4PGYA

Structure of human dna polymerase beta complexed with a nicked dna containing a gt at n-1 position and gc at n position
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The spontaneous base substitution mechanisms of human DNA polymerase beta
rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pgyA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pgyA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pgyA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pgyA03
1XS9D 4J9RA 4NLZA 4IQVA 3SZ2A 4RNOA 3JPNA 3M9MB 1EXNA 3RRHA 4O3SA 3HT3A 9ICCA 8ICZA 2KP7A 1BNPA 1VFGA 3KHHA 2DPIA 5J0UA 4KLSA 4C8NA 5J0SA 2BCVA 3TAPA 4DS4A 2JEGA 2ZUBA 4P4OA 4EBKA 4DOCA 1QLNA 3V6JA 4FHWA 2HHUA 7ICOA 3OVAA 7ICSA 1BGXT 1WOTA 3RBDA 4ATBA 2IHMA 4NLKA 2NRTA 3RRGA 2BPCA 3ZDBA 3LWMA 2AQ0A 3ORYA 4M0AA 3EWAA 8ICAA 5KG4A 7ICQA 4RNNA 4F8RA 4ECRA 4I2FA 4KLOA 4C8LA 4R8UB 4B9SA 3V7KA 1Q78A 2RDIA 2HVIA 4MFAA 2FMPA 1B43A 2ZJ8A 3BQTA 2AGPA 1ZQEA 1ZQHA 4FBUA 3H8WA 4EZ6A 1NO5A 5J0YA 1UT8A 4Q8EA 1UEVA 5J2GA 3NYBA 4FHVA 4QZ9A 1ZQXA 2XY6A 3OJSA 5KFIA 4GLXA 4FO6A 4DLEA 2P66A 5J2AA 3IM1A 5DG7A 1XC9A 4NLGA 2HHVA 2AJQA 4IRCA 1H38A 1U45A 4QWEA 1R8CA 4F4XA 2HVHA 4I2IA 1X9WA 8ICXA 5KFWA 4F4ZA 2BQ3A 5EWFA 4J9KA 1MC8A 2C2EA 3BQ2A 3Q8MA 4I29A 3PO4A 3WFPA 5KT6A 4UAZA 4S3NA 4UBCA 2W8LA 2PXIA 1ZQPA 5L1JA 3RB3A 4ECSA 5J2EA 3GIKA 4PHAA 3RJEA 3PMLA 1Z3EB 3TQ1A 9ICAA 3K4GA 5KFXA 8ICFA 1RPLA 4O3PA 2VA3A 3MGIA 3OV7A 3K75D 1TAQA 4F5NA 3TARA 2ZTCA 3PV8A 2MUTB 2AGQA 3BQ1A 1CEZA 4ECXA 4X4PA 1KFTA 1T3NA 4UB2A 4DQPA 1S0NA 4I2CA 1BPBA 1ZQTA 1QSYA 3ZDDA 4UD5A 4XQ7A 1V9PA 1KDHA 5CJ7A 1ZQCA 1KLNA 3PX6A 4F5PA 3PW5A 4UQGA 3MGHA 4DSKA 3MDCA 5J2KA 5CB1A 1ZQYA 3GQCA 4YN4A 4E0DA 3WFRE 4XQ8A 5KFTA 5HC9A 4QZIA 1UA1A 2J6UA 3SYZA 1U48A 2HW3A 2ZTDA 9ICFA 5C5JA 4M04A 7ICKA 4R65A 1ZQWA 5KT7A 3OHAA 3GILA 4J9PA 4DSJA 1S0VA 3EW9A 5DDMA 4ELVA 5KFHA 2HHSA 9ICKA 1OU5A 1Z00B 3ZDEA 2ISPA 3HJ4A 2BGWA 5L1LA 3SV3A 1V4AA 5KT5A 7ICLA 9ICOA 1TK5A 5D49A 5CA7A 2W8KA 5KG2A 4YD2A 3RJJA 2PI5A 1R8BA 4X0BA 3RBEA 1LV5A 3RJIA 1NK8A 4KLLA 8ICOA 1T7PA 4EYHB 2R8JA 8ICLA 4DL4A 1RZTA 5KFZA 3SI8A 3PO5A 3MR5A 2O1PA 1XU4A 1FA0A 4RQ2A 1NK0A 1KTQA 3PW4A 3KTQA 5BOMA 5KG7A 2Y1JA 3MR2A 8ICCA 1MIYA 4I27A 4R66A 2ZH9A 4RQ4A 2DRBA 5KFPA 5KFBA 5DB6A 3C5FA 3OGUA 1D8YA 4RQ8A 1TK0A 4FH3A 2FLPA 3QZ8A 4KLTA 2HHWA 2B21A 4O5KA 1D8LA 5DBCA 5J2HA 1ZQQA 3C2MA 9ICUA 4YQWA 4MF8A 2XCAA 4WBYA 4WC2A 4IRKA 9ICSA 3RB4A 7ICMA 1S10A 3GV5B 2C2RA 5HP4A 2ZH6A 5BOLA 3PX4A 2ZH8A 4Z6EA 4QZEA 2BCSA 4AT8A 3H7IA 2ZHAA 1T8EA 5HNKA 2FMQA 4ED3A 3ZDCA 2LYHA 3M9OB 1JIHA 3G6XA 4LVSA 9ICGA 4F50A 1MQ2A 4F4YA 3PX0A 3AQMA 5HMLA 4YCXA 5KFLA 4YR0A 5L1KA 4X4NA 5J0PA 1ZQOA 1SL0A 2GWSA 2JZBB 5TZVA 3TAQA 2W9CB 4F92B 3PW7A 1U49A 1XSNA 3Q8LA 2ZUCA 1TV9A 1ZJMA 3ETLA 4GC6A 3JZ0A 2V4RA 1VJ7A 3GDXA 2I1QA 4ELTA 2HHTA 4EBDA 2NRZA 4M9LA 1PX5A 3H3AA 5BPCA 1TK8A 1TFYA 1XSLA 5KG6A 1L5UA 2BPGA 5HRLA 3C21A 3V7JA 4I2DA 5KT2A 1XO1A 5KFNA 4F3OA 3HW8A 4F93B 2W9CA 3BQ0A 2JEFA 3C2KA 1S76D 4YR3A 5L9XA 9ICBA 2UVRA 4ATBB 2ZHBA 4O5EA 1ZQIA 5DQGA 2HHQA 4MFFA 4FS1A 8ICGA 3LQCB 5KG0A 2FPLA 3OSPA 3HIYA 4JK1A 3OUYB 3JPQA 5IIMA 3RR8A 8ICYA 3HX0A 5HRHA 1HUOA 4JV2A 2PFQA 4ED6A 3KHLA 1X9MA 2M9NA 4GXJA 4B9VA 4CCHA 4I28A 5DECA 4WC7A 2R8HA 5EOZA 5KTQA 4J9SA 1NKCA 3L9DA 4X4UA 3H38A 3OVSA 3MR3A 1NK7A 4ED2A 1BVSA 1TFRA 3IHQB 3PNCA 3OUYA 3RJGA 1ZQAA 3OSNA 5CP2A 1YLQA 3SV4A 4MF2A 2BE3A 3UXOA 1ZYQA 4QWBA 4M9JA 3EZ5A 1TKDA 1MSWD 2J6SA 4ELUA 3JPSA 1C7YA 2OWOA 1JQRA 2IMWP 4QWDA 1S0MA 1NJWA 5KFGA 3JPOA 2R8GA 9ICRA 4WC3A 3AQKA 2ASLA 3AU6A 3HPOA 3GV8B 4ECQA 4P4PA 9ICNA 5EWEA 5KFCA 3BJYA 2VA8A 4ECUA 1ZJNA 4M2YA 4IQWA 4NKTA 2FLLA 2M2WA 1TFWA 4F2RA 5DBBA 4F2SA 4RNMA 8ICWA 4UB5A 9ICEA 4FBTA 9ICVA 3ISBA 2RDJA 3T5HA 9ICQA 3HP6A 3GIIA 2KZMA 5KFKA 3EPGA 4MEXA 5EWGA 3V72A 2VANA 3LK9A 4BWJA 3RJKA 5KFQA 5DKWA 7ICGA 4ED1A 1QSLA 4MFCA 3JPTA 1K1SA 4KMUA 3GIMA 4QW8A 3QEAZ 1N56A 8ICBA 4ZH4A 4P2HA 4K4IA 1KRPA 4KLMA 2ZH5A 5J0OA 2BR0A 4BGDA 2V9WA 1KSPA 3ISDA 1ZETA 4RQ7A 1LB2B 1SL2A 8ICUA 5DB8A 4RQ0A 4G3IA 4GC7A 3OVBA 4ED0A 8ICHA 3H37A 1A77A 1ZQJA 4KLGA 5HRKA 1KNYA 4QZ8A 3GIJA 3MDAA 4ECYA 5DDYA 1B22A 3H39A 2DR7A 4YR2A 4AT9A 4RQ6A 4KTQA 4M6WB 1U4BA 2ZTEA 1ZQMA 2M2TA 4RWNA 5CWRA 4DQRA 4KLDA 4X0AA 4DL6A 3QE9Y 1JX4A 2FPKA 4RUAA 4RU9A 4R64A 2ISOA 4FHXA 5J2CA 3C23A 1RYSA 4I2HA 3QZ7A 3C5GA 2RFFA 1K1QA 4M9NA 8ICVA 2Q0ZX 2R8IA 1SKWA 5IINA 5DQHA 4DFMA 2ZH4A 1QSSA 1JMSA 4J9LA 3T3FA 4M6WA 1DOQA 1NKEA 1ZQFA 4O5CA 5DEDA 4AT8B 7ICRA 4HYKA 4EBCA 2W9BA 4X4VA 1TVAA 4PHPA 3Q8KA 4DSEA 1IM4A 4QZHA 3MR6A 4O3RA 5DB7A 5J0QA 2HHXA 4I2JA 1X2IA 3H8SA 3M8RA 2A1JA 4IQUA 3M9NB 1NJZA 4XA5A 4KN4A 1NK6A 5KT4A 9ICXA 1R89A 4RPXA 3V7LA 2WTFA 2R8KA 3RB0A 4YXMA 3GV7B 4EZ9A 1ZQZA 3NGDA 4LT6A 5DBAA 5KFYA 4F91B 1NK5A 4X4SA 2C2DA 5JUMA 4DL5A 1ZQVA 5DLGA 2BCRA 3KHGA 3NTUA 4DL3A 4RQ3A 5J2DA 2ALZA 4FS2A 4X4OA 3G6YA 9ICHA 4QWCA 4EBJA 1L3VA 4JUZA 5DGAA 3HJ1A 5KG1A 1ZQBA 5KFRA 3RAXA 1HJPA 1T4GA 3QEBZ 2JEJA 3PY8A 1RXVA 2DR8A 3HWTA 4NM2A 4J9MA 1SZPA 4PGYA 3ZD9A 5KFOA 3RJHA 5J0XA 4IR9A 4LZDA 3LDAA 5J0TA 3MBYA 3H4DA 4XUSA 4DLGA 3B0YA 3MABA 5DG8A 4ED7A 4UB3A 4DFKA 4DF4A 2XC9A 4R63A 4F5RA 4DSFA 1KFSA 2AQ4A 1ZQLA 4UB4A 1KEJA 4TUPA 1ZQKA 3BDPA 5D46A 4JV1A 3RAQA 5DG9A 4FHPA 4J9QA 4QZCA 1L3UA 2KFZA 4E8FA 5CR0A 5IIIA 4WCWA 1BPYA 4DEZA 2KN7A 3PR4A 2V4QA 1JXLA 4B9TA 4I2BA 7ICTA 3C66A 3UXNA 3H4BA 3PW0A 9ICMA 2BKEA 4QW9A 1X9SA 5F2VO 4J9OA 4TQSA 3ISCA 4DQSA 3OHBA 4IG8A 2KZ3A 2XO7A 4O3NA 4JV0A 4IRDA 4UB1A 2NRXA 4RPZA 5CHGA 1NK4A 4YMOA 1MIWA 4DF8A 4KLUA 4P4MA 2ASDA 4AT7A 3RH4A 1ZQRA 3WFSC 4QZDA 4B9NA 4PH5A 5DGBA 4TURA 2XCPA 4LZGA 4WC4A 1D9DA 4KN7A 7ICIA 4X4QA 4RWQA 3JPRA 1S97A 4KLIA 5HREA 4NXZA 1N48A 1R8AA 2F1JA 2P6RA 4XRHA 4PGQA 5IILA 2BQRA 2UVVA 5J0RA 7ICFA 4DSLA 2PI4A 7ICHA 4E7XA 4QZAA 2HHPA 2W9AA 3THVA 4C8KA 2BQUA 4Q8FA 3C1ZA 3UPSA 2UVWA 4E80A 9ICWA 2PFPA 3UQ0A 3AQLA 2W9MA 1DGSA 4ED8A 4K4HA 5IIJA 1F5AA 1ZQSA 4RWPA 4PPXA 3PW2A 4NKUA 4RQ1A 4DSIA 4NLNA 9ICLA 2ZJ5A 7ICJA 3H8JA 8ICJA 4YG2A 4DOAA 4DO9A 4JWMA 4X4TA 1XWLA 5HRGA 1PZNA 5DLFA 3M8SA 7ICEA 3T5KA 4ECTA 4DWIA 3PVXA 3T5JA 4TUSA 4IQTA 4PGXA 4YP3A 4Z6FA 3T5LA 5HRIA 2XY7A 5KG5A 3OJUA 2BCUA 5D4BA 3AUOA 4YFKA 1QTMA 1WCLA 4RZRA 8ICIA 8ICNA 4WC6A 3G6VA 4PHDA 4B9MA 3RB6A 3RJFA 4EP7A 1NKBA 2DPJA 2P6UA 1NZPA 4Z6CA 1U47A 1ZQDA 2C28A 8ICEA 1COOA 2ID1A 2VA2A 4AT9B 4X4RA 1AROP 2UVUA 4YD1A 8ICTA 3WFQE 1MQ3A 2PBEA 4MEYA 2PFNA 4IR1A 4GXIA 1BPXA 5IIOA 4DL2A 4R8UA 5J0WA 1U9LA 1NJYA 8ICMA 4YVZA 4KLEA 7ICVA 5HHHA 2XGPA 1Y88A 2ZUDA 3FDSA 5KFSA 1SKRA 2FLNA 2Q66A 2ZH2A 4WBZA 3C18A 2IHNA 2O5AA 2DR9A 3N4MB 1NK9A 7ICPA 3JYYA 4F4KA 1S0OA 3TFRA 4RPYA 4I2GA 4RUCA 2ZJAA 3AU2A 4Q45A 1ZQGA 4EYIB 2W9BB 2FPMA 1UT5A 4YXJA 2AU0A 4QZGA 4M47A 2DFLA 1CUKA 2AGOA 4KITB 3RH6A 2A1JB 5J2FA 3ZDAA 3AQNA 1ZQNA 1WCNA 2BHNA 2FMSA 2ZH1A 3UQ2A 4RT2A 2NRVA 4KLHA 2IBKA 5HHIA 4WC5A 2NRWA 8ICSA 1S9FA 4F5OA 4FH5A 2MUTA 4J9NA 1HUZA 4I2AA 4NM1A 4YMNA 2ZH7A 1KFDA 1JN3A 2F1IA 5DB9A 3RTVA 3FYHA 3ZD8A 2F1HA 3Q8PB 4K4GA 2DR5A 2H5XA 4DFJA 5KFEA 2KTQA 3JPPA 2M2VA 1A76A 4RWOA 4B9LA 5L1IA 5F9LA 1SL1A 5J2BA 4I2EA 4DS5A 5DQIA 1UA0A 2KFNA 1Q79A 4O0IA 5J2IA 3Q8QB 3TFSA 3MFIA 4ECZA 3GFKB 1Z00A 2C22A 2KZZA 2ATLA 4QWAA 5F9NA 2PFOA 2JEIA 4O9MA 4M9HA 1S77D 3LWLA 1JXEA 1BPZA 4KLFA 4GXKA 3TANA 5IIKA 3C2LA 4BXOB 3MFHA 5HR9A 4Z6DA 2BPFA 1NJXA 5KFDA 4F5QA 4NY8A 7ICNA 1SKSA 1DK2A 5HRDA 4KLQA 2DVIA 4DQIA 5J2JA 4QZBA 1UETA 1BPDA 9ICTA 4F4WA 1JAJA 3WFOA 4RT3A 1DK3A 4TUQA 4JWNA 1NOMA 3H40A 5J29A 2M2UA 2NRKA 5HRBA 3C1YA 4AT7B 4DQQA 3UXPA 2XY5A 3EPIA 2IA6A 9ICPA 5HMMA 3E2EA 8ICRA 4BXOA 2XGQA 4DFPA 4ECVA 4EBEA 4RQ5A 5KG3A 2Y1IA 1RYRA 1BNOA 3V6KA 4DOBA 2BCQA 3EYZA 7ICUA 3UPQA 3RR7A 5HRFA 1ZQUA 4C8OA 3Q8SB 8ICPA 2MAXA 5KFUA 4WC0A 4O3OA 1L3TA 3Q8RB 3N97B 1TAUA 2ASJA 4B9UA 4TQRA 4C8MA 9ICIA 4BWMA 3PMNA 1IXRA 5KT3A 4DL7A 5KFVA 3TI0A 3RH5A 1RXWA 2I9GA 4UD4A 4WC1A 2DRAA 9ICJA 1UEUA 4M9GA 1L3SA 3B0XA 4UAWA 5KFAA 1XSPA 2BDPA 4FHYA 4UAYA 3V6HA 2ZH3A 8ICQA 5KFFA 2J6TA 4KLJA 4Q43A 8ICKA 4UBBA 2JZBA 1BPEA 4YMMA 3KHRA 4PHEA 4X5VA 1D9FA 4BDPA 4M5DA 5KFMA 5KFJA 1MIVA 4EEYA 4O3QA 4ECWA 3PR5B 4Q44A 4QZFA
chains in the Genus database with same CATH superfamily
5TISU 3M9MB 1DK2A 2Z7JA 3HT3A 3KHHA 4DS4A 4EBKA 3V6JA 7ICOA 1A6SA 3OVAA 5B66U 1RQNA 2IHMA 3RRGA 2BPCA 4R8UB 4B9SA 2RDIA 4MFAA 2ZJ8A 1NO5A 2P66A 3VCBA 4K8VA 2GLEA 4GLXA 5DG7A 3IM1A 5ALKA 8ICXA 3ALRA 1X9WA 1A0PA 2QB0A 1MC8A 4J9KA 3WFPA 4I29A 3PO4A 4S3NA 2W8LA 5J2EA 5AI4A 9ICAA 1Z3EB 3K4GA 3KZIU 5KFXA 2VA3A 2JH7A 3K75D 2W11A 1SV4A 4OAIZ 5T14A 5AKKA 2KIWA 4I2CA 1QSYA 3I76A 1KLNA 5CJ7A 1RQLA 5L1MA 3MDCA 5J2KA 3GQCA 4YN4A 4C7YA 2HI0A 5HC9A 2G09A 5EE0A 4J03A 1UA1A 4LEYA 2KKPA 1U48A 1ZQWA 2EH9A 3GILA 4J9PA 4DSJA 3EW9A 2HHSA 1OU5A 2ISPA 1MA7A 5KT5A 1SWWA 9ICOA 5CA7A 1R8BA 5KG2A 4YD2A 4KLLA 3RJIA 4DL4A 1RZTA 5KFZA 3SI8A 3PO5A 3MR5A 1XU4A 1FA0A 1NK0A 3J81j 2Y1JA 2ZG6A 3MR2A 4I27A 4R66A 4ZOHC 3FAHA 2LYBA 4RQ8A 2DKXA 3SR6A 3H0LB 1DGJA 2XCAA 1S10A 3GV5B 4FE3A 1JIHA 2DGZA 5HMLA 3BS5B 2HN1A 4OO1J 5KFLA 4YR0A 1YT3A 2QARA 2JRZA 3N7SC 3PW7A 2VKQA 3SENA 3Q8LA 3D2SA 3ETLA 3JZ0A 2AH5A 5GTIU 1PX5A 5BPCA 3GZFA 4JLXA 1Q8KA 2BPGA 1X42A 1V97A 4I2DA 4F93B 2JEFA 4YR3A 5L9XA 2UVRA 1ZQIA 5ALSA 3LQCB 3OUYB 3HIYA 3OSPA 5AM2A 4FZNA 1HUOA 4JV2A 2M9NA 5AKGA 3NVVA 5KL8B 3M6ZA 1JUDA 3OVSA 1BVSA 3SEIA 4G9BA 4EV6A 5CP2A 3PSPA 4OJLA 4CRXA 2GH1A 2IMWP 2WB1F 1NJWA 5KFGA 1F0MA 4WC3A 5ALYA 3AU6A 2F8KA 5EWEA 2KEYA 4ECUA 4M2YA 4IQWA 1D8BA 2FLLA 1TFWA 4RNMA 2H3QA 2RDJA 1LKYA 9ICQA 4C4SA 1QSLA 3JPTA 4KMUA 3GIMA 2ZH5A 4BGDA 2DUYA 1FFUA 4WOYA 3TKAA 2BBJA 3H37A 1IV8A 3GIJA 3MDAA 4ECYA 4PZOA 4OAHA 4RQ6A 4KTQA 1ZQMA 4RWNA 2PMZF 3M6KA 3KZXA 4RU9A 2ISOA 5J2CA 1JALA 4DFMA 3SAGA 1QSSA 4O5CA 3SMVA 1DOQA 7ICRA 3F2DA 1IM4A 3BZKA 1X2IA 3M8RA 4DFDA 2A1JA 4IQUA 3M9NB 4KN4A 1NK6A 9ICXA 2WTFA 3GV7B 5JTGA 5DBAA 1X9XA 2DBYA 3KHGA 4FS2A 4LJXA 9ICHA 2YY6A 1L3VA 5ALWA 1ZQBA 2CXYA 1OXJA 1HJPA 3ICXA 3PY8A 3HWTA 4NM2A 4J9MA 1SZPA 4PGYA 3ZD9A 5J0XA 3H4DA 5ALVA 4DLGA 2XC9A 4DSFA 4UAUA 2AQ4A 4J9QA 4QZCA 2KJ5A 2LBOA 2KFZA 5CR0A 5F3XB 4WCWA 2KN7A 2V4QA 2KG5A 4B9TA 3C66A 3K7DA 9ICMA 3ISCA 4IG8A 2ZIXB 5CHGA 1MIWA 1L7NA 4KLUA 2H3ZA 4AT7A 4TURA 1QQ7A 1KBUA 2GOLA 3JPRA 3AL0B 1C20A 3IG5A 1R8AA 2P6RA 4PGQA 2BQRA 3QU9A 4DSLA 4E7XA 2W9AA 4C8KA 2EAPA 2UVWA 4E80A 3UQ0A 1DGSA 2FJ6A 4RWPA 1KQQA 4NKUA 4RQ1A 4DSIA 9ICLA 2ZJ5A 7ICJA 4DOAA 5AK4A 2G0AA 3IN5A 5ALZA 4PGXA 3OJUA 3WK8A 4YFKA 1QTMA 1WCLA 8ICNA 3F5EA 4WC6A 3QUBA 3RJFA 1NNLA 4IS7A 2IOFK 3PZPA 1ZQDA 2ID1A 4X4RA 1COOA 3QU4A 2VA2A 3WFQE 1MQ3A 2KSOB 2PFNA 4IR1A 5FP0A 2LM4A 2HDOA 4R8UA 1NJYA 5JRTA 3AMZA 1CI4A 1SKRA 5KFSA 2FLNA 4OJPA 4WBZA 3JYYA 4F4KA 1S0OA 3TFRA 4RPYA 1QQ5A 1ZQGA 3TADA 2W9BB 2NYVA 2AU0A 1Z4OA 4M47A 4KITB 1FEZA 3RH6A 1ZQNA 1WCNA 4P0PA 2EDUA 1S8OA 2NRVA 2KHQA 2IBKA 4WC5A 4K98A 4FH5A 1HUZA 2ZH7A 1JN3A 3FYHA 4Y2YA 2F1HA 3Q8PB 2H5XA 5KFEA 1A76A 2YB1A 4OAGA 4B9LA 2ESEA 2YTUA 4DS5A 5DQIA 3T79A 2KFNA 4O0IA 5J2IA 2W04A 3MFIA 2QLTA 3GFKB 3NS1A 2KZZA 1PVRA 5F9NA 2PFOA 3LWLA 1JXEA 1RM6C 4WQKA 2OXOA 2JHDA 5HR9A 4NY8A 5HRDA 2LHTA 2WB1C 5J2JA 1UETA 2VJ5A 3WFOA 1DK3A 2PKEA 3C1YA 4DQQA 9ICPA 4BXOA 5AICA 2OH2A 3DV9A 2Y1IA 7ICUA 3UPQA 3RR7A 1ZQUA 4ACOA 8ICPA 4B9UA 9ICIA 4BWMA 3PMNA 4DL7A 4UD4A 2ZIUA 3K1ZA 4M9GA 1L3SA 3B0XA 2ZH3A 2J6TA 1D9FA 5KFJA 2FI1A 2FDRA 4O3QA 4QZFA 3LVVA 4O3SA 1BNPA 1VFGA 2PMZC 1O08A 4KLSA 4C8NA 3CNHA 3MC1A 2ZUBA 4P4OA 1QLNA 5KNIA 4FO1A 1Z19A 3ZDBA 1RDFA 3LWMA 2GAFD 3ORYA 4M0AA 7ICQA 8ICAA 4F8RA 4I2FA 4OJ6A 4C8LA 2CN1A 1Q78A 8ICGA 2FMPA 3BQTA 5KAFU 1ZQHA 5J8YC 5J0YA 1UT8A 4Q8EA 5J2GA 4QZ9A 4Y2JA 4IRCA 1KL9A 3ER8C 1H38A 1U45A 4QWEA 3MGVA 4F4XA 2HVHA 2ZIVB 3NKUA 5KFWA 5EWFA 2C2EA 3BQ2A 3Q8MA 4UAZA 7ICLA 3RJEA 3NVYA 1RPLA 2JGAA 3MGIA 1TAQA 4F5NA 2AGQA 3PV8A 1CEZA 3BQ1A 4ECXA 4X4PA 4EX6A 4DQPA 4UD5A 3ZDDA 4XQ7A 1V9PA 4F5PA 1KW4A 2Y0SF 4DSKA 4GFJA 4QZIA 9ICFA 3HJ4A 1Q46A 2BGWA 2IOFA 3ETRA 1N2XA 1PK3A 4FZLA 3RJJA 2K8AA 2PI5A 3WKDA 1ZQ1C 4US8A 5ALHA 3QNMA 4BX9C 4RQ2A 8ICCA 3PW4A 5CFTA 1MIYA 4RQ4A 5DB6A 2W7PA 1TK0A 2FLPA 4KLTA 2HHWA 1ZD2P 4WC2A 2C2RA 3PX4A 2W3SA 1T8EA 2FMQA 2KHVA 3ZDCA 5ALDA 2LYHA 4BUGA 4LVSA 9ICGA 3SAHA 2YQEA 5L1KA 3TAQA 2W9CB 4USAA 1ZJMA 3CW2C 2G5HB 1VJ7A 4EBDA 1N63A 4M9LA 1L5UA 3C21A 3IG8A 5KT2A 2HMXA 5KFNA 1B0XA 4Y2QA 4ATBB 4O5EA 5DQGA 4FS1A 5K4LA 5KG0A 2FPLA 1ZOLA 2BBHA 8ICYA 3HX0A 1SB3C 5D62A 2PFQA 2XI9A 3KHLA 1X9MA 2KOBA 4WC7A 1NKCA 4NXTA 3L9DA 1SWVA 3MR3A 2DF4B 4ED2A 5B3QA 5AI0A 3RJGA 1ZQAA 4C7ZA 2KIVA 1YLQA 4MF2A 1ZYQA 4QWBA 4M9JA 1TKDA 1MSWD 2VJ4A 2OWOA 2WF8A 2R8GA 2ASLA 3GV8B 4NWIA 4P4PA 5KFCA 3LVWA 3N7PD 4F2RA 4F2SA 3HP6A 2NO4A 5EWGA 3V72A 5DKWA 3L5KA 5AI9A 1N56A 1N62A 4ZH4A 4P2HA 4KLMA 2D3DA 2V9WA 4EGWA 3ISDA 1ZETA 1LB2B 4HAIA 2GO7A 1YZ6A 3OVBA 5KAIU 2KD1A 4ED0A 4KLGA 1ZQJA 1ECWA 4QZ8A 1B22A 5DDYA 4IL6U 4YR2A 2DR7A 4EEBA 4M6WB 1U4BA 2ZTEA 2FPKA 4FHXA 3OTQA 3C23A 3QZ7A 3C5GA 2MSNA 4M9NA 2Q0ZX 2R8IA 2ZH4A 5IINA 1COKA 4J9LA 3T3FA 1NKEA 2F2AB 2HBJA 3OWGA 1SV0A 4EBCA 2LM1A 2W9BA 4DSEA 4QZHA 3MR6A 4EEKA 4O3RA 4U6PA 3H8SA 1NJZA 4NXWA 1Q3UA 4XA5A 2R8KA 2KK0A 4EZ9A 1ZQZA 3L4PA 4K9BA 5KFYA 4F91B 5DLGA 1P7DA 2W43A 4QWCA 4EBJA 3HJ1A 3ONNA 3HKZC 3S6JA 4CF3A 3AQEA 4LZDA 5J0TA 4XUSA 3MABA 5DG8A 4DFKA 4DF4A 2HN2A 1ZQLA 1KEJA 2KJ8A 3RAQA 1SXEA 5DG9A 3QUQA 4E8FA 2E1EA 2WFAA 4DEZA 5B5EU 3UXNA 3R9KA 5F2VO 4J9OA 4C80A 2G08A 2KZ3A 4O3NA 4JV0A 2NRXA 4DF8A 2ASDA 3RH4A 4LZGA 7ICIA 4KN7A 4RWQA 4WH5A 1S97A 3C28A 5HREA 4HX0A 4NXZA 2Y0SC 1N48A 2HSZA 2F1JA 1NZBA 5IILA 4LEZA 2PI4A 4QZAA 3THVA 4Q8FA 9ICWA 3AQLA 3PSTA 4ED8A 5IIJA 3AN1A 1ZQSA 2EANA 4OAFA 3PW2A 4NLNA 2LYAA 4YG2A 2ZXIA 5AM0A 5HRGA 4ECTA 2F76X 4RQNA 4Z6FA 3T5LA 5E79U 4RZRA 1J2NA 3G6VA 1XO0A 4PHDA 4B9MA 3ERCC 2RQ5A 2C28A 4AT9B 4YD1A 1ED1A 4PL1A 1X40A 2WAQF 1U9LA 4KLEA 2XGPA 3LYSA 2IHNA 2O5AA 7ICPA 2ODGA 1RYUA 2ZJAA 3AU2A 4FFDA 4Q45A 1O03A 4NLCA 2FPMA 4C4TA 2ZIVA 3ZDAA 5J2FA 3K1RB 3NRZA 3CK6A 3QU2A 1GO3F 5AKZA 2NRWA 4QIWF 1S9FA 2A1AA 4I2AA 4YMNA 4LEVA 3BS7A 2A3VA 2DR5A 3JPPA 4RWOA 1VDVA 5L1IA 5G5GA 1UA0A 3D2NA 3Q8QB 4ECZA 3F5AA 3M1YA 2JEIA 1S77D 2JV3A 4KLFA 1OUQA 3UM9A 4Z6DA 2BPFA 4C0ZA 5CFUA 3M7DA 4QZBA 1ZD5A 1BPDA 3RF9A 4RT3A 4JWNA 1NOMA 1K5OA 2DWQA 5J29A 3PHZA 2IA6A 5HMMA 3E2EA 4OJOA 2RRDA 2W3RA 3V6KA 4DOBA 4MKPA 1L6NA 2MAXA 4WC0A 4O3OA 1N5WA 2HCFA 1Q3VA 1L3TA 1TAUA 1RXWA 1IXRA 5KT3A 3NVWA 2I9GA 1PUZA 5KFAA 1XSPA 4UAYA 8ICQA 8ICKA 4KLJA 4Q43A 4UBBA 2YMQA 4PHEA 3KHRA 1B4FA 2F3NA 4MFCA 5ALEA 4ECWA 4Q44A 2LKYA 2E3TA 4J9RA 2ZIWB 4RNOA 3JPNA 3RRHA 2KP7A 8ICZA 9ICCA 5J0UA 5J0SA 1WUDA 4DOCA 3DDHA 5AM3A 2ES6A 4B6JA 2HHUA 3E58A 7ICSA 1BGXT 5AI6A 1WOTA 4ATBA 4NLKA 2NRTA 1SIJA 2AQ0A 4ECRA 4KLOA 2QB0B 1ZQEA 4I0UA 2AGPA 3CRXA 3H8WA 1UEVA 3NYBA 2XY6A 5KFIA 2LI6A 5J2AA 1XC9A 2AJQA 2HHVA 4UAVA 4Y2UA 3F53A 1R8CA 1Z1BA 4I2IA 5J8YA 4F4ZA 2BQ3A 1WYGA 5ALIA 2K4HA 5KT6A 2PXIA 3RB3A 3GIKA 2L5YA 3PMLA 3TQ1A 8ICFA 4O3PA 3OV7A 5EE1A 3TARA 1KFTA 4CDGA 4UB2A 1S0NA 5AKIA 1BPBA 3PX6A 2H3VA 2MU2A 3MGHA 2OM6A 2KMDA 1ZQYA 1JI7A 4K99A 4US9A 4XQ8A 4PL2A 3OPXA 4FZMA 2J6UA 2HW3A 2ZTDA 4M04A 7ICKA 4R65A 5KT7A 3OHAA 3WK6A 1ZXIA 1FIQA 1S0VA 4ELVA 3H39A 5EE9A 9ICKA 2EAMA 5ALMA 3ZDEA 4UW9A 2WF9A 5L1LA 4P0QB 2HBKA 2OCEA 5D49A 2W8KA 4X0BA 2DQNB 5ALXA 3QU7A 8ICOA 2R8JA 2KICA 1KTQA 3KTQA 5CEHA 5KG7A 4K96A 2DRBA 5KFPA 5KFBA 2E8OA 1D8YA 4O5KA 1D8LA 3C2MA 4YQWA 1L7OA 4UASA 4WBYA 4IRKA 9ICSA 7ICMA 3SAFA 5BOLA 2W54A 3H7IA 2QARB 2ZHAA 3A0BU 5HNKA 4ED3A 1RG6A 1T3QA 4F50A 1WG8A 1MQ2A 2EQYA 3PX0A 2NV3A 3AQMA 3AQFA 3FC4A 4YCXA 3A0HU 5J0PA 1ZQOA 2JZBB 4EENA 4CGZA 4Y2TA 1XSNA 2DL0A 4GC6A 3GDXA 3H3AA 4QNLA 1TFYA 5KG6A 3BS5A 5AKJA 5HRLA 1L8LA 5ALUA 2WAQC 1XO1A 2G07A 1JRPA 5A0LA 3BQ0A 1S76D 3C2KA 2Q66A 3IV6A 4JK1A 3JPQA 5HRHA 1F5SA 3ER9B 4I28A 5EOZA 4X4UA 1DXSA 4NXXA 2LMRA 3PNCA 3OUYA 3HKZF 3OSNA 4QIWC 3C29A 2BE3A 1LKYB 3EZ5A 1C7YA 5C0YA 3QXGA 2F44A 3IP4B 4QWDA 9ICRA 3AQKA 4ECQA 5AKEA 3BJYA 8ICWA 9ICEA 4FBTA 9ICVA 3ISBA 3GIIA 3EPGA 1ZRNA 4EELA 4MEXA 3RJKA 3LK9A 3D6JA 7ICGA 4K97A 2FCLA 1K1SA 4K4IA 3O0FA 5J0OA 3JCFA 4EEDA 5ALGA 4IC9A 4RQ7A 2YMPA 1SL2A 1URJA 4RQ0A 1PVPA 4G3IA 8ICHA 3QUTA 1KNYA 2AXTU 4O6AA 1DRGA 4AT9A 2M2TA 3HRDD 4KLDA 4DQRA 4DL6A 3QE9Y 4RUAA 3AM9A 4R64A 3E0FA 2IHOA 2N1RA 8ICVA 5DQHA 1JMSA 2YMMA 5DEDA 4AT8B 5CFSA 4HYKA 4LEWA 3H8MA 1TVAA 4PHPA 5D63A 5DB7A 1J2MA 4RPXA 3RB0A 3KBBA 4YXMA 1GPJA 3NGDA 2A19A 1NK5A 4X4SA 5AKYA 2C2DA 4DL5A 2HOIA 1J97A 3NTUA 4RQ3A 5J2DA 2JXJA 4X4OA 3G6YA 2KVCA 5AKLA 4JUZA 5DGAA 5EE3A 3RAXA 2JEJA 1WWUA 1RXVA 5KFOA 3ZI4A 4IR9A 3LDAA 4ED7A 2KZMA 1X6IA 4UB3A 4F5RA 4TUPA 1ZQKA 3BDPA 2B56A 4FHPA 1L3UA 5GTHU 5IIIA 1BPYA 3PR4A 1JXLA 2B51A 1N61A 2W55A 4KMOB 4QW9A 1X9SA 3MCRA 4TQSA 4DQSA 3OHBA 2XO7A 3PSFA 4UB1A 4NXUA 2Y9UA 2WF7A 4RPZA 4O67A 2R18A 3WFSC 4QZDA 5DGBA 2XCPA 4K9AA 5AM4A 3NVOA 1D9DA 3D2QA 3SD7A 4XJEA 4XRHA 3KFUF 2ZIXA 2BQUA 3L3FX 2W9MA 3IRUA 3WKBA 3CYMA 3F2CA 4PPXA 4KB6A 5ALTA 5AI5A 1Z1VA 3H8JA 4DO9A 3WK7A 4X4TA 3CP8A 1PZNA 5DLFA 3PVXA 3T5JA 2ZIWA 4YP3A 2VIXA 3AUOA 2HOQA 4F71A 1QCKA 4Z6CA 8ICEA 3UMBA 1L7MA 4PJ0U 2PBEA 4AP9A 3H0MB 1BPXA 5IIOA 8ICMA 4YVZA 2E1FA 7ICVA 5HHHA 3WK9A 4P0PB 5AIBA 4RUCA 4EYIB 1JROA 2KSOA 1S5LU 4YXJA 2MA1A 4AYBF 2DFLA 1CUKA 2AGOA 3KKAC 5AM5A 3AQNA 2FMSA 2KE7A 3UQ2A 5D61A 8ICSA 4F5OA 4NM1A 1PK1B 1KFDA 2F1IA 1L8OA 4K4GA 2KTQA 4ICAA 3U26A 4NXVA 5F9LA 1SL1A 4I2EA 1Q79A 2XVTA 2C22A 4QWAA 4P0QA 5ALQA 3F2BA 1BPZA 3QX7A 4GXKA 5IIKA 4BXOB 1TAMA 1UQVA 3MFHA 4O3MA 2F77X 1NJXA 4NL9C 5KFDA 4F5QA 1SKSA 4CE6A 2FE9A 2K60A 1JAJA 2E5SA 5HRBA 4MHVA 2K8CB 4KM5A 3UXPA 2XY5A 3EPIA 2ZIUB 2XGQA 4DFPA 4ECVA 1BNOA 4RQ5A 2BCQA 2K4PA 3EYZA 4C8OA 4NJ8A 2BDUA 3Q8RB 3N97B 2ASJA 4C8MA 3TI0A 3RH5A 2DRAA 3UMGA 9ICJA 4UB6U 1UEUA 1QH9A 4FHYA 2BDPA 5KFFA 2JZBA 4M5DA 3H0RB 5JTIA 3IDWA 2EZZA 3PR5B 1XS9D 4KX3A 4IQVA 3SZ2A 4NLZA 5ALPA 4CF5A 1EXNA 3EF2A 5JU5A 2DPIA 4NV0A 2JR5A 4DCCA 2BCVA 3TAPA 2JEGA 4FHWA 4OCZA 3RBDA 3EWAA 5KG4A 4RNNA 3V7KA 3BQ7A 2HVIA 1B43A 4FBUA 4EZ6A 3N7RC 4FHVA 1ZQXA 3OJSA 4FO6A 4NLGA 4DLEA 1WWVA 2D6FC 2K8BB 4O68A 2KJ9A 4UBCA 1ZQPA 5L1JA 4ECSA 4PHAA 1LVHA 3NUQA 2ZTCA 2MUTB 1T3NA 1MN8A 1TE2A 1ZQTA 2K4IA 1KDHA 1ZQCA 1IIPA 4JB3A 3PW5A 3PSIA 4UQGA 1V38A 5CB1A 4E0DA 3WFRE 5KFTA 3SYZA 3H38A 5AHXA 5C5JA 2E8NA 5DDMA 5KFHA 1Z00B 1VJ5A 3SV3A 1V4AA 3I28A 5G5HA 3WK4A 1SXDA 3WKEA 1QQ6A 1TK5A 1YZ7A 1SV0C 3RBEA 1LV5A 1NK8A 1T7PA 4EYHB 8ICLA 2O1PA 5BOMA 2ZH9A 3C5FA 2YX8A 3OGUA 4FH3A 4CF4A 4PZNA 3QZ8A 2B21A 4NLBA 5DBCA 5J2HA 1ZQQA 9ICUA 2HBLA 4MF8A 3UMCA 3RB4A 5HP4A 2ZH6A 3GU3A 2ZH8A 4Z6EA 4QZEA 2BCSA 4AT8A 5ALOA 2YN4A 4KX5A 3DEEA 3M9OB 1V85A 3G6XA 4UB8U 4GIBA 2WF5A 3SQIA 4F4YA 4X4NA 2GA9D 2M0NA 1SL0A 2GWSA 5TZVA 2KNJA 1U49A 4F92B 3BZCA 2ZUCA 1TV9A 2V4RA 2I1QA 4ELTA 2HHTA 2NRZA 2CPRA 1X6JA 1TK8A 1XSLA 3V7JA 1ZD4A 4F3OA 3HW8A 2W9CA 9ICBA 2ZHBA 2HHQA 5AI8A 4MFFA 1SGGA 5IIMA 3RR8A 4Y2VA 5CRXA 5ALLA 2XIDA 4ED6A 2YMLA 4AYBC 3NWIA 4GXJA 5AM1A 3FM9A 4B9VA 4CCHA 5DECA 1KKXA 2R8HA 1ZRMA 5KTQA 4J9SA 2EZYA 1NK7A 1TFRA 3IHQB 2E8MA 5AK6A 2ZXHA 1HEKA 3UXOA 2J6SA 4ELUA 3JPSA 1JQRA 1S0MA 3JPOA 3HPOA 2W7OA 9ICNA 1F44A 2H3IA 4NKTA 2VA8A 1ZJNA 3QYPA 2M2WA 3NASA 5DBBA 4UB5A 3T5HA 3VC8A 5KFKA 2KVSA 1FFVA 2VANA 4BWJA 5KFQA 4ED1A 3QEAZ 2K89A 8ICBA 2Y9TA 4QW8A 2DKZA 1KRPA 2BR0A 5AK3A 1KSPA 3I1YA 2W03A 8ICUA 5DB8A 1L7PA 4Y2PA 4GC7A 1A77A 1HIWA 5HRKA 2E8PA 2I5HA 5ALJA 1NI3A 2H3FA 5CWRA 4X0AA 1JX4A 5KL1B 1RYSA 2RFFA 1K1QA 2XICA 1SKWA 1FO4A 4M6WA 1ZQFA 5AK5A 2JH1A 2YB4A 4X4VA 4O69A 3Q8KA 4WQLA 5J0QA 2HHXA 4I2JA 2IOHA 2KV2A 5KT4A 2CRXA 1R89A 3V7LA 2B4VA 4RQMA 4LT6A 5JUMA 1PK1A 1ZQVA 2BCRA 4DL3A 2ALZA 1OW5A 4Y2RA 5ALNA 3NRWA 5KG1A 5KFRA 2B0CA 1T4GA 3QEBZ 1T94A 1VLBA 2DR8A 3RJHA 3MBYA 3B0YA 1KFSA 4R63A 1IG6A 1N60A 4UB4A 4JV1A 5D46A 2RLTA 4I2BA 7ICTA 2JMGA 2Q4TA 3H4BA 3PW0A 4WJ3B 1X66A 2BKEA 3NVZA 5H2FU 2NO5A 4EX7A 1PVQA 4UARA 4F72A 4IRDA 1NK4A 4YMOA 4P4MA 1ZQRA 2WF6A 4B9NA 4PH5A 4WC4A 2QKQA 4X4QA 4KLIA 3HILA 2HOFA 4Y2XA 4UATA 2UVVA 3WKCA 5J0RA 7ICFA 7ICHA 2HHPA 2G06A 3KOOA 4Y2SA 2IUBA 3C1ZA 3UPSA 2B6GA 2PFPA 4JMUA 4K4HA 3KD3A 1F5AA 2EZXA 2BZFA 1Z4NA 5ALRA 2OYYA 2RP5A 8ICJA 4JWMA 1XWLA 3M8SA 7ICEA 3T5KA 4DWIA 2D8CA 4TUSA 4IQTA 2KKVA 5HRIA 3WKAA 5AKHA 5AKXA 5KG5A 2XY7A 2BCUA 5D4BA 4JLZA 8ICIA 2MRLA 3RB6A 5HR6A 5B3PA 4EP7A 1KN5A 1NKBA 2RHFA 5CHEA 2DPJA 2P6UA 1NZPA 1U47A 1AROP 2UVUA 8ICTA 4C4RA 4MEYA 4GXIA 4OJ5A 4DL2A 5J0WA 3TADC 1Y88A 2ZUDA 3FDSA 3EUB2 2ZH2A 4U7CA 3C18A 2DR9A 3N4MB 1NK9A 4I2GA 2P35A 2K4EA 1UT5A 4QZGA 5HR7A 4QJFB 2A1JB 1CRXA 2O6KA 2ZH1A 2BHNA 4BJQA 4RT2A 4KLHA 5HHIA 3HJEA 2MUTA 4J9NA 3KKAA 3N28A 5DB9A 3RTVA 3ZD8A 1M6YA 2EWRA 1AQ6A 4DFJA 1XNSA 2M2VA 4N7RA 2I6XA 5J2BA 1ZD3A 2WHEA 1SZHA 3TFSA 4A8EA 3WK5A 1Z00A 2ATLA 1UPHA 4O9MA 4M9HA 3TANA 3C2LA 7ICNA 2DVIA 4KLQA 4DQIA 3TACB 3QU5A 2OHFA 9ICTA 4F4WA 4TUQA 3H40A 2M2UA 2NRKA 4AT7B 3QUCA 4NL9A 8ICRA 1UCVA 4EBEA 2EAOA 5KG3A 1RYRA 1N5XA 3B9JA 1UHUA 5HRFA 3Q8SB 2QB1A 5KFUA 2HBMA 3ED5A 3AEVA 3RFAA 4TQRA 2OEHA 4CNQA 2AHOB 5KFVA 4WC1A 4OD0A 2LPEA 2F8LA 4UAWA 3V6HA 2G5IB 5AIAA 4X5VA 4BDPA 1BPEA 4YMMA 5KFMA 1MIVA 4EEYA 3WU2U 5ALFA 3SV4A 4I2HA
chains in the Genus database with same CATH topology
1XS9D 4J9RA 4NLZA 4IQVA 3SZ2A 4RNOA 3JPNA 3M9MB 1EXNA 3RRHA 4O3SA 3HT3A 9ICCA 8ICZA 2KP7A 1BNPA 1VFGA 3KHHA 2DPIA 5J0UA 4KLSA 4C8NA 5J0SA 2BCVA 3TAPA 4DS4A 2JEGA 2ZUBA 4P4OA 4EBKA 4DOCA 1QLNA 3V6JA 4FHWA 2HHUA 7ICOA 3OVAA 7ICSA 1BGXT 1WOTA 3RBDA 4ATBA 2IHMA 4NLKA 2NRTA 3RRGA 2BPCA 3ZDBA 3LWMA 2AQ0A 3ORYA 4M0AA 3EWAA 8ICAA 5KG4A 7ICQA 4RNNA 4F8RA 4ECRA 4I2FA 4KLOA 4C8LA 4R8UB 4B9SA 3V7KA 1Q78A 2RDIA 2HVIA 4MFAA 2FMPA 1B43A 2ZJ8A 3BQTA 2AGPA 1ZQEA 1ZQHA 4FBUA 3H8WA 4EZ6A 1NO5A 5J0YA 1UT8A 4Q8EA 1UEVA 5J2GA 3NYBA 4FHVA 4QZ9A 1ZQXA 2XY6A 3OJSA 5KFIA 4GLXA 4FO6A 4DLEA 2P66A 5J2AA 3IM1A 5DG7A 1XC9A 4NLGA 2HHVA 2AJQA 4IRCA 1H38A 1U45A 4QWEA 1R8CA 4F4XA 2HVHA 4I2IA 1X9WA 8ICXA 5KFWA 4F4ZA 2BQ3A 5EWFA 4J9KA 1MC8A 2C2EA 3BQ2A 3Q8MA 4I29A 3PO4A 3WFPA 5KT6A 4UAZA 4S3NA 4UBCA 2W8LA 2PXIA 1ZQPA 5L1JA 3RB3A 4ECSA 5J2EA 3GIKA 4PHAA 3RJEA 3PMLA 1Z3EB 3TQ1A 9ICAA 3K4GA 5KFXA 8ICFA 1RPLA 4O3PA 2VA3A 3MGIA 3OV7A 3K75D 1TAQA 4F5NA 3TARA 2ZTCA 3PV8A 2MUTB 2AGQA 3BQ1A 1CEZA 4ECXA 4X4PA 1KFTA 1T3NA 4UB2A 4DQPA 1S0NA 4I2CA 1BPBA 1ZQTA 1QSYA 3ZDDA 4UD5A 4XQ7A 1V9PA 1KDHA 5CJ7A 1ZQCA 1KLNA 3PX6A 4F5PA 3PW5A 4UQGA 3MGHA 4DSKA 3MDCA 5J2KA 5CB1A 1ZQYA 3GQCA 4YN4A 4E0DA 3WFRE 4XQ8A 5KFTA 5HC9A 4QZIA 1UA1A 2J6UA 3SYZA 1U48A 2HW3A 2ZTDA 9ICFA 5C5JA 4M04A 7ICKA 4R65A 1ZQWA 5KT7A 3OHAA 3GILA 4J9PA 4DSJA 1S0VA 3EW9A 5DDMA 4ELVA 5KFHA 2HHSA 9ICKA 1OU5A 1Z00B 3ZDEA 2ISPA 3HJ4A 2BGWA 5L1LA 3SV3A 1V4AA 5KT5A 7ICLA 9ICOA 1TK5A 5D49A 5CA7A 2W8KA 5KG2A 4YD2A 3RJJA 2PI5A 1R8BA 4X0BA 3RBEA 1LV5A 3RJIA 1NK8A 4KLLA 8ICOA 1T7PA 4EYHB 2R8JA 8ICLA 4DL4A 1RZTA 5KFZA 3SI8A 3PO5A 3MR5A 2O1PA 1XU4A 1FA0A 4RQ2A 1NK0A 1KTQA 3PW4A 3KTQA 5BOMA 5KG7A 2Y1JA 3MR2A 8ICCA 1MIYA 4I27A 4R66A 2ZH9A 4RQ4A 2DRBA 5KFPA 5KFBA 5DB6A 3C5FA 3OGUA 1D8YA 4RQ8A 1TK0A 4FH3A 2FLPA 3QZ8A 4KLTA 2HHWA 2B21A 4O5KA 1D8LA 5DBCA 5J2HA 1ZQQA 3C2MA 9ICUA 4YQWA 4MF8A 2XCAA 4WBYA 4WC2A 4IRKA 9ICSA 3RB4A 7ICMA 1S10A 3GV5B 2C2RA 5HP4A 2ZH6A 5BOLA 3PX4A 2ZH8A 4Z6EA 4QZEA 2BCSA 4AT8A 3H7IA 2ZHAA 1T8EA 5HNKA 2FMQA 4ED3A 3ZDCA 2LYHA 3M9OB 1JIHA 3G6XA 4LVSA 9ICGA 4F50A 1MQ2A 4F4YA 3PX0A 3AQMA 5HMLA 4YCXA 5KFLA 4YR0A 5L1KA 4X4NA 5J0PA 1ZQOA 1SL0A 2GWSA 2JZBB 5TZVA 3TAQA 2W9CB 4F92B 3PW7A 1U49A 1XSNA 3Q8LA 2ZUCA 1TV9A 1ZJMA 3ETLA 4GC6A 3JZ0A 2V4RA 1VJ7A 3GDXA 2I1QA 4ELTA 2HHTA 4EBDA 2NRZA 4M9LA 1PX5A 3H3AA 5BPCA 1TK8A 1TFYA 1XSLA 5KG6A 1L5UA 2BPGA 5HRLA 3C21A 3V7JA 4I2DA 5KT2A 1XO1A 5KFNA 4F3OA 3HW8A 4F93B 2W9CA 3BQ0A 2JEFA 3C2KA 1S76D 4YR3A 5L9XA 9ICBA 2UVRA 4ATBB 2ZHBA 4O5EA 1ZQIA 5DQGA 2HHQA 4MFFA 4FS1A 8ICGA 3LQCB 5KG0A 2FPLA 3OSPA 3HIYA 4JK1A 3OUYB 3JPQA 5IIMA 3RR8A 8ICYA 3HX0A 5HRHA 1HUOA 4JV2A 2PFQA 4ED6A 3KHLA 1X9MA 2M9NA 4GXJA 4B9VA 4CCHA 4I28A 5DECA 4WC7A 2R8HA 5EOZA 5KTQA 4J9SA 1NKCA 3L9DA 4X4UA 3H38A 3OVSA 3MR3A 1NK7A 4ED2A 1BVSA 1TFRA 3IHQB 3PNCA 3OUYA 3RJGA 1ZQAA 3OSNA 5CP2A 1YLQA 3SV4A 4MF2A 2BE3A 3UXOA 1ZYQA 4QWBA 4M9JA 3EZ5A 1TKDA 1MSWD 2J6SA 4ELUA 3JPSA 1C7YA 2OWOA 1JQRA 2IMWP 4QWDA 1S0MA 1NJWA 5KFGA 3JPOA 2R8GA 9ICRA 4WC3A 3AQKA 2ASLA 3AU6A 3HPOA 3GV8B 4ECQA 4P4PA 9ICNA 5EWEA 5KFCA 3BJYA 2VA8A 4ECUA 1ZJNA 4M2YA 4IQWA 4NKTA 2FLLA 2M2WA 1TFWA 4F2RA 5DBBA 4F2SA 4RNMA 8ICWA 4UB5A 9ICEA 4FBTA 9ICVA 3ISBA 2RDJA 3T5HA 9ICQA 3HP6A 3GIIA 2KZMA 5KFKA 3EPGA 4MEXA 5EWGA 3V72A 2VANA 3LK9A 4BWJA 3RJKA 5KFQA 5DKWA 7ICGA 4ED1A 1QSLA 4MFCA 3JPTA 1K1SA 4KMUA 3GIMA 4QW8A 3QEAZ 1N56A 8ICBA 4ZH4A 4P2HA 4K4IA 1KRPA 4KLMA 2ZH5A 5J0OA 2BR0A 4BGDA 2V9WA 1KSPA 3ISDA 1ZETA 4RQ7A 1LB2B 1SL2A 8ICUA 5DB8A 4RQ0A 4G3IA 4GC7A 3OVBA 4ED0A 8ICHA 3H37A 1A77A 1ZQJA 4KLGA 5HRKA 1KNYA 4QZ8A 3GIJA 3MDAA 4ECYA 5DDYA 1B22A 3H39A 2DR7A 4YR2A 4AT9A 4RQ6A 4KTQA 4M6WB 1U4BA 2ZTEA 1ZQMA 2M2TA 4RWNA 5CWRA 4DQRA 4KLDA 4X0AA 4DL6A 3QE9Y 1JX4A 2FPKA 4RUAA 4RU9A 4R64A 2ISOA 4FHXA 5J2CA 3C23A 1RYSA 4I2HA 3QZ7A 3C5GA 2RFFA 1K1QA 4M9NA 8ICVA 2Q0ZX 2R8IA 1SKWA 5IINA 5DQHA 4DFMA 2ZH4A 1QSSA 1JMSA 4J9LA 3T3FA 4M6WA 1DOQA 1NKEA 1ZQFA 4O5CA 5DEDA 4AT8B 7ICRA 4HYKA 4EBCA 2W9BA 4X4VA 1TVAA 4PHPA 3Q8KA 4DSEA 1IM4A 4QZHA 3MR6A 4O3RA 5DB7A 5J0QA 2HHXA 4I2JA 1X2IA 3H8SA 3M8RA 2A1JA 4IQUA 3M9NB 1NJZA 4XA5A 4KN4A 1NK6A 5KT4A 9ICXA 1R89A 4RPXA 3V7LA 2WTFA 2R8KA 3RB0A 4YXMA 3GV7B 4EZ9A 1ZQZA 3NGDA 4LT6A 5DBAA 5KFYA 4F91B 1NK5A 4X4SA 2C2DA 5JUMA 4DL5A 1ZQVA 5DLGA 2BCRA 3KHGA 3NTUA 4DL3A 4RQ3A 5J2DA 2ALZA 4FS2A 4X4OA 3G6YA 9ICHA 4QWCA 4EBJA 1L3VA 4JUZA 5DGAA 3HJ1A 5KG1A 1ZQBA 5KFRA 3RAXA 1HJPA 1T4GA 3QEBZ 2JEJA 3PY8A 1RXVA 2DR8A 3HWTA 4NM2A 4J9MA 1SZPA 4PGYA 3ZD9A 5KFOA 3RJHA 5J0XA 4IR9A 4LZDA 3LDAA 5J0TA 3MBYA 3H4DA 4XUSA 4DLGA 3B0YA 3MABA 5DG8A 4ED7A 4UB3A 4DFKA 4DF4A 2XC9A 4R63A 4F5RA 4DSFA 1KFSA 2AQ4A 1ZQLA 4UB4A 1KEJA 4TUPA 1ZQKA 3BDPA 5D46A 4JV1A 3RAQA 5DG9A 4FHPA 4J9QA 4QZCA 1L3UA 2KFZA 4E8FA 5CR0A 5IIIA 4WCWA 1BPYA 4DEZA 2KN7A 3PR4A 2V4QA 1JXLA 4B9TA 4I2BA 7ICTA 3C66A 3UXNA 3H4BA 3PW0A 9ICMA 2BKEA 4QW9A 1X9SA 5F2VO 4J9OA 4TQSA 3ISCA 4DQSA 3OHBA 4IG8A 2KZ3A 2XO7A 4O3NA 4JV0A 4IRDA 4UB1A 2NRXA 4RPZA 5CHGA 1NK4A 4YMOA 1MIWA 4DF8A 4KLUA 4P4MA 2ASDA 4AT7A 3RH4A 1ZQRA 3WFSC 4QZDA 4B9NA 4PH5A 5DGBA 4TURA 2XCPA 4LZGA 4WC4A 1D9DA 4KN7A 7ICIA 4X4QA 4RWQA 3JPRA 1S97A 4KLIA 5HREA 4NXZA 1N48A 1R8AA 2F1JA 2P6RA 4XRHA 4PGQA 5IILA 2BQRA 2UVVA 5J0RA 7ICFA 4DSLA 2PI4A 7ICHA 4E7XA 4QZAA 2HHPA 2W9AA 3THVA 4C8KA 2BQUA 4Q8FA 3C1ZA 3UPSA 2UVWA 4E80A 9ICWA 2PFPA 3UQ0A 3AQLA 2W9MA 1DGSA 4ED8A 4K4HA 5IIJA 1F5AA 1ZQSA 4RWPA 4PPXA 3PW2A 4NKUA 4RQ1A 4DSIA 4NLNA 9ICLA 2ZJ5A 7ICJA 3H8JA 8ICJA 4YG2A 4DOAA 4DO9A 4JWMA 4X4TA 1XWLA 5HRGA 1PZNA 5DLFA 3M8SA 7ICEA 3T5KA 4ECTA 4DWIA 3PVXA 3T5JA 4TUSA 4IQTA 4PGXA 4YP3A 4Z6FA 3T5LA 5HRIA 2XY7A 5KG5A 3OJUA 2BCUA 5D4BA 3AUOA 4YFKA 1QTMA 1WCLA 4RZRA 8ICIA 8ICNA 4WC6A 3G6VA 4PHDA 4B9MA 3RB6A 3RJFA 4EP7A 1NKBA 2DPJA 2P6UA 1NZPA 4Z6CA 1U47A 1ZQDA 2C28A 8ICEA 1COOA 2ID1A 2VA2A 4AT9B 4X4RA 1AROP 2UVUA 4YD1A 8ICTA 3WFQE 1MQ3A 2PBEA 4MEYA 2PFNA 4IR1A 4GXIA 1BPXA 5IIOA 4DL2A 4R8UA 5J0WA 1U9LA 1NJYA 8ICMA 4YVZA 4KLEA 7ICVA 5HHHA 2XGPA 1Y88A 2ZUDA 3FDSA 5KFSA 1SKRA 2FLNA 2Q66A 2ZH2A 4WBZA 3C18A 2IHNA 2O5AA 2DR9A 3N4MB 1NK9A 7ICPA 3JYYA 4F4KA 1S0OA 3TFRA 4RPYA 4I2GA 4RUCA 2ZJAA 3AU2A 4Q45A 1ZQGA 4EYIB 2W9BB 2FPMA 1UT5A 4YXJA 2AU0A 4QZGA 4M47A 2DFLA 1CUKA 2AGOA 4KITB 3RH6A 2A1JB 5J2FA 3ZDAA 3AQNA 1ZQNA 1WCNA 2BHNA 2FMSA 2ZH1A 3UQ2A 4RT2A 2NRVA 4KLHA 2IBKA 5HHIA 4WC5A 2NRWA 8ICSA 1S9FA 4F5OA 4FH5A 2MUTA 4J9NA 1HUZA 4I2AA 4NM1A 4YMNA 2ZH7A 1KFDA 1JN3A 2F1IA 5DB9A 3RTVA 3FYHA 3ZD8A 2F1HA 3Q8PB 4K4GA 2DR5A 2H5XA 4DFJA 5KFEA 2KTQA 3JPPA 2M2VA 1A76A 4RWOA 4B9LA 5L1IA 5F9LA 1SL1A 5J2BA 4I2EA 4DS5A 5DQIA 1UA0A 2KFNA 1Q79A 4O0IA 5J2IA 3Q8QB 3TFSA 3MFIA 4ECZA 3GFKB 1Z00A 2C22A 2KZZA 2ATLA 4QWAA 5F9NA 2PFOA 2JEIA 4O9MA 4M9HA 1S77D 3LWLA 1JXEA 1BPZA 4KLFA 4GXKA 3TANA 5IIKA 3C2LA 4BXOB 3MFHA 5HR9A 4Z6DA 2BPFA 1NJXA 5KFDA 4F5QA 4NY8A 7ICNA 1SKSA 1DK2A 5HRDA 4KLQA 2DVIA 4DQIA 5J2JA 4QZBA 1UETA 1BPDA 9ICTA 4F4WA 1JAJA 3WFOA 4RT3A 1DK3A 4TUQA 4JWNA 1NOMA 3H40A 5J29A 2M2UA 2NRKA 5HRBA 3C1YA 4AT7B 4DQQA 3UXPA 2XY5A 3EPIA 2IA6A 9ICPA 5HMMA 3E2EA 8ICRA 4BXOA 2XGQA 4DFPA 4ECVA 4EBEA 4RQ5A 5KG3A 2Y1IA 1RYRA 1BNOA 3V6KA 4DOBA 2BCQA 3EYZA 7ICUA 3UPQA 3RR7A 5HRFA 1ZQUA 4C8OA 3Q8SB 8ICPA 2MAXA 5KFUA 4WC0A 4O3OA 1L3TA 3Q8RB 3N97B 1TAUA 2ASJA 4B9UA 4TQRA 4C8MA 9ICIA 4BWMA 3PMNA 1IXRA 5KT3A 4DL7A 5KFVA 3TI0A 3RH5A 1RXWA 2I9GA 4UD4A 4WC1A 2DRAA 9ICJA 1UEUA 4M9GA 1L3SA 3B0XA 4UAWA 5KFAA 1XSPA 2BDPA 4FHYA 4UAYA 3V6HA 2ZH3A 8ICQA 5KFFA 2J6TA 4KLJA 4Q43A 8ICKA 4UBBA 2JZBA 1BPEA 4YMMA 3KHRA 4PHEA 4X5VA 1D9FA 4BDPA 4M5DA 5KFMA 5KFJA 1MIVA 4EEYA 4O3QA 4ECWA 3PR5B 4Q44A 4QZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XS9 D;  4J9R A;  4NLZ A;  4IQV A;  3SZ2 A;  4RNO A;  3JPN A;  3M9M B;  1EXN A;  3RRH A;  4O3S A;  3HT3 A;  9ICC A;  8ICZ A;  2KP7 A;  1BNP A;  1VFG A;  3KHH A;  2DPI A;  5J0U A;  4KLS A;  4C8N A;  5J0S A;  2BCV A;  3TAP A;  4DS4 A;  2JEG A;  2ZUB A;  4P4O A;  4EBK A;  4DOC A;  1QLN A;  3V6J A;  4FHW A;  2HHU A;  7ICO A;  3OVA A;  7ICS A;  1BGX T;  1WOT A;  3RBD A;  4ATB A;  2IHM A;  4NLK A;  2NRT A;  3RRG A;  2BPC A;  3ZDB A;  3LWM A;  2AQ0 A;  3ORY A;  4M0A A;  3EWA A;  8ICA A;  5KG4 A;  7ICQ A;  4RNN A;  4F8R A;  4ECR A;  4I2F A;  4KLO A;  4C8L A;  4R8U B;  4B9S A;  3V7K A;  1Q78 A;  2RDI A;  2HVI A;  4MFA A;  2FMP A;  1B43 A;  2ZJ8 A;  3BQT A;  2AGP A;  1ZQE A;  1ZQH A;  4FBU A;  3H8W A;  4EZ6 A;  1NO5 A;  5J0Y A;  1UT8 A;  4Q8E A;  1UEV A;  5J2G A;  3NYB A;  4FHV A;  4QZ9 A;  1ZQX A;  2XY6 A;  3OJS A;  5KFI A;  4GLX A;  4FO6 A;  4DLE A;  2P66 A;  5J2A A;  3IM1 A;  5DG7 A;  1XC9 A;  4NLG A;  2HHV A;  2AJQ A;  4IRC A;  1H38 A;  1U45 A;  4QWE A;  1R8C A;  4F4X A;  2HVH A;  4I2I A;  1X9W A;  8ICX A;  5KFW A;  4F4Z A;  2BQ3 A;  5EWF A;  4J9K A;  1MC8 A;  2C2E A;  3BQ2 A;  3Q8M A;  4I29 A;  3PO4 A;  3WFP A;  5KT6 A;  4UAZ A;  4S3N A;  4UBC A;  2W8L A;  2PXI A;  1ZQP A;  5L1J A;  3RB3 A;  4ECS A;  5J2E A;  3GIK A;  4PHA A;  3RJE A;  3PML A;  1Z3E B;  3TQ1 A;  9ICA A;  3K4G A;  5KFX A;  8ICF A;  1RPL A;  4O3P A;  2VA3 A;  3MGI A;  3OV7 A;  3K75 D;  1TAQ A;  4F5N A;  3TAR A;  2ZTC A;  3PV8 A;  2MUT B;  2AGQ A;  3BQ1 A;  1CEZ A;  4ECX A;  4X4P A;  1KFT A;  1T3N A;  4UB2 A;  4DQP A;  1S0N A;  4I2C A;  1BPB A;  1ZQT A;  1QSY A;  3ZDD A;  4UD5 A;  4XQ7 A;  1V9P A;  1KDH A;  5CJ7 A;  1ZQC A;  1KLN A;  3PX6 A;  4F5P A;  3PW5 A;  4UQG A;  3MGH A;  4DSK A;  3MDC A;  5J2K A;  5CB1 A;  1ZQY A;  3GQC A;  4YN4 A;  4E0D A;  3WFR E;  4XQ8 A;  5KFT A;  5HC9 A;  4QZI A;  1UA1 A;  2J6U A;  3SYZ A;  1U48 A;  2HW3 A;  2ZTD A;  9ICF A;  5C5J A;  4M04 A;  7ICK A;  4R65 A;  1ZQW A;  5KT7 A;  3OHA A;  3GIL A;  4J9P A;  4DSJ A;  1S0V A;  3EW9 A;  5DDM A;  4ELV A;  5KFH A;  2HHS A;  9ICK A;  1OU5 A;  1Z00 B;  3ZDE A;  2ISP A;  3HJ4 A;  2BGW A;  5L1L A;  3SV3 A;  1V4A A;  5KT5 A;  7ICL A;  9ICO A;  1TK5 A;  5D49 A;  5CA7 A;  2W8K A;  5KG2 A;  4YD2 A;  3RJJ A;  2PI5 A;  1R8B A;  4X0B A;  3RBE A;  1LV5 A;  3RJI A;  1NK8 A;  4KLL A;  8ICO A;  1T7P A;  4EYH B;  2R8J A;  8ICL A;  4DL4 A;  1RZT A;  5KFZ A;  3SI8 A;  3PO5 A;  3MR5 A;  2O1P A;  1XU4 A;  1FA0 A;  4RQ2 A;  1NK0 A;  1KTQ A;  3PW4 A;  3KTQ A;  5BOM A;  5KG7 A;  2Y1J A;  3MR2 A;  8ICC A;  1MIY A;  4I27 A;  4R66 A;  2ZH9 A;  4RQ4 A;  2DRB A;  5KFP A;  5KFB A;  5DB6 A;  3C5F A;  3OGU A;  1D8Y A;  4RQ8 A;  1TK0 A;  4FH3 A;  2FLP A;  3QZ8 A;  4KLT A;  2HHW A;  2B21 A;  4O5K A;  1D8L A;  5DBC A;  5J2H A;  1ZQQ A;  3C2M A;  9ICU A;  4YQW A;  4MF8 A;  2XCA A;  4WBY A;  4WC2 A;  4IRK A;  9ICS A;  3RB4 A;  7ICM A;  1S10 A;  3GV5 B;  2C2R A;  5HP4 A;  2ZH6 A;  5BOL A;  3PX4 A;  2ZH8 A;  4Z6E A;  4QZE A;  2BCS A;  4AT8 A;  3H7I A;  2ZHA A;  1T8E A;  5HNK A;  2FMQ A;  4ED3 A;  3ZDC A;  2LYH A;  3M9O B;  1JIH A;  3G6X A;  4LVS A;  9ICG A;  4F50 A;  1MQ2 A;  4F4Y A;  3PX0 A;  3AQM A;  5HML A;  4YCX A;  5KFL A;  4YR0 A;  5L1K A;  4X4N A;  5J0P A;  1ZQO A;  1SL0 A;  2GWS A;  2JZB B;  5TZV A;  3TAQ A;  2W9C B;  4F92 B;  3PW7 A;  1U49 A;  1XSN A;  3Q8L A;  2ZUC A;  1TV9 A;  1ZJM A;  3ETL A;  4GC6 A;  3JZ0 A;  2V4R A;  1VJ7 A;  3GDX A;  2I1Q A;  4ELT A;  2HHT A;  4EBD A;  2NRZ A;  4M9L A;  1PX5 A;  3H3A A;  5BPC A;  1TK8 A;  1TFY A;  1XSL A;  5KG6 A;  1L5U A;  2BPG A;  5HRL A;  3C21 A;  3V7J A;  4I2D A;  5KT2 A;  1XO1 A;  5KFN A;  4F3O A;  3HW8 A;  4F93 B;  2W9C A;  3BQ0 A;  2JEF A;  3C2K A;  1S76 D;  4YR3 A;  5L9X A;  9ICB A;  2UVR A;  4ATB B;  2ZHB A;  4O5E A;  1ZQI A;  5DQG A;  2HHQ A;  4MFF A;  4FS1 A;  8ICG A;  3LQC B;  5KG0 A;  2FPL A;  3OSP A;  3HIY A;  4JK1 A;  3OUY B;  3JPQ A;  5IIM A;  3RR8 A;  8ICY A;  3HX0 A;  5HRH A;  1HUO A;  4JV2 A;  2PFQ A;  4ED6 A;  3KHL A;  1X9M A;  2M9N A;  4GXJ A;  4B9V A;  4CCH A;  4I28 A;  5DEC A;  4WC7 A;  2R8H A;  5EOZ A;  5KTQ A;  4J9S A;  1NKC A;  3L9D A;  4X4U A;  3H38 A;  3OVS A;  3MR3 A;  1NK7 A;  4ED2 A;  1BVS A;  1TFR A;  3IHQ B;  3PNC A;  3OUY A;  3RJG A;  1ZQA A;  3OSN A;  5CP2 A;  1YLQ A;  3SV4 A;  4MF2 A;  2BE3 A;  3UXO A;  1ZYQ A;  4QWB A;  4M9J A;  3EZ5 A;  1TKD A;  1MSW D;  2J6S A;  4ELU A;  3JPS A;  1C7Y A;  2OWO A;  1JQR A;  2IMW P;  4QWD A;  1S0M A;  1NJW A;  5KFG A;  3JPO A;  2R8G A;  9ICR A;  4WC3 A;  3AQK A;  2ASL A;  3AU6 A;  3HPO A;  3GV8 B;  4ECQ A;  4P4P A;  9ICN A;  5EWE A;  5KFC A;  3BJY A;  2VA8 A;  4ECU A;  1ZJN A;  4M2Y A;  4IQW A;  4NKT A;  2FLL A;  2M2W A;  1TFW A;  4F2R A;  5DBB A;  4F2S A;  4RNM A;  8ICW A;  4UB5 A;  9ICE A;  4FBT A;  9ICV A;  3ISB A;  2RDJ A;  3T5H A;  9ICQ A;  3HP6 A;  3GII A;  2KZM A;  5KFK A;  3EPG A;  4MEX A;  5EWG A;  3V72 A;  2VAN A;  3LK9 A;  4BWJ A;  3RJK A;  5KFQ A;  5DKW A;  7ICG A;  4ED1 A;  1QSL A;  4MFC A;  3JPT A;  1K1S A;  4KMU A;  3GIM A;  4QW8 A;  3QEA Z;  1N56 A;  8ICB A;  4ZH4 A;  4P2H A;  4K4I A;  1KRP A;  4KLM A;  2ZH5 A;  5J0O A;  2BR0 A;  4BGD A;  2V9W A;  1KSP A;  3ISD A;  1ZET A;  4RQ7 A;  1LB2 B;  1SL2 A;  8ICU A;  5DB8 A;  4RQ0 A;  4G3I A;  4GC7 A;  3OVB A;  4ED0 A;  8ICH A;  3H37 A;  1A77 A;  1ZQJ A;  4KLG A;  5HRK A;  1KNY A;  4QZ8 A;  3GIJ A;  3MDA A;  4ECY A;  5DDY A;  1B22 A;  3H39 A;  2DR7 A;  4YR2 A;  4AT9 A;  4RQ6 A;  4KTQ A;  4M6W B;  1U4B A;  2ZTE A;  1ZQM A;  2M2T A;  4RWN A;  5CWR A;  4DQR A;  4KLD A;  4X0A A;  4DL6 A;  3QE9 Y;  1JX4 A;  2FPK A;  4RUA A;  4RU9 A;  4R64 A;  2ISO A;  4FHX A;  5J2C A;  3C23 A;  1RYS A;  4I2H A;  3QZ7 A;  3C5G A;  2RFF A;  1K1Q A;  4M9N A;  8ICV A;  2Q0Z X;  2R8I A;  1SKW A;  5IIN A;  5DQH A;  4DFM A;  2ZH4 A;  1QSS A;  1JMS A;  4J9L A;  3T3F A;  4M6W A;  1DOQ A;  1NKE A;  1ZQF A;  4O5C A;  5DED A;  4AT8 B;  7ICR A;  4HYK A;  4EBC A;  2W9B A;  4X4V A;  1TVA A;  4PHP A;  3Q8K A;  4DSE A;  1IM4 A;  4QZH A;  3MR6 A;  4O3R A;  5DB7 A;  5J0Q A;  2HHX A;  4I2J A;  1X2I A;  3H8S A;  3M8R A;  2A1J A;  4IQU A;  3M9N B;  1NJZ A;  4XA5 A;  4KN4 A;  1NK6 A;  5KT4 A;  9ICX A;  1R89 A;  4RPX A;  3V7L A;  2WTF A;  2R8K A;  3RB0 A;  4YXM A;  3GV7 B;  4EZ9 A;  1ZQZ A;  3NGD A;  4LT6 A;  5DBA A;  5KFY A;  4F91 B;  1NK5 A;  4X4S A;  2C2D A;  5JUM A;  4DL5 A;  1ZQV A;  5DLG A;  2BCR A;  3KHG A;  3NTU A;  4DL3 A;  4RQ3 A;  5J2D A;  2ALZ A;  4FS2 A;  4X4O A;  3G6Y A;  9ICH A;  4QWC A;  4EBJ A;  1L3V A;  4JUZ A;  5DGA A;  3HJ1 A;  5KG1 A;  1ZQB A;  5KFR A;  3RAX A;  1HJP A;  1T4G A;  3QEB Z;  2JEJ A;  3PY8 A;  1RXV A;  2DR8 A;  3HWT A;  4NM2 A;  4J9M A;  1SZP A;  4PGY A;  3ZD9 A;  5KFO A;  3RJH A;  5J0X A;  4IR9 A;  4LZD A;  3LDA A;  5J0T A;  3MBY A;  3H4D A;  4XUS A;  4DLG A;  3B0Y A;  3MAB A;  5DG8 A;  4ED7 A;  4UB3 A;  4DFK A;  4DF4 A;  2XC9 A;  4R63 A;  4F5R A;  4DSF A;  1KFS A;  2AQ4 A;  1ZQL A;  4UB4 A;  1KEJ A;  4TUP A;  1ZQK A;  3BDP A;  5D46 A;  4JV1 A;  3RAQ A;  5DG9 A;  4FHP A;  4J9Q A;  4QZC A;  1L3U A;  2KFZ A;  4E8F A;  5CR0 A;  5III A;  4WCW A;  1BPY A;  4DEZ A;  2KN7 A;  3PR4 A;  2V4Q A;  1JXL A;  4B9T A;  4I2B A;  7ICT A;  3C66 A;  3UXN A;  3H4B A;  3PW0 A;  9ICM A;  2BKE A;  4QW9 A;  1X9S A;  5F2V O;  4J9O A;  4TQS A;  3ISC A;  4DQS A;  3OHB A;  4IG8 A;  2KZ3 A;  2XO7 A;  4O3N A;  4JV0 A;  4IRD A;  4UB1 A;  2NRX A;  4RPZ A;  5CHG A;  1NK4 A;  4YMO A;  1MIW A;  4DF8 A;  4KLU A;  4P4M A;  2ASD A;  4AT7 A;  3RH4 A;  1ZQR A;  3WFS C;  4QZD A;  4B9N A;  4PH5 A;  5DGB A;  4TUR A;  2XCP A;  4LZG A;  4WC4 A;  1D9D A;  4KN7 A;  7ICI A;  4X4Q A;  4RWQ A;  3JPR A;  1S97 A;  4KLI A;  5HRE A;  4NXZ A;  1N48 A;  1R8A A;  2F1J A;  2P6R A;  4XRH A;  4PGQ A;  5IIL A;  2BQR A;  2UVV A;  5J0R A;  7ICF A;  4DSL A;  2PI4 A;  7ICH A;  4E7X A;  4QZA A;  2HHP A;  2W9A A;  3THV A;  4C8K A;  2BQU A;  4Q8F A;  3C1Z A;  3UPS A;  2UVW A;  4E80 A;  9ICW A;  2PFP A;  3UQ0 A;  3AQL A;  2W9M A;  1DGS A;  4ED8 A;  4K4H A;  5IIJ A;  1F5A A;  1ZQS A;  4RWP A;  4PPX A;  3PW2 A;  4NKU A;  4RQ1 A;  4DSI A;  4NLN A;  9ICL A;  2ZJ5 A;  7ICJ A;  3H8J A;  8ICJ A;  4YG2 A;  4DOA A;  4DO9 A;  4JWM A;  4X4T A;  1XWL A;  5HRG A;  1PZN A;  5DLF A;  3M8S A;  7ICE A;  3T5K A;  4ECT A;  4DWI A;  3PVX A;  3T5J A;  4TUS A;  4IQT A;  4PGX A;  4YP3 A;  4Z6F A;  3T5L A;  5HRI A;  2XY7 A;  5KG5 A;  3OJU A;  2BCU A;  5D4B A;  3AUO A;  4YFK A;  1QTM A;  1WCL A;  4RZR A;  8ICI A;  8ICN A;  4WC6 A;  3G6V A;  4PHD A;  4B9M A;  3RB6 A;  3RJF A;  4EP7 A;  1NKB A;  2DPJ A;  2P6U A;  1NZP A;  4Z6C A;  1U47 A;  1ZQD A;  2C28 A;  8ICE A;  1COO A;  2ID1 A;  2VA2 A;  4AT9 B;  4X4R A;  1ARO P;  2UVU A;  4YD1 A;  8ICT A;  3WFQ E;  1MQ3 A;  2PBE A;  4MEY A;  2PFN A;  4IR1 A;  4GXI A;  1BPX A;  5IIO A;  4DL2 A;  4R8U A;  5J0W A;  1U9L A;  1NJY A;  8ICM A;  4YVZ A;  4KLE A;  7ICV A;  5HHH A;  2XGP A;  1Y88 A;  2ZUD A;  3FDS A;  5KFS A;  1SKR A;  2FLN A;  2Q66 A;  2ZH2 A;  4WBZ A;  3C18 A;  2IHN A;  2O5A A;  2DR9 A;  3N4M B;  1NK9 A;  7ICP A;  3JYY A;  4F4K A;  1S0O A;  3TFR A;  4RPY A;  4I2G A;  4RUC A;  2ZJA A;  3AU2 A;  4Q45 A;  1ZQG A;  4EYI B;  2W9B B;  2FPM A;  1UT5 A;  4YXJ A;  2AU0 A;  4QZG A;  4M47 A;  2DFL A;  1CUK A;  2AGO A;  4KIT B;  3RH6 A;  2A1J B;  5J2F A;  3ZDA A;  3AQN A;  1ZQN A;  1WCN A;  2BHN A;  2FMS A;  2ZH1 A;  3UQ2 A;  4RT2 A;  2NRV A;  4KLH A;  2IBK A;  5HHI A;  4WC5 A;  2NRW A;  8ICS A;  1S9F A;  4F5O A;  4FH5 A;  2MUT A;  4J9N A;  1HUZ A;  4I2A A;  4NM1 A;  4YMN A;  2ZH7 A;  1KFD A;  1JN3 A;  2F1I A;  5DB9 A;  3RTV A;  3FYH A;  3ZD8 A;  2F1H A;  3Q8P B;  4K4G A;  2DR5 A;  2H5X A;  4DFJ A;  5KFE A;  2KTQ A;  3JPP A;  2M2V A;  1A76 A;  4RWO A;  4B9L A;  5L1I A;  5F9L A;  1SL1 A;  5J2B A;  4I2E A;  4DS5 A;  5DQI A;  1UA0 A;  2KFN A;  1Q79 A;  4O0I A;  5J2I A;  3Q8Q B;  3TFS A;  3MFI A;  4ECZ A;  3GFK B;  1Z00 A;  2C22 A;  2KZZ A;  2ATL A;  4QWA A;  5F9N A;  2PFO A;  2JEI A;  4O9M A;  4M9H A;  1S77 D;  3LWL A;  1JXE A;  1BPZ A;  4KLF A;  4GXK A;  3TAN A;  5IIK A;  3C2L A;  4BXO B;  3MFH A;  5HR9 A;  4Z6D A;  2BPF A;  1NJX A;  5KFD A;  4F5Q A;  4NY8 A;  7ICN A;  1SKS A;  1DK2 A;  5HRD A;  4KLQ A;  2DVI A;  4DQI A;  5J2J A;  4QZB A;  1UET A;  1BPD A;  9ICT A;  4F4W A;  1JAJ A;  3WFO A;  4RT3 A;  1DK3 A;  4TUQ A;  4JWN A;  1NOM A;  3H40 A;  5J29 A;  2M2U A;  2NRK A;  5HRB A;  3C1Y A;  4AT7 B;  4DQQ A;  3UXP A;  2XY5 A;  3EPI A;  2IA6 A;  9ICP A;  5HMM A;  3E2E A;  8ICR A;  4BXO A;  2XGQ A;  4DFP A;  4ECV A;  4EBE A;  4RQ5 A;  5KG3 A;  2Y1I A;  1RYR A;  1BNO A;  3V6K A;  4DOB A;  2BCQ A;  3EYZ A;  7ICU A;  3UPQ A;  3RR7 A;  5HRF A;  1ZQU A;  4C8O A;  3Q8S B;  8ICP A;  2MAX A;  5KFU A;  4WC0 A;  4O3O A;  1L3T A;  3Q8R B;  3N97 B;  1TAU A;  2ASJ A;  4B9U A;  4TQR A;  4C8M A;  9ICI A;  4BWM A;  3PMN A;  1IXR A;  5KT3 A;  4DL7 A;  5KFV A;  3TI0 A;  3RH5 A;  1RXW A;  2I9G A;  4UD4 A;  4WC1 A;  2DRA A;  9ICJ A;  1UEU A;  4M9G A;  1L3S A;  3B0X A;  4UAW A;  5KFA A;  1XSP A;  2BDP A;  4FHY A;  4UAY A;  3V6H A;  2ZH3 A;  8ICQ A;  5KFF A;  2J6T A;  4KLJ A;  4Q43 A;  8ICK A;  4UBB A;  2JZB A;  1BPE A;  4YMM A;  3KHR A;  4PHE A;  4X5V A;  1D9F A;  4BDP A;  4M5D A;  5KFM A;  5KFJ A;  1MIV A;  4EEY A;  4O3Q A;  4ECW A;  3PR5 B;  4Q44 A;  4QZF A; 
#chains in the Genus database with same CATH topology
 5TIS U;  3M9M B;  1DK2 A;  2Z7J A;  3HT3 A;  3KHH A;  4DS4 A;  4EBK A;  3V6J A;  7ICO A;  1A6S A;  3OVA A;  5B66 U;  1RQN A;  2IHM A;  3RRG A;  2BPC A;  4R8U B;  4B9S A;  2RDI A;  4MFA A;  2ZJ8 A;  1NO5 A;  2P66 A;  3VCB A;  4K8V A;  2GLE A;  4GLX A;  5DG7 A;  3IM1 A;  5ALK A;  8ICX A;  3ALR A;  1X9W A;  1A0P A;  2QB0 A;  1MC8 A;  4J9K A;  3WFP A;  4I29 A;  3PO4 A;  4S3N A;  2W8L A;  5J2E A;  5AI4 A;  9ICA A;  1Z3E B;  3K4G A;  3KZI U;  5KFX A;  2VA3 A;  2JH7 A;  3K75 D;  2W11 A;  1SV4 A;  4OAI Z;  5T14 A;  5AKK A;  2KIW A;  4I2C A;  1QSY A;  3I76 A;  1KLN A;  5CJ7 A;  1RQL A;  5L1M A;  3MDC A;  5J2K A;  3GQC A;  4YN4 A;  4C7Y A;  2HI0 A;  5HC9 A;  2G09 A;  5EE0 A;  4J03 A;  1UA1 A;  4LEY A;  2KKP A;  1U48 A;  1ZQW A;  2EH9 A;  3GIL A;  4J9P A;  4DSJ A;  3EW9 A;  2HHS A;  1OU5 A;  2ISP A;  1MA7 A;  5KT5 A;  1SWW A;  9ICO A;  5CA7 A;  1R8B A;  5KG2 A;  4YD2 A;  4KLL A;  3RJI A;  4DL4 A;  1RZT A;  5KFZ A;  3SI8 A;  3PO5 A;  3MR5 A;  1XU4 A;  1FA0 A;  1NK0 A;  3J81 j;  2Y1J A;  2ZG6 A;  3MR2 A;  4I27 A;  4R66 A;  4ZOH C;  3FAH A;  2LYB A;  4RQ8 A;  2DKX A;  3SR6 A;  3H0L B;  1DGJ A;  2XCA A;  1S10 A;  3GV5 B;  4FE3 A;  1JIH A;  2DGZ A;  5HML A;  3BS5 B;  2HN1 A;  4OO1 J;  5KFL A;  4YR0 A;  1YT3 A;  2QAR A;  2JRZ A;  3N7S C;  3PW7 A;  2VKQ A;  3SEN A;  3Q8L A;  3D2S A;  3ETL A;  3JZ0 A;  2AH5 A;  5GTI U;  1PX5 A;  5BPC A;  3GZF A;  4JLX A;  1Q8K A;  2BPG A;  1X42 A;  1V97 A;  4I2D A;  4F93 B;  2JEF A;  4YR3 A;  5L9X A;  2UVR A;  1ZQI A;  5ALS A;  3LQC B;  3OUY B;  3HIY A;  3OSP A;  5AM2 A;  4FZN A;  1HUO A;  4JV2 A;  2M9N A;  5AKG A;  3NVV A;  5KL8 B;  3M6Z A;  1JUD A;  3OVS A;  1BVS A;  3SEI A;  4G9B A;  4EV6 A;  5CP2 A;  3PSP A;  4OJL A;  4CRX A;  2GH1 A;  2IMW P;  2WB1 F;  1NJW A;  5KFG A;  1F0M A;  4WC3 A;  5ALY A;  3AU6 A;  2F8K A;  5EWE A;  2KEY A;  4ECU A;  4M2Y A;  4IQW A;  1D8B A;  2FLL A;  1TFW A;  4RNM A;  2H3Q A;  2RDJ A;  1LKY A;  9ICQ A;  4C4S A;  1QSL A;  3JPT A;  4KMU A;  3GIM A;  2ZH5 A;  4BGD A;  2DUY A;  1FFU A;  4WOY A;  3TKA A;  2BBJ A;  3H37 A;  1IV8 A;  3GIJ A;  3MDA A;  4ECY A;  4PZO A;  4OAH A;  4RQ6 A;  4KTQ A;  1ZQM A;  4RWN A;  2PMZ F;  3M6K A;  3KZX A;  4RU9 A;  2ISO A;  5J2C A;  1JAL A;  4DFM A;  3SAG A;  1QSS A;  4O5C A;  3SMV A;  1DOQ A;  7ICR A;  3F2D A;  1IM4 A;  3BZK A;  1X2I A;  3M8R A;  4DFD A;  2A1J A;  4IQU A;  3M9N B;  4KN4 A;  1NK6 A;  9ICX A;  2WTF A;  3GV7 B;  5JTG A;  5DBA A;  1X9X A;  2DBY A;  3KHG A;  4FS2 A;  4LJX A;  9ICH A;  2YY6 A;  1L3V A;  5ALW A;  1ZQB A;  2CXY A;  1OXJ A;  1HJP A;  3ICX A;  3PY8 A;  3HWT A;  4NM2 A;  4J9M A;  1SZP A;  4PGY A;  3ZD9 A;  5J0X A;  3H4D A;  5ALV A;  4DLG A;  2XC9 A;  4DSF A;  4UAU A;  2AQ4 A;  4J9Q A;  4QZC A;  2KJ5 A;  2LBO A;  2KFZ A;  5CR0 A;  5F3X B;  4WCW A;  2KN7 A;  2V4Q A;  2KG5 A;  4B9T A;  3C66 A;  3K7D A;  9ICM A;  3ISC A;  4IG8 A;  2ZIX B;  5CHG A;  1MIW A;  1L7N A;  4KLU A;  2H3Z A;  4AT7 A;  4TUR A;  1QQ7 A;  1KBU A;  2GOL A;  3JPR A;  3AL0 B;  1C20 A;  3IG5 A;  1R8A A;  2P6R A;  4PGQ A;  2BQR A;  3QU9 A;  4DSL A;  4E7X A;  2W9A A;  4C8K A;  2EAP A;  2UVW A;  4E80 A;  3UQ0 A;  1DGS A;  2FJ6 A;  4RWP A;  1KQQ A;  4NKU A;  4RQ1 A;  4DSI A;  9ICL A;  2ZJ5 A;  7ICJ A;  4DOA A;  5AK4 A;  2G0A A;  3IN5 A;  5ALZ A;  4PGX A;  3OJU A;  3WK8 A;  4YFK A;  1QTM A;  1WCL A;  8ICN A;  3F5E A;  4WC6 A;  3QUB A;  3RJF A;  1NNL A;  4IS7 A;  2IOF K;  3PZP A;  1ZQD A;  2ID1 A;  4X4R A;  1COO A;  3QU4 A;  2VA2 A;  3WFQ E;  1MQ3 A;  2KSO B;  2PFN A;  4IR1 A;  5FP0 A;  2LM4 A;  2HDO A;  4R8U A;  1NJY A;  5JRT A;  3AMZ A;  1CI4 A;  1SKR A;  5KFS A;  2FLN A;  4OJP A;  4WBZ A;  3JYY A;  4F4K A;  1S0O A;  3TFR A;  4RPY A;  1QQ5 A;  1ZQG A;  3TAD A;  2W9B B;  2NYV A;  2AU0 A;  1Z4O A;  4M47 A;  4KIT B;  1FEZ A;  3RH6 A;  1ZQN A;  1WCN A;  4P0P A;  2EDU A;  1S8O A;  2NRV A;  2KHQ A;  2IBK A;  4WC5 A;  4K98 A;  4FH5 A;  1HUZ A;  2ZH7 A;  1JN3 A;  3FYH A;  4Y2Y A;  2F1H A;  3Q8P B;  2H5X A;  5KFE A;  1A76 A;  2YB1 A;  4OAG A;  4B9L A;  2ESE A;  2YTU A;  4DS5 A;  5DQI A;  3T79 A;  2KFN A;  4O0I A;  5J2I A;  2W04 A;  3MFI A;  2QLT A;  3GFK B;  3NS1 A;  2KZZ A;  1PVR A;  5F9N A;  2PFO A;  3LWL A;  1JXE A;  1RM6 C;  4WQK A;  2OXO A;  2JHD A;  5HR9 A;  4NY8 A;  5HRD A;  2LHT A;  2WB1 C;  5J2J A;  1UET A;  2VJ5 A;  3WFO A;  1DK3 A;  2PKE A;  3C1Y A;  4DQQ A;  9ICP A;  4BXO A;  5AIC A;  2OH2 A;  3DV9 A;  2Y1I A;  7ICU A;  3UPQ A;  3RR7 A;  1ZQU A;  4ACO A;  8ICP A;  4B9U A;  9ICI A;  4BWM A;  3PMN A;  4DL7 A;  4UD4 A;  2ZIU A;  3K1Z A;  4M9G A;  1L3S A;  3B0X A;  2ZH3 A;  2J6T A;  1D9F A;  5KFJ A;  2FI1 A;  2FDR A;  4O3Q A;  4QZF A;  3LVV A;  4O3S A;  1BNP A;  1VFG A;  2PMZ C;  1O08 A;  4KLS A;  4C8N A;  3CNH A;  3MC1 A;  2ZUB A;  4P4O A;  1QLN A;  5KNI A;  4FO1 A;  1Z19 A;  3ZDB A;  1RDF A;  3LWM A;  2GAF D;  3ORY A;  4M0A A;  7ICQ A;  8ICA A;  4F8R A;  4I2F A;  4OJ6 A;  4C8L A;  2CN1 A;  1Q78 A;  8ICG A;  2FMP A;  3BQT A;  5KAF U;  1ZQH A;  5J8Y C;  5J0Y A;  1UT8 A;  4Q8E A;  5J2G A;  4QZ9 A;  4Y2J A;  4IRC A;  1KL9 A;  3ER8 C;  1H38 A;  1U45 A;  4QWE A;  3MGV A;  4F4X A;  2HVH A;  2ZIV B;  3NKU A;  5KFW A;  5EWF A;  2C2E A;  3BQ2 A;  3Q8M A;  4UAZ A;  7ICL A;  3RJE A;  3NVY A;  1RPL A;  2JGA A;  3MGI A;  1TAQ A;  4F5N A;  2AGQ A;  3PV8 A;  1CEZ A;  3BQ1 A;  4ECX A;  4X4P A;  4EX6 A;  4DQP A;  4UD5 A;  3ZDD A;  4XQ7 A;  1V9P A;  4F5P A;  1KW4 A;  2Y0S F;  4DSK A;  4GFJ A;  4QZI A;  9ICF A;  3HJ4 A;  1Q46 A;  2BGW A;  2IOF A;  3ETR A;  1N2X A;  1PK3 A;  4FZL A;  3RJJ A;  2K8A A;  2PI5 A;  3WKD A;  1ZQ1 C;  4US8 A;  5ALH A;  3QNM A;  4BX9 C;  4RQ2 A;  8ICC A;  3PW4 A;  5CFT A;  1MIY A;  4RQ4 A;  5DB6 A;  2W7P A;  1TK0 A;  2FLP A;  4KLT A;  2HHW A;  1ZD2 P;  4WC2 A;  2C2R A;  3PX4 A;  2W3S A;  1T8E A;  2FMQ A;  2KHV A;  3ZDC A;  5ALD A;  2LYH A;  4BUG A;  4LVS A;  9ICG A;  3SAH A;  2YQE A;  5L1K A;  3TAQ A;  2W9C B;  4USA A;  1ZJM A;  3CW2 C;  2G5H B;  1VJ7 A;  4EBD A;  1N63 A;  4M9L A;  1L5U A;  3C21 A;  3IG8 A;  5KT2 A;  2HMX A;  5KFN A;  1B0X A;  4Y2Q A;  4ATB B;  4O5E A;  5DQG A;  4FS1 A;  5K4L A;  5KG0 A;  2FPL A;  1ZOL A;  2BBH A;  8ICY A;  3HX0 A;  1SB3 C;  5D62 A;  2PFQ A;  2XI9 A;  3KHL A;  1X9M A;  2KOB A;  4WC7 A;  1NKC A;  4NXT A;  3L9D A;  1SWV A;  3MR3 A;  2DF4 B;  4ED2 A;  5B3Q A;  5AI0 A;  3RJG A;  1ZQA A;  4C7Z A;  2KIV A;  1YLQ A;  4MF2 A;  1ZYQ A;  4QWB A;  4M9J A;  1TKD A;  1MSW D;  2VJ4 A;  2OWO A;  2WF8 A;  2R8G A;  2ASL A;  3GV8 B;  4NWI A;  4P4P A;  5KFC A;  3LVW A;  3N7P D;  4F2R A;  4F2S A;  3HP6 A;  2NO4 A;  5EWG A;  3V72 A;  5DKW A;  3L5K A;  5AI9 A;  1N56 A;  1N62 A;  4ZH4 A;  4P2H A;  4KLM A;  2D3D A;  2V9W A;  4EGW A;  3ISD A;  1ZET A;  1LB2 B;  4HAI A;  2GO7 A;  1YZ6 A;  3OVB A;  5KAI U;  2KD1 A;  4ED0 A;  4KLG A;  1ZQJ A;  1ECW A;  4QZ8 A;  1B22 A;  5DDY A;  4IL6 U;  4YR2 A;  2DR7 A;  4EEB A;  4M6W B;  1U4B A;  2ZTE A;  2FPK A;  4FHX A;  3OTQ A;  3C23 A;  3QZ7 A;  3C5G A;  2MSN A;  4M9N A;  2Q0Z X;  2R8I A;  2ZH4 A;  5IIN A;  1COK A;  4J9L A;  3T3F A;  1NKE A;  2F2A B;  2HBJ A;  3OWG A;  1SV0 A;  4EBC A;  2LM1 A;  2W9B A;  4DSE A;  4QZH A;  3MR6 A;  4EEK A;  4O3R A;  4U6P A;  3H8S A;  1NJZ A;  4NXW A;  1Q3U A;  4XA5 A;  2R8K A;  2KK0 A;  4EZ9 A;  1ZQZ A;  3L4P A;  4K9B A;  5KFY A;  4F91 B;  5DLG A;  1P7D A;  2W43 A;  4QWC A;  4EBJ A;  3HJ1 A;  3ONN A;  3HKZ C;  3S6J A;  4CF3 A;  3AQE A;  4LZD A;  5J0T A;  4XUS A;  3MAB A;  5DG8 A;  4DFK A;  4DF4 A;  2HN2 A;  1ZQL A;  1KEJ A;  2KJ8 A;  3RAQ A;  1SXE A;  5DG9 A;  3QUQ A;  4E8F A;  2E1E A;  2WFA A;  4DEZ A;  5B5E U;  3UXN A;  3R9K A;  5F2V O;  4J9O A;  4C80 A;  2G08 A;  2KZ3 A;  4O3N A;  4JV0 A;  2NRX A;  4DF8 A;  2ASD A;  3RH4 A;  4LZG A;  7ICI A;  4KN7 A;  4RWQ A;  4WH5 A;  1S97 A;  3C28 A;  5HRE A;  4HX0 A;  4NXZ A;  2Y0S C;  1N48 A;  2HSZ A;  2F1J A;  1NZB A;  5IIL A;  4LEZ A;  2PI4 A;  4QZA A;  3THV A;  4Q8F A;  9ICW A;  3AQL A;  3PST A;  4ED8 A;  5IIJ A;  3AN1 A;  1ZQS A;  2EAN A;  4OAF A;  3PW2 A;  4NLN A;  2LYA A;  4YG2 A;  2ZXI A;  5AM0 A;  5HRG A;  4ECT A;  2F76 X;  4RQN A;  4Z6F A;  3T5L A;  5E79 U;  4RZR A;  1J2N A;  3G6V A;  1XO0 A;  4PHD A;  4B9M A;  3ERC C;  2RQ5 A;  2C28 A;  4AT9 B;  4YD1 A;  1ED1 A;  4PL1 A;  1X40 A;  2WAQ F;  1U9L A;  4KLE A;  2XGP A;  3LYS A;  2IHN A;  2O5A A;  7ICP A;  2ODG A;  1RYU A;  2ZJA A;  3AU2 A;  4FFD A;  4Q45 A;  1O03 A;  4NLC A;  2FPM A;  4C4T A;  2ZIV A;  3ZDA A;  5J2F A;  3K1R B;  3NRZ A;  3CK6 A;  3QU2 A;  1GO3 F;  5AKZ A;  2NRW A;  4QIW F;  1S9F A;  2A1A A;  4I2A A;  4YMN A;  4LEV A;  3BS7 A;  2A3V A;  2DR5 A;  3JPP A;  4RWO A;  1VDV A;  5L1I A;  5G5G A;  1UA0 A;  3D2N A;  3Q8Q B;  4ECZ A;  3F5A A;  3M1Y A;  2JEI A;  1S77 D;  2JV3 A;  4KLF A;  1OUQ A;  3UM9 A;  4Z6D A;  2BPF A;  4C0Z A;  5CFU A;  3M7D A;  4QZB A;  1ZD5 A;  1BPD A;  3RF9 A;  4RT3 A;  4JWN A;  1NOM A;  1K5O A;  2DWQ A;  5J29 A;  3PHZ A;  2IA6 A;  5HMM A;  3E2E A;  4OJO A;  2RRD A;  2W3R A;  3V6K A;  4DOB A;  4MKP A;  1L6N A;  2MAX A;  4WC0 A;  4O3O A;  1N5W A;  2HCF A;  1Q3V A;  1L3T A;  1TAU A;  1RXW A;  1IXR A;  5KT3 A;  3NVW A;  2I9G A;  1PUZ A;  5KFA A;  1XSP A;  4UAY A;  8ICQ A;  8ICK A;  4KLJ A;  4Q43 A;  4UBB A;  2YMQ A;  4PHE A;  3KHR A;  1B4F A;  2F3N A;  4MFC A;  5ALE A;  4ECW A;  4Q44 A;  2LKY A;  2E3T A;  4J9R A;  2ZIW B;  4RNO A;  3JPN A;  3RRH A;  2KP7 A;  8ICZ A;  9ICC A;  5J0U A;  5J0S A;  1WUD A;  4DOC A;  3DDH A;  5AM3 A;  2ES6 A;  4B6J A;  2HHU A;  3E58 A;  7ICS A;  1BGX T;  5AI6 A;  1WOT A;  4ATB A;  4NLK A;  2NRT A;  1SIJ A;  2AQ0 A;  4ECR A;  4KLO A;  2QB0 B;  1ZQE A;  4I0U A;  2AGP A;  3CRX A;  3H8W A;  1UEV A;  3NYB A;  2XY6 A;  5KFI A;  2LI6 A;  5J2A A;  1XC9 A;  2AJQ A;  2HHV A;  4UAV A;  4Y2U A;  3F53 A;  1R8C A;  1Z1B A;  4I2I A;  5J8Y A;  4F4Z A;  2BQ3 A;  1WYG A;  5ALI A;  2K4H A;  5KT6 A;  2PXI A;  3RB3 A;  3GIK A;  2L5Y A;  3PML A;  3TQ1 A;  8ICF A;  4O3P A;  3OV7 A;  5EE1 A;  3TAR A;  1KFT A;  4CDG A;  4UB2 A;  1S0N A;  5AKI A;  1BPB A;  3PX6 A;  2H3V A;  2MU2 A;  3MGH A;  2OM6 A;  2KMD A;  1ZQY A;  1JI7 A;  4K99 A;  4US9 A;  4XQ8 A;  4PL2 A;  3OPX A;  4FZM A;  2J6U A;  2HW3 A;  2ZTD A;  4M04 A;  7ICK A;  4R65 A;  5KT7 A;  3OHA A;  3WK6 A;  1ZXI A;  1FIQ A;  1S0V A;  4ELV A;  3H39 A;  5EE9 A;  9ICK A;  2EAM A;  5ALM A;  3ZDE A;  4UW9 A;  2WF9 A;  5L1L A;  4P0Q B;  2HBK A;  2OCE A;  5D49 A;  2W8K A;  4X0B A;  2DQN B;  5ALX A;  3QU7 A;  8ICO A;  2R8J A;  2KIC A;  1KTQ A;  3KTQ A;  5CEH A;  5KG7 A;  4K96 A;  2DRB A;  5KFP A;  5KFB A;  2E8O A;  1D8Y A;  4O5K A;  1D8L A;  3C2M A;  4YQW A;  1L7O A;  4UAS A;  4WBY A;  4IRK A;  9ICS A;  7ICM A;  3SAF A;  5BOL A;  2W54 A;  3H7I A;  2QAR B;  2ZHA A;  3A0B U;  5HNK A;  4ED3 A;  1RG6 A;  1T3Q A;  4F50 A;  1WG8 A;  1MQ2 A;  2EQY A;  3PX0 A;  2NV3 A;  3AQM A;  3AQF A;  3FC4 A;  4YCX A;  3A0H U;  5J0P A;  1ZQO A;  2JZB B;  4EEN A;  4CGZ A;  4Y2T A;  1XSN A;  2DL0 A;  4GC6 A;  3GDX A;  3H3A A;  4QNL A;  1TFY A;  5KG6 A;  3BS5 A;  5AKJ A;  5HRL A;  1L8L A;  5ALU A;  2WAQ C;  1XO1 A;  2G07 A;  1JRP A;  5A0L A;  3BQ0 A;  1S76 D;  3C2K A;  2Q66 A;  3IV6 A;  4JK1 A;  3JPQ A;  5HRH A;  1F5S A;  3ER9 B;  4I28 A;  5EOZ A;  4X4U A;  1DXS A;  4NXX A;  2LMR A;  3PNC A;  3OUY A;  3HKZ F;  3OSN A;  4QIW C;  3C29 A;  2BE3 A;  1LKY B;  3EZ5 A;  1C7Y A;  5C0Y A;  3QXG A;  2F44 A;  3IP4 B;  4QWD A;  9ICR A;  3AQK A;  4ECQ A;  5AKE A;  3BJY A;  8ICW A;  9ICE A;  4FBT A;  9ICV A;  3ISB A;  3GII A;  3EPG A;  1ZRN A;  4EEL A;  4MEX A;  3RJK A;  3LK9 A;  3D6J A;  7ICG A;  4K97 A;  2FCL A;  1K1S A;  4K4I A;  3O0F A;  5J0O A;  3JCF A;  4EED A;  5ALG A;  4IC9 A;  4RQ7 A;  2YMP A;  1SL2 A;  1URJ A;  4RQ0 A;  1PVP A;  4G3I A;  8ICH A;  3QUT A;  1KNY A;  2AXT U;  4O6A A;  1DRG A;  4AT9 A;  2M2T A;  3HRD D;  4KLD A;  4DQR A;  4DL6 A;  3QE9 Y;  4RUA A;  3AM9 A;  4R64 A;  3E0F A;  2IHO A;  2N1R A;  8ICV A;  5DQH A;  1JMS A;  2YMM A;  5DED A;  4AT8 B;  5CFS A;  4HYK A;  4LEW A;  3H8M A;  1TVA A;  4PHP A;  5D63 A;  5DB7 A;  1J2M A;  4RPX A;  3RB0 A;  3KBB A;  4YXM A;  1GPJ A;  3NGD A;  2A19 A;  1NK5 A;  4X4S A;  5AKY A;  2C2D A;  4DL5 A;  2HOI A;  1J97 A;  3NTU A;  4RQ3 A;  5J2D A;  2JXJ A;  4X4O A;  3G6Y A;  2KVC A;  5AKL A;  4JUZ A;  5DGA A;  5EE3 A;  3RAX A;  2JEJ A;  1WWU A;  1RXV A;  5KFO A;  3ZI4 A;  4IR9 A;  3LDA A;  4ED7 A;  2KZM A;  1X6I A;  4UB3 A;  4F5R A;  4TUP A;  1ZQK A;  3BDP A;  2B56 A;  4FHP A;  1L3U A;  5GTH U;  5III A;  1BPY A;  3PR4 A;  1JXL A;  2B51 A;  1N61 A;  2W55 A;  4KMO B;  4QW9 A;  1X9S A;  3MCR A;  4TQS A;  4DQS A;  3OHB A;  2XO7 A;  3PSF A;  4UB1 A;  4NXU A;  2Y9U A;  2WF7 A;  4RPZ A;  4O67 A;  2R18 A;  3WFS C;  4QZD A;  5DGB A;  2XCP A;  4K9A A;  5AM4 A;  3NVO A;  1D9D A;  3D2Q A;  3SD7 A;  4XJE A;  4XRH A;  3KFU F;  2ZIX A;  2BQU A;  3L3F X;  2W9M A;  3IRU A;  3WKB A;  3CYM A;  3F2C A;  4PPX A;  4KB6 A;  5ALT A;  5AI5 A;  1Z1V A;  3H8J A;  4DO9 A;  3WK7 A;  4X4T A;  3CP8 A;  1PZN A;  5DLF A;  3PVX A;  3T5J A;  2ZIW A;  4YP3 A;  2VIX A;  3AUO A;  2HOQ A;  4F71 A;  1QCK A;  4Z6C A;  8ICE A;  3UMB A;  1L7M A;  4PJ0 U;  2PBE A;  4AP9 A;  3H0M B;  1BPX A;  5IIO A;  8ICM A;  4YVZ A;  2E1F A;  7ICV A;  5HHH A;  3WK9 A;  4P0P B;  5AIB A;  4RUC A;  4EYI B;  1JRO A;  2KSO A;  1S5L U;  4YXJ A;  2MA1 A;  4AYB F;  2DFL A;  1CUK A;  2AGO A;  3KKA C;  5AM5 A;  3AQN A;  2FMS A;  2KE7 A;  3UQ2 A;  5D61 A;  8ICS A;  4F5O A;  4NM1 A;  1PK1 B;  1KFD A;  2F1I A;  1L8O A;  4K4G A;  2KTQ A;  4ICA A;  3U26 A;  4NXV A;  5F9L A;  1SL1 A;  4I2E A;  1Q79 A;  2XVT A;  2C22 A;  4QWA A;  4P0Q A;  5ALQ A;  3F2B A;  1BPZ A;  3QX7 A;  4GXK A;  5IIK A;  4BXO B;  1TAM A;  1UQV A;  3MFH A;  4O3M A;  2F77 X;  1NJX A;  4NL9 C;  5KFD A;  4F5Q A;  1SKS A;  4CE6 A;  2FE9 A;  2K60 A;  1JAJ A;  2E5S A;  5HRB A;  4MHV A;  2K8C B;  4KM5 A;  3UXP A;  2XY5 A;  3EPI A;  2ZIU B;  2XGQ A;  4DFP A;  4ECV A;  1BNO A;  4RQ5 A;  2BCQ A;  2K4P A;  3EYZ A;  4C8O A;  4NJ8 A;  2BDU A;  3Q8R B;  3N97 B;  2ASJ A;  4C8M A;  3TI0 A;  3RH5 A;  2DRA A;  3UMG A;  9ICJ A;  4UB6 U;  1UEU A;  1QH9 A;  4FHY A;  2BDP A;  5KFF A;  2JZB A;  4M5D A;  3H0R B;  5JTI A;  3IDW A;  2EZZ A;  3PR5 B;  1XS9 D;  4KX3 A;  4IQV A;  3SZ2 A;  4NLZ A;  5ALP A;  4CF5 A;  1EXN A;  3EF2 A;  5JU5 A;  2DPI A;  4NV0 A;  2JR5 A;  4DCC A;  2BCV A;  3TAP A;  2JEG A;  4FHW A;  4OCZ A;  3RBD A;  3EWA A;  5KG4 A;  4RNN A;  3V7K A;  3BQ7 A;  2HVI A;  1B43 A;  4FBU A;  4EZ6 A;  3N7R C;  4FHV A;  1ZQX A;  3OJS A;  4FO6 A;  4NLG A;  4DLE A;  1WWV A;  2D6F C;  2K8B B;  4O68 A;  2KJ9 A;  4UBC A;  1ZQP A;  5L1J A;  4ECS A;  4PHA A;  1LVH A;  3NUQ A;  2ZTC A;  2MUT B;  1T3N A;  1MN8 A;  1TE2 A;  1ZQT A;  2K4I A;  1KDH A;  1ZQC A;  1IIP A;  4JB3 A;  3PW5 A;  3PSI A;  4UQG A;  1V38 A;  5CB1 A;  4E0D A;  3WFR E;  5KFT A;  3SYZ A;  3H38 A;  5AHX A;  5C5J A;  2E8N A;  5DDM A;  5KFH A;  1Z00 B;  1VJ5 A;  3SV3 A;  1V4A A;  3I28 A;  5G5H A;  3WK4 A;  1SXD A;  3WKE A;  1QQ6 A;  1TK5 A;  1YZ7 A;  1SV0 C;  3RBE A;  1LV5 A;  1NK8 A;  1T7P A;  4EYH B;  8ICL A;  2O1P A;  5BOM A;  2ZH9 A;  3C5F A;  2YX8 A;  3OGU A;  4FH3 A;  4CF4 A;  4PZN A;  3QZ8 A;  2B21 A;  4NLB A;  5DBC A;  5J2H A;  1ZQQ A;  9ICU A;  2HBL A;  4MF8 A;  3UMC A;  3RB4 A;  5HP4 A;  2ZH6 A;  3GU3 A;  2ZH8 A;  4Z6E A;  4QZE A;  2BCS A;  4AT8 A;  5ALO A;  2YN4 A;  4KX5 A;  3DEE A;  3M9O B;  1V85 A;  3G6X A;  4UB8 U;  4GIB A;  2WF5 A;  3SQI A;  4F4Y A;  4X4N A;  2GA9 D;  2M0N A;  1SL0 A;  2GWS A;  5TZV A;  2KNJ A;  1U49 A;  4F92 B;  3BZC A;  2ZUC A;  1TV9 A;  2V4R A;  2I1Q A;  4ELT A;  2HHT A;  2NRZ A;  2CPR A;  1X6J A;  1TK8 A;  1XSL A;  3V7J A;  1ZD4 A;  4F3O A;  3HW8 A;  2W9C A;  9ICB A;  2ZHB A;  2HHQ A;  5AI8 A;  4MFF A;  1SGG A;  5IIM A;  3RR8 A;  4Y2V A;  5CRX A;  5ALL A;  2XID A;  4ED6 A;  2YML A;  4AYB C;  3NWI A;  4GXJ A;  5AM1 A;  3FM9 A;  4B9V A;  4CCH A;  5DEC A;  1KKX A;  2R8H A;  1ZRM A;  5KTQ A;  4J9S A;  2EZY A;  1NK7 A;  1TFR A;  3IHQ B;  2E8M A;  5AK6 A;  2ZXH A;  1HEK A;  3UXO A;  2J6S A;  4ELU A;  3JPS A;  1JQR A;  1S0M A;  3JPO A;  3HPO A;  2W7O A;  9ICN A;  1F44 A;  2H3I A;  4NKT A;  2VA8 A;  1ZJN A;  3QYP A;  2M2W A;  3NAS A;  5DBB A;  4UB5 A;  3T5H A;  3VC8 A;  5KFK A;  2KVS A;  1FFV A;  2VAN A;  4BWJ A;  5KFQ A;  4ED1 A;  3QEA Z;  2K89 A;  8ICB A;  2Y9T A;  4QW8 A;  2DKZ A;  1KRP A;  2BR0 A;  5AK3 A;  1KSP A;  3I1Y A;  2W03 A;  8ICU A;  5DB8 A;  1L7P A;  4Y2P A;  4GC7 A;  1A77 A;  1HIW A;  5HRK A;  2E8P A;  2I5H A;  5ALJ A;  1NI3 A;  2H3F A;  5CWR A;  4X0A A;  1JX4 A;  5KL1 B;  1RYS A;  2RFF A;  1K1Q A;  2XIC A;  1SKW A;  1FO4 A;  4M6W A;  1ZQF A;  5AK5 A;  2JH1 A;  2YB4 A;  4X4V A;  4O69 A;  3Q8K A;  4WQL A;  5J0Q A;  2HHX A;  4I2J A;  2IOH A;  2KV2 A;  5KT4 A;  2CRX A;  1R89 A;  3V7L A;  2B4V A;  4RQM A;  4LT6 A;  5JUM A;  1PK1 A;  1ZQV A;  2BCR A;  4DL3 A;  2ALZ A;  1OW5 A;  4Y2R A;  5ALN A;  3NRW A;  5KG1 A;  5KFR A;  2B0C A;  1T4G A;  3QEB Z;  1T94 A;  1VLB A;  2DR8 A;  3RJH A;  3MBY A;  3B0Y A;  1KFS A;  4R63 A;  1IG6 A;  1N60 A;  4UB4 A;  4JV1 A;  5D46 A;  2RLT A;  4I2B A;  7ICT A;  2JMG A;  2Q4T A;  3H4B A;  3PW0 A;  4WJ3 B;  1X66 A;  2BKE A;  3NVZ A;  5H2F U;  2NO5 A;  4EX7 A;  1PVQ A;  4UAR A;  4F72 A;  4IRD A;  1NK4 A;  4YMO A;  4P4M A;  1ZQR A;  2WF6 A;  4B9N A;  4PH5 A;  4WC4 A;  2QKQ A;  4X4Q A;  4KLI A;  3HIL A;  2HOF A;  4Y2X A;  4UAT A;  2UVV A;  3WKC A;  5J0R A;  7ICF A;  7ICH A;  2HHP A;  2G06 A;  3KOO A;  4Y2S A;  2IUB A;  3C1Z A;  3UPS A;  2B6G A;  2PFP A;  4JMU A;  4K4H A;  3KD3 A;  1F5A A;  2EZX A;  2BZF A;  1Z4N A;  5ALR A;  2OYY A;  2RP5 A;  8ICJ A;  4JWM A;  1XWL A;  3M8S A;  7ICE A;  3T5K A;  4DWI A;  2D8C A;  4TUS A;  4IQT A;  2KKV A;  5HRI A;  3WKA A;  5AKH A;  5AKX A;  5KG5 A;  2XY7 A;  2BCU A;  5D4B A;  4JLZ A;  8ICI A;  2MRL A;  3RB6 A;  5HR6 A;  5B3P A;  4EP7 A;  1KN5 A;  1NKB A;  2RHF A;  5CHE A;  2DPJ A;  2P6U A;  1NZP A;  1U47 A;  1ARO P;  2UVU A;  8ICT A;  4C4R A;  4MEY A;  4GXI A;  4OJ5 A;  4DL2 A;  5J0W A;  3TAD C;  1Y88 A;  2ZUD A;  3FDS A;  3EUB 2;  2ZH2 A;  4U7C A;  3C18 A;  2DR9 A;  3N4M B;  1NK9 A;  4I2G A;  2P35 A;  2K4E A;  1UT5 A;  4QZG A;  5HR7 A;  4QJF B;  2A1J B;  1CRX A;  2O6K A;  2ZH1 A;  2BHN A;  4BJQ A;  4RT2 A;  4KLH A;  5HHI A;  3HJE A;  2MUT A;  4J9N A;  3KKA A;  3N28 A;  5DB9 A;  3RTV A;  3ZD8 A;  1M6Y A;  2EWR A;  1AQ6 A;  4DFJ A;  1XNS A;  2M2V A;  4N7R A;  2I6X A;  5J2B A;  1ZD3 A;  2WHE A;  1SZH A;  3TFS A;  4A8E A;  3WK5 A;  1Z00 A;  2ATL A;  1UPH A;  4O9M A;  4M9H A;  3TAN A;  3C2L A;  7ICN A;  2DVI A;  4KLQ A;  4DQI A;  3TAC B;  3QU5 A;  2OHF A;  9ICT A;  4F4W A;  4TUQ A;  3H40 A;  2M2U A;  2NRK A;  4AT7 B;  3QUC A;  4NL9 A;  8ICR A;  1UCV A;  4EBE A;  2EAO A;  5KG3 A;  1RYR A;  1N5X A;  3B9J A;  1UHU A;  5HRF A;  3Q8S B;  2QB1 A;  5KFU A;  2HBM A;  3ED5 A;  3AEV A;  3RFA A;  4TQR A;  2OEH A;  4CNQ A;  2AHO B;  5KFV A;  4WC1 A;  4OD0 A;  2LPE A;  2F8L A;  4UAW A;  3V6H A;  2G5I B;  5AIA A;  4X5V A;  4BDP A;  1BPE A;  4YMM A;  5KFM A;  1MIV A;  4EEY A;  3WU2 U;  5ALF A;  3SV4 A;  4I2H A; 
#chains in the Genus database with same CATH homology
 1XS9 D;  4J9R A;  4NLZ A;  4IQV A;  3SZ2 A;  4RNO A;  3JPN A;  3M9M B;  1EXN A;  3RRH A;  4O3S A;  3HT3 A;  9ICC A;  8ICZ A;  2KP7 A;  1BNP A;  1VFG A;  3KHH A;  2DPI A;  5J0U A;  4KLS A;  4C8N A;  5J0S A;  2BCV A;  3TAP A;  4DS4 A;  2JEG A;  2ZUB A;  4P4O A;  4EBK A;  4DOC A;  1QLN A;  3V6J A;  4FHW A;  2HHU A;  7ICO A;  3OVA A;  7ICS A;  1BGX T;  1WOT A;  3RBD A;  4ATB A;  2IHM A;  4NLK A;  2NRT A;  3RRG A;  2BPC A;  3ZDB A;  3LWM A;  2AQ0 A;  3ORY A;  4M0A A;  3EWA A;  8ICA A;  5KG4 A;  7ICQ A;  4RNN A;  4F8R A;  4ECR A;  4I2F A;  4KLO A;  4C8L A;  4R8U B;  4B9S A;  3V7K A;  1Q78 A;  2RDI A;  2HVI A;  4MFA A;  2FMP A;  1B43 A;  2ZJ8 A;  3BQT A;  2AGP A;  1ZQE A;  1ZQH A;  4FBU A;  3H8W A;  4EZ6 A;  1NO5 A;  5J0Y A;  1UT8 A;  4Q8E A;  1UEV A;  5J2G A;  3NYB A;  4FHV A;  4QZ9 A;  1ZQX A;  2XY6 A;  3OJS A;  5KFI A;  4GLX A;  4FO6 A;  4DLE A;  2P66 A;  5J2A A;  3IM1 A;  5DG7 A;  1XC9 A;  4NLG A;  2HHV A;  2AJQ A;  4IRC A;  1H38 A;  1U45 A;  4QWE A;  1R8C A;  4F4X A;  2HVH A;  4I2I A;  1X9W A;  8ICX A;  5KFW A;  4F4Z A;  2BQ3 A;  5EWF A;  4J9K A;  1MC8 A;  2C2E A;  3BQ2 A;  3Q8M A;  4I29 A;  3PO4 A;  3WFP A;  5KT6 A;  4UAZ A;  4S3N A;  4UBC A;  2W8L A;  2PXI A;  1ZQP A;  5L1J A;  3RB3 A;  4ECS A;  5J2E A;  3GIK A;  4PHA A;  3RJE A;  3PML A;  1Z3E B;  3TQ1 A;  9ICA A;  3K4G A;  5KFX A;  8ICF A;  1RPL A;  4O3P A;  2VA3 A;  3MGI A;  3OV7 A;  3K75 D;  1TAQ A;  4F5N A;  3TAR A;  2ZTC A;  3PV8 A;  2MUT B;  2AGQ A;  3BQ1 A;  1CEZ A;  4ECX A;  4X4P A;  1KFT A;  1T3N A;  4UB2 A;  4DQP A;  1S0N A;  4I2C A;  1BPB A;  1ZQT A;  1QSY A;  3ZDD A;  4UD5 A;  4XQ7 A;  1V9P A;  1KDH A;  5CJ7 A;  1ZQC A;  1KLN A;  3PX6 A;  4F5P A;  3PW5 A;  4UQG A;  3MGH A;  4DSK A;  3MDC A;  5J2K A;  5CB1 A;  1ZQY A;  3GQC A;  4YN4 A;  4E0D A;  3WFR E;  4XQ8 A;  5KFT A;  5HC9 A;  4QZI A;  1UA1 A;  2J6U A;  3SYZ A;  1U48 A;  2HW3 A;  2ZTD A;  9ICF A;  5C5J A;  4M04 A;  7ICK A;  4R65 A;  1ZQW A;  5KT7 A;  3OHA A;  3GIL A;  4J9P A;  4DSJ A;  1S0V A;  3EW9 A;  5DDM A;  4ELV A;  5KFH A;  2HHS A;  9ICK A;  1OU5 A;  1Z00 B;  3ZDE A;  2ISP A;  3HJ4 A;  2BGW A;  5L1L A;  3SV3 A;  1V4A A;  5KT5 A;  7ICL A;  9ICO A;  1TK5 A;  5D49 A;  5CA7 A;  2W8K A;  5KG2 A;  4YD2 A;  3RJJ A;  2PI5 A;  1R8B A;  4X0B A;  3RBE A;  1LV5 A;  3RJI A;  1NK8 A;  4KLL A;  8ICO A;  1T7P A;  4EYH B;  2R8J A;  8ICL A;  4DL4 A;  1RZT A;  5KFZ A;  3SI8 A;  3PO5 A;  3MR5 A;  2O1P A;  1XU4 A;  1FA0 A;  4RQ2 A;  1NK0 A;  1KTQ A;  3PW4 A;  3KTQ A;  5BOM A;  5KG7 A;  2Y1J A;  3MR2 A;  8ICC A;  1MIY A;  4I27 A;  4R66 A;  2ZH9 A;  4RQ4 A;  2DRB A;  5KFP A;  5KFB A;  5DB6 A;  3C5F A;  3OGU A;  1D8Y A;  4RQ8 A;  1TK0 A;  4FH3 A;  2FLP A;  3QZ8 A;  4KLT A;  2HHW A;  2B21 A;  4O5K A;  1D8L A;  5DBC A;  5J2H A;  1ZQQ A;  3C2M A;  9ICU A;  4YQW A;  4MF8 A;  2XCA A;  4WBY A;  4WC2 A;  4IRK A;  9ICS A;  3RB4 A;  7ICM A;  1S10 A;  3GV5 B;  2C2R A;  5HP4 A;  2ZH6 A;  5BOL A;  3PX4 A;  2ZH8 A;  4Z6E A;  4QZE A;  2BCS A;  4AT8 A;  3H7I A;  2ZHA A;  1T8E A;  5HNK A;  2FMQ A;  4ED3 A;  3ZDC A;  2LYH A;  3M9O B;  1JIH A;  3G6X A;  4LVS A;  9ICG A;  4F50 A;  1MQ2 A;  4F4Y A;  3PX0 A;  3AQM A;  5HML A;  4YCX A;  5KFL A;  4YR0 A;  5L1K A;  4X4N A;  5J0P A;  1ZQO A;  1SL0 A;  2GWS A;  2JZB B;  5TZV A;  3TAQ A;  2W9C B;  4F92 B;  3PW7 A;  1U49 A;  1XSN A;  3Q8L A;  2ZUC A;  1TV9 A;  1ZJM A;  3ETL A;  4GC6 A;  3JZ0 A;  2V4R A;  1VJ7 A;  3GDX A;  2I1Q A;  4ELT A;  2HHT A;  4EBD A;  2NRZ A;  4M9L A;  1PX5 A;  3H3A A;  5BPC A;  1TK8 A;  1TFY A;  1XSL A;  5KG6 A;  1L5U A;  2BPG A;  5HRL A;  3C21 A;  3V7J A;  4I2D A;  5KT2 A;  1XO1 A;  5KFN A;  4F3O A;  3HW8 A;  4F93 B;  2W9C A;  3BQ0 A;  2JEF A;  3C2K A;  1S76 D;  4YR3 A;  5L9X A;  9ICB A;  2UVR A;  4ATB B;  2ZHB A;  4O5E A;  1ZQI A;  5DQG A;  2HHQ A;  4MFF A;  4FS1 A;  8ICG A;  3LQC B;  5KG0 A;  2FPL A;  3OSP A;  3HIY A;  4JK1 A;  3OUY B;  3JPQ A;  5IIM A;  3RR8 A;  8ICY A;  3HX0 A;  5HRH A;  1HUO A;  4JV2 A;  2PFQ A;  4ED6 A;  3KHL A;  1X9M A;  2M9N A;  4GXJ A;  4B9V A;  4CCH A;  4I28 A;  5DEC A;  4WC7 A;  2R8H A;  5EOZ A;  5KTQ A;  4J9S A;  1NKC A;  3L9D A;  4X4U A;  3H38 A;  3OVS A;  3MR3 A;  1NK7 A;  4ED2 A;  1BVS A;  1TFR A;  3IHQ B;  3PNC A;  3OUY A;  3RJG A;  1ZQA A;  3OSN A;  5CP2 A;  1YLQ A;  3SV4 A;  4MF2 A;  2BE3 A;  3UXO A;  1ZYQ A;  4QWB A;  4M9J A;  3EZ5 A;  1TKD A;  1MSW D;  2J6S A;  4ELU A;  3JPS A;  1C7Y A;  2OWO A;  1JQR A;  2IMW P;  4QWD A;  1S0M A;  1NJW A;  5KFG A;  3JPO A;  2R8G A;  9ICR A;  4WC3 A;  3AQK A;  2ASL A;  3AU6 A;  3HPO A;  3GV8 B;  4ECQ A;  4P4P A;  9ICN A;  5EWE A;  5KFC A;  3BJY A;  2VA8 A;  4ECU A;  1ZJN A;  4M2Y A;  4IQW A;  4NKT A;  2FLL A;  2M2W A;  1TFW A;  4F2R A;  5DBB A;  4F2S A;  4RNM A;  8ICW A;  4UB5 A;  9ICE A;  4FBT A;  9ICV A;  3ISB A;  2RDJ A;  3T5H A;  9ICQ A;  3HP6 A;  3GII A;  2KZM A;  5KFK A;  3EPG A;  4MEX A;  5EWG A;  3V72 A;  2VAN A;  3LK9 A;  4BWJ A;  3RJK A;  5KFQ A;  5DKW A;  7ICG A;  4ED1 A;  1QSL A;  4MFC A;  3JPT A;  1K1S A;  4KMU A;  3GIM A;  4QW8 A;  3QEA Z;  1N56 A;  8ICB A;  4ZH4 A;  4P2H A;  4K4I A;  1KRP A;  4KLM A;  2ZH5 A;  5J0O A;  2BR0 A;  4BGD A;  2V9W A;  1KSP A;  3ISD A;  1ZET A;  4RQ7 A;  1LB2 B;  1SL2 A;  8ICU A;  5DB8 A;  4RQ0 A;  4G3I A;  4GC7 A;  3OVB A;  4ED0 A;  8ICH A;  3H37 A;  1A77 A;  1ZQJ A;  4KLG A;  5HRK A;  1KNY A;  4QZ8 A;  3GIJ A;  3MDA A;  4ECY A;  5DDY A;  1B22 A;  3H39 A;  2DR7 A;  4YR2 A;  4AT9 A;  4RQ6 A;  4KTQ A;  4M6W B;  1U4B A;  2ZTE A;  1ZQM A;  2M2T A;  4RWN A;  5CWR A;  4DQR A;  4KLD A;  4X0A A;  4DL6 A;  3QE9 Y;  1JX4 A;  2FPK A;  4RUA A;  4RU9 A;  4R64 A;  2ISO A;  4FHX A;  5J2C A;  3C23 A;  1RYS A;  4I2H A;  3QZ7 A;  3C5G A;  2RFF A;  1K1Q A;  4M9N A;  8ICV A;  2Q0Z X;  2R8I A;  1SKW A;  5IIN A;  5DQH A;  4DFM A;  2ZH4 A;  1QSS A;  1JMS A;  4J9L A;  3T3F A;  4M6W A;  1DOQ A;  1NKE A;  1ZQF A;  4O5C A;  5DED A;  4AT8 B;  7ICR A;  4HYK A;  4EBC A;  2W9B A;  4X4V A;  1TVA A;  4PHP A;  3Q8K A;  4DSE A;  1IM4 A;  4QZH A;  3MR6 A;  4O3R A;  5DB7 A;  5J0Q A;  2HHX A;  4I2J A;  1X2I A;  3H8S A;  3M8R A;  2A1J A;  4IQU A;  3M9N B;  1NJZ A;  4XA5 A;  4KN4 A;  1NK6 A;  5KT4 A;  9ICX A;  1R89 A;  4RPX A;  3V7L A;  2WTF A;  2R8K A;  3RB0 A;  4YXM A;  3GV7 B;  4EZ9 A;  1ZQZ A;  3NGD A;  4LT6 A;  5DBA A;  5KFY A;  4F91 B;  1NK5 A;  4X4S A;  2C2D A;  5JUM A;  4DL5 A;  1ZQV A;  5DLG A;  2BCR A;  3KHG A;  3NTU A;  4DL3 A;  4RQ3 A;  5J2D A;  2ALZ A;  4FS2 A;  4X4O A;  3G6Y A;  9ICH A;  4QWC A;  4EBJ A;  1L3V A;  4JUZ A;  5DGA A;  3HJ1 A;  5KG1 A;  1ZQB A;  5KFR A;  3RAX A;  1HJP A;  1T4G A;  3QEB Z;  2JEJ A;  3PY8 A;  1RXV A;  2DR8 A;  3HWT A;  4NM2 A;  4J9M A;  1SZP A;  4PGY A;  3ZD9 A;  5KFO A;  3RJH A;  5J0X A;  4IR9 A;  4LZD A;  3LDA A;  5J0T A;  3MBY A;  3H4D A;  4XUS A;  4DLG A;  3B0Y A;  3MAB A;  5DG8 A;  4ED7 A;  4UB3 A;  4DFK A;  4DF4 A;  2XC9 A;  4R63 A;  4F5R A;  4DSF A;  1KFS A;  2AQ4 A;  1ZQL A;  4UB4 A;  1KEJ A;  4TUP A;  1ZQK A;  3BDP A;  5D46 A;  4JV1 A;  3RAQ A;  5DG9 A;  4FHP A;  4J9Q A;  4QZC A;  1L3U A;  2KFZ A;  4E8F A;  5CR0 A;  5III A;  4WCW A;  1BPY A;  4DEZ A;  2KN7 A;  3PR4 A;  2V4Q A;  1JXL A;  4B9T A;  4I2B A;  7ICT A;  3C66 A;  3UXN A;  3H4B A;  3PW0 A;  9ICM A;  2BKE A;  4QW9 A;  1X9S A;  5F2V O;  4J9O A;  4TQS A;  3ISC A;  4DQS A;  3OHB A;  4IG8 A;  2KZ3 A;  2XO7 A;  4O3N A;  4JV0 A;  4IRD A;  4UB1 A;  2NRX A;  4RPZ A;  5CHG A;  1NK4 A;  4YMO A;  1MIW A;  4DF8 A;  4KLU A;  4P4M A;  2ASD A;  4AT7 A;  3RH4 A;  1ZQR A;  3WFS C;  4QZD A;  4B9N A;  4PH5 A;  5DGB A;  4TUR A;  2XCP A;  4LZG A;  4WC4 A;  1D9D A;  4KN7 A;  7ICI A;  4X4Q A;  4RWQ A;  3JPR A;  1S97 A;  4KLI A;  5HRE A;  4NXZ A;  1N48 A;  1R8A A;  2F1J A;  2P6R A;  4XRH A;  4PGQ A;  5IIL A;  2BQR A;  2UVV A;  5J0R A;  7ICF A;  4DSL A;  2PI4 A;  7ICH A;  4E7X A;  4QZA A;  2HHP A;  2W9A A;  3THV A;  4C8K A;  2BQU A;  4Q8F A;  3C1Z A;  3UPS A;  2UVW A;  4E80 A;  9ICW A;  2PFP A;  3UQ0 A;  3AQL A;  2W9M A;  1DGS A;  4ED8 A;  4K4H A;  5IIJ A;  1F5A A;  1ZQS A;  4RWP A;  4PPX A;  3PW2 A;  4NKU A;  4RQ1 A;  4DSI A;  4NLN A;  9ICL A;  2ZJ5 A;  7ICJ A;  3H8J A;  8ICJ A;  4YG2 A;  4DOA A;  4DO9 A;  4JWM A;  4X4T A;  1XWL A;  5HRG A;  1PZN A;  5DLF A;  3M8S A;  7ICE A;  3T5K A;  4ECT A;  4DWI A;  3PVX A;  3T5J A;  4TUS A;  4IQT A;  4PGX A;  4YP3 A;  4Z6F A;  3T5L A;  5HRI A;  2XY7 A;  5KG5 A;  3OJU A;  2BCU A;  5D4B A;  3AUO A;  4YFK A;  1QTM A;  1WCL A;  4RZR A;  8ICI A;  8ICN A;  4WC6 A;  3G6V A;  4PHD A;  4B9M A;  3RB6 A;  3RJF A;  4EP7 A;  1NKB A;  2DPJ A;  2P6U A;  1NZP A;  4Z6C A;  1U47 A;  1ZQD A;  2C28 A;  8ICE A;  1COO A;  2ID1 A;  2VA2 A;  4AT9 B;  4X4R A;  1ARO P;  2UVU A;  4YD1 A;  8ICT A;  3WFQ E;  1MQ3 A;  2PBE A;  4MEY A;  2PFN A;  4IR1 A;  4GXI A;  1BPX A;  5IIO A;  4DL2 A;  4R8U A;  5J0W A;  1U9L A;  1NJY A;  8ICM A;  4YVZ A;  4KLE A;  7ICV A;  5HHH A;  2XGP A;  1Y88 A;  2ZUD A;  3FDS A;  5KFS A;  1SKR A;  2FLN A;  2Q66 A;  2ZH2 A;  4WBZ A;  3C18 A;  2IHN A;  2O5A A;  2DR9 A;  3N4M B;  1NK9 A;  7ICP A;  3JYY A;  4F4K A;  1S0O A;  3TFR A;  4RPY A;  4I2G A;  4RUC A;  2ZJA A;  3AU2 A;  4Q45 A;  1ZQG A;  4EYI B;  2W9B B;  2FPM A;  1UT5 A;  4YXJ A;  2AU0 A;  4QZG A;  4M47 A;  2DFL A;  1CUK A;  2AGO A;  4KIT B;  3RH6 A;  2A1J B;  5J2F A;  3ZDA A;  3AQN A;  1ZQN A;  1WCN A;  2BHN A;  2FMS A;  2ZH1 A;  3UQ2 A;  4RT2 A;  2NRV A;  4KLH A;  2IBK A;  5HHI A;  4WC5 A;  2NRW A;  8ICS A;  1S9F A;  4F5O A;  4FH5 A;  2MUT A;  4J9N A;  1HUZ A;  4I2A A;  4NM1 A;  4YMN A;  2ZH7 A;  1KFD A;  1JN3 A;  2F1I A;  5DB9 A;  3RTV A;  3FYH A;  3ZD8 A;  2F1H A;  3Q8P B;  4K4G A;  2DR5 A;  2H5X A;  4DFJ A;  5KFE A;  2KTQ A;  3JPP A;  2M2V A;  1A76 A;  4RWO A;  4B9L A;  5L1I A;  5F9L A;  1SL1 A;  5J2B A;  4I2E A;  4DS5 A;  5DQI A;  1UA0 A;  2KFN A;  1Q79 A;  4O0I A;  5J2I A;  3Q8Q B;  3TFS A;  3MFI A;  4ECZ A;  3GFK B;  1Z00 A;  2C22 A;  2KZZ A;  2ATL A;  4QWA A;  5F9N A;  2PFO A;  2JEI A;  4O9M A;  4M9H A;  1S77 D;  3LWL A;  1JXE A;  1BPZ A;  4KLF A;  4GXK A;  3TAN A;  5IIK A;  3C2L A;  4BXO B;  3MFH A;  5HR9 A;  4Z6D A;  2BPF A;  1NJX A;  5KFD A;  4F5Q A;  4NY8 A;  7ICN A;  1SKS A;  1DK2 A;  5HRD A;  4KLQ A;  2DVI A;  4DQI A;  5J2J A;  4QZB A;  1UET A;  1BPD A;  9ICT A;  4F4W A;  1JAJ A;  3WFO A;  4RT3 A;  1DK3 A;  4TUQ A;  4JWN A;  1NOM A;  3H40 A;  5J29 A;  2M2U A;  2NRK A;  5HRB A;  3C1Y A;  4AT7 B;  4DQQ A;  3UXP A;  2XY5 A;  3EPI A;  2IA6 A;  9ICP A;  5HMM A;  3E2E A;  8ICR A;  4BXO A;  2XGQ A;  4DFP A;  4ECV A;  4EBE A;  4RQ5 A;  5KG3 A;  2Y1I A;  1RYR A;  1BNO A;  3V6K A;  4DOB A;  2BCQ A;  3EYZ A;  7ICU A;  3UPQ A;  3RR7 A;  5HRF A;  1ZQU A;  4C8O A;  3Q8S B;  8ICP A;  2MAX A;  5KFU A;  4WC0 A;  4O3O A;  1L3T A;  3Q8R B;  3N97 B;  1TAU A;  2ASJ A;  4B9U A;  4TQR A;  4C8M A;  9ICI A;  4BWM A;  3PMN A;  1IXR A;  5KT3 A;  4DL7 A;  5KFV A;  3TI0 A;  3RH5 A;  1RXW A;  2I9G A;  4UD4 A;  4WC1 A;  2DRA A;  9ICJ A;  1UEU A;  4M9G A;  1L3S A;  3B0X A;  4UAW A;  5KFA A;  1XSP A;  2BDP A;  4FHY A;  4UAY A;  3V6H A;  2ZH3 A;  8ICQ A;  5KFF A;  2J6T A;  4KLJ A;  4Q43 A;  8ICK A;  4UBB A;  2JZB A;  1BPE A;  4YMM A;  3KHR A;  4PHE A;  4X5V A;  1D9F A;  4BDP A;  4M5D A;  5KFM A;  5KFJ A;  1MIV A;  4EEY A;  4O3Q A;  4ECW A;  3PR5 B;  4Q44 A;  4QZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...