4PGYA

Structure of human dna polymerase beta complexed with a nicked dna containing a gt at n-1 position and gc at n position
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The spontaneous base substitution mechanisms of human DNA polymerase beta
rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 106
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pgyA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pgyA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pgyA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pgyA03
4DSKA 1AROP 3H3AA 4M9NA 2ZH1A 8ICXA 3V7LA 3WFOA 4F92B 3GFKB 2R8HA 2PFOA 1RZTA 5J2BA 1KEJA 3MR5A 3PVXA 1QSLA 1ZQZA 4C8OA 1OU5A 3UQ0A 3ZDCA 3M9NB 4EP7A 4YXJA 4P4OA 4DQQA 4BGDA 4DSFA 1HJPA 4UBBA 1ZETA 4UB3A 5KFTA 4YFKA 4M04A 4X4OA 4I2EA 3OSPA 5BOMA 4TURA 4ECWA 4I2GA 4FHWA 4M5DA 3OVSA 4DF8A 3OHAA 4DQSA 9ICNA 1MQ2A 2JEJA 4IQWA 4J9LA 1SL0A 4YXMA 5CJ7A 3MR3A 3IM1A 4J9SA 4MFCA 2ZH3A 2ZH8A 4F91B 4I2AA 5BOLA 4YR2A 2I1QA 4YN4A 1R8AA 1JMSA 3JPPA 5KG3A 2NRWA 4O5KA 2M2VA 1S0OA 5HRBA 1NJXA 1MIVA 4B9SA 3HP6A 1NJWA 2W8KA 2IHNA 8ICYA 1F5AA 3GDXA 4GXKA 4ZH4A 2Q66A 5L9XA 3RBDA 2BQUA 3V7JA 3RRHA 3HWTA 5J2IA 1WCNA 2J6UA 3PY8A 4ATBB 4RWPA 5KT7A 4ED1A 1ZQLA 4QZDA 1JAJA 3L9DA 4O3RA 4GC7A 4KLMA 1S76D 5KFRA 5CA7A 4DFJA 3QEBZ 2KFNA 7ICPA 3TARA 9ICWA 3OJUA 3OUYB 4QZ8A 4YVZA 4ELVA 1QSYA 1WOTA 5HMLA 4X0AA 4QWCA 5J0QA 3NGDA 4TUSA 4YG2A 5HP4A 3PMNA 1L5UA 5DKWA 4M9JA 2FPLA 4X4UA 4PHEA 1ZQMA 4QZAA 4BDPA 4ED0A 8ICAA 1T8EA 5DB6A 3PR5B 4NXZA 2XY5A 9ICCA 2P6UA 2ZTDA 4QZEA 8ICOA 3PNCA 9ICKA 4DSEA 4IR9A 4BWJA 3MFHA 4F4WA 2FLPA 3G6VA 2DR7A 4UD5A 3LDAA 4YMOA 4E8FA 4B9NA 3PW7A 1ZQGA 5D46A 5KT5A 2R8GA 5KG5A 5HHIA 3C21A 3OGUA 5HMMA 5DB8A 2I9GA 2IA6A 2IBKA 1ZQBA 7ICKA 1ZQFA 4DO9A 5IIMA 4YD2A 3SV4A 4I29A 5IILA 4DOCA 5DG7A 1NKEA 2XGQA 5J29A 4R8UA 1MQ3A 1ZQAA 5DBAA 5J2AA 1T4GA 1PX5A 3RJFA 2XO7A 4JK1A 3TFSA 4GLXA 3QZ7A 1ZQQA 2C28A 4F5NA 5KFFA 1KTQA 4LVSA 1RYRA 4R65A 3V72A 8ICEA 3FYHA 1B22A 1NKCA 1QLNA 1UETA 2ZH2A 3Q8QB 1Z00A 4O3PA 2ASLA 5DB9A 1HUOA 9ICHA 2W9CA 4F4KA 4AT8B 9ICFA 2ZH4A 2BDPA 4I2JA 2ASDA 1JQRA 3RAXA 2DVIA 4RPZA 2Y1JA 3Q8RB 4QWBA 4RNNA 2NRTA 3ISBA 2BKEA 2C22A 1BPZA 2P66A 4K4IA 2ID1A 1NJZA 1DGSA 1XS9D 4ECQA 5CP2A 1KFSA 1BPBA 2PXIA 4ED3A 8ICSA 4X4VA 1T3NA 4X4PA 5HRIA 3B0YA 4UBCA 2VA2A 5KFQA 5DBBA 5J0UA 3BDPA 4KLHA 2NRVA 1QSSA 1NKBA 3UQ2A 4ECRA 2NRZA 3V6JA 2IHMA 1MC8A 1TK8A 2R8KA 1ZQXA 8ICLA 1K1QA 1PZNA 3OHBA 1N56A 4PHDA 4IRCA 3PW5A 3N4MB 4GXJA 4NLGA 5D49A 1KLNA 4R63A 3QEAZ 1U48A 2BCQA 2HVIA 4PGYA 4UB5A 4J9MA 4PHPA 4UB2A 4FO6A 3V6KA 3PX0A 3RR8A 4CCHA 2F1IA 5HNKA 4JWNA 4NM1A 1COOA 3RB3A 2C2EA 2RDJA 3LK9A 4DS4A 1L3VA 1KFTA 2W8LA 3AUOA 8ICHA 3ZDBA 3RJGA 3HJ1A 7ICNA 4ATBA 4DLEA 2BGWA 1S0MA 4KLTA 1JXEA 1ZQNA 4DL3A 4DL7A 2JEIA 5IIIA 4EZ9A 4XRHA 1X9SA 4F5QA 3OV7A 1DK3A 3IHQB 4QZCA 4J9KA 1NZPA 4QZBA 4M9GA 1VFGA 1L3UA 2BQ3A 1H38A 4K4HA 4RU9A 4DFMA 1JN3A 1UA1A 8ICCA 3LWLA 4XUSA 3BQ0A 4WC1A 4DOBA 3Q8LA 2PFPA 3UXPA 5J0XA 7ICEA 2BHNA 2MAXA 9ICOA 8ICVA 1KNYA 3ISDA 4P4PA 5J0PA 3MBYA 4RQ0A 3GIKA 1RXWA 3B0XA 1ZQOA 2XY6A 4NLKA 1ZJMA 5C5JA 3THVA 3UXOA 2DRAA 4WC6A 4MEYA 1D9DA 4F5PA 4ECSA 5KFHA 3TI0A 5KFUA 4YQWA 1U4BA 3V6HA 5J2JA 3K4GA 1TK0A 4MFFA 4KLGA 9ICTA 1NO5A 4WC5A 2AJQA 5KFNA 5KFXA 1D8LA 5KFIA 3JPOA 3M9MB 3Q8MA 4F3OA 4AT7A 4M47A 4NLNA 4F4XA 4TUPA 2AGQA 3E2EA 4DQPA 1WCLA 2JEFA 2P6RA 1S77D 4M9HA 1SKRA 8ICRA 3NYBA 1ZQTA 2HHVA 7ICRA 2FLNA 5KFYA 4DL4A 4KLDA 4IQUA 3ISCA 2PBEA 2HHUA 3PW2A 1Z3EB 3C2MA 5DGBA 4DF4A 3AQMA 4X4RA 3H40A 2W9BB 1XWLA 3MGHA 4F5OA 4Z6CA 3T5HA 2ZTCA 2ZH7A 5IIJA 3TANA 4DFPA 4F2RA 1A76A 4Q45A 2JZBB 2ZJAA 4FS2A 4C8LA 2ZH9A 4C8MA 2C2DA 7ICJA 1ZQKA 4QWAA 2UVVA 3PW4A 5KFAA 4O3OA 2R8JA 3RBEA 7ICUA 1U9LA 5KG7A 4EYIB 4KLOA 4UD4A 1Z00B 2A1JB 5DQGA 3RR7A 3ZDEA 4RQ2A 5KFGA 5DDMA 4WBZA 4ELTA 3T5KA 2MUTB 5CWRA 1SKWA 2HHXA 3TQ1A 4P4MA 1X9WA 5KG4A 4RPYA 1TFWA 3C5FA 3GIJA 3QE9Y 1ZQVA 2KFZA 4BXOB 1ZQWA 4JWMA 5DGAA 3MDCA 1ZQCA 5DEDA 4X0BA 8ICIA 3KTQA 3RAQA 4B9UA 3WFQE 4Z6DA 2ALZA 1R8CA 4EBJA 4O3QA 4RQ6A 1Q79A 2O5AA 4FH5A 3BQ2A 1XSNA 4QZHA 4RQ1A 4NLZA 3EZ5A 4O5CA 4X4SA 4QZGA 2PI4A 7ICQA 4FHVA 4IQTA 3JPSA 2BCUA 4QWEA 5CR0A 4ED2A 1U45A 9ICUA 1S9FA 5EWGA 5HHHA 2ZUBA 4F5RA 2KZMA 5DG9A 3N97B 2O1PA 4S3NA 4RQ3A 3M8SA 4J9OA 3LQCB 1ZQIA 4QW9A 5KFOA 4Q8FA 2ZHAA 4F4ZA 7ICHA 2DPJA 2VANA 4X4NA 1UT8A 4UAWA 2XCPA 3EPGA 4UQGA 4O5EA 1MIYA 7ICSA 1RYSA 4PH5A 2NRXA 4M6WB 5J0YA 3Q8PB 3C1YA 1SZPA 4F50A 5J2HA 3EPIA 4X4TA 2ZH6A 1SL2A 4NKTA 2XC9A 2BPGA 2UVUA 1S0VA 5HRHA 4NM2A 4RT3A 3G6XA 3KHHA 2ISPA 4FHPA 4AT9B 3C1ZA 4X5VA 2GWSA 2BPFA 2XGPA 3EW9A 3HT3A 1ZQEA 2BCSA 2FMQA 5L1LA 5KT6A 4DLGA 2VA3A 4M9LA 5DG8A 2HHPA 3AQLA 3AQKA 7ICMA 4C8KA 4JV1A 3HIYA 5F2VO 2Q0ZX 4PPXA 3OVBA 3KHGA 4LZDA 7ICTA 4JV0A 5KFWA 4JUZA 1BNPA 4XQ7A 3RB0A 8ICZA 3OUYA 4DFKA 4DEZA 5HRLA 3RTVA 3MGIA 3H4BA 1LV5A 4M0AA 3H7IA 1TAUA 2WTFA 4Z6EA 3MFIA 1A77A 2KN7A 3C18A 4KLFA 4I2BA 5HRFA 4LT6A 4KLQA 9ICLA 5EWFA 4KLUA 1S0NA 4YMNA 4EYHB 9ICIA 3GV5B 3SZ2A 9ICEA 2DR9A 1Y88A 4PGXA 5KFVA 4MEXA 4I2IA 4E80A 4F2SA 4O3NA 3OSNA 4KLJA 3RJEA 5KFCA 2W9AA 4FHYA 4DWIA 3RB6A 4NY8A 5DLGA 3AQNA 2BE3A 3KHRA 3H38A 1HUZA 4QWDA 8ICQA 2ZJ8A 5TZVA 4UAZA 1NJYA 2FMSA 2DFLA 4RUCA 5EWEA 1XSLA 2BCVA 1X9MA 3HJ4A 1BNOA 3C5GA 4I2DA 1NK6A 5KFPA 1JIHA 3M8RA 1ZQPA 8ICWA 1N48A 3H4DA 1CUKA 1XO1A 4R66A 3HX0A 4GXIA 4IR1A 2M2WA 1KDHA 7ICOA 2B21A 2ATLA 3PO5A 2M2UA 5CB1A 3HW8A 3H37A 2C2RA 2HHTA 3WFRE 3PO4A 2M2TA 4DSIA 5KFBA 3RJIA 3H8SA 4RQ8A 1KRPA 2UVRA 2NRKA 1DOQA 1UA0A 5DBCA 3RJJA 2KP7A 1FA0A 7ICIA 2DR5A 4LZGA 1TAQA 4QW8A 5J2EA 4JV2A 5HR9A 3UXNA 1TV9A 3T3FA 2FPKA 3GIIA 4F4YA 8ICBA 2F1JA 4XA5A 4ED8A 1JX4A 4I2FA 5J0OA 2KZ3A 1DK2A 9ICMA 3OJSA 1CEZA 5J2CA 4QZIA 1UEVA 1D8YA 5CHGA 1XC9A 1BGXT 2W9MA 5J2KA 3ORYA 5KT3A 1BPEA 3SV3A 1TFYA 4KLIA 1IM4A 3JPRA 3UPQA 4ECUA 3TFRA 5KG2A 4M2YA 1KFDA 9ICGA 4TUQA 7ICLA 3EWAA 5KG1A 2ZUCA 4ECTA 3UPSA 2ZH5A 2R8IA 4ECVA 2M9NA 8ICMA 2BPCA 2FLLA 4KN4A 3RJHA 1ZYQA 4DS5A 3RRGA 1BVSA 4I27A 1YLQA 5HREA 3TAPA 3WFSC 1C7YA 4R8UB 3GQCA 4P2HA 3PX6A 4WC3A 4MF2A 3ETLA 5J0SA 3KHLA 5HRGA 3NTUA 1L3SA 5IIOA 4RT2A 4DL2A 1ZQDA 4FBUA 4RQ5A 5KFJA 2Y1IA 4B9MA 4EZ6A 4DOAA 4DL5A 4R64A 3Q8KA 4WC7A 4YP3A 1ZQJA 4RPXA 3QZ8A 3OVAA 3GILA 3M9OB 1BPXA 4RNMA 3GIMA 2W9CB 3JPNA 3MR6A 3H39A 5DECA 4IG8A 2ZTEA 4G3IA 5DDYA 5KFKA 2V4QA 2VA8A 3RJKA 3JZ0A 3PMLA 4HYKA 1NOMA 1TFRA 1U49A 3C2LA 4Q44A 3BQ1A 5IINA 2DPIA 7ICFA 3TAQA 4IRKA 8ICPA 9ICSA 4Z6FA 3MR2A 3LWMA 4KMUA 5DQHA 2XCAA 1L3TA 3G6YA 9ICXA 4EBKA 3K75D 2FMPA 1MIWA 5D4BA 4O9MA 4TQSA 4FS1A 4B9LA 1K1SA 5KFZA 2ASJA 9ICAA 8ICNA 3T5LA 4DSJA 2HHQA 9ICPA 5DB7A 1S97A 1ZQYA 2ZHBA 1BPDA 1X2IA 5F9LA 2PFQA 4J9RA 2JEGA 4WBYA 3FDSA 3H8WA 5KG0A 2PFNA 4DQIA 2BR0A 5HRKA 4WC2A 4MFAA 2HW3A 4ECZA 1S10A 3T5JA 1D9FA 2BQRA 2V9WA 1R89A 1V9PA 2F1HA 4RNOA 2DR8A 4PGQA 1UEUA 2ISOA 5HRDA 4UB1A 2J6SA 2XY7A 4B9VA 4FBTA 9ICBA 1R8BA 4FHXA 1NK9A 4PHAA 5HC9A 1B43A 2BCRA 3BJYA 4RWNA 5F9NA 1ZJNA 5L1JA 1NK0A 3SYZA 3RB4A 8ICGA 4YCXA 1RXVA 1XSPA 2FPMA 4BWMA 3BQTA 5KG6A 1U47A 4I28A 2KTQA 8ICJA 3GV7B 1VJ7A 4RWQA 1NK8A 3PV8A 4WCWA 4RWOA 5IIKA 3EYZA 2UVWA 9ICRA 2W9BA 3C2KA 4DQRA 3WFPA 3PX4A 4WC4A 5KFLA 3HPOA 3V7KA 4ECYA 3H8JA 1V4AA 4YD1A 4DSLA 3Q8SB 3C23A 2JZBA 2LYHA 5J2DA 2AQ0A 1ZQHA 5J0WA 2PI5A 4O3SA 4KITB 3AU2A 5KTQA 4J9NA 4XQ8A 5J0RA 1TVAA 2A1JA 4QZFA 4UB4A 3ZD9A 3JPTA 3GV8B 2V4RA 2HHWA 4IRDA 3MDAA 3JYYA 4ED7A 1NK7A 2MUTA 4F93B 4KTQA 3C66A 7ICGA 4C8NA 8ICTA 4RUAA 3RH5A 4YMMA 4EBDA 4EEYA 1T7PA 4BXOA 2AGOA 1TKDA 4K4GA 4RZRA 1Q78A 1LB2B 5J2FA 2DRBA 4DL6A 4Q43A 1NK5A 5KT2A 4O0IA 4I2CA 8ICFA 4ECXA 1KSPA 7ICVA 4AT7B 2H5XA 1BPYA 9ICQA 4J9PA 4E7XA 4RQ4A 4WC0A 1ZQRA 2ZUDA 1QTMA 4X4QA 1JXLA 3AU6A 2KZZA 5EOZA 2RFFA 5KFSA 2ZJ5A 2HVHA 1IXRA 1XU4A 4KN7A 2HHSA 1ZQUA 1SKSA 1RPLA 2OWOA 4B9TA 1UT5A 3PR4A 4YR0A 5KFMA 5L1KA 4EBEA 3ZDDA 4KLSA 8ICKA 5DQIA 5DLFA 2IMWP 1ZQSA 4M6WA 4E0DA 3MABA 4F8RA 5KFDA 8ICUA 1EXNA 3RH4A 4AT8A 4TQRA 4J9QA 5KFEA 4IQVA 1SL1A 3ZD8A 4QZ9A 4KLEA 5J0TA 4I2HA 4Q8EA 2J6TA 9ICJA 4FH3A 4ED6A 4AT9A 4MF8A 4NKUA 2AQ4A 4ELUA 5JUMA 4YR3A 5KT4A 3PW0A 2RDIA 4EBCA 2AGPA 1NK4A 1TK5A 4RQ7A 3SI8A 2AU0A 3ZDAA 4UAYA 4GC6A 4KLLA 3RH6A 1MSWD 5BPCA 3JPQA 5J2GA 5L1IA 9ICVA
chains in the Genus database with same CATH superfamily
1AROP 2LPEA 1SV0C 8ICXA 3WFOA 1RZTA 4WQLA 4C8OA 3MR5A 1QSLA 2YTUA 3M9NB 4DSFA 1HJPA 3NVWA 4UB3A 5KFTA 1ZETA 2ZIWB 4DCCA 4QNLA 4I2GA 4FHWA 3OHAA 1JUDA 4DQSA 2DKZA 3MR3A 4J9SA 4I2AA 5HR6A 4OCZA 4O5KA 8ICYA 3GDXA 3ONNA 2BQUA 2JR5A 2J6UA 1WCNA 4ATBB 3WKEA 3L9DA 1ZQLA 5ALNA 1QQ6A 4O3RA 5CA7A 4DFJA 2KFNA 3QEBZ 3TARA 2EDUA 5AM4A 1WOTA 5ALTA 4QWCA 5J0QA 2LBOA 4YG2A 5AKGA 4X4UA 2VJ5A 1LKYA 5DB6A 5EE9A 4NXZA 8ICOA 4DSEA 1X6IA 3MFHA 2CRXA 2DR7A 4YMOA 4E8FA 4B9NA 1ZQGA 2KJ8A 2R8GA 1Q8KA 3OV7A 2IBKA 2IA6A 1ZQBA 4DO9A 3SV4A 5DG7A 5J29A 1ZQAA 1XO0A 2EANA 1KL9A 2C28A 5KFFA 2KVSA 8ICEA 2ZH2A 3QX7A 3Q8QB 1Z00A 2K4HA 2LMRA 2HOQA 5L1MA 2DVIA 3Q8RB 2BKEA 1BPZA 1L8OA 1NJZA 3U26A 2HMXA 5AHXA 4UBCA 2VA2A 4KLHA 2NRVA 1NKBA 1QCKA 3VC8A 1TK8A 2R8KA 1ZQXA 3PW5A 3N4MB 1U48A 5KAFU 2Y9UA 4F4KA 4J9MA 2F1IA 1VDVA 4Y2JA 2RLTA 3WKCA 1SV4A 4DS4A 2K4IA 1KFTA 2DWQA 3AUOA 5ALRA 4DLEA 4KLTA 5FP0A 2KICA 2BQ3A 2NV3A 4RU9A 5J8YC 4DFMA 3BQ0A 2MAXA 3ISDA 2HOIA 4P4PA 3B0XA 1ZJMA 1L8LA 1F0MA 2KJ9A 3TI0A 1U4BA 3V6HA 4JB3A 9ICTA 4WC5A 5KFNA 1SZHA 1D8LA 3Q8MA 2GOLA 4K9AA 3LVWA 4Y2SA 4CE6A 3M6KA 2OEHA 7ICRA 2FLNA 3ERCC 2PBEA 2HHUA 2AH5A 4RQMA 1KKXA 2ZTCA 1ZRNA 4DFPA 2ZJAA 2ZH9A 2K60A 2C2DA 7ICJA 1O08A 4Y2UA 4KLOA 4EGWA 5CEHA 3OWGA 1Z00B 3RR7A 4WQKA 2KG5A 5KFGA 5DDMA 1SWVA 3TADA 2MUTB 5CWRA 3T5KA 3TQ1A 1P7DA 2ZG6A 3GIJA 4BXOB 1ZQWA 4C4SA 3KTQA 2EZZA 4OJ5A 3BQ2A 2PI4A 7ICQA 5ALMA 2K8AA 1ZD3A 2BDUA 3GU3A 3IN5A 3LVVA 2KZMA 4Y2VA 4S3NA 3N97B 1V85A 2YQEA 1RG6A 5KAIU 5KFOA 4Q8FA 2XCPA 3DDHA 3EPGA 4UQGA 5KL8B 4HAIA 7ICSA 3AN1A 4M6WB 3KOOA 5J0YA 1SL2A 2BPGA 2UVUA 3C1ZA 5AKXA 4F72A 2BCSA 5L1LA 4E7XA 5DG8A 2YY6A 7ICMA 4PPXA 2KD1A 5KFWA 5AI9A 2F44A 1N61A 4M0AA 1Z1VA 1WWVA 9ICIA 4EYHB 4N7RA 1Y88A 3OSNA 5KFCA 1A0PA 4US8A 4QWDA 3BQ7A 2DFLA 1XSLA 2JH7A 1VLBA 3TKAA 1NK6A 3M8RA 4XJEA 2D6FC 8ICWA 1CUKA 1XO1A 3HX0A 1X40A 3WK8A 5AKIA 1ZOLA 2KNJA 2EH9A 1DOQA 2DR5A 3RJJA 4QW8A 1TV9A 3GIIA 4ED8A 1PK3A 1DK2A 9ICMA 3OJSA 2AXTU 1CEZA 5CHGA 4CRXA 3WK6A 5J2KA 3SV3A 1TFYA 3QUTA 2Y9TA 4OJLA 4KLIA 5KG2A 2YMQA 2ZUCA 1RDFA 4ECTA 2R8IA 4ECVA 2K89A 2M9NA 3AM9A 1F5SA 4DS5A 1ZYQA 4FZNA 1YLQA 2YB1A 1YZ6A 1C7YA 4R8UB 4P2HA 3FC4A 3ETLA 3NTUA 4FBUA 4DOAA 4WC7A 1WUDA 3JCFA 3QZ8A 3DEEA 1NZBA 3NVYA 3H39A 4IG8A 4G3IA 2H3IA 3JZ0A 4HYKA 1NOMA 4Q44A 3BQ1A 9ICSA 3TAQA 4Z6FA 2XCAA 3G6YA 1UHUA 2FMPA 1MIWA 4JMUA 1L7MA 8ICNA 3T5LA 2HHQA 3NRWA 2ZHBA 5AM5A 2KSOA 5F9LA 1S8OA 3A0HU 1DRGA 1IIPA 3M1YA 4ECZA 1D9FA 2V9WA 1N63A 1F44A 4MHVA 4FBTA 1R8BA 1NK9A 4PHAA 2LM4A 2BCRA 2JV3A 3NKUA 5G5HA 4YCXA 1XSPA 2FPMA 8ICJA 1U47A 3GV7B 4WCWA 4RWOA 9ICRA 2UVWA 3WFPA 4U7CA 3HPOA 3V7KA 2LYHA 5ALQA 2AQ0A 4O3SA 5J0RA 1TVAA 4QZFA 3GV8B 3MDAA 3JYYA 1NK7A 4F93B 2F77X 2K4EA 7ICGA 4RUAA 2OM6A 4K4GA 4YMMA 1T7PA 1TKDA 3L5KA 5AK6A 5J2FA 2DRBA 1GO3F 2ZIXB 5KT2A 4I2CA 4AT7B 2WF6A 4K97A 3BZCA 3MGVA 9ICQA 5KFSA 4A8EA 2ZJ5A 2IOFK 2WB1C 1RPLA 2OWOA 3PR4A 4YR0A 5L1KA 4KLSA 5DLFA 1ZQSA 2KHQA 4E0DA 1HEKA 4F8RA 5KFDA 3RH4A 2G06A 5KFEA 2GAFD 4QZ9A 4MF8A 4NKUA 4KB6A 5E79U 2RDIA 2AGPA 3ZDAA 1NK4A 4KLLA 4X0AA 3C28A 2AU0A 3JPQA 5ALKA 3H3AA 2R18A 4M9NA 4O68A 3GFKB 2PFOA 2EWRA 2HN1A 3QU2A 1TE2A 1KEJA 1ZQZA 1Z4NA 4YXJA 2YX8A 4P4OA 4DQQA 4M04A 4YFKA 4X4OA 2WF5A 1B4FA 4TURA 3HKZF 3UMCA 2RP5A 2VKQA 2WF7A 4C7YA 3OVSA 9ICNA 4FFDA 2ZIVA 4J9LA 4F71A 5CJ7A 4F91B 5BOLA 4YR2A 1JMSA 3JPPA 4WH5A 5HRBA 4P0QA 1NJXA 4B9SA 3HP6A 2HBLA 2W8KA 4O67A 3EF2A 4GXKA 3RBDA 3V7JA 5AI5A 5KT7A 1JAJA 3K7DA 5HR7A 4GC7A 5KFRA 3QUCA 3OUYB 4ELVA 2YMLA 4OAGA 5HP4A 4EX6A 2FPLA 4BDPA 1A6SA 2XY5A 2P6UA 2ZTDA 3SEIA 3PNCA 2NO4A 9ICKA 4IR9A 4UD5A 2FI1A 5D46A 5KT5A 5HC9A 3OGUA 7ICKA 5DB8A 5IIMA 4YD2A 4DOCA 3D2QA 1RYUA 4GLXA 3AQFA 5K4LA 1L7PA 1RYRA 4R65A 3FYHA 1NKCA 1UETA 1JRPA 5DB9A 9ICHA 2ZH4A 2BBJA 4I2JA 1Z1BA 5C0YA 2Y1JA 4QWBA 1SXEA 2C22A 1XS9D 4ECQA 4Y2QA 1NNLA 1OXJA 4X4PA 4DFDA 5HRIA 3B0YA 5DBBA 1L7NA 2NRZA 2EQYA 2IHMA 4UASA 1K1QA 1N56A 3OHBA 4PHDA 4GXJA 4NLGA 3QEAZ 2HVIA 3MCRA 4PGYA 4FO6A 3AQEA 4CCHA 1NO5A 4JWNA 5HNKA 2G07A 3RB3A 5AIAA 1JI7A 1FO4A 2DQNB 8ICHA 1ZXIA 3ZDBA 7ICNA 2H3VA 2PMZF 1X9SA 1V38A 1XNSA 1DK3A 3IHQB 4QZCA 4FZMA 1VFGA 2BZFA 5AI0A 4K4HA 3FAHA 5JU5A 1UA1A 2KEYA 4XUSA 3Q8LA 2PFPA 3UXPA 3BS7A 3E58A 5J0XA 2BHNA 7ICEA 1KNYA 8ICVA 2QARB 3GIKA 3MBYA 1ZQOA 5C5JA 3THVA 2E5SA 2A1AA 3D2NA 5KFHA 4YQWA 2HBJA 5KFXA 3M9MB 4TUPA 4M9HA 5CFTA 8ICRA 1ZQTA 3J81j 5KFYA 4DL4A 4KLDA 4IQUA 3N28A 3ISCA 1Z3EB 3C2MA 5DGBA 3AQMA 4X4RA 4Z6CA 4EEBA 2ZH7A 5IIJA 4F2RA 3IG8A 4OJOA 1ZRMA 4C8MA 5AKYA 2R8JA 1U9LA 2A1JB 1QH9A 3ZDEA 4RQ2A 4WBZA 2XICA 2Z7JA 1SKWA 4CNQA 1TFWA 2KFZA 2IOFA 3NUQA 4JWMA 5DGAA 3MDCA 4X0BA 3C29A 3RAQA 2E8OA 4Z6DA 4RQ1A 4X4SA 2HBMA 3TADC 4QZGA 3F2BA 4FHVA 2KKPA 2KOBA 2H3FA 4IQTA 5CR0A 4ED2A 1U45A 4Y2TA 5EWGA 3EUB2 4F5RA 4RQ3A 3M8SA 3ZI4A 4QW9A 3SD7A 7ICHA 2DPJA 2FCLA 4C80A 4PH5A 3Q8PB 4UAVA 4F50A 2ZIUA 5J2HA 1V97A 4NKTA 4U6PA 1AQ6A 3G6XA 2ISPA 5AM3A 5AK5A 2GWSA 2BPFA 4OO1J 2LYBA 3HT3A 3AQLA 4DLGA 3AQKA 4QJFB 3M7DA 3OVBA 1Q3VA 7ICTA 4KX3A 1Q3UA 2W3SA 4DEZA 4DFKA 5HRLA 3MGIA 1LV5A 3H0RB 3IG5A 4Z6EA 4QIWC 3C18A 4KLFA 5HRFA 4LT6A 2E8MA 5ALHA 9ICLA 3ALRA 3GV5B 3SZ2A 9ICEA 4PGXA 5KFVA 4MEXA 4I2IA 3DV9A 4FHYA 2BE3A 1UQVA 3KHRA 3H38A 1HUZA 8ICQA 4UAZA 3NWIA 1T3QA 3C5GA 4I2DA 4CDGA 1JIHA 5KFPA 4NXXA 2EZXA 2KJ5A 3CW2C 7ICOA 2ATLA 4HX0A 3HW8A 2C2RA 2HHTA 3L4PA 3NRZA 3WK5A 5KFBA 1KRPA 4RQ8A 2UVRA 1FA0A 2KP7A 4PJ0U 2LI6A 5HR9A 5J2EA 4JV2A 3GZFA 5B3PA 8ICBA 2F1JA 4I2FA 5J0OA 2KZ3A 4JLXA 4QZIA 1LKYB 1XC9A 1BGXT 3WKDA 3ER8C 1BPEA 1YZ7A 4LEWA 1N2XA 3F5AA 1IM4A 3JPRA 3TFRA 1KFDA 9ICGA 4TUQA 7ICLA 3EWAA 3UPSA 2ZH5A 3D2SA 8ICMA 2BPCA 3F53A 2W54A 1BVSA 5CFUA 4CGZA 3PX6A 4MF2A 5J0SA 3KHLA 2ODGA 1L3SA 5IIOA 1ZQDA 3KZXA 3ER9B 2Y1IA 5KFJA 4DL5A 1UCVA 4R64A 4PL1A 2F8KA 3OVAA 3M9OB 1BPXA 2EAMA 3GIMA 3IP4B 1FIQA 3JPNA 2WF8A 2D8CA 2VA8A 3PMLA 1U49A 3C2LA 3PHZA 5AKZA 3MR2A 4KMUA 2XIDA 4US9A 4LEVA 4QIWF 4FS1A 4B9LA 4Y2RA 5KFZA 2ASJA 9ICPA 3PSFA 1ZQYA 1BPDA 1X2IA 1RM6C 4J9RA 3FDSA 3H8WA 2N1RA 2HDOA 2PFNA 3LYSA 2BR0A 4DQIA 1IG6A 3T5JA 2BQRA 4AYBF 1R89A 4UB1A 9ICBA 2IHOA 5L1JA 1NK0A 3RB4A 8ICPA 2G5HB 3PV8A 2L5YA 2W9BA 3HRDD 1QQ5A 1HIWA 2JZBA 2PI5A 5ALFA 2VJ4A 4K98A 4P0PA 5KTQA 2CPRA 4XQ8A 2JMGA 4IRDA 2KE7A 3RH5A 4EEYA 2AGOA 4EEDA 5AKKA 3NS1A 1NK5A 8ICFA 4RQNA 2H5XA 2DF4B 4RQ4A 1ZQRA 2F76X 1QTMA 3UMGA 3SAFA 5EOZA 2A19A 5H2FU 4KN7A 1MN8A 4EX7A 5DQIA 2F3NA 3MABA 5B3QA 4IL6U 1FEZA 4AT9A 4ED6A 5GTIU 2KV2A 5KT4A 3BZKA 1J97A 1TK5A 4RQ7A 3SI8A 4UAYA 5J2GA 5B5EU 4DSKA 2ZH1A 5KNIA 3V7LA 5JTIA 1WYGA 2R8HA 3RFAA 1OU5A 3UQ0A 4EP7A 4UBBA 2W11A 1FFVA 3OSPA 5BOMA 3UMBA 4ECWA 5ALSA 2QB1A 4DF8A 1MQ2A 2JEJA 3KFUF 2G0AA 4ACOA 2H3ZA 4MFCA 3IM1A 2ZH3A 2E1FA 1R8AA 4EELA 5KG3A 2NRWA 2M2VA 1S0OA 3QU4A 2I5HA 1N5WA 1L7OA 2IHNA 1F5AA 4ZH4A 5L9XA 1OUQA 3HWTA 5J2IA 4ED1A 2YMPA 3QU9A 2BBHA 1S76D 9ICWA 3OJUA 4P0PB 4QZ8A 4YVZA 1O03A 1M6YA 5HMLA 4TUSA 3PMNA 4PHEA 3RF9A 2E1EA 4QZAA 1ZQMA 8ICAA 4ED0A 2K4PA 1L6NA 3M6ZA 3HKZC 4BWJA 5ALVA 4F4WA 2FLPA 3G6VA 2W03A 4JLZA 3C21A 2I9GA 5HMMA 1ZQFA 4I29A 2XGQA 5DBAA 1PX5A 3RJFA 3TFSA 3WK7A 3QZ7A 1ZQQA 1X66A 4LVSA 1KTQA 3V72A 1QLNA 5ALXA 2ASLA 5ALIA 1WG8A 1HUOA 2W9CA 2BDPA 2ASDA 3RAXA 2DKXA 4RNNA 2NRTA 3ISBA 2ID1A 4K4IA 3F2CA 1DGSA 3CP8A 1BPBA 8ICSA 1K5OA 4X4VA 4OJ6A 1T3NA 1D8BA 5AI4A 5KFQA 3BDPA 3V6JA 3SR6A 1MC8A 3CNHA 1PZNA 3WK9A 4IRCA 5D49A 4UB5A 3PX0A 4PHPA 3RR8A 2C2EA 4IS7A 3LK9A 3AL0B 3RJGA 3HJ1A 3F5EA 2BGWA 3QNMA 1S0MA 1JXEA 1ZQNA 2HBKA 5IIIA 4EZ9A 5A0LA 3ICXA 4Y2PA 4EENA 5CRXA 4UATA 2W55A 4CF5A 2OHFA 2H3QA 5D62A 3KBBA 4WC1A 3AMZA 9ICOA 1RXWA 4RQ0A 1KW4A 4WC6A 2KSOB 2RQ5A 4NXVA 1D9DA 4ECSA 3N7SC 1ZD2P 5KFIA 3JPOA 2QKQA 4NLNA 3E2EA 3PSIA 1WCLA 3NYBA 2HHVA 2ZXIA 2O6KA 3PW2A 3N7PD 4DF4A 4FO1A 2PMZC 2HI0A 1A76A 4FS2A 4QWAA 2UVVA 3PW4A 7ICUA 1PK1A 3RBEA 5EE3A 3BS5A 5DQGA 1SWWA 2W7PA 5EE0A 3R9KA 2HHXA 4P4MA 5KG4A 2W04A 4RPYA 3C5FA 3QE9Y 1ZQVA 2KHVA 1ZQCA 8ICIA 4B9UA 3WFQE 5G5GA 2DUYA 1R8CA 4O3QA 4RQ6A 3L3FX 1XSNA 4QZHA 4NLZA 5AKJA 4O5CA 1KQQA 2G09A 3NVOA 3JPSA 3QXGA 4QWEA 2GA9D 5AKEA 5AM1A 1S9FA 2ZUBA 2O1PA 5DG9A 4J9OA 1ZQIA 2ZHAA 5ALOA 1UT8A 4UAWA 1QQ7A 1RYSA 2NRXA 5ALZA 2ZH6A 5ALGA 1S0VA 4RT3A 3KHHA 4FHPA 1PVQA 2RRDA 4X5VA 2XGPA 3EW9A 1ZQEA 2JH1A 4M9LA 1MA7A 5KT6A 1LVHA 4ATBA 5JTGA 2ES6A 2MRLA 4LZDA 4USAA 4JUZA 3MC1A 1BNPA 3RB0A 2LHTA 4K99A 2K8CB 2B56A 3RTVA 1TAUA 3UM9A 2ESEA 2WTFA 2JRZA 3MFIA 2KN7A 4I2BA 4KLQA 5EWFA 4YMNA 2HN2A 4E80A 4KLJA 3RJEA 3O0FA 5DLGA 2ZIVB 2ZJ8A 5TZVA 3NVZA 1NJYA 4RUCA 2BCVA 5JRTA 4P0QB 2CN1A 2YB4A 4R66A 2M2WA 4GXIA 4IR1A 3KKAA 2B21A 2M2UA 5CB1A 4OAIZ 3H0LB 5T14A 3PO4A 4DSIA 2NRKA 1UA0A 5DBCA 5D61A 2MSNA 3T3FA 4XA5A 1JX4A 4BJQA 4C0ZA 4Y2XA 1UEVA 2JXJA 5TISU 1JROA 1N5XA 2FJ6A 2JGAA 5KT3A 3ORYA 3UPQA 4M2YA 3QU5A 3PZPA 3QYPA 5KG1A 2FLLA 3A0BU 3H0MB 3RRGA 2WAQC 5HREA 2WFAA 3WFSC 5AM0A 5HRGA 3QU7A 4FZLA 4PZOA 4B9MA 3CYMA 4WOYA 2OCEA 3GILA 4RNMA 2ZTEA 4NV0A 5KFKA 2V4QA 3QUQA 1TFRA 5AIBA 2DPIA 3PSTA 1L3TA 5DQHA 4EBKA 9ICXA 1RQLA 3K75D 5D4BA 4O6AA 1K1SA 1X42A 4DSJA 2D3DA 5DB7A 1S97A 2PFQA 2JEGA 5KG0A 4WC2A 4MFAA 5KL1B 3WKBA 2HW3A 1V9PA 1UEUA 2ISOA 4OAFA 2J6SA 4PZNA 4NWIA 1WWUA 1B43A 1URJA 2W43A 1ZJNA 4RWNA 8ICGA 3SYZA 1RXVA 2KTQA 4BWMA 1YT3A 3KD3A 4I28A 1VJ7A 4WC3A 1JALA 3EYZA 4WC4A 3PX4A 4CF4A 5KFLA 4ECYA 2K8BB 3H8JA 4GFJA 3Q8SB 3C23A 5J2DA 1ZQHA 5J0WA 4KITB 1N62A 2MU2A 3AU2A 4C7ZA 4NXWA 3OTQA 4UB4A 3JPTA 2V4RA 2HHWA 3E0FA 2OXOA 4ED7A 1C20A 2MUTA 4KTQA 3C66A 4G9BA 4C8NA 4BXOA 2GH1A 5ALJA 1Q46A 4RZRA 2Y0SC 4O0IA 4ECXA 1KSPA 4AYBC 2PKEA 4WC0A 4EV6A 4K96A 2ZUDA 4KM5A 1SIJA 2WAQF 3AU6A 3NASA 2RFFA 1IXRA 1XU4A 3CK6A 1ZQUA 1SKSA 5ALEA 3ETRA 4B9TA 4M6WA 1KBUA 1ED1A 8ICUA 5ALUA 4AT8A 4TQRA 1SV0A 5AICA 4ELUA 5JUMA 4YR3A 4OAHA 3RH6A 5BPCA 3OPXA 1CRXA 9ICVA 2ZXHA 4F92B 4UB6U 5J2BA 3PVXA 3ZDCA 2LM1A 4BGDA 2LKYA 1SGGA 4NL9C 4I2EA 4LEYA 2MA1A 4OD0A 4IQWA 2DBYA 1SL0A 4YXMA 2ZH8A 2I1QA 4YN4A 2B4VA 2ZIUB 1T94A 2P35A 1MIVA 5ALPA 4KMOB 1NJWA 2Q4TA 5AI6A 2Q66A 3RRHA 2HOFA 4RWPA 3PY8A 4OJPA 4QZDA 4KLMA 3I28A 7ICPA 1QSYA 2A3VA 1J2MA 3NGDA 4UAUA 2WF9A 1L5UA 2QLTA 5DKWA 4M9JA 4C4RA 2Y0SF 1T8EA 2F2AB 3PR5B 9ICCA 4QZEA 3NVVA 1CI4A 4NJ8A 4LJXA 3LDAA 1COKA 3PW7A 3CRXA 5KG5A 5HHIA 2YN4A 2GO7A 1Q78A 5AKLA 5IILA 1NKEA 2JHDA 5ALYA 1MQ3A 4R8UA 5J2AA 1PVRA 1T4GA 2XO7A 4JK1A 4F5NA 2WHEA 1B22A 1ZQ1C 4O3MA 4O3PA 2F8LA 3I76A 4AT8B 9ICFA 4FE3A 5GTHU 1JQRA 5AKHA 4RPZA 2P66A 3IRUA 5CP2A 1KFSA 2PXIA 4ED3A 5J0UA 1QSSA 2G08A 3UQ2A 4ECRA 8ICLA 2XVTA 1KLNA 4R63A 2BCQA 4M5DA 4UB2A 3V6KA 4NM1A 4MKPA 1COOA 2RDJA 1L3VA 3WKAA 3SENA 2W8LA 4AP9A 2HSZA 5J8YA 4C4TA 1ZD4A 4DL3A 4DL7A 2JEIA 4XRHA 4F5QA 4IC9A 1NZPA 4J9KA 5B66U 4QZBA 2OYYA 1ECWA 1TAMA 4NL9A 4M9GA 1L3UA 1X9XA 1H38A 4EEKA 3IV6A 1JN3A 8ICCA 3LWLA 4DOBA 4KX5A 5J0PA 4NLKA 2XY6A 3UXOA 2DRAA 4K9BA 4MEYA 4F5PA 5KFUA 1PUZA 1TK0A 5J2JA 3K4GA 4MFFA 4NXUA 2ZIXA 2AJQA 4F3OA 4AT7A 4M47A 4F4XA 2QB0A 1PVPA 1DGJA 2AGQA 4DQPA 1ZD5A 2JEFA 2P6RA 1S77D 1SKRA 2AHOB 2FE9A 3SAGA 3PSPA 3H40A 2W9BB 1XWLA 3MGHA 4F5OA 3T5HA 3TANA 2KVCA 1VJ5A 2JZBB 4Q45A 4C8LA 1ZQKA 4UARA 5KFAA 4O3OA 3ED5A 4Y2YA 5KG7A 4EYIB 4UD4A 3S6JA 4ELTA 4WJ3B 1X9WA 1GPJA 5DEDA 1RQNA 2ALZA 4EBJA 4GIBA 1Q79A 2O5AA 4FH5A 3EZ5A 2XI9A 2BCUA 9ICUA 2M0NA 2EAPA 5HHHA 2IUBA 1SXDA 3F2DA 3LQCB 4X4NA 4F4ZA 2VANA 1MIYA 4O5EA 4B6JA 2KMDA 2E8NA 3C1YA 1SZPA 3K1RB 3EPIA 4X4TA 2XC9A 4LEZA 5HRHA 4NM2A 4ZOHC 4AT9B 2FMQA 2VA3A 2HHPA 2G5IB 3HIYA 4C8KA 4JV1A 5F2VO 2DL0A 2Q0ZX 3KHGA 4XQ7A 4JV0A 3OUYA 8ICZA 3K1ZA 3H4BA 3H7IA 1A77A 2KIWA 3HJEA 4KLUA 1S0NA 2EZYA 2IOHA 2B0CA 4F2SA 4O3NA 2W9AA 4DWIA 2KK0A 1KN5A 3RB6A 1B0XA 4NY8A 3AQNA 4BX9C 2CXYA 4CF3A 5CFSA 4UB8U 2QB0B 2FMSA 5EWEA 3B9JA 1X9MA 3HJ4A 3HILA 2KIVA 1BNOA 2GLEA 1ZQPA 2HCFA 3VCBA 2W3RA 3H4DA 1N48A 1KDHA 3PO5A 3H37A 3WFRE 3WK4A 2M2TA 3RJIA 3H8SA 7ICIA 4LZGA 1TAQA 3UXNA 2FPKA 4F4YA 3FM9A 3KKAC 4NLCA 5J2CA 1D8YA 5ALDA 2W9MA 5EE1A 4I0UA 5CHEA 2VIXA 5AM2A 5AI8A 4ECUA 4K8VA 2B51A 4NLBA 2W7OA 3WU2U 2DGZA 3KZIU 2FDRA 4KN4A 1X6JA 3RJHA 4I27A 3TAPA 3H8MA 3GQCA 2NO5A 3D6JA 1J2NA 4RT2A 4DL2A 4RQ5A 1Z4OA 4EZ6A 3Q8KA 4YP3A 1ZQJA 4RPXA 2W9CB 3MR6A 5DECA 2B6GA 5DDYA 3T79A 3RJKA 1DXSA 3SMVA 2NYVA 3SAHA 5IINA 7ICFA 4IRKA 3LWMA 5D63A 3QUBA 2QARA 4TQSA 4O9MA 9ICAA 2ZIWA 5ALLA 4WBYA 5AK3A 3I1YA 5HRKA 1S10A 2I6XA 2DR8A 2F1HA 4RNOA 2YMMA 4PGQA 5HRDA 4B9VA 2XY7A 4FHXA 1UPHA 4O69A 3BJYA 2KKVA 4ICAA 5F9NA 2RHFA 5KG6A 3BQTA 2WB1F 3IDWA 4RWQA 1NK8A 5IIKA 1IV8A 4DQRA 3C2KA 4BUGA 1V4AA 4YD1A 4DSLA 4J03A 2E8PA 1SB3C 4J9NA 2A1JA 1OW5A 3N7RC 3ZD9A 4NXTA 2E3TA 8ICTA 1S5LU 4EBDA 5ALWA 1LB2B 5AK4A 4DL6A 4Q43A 7ICVA 1FFUA 1BPYA 4J9PA 1NI3A 3AEVA 2OH2A 4X4QA 1JXLA 2KZZA 2HVHA 5F3XB 2HHSA 1N60A 1UT5A 5KFMA 3ZDDA 4EBEA 8ICKA 2LYAA 2IMWP 1EXNA 4UW9A 1Z19A 4J9QA 4IQVA 3TACB 1SL1A 1PK1B 3ZD8A 4KLEA 5J0TA 4I2HA 4Q8EA 3BS5B 2J6TA 9ICJA 4FH3A 2AQ4A 2EAOA 3PW0A 4EBCA 2DR9A 1MSWD 4GC6A 3SQIA 4KLGA 5L1IA 4PL2A
chains in the Genus database with same CATH topology
4DSKA 1AROP 3H3AA 4M9NA 2ZH1A 8ICXA 3V7LA 3WFOA 4F92B 3GFKB 2R8HA 2PFOA 1RZTA 5J2BA 1KEJA 3MR5A 3PVXA 1QSLA 1ZQZA 4C8OA 1OU5A 3UQ0A 3ZDCA 3M9NB 4EP7A 4YXJA 4P4OA 4DQQA 4BGDA 4DSFA 1HJPA 4UBBA 1ZETA 4UB3A 5KFTA 4YFKA 4M04A 4X4OA 4I2EA 3OSPA 5BOMA 4TURA 4ECWA 4I2GA 4FHWA 4M5DA 3OVSA 4DF8A 3OHAA 4DQSA 9ICNA 1MQ2A 2JEJA 4IQWA 4J9LA 1SL0A 4YXMA 5CJ7A 3MR3A 3IM1A 4J9SA 4MFCA 2ZH3A 2ZH8A 4F91B 4I2AA 5BOLA 4YR2A 2I1QA 4YN4A 1R8AA 1JMSA 3JPPA 5KG3A 2NRWA 4O5KA 2M2VA 1S0OA 5HRBA 1NJXA 1MIVA 4B9SA 3HP6A 1NJWA 2W8KA 2IHNA 8ICYA 1F5AA 3GDXA 4GXKA 4ZH4A 2Q66A 5L9XA 3RBDA 2BQUA 3V7JA 3RRHA 3HWTA 5J2IA 1WCNA 2J6UA 3PY8A 4ATBB 4RWPA 5KT7A 4ED1A 1ZQLA 4QZDA 1JAJA 3L9DA 4O3RA 4GC7A 4KLMA 1S76D 5KFRA 5CA7A 4DFJA 3QEBZ 2KFNA 7ICPA 3TARA 9ICWA 3OJUA 3OUYB 4QZ8A 4YVZA 4ELVA 1QSYA 1WOTA 5HMLA 4X0AA 4QWCA 5J0QA 3NGDA 4TUSA 4YG2A 5HP4A 3PMNA 1L5UA 5DKWA 4M9JA 2FPLA 4X4UA 4PHEA 1ZQMA 4QZAA 4BDPA 4ED0A 8ICAA 1T8EA 5DB6A 3PR5B 4NXZA 2XY5A 9ICCA 2P6UA 2ZTDA 4QZEA 8ICOA 3PNCA 9ICKA 4DSEA 4IR9A 4BWJA 3MFHA 4F4WA 2FLPA 3G6VA 2DR7A 4UD5A 3LDAA 4YMOA 4E8FA 4B9NA 3PW7A 1ZQGA 5D46A 5KT5A 2R8GA 5KG5A 5HHIA 3C21A 3OGUA 5HMMA 5DB8A 2I9GA 2IA6A 2IBKA 1ZQBA 7ICKA 1ZQFA 4DO9A 5IIMA 4YD2A 3SV4A 4I29A 5IILA 4DOCA 5DG7A 1NKEA 2XGQA 5J29A 4R8UA 1MQ3A 1ZQAA 5DBAA 5J2AA 1T4GA 1PX5A 3RJFA 2XO7A 4JK1A 3TFSA 4GLXA 3QZ7A 1ZQQA 2C28A 4F5NA 5KFFA 1KTQA 4LVSA 1RYRA 4R65A 3V72A 8ICEA 3FYHA 1B22A 1NKCA 1QLNA 1UETA 2ZH2A 3Q8QB 1Z00A 4O3PA 2ASLA 5DB9A 1HUOA 9ICHA 2W9CA 4F4KA 4AT8B 9ICFA 2ZH4A 2BDPA 4I2JA 2ASDA 1JQRA 3RAXA 2DVIA 4RPZA 2Y1JA 3Q8RB 4QWBA 4RNNA 2NRTA 3ISBA 2BKEA 2C22A 1BPZA 2P66A 4K4IA 2ID1A 1NJZA 1DGSA 1XS9D 4ECQA 5CP2A 1KFSA 1BPBA 2PXIA 4ED3A 8ICSA 4X4VA 1T3NA 4X4PA 5HRIA 3B0YA 4UBCA 2VA2A 5KFQA 5DBBA 5J0UA 3BDPA 4KLHA 2NRVA 1QSSA 1NKBA 3UQ2A 4ECRA 2NRZA 3V6JA 2IHMA 1MC8A 1TK8A 2R8KA 1ZQXA 8ICLA 1K1QA 1PZNA 3OHBA 1N56A 4PHDA 4IRCA 3PW5A 3N4MB 4GXJA 4NLGA 5D49A 1KLNA 4R63A 3QEAZ 1U48A 2BCQA 2HVIA 4PGYA 4UB5A 4J9MA 4PHPA 4UB2A 4FO6A 3V6KA 3PX0A 3RR8A 4CCHA 2F1IA 5HNKA 4JWNA 4NM1A 1COOA 3RB3A 2C2EA 2RDJA 3LK9A 4DS4A 1L3VA 1KFTA 2W8LA 3AUOA 8ICHA 3ZDBA 3RJGA 3HJ1A 7ICNA 4ATBA 4DLEA 2BGWA 1S0MA 4KLTA 1JXEA 1ZQNA 4DL3A 4DL7A 2JEIA 5IIIA 4EZ9A 4XRHA 1X9SA 4F5QA 3OV7A 1DK3A 3IHQB 4QZCA 4J9KA 1NZPA 4QZBA 4M9GA 1VFGA 1L3UA 2BQ3A 1H38A 4K4HA 4RU9A 4DFMA 1JN3A 1UA1A 8ICCA 3LWLA 4XUSA 3BQ0A 4WC1A 4DOBA 3Q8LA 2PFPA 3UXPA 5J0XA 7ICEA 2BHNA 2MAXA 9ICOA 8ICVA 1KNYA 3ISDA 4P4PA 5J0PA 3MBYA 4RQ0A 3GIKA 1RXWA 3B0XA 1ZQOA 2XY6A 4NLKA 1ZJMA 5C5JA 3THVA 3UXOA 2DRAA 4WC6A 4MEYA 1D9DA 4F5PA 4ECSA 5KFHA 3TI0A 5KFUA 4YQWA 1U4BA 3V6HA 5J2JA 3K4GA 1TK0A 4MFFA 4KLGA 9ICTA 1NO5A 4WC5A 2AJQA 5KFNA 5KFXA 1D8LA 5KFIA 3JPOA 3M9MB 3Q8MA 4F3OA 4AT7A 4M47A 4NLNA 4F4XA 4TUPA 2AGQA 3E2EA 4DQPA 1WCLA 2JEFA 2P6RA 1S77D 4M9HA 1SKRA 8ICRA 3NYBA 1ZQTA 2HHVA 7ICRA 2FLNA 5KFYA 4DL4A 4KLDA 4IQUA 3ISCA 2PBEA 2HHUA 3PW2A 1Z3EB 3C2MA 5DGBA 4DF4A 3AQMA 4X4RA 3H40A 2W9BB 1XWLA 3MGHA 4F5OA 4Z6CA 3T5HA 2ZTCA 2ZH7A 5IIJA 3TANA 4DFPA 4F2RA 1A76A 4Q45A 2JZBB 2ZJAA 4FS2A 4C8LA 2ZH9A 4C8MA 2C2DA 7ICJA 1ZQKA 4QWAA 2UVVA 3PW4A 5KFAA 4O3OA 2R8JA 3RBEA 7ICUA 1U9LA 5KG7A 4EYIB 4KLOA 4UD4A 1Z00B 2A1JB 5DQGA 3RR7A 3ZDEA 4RQ2A 5KFGA 5DDMA 4WBZA 4ELTA 3T5KA 2MUTB 5CWRA 1SKWA 2HHXA 3TQ1A 4P4MA 1X9WA 5KG4A 4RPYA 1TFWA 3C5FA 3GIJA 3QE9Y 1ZQVA 2KFZA 4BXOB 1ZQWA 4JWMA 5DGAA 3MDCA 1ZQCA 5DEDA 4X0BA 8ICIA 3KTQA 3RAQA 4B9UA 3WFQE 4Z6DA 2ALZA 1R8CA 4EBJA 4O3QA 4RQ6A 1Q79A 2O5AA 4FH5A 3BQ2A 1XSNA 4QZHA 4RQ1A 4NLZA 3EZ5A 4O5CA 4X4SA 4QZGA 2PI4A 7ICQA 4FHVA 4IQTA 3JPSA 2BCUA 4QWEA 5CR0A 4ED2A 1U45A 9ICUA 1S9FA 5EWGA 5HHHA 2ZUBA 4F5RA 2KZMA 5DG9A 3N97B 2O1PA 4S3NA 4RQ3A 3M8SA 4J9OA 3LQCB 1ZQIA 4QW9A 5KFOA 4Q8FA 2ZHAA 4F4ZA 7ICHA 2DPJA 2VANA 4X4NA 1UT8A 4UAWA 2XCPA 3EPGA 4UQGA 4O5EA 1MIYA 7ICSA 1RYSA 4PH5A 2NRXA 4M6WB 5J0YA 3Q8PB 3C1YA 1SZPA 4F50A 5J2HA 3EPIA 4X4TA 2ZH6A 1SL2A 4NKTA 2XC9A 2BPGA 2UVUA 1S0VA 5HRHA 4NM2A 4RT3A 3G6XA 3KHHA 2ISPA 4FHPA 4AT9B 3C1ZA 4X5VA 2GWSA 2BPFA 2XGPA 3EW9A 3HT3A 1ZQEA 2BCSA 2FMQA 5L1LA 5KT6A 4DLGA 2VA3A 4M9LA 5DG8A 2HHPA 3AQLA 3AQKA 7ICMA 4C8KA 4JV1A 3HIYA 5F2VO 2Q0ZX 4PPXA 3OVBA 3KHGA 4LZDA 7ICTA 4JV0A 5KFWA 4JUZA 1BNPA 4XQ7A 3RB0A 8ICZA 3OUYA 4DFKA 4DEZA 5HRLA 3RTVA 3MGIA 3H4BA 1LV5A 4M0AA 3H7IA 1TAUA 2WTFA 4Z6EA 3MFIA 1A77A 2KN7A 3C18A 4KLFA 4I2BA 5HRFA 4LT6A 4KLQA 9ICLA 5EWFA 4KLUA 1S0NA 4YMNA 4EYHB 9ICIA 3GV5B 3SZ2A 9ICEA 2DR9A 1Y88A 4PGXA 5KFVA 4MEXA 4I2IA 4E80A 4F2SA 4O3NA 3OSNA 4KLJA 3RJEA 5KFCA 2W9AA 4FHYA 4DWIA 3RB6A 4NY8A 5DLGA 3AQNA 2BE3A 3KHRA 3H38A 1HUZA 4QWDA 8ICQA 2ZJ8A 5TZVA 4UAZA 1NJYA 2FMSA 2DFLA 4RUCA 5EWEA 1XSLA 2BCVA 1X9MA 3HJ4A 1BNOA 3C5GA 4I2DA 1NK6A 5KFPA 1JIHA 3M8RA 1ZQPA 8ICWA 1N48A 3H4DA 1CUKA 1XO1A 4R66A 3HX0A 4GXIA 4IR1A 2M2WA 1KDHA 7ICOA 2B21A 2ATLA 3PO5A 2M2UA 5CB1A 3HW8A 3H37A 2C2RA 2HHTA 3WFRE 3PO4A 2M2TA 4DSIA 5KFBA 3RJIA 3H8SA 4RQ8A 1KRPA 2UVRA 2NRKA 1DOQA 1UA0A 5DBCA 3RJJA 2KP7A 1FA0A 7ICIA 2DR5A 4LZGA 1TAQA 4QW8A 5J2EA 4JV2A 5HR9A 3UXNA 1TV9A 3T3FA 2FPKA 3GIIA 4F4YA 8ICBA 2F1JA 4XA5A 4ED8A 1JX4A 4I2FA 5J0OA 2KZ3A 1DK2A 9ICMA 3OJSA 1CEZA 5J2CA 4QZIA 1UEVA 1D8YA 5CHGA 1XC9A 1BGXT 2W9MA 5J2KA 3ORYA 5KT3A 1BPEA 3SV3A 1TFYA 4KLIA 1IM4A 3JPRA 3UPQA 4ECUA 3TFRA 5KG2A 4M2YA 1KFDA 9ICGA 4TUQA 7ICLA 3EWAA 5KG1A 2ZUCA 4ECTA 3UPSA 2ZH5A 2R8IA 4ECVA 2M9NA 8ICMA 2BPCA 2FLLA 4KN4A 3RJHA 1ZYQA 4DS5A 3RRGA 1BVSA 4I27A 1YLQA 5HREA 3TAPA 3WFSC 1C7YA 4R8UB 3GQCA 4P2HA 3PX6A 4WC3A 4MF2A 3ETLA 5J0SA 3KHLA 5HRGA 3NTUA 1L3SA 5IIOA 4RT2A 4DL2A 1ZQDA 4FBUA 4RQ5A 5KFJA 2Y1IA 4B9MA 4EZ6A 4DOAA 4DL5A 4R64A 3Q8KA 4WC7A 4YP3A 1ZQJA 4RPXA 3QZ8A 3OVAA 3GILA 3M9OB 1BPXA 4RNMA 3GIMA 2W9CB 3JPNA 3MR6A 3H39A 5DECA 4IG8A 2ZTEA 4G3IA 5DDYA 5KFKA 2V4QA 2VA8A 3RJKA 3JZ0A 3PMLA 4HYKA 1NOMA 1TFRA 1U49A 3C2LA 4Q44A 3BQ1A 5IINA 2DPIA 7ICFA 3TAQA 4IRKA 8ICPA 9ICSA 4Z6FA 3MR2A 3LWMA 4KMUA 5DQHA 2XCAA 1L3TA 3G6YA 9ICXA 4EBKA 3K75D 2FMPA 1MIWA 5D4BA 4O9MA 4TQSA 4FS1A 4B9LA 1K1SA 5KFZA 2ASJA 9ICAA 8ICNA 3T5LA 4DSJA 2HHQA 9ICPA 5DB7A 1S97A 1ZQYA 2ZHBA 1BPDA 1X2IA 5F9LA 2PFQA 4J9RA 2JEGA 4WBYA 3FDSA 3H8WA 5KG0A 2PFNA 4DQIA 2BR0A 5HRKA 4WC2A 4MFAA 2HW3A 4ECZA 1S10A 3T5JA 1D9FA 2BQRA 2V9WA 1R89A 1V9PA 2F1HA 4RNOA 2DR8A 4PGQA 1UEUA 2ISOA 5HRDA 4UB1A 2J6SA 2XY7A 4B9VA 4FBTA 9ICBA 1R8BA 4FHXA 1NK9A 4PHAA 5HC9A 1B43A 2BCRA 3BJYA 4RWNA 5F9NA 1ZJNA 5L1JA 1NK0A 3SYZA 3RB4A 8ICGA 4YCXA 1RXVA 1XSPA 2FPMA 4BWMA 3BQTA 5KG6A 1U47A 4I28A 2KTQA 8ICJA 3GV7B 1VJ7A 4RWQA 1NK8A 3PV8A 4WCWA 4RWOA 5IIKA 3EYZA 2UVWA 9ICRA 2W9BA 3C2KA 4DQRA 3WFPA 3PX4A 4WC4A 5KFLA 3HPOA 3V7KA 4ECYA 3H8JA 1V4AA 4YD1A 4DSLA 3Q8SB 3C23A 2JZBA 2LYHA 5J2DA 2AQ0A 1ZQHA 5J0WA 2PI5A 4O3SA 4KITB 3AU2A 5KTQA 4J9NA 4XQ8A 5J0RA 1TVAA 2A1JA 4QZFA 4UB4A 3ZD9A 3JPTA 3GV8B 2V4RA 2HHWA 4IRDA 3MDAA 3JYYA 4ED7A 1NK7A 2MUTA 4F93B 4KTQA 3C66A 7ICGA 4C8NA 8ICTA 4RUAA 3RH5A 4YMMA 4EBDA 4EEYA 1T7PA 4BXOA 2AGOA 1TKDA 4K4GA 4RZRA 1Q78A 1LB2B 5J2FA 2DRBA 4DL6A 4Q43A 1NK5A 5KT2A 4O0IA 4I2CA 8ICFA 4ECXA 1KSPA 7ICVA 4AT7B 2H5XA 1BPYA 9ICQA 4J9PA 4E7XA 4RQ4A 4WC0A 1ZQRA 2ZUDA 1QTMA 4X4QA 1JXLA 3AU6A 2KZZA 5EOZA 2RFFA 5KFSA 2ZJ5A 2HVHA 1IXRA 1XU4A 4KN7A 2HHSA 1ZQUA 1SKSA 1RPLA 2OWOA 4B9TA 1UT5A 3PR4A 4YR0A 5KFMA 5L1KA 4EBEA 3ZDDA 4KLSA 8ICKA 5DQIA 5DLFA 2IMWP 1ZQSA 4M6WA 4E0DA 3MABA 4F8RA 5KFDA 8ICUA 1EXNA 3RH4A 4AT8A 4TQRA 4J9QA 5KFEA 4IQVA 1SL1A 3ZD8A 4QZ9A 4KLEA 5J0TA 4I2HA 4Q8EA 2J6TA 9ICJA 4FH3A 4ED6A 4AT9A 4MF8A 4NKUA 2AQ4A 4ELUA 5JUMA 4YR3A 5KT4A 3PW0A 2RDIA 4EBCA 2AGPA 1NK4A 1TK5A 4RQ7A 3SI8A 2AU0A 3ZDAA 4UAYA 4GC6A 4KLLA 3RH6A 1MSWD 5BPCA 3JPQA 5J2GA 5L1IA 9ICVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DSK A;  1ARO P;  3H3A A;  4M9N A;  2ZH1 A;  8ICX A;  3V7L A;  3WFO A;  4F92 B;  3GFK B;  2R8H A;  2PFO A;  1RZT A;  5J2B A;  1KEJ A;  3MR5 A;  3PVX A;  1QSL A;  1ZQZ A;  4C8O A;  1OU5 A;  3UQ0 A;  3ZDC A;  3M9N B;  4EP7 A;  4YXJ A;  4P4O A;  4DQQ A;  4BGD A;  4DSF A;  1HJP A;  4UBB A;  1ZET A;  4UB3 A;  5KFT A;  4YFK A;  4M04 A;  4X4O A;  4I2E A;  3OSP A;  5BOM A;  4TUR A;  4ECW A;  4I2G A;  4FHW A;  4M5D A;  3OVS A;  4DF8 A;  3OHA A;  4DQS A;  9ICN A;  1MQ2 A;  2JEJ A;  4IQW A;  4J9L A;  1SL0 A;  4YXM A;  5CJ7 A;  3MR3 A;  3IM1 A;  4J9S A;  4MFC A;  2ZH3 A;  2ZH8 A;  4F91 B;  4I2A A;  5BOL A;  4YR2 A;  2I1Q A;  4YN4 A;  1R8A A;  1JMS A;  3JPP A;  5KG3 A;  2NRW A;  4O5K A;  2M2V A;  1S0O A;  5HRB A;  1NJX A;  1MIV A;  4B9S A;  3HP6 A;  1NJW A;  2W8K A;  2IHN A;  8ICY A;  1F5A A;  3GDX A;  4GXK A;  4ZH4 A;  2Q66 A;  5L9X A;  3RBD A;  2BQU A;  3V7J A;  3RRH A;  3HWT A;  5J2I A;  1WCN A;  2J6U A;  3PY8 A;  4ATB B;  4RWP A;  5KT7 A;  4ED1 A;  1ZQL A;  4QZD A;  1JAJ A;  3L9D A;  4O3R A;  4GC7 A;  4KLM A;  1S76 D;  5KFR A;  5CA7 A;  4DFJ A;  3QEB Z;  2KFN A;  7ICP A;  3TAR A;  9ICW A;  3OJU A;  3OUY B;  4QZ8 A;  4YVZ A;  4ELV A;  1QSY A;  1WOT A;  5HML A;  4X0A A;  4QWC A;  5J0Q A;  3NGD A;  4TUS A;  4YG2 A;  5HP4 A;  3PMN A;  1L5U A;  5DKW A;  4M9J A;  2FPL A;  4X4U A;  4PHE A;  1ZQM A;  4QZA A;  4BDP A;  4ED0 A;  8ICA A;  1T8E A;  5DB6 A;  3PR5 B;  4NXZ A;  2XY5 A;  9ICC A;  2P6U A;  2ZTD A;  4QZE A;  8ICO A;  3PNC A;  9ICK A;  4DSE A;  4IR9 A;  4BWJ A;  3MFH A;  4F4W A;  2FLP A;  3G6V A;  2DR7 A;  4UD5 A;  3LDA A;  4YMO A;  4E8F A;  4B9N A;  3PW7 A;  1ZQG A;  5D46 A;  5KT5 A;  2R8G A;  5KG5 A;  5HHI A;  3C21 A;  3OGU A;  5HMM A;  5DB8 A;  2I9G A;  2IA6 A;  2IBK A;  1ZQB A;  7ICK A;  1ZQF A;  4DO9 A;  5IIM A;  4YD2 A;  3SV4 A;  4I29 A;  5IIL A;  4DOC A;  5DG7 A;  1NKE A;  2XGQ A;  5J29 A;  4R8U A;  1MQ3 A;  1ZQA A;  5DBA A;  5J2A A;  1T4G A;  1PX5 A;  3RJF A;  2XO7 A;  4JK1 A;  3TFS A;  4GLX A;  3QZ7 A;  1ZQQ A;  2C28 A;  4F5N A;  5KFF A;  1KTQ A;  4LVS A;  1RYR A;  4R65 A;  3V72 A;  8ICE A;  3FYH A;  1B22 A;  1NKC A;  1QLN A;  1UET A;  2ZH2 A;  3Q8Q B;  1Z00 A;  4O3P A;  2ASL A;  5DB9 A;  1HUO A;  9ICH A;  2W9C A;  4F4K A;  4AT8 B;  9ICF A;  2ZH4 A;  2BDP A;  4I2J A;  2ASD A;  1JQR A;  3RAX A;  2DVI A;  4RPZ A;  2Y1J A;  3Q8R B;  4QWB A;  4RNN A;  2NRT A;  3ISB A;  2BKE A;  2C22 A;  1BPZ A;  2P66 A;  4K4I A;  2ID1 A;  1NJZ A;  1DGS A;  1XS9 D;  4ECQ A;  5CP2 A;  1KFS A;  1BPB A;  2PXI A;  4ED3 A;  8ICS A;  4X4V A;  1T3N A;  4X4P A;  5HRI A;  3B0Y A;  4UBC A;  2VA2 A;  5KFQ A;  5DBB A;  5J0U A;  3BDP A;  4KLH A;  2NRV A;  1QSS A;  1NKB A;  3UQ2 A;  4ECR A;  2NRZ A;  3V6J A;  2IHM A;  1MC8 A;  1TK8 A;  2R8K A;  1ZQX A;  8ICL A;  1K1Q A;  1PZN A;  3OHB A;  1N56 A;  4PHD A;  4IRC A;  3PW5 A;  3N4M B;  4GXJ A;  4NLG A;  5D49 A;  1KLN A;  4R63 A;  3QEA Z;  1U48 A;  2BCQ A;  2HVI A;  4PGY A;  4UB5 A;  4J9M A;  4PHP A;  4UB2 A;  4FO6 A;  3V6K A;  3PX0 A;  3RR8 A;  4CCH A;  2F1I A;  5HNK A;  4JWN A;  4NM1 A;  1COO A;  3RB3 A;  2C2E A;  2RDJ A;  3LK9 A;  4DS4 A;  1L3V A;  1KFT A;  2W8L A;  3AUO A;  8ICH A;  3ZDB A;  3RJG A;  3HJ1 A;  7ICN A;  4ATB A;  4DLE A;  2BGW A;  1S0M A;  4KLT A;  1JXE A;  1ZQN A;  4DL3 A;  4DL7 A;  2JEI A;  5III A;  4EZ9 A;  4XRH A;  1X9S A;  4F5Q A;  3OV7 A;  1DK3 A;  3IHQ B;  4QZC A;  4J9K A;  1NZP A;  4QZB A;  4M9G A;  1VFG A;  1L3U A;  2BQ3 A;  1H38 A;  4K4H A;  4RU9 A;  4DFM A;  1JN3 A;  1UA1 A;  8ICC A;  3LWL A;  4XUS A;  3BQ0 A;  4WC1 A;  4DOB A;  3Q8L A;  2PFP A;  3UXP A;  5J0X A;  7ICE A;  2BHN A;  2MAX A;  9ICO A;  8ICV A;  1KNY A;  3ISD A;  4P4P A;  5J0P A;  3MBY A;  4RQ0 A;  3GIK A;  1RXW A;  3B0X A;  1ZQO A;  2XY6 A;  4NLK A;  1ZJM A;  5C5J A;  3THV A;  3UXO A;  2DRA A;  4WC6 A;  4MEY A;  1D9D A;  4F5P A;  4ECS A;  5KFH A;  3TI0 A;  5KFU A;  4YQW A;  1U4B A;  3V6H A;  5J2J A;  3K4G A;  1TK0 A;  4MFF A;  4KLG A;  9ICT A;  1NO5 A;  4WC5 A;  2AJQ A;  5KFN A;  5KFX A;  1D8L A;  5KFI A;  3JPO A;  3M9M B;  3Q8M A;  4F3O A;  4AT7 A;  4M47 A;  4NLN A;  4F4X A;  4TUP A;  2AGQ A;  3E2E A;  4DQP A;  1WCL A;  2JEF A;  2P6R A;  1S77 D;  4M9H A;  1SKR A;  8ICR A;  3NYB A;  1ZQT A;  2HHV A;  7ICR A;  2FLN A;  5KFY A;  4DL4 A;  4KLD A;  4IQU A;  3ISC A;  2PBE A;  2HHU A;  3PW2 A;  1Z3E B;  3C2M A;  5DGB A;  4DF4 A;  3AQM A;  4X4R A;  3H40 A;  2W9B B;  1XWL A;  3MGH A;  4F5O A;  4Z6C A;  3T5H A;  2ZTC A;  2ZH7 A;  5IIJ A;  3TAN A;  4DFP A;  4F2R A;  1A76 A;  4Q45 A;  2JZB B;  2ZJA A;  4FS2 A;  4C8L A;  2ZH9 A;  4C8M A;  2C2D A;  7ICJ A;  1ZQK A;  4QWA A;  2UVV A;  3PW4 A;  5KFA A;  4O3O A;  2R8J A;  3RBE A;  7ICU A;  1U9L A;  5KG7 A;  4EYI B;  4KLO A;  4UD4 A;  1Z00 B;  2A1J B;  5DQG A;  3RR7 A;  3ZDE A;  4RQ2 A;  5KFG A;  5DDM A;  4WBZ A;  4ELT A;  3T5K A;  2MUT B;  5CWR A;  1SKW A;  2HHX A;  3TQ1 A;  4P4M A;  1X9W A;  5KG4 A;  4RPY A;  1TFW A;  3C5F A;  3GIJ A;  3QE9 Y;  1ZQV A;  2KFZ A;  4BXO B;  1ZQW A;  4JWM A;  5DGA A;  3MDC A;  1ZQC A;  5DED A;  4X0B A;  8ICI A;  3KTQ A;  3RAQ A;  4B9U A;  3WFQ E;  4Z6D A;  2ALZ A;  1R8C A;  4EBJ A;  4O3Q A;  4RQ6 A;  1Q79 A;  2O5A A;  4FH5 A;  3BQ2 A;  1XSN A;  4QZH A;  4RQ1 A;  4NLZ A;  3EZ5 A;  4O5C A;  4X4S A;  4QZG A;  2PI4 A;  7ICQ A;  4FHV A;  4IQT A;  3JPS A;  2BCU A;  4QWE A;  5CR0 A;  4ED2 A;  1U45 A;  9ICU A;  1S9F A;  5EWG A;  5HHH A;  2ZUB A;  4F5R A;  2KZM A;  5DG9 A;  3N97 B;  2O1P A;  4S3N A;  4RQ3 A;  3M8S A;  4J9O A;  3LQC B;  1ZQI A;  4QW9 A;  5KFO A;  4Q8F A;  2ZHA A;  4F4Z A;  7ICH A;  2DPJ A;  2VAN A;  4X4N A;  1UT8 A;  4UAW A;  2XCP A;  3EPG A;  4UQG A;  4O5E A;  1MIY A;  7ICS A;  1RYS A;  4PH5 A;  2NRX A;  4M6W B;  5J0Y A;  3Q8P B;  3C1Y A;  1SZP A;  4F50 A;  5J2H A;  3EPI A;  4X4T A;  2ZH6 A;  1SL2 A;  4NKT A;  2XC9 A;  2BPG A;  2UVU A;  1S0V A;  5HRH A;  4NM2 A;  4RT3 A;  3G6X A;  3KHH A;  2ISP A;  4FHP A;  4AT9 B;  3C1Z A;  4X5V A;  2GWS A;  2BPF A;  2XGP A;  3EW9 A;  3HT3 A;  1ZQE A;  2BCS A;  2FMQ A;  5L1L A;  5KT6 A;  4DLG A;  2VA3 A;  4M9L A;  5DG8 A;  2HHP A;  3AQL A;  3AQK A;  7ICM A;  4C8K A;  4JV1 A;  3HIY A;  5F2V O;  2Q0Z X;  4PPX A;  3OVB A;  3KHG A;  4LZD A;  7ICT A;  4JV0 A;  5KFW A;  4JUZ A;  1BNP A;  4XQ7 A;  3RB0 A;  8ICZ A;  3OUY A;  4DFK A;  4DEZ A;  5HRL A;  3RTV A;  3MGI A;  3H4B A;  1LV5 A;  4M0A A;  3H7I A;  1TAU A;  2WTF A;  4Z6E A;  3MFI A;  1A77 A;  2KN7 A;  3C18 A;  4KLF A;  4I2B A;  5HRF A;  4LT6 A;  4KLQ A;  9ICL A;  5EWF A;  4KLU A;  1S0N A;  4YMN A;  4EYH B;  9ICI A;  3GV5 B;  3SZ2 A;  9ICE A;  2DR9 A;  1Y88 A;  4PGX A;  5KFV A;  4MEX A;  4I2I A;  4E80 A;  4F2S A;  4O3N A;  3OSN A;  4KLJ A;  3RJE A;  5KFC A;  2W9A A;  4FHY A;  4DWI A;  3RB6 A;  4NY8 A;  5DLG A;  3AQN A;  2BE3 A;  3KHR A;  3H38 A;  1HUZ A;  4QWD A;  8ICQ A;  2ZJ8 A;  5TZV A;  4UAZ A;  1NJY A;  2FMS A;  2DFL A;  4RUC A;  5EWE A;  1XSL A;  2BCV A;  1X9M A;  3HJ4 A;  1BNO A;  3C5G A;  4I2D A;  1NK6 A;  5KFP A;  1JIH A;  3M8R A;  1ZQP A;  8ICW A;  1N48 A;  3H4D A;  1CUK A;  1XO1 A;  4R66 A;  3HX0 A;  4GXI A;  4IR1 A;  2M2W A;  1KDH A;  7ICO A;  2B21 A;  2ATL A;  3PO5 A;  2M2U A;  5CB1 A;  3HW8 A;  3H37 A;  2C2R A;  2HHT A;  3WFR E;  3PO4 A;  2M2T A;  4DSI A;  5KFB A;  3RJI A;  3H8S A;  4RQ8 A;  1KRP A;  2UVR A;  2NRK A;  1DOQ A;  1UA0 A;  5DBC A;  3RJJ A;  2KP7 A;  1FA0 A;  7ICI A;  2DR5 A;  4LZG A;  1TAQ A;  4QW8 A;  5J2E A;  4JV2 A;  5HR9 A;  3UXN A;  1TV9 A;  3T3F A;  2FPK A;  3GII A;  4F4Y A;  8ICB A;  2F1J A;  4XA5 A;  4ED8 A;  1JX4 A;  4I2F A;  5J0O A;  2KZ3 A;  1DK2 A;  9ICM A;  3OJS A;  1CEZ A;  5J2C A;  4QZI A;  1UEV A;  1D8Y A;  5CHG A;  1XC9 A;  1BGX T;  2W9M A;  5J2K A;  3ORY A;  5KT3 A;  1BPE A;  3SV3 A;  1TFY A;  4KLI A;  1IM4 A;  3JPR A;  3UPQ A;  4ECU A;  3TFR A;  5KG2 A;  4M2Y A;  1KFD A;  9ICG A;  4TUQ A;  7ICL A;  3EWA A;  5KG1 A;  2ZUC A;  4ECT A;  3UPS A;  2ZH5 A;  2R8I A;  4ECV A;  2M9N A;  8ICM A;  2BPC A;  2FLL A;  4KN4 A;  3RJH A;  1ZYQ A;  4DS5 A;  3RRG A;  1BVS A;  4I27 A;  1YLQ A;  5HRE A;  3TAP A;  3WFS C;  1C7Y A;  4R8U B;  3GQC A;  4P2H A;  3PX6 A;  4WC3 A;  4MF2 A;  3ETL A;  5J0S A;  3KHL A;  5HRG A;  3NTU A;  1L3S A;  5IIO A;  4RT2 A;  4DL2 A;  1ZQD A;  4FBU A;  4RQ5 A;  5KFJ A;  2Y1I A;  4B9M A;  4EZ6 A;  4DOA A;  4DL5 A;  4R64 A;  3Q8K A;  4WC7 A;  4YP3 A;  1ZQJ A;  4RPX A;  3QZ8 A;  3OVA A;  3GIL A;  3M9O B;  1BPX A;  4RNM A;  3GIM A;  2W9C B;  3JPN A;  3MR6 A;  3H39 A;  5DEC A;  4IG8 A;  2ZTE A;  4G3I A;  5DDY A;  5KFK A;  2V4Q A;  2VA8 A;  3RJK A;  3JZ0 A;  3PML A;  4HYK A;  1NOM A;  1TFR A;  1U49 A;  3C2L A;  4Q44 A;  3BQ1 A;  5IIN A;  2DPI A;  7ICF A;  3TAQ A;  4IRK A;  8ICP A;  9ICS A;  4Z6F A;  3MR2 A;  3LWM A;  4KMU A;  5DQH A;  2XCA A;  1L3T A;  3G6Y A;  9ICX A;  4EBK A;  3K75 D;  2FMP A;  1MIW A;  5D4B A;  4O9M A;  4TQS A;  4FS1 A;  4B9L A;  1K1S A;  5KFZ A;  2ASJ A;  9ICA A;  8ICN A;  3T5L A;  4DSJ A;  2HHQ A;  9ICP A;  5DB7 A;  1S97 A;  1ZQY A;  2ZHB A;  1BPD A;  1X2I A;  5F9L A;  2PFQ A;  4J9R A;  2JEG A;  4WBY A;  3FDS A;  3H8W A;  5KG0 A;  2PFN A;  4DQI A;  2BR0 A;  5HRK A;  4WC2 A;  4MFA A;  2HW3 A;  4ECZ A;  1S10 A;  3T5J A;  1D9F A;  2BQR A;  2V9W A;  1R89 A;  1V9P A;  2F1H A;  4RNO A;  2DR8 A;  4PGQ A;  1UEU A;  2ISO A;  5HRD A;  4UB1 A;  2J6S A;  2XY7 A;  4B9V A;  4FBT A;  9ICB A;  1R8B A;  4FHX A;  1NK9 A;  4PHA A;  5HC9 A;  1B43 A;  2BCR A;  3BJY A;  4RWN A;  5F9N A;  1ZJN A;  5L1J A;  1NK0 A;  3SYZ A;  3RB4 A;  8ICG A;  4YCX A;  1RXV A;  1XSP A;  2FPM A;  4BWM A;  3BQT A;  5KG6 A;  1U47 A;  4I28 A;  2KTQ A;  8ICJ A;  3GV7 B;  1VJ7 A;  4RWQ A;  1NK8 A;  3PV8 A;  4WCW A;  4RWO A;  5IIK A;  3EYZ A;  2UVW A;  9ICR A;  2W9B A;  3C2K A;  4DQR A;  3WFP A;  3PX4 A;  4WC4 A;  5KFL A;  3HPO A;  3V7K A;  4ECY A;  3H8J A;  1V4A A;  4YD1 A;  4DSL A;  3Q8S B;  3C23 A;  2JZB A;  2LYH A;  5J2D A;  2AQ0 A;  1ZQH A;  5J0W A;  2PI5 A;  4O3S A;  4KIT B;  3AU2 A;  5KTQ A;  4J9N A;  4XQ8 A;  5J0R A;  1TVA A;  2A1J A;  4QZF A;  4UB4 A;  3ZD9 A;  3JPT A;  3GV8 B;  2V4R A;  2HHW A;  4IRD A;  3MDA A;  3JYY A;  4ED7 A;  1NK7 A;  2MUT A;  4F93 B;  4KTQ A;  3C66 A;  7ICG A;  4C8N A;  8ICT A;  4RUA A;  3RH5 A;  4YMM A;  4EBD A;  4EEY A;  1T7P A;  4BXO A;  2AGO A;  1TKD A;  4K4G A;  4RZR A;  1Q78 A;  1LB2 B;  5J2F A;  2DRB A;  4DL6 A;  4Q43 A;  1NK5 A;  5KT2 A;  4O0I A;  4I2C A;  8ICF A;  4ECX A;  1KSP A;  7ICV A;  4AT7 B;  2H5X A;  1BPY A;  9ICQ A;  4J9P A;  4E7X A;  4RQ4 A;  4WC0 A;  1ZQR A;  2ZUD A;  1QTM A;  4X4Q A;  1JXL A;  3AU6 A;  2KZZ A;  5EOZ A;  2RFF A;  5KFS A;  2ZJ5 A;  2HVH A;  1IXR A;  1XU4 A;  4KN7 A;  2HHS A;  1ZQU A;  1SKS A;  1RPL A;  2OWO A;  4B9T A;  1UT5 A;  3PR4 A;  4YR0 A;  5KFM A;  5L1K A;  4EBE A;  3ZDD A;  4KLS A;  8ICK A;  5DQI A;  5DLF A;  2IMW P;  1ZQS A;  4M6W A;  4E0D A;  3MAB A;  4F8R A;  5KFD A;  8ICU A;  1EXN A;  3RH4 A;  4AT8 A;  4TQR A;  4J9Q A;  5KFE A;  4IQV A;  1SL1 A;  3ZD8 A;  4QZ9 A;  4KLE A;  5J0T A;  4I2H A;  4Q8E A;  2J6T A;  9ICJ A;  4FH3 A;  4ED6 A;  4AT9 A;  4MF8 A;  4NKU A;  2AQ4 A;  4ELU A;  5JUM A;  4YR3 A;  5KT4 A;  3PW0 A;  2RDI A;  4EBC A;  2AGP A;  1NK4 A;  1TK5 A;  4RQ7 A;  3SI8 A;  2AU0 A;  3ZDA A;  4UAY A;  4GC6 A;  4KLL A;  3RH6 A;  1MSW D;  5BPC A;  3JPQ A;  5J2G A;  5L1I A;  9ICV A; 
#chains in the Genus database with same CATH topology
 1ARO P;  2LPE A;  1SV0 C;  8ICX A;  3WFO A;  1RZT A;  4WQL A;  4C8O A;  3MR5 A;  1QSL A;  2YTU A;  3M9N B;  4DSF A;  1HJP A;  3NVW A;  4UB3 A;  5KFT A;  1ZET A;  2ZIW B;  4DCC A;  4QNL A;  4I2G A;  4FHW A;  3OHA A;  1JUD A;  4DQS A;  2DKZ A;  3MR3 A;  4J9S A;  4I2A A;  5HR6 A;  4OCZ A;  4O5K A;  8ICY A;  3GDX A;  3ONN A;  2BQU A;  2JR5 A;  2J6U A;  1WCN A;  4ATB B;  3WKE A;  3L9D A;  1ZQL A;  5ALN A;  1QQ6 A;  4O3R A;  5CA7 A;  4DFJ A;  2KFN A;  3QEB Z;  3TAR A;  2EDU A;  5AM4 A;  1WOT A;  5ALT A;  4QWC A;  5J0Q A;  2LBO A;  4YG2 A;  5AKG A;  4X4U A;  2VJ5 A;  1LKY A;  5DB6 A;  5EE9 A;  4NXZ A;  8ICO A;  4DSE A;  1X6I A;  3MFH A;  2CRX A;  2DR7 A;  4YMO A;  4E8F A;  4B9N A;  1ZQG A;  2KJ8 A;  2R8G A;  1Q8K A;  3OV7 A;  2IBK A;  2IA6 A;  1ZQB A;  4DO9 A;  3SV4 A;  5DG7 A;  5J29 A;  1ZQA A;  1XO0 A;  2EAN A;  1KL9 A;  2C28 A;  5KFF A;  2KVS A;  8ICE A;  2ZH2 A;  3QX7 A;  3Q8Q B;  1Z00 A;  2K4H A;  2LMR A;  2HOQ A;  5L1M A;  2DVI A;  3Q8R B;  2BKE A;  1BPZ A;  1L8O A;  1NJZ A;  3U26 A;  2HMX A;  5AHX A;  4UBC A;  2VA2 A;  4KLH A;  2NRV A;  1NKB A;  1QCK A;  3VC8 A;  1TK8 A;  2R8K A;  1ZQX A;  3PW5 A;  3N4M B;  1U48 A;  5KAF U;  2Y9U A;  4F4K A;  4J9M A;  2F1I A;  1VDV A;  4Y2J A;  2RLT A;  3WKC A;  1SV4 A;  4DS4 A;  2K4I A;  1KFT A;  2DWQ A;  3AUO A;  5ALR A;  4DLE A;  4KLT A;  5FP0 A;  2KIC A;  2BQ3 A;  2NV3 A;  4RU9 A;  5J8Y C;  4DFM A;  3BQ0 A;  2MAX A;  3ISD A;  2HOI A;  4P4P A;  3B0X A;  1ZJM A;  1L8L A;  1F0M A;  2KJ9 A;  3TI0 A;  1U4B A;  3V6H A;  4JB3 A;  9ICT A;  4WC5 A;  5KFN A;  1SZH A;  1D8L A;  3Q8M A;  2GOL A;  4K9A A;  3LVW A;  4Y2S A;  4CE6 A;  3M6K A;  2OEH A;  7ICR A;  2FLN A;  3ERC C;  2PBE A;  2HHU A;  2AH5 A;  4RQM A;  1KKX A;  2ZTC A;  1ZRN A;  4DFP A;  2ZJA A;  2ZH9 A;  2K60 A;  2C2D A;  7ICJ A;  1O08 A;  4Y2U A;  4KLO A;  4EGW A;  5CEH A;  3OWG A;  1Z00 B;  3RR7 A;  4WQK A;  2KG5 A;  5KFG A;  5DDM A;  1SWV A;  3TAD A;  2MUT B;  5CWR A;  3T5K A;  3TQ1 A;  1P7D A;  2ZG6 A;  3GIJ A;  4BXO B;  1ZQW A;  4C4S A;  3KTQ A;  2EZZ A;  4OJ5 A;  3BQ2 A;  2PI4 A;  7ICQ A;  5ALM A;  2K8A A;  1ZD3 A;  2BDU A;  3GU3 A;  3IN5 A;  3LVV A;  2KZM A;  4Y2V A;  4S3N A;  3N97 B;  1V85 A;  2YQE A;  1RG6 A;  5KAI U;  5KFO A;  4Q8F A;  2XCP A;  3DDH A;  3EPG A;  4UQG A;  5KL8 B;  4HAI A;  7ICS A;  3AN1 A;  4M6W B;  3KOO A;  5J0Y A;  1SL2 A;  2BPG A;  2UVU A;  3C1Z A;  5AKX A;  4F72 A;  2BCS A;  5L1L A;  4E7X A;  5DG8 A;  2YY6 A;  7ICM A;  4PPX A;  2KD1 A;  5KFW A;  5AI9 A;  2F44 A;  1N61 A;  4M0A A;  1Z1V A;  1WWV A;  9ICI A;  4EYH B;  4N7R A;  1Y88 A;  3OSN A;  5KFC A;  1A0P A;  4US8 A;  4QWD A;  3BQ7 A;  2DFL A;  1XSL A;  2JH7 A;  1VLB A;  3TKA A;  1NK6 A;  3M8R A;  4XJE A;  2D6F C;  8ICW A;  1CUK A;  1XO1 A;  3HX0 A;  1X40 A;  3WK8 A;  5AKI A;  1ZOL A;  2KNJ A;  2EH9 A;  1DOQ A;  2DR5 A;  3RJJ A;  4QW8 A;  1TV9 A;  3GII A;  4ED8 A;  1PK3 A;  1DK2 A;  9ICM A;  3OJS A;  2AXT U;  1CEZ A;  5CHG A;  4CRX A;  3WK6 A;  5J2K A;  3SV3 A;  1TFY A;  3QUT A;  2Y9T A;  4OJL A;  4KLI A;  5KG2 A;  2YMQ A;  2ZUC A;  1RDF A;  4ECT A;  2R8I A;  4ECV A;  2K89 A;  2M9N A;  3AM9 A;  1F5S A;  4DS5 A;  1ZYQ A;  4FZN A;  1YLQ A;  2YB1 A;  1YZ6 A;  1C7Y A;  4R8U B;  4P2H A;  3FC4 A;  3ETL A;  3NTU A;  4FBU A;  4DOA A;  4WC7 A;  1WUD A;  3JCF A;  3QZ8 A;  3DEE A;  1NZB A;  3NVY A;  3H39 A;  4IG8 A;  4G3I A;  2H3I A;  3JZ0 A;  4HYK A;  1NOM A;  4Q44 A;  3BQ1 A;  9ICS A;  3TAQ A;  4Z6F A;  2XCA A;  3G6Y A;  1UHU A;  2FMP A;  1MIW A;  4JMU A;  1L7M A;  8ICN A;  3T5L A;  2HHQ A;  3NRW A;  2ZHB A;  5AM5 A;  2KSO A;  5F9L A;  1S8O A;  3A0H U;  1DRG A;  1IIP A;  3M1Y A;  4ECZ A;  1D9F A;  2V9W A;  1N63 A;  1F44 A;  4MHV A;  4FBT A;  1R8B A;  1NK9 A;  4PHA A;  2LM4 A;  2BCR A;  2JV3 A;  3NKU A;  5G5H A;  4YCX A;  1XSP A;  2FPM A;  8ICJ A;  1U47 A;  3GV7 B;  4WCW A;  4RWO A;  9ICR A;  2UVW A;  3WFP A;  4U7C A;  3HPO A;  3V7K A;  2LYH A;  5ALQ A;  2AQ0 A;  4O3S A;  5J0R A;  1TVA A;  4QZF A;  3GV8 B;  3MDA A;  3JYY A;  1NK7 A;  4F93 B;  2F77 X;  2K4E A;  7ICG A;  4RUA A;  2OM6 A;  4K4G A;  4YMM A;  1T7P A;  1TKD A;  3L5K A;  5AK6 A;  5J2F A;  2DRB A;  1GO3 F;  2ZIX B;  5KT2 A;  4I2C A;  4AT7 B;  2WF6 A;  4K97 A;  3BZC A;  3MGV A;  9ICQ A;  5KFS A;  4A8E A;  2ZJ5 A;  2IOF K;  2WB1 C;  1RPL A;  2OWO A;  3PR4 A;  4YR0 A;  5L1K A;  4KLS A;  5DLF A;  1ZQS A;  2KHQ A;  4E0D A;  1HEK A;  4F8R A;  5KFD A;  3RH4 A;  2G06 A;  5KFE A;  2GAF D;  4QZ9 A;  4MF8 A;  4NKU A;  4KB6 A;  5E79 U;  2RDI A;  2AGP A;  3ZDA A;  1NK4 A;  4KLL A;  4X0A A;  3C28 A;  2AU0 A;  3JPQ A;  5ALK A;  3H3A A;  2R18 A;  4M9N A;  4O68 A;  3GFK B;  2PFO A;  2EWR A;  2HN1 A;  3QU2 A;  1TE2 A;  1KEJ A;  1ZQZ A;  1Z4N A;  4YXJ A;  2YX8 A;  4P4O A;  4DQQ A;  4M04 A;  4YFK A;  4X4O A;  2WF5 A;  1B4F A;  4TUR A;  3HKZ F;  3UMC A;  2RP5 A;  2VKQ A;  2WF7 A;  4C7Y A;  3OVS A;  9ICN A;  4FFD A;  2ZIV A;  4J9L A;  4F71 A;  5CJ7 A;  4F91 B;  5BOL A;  4YR2 A;  1JMS A;  3JPP A;  4WH5 A;  5HRB A;  4P0Q A;  1NJX A;  4B9S A;  3HP6 A;  2HBL A;  2W8K A;  4O67 A;  3EF2 A;  4GXK A;  3RBD A;  3V7J A;  5AI5 A;  5KT7 A;  1JAJ A;  3K7D A;  5HR7 A;  4GC7 A;  5KFR A;  3QUC A;  3OUY B;  4ELV A;  2YML A;  4OAG A;  5HP4 A;  4EX6 A;  2FPL A;  4BDP A;  1A6S A;  2XY5 A;  2P6U A;  2ZTD A;  3SEI A;  3PNC A;  2NO4 A;  9ICK A;  4IR9 A;  4UD5 A;  2FI1 A;  5D46 A;  5KT5 A;  5HC9 A;  3OGU A;  7ICK A;  5DB8 A;  5IIM A;  4YD2 A;  4DOC A;  3D2Q A;  1RYU A;  4GLX A;  3AQF A;  5K4L A;  1L7P A;  1RYR A;  4R65 A;  3FYH A;  1NKC A;  1UET A;  1JRP A;  5DB9 A;  9ICH A;  2ZH4 A;  2BBJ A;  4I2J A;  1Z1B A;  5C0Y A;  2Y1J A;  4QWB A;  1SXE A;  2C22 A;  1XS9 D;  4ECQ A;  4Y2Q A;  1NNL A;  1OXJ A;  4X4P A;  4DFD A;  5HRI A;  3B0Y A;  5DBB A;  1L7N A;  2NRZ A;  2EQY A;  2IHM A;  4UAS A;  1K1Q A;  1N56 A;  3OHB A;  4PHD A;  4GXJ A;  4NLG A;  3QEA Z;  2HVI A;  3MCR A;  4PGY A;  4FO6 A;  3AQE A;  4CCH A;  1NO5 A;  4JWN A;  5HNK A;  2G07 A;  3RB3 A;  5AIA A;  1JI7 A;  1FO4 A;  2DQN B;  8ICH A;  1ZXI A;  3ZDB A;  7ICN A;  2H3V A;  2PMZ F;  1X9S A;  1V38 A;  1XNS A;  1DK3 A;  3IHQ B;  4QZC A;  4FZM A;  1VFG A;  2BZF A;  5AI0 A;  4K4H A;  3FAH A;  5JU5 A;  1UA1 A;  2KEY A;  4XUS A;  3Q8L A;  2PFP A;  3UXP A;  3BS7 A;  3E58 A;  5J0X A;  2BHN A;  7ICE A;  1KNY A;  8ICV A;  2QAR B;  3GIK A;  3MBY A;  1ZQO A;  5C5J A;  3THV A;  2E5S A;  2A1A A;  3D2N A;  5KFH A;  4YQW A;  2HBJ A;  5KFX A;  3M9M B;  4TUP A;  4M9H A;  5CFT A;  8ICR A;  1ZQT A;  3J81 j;  5KFY A;  4DL4 A;  4KLD A;  4IQU A;  3N28 A;  3ISC A;  1Z3E B;  3C2M A;  5DGB A;  3AQM A;  4X4R A;  4Z6C A;  4EEB A;  2ZH7 A;  5IIJ A;  4F2R A;  3IG8 A;  4OJO A;  1ZRM A;  4C8M A;  5AKY A;  2R8J A;  1U9L A;  2A1J B;  1QH9 A;  3ZDE A;  4RQ2 A;  4WBZ A;  2XIC A;  2Z7J A;  1SKW A;  4CNQ A;  1TFW A;  2KFZ A;  2IOF A;  3NUQ A;  4JWM A;  5DGA A;  3MDC A;  4X0B A;  3C29 A;  3RAQ A;  2E8O A;  4Z6D A;  4RQ1 A;  4X4S A;  2HBM A;  3TAD C;  4QZG A;  3F2B A;  4FHV A;  2KKP A;  2KOB A;  2H3F A;  4IQT A;  5CR0 A;  4ED2 A;  1U45 A;  4Y2T A;  5EWG A;  3EUB 2;  4F5R A;  4RQ3 A;  3M8S A;  3ZI4 A;  4QW9 A;  3SD7 A;  7ICH A;  2DPJ A;  2FCL A;  4C80 A;  4PH5 A;  3Q8P B;  4UAV A;  4F50 A;  2ZIU A;  5J2H A;  1V97 A;  4NKT A;  4U6P A;  1AQ6 A;  3G6X A;  2ISP A;  5AM3 A;  5AK5 A;  2GWS A;  2BPF A;  4OO1 J;  2LYB A;  3HT3 A;  3AQL A;  4DLG A;  3AQK A;  4QJF B;  3M7D A;  3OVB A;  1Q3V A;  7ICT A;  4KX3 A;  1Q3U A;  2W3S A;  4DEZ A;  4DFK A;  5HRL A;  3MGI A;  1LV5 A;  3H0R B;  3IG5 A;  4Z6E A;  4QIW C;  3C18 A;  4KLF A;  5HRF A;  4LT6 A;  2E8M A;  5ALH A;  9ICL A;  3ALR A;  3GV5 B;  3SZ2 A;  9ICE A;  4PGX A;  5KFV A;  4MEX A;  4I2I A;  3DV9 A;  4FHY A;  2BE3 A;  1UQV A;  3KHR A;  3H38 A;  1HUZ A;  8ICQ A;  4UAZ A;  3NWI A;  1T3Q A;  3C5G A;  4I2D A;  4CDG A;  1JIH A;  5KFP A;  4NXX A;  2EZX A;  2KJ5 A;  3CW2 C;  7ICO A;  2ATL A;  4HX0 A;  3HW8 A;  2C2R A;  2HHT A;  3L4P A;  3NRZ A;  3WK5 A;  5KFB A;  1KRP A;  4RQ8 A;  2UVR A;  1FA0 A;  2KP7 A;  4PJ0 U;  2LI6 A;  5HR9 A;  5J2E A;  4JV2 A;  3GZF A;  5B3P A;  8ICB A;  2F1J A;  4I2F A;  5J0O A;  2KZ3 A;  4JLX A;  4QZI A;  1LKY B;  1XC9 A;  1BGX T;  3WKD A;  3ER8 C;  1BPE A;  1YZ7 A;  4LEW A;  1N2X A;  3F5A A;  1IM4 A;  3JPR A;  3TFR A;  1KFD A;  9ICG A;  4TUQ A;  7ICL A;  3EWA A;  3UPS A;  2ZH5 A;  3D2S A;  8ICM A;  2BPC A;  3F53 A;  2W54 A;  1BVS A;  5CFU A;  4CGZ A;  3PX6 A;  4MF2 A;  5J0S A;  3KHL A;  2ODG A;  1L3S A;  5IIO A;  1ZQD A;  3KZX A;  3ER9 B;  2Y1I A;  5KFJ A;  4DL5 A;  1UCV A;  4R64 A;  4PL1 A;  2F8K A;  3OVA A;  3M9O B;  1BPX A;  2EAM A;  3GIM A;  3IP4 B;  1FIQ A;  3JPN A;  2WF8 A;  2D8C A;  2VA8 A;  3PML A;  1U49 A;  3C2L A;  3PHZ A;  5AKZ A;  3MR2 A;  4KMU A;  2XID A;  4US9 A;  4LEV A;  4QIW F;  4FS1 A;  4B9L A;  4Y2R A;  5KFZ A;  2ASJ A;  9ICP A;  3PSF A;  1ZQY A;  1BPD A;  1X2I A;  1RM6 C;  4J9R A;  3FDS A;  3H8W A;  2N1R A;  2HDO A;  2PFN A;  3LYS A;  2BR0 A;  4DQI A;  1IG6 A;  3T5J A;  2BQR A;  4AYB F;  1R89 A;  4UB1 A;  9ICB A;  2IHO A;  5L1J A;  1NK0 A;  3RB4 A;  8ICP A;  2G5H B;  3PV8 A;  2L5Y A;  2W9B A;  3HRD D;  1QQ5 A;  1HIW A;  2JZB A;  2PI5 A;  5ALF A;  2VJ4 A;  4K98 A;  4P0P A;  5KTQ A;  2CPR A;  4XQ8 A;  2JMG A;  4IRD A;  2KE7 A;  3RH5 A;  4EEY A;  2AGO A;  4EED A;  5AKK A;  3NS1 A;  1NK5 A;  8ICF A;  4RQN A;  2H5X A;  2DF4 B;  4RQ4 A;  1ZQR A;  2F76 X;  1QTM A;  3UMG A;  3SAF A;  5EOZ A;  2A19 A;  5H2F U;  4KN7 A;  1MN8 A;  4EX7 A;  5DQI A;  2F3N A;  3MAB A;  5B3Q A;  4IL6 U;  1FEZ A;  4AT9 A;  4ED6 A;  5GTI U;  2KV2 A;  5KT4 A;  3BZK A;  1J97 A;  1TK5 A;  4RQ7 A;  3SI8 A;  4UAY A;  5J2G A;  5B5E U;  4DSK A;  2ZH1 A;  5KNI A;  3V7L A;  5JTI A;  1WYG A;  2R8H A;  3RFA A;  1OU5 A;  3UQ0 A;  4EP7 A;  4UBB A;  2W11 A;  1FFV A;  3OSP A;  5BOM A;  3UMB A;  4ECW A;  5ALS A;  2QB1 A;  4DF8 A;  1MQ2 A;  2JEJ A;  3KFU F;  2G0A A;  4ACO A;  2H3Z A;  4MFC A;  3IM1 A;  2ZH3 A;  2E1F A;  1R8A A;  4EEL A;  5KG3 A;  2NRW A;  2M2V A;  1S0O A;  3QU4 A;  2I5H A;  1N5W A;  1L7O A;  2IHN A;  1F5A A;  4ZH4 A;  5L9X A;  1OUQ A;  3HWT A;  5J2I A;  4ED1 A;  2YMP A;  3QU9 A;  2BBH A;  1S76 D;  9ICW A;  3OJU A;  4P0P B;  4QZ8 A;  4YVZ A;  1O03 A;  1M6Y A;  5HML A;  4TUS A;  3PMN A;  4PHE A;  3RF9 A;  2E1E A;  4QZA A;  1ZQM A;  8ICA A;  4ED0 A;  2K4P A;  1L6N A;  3M6Z A;  3HKZ C;  4BWJ A;  5ALV A;  4F4W A;  2FLP A;  3G6V A;  2W03 A;  4JLZ A;  3C21 A;  2I9G A;  5HMM A;  1ZQF A;  4I29 A;  2XGQ A;  5DBA A;  1PX5 A;  3RJF A;  3TFS A;  3WK7 A;  3QZ7 A;  1ZQQ A;  1X66 A;  4LVS A;  1KTQ A;  3V72 A;  1QLN A;  5ALX A;  2ASL A;  5ALI A;  1WG8 A;  1HUO A;  2W9C A;  2BDP A;  2ASD A;  3RAX A;  2DKX A;  4RNN A;  2NRT A;  3ISB A;  2ID1 A;  4K4I A;  3F2C A;  1DGS A;  3CP8 A;  1BPB A;  8ICS A;  1K5O A;  4X4V A;  4OJ6 A;  1T3N A;  1D8B A;  5AI4 A;  5KFQ A;  3BDP A;  3V6J A;  3SR6 A;  1MC8 A;  3CNH A;  1PZN A;  3WK9 A;  4IRC A;  5D49 A;  4UB5 A;  3PX0 A;  4PHP A;  3RR8 A;  2C2E A;  4IS7 A;  3LK9 A;  3AL0 B;  3RJG A;  3HJ1 A;  3F5E A;  2BGW A;  3QNM A;  1S0M A;  1JXE A;  1ZQN A;  2HBK A;  5III A;  4EZ9 A;  5A0L A;  3ICX A;  4Y2P A;  4EEN A;  5CRX A;  4UAT A;  2W55 A;  4CF5 A;  2OHF A;  2H3Q A;  5D62 A;  3KBB A;  4WC1 A;  3AMZ A;  9ICO A;  1RXW A;  4RQ0 A;  1KW4 A;  4WC6 A;  2KSO B;  2RQ5 A;  4NXV A;  1D9D A;  4ECS A;  3N7S C;  1ZD2 P;  5KFI A;  3JPO A;  2QKQ A;  4NLN A;  3E2E A;  3PSI A;  1WCL A;  3NYB A;  2HHV A;  2ZXI A;  2O6K A;  3PW2 A;  3N7P D;  4DF4 A;  4FO1 A;  2PMZ C;  2HI0 A;  1A76 A;  4FS2 A;  4QWA A;  2UVV A;  3PW4 A;  7ICU A;  1PK1 A;  3RBE A;  5EE3 A;  3BS5 A;  5DQG A;  1SWW A;  2W7P A;  5EE0 A;  3R9K A;  2HHX A;  4P4M A;  5KG4 A;  2W04 A;  4RPY A;  3C5F A;  3QE9 Y;  1ZQV A;  2KHV A;  1ZQC A;  8ICI A;  4B9U A;  3WFQ E;  5G5G A;  2DUY A;  1R8C A;  4O3Q A;  4RQ6 A;  3L3F X;  1XSN A;  4QZH A;  4NLZ A;  5AKJ A;  4O5C A;  1KQQ A;  2G09 A;  3NVO A;  3JPS A;  3QXG A;  4QWE A;  2GA9 D;  5AKE A;  5AM1 A;  1S9F A;  2ZUB A;  2O1P A;  5DG9 A;  4J9O A;  1ZQI A;  2ZHA A;  5ALO A;  1UT8 A;  4UAW A;  1QQ7 A;  1RYS A;  2NRX A;  5ALZ A;  2ZH6 A;  5ALG A;  1S0V A;  4RT3 A;  3KHH A;  4FHP A;  1PVQ A;  2RRD A;  4X5V A;  2XGP A;  3EW9 A;  1ZQE A;  2JH1 A;  4M9L A;  1MA7 A;  5KT6 A;  1LVH A;  4ATB A;  5JTG A;  2ES6 A;  2MRL A;  4LZD A;  4USA A;  4JUZ A;  3MC1 A;  1BNP A;  3RB0 A;  2LHT A;  4K99 A;  2K8C B;  2B56 A;  3RTV A;  1TAU A;  3UM9 A;  2ESE A;  2WTF A;  2JRZ A;  3MFI A;  2KN7 A;  4I2B A;  4KLQ A;  5EWF A;  4YMN A;  2HN2 A;  4E80 A;  4KLJ A;  3RJE A;  3O0F A;  5DLG A;  2ZIV B;  2ZJ8 A;  5TZV A;  3NVZ A;  1NJY A;  4RUC A;  2BCV A;  5JRT A;  4P0Q B;  2CN1 A;  2YB4 A;  4R66 A;  2M2W A;  4GXI A;  4IR1 A;  3KKA A;  2B21 A;  2M2U A;  5CB1 A;  4OAI Z;  3H0L B;  5T14 A;  3PO4 A;  4DSI A;  2NRK A;  1UA0 A;  5DBC A;  5D61 A;  2MSN A;  3T3F A;  4XA5 A;  1JX4 A;  4BJQ A;  4C0Z A;  4Y2X A;  1UEV A;  2JXJ A;  5TIS U;  1JRO A;  1N5X A;  2FJ6 A;  2JGA A;  5KT3 A;  3ORY A;  3UPQ A;  4M2Y A;  3QU5 A;  3PZP A;  3QYP A;  5KG1 A;  2FLL A;  3A0B U;  3H0M B;  3RRG A;  2WAQ C;  5HRE A;  2WFA A;  3WFS C;  5AM0 A;  5HRG A;  3QU7 A;  4FZL A;  4PZO A;  4B9M A;  3CYM A;  4WOY A;  2OCE A;  3GIL A;  4RNM A;  2ZTE A;  4NV0 A;  5KFK A;  2V4Q A;  3QUQ A;  1TFR A;  5AIB A;  2DPI A;  3PST A;  1L3T A;  5DQH A;  4EBK A;  9ICX A;  1RQL A;  3K75 D;  5D4B A;  4O6A A;  1K1S A;  1X42 A;  4DSJ A;  2D3D A;  5DB7 A;  1S97 A;  2PFQ A;  2JEG A;  5KG0 A;  4WC2 A;  4MFA A;  5KL1 B;  3WKB A;  2HW3 A;  1V9P A;  1UEU A;  2ISO A;  4OAF A;  2J6S A;  4PZN A;  4NWI A;  1WWU A;  1B43 A;  1URJ A;  2W43 A;  1ZJN A;  4RWN A;  8ICG A;  3SYZ A;  1RXV A;  2KTQ A;  4BWM A;  1YT3 A;  3KD3 A;  4I28 A;  1VJ7 A;  4WC3 A;  1JAL A;  3EYZ A;  4WC4 A;  3PX4 A;  4CF4 A;  5KFL A;  4ECY A;  2K8B B;  3H8J A;  4GFJ A;  3Q8S B;  3C23 A;  5J2D A;  1ZQH A;  5J0W A;  4KIT B;  1N62 A;  2MU2 A;  3AU2 A;  4C7Z A;  4NXW A;  3OTQ A;  4UB4 A;  3JPT A;  2V4R A;  2HHW A;  3E0F A;  2OXO A;  4ED7 A;  1C20 A;  2MUT A;  4KTQ A;  3C66 A;  4G9B A;  4C8N A;  4BXO A;  2GH1 A;  5ALJ A;  1Q46 A;  4RZR A;  2Y0S C;  4O0I A;  4ECX A;  1KSP A;  4AYB C;  2PKE A;  4WC0 A;  4EV6 A;  4K96 A;  2ZUD A;  4KM5 A;  1SIJ A;  2WAQ F;  3AU6 A;  3NAS A;  2RFF A;  1IXR A;  1XU4 A;  3CK6 A;  1ZQU A;  1SKS A;  5ALE A;  3ETR A;  4B9T A;  4M6W A;  1KBU A;  1ED1 A;  8ICU A;  5ALU A;  4AT8 A;  4TQR A;  1SV0 A;  5AIC A;  4ELU A;  5JUM A;  4YR3 A;  4OAH A;  3RH6 A;  5BPC A;  3OPX A;  1CRX A;  9ICV A;  2ZXH A;  4F92 B;  4UB6 U;  5J2B A;  3PVX A;  3ZDC A;  2LM1 A;  4BGD A;  2LKY A;  1SGG A;  4NL9 C;  4I2E A;  4LEY A;  2MA1 A;  4OD0 A;  4IQW A;  2DBY A;  1SL0 A;  4YXM A;  2ZH8 A;  2I1Q A;  4YN4 A;  2B4V A;  2ZIU B;  1T94 A;  2P35 A;  1MIV A;  5ALP A;  4KMO B;  1NJW A;  2Q4T A;  5AI6 A;  2Q66 A;  3RRH A;  2HOF A;  4RWP A;  3PY8 A;  4OJP A;  4QZD A;  4KLM A;  3I28 A;  7ICP A;  1QSY A;  2A3V A;  1J2M A;  3NGD A;  4UAU A;  2WF9 A;  1L5U A;  2QLT A;  5DKW A;  4M9J A;  4C4R A;  2Y0S F;  1T8E A;  2F2A B;  3PR5 B;  9ICC A;  4QZE A;  3NVV A;  1CI4 A;  4NJ8 A;  4LJX A;  3LDA A;  1COK A;  3PW7 A;  3CRX A;  5KG5 A;  5HHI A;  2YN4 A;  2GO7 A;  1Q78 A;  5AKL A;  5IIL A;  1NKE A;  2JHD A;  5ALY A;  1MQ3 A;  4R8U A;  5J2A A;  1PVR A;  1T4G A;  2XO7 A;  4JK1 A;  4F5N A;  2WHE A;  1B22 A;  1ZQ1 C;  4O3M A;  4O3P A;  2F8L A;  3I76 A;  4AT8 B;  9ICF A;  4FE3 A;  5GTH U;  1JQR A;  5AKH A;  4RPZ A;  2P66 A;  3IRU A;  5CP2 A;  1KFS A;  2PXI A;  4ED3 A;  5J0U A;  1QSS A;  2G08 A;  3UQ2 A;  4ECR A;  8ICL A;  2XVT A;  1KLN A;  4R63 A;  2BCQ A;  4M5D A;  4UB2 A;  3V6K A;  4NM1 A;  4MKP A;  1COO A;  2RDJ A;  1L3V A;  3WKA A;  3SEN A;  2W8L A;  4AP9 A;  2HSZ A;  5J8Y A;  4C4T A;  1ZD4 A;  4DL3 A;  4DL7 A;  2JEI A;  4XRH A;  4F5Q A;  4IC9 A;  1NZP A;  4J9K A;  5B66 U;  4QZB A;  2OYY A;  1ECW A;  1TAM A;  4NL9 A;  4M9G A;  1L3U A;  1X9X A;  1H38 A;  4EEK A;  3IV6 A;  1JN3 A;  8ICC A;  3LWL A;  4DOB A;  4KX5 A;  5J0P A;  4NLK A;  2XY6 A;  3UXO A;  2DRA A;  4K9B A;  4MEY A;  4F5P A;  5KFU A;  1PUZ A;  1TK0 A;  5J2J A;  3K4G A;  4MFF A;  4NXU A;  2ZIX A;  2AJQ A;  4F3O A;  4AT7 A;  4M47 A;  4F4X A;  2QB0 A;  1PVP A;  1DGJ A;  2AGQ A;  4DQP A;  1ZD5 A;  2JEF A;  2P6R A;  1S77 D;  1SKR A;  2AHO B;  2FE9 A;  3SAG A;  3PSP A;  3H40 A;  2W9B B;  1XWL A;  3MGH A;  4F5O A;  3T5H A;  3TAN A;  2KVC A;  1VJ5 A;  2JZB B;  4Q45 A;  4C8L A;  1ZQK A;  4UAR A;  5KFA A;  4O3O A;  3ED5 A;  4Y2Y A;  5KG7 A;  4EYI B;  4UD4 A;  3S6J A;  4ELT A;  4WJ3 B;  1X9W A;  1GPJ A;  5DED A;  1RQN A;  2ALZ A;  4EBJ A;  4GIB A;  1Q79 A;  2O5A A;  4FH5 A;  3EZ5 A;  2XI9 A;  2BCU A;  9ICU A;  2M0N A;  2EAP A;  5HHH A;  2IUB A;  1SXD A;  3F2D A;  3LQC B;  4X4N A;  4F4Z A;  2VAN A;  1MIY A;  4O5E A;  4B6J A;  2KMD A;  2E8N A;  3C1Y A;  1SZP A;  3K1R B;  3EPI A;  4X4T A;  2XC9 A;  4LEZ A;  5HRH A;  4NM2 A;  4ZOH C;  4AT9 B;  2FMQ A;  2VA3 A;  2HHP A;  2G5I B;  3HIY A;  4C8K A;  4JV1 A;  5F2V O;  2DL0 A;  2Q0Z X;  3KHG A;  4XQ7 A;  4JV0 A;  3OUY A;  8ICZ A;  3K1Z A;  3H4B A;  3H7I A;  1A77 A;  2KIW A;  3HJE A;  4KLU A;  1S0N A;  2EZY A;  2IOH A;  2B0C A;  4F2S A;  4O3N A;  2W9A A;  4DWI A;  2KK0 A;  1KN5 A;  3RB6 A;  1B0X A;  4NY8 A;  3AQN A;  4BX9 C;  2CXY A;  4CF3 A;  5CFS A;  4UB8 U;  2QB0 B;  2FMS A;  5EWE A;  3B9J A;  1X9M A;  3HJ4 A;  3HIL A;  2KIV A;  1BNO A;  2GLE A;  1ZQP A;  2HCF A;  3VCB A;  2W3R A;  3H4D A;  1N48 A;  1KDH A;  3PO5 A;  3H37 A;  3WFR E;  3WK4 A;  2M2T A;  3RJI A;  3H8S A;  7ICI A;  4LZG A;  1TAQ A;  3UXN A;  2FPK A;  4F4Y A;  3FM9 A;  3KKA C;  4NLC A;  5J2C A;  1D8Y A;  5ALD A;  2W9M A;  5EE1 A;  4I0U A;  5CHE A;  2VIX A;  5AM2 A;  5AI8 A;  4ECU A;  4K8V A;  2B51 A;  4NLB A;  2W7O A;  3WU2 U;  2DGZ A;  3KZI U;  2FDR A;  4KN4 A;  1X6J A;  3RJH A;  4I27 A;  3TAP A;  3H8M A;  3GQC A;  2NO5 A;  3D6J A;  1J2N A;  4RT2 A;  4DL2 A;  4RQ5 A;  1Z4O A;  4EZ6 A;  3Q8K A;  4YP3 A;  1ZQJ A;  4RPX A;  2W9C B;  3MR6 A;  5DEC A;  2B6G A;  5DDY A;  3T79 A;  3RJK A;  1DXS A;  3SMV A;  2NYV A;  3SAH A;  5IIN A;  7ICF A;  4IRK A;  3LWM A;  5D63 A;  3QUB A;  2QAR A;  4TQS A;  4O9M A;  9ICA A;  2ZIW A;  5ALL A;  4WBY A;  5AK3 A;  3I1Y A;  5HRK A;  1S10 A;  2I6X A;  2DR8 A;  2F1H A;  4RNO A;  2YMM A;  4PGQ A;  5HRD A;  4B9V A;  2XY7 A;  4FHX A;  1UPH A;  4O69 A;  3BJY A;  2KKV A;  4ICA A;  5F9N A;  2RHF A;  5KG6 A;  3BQT A;  2WB1 F;  3IDW A;  4RWQ A;  1NK8 A;  5IIK A;  1IV8 A;  4DQR A;  3C2K A;  4BUG A;  1V4A A;  4YD1 A;  4DSL A;  4J03 A;  2E8P A;  1SB3 C;  4J9N A;  2A1J A;  1OW5 A;  3N7R C;  3ZD9 A;  4NXT A;  2E3T A;  8ICT A;  1S5L U;  4EBD A;  5ALW A;  1LB2 B;  5AK4 A;  4DL6 A;  4Q43 A;  7ICV A;  1FFU A;  1BPY A;  4J9P A;  1NI3 A;  3AEV A;  2OH2 A;  4X4Q A;  1JXL A;  2KZZ A;  2HVH A;  5F3X B;  2HHS A;  1N60 A;  1UT5 A;  5KFM A;  3ZDD A;  4EBE A;  8ICK A;  2LYA A;  2IMW P;  1EXN A;  4UW9 A;  1Z19 A;  4J9Q A;  4IQV A;  3TAC B;  1SL1 A;  1PK1 B;  3ZD8 A;  4KLE A;  5J0T A;  4I2H A;  4Q8E A;  3BS5 B;  2J6T A;  9ICJ A;  4FH3 A;  2AQ4 A;  2EAO A;  3PW0 A;  4EBC A;  2DR9 A;  1MSW D;  4GC6 A;  3SQI A;  4KLG A;  5L1I A;  4PL2 A; 
#chains in the Genus database with same CATH homology
 4DSK A;  1ARO P;  3H3A A;  4M9N A;  2ZH1 A;  8ICX A;  3V7L A;  3WFO A;  4F92 B;  3GFK B;  2R8H A;  2PFO A;  1RZT A;  5J2B A;  1KEJ A;  3MR5 A;  3PVX A;  1QSL A;  1ZQZ A;  4C8O A;  1OU5 A;  3UQ0 A;  3ZDC A;  3M9N B;  4EP7 A;  4YXJ A;  4P4O A;  4DQQ A;  4BGD A;  4DSF A;  1HJP A;  4UBB A;  1ZET A;  4UB3 A;  5KFT A;  4YFK A;  4M04 A;  4X4O A;  4I2E A;  3OSP A;  5BOM A;  4TUR A;  4ECW A;  4I2G A;  4FHW A;  4M5D A;  3OVS A;  4DF8 A;  3OHA A;  4DQS A;  9ICN A;  1MQ2 A;  2JEJ A;  4IQW A;  4J9L A;  1SL0 A;  4YXM A;  5CJ7 A;  3MR3 A;  3IM1 A;  4J9S A;  4MFC A;  2ZH3 A;  2ZH8 A;  4F91 B;  4I2A A;  5BOL A;  4YR2 A;  2I1Q A;  4YN4 A;  1R8A A;  1JMS A;  3JPP A;  5KG3 A;  2NRW A;  4O5K A;  2M2V A;  1S0O A;  5HRB A;  1NJX A;  1MIV A;  4B9S A;  3HP6 A;  1NJW A;  2W8K A;  2IHN A;  8ICY A;  1F5A A;  3GDX A;  4GXK A;  4ZH4 A;  2Q66 A;  5L9X A;  3RBD A;  2BQU A;  3V7J A;  3RRH A;  3HWT A;  5J2I A;  1WCN A;  2J6U A;  3PY8 A;  4ATB B;  4RWP A;  5KT7 A;  4ED1 A;  1ZQL A;  4QZD A;  1JAJ A;  3L9D A;  4O3R A;  4GC7 A;  4KLM A;  1S76 D;  5KFR A;  5CA7 A;  4DFJ A;  3QEB Z;  2KFN A;  7ICP A;  3TAR A;  9ICW A;  3OJU A;  3OUY B;  4QZ8 A;  4YVZ A;  4ELV A;  1QSY A;  1WOT A;  5HML A;  4X0A A;  4QWC A;  5J0Q A;  3NGD A;  4TUS A;  4YG2 A;  5HP4 A;  3PMN A;  1L5U A;  5DKW A;  4M9J A;  2FPL A;  4X4U A;  4PHE A;  1ZQM A;  4QZA A;  4BDP A;  4ED0 A;  8ICA A;  1T8E A;  5DB6 A;  3PR5 B;  4NXZ A;  2XY5 A;  9ICC A;  2P6U A;  2ZTD A;  4QZE A;  8ICO A;  3PNC A;  9ICK A;  4DSE A;  4IR9 A;  4BWJ A;  3MFH A;  4F4W A;  2FLP A;  3G6V A;  2DR7 A;  4UD5 A;  3LDA A;  4YMO A;  4E8F A;  4B9N A;  3PW7 A;  1ZQG A;  5D46 A;  5KT5 A;  2R8G A;  5KG5 A;  5HHI A;  3C21 A;  3OGU A;  5HMM A;  5DB8 A;  2I9G A;  2IA6 A;  2IBK A;  1ZQB A;  7ICK A;  1ZQF A;  4DO9 A;  5IIM A;  4YD2 A;  3SV4 A;  4I29 A;  5IIL A;  4DOC A;  5DG7 A;  1NKE A;  2XGQ A;  5J29 A;  4R8U A;  1MQ3 A;  1ZQA A;  5DBA A;  5J2A A;  1T4G A;  1PX5 A;  3RJF A;  2XO7 A;  4JK1 A;  3TFS A;  4GLX A;  3QZ7 A;  1ZQQ A;  2C28 A;  4F5N A;  5KFF A;  1KTQ A;  4LVS A;  1RYR A;  4R65 A;  3V72 A;  8ICE A;  3FYH A;  1B22 A;  1NKC A;  1QLN A;  1UET A;  2ZH2 A;  3Q8Q B;  1Z00 A;  4O3P A;  2ASL A;  5DB9 A;  1HUO A;  9ICH A;  2W9C A;  4F4K A;  4AT8 B;  9ICF A;  2ZH4 A;  2BDP A;  4I2J A;  2ASD A;  1JQR A;  3RAX A;  2DVI A;  4RPZ A;  2Y1J A;  3Q8R B;  4QWB A;  4RNN A;  2NRT A;  3ISB A;  2BKE A;  2C22 A;  1BPZ A;  2P66 A;  4K4I A;  2ID1 A;  1NJZ A;  1DGS A;  1XS9 D;  4ECQ A;  5CP2 A;  1KFS A;  1BPB A;  2PXI A;  4ED3 A;  8ICS A;  4X4V A;  1T3N A;  4X4P A;  5HRI A;  3B0Y A;  4UBC A;  2VA2 A;  5KFQ A;  5DBB A;  5J0U A;  3BDP A;  4KLH A;  2NRV A;  1QSS A;  1NKB A;  3UQ2 A;  4ECR A;  2NRZ A;  3V6J A;  2IHM A;  1MC8 A;  1TK8 A;  2R8K A;  1ZQX A;  8ICL A;  1K1Q A;  1PZN A;  3OHB A;  1N56 A;  4PHD A;  4IRC A;  3PW5 A;  3N4M B;  4GXJ A;  4NLG A;  5D49 A;  1KLN A;  4R63 A;  3QEA Z;  1U48 A;  2BCQ A;  2HVI A;  4PGY A;  4UB5 A;  4J9M A;  4PHP A;  4UB2 A;  4FO6 A;  3V6K A;  3PX0 A;  3RR8 A;  4CCH A;  2F1I A;  5HNK A;  4JWN A;  4NM1 A;  1COO A;  3RB3 A;  2C2E A;  2RDJ A;  3LK9 A;  4DS4 A;  1L3V A;  1KFT A;  2W8L A;  3AUO A;  8ICH A;  3ZDB A;  3RJG A;  3HJ1 A;  7ICN A;  4ATB A;  4DLE A;  2BGW A;  1S0M A;  4KLT A;  1JXE A;  1ZQN A;  4DL3 A;  4DL7 A;  2JEI A;  5III A;  4EZ9 A;  4XRH A;  1X9S A;  4F5Q A;  3OV7 A;  1DK3 A;  3IHQ B;  4QZC A;  4J9K A;  1NZP A;  4QZB A;  4M9G A;  1VFG A;  1L3U A;  2BQ3 A;  1H38 A;  4K4H A;  4RU9 A;  4DFM A;  1JN3 A;  1UA1 A;  8ICC A;  3LWL A;  4XUS A;  3BQ0 A;  4WC1 A;  4DOB A;  3Q8L A;  2PFP A;  3UXP A;  5J0X A;  7ICE A;  2BHN A;  2MAX A;  9ICO A;  8ICV A;  1KNY A;  3ISD A;  4P4P A;  5J0P A;  3MBY A;  4RQ0 A;  3GIK A;  1RXW A;  3B0X A;  1ZQO A;  2XY6 A;  4NLK A;  1ZJM A;  5C5J A;  3THV A;  3UXO A;  2DRA A;  4WC6 A;  4MEY A;  1D9D A;  4F5P A;  4ECS A;  5KFH A;  3TI0 A;  5KFU A;  4YQW A;  1U4B A;  3V6H A;  5J2J A;  3K4G A;  1TK0 A;  4MFF A;  4KLG A;  9ICT A;  1NO5 A;  4WC5 A;  2AJQ A;  5KFN A;  5KFX A;  1D8L A;  5KFI A;  3JPO A;  3M9M B;  3Q8M A;  4F3O A;  4AT7 A;  4M47 A;  4NLN A;  4F4X A;  4TUP A;  2AGQ A;  3E2E A;  4DQP A;  1WCL A;  2JEF A;  2P6R A;  1S77 D;  4M9H A;  1SKR A;  8ICR A;  3NYB A;  1ZQT A;  2HHV A;  7ICR A;  2FLN A;  5KFY A;  4DL4 A;  4KLD A;  4IQU A;  3ISC A;  2PBE A;  2HHU A;  3PW2 A;  1Z3E B;  3C2M A;  5DGB A;  4DF4 A;  3AQM A;  4X4R A;  3H40 A;  2W9B B;  1XWL A;  3MGH A;  4F5O A;  4Z6C A;  3T5H A;  2ZTC A;  2ZH7 A;  5IIJ A;  3TAN A;  4DFP A;  4F2R A;  1A76 A;  4Q45 A;  2JZB B;  2ZJA A;  4FS2 A;  4C8L A;  2ZH9 A;  4C8M A;  2C2D A;  7ICJ A;  1ZQK A;  4QWA A;  2UVV A;  3PW4 A;  5KFA A;  4O3O A;  2R8J A;  3RBE A;  7ICU A;  1U9L A;  5KG7 A;  4EYI B;  4KLO A;  4UD4 A;  1Z00 B;  2A1J B;  5DQG A;  3RR7 A;  3ZDE A;  4RQ2 A;  5KFG A;  5DDM A;  4WBZ A;  4ELT A;  3T5K A;  2MUT B;  5CWR A;  1SKW A;  2HHX A;  3TQ1 A;  4P4M A;  1X9W A;  5KG4 A;  4RPY A;  1TFW A;  3C5F A;  3GIJ A;  3QE9 Y;  1ZQV A;  2KFZ A;  4BXO B;  1ZQW A;  4JWM A;  5DGA A;  3MDC A;  1ZQC A;  5DED A;  4X0B A;  8ICI A;  3KTQ A;  3RAQ A;  4B9U A;  3WFQ E;  4Z6D A;  2ALZ A;  1R8C A;  4EBJ A;  4O3Q A;  4RQ6 A;  1Q79 A;  2O5A A;  4FH5 A;  3BQ2 A;  1XSN A;  4QZH A;  4RQ1 A;  4NLZ A;  3EZ5 A;  4O5C A;  4X4S A;  4QZG A;  2PI4 A;  7ICQ A;  4FHV A;  4IQT A;  3JPS A;  2BCU A;  4QWE A;  5CR0 A;  4ED2 A;  1U45 A;  9ICU A;  1S9F A;  5EWG A;  5HHH A;  2ZUB A;  4F5R A;  2KZM A;  5DG9 A;  3N97 B;  2O1P A;  4S3N A;  4RQ3 A;  3M8S A;  4J9O A;  3LQC B;  1ZQI A;  4QW9 A;  5KFO A;  4Q8F A;  2ZHA A;  4F4Z A;  7ICH A;  2DPJ A;  2VAN A;  4X4N A;  1UT8 A;  4UAW A;  2XCP A;  3EPG A;  4UQG A;  4O5E A;  1MIY A;  7ICS A;  1RYS A;  4PH5 A;  2NRX A;  4M6W B;  5J0Y A;  3Q8P B;  3C1Y A;  1SZP A;  4F50 A;  5J2H A;  3EPI A;  4X4T A;  2ZH6 A;  1SL2 A;  4NKT A;  2XC9 A;  2BPG A;  2UVU A;  1S0V A;  5HRH A;  4NM2 A;  4RT3 A;  3G6X A;  3KHH A;  2ISP A;  4FHP A;  4AT9 B;  3C1Z A;  4X5V A;  2GWS A;  2BPF A;  2XGP A;  3EW9 A;  3HT3 A;  1ZQE A;  2BCS A;  2FMQ A;  5L1L A;  5KT6 A;  4DLG A;  2VA3 A;  4M9L A;  5DG8 A;  2HHP A;  3AQL A;  3AQK A;  7ICM A;  4C8K A;  4JV1 A;  3HIY A;  5F2V O;  2Q0Z X;  4PPX A;  3OVB A;  3KHG A;  4LZD A;  7ICT A;  4JV0 A;  5KFW A;  4JUZ A;  1BNP A;  4XQ7 A;  3RB0 A;  8ICZ A;  3OUY A;  4DFK A;  4DEZ A;  5HRL A;  3RTV A;  3MGI A;  3H4B A;  1LV5 A;  4M0A A;  3H7I A;  1TAU A;  2WTF A;  4Z6E A;  3MFI A;  1A77 A;  2KN7 A;  3C18 A;  4KLF A;  4I2B A;  5HRF A;  4LT6 A;  4KLQ A;  9ICL A;  5EWF A;  4KLU A;  1S0N A;  4YMN A;  4EYH B;  9ICI A;  3GV5 B;  3SZ2 A;  9ICE A;  2DR9 A;  1Y88 A;  4PGX A;  5KFV A;  4MEX A;  4I2I A;  4E80 A;  4F2S A;  4O3N A;  3OSN A;  4KLJ A;  3RJE A;  5KFC A;  2W9A A;  4FHY A;  4DWI A;  3RB6 A;  4NY8 A;  5DLG A;  3AQN A;  2BE3 A;  3KHR A;  3H38 A;  1HUZ A;  4QWD A;  8ICQ A;  2ZJ8 A;  5TZV A;  4UAZ A;  1NJY A;  2FMS A;  2DFL A;  4RUC A;  5EWE A;  1XSL A;  2BCV A;  1X9M A;  3HJ4 A;  1BNO A;  3C5G A;  4I2D A;  1NK6 A;  5KFP A;  1JIH A;  3M8R A;  1ZQP A;  8ICW A;  1N48 A;  3H4D A;  1CUK A;  1XO1 A;  4R66 A;  3HX0 A;  4GXI A;  4IR1 A;  2M2W A;  1KDH A;  7ICO A;  2B21 A;  2ATL A;  3PO5 A;  2M2U A;  5CB1 A;  3HW8 A;  3H37 A;  2C2R A;  2HHT A;  3WFR E;  3PO4 A;  2M2T A;  4DSI A;  5KFB A;  3RJI A;  3H8S A;  4RQ8 A;  1KRP A;  2UVR A;  2NRK A;  1DOQ A;  1UA0 A;  5DBC A;  3RJJ A;  2KP7 A;  1FA0 A;  7ICI A;  2DR5 A;  4LZG A;  1TAQ A;  4QW8 A;  5J2E A;  4JV2 A;  5HR9 A;  3UXN A;  1TV9 A;  3T3F A;  2FPK A;  3GII A;  4F4Y A;  8ICB A;  2F1J A;  4XA5 A;  4ED8 A;  1JX4 A;  4I2F A;  5J0O A;  2KZ3 A;  1DK2 A;  9ICM A;  3OJS A;  1CEZ A;  5J2C A;  4QZI A;  1UEV A;  1D8Y A;  5CHG A;  1XC9 A;  1BGX T;  2W9M A;  5J2K A;  3ORY A;  5KT3 A;  1BPE A;  3SV3 A;  1TFY A;  4KLI A;  1IM4 A;  3JPR A;  3UPQ A;  4ECU A;  3TFR A;  5KG2 A;  4M2Y A;  1KFD A;  9ICG A;  4TUQ A;  7ICL A;  3EWA A;  5KG1 A;  2ZUC A;  4ECT A;  3UPS A;  2ZH5 A;  2R8I A;  4ECV A;  2M9N A;  8ICM A;  2BPC A;  2FLL A;  4KN4 A;  3RJH A;  1ZYQ A;  4DS5 A;  3RRG A;  1BVS A;  4I27 A;  1YLQ A;  5HRE A;  3TAP A;  3WFS C;  1C7Y A;  4R8U B;  3GQC A;  4P2H A;  3PX6 A;  4WC3 A;  4MF2 A;  3ETL A;  5J0S A;  3KHL A;  5HRG A;  3NTU A;  1L3S A;  5IIO A;  4RT2 A;  4DL2 A;  1ZQD A;  4FBU A;  4RQ5 A;  5KFJ A;  2Y1I A;  4B9M A;  4EZ6 A;  4DOA A;  4DL5 A;  4R64 A;  3Q8K A;  4WC7 A;  4YP3 A;  1ZQJ A;  4RPX A;  3QZ8 A;  3OVA A;  3GIL A;  3M9O B;  1BPX A;  4RNM A;  3GIM A;  2W9C B;  3JPN A;  3MR6 A;  3H39 A;  5DEC A;  4IG8 A;  2ZTE A;  4G3I A;  5DDY A;  5KFK A;  2V4Q A;  2VA8 A;  3RJK A;  3JZ0 A;  3PML A;  4HYK A;  1NOM A;  1TFR A;  1U49 A;  3C2L A;  4Q44 A;  3BQ1 A;  5IIN A;  2DPI A;  7ICF A;  3TAQ A;  4IRK A;  8ICP A;  9ICS A;  4Z6F A;  3MR2 A;  3LWM A;  4KMU A;  5DQH A;  2XCA A;  1L3T A;  3G6Y A;  9ICX A;  4EBK A;  3K75 D;  2FMP A;  1MIW A;  5D4B A;  4O9M A;  4TQS A;  4FS1 A;  4B9L A;  1K1S A;  5KFZ A;  2ASJ A;  9ICA A;  8ICN A;  3T5L A;  4DSJ A;  2HHQ A;  9ICP A;  5DB7 A;  1S97 A;  1ZQY A;  2ZHB A;  1BPD A;  1X2I A;  5F9L A;  2PFQ A;  4J9R A;  2JEG A;  4WBY A;  3FDS A;  3H8W A;  5KG0 A;  2PFN A;  4DQI A;  2BR0 A;  5HRK A;  4WC2 A;  4MFA A;  2HW3 A;  4ECZ A;  1S10 A;  3T5J A;  1D9F A;  2BQR A;  2V9W A;  1R89 A;  1V9P A;  2F1H A;  4RNO A;  2DR8 A;  4PGQ A;  1UEU A;  2ISO A;  5HRD A;  4UB1 A;  2J6S A;  2XY7 A;  4B9V A;  4FBT A;  9ICB A;  1R8B A;  4FHX A;  1NK9 A;  4PHA A;  5HC9 A;  1B43 A;  2BCR A;  3BJY A;  4RWN A;  5F9N A;  1ZJN A;  5L1J A;  1NK0 A;  3SYZ A;  3RB4 A;  8ICG A;  4YCX A;  1RXV A;  1XSP A;  2FPM A;  4BWM A;  3BQT A;  5KG6 A;  1U47 A;  4I28 A;  2KTQ A;  8ICJ A;  3GV7 B;  1VJ7 A;  4RWQ A;  1NK8 A;  3PV8 A;  4WCW A;  4RWO A;  5IIK A;  3EYZ A;  2UVW A;  9ICR A;  2W9B A;  3C2K A;  4DQR A;  3WFP A;  3PX4 A;  4WC4 A;  5KFL A;  3HPO A;  3V7K A;  4ECY A;  3H8J A;  1V4A A;  4YD1 A;  4DSL A;  3Q8S B;  3C23 A;  2JZB A;  2LYH A;  5J2D A;  2AQ0 A;  1ZQH A;  5J0W A;  2PI5 A;  4O3S A;  4KIT B;  3AU2 A;  5KTQ A;  4J9N A;  4XQ8 A;  5J0R A;  1TVA A;  2A1J A;  4QZF A;  4UB4 A;  3ZD9 A;  3JPT A;  3GV8 B;  2V4R A;  2HHW A;  4IRD A;  3MDA A;  3JYY A;  4ED7 A;  1NK7 A;  2MUT A;  4F93 B;  4KTQ A;  3C66 A;  7ICG A;  4C8N A;  8ICT A;  4RUA A;  3RH5 A;  4YMM A;  4EBD A;  4EEY A;  1T7P A;  4BXO A;  2AGO A;  1TKD A;  4K4G A;  4RZR A;  1Q78 A;  1LB2 B;  5J2F A;  2DRB A;  4DL6 A;  4Q43 A;  1NK5 A;  5KT2 A;  4O0I A;  4I2C A;  8ICF A;  4ECX A;  1KSP A;  7ICV A;  4AT7 B;  2H5X A;  1BPY A;  9ICQ A;  4J9P A;  4E7X A;  4RQ4 A;  4WC0 A;  1ZQR A;  2ZUD A;  1QTM A;  4X4Q A;  1JXL A;  3AU6 A;  2KZZ A;  5EOZ A;  2RFF A;  5KFS A;  2ZJ5 A;  2HVH A;  1IXR A;  1XU4 A;  4KN7 A;  2HHS A;  1ZQU A;  1SKS A;  1RPL A;  2OWO A;  4B9T A;  1UT5 A;  3PR4 A;  4YR0 A;  5KFM A;  5L1K A;  4EBE A;  3ZDD A;  4KLS A;  8ICK A;  5DQI A;  5DLF A;  2IMW P;  1ZQS A;  4M6W A;  4E0D A;  3MAB A;  4F8R A;  5KFD A;  8ICU A;  1EXN A;  3RH4 A;  4AT8 A;  4TQR A;  4J9Q A;  5KFE A;  4IQV A;  1SL1 A;  3ZD8 A;  4QZ9 A;  4KLE A;  5J0T A;  4I2H A;  4Q8E A;  2J6T A;  9ICJ A;  4FH3 A;  4ED6 A;  4AT9 A;  4MF8 A;  4NKU A;  2AQ4 A;  4ELU A;  5JUM A;  4YR3 A;  5KT4 A;  3PW0 A;  2RDI A;  4EBC A;  2AGP A;  1NK4 A;  1TK5 A;  4RQ7 A;  3SI8 A;  2AU0 A;  3ZDA A;  4UAY A;  4GC6 A;  4KLL A;  3RH6 A;  1MSW D;  5BPC A;  3JPQ A;  5J2G A;  5L1I A;  9ICV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...