5F2VO

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to ampcpp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
184
Chain Sequence
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
molecule tags Transferase
total genus 59
structure length 184
sequence length 195
chains with identical sequence P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5f2vO02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5f2vO01
1ZQOA 4MFAA 4P4MA 2P66A 8ICVA 2BCUA 4X4VA 4X4UA 4I29A 1NO5A 4UB4A 5DBBA 3HWTA 3OVAA 4FHPA 1ZQZA 5D49A 4RPZA 4F5RA 3AUOA 9ICTA 3UXPA 4IQUA 5J0RA 8ICAA 5J0UA 1PX5A 5HRFA 2BPCA 3OUYB 1ZQDA 9ICWA 4UD4A 3ISBA 8ICZA 1BPYA 1V4AA 5J0WA 4NKUA 7ICIA 5J2EA 4XQ8A 4R66A 3H39A 4RQ3A 4YMMA 3PNCA 3WFRE 1BPXA 3LQCB 9ICIA 4IQWA 4RT2A 4FHVA 4RQ5A 4M9GA 4GXJA 4P4OA 2PXIA 9ICSA 9ICKA 4M9NA 1F5AA 4RQ7A 4I2FA 1R8AA 3PMNA 3JPQA 1RZTA 4QZGA 1VJ7A 3C2LA 4X0AA 8ICYA 1BPEA 4E7XA 8ICQA 7ICMA 4I2HA 5IIMA 5DDMA 4LZGA 5HREA 4XQ7A 5J29A 4UAWA 9ICPA 4XRHA 5J2BA 5TZVA 5IIKA 5DECA 4O5EA 4KLGA 3OUYA 5HHIA 4NM2A 1MIWA 3UXOA 4M04A 2ZH1A 1BPDA 2DRAA 9ICNA 4UB1A 2BCVA 5J2HA 8ICTA 4MF2A 3B0YA 9ICAA 4FH3A 3LK9A 4MFFA 9ICLA 5DB9A 1ZQAA 1ZQIA 4AT7B 4EBJA 8ICWA 1ZQKA 4I2DA 5DDYA 2ZH2A 2BE3A 5J2CA 1BPBA 3MBYA 4I27A 2FMPA 1FA0A 5J2GA 1KDHA 7ICOA 3JPTA 2IHMA 4I2JA 4X0BA 4MFCA 5DB6A 2BCSA 1JAJA 1RPLA 4RQ1A 7ICKA 4X4OA 5CR0A 3NYBA 5CHGA 5J0QA 3RJHA 3WFPA 4RPXA 5HRKA 4DOCA 4AT8B 9ICUA 1TFWA 7ICHA 2ZH8A 5HC9A 2ZH4A 3RH6A 4O5CA 5CB1A 4P4PA 4FO6A 4KLEA 3HIYA 1ZQJA 7ICSA 3RJIA 4QZHA 8ICIA 7ICQA 4RPYA 3C5FA 4WCWA 4IQTA 4X4NA 4WC7A 2ZH9A 1Q78A 4FH5A 2I9GA 4M47A 1R8CA 4QZAA 3OVBA 4Z6FA 8ICOA 2PBEA 4X4TA 4UD5A 5HRIA 7ICGA 4AT7A 4FHWA 8ICLA 1ZQVA 1ZQTA 9ICGA 3AU2A 4RQ4A 1OU5A 4LT6A 5J2JA 4I2CA 7ICVA 1ZQXA 4Z6CA 4IG8A 2DR8A 3V72A 3TFRA 1ZJMA 4KLIA 4KLMA 3WFOA 4M2YA 2DVIA 5HRDA 4EBKA 1UEVA 3WFQE 4NY8A 4S3NA 4KLUA 8ICFA 4LVSA 2BPFA 1XSPA 2M2VA 3AQNA 7ICLA 5DBAA 4X5VA 4PHAA 2ISOA 3H38A 5IIOA 4UAZA 4X4RA 4KLDA 1JN3A 8ICEA 4NM1A 9ICFA 1ZQGA 4AT9B 4Z6EA 1KEJA 4QZ9A 1WOTA 9ICBA 3H37A 8ICSA 3UQ0A 4RWPA 2ZHBA 4K4GA 9ICJA 4PHDA 5J0TA 8ICPA 1ZQFA 4UBCA 8ICHA 2DRBA 5J0SA 4F5PA 4RQ8A 4KLLA 3MDAA 2BCQA 5HRHA 1HUOA 4WBZA 5HRLA 4K4HA 7ICTA 4GXIA 8ICGA 7ICEA 1ZJNA 9ICHA 3H3AA 5BOLA 9ICOA 1TFYA 3HJ1A 3JPOA 3AQLA 3PMLA 3RH4A 3RH5A 4I2GA 4WC6A 1KNYA 5J2AA 3HX0A 3TFSA 3AQMA 4YMNA 4FHYA 5DEDA 1UEUA 3RJJA 1ZQCA 5J0XA 1XSNA 3RJFA 4KLFA 1JQRA 4AT9A 4FHXA 4K4IA 4I2EA 2O1PA 1ZQRA 3UPSA 4KLTA 3JYYA 4QZDA 5HRGA 5DB7A 2M2WA 3AQKA 4M9HA 1R89A 4PH5A 5IIIA 1ZQYA 1ZQMA 5IILA 3MDCA 4WC2A 2FMQA 4TUQA 4KLHA 4YMOA 1UETA 8ICRA 3C5GA 3C18A 7ICNA 1YLQA 9ICCA 8ICUA 3ISDA 3JPPA 1TV9A 2M2UA 1MIVA 4R63A 3JPRA 2BCRA 4EP7A 5D46A 2VANA 5BPCA 8ICBA 3OVSA 2PFQA 5DB8A 4PGQA 1MQ2A 4NLKA 3UQ2A 5F2VO 4XUSA 4P2HA 4XA5A 4JWMA 4WC1A 1XSLA 4QZ8A 7ICUA 4PHEA 4GXKA 3RJEA 5J0OA 2HHPA 8ICNA 7ICRA 9ICEA 2ZH5A 4WC4A 2ZH6A 1ZQQA 9ICQA 5IINA 1TVAA 2DR5A 4YN4A 4AT8A 4NXZA 4UB3A 5DBCA 4RWOA 2ZHAA 2O5AA 4YD1A 4RWQA 1ZQUA 3AU6A 3C66A 3V7LA 1VFGA 4RQ0A 4UB2A 4QZEA 4RQ6A 3WFSC 4KLQA 3K75D 3RJKA 4I28A 3OV7A 1ZQEA 4WC5A 4ATBB 2PFNA 9ICRA 2NRKA 3ISCA 1ZQNA 2FMSA 4O9MA 4M9LA 4KLOA 8ICKA 1JMSA 4DOAA 3UPQA 3UXNA 9ICVA 4F5OA 1ZQPA 4PGXA 1HUZA 4PGYA 8ICJA 4I2IA 4X4QA 4F5NA 3HJ4A 4TURA 4NLNA 5EOZA 3L9DA 4UBBA 5HR9A 9ICMA 3HW8A 4TUSA 5HHHA 4QZIA 8ICCA 1MIYA 4MF8A 4QZFA 3C2KA 3MGHA 4X4PA 5D4BA 2ZH3A 4F5QA 3JPNA 2DR7A 7ICFA 4DOBA 4E80A 4X4SA 4E8FA 4NLZA 4WBYA 5J0PA 4YCXA 5CJ7A 5IIJA 4LZDA 4R65A 3C2MA 4IQVA 1ZQLA 5J2DA 4RT3A 4Z6DA 2PFOA 3V7KA 2W9MA 4ATBA 3B0XA 1MQ3A 1BPZA 1NOMA 2M2TA 5J2IA 5BOMA 4NKTA 5J0YA 2GWSA 1R8BA 1Q79A 4KLSA 4KLJA 4UAYA 5CA7A 4YD2A 4M5DA 2ZH7A 9ICXA 2DR9A 3V7JA 5CP2A 4QZBA 3JPSA 3GDXA 4M9JA 3JZ0A 4DO9A 5DKWA 4RQ2A 3MGIA 4M0AA 7ICJA 4R64A 1ZQSA 3RJGA 4WC3A 4PHPA 4JWNA 4UB5A 1ZQBA 3OGUA 2Q66A 4RWNA 2PFPA 8ICXA 5J2FA 4QZCA 4TUPA 2RFFA 4PPXA 5J2KA 4I2BA 4O5KA 1ZQHA 2BPGA 7ICPA 1ZQWA 8ICMA 2ISPA 4I2AA 2ID1A 5CWRA 4WC0A 5HRBA
chains in the Genus database with same CATH superfamily
4GZRB 5EK0A 4WBNA 2BCUA 4NXVA 2HN2A 3A0BZ 4LFAB 4X4UA 2H3OA 3RYIB 5IYZA 1XREA 3D8CA 3QO5A 3OVAA 3CMAV 3LNMB 1ZQZA 2ADQB 2EWRA 1K7DA 1P84F 9ICTA 1Q43A 1S5JA 1AI4A 1PX5A 5HRFA 2BPCA 3OUYB 2EIJC 3SYQA 2PYLA 5LHHA 3SJQC 1BPYA 4ZBMA 3OUFA 7ICIA 3SYCA 4JI4O 2H94A 1K34A 2ZDIC 3LSSA 2E5LB 1PL0A 4PA9A 3LQCB 1SESA 4MVOA 5L3CA 4RQ5A 2ZNJA 1S5HC 4P4OA 2PXIA 2IHOA 1Q82W 9ICKA 1Q8IA 3Q4HA 4WQLA 4RQ7A 4GKJO 1CPYA 4I2FA 4NXMB 4O2BB 4PD4F 2JDIG 4LEYA 3DC6A 4JI0B 4E7XA 1N34O 2BBJA 7ICMA 2MK3A 4XJEA 2LW1A 4UVAA 1M56B 1FFXA 4DR1O 5J29A 3ZS8C 1QLNA 4XBFA 4NTWA 4UAWA 5J2BA 5TZVA 5IIKA 1PM9A 1DTOA 4KL1A 4KLGA 5HHIA 1GN2A 1MIWA 1O9GA 3MDSA 1WB7A 1M90W 4M04A 2ZH1A 3E35A 3BEHA 2BCVA 3LDCA 2P90A 4MT8A 4MF2A 4QGPA 4YJ3A 2NN4A 3L70H 4MFFA 2P67A 9ICLA 4FMTA 2B1IA 5DB9A 5H5NA 3WB0A 2BTQA 4UB6Z 2EZPA 4BWAA 1Z5VA 1ZQKA 3L73H 3OT7A 4I2DA 5DDYA 2QKAA 2BE3A 1XMQO 2Q73A 3CS5A 3WFVA 3FB5C 4DV0B 1YEWA 2R70A 3JPTA 1NBMG 3OR7C 1W2BU 1XNRB 2HEPA 3APOA 4HNAB 5CA0B 1FXKA 5CR0A 3SGIA 3RJHA 3F7YC 2A0LA 5A2QN 3WFPA 3IC7A 4DV6B 3JAKA 5L3FA 5KHHA 4IIJB 5EYPA 2JS3A 3BRCA 2ZH8A 1R6NA 5KAFZ 1N33B 3RH6A 3CJHB 2R72A 2QTSA 3RVYA 3E83A 3SYOA 1ZL8A 4WCWA 2F4VB 2CH7A 4LP8A 4AQYO 2DQ0A 1N8RW 4WC7A 1M4UA 2ZH9A 1HW7A 4QPKA 4FH5A 2I9GA 3K5NA 1ENVA 3RYFA 1R8CA 3OVBA 4I9WA 2UUAB 4Z6FA 2PBEA 4X4TA 2WLNA 4DV4O 4UD5A 1K8AW 1HNXO 4U3JA 4PDLA 5EBWC 3LSUA 4LH6A 8ICLA 3EVKA 4XDLA 2QWPB 2OIEA 1OHHG 4JGSA 1E1RG 1ZQTA 1I5XA 5EZYA 3MAQA 3ASNB 4GX1A 2A7WA 4HAMA 2HR3A 3KG2A 1R6TA 4CC5A 4O6AA 4DXWA 3SPCA 5CB4A 2VS0A 1N0NA 4R8CA 3W7XA 4KB6A 2YXHA 1VF6C 3B09A 5KA5A 3JSNA 3ZHSA 5DBAA 4X5VA 2IJKA 1AJQA 1TAEA 3CCVV 3H38A 1VQ7V 4PV1B 1NH2D 4UAZA 9ICFA 1H2NA 2R9IA 3TGUH 2GSMB 3CB2A 1ZQGA 3ZMZA 1K4DC 4Z6EA 2YS8A 1I7FA 2EIMC 1PKXA 1ZX3A 3L71H 1K73W 2ZHBA 4JTAB 3SPHA 1QLEC 2WLHA 1KD1W 3ZMUA 4F5PA 3O9OA 3P32A 2XT9A 4TV9B 4BW9A 3FX7A 2N05A 4I50B 3MDAA 2BCQA 4JI8O 3MD0A 7ICTA 4EGWA 1XDCA 1MNGA 1S76D 1QVFU 7ICEA 4LFBB 8ICGA 4TT3G 2AGAA 4BIUA 1XOUA 2EIKB 9ICOA 3CRAA 2IM9A 4FM0A 1YDXA 3HJ1A 4WF9V 2ZIOA 3PMLA 4PI2A 2XUMA 1J5EB 2Q4PA 3JARA 1SQVH 5IDJA 1G8MA 5B5EZ 3CRRA 5B1BC 1YJNV 5CFTA 4JI6O 4R50A 1FXVA 5IJ9A 3QF7A 4OAHA 4J42A 4TV8B 4KLFA 3M7MX 2DWDC 3E8GA 5FNVA 4FHXA 4DUYO 1KP3A 5IJ0B 1F51A 1NS1A 3T4ZA 5HRGA 1COWG 2EULA 3ABLC 1ZQYA 5IILA 1Y67A 3N2GB 4Q20A 4WC2A 2FMQA 1YHQV 1UETA 1WA8A 4LC1A 1TUBA 1V9PA 4JI4B 3EF2A 2JEUA 9ICCA 3E22B 2Q69A 5ITZB 2IJIA 4WFHA 1XNQO 4JV5O 1MIVA 3JPRA 2BCRA 5B1BB 1JR9A 3WB1A 4JI3O 5BY1A 2ZINA 5D61A 5KHGA 4NXWA 2X0LA 3OVSA 2PFQA 5DB8A 4GKJB 5F2VO 2DWEC 1XL6A 2LQTA 4XA5A 4JWMA 3ZN1A 2HFEC 1N34B 2B9ZA 3ABLB 3RJEA 3STZC 2HHPA 3M99B 2H8PC 4DR1B 4W4LA 4FIPC 3QVNA 2ZH5A 4Z1MG 1MMMA 1PNKA 4CS4A 4WQKA 9ICQA 1BCCH 1QR8A 2Q8VA 2IU0A 4AT8A 4X62O 4YIOA 5CA1B 3W7UA 4PELA 2F43G 4UB3A 1XI1A 5E1AC 4FZ0A 4O4LA 1VQ9V 4P2ZA 1ZQUA 3V7LA 4RQ0A 4X1YA 4TQDA 4CZZA 4KLQA 3RJKA 3DXRA 3OV7A 1TVKB 5LGNA 4X20B 4UV8A 1M93A 2NRKA 3ISCA 1XMOO 2O57A 1P7GA 1VQOV 2B56A 2JGUA 4KLOA 2CAZC 1JMSA 5LHIA 4PA4A 1PPJH 5BXZA 2F95B 4F5OA 5DN6G 2E75B 1ZQPA 1JQ0A 1R3KC 2OYQA 1S0VA 1BHBA 4PGXA 5JVDA 4PGYA 1H8HG 1XMQB 3OMNB 3D36A 5LMUO 4NLNA 4B08A 3L9DA 1H2MA 1QNMA 5KX5B 4UBBA 3JAWB 1YJWV 9ICMA 3LUTB 8ICCA 3HKBA 4MF8A 3CRMA 2UU9O 2Z0AA 3MGHA 1OJHA 4UCOA 3CMEV 1VQ4V 4DV5O 4F5QA 3JPNA 1FXHA 3SYPA 5B3QA 7ICFA 5LA6A 4X4SA 1GO3F 1UPGA 2YIDA 2AXTZ 3R65A 2QA4V 3T1YO 4YCXA 5CJ7A 4R65A 5GONB 5L3GA 1ZQLA 4Z6DA 4LNUA 4AQYB 3QO8A 4LF6O 3BFRA 3V7KA 4FK5C 1AJPA 2W9MA 3WB2A 3WG7C 1GM7A 2PUSA 3NWIA 4JAVA 3KZIZ 5BOMA 4DV4B 3HKCB 4QPJA 1HNXB 1UJWB 1R8BA 4Q6GA 1Y74A 4YD2A 5D5PA 4X64O 4BIZA 3ERCC 3D3QA 3HR0A 2BSKA 1SKVA 3FYEB 3JZ0A 2Q0OC 5DKWA 2DYSC 4M0AA 2IJJA 3ER9B 4R64A 4QJFB 1G6UA 4PI0A 2V4DA 1B06A 2PTMA 1ZSPA 4FLUA 3ETDA 2Q66A 4DR5O 4RWNA 5BZBA 4G2KA 2PFPA 4DK0A 2OTLV 5J2KA 4I5SA 2BPGA 1ZQWA 2IUBA 2VRZA 4BAYA 3WG7B 4I2AA 2HKOA 3CCUV 4MFAA 1AJNA 1N0JA 2GAFD 4X4VA 4FJCC 3HKEA 2CTQA 4I29A 3K57A 4UB4A 3SDLA 1NVPB 4PDMA 1YVWA 1GM8A 3AUOA 2EZOA 3UXPA 2PI4A 3JD4A 4JI8B 1K5SA 8ICAA 4Z1VA 3ABTA 1VQ8V 4EEDA 1ZQDA 3JATB 1MZEA 2CUGA 4JI7O 9ICWA 4UD4A 1V4AA 1DLBA 4K97A 4NKUA 4I9QA 2YI9A 4XQ8A 2BOBC 1SQFA 4LF5O 4YMMA 4RQ3A 4JYYA 4K0KO 1BPXA 4DK1A 2W6JG 4JI6B 4FHVA 3W7SA 4K35A 9ICSA 5EBMC 4RAIA 2ZE5A 1GPJA 3FD9A 4DUYB 3D3IA 1R8AA 3JPQA 3ZMTA 4QZGA 3OW2U 2Q6AA 4X0AA 4O4IB 2P5OA 3RN4A 5LP6B 1WP7A 1HNZO 2ZD9A 3RYIA 4DV1O 4I2HA 1EBOA 2F66C 3OAAG 4OXSA 2IU3A 5HREA 4U3FH 4XQ7A 3VQWA 4D6TH 1VQLV 1N4CA 2DOSA 4O5EA 3OUYA 2JRIA 1E1QG 1QR9A 1XNQB 1G1XB 2C2AA 5EBLC 1FFTB 1Y6XA 4DR2O 1B3QA 4JV5B 3G6EV 3OTFA 4JI3B 2OCCC 3U11A 5IE9A 3OGIB 3JCUZ 2DRAA 4UB1A 8ICTA 4DRXB 3B0YA 1P4RA 2B5UA 1ZQAA 1R3IC 3A2FA 3AK3A 2GHYA 2G38A 4AT7B 5IT9N 1JOYA 3J81N 2ZH2A 4O2BA 5J2CA 3G71V 5IY5B 3K5MA 4DR7O 1LUVA 3FB8C 4X1KB 7ICOA 2IHMA 4I2JA 3F5TA 3ZN0A 5EIBD 1JAJA 1H2KA 4X62B 4J10A 3CCMV 2UXBO 4WH5A 2WLLA 4X4OA 5J0QA 4JI1O 3N2KB 1F4MA 1TUEB 1PV0A 5HRKA 4YJ2B 3P3NA 5H9CA 4B3TO 3ABKC 2OCCB 5L3BA 5BMVB 2AZ0A 4XDKA 1L8DA 2YDEA 4E2LA 1WPBA 4D7SA 2AHZA 1RM1C 2ZH4A 2ZDIA 3SPGA 3E89A 4O5CA 4FO6A 4P4PA 4KLEA 1XMOB 1ZQJA 1BE3H 3CC2V 2QWRB 2Q67A 3SPJA 2UXCO 5B3PA 1Q78A 3RBZA 5H6QA 1F4NA 1VF7A 2YUAA 5LMUB 5LOVB 1DGSA 2XAHA 4O2AB 2OTJV 2LGQA 4UVCA 4FHWA 3T4DA 4XDJA 1ZQVA 3AU2A 2UU9B 4LT6A 4I2CA 7ICVA 1KP2A 3RYCA 1ZQXA 4DO2A 4Z6CA 4IG8A 4LF9O 3TFRA 1KB9F 3WFOA 4DV5B 4X66O 2DVIA 2IJHA 3TCUA 4HNAA 5IWAO 4N23A 5CA0A 1KECA 4KLUA 3C3TA 1RM1B 4OPAA 2YIBD 3T1YB 4LVSA 5B1OA 3ZRWA 4A5UB 3AQNA 2RDCA 3GWKC 4MSWC 7ICLA 3A0HZ 4IIJA 4LF6B 3CCRV 1E79G 3RVZA 3CJHA 4KLDA 1MZFA 3JYCA 2ITDC 4AT9B 1ZWIC 4HYOA 4KP4A 3ABUA 4X64B 3ICXA 3TXSA 2WSSG 4QZ9A 3GVMA 1WOTA 4B3RO 1I5YA 3VQXA 3HKDB 8ICSA 2LGWA 2EIJB 2YI8A 2UXDO 5J0TA 4PHDA 1RFYA 8ICPA 1NR1A 1ORQC 5CN0A 4WCEV 4FLYA 2P7TC 4CBCA 4RQ8A 2KG7B 1O9HA 4DR5B 5HRHA 1GH6A 3KKYA 3JD2A 9ICHA 4LR3A 3H3AA 3AG4C 1J95A 3UT5B 1YF2A 4JF3A 3JPOA 3ABMC 1NVPD 2F1MA 2BBHA 3RFRA 3RH4A 3JD3A 4WC6A 2YICA 1S3JA 3SJBC 3TFSA 3QO7A 4O4HB 4YMNA 1CP9A 2W0XA 2QM4A 1M1KW 1UEUA 1Q7YW 5J0XA 4AHCA 4LF7O 2KSDA 1FJGO 1WN7A 3RJFA 3JSLA 3OTOO 2EJ7A 4K4IA 3CP1A 4EEQA 3DGEA 3JAMN 3OFNG 5LL6Y 2WLIB 2HP8A 3I56V 4JI5B 3UPSA 4QZDA 2FCLA 1IBKO 3AQKA 4M9HA 5IIIA 4UCUA 4K3AA 1S72V 4TUQA 1VQMV 4JI7B 5JCOA 4YMOA 4TSFG 1L0NH 3C5GA 4TV9A 2B1GA 4I50A 4MVRA 3ABMB 5CFUA 3RW0A 1N36O 4LF5B 2Q68A 3LSQA 1BMFG 2EX3A 4FZ1A 4K0KB 1CEZA 3JPPA 4JLZA 3ZX6A 3VQVA 4FLWA 3B4SA 4N21A 4EP7A 1H38A 3B8MA 1Y76B 1PNLA 3ZHQA 3F7VC 4H33A 1MQ2A 1RSOA 4NXTA 3SYAA 4P2HA 3LDEA 2YIAA 3I55V 3MCRA 1NTMH 1HNZB 1Q86W 2A79B 2ETNA 4DV1B 4QZ8A 7ICUA 4PHEA 2XHBA 5J0OA 1SQPH 1Y66A 3K5LA 5IJ0A 2CGOA 1A32A 3W7WA 3DSQA 9ICEA 2QM8A 4MVMA 1JFFB 4WC4A 4U7NA 2JK5C 1ZQQA 5KHKA 3N2GA 2QWOB 4O69A 1K4CC 3STLC 4DR2B 4RWOA 2ZHAA 1Z2GA 1FXKC 1JVMA 4YD1A 4J80A 4JZ2A 1IZ3A 3E2EA 3AU6A 4QZEA 4RQ6A 1YCIA 1GK9A 3CE2A 2HJFC 3E22A 1YZBA 4ATBB 5JQGB 2PFNA 5C8YA 1JX9A 3F5WC 2PYJA 3BABA 2DE0X 1ZQNA 4LFCO 4RQEA 2ZE6A 4I0XB 4X65O 3VOUA 2VQFO 3UXNA 9ICVA 2AHYA 4I2IA 4RO2A 4OPHA 2BTQB 4DR7B 4F5NA 1YI2V 1M5IA 5L3EA 4NKGB 4MW8A 4KM5A 4CC6A 2QTOA 4QE7A 1VIBA 2ZKOA 4NXXA 2UXBB 4QZIA 1MIYA 4JI1B 1Q6IA 5JJNB 4QZFA 4NXUA 4X1IB 2FKXA 4X4PA 1HR0O 4B3TB 4IL6Z 1X4TA 4I7ZB 4UFZA 3PN1A 4H0LB 2ZH3A 5JTGA 2IH1C 2DR7A 3LNNA 5CA1A 2ZT9B 4DOBA 3ZJZA 5J0PA 1YSCA 2ZE7A 3ZCCA 2NR5A 1NTZH 1B04A 2EIMB 3C2MA 4RT3A 4K9BA 1XL4A 3FKSG 4RWUA 2UXCB 2PFOA 1IXBA 1TVKA 2BTOA 2A06H 2XTAA 4X20A 3K9SA 3B0XA 1NOMA 5J2IA 5CA3A 1GMGA 4MW3A 5J0YA 3FAVA 1QLEB 2XOKG 3TXQA 2B51A 3RYFB 4DV3O 4KLJA 1OCRC 3JALB 5CA7A 2EILC 2E76B 4NVPA 3CEIA 3RWRD 3OUSA 4J7JA 2QE7G 3QNEA 4QZBA 1QHTA 1XHXA 3A8TA 1GN4A 4LF9B 5KX5A 2LP7A 3ETQA 3JAWA 4X66B 4DUZO 1IVSA 3RJGA 4UCTA 5IWAB 2Y48A 4PHPA 3UO3A 1ZQBA 3OGUA 1G4YB 4FLTA 4UV9A 8ICXA 4UCSA 2ITCC 3H1KH 3CX5F 4QZCA 2XASA 1UFIA 3G67A 4PPXA 4I2BA 4O5KA 3E8HA 2W0FC 2QSAA 4WFAV 2ISPA 1K9MW 5GONA 4LF8O 4G28B 1ZQOA 3CRCA 1NZ6A 2P66A 1OCRB 3KCXA 4B3RB 2EILB 3WU2Z 1VQ5V 1BT8A 4GCZA 1ZAUA 5FPOA 1HWYA 2UXDB 3ZHUA 1H2LA 3HKCA 2PZSA 2KQXA 2YIBA 4C7UA 5D49A 4RPZA 4F5RA 4JI2B 5B3SC 2ILMA 5LMNO 4JTCB 2Q0AA 5J0UA 3H01A 2JVDA 3PJSK 5KUKA 4DW1A 3CSXA 4IYHA 1BSMA 3ZEDA 5JH7A 5KA6A 5J0WA 2CK3G 1SF9A 4R66A 1KKCA 1ZLZA 2N04A 3PNCA 1IBMO 2LO1A 1GTOA 1KUQA 4GUNA 9ICIA 4IQWA 3NKUA 3JARB 3DTUB 4LF7B 3E8FA 3OD4A 3OMAB 1FJGB 2HVJC 3OTOB 1F5AA 3IJ4A 3UCSC 4TWKA 2GDSA 5KHIA 1Q81W 3PMNA 1RZTA 1VJ7A 3TETA 2QR4A 3C2LA 8ICYA 1IBKB 5B3SB 1BPEA 1X59A 8ICQA 4GT1A 2P06A 4RUEA 5IIMA 1AR5A 4CH6A 4FFKA 2JGDB 2RN9A 2WA4A 5H2FZ 4TOIA 3CCSV 2XAQA 3UQ8A 4XRHA 3I5DA 4ZOLB 5DECA 1TUBB 1N36B 3AG7A 2LJ2A 2UXXA 1BZKA 3JATA 4JTDB 3TK1A 2ZM6O 3BVOA 1WNSA 1XBLA 2ZCEA 1Z5WA 3OWGA 1BPDA 1QCEA 9ICNA 1NU1H 2CTPA 3J7AU 1W0JG 3AK2A 4HBNA 1HP8A 3W7TA 3CCQV 3LK9A 2ZE8A 4FFBB 1MOFA 4GKKO 1ZQIA 1RP3B 3CK6A 1BPBA 4J9YB 3M8AA 3JD1A 3MBYA 4I27A 2FMPA 4O4IA 1FA0A 5J2GA 1KDHA 5LP6A 5LHGA 1I08A 4X0BA 3D36C 1VQ6V 2BCSA 2JJ2G 7ICKA 3CXHF 3IGAC 4MKPA 3X2QC 3L72H 4AT8B 4DR6O 1FS0G 9ICUA 1Q6HA 4LF4O 5B1NA 1BHAA 4KXRA 4P30A 4O67A 2QJ1A 2GA9D 1U97A 1K33A 1GAXA 3CWBH 4LFCB 3HIYA 3RJIA 5LXTA 4X65B 8ICIA 1DK1A 1OZ0A 7ICQA 2VQFB 4N7RA 3CC4V 4X4NA 1SZTA 4DRXA 4M47A 2P22C 4Z2WA 4QZAA 2R9RB 2DYSB 1P7BA 1OCOC 1V54C 1XHZA 1R6KA 4UVBA 4JI5O 1JJ2U 1KC8W 5HRIA 4AT7A 4DYLA 1WP8A 2OWOA 4DV7O 1MA1A 2RQ6A 1FPOA 5J2JA 3ZRXA 1HR0B 4MS2A 3X2QB 2DR8A 4NTYA 4KLMA 1PNMA 1S5LZ 3EHBB 5HRDA 3P3PA 1UEVA 4NY8A 2QWQB 3QG5A 3OR6C 3JASA 3N2KA 8ICFA 1VMGA 4OX9O 1N32O 4NR1A 3ZMVA 2ISOA 4GYCB 5IIOA 1QVGU 1I0HA 1AB3A 2FTKA 5J2UB 4PA6A 3E8BA 4LNUB 3TJTA 1IBLO 3OEHG 5J2TB 4X4RA 4NM1A 8ICEA 1EFRG 4H37A 4WFEA 4K9AA 4MVZA 4L87A 1AROP 3E86A 1V54B 3GB7C 4ZI7B 1XILA 4DV3B 2UUCO 2CGNA 3FB6C 1LR1A 2DW4A 9ICBA 2QWNB 2V1DA 4CS2A 3UQ0A 3VBBA 9ICJA 5CWRA 3ZIAG 5LOVA 2RCVA 1ZQFA 4DUZB 2DRBA 5J0SA 1LUWA 1EN6A 1KU9A 4KLLA 3CYOA 1HUOA 4MVUA 5HRLA 3C3SA 1ZJNA 4I55B 1M9NA 5BOLA 1TFYA 1PD3A 4P9OA 4JAAA 1SETA 4LF8B 3RH5A 4I2GA 4OGQB 2YEVB 3HX0A 3AQMA 4K8XA 3CHXA 4FHYA 1TGOA 1SQBH 5DEDA 4ICGA 1MSWD 2EINC 3G4SV 4D7TA 3RJJA 1SA0B 2DYRC 2Q7HA 1SC5B 4EB6B 1VQPV 5AG2A 4AT9A 2ADPA 4I2EA 4MVSA 1L0LH 2O1PA 4KLTA 3G6BA 3JYYA 2M2WA 5LMNB 1R1BA 4UUJC 3HKDA 4RUFA 3FFQA 2MW2B 4JZGA 3NVOA 4LWSB 1ZQMA 3MDCA 2GTSA 1LNQA 4IHJB 1F7YA 4K99A 8ICRA 2XAGA 2ZXWC 1AI7A 2KG7A 4FM2A 7ICNA 1SZXA 2DJVA 1FD9A 1IBMB 5KAIZ 4O68A 4H44B 2NNUA 5JJEB 3UT5A 2L35A 2OIGA 3B2EE 4EKWA 2EINB 1R73A 3RGBA 2DYRB 8ICBA 5EC2C 4PGQA 3BCCH 4O4HA 3BA8A 4DV2O 4NLKA 3UQ2A 4XUSA 1YXBA 3JD0A 3KCYA 3BY6A 4FPPA 2YC0A 2Z5UA 1XSLA 1IURA 4JPRA 4OAGA 4UXNA 2BCCH 3SPIA 1AVMA 1DF5A 2WLIA 3K5OA 4K8ZA 4KHPO 3PHZA 3ABKB 1YTFB 3O65A 3SR2C 2ZXWB 1I94O 2ZH6A 1NT2B 3H1LH 3NR7A 5IYCO 1GM9A 1RPOA 4GX0A 2ZM6B 4NXZA 5DBCA 3K06A 2O5AA 1AI6A 1M56C 3K0DA 4W4KA 4RWQA 3N27A 3RYHB 1JPXA 3C66A 1VFGA 3C90A 4BW5A 5GTHZ 1WPXA 4JLXA 4LEWA 4TUYB 4I4TB 3CXCU 5LYJB 3AG3C 2YXLA 4B7KA 2BOCC 1H2SB 1GN6A 1KKDA 5CBFA 4DOAA 1Y76A 1SS3A 5BR8O 4FO1A 4GKKB 4L8JA 1ZTEA 4F6RB 4ZHQB 3OEEG 5TISZ 1BS3A 1MSDA 2QKSA 3HB3B 5LGUA 3HJ4A 4TURA 4JI2O 1H8EG 1BL8A 4PA3A 4LEVA 5HR9A 5D62A 4J11A 1JJOA 3R66A 3HW8A 2IH3C 1SRYA 2Y69C 5LBQA 4O4JB 4TQFA 4DR6B 2Q7EA 1JFFA 1EZJA 3AEIA 4G27B 4B3SO 2WLLB 4LF4B 2FYUH 4X88A 2Y4UA 2CDYA 3CCLV 2L6LA 2Y0IA 4NTXA 4ASUG 3ER8C 2RJZA 3ZRVA 1XEQA 4BIOA 5HFLA 1YITV 1FKAO 4E8FA 4NLZA 5KMGB 5IIJA 3AG3B 2GUZB 4PDVA 2F23A 5J2DA 4EEBA 4CH5A 1TA8A 4WBNB 1VARA 4ATBA 5JQGA 1MQ3A 1BPZA 5JWPA 3K03A 2M2TA 4NKTA 1D5NA 5IYZB 4I0XA 3CPWU 3JCZA 1Q79A 4KLSA 2X6BA 1Q90D 2E3CA 3OMIB 4J9ZB 4DV7B 2OT5A 2ZQMA 1XUQA 1FAFA 3V7JA 2DR9A 1BQ0A 2Y69B 3GDXA 4R6ZA 1VQNV 2ZR2A 1GRJA 3K7DA 3AG4B 1V55C 4RQ2A 3SJCC 7ICJA 3RYCB 4FLZA 4DR3O 4JYBA 4PHZA 4WC3A 2N74A 4JWNA 3THOA 1VF6A 4UB5A 3AK1A 1H2GA 3BHPA 3U10A 4OX9B 1WAZA 4X1IA 1N32B 2UUBO 3FYIB 1EN5A 3ASNC 4OAFA 1IX9A 1NKDA 3ZRWB 1IBLB 1WB8A 3Q4HB 2ID1A 4WC0A 5HRBA 1EN4A 3L74H 2UUCB 4P4MA 4TV8A 8ICVA 1VQKV 4YY3O 2XAFA 2WLMA 3U0ZA 4K98A 2Y0PA 1NO5A 5DBBA 2WLJA 3HWTA 1MABG 4B3MB 3T2MA 4FHPA 4F6EA 2W6IG 3JALA 1FFXB 1V55B 1GKFA 3ETGA 1VP7A 4IQUA 5J0RA 4F4LA 2HHHO 1CXZB 2PGGA 1FYJA 4X89A 4LBEC 1BQZA 3ISBA 8ICZA 5JCOC 5D63A 5ITZA 5J2EA 2QGNA 3AG1C 3H39A 4YJ3B 3WFRE 2ARHA 2VQEO 1OCCC 4RT2A 4M9GA 2UXNA 4GXJA 2EIKC 2RNBA 3RT3C 4M9NA 3H1IH 1OV9A 4GX5A 5DM6V 3VQYA 4MTFA 1NI8A 5DDMA 4LZGA 1FXKB 2P6JA 1OCZC 9ICPA 4CH4A 3JAKB 1YIJV 3HPLC 4KFMA 5EYPB 3ASOC 4NM2A 1PP9H 2CTRA 3AG1B 4YHHO 3UXOA 3IFXA 3H1JH 1OCCB 2HN1A 2DN9A 1P49A 4WFBV 3T1HO 3CD6V 1ZL8B 1NQTA 2CH7B 2GV9A 4CS3A 1KYOF 5J2HA 4NXNO 1YTFD 2GBOA 9ICAA 3K58A 5CMUA 4DV2B 4FH3A 2P4KA 1RSOB 4U3JB 5FLXN 4EBJA 3OE7G 8ICWA 3APQA 5H6RA 2K9PA 4MTGA 4KHPB 5EZYB 3K08A 5CBGA 4J7ZA 4UB8Z 4WFGA 1KQSU 1OCZB 1I94B 4MFCA 2PI5A 5DB6A 1RPLA 4RQ1A 5CB4B 3ASOB 2Q7GA 2JGDA 3NYBA 4DR4O 4J7KA 5CHGA 2PY5A 3EFFK 3OM3B 4RPXA 4DOCA 4PA7A 5CBHA 1TFWA 4ZOLA 7ICHA 2X7RB 1US6A 2WAMA 5HC9A 2IW5A 3ZHVA 5CB1A 1AP6A 3QTCA 1HNWO 7ICSA 3CCEV 4QZHA 3K04A 4RPYA 3C5FA 5C8YB 5BR8B 4IQTA 5J9PC 4KUMA 3MHHC 1PL4A 2LW7A 1BGYH 2XNDG 1Y4MA 2CE4A 8ICOA 4FVMA 5EIBC 1L1FA 4AI8A 2JEXA 4FFBA 5B1AC 7ICGA 4UCRA 4EFBA 1EM1A 5FL7G 9ICGA 4RQ4A 1OU5A 4E4EA 4FLXA 1DF4A 2Z3YA 2P4VA 4B3SB 3V72A 5LGTA 1ZJMA 4KLIA 2NLJC 1KBHA 3L75H 4M2YA 2OCHA 2WWWA 2XAJA 4EBKA 3WFQE 4S3NA 1W59A 2DQ3A 1AR1B 4JYAO 2BPFA 1IXMA 1KMIZ 1XSPA 2M2VA 3H1HH 4RQFA 2WA3A 4PHAA 5CHEA 2LFSA 3K9AA 5IJ9B 3LDDA 1SQGA 1JN3A 3ZMSA 1F23A 1R3JC 2QEXV 5FNVB 2QKCA 4YXWG 2Y4TA 3FAVB 5B1AB 1KEJA 4I0UA 2F93B 3H37A 4LFAO 2GTAA 3BAAA 4RWPA 4K4GA 3DC5A 3ZRSA 4UBCA 8ICHA 4DR3B 1WA8B 3CC7V 3ZHRA 4CH3A 2JJ1G 2M7WA 4AILC 4WBZA 4K4HA 2UUBB 1S77D 3UKMA 4GXIA 3OGCC 1QU7A 2HVKC 5E79Z 3K0GA 4K96A 4J41A 2V7QG 1Q5OA 1K97A 3B77A 4MVQA 3AQLA 4ZIBA 5KHJA 4BR6A 1KNYA 4WOYA 4EFEA 5J2AA 4P9PA 2E5LO 2HLDG 2Q9LA 2ODMA 4YY3B 2X6CA 5J2UA 1ZQCA 1JMKC 1XSNA 5J2TA 4MTXA 3H9VA 2D3OW 5HFMA 1NR7A 5CFSA 2FL4A 1JQRA 4NYKA 3EXAA 3P30A 4DW0A 2QDOA 4ZI7A 1Q6UA 1ZQRA 4NXMO 1K3EA 3JCFA 5DB7A 2HHHB 3UO2A 1WJZA 1R89A 4JI0O 4PH5A 4NB5A 2Q5ZA 3K79A 4KLHA 1T5EA 1ROPA 3C18A 4O4LB 4YIPA 1YLQA 2VWKA 4X1YB 5IYDO 3DXRB 3S3XA 5JH7B 8ICUA 1IDSA 3ISDA 4I55A 2VQEB 1YJ9V 4H13B 3S3WA 1TV9A 1SQXH 3ETEA 2M2UA 1ZUQA 4R63A 3ZHTA 4GX2A 4JASA 5D46A 2JS5A 1QQCA 2VANA 5BPCA 2FB5A 1W0KG 1AR4A 2YEVA 5FPRA 2AZ2A 4LH7A 5JVDB 4EV6A 1URFA 4JYCA 1B6QA 4WC1A 1SA0A 4IT5A 4EB6A 4MTOA 2ZNIA 4B7EA 4GXKA 5EC1C 1AILA 1XQ8A 3HKBB 1K92A 4X1KA 8ICNA 4PDRA 4HX0A 1M57C 5GTIZ 3G80A 1D2DA 7ICRA 3K3WA 2X6AA 3BPZA 2KKWA 3ZBHA 4DV0O 4HZ3A 1VEWA 1VF5B 5IINA 4LWSA 5LP6C 1TVAA 1XNRO 2DR5A 4YN4A 4YJ2A 2WLKA 2DMXA 4YHHB 5LA6B 1AI5A 1QBZA 4IHJA 1THZA 5BMVA 2LFRA 4ABMA 4GLXA 4DV6O 1SQQH 4WFFA 2WPDG 3T1HB 2HJDA 4UB2A 4QE9A 3WFSC 3K75D 1WLEA 4I28A 1ZQEA 4NXNB 2D2CB 5GW7A 4WC5A 5IYBO 1N33O 5KUMA 1OCOB 9ICRA 3CCJV 1JCHA 2EBOA 5D5QA 4FLVA 2FMSA 4O9MA 4M9LA 3AG2C 8ICKA 4PJ0Z 2F4VO 3UPQA 1EZVH 2YSUB 1Y74B 5A9GA 3IAYA 1Q3EA 4B3MO 1HUZA 8ICJA 1AP5A 2ATKC 2BSKB 4O2AA 2UUAO 4X4QA 1JA8A 2K1EA 1M57B 3CRQA 4LCUC 5EOZA 4OAIZ 1D5AA 3IC9A 2M6YA 2HG5C 4TUSA 4LEZA 5HHHA 2ZR3A 3ML0A 4DR4B 2EJRA 2FMLA 1MG1A 3C2KA 2R9AA 2QM7A 5IY5C 5D4BA 2KB1A 2A9HA 5KLVH 1NTKH 2RMKB 3UM7A 4E80A 2B4VA 4WBYA 1HNWB 4ZKIA 4IYIA 4LZDA 1R3LC 4IGGA 3BA9A 3RYHA 4IQVA 2VWJA 3AG2B 1RPRA 3T1CA 4TUYA 5LXTB 4I4TA 2YXYA 2ZIMA 5LYJA 3HKEB 3B40A 3MHSC 3NXSA 3FB7C 1U96A 2GWSA 2A3QA 1HDJA 5K1PA 3A0RA 3K59A 4UAYA 2E74B 5B66Z 5L3DA 4F6RA 4M5DA 4ZHQA 2IBZH 4QIWF 2ZH7A 1K5QA 4UCVA 9ICXA 5CP2A 4JAUA 5K1XA 3JPSA 4M9JA 1NH2B 4DO9A 3MGIA 2CTWA 3SJAC 1ZQSA 5JJJB 4K8VA 4O4JA 4FM1A 3GWOA 4JYAB 1SERA 2AW9A 2PF4E 4X9QA 5J2FA 3JASB 4LFBO 4TUPA 1GN3A 3B8NA 2RFFA 1ZQHA 3J80N 4U7OA 7ICPA 4QNHB 8ICMA 5KMGA 2JIZG 4R7CA 1NJIW 2GUZA 1J5EO 4X8AA 5C93A
chains in the Genus database with same CATH topology
1ZQOA 4MFAA 4P4MA 2P66A 8ICVA 2BCUA 4X4VA 4X4UA 4I29A 1NO5A 4UB4A 5DBBA 3HWTA 3OVAA 4FHPA 1ZQZA 5D49A 4RPZA 4F5RA 3AUOA 9ICTA 3UXPA 4IQUA 5J0RA 8ICAA 5J0UA 1PX5A 5HRFA 2BPCA 3OUYB 1ZQDA 9ICWA 4UD4A 3ISBA 8ICZA 1BPYA 1V4AA 5J0WA 4NKUA 7ICIA 5J2EA 4XQ8A 4R66A 3H39A 4RQ3A 4YMMA 3PNCA 3WFRE 1BPXA 3LQCB 9ICIA 4IQWA 4RT2A 4FHVA 4RQ5A 4M9GA 4GXJA 4P4OA 2PXIA 9ICSA 9ICKA 4M9NA 1F5AA 4RQ7A 4I2FA 1R8AA 3PMNA 3JPQA 1RZTA 4QZGA 1VJ7A 3C2LA 4X0AA 8ICYA 1BPEA 4E7XA 8ICQA 7ICMA 4I2HA 5IIMA 5DDMA 4LZGA 5HREA 4XQ7A 5J29A 4UAWA 9ICPA 4XRHA 5J2BA 5TZVA 5IIKA 5DECA 4O5EA 4KLGA 3OUYA 5HHIA 4NM2A 1MIWA 3UXOA 4M04A 2ZH1A 1BPDA 2DRAA 9ICNA 4UB1A 2BCVA 5J2HA 8ICTA 4MF2A 3B0YA 9ICAA 4FH3A 3LK9A 4MFFA 9ICLA 5DB9A 1ZQAA 1ZQIA 4AT7B 4EBJA 8ICWA 1ZQKA 4I2DA 5DDYA 2ZH2A 2BE3A 5J2CA 1BPBA 3MBYA 4I27A 2FMPA 1FA0A 5J2GA 1KDHA 7ICOA 3JPTA 2IHMA 4I2JA 4X0BA 4MFCA 5DB6A 2BCSA 1JAJA 1RPLA 4RQ1A 7ICKA 4X4OA 5CR0A 3NYBA 5CHGA 5J0QA 3RJHA 3WFPA 4RPXA 5HRKA 4DOCA 4AT8B 9ICUA 1TFWA 7ICHA 2ZH8A 5HC9A 2ZH4A 3RH6A 4O5CA 5CB1A 4P4PA 4FO6A 4KLEA 3HIYA 1ZQJA 7ICSA 3RJIA 4QZHA 8ICIA 7ICQA 4RPYA 3C5FA 4WCWA 4IQTA 4X4NA 4WC7A 2ZH9A 1Q78A 4FH5A 2I9GA 4M47A 1R8CA 4QZAA 3OVBA 4Z6FA 8ICOA 2PBEA 4X4TA 4UD5A 5HRIA 7ICGA 4AT7A 4FHWA 8ICLA 1ZQVA 1ZQTA 9ICGA 3AU2A 4RQ4A 1OU5A 4LT6A 5J2JA 4I2CA 7ICVA 1ZQXA 4Z6CA 4IG8A 2DR8A 3V72A 3TFRA 1ZJMA 4KLIA 4KLMA 3WFOA 4M2YA 2DVIA 5HRDA 4EBKA 1UEVA 3WFQE 4NY8A 4S3NA 4KLUA 8ICFA 4LVSA 2BPFA 1XSPA 2M2VA 3AQNA 7ICLA 5DBAA 4X5VA 4PHAA 2ISOA 3H38A 5IIOA 4UAZA 4X4RA 4KLDA 1JN3A 8ICEA 4NM1A 9ICFA 1ZQGA 4AT9B 4Z6EA 1KEJA 4QZ9A 1WOTA 9ICBA 3H37A 8ICSA 3UQ0A 4RWPA 2ZHBA 4K4GA 9ICJA 4PHDA 5J0TA 8ICPA 1ZQFA 4UBCA 8ICHA 2DRBA 5J0SA 4F5PA 4RQ8A 4KLLA 3MDAA 2BCQA 5HRHA 1HUOA 4WBZA 5HRLA 4K4HA 7ICTA 4GXIA 8ICGA 7ICEA 1ZJNA 9ICHA 3H3AA 5BOLA 9ICOA 1TFYA 3HJ1A 3JPOA 3AQLA 3PMLA 3RH4A 3RH5A 4I2GA 4WC6A 1KNYA 5J2AA 3HX0A 3TFSA 3AQMA 4YMNA 4FHYA 5DEDA 1UEUA 3RJJA 1ZQCA 5J0XA 1XSNA 3RJFA 4KLFA 1JQRA 4AT9A 4FHXA 4K4IA 4I2EA 2O1PA 1ZQRA 3UPSA 4KLTA 3JYYA 4QZDA 5HRGA 5DB7A 2M2WA 3AQKA 4M9HA 1R89A 4PH5A 5IIIA 1ZQYA 1ZQMA 5IILA 3MDCA 4WC2A 2FMQA 4TUQA 4KLHA 4YMOA 1UETA 8ICRA 3C5GA 3C18A 7ICNA 1YLQA 9ICCA 8ICUA 3ISDA 3JPPA 1TV9A 2M2UA 1MIVA 4R63A 3JPRA 2BCRA 4EP7A 5D46A 2VANA 5BPCA 8ICBA 3OVSA 2PFQA 5DB8A 4PGQA 1MQ2A 4NLKA 3UQ2A 5F2VO 4XUSA 4P2HA 4XA5A 4JWMA 4WC1A 1XSLA 4QZ8A 7ICUA 4PHEA 4GXKA 3RJEA 5J0OA 2HHPA 8ICNA 7ICRA 9ICEA 2ZH5A 4WC4A 2ZH6A 1ZQQA 9ICQA 5IINA 1TVAA 2DR5A 4YN4A 4AT8A 4NXZA 4UB3A 5DBCA 4RWOA 2ZHAA 2O5AA 4YD1A 4RWQA 1ZQUA 3AU6A 3C66A 3V7LA 1VFGA 4RQ0A 4UB2A 4QZEA 4RQ6A 3WFSC 4KLQA 3K75D 3RJKA 4I28A 3OV7A 1ZQEA 4WC5A 4ATBB 2PFNA 9ICRA 2NRKA 3ISCA 1ZQNA 2FMSA 4O9MA 4M9LA 4KLOA 8ICKA 1JMSA 4DOAA 3UPQA 3UXNA 9ICVA 4F5OA 1ZQPA 4PGXA 1HUZA 4PGYA 8ICJA 4I2IA 4X4QA 4F5NA 3HJ4A 4TURA 4NLNA 5EOZA 3L9DA 4UBBA 5HR9A 9ICMA 3HW8A 4TUSA 5HHHA 4QZIA 8ICCA 1MIYA 4MF8A 4QZFA 3C2KA 3MGHA 4X4PA 5D4BA 2ZH3A 4F5QA 3JPNA 2DR7A 7ICFA 4DOBA 4E80A 4X4SA 4E8FA 4NLZA 4WBYA 5J0PA 4YCXA 5CJ7A 5IIJA 4LZDA 4R65A 3C2MA 4IQVA 1ZQLA 5J2DA 4RT3A 4Z6DA 2PFOA 3V7KA 2W9MA 4ATBA 3B0XA 1MQ3A 1BPZA 1NOMA 2M2TA 5J2IA 5BOMA 4NKTA 5J0YA 2GWSA 1R8BA 1Q79A 4KLSA 4KLJA 4UAYA 5CA7A 4YD2A 4M5DA 2ZH7A 9ICXA 2DR9A 3V7JA 5CP2A 4QZBA 3JPSA 3GDXA 4M9JA 3JZ0A 4DO9A 5DKWA 4RQ2A 3MGIA 4M0AA 7ICJA 4R64A 1ZQSA 3RJGA 4WC3A 4PHPA 4JWNA 4UB5A 1ZQBA 3OGUA 2Q66A 4RWNA 2PFPA 8ICXA 5J2FA 4QZCA 4TUPA 2RFFA 4PPXA 5J2KA 4I2BA 4O5KA 1ZQHA 2BPGA 7ICPA 1ZQWA 8ICMA 2ISPA 4I2AA 2ID1A 5CWRA 4WC0A 5HRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQO A;  4MFA A;  4P4M A;  2P66 A;  8ICV A;  2BCU A;  4X4V A;  4X4U A;  4I29 A;  1NO5 A;  4UB4 A;  5DBB A;  3HWT A;  3OVA A;  4FHP A;  1ZQZ A;  5D49 A;  4RPZ A;  4F5R A;  3AUO A;  9ICT A;  3UXP A;  4IQU A;  5J0R A;  8ICA A;  5J0U A;  1PX5 A;  5HRF A;  2BPC A;  3OUY B;  1ZQD A;  9ICW A;  4UD4 A;  3ISB A;  8ICZ A;  1BPY A;  1V4A A;  5J0W A;  4NKU A;  7ICI A;  5J2E A;  4XQ8 A;  4R66 A;  3H39 A;  4RQ3 A;  4YMM A;  3PNC A;  3WFR E;  1BPX A;  3LQC B;  9ICI A;  4IQW A;  4RT2 A;  4FHV A;  4RQ5 A;  4M9G A;  4GXJ A;  4P4O A;  2PXI A;  9ICS A;  9ICK A;  4M9N A;  1F5A A;  4RQ7 A;  4I2F A;  1R8A A;  3PMN A;  3JPQ A;  1RZT A;  4QZG A;  1VJ7 A;  3C2L A;  4X0A A;  8ICY A;  1BPE A;  4E7X A;  8ICQ A;  7ICM A;  4I2H A;  5IIM A;  5DDM A;  4LZG A;  5HRE A;  4XQ7 A;  5J29 A;  4UAW A;  9ICP A;  4XRH A;  5J2B A;  5TZV A;  5IIK A;  5DEC A;  4O5E A;  4KLG A;  3OUY A;  5HHI A;  4NM2 A;  1MIW A;  3UXO A;  4M04 A;  2ZH1 A;  1BPD A;  2DRA A;  9ICN A;  4UB1 A;  2BCV A;  5J2H A;  8ICT A;  4MF2 A;  3B0Y A;  9ICA A;  4FH3 A;  3LK9 A;  4MFF A;  9ICL A;  5DB9 A;  1ZQA A;  1ZQI A;  4AT7 B;  4EBJ A;  8ICW A;  1ZQK A;  4I2D A;  5DDY A;  2ZH2 A;  2BE3 A;  5J2C A;  1BPB A;  3MBY A;  4I27 A;  2FMP A;  1FA0 A;  5J2G A;  1KDH A;  7ICO A;  3JPT A;  2IHM A;  4I2J A;  4X0B A;  4MFC A;  5DB6 A;  2BCS A;  1JAJ A;  1RPL A;  4RQ1 A;  7ICK A;  4X4O A;  5CR0 A;  3NYB A;  5CHG A;  5J0Q A;  3RJH A;  3WFP A;  4RPX A;  5HRK A;  4DOC A;  4AT8 B;  9ICU A;  1TFW A;  7ICH A;  2ZH8 A;  5HC9 A;  2ZH4 A;  3RH6 A;  4O5C A;  5CB1 A;  4P4P A;  4FO6 A;  4KLE A;  3HIY A;  1ZQJ A;  7ICS A;  3RJI A;  4QZH A;  8ICI A;  7ICQ A;  4RPY A;  3C5F A;  4WCW A;  4IQT A;  4X4N A;  4WC7 A;  2ZH9 A;  1Q78 A;  4FH5 A;  2I9G A;  4M47 A;  1R8C A;  4QZA A;  3OVB A;  4Z6F A;  8ICO A;  2PBE A;  4X4T A;  4UD5 A;  5HRI A;  7ICG A;  4AT7 A;  4FHW A;  8ICL A;  1ZQV A;  1ZQT A;  9ICG A;  3AU2 A;  4RQ4 A;  1OU5 A;  4LT6 A;  5J2J A;  4I2C A;  7ICV A;  1ZQX A;  4Z6C A;  4IG8 A;  2DR8 A;  3V72 A;  3TFR A;  1ZJM A;  4KLI A;  4KLM A;  3WFO A;  4M2Y A;  2DVI A;  5HRD A;  4EBK A;  1UEV A;  3WFQ E;  4NY8 A;  4S3N A;  4KLU A;  8ICF A;  4LVS A;  2BPF A;  1XSP A;  2M2V A;  3AQN A;  7ICL A;  5DBA A;  4X5V A;  4PHA A;  2ISO A;  3H38 A;  5IIO A;  4UAZ A;  4X4R A;  4KLD A;  1JN3 A;  8ICE A;  4NM1 A;  9ICF A;  1ZQG A;  4AT9 B;  4Z6E A;  1KEJ A;  4QZ9 A;  1WOT A;  9ICB A;  3H37 A;  8ICS A;  3UQ0 A;  4RWP A;  2ZHB A;  4K4G A;  9ICJ A;  4PHD A;  5J0T A;  8ICP A;  1ZQF A;  4UBC A;  8ICH A;  2DRB A;  5J0S A;  4F5P A;  4RQ8 A;  4KLL A;  3MDA A;  2BCQ A;  5HRH A;  1HUO A;  4WBZ A;  5HRL A;  4K4H A;  7ICT A;  4GXI A;  8ICG A;  7ICE A;  1ZJN A;  9ICH A;  3H3A A;  5BOL A;  9ICO A;  1TFY A;  3HJ1 A;  3JPO A;  3AQL A;  3PML A;  3RH4 A;  3RH5 A;  4I2G A;  4WC6 A;  1KNY A;  5J2A A;  3HX0 A;  3TFS A;  3AQM A;  4YMN A;  4FHY A;  5DED A;  1UEU A;  3RJJ A;  1ZQC A;  5J0X A;  1XSN A;  3RJF A;  4KLF A;  1JQR A;  4AT9 A;  4FHX A;  4K4I A;  4I2E A;  2O1P A;  1ZQR A;  3UPS A;  4KLT A;  3JYY A;  4QZD A;  5HRG A;  5DB7 A;  2M2W A;  3AQK A;  4M9H A;  1R89 A;  4PH5 A;  5III A;  1ZQY A;  1ZQM A;  5IIL A;  3MDC A;  4WC2 A;  2FMQ A;  4TUQ A;  4KLH A;  4YMO A;  1UET A;  8ICR A;  3C5G A;  3C18 A;  7ICN A;  1YLQ A;  9ICC A;  8ICU A;  3ISD A;  3JPP A;  1TV9 A;  2M2U A;  1MIV A;  4R63 A;  3JPR A;  2BCR A;  4EP7 A;  5D46 A;  2VAN A;  5BPC A;  8ICB A;  3OVS A;  2PFQ A;  5DB8 A;  4PGQ A;  1MQ2 A;  4NLK A;  3UQ2 A;  5F2V O;  4XUS A;  4P2H A;  4XA5 A;  4JWM A;  4WC1 A;  1XSL A;  4QZ8 A;  7ICU A;  4PHE A;  4GXK A;  3RJE A;  5J0O A;  2HHP A;  8ICN A;  7ICR A;  9ICE A;  2ZH5 A;  4WC4 A;  2ZH6 A;  1ZQQ A;  9ICQ A;  5IIN A;  1TVA A;  2DR5 A;  4YN4 A;  4AT8 A;  4NXZ A;  4UB3 A;  5DBC A;  4RWO A;  2ZHA A;  2O5A A;  4YD1 A;  4RWQ A;  1ZQU A;  3AU6 A;  3C66 A;  3V7L A;  1VFG A;  4RQ0 A;  4UB2 A;  4QZE A;  4RQ6 A;  3WFS C;  4KLQ A;  3K75 D;  3RJK A;  4I28 A;  3OV7 A;  1ZQE A;  4WC5 A;  4ATB B;  2PFN A;  9ICR A;  2NRK A;  3ISC A;  1ZQN A;  2FMS A;  4O9M A;  4M9L A;  4KLO A;  8ICK A;  1JMS A;  4DOA A;  3UPQ A;  3UXN A;  9ICV A;  4F5O A;  1ZQP A;  4PGX A;  1HUZ A;  4PGY A;  8ICJ A;  4I2I A;  4X4Q A;  4F5N A;  3HJ4 A;  4TUR A;  4NLN A;  5EOZ A;  3L9D A;  4UBB A;  5HR9 A;  9ICM A;  3HW8 A;  4TUS A;  5HHH A;  4QZI A;  8ICC A;  1MIY A;  4MF8 A;  4QZF A;  3C2K A;  3MGH A;  4X4P A;  5D4B A;  2ZH3 A;  4F5Q A;  3JPN A;  2DR7 A;  7ICF A;  4DOB A;  4E80 A;  4X4S A;  4E8F A;  4NLZ A;  4WBY A;  5J0P A;  4YCX A;  5CJ7 A;  5IIJ A;  4LZD A;  4R65 A;  3C2M A;  4IQV A;  1ZQL A;  5J2D A;  4RT3 A;  4Z6D A;  2PFO A;  3V7K A;  2W9M A;  4ATB A;  3B0X A;  1MQ3 A;  1BPZ A;  1NOM A;  2M2T A;  5J2I A;  5BOM A;  4NKT A;  5J0Y A;  2GWS A;  1R8B A;  1Q79 A;  4KLS A;  4KLJ A;  4UAY A;  5CA7 A;  4YD2 A;  4M5D A;  2ZH7 A;  9ICX A;  2DR9 A;  3V7J A;  5CP2 A;  4QZB A;  3JPS A;  3GDX A;  4M9J A;  3JZ0 A;  4DO9 A;  5DKW A;  4RQ2 A;  3MGI A;  4M0A A;  7ICJ A;  4R64 A;  1ZQS A;  3RJG A;  4WC3 A;  4PHP A;  4JWN A;  4UB5 A;  1ZQB A;  3OGU A;  2Q66 A;  4RWN A;  2PFP A;  8ICX A;  5J2F A;  4QZC A;  4TUP A;  2RFF A;  4PPX A;  5J2K A;  4I2B A;  4O5K A;  1ZQH A;  2BPG A;  7ICP A;  1ZQW A;  8ICM A;  2ISP A;  4I2A A;  2ID1 A;  5CWR A;  4WC0 A;  5HRB A; 
#chains in the Genus database with same CATH topology
 4GZR B;  5EK0 A;  4WBN A;  2BCU A;  4NXV A;  2HN2 A;  3A0B Z;  4LFA B;  4X4U A;  2H3O A;  3RYI B;  5IYZ A;  1XRE A;  3D8C A;  3QO5 A;  3OVA A;  3CMA V;  3LNM B;  1ZQZ A;  2ADQ B;  2EWR A;  1K7D A;  1P84 F;  9ICT A;  1Q43 A;  1S5J A;  1AI4 A;  1PX5 A;  5HRF A;  2BPC A;  3OUY B;  2EIJ C;  3SYQ A;  2PYL A;  5LHH A;  3SJQ C;  1BPY A;  4ZBM A;  3OUF A;  7ICI A;  3SYC A;  4JI4 O;  2H94 A;  1K34 A;  2ZDI C;  3LSS A;  2E5L B;  1PL0 A;  4PA9 A;  3LQC B;  1SES A;  4MVO A;  5L3C A;  4RQ5 A;  2ZNJ A;  1S5H C;  4P4O A;  2PXI A;  2IHO A;  1Q82 W;  9ICK A;  1Q8I A;  3Q4H A;  4WQL A;  4RQ7 A;  4GKJ O;  1CPY A;  4I2F A;  4NXM B;  4O2B B;  4PD4 F;  2JDI G;  4LEY A;  3DC6 A;  4JI0 B;  4E7X A;  1N34 O;  2BBJ A;  7ICM A;  2MK3 A;  4XJE A;  2LW1 A;  4UVA A;  1M56 B;  1FFX A;  4DR1 O;  5J29 A;  3ZS8 C;  1QLN A;  4XBF A;  4NTW A;  4UAW A;  5J2B A;  5TZV A;  5IIK A;  1PM9 A;  1DTO A;  4KL1 A;  4KLG A;  5HHI A;  1GN2 A;  1MIW A;  1O9G A;  3MDS A;  1WB7 A;  1M90 W;  4M04 A;  2ZH1 A;  3E35 A;  3BEH A;  2BCV A;  3LDC A;  2P90 A;  4MT8 A;  4MF2 A;  4QGP A;  4YJ3 A;  2NN4 A;  3L70 H;  4MFF A;  2P67 A;  9ICL A;  4FMT A;  2B1I A;  5DB9 A;  5H5N A;  3WB0 A;  2BTQ A;  4UB6 Z;  2EZP A;  4BWA A;  1Z5V A;  1ZQK A;  3L73 H;  3OT7 A;  4I2D A;  5DDY A;  2QKA A;  2BE3 A;  1XMQ O;  2Q73 A;  3CS5 A;  3WFV A;  3FB5 C;  4DV0 B;  1YEW A;  2R70 A;  3JPT A;  1NBM G;  3OR7 C;  1W2B U;  1XNR B;  2HEP A;  3APO A;  4HNA B;  5CA0 B;  1FXK A;  5CR0 A;  3SGI A;  3RJH A;  3F7Y C;  2A0L A;  5A2Q N;  3WFP A;  3IC7 A;  4DV6 B;  3JAK A;  5L3F A;  5KHH A;  4IIJ B;  5EYP A;  2JS3 A;  3BRC A;  2ZH8 A;  1R6N A;  5KAF Z;  1N33 B;  3RH6 A;  3CJH B;  2R72 A;  2QTS A;  3RVY A;  3E83 A;  3SYO A;  1ZL8 A;  4WCW A;  2F4V B;  2CH7 A;  4LP8 A;  4AQY O;  2DQ0 A;  1N8R W;  4WC7 A;  1M4U A;  2ZH9 A;  1HW7 A;  4QPK A;  4FH5 A;  2I9G A;  3K5N A;  1ENV A;  3RYF A;  1R8C A;  3OVB A;  4I9W A;  2UUA B;  4Z6F A;  2PBE A;  4X4T A;  2WLN A;  4DV4 O;  4UD5 A;  1K8A W;  1HNX O;  4U3J A;  4PDL A;  5EBW C;  3LSU A;  4LH6 A;  8ICL A;  3EVK A;  4XDL A;  2QWP B;  2OIE A;  1OHH G;  4JGS A;  1E1R G;  1ZQT A;  1I5X A;  5EZY A;  3MAQ A;  3ASN B;  4GX1 A;  2A7W A;  4HAM A;  2HR3 A;  3KG2 A;  1R6T A;  4CC5 A;  4O6A A;  4DXW A;  3SPC A;  5CB4 A;  2VS0 A;  1N0N A;  4R8C A;  3W7X A;  4KB6 A;  2YXH A;  1VF6 C;  3B09 A;  5KA5 A;  3JSN A;  3ZHS A;  5DBA A;  4X5V A;  2IJK A;  1AJQ A;  1TAE A;  3CCV V;  3H38 A;  1VQ7 V;  4PV1 B;  1NH2 D;  4UAZ A;  9ICF A;  1H2N A;  2R9I A;  3TGU H;  2GSM B;  3CB2 A;  1ZQG A;  3ZMZ A;  1K4D C;  4Z6E A;  2YS8 A;  1I7F A;  2EIM C;  1PKX A;  1ZX3 A;  3L71 H;  1K73 W;  2ZHB A;  4JTA B;  3SPH A;  1QLE C;  2WLH A;  1KD1 W;  3ZMU A;  4F5P A;  3O9O A;  3P32 A;  2XT9 A;  4TV9 B;  4BW9 A;  3FX7 A;  2N05 A;  4I50 B;  3MDA A;  2BCQ A;  4JI8 O;  3MD0 A;  7ICT A;  4EGW A;  1XDC A;  1MNG A;  1S76 D;  1QVF U;  7ICE A;  4LFB B;  8ICG A;  4TT3 G;  2AGA A;  4BIU A;  1XOU A;  2EIK B;  9ICO A;  3CRA A;  2IM9 A;  4FM0 A;  1YDX A;  3HJ1 A;  4WF9 V;  2ZIO A;  3PML A;  4PI2 A;  2XUM A;  1J5E B;  2Q4P A;  3JAR A;  1SQV H;  5IDJ A;  1G8M A;  5B5E Z;  3CRR A;  5B1B C;  1YJN V;  5CFT A;  4JI6 O;  4R50 A;  1FXV A;  5IJ9 A;  3QF7 A;  4OAH A;  4J42 A;  4TV8 B;  4KLF A;  3M7M X;  2DWD C;  3E8G A;  5FNV A;  4FHX A;  4DUY O;  1KP3 A;  5IJ0 B;  1F51 A;  1NS1 A;  3T4Z A;  5HRG A;  1COW G;  2EUL A;  3ABL C;  1ZQY A;  5IIL A;  1Y67 A;  3N2G B;  4Q20 A;  4WC2 A;  2FMQ A;  1YHQ V;  1UET A;  1WA8 A;  4LC1 A;  1TUB A;  1V9P A;  4JI4 B;  3EF2 A;  2JEU A;  9ICC A;  3E22 B;  2Q69 A;  5ITZ B;  2IJI A;  4WFH A;  1XNQ O;  4JV5 O;  1MIV A;  3JPR A;  2BCR A;  5B1B B;  1JR9 A;  3WB1 A;  4JI3 O;  5BY1 A;  2ZIN A;  5D61 A;  5KHG A;  4NXW A;  2X0L A;  3OVS A;  2PFQ A;  5DB8 A;  4GKJ B;  5F2V O;  2DWE C;  1XL6 A;  2LQT A;  4XA5 A;  4JWM A;  3ZN1 A;  2HFE C;  1N34 B;  2B9Z A;  3ABL B;  3RJE A;  3STZ C;  2HHP A;  3M99 B;  2H8P C;  4DR1 B;  4W4L A;  4FIP C;  3QVN A;  2ZH5 A;  4Z1M G;  1MMM A;  1PNK A;  4CS4 A;  4WQK A;  9ICQ A;  1BCC H;  1QR8 A;  2Q8V A;  2IU0 A;  4AT8 A;  4X62 O;  4YIO A;  5CA1 B;  3W7U A;  4PEL A;  2F43 G;  4UB3 A;  1XI1 A;  5E1A C;  4FZ0 A;  4O4L A;  1VQ9 V;  4P2Z A;  1ZQU A;  3V7L A;  4RQ0 A;  4X1Y A;  4TQD A;  4CZZ A;  4KLQ A;  3RJK A;  3DXR A;  3OV7 A;  1TVK B;  5LGN A;  4X20 B;  4UV8 A;  1M93 A;  2NRK A;  3ISC A;  1XMO O;  2O57 A;  1P7G A;  1VQO V;  2B56 A;  2JGU A;  4KLO A;  2CAZ C;  1JMS A;  5LHI A;  4PA4 A;  1PPJ H;  5BXZ A;  2F95 B;  4F5O A;  5DN6 G;  2E75 B;  1ZQP A;  1JQ0 A;  1R3K C;  2OYQ A;  1S0V A;  1BHB A;  4PGX A;  5JVD A;  4PGY A;  1H8H G;  1XMQ B;  3OMN B;  3D36 A;  5LMU O;  4NLN A;  4B08 A;  3L9D A;  1H2M A;  1QNM A;  5KX5 B;  4UBB A;  3JAW B;  1YJW V;  9ICM A;  3LUT B;  8ICC A;  3HKB A;  4MF8 A;  3CRM A;  2UU9 O;  2Z0A A;  3MGH A;  1OJH A;  4UCO A;  3CME V;  1VQ4 V;  4DV5 O;  4F5Q A;  3JPN A;  1FXH A;  3SYP A;  5B3Q A;  7ICF A;  5LA6 A;  4X4S A;  1GO3 F;  1UPG A;  2YID A;  2AXT Z;  3R65 A;  2QA4 V;  3T1Y O;  4YCX A;  5CJ7 A;  4R65 A;  5GON B;  5L3G A;  1ZQL A;  4Z6D A;  4LNU A;  4AQY B;  3QO8 A;  4LF6 O;  3BFR A;  3V7K A;  4FK5 C;  1AJP A;  2W9M A;  3WB2 A;  3WG7 C;  1GM7 A;  2PUS A;  3NWI A;  4JAV A;  3KZI Z;  5BOM A;  4DV4 B;  3HKC B;  4QPJ A;  1HNX B;  1UJW B;  1R8B A;  4Q6G A;  1Y74 A;  4YD2 A;  5D5P A;  4X64 O;  4BIZ A;  3ERC C;  3D3Q A;  3HR0 A;  2BSK A;  1SKV A;  3FYE B;  3JZ0 A;  2Q0O C;  5DKW A;  2DYS C;  4M0A A;  2IJJ A;  3ER9 B;  4R64 A;  4QJF B;  1G6U A;  4PI0 A;  2V4D A;  1B06 A;  2PTM A;  1ZSP A;  4FLU A;  3ETD A;  2Q66 A;  4DR5 O;  4RWN A;  5BZB A;  4G2K A;  2PFP A;  4DK0 A;  2OTL V;  5J2K A;  4I5S A;  2BPG A;  1ZQW A;  2IUB A;  2VRZ A;  4BAY A;  3WG7 B;  4I2A A;  2HKO A;  3CCU V;  4MFA A;  1AJN A;  1N0J A;  2GAF D;  4X4V A;  4FJC C;  3HKE A;  2CTQ A;  4I29 A;  3K57 A;  4UB4 A;  3SDL A;  1NVP B;  4PDM A;  1YVW A;  1GM8 A;  3AUO A;  2EZO A;  3UXP A;  2PI4 A;  3JD4 A;  4JI8 B;  1K5S A;  8ICA A;  4Z1V A;  3ABT A;  1VQ8 V;  4EED A;  1ZQD A;  3JAT B;  1MZE A;  2CUG A;  4JI7 O;  9ICW A;  4UD4 A;  1V4A A;  1DLB A;  4K97 A;  4NKU A;  4I9Q A;  2YI9 A;  4XQ8 A;  2BOB C;  1SQF A;  4LF5 O;  4YMM A;  4RQ3 A;  4JYY A;  4K0K O;  1BPX A;  4DK1 A;  2W6J G;  4JI6 B;  4FHV A;  3W7S A;  4K35 A;  9ICS A;  5EBM C;  4RAI A;  2ZE5 A;  1GPJ A;  3FD9 A;  4DUY B;  3D3I A;  1R8A A;  3JPQ A;  3ZMT A;  4QZG A;  3OW2 U;  2Q6A A;  4X0A A;  4O4I B;  2P5O A;  3RN4 A;  5LP6 B;  1WP7 A;  1HNZ O;  2ZD9 A;  3RYI A;  4DV1 O;  4I2H A;  1EBO A;  2F66 C;  3OAA G;  4OXS A;  2IU3 A;  5HRE A;  4U3F H;  4XQ7 A;  3VQW A;  4D6T H;  1VQL V;  1N4C A;  2DOS A;  4O5E A;  3OUY A;  2JRI A;  1E1Q G;  1QR9 A;  1XNQ B;  1G1X B;  2C2A A;  5EBL C;  1FFT B;  1Y6X A;  4DR2 O;  1B3Q A;  4JV5 B;  3G6E V;  3OTF A;  4JI3 B;  2OCC C;  3U11 A;  5IE9 A;  3OGI B;  3JCU Z;  2DRA A;  4UB1 A;  8ICT A;  4DRX B;  3B0Y A;  1P4R A;  2B5U A;  1ZQA A;  1R3I C;  3A2F A;  3AK3 A;  2GHY A;  2G38 A;  4AT7 B;  5IT9 N;  1JOY A;  3J81 N;  2ZH2 A;  4O2B A;  5J2C A;  3G71 V;  5IY5 B;  3K5M A;  4DR7 O;  1LUV A;  3FB8 C;  4X1K B;  7ICO A;  2IHM A;  4I2J A;  3F5T A;  3ZN0 A;  5EIB D;  1JAJ A;  1H2K A;  4X62 B;  4J10 A;  3CCM V;  2UXB O;  4WH5 A;  2WLL A;  4X4O A;  5J0Q A;  4JI1 O;  3N2K B;  1F4M A;  1TUE B;  1PV0 A;  5HRK A;  4YJ2 B;  3P3N A;  5H9C A;  4B3T O;  3ABK C;  2OCC B;  5L3B A;  5BMV B;  2AZ0 A;  4XDK A;  1L8D A;  2YDE A;  4E2L A;  1WPB A;  4D7S A;  2AHZ A;  1RM1 C;  2ZH4 A;  2ZDI A;  3SPG A;  3E89 A;  4O5C A;  4FO6 A;  4P4P A;  4KLE A;  1XMO B;  1ZQJ A;  1BE3 H;  3CC2 V;  2QWR B;  2Q67 A;  3SPJ A;  2UXC O;  5B3P A;  1Q78 A;  3RBZ A;  5H6Q A;  1F4N A;  1VF7 A;  2YUA A;  5LMU B;  5LOV B;  1DGS A;  2XAH A;  4O2A B;  2OTJ V;  2LGQ A;  4UVC A;  4FHW A;  3T4D A;  4XDJ A;  1ZQV A;  3AU2 A;  2UU9 B;  4LT6 A;  4I2C A;  7ICV A;  1KP2 A;  3RYC A;  1ZQX A;  4DO2 A;  4Z6C A;  4IG8 A;  4LF9 O;  3TFR A;  1KB9 F;  3WFO A;  4DV5 B;  4X66 O;  2DVI A;  2IJH A;  3TCU A;  4HNA A;  5IWA O;  4N23 A;  5CA0 A;  1KEC A;  4KLU A;  3C3T A;  1RM1 B;  4OPA A;  2YIB D;  3T1Y B;  4LVS A;  5B1O A;  3ZRW A;  4A5U B;  3AQN A;  2RDC A;  3GWK C;  4MSW C;  7ICL A;  3A0H Z;  4IIJ A;  4LF6 B;  3CCR V;  1E79 G;  3RVZ A;  3CJH A;  4KLD A;  1MZF A;  3JYC A;  2ITD C;  4AT9 B;  1ZWI C;  4HYO A;  4KP4 A;  3ABU A;  4X64 B;  3ICX A;  3TXS A;  2WSS G;  4QZ9 A;  3GVM A;  1WOT A;  4B3R O;  1I5Y A;  3VQX A;  3HKD B;  8ICS A;  2LGW A;  2EIJ B;  2YI8 A;  2UXD O;  5J0T A;  4PHD A;  1RFY A;  8ICP A;  1NR1 A;  1ORQ C;  5CN0 A;  4WCE V;  4FLY A;  2P7T C;  4CBC A;  4RQ8 A;  2KG7 B;  1O9H A;  4DR5 B;  5HRH A;  1GH6 A;  3KKY A;  3JD2 A;  9ICH A;  4LR3 A;  3H3A A;  3AG4 C;  1J95 A;  3UT5 B;  1YF2 A;  4JF3 A;  3JPO A;  3ABM C;  1NVP D;  2F1M A;  2BBH A;  3RFR A;  3RH4 A;  3JD3 A;  4WC6 A;  2YIC A;  1S3J A;  3SJB C;  3TFS A;  3QO7 A;  4O4H B;  4YMN A;  1CP9 A;  2W0X A;  2QM4 A;  1M1K W;  1UEU A;  1Q7Y W;  5J0X A;  4AHC A;  4LF7 O;  2KSD A;  1FJG O;  1WN7 A;  3RJF A;  3JSL A;  3OTO O;  2EJ7 A;  4K4I A;  3CP1 A;  4EEQ A;  3DGE A;  3JAM N;  3OFN G;  5LL6 Y;  2WLI B;  2HP8 A;  3I56 V;  4JI5 B;  3UPS A;  4QZD A;  2FCL A;  1IBK O;  3AQK A;  4M9H A;  5III A;  4UCU A;  4K3A A;  1S72 V;  4TUQ A;  1VQM V;  4JI7 B;  5JCO A;  4YMO A;  4TSF G;  1L0N H;  3C5G A;  4TV9 A;  2B1G A;  4I50 A;  4MVR A;  3ABM B;  5CFU A;  3RW0 A;  1N36 O;  4LF5 B;  2Q68 A;  3LSQ A;  1BMF G;  2EX3 A;  4FZ1 A;  4K0K B;  1CEZ A;  3JPP A;  4JLZ A;  3ZX6 A;  3VQV A;  4FLW A;  3B4S A;  4N21 A;  4EP7 A;  1H38 A;  3B8M A;  1Y76 B;  1PNL A;  3ZHQ A;  3F7V C;  4H33 A;  1MQ2 A;  1RSO A;  4NXT A;  3SYA A;  4P2H A;  3LDE A;  2YIA A;  3I55 V;  3MCR A;  1NTM H;  1HNZ B;  1Q86 W;  2A79 B;  2ETN A;  4DV1 B;  4QZ8 A;  7ICU A;  4PHE A;  2XHB A;  5J0O A;  1SQP H;  1Y66 A;  3K5L A;  5IJ0 A;  2CGO A;  1A32 A;  3W7W A;  3DSQ A;  9ICE A;  2QM8 A;  4MVM A;  1JFF B;  4WC4 A;  4U7N A;  2JK5 C;  1ZQQ A;  5KHK A;  3N2G A;  2QWO B;  4O69 A;  1K4C C;  3STL C;  4DR2 B;  4RWO A;  2ZHA A;  1Z2G A;  1FXK C;  1JVM A;  4YD1 A;  4J80 A;  4JZ2 A;  1IZ3 A;  3E2E A;  3AU6 A;  4QZE A;  4RQ6 A;  1YCI A;  1GK9 A;  3CE2 A;  2HJF C;  3E22 A;  1YZB A;  4ATB B;  5JQG B;  2PFN A;  5C8Y A;  1JX9 A;  3F5W C;  2PYJ A;  3BAB A;  2DE0 X;  1ZQN A;  4LFC O;  4RQE A;  2ZE6 A;  4I0X B;  4X65 O;  3VOU A;  2VQF O;  3UXN A;  9ICV A;  2AHY A;  4I2I A;  4RO2 A;  4OPH A;  2BTQ B;  4DR7 B;  4F5N A;  1YI2 V;  1M5I A;  5L3E A;  4NKG B;  4MW8 A;  4KM5 A;  4CC6 A;  2QTO A;  4QE7 A;  1VIB A;  2ZKO A;  4NXX A;  2UXB B;  4QZI A;  1MIY A;  4JI1 B;  1Q6I A;  5JJN B;  4QZF A;  4NXU A;  4X1I B;  2FKX A;  4X4P A;  1HR0 O;  4B3T B;  4IL6 Z;  1X4T A;  4I7Z B;  4UFZ A;  3PN1 A;  4H0L B;  2ZH3 A;  5JTG A;  2IH1 C;  2DR7 A;  3LNN A;  5CA1 A;  2ZT9 B;  4DOB A;  3ZJZ A;  5J0P A;  1YSC A;  2ZE7 A;  3ZCC A;  2NR5 A;  1NTZ H;  1B04 A;  2EIM B;  3C2M A;  4RT3 A;  4K9B A;  1XL4 A;  3FKS G;  4RWU A;  2UXC B;  2PFO A;  1IXB A;  1TVK A;  2BTO A;  2A06 H;  2XTA A;  4X20 A;  3K9S A;  3B0X A;  1NOM A;  5J2I A;  5CA3 A;  1GMG A;  4MW3 A;  5J0Y A;  3FAV A;  1QLE B;  2XOK G;  3TXQ A;  2B51 A;  3RYF B;  4DV3 O;  4KLJ A;  1OCR C;  3JAL B;  5CA7 A;  2EIL C;  2E76 B;  4NVP A;  3CEI A;  3RWR D;  3OUS A;  4J7J A;  2QE7 G;  3QNE A;  4QZB A;  1QHT A;  1XHX A;  3A8T A;  1GN4 A;  4LF9 B;  5KX5 A;  2LP7 A;  3ETQ A;  3JAW A;  4X66 B;  4DUZ O;  1IVS A;  3RJG A;  4UCT A;  5IWA B;  2Y48 A;  4PHP A;  3UO3 A;  1ZQB A;  3OGU A;  1G4Y B;  4FLT A;  4UV9 A;  8ICX A;  4UCS A;  2ITC C;  3H1K H;  3CX5 F;  4QZC A;  2XAS A;  1UFI A;  3G67 A;  4PPX A;  4I2B A;  4O5K A;  3E8H A;  2W0F C;  2QSA A;  4WFA V;  2ISP A;  1K9M W;  5GON A;  4LF8 O;  4G28 B;  1ZQO A;  3CRC A;  1NZ6 A;  2P66 A;  1OCR B;  3KCX A;  4B3R B;  2EIL B;  3WU2 Z;  1VQ5 V;  1BT8 A;  4GCZ A;  1ZAU A;  5FPO A;  1HWY A;  2UXD B;  3ZHU A;  1H2L A;  3HKC A;  2PZS A;  2KQX A;  2YIB A;  4C7U A;  5D49 A;  4RPZ A;  4F5R A;  4JI2 B;  5B3S C;  2ILM A;  5LMN O;  4JTC B;  2Q0A A;  5J0U A;  3H01 A;  2JVD A;  3PJS K;  5KUK A;  4DW1 A;  3CSX A;  4IYH A;  1BSM A;  3ZED A;  5JH7 A;  5KA6 A;  5J0W A;  2CK3 G;  1SF9 A;  4R66 A;  1KKC A;  1ZLZ A;  2N04 A;  3PNC A;  1IBM O;  2LO1 A;  1GTO A;  1KUQ A;  4GUN A;  9ICI A;  4IQW A;  3NKU A;  3JAR B;  3DTU B;  4LF7 B;  3E8F A;  3OD4 A;  3OMA B;  1FJG B;  2HVJ C;  3OTO B;  1F5A A;  3IJ4 A;  3UCS C;  4TWK A;  2GDS A;  5KHI A;  1Q81 W;  3PMN A;  1RZT A;  1VJ7 A;  3TET A;  2QR4 A;  3C2L A;  8ICY A;  1IBK B;  5B3S B;  1BPE A;  1X59 A;  8ICQ A;  4GT1 A;  2P06 A;  4RUE A;  5IIM A;  1AR5 A;  4CH6 A;  4FFK A;  2JGD B;  2RN9 A;  2WA4 A;  5H2F Z;  4TOI A;  3CCS V;  2XAQ A;  3UQ8 A;  4XRH A;  3I5D A;  4ZOL B;  5DEC A;  1TUB B;  1N36 B;  3AG7 A;  2LJ2 A;  2UXX A;  1BZK A;  3JAT A;  4JTD B;  3TK1 A;  2ZM6 O;  3BVO A;  1WNS A;  1XBL A;  2ZCE A;  1Z5W A;  3OWG A;  1BPD A;  1QCE A;  9ICN A;  1NU1 H;  2CTP A;  3J7A U;  1W0J G;  3AK2 A;  4HBN A;  1HP8 A;  3W7T A;  3CCQ V;  3LK9 A;  2ZE8 A;  4FFB B;  1MOF A;  4GKK O;  1ZQI A;  1RP3 B;  3CK6 A;  1BPB A;  4J9Y B;  3M8A A;  3JD1 A;  3MBY A;  4I27 A;  2FMP A;  4O4I A;  1FA0 A;  5J2G A;  1KDH A;  5LP6 A;  5LHG A;  1I08 A;  4X0B A;  3D36 C;  1VQ6 V;  2BCS A;  2JJ2 G;  7ICK A;  3CXH F;  3IGA C;  4MKP A;  3X2Q C;  3L72 H;  4AT8 B;  4DR6 O;  1FS0 G;  9ICU A;  1Q6H A;  4LF4 O;  5B1N A;  1BHA A;  4KXR A;  4P30 A;  4O67 A;  2QJ1 A;  2GA9 D;  1U97 A;  1K33 A;  1GAX A;  3CWB H;  4LFC B;  3HIY A;  3RJI A;  5LXT A;  4X65 B;  8ICI A;  1DK1 A;  1OZ0 A;  7ICQ A;  2VQF B;  4N7R A;  3CC4 V;  4X4N A;  1SZT A;  4DRX A;  4M47 A;  2P22 C;  4Z2W A;  4QZA A;  2R9R B;  2DYS B;  1P7B A;  1OCO C;  1V54 C;  1XHZ A;  1R6K A;  4UVB A;  4JI5 O;  1JJ2 U;  1KC8 W;  5HRI A;  4AT7 A;  4DYL A;  1WP8 A;  2OWO A;  4DV7 O;  1MA1 A;  2RQ6 A;  1FPO A;  5J2J A;  3ZRX A;  1HR0 B;  4MS2 A;  3X2Q B;  2DR8 A;  4NTY A;  4KLM A;  1PNM A;  1S5L Z;  3EHB B;  5HRD A;  3P3P A;  1UEV A;  4NY8 A;  2QWQ B;  3QG5 A;  3OR6 C;  3JAS A;  3N2K A;  8ICF A;  1VMG A;  4OX9 O;  1N32 O;  4NR1 A;  3ZMV A;  2ISO A;  4GYC B;  5IIO A;  1QVG U;  1I0H A;  1AB3 A;  2FTK A;  5J2U B;  4PA6 A;  3E8B A;  4LNU B;  3TJT A;  1IBL O;  3OEH G;  5J2T B;  4X4R A;  4NM1 A;  8ICE A;  1EFR G;  4H37 A;  4WFE A;  4K9A A;  4MVZ A;  4L87 A;  1ARO P;  3E86 A;  1V54 B;  3GB7 C;  4ZI7 B;  1XIL A;  4DV3 B;  2UUC O;  2CGN A;  3FB6 C;  1LR1 A;  2DW4 A;  9ICB A;  2QWN B;  2V1D A;  4CS2 A;  3UQ0 A;  3VBB A;  9ICJ A;  5CWR A;  3ZIA G;  5LOV A;  2RCV A;  1ZQF A;  4DUZ B;  2DRB A;  5J0S A;  1LUW A;  1EN6 A;  1KU9 A;  4KLL A;  3CYO A;  1HUO A;  4MVU A;  5HRL A;  3C3S A;  1ZJN A;  4I55 B;  1M9N A;  5BOL A;  1TFY A;  1PD3 A;  4P9O A;  4JAA A;  1SET A;  4LF8 B;  3RH5 A;  4I2G A;  4OGQ B;  2YEV B;  3HX0 A;  3AQM A;  4K8X A;  3CHX A;  4FHY A;  1TGO A;  1SQB H;  5DED A;  4ICG A;  1MSW D;  2EIN C;  3G4S V;  4D7T A;  3RJJ A;  1SA0 B;  2DYR C;  2Q7H A;  1SC5 B;  4EB6 B;  1VQP V;  5AG2 A;  4AT9 A;  2ADP A;  4I2E A;  4MVS A;  1L0L H;  2O1P A;  4KLT A;  3G6B A;  3JYY A;  2M2W A;  5LMN B;  1R1B A;  4UUJ C;  3HKD A;  4RUF A;  3FFQ A;  2MW2 B;  4JZG A;  3NVO A;  4LWS B;  1ZQM A;  3MDC A;  2GTS A;  1LNQ A;  4IHJ B;  1F7Y A;  4K99 A;  8ICR A;  2XAG A;  2ZXW C;  1AI7 A;  2KG7 A;  4FM2 A;  7ICN A;  1SZX A;  2DJV A;  1FD9 A;  1IBM B;  5KAI Z;  4O68 A;  4H44 B;  2NNU A;  5JJE B;  3UT5 A;  2L35 A;  2OIG A;  3B2E E;  4EKW A;  2EIN B;  1R73 A;  3RGB A;  2DYR B;  8ICB A;  5EC2 C;  4PGQ A;  3BCC H;  4O4H A;  3BA8 A;  4DV2 O;  4NLK A;  3UQ2 A;  4XUS A;  1YXB A;  3JD0 A;  3KCY A;  3BY6 A;  4FPP A;  2YC0 A;  2Z5U A;  1XSL A;  1IUR A;  4JPR A;  4OAG A;  4UXN A;  2BCC H;  3SPI A;  1AVM A;  1DF5 A;  2WLI A;  3K5O A;  4K8Z A;  4KHP O;  3PHZ A;  3ABK B;  1YTF B;  3O65 A;  3SR2 C;  2ZXW B;  1I94 O;  2ZH6 A;  1NT2 B;  3H1L H;  3NR7 A;  5IYC O;  1GM9 A;  1RPO A;  4GX0 A;  2ZM6 B;  4NXZ A;  5DBC A;  3K06 A;  2O5A A;  1AI6 A;  1M56 C;  3K0D A;  4W4K A;  4RWQ A;  3N27 A;  3RYH B;  1JPX A;  3C66 A;  1VFG A;  3C90 A;  4BW5 A;  5GTH Z;  1WPX A;  4JLX A;  4LEW A;  4TUY B;  4I4T B;  3CXC U;  5LYJ B;  3AG3 C;  2YXL A;  4B7K A;  2BOC C;  1H2S B;  1GN6 A;  1KKD A;  5CBF A;  4DOA A;  1Y76 A;  1SS3 A;  5BR8 O;  4FO1 A;  4GKK B;  4L8J A;  1ZTE A;  4F6R B;  4ZHQ B;  3OEE G;  5TIS Z;  1BS3 A;  1MSD A;  2QKS A;  3HB3 B;  5LGU A;  3HJ4 A;  4TUR A;  4JI2 O;  1H8E G;  1BL8 A;  4PA3 A;  4LEV A;  5HR9 A;  5D62 A;  4J11 A;  1JJO A;  3R66 A;  3HW8 A;  2IH3 C;  1SRY A;  2Y69 C;  5LBQ A;  4O4J B;  4TQF A;  4DR6 B;  2Q7E A;  1JFF A;  1EZJ A;  3AEI A;  4G27 B;  4B3S O;  2WLL B;  4LF4 B;  2FYU H;  4X88 A;  2Y4U A;  2CDY A;  3CCL V;  2L6L A;  2Y0I A;  4NTX A;  4ASU G;  3ER8 C;  2RJZ A;  3ZRV A;  1XEQ A;  4BIO A;  5HFL A;  1YIT V;  1FKA O;  4E8F A;  4NLZ A;  5KMG B;  5IIJ A;  3AG3 B;  2GUZ B;  4PDV A;  2F23 A;  5J2D A;  4EEB A;  4CH5 A;  1TA8 A;  4WBN B;  1VAR A;  4ATB A;  5JQG A;  1MQ3 A;  1BPZ A;  5JWP A;  3K03 A;  2M2T A;  4NKT A;  1D5N A;  5IYZ B;  4I0X A;  3CPW U;  3JCZ A;  1Q79 A;  4KLS A;  2X6B A;  1Q90 D;  2E3C A;  3OMI B;  4J9Z B;  4DV7 B;  2OT5 A;  2ZQM A;  1XUQ A;  1FAF A;  3V7J A;  2DR9 A;  1BQ0 A;  2Y69 B;  3GDX A;  4R6Z A;  1VQN V;  2ZR2 A;  1GRJ A;  3K7D A;  3AG4 B;  1V55 C;  4RQ2 A;  3SJC C;  7ICJ A;  3RYC B;  4FLZ A;  4DR3 O;  4JYB A;  4PHZ A;  4WC3 A;  2N74 A;  4JWN A;  3THO A;  1VF6 A;  4UB5 A;  3AK1 A;  1H2G A;  3BHP A;  3U10 A;  4OX9 B;  1WAZ A;  4X1I A;  1N32 B;  2UUB O;  3FYI B;  1EN5 A;  3ASN C;  4OAF A;  1IX9 A;  1NKD A;  3ZRW B;  1IBL B;  1WB8 A;  3Q4H B;  2ID1 A;  4WC0 A;  5HRB A;  1EN4 A;  3L74 H;  2UUC B;  4P4M A;  4TV8 A;  8ICV A;  1VQK V;  4YY3 O;  2XAF A;  2WLM A;  3U0Z A;  4K98 A;  2Y0P A;  1NO5 A;  5DBB A;  2WLJ A;  3HWT A;  1MAB G;  4B3M B;  3T2M A;  4FHP A;  4F6E A;  2W6I G;  3JAL A;  1FFX B;  1V55 B;  1GKF A;  3ETG A;  1VP7 A;  4IQU A;  5J0R A;  4F4L A;  2HHH O;  1CXZ B;  2PGG A;  1FYJ A;  4X89 A;  4LBE C;  1BQZ A;  3ISB A;  8ICZ A;  5JCO C;  5D63 A;  5ITZ A;  5J2E A;  2QGN A;  3AG1 C;  3H39 A;  4YJ3 B;  3WFR E;  2ARH A;  2VQE O;  1OCC C;  4RT2 A;  4M9G A;  2UXN A;  4GXJ A;  2EIK C;  2RNB A;  3RT3 C;  4M9N A;  3H1I H;  1OV9 A;  4GX5 A;  5DM6 V;  3VQY A;  4MTF A;  1NI8 A;  5DDM A;  4LZG A;  1FXK B;  2P6J A;  1OCZ C;  9ICP A;  4CH4 A;  3JAK B;  1YIJ V;  3HPL C;  4KFM A;  5EYP B;  3ASO C;  4NM2 A;  1PP9 H;  2CTR A;  3AG1 B;  4YHH O;  3UXO A;  3IFX A;  3H1J H;  1OCC B;  2HN1 A;  2DN9 A;  1P49 A;  4WFB V;  3T1H O;  3CD6 V;  1ZL8 B;  1NQT A;  2CH7 B;  2GV9 A;  4CS3 A;  1KYO F;  5J2H A;  4NXN O;  1YTF D;  2GBO A;  9ICA A;  3K58 A;  5CMU A;  4DV2 B;  4FH3 A;  2P4K A;  1RSO B;  4U3J B;  5FLX N;  4EBJ A;  3OE7 G;  8ICW A;  3APQ A;  5H6R A;  2K9P A;  4MTG A;  4KHP B;  5EZY B;  3K08 A;  5CBG A;  4J7Z A;  4UB8 Z;  4WFG A;  1KQS U;  1OCZ B;  1I94 B;  4MFC A;  2PI5 A;  5DB6 A;  1RPL A;  4RQ1 A;  5CB4 B;  3ASO B;  2Q7G A;  2JGD A;  3NYB A;  4DR4 O;  4J7K A;  5CHG A;  2PY5 A;  3EFF K;  3OM3 B;  4RPX A;  4DOC A;  4PA7 A;  5CBH A;  1TFW A;  4ZOL A;  7ICH A;  2X7R B;  1US6 A;  2WAM A;  5HC9 A;  2IW5 A;  3ZHV A;  5CB1 A;  1AP6 A;  3QTC A;  1HNW O;  7ICS A;  3CCE V;  4QZH A;  3K04 A;  4RPY A;  3C5F A;  5C8Y B;  5BR8 B;  4IQT A;  5J9P C;  4KUM A;  3MHH C;  1PL4 A;  2LW7 A;  1BGY H;  2XND G;  1Y4M A;  2CE4 A;  8ICO A;  4FVM A;  5EIB C;  1L1F A;  4AI8 A;  2JEX A;  4FFB A;  5B1A C;  7ICG A;  4UCR A;  4EFB A;  1EM1 A;  5FL7 G;  9ICG A;  4RQ4 A;  1OU5 A;  4E4E A;  4FLX A;  1DF4 A;  2Z3Y A;  2P4V A;  4B3S B;  3V72 A;  5LGT A;  1ZJM A;  4KLI A;  2NLJ C;  1KBH A;  3L75 H;  4M2Y A;  2OCH A;  2WWW A;  2XAJ A;  4EBK A;  3WFQ E;  4S3N A;  1W59 A;  2DQ3 A;  1AR1 B;  4JYA O;  2BPF A;  1IXM A;  1KMI Z;  1XSP A;  2M2V A;  3H1H H;  4RQF A;  2WA3 A;  4PHA A;  5CHE A;  2LFS A;  3K9A A;  5IJ9 B;  3LDD A;  1SQG A;  1JN3 A;  3ZMS A;  1F23 A;  1R3J C;  2QEX V;  5FNV B;  2QKC A;  4YXW G;  2Y4T A;  3FAV B;  5B1A B;  1KEJ A;  4I0U A;  2F93 B;  3H37 A;  4LFA O;  2GTA A;  3BAA A;  4RWP A;  4K4G A;  3DC5 A;  3ZRS A;  4UBC A;  8ICH A;  4DR3 B;  1WA8 B;  3CC7 V;  3ZHR A;  4CH3 A;  2JJ1 G;  2M7W A;  4AIL C;  4WBZ A;  4K4H A;  2UUB B;  1S77 D;  3UKM A;  4GXI A;  3OGC C;  1QU7 A;  2HVK C;  5E79 Z;  3K0G A;  4K96 A;  4J41 A;  2V7Q G;  1Q5O A;  1K97 A;  3B77 A;  4MVQ A;  3AQL A;  4ZIB A;  5KHJ A;  4BR6 A;  1KNY A;  4WOY A;  4EFE A;  5J2A A;  4P9P A;  2E5L O;  2HLD G;  2Q9L A;  2ODM A;  4YY3 B;  2X6C A;  5J2U A;  1ZQC A;  1JMK C;  1XSN A;  5J2T A;  4MTX A;  3H9V A;  2D3O W;  5HFM A;  1NR7 A;  5CFS A;  2FL4 A;  1JQR A;  4NYK A;  3EXA A;  3P30 A;  4DW0 A;  2QDO A;  4ZI7 A;  1Q6U A;  1ZQR A;  4NXM O;  1K3E A;  3JCF A;  5DB7 A;  2HHH B;  3UO2 A;  1WJZ A;  1R89 A;  4JI0 O;  4PH5 A;  4NB5 A;  2Q5Z A;  3K79 A;  4KLH A;  1T5E A;  1ROP A;  3C18 A;  4O4L B;  4YIP A;  1YLQ A;  2VWK A;  4X1Y B;  5IYD O;  3DXR B;  3S3X A;  5JH7 B;  8ICU A;  1IDS A;  3ISD A;  4I55 A;  2VQE B;  1YJ9 V;  4H13 B;  3S3W A;  1TV9 A;  1SQX H;  3ETE A;  2M2U A;  1ZUQ A;  4R63 A;  3ZHT A;  4GX2 A;  4JAS A;  5D46 A;  2JS5 A;  1QQC A;  2VAN A;  5BPC A;  2FB5 A;  1W0K G;  1AR4 A;  2YEV A;  5FPR A;  2AZ2 A;  4LH7 A;  5JVD B;  4EV6 A;  1URF A;  4JYC A;  1B6Q A;  4WC1 A;  1SA0 A;  4IT5 A;  4EB6 A;  4MTO A;  2ZNI A;  4B7E A;  4GXK A;  5EC1 C;  1AIL A;  1XQ8 A;  3HKB B;  1K92 A;  4X1K A;  8ICN A;  4PDR A;  4HX0 A;  1M57 C;  5GTI Z;  3G80 A;  1D2D A;  7ICR A;  3K3W A;  2X6A A;  3BPZ A;  2KKW A;  3ZBH A;  4DV0 O;  4HZ3 A;  1VEW A;  1VF5 B;  5IIN A;  4LWS A;  5LP6 C;  1TVA A;  1XNR O;  2DR5 A;  4YN4 A;  4YJ2 A;  2WLK A;  2DMX A;  4YHH B;  5LA6 B;  1AI5 A;  1QBZ A;  4IHJ A;  1THZ A;  5BMV A;  2LFR A;  4ABM A;  4GLX A;  4DV6 O;  1SQQ H;  4WFF A;  2WPD G;  3T1H B;  2HJD A;  4UB2 A;  4QE9 A;  3WFS C;  3K75 D;  1WLE A;  4I28 A;  1ZQE A;  4NXN B;  2D2C B;  5GW7 A;  4WC5 A;  5IYB O;  1N33 O;  5KUM A;  1OCO B;  9ICR A;  3CCJ V;  1JCH A;  2EBO A;  5D5Q A;  4FLV A;  2FMS A;  4O9M A;  4M9L A;  3AG2 C;  8ICK A;  4PJ0 Z;  2F4V O;  3UPQ A;  1EZV H;  2YSU B;  1Y74 B;  5A9G A;  3IAY A;  1Q3E A;  4B3M O;  1HUZ A;  8ICJ A;  1AP5 A;  2ATK C;  2BSK B;  4O2A A;  2UUA O;  4X4Q A;  1JA8 A;  2K1E A;  1M57 B;  3CRQ A;  4LCU C;  5EOZ A;  4OAI Z;  1D5A A;  3IC9 A;  2M6Y A;  2HG5 C;  4TUS A;  4LEZ A;  5HHH A;  2ZR3 A;  3ML0 A;  4DR4 B;  2EJR A;  2FML A;  1MG1 A;  3C2K A;  2R9A A;  2QM7 A;  5IY5 C;  5D4B A;  2KB1 A;  2A9H A;  5KLV H;  1NTK H;  2RMK B;  3UM7 A;  4E80 A;  2B4V A;  4WBY A;  1HNW B;  4ZKI A;  4IYI A;  4LZD A;  1R3L C;  4IGG A;  3BA9 A;  3RYH A;  4IQV A;  2VWJ A;  3AG2 B;  1RPR A;  3T1C A;  4TUY A;  5LXT B;  4I4T A;  2YXY A;  2ZIM A;  5LYJ A;  3HKE B;  3B40 A;  3MHS C;  3NXS A;  3FB7 C;  1U96 A;  2GWS A;  2A3Q A;  1HDJ A;  5K1P A;  3A0R A;  3K59 A;  4UAY A;  2E74 B;  5B66 Z;  5L3D A;  4F6R A;  4M5D A;  4ZHQ A;  2IBZ H;  4QIW F;  2ZH7 A;  1K5Q A;  4UCV A;  9ICX A;  5CP2 A;  4JAU A;  5K1X A;  3JPS A;  4M9J A;  1NH2 B;  4DO9 A;  3MGI A;  2CTW A;  3SJA C;  1ZQS A;  5JJJ B;  4K8V A;  4O4J A;  4FM1 A;  3GWO A;  4JYA B;  1SER A;  2AW9 A;  2PF4 E;  4X9Q A;  5J2F A;  3JAS B;  4LFB O;  4TUP A;  1GN3 A;  3B8N A;  2RFF A;  1ZQH A;  3J80 N;  4U7O A;  7ICP A;  4QNH B;  8ICM A;  5KMG A;  2JIZ G;  4R7C A;  1NJI W;  2GUZ A;  1J5E O;  4X8A A;  5C93 A; 
#chains in the Genus database with same CATH homology
 1ZQO A;  4MFA A;  4P4M A;  2P66 A;  8ICV A;  2BCU A;  4X4V A;  4X4U A;  4I29 A;  1NO5 A;  4UB4 A;  5DBB A;  3HWT A;  3OVA A;  4FHP A;  1ZQZ A;  5D49 A;  4RPZ A;  4F5R A;  3AUO A;  9ICT A;  3UXP A;  4IQU A;  5J0R A;  8ICA A;  5J0U A;  1PX5 A;  5HRF A;  2BPC A;  3OUY B;  1ZQD A;  9ICW A;  4UD4 A;  3ISB A;  8ICZ A;  1BPY A;  1V4A A;  5J0W A;  4NKU A;  7ICI A;  5J2E A;  4XQ8 A;  4R66 A;  3H39 A;  4RQ3 A;  4YMM A;  3PNC A;  3WFR E;  1BPX A;  3LQC B;  9ICI A;  4IQW A;  4RT2 A;  4FHV A;  4RQ5 A;  4M9G A;  4GXJ A;  4P4O A;  2PXI A;  9ICS A;  9ICK A;  4M9N A;  1F5A A;  4RQ7 A;  4I2F A;  1R8A A;  3PMN A;  3JPQ A;  1RZT A;  4QZG A;  1VJ7 A;  3C2L A;  4X0A A;  8ICY A;  1BPE A;  4E7X A;  8ICQ A;  7ICM A;  4I2H A;  5IIM A;  5DDM A;  4LZG A;  5HRE A;  4XQ7 A;  5J29 A;  4UAW A;  9ICP A;  4XRH A;  5J2B A;  5TZV A;  5IIK A;  5DEC A;  4O5E A;  4KLG A;  3OUY A;  5HHI A;  4NM2 A;  1MIW A;  3UXO A;  4M04 A;  2ZH1 A;  1BPD A;  2DRA A;  9ICN A;  4UB1 A;  2BCV A;  5J2H A;  8ICT A;  4MF2 A;  3B0Y A;  9ICA A;  4FH3 A;  3LK9 A;  4MFF A;  9ICL A;  5DB9 A;  1ZQA A;  1ZQI A;  4AT7 B;  4EBJ A;  8ICW A;  1ZQK A;  4I2D A;  5DDY A;  2ZH2 A;  2BE3 A;  5J2C A;  1BPB A;  3MBY A;  4I27 A;  2FMP A;  1FA0 A;  5J2G A;  1KDH A;  7ICO A;  3JPT A;  2IHM A;  4I2J A;  4X0B A;  4MFC A;  5DB6 A;  2BCS A;  1JAJ A;  1RPL A;  4RQ1 A;  7ICK A;  4X4O A;  5CR0 A;  3NYB A;  5CHG A;  5J0Q A;  3RJH A;  3WFP A;  4RPX A;  5HRK A;  4DOC A;  4AT8 B;  9ICU A;  1TFW A;  7ICH A;  2ZH8 A;  5HC9 A;  2ZH4 A;  3RH6 A;  4O5C A;  5CB1 A;  4P4P A;  4FO6 A;  4KLE A;  3HIY A;  1ZQJ A;  7ICS A;  3RJI A;  4QZH A;  8ICI A;  7ICQ A;  4RPY A;  3C5F A;  4WCW A;  4IQT A;  4X4N A;  4WC7 A;  2ZH9 A;  1Q78 A;  4FH5 A;  2I9G A;  4M47 A;  1R8C A;  4QZA A;  3OVB A;  4Z6F A;  8ICO A;  2PBE A;  4X4T A;  4UD5 A;  5HRI A;  7ICG A;  4AT7 A;  4FHW A;  8ICL A;  1ZQV A;  1ZQT A;  9ICG A;  3AU2 A;  4RQ4 A;  1OU5 A;  4LT6 A;  5J2J A;  4I2C A;  7ICV A;  1ZQX A;  4Z6C A;  4IG8 A;  2DR8 A;  3V72 A;  3TFR A;  1ZJM A;  4KLI A;  4KLM A;  3WFO A;  4M2Y A;  2DVI A;  5HRD A;  4EBK A;  1UEV A;  3WFQ E;  4NY8 A;  4S3N A;  4KLU A;  8ICF A;  4LVS A;  2BPF A;  1XSP A;  2M2V A;  3AQN A;  7ICL A;  5DBA A;  4X5V A;  4PHA A;  2ISO A;  3H38 A;  5IIO A;  4UAZ A;  4X4R A;  4KLD A;  1JN3 A;  8ICE A;  4NM1 A;  9ICF A;  1ZQG A;  4AT9 B;  4Z6E A;  1KEJ A;  4QZ9 A;  1WOT A;  9ICB A;  3H37 A;  8ICS A;  3UQ0 A;  4RWP A;  2ZHB A;  4K4G A;  9ICJ A;  4PHD A;  5J0T A;  8ICP A;  1ZQF A;  4UBC A;  8ICH A;  2DRB A;  5J0S A;  4F5P A;  4RQ8 A;  4KLL A;  3MDA A;  2BCQ A;  5HRH A;  1HUO A;  4WBZ A;  5HRL A;  4K4H A;  7ICT A;  4GXI A;  8ICG A;  7ICE A;  1ZJN A;  9ICH A;  3H3A A;  5BOL A;  9ICO A;  1TFY A;  3HJ1 A;  3JPO A;  3AQL A;  3PML A;  3RH4 A;  3RH5 A;  4I2G A;  4WC6 A;  1KNY A;  5J2A A;  3HX0 A;  3TFS A;  3AQM A;  4YMN A;  4FHY A;  5DED A;  1UEU A;  3RJJ A;  1ZQC A;  5J0X A;  1XSN A;  3RJF A;  4KLF A;  1JQR A;  4AT9 A;  4FHX A;  4K4I A;  4I2E A;  2O1P A;  1ZQR A;  3UPS A;  4KLT A;  3JYY A;  4QZD A;  5HRG A;  5DB7 A;  2M2W A;  3AQK A;  4M9H A;  1R89 A;  4PH5 A;  5III A;  1ZQY A;  1ZQM A;  5IIL A;  3MDC A;  4WC2 A;  2FMQ A;  4TUQ A;  4KLH A;  4YMO A;  1UET A;  8ICR A;  3C5G A;  3C18 A;  7ICN A;  1YLQ A;  9ICC A;  8ICU A;  3ISD A;  3JPP A;  1TV9 A;  2M2U A;  1MIV A;  4R63 A;  3JPR A;  2BCR A;  4EP7 A;  5D46 A;  2VAN A;  5BPC A;  8ICB A;  3OVS A;  2PFQ A;  5DB8 A;  4PGQ A;  1MQ2 A;  4NLK A;  3UQ2 A;  5F2V O;  4XUS A;  4P2H A;  4XA5 A;  4JWM A;  4WC1 A;  1XSL A;  4QZ8 A;  7ICU A;  4PHE A;  4GXK A;  3RJE A;  5J0O A;  2HHP A;  8ICN A;  7ICR A;  9ICE A;  2ZH5 A;  4WC4 A;  2ZH6 A;  1ZQQ A;  9ICQ A;  5IIN A;  1TVA A;  2DR5 A;  4YN4 A;  4AT8 A;  4NXZ A;  4UB3 A;  5DBC A;  4RWO A;  2ZHA A;  2O5A A;  4YD1 A;  4RWQ A;  1ZQU A;  3AU6 A;  3C66 A;  3V7L A;  1VFG A;  4RQ0 A;  4UB2 A;  4QZE A;  4RQ6 A;  3WFS C;  4KLQ A;  3K75 D;  3RJK A;  4I28 A;  3OV7 A;  1ZQE A;  4WC5 A;  4ATB B;  2PFN A;  9ICR A;  2NRK A;  3ISC A;  1ZQN A;  2FMS A;  4O9M A;  4M9L A;  4KLO A;  8ICK A;  1JMS A;  4DOA A;  3UPQ A;  3UXN A;  9ICV A;  4F5O A;  1ZQP A;  4PGX A;  1HUZ A;  4PGY A;  8ICJ A;  4I2I A;  4X4Q A;  4F5N A;  3HJ4 A;  4TUR A;  4NLN A;  5EOZ A;  3L9D A;  4UBB A;  5HR9 A;  9ICM A;  3HW8 A;  4TUS A;  5HHH A;  4QZI A;  8ICC A;  1MIY A;  4MF8 A;  4QZF A;  3C2K A;  3MGH A;  4X4P A;  5D4B A;  2ZH3 A;  4F5Q A;  3JPN A;  2DR7 A;  7ICF A;  4DOB A;  4E80 A;  4X4S A;  4E8F A;  4NLZ A;  4WBY A;  5J0P A;  4YCX A;  5CJ7 A;  5IIJ A;  4LZD A;  4R65 A;  3C2M A;  4IQV A;  1ZQL A;  5J2D A;  4RT3 A;  4Z6D A;  2PFO A;  3V7K A;  2W9M A;  4ATB A;  3B0X A;  1MQ3 A;  1BPZ A;  1NOM A;  2M2T A;  5J2I A;  5BOM A;  4NKT A;  5J0Y A;  2GWS A;  1R8B A;  1Q79 A;  4KLS A;  4KLJ A;  4UAY A;  5CA7 A;  4YD2 A;  4M5D A;  2ZH7 A;  9ICX A;  2DR9 A;  3V7J A;  5CP2 A;  4QZB A;  3JPS A;  3GDX A;  4M9J A;  3JZ0 A;  4DO9 A;  5DKW A;  4RQ2 A;  3MGI A;  4M0A A;  7ICJ A;  4R64 A;  1ZQS A;  3RJG A;  4WC3 A;  4PHP A;  4JWN A;  4UB5 A;  1ZQB A;  3OGU A;  2Q66 A;  4RWN A;  2PFP A;  8ICX A;  5J2F A;  4QZC A;  4TUP A;  2RFF A;  4PPX A;  5J2K A;  4I2B A;  4O5K A;  1ZQH A;  2BPG A;  7ICP A;  1ZQW A;  8ICM A;  2ISP A;  4I2A A;  2ID1 A;  5CWR A;  4WC0 A;  5HRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...