4PGYA

Structure of human dna polymerase beta complexed with a nicked dna containing a gt at n-1 position and gc at n position
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
publication title The spontaneous base substitution mechanisms of human DNA polymerase beta
rcsb
source organism Homo sapiens
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pgyA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pgyA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pgyA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pgyA03
2Y1JA 1ZQOA 4ATBA 1NKBA 4J9RA 2UVUA 2KZMA 4K4GA 4UBCA 3ZDCA 4DL7A 4I2EA 4P2HA 3HJ4A 5KFIA 2BCRA 1QSSA 1MIWA 2BGWA 4ELUA 4ED8A 1ZQMA 4UD5A 2DPIA 4M9JA 4O3RA 2HW3A 1XWLA 5KG4A 3LWLA 4IRKA 3M9MB 3MR5A 3KHHA 1HUOA 2FMSA 2KFNA 4E8FA 1TK0A 4LZDA 5CWRA 1TKDA 4F92B 3T5JA 1D9DA 4LZGA 8ICHA 4FHXA 4WCWA 2JZBB 5J0WA 4UB3A 4ECVA 4MEYA 2BQ3A 3PO5A 3AQMA 4WC4A 4PPXA 4B9LA 1UEUA 1MIYA 4ECZA 3Q8SB 4X0BA 2BPFA 4EZ9A 3TARA 4F4YA 5J0OA 4P4MA 4IG8A 4Q44A 1ZQVA 1JIHA 2MUTA 2NRVA 4KLTA 2AJQA 4Z6DA 4YCXA 5J0PA 1QSLA 5KFHA 4X0AA 4G3IA 3KHLA 3WFPA 4RQ5A 5KFSA 1UETA 3PY8A 9ICRA 4KLOA 4R8UA 4F5RA 1BPEA 2M2WA 9ICLA 3Q8MA 4QWDA 2HHWA 3WFQE 2J6UA 5IILA 1NK9A 3EPIA 8ICMA 4M6WA 4NKTA 4RZRA 4RWOA 1ZQTA 2NRTA 2XGPA 2VA3A 3JPPA 5J2AA 4Z6FA 3EW9A 2DRBA 4QZAA 4YR2A 7ICKA 2P6UA 4DFMA 4B9TA 4PHAA 5EWEA 4DSIA 4MFFA 4ECQA 4KLJA 4LT6A 7ICJA 1TK8A 2BE3A 7ICMA 1U9LA 5J2IA 8ICWA 3JPRA 4DSEA 1UT8A 3HWTA 9ICHA 1ZQNA 2JEGA 4X4OA 4O3QA 3G6XA 3C2MA 1Z00A 3FYHA 4F50A 2P6RA 1ZQKA 4Q8FA 4M9LA 3RBEA 9ICJA 3MR3A 9ICAA 3RJFA 5DQGA 4RQ8A 3RJIA 4AT7A 5DB6A 3RBDA 2J6TA 4I2GA 1NOMA 3TI0A 4ED0A 2Y1IA 1NK5A 5D49A 2W9BA 3Q8LA 5DLFA 2O1PA 4RWQA 2AU0A 1B43A 4NXZA 4F4ZA 3T3FA 2AGOA 1D8YA 5J29A 4X4PA 2ASDA 1XS9D 2VA2A 4NM2A 4Q43A 3OGUA 3JPTA 3V7JA 4BWJA 3T5HA 4I29A 8ICCA 1U47A 3BQ0A 4XA5A 2C2DA 2I1QA 2JEJA 2M2TA 5BOMA 4DL5A 5KFWA 3ZD8A 1ZQYA 4RUAA 3PMNA 4MFAA 3PV8A 2M2VA 1JMSA 3C21A 4IQVA 2WTFA 3N97B 2NRWA 2M2UA 2FPMA 4R64A 1JN3A 5KFPA 3BQTA 7ICHA 3SZ2A 1TFYA 3ZDBA 5CA7A 2HVHA 4TURA 3T5LA 8ICUA 5DBAA 5KG7A 3C2KA 2R8HA 3WFRE 4FS2A 3UPQA 4B9MA 4E7XA 3IM1A 5IIOA 4MF8A 3PR5B 4IRDA 2FLNA 8ICOA 3OUYA 3H7IA 3H8SA 1TAQA 5DB7A 5KG3A 4DOAA 2UVVA 4RT2A 8ICTA 4C8NA 1KFSA 2JEFA 4JWNA 4MFCA 5HRKA 1L5UA 3OJUA 5J0UA 2MUTB 2BHNA 1DOQA 2VANA 3LWMA 3M8RA 4ELVA 1PX5A 3UPSA 3NTUA 1S76D 3C2LA 4DSJA 1ZQIA 2IHMA 1QTMA 5KG0A 2W8LA 2KZZA 4I2CA 3H8WA 3ZDEA 4GC6A 1ZQLA 1R8CA 3RAXA 4O3PA 3MDAA 3C1YA 4R8UB 1ZQUA 3RJJA 8ICXA 9ICTA 4R63A 4FHVA 3HX0A 3GIKA 1SL1A 4M9NA 4NLZA 5J2KA 4M5DA 3QEBZ 2HHSA 2J6SA 5J2FA 3RJHA 2FMQA 1RYRA 3Q8KA 3RAQA 1TFRA 4ZH4A 4B9UA 5HRFA 9ICQA 2R8JA 1RZTA 5HNKA 4ED7A 4KTQA 3ISDA 4TQRA 4GXJA 5HR9A 5KFQA 4O9MA 1XO1A 2C28A 3EWAA 4C8MA 9ICSA 2R8KA 4DQPA 1S77D 1NKCA 1DK3A 4WBYA 4NLKA 2ZH6A 3H3AA 4FH3A 2ZUCA 4JV1A 2XY6A 3SV4A 3WFOA 5J0QA 4IQWA 5J0XA 1TK5A 3V6HA 4WC7A 5J0RA 5J2EA 3ZDDA 3HPOA 3GDXA 4R65A 2DRAA 4KLFA 3AU6A 7ICGA 2DR5A 8ICBA 5HRDA 4DEZA 5DB9A 4DL6A 2HHTA 4DS5A 4KN4A 3PX4A 2ZUDA 3JPSA 1S0NA 5JUMA 2GWSA 1QLNA 1Q78A 4UB4A 4DLEA 3QZ7A 1FA0A 4X4TA 5KFYA 2DPJA 2ZJ5A 1ZQSA 2PFOA 4PHPA 4ELTA 1TV9A 1QSYA 4KLLA 2RDJA 1YLQA 2DR8A 2RDIA 1L3VA 1A76A 3BQ2A 3BJYA 2PBEA 4YR3A 4X4NA 4YMMA 3LQCB 3RR7A 5HHHA 5KG5A 1HJPA 3GIJA 5IINA 4KN7A 4WC6A 4NKUA 3EZ5A 4BXOB 2NRZA 2R8IA 3UXPA 2AGPA 1T7PA 4RPXA 5HRBA 4YN4A 3WFSC 5DGBA 2W9CA 5KFMA 4GXIA 4E0DA 1UEVA 4X4SA 4XQ8A 2ZJ8A 3RJEA 5DKWA 3OUYB 3RTVA 4YXMA 2PI4A 8ICVA 3THVA 4X4QA 4RQ7A 1JAJA 8ICNA 3ZD9A 5IIMA 4DFJA 7ICVA 3OSNA 5KFTA 4FBTA 4J9OA 2B21A 4QZDA 5DG9A 3TFSA 5DG7A 4M47A 8ICGA 4F5NA 4JV2A 9ICPA 2BR0A 4Z6CA 3TANA 4J9KA 1NJXA 1ZQWA 1RYSA 3GIIA 4RNNA 4YG2A 3H39A 1X9MA 5L1KA 3RR8A 3N4MB 4JWMA 3PW0A 1R8BA 1V4AA 4F8RA 2ZTEA 2ZH4A 1S97A 1KTQA 1A77A 1KLNA 1KEJA 4RQ3A 4EBEA 3PW5A 4XQ7A 4NLGA 3JPOA 3PX6A 2C2RA 2KN7A 1UA1A 1JX4A 3KHGA 1XSNA 8ICEA 1TFWA 3KTQA 4DQIA 5CHGA 4QZBA 9ICBA 2V4RA 4O3OA 4QZ9A 4QZCA 1SZPA 3MFHA 1U45A 2C22A 3SV3A 3GILA 3Q8QB 3V6KA 5KFOA 5IIIA 5TZVA 1EXNA 5L9XA 4YQWA 5L1JA 4F2SA 5KT7A 2ZH8A 3ISBA 3MBYA 1ZQAA 1ZYQA 1SKSA 4I2AA 1F5AA 3JPQA 4DSLA 4UAZA 4C8OA 5F9LA 3V72A 4IR9A 5J0SA 3H8JA 5C5JA 5KFDA 5DG8A 8ICYA 4S3NA 1N56A 1Z3EB 5DQHA 1ZQRA 1KFTA 1MQ3A 4WC3A 4EP7A 1SL2A 3TQ1A 1AROP 4J9LA 1KFDA 2O5AA 9ICUA 5HMLA 1RXWA 9ICNA 2FPLA 4M0AA 2ZTDA 4DO9A 4DS4A 4WC2A 5KFLA 4I28A 4FH5A 1BPYA 3PW7A 3IHQB 1ZJNA 4KLGA 1V9PA 4UB5A 2BQRA 4QZ8A 1ZQBA 5KG2A 5KTQA 4JUZA 3RB0A 3RJKA 1X9SA 4BXOA 4KLUA 5DDMA 5KFBA 3E2EA 1BNOA 4J9SA 3PVXA 1ZQFA 1ZQQA 5KT6A 4YD2A 4DLGA 1NZPA 4DFKA 1U4BA 4M2YA 2AGQA 5D4BA 4QW8A 5DBBA 2HHPA 4F91B 4ECRA 4HYKA 3LK9A 1WCLA 3UXOA 4EBDA 2W9CB 4J9QA 1DK2A 4F3OA 1KNYA 1Q79A 3RRGA 4WBZA 3NYBA 4KLDA 4X5VA 4J9NA 5HP4A 1SL0A 7ICOA 1RPLA 2ASJA 8ICSA 2KFZA 2PXIA 3MDCA 1B22A 3B0XA 5DGAA 5KFJA 4QZHA 3BDPA 4QZIA 9ICEA 4I2IA 5KFRA 1DGSA 3PNCA 1XU4A 2M9NA 4RQ4A 4P4OA 4DSFA 4MEXA 5DEDA 4J9PA 5F9NA 4BDPA 4AT9B 1VJ7A 4DL4A 2IMWP 2ZH5A 4WC1A 3T5KA 1N48A 3TAPA 4TUSA 1NJYA 4ECTA 7ICLA 2ZH7A 2ZHAA 1H38A 5KFEA 2NRXA 2HHUA 9ICXA 4QW9A 2XGQA 1BPBA 2V9WA 4YP3A 7ICEA 4RT3A 8ICRA 5KFXA 5BPCA 4R66A 4EEYA 2BCSA 2ZH1A 5HRIA 1U49A 5KT2A 4DQSA 5KFNA 2W9MA 4FHPA 3K75D 1K1QA 1U48A 2ZH3A 1L3TA 1JXLA 4QZEA 1NK8A 1BPZA 5DLGA 3MR2A 3RH5A 4RNOA 3ETLA 4RQ1A 9ICFA 9ICGA 4DWIA 2IA6A 2Q66A 3G6YA 1PZNA 1S0OA 4DSKA 4GC7A 2HHVA 2PFPA 2DFLA 4DF4A 3GFKB 3OHAA 3ORYA 4RU9A 3LDAA 2XCAA 4RWNA 4EZ6A 5J2DA 3RB6A 2FLPA 3V7KA 1HUZA 9ICOA 5CR0A 1ZQDA 3AQNA 4M9HA 2ID1A 4UAYA 1D9FA 2W9AA 5HRGA 4E80A 2BDPA 3C23A 1R8AA 5KFGA 4F2RA 1OU5A 5KFVA 3C1ZA 3K4GA 3SYZA 2R8GA 2PI5A 4I27A 4JK1A 5EOZA 3UQ0A 2ZH2A 7ICSA 4JV0A 2IHNA 3RJGA 4NLNA 3MABA 4RPZA 3HIYA 4WC0A 2XY7A 1MQ2A 1WOTA 5J0YA 1COOA 2ALZA 3AQKA 5J2JA 5KG1A 3PX0A 4DL2A 4IQTA 4ECXA 3RH6A 4I2BA 8ICQA 3H38A 5KT5A 4YD1A 5KFKA 3Q8PB 2FMPA 1ZQJA 3V6JA 2KP7A 1BPDA 2F1HA 5EWGA 2OWOA 4O0IA 1TAUA 3RH4A 1L3UA 4EBKA 1SKWA 1NK7A 3MGIA 3JZ0A 2A1JA 2ISOA 4FBUA 3PMLA 3GV5B 8ICKA 3H4DA 9ICCA 3OVBA 3QEAZ 4I2DA 1X2IA 4UBBA 1NJWA 3G6VA 1NK6A 3MGHA 5L1LA 4ED1A 3ZDAA 4BWMA 2BCUA 1BNPA 5KT4A 3MFIA 4ED2A 4AT9A 1IM4A 5DQIA 3KHRA 4QWEA 2ZH9A 3TAQA 1T4GA 4ED3A 1TVAA 7ICQA 4DF8A 4DL3A 4I2FA 5HREA 3UQ2A 2JEIA 4PGXA 4F4XA 2KTQA 2HVIA 3H37A 4YR0A 1RXVA 4XUSA 1BPXA 2H5XA 4O3SA 5CJ7A 1L3SA 2F1IA 4KITB 4RQ2A 4KLHA 4ECWA 4B9VA 5BOLA 4O5CA 5KFZA 1S10A 2HHXA 4IQUA 9ICVA 1IXRA 4F4KA 4MF2A 8ICPA 5DECA 2ZTCA 2I9GA 3QE9Y 4X4VA 5KFAA 2FPKA 4QWBA 4NY8A 3JPNA 4TUPA 4PH5A 2MAXA 8ICIA 3NGDA 4RQ0A 4ECSA 4KLIA 4BGDA 4YFKA 4XRHA 1ZQCA 1XSLA 3OJSA 7ICNA 4DOCA 4F5PA 5J0TA 1KRPA 2ASLA 4ECUA 4ECYA 2UVRA 3PW4A 1C7YA 4EBJA 2ATLA 4F4WA 3QZ8A 1UT5A 9ICIA 3AQLA 4M04A 4J9MA 4EYHB 4FO6A 1BVSA 4UB1A 5J2CA 3HW8A 9ICMA 4I2JA 1SKRA 4YXJA 4IRCA 1ZQEA 3OHBA 3GIMA 1ZQZA 4M9GA 2BQUA 3L9DA 2BPGA 2FLLA 4Z6EA 4O5KA 1WCNA 4IR1A 3M9NB 4AT8B 2ISPA 4KLSA 1ZJMA 5IIJA 3RRHA 4ED6A 2AQ4A 4X4RA 1ZETA 4TQSA 5KFUA 4YMNA 2VA8A 3Q8RB 4B9SA 4C8LA 1S0VA 1MSWD 5F2VO 1MIVA 5HHIA 4EYIB 2DR7A 3BQ1A 5DDYA 3B0YA 5HMMA 5DB8A 2ZUBA 3MR6A 3EPGA 5L1IA 3C66A 8ICAA 3HJ1A 1LB2B 2NRKA 5HRLA 3JYYA 4ATBB 1MC8A 1KDHA 9ICKA 2ZJAA 1ZQPA 1VFGA 2AQ0A 5CB1A 3TFRA 8ICZA 2JZBA 1K1SA 4F93B 2DR9A 4PGQA 5IIKA 4B9NA 4RWPA 4KLMA 2A1JB 4FS1A 1UA0A 1CEZA 4C8KA 4DQQA 4PHDA 5J2BA 4DOBA 4EBCA 2PFQA 3PO4A 2DVIA 2F1JA 3HT3A 7ICPA 5CP2A 1NKEA 2P66A 5HC9A 5EWFA 5KFFA 4F5QA 3C18A 2XCPA 2HHQA 5KT3A 4KLQA 2V4QA 3GQCA 3OSPA 2PFNA 1CUKA 1NK4A 2BKEA 1ZQXA 1XSPA 1NO5A 2ZHBA 3UXNA 1JQRA 3PW2A 3OVAA 2KZ3A 1T8EA 4I2HA 4P4PA 2XY5A 4LVSA 5J2GA 9ICWA 4X4UA 4FHWA 3AU2A 1ZQGA 5J2HA 2BCVA 2LYHA 2BPCA 4WC5A 3HP6A 4DFPA 1KSPA 1NJZA 1T3NA 5DBCA 3M9OB 4F5OA 8ICJA 4FHYA 4Q8EA 3H40A 8ICFA 3C5FA 4QZGA 3OVSA 2UVWA 4YVZA 1D8LA 4RNMA 4M6WB 4PHEA 4QWAA 1JXEA 3PR4A 3ISCA 3RB3A 7ICUA 2XO7A 2BCQA 7ICFA 3SI8A 5D46A 3RB4A 7ICTA 4TUQA 4UD4A 4PGYA 4GXKA 2RFFA 4K4IA 1BGXT 3M8SA 3GV7B 4KLEA 5KG6A 4Q45A 4QWCA 3GV8B 2IBKA 1S9FA 1R89A 4UB2A 1NK0A 1ZQHA 4DQRA 3H4BA 8ICLA 4K4HA 7ICRA 4UQGA 1Z00B 4AT8A 4UAWA 1XC9A 4O5EA 2C2EA 1LV5A 4GLXA 3EYZA 4NM1A 4QZFA 3FDSA 1X9WA 4YMOA 1S0MA 4RPYA 3V7LA 3C5GA 7ICIA 4AT7B 1Y88A 3OV7A 2XC9A 2W8KA 3AUOA 5KFCA 4KMUA 2Q0ZX 4RQ6A 2W9BB 4RUCA 5HRHA 4CCHA 4O3NA
chains in the Genus database with same CATH superfamily
5AM3A 4ATBA 4J9RA 4UBCA 3ZDCA 4I2EA 5KFIA 1MIWA 2BGWA 4ELUA 4K98A 1ZQMA 4UD5A 3FAHA 4IRKA 5AI5A 4C4SA 3M9MB 3KHHA 2KFNA 4E8FA 3BZKA 4LZDA 5CWRA 8ICHA 3T5JA 1D9DA 3PO5A 4WC4A 5KL8B 4ECZA 2BPFA 4Q44A 1QQ7A 3AMZA 4OAIZ 4YCXA 4X0AA 2H3ZA 4O68A 3KHLA 1RG6A 4R8UA 4A8EA 2LM1A 4IS7A 2WF7A 2J6UA 4RQMA 5IILA 1NK9A 4NKTA 2BZFA 3QUBA 1WG8A 4ICAA 2IOFA 5J2AA 3EW9A 1UHUA 2ZIXA 5FP0A 4B9TA 4WH5A 4ECQA 1U9LA 5J2IA 8ICWA 9ICHA 5CRXA 4O3QA 3C2MA 1C20A 3O0FA 2PKEA 3RBDA 1NOMA 3M1YA 3Q8LA 5DLFA 2O1PA 2AU0A 3T3FA 2AGOA 5J29A 2ASDA 4NM2A 2MRLA 1JUDA 3NKUA 2I1QA 2JEJA 3DDHA 2M2TA 3ZD8A 1ZQYA 4P0PB 3LVWA 1A0PA 2NRWA 1JN3A 5D61A 3QX7A 3M6KA 5KG7A 3A0BU 2G5HB 4E7XA 2W04A 1TAQA 4DOAA 4RT2A 4JWNA 5HRKA 2MU2A 1IV8A 4ELVA 3LWMA 2HBMA 3CK6A 3UPSA 1S76D 2DBYA 2W8LA 4CCHA 3ZDEA 4NL9C 3AEVA 3RAXA 1ZQUA 2H3FA 2AHOB 3HX0A 4M9NA 1FFVA 1Q3VA 2YMPA 4ZH4A 4B9UA 2E3TA 3ISDA 4TQRA 2N1RA 3QUTA 1XO1A 2C28A 4ZOHC 3NASA 2R8KA 4DQPA 4WBYA 4FH3A 4JV1A 3SMVA 3SV4A 4MHVA 5J0QA 1TK5A 3V6HA 1ZD3A 5J2EA 4OJOA 3ZDDA 3GDXA 3UM9A 3AU6A 2DR5A 4P0PA 5DB9A 4WJ3B 1HEKA 2Y0SF 5B3PA 1ED1A 2ZUDA 1K5OA 1S0NA 3F2BA 5JUMA 1QLNA 1ECWA 4B6JA 1ZQSA 2DQNB 2RDJA 4KLLA 3TADC 2RDIA 3BJYA 4X4NA 4YMMA 3LQCB 1OW5A 4WC6A 5E79U 2DL0A 5DGBA 1FFUA 4E0DA 1XO0A 3OUYB 2PI4A 8ICVA 5K4LA 3THVA 8ICNA 5IIMA 5KFTA 1O08A 2WB1F 3N7SC 3KD3A 3NVVA 9ICPA 5HR7A 2BR0A 4Z6CA 3TANA 1NJXA 1ZQWA 1L8OA 1X9MA 3H0MB 2HOQA 1A77A 1L7NA 5EE0A 1Q8KA 2QB0B 3KOOA 3JPOA 4NLGA 2R18A 5CHGA 3ERCC 2G09A 5TZVA 2EDUA 5L9XA 3ISBA 3MBYA 5B5EU 1SKSA 4DSLA 3HKZC 4IR9A 4UW9A 5F3XB 5J0SA 4NV0A 1N56A 2YMLA 2IUBA 2FPLA 4DS4A 5KFLA 2F77X 3ER8C 1BPYA 3PW7A 4KLGA 1B4FA 4UB5A 1Q3UA 5D63A 2F76X 1M6YA 3E2EA 5DDMA 3PVXA 1ZQFA 4DLGA 5HR6A 3LK9A 1WCLA 5GTHU 4KMOB 1DK2A 4F3OA 4EX6A 3RRGA 4AYBF 4UAUA 4X5VA 7ICOA 8ICSA 1RPLA 4X4OA 3B0XA 5DGAA 5KFJA 4QZHA 3BDPA 4QZIA 4I2IA 5AICA 5KFRA 1DGSA 3PNCA 1XU4A 2M9NA 4RQ4A 2QB0A 4ACOA 4MEXA 5DEDA 1VJ7A 3E0FA 2ZH5A 3TAPA 7ICLA 1H38A 5KFEA 5ALLA 2V9WA 7ICEA 4RT3A 4EX7A 2JHDA 3L4PA 5KT2A 4DQSA 2FI1A 5AM5A 3K75D 1ZXIA 2KVSA 1SV0C 3QNMA 2IA6A 4DWIA 5A0LA 1S0OA 4DSKA 2HHVA 2NO5A 2KHVA 4DF4A 2XCAA 4RWNA 4EZ6A 5J2DA 2K4EA 2EZZA 2FLPA 3V7KA 1HUZA 1ZQDA 3AQNA 3ETRA 3WK9A 3K4GA 2W55A 3UQ0A 5EOZA 2IHNA 3MABA 5JRTA 4RPZA 4HAIA 4WC0A 2DWQA 3AQKA 5J2JA 1KQQA 1ZQJA 3V6JA 5EWGA 2OWOA 1QQ6A 4LEWA 1SKWA 3PMLA 2K4IA 4FZLA 3GV5B 8ICKA 3H4DA 9ICCA 3QEAZ 2DR7A 3G6VA 3ZDAA 1IM4A 5DQIA 3LVVA 4ED3A 4I2FA 5HREA 3UQ2A 3H37A 2KIVA 4KITB 4KLHA 2HSZA 4O5CA 9ICVA 1Z4OA 2K4HA 4MF2A 8ICPA 2ZTCA 3D2SA 2FPKA 4U6PA 4K99A 5AM1A 4RQ0A 4EEBA 4XRHA 4XJEA 1FO4A 3QUQA 4DOCA 2QLTA 4ECYA 1TAMA 4EBJA 2ATLA 4F4WA 1PUZA 2EZXA 1BVSA 5J2CA 9ICMA 4IRCA 5B3QA 3GIMA 3NWIA 2LYAA 4AT8B 3M9NB 2ISPA 4KLSA 5AKYA 1ZETA 1N62A 4YMNA 4TQSA 2JGAA 4RQNA 4C8LA 1S0VA 1MIVA 5DDYA 3MR6A 3C66A 8ICAA 1LB2B 4OAGA 5ALUA 1ZQPA 3MC1A 4NWIA 3TFRA 5IIKA 1CEZA 5J2BA 3PO4A 1UQVA 5ALOA 7ICPA 5CP2A 5HC9A 1Z1BA 2XCPA 2V4QA 1NK4A 2BKEA 1ZQXA 5AKLA 3PW2A 1T8EA 4I2HA 4P4PA 5J2GA 1NZBA 1ZQGA 1F5SA 2KEYA 2BPCA 4WC5A 1KSPA 1T3NA 5DBCA 3M9OB 4QZGA 2UVWA 4RNMA 7ICUA 4FE3A 4CRXA 2BCQA 1ZD2P 3GZFA 4TUQA 5ALJA 3CYMA 2G0AA 2RFFA 4K4IA 2XVTA 1S9FA 1NK0A 3WK8A 1DXSA 4O69A 4AT8A 4GLXA 3KBBA 4NXUA 4UATA 3FDSA 5H2FU 3AUOA 4KMUA 2Q0ZX 2W9BB 5DB6A 3F5AA 1ZQOA 2UVUA 1QSSA 2DPIA 2HW3A 1XWLA 3LWLA 3MR5A 1HUOA 2FMSA 2M0NA 5AKJA 1TK0A 1TKDA 4LZGA 4F92B 1RQLA 4MEYA 4PPXA 4FO1A 4X0BA 1N61A 1QSLA 5KFHA 3WFPA 3PSTA 5KFSA 3SEIA 2NO4A 4K9AA 3PY8A 2I5HA 4KLOA 1BPEA 2M2WA 3WFQE 3AQFA 3RFAA 1ZQTA 2E8NA 2NRTA 2DGZA 3JPPA 3NVOA 3OTQA 4YR2A 5EWEA 2BE3A 1N63A 1UT8A 3HWTA 2JEGA 3FYHA 4F50A 1ZQKA 2EQYA 3RBEA 3RJFA 4RQ8A 4I2GA 2ES6A 5D49A 2W9BA 1B43A 4NXZA 1D8YA 4NLCA 8ICJA 1U47A 3BQ0A 5KFWA 4KM5A 2FPMA 4BUGA 4R64A 7ICHA 1PK3A 4OJ6A 3ZDBA 3T5LA 8ICUA 5DBAA 3C2KA 3WFRE 4B9MA 3R9KA 5IIOA 4MF8A 2FLNA 2KJ5A 8ICOA 5DB7A 2UVVA 5KG3A 2KNJA 2YB4A 1IIPA 3OJUA 1DOQA 1PX5A 2HMXA 3M8RA 3NTUA 5AK5A 2GH1A 1QTMA 2YMQA 1YZ6A 1DGJA 4I2CA 3MGVA 4CDGA 4O3PA 3MDAA 4R8UB 8ICXA 4AP9A 2NV3A 3QXGA 2XICA 3QEBZ 5ALPA 2J6SA 3QU4A 3RJHA 2FMQA 4CNQA 1RYRA 1SV4A 4BX9C 1T3QA 2EH9A 2ZIXB 4ED7A 4KTQA 5HR9A 4O9MA 3EWAA 9ICSA 1NKCA 1DK3A 2ZH6A 1J2NA 3NRZA 5J0XA 2DRAA 4QIWC 5HRDA 5ALMA 4DEZA 3F53A 4Y2TA 4DS5A 3PX4A 3QU5A 4K97A 3K1ZA 1Q78A 4UB4A 3QZ7A 2WAQC 5KFYA 4ELTA 1TV9A 1QSYA 2DR8A 2PBEA 5HHHA 4KN7A 3OPXA 3EZ5A 2NRZA 2R8IA 3UXPA 4RPXA 3QUCA 5HRBA 1QQ5A 2W9CA 1UEVA 4XQ8A 2EAPA 4YXMA 5ALWA 1VDVA 4Y2QA 5AI6A 7ICVA 3A0HU 4KX3A 2B21A 5DG9A 1N5WA 4F5NA 1IG6A 4J9KA 4RNNA 4YG2A 3N4MB 2EZYA 4JLZA 1V4AA 4F8RA 5ALVA 1KLNA 1KEJA 5AI9A 4EBEA 4XQ7A 3PX6A 8ICEA 1JX4A 2KJ9A 1Q46A 4O3OA 4QZCA 3MFHA 1SZPA 1U45A 2C22A 2OHFA 3SV3A 3GILA 5GTIU 1LKYA 4CE6A 3JPQA 2WF5A 3V72A 2LHTA 5C5JA 1L6NA 1L7MA 5DQHA 1ZQRA 2E8MA 4WC3A 1SL2A 3EF2A 1AROP 5HMLA 1RXWA 2ZTDA 4DO9A 4WC2A 2GA9D 4FH5A 4QZ8A 2DF4B 5KTQA 4JUZA 3RB0A 4IL6U 2H3IA 4KLUA 4J9SA 3NVYA 1NZPA 5KT6A 4ECRA 4WQKA 1LVHA 3UXOA 1Q79A 3NYBA 2FE9A 1SL0A 2KFZA 1B22A 9ICEA 2WF8A 4Y2YA 4P4OA 4OO1J 4J9PA 4AT9B 1NJYA 1WUDA 5ALZA 2HHUA 9ICXA 4QW9A 2XGQA 1BPBA 4UAVA 3VC8A 2EAMA 2JH1A 3TACB 4EENA 5BPCA 2GAFD 4R66A 4PL2A 5HRIA 4O3MA 3WK5A 4NXXA 4EEKA 5KFNA 2W9MA 2FJ6A 2LM4A 5G5GA 1L3TA 4QZEA 5DLGA 4RNOA 4K9BA 2Q66A 1PZNA 2D3DA 2PFPA 2DKXA 4RU9A 1NI3A 3LYSA 2KG5A 4UAYA 4E80A 4EV6A 3C1ZA 3SYZA 2R8GA 4I27A 4JV0A 3RJGA 2XY7A 1COOA 2ALZA 1PVRA 3PX0A 4IQTA 8ICQA 5KFKA 1YZ7A 4UB6U 3JZ0A 2A1JA 2LYBA 1SWVA 1NJWA 1X2IA 1NK6A 5L1LA 4BWMA 2BCUA 3MFIA 4AT9A 3KHRA 1T4GA 2OCEA 1TVAA 4UB8U 4F4XA 4US9A 2KTQA 3ER9B 4O3SA 1L3SA 2F1IA 1Z19A 4ECWA 2OEHA 4P0QA 4IQUA 1FIQA 4F4KA 3QE9Y 4TUPA 5CFTA 3NGDA 1XSLA 3WKBA 2ZIVB 4PZOA 2Y9UA 3PW4A 2F3NA 1RQNA 4J9MA 4F72A 2B0CA 2BBJA 4I2JA 1ZQZA 2KD1A 2FLLA 4FZNA 1WCNA 5AKHA 2K8AA 2HCFA 4ED6A 2VA8A 5F2VO 1KBUA 5HHIA 3BQ1A 3H0RB 5HMMA 3EPGA 2ZUBA 3HJ1A 3WK4A 4CGZA 3IG5A 4KX5A 1SB3C 2JZBA 2DR9A 4B9NA 2G07A 4KLMA 3WKAA 4FS1A 1UA0A 3HT3A 5EWFA 5KT3A 2PFNA 1CUKA 1JQRA 5AKEA 5ALYA 3OVAA 9ICWA 5J2HA 3FC4A 2WFAA 3NVWA 4FHYA 4Q8EA 3OVSA 1D8LA 4FHPA 4M6WB 3RB3A 4QWAA 1JXEA 3PR4A 2ZIVA 1HIWA 2D8CA 2WAQF 4GXKA 3DV9A 1BGXT 3GV7B 4KLEA 5KG6A 4Q45A 4QWCA 3NRWA 2IBKA 5KAIU 1R89A 2QKQA 1ZQHA 4DQRA 4Y2RA 1V38A 1ZD5A 5AM0A 3UMBA 4UAWA 1XC9A 1LV5A 2F44A 4QZFA 1X9WA 4YMOA 3OV7A 2KE7A 2XC9A 5KFCA 1L7OA 4RQ6A 4RUCA 1L8LA 3EUB2 4LEVA 2Y1JA 1OUQA 1NKBA 4K4GA 5EE3A 3HJ4A 4ED8A 3DEEA 4M9JA 4O3RA 1SGGA 1ZOLA 3WK6A 4Y2JA 2KSOA 2ZIWB 4I0UA 2OXOA 2W7PA 4WCWA 2BQ3A 4WQLA 4PL1A 1NNLA 1UEUA 1FEZA 4B9LA 2QARB 5ALDA 3Q8SB 1KL9A 3TARA 3BS7A 4IG8A 1ZQVA 1JIHA 2MUTA 2NRVA 3H8MA 4KLTA 2AJQA 4Z6DA 5J0PA 4G3IA 2W11A 5AKIA 4F5RA 4CF5A 2YX8A 3EPIA 2W3SA 4M6WA 4RWOA 1PK1A 2LBOA 7ICKA 2FCLA 4KLJA 7ICJA 1TK8A 3JPRA 4DSEA 4US8A 3G6XA 2VJ4A 3KZXA 4GIBA 3MR3A 5DQGA 3SD7A 2J6TA 4NLBA 3TI0A 3D2QA 3ICXA 2Y1IA 1XS9D 3T5HA 8ICCA 2C2DA 3KKAA 1N2XA 2K89A 2OYYA 2W54A 4RUAA 3PMNA 4Y2VA 1JMSA 3C21A 4IQVA 2WTFA 3N97B 2ZIWA 3ZI4A 2E1EA 3BQTA 1DRGA 3SZ2A 3BS5A 2HVHA 4TURA 1OXJA 2QARA 1MN8A 3IM1A 4IRDA 3TKAA 2HBKA 3H7IA 3H8SA 5AKKA 1QH9A 8ICTA 2JEFA 5AI4A 4MFCA 1L5UA 2VANA 2BHNA 3C2LA 4DSJA 3M6ZA 1ZQIA 3PHZA 5KG0A 2B4VA 3H8WA 4GC6A 1X42A 4JMUA 4FHVA 1J2MA 3C1YA 9ICTA 4R63A 5AI8A 3GIKA 1SL1A 2HHSA 5J2FA 3RAQA 1TFRA 3CNHA 2RP5A 5HRFA 9ICQA 1V97A 4OD0A 1RZTA 5HNKA 1ZD4A 5KFQA 4C8MA 4NXVA 3WKDA 4MKPA 3NVZA 4NLKA 3SAHA 2XY6A 3WFOA 4IQWA 4WC7A 4R65A 4KLFA 7ICGA 3ONNA 3IRUA 2HHTA 4EGWA 3BQ7A 4C80A 2GWSA 1FA0A 4X4TA 2DPJA 2ZJ5A 1YLQA 2PFOA 4PHPA 4OAFA 1L3VA 3RR7A 3GIJA 4NKUA 4BXOB 2AGPA 3WFSC 5KFMA 4X4SA 2ZJ8A 3RJEA 5DKWA 3RTVA 4X4QA 1CI4A 1JAJA 1B0XA 3ZD9A 2KJ8A 4Y2PA 3OSNA 4FBTA 5DG7A 4M47A 3HKZF 4JV2A 1RYUA 2EANA 1RYSA 2VIXA 3H39A 5L1KA 3RR8A 4JWMA 3PW0A 1R8BA 2KKVA 2HN2A 1S97A 1KTQA 3PW5A 5B66U 1VLBA 1UA1A 3KHGA 1XSNA 1X9XA 3KTQA 1SIJA 3Q8QB 3WU2U 5KFOA 1J97A 2W3RA 2JV3A 1EXNA 4YQWA 5L1JA 4F2SA 4NXTA 4PJ0U 5KT7A 1ZYQA 2WB1C 3H8JA 5CFUA 2JH7A 2WF9A 4EP7A 3TQ1A 1KFDA 2O5AA 4M0AA 3IHQB 3MCRA 1ZJNA 4DCCA 1ZQBA 2KVCA 1X9SA 4BXOA 3SQIA 1UCVA 1ZQQA 4DFKA 2AGQA 5D4BA 5DBBA 4HYKA 2O6KA 4NXWA 2B6GA 1KNYA 4EBDA 2W9CB 4J9QA 2LMRA 3PZPA 1ZRMA 3NUQA 4J9NA 5HP4A 3KFUF 2H3VA 2PXIA 3AM9A 5F9NA 4J03A 4BDPA 4WC1A 1N48A 4TUSA 4PZNA 3D6JA 2ZH7A 2ZHAA 8ICRA 5KFXA 4EEYA 2BCSA 1K1QA 1LKYB 2E1FA 2ZH3A 1JXLA 1BPZA 3QU2A 3ETLA 4CF3A 4RQ1A 9ICFA 3G6YA 4GC7A 2DFLA 3GFKB 3OHAA 3RB6A 2JR5A 5ALHA 1N60A 9ICOA 2IHOA 2QB1A 3QU9A 4M9HA 2ID1A 2K8BB 5HRGA 1R8AA 5KFGA 4CF4A 1OU5A 5KFVA 2PI5A 3C29A 7ICSA 3N7RC 3PSPA 3T79A 3QU7A 2GOLA 1WOTA 1MA7A 5J0YA 5KG1A 4DL2A 4I2BA 3RH6A 1KKXA 3H38A 4YD1A 1UPHA 4HX0A 2ZG6A 4EBKA 4O0IA 1L3UA 2ISOA 5KL1B 4O67A 3OVBA 5CEHA 4UBBA 1BNPA 3MGHA 2I6XA 5KT4A 4ED2A 2LI6A 2A1AA 3K1RB 4QWEA 2MSNA 2Q4TA 4C7ZA 7ICQA 4DL3A 2F2AB 2JEIA 4PGXA 2CN1A 1JI7A 2A19A 4XUSA 2Z7JA 2H5XA 4WOYA 4B9VA 1ZQ1C 5ALIA 5ALXA 5KFZA 1Z4NA 1IXRA 2I9GA 1WWVA 5KFAA 2YB1A 4QWBA 4NY8A 3JPNA 8ICIA 4ECSA 2AH5A 3OJSA 4F5PA 5J0TA 4IC9A 4ECUA 2UVRA 1C7YA 2HOFA 5J8YC 1UT5A 3AQLA 4M04A 4EYHB 4FO6A 3HW8A 1SKRA 4YXJA 4M9GA 2BQUA 3L9DA 5AK3A 4Z6EA 4O5KA 3RRHA 3OWGA 4X4RA 3KZIU 1URJA 5KFUA 4B9SA 2G5IB 2K4PA 3SAGA 1SZHA 3B0YA 3S6JA 3JYYA 2ZH1A 2NRKA 4C7YA 5HRLA 1MC8A 1KDHA 3UMCA 2ZJAA 1VFGA 5CB1A 8ICZA 2DUYA 1K1SA 4F93B 2W7OA 2A1JB 4PHDA 4EBCA 1KN5A 2DVIA 2F1JA 5ALNA 1NKEA 5KFFA 4F5QA 3C18A 2HHQA 4KLQA 3GQCA 3GU3A 3OSPA 1NO5A 1XSPA 2YY6A 2XY5A 4X4UA 2B51A 4FHWA 1X66A 2W03A 4C4RA 1P7DA 2BCVA 5AHXA 4P0QB 8ICFA 4C0ZA 3IDWA 4PHEA 3F5EA 2KICA 7ICFA 3SI8A 1X6IA 5D46A 3RB4A 4UD4A 4PGYA 2F8LA 2MA1A 3HRDD 3M8SA 3GV8B 2KK0A 8ICLA 1KW4A 4K4HA 4OAHA 4UQGA 1Z00B 4LEZA 3EYZA 4LJXA 1S0MA 4RPYA 3V7LA 4AT7B 4UASA 1Y88A 2CPRA 4GFJA 2YN4A 1PVQA 2KZMA 4P2HA 4DL7A 3B9JA 2BCRA 5AK6A 4OJ5A 5ALEA 5KG4A 1WYGA 4FHXA 5ALKA 2JZBB 5J0WA 2KV2A 4UB3A 4ECVA 2ESEA 3AQMA 1MIYA 2K8CB 2WF6A 4EZ9A 4F4YA 5J0OA 1Z1VA 4P4MA 3D2NA 5AK4A 2PMZC 3RF9A 4RQ5A 3L3FX 4EELA 2JMGA 1UETA 3SR6A 9ICRA 2HI0A 9ICLA 3Q8MA 4QWDA 3I1YA 2KOBA 2HHWA 8ICMA 4RZRA 5T14A 1JROA 2XGPA 2VA3A 4QJFB 3IG8A 4Z6FA 3WKEA 2DRBA 2WHEA 4QZAA 2P6UA 4DFMA 4DSIA 4PHAA 4MFFA 4LT6A 3M7DA 7ICMA 5ALGA 5J8YA 1ZQNA 2FDRA 3JCFA 3HJEA 1Z00A 2P6RA 4Q8FA 2YMMA 4M9LA 9ICJA 9ICAA 3QYPA 5AKXA 4NJ8A 3RJIA 4AT7A 1COKA 4ED0A 3L5KA 1NK5A 4RWQA 2HBLA 4F4ZA 3AL0B 2ZH9A 4X4PA 2VA2A 4Q43A 3OGUA 3JPTA 3V7JA 4BWJA 4I29A 3WKCA 4XA5A 5L1MA 2HOIA 5BOMA 4DL5A 3SENA 3KKAC 2B56A 4MFAA 3PV8A 2M2VA 1JRPA 5KFPA 5ALSA 1TFYA 5CA7A 2KMDA 2YQEA 4U7CA 4K96A 2R8HA 5G5HA 2EWRA 4KB6A 4FS2A 3UPQA 1SXEA 2KSOB 4OJPA 3PR5B 3OUYA 5KAFU 4C8NA 1KFSA 4OCZA 2MUTB 3AN1A 5J0UA 2IHMA 4NL9A 2KZZA 1RM6C 1ZQLA 1R8CA 1S8OA 3HILA 2E5SA 3RJJA 4QIWF 2RQ5A 4NLZA 4M5DA 5J2KA 2KHQA 2VJ5A 3Q8KA 2RHFA 1PK1B 4OJLA 2R8JA 4BJQA 5JU5A 4GXJA 3CP8A 1S77D 3H3AA 2ZUCA 3PSFA 2E8PA 2RRDA 5CHEA 5J0RA 3HPOA 5D62A 3IP4B 3CRXA 2H3QA 8ICBA 4DL6A 4KN4A 5ALQA 3JPSA 4DLEA 3K7DA 3TADA 2CXYA 1A76A 3BQ2A 3CW2C 4YR3A 2AXTU 3BS5B 5AI0A 5KG5A 1HJPA 5ALTA 2NYVA 5IINA 5AM4A 1T7PA 4YN4A 3H0LB 1SXDA 4GXIA 4RQ7A 2G06A 3F2CA 4DFJA 4J9OA 1VJ5A 4QZDA 3TFSA 1WWUA 8ICGA 3GIIA 5AKZA 2ZTEA 2ZH4A 2JXJA 2LPEA 4RQ3A 1TE2A 2C2RA 1TFWA 2KN7A 2W43A 4DQIA 5TISU 4QZBA 9ICBA 2V4RA 4QZ9A 5KNIA 3V6KA 5IIIA 2ZH8A 5EE1A 1ZQAA 2XIDA 4I2AA 4JLXA 1F5AA 2KIWA 4UAZA 4C8OA 5F9LA 5DG8A 5KFDA 8ICYA 4S3NA 2Y9TA 1Z3EB 1KFTA 4G9BA 1MQ3A 1GO3F 4J9LA 9ICUA 9ICNA 4I28A 1XNSA 2YTUA 5ALRA 1V9PA 2BQRA 5KG2A 3RJKA 2EAOA 2ZIUB 1BNOA 5KFBA 1ZRNA 5C0YA 4YD2A 5AIAA 2ZXHA 3NS1A 1U4BA 4M2YA 2HHPA 1F0MA 4QW8A 4F91B 1GPJA 3C28A 4WBZA 1X40A 4Y2XA 4KLDA 1A6SA 2ASJA 3MDCA 2BDUA 2RLTA 4C4TA 4DSFA 4DL4A 2IMWP 3T5KA 2DKZA 2VKQA 4ECTA 2NRXA 2LKYA 4YP3A 5CFSA 5AM2A 1V85A 4FFDA 1CRXA 1U49A 3AQEA 1L7PA 1SV0A 3SAFA 1U48A 1NK8A 2IOFK 2KKPA 3MR2A 3RH5A 3IV6A 9ICGA 2ODGA 3UMGA 3ORYA 3LDAA 2ZIUA 1RDFA 5CR0A 1D9FA 2W9AA 2BDPA 3C23A 4F2RA 4JK1A 4USAA 2ZH2A 2PMZF 4NLNA 3HIYA 1MQ2A 1D8BA 4ECXA 3I28A 4Y2UA 5KT5A 2KP7A 3Q8PB 2FMPA 1BPDA 2F1HA 2Y0SC 3RH4A 2HBJA 2GLEA 5EE9A 1NK7A 3MGIA 4FBUA 3I76A 2BBHA 5AIBA 4I2DA 2P35A 1TAUA 4ED1A 1PVPA 3TAQA 4F71A 4DF8A 1F44A 2E8OA 2XI9A 4N7RA 2HVIA 2IOHA 4YR0A 5JTIA 1YT3A 1RXVA 2CRXA 1BPXA 5CJ7A 4RQ2A 5BOLA 4EEDA 2HHXA 1S10A 2K60A 5DECA 4X4VA 2GO7A 4DFDA 4PH5A 2MAXA 4LEYA 4KLIA 4BGDA 4YFKA 1ZQCA 7ICNA 2L5YA 2ASLA 1KRPA 4O6AA 1JALA 3QZ8A 1N5XA 9ICIA 3ED5A 4UB1A 1S5LU 5ALFA 3FM9A 1ZQEA 3OHBA 2BPGA 4IR1A 1ZJMA 1O03A 5IIJA 2AQ4A 1MSWD 3PSIA 3Q8RB 4EYIB 5L1IA 5DB8A 5AKGA 4K8VA 2HN1A 4ATBB 9ICKA 4UARA 1AQ6A 2F8KA 2AQ0A 3WK7A 2G08A 4PGQA 4RWPA 4C8KA 4DQQA 4DOBA 2PFQA 3J81j 2P66A 2JRZA 3E58A 3ALRA 2ZHBA 3UXNA 2KZ3A 4LVSA 2OH2A 3AU2A 2HDOA 2LYHA 1QCKA 3HP6A 1T94A 4Y2SA 2ZXIA 4DFPA 1NJZA 4AYBC 4F5OA 3H40A 1X6JA 3C5FA 4YVZA 2M2UA 3ISCA 2XO7A 7ICTA 3BZCA 3N28A 3N7PD 3IN5A 4FZMA 4UB2A 4JB3A 3H4BA 3U26A 5JTGA 7ICRA 3F2DA 1SWWA 4O5EA 2C2EA 4NM1A 2A3VA 7ICIA 2OM6A 3C5GA 2W8KA 2D6FC 5HRHA 4QNLA 4O3NA 3VCBA
chains in the Genus database with same CATH topology
2Y1JA 1ZQOA 4ATBA 1NKBA 4J9RA 2UVUA 2KZMA 4K4GA 4UBCA 3ZDCA 4DL7A 4I2EA 4P2HA 3HJ4A 5KFIA 2BCRA 1QSSA 1MIWA 2BGWA 4ELUA 4ED8A 1ZQMA 4UD5A 2DPIA 4M9JA 4O3RA 2HW3A 1XWLA 5KG4A 3LWLA 4IRKA 3M9MB 3MR5A 3KHHA 1HUOA 2FMSA 2KFNA 4E8FA 1TK0A 4LZDA 5CWRA 1TKDA 4F92B 3T5JA 1D9DA 4LZGA 8ICHA 4FHXA 4WCWA 2JZBB 5J0WA 4UB3A 4ECVA 4MEYA 2BQ3A 3PO5A 3AQMA 4WC4A 4PPXA 4B9LA 1UEUA 1MIYA 4ECZA 3Q8SB 4X0BA 2BPFA 4EZ9A 3TARA 4F4YA 5J0OA 4P4MA 4IG8A 4Q44A 1ZQVA 1JIHA 2MUTA 2NRVA 4KLTA 2AJQA 4Z6DA 4YCXA 5J0PA 1QSLA 5KFHA 4X0AA 4G3IA 3KHLA 3WFPA 4RQ5A 5KFSA 1UETA 3PY8A 9ICRA 4KLOA 4R8UA 4F5RA 1BPEA 2M2WA 9ICLA 3Q8MA 4QWDA 2HHWA 3WFQE 2J6UA 5IILA 1NK9A 3EPIA 8ICMA 4M6WA 4NKTA 4RZRA 4RWOA 1ZQTA 2NRTA 2XGPA 2VA3A 3JPPA 5J2AA 4Z6FA 3EW9A 2DRBA 4QZAA 4YR2A 7ICKA 2P6UA 4DFMA 4B9TA 4PHAA 5EWEA 4DSIA 4MFFA 4ECQA 4KLJA 4LT6A 7ICJA 1TK8A 2BE3A 7ICMA 1U9LA 5J2IA 8ICWA 3JPRA 4DSEA 1UT8A 3HWTA 9ICHA 1ZQNA 2JEGA 4X4OA 4O3QA 3G6XA 3C2MA 1Z00A 3FYHA 4F50A 2P6RA 1ZQKA 4Q8FA 4M9LA 3RBEA 9ICJA 3MR3A 9ICAA 3RJFA 5DQGA 4RQ8A 3RJIA 4AT7A 5DB6A 3RBDA 2J6TA 4I2GA 1NOMA 3TI0A 4ED0A 2Y1IA 1NK5A 5D49A 2W9BA 3Q8LA 5DLFA 2O1PA 4RWQA 2AU0A 1B43A 4NXZA 4F4ZA 3T3FA 2AGOA 1D8YA 5J29A 4X4PA 2ASDA 1XS9D 2VA2A 4NM2A 4Q43A 3OGUA 3JPTA 3V7JA 4BWJA 3T5HA 4I29A 8ICCA 1U47A 3BQ0A 4XA5A 2C2DA 2I1QA 2JEJA 2M2TA 5BOMA 4DL5A 5KFWA 3ZD8A 1ZQYA 4RUAA 3PMNA 4MFAA 3PV8A 2M2VA 1JMSA 3C21A 4IQVA 2WTFA 3N97B 2NRWA 2M2UA 2FPMA 4R64A 1JN3A 5KFPA 3BQTA 7ICHA 3SZ2A 1TFYA 3ZDBA 5CA7A 2HVHA 4TURA 3T5LA 8ICUA 5DBAA 5KG7A 3C2KA 2R8HA 3WFRE 4FS2A 3UPQA 4B9MA 4E7XA 3IM1A 5IIOA 4MF8A 3PR5B 4IRDA 2FLNA 8ICOA 3OUYA 3H7IA 3H8SA 1TAQA 5DB7A 5KG3A 4DOAA 2UVVA 4RT2A 8ICTA 4C8NA 1KFSA 2JEFA 4JWNA 4MFCA 5HRKA 1L5UA 3OJUA 5J0UA 2MUTB 2BHNA 1DOQA 2VANA 3LWMA 3M8RA 4ELVA 1PX5A 3UPSA 3NTUA 1S76D 3C2LA 4DSJA 1ZQIA 2IHMA 1QTMA 5KG0A 2W8LA 2KZZA 4I2CA 3H8WA 3ZDEA 4GC6A 1ZQLA 1R8CA 3RAXA 4O3PA 3MDAA 3C1YA 4R8UB 1ZQUA 3RJJA 8ICXA 9ICTA 4R63A 4FHVA 3HX0A 3GIKA 1SL1A 4M9NA 4NLZA 5J2KA 4M5DA 3QEBZ 2HHSA 2J6SA 5J2FA 3RJHA 2FMQA 1RYRA 3Q8KA 3RAQA 1TFRA 4ZH4A 4B9UA 5HRFA 9ICQA 2R8JA 1RZTA 5HNKA 4ED7A 4KTQA 3ISDA 4TQRA 4GXJA 5HR9A 5KFQA 4O9MA 1XO1A 2C28A 3EWAA 4C8MA 9ICSA 2R8KA 4DQPA 1S77D 1NKCA 1DK3A 4WBYA 4NLKA 2ZH6A 3H3AA 4FH3A 2ZUCA 4JV1A 2XY6A 3SV4A 3WFOA 5J0QA 4IQWA 5J0XA 1TK5A 3V6HA 4WC7A 5J0RA 5J2EA 3ZDDA 3HPOA 3GDXA 4R65A 2DRAA 4KLFA 3AU6A 7ICGA 2DR5A 8ICBA 5HRDA 4DEZA 5DB9A 4DL6A 2HHTA 4DS5A 4KN4A 3PX4A 2ZUDA 3JPSA 1S0NA 5JUMA 2GWSA 1QLNA 1Q78A 4UB4A 4DLEA 3QZ7A 1FA0A 4X4TA 5KFYA 2DPJA 2ZJ5A 1ZQSA 2PFOA 4PHPA 4ELTA 1TV9A 1QSYA 4KLLA 2RDJA 1YLQA 2DR8A 2RDIA 1L3VA 1A76A 3BQ2A 3BJYA 2PBEA 4YR3A 4X4NA 4YMMA 3LQCB 3RR7A 5HHHA 5KG5A 1HJPA 3GIJA 5IINA 4KN7A 4WC6A 4NKUA 3EZ5A 4BXOB 2NRZA 2R8IA 3UXPA 2AGPA 1T7PA 4RPXA 5HRBA 4YN4A 3WFSC 5DGBA 2W9CA 5KFMA 4GXIA 4E0DA 1UEVA 4X4SA 4XQ8A 2ZJ8A 3RJEA 5DKWA 3OUYB 3RTVA 4YXMA 2PI4A 8ICVA 3THVA 4X4QA 4RQ7A 1JAJA 8ICNA 3ZD9A 5IIMA 4DFJA 7ICVA 3OSNA 5KFTA 4FBTA 4J9OA 2B21A 4QZDA 5DG9A 3TFSA 5DG7A 4M47A 8ICGA 4F5NA 4JV2A 9ICPA 2BR0A 4Z6CA 3TANA 4J9KA 1NJXA 1ZQWA 1RYSA 3GIIA 4RNNA 4YG2A 3H39A 1X9MA 5L1KA 3RR8A 3N4MB 4JWMA 3PW0A 1R8BA 1V4AA 4F8RA 2ZTEA 2ZH4A 1S97A 1KTQA 1A77A 1KLNA 1KEJA 4RQ3A 4EBEA 3PW5A 4XQ7A 4NLGA 3JPOA 3PX6A 2C2RA 2KN7A 1UA1A 1JX4A 3KHGA 1XSNA 8ICEA 1TFWA 3KTQA 4DQIA 5CHGA 4QZBA 9ICBA 2V4RA 4O3OA 4QZ9A 4QZCA 1SZPA 3MFHA 1U45A 2C22A 3SV3A 3GILA 3Q8QB 3V6KA 5KFOA 5IIIA 5TZVA 1EXNA 5L9XA 4YQWA 5L1JA 4F2SA 5KT7A 2ZH8A 3ISBA 3MBYA 1ZQAA 1ZYQA 1SKSA 4I2AA 1F5AA 3JPQA 4DSLA 4UAZA 4C8OA 5F9LA 3V72A 4IR9A 5J0SA 3H8JA 5C5JA 5KFDA 5DG8A 8ICYA 4S3NA 1N56A 1Z3EB 5DQHA 1ZQRA 1KFTA 1MQ3A 4WC3A 4EP7A 1SL2A 3TQ1A 1AROP 4J9LA 1KFDA 2O5AA 9ICUA 5HMLA 1RXWA 9ICNA 2FPLA 4M0AA 2ZTDA 4DO9A 4DS4A 4WC2A 5KFLA 4I28A 4FH5A 1BPYA 3PW7A 3IHQB 1ZJNA 4KLGA 1V9PA 4UB5A 2BQRA 4QZ8A 1ZQBA 5KG2A 5KTQA 4JUZA 3RB0A 3RJKA 1X9SA 4BXOA 4KLUA 5DDMA 5KFBA 3E2EA 1BNOA 4J9SA 3PVXA 1ZQFA 1ZQQA 5KT6A 4YD2A 4DLGA 1NZPA 4DFKA 1U4BA 4M2YA 2AGQA 5D4BA 4QW8A 5DBBA 2HHPA 4F91B 4ECRA 4HYKA 3LK9A 1WCLA 3UXOA 4EBDA 2W9CB 4J9QA 1DK2A 4F3OA 1KNYA 1Q79A 3RRGA 4WBZA 3NYBA 4KLDA 4X5VA 4J9NA 5HP4A 1SL0A 7ICOA 1RPLA 2ASJA 8ICSA 2KFZA 2PXIA 3MDCA 1B22A 3B0XA 5DGAA 5KFJA 4QZHA 3BDPA 4QZIA 9ICEA 4I2IA 5KFRA 1DGSA 3PNCA 1XU4A 2M9NA 4RQ4A 4P4OA 4DSFA 4MEXA 5DEDA 4J9PA 5F9NA 4BDPA 4AT9B 1VJ7A 4DL4A 2IMWP 2ZH5A 4WC1A 3T5KA 1N48A 3TAPA 4TUSA 1NJYA 4ECTA 7ICLA 2ZH7A 2ZHAA 1H38A 5KFEA 2NRXA 2HHUA 9ICXA 4QW9A 2XGQA 1BPBA 2V9WA 4YP3A 7ICEA 4RT3A 8ICRA 5KFXA 5BPCA 4R66A 4EEYA 2BCSA 2ZH1A 5HRIA 1U49A 5KT2A 4DQSA 5KFNA 2W9MA 4FHPA 3K75D 1K1QA 1U48A 2ZH3A 1L3TA 1JXLA 4QZEA 1NK8A 1BPZA 5DLGA 3MR2A 3RH5A 4RNOA 3ETLA 4RQ1A 9ICFA 9ICGA 4DWIA 2IA6A 2Q66A 3G6YA 1PZNA 1S0OA 4DSKA 4GC7A 2HHVA 2PFPA 2DFLA 4DF4A 3GFKB 3OHAA 3ORYA 4RU9A 3LDAA 2XCAA 4RWNA 4EZ6A 5J2DA 3RB6A 2FLPA 3V7KA 1HUZA 9ICOA 5CR0A 1ZQDA 3AQNA 4M9HA 2ID1A 4UAYA 1D9FA 2W9AA 5HRGA 4E80A 2BDPA 3C23A 1R8AA 5KFGA 4F2RA 1OU5A 5KFVA 3C1ZA 3K4GA 3SYZA 2R8GA 2PI5A 4I27A 4JK1A 5EOZA 3UQ0A 2ZH2A 7ICSA 4JV0A 2IHNA 3RJGA 4NLNA 3MABA 4RPZA 3HIYA 4WC0A 2XY7A 1MQ2A 1WOTA 5J0YA 1COOA 2ALZA 3AQKA 5J2JA 5KG1A 3PX0A 4DL2A 4IQTA 4ECXA 3RH6A 4I2BA 8ICQA 3H38A 5KT5A 4YD1A 5KFKA 3Q8PB 2FMPA 1ZQJA 3V6JA 2KP7A 1BPDA 2F1HA 5EWGA 2OWOA 4O0IA 1TAUA 3RH4A 1L3UA 4EBKA 1SKWA 1NK7A 3MGIA 3JZ0A 2A1JA 2ISOA 4FBUA 3PMLA 3GV5B 8ICKA 3H4DA 9ICCA 3OVBA 3QEAZ 4I2DA 1X2IA 4UBBA 1NJWA 3G6VA 1NK6A 3MGHA 5L1LA 4ED1A 3ZDAA 4BWMA 2BCUA 1BNPA 5KT4A 3MFIA 4ED2A 4AT9A 1IM4A 5DQIA 3KHRA 4QWEA 2ZH9A 3TAQA 1T4GA 4ED3A 1TVAA 7ICQA 4DF8A 4DL3A 4I2FA 5HREA 3UQ2A 2JEIA 4PGXA 4F4XA 2KTQA 2HVIA 3H37A 4YR0A 1RXVA 4XUSA 1BPXA 2H5XA 4O3SA 5CJ7A 1L3SA 2F1IA 4KITB 4RQ2A 4KLHA 4ECWA 4B9VA 5BOLA 4O5CA 5KFZA 1S10A 2HHXA 4IQUA 9ICVA 1IXRA 4F4KA 4MF2A 8ICPA 5DECA 2ZTCA 2I9GA 3QE9Y 4X4VA 5KFAA 2FPKA 4QWBA 4NY8A 3JPNA 4TUPA 4PH5A 2MAXA 8ICIA 3NGDA 4RQ0A 4ECSA 4KLIA 4BGDA 4YFKA 4XRHA 1ZQCA 1XSLA 3OJSA 7ICNA 4DOCA 4F5PA 5J0TA 1KRPA 2ASLA 4ECUA 4ECYA 2UVRA 3PW4A 1C7YA 4EBJA 2ATLA 4F4WA 3QZ8A 1UT5A 9ICIA 3AQLA 4M04A 4J9MA 4EYHB 4FO6A 1BVSA 4UB1A 5J2CA 3HW8A 9ICMA 4I2JA 1SKRA 4YXJA 4IRCA 1ZQEA 3OHBA 3GIMA 1ZQZA 4M9GA 2BQUA 3L9DA 2BPGA 2FLLA 4Z6EA 4O5KA 1WCNA 4IR1A 3M9NB 4AT8B 2ISPA 4KLSA 1ZJMA 5IIJA 3RRHA 4ED6A 2AQ4A 4X4RA 1ZETA 4TQSA 5KFUA 4YMNA 2VA8A 3Q8RB 4B9SA 4C8LA 1S0VA 1MSWD 5F2VO 1MIVA 5HHIA 4EYIB 2DR7A 3BQ1A 5DDYA 3B0YA 5HMMA 5DB8A 2ZUBA 3MR6A 3EPGA 5L1IA 3C66A 8ICAA 3HJ1A 1LB2B 2NRKA 5HRLA 3JYYA 4ATBB 1MC8A 1KDHA 9ICKA 2ZJAA 1ZQPA 1VFGA 2AQ0A 5CB1A 3TFRA 8ICZA 2JZBA 1K1SA 4F93B 2DR9A 4PGQA 5IIKA 4B9NA 4RWPA 4KLMA 2A1JB 4FS1A 1UA0A 1CEZA 4C8KA 4DQQA 4PHDA 5J2BA 4DOBA 4EBCA 2PFQA 3PO4A 2DVIA 2F1JA 3HT3A 7ICPA 5CP2A 1NKEA 2P66A 5HC9A 5EWFA 5KFFA 4F5QA 3C18A 2XCPA 2HHQA 5KT3A 4KLQA 2V4QA 3GQCA 3OSPA 2PFNA 1CUKA 1NK4A 2BKEA 1ZQXA 1XSPA 1NO5A 2ZHBA 3UXNA 1JQRA 3PW2A 3OVAA 2KZ3A 1T8EA 4I2HA 4P4PA 2XY5A 4LVSA 5J2GA 9ICWA 4X4UA 4FHWA 3AU2A 1ZQGA 5J2HA 2BCVA 2LYHA 2BPCA 4WC5A 3HP6A 4DFPA 1KSPA 1NJZA 1T3NA 5DBCA 3M9OB 4F5OA 8ICJA 4FHYA 4Q8EA 3H40A 8ICFA 3C5FA 4QZGA 3OVSA 2UVWA 4YVZA 1D8LA 4RNMA 4M6WB 4PHEA 4QWAA 1JXEA 3PR4A 3ISCA 3RB3A 7ICUA 2XO7A 2BCQA 7ICFA 3SI8A 5D46A 3RB4A 7ICTA 4TUQA 4UD4A 4PGYA 4GXKA 2RFFA 4K4IA 1BGXT 3M8SA 3GV7B 4KLEA 5KG6A 4Q45A 4QWCA 3GV8B 2IBKA 1S9FA 1R89A 4UB2A 1NK0A 1ZQHA 4DQRA 3H4BA 8ICLA 4K4HA 7ICRA 4UQGA 1Z00B 4AT8A 4UAWA 1XC9A 4O5EA 2C2EA 1LV5A 4GLXA 3EYZA 4NM1A 4QZFA 3FDSA 1X9WA 4YMOA 1S0MA 4RPYA 3V7LA 3C5GA 7ICIA 4AT7B 1Y88A 3OV7A 2XC9A 2W8KA 3AUOA 5KFCA 4KMUA 2Q0ZX 4RQ6A 2W9BB 4RUCA 5HRHA 4CCHA 4O3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y1J A;  1ZQO A;  4ATB A;  1NKB A;  4J9R A;  2UVU A;  2KZM A;  4K4G A;  4UBC A;  3ZDC A;  4DL7 A;  4I2E A;  4P2H A;  3HJ4 A;  5KFI A;  2BCR A;  1QSS A;  1MIW A;  2BGW A;  4ELU A;  4ED8 A;  1ZQM A;  4UD5 A;  2DPI A;  4M9J A;  4O3R A;  2HW3 A;  1XWL A;  5KG4 A;  3LWL A;  4IRK A;  3M9M B;  3MR5 A;  3KHH A;  1HUO A;  2FMS A;  2KFN A;  4E8F A;  1TK0 A;  4LZD A;  5CWR A;  1TKD A;  4F92 B;  3T5J A;  1D9D A;  4LZG A;  8ICH A;  4FHX A;  4WCW A;  2JZB B;  5J0W A;  4UB3 A;  4ECV A;  4MEY A;  2BQ3 A;  3PO5 A;  3AQM A;  4WC4 A;  4PPX A;  4B9L A;  1UEU A;  1MIY A;  4ECZ A;  3Q8S B;  4X0B A;  2BPF A;  4EZ9 A;  3TAR A;  4F4Y A;  5J0O A;  4P4M A;  4IG8 A;  4Q44 A;  1ZQV A;  1JIH A;  2MUT A;  2NRV A;  4KLT A;  2AJQ A;  4Z6D A;  4YCX A;  5J0P A;  1QSL A;  5KFH A;  4X0A A;  4G3I A;  3KHL A;  3WFP A;  4RQ5 A;  5KFS A;  1UET A;  3PY8 A;  9ICR A;  4KLO A;  4R8U A;  4F5R A;  1BPE A;  2M2W A;  9ICL A;  3Q8M A;  4QWD A;  2HHW A;  3WFQ E;  2J6U A;  5IIL A;  1NK9 A;  3EPI A;  8ICM A;  4M6W A;  4NKT A;  4RZR A;  4RWO A;  1ZQT A;  2NRT A;  2XGP A;  2VA3 A;  3JPP A;  5J2A A;  4Z6F A;  3EW9 A;  2DRB A;  4QZA A;  4YR2 A;  7ICK A;  2P6U A;  4DFM A;  4B9T A;  4PHA A;  5EWE A;  4DSI A;  4MFF A;  4ECQ A;  4KLJ A;  4LT6 A;  7ICJ A;  1TK8 A;  2BE3 A;  7ICM A;  1U9L A;  5J2I A;  8ICW A;  3JPR A;  4DSE A;  1UT8 A;  3HWT A;  9ICH A;  1ZQN A;  2JEG A;  4X4O A;  4O3Q A;  3G6X A;  3C2M A;  1Z00 A;  3FYH A;  4F50 A;  2P6R A;  1ZQK A;  4Q8F A;  4M9L A;  3RBE A;  9ICJ A;  3MR3 A;  9ICA A;  3RJF A;  5DQG A;  4RQ8 A;  3RJI A;  4AT7 A;  5DB6 A;  3RBD A;  2J6T A;  4I2G A;  1NOM A;  3TI0 A;  4ED0 A;  2Y1I A;  1NK5 A;  5D49 A;  2W9B A;  3Q8L A;  5DLF A;  2O1P A;  4RWQ A;  2AU0 A;  1B43 A;  4NXZ A;  4F4Z A;  3T3F A;  2AGO A;  1D8Y A;  5J29 A;  4X4P A;  2ASD A;  1XS9 D;  2VA2 A;  4NM2 A;  4Q43 A;  3OGU A;  3JPT A;  3V7J A;  4BWJ A;  3T5H A;  4I29 A;  8ICC A;  1U47 A;  3BQ0 A;  4XA5 A;  2C2D A;  2I1Q A;  2JEJ A;  2M2T A;  5BOM A;  4DL5 A;  5KFW A;  3ZD8 A;  1ZQY A;  4RUA A;  3PMN A;  4MFA A;  3PV8 A;  2M2V A;  1JMS A;  3C21 A;  4IQV A;  2WTF A;  3N97 B;  2NRW A;  2M2U A;  2FPM A;  4R64 A;  1JN3 A;  5KFP A;  3BQT A;  7ICH A;  3SZ2 A;  1TFY A;  3ZDB A;  5CA7 A;  2HVH A;  4TUR A;  3T5L A;  8ICU A;  5DBA A;  5KG7 A;  3C2K A;  2R8H A;  3WFR E;  4FS2 A;  3UPQ A;  4B9M A;  4E7X A;  3IM1 A;  5IIO A;  4MF8 A;  3PR5 B;  4IRD A;  2FLN A;  8ICO A;  3OUY A;  3H7I A;  3H8S A;  1TAQ A;  5DB7 A;  5KG3 A;  4DOA A;  2UVV A;  4RT2 A;  8ICT A;  4C8N A;  1KFS A;  2JEF A;  4JWN A;  4MFC A;  5HRK A;  1L5U A;  3OJU A;  5J0U A;  2MUT B;  2BHN A;  1DOQ A;  2VAN A;  3LWM A;  3M8R A;  4ELV A;  1PX5 A;  3UPS A;  3NTU A;  1S76 D;  3C2L A;  4DSJ A;  1ZQI A;  2IHM A;  1QTM A;  5KG0 A;  2W8L A;  2KZZ A;  4I2C A;  3H8W A;  3ZDE A;  4GC6 A;  1ZQL A;  1R8C A;  3RAX A;  4O3P A;  3MDA A;  3C1Y A;  4R8U B;  1ZQU A;  3RJJ A;  8ICX A;  9ICT A;  4R63 A;  4FHV A;  3HX0 A;  3GIK A;  1SL1 A;  4M9N A;  4NLZ A;  5J2K A;  4M5D A;  3QEB Z;  2HHS A;  2J6S A;  5J2F A;  3RJH A;  2FMQ A;  1RYR A;  3Q8K A;  3RAQ A;  1TFR A;  4ZH4 A;  4B9U A;  5HRF A;  9ICQ A;  2R8J A;  1RZT A;  5HNK A;  4ED7 A;  4KTQ A;  3ISD A;  4TQR A;  4GXJ A;  5HR9 A;  5KFQ A;  4O9M A;  1XO1 A;  2C28 A;  3EWA A;  4C8M A;  9ICS A;  2R8K A;  4DQP A;  1S77 D;  1NKC A;  1DK3 A;  4WBY A;  4NLK A;  2ZH6 A;  3H3A A;  4FH3 A;  2ZUC A;  4JV1 A;  2XY6 A;  3SV4 A;  3WFO A;  5J0Q A;  4IQW A;  5J0X A;  1TK5 A;  3V6H A;  4WC7 A;  5J0R A;  5J2E A;  3ZDD A;  3HPO A;  3GDX A;  4R65 A;  2DRA A;  4KLF A;  3AU6 A;  7ICG A;  2DR5 A;  8ICB A;  5HRD A;  4DEZ A;  5DB9 A;  4DL6 A;  2HHT A;  4DS5 A;  4KN4 A;  3PX4 A;  2ZUD A;  3JPS A;  1S0N A;  5JUM A;  2GWS A;  1QLN A;  1Q78 A;  4UB4 A;  4DLE A;  3QZ7 A;  1FA0 A;  4X4T A;  5KFY A;  2DPJ A;  2ZJ5 A;  1ZQS A;  2PFO A;  4PHP A;  4ELT A;  1TV9 A;  1QSY A;  4KLL A;  2RDJ A;  1YLQ A;  2DR8 A;  2RDI A;  1L3V A;  1A76 A;  3BQ2 A;  3BJY A;  2PBE A;  4YR3 A;  4X4N A;  4YMM A;  3LQC B;  3RR7 A;  5HHH A;  5KG5 A;  1HJP A;  3GIJ A;  5IIN A;  4KN7 A;  4WC6 A;  4NKU A;  3EZ5 A;  4BXO B;  2NRZ A;  2R8I A;  3UXP A;  2AGP A;  1T7P A;  4RPX A;  5HRB A;  4YN4 A;  3WFS C;  5DGB A;  2W9C A;  5KFM A;  4GXI A;  4E0D A;  1UEV A;  4X4S A;  4XQ8 A;  2ZJ8 A;  3RJE A;  5DKW A;  3OUY B;  3RTV A;  4YXM A;  2PI4 A;  8ICV A;  3THV A;  4X4Q A;  4RQ7 A;  1JAJ A;  8ICN A;  3ZD9 A;  5IIM A;  4DFJ A;  7ICV A;  3OSN A;  5KFT A;  4FBT A;  4J9O A;  2B21 A;  4QZD A;  5DG9 A;  3TFS A;  5DG7 A;  4M47 A;  8ICG A;  4F5N A;  4JV2 A;  9ICP A;  2BR0 A;  4Z6C A;  3TAN A;  4J9K A;  1NJX A;  1ZQW A;  1RYS A;  3GII A;  4RNN A;  4YG2 A;  3H39 A;  1X9M A;  5L1K A;  3RR8 A;  3N4M B;  4JWM A;  3PW0 A;  1R8B A;  1V4A A;  4F8R A;  2ZTE A;  2ZH4 A;  1S97 A;  1KTQ A;  1A77 A;  1KLN A;  1KEJ A;  4RQ3 A;  4EBE A;  3PW5 A;  4XQ7 A;  4NLG A;  3JPO A;  3PX6 A;  2C2R A;  2KN7 A;  1UA1 A;  1JX4 A;  3KHG A;  1XSN A;  8ICE A;  1TFW A;  3KTQ A;  4DQI A;  5CHG A;  4QZB A;  9ICB A;  2V4R A;  4O3O A;  4QZ9 A;  4QZC A;  1SZP A;  3MFH A;  1U45 A;  2C22 A;  3SV3 A;  3GIL A;  3Q8Q B;  3V6K A;  5KFO A;  5III A;  5TZV A;  1EXN A;  5L9X A;  4YQW A;  5L1J A;  4F2S A;  5KT7 A;  2ZH8 A;  3ISB A;  3MBY A;  1ZQA A;  1ZYQ A;  1SKS A;  4I2A A;  1F5A A;  3JPQ A;  4DSL A;  4UAZ A;  4C8O A;  5F9L A;  3V72 A;  4IR9 A;  5J0S A;  3H8J A;  5C5J A;  5KFD A;  5DG8 A;  8ICY A;  4S3N A;  1N56 A;  1Z3E B;  5DQH A;  1ZQR A;  1KFT A;  1MQ3 A;  4WC3 A;  4EP7 A;  1SL2 A;  3TQ1 A;  1ARO P;  4J9L A;  1KFD A;  2O5A A;  9ICU A;  5HML A;  1RXW A;  9ICN A;  2FPL A;  4M0A A;  2ZTD A;  4DO9 A;  4DS4 A;  4WC2 A;  5KFL A;  4I28 A;  4FH5 A;  1BPY A;  3PW7 A;  3IHQ B;  1ZJN A;  4KLG A;  1V9P A;  4UB5 A;  2BQR A;  4QZ8 A;  1ZQB A;  5KG2 A;  5KTQ A;  4JUZ A;  3RB0 A;  3RJK A;  1X9S A;  4BXO A;  4KLU A;  5DDM A;  5KFB A;  3E2E A;  1BNO A;  4J9S A;  3PVX A;  1ZQF A;  1ZQQ A;  5KT6 A;  4YD2 A;  4DLG A;  1NZP A;  4DFK A;  1U4B A;  4M2Y A;  2AGQ A;  5D4B A;  4QW8 A;  5DBB A;  2HHP A;  4F91 B;  4ECR A;  4HYK A;  3LK9 A;  1WCL A;  3UXO A;  4EBD A;  2W9C B;  4J9Q A;  1DK2 A;  4F3O A;  1KNY A;  1Q79 A;  3RRG A;  4WBZ A;  3NYB A;  4KLD A;  4X5V A;  4J9N A;  5HP4 A;  1SL0 A;  7ICO A;  1RPL A;  2ASJ A;  8ICS A;  2KFZ A;  2PXI A;  3MDC A;  1B22 A;  3B0X A;  5DGA A;  5KFJ A;  4QZH A;  3BDP A;  4QZI A;  9ICE A;  4I2I A;  5KFR A;  1DGS A;  3PNC A;  1XU4 A;  2M9N A;  4RQ4 A;  4P4O A;  4DSF A;  4MEX A;  5DED A;  4J9P A;  5F9N A;  4BDP A;  4AT9 B;  1VJ7 A;  4DL4 A;  2IMW P;  2ZH5 A;  4WC1 A;  3T5K A;  1N48 A;  3TAP A;  4TUS A;  1NJY A;  4ECT A;  7ICL A;  2ZH7 A;  2ZHA A;  1H38 A;  5KFE A;  2NRX A;  2HHU A;  9ICX A;  4QW9 A;  2XGQ A;  1BPB A;  2V9W A;  4YP3 A;  7ICE A;  4RT3 A;  8ICR A;  5KFX A;  5BPC A;  4R66 A;  4EEY A;  2BCS A;  2ZH1 A;  5HRI A;  1U49 A;  5KT2 A;  4DQS A;  5KFN A;  2W9M A;  4FHP A;  3K75 D;  1K1Q A;  1U48 A;  2ZH3 A;  1L3T A;  1JXL A;  4QZE A;  1NK8 A;  1BPZ A;  5DLG A;  3MR2 A;  3RH5 A;  4RNO A;  3ETL A;  4RQ1 A;  9ICF A;  9ICG A;  4DWI A;  2IA6 A;  2Q66 A;  3G6Y A;  1PZN A;  1S0O A;  4DSK A;  4GC7 A;  2HHV A;  2PFP A;  2DFL A;  4DF4 A;  3GFK B;  3OHA A;  3ORY A;  4RU9 A;  3LDA A;  2XCA A;  4RWN A;  4EZ6 A;  5J2D A;  3RB6 A;  2FLP A;  3V7K A;  1HUZ A;  9ICO A;  5CR0 A;  1ZQD A;  3AQN A;  4M9H A;  2ID1 A;  4UAY A;  1D9F A;  2W9A A;  5HRG A;  4E80 A;  2BDP A;  3C23 A;  1R8A A;  5KFG A;  4F2R A;  1OU5 A;  5KFV A;  3C1Z A;  3K4G A;  3SYZ A;  2R8G A;  2PI5 A;  4I27 A;  4JK1 A;  5EOZ A;  3UQ0 A;  2ZH2 A;  7ICS A;  4JV0 A;  2IHN A;  3RJG A;  4NLN A;  3MAB A;  4RPZ A;  3HIY A;  4WC0 A;  2XY7 A;  1MQ2 A;  1WOT A;  5J0Y A;  1COO A;  2ALZ A;  3AQK A;  5J2J A;  5KG1 A;  3PX0 A;  4DL2 A;  4IQT A;  4ECX A;  3RH6 A;  4I2B A;  8ICQ A;  3H38 A;  5KT5 A;  4YD1 A;  5KFK A;  3Q8P B;  2FMP A;  1ZQJ A;  3V6J A;  2KP7 A;  1BPD A;  2F1H A;  5EWG A;  2OWO A;  4O0I A;  1TAU A;  3RH4 A;  1L3U A;  4EBK A;  1SKW A;  1NK7 A;  3MGI A;  3JZ0 A;  2A1J A;  2ISO A;  4FBU A;  3PML A;  3GV5 B;  8ICK A;  3H4D A;  9ICC A;  3OVB A;  3QEA Z;  4I2D A;  1X2I A;  4UBB A;  1NJW A;  3G6V A;  1NK6 A;  3MGH A;  5L1L A;  4ED1 A;  3ZDA A;  4BWM A;  2BCU A;  1BNP A;  5KT4 A;  3MFI A;  4ED2 A;  4AT9 A;  1IM4 A;  5DQI A;  3KHR A;  4QWE A;  2ZH9 A;  3TAQ A;  1T4G A;  4ED3 A;  1TVA A;  7ICQ A;  4DF8 A;  4DL3 A;  4I2F A;  5HRE A;  3UQ2 A;  2JEI A;  4PGX A;  4F4X A;  2KTQ A;  2HVI A;  3H37 A;  4YR0 A;  1RXV A;  4XUS A;  1BPX A;  2H5X A;  4O3S A;  5CJ7 A;  1L3S A;  2F1I A;  4KIT B;  4RQ2 A;  4KLH A;  4ECW A;  4B9V A;  5BOL A;  4O5C A;  5KFZ A;  1S10 A;  2HHX A;  4IQU A;  9ICV A;  1IXR A;  4F4K A;  4MF2 A;  8ICP A;  5DEC A;  2ZTC A;  2I9G A;  3QE9 Y;  4X4V A;  5KFA A;  2FPK A;  4QWB A;  4NY8 A;  3JPN A;  4TUP A;  4PH5 A;  2MAX A;  8ICI A;  3NGD A;  4RQ0 A;  4ECS A;  4KLI A;  4BGD A;  4YFK A;  4XRH A;  1ZQC A;  1XSL A;  3OJS A;  7ICN A;  4DOC A;  4F5P A;  5J0T A;  1KRP A;  2ASL A;  4ECU A;  4ECY A;  2UVR A;  3PW4 A;  1C7Y A;  4EBJ A;  2ATL A;  4F4W A;  3QZ8 A;  1UT5 A;  9ICI A;  3AQL A;  4M04 A;  4J9M A;  4EYH B;  4FO6 A;  1BVS A;  4UB1 A;  5J2C A;  3HW8 A;  9ICM A;  4I2J A;  1SKR A;  4YXJ A;  4IRC A;  1ZQE A;  3OHB A;  3GIM A;  1ZQZ A;  4M9G A;  2BQU A;  3L9D A;  2BPG A;  2FLL A;  4Z6E A;  4O5K A;  1WCN A;  4IR1 A;  3M9N B;  4AT8 B;  2ISP A;  4KLS A;  1ZJM A;  5IIJ A;  3RRH A;  4ED6 A;  2AQ4 A;  4X4R A;  1ZET A;  4TQS A;  5KFU A;  4YMN A;  2VA8 A;  3Q8R B;  4B9S A;  4C8L A;  1S0V A;  1MSW D;  5F2V O;  1MIV A;  5HHI A;  4EYI B;  2DR7 A;  3BQ1 A;  5DDY A;  3B0Y A;  5HMM A;  5DB8 A;  2ZUB A;  3MR6 A;  3EPG A;  5L1I A;  3C66 A;  8ICA A;  3HJ1 A;  1LB2 B;  2NRK A;  5HRL A;  3JYY A;  4ATB B;  1MC8 A;  1KDH A;  9ICK A;  2ZJA A;  1ZQP A;  1VFG A;  2AQ0 A;  5CB1 A;  3TFR A;  8ICZ A;  2JZB A;  1K1S A;  4F93 B;  2DR9 A;  4PGQ A;  5IIK A;  4B9N A;  4RWP A;  4KLM A;  2A1J B;  4FS1 A;  1UA0 A;  1CEZ A;  4C8K A;  4DQQ A;  4PHD A;  5J2B A;  4DOB A;  4EBC A;  2PFQ A;  3PO4 A;  2DVI A;  2F1J A;  3HT3 A;  7ICP A;  5CP2 A;  1NKE A;  2P66 A;  5HC9 A;  5EWF A;  5KFF A;  4F5Q A;  3C18 A;  2XCP A;  2HHQ A;  5KT3 A;  4KLQ A;  2V4Q A;  3GQC A;  3OSP A;  2PFN A;  1CUK A;  1NK4 A;  2BKE A;  1ZQX A;  1XSP A;  1NO5 A;  2ZHB A;  3UXN A;  1JQR A;  3PW2 A;  3OVA A;  2KZ3 A;  1T8E A;  4I2H A;  4P4P A;  2XY5 A;  4LVS A;  5J2G A;  9ICW A;  4X4U A;  4FHW A;  3AU2 A;  1ZQG A;  5J2H A;  2BCV A;  2LYH A;  2BPC A;  4WC5 A;  3HP6 A;  4DFP A;  1KSP A;  1NJZ A;  1T3N A;  5DBC A;  3M9O B;  4F5O A;  8ICJ A;  4FHY A;  4Q8E A;  3H40 A;  8ICF A;  3C5F A;  4QZG A;  3OVS A;  2UVW A;  4YVZ A;  1D8L A;  4RNM A;  4M6W B;  4PHE A;  4QWA A;  1JXE A;  3PR4 A;  3ISC A;  3RB3 A;  7ICU A;  2XO7 A;  2BCQ A;  7ICF A;  3SI8 A;  5D46 A;  3RB4 A;  7ICT A;  4TUQ A;  4UD4 A;  4PGY A;  4GXK A;  2RFF A;  4K4I A;  1BGX T;  3M8S A;  3GV7 B;  4KLE A;  5KG6 A;  4Q45 A;  4QWC A;  3GV8 B;  2IBK A;  1S9F A;  1R89 A;  4UB2 A;  1NK0 A;  1ZQH A;  4DQR A;  3H4B A;  8ICL A;  4K4H A;  7ICR A;  4UQG A;  1Z00 B;  4AT8 A;  4UAW A;  1XC9 A;  4O5E A;  2C2E A;  1LV5 A;  4GLX A;  3EYZ A;  4NM1 A;  4QZF A;  3FDS A;  1X9W A;  4YMO A;  1S0M A;  4RPY A;  3V7L A;  3C5G A;  7ICI A;  4AT7 B;  1Y88 A;  3OV7 A;  2XC9 A;  2W8K A;  3AUO A;  5KFC A;  4KMU A;  2Q0Z X;  4RQ6 A;  2W9B B;  4RUC A;  5HRH A;  4CCH A;  4O3N A; 
#chains in the Genus database with same CATH topology
 5AM3 A;  4ATB A;  4J9R A;  4UBC A;  3ZDC A;  4I2E A;  5KFI A;  1MIW A;  2BGW A;  4ELU A;  4K98 A;  1ZQM A;  4UD5 A;  3FAH A;  4IRK A;  5AI5 A;  4C4S A;  3M9M B;  3KHH A;  2KFN A;  4E8F A;  3BZK A;  4LZD A;  5CWR A;  8ICH A;  3T5J A;  1D9D A;  3PO5 A;  4WC4 A;  5KL8 B;  4ECZ A;  2BPF A;  4Q44 A;  1QQ7 A;  3AMZ A;  4OAI Z;  4YCX A;  4X0A A;  2H3Z A;  4O68 A;  3KHL A;  1RG6 A;  4R8U A;  4A8E A;  2LM1 A;  4IS7 A;  2WF7 A;  2J6U A;  4RQM A;  5IIL A;  1NK9 A;  4NKT A;  2BZF A;  3QUB A;  1WG8 A;  4ICA A;  2IOF A;  5J2A A;  3EW9 A;  1UHU A;  2ZIX A;  5FP0 A;  4B9T A;  4WH5 A;  4ECQ A;  1U9L A;  5J2I A;  8ICW A;  9ICH A;  5CRX A;  4O3Q A;  3C2M A;  1C20 A;  3O0F A;  2PKE A;  3RBD A;  1NOM A;  3M1Y A;  3Q8L A;  5DLF A;  2O1P A;  2AU0 A;  3T3F A;  2AGO A;  5J29 A;  2ASD A;  4NM2 A;  2MRL A;  1JUD A;  3NKU A;  2I1Q A;  2JEJ A;  3DDH A;  2M2T A;  3ZD8 A;  1ZQY A;  4P0P B;  3LVW A;  1A0P A;  2NRW A;  1JN3 A;  5D61 A;  3QX7 A;  3M6K A;  5KG7 A;  3A0B U;  2G5H B;  4E7X A;  2W04 A;  1TAQ A;  4DOA A;  4RT2 A;  4JWN A;  5HRK A;  2MU2 A;  1IV8 A;  4ELV A;  3LWM A;  2HBM A;  3CK6 A;  3UPS A;  1S76 D;  2DBY A;  2W8L A;  4CCH A;  3ZDE A;  4NL9 C;  3AEV A;  3RAX A;  1ZQU A;  2H3F A;  2AHO B;  3HX0 A;  4M9N A;  1FFV A;  1Q3V A;  2YMP A;  4ZH4 A;  4B9U A;  2E3T A;  3ISD A;  4TQR A;  2N1R A;  3QUT A;  1XO1 A;  2C28 A;  4ZOH C;  3NAS A;  2R8K A;  4DQP A;  4WBY A;  4FH3 A;  4JV1 A;  3SMV A;  3SV4 A;  4MHV A;  5J0Q A;  1TK5 A;  3V6H A;  1ZD3 A;  5J2E A;  4OJO A;  3ZDD A;  3GDX A;  3UM9 A;  3AU6 A;  2DR5 A;  4P0P A;  5DB9 A;  4WJ3 B;  1HEK A;  2Y0S F;  5B3P A;  1ED1 A;  2ZUD A;  1K5O A;  1S0N A;  3F2B A;  5JUM A;  1QLN A;  1ECW A;  4B6J A;  1ZQS A;  2DQN B;  2RDJ A;  4KLL A;  3TAD C;  2RDI A;  3BJY A;  4X4N A;  4YMM A;  3LQC B;  1OW5 A;  4WC6 A;  5E79 U;  2DL0 A;  5DGB A;  1FFU A;  4E0D A;  1XO0 A;  3OUY B;  2PI4 A;  8ICV A;  5K4L A;  3THV A;  8ICN A;  5IIM A;  5KFT A;  1O08 A;  2WB1 F;  3N7S C;  3KD3 A;  3NVV A;  9ICP A;  5HR7 A;  2BR0 A;  4Z6C A;  3TAN A;  1NJX A;  1ZQW A;  1L8O A;  1X9M A;  3H0M B;  2HOQ A;  1A77 A;  1L7N A;  5EE0 A;  1Q8K A;  2QB0 B;  3KOO A;  3JPO A;  4NLG A;  2R18 A;  5CHG A;  3ERC C;  2G09 A;  5TZV A;  2EDU A;  5L9X A;  3ISB A;  3MBY A;  5B5E U;  1SKS A;  4DSL A;  3HKZ C;  4IR9 A;  4UW9 A;  5F3X B;  5J0S A;  4NV0 A;  1N56 A;  2YML A;  2IUB A;  2FPL A;  4DS4 A;  5KFL A;  2F77 X;  3ER8 C;  1BPY A;  3PW7 A;  4KLG A;  1B4F A;  4UB5 A;  1Q3U A;  5D63 A;  2F76 X;  1M6Y A;  3E2E A;  5DDM A;  3PVX A;  1ZQF A;  4DLG A;  5HR6 A;  3LK9 A;  1WCL A;  5GTH U;  4KMO B;  1DK2 A;  4F3O A;  4EX6 A;  3RRG A;  4AYB F;  4UAU A;  4X5V A;  7ICO A;  8ICS A;  1RPL A;  4X4O A;  3B0X A;  5DGA A;  5KFJ A;  4QZH A;  3BDP A;  4QZI A;  4I2I A;  5AIC A;  5KFR A;  1DGS A;  3PNC A;  1XU4 A;  2M9N A;  4RQ4 A;  2QB0 A;  4ACO A;  4MEX A;  5DED A;  1VJ7 A;  3E0F A;  2ZH5 A;  3TAP A;  7ICL A;  1H38 A;  5KFE A;  5ALL A;  2V9W A;  7ICE A;  4RT3 A;  4EX7 A;  2JHD A;  3L4P A;  5KT2 A;  4DQS A;  2FI1 A;  5AM5 A;  3K75 D;  1ZXI A;  2KVS A;  1SV0 C;  3QNM A;  2IA6 A;  4DWI A;  5A0L A;  1S0O A;  4DSK A;  2HHV A;  2NO5 A;  2KHV A;  4DF4 A;  2XCA A;  4RWN A;  4EZ6 A;  5J2D A;  2K4E A;  2EZZ A;  2FLP A;  3V7K A;  1HUZ A;  1ZQD A;  3AQN A;  3ETR A;  3WK9 A;  3K4G A;  2W55 A;  3UQ0 A;  5EOZ A;  2IHN A;  3MAB A;  5JRT A;  4RPZ A;  4HAI A;  4WC0 A;  2DWQ A;  3AQK A;  5J2J A;  1KQQ A;  1ZQJ A;  3V6J A;  5EWG A;  2OWO A;  1QQ6 A;  4LEW A;  1SKW A;  3PML A;  2K4I A;  4FZL A;  3GV5 B;  8ICK A;  3H4D A;  9ICC A;  3QEA Z;  2DR7 A;  3G6V A;  3ZDA A;  1IM4 A;  5DQI A;  3LVV A;  4ED3 A;  4I2F A;  5HRE A;  3UQ2 A;  3H37 A;  2KIV A;  4KIT B;  4KLH A;  2HSZ A;  4O5C A;  9ICV A;  1Z4O A;  2K4H A;  4MF2 A;  8ICP A;  2ZTC A;  3D2S A;  2FPK A;  4U6P A;  4K99 A;  5AM1 A;  4RQ0 A;  4EEB A;  4XRH A;  4XJE A;  1FO4 A;  3QUQ A;  4DOC A;  2QLT A;  4ECY A;  1TAM A;  4EBJ A;  2ATL A;  4F4W A;  1PUZ A;  2EZX A;  1BVS A;  5J2C A;  9ICM A;  4IRC A;  5B3Q A;  3GIM A;  3NWI A;  2LYA A;  4AT8 B;  3M9N B;  2ISP A;  4KLS A;  5AKY A;  1ZET A;  1N62 A;  4YMN A;  4TQS A;  2JGA A;  4RQN A;  4C8L A;  1S0V A;  1MIV A;  5DDY A;  3MR6 A;  3C66 A;  8ICA A;  1LB2 B;  4OAG A;  5ALU A;  1ZQP A;  3MC1 A;  4NWI A;  3TFR A;  5IIK A;  1CEZ A;  5J2B A;  3PO4 A;  1UQV A;  5ALO A;  7ICP A;  5CP2 A;  5HC9 A;  1Z1B A;  2XCP A;  2V4Q A;  1NK4 A;  2BKE A;  1ZQX A;  5AKL A;  3PW2 A;  1T8E A;  4I2H A;  4P4P A;  5J2G A;  1NZB A;  1ZQG A;  1F5S A;  2KEY A;  2BPC A;  4WC5 A;  1KSP A;  1T3N A;  5DBC A;  3M9O B;  4QZG A;  2UVW A;  4RNM A;  7ICU A;  4FE3 A;  4CRX A;  2BCQ A;  1ZD2 P;  3GZF A;  4TUQ A;  5ALJ A;  3CYM A;  2G0A A;  2RFF A;  4K4I A;  2XVT A;  1S9F A;  1NK0 A;  3WK8 A;  1DXS A;  4O69 A;  4AT8 A;  4GLX A;  3KBB A;  4NXU A;  4UAT A;  3FDS A;  5H2F U;  3AUO A;  4KMU A;  2Q0Z X;  2W9B B;  5DB6 A;  3F5A A;  1ZQO A;  2UVU A;  1QSS A;  2DPI A;  2HW3 A;  1XWL A;  3LWL A;  3MR5 A;  1HUO A;  2FMS A;  2M0N A;  5AKJ A;  1TK0 A;  1TKD A;  4LZG A;  4F92 B;  1RQL A;  4MEY A;  4PPX A;  4FO1 A;  4X0B A;  1N61 A;  1QSL A;  5KFH A;  3WFP A;  3PST A;  5KFS A;  3SEI A;  2NO4 A;  4K9A A;  3PY8 A;  2I5H A;  4KLO A;  1BPE A;  2M2W A;  3WFQ E;  3AQF A;  3RFA A;  1ZQT A;  2E8N A;  2NRT A;  2DGZ A;  3JPP A;  3NVO A;  3OTQ A;  4YR2 A;  5EWE A;  2BE3 A;  1N63 A;  1UT8 A;  3HWT A;  2JEG A;  3FYH A;  4F50 A;  1ZQK A;  2EQY A;  3RBE A;  3RJF A;  4RQ8 A;  4I2G A;  2ES6 A;  5D49 A;  2W9B A;  1B43 A;  4NXZ A;  1D8Y A;  4NLC A;  8ICJ A;  1U47 A;  3BQ0 A;  5KFW A;  4KM5 A;  2FPM A;  4BUG A;  4R64 A;  7ICH A;  1PK3 A;  4OJ6 A;  3ZDB A;  3T5L A;  8ICU A;  5DBA A;  3C2K A;  3WFR E;  4B9M A;  3R9K A;  5IIO A;  4MF8 A;  2FLN A;  2KJ5 A;  8ICO A;  5DB7 A;  2UVV A;  5KG3 A;  2KNJ A;  2YB4 A;  1IIP A;  3OJU A;  1DOQ A;  1PX5 A;  2HMX A;  3M8R A;  3NTU A;  5AK5 A;  2GH1 A;  1QTM A;  2YMQ A;  1YZ6 A;  1DGJ A;  4I2C A;  3MGV A;  4CDG A;  4O3P A;  3MDA A;  4R8U B;  8ICX A;  4AP9 A;  2NV3 A;  3QXG A;  2XIC A;  3QEB Z;  5ALP A;  2J6S A;  3QU4 A;  3RJH A;  2FMQ A;  4CNQ A;  1RYR A;  1SV4 A;  4BX9 C;  1T3Q A;  2EH9 A;  2ZIX B;  4ED7 A;  4KTQ A;  5HR9 A;  4O9M A;  3EWA A;  9ICS A;  1NKC A;  1DK3 A;  2ZH6 A;  1J2N A;  3NRZ A;  5J0X A;  2DRA A;  4QIW C;  5HRD A;  5ALM A;  4DEZ A;  3F53 A;  4Y2T A;  4DS5 A;  3PX4 A;  3QU5 A;  4K97 A;  3K1Z A;  1Q78 A;  4UB4 A;  3QZ7 A;  2WAQ C;  5KFY A;  4ELT A;  1TV9 A;  1QSY A;  2DR8 A;  2PBE A;  5HHH A;  4KN7 A;  3OPX A;  3EZ5 A;  2NRZ A;  2R8I A;  3UXP A;  4RPX A;  3QUC A;  5HRB A;  1QQ5 A;  2W9C A;  1UEV A;  4XQ8 A;  2EAP A;  4YXM A;  5ALW A;  1VDV A;  4Y2Q A;  5AI6 A;  7ICV A;  3A0H U;  4KX3 A;  2B21 A;  5DG9 A;  1N5W A;  4F5N A;  1IG6 A;  4J9K A;  4RNN A;  4YG2 A;  3N4M B;  2EZY A;  4JLZ A;  1V4A A;  4F8R A;  5ALV A;  1KLN A;  1KEJ A;  5AI9 A;  4EBE A;  4XQ7 A;  3PX6 A;  8ICE A;  1JX4 A;  2KJ9 A;  1Q46 A;  4O3O A;  4QZC A;  3MFH A;  1SZP A;  1U45 A;  2C22 A;  2OHF A;  3SV3 A;  3GIL A;  5GTI U;  1LKY A;  4CE6 A;  3JPQ A;  2WF5 A;  3V72 A;  2LHT A;  5C5J A;  1L6N A;  1L7M A;  5DQH A;  1ZQR A;  2E8M A;  4WC3 A;  1SL2 A;  3EF2 A;  1ARO P;  5HML A;  1RXW A;  2ZTD A;  4DO9 A;  4WC2 A;  2GA9 D;  4FH5 A;  4QZ8 A;  2DF4 B;  5KTQ A;  4JUZ A;  3RB0 A;  4IL6 U;  2H3I A;  4KLU A;  4J9S A;  3NVY A;  1NZP A;  5KT6 A;  4ECR A;  4WQK A;  1LVH A;  3UXO A;  1Q79 A;  3NYB A;  2FE9 A;  1SL0 A;  2KFZ A;  1B22 A;  9ICE A;  2WF8 A;  4Y2Y A;  4P4O A;  4OO1 J;  4J9P A;  4AT9 B;  1NJY A;  1WUD A;  5ALZ A;  2HHU A;  9ICX A;  4QW9 A;  2XGQ A;  1BPB A;  4UAV A;  3VC8 A;  2EAM A;  2JH1 A;  3TAC B;  4EEN A;  5BPC A;  2GAF D;  4R66 A;  4PL2 A;  5HRI A;  4O3M A;  3WK5 A;  4NXX A;  4EEK A;  5KFN A;  2W9M A;  2FJ6 A;  2LM4 A;  5G5G A;  1L3T A;  4QZE A;  5DLG A;  4RNO A;  4K9B A;  2Q66 A;  1PZN A;  2D3D A;  2PFP A;  2DKX A;  4RU9 A;  1NI3 A;  3LYS A;  2KG5 A;  4UAY A;  4E80 A;  4EV6 A;  3C1Z A;  3SYZ A;  2R8G A;  4I27 A;  4JV0 A;  3RJG A;  2XY7 A;  1COO A;  2ALZ A;  1PVR A;  3PX0 A;  4IQT A;  8ICQ A;  5KFK A;  1YZ7 A;  4UB6 U;  3JZ0 A;  2A1J A;  2LYB A;  1SWV A;  1NJW A;  1X2I A;  1NK6 A;  5L1L A;  4BWM A;  2BCU A;  3MFI A;  4AT9 A;  3KHR A;  1T4G A;  2OCE A;  1TVA A;  4UB8 U;  4F4X A;  4US9 A;  2KTQ A;  3ER9 B;  4O3S A;  1L3S A;  2F1I A;  1Z19 A;  4ECW A;  2OEH A;  4P0Q A;  4IQU A;  1FIQ A;  4F4K A;  3QE9 Y;  4TUP A;  5CFT A;  3NGD A;  1XSL A;  3WKB A;  2ZIV B;  4PZO A;  2Y9U A;  3PW4 A;  2F3N A;  1RQN A;  4J9M A;  4F72 A;  2B0C A;  2BBJ A;  4I2J A;  1ZQZ A;  2KD1 A;  2FLL A;  4FZN A;  1WCN A;  5AKH A;  2K8A A;  2HCF A;  4ED6 A;  2VA8 A;  5F2V O;  1KBU A;  5HHI A;  3BQ1 A;  3H0R B;  5HMM A;  3EPG A;  2ZUB A;  3HJ1 A;  3WK4 A;  4CGZ A;  3IG5 A;  4KX5 A;  1SB3 C;  2JZB A;  2DR9 A;  4B9N A;  2G07 A;  4KLM A;  3WKA A;  4FS1 A;  1UA0 A;  3HT3 A;  5EWF A;  5KT3 A;  2PFN A;  1CUK A;  1JQR A;  5AKE A;  5ALY A;  3OVA A;  9ICW A;  5J2H A;  3FC4 A;  2WFA A;  3NVW A;  4FHY A;  4Q8E A;  3OVS A;  1D8L A;  4FHP A;  4M6W B;  3RB3 A;  4QWA A;  1JXE A;  3PR4 A;  2ZIV A;  1HIW A;  2D8C A;  2WAQ F;  4GXK A;  3DV9 A;  1BGX T;  3GV7 B;  4KLE A;  5KG6 A;  4Q45 A;  4QWC A;  3NRW A;  2IBK A;  5KAI U;  1R89 A;  2QKQ A;  1ZQH A;  4DQR A;  4Y2R A;  1V38 A;  1ZD5 A;  5AM0 A;  3UMB A;  4UAW A;  1XC9 A;  1LV5 A;  2F44 A;  4QZF A;  1X9W A;  4YMO A;  3OV7 A;  2KE7 A;  2XC9 A;  5KFC A;  1L7O A;  4RQ6 A;  4RUC A;  1L8L A;  3EUB 2;  4LEV A;  2Y1J A;  1OUQ A;  1NKB A;  4K4G A;  5EE3 A;  3HJ4 A;  4ED8 A;  3DEE A;  4M9J A;  4O3R A;  1SGG A;  1ZOL A;  3WK6 A;  4Y2J A;  2KSO A;  2ZIW B;  4I0U A;  2OXO A;  2W7P A;  4WCW A;  2BQ3 A;  4WQL A;  4PL1 A;  1NNL A;  1UEU A;  1FEZ A;  4B9L A;  2QAR B;  5ALD A;  3Q8S B;  1KL9 A;  3TAR A;  3BS7 A;  4IG8 A;  1ZQV A;  1JIH A;  2MUT A;  2NRV A;  3H8M A;  4KLT A;  2AJQ A;  4Z6D A;  5J0P A;  4G3I A;  2W11 A;  5AKI A;  4F5R A;  4CF5 A;  2YX8 A;  3EPI A;  2W3S A;  4M6W A;  4RWO A;  1PK1 A;  2LBO A;  7ICK A;  2FCL A;  4KLJ A;  7ICJ A;  1TK8 A;  3JPR A;  4DSE A;  4US8 A;  3G6X A;  2VJ4 A;  3KZX A;  4GIB A;  3MR3 A;  5DQG A;  3SD7 A;  2J6T A;  4NLB A;  3TI0 A;  3D2Q A;  3ICX A;  2Y1I A;  1XS9 D;  3T5H A;  8ICC A;  2C2D A;  3KKA A;  1N2X A;  2K89 A;  2OYY A;  2W54 A;  4RUA A;  3PMN A;  4Y2V A;  1JMS A;  3C21 A;  4IQV A;  2WTF A;  3N97 B;  2ZIW A;  3ZI4 A;  2E1E A;  3BQT A;  1DRG A;  3SZ2 A;  3BS5 A;  2HVH A;  4TUR A;  1OXJ A;  2QAR A;  1MN8 A;  3IM1 A;  4IRD A;  3TKA A;  2HBK A;  3H7I A;  3H8S A;  5AKK A;  1QH9 A;  8ICT A;  2JEF A;  5AI4 A;  4MFC A;  1L5U A;  2VAN A;  2BHN A;  3C2L A;  4DSJ A;  3M6Z A;  1ZQI A;  3PHZ A;  5KG0 A;  2B4V A;  3H8W A;  4GC6 A;  1X42 A;  4JMU A;  4FHV A;  1J2M A;  3C1Y A;  9ICT A;  4R63 A;  5AI8 A;  3GIK A;  1SL1 A;  2HHS A;  5J2F A;  3RAQ A;  1TFR A;  3CNH A;  2RP5 A;  5HRF A;  9ICQ A;  1V97 A;  4OD0 A;  1RZT A;  5HNK A;  1ZD4 A;  5KFQ A;  4C8M A;  4NXV A;  3WKD A;  4MKP A;  3NVZ A;  4NLK A;  3SAH A;  2XY6 A;  3WFO A;  4IQW A;  4WC7 A;  4R65 A;  4KLF A;  7ICG A;  3ONN A;  3IRU A;  2HHT A;  4EGW A;  3BQ7 A;  4C80 A;  2GWS A;  1FA0 A;  4X4T A;  2DPJ A;  2ZJ5 A;  1YLQ A;  2PFO A;  4PHP A;  4OAF A;  1L3V A;  3RR7 A;  3GIJ A;  4NKU A;  4BXO B;  2AGP A;  3WFS C;  5KFM A;  4X4S A;  2ZJ8 A;  3RJE A;  5DKW A;  3RTV A;  4X4Q A;  1CI4 A;  1JAJ A;  1B0X A;  3ZD9 A;  2KJ8 A;  4Y2P A;  3OSN A;  4FBT A;  5DG7 A;  4M47 A;  3HKZ F;  4JV2 A;  1RYU A;  2EAN A;  1RYS A;  2VIX A;  3H39 A;  5L1K A;  3RR8 A;  4JWM A;  3PW0 A;  1R8B A;  2KKV A;  2HN2 A;  1S97 A;  1KTQ A;  3PW5 A;  5B66 U;  1VLB A;  1UA1 A;  3KHG A;  1XSN A;  1X9X A;  3KTQ A;  1SIJ A;  3Q8Q B;  3WU2 U;  5KFO A;  1J97 A;  2W3R A;  2JV3 A;  1EXN A;  4YQW A;  5L1J A;  4F2S A;  4NXT A;  4PJ0 U;  5KT7 A;  1ZYQ A;  2WB1 C;  3H8J A;  5CFU A;  2JH7 A;  2WF9 A;  4EP7 A;  3TQ1 A;  1KFD A;  2O5A A;  4M0A A;  3IHQ B;  3MCR A;  1ZJN A;  4DCC A;  1ZQB A;  2KVC A;  1X9S A;  4BXO A;  3SQI A;  1UCV A;  1ZQQ A;  4DFK A;  2AGQ A;  5D4B A;  5DBB A;  4HYK A;  2O6K A;  4NXW A;  2B6G A;  1KNY A;  4EBD A;  2W9C B;  4J9Q A;  2LMR A;  3PZP A;  1ZRM A;  3NUQ A;  4J9N A;  5HP4 A;  3KFU F;  2H3V A;  2PXI A;  3AM9 A;  5F9N A;  4J03 A;  4BDP A;  4WC1 A;  1N48 A;  4TUS A;  4PZN A;  3D6J A;  2ZH7 A;  2ZHA A;  8ICR A;  5KFX A;  4EEY A;  2BCS A;  1K1Q A;  1LKY B;  2E1F A;  2ZH3 A;  1JXL A;  1BPZ A;  3QU2 A;  3ETL A;  4CF3 A;  4RQ1 A;  9ICF A;  3G6Y A;  4GC7 A;  2DFL A;  3GFK B;  3OHA A;  3RB6 A;  2JR5 A;  5ALH A;  1N60 A;  9ICO A;  2IHO A;  2QB1 A;  3QU9 A;  4M9H A;  2ID1 A;  2K8B B;  5HRG A;  1R8A A;  5KFG A;  4CF4 A;  1OU5 A;  5KFV A;  2PI5 A;  3C29 A;  7ICS A;  3N7R C;  3PSP A;  3T79 A;  3QU7 A;  2GOL A;  1WOT A;  1MA7 A;  5J0Y A;  5KG1 A;  4DL2 A;  4I2B A;  3RH6 A;  1KKX A;  3H38 A;  4YD1 A;  1UPH A;  4HX0 A;  2ZG6 A;  4EBK A;  4O0I A;  1L3U A;  2ISO A;  5KL1 B;  4O67 A;  3OVB A;  5CEH A;  4UBB A;  1BNP A;  3MGH A;  2I6X A;  5KT4 A;  4ED2 A;  2LI6 A;  2A1A A;  3K1R B;  4QWE A;  2MSN A;  2Q4T A;  4C7Z A;  7ICQ A;  4DL3 A;  2F2A B;  2JEI A;  4PGX A;  2CN1 A;  1JI7 A;  2A19 A;  4XUS A;  2Z7J A;  2H5X A;  4WOY A;  4B9V A;  1ZQ1 C;  5ALI A;  5ALX A;  5KFZ A;  1Z4N A;  1IXR A;  2I9G A;  1WWV A;  5KFA A;  2YB1 A;  4QWB A;  4NY8 A;  3JPN A;  8ICI A;  4ECS A;  2AH5 A;  3OJS A;  4F5P A;  5J0T A;  4IC9 A;  4ECU A;  2UVR A;  1C7Y A;  2HOF A;  5J8Y C;  1UT5 A;  3AQL A;  4M04 A;  4EYH B;  4FO6 A;  3HW8 A;  1SKR A;  4YXJ A;  4M9G A;  2BQU A;  3L9D A;  5AK3 A;  4Z6E A;  4O5K A;  3RRH A;  3OWG A;  4X4R A;  3KZI U;  1URJ A;  5KFU A;  4B9S A;  2G5I B;  2K4P A;  3SAG A;  1SZH A;  3B0Y A;  3S6J A;  3JYY A;  2ZH1 A;  2NRK A;  4C7Y A;  5HRL A;  1MC8 A;  1KDH A;  3UMC A;  2ZJA A;  1VFG A;  5CB1 A;  8ICZ A;  2DUY A;  1K1S A;  4F93 B;  2W7O A;  2A1J B;  4PHD A;  4EBC A;  1KN5 A;  2DVI A;  2F1J A;  5ALN A;  1NKE A;  5KFF A;  4F5Q A;  3C18 A;  2HHQ A;  4KLQ A;  3GQC A;  3GU3 A;  3OSP A;  1NO5 A;  1XSP A;  2YY6 A;  2XY5 A;  4X4U A;  2B51 A;  4FHW A;  1X66 A;  2W03 A;  4C4R A;  1P7D A;  2BCV A;  5AHX A;  4P0Q B;  8ICF A;  4C0Z A;  3IDW A;  4PHE A;  3F5E A;  2KIC A;  7ICF A;  3SI8 A;  1X6I A;  5D46 A;  3RB4 A;  4UD4 A;  4PGY A;  2F8L A;  2MA1 A;  3HRD D;  3M8S A;  3GV8 B;  2KK0 A;  8ICL A;  1KW4 A;  4K4H A;  4OAH A;  4UQG A;  1Z00 B;  4LEZ A;  3EYZ A;  4LJX A;  1S0M A;  4RPY A;  3V7L A;  4AT7 B;  4UAS A;  1Y88 A;  2CPR A;  4GFJ A;  2YN4 A;  1PVQ A;  2KZM A;  4P2H A;  4DL7 A;  3B9J A;  2BCR A;  5AK6 A;  4OJ5 A;  5ALE A;  5KG4 A;  1WYG A;  4FHX A;  5ALK A;  2JZB B;  5J0W A;  2KV2 A;  4UB3 A;  4ECV A;  2ESE A;  3AQM A;  1MIY A;  2K8C B;  2WF6 A;  4EZ9 A;  4F4Y A;  5J0O A;  1Z1V A;  4P4M A;  3D2N A;  5AK4 A;  2PMZ C;  3RF9 A;  4RQ5 A;  3L3F X;  4EEL A;  2JMG A;  1UET A;  3SR6 A;  9ICR A;  2HI0 A;  9ICL A;  3Q8M A;  4QWD A;  3I1Y A;  2KOB A;  2HHW A;  8ICM A;  4RZR A;  5T14 A;  1JRO A;  2XGP A;  2VA3 A;  4QJF B;  3IG8 A;  4Z6F A;  3WKE A;  2DRB A;  2WHE A;  4QZA A;  2P6U A;  4DFM A;  4DSI A;  4PHA A;  4MFF A;  4LT6 A;  3M7D A;  7ICM A;  5ALG A;  5J8Y A;  1ZQN A;  2FDR A;  3JCF A;  3HJE A;  1Z00 A;  2P6R A;  4Q8F A;  2YMM A;  4M9L A;  9ICJ A;  9ICA A;  3QYP A;  5AKX A;  4NJ8 A;  3RJI A;  4AT7 A;  1COK A;  4ED0 A;  3L5K A;  1NK5 A;  4RWQ A;  2HBL A;  4F4Z A;  3AL0 B;  2ZH9 A;  4X4P A;  2VA2 A;  4Q43 A;  3OGU A;  3JPT A;  3V7J A;  4BWJ A;  4I29 A;  3WKC A;  4XA5 A;  5L1M A;  2HOI A;  5BOM A;  4DL5 A;  3SEN A;  3KKA C;  2B56 A;  4MFA A;  3PV8 A;  2M2V A;  1JRP A;  5KFP A;  5ALS A;  1TFY A;  5CA7 A;  2KMD A;  2YQE A;  4U7C A;  4K96 A;  2R8H A;  5G5H A;  2EWR A;  4KB6 A;  4FS2 A;  3UPQ A;  1SXE A;  2KSO B;  4OJP A;  3PR5 B;  3OUY A;  5KAF U;  4C8N A;  1KFS A;  4OCZ A;  2MUT B;  3AN1 A;  5J0U A;  2IHM A;  4NL9 A;  2KZZ A;  1RM6 C;  1ZQL A;  1R8C A;  1S8O A;  3HIL A;  2E5S A;  3RJJ A;  4QIW F;  2RQ5 A;  4NLZ A;  4M5D A;  5J2K A;  2KHQ A;  2VJ5 A;  3Q8K A;  2RHF A;  1PK1 B;  4OJL A;  2R8J A;  4BJQ A;  5JU5 A;  4GXJ A;  3CP8 A;  1S77 D;  3H3A A;  2ZUC A;  3PSF A;  2E8P A;  2RRD A;  5CHE A;  5J0R A;  3HPO A;  5D62 A;  3IP4 B;  3CRX A;  2H3Q A;  8ICB A;  4DL6 A;  4KN4 A;  5ALQ A;  3JPS A;  4DLE A;  3K7D A;  3TAD A;  2CXY A;  1A76 A;  3BQ2 A;  3CW2 C;  4YR3 A;  2AXT U;  3BS5 B;  5AI0 A;  5KG5 A;  1HJP A;  5ALT A;  2NYV A;  5IIN A;  5AM4 A;  1T7P A;  4YN4 A;  3H0L B;  1SXD A;  4GXI A;  4RQ7 A;  2G06 A;  3F2C A;  4DFJ A;  4J9O A;  1VJ5 A;  4QZD A;  3TFS A;  1WWU A;  8ICG A;  3GII A;  5AKZ A;  2ZTE A;  2ZH4 A;  2JXJ A;  2LPE A;  4RQ3 A;  1TE2 A;  2C2R A;  1TFW A;  2KN7 A;  2W43 A;  4DQI A;  5TIS U;  4QZB A;  9ICB A;  2V4R A;  4QZ9 A;  5KNI A;  3V6K A;  5III A;  2ZH8 A;  5EE1 A;  1ZQA A;  2XID A;  4I2A A;  4JLX A;  1F5A A;  2KIW A;  4UAZ A;  4C8O A;  5F9L A;  5DG8 A;  5KFD A;  8ICY A;  4S3N A;  2Y9T A;  1Z3E B;  1KFT A;  4G9B A;  1MQ3 A;  1GO3 F;  4J9L A;  9ICU A;  9ICN A;  4I28 A;  1XNS A;  2YTU A;  5ALR A;  1V9P A;  2BQR A;  5KG2 A;  3RJK A;  2EAO A;  2ZIU B;  1BNO A;  5KFB A;  1ZRN A;  5C0Y A;  4YD2 A;  5AIA A;  2ZXH A;  3NS1 A;  1U4B A;  4M2Y A;  2HHP A;  1F0M A;  4QW8 A;  4F91 B;  1GPJ A;  3C28 A;  4WBZ A;  1X40 A;  4Y2X A;  4KLD A;  1A6S A;  2ASJ A;  3MDC A;  2BDU A;  2RLT A;  4C4T A;  4DSF A;  4DL4 A;  2IMW P;  3T5K A;  2DKZ A;  2VKQ A;  4ECT A;  2NRX A;  2LKY A;  4YP3 A;  5CFS A;  5AM2 A;  1V85 A;  4FFD A;  1CRX A;  1U49 A;  3AQE A;  1L7P A;  1SV0 A;  3SAF A;  1U48 A;  1NK8 A;  2IOF K;  2KKP A;  3MR2 A;  3RH5 A;  3IV6 A;  9ICG A;  2ODG A;  3UMG A;  3ORY A;  3LDA A;  2ZIU A;  1RDF A;  5CR0 A;  1D9F A;  2W9A A;  2BDP A;  3C23 A;  4F2R A;  4JK1 A;  4USA A;  2ZH2 A;  2PMZ F;  4NLN A;  3HIY A;  1MQ2 A;  1D8B A;  4ECX A;  3I28 A;  4Y2U A;  5KT5 A;  2KP7 A;  3Q8P B;  2FMP A;  1BPD A;  2F1H A;  2Y0S C;  3RH4 A;  2HBJ A;  2GLE A;  5EE9 A;  1NK7 A;  3MGI A;  4FBU A;  3I76 A;  2BBH A;  5AIB A;  4I2D A;  2P35 A;  1TAU A;  4ED1 A;  1PVP A;  3TAQ A;  4F71 A;  4DF8 A;  1F44 A;  2E8O A;  2XI9 A;  4N7R A;  2HVI A;  2IOH A;  4YR0 A;  5JTI A;  1YT3 A;  1RXV A;  2CRX A;  1BPX A;  5CJ7 A;  4RQ2 A;  5BOL A;  4EED A;  2HHX A;  1S10 A;  2K60 A;  5DEC A;  4X4V A;  2GO7 A;  4DFD A;  4PH5 A;  2MAX A;  4LEY A;  4KLI A;  4BGD A;  4YFK A;  1ZQC A;  7ICN A;  2L5Y A;  2ASL A;  1KRP A;  4O6A A;  1JAL A;  3QZ8 A;  1N5X A;  9ICI A;  3ED5 A;  4UB1 A;  1S5L U;  5ALF A;  3FM9 A;  1ZQE A;  3OHB A;  2BPG A;  4IR1 A;  1ZJM A;  1O03 A;  5IIJ A;  2AQ4 A;  1MSW D;  3PSI A;  3Q8R B;  4EYI B;  5L1I A;  5DB8 A;  5AKG A;  4K8V A;  2HN1 A;  4ATB B;  9ICK A;  4UAR A;  1AQ6 A;  2F8K A;  2AQ0 A;  3WK7 A;  2G08 A;  4PGQ A;  4RWP A;  4C8K A;  4DQQ A;  4DOB A;  2PFQ A;  3J81 j;  2P66 A;  2JRZ A;  3E58 A;  3ALR A;  2ZHB A;  3UXN A;  2KZ3 A;  4LVS A;  2OH2 A;  3AU2 A;  2HDO A;  2LYH A;  1QCK A;  3HP6 A;  1T94 A;  4Y2S A;  2ZXI A;  4DFP A;  1NJZ A;  4AYB C;  4F5O A;  3H40 A;  1X6J A;  3C5F A;  4YVZ A;  2M2U A;  3ISC A;  2XO7 A;  7ICT A;  3BZC A;  3N28 A;  3N7P D;  3IN5 A;  4FZM A;  4UB2 A;  4JB3 A;  3H4B A;  3U26 A;  5JTG A;  7ICR A;  3F2D A;  1SWW A;  4O5E A;  2C2E A;  4NM1 A;  2A3V A;  7ICI A;  2OM6 A;  3C5G A;  2W8K A;  2D6F C;  5HRH A;  4QNL A;  4O3N A;  3VCB A; 
#chains in the Genus database with same CATH homology
 2Y1J A;  1ZQO A;  4ATB A;  1NKB A;  4J9R A;  2UVU A;  2KZM A;  4K4G A;  4UBC A;  3ZDC A;  4DL7 A;  4I2E A;  4P2H A;  3HJ4 A;  5KFI A;  2BCR A;  1QSS A;  1MIW A;  2BGW A;  4ELU A;  4ED8 A;  1ZQM A;  4UD5 A;  2DPI A;  4M9J A;  4O3R A;  2HW3 A;  1XWL A;  5KG4 A;  3LWL A;  4IRK A;  3M9M B;  3MR5 A;  3KHH A;  1HUO A;  2FMS A;  2KFN A;  4E8F A;  1TK0 A;  4LZD A;  5CWR A;  1TKD A;  4F92 B;  3T5J A;  1D9D A;  4LZG A;  8ICH A;  4FHX A;  4WCW A;  2JZB B;  5J0W A;  4UB3 A;  4ECV A;  4MEY A;  2BQ3 A;  3PO5 A;  3AQM A;  4WC4 A;  4PPX A;  4B9L A;  1UEU A;  1MIY A;  4ECZ A;  3Q8S B;  4X0B A;  2BPF A;  4EZ9 A;  3TAR A;  4F4Y A;  5J0O A;  4P4M A;  4IG8 A;  4Q44 A;  1ZQV A;  1JIH A;  2MUT A;  2NRV A;  4KLT A;  2AJQ A;  4Z6D A;  4YCX A;  5J0P A;  1QSL A;  5KFH A;  4X0A A;  4G3I A;  3KHL A;  3WFP A;  4RQ5 A;  5KFS A;  1UET A;  3PY8 A;  9ICR A;  4KLO A;  4R8U A;  4F5R A;  1BPE A;  2M2W A;  9ICL A;  3Q8M A;  4QWD A;  2HHW A;  3WFQ E;  2J6U A;  5IIL A;  1NK9 A;  3EPI A;  8ICM A;  4M6W A;  4NKT A;  4RZR A;  4RWO A;  1ZQT A;  2NRT A;  2XGP A;  2VA3 A;  3JPP A;  5J2A A;  4Z6F A;  3EW9 A;  2DRB A;  4QZA A;  4YR2 A;  7ICK A;  2P6U A;  4DFM A;  4B9T A;  4PHA A;  5EWE A;  4DSI A;  4MFF A;  4ECQ A;  4KLJ A;  4LT6 A;  7ICJ A;  1TK8 A;  2BE3 A;  7ICM A;  1U9L A;  5J2I A;  8ICW A;  3JPR A;  4DSE A;  1UT8 A;  3HWT A;  9ICH A;  1ZQN A;  2JEG A;  4X4O A;  4O3Q A;  3G6X A;  3C2M A;  1Z00 A;  3FYH A;  4F50 A;  2P6R A;  1ZQK A;  4Q8F A;  4M9L A;  3RBE A;  9ICJ A;  3MR3 A;  9ICA A;  3RJF A;  5DQG A;  4RQ8 A;  3RJI A;  4AT7 A;  5DB6 A;  3RBD A;  2J6T A;  4I2G A;  1NOM A;  3TI0 A;  4ED0 A;  2Y1I A;  1NK5 A;  5D49 A;  2W9B A;  3Q8L A;  5DLF A;  2O1P A;  4RWQ A;  2AU0 A;  1B43 A;  4NXZ A;  4F4Z A;  3T3F A;  2AGO A;  1D8Y A;  5J29 A;  4X4P A;  2ASD A;  1XS9 D;  2VA2 A;  4NM2 A;  4Q43 A;  3OGU A;  3JPT A;  3V7J A;  4BWJ A;  3T5H A;  4I29 A;  8ICC A;  1U47 A;  3BQ0 A;  4XA5 A;  2C2D A;  2I1Q A;  2JEJ A;  2M2T A;  5BOM A;  4DL5 A;  5KFW A;  3ZD8 A;  1ZQY A;  4RUA A;  3PMN A;  4MFA A;  3PV8 A;  2M2V A;  1JMS A;  3C21 A;  4IQV A;  2WTF A;  3N97 B;  2NRW A;  2M2U A;  2FPM A;  4R64 A;  1JN3 A;  5KFP A;  3BQT A;  7ICH A;  3SZ2 A;  1TFY A;  3ZDB A;  5CA7 A;  2HVH A;  4TUR A;  3T5L A;  8ICU A;  5DBA A;  5KG7 A;  3C2K A;  2R8H A;  3WFR E;  4FS2 A;  3UPQ A;  4B9M A;  4E7X A;  3IM1 A;  5IIO A;  4MF8 A;  3PR5 B;  4IRD A;  2FLN A;  8ICO A;  3OUY A;  3H7I A;  3H8S A;  1TAQ A;  5DB7 A;  5KG3 A;  4DOA A;  2UVV A;  4RT2 A;  8ICT A;  4C8N A;  1KFS A;  2JEF A;  4JWN A;  4MFC A;  5HRK A;  1L5U A;  3OJU A;  5J0U A;  2MUT B;  2BHN A;  1DOQ A;  2VAN A;  3LWM A;  3M8R A;  4ELV A;  1PX5 A;  3UPS A;  3NTU A;  1S76 D;  3C2L A;  4DSJ A;  1ZQI A;  2IHM A;  1QTM A;  5KG0 A;  2W8L A;  2KZZ A;  4I2C A;  3H8W A;  3ZDE A;  4GC6 A;  1ZQL A;  1R8C A;  3RAX A;  4O3P A;  3MDA A;  3C1Y A;  4R8U B;  1ZQU A;  3RJJ A;  8ICX A;  9ICT A;  4R63 A;  4FHV A;  3HX0 A;  3GIK A;  1SL1 A;  4M9N A;  4NLZ A;  5J2K A;  4M5D A;  3QEB Z;  2HHS A;  2J6S A;  5J2F A;  3RJH A;  2FMQ A;  1RYR A;  3Q8K A;  3RAQ A;  1TFR A;  4ZH4 A;  4B9U A;  5HRF A;  9ICQ A;  2R8J A;  1RZT A;  5HNK A;  4ED7 A;  4KTQ A;  3ISD A;  4TQR A;  4GXJ A;  5HR9 A;  5KFQ A;  4O9M A;  1XO1 A;  2C28 A;  3EWA A;  4C8M A;  9ICS A;  2R8K A;  4DQP A;  1S77 D;  1NKC A;  1DK3 A;  4WBY A;  4NLK A;  2ZH6 A;  3H3A A;  4FH3 A;  2ZUC A;  4JV1 A;  2XY6 A;  3SV4 A;  3WFO A;  5J0Q A;  4IQW A;  5J0X A;  1TK5 A;  3V6H A;  4WC7 A;  5J0R A;  5J2E A;  3ZDD A;  3HPO A;  3GDX A;  4R65 A;  2DRA A;  4KLF A;  3AU6 A;  7ICG A;  2DR5 A;  8ICB A;  5HRD A;  4DEZ A;  5DB9 A;  4DL6 A;  2HHT A;  4DS5 A;  4KN4 A;  3PX4 A;  2ZUD A;  3JPS A;  1S0N A;  5JUM A;  2GWS A;  1QLN A;  1Q78 A;  4UB4 A;  4DLE A;  3QZ7 A;  1FA0 A;  4X4T A;  5KFY A;  2DPJ A;  2ZJ5 A;  1ZQS A;  2PFO A;  4PHP A;  4ELT A;  1TV9 A;  1QSY A;  4KLL A;  2RDJ A;  1YLQ A;  2DR8 A;  2RDI A;  1L3V A;  1A76 A;  3BQ2 A;  3BJY A;  2PBE A;  4YR3 A;  4X4N A;  4YMM A;  3LQC B;  3RR7 A;  5HHH A;  5KG5 A;  1HJP A;  3GIJ A;  5IIN A;  4KN7 A;  4WC6 A;  4NKU A;  3EZ5 A;  4BXO B;  2NRZ A;  2R8I A;  3UXP A;  2AGP A;  1T7P A;  4RPX A;  5HRB A;  4YN4 A;  3WFS C;  5DGB A;  2W9C A;  5KFM A;  4GXI A;  4E0D A;  1UEV A;  4X4S A;  4XQ8 A;  2ZJ8 A;  3RJE A;  5DKW A;  3OUY B;  3RTV A;  4YXM A;  2PI4 A;  8ICV A;  3THV A;  4X4Q A;  4RQ7 A;  1JAJ A;  8ICN A;  3ZD9 A;  5IIM A;  4DFJ A;  7ICV A;  3OSN A;  5KFT A;  4FBT A;  4J9O A;  2B21 A;  4QZD A;  5DG9 A;  3TFS A;  5DG7 A;  4M47 A;  8ICG A;  4F5N A;  4JV2 A;  9ICP A;  2BR0 A;  4Z6C A;  3TAN A;  4J9K A;  1NJX A;  1ZQW A;  1RYS A;  3GII A;  4RNN A;  4YG2 A;  3H39 A;  1X9M A;  5L1K A;  3RR8 A;  3N4M B;  4JWM A;  3PW0 A;  1R8B A;  1V4A A;  4F8R A;  2ZTE A;  2ZH4 A;  1S97 A;  1KTQ A;  1A77 A;  1KLN A;  1KEJ A;  4RQ3 A;  4EBE A;  3PW5 A;  4XQ7 A;  4NLG A;  3JPO A;  3PX6 A;  2C2R A;  2KN7 A;  1UA1 A;  1JX4 A;  3KHG A;  1XSN A;  8ICE A;  1TFW A;  3KTQ A;  4DQI A;  5CHG A;  4QZB A;  9ICB A;  2V4R A;  4O3O A;  4QZ9 A;  4QZC A;  1SZP A;  3MFH A;  1U45 A;  2C22 A;  3SV3 A;  3GIL A;  3Q8Q B;  3V6K A;  5KFO A;  5III A;  5TZV A;  1EXN A;  5L9X A;  4YQW A;  5L1J A;  4F2S A;  5KT7 A;  2ZH8 A;  3ISB A;  3MBY A;  1ZQA A;  1ZYQ A;  1SKS A;  4I2A A;  1F5A A;  3JPQ A;  4DSL A;  4UAZ A;  4C8O A;  5F9L A;  3V72 A;  4IR9 A;  5J0S A;  3H8J A;  5C5J A;  5KFD A;  5DG8 A;  8ICY A;  4S3N A;  1N56 A;  1Z3E B;  5DQH A;  1ZQR A;  1KFT A;  1MQ3 A;  4WC3 A;  4EP7 A;  1SL2 A;  3TQ1 A;  1ARO P;  4J9L A;  1KFD A;  2O5A A;  9ICU A;  5HML A;  1RXW A;  9ICN A;  2FPL A;  4M0A A;  2ZTD A;  4DO9 A;  4DS4 A;  4WC2 A;  5KFL A;  4I28 A;  4FH5 A;  1BPY A;  3PW7 A;  3IHQ B;  1ZJN A;  4KLG A;  1V9P A;  4UB5 A;  2BQR A;  4QZ8 A;  1ZQB A;  5KG2 A;  5KTQ A;  4JUZ A;  3RB0 A;  3RJK A;  1X9S A;  4BXO A;  4KLU A;  5DDM A;  5KFB A;  3E2E A;  1BNO A;  4J9S A;  3PVX A;  1ZQF A;  1ZQQ A;  5KT6 A;  4YD2 A;  4DLG A;  1NZP A;  4DFK A;  1U4B A;  4M2Y A;  2AGQ A;  5D4B A;  4QW8 A;  5DBB A;  2HHP A;  4F91 B;  4ECR A;  4HYK A;  3LK9 A;  1WCL A;  3UXO A;  4EBD A;  2W9C B;  4J9Q A;  1DK2 A;  4F3O A;  1KNY A;  1Q79 A;  3RRG A;  4WBZ A;  3NYB A;  4KLD A;  4X5V A;  4J9N A;  5HP4 A;  1SL0 A;  7ICO A;  1RPL A;  2ASJ A;  8ICS A;  2KFZ A;  2PXI A;  3MDC A;  1B22 A;  3B0X A;  5DGA A;  5KFJ A;  4QZH A;  3BDP A;  4QZI A;  9ICE A;  4I2I A;  5KFR A;  1DGS A;  3PNC A;  1XU4 A;  2M9N A;  4RQ4 A;  4P4O A;  4DSF A;  4MEX A;  5DED A;  4J9P A;  5F9N A;  4BDP A;  4AT9 B;  1VJ7 A;  4DL4 A;  2IMW P;  2ZH5 A;  4WC1 A;  3T5K A;  1N48 A;  3TAP A;  4TUS A;  1NJY A;  4ECT A;  7ICL A;  2ZH7 A;  2ZHA A;  1H38 A;  5KFE A;  2NRX A;  2HHU A;  9ICX A;  4QW9 A;  2XGQ A;  1BPB A;  2V9W A;  4YP3 A;  7ICE A;  4RT3 A;  8ICR A;  5KFX A;  5BPC A;  4R66 A;  4EEY A;  2BCS A;  2ZH1 A;  5HRI A;  1U49 A;  5KT2 A;  4DQS A;  5KFN A;  2W9M A;  4FHP A;  3K75 D;  1K1Q A;  1U48 A;  2ZH3 A;  1L3T A;  1JXL A;  4QZE A;  1NK8 A;  1BPZ A;  5DLG A;  3MR2 A;  3RH5 A;  4RNO A;  3ETL A;  4RQ1 A;  9ICF A;  9ICG A;  4DWI A;  2IA6 A;  2Q66 A;  3G6Y A;  1PZN A;  1S0O A;  4DSK A;  4GC7 A;  2HHV A;  2PFP A;  2DFL A;  4DF4 A;  3GFK B;  3OHA A;  3ORY A;  4RU9 A;  3LDA A;  2XCA A;  4RWN A;  4EZ6 A;  5J2D A;  3RB6 A;  2FLP A;  3V7K A;  1HUZ A;  9ICO A;  5CR0 A;  1ZQD A;  3AQN A;  4M9H A;  2ID1 A;  4UAY A;  1D9F A;  2W9A A;  5HRG A;  4E80 A;  2BDP A;  3C23 A;  1R8A A;  5KFG A;  4F2R A;  1OU5 A;  5KFV A;  3C1Z A;  3K4G A;  3SYZ A;  2R8G A;  2PI5 A;  4I27 A;  4JK1 A;  5EOZ A;  3UQ0 A;  2ZH2 A;  7ICS A;  4JV0 A;  2IHN A;  3RJG A;  4NLN A;  3MAB A;  4RPZ A;  3HIY A;  4WC0 A;  2XY7 A;  1MQ2 A;  1WOT A;  5J0Y A;  1COO A;  2ALZ A;  3AQK A;  5J2J A;  5KG1 A;  3PX0 A;  4DL2 A;  4IQT A;  4ECX A;  3RH6 A;  4I2B A;  8ICQ A;  3H38 A;  5KT5 A;  4YD1 A;  5KFK A;  3Q8P B;  2FMP A;  1ZQJ A;  3V6J A;  2KP7 A;  1BPD A;  2F1H A;  5EWG A;  2OWO A;  4O0I A;  1TAU A;  3RH4 A;  1L3U A;  4EBK A;  1SKW A;  1NK7 A;  3MGI A;  3JZ0 A;  2A1J A;  2ISO A;  4FBU A;  3PML A;  3GV5 B;  8ICK A;  3H4D A;  9ICC A;  3OVB A;  3QEA Z;  4I2D A;  1X2I A;  4UBB A;  1NJW A;  3G6V A;  1NK6 A;  3MGH A;  5L1L A;  4ED1 A;  3ZDA A;  4BWM A;  2BCU A;  1BNP A;  5KT4 A;  3MFI A;  4ED2 A;  4AT9 A;  1IM4 A;  5DQI A;  3KHR A;  4QWE A;  2ZH9 A;  3TAQ A;  1T4G A;  4ED3 A;  1TVA A;  7ICQ A;  4DF8 A;  4DL3 A;  4I2F A;  5HRE A;  3UQ2 A;  2JEI A;  4PGX A;  4F4X A;  2KTQ A;  2HVI A;  3H37 A;  4YR0 A;  1RXV A;  4XUS A;  1BPX A;  2H5X A;  4O3S A;  5CJ7 A;  1L3S A;  2F1I A;  4KIT B;  4RQ2 A;  4KLH A;  4ECW A;  4B9V A;  5BOL A;  4O5C A;  5KFZ A;  1S10 A;  2HHX A;  4IQU A;  9ICV A;  1IXR A;  4F4K A;  4MF2 A;  8ICP A;  5DEC A;  2ZTC A;  2I9G A;  3QE9 Y;  4X4V A;  5KFA A;  2FPK A;  4QWB A;  4NY8 A;  3JPN A;  4TUP A;  4PH5 A;  2MAX A;  8ICI A;  3NGD A;  4RQ0 A;  4ECS A;  4KLI A;  4BGD A;  4YFK A;  4XRH A;  1ZQC A;  1XSL A;  3OJS A;  7ICN A;  4DOC A;  4F5P A;  5J0T A;  1KRP A;  2ASL A;  4ECU A;  4ECY A;  2UVR A;  3PW4 A;  1C7Y A;  4EBJ A;  2ATL A;  4F4W A;  3QZ8 A;  1UT5 A;  9ICI A;  3AQL A;  4M04 A;  4J9M A;  4EYH B;  4FO6 A;  1BVS A;  4UB1 A;  5J2C A;  3HW8 A;  9ICM A;  4I2J A;  1SKR A;  4YXJ A;  4IRC A;  1ZQE A;  3OHB A;  3GIM A;  1ZQZ A;  4M9G A;  2BQU A;  3L9D A;  2BPG A;  2FLL A;  4Z6E A;  4O5K A;  1WCN A;  4IR1 A;  3M9N B;  4AT8 B;  2ISP A;  4KLS A;  1ZJM A;  5IIJ A;  3RRH A;  4ED6 A;  2AQ4 A;  4X4R A;  1ZET A;  4TQS A;  5KFU A;  4YMN A;  2VA8 A;  3Q8R B;  4B9S A;  4C8L A;  1S0V A;  1MSW D;  5F2V O;  1MIV A;  5HHI A;  4EYI B;  2DR7 A;  3BQ1 A;  5DDY A;  3B0Y A;  5HMM A;  5DB8 A;  2ZUB A;  3MR6 A;  3EPG A;  5L1I A;  3C66 A;  8ICA A;  3HJ1 A;  1LB2 B;  2NRK A;  5HRL A;  3JYY A;  4ATB B;  1MC8 A;  1KDH A;  9ICK A;  2ZJA A;  1ZQP A;  1VFG A;  2AQ0 A;  5CB1 A;  3TFR A;  8ICZ A;  2JZB A;  1K1S A;  4F93 B;  2DR9 A;  4PGQ A;  5IIK A;  4B9N A;  4RWP A;  4KLM A;  2A1J B;  4FS1 A;  1UA0 A;  1CEZ A;  4C8K A;  4DQQ A;  4PHD A;  5J2B A;  4DOB A;  4EBC A;  2PFQ A;  3PO4 A;  2DVI A;  2F1J A;  3HT3 A;  7ICP A;  5CP2 A;  1NKE A;  2P66 A;  5HC9 A;  5EWF A;  5KFF A;  4F5Q A;  3C18 A;  2XCP A;  2HHQ A;  5KT3 A;  4KLQ A;  2V4Q A;  3GQC A;  3OSP A;  2PFN A;  1CUK A;  1NK4 A;  2BKE A;  1ZQX A;  1XSP A;  1NO5 A;  2ZHB A;  3UXN A;  1JQR A;  3PW2 A;  3OVA A;  2KZ3 A;  1T8E A;  4I2H A;  4P4P A;  2XY5 A;  4LVS A;  5J2G A;  9ICW A;  4X4U A;  4FHW A;  3AU2 A;  1ZQG A;  5J2H A;  2BCV A;  2LYH A;  2BPC A;  4WC5 A;  3HP6 A;  4DFP A;  1KSP A;  1NJZ A;  1T3N A;  5DBC A;  3M9O B;  4F5O A;  8ICJ A;  4FHY A;  4Q8E A;  3H40 A;  8ICF A;  3C5F A;  4QZG A;  3OVS A;  2UVW A;  4YVZ A;  1D8L A;  4RNM A;  4M6W B;  4PHE A;  4QWA A;  1JXE A;  3PR4 A;  3ISC A;  3RB3 A;  7ICU A;  2XO7 A;  2BCQ A;  7ICF A;  3SI8 A;  5D46 A;  3RB4 A;  7ICT A;  4TUQ A;  4UD4 A;  4PGY A;  4GXK A;  2RFF A;  4K4I A;  1BGX T;  3M8S A;  3GV7 B;  4KLE A;  5KG6 A;  4Q45 A;  4QWC A;  3GV8 B;  2IBK A;  1S9F A;  1R89 A;  4UB2 A;  1NK0 A;  1ZQH A;  4DQR A;  3H4B A;  8ICL A;  4K4H A;  7ICR A;  4UQG A;  1Z00 B;  4AT8 A;  4UAW A;  1XC9 A;  4O5E A;  2C2E A;  1LV5 A;  4GLX A;  3EYZ A;  4NM1 A;  4QZF A;  3FDS A;  1X9W A;  4YMO A;  1S0M A;  4RPY A;  3V7L A;  3C5G A;  7ICI A;  4AT7 B;  1Y88 A;  3OV7 A;  2XC9 A;  2W8K A;  3AUO A;  5KFC A;  4KMU A;  2Q0Z X;  4RQ6 A;  2W9B B;  4RUC A;  5HRH A;  4CCH A;  4O3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...