5CFSA

Crystal structure of ant(2")-ia in complex with ampcpp and tobramycin
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
176
structure length
176
Chain Sequence
DTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords AAD(2''),Gentamicin 2''-nucleotidyltransferase,Gentamicin re
publication title Structural Analysis of the Tobramycin and Gentamicin Clinical Resistome Reveals Limitations for Next-generation Aminoglycoside Design.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 59
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cfsA00
2EWRA 4FO1A 4XJEA 5CFSA 4WQLA 5CFUA 4WQKA 2FCLA 4WH5A 4HX0A 5CFTA
chains in the Genus database with same CATH superfamily
9ICHA 4M9LA 1OU5A 5DBBA 1ZQDA 3MGHA 3ERCC 4YMNA 4FH5A 4M9HA 4F5QA 4LEWA 5J0SA 5BOMA 1MQ2A 1BPEA 3OVSA 3RH5A 7ICLA 5HRGA 5DEDA 3C66A 4O9MA 4FHXA 1ZQEA 4KLLA 3TFRA 3JYYA 4O68A 3RJKA 2FMQA 3RJGA 4M9GA 4X4OA 5D4BA 4X0BA 3JPQA 4PHEA 3RJHA 2M2TA 4RQ8A 3C18A 4LZDA 4MF8A 2VANA 5J2FA 4TUPA 4M2YA 7ICMA 4JWMA 4OAIZ 5HRIA 4RPZA 8ICFA 3H37A 3RH6A 4I2IA 9ICMA 8ICEA 3PHZA 4JLXA 4WC3A 1BPBA 4I2DA 1ZQKA 3JPOA 3ER9B 4WQKA 5CHEA 1ZQFA 8ICHA 3B0YA 1R8CA 3WFRE 4GXKA 5D49A 4WC7A 4M47A 4OAFA 2BPFA 3WFOA 4NLKA 4KLMA 4RQ1A 4LEYA 1TFWA 4OAGA 5J0QA 4X4SA 4EEDA 4P4MA 3RJEA 5CWRA 4I29A 4PGYA 9ICXA 2M2VA 5D61A 4E7XA 8ICTA 4I0UA 4I27A 4I2BA 3JPSA 1ZQMA 1ZQNA 4KLEA 3V72A 4EP7A 7ICNA 3AQKA 3OWGA 2DRAA 4R66A 4XA5A 9ICEA 2BPCA 4LEVA 2M2UA 2PFPA 4QZ9A 5BOLA 4K4HA 4M5DA 3AQNA 4Z6FA 4R65A 4UBBA 4EGWA 5IIMA 4F5NA 4P2HA 4DOBA 4KLIA 4FHWA 7ICEA 4RT2A 3OVAA 5J2KA 3V7KA 1RZTA 2BPGA 2PFQA 4PPXA 1JAJA 5D46A 4RQ0A 5J29A 2W9MA 4WC5A 4DOAA 5IIIA 4AT9B 3MGIA 5J0WA 4JWNA 3JPNA 3AUOA 2I9GA 5J0RA 3CK6A 4X4QA 1ZQYA 5DB9A 4NXWA 3NWIA 8ICMA 8ICNA 3EF2A 2EWRA 2ZH1A 2IUBA 5HRFA 3OGUA 8ICLA 1ZQIA 8ICWA 4EBJA 8ICSA 4FHPA 2O1PA 5HHIA 5HRDA 4X4PA 4RQ6A 2FMSA 8ICQA 4KLTA 4WC4A 4FHVA 3NYBA 3K7DA 1Q79A 9ICQA 4O69A 5J2HA 1R8BA 1TV9A 4QZFA 3AQMA 3OUYB 1ZQSA 8ICAA 3L9DA 4RPXA 4WCWA 4K99A 9ICBA 5J0XA 5DDYA 4KLFA 5J2DA 4WC2A 2M2WA 4QZGA 4ATBA 4PGQA 5CP2A 2DR9A 3OUYA 5DDMA 4KLSA 7ICOA 4NXUA 4EBKA 7ICPA 4KM5A 5HRLA 4IQTA 4TURA 4IQUA 4TUQA 4FO1A 9ICPA 2FMPA 4WQLA 5DKWA 2DVIA 3OV7A 4MFAA 1ZQAA 4YD2A 1JN3A 4YN4A 4O67A 1ZQOA 4M9NA 4UAYA 4X0AA 4I2AA 3NKUA 1ZJMA 9ICCA 2Q66A 7ICRA 2P66A 3C2LA 1F5AA 4IQWA 3NVOA 3AQLA 5J2CA 3JCFA 5CFSA 3RJJA 4FO6A 3JPRA 5DBAA 1UETA 8ICUA 2HN1A 4O5EA 4O6AA 4YMOA 2BCQA 3PMLA 4KLUA 2IHOA 4EV6A 4XUSA 9ICAA 8ICOA 7ICGA 4X4TA 7ICQA 2DRBA 3JZ0A 4MKPA 3HJ1A 2BCUA 2ZHAA 3UXPA 8ICCA 1NO5A 5HRBA 3JPTA 2BCVA 4Z6EA 4DO9A 4X5VA 1ZQGA 4Z6DA 4K9BA 5HHHA 5D62A 5J0PA 2HHPA 2ISOA 8ICYA 4F5OA 2ZHBA 2HN2A 8ICIA 3ER8C 4K8VA 2ZH5A 1UEVA 5D63A 3PNCA 1ZQJA 3WFQE 1R89A 2ZH2A 3C2MA 2ISPA 1V4AA 4I2CA 7ICVA 1MQ3A 9ICOA 3RJIA 5DB7A 3V7LA 4I2GA 2DR5A 3AU2A 1ZQWA 3LK9A 4I2JA 4F5PA 1TFYA 2DR7A 2PFNA 1Q78A 2ZH6A 2ZH7A 4I2HA 4AT8B 4XRHA 1ZQCA 4K97A 4RWQA 4NM1A 4K9AA 8ICRA 5CJ7A 2PFOA 5CHGA 4AT8A 1HUOA 4LVSA 1TVAA 9ICIA 4FH3A 2BBJA 7ICIA 3LQCB 5HRHA 3RH4A 1GPJA 1VFGA 5HR9A 1ZQTA 3WFSC 3H38A 3HIYA 7ICFA 1BPYA 4M0AA 1HUZA 4F5RA 4UBCA 9ICWA 5IINA 5J0UA 1ZQPA 4PHPA 2BE3A 2BBHA 9ICNA 2NRKA 4ATBB 4UB5A 5J2IA 4X4VA 4KLJA 3PMNA 7ICSA 4UB1A 4I2EA 3V7JA 4NXTA 3RJFA 5CR0A 4MFCA 4WC6A 3UXNA 4YCXA 1YLQA 2PBEA 4NXXA 5B3QA 4PH5A 9ICGA 4GXJA 3MDAA 4WBYA 4QZEA 4I28A 3WFPA 4X4RA 5CB1A 4K98A 3C5GA 4UB2A 3ISDA 4X4UA 4KB6A 7ICUA 1XSNA 1MIVA 5IIKA 1ZQHA 3MDCA 3UXOA 5HREA 3B0XA 2GA9D 4NY8A 5DECA 8ICVA 4QZ8A 4E80A 5J2GA 5HC9A 8ICGA 2GAFD 8ICZA 2IHMA 4KLGA 4FHYA 5HRKA 4GXIA 3HX0A 1ZQBA 4R64A 5J0YA 4PHDA 1ZQLA 4RQ5A 1BPDA 4QZAA 4QZBA 4KLOA 1MIYA 1PX5A 3ISCA 7ICKA 2GWSA 4WH5A 4K4IA 4TUSA 4UAWA 4KLQA 3UPSA 1ZQXA 1FA0A 4E8FA 4RWPA 8ICXA 5CFUA 4NXZA 4K4GA 4M9JA 4RQ2A 4AT7B 4K96A 3GDXA 2ZH4A 8ICJA 5BPCA 2O5AA 9ICTA 3MBYA 4AT7A 4EEBA 4M04A 1MIWA 1WOTA 4RQ3A 1XSLA 4LZGA 4UAZA 4YD1A 1BPZA 5B3PA 4RT3A 4NXVA 4UD5A 4QZIA 5CFTA 2ID1A 2RFFA 4NM2A 3ISBA 3UPQA 2DR8A 4NKUA 1XSPA 7ICTA 4QZHA 4MF2A 9ICJA 2BCSA 5J0OA 1KNYA 9ICKA 1JMSA 9ICLA 4IG8A 4MFFA 2ZH9A 9ICUA 5IILA 4N7RA 5J0TA 4UB3A 4RWOA 3MCRA 8ICKA 4UD4A 5J2AA 4RPYA 2B56A 3H39A 4DOCA 1KDHA 4X4NA 5CA7A 4WC1A 9ICRA 4O5KA 4QZCA 7ICJA 9ICSA 4UB4A 5J2JA 3C5FA 4LEZA 4HX0A 1UEUA 1VJ7A 3AU6A 4RQ4A 4NLZA 4P4OA 5IIJA 2PXIA 9ICVA 5DBCA 4S3NA 4IQVA 5IIOA 4RWNA 4PGXA 2B4VA 1R8AA 4JLZA 4WBZA 3UQ2A 1ZQRA 9ICFA 3TFSA 5DB8A 4PHAA 3H3AA 1ZQUA 5TZVA 3K75D 5EOZA 4YMMA 4P4PA 3C2KA 4XQ7A 4NKTA 1JQRA 4KLHA 2ZH3A 4NLNA 4O5CA 4LT6A 4KLDA 3JPPA 4Z6CA 3HWTA 8ICBA 4WOYA 5J2BA 1ZQVA 1KEJA 5JTGA 4OAHA 2FCLA 1ZJNA 2B51A 4AT9A 8ICPA 4WC0A 3HW8A 3OVBA 4R63A 5DB6A 5J2EA 1NOMA 1ZQZA 4XJEA 4XQ8A 2ZH8A 1ZQQA 3UQ0A 2BCRA 7ICHA 3HJ4A 5F2VO 4RQ7A 1BPXA 4QZDA 4I2FA 1RPLA
chains in the Genus database with same CATH topology
4K96A 4K99A 4WOYA 2GA9D 4NXTA 3ER9B 4WQKA 5CHEA 4MKPA 4NXWA 2FCLA 3OWGA 4OAHA 4LEZA 3EF2A 4NXXA 2GAFD 5B3QA 1GPJA 2EWRA 2B51A 4LEVA 3ERCC 5CFSA 4NXUA 4KM5A 4N7RA 2B4VA 4JLZA 4LEWA 4K98A 4K9BA 4OAFA 3MCRA 5D62A 4FO1A 4XJEA 4LEYA 4WQLA 4KB6A 4OAGA 2B56A 4O6AA 5B3PA 4WH5A 3K7DA 4NXVA 4OAIZ 5CFTA 4K97A 3ER8C 3PHZA 2IHOA 4K8VA 4O69A 4O67A 4K9AA 5CFUA 5D63A 5D61A 4JLXA 3NKUA 4HX0A 4O68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWR A;  4FO1 A;  4XJE A;  5CFS A;  4WQL A;  5CFU A;  4WQK A;  2FCL A;  4WH5 A;  4HX0 A;  5CFT A; 
#chains in the Genus database with same CATH topology
 9ICH A;  4M9L A;  1OU5 A;  5DBB A;  1ZQD A;  3MGH A;  3ERC C;  4YMN A;  4FH5 A;  4M9H A;  4F5Q A;  4LEW A;  5J0S A;  5BOM A;  1MQ2 A;  1BPE A;  3OVS A;  3RH5 A;  7ICL A;  5HRG A;  5DED A;  3C66 A;  4O9M A;  4FHX A;  1ZQE A;  4KLL A;  3TFR A;  3JYY A;  4O68 A;  3RJK A;  2FMQ A;  3RJG A;  4M9G A;  4X4O A;  5D4B A;  4X0B A;  3JPQ A;  4PHE A;  3RJH A;  2M2T A;  4RQ8 A;  3C18 A;  4LZD A;  4MF8 A;  2VAN A;  5J2F A;  4TUP A;  4M2Y A;  7ICM A;  4JWM A;  4OAI Z;  5HRI A;  4RPZ A;  8ICF A;  3H37 A;  3RH6 A;  4I2I A;  9ICM A;  8ICE A;  3PHZ A;  4JLX A;  4WC3 A;  1BPB A;  4I2D A;  1ZQK A;  3JPO A;  3ER9 B;  4WQK A;  5CHE A;  1ZQF A;  8ICH A;  3B0Y A;  1R8C A;  3WFR E;  4GXK A;  5D49 A;  4WC7 A;  4M47 A;  4OAF A;  2BPF A;  3WFO A;  4NLK A;  4KLM A;  4RQ1 A;  4LEY A;  1TFW A;  4OAG A;  5J0Q A;  4X4S A;  4EED A;  4P4M A;  3RJE A;  5CWR A;  4I29 A;  4PGY A;  9ICX A;  2M2V A;  5D61 A;  4E7X A;  8ICT A;  4I0U A;  4I27 A;  4I2B A;  3JPS A;  1ZQM A;  1ZQN A;  4KLE A;  3V72 A;  4EP7 A;  7ICN A;  3AQK A;  3OWG A;  2DRA A;  4R66 A;  4XA5 A;  9ICE A;  2BPC A;  4LEV A;  2M2U A;  2PFP A;  4QZ9 A;  5BOL A;  4K4H A;  4M5D A;  3AQN A;  4Z6F A;  4R65 A;  4UBB A;  4EGW A;  5IIM A;  4F5N A;  4P2H A;  4DOB A;  4KLI A;  4FHW A;  7ICE A;  4RT2 A;  3OVA A;  5J2K A;  3V7K A;  1RZT A;  2BPG A;  2PFQ A;  4PPX A;  1JAJ A;  5D46 A;  4RQ0 A;  5J29 A;  2W9M A;  4WC5 A;  4DOA A;  5III A;  4AT9 B;  3MGI A;  5J0W A;  4JWN A;  3JPN A;  3AUO A;  2I9G A;  5J0R A;  3CK6 A;  4X4Q A;  1ZQY A;  5DB9 A;  4NXW A;  3NWI A;  8ICM A;  8ICN A;  3EF2 A;  2EWR A;  2ZH1 A;  2IUB A;  5HRF A;  3OGU A;  8ICL A;  1ZQI A;  8ICW A;  4EBJ A;  8ICS A;  4FHP A;  2O1P A;  5HHI A;  5HRD A;  4X4P A;  4RQ6 A;  2FMS A;  8ICQ A;  4KLT A;  4WC4 A;  4FHV A;  3NYB A;  3K7D A;  1Q79 A;  9ICQ A;  4O69 A;  5J2H A;  1R8B A;  1TV9 A;  4QZF A;  3AQM A;  3OUY B;  1ZQS A;  8ICA A;  3L9D A;  4RPX A;  4WCW A;  4K99 A;  9ICB A;  5J0X A;  5DDY A;  4KLF A;  5J2D A;  4WC2 A;  2M2W A;  4QZG A;  4ATB A;  4PGQ A;  5CP2 A;  2DR9 A;  3OUY A;  5DDM A;  4KLS A;  7ICO A;  4NXU A;  4EBK A;  7ICP A;  4KM5 A;  5HRL A;  4IQT A;  4TUR A;  4IQU A;  4TUQ A;  4FO1 A;  9ICP A;  2FMP A;  4WQL A;  5DKW A;  2DVI A;  3OV7 A;  4MFA A;  1ZQA A;  4YD2 A;  1JN3 A;  4YN4 A;  4O67 A;  1ZQO A;  4M9N A;  4UAY A;  4X0A A;  4I2A A;  3NKU A;  1ZJM A;  9ICC A;  2Q66 A;  7ICR A;  2P66 A;  3C2L A;  1F5A A;  4IQW A;  3NVO A;  3AQL A;  5J2C A;  3JCF A;  5CFS A;  3RJJ A;  4FO6 A;  3JPR A;  5DBA A;  1UET A;  8ICU A;  2HN1 A;  4O5E A;  4O6A A;  4YMO A;  2BCQ A;  3PML A;  4KLU A;  2IHO A;  4EV6 A;  4XUS A;  9ICA A;  8ICO A;  7ICG A;  4X4T A;  7ICQ A;  2DRB A;  3JZ0 A;  4MKP A;  3HJ1 A;  2BCU A;  2ZHA A;  3UXP A;  8ICC A;  1NO5 A;  5HRB A;  3JPT A;  2BCV A;  4Z6E A;  4DO9 A;  4X5V A;  1ZQG A;  4Z6D A;  4K9B A;  5HHH A;  5D62 A;  5J0P A;  2HHP A;  2ISO A;  8ICY A;  4F5O A;  2ZHB A;  2HN2 A;  8ICI A;  3ER8 C;  4K8V A;  2ZH5 A;  1UEV A;  5D63 A;  3PNC A;  1ZQJ A;  3WFQ E;  1R89 A;  2ZH2 A;  3C2M A;  2ISP A;  1V4A A;  4I2C A;  7ICV A;  1MQ3 A;  9ICO A;  3RJI A;  5DB7 A;  3V7L A;  4I2G A;  2DR5 A;  3AU2 A;  1ZQW A;  3LK9 A;  4I2J A;  4F5P A;  1TFY A;  2DR7 A;  2PFN A;  1Q78 A;  2ZH6 A;  2ZH7 A;  4I2H A;  4AT8 B;  4XRH A;  1ZQC A;  4K97 A;  4RWQ A;  4NM1 A;  4K9A A;  8ICR A;  5CJ7 A;  2PFO A;  5CHG A;  4AT8 A;  1HUO A;  4LVS A;  1TVA A;  9ICI A;  4FH3 A;  2BBJ A;  7ICI A;  3LQC B;  5HRH A;  3RH4 A;  1GPJ A;  1VFG A;  5HR9 A;  1ZQT A;  3WFS C;  3H38 A;  3HIY A;  7ICF A;  1BPY A;  4M0A A;  1HUZ A;  4F5R A;  4UBC A;  9ICW A;  5IIN A;  5J0U A;  1ZQP A;  4PHP A;  2BE3 A;  2BBH A;  9ICN A;  2NRK A;  4ATB B;  4UB5 A;  5J2I A;  4X4V A;  4KLJ A;  3PMN A;  7ICS A;  4UB1 A;  4I2E A;  3V7J A;  4NXT A;  3RJF A;  5CR0 A;  4MFC A;  4WC6 A;  3UXN A;  4YCX A;  1YLQ A;  2PBE A;  4NXX A;  5B3Q A;  4PH5 A;  9ICG A;  4GXJ A;  3MDA A;  4WBY A;  4QZE A;  4I28 A;  3WFP A;  4X4R A;  5CB1 A;  4K98 A;  3C5G A;  4UB2 A;  3ISD A;  4X4U A;  4KB6 A;  7ICU A;  1XSN A;  1MIV A;  5IIK A;  1ZQH A;  3MDC A;  3UXO A;  5HRE A;  3B0X A;  2GA9 D;  4NY8 A;  5DEC A;  8ICV A;  4QZ8 A;  4E80 A;  5J2G A;  5HC9 A;  8ICG A;  2GAF D;  8ICZ A;  2IHM A;  4KLG A;  4FHY A;  5HRK A;  4GXI A;  3HX0 A;  1ZQB A;  4R64 A;  5J0Y A;  4PHD A;  1ZQL A;  4RQ5 A;  1BPD A;  4QZA A;  4QZB A;  4KLO A;  1MIY A;  1PX5 A;  3ISC A;  7ICK A;  2GWS A;  4WH5 A;  4K4I A;  4TUS A;  4UAW A;  4KLQ A;  3UPS A;  1ZQX A;  1FA0 A;  4E8F A;  4RWP A;  8ICX A;  5CFU A;  4NXZ A;  4K4G A;  4M9J A;  4RQ2 A;  4AT7 B;  4K96 A;  3GDX A;  2ZH4 A;  8ICJ A;  5BPC A;  2O5A A;  9ICT A;  3MBY A;  4AT7 A;  4EEB A;  4M04 A;  1MIW A;  1WOT A;  4RQ3 A;  1XSL A;  4LZG A;  4UAZ A;  4YD1 A;  1BPZ A;  5B3P A;  4RT3 A;  4NXV A;  4UD5 A;  4QZI A;  5CFT A;  2ID1 A;  2RFF A;  4NM2 A;  3ISB A;  3UPQ A;  2DR8 A;  4NKU A;  1XSP A;  7ICT A;  4QZH A;  4MF2 A;  9ICJ A;  2BCS A;  5J0O A;  1KNY A;  9ICK A;  1JMS A;  9ICL A;  4IG8 A;  4MFF A;  2ZH9 A;  9ICU A;  5IIL A;  4N7R A;  5J0T A;  4UB3 A;  4RWO A;  3MCR A;  8ICK A;  4UD4 A;  5J2A A;  4RPY A;  2B56 A;  3H39 A;  4DOC A;  1KDH A;  4X4N A;  5CA7 A;  4WC1 A;  9ICR A;  4O5K A;  4QZC A;  7ICJ A;  9ICS A;  4UB4 A;  5J2J A;  3C5F A;  4LEZ A;  4HX0 A;  1UEU A;  1VJ7 A;  3AU6 A;  4RQ4 A;  4NLZ A;  4P4O A;  5IIJ A;  2PXI A;  9ICV A;  5DBC A;  4S3N A;  4IQV A;  5IIO A;  4RWN A;  4PGX A;  2B4V A;  1R8A A;  4JLZ A;  4WBZ A;  3UQ2 A;  1ZQR A;  9ICF A;  3TFS A;  5DB8 A;  4PHA A;  3H3A A;  1ZQU A;  5TZV A;  3K75 D;  5EOZ A;  4YMM A;  4P4P A;  3C2K A;  4XQ7 A;  4NKT A;  1JQR A;  4KLH A;  2ZH3 A;  4NLN A;  4O5C A;  4LT6 A;  4KLD A;  3JPP A;  4Z6C A;  3HWT A;  8ICB A;  4WOY A;  5J2B A;  1ZQV A;  1KEJ A;  5JTG A;  4OAH A;  2FCL A;  1ZJN A;  2B51 A;  4AT9 A;  8ICP A;  4WC0 A;  3HW8 A;  3OVB A;  4R63 A;  5DB6 A;  5J2E A;  1NOM A;  1ZQZ A;  4XJE A;  4XQ8 A;  2ZH8 A;  1ZQQ A;  3UQ0 A;  2BCR A;  7ICH A;  3HJ4 A;  5F2V O;  4RQ7 A;  1BPX A;  4QZD A;  4I2F A;  1RPL A; 
#chains in the Genus database with same CATH homology
 4K96 A;  4K99 A;  4WOY A;  2GA9 D;  4NXT A;  3ER9 B;  4WQK A;  5CHE A;  4MKP A;  4NXW A;  2FCL A;  3OWG A;  4OAH A;  4LEZ A;  3EF2 A;  4NXX A;  2GAF D;  5B3Q A;  1GPJ A;  2EWR A;  2B51 A;  4LEV A;  3ERC C;  5CFS A;  4NXU A;  4KM5 A;  4N7R A;  2B4V A;  4JLZ A;  4LEW A;  4K98 A;  4K9B A;  4OAF A;  3MCR A;  5D62 A;  4FO1 A;  4XJE A;  4LEY A;  4WQL A;  4KB6 A;  4OAG A;  2B56 A;  4O6A A;  5B3P A;  4WH5 A;  3K7D A;  4NXV A;  4OAI Z;  5CFT A;  4K97 A;  3ER8 C;  3PHZ A;  2IHO A;  4K8V A;  4O69 A;  4O67 A;  4K9A A;  5CFU A;  5D63 A;  5D61 A;  4JLX A;  3NKU A;  4HX0 A;  4O68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...