4WC1A

Structure of trna-processing enzyme with ctp
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
382
structure length
364
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARREPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKELGERIEELKREIMNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase
total genus 114
structure length 364
sequence length 382
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc1A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc1A01
5J2BA 3RJJA 9ICFA 4X5VA 4RQ6A 4K4IA 8ICMA 7ICOA 3C2MA 3HIYA 4KLHA 3C2LA 5J2KA 4AT7B 4FH3A 4XQ8A 5J2IA 2BPCA 4WCWA 4WC7A 3OUYB 4I2AA 2PBEA 3ISBA 4M47A 5BPCA 3MGHA 9ICWA 5HHHA 3HJ1A 4X4TA 1Q78A 4QZBA 9ICMA 1ZQGA 2PXIA 7ICHA 4GXKA 4NLNA 5HRHA 2ZH2A 5HRKA 1VFGA 1ZQEA 3RH4A 7ICUA 9ICXA 1ZQAA 3WFPA 1JAJA 1R8BA 9ICVA 5DBBA 3RH5A 5HRIA 4I2DA 4KLQA 1ZQSA 9ICSA 8ICIA 2ZHBA 1TVAA 4UB3A 1ZQLA 4I2EA 4KLUA 9ICPA 1UEUA 3WFSC 4FHWA 4X4OA 5J0QA 1WOTA 4QZ8A 1ZQHA 1ZQJA 8ICCA 4O5CA 4F5RA 3V7JA 3AUOA 4TURA 4FHYA 3PMNA 4E8FA 5DBAA 4RQ7A 1NO5A 5CR0A 5IIMA 4RQ4A 1ZQOA 3K75D 1ZQDA 4QZIA 2BE3A 4IQVA 3ISDA 4QZ9A 4M9GA 7ICFA 9ICGA 5BOMA 5BOLA 4UB1A 4QZAA 5DDYA 9ICOA 4LZGA 4TUSA 3OVAA 5HR9A 4RWPA 5J0RA 1TFYA 5HRBA 1ZQVA 9ICLA 3UPSA 4ATBA 1ZJMA 2P66A 7ICRA 4F5QA 2FMSA 4WC1A 5D49A 7ICJA 7ICEA 3OGUA 4X4UA 3RH6A 2BCUA 2ZH6A 4RT2A 4R65A 4EBJA 4NXZA 3HW8A 4KLDA 1MQ3A 4YD2A 2DR7A 4UD5A 3AQNA 4KLIA 1UETA 1ZQFA 5J2DA 9ICBA 4UAYA 3OVSA 8ICBA 2ZH9A 4I2BA 4WC2A 1MIVA 2ZH1A 4PHAA 9ICCA 4YD1A 8ICVA 3TFSA 5J2HA 4R66A 4O9MA 5J0SA 4RQ2A 5HREA 4KLOA 3JYYA 4X4SA 4YMOA 4AT9A 5J0TA 4UB4A 4I28A 4LT6A 4I2FA 4RWQA 4NKUA 1FA0A 3JPSA 9ICJA 3LK9A 3PNCA 3UXPA 1BPXA 4M2YA 4P2HA 3AQMA 4DOBA 8ICPA 4F5NA 2BCQA 1UEVA 4PGYA 1ZJNA 5HRLA 4FHPA 2M2TA 8ICXA 1BPBA 4I2IA 1MIYA 4F5OA 5J2GA 3OV7A 3H3AA 7ICKA 2PFOA 5DECA 4P4OA 9ICEA 4R63A 1KNYA 1ZQXA 4FHVA 2BCSA 1ZQCA 1R8CA 5DB6A 4GXIA 4UB5A 8ICJA 1ZQZA 4M9NA 2PFQA 3B0XA 4DO9A 4MF8A 4PGXA 5F2VO 3MDCA 4GXJA 4WC6A 4RQ1A 7ICIA 8ICQA 4UAWA 4PGQA 4X4VA 8ICLA 3JPRA 9ICQA 5CHGA 3V7KA 5CB1A 8ICNA 3RJKA 4Z6CA 4QZEA 2ZH7A 3WFRE 5HRGA 5J0XA 1ZQQA 1KDHA 1VJ7A 4ATBB 8ICGA 3UXOA 3JZ0A 1ZQRA 8ICUA 4I2CA 4YCXA 8ICAA 4IQWA 5J2FA 4XUSA 4RPYA 5D46A 2DRBA 3UPQA 4TUQA 4Z6EA 1F5AA 3RJHA 4NKTA 3RJFA 5HRFA 5IIOA 1OU5A 4X4RA 2DR5A 4RT3A 1MQ2A 1XSPA 3C2KA 4IQTA 4AT8A 5TZVA 2ID1A 4K4HA 5J0YA 3H39A 2BPFA 4QZGA 1BPYA 5J0UA 5J2AA 3B0YA 4WBZA 4R64A 4M0AA 4E7XA 1JN3A 1ZQWA 4AT9B 3RJGA 4I2GA 2BCVA 4XQ7A 4I2HA 7ICMA 5DKWA 4I27A 5HHIA 4IG8A 3HWTA 4X4QA 4UD4A 1ZQYA 3H37A 4S3NA 4PH5A 4RQ5A 4NLZA 4RQ3A 2M2UA 9ICRA 4WC0A 5DB8A 3C18A 5DEDA 1MIWA 3AQKA 4F5PA 4WC4A 4YN4A 8ICOA 4M5DA 4RPZA 3AU2A 4XA5A 4WC3A 4JWNA 9ICIA 4EP7A 5J2JA 4KLTA 4FHXA 5HRDA 3UXNA 8ICEA 4EBKA 1NOMA 5IIKA 1HUOA 1BPEA 8ICZA 1ZQNA 4M9LA 3HJ4A 5J0WA 5DBCA 3AU6A 4Z6DA 1V4AA 4IQUA 1JQRA 2BPGA 9ICAA 5HC9A 4XRHA 2ISPA 4YMMA 4Z6FA 4KLLA 3MDAA 1XSLA 8ICKA 4FH5A 5J0OA 9ICUA 3JPPA 4RWNA 5CJ7A 1PX5A 7ICSA 1R89A 3LQCB 8ICWA 8ICRA 4I2JA 4M9JA 5DB9A 4X4PA 4PHEA 7ICLA 2IHMA 3C5GA 5DDMA 2ZHAA 3C66A 4MFCA 9ICKA 7ICGA 4M04A 3MGIA 2RFFA 2ZH8A 1ZQKA 2PFNA 5CWRA 8ICSA 4P4PA 3PMLA 3GDXA 1TFWA 4UAZA 1ZQBA 4X0BA 4KLFA 8ICHA 2FMPA 1YLQA 8ICTA 4NLKA 4O5KA 3OVBA 5D4BA 4LVSA 4O5EA 4MFFA 1Q79A 5CA7A 3C5FA 2M2VA 4X0AA 4AT8B 3V72A 1ZQPA 4M9HA 2NRKA 5J2EA 2O1PA 5EOZA 4PHPA 2O5AA 3NYBA 4JWMA 4KLEA 4AT7A 4UB2A 9ICNA 4KLMA 4QZDA 1ZQMA 2W9MA 4TUPA 3JPTA 4DOCA 4WC5A 3V7LA 4KLSA 1KEJA 5J29A 3OUYA 4YMNA 4UBBA 3H38A 2VANA 3TFRA 2DRAA 4MFAA 5IIJA 4QZCA 2BCRA 1R8AA 3L9DA 4QZHA 4PHDA 4UBCA 7ICTA 3JPQA 5IILA 9ICTA 2GWSA 7ICVA 2ZH5A 5J2CA 4RPXA 3MBYA 4NM1A 3JPNA 2HHPA 1ZQUA 1BPZA 4WBYA 3RJIA 5J0PA 4NM2A 3WFQE 4RQ0A 3UQ0A 4X4NA 2ISOA 4LZDA 3WFOA 4E80A 2I9GA 7ICPA 3HX0A 2ZH3A 4RQ8A 1HUZA 1ZQTA 4NY8A 4KLJA 2M2WA 4DOAA 3UQ2A 8ICFA 4RWOA 1TV9A 5DB7A 4MF2A 9ICHA 7ICNA 3AQLA 4QZFA 5IINA 4PPXA 4KLGA 3ISCA 3JPOA 4K4GA 1ZQIA 2Q66A 4I29A 2DVIA 8ICYA 5CP2A 4P4MA 4FO6A 5IIIA 2FMQA 2PFPA 3RJEA 1RPLA 2DR8A 1XSNA 1RZTA 1JMSA 2DR9A 2ZH4A 1BPDA 7ICQA
chains in the Genus database with same CATH superfamily
5J2BA 3RJJA 4WQKA 9ICFA 4X5VA 4RQ6A 4K4IA 8ICMA 7ICOA 3C2MA 3HIYA 4KLHA 3C2LA 5J2KA 4AT7B 4FH3A 3JCFA 4XQ8A 5J2IA 2BPCA 4WCWA 4WC7A 2BBJA 3OUYB 4I2AA 2PBEA 3ISBA 4M47A 5BPCA 3MGHA 9ICWA 5HHHA 3HJ1A 4X4TA 1Q78A 4QZBA 9ICMA 1ZQGA 2PXIA 7ICHA 4GXKA 4NLNA 4OAGA 5HRHA 2ZH2A 4K9BA 5HRKA 1VFGA 1ZQEA 3RH4A 7ICUA 3NWIA 9ICXA 1ZQAA 3WFPA 1JAJA 1R8BA 3ER8C 9ICVA 4EEBA 5DBBA 3RH5A 3K7DA 5HRIA 4I2DA 4KLQA 1ZQSA 9ICSA 8ICIA 2ZHBA 1TVAA 4LEVA 4UB3A 1ZQLA 4I2EA 4KLUA 9ICPA 1UEUA 3WFSC 4FHWA 4X4OA 5CFSA 5J0QA 4O67A 1WOTA 4QZ8A 1ZQHA 1ZQJA 8ICCA 5D61A 4O5CA 4O6AA 4F5RA 3V7JA 4EV6A 3AUOA 4TURA 4FHYA 3PMNA 4E8FA 4LEZA 4KM5A 5DBAA 4RQ7A 1NO5A 5CR0A 5IIMA 4RQ4A 4HX0A 1ZQOA 3K75D 1ZQDA 4QZIA 2BE3A 4IQVA 3ISDA 4QZ9A 4M9GA 7ICFA 4EGWA 9ICGA 5BOMA 5BOLA 4UB1A 4QZAA 5DDYA 9ICOA 4LZGA 4TUSA 3OVAA 5HR9A 4RWPA 5J0RA 1TFYA 5HRBA 1ZQVA 9ICLA 3UPSA 4ATBA 1ZJMA 2P66A 7ICRA 4F5QA 2FMSA 4WC1A 5D49A 7ICJA 3ERCC 3OGUA 7ICEA 4X4UA 3RH6A 2BCUA 2ZH6A 4RT2A 4R65A 4EBJA 4NXZA 3HW8A 4KLDA 1MQ3A 4NXXA 4YD2A 2DR7A 4NXVA 4O68A 4UD5A 3AQNA 4KLIA 1UETA 1ZQFA 5J2DA 9ICBA 2GA9D 4UAYA 3OVSA 8ICBA 2ZH9A 4I2BA 4WC2A 1MIVA 2ZH1A 4PHAA 9ICCA 4YD1A 5CFTA 3TFSA 8ICVA 5J2HA 4R66A 4O9MA 5J0SA 4RQ2A 5HREA 4KLOA 3JYYA 4X4SA 4YMOA 4AT9A 5J0TA 5CHEA 4UB4A 4I28A 4LT6A 4I2FA 4RWQA 4NKUA 1FA0A 3JPSA 9ICJA 4I0UA 3LK9A 3PNCA 3UXPA 1BPXA 4M2YA 4P2HA 3AQMA 4DOBA 8ICPA 4F5NA 2BCQA 1UEVA 4PGYA 1ZJNA 5HRLA 4FHPA 2M2TA 8ICXA 1BPBA 4N7RA 4K98A 4I2IA 2B4VA 2IHOA 5B3QA 1MIYA 4WQLA 4F5OA 5J2GA 3OV7A 3H3AA 7ICKA 2PFOA 5DECA 4P4OA 9ICEA 4R63A 1KNYA 1ZQXA 4FHVA 2BCSA 1ZQCA 1R8CA 5DB6A 4GXIA 4UB5A 8ICJA 1ZQZA 4M9NA 2PFQA 3B0XA 4DO9A 4MF8A 4PGXA 5F2VO 3MDCA 4GXJA 4WC6A 4RQ1A 7ICIA 8ICQA 4UAWA 4PGQA 4X4VA 8ICLA 3JPRA 9ICQA 5CHGA 4NXUA 5B3PA 4OAIZ 3V7KA 5CB1A 8ICNA 2BBHA 3RJKA 4Z6CA 4QZEA 2ZH7A 3WFRE 5HRGA 5J0XA 1ZQQA 1KDHA 1VJ7A 4ATBB 8ICGA 3UXOA 3JZ0A 1ZQRA 8ICUA 4I2CA 4YCXA 8ICAA 4IQWA 5J2FA 4XUSA 4RPYA 5D46A 2DRBA 3UPQA 4TUQA 4Z6EA 1F5AA 3RJHA 4NKTA 3RJFA 5HRFA 5IIOA 1OU5A 4X4RA 2DR5A 4RT3A 1MQ2A 1XSPA 3C2KA 4IQTA 4AT8A 5D63A 5TZVA 2ID1A 4K4HA 5J0YA 3H39A 2BPFA 4QZGA 1BPYA 5J0UA 5J2AA 4WBZA 3B0YA 4R64A 4M0AA 4E7XA 1JN3A 1ZQWA 4AT9B 3RJGA 4I2GA 2BCVA 4XQ7A 4I2HA 7ICMA 5DKWA 2HN2A 5HHIA 4I27A 4IG8A 3HWTA 4X4QA 4UD4A 1ZQYA 3H37A 2B56A 4S3NA 4PH5A 4RQ5A 4NLZA 5CFUA 4RQ3A 2M2UA 4JLZA 9ICRA 4WC0A 5DB8A 3C18A 5DEDA 1MIWA 2B51A 3AQKA 4F5PA 4WC4A 4YN4A 8ICOA 4M5DA 4RPZA 3AU2A 4XA5A 4WC3A 4JWNA 9ICIA 4EP7A 5J2JA 4KLTA 4FHXA 2GAFD 5HRDA 3UXNA 8ICEA 4EBKA 1NOMA 5IIKA 1HUOA 1BPEA 8ICZA 1ZQNA 4M9LA 3HJ4A 5J0WA 5DBCA 3AU6A 4Z6DA 1V4AA 4IQUA 1JQRA 4MKPA 2BPGA 9ICAA 5HC9A 4XRHA 2ISPA 4YMMA 4Z6FA 4KLLA 3MDAA 1XSLA 8ICKA 4FH5A 5J0OA 9ICUA 4NXTA 3JPPA 4RWNA 5CJ7A 1PX5A 7ICSA 1R89A 3LQCB 8ICWA 8ICRA 4I2JA 4M9JA 5DB9A 4X4PA 4PHEA 4OAFA 7ICLA 4LEWA 2IHMA 3C5GA 5DDMA 2ZHAA 3C66A 4MFCA 9ICKA 7ICGA 4M04A 3OWGA 3MGIA 2RFFA 2ZH8A 1ZQKA 2PFNA 5CWRA 8ICSA 4P4PA 3PMLA 3GDXA 1TFWA 4UAZA 1ZQBA 4X0BA 4KLFA 8ICHA 2FMPA 1YLQA 8ICTA 4NLKA 1GPJA 4O5KA 5D4BA 3OVBA 4LVSA 3PHZA 4MFFA 4O5EA 1Q79A 5CA7A 3C5FA 2M2VA 4LEYA 4X0AA 4AT8B 3V72A 1ZQPA 4M9HA 3CK6A 2NRKA 5J2EA 2O1PA 5EOZA 4PHPA 2O5AA 3NVOA 3NYBA 4JWMA 4KLEA 4AT7A 4O69A 4UB2A 9ICNA 2EWRA 4KLMA 5JTGA 4QZDA 1ZQMA 2W9MA 4TUPA 3JPTA 4K96A 4WC5A 2IUBA 3V7LA 4DOCA 1KEJA 4KLSA 5J29A 3OUYA 4YMNA 4UBBA 3H38A 2VANA 4OAHA 3TFRA 2DRAA 4K9AA 4MFAA 5IIJA 4QZCA 2BCRA 1R8AA 3L9DA 4QZHA 4PHDA 4UBCA 7ICTA 3JPQA 5IILA 9ICTA 2GWSA 4NXWA 7ICVA 2ZH5A 5J2CA 5D62A 4RPXA 3MBYA 4NM1A 3JPNA 2HHPA 1ZQUA 1BPZA 4WBYA 4K99A 3RJIA 5J0PA 4NM2A 3WFQE 4RQ0A 3UQ0A 4X4NA 2ISOA 4LZDA 3WFOA 4E80A 2I9GA 2HN1A 2FCLA 7ICPA 3HX0A 2ZH3A 4RQ8A 4WH5A 4K8VA 1HUZA 1ZQTA 4NY8A 4KLJA 2M2WA 4DOAA 3UQ2A 8ICFA 3NKUA 4RWOA 1TV9A 4FO1A 5DB7A 4WOYA 3ER9B 4MF2A 9ICHA 7ICNA 3AQLA 4QZFA 5IINA 4PPXA 4KLGA 3ISCA 3JPOA 4K4GA 1ZQIA 2Q66A 3EF2A 4I29A 2DVIA 4XJEA 8ICYA 5CP2A 4EEDA 4P4MA 4FO6A 5IIIA 4K97A 2FMQA 4JLXA 2PFPA 3RJEA 1RPLA 2DR8A 1XSNA 1RZTA 1JMSA 4KB6A 3MCRA 2DR9A 2ZH4A 1BPDA 7ICQA
chains in the Genus database with same CATH topology
5J2BA 3RJJA 9ICFA 4X5VA 4RQ6A 4K4IA 8ICMA 7ICOA 3C2MA 3HIYA 4KLHA 3C2LA 5J2KA 4AT7B 4FH3A 4XQ8A 5J2IA 2BPCA 4WCWA 4WC7A 3OUYB 4I2AA 2PBEA 3ISBA 4M47A 5BPCA 3MGHA 9ICWA 5HHHA 3HJ1A 4X4TA 1Q78A 4QZBA 9ICMA 1ZQGA 2PXIA 7ICHA 4GXKA 4NLNA 5HRHA 2ZH2A 5HRKA 1VFGA 1ZQEA 3RH4A 7ICUA 9ICXA 1ZQAA 3WFPA 1JAJA 1R8BA 9ICVA 5DBBA 3RH5A 5HRIA 4I2DA 4KLQA 1ZQSA 9ICSA 8ICIA 2ZHBA 1TVAA 4UB3A 1ZQLA 4I2EA 4KLUA 9ICPA 1UEUA 3WFSC 4FHWA 4X4OA 5J0QA 1WOTA 4QZ8A 1ZQHA 1ZQJA 8ICCA 4O5CA 4F5RA 3V7JA 3AUOA 4TURA 4FHYA 3PMNA 4E8FA 5DBAA 4RQ7A 1NO5A 5CR0A 5IIMA 4RQ4A 1ZQOA 3K75D 1ZQDA 4QZIA 2BE3A 4IQVA 3ISDA 4QZ9A 4M9GA 7ICFA 9ICGA 5BOMA 5BOLA 4UB1A 4QZAA 5DDYA 9ICOA 4LZGA 4TUSA 3OVAA 5HR9A 4RWPA 5J0RA 1TFYA 5HRBA 1ZQVA 9ICLA 3UPSA 4ATBA 1ZJMA 2P66A 7ICRA 4F5QA 2FMSA 4WC1A 5D49A 7ICJA 7ICEA 3OGUA 4X4UA 3RH6A 2BCUA 2ZH6A 4RT2A 4R65A 4EBJA 4NXZA 3HW8A 4KLDA 1MQ3A 4YD2A 2DR7A 4UD5A 3AQNA 4KLIA 1UETA 1ZQFA 5J2DA 9ICBA 4UAYA 3OVSA 8ICBA 2ZH9A 4I2BA 4WC2A 1MIVA 2ZH1A 4PHAA 9ICCA 4YD1A 8ICVA 3TFSA 5J2HA 4R66A 4O9MA 5J0SA 4RQ2A 5HREA 4KLOA 3JYYA 4X4SA 4YMOA 4AT9A 5J0TA 4UB4A 4I28A 4LT6A 4I2FA 4RWQA 4NKUA 1FA0A 3JPSA 9ICJA 3LK9A 3PNCA 3UXPA 1BPXA 4M2YA 4P2HA 3AQMA 4DOBA 8ICPA 4F5NA 2BCQA 1UEVA 4PGYA 1ZJNA 5HRLA 4FHPA 2M2TA 8ICXA 1BPBA 4I2IA 1MIYA 4F5OA 5J2GA 3OV7A 3H3AA 7ICKA 2PFOA 5DECA 4P4OA 9ICEA 4R63A 1KNYA 1ZQXA 4FHVA 2BCSA 1ZQCA 1R8CA 5DB6A 4GXIA 4UB5A 8ICJA 1ZQZA 4M9NA 2PFQA 3B0XA 4DO9A 4MF8A 4PGXA 5F2VO 3MDCA 4GXJA 4WC6A 4RQ1A 7ICIA 8ICQA 4UAWA 4PGQA 4X4VA 8ICLA 3JPRA 9ICQA 5CHGA 3V7KA 5CB1A 8ICNA 3RJKA 4Z6CA 4QZEA 2ZH7A 3WFRE 5HRGA 5J0XA 1ZQQA 1KDHA 1VJ7A 4ATBB 8ICGA 3UXOA 3JZ0A 1ZQRA 8ICUA 4I2CA 4YCXA 8ICAA 4IQWA 5J2FA 4XUSA 4RPYA 5D46A 2DRBA 3UPQA 4TUQA 4Z6EA 1F5AA 3RJHA 4NKTA 3RJFA 5HRFA 5IIOA 1OU5A 4X4RA 2DR5A 4RT3A 1MQ2A 1XSPA 3C2KA 4IQTA 4AT8A 5TZVA 2ID1A 4K4HA 5J0YA 3H39A 2BPFA 4QZGA 1BPYA 5J0UA 5J2AA 3B0YA 4WBZA 4R64A 4M0AA 4E7XA 1JN3A 1ZQWA 4AT9B 3RJGA 4I2GA 2BCVA 4XQ7A 4I2HA 7ICMA 5DKWA 4I27A 5HHIA 4IG8A 3HWTA 4X4QA 4UD4A 1ZQYA 3H37A 4S3NA 4PH5A 4RQ5A 4NLZA 4RQ3A 2M2UA 9ICRA 4WC0A 5DB8A 3C18A 5DEDA 1MIWA 3AQKA 4F5PA 4WC4A 4YN4A 8ICOA 4M5DA 4RPZA 3AU2A 4XA5A 4WC3A 4JWNA 9ICIA 4EP7A 5J2JA 4KLTA 4FHXA 5HRDA 3UXNA 8ICEA 4EBKA 1NOMA 5IIKA 1HUOA 1BPEA 8ICZA 1ZQNA 4M9LA 3HJ4A 5J0WA 5DBCA 3AU6A 4Z6DA 1V4AA 4IQUA 1JQRA 2BPGA 9ICAA 5HC9A 4XRHA 2ISPA 4YMMA 4Z6FA 4KLLA 3MDAA 1XSLA 8ICKA 4FH5A 5J0OA 9ICUA 3JPPA 4RWNA 5CJ7A 1PX5A 7ICSA 1R89A 3LQCB 8ICWA 8ICRA 4I2JA 4M9JA 5DB9A 4X4PA 4PHEA 7ICLA 2IHMA 3C5GA 5DDMA 2ZHAA 3C66A 4MFCA 9ICKA 7ICGA 4M04A 3MGIA 2RFFA 2ZH8A 1ZQKA 2PFNA 5CWRA 8ICSA 4P4PA 3PMLA 3GDXA 1TFWA 4UAZA 1ZQBA 4X0BA 4KLFA 8ICHA 2FMPA 1YLQA 8ICTA 4NLKA 4O5KA 3OVBA 5D4BA 4LVSA 4O5EA 4MFFA 1Q79A 5CA7A 3C5FA 2M2VA 4X0AA 4AT8B 3V72A 1ZQPA 4M9HA 2NRKA 5J2EA 2O1PA 5EOZA 4PHPA 2O5AA 3NYBA 4JWMA 4KLEA 4AT7A 4UB2A 9ICNA 4KLMA 4QZDA 1ZQMA 2W9MA 4TUPA 3JPTA 4DOCA 4WC5A 3V7LA 4KLSA 1KEJA 5J29A 3OUYA 4YMNA 4UBBA 3H38A 2VANA 3TFRA 2DRAA 4MFAA 5IIJA 4QZCA 2BCRA 1R8AA 3L9DA 4QZHA 4PHDA 4UBCA 7ICTA 3JPQA 5IILA 9ICTA 2GWSA 7ICVA 2ZH5A 5J2CA 4RPXA 3MBYA 4NM1A 3JPNA 2HHPA 1ZQUA 1BPZA 4WBYA 3RJIA 5J0PA 4NM2A 3WFQE 4RQ0A 3UQ0A 4X4NA 2ISOA 4LZDA 3WFOA 4E80A 2I9GA 7ICPA 3HX0A 2ZH3A 4RQ8A 1HUZA 1ZQTA 4NY8A 4KLJA 2M2WA 4DOAA 3UQ2A 8ICFA 4RWOA 1TV9A 5DB7A 4MF2A 9ICHA 7ICNA 3AQLA 4QZFA 5IINA 4PPXA 4KLGA 3ISCA 3JPOA 4K4GA 1ZQIA 2Q66A 4I29A 2DVIA 8ICYA 5CP2A 4P4MA 4FO6A 5IIIA 2FMQA 2PFPA 3RJEA 1RPLA 2DR8A 1XSNA 1RZTA 1JMSA 2DR9A 2ZH4A 1BPDA 7ICQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2B A;  3RJJ A;  9ICF A;  4X5V A;  4RQ6 A;  4K4I A;  8ICM A;  7ICO A;  3C2M A;  3HIY A;  4KLH A;  3C2L A;  5J2K A;  4AT7 B;  4FH3 A;  4XQ8 A;  5J2I A;  2BPC A;  4WCW A;  4WC7 A;  3OUY B;  4I2A A;  2PBE A;  3ISB A;  4M47 A;  5BPC A;  3MGH A;  9ICW A;  5HHH A;  3HJ1 A;  4X4T A;  1Q78 A;  4QZB A;  9ICM A;  1ZQG A;  2PXI A;  7ICH A;  4GXK A;  4NLN A;  5HRH A;  2ZH2 A;  5HRK A;  1VFG A;  1ZQE A;  3RH4 A;  7ICU A;  9ICX A;  1ZQA A;  3WFP A;  1JAJ A;  1R8B A;  9ICV A;  5DBB A;  3RH5 A;  5HRI A;  4I2D A;  4KLQ A;  1ZQS A;  9ICS A;  8ICI A;  2ZHB A;  1TVA A;  4UB3 A;  1ZQL A;  4I2E A;  4KLU A;  9ICP A;  1UEU A;  3WFS C;  4FHW A;  4X4O A;  5J0Q A;  1WOT A;  4QZ8 A;  1ZQH A;  1ZQJ A;  8ICC A;  4O5C A;  4F5R A;  3V7J A;  3AUO A;  4TUR A;  4FHY A;  3PMN A;  4E8F A;  5DBA A;  4RQ7 A;  1NO5 A;  5CR0 A;  5IIM A;  4RQ4 A;  1ZQO A;  3K75 D;  1ZQD A;  4QZI A;  2BE3 A;  4IQV A;  3ISD A;  4QZ9 A;  4M9G A;  7ICF A;  9ICG A;  5BOM A;  5BOL A;  4UB1 A;  4QZA A;  5DDY A;  9ICO A;  4LZG A;  4TUS A;  3OVA A;  5HR9 A;  4RWP A;  5J0R A;  1TFY A;  5HRB A;  1ZQV A;  9ICL A;  3UPS A;  4ATB A;  1ZJM A;  2P66 A;  7ICR A;  4F5Q A;  2FMS A;  4WC1 A;  5D49 A;  7ICJ A;  7ICE A;  3OGU A;  4X4U A;  3RH6 A;  2BCU A;  2ZH6 A;  4RT2 A;  4R65 A;  4EBJ A;  4NXZ A;  3HW8 A;  4KLD A;  1MQ3 A;  4YD2 A;  2DR7 A;  4UD5 A;  3AQN A;  4KLI A;  1UET A;  1ZQF A;  5J2D A;  9ICB A;  4UAY A;  3OVS A;  8ICB A;  2ZH9 A;  4I2B A;  4WC2 A;  1MIV A;  2ZH1 A;  4PHA A;  9ICC A;  4YD1 A;  8ICV A;  3TFS A;  5J2H A;  4R66 A;  4O9M A;  5J0S A;  4RQ2 A;  5HRE A;  4KLO A;  3JYY A;  4X4S A;  4YMO A;  4AT9 A;  5J0T A;  4UB4 A;  4I28 A;  4LT6 A;  4I2F A;  4RWQ A;  4NKU A;  1FA0 A;  3JPS A;  9ICJ A;  3LK9 A;  3PNC A;  3UXP A;  1BPX A;  4M2Y A;  4P2H A;  3AQM A;  4DOB A;  8ICP A;  4F5N A;  2BCQ A;  1UEV A;  4PGY A;  1ZJN A;  5HRL A;  4FHP A;  2M2T A;  8ICX A;  1BPB A;  4I2I A;  1MIY A;  4F5O A;  5J2G A;  3OV7 A;  3H3A A;  7ICK A;  2PFO A;  5DEC A;  4P4O A;  9ICE A;  4R63 A;  1KNY A;  1ZQX A;  4FHV A;  2BCS A;  1ZQC A;  1R8C A;  5DB6 A;  4GXI A;  4UB5 A;  8ICJ A;  1ZQZ A;  4M9N A;  2PFQ A;  3B0X A;  4DO9 A;  4MF8 A;  4PGX A;  5F2V O;  3MDC A;  4GXJ A;  4WC6 A;  4RQ1 A;  7ICI A;  8ICQ A;  4UAW A;  4PGQ A;  4X4V A;  8ICL A;  3JPR A;  9ICQ A;  5CHG A;  3V7K A;  5CB1 A;  8ICN A;  3RJK A;  4Z6C A;  4QZE A;  2ZH7 A;  3WFR E;  5HRG A;  5J0X A;  1ZQQ A;  1KDH A;  1VJ7 A;  4ATB B;  8ICG A;  3UXO A;  3JZ0 A;  1ZQR A;  8ICU A;  4I2C A;  4YCX A;  8ICA A;  4IQW A;  5J2F A;  4XUS A;  4RPY A;  5D46 A;  2DRB A;  3UPQ A;  4TUQ A;  4Z6E A;  1F5A A;  3RJH A;  4NKT A;  3RJF A;  5HRF A;  5IIO A;  1OU5 A;  4X4R A;  2DR5 A;  4RT3 A;  1MQ2 A;  1XSP A;  3C2K A;  4IQT A;  4AT8 A;  5TZV A;  2ID1 A;  4K4H A;  5J0Y A;  3H39 A;  2BPF A;  4QZG A;  1BPY A;  5J0U A;  5J2A A;  3B0Y A;  4WBZ A;  4R64 A;  4M0A A;  4E7X A;  1JN3 A;  1ZQW A;  4AT9 B;  3RJG A;  4I2G A;  2BCV A;  4XQ7 A;  4I2H A;  7ICM A;  5DKW A;  4I27 A;  5HHI A;  4IG8 A;  3HWT A;  4X4Q A;  4UD4 A;  1ZQY A;  3H37 A;  4S3N A;  4PH5 A;  4RQ5 A;  4NLZ A;  4RQ3 A;  2M2U A;  9ICR A;  4WC0 A;  5DB8 A;  3C18 A;  5DED A;  1MIW A;  3AQK A;  4F5P A;  4WC4 A;  4YN4 A;  8ICO A;  4M5D A;  4RPZ A;  3AU2 A;  4XA5 A;  4WC3 A;  4JWN A;  9ICI A;  4EP7 A;  5J2J A;  4KLT A;  4FHX A;  5HRD A;  3UXN A;  8ICE A;  4EBK A;  1NOM A;  5IIK A;  1HUO A;  1BPE A;  8ICZ A;  1ZQN A;  4M9L A;  3HJ4 A;  5J0W A;  5DBC A;  3AU6 A;  4Z6D A;  1V4A A;  4IQU A;  1JQR A;  2BPG A;  9ICA A;  5HC9 A;  4XRH A;  2ISP A;  4YMM A;  4Z6F A;  4KLL A;  3MDA A;  1XSL A;  8ICK A;  4FH5 A;  5J0O A;  9ICU A;  3JPP A;  4RWN A;  5CJ7 A;  1PX5 A;  7ICS A;  1R89 A;  3LQC B;  8ICW A;  8ICR A;  4I2J A;  4M9J A;  5DB9 A;  4X4P A;  4PHE A;  7ICL A;  2IHM A;  3C5G A;  5DDM A;  2ZHA A;  3C66 A;  4MFC A;  9ICK A;  7ICG A;  4M04 A;  3MGI A;  2RFF A;  2ZH8 A;  1ZQK A;  2PFN A;  5CWR A;  8ICS A;  4P4P A;  3PML A;  3GDX A;  1TFW A;  4UAZ A;  1ZQB A;  4X0B A;  4KLF A;  8ICH A;  2FMP A;  1YLQ A;  8ICT A;  4NLK A;  4O5K A;  3OVB A;  5D4B A;  4LVS A;  4O5E A;  4MFF A;  1Q79 A;  5CA7 A;  3C5F A;  2M2V A;  4X0A A;  4AT8 B;  3V72 A;  1ZQP A;  4M9H A;  2NRK A;  5J2E A;  2O1P A;  5EOZ A;  4PHP A;  2O5A A;  3NYB A;  4JWM A;  4KLE A;  4AT7 A;  4UB2 A;  9ICN A;  4KLM A;  4QZD A;  1ZQM A;  2W9M A;  4TUP A;  3JPT A;  4DOC A;  4WC5 A;  3V7L A;  4KLS A;  1KEJ A;  5J29 A;  3OUY A;  4YMN A;  4UBB A;  3H38 A;  2VAN A;  3TFR A;  2DRA A;  4MFA A;  5IIJ A;  4QZC A;  2BCR A;  1R8A A;  3L9D A;  4QZH A;  4PHD A;  4UBC A;  7ICT A;  3JPQ A;  5IIL A;  9ICT A;  2GWS A;  7ICV A;  2ZH5 A;  5J2C A;  4RPX A;  3MBY A;  4NM1 A;  3JPN A;  2HHP A;  1ZQU A;  1BPZ A;  4WBY A;  3RJI A;  5J0P A;  4NM2 A;  3WFQ E;  4RQ0 A;  3UQ0 A;  4X4N A;  2ISO A;  4LZD A;  3WFO A;  4E80 A;  2I9G A;  7ICP A;  3HX0 A;  2ZH3 A;  4RQ8 A;  1HUZ A;  1ZQT A;  4NY8 A;  4KLJ A;  2M2W A;  4DOA A;  3UQ2 A;  8ICF A;  4RWO A;  1TV9 A;  5DB7 A;  4MF2 A;  9ICH A;  7ICN A;  3AQL A;  4QZF A;  5IIN A;  4PPX A;  4KLG A;  3ISC A;  3JPO A;  4K4G A;  1ZQI A;  2Q66 A;  4I29 A;  2DVI A;  8ICY A;  5CP2 A;  4P4M A;  4FO6 A;  5III A;  2FMQ A;  2PFP A;  3RJE A;  1RPL A;  2DR8 A;  1XSN A;  1RZT A;  1JMS A;  2DR9 A;  2ZH4 A;  1BPD A;  7ICQ A; 
#chains in the Genus database with same CATH topology
 5J2B A;  3RJJ A;  4WQK A;  9ICF A;  4X5V A;  4RQ6 A;  4K4I A;  8ICM A;  7ICO A;  3C2M A;  3HIY A;  4KLH A;  3C2L A;  5J2K A;  4AT7 B;  4FH3 A;  3JCF A;  4XQ8 A;  5J2I A;  2BPC A;  4WCW A;  4WC7 A;  2BBJ A;  3OUY B;  4I2A A;  2PBE A;  3ISB A;  4M47 A;  5BPC A;  3MGH A;  9ICW A;  5HHH A;  3HJ1 A;  4X4T A;  1Q78 A;  4QZB A;  9ICM A;  1ZQG A;  2PXI A;  7ICH A;  4GXK A;  4NLN A;  4OAG A;  5HRH A;  2ZH2 A;  4K9B A;  5HRK A;  1VFG A;  1ZQE A;  3RH4 A;  7ICU A;  3NWI A;  9ICX A;  1ZQA A;  3WFP A;  1JAJ A;  1R8B A;  3ER8 C;  9ICV A;  4EEB A;  5DBB A;  3RH5 A;  3K7D A;  5HRI A;  4I2D A;  4KLQ A;  1ZQS A;  9ICS A;  8ICI A;  2ZHB A;  1TVA A;  4LEV A;  4UB3 A;  1ZQL A;  4I2E A;  4KLU A;  9ICP A;  1UEU A;  3WFS C;  4FHW A;  4X4O A;  5CFS A;  5J0Q A;  4O67 A;  1WOT A;  4QZ8 A;  1ZQH A;  1ZQJ A;  8ICC A;  5D61 A;  4O5C A;  4O6A A;  4F5R A;  3V7J A;  4EV6 A;  3AUO A;  4TUR A;  4FHY A;  3PMN A;  4E8F A;  4LEZ A;  4KM5 A;  5DBA A;  4RQ7 A;  1NO5 A;  5CR0 A;  5IIM A;  4RQ4 A;  4HX0 A;  1ZQO A;  3K75 D;  1ZQD A;  4QZI A;  2BE3 A;  4IQV A;  3ISD A;  4QZ9 A;  4M9G A;  7ICF A;  4EGW A;  9ICG A;  5BOM A;  5BOL A;  4UB1 A;  4QZA A;  5DDY A;  9ICO A;  4LZG A;  4TUS A;  3OVA A;  5HR9 A;  4RWP A;  5J0R A;  1TFY A;  5HRB A;  1ZQV A;  9ICL A;  3UPS A;  4ATB A;  1ZJM A;  2P66 A;  7ICR A;  4F5Q A;  2FMS A;  4WC1 A;  5D49 A;  7ICJ A;  3ERC C;  3OGU A;  7ICE A;  4X4U A;  3RH6 A;  2BCU A;  2ZH6 A;  4RT2 A;  4R65 A;  4EBJ A;  4NXZ A;  3HW8 A;  4KLD A;  1MQ3 A;  4NXX A;  4YD2 A;  2DR7 A;  4NXV A;  4O68 A;  4UD5 A;  3AQN A;  4KLI A;  1UET A;  1ZQF A;  5J2D A;  9ICB A;  2GA9 D;  4UAY A;  3OVS A;  8ICB A;  2ZH9 A;  4I2B A;  4WC2 A;  1MIV A;  2ZH1 A;  4PHA A;  9ICC A;  4YD1 A;  5CFT A;  3TFS A;  8ICV A;  5J2H A;  4R66 A;  4O9M A;  5J0S A;  4RQ2 A;  5HRE A;  4KLO A;  3JYY A;  4X4S A;  4YMO A;  4AT9 A;  5J0T A;  5CHE A;  4UB4 A;  4I28 A;  4LT6 A;  4I2F A;  4RWQ A;  4NKU A;  1FA0 A;  3JPS A;  9ICJ A;  4I0U A;  3LK9 A;  3PNC A;  3UXP A;  1BPX A;  4M2Y A;  4P2H A;  3AQM A;  4DOB A;  8ICP A;  4F5N A;  2BCQ A;  1UEV A;  4PGY A;  1ZJN A;  5HRL A;  4FHP A;  2M2T A;  8ICX A;  1BPB A;  4N7R A;  4K98 A;  4I2I A;  2B4V A;  2IHO A;  5B3Q A;  1MIY A;  4WQL A;  4F5O A;  5J2G A;  3OV7 A;  3H3A A;  7ICK A;  2PFO A;  5DEC A;  4P4O A;  9ICE A;  4R63 A;  1KNY A;  1ZQX A;  4FHV A;  2BCS A;  1ZQC A;  1R8C A;  5DB6 A;  4GXI A;  4UB5 A;  8ICJ A;  1ZQZ A;  4M9N A;  2PFQ A;  3B0X A;  4DO9 A;  4MF8 A;  4PGX A;  5F2V O;  3MDC A;  4GXJ A;  4WC6 A;  4RQ1 A;  7ICI A;  8ICQ A;  4UAW A;  4PGQ A;  4X4V A;  8ICL A;  3JPR A;  9ICQ A;  5CHG A;  4NXU A;  5B3P A;  4OAI Z;  3V7K A;  5CB1 A;  8ICN A;  2BBH A;  3RJK A;  4Z6C A;  4QZE A;  2ZH7 A;  3WFR E;  5HRG A;  5J0X A;  1ZQQ A;  1KDH A;  1VJ7 A;  4ATB B;  8ICG A;  3UXO A;  3JZ0 A;  1ZQR A;  8ICU A;  4I2C A;  4YCX A;  8ICA A;  4IQW A;  5J2F A;  4XUS A;  4RPY A;  5D46 A;  2DRB A;  3UPQ A;  4TUQ A;  4Z6E A;  1F5A A;  3RJH A;  4NKT A;  3RJF A;  5HRF A;  5IIO A;  1OU5 A;  4X4R A;  2DR5 A;  4RT3 A;  1MQ2 A;  1XSP A;  3C2K A;  4IQT A;  4AT8 A;  5D63 A;  5TZV A;  2ID1 A;  4K4H A;  5J0Y A;  3H39 A;  2BPF A;  4QZG A;  1BPY A;  5J0U A;  5J2A A;  4WBZ A;  3B0Y A;  4R64 A;  4M0A A;  4E7X A;  1JN3 A;  1ZQW A;  4AT9 B;  3RJG A;  4I2G A;  2BCV A;  4XQ7 A;  4I2H A;  7ICM A;  5DKW A;  2HN2 A;  5HHI A;  4I27 A;  4IG8 A;  3HWT A;  4X4Q A;  4UD4 A;  1ZQY A;  3H37 A;  2B56 A;  4S3N A;  4PH5 A;  4RQ5 A;  4NLZ A;  5CFU A;  4RQ3 A;  2M2U A;  4JLZ A;  9ICR A;  4WC0 A;  5DB8 A;  3C18 A;  5DED A;  1MIW A;  2B51 A;  3AQK A;  4F5P A;  4WC4 A;  4YN4 A;  8ICO A;  4M5D A;  4RPZ A;  3AU2 A;  4XA5 A;  4WC3 A;  4JWN A;  9ICI A;  4EP7 A;  5J2J A;  4KLT A;  4FHX A;  2GAF D;  5HRD A;  3UXN A;  8ICE A;  4EBK A;  1NOM A;  5IIK A;  1HUO A;  1BPE A;  8ICZ A;  1ZQN A;  4M9L A;  3HJ4 A;  5J0W A;  5DBC A;  3AU6 A;  4Z6D A;  1V4A A;  4IQU A;  1JQR A;  4MKP A;  2BPG A;  9ICA A;  5HC9 A;  4XRH A;  2ISP A;  4YMM A;  4Z6F A;  4KLL A;  3MDA A;  1XSL A;  8ICK A;  4FH5 A;  5J0O A;  9ICU A;  4NXT A;  3JPP A;  4RWN A;  5CJ7 A;  1PX5 A;  7ICS A;  1R89 A;  3LQC B;  8ICW A;  8ICR A;  4I2J A;  4M9J A;  5DB9 A;  4X4P A;  4PHE A;  4OAF A;  7ICL A;  4LEW A;  2IHM A;  3C5G A;  5DDM A;  2ZHA A;  3C66 A;  4MFC A;  9ICK A;  7ICG A;  4M04 A;  3OWG A;  3MGI A;  2RFF A;  2ZH8 A;  1ZQK A;  2PFN A;  5CWR A;  8ICS A;  4P4P A;  3PML A;  3GDX A;  1TFW A;  4UAZ A;  1ZQB A;  4X0B A;  4KLF A;  8ICH A;  2FMP A;  1YLQ A;  8ICT A;  4NLK A;  1GPJ A;  4O5K A;  5D4B A;  3OVB A;  4LVS A;  3PHZ A;  4MFF A;  4O5E A;  1Q79 A;  5CA7 A;  3C5F A;  2M2V A;  4LEY A;  4X0A A;  4AT8 B;  3V72 A;  1ZQP A;  4M9H A;  3CK6 A;  2NRK A;  5J2E A;  2O1P A;  5EOZ A;  4PHP A;  2O5A A;  3NVO A;  3NYB A;  4JWM A;  4KLE A;  4AT7 A;  4O69 A;  4UB2 A;  9ICN A;  2EWR A;  4KLM A;  5JTG A;  4QZD A;  1ZQM A;  2W9M A;  4TUP A;  3JPT A;  4K96 A;  4WC5 A;  2IUB A;  3V7L A;  4DOC A;  1KEJ A;  4KLS A;  5J29 A;  3OUY A;  4YMN A;  4UBB A;  3H38 A;  2VAN A;  4OAH A;  3TFR A;  2DRA A;  4K9A A;  4MFA A;  5IIJ A;  4QZC A;  2BCR A;  1R8A A;  3L9D A;  4QZH A;  4PHD A;  4UBC A;  7ICT A;  3JPQ A;  5IIL A;  9ICT A;  2GWS A;  4NXW A;  7ICV A;  2ZH5 A;  5J2C A;  5D62 A;  4RPX A;  3MBY A;  4NM1 A;  3JPN A;  2HHP A;  1ZQU A;  1BPZ A;  4WBY A;  4K99 A;  3RJI A;  5J0P A;  4NM2 A;  3WFQ E;  4RQ0 A;  3UQ0 A;  4X4N A;  2ISO A;  4LZD A;  3WFO A;  4E80 A;  2I9G A;  2HN1 A;  2FCL A;  7ICP A;  3HX0 A;  2ZH3 A;  4RQ8 A;  4WH5 A;  4K8V A;  1HUZ A;  1ZQT A;  4NY8 A;  4KLJ A;  2M2W A;  4DOA A;  3UQ2 A;  8ICF A;  3NKU A;  4RWO A;  1TV9 A;  4FO1 A;  5DB7 A;  4WOY A;  3ER9 B;  4MF2 A;  9ICH A;  7ICN A;  3AQL A;  4QZF A;  5IIN A;  4PPX A;  4KLG A;  3ISC A;  3JPO A;  4K4G A;  1ZQI A;  2Q66 A;  3EF2 A;  4I29 A;  2DVI A;  4XJE A;  8ICY A;  5CP2 A;  4EED A;  4P4M A;  4FO6 A;  5III A;  4K97 A;  2FMQ A;  4JLX A;  2PFP A;  3RJE A;  1RPL A;  2DR8 A;  1XSN A;  1RZT A;  1JMS A;  4KB6 A;  3MCR A;  2DR9 A;  2ZH4 A;  1BPD A;  7ICQ A; 
#chains in the Genus database with same CATH homology
 5J2B A;  3RJJ A;  9ICF A;  4X5V A;  4RQ6 A;  4K4I A;  8ICM A;  7ICO A;  3C2M A;  3HIY A;  4KLH A;  3C2L A;  5J2K A;  4AT7 B;  4FH3 A;  4XQ8 A;  5J2I A;  2BPC A;  4WCW A;  4WC7 A;  3OUY B;  4I2A A;  2PBE A;  3ISB A;  4M47 A;  5BPC A;  3MGH A;  9ICW A;  5HHH A;  3HJ1 A;  4X4T A;  1Q78 A;  4QZB A;  9ICM A;  1ZQG A;  2PXI A;  7ICH A;  4GXK A;  4NLN A;  5HRH A;  2ZH2 A;  5HRK A;  1VFG A;  1ZQE A;  3RH4 A;  7ICU A;  9ICX A;  1ZQA A;  3WFP A;  1JAJ A;  1R8B A;  9ICV A;  5DBB A;  3RH5 A;  5HRI A;  4I2D A;  4KLQ A;  1ZQS A;  9ICS A;  8ICI A;  2ZHB A;  1TVA A;  4UB3 A;  1ZQL A;  4I2E A;  4KLU A;  9ICP A;  1UEU A;  3WFS C;  4FHW A;  4X4O A;  5J0Q A;  1WOT A;  4QZ8 A;  1ZQH A;  1ZQJ A;  8ICC A;  4O5C A;  4F5R A;  3V7J A;  3AUO A;  4TUR A;  4FHY A;  3PMN A;  4E8F A;  5DBA A;  4RQ7 A;  1NO5 A;  5CR0 A;  5IIM A;  4RQ4 A;  1ZQO A;  3K75 D;  1ZQD A;  4QZI A;  2BE3 A;  4IQV A;  3ISD A;  4QZ9 A;  4M9G A;  7ICF A;  9ICG A;  5BOM A;  5BOL A;  4UB1 A;  4QZA A;  5DDY A;  9ICO A;  4LZG A;  4TUS A;  3OVA A;  5HR9 A;  4RWP A;  5J0R A;  1TFY A;  5HRB A;  1ZQV A;  9ICL A;  3UPS A;  4ATB A;  1ZJM A;  2P66 A;  7ICR A;  4F5Q A;  2FMS A;  4WC1 A;  5D49 A;  7ICJ A;  7ICE A;  3OGU A;  4X4U A;  3RH6 A;  2BCU A;  2ZH6 A;  4RT2 A;  4R65 A;  4EBJ A;  4NXZ A;  3HW8 A;  4KLD A;  1MQ3 A;  4YD2 A;  2DR7 A;  4UD5 A;  3AQN A;  4KLI A;  1UET A;  1ZQF A;  5J2D A;  9ICB A;  4UAY A;  3OVS A;  8ICB A;  2ZH9 A;  4I2B A;  4WC2 A;  1MIV A;  2ZH1 A;  4PHA A;  9ICC A;  4YD1 A;  8ICV A;  3TFS A;  5J2H A;  4R66 A;  4O9M A;  5J0S A;  4RQ2 A;  5HRE A;  4KLO A;  3JYY A;  4X4S A;  4YMO A;  4AT9 A;  5J0T A;  4UB4 A;  4I28 A;  4LT6 A;  4I2F A;  4RWQ A;  4NKU A;  1FA0 A;  3JPS A;  9ICJ A;  3LK9 A;  3PNC A;  3UXP A;  1BPX A;  4M2Y A;  4P2H A;  3AQM A;  4DOB A;  8ICP A;  4F5N A;  2BCQ A;  1UEV A;  4PGY A;  1ZJN A;  5HRL A;  4FHP A;  2M2T A;  8ICX A;  1BPB A;  4I2I A;  1MIY A;  4F5O A;  5J2G A;  3OV7 A;  3H3A A;  7ICK A;  2PFO A;  5DEC A;  4P4O A;  9ICE A;  4R63 A;  1KNY A;  1ZQX A;  4FHV A;  2BCS A;  1ZQC A;  1R8C A;  5DB6 A;  4GXI A;  4UB5 A;  8ICJ A;  1ZQZ A;  4M9N A;  2PFQ A;  3B0X A;  4DO9 A;  4MF8 A;  4PGX A;  5F2V O;  3MDC A;  4GXJ A;  4WC6 A;  4RQ1 A;  7ICI A;  8ICQ A;  4UAW A;  4PGQ A;  4X4V A;  8ICL A;  3JPR A;  9ICQ A;  5CHG A;  3V7K A;  5CB1 A;  8ICN A;  3RJK A;  4Z6C A;  4QZE A;  2ZH7 A;  3WFR E;  5HRG A;  5J0X A;  1ZQQ A;  1KDH A;  1VJ7 A;  4ATB B;  8ICG A;  3UXO A;  3JZ0 A;  1ZQR A;  8ICU A;  4I2C A;  4YCX A;  8ICA A;  4IQW A;  5J2F A;  4XUS A;  4RPY A;  5D46 A;  2DRB A;  3UPQ A;  4TUQ A;  4Z6E A;  1F5A A;  3RJH A;  4NKT A;  3RJF A;  5HRF A;  5IIO A;  1OU5 A;  4X4R A;  2DR5 A;  4RT3 A;  1MQ2 A;  1XSP A;  3C2K A;  4IQT A;  4AT8 A;  5TZV A;  2ID1 A;  4K4H A;  5J0Y A;  3H39 A;  2BPF A;  4QZG A;  1BPY A;  5J0U A;  5J2A A;  3B0Y A;  4WBZ A;  4R64 A;  4M0A A;  4E7X A;  1JN3 A;  1ZQW A;  4AT9 B;  3RJG A;  4I2G A;  2BCV A;  4XQ7 A;  4I2H A;  7ICM A;  5DKW A;  4I27 A;  5HHI A;  4IG8 A;  3HWT A;  4X4Q A;  4UD4 A;  1ZQY A;  3H37 A;  4S3N A;  4PH5 A;  4RQ5 A;  4NLZ A;  4RQ3 A;  2M2U A;  9ICR A;  4WC0 A;  5DB8 A;  3C18 A;  5DED A;  1MIW A;  3AQK A;  4F5P A;  4WC4 A;  4YN4 A;  8ICO A;  4M5D A;  4RPZ A;  3AU2 A;  4XA5 A;  4WC3 A;  4JWN A;  9ICI A;  4EP7 A;  5J2J A;  4KLT A;  4FHX A;  5HRD A;  3UXN A;  8ICE A;  4EBK A;  1NOM A;  5IIK A;  1HUO A;  1BPE A;  8ICZ A;  1ZQN A;  4M9L A;  3HJ4 A;  5J0W A;  5DBC A;  3AU6 A;  4Z6D A;  1V4A A;  4IQU A;  1JQR A;  2BPG A;  9ICA A;  5HC9 A;  4XRH A;  2ISP A;  4YMM A;  4Z6F A;  4KLL A;  3MDA A;  1XSL A;  8ICK A;  4FH5 A;  5J0O A;  9ICU A;  3JPP A;  4RWN A;  5CJ7 A;  1PX5 A;  7ICS A;  1R89 A;  3LQC B;  8ICW A;  8ICR A;  4I2J A;  4M9J A;  5DB9 A;  4X4P A;  4PHE A;  7ICL A;  2IHM A;  3C5G A;  5DDM A;  2ZHA A;  3C66 A;  4MFC A;  9ICK A;  7ICG A;  4M04 A;  3MGI A;  2RFF A;  2ZH8 A;  1ZQK A;  2PFN A;  5CWR A;  8ICS A;  4P4P A;  3PML A;  3GDX A;  1TFW A;  4UAZ A;  1ZQB A;  4X0B A;  4KLF A;  8ICH A;  2FMP A;  1YLQ A;  8ICT A;  4NLK A;  4O5K A;  3OVB A;  5D4B A;  4LVS A;  4O5E A;  4MFF A;  1Q79 A;  5CA7 A;  3C5F A;  2M2V A;  4X0A A;  4AT8 B;  3V72 A;  1ZQP A;  4M9H A;  2NRK A;  5J2E A;  2O1P A;  5EOZ A;  4PHP A;  2O5A A;  3NYB A;  4JWM A;  4KLE A;  4AT7 A;  4UB2 A;  9ICN A;  4KLM A;  4QZD A;  1ZQM A;  2W9M A;  4TUP A;  3JPT A;  4DOC A;  4WC5 A;  3V7L A;  4KLS A;  1KEJ A;  5J29 A;  3OUY A;  4YMN A;  4UBB A;  3H38 A;  2VAN A;  3TFR A;  2DRA A;  4MFA A;  5IIJ A;  4QZC A;  2BCR A;  1R8A A;  3L9D A;  4QZH A;  4PHD A;  4UBC A;  7ICT A;  3JPQ A;  5IIL A;  9ICT A;  2GWS A;  7ICV A;  2ZH5 A;  5J2C A;  4RPX A;  3MBY A;  4NM1 A;  3JPN A;  2HHP A;  1ZQU A;  1BPZ A;  4WBY A;  3RJI A;  5J0P A;  4NM2 A;  3WFQ E;  4RQ0 A;  3UQ0 A;  4X4N A;  2ISO A;  4LZD A;  3WFO A;  4E80 A;  2I9G A;  7ICP A;  3HX0 A;  2ZH3 A;  4RQ8 A;  1HUZ A;  1ZQT A;  4NY8 A;  4KLJ A;  2M2W A;  4DOA A;  3UQ2 A;  8ICF A;  4RWO A;  1TV9 A;  5DB7 A;  4MF2 A;  9ICH A;  7ICN A;  3AQL A;  4QZF A;  5IIN A;  4PPX A;  4KLG A;  3ISC A;  3JPO A;  4K4G A;  1ZQI A;  2Q66 A;  4I29 A;  2DVI A;  8ICY A;  5CP2 A;  4P4M A;  4FO6 A;  5III A;  2FMQ A;  2PFP A;  3RJE A;  1RPL A;  2DR8 A;  1XSN A;  1RZT A;  1JMS A;  2DR9 A;  2ZH4 A;  1BPD A;  7ICQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...