4PGYA

Structure of human dna polymerase beta complexed with a nicked dna containing a gt at n-1 position and gc at n position
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The spontaneous base substitution mechanisms of human DNA polymerase beta
rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pgyA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pgyA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pgyA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pgyA03
5HHHA 2V4RA 5DLFA 1UA1A 1ZQDA 5KFDA 2ZUBA 2BQUA 1AROP 3GQCA 4M6WB 4PPXA 3Q8PB 3MBYA 3Q8MA 1U47A 3BDPA 1ZQAA 3AQMA 1TK0A 3AUOA 2FPLA 3IM1A 5KFYA 5HRDA 4LZDA 5IIJA 3HPOA 3SYZA 3H3AA 4RWQA 3G6VA 1FA0A 7ICOA 3GV5B 2ZH8A 2ALZA 4RPXA 2R8JA 5DB8A 8ICLA 5J0WA 4GC7A 2AQ0A 2ZH9A 4IRDA 5KFCA 1ZQNA 1S0NA 4IRKA 8ICRA 4I2AA 4WC3A 3ZD9A 5KFVA 3Q8KA 4WC7A 5DDYA 5EWGA 2HHXA 3M9OB 3RTVA 5DG8A 3MFHA 3M9NB 5J29A 5DB6A 2BQ3A 4JV1A 3SV4A 5DDMA 2BCQA 4UBCA 2J6UA 2W9AA 3V7KA 5CP2A 4KN4A 2JEFA 5L1KA 4TQRA 7ICGA 1T4GA 4M6WA 1ZQMA 5KFGA 3AU6A 2Y1JA 8ICCA 4Q44A 1B22A 4ECTA 4F2SA 3N4MB 1S0OA 3TAPA 3RR8A 3AQLA 3OVBA 4I2EA 2A1JA 4ZH4A 4ED2A 1TKDA 1QSSA 2ZTCA 1ZQOA 1ZQIA 2FMSA 4WC1A 3T3FA 2PFPA 4RQ5A 1ZQVA 2KZ3A 5KG0A 4R63A 3GV8B 1Q79A 3EYZA 3UQ2A 3AU2A 5IIMA 2NRWA 1WOTA 2J6TA 5L9XA 4FHPA 1JN3A 3SI8A 4ECXA 9ICLA 2F1JA 3RR7A 5J0RA 4HYKA 1BVSA 3PW5A 3TAQA 4Z6EA 4QWAA 3TFRA 5HRLA 3UPQA 1HUOA 2UVRA 4DL2A 7ICQA 3HIYA 4NY8A 3PO5A 3L9DA 3HP6A 1KLNA 1XO1A 4DWIA 1DK2A 3T5KA 1XS9D 2F1IA 3OV7A 1S9FA 4I2IA 5CWRA 1ZQPA 4K4IA 3PX6A 4YXJA 1NKCA 1MQ2A 4B9VA 8ICGA 1A76A 3V6JA 2ATLA 1MQ3A 3FDSA 5KT7A 5HRFA 4DQQA 4NKTA 1SL0A 4ELTA 5BPCA 4QZ8A 1NJWA 2ZHBA 4RQ4A 2ZTEA 3PVXA 2W8KA 2C28A 4M9GA 5KFIA 3OHAA 9ICCA 3HWTA 1U45A 4ED3A 4K4HA 3H4BA 2HW3A 2HVIA 3C2LA 2HHSA 2VA8A 1KTQA 1X2IA 2NRVA 4C8KA 2HHUA 4F91B 4DSEA 8ICJA 3C2MA 2BPGA 4EBJA 3LWLA 1JX4A 2XCAA 5HC9A 4EZ6A 2C2DA 2AGOA 1NOMA 1T3NA 2BGWA 3GV7B 2I9GA 4IR9A 3RJFA 1NK9A 4JWNA 9ICEA 3MFIA 4AT7A 3NTUA 4XQ8A 3H39A 1SZPA 2NRXA 4KLUA 4I2HA 3RH4A 4KLIA 9ICBA 2J6SA 4O3NA 4JV0A 3EPGA 4DSFA 8ICPA 4YMNA 1ZQUA 9ICJA 2ID1A 1RYSA 4O3QA 3QZ7A 4KLHA 1F5AA 2FLPA 3RRGA 4KTQA 2BCRA 4WC4A 3BJYA 2BQRA 2UVWA 4AT9B 4DL6A 4R8UA 2ASLA 5J0UA 4DLEA 3C1ZA 1COOA 3C23A 5IIKA 5KFJA 1JXEA 5J0PA 2BR0A 4F4WA 1N56A 4KLJA 4MFCA 4P2HA 1NK7A 5J2BA 4TQSA 7ICEA 1XU4A 4QW9A 1JQRA 4J9KA 2R8GA 1ZQGA 4DF4A 3SZ2A 4PHDA 4F8RA 1RYRA 4TURA 4FH3A 1S10A 3EW9A 3OUYA 4RNNA 1EXNA 4X4OA 4NLKA 2Q66A 4UB3A 4WBYA 1ZQWA 4M04A 7ICNA 5EWFA 4UAWA 1BPYA 1R89A 1RPLA 4ECYA 4FO6A 5L1JA 2XCPA 3HX0A 1ZQSA 1BNPA 1ZQJA 2O1PA 4YMOA 3UQ0A 9ICNA 1NO5A 5J0XA 4RQ1A 3JYYA 4TUQA 1ZQLA 2KFZA 3BQ1A 2BCVA 4O3OA 2W9BB 4KLEA 4NM2A 2Y1IA 4J9LA 1JXLA 1L3VA 2JEIA 4M0AA 4LT6A 5J2DA 4QWBA 3PW7A 3G6YA 5DGAA 1UT5A 4JK1A 4IG8A 4QZFA 4ECZA 3PX0A 2ZH6A 5KT6A 8ICYA 5J0SA 4KLTA 5DLGA 4E0DA 1ZQKA 1UEVA 3MR6A 4X4UA 2IHNA 5D4BA 2ISOA 2HHTA 2AJQA 4DSIA 3SV3A 2NRZA 5DGBA 9ICQA 4I2DA 4FH5A 4KN7A 4F5RA 5DB7A 2AU0A 2AGPA 1VJ7A 2JZBA 2ZTDA 4P4OA 1TFRA 9ICSA 4BWMA 3PW0A 3ZDCA 7ICFA 1RZTA 4YFKA 4NKUA 4QZIA 4EYHB 3NGDA 4GXIA 4ED7A 5HREA 4MEXA 5F9LA 4B9NA 4F3OA 2KFNA 2I1QA 4ECRA 4ELVA 1TFYA 4F4YA 3H7IA 2A1JB 3OUYB 1Z00B 1BGXT 1BNOA 4ED1A 3LK9A 3PV8A 4KLLA 2VA2A 5C5JA 1Y88A 4R64A 1T7PA 1NKEA 3LDAA 4QZAA 4GXJA 1X9WA 8ICNA 4DSLA 7ICVA 4EBKA 2P6UA 4NLGA 9ICAA 1KRPA 4F2RA 4DQSA 4KLMA 4RQ7A 3RJGA 4TUSA 4RWOA 4YVZA 4ECQA 4QW8A 2HVHA 5HMMA 2ZUDA 1MC8A 4YD2A 2VA3A 5KFHA 2AQ4A 1NK8A 5EWEA 4PHPA 3RH6A 2MUTA 7ICMA 2DVIA 2M2UA 2XY7A 3GFKB 4BWJA 5KG1A 3OJUA 2ASJA 4Q8EA 4TUPA 1D9FA 3NYBA 4O5EA 3ZD8A 4UB2A 3MDCA 4I2FA 4M9JA 1ZQXA 1OU5A 4GC6A 2H5XA 4RU9A 3JPSA 1KFTA 2DR9A 4Z6FA 2XGQA 3UXNA 4F5OA 4RQ8A 3PR5B 1ZQZA 1CUKA 4PGQA 2PFQA 3GIIA 1DOQA 1XSPA 3BQ2A 1BPBA 3C1YA 5DG7A 2LYHA 4C8MA 4NM1A 2W9MA 5HRIA 4RQ2A 7ICHA 1U9LA 1KEJA 3K75D 5KG3A 1Z00A 2BDPA 4DOBA 7ICTA 4KLFA 5F2VO 9ICVA 9ICWA 5HRBA 3JZ0A 1NK6A 5BOMA 4X4RA 4R8UB 2IHMA 1TV9A 4B9SA 4ECUA 2ZJAA 3ORYA 5J0QA 5DBAA 3MGHA 4B9UA 2C2RA 3KHHA 4DQPA 1U4BA 4RWPA 4UAYA 3T5HA 1S97A 2F1HA 4DQRA 2FLLA 4X4TA 5KFQA 3PR4A 4MFAA 1D8YA 4QZCA 1MSWD 3OJSA 3KHGA 3PW4A 1ZJMA 4DSJA 2M2WA 4PGXA 2FMQA 4EBEA 4RQ3A 4WBZA 5CJ7A 3JPTA 4J9NA 3ZDBA 4RQ6A 7ICUA 3RJJA 4IQVA 3RAXA 2XC9A 3B0YA 5J2AA 4KLSA 4MEYA 3ZDAA 1TAUA 2BCSA 1ZJNA 1NK5A 4NXZA 3RH5A 4ELUA 2RFFA 5DEDA 4X4QA 1YLQA 2W9BA 1U49A 1NJXA 4K4GA 2DR5A 2IBKA 5L1IA 5KFZA 3OGUA 7ICKA 5KFWA 4UB4A 2M2TA 4F5QA 5KG5A 4YCXA 7ICLA 5KT4A 1QLNA 1KSPA 2ISPA 1T8EA 7ICSA 3PNCA 3M9MB 2RDJA 4YP3A 1S77D 2KZZA 5J2GA 4QZDA 2KZMA 1XSLA 1CEZA 5KFSA 4EBDA 1BPEA 5IILA 2C22A 4JWMA 9ICHA 4FHWA 2W9CA 8ICVA 1Q78A 4WC6A 5CHGA 4YR2A 3PMNA 3V7JA 4RPZA 3ISBA 4RQ0A 2ZH2A 1ZQFA 9ICFA 5KFUA 3EZ5A 1SKWA 4XA5A 5KFLA 4RNOA 1LB2B 4MFFA 2Q0ZX 5IINA 4WC5A 2C2EA 3RB6A 3QE9Y 1V4AA 5CB1A 1XSNA 4PHAA 2FMPA 4J9OA 4DL5A 4RUCA 1QSLA 5DQHA 3V6KA 1ZQTA 4X4PA 4Z6DA 3M8SA 2GWSA 2P66A 1TK8A 4EZ9A 5JUMA 3OVAA 5DQGA 4I2JA 5CR0A 1R8CA 2ZH4A 1ZQRA 4M9LA 3UPSA 1NJZA 4UBBA 4DLGA 2WTFA 4UD4A 4M2YA 3BQ0A 5DBCA 3JPPA 3C5FA 2BHNA 5HMLA 4LVSA 4DS4A 1SL1A 8ICXA 1D9DA 2DRBA 4O9MA 4AT7B 2V4QA 4FBTA 2IA6A 2JEGA 4XRHA 2V9WA 2HHQA 5TZVA 2VANA 2DPIA 4FHXA 9ICKA 5HRHA 4FHVA 4B9LA 4ATBA 1L3TA 4M47A 3PO4A 4BXOA 3H8WA 4R66A 8ICKA 4EP7A 4O3PA 3RJIA 4AT9A 4KITB 2IMWP 4ECSA 3UXOA 4DL3A 5J0TA 4UB1A 1S76D 3H37A 5KG6A 5KG4A 1RXWA 3WFPA 5KFBA 4O5KA 1MIVA 2NRKA 2MUTB 4KMUA 3HJ1A 2R8HA 4I28A 1S0VA 9ICIA 2BKEA 2R8KA 3T5LA 4DQIA 4KLGA 5IIIA 4QZGA 4Q45A 8ICBA 8ICIA 2O5AA 5J2IA 2RDIA 5KFKA 3PX4A 4F4ZA 1X9SA 8ICSA 3LQCB 4M5DA 4GXKA 4J9QA 1C7YA 4I29A 9ICGA 3N97B 1BPXA 3H38A 2R8IA 3E2EA 2M2VA 3QEAZ 2B21A 1SKRA 5HNKA 4DFMA 3V6HA 5HP4A 3ZDEA 5KFMA 4QWCA 9ICMA 3C18A 4DS5A 4QZEA 3OVSA 3ISDA 3RB0A 3GIKA 4DFJA 4CCHA 4O3RA 4IQUA 3MGIA 3KTQA 4UAZA 4ED8A 4DEZA 1U48A 4X4VA 5DKWA 3TANA 3G6XA 3WFRE 3RBDA 4F93B 3Q8SB 3FYHA 4ED6A 4B9MA 4F4XA 2JZBB 5J2EA 8ICFA 1KNYA 4J9SA 3OHBA 4DL4A 3Q8LA 1MIYA 4YXMA 1K1QA 3KHLA 1Z3EB 1UA0A 1TAQA 4XUSA 4QZHA 4YQWA 3TI0A 5J2CA 3TQ1A 1RXVA 4UQGA 1HJPA 3C2KA 3RJKA 5KTQA 1ZQBA 2ZJ5A 4QWDA 2XGPA 3MR5A 4FBUA 5HRGA 4F5PA 4YR3A 1K1SA 2M9NA 5KFFA 5KG2A 3M8RA 3HW8A 4ECWA 3UXPA 1L5UA 3PY8A 3MDAA 2DFLA 2UVVA 7ICJA 4KLOA 3LWMA 3H40A 4JV2A 3JPOA 1B43A 2ZJ8A 3MABA 3TARA 4E80A 2FPMA 3IHQB 4IQWA 1BPZA 1NK4A 4JUZA 2UVUA 7ICRA 4MF8A 3H4DA 4E8FA 1WCLA 2DRAA 5KFAA 4F92B 4FHYA 4J9RA 1NKBA 4RPYA 3ZDDA 4I27A 4FS2A 3C66A 2PI5A 1SL2A 2PBEA 1QSYA 2ZUCA 4DL7A 8ICQA 4Q43A 2KN7A 1DK3A 1TVAA 4NLZA 4X4SA 1ZQHA 3ETLA 4R65A 4X5VA 4PGYA 3RAQA 4ATBB 4YD1A 8ICUA 3TFSA 2PXIA 4EBCA 1ZQQA 2BCUA 1ZQYA 5KFXA 1BPDA 2HHWA 1UEUA 4I2GA 4BGDA 4NLNA 1IM4A 5KT3A 3MR3A 5J2HA 4KLQA 1IXRA 5HR9A 4WC2A 5HHIA 3QZ8A 2HHPA 2KTQA 4WCWA 3C21A 3BQTA 5KG7A 2PI4A 7ICIA 4RNMA 1KFDA 2ZH1A 4UB5A 5J0YA 1N48A 4RWNA 4X0BA 1VFGA 3RJEA 3V7LA 2PFNA 1DGSA 4DSKA 1L3UA 4RT3A 3OSNA 1KFSA 2W8LA 4BDPA 8ICEA 5HRKA 2ASDA 1R8BA 3ISCA 9ICOA 4DFPA 3RJHA 1MIWA 1TFWA 4XQ7A 4C8OA 3KHRA 1ZQEA 2XY5A 1PZNA 5KFNA 5DB9A 4RT2A 2OWOA 4BXOB 4M9NA 1V9PA 4O3SA 3WFOA 4Z6CA 5DG9A 4J9PA 9ICPA 4AT8B 2DR7A 5KT2A 4DFKA 2XO7A 4O5CA 4I2BA 4F5NA 5J2FA 4E7XA 4O0IA 1HUZA 3H8SA 3C5GA 3OSPA 8ICZA 4YG2A 3K4GA 2ZH5A 2FPKA 3HJ4A 3HT3A 4WC0A 5BOLA 2HHVA 4G3IA 4DOAA 5J0OA 1SKSA 4C8LA 4DO9A 1L3SA 4YR0A 5KFTA 1TK5A 4B9TA 2BPFA 4LZGA 8ICWA 4F4KA 1QTMA 7ICPA 4IR1A 2KP7A 3THVA 3RB3A 4P4MA 3Q8QB 4AT8A 3GDXA 3EPIA 1XC9A 4IRCA 1ZYQA 1NK0A 5DQIA 2FLNA 2ZH7A 1KDHA 4ED0A 5KFEA 4P4PA 2DPJA 1JIHA 1ZQCA 4IQTA 3JPNA 8ICOA 3JPRA 3EWAA 1S0MA 2PFOA 3AQKA 2AGQA 8ICHA 4S3NA 2DR8A 1A77A 4FS1A 5D49A 1H38A 3WFQE 4PH5A 3B0XA 2MAXA 5KT5A 4ECVA 4X0AA 5L1LA 4RZRA 4PHEA 3RBEA 9ICUA 4YMMA 5CA7A 4J9MA 3PW2A 5KFPA 4C8NA 4EEYA 2BPCA 9ICXA 3H8JA 5DBBA 4QZ9A 5EOZA 3JPQA 4QZBA 1LV5A 4I2CA 2W9CB 2XY6A 1UT8A 5D46A 5IIOA 5J2KA 4EYIB 4GLXA 3V72A 4DOCA 3PMLA 4DF8A 5F9NA 3T5JA 3RB4A 1NJYA 2ZHAA 5KFOA 9ICRA 1PX5A 3AQNA 2ZH3A 4UD5A 3RRHA 2NRTA 3GIJA 3QEBZ 8ICTA 1UETA 3GILA 1NZPA 8ICMA 1WCNA 1XWLA 1D8LA 3MR2A 4Q8FA 5J2JA 5DECA 4RUAA 8ICAA 4YN4A 2BE3A 4KLDA 4QWEA 1X9MA 1ZETA 4F50A 4M9HA 3Q8RB 1R8AA 3GIMA 4X4NA 2JEJA 1JAJA 4MF2A 5KFRA 9ICTA 3WFSC 2P6RA 1JMSA
chains in the Genus database with same CATH superfamily
5HHHA 1PK1B 3GQCA 4M6WB 2KJ8A 2WF8A 2ZIVB 3Q8MA 3AQMA 5KFYA 4O68A 3SQIA 3GV5B 4Y2VA 5AICA 4Y2RA 3AEVA 4WC3A 2HSZA 1SB3C 1L8OA 3SV4A 1CRXA 2JEFA 7ICGA 5L1KA 4TQRA 4M6WA 4Q44A 4ZH4A 4ED2A 1QSSA 2ZTCA 1ZQOA 3MCRA 2KZ3A 1DGJA 5KG0A 4R63A 3GV8B 2FJ6A 2NO5A 3EYZA 1L7PA 3QUBA 4CRXA 1WOTA 2J6TA 3SI8A 1L6NA 1LKYB 2F1JA 3NVZA 2NYVA 4USAA 3TAQA 3CRXA 5HRLA 7ICQA 1Z4OA 3HIYA 3PO5A 3L9DA 2XVTA 4ZOHC 4O3MA 1NKCA 4YXJA 4B9VA 2K8CB 3SR6A 4G9BA 3FDSA 4NKTA 1SL0A 4OCZA 3ED5A 2ZHBA 2M0NA 4RQ4A 2ZTEA 2C28A 5KFIA 3L4PA 9ICCA 4GFJA 2KKVA 2HHSA 2BZFA 8ICJA 2NRVA 5AK6A 4DSEA 3KZIU 2BPGA 3LWLA 1YZ6A 2A1AA 4EZ6A 2AGOA 1NOMA 1T3NA 4IR9A 3GV7B 4JWNA 2E5SA 1NK9A 5AM1A 3MFIA 4KLUA 2J6SA 4O3NA 4OJPA 4F71A 1XO0A 3UM9A 2KD1A 3I1YA 2ASLA 4DLEA 5IIKA 3KKAA 1N56A 1SXDA 4U7CA 2HI0A 2ZXIA 4DF4A 4TURA 3F2CA 1S10A 3OUYA 4RNNA 1EXNA 4C80A 1IV8A 2VJ5A 4KM5A 4FO6A 5L1JA 2XCPA 1KBUA 1ZQSA 4YMOA 2GLEA 1PK3A 4TUQA 3BQ1A 2BCVA 4O3OA 4NM2A 2Y1IA 1L8LA 5J2DA 3G6YA 4Y2TA 3QNMA 2ESEA 3ALRA 3WKBA 4ECZA 3PX0A 5DLGA 4X4UA 2ISOA 2AJQA 4UW9A 2NRZA 1QH9A 2G09A 3VC8A 1CI4A 2KJ9A 9ICQA 4EX6A 2AGPA 5ALNA 4NKUA 4EYHB 2DGZA 1PVPA 5HREA 2DUYA 3L5KA 3NRZA 2K4EA 1Z00B 1BNOA 2K89A 4ED1A 5C5JA 3LDAA 4DSLA 9ICAA 1OW5A 4DQSA 4YVZA 4ECQA 1MC8A 4YD2A 5CRXA 5KFHA 2AQ4A 4PHPA 3RH6A 7ICMA 3EUB2 2ASJA 4O5EA 3MDCA 5ALYA 4CF3A 2H5XA 4RU9A 3JPSA 1TAMA 3UXNA 4UARA 2RHFA 2JMGA 1RYUA 3BQ2A 3C1YA 4NXWA 3F5EA 3D2QA 5ALJA 3K75D 1ECWA 9ICWA 4B9SA 5J0QA 4B9UA 3MGHA 2C2RA 4DQPA 4OAFA 1U4BA 2F1HA 5FP0A 4DQRA 5KFQA 3PR4A 1D8YA 4QZCA 3NUQA 4PGXA 2XI9A 1Z4NA 4J9NA 7ICUA 3F53A 3RJJA 4IQVA 2XC9A 2EDUA 4MEYA 3ZDAA 2BCSA 4ELUA 3WKEA 4X4QA 1U49A 2DR5A 7ICKA 5KFWA 2M2TA 2IOFA 4EEDA 1F0MA 1KL9A 5KT4A 3HRDD 3AMZA 2ISPA 3PNCA 4YP3A 4DCCA 2KZMA 2OH2A 1PVRA 2JRZA 2C22A 4YR2A 3PMNA 1SWWA 4LEZA 1JI7A 3EZ5A 5D63A 4MFFA 4IC9A 3RB6A 3QE9Y 5CB1A 3AQEA 4J9OA 5DQHA 1ZQTA 4X4PA 1TK8A 3OPXA 2B51A 5EE1A 4I2JA 2LBOA 1R8CA 3PSFA 4UBBA 1FEZA 3PHZA 8ICXA 5HMLA 4DS4A 1HEKA 3LYSA 5AM0A 2DF4B 5KL8B 4BJQA 2VANA 2DPIA 2WF9A 4B9LA 4ATBA 5AM5A 3PSPA 4M47A 4R66A 4QIWC 2I6XA 1RXWA 3WFPA 4O5KA 2GOLA 3WK8A 3HJ1A 1S0VA 2AH5A 2BKEA 4KLGA 4DQIA 4F4ZA 2GA9D 4M5DA 4GXKA 2CN1A 1C7YA 9ICGA 3H38A 2R8IA 2M2VA 1IG6A 4NXTA 3M7DA 5AI5A 2YTUA 4MKPA 3OVSA 3ISDA 3GIKA 4CCHA 3WK5A 5KAIU 4DEZA 5DKWA 3TANA 1YZ7A 8ICFA 2JZBB 5J2EA 4J9SA 5AKZA 4YXMA 3KHLA 1Z3EB 4K98A 1TAQA 4XUSA 3TQ1A 3ER8C 5ALXA 3C29A 4QWDA 4FBUA 4F5PA 1K1SA 2HHUA 5KG2A 3HW8A 4ECWA 4Y2JA 3PY8A 5ALKA 2UVVA 3LWMA 5AIBA 1B43A 2KG5A 4OJLA 1A6SA 2UVUA 4KX3A 4E8FA 1WCLA 4EEBA 5A0LA 4UATA 5ALPA 1ZD5A 2HCFA 2ZUCA 2LHTA 1ZQHA 1S5LU 1JUDA 3TFSA 1ZQQA 5EE3A 5KFXA 5CHEA 4BGDA 5KT3A 5HR9A 4UB8U 3VCBA 2E1EA 4X0BA 4DSKA 1UHUA 1L3UA 8ICEA 1R8BA 3RJHA 5F3XB 2AHOB 4M9NA 2PKEA 2LKYA 2ZIXA 4J9PA 5AI8A 2DR7A 2H3QA 2XO7A 2WF7A 4I2BA 1HUZA 5ALHA 8ICZA 3C5GA 2ZH5A 3SD7A 4WC0A 5BOLA 5D62A 3DEEA 2HHVA 4C8LA 1TK5A 2HN1A 1WWVA 4NLCA 2Q4TA 2ZIUA 1V38A 3EPIA 1XC9A 4IRCA 2KEYA 8ICOA 1WWUA 3JPNA 3JPRA 3AQKA 1A77A 4ECVA 3B0XA 3IRUA 1GO3F 2YB1A 4X0AA 5L1LA 2P35A 3RBEA 2G0AA 5KFPA 3O0FA 4EEYA 2W9CB 1BPXA 5D46A 4EYIB 5F9NA 3T5JA 2ZHAA 3AQNA 1PX5A 2ZH3A 4UD5A 3QEBZ 1UETA 3GILA 1WCNA 4YN4A 1QCKA 1R8AA 3GIMA 2JEJA 4MF2A 4WOYA 5KFRA 1AROP 1X42A 1VDVA 4PPXA 5JTGA 4J03A 4EV6A 1TK0A 3AUOA 1WYGA 5HRDA 2Y0SC 4Y2UA 3H3AA 7ICOA 2ALZA 2R8JA 2AQ0A 2MU2A 5KFCA 1ZQNA 1S0NA 1N5XA 3C28A 2KSOB 5EWGA 3M9OB 5J29A 2BQ3A 4JV1A 5DDMA 2HOQA 2BCQA 5AKYA 8ICCA 1T4GA 1ZQMA 5KFGA 2A1JA 1TKDA 2PFPA 2WFAA 3UQ2A 2NRWA 1OUQA 2CRXA 3RR7A 3UMBA 3PW5A 4Z6EA 3HKZF 4GIBA 4DWIA 1XS9D 2F1IA 2OEHA 4K4IA 1O08A 4OAHA 1MQ2A 8ICGA 4CDGA 5KT7A 4BX9C 3QXGA 4QZ8A 1NJWA 2OHFA 4OJ6A 3OHAA 4K96A 2XICA 2B4VA 2IUBA 3C2LA 2VA8A 1X2IA 3WU2U 4F91B 3C2MA 2DL0A 2FI1A 1JX4A 3UMGA 2XCAA 2W7OA 9ICEA 2I9GA 3RFAA 4O6AA 4AT7A 3SAGA 3H0LB 2NRXA 3LVWA 3RH4A 4KLIA 9ICBA 2D6FC 3OWGA 4JV0A 8ICPA 4YMNA 1Q3UA 1GPJA 4O3QA 3QZ7A 4KTQA 2BCRA 3D2NA 4AT9B 4DL6A 1ZD4A 3C1ZA 1COOA 1SWVA 5J0PA 5J2BA 4TQSA 7ICEA 1XU4A 1JQRA 1ZQGA 2QB0B 4FH3A 1J2MA 4UB3A 5HR6A 4UAWA 3WKAA 3ICXA 3HX0A 2O1PA 5J0XA 3QU2A 2KFZA 4C4SA 2W9BB 1C20A 2JEIA 2GAFD 2G06A 4QWBA 1Z1BA 4JK1A 3RF9A 5ALUA 5G5GA 4QZFA 2ZH6A 8ICYA 4E0DA 1D8BA 3WK9A 2NV3A 3H8MA 3MR6A 1UEVA 1RG6A 5D4BA 2IHNA 3H0MB 2W3RA 2ZIWA 4PJ0U 5DGBA 4FZMA 5DB7A 2W43A 2JZBA 2ZTDA 1TFRA 3TADA 7ICFA 4QZIA 4GXIA 4ED7A 2KFNA 2I1QA 5T14A 4ECRA 2IHOA 1TFYA 2MSNA 1Y88A 4R64A 1NKEA 1PUZA 4QZAA 2JH1A 5AI9A 2F76X 1KKXA 1L7NA 4KLMA 4RQ7A 3RJGA 1MN8A 2EZXA 4QW8A 4LJXA 2VA3A 5AKKA 3QUCA 5L1MA 1MA7A 2DVIA 2XY7A 1X66A 4Q8EA 3GZFA 1KFTA 2DR9A 2XGQA 4RQ8A 3PR5B 1ZQZA 3GIIA 1DOQA 1BPBA 5DG7A 5CFUA 4RQ2A 7ICHA 1U9LA 7ICTA 5F2VO 3JZ0A 4X4RA 2ZJAA 2W54A 2EANA 1SIJA 4RWPA 4UAYA 3T5HA 4MFAA 3OJSA 1ZJMA 4DSJA 4EBEA 4WBZA 5CJ7A 3ZDBA 3RAXA 5ALOA 1SZHA 3BQ7A 1TAUA 1FFVA 1YLQA 3QU4A 4Y2QA 2E3TA 5KG5A 4O69A 3QUTA 1UQVA 3M6KA 2G08A 2VJ4A 1S77D 4OO1J 4QZDA 2LM4A 1XSLA 4HAIA 5KFSA 5IILA 1BPEA 9ICHA 4JWMA 4K8VA 4P0PB 2W9CA 2EAOA 4RPZA 1V85A 2ZH2A 1ZQFA 9ICFA 5KFUA 1SKWA 2FDRA 4XA5A 4WH5A 3ZI4A 5IINA 4WC5A 1LVHA 2OYYA 2FMPA 2OCEA 2PMZC 4LEYA 2GWSA 4EZ9A 5DQGA 1ZQRA 4M9LA 2WTFA 4M2YA 1F5SA 5DBCA 2BHNA 3CNHA 2DRBA 1D9DA 3NS1A 4O9MA 2Y9UA 2IA6A 4QIWF 2HHQA 2VKQA 4FHXA 4K9BA 3PO4A 4O3PA 4ECSA 3H37A 5KFBA 1MIVA 2NRKA 1KW4A 2WF5A 3T5LA 4QZGA 8ICIA 5J2IA 1SGGA 8ICSA 3LQCB 4J9QA 2DWQA 3E2EA 3V6HA 9ICMA 3DV9A 4QWCA 2KICA 4DFJA 4IQUA 1IIPA 3KBBA 4ED8A 1U48A 3WFRE 3RBDA 4F93B 3Q8SB 5D61A 1V97A 2HBLA 3KOOA 1K1QA 1N60A 1UA0A 5ALMA 3NVWA 3C2KA 2F8LA 3KKAC 2ZJ5A 3MR5A 5TISU 3M8RA 1WUDA 4KLOA 4JV2A 4JB3A 2ZJ8A 3MABA 4E80A 3NVOA 4IQWA 1BPZA 1NK4A 7ICRA 4UAUA 2DRAA 5KFAA 4FZNA 4J9RA 2KE7A 4FS2A 2PI5A 2PBEA 1QSYA 2KN7A 1T3QA 2YB4A 4ATBB 4YD1A 2YMQA 8ICUA 4EBCA 4C4TA 2BCUA 1ZQYA 2HHWA 2PMZF 4OJ5A 4NLNA 3MR3A 3F2BA 2PI4A 4RNMA 5AKLA 4UB5A 4RWNA 1N48A 2PFNA 5AKHA 1KFSA 2W8LA 2Y9TA 5JTIA 2ASDA 3ISCA 3AQFA 5EE0A 1TFWA 1MIWA 5ALEA 3WK6A 4C8OA 3KHRA 5KFNA 4BXOB 4CGZA 1V9PA 4JLZA 3H0RB 3WFOA 1QQ5A 3IDWA 4AT8B 2JGAA 4DFKA 4O5CA 1N62A 5ALZA 5H2FU 2FPKA 1J2NA 3HT3A 1NNLA 2D8CA 5J0OA 1SKSA 4DO9A 1L3SA 4YR0A 4B9TA 8ICWA 2QKQA 3BS7A 2KP7A 2ZG6A 2KIVA 3RB3A 4P4MA 1NK0A 5GTIU 3A0BU 4C0ZA 4ED0A 5KFEA 4P4PA 1JIHA 4NWIA 2PFOA 8ICHA 4FS1A 5D49A 2MAXA 4MHVA 2B6GA 5CA7A 4J9MA 3PW2A 5HR7A 4C8NA 9ICXA 1Q46A 3JPQA 1LV5A 5AK3A 1UT8A 5IIOA 3RB4A 1NJYA 1LKYA 1AQ6A 4AYBF 2KMDA 1XWLA 5DECA 4PL1A 2JXJA 4X4NA 3WK4A 4AP9A 9ICTA 3WFSC 1JMSA 1QQ7A 4EENA 2V4RA 5DLFA 1UA1A 3EF2A 4OJOA 4P0QA 2ZUBA 2BQUA 1Q8KA 3MBYA 1U47A 3BDPA 1ZQAA 1K5OA 2FPLA 4CE6A 5ALTA 3HPOA 3SYZA 4RWQA 5DB8A 8ICLA 5J0WA 2ZH9A 4IRDA 2ES6A 4US8A 2W04A 8ICRA 4I2AA 2Z7JA 3ZD9A 3Q8KA 2HHXA 3RTVA 5DG8A 2W7PA 4QNLA 5DB6A 2J6UA 1Q3VA 5AM2A 3AU6A 2Y1JA 1PVQA 4F2SA 3N4MB 1S0OA 3TAPA 3RR8A 3AQLA 4P0PA 3K7DA 2FMSA 1VLBA 1ZQVA 1Q79A 3AN1A 3AU2A 5IIMA 4FHPA 2HMXA 4ECXA 9ICLA 5ALIA 2JH7A 1B4FA 4QWAA 3TFRA 3ONNA 1ZD3A 2UVRA 4DL2A 4NY8A 2R18A 4PZNA 1DK2A 3T5KA 2KKPA 3OV7A 4ACOA 5CWRA 3OTQA 2ATLA 4DQQA 4ELTA 5BPCA 1FIQA 2H3ZA 3PVXA 2W8KA 4M9GA 1U45A 4ED3A 2HW3A 3H4BA 4C8KA 1FFUA 3I28A 5AI6A 5AM4A 3B9JA 5HC9A 4HX0A 2BGWA 3N7RC 5J8YC 2BDUA 4XQ8A 1SZPA 4I2HA 1ZQUA 9ICJA 2QARA 1RYSA 1X6IA 1ZXIA 2DKXA 4KLHA 1F5AA 2FLPA 1L7MA 2KHVA 2BQRA 4KB6A 2UVWA 5J0UA 3C23A 2BR0A 2GO7A 5KFJA 4F4WA 4MFCA 4P2HA 3A0HU 2KIWA 1NK7A 2RQ5A 2QB0A 4J9KA 3SZ2A 1ZD2P 4F8RA 3EW9A 2Q66A 4NLKA 4WBYA 1ZQWA 7ICNA 4NJ8A 4CF4A 3QUQA 4Y2PA 1BPYA 4ECYA 1BNPA 1ZQJA 3UQ0A 9ICNA 1NO5A 4IL6U 4NL9C 1ZQLA 4KLEA 4K9AA 1L3VA 2F77X 3CP8A 5KAFU 3SEIA 3WKDA 5KT6A 5J0SA 3FM9A 5B5EU 1ZQKA 3KD3A 4DSIA 4NXUA 4I2DA 4FH5A 2F2AB 4F5RA 3AM9A 4CF5A 2E1FA 5ALWA 1RZTA 2YMLA 4B9NA 4F3OA 4ELVA 3LK9A 3PV8A 2VA2A 8ICNA 7ICVA 2P6UA 1S8OA 5AI0A 1XNSA 4F2RA 3BZKA 4TUSA 4RWOA 5HMMA 3D6JA 1HIWA 5GTHU 1NK8A 2KSOA 5EWEA 2MUTA 2M2UA 3QYPA 4BWJA 3NYBA 4JMUA 1D9FA 2BBJA 4M9JA 3PSIA 4I2FA 1OU5A 4GC6A 3I76A 1CUKA 4JLXA 2PFQA 1XSPA 4NM1A 2LYHA 4C8MA 1PK1A 3HKZC 1KEJA 2BDPA 5B66U 3ETRA 1L7OA 9ICVA 1M6YA 5BOMA 4PL2A 2LYAA 4R8UB 5DBAA 3KHHA 4X4TA 2A3VA 1MSWD 3PW4A 3KHGA 2FMQA 4RQ3A 3JPTA 4RQ6A 2HBJA 2WHEA 4K99A 3HJEA 2YY6A 1NK5A 2RFFA 4NXZA 5DEDA 2DQNB 2W9BA 4K4GA 1NJXA 2IBKA 4F5QA 2G07A 7ICLA 2WF6A 1KSPA 1T8EA 2ZIUB 2RDJA 4A8EA 1X40A 3KZXA 1CEZA 1Q78A 4WC6A 5CHGA 3V7JA 2HOFA 3NVVA 3ISBA 4LEVA 4RQMA 1NI3A 1LB2B 2Q0ZX 2C2EA 3U26A 4DL5A 4RUCA 2W03A 1QSLA 3QX7A 4Z6DA 2BBHA 3TADC 5JUMA 3OVAA 2ZH4A 2G5IB 2DKZA 3UPSA 1NJZA 4RQNA 2H3IA 3JPPA 4LVSA 1ZQ1C 2V4QA 4NV0A 4OD0A 4FBTA 2JEGA 1JALA 4XRHA 2V9WA 5TZVA 5HRHA 1L3TA 4N7RA 3RJIA 2EZZA 2IMWP 5AK5A 1S76D 4UB1A 4KX5A 3TKAA 2MUTB 2R8HA 4I28A 2O5AA 5IIIA 1N63A 2MA1A 2FE9A 2RDIA 3PX4A 1X9SA 4I29A 2B0CA 2VIXA 2B21A 5HP4A 3ZDEA 3C18A 4DS5A 5ALSA 4QZEA 3CK6A 3RB0A 4O3RA 4UAZA 4X4VA 2EAMA 2A19A 2RRDA 4Y2SA 1KNYA 4FFDA 4B9MA 4F4XA 3OHBA 1JROA 3SAHA 3TI0A 4YQWA 4KMOB 5J2CA 1RXVA 4UQGA 4OAIZ 2RLTA 2XGPA 4YR3A 1L5UA 2M9NA 5KFFA 3UXPA 7ICJA 4EBKA 2DFLA 1FO4A 3TARA 1F44A 5CFSA 2FPMA 3IHQB 4JUZA 5KL1B 3MC1A 4F92B 5ALQA 4I27A 1SL2A 2YX8A 4Q43A 4X4SA 3ETLA 4R65A 5AIAA 3RAQA 2K4IA 3NASA 1BPDA 1UEUA 4DFDA 1IM4A 2ZXHA 5J2HA 2E8NA 4KLQA 1IXRA 4WC2A 5HHIA 3UMCA 5KG7A 1KFDA 2G5HB 2ZH1A 5J0YA 1VFGA 3M1YA 3V7LA 4RT3A 5HRKA 1B0XA 5AI4A 4DFPA 4XQ7A 3AL0B 5DB9A 4O3SA 2XIDA 2KNJA 4Z6CA 2NO4A 4K97A 1SV0A 5J2FA 4O0IA 3OSPA 4YG2A 4US9A 3HJ4A 2RP5A 4DOAA 2WB1F 4B6JA 2MRLA 2BPFA 4LZGA 4F4KA 3LVVA 4IR1A 2HN2A 1RQLA 3THVA 3Q8QB 3GDXA 1N61A 2FLNA 2ZH7A 4IQTA 1S0MA 2HDOA 2AGQA 3QU5A 5KNIA 1T94A 9ICUA 3DDHA 4YMMA 2EAPA 4C7ZA 2BPCA 3D2SA 3H8JA 4QZBA 4AYBC 2XY6A 1KLNA 2KVCA 5HRBA 1ED1A 2YQEA 4DOCA 5KFOA 9ICRA 2NRTA 8ICTA 1RDFA 3T79A 1D8LA 5AKEA 3MR2A 3PSTA 5J2JA 4Q8FA 8ICAA 2BE3A 4KLDA 1X9MA 1ZETA 4F50A 4M9HA 1JAJA 2P6RA 3WK7A 1ZQDA 5KFDA 3Q8PB 3IM1A 2F44A 4LZDA 5IIJA 3G6VA 2E8OA 4Y2YA 1FA0A 2ZH8A 4RPXA 3N28A 4GC7A 1ZOLA 4IRKA 2QARB 1VJ5A 2N1RA 5KFVA 4WC7A 5DDYA 3MFHA 3M9NB 2K4HA 2W11A 2O6KA 4UBCA 2EZYA 2W9AA 5CP2A 1OXJA 4KN4A 3V7KA 1B22A 4P0QB 4ECTA 2D3DA 4QJFB 2DBYA 3OVBA 4I2EA 2JR5A 5ALDA 1ZQIA 4WC1A 3T3FA 2F8KA 4RQ5A 4FO1A 4WQKA 4XJEA 5L9XA 1JN3A 2I5HA 4ICAA 3JCFA 5J0RA 4HYKA 4IS7A 1BVSA 5ALFA 3UPQA 1HUOA 3HP6A 1XO1A 1DXSA 2JV3A 2K4PA 4I2IA 5AHXA 1S9FA 1ZQPA 3PX6A 5C0YA 1A76A 3V6JA 1MQ3A 2E8MA 5HRFA 4O67A 5ALRA 3HWTA 2W55A 4K4HA 4NXXA 2YN4A 2HVIA 1KTQA 4LEWA 3ERCC 4EBJA 2C2DA 3RJFA 2ZIXB 2ODGA 2WAQF 3NTUA 3N7PD 3H39A 1Z1VA 3BS5A 4DSFA 3EPGA 2ID1A 2IOFK 4C4RA 3RRGA 2K8AA 4WC4A 3BJYA 2OXOA 4R8UA 1KN5A 1JXEA 4FZLA 4KLJA 2Y0SF 3HILA 2JHDA 4QW9A 2R8GA 4PHDA 3E58A 1RYRA 1N5WA 4X4OA 5B3QA 2QLTA 2EWRA 4M04A 3L3FX 2LI6A 5EWFA 1Z19A 3FC4A 1R89A 1RPLA 5JRTA 3PZPA 3BZCA 4NL9A 3IP4B 4RQ1A 3JYYA 1ZRMA 3IV6A 1N2XA 5J8YA 1COKA 4LT6A 1JXLA 4J9LA 4M0AA 3TACB 4F72A 3J81j 3PW7A 5DGAA 1UT5A 4IG8A 2E8PA 2HOIA 4KLTA 2H3FA 3KFUF 3ER9B 2HHTA 3SV3A 5AKXA 2LMRA 4KN7A 2AU0A 1VJ7A 4P4OA 3K1RB 9ICSA 4BWMA 3PW0A 3ZDCA 4YFKA 3NGDA 4FE3A 1O03A 4MEXA 5JU5A 5F9LA 2QB1A 3SMVA 4F4YA 1YT3A 2A1JB 3H7IA 3OUYB 1BGXT 4KLLA 1T7PA 1X9WA 4GXJA 3N7SC 3FAHA 4UB6U 4NLGA 5G5HA 1KRPA 4UASA 1JRPA 4NLBA 2HVHA 2ZUDA 3GFKB 5KG1A 3OJUA 4TUPA 3QU7A 3ZD8A 4UB2A 1ZQXA 3F5AA 1TE2A 4Z6FA 4F5OA 5B3PA 2IOHA 4PGQA 2WAQC 1A0PA 1WG8A 2W9MA 5HRIA 2YMMA 3NWIA 5KG3A 1Z00A 1X6JA 2KK0A 1RM6C 4DOBA 4KLFA 4CNQA 1NK6A 2YMPA 5AM3A 1ZRNA 1KQQA 1TV9A 2IHMA 4EEKA 4ECUA 3ORYA 3IN5A 2FLLA 1S97A 3NVYA 2LM1A 4U6PA 2ZIWB 2M2WA 3IG8A 3E0FA 5AKIA 3B0YA 5J2AA 4KLSA 1RQNA 3M6ZA 1ZJNA 3RH5A 4BUGA 5L1IA 5KFZA 3OGUA 5E79U 4UB4A 2KV2A 4YCXA 2EH9A 4EELA 1UPHA 1QLNA 2K60A 4I0UA 7ICSA 3M9MB 3IG5A 2KZZA 3SENA 5J2GA 4EBDA 4FHWA 2HBMA 8ICVA 2F3NA 4RQ0A 2K8BB 3SAFA 4RNOA 5KFLA 2WB1C 1V4AA 1QQ6A 1XSNA 4PHAA 4EGWA 2KOBA 3V6KA 3M8SA 2P66A 1URJA 5CR0A 4DLGA 4UD4A 3BQ0A 3C5FA 1SL1A 4NXVA 3CW2C 1DRGA 2EQYA 4AT7B 1SXEA 4C7YA 2KJ5A 2KVSA 9ICKA 1SV0C 4FHVA 5CFTA 1UCVA 4BXOA 3H8WA 4EP7A 4AT9A 4KITB 4DL3A 3UXOA 5J0TA 5KG6A 5KG4A 4KMUA 9ICIA 3BS5B 2R8KA 3NRWA 8ICBA 4Q45A 3QU9A 5KFKA 3N97B 3QEAZ 1SKRA 5HNKA 4DFMA 5AK4A 5KFMA 3R9KA 1P7DA 3MGIA 3KTQA 3NKUA 3G6XA 4ED6A 3FYHA 3Q8LA 4DL4A 1MIYA 5ALLA 4QZHA 3MGVA 1HJPA 3RJKA 5KTQA 1ZQBA 2GH1A 5HRGA 4G3IA 8ICKA 4AT8A 3MDAA 3H40A 3JPOA 2AXTU 2LPEA 5ALGA 2H3VA 4MF8A 3H4DA 2W3SA 4FHYA 1NKBA 4EX7A 4RPYA 3ZDDA 3C66A 4DL7A 8ICQA 1DK3A 1TVAA 5AKJA 4NLZA 1NZBA 4X5VA 4PGYA 2PXIA 2KHQA 2LYBA 4I2GA 3K1ZA 3QZ8A 2HHPA 2KTQA 4WCWA 3C21A 5K4LA 3BQTA 7ICIA 2OM6A 4UAVA 3RJEA 1DGSA 3OSNA 4BDPA 9ICOA 3S6JA 1ZQEA 2XY5A 1PZNA 4RT2A 2OWOA 4OAGA 1J97A 2FCLA 3WKCA 4Y2XA 5DG9A 2ZIVA 9ICPA 5AKGA 5KT2A 2CXYA 4F5NA 4E7XA 3H8SA 3K4GA 2HBKA 5KFTA 7ICPA 1QTMA 2CPRA 1X9XA 1ZYQA 5DQIA 1KDHA 2DPJA 1ZQCA 3CYMA 4PZOA 3EWAA 4S3NA 2DR8A 3WFQE 1H38A 2B56A 3GU3A 4PH5A 5KT5A 4RZRA 4PHEA 3F2DA 5CEHA 5DBBA 4QZ9A 5EOZA 4I2CA 5J2KA 4DF8A 4GLXA 2L5YA 3V72A 3PMLA 5EE9A 4WJ3B 5ALVA 3RRHA 3GIJA 1NZPA 8ICMA 4RUAA 4QWEA 4WQLA 3Q8RB 1SV4A
chains in the Genus database with same CATH topology
5HHHA 2V4RA 5DLFA 1UA1A 1ZQDA 5KFDA 2ZUBA 2BQUA 1AROP 3GQCA 4M6WB 4PPXA 3Q8PB 3MBYA 3Q8MA 1U47A 3BDPA 1ZQAA 3AQMA 1TK0A 3AUOA 2FPLA 3IM1A 5KFYA 5HRDA 4LZDA 5IIJA 3HPOA 3SYZA 3H3AA 4RWQA 3G6VA 1FA0A 7ICOA 3GV5B 2ZH8A 2ALZA 4RPXA 2R8JA 5DB8A 8ICLA 5J0WA 4GC7A 2AQ0A 2ZH9A 4IRDA 5KFCA 1ZQNA 1S0NA 4IRKA 8ICRA 4I2AA 4WC3A 3ZD9A 5KFVA 3Q8KA 4WC7A 5DDYA 5EWGA 2HHXA 3M9OB 3RTVA 5DG8A 3MFHA 3M9NB 5J29A 5DB6A 2BQ3A 4JV1A 3SV4A 5DDMA 2BCQA 4UBCA 2J6UA 2W9AA 3V7KA 5CP2A 4KN4A 2JEFA 5L1KA 4TQRA 7ICGA 1T4GA 4M6WA 1ZQMA 5KFGA 3AU6A 2Y1JA 8ICCA 4Q44A 1B22A 4ECTA 4F2SA 3N4MB 1S0OA 3TAPA 3RR8A 3AQLA 3OVBA 4I2EA 2A1JA 4ZH4A 4ED2A 1TKDA 1QSSA 2ZTCA 1ZQOA 1ZQIA 2FMSA 4WC1A 3T3FA 2PFPA 4RQ5A 1ZQVA 2KZ3A 5KG0A 4R63A 3GV8B 1Q79A 3EYZA 3UQ2A 3AU2A 5IIMA 2NRWA 1WOTA 2J6TA 5L9XA 4FHPA 1JN3A 3SI8A 4ECXA 9ICLA 2F1JA 3RR7A 5J0RA 4HYKA 1BVSA 3PW5A 3TAQA 4Z6EA 4QWAA 3TFRA 5HRLA 3UPQA 1HUOA 2UVRA 4DL2A 7ICQA 3HIYA 4NY8A 3PO5A 3L9DA 3HP6A 1KLNA 1XO1A 4DWIA 1DK2A 3T5KA 1XS9D 2F1IA 3OV7A 1S9FA 4I2IA 5CWRA 1ZQPA 4K4IA 3PX6A 4YXJA 1NKCA 1MQ2A 4B9VA 8ICGA 1A76A 3V6JA 2ATLA 1MQ3A 3FDSA 5KT7A 5HRFA 4DQQA 4NKTA 1SL0A 4ELTA 5BPCA 4QZ8A 1NJWA 2ZHBA 4RQ4A 2ZTEA 3PVXA 2W8KA 2C28A 4M9GA 5KFIA 3OHAA 9ICCA 3HWTA 1U45A 4ED3A 4K4HA 3H4BA 2HW3A 2HVIA 3C2LA 2HHSA 2VA8A 1KTQA 1X2IA 2NRVA 4C8KA 2HHUA 4F91B 4DSEA 8ICJA 3C2MA 2BPGA 4EBJA 3LWLA 1JX4A 2XCAA 5HC9A 4EZ6A 2C2DA 2AGOA 1NOMA 1T3NA 2BGWA 3GV7B 2I9GA 4IR9A 3RJFA 1NK9A 4JWNA 9ICEA 3MFIA 4AT7A 3NTUA 4XQ8A 3H39A 1SZPA 2NRXA 4KLUA 4I2HA 3RH4A 4KLIA 9ICBA 2J6SA 4O3NA 4JV0A 3EPGA 4DSFA 8ICPA 4YMNA 1ZQUA 9ICJA 2ID1A 1RYSA 4O3QA 3QZ7A 4KLHA 1F5AA 2FLPA 3RRGA 4KTQA 2BCRA 4WC4A 3BJYA 2BQRA 2UVWA 4AT9B 4DL6A 4R8UA 2ASLA 5J0UA 4DLEA 3C1ZA 1COOA 3C23A 5IIKA 5KFJA 1JXEA 5J0PA 2BR0A 4F4WA 1N56A 4KLJA 4MFCA 4P2HA 1NK7A 5J2BA 4TQSA 7ICEA 1XU4A 4QW9A 1JQRA 4J9KA 2R8GA 1ZQGA 4DF4A 3SZ2A 4PHDA 4F8RA 1RYRA 4TURA 4FH3A 1S10A 3EW9A 3OUYA 4RNNA 1EXNA 4X4OA 4NLKA 2Q66A 4UB3A 4WBYA 1ZQWA 4M04A 7ICNA 5EWFA 4UAWA 1BPYA 1R89A 1RPLA 4ECYA 4FO6A 5L1JA 2XCPA 3HX0A 1ZQSA 1BNPA 1ZQJA 2O1PA 4YMOA 3UQ0A 9ICNA 1NO5A 5J0XA 4RQ1A 3JYYA 4TUQA 1ZQLA 2KFZA 3BQ1A 2BCVA 4O3OA 2W9BB 4KLEA 4NM2A 2Y1IA 4J9LA 1JXLA 1L3VA 2JEIA 4M0AA 4LT6A 5J2DA 4QWBA 3PW7A 3G6YA 5DGAA 1UT5A 4JK1A 4IG8A 4QZFA 4ECZA 3PX0A 2ZH6A 5KT6A 8ICYA 5J0SA 4KLTA 5DLGA 4E0DA 1ZQKA 1UEVA 3MR6A 4X4UA 2IHNA 5D4BA 2ISOA 2HHTA 2AJQA 4DSIA 3SV3A 2NRZA 5DGBA 9ICQA 4I2DA 4FH5A 4KN7A 4F5RA 5DB7A 2AU0A 2AGPA 1VJ7A 2JZBA 2ZTDA 4P4OA 1TFRA 9ICSA 4BWMA 3PW0A 3ZDCA 7ICFA 1RZTA 4YFKA 4NKUA 4QZIA 4EYHB 3NGDA 4GXIA 4ED7A 5HREA 4MEXA 5F9LA 4B9NA 4F3OA 2KFNA 2I1QA 4ECRA 4ELVA 1TFYA 4F4YA 3H7IA 2A1JB 3OUYB 1Z00B 1BGXT 1BNOA 4ED1A 3LK9A 3PV8A 4KLLA 2VA2A 5C5JA 1Y88A 4R64A 1T7PA 1NKEA 3LDAA 4QZAA 4GXJA 1X9WA 8ICNA 4DSLA 7ICVA 4EBKA 2P6UA 4NLGA 9ICAA 1KRPA 4F2RA 4DQSA 4KLMA 4RQ7A 3RJGA 4TUSA 4RWOA 4YVZA 4ECQA 4QW8A 2HVHA 5HMMA 2ZUDA 1MC8A 4YD2A 2VA3A 5KFHA 2AQ4A 1NK8A 5EWEA 4PHPA 3RH6A 2MUTA 7ICMA 2DVIA 2M2UA 2XY7A 3GFKB 4BWJA 5KG1A 3OJUA 2ASJA 4Q8EA 4TUPA 1D9FA 3NYBA 4O5EA 3ZD8A 4UB2A 3MDCA 4I2FA 4M9JA 1ZQXA 1OU5A 4GC6A 2H5XA 4RU9A 3JPSA 1KFTA 2DR9A 4Z6FA 2XGQA 3UXNA 4F5OA 4RQ8A 3PR5B 1ZQZA 1CUKA 4PGQA 2PFQA 3GIIA 1DOQA 1XSPA 3BQ2A 1BPBA 3C1YA 5DG7A 2LYHA 4C8MA 4NM1A 2W9MA 5HRIA 4RQ2A 7ICHA 1U9LA 1KEJA 3K75D 5KG3A 1Z00A 2BDPA 4DOBA 7ICTA 4KLFA 5F2VO 9ICVA 9ICWA 5HRBA 3JZ0A 1NK6A 5BOMA 4X4RA 4R8UB 2IHMA 1TV9A 4B9SA 4ECUA 2ZJAA 3ORYA 5J0QA 5DBAA 3MGHA 4B9UA 2C2RA 3KHHA 4DQPA 1U4BA 4RWPA 4UAYA 3T5HA 1S97A 2F1HA 4DQRA 2FLLA 4X4TA 5KFQA 3PR4A 4MFAA 1D8YA 4QZCA 1MSWD 3OJSA 3KHGA 3PW4A 1ZJMA 4DSJA 2M2WA 4PGXA 2FMQA 4EBEA 4RQ3A 4WBZA 5CJ7A 3JPTA 4J9NA 3ZDBA 4RQ6A 7ICUA 3RJJA 4IQVA 3RAXA 2XC9A 3B0YA 5J2AA 4KLSA 4MEYA 3ZDAA 1TAUA 2BCSA 1ZJNA 1NK5A 4NXZA 3RH5A 4ELUA 2RFFA 5DEDA 4X4QA 1YLQA 2W9BA 1U49A 1NJXA 4K4GA 2DR5A 2IBKA 5L1IA 5KFZA 3OGUA 7ICKA 5KFWA 4UB4A 2M2TA 4F5QA 5KG5A 4YCXA 7ICLA 5KT4A 1QLNA 1KSPA 2ISPA 1T8EA 7ICSA 3PNCA 3M9MB 2RDJA 4YP3A 1S77D 2KZZA 5J2GA 4QZDA 2KZMA 1XSLA 1CEZA 5KFSA 4EBDA 1BPEA 5IILA 2C22A 4JWMA 9ICHA 4FHWA 2W9CA 8ICVA 1Q78A 4WC6A 5CHGA 4YR2A 3PMNA 3V7JA 4RPZA 3ISBA 4RQ0A 2ZH2A 1ZQFA 9ICFA 5KFUA 3EZ5A 1SKWA 4XA5A 5KFLA 4RNOA 1LB2B 4MFFA 2Q0ZX 5IINA 4WC5A 2C2EA 3RB6A 3QE9Y 1V4AA 5CB1A 1XSNA 4PHAA 2FMPA 4J9OA 4DL5A 4RUCA 1QSLA 5DQHA 3V6KA 1ZQTA 4X4PA 4Z6DA 3M8SA 2GWSA 2P66A 1TK8A 4EZ9A 5JUMA 3OVAA 5DQGA 4I2JA 5CR0A 1R8CA 2ZH4A 1ZQRA 4M9LA 3UPSA 1NJZA 4UBBA 4DLGA 2WTFA 4UD4A 4M2YA 3BQ0A 5DBCA 3JPPA 3C5FA 2BHNA 5HMLA 4LVSA 4DS4A 1SL1A 8ICXA 1D9DA 2DRBA 4O9MA 4AT7B 2V4QA 4FBTA 2IA6A 2JEGA 4XRHA 2V9WA 2HHQA 5TZVA 2VANA 2DPIA 4FHXA 9ICKA 5HRHA 4FHVA 4B9LA 4ATBA 1L3TA 4M47A 3PO4A 4BXOA 3H8WA 4R66A 8ICKA 4EP7A 4O3PA 3RJIA 4AT9A 4KITB 2IMWP 4ECSA 3UXOA 4DL3A 5J0TA 4UB1A 1S76D 3H37A 5KG6A 5KG4A 1RXWA 3WFPA 5KFBA 4O5KA 1MIVA 2NRKA 2MUTB 4KMUA 3HJ1A 2R8HA 4I28A 1S0VA 9ICIA 2BKEA 2R8KA 3T5LA 4DQIA 4KLGA 5IIIA 4QZGA 4Q45A 8ICBA 8ICIA 2O5AA 5J2IA 2RDIA 5KFKA 3PX4A 4F4ZA 1X9SA 8ICSA 3LQCB 4M5DA 4GXKA 4J9QA 1C7YA 4I29A 9ICGA 3N97B 1BPXA 3H38A 2R8IA 3E2EA 2M2VA 3QEAZ 2B21A 1SKRA 5HNKA 4DFMA 3V6HA 5HP4A 3ZDEA 5KFMA 4QWCA 9ICMA 3C18A 4DS5A 4QZEA 3OVSA 3ISDA 3RB0A 3GIKA 4DFJA 4CCHA 4O3RA 4IQUA 3MGIA 3KTQA 4UAZA 4ED8A 4DEZA 1U48A 4X4VA 5DKWA 3TANA 3G6XA 3WFRE 3RBDA 4F93B 3Q8SB 3FYHA 4ED6A 4B9MA 4F4XA 2JZBB 5J2EA 8ICFA 1KNYA 4J9SA 3OHBA 4DL4A 3Q8LA 1MIYA 4YXMA 1K1QA 3KHLA 1Z3EB 1UA0A 1TAQA 4XUSA 4QZHA 4YQWA 3TI0A 5J2CA 3TQ1A 1RXVA 4UQGA 1HJPA 3C2KA 3RJKA 5KTQA 1ZQBA 2ZJ5A 4QWDA 2XGPA 3MR5A 4FBUA 5HRGA 4F5PA 4YR3A 1K1SA 2M9NA 5KFFA 5KG2A 3M8RA 3HW8A 4ECWA 3UXPA 1L5UA 3PY8A 3MDAA 2DFLA 2UVVA 7ICJA 4KLOA 3LWMA 3H40A 4JV2A 3JPOA 1B43A 2ZJ8A 3MABA 3TARA 4E80A 2FPMA 3IHQB 4IQWA 1BPZA 1NK4A 4JUZA 2UVUA 7ICRA 4MF8A 3H4DA 4E8FA 1WCLA 2DRAA 5KFAA 4F92B 4FHYA 4J9RA 1NKBA 4RPYA 3ZDDA 4I27A 4FS2A 3C66A 2PI5A 1SL2A 2PBEA 1QSYA 2ZUCA 4DL7A 8ICQA 4Q43A 2KN7A 1DK3A 1TVAA 4NLZA 4X4SA 1ZQHA 3ETLA 4R65A 4X5VA 4PGYA 3RAQA 4ATBB 4YD1A 8ICUA 3TFSA 2PXIA 4EBCA 1ZQQA 2BCUA 1ZQYA 5KFXA 1BPDA 2HHWA 1UEUA 4I2GA 4BGDA 4NLNA 1IM4A 5KT3A 3MR3A 5J2HA 4KLQA 1IXRA 5HR9A 4WC2A 5HHIA 3QZ8A 2HHPA 2KTQA 4WCWA 3C21A 3BQTA 5KG7A 2PI4A 7ICIA 4RNMA 1KFDA 2ZH1A 4UB5A 5J0YA 1N48A 4RWNA 4X0BA 1VFGA 3RJEA 3V7LA 2PFNA 1DGSA 4DSKA 1L3UA 4RT3A 3OSNA 1KFSA 2W8LA 4BDPA 8ICEA 5HRKA 2ASDA 1R8BA 3ISCA 9ICOA 4DFPA 3RJHA 1MIWA 1TFWA 4XQ7A 4C8OA 3KHRA 1ZQEA 2XY5A 1PZNA 5KFNA 5DB9A 4RT2A 2OWOA 4BXOB 4M9NA 1V9PA 4O3SA 3WFOA 4Z6CA 5DG9A 4J9PA 9ICPA 4AT8B 2DR7A 5KT2A 4DFKA 2XO7A 4O5CA 4I2BA 4F5NA 5J2FA 4E7XA 4O0IA 1HUZA 3H8SA 3C5GA 3OSPA 8ICZA 4YG2A 3K4GA 2ZH5A 2FPKA 3HJ4A 3HT3A 4WC0A 5BOLA 2HHVA 4G3IA 4DOAA 5J0OA 1SKSA 4C8LA 4DO9A 1L3SA 4YR0A 5KFTA 1TK5A 4B9TA 2BPFA 4LZGA 8ICWA 4F4KA 1QTMA 7ICPA 4IR1A 2KP7A 3THVA 3RB3A 4P4MA 3Q8QB 4AT8A 3GDXA 3EPIA 1XC9A 4IRCA 1ZYQA 1NK0A 5DQIA 2FLNA 2ZH7A 1KDHA 4ED0A 5KFEA 4P4PA 2DPJA 1JIHA 1ZQCA 4IQTA 3JPNA 8ICOA 3JPRA 3EWAA 1S0MA 2PFOA 3AQKA 2AGQA 8ICHA 4S3NA 2DR8A 1A77A 4FS1A 5D49A 1H38A 3WFQE 4PH5A 3B0XA 2MAXA 5KT5A 4ECVA 4X0AA 5L1LA 4RZRA 4PHEA 3RBEA 9ICUA 4YMMA 5CA7A 4J9MA 3PW2A 5KFPA 4C8NA 4EEYA 2BPCA 9ICXA 3H8JA 5DBBA 4QZ9A 5EOZA 3JPQA 4QZBA 1LV5A 4I2CA 2W9CB 2XY6A 1UT8A 5D46A 5IIOA 5J2KA 4EYIB 4GLXA 3V72A 4DOCA 3PMLA 4DF8A 5F9NA 3T5JA 3RB4A 1NJYA 2ZHAA 5KFOA 9ICRA 1PX5A 3AQNA 2ZH3A 4UD5A 3RRHA 2NRTA 3GIJA 3QEBZ 8ICTA 1UETA 3GILA 1NZPA 8ICMA 1WCNA 1XWLA 1D8LA 3MR2A 4Q8FA 5J2JA 5DECA 4RUAA 8ICAA 4YN4A 2BE3A 4KLDA 4QWEA 1X9MA 1ZETA 4F50A 4M9HA 3Q8RB 1R8AA 3GIMA 4X4NA 2JEJA 1JAJA 4MF2A 5KFRA 9ICTA 3WFSC 2P6RA 1JMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HHH A;  2V4R A;  5DLF A;  1UA1 A;  1ZQD A;  5KFD A;  2ZUB A;  2BQU A;  1ARO P;  3GQC A;  4M6W B;  4PPX A;  3Q8P B;  3MBY A;  3Q8M A;  1U47 A;  3BDP A;  1ZQA A;  3AQM A;  1TK0 A;  3AUO A;  2FPL A;  3IM1 A;  5KFY A;  5HRD A;  4LZD A;  5IIJ A;  3HPO A;  3SYZ A;  3H3A A;  4RWQ A;  3G6V A;  1FA0 A;  7ICO A;  3GV5 B;  2ZH8 A;  2ALZ A;  4RPX A;  2R8J A;  5DB8 A;  8ICL A;  5J0W A;  4GC7 A;  2AQ0 A;  2ZH9 A;  4IRD A;  5KFC A;  1ZQN A;  1S0N A;  4IRK A;  8ICR A;  4I2A A;  4WC3 A;  3ZD9 A;  5KFV A;  3Q8K A;  4WC7 A;  5DDY A;  5EWG A;  2HHX A;  3M9O B;  3RTV A;  5DG8 A;  3MFH A;  3M9N B;  5J29 A;  5DB6 A;  2BQ3 A;  4JV1 A;  3SV4 A;  5DDM A;  2BCQ A;  4UBC A;  2J6U A;  2W9A A;  3V7K A;  5CP2 A;  4KN4 A;  2JEF A;  5L1K A;  4TQR A;  7ICG A;  1T4G A;  4M6W A;  1ZQM A;  5KFG A;  3AU6 A;  2Y1J A;  8ICC A;  4Q44 A;  1B22 A;  4ECT A;  4F2S A;  3N4M B;  1S0O A;  3TAP A;  3RR8 A;  3AQL A;  3OVB A;  4I2E A;  2A1J A;  4ZH4 A;  4ED2 A;  1TKD A;  1QSS A;  2ZTC A;  1ZQO A;  1ZQI A;  2FMS A;  4WC1 A;  3T3F A;  2PFP A;  4RQ5 A;  1ZQV A;  2KZ3 A;  5KG0 A;  4R63 A;  3GV8 B;  1Q79 A;  3EYZ A;  3UQ2 A;  3AU2 A;  5IIM A;  2NRW A;  1WOT A;  2J6T A;  5L9X A;  4FHP A;  1JN3 A;  3SI8 A;  4ECX A;  9ICL A;  2F1J A;  3RR7 A;  5J0R A;  4HYK A;  1BVS A;  3PW5 A;  3TAQ A;  4Z6E A;  4QWA A;  3TFR A;  5HRL A;  3UPQ A;  1HUO A;  2UVR A;  4DL2 A;  7ICQ A;  3HIY A;  4NY8 A;  3PO5 A;  3L9D A;  3HP6 A;  1KLN A;  1XO1 A;  4DWI A;  1DK2 A;  3T5K A;  1XS9 D;  2F1I A;  3OV7 A;  1S9F A;  4I2I A;  5CWR A;  1ZQP A;  4K4I A;  3PX6 A;  4YXJ A;  1NKC A;  1MQ2 A;  4B9V A;  8ICG A;  1A76 A;  3V6J A;  2ATL A;  1MQ3 A;  3FDS A;  5KT7 A;  5HRF A;  4DQQ A;  4NKT A;  1SL0 A;  4ELT A;  5BPC A;  4QZ8 A;  1NJW A;  2ZHB A;  4RQ4 A;  2ZTE A;  3PVX A;  2W8K A;  2C28 A;  4M9G A;  5KFI A;  3OHA A;  9ICC A;  3HWT A;  1U45 A;  4ED3 A;  4K4H A;  3H4B A;  2HW3 A;  2HVI A;  3C2L A;  2HHS A;  2VA8 A;  1KTQ A;  1X2I A;  2NRV A;  4C8K A;  2HHU A;  4F91 B;  4DSE A;  8ICJ A;  3C2M A;  2BPG A;  4EBJ A;  3LWL A;  1JX4 A;  2XCA A;  5HC9 A;  4EZ6 A;  2C2D A;  2AGO A;  1NOM A;  1T3N A;  2BGW A;  3GV7 B;  2I9G A;  4IR9 A;  3RJF A;  1NK9 A;  4JWN A;  9ICE A;  3MFI A;  4AT7 A;  3NTU A;  4XQ8 A;  3H39 A;  1SZP A;  2NRX A;  4KLU A;  4I2H A;  3RH4 A;  4KLI A;  9ICB A;  2J6S A;  4O3N A;  4JV0 A;  3EPG A;  4DSF A;  8ICP A;  4YMN A;  1ZQU A;  9ICJ A;  2ID1 A;  1RYS A;  4O3Q A;  3QZ7 A;  4KLH A;  1F5A A;  2FLP A;  3RRG A;  4KTQ A;  2BCR A;  4WC4 A;  3BJY A;  2BQR A;  2UVW A;  4AT9 B;  4DL6 A;  4R8U A;  2ASL A;  5J0U A;  4DLE A;  3C1Z A;  1COO A;  3C23 A;  5IIK A;  5KFJ A;  1JXE A;  5J0P A;  2BR0 A;  4F4W A;  1N56 A;  4KLJ A;  4MFC A;  4P2H A;  1NK7 A;  5J2B A;  4TQS A;  7ICE A;  1XU4 A;  4QW9 A;  1JQR A;  4J9K A;  2R8G A;  1ZQG A;  4DF4 A;  3SZ2 A;  4PHD A;  4F8R A;  1RYR A;  4TUR A;  4FH3 A;  1S10 A;  3EW9 A;  3OUY A;  4RNN A;  1EXN A;  4X4O A;  4NLK A;  2Q66 A;  4UB3 A;  4WBY A;  1ZQW A;  4M04 A;  7ICN A;  5EWF A;  4UAW A;  1BPY A;  1R89 A;  1RPL A;  4ECY A;  4FO6 A;  5L1J A;  2XCP A;  3HX0 A;  1ZQS A;  1BNP A;  1ZQJ A;  2O1P A;  4YMO A;  3UQ0 A;  9ICN A;  1NO5 A;  5J0X A;  4RQ1 A;  3JYY A;  4TUQ A;  1ZQL A;  2KFZ A;  3BQ1 A;  2BCV A;  4O3O A;  2W9B B;  4KLE A;  4NM2 A;  2Y1I A;  4J9L A;  1JXL A;  1L3V A;  2JEI A;  4M0A A;  4LT6 A;  5J2D A;  4QWB A;  3PW7 A;  3G6Y A;  5DGA A;  1UT5 A;  4JK1 A;  4IG8 A;  4QZF A;  4ECZ A;  3PX0 A;  2ZH6 A;  5KT6 A;  8ICY A;  5J0S A;  4KLT A;  5DLG A;  4E0D A;  1ZQK A;  1UEV A;  3MR6 A;  4X4U A;  2IHN A;  5D4B A;  2ISO A;  2HHT A;  2AJQ A;  4DSI A;  3SV3 A;  2NRZ A;  5DGB A;  9ICQ A;  4I2D A;  4FH5 A;  4KN7 A;  4F5R A;  5DB7 A;  2AU0 A;  2AGP A;  1VJ7 A;  2JZB A;  2ZTD A;  4P4O A;  1TFR A;  9ICS A;  4BWM A;  3PW0 A;  3ZDC A;  7ICF A;  1RZT A;  4YFK A;  4NKU A;  4QZI A;  4EYH B;  3NGD A;  4GXI A;  4ED7 A;  5HRE A;  4MEX A;  5F9L A;  4B9N A;  4F3O A;  2KFN A;  2I1Q A;  4ECR A;  4ELV A;  1TFY A;  4F4Y A;  3H7I A;  2A1J B;  3OUY B;  1Z00 B;  1BGX T;  1BNO A;  4ED1 A;  3LK9 A;  3PV8 A;  4KLL A;  2VA2 A;  5C5J A;  1Y88 A;  4R64 A;  1T7P A;  1NKE A;  3LDA A;  4QZA A;  4GXJ A;  1X9W A;  8ICN A;  4DSL A;  7ICV A;  4EBK A;  2P6U A;  4NLG A;  9ICA A;  1KRP A;  4F2R A;  4DQS A;  4KLM A;  4RQ7 A;  3RJG A;  4TUS A;  4RWO A;  4YVZ A;  4ECQ A;  4QW8 A;  2HVH A;  5HMM A;  2ZUD A;  1MC8 A;  4YD2 A;  2VA3 A;  5KFH A;  2AQ4 A;  1NK8 A;  5EWE A;  4PHP A;  3RH6 A;  2MUT A;  7ICM A;  2DVI A;  2M2U A;  2XY7 A;  3GFK B;  4BWJ A;  5KG1 A;  3OJU A;  2ASJ A;  4Q8E A;  4TUP A;  1D9F A;  3NYB A;  4O5E A;  3ZD8 A;  4UB2 A;  3MDC A;  4I2F A;  4M9J A;  1ZQX A;  1OU5 A;  4GC6 A;  2H5X A;  4RU9 A;  3JPS A;  1KFT A;  2DR9 A;  4Z6F A;  2XGQ A;  3UXN A;  4F5O A;  4RQ8 A;  3PR5 B;  1ZQZ A;  1CUK A;  4PGQ A;  2PFQ A;  3GII A;  1DOQ A;  1XSP A;  3BQ2 A;  1BPB A;  3C1Y A;  5DG7 A;  2LYH A;  4C8M A;  4NM1 A;  2W9M A;  5HRI A;  4RQ2 A;  7ICH A;  1U9L A;  1KEJ A;  3K75 D;  5KG3 A;  1Z00 A;  2BDP A;  4DOB A;  7ICT A;  4KLF A;  5F2V O;  9ICV A;  9ICW A;  5HRB A;  3JZ0 A;  1NK6 A;  5BOM A;  4X4R A;  4R8U B;  2IHM A;  1TV9 A;  4B9S A;  4ECU A;  2ZJA A;  3ORY A;  5J0Q A;  5DBA A;  3MGH A;  4B9U A;  2C2R A;  3KHH A;  4DQP A;  1U4B A;  4RWP A;  4UAY A;  3T5H A;  1S97 A;  2F1H A;  4DQR A;  2FLL A;  4X4T A;  5KFQ A;  3PR4 A;  4MFA A;  1D8Y A;  4QZC A;  1MSW D;  3OJS A;  3KHG A;  3PW4 A;  1ZJM A;  4DSJ A;  2M2W A;  4PGX A;  2FMQ A;  4EBE A;  4RQ3 A;  4WBZ A;  5CJ7 A;  3JPT A;  4J9N A;  3ZDB A;  4RQ6 A;  7ICU A;  3RJJ A;  4IQV A;  3RAX A;  2XC9 A;  3B0Y A;  5J2A A;  4KLS A;  4MEY A;  3ZDA A;  1TAU A;  2BCS A;  1ZJN A;  1NK5 A;  4NXZ A;  3RH5 A;  4ELU A;  2RFF A;  5DED A;  4X4Q A;  1YLQ A;  2W9B A;  1U49 A;  1NJX A;  4K4G A;  2DR5 A;  2IBK A;  5L1I A;  5KFZ A;  3OGU A;  7ICK A;  5KFW A;  4UB4 A;  2M2T A;  4F5Q A;  5KG5 A;  4YCX A;  7ICL A;  5KT4 A;  1QLN A;  1KSP A;  2ISP A;  1T8E A;  7ICS A;  3PNC A;  3M9M B;  2RDJ A;  4YP3 A;  1S77 D;  2KZZ A;  5J2G A;  4QZD A;  2KZM A;  1XSL A;  1CEZ A;  5KFS A;  4EBD A;  1BPE A;  5IIL A;  2C22 A;  4JWM A;  9ICH A;  4FHW A;  2W9C A;  8ICV A;  1Q78 A;  4WC6 A;  5CHG A;  4YR2 A;  3PMN A;  3V7J A;  4RPZ A;  3ISB A;  4RQ0 A;  2ZH2 A;  1ZQF A;  9ICF A;  5KFU A;  3EZ5 A;  1SKW A;  4XA5 A;  5KFL A;  4RNO A;  1LB2 B;  4MFF A;  2Q0Z X;  5IIN A;  4WC5 A;  2C2E A;  3RB6 A;  3QE9 Y;  1V4A A;  5CB1 A;  1XSN A;  4PHA A;  2FMP A;  4J9O A;  4DL5 A;  4RUC A;  1QSL A;  5DQH A;  3V6K A;  1ZQT A;  4X4P A;  4Z6D A;  3M8S A;  2GWS A;  2P66 A;  1TK8 A;  4EZ9 A;  5JUM A;  3OVA A;  5DQG A;  4I2J A;  5CR0 A;  1R8C A;  2ZH4 A;  1ZQR A;  4M9L A;  3UPS A;  1NJZ A;  4UBB A;  4DLG A;  2WTF A;  4UD4 A;  4M2Y A;  3BQ0 A;  5DBC A;  3JPP A;  3C5F A;  2BHN A;  5HML A;  4LVS A;  4DS4 A;  1SL1 A;  8ICX A;  1D9D A;  2DRB A;  4O9M A;  4AT7 B;  2V4Q A;  4FBT A;  2IA6 A;  2JEG A;  4XRH A;  2V9W A;  2HHQ A;  5TZV A;  2VAN A;  2DPI A;  4FHX A;  9ICK A;  5HRH A;  4FHV A;  4B9L A;  4ATB A;  1L3T A;  4M47 A;  3PO4 A;  4BXO A;  3H8W A;  4R66 A;  8ICK A;  4EP7 A;  4O3P A;  3RJI A;  4AT9 A;  4KIT B;  2IMW P;  4ECS A;  3UXO A;  4DL3 A;  5J0T A;  4UB1 A;  1S76 D;  3H37 A;  5KG6 A;  5KG4 A;  1RXW A;  3WFP A;  5KFB A;  4O5K A;  1MIV A;  2NRK A;  2MUT B;  4KMU A;  3HJ1 A;  2R8H A;  4I28 A;  1S0V A;  9ICI A;  2BKE A;  2R8K A;  3T5L A;  4DQI A;  4KLG A;  5III A;  4QZG A;  4Q45 A;  8ICB A;  8ICI A;  2O5A A;  5J2I A;  2RDI A;  5KFK A;  3PX4 A;  4F4Z A;  1X9S A;  8ICS A;  3LQC B;  4M5D A;  4GXK A;  4J9Q A;  1C7Y A;  4I29 A;  9ICG A;  3N97 B;  1BPX A;  3H38 A;  2R8I A;  3E2E A;  2M2V A;  3QEA Z;  2B21 A;  1SKR A;  5HNK A;  4DFM A;  3V6H A;  5HP4 A;  3ZDE A;  5KFM A;  4QWC A;  9ICM A;  3C18 A;  4DS5 A;  4QZE A;  3OVS A;  3ISD A;  3RB0 A;  3GIK A;  4DFJ A;  4CCH A;  4O3R A;  4IQU A;  3MGI A;  3KTQ A;  4UAZ A;  4ED8 A;  4DEZ A;  1U48 A;  4X4V A;  5DKW A;  3TAN A;  3G6X A;  3WFR E;  3RBD A;  4F93 B;  3Q8S B;  3FYH A;  4ED6 A;  4B9M A;  4F4X A;  2JZB B;  5J2E A;  8ICF A;  1KNY A;  4J9S A;  3OHB A;  4DL4 A;  3Q8L A;  1MIY A;  4YXM A;  1K1Q A;  3KHL A;  1Z3E B;  1UA0 A;  1TAQ A;  4XUS A;  4QZH A;  4YQW A;  3TI0 A;  5J2C A;  3TQ1 A;  1RXV A;  4UQG A;  1HJP A;  3C2K A;  3RJK A;  5KTQ A;  1ZQB A;  2ZJ5 A;  4QWD A;  2XGP A;  3MR5 A;  4FBU A;  5HRG A;  4F5P A;  4YR3 A;  1K1S A;  2M9N A;  5KFF A;  5KG2 A;  3M8R A;  3HW8 A;  4ECW A;  3UXP A;  1L5U A;  3PY8 A;  3MDA A;  2DFL A;  2UVV A;  7ICJ A;  4KLO A;  3LWM A;  3H40 A;  4JV2 A;  3JPO A;  1B43 A;  2ZJ8 A;  3MAB A;  3TAR A;  4E80 A;  2FPM A;  3IHQ B;  4IQW A;  1BPZ A;  1NK4 A;  4JUZ A;  2UVU A;  7ICR A;  4MF8 A;  3H4D A;  4E8F A;  1WCL A;  2DRA A;  5KFA A;  4F92 B;  4FHY A;  4J9R A;  1NKB A;  4RPY A;  3ZDD A;  4I27 A;  4FS2 A;  3C66 A;  2PI5 A;  1SL2 A;  2PBE A;  1QSY A;  2ZUC A;  4DL7 A;  8ICQ A;  4Q43 A;  2KN7 A;  1DK3 A;  1TVA A;  4NLZ A;  4X4S A;  1ZQH A;  3ETL A;  4R65 A;  4X5V A;  4PGY A;  3RAQ A;  4ATB B;  4YD1 A;  8ICU A;  3TFS A;  2PXI A;  4EBC A;  1ZQQ A;  2BCU A;  1ZQY A;  5KFX A;  1BPD A;  2HHW A;  1UEU A;  4I2G A;  4BGD A;  4NLN A;  1IM4 A;  5KT3 A;  3MR3 A;  5J2H A;  4KLQ A;  1IXR A;  5HR9 A;  4WC2 A;  5HHI A;  3QZ8 A;  2HHP A;  2KTQ A;  4WCW A;  3C21 A;  3BQT A;  5KG7 A;  2PI4 A;  7ICI A;  4RNM A;  1KFD A;  2ZH1 A;  4UB5 A;  5J0Y A;  1N48 A;  4RWN A;  4X0B A;  1VFG A;  3RJE A;  3V7L A;  2PFN A;  1DGS A;  4DSK A;  1L3U A;  4RT3 A;  3OSN A;  1KFS A;  2W8L A;  4BDP A;  8ICE A;  5HRK A;  2ASD A;  1R8B A;  3ISC A;  9ICO A;  4DFP A;  3RJH A;  1MIW A;  1TFW A;  4XQ7 A;  4C8O A;  3KHR A;  1ZQE A;  2XY5 A;  1PZN A;  5KFN A;  5DB9 A;  4RT2 A;  2OWO A;  4BXO B;  4M9N A;  1V9P A;  4O3S A;  3WFO A;  4Z6C A;  5DG9 A;  4J9P A;  9ICP A;  4AT8 B;  2DR7 A;  5KT2 A;  4DFK A;  2XO7 A;  4O5C A;  4I2B A;  4F5N A;  5J2F A;  4E7X A;  4O0I A;  1HUZ A;  3H8S A;  3C5G A;  3OSP A;  8ICZ A;  4YG2 A;  3K4G A;  2ZH5 A;  2FPK A;  3HJ4 A;  3HT3 A;  4WC0 A;  5BOL A;  2HHV A;  4G3I A;  4DOA A;  5J0O A;  1SKS A;  4C8L A;  4DO9 A;  1L3S A;  4YR0 A;  5KFT A;  1TK5 A;  4B9T A;  2BPF A;  4LZG A;  8ICW A;  4F4K A;  1QTM A;  7ICP A;  4IR1 A;  2KP7 A;  3THV A;  3RB3 A;  4P4M A;  3Q8Q B;  4AT8 A;  3GDX A;  3EPI A;  1XC9 A;  4IRC A;  1ZYQ A;  1NK0 A;  5DQI A;  2FLN A;  2ZH7 A;  1KDH A;  4ED0 A;  5KFE A;  4P4P A;  2DPJ A;  1JIH A;  1ZQC A;  4IQT A;  3JPN A;  8ICO A;  3JPR A;  3EWA A;  1S0M A;  2PFO A;  3AQK A;  2AGQ A;  8ICH A;  4S3N A;  2DR8 A;  1A77 A;  4FS1 A;  5D49 A;  1H38 A;  3WFQ E;  4PH5 A;  3B0X A;  2MAX A;  5KT5 A;  4ECV A;  4X0A A;  5L1L A;  4RZR A;  4PHE A;  3RBE A;  9ICU A;  4YMM A;  5CA7 A;  4J9M A;  3PW2 A;  5KFP A;  4C8N A;  4EEY A;  2BPC A;  9ICX A;  3H8J A;  5DBB A;  4QZ9 A;  5EOZ A;  3JPQ A;  4QZB A;  1LV5 A;  4I2C A;  2W9C B;  2XY6 A;  1UT8 A;  5D46 A;  5IIO A;  5J2K A;  4EYI B;  4GLX A;  3V72 A;  4DOC A;  3PML A;  4DF8 A;  5F9N A;  3T5J A;  3RB4 A;  1NJY A;  2ZHA A;  5KFO A;  9ICR A;  1PX5 A;  3AQN A;  2ZH3 A;  4UD5 A;  3RRH A;  2NRT A;  3GIJ A;  3QEB Z;  8ICT A;  1UET A;  3GIL A;  1NZP A;  8ICM A;  1WCN A;  1XWL A;  1D8L A;  3MR2 A;  4Q8F A;  5J2J A;  5DEC A;  4RUA A;  8ICA A;  4YN4 A;  2BE3 A;  4KLD A;  4QWE A;  1X9M A;  1ZET A;  4F50 A;  4M9H A;  3Q8R B;  1R8A A;  3GIM A;  4X4N A;  2JEJ A;  1JAJ A;  4MF2 A;  5KFR A;  9ICT A;  3WFS C;  2P6R A;  1JMS A; 
#chains in the Genus database with same CATH topology
 5HHH A;  1PK1 B;  3GQC A;  4M6W B;  2KJ8 A;  2WF8 A;  2ZIV B;  3Q8M A;  3AQM A;  5KFY A;  4O68 A;  3SQI A;  3GV5 B;  4Y2V A;  5AIC A;  4Y2R A;  3AEV A;  4WC3 A;  2HSZ A;  1SB3 C;  1L8O A;  3SV4 A;  1CRX A;  2JEF A;  7ICG A;  5L1K A;  4TQR A;  4M6W A;  4Q44 A;  4ZH4 A;  4ED2 A;  1QSS A;  2ZTC A;  1ZQO A;  3MCR A;  2KZ3 A;  1DGJ A;  5KG0 A;  4R63 A;  3GV8 B;  2FJ6 A;  2NO5 A;  3EYZ A;  1L7P A;  3QUB A;  4CRX A;  1WOT A;  2J6T A;  3SI8 A;  1L6N A;  1LKY B;  2F1J A;  3NVZ A;  2NYV A;  4USA A;  3TAQ A;  3CRX A;  5HRL A;  7ICQ A;  1Z4O A;  3HIY A;  3PO5 A;  3L9D A;  2XVT A;  4ZOH C;  4O3M A;  1NKC A;  4YXJ A;  4B9V A;  2K8C B;  3SR6 A;  4G9B A;  3FDS A;  4NKT A;  1SL0 A;  4OCZ A;  3ED5 A;  2ZHB A;  2M0N A;  4RQ4 A;  2ZTE A;  2C28 A;  5KFI A;  3L4P A;  9ICC A;  4GFJ A;  2KKV A;  2HHS A;  2BZF A;  8ICJ A;  2NRV A;  5AK6 A;  4DSE A;  3KZI U;  2BPG A;  3LWL A;  1YZ6 A;  2A1A A;  4EZ6 A;  2AGO A;  1NOM A;  1T3N A;  4IR9 A;  3GV7 B;  4JWN A;  2E5S A;  1NK9 A;  5AM1 A;  3MFI A;  4KLU A;  2J6S A;  4O3N A;  4OJP A;  4F71 A;  1XO0 A;  3UM9 A;  2KD1 A;  3I1Y A;  2ASL A;  4DLE A;  5IIK A;  3KKA A;  1N56 A;  1SXD A;  4U7C A;  2HI0 A;  2ZXI A;  4DF4 A;  4TUR A;  3F2C A;  1S10 A;  3OUY A;  4RNN A;  1EXN A;  4C80 A;  1IV8 A;  2VJ5 A;  4KM5 A;  4FO6 A;  5L1J A;  2XCP A;  1KBU A;  1ZQS A;  4YMO A;  2GLE A;  1PK3 A;  4TUQ A;  3BQ1 A;  2BCV A;  4O3O A;  4NM2 A;  2Y1I A;  1L8L A;  5J2D A;  3G6Y A;  4Y2T A;  3QNM A;  2ESE A;  3ALR A;  3WKB A;  4ECZ A;  3PX0 A;  5DLG A;  4X4U A;  2ISO A;  2AJQ A;  4UW9 A;  2NRZ A;  1QH9 A;  2G09 A;  3VC8 A;  1CI4 A;  2KJ9 A;  9ICQ A;  4EX6 A;  2AGP A;  5ALN A;  4NKU A;  4EYH B;  2DGZ A;  1PVP A;  5HRE A;  2DUY A;  3L5K A;  3NRZ A;  2K4E A;  1Z00 B;  1BNO A;  2K89 A;  4ED1 A;  5C5J A;  3LDA A;  4DSL A;  9ICA A;  1OW5 A;  4DQS A;  4YVZ A;  4ECQ A;  1MC8 A;  4YD2 A;  5CRX A;  5KFH A;  2AQ4 A;  4PHP A;  3RH6 A;  7ICM A;  3EUB 2;  2ASJ A;  4O5E A;  3MDC A;  5ALY A;  4CF3 A;  2H5X A;  4RU9 A;  3JPS A;  1TAM A;  3UXN A;  4UAR A;  2RHF A;  2JMG A;  1RYU A;  3BQ2 A;  3C1Y A;  4NXW A;  3F5E A;  3D2Q A;  5ALJ A;  3K75 D;  1ECW A;  9ICW A;  4B9S A;  5J0Q A;  4B9U A;  3MGH A;  2C2R A;  4DQP A;  4OAF A;  1U4B A;  2F1H A;  5FP0 A;  4DQR A;  5KFQ A;  3PR4 A;  1D8Y A;  4QZC A;  3NUQ A;  4PGX A;  2XI9 A;  1Z4N A;  4J9N A;  7ICU A;  3F53 A;  3RJJ A;  4IQV A;  2XC9 A;  2EDU A;  4MEY A;  3ZDA A;  2BCS A;  4ELU A;  3WKE A;  4X4Q A;  1U49 A;  2DR5 A;  7ICK A;  5KFW A;  2M2T A;  2IOF A;  4EED A;  1F0M A;  1KL9 A;  5KT4 A;  3HRD D;  3AMZ A;  2ISP A;  3PNC A;  4YP3 A;  4DCC A;  2KZM A;  2OH2 A;  1PVR A;  2JRZ A;  2C22 A;  4YR2 A;  3PMN A;  1SWW A;  4LEZ A;  1JI7 A;  3EZ5 A;  5D63 A;  4MFF A;  4IC9 A;  3RB6 A;  3QE9 Y;  5CB1 A;  3AQE A;  4J9O A;  5DQH A;  1ZQT A;  4X4P A;  1TK8 A;  3OPX A;  2B51 A;  5EE1 A;  4I2J A;  2LBO A;  1R8C A;  3PSF A;  4UBB A;  1FEZ A;  3PHZ A;  8ICX A;  5HML A;  4DS4 A;  1HEK A;  3LYS A;  5AM0 A;  2DF4 B;  5KL8 B;  4BJQ A;  2VAN A;  2DPI A;  2WF9 A;  4B9L A;  4ATB A;  5AM5 A;  3PSP A;  4M47 A;  4R66 A;  4QIW C;  2I6X A;  1RXW A;  3WFP A;  4O5K A;  2GOL A;  3WK8 A;  3HJ1 A;  1S0V A;  2AH5 A;  2BKE A;  4KLG A;  4DQI A;  4F4Z A;  2GA9 D;  4M5D A;  4GXK A;  2CN1 A;  1C7Y A;  9ICG A;  3H38 A;  2R8I A;  2M2V A;  1IG6 A;  4NXT A;  3M7D A;  5AI5 A;  2YTU A;  4MKP A;  3OVS A;  3ISD A;  3GIK A;  4CCH A;  3WK5 A;  5KAI U;  4DEZ A;  5DKW A;  3TAN A;  1YZ7 A;  8ICF A;  2JZB B;  5J2E A;  4J9S A;  5AKZ A;  4YXM A;  3KHL A;  1Z3E B;  4K98 A;  1TAQ A;  4XUS A;  3TQ1 A;  3ER8 C;  5ALX A;  3C29 A;  4QWD A;  4FBU A;  4F5P A;  1K1S A;  2HHU A;  5KG2 A;  3HW8 A;  4ECW A;  4Y2J A;  3PY8 A;  5ALK A;  2UVV A;  3LWM A;  5AIB A;  1B43 A;  2KG5 A;  4OJL A;  1A6S A;  2UVU A;  4KX3 A;  4E8F A;  1WCL A;  4EEB A;  5A0L A;  4UAT A;  5ALP A;  1ZD5 A;  2HCF A;  2ZUC A;  2LHT A;  1ZQH A;  1S5L U;  1JUD A;  3TFS A;  1ZQQ A;  5EE3 A;  5KFX A;  5CHE A;  4BGD A;  5KT3 A;  5HR9 A;  4UB8 U;  3VCB A;  2E1E A;  4X0B A;  4DSK A;  1UHU A;  1L3U A;  8ICE A;  1R8B A;  3RJH A;  5F3X B;  2AHO B;  4M9N A;  2PKE A;  2LKY A;  2ZIX A;  4J9P A;  5AI8 A;  2DR7 A;  2H3Q A;  2XO7 A;  2WF7 A;  4I2B A;  1HUZ A;  5ALH A;  8ICZ A;  3C5G A;  2ZH5 A;  3SD7 A;  4WC0 A;  5BOL A;  5D62 A;  3DEE A;  2HHV A;  4C8L A;  1TK5 A;  2HN1 A;  1WWV A;  4NLC A;  2Q4T A;  2ZIU A;  1V38 A;  3EPI A;  1XC9 A;  4IRC A;  2KEY A;  8ICO A;  1WWU A;  3JPN A;  3JPR A;  3AQK A;  1A77 A;  4ECV A;  3B0X A;  3IRU A;  1GO3 F;  2YB1 A;  4X0A A;  5L1L A;  2P35 A;  3RBE A;  2G0A A;  5KFP A;  3O0F A;  4EEY A;  2W9C B;  1BPX A;  5D46 A;  4EYI B;  5F9N A;  3T5J A;  2ZHA A;  3AQN A;  1PX5 A;  2ZH3 A;  4UD5 A;  3QEB Z;  1UET A;  3GIL A;  1WCN A;  4YN4 A;  1QCK A;  1R8A A;  3GIM A;  2JEJ A;  4MF2 A;  4WOY A;  5KFR A;  1ARO P;  1X42 A;  1VDV A;  4PPX A;  5JTG A;  4J03 A;  4EV6 A;  1TK0 A;  3AUO A;  1WYG A;  5HRD A;  2Y0S C;  4Y2U A;  3H3A A;  7ICO A;  2ALZ A;  2R8J A;  2AQ0 A;  2MU2 A;  5KFC A;  1ZQN A;  1S0N A;  1N5X A;  3C28 A;  2KSO B;  5EWG A;  3M9O B;  5J29 A;  2BQ3 A;  4JV1 A;  5DDM A;  2HOQ A;  2BCQ A;  5AKY A;  8ICC A;  1T4G A;  1ZQM A;  5KFG A;  2A1J A;  1TKD A;  2PFP A;  2WFA A;  3UQ2 A;  2NRW A;  1OUQ A;  2CRX A;  3RR7 A;  3UMB A;  3PW5 A;  4Z6E A;  3HKZ F;  4GIB A;  4DWI A;  1XS9 D;  2F1I A;  2OEH A;  4K4I A;  1O08 A;  4OAH A;  1MQ2 A;  8ICG A;  4CDG A;  5KT7 A;  4BX9 C;  3QXG A;  4QZ8 A;  1NJW A;  2OHF A;  4OJ6 A;  3OHA A;  4K96 A;  2XIC A;  2B4V A;  2IUB A;  3C2L A;  2VA8 A;  1X2I A;  3WU2 U;  4F91 B;  3C2M A;  2DL0 A;  2FI1 A;  1JX4 A;  3UMG A;  2XCA A;  2W7O A;  9ICE A;  2I9G A;  3RFA A;  4O6A A;  4AT7 A;  3SAG A;  3H0L B;  2NRX A;  3LVW A;  3RH4 A;  4KLI A;  9ICB A;  2D6F C;  3OWG A;  4JV0 A;  8ICP A;  4YMN A;  1Q3U A;  1GPJ A;  4O3Q A;  3QZ7 A;  4KTQ A;  2BCR A;  3D2N A;  4AT9 B;  4DL6 A;  1ZD4 A;  3C1Z A;  1COO A;  1SWV A;  5J0P A;  5J2B A;  4TQS A;  7ICE A;  1XU4 A;  1JQR A;  1ZQG A;  2QB0 B;  4FH3 A;  1J2M A;  4UB3 A;  5HR6 A;  4UAW A;  3WKA A;  3ICX A;  3HX0 A;  2O1P A;  5J0X A;  3QU2 A;  2KFZ A;  4C4S A;  2W9B B;  1C20 A;  2JEI A;  2GAF D;  2G06 A;  4QWB A;  1Z1B A;  4JK1 A;  3RF9 A;  5ALU A;  5G5G A;  4QZF A;  2ZH6 A;  8ICY A;  4E0D A;  1D8B A;  3WK9 A;  2NV3 A;  3H8M A;  3MR6 A;  1UEV A;  1RG6 A;  5D4B A;  2IHN A;  3H0M B;  2W3R A;  2ZIW A;  4PJ0 U;  5DGB A;  4FZM A;  5DB7 A;  2W43 A;  2JZB A;  2ZTD A;  1TFR A;  3TAD A;  7ICF A;  4QZI A;  4GXI A;  4ED7 A;  2KFN A;  2I1Q A;  5T14 A;  4ECR A;  2IHO A;  1TFY A;  2MSN A;  1Y88 A;  4R64 A;  1NKE A;  1PUZ A;  4QZA A;  2JH1 A;  5AI9 A;  2F76 X;  1KKX A;  1L7N A;  4KLM A;  4RQ7 A;  3RJG A;  1MN8 A;  2EZX A;  4QW8 A;  4LJX A;  2VA3 A;  5AKK A;  3QUC A;  5L1M A;  1MA7 A;  2DVI A;  2XY7 A;  1X66 A;  4Q8E A;  3GZF A;  1KFT A;  2DR9 A;  2XGQ A;  4RQ8 A;  3PR5 B;  1ZQZ A;  3GII A;  1DOQ A;  1BPB A;  5DG7 A;  5CFU A;  4RQ2 A;  7ICH A;  1U9L A;  7ICT A;  5F2V O;  3JZ0 A;  4X4R A;  2ZJA A;  2W54 A;  2EAN A;  1SIJ A;  4RWP A;  4UAY A;  3T5H A;  4MFA A;  3OJS A;  1ZJM A;  4DSJ A;  4EBE A;  4WBZ A;  5CJ7 A;  3ZDB A;  3RAX A;  5ALO A;  1SZH A;  3BQ7 A;  1TAU A;  1FFV A;  1YLQ A;  3QU4 A;  4Y2Q A;  2E3T A;  5KG5 A;  4O69 A;  3QUT A;  1UQV A;  3M6K A;  2G08 A;  2VJ4 A;  1S77 D;  4OO1 J;  4QZD A;  2LM4 A;  1XSL A;  4HAI A;  5KFS A;  5IIL A;  1BPE A;  9ICH A;  4JWM A;  4K8V A;  4P0P B;  2W9C A;  2EAO A;  4RPZ A;  1V85 A;  2ZH2 A;  1ZQF A;  9ICF A;  5KFU A;  1SKW A;  2FDR A;  4XA5 A;  4WH5 A;  3ZI4 A;  5IIN A;  4WC5 A;  1LVH A;  2OYY A;  2FMP A;  2OCE A;  2PMZ C;  4LEY A;  2GWS A;  4EZ9 A;  5DQG A;  1ZQR A;  4M9L A;  2WTF A;  4M2Y A;  1F5S A;  5DBC A;  2BHN A;  3CNH A;  2DRB A;  1D9D A;  3NS1 A;  4O9M A;  2Y9U A;  2IA6 A;  4QIW F;  2HHQ A;  2VKQ A;  4FHX A;  4K9B A;  3PO4 A;  4O3P A;  4ECS A;  3H37 A;  5KFB A;  1MIV A;  2NRK A;  1KW4 A;  2WF5 A;  3T5L A;  4QZG A;  8ICI A;  5J2I A;  1SGG A;  8ICS A;  3LQC B;  4J9Q A;  2DWQ A;  3E2E A;  3V6H A;  9ICM A;  3DV9 A;  4QWC A;  2KIC A;  4DFJ A;  4IQU A;  1IIP A;  3KBB A;  4ED8 A;  1U48 A;  3WFR E;  3RBD A;  4F93 B;  3Q8S B;  5D61 A;  1V97 A;  2HBL A;  3KOO A;  1K1Q A;  1N60 A;  1UA0 A;  5ALM A;  3NVW A;  3C2K A;  2F8L A;  3KKA C;  2ZJ5 A;  3MR5 A;  5TIS U;  3M8R A;  1WUD A;  4KLO A;  4JV2 A;  4JB3 A;  2ZJ8 A;  3MAB A;  4E80 A;  3NVO A;  4IQW A;  1BPZ A;  1NK4 A;  7ICR A;  4UAU A;  2DRA A;  5KFA A;  4FZN A;  4J9R A;  2KE7 A;  4FS2 A;  2PI5 A;  2PBE A;  1QSY A;  2KN7 A;  1T3Q A;  2YB4 A;  4ATB B;  4YD1 A;  2YMQ A;  8ICU A;  4EBC A;  4C4T A;  2BCU A;  1ZQY A;  2HHW A;  2PMZ F;  4OJ5 A;  4NLN A;  3MR3 A;  3F2B A;  2PI4 A;  4RNM A;  5AKL A;  4UB5 A;  4RWN A;  1N48 A;  2PFN A;  5AKH A;  1KFS A;  2W8L A;  2Y9T A;  5JTI A;  2ASD A;  3ISC A;  3AQF A;  5EE0 A;  1TFW A;  1MIW A;  5ALE A;  3WK6 A;  4C8O A;  3KHR A;  5KFN A;  4BXO B;  4CGZ A;  1V9P A;  4JLZ A;  3H0R B;  3WFO A;  1QQ5 A;  3IDW A;  4AT8 B;  2JGA A;  4DFK A;  4O5C A;  1N62 A;  5ALZ A;  5H2F U;  2FPK A;  1J2N A;  3HT3 A;  1NNL A;  2D8C A;  5J0O A;  1SKS A;  4DO9 A;  1L3S A;  4YR0 A;  4B9T A;  8ICW A;  2QKQ A;  3BS7 A;  2KP7 A;  2ZG6 A;  2KIV A;  3RB3 A;  4P4M A;  1NK0 A;  5GTI U;  3A0B U;  4C0Z A;  4ED0 A;  5KFE A;  4P4P A;  1JIH A;  4NWI A;  2PFO A;  8ICH A;  4FS1 A;  5D49 A;  2MAX A;  4MHV A;  2B6G A;  5CA7 A;  4J9M A;  3PW2 A;  5HR7 A;  4C8N A;  9ICX A;  1Q46 A;  3JPQ A;  1LV5 A;  5AK3 A;  1UT8 A;  5IIO A;  3RB4 A;  1NJY A;  1LKY A;  1AQ6 A;  4AYB F;  2KMD A;  1XWL A;  5DEC A;  4PL1 A;  2JXJ A;  4X4N A;  3WK4 A;  4AP9 A;  9ICT A;  3WFS C;  1JMS A;  1QQ7 A;  4EEN A;  2V4R A;  5DLF A;  1UA1 A;  3EF2 A;  4OJO A;  4P0Q A;  2ZUB A;  2BQU A;  1Q8K A;  3MBY A;  1U47 A;  3BDP A;  1ZQA A;  1K5O A;  2FPL A;  4CE6 A;  5ALT A;  3HPO A;  3SYZ A;  4RWQ A;  5DB8 A;  8ICL A;  5J0W A;  2ZH9 A;  4IRD A;  2ES6 A;  4US8 A;  2W04 A;  8ICR A;  4I2A A;  2Z7J A;  3ZD9 A;  3Q8K A;  2HHX A;  3RTV A;  5DG8 A;  2W7P A;  4QNL A;  5DB6 A;  2J6U A;  1Q3V A;  5AM2 A;  3AU6 A;  2Y1J A;  1PVQ A;  4F2S A;  3N4M B;  1S0O A;  3TAP A;  3RR8 A;  3AQL A;  4P0P A;  3K7D A;  2FMS A;  1VLB A;  1ZQV A;  1Q79 A;  3AN1 A;  3AU2 A;  5IIM A;  4FHP A;  2HMX A;  4ECX A;  9ICL A;  5ALI A;  2JH7 A;  1B4F A;  4QWA A;  3TFR A;  3ONN A;  1ZD3 A;  2UVR A;  4DL2 A;  4NY8 A;  2R18 A;  4PZN A;  1DK2 A;  3T5K A;  2KKP A;  3OV7 A;  4ACO A;  5CWR A;  3OTQ A;  2ATL A;  4DQQ A;  4ELT A;  5BPC A;  1FIQ A;  2H3Z A;  3PVX A;  2W8K A;  4M9G A;  1U45 A;  4ED3 A;  2HW3 A;  3H4B A;  4C8K A;  1FFU A;  3I28 A;  5AI6 A;  5AM4 A;  3B9J A;  5HC9 A;  4HX0 A;  2BGW A;  3N7R C;  5J8Y C;  2BDU A;  4XQ8 A;  1SZP A;  4I2H A;  1ZQU A;  9ICJ A;  2QAR A;  1RYS A;  1X6I A;  1ZXI A;  2DKX A;  4KLH A;  1F5A A;  2FLP A;  1L7M A;  2KHV A;  2BQR A;  4KB6 A;  2UVW A;  5J0U A;  3C23 A;  2BR0 A;  2GO7 A;  5KFJ A;  4F4W A;  4MFC A;  4P2H A;  3A0H U;  2KIW A;  1NK7 A;  2RQ5 A;  2QB0 A;  4J9K A;  3SZ2 A;  1ZD2 P;  4F8R A;  3EW9 A;  2Q66 A;  4NLK A;  4WBY A;  1ZQW A;  7ICN A;  4NJ8 A;  4CF4 A;  3QUQ A;  4Y2P A;  1BPY A;  4ECY A;  1BNP A;  1ZQJ A;  3UQ0 A;  9ICN A;  1NO5 A;  4IL6 U;  4NL9 C;  1ZQL A;  4KLE A;  4K9A A;  1L3V A;  2F77 X;  3CP8 A;  5KAF U;  3SEI A;  3WKD A;  5KT6 A;  5J0S A;  3FM9 A;  5B5E U;  1ZQK A;  3KD3 A;  4DSI A;  4NXU A;  4I2D A;  4FH5 A;  2F2A B;  4F5R A;  3AM9 A;  4CF5 A;  2E1F A;  5ALW A;  1RZT A;  2YML A;  4B9N A;  4F3O A;  4ELV A;  3LK9 A;  3PV8 A;  2VA2 A;  8ICN A;  7ICV A;  2P6U A;  1S8O A;  5AI0 A;  1XNS A;  4F2R A;  3BZK A;  4TUS A;  4RWO A;  5HMM A;  3D6J A;  1HIW A;  5GTH U;  1NK8 A;  2KSO A;  5EWE A;  2MUT A;  2M2U A;  3QYP A;  4BWJ A;  3NYB A;  4JMU A;  1D9F A;  2BBJ A;  4M9J A;  3PSI A;  4I2F A;  1OU5 A;  4GC6 A;  3I76 A;  1CUK A;  4JLX A;  2PFQ A;  1XSP A;  4NM1 A;  2LYH A;  4C8M A;  1PK1 A;  3HKZ C;  1KEJ A;  2BDP A;  5B66 U;  3ETR A;  1L7O A;  9ICV A;  1M6Y A;  5BOM A;  4PL2 A;  2LYA A;  4R8U B;  5DBA A;  3KHH A;  4X4T A;  2A3V A;  1MSW D;  3PW4 A;  3KHG A;  2FMQ A;  4RQ3 A;  3JPT A;  4RQ6 A;  2HBJ A;  2WHE A;  4K99 A;  3HJE A;  2YY6 A;  1NK5 A;  2RFF A;  4NXZ A;  5DED A;  2DQN B;  2W9B A;  4K4G A;  1NJX A;  2IBK A;  4F5Q A;  2G07 A;  7ICL A;  2WF6 A;  1KSP A;  1T8E A;  2ZIU B;  2RDJ A;  4A8E A;  1X40 A;  3KZX A;  1CEZ A;  1Q78 A;  4WC6 A;  5CHG A;  3V7J A;  2HOF A;  3NVV A;  3ISB A;  4LEV A;  4RQM A;  1NI3 A;  1LB2 B;  2Q0Z X;  2C2E A;  3U26 A;  4DL5 A;  4RUC A;  2W03 A;  1QSL A;  3QX7 A;  4Z6D A;  2BBH A;  3TAD C;  5JUM A;  3OVA A;  2ZH4 A;  2G5I B;  2DKZ A;  3UPS A;  1NJZ A;  4RQN A;  2H3I A;  3JPP A;  4LVS A;  1ZQ1 C;  2V4Q A;  4NV0 A;  4OD0 A;  4FBT A;  2JEG A;  1JAL A;  4XRH A;  2V9W A;  5TZV A;  5HRH A;  1L3T A;  4N7R A;  3RJI A;  2EZZ A;  2IMW P;  5AK5 A;  1S76 D;  4UB1 A;  4KX5 A;  3TKA A;  2MUT B;  2R8H A;  4I28 A;  2O5A A;  5III A;  1N63 A;  2MA1 A;  2FE9 A;  2RDI A;  3PX4 A;  1X9S A;  4I29 A;  2B0C A;  2VIX A;  2B21 A;  5HP4 A;  3ZDE A;  3C18 A;  4DS5 A;  5ALS A;  4QZE A;  3CK6 A;  3RB0 A;  4O3R A;  4UAZ A;  4X4V A;  2EAM A;  2A19 A;  2RRD A;  4Y2S A;  1KNY A;  4FFD A;  4B9M A;  4F4X A;  3OHB A;  1JRO A;  3SAH A;  3TI0 A;  4YQW A;  4KMO B;  5J2C A;  1RXV A;  4UQG A;  4OAI Z;  2RLT A;  2XGP A;  4YR3 A;  1L5U A;  2M9N A;  5KFF A;  3UXP A;  7ICJ A;  4EBK A;  2DFL A;  1FO4 A;  3TAR A;  1F44 A;  5CFS A;  2FPM A;  3IHQ B;  4JUZ A;  5KL1 B;  3MC1 A;  4F92 B;  5ALQ A;  4I27 A;  1SL2 A;  2YX8 A;  4Q43 A;  4X4S A;  3ETL A;  4R65 A;  5AIA A;  3RAQ A;  2K4I A;  3NAS A;  1BPD A;  1UEU A;  4DFD A;  1IM4 A;  2ZXH A;  5J2H A;  2E8N A;  4KLQ A;  1IXR A;  4WC2 A;  5HHI A;  3UMC A;  5KG7 A;  1KFD A;  2G5H B;  2ZH1 A;  5J0Y A;  1VFG A;  3M1Y A;  3V7L A;  4RT3 A;  5HRK A;  1B0X A;  5AI4 A;  4DFP A;  4XQ7 A;  3AL0 B;  5DB9 A;  4O3S A;  2XID A;  2KNJ A;  4Z6C A;  2NO4 A;  4K97 A;  1SV0 A;  5J2F A;  4O0I A;  3OSP A;  4YG2 A;  4US9 A;  3HJ4 A;  2RP5 A;  4DOA A;  2WB1 F;  4B6J A;  2MRL A;  2BPF A;  4LZG A;  4F4K A;  3LVV A;  4IR1 A;  2HN2 A;  1RQL A;  3THV A;  3Q8Q B;  3GDX A;  1N61 A;  2FLN A;  2ZH7 A;  4IQT A;  1S0M A;  2HDO A;  2AGQ A;  3QU5 A;  5KNI A;  1T94 A;  9ICU A;  3DDH A;  4YMM A;  2EAP A;  4C7Z A;  2BPC A;  3D2S A;  3H8J A;  4QZB A;  4AYB C;  2XY6 A;  1KLN A;  2KVC A;  5HRB A;  1ED1 A;  2YQE A;  4DOC A;  5KFO A;  9ICR A;  2NRT A;  8ICT A;  1RDF A;  3T79 A;  1D8L A;  5AKE A;  3MR2 A;  3PST A;  5J2J A;  4Q8F A;  8ICA A;  2BE3 A;  4KLD A;  1X9M A;  1ZET A;  4F50 A;  4M9H A;  1JAJ A;  2P6R A;  3WK7 A;  1ZQD A;  5KFD A;  3Q8P B;  3IM1 A;  2F44 A;  4LZD A;  5IIJ A;  3G6V A;  2E8O A;  4Y2Y A;  1FA0 A;  2ZH8 A;  4RPX A;  3N28 A;  4GC7 A;  1ZOL A;  4IRK A;  2QAR B;  1VJ5 A;  2N1R A;  5KFV A;  4WC7 A;  5DDY A;  3MFH A;  3M9N B;  2K4H A;  2W11 A;  2O6K A;  4UBC A;  2EZY A;  2W9A A;  5CP2 A;  1OXJ A;  4KN4 A;  3V7K A;  1B22 A;  4P0Q B;  4ECT A;  2D3D A;  4QJF B;  2DBY A;  3OVB A;  4I2E A;  2JR5 A;  5ALD A;  1ZQI A;  4WC1 A;  3T3F A;  2F8K A;  4RQ5 A;  4FO1 A;  4WQK A;  4XJE A;  5L9X A;  1JN3 A;  2I5H A;  4ICA A;  3JCF A;  5J0R A;  4HYK A;  4IS7 A;  1BVS A;  5ALF A;  3UPQ A;  1HUO A;  3HP6 A;  1XO1 A;  1DXS A;  2JV3 A;  2K4P A;  4I2I A;  5AHX A;  1S9F A;  1ZQP A;  3PX6 A;  5C0Y A;  1A76 A;  3V6J A;  1MQ3 A;  2E8M A;  5HRF A;  4O67 A;  5ALR A;  3HWT A;  2W55 A;  4K4H A;  4NXX A;  2YN4 A;  2HVI A;  1KTQ A;  4LEW A;  3ERC C;  4EBJ A;  2C2D A;  3RJF A;  2ZIX B;  2ODG A;  2WAQ F;  3NTU A;  3N7P D;  3H39 A;  1Z1V A;  3BS5 A;  4DSF A;  3EPG A;  2ID1 A;  2IOF K;  4C4R A;  3RRG A;  2K8A A;  4WC4 A;  3BJY A;  2OXO A;  4R8U A;  1KN5 A;  1JXE A;  4FZL A;  4KLJ A;  2Y0S F;  3HIL A;  2JHD A;  4QW9 A;  2R8G A;  4PHD A;  3E58 A;  1RYR A;  1N5W A;  4X4O A;  5B3Q A;  2QLT A;  2EWR A;  4M04 A;  3L3F X;  2LI6 A;  5EWF A;  1Z19 A;  3FC4 A;  1R89 A;  1RPL A;  5JRT A;  3PZP A;  3BZC A;  4NL9 A;  3IP4 B;  4RQ1 A;  3JYY A;  1ZRM A;  3IV6 A;  1N2X A;  5J8Y A;  1COK A;  4LT6 A;  1JXL A;  4J9L A;  4M0A A;  3TAC B;  4F72 A;  3J81 j;  3PW7 A;  5DGA A;  1UT5 A;  4IG8 A;  2E8P A;  2HOI A;  4KLT A;  2H3F A;  3KFU F;  3ER9 B;  2HHT A;  3SV3 A;  5AKX A;  2LMR A;  4KN7 A;  2AU0 A;  1VJ7 A;  4P4O A;  3K1R B;  9ICS A;  4BWM A;  3PW0 A;  3ZDC A;  4YFK A;  3NGD A;  4FE3 A;  1O03 A;  4MEX A;  5JU5 A;  5F9L A;  2QB1 A;  3SMV A;  4F4Y A;  1YT3 A;  2A1J B;  3H7I A;  3OUY B;  1BGX T;  4KLL A;  1T7P A;  1X9W A;  4GXJ A;  3N7S C;  3FAH A;  4UB6 U;  4NLG A;  5G5H A;  1KRP A;  4UAS A;  1JRP A;  4NLB A;  2HVH A;  2ZUD A;  3GFK B;  5KG1 A;  3OJU A;  4TUP A;  3QU7 A;  3ZD8 A;  4UB2 A;  1ZQX A;  3F5A A;  1TE2 A;  4Z6F A;  4F5O A;  5B3P A;  2IOH A;  4PGQ A;  2WAQ C;  1A0P A;  1WG8 A;  2W9M A;  5HRI A;  2YMM A;  3NWI A;  5KG3 A;  1Z00 A;  1X6J A;  2KK0 A;  1RM6 C;  4DOB A;  4KLF A;  4CNQ A;  1NK6 A;  2YMP A;  5AM3 A;  1ZRN A;  1KQQ A;  1TV9 A;  2IHM A;  4EEK A;  4ECU A;  3ORY A;  3IN5 A;  2FLL A;  1S97 A;  3NVY A;  2LM1 A;  4U6P A;  2ZIW B;  2M2W A;  3IG8 A;  3E0F A;  5AKI A;  3B0Y A;  5J2A A;  4KLS A;  1RQN A;  3M6Z A;  1ZJN A;  3RH5 A;  4BUG A;  5L1I A;  5KFZ A;  3OGU A;  5E79 U;  4UB4 A;  2KV2 A;  4YCX A;  2EH9 A;  4EEL A;  1UPH A;  1QLN A;  2K60 A;  4I0U A;  7ICS A;  3M9M B;  3IG5 A;  2KZZ A;  3SEN A;  5J2G A;  4EBD A;  4FHW A;  2HBM A;  8ICV A;  2F3N A;  4RQ0 A;  2K8B B;  3SAF A;  4RNO A;  5KFL A;  2WB1 C;  1V4A A;  1QQ6 A;  1XSN A;  4PHA A;  4EGW A;  2KOB A;  3V6K A;  3M8S A;  2P66 A;  1URJ A;  5CR0 A;  4DLG A;  4UD4 A;  3BQ0 A;  3C5F A;  1SL1 A;  4NXV A;  3CW2 C;  1DRG A;  2EQY A;  4AT7 B;  1SXE A;  4C7Y A;  2KJ5 A;  2KVS A;  9ICK A;  1SV0 C;  4FHV A;  5CFT A;  1UCV A;  4BXO A;  3H8W A;  4EP7 A;  4AT9 A;  4KIT B;  4DL3 A;  3UXO A;  5J0T A;  5KG6 A;  5KG4 A;  4KMU A;  9ICI A;  3BS5 B;  2R8K A;  3NRW A;  8ICB A;  4Q45 A;  3QU9 A;  5KFK A;  3N97 B;  3QEA Z;  1SKR A;  5HNK A;  4DFM A;  5AK4 A;  5KFM A;  3R9K A;  1P7D A;  3MGI A;  3KTQ A;  3NKU A;  3G6X A;  4ED6 A;  3FYH A;  3Q8L A;  4DL4 A;  1MIY A;  5ALL A;  4QZH A;  3MGV A;  1HJP A;  3RJK A;  5KTQ A;  1ZQB A;  2GH1 A;  5HRG A;  4G3I A;  8ICK A;  4AT8 A;  3MDA A;  3H40 A;  3JPO A;  2AXT U;  2LPE A;  5ALG A;  2H3V A;  4MF8 A;  3H4D A;  2W3S A;  4FHY A;  1NKB A;  4EX7 A;  4RPY A;  3ZDD A;  3C66 A;  4DL7 A;  8ICQ A;  1DK3 A;  1TVA A;  5AKJ A;  4NLZ A;  1NZB A;  4X5V A;  4PGY A;  2PXI A;  2KHQ A;  2LYB A;  4I2G A;  3K1Z A;  3QZ8 A;  2HHP A;  2KTQ A;  4WCW A;  3C21 A;  5K4L A;  3BQT A;  7ICI A;  2OM6 A;  4UAV A;  3RJE A;  1DGS A;  3OSN A;  4BDP A;  9ICO A;  3S6J A;  1ZQE A;  2XY5 A;  1PZN A;  4RT2 A;  2OWO A;  4OAG A;  1J97 A;  2FCL A;  3WKC A;  4Y2X A;  5DG9 A;  2ZIV A;  9ICP A;  5AKG A;  5KT2 A;  2CXY A;  4F5N A;  4E7X A;  3H8S A;  3K4G A;  2HBK A;  5KFT A;  7ICP A;  1QTM A;  2CPR A;  1X9X A;  1ZYQ A;  5DQI A;  1KDH A;  2DPJ A;  1ZQC A;  3CYM A;  4PZO A;  3EWA A;  4S3N A;  2DR8 A;  3WFQ E;  1H38 A;  2B56 A;  3GU3 A;  4PH5 A;  5KT5 A;  4RZR A;  4PHE A;  3F2D A;  5CEH A;  5DBB A;  4QZ9 A;  5EOZ A;  4I2C A;  5J2K A;  4DF8 A;  4GLX A;  2L5Y A;  3V72 A;  3PML A;  5EE9 A;  4WJ3 B;  5ALV A;  3RRH A;  3GIJ A;  1NZP A;  8ICM A;  4RUA A;  4QWE A;  4WQL A;  3Q8R B;  1SV4 A; 
#chains in the Genus database with same CATH homology
 5HHH A;  2V4R A;  5DLF A;  1UA1 A;  1ZQD A;  5KFD A;  2ZUB A;  2BQU A;  1ARO P;  3GQC A;  4M6W B;  4PPX A;  3Q8P B;  3MBY A;  3Q8M A;  1U47 A;  3BDP A;  1ZQA A;  3AQM A;  1TK0 A;  3AUO A;  2FPL A;  3IM1 A;  5KFY A;  5HRD A;  4LZD A;  5IIJ A;  3HPO A;  3SYZ A;  3H3A A;  4RWQ A;  3G6V A;  1FA0 A;  7ICO A;  3GV5 B;  2ZH8 A;  2ALZ A;  4RPX A;  2R8J A;  5DB8 A;  8ICL A;  5J0W A;  4GC7 A;  2AQ0 A;  2ZH9 A;  4IRD A;  5KFC A;  1ZQN A;  1S0N A;  4IRK A;  8ICR A;  4I2A A;  4WC3 A;  3ZD9 A;  5KFV A;  3Q8K A;  4WC7 A;  5DDY A;  5EWG A;  2HHX A;  3M9O B;  3RTV A;  5DG8 A;  3MFH A;  3M9N B;  5J29 A;  5DB6 A;  2BQ3 A;  4JV1 A;  3SV4 A;  5DDM A;  2BCQ A;  4UBC A;  2J6U A;  2W9A A;  3V7K A;  5CP2 A;  4KN4 A;  2JEF A;  5L1K A;  4TQR A;  7ICG A;  1T4G A;  4M6W A;  1ZQM A;  5KFG A;  3AU6 A;  2Y1J A;  8ICC A;  4Q44 A;  1B22 A;  4ECT A;  4F2S A;  3N4M B;  1S0O A;  3TAP A;  3RR8 A;  3AQL A;  3OVB A;  4I2E A;  2A1J A;  4ZH4 A;  4ED2 A;  1TKD A;  1QSS A;  2ZTC A;  1ZQO A;  1ZQI A;  2FMS A;  4WC1 A;  3T3F A;  2PFP A;  4RQ5 A;  1ZQV A;  2KZ3 A;  5KG0 A;  4R63 A;  3GV8 B;  1Q79 A;  3EYZ A;  3UQ2 A;  3AU2 A;  5IIM A;  2NRW A;  1WOT A;  2J6T A;  5L9X A;  4FHP A;  1JN3 A;  3SI8 A;  4ECX A;  9ICL A;  2F1J A;  3RR7 A;  5J0R A;  4HYK A;  1BVS A;  3PW5 A;  3TAQ A;  4Z6E A;  4QWA A;  3TFR A;  5HRL A;  3UPQ A;  1HUO A;  2UVR A;  4DL2 A;  7ICQ A;  3HIY A;  4NY8 A;  3PO5 A;  3L9D A;  3HP6 A;  1KLN A;  1XO1 A;  4DWI A;  1DK2 A;  3T5K A;  1XS9 D;  2F1I A;  3OV7 A;  1S9F A;  4I2I A;  5CWR A;  1ZQP A;  4K4I A;  3PX6 A;  4YXJ A;  1NKC A;  1MQ2 A;  4B9V A;  8ICG A;  1A76 A;  3V6J A;  2ATL A;  1MQ3 A;  3FDS A;  5KT7 A;  5HRF A;  4DQQ A;  4NKT A;  1SL0 A;  4ELT A;  5BPC A;  4QZ8 A;  1NJW A;  2ZHB A;  4RQ4 A;  2ZTE A;  3PVX A;  2W8K A;  2C28 A;  4M9G A;  5KFI A;  3OHA A;  9ICC A;  3HWT A;  1U45 A;  4ED3 A;  4K4H A;  3H4B A;  2HW3 A;  2HVI A;  3C2L A;  2HHS A;  2VA8 A;  1KTQ A;  1X2I A;  2NRV A;  4C8K A;  2HHU A;  4F91 B;  4DSE A;  8ICJ A;  3C2M A;  2BPG A;  4EBJ A;  3LWL A;  1JX4 A;  2XCA A;  5HC9 A;  4EZ6 A;  2C2D A;  2AGO A;  1NOM A;  1T3N A;  2BGW A;  3GV7 B;  2I9G A;  4IR9 A;  3RJF A;  1NK9 A;  4JWN A;  9ICE A;  3MFI A;  4AT7 A;  3NTU A;  4XQ8 A;  3H39 A;  1SZP A;  2NRX A;  4KLU A;  4I2H A;  3RH4 A;  4KLI A;  9ICB A;  2J6S A;  4O3N A;  4JV0 A;  3EPG A;  4DSF A;  8ICP A;  4YMN A;  1ZQU A;  9ICJ A;  2ID1 A;  1RYS A;  4O3Q A;  3QZ7 A;  4KLH A;  1F5A A;  2FLP A;  3RRG A;  4KTQ A;  2BCR A;  4WC4 A;  3BJY A;  2BQR A;  2UVW A;  4AT9 B;  4DL6 A;  4R8U A;  2ASL A;  5J0U A;  4DLE A;  3C1Z A;  1COO A;  3C23 A;  5IIK A;  5KFJ A;  1JXE A;  5J0P A;  2BR0 A;  4F4W A;  1N56 A;  4KLJ A;  4MFC A;  4P2H A;  1NK7 A;  5J2B A;  4TQS A;  7ICE A;  1XU4 A;  4QW9 A;  1JQR A;  4J9K A;  2R8G A;  1ZQG A;  4DF4 A;  3SZ2 A;  4PHD A;  4F8R A;  1RYR A;  4TUR A;  4FH3 A;  1S10 A;  3EW9 A;  3OUY A;  4RNN A;  1EXN A;  4X4O A;  4NLK A;  2Q66 A;  4UB3 A;  4WBY A;  1ZQW A;  4M04 A;  7ICN A;  5EWF A;  4UAW A;  1BPY A;  1R89 A;  1RPL A;  4ECY A;  4FO6 A;  5L1J A;  2XCP A;  3HX0 A;  1ZQS A;  1BNP A;  1ZQJ A;  2O1P A;  4YMO A;  3UQ0 A;  9ICN A;  1NO5 A;  5J0X A;  4RQ1 A;  3JYY A;  4TUQ A;  1ZQL A;  2KFZ A;  3BQ1 A;  2BCV A;  4O3O A;  2W9B B;  4KLE A;  4NM2 A;  2Y1I A;  4J9L A;  1JXL A;  1L3V A;  2JEI A;  4M0A A;  4LT6 A;  5J2D A;  4QWB A;  3PW7 A;  3G6Y A;  5DGA A;  1UT5 A;  4JK1 A;  4IG8 A;  4QZF A;  4ECZ A;  3PX0 A;  2ZH6 A;  5KT6 A;  8ICY A;  5J0S A;  4KLT A;  5DLG A;  4E0D A;  1ZQK A;  1UEV A;  3MR6 A;  4X4U A;  2IHN A;  5D4B A;  2ISO A;  2HHT A;  2AJQ A;  4DSI A;  3SV3 A;  2NRZ A;  5DGB A;  9ICQ A;  4I2D A;  4FH5 A;  4KN7 A;  4F5R A;  5DB7 A;  2AU0 A;  2AGP A;  1VJ7 A;  2JZB A;  2ZTD A;  4P4O A;  1TFR A;  9ICS A;  4BWM A;  3PW0 A;  3ZDC A;  7ICF A;  1RZT A;  4YFK A;  4NKU A;  4QZI A;  4EYH B;  3NGD A;  4GXI A;  4ED7 A;  5HRE A;  4MEX A;  5F9L A;  4B9N A;  4F3O A;  2KFN A;  2I1Q A;  4ECR A;  4ELV A;  1TFY A;  4F4Y A;  3H7I A;  2A1J B;  3OUY B;  1Z00 B;  1BGX T;  1BNO A;  4ED1 A;  3LK9 A;  3PV8 A;  4KLL A;  2VA2 A;  5C5J A;  1Y88 A;  4R64 A;  1T7P A;  1NKE A;  3LDA A;  4QZA A;  4GXJ A;  1X9W A;  8ICN A;  4DSL A;  7ICV A;  4EBK A;  2P6U A;  4NLG A;  9ICA A;  1KRP A;  4F2R A;  4DQS A;  4KLM A;  4RQ7 A;  3RJG A;  4TUS A;  4RWO A;  4YVZ A;  4ECQ A;  4QW8 A;  2HVH A;  5HMM A;  2ZUD A;  1MC8 A;  4YD2 A;  2VA3 A;  5KFH A;  2AQ4 A;  1NK8 A;  5EWE A;  4PHP A;  3RH6 A;  2MUT A;  7ICM A;  2DVI A;  2M2U A;  2XY7 A;  3GFK B;  4BWJ A;  5KG1 A;  3OJU A;  2ASJ A;  4Q8E A;  4TUP A;  1D9F A;  3NYB A;  4O5E A;  3ZD8 A;  4UB2 A;  3MDC A;  4I2F A;  4M9J A;  1ZQX A;  1OU5 A;  4GC6 A;  2H5X A;  4RU9 A;  3JPS A;  1KFT A;  2DR9 A;  4Z6F A;  2XGQ A;  3UXN A;  4F5O A;  4RQ8 A;  3PR5 B;  1ZQZ A;  1CUK A;  4PGQ A;  2PFQ A;  3GII A;  1DOQ A;  1XSP A;  3BQ2 A;  1BPB A;  3C1Y A;  5DG7 A;  2LYH A;  4C8M A;  4NM1 A;  2W9M A;  5HRI A;  4RQ2 A;  7ICH A;  1U9L A;  1KEJ A;  3K75 D;  5KG3 A;  1Z00 A;  2BDP A;  4DOB A;  7ICT A;  4KLF A;  5F2V O;  9ICV A;  9ICW A;  5HRB A;  3JZ0 A;  1NK6 A;  5BOM A;  4X4R A;  4R8U B;  2IHM A;  1TV9 A;  4B9S A;  4ECU A;  2ZJA A;  3ORY A;  5J0Q A;  5DBA A;  3MGH A;  4B9U A;  2C2R A;  3KHH A;  4DQP A;  1U4B A;  4RWP A;  4UAY A;  3T5H A;  1S97 A;  2F1H A;  4DQR A;  2FLL A;  4X4T A;  5KFQ A;  3PR4 A;  4MFA A;  1D8Y A;  4QZC A;  1MSW D;  3OJS A;  3KHG A;  3PW4 A;  1ZJM A;  4DSJ A;  2M2W A;  4PGX A;  2FMQ A;  4EBE A;  4RQ3 A;  4WBZ A;  5CJ7 A;  3JPT A;  4J9N A;  3ZDB A;  4RQ6 A;  7ICU A;  3RJJ A;  4IQV A;  3RAX A;  2XC9 A;  3B0Y A;  5J2A A;  4KLS A;  4MEY A;  3ZDA A;  1TAU A;  2BCS A;  1ZJN A;  1NK5 A;  4NXZ A;  3RH5 A;  4ELU A;  2RFF A;  5DED A;  4X4Q A;  1YLQ A;  2W9B A;  1U49 A;  1NJX A;  4K4G A;  2DR5 A;  2IBK A;  5L1I A;  5KFZ A;  3OGU A;  7ICK A;  5KFW A;  4UB4 A;  2M2T A;  4F5Q A;  5KG5 A;  4YCX A;  7ICL A;  5KT4 A;  1QLN A;  1KSP A;  2ISP A;  1T8E A;  7ICS A;  3PNC A;  3M9M B;  2RDJ A;  4YP3 A;  1S77 D;  2KZZ A;  5J2G A;  4QZD A;  2KZM A;  1XSL A;  1CEZ A;  5KFS A;  4EBD A;  1BPE A;  5IIL A;  2C22 A;  4JWM A;  9ICH A;  4FHW A;  2W9C A;  8ICV A;  1Q78 A;  4WC6 A;  5CHG A;  4YR2 A;  3PMN A;  3V7J A;  4RPZ A;  3ISB A;  4RQ0 A;  2ZH2 A;  1ZQF A;  9ICF A;  5KFU A;  3EZ5 A;  1SKW A;  4XA5 A;  5KFL A;  4RNO A;  1LB2 B;  4MFF A;  2Q0Z X;  5IIN A;  4WC5 A;  2C2E A;  3RB6 A;  3QE9 Y;  1V4A A;  5CB1 A;  1XSN A;  4PHA A;  2FMP A;  4J9O A;  4DL5 A;  4RUC A;  1QSL A;  5DQH A;  3V6K A;  1ZQT A;  4X4P A;  4Z6D A;  3M8S A;  2GWS A;  2P66 A;  1TK8 A;  4EZ9 A;  5JUM A;  3OVA A;  5DQG A;  4I2J A;  5CR0 A;  1R8C A;  2ZH4 A;  1ZQR A;  4M9L A;  3UPS A;  1NJZ A;  4UBB A;  4DLG A;  2WTF A;  4UD4 A;  4M2Y A;  3BQ0 A;  5DBC A;  3JPP A;  3C5F A;  2BHN A;  5HML A;  4LVS A;  4DS4 A;  1SL1 A;  8ICX A;  1D9D A;  2DRB A;  4O9M A;  4AT7 B;  2V4Q A;  4FBT A;  2IA6 A;  2JEG A;  4XRH A;  2V9W A;  2HHQ A;  5TZV A;  2VAN A;  2DPI A;  4FHX A;  9ICK A;  5HRH A;  4FHV A;  4B9L A;  4ATB A;  1L3T A;  4M47 A;  3PO4 A;  4BXO A;  3H8W A;  4R66 A;  8ICK A;  4EP7 A;  4O3P A;  3RJI A;  4AT9 A;  4KIT B;  2IMW P;  4ECS A;  3UXO A;  4DL3 A;  5J0T A;  4UB1 A;  1S76 D;  3H37 A;  5KG6 A;  5KG4 A;  1RXW A;  3WFP A;  5KFB A;  4O5K A;  1MIV A;  2NRK A;  2MUT B;  4KMU A;  3HJ1 A;  2R8H A;  4I28 A;  1S0V A;  9ICI A;  2BKE A;  2R8K A;  3T5L A;  4DQI A;  4KLG A;  5III A;  4QZG A;  4Q45 A;  8ICB A;  8ICI A;  2O5A A;  5J2I A;  2RDI A;  5KFK A;  3PX4 A;  4F4Z A;  1X9S A;  8ICS A;  3LQC B;  4M5D A;  4GXK A;  4J9Q A;  1C7Y A;  4I29 A;  9ICG A;  3N97 B;  1BPX A;  3H38 A;  2R8I A;  3E2E A;  2M2V A;  3QEA Z;  2B21 A;  1SKR A;  5HNK A;  4DFM A;  3V6H A;  5HP4 A;  3ZDE A;  5KFM A;  4QWC A;  9ICM A;  3C18 A;  4DS5 A;  4QZE A;  3OVS A;  3ISD A;  3RB0 A;  3GIK A;  4DFJ A;  4CCH A;  4O3R A;  4IQU A;  3MGI A;  3KTQ A;  4UAZ A;  4ED8 A;  4DEZ A;  1U48 A;  4X4V A;  5DKW A;  3TAN A;  3G6X A;  3WFR E;  3RBD A;  4F93 B;  3Q8S B;  3FYH A;  4ED6 A;  4B9M A;  4F4X A;  2JZB B;  5J2E A;  8ICF A;  1KNY A;  4J9S A;  3OHB A;  4DL4 A;  3Q8L A;  1MIY A;  4YXM A;  1K1Q A;  3KHL A;  1Z3E B;  1UA0 A;  1TAQ A;  4XUS A;  4QZH A;  4YQW A;  3TI0 A;  5J2C A;  3TQ1 A;  1RXV A;  4UQG A;  1HJP A;  3C2K A;  3RJK A;  5KTQ A;  1ZQB A;  2ZJ5 A;  4QWD A;  2XGP A;  3MR5 A;  4FBU A;  5HRG A;  4F5P A;  4YR3 A;  1K1S A;  2M9N A;  5KFF A;  5KG2 A;  3M8R A;  3HW8 A;  4ECW A;  3UXP A;  1L5U A;  3PY8 A;  3MDA A;  2DFL A;  2UVV A;  7ICJ A;  4KLO A;  3LWM A;  3H40 A;  4JV2 A;  3JPO A;  1B43 A;  2ZJ8 A;  3MAB A;  3TAR A;  4E80 A;  2FPM A;  3IHQ B;  4IQW A;  1BPZ A;  1NK4 A;  4JUZ A;  2UVU A;  7ICR A;  4MF8 A;  3H4D A;  4E8F A;  1WCL A;  2DRA A;  5KFA A;  4F92 B;  4FHY A;  4J9R A;  1NKB A;  4RPY A;  3ZDD A;  4I27 A;  4FS2 A;  3C66 A;  2PI5 A;  1SL2 A;  2PBE A;  1QSY A;  2ZUC A;  4DL7 A;  8ICQ A;  4Q43 A;  2KN7 A;  1DK3 A;  1TVA A;  4NLZ A;  4X4S A;  1ZQH A;  3ETL A;  4R65 A;  4X5V A;  4PGY A;  3RAQ A;  4ATB B;  4YD1 A;  8ICU A;  3TFS A;  2PXI A;  4EBC A;  1ZQQ A;  2BCU A;  1ZQY A;  5KFX A;  1BPD A;  2HHW A;  1UEU A;  4I2G A;  4BGD A;  4NLN A;  1IM4 A;  5KT3 A;  3MR3 A;  5J2H A;  4KLQ A;  1IXR A;  5HR9 A;  4WC2 A;  5HHI A;  3QZ8 A;  2HHP A;  2KTQ A;  4WCW A;  3C21 A;  3BQT A;  5KG7 A;  2PI4 A;  7ICI A;  4RNM A;  1KFD A;  2ZH1 A;  4UB5 A;  5J0Y A;  1N48 A;  4RWN A;  4X0B A;  1VFG A;  3RJE A;  3V7L A;  2PFN A;  1DGS A;  4DSK A;  1L3U A;  4RT3 A;  3OSN A;  1KFS A;  2W8L A;  4BDP A;  8ICE A;  5HRK A;  2ASD A;  1R8B A;  3ISC A;  9ICO A;  4DFP A;  3RJH A;  1MIW A;  1TFW A;  4XQ7 A;  4C8O A;  3KHR A;  1ZQE A;  2XY5 A;  1PZN A;  5KFN A;  5DB9 A;  4RT2 A;  2OWO A;  4BXO B;  4M9N A;  1V9P A;  4O3S A;  3WFO A;  4Z6C A;  5DG9 A;  4J9P A;  9ICP A;  4AT8 B;  2DR7 A;  5KT2 A;  4DFK A;  2XO7 A;  4O5C A;  4I2B A;  4F5N A;  5J2F A;  4E7X A;  4O0I A;  1HUZ A;  3H8S A;  3C5G A;  3OSP A;  8ICZ A;  4YG2 A;  3K4G A;  2ZH5 A;  2FPK A;  3HJ4 A;  3HT3 A;  4WC0 A;  5BOL A;  2HHV A;  4G3I A;  4DOA A;  5J0O A;  1SKS A;  4C8L A;  4DO9 A;  1L3S A;  4YR0 A;  5KFT A;  1TK5 A;  4B9T A;  2BPF A;  4LZG A;  8ICW A;  4F4K A;  1QTM A;  7ICP A;  4IR1 A;  2KP7 A;  3THV A;  3RB3 A;  4P4M A;  3Q8Q B;  4AT8 A;  3GDX A;  3EPI A;  1XC9 A;  4IRC A;  1ZYQ A;  1NK0 A;  5DQI A;  2FLN A;  2ZH7 A;  1KDH A;  4ED0 A;  5KFE A;  4P4P A;  2DPJ A;  1JIH A;  1ZQC A;  4IQT A;  3JPN A;  8ICO A;  3JPR A;  3EWA A;  1S0M A;  2PFO A;  3AQK A;  2AGQ A;  8ICH A;  4S3N A;  2DR8 A;  1A77 A;  4FS1 A;  5D49 A;  1H38 A;  3WFQ E;  4PH5 A;  3B0X A;  2MAX A;  5KT5 A;  4ECV A;  4X0A A;  5L1L A;  4RZR A;  4PHE A;  3RBE A;  9ICU A;  4YMM A;  5CA7 A;  4J9M A;  3PW2 A;  5KFP A;  4C8N A;  4EEY A;  2BPC A;  9ICX A;  3H8J A;  5DBB A;  4QZ9 A;  5EOZ A;  3JPQ A;  4QZB A;  1LV5 A;  4I2C A;  2W9C B;  2XY6 A;  1UT8 A;  5D46 A;  5IIO A;  5J2K A;  4EYI B;  4GLX A;  3V72 A;  4DOC A;  3PML A;  4DF8 A;  5F9N A;  3T5J A;  3RB4 A;  1NJY A;  2ZHA A;  5KFO A;  9ICR A;  1PX5 A;  3AQN A;  2ZH3 A;  4UD5 A;  3RRH A;  2NRT A;  3GIJ A;  3QEB Z;  8ICT A;  1UET A;  3GIL A;  1NZP A;  8ICM A;  1WCN A;  1XWL A;  1D8L A;  3MR2 A;  4Q8F A;  5J2J A;  5DEC A;  4RUA A;  8ICA A;  4YN4 A;  2BE3 A;  4KLD A;  4QWE A;  1X9M A;  1ZET A;  4F50 A;  4M9H A;  3Q8R B;  1R8A A;  3GIM A;  4X4N A;  2JEJ A;  1JAJ A;  4MF2 A;  5KFR A;  9ICT A;  3WFS C;  2P6R A;  1JMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...