5CFSA

Crystal structure of ant(2")-ia in complex with ampcpp and tobramycin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
DTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AAD(2''),Gentamicin 2''-nucleotidyltransferase,Gentamicin re
publication title Structural Analysis of the Tobramycin and Gentamicin Clinical Resistome Reveals Limitations for Next-generation Aminoglycoside Design.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/antibiotic
total genus 59
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cfsA00
4HX0A 5CFUA 5CFSA 4XJEA 4WQKA 5CFTA 4WQLA 4WH5A 4FO1A 2EWRA 2FCLA
chains in the Genus database with same CATH superfamily
2ZH8A 2M2UA 3HW8A 2BCSA 5HRIA 4XRHA 1ZQDA 1RPLA 4FHYA 4NKTA 5HRKA 4PGYA 3OUYA 8ICKA 5CWRA 4O5EA 3MCRA 2O1PA 4I2EA 2PFPA 4ATBA 3OVAA 3GDXA 3UQ2A 4AT9B 1MQ2A 1Q79A 1BPXA 4EEBA 4N7RA 4KLTA 4LEVA 2ZH3A 1ZQIA 1ZQRA 8ICOA 3ISBA 4M9HA 4AT8A 4EP7A 2DR5A 4R66A 2PFQA 5J2KA 4UB5A 3RH4A 4UB1A 3WFRE 5HRHA 2ZHAA 1WOTA 8ICGA 4OAFA 4HX0A 4YMMA 1VJ7A 3PMLA 4FHVA 4Z6FA 1TFYA 7ICJA 4KLMA 9ICHA 4NM1A 5D46A 4O6AA 3B0XA 4R63A 1ZQTA 2GAFD 9ICIA 4X4PA 3MGHA 1XSLA 4KLHA 3K75D 4PHAA 1ZQCA 2ZH9A 4S3NA 4F5OA 1BPBA 2ISPA 4LT6A 4E7XA 1MIVA 5DKWA 8ICLA 3C66A 3WFSC 4P4PA 1ZQZA 1ZQBA 3H39A 5D49A 4RQ6A 4M04A 5BOMA 3C2LA 3UXOA 1ZQGA 1BPYA 3MDCA 4WOYA 5J2IA 4O9MA 4RT2A 3C2MA 3MBYA 5CHGA 4IQTA 5J2EA 5IIJA 4NXZA 4OAGA 5CA7A 4JLZA 4QZCA 2BBJA 5DBBA 2BPFA 2FCLA 3RJEA 4QZ9A 4I2CA 4FH5A 4JLXA 4LEYA 1PX5A 4UAZA 1HUZA 1F5AA 4P4MA 3AQLA 8ICMA 4EBKA 4RPYA 4EBJA 4NXXA 1MIYA 4UAYA 3NYBA 4MFAA 3RJHA 4PHDA 4KLGA 4IQVA 4GXIA 1ZQQA 7ICNA 8ICWA 2DR8A 4K96A 3AU6A 7ICQA 2PFOA 4K9AA 4NLKA 2P66A 3JZ0A 4K9BA 5J2BA 1ZQUA 1ZQNA 5IIMA 3WFOA 4QZIA 4WC1A 3V7JA 2ZH4A 4E80A 4XJEA 1JQRA 1FA0A 2M2VA 4PHEA 4F5PA 7ICKA 4UD4A 4QZAA 4EEDA 5B3PA 1XSNA 9ICKA 4UAWA 5D4BA 2VANA 2BPGA 1UEVA 3OVBA 4PPXA 1JAJA 4RQ8A 8ICXA 5TZVA 3TFSA 1ZQPA 4RWQA 2GA9D 7ICIA 4EGWA 9ICTA 5J0XA 5J0UA 4DOAA 3LQCB 8ICVA 3WFQE 4WC7A 3HIYA 5B3QA 5DB8A 2HN2A 4P4OA 7ICHA 1ZQLA 4TURA 5CR0A 1JN3A 4UBCA 4RWPA 5DDYA 3OV7A 5CB1A 4K97A 3PNCA 1BPEA 3JPRA 4K4HA 1RZTA 3V7KA 5HHHA 5J0WA 1XSPA 4WC2A 5DB7A 3OUYB 1Q78A 7ICPA 5J2DA 3RH5A 3UQ0A 4KLFA 5J2CA 4GXKA 5CJ7A 3AQKA 1NOMA 2DRAA 4ATBB 4QZFA 4O5CA 3JPSA 8ICQA 4YMOA 3TFRA 1HUOA 9ICJA 4NXUA 4NXTA 8ICJA 4UBBA 4Z6CA 9ICCA 9ICUA 2FMPA 1NO5A 2B56A 5BPCA 4MF8A 3MGIA 1ZQJA 4O5KA 9ICWA 2PXIA 4AT8B 9ICRA 1ZQOA 4KB6A 2DR7A 4RT3A 4XQ8A 4M9NA 2BPCA 4WC6A 3ISDA 4LZDA 4X4UA 1R8CA 1BPZA 3H38A 4YMNA 5J0SA 4WBYA 4NLNA 4Z6DA 5J2AA 8ICBA 8ICTA 3HJ1A 2DVIA 4RQ7A 1KNYA 5CP2A 8ICFA 2O5AA 5HRFA 4F5RA 4DOBA 5IINA 9ICLA 3PMNA 2ZH2A 3RJIA 4I2HA 4LVSA 4DOCA 1KDHA 8ICNA 4KLQA 4F5QA 4YD2A 8ICZA 4GXJA 9ICVA 2ZH5A 4I2FA 4NXWA 3UXNA 3HX0A 4QZBA 4M0AA 5DECA 1ZQFA 4Z6EA 4KLJA 4AT7A 5CFSA 5IIKA 4KLSA 5J2JA 2B4VA 2ZH7A 4NM2A 4UB2A 5J2FA 3MDAA 3NWIA 7ICUA 1ZJMA 4XA5A 4FHPA 9ICSA 3JPQA 9ICFA 2BCQA 4E8FA 4MF2A 4KM5A 4YD1A 9ICGA 2PBEA 5HR9A 1UETA 1ZQSA 7ICGA 2M2TA 8ICRA 4WBZA 1KEJA 2ZHBA 3RH6A 1ZQMA 4I2BA 1V4AA 4KLDA 1TFWA 5J0OA 3JPOA 5HC9A 3C5GA 3AQMA 5HREA 3HJ4A 4QZGA 4WC0A 9ICEA 7ICSA 1MIWA 4OAHA 5HRLA 5DB9A 2DRBA 4NXVA 4JWMA 4K4IA 5D63A 5HRBA 4R64A 8ICAA 4X0BA 1ZQYA 4WQLA 1ZQHA 3NVOA 1R89A 1ZQEA 5J0YA 1VFGA 8ICIA 3H37A 5J2GA 1TV9A 2ISOA 3L9DA 7ICRA 3LK9A 2W9MA 4RPXA 2BCUA 1TVAA 3B0YA 3AQNA 1JMSA 4RPZA 4X4VA 7ICEA 3K7DA 3JCFA 3WFPA 4RQ5A 3OVSA 3ER9B 5DB6A 2I9GA 3RJJA 2IHOA 7ICTA 4TUPA 3JYYA 4AT9A 4TUSA 4XUSA 2ZH6A 4FHXA 9ICQA 5HRDA 4MFFA 9ICBA 4PH5A 2BCVA 4KLUA 3OWGA 4FO6A 1R8AA 5DBCA 8ICHA 5D62A 4K8VA 4KLOA 5DDMA 3AUOA 3JPNA 4KLIA 3C2KA 8ICYA 8ICPA 4WQKA 4EV6A 4LZGA 5D61A 4LEZA 4DO9A 3HWTA 4QZEA 3RJKA 5J0TA 5IIOA 4PGXA 7ICLA 4WH5A 4WCWA 4UD5A 1BPDA 2IUBA 3OGUA 3V7LA 4IG8A 3RJGA 4K98A 4I29A 4X4RA 3CK6A 4LEWA 4O67A 3AU2A 4RWNA 2DR9A 2FMSA 4NKUA 5BOLA 5CFUA 5HHIA 5F2VO 4I28A 4I2AA 2IHMA 4I0UA 1OU5A 4UB3A 3UPSA 4I2JA 4X4NA 4X4OA 4NY8A 4K99A 4X5VA 4RQ4A 2NRKA 5J0QA 1ZQXA 4IQWA 9ICPA 4MKPA 5J0RA 5HRGA 9ICNA 4I2IA 1GPJA 2GWSA 3C5FA 4PHPA 4JWNA 4M9LA 2ID1A 1ZQWA 2M2WA 4R65A 4I2GA 8ICUA 4X4TA 3JPPA 4PGQA 4KLEA 5J29A 4M5DA 5IIIA 4WC4A 2BCRA 4P2HA 3PHZA 8ICSA 4M2YA 4QZDA 2Q66A 9ICOA 4WC5A 2BE3A 3UPQA 4AT7B 4M9GA 5EOZA 9ICXA 2BBHA 1ZQAA 8ICCA 4O69A 5JTGA 2B51A 3V72A 7ICOA 3RJFA 2PFNA 4I27A 3NKUA 4M9JA 3JPTA 4XQ7A 4YCXA 2RFFA 2HN1A 1MQ3A 5CHEA 4WC3A 9ICAA 4QZ8A 5DBAA 7ICVA 4M47A 3ER8C 3C18A 4FO1A 9ICMA 4X4QA 3ISCA 5DEDA 1ZQKA 1YLQA 2ZH1A 7ICMA 4RQ2A 1UEUA 4YN4A 3ERCC 4OAIZ 4F5NA 1R8BA 1ZQVA 3EF2A 5J0PA 4X0AA 4QZHA 5IILA 1ZJNA 4X4SA 4FHWA 4IQUA 7ICFA 4NLZA 4RQ0A 4TUQA 4O68A 4UB4A 4MFCA 3UXPA 4I2DA 2HHPA 4K4GA 5CFTA 8ICEA 3H3AA 5J2HA 4KLLA 4RWOA 4RQ1A 4FH3A 2FMQA 2EWRA 4RQ3A
chains in the Genus database with same CATH topology
4OAGA 5D61A 3PHZA 4OAHA 4JLZA 2GAFD 4KB6A 2GA9D 4K9AA 4OAIZ 4WH5A 4NXVA 4K9BA 4K99A 3ERCC 2EWRA 2FCLA 5D63A 3EF2A 4LEZA 4K98A 4KM5A 4MKPA 4LEYA 4JLXA 4WQLA 5B3QA 1GPJA 4LEWA 3OWGA 4NXWA 4O69A 3MCRA 4NXUA 2B51A 4NXTA 4O67A 4O68A 3NKUA 4XJEA 5CFTA 5D62A 4NXXA 4WOYA 4K8VA 4K97A 2B56A 4OAFA 4HX0A 5CFUA 5CHEA 5CFSA 4WQKA 5B3PA 3K7DA 4N7RA 2B4VA 3ER9B 4LEVA 4FO1A 4K96A 3ER8C 4O6AA 2IHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HX0 A;  5CFU A;  5CFS A;  4XJE A;  4WQK A;  5CFT A;  4WQL A;  4WH5 A;  4FO1 A;  2EWR A;  2FCL A; 
#chains in the Genus database with same CATH topology
 2ZH8 A;  2M2U A;  3HW8 A;  2BCS A;  5HRI A;  4XRH A;  1ZQD A;  1RPL A;  4FHY A;  4NKT A;  5HRK A;  4PGY A;  3OUY A;  8ICK A;  5CWR A;  4O5E A;  3MCR A;  2O1P A;  4I2E A;  2PFP A;  4ATB A;  3OVA A;  3GDX A;  3UQ2 A;  4AT9 B;  1MQ2 A;  1Q79 A;  1BPX A;  4EEB A;  4N7R A;  4KLT A;  4LEV A;  2ZH3 A;  1ZQI A;  1ZQR A;  8ICO A;  3ISB A;  4M9H A;  4AT8 A;  4EP7 A;  2DR5 A;  4R66 A;  2PFQ A;  5J2K A;  4UB5 A;  3RH4 A;  4UB1 A;  3WFR E;  5HRH A;  2ZHA A;  1WOT A;  8ICG A;  4OAF A;  4HX0 A;  4YMM A;  1VJ7 A;  3PML A;  4FHV A;  4Z6F A;  1TFY A;  7ICJ A;  4KLM A;  9ICH A;  4NM1 A;  5D46 A;  4O6A A;  3B0X A;  4R63 A;  1ZQT A;  2GAF D;  9ICI A;  4X4P A;  3MGH A;  1XSL A;  4KLH A;  3K75 D;  4PHA A;  1ZQC A;  2ZH9 A;  4S3N A;  4F5O A;  1BPB A;  2ISP A;  4LT6 A;  4E7X A;  1MIV A;  5DKW A;  8ICL A;  3C66 A;  3WFS C;  4P4P A;  1ZQZ A;  1ZQB A;  3H39 A;  5D49 A;  4RQ6 A;  4M04 A;  5BOM A;  3C2L A;  3UXO A;  1ZQG A;  1BPY A;  3MDC A;  4WOY A;  5J2I A;  4O9M A;  4RT2 A;  3C2M A;  3MBY A;  5CHG A;  4IQT A;  5J2E A;  5IIJ A;  4NXZ A;  4OAG A;  5CA7 A;  4JLZ A;  4QZC A;  2BBJ A;  5DBB A;  2BPF A;  2FCL A;  3RJE A;  4QZ9 A;  4I2C A;  4FH5 A;  4JLX A;  4LEY A;  1PX5 A;  4UAZ A;  1HUZ A;  1F5A A;  4P4M A;  3AQL A;  8ICM A;  4EBK A;  4RPY A;  4EBJ A;  4NXX A;  1MIY A;  4UAY A;  3NYB A;  4MFA A;  3RJH A;  4PHD A;  4KLG A;  4IQV A;  4GXI A;  1ZQQ A;  7ICN A;  8ICW A;  2DR8 A;  4K96 A;  3AU6 A;  7ICQ A;  2PFO A;  4K9A A;  4NLK A;  2P66 A;  3JZ0 A;  4K9B A;  5J2B A;  1ZQU A;  1ZQN A;  5IIM A;  3WFO A;  4QZI A;  4WC1 A;  3V7J A;  2ZH4 A;  4E80 A;  4XJE A;  1JQR A;  1FA0 A;  2M2V A;  4PHE A;  4F5P A;  7ICK A;  4UD4 A;  4QZA A;  4EED A;  5B3P A;  1XSN A;  9ICK A;  4UAW A;  5D4B A;  2VAN A;  2BPG A;  1UEV A;  3OVB A;  4PPX A;  1JAJ A;  4RQ8 A;  8ICX A;  5TZV A;  3TFS A;  1ZQP A;  4RWQ A;  2GA9 D;  7ICI A;  4EGW A;  9ICT A;  5J0X A;  5J0U A;  4DOA A;  3LQC B;  8ICV A;  3WFQ E;  4WC7 A;  3HIY A;  5B3Q A;  5DB8 A;  2HN2 A;  4P4O A;  7ICH A;  1ZQL A;  4TUR A;  5CR0 A;  1JN3 A;  4UBC A;  4RWP A;  5DDY A;  3OV7 A;  5CB1 A;  4K97 A;  3PNC A;  1BPE A;  3JPR A;  4K4H A;  1RZT A;  3V7K A;  5HHH A;  5J0W A;  1XSP A;  4WC2 A;  5DB7 A;  3OUY B;  1Q78 A;  7ICP A;  5J2D A;  3RH5 A;  3UQ0 A;  4KLF A;  5J2C A;  4GXK A;  5CJ7 A;  3AQK A;  1NOM A;  2DRA A;  4ATB B;  4QZF A;  4O5C A;  3JPS A;  8ICQ A;  4YMO A;  3TFR A;  1HUO A;  9ICJ A;  4NXU A;  4NXT A;  8ICJ A;  4UBB A;  4Z6C A;  9ICC A;  9ICU A;  2FMP A;  1NO5 A;  2B56 A;  5BPC A;  4MF8 A;  3MGI A;  1ZQJ A;  4O5K A;  9ICW A;  2PXI A;  4AT8 B;  9ICR A;  1ZQO A;  4KB6 A;  2DR7 A;  4RT3 A;  4XQ8 A;  4M9N A;  2BPC A;  4WC6 A;  3ISD A;  4LZD A;  4X4U A;  1R8C A;  1BPZ A;  3H38 A;  4YMN A;  5J0S A;  4WBY A;  4NLN A;  4Z6D A;  5J2A A;  8ICB A;  8ICT A;  3HJ1 A;  2DVI A;  4RQ7 A;  1KNY A;  5CP2 A;  8ICF A;  2O5A A;  5HRF A;  4F5R A;  4DOB A;  5IIN A;  9ICL A;  3PMN A;  2ZH2 A;  3RJI A;  4I2H A;  4LVS A;  4DOC A;  1KDH A;  8ICN A;  4KLQ A;  4F5Q A;  4YD2 A;  8ICZ A;  4GXJ A;  9ICV A;  2ZH5 A;  4I2F A;  4NXW A;  3UXN A;  3HX0 A;  4QZB A;  4M0A A;  5DEC A;  1ZQF A;  4Z6E A;  4KLJ A;  4AT7 A;  5CFS A;  5IIK A;  4KLS A;  5J2J A;  2B4V A;  2ZH7 A;  4NM2 A;  4UB2 A;  5J2F A;  3MDA A;  3NWI A;  7ICU A;  1ZJM A;  4XA5 A;  4FHP A;  9ICS A;  3JPQ A;  9ICF A;  2BCQ A;  4E8F A;  4MF2 A;  4KM5 A;  4YD1 A;  9ICG A;  2PBE A;  5HR9 A;  1UET A;  1ZQS A;  7ICG A;  2M2T A;  8ICR A;  4WBZ A;  1KEJ A;  2ZHB A;  3RH6 A;  1ZQM A;  4I2B A;  1V4A A;  4KLD A;  1TFW A;  5J0O A;  3JPO A;  5HC9 A;  3C5G A;  3AQM A;  5HRE A;  3HJ4 A;  4QZG A;  4WC0 A;  9ICE A;  7ICS A;  1MIW A;  4OAH A;  5HRL A;  5DB9 A;  2DRB A;  4NXV A;  4JWM A;  4K4I A;  5D63 A;  5HRB A;  4R64 A;  8ICA A;  4X0B A;  1ZQY A;  4WQL A;  1ZQH A;  3NVO A;  1R89 A;  1ZQE A;  5J0Y A;  1VFG A;  8ICI A;  3H37 A;  5J2G A;  1TV9 A;  2ISO A;  3L9D A;  7ICR A;  3LK9 A;  2W9M A;  4RPX A;  2BCU A;  1TVA A;  3B0Y A;  3AQN A;  1JMS A;  4RPZ A;  4X4V A;  7ICE A;  3K7D A;  3JCF A;  3WFP A;  4RQ5 A;  3OVS A;  3ER9 B;  5DB6 A;  2I9G A;  3RJJ A;  2IHO A;  7ICT A;  4TUP A;  3JYY A;  4AT9 A;  4TUS A;  4XUS A;  2ZH6 A;  4FHX A;  9ICQ A;  5HRD A;  4MFF A;  9ICB A;  4PH5 A;  2BCV A;  4KLU A;  3OWG A;  4FO6 A;  1R8A A;  5DBC A;  8ICH A;  5D62 A;  4K8V A;  4KLO A;  5DDM A;  3AUO A;  3JPN A;  4KLI A;  3C2K A;  8ICY A;  8ICP A;  4WQK A;  4EV6 A;  4LZG A;  5D61 A;  4LEZ A;  4DO9 A;  3HWT A;  4QZE A;  3RJK A;  5J0T A;  5IIO A;  4PGX A;  7ICL A;  4WH5 A;  4WCW A;  4UD5 A;  1BPD A;  2IUB A;  3OGU A;  3V7L A;  4IG8 A;  3RJG A;  4K98 A;  4I29 A;  4X4R A;  3CK6 A;  4LEW A;  4O67 A;  3AU2 A;  4RWN A;  2DR9 A;  2FMS A;  4NKU A;  5BOL A;  5CFU A;  5HHI A;  5F2V O;  4I28 A;  4I2A A;  2IHM A;  4I0U A;  1OU5 A;  4UB3 A;  3UPS A;  4I2J A;  4X4N A;  4X4O A;  4NY8 A;  4K99 A;  4X5V A;  4RQ4 A;  2NRK A;  5J0Q A;  1ZQX A;  4IQW A;  9ICP A;  4MKP A;  5J0R A;  5HRG A;  9ICN A;  4I2I A;  1GPJ A;  2GWS A;  3C5F A;  4PHP A;  4JWN A;  4M9L A;  2ID1 A;  1ZQW A;  2M2W A;  4R65 A;  4I2G A;  8ICU A;  4X4T A;  3JPP A;  4PGQ A;  4KLE A;  5J29 A;  4M5D A;  5III A;  4WC4 A;  2BCR A;  4P2H A;  3PHZ A;  8ICS A;  4M2Y A;  4QZD A;  2Q66 A;  9ICO A;  4WC5 A;  2BE3 A;  3UPQ A;  4AT7 B;  4M9G A;  5EOZ A;  9ICX A;  2BBH A;  1ZQA A;  8ICC A;  4O69 A;  5JTG A;  2B51 A;  3V72 A;  7ICO A;  3RJF A;  2PFN A;  4I27 A;  3NKU A;  4M9J A;  3JPT A;  4XQ7 A;  4YCX A;  2RFF A;  2HN1 A;  1MQ3 A;  5CHE A;  4WC3 A;  9ICA A;  4QZ8 A;  5DBA A;  7ICV A;  4M47 A;  3ER8 C;  3C18 A;  4FO1 A;  9ICM A;  4X4Q A;  3ISC A;  5DED A;  1ZQK A;  1YLQ A;  2ZH1 A;  7ICM A;  4RQ2 A;  1UEU A;  4YN4 A;  3ERC C;  4OAI Z;  4F5N A;  1R8B A;  1ZQV A;  3EF2 A;  5J0P A;  4X0A A;  4QZH A;  5IIL A;  1ZJN A;  4X4S A;  4FHW A;  4IQU A;  7ICF A;  4NLZ A;  4RQ0 A;  4TUQ A;  4O68 A;  4UB4 A;  4MFC A;  3UXP A;  4I2D A;  2HHP A;  4K4G A;  5CFT A;  8ICE A;  3H3A A;  5J2H A;  4KLL A;  4RWO A;  4RQ1 A;  4FH3 A;  2FMQ A;  2EWR A;  4RQ3 A; 
#chains in the Genus database with same CATH homology
 4OAG A;  5D61 A;  3PHZ A;  4OAH A;  4JLZ A;  2GAF D;  4KB6 A;  2GA9 D;  4K9A A;  4OAI Z;  4WH5 A;  4NXV A;  4K9B A;  4K99 A;  3ERC C;  2EWR A;  2FCL A;  5D63 A;  3EF2 A;  4LEZ A;  4K98 A;  4KM5 A;  4MKP A;  4LEY A;  4JLX A;  4WQL A;  5B3Q A;  1GPJ A;  4LEW A;  3OWG A;  4NXW A;  4O69 A;  3MCR A;  4NXU A;  2B51 A;  4NXT A;  4O67 A;  4O68 A;  3NKU A;  4XJE A;  5CFT A;  5D62 A;  4NXX A;  4WOY A;  4K8V A;  4K97 A;  2B56 A;  4OAF A;  4HX0 A;  5CFU A;  5CHE A;  5CFS A;  4WQK A;  5B3P A;  3K7D A;  4N7R A;  2B4V A;  3ER9 B;  4LEV A;  4FO1 A;  4K96 A;  3ER8 C;  4O6A A;  2IHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...