4WC1A

Structure of trna-processing enzyme with ctp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
382
structure length
364
Chain Sequence
b'MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 114
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc1A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc1A01
1JMSA 2ZH2A 2BCRA 5J0QA 4RQ7A 1ZQDA 1KEJA 5J29A 7ICLA 4AT9B 4P4PA 4YMMA 4NY8A 4NKTA 7ICEA 5DDMA 8ICMA 1ZQYA 4M47A 9ICAA 5DB7A 9ICQA 4X4OA 3RJEA 4X4QA 4RPYA 4FHPA 3H37A 1RPLA 5J2EA 9ICRA 4QZDA 5CWRA 4NM1A 4I2HA 3MDCA 7ICTA 1ZQUA 4E7XA 1ZQQA 2PFNA 1R8CA 4ATBA 4EBJA 5DBCA 9ICLA 2ZH3A 3B0YA 5IIJA 5D49A 7ICNA 5HRGA 5J0SA 1MQ3A 3OVAA 4YMNA 1HUOA 4M9JA 5HHIA 4TUSA 1KNYA 3UPSA 4QZGA 1PX5A 3WFQE 7ICQA 4AT7B 3ISDA 1F5AA 4RT2A 2DRBA 3MGHA 4KLFA 3HIYA 4RQ0A 8ICXA 7ICOA 4NLKA 4X4UA 9ICCA 2PBEA 4KLTA 5HRFA 4NLNA 5CR0A 8ICAA 2BCVA 8ICSA 2ISOA 2DR5A 8ICNA 9ICUA 2M2UA 4M9HA 8ICZA 4E80A 1VJ7A 1ZQVA 3AQKA 4NLZA 9ICHA 4GXIA 5J0PA 2ID1A 1ZQTA 4PHPA 4M9GA 4PPXA 3HW8A 4UB4A 4I29A 4PHAA 4QZEA 4RQ2A 8ICVA 3V7JA 2ZH4A 4IQUA 5CJ7A 4F5RA 7ICUA 8ICHA 1XSLA 1ZQXA 4M0AA 4RQ8A 4UB2A 2DR7A 3UQ0A 3AQMA 4FHVA 1R8AA 4XUSA 4RT3A 9ICNA 1ZQNA 4UBCA 3L9DA 4LZDA 9ICSA 3RJGA 3C2KA 4WC1A 5HREA 1ZQSA 1XSNA 4MFCA 4M04A 2ISPA 1UEVA 2BPCA 8ICQA 4EP7A 5DKWA 4UB5A 7ICGA 4KLQA 7ICVA 2BE3A 2P66A 1R89A 4P4MA 4M9NA 5DEDA 4JWNA 1UETA 4PH5A 4R66A 4M5DA 7ICFA 4IQWA 4KLLA 9ICXA 4MF8A 3C2MA 4F5OA 2IHMA 1UEUA 4XRHA 4WC4A 4JWMA 3AUOA 8ICLA 5J2AA 4NM2A 4TURA 5J2CA 5DECA 4XA5A 4X0BA 4PHDA 4X4PA 3WFRE 9ICPA 4KLIA 8ICEA 3HX0A 1ZQAA 4F5NA 5DB9A 4RPXA 4O9MA 3OGUA 4AT7A 4RQ3A 4KLGA 3C5FA 3LK9A 3ISBA 4RWPA 3HJ1A 4YMOA 4X5VA 4I2GA 1JN3A 3WFPA 1ZJMA 4WBYA 1ZQOA 3PNCA 5IIMA 5J0UA 3RJKA 8ICIA 1BPZA 5HC9A 3JPOA 5J2BA 4R65A 3MGIA 4WC2A 3UXPA 2ZHBA 9ICTA 9ICIA 3HJ4A 3RH5A 1FA0A 3PMLA 4P4OA 4QZCA 3RH6A 3AU2A 3AU6A 3OVBA 4RQ6A 1BPXA 9ICFA 4RQ1A 4PGYA 4UAWA 3UPQA 4WC5A 4Z6FA 5J0OA 8ICYA 8ICFA 4UB3A 4RQ4A 7ICHA 4ATBB 3H38A 3GDXA 3H3AA 3JPQA 4QZIA 5CA7A 5D4BA 3TFRA 5IINA 5IIKA 1ZQEA 3UQ2A 3MDAA 7ICMA 3B0XA 1ZQCA 1ZQBA 4UB1A 4UAYA 1MIYA 5HRKA 3AQNA 1BPEA 4FO6A 3C66A 9ICOA 2VANA 8ICBA 4UD5A 4AT8A 4PGXA 3V7LA 3C2LA 5DB8A 4NXZA 4PGQA 4RWOA 3ISCA 4XQ8A 5HRBA 2ZH8A 5F2VO 1BPBA 1TFWA 3RJIA 9ICMA 4R64A 4I2CA 5D46A 5DB6A 4I2EA 4WBZA 3TFSA 1ZQKA 8ICCA 2M2VA 3RJFA 2BCSA 1KDHA 2DVIA 4DOBA 4X4RA 4DOCA 3H39A 4Z6DA 3NYBA 4TUQA 4X4NA 4KLEA 2DR8A 4WC0A 4I2BA 4FHXA 2BPFA 4QZ8A 4AT9A 2DR9A 4UD4A 3OVSA 4XQ7A 8ICUA 4RWQA 4LT6A 1VFGA 9ICGA 9ICWA 4TUPA 2BCQA 4F5QA 3C18A 9ICKA 2ZH9A 3JPRA 4DO9A 4LVSA 8ICOA 5DBBA 2DRAA 3JPPA 3OUYB 4RPZA 4QZFA 7ICPA 4RQ5A 4YD1A 4WC7A 5BOMA 3RJJA 2FMPA 4X4SA 4I2DA 5J2IA 3UXNA 1NO5A 4FHWA 4P2HA 4I2AA 3LQCB 5EOZA 3HWTA 5J2FA 5J0RA 1ZQHA 1NOMA 1BPYA 2PFPA 4KLOA 3UXOA 3JPSA 4I2IA 2O1PA 9ICVA 4S3NA 1ZQPA 5J2DA 5J2HA 4GXJA 4DOAA 4RWNA 2ZH6A 1ZQRA 3JYYA 5BPCA 2M2WA 4K4GA 9ICJA 3C5GA 1V4AA 4QZBA 7ICKA 8ICGA 3RJHA 2ZH1A 2I9GA 4FH5A 4EBKA 4IQTA 1MIWA 5IILA 5J2JA 8ICWA 4KLSA 3AQLA 4KLJA 4I27A 1Q78A 4WC6A 5J0TA 2PXIA 1JAJA 3V72A 2RFFA 5TZVA 4MF2A 3OV7A 5CP2A 1MQ2A 1ZQLA 4QZAA 1JQRA 4UAZA 5DBAA 4K4HA 2M2TA 4WCWA 3V7KA 2ZH5A 7ICRA 4X4TA 4YD2A 5J2KA 8ICRA 1MIVA 2ZH7A 8ICJA 3PMNA 2PFQA 4O5EA 4KLHA 2NRKA 2PFOA 2HHPA 4IQVA 9ICEA 5HR9A 5J2GA 7ICJA 2GWSA 4Z6CA 1ZQWA 5HRDA 2O5AA 4QZ9A 5J0XA 4KLDA 4PHEA 2FMQA 2FMSA 1ZQIA 8ICTA 1TV9A 7ICSA 3JZ0A 1XSPA 1TVAA 5HRIA 5HRLA 4NKUA 4FHYA 5IIOA 5DDYA 5HRHA 4X0AA 5CHGA 3WFSC 4K4IA 1ZQGA 4WC3A 4YN4A 2BCUA 1WOTA 2BPGA 8ICPA 2ZHAA 4IG8A 4QZHA 1TFYA 3WFOA 2W9MA 1YLQA 4M9LA 1ZQMA 5IIIA 1RZTA 1R8BA 4Z6EA 2Q66A 3OUYA 3K75D 1OU5A 3JPTA 3MBYA 1ZQFA 4O5CA 4AT8B 4KLUA 4O5KA 1ZJNA 1ZQJA 4UBBA 8ICKA 5J0WA 3JPNA 4MFAA 4MFFA 4GXKA 4FH3A 3RH4A 5BOLA 1HUZA 1ZQZA 1Q79A 4I2FA 5J0YA 4KLMA 9ICBA 4I28A 4F5PA 4YCXA 5HHHA 4I2JA 4LZGA 4R63A 4E8FA 1BPDA 7ICIA 4X4VA 5CB1A 4M2YA
chains in the Genus database with same CATH superfamily
1JMSA 2ZH2A 2BCRA 5J0QA 4RQ7A 1ZQDA 3EF2A 1KEJA 5J29A 7ICLA 4AT9B 3NKUA 4P4PA 4YMMA 4NY8A 4NKTA 7ICEA 5DDMA 8ICMA 1ZQYA 4M47A 9ICAA 4O6AA 5DB7A 9ICQA 4X4OA 3RJEA 4WQLA 4X4QA 4RPYA 3MCRA 4FHPA 3H37A 4K98A 2EWRA 1RPLA 4LEVA 5J2EA 9ICRA 4QZDA 5CWRA 4NM1A 4I2HA 3MDCA 7ICTA 1ZQUA 4E7XA 1ZQQA 2PFNA 1R8CA 4ATBA 4EBJA 5DBCA 9ICLA 2ZH3A 3B0YA 5IIJA 5D49A 7ICNA 5HRGA 5J0SA 2HN1A 1MQ3A 2HN2A 3OVAA 4YMNA 1HUOA 4M9JA 5HHIA 4TUSA 1KNYA 3UPSA 4QZGA 1PX5A 3WFQE 7ICQA 4AT7B 3ISDA 1F5AA 4RT2A 2DRBA 3MGHA 4KLFA 4XJEA 3HIYA 4RQ0A 8ICXA 7ICOA 5CFSA 4NLKA 4X4UA 9ICCA 2PBEA 4KLTA 5HRFA 4NLNA 5CR0A 8ICAA 2BCVA 8ICSA 2ISOA 2DR5A 8ICNA 9ICUA 2M2UA 4M9HA 8ICZA 4E80A 1VJ7A 1ZQVA 3AQKA 4NLZA 9ICHA 4GXIA 5J0PA 2ID1A 1ZQTA 4PHPA 4M9GA 4PPXA 4JLXA 3HW8A 4UB4A 4I29A 4PHAA 4NXXA 2BBHA 4QZEA 4RQ2A 8ICVA 3V7JA 2ZH4A 4IQUA 5CJ7A 4F5RA 7ICUA 8ICHA 1XSLA 1ZQXA 5CHEA 4M0AA 4RQ8A 4UB2A 2DR7A 3UQ0A 3AQMA 4FHVA 1R8AA 4XUSA 4RT3A 9ICNA 1ZQNA 4UBCA 3L9DA 4LZDA 9ICSA 3RJGA 3C2KA 4WC1A 5HREA 1ZQSA 1XSNA 4MFCA 2FCLA 4M04A 2ISPA 4EV6A 1UEVA 2BPCA 8ICQA 4JLZA 4EP7A 5DKWA 4UB5A 7ICGA 4KLQA 7ICVA 2BE3A 2P66A 1R89A 4P4MA 4M9NA 5DEDA 4JWNA 1UETA 4O67A 4PH5A 4R66A 4M5DA 4K97A 7ICFA 4IQWA 4KLLA 4WQKA 9ICXA 4MF8A 3C2MA 4F5OA 2IHMA 1UEUA 4XRHA 4WC4A 4OAFA 4JWMA 3PHZA 3AUOA 8ICLA 5J2AA 4NM2A 4TURA 4NXWA 5J2CA 5DECA 4XA5A 4X0BA 4PHDA 4X4PA 3WFRE 3ER8C 9ICPA 4K9BA 4KLIA 8ICEA 3HX0A 1ZQAA 4F5NA 5DB9A 4RPXA 4O9MA 3OGUA 4AT7A 4RQ3A 4KLGA 3C5FA 3LK9A 3ISBA 4RWPA 3HJ1A 4YMOA 4X5VA 4I2GA 1JN3A 3WFPA 1ZJMA 4WBYA 1ZQOA 3PNCA 5IIMA 5J0UA 3RJKA 8ICIA 1BPZA 4MKPA 5HC9A 3JPOA 4K96A 5J2BA 4R65A 3MGIA 4WC2A 3UXPA 2ZHBA 9ICTA 9ICIA 3HJ4A 4WOYA 3OWGA 3RH5A 2GAFD 1FA0A 3PMLA 4P4OA 4KM5A 4QZCA 3RH6A 3AU2A 3AU6A 3OVBA 4RQ6A 1BPXA 9ICFA 4RQ1A 4PGYA 4UAWA 3UPQA 4WC5A 4Z6FA 5J0OA 8ICYA 8ICFA 4UB3A 4NXUA 4RQ4A 3CK6A 7ICHA 4ATBB 3H38A 3GDXA 3NWIA 3H3AA 3JPQA 4QZIA 5CA7A 5D4BA 3TFRA 2GA9D 5IINA 5IIKA 1ZQEA 3UQ2A 3MDAA 7ICMA 3B0XA 1ZQCA 1ZQBA 4UB1A 4UAYA 1MIYA 5HRKA 3AQNA 1BPEA 5JTGA 4FO6A 3C66A 9ICOA 4WH5A 2IUBA 2VANA 8ICBA 4UD5A 4AT8A 4PGXA 3V7LA 3C2LA 4O69A 5DB8A 4NXZA 4PGQA 4RWOA 3ISCA 4XQ8A 5HRBA 2ZH8A 5F2VO 1BPBA 1TFWA 3RJIA 9ICMA 4R64A 4I2CA 5D46A 5DB6A 4I2EA 4WBZA 3TFSA 1ZQKA 4NXVA 8ICCA 2M2VA 3RJFA 2BCSA 1KDHA 2B51A 2DVIA 4DOBA 4X4RA 4DOCA 3H39A 4Z6DA 3NYBA 4TUQA 4X4NA 4KLEA 2DR8A 4WC0A 4I2BA 4FHXA 2BPFA 4QZ8A 4AT9A 2DR9A 4UD4A 3OVSA 4XQ7A 8ICUA 4RWQA 4LT6A 1VFGA 9ICGA 4KB6A 9ICWA 4TUPA 2BCQA 4F5QA 3C18A 9ICKA 2ZH9A 3JPRA 4DO9A 4LVSA 8ICOA 3NVOA 5DBBA 2DRAA 3JPPA 3OUYB 4RPZA 4QZFA 7ICPA 4RQ5A 4YD1A 4WC7A 5BOMA 3RJJA 2FMPA 4X4SA 4I2DA 4I0UA 5J2IA 3UXNA 1NO5A 4FHWA 4P2HA 4I2AA 3LQCB 5D61A 5EOZA 3HWTA 5J2FA 5D62A 5J0RA 1ZQHA 1NOMA 1BPYA 2PFPA 4KLOA 3UXOA 3JPSA 4I2IA 2O1PA 9ICVA 5B3PA 4S3NA 1ZQPA 5J2DA 5J2HA 4GXJA 4DOAA 4K99A 4RWNA 2ZH6A 1ZQRA 3JYYA 5BPCA 2M2WA 4K4GA 5CFUA 9ICJA 3C5GA 1V4AA 4QZBA 7ICKA 8ICGA 3JCFA 3RJHA 2ZH1A 2I9GA 3ERCC 4FH5A 4OAGA 4EBKA 4IQTA 1MIWA 5IILA 5J2JA 8ICWA 4KLSA 3AQLA 4KLJA 4I27A 1Q78A 4WC6A 5J0TA 2PXIA 1JAJA 3V72A 2RFFA 5TZVA 4MF2A 3OV7A 5CP2A 1MQ2A 1ZQLA 4QZAA 1JQRA 4UAZA 5DBAA 4K4HA 2M2TA 4WCWA 3V7KA 2ZH5A 7ICRA 4X4TA 4YD2A 5J2KA 8ICRA 1MIVA 2B4VA 2ZH7A 8ICJA 3PMNA 2PFQA 5D63A 4O5EA 4EEBA 4KLHA 2NRKA 4OAHA 2HHPA 4IQVA 2PFOA 9ICEA 5HR9A 5J2GA 7ICJA 2GWSA 4Z6CA 1ZQWA 5HRDA 2O5AA 4QZ9A 5J0XA 4KLDA 4PHEA 2FMQA 2FMSA 2IHOA 1ZQIA 8ICTA 1TV9A 7ICSA 3JZ0A 1XSPA 1TVAA 5HRIA 5HRLA 4NKUA 4FHYA 5IIOA 4EEDA 5DDYA 5HRHA 4X0AA 5CHGA 3WFSC 4K4IA 5CFTA 1ZQGA 4WC3A 4YN4A 2BCUA 1WOTA 2BPGA 4LEWA 8ICPA 2ZHAA 4LEYA 4QZHA 4IG8A 1TFYA 3WFOA 2W9MA 1YLQA 4FO1A 4M9LA 1ZQMA 4OAIZ 5IIIA 1RZTA 1R8BA 4Z6EA 2Q66A 3OUYA 3K75D 4K9AA 2BBJA 1OU5A 4K8VA 4O68A 3JPTA 3MBYA 1ZQFA 4O5CA 4AT8B 4KLUA 4NXTA 4O5KA 1ZJNA 1ZQJA 4UBBA 8ICKA 3ER9B 5J0WA 3JPNA 4MFAA 4MFFA 4N7RA 4GXKA 4FH3A 3RH4A 4EGWA 5BOLA 1GPJA 1HUZA 4LEZA 1ZQZA 4HX0A 1Q79A 4I2FA 3K7DA 5J0YA 4KLMA 2B56A 9ICBA 4I28A 4F5PA 4YCXA 5HHHA 4I2JA 4LZGA 4R63A 4E8FA 1BPDA 7ICIA 4X4VA 5CB1A 4M2YA 5B3QA
chains in the Genus database with same CATH topology
1JMSA 2ZH2A 2BCRA 5J0QA 4RQ7A 1ZQDA 1KEJA 5J29A 7ICLA 4AT9B 4P4PA 4YMMA 4NY8A 4NKTA 7ICEA 5DDMA 8ICMA 1ZQYA 4M47A 9ICAA 5DB7A 9ICQA 4X4OA 3RJEA 4X4QA 4RPYA 4FHPA 3H37A 1RPLA 5J2EA 9ICRA 4QZDA 5CWRA 4NM1A 4I2HA 3MDCA 7ICTA 1ZQUA 4E7XA 1ZQQA 2PFNA 1R8CA 4ATBA 4EBJA 5DBCA 9ICLA 2ZH3A 3B0YA 5IIJA 5D49A 7ICNA 5HRGA 5J0SA 1MQ3A 3OVAA 4YMNA 1HUOA 4M9JA 5HHIA 4TUSA 1KNYA 3UPSA 4QZGA 1PX5A 3WFQE 7ICQA 4AT7B 3ISDA 1F5AA 4RT2A 2DRBA 3MGHA 4KLFA 3HIYA 4RQ0A 8ICXA 7ICOA 4NLKA 4X4UA 9ICCA 2PBEA 4KLTA 5HRFA 4NLNA 5CR0A 8ICAA 2BCVA 8ICSA 2ISOA 2DR5A 8ICNA 9ICUA 2M2UA 4M9HA 8ICZA 4E80A 1VJ7A 1ZQVA 3AQKA 4NLZA 9ICHA 4GXIA 5J0PA 2ID1A 1ZQTA 4PHPA 4M9GA 4PPXA 3HW8A 4UB4A 4I29A 4PHAA 4QZEA 4RQ2A 8ICVA 3V7JA 2ZH4A 4IQUA 5CJ7A 4F5RA 7ICUA 8ICHA 1XSLA 1ZQXA 4M0AA 4RQ8A 4UB2A 2DR7A 3UQ0A 3AQMA 4FHVA 1R8AA 4XUSA 4RT3A 9ICNA 1ZQNA 4UBCA 3L9DA 4LZDA 9ICSA 3RJGA 3C2KA 4WC1A 5HREA 1ZQSA 1XSNA 4MFCA 4M04A 2ISPA 1UEVA 2BPCA 8ICQA 4EP7A 5DKWA 4UB5A 7ICGA 4KLQA 7ICVA 2BE3A 2P66A 1R89A 4P4MA 4M9NA 5DEDA 4JWNA 1UETA 4PH5A 4R66A 4M5DA 7ICFA 4IQWA 4KLLA 9ICXA 4MF8A 3C2MA 4F5OA 2IHMA 1UEUA 4XRHA 4WC4A 4JWMA 3AUOA 8ICLA 5J2AA 4NM2A 4TURA 5J2CA 5DECA 4XA5A 4X0BA 4PHDA 4X4PA 3WFRE 9ICPA 4KLIA 8ICEA 3HX0A 1ZQAA 4F5NA 5DB9A 4RPXA 4O9MA 3OGUA 4AT7A 4RQ3A 4KLGA 3C5FA 3LK9A 3ISBA 4RWPA 3HJ1A 4YMOA 4X5VA 4I2GA 1JN3A 3WFPA 1ZJMA 4WBYA 1ZQOA 3PNCA 5IIMA 5J0UA 3RJKA 8ICIA 1BPZA 5HC9A 3JPOA 5J2BA 4R65A 3MGIA 4WC2A 3UXPA 2ZHBA 9ICTA 9ICIA 3HJ4A 3RH5A 1FA0A 3PMLA 4P4OA 4QZCA 3RH6A 3AU2A 3AU6A 3OVBA 4RQ6A 1BPXA 9ICFA 4RQ1A 4PGYA 4UAWA 3UPQA 4WC5A 4Z6FA 5J0OA 8ICYA 8ICFA 4UB3A 4RQ4A 7ICHA 4ATBB 3H38A 3GDXA 3H3AA 3JPQA 4QZIA 5CA7A 5D4BA 3TFRA 5IINA 5IIKA 1ZQEA 3UQ2A 3MDAA 7ICMA 3B0XA 1ZQCA 1ZQBA 4UB1A 4UAYA 1MIYA 5HRKA 3AQNA 1BPEA 4FO6A 3C66A 9ICOA 2VANA 8ICBA 4UD5A 4AT8A 4PGXA 3V7LA 3C2LA 5DB8A 4NXZA 4PGQA 4RWOA 3ISCA 4XQ8A 5HRBA 2ZH8A 5F2VO 1BPBA 1TFWA 3RJIA 9ICMA 4R64A 4I2CA 5D46A 5DB6A 4I2EA 4WBZA 3TFSA 1ZQKA 8ICCA 2M2VA 3RJFA 2BCSA 1KDHA 2DVIA 4DOBA 4X4RA 4DOCA 3H39A 4Z6DA 3NYBA 4TUQA 4X4NA 4KLEA 2DR8A 4WC0A 4I2BA 4FHXA 2BPFA 4QZ8A 4AT9A 2DR9A 4UD4A 3OVSA 4XQ7A 8ICUA 4RWQA 4LT6A 1VFGA 9ICGA 9ICWA 4TUPA 2BCQA 4F5QA 3C18A 9ICKA 2ZH9A 3JPRA 4DO9A 4LVSA 8ICOA 5DBBA 2DRAA 3JPPA 3OUYB 4RPZA 4QZFA 7ICPA 4RQ5A 4YD1A 4WC7A 5BOMA 3RJJA 2FMPA 4X4SA 4I2DA 5J2IA 3UXNA 1NO5A 4FHWA 4P2HA 4I2AA 3LQCB 5EOZA 3HWTA 5J2FA 5J0RA 1ZQHA 1NOMA 1BPYA 2PFPA 4KLOA 3UXOA 3JPSA 4I2IA 2O1PA 9ICVA 4S3NA 1ZQPA 5J2DA 5J2HA 4GXJA 4DOAA 4RWNA 2ZH6A 1ZQRA 3JYYA 5BPCA 2M2WA 4K4GA 9ICJA 3C5GA 1V4AA 4QZBA 7ICKA 8ICGA 3RJHA 2ZH1A 2I9GA 4FH5A 4EBKA 4IQTA 1MIWA 5IILA 5J2JA 8ICWA 4KLSA 3AQLA 4KLJA 4I27A 1Q78A 4WC6A 5J0TA 2PXIA 1JAJA 3V72A 2RFFA 5TZVA 4MF2A 3OV7A 5CP2A 1MQ2A 1ZQLA 4QZAA 1JQRA 4UAZA 5DBAA 4K4HA 2M2TA 4WCWA 3V7KA 2ZH5A 7ICRA 4X4TA 4YD2A 5J2KA 8ICRA 1MIVA 2ZH7A 8ICJA 3PMNA 2PFQA 4O5EA 4KLHA 2NRKA 2PFOA 2HHPA 4IQVA 9ICEA 5HR9A 5J2GA 7ICJA 2GWSA 4Z6CA 1ZQWA 5HRDA 2O5AA 4QZ9A 5J0XA 4KLDA 4PHEA 2FMQA 2FMSA 1ZQIA 8ICTA 1TV9A 7ICSA 3JZ0A 1XSPA 1TVAA 5HRIA 5HRLA 4NKUA 4FHYA 5IIOA 5DDYA 5HRHA 4X0AA 5CHGA 3WFSC 4K4IA 1ZQGA 4WC3A 4YN4A 2BCUA 1WOTA 2BPGA 8ICPA 2ZHAA 4IG8A 4QZHA 1TFYA 3WFOA 2W9MA 1YLQA 4M9LA 1ZQMA 5IIIA 1RZTA 1R8BA 4Z6EA 2Q66A 3OUYA 3K75D 1OU5A 3JPTA 3MBYA 1ZQFA 4O5CA 4AT8B 4KLUA 4O5KA 1ZJNA 1ZQJA 4UBBA 8ICKA 5J0WA 3JPNA 4MFAA 4MFFA 4GXKA 4FH3A 3RH4A 5BOLA 1HUZA 1ZQZA 1Q79A 4I2FA 5J0YA 4KLMA 9ICBA 4I28A 4F5PA 4YCXA 5HHHA 4I2JA 4LZGA 4R63A 4E8FA 1BPDA 7ICIA 4X4VA 5CB1A 4M2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMS A;  2ZH2 A;  2BCR A;  5J0Q A;  4RQ7 A;  1ZQD A;  1KEJ A;  5J29 A;  7ICL A;  4AT9 B;  4P4P A;  4YMM A;  4NY8 A;  4NKT A;  7ICE A;  5DDM A;  8ICM A;  1ZQY A;  4M47 A;  9ICA A;  5DB7 A;  9ICQ A;  4X4O A;  3RJE A;  4X4Q A;  4RPY A;  4FHP A;  3H37 A;  1RPL A;  5J2E A;  9ICR A;  4QZD A;  5CWR A;  4NM1 A;  4I2H A;  3MDC A;  7ICT A;  1ZQU A;  4E7X A;  1ZQQ A;  2PFN A;  1R8C A;  4ATB A;  4EBJ A;  5DBC A;  9ICL A;  2ZH3 A;  3B0Y A;  5IIJ A;  5D49 A;  7ICN A;  5HRG A;  5J0S A;  1MQ3 A;  3OVA A;  4YMN A;  1HUO A;  4M9J A;  5HHI A;  4TUS A;  1KNY A;  3UPS A;  4QZG A;  1PX5 A;  3WFQ E;  7ICQ A;  4AT7 B;  3ISD A;  1F5A A;  4RT2 A;  2DRB A;  3MGH A;  4KLF A;  3HIY A;  4RQ0 A;  8ICX A;  7ICO A;  4NLK A;  4X4U A;  9ICC A;  2PBE A;  4KLT A;  5HRF A;  4NLN A;  5CR0 A;  8ICA A;  2BCV A;  8ICS A;  2ISO A;  2DR5 A;  8ICN A;  9ICU A;  2M2U A;  4M9H A;  8ICZ A;  4E80 A;  1VJ7 A;  1ZQV A;  3AQK A;  4NLZ A;  9ICH A;  4GXI A;  5J0P A;  2ID1 A;  1ZQT A;  4PHP A;  4M9G A;  4PPX A;  3HW8 A;  4UB4 A;  4I29 A;  4PHA A;  4QZE A;  4RQ2 A;  8ICV A;  3V7J A;  2ZH4 A;  4IQU A;  5CJ7 A;  4F5R A;  7ICU A;  8ICH A;  1XSL A;  1ZQX A;  4M0A A;  4RQ8 A;  4UB2 A;  2DR7 A;  3UQ0 A;  3AQM A;  4FHV A;  1R8A A;  4XUS A;  4RT3 A;  9ICN A;  1ZQN A;  4UBC A;  3L9D A;  4LZD A;  9ICS A;  3RJG A;  3C2K A;  4WC1 A;  5HRE A;  1ZQS A;  1XSN A;  4MFC A;  4M04 A;  2ISP A;  1UEV A;  2BPC A;  8ICQ A;  4EP7 A;  5DKW A;  4UB5 A;  7ICG A;  4KLQ A;  7ICV A;  2BE3 A;  2P66 A;  1R89 A;  4P4M A;  4M9N A;  5DED A;  4JWN A;  1UET A;  4PH5 A;  4R66 A;  4M5D A;  7ICF A;  4IQW A;  4KLL A;  9ICX A;  4MF8 A;  3C2M A;  4F5O A;  2IHM A;  1UEU A;  4XRH A;  4WC4 A;  4JWM A;  3AUO A;  8ICL A;  5J2A A;  4NM2 A;  4TUR A;  5J2C A;  5DEC A;  4XA5 A;  4X0B A;  4PHD A;  4X4P A;  3WFR E;  9ICP A;  4KLI A;  8ICE A;  3HX0 A;  1ZQA A;  4F5N A;  5DB9 A;  4RPX A;  4O9M A;  3OGU A;  4AT7 A;  4RQ3 A;  4KLG A;  3C5F A;  3LK9 A;  3ISB A;  4RWP A;  3HJ1 A;  4YMO A;  4X5V A;  4I2G A;  1JN3 A;  3WFP A;  1ZJM A;  4WBY A;  1ZQO A;  3PNC A;  5IIM A;  5J0U A;  3RJK A;  8ICI A;  1BPZ A;  5HC9 A;  3JPO A;  5J2B A;  4R65 A;  3MGI A;  4WC2 A;  3UXP A;  2ZHB A;  9ICT A;  9ICI A;  3HJ4 A;  3RH5 A;  1FA0 A;  3PML A;  4P4O A;  4QZC A;  3RH6 A;  3AU2 A;  3AU6 A;  3OVB A;  4RQ6 A;  1BPX A;  9ICF A;  4RQ1 A;  4PGY A;  4UAW A;  3UPQ A;  4WC5 A;  4Z6F A;  5J0O A;  8ICY A;  8ICF A;  4UB3 A;  4RQ4 A;  7ICH A;  4ATB B;  3H38 A;  3GDX A;  3H3A A;  3JPQ A;  4QZI A;  5CA7 A;  5D4B A;  3TFR A;  5IIN A;  5IIK A;  1ZQE A;  3UQ2 A;  3MDA A;  7ICM A;  3B0X A;  1ZQC A;  1ZQB A;  4UB1 A;  4UAY A;  1MIY A;  5HRK A;  3AQN A;  1BPE A;  4FO6 A;  3C66 A;  9ICO A;  2VAN A;  8ICB A;  4UD5 A;  4AT8 A;  4PGX A;  3V7L A;  3C2L A;  5DB8 A;  4NXZ A;  4PGQ A;  4RWO A;  3ISC A;  4XQ8 A;  5HRB A;  2ZH8 A;  5F2V O;  1BPB A;  1TFW A;  3RJI A;  9ICM A;  4R64 A;  4I2C A;  5D46 A;  5DB6 A;  4I2E A;  4WBZ A;  3TFS A;  1ZQK A;  8ICC A;  2M2V A;  3RJF A;  2BCS A;  1KDH A;  2DVI A;  4DOB A;  4X4R A;  4DOC A;  3H39 A;  4Z6D A;  3NYB A;  4TUQ A;  4X4N A;  4KLE A;  2DR8 A;  4WC0 A;  4I2B A;  4FHX A;  2BPF A;  4QZ8 A;  4AT9 A;  2DR9 A;  4UD4 A;  3OVS A;  4XQ7 A;  8ICU A;  4RWQ A;  4LT6 A;  1VFG A;  9ICG A;  9ICW A;  4TUP A;  2BCQ A;  4F5Q A;  3C18 A;  9ICK A;  2ZH9 A;  3JPR A;  4DO9 A;  4LVS A;  8ICO A;  5DBB A;  2DRA A;  3JPP A;  3OUY B;  4RPZ A;  4QZF A;  7ICP A;  4RQ5 A;  4YD1 A;  4WC7 A;  5BOM A;  3RJJ A;  2FMP A;  4X4S A;  4I2D A;  5J2I A;  3UXN A;  1NO5 A;  4FHW A;  4P2H A;  4I2A A;  3LQC B;  5EOZ A;  3HWT A;  5J2F A;  5J0R A;  1ZQH A;  1NOM A;  1BPY A;  2PFP A;  4KLO A;  3UXO A;  3JPS A;  4I2I A;  2O1P A;  9ICV A;  4S3N A;  1ZQP A;  5J2D A;  5J2H A;  4GXJ A;  4DOA A;  4RWN A;  2ZH6 A;  1ZQR A;  3JYY A;  5BPC A;  2M2W A;  4K4G A;  9ICJ A;  3C5G A;  1V4A A;  4QZB A;  7ICK A;  8ICG A;  3RJH A;  2ZH1 A;  2I9G A;  4FH5 A;  4EBK A;  4IQT A;  1MIW A;  5IIL A;  5J2J A;  8ICW A;  4KLS A;  3AQL A;  4KLJ A;  4I27 A;  1Q78 A;  4WC6 A;  5J0T A;  2PXI A;  1JAJ A;  3V72 A;  2RFF A;  5TZV A;  4MF2 A;  3OV7 A;  5CP2 A;  1MQ2 A;  1ZQL A;  4QZA A;  1JQR A;  4UAZ A;  5DBA A;  4K4H A;  2M2T A;  4WCW A;  3V7K A;  2ZH5 A;  7ICR A;  4X4T A;  4YD2 A;  5J2K A;  8ICR A;  1MIV A;  2ZH7 A;  8ICJ A;  3PMN A;  2PFQ A;  4O5E A;  4KLH A;  2NRK A;  2PFO A;  2HHP A;  4IQV A;  9ICE A;  5HR9 A;  5J2G A;  7ICJ A;  2GWS A;  4Z6C A;  1ZQW A;  5HRD A;  2O5A A;  4QZ9 A;  5J0X A;  4KLD A;  4PHE A;  2FMQ A;  2FMS A;  1ZQI A;  8ICT A;  1TV9 A;  7ICS A;  3JZ0 A;  1XSP A;  1TVA A;  5HRI A;  5HRL A;  4NKU A;  4FHY A;  5IIO A;  5DDY A;  5HRH A;  4X0A A;  5CHG A;  3WFS C;  4K4I A;  1ZQG A;  4WC3 A;  4YN4 A;  2BCU A;  1WOT A;  2BPG A;  8ICP A;  2ZHA A;  4IG8 A;  4QZH A;  1TFY A;  3WFO A;  2W9M A;  1YLQ A;  4M9L A;  1ZQM A;  5III A;  1RZT A;  1R8B A;  4Z6E A;  2Q66 A;  3OUY A;  3K75 D;  1OU5 A;  3JPT A;  3MBY A;  1ZQF A;  4O5C A;  4AT8 B;  4KLU A;  4O5K A;  1ZJN A;  1ZQJ A;  4UBB A;  8ICK A;  5J0W A;  3JPN A;  4MFA A;  4MFF A;  4GXK A;  4FH3 A;  3RH4 A;  5BOL A;  1HUZ A;  1ZQZ A;  1Q79 A;  4I2F A;  5J0Y A;  4KLM A;  9ICB A;  4I28 A;  4F5P A;  4YCX A;  5HHH A;  4I2J A;  4LZG A;  4R63 A;  4E8F A;  1BPD A;  7ICI A;  4X4V A;  5CB1 A;  4M2Y A; 
#chains in the Genus database with same CATH topology
 1JMS A;  2ZH2 A;  2BCR A;  5J0Q A;  4RQ7 A;  1ZQD A;  3EF2 A;  1KEJ A;  5J29 A;  7ICL A;  4AT9 B;  3NKU A;  4P4P A;  4YMM A;  4NY8 A;  4NKT A;  7ICE A;  5DDM A;  8ICM A;  1ZQY A;  4M47 A;  9ICA A;  4O6A A;  5DB7 A;  9ICQ A;  4X4O A;  3RJE A;  4WQL A;  4X4Q A;  4RPY A;  3MCR A;  4FHP A;  3H37 A;  4K98 A;  2EWR A;  1RPL A;  4LEV A;  5J2E A;  9ICR A;  4QZD A;  5CWR A;  4NM1 A;  4I2H A;  3MDC A;  7ICT A;  1ZQU A;  4E7X A;  1ZQQ A;  2PFN A;  1R8C A;  4ATB A;  4EBJ A;  5DBC A;  9ICL A;  2ZH3 A;  3B0Y A;  5IIJ A;  5D49 A;  7ICN A;  5HRG A;  5J0S A;  2HN1 A;  1MQ3 A;  2HN2 A;  3OVA A;  4YMN A;  1HUO A;  4M9J A;  5HHI A;  4TUS A;  1KNY A;  3UPS A;  4QZG A;  1PX5 A;  3WFQ E;  7ICQ A;  4AT7 B;  3ISD A;  1F5A A;  4RT2 A;  2DRB A;  3MGH A;  4KLF A;  4XJE A;  3HIY A;  4RQ0 A;  8ICX A;  7ICO A;  5CFS A;  4NLK A;  4X4U A;  9ICC A;  2PBE A;  4KLT A;  5HRF A;  4NLN A;  5CR0 A;  8ICA A;  2BCV A;  8ICS A;  2ISO A;  2DR5 A;  8ICN A;  9ICU A;  2M2U A;  4M9H A;  8ICZ A;  4E80 A;  1VJ7 A;  1ZQV A;  3AQK A;  4NLZ A;  9ICH A;  4GXI A;  5J0P A;  2ID1 A;  1ZQT A;  4PHP A;  4M9G A;  4PPX A;  4JLX A;  3HW8 A;  4UB4 A;  4I29 A;  4PHA A;  4NXX A;  2BBH A;  4QZE A;  4RQ2 A;  8ICV A;  3V7J A;  2ZH4 A;  4IQU A;  5CJ7 A;  4F5R A;  7ICU A;  8ICH A;  1XSL A;  1ZQX A;  5CHE A;  4M0A A;  4RQ8 A;  4UB2 A;  2DR7 A;  3UQ0 A;  3AQM A;  4FHV A;  1R8A A;  4XUS A;  4RT3 A;  9ICN A;  1ZQN A;  4UBC A;  3L9D A;  4LZD A;  9ICS A;  3RJG A;  3C2K A;  4WC1 A;  5HRE A;  1ZQS A;  1XSN A;  4MFC A;  2FCL A;  4M04 A;  2ISP A;  4EV6 A;  1UEV A;  2BPC A;  8ICQ A;  4JLZ A;  4EP7 A;  5DKW A;  4UB5 A;  7ICG A;  4KLQ A;  7ICV A;  2BE3 A;  2P66 A;  1R89 A;  4P4M A;  4M9N A;  5DED A;  4JWN A;  1UET A;  4O67 A;  4PH5 A;  4R66 A;  4M5D A;  4K97 A;  7ICF A;  4IQW A;  4KLL A;  4WQK A;  9ICX A;  4MF8 A;  3C2M A;  4F5O A;  2IHM A;  1UEU A;  4XRH A;  4WC4 A;  4OAF A;  4JWM A;  3PHZ A;  3AUO A;  8ICL A;  5J2A A;  4NM2 A;  4TUR A;  4NXW A;  5J2C A;  5DEC A;  4XA5 A;  4X0B A;  4PHD A;  4X4P A;  3WFR E;  3ER8 C;  9ICP A;  4K9B A;  4KLI A;  8ICE A;  3HX0 A;  1ZQA A;  4F5N A;  5DB9 A;  4RPX A;  4O9M A;  3OGU A;  4AT7 A;  4RQ3 A;  4KLG A;  3C5F A;  3LK9 A;  3ISB A;  4RWP A;  3HJ1 A;  4YMO A;  4X5V A;  4I2G A;  1JN3 A;  3WFP A;  1ZJM A;  4WBY A;  1ZQO A;  3PNC A;  5IIM A;  5J0U A;  3RJK A;  8ICI A;  1BPZ A;  4MKP A;  5HC9 A;  3JPO A;  4K96 A;  5J2B A;  4R65 A;  3MGI A;  4WC2 A;  3UXP A;  2ZHB A;  9ICT A;  9ICI A;  3HJ4 A;  4WOY A;  3OWG A;  3RH5 A;  2GAF D;  1FA0 A;  3PML A;  4P4O A;  4KM5 A;  4QZC A;  3RH6 A;  3AU2 A;  3AU6 A;  3OVB A;  4RQ6 A;  1BPX A;  9ICF A;  4RQ1 A;  4PGY A;  4UAW A;  3UPQ A;  4WC5 A;  4Z6F A;  5J0O A;  8ICY A;  8ICF A;  4UB3 A;  4NXU A;  4RQ4 A;  3CK6 A;  7ICH A;  4ATB B;  3H38 A;  3GDX A;  3NWI A;  3H3A A;  3JPQ A;  4QZI A;  5CA7 A;  5D4B A;  3TFR A;  2GA9 D;  5IIN A;  5IIK A;  1ZQE A;  3UQ2 A;  3MDA A;  7ICM A;  3B0X A;  1ZQC A;  1ZQB A;  4UB1 A;  4UAY A;  1MIY A;  5HRK A;  3AQN A;  1BPE A;  5JTG A;  4FO6 A;  3C66 A;  9ICO A;  4WH5 A;  2IUB A;  2VAN A;  8ICB A;  4UD5 A;  4AT8 A;  4PGX A;  3V7L A;  3C2L A;  4O69 A;  5DB8 A;  4NXZ A;  4PGQ A;  4RWO A;  3ISC A;  4XQ8 A;  5HRB A;  2ZH8 A;  5F2V O;  1BPB A;  1TFW A;  3RJI A;  9ICM A;  4R64 A;  4I2C A;  5D46 A;  5DB6 A;  4I2E A;  4WBZ A;  3TFS A;  1ZQK A;  4NXV A;  8ICC A;  2M2V A;  3RJF A;  2BCS A;  1KDH A;  2B51 A;  2DVI A;  4DOB A;  4X4R A;  4DOC A;  3H39 A;  4Z6D A;  3NYB A;  4TUQ A;  4X4N A;  4KLE A;  2DR8 A;  4WC0 A;  4I2B A;  4FHX A;  2BPF A;  4QZ8 A;  4AT9 A;  2DR9 A;  4UD4 A;  3OVS A;  4XQ7 A;  8ICU A;  4RWQ A;  4LT6 A;  1VFG A;  9ICG A;  4KB6 A;  9ICW A;  4TUP A;  2BCQ A;  4F5Q A;  3C18 A;  9ICK A;  2ZH9 A;  3JPR A;  4DO9 A;  4LVS A;  8ICO A;  3NVO A;  5DBB A;  2DRA A;  3JPP A;  3OUY B;  4RPZ A;  4QZF A;  7ICP A;  4RQ5 A;  4YD1 A;  4WC7 A;  5BOM A;  3RJJ A;  2FMP A;  4X4S A;  4I2D A;  4I0U A;  5J2I A;  3UXN A;  1NO5 A;  4FHW A;  4P2H A;  4I2A A;  3LQC B;  5D61 A;  5EOZ A;  3HWT A;  5J2F A;  5D62 A;  5J0R A;  1ZQH A;  1NOM A;  1BPY A;  2PFP A;  4KLO A;  3UXO A;  3JPS A;  4I2I A;  2O1P A;  9ICV A;  5B3P A;  4S3N A;  1ZQP A;  5J2D A;  5J2H A;  4GXJ A;  4DOA A;  4K99 A;  4RWN A;  2ZH6 A;  1ZQR A;  3JYY A;  5BPC A;  2M2W A;  4K4G A;  5CFU A;  9ICJ A;  3C5G A;  1V4A A;  4QZB A;  7ICK A;  8ICG A;  3JCF A;  3RJH A;  2ZH1 A;  2I9G A;  3ERC C;  4FH5 A;  4OAG A;  4EBK A;  4IQT A;  1MIW A;  5IIL A;  5J2J A;  8ICW A;  4KLS A;  3AQL A;  4KLJ A;  4I27 A;  1Q78 A;  4WC6 A;  5J0T A;  2PXI A;  1JAJ A;  3V72 A;  2RFF A;  5TZV A;  4MF2 A;  3OV7 A;  5CP2 A;  1MQ2 A;  1ZQL A;  4QZA A;  1JQR A;  4UAZ A;  5DBA A;  4K4H A;  2M2T A;  4WCW A;  3V7K A;  2ZH5 A;  7ICR A;  4X4T A;  4YD2 A;  5J2K A;  8ICR A;  1MIV A;  2B4V A;  2ZH7 A;  8ICJ A;  3PMN A;  2PFQ A;  5D63 A;  4O5E A;  4EEB A;  4KLH A;  2NRK A;  4OAH A;  2HHP A;  4IQV A;  2PFO A;  9ICE A;  5HR9 A;  5J2G A;  7ICJ A;  2GWS A;  4Z6C A;  1ZQW A;  5HRD A;  2O5A A;  4QZ9 A;  5J0X A;  4KLD A;  4PHE A;  2FMQ A;  2FMS A;  2IHO A;  1ZQI A;  8ICT A;  1TV9 A;  7ICS A;  3JZ0 A;  1XSP A;  1TVA A;  5HRI A;  5HRL A;  4NKU A;  4FHY A;  5IIO A;  4EED A;  5DDY A;  5HRH A;  4X0A A;  5CHG A;  3WFS C;  4K4I A;  5CFT A;  1ZQG A;  4WC3 A;  4YN4 A;  2BCU A;  1WOT A;  2BPG A;  4LEW A;  8ICP A;  2ZHA A;  4LEY A;  4QZH A;  4IG8 A;  1TFY A;  3WFO A;  2W9M A;  1YLQ A;  4FO1 A;  4M9L A;  1ZQM A;  4OAI Z;  5III A;  1RZT A;  1R8B A;  4Z6E A;  2Q66 A;  3OUY A;  3K75 D;  4K9A A;  2BBJ A;  1OU5 A;  4K8V A;  4O68 A;  3JPT A;  3MBY A;  1ZQF A;  4O5C A;  4AT8 B;  4KLU A;  4NXT A;  4O5K A;  1ZJN A;  1ZQJ A;  4UBB A;  8ICK A;  3ER9 B;  5J0W A;  3JPN A;  4MFA A;  4MFF A;  4N7R A;  4GXK A;  4FH3 A;  3RH4 A;  4EGW A;  5BOL A;  1GPJ A;  1HUZ A;  4LEZ A;  1ZQZ A;  4HX0 A;  1Q79 A;  4I2F A;  3K7D A;  5J0Y A;  4KLM A;  2B56 A;  9ICB A;  4I28 A;  4F5P A;  4YCX A;  5HHH A;  4I2J A;  4LZG A;  4R63 A;  4E8F A;  1BPD A;  7ICI A;  4X4V A;  5CB1 A;  4M2Y A;  5B3Q A; 
#chains in the Genus database with same CATH homology
 1JMS A;  2ZH2 A;  2BCR A;  5J0Q A;  4RQ7 A;  1ZQD A;  1KEJ A;  5J29 A;  7ICL A;  4AT9 B;  4P4P A;  4YMM A;  4NY8 A;  4NKT A;  7ICE A;  5DDM A;  8ICM A;  1ZQY A;  4M47 A;  9ICA A;  5DB7 A;  9ICQ A;  4X4O A;  3RJE A;  4X4Q A;  4RPY A;  4FHP A;  3H37 A;  1RPL A;  5J2E A;  9ICR A;  4QZD A;  5CWR A;  4NM1 A;  4I2H A;  3MDC A;  7ICT A;  1ZQU A;  4E7X A;  1ZQQ A;  2PFN A;  1R8C A;  4ATB A;  4EBJ A;  5DBC A;  9ICL A;  2ZH3 A;  3B0Y A;  5IIJ A;  5D49 A;  7ICN A;  5HRG A;  5J0S A;  1MQ3 A;  3OVA A;  4YMN A;  1HUO A;  4M9J A;  5HHI A;  4TUS A;  1KNY A;  3UPS A;  4QZG A;  1PX5 A;  3WFQ E;  7ICQ A;  4AT7 B;  3ISD A;  1F5A A;  4RT2 A;  2DRB A;  3MGH A;  4KLF A;  3HIY A;  4RQ0 A;  8ICX A;  7ICO A;  4NLK A;  4X4U A;  9ICC A;  2PBE A;  4KLT A;  5HRF A;  4NLN A;  5CR0 A;  8ICA A;  2BCV A;  8ICS A;  2ISO A;  2DR5 A;  8ICN A;  9ICU A;  2M2U A;  4M9H A;  8ICZ A;  4E80 A;  1VJ7 A;  1ZQV A;  3AQK A;  4NLZ A;  9ICH A;  4GXI A;  5J0P A;  2ID1 A;  1ZQT A;  4PHP A;  4M9G A;  4PPX A;  3HW8 A;  4UB4 A;  4I29 A;  4PHA A;  4QZE A;  4RQ2 A;  8ICV A;  3V7J A;  2ZH4 A;  4IQU A;  5CJ7 A;  4F5R A;  7ICU A;  8ICH A;  1XSL A;  1ZQX A;  4M0A A;  4RQ8 A;  4UB2 A;  2DR7 A;  3UQ0 A;  3AQM A;  4FHV A;  1R8A A;  4XUS A;  4RT3 A;  9ICN A;  1ZQN A;  4UBC A;  3L9D A;  4LZD A;  9ICS A;  3RJG A;  3C2K A;  4WC1 A;  5HRE A;  1ZQS A;  1XSN A;  4MFC A;  4M04 A;  2ISP A;  1UEV A;  2BPC A;  8ICQ A;  4EP7 A;  5DKW A;  4UB5 A;  7ICG A;  4KLQ A;  7ICV A;  2BE3 A;  2P66 A;  1R89 A;  4P4M A;  4M9N A;  5DED A;  4JWN A;  1UET A;  4PH5 A;  4R66 A;  4M5D A;  7ICF A;  4IQW A;  4KLL A;  9ICX A;  4MF8 A;  3C2M A;  4F5O A;  2IHM A;  1UEU A;  4XRH A;  4WC4 A;  4JWM A;  3AUO A;  8ICL A;  5J2A A;  4NM2 A;  4TUR A;  5J2C A;  5DEC A;  4XA5 A;  4X0B A;  4PHD A;  4X4P A;  3WFR E;  9ICP A;  4KLI A;  8ICE A;  3HX0 A;  1ZQA A;  4F5N A;  5DB9 A;  4RPX A;  4O9M A;  3OGU A;  4AT7 A;  4RQ3 A;  4KLG A;  3C5F A;  3LK9 A;  3ISB A;  4RWP A;  3HJ1 A;  4YMO A;  4X5V A;  4I2G A;  1JN3 A;  3WFP A;  1ZJM A;  4WBY A;  1ZQO A;  3PNC A;  5IIM A;  5J0U A;  3RJK A;  8ICI A;  1BPZ A;  5HC9 A;  3JPO A;  5J2B A;  4R65 A;  3MGI A;  4WC2 A;  3UXP A;  2ZHB A;  9ICT A;  9ICI A;  3HJ4 A;  3RH5 A;  1FA0 A;  3PML A;  4P4O A;  4QZC A;  3RH6 A;  3AU2 A;  3AU6 A;  3OVB A;  4RQ6 A;  1BPX A;  9ICF A;  4RQ1 A;  4PGY A;  4UAW A;  3UPQ A;  4WC5 A;  4Z6F A;  5J0O A;  8ICY A;  8ICF A;  4UB3 A;  4RQ4 A;  7ICH A;  4ATB B;  3H38 A;  3GDX A;  3H3A A;  3JPQ A;  4QZI A;  5CA7 A;  5D4B A;  3TFR A;  5IIN A;  5IIK A;  1ZQE A;  3UQ2 A;  3MDA A;  7ICM A;  3B0X A;  1ZQC A;  1ZQB A;  4UB1 A;  4UAY A;  1MIY A;  5HRK A;  3AQN A;  1BPE A;  4FO6 A;  3C66 A;  9ICO A;  2VAN A;  8ICB A;  4UD5 A;  4AT8 A;  4PGX A;  3V7L A;  3C2L A;  5DB8 A;  4NXZ A;  4PGQ A;  4RWO A;  3ISC A;  4XQ8 A;  5HRB A;  2ZH8 A;  5F2V O;  1BPB A;  1TFW A;  3RJI A;  9ICM A;  4R64 A;  4I2C A;  5D46 A;  5DB6 A;  4I2E A;  4WBZ A;  3TFS A;  1ZQK A;  8ICC A;  2M2V A;  3RJF A;  2BCS A;  1KDH A;  2DVI A;  4DOB A;  4X4R A;  4DOC A;  3H39 A;  4Z6D A;  3NYB A;  4TUQ A;  4X4N A;  4KLE A;  2DR8 A;  4WC0 A;  4I2B A;  4FHX A;  2BPF A;  4QZ8 A;  4AT9 A;  2DR9 A;  4UD4 A;  3OVS A;  4XQ7 A;  8ICU A;  4RWQ A;  4LT6 A;  1VFG A;  9ICG A;  9ICW A;  4TUP A;  2BCQ A;  4F5Q A;  3C18 A;  9ICK A;  2ZH9 A;  3JPR A;  4DO9 A;  4LVS A;  8ICO A;  5DBB A;  2DRA A;  3JPP A;  3OUY B;  4RPZ A;  4QZF A;  7ICP A;  4RQ5 A;  4YD1 A;  4WC7 A;  5BOM A;  3RJJ A;  2FMP A;  4X4S A;  4I2D A;  5J2I A;  3UXN A;  1NO5 A;  4FHW A;  4P2H A;  4I2A A;  3LQC B;  5EOZ A;  3HWT A;  5J2F A;  5J0R A;  1ZQH A;  1NOM A;  1BPY A;  2PFP A;  4KLO A;  3UXO A;  3JPS A;  4I2I A;  2O1P A;  9ICV A;  4S3N A;  1ZQP A;  5J2D A;  5J2H A;  4GXJ A;  4DOA A;  4RWN A;  2ZH6 A;  1ZQR A;  3JYY A;  5BPC A;  2M2W A;  4K4G A;  9ICJ A;  3C5G A;  1V4A A;  4QZB A;  7ICK A;  8ICG A;  3RJH A;  2ZH1 A;  2I9G A;  4FH5 A;  4EBK A;  4IQT A;  1MIW A;  5IIL A;  5J2J A;  8ICW A;  4KLS A;  3AQL A;  4KLJ A;  4I27 A;  1Q78 A;  4WC6 A;  5J0T A;  2PXI A;  1JAJ A;  3V72 A;  2RFF A;  5TZV A;  4MF2 A;  3OV7 A;  5CP2 A;  1MQ2 A;  1ZQL A;  4QZA A;  1JQR A;  4UAZ A;  5DBA A;  4K4H A;  2M2T A;  4WCW A;  3V7K A;  2ZH5 A;  7ICR A;  4X4T A;  4YD2 A;  5J2K A;  8ICR A;  1MIV A;  2ZH7 A;  8ICJ A;  3PMN A;  2PFQ A;  4O5E A;  4KLH A;  2NRK A;  2PFO A;  2HHP A;  4IQV A;  9ICE A;  5HR9 A;  5J2G A;  7ICJ A;  2GWS A;  4Z6C A;  1ZQW A;  5HRD A;  2O5A A;  4QZ9 A;  5J0X A;  4KLD A;  4PHE A;  2FMQ A;  2FMS A;  1ZQI A;  8ICT A;  1TV9 A;  7ICS A;  3JZ0 A;  1XSP A;  1TVA A;  5HRI A;  5HRL A;  4NKU A;  4FHY A;  5IIO A;  5DDY A;  5HRH A;  4X0A A;  5CHG A;  3WFS C;  4K4I A;  1ZQG A;  4WC3 A;  4YN4 A;  2BCU A;  1WOT A;  2BPG A;  8ICP A;  2ZHA A;  4IG8 A;  4QZH A;  1TFY A;  3WFO A;  2W9M A;  1YLQ A;  4M9L A;  1ZQM A;  5III A;  1RZT A;  1R8B A;  4Z6E A;  2Q66 A;  3OUY A;  3K75 D;  1OU5 A;  3JPT A;  3MBY A;  1ZQF A;  4O5C A;  4AT8 B;  4KLU A;  4O5K A;  1ZJN A;  1ZQJ A;  4UBB A;  8ICK A;  5J0W A;  3JPN A;  4MFA A;  4MFF A;  4GXK A;  4FH3 A;  3RH4 A;  5BOL A;  1HUZ A;  1ZQZ A;  1Q79 A;  4I2F A;  5J0Y A;  4KLM A;  9ICB A;  4I28 A;  4F5P A;  4YCX A;  5HHH A;  4I2J A;  4LZG A;  4R63 A;  4E8F A;  1BPD A;  7ICI A;  4X4V A;  5CB1 A;  4M2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...