4PGYA

Structure of human dna polymerase beta complexed with a nicked dna containing a gt at n-1 position and gc at n position
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The spontaneous base substitution mechanisms of human DNA polymerase beta
rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pgyA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pgyA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pgyA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pgyA03
4DL5A 3BQ2A 4J9MA 4KN4A 1X9WA 3OV7A 5DB9A 4F8RA 4I28A 8ICNA 2JZBB 2ZH6A 1ZQWA 1A76A 4DOBA 3AQNA 3M8RA 3ISCA 3UQ0A 3GV8B 2BQRA 2ZJAA 1BPYA 1ZJMA 1ZQDA 2VA3A 1OU5A 3AQKA 1ZQBA 4EBJA 4QZGA 4YP3A 4WC2A 2C2RA 3FYHA 2KFZA 3OVSA 5J2KA 4M0AA 8ICPA 5EOZA 1XS9D 2BCRA 1NK4A 9ICSA 3H37A 1UA1A 1JXEA 3ZD8A 4RQ6A 1XSNA 2ALZA 4GLXA 3HW8A 4DFJA 4DQPA 2KFNA 4QWAA 4UB5A 2V9WA 2M2TA 1HJPA 1DK3A 1ZQGA 4X4PA 4IG8A 5BPCA 4KLHA 2J6SA 5HMMA 2UVVA 3KHRA 1NKBA 2XY6A 1TK8A 3PO4A 4NM2A 4YMNA 5KT4A 3PW4A 1U49A 2W9CA 2PXIA 4DLGA 8ICOA 4YR2A 1N56A 4FBUA 4O5KA 2MAXA 4RPXA 3HP6A 3Q8LA 2A1JA 7ICMA 3LWMA 4KTQA 4C8NA 5DDMA 4UB2A 5CHGA 4S3NA 1U9LA 3V7KA 1ZQSA 2AGQA 9ICWA 4RQ7A 4F2SA 5DECA 4DOCA 2IMWP 1TK0A 2KN7A 4AT8B 4CCHA 3ZDEA 3MBYA 4J9SA 1BPEA 4K4IA 4Q8EA 8ICQA 9ICOA 3MR6A 2JEIA 4O3RA 4RPZA 2VANA 4EYIB 4ECVA 4DFPA 1N48A 4B9NA 5CA7A 4F92B 4NLKA 2BQ3A 5DBAA 2BPGA 4O5CA 2NRZA 3WFOA 2ZHAA 2HHTA 2DRAA 1TFYA 4YQWA 4DL6A 1TV9A 4M9NA 2XGPA 2V4QA 1ZQTA 3MR2A 9ICIA 3UPSA 1JIHA 4RQ0A 3PR4A 4DSFA 5IIIA 4X4OA 1JAJA 4RT2A 2BPFA 3E2EA 2HVHA 5DB6A 5BOLA 5KFFA 3WFPA 5IINA 3UXPA 3V7LA 5J2JA 4ELUA 5KFNA 2I9GA 8ICRA 2C2DA 1KLNA 4B9LA 5HRHA 4JWMA 1XU4A 3C23A 4PHEA 3ISDA 1ZQRA 5KG2A 1KEJA 4O3PA 5KG4A 1T4GA 2BCUA 4FHPA 2PFNA 3MGHA 9ICHA 4RNMA 4KLDA 4YXMA 5F9LA 4TQSA 3HPOA 1X9SA 5KG5A 3AUOA 4DL7A 3TAQA 4X5VA 2BDPA 4KLIA 1Z00A 4ECWA 2IBKA 3EYZA 4R8UB 3PO5A 4AT7B 4DWIA 3RAXA 3N4MB 8ICGA 4JUZA 2HW3A 4YXJA 3PVXA 2IHMA 3RR8A 1RXVA 4FHYA 3RJGA 3T5KA 3PW7A 2FPLA 4DSIA 4M9GA 3ISBA 1NJYA 3TQ1A 2AGOA 4B9MA 4ED3A 4PGQA 4MF2A 1ZQUA 3GIIA 5DDYA 2P66A 3ZDDA 2Q66A 4ED1A 4O9MA 7ICRA 2ZUBA 4QZDA 1ZQEA 5KFUA 5DB8A 2ASLA 4C8KA 4X0AA 2B21A 3Q8RB 4P4OA 3MR3A 3JPOA 4ED7A 4EBDA 4QWCA 4J9QA 3H4BA 4NY8A 2ZUCA 2DR9A 2ISOA 4AT9B 4QWBA 3K75D 4ECRA 4XRHA 1S10A 1Q78A 2XCPA 4I2BA 8ICBA 9ICBA 1WOTA 2BCQA 1R8CA 3RBEA 3LK9A 2PFPA 4LT6A 4ATBA 5J2FA 4RWPA 4TUQA 1NJWA 2FPKA 4KLQA 5KFSA 4B9TA 1UEUA 4HYKA 4IRKA 4IQTA 2RDIA 4WCWA 8ICEA 5KFDA 1T3NA 4KMUA 4TUSA 1TFWA 5KFAA 2R8JA 2KTQA 8ICXA 1QLNA 4I2HA 3OVAA 4F3OA 2ID1A 2R8HA 1XC9A 3SZ2A 5KT5A 1L3TA 9ICXA 1KNYA 1U48A 4DL3A 1VJ7A 3ZDAA 5L9XA 4ECQA 3PW2A 5KG0A 1UETA 5DB7A 1XSPA 4DFMA 2LYHA 1TVAA 3OJSA 2WTFA 4EZ9A 5KFPA 4X4SA 1V4AA 5J2IA 1SL1A 3WFQE 1A77A 5DEDA 4JV0A 1LB2B 2NRWA 5HRFA 4BWJA 4I2DA 3V6HA 4UAWA 3RH5A 3RH4A 2ZTCA 3NGDA 3ETLA 8ICIA 2O5AA 4FHXA 2DRBA 1L3UA 5KFHA 2ZH1A 4ELVA 1NKEA 1ZQHA 3UPQA 2ZH3A 4ECTA 2FLLA 1RPLA 9ICNA 4M6WA 1ZQYA 1FA0A 4E7XA 5HMLA 3KHHA 5J0YA 4DO9A 2Y1IA 2AU0A 5IILA 2J6UA 8ICYA 4XQ7A 4FHWA 3EZ5A 5J0PA 3Q8QB 4X4UA 1TKDA 2KP7A 4TUPA 4P4PA 3UQ2A 3OUYB 4FS1A 2F1HA 2AQ0A 2DPJA 1ZQZA 4EBCA 2PI5A 2HHVA 3C66A 5J2EA 3H39A 3EPIA 1BGXT 2W8LA 1YLQA 3Q8SB 3KHGA 4F4ZA 4RNNA 1S0NA 2FMPA 3V6JA 3GIMA 5J2CA 1BNOA 1ZQMA 5KFLA 5CR0A 4NLZA 9ICPA 3PR5B 2P6RA 5DGAA 3NYBA 1T8EA 3QEAZ 1C7YA 3K4GA 4QW9A 3IHQB 4FS2A 5DG9A 1K1QA 3BDPA 1X2IA 2NRVA 5J2BA 4DSEA 3BQ1A 4DL2A 4EEYA 4KN7A 4I2CA 4YN4A 2ZJ5A 4M04A 4QZHA 2HHSA 7ICUA 2PFOA 4B9VA 5KT2A 5IIOA 1D9DA 3IM1A 4LVSA 2C22A 1SKRA 1JX4A 1PZNA 2BCSA 4DQIA 3PX6A 5HRDA 4Z6CA 4RT3A 4BXOB 1S77D 9ICQA 1L3VA 5F9NA 5C5JA 3G6VA 4F4XA 1ZJNA 2NRXA 3OJUA 1JMSA 5L1KA 1ZQFA 4C8OA 4DQRA 8ICWA 2HHUA 4ED8A 4B9UA 4F93B 2XGQA 3OHBA 1MIYA 2ZH7A 2DVIA 4DF8A 5DGBA 1L3SA 1ZETA 3LQCB 9ICJA 3EW9A 4O5EA 5KFZA 1S0OA 1UT8A 4JK1A 5J0QA 5BOMA 3GQCA 3EPGA 2AQ4A 4KLJA 1S0VA 1ZQPA 4XUSA 4PGXA 5KT7A 3PW0A 3RTVA 3M9OB 2BCVA 7ICJA 5DQIA 5KG3A 1ZQQA 4J9LA 4RNOA 4ELTA 4WC3A 5KFRA 1NK8A 7ICFA 4I2FA 9ICLA 4RWOA 3C21A 4QZIA 1BVSA 1QSYA 1IM4A 4UD4A 4RQ4A 4NKUA 4KLEA 2UVRA 3MFHA 2BHNA 4PHPA 3RJEA 2PBEA 4K4GA 4BGDA 4Q45A 1XO1A 4XA5A 1NJZA 4GXJA 4ECYA 3AQLA 4F91B 2ZH9A 8ICVA 2R8IA 4R65A 4F5OA 4K4HA 5HR9A 8ICJA 1MIVA 5KG7A 4UAZA 4YD2A 4RZRA 3JZ0A 4R66A 3C5GA 4AT9A 4C8LA 4I2GA 4EBEA 3C2KA 4IQUA 4MFFA 4X0BA 3PNCA 4X4RA 4P2HA 1JXLA 3AU2A 2DPIA 4KLGA 2DR7A 4JV1A 7ICOA 4ZH4A 3OGUA 5D4BA 1MQ3A 1D8LA 4JV2A 4LZGA 3OHAA 2A1JB 4PHAA 4YCXA 3HWTA 1BPDA 2BGWA 1SKWA 4M5DA 4RWQA 4O3NA 4IQWA 3SV4A 1NJXA 1JQRA 5KFGA 5J0WA 4F5NA 4LZDA 3RRHA 3RB6A 3B0YA 5KFVA 2W9BA 4KLFA 3ZDBA 1KFDA 4GC7A 1Z3EB 1PX5A 1TK5A 3TANA 9ICGA 4ECSA 4FH3A 3ORYA 3LWLA 5KFCA 3SI8A 1QTMA 1ZQIA 7ICLA 1NK9A 4QZEA 4RU9A 1EXNA 2JEFA 4IRCA 4X4TA 4FHVA 1VFGA 4O3QA 4TQRA 4RQ2A 5KG1A 1MQ2A 4IR1A 7ICVA 1U47A 9ICMA 3C2LA 2ZJ8A 1S97A 2FPMA 3GILA 3H38A 4I29A 3TI0A 1SL0A 4ECUA 4ED6A 4QZ9A 3SYZA 2BR0A 2PFQA 3H8JA 3RH6A 2C2EA 3GIKA 1R89A 1WCNA 2H5XA 2P6UA 3C1YA 2JZBA 8ICFA 1ZQNA 2ZH4A 5KFIA 5CB1A 1B43A 4KITB 1ZYQA 5HHHA 3C2MA 2ISPA 7ICPA 4EYHB 9ICKA 8ICAA 4UB3A 3JPTA 2MUTB 4JWNA 5J0SA 4DQQA 1MSWD 2O1PA 1X9MA 1S0MA 4WBZA 4KLTA 1Z00B 3OUYA 3NTUA 4IQVA 1ZQAA 4FH5A 1DOQA 4WBYA 1JN3A 2DR5A 2VA8A 2KZ3A 2Y1JA 9ICVA 3JPPA 4DQSA 2F1IA 4ECXA 2F1JA 2JEJA 3RJIA 1BPXA 1D9FA 4QZAA 5JUMA 4RUCA 3OSPA 3PMLA 3FDSA 1LV5A 4UB1A 4I2IA 4BWMA 1ZQXA 1K1SA 4YG2A 3OVBA 2HVIA 4NLGA 5J0UA 3BQTA 5HRLA 2Q0ZX 2FMQA 2AGPA 5KFTA 3RRGA 8ICUA 1NK7A 4M9JA 3UXOA 3JPSA 5KFEA 4E0DA 2W9AA 4AT8A 4UBBA 3G6YA 3HJ4A 5DBBA 2ATLA 9ICTA 4DLEA 1S76D 7ICQA 4NKTA 5F2VO 4F5RA 2XCAA 5J0RA 3BJYA 4IRDA 1CEZA 5KT3A 3KTQA 1RYSA 4I27A 3T5JA 4F2RA 3QZ7A 4DSJA 4Z6FA 1XWLA 4O0IA 1ZQKA 3H3AA 3EWAA 3GV5B 4YMOA 2FLPA 4NXZA 3TAPA 8ICMA 4KLMA 5KFOA 5J29A 4DFKA 3RBDA 4YD1A 5D46A 3V72A 2ZH5A 4F5PA 5TZVA 3PV8A 5KFMA 4KLUA 1R8AA 3HIYA 4DSLA 4R64A 2XO7A 3TFRA 2XY7A 3JPNA 3LDAA 2V4RA 8ICKA 5HC9A 3QEBZ 3PY8A 4EBKA 3RJKA 3MDCA 2XY5A 3V6KA 2KZZA 9ICRA 4QZFA 3MFIA 3QE9Y 1NO5A 4WC4A 3MDAA 3MABA 3RR7A 4AT7A 5DBCA 4R8UA 4ED0A 2GWSA 1F5AA 4F4YA 5DLGA 4DSKA 4WC5A 2M2UA 2BE3A 2FLNA 3RB3A 4KLSA 8ICZA 4M6WB 2RDJA 1TAQA 5HHIA 5D49A 4C8MA 3QZ8A 3RJFA 2M2WA 3WFSC 3RB4A 4UB4A 2M9NA 3RJJA 4DOAA 3GIJA 5J2AA 7ICTA 4E8FA 4EP7A 1XSLA 1U4BA 3RJHA 8ICHA 8ICSA 4DEZA 5J0XA 2W8KA 5IIMA 4FO6A 1BPBA 1COOA 4RPYA 4UBCA 1Q79A 9ICEA 4MFAA 1CUKA 3HJ1A 3ZD9A 1RZTA 1Y88A 2ZTEA 4YMMA 5HRKA 5HRBA 1AROP 2M2VA 3Q8MA 3M9MB 2PI4A 5HP4A 1KFTA 4F4WA 4BDPA 1U45A 2XC9A 1L5UA 4I2EA 2UVWA 2HHXA 4Q44A 4ECZA 8ICTA 4J9NA 4NM1A 5KFWA 1RYRA 5L1IA 4PGYA 5KFJA 4Z6EA 4QZCA 3GFKB 4MF8A 4EZ6A 4PH5A 3T5HA 4KLLA 2W9CB 2HHPA 3L9DA 5KT6A 3H4DA 4YR3A 1QSLA 3C18A 5KFKA 4YFKA 2BQUA 3JPRA 3KHLA 3MR5A 4O3OA 1SL2A 2IA6A 9ICFA 1TFRA 5DLFA 1UT5A 4RQ3A 2W9MA 2ASDA 2JEGA 7ICSA 1SKSA 4IR9A 5IIKA 7ICEA 4E80A 3PMNA 4J9RA 5KFYA 3N97B 7ICHA 5EWGA 4QZ8A 4RUAA 3H40A 1B22A 2RFFA 4QZBA 2MUTA 4YVZA 3C5FA 2UVUA 1R8BA 4I2AA 3V7JA 4J9KA 4GXKA 2C28A 8ICLA 9ICAA 4RWNA 4X4VA 2R8KA 9ICCA 1UEVA 2DR8A 2ZTDA 5KFQA 3RAQA 2ZH8A 4M2YA 3TARA 4F5QA 4DF4A 3HX0A 4ATBB 3TFSA 1ZQOA 5J0TA 2NRKA 1WCLA 3SV3A 4ED2A 2ZH2A 3UXNA 4R63A 1HUOA 5HNKA 3OSNA 2IHNA 5J2DA 3M9NB 5CJ7A 3Q8PB 1NK5A 4MFCA 7ICIA 3MGIA 5L1LA 3HT3A 2ASJA 1T7PA 5HREA 3H8SA 3G6XA 1KRPA 3RB0A 4Z6DA 5CWRA 1ZQCA 5HRGA 4RQ8A 5J2GA 2KZMA 3GDXA 4YR0A 4I2JA 5EWFA 4M9LA 1NZPA 2ZUDA 1HUZA 4RQ5A 1UA0A 1KDHA 4FBTA 5L1JA 4X4NA 4X4QA 5DG7A 4PPXA 4TURA 1KTQA 1NK6A 7ICKA 3GV7B 2J6TA 3PX0A 4PHDA 4GXIA 1NKCA 3AU6A 2I1QA 4J9OA 3AQMA 5J2HA 4F4KA 3T3FA 4DL4A 4Q8FA 1ZQVA 4MEXA 1S9FA 2DFLA 3JPQA 1KFSA 2BKEA 2BPCA 4QWDA 1SZPA 1QSSA 3B0XA 4WC6A 2AJQA 1KSPA 1RXWA 4QW8A 1H38A 1IXRA 3PX4A 3ZDCA 4NLNA 1BPZA 5HRIA 4WC7A 3H7IA 5CP2A 7ICNA 1NOMA 5J0OA 5DQGA 4GC6A 5KFXA 4Q43A 3M8SA 2R8GA 1MIWA 4UAYA 4MEYA 1MC8A 2W9BB 2FMSA 2VA2A 3BQ0A 7ICGA 4F50A 4WC1A 3H8WA 5KFBA 4UQGA 1TAUA 1DK2A 5DG8A 3THVA 4M47A 4BXOA 3Q8KA 4XQ8A 4B9SA 4M9HA 9ICUA 1BNPA 1ZQJA 3C1ZA 3PW5A 4QWEA 5IIJA 3T5LA 4KLOA 4P4MA 2NRTA 4UD5A 5DKWA 4DS4A 4G3IA 4RQ1A 2HHQA 5KG6A 1NK0A 4DS5A 2OWOA 4O3SA 3JYYA 1V9PA 2HHWA 5DQHA 8ICCA 1DGSA 4J9PA 4WC0A 5KTQA 3WFRE 1D8YA 1ZQLA 2ZHBA 5EWEA
chains in the Genus database with same CATH superfamily
2LPEA 5DB9A 3AEVA 4KX5A 1WWVA 3GV8B 1ZJMA 2MU2A 1ZQBA 3FYHA 4UATA 2VKQA 8ICPA 1JXEA 2G09A 2ALZA 4GLXA 2KFNA 4DFJA 2M2TA 1HJPA 1KKXA 3E58A 2B0CA 4X4PA 5EE0A 1NKBA 5L1MA 3PO4A 2DUYA 3N7PD 4NM2A 3PW4A 2B4VA 8ICOA 1N56A 4RPXA 3HP6A 7ICMA 3V7KA 5J8YC 4DOCA 3BS7A 4BUGA 1TK0A 9ICOA 2QKQA 1BPEA 4AYBF 2HOFA 3M1YA 4RPZA 2VANA 1N48A 2HSZA 5CFSA 4CF4A 2W3SA 4C80A 2ZIVB 2DRAA 3EUB2 1TV9A 2V4QA 4PL2A 2HVHA 2L5YA 2FJ6A 5DB6A 5BOLA 2HMXA 8ICRA 5HRHA 2YTUA 2WHEA 1VDVA 2VJ5A 2Y9TA 3I28A 3FM9A 1J2MA 9ICHA 5ALRA 1QCKA 1QQ7A 4I2FA 1X6IA 1YZ6A 4ECWA 3PO5A 2LKYA 3ER8C 4O6AA 1RXVA 4K9AA 4NLCA 2AGOA 4B9MA 4NXVA 2FCLA 2W3RA 2OYYA 3UMGA 5DB8A 4X0AA 4MHVA 3MR3A 2DBYA 4EBDA 4J9QA 3H4BA 5ALUA 2GO7A 2ZUCA 4ECRA 1O08A 1Q78A 1WOTA 4I2BA 2K8BB 1R8CA 4G9BA 3LK9A 4RWPA 1NJWA 5JU5A 2KJ5A 4UW9A 1N2XA 4B9TA 3UM9A 2K4HA 4WCWA 1NI3A 8ICEA 4TUSA 2KTQA 1M6YA 1Z1BA 5KT5A 1MN8A 5KG0A 4Y2JA 2WTFA 2A19A 1SL1A 3WFQE 4JV0A 1LB2B 3CNHA 3RH5A 2ZTCA 4C4TA 3ETLA 1L3UA 5KFHA 2ZH3A 1RPLA 2HBMA 1ZQYA 1FA0A 5IILA 3RF9A 8ICYA 3Q8QB 4Y2UA 4FS1A 1ZQZA 1BGXT 3Q8SB 2RRDA 3GIMA 1BNOA 3HILA 1ZQMA 2KVSA 1T8EA 3IHQB 1X2IA 4DL2A 2EANA 1LKYA 7ICUA 2HHSA 3ERCC 5IIOA 5AI4A 1PZNA 1Q3VA 4FO1A 2ZIXA 2KMDA 1L3VA 3KZXA 3G6VA 3PZPA 4C8OA 1ZQFA 3D2NA 4C7YA 4F93B 2DVIA 5DGBA 9ICJA 3NVOA 1RG6A 4JK1A 4KLJA 1FFUA 1N61A 2Y0SF 5ALTA 7ICJA 1SIJA 1NK8A 3NVZA 7ICFA 9ICLA 4PL1A 3C21A 4QZIA 1QSYA 2UVRA 2PBEA 4PHPA 4K4GA 4GXJA 4ECYA 3L3FX 4OD0A 2KV2A 4R66A 4AT9A 4OJ5A 2E8OA 4IQUA 2BZFA 4KLGA 4JV1A 7ICOA 4ZH4A 5D4BA 1KW4A 4LZGA 3HWTA 4M5DA 1PVPA 4IQWA 1XO0A 4FZNA 1JQRA 5KFVA 2W9BA 3KKAA 1WYGA 3ORYA 4RU9A 4IRCA 4FHVA 4O3QA 4IR1A 5B66U 7ICVA 1U47A 4MKPA 1S97A 2FPMA 2KNJA 4A8EA 4ED6A 4KM5A 3GIKA 2P6UA 8ICFA 2JZBA 1ZQNA 5KFIA 7ICPA 1FFVA 3VC8A 4EYHB 4DQQA 1SXDA 4KLTA 1ZQAA 2G0AA 4WBYA 3VCBA 3JPPA 4NWIA 1BPXA 4CF5A 4GIBA 3FDSA 3SAHA 4BWMA 4UB1A 1K1SA 4YG2A 4NLGA 2Q0ZX 2AGPA 3RRGA 5KFEA 2W9AA 4UBBA 3HJ4A 5DBBA 9ICTA 4CE6A 7ICQA 5F2VO 1PVQA 4K96A 2ZXHA 2WB1F 2P35A 3H0RB 1CEZA 5KT3A 3AN1A 2IHOA 5CFTA 2H3QA 1WG8A 1ZQKA 2HN2A 3EWAA 3GV5B 4YMOA 2FLPA 8ICMA 2K4PA 5J29A 2JMGA 3ER9B 4YD1A 3V72A 3L4PA 3QU5A 3PV8A 1R8AA 5G5HA 5HC9A 1VLBA 1J2NA 3RJKA 2XY5A 4NJ8A 3V6KA 4FZMA 4WC4A 3MFIA 2ZG6A 3MABA 3RR7A 2HDOA 5ALFA 5DBCA 4ED0A 1F5AA 4F4YA 4WC5A 2BE3A 2RDJA 5D49A 4C8MA 2F8LA 2MA1A 3T79A 3GIJA 7ICTA 4EP7A 8ICSA 1L8LA 1CUKA 3HJ1A 3ZD9A 1RZTA 1Y88A 2ZTEA 1FIQA 1RDFA 5HP4A 1L8OA 4F4WA 5AKYA 4J9NA 4NM1A 5L1IA 3GFKB 4EZ6A 5HR7A 4KLLA 3CRXA 2W9CB 3H4DA 1AQ6A 1QH9A 2BQUA 3KHLA 1SL2A 2DKXA 4O3OA 2G5HB 1UT5A 4RQ3A 2W9MA 3MCRA 2JEGA 3CK6A 4OJOA 7ICEA 4EGWA 3KD3A 7ICHA 4QZ8A 4PZNA 2RFFA 4QZBA 4YVZA 4I2AA 3V7JA 5ALEA 5ALVA 2ZH8A 4M2YA 3TARA 4F5QA 4EEKA 3TFSA 2YN4A 1WCLA 2PMZC 5HNKA 3IG8A 2IHNA 5CJ7A 2H3IA 5HREA 3HT3A 2ASJA 3H8SA 2BBHA 3RB0A 4M9LA 4Y2PA 5EWFA 4YR0A 2ZUDA 2KOBA 5DG7A 2DKZA 4TURA 1NK6A 4KMOB 4PHDA 4Y2TA 3AU6A 2I1QA 3JCFA 4F4KA 3T3FA 2QARA 1KFSA 2LMRA 1UPHA 2KICA 1F5SA 3PSFA 1IXRA 3ZDCA 1BPZA 5HRIA 4WC7A 5CP2A 7ICNA 4GC6A 4JMUA 3M8SA 2KE7A 4WC1A 4MEYA 7ICGA 2FMSA 1X9XA 4UQGA 5DG8A 4B9SA 3J81j 3QUBA 3PW5A 5CEHA 2VJ4A 5DKWA 3KFUF 3F53A 2IOFK 4O3SA 3JYYA 2OWOA 4RQMA 5DQHA 4J9PA 4WC0A 1D8YA 3ETRA 4J03A 1X9WA 4F8RA 4OAIZ 4DOBA 1BPYA 1ZQDA 1OU5A 4QZGA 4WC2A 5J2KA 1XS9D 2YB4A 4WJ3B 4UB5A 4IG8A 4N7RA 3QUCA 3NVYA 4KLHA 3TADC 5KNIA 2Q4TA 3BS5A 4YMNA 1XNSA 4DLGA 4YR2A 3NRWA 4GFJA 3LWMA 2O6KA 4C8NA 5DDMA 4K9BA 5CHGA 2Y9UA 1U9LA 5DECA 4AT8B 2KN7A 4CCHA 3MBYA 4J9SA 4K4IA 4Q8EA 3WKAA 3R9KA 3MR6A 2CXYA 4DFPA 1PK1A 4F92B 2BQ3A 4O5CA 2ZHAA 5AHXA 4BJQA 4DL6A 4UASA 1SZHA 3MR2A 5AI6A 2D6FC 3PR4A 5IIIA 4Y2XA 2BPFA 3WFPA 3UXPA 1ZQRA 4O3MA 4O3PA 5KG4A 2BCUA 4FHPA 3QNMA 2PFNA 5F9LA 3HPOA 4DL7A 4P0QA 2BDPA 3OTQA 5CHEA 3L5KA 3RAXA 5AI9A 2IHMA 5ALKA 2FPLA 1C20A 1NJYA 4PGQA 1ZQUA 4AP9A 2Q66A 5ALJA 7ICRA 4NXXA 3JPOA 4ED7A 2KJ8A 2DR9A 1V38A 3K75D 1S10A 4XRHA 9ICBA 2PFPA 5J2FA 4OO1J 2FPKA 2KJ9A 3HKZC 1OUQA 2WF7A 4IRKA 4IQTA 5AICA 1TFWA 2DF4B 8ICXA 4F3OA 1NZBA 3QU9A 2KSOB 2R8HA 9ICXA 4ECQA 1LVHA 1N5WA 1TVAA 3OJSA 5KFPA 4X4SA 2NYVA 5J2IA 5DEDA 2NRWA 5HRFA 5B5EU 4I2DA 3OPXA 4FHXA 2ZH1A 1NKEA 3WK4A 2FLLA 2RP5A 2KKPA 1J97A 4XQ7A 5AKJA 1CI4A 3KBBA 3M6ZA 4UAVA 1TKDA 3UQ2A 2DPJA 2HHVA 2PI5A 5J2EA 2W8LA 2EZXA 4F4ZA 4RNNA 2FMPA 3V6JA 1A0PA 3QEAZ 1C7YA 4QW9A 5AIAA 4FS2A 3SR6A 4I2CA 3BQ1A 8ICGA 4KN7A 2ZJ5A 4OAFA 4QZHA 4B9VA 5KT2A 4LVSA 2C22A 1SKRA 2BCSA 4RT3A 1S77D 3CYMA 3F2CA 2HOIA 2KIVA 5F9NA 4F4XA 2NRXA 5L1KA 8ICWA 2AH5A 5AIBA 4DQRA 4ED8A 1F44A 4B9UA 4DF8A 1ZETA 3LQCB 4OJ6A 4O5EA 4UARA 4K8VA 5J0QA 5BOMA 1S0VA 2LM1A 4XUSA 4PGXA 5KT7A 2BCVA 4ICAA 2FE9A 4J9LA 2OH2A 4ELTA 5KFRA 5AK4A 2OXOA 2F2AB 3RJEA 4U7CA 4XA5A 1NJZA 3AQLA 2WF5A 2ZH9A 4R65A 1MIVA 3ED5A 3JZ0A 3GZFA 1COKA 4X0BA 3PNCA 2XI9A 1X66A 3AU2A 2DPIA 5D62A 3OGUA 1D8LA 1SKWA 4YCXA 2BGWA 2YY6A 1NJXA 4QIWF 5KFGA 5J0WA 1Q3UA 5ALIA 3RRHA 3RB6A 4GC7A 5ALGA 1PX5A 3TANA 5B3QA 4FH3A 1YT3A 1QTMA 5AKLA 7ICLA 1VFGA 1L7NA 3SAFA 4TQRA 4RQ2A 1ZQ1C 2OHFA 4B6JA 3TI0A 4ECUA 3SYZA 2C2EA 1R89A 2ISPA 1B43A 4PJ0U 3N7RC 4JWNA 2O1PA 2R18A 4WH5A 1Z1VA 4Y2RA 4CDGA 2DR5A 2XIDA 2KZ3A 1A6SA 1TAMA 2ZIUA 2LBOA 1QQ6A 2F1JA 2JEJA 3RJIA 5JUMA 4RUCA 5B3PA 4I2IA 3SENA 1ZD3A 1NK7A 4HAIA 3JPSA 2W03A 5G5GA 4DLEA 2XCAA 4IRDA 2KKVA 3SEIA 4I27A 3T5JA 4F2RA 4EV6A 5T14A 3A0HU 3E0FA 3HJEA 3ONNA 5KFOA 5ALMA 5KFMA 4R64A 3TADA 3DDHA 2XO7A 3TFRA 2V4RA 3LDAA 5ALOA 1X6JA 4AYBC 3QE9Y 3MDAA 2QB1A 3NKUA 4AT7A 4R8UA 2GWSA 2YB1A 1SWVA 2XICA 3NRZA 1L6NA 4IS7A 3RJJA 2M9NA 5J2AA 2OM6A 4FO6A 1Q79A 4CF3A 4MFAA 3NWIA 2OCEA 2VIXA 4DFDA 2EDUA 1HIWA 2LI6A 1U45A 1L5UA 2HHXA 4ECZA 1SB3C 5KFWA 1RYRA 1LKYB 5KT6A 3C18A 2K8AA 5KFKA 3MR5A 3WK7A 2JRZA 4C4RA 1B4FA 2ZIXB 4EENA 1SKSA 2CRXA 4IR9A 5ALYA 2YMPA 4E80A 5EWGA 4RUAA 2KEYA 2IOHA 5AK3A 2KHVA 4J9KA 8ICLA 4EX6A 2R8KA 1UEVA 2DR8A 3U26A 2H3ZA 2W54A 1DGJA 5J0TA 4ED2A 1NK5A 1T7PA 3G6XA 1KRPA 5CWRA 5HRGA 2FDRA 1HUZA 2CPRA 1KDHA 5L1JA 4X4NA 4PPXA 2LHTA 2PKEA 7ICKA 1JALA 4GXIA 3EF2A 4J9OA 3AQMA 4DL4A 5AKEA 4UB6U 5AK5A 1S9FA 2BKEA 1QSSA 1OW5A 1KSPA 1RXWA 2D8CA 3D2QA 5AM3A 3PX4A 5DQGA 1S5LU 4UAYA 2W9BB 2VA2A 5KFBA 3AL0B 3THVA 4M9HA 4BXOA 3Q8KA 1BNPA 2G06A 3T5LA 1IG6A 4DS4A 5ALPA 1CRXA 5KG6A 2HHWA 5KTQA 4UAWA 4DL5A 2G07A 3OV7A 4KN4A 4I28A 8ICNA 2JZBB 2ZH6A 1A76A 4FZLA 4HX0A 3UQ0A 2BQRA 2VA3A 4EBJA 4YP3A 1NK4A 3H37A 1UA1A 3ZD8A 2ZIWA 2HOQA 3HW8A 4QWAA 2A3VA 1SV4A 1T94A 3IRUA 1N60A 5AKXA 5HMMA 3WK6A 3KHRA 5J8YA 1TK8A 1DXSA 1QQ5A 2W9CA 2Y0SC 3B9JA 4FBUA 4O5KA 2MAXA 2A1JA 4UB2A 1ZQSA 3ZI4A 4F2SA 2IMWP 4JLXA 4EYIB 4ECVA 1UCVA 3AMZA 4NLKA 2BPGA 3WFOA 2HHTA 4FE3A 4YQWA 4M9NA 2XGPA 1ZQTA 4LJXA 9ICIA 3UPSA 4DSFA 4RT2A 4I0UA 2E1FA 1TE2A 5IINA 4ELUA 5KFNA 2I9GA 2C2DA 1KLNA 2EZZA 3ISDA 4PHEA 5KG2A 1KEJA 2DL0A 5AI0A 3MGHA 4RNMA 4KLDA 4YXMA 1X9SA 5KG5A 2K60A 3AUOA 4X5VA 4KLIA 1GPJA 1Z00A 4EX7A 3EYZA 2B56A 4DWIA 3N4MB 1X40A 3BZKA 4YXJA 3PVXA 3T5KA 4JLZA 4DSIA 4P0PA 3KOOA 2EAOA 3ISBA 4IL6U 4MF2A 4ED3A 1Q8KA 3GIIA 5DDYA 2P66A 3ZDDA 4ED1A 4O9MA 3K7DA 2ZUBA 1ZQEA 4C8KA 2B21A 3N7SC 3Q8RB 4P4OA 3QUTA 2ISOA 4QWBA 5ALWA 2WAQF 3NS1A 8ICBA 2BCQA 1OXJA 4LT6A 4TUQA 4KLQA 2I5HA 4HYKA 2RDIA 5KFDA 2F76X 2EAPA 1QLNA 3OVAA 2ID1A 1KNYA 2GAFD 4DL3A 2JV3A 5KL8B 3ZDAA 1UETA 5DB7A 4EZ9A 1X42A 4DFMA 2KD1A 3TKAA 1V4AA 3AQEA 4BWJA 2WB1C 2H3FA 8ICIA 1NNLA 4OCZA 1ZRMA 2K4EA 1ZQHA 3UPQA 4ECTA 3H8MA 4M6WA 4E7XA 3QU2A 2J6UA 4FHWA 4X4UA 2QB0B 2YMLA 4K98A 1KN5A 4P4PA 3M6KA 3OUYB 2YMMA 2AQ0A 3C66A 2QARB 3EPIA 1S0NA 5J2CA 4NLZA 9ICPA 2JH7A 2P6RA 5DG9A 3BDPA 2NRVA 3WK8A 1N62A 2QLTA 4DSEA 4EEYA 4M04A 2ZH4A 1D9DA 4CRXA 3PX6A 5HRDA 4Z6CA 1FO4A 5K4LA 5D61A 2K4IA 9ICQA 4QNLA 5C5JA 4UD5A 4UAUA 1ZJNA 1JMSA 2MSNA 2ZH7A 2HHUA 1MIYA 3OHBA 1L3SA 1KQQA 5AM2A 3EW9A 5D63A 5KFZA 1S0OA 1UT8A 2AQ4A 3GQCA 1ZOLA 3SMVA 1ZQPA 2EAMA 4ATBA 3M9OB 5EE3A 5DQIA 1ZQQA 4WC3A 2F77X 4CGZA 4RWOA 4UD4A 1BVSA 4RQ4A 4KX3A 4KLEA 2BHNA 3TACB 5ALDA 1SWWA 4NXTA 8ICVA 2R8IA 4F5OA 4K4HA 5HR9A 8ICJA 4UAZA 4YD2A 4RZRA 2KHQA 5KAFU 2GOLA 4I2GA 4EBEA 2NO5A 4X4RA 4P2HA 3WK5A 1JXLA 1MQ3A 5ALNA 3OHAA 4RWQA 3SV4A 3KZIU 2N1RA 3ZDBA 1KFDA 1Z3EB 5EE1A 9ICGA 1PK1B 3LWLA 5KFCA 3SI8A 1NK9A 2K8CB 4QZEA 1EXNA 1MQ2A 1RQLA 4NL9C 9ICMA 3C2LA 3H38A 2IUBA 3NASA 2BR0A 1L7OA 2PFQA 3RH6A 2H5XA 3C1YA 5CB1A 5HHHA 3C2MA 1HEKA 2GLEA 9ICKA 1P7DA 8ICAA 2MUTB 5J0SA 1MSWD 1ZD5A 1X9MA 4EEBA 3NTUA 4IQVA 2WFAA 4FH5A 3MGVA 1DOQA 1JN3A 2JR5A 3UMBA 2Y1JA 2HCFA 9ICVA 5AKGA 5CRXA 4DQSA 4LEVA 1N5XA 2F1IA 3IP4B 4ECXA 1O03A 3PMLA 3BQTA 2FMQA 8ICUA 5C0YA 4ACOA 4USAA 2B6GA 3G6YA 2ATLA 1S76D 2BDUA 2E8MA 4F5RA 5J0RA 3WKEA 3KTQA 3C28A 2ZIVA 3QZ7A 4DSJA 4Z6FA 1XWLA 3H3AA 4CNQA 3AQFA 2LYAA 3LVWA 5AKZA 3RBDA 4WQLA 2ZH5A 4F5PA 4KLUA 3HIYA 5AK6A 2E3TA 3JPNA 4EBKA 3MDCA 2KZZA 9ICRA 4QZFA 4US9A 2M2UA 4KLSA 3QZ8A 5HHIA 2HI0A 4UB8U 3QU4A 2M2WA 3WFSC 3D6JA 3I1YA 1N63A 1B0XA 1XSLA 1U4BA 1ED1A 3RJHA 8ICHA 1V97A 5J0XA 5IIMA 1BPBA 4RPYA 9ICEA 3PHZA 1SGGA 5HRKA 1AROP 2M2VA 3Q8MA 3M9MB 1PUZA 4BDPA 2DQNB 4I2EA 1SV0C 4Q44A 8ICTA 4PGYA 2YX8A 4Z6EA 4QZCA 1VJ5A 2HHPA 4Y2VA 3L9DA 3QYPA 4YFKA 1JROA 3JPRA 3CP8A 5DLFA 3C29A 4J9RA 3N97B 3H40A 1B22A 1R8BA 4GXKA 2C28A 2WF9A 9ICAA 9ICCA 2ZTDA 5KFQA 3RAQA 4K99A 4DF4A 2H3VA 1ZQOA 4OJPA 3SV3A 1SXEA 3UXNA 4R63A 1HUOA 3OSNA 7ICIA 5J2DA 4MFCA 3MGIA 2JHDA 2HN1A 4Z6DA 1ZQCA 5ALSA 2AHOB 3A0BU 1NZPA 4O69A 4K97A 1RQNA 3PX0A 1KL9A 1Q46A 4Y2YA 1NKCA 4NXWA 2DGZA 3CW2C 4Q8FA 1JRPA 1PK3A 2DFLA 3JPQA 3B0XA 2AJQA 3WK9A 4QW8A 4NV0A 4NLNA 2HBKA 3PSIA 4Y2SA 1NOMA 5J0OA 3N28A 4LEZA 3H8WA 1TAUA 4M47A 2K89A 3RFAA 1ZQJA 3C1ZA 5GTHU 1YZ7A 5ALHA 2NRTA 2HHQA 5ALQA 1DGSA 3WFRE 4C7ZA 1MIWA 3D2SA 2ZHBA 3BQ2A 4J9MA 1WWUA 1ZQWA 3AQNA 3M8RA 4LEWA 3ISCA 2RLTA 2ZJAA 3AQKA 2HBLA 2C2RA 2KFZA 3OVSA 4M0AA 5EOZA 2BCRA 9ICSA 4RQ6A 1XSNA 4DQPA 2V9WA 3IV6A 1DK3A 3WU2U 1ZQGA 1L7PA 2ZIUB 3NUQA 4U6PA 5BPCA 2J6SA 2UVVA 2XY6A 4FFDA 5KT4A 1U49A 2PXIA 3IDWA 3NVVA 3Q8LA 4KTQA 4S3NA 2AGQA 9ICWA 4F71A 2FI1A 4RQ7A 2DWQA 2NO4A 3PSPA 3ZDEA 8ICQA 2JEIA 4O3RA 4B9NA 5CA7A 1Z4OA 3DV9A 5DBAA 2NRZA 1TFYA 2BBJA 3UMCA 1JIHA 4RQ0A 4X4OA 1JAJA 3E2EA 4C4SA 5F3XB 5KFFA 4O68A 3V7LA 5J2JA 2F8KA 3LYSA 4B9LA 4JWMA 1XU4A 3C23A 1T4GA 4QIWC 2A1AA 2JH1A 4TQSA 1KFTA 3TAQA 2GH1A 2EZYA 1Z4NA 2IBKA 2KVCA 4AT7B 4R8UB 3BZCA 3WKCA 4JUZA 1ZXIA 2HW3A 1UQVA 3RR8A 4FHYA 3RJGA 3PW7A 5EE9A 4M9GA 2EQYA 1IV8A 3TQ1A 1K5OA 3ICXA 4QZDA 4NL9A 5KFUA 2ASLA 5AM1A 3S6JA 2F44A 4NY8A 4QWCA 2W11A 5TISU 5ALXA 4AT9B 2XCPA 2PMZF 3RBEA 5AKIA 3MC1A 5KFSA 3I76A 1UEUA 3QUQA 2XVTA 2EH9A 4KMUA 1T3NA 5KFAA 2R8JA 4I2HA 1XC9A 3SZ2A 1L3TA 4EEDA 1U48A 1VJ7A 2AXTU 5L9XA 3PW2A 1XSPA 2LYHA 4KB6A 1A77A 5AM5A 3V6HA 3RH4A 1PVRA 3NGDA 5E79U 2O5AA 2DRBA 4OJLA 5KL1B 4ELVA 3WKBA 4NXUA 9ICNA 2W55A 5HMLA 3KHHA 5J0YA 4DO9A 2Y1IA 2AU0A 1RM6C 3EZ5A 4O67A 5J0PA 1DRGA 5H2FU 2KP7A 4TUPA 5GTIU 2JGAA 1Z19A 2F1HA 4EBCA 3H39A 1YLQA 3KHGA 3F2DA 5HR6A 5KFLA 5CR0A 3PR5B 5DGAA 3NYBA 3H0LB 3K4GA 1K1QA 5J2BA 2DR7A 4YN4A 2PFOA 1T3QA 3IM1A 4DQIA 1JX4A 3GU3A 4BXOB 4XJEA 2YMQA 5ALLA 1S8OA 3OJUA 4X4QA 3AM9A 2XGQA 1GO3F 2E8NA 3EPGA 3PW0A 3RTVA 5KG3A 3QU7A 4RNOA 1ZD4A 4NKUA 1IM4A 4QJFB 3MFHA 1RYUA 1SV0A 4BGDA 4Q45A 1XO1A 4F91B 2ZIWB 5KG7A 3C5GA 4C8LA 3C2KA 4MFFA 2Z7JA 5CFUA 1KBUA 4JV2A 3F5EA 2A1JB 2E1EA 4PHAA 1BPDA 3SQIA 4O3NA 4F5NA 4LZDA 1MA7A 1UHUA 3B0YA 5AKKA 4KLFA 4BX9C 1TK5A 4ECSA 1URJA 3F2BA 2LYBA 3FAHA 1JUDA 1ZQIA 4X4TA 2JEFA 2W04A 5FP0A 5KG1A 2ZJ8A 3GILA 2E8PA 4I29A 1SL0A 4QZ9A 3H8JA 5JTIA 2OEHA 2LM4A 5KAIU 1WCNA 5AM0A 4KITB 1ZYQA 1FEZA 4UB3A 3JPTA 2QB0A 1F0MA 2WF8A 4WBZA 1WUDA 1S0MA 3OUYA 1Z00B 3IN5A 2I6XA 2E5SA 1ECWA 2VA8A 3HKZF 2W7OA 3PSTA 5A0LA 4P0PB 1ZRNA 2MRLA 1D9FA 4QZAA 3OSPA 2RQ5A 1LV5A 1ZQXA 4ZOHC 3OVBA 2HVIA 5HRLA 2G5IB 5J0UA 3O0FA 4RQNA 5KFTA 4M9JA 3UXOA 2JXJA 3SAGA 4E0DA 4AT8A 3K1RB 4NKTA 3BJYA 4DCCA 1RYSA 3FC4A 2RHFA 4EELA 4O0IA 5JTGA 4NXZA 3TAPA 4KLMA 3SD7A 4DFKA 2CN1A 2YQEA 5D46A 5TZVA 4DSLA 2XY7A 8ICKA 2KIWA 3IG5A 5AI8A 3WKDA 2W43A 3QEBZ 3PY8A 2ESEA 1NO5A 4Y2QA 2WF6A 3OWGA 5DLGA 4DSKA 2FLNA 3RB3A 3M7DA 8ICZA 4M6WB 1D8BA 1TAQA 2D3DA 3RJFA 4WOYA 3RB4A 4UB4A 2G08A 4DOAA 4E8FA 2GA9D 4DEZA 2W8KA 3F5AA 1COOA 4UBCA 2ZXIA 2KG5A 4YMMA 5HRBA 2PI4A 1IIPA 2XC9A 4JB3A 2UVWA 3NVWA 4NLBA 4MF8A 3BS5B 5KFJA 4C0ZA 4PH5A 3T5HA 5AM4A 4YR3A 1QSLA 4PZOA 2IA6A 9ICFA 1TFRA 2NV3A 2ASDA 1L7MA 7ICSA 5IIKA 2HBJA 3PMNA 3LVVA 5KFYA 2KSOA 2EWRA 5AI5A 3C5FA 2MUTA 2UVUA 4RWNA 4X4VA 3QX7A 3BQ7A 3HRDD 4ATBB 3HX0A 2WAQC 3KKAC 4WQKA 2NRKA 2ES6A 2ZH2A 3M9NB 3Q8PB 5L1LA 4RQ8A 2M0NA 5J2GA 2KZMA 3GDXA 4I2JA 2W7PA 4FBTA 4RQ5A 1UA0A 2KK0A 1KTQA 3GV7B 2J6TA 4P0QB 4F72A 5J2HA 1JI7A 4IC9A 1ZQVA 4MEXA 2BPCA 4QWDA 1SZPA 3H0MB 4WC6A 1H38A 2ODGA 5AKHA 3H7IA 4OAHA 2IOFA 5KFXA 4Q43A 3DEEA 2R8GA 1MC8A 1ZD2P 3BQ0A 4F50A 2F3NA 3QXGA 1DK2A 5JRTA 4XQ8A 9ICUA 4QWEA 5IIJA 4KLOA 4US8A 3K1ZA 4P4MA 3ALRA 5ALZA 4G3IA 4RQ1A 1NK0A 4DS5A 2B51A 1V9PA 1V85A 8ICCA 1ZQLA 4LEYA 4OAGA 5EWEA
chains in the Genus database with same CATH topology
4DL5A 3BQ2A 4J9MA 4KN4A 1X9WA 3OV7A 5DB9A 4F8RA 4I28A 8ICNA 2JZBB 2ZH6A 1ZQWA 1A76A 4DOBA 3AQNA 3M8RA 3ISCA 3UQ0A 3GV8B 2BQRA 2ZJAA 1BPYA 1ZJMA 1ZQDA 2VA3A 1OU5A 3AQKA 1ZQBA 4EBJA 4QZGA 4YP3A 4WC2A 2C2RA 3FYHA 2KFZA 3OVSA 5J2KA 4M0AA 8ICPA 5EOZA 1XS9D 2BCRA 1NK4A 9ICSA 3H37A 1UA1A 1JXEA 3ZD8A 4RQ6A 1XSNA 2ALZA 4GLXA 3HW8A 4DFJA 4DQPA 2KFNA 4QWAA 4UB5A 2V9WA 2M2TA 1HJPA 1DK3A 1ZQGA 4X4PA 4IG8A 5BPCA 4KLHA 2J6SA 5HMMA 2UVVA 3KHRA 1NKBA 2XY6A 1TK8A 3PO4A 4NM2A 4YMNA 5KT4A 3PW4A 1U49A 2W9CA 2PXIA 4DLGA 8ICOA 4YR2A 1N56A 4FBUA 4O5KA 2MAXA 4RPXA 3HP6A 3Q8LA 2A1JA 7ICMA 3LWMA 4KTQA 4C8NA 5DDMA 4UB2A 5CHGA 4S3NA 1U9LA 3V7KA 1ZQSA 2AGQA 9ICWA 4RQ7A 4F2SA 5DECA 4DOCA 2IMWP 1TK0A 2KN7A 4AT8B 4CCHA 3ZDEA 3MBYA 4J9SA 1BPEA 4K4IA 4Q8EA 8ICQA 9ICOA 3MR6A 2JEIA 4O3RA 4RPZA 2VANA 4EYIB 4ECVA 4DFPA 1N48A 4B9NA 5CA7A 4F92B 4NLKA 2BQ3A 5DBAA 2BPGA 4O5CA 2NRZA 3WFOA 2ZHAA 2HHTA 2DRAA 1TFYA 4YQWA 4DL6A 1TV9A 4M9NA 2XGPA 2V4QA 1ZQTA 3MR2A 9ICIA 3UPSA 1JIHA 4RQ0A 3PR4A 4DSFA 5IIIA 4X4OA 1JAJA 4RT2A 2BPFA 3E2EA 2HVHA 5DB6A 5BOLA 5KFFA 3WFPA 5IINA 3UXPA 3V7LA 5J2JA 4ELUA 5KFNA 2I9GA 8ICRA 2C2DA 1KLNA 4B9LA 5HRHA 4JWMA 1XU4A 3C23A 4PHEA 3ISDA 1ZQRA 5KG2A 1KEJA 4O3PA 5KG4A 1T4GA 2BCUA 4FHPA 2PFNA 3MGHA 9ICHA 4RNMA 4KLDA 4YXMA 5F9LA 4TQSA 3HPOA 1X9SA 5KG5A 3AUOA 4DL7A 3TAQA 4X5VA 2BDPA 4KLIA 1Z00A 4ECWA 2IBKA 3EYZA 4R8UB 3PO5A 4AT7B 4DWIA 3RAXA 3N4MB 8ICGA 4JUZA 2HW3A 4YXJA 3PVXA 2IHMA 3RR8A 1RXVA 4FHYA 3RJGA 3T5KA 3PW7A 2FPLA 4DSIA 4M9GA 3ISBA 1NJYA 3TQ1A 2AGOA 4B9MA 4ED3A 4PGQA 4MF2A 1ZQUA 3GIIA 5DDYA 2P66A 3ZDDA 2Q66A 4ED1A 4O9MA 7ICRA 2ZUBA 4QZDA 1ZQEA 5KFUA 5DB8A 2ASLA 4C8KA 4X0AA 2B21A 3Q8RB 4P4OA 3MR3A 3JPOA 4ED7A 4EBDA 4QWCA 4J9QA 3H4BA 4NY8A 2ZUCA 2DR9A 2ISOA 4AT9B 4QWBA 3K75D 4ECRA 4XRHA 1S10A 1Q78A 2XCPA 4I2BA 8ICBA 9ICBA 1WOTA 2BCQA 1R8CA 3RBEA 3LK9A 2PFPA 4LT6A 4ATBA 5J2FA 4RWPA 4TUQA 1NJWA 2FPKA 4KLQA 5KFSA 4B9TA 1UEUA 4HYKA 4IRKA 4IQTA 2RDIA 4WCWA 8ICEA 5KFDA 1T3NA 4KMUA 4TUSA 1TFWA 5KFAA 2R8JA 2KTQA 8ICXA 1QLNA 4I2HA 3OVAA 4F3OA 2ID1A 2R8HA 1XC9A 3SZ2A 5KT5A 1L3TA 9ICXA 1KNYA 1U48A 4DL3A 1VJ7A 3ZDAA 5L9XA 4ECQA 3PW2A 5KG0A 1UETA 5DB7A 1XSPA 4DFMA 2LYHA 1TVAA 3OJSA 2WTFA 4EZ9A 5KFPA 4X4SA 1V4AA 5J2IA 1SL1A 3WFQE 1A77A 5DEDA 4JV0A 1LB2B 2NRWA 5HRFA 4BWJA 4I2DA 3V6HA 4UAWA 3RH5A 3RH4A 2ZTCA 3NGDA 3ETLA 8ICIA 2O5AA 4FHXA 2DRBA 1L3UA 5KFHA 2ZH1A 4ELVA 1NKEA 1ZQHA 3UPQA 2ZH3A 4ECTA 2FLLA 1RPLA 9ICNA 4M6WA 1ZQYA 1FA0A 4E7XA 5HMLA 3KHHA 5J0YA 4DO9A 2Y1IA 2AU0A 5IILA 2J6UA 8ICYA 4XQ7A 4FHWA 3EZ5A 5J0PA 3Q8QB 4X4UA 1TKDA 2KP7A 4TUPA 4P4PA 3UQ2A 3OUYB 4FS1A 2F1HA 2AQ0A 2DPJA 1ZQZA 4EBCA 2PI5A 2HHVA 3C66A 5J2EA 3H39A 3EPIA 1BGXT 2W8LA 1YLQA 3Q8SB 3KHGA 4F4ZA 4RNNA 1S0NA 2FMPA 3V6JA 3GIMA 5J2CA 1BNOA 1ZQMA 5KFLA 5CR0A 4NLZA 9ICPA 3PR5B 2P6RA 5DGAA 3NYBA 1T8EA 3QEAZ 1C7YA 3K4GA 4QW9A 3IHQB 4FS2A 5DG9A 1K1QA 3BDPA 1X2IA 2NRVA 5J2BA 4DSEA 3BQ1A 4DL2A 4EEYA 4KN7A 4I2CA 4YN4A 2ZJ5A 4M04A 4QZHA 2HHSA 7ICUA 2PFOA 4B9VA 5KT2A 5IIOA 1D9DA 3IM1A 4LVSA 2C22A 1SKRA 1JX4A 1PZNA 2BCSA 4DQIA 3PX6A 5HRDA 4Z6CA 4RT3A 4BXOB 1S77D 9ICQA 1L3VA 5F9NA 5C5JA 3G6VA 4F4XA 1ZJNA 2NRXA 3OJUA 1JMSA 5L1KA 1ZQFA 4C8OA 4DQRA 8ICWA 2HHUA 4ED8A 4B9UA 4F93B 2XGQA 3OHBA 1MIYA 2ZH7A 2DVIA 4DF8A 5DGBA 1L3SA 1ZETA 3LQCB 9ICJA 3EW9A 4O5EA 5KFZA 1S0OA 1UT8A 4JK1A 5J0QA 5BOMA 3GQCA 3EPGA 2AQ4A 4KLJA 1S0VA 1ZQPA 4XUSA 4PGXA 5KT7A 3PW0A 3RTVA 3M9OB 2BCVA 7ICJA 5DQIA 5KG3A 1ZQQA 4J9LA 4RNOA 4ELTA 4WC3A 5KFRA 1NK8A 7ICFA 4I2FA 9ICLA 4RWOA 3C21A 4QZIA 1BVSA 1QSYA 1IM4A 4UD4A 4RQ4A 4NKUA 4KLEA 2UVRA 3MFHA 2BHNA 4PHPA 3RJEA 2PBEA 4K4GA 4BGDA 4Q45A 1XO1A 4XA5A 1NJZA 4GXJA 4ECYA 3AQLA 4F91B 2ZH9A 8ICVA 2R8IA 4R65A 4F5OA 4K4HA 5HR9A 8ICJA 1MIVA 5KG7A 4UAZA 4YD2A 4RZRA 3JZ0A 4R66A 3C5GA 4AT9A 4C8LA 4I2GA 4EBEA 3C2KA 4IQUA 4MFFA 4X0BA 3PNCA 4X4RA 4P2HA 1JXLA 3AU2A 2DPIA 4KLGA 2DR7A 4JV1A 7ICOA 4ZH4A 3OGUA 5D4BA 1MQ3A 1D8LA 4JV2A 4LZGA 3OHAA 2A1JB 4PHAA 4YCXA 3HWTA 1BPDA 2BGWA 1SKWA 4M5DA 4RWQA 4O3NA 4IQWA 3SV4A 1NJXA 1JQRA 5KFGA 5J0WA 4F5NA 4LZDA 3RRHA 3RB6A 3B0YA 5KFVA 2W9BA 4KLFA 3ZDBA 1KFDA 4GC7A 1Z3EB 1PX5A 1TK5A 3TANA 9ICGA 4ECSA 4FH3A 3ORYA 3LWLA 5KFCA 3SI8A 1QTMA 1ZQIA 7ICLA 1NK9A 4QZEA 4RU9A 1EXNA 2JEFA 4IRCA 4X4TA 4FHVA 1VFGA 4O3QA 4TQRA 4RQ2A 5KG1A 1MQ2A 4IR1A 7ICVA 1U47A 9ICMA 3C2LA 2ZJ8A 1S97A 2FPMA 3GILA 3H38A 4I29A 3TI0A 1SL0A 4ECUA 4ED6A 4QZ9A 3SYZA 2BR0A 2PFQA 3H8JA 3RH6A 2C2EA 3GIKA 1R89A 1WCNA 2H5XA 2P6UA 3C1YA 2JZBA 8ICFA 1ZQNA 2ZH4A 5KFIA 5CB1A 1B43A 4KITB 1ZYQA 5HHHA 3C2MA 2ISPA 7ICPA 4EYHB 9ICKA 8ICAA 4UB3A 3JPTA 2MUTB 4JWNA 5J0SA 4DQQA 1MSWD 2O1PA 1X9MA 1S0MA 4WBZA 4KLTA 1Z00B 3OUYA 3NTUA 4IQVA 1ZQAA 4FH5A 1DOQA 4WBYA 1JN3A 2DR5A 2VA8A 2KZ3A 2Y1JA 9ICVA 3JPPA 4DQSA 2F1IA 4ECXA 2F1JA 2JEJA 3RJIA 1BPXA 1D9FA 4QZAA 5JUMA 4RUCA 3OSPA 3PMLA 3FDSA 1LV5A 4UB1A 4I2IA 4BWMA 1ZQXA 1K1SA 4YG2A 3OVBA 2HVIA 4NLGA 5J0UA 3BQTA 5HRLA 2Q0ZX 2FMQA 2AGPA 5KFTA 3RRGA 8ICUA 1NK7A 4M9JA 3UXOA 3JPSA 5KFEA 4E0DA 2W9AA 4AT8A 4UBBA 3G6YA 3HJ4A 5DBBA 2ATLA 9ICTA 4DLEA 1S76D 7ICQA 4NKTA 5F2VO 4F5RA 2XCAA 5J0RA 3BJYA 4IRDA 1CEZA 5KT3A 3KTQA 1RYSA 4I27A 3T5JA 4F2RA 3QZ7A 4DSJA 4Z6FA 1XWLA 4O0IA 1ZQKA 3H3AA 3EWAA 3GV5B 4YMOA 2FLPA 4NXZA 3TAPA 8ICMA 4KLMA 5KFOA 5J29A 4DFKA 3RBDA 4YD1A 5D46A 3V72A 2ZH5A 4F5PA 5TZVA 3PV8A 5KFMA 4KLUA 1R8AA 3HIYA 4DSLA 4R64A 2XO7A 3TFRA 2XY7A 3JPNA 3LDAA 2V4RA 8ICKA 5HC9A 3QEBZ 3PY8A 4EBKA 3RJKA 3MDCA 2XY5A 3V6KA 2KZZA 9ICRA 4QZFA 3MFIA 3QE9Y 1NO5A 4WC4A 3MDAA 3MABA 3RR7A 4AT7A 5DBCA 4R8UA 4ED0A 2GWSA 1F5AA 4F4YA 5DLGA 4DSKA 4WC5A 2M2UA 2BE3A 2FLNA 3RB3A 4KLSA 8ICZA 4M6WB 2RDJA 1TAQA 5HHIA 5D49A 4C8MA 3QZ8A 3RJFA 2M2WA 3WFSC 3RB4A 4UB4A 2M9NA 3RJJA 4DOAA 3GIJA 5J2AA 7ICTA 4E8FA 4EP7A 1XSLA 1U4BA 3RJHA 8ICHA 8ICSA 4DEZA 5J0XA 2W8KA 5IIMA 4FO6A 1BPBA 1COOA 4RPYA 4UBCA 1Q79A 9ICEA 4MFAA 1CUKA 3HJ1A 3ZD9A 1RZTA 1Y88A 2ZTEA 4YMMA 5HRKA 5HRBA 1AROP 2M2VA 3Q8MA 3M9MB 2PI4A 5HP4A 1KFTA 4F4WA 4BDPA 1U45A 2XC9A 1L5UA 4I2EA 2UVWA 2HHXA 4Q44A 4ECZA 8ICTA 4J9NA 4NM1A 5KFWA 1RYRA 5L1IA 4PGYA 5KFJA 4Z6EA 4QZCA 3GFKB 4MF8A 4EZ6A 4PH5A 3T5HA 4KLLA 2W9CB 2HHPA 3L9DA 5KT6A 3H4DA 4YR3A 1QSLA 3C18A 5KFKA 4YFKA 2BQUA 3JPRA 3KHLA 3MR5A 4O3OA 1SL2A 2IA6A 9ICFA 1TFRA 5DLFA 1UT5A 4RQ3A 2W9MA 2ASDA 2JEGA 7ICSA 1SKSA 4IR9A 5IIKA 7ICEA 4E80A 3PMNA 4J9RA 5KFYA 3N97B 7ICHA 5EWGA 4QZ8A 4RUAA 3H40A 1B22A 2RFFA 4QZBA 2MUTA 4YVZA 3C5FA 2UVUA 1R8BA 4I2AA 3V7JA 4J9KA 4GXKA 2C28A 8ICLA 9ICAA 4RWNA 4X4VA 2R8KA 9ICCA 1UEVA 2DR8A 2ZTDA 5KFQA 3RAQA 2ZH8A 4M2YA 3TARA 4F5QA 4DF4A 3HX0A 4ATBB 3TFSA 1ZQOA 5J0TA 2NRKA 1WCLA 3SV3A 4ED2A 2ZH2A 3UXNA 4R63A 1HUOA 5HNKA 3OSNA 2IHNA 5J2DA 3M9NB 5CJ7A 3Q8PB 1NK5A 4MFCA 7ICIA 3MGIA 5L1LA 3HT3A 2ASJA 1T7PA 5HREA 3H8SA 3G6XA 1KRPA 3RB0A 4Z6DA 5CWRA 1ZQCA 5HRGA 4RQ8A 5J2GA 2KZMA 3GDXA 4YR0A 4I2JA 5EWFA 4M9LA 1NZPA 2ZUDA 1HUZA 4RQ5A 1UA0A 1KDHA 4FBTA 5L1JA 4X4NA 4X4QA 5DG7A 4PPXA 4TURA 1KTQA 1NK6A 7ICKA 3GV7B 2J6TA 3PX0A 4PHDA 4GXIA 1NKCA 3AU6A 2I1QA 4J9OA 3AQMA 5J2HA 4F4KA 3T3FA 4DL4A 4Q8FA 1ZQVA 4MEXA 1S9FA 2DFLA 3JPQA 1KFSA 2BKEA 2BPCA 4QWDA 1SZPA 1QSSA 3B0XA 4WC6A 2AJQA 1KSPA 1RXWA 4QW8A 1H38A 1IXRA 3PX4A 3ZDCA 4NLNA 1BPZA 5HRIA 4WC7A 3H7IA 5CP2A 7ICNA 1NOMA 5J0OA 5DQGA 4GC6A 5KFXA 4Q43A 3M8SA 2R8GA 1MIWA 4UAYA 4MEYA 1MC8A 2W9BB 2FMSA 2VA2A 3BQ0A 7ICGA 4F50A 4WC1A 3H8WA 5KFBA 4UQGA 1TAUA 1DK2A 5DG8A 3THVA 4M47A 4BXOA 3Q8KA 4XQ8A 4B9SA 4M9HA 9ICUA 1BNPA 1ZQJA 3C1ZA 3PW5A 4QWEA 5IIJA 3T5LA 4KLOA 4P4MA 2NRTA 4UD5A 5DKWA 4DS4A 4G3IA 4RQ1A 2HHQA 5KG6A 1NK0A 4DS5A 2OWOA 4O3SA 3JYYA 1V9PA 2HHWA 5DQHA 8ICCA 1DGSA 4J9PA 4WC0A 5KTQA 3WFRE 1D8YA 1ZQLA 2ZHBA 5EWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DL5 A;  3BQ2 A;  4J9M A;  4KN4 A;  1X9W A;  3OV7 A;  5DB9 A;  4F8R A;  4I28 A;  8ICN A;  2JZB B;  2ZH6 A;  1ZQW A;  1A76 A;  4DOB A;  3AQN A;  3M8R A;  3ISC A;  3UQ0 A;  3GV8 B;  2BQR A;  2ZJA A;  1BPY A;  1ZJM A;  1ZQD A;  2VA3 A;  1OU5 A;  3AQK A;  1ZQB A;  4EBJ A;  4QZG A;  4YP3 A;  4WC2 A;  2C2R A;  3FYH A;  2KFZ A;  3OVS A;  5J2K A;  4M0A A;  8ICP A;  5EOZ A;  1XS9 D;  2BCR A;  1NK4 A;  9ICS A;  3H37 A;  1UA1 A;  1JXE A;  3ZD8 A;  4RQ6 A;  1XSN A;  2ALZ A;  4GLX A;  3HW8 A;  4DFJ A;  4DQP A;  2KFN A;  4QWA A;  4UB5 A;  2V9W A;  2M2T A;  1HJP A;  1DK3 A;  1ZQG A;  4X4P A;  4IG8 A;  5BPC A;  4KLH A;  2J6S A;  5HMM A;  2UVV A;  3KHR A;  1NKB A;  2XY6 A;  1TK8 A;  3PO4 A;  4NM2 A;  4YMN A;  5KT4 A;  3PW4 A;  1U49 A;  2W9C A;  2PXI A;  4DLG A;  8ICO A;  4YR2 A;  1N56 A;  4FBU A;  4O5K A;  2MAX A;  4RPX A;  3HP6 A;  3Q8L A;  2A1J A;  7ICM A;  3LWM A;  4KTQ A;  4C8N A;  5DDM A;  4UB2 A;  5CHG A;  4S3N A;  1U9L A;  3V7K A;  1ZQS A;  2AGQ A;  9ICW A;  4RQ7 A;  4F2S A;  5DEC A;  4DOC A;  2IMW P;  1TK0 A;  2KN7 A;  4AT8 B;  4CCH A;  3ZDE A;  3MBY A;  4J9S A;  1BPE A;  4K4I A;  4Q8E A;  8ICQ A;  9ICO A;  3MR6 A;  2JEI A;  4O3R A;  4RPZ A;  2VAN A;  4EYI B;  4ECV A;  4DFP A;  1N48 A;  4B9N A;  5CA7 A;  4F92 B;  4NLK A;  2BQ3 A;  5DBA A;  2BPG A;  4O5C A;  2NRZ A;  3WFO A;  2ZHA A;  2HHT A;  2DRA A;  1TFY A;  4YQW A;  4DL6 A;  1TV9 A;  4M9N A;  2XGP A;  2V4Q A;  1ZQT A;  3MR2 A;  9ICI A;  3UPS A;  1JIH A;  4RQ0 A;  3PR4 A;  4DSF A;  5III A;  4X4O A;  1JAJ A;  4RT2 A;  2BPF A;  3E2E A;  2HVH A;  5DB6 A;  5BOL A;  5KFF A;  3WFP A;  5IIN A;  3UXP A;  3V7L A;  5J2J A;  4ELU A;  5KFN A;  2I9G A;  8ICR A;  2C2D A;  1KLN A;  4B9L A;  5HRH A;  4JWM A;  1XU4 A;  3C23 A;  4PHE A;  3ISD A;  1ZQR A;  5KG2 A;  1KEJ A;  4O3P A;  5KG4 A;  1T4G A;  2BCU A;  4FHP A;  2PFN A;  3MGH A;  9ICH A;  4RNM A;  4KLD A;  4YXM A;  5F9L A;  4TQS A;  3HPO A;  1X9S A;  5KG5 A;  3AUO A;  4DL7 A;  3TAQ A;  4X5V A;  2BDP A;  4KLI A;  1Z00 A;  4ECW A;  2IBK A;  3EYZ A;  4R8U B;  3PO5 A;  4AT7 B;  4DWI A;  3RAX A;  3N4M B;  8ICG A;  4JUZ A;  2HW3 A;  4YXJ A;  3PVX A;  2IHM A;  3RR8 A;  1RXV A;  4FHY A;  3RJG A;  3T5K A;  3PW7 A;  2FPL A;  4DSI A;  4M9G A;  3ISB A;  1NJY A;  3TQ1 A;  2AGO A;  4B9M A;  4ED3 A;  4PGQ A;  4MF2 A;  1ZQU A;  3GII A;  5DDY A;  2P66 A;  3ZDD A;  2Q66 A;  4ED1 A;  4O9M A;  7ICR A;  2ZUB A;  4QZD A;  1ZQE A;  5KFU A;  5DB8 A;  2ASL A;  4C8K A;  4X0A A;  2B21 A;  3Q8R B;  4P4O A;  3MR3 A;  3JPO A;  4ED7 A;  4EBD A;  4QWC A;  4J9Q A;  3H4B A;  4NY8 A;  2ZUC A;  2DR9 A;  2ISO A;  4AT9 B;  4QWB A;  3K75 D;  4ECR A;  4XRH A;  1S10 A;  1Q78 A;  2XCP A;  4I2B A;  8ICB A;  9ICB A;  1WOT A;  2BCQ A;  1R8C A;  3RBE A;  3LK9 A;  2PFP A;  4LT6 A;  4ATB A;  5J2F A;  4RWP A;  4TUQ A;  1NJW A;  2FPK A;  4KLQ A;  5KFS A;  4B9T A;  1UEU A;  4HYK A;  4IRK A;  4IQT A;  2RDI A;  4WCW A;  8ICE A;  5KFD A;  1T3N A;  4KMU A;  4TUS A;  1TFW A;  5KFA A;  2R8J A;  2KTQ A;  8ICX A;  1QLN A;  4I2H A;  3OVA A;  4F3O A;  2ID1 A;  2R8H A;  1XC9 A;  3SZ2 A;  5KT5 A;  1L3T A;  9ICX A;  1KNY A;  1U48 A;  4DL3 A;  1VJ7 A;  3ZDA A;  5L9X A;  4ECQ A;  3PW2 A;  5KG0 A;  1UET A;  5DB7 A;  1XSP A;  4DFM A;  2LYH A;  1TVA A;  3OJS A;  2WTF A;  4EZ9 A;  5KFP A;  4X4S A;  1V4A A;  5J2I A;  1SL1 A;  3WFQ E;  1A77 A;  5DED A;  4JV0 A;  1LB2 B;  2NRW A;  5HRF A;  4BWJ A;  4I2D A;  3V6H A;  4UAW A;  3RH5 A;  3RH4 A;  2ZTC A;  3NGD A;  3ETL A;  8ICI A;  2O5A A;  4FHX A;  2DRB A;  1L3U A;  5KFH A;  2ZH1 A;  4ELV A;  1NKE A;  1ZQH A;  3UPQ A;  2ZH3 A;  4ECT A;  2FLL A;  1RPL A;  9ICN A;  4M6W A;  1ZQY A;  1FA0 A;  4E7X A;  5HML A;  3KHH A;  5J0Y A;  4DO9 A;  2Y1I A;  2AU0 A;  5IIL A;  2J6U A;  8ICY A;  4XQ7 A;  4FHW A;  3EZ5 A;  5J0P A;  3Q8Q B;  4X4U A;  1TKD A;  2KP7 A;  4TUP A;  4P4P A;  3UQ2 A;  3OUY B;  4FS1 A;  2F1H A;  2AQ0 A;  2DPJ A;  1ZQZ A;  4EBC A;  2PI5 A;  2HHV A;  3C66 A;  5J2E A;  3H39 A;  3EPI A;  1BGX T;  2W8L A;  1YLQ A;  3Q8S B;  3KHG A;  4F4Z A;  4RNN A;  1S0N A;  2FMP A;  3V6J A;  3GIM A;  5J2C A;  1BNO A;  1ZQM A;  5KFL A;  5CR0 A;  4NLZ A;  9ICP A;  3PR5 B;  2P6R A;  5DGA A;  3NYB A;  1T8E A;  3QEA Z;  1C7Y A;  3K4G A;  4QW9 A;  3IHQ B;  4FS2 A;  5DG9 A;  1K1Q A;  3BDP A;  1X2I A;  2NRV A;  5J2B A;  4DSE A;  3BQ1 A;  4DL2 A;  4EEY A;  4KN7 A;  4I2C A;  4YN4 A;  2ZJ5 A;  4M04 A;  4QZH A;  2HHS A;  7ICU A;  2PFO A;  4B9V A;  5KT2 A;  5IIO A;  1D9D A;  3IM1 A;  4LVS A;  2C22 A;  1SKR A;  1JX4 A;  1PZN A;  2BCS A;  4DQI A;  3PX6 A;  5HRD A;  4Z6C A;  4RT3 A;  4BXO B;  1S77 D;  9ICQ A;  1L3V A;  5F9N A;  5C5J A;  3G6V A;  4F4X A;  1ZJN A;  2NRX A;  3OJU A;  1JMS A;  5L1K A;  1ZQF A;  4C8O A;  4DQR A;  8ICW A;  2HHU A;  4ED8 A;  4B9U A;  4F93 B;  2XGQ A;  3OHB A;  1MIY A;  2ZH7 A;  2DVI A;  4DF8 A;  5DGB A;  1L3S A;  1ZET A;  3LQC B;  9ICJ A;  3EW9 A;  4O5E A;  5KFZ A;  1S0O A;  1UT8 A;  4JK1 A;  5J0Q A;  5BOM A;  3GQC A;  3EPG A;  2AQ4 A;  4KLJ A;  1S0V A;  1ZQP A;  4XUS A;  4PGX A;  5KT7 A;  3PW0 A;  3RTV A;  3M9O B;  2BCV A;  7ICJ A;  5DQI A;  5KG3 A;  1ZQQ A;  4J9L A;  4RNO A;  4ELT A;  4WC3 A;  5KFR A;  1NK8 A;  7ICF A;  4I2F A;  9ICL A;  4RWO A;  3C21 A;  4QZI A;  1BVS A;  1QSY A;  1IM4 A;  4UD4 A;  4RQ4 A;  4NKU A;  4KLE A;  2UVR A;  3MFH A;  2BHN A;  4PHP A;  3RJE A;  2PBE A;  4K4G A;  4BGD A;  4Q45 A;  1XO1 A;  4XA5 A;  1NJZ A;  4GXJ A;  4ECY A;  3AQL A;  4F91 B;  2ZH9 A;  8ICV A;  2R8I A;  4R65 A;  4F5O A;  4K4H A;  5HR9 A;  8ICJ A;  1MIV A;  5KG7 A;  4UAZ A;  4YD2 A;  4RZR A;  3JZ0 A;  4R66 A;  3C5G A;  4AT9 A;  4C8L A;  4I2G A;  4EBE A;  3C2K A;  4IQU A;  4MFF A;  4X0B A;  3PNC A;  4X4R A;  4P2H A;  1JXL A;  3AU2 A;  2DPI A;  4KLG A;  2DR7 A;  4JV1 A;  7ICO A;  4ZH4 A;  3OGU A;  5D4B A;  1MQ3 A;  1D8L A;  4JV2 A;  4LZG A;  3OHA A;  2A1J B;  4PHA A;  4YCX A;  3HWT A;  1BPD A;  2BGW A;  1SKW A;  4M5D A;  4RWQ A;  4O3N A;  4IQW A;  3SV4 A;  1NJX A;  1JQR A;  5KFG A;  5J0W A;  4F5N A;  4LZD A;  3RRH A;  3RB6 A;  3B0Y A;  5KFV A;  2W9B A;  4KLF A;  3ZDB A;  1KFD A;  4GC7 A;  1Z3E B;  1PX5 A;  1TK5 A;  3TAN A;  9ICG A;  4ECS A;  4FH3 A;  3ORY A;  3LWL A;  5KFC A;  3SI8 A;  1QTM A;  1ZQI A;  7ICL A;  1NK9 A;  4QZE A;  4RU9 A;  1EXN A;  2JEF A;  4IRC A;  4X4T A;  4FHV A;  1VFG A;  4O3Q A;  4TQR A;  4RQ2 A;  5KG1 A;  1MQ2 A;  4IR1 A;  7ICV A;  1U47 A;  9ICM A;  3C2L A;  2ZJ8 A;  1S97 A;  2FPM A;  3GIL A;  3H38 A;  4I29 A;  3TI0 A;  1SL0 A;  4ECU A;  4ED6 A;  4QZ9 A;  3SYZ A;  2BR0 A;  2PFQ A;  3H8J A;  3RH6 A;  2C2E A;  3GIK A;  1R89 A;  1WCN A;  2H5X A;  2P6U A;  3C1Y A;  2JZB A;  8ICF A;  1ZQN A;  2ZH4 A;  5KFI A;  5CB1 A;  1B43 A;  4KIT B;  1ZYQ A;  5HHH A;  3C2M A;  2ISP A;  7ICP A;  4EYH B;  9ICK A;  8ICA A;  4UB3 A;  3JPT A;  2MUT B;  4JWN A;  5J0S A;  4DQQ A;  1MSW D;  2O1P A;  1X9M A;  1S0M A;  4WBZ A;  4KLT A;  1Z00 B;  3OUY A;  3NTU A;  4IQV A;  1ZQA A;  4FH5 A;  1DOQ A;  4WBY A;  1JN3 A;  2DR5 A;  2VA8 A;  2KZ3 A;  2Y1J A;  9ICV A;  3JPP A;  4DQS A;  2F1I A;  4ECX A;  2F1J A;  2JEJ A;  3RJI A;  1BPX A;  1D9F A;  4QZA A;  5JUM A;  4RUC A;  3OSP A;  3PML A;  3FDS A;  1LV5 A;  4UB1 A;  4I2I A;  4BWM A;  1ZQX A;  1K1S A;  4YG2 A;  3OVB A;  2HVI A;  4NLG A;  5J0U A;  3BQT A;  5HRL A;  2Q0Z X;  2FMQ A;  2AGP A;  5KFT A;  3RRG A;  8ICU A;  1NK7 A;  4M9J A;  3UXO A;  3JPS A;  5KFE A;  4E0D A;  2W9A A;  4AT8 A;  4UBB A;  3G6Y A;  3HJ4 A;  5DBB A;  2ATL A;  9ICT A;  4DLE A;  1S76 D;  7ICQ A;  4NKT A;  5F2V O;  4F5R A;  2XCA A;  5J0R A;  3BJY A;  4IRD A;  1CEZ A;  5KT3 A;  3KTQ A;  1RYS A;  4I27 A;  3T5J A;  4F2R A;  3QZ7 A;  4DSJ A;  4Z6F A;  1XWL A;  4O0I A;  1ZQK A;  3H3A A;  3EWA A;  3GV5 B;  4YMO A;  2FLP A;  4NXZ A;  3TAP A;  8ICM A;  4KLM A;  5KFO A;  5J29 A;  4DFK A;  3RBD A;  4YD1 A;  5D46 A;  3V72 A;  2ZH5 A;  4F5P A;  5TZV A;  3PV8 A;  5KFM A;  4KLU A;  1R8A A;  3HIY A;  4DSL A;  4R64 A;  2XO7 A;  3TFR A;  2XY7 A;  3JPN A;  3LDA A;  2V4R A;  8ICK A;  5HC9 A;  3QEB Z;  3PY8 A;  4EBK A;  3RJK A;  3MDC A;  2XY5 A;  3V6K A;  2KZZ A;  9ICR A;  4QZF A;  3MFI A;  3QE9 Y;  1NO5 A;  4WC4 A;  3MDA A;  3MAB A;  3RR7 A;  4AT7 A;  5DBC A;  4R8U A;  4ED0 A;  2GWS A;  1F5A A;  4F4Y A;  5DLG A;  4DSK A;  4WC5 A;  2M2U A;  2BE3 A;  2FLN A;  3RB3 A;  4KLS A;  8ICZ A;  4M6W B;  2RDJ A;  1TAQ A;  5HHI A;  5D49 A;  4C8M A;  3QZ8 A;  3RJF A;  2M2W A;  3WFS C;  3RB4 A;  4UB4 A;  2M9N A;  3RJJ A;  4DOA A;  3GIJ A;  5J2A A;  7ICT A;  4E8F A;  4EP7 A;  1XSL A;  1U4B A;  3RJH A;  8ICH A;  8ICS A;  4DEZ A;  5J0X A;  2W8K A;  5IIM A;  4FO6 A;  1BPB A;  1COO A;  4RPY A;  4UBC A;  1Q79 A;  9ICE A;  4MFA A;  1CUK A;  3HJ1 A;  3ZD9 A;  1RZT A;  1Y88 A;  2ZTE A;  4YMM A;  5HRK A;  5HRB A;  1ARO P;  2M2V A;  3Q8M A;  3M9M B;  2PI4 A;  5HP4 A;  1KFT A;  4F4W A;  4BDP A;  1U45 A;  2XC9 A;  1L5U A;  4I2E A;  2UVW A;  2HHX A;  4Q44 A;  4ECZ A;  8ICT A;  4J9N A;  4NM1 A;  5KFW A;  1RYR A;  5L1I A;  4PGY A;  5KFJ A;  4Z6E A;  4QZC A;  3GFK B;  4MF8 A;  4EZ6 A;  4PH5 A;  3T5H A;  4KLL A;  2W9C B;  2HHP A;  3L9D A;  5KT6 A;  3H4D A;  4YR3 A;  1QSL A;  3C18 A;  5KFK A;  4YFK A;  2BQU A;  3JPR A;  3KHL A;  3MR5 A;  4O3O A;  1SL2 A;  2IA6 A;  9ICF A;  1TFR A;  5DLF A;  1UT5 A;  4RQ3 A;  2W9M A;  2ASD A;  2JEG A;  7ICS A;  1SKS A;  4IR9 A;  5IIK A;  7ICE A;  4E80 A;  3PMN A;  4J9R A;  5KFY A;  3N97 B;  7ICH A;  5EWG A;  4QZ8 A;  4RUA A;  3H40 A;  1B22 A;  2RFF A;  4QZB A;  2MUT A;  4YVZ A;  3C5F A;  2UVU A;  1R8B A;  4I2A A;  3V7J A;  4J9K A;  4GXK A;  2C28 A;  8ICL A;  9ICA A;  4RWN A;  4X4V A;  2R8K A;  9ICC A;  1UEV A;  2DR8 A;  2ZTD A;  5KFQ A;  3RAQ A;  2ZH8 A;  4M2Y A;  3TAR A;  4F5Q A;  4DF4 A;  3HX0 A;  4ATB B;  3TFS A;  1ZQO A;  5J0T A;  2NRK A;  1WCL A;  3SV3 A;  4ED2 A;  2ZH2 A;  3UXN A;  4R63 A;  1HUO A;  5HNK A;  3OSN A;  2IHN A;  5J2D A;  3M9N B;  5CJ7 A;  3Q8P B;  1NK5 A;  4MFC A;  7ICI A;  3MGI A;  5L1L A;  3HT3 A;  2ASJ A;  1T7P A;  5HRE A;  3H8S A;  3G6X A;  1KRP A;  3RB0 A;  4Z6D A;  5CWR A;  1ZQC A;  5HRG A;  4RQ8 A;  5J2G A;  2KZM A;  3GDX A;  4YR0 A;  4I2J A;  5EWF A;  4M9L A;  1NZP A;  2ZUD A;  1HUZ A;  4RQ5 A;  1UA0 A;  1KDH A;  4FBT A;  5L1J A;  4X4N A;  4X4Q A;  5DG7 A;  4PPX A;  4TUR A;  1KTQ A;  1NK6 A;  7ICK A;  3GV7 B;  2J6T A;  3PX0 A;  4PHD A;  4GXI A;  1NKC A;  3AU6 A;  2I1Q A;  4J9O A;  3AQM A;  5J2H A;  4F4K A;  3T3F A;  4DL4 A;  4Q8F A;  1ZQV A;  4MEX A;  1S9F A;  2DFL A;  3JPQ A;  1KFS A;  2BKE A;  2BPC A;  4QWD A;  1SZP A;  1QSS A;  3B0X A;  4WC6 A;  2AJQ A;  1KSP A;  1RXW A;  4QW8 A;  1H38 A;  1IXR A;  3PX4 A;  3ZDC A;  4NLN A;  1BPZ A;  5HRI A;  4WC7 A;  3H7I A;  5CP2 A;  7ICN A;  1NOM A;  5J0O A;  5DQG A;  4GC6 A;  5KFX A;  4Q43 A;  3M8S A;  2R8G A;  1MIW A;  4UAY A;  4MEY A;  1MC8 A;  2W9B B;  2FMS A;  2VA2 A;  3BQ0 A;  7ICG A;  4F50 A;  4WC1 A;  3H8W A;  5KFB A;  4UQG A;  1TAU A;  1DK2 A;  5DG8 A;  3THV A;  4M47 A;  4BXO A;  3Q8K A;  4XQ8 A;  4B9S A;  4M9H A;  9ICU A;  1BNP A;  1ZQJ A;  3C1Z A;  3PW5 A;  4QWE A;  5IIJ A;  3T5L A;  4KLO A;  4P4M A;  2NRT A;  4UD5 A;  5DKW A;  4DS4 A;  4G3I A;  4RQ1 A;  2HHQ A;  5KG6 A;  1NK0 A;  4DS5 A;  2OWO A;  4O3S A;  3JYY A;  1V9P A;  2HHW A;  5DQH A;  8ICC A;  1DGS A;  4J9P A;  4WC0 A;  5KTQ A;  3WFR E;  1D8Y A;  1ZQL A;  2ZHB A;  5EWE A; 
#chains in the Genus database with same CATH topology
 2LPE A;  5DB9 A;  3AEV A;  4KX5 A;  1WWV A;  3GV8 B;  1ZJM A;  2MU2 A;  1ZQB A;  3FYH A;  4UAT A;  2VKQ A;  8ICP A;  1JXE A;  2G09 A;  2ALZ A;  4GLX A;  2KFN A;  4DFJ A;  2M2T A;  1HJP A;  1KKX A;  3E58 A;  2B0C A;  4X4P A;  5EE0 A;  1NKB A;  5L1M A;  3PO4 A;  2DUY A;  3N7P D;  4NM2 A;  3PW4 A;  2B4V A;  8ICO A;  1N56 A;  4RPX A;  3HP6 A;  7ICM A;  3V7K A;  5J8Y C;  4DOC A;  3BS7 A;  4BUG A;  1TK0 A;  9ICO A;  2QKQ A;  1BPE A;  4AYB F;  2HOF A;  3M1Y A;  4RPZ A;  2VAN A;  1N48 A;  2HSZ A;  5CFS A;  4CF4 A;  2W3S A;  4C80 A;  2ZIV B;  2DRA A;  3EUB 2;  1TV9 A;  2V4Q A;  4PL2 A;  2HVH A;  2L5Y A;  2FJ6 A;  5DB6 A;  5BOL A;  2HMX A;  8ICR A;  5HRH A;  2YTU A;  2WHE A;  1VDV A;  2VJ5 A;  2Y9T A;  3I28 A;  3FM9 A;  1J2M A;  9ICH A;  5ALR A;  1QCK A;  1QQ7 A;  4I2F A;  1X6I A;  1YZ6 A;  4ECW A;  3PO5 A;  2LKY A;  3ER8 C;  4O6A A;  1RXV A;  4K9A A;  4NLC A;  2AGO A;  4B9M A;  4NXV A;  2FCL A;  2W3R A;  2OYY A;  3UMG A;  5DB8 A;  4X0A A;  4MHV A;  3MR3 A;  2DBY A;  4EBD A;  4J9Q A;  3H4B A;  5ALU A;  2GO7 A;  2ZUC A;  4ECR A;  1O08 A;  1Q78 A;  1WOT A;  4I2B A;  2K8B B;  1R8C A;  4G9B A;  3LK9 A;  4RWP A;  1NJW A;  5JU5 A;  2KJ5 A;  4UW9 A;  1N2X A;  4B9T A;  3UM9 A;  2K4H A;  4WCW A;  1NI3 A;  8ICE A;  4TUS A;  2KTQ A;  1M6Y A;  1Z1B A;  5KT5 A;  1MN8 A;  5KG0 A;  4Y2J A;  2WTF A;  2A19 A;  1SL1 A;  3WFQ E;  4JV0 A;  1LB2 B;  3CNH A;  3RH5 A;  2ZTC A;  4C4T A;  3ETL A;  1L3U A;  5KFH A;  2ZH3 A;  1RPL A;  2HBM A;  1ZQY A;  1FA0 A;  5IIL A;  3RF9 A;  8ICY A;  3Q8Q B;  4Y2U A;  4FS1 A;  1ZQZ A;  1BGX T;  3Q8S B;  2RRD A;  3GIM A;  1BNO A;  3HIL A;  1ZQM A;  2KVS A;  1T8E A;  3IHQ B;  1X2I A;  4DL2 A;  2EAN A;  1LKY A;  7ICU A;  2HHS A;  3ERC C;  5IIO A;  5AI4 A;  1PZN A;  1Q3V A;  4FO1 A;  2ZIX A;  2KMD A;  1L3V A;  3KZX A;  3G6V A;  3PZP A;  4C8O A;  1ZQF A;  3D2N A;  4C7Y A;  4F93 B;  2DVI A;  5DGB A;  9ICJ A;  3NVO A;  1RG6 A;  4JK1 A;  4KLJ A;  1FFU A;  1N61 A;  2Y0S F;  5ALT A;  7ICJ A;  1SIJ A;  1NK8 A;  3NVZ A;  7ICF A;  9ICL A;  4PL1 A;  3C21 A;  4QZI A;  1QSY A;  2UVR A;  2PBE A;  4PHP A;  4K4G A;  4GXJ A;  4ECY A;  3L3F X;  4OD0 A;  2KV2 A;  4R66 A;  4AT9 A;  4OJ5 A;  2E8O A;  4IQU A;  2BZF A;  4KLG A;  4JV1 A;  7ICO A;  4ZH4 A;  5D4B A;  1KW4 A;  4LZG A;  3HWT A;  4M5D A;  1PVP A;  4IQW A;  1XO0 A;  4FZN A;  1JQR A;  5KFV A;  2W9B A;  3KKA A;  1WYG A;  3ORY A;  4RU9 A;  4IRC A;  4FHV A;  4O3Q A;  4IR1 A;  5B66 U;  7ICV A;  1U47 A;  4MKP A;  1S97 A;  2FPM A;  2KNJ A;  4A8E A;  4ED6 A;  4KM5 A;  3GIK A;  2P6U A;  8ICF A;  2JZB A;  1ZQN A;  5KFI A;  7ICP A;  1FFV A;  3VC8 A;  4EYH B;  4DQQ A;  1SXD A;  4KLT A;  1ZQA A;  2G0A A;  4WBY A;  3VCB A;  3JPP A;  4NWI A;  1BPX A;  4CF5 A;  4GIB A;  3FDS A;  3SAH A;  4BWM A;  4UB1 A;  1K1S A;  4YG2 A;  4NLG A;  2Q0Z X;  2AGP A;  3RRG A;  5KFE A;  2W9A A;  4UBB A;  3HJ4 A;  5DBB A;  9ICT A;  4CE6 A;  7ICQ A;  5F2V O;  1PVQ A;  4K96 A;  2ZXH A;  2WB1 F;  2P35 A;  3H0R B;  1CEZ A;  5KT3 A;  3AN1 A;  2IHO A;  5CFT A;  2H3Q A;  1WG8 A;  1ZQK A;  2HN2 A;  3EWA A;  3GV5 B;  4YMO A;  2FLP A;  8ICM A;  2K4P A;  5J29 A;  2JMG A;  3ER9 B;  4YD1 A;  3V72 A;  3L4P A;  3QU5 A;  3PV8 A;  1R8A A;  5G5H A;  5HC9 A;  1VLB A;  1J2N A;  3RJK A;  2XY5 A;  4NJ8 A;  3V6K A;  4FZM A;  4WC4 A;  3MFI A;  2ZG6 A;  3MAB A;  3RR7 A;  2HDO A;  5ALF A;  5DBC A;  4ED0 A;  1F5A A;  4F4Y A;  4WC5 A;  2BE3 A;  2RDJ A;  5D49 A;  4C8M A;  2F8L A;  2MA1 A;  3T79 A;  3GIJ A;  7ICT A;  4EP7 A;  8ICS A;  1L8L A;  1CUK A;  3HJ1 A;  3ZD9 A;  1RZT A;  1Y88 A;  2ZTE A;  1FIQ A;  1RDF A;  5HP4 A;  1L8O A;  4F4W A;  5AKY A;  4J9N A;  4NM1 A;  5L1I A;  3GFK B;  4EZ6 A;  5HR7 A;  4KLL A;  3CRX A;  2W9C B;  3H4D A;  1AQ6 A;  1QH9 A;  2BQU A;  3KHL A;  1SL2 A;  2DKX A;  4O3O A;  2G5H B;  1UT5 A;  4RQ3 A;  2W9M A;  3MCR A;  2JEG A;  3CK6 A;  4OJO A;  7ICE A;  4EGW A;  3KD3 A;  7ICH A;  4QZ8 A;  4PZN A;  2RFF A;  4QZB A;  4YVZ A;  4I2A A;  3V7J A;  5ALE A;  5ALV A;  2ZH8 A;  4M2Y A;  3TAR A;  4F5Q A;  4EEK A;  3TFS A;  2YN4 A;  1WCL A;  2PMZ C;  5HNK A;  3IG8 A;  2IHN A;  5CJ7 A;  2H3I A;  5HRE A;  3HT3 A;  2ASJ A;  3H8S A;  2BBH A;  3RB0 A;  4M9L A;  4Y2P A;  5EWF A;  4YR0 A;  2ZUD A;  2KOB A;  5DG7 A;  2DKZ A;  4TUR A;  1NK6 A;  4KMO B;  4PHD A;  4Y2T A;  3AU6 A;  2I1Q A;  3JCF A;  4F4K A;  3T3F A;  2QAR A;  1KFS A;  2LMR A;  1UPH A;  2KIC A;  1F5S A;  3PSF A;  1IXR A;  3ZDC A;  1BPZ A;  5HRI A;  4WC7 A;  5CP2 A;  7ICN A;  4GC6 A;  4JMU A;  3M8S A;  2KE7 A;  4WC1 A;  4MEY A;  7ICG A;  2FMS A;  1X9X A;  4UQG A;  5DG8 A;  4B9S A;  3J81 j;  3QUB A;  3PW5 A;  5CEH A;  2VJ4 A;  5DKW A;  3KFU F;  3F53 A;  2IOF K;  4O3S A;  3JYY A;  2OWO A;  4RQM A;  5DQH A;  4J9P A;  4WC0 A;  1D8Y A;  3ETR A;  4J03 A;  1X9W A;  4F8R A;  4OAI Z;  4DOB A;  1BPY A;  1ZQD A;  1OU5 A;  4QZG A;  4WC2 A;  5J2K A;  1XS9 D;  2YB4 A;  4WJ3 B;  4UB5 A;  4IG8 A;  4N7R A;  3QUC A;  3NVY A;  4KLH A;  3TAD C;  5KNI A;  2Q4T A;  3BS5 A;  4YMN A;  1XNS A;  4DLG A;  4YR2 A;  3NRW A;  4GFJ A;  3LWM A;  2O6K A;  4C8N A;  5DDM A;  4K9B A;  5CHG A;  2Y9U A;  1U9L A;  5DEC A;  4AT8 B;  2KN7 A;  4CCH A;  3MBY A;  4J9S A;  4K4I A;  4Q8E A;  3WKA A;  3R9K A;  3MR6 A;  2CXY A;  4DFP A;  1PK1 A;  4F92 B;  2BQ3 A;  4O5C A;  2ZHA A;  5AHX A;  4BJQ A;  4DL6 A;  4UAS A;  1SZH A;  3MR2 A;  5AI6 A;  2D6F C;  3PR4 A;  5III A;  4Y2X A;  2BPF A;  3WFP A;  3UXP A;  1ZQR A;  4O3M A;  4O3P A;  5KG4 A;  2BCU A;  4FHP A;  3QNM A;  2PFN A;  5F9L A;  3HPO A;  4DL7 A;  4P0Q A;  2BDP A;  3OTQ A;  5CHE A;  3L5K A;  3RAX A;  5AI9 A;  2IHM A;  5ALK A;  2FPL A;  1C20 A;  1NJY A;  4PGQ A;  1ZQU A;  4AP9 A;  2Q66 A;  5ALJ A;  7ICR A;  4NXX A;  3JPO A;  4ED7 A;  2KJ8 A;  2DR9 A;  1V38 A;  3K75 D;  1S10 A;  4XRH A;  9ICB A;  2PFP A;  5J2F A;  4OO1 J;  2FPK A;  2KJ9 A;  3HKZ C;  1OUQ A;  2WF7 A;  4IRK A;  4IQT A;  5AIC A;  1TFW A;  2DF4 B;  8ICX A;  4F3O A;  1NZB A;  3QU9 A;  2KSO B;  2R8H A;  9ICX A;  4ECQ A;  1LVH A;  1N5W A;  1TVA A;  3OJS A;  5KFP A;  4X4S A;  2NYV A;  5J2I A;  5DED A;  2NRW A;  5HRF A;  5B5E U;  4I2D A;  3OPX A;  4FHX A;  2ZH1 A;  1NKE A;  3WK4 A;  2FLL A;  2RP5 A;  2KKP A;  1J97 A;  4XQ7 A;  5AKJ A;  1CI4 A;  3KBB A;  3M6Z A;  4UAV A;  1TKD A;  3UQ2 A;  2DPJ A;  2HHV A;  2PI5 A;  5J2E A;  2W8L A;  2EZX A;  4F4Z A;  4RNN A;  2FMP A;  3V6J A;  1A0P A;  3QEA Z;  1C7Y A;  4QW9 A;  5AIA A;  4FS2 A;  3SR6 A;  4I2C A;  3BQ1 A;  8ICG A;  4KN7 A;  2ZJ5 A;  4OAF A;  4QZH A;  4B9V A;  5KT2 A;  4LVS A;  2C22 A;  1SKR A;  2BCS A;  4RT3 A;  1S77 D;  3CYM A;  3F2C A;  2HOI A;  2KIV A;  5F9N A;  4F4X A;  2NRX A;  5L1K A;  8ICW A;  2AH5 A;  5AIB A;  4DQR A;  4ED8 A;  1F44 A;  4B9U A;  4DF8 A;  1ZET A;  3LQC B;  4OJ6 A;  4O5E A;  4UAR A;  4K8V A;  5J0Q A;  5BOM A;  1S0V A;  2LM1 A;  4XUS A;  4PGX A;  5KT7 A;  2BCV A;  4ICA A;  2FE9 A;  4J9L A;  2OH2 A;  4ELT A;  5KFR A;  5AK4 A;  2OXO A;  2F2A B;  3RJE A;  4U7C A;  4XA5 A;  1NJZ A;  3AQL A;  2WF5 A;  2ZH9 A;  4R65 A;  1MIV A;  3ED5 A;  3JZ0 A;  3GZF A;  1COK A;  4X0B A;  3PNC A;  2XI9 A;  1X66 A;  3AU2 A;  2DPI A;  5D62 A;  3OGU A;  1D8L A;  1SKW A;  4YCX A;  2BGW A;  2YY6 A;  1NJX A;  4QIW F;  5KFG A;  5J0W A;  1Q3U A;  5ALI A;  3RRH A;  3RB6 A;  4GC7 A;  5ALG A;  1PX5 A;  3TAN A;  5B3Q A;  4FH3 A;  1YT3 A;  1QTM A;  5AKL A;  7ICL A;  1VFG A;  1L7N A;  3SAF A;  4TQR A;  4RQ2 A;  1ZQ1 C;  2OHF A;  4B6J A;  3TI0 A;  4ECU A;  3SYZ A;  2C2E A;  1R89 A;  2ISP A;  1B43 A;  4PJ0 U;  3N7R C;  4JWN A;  2O1P A;  2R18 A;  4WH5 A;  1Z1V A;  4Y2R A;  4CDG A;  2DR5 A;  2XID A;  2KZ3 A;  1A6S A;  1TAM A;  2ZIU A;  2LBO A;  1QQ6 A;  2F1J A;  2JEJ A;  3RJI A;  5JUM A;  4RUC A;  5B3P A;  4I2I A;  3SEN A;  1ZD3 A;  1NK7 A;  4HAI A;  3JPS A;  2W03 A;  5G5G A;  4DLE A;  2XCA A;  4IRD A;  2KKV A;  3SEI A;  4I27 A;  3T5J A;  4F2R A;  4EV6 A;  5T14 A;  3A0H U;  3E0F A;  3HJE A;  3ONN A;  5KFO A;  5ALM A;  5KFM A;  4R64 A;  3TAD A;  3DDH A;  2XO7 A;  3TFR A;  2V4R A;  3LDA A;  5ALO A;  1X6J A;  4AYB C;  3QE9 Y;  3MDA A;  2QB1 A;  3NKU A;  4AT7 A;  4R8U A;  2GWS A;  2YB1 A;  1SWV A;  2XIC A;  3NRZ A;  1L6N A;  4IS7 A;  3RJJ A;  2M9N A;  5J2A A;  2OM6 A;  4FO6 A;  1Q79 A;  4CF3 A;  4MFA A;  3NWI A;  2OCE A;  2VIX A;  4DFD A;  2EDU A;  1HIW A;  2LI6 A;  1U45 A;  1L5U A;  2HHX A;  4ECZ A;  1SB3 C;  5KFW A;  1RYR A;  1LKY B;  5KT6 A;  3C18 A;  2K8A A;  5KFK A;  3MR5 A;  3WK7 A;  2JRZ A;  4C4R A;  1B4F A;  2ZIX B;  4EEN A;  1SKS A;  2CRX A;  4IR9 A;  5ALY A;  2YMP A;  4E80 A;  5EWG A;  4RUA A;  2KEY A;  2IOH A;  5AK3 A;  2KHV A;  4J9K A;  8ICL A;  4EX6 A;  2R8K A;  1UEV A;  2DR8 A;  3U26 A;  2H3Z A;  2W54 A;  1DGJ A;  5J0T A;  4ED2 A;  1NK5 A;  1T7P A;  3G6X A;  1KRP A;  5CWR A;  5HRG A;  2FDR A;  1HUZ A;  2CPR A;  1KDH A;  5L1J A;  4X4N A;  4PPX A;  2LHT A;  2PKE A;  7ICK A;  1JAL A;  4GXI A;  3EF2 A;  4J9O A;  3AQM A;  4DL4 A;  5AKE A;  4UB6 U;  5AK5 A;  1S9F A;  2BKE A;  1QSS A;  1OW5 A;  1KSP A;  1RXW A;  2D8C A;  3D2Q A;  5AM3 A;  3PX4 A;  5DQG A;  1S5L U;  4UAY A;  2W9B B;  2VA2 A;  5KFB A;  3AL0 B;  3THV A;  4M9H A;  4BXO A;  3Q8K A;  1BNP A;  2G06 A;  3T5L A;  1IG6 A;  4DS4 A;  5ALP A;  1CRX A;  5KG6 A;  2HHW A;  5KTQ A;  4UAW A;  4DL5 A;  2G07 A;  3OV7 A;  4KN4 A;  4I28 A;  8ICN A;  2JZB B;  2ZH6 A;  1A76 A;  4FZL A;  4HX0 A;  3UQ0 A;  2BQR A;  2VA3 A;  4EBJ A;  4YP3 A;  1NK4 A;  3H37 A;  1UA1 A;  3ZD8 A;  2ZIW A;  2HOQ A;  3HW8 A;  4QWA A;  2A3V A;  1SV4 A;  1T94 A;  3IRU A;  1N60 A;  5AKX A;  5HMM A;  3WK6 A;  3KHR A;  5J8Y A;  1TK8 A;  1DXS A;  1QQ5 A;  2W9C A;  2Y0S C;  3B9J A;  4FBU A;  4O5K A;  2MAX A;  2A1J A;  4UB2 A;  1ZQS A;  3ZI4 A;  4F2S A;  2IMW P;  4JLX A;  4EYI B;  4ECV A;  1UCV A;  3AMZ A;  4NLK A;  2BPG A;  3WFO A;  2HHT A;  4FE3 A;  4YQW A;  4M9N A;  2XGP A;  1ZQT A;  4LJX A;  9ICI A;  3UPS A;  4DSF A;  4RT2 A;  4I0U A;  2E1F A;  1TE2 A;  5IIN A;  4ELU A;  5KFN A;  2I9G A;  2C2D A;  1KLN A;  2EZZ A;  3ISD A;  4PHE A;  5KG2 A;  1KEJ A;  2DL0 A;  5AI0 A;  3MGH A;  4RNM A;  4KLD A;  4YXM A;  1X9S A;  5KG5 A;  2K60 A;  3AUO A;  4X5V A;  4KLI A;  1GPJ A;  1Z00 A;  4EX7 A;  3EYZ A;  2B56 A;  4DWI A;  3N4M B;  1X40 A;  3BZK A;  4YXJ A;  3PVX A;  3T5K A;  4JLZ A;  4DSI A;  4P0P A;  3KOO A;  2EAO A;  3ISB A;  4IL6 U;  4MF2 A;  4ED3 A;  1Q8K A;  3GII A;  5DDY A;  2P66 A;  3ZDD A;  4ED1 A;  4O9M A;  3K7D A;  2ZUB A;  1ZQE A;  4C8K A;  2B21 A;  3N7S C;  3Q8R B;  4P4O A;  3QUT A;  2ISO A;  4QWB A;  5ALW A;  2WAQ F;  3NS1 A;  8ICB A;  2BCQ A;  1OXJ A;  4LT6 A;  4TUQ A;  4KLQ A;  2I5H A;  4HYK A;  2RDI A;  5KFD A;  2F76 X;  2EAP A;  1QLN A;  3OVA A;  2ID1 A;  1KNY A;  2GAF D;  4DL3 A;  2JV3 A;  5KL8 B;  3ZDA A;  1UET A;  5DB7 A;  4EZ9 A;  1X42 A;  4DFM A;  2KD1 A;  3TKA A;  1V4A A;  3AQE A;  4BWJ A;  2WB1 C;  2H3F A;  8ICI A;  1NNL A;  4OCZ A;  1ZRM A;  2K4E A;  1ZQH A;  3UPQ A;  4ECT A;  3H8M A;  4M6W A;  4E7X A;  3QU2 A;  2J6U A;  4FHW A;  4X4U A;  2QB0 B;  2YML A;  4K98 A;  1KN5 A;  4P4P A;  3M6K A;  3OUY B;  2YMM A;  2AQ0 A;  3C66 A;  2QAR B;  3EPI A;  1S0N A;  5J2C A;  4NLZ A;  9ICP A;  2JH7 A;  2P6R A;  5DG9 A;  3BDP A;  2NRV A;  3WK8 A;  1N62 A;  2QLT A;  4DSE A;  4EEY A;  4M04 A;  2ZH4 A;  1D9D A;  4CRX A;  3PX6 A;  5HRD A;  4Z6C A;  1FO4 A;  5K4L A;  5D61 A;  2K4I A;  9ICQ A;  4QNL A;  5C5J A;  4UD5 A;  4UAU A;  1ZJN A;  1JMS A;  2MSN A;  2ZH7 A;  2HHU A;  1MIY A;  3OHB A;  1L3S A;  1KQQ A;  5AM2 A;  3EW9 A;  5D63 A;  5KFZ A;  1S0O A;  1UT8 A;  2AQ4 A;  3GQC A;  1ZOL A;  3SMV A;  1ZQP A;  2EAM A;  4ATB A;  3M9O B;  5EE3 A;  5DQI A;  1ZQQ A;  4WC3 A;  2F77 X;  4CGZ A;  4RWO A;  4UD4 A;  1BVS A;  4RQ4 A;  4KX3 A;  4KLE A;  2BHN A;  3TAC B;  5ALD A;  1SWW A;  4NXT A;  8ICV A;  2R8I A;  4F5O A;  4K4H A;  5HR9 A;  8ICJ A;  4UAZ A;  4YD2 A;  4RZR A;  2KHQ A;  5KAF U;  2GOL A;  4I2G A;  4EBE A;  2NO5 A;  4X4R A;  4P2H A;  3WK5 A;  1JXL A;  1MQ3 A;  5ALN A;  3OHA A;  4RWQ A;  3SV4 A;  3KZI U;  2N1R A;  3ZDB A;  1KFD A;  1Z3E B;  5EE1 A;  9ICG A;  1PK1 B;  3LWL A;  5KFC A;  3SI8 A;  1NK9 A;  2K8C B;  4QZE A;  1EXN A;  1MQ2 A;  1RQL A;  4NL9 C;  9ICM A;  3C2L A;  3H38 A;  2IUB A;  3NAS A;  2BR0 A;  1L7O A;  2PFQ A;  3RH6 A;  2H5X A;  3C1Y A;  5CB1 A;  5HHH A;  3C2M A;  1HEK A;  2GLE A;  9ICK A;  1P7D A;  8ICA A;  2MUT B;  5J0S A;  1MSW D;  1ZD5 A;  1X9M A;  4EEB A;  3NTU A;  4IQV A;  2WFA A;  4FH5 A;  3MGV A;  1DOQ A;  1JN3 A;  2JR5 A;  3UMB A;  2Y1J A;  2HCF A;  9ICV A;  5AKG A;  5CRX A;  4DQS A;  4LEV A;  1N5X A;  2F1I A;  3IP4 B;  4ECX A;  1O03 A;  3PML A;  3BQT A;  2FMQ A;  8ICU A;  5C0Y A;  4ACO A;  4USA A;  2B6G A;  3G6Y A;  2ATL A;  1S76 D;  2BDU A;  2E8M A;  4F5R A;  5J0R A;  3WKE A;  3KTQ A;  3C28 A;  2ZIV A;  3QZ7 A;  4DSJ A;  4Z6F A;  1XWL A;  3H3A A;  4CNQ A;  3AQF A;  2LYA A;  3LVW A;  5AKZ A;  3RBD A;  4WQL A;  2ZH5 A;  4F5P A;  4KLU A;  3HIY A;  5AK6 A;  2E3T A;  3JPN A;  4EBK A;  3MDC A;  2KZZ A;  9ICR A;  4QZF A;  4US9 A;  2M2U A;  4KLS A;  3QZ8 A;  5HHI A;  2HI0 A;  4UB8 U;  3QU4 A;  2M2W A;  3WFS C;  3D6J A;  3I1Y A;  1N63 A;  1B0X A;  1XSL A;  1U4B A;  1ED1 A;  3RJH A;  8ICH A;  1V97 A;  5J0X A;  5IIM A;  1BPB A;  4RPY A;  9ICE A;  3PHZ A;  1SGG A;  5HRK A;  1ARO P;  2M2V A;  3Q8M A;  3M9M B;  1PUZ A;  4BDP A;  2DQN B;  4I2E A;  1SV0 C;  4Q44 A;  8ICT A;  4PGY A;  2YX8 A;  4Z6E A;  4QZC A;  1VJ5 A;  2HHP A;  4Y2V A;  3L9D A;  3QYP A;  4YFK A;  1JRO A;  3JPR A;  3CP8 A;  5DLF A;  3C29 A;  4J9R A;  3N97 B;  3H40 A;  1B22 A;  1R8B A;  4GXK A;  2C28 A;  2WF9 A;  9ICA A;  9ICC A;  2ZTD A;  5KFQ A;  3RAQ A;  4K99 A;  4DF4 A;  2H3V A;  1ZQO A;  4OJP A;  3SV3 A;  1SXE A;  3UXN A;  4R63 A;  1HUO A;  3OSN A;  7ICI A;  5J2D A;  4MFC A;  3MGI A;  2JHD A;  2HN1 A;  4Z6D A;  1ZQC A;  5ALS A;  2AHO B;  3A0B U;  1NZP A;  4O69 A;  4K97 A;  1RQN A;  3PX0 A;  1KL9 A;  1Q46 A;  4Y2Y A;  1NKC A;  4NXW A;  2DGZ A;  3CW2 C;  4Q8F A;  1JRP A;  1PK3 A;  2DFL A;  3JPQ A;  3B0X A;  2AJQ A;  3WK9 A;  4QW8 A;  4NV0 A;  4NLN A;  2HBK A;  3PSI A;  4Y2S A;  1NOM A;  5J0O A;  3N28 A;  4LEZ A;  3H8W A;  1TAU A;  4M47 A;  2K89 A;  3RFA A;  1ZQJ A;  3C1Z A;  5GTH U;  1YZ7 A;  5ALH A;  2NRT A;  2HHQ A;  5ALQ A;  1DGS A;  3WFR E;  4C7Z A;  1MIW A;  3D2S A;  2ZHB A;  3BQ2 A;  4J9M A;  1WWU A;  1ZQW A;  3AQN A;  3M8R A;  4LEW A;  3ISC A;  2RLT A;  2ZJA A;  3AQK A;  2HBL A;  2C2R A;  2KFZ A;  3OVS A;  4M0A A;  5EOZ A;  2BCR A;  9ICS A;  4RQ6 A;  1XSN A;  4DQP A;  2V9W A;  3IV6 A;  1DK3 A;  3WU2 U;  1ZQG A;  1L7P A;  2ZIU B;  3NUQ A;  4U6P A;  5BPC A;  2J6S A;  2UVV A;  2XY6 A;  4FFD A;  5KT4 A;  1U49 A;  2PXI A;  3IDW A;  3NVV A;  3Q8L A;  4KTQ A;  4S3N A;  2AGQ A;  9ICW A;  4F71 A;  2FI1 A;  4RQ7 A;  2DWQ A;  2NO4 A;  3PSP A;  3ZDE A;  8ICQ A;  2JEI A;  4O3R A;  4B9N A;  5CA7 A;  1Z4O A;  3DV9 A;  5DBA A;  2NRZ A;  1TFY A;  2BBJ A;  3UMC A;  1JIH A;  4RQ0 A;  4X4O A;  1JAJ A;  3E2E A;  4C4S A;  5F3X B;  5KFF A;  4O68 A;  3V7L A;  5J2J A;  2F8K A;  3LYS A;  4B9L A;  4JWM A;  1XU4 A;  3C23 A;  1T4G A;  4QIW C;  2A1A A;  2JH1 A;  4TQS A;  1KFT A;  3TAQ A;  2GH1 A;  2EZY A;  1Z4N A;  2IBK A;  2KVC A;  4AT7 B;  4R8U B;  3BZC A;  3WKC A;  4JUZ A;  1ZXI A;  2HW3 A;  1UQV A;  3RR8 A;  4FHY A;  3RJG A;  3PW7 A;  5EE9 A;  4M9G A;  2EQY A;  1IV8 A;  3TQ1 A;  1K5O A;  3ICX A;  4QZD A;  4NL9 A;  5KFU A;  2ASL A;  5AM1 A;  3S6J A;  2F44 A;  4NY8 A;  4QWC A;  2W11 A;  5TIS U;  5ALX A;  4AT9 B;  2XCP A;  2PMZ F;  3RBE A;  5AKI A;  3MC1 A;  5KFS A;  3I76 A;  1UEU A;  3QUQ A;  2XVT A;  2EH9 A;  4KMU A;  1T3N A;  5KFA A;  2R8J A;  4I2H A;  1XC9 A;  3SZ2 A;  1L3T A;  4EED A;  1U48 A;  1VJ7 A;  2AXT U;  5L9X A;  3PW2 A;  1XSP A;  2LYH A;  4KB6 A;  1A77 A;  5AM5 A;  3V6H A;  3RH4 A;  1PVR A;  3NGD A;  5E79 U;  2O5A A;  2DRB A;  4OJL A;  5KL1 B;  4ELV A;  3WKB A;  4NXU A;  9ICN A;  2W55 A;  5HML A;  3KHH A;  5J0Y A;  4DO9 A;  2Y1I A;  2AU0 A;  1RM6 C;  3EZ5 A;  4O67 A;  5J0P A;  1DRG A;  5H2F U;  2KP7 A;  4TUP A;  5GTI U;  2JGA A;  1Z19 A;  2F1H A;  4EBC A;  3H39 A;  1YLQ A;  3KHG A;  3F2D A;  5HR6 A;  5KFL A;  5CR0 A;  3PR5 B;  5DGA A;  3NYB A;  3H0L B;  3K4G A;  1K1Q A;  5J2B A;  2DR7 A;  4YN4 A;  2PFO A;  1T3Q A;  3IM1 A;  4DQI A;  1JX4 A;  3GU3 A;  4BXO B;  4XJE A;  2YMQ A;  5ALL A;  1S8O A;  3OJU A;  4X4Q A;  3AM9 A;  2XGQ A;  1GO3 F;  2E8N A;  3EPG A;  3PW0 A;  3RTV A;  5KG3 A;  3QU7 A;  4RNO A;  1ZD4 A;  4NKU A;  1IM4 A;  4QJF B;  3MFH A;  1RYU A;  1SV0 A;  4BGD A;  4Q45 A;  1XO1 A;  4F91 B;  2ZIW B;  5KG7 A;  3C5G A;  4C8L A;  3C2K A;  4MFF A;  2Z7J A;  5CFU A;  1KBU A;  4JV2 A;  3F5E A;  2A1J B;  2E1E A;  4PHA A;  1BPD A;  3SQI A;  4O3N A;  4F5N A;  4LZD A;  1MA7 A;  1UHU A;  3B0Y A;  5AKK A;  4KLF A;  4BX9 C;  1TK5 A;  4ECS A;  1URJ A;  3F2B A;  2LYB A;  3FAH A;  1JUD A;  1ZQI A;  4X4T A;  2JEF A;  2W04 A;  5FP0 A;  5KG1 A;  2ZJ8 A;  3GIL A;  2E8P A;  4I29 A;  1SL0 A;  4QZ9 A;  3H8J A;  5JTI A;  2OEH A;  2LM4 A;  5KAI U;  1WCN A;  5AM0 A;  4KIT B;  1ZYQ A;  1FEZ A;  4UB3 A;  3JPT A;  2QB0 A;  1F0M A;  2WF8 A;  4WBZ A;  1WUD A;  1S0M A;  3OUY A;  1Z00 B;  3IN5 A;  2I6X A;  2E5S A;  1ECW A;  2VA8 A;  3HKZ F;  2W7O A;  3PST A;  5A0L A;  4P0P B;  1ZRN A;  2MRL A;  1D9F A;  4QZA A;  3OSP A;  2RQ5 A;  1LV5 A;  1ZQX A;  4ZOH C;  3OVB A;  2HVI A;  5HRL A;  2G5I B;  5J0U A;  3O0F A;  4RQN A;  5KFT A;  4M9J A;  3UXO A;  2JXJ A;  3SAG A;  4E0D A;  4AT8 A;  3K1R B;  4NKT A;  3BJY A;  4DCC A;  1RYS A;  3FC4 A;  2RHF A;  4EEL A;  4O0I A;  5JTG A;  4NXZ A;  3TAP A;  4KLM A;  3SD7 A;  4DFK A;  2CN1 A;  2YQE A;  5D46 A;  5TZV A;  4DSL A;  2XY7 A;  8ICK A;  2KIW A;  3IG5 A;  5AI8 A;  3WKD A;  2W43 A;  3QEB Z;  3PY8 A;  2ESE A;  1NO5 A;  4Y2Q A;  2WF6 A;  3OWG A;  5DLG A;  4DSK A;  2FLN A;  3RB3 A;  3M7D A;  8ICZ A;  4M6W B;  1D8B A;  1TAQ A;  2D3D A;  3RJF A;  4WOY A;  3RB4 A;  4UB4 A;  2G08 A;  4DOA A;  4E8F A;  2GA9 D;  4DEZ A;  2W8K A;  3F5A A;  1COO A;  4UBC A;  2ZXI A;  2KG5 A;  4YMM A;  5HRB A;  2PI4 A;  1IIP A;  2XC9 A;  4JB3 A;  2UVW A;  3NVW A;  4NLB A;  4MF8 A;  3BS5 B;  5KFJ A;  4C0Z A;  4PH5 A;  3T5H A;  5AM4 A;  4YR3 A;  1QSL A;  4PZO A;  2IA6 A;  9ICF A;  1TFR A;  2NV3 A;  2ASD A;  1L7M A;  7ICS A;  5IIK A;  2HBJ A;  3PMN A;  3LVV A;  5KFY A;  2KSO A;  2EWR A;  5AI5 A;  3C5F A;  2MUT A;  2UVU A;  4RWN A;  4X4V A;  3QX7 A;  3BQ7 A;  3HRD D;  4ATB B;  3HX0 A;  2WAQ C;  3KKA C;  4WQK A;  2NRK A;  2ES6 A;  2ZH2 A;  3M9N B;  3Q8P B;  5L1L A;  4RQ8 A;  2M0N A;  5J2G A;  2KZM A;  3GDX A;  4I2J A;  2W7P A;  4FBT A;  4RQ5 A;  1UA0 A;  2KK0 A;  1KTQ A;  3GV7 B;  2J6T A;  4P0Q B;  4F72 A;  5J2H A;  1JI7 A;  4IC9 A;  1ZQV A;  4MEX A;  2BPC A;  4QWD A;  1SZP A;  3H0M B;  4WC6 A;  1H38 A;  2ODG A;  5AKH A;  3H7I A;  4OAH A;  2IOF A;  5KFX A;  4Q43 A;  3DEE A;  2R8G A;  1MC8 A;  1ZD2 P;  3BQ0 A;  4F50 A;  2F3N A;  3QXG A;  1DK2 A;  5JRT A;  4XQ8 A;  9ICU A;  4QWE A;  5IIJ A;  4KLO A;  4US8 A;  3K1Z A;  4P4M A;  3ALR A;  5ALZ A;  4G3I A;  4RQ1 A;  1NK0 A;  4DS5 A;  2B51 A;  1V9P A;  1V85 A;  8ICC A;  1ZQL A;  4LEY A;  4OAG A;  5EWE A; 
#chains in the Genus database with same CATH homology
 4DL5 A;  3BQ2 A;  4J9M A;  4KN4 A;  1X9W A;  3OV7 A;  5DB9 A;  4F8R A;  4I28 A;  8ICN A;  2JZB B;  2ZH6 A;  1ZQW A;  1A76 A;  4DOB A;  3AQN A;  3M8R A;  3ISC A;  3UQ0 A;  3GV8 B;  2BQR A;  2ZJA A;  1BPY A;  1ZJM A;  1ZQD A;  2VA3 A;  1OU5 A;  3AQK A;  1ZQB A;  4EBJ A;  4QZG A;  4YP3 A;  4WC2 A;  2C2R A;  3FYH A;  2KFZ A;  3OVS A;  5J2K A;  4M0A A;  8ICP A;  5EOZ A;  1XS9 D;  2BCR A;  1NK4 A;  9ICS A;  3H37 A;  1UA1 A;  1JXE A;  3ZD8 A;  4RQ6 A;  1XSN A;  2ALZ A;  4GLX A;  3HW8 A;  4DFJ A;  4DQP A;  2KFN A;  4QWA A;  4UB5 A;  2V9W A;  2M2T A;  1HJP A;  1DK3 A;  1ZQG A;  4X4P A;  4IG8 A;  5BPC A;  4KLH A;  2J6S A;  5HMM A;  2UVV A;  3KHR A;  1NKB A;  2XY6 A;  1TK8 A;  3PO4 A;  4NM2 A;  4YMN A;  5KT4 A;  3PW4 A;  1U49 A;  2W9C A;  2PXI A;  4DLG A;  8ICO A;  4YR2 A;  1N56 A;  4FBU A;  4O5K A;  2MAX A;  4RPX A;  3HP6 A;  3Q8L A;  2A1J A;  7ICM A;  3LWM A;  4KTQ A;  4C8N A;  5DDM A;  4UB2 A;  5CHG A;  4S3N A;  1U9L A;  3V7K A;  1ZQS A;  2AGQ A;  9ICW A;  4RQ7 A;  4F2S A;  5DEC A;  4DOC A;  2IMW P;  1TK0 A;  2KN7 A;  4AT8 B;  4CCH A;  3ZDE A;  3MBY A;  4J9S A;  1BPE A;  4K4I A;  4Q8E A;  8ICQ A;  9ICO A;  3MR6 A;  2JEI A;  4O3R A;  4RPZ A;  2VAN A;  4EYI B;  4ECV A;  4DFP A;  1N48 A;  4B9N A;  5CA7 A;  4F92 B;  4NLK A;  2BQ3 A;  5DBA A;  2BPG A;  4O5C A;  2NRZ A;  3WFO A;  2ZHA A;  2HHT A;  2DRA A;  1TFY A;  4YQW A;  4DL6 A;  1TV9 A;  4M9N A;  2XGP A;  2V4Q A;  1ZQT A;  3MR2 A;  9ICI A;  3UPS A;  1JIH A;  4RQ0 A;  3PR4 A;  4DSF A;  5III A;  4X4O A;  1JAJ A;  4RT2 A;  2BPF A;  3E2E A;  2HVH A;  5DB6 A;  5BOL A;  5KFF A;  3WFP A;  5IIN A;  3UXP A;  3V7L A;  5J2J A;  4ELU A;  5KFN A;  2I9G A;  8ICR A;  2C2D A;  1KLN A;  4B9L A;  5HRH A;  4JWM A;  1XU4 A;  3C23 A;  4PHE A;  3ISD A;  1ZQR A;  5KG2 A;  1KEJ A;  4O3P A;  5KG4 A;  1T4G A;  2BCU A;  4FHP A;  2PFN A;  3MGH A;  9ICH A;  4RNM A;  4KLD A;  4YXM A;  5F9L A;  4TQS A;  3HPO A;  1X9S A;  5KG5 A;  3AUO A;  4DL7 A;  3TAQ A;  4X5V A;  2BDP A;  4KLI A;  1Z00 A;  4ECW A;  2IBK A;  3EYZ A;  4R8U B;  3PO5 A;  4AT7 B;  4DWI A;  3RAX A;  3N4M B;  8ICG A;  4JUZ A;  2HW3 A;  4YXJ A;  3PVX A;  2IHM A;  3RR8 A;  1RXV A;  4FHY A;  3RJG A;  3T5K A;  3PW7 A;  2FPL A;  4DSI A;  4M9G A;  3ISB A;  1NJY A;  3TQ1 A;  2AGO A;  4B9M A;  4ED3 A;  4PGQ A;  4MF2 A;  1ZQU A;  3GII A;  5DDY A;  2P66 A;  3ZDD A;  2Q66 A;  4ED1 A;  4O9M A;  7ICR A;  2ZUB A;  4QZD A;  1ZQE A;  5KFU A;  5DB8 A;  2ASL A;  4C8K A;  4X0A A;  2B21 A;  3Q8R B;  4P4O A;  3MR3 A;  3JPO A;  4ED7 A;  4EBD A;  4QWC A;  4J9Q A;  3H4B A;  4NY8 A;  2ZUC A;  2DR9 A;  2ISO A;  4AT9 B;  4QWB A;  3K75 D;  4ECR A;  4XRH A;  1S10 A;  1Q78 A;  2XCP A;  4I2B A;  8ICB A;  9ICB A;  1WOT A;  2BCQ A;  1R8C A;  3RBE A;  3LK9 A;  2PFP A;  4LT6 A;  4ATB A;  5J2F A;  4RWP A;  4TUQ A;  1NJW A;  2FPK A;  4KLQ A;  5KFS A;  4B9T A;  1UEU A;  4HYK A;  4IRK A;  4IQT A;  2RDI A;  4WCW A;  8ICE A;  5KFD A;  1T3N A;  4KMU A;  4TUS A;  1TFW A;  5KFA A;  2R8J A;  2KTQ A;  8ICX A;  1QLN A;  4I2H A;  3OVA A;  4F3O A;  2ID1 A;  2R8H A;  1XC9 A;  3SZ2 A;  5KT5 A;  1L3T A;  9ICX A;  1KNY A;  1U48 A;  4DL3 A;  1VJ7 A;  3ZDA A;  5L9X A;  4ECQ A;  3PW2 A;  5KG0 A;  1UET A;  5DB7 A;  1XSP A;  4DFM A;  2LYH A;  1TVA A;  3OJS A;  2WTF A;  4EZ9 A;  5KFP A;  4X4S A;  1V4A A;  5J2I A;  1SL1 A;  3WFQ E;  1A77 A;  5DED A;  4JV0 A;  1LB2 B;  2NRW A;  5HRF A;  4BWJ A;  4I2D A;  3V6H A;  4UAW A;  3RH5 A;  3RH4 A;  2ZTC A;  3NGD A;  3ETL A;  8ICI A;  2O5A A;  4FHX A;  2DRB A;  1L3U A;  5KFH A;  2ZH1 A;  4ELV A;  1NKE A;  1ZQH A;  3UPQ A;  2ZH3 A;  4ECT A;  2FLL A;  1RPL A;  9ICN A;  4M6W A;  1ZQY A;  1FA0 A;  4E7X A;  5HML A;  3KHH A;  5J0Y A;  4DO9 A;  2Y1I A;  2AU0 A;  5IIL A;  2J6U A;  8ICY A;  4XQ7 A;  4FHW A;  3EZ5 A;  5J0P A;  3Q8Q B;  4X4U A;  1TKD A;  2KP7 A;  4TUP A;  4P4P A;  3UQ2 A;  3OUY B;  4FS1 A;  2F1H A;  2AQ0 A;  2DPJ A;  1ZQZ A;  4EBC A;  2PI5 A;  2HHV A;  3C66 A;  5J2E A;  3H39 A;  3EPI A;  1BGX T;  2W8L A;  1YLQ A;  3Q8S B;  3KHG A;  4F4Z A;  4RNN A;  1S0N A;  2FMP A;  3V6J A;  3GIM A;  5J2C A;  1BNO A;  1ZQM A;  5KFL A;  5CR0 A;  4NLZ A;  9ICP A;  3PR5 B;  2P6R A;  5DGA A;  3NYB A;  1T8E A;  3QEA Z;  1C7Y A;  3K4G A;  4QW9 A;  3IHQ B;  4FS2 A;  5DG9 A;  1K1Q A;  3BDP A;  1X2I A;  2NRV A;  5J2B A;  4DSE A;  3BQ1 A;  4DL2 A;  4EEY A;  4KN7 A;  4I2C A;  4YN4 A;  2ZJ5 A;  4M04 A;  4QZH A;  2HHS A;  7ICU A;  2PFO A;  4B9V A;  5KT2 A;  5IIO A;  1D9D A;  3IM1 A;  4LVS A;  2C22 A;  1SKR A;  1JX4 A;  1PZN A;  2BCS A;  4DQI A;  3PX6 A;  5HRD A;  4Z6C A;  4RT3 A;  4BXO B;  1S77 D;  9ICQ A;  1L3V A;  5F9N A;  5C5J A;  3G6V A;  4F4X A;  1ZJN A;  2NRX A;  3OJU A;  1JMS A;  5L1K A;  1ZQF A;  4C8O A;  4DQR A;  8ICW A;  2HHU A;  4ED8 A;  4B9U A;  4F93 B;  2XGQ A;  3OHB A;  1MIY A;  2ZH7 A;  2DVI A;  4DF8 A;  5DGB A;  1L3S A;  1ZET A;  3LQC B;  9ICJ A;  3EW9 A;  4O5E A;  5KFZ A;  1S0O A;  1UT8 A;  4JK1 A;  5J0Q A;  5BOM A;  3GQC A;  3EPG A;  2AQ4 A;  4KLJ A;  1S0V A;  1ZQP A;  4XUS A;  4PGX A;  5KT7 A;  3PW0 A;  3RTV A;  3M9O B;  2BCV A;  7ICJ A;  5DQI A;  5KG3 A;  1ZQQ A;  4J9L A;  4RNO A;  4ELT A;  4WC3 A;  5KFR A;  1NK8 A;  7ICF A;  4I2F A;  9ICL A;  4RWO A;  3C21 A;  4QZI A;  1BVS A;  1QSY A;  1IM4 A;  4UD4 A;  4RQ4 A;  4NKU A;  4KLE A;  2UVR A;  3MFH A;  2BHN A;  4PHP A;  3RJE A;  2PBE A;  4K4G A;  4BGD A;  4Q45 A;  1XO1 A;  4XA5 A;  1NJZ A;  4GXJ A;  4ECY A;  3AQL A;  4F91 B;  2ZH9 A;  8ICV A;  2R8I A;  4R65 A;  4F5O A;  4K4H A;  5HR9 A;  8ICJ A;  1MIV A;  5KG7 A;  4UAZ A;  4YD2 A;  4RZR A;  3JZ0 A;  4R66 A;  3C5G A;  4AT9 A;  4C8L A;  4I2G A;  4EBE A;  3C2K A;  4IQU A;  4MFF A;  4X0B A;  3PNC A;  4X4R A;  4P2H A;  1JXL A;  3AU2 A;  2DPI A;  4KLG A;  2DR7 A;  4JV1 A;  7ICO A;  4ZH4 A;  3OGU A;  5D4B A;  1MQ3 A;  1D8L A;  4JV2 A;  4LZG A;  3OHA A;  2A1J B;  4PHA A;  4YCX A;  3HWT A;  1BPD A;  2BGW A;  1SKW A;  4M5D A;  4RWQ A;  4O3N A;  4IQW A;  3SV4 A;  1NJX A;  1JQR A;  5KFG A;  5J0W A;  4F5N A;  4LZD A;  3RRH A;  3RB6 A;  3B0Y A;  5KFV A;  2W9B A;  4KLF A;  3ZDB A;  1KFD A;  4GC7 A;  1Z3E B;  1PX5 A;  1TK5 A;  3TAN A;  9ICG A;  4ECS A;  4FH3 A;  3ORY A;  3LWL A;  5KFC A;  3SI8 A;  1QTM A;  1ZQI A;  7ICL A;  1NK9 A;  4QZE A;  4RU9 A;  1EXN A;  2JEF A;  4IRC A;  4X4T A;  4FHV A;  1VFG A;  4O3Q A;  4TQR A;  4RQ2 A;  5KG1 A;  1MQ2 A;  4IR1 A;  7ICV A;  1U47 A;  9ICM A;  3C2L A;  2ZJ8 A;  1S97 A;  2FPM A;  3GIL A;  3H38 A;  4I29 A;  3TI0 A;  1SL0 A;  4ECU A;  4ED6 A;  4QZ9 A;  3SYZ A;  2BR0 A;  2PFQ A;  3H8J A;  3RH6 A;  2C2E A;  3GIK A;  1R89 A;  1WCN A;  2H5X A;  2P6U A;  3C1Y A;  2JZB A;  8ICF A;  1ZQN A;  2ZH4 A;  5KFI A;  5CB1 A;  1B43 A;  4KIT B;  1ZYQ A;  5HHH A;  3C2M A;  2ISP A;  7ICP A;  4EYH B;  9ICK A;  8ICA A;  4UB3 A;  3JPT A;  2MUT B;  4JWN A;  5J0S A;  4DQQ A;  1MSW D;  2O1P A;  1X9M A;  1S0M A;  4WBZ A;  4KLT A;  1Z00 B;  3OUY A;  3NTU A;  4IQV A;  1ZQA A;  4FH5 A;  1DOQ A;  4WBY A;  1JN3 A;  2DR5 A;  2VA8 A;  2KZ3 A;  2Y1J A;  9ICV A;  3JPP A;  4DQS A;  2F1I A;  4ECX A;  2F1J A;  2JEJ A;  3RJI A;  1BPX A;  1D9F A;  4QZA A;  5JUM A;  4RUC A;  3OSP A;  3PML A;  3FDS A;  1LV5 A;  4UB1 A;  4I2I A;  4BWM A;  1ZQX A;  1K1S A;  4YG2 A;  3OVB A;  2HVI A;  4NLG A;  5J0U A;  3BQT A;  5HRL A;  2Q0Z X;  2FMQ A;  2AGP A;  5KFT A;  3RRG A;  8ICU A;  1NK7 A;  4M9J A;  3UXO A;  3JPS A;  5KFE A;  4E0D A;  2W9A A;  4AT8 A;  4UBB A;  3G6Y A;  3HJ4 A;  5DBB A;  2ATL A;  9ICT A;  4DLE A;  1S76 D;  7ICQ A;  4NKT A;  5F2V O;  4F5R A;  2XCA A;  5J0R A;  3BJY A;  4IRD A;  1CEZ A;  5KT3 A;  3KTQ A;  1RYS A;  4I27 A;  3T5J A;  4F2R A;  3QZ7 A;  4DSJ A;  4Z6F A;  1XWL A;  4O0I A;  1ZQK A;  3H3A A;  3EWA A;  3GV5 B;  4YMO A;  2FLP A;  4NXZ A;  3TAP A;  8ICM A;  4KLM A;  5KFO A;  5J29 A;  4DFK A;  3RBD A;  4YD1 A;  5D46 A;  3V72 A;  2ZH5 A;  4F5P A;  5TZV A;  3PV8 A;  5KFM A;  4KLU A;  1R8A A;  3HIY A;  4DSL A;  4R64 A;  2XO7 A;  3TFR A;  2XY7 A;  3JPN A;  3LDA A;  2V4R A;  8ICK A;  5HC9 A;  3QEB Z;  3PY8 A;  4EBK A;  3RJK A;  3MDC A;  2XY5 A;  3V6K A;  2KZZ A;  9ICR A;  4QZF A;  3MFI A;  3QE9 Y;  1NO5 A;  4WC4 A;  3MDA A;  3MAB A;  3RR7 A;  4AT7 A;  5DBC A;  4R8U A;  4ED0 A;  2GWS A;  1F5A A;  4F4Y A;  5DLG A;  4DSK A;  4WC5 A;  2M2U A;  2BE3 A;  2FLN A;  3RB3 A;  4KLS A;  8ICZ A;  4M6W B;  2RDJ A;  1TAQ A;  5HHI A;  5D49 A;  4C8M A;  3QZ8 A;  3RJF A;  2M2W A;  3WFS C;  3RB4 A;  4UB4 A;  2M9N A;  3RJJ A;  4DOA A;  3GIJ A;  5J2A A;  7ICT A;  4E8F A;  4EP7 A;  1XSL A;  1U4B A;  3RJH A;  8ICH A;  8ICS A;  4DEZ A;  5J0X A;  2W8K A;  5IIM A;  4FO6 A;  1BPB A;  1COO A;  4RPY A;  4UBC A;  1Q79 A;  9ICE A;  4MFA A;  1CUK A;  3HJ1 A;  3ZD9 A;  1RZT A;  1Y88 A;  2ZTE A;  4YMM A;  5HRK A;  5HRB A;  1ARO P;  2M2V A;  3Q8M A;  3M9M B;  2PI4 A;  5HP4 A;  1KFT A;  4F4W A;  4BDP A;  1U45 A;  2XC9 A;  1L5U A;  4I2E A;  2UVW A;  2HHX A;  4Q44 A;  4ECZ A;  8ICT A;  4J9N A;  4NM1 A;  5KFW A;  1RYR A;  5L1I A;  4PGY A;  5KFJ A;  4Z6E A;  4QZC A;  3GFK B;  4MF8 A;  4EZ6 A;  4PH5 A;  3T5H A;  4KLL A;  2W9C B;  2HHP A;  3L9D A;  5KT6 A;  3H4D A;  4YR3 A;  1QSL A;  3C18 A;  5KFK A;  4YFK A;  2BQU A;  3JPR A;  3KHL A;  3MR5 A;  4O3O A;  1SL2 A;  2IA6 A;  9ICF A;  1TFR A;  5DLF A;  1UT5 A;  4RQ3 A;  2W9M A;  2ASD A;  2JEG A;  7ICS A;  1SKS A;  4IR9 A;  5IIK A;  7ICE A;  4E80 A;  3PMN A;  4J9R A;  5KFY A;  3N97 B;  7ICH A;  5EWG A;  4QZ8 A;  4RUA A;  3H40 A;  1B22 A;  2RFF A;  4QZB A;  2MUT A;  4YVZ A;  3C5F A;  2UVU A;  1R8B A;  4I2A A;  3V7J A;  4J9K A;  4GXK A;  2C28 A;  8ICL A;  9ICA A;  4RWN A;  4X4V A;  2R8K A;  9ICC A;  1UEV A;  2DR8 A;  2ZTD A;  5KFQ A;  3RAQ A;  2ZH8 A;  4M2Y A;  3TAR A;  4F5Q A;  4DF4 A;  3HX0 A;  4ATB B;  3TFS A;  1ZQO A;  5J0T A;  2NRK A;  1WCL A;  3SV3 A;  4ED2 A;  2ZH2 A;  3UXN A;  4R63 A;  1HUO A;  5HNK A;  3OSN A;  2IHN A;  5J2D A;  3M9N B;  5CJ7 A;  3Q8P B;  1NK5 A;  4MFC A;  7ICI A;  3MGI A;  5L1L A;  3HT3 A;  2ASJ A;  1T7P A;  5HRE A;  3H8S A;  3G6X A;  1KRP A;  3RB0 A;  4Z6D A;  5CWR A;  1ZQC A;  5HRG A;  4RQ8 A;  5J2G A;  2KZM A;  3GDX A;  4YR0 A;  4I2J A;  5EWF A;  4M9L A;  1NZP A;  2ZUD A;  1HUZ A;  4RQ5 A;  1UA0 A;  1KDH A;  4FBT A;  5L1J A;  4X4N A;  4X4Q A;  5DG7 A;  4PPX A;  4TUR A;  1KTQ A;  1NK6 A;  7ICK A;  3GV7 B;  2J6T A;  3PX0 A;  4PHD A;  4GXI A;  1NKC A;  3AU6 A;  2I1Q A;  4J9O A;  3AQM A;  5J2H A;  4F4K A;  3T3F A;  4DL4 A;  4Q8F A;  1ZQV A;  4MEX A;  1S9F A;  2DFL A;  3JPQ A;  1KFS A;  2BKE A;  2BPC A;  4QWD A;  1SZP A;  1QSS A;  3B0X A;  4WC6 A;  2AJQ A;  1KSP A;  1RXW A;  4QW8 A;  1H38 A;  1IXR A;  3PX4 A;  3ZDC A;  4NLN A;  1BPZ A;  5HRI A;  4WC7 A;  3H7I A;  5CP2 A;  7ICN A;  1NOM A;  5J0O A;  5DQG A;  4GC6 A;  5KFX A;  4Q43 A;  3M8S A;  2R8G A;  1MIW A;  4UAY A;  4MEY A;  1MC8 A;  2W9B B;  2FMS A;  2VA2 A;  3BQ0 A;  7ICG A;  4F50 A;  4WC1 A;  3H8W A;  5KFB A;  4UQG A;  1TAU A;  1DK2 A;  5DG8 A;  3THV A;  4M47 A;  4BXO A;  3Q8K A;  4XQ8 A;  4B9S A;  4M9H A;  9ICU A;  1BNP A;  1ZQJ A;  3C1Z A;  3PW5 A;  4QWE A;  5IIJ A;  3T5L A;  4KLO A;  4P4M A;  2NRT A;  4UD5 A;  5DKW A;  4DS4 A;  4G3I A;  4RQ1 A;  2HHQ A;  5KG6 A;  1NK0 A;  4DS5 A;  2OWO A;  4O3S A;  3JYY A;  1V9P A;  2HHW A;  5DQH A;  8ICC A;  1DGS A;  4J9P A;  4WC0 A;  5KTQ A;  3WFR E;  1D8Y A;  1ZQL A;  2ZHB A;  5EWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...