 2DR5A 5CP2A 3H39A 5IINA 4FHXA 4I29A 4YD2A 4MFFA 4X4UA 5DBCA 3JPNA 4KLGA 5DECA 5J0TA 8ICVA 8ICNA 1UETA 4I27A 4I2EA 4P4PA 4O5EA 3OV7A 3MDCA 4PH5A 3C18A 3HJ4A 5HRKA 4KLDA 1ZQKA 4X4TA 1XSNA 3AQLA 9ICCA 7ICGA 7ICIA 4NM1A 1ZQQA 4X4VA 4QZBA 8ICIA 4ATBA 4TUSA 4UAWA 5IIJA 1BPYA 4Z6EA 4AT9A 5DKWA 1ZJMA 8ICCA 1YLQA 9ICAA 3JPSA 5DB8A 2P66A 5IIMA 5J2IA 4QZEA 3AQMA 4RT3A 3V7KA 3AUOA 5D4BA 2IHMA 4GXJA 1JAJA 8ICRA 3PMLA 4X4PA 4IQTA 1R8AA 1RZTA 2M2UA 1VFGA 5IIIA 9ICHA 1MQ3A 3K75D 9ICIA 9ICQA 4IQUA 1RPLA 1MIYA 4I28A 1KDHA 4NKTA 5DDYA 4YMNA 4NLNA 7ICJA 4F5RA 1UEVA 2PBEA 8ICLA 5CA7A 3RH6A 5DBBA 2BCUA 4MF2A 4TUQA 9ICRA 9ICXA 7ICLA 3H3AA 1ZQPA 1BPBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WFO A;  5J0X A;  4IQV A;  4M0A A;  8ICY A;  1ZQN A;  3HWT A;  1JMS A;  4NLK A;  3OGU A;  3TFS A;  4F5O A;  3AQK A;  4NM2 A;  3JYY A;  4WCW A;  5J2J A;  3AU6 A;  3C2K A;  5J0U A;  5D49 A;  3AQN A;  4KLS A;  1WOT A;  3B0X A;  4QZ8 A;  5HR9 A;  4I2J A;  3UXN A;  3OVB A;  9ICK A;  4MFA A;  4K4H A;  3RH5 A;  1KNY A;  3OVA A;  1R89 A;  5HRL A;  1ZQZ A;  4RQ2 A;  3RH4 A;  4YN4 A;  4P4M A;  5DED A;  4PHP A;  1BPE A;  7ICU A;  3C2M A;  2Q66 A;  1UEU A;  2ID1 A;  5HRD A;  5J0Y A;  4PGX A;  1BPD A;  4RWO A;  5HRF A;  3RJI A;  2DRA A;  4K4G A;  8ICW A;  4M9G A;  4FHY A;  3V72 A;  4LVS A;  9ICW A;  4I2A A;  4JWM A;  1OU5 A;  4WC1 A;  3PMN A;  2ZH1 A;  5DB6 A;  2DVI A;  1XSL A;  5IIL A;  2ZH4 A;  4LZD A;  4RPZ A;  8ICP A;  9ICM A;  2HHP A;  1Q78 A;  9ICU A;  4K4I A;  2ZHA A;  4NXZ A;  5HHH A;  4PPX A;  5J2B A;  4RQ3 A;  4X4N A;  2PFQ A;  4NLZ A;  1ZQX A;  1FA0 A;  2ZH9 A;  4E8F A;  3JPO A;  3H37 A;  8ICZ A;  7ICP A;  1ZQR A;  4QZH A;  3RJK A;  4RT2 A;  3RJF A;  5J0Q A;  4WBZ A;  2ZH7 A;  4PHA A;  3JPQ A;  4O9M A;  2I9G A;  4RQ0 A;  4I2G A;  2BE3 A;  5HRI A;  4RQ6 A;  3RJJ A;  5HRG A;  4UAZ A;  4NY8 A;  4UB5 A;  2ZHB A;  3MGI A;  1ZQO A;  4YMM A;  4TUR A;  3NYB A;  8ICU A;  2DR7 A;  1PX5 A;  2GWS A;  4JWN A;  2ISP A;  3OUY B;  4AT8 B;  4I2F A;  4UBB A;  3UQ2 A;  3C5F A;  3B0Y A;  4XUS A;  4O5C A;  3RJE A;  5BOM A;  4M9J A;  5F2V O;  3L9D A;  3JPP A;  1KEJ A;  3RJG A;  4DO9 A;  1TFW A;  9ICJ A;  3V7L A;  4XA5 A;  9ICO A;  4WC6 A;  3UQ0 A;  4XQ8 A;  4KLQ A;  4IQW A;  2ZH3 A;  4MF8 A;  2PXI A;  1TFY A;  5J0P A;  4RQ5 A;  7ICK A;  4P2H A;  4GXI A;  3WFR E;  1V4A A;  4I2C A;  3C66 A;  1TVA A;  2ZH8 A;  2BPC A;  4DOB A;  5J0S A;  3H38 A;  4XRH A;  4I2D A;  1VJ7 A;  4YCX A;  9ICN A;  8ICM A;  5J2A A;  8ICJ A;  4X4O A;  4QZI A;  5J0W A;  4M2Y A;  5DB9 A;  1R8B A;  4QZ9 A;  5BPC A;  4DOA A;  2BCS A;  3WFQ E;  4I2I A;  1ZQJ A;  5J2E A;  4RPX A;  4TUP A;  5IIK A;  5HRH A;  4UD4 A;  3MGH A;  4M9L A;  5J2F A;  4YMO A;  5BOL A;  1HUZ A;  8ICK A;  3JPR A;  4FHV A;  2M2V A;  2O1P A;  4E7X A;  4DOC A;  7ICV A;  1ZQE A;  5J29 A;  3RJH A;  4M5D A;  4QZC A;  2FMS A;  7ICR A;  5IIO A;  4UB3 A;  1ZQF A;  7ICQ A;  2NRK A;  3TFR A;  1BPX A;  5HRE A;  5CHG A;  5J2D A;  3UXO A;  1ZQG A;  4AT7 B;  5HHI A;  1ZQH A;  4I2H A;  4KLE A;  8ICH A;  2FMQ A;  7ICS A;  8ICF A;  4FHW A;  4X5V A;  1ZQB A;  2ZH2 A;  4M04 A;  7ICH A;  2BPF A;  2ZH5 A;  8ICS A;  2PFP A;  3UXP A;  4WC4 A;  9ICT A;  4F5P A;  9ICG A;  3C5G A;  2DR9 A;  1ZJN A;  8ICX A;  5HRB A;  3OVS A;  4P4O A;  1HUO A;  7ICT A;  1TV9 A;  4YD1 A;  4LZG A;  4WC5 A;  9ICP A;  4GXK A;  4Z6C A;  2ISO A;  3C2L A;  4F5N A;  1ZQV A;  4XQ7 A;  4WC3 A;  4E80 A;  9ICE A;  1F5A A;  4KLH A;  7ICO A;  3OUY A;  4AT8 A;  3AU2 A;  4EP7 A;  3MDA A;  1ZQT A;  2M2W A;  3V7J A;  4QZG A;  1ZQW A;  4RQ4 A;  4F5Q A;  1ZQU A;  1NOM A;  5J2C A;  4KLJ A;  1MQ2 A;  9ICV A;  8ICE A;  3WFS C;  4UB4 A;  1JN3 A;  4UAY A;  4KLL A;  4NKU A;  4R63 A;  3LQC B;  1MIV A;  4X4R A;  4EBK A;  4X0B A;  3HW8 A;  4ATB B;  5CJ7 A;  3JPT A;  4KLI A;  5D46 A;  1ZQC A;  4PHE A;  4RQ8 A;  2BCQ A;  4Z6F A;  2FMP A;  4AT9 B;  3ISC A;  8ICG A;  5DDM A;  1XSP A;  4IG8 A;  4FH3 A;  3MBY A;  8ICB A;  1NO5 A;  3HX0 A;  5J2K A;  5DB7 A;  4M9N A;  8ICT A;  4WC0 A;  1BPZ A;  1ZQY A;  9ICF A;  4FHP A;  5J2H A;  1ZQI A;  4R66 A;  4PGY A;  5CWR A;  7ICF A;  9ICL A;  5CR0 A;  3HIY A;  2ZH6 A;  4UD5 A;  3LK9 A;  4R65 A;  4PGQ A;  1JQR A;  2BPG A;  2RFF A;  4UB1 A;  4LT6 A;  4RWP A;  4RQ1 A;  2M2T A;  2O5A A;  4KLT A;  2DRB A;  3UPQ A;  2BCV A;  7ICE A;  1Q79 A;  1ZQA A;  5J0O A;  1R8C A;  4KLM A;  5HC9 A;  4Z6D A;  3WFP A;  5TZV A;  4QZF A;  4KLU A;  3GDX A;  4WC7 A;  1ZQD A;  9ICS A;  4WC2 A;  2PFN A;  4QZA A;  2DR8 A;  5J2G A;  4MFC A;  4RQ7 A;  4FO6 A;  2BCR A;  4M47 A;  4RWN A;  4S3N A;  2VAN A;  4PHD A;  3JZ0 A;  4AT7 A;  9ICB A;  4X4Q A;  5CB1 A;  1ZQM A;  4I2B A;  4UBC A;  5J0R A;  4WBY A;  5EOZ A;  4KLF A;  4X4S A;  4O5K A;  3ISD A;  4EBJ A;  7ICN A;  4RWQ A;  5DBA A;  3ISB A;  8ICQ A;  8ICA A;  7ICM A;  4QZD A;  4X0A A;  4KLO A;  4R64 A;  4M9H A;  4RPY A;  2W9M A;  1MIW A;  3UPS A;  2PFO A;  8ICO A;  3HJ1 A;  4FH5 A;  3PNC A;  1ZQS A;  1ZQL A;  4UB2 A;  2DR5 A;  5CP2 A;  3H39 A;  5IIN A;  4FHX A;  4I29 A;  4YD2 A;  4MFF A;  4X4U A;  5DBC A;  3JPN A;  4KLG A;  5DEC A;  5J0T A;  8ICV A;  8ICN A;  1UET A;  4I27 A;  4I2E A;  4P4P A;  4O5E A;  3OV7 A;  3MDC A;  4PH5 A;  3C18 A;  3HJ4 A;  5HRK A;  4KLD A;  1ZQK A;  4X4T A;  1XSN A;  3AQL A;  9ICC A;  7ICG A;  7ICI A;  4NM1 A;  1ZQQ A;  4X4V A;  4QZB A;  8ICI A;  4ATB A;  4TUS A;  4UAW A;  5IIJ A;  1BPY A;  4Z6E A;  4AT9 A;  5DKW A;  1ZJM A;  8ICC A;  1YLQ A;  9ICA A;  3JPS A;  5DB8 A;  2P66 A;  5IIM A;  5J2I A;  4QZE A;  3AQM A;  4RT3 A;  3V7K A;  3AUO A;  5D4B A;  2IHM A;  4GXJ A;  1JAJ A;  8ICR A;  3PML A;  4X4P A;  4IQT A;  1R8A A;  1RZT A;  2M2U A;  1VFG A;  5III A;  9ICH A;  1MQ3 A;  3K75 D;  9ICI A;  9ICQ A;  4IQU A;  1RPL A;  1MIY A;  4I28 A;  1KDH A;  4NKT A;  5DDY A;  4YMN A;  4NLN A;  7ICJ A;  4F5R A;  1UEV A;  2PBE A;  8ICL A;  5CA7 A;  3RH6 A;  5DBB A;  2BCU A;  4MF2 A;  4TUQ A;  9ICR A;  9ICX A;  7ICL A;  3H3A A;  1ZQP A;  1BPB A; 
#chains in the Genus database with same CATH topology
 4EV6 A;  3WFO A;  5J0X A;  4IQV A;  4M0A A;  8ICY A;  1ZQN A;  3HWT A;  1JMS A;  4NLK A;  3OGU A;  3TFS A;  4F5O A;  3AQK A;  4NM2 A;  3JYY A;  4NXT A;  4WCW A;  5J2J A;  3AU6 A;  3C2K A;  5J0U A;  5D49 A;  3AQN A;  4KLS A;  2IUB A;  4NXV A;  1WOT A;  3B0X A;  4QZ8 A;  5HR9 A;  4I2J A;  3UXN A;  3OVB A;  9ICK A;  4MFA A;  4K4H A;  3RH5 A;  1KNY A;  3OVA A;  1R89 A;  2EWR A;  5HRL A;  1ZQZ A;  4RQ2 A;  3RH4 A;  4YN4 A;  3NVO A;  4P4M A;  5DED A;  4PHP A;  1BPE A;  7ICU A;  4FO1 A;  3C2M A;  2Q66 A;  1UEU A;  4NXX A;  2ID1 A;  5HRD A;  5J0Y A;  4PGX A;  1BPD A;  4RWO A;  5HRF A;  3RJI A;  2DRA A;  2BBJ A;  4K4G A;  8ICW A;  4M9G A;  4FHY A;  3V72 A;  4LVS A;  9ICW A;  4I2A A;  2BBH A;  4JWM A;  1OU5 A;  4WC1 A;  3PMN A;  2ZH1 A;  5DB6 A;  3ER8 C;  2DVI A;  1XSL A;  5IIL A;  2ZH4 A;  4LEW A;  4LZD A;  4RPZ A;  8ICP A;  9ICM A;  2HHP A;  1Q78 A;  9ICU A;  4K4I A;  2ZHA A;  4NXZ A;  5HHH A;  4PPX A;  5J2B A;  4RQ3 A;  4X4N A;  2PFQ A;  4NLZ A;  1ZQX A;  1FA0 A;  2ZH9 A;  4E8F A;  5B3P A;  3JPO A;  3H37 A;  8ICZ A;  7ICP A;  1ZQR A;  4QZH A;  3RJK A;  4RT2 A;  2FCL A;  3RJF A;  5J0Q A;  4WQK A;  4WBZ A;  2ZH7 A;  4PHA A;  3K7D A;  3JPQ A;  4O9M A;  2I9G A;  4RQ0 A;  4I2G A;  2BE3 A;  5HRI A;  4RQ6 A;  3RJJ A;  5CHE A;  5HRG A;  4UAZ A;  4EED A;  4NY8 A;  4UB5 A;  2ZHB A;  3MGI A;  1ZQO A;  4YMM A;  4TUR A;  3NYB A;  8ICU A;  2DR7 A;  1PX5 A;  4K9B A;  2GWS A;  4JWN A;  2ISP A;  3OUY B;  4AT8 B;  4I2F A;  4UBB A;  3UQ2 A;  3C5F A;  3B0Y A;  3PHZ A;  4XUS A;  4O5C A;  3RJE A;  5BOM A;  4M9J A;  5F2V O;  3L9D A;  3JPP A;  1KEJ A;  3RJG A;  4DO9 A;  3ERC C;  1TFW A;  9ICJ A;  3V7L A;  4XA5 A;  9ICO A;  4WC6 A;  4JLX A;  3UQ0 A;  4XQ8 A;  4O67 A;  4KLQ A;  4IQW A;  4K96 A;  2ZH3 A;  4MF8 A;  2PXI A;  1TFY A;  5J0P A;  4RQ5 A;  7ICK A;  4P2H A;  4GXI A;  3WFR E;  1V4A A;  4I2C A;  3C66 A;  1TVA A;  2ZH8 A;  3OWG A;  2BPC A;  4DOB A;  4OAG A;  5J0S A;  4KM5 A;  5B3Q A;  3H38 A;  4O6A A;  4XRH A;  4I2D A;  1VJ7 A;  4YCX A;  9ICN A;  8ICM A;  5J2A A;  8ICJ A;  4X4O A;  4QZI A;  5D63 A;  3NKU A;  5J0W A;  4M2Y A;  5DB9 A;  1R8B A;  4QZ9 A;  5BPC A;  4DOA A;  4LEV A;  2BCS A;  3WFQ E;  4I2I A;  2GA9 D;  1ZQJ A;  5J2E A;  4RPX A;  4TUP A;  5IIK A;  5HRH A;  4UD4 A;  3MGH A;  4M9L A;  5J2F A;  4YMO A;  5BOL A;  3NWI A;  1HUZ A;  4EEB A;  8ICK A;  3JPR A;  4FHV A;  2M2V A;  2O1P A;  4E7X A;  4DOC A;  7ICV A;  1ZQE A;  5J29 A;  3RJH A;  4M5D A;  4QZC A;  5CFS A;  2FMS A;  7ICR A;  5IIO A;  4UB3 A;  1ZQF A;  7ICQ A;  2NRK A;  3TFR A;  1BPX A;  5HRE A;  5CHG A;  5J2D A;  2GAF D;  3UXO A;  4AT7 B;  1ZQG A;  5HHI A;  1ZQH A;  4I2H A;  4KLE A;  8ICH A;  2FMQ A;  1GPJ A;  7ICS A;  4KB6 A;  8ICF A;  4FHW A;  4X5V A;  1ZQB A;  2ZH2 A;  4M04 A;  7ICH A;  2BPF A;  2ZH5 A;  8ICS A;  2PFP A;  4K99 A;  3UXP A;  4WC4 A;  4HX0 A;  9ICT A;  4F5P A;  9ICG A;  3C5G A;  2DR9 A;  1ZJN A;  8ICX A;  5HRB A;  3OVS A;  4P4O A;  4LEY A;  1HUO A;  7ICT A;  1TV9 A;  4YD1 A;  4LZG A;  4WC5 A;  9ICP A;  4GXK A;  4Z6C A;  2ISO A;  3C2L A;  4F5N A;  1ZQV A;  4XQ7 A;  4WC3 A;  4E80 A;  9ICE A;  1F5A A;  4KLH A;  7ICO A;  3OUY A;  4AT8 A;  3AU2 A;  4EP7 A;  3MDA A;  1ZQT A;  2M2W A;  3V7J A;  4QZG A;  1ZQW A;  4RQ4 A;  4F5Q A;  1ZQU A;  1NOM A;  5J2C A;  4KLJ A;  1MQ2 A;  9ICV A;  8ICE A;  3WFS C;  4UB4 A;  1JN3 A;  2HN2 A;  4UAY A;  4KLL A;  4NKU A;  4R63 A;  4OAH A;  4XJE A;  3LQC B;  1MIV A;  4X4R A;  4EBK A;  4X0B A;  3HW8 A;  4ATB B;  5CJ7 A;  3JPT A;  4KLI A;  5D46 A;  4NXU A;  1ZQC A;  4PHE A;  4RQ8 A;  2BCQ A;  4Z6F A;  2FMP A;  4AT9 B;  3ISC A;  8ICG A;  5DDM A;  1XSP A;  4WH5 A;  4I0U A;  4IG8 A;  2B51 A;  5D62 A;  4FH3 A;  3MBY A;  3EF2 A;  1NO5 A;  3CK6 A;  4JLZ A;  3HX0 A;  8ICB A;  5J2K A;  5DB7 A;  4M9N A;  4K97 A;  8ICT A;  4WC0 A;  1BPZ A;  1ZQY A;  9ICF A;  4FHP A;  5J2H A;  1ZQI A;  4R66 A;  4PGY A;  5CWR A;  7ICF A;  9ICL A;  5CR0 A;  3HIY A;  2ZH6 A;  4UD5 A;  3LK9 A;  4R65 A;  4PGQ A;  1JQR A;  2BPG A;  4O69 A;  2RFF A;  4UB1 A;  4LT6 A;  4RWP A;  4RQ1 A;  4OAF A;  2M2T A;  2O5A A;  4KLT A;  3ER9 B;  2DRB A;  3UPQ A;  4N7R A;  2BCV A;  1Q79 A;  1ZQA A;  7ICE A;  5J0O A;  1R8C A;  4KLM A;  5HC9 A;  4Z6D A;  4MKP A;  3WFP A;  3MCR A;  5TZV A;  4QZF A;  4K98 A;  4EGW A;  4KLU A;  4WQL A;  3GDX A;  4WC7 A;  1ZQD A;  9ICS A;  4WC2 A;  2PFN A;  4QZA A;  2DR8 A;  5J2G A;  4MFC A;  4RQ7 A;  4FO6 A;  2BCR A;  4M47 A;  4OAI Z;  4RWN A;  3JCF A;  4S3N A;  2VAN A;  4PHD A;  3JZ0 A;  4AT7 A;  9ICB A;  4X4Q A;  5CB1 A;  1ZQM A;  4I2B A;  4LEZ A;  4UBC A;  5J0R A;  4WBY A;  5EOZ A;  4KLF A;  4X4S A;  4O5K A;  3ISD A;  4EBJ A;  7ICN A;  4RWQ A;  5DBA A;  3ISB A;  8ICQ A;  5CFU A;  7ICM A;  8ICA A;  4QZD A;  4X0A A;  4KLO A;  4R64 A;  4M9H A;  5D61 A;  4RPY A;  2W9M A;  5CFT A;  1MIW A;  3UPS A;  2PFO A;  8ICO A;  2IHO A;  3HJ1 A;  4FH5 A;  3PNC A;  1ZQS A;  1ZQL A;  4UB2 A;  2DR5 A;  5CP2 A;  3H39 A;  4K8V A;  5IIN A;  4FHX A;  4I29 A;  4YD2 A;  4MFF A;  5JTG A;  4X4U A;  5DBC A;  3JPN A;  4KLG A;  5DEC A;  5J0T A;  8ICV A;  8ICN A;  1UET A;  4I27 A;  4I2E A;  4P4P A;  4O5E A;  3OV7 A;  3MDC A;  4PH5 A;  3C18 A;  3HJ4 A;  5HRK A;  4KLD A;  1ZQK A;  2B4V A;  4X4T A;  1XSN A;  3AQL A;  9ICC A;  7ICG A;  7ICI A;  4NM1 A;  1ZQQ A;  2B56 A;  4X4V A;  4QZB A;  8ICI A;  4ATB A;  4TUS A;  4UAW A;  4NXW A;  5IIJ A;  1BPY A;  4Z6E A;  4AT9 A;  5DKW A;  1ZJM A;  8ICC A;  1YLQ A;  9ICA A;  3JPS A;  5DB8 A;  2P66 A;  5IIM A;  5J2I A;  2HN1 A;  4QZE A;  3AQM A;  4RT3 A;  3V7K A;  3AUO A;  4K9A A;  5D4B A;  2IHM A;  4GXJ A;  1JAJ A;  8ICR A;  3PML A;  4X4P A;  4IQT A;  1R8A A;  1RZT A;  2M2U A;  1VFG A;  5III A;  9ICH A;  1MQ3 A;  3K75 D;  9ICI A;  9ICQ A;  4IQU A;  1RPL A;  1MIY A;  4I28 A;  1KDH A;  4NKT A;  5DDY A;  4WOY A;  4YMN A;  4NLN A;  7ICJ A;  4F5R A;  1UEV A;  2PBE A;  8ICL A;  5CA7 A;  3RH6 A;  5DBB A;  4O68 A;  2BCU A;  4MF2 A;  4TUQ A;  9ICR A;  9ICX A;  7ICL A;  3H3A A;  1ZQP A;  1BPB A; 
#chains in the Genus database with same CATH homology
 3WFO A;  5J0X A;  4IQV A;  4M0A A;  8ICY A;  1ZQN A;  3HWT A;  1JMS A;  4NLK A;  3OGU A;  3TFS A;  4F5O A;  3AQK A;  4NM2 A;  3JYY A;  4WCW A;  5J2J A;  3AU6 A;  3C2K A;  5J0U A;  5D49 A;  3AQN A;  4KLS A;  1WOT A;  3B0X A;  4QZ8 A;  5HR9 A;  4I2J A;  3UXN A;  3OVB A;  9ICK A;  4MFA A;  4K4H A;  3RH5 A;  1KNY A;  3OVA A;  1R89 A;  5HRL A;  1ZQZ A;  4RQ2 A;  3RH4 A;  4YN4 A;  4P4M A;  5DED A;  4PHP A;  1BPE A;  7ICU A;  3C2M A;  2Q66 A;  1UEU A;  2ID1 A;  5HRD A;  5J0Y A;  4PGX A;  1BPD A;  4RWO A;  5HRF A;  3RJI A;  2DRA A;  4K4G A;  8ICW A;  4M9G A;  4FHY A;  3V72 A;  4LVS A;  9ICW A;  4I2A A;  4JWM A;  1OU5 A;  4WC1 A;  3PMN A;  2ZH1 A;  5DB6 A;  2DVI A;  1XSL A;  5IIL A;  2ZH4 A;  4LZD A;  4RPZ A;  8ICP A;  9ICM A;  2HHP A;  1Q78 A;  9ICU A;  4K4I A;  2ZHA A;  4NXZ A;  5HHH A;  4PPX A;  5J2B A;  4RQ3 A;  4X4N A;  2PFQ A;  4NLZ A;  1ZQX A;  1FA0 A;  2ZH9 A;  4E8F A;  3JPO A;  3H37 A;  8ICZ A;  7ICP A;  1ZQR A;  4QZH A;  3RJK A;  4RT2 A;  3RJF A;  5J0Q A;  4WBZ A;  2ZH7 A;  4PHA A;  3JPQ A;  4O9M A;  2I9G A;  4RQ0 A;  4I2G A;  2BE3 A;  5HRI A;  4RQ6 A;  3RJJ A;  5HRG A;  4UAZ A;  4NY8 A;  4UB5 A;  2ZHB A;  3MGI A;  1ZQO A;  4YMM A;  4TUR A;  3NYB A;  8ICU A;  2DR7 A;  1PX5 A;  2GWS A;  4JWN A;  2ISP A;  3OUY B;  4AT8 B;  4I2F A;  4UBB A;  3UQ2 A;  3C5F A;  3B0Y A;  4XUS A;  4O5C A;  3RJE A;  5BOM A;  4M9J A;  5F2V O;  3L9D A;  3JPP A;  1KEJ A;  3RJG A;  4DO9 A;  1TFW A;  9ICJ A;  3V7L A;  4XA5 A;  9ICO A;  4WC6 A;  3UQ0 A;  4XQ8 A;  4KLQ A;  4IQW A;  2ZH3 A;  4MF8 A;  2PXI A;  1TFY A;  5J0P A;  4RQ5 A;  7ICK A;  4P2H A;  4GXI A;  3WFR E;  1V4A A;  4I2C A;  3C66 A;  1TVA A;  2ZH8 A;  2BPC A;  4DOB A;  5J0S A;  3H38 A;  4XRH A;  4I2D A;  1VJ7 A;  4YCX A;  9ICN A;  8ICM A;  5J2A A;  8ICJ A;  4X4O A;  4QZI A;  5J0W A;  4M2Y A;  5DB9 A;  1R8B A;  4QZ9 A;  5BPC A;  4DOA A;  2BCS A;  3WFQ E;  4I2I A;  1ZQJ A;  5J2E A;  4RPX A;  4TUP A;  5IIK A;  5HRH A;  4UD4 A;  3MGH A;  4M9L A;  5J2F A;  4YMO A;  5BOL A;  1HUZ A;  8ICK A;  3JPR A;  4FHV A;  2M2V A;  2O1P A;  4E7X A;  4DOC A;  7ICV A;  1ZQE A;  5J29 A;  3RJH A;  4M5D A;  4QZC A;  2FMS A;  7ICR A;  5IIO A;  4UB3 A;  1ZQF A;  7ICQ A;  2NRK A;  3TFR A;  1BPX A;  5HRE A;  5CHG A;  5J2D A;  3UXO A;  1ZQG A;  4AT7 B;  5HHI A;  1ZQH A;  4I2H A;  4KLE A;  8ICH A;  2FMQ A;  7ICS A;  8ICF A;  4FHW A;  4X5V A;  1ZQB A;  2ZH2 A;  4M04 A;  7ICH A;  2BPF A;  2ZH5 A;  8ICS A;  2PFP A;  3UXP A;  4WC4 A;  9ICT A;  4F5P A;  9ICG A;  3C5G A;  2DR9 A;  1ZJN A;  8ICX A;  5HRB A;  3OVS A;  4P4O A;  1HUO A;  7ICT A;  1TV9 A;  4YD1 A;  4LZG A;  4WC5 A;  9ICP A;  4GXK A;  4Z6C A;  2ISO A;  3C2L A;  4F5N A;  1ZQV A;  4XQ7 A;  4WC3 A;  4E80 A;  9ICE A;  1F5A A;  4KLH A;  7ICO A;  3OUY A;  4AT8 A;  3AU2 A;  4EP7 A;  3MDA A;  1ZQT A;  2M2W A;  3V7J A;  4QZG A;  1ZQW A;  4RQ4 A;  4F5Q A;  1ZQU A;  1NOM A;  5J2C A;  4KLJ A;  1MQ2 A;  9ICV A;  8ICE A;  3WFS C;  4UB4 A;  1JN3 A;  4UAY A;  4KLL A;  4NKU A;  4R63 A;  3LQC B;  1MIV A;  4X4R A;  4EBK A;  4X0B A;  3HW8 A;  4ATB B;  5CJ7 A;  3JPT A;  4KLI A;  5D46 A;  1ZQC A;  4PHE A;  4RQ8 A;  2BCQ A;  4Z6F A;  2FMP A;  4AT9 B;  3ISC A;  8ICG A;  5DDM A;  1XSP A;  4IG8 A;  4FH3 A;  3MBY A;  8ICB A;  1NO5 A;  3HX0 A;  5J2K A;  5DB7 A;  4M9N A;  8ICT A;  4WC0 A;  1BPZ A;  1ZQY A;  9ICF A;  4FHP A;  5J2H A;  1ZQI A;  4R66 A;  4PGY A;  5CWR A;  7ICF A;  9ICL A;  5CR0 A;  3HIY A;  2ZH6 A;  4UD5 A;  3LK9 A;  4R65 A;  4PGQ A;  1JQR A;  2BPG A;  2RFF A;  4UB1 A;  4LT6 A;  4RWP A;  4RQ1 A;  2M2T A;  2O5A A;  4KLT A;  2DRB A;  3UPQ A;  2BCV A;  7ICE A;  1Q79 A;  1ZQA A;  5J0O A;  1R8C A;  4KLM A;  5HC9 A;  4Z6D A;  3WFP A;  5TZV A;  4QZF A;  4KLU A;  3GDX A;  4WC7 A;  1ZQD A;  9ICS A;  4WC2 A;  2PFN A;  4QZA A;  2DR8 A;  5J2G A;  4MFC A;  4RQ7 A;  4FO6 A;  2BCR A;  4M47 A;  4RWN A;  4S3N A;  2VAN A;  4PHD A;  3JZ0 A;  4AT7 A;  9ICB A;  4X4Q A;  5CB1 A;  1ZQM A;  4I2B A;  4UBC A;  5J0R A;  4WBY A;  5EOZ A;  4KLF A;  4X4S A;  4O5K A;  3ISD A;  4EBJ A;  7ICN A;  4RWQ A;  5DBA A;  3ISB A;  8ICQ A;  8ICA A;  7ICM A;  4QZD A;  4X0A A;  4KLO A;  4R64 A;  4M9H A;  4RPY A;  2W9M A;  1MIW A;  3UPS A;  2PFO A;  8ICO A;  3HJ1 A;  4FH5 A;  3PNC A;  1ZQS A;  1ZQL A;  4UB2 A;  2DR5 A;  5CP2 A;  3H39 A;  5IIN A;  4FHX A;  4I29 A;  4YD2 A;  4MFF A;  4X4U A;  5DBC A;  3JPN A;  4KLG A;  5DEC A;  5J0T A;  8ICV A;  8ICN A;  1UET A;  4I27 A;  4I2E A;  4P4P A;  4O5E A;  3OV7 A;  3MDC A;  4PH5 A;  3C18 A;  3HJ4 A;  5HRK A;  4KLD A;  1ZQK A;  4X4T A;  1XSN A;  3AQL A;  9ICC A;  7ICG A;  7ICI A;  4NM1 A;  1ZQQ A;  4X4V A;  4QZB A;  8ICI A;  4ATB A;  4TUS A;  4UAW A;  5IIJ A;  1BPY A;  4Z6E A;  4AT9 A;  5DKW A;  1ZJM A;  8ICC A;  1YLQ A;  9ICA A;  3JPS A;  5DB8 A;  2P66 A;  5IIM A;  5J2I A;  4QZE A;  3AQM A;  4RT3 A;  3V7K A;  3AUO A;  5D4B A;  2IHM A;  4GXJ A;  1JAJ A;  8ICR A;  3PML A;  4X4P A;  4IQT A;  1R8A A;  1RZT A;  2M2U A;  1VFG A;  5III A;  9ICH A;  1MQ3 A;  3K75 D;  9ICI A;  9ICQ A;  4IQU A;  1RPL A;  1MIY A;  4I28 A;  1KDH A;  4NKT A;  5DDY A;  4YMN A;  4NLN A;  7ICJ A;  4F5R A;  1UEV A;  2PBE A;  8ICL A;  5CA7 A;  3RH6 A;  5DBB A;  2BCU A;  4MF2 A;  4TUQ A;  9ICR A;  9ICX A;  7ICL A;  3H3A A;  1ZQP A;  1BPB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...