4PGYA

Structure of human dna polymerase beta complexed with a nicked dna containing a gt at n-1 position and gc at n position
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The spontaneous base substitution mechanisms of human DNA polymerase beta
rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pgyA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pgyA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pgyA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pgyA03
4RT3A 4LZDA 3GIJA 3KHGA 4QZDA 5DKWA 4UB1A 5BPCA 2ALZA 3RJGA 4Q45A 4ATBB 4DL3A 4TUPA 4F4ZA 4AT7B 4RT2A 4QWAA 4FO6A 4DQQA 5HMMA 4DS5A 4KLMA 7ICPA 2FMQA 3UQ0A 1U48A 1Z3EB 5KFSA 3JPTA 1L3SA 3MR2A 1BNOA 1KFDA 5KFOA 2AQ4A 2ZH4A 2ZUBA 4DF8A 2IBKA 5KFNA 7ICFA 4QZIA 4X4RA 4KLGA 3GDXA 4FS2A 4Z6DA 3MGIA 2M2UA 3H7IA 3B0XA 4S3NA 4PHDA 3GV7B 5KT3A 2KZZA 3HT3A 4B9VA 8ICUA 1R8AA 2W9BA 3UPSA 3B0YA 4NM2A 5KFEA 1T7PA 5F2VO 3WFRE 2B21A 3RR7A 2XCPA 1JQRA 5J0RA 1IXRA 5CB1A 2BE3A 5KFTA 1KRPA 4DQPA 4BDPA 3H8WA 2XCAA 4WC0A 8ICQA 4J9OA 3GQCA 4J9MA 1BPXA 4QZFA 3BDPA 4PHPA 3RBDA 2HHTA 3UXNA 4EP7A 4KN7A 2ZHAA 4KLDA 2PFNA 4X4OA 4O0IA 3G6YA 4XQ8A 3V7LA 4MEXA 3RAQA 4DOBA 3TQ1A 1X9SA 1PX5A 4O5KA 3OJSA 9ICHA 4DSKA 2RFFA 3HIYA 3NTUA 3N4MB 2PI5A 3L9DA 3RB3A 4B9SA 3H38A 2BDPA 3OVAA 2V4QA 9ICKA 8ICFA 5KFHA 1BPYA 4DF4A 3RR8A 1AROP 5DB7A 3C66A 3N97B 4B9MA 4J9NA 3AQNA 1TK8A 2V9WA 3JPQA 2F1HA 3EPGA 8ICYA 3GFKB 3V6HA 3ZDEA 4MFFA 3UQ2A 1BPDA 4UB4A 1RYRA 4R63A 2HW3A 4KLSA 4UBBA 5BOLA 3RRGA 3T5LA 2ZJAA 5IIKA 1S0MA 4F5PA 4NLZA 2ZH1A 2KZ3A 5DGBA 5J0PA 3TANA 4QZGA 5J2FA 3IM1A 3LWMA 3C5GA 5KFMA 2R8KA 4E0DA 1ZQHA 5DQIA 3SYZA 4DEZA 2DPJA 4KLQA 4QZAA 4ECQA 4IRKA 4IQVA 9ICPA 3MGHA 5KT2A 4JV0A 4YMNA 2DFLA 1SKWA 5KFRA 1UT5A 2J6UA 2XGPA 1S0OA 4RWPA 1SKRA 1ZQWA 4RQ6A 2IMWP 4RU9A 2P6UA 5HRFA 2W9MA 2M9NA 5KFKA 4AT9A 4MEYA 2XY5A 1CUKA 1TKDA 1LB2B 2BCVA 8ICAA 2FLNA 4IQWA 3Q8MA 1ZQQA 2ZH2A 4JWNA 4AT8B 8ICKA 4GC6A 4IQTA 2M2VA 1VFGA 2MAXA 4PHEA 2BPFA 1UEVA 3ISBA 4WC2A 3JPPA 2HHXA 1S97A 3KHHA 3V7KA 4EBDA 2BCQA 2W9CA 4IRCA 2ID1A 2ZJ8A 3H8JA 4YR2A 7ICEA 8ICVA 4NKTA 4UD4A 1JXEA 3EW9A 5EWEA 1D9FA 3QZ8A 3BQTA 3AUOA 4RQ1A 4JUZA 4YQWA 3GV8B 1T3NA 1ZQEA 4HYKA 5DECA 9ICCA 4BGDA 1R8BA 2ZUCA 4O3OA 3FDSA 4QZHA 4PHAA 2R8GA 1BNPA 7ICHA 3WFOA 2ISOA 2PBEA 5DG7A 4QWCA 1ZQRA 4ECWA 1NJYA 5DBCA 4R8UA 4QZBA 3G6XA 3PX6A 3RJKA 5KFFA 4DSJA 3RJHA 1IM4A 4KLUA 2XY6A 8ICLA 1NZPA 2NRTA 4DLEA 3RJIA 2HHWA 1XO1A 4F5OA 5DGAA 1N48A 1ZQDA 4TURA 5KG0A 5J0TA 2W9BB 3T3FA 3SI8A 3RBEA 4O3RA 3H8SA 1U45A 5HRGA 5J2DA 5IINA 3RJEA 1CEZA 2M2WA 4FHXA 4YXJA 2FLPA 1WCLA 3OGUA 3EPIA 1ZQNA 2JEFA 5HRKA 5J0YA 1JX4A 2BQ3A 3QEAZ 4O3QA 1TV9A 3ZDAA 4XQ7A 5DG9A 1NJZA 1BVSA 9ICOA 1L3VA 5KTQA 4QZEA 3AQMA 3Q8PB 2JZBA 4K4IA 4X0BA 4M6WB 1WOTA 1EXNA 8ICMA 1BPEA 4EBJA 4RNNA 1MIWA 4ECXA 4I27A 4YP3A 3TFSA 4DFPA 9ICTA 4B9UA 2JZBB 5IIOA 3M9MB 5HP4A 1SL2A 2AGPA 3WFPA 1A76A 5IIJA 4I2JA 1KLNA 5KFLA 3PR4A 4KMUA 4YMOA 3RB6A 8ICJA 1NJXA 3MFHA 2KN7A 2RDJA 2BPCA 1DK2A 3QZ7A 3C2KA 2UVRA 4KLIA 8ICCA 3AQKA 4X4TA 4IG8A 4DQRA 4CCHA 2ZTCA 5KT5A 2PFOA 4EBKA 5IIIA 8ICWA 2ATLA 1QSSA 1KTQA 1XU4A 1KEJA 4GXIA 3OV7A 4YN4A 4YG2A 5CR0A 4NLKA 9ICIA 3ZD8A 3RB4A 4RQ2A 3ETLA 5KG3A 1ZQPA 3ZDDA 4I28A 4J9RA 4WBYA 1ZQXA 3SV4A 4F4KA 1U4BA 4DSIA 4M9HA 4KLJA 4PGQA 1NK8A 2IHMA 3JPSA 5KFIA 1ZETA 2FLLA 4KLLA 1MIYA 5KG2A 4RQ4A 8ICEA 3ZD9A 3BQ1A 4EYHB 1DOQA 4E8FA 3MBYA 1DGSA 5DLGA 4ECTA 4WC7A 1TFWA 3V6KA 2I1QA 5KFCA 4M5DA 3MFIA 5DB9A 5DG8A 4R64A 3GIKA 4ECZA 2A1JA 4M2YA 4DFJA 4G3IA 2J6SA 4F91B 1MSWD 4F50A 2KFNA 2NRVA 1U49A 4ELVA 2R8IA 1NOMA 4AT8A 4F4YA 1ZQOA 3V72A 3RRHA 2P66A 5J0SA 1OU5A 2DR8A 5KT6A 3ISDA 1JAJA 1XWLA 2Q0ZX 4QWDA 3M9NB 4DOCA 1COOA 1ZQFA 4O9MA 9ICJA 3JPRA 3KHLA 1S0NA 4I2HA 2HHUA 4JK1A 1B22A 4O3SA 4GC7A 4X4QA 5L1KA 2NRXA 3UXPA 1B43A 4P4MA 3HWTA 4DL7A 4RNMA 3PO4A 2ZUDA 4O3PA 4IR9A 4GXJA 4FHYA 1NKEA 3TAQA 1MQ3A 1L5UA 4MFCA 4J9KA 1NJWA 4KLHA 4M6WA 2BHNA 2RDIA 4WC4A 2LYHA 4WC5A 5DLFA 4I2FA 4FS1A 5KG5A 5HHIA 4ELTA 1XSNA 7ICQA 4FBUA 8ICXA 3EWAA 4P4OA 4Q44A 1Q79A 5J0QA 2WTFA 5KFPA 2W9CB 4QZ9A 4TUSA 3QEBZ 2BCUA 5KG6A 5CP2A 2HVHA 4YCXA 5DQHA 3RJFA 3K75D 1RPLA 3C21A 2C2RA 1XSLA 5J2BA 5KG7A 4F4WA 1U47A 2C28A 2MUTB 5EWGA 2MUTA 3C1ZA 4QW9A 4DL5A 1S9FA 1XSPA 1KSPA 9ICRA 4AT9B 4DL6A 8ICHA 2H5XA 2FPLA 1Q78A 1BPBA 4WCWA 9ICVA 9ICMA 3GIIA 1TAQA 4RPYA 1QTMA 4YXMA 5F9LA 5KFYA 3ZDCA 3TFRA 4I2IA 4ECYA 3JPOA 3RTVA 4C8MA 1PZNA 4C8KA 1L3TA 4I2EA 3M8RA 4KLEA 4DL4A 8ICPA 4O5EA 4RZRA 5CHGA 5F9NA 3PNCA 2O5AA 4DSLA 9ICWA 5C5JA 1NK9A 1NK0A 3OVBA 1V9PA 2Q66A 2HHVA 4IQUA 1QLNA 7ICIA 4UB2A 2HVIA 5HRIA 4ED2A 3PY8A 5J0WA 4ELUA 4NKUA 4B9NA 1NK5A 1C7YA 2JEIA 8ICTA 7ICLA 5J0UA 8ICIA 4ED6A 2KP7A 5HR9A 4ED7A 5KT7A 1SKSA 4XRHA 1UA1A 2DRBA 3M8SA 5KFVA 2ZHBA 2W8KA 4DSEA 1SZPA 1Y88A 5DB6A 4EBEA 2KFZA 3PX4A 7ICKA 4ZH4A 9ICFA 4NM1A 2A1JB 4I2CA 1X9WA 5CWRA 5L1JA 5HC9A 4QWEA 3BQ2A 3OJUA 3THVA 4BXOB 2AJQA 2HHQA 9ICSA 2DVIA 3TAPA 4F5NA 2O1PA 1R89A 3NYBA 5L1IA 3Q8LA 4X4VA 5HREA 4ED0A 7ICNA 4JWMA 2BCRA 4J9SA 1RYSA 2AQ0A 4X4PA 1TFRA 3C1YA 5D4BA 4TUQA 4C8LA 2F1JA 1ZQUA 4ED3A 4M9JA 3M9OB 3UXOA 5J0XA 4UB5A 2KTQA 4I2GA 4FHVA 4RWQA 1D8LA 3RB0A 1SL1A 2OWOA 3WFSC 1X9MA 5J2KA 1T8EA 4O5CA 4C8OA 2ZH3A 4DQIA 2JEJA 5HNKA 3HW8A 2XGQA 3HJ4A 4WC1A 8ICBA 4UD5A 1Z00B 2C22A 4UQGA 4X0AA 3AQLA 4RUCA 3MR3A 2PI4A 2NRWA 4F2RA 4JV1A 3BJYA 7ICRA 3K4GA 3SZ2A 1LV5A 4TQSA 3LDAA 1ZQLA 1ZQBA 4Q8EA 2DR7A 4RWNA 3OVSA 1ZQMA 8ICNA 4E7XA 1YLQA 4M47A 4K4HA 5J2GA 3C2MA 1RXWA 1U9LA 4YD2A 2UVWA 5KFQA 5KFWA 1RXVA 1K1QA 2AGQA 1S76D 5DBBA 4QZ8A 3H40A 2ISPA 1QSYA 1N56A 1ZQGA 2V4RA 4MFAA 4Z6EA 2ZTDA 5J0OA 4K4GA 4M9LA 4KLOA 4ATBA 1XS9D 5KG1A 4F92B 5KFDA 3H3AA 3OHBA 1UA0A 4LZGA 5KFZA 4F3OA 1KFTA 5HRHA 3EYZA 3Q8KA 1ZQJA 4UAZA 2ASDA 1XC9A 9ICLA 3OUYA 4RWOA 1K1SA 3PVXA 1ZYQA 1SL0A 3JYYA 5DEDA 5KFUA 3NGDA 3MR5A 4F5QA 2FMSA 4DFKA 2F1IA 3LWLA 4LVSA 1R8CA 1KFSA 3C2LA 4IRDA 5EWFA 1KNYA 2GWSA 5J2HA 2ZJ5A 2XY7A 4NXZA 2BGWA 4NY8A 3OHAA 1ZJNA 9ICGA 1D8YA 7ICSA 2HHPA 4Q8FA 3ISCA 4WC6A 1VJ7A 3QE9Y 4MF8A 2ASJA 1NK6A 2IA6A 3HJ1A 4RUAA 3V6JA 5L9XA 3G6VA 1TVAA 2R8HA 3T5JA 4IR1A 3FYHA 4DL2A 4O3NA 1NK4A 2BR0A 4J9PA 5KG4A 1NK7A 3Q8RB 4I29A 1ZQVA 4X4NA 9ICNA 2PXIA 4NLNA 5CJ7A 4DSFA 1KDHA 4R65A 4X5VA 4PGXA 2ZH7A 9ICUA 4WC3A 4M9GA 4ECUA 5HMLA 2ZH6A 3UPQA 5CA7A 2BQRA 4JV2A 3GILA 3E2EA 2J6TA 4EZ6A 4FHWA 4AT7A 1ZQKA 3Q8SB 3H4DA 2ZH8A 2VA8A 1JXLA 2C2EA 1JN3A 4DLGA 4MF2A 4YR3A 3MDCA 4UBCA 5DDMA 3HP6A 2DR5A 4J9QA 2DR9A 3MDAA 3V7JA 1HUOA 4WBZA 5J2IA 3PW5A 3PW2A 7ICVA 3RH4A 2BQUA 4ECRA 3H39A 1S10A 1ZQCA 2AGOA 2KZMA 1T4GA 7ICUA 4I2DA 2W8LA 4B9TA 3WFQE 5KFGA 2R8JA 2XC9A 4GXKA 5J2AA 3OSNA 3C5FA 3RH6A 9ICXA 2FPMA 4FH3A 3PMLA 1ZQYA 4ECSA 4DO9A 4C8NA 2VANA 4QZCA 5J2JA 5D49A 4P4PA 1ZJMA 4RQ3A 8ICRA 5KFJA 3T5KA 4J9LA 4DQSA 2DPIA 3LK9A 2ZH9A 1HJPA 3PMNA 4F8RA 5D46A 3C23A 3MABA 1ZQSA 4EBCA 5HHHA 1UETA 5J29A 4ED1A 2BKEA 3HX0A 2ZH5A 4B9LA 1JMSA 1ZQZA 5DQGA 4KTQA 5DDYA 9ICBA 1RZTA 4XUSA 4DOAA 1BGXT 4RNOA 3Q8QB 5KT4A 3C18A 2JEGA 3PW4A 4E80A 5HRDA 1S77D 4ED8A 3GIMA 2Y1JA 1A77A 4KN4A 3PR5B 3PW0A 5L1LA 2W9AA 4DS4A 4BWMA 5DBAA 3RAXA 2PFQA 5TZVA 7ICJA 5HRBA 4YVZA 5IILA 2VA3A 3RJJA 2Y1IA 5DB8A 3PV8A 1UT8A 3AU2A 3TI0A 1NKBA 3ZDBA 4FH5A 5IIMA 3RH5A 3H4BA 1NKCA 8ICSA 2DRAA 8ICZA 4RPXA 5JUMA 4RPZA 4RQ5A 4F93B 2FPKA 4PPXA 4NLGA 1Z00A 2ZTEA 4KLTA 1S0VA 1MQ2A 5J2EA 2AU0A 2ASLA 4YD1A 1MC8A 5KFXA 4UAWA 1JIHA 3GV5B 3PW7A 3OSPA 4KLFA 7ICMA 7ICTA 4F2SA 2NRZA 4M0AA 9ICEA 2I9GA 4PH5A 9ICQA 4F5RA 4PGYA 4R8UB 2M2TA 3ORYA 4QW8A 3H37A 4TQRA 4ECVA 1ZQTA 3KHRA 2PFPA 3OUYB 4YMMA 1FA0A 4P2HA 4RQ7A 3MR6A 4I2BA 3IHQB 4YR0A 1UEUA 4LT6A 5KFAA 4FHPA 3TARA 1NO5A 1WCNA 3EZ5A 1TK5A 4X4UA 5BOMA 4Z6FA 4XA5A 9ICAA 4EYIB 4I2AA 7ICOA 2C2DA 1V4AA 4EEYA 4M04A 1MIVA 4YFKA 3KTQA 1TAUA 3PO5A 4KITB 4BXOA 3JPNA 1H38A 1BPZA 1D9DA 4EZ9A 3AU6A 3LQCB 1TFYA 2BCSA 4DWIA 2UVUA 4BWJA 1HUZA 4Z6CA 1TK0A 1F5AA 3PX0A 4F4XA 1DK3A 8ICOA 1ZQAA 1QSLA 4UAYA 2FMPA 4QWBA 4FBTA 8ICGA 1L3UA 2XO7A 3BQ0A 5J2CA 2VA2A 4DFMA 2BPGA 4M9NA 2P6RA 4UB3A 2IHNA 2UVVA 5EOZA 3SV3A 2HHSA 4GLXA 5KFBA 3T5HA 4RQ8A 3HPOA 2NRKA 3JZ0A 7ICGA 4Q43A 4R66A 4RQ0A 1ZQIA 4X4SA 5HRLA 1X2IA
chains in the Genus database with same CATH superfamily
3WKAA 2DBYA 4UB1A 5DKWA 4CRXA 4AT7B 3RJGA 1L8LA 4DL3A 3O0FA 4RT2A 4DQQA 5HMMA 4DS5A 5KFSA 1L3SA 1BNOA 5KFOA 2AQ4A 5KFNA 4X4RA 4USAA 4Z6DA 3MGIA 3GV7B 2KZZA 4B9VA 3B0YA 1UCVA 5KFEA 1T7PA 3KZIU 3QUTA 3RR7A 1JQRA 5J8YA 1ZRMA 5KFTA 2JR5A 5AI4A 8ICQA 1X6JA 3GQCA 1BPXA 4PHPA 3UXNA 4KN7A 4KLDA 2PFNA 5ALSA 1T3QA 2RFFA 3HIYA 2QB0B 3RB3A 3H38A 9ICKA 5KFHA 1BPYA 3RR8A 1AROP 3SENA 3C66A 3N97B 2MSNA 3JPQA 1K5OA 8ICYA 3V6HA 3ZDEA 3UQ2A 1BPDA 4EEBA 4R63A 5B3QA 4UAVA 2RRDA 2HW3A 5ALLA 5ALEA 3NVVA 3PHZA 3C5GA 5ALPA 3SYZA 2DPJA 4N7RA 4ECQA 5AK3A 1S0OA 1ZQWA 4RQ6A 1X66A 8ICAA 3ALRA 3NKUA 2KIVA 4OAFA 2DL0A 3BS7A 3ISBA 4WC2A 2HHXA 2MU2A 2ZJ8A 4YR2A 7ICEA 4UD4A 1D9FA 3QZ8A 3IG8A 3AUOA 2BDUA 1T3NA 1ZQEA 2H3IA 9ICCA 2ZUCA 5B5EU 1X9XA 1V38A 4QZHA 2R8GA 2PBEA 4QWCA 1ZQRA 5DBCA 3G6XA 1R8AA 2MA1A 2Z7JA 4DLEA 2HHWA 1XO1A 1ZQDA 2KICA 4TURA 2W9BB 4US9A 3EPIA 2JEFA 4ICAA 1ZQNA 4FZNA 4BJQA 2BQ3A 3QEAZ 2LM4A 3ZDAA 5DG9A 1NJZA 1BVSA 4GIBA 4K4IA 4X0BA 4M6WB 4K98A 1EXNA 1BPEA 4OJOA 4EBJA 1FEZA 4LEVA 4I27A 4B9UA 5HP4A 1ZD5A 2B6GA 2GOLA 2AGPA 2P35A 5KFLA 5TISU 2E3TA 4KMUA 8ICJA 1PUZA 2BPCA 2EANA 3QZ7A 4KLIA 4DQRA 4CCHA 2ZTCA 2DUYA 2PFOA 4EBKA 1QSSA 4NXXA 4NLKA 3RB4A 4I28A 3SV4A 2F3NA 5GTHU 1NK8A 2IHMA 5B66U 2FLLA 4KLLA 1ZETA 5AKGA 4E8FA 4RQ4A 2ES6A 3ZD9A 2OEHA 3MBYA 1SV0C 1S8OA 2W54A 2F8KA 3GIKA 5ALZA 4UB8U 2A1JA 4M2YA 4DFJA 3WU2U 4O3MA 2J6SA 4F91B 2EZXA 3CK6A 4AT8A 1ZQOA 2W7OA 4OAGA 2DR8A 5EE3A 4O9MA 4DOCA 5CFSA 9ICJA 3KZXA 4NV0A 4P4MA 3HWTA 1N5WA 4DL7A 4FHYA 1MQ3A 5AKZA 4MFCA 3A0BU 3I1YA 1CRXA 2LYHA 2ZIXA 4FBUA 3EWAA 4P4OA 4MHVA 4TUSA 2HVHA 2K89A 3RJFA 1XSLA 5KG7A 3AQFA 2C28A 3AQLA 9ICRA 1O08A 3BS5A 4DL6A 9ICMA 3GIIA 4RPYA 3ETRA 4YXMA 5HR6A 3RTVA 1PZNA 4I2EA 3NVWA 5CHGA 5AM1A 2O5AA 4DSLA 3QU5A 2ESEA 3R9KA 7ICIA 2GAFD 5ALWA 3PY8A 4B9NA 1NK5A 7ICLA 3QUQA 4FFDA 4DSEA 1WWUA 2ZXIA 1X42A 2KFZA 4P0PB 4PJ0U 4NM1A 2A1JB 5CWRA 5L1JA 3WKEA 2AXTU 4QWEA 4BXOB 1C20A 5D61A 2DVIA 4F5NA 1R89A 3Q8LA 4ED0A 2K8BB 7ICNA 4LJXA 5CRXA 1TFRA 5D4BA 2HN1A 2E8OA 2KTQA 1D8LA 2E5SA 2RQ5A 2JEJA 2QKQA 2XGQA 3HJ4A 4UW9A 4WC1A 4UD5A 4UQGA 3LYSA 2PI4A 3KBBA 4F2RA 4JV1A 5CHEA 1ZQBA 3SZ2A 1LV5A 4OJ6A 4Y2TA 1UHUA 4Y2PA 5AM5A 4RWNA 8ICNA 4E7XA 4K4HA 3F2CA 3C2MA 1U9LA 1RXWA 2UVWA 5KFQA 2YB4A 1S76D 3H40A 2ISPA 1QSYA 1ZQGA 5J0OA 2WF7A 2IHOA 4KLOA 4ATBA 1XS9D 2B51A 3H3AA 4LZGA 2KJ9A 1KFTA 3PSIA 2ASDA 3M7DA 1XC9A 5H2FU 1K1SA 4RWOA 1ZYQA 5KFUA 4F5QA 4DFKA 3C2LA 4IRDA 5EWFA 4NXZA 2BGWA 2DF4B 3ISCA 3QE9Y 1NK6A 1TVAA 4RQMA 1NK4A 2BR0A 1ZQVA 4X4NA 4NLNA 2F44A 4R65A 4X5VA 2ZH7A 4WC3A 3UPQA 2DWQA 4JV2A 4AT7A 4FHWA 2PKEA 2VA8A 1ZRNA 5AHXA 4UBCA 2KHQA 2DR5A 1HUOA 3PZPA 3H39A 2AGOA 2DKXA 1T4GA 4CF4A 2WAQF 4I2DA 5J2AA 3OSNA 4KX5A 4FH3A 2O6KA 1KQQA 4KB6A 2VANA 4O68A 4RQ3A 4J9LA 4CF5A 2DPIA 1HJPA 3OWGA 3QUBA 2KJ8A 5D46A 1ZQSA 5AIAA 5J29A 2BKEA 4KM5A 4PZNA 3ICXA 1ZQZA 5DQGA 3MGVA 4Y2RA 1BGXT 2JEGA 5HRDA 1S77D 1D8BA 3PW0A 4NWIA 3RAXA 5TZVA 5HRBA 5IILA 4J03A 2VA3A 3ZDBA 1NKBA 1NKCA 3H4BA 4Y2QA 5JUMA 4RPZA 4RQ5A 1S0VA 1N5XA 1MC8A 4KLFA 2M0NA 7ICTA 1NI3A 2I9GA 3ORYA 3OUYB 1ZQTA 4ECVA 1HIWA 4YMMA 4I2BA 5BOMA 4Z6FA 4XA5A 2WF5A 3MCRA 4UATA 4EEYA 1MIVA 1TAUA 3JPNA 2OH2A 3WK9A 4Z6CA 3NRZA 1TK0A 5KL8B 4UAYA 3FAHA 8ICGA 4UB3A 2IHNA 2UVVA 2KV2A 3HPOA 2LM1A 1RQNA 4X4SA 5HRLA 3H0MB 2WB1C 4C7YA 2ALZA 4ATBB 1VJ5A 2E1FA 4F72A 5ALFA 4FO6A 3UQ0A 3MR2A 4DF8A 7ICFA 4QZIA 2R18A 4NL9C 3H8MA 8ICUA 4FZMA 1LKYB 3WFRE 2B21A 3A0HU 5J0RA 1IXRA 4BDPA 5T14A 2ZIXB 4J9MA 3RBDA 2HHTA 1PK1B 4FO1A 4MEXA 3WKCA 3OJSA 4B9SA 3OVAA 2A3VA 2D8CA 4DF4A 5DB7A 4CNQA 2V9WA 1DGJA 2PMZF 3GFKB 3B9JA 4KLSA 5BOLA 3RRGA 1KBUA 2A1AA 5CEHA 4F5PA 2KZ3A 3CW2C 5DGBA 4OAHA 2R8KA 3OVBA 5J2FA 4KLQA 4DEZA 1F44A 4QZAA 5ALOA 2DFLA 1SKWA 2PMZC 2W9MA 2M9NA 2JHDA 1VDVA 3QX7A 1TKDA 3Q8MA 4AT8B 3TKAA 2CN1A 2M2VA 1WWVA 2HBKA 4PHEA 1VFGA 1Q8KA 1UEVA 4EGWA 3JPPA 1S97A 3KHHA 4EBDA 2NV3A 4IRCA 1PVRA 2OYYA 3VC8A 3EW9A 4OAIZ 3BQTA 3ER8C 2ODGA 3WK5A 4YQWA 5DECA 5AM2A 4BGDA 1R8BA 4O3OA 4Y2VA 1BNPA 3WFOA 1QCKA 5DG7A 4DSJA 2W04A 1S5LU 3OPXA 1RM6C 4F5OA 5DGAA 4OJ5A 3BS5B 1YZ7A 5KG0A 3T3FA 4O3RA 4AT9A 5ALVA 1U45A 4EV6A 4WJ3B 2HBJA 4FHXA 4YXJA 4U7CA 5J0YA 1JX4A 4O3QA 4OO1J 1V97A 1TAMA 3Q8PB 2WF8A 8ICMA 4ECXA 4C80A 1COKA 4YP3A 1SL2A 2WF9A 1A76A 5IIJA 3WFPA 2K4PA 4O67A 4MKPA 2RLTA 3GU3A 1SGGA 1DK2A 4X4TA 3I28A 3QU7A 4B6JA 1XU4A 4YN4A 2KNJA 3SAFA 3M6ZA 2G09A 4RQ2A 3ZDDA 1L7PA 1ZQXA 4F4KA 1U4BA 5G5GA 4DSIA 3KKAC 4KLJA 4EX6A 5KNIA 1MIYA 5KG2A 5DLGA 2BBHA 3V6KA 3MFIA 3DDHA 3GZFA 2H3ZA 4G3IA 1N63A 1MSWD 2HN2A 2B0CA 2KFNA 2NRVA 4ELVA 1NOMA 4F4YA 1IG6A 1OU5A 3ISDA 2Q0ZX 2LBOA 3KHLA 4I2HA 5L1KA 2NRXA 2EH9A 3IG5A 5AKJA 3PO4A 4RNMA 2ZUDA 4O3PA 1NKEA 1B4FA 1JRPA 4WC4A 1NJWA 2BHNA 5ALQA 2LYAA 2LYBA 2W3RA 5DLFA 4WC5A 4FS1A 5KG5A 4ELTA 5AI5A 8ICXA 1Z19A 5J0QA 2WTFA 3IRUA 2BCUA 5KG6A 3K75D 1U47A 4QW9A 1KSPA 4DL5A 1BPBA 1TE2A 1TAQA 2K4IA 3LVWA 5JTGA 4CDGA 2JXJA 2YMQA 1SWWA 8ICPA 4O5EA 4RZRA 5F9NA 1V9PA 2Q66A 1L7NA 5AI6A 5ALNA 4C4TA 4EELA 3NVYA 4ED6A 2KP7A 3D2QA 5HR9A 5KT7A 2DRBA 4A8EA 2ZHBA 2W8KA 1OXJA 1Y88A 4EBEA 3PX4A 9ICFA 3SR6A 5HC9A 1YZ6A 2XVTA 3OJUA 3THVA 9ICSA 3T79A 5HREA 5D63A 3C1YA 5CFUA 4M9JA 1FFVA 5J0XA 3UXOA 4UB5A 1QQ7A 1HEKA 3TADA 3AN1A 1O03A 1L7OA 3N7PD 2OWOA 3WFSC 1X9MA 1T8EA 4DQIA 2C22A 4X0AA 3MR3A 3K4GA 1Z1BA 3OVSA 1ZQMA 2OM6A 1YLQA 5J2GA 3NVOA 3ONNA 1UPHA 3PSFA 1K1QA 2AGQA 1DXSA 3TADC 5DBBA 2KSOA 2ZTDA 4K4GA 3NS1A 5AI0A 5KFZA 3SAHA 4F3OA 5HRHA 3EYZA 3OUYA 3PSTA 3JYYA 2Y0SF 2HOIA 3MR5A 2FMSA 4LVSA 2F1IA 1KFSA 3S6JA 2GWSA 5J2HA 1F5SA 2XY7A 4NY8A 2HHPA 1ED1A 3HKZF 2ASJA 1VJ7A 3HJ1A 3V6JA 3G6VA 2B56A 3FYHA 4DL2A 4I29A 2F76X 4M9GA 4ECUA 5HMLA 4QJFB 2BQRA 4BX9C 3E2EA 2IOHA 3Q8SB 1ZQKA 4IL6U 2C2EA 4YR3A 4NXTA 2AHOB 4J9QA 3V7JA 4CGZA 3PW2A 2KZMA 1GO3F 1Z4NA 3NWIA 4NJ8A 3WFQE 3C5FA 3RH6A 3D2SA 1N61A 4DO9A 4C8NA 3HKZC 4DQSA 3C23A 4EBCA 1UETA 2ZH5A 3HX0A 1JMSA 4KTQA 1Z1VA 1X6IA 3Q8QB 4LEZA 5K4LA 1SB3C 1SXDA 1DRGA 2Y1JA 3PR5B 1JROA 4DS4A 2PFQA 5AM4A 5DB8A 4FH5A 3RFAA 5IIMA 3AQEA 2K8AA 4Y2XA 2G06A 3WK6A 1F0MA 1Z00A 2ZTEA 2LKYA 5A0LA 2ASLA 5J2EA 1KLNA 5KFXA 4UAWA 2KKVA 3FM9A 4F2SA 9ICQA 1AQ6A 2YB1A 4R8UB 2M2TA 3H37A 2GO7A 4TQRA 4YR0A 5AKLA 3D6JA 4FHPA 3D2NA 1NO5A 1TK5A 1SWVA 9ICAA 2H3VA 4EYIB 2QARB 2C2DA 3IN5A 1V4AA 4HAIA 4IC9A 2KKPA 1T94A 1H38A 3AU6A 3LQCB 1TFYA 2UVUA 4P0PA 1DK3A 1ZQAA 1ZXIA 2ZIUA 2BPGA 4M9NA 2P6RA 3SV3A 3N7RC 2HHSA 3JZ0A 5JU5A 4U6PA 1X2IA 3GIJA 5ALJA 4QZDA 4Q45A 2Q4TA 4F4ZA 2B4VA 5EE1A 2F77X 2FMQA 1U48A 1KFDA 1QH9A 2ZUBA 1V85A 5ALUA 2IBKA 2WB1F 4KLGA 3GDXA 4FS2A 3H7IA 3B0XA 3UMCA 4S3NA 2IOFA 5KT3A 3HT3A 1MN8A 3UPSA 4PL1A 2KD1A 4NM2A 5F2VO 2FI1A 2OCEA 2BE3A 3JCFA 1JUDA 3H8WA 2XCAA 1J2NA 4EEKA 1WG8A 4QZFA 2ZHAA 2JH1A 4HX0A 4X4OA 4O0IA 3V7LA 3RAQA 3TQ1A 4O5KA 3AL0B 2BDPA 1KKXA 2JRZA 8ICFA 3F53A 1L7MA 4AP9A 4B9MA 3AQNA 1RQLA 1TK8A 2F1HA 1SV0A 1Q3VA 4UBBA 2K60A 4Y2SA 3T5LA 5IIKA 2ZIVB 1S0MA 2GA9D 3NASA 2EQYA 4C7ZA 5J0PA 4QZGA 3TANA 3LWMA 4E0DA 3M6KA 5KFMA 1ZQHA 4IQVA 9ICPA 3MGHA 4JV0A 4YMNA 1A0PA 5KFRA 1UT5A 4RWPA 2ZIUB 3WKDA 2KVSA 4RU9A 2P6UA 5AICA 1CUKA 1N60A 2BCVA 3NUQA 2FLNA 4JWNA 8ICKA 4GC6A 5KL1B 4IQTA 2KVCA 3L5KA 2HMXA 4G9BA 2ID1A 1JXEA 1ECWA 2LPEA 4RQ1A 4JUZA 5AKYA 4HYKA 2QB1A 2HOQA 4JB3A 2ISOA 4JMUA 4ECWA 4QZBA 4R8UA 1NJYA 3RJKA 8ICLA 1IM4A 3J81j 2JV3A 2F2AB 4OJPA 4EX7A 3HRDD 4EP7A 3SI8A 3RBEA 1CEZA 4C4RA 1WCLA 3OGUA 5HRKA 2E1EA 4WQLA 4XQ7A 4K8VA 1L3VA 4QZEA 2JZBA 1WOTA 4RNNA 1MIWA 4KMOB 2HBLA 2HDOA 2K8CB 2JZBB 2QLTA 5AKEA 5IIOA 3M9MB 9ICTA 2W11A 4JLXA 1Z4OA 4YMOA 3RB6A 3HILA 3MFHA 2RDJA 5FP0A 4F71A 2UVRA 5KT5A 5IIIA 4QIWC 1KTQA 4GXIA 4RQNA 9ICIA 2HI0A 5KG3A 2XIDA 3KOOA 2EAOA 4M9HA 2HCFA 4US8A 3JPSA 5KFIA 5ALGA 1N2XA 4EYHB 1DOQA 3SEIA 4CF3A 1IV8A 2G5HB 4M5DA 4ACOA 5DB9A 1XO0A 5ALXA 3F2BA 3V72A 5KAIU 5KT6A 1JAJA 4QWDA 1COOA 3JPRA 1S0NA 4JK1A 1B22A 4O3SA 4GC7A 5ALIA 3UXPA 1YT3A 1B43A 2A19A 4J9KA 4KLHA 4M6WA 2RDIA 1XSNA 3RF9A 7ICQA 3E0FA 4Q44A 2ZIVA 4JLZA 3QEBZ 2KSOB 1LVHA 5CP2A 2HHVA 2Y9UA 1VLBA 4YCXA 2M2UA 2C2RA 5EWGA 1S9FA 4AT9B 1Q78A 2H5XA 3L3FX 5AIBA 1URJA 4WCWA 9ICVA 1QTMA 1ZD4A 5F9LA 5ALHA 3ZDCA 3UMGA 5EE9A 2OHFA 4C8MA 1FO4A 3CYMA 4C8KA 2RHFA 4DL4A 2ZIWB 3PNCA 1NK0A 2YQEA 2HVIA 4ED2A 2YY6A 5J0WA 4ELUA 8ICTA 2JEIA 4NXWA 4ED7A 1SKSA 4XRHA 1UA1A 5CFTA 1SZPA 5DB6A 4NXVA 4ZH4A 4I2CA 5ALDA 3BQ2A 2AJQA 2YMMA 2HHQA 3TAPA 3IDWA 2O1PA 4X4VA 3AM9A 1WYGA 3PSPA 4J9SA 3BQ7A 1RYSA 2AQ0A 4C8LA 4TUQA 1Q46A 2F1JA 1ZQUA 4ED3A 1PK1A 2LHTA 4FE3A 2AH5A 1SIJA 4I2GA 4FHVA 1A6SA 4K99A 4C8OA 2ZH3A 3HW8A 2W43A 3NVZA 4RUCA 2NRWA 7ICRA 1ZQLA 4TQSA 4NLBA 4Q8EA 3AEVA 2E8NA 2DQNB 4Y2JA 4YD2A 4QZ8A 4Z6EA 4M9LA 1UA0A 5ALYA 4FZLA 2GLEA 4K96A 3Q8KA 1ZQJA 9ICLA 4QIWF 1SL0A 2D3DA 3NGDA 3C29A 4NXUA 1KNYA 2ZJ5A 7ICSA 3BZCA 3OHAA 1D8YA 4Q8FA 4WC6A 4MF8A 2IA6A 1TFWA 3LVVA 2R8HA 3T5JA 4O3NA 1SZHA 1NK7A 2FDRA 3Q8RB 4UARA 9ICNA 2WAQC 2PXIA 5CJ7A 1KDHA 3C28A 4WQKA 3GILA 2CXYA 1JN3A 4DLGA 4MF2A 4KX3A 2EAPA 3MDAA 1QQ5A 3ED5A 3QNMA 2K4EA 7ICVA 4ECRA 1S10A 7ICUA 2R8JA 2XC9A 4GXKA 9ICXA 3PMLA 5JRTA 5KAFU 5D49A 4P4PA 5KFJA 1NZBA 2ZH9A 3PMNA 4F8RA 4EENA 5HHHA 1OW5A 5DDYA 9ICBA 1RZTA 3CP8A 2DKZA 4DOAA 2W55A 3F5EA 4RNOA 3C18A 3PW4A 4E80A 3GIMA 1A77A 1XNSA 4BWMA 5DBAA 5EE0A 4ZOHC 4YVZA 2Y1IA 1UT8A 3TI0A 2DRAA 3U26A 4F93B 2FPKA 4NLGA 4JWMA 3GV5B 3PW7A 7ICMA 1JIHA 2NRZA 4PH5A 4F5RA 5ALRA 4QW8A 2L5YA 3KHRA 2PFPA 1FA0A 4RQ7A 3CNHA 3KKAA 3MR6A 3H0LB 3TARA 1WCNA 4X4UA 2KIWA 5L1MA 4I2AA 4AYBC 5ALMA 3M1YA 4YFKA 3KTQA 4LEWA 3PO5A 4KITB 4BXOA 1D9DA 1CI4A 4EZ9A 2EAMA 2BCSA 5D62A 5F3XB 4FBTA 2E8MA 1L3UA 2XO7A 3BQ0A 5J2CA 3WK7A 2OXOA 4GLXA 5KFBA 3T5HA 4RQ8A 2W03A 7ICGA 4R66A 4RQ0A 3OHBA 1X9WA 4RT3A 4LZDA 4GFJA 3KHGA 5BPCA 4TUPA 3QUCA 5C0YA 5ALKA 4QWAA 4KLMA 7ICPA 1RDFA 1Z3EB 3JPTA 1GPJA 2ZH4A 2YN4A 5AI8A 5AKKA 2RP5A 4PHDA 2ZG6A 3NRWA 2W9BA 2Y0SC 1N62A 2XCPA 5CB1A 2KEYA 4K97A 1KRPA 4DQPA 2JMGA 4WC0A 4J9OA 2K4HA 1ZQ1C 4P0QB 3BDPA 1FIQA 3G6YA 4XQ8A 4DOBA 1X9SA 1PX5A 9ICHA 4P0QA 4DSKA 3NTUA 3N4MB 2PI5A 4IS7A 3L9DA 2V4QA 4K9BA 2I6XA 4J9NA 2G0AA 3EPGA 1PK3A 4MFFA 4UB4A 1RYRA 2ZJAA 4NLZA 2ZH1A 3K7DA 2EDUA 3IM1A 4XJEA 5DQIA 4IRKA 5KT2A 2J6UA 1P7DA 2XGPA 4NL9A 1SKRA 4CE6A 2IMWP 2FCLA 5HRFA 5KFKA 4MEYA 2XY5A 1LB2B 4IQWA 2E8PA 1ZQQA 2ZH2A 2MAXA 4WOYA 3K1RB 2BPFA 2D6FC 1L8OA 3V7KA 2BCQA 2W9CA 5GTIU 1RYUA 3KD3A 3H8JA 2H3QA 4NKTA 8ICVA 2F8LA 2N1RA 5EWEA 2EZZA 3GV8B 2CPRA 2JGAA 2WHEA 3FDSA 3EUB2 4PHAA 7ICHA 3PX6A 1KW4A 4KLUA 5KFFA 3RJHA 2XY6A 1NZPA 3N7SC 2NRTA 3RJIA 5E79U 5J8YC 1N48A 2Y9TA 3ZI4A 4NLCA 5J0TA 5HRGA 3H8SA 3SD7A 5J2DA 5IINA 3RJEA 1J2MA 2M2WA 2FLPA 3F5AA 1TV9A 9ICOA 2KG5A 5KTQA 2VKQA 3IV6A 3AQMA 3SMVA 5AK4A 1OUQA 3TFSA 4DFPA 4I2JA 3PR4A 2WF6A 1FFUA 1NJXA 2KN7A 4AYBF 1KN5A 3C2KA 3AQKA 8ICCA 4IG8A 4DCCA 8ICWA 2ATLA 1KEJA 1SV4A 1PVPA 2KJ5A 4YG2A 3UMBA 3OV7A 5CR0A 3VCBA 3FC4A 3ZD8A 3ETLA 1ZQPA 2KMDA 5AI9A 4J9RA 4WBYA 1NNLA 3DV9A 5B3PA 3WK4A 4PGQA 1WUDA 3BQ1A 2KOBA 5AKHA 1DGSA 4WC7A 4ECTA 4O6AA 2I1QA 5KFCA 1Q3UA 4R64A 5DG8A 3QYPA 3EF2A 4ECZA 4F50A 4QNLA 1U49A 2R8IA 2G08A 3RRHA 2P66A 5J0SA 3UM9A 1XWLA 1J97A 3M9NB 1ZQFA 1JI7A 2LMRA 2HHUA 3OTQA 4X4QA 4IR9A 4GXJA 3HJEA 3TAQA 1L5UA 1L6NA 1ZD3A 2VJ5A 4I2FA 4C4SA 5HHIA 2NO4A 1Q79A 2G07A 5G5HA 2H3FA 2W9CB 5KFPA 3AMZA 4QZ9A 2GH1A 4Y2YA 5DQHA 5ALTA 1RPLA 3C21A 5J2BA 4F4WA 2G5IB 2MUTB 2MUTA 3C1ZA 1XSPA 2VIXA 8ICHA 2FPLA 3QXGA 1B0XA 5KFYA 3TFRA 4I2IA 4ECYA 2ZXHA 3JPOA 1L3TA 3M8RA 4KLEA 3TACB 3I76A 9ICWA 5C5JA 1NK9A 4IQUA 2CRXA 1QLNA 4UB2A 5HRIA 3L4PA 4NKUA 2YX8A 1C7YA 5J0UA 8ICIA 2DGZA 3M8SA 4OD0A 5KFVA 3IP4B 7ICKA 3ERCC 3NYBA 5L1IA 2QB0A 2KE7A 2BCRA 2XI9A 4X4PA 3H0RB 5JTIA 2YMLA 2EZYA 1MA7A 4I0UA 3M9OB 3WKBA 2ZIWA 4RWQA 1IIPA 3RB0A 1SL1A 3QU4A 5J2KA 4O5CA 1SXEA 3SAGA 5HNKA 4EEDA 2IOFK 8ICBA 1Z00B 2MRLA 2NYVA 3BJYA 2KK0A 4LEYA 3LDAA 2DR7A 2BZFA 4M47A 5AM3A 5KFWA 1RXVA 1ZD2P 5AKIA 1N56A 3SQIA 2V4RA 4MFAA 4OJLA 3QU2A 5KG1A 2VJ4A 4F92B 5KFDA 5HR7A 3BZKA 4WH5A 4UAZA 5AK5A 3PVXA 5DEDA 1R8CA 2HSZA 3LWLA 5AK6A 2W7PA 9ICGA 1ZJNA 1X40A 2I5HA 4RUAA 1M6YA 5L9XA 4IR1A 4BUGA 4J9PA 2YTUA 3MC1A 1UQVA 5KG4A 2JH7A 2NO5A 4DSFA 2QARA 4PGXA 3N28A 3KFUF 9ICUA 2ZH6A 5CA7A 2J6TA 4EZ6A 2W3SA 2ZH8A 3H4DA 2LI6A 3WK8A 4C0ZA 1JXLA 3MDCA 3ER9B 5DDMA 3HP6A 2DR9A 4UB6U 4WBZA 3CRXA 5J2IA 2KHVA 3PW5A 2YMPA 3RH4A 5AM0A 2BQUA 1ZQCA 2FE9A 2W8LA 4B9TA 5KFGA 3F2DA 2FPMA 1ZQYA 4ECSA 3K1ZA 4QZCA 5J2JA 1ZJMA 8ICRA 3T5KA 3LK9A 4O69A 3MABA 1KL9A 4OCZA 3DEEA 4ED1A 1JALA 3QU9A 4XUSA 4DFDA 5KT4A 2IUBA 2HBMA 4ED8A 3E58A 4KN4A 7ICJA 5L1LA 2W9AA 3RJJA 1ZOLA 3PV8A 1RG6A 3AU2A 2XICA 3RH5A 8ICSA 8ICZA 4RPXA 4PPXA 4KLTA 2EWRA 1MQ2A 2AU0A 8ICEA 3OSPA 4YD1A 9ICEA 4M0AA 2WFAA 4PGYA 1QQ6A 1PVQA 2BBJA 4P2HA 3IHQB 1UEUA 5AKXA 4LT6A 5KFAA 3EZ5A 7ICOA 4K9AA 4M04A 1LKYA 4UASA 1BPZA 4DWIA 4BWJA 1HUZA 2HOFA 1F5AA 4Y2UA 3PX0A 4PL2A 4F4XA 8ICOA 1QSLA 2FMPA 4QWBA 2VA2A 4DFMA 5EOZA 4PZOA 2FJ6A 2NRKA 4UAUA 4Q43A 4B9LA 1ZQIA
chains in the Genus database with same CATH topology
4RT3A 4LZDA 3GIJA 3KHGA 4QZDA 5DKWA 4UB1A 5BPCA 2ALZA 3RJGA 4Q45A 4ATBB 4DL3A 4TUPA 4F4ZA 4AT7B 4RT2A 4QWAA 4FO6A 4DQQA 5HMMA 4DS5A 4KLMA 7ICPA 2FMQA 3UQ0A 1U48A 1Z3EB 5KFSA 3JPTA 1L3SA 3MR2A 1BNOA 1KFDA 5KFOA 2AQ4A 2ZH4A 2ZUBA 4DF8A 2IBKA 5KFNA 7ICFA 4QZIA 4X4RA 4KLGA 3GDXA 4FS2A 4Z6DA 3MGIA 2M2UA 3H7IA 3B0XA 4S3NA 4PHDA 3GV7B 5KT3A 2KZZA 3HT3A 4B9VA 8ICUA 1R8AA 2W9BA 3UPSA 3B0YA 4NM2A 5KFEA 1T7PA 5F2VO 3WFRE 2B21A 3RR7A 2XCPA 1JQRA 5J0RA 1IXRA 5CB1A 2BE3A 5KFTA 1KRPA 4DQPA 4BDPA 3H8WA 2XCAA 4WC0A 8ICQA 4J9OA 3GQCA 4J9MA 1BPXA 4QZFA 3BDPA 4PHPA 3RBDA 2HHTA 3UXNA 4EP7A 4KN7A 2ZHAA 4KLDA 2PFNA 4X4OA 4O0IA 3G6YA 4XQ8A 3V7LA 4MEXA 3RAQA 4DOBA 3TQ1A 1X9SA 1PX5A 4O5KA 3OJSA 9ICHA 4DSKA 2RFFA 3HIYA 3NTUA 3N4MB 2PI5A 3L9DA 3RB3A 4B9SA 3H38A 2BDPA 3OVAA 2V4QA 9ICKA 8ICFA 5KFHA 1BPYA 4DF4A 3RR8A 1AROP 5DB7A 3C66A 3N97B 4B9MA 4J9NA 3AQNA 1TK8A 2V9WA 3JPQA 2F1HA 3EPGA 8ICYA 3GFKB 3V6HA 3ZDEA 4MFFA 3UQ2A 1BPDA 4UB4A 1RYRA 4R63A 2HW3A 4KLSA 4UBBA 5BOLA 3RRGA 3T5LA 2ZJAA 5IIKA 1S0MA 4F5PA 4NLZA 2ZH1A 2KZ3A 5DGBA 5J0PA 3TANA 4QZGA 5J2FA 3IM1A 3LWMA 3C5GA 5KFMA 2R8KA 4E0DA 1ZQHA 5DQIA 3SYZA 4DEZA 2DPJA 4KLQA 4QZAA 4ECQA 4IRKA 4IQVA 9ICPA 3MGHA 5KT2A 4JV0A 4YMNA 2DFLA 1SKWA 5KFRA 1UT5A 2J6UA 2XGPA 1S0OA 4RWPA 1SKRA 1ZQWA 4RQ6A 2IMWP 4RU9A 2P6UA 5HRFA 2W9MA 2M9NA 5KFKA 4AT9A 4MEYA 2XY5A 1CUKA 1TKDA 1LB2B 2BCVA 8ICAA 2FLNA 4IQWA 3Q8MA 1ZQQA 2ZH2A 4JWNA 4AT8B 8ICKA 4GC6A 4IQTA 2M2VA 1VFGA 2MAXA 4PHEA 2BPFA 1UEVA 3ISBA 4WC2A 3JPPA 2HHXA 1S97A 3KHHA 3V7KA 4EBDA 2BCQA 2W9CA 4IRCA 2ID1A 2ZJ8A 3H8JA 4YR2A 7ICEA 8ICVA 4NKTA 4UD4A 1JXEA 3EW9A 5EWEA 1D9FA 3QZ8A 3BQTA 3AUOA 4RQ1A 4JUZA 4YQWA 3GV8B 1T3NA 1ZQEA 4HYKA 5DECA 9ICCA 4BGDA 1R8BA 2ZUCA 4O3OA 3FDSA 4QZHA 4PHAA 2R8GA 1BNPA 7ICHA 3WFOA 2ISOA 2PBEA 5DG7A 4QWCA 1ZQRA 4ECWA 1NJYA 5DBCA 4R8UA 4QZBA 3G6XA 3PX6A 3RJKA 5KFFA 4DSJA 3RJHA 1IM4A 4KLUA 2XY6A 8ICLA 1NZPA 2NRTA 4DLEA 3RJIA 2HHWA 1XO1A 4F5OA 5DGAA 1N48A 1ZQDA 4TURA 5KG0A 5J0TA 2W9BB 3T3FA 3SI8A 3RBEA 4O3RA 3H8SA 1U45A 5HRGA 5J2DA 5IINA 3RJEA 1CEZA 2M2WA 4FHXA 4YXJA 2FLPA 1WCLA 3OGUA 3EPIA 1ZQNA 2JEFA 5HRKA 5J0YA 1JX4A 2BQ3A 3QEAZ 4O3QA 1TV9A 3ZDAA 4XQ7A 5DG9A 1NJZA 1BVSA 9ICOA 1L3VA 5KTQA 4QZEA 3AQMA 3Q8PB 2JZBA 4K4IA 4X0BA 4M6WB 1WOTA 1EXNA 8ICMA 1BPEA 4EBJA 4RNNA 1MIWA 4ECXA 4I27A 4YP3A 3TFSA 4DFPA 9ICTA 4B9UA 2JZBB 5IIOA 3M9MB 5HP4A 1SL2A 2AGPA 3WFPA 1A76A 5IIJA 4I2JA 1KLNA 5KFLA 3PR4A 4KMUA 4YMOA 3RB6A 8ICJA 1NJXA 3MFHA 2KN7A 2RDJA 2BPCA 1DK2A 3QZ7A 3C2KA 2UVRA 4KLIA 8ICCA 3AQKA 4X4TA 4IG8A 4DQRA 4CCHA 2ZTCA 5KT5A 2PFOA 4EBKA 5IIIA 8ICWA 2ATLA 1QSSA 1KTQA 1XU4A 1KEJA 4GXIA 3OV7A 4YN4A 4YG2A 5CR0A 4NLKA 9ICIA 3ZD8A 3RB4A 4RQ2A 3ETLA 5KG3A 1ZQPA 3ZDDA 4I28A 4J9RA 4WBYA 1ZQXA 3SV4A 4F4KA 1U4BA 4DSIA 4M9HA 4KLJA 4PGQA 1NK8A 2IHMA 3JPSA 5KFIA 1ZETA 2FLLA 4KLLA 1MIYA 5KG2A 4RQ4A 8ICEA 3ZD9A 3BQ1A 4EYHB 1DOQA 4E8FA 3MBYA 1DGSA 5DLGA 4ECTA 4WC7A 1TFWA 3V6KA 2I1QA 5KFCA 4M5DA 3MFIA 5DB9A 5DG8A 4R64A 3GIKA 4ECZA 2A1JA 4M2YA 4DFJA 4G3IA 2J6SA 4F91B 1MSWD 4F50A 2KFNA 2NRVA 1U49A 4ELVA 2R8IA 1NOMA 4AT8A 4F4YA 1ZQOA 3V72A 3RRHA 2P66A 5J0SA 1OU5A 2DR8A 5KT6A 3ISDA 1JAJA 1XWLA 2Q0ZX 4QWDA 3M9NB 4DOCA 1COOA 1ZQFA 4O9MA 9ICJA 3JPRA 3KHLA 1S0NA 4I2HA 2HHUA 4JK1A 1B22A 4O3SA 4GC7A 4X4QA 5L1KA 2NRXA 3UXPA 1B43A 4P4MA 3HWTA 4DL7A 4RNMA 3PO4A 2ZUDA 4O3PA 4IR9A 4GXJA 4FHYA 1NKEA 3TAQA 1MQ3A 1L5UA 4MFCA 4J9KA 1NJWA 4KLHA 4M6WA 2BHNA 2RDIA 4WC4A 2LYHA 4WC5A 5DLFA 4I2FA 4FS1A 5KG5A 5HHIA 4ELTA 1XSNA 7ICQA 4FBUA 8ICXA 3EWAA 4P4OA 4Q44A 1Q79A 5J0QA 2WTFA 5KFPA 2W9CB 4QZ9A 4TUSA 3QEBZ 2BCUA 5KG6A 5CP2A 2HVHA 4YCXA 5DQHA 3RJFA 3K75D 1RPLA 3C21A 2C2RA 1XSLA 5J2BA 5KG7A 4F4WA 1U47A 2C28A 2MUTB 5EWGA 2MUTA 3C1ZA 4QW9A 4DL5A 1S9FA 1XSPA 1KSPA 9ICRA 4AT9B 4DL6A 8ICHA 2H5XA 2FPLA 1Q78A 1BPBA 4WCWA 9ICVA 9ICMA 3GIIA 1TAQA 4RPYA 1QTMA 4YXMA 5F9LA 5KFYA 3ZDCA 3TFRA 4I2IA 4ECYA 3JPOA 3RTVA 4C8MA 1PZNA 4C8KA 1L3TA 4I2EA 3M8RA 4KLEA 4DL4A 8ICPA 4O5EA 4RZRA 5CHGA 5F9NA 3PNCA 2O5AA 4DSLA 9ICWA 5C5JA 1NK9A 1NK0A 3OVBA 1V9PA 2Q66A 2HHVA 4IQUA 1QLNA 7ICIA 4UB2A 2HVIA 5HRIA 4ED2A 3PY8A 5J0WA 4ELUA 4NKUA 4B9NA 1NK5A 1C7YA 2JEIA 8ICTA 7ICLA 5J0UA 8ICIA 4ED6A 2KP7A 5HR9A 4ED7A 5KT7A 1SKSA 4XRHA 1UA1A 2DRBA 3M8SA 5KFVA 2ZHBA 2W8KA 4DSEA 1SZPA 1Y88A 5DB6A 4EBEA 2KFZA 3PX4A 7ICKA 4ZH4A 9ICFA 4NM1A 2A1JB 4I2CA 1X9WA 5CWRA 5L1JA 5HC9A 4QWEA 3BQ2A 3OJUA 3THVA 4BXOB 2AJQA 2HHQA 9ICSA 2DVIA 3TAPA 4F5NA 2O1PA 1R89A 3NYBA 5L1IA 3Q8LA 4X4VA 5HREA 4ED0A 7ICNA 4JWMA 2BCRA 4J9SA 1RYSA 2AQ0A 4X4PA 1TFRA 3C1YA 5D4BA 4TUQA 4C8LA 2F1JA 1ZQUA 4ED3A 4M9JA 3M9OB 3UXOA 5J0XA 4UB5A 2KTQA 4I2GA 4FHVA 4RWQA 1D8LA 3RB0A 1SL1A 2OWOA 3WFSC 1X9MA 5J2KA 1T8EA 4O5CA 4C8OA 2ZH3A 4DQIA 2JEJA 5HNKA 3HW8A 2XGQA 3HJ4A 4WC1A 8ICBA 4UD5A 1Z00B 2C22A 4UQGA 4X0AA 3AQLA 4RUCA 3MR3A 2PI4A 2NRWA 4F2RA 4JV1A 3BJYA 7ICRA 3K4GA 3SZ2A 1LV5A 4TQSA 3LDAA 1ZQLA 1ZQBA 4Q8EA 2DR7A 4RWNA 3OVSA 1ZQMA 8ICNA 4E7XA 1YLQA 4M47A 4K4HA 5J2GA 3C2MA 1RXWA 1U9LA 4YD2A 2UVWA 5KFQA 5KFWA 1RXVA 1K1QA 2AGQA 1S76D 5DBBA 4QZ8A 3H40A 2ISPA 1QSYA 1N56A 1ZQGA 2V4RA 4MFAA 4Z6EA 2ZTDA 5J0OA 4K4GA 4M9LA 4KLOA 4ATBA 1XS9D 5KG1A 4F92B 5KFDA 3H3AA 3OHBA 1UA0A 4LZGA 5KFZA 4F3OA 1KFTA 5HRHA 3EYZA 3Q8KA 1ZQJA 4UAZA 2ASDA 1XC9A 9ICLA 3OUYA 4RWOA 1K1SA 3PVXA 1ZYQA 1SL0A 3JYYA 5DEDA 5KFUA 3NGDA 3MR5A 4F5QA 2FMSA 4DFKA 2F1IA 3LWLA 4LVSA 1R8CA 1KFSA 3C2LA 4IRDA 5EWFA 1KNYA 2GWSA 5J2HA 2ZJ5A 2XY7A 4NXZA 2BGWA 4NY8A 3OHAA 1ZJNA 9ICGA 1D8YA 7ICSA 2HHPA 4Q8FA 3ISCA 4WC6A 1VJ7A 3QE9Y 4MF8A 2ASJA 1NK6A 2IA6A 3HJ1A 4RUAA 3V6JA 5L9XA 3G6VA 1TVAA 2R8HA 3T5JA 4IR1A 3FYHA 4DL2A 4O3NA 1NK4A 2BR0A 4J9PA 5KG4A 1NK7A 3Q8RB 4I29A 1ZQVA 4X4NA 9ICNA 2PXIA 4NLNA 5CJ7A 4DSFA 1KDHA 4R65A 4X5VA 4PGXA 2ZH7A 9ICUA 4WC3A 4M9GA 4ECUA 5HMLA 2ZH6A 3UPQA 5CA7A 2BQRA 4JV2A 3GILA 3E2EA 2J6TA 4EZ6A 4FHWA 4AT7A 1ZQKA 3Q8SB 3H4DA 2ZH8A 2VA8A 1JXLA 2C2EA 1JN3A 4DLGA 4MF2A 4YR3A 3MDCA 4UBCA 5DDMA 3HP6A 2DR5A 4J9QA 2DR9A 3MDAA 3V7JA 1HUOA 4WBZA 5J2IA 3PW5A 3PW2A 7ICVA 3RH4A 2BQUA 4ECRA 3H39A 1S10A 1ZQCA 2AGOA 2KZMA 1T4GA 7ICUA 4I2DA 2W8LA 4B9TA 3WFQE 5KFGA 2R8JA 2XC9A 4GXKA 5J2AA 3OSNA 3C5FA 3RH6A 9ICXA 2FPMA 4FH3A 3PMLA 1ZQYA 4ECSA 4DO9A 4C8NA 2VANA 4QZCA 5J2JA 5D49A 4P4PA 1ZJMA 4RQ3A 8ICRA 5KFJA 3T5KA 4J9LA 4DQSA 2DPIA 3LK9A 2ZH9A 1HJPA 3PMNA 4F8RA 5D46A 3C23A 3MABA 1ZQSA 4EBCA 5HHHA 1UETA 5J29A 4ED1A 2BKEA 3HX0A 2ZH5A 4B9LA 1JMSA 1ZQZA 5DQGA 4KTQA 5DDYA 9ICBA 1RZTA 4XUSA 4DOAA 1BGXT 4RNOA 3Q8QB 5KT4A 3C18A 2JEGA 3PW4A 4E80A 5HRDA 1S77D 4ED8A 3GIMA 2Y1JA 1A77A 4KN4A 3PR5B 3PW0A 5L1LA 2W9AA 4DS4A 4BWMA 5DBAA 3RAXA 2PFQA 5TZVA 7ICJA 5HRBA 4YVZA 5IILA 2VA3A 3RJJA 2Y1IA 5DB8A 3PV8A 1UT8A 3AU2A 3TI0A 1NKBA 3ZDBA 4FH5A 5IIMA 3RH5A 3H4BA 1NKCA 8ICSA 2DRAA 8ICZA 4RPXA 5JUMA 4RPZA 4RQ5A 4F93B 2FPKA 4PPXA 4NLGA 1Z00A 2ZTEA 4KLTA 1S0VA 1MQ2A 5J2EA 2AU0A 2ASLA 4YD1A 1MC8A 5KFXA 4UAWA 1JIHA 3GV5B 3PW7A 3OSPA 4KLFA 7ICMA 7ICTA 4F2SA 2NRZA 4M0AA 9ICEA 2I9GA 4PH5A 9ICQA 4F5RA 4PGYA 4R8UB 2M2TA 3ORYA 4QW8A 3H37A 4TQRA 4ECVA 1ZQTA 3KHRA 2PFPA 3OUYB 4YMMA 1FA0A 4P2HA 4RQ7A 3MR6A 4I2BA 3IHQB 4YR0A 1UEUA 4LT6A 5KFAA 4FHPA 3TARA 1NO5A 1WCNA 3EZ5A 1TK5A 4X4UA 5BOMA 4Z6FA 4XA5A 9ICAA 4EYIB 4I2AA 7ICOA 2C2DA 1V4AA 4EEYA 4M04A 1MIVA 4YFKA 3KTQA 1TAUA 3PO5A 4KITB 4BXOA 3JPNA 1H38A 1BPZA 1D9DA 4EZ9A 3AU6A 3LQCB 1TFYA 2BCSA 4DWIA 2UVUA 4BWJA 1HUZA 4Z6CA 1TK0A 1F5AA 3PX0A 4F4XA 1DK3A 8ICOA 1ZQAA 1QSLA 4UAYA 2FMPA 4QWBA 4FBTA 8ICGA 1L3UA 2XO7A 3BQ0A 5J2CA 2VA2A 4DFMA 2BPGA 4M9NA 2P6RA 4UB3A 2IHNA 2UVVA 5EOZA 3SV3A 2HHSA 4GLXA 5KFBA 3T5HA 4RQ8A 3HPOA 2NRKA 3JZ0A 7ICGA 4Q43A 4R66A 4RQ0A 1ZQIA 4X4SA 5HRLA 1X2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RT3 A;  4LZD A;  3GIJ A;  3KHG A;  4QZD A;  5DKW A;  4UB1 A;  5BPC A;  2ALZ A;  3RJG A;  4Q45 A;  4ATB B;  4DL3 A;  4TUP A;  4F4Z A;  4AT7 B;  4RT2 A;  4QWA A;  4FO6 A;  4DQQ A;  5HMM A;  4DS5 A;  4KLM A;  7ICP A;  2FMQ A;  3UQ0 A;  1U48 A;  1Z3E B;  5KFS A;  3JPT A;  1L3S A;  3MR2 A;  1BNO A;  1KFD A;  5KFO A;  2AQ4 A;  2ZH4 A;  2ZUB A;  4DF8 A;  2IBK A;  5KFN A;  7ICF A;  4QZI A;  4X4R A;  4KLG A;  3GDX A;  4FS2 A;  4Z6D A;  3MGI A;  2M2U A;  3H7I A;  3B0X A;  4S3N A;  4PHD A;  3GV7 B;  5KT3 A;  2KZZ A;  3HT3 A;  4B9V A;  8ICU A;  1R8A A;  2W9B A;  3UPS A;  3B0Y A;  4NM2 A;  5KFE A;  1T7P A;  5F2V O;  3WFR E;  2B21 A;  3RR7 A;  2XCP A;  1JQR A;  5J0R A;  1IXR A;  5CB1 A;  2BE3 A;  5KFT A;  1KRP A;  4DQP A;  4BDP A;  3H8W A;  2XCA A;  4WC0 A;  8ICQ A;  4J9O A;  3GQC A;  4J9M A;  1BPX A;  4QZF A;  3BDP A;  4PHP A;  3RBD A;  2HHT A;  3UXN A;  4EP7 A;  4KN7 A;  2ZHA A;  4KLD A;  2PFN A;  4X4O A;  4O0I A;  3G6Y A;  4XQ8 A;  3V7L A;  4MEX A;  3RAQ A;  4DOB A;  3TQ1 A;  1X9S A;  1PX5 A;  4O5K A;  3OJS A;  9ICH A;  4DSK A;  2RFF A;  3HIY A;  3NTU A;  3N4M B;  2PI5 A;  3L9D A;  3RB3 A;  4B9S A;  3H38 A;  2BDP A;  3OVA A;  2V4Q A;  9ICK A;  8ICF A;  5KFH A;  1BPY A;  4DF4 A;  3RR8 A;  1ARO P;  5DB7 A;  3C66 A;  3N97 B;  4B9M A;  4J9N A;  3AQN A;  1TK8 A;  2V9W A;  3JPQ A;  2F1H A;  3EPG A;  8ICY A;  3GFK B;  3V6H A;  3ZDE A;  4MFF A;  3UQ2 A;  1BPD A;  4UB4 A;  1RYR A;  4R63 A;  2HW3 A;  4KLS A;  4UBB A;  5BOL A;  3RRG A;  3T5L A;  2ZJA A;  5IIK A;  1S0M A;  4F5P A;  4NLZ A;  2ZH1 A;  2KZ3 A;  5DGB A;  5J0P A;  3TAN A;  4QZG A;  5J2F A;  3IM1 A;  3LWM A;  3C5G A;  5KFM A;  2R8K A;  4E0D A;  1ZQH A;  5DQI A;  3SYZ A;  4DEZ A;  2DPJ A;  4KLQ A;  4QZA A;  4ECQ A;  4IRK A;  4IQV A;  9ICP A;  3MGH A;  5KT2 A;  4JV0 A;  4YMN A;  2DFL A;  1SKW A;  5KFR A;  1UT5 A;  2J6U A;  2XGP A;  1S0O A;  4RWP A;  1SKR A;  1ZQW A;  4RQ6 A;  2IMW P;  4RU9 A;  2P6U A;  5HRF A;  2W9M A;  2M9N A;  5KFK A;  4AT9 A;  4MEY A;  2XY5 A;  1CUK A;  1TKD A;  1LB2 B;  2BCV A;  8ICA A;  2FLN A;  4IQW A;  3Q8M A;  1ZQQ A;  2ZH2 A;  4JWN A;  4AT8 B;  8ICK A;  4GC6 A;  4IQT A;  2M2V A;  1VFG A;  2MAX A;  4PHE A;  2BPF A;  1UEV A;  3ISB A;  4WC2 A;  3JPP A;  2HHX A;  1S97 A;  3KHH A;  3V7K A;  4EBD A;  2BCQ A;  2W9C A;  4IRC A;  2ID1 A;  2ZJ8 A;  3H8J A;  4YR2 A;  7ICE A;  8ICV A;  4NKT A;  4UD4 A;  1JXE A;  3EW9 A;  5EWE A;  1D9F A;  3QZ8 A;  3BQT A;  3AUO A;  4RQ1 A;  4JUZ A;  4YQW A;  3GV8 B;  1T3N A;  1ZQE A;  4HYK A;  5DEC A;  9ICC A;  4BGD A;  1R8B A;  2ZUC A;  4O3O A;  3FDS A;  4QZH A;  4PHA A;  2R8G A;  1BNP A;  7ICH A;  3WFO A;  2ISO A;  2PBE A;  5DG7 A;  4QWC A;  1ZQR A;  4ECW A;  1NJY A;  5DBC A;  4R8U A;  4QZB A;  3G6X A;  3PX6 A;  3RJK A;  5KFF A;  4DSJ A;  3RJH A;  1IM4 A;  4KLU A;  2XY6 A;  8ICL A;  1NZP A;  2NRT A;  4DLE A;  3RJI A;  2HHW A;  1XO1 A;  4F5O A;  5DGA A;  1N48 A;  1ZQD A;  4TUR A;  5KG0 A;  5J0T A;  2W9B B;  3T3F A;  3SI8 A;  3RBE A;  4O3R A;  3H8S A;  1U45 A;  5HRG A;  5J2D A;  5IIN A;  3RJE A;  1CEZ A;  2M2W A;  4FHX A;  4YXJ A;  2FLP A;  1WCL A;  3OGU A;  3EPI A;  1ZQN A;  2JEF A;  5HRK A;  5J0Y A;  1JX4 A;  2BQ3 A;  3QEA Z;  4O3Q A;  1TV9 A;  3ZDA A;  4XQ7 A;  5DG9 A;  1NJZ A;  1BVS A;  9ICO A;  1L3V A;  5KTQ A;  4QZE A;  3AQM A;  3Q8P B;  2JZB A;  4K4I A;  4X0B A;  4M6W B;  1WOT A;  1EXN A;  8ICM A;  1BPE A;  4EBJ A;  4RNN A;  1MIW A;  4ECX A;  4I27 A;  4YP3 A;  3TFS A;  4DFP A;  9ICT A;  4B9U A;  2JZB B;  5IIO A;  3M9M B;  5HP4 A;  1SL2 A;  2AGP A;  3WFP A;  1A76 A;  5IIJ A;  4I2J A;  1KLN A;  5KFL A;  3PR4 A;  4KMU A;  4YMO A;  3RB6 A;  8ICJ A;  1NJX A;  3MFH A;  2KN7 A;  2RDJ A;  2BPC A;  1DK2 A;  3QZ7 A;  3C2K A;  2UVR A;  4KLI A;  8ICC A;  3AQK A;  4X4T A;  4IG8 A;  4DQR A;  4CCH A;  2ZTC A;  5KT5 A;  2PFO A;  4EBK A;  5III A;  8ICW A;  2ATL A;  1QSS A;  1KTQ A;  1XU4 A;  1KEJ A;  4GXI A;  3OV7 A;  4YN4 A;  4YG2 A;  5CR0 A;  4NLK A;  9ICI A;  3ZD8 A;  3RB4 A;  4RQ2 A;  3ETL A;  5KG3 A;  1ZQP A;  3ZDD A;  4I28 A;  4J9R A;  4WBY A;  1ZQX A;  3SV4 A;  4F4K A;  1U4B A;  4DSI A;  4M9H A;  4KLJ A;  4PGQ A;  1NK8 A;  2IHM A;  3JPS A;  5KFI A;  1ZET A;  2FLL A;  4KLL A;  1MIY A;  5KG2 A;  4RQ4 A;  8ICE A;  3ZD9 A;  3BQ1 A;  4EYH B;  1DOQ A;  4E8F A;  3MBY A;  1DGS A;  5DLG A;  4ECT A;  4WC7 A;  1TFW A;  3V6K A;  2I1Q A;  5KFC A;  4M5D A;  3MFI A;  5DB9 A;  5DG8 A;  4R64 A;  3GIK A;  4ECZ A;  2A1J A;  4M2Y A;  4DFJ A;  4G3I A;  2J6S A;  4F91 B;  1MSW D;  4F50 A;  2KFN A;  2NRV A;  1U49 A;  4ELV A;  2R8I A;  1NOM A;  4AT8 A;  4F4Y A;  1ZQO A;  3V72 A;  3RRH A;  2P66 A;  5J0S A;  1OU5 A;  2DR8 A;  5KT6 A;  3ISD A;  1JAJ A;  1XWL A;  2Q0Z X;  4QWD A;  3M9N B;  4DOC A;  1COO A;  1ZQF A;  4O9M A;  9ICJ A;  3JPR A;  3KHL A;  1S0N A;  4I2H A;  2HHU A;  4JK1 A;  1B22 A;  4O3S A;  4GC7 A;  4X4Q A;  5L1K A;  2NRX A;  3UXP A;  1B43 A;  4P4M A;  3HWT A;  4DL7 A;  4RNM A;  3PO4 A;  2ZUD A;  4O3P A;  4IR9 A;  4GXJ A;  4FHY A;  1NKE A;  3TAQ A;  1MQ3 A;  1L5U A;  4MFC A;  4J9K A;  1NJW A;  4KLH A;  4M6W A;  2BHN A;  2RDI A;  4WC4 A;  2LYH A;  4WC5 A;  5DLF A;  4I2F A;  4FS1 A;  5KG5 A;  5HHI A;  4ELT A;  1XSN A;  7ICQ A;  4FBU A;  8ICX A;  3EWA A;  4P4O A;  4Q44 A;  1Q79 A;  5J0Q A;  2WTF A;  5KFP A;  2W9C B;  4QZ9 A;  4TUS A;  3QEB Z;  2BCU A;  5KG6 A;  5CP2 A;  2HVH A;  4YCX A;  5DQH A;  3RJF A;  3K75 D;  1RPL A;  3C21 A;  2C2R A;  1XSL A;  5J2B A;  5KG7 A;  4F4W A;  1U47 A;  2C28 A;  2MUT B;  5EWG A;  2MUT A;  3C1Z A;  4QW9 A;  4DL5 A;  1S9F A;  1XSP A;  1KSP A;  9ICR A;  4AT9 B;  4DL6 A;  8ICH A;  2H5X A;  2FPL A;  1Q78 A;  1BPB A;  4WCW A;  9ICV A;  9ICM A;  3GII A;  1TAQ A;  4RPY A;  1QTM A;  4YXM A;  5F9L A;  5KFY A;  3ZDC A;  3TFR A;  4I2I A;  4ECY A;  3JPO A;  3RTV A;  4C8M A;  1PZN A;  4C8K A;  1L3T A;  4I2E A;  3M8R A;  4KLE A;  4DL4 A;  8ICP A;  4O5E A;  4RZR A;  5CHG A;  5F9N A;  3PNC A;  2O5A A;  4DSL A;  9ICW A;  5C5J A;  1NK9 A;  1NK0 A;  3OVB A;  1V9P A;  2Q66 A;  2HHV A;  4IQU A;  1QLN A;  7ICI A;  4UB2 A;  2HVI A;  5HRI A;  4ED2 A;  3PY8 A;  5J0W A;  4ELU A;  4NKU A;  4B9N A;  1NK5 A;  1C7Y A;  2JEI A;  8ICT A;  7ICL A;  5J0U A;  8ICI A;  4ED6 A;  2KP7 A;  5HR9 A;  4ED7 A;  5KT7 A;  1SKS A;  4XRH A;  1UA1 A;  2DRB A;  3M8S A;  5KFV A;  2ZHB A;  2W8K A;  4DSE A;  1SZP A;  1Y88 A;  5DB6 A;  4EBE A;  2KFZ A;  3PX4 A;  7ICK A;  4ZH4 A;  9ICF A;  4NM1 A;  2A1J B;  4I2C A;  1X9W A;  5CWR A;  5L1J A;  5HC9 A;  4QWE A;  3BQ2 A;  3OJU A;  3THV A;  4BXO B;  2AJQ A;  2HHQ A;  9ICS A;  2DVI A;  3TAP A;  4F5N A;  2O1P A;  1R89 A;  3NYB A;  5L1I A;  3Q8L A;  4X4V A;  5HRE A;  4ED0 A;  7ICN A;  4JWM A;  2BCR A;  4J9S A;  1RYS A;  2AQ0 A;  4X4P A;  1TFR A;  3C1Y A;  5D4B A;  4TUQ A;  4C8L A;  2F1J A;  1ZQU A;  4ED3 A;  4M9J A;  3M9O B;  3UXO A;  5J0X A;  4UB5 A;  2KTQ A;  4I2G A;  4FHV A;  4RWQ A;  1D8L A;  3RB0 A;  1SL1 A;  2OWO A;  3WFS C;  1X9M A;  5J2K A;  1T8E A;  4O5C A;  4C8O A;  2ZH3 A;  4DQI A;  2JEJ A;  5HNK A;  3HW8 A;  2XGQ A;  3HJ4 A;  4WC1 A;  8ICB A;  4UD5 A;  1Z00 B;  2C22 A;  4UQG A;  4X0A A;  3AQL A;  4RUC A;  3MR3 A;  2PI4 A;  2NRW A;  4F2R A;  4JV1 A;  3BJY A;  7ICR A;  3K4G A;  3SZ2 A;  1LV5 A;  4TQS A;  3LDA A;  1ZQL A;  1ZQB A;  4Q8E A;  2DR7 A;  4RWN A;  3OVS A;  1ZQM A;  8ICN A;  4E7X A;  1YLQ A;  4M47 A;  4K4H A;  5J2G A;  3C2M A;  1RXW A;  1U9L A;  4YD2 A;  2UVW A;  5KFQ A;  5KFW A;  1RXV A;  1K1Q A;  2AGQ A;  1S76 D;  5DBB A;  4QZ8 A;  3H40 A;  2ISP A;  1QSY A;  1N56 A;  1ZQG A;  2V4R A;  4MFA A;  4Z6E A;  2ZTD A;  5J0O A;  4K4G A;  4M9L A;  4KLO A;  4ATB A;  1XS9 D;  5KG1 A;  4F92 B;  5KFD A;  3H3A A;  3OHB A;  1UA0 A;  4LZG A;  5KFZ A;  4F3O A;  1KFT A;  5HRH A;  3EYZ A;  3Q8K A;  1ZQJ A;  4UAZ A;  2ASD A;  1XC9 A;  9ICL A;  3OUY A;  4RWO A;  1K1S A;  3PVX A;  1ZYQ A;  1SL0 A;  3JYY A;  5DED A;  5KFU A;  3NGD A;  3MR5 A;  4F5Q A;  2FMS A;  4DFK A;  2F1I A;  3LWL A;  4LVS A;  1R8C A;  1KFS A;  3C2L A;  4IRD A;  5EWF A;  1KNY A;  2GWS A;  5J2H A;  2ZJ5 A;  2XY7 A;  4NXZ A;  2BGW A;  4NY8 A;  3OHA A;  1ZJN A;  9ICG A;  1D8Y A;  7ICS A;  2HHP A;  4Q8F A;  3ISC A;  4WC6 A;  1VJ7 A;  3QE9 Y;  4MF8 A;  2ASJ A;  1NK6 A;  2IA6 A;  3HJ1 A;  4RUA A;  3V6J A;  5L9X A;  3G6V A;  1TVA A;  2R8H A;  3T5J A;  4IR1 A;  3FYH A;  4DL2 A;  4O3N A;  1NK4 A;  2BR0 A;  4J9P A;  5KG4 A;  1NK7 A;  3Q8R B;  4I29 A;  1ZQV A;  4X4N A;  9ICN A;  2PXI A;  4NLN A;  5CJ7 A;  4DSF A;  1KDH A;  4R65 A;  4X5V A;  4PGX A;  2ZH7 A;  9ICU A;  4WC3 A;  4M9G A;  4ECU A;  5HML A;  2ZH6 A;  3UPQ A;  5CA7 A;  2BQR A;  4JV2 A;  3GIL A;  3E2E A;  2J6T A;  4EZ6 A;  4FHW A;  4AT7 A;  1ZQK A;  3Q8S B;  3H4D A;  2ZH8 A;  2VA8 A;  1JXL A;  2C2E A;  1JN3 A;  4DLG A;  4MF2 A;  4YR3 A;  3MDC A;  4UBC A;  5DDM A;  3HP6 A;  2DR5 A;  4J9Q A;  2DR9 A;  3MDA A;  3V7J A;  1HUO A;  4WBZ A;  5J2I A;  3PW5 A;  3PW2 A;  7ICV A;  3RH4 A;  2BQU A;  4ECR A;  3H39 A;  1S10 A;  1ZQC A;  2AGO A;  2KZM A;  1T4G A;  7ICU A;  4I2D A;  2W8L A;  4B9T A;  3WFQ E;  5KFG A;  2R8J A;  2XC9 A;  4GXK A;  5J2A A;  3OSN A;  3C5F A;  3RH6 A;  9ICX A;  2FPM A;  4FH3 A;  3PML A;  1ZQY A;  4ECS A;  4DO9 A;  4C8N A;  2VAN A;  4QZC A;  5J2J A;  5D49 A;  4P4P A;  1ZJM A;  4RQ3 A;  8ICR A;  5KFJ A;  3T5K A;  4J9L A;  4DQS A;  2DPI A;  3LK9 A;  2ZH9 A;  1HJP A;  3PMN A;  4F8R A;  5D46 A;  3C23 A;  3MAB A;  1ZQS A;  4EBC A;  5HHH A;  1UET A;  5J29 A;  4ED1 A;  2BKE A;  3HX0 A;  2ZH5 A;  4B9L A;  1JMS A;  1ZQZ A;  5DQG A;  4KTQ A;  5DDY A;  9ICB A;  1RZT A;  4XUS A;  4DOA A;  1BGX T;  4RNO A;  3Q8Q B;  5KT4 A;  3C18 A;  2JEG A;  3PW4 A;  4E80 A;  5HRD A;  1S77 D;  4ED8 A;  3GIM A;  2Y1J A;  1A77 A;  4KN4 A;  3PR5 B;  3PW0 A;  5L1L A;  2W9A A;  4DS4 A;  4BWM A;  5DBA A;  3RAX A;  2PFQ A;  5TZV A;  7ICJ A;  5HRB A;  4YVZ A;  5IIL A;  2VA3 A;  3RJJ A;  2Y1I A;  5DB8 A;  3PV8 A;  1UT8 A;  3AU2 A;  3TI0 A;  1NKB A;  3ZDB A;  4FH5 A;  5IIM A;  3RH5 A;  3H4B A;  1NKC A;  8ICS A;  2DRA A;  8ICZ A;  4RPX A;  5JUM A;  4RPZ A;  4RQ5 A;  4F93 B;  2FPK A;  4PPX A;  4NLG A;  1Z00 A;  2ZTE A;  4KLT A;  1S0V A;  1MQ2 A;  5J2E A;  2AU0 A;  2ASL A;  4YD1 A;  1MC8 A;  5KFX A;  4UAW A;  1JIH A;  3GV5 B;  3PW7 A;  3OSP A;  4KLF A;  7ICM A;  7ICT A;  4F2S A;  2NRZ A;  4M0A A;  9ICE A;  2I9G A;  4PH5 A;  9ICQ A;  4F5R A;  4PGY A;  4R8U B;  2M2T A;  3ORY A;  4QW8 A;  3H37 A;  4TQR A;  4ECV A;  1ZQT A;  3KHR A;  2PFP A;  3OUY B;  4YMM A;  1FA0 A;  4P2H A;  4RQ7 A;  3MR6 A;  4I2B A;  3IHQ B;  4YR0 A;  1UEU A;  4LT6 A;  5KFA A;  4FHP A;  3TAR A;  1NO5 A;  1WCN A;  3EZ5 A;  1TK5 A;  4X4U A;  5BOM A;  4Z6F A;  4XA5 A;  9ICA A;  4EYI B;  4I2A A;  7ICO A;  2C2D A;  1V4A A;  4EEY A;  4M04 A;  1MIV A;  4YFK A;  3KTQ A;  1TAU A;  3PO5 A;  4KIT B;  4BXO A;  3JPN A;  1H38 A;  1BPZ A;  1D9D A;  4EZ9 A;  3AU6 A;  3LQC B;  1TFY A;  2BCS A;  4DWI A;  2UVU A;  4BWJ A;  1HUZ A;  4Z6C A;  1TK0 A;  1F5A A;  3PX0 A;  4F4X A;  1DK3 A;  8ICO A;  1ZQA A;  1QSL A;  4UAY A;  2FMP A;  4QWB A;  4FBT A;  8ICG A;  1L3U A;  2XO7 A;  3BQ0 A;  5J2C A;  2VA2 A;  4DFM A;  2BPG A;  4M9N A;  2P6R A;  4UB3 A;  2IHN A;  2UVV A;  5EOZ A;  3SV3 A;  2HHS A;  4GLX A;  5KFB A;  3T5H A;  4RQ8 A;  3HPO A;  2NRK A;  3JZ0 A;  7ICG A;  4Q43 A;  4R66 A;  4RQ0 A;  1ZQI A;  4X4S A;  5HRL A;  1X2I A; 
#chains in the Genus database with same CATH topology
 3WKA A;  2DBY A;  4UB1 A;  5DKW A;  4CRX A;  4AT7 B;  3RJG A;  1L8L A;  4DL3 A;  3O0F A;  4RT2 A;  4DQQ A;  5HMM A;  4DS5 A;  5KFS A;  1L3S A;  1BNO A;  5KFO A;  2AQ4 A;  5KFN A;  4X4R A;  4USA A;  4Z6D A;  3MGI A;  3GV7 B;  2KZZ A;  4B9V A;  3B0Y A;  1UCV A;  5KFE A;  1T7P A;  3KZI U;  3QUT A;  3RR7 A;  1JQR A;  5J8Y A;  1ZRM A;  5KFT A;  2JR5 A;  5AI4 A;  8ICQ A;  1X6J A;  3GQC A;  1BPX A;  4PHP A;  3UXN A;  4KN7 A;  4KLD A;  2PFN A;  5ALS A;  1T3Q A;  2RFF A;  3HIY A;  2QB0 B;  3RB3 A;  3H38 A;  9ICK A;  5KFH A;  1BPY A;  3RR8 A;  1ARO P;  3SEN A;  3C66 A;  3N97 B;  2MSN A;  3JPQ A;  1K5O A;  8ICY A;  3V6H A;  3ZDE A;  3UQ2 A;  1BPD A;  4EEB A;  4R63 A;  5B3Q A;  4UAV A;  2RRD A;  2HW3 A;  5ALL A;  5ALE A;  3NVV A;  3PHZ A;  3C5G A;  5ALP A;  3SYZ A;  2DPJ A;  4N7R A;  4ECQ A;  5AK3 A;  1S0O A;  1ZQW A;  4RQ6 A;  1X66 A;  8ICA A;  3ALR A;  3NKU A;  2KIV A;  4OAF A;  2DL0 A;  3BS7 A;  3ISB A;  4WC2 A;  2HHX A;  2MU2 A;  2ZJ8 A;  4YR2 A;  7ICE A;  4UD4 A;  1D9F A;  3QZ8 A;  3IG8 A;  3AUO A;  2BDU A;  1T3N A;  1ZQE A;  2H3I A;  9ICC A;  2ZUC A;  5B5E U;  1X9X A;  1V38 A;  4QZH A;  2R8G A;  2PBE A;  4QWC A;  1ZQR A;  5DBC A;  3G6X A;  1R8A A;  2MA1 A;  2Z7J A;  4DLE A;  2HHW A;  1XO1 A;  1ZQD A;  2KIC A;  4TUR A;  2W9B B;  4US9 A;  3EPI A;  2JEF A;  4ICA A;  1ZQN A;  4FZN A;  4BJQ A;  2BQ3 A;  3QEA Z;  2LM4 A;  3ZDA A;  5DG9 A;  1NJZ A;  1BVS A;  4GIB A;  4K4I A;  4X0B A;  4M6W B;  4K98 A;  1EXN A;  1BPE A;  4OJO A;  4EBJ A;  1FEZ A;  4LEV A;  4I27 A;  4B9U A;  5HP4 A;  1ZD5 A;  2B6G A;  2GOL A;  2AGP A;  2P35 A;  5KFL A;  5TIS U;  2E3T A;  4KMU A;  8ICJ A;  1PUZ A;  2BPC A;  2EAN A;  3QZ7 A;  4KLI A;  4DQR A;  4CCH A;  2ZTC A;  2DUY A;  2PFO A;  4EBK A;  1QSS A;  4NXX A;  4NLK A;  3RB4 A;  4I28 A;  3SV4 A;  2F3N A;  5GTH U;  1NK8 A;  2IHM A;  5B66 U;  2FLL A;  4KLL A;  1ZET A;  5AKG A;  4E8F A;  4RQ4 A;  2ES6 A;  3ZD9 A;  2OEH A;  3MBY A;  1SV0 C;  1S8O A;  2W54 A;  2F8K A;  3GIK A;  5ALZ A;  4UB8 U;  2A1J A;  4M2Y A;  4DFJ A;  3WU2 U;  4O3M A;  2J6S A;  4F91 B;  2EZX A;  3CK6 A;  4AT8 A;  1ZQO A;  2W7O A;  4OAG A;  2DR8 A;  5EE3 A;  4O9M A;  4DOC A;  5CFS A;  9ICJ A;  3KZX A;  4NV0 A;  4P4M A;  3HWT A;  1N5W A;  4DL7 A;  4FHY A;  1MQ3 A;  5AKZ A;  4MFC A;  3A0B U;  3I1Y A;  1CRX A;  2LYH A;  2ZIX A;  4FBU A;  3EWA A;  4P4O A;  4MHV A;  4TUS A;  2HVH A;  2K89 A;  3RJF A;  1XSL A;  5KG7 A;  3AQF A;  2C28 A;  3AQL A;  9ICR A;  1O08 A;  3BS5 A;  4DL6 A;  9ICM A;  3GII A;  4RPY A;  3ETR A;  4YXM A;  5HR6 A;  3RTV A;  1PZN A;  4I2E A;  3NVW A;  5CHG A;  5AM1 A;  2O5A A;  4DSL A;  3QU5 A;  2ESE A;  3R9K A;  7ICI A;  2GAF D;  5ALW A;  3PY8 A;  4B9N A;  1NK5 A;  7ICL A;  3QUQ A;  4FFD A;  4DSE A;  1WWU A;  2ZXI A;  1X42 A;  2KFZ A;  4P0P B;  4PJ0 U;  4NM1 A;  2A1J B;  5CWR A;  5L1J A;  3WKE A;  2AXT U;  4QWE A;  4BXO B;  1C20 A;  5D61 A;  2DVI A;  4F5N A;  1R89 A;  3Q8L A;  4ED0 A;  2K8B B;  7ICN A;  4LJX A;  5CRX A;  1TFR A;  5D4B A;  2HN1 A;  2E8O A;  2KTQ A;  1D8L A;  2E5S A;  2RQ5 A;  2JEJ A;  2QKQ A;  2XGQ A;  3HJ4 A;  4UW9 A;  4WC1 A;  4UD5 A;  4UQG A;  3LYS A;  2PI4 A;  3KBB A;  4F2R A;  4JV1 A;  5CHE A;  1ZQB A;  3SZ2 A;  1LV5 A;  4OJ6 A;  4Y2T A;  1UHU A;  4Y2P A;  5AM5 A;  4RWN A;  8ICN A;  4E7X A;  4K4H A;  3F2C A;  3C2M A;  1U9L A;  1RXW A;  2UVW A;  5KFQ A;  2YB4 A;  1S76 D;  3H40 A;  2ISP A;  1QSY A;  1ZQG A;  5J0O A;  2WF7 A;  2IHO A;  4KLO A;  4ATB A;  1XS9 D;  2B51 A;  3H3A A;  4LZG A;  2KJ9 A;  1KFT A;  3PSI A;  2ASD A;  3M7D A;  1XC9 A;  5H2F U;  1K1S A;  4RWO A;  1ZYQ A;  5KFU A;  4F5Q A;  4DFK A;  3C2L A;  4IRD A;  5EWF A;  4NXZ A;  2BGW A;  2DF4 B;  3ISC A;  3QE9 Y;  1NK6 A;  1TVA A;  4RQM A;  1NK4 A;  2BR0 A;  1ZQV A;  4X4N A;  4NLN A;  2F44 A;  4R65 A;  4X5V A;  2ZH7 A;  4WC3 A;  3UPQ A;  2DWQ A;  4JV2 A;  4AT7 A;  4FHW A;  2PKE A;  2VA8 A;  1ZRN A;  5AHX A;  4UBC A;  2KHQ A;  2DR5 A;  1HUO A;  3PZP A;  3H39 A;  2AGO A;  2DKX A;  1T4G A;  4CF4 A;  2WAQ F;  4I2D A;  5J2A A;  3OSN A;  4KX5 A;  4FH3 A;  2O6K A;  1KQQ A;  4KB6 A;  2VAN A;  4O68 A;  4RQ3 A;  4J9L A;  4CF5 A;  2DPI A;  1HJP A;  3OWG A;  3QUB A;  2KJ8 A;  5D46 A;  1ZQS A;  5AIA A;  5J29 A;  2BKE A;  4KM5 A;  4PZN A;  3ICX A;  1ZQZ A;  5DQG A;  3MGV A;  4Y2R A;  1BGX T;  2JEG A;  5HRD A;  1S77 D;  1D8B A;  3PW0 A;  4NWI A;  3RAX A;  5TZV A;  5HRB A;  5IIL A;  4J03 A;  2VA3 A;  3ZDB A;  1NKB A;  1NKC A;  3H4B A;  4Y2Q A;  5JUM A;  4RPZ A;  4RQ5 A;  1S0V A;  1N5X A;  1MC8 A;  4KLF A;  2M0N A;  7ICT A;  1NI3 A;  2I9G A;  3ORY A;  3OUY B;  1ZQT A;  4ECV A;  1HIW A;  4YMM A;  4I2B A;  5BOM A;  4Z6F A;  4XA5 A;  2WF5 A;  3MCR A;  4UAT A;  4EEY A;  1MIV A;  1TAU A;  3JPN A;  2OH2 A;  3WK9 A;  4Z6C A;  3NRZ A;  1TK0 A;  5KL8 B;  4UAY A;  3FAH A;  8ICG A;  4UB3 A;  2IHN A;  2UVV A;  2KV2 A;  3HPO A;  2LM1 A;  1RQN A;  4X4S A;  5HRL A;  3H0M B;  2WB1 C;  4C7Y A;  2ALZ A;  4ATB B;  1VJ5 A;  2E1F A;  4F72 A;  5ALF A;  4FO6 A;  3UQ0 A;  3MR2 A;  4DF8 A;  7ICF A;  4QZI A;  2R18 A;  4NL9 C;  3H8M A;  8ICU A;  4FZM A;  1LKY B;  3WFR E;  2B21 A;  3A0H U;  5J0R A;  1IXR A;  4BDP A;  5T14 A;  2ZIX B;  4J9M A;  3RBD A;  2HHT A;  1PK1 B;  4FO1 A;  4MEX A;  3WKC A;  3OJS A;  4B9S A;  3OVA A;  2A3V A;  2D8C A;  4DF4 A;  5DB7 A;  4CNQ A;  2V9W A;  1DGJ A;  2PMZ F;  3GFK B;  3B9J A;  4KLS A;  5BOL A;  3RRG A;  1KBU A;  2A1A A;  5CEH A;  4F5P A;  2KZ3 A;  3CW2 C;  5DGB A;  4OAH A;  2R8K A;  3OVB A;  5J2F A;  4KLQ A;  4DEZ A;  1F44 A;  4QZA A;  5ALO A;  2DFL A;  1SKW A;  2PMZ C;  2W9M A;  2M9N A;  2JHD A;  1VDV A;  3QX7 A;  1TKD A;  3Q8M A;  4AT8 B;  3TKA A;  2CN1 A;  2M2V A;  1WWV A;  2HBK A;  4PHE A;  1VFG A;  1Q8K A;  1UEV A;  4EGW A;  3JPP A;  1S97 A;  3KHH A;  4EBD A;  2NV3 A;  4IRC A;  1PVR A;  2OYY A;  3VC8 A;  3EW9 A;  4OAI Z;  3BQT A;  3ER8 C;  2ODG A;  3WK5 A;  4YQW A;  5DEC A;  5AM2 A;  4BGD A;  1R8B A;  4O3O A;  4Y2V A;  1BNP A;  3WFO A;  1QCK A;  5DG7 A;  4DSJ A;  2W04 A;  1S5L U;  3OPX A;  1RM6 C;  4F5O A;  5DGA A;  4OJ5 A;  3BS5 B;  1YZ7 A;  5KG0 A;  3T3F A;  4O3R A;  4AT9 A;  5ALV A;  1U45 A;  4EV6 A;  4WJ3 B;  2HBJ A;  4FHX A;  4YXJ A;  4U7C A;  5J0Y A;  1JX4 A;  4O3Q A;  4OO1 J;  1V97 A;  1TAM A;  3Q8P B;  2WF8 A;  8ICM A;  4ECX A;  4C80 A;  1COK A;  4YP3 A;  1SL2 A;  2WF9 A;  1A76 A;  5IIJ A;  3WFP A;  2K4P A;  4O67 A;  4MKP A;  2RLT A;  3GU3 A;  1SGG A;  1DK2 A;  4X4T A;  3I28 A;  3QU7 A;  4B6J A;  1XU4 A;  4YN4 A;  2KNJ A;  3SAF A;  3M6Z A;  2G09 A;  4RQ2 A;  3ZDD A;  1L7P A;  1ZQX A;  4F4K A;  1U4B A;  5G5G A;  4DSI A;  3KKA C;  4KLJ A;  4EX6 A;  5KNI A;  1MIY A;  5KG2 A;  5DLG A;  2BBH A;  3V6K A;  3MFI A;  3DDH A;  3GZF A;  2H3Z A;  4G3I A;  1N63 A;  1MSW D;  2HN2 A;  2B0C A;  2KFN A;  2NRV A;  4ELV A;  1NOM A;  4F4Y A;  1IG6 A;  1OU5 A;  3ISD A;  2Q0Z X;  2LBO A;  3KHL A;  4I2H A;  5L1K A;  2NRX A;  2EH9 A;  3IG5 A;  5AKJ A;  3PO4 A;  4RNM A;  2ZUD A;  4O3P A;  1NKE A;  1B4F A;  1JRP A;  4WC4 A;  1NJW A;  2BHN A;  5ALQ A;  2LYA A;  2LYB A;  2W3R A;  5DLF A;  4WC5 A;  4FS1 A;  5KG5 A;  4ELT A;  5AI5 A;  8ICX A;  1Z19 A;  5J0Q A;  2WTF A;  3IRU A;  2BCU A;  5KG6 A;  3K75 D;  1U47 A;  4QW9 A;  1KSP A;  4DL5 A;  1BPB A;  1TE2 A;  1TAQ A;  2K4I A;  3LVW A;  5JTG A;  4CDG A;  2JXJ A;  2YMQ A;  1SWW A;  8ICP A;  4O5E A;  4RZR A;  5F9N A;  1V9P A;  2Q66 A;  1L7N A;  5AI6 A;  5ALN A;  4C4T A;  4EEL A;  3NVY A;  4ED6 A;  2KP7 A;  3D2Q A;  5HR9 A;  5KT7 A;  2DRB A;  4A8E A;  2ZHB A;  2W8K A;  1OXJ A;  1Y88 A;  4EBE A;  3PX4 A;  9ICF A;  3SR6 A;  5HC9 A;  1YZ6 A;  2XVT A;  3OJU A;  3THV A;  9ICS A;  3T79 A;  5HRE A;  5D63 A;  3C1Y A;  5CFU A;  4M9J A;  1FFV A;  5J0X A;  3UXO A;  4UB5 A;  1QQ7 A;  1HEK A;  3TAD A;  3AN1 A;  1O03 A;  1L7O A;  3N7P D;  2OWO A;  3WFS C;  1X9M A;  1T8E A;  4DQI A;  2C22 A;  4X0A A;  3MR3 A;  3K4G A;  1Z1B A;  3OVS A;  1ZQM A;  2OM6 A;  1YLQ A;  5J2G A;  3NVO A;  3ONN A;  1UPH A;  3PSF A;  1K1Q A;  2AGQ A;  1DXS A;  3TAD C;  5DBB A;  2KSO A;  2ZTD A;  4K4G A;  3NS1 A;  5AI0 A;  5KFZ A;  3SAH A;  4F3O A;  5HRH A;  3EYZ A;  3OUY A;  3PST A;  3JYY A;  2Y0S F;  2HOI A;  3MR5 A;  2FMS A;  4LVS A;  2F1I A;  1KFS A;  3S6J A;  2GWS A;  5J2H A;  1F5S A;  2XY7 A;  4NY8 A;  2HHP A;  1ED1 A;  3HKZ F;  2ASJ A;  1VJ7 A;  3HJ1 A;  3V6J A;  3G6V A;  2B56 A;  3FYH A;  4DL2 A;  4I29 A;  2F76 X;  4M9G A;  4ECU A;  5HML A;  4QJF B;  2BQR A;  4BX9 C;  3E2E A;  2IOH A;  3Q8S B;  1ZQK A;  4IL6 U;  2C2E A;  4YR3 A;  4NXT A;  2AHO B;  4J9Q A;  3V7J A;  4CGZ A;  3PW2 A;  2KZM A;  1GO3 F;  1Z4N A;  3NWI A;  4NJ8 A;  3WFQ E;  3C5F A;  3RH6 A;  3D2S A;  1N61 A;  4DO9 A;  4C8N A;  3HKZ C;  4DQS A;  3C23 A;  4EBC A;  1UET A;  2ZH5 A;  3HX0 A;  1JMS A;  4KTQ A;  1Z1V A;  1X6I A;  3Q8Q B;  4LEZ A;  5K4L A;  1SB3 C;  1SXD A;  1DRG A;  2Y1J A;  3PR5 B;  1JRO A;  4DS4 A;  2PFQ A;  5AM4 A;  5DB8 A;  4FH5 A;  3RFA A;  5IIM A;  3AQE A;  2K8A A;  4Y2X A;  2G06 A;  3WK6 A;  1F0M A;  1Z00 A;  2ZTE A;  2LKY A;  5A0L A;  2ASL A;  5J2E A;  1KLN A;  5KFX A;  4UAW A;  2KKV A;  3FM9 A;  4F2S A;  9ICQ A;  1AQ6 A;  2YB1 A;  4R8U B;  2M2T A;  3H37 A;  2GO7 A;  4TQR A;  4YR0 A;  5AKL A;  3D6J A;  4FHP A;  3D2N A;  1NO5 A;  1TK5 A;  1SWV A;  9ICA A;  2H3V A;  4EYI B;  2QAR B;  2C2D A;  3IN5 A;  1V4A A;  4HAI A;  4IC9 A;  2KKP A;  1T94 A;  1H38 A;  3AU6 A;  3LQC B;  1TFY A;  2UVU A;  4P0P A;  1DK3 A;  1ZQA A;  1ZXI A;  2ZIU A;  2BPG A;  4M9N A;  2P6R A;  3SV3 A;  3N7R C;  2HHS A;  3JZ0 A;  5JU5 A;  4U6P A;  1X2I A;  3GIJ A;  5ALJ A;  4QZD A;  4Q45 A;  2Q4T A;  4F4Z A;  2B4V A;  5EE1 A;  2F77 X;  2FMQ A;  1U48 A;  1KFD A;  1QH9 A;  2ZUB A;  1V85 A;  5ALU A;  2IBK A;  2WB1 F;  4KLG A;  3GDX A;  4FS2 A;  3H7I A;  3B0X A;  3UMC A;  4S3N A;  2IOF A;  5KT3 A;  3HT3 A;  1MN8 A;  3UPS A;  4PL1 A;  2KD1 A;  4NM2 A;  5F2V O;  2FI1 A;  2OCE A;  2BE3 A;  3JCF A;  1JUD A;  3H8W A;  2XCA A;  1J2N A;  4EEK A;  1WG8 A;  4QZF A;  2ZHA A;  2JH1 A;  4HX0 A;  4X4O A;  4O0I A;  3V7L A;  3RAQ A;  3TQ1 A;  4O5K A;  3AL0 B;  2BDP A;  1KKX A;  2JRZ A;  8ICF A;  3F53 A;  1L7M A;  4AP9 A;  4B9M A;  3AQN A;  1RQL A;  1TK8 A;  2F1H A;  1SV0 A;  1Q3V A;  4UBB A;  2K60 A;  4Y2S A;  3T5L A;  5IIK A;  2ZIV B;  1S0M A;  2GA9 D;  3NAS A;  2EQY A;  4C7Z A;  5J0P A;  4QZG A;  3TAN A;  3LWM A;  4E0D A;  3M6K A;  5KFM A;  1ZQH A;  4IQV A;  9ICP A;  3MGH A;  4JV0 A;  4YMN A;  1A0P A;  5KFR A;  1UT5 A;  4RWP A;  2ZIU B;  3WKD A;  2KVS A;  4RU9 A;  2P6U A;  5AIC A;  1CUK A;  1N60 A;  2BCV A;  3NUQ A;  2FLN A;  4JWN A;  8ICK A;  4GC6 A;  5KL1 B;  4IQT A;  2KVC A;  3L5K A;  2HMX A;  4G9B A;  2ID1 A;  1JXE A;  1ECW A;  2LPE A;  4RQ1 A;  4JUZ A;  5AKY A;  4HYK A;  2QB1 A;  2HOQ A;  4JB3 A;  2ISO A;  4JMU A;  4ECW A;  4QZB A;  4R8U A;  1NJY A;  3RJK A;  8ICL A;  1IM4 A;  3J81 j;  2JV3 A;  2F2A B;  4OJP A;  4EX7 A;  3HRD D;  4EP7 A;  3SI8 A;  3RBE A;  1CEZ A;  4C4R A;  1WCL A;  3OGU A;  5HRK A;  2E1E A;  4WQL A;  4XQ7 A;  4K8V A;  1L3V A;  4QZE A;  2JZB A;  1WOT A;  4RNN A;  1MIW A;  4KMO B;  2HBL A;  2HDO A;  2K8C B;  2JZB B;  2QLT A;  5AKE A;  5IIO A;  3M9M B;  9ICT A;  2W11 A;  4JLX A;  1Z4O A;  4YMO A;  3RB6 A;  3HIL A;  3MFH A;  2RDJ A;  5FP0 A;  4F71 A;  2UVR A;  5KT5 A;  5III A;  4QIW C;  1KTQ A;  4GXI A;  4RQN A;  9ICI A;  2HI0 A;  5KG3 A;  2XID A;  3KOO A;  2EAO A;  4M9H A;  2HCF A;  4US8 A;  3JPS A;  5KFI A;  5ALG A;  1N2X A;  4EYH B;  1DOQ A;  3SEI A;  4CF3 A;  1IV8 A;  2G5H B;  4M5D A;  4ACO A;  5DB9 A;  1XO0 A;  5ALX A;  3F2B A;  3V72 A;  5KAI U;  5KT6 A;  1JAJ A;  4QWD A;  1COO A;  3JPR A;  1S0N A;  4JK1 A;  1B22 A;  4O3S A;  4GC7 A;  5ALI A;  3UXP A;  1YT3 A;  1B43 A;  2A19 A;  4J9K A;  4KLH A;  4M6W A;  2RDI A;  1XSN A;  3RF9 A;  7ICQ A;  3E0F A;  4Q44 A;  2ZIV A;  4JLZ A;  3QEB Z;  2KSO B;  1LVH A;  5CP2 A;  2HHV A;  2Y9U A;  1VLB A;  4YCX A;  2M2U A;  2C2R A;  5EWG A;  1S9F A;  4AT9 B;  1Q78 A;  2H5X A;  3L3F X;  5AIB A;  1URJ A;  4WCW A;  9ICV A;  1QTM A;  1ZD4 A;  5F9L A;  5ALH A;  3ZDC A;  3UMG A;  5EE9 A;  2OHF A;  4C8M A;  1FO4 A;  3CYM A;  4C8K A;  2RHF A;  4DL4 A;  2ZIW B;  3PNC A;  1NK0 A;  2YQE A;  2HVI A;  4ED2 A;  2YY6 A;  5J0W A;  4ELU A;  8ICT A;  2JEI A;  4NXW A;  4ED7 A;  1SKS A;  4XRH A;  1UA1 A;  5CFT A;  1SZP A;  5DB6 A;  4NXV A;  4ZH4 A;  4I2C A;  5ALD A;  3BQ2 A;  2AJQ A;  2YMM A;  2HHQ A;  3TAP A;  3IDW A;  2O1P A;  4X4V A;  3AM9 A;  1WYG A;  3PSP A;  4J9S A;  3BQ7 A;  1RYS A;  2AQ0 A;  4C8L A;  4TUQ A;  1Q46 A;  2F1J A;  1ZQU A;  4ED3 A;  1PK1 A;  2LHT A;  4FE3 A;  2AH5 A;  1SIJ A;  4I2G A;  4FHV A;  1A6S A;  4K99 A;  4C8O A;  2ZH3 A;  3HW8 A;  2W43 A;  3NVZ A;  4RUC A;  2NRW A;  7ICR A;  1ZQL A;  4TQS A;  4NLB A;  4Q8E A;  3AEV A;  2E8N A;  2DQN B;  4Y2J A;  4YD2 A;  4QZ8 A;  4Z6E A;  4M9L A;  1UA0 A;  5ALY A;  4FZL A;  2GLE A;  4K96 A;  3Q8K A;  1ZQJ A;  9ICL A;  4QIW F;  1SL0 A;  2D3D A;  3NGD A;  3C29 A;  4NXU A;  1KNY A;  2ZJ5 A;  7ICS A;  3BZC A;  3OHA A;  1D8Y A;  4Q8F A;  4WC6 A;  4MF8 A;  2IA6 A;  1TFW A;  3LVV A;  2R8H A;  3T5J A;  4O3N A;  1SZH A;  1NK7 A;  2FDR A;  3Q8R B;  4UAR A;  9ICN A;  2WAQ C;  2PXI A;  5CJ7 A;  1KDH A;  3C28 A;  4WQK A;  3GIL A;  2CXY A;  1JN3 A;  4DLG A;  4MF2 A;  4KX3 A;  2EAP A;  3MDA A;  1QQ5 A;  3ED5 A;  3QNM A;  2K4E A;  7ICV A;  4ECR A;  1S10 A;  7ICU A;  2R8J A;  2XC9 A;  4GXK A;  9ICX A;  3PML A;  5JRT A;  5KAF U;  5D49 A;  4P4P A;  5KFJ A;  1NZB A;  2ZH9 A;  3PMN A;  4F8R A;  4EEN A;  5HHH A;  1OW5 A;  5DDY A;  9ICB A;  1RZT A;  3CP8 A;  2DKZ A;  4DOA A;  2W55 A;  3F5E A;  4RNO A;  3C18 A;  3PW4 A;  4E80 A;  3GIM A;  1A77 A;  1XNS A;  4BWM A;  5DBA A;  5EE0 A;  4ZOH C;  4YVZ A;  2Y1I A;  1UT8 A;  3TI0 A;  2DRA A;  3U26 A;  4F93 B;  2FPK A;  4NLG A;  4JWM A;  3GV5 B;  3PW7 A;  7ICM A;  1JIH A;  2NRZ A;  4PH5 A;  4F5R A;  5ALR A;  4QW8 A;  2L5Y A;  3KHR A;  2PFP A;  1FA0 A;  4RQ7 A;  3CNH A;  3KKA A;  3MR6 A;  3H0L B;  3TAR A;  1WCN A;  4X4U A;  2KIW A;  5L1M A;  4I2A A;  4AYB C;  5ALM A;  3M1Y A;  4YFK A;  3KTQ A;  4LEW A;  3PO5 A;  4KIT B;  4BXO A;  1D9D A;  1CI4 A;  4EZ9 A;  2EAM A;  2BCS A;  5D62 A;  5F3X B;  4FBT A;  2E8M A;  1L3U A;  2XO7 A;  3BQ0 A;  5J2C A;  3WK7 A;  2OXO A;  4GLX A;  5KFB A;  3T5H A;  4RQ8 A;  2W03 A;  7ICG A;  4R66 A;  4RQ0 A;  3OHB A;  1X9W A;  4RT3 A;  4LZD A;  4GFJ A;  3KHG A;  5BPC A;  4TUP A;  3QUC A;  5C0Y A;  5ALK A;  4QWA A;  4KLM A;  7ICP A;  1RDF A;  1Z3E B;  3JPT A;  1GPJ A;  2ZH4 A;  2YN4 A;  5AI8 A;  5AKK A;  2RP5 A;  4PHD A;  2ZG6 A;  3NRW A;  2W9B A;  2Y0S C;  1N62 A;  2XCP A;  5CB1 A;  2KEY A;  4K97 A;  1KRP A;  4DQP A;  2JMG A;  4WC0 A;  4J9O A;  2K4H A;  1ZQ1 C;  4P0Q B;  3BDP A;  1FIQ A;  3G6Y A;  4XQ8 A;  4DOB A;  1X9S A;  1PX5 A;  9ICH A;  4P0Q A;  4DSK A;  3NTU A;  3N4M B;  2PI5 A;  4IS7 A;  3L9D A;  2V4Q A;  4K9B A;  2I6X A;  4J9N A;  2G0A A;  3EPG A;  1PK3 A;  4MFF A;  4UB4 A;  1RYR A;  2ZJA A;  4NLZ A;  2ZH1 A;  3K7D A;  2EDU A;  3IM1 A;  4XJE A;  5DQI A;  4IRK A;  5KT2 A;  2J6U A;  1P7D A;  2XGP A;  4NL9 A;  1SKR A;  4CE6 A;  2IMW P;  2FCL A;  5HRF A;  5KFK A;  4MEY A;  2XY5 A;  1LB2 B;  4IQW A;  2E8P A;  1ZQQ A;  2ZH2 A;  2MAX A;  4WOY A;  3K1R B;  2BPF A;  2D6F C;  1L8O A;  3V7K A;  2BCQ A;  2W9C A;  5GTI U;  1RYU A;  3KD3 A;  3H8J A;  2H3Q A;  4NKT A;  8ICV A;  2F8L A;  2N1R A;  5EWE A;  2EZZ A;  3GV8 B;  2CPR A;  2JGA A;  2WHE A;  3FDS A;  3EUB 2;  4PHA A;  7ICH A;  3PX6 A;  1KW4 A;  4KLU A;  5KFF A;  3RJH A;  2XY6 A;  1NZP A;  3N7S C;  2NRT A;  3RJI A;  5E79 U;  5J8Y C;  1N48 A;  2Y9T A;  3ZI4 A;  4NLC A;  5J0T A;  5HRG A;  3H8S A;  3SD7 A;  5J2D A;  5IIN A;  3RJE A;  1J2M A;  2M2W A;  2FLP A;  3F5A A;  1TV9 A;  9ICO A;  2KG5 A;  5KTQ A;  2VKQ A;  3IV6 A;  3AQM A;  3SMV A;  5AK4 A;  1OUQ A;  3TFS A;  4DFP A;  4I2J A;  3PR4 A;  2WF6 A;  1FFU A;  1NJX A;  2KN7 A;  4AYB F;  1KN5 A;  3C2K A;  3AQK A;  8ICC A;  4IG8 A;  4DCC A;  8ICW A;  2ATL A;  1KEJ A;  1SV4 A;  1PVP A;  2KJ5 A;  4YG2 A;  3UMB A;  3OV7 A;  5CR0 A;  3VCB A;  3FC4 A;  3ZD8 A;  3ETL A;  1ZQP A;  2KMD A;  5AI9 A;  4J9R A;  4WBY A;  1NNL A;  3DV9 A;  5B3P A;  3WK4 A;  4PGQ A;  1WUD A;  3BQ1 A;  2KOB A;  5AKH A;  1DGS A;  4WC7 A;  4ECT A;  4O6A A;  2I1Q A;  5KFC A;  1Q3U A;  4R64 A;  5DG8 A;  3QYP A;  3EF2 A;  4ECZ A;  4F50 A;  4QNL A;  1U49 A;  2R8I A;  2G08 A;  3RRH A;  2P66 A;  5J0S A;  3UM9 A;  1XWL A;  1J97 A;  3M9N B;  1ZQF A;  1JI7 A;  2LMR A;  2HHU A;  3OTQ A;  4X4Q A;  4IR9 A;  4GXJ A;  3HJE A;  3TAQ A;  1L5U A;  1L6N A;  1ZD3 A;  2VJ5 A;  4I2F A;  4C4S A;  5HHI A;  2NO4 A;  1Q79 A;  2G07 A;  5G5H A;  2H3F A;  2W9C B;  5KFP A;  3AMZ A;  4QZ9 A;  2GH1 A;  4Y2Y A;  5DQH A;  5ALT A;  1RPL A;  3C21 A;  5J2B A;  4F4W A;  2G5I B;  2MUT B;  2MUT A;  3C1Z A;  1XSP A;  2VIX A;  8ICH A;  2FPL A;  3QXG A;  1B0X A;  5KFY A;  3TFR A;  4I2I A;  4ECY A;  2ZXH A;  3JPO A;  1L3T A;  3M8R A;  4KLE A;  3TAC B;  3I76 A;  9ICW A;  5C5J A;  1NK9 A;  4IQU A;  2CRX A;  1QLN A;  4UB2 A;  5HRI A;  3L4P A;  4NKU A;  2YX8 A;  1C7Y A;  5J0U A;  8ICI A;  2DGZ A;  3M8S A;  4OD0 A;  5KFV A;  3IP4 B;  7ICK A;  3ERC C;  3NYB A;  5L1I A;  2QB0 A;  2KE7 A;  2BCR A;  2XI9 A;  4X4P A;  3H0R B;  5JTI A;  2YML A;  2EZY A;  1MA7 A;  4I0U A;  3M9O B;  3WKB A;  2ZIW A;  4RWQ A;  1IIP A;  3RB0 A;  1SL1 A;  3QU4 A;  5J2K A;  4O5C A;  1SXE A;  3SAG A;  5HNK A;  4EED A;  2IOF K;  8ICB A;  1Z00 B;  2MRL A;  2NYV A;  3BJY A;  2KK0 A;  4LEY A;  3LDA A;  2DR7 A;  2BZF A;  4M47 A;  5AM3 A;  5KFW A;  1RXV A;  1ZD2 P;  5AKI A;  1N56 A;  3SQI A;  2V4R A;  4MFA A;  4OJL A;  3QU2 A;  5KG1 A;  2VJ4 A;  4F92 B;  5KFD A;  5HR7 A;  3BZK A;  4WH5 A;  4UAZ A;  5AK5 A;  3PVX A;  5DED A;  1R8C A;  2HSZ A;  3LWL A;  5AK6 A;  2W7P A;  9ICG A;  1ZJN A;  1X40 A;  2I5H A;  4RUA A;  1M6Y A;  5L9X A;  4IR1 A;  4BUG A;  4J9P A;  2YTU A;  3MC1 A;  1UQV A;  5KG4 A;  2JH7 A;  2NO5 A;  4DSF A;  2QAR A;  4PGX A;  3N28 A;  3KFU F;  9ICU A;  2ZH6 A;  5CA7 A;  2J6T A;  4EZ6 A;  2W3S A;  2ZH8 A;  3H4D A;  2LI6 A;  3WK8 A;  4C0Z A;  1JXL A;  3MDC A;  3ER9 B;  5DDM A;  3HP6 A;  2DR9 A;  4UB6 U;  4WBZ A;  3CRX A;  5J2I A;  2KHV A;  3PW5 A;  2YMP A;  3RH4 A;  5AM0 A;  2BQU A;  1ZQC A;  2FE9 A;  2W8L A;  4B9T A;  5KFG A;  3F2D A;  2FPM A;  1ZQY A;  4ECS A;  3K1Z A;  4QZC A;  5J2J A;  1ZJM A;  8ICR A;  3T5K A;  3LK9 A;  4O69 A;  3MAB A;  1KL9 A;  4OCZ A;  3DEE A;  4ED1 A;  1JAL A;  3QU9 A;  4XUS A;  4DFD A;  5KT4 A;  2IUB A;  2HBM A;  4ED8 A;  3E58 A;  4KN4 A;  7ICJ A;  5L1L A;  2W9A A;  3RJJ A;  1ZOL A;  3PV8 A;  1RG6 A;  3AU2 A;  2XIC A;  3RH5 A;  8ICS A;  8ICZ A;  4RPX A;  4PPX A;  4KLT A;  2EWR A;  1MQ2 A;  2AU0 A;  8ICE A;  3OSP A;  4YD1 A;  9ICE A;  4M0A A;  2WFA A;  4PGY A;  1QQ6 A;  1PVQ A;  2BBJ A;  4P2H A;  3IHQ B;  1UEU A;  5AKX A;  4LT6 A;  5KFA A;  3EZ5 A;  7ICO A;  4K9A A;  4M04 A;  1LKY A;  4UAS A;  1BPZ A;  4DWI A;  4BWJ A;  1HUZ A;  2HOF A;  1F5A A;  4Y2U A;  3PX0 A;  4PL2 A;  4F4X A;  8ICO A;  1QSL A;  2FMP A;  4QWB A;  2VA2 A;  4DFM A;  5EOZ A;  4PZO A;  2FJ6 A;  2NRK A;  4UAU A;  4Q43 A;  4B9L A;  1ZQI A; 
#chains in the Genus database with same CATH homology
 4RT3 A;  4LZD A;  3GIJ A;  3KHG A;  4QZD A;  5DKW A;  4UB1 A;  5BPC A;  2ALZ A;  3RJG A;  4Q45 A;  4ATB B;  4DL3 A;  4TUP A;  4F4Z A;  4AT7 B;  4RT2 A;  4QWA A;  4FO6 A;  4DQQ A;  5HMM A;  4DS5 A;  4KLM A;  7ICP A;  2FMQ A;  3UQ0 A;  1U48 A;  1Z3E B;  5KFS A;  3JPT A;  1L3S A;  3MR2 A;  1BNO A;  1KFD A;  5KFO A;  2AQ4 A;  2ZH4 A;  2ZUB A;  4DF8 A;  2IBK A;  5KFN A;  7ICF A;  4QZI A;  4X4R A;  4KLG A;  3GDX A;  4FS2 A;  4Z6D A;  3MGI A;  2M2U A;  3H7I A;  3B0X A;  4S3N A;  4PHD A;  3GV7 B;  5KT3 A;  2KZZ A;  3HT3 A;  4B9V A;  8ICU A;  1R8A A;  2W9B A;  3UPS A;  3B0Y A;  4NM2 A;  5KFE A;  1T7P A;  5F2V O;  3WFR E;  2B21 A;  3RR7 A;  2XCP A;  1JQR A;  5J0R A;  1IXR A;  5CB1 A;  2BE3 A;  5KFT A;  1KRP A;  4DQP A;  4BDP A;  3H8W A;  2XCA A;  4WC0 A;  8ICQ A;  4J9O A;  3GQC A;  4J9M A;  1BPX A;  4QZF A;  3BDP A;  4PHP A;  3RBD A;  2HHT A;  3UXN A;  4EP7 A;  4KN7 A;  2ZHA A;  4KLD A;  2PFN A;  4X4O A;  4O0I A;  3G6Y A;  4XQ8 A;  3V7L A;  4MEX A;  3RAQ A;  4DOB A;  3TQ1 A;  1X9S A;  1PX5 A;  4O5K A;  3OJS A;  9ICH A;  4DSK A;  2RFF A;  3HIY A;  3NTU A;  3N4M B;  2PI5 A;  3L9D A;  3RB3 A;  4B9S A;  3H38 A;  2BDP A;  3OVA A;  2V4Q A;  9ICK A;  8ICF A;  5KFH A;  1BPY A;  4DF4 A;  3RR8 A;  1ARO P;  5DB7 A;  3C66 A;  3N97 B;  4B9M A;  4J9N A;  3AQN A;  1TK8 A;  2V9W A;  3JPQ A;  2F1H A;  3EPG A;  8ICY A;  3GFK B;  3V6H A;  3ZDE A;  4MFF A;  3UQ2 A;  1BPD A;  4UB4 A;  1RYR A;  4R63 A;  2HW3 A;  4KLS A;  4UBB A;  5BOL A;  3RRG A;  3T5L A;  2ZJA A;  5IIK A;  1S0M A;  4F5P A;  4NLZ A;  2ZH1 A;  2KZ3 A;  5DGB A;  5J0P A;  3TAN A;  4QZG A;  5J2F A;  3IM1 A;  3LWM A;  3C5G A;  5KFM A;  2R8K A;  4E0D A;  1ZQH A;  5DQI A;  3SYZ A;  4DEZ A;  2DPJ A;  4KLQ A;  4QZA A;  4ECQ A;  4IRK A;  4IQV A;  9ICP A;  3MGH A;  5KT2 A;  4JV0 A;  4YMN A;  2DFL A;  1SKW A;  5KFR A;  1UT5 A;  2J6U A;  2XGP A;  1S0O A;  4RWP A;  1SKR A;  1ZQW A;  4RQ6 A;  2IMW P;  4RU9 A;  2P6U A;  5HRF A;  2W9M A;  2M9N A;  5KFK A;  4AT9 A;  4MEY A;  2XY5 A;  1CUK A;  1TKD A;  1LB2 B;  2BCV A;  8ICA A;  2FLN A;  4IQW A;  3Q8M A;  1ZQQ A;  2ZH2 A;  4JWN A;  4AT8 B;  8ICK A;  4GC6 A;  4IQT A;  2M2V A;  1VFG A;  2MAX A;  4PHE A;  2BPF A;  1UEV A;  3ISB A;  4WC2 A;  3JPP A;  2HHX A;  1S97 A;  3KHH A;  3V7K A;  4EBD A;  2BCQ A;  2W9C A;  4IRC A;  2ID1 A;  2ZJ8 A;  3H8J A;  4YR2 A;  7ICE A;  8ICV A;  4NKT A;  4UD4 A;  1JXE A;  3EW9 A;  5EWE A;  1D9F A;  3QZ8 A;  3BQT A;  3AUO A;  4RQ1 A;  4JUZ A;  4YQW A;  3GV8 B;  1T3N A;  1ZQE A;  4HYK A;  5DEC A;  9ICC A;  4BGD A;  1R8B A;  2ZUC A;  4O3O A;  3FDS A;  4QZH A;  4PHA A;  2R8G A;  1BNP A;  7ICH A;  3WFO A;  2ISO A;  2PBE A;  5DG7 A;  4QWC A;  1ZQR A;  4ECW A;  1NJY A;  5DBC A;  4R8U A;  4QZB A;  3G6X A;  3PX6 A;  3RJK A;  5KFF A;  4DSJ A;  3RJH A;  1IM4 A;  4KLU A;  2XY6 A;  8ICL A;  1NZP A;  2NRT A;  4DLE A;  3RJI A;  2HHW A;  1XO1 A;  4F5O A;  5DGA A;  1N48 A;  1ZQD A;  4TUR A;  5KG0 A;  5J0T A;  2W9B B;  3T3F A;  3SI8 A;  3RBE A;  4O3R A;  3H8S A;  1U45 A;  5HRG A;  5J2D A;  5IIN A;  3RJE A;  1CEZ A;  2M2W A;  4FHX A;  4YXJ A;  2FLP A;  1WCL A;  3OGU A;  3EPI A;  1ZQN A;  2JEF A;  5HRK A;  5J0Y A;  1JX4 A;  2BQ3 A;  3QEA Z;  4O3Q A;  1TV9 A;  3ZDA A;  4XQ7 A;  5DG9 A;  1NJZ A;  1BVS A;  9ICO A;  1L3V A;  5KTQ A;  4QZE A;  3AQM A;  3Q8P B;  2JZB A;  4K4I A;  4X0B A;  4M6W B;  1WOT A;  1EXN A;  8ICM A;  1BPE A;  4EBJ A;  4RNN A;  1MIW A;  4ECX A;  4I27 A;  4YP3 A;  3TFS A;  4DFP A;  9ICT A;  4B9U A;  2JZB B;  5IIO A;  3M9M B;  5HP4 A;  1SL2 A;  2AGP A;  3WFP A;  1A76 A;  5IIJ A;  4I2J A;  1KLN A;  5KFL A;  3PR4 A;  4KMU A;  4YMO A;  3RB6 A;  8ICJ A;  1NJX A;  3MFH A;  2KN7 A;  2RDJ A;  2BPC A;  1DK2 A;  3QZ7 A;  3C2K A;  2UVR A;  4KLI A;  8ICC A;  3AQK A;  4X4T A;  4IG8 A;  4DQR A;  4CCH A;  2ZTC A;  5KT5 A;  2PFO A;  4EBK A;  5III A;  8ICW A;  2ATL A;  1QSS A;  1KTQ A;  1XU4 A;  1KEJ A;  4GXI A;  3OV7 A;  4YN4 A;  4YG2 A;  5CR0 A;  4NLK A;  9ICI A;  3ZD8 A;  3RB4 A;  4RQ2 A;  3ETL A;  5KG3 A;  1ZQP A;  3ZDD A;  4I28 A;  4J9R A;  4WBY A;  1ZQX A;  3SV4 A;  4F4K A;  1U4B A;  4DSI A;  4M9H A;  4KLJ A;  4PGQ A;  1NK8 A;  2IHM A;  3JPS A;  5KFI A;  1ZET A;  2FLL A;  4KLL A;  1MIY A;  5KG2 A;  4RQ4 A;  8ICE A;  3ZD9 A;  3BQ1 A;  4EYH B;  1DOQ A;  4E8F A;  3MBY A;  1DGS A;  5DLG A;  4ECT A;  4WC7 A;  1TFW A;  3V6K A;  2I1Q A;  5KFC A;  4M5D A;  3MFI A;  5DB9 A;  5DG8 A;  4R64 A;  3GIK A;  4ECZ A;  2A1J A;  4M2Y A;  4DFJ A;  4G3I A;  2J6S A;  4F91 B;  1MSW D;  4F50 A;  2KFN A;  2NRV A;  1U49 A;  4ELV A;  2R8I A;  1NOM A;  4AT8 A;  4F4Y A;  1ZQO A;  3V72 A;  3RRH A;  2P66 A;  5J0S A;  1OU5 A;  2DR8 A;  5KT6 A;  3ISD A;  1JAJ A;  1XWL A;  2Q0Z X;  4QWD A;  3M9N B;  4DOC A;  1COO A;  1ZQF A;  4O9M A;  9ICJ A;  3JPR A;  3KHL A;  1S0N A;  4I2H A;  2HHU A;  4JK1 A;  1B22 A;  4O3S A;  4GC7 A;  4X4Q A;  5L1K A;  2NRX A;  3UXP A;  1B43 A;  4P4M A;  3HWT A;  4DL7 A;  4RNM A;  3PO4 A;  2ZUD A;  4O3P A;  4IR9 A;  4GXJ A;  4FHY A;  1NKE A;  3TAQ A;  1MQ3 A;  1L5U A;  4MFC A;  4J9K A;  1NJW A;  4KLH A;  4M6W A;  2BHN A;  2RDI A;  4WC4 A;  2LYH A;  4WC5 A;  5DLF A;  4I2F A;  4FS1 A;  5KG5 A;  5HHI A;  4ELT A;  1XSN A;  7ICQ A;  4FBU A;  8ICX A;  3EWA A;  4P4O A;  4Q44 A;  1Q79 A;  5J0Q A;  2WTF A;  5KFP A;  2W9C B;  4QZ9 A;  4TUS A;  3QEB Z;  2BCU A;  5KG6 A;  5CP2 A;  2HVH A;  4YCX A;  5DQH A;  3RJF A;  3K75 D;  1RPL A;  3C21 A;  2C2R A;  1XSL A;  5J2B A;  5KG7 A;  4F4W A;  1U47 A;  2C28 A;  2MUT B;  5EWG A;  2MUT A;  3C1Z A;  4QW9 A;  4DL5 A;  1S9F A;  1XSP A;  1KSP A;  9ICR A;  4AT9 B;  4DL6 A;  8ICH A;  2H5X A;  2FPL A;  1Q78 A;  1BPB A;  4WCW A;  9ICV A;  9ICM A;  3GII A;  1TAQ A;  4RPY A;  1QTM A;  4YXM A;  5F9L A;  5KFY A;  3ZDC A;  3TFR A;  4I2I A;  4ECY A;  3JPO A;  3RTV A;  4C8M A;  1PZN A;  4C8K A;  1L3T A;  4I2E A;  3M8R A;  4KLE A;  4DL4 A;  8ICP A;  4O5E A;  4RZR A;  5CHG A;  5F9N A;  3PNC A;  2O5A A;  4DSL A;  9ICW A;  5C5J A;  1NK9 A;  1NK0 A;  3OVB A;  1V9P A;  2Q66 A;  2HHV A;  4IQU A;  1QLN A;  7ICI A;  4UB2 A;  2HVI A;  5HRI A;  4ED2 A;  3PY8 A;  5J0W A;  4ELU A;  4NKU A;  4B9N A;  1NK5 A;  1C7Y A;  2JEI A;  8ICT A;  7ICL A;  5J0U A;  8ICI A;  4ED6 A;  2KP7 A;  5HR9 A;  4ED7 A;  5KT7 A;  1SKS A;  4XRH A;  1UA1 A;  2DRB A;  3M8S A;  5KFV A;  2ZHB A;  2W8K A;  4DSE A;  1SZP A;  1Y88 A;  5DB6 A;  4EBE A;  2KFZ A;  3PX4 A;  7ICK A;  4ZH4 A;  9ICF A;  4NM1 A;  2A1J B;  4I2C A;  1X9W A;  5CWR A;  5L1J A;  5HC9 A;  4QWE A;  3BQ2 A;  3OJU A;  3THV A;  4BXO B;  2AJQ A;  2HHQ A;  9ICS A;  2DVI A;  3TAP A;  4F5N A;  2O1P A;  1R89 A;  3NYB A;  5L1I A;  3Q8L A;  4X4V A;  5HRE A;  4ED0 A;  7ICN A;  4JWM A;  2BCR A;  4J9S A;  1RYS A;  2AQ0 A;  4X4P A;  1TFR A;  3C1Y A;  5D4B A;  4TUQ A;  4C8L A;  2F1J A;  1ZQU A;  4ED3 A;  4M9J A;  3M9O B;  3UXO A;  5J0X A;  4UB5 A;  2KTQ A;  4I2G A;  4FHV A;  4RWQ A;  1D8L A;  3RB0 A;  1SL1 A;  2OWO A;  3WFS C;  1X9M A;  5J2K A;  1T8E A;  4O5C A;  4C8O A;  2ZH3 A;  4DQI A;  2JEJ A;  5HNK A;  3HW8 A;  2XGQ A;  3HJ4 A;  4WC1 A;  8ICB A;  4UD5 A;  1Z00 B;  2C22 A;  4UQG A;  4X0A A;  3AQL A;  4RUC A;  3MR3 A;  2PI4 A;  2NRW A;  4F2R A;  4JV1 A;  3BJY A;  7ICR A;  3K4G A;  3SZ2 A;  1LV5 A;  4TQS A;  3LDA A;  1ZQL A;  1ZQB A;  4Q8E A;  2DR7 A;  4RWN A;  3OVS A;  1ZQM A;  8ICN A;  4E7X A;  1YLQ A;  4M47 A;  4K4H A;  5J2G A;  3C2M A;  1RXW A;  1U9L A;  4YD2 A;  2UVW A;  5KFQ A;  5KFW A;  1RXV A;  1K1Q A;  2AGQ A;  1S76 D;  5DBB A;  4QZ8 A;  3H40 A;  2ISP A;  1QSY A;  1N56 A;  1ZQG A;  2V4R A;  4MFA A;  4Z6E A;  2ZTD A;  5J0O A;  4K4G A;  4M9L A;  4KLO A;  4ATB A;  1XS9 D;  5KG1 A;  4F92 B;  5KFD A;  3H3A A;  3OHB A;  1UA0 A;  4LZG A;  5KFZ A;  4F3O A;  1KFT A;  5HRH A;  3EYZ A;  3Q8K A;  1ZQJ A;  4UAZ A;  2ASD A;  1XC9 A;  9ICL A;  3OUY A;  4RWO A;  1K1S A;  3PVX A;  1ZYQ A;  1SL0 A;  3JYY A;  5DED A;  5KFU A;  3NGD A;  3MR5 A;  4F5Q A;  2FMS A;  4DFK A;  2F1I A;  3LWL A;  4LVS A;  1R8C A;  1KFS A;  3C2L A;  4IRD A;  5EWF A;  1KNY A;  2GWS A;  5J2H A;  2ZJ5 A;  2XY7 A;  4NXZ A;  2BGW A;  4NY8 A;  3OHA A;  1ZJN A;  9ICG A;  1D8Y A;  7ICS A;  2HHP A;  4Q8F A;  3ISC A;  4WC6 A;  1VJ7 A;  3QE9 Y;  4MF8 A;  2ASJ A;  1NK6 A;  2IA6 A;  3HJ1 A;  4RUA A;  3V6J A;  5L9X A;  3G6V A;  1TVA A;  2R8H A;  3T5J A;  4IR1 A;  3FYH A;  4DL2 A;  4O3N A;  1NK4 A;  2BR0 A;  4J9P A;  5KG4 A;  1NK7 A;  3Q8R B;  4I29 A;  1ZQV A;  4X4N A;  9ICN A;  2PXI A;  4NLN A;  5CJ7 A;  4DSF A;  1KDH A;  4R65 A;  4X5V A;  4PGX A;  2ZH7 A;  9ICU A;  4WC3 A;  4M9G A;  4ECU A;  5HML A;  2ZH6 A;  3UPQ A;  5CA7 A;  2BQR A;  4JV2 A;  3GIL A;  3E2E A;  2J6T A;  4EZ6 A;  4FHW A;  4AT7 A;  1ZQK A;  3Q8S B;  3H4D A;  2ZH8 A;  2VA8 A;  1JXL A;  2C2E A;  1JN3 A;  4DLG A;  4MF2 A;  4YR3 A;  3MDC A;  4UBC A;  5DDM A;  3HP6 A;  2DR5 A;  4J9Q A;  2DR9 A;  3MDA A;  3V7J A;  1HUO A;  4WBZ A;  5J2I A;  3PW5 A;  3PW2 A;  7ICV A;  3RH4 A;  2BQU A;  4ECR A;  3H39 A;  1S10 A;  1ZQC A;  2AGO A;  2KZM A;  1T4G A;  7ICU A;  4I2D A;  2W8L A;  4B9T A;  3WFQ E;  5KFG A;  2R8J A;  2XC9 A;  4GXK A;  5J2A A;  3OSN A;  3C5F A;  3RH6 A;  9ICX A;  2FPM A;  4FH3 A;  3PML A;  1ZQY A;  4ECS A;  4DO9 A;  4C8N A;  2VAN A;  4QZC A;  5J2J A;  5D49 A;  4P4P A;  1ZJM A;  4RQ3 A;  8ICR A;  5KFJ A;  3T5K A;  4J9L A;  4DQS A;  2DPI A;  3LK9 A;  2ZH9 A;  1HJP A;  3PMN A;  4F8R A;  5D46 A;  3C23 A;  3MAB A;  1ZQS A;  4EBC A;  5HHH A;  1UET A;  5J29 A;  4ED1 A;  2BKE A;  3HX0 A;  2ZH5 A;  4B9L A;  1JMS A;  1ZQZ A;  5DQG A;  4KTQ A;  5DDY A;  9ICB A;  1RZT A;  4XUS A;  4DOA A;  1BGX T;  4RNO A;  3Q8Q B;  5KT4 A;  3C18 A;  2JEG A;  3PW4 A;  4E80 A;  5HRD A;  1S77 D;  4ED8 A;  3GIM A;  2Y1J A;  1A77 A;  4KN4 A;  3PR5 B;  3PW0 A;  5L1L A;  2W9A A;  4DS4 A;  4BWM A;  5DBA A;  3RAX A;  2PFQ A;  5TZV A;  7ICJ A;  5HRB A;  4YVZ A;  5IIL A;  2VA3 A;  3RJJ A;  2Y1I A;  5DB8 A;  3PV8 A;  1UT8 A;  3AU2 A;  3TI0 A;  1NKB A;  3ZDB A;  4FH5 A;  5IIM A;  3RH5 A;  3H4B A;  1NKC A;  8ICS A;  2DRA A;  8ICZ A;  4RPX A;  5JUM A;  4RPZ A;  4RQ5 A;  4F93 B;  2FPK A;  4PPX A;  4NLG A;  1Z00 A;  2ZTE A;  4KLT A;  1S0V A;  1MQ2 A;  5J2E A;  2AU0 A;  2ASL A;  4YD1 A;  1MC8 A;  5KFX A;  4UAW A;  1JIH A;  3GV5 B;  3PW7 A;  3OSP A;  4KLF A;  7ICM A;  7ICT A;  4F2S A;  2NRZ A;  4M0A A;  9ICE A;  2I9G A;  4PH5 A;  9ICQ A;  4F5R A;  4PGY A;  4R8U B;  2M2T A;  3ORY A;  4QW8 A;  3H37 A;  4TQR A;  4ECV A;  1ZQT A;  3KHR A;  2PFP A;  3OUY B;  4YMM A;  1FA0 A;  4P2H A;  4RQ7 A;  3MR6 A;  4I2B A;  3IHQ B;  4YR0 A;  1UEU A;  4LT6 A;  5KFA A;  4FHP A;  3TAR A;  1NO5 A;  1WCN A;  3EZ5 A;  1TK5 A;  4X4U A;  5BOM A;  4Z6F A;  4XA5 A;  9ICA A;  4EYI B;  4I2A A;  7ICO A;  2C2D A;  1V4A A;  4EEY A;  4M04 A;  1MIV A;  4YFK A;  3KTQ A;  1TAU A;  3PO5 A;  4KIT B;  4BXO A;  3JPN A;  1H38 A;  1BPZ A;  1D9D A;  4EZ9 A;  3AU6 A;  3LQC B;  1TFY A;  2BCS A;  4DWI A;  2UVU A;  4BWJ A;  1HUZ A;  4Z6C A;  1TK0 A;  1F5A A;  3PX0 A;  4F4X A;  1DK3 A;  8ICO A;  1ZQA A;  1QSL A;  4UAY A;  2FMP A;  4QWB A;  4FBT A;  8ICG A;  1L3U A;  2XO7 A;  3BQ0 A;  5J2C A;  2VA2 A;  4DFM A;  2BPG A;  4M9N A;  2P6R A;  4UB3 A;  2IHN A;  2UVV A;  5EOZ A;  3SV3 A;  2HHS A;  4GLX A;  5KFB A;  3T5H A;  4RQ8 A;  3HPO A;  2NRK A;  3JZ0 A;  7ICG A;  4Q43 A;  4R66 A;  4RQ0 A;  1ZQI A;  4X4S A;  5HRL A;  1X2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...