5F2VO

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to ampcpp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
184
Chain Sequence
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
molecule tags Transferase
total genus 59
structure length 184
sequence length 195
chains with identical sequence P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5f2vO02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5f2vO01
5DB9A 4WBYA 1R8BA 4NKTA 2P66A 2FMQA 5J2GA 7ICTA 5DB8A 2ZH6A 5J0SA 4PPXA 5HR9A 2ZH3A 4ATBA 3RH6A 1R89A 5J2BA 2PFNA 4QZIA 4UB5A 1KDHA 2DR5A 4QZBA 4I2BA 3AQKA 2BCVA 4X4TA 2ISOA 4X4VA 4WC5A 3TFSA 3WFOA 1PX5A 4FHWA 3ISCA 4UD4A 3WFSC 8ICZA 4M2YA 2O1PA 4YMOA 4R65A 4KLQA 3ISBA 4JWMA 2ZH7A 4YMMA 5HC9A 4JWNA 4TURA 8ICUA 4UB4A 1Q78A 4AT8A 4IQVA 8ICYA 1JQRA 4UB2A 2ISPA 4XQ7A 4F5RA 4E7XA 4KLTA 4PHDA 2HHPA 4RQ5A 3HJ1A 4I2CA 4KLEA 9ICKA 5BPCA 2ZHAA 8ICTA 4RWOA 1ZQPA 2FMPA 4X4QA 5J0QA 9ICWA 5DKWA 4O9MA 4FHPA 4PHAA 4O5CA 3H3AA 3H38A 4GXKA 1R8AA 1UEVA 4EBKA 5J0YA 4TUQA 4MFCA 4KLSA 4WBZA 1XSPA 3B0YA 4P2HA 3PMNA 5BOMA 8ICIA 9ICQA 4UB3A 5CHGA 3C2KA 4M9GA 5J29A 4XA5A 1JMSA 1ZQLA 1NO5A 4X0AA 4P4MA 9ICCA 3WFRE 2Q66A 4PH5A 1ZQHA 3AQNA 3RJGA 4M9LA 5J0TA 4RQ8A 4XUSA 4UAWA 5IINA 5DBBA 4LZGA 8ICAA 3RH5A 4Z6FA 4M0AA 4O5EA 4RQ0A 4K4HA 1ZJNA 4M9JA 4QZHA 4KLIA 1ZQXA 8ICCA 4RPYA 1WOTA 1MQ2A 3HJ4A 3MDAA 4TUPA 4E8FA 1MIWA 3RJFA 3C18A 1F5AA 4GXJA 4RT2A 2I9GA 2BPCA 1ZQDA 4I2DA 1Q79A 1TFYA 4M9NA 1HUOA 2M2TA 4RPZA 4I2HA 1ZQGA 2BPGA 4MFFA 4AT8B 2DR9A 4FH5A 1ZQFA 4FO6A 7ICEA 3AU2A 4X4OA 1ZQUA 4I27A 4X4PA 3UQ0A 4I2JA 1BPYA 4YD1A 3MDCA 5J2JA 3C5FA 4RQ6A 1OU5A 4X4RA 1MIVA 5CP2A 5CB1A 1ZQCA 1ZQOA 5HRKA 4UAYA 2PXIA 4I2FA 4R63A 4KLFA 5HRLA 4F5NA 3MBYA 2DRBA 7ICIA 1ZQTA 4PHEA 2M2VA 5DBAA 2BCRA 7ICLA 1ZQMA 5J2DA 8ICXA 3UQ2A 2PFOA 5DB7A 8ICBA 3AQLA 4I2IA 9ICAA 3MGHA 4XQ8A 4X5VA 1UEUA 3UPSA 5HREA 2ZH9A 5HHIA 4YMNA 5HRIA 4MF8A 5IIMA 2NRKA 4I29A 2ZH1A 3AQMA 5D49A 4QZCA 5CJ7A 8ICWA 1ZQNA 4WC6A 9ICTA 4IG8A 4F5PA 7ICPA 9ICNA 4WCWA 1TV9A 2M2WA 3HIYA 4LT6A 4O5KA 5DB6A 4RWQA 4PGYA 4AT9A 8ICGA 5F2VO 4NLZA 7ICMA 1XSNA 4WC3A 1RZTA 3HW8A 3OV7A 9ICHA 1ZQWA 4KLOA 3OVBA 3OVAA 3GDXA 5J0OA 5J0UA 8ICHA 5HRDA 4QZDA 3V7LA 1JAJA 4DOAA 4IQUA 4RQ4A 5J2KA 4X4SA 2IHMA 4E80A 4QZEA 4NXZA 5CWRA 4M04A 8ICFA 4LZDA 4EP7A 2ZHBA 2M2UA 4M5DA 5J0WA 9ICJA 4NY8A 3AU6A 3ISDA 4X4NA 5IIKA 1BPZA 1XSLA 9ICFA 4I2EA 3B0XA 3WFPA 4QZGA 4F5OA 3RH4A 4ATBB 2RFFA 5J2EA 1ZQZA 3OUYA 5DECA 4I2GA 9ICRA 5J2CA 4S3NA 5BOLA 4RQ3A 3C66A 9ICBA 3RJEA 2DRAA 2DR7A 2DR8A 4RQ1A 4PGXA 5IIIA 1JN3A 7ICQA 9ICOA 4KLMA 1MIYA 1ZQQA 4K4IA 8ICQA 3UXOA 1FA0A 9ICIA 4MFAA 7ICSA 4TUSA 4QZAA 4RQ2A 4IQWA 4AT9B 9ICVA 1BPDA 9ICSA 1RPLA 7ICNA 5J2FA 4MF2A 4QZ8A 1HUZA 9ICLA 4UBBA 1R8CA 4AT7A 5TZVA 4IQTA 9ICMA 3WFQE 8ICNA 8ICLA 3RJJA 4KLUA 2ZH4A 5IILA 3JYYA 3JPPA 3OGUA 4WC4A 1ZJMA 4LVSA 4R64A 8ICSA 4FHVA 3PNCA 1ZQVA 4NLKA 4NM1A 4DO9A 9ICPA 2FMSA 5IIOA 1ZQIA 5HRBA 5J0PA 4KLLA 2BE3A 9ICEA 1ZQEA 7ICUA 2VANA 2PBEA 3HWTA 5CA7A 1YLQA 3OUYB 2ID1A 7ICJA 1BPXA 8ICKA 4WC0A 3NYBA 7ICKA 4KLDA 3JPSA 4QZ9A 3JPQA 4M47A 4YN4A 3V7JA 3RJIA 4X0BA 2PFPA 5D46A 4P4PA 2BCQA 4QZFA 4R66A 4DOBA 4NKUA 4KLJA 4UB1A 2ZH8A 4DOCA 1BPEA 3L9DA 3JPTA 5HRHA 4GXIA 3RJKA 2W9MA 5HRFA 1VJ7A 4WC1A 4Z6DA 1ZQRA 4FH3A 1TVAA 4P4OA 1KNYA 4YD2A 7ICOA 4WC7A 3JZ0A 3V72A 4UD5A 3JPNA 2O5AA 5HRGA 4AT7B 4NLNA 5J0RA 3HX0A 3V7KA 5DEDA 1NOMA 3C2MA 4X4UA 8ICJA 1BPBA 4K4GA 8ICMA 3RJHA 8ICRA 4KLGA 4XRHA 4I28A 2BCSA 2BCUA 7ICGA 5J2IA 5D4BA 4WC2A 1ZQYA 3K75D 8ICOA 5DBCA 4RQ7A 5DDMA 3UXNA 4PGQA 1ZQSA 3PMLA 1ZQJA 2BPFA 2PFQA 4Z6CA 3UXPA 3OVSA 4FHXA 4RT3A 1V4AA 1VFGA 4RPXA 3MGIA 3C2LA 3LK9A 5IIJA 7ICRA 4UAZA 4M9HA 1KEJA 5DDYA 4RWNA 3TFRA 3H39A 4UBCA 4I2AA 8ICEA 5EOZA 1MQ3A 5J0XA 9ICXA 3H37A 1ZQBA 8ICVA 4Z6EA 4RWPA 3JPRA 1TFWA 3C5GA 4EBJA 2ZH2A 1UETA 9ICUA 4F5QA 7ICVA 1ZQKA 2DVIA 5J2HA 8ICPA 5CR0A 4KLHA 7ICFA 2GWSA 4NM2A 7ICHA 3JPOA 9ICGA 4FHYA 3UPQA 3AUOA 3LQCB 4YCXA 4PHPA 2ZH5A 1ZQAA 5HHHA 5J2AA
chains in the Genus database with same CATH superfamily
4WBYA 2Q67A 4YHHO 4JI2B 1QNMA 4JF3A 4A5UB 5DB8A 2ZH6A 3G67A 5L3FA 2UXCO 2ZH3A 4JASA 4DV0O 3JAKA 3ZCCA 4AHCA 4DUYO 4QZIA 3JASA 3IC9A 3OW2U 4QZBA 1LNQA 3AQKA 3CC7V 4F6RA 3CRCA 1GN6A 4KFMA 2CUGA 2CH7B 2OCCC 4DV2O 3ISCA 4UXNA 2DQ0A 4LFBB 1JOYA 4Z2WA 1TVKA 4M2YA 1AR1B 3ISBA 1MZEA 3ML0A 2ZH7A 4UB4A 3ZIAG 1AJPA 4MVMA 1Q78A 3HKCB 3VOUA 2JEXA 4EB6B 1OV9A 5IYDO 1JPXA 3APQA 3DC5A 2XNDG 4QPJA 4F5RA 2KKWA 3CB2A 1L0LH 5GONA 5CA1A 4U7OA 2EIKC 8ICTA 3P32A 5KHIA 4RWOA 1TAEA 1ZQPA 1EM1A 4WH5A 1SZTA 4HYOA 5J0QA 1GN3A 4H37A 4O9MA 3CSXA 3K03A 2P06A 2EIMC 2LGWA 1IBMB 2XAHA 1IZ3A 4B08A 2L6LA 1UEVA 3I56V 4BIUA 5J0YA 4LR3A 2HVKC 4KLSA 1XSPA 1E1RG 3GB7C 8ICIA 2ZIOA 9ICQA 4DV6B 2GBOA 5K1XA 1E79G 4O4IB 2DJVA 5J29A 1B6QA 3RW0A 1DLBA 4X0AA 3E89A 2D3OW 3A0BZ 3TETA 3E2EA 3RJGA 4FFKA 3OMIB 3N2GB 4R50A 2JGDB 2M6YA 2HJDA 2QWQB 4LZGA 1RPRA 1QVFU 8ICAA 5CFTA 3CJHB 4PD4F 2PI5A 4M0AA 1MSWD 1SERA 2V7QG 4F4LA 5L3DA 5EYPB 3JAWB 1ZQXA 4RPYA 1IVSA 4E8FA 4WFGA 1F5AA 4GXJA 4MW3A 1TUBA 5KHHA 1Q79A 4I2DA 3H01A 4PA7A 3DTUB 4K9BA 2A06H 3SJBC 2Q0AA 1QLEB 1IXMA 3E8GA 4B3SB 2LFRA 5JCOA 4CC6A 4PV1B 3BPZA 1U96A 4G2KA 4DR4B 3OAAG 4UUJC 4J7JA 3AG1B 4KXRA 4FIPC 4I27A 1K9MW 5B1AC 1ZSPA 2KB1A 3ASOC 2ZE8A 3I5DA 1XNRO 3UQ0A 1BPYA 4YD1A 1IDSA 2R70A 1N36B 2LW1A 4ZKIA 1BS3A 1AJNA 1K5QA 1XL6A 1JVMA 5HRLA 4OPAA 3RFRA 3MBYA 4DYLA 3O9OA 1J5EB 1YVWA 2UUAO 5J2DA 3MHHC 1R3KC 4FPPA 1Z5VA 1B06A 2RMKB 4DV4B 4X5VA 2P67A 1NKDA 2ARHA 2P90A 3ZX6A 1G6UA 3BHPA 1AI7A 5FLXN 5JCOC 1OCZC 1KBHA 4I0XB 5IJ9B 5ITZB 2YI9A 5LA6B 4YY3B 1NVPB 3H1IH 4WFHA 4X66B 5D49A 1IXBA 1CXZB 5LYJB 3SJAC 1MABG 4UCUA 1W0JG 1U97A 1X59A 1EN6A 1ZQNA 4TUYB 2ZDIA 2B9ZA 4LT6A 4DR3B 4JI4O 5F2VO 4TOIA 5J2UB 4J41A 2IUBA 1XMQB 1F23A 1UPGA 1WAZA 2IH1C 2ODMA 4DR2O 4KLOA 5KHGA 1GPJA 4DV3O 2LFSA 4L8JA 3OVAA 5KX5B 2YXHA 2PY5A 1R73A 3KCXA 5J0UA 2EX3A 1N33O 1P7BA 2JDIG 2F93B 4QZDA 1M90W 4GLXA 4GT1A 4IQUA 3ASNB 2XAFA 4J7KA 5J2KA 5IJ0B 3TCUA 3HPLC 4NXZA 4W4KA 2ETNA 4M04A 4EP7A 1PPJH 4JTDB 4H33A 5B3QA 4WQLA 5J0WA 1FFXB 2ZDIC 5FL7G 3CCLV 5HFLA 4DV7O 5B3PA 4PDMA 4XDKA 1WP7A 4LC1A 4OAGA 4NXVA 4JAVA 4GX1A 1CPYA 1RP3B 1FKAO 2EILC 3OUYA 1Y6XA 4B3TO 2PYLA 5EIBD 4PA6A 1L1FA 4RQ3A 4I4TB 3VBBA 3RJEA 1S5JA 2F43G 3ZMSA 2HN1A 4PA3A 4OAIZ 4LEZA 5A9GA 2DR8A 1VP7A 4UV8A 1Q6UA 3CC2V 1JN3A 3CWBH 1RFYA 1WN7A 2ZINA 4X1KB 5CBHA 5JJEB 5CMUA 2X6AA 1ZQQA 4KLMA 8ICQA 2WWWA 3UXOA 5IY5B 3RYCA 1HNZB 4JV5B 3KKYA 4K8VA 4Z1MG 3CMEV 3WG7B 4RQ2A 3THOA 3K0DA 2XOKG 4LF5O 2XAQA 3K7DA 1BPDA 1VF5B 2AHYA 1FXHA 5CA1B 4O4JA 5J2FA 4GUNA 4QZ8A 9ICLA 3K57A 4FZ1A 4Z1VA 3E8BA 2WLIA 2FB5A 4U3FH 3OT7A 4NTYA 1ZUQA 2M7WA 5CHEA 3APOA 8ICNA 2UUCO 4GX5A 4KLUA 1NJIW 5LOVB 3JYYA 1IBKO 1I5XA 4I55A 3OGUA 4X20B 1YDXA 1Y74B 1ZJMA 2KG7B 1SQQH 1N34B 8ICSA 1OCOC 1M93A 1XEQA 2HJFC 4NM1A 3SYCA 2FMSA 9ICPA 5KUKA 5LBQA 1VQMV 2VQEB 3IC7A 4GYCB 2VWKA 4MTOA 1I94O 4OPHA 2YDEA 4GKKB 1BGYH 1KP2A 2PBEA 7ICUA 2YSUB 4G28B 5E1AC 1EN4A 2JEUA 4MS2A 2BCCH 1AI4A 4WC0A 2JS3A 1XI1A 2IJKA 2QWNB 3ABMB 5LMNB 1SQGA 2YIBA 2DE0X 1BSMA 4X0BA 1TUBB 3ZRWA 4KHPB 4OX9B 2PZSA 2F66C 2WLLB 1QR8A 2UU9B 1HNXO 4R66A 1AP6A 4TV9B 4KLJA 1JR9A 1K7DA 4UB1A 2ZH8A 4DOCA 3OTOO 2IM9A 1PNMA 3JPTA 5HRHA 3L74H 4MTGA 2UUBB 1VJ7A 2DYSC 1WB7A 1N32B 2QR4A 3EVKA 3ZHRA 1FXKA 4JLXA 3BVOA 4OXSA 4WC7A 2BTQB 3JZ0A 1Q7YW 4UD5A 5IYZA 2Q73A 5HRGA 4IHJB 1HDJA 3GVMA 1NOMA 4DK1A 4K4GA 1VQPV 3BFRA 4DUZB 5D4BA 4WC2A 2P4KA 2ADQB 3G4SV 3CEIA 2PFQA 2IU0A 4LFBO 4GKJB 1N4CA 4Z6CA 2QWPB 1IBLB 1T5EA 1XL4A 3K79A 4JI3B 3UXPA 1AJQA 2CH7A 1VFGA 3BABA 1UFIA 1FXKC 1DF4A 4O4LB 1H2MA 5KHJA 1VQ7V 1D5AA 1XBLA 2Y69C 2ZD9A 1KEJA 1Y4MA 2E76B 3HKCA 4EB6A 5B1BB 4I2AA 5EOZA 4CH6A 1MQ3A 2YI8A 4TV8B 1SC5B 2JJ1G 3GWKC 3QTCA 1IBMO 4RWPA 4LF9B 3K9AA 3WB2A 2CAZC 2Q5ZA 1DF5A 1ZWIC 4FLZA 7ICVA 3MHSC 4QIWF 4XBFA 1MMMA 4NB5A 1VQNV 5J2HA 1ZX3A 1K5SA 2ILMA 3NVOA 3OEHG 3JPOA 3QO5A 4TT3G 4X62B 4I0UA 2PTMA 3LQCB 4O4IA 4YCXA 2VQFB 3OR6C 4RUEA 3ZMUA 4JI0B 1ZQAA 2X6CA 1YJWV 5DB9A 2LGQA 1D2DA 2QEXV 3OE7G 4YJ2B 5J2GA 3N2GA 5J0SA 5K1PA 4ATBA 3CJHA 1R89A 2OCHA 2QM4A 1KDHA 5EYPA 4B7EA 3TGUH 2ZM6B 3JAWA 5EZYB 1K73W 4I2BA 2BCVA 4X4TA 2Y0PA 2ISOA 4B3RO 3CK6A 4X4VA 2EJRA 1Q82W 3NXSA 3TFSA 1G4YB 4FHWA 1LUWA 4B3SO 4TWKA 4UD4A 3WFSC 4MTXA 3N27A 2YIAA 4KM5A 5GTHZ 4JWMA 2XTAA 5HC9A 4TURA 4K3AA 1VEWA 4X1YB 4IQVA 8ICYA 4HZ3A 1PL0A 1Z5WA 1PKXA 4R6ZA 5LL6Y 2YICA 3CXHF 1N36O 1GK9A 3ETEA 4RQ5A 4LP8A 1E1QG 3HJ1A 9ICKA 2C2AA 1GM7A 5D5PA 1YJ9V 2ZHAA 4X4QA 9ICWA 1J5EO 3CE2A 5FPRA 2Z3YA 3H3AA 2GTAA 3H38A 5A2QN 3K5LA 4EBKA 5CBFA 3KG2A 3CC4V 5BY1A 4DV4O 4GZRB 3ZMTA 4TUQA 3B0YA 3G6EV 4BW5A 1VQKV 2Q8VA 5IWAB 2F95B 5LMUB 5CHGA 1QLEC 3BEHA 5LGUA 1NO5A 1AI6A 9ICCA 3K3WA 4YY3O 1XILA 3WFRE 4BW9A 3CRRA 1ZQHA 4X66O 5KUMA 2AXTZ 3DGEA 2BSKB 4I0XA 5IJ9A 1PD3A 5J0TA 1NT2B 3JARB 4RQ8A 2N05A 3T2MA 5ITZA 5DBBA 3AG1C 4DR5B 2AZ0A 2PF4E 2HR3A 2XHBA 4AI8A 5LHIA 1GH6A 1K92A 4Z6FA 5LYJA 4DR3O 4RQ0A 3U10A 1ZJNA 3D8CA 4M9JA 3JALB 4TUYA 4IGGA 1NZ6A 4MTFA 3AG2B 3E35A 4ICGA 1XMQO 2QKCA 1MQ2A 1R3LC 2IH3C 3RJFA 1I08A 1H2SB 2I9GA 1ZQDA 2QM8A 4CBCA 4CS3A 4P2ZA 1QR9A 5J2UA 4M9NA 4FVMA 3R65A 1HUOA 4JI7B 2GSMB 4X64O 3OM3B 2DYRB 4NVPA 1VQ8V 3UQ8A 2P4VA 5EC2C 2DN9A 5KX5A 5AG2A 3FB8C 2QKAA 2QA4V 1JMKC 3T1YB 1PL4A 2JVDA 3A0HZ 3BCCH 4PELA 3RYFB 2X0LA 1OHHG 1YCIA 4YJ3B 5IJ0A 2EINB 2A3QA 3MDCA 5J2JA 3C5FA 1WPBA 2CE4A 4JYAO 5CP2A 3A0RA 1YTFB 4WQKA 5HRKA 1FFXA 2PXIA 4KLFA 2Q9LA 2DRBA 4EFEA 5B5EZ 7ICIA 1ZQTA 4NKGB 1Q6IA 2M2VA 5B1OA 1FJGB 1ZAUA 3OR7C 5E79Z 7ICLA 2YC0A 4WFBV 3UQ2A 5DB7A 4RO2A 1NH2B 3IFXA 4CH5A 1IURA 1UEUA 5L3EA 4I4TA 1W0KG 2A79B 4MF8A 3OMAB 5IIMA 2VRZA 1HNZO 2NRKA 2HG5C 4JV5O 2ZH1A 1BMFG 1S76D 4X1KA 1GKFA 3ASNC 3SPCA 4QZCA 3IGAC 4WBNB 2UXXA 1BZKA 2MW2B 4PI2A 2A9HA 1VMGA 3R66A 1Z2GA 4W4LA 2F4VB 4IG8A 9ICNA 4WCWA 2F23A 3WU2Z 2XAJA 2M2WA 3ZMVA 1TV9A 4RWQA 4HBNA 1XSNA 1RZTA 3HW8A 5JH7A 3SJQC 2QWOB 2JIZG 3EFFK 1JFFB 1GO3F 3UO2A 2GA9D 3GDXA 3JCUZ 1K33A 1BCCH 3T1HB 4JI8B 1RSOB 5HRDA 4JI1O 1GM8A 3V7LA 4DOAA 1JAJA 4RQ4A 5LOVA 2WLKA 2XASA 3UCSC 1SQFA 4K0KO 4X20A 3O65A 1Y74A 2VQEO 2KG7A 3UO3A 2OTLV 3ABLB 3QVNA 5IY5C 3ETQA 2E5LO 3ZRVA 3G80A 3S3XA 2PI4A 4EFBA 3HR0A 3LDEA 4GKKO 3ER8C 4TQDA 5IIKA 9ICFA 3PJSK 2OWOA 4FLWA 1KECA 1KB9F 4F5OA 3F7VC 4GX2A 3RH4A 4ATBB 3U11A 2H3OA 2RFFA 3TXSA 1ZQZA 5LMNO 1L8DA 4S3NA 2R9AA 4KHPO 4OX9O 3C66A 2NNUA 1WB8A 5HFMA 3G71V 4PGXA 7ICQA 1AR4A 2WLLA 2UUBO 1OCCB 3OWGA 4O69A 4TV9A 9ICIA 2IW5A 4K8XA 4TUSA 1VQ9V 1KUQA 4IQWA 5KMGB 3JD3A 4MVQA 2B56A 3SYQA 4AT9B 2QKSA 2WPDG 1RPLA 4B3MB 5CFSA 4I5SA 2BTQA 4PJ0Z 1MG1A 3CP1A 1V55B 1HUZA 2WLJA 1HR0B 1R8CA 1GMGA 4IHJA 5TZVA 4UBBA 4X8AA 1W59A 2FYUH 1JA8A 4LF4O 4DUZO 2E3CA 3ABMC 3H1LH 3JD4A 2HHHB 8ICLA 3RJJA 2WSSG 1H2LA 1S5LZ 4MSWC 3UKMA 3T4DA 3JPPA 4MVRA 4GKJO 4WC4A 1IBLO 4JI3O 4EEQA 1XQ8A 4LF7B 1OCRB 1ZQVA 4NLKA 4DO9A 1XUQA 3T4ZA 1JQ0A 5IIOA 1LUVA 1ZQIA 2IHOA 5HRBA 2BE3A 5EBWC 2VANA 4LNUB 3HWTA 4CH4A 5CA7A 1Y76B 3CCUV 4O4LA 3CCMV 1Q8IA 4X9QA 1SS3A 1M9NA 2BBJA 4JAAA 7ICJA 2E75B 3L71H 8ICKA 4FFBB 1J95A 2CK3G 5LGNA 3IAYA 7ICKA 2ZCEA 1MZFA 4YN4A 3V7JA 3FKSG 3LNNA 3RJIA 3C90A 2ATKC 4FZ0A 3JD0A 5KAFZ 4TV8A 2EIJB 4QNHB 4QZFA 4DV5O 1BPEA 4TQFA 4WOYA 3RJKA 4FM2A 2GV9A 1YJNV 3JD1A 4X62O 4O6AA 2JK5C 2VQFO 1TVAA 1KNYA 3L70H 4JI0O 4ZOLB 5J9PC 1XMOB 1RM1B 7ICOA 2CTPA 3M8AA 1VQLV 1R6TA 1OJHA 1QQCA 3AEIA 5B66Z 4UVBA 4AT7B 4P9PA 2PYJA 2F1MA 5J0RA 1ZL8B 1AILA 2QTSA 4YJ2A 3CMAV 2OTJV 5B1BC 3P3PA 4X4UA 3NR7A 3GWOA 4ZBMA 4ZIBA 3RJHA 2ZKOA 2ZM6O 4XRHA 1HNWB 2QJ1A 5J2IA 2HN2A 3OGIB 3K75D 8ICOA 1MSDA 3UXNA 1WLEA 4BR6A 4JI6O 2V4DA 4PGQA 1WA8B 4O4HB 5EZYA 4LWSB 3L72H 4H13B 3OVSA 2E74B 4B7KA 4YHHB 4RPXA 3MGIA 2ZR3A 5CN0A 1VF7A 3C2LA 5IIJA 3K58A 4UAZA 1S72V 2W6IG 3X2QB 4BIOA 4X1YA 4DV0B 5DM6V 3H39A 1BQZA 4LCUC 1JCHA 1O9HA 4NXMB 3H37A 1ZQBA 4J80A 2H94A 3B2EE 5JH7B 4I7ZB 5BXZA 3JPRA 4HNAB 1TFWA 2JS5A 1FYJA 1GN4A 5BR8B 4DV2B 1ZQKA 2AW9A 5IWAO 1X4TA 3HKBB 1QU7A 5LMUO 5CR0A 3B09A 4NM2A 5IT9N 1PNKA 3JCZA 3UPQA 3CCQV 4IT5A 2ZH5A 5HHHA 5J2AA 4DR5O 1R8BA 4NKTA 2P66A 4J42A 2FMQA 2BSKA 4UVAA 7ICTA 2Q69A 3BAAA 3JARA 3LSUA 2WAMA 2RNBA 2QE7G 2HVJC 2EWRA 1O9GA 4FLXA 1TUEB 5J2BA 3RH6A 4NXXA 1ZTEA 4NXUA 1S0VA 4UB5A 3RYHB 4IYHA 3J81N 3H1JH 2LQTA 3RGBA 4RQFA 2MK3A 3JALA 1V54B 1L0NH 1W2BU 4X88A 4JI7O 4PA9A 1R6NA 3WFOA 5BMVB 1PX5A 5B1AB 3EXAA 1AR5A 1H8HG 3T1YO 4MKPA 4EGWA 3RVYA 4KB6A 2OT5A 4BIZA 4KLQA 4DR7O 1XNQB 2B51A 1JQRA 1N8RW 3RYFA 3B8MA 5CA0B 5KAIZ 3QO7A 4P30A 4KLTA 4PHDA 2QM7A 4YJ3A 2HHPA 4JI2O 5BPCA 4JI5B 1DTOA 2G38A 5EBLC 1M57B 4IIJB 1DK1A 4YIPA 5DKWA 1Q3EA 4O5CA 1FJGO 3AG2C 4BWAA 4FM0A 2NLJC 4UCTA 3DXRB 4MT8A 4J9YB 4P2HA 3PMNA 1KKDA 1KKCA 1NR7A 4XA5A 2DYRC 2QGNA 3HKEB 1ZQLA 4P4MA 1M5IA 1AP5A 2Q66A 4DO2A 4M9LA 2Q7GA 4X1IA 1QVGU 1URFA 4XUSA 4LBEC 4UAWA 3QNEA 1NVPD 3ZS8C 3RH5A 4WBNA 2F4VO 4OAFA 3J80N 5D61A 4K4HA 4O68A 2AGAA 4QZHA 4KLIA 3HB3B 3JATB 8ICCA 4K8ZA 3FFQA 4YIOA 1MIWA 4ZI7B 3C18A 4RT2A 2BPCA 1TFYA 3RN4A 1M4UA 3T1HO 4DW0A 2M2TA 4JI8O 3LNMB 4JYCA 1JFFA 4FMTA 2IJHA 4UCOA 4MFFA 4AT8B 2DR9A 4FH5A 1Q5OA 1ZQFA 4DV6O 1RSOA 4C7UA 2CTRA 4NXWA 3AU2A 2GUZB 1ZQUA 2A7WA 3AG3B 5H6QA 1CEZA 5D63A 4I2JA 4GX0A 3F5TA 3CCRV 4RQ6A 1OU5A 4X4RA 1MIVA 5CB1A 1R6KA 1H2GA 1RPOA 4UAYA 2RJZA 1NTMH 4HAMA 4F5NA 2Z5UA 3B77A 3MD0A 1FPOA 4DV3B 5LP6B 2DOSA 4LF8B 5CFUA 4PHEA 5DBAA 3TJTA 1ZQMA 4BAYA 3ICXA 3K0GA 3WB1A 3AQLA 1WNSA 2ZR2A 9ICAA 4XQ8A 2Y4UA 1KQSU 3UPSA 2ZXWB 5HREA 1WJZA 4E4EA 2ZH9A 1NS1A 3ZHSA 5HRIA 1AB3A 4I29A 2CTWA 4NXNB 3AQMA 3CPWU 3PHZA 3C3TA 3QO8A 2R9IA 1COWG 1SA0B 4DR4O 4I50B 4DV7B 8ICWA 3ABLC 4D7SA 2EBOA 4B3MO 7ICPA 3HIYA 1F51A 5KMGA 4O5KA 4AT9A 4O2BB 8ICGA 2IU3A 3OV7A 2LP7A 3JSNA 9ICHA 4GCZA 4WFFA 3NWIA 2HHHO 1XHXA 5IYCO 4WCEV 3CCEV 2HFEC 3EF2A 1K34A 2ZE5A 3VQWA 2IHMA 3W7XA 2JGUA 4E80A 5JJJB 4QZEA 5CWRA 1OCCC 2DMXA 1EZVH 1NR1A 2M2UA 4M5DA 2OIEA 3ETDA 9ICJA 3AU6A 3B8NA 5KLVH 4TSFG 1KD1W 4X4NA 1BPZA 1XREA 1XSLA 4PI0A 1K4DC 3B0XA 1Q86W 3MAQA 1PM9A 4LNUA 3CRMA 3ZBHA 3K5MA 1Y76A 3FB5C 4ABMA 2AZ2A 5DECA 1V55C 9ICRA 5JTGA 4FFBA 3FD9A 5BOLA 3E83A 4JGSA 5GW7A 2DRAA 3VQYA 4ZHQB 2WA3A 3BA9A 4RQ1A 3CCJV 4K4IA 3CCVV 1MNGA 3L73H 2NN4A 1OCRC 2VS0A 5B1NA 5JWPA 1I94B 2CGOA 1XMOO 2YXYA 4RQEA 4DXWA 1NU1H 2ZQMA 2W0XA 4CZZA 3K04A 1NTKH 3LUTB 4ZOLA 4IL6Z 2P5OA 2YUAA 9ICSA 1SQXH 3SPHA 3ZEDA 1GTOA 4AT7A 4CS4A 1P49A 2LO1A 1ZL8A 4U3JA 2W6JG 1PNLA 4FLUA 1KYOF 2X6BA 1HNXB 4NXTA 9ICMA 1F4NA 1KU9A 5CB4B 2X7RB 3DC6A 3D36A 2ZH4A 5IILA 4UV9A 3SYAA 2ITDC 2EIJC 4LVSA 1F4MA 3SJCC 4PDRA 1EFRG 4FHVA 3PNCA 1SQVH 3UM7A 1WA8A 4O4HA 3ZRXA 2OYQA 4K99A 3N2KB 1EZJA 4LWSA 4X1IB 4DRXB 5J0PA 2BOCC 2P22C 2UXBB 1BL8A 2H8PC 3AG4B 1SRYA 1LR1A 4XDJA 5LXTB 1RM1C 3ZRSA 1AROP 2WLHA 4UFZA 2ID1A 1BPXA 2B1GA 4NXMO 4M47A 4RUFA 3OUFA 4DR1B 2PUSA 1PV0A 2P6JA 1R3IC 3SPJA 5D5QA 2QDOA 1Y67A 3M99B 4K35A 3E86A 4P4PA 1BT8A 4NTWA 3CHXA 5BR8O 3D36C 3Q4HB 4HNAA 4NKUA 1AI5A 3SGIA 4LH7A 1QCEA 3JCFA 2WLMA 1V9PA 4WC1A 2QTOA 3HKBA 4Z6DA 3JYCA 1ZQRA 1N34O 2ITCC 4P4OA 4YD2A 2FTKA 5C8YB 1YZBA 3V72A 4OGQB 5CBGA 3JPNA 3ZHVA 3OMNB 4I9WA 4JTAB 2Y48A 3K9SA 3X2QC 3HX0A 3WG7C 2IBZH 1FS0G 8ICJA 1FFTB 3E22A 3JAMN 4WFAV 1M1KW 4DR6B 3AK1A 4I28A 5B3SB 2BCUA 1ZQYA 3RYHA 3W7SA 3ZN0A 4PDVA 5DBCA 5DDMA 1ZLZA 3MDSA 5CA3A 4DV1B 4N7RA 3PMLA 1YITV 1ZQJA 2BPFA 5L3GA 2UU9O 3RYIB 3E8FA 4Q6GA 1B3QA 4EV6A 5BMVA 1H8EG 4WFEA 4RT3A 1V4AA 1Y66A 1XNQO 1EBOA 1H2NA 5JVDB 4MW8A 4FM1A 4FO1A 2V1DA 1YIJV 4HX0A 4K98A 1N32O 3CS5A 1M56B 4RAIA 7ICRA 4M9HA 4K97A 2Q4PA 4LF6B 1US6A 4MVOA 5DDYA 3LDDA 3TFRA 4RWNA 4JI5O 5CA0A 3ABKB 2BBHA 3BRCA 5J0XA 9ICXA 8ICVA 5JJNB 2DW4A 4Z6EA 1GRJA 2YIDA 4UVCA 1VQ4V 1SESA 5C93A 4B3RB 2QSAA 1ORQC 4JLZA 2ZH2A 4WF9V 1UETA 1BHBA 4IIJA 9ICUA 3RVZA 4F5QA 3FAVB 2YEVB 4N21A 1V54C 2DVIA 1VQ6V 8ICPA 7ICFA 4LFAB 3ETGA 1KC8W 3DXRA 3ABTA 2GWSA 7ICHA 5EC1C 1OZ0A 1FD9A 5LHHA 3CXCU 4FHYA 3P3NA 5JQGB 1XDCA 3QF7A 4JPRA 3HKEA 4UB8Z 5FNVA 3UT5B 4J10A 4E2LA 2Q7EA 3K59A 4PPXA 5HR9A 2HKOA 2PGGA 2ZE7A 1XHZA 1S3JA 3AK2A 1VF6A 3RT3C 2HP8A 2PFNA 2A0LA 3J7AU 2DR5A 1UJWB 1VQ5V 1MOFA 3OGCC 1M57C 3JATA 1GN2A 2Q7HA 4CH3A 4LF9O 1HP8A 2YIBD 2BTOA 1H38A 4WC5A 4ZI7A 3CD6V 3SPGA 1THZA 4FLTA 8ICZA 2O1PA 4YMOA 4R65A 2Q6AA 4YMMA 4QE9A 4JWNA 1YF2A 8ICUA 4AT8A 4UB2A 4J11A 2ISPA 4XQ7A 2CTQA 2AHZA 3C3SA 4UCVA 5LGTA 1JJ2U 4EEBA 2GUZA 2UXDB 4E7XA 1NI8A 4I2CA 4KLEA 1A32A 1VF6C 2EZOA 2DWDC 2FMPA 4LF8O 4QGPA 4U3JB 1YTFD 4FHPA 4PHAA 4JZ2A 4GXKA 4UCRA 1R8AA 4X64B 5LP6A 4LFCB 3STLC 2OCCB 2ZT9B 4MFCA 4WBZA 3F5WC 1Q6HA 5BOMA 4LEWA 1P84F 4DW1A 3SYOA 4UB3A 4O2AB 5FPOA 5J2TB 3C2KA 4M9GA 3CRAA 2RN9A 3FB6C 1JMSA 1NH2D 4NXNO 2Y0IA 4X65B 4AQYB 1FXVA 4PH5A 3CX5F 1SF9A 3AQNA 3ER9B 4F6EA 2B4VA 4JYAB 5IINA 4KP4A 5H5NA 3ZMZA 3M7MX 1SZXA 2XUMA 2YS8A 2ZNJA 3AG3C 1SA0A 2EIKB 1N0JA 3JAKB 4O5EA 4I50A 3ABUA 3FYIB 3JASB 2UXCB 1I7FA 3D3IA 3DSQA 3A8TA 3AK3A 4QPKA 2EIMB 4DUYB 3HJ4A 4F6RB 3MDAA 3LSSA 4TUPA 1R1BA 4O2BA 5BZBA 1S5HC 1QLNA 5LP6C 1QBZA 4PDLA 1K4CC 1TVKB 3ZN1A 4RPZA 4I2HA 4L87A 1NTZH 1ZQGA 2BPGA 3CCSV 2FL4A 2KQXA 2WLNA 2ZXWC 3OEEG 4PHZA 3P30A 4FO6A 3LSQA 1ROPA 4MVSA 4CS2A 7ICEA 2ZIMA 4X4OA 4UCSA 1NBMG 4X4PA 3JSLA 4H0LB 5GONB 3PN1A 3BA8A 3VQVA 3G6BA 1ZQCA 1ZQOA 1VIBA 2HEPA 4UB6Z 4I2FA 4R63A 1SKVA 1B04A 4I9QA 4MVZA 3E22B 2CDYA 5L3CA 2BCRA 4QE7A 3MCRA 8ICXA 2PFOA 1H2KA 1GAXA 8ICBA 4I2IA 3MGHA 2N74A 3BY6A 4J7ZA 4JI1B 2JRIA 3HKDA 2FKXA 2GAFD 5DN6G 4G27B 4K0KB 3K5NA 5HHIA 4ZHQA 4H44B 2RQ6A 2E5LB 2B5UA 3A2FA 3ASOB 4FLYA 1QHTA 1XOUA 5CJ7A 2RDCA 4WC6A 3CRQA 9ICTA 4CC5A 3AG7A 2BOBC 4F5PA 1R3JC 2W0FC 4OAHA 2ADPA 5DB6A 4K9AA 4PGYA 4EKWA 2EJ7A 4NLZA 7ICMA 5TISZ 4WC3A 2EULA 1YSCA 1ZQWA 1FAFA 3OVBA 1K3EA 2GTSA 2L35A 5J0OA 1OCZB 3OD4A 8ICHA 5CB4A 4NTXA 4IYIA 1EN5A 4X4SA 4AILC 2KSDA 3I55V 4O67A 3IJ4A 1CP9A 5GTIZ 8ICFA 4LZDA 2Z0AA 5FNVB 2ZHBA 2UXBO 3N2KA 1XNRB 2ZNIA 4NY8A 3ISDA 2LW7A 4J9ZB 4DRXA 2P7TC 4LEVA 4I2EA 4XDLA 3WFPA 4QZGA 2EINC 5LXTA 4LF4B 5J2EA 3OFNG 4DR1O 4I2GA 2QWRB 2R72A 5J2CA 5EK0A 2FMLA 2UXNA 2XAGA 2UUAB 1WPXA 9ICBA 2DR7A 1P7GA 2IJJA 3ERCC 5IIIA 1SQPH 9ICOA 1MIYA 2B1IA 3Q4HA 2OIGA 1FA0A 4MFAA 2Q0OC 2D2CB 2EZPA 3SDLA 7ICSA 4QZAA 2DQ3A 1NQTA 4LEYA 4JZGA 5KA6A 9ICVA 5IDJA 4P9OA 3F7YC 5C8YA 7ICNA 2EILB 3AG4C 4R7CA 1GM9A 4MF2A 4JI4B 5KA5A 3STZC 3K08A 1YHQV 5EIBC 3H1HH 2IJIA 3KCYA 3OUSA 4DR6O 3ZHQA 1BQ0A 4IQTA 4DR2B 1Q81W 3ZHUA 4DV5B 4JYYA 1MA1A 3WFQE 4DV1O 1N33B 4X89A 4ASUG 4DK0A 1S77D 4R64A 5KHKA 1YXBA 3WB0A 3RYIA 4RWUA 1P4RA 2GHYA 4KLLA 3ZJZA 1VARA 2JGDA 9ICEA 1F7YA 1ZQEA 4MVUA 4LF6O 5JVDA 4LH6A 1VQOV 1YLQA 4QJFB 3U0ZA 3FX7A 3OUYB 5IYBO 3SPIA 3NYBA 4KLDA 3JPSA 2N04A 4QZ9A 3JPQA 4R8CA 4D7TA 1ENVA 2NR5A 4B3TB 1TGOA 1HR0O 2PFPA 5D46A 4JI6B 3H9VA 4JYBA 2BCQA 2WA4A 1K97A 1Q90D 5B3SC 2VWJA 4DOBA 1OCOB 4JTCB 3RYCB 3JD2A 1K8AW 4LFAO 3L9DA 3FAVA 2YEVA 4JAUA 4GXIA 2W9MA 2DWEC 5HRFA 4Q20A 3FB7C 3WFVA 5EBMC 3K5OA 4FH3A 4LF7O 5H6RA 4NR1A 2XT9A 1BE3H 4O4JB 5JQGA 1G1XB 2O5AA 4LF5B 1M56C 4NLNA 3UT5A 5H9CA 3W7WA 2WLIB 1YEWA 3EHBB 3D3QA 3FYEB 4K96A 3V7KA 3W7TA 5DEDA 3C2MA 3ABKC 1YI2V 1BPBA 8ICMA 3ZHTA 8ICRA 5H2FZ 4KLGA 3RBZA 2BCSA 4KL1A 2Y4TA 3LDCA 7ICGA 3B40A 4I55B 1Q43A 3SYPA 2YXLA 1KMIZ 4RQ7A 1N0NA 3H1KH 3S3WA 2UUCB 2FCLA 1ZQSA 4FJCC 3NKUA 3CYOA 3HKDB 2ZE6A 3E8HA 1IBKB 2DYSB 3T1CA 3RWRD 1KP3A 2O57A 4XJEA 1SQBH 3L75H 3VQXA 4U7NA 2RCVA 4FHXA 5LA6A 1SETA 2K9PA 3LK9A 1HWYA 2LJ2A 1I0HA 4D6TH 1WP8A 2UXDO 5D62A 4KUMA 1TA8A 1BHAA 2GDSA 4UBCA 8ICEA 5IE9A 3B4SA 4PA4A 3TXQA 4EEDA 3ZRWB 1I5YA 2Q68A 1HW7A 1D5NA 4N23A 5LHGA 3C5GA 4EBJA 2JJ2G 3QG5A 2HLDG 4FK5C 3KZIZ 4LFCO 1DGSA 4YXWG 1HNWO 5L3BA 1PP9H 1G8MA 3TK1A 3K06A 3SR2C 4KLHA 3OTOB 4DR7B 1FXKB 4NYKA 9ICGA 4X65O 4AQYO 3OTFA 4FLVA 1JX9A 2K1EA 3W7UA 3AUOA 1JJOA 4O2AA 5J2TA 5IYZB 2Y69B 1AVMA 2R9RB 4PHPA 1WOTA 2CGNA 1IX9A 4YMNA
chains in the Genus database with same CATH topology
5DB9A 4WBYA 1R8BA 4NKTA 2P66A 2FMQA 5J2GA 7ICTA 5DB8A 2ZH6A 5J0SA 4PPXA 5HR9A 2ZH3A 4ATBA 3RH6A 1R89A 5J2BA 2PFNA 4QZIA 4UB5A 1KDHA 2DR5A 4QZBA 4I2BA 3AQKA 2BCVA 4X4TA 2ISOA 4X4VA 4WC5A 3TFSA 3WFOA 1PX5A 4FHWA 3ISCA 4UD4A 3WFSC 8ICZA 4M2YA 2O1PA 4YMOA 4R65A 4KLQA 3ISBA 4JWMA 2ZH7A 4YMMA 5HC9A 4JWNA 4TURA 8ICUA 4UB4A 1Q78A 4AT8A 4IQVA 8ICYA 1JQRA 4UB2A 2ISPA 4XQ7A 4F5RA 4E7XA 4KLTA 4PHDA 2HHPA 4RQ5A 3HJ1A 4I2CA 4KLEA 9ICKA 5BPCA 2ZHAA 8ICTA 4RWOA 1ZQPA 2FMPA 4X4QA 5J0QA 9ICWA 5DKWA 4O9MA 4FHPA 4PHAA 4O5CA 3H3AA 3H38A 4GXKA 1R8AA 1UEVA 4EBKA 5J0YA 4TUQA 4MFCA 4KLSA 4WBZA 1XSPA 3B0YA 4P2HA 3PMNA 5BOMA 8ICIA 9ICQA 4UB3A 5CHGA 3C2KA 4M9GA 5J29A 4XA5A 1JMSA 1ZQLA 1NO5A 4X0AA 4P4MA 9ICCA 3WFRE 2Q66A 4PH5A 1ZQHA 3AQNA 3RJGA 4M9LA 5J0TA 4RQ8A 4XUSA 4UAWA 5IINA 5DBBA 4LZGA 8ICAA 3RH5A 4Z6FA 4M0AA 4O5EA 4RQ0A 4K4HA 1ZJNA 4M9JA 4QZHA 4KLIA 1ZQXA 8ICCA 4RPYA 1WOTA 1MQ2A 3HJ4A 3MDAA 4TUPA 4E8FA 1MIWA 3RJFA 3C18A 1F5AA 4GXJA 4RT2A 2I9GA 2BPCA 1ZQDA 4I2DA 1Q79A 1TFYA 4M9NA 1HUOA 2M2TA 4RPZA 4I2HA 1ZQGA 2BPGA 4MFFA 4AT8B 2DR9A 4FH5A 1ZQFA 4FO6A 7ICEA 3AU2A 4X4OA 1ZQUA 4I27A 4X4PA 3UQ0A 4I2JA 1BPYA 4YD1A 3MDCA 5J2JA 3C5FA 4RQ6A 1OU5A 4X4RA 1MIVA 5CP2A 5CB1A 1ZQCA 1ZQOA 5HRKA 4UAYA 2PXIA 4I2FA 4R63A 4KLFA 5HRLA 4F5NA 3MBYA 2DRBA 7ICIA 1ZQTA 4PHEA 2M2VA 5DBAA 2BCRA 7ICLA 1ZQMA 5J2DA 8ICXA 3UQ2A 2PFOA 5DB7A 8ICBA 3AQLA 4I2IA 9ICAA 3MGHA 4XQ8A 4X5VA 1UEUA 3UPSA 5HREA 2ZH9A 5HHIA 4YMNA 5HRIA 4MF8A 5IIMA 2NRKA 4I29A 2ZH1A 3AQMA 5D49A 4QZCA 5CJ7A 8ICWA 1ZQNA 4WC6A 9ICTA 4IG8A 4F5PA 7ICPA 9ICNA 4WCWA 1TV9A 2M2WA 3HIYA 4LT6A 4O5KA 5DB6A 4RWQA 4PGYA 4AT9A 8ICGA 5F2VO 4NLZA 7ICMA 1XSNA 4WC3A 1RZTA 3HW8A 3OV7A 9ICHA 1ZQWA 4KLOA 3OVBA 3OVAA 3GDXA 5J0OA 5J0UA 8ICHA 5HRDA 4QZDA 3V7LA 1JAJA 4DOAA 4IQUA 4RQ4A 5J2KA 4X4SA 2IHMA 4E80A 4QZEA 4NXZA 5CWRA 4M04A 8ICFA 4LZDA 4EP7A 2ZHBA 2M2UA 4M5DA 5J0WA 9ICJA 4NY8A 3AU6A 3ISDA 4X4NA 5IIKA 1BPZA 1XSLA 9ICFA 4I2EA 3B0XA 3WFPA 4QZGA 4F5OA 3RH4A 4ATBB 2RFFA 5J2EA 1ZQZA 3OUYA 5DECA 4I2GA 9ICRA 5J2CA 4S3NA 5BOLA 4RQ3A 3C66A 9ICBA 3RJEA 2DRAA 2DR7A 2DR8A 4RQ1A 4PGXA 5IIIA 1JN3A 7ICQA 9ICOA 4KLMA 1MIYA 1ZQQA 4K4IA 8ICQA 3UXOA 1FA0A 9ICIA 4MFAA 7ICSA 4TUSA 4QZAA 4RQ2A 4IQWA 4AT9B 9ICVA 1BPDA 9ICSA 1RPLA 7ICNA 5J2FA 4MF2A 4QZ8A 1HUZA 9ICLA 4UBBA 1R8CA 4AT7A 5TZVA 4IQTA 9ICMA 3WFQE 8ICNA 8ICLA 3RJJA 4KLUA 2ZH4A 5IILA 3JYYA 3JPPA 3OGUA 4WC4A 1ZJMA 4LVSA 4R64A 8ICSA 4FHVA 3PNCA 1ZQVA 4NLKA 4NM1A 4DO9A 9ICPA 2FMSA 5IIOA 1ZQIA 5HRBA 5J0PA 4KLLA 2BE3A 9ICEA 1ZQEA 7ICUA 2VANA 2PBEA 3HWTA 5CA7A 1YLQA 3OUYB 2ID1A 7ICJA 1BPXA 8ICKA 4WC0A 3NYBA 7ICKA 4KLDA 3JPSA 4QZ9A 3JPQA 4M47A 4YN4A 3V7JA 3RJIA 4X0BA 2PFPA 5D46A 4P4PA 2BCQA 4QZFA 4R66A 4DOBA 4NKUA 4KLJA 4UB1A 2ZH8A 4DOCA 1BPEA 3L9DA 3JPTA 5HRHA 4GXIA 3RJKA 2W9MA 5HRFA 1VJ7A 4WC1A 4Z6DA 1ZQRA 4FH3A 1TVAA 4P4OA 1KNYA 4YD2A 7ICOA 4WC7A 3JZ0A 3V72A 4UD5A 3JPNA 2O5AA 5HRGA 4AT7B 4NLNA 5J0RA 3HX0A 3V7KA 5DEDA 1NOMA 3C2MA 4X4UA 8ICJA 1BPBA 4K4GA 8ICMA 3RJHA 8ICRA 4KLGA 4XRHA 4I28A 2BCSA 2BCUA 7ICGA 5J2IA 5D4BA 4WC2A 1ZQYA 3K75D 8ICOA 5DBCA 4RQ7A 5DDMA 3UXNA 4PGQA 1ZQSA 3PMLA 1ZQJA 2BPFA 2PFQA 4Z6CA 3UXPA 3OVSA 4FHXA 4RT3A 1V4AA 1VFGA 4RPXA 3MGIA 3C2LA 3LK9A 5IIJA 7ICRA 4UAZA 4M9HA 1KEJA 5DDYA 4RWNA 3TFRA 3H39A 4UBCA 4I2AA 8ICEA 5EOZA 1MQ3A 5J0XA 9ICXA 3H37A 1ZQBA 8ICVA 4Z6EA 4RWPA 3JPRA 1TFWA 3C5GA 4EBJA 2ZH2A 1UETA 9ICUA 4F5QA 7ICVA 1ZQKA 2DVIA 5J2HA 8ICPA 5CR0A 4KLHA 7ICFA 2GWSA 4NM2A 7ICHA 3JPOA 9ICGA 4FHYA 3UPQA 3AUOA 3LQCB 4YCXA 4PHPA 2ZH5A 1ZQAA 5HHHA 5J2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DB9 A;  4WBY A;  1R8B A;  4NKT A;  2P66 A;  2FMQ A;  5J2G A;  7ICT A;  5DB8 A;  2ZH6 A;  5J0S A;  4PPX A;  5HR9 A;  2ZH3 A;  4ATB A;  3RH6 A;  1R89 A;  5J2B A;  2PFN A;  4QZI A;  4UB5 A;  1KDH A;  2DR5 A;  4QZB A;  4I2B A;  3AQK A;  2BCV A;  4X4T A;  2ISO A;  4X4V A;  4WC5 A;  3TFS A;  3WFO A;  1PX5 A;  4FHW A;  3ISC A;  4UD4 A;  3WFS C;  8ICZ A;  4M2Y A;  2O1P A;  4YMO A;  4R65 A;  4KLQ A;  3ISB A;  4JWM A;  2ZH7 A;  4YMM A;  5HC9 A;  4JWN A;  4TUR A;  8ICU A;  4UB4 A;  1Q78 A;  4AT8 A;  4IQV A;  8ICY A;  1JQR A;  4UB2 A;  2ISP A;  4XQ7 A;  4F5R A;  4E7X A;  4KLT A;  4PHD A;  2HHP A;  4RQ5 A;  3HJ1 A;  4I2C A;  4KLE A;  9ICK A;  5BPC A;  2ZHA A;  8ICT A;  4RWO A;  1ZQP A;  2FMP A;  4X4Q A;  5J0Q A;  9ICW A;  5DKW A;  4O9M A;  4FHP A;  4PHA A;  4O5C A;  3H3A A;  3H38 A;  4GXK A;  1R8A A;  1UEV A;  4EBK A;  5J0Y A;  4TUQ A;  4MFC A;  4KLS A;  4WBZ A;  1XSP A;  3B0Y A;  4P2H A;  3PMN A;  5BOM A;  8ICI A;  9ICQ A;  4UB3 A;  5CHG A;  3C2K A;  4M9G A;  5J29 A;  4XA5 A;  1JMS A;  1ZQL A;  1NO5 A;  4X0A A;  4P4M A;  9ICC A;  3WFR E;  2Q66 A;  4PH5 A;  1ZQH A;  3AQN A;  3RJG A;  4M9L A;  5J0T A;  4RQ8 A;  4XUS A;  4UAW A;  5IIN A;  5DBB A;  4LZG A;  8ICA A;  3RH5 A;  4Z6F A;  4M0A A;  4O5E A;  4RQ0 A;  4K4H A;  1ZJN A;  4M9J A;  4QZH A;  4KLI A;  1ZQX A;  8ICC A;  4RPY A;  1WOT A;  1MQ2 A;  3HJ4 A;  3MDA A;  4TUP A;  4E8F A;  1MIW A;  3RJF A;  3C18 A;  1F5A A;  4GXJ A;  4RT2 A;  2I9G A;  2BPC A;  1ZQD A;  4I2D A;  1Q79 A;  1TFY A;  4M9N A;  1HUO A;  2M2T A;  4RPZ A;  4I2H A;  1ZQG A;  2BPG A;  4MFF A;  4AT8 B;  2DR9 A;  4FH5 A;  1ZQF A;  4FO6 A;  7ICE A;  3AU2 A;  4X4O A;  1ZQU A;  4I27 A;  4X4P A;  3UQ0 A;  4I2J A;  1BPY A;  4YD1 A;  3MDC A;  5J2J A;  3C5F A;  4RQ6 A;  1OU5 A;  4X4R A;  1MIV A;  5CP2 A;  5CB1 A;  1ZQC A;  1ZQO A;  5HRK A;  4UAY A;  2PXI A;  4I2F A;  4R63 A;  4KLF A;  5HRL A;  4F5N A;  3MBY A;  2DRB A;  7ICI A;  1ZQT A;  4PHE A;  2M2V A;  5DBA A;  2BCR A;  7ICL A;  1ZQM A;  5J2D A;  8ICX A;  3UQ2 A;  2PFO A;  5DB7 A;  8ICB A;  3AQL A;  4I2I A;  9ICA A;  3MGH A;  4XQ8 A;  4X5V A;  1UEU A;  3UPS A;  5HRE A;  2ZH9 A;  5HHI A;  4YMN A;  5HRI A;  4MF8 A;  5IIM A;  2NRK A;  4I29 A;  2ZH1 A;  3AQM A;  5D49 A;  4QZC A;  5CJ7 A;  8ICW A;  1ZQN A;  4WC6 A;  9ICT A;  4IG8 A;  4F5P A;  7ICP A;  9ICN A;  4WCW A;  1TV9 A;  2M2W A;  3HIY A;  4LT6 A;  4O5K A;  5DB6 A;  4RWQ A;  4PGY A;  4AT9 A;  8ICG A;  5F2V O;  4NLZ A;  7ICM A;  1XSN A;  4WC3 A;  1RZT A;  3HW8 A;  3OV7 A;  9ICH A;  1ZQW A;  4KLO A;  3OVB A;  3OVA A;  3GDX A;  5J0O A;  5J0U A;  8ICH A;  5HRD A;  4QZD A;  3V7L A;  1JAJ A;  4DOA A;  4IQU A;  4RQ4 A;  5J2K A;  4X4S A;  2IHM A;  4E80 A;  4QZE A;  4NXZ A;  5CWR A;  4M04 A;  8ICF A;  4LZD A;  4EP7 A;  2ZHB A;  2M2U A;  4M5D A;  5J0W A;  9ICJ A;  4NY8 A;  3AU6 A;  3ISD A;  4X4N A;  5IIK A;  1BPZ A;  1XSL A;  9ICF A;  4I2E A;  3B0X A;  3WFP A;  4QZG A;  4F5O A;  3RH4 A;  4ATB B;  2RFF A;  5J2E A;  1ZQZ A;  3OUY A;  5DEC A;  4I2G A;  9ICR A;  5J2C A;  4S3N A;  5BOL A;  4RQ3 A;  3C66 A;  9ICB A;  3RJE A;  2DRA A;  2DR7 A;  2DR8 A;  4RQ1 A;  4PGX A;  5III A;  1JN3 A;  7ICQ A;  9ICO A;  4KLM A;  1MIY A;  1ZQQ A;  4K4I A;  8ICQ A;  3UXO A;  1FA0 A;  9ICI A;  4MFA A;  7ICS A;  4TUS A;  4QZA A;  4RQ2 A;  4IQW A;  4AT9 B;  9ICV A;  1BPD A;  9ICS A;  1RPL A;  7ICN A;  5J2F A;  4MF2 A;  4QZ8 A;  1HUZ A;  9ICL A;  4UBB A;  1R8C A;  4AT7 A;  5TZV A;  4IQT A;  9ICM A;  3WFQ E;  8ICN A;  8ICL A;  3RJJ A;  4KLU A;  2ZH4 A;  5IIL A;  3JYY A;  3JPP A;  3OGU A;  4WC4 A;  1ZJM A;  4LVS A;  4R64 A;  8ICS A;  4FHV A;  3PNC A;  1ZQV A;  4NLK A;  4NM1 A;  4DO9 A;  9ICP A;  2FMS A;  5IIO A;  1ZQI A;  5HRB A;  5J0P A;  4KLL A;  2BE3 A;  9ICE A;  1ZQE A;  7ICU A;  2VAN A;  2PBE A;  3HWT A;  5CA7 A;  1YLQ A;  3OUY B;  2ID1 A;  7ICJ A;  1BPX A;  8ICK A;  4WC0 A;  3NYB A;  7ICK A;  4KLD A;  3JPS A;  4QZ9 A;  3JPQ A;  4M47 A;  4YN4 A;  3V7J A;  3RJI A;  4X0B A;  2PFP A;  5D46 A;  4P4P A;  2BCQ A;  4QZF A;  4R66 A;  4DOB A;  4NKU A;  4KLJ A;  4UB1 A;  2ZH8 A;  4DOC A;  1BPE A;  3L9D A;  3JPT A;  5HRH A;  4GXI A;  3RJK A;  2W9M A;  5HRF A;  1VJ7 A;  4WC1 A;  4Z6D A;  1ZQR A;  4FH3 A;  1TVA A;  4P4O A;  1KNY A;  4YD2 A;  7ICO A;  4WC7 A;  3JZ0 A;  3V72 A;  4UD5 A;  3JPN A;  2O5A A;  5HRG A;  4AT7 B;  4NLN A;  5J0R A;  3HX0 A;  3V7K A;  5DED A;  1NOM A;  3C2M A;  4X4U A;  8ICJ A;  1BPB A;  4K4G A;  8ICM A;  3RJH A;  8ICR A;  4KLG A;  4XRH A;  4I28 A;  2BCS A;  2BCU A;  7ICG A;  5J2I A;  5D4B A;  4WC2 A;  1ZQY A;  3K75 D;  8ICO A;  5DBC A;  4RQ7 A;  5DDM A;  3UXN A;  4PGQ A;  1ZQS A;  3PML A;  1ZQJ A;  2BPF A;  2PFQ A;  4Z6C A;  3UXP A;  3OVS A;  4FHX A;  4RT3 A;  1V4A A;  1VFG A;  4RPX A;  3MGI A;  3C2L A;  3LK9 A;  5IIJ A;  7ICR A;  4UAZ A;  4M9H A;  1KEJ A;  5DDY A;  4RWN A;  3TFR A;  3H39 A;  4UBC A;  4I2A A;  8ICE A;  5EOZ A;  1MQ3 A;  5J0X A;  9ICX A;  3H37 A;  1ZQB A;  8ICV A;  4Z6E A;  4RWP A;  3JPR A;  1TFW A;  3C5G A;  4EBJ A;  2ZH2 A;  1UET A;  9ICU A;  4F5Q A;  7ICV A;  1ZQK A;  2DVI A;  5J2H A;  8ICP A;  5CR0 A;  4KLH A;  7ICF A;  2GWS A;  4NM2 A;  7ICH A;  3JPO A;  9ICG A;  4FHY A;  3UPQ A;  3AUO A;  3LQC B;  4YCX A;  4PHP A;  2ZH5 A;  1ZQA A;  5HHH A;  5J2A A; 
#chains in the Genus database with same CATH topology
 4WBY A;  2Q67 A;  4YHH O;  4JI2 B;  1QNM A;  4JF3 A;  4A5U B;  5DB8 A;  2ZH6 A;  3G67 A;  5L3F A;  2UXC O;  2ZH3 A;  4JAS A;  4DV0 O;  3JAK A;  3ZCC A;  4AHC A;  4DUY O;  4QZI A;  3JAS A;  3IC9 A;  3OW2 U;  4QZB A;  1LNQ A;  3AQK A;  3CC7 V;  4F6R A;  3CRC A;  1GN6 A;  4KFM A;  2CUG A;  2CH7 B;  2OCC C;  4DV2 O;  3ISC A;  4UXN A;  2DQ0 A;  4LFB B;  1JOY A;  4Z2W A;  1TVK A;  4M2Y A;  1AR1 B;  3ISB A;  1MZE A;  3ML0 A;  2ZH7 A;  4UB4 A;  3ZIA G;  1AJP A;  4MVM A;  1Q78 A;  3HKC B;  3VOU A;  2JEX A;  4EB6 B;  1OV9 A;  5IYD O;  1JPX A;  3APQ A;  3DC5 A;  2XND G;  4QPJ A;  4F5R A;  2KKW A;  3CB2 A;  1L0L H;  5GON A;  5CA1 A;  4U7O A;  2EIK C;  8ICT A;  3P32 A;  5KHI A;  4RWO A;  1TAE A;  1ZQP A;  1EM1 A;  4WH5 A;  1SZT A;  4HYO A;  5J0Q A;  1GN3 A;  4H37 A;  4O9M A;  3CSX A;  3K03 A;  2P06 A;  2EIM C;  2LGW A;  1IBM B;  2XAH A;  1IZ3 A;  4B08 A;  2L6L A;  1UEV A;  3I56 V;  4BIU A;  5J0Y A;  4LR3 A;  2HVK C;  4KLS A;  1XSP A;  1E1R G;  3GB7 C;  8ICI A;  2ZIO A;  9ICQ A;  4DV6 B;  2GBO A;  5K1X A;  1E79 G;  4O4I B;  2DJV A;  5J29 A;  1B6Q A;  3RW0 A;  1DLB A;  4X0A A;  3E89 A;  2D3O W;  3A0B Z;  3TET A;  3E2E A;  3RJG A;  4FFK A;  3OMI B;  3N2G B;  4R50 A;  2JGD B;  2M6Y A;  2HJD A;  2QWQ B;  4LZG A;  1RPR A;  1QVF U;  8ICA A;  5CFT A;  3CJH B;  4PD4 F;  2PI5 A;  4M0A A;  1MSW D;  1SER A;  2V7Q G;  4F4L A;  5L3D A;  5EYP B;  3JAW B;  1ZQX A;  4RPY A;  1IVS A;  4E8F A;  4WFG A;  1F5A A;  4GXJ A;  4MW3 A;  1TUB A;  5KHH A;  1Q79 A;  4I2D A;  3H01 A;  4PA7 A;  3DTU B;  4K9B A;  2A06 H;  3SJB C;  2Q0A A;  1QLE B;  1IXM A;  3E8G A;  4B3S B;  2LFR A;  5JCO A;  4CC6 A;  4PV1 B;  3BPZ A;  1U96 A;  4G2K A;  4DR4 B;  3OAA G;  4UUJ C;  4J7J A;  3AG1 B;  4KXR A;  4FIP C;  4I27 A;  1K9M W;  5B1A C;  1ZSP A;  2KB1 A;  3ASO C;  2ZE8 A;  3I5D A;  1XNR O;  3UQ0 A;  1BPY A;  4YD1 A;  1IDS A;  2R70 A;  1N36 B;  2LW1 A;  4ZKI A;  1BS3 A;  1AJN A;  1K5Q A;  1XL6 A;  1JVM A;  5HRL A;  4OPA A;  3RFR A;  3MBY A;  4DYL A;  3O9O A;  1J5E B;  1YVW A;  2UUA O;  5J2D A;  3MHH C;  1R3K C;  4FPP A;  1Z5V A;  1B06 A;  2RMK B;  4DV4 B;  4X5V A;  2P67 A;  1NKD A;  2ARH A;  2P90 A;  3ZX6 A;  1G6U A;  3BHP A;  1AI7 A;  5FLX N;  5JCO C;  1OCZ C;  1KBH A;  4I0X B;  5IJ9 B;  5ITZ B;  2YI9 A;  5LA6 B;  4YY3 B;  1NVP B;  3H1I H;  4WFH A;  4X66 B;  5D49 A;  1IXB A;  1CXZ B;  5LYJ B;  3SJA C;  1MAB G;  4UCU A;  1W0J G;  1U97 A;  1X59 A;  1EN6 A;  1ZQN A;  4TUY B;  2ZDI A;  2B9Z A;  4LT6 A;  4DR3 B;  4JI4 O;  5F2V O;  4TOI A;  5J2U B;  4J41 A;  2IUB A;  1XMQ B;  1F23 A;  1UPG A;  1WAZ A;  2IH1 C;  2ODM A;  4DR2 O;  4KLO A;  5KHG A;  1GPJ A;  4DV3 O;  2LFS A;  4L8J A;  3OVA A;  5KX5 B;  2YXH A;  2PY5 A;  1R73 A;  3KCX A;  5J0U A;  2EX3 A;  1N33 O;  1P7B A;  2JDI G;  2F93 B;  4QZD A;  1M90 W;  4GLX A;  4GT1 A;  4IQU A;  3ASN B;  2XAF A;  4J7K A;  5J2K A;  5IJ0 B;  3TCU A;  3HPL C;  4NXZ A;  4W4K A;  2ETN A;  4M04 A;  4EP7 A;  1PPJ H;  4JTD B;  4H33 A;  5B3Q A;  4WQL A;  5J0W A;  1FFX B;  2ZDI C;  5FL7 G;  3CCL V;  5HFL A;  4DV7 O;  5B3P A;  4PDM A;  4XDK A;  1WP7 A;  4LC1 A;  4OAG A;  4NXV A;  4JAV A;  4GX1 A;  1CPY A;  1RP3 B;  1FKA O;  2EIL C;  3OUY A;  1Y6X A;  4B3T O;  2PYL A;  5EIB D;  4PA6 A;  1L1F A;  4RQ3 A;  4I4T B;  3VBB A;  3RJE A;  1S5J A;  2F43 G;  3ZMS A;  2HN1 A;  4PA3 A;  4OAI Z;  4LEZ A;  5A9G A;  2DR8 A;  1VP7 A;  4UV8 A;  1Q6U A;  3CC2 V;  1JN3 A;  3CWB H;  1RFY A;  1WN7 A;  2ZIN A;  4X1K B;  5CBH A;  5JJE B;  5CMU A;  2X6A A;  1ZQQ A;  4KLM A;  8ICQ A;  2WWW A;  3UXO A;  5IY5 B;  3RYC A;  1HNZ B;  4JV5 B;  3KKY A;  4K8V A;  4Z1M G;  3CME V;  3WG7 B;  4RQ2 A;  3THO A;  3K0D A;  2XOK G;  4LF5 O;  2XAQ A;  3K7D A;  1BPD A;  1VF5 B;  2AHY A;  1FXH A;  5CA1 B;  4O4J A;  5J2F A;  4GUN A;  4QZ8 A;  9ICL A;  3K57 A;  4FZ1 A;  4Z1V A;  3E8B A;  2WLI A;  2FB5 A;  4U3F H;  3OT7 A;  4NTY A;  1ZUQ A;  2M7W A;  5CHE A;  3APO A;  8ICN A;  2UUC O;  4GX5 A;  4KLU A;  1NJI W;  5LOV B;  3JYY A;  1IBK O;  1I5X A;  4I55 A;  3OGU A;  4X20 B;  1YDX A;  1Y74 B;  1ZJM A;  2KG7 B;  1SQQ H;  1N34 B;  8ICS A;  1OCO C;  1M93 A;  1XEQ A;  2HJF C;  4NM1 A;  3SYC A;  2FMS A;  9ICP A;  5KUK A;  5LBQ A;  1VQM V;  2VQE B;  3IC7 A;  4GYC B;  2VWK A;  4MTO A;  1I94 O;  4OPH A;  2YDE A;  4GKK B;  1BGY H;  1KP2 A;  2PBE A;  7ICU A;  2YSU B;  4G28 B;  5E1A C;  1EN4 A;  2JEU A;  4MS2 A;  2BCC H;  1AI4 A;  4WC0 A;  2JS3 A;  1XI1 A;  2IJK A;  2QWN B;  3ABM B;  5LMN B;  1SQG A;  2YIB A;  2DE0 X;  1BSM A;  4X0B A;  1TUB B;  3ZRW A;  4KHP B;  4OX9 B;  2PZS A;  2F66 C;  2WLL B;  1QR8 A;  2UU9 B;  1HNX O;  4R66 A;  1AP6 A;  4TV9 B;  4KLJ A;  1JR9 A;  1K7D A;  4UB1 A;  2ZH8 A;  4DOC A;  3OTO O;  2IM9 A;  1PNM A;  3JPT A;  5HRH A;  3L74 H;  4MTG A;  2UUB B;  1VJ7 A;  2DYS C;  1WB7 A;  1N32 B;  2QR4 A;  3EVK A;  3ZHR A;  1FXK A;  4JLX A;  3BVO A;  4OXS A;  4WC7 A;  2BTQ B;  3JZ0 A;  1Q7Y W;  4UD5 A;  5IYZ A;  2Q73 A;  5HRG A;  4IHJ B;  1HDJ A;  3GVM A;  1NOM A;  4DK1 A;  4K4G A;  1VQP V;  3BFR A;  4DUZ B;  5D4B A;  4WC2 A;  2P4K A;  2ADQ B;  3G4S V;  3CEI A;  2PFQ A;  2IU0 A;  4LFB O;  4GKJ B;  1N4C A;  4Z6C A;  2QWP B;  1IBL B;  1T5E A;  1XL4 A;  3K79 A;  4JI3 B;  3UXP A;  1AJQ A;  2CH7 A;  1VFG A;  3BAB A;  1UFI A;  1FXK C;  1DF4 A;  4O4L B;  1H2M A;  5KHJ A;  1VQ7 V;  1D5A A;  1XBL A;  2Y69 C;  2ZD9 A;  1KEJ A;  1Y4M A;  2E76 B;  3HKC A;  4EB6 A;  5B1B B;  4I2A A;  5EOZ A;  4CH6 A;  1MQ3 A;  2YI8 A;  4TV8 B;  1SC5 B;  2JJ1 G;  3GWK C;  3QTC A;  1IBM O;  4RWP A;  4LF9 B;  3K9A A;  3WB2 A;  2CAZ C;  2Q5Z A;  1DF5 A;  1ZWI C;  4FLZ A;  7ICV A;  3MHS C;  4QIW F;  4XBF A;  1MMM A;  4NB5 A;  1VQN V;  5J2H A;  1ZX3 A;  1K5S A;  2ILM A;  3NVO A;  3OEH G;  3JPO A;  3QO5 A;  4TT3 G;  4X62 B;  4I0U A;  2PTM A;  3LQC B;  4O4I A;  4YCX A;  2VQF B;  3OR6 C;  4RUE A;  3ZMU A;  4JI0 B;  1ZQA A;  2X6C A;  1YJW V;  5DB9 A;  2LGQ A;  1D2D A;  2QEX V;  3OE7 G;  4YJ2 B;  5J2G A;  3N2G A;  5J0S A;  5K1P A;  4ATB A;  3CJH A;  1R89 A;  2OCH A;  2QM4 A;  1KDH A;  5EYP A;  4B7E A;  3TGU H;  2ZM6 B;  3JAW A;  5EZY B;  1K73 W;  4I2B A;  2BCV A;  4X4T A;  2Y0P A;  2ISO A;  4B3R O;  3CK6 A;  4X4V A;  2EJR A;  1Q82 W;  3NXS A;  3TFS A;  1G4Y B;  4FHW A;  1LUW A;  4B3S O;  4TWK A;  4UD4 A;  3WFS C;  4MTX A;  3N27 A;  2YIA A;  4KM5 A;  5GTH Z;  4JWM A;  2XTA A;  5HC9 A;  4TUR A;  4K3A A;  1VEW A;  4X1Y B;  4IQV A;  8ICY A;  4HZ3 A;  1PL0 A;  1Z5W A;  1PKX A;  4R6Z A;  5LL6 Y;  2YIC A;  3CXH F;  1N36 O;  1GK9 A;  3ETE A;  4RQ5 A;  4LP8 A;  1E1Q G;  3HJ1 A;  9ICK A;  2C2A A;  1GM7 A;  5D5P A;  1YJ9 V;  2ZHA A;  4X4Q A;  9ICW A;  1J5E O;  3CE2 A;  5FPR A;  2Z3Y A;  3H3A A;  2GTA A;  3H38 A;  5A2Q N;  3K5L A;  4EBK A;  5CBF A;  3KG2 A;  3CC4 V;  5BY1 A;  4DV4 O;  4GZR B;  3ZMT A;  4TUQ A;  3B0Y A;  3G6E V;  4BW5 A;  1VQK V;  2Q8V A;  5IWA B;  2F95 B;  5LMU B;  5CHG A;  1QLE C;  3BEH A;  5LGU A;  1NO5 A;  1AI6 A;  9ICC A;  3K3W A;  4YY3 O;  1XIL A;  3WFR E;  4BW9 A;  3CRR A;  1ZQH A;  4X66 O;  5KUM A;  2AXT Z;  3DGE A;  2BSK B;  4I0X A;  5IJ9 A;  1PD3 A;  5J0T A;  1NT2 B;  3JAR B;  4RQ8 A;  2N05 A;  3T2M A;  5ITZ A;  5DBB A;  3AG1 C;  4DR5 B;  2AZ0 A;  2PF4 E;  2HR3 A;  2XHB A;  4AI8 A;  5LHI A;  1GH6 A;  1K92 A;  4Z6F A;  5LYJ A;  4DR3 O;  4RQ0 A;  3U10 A;  1ZJN A;  3D8C A;  4M9J A;  3JAL B;  4TUY A;  4IGG A;  1NZ6 A;  4MTF A;  3AG2 B;  3E35 A;  4ICG A;  1XMQ O;  2QKC A;  1MQ2 A;  1R3L C;  2IH3 C;  3RJF A;  1I08 A;  1H2S B;  2I9G A;  1ZQD A;  2QM8 A;  4CBC A;  4CS3 A;  4P2Z A;  1QR9 A;  5J2U A;  4M9N A;  4FVM A;  3R65 A;  1HUO A;  4JI7 B;  2GSM B;  4X64 O;  3OM3 B;  2DYR B;  4NVP A;  1VQ8 V;  3UQ8 A;  2P4V A;  5EC2 C;  2DN9 A;  5KX5 A;  5AG2 A;  3FB8 C;  2QKA A;  2QA4 V;  1JMK C;  3T1Y B;  1PL4 A;  2JVD A;  3A0H Z;  3BCC H;  4PEL A;  3RYF B;  2X0L A;  1OHH G;  1YCI A;  4YJ3 B;  5IJ0 A;  2EIN B;  2A3Q A;  3MDC A;  5J2J A;  3C5F A;  1WPB A;  2CE4 A;  4JYA O;  5CP2 A;  3A0R A;  1YTF B;  4WQK A;  5HRK A;  1FFX A;  2PXI A;  4KLF A;  2Q9L A;  2DRB A;  4EFE A;  5B5E Z;  7ICI A;  1ZQT A;  4NKG B;  1Q6I A;  2M2V A;  5B1O A;  1FJG B;  1ZAU A;  3OR7 C;  5E79 Z;  7ICL A;  2YC0 A;  4WFB V;  3UQ2 A;  5DB7 A;  4RO2 A;  1NH2 B;  3IFX A;  4CH5 A;  1IUR A;  1UEU A;  5L3E A;  4I4T A;  1W0K G;  2A79 B;  4MF8 A;  3OMA B;  5IIM A;  2VRZ A;  1HNZ O;  2NRK A;  2HG5 C;  4JV5 O;  2ZH1 A;  1BMF G;  1S76 D;  4X1K A;  1GKF A;  3ASN C;  3SPC A;  4QZC A;  3IGA C;  4WBN B;  2UXX A;  1BZK A;  2MW2 B;  4PI2 A;  2A9H A;  1VMG A;  3R66 A;  1Z2G A;  4W4L A;  2F4V B;  4IG8 A;  9ICN A;  4WCW A;  2F23 A;  3WU2 Z;  2XAJ A;  2M2W A;  3ZMV A;  1TV9 A;  4RWQ A;  4HBN A;  1XSN A;  1RZT A;  3HW8 A;  5JH7 A;  3SJQ C;  2QWO B;  2JIZ G;  3EFF K;  1JFF B;  1GO3 F;  3UO2 A;  2GA9 D;  3GDX A;  3JCU Z;  1K33 A;  1BCC H;  3T1H B;  4JI8 B;  1RSO B;  5HRD A;  4JI1 O;  1GM8 A;  3V7L A;  4DOA A;  1JAJ A;  4RQ4 A;  5LOV A;  2WLK A;  2XAS A;  3UCS C;  1SQF A;  4K0K O;  4X20 A;  3O65 A;  1Y74 A;  2VQE O;  2KG7 A;  3UO3 A;  2OTL V;  3ABL B;  3QVN A;  5IY5 C;  3ETQ A;  2E5L O;  3ZRV A;  3G80 A;  3S3X A;  2PI4 A;  4EFB A;  3HR0 A;  3LDE A;  4GKK O;  3ER8 C;  4TQD A;  5IIK A;  9ICF A;  3PJS K;  2OWO A;  4FLW A;  1KEC A;  1KB9 F;  4F5O A;  3F7V C;  4GX2 A;  3RH4 A;  4ATB B;  3U11 A;  2H3O A;  2RFF A;  3TXS A;  1ZQZ A;  5LMN O;  1L8D A;  4S3N A;  2R9A A;  4KHP O;  4OX9 O;  3C66 A;  2NNU A;  1WB8 A;  5HFM A;  3G71 V;  4PGX A;  7ICQ A;  1AR4 A;  2WLL A;  2UUB O;  1OCC B;  3OWG A;  4O69 A;  4TV9 A;  9ICI A;  2IW5 A;  4K8X A;  4TUS A;  1VQ9 V;  1KUQ A;  4IQW A;  5KMG B;  3JD3 A;  4MVQ A;  2B56 A;  3SYQ A;  4AT9 B;  2QKS A;  2WPD G;  1RPL A;  4B3M B;  5CFS A;  4I5S A;  2BTQ A;  4PJ0 Z;  1MG1 A;  3CP1 A;  1V55 B;  1HUZ A;  2WLJ A;  1HR0 B;  1R8C A;  1GMG A;  4IHJ A;  5TZV A;  4UBB A;  4X8A A;  1W59 A;  2FYU H;  1JA8 A;  4LF4 O;  4DUZ O;  2E3C A;  3ABM C;  3H1L H;  3JD4 A;  2HHH B;  8ICL A;  3RJJ A;  2WSS G;  1H2L A;  1S5L Z;  4MSW C;  3UKM A;  3T4D A;  3JPP A;  4MVR A;  4GKJ O;  4WC4 A;  1IBL O;  4JI3 O;  4EEQ A;  1XQ8 A;  4LF7 B;  1OCR B;  1ZQV A;  4NLK A;  4DO9 A;  1XUQ A;  3T4Z A;  1JQ0 A;  5IIO A;  1LUV A;  1ZQI A;  2IHO A;  5HRB A;  2BE3 A;  5EBW C;  2VAN A;  4LNU B;  3HWT A;  4CH4 A;  5CA7 A;  1Y76 B;  3CCU V;  4O4L A;  3CCM V;  1Q8I A;  4X9Q A;  1SS3 A;  1M9N A;  2BBJ A;  4JAA A;  7ICJ A;  2E75 B;  3L71 H;  8ICK A;  4FFB B;  1J95 A;  2CK3 G;  5LGN A;  3IAY A;  7ICK A;  2ZCE A;  1MZF A;  4YN4 A;  3V7J A;  3FKS G;  3LNN A;  3RJI A;  3C90 A;  2ATK C;  4FZ0 A;  3JD0 A;  5KAF Z;  4TV8 A;  2EIJ B;  4QNH B;  4QZF A;  4DV5 O;  1BPE A;  4TQF A;  4WOY A;  3RJK A;  4FM2 A;  2GV9 A;  1YJN V;  3JD1 A;  4X62 O;  4O6A A;  2JK5 C;  2VQF O;  1TVA A;  1KNY A;  3L70 H;  4JI0 O;  4ZOL B;  5J9P C;  1XMO B;  1RM1 B;  7ICO A;  2CTP A;  3M8A A;  1VQL V;  1R6T A;  1OJH A;  1QQC A;  3AEI A;  5B66 Z;  4UVB A;  4AT7 B;  4P9P A;  2PYJ A;  2F1M A;  5J0R A;  1ZL8 B;  1AIL A;  2QTS A;  4YJ2 A;  3CMA V;  2OTJ V;  5B1B C;  3P3P A;  4X4U A;  3NR7 A;  3GWO A;  4ZBM A;  4ZIB A;  3RJH A;  2ZKO A;  2ZM6 O;  4XRH A;  1HNW B;  2QJ1 A;  5J2I A;  2HN2 A;  3OGI B;  3K75 D;  8ICO A;  1MSD A;  3UXN A;  1WLE A;  4BR6 A;  4JI6 O;  2V4D A;  4PGQ A;  1WA8 B;  4O4H B;  5EZY A;  4LWS B;  3L72 H;  4H13 B;  3OVS A;  2E74 B;  4B7K A;  4YHH B;  4RPX A;  3MGI A;  2ZR3 A;  5CN0 A;  1VF7 A;  3C2L A;  5IIJ A;  3K58 A;  4UAZ A;  1S72 V;  2W6I G;  3X2Q B;  4BIO A;  4X1Y A;  4DV0 B;  5DM6 V;  3H39 A;  1BQZ A;  4LCU C;  1JCH A;  1O9H A;  4NXM B;  3H37 A;  1ZQB A;  4J80 A;  2H94 A;  3B2E E;  5JH7 B;  4I7Z B;  5BXZ A;  3JPR A;  4HNA B;  1TFW A;  2JS5 A;  1FYJ A;  1GN4 A;  5BR8 B;  4DV2 B;  1ZQK A;  2AW9 A;  5IWA O;  1X4T A;  3HKB B;  1QU7 A;  5LMU O;  5CR0 A;  3B09 A;  4NM2 A;  5IT9 N;  1PNK A;  3JCZ A;  3UPQ A;  3CCQ V;  4IT5 A;  2ZH5 A;  5HHH A;  5J2A A;  4DR5 O;  1R8B A;  4NKT A;  2P66 A;  4J42 A;  2FMQ A;  2BSK A;  4UVA A;  7ICT A;  2Q69 A;  3BAA A;  3JAR A;  3LSU A;  2WAM A;  2RNB A;  2QE7 G;  2HVJ C;  2EWR A;  1O9G A;  4FLX A;  1TUE B;  5J2B A;  3RH6 A;  4NXX A;  1ZTE A;  4NXU A;  1S0V A;  4UB5 A;  3RYH B;  4IYH A;  3J81 N;  3H1J H;  2LQT A;  3RGB A;  4RQF A;  2MK3 A;  3JAL A;  1V54 B;  1L0N H;  1W2B U;  4X88 A;  4JI7 O;  4PA9 A;  1R6N A;  3WFO A;  5BMV B;  1PX5 A;  5B1A B;  3EXA A;  1AR5 A;  1H8H G;  3T1Y O;  4MKP A;  4EGW A;  3RVY A;  4KB6 A;  2OT5 A;  4BIZ A;  4KLQ A;  4DR7 O;  1XNQ B;  2B51 A;  1JQR A;  1N8R W;  3RYF A;  3B8M A;  5CA0 B;  5KAI Z;  3QO7 A;  4P30 A;  4KLT A;  4PHD A;  2QM7 A;  4YJ3 A;  2HHP A;  4JI2 O;  5BPC A;  4JI5 B;  1DTO A;  2G38 A;  5EBL C;  1M57 B;  4IIJ B;  1DK1 A;  4YIP A;  5DKW A;  1Q3E A;  4O5C A;  1FJG O;  3AG2 C;  4BWA A;  4FM0 A;  2NLJ C;  4UCT A;  3DXR B;  4MT8 A;  4J9Y B;  4P2H A;  3PMN A;  1KKD A;  1KKC A;  1NR7 A;  4XA5 A;  2DYR C;  2QGN A;  3HKE B;  1ZQL A;  4P4M A;  1M5I A;  1AP5 A;  2Q66 A;  4DO2 A;  4M9L A;  2Q7G A;  4X1I A;  1QVG U;  1URF A;  4XUS A;  4LBE C;  4UAW A;  3QNE A;  1NVP D;  3ZS8 C;  3RH5 A;  4WBN A;  2F4V O;  4OAF A;  3J80 N;  5D61 A;  4K4H A;  4O68 A;  2AGA A;  4QZH A;  4KLI A;  3HB3 B;  3JAT B;  8ICC A;  4K8Z A;  3FFQ A;  4YIO A;  1MIW A;  4ZI7 B;  3C18 A;  4RT2 A;  2BPC A;  1TFY A;  3RN4 A;  1M4U A;  3T1H O;  4DW0 A;  2M2T A;  4JI8 O;  3LNM B;  4JYC A;  1JFF A;  4FMT A;  2IJH A;  4UCO A;  4MFF A;  4AT8 B;  2DR9 A;  4FH5 A;  1Q5O A;  1ZQF A;  4DV6 O;  1RSO A;  4C7U A;  2CTR A;  4NXW A;  3AU2 A;  2GUZ B;  1ZQU A;  2A7W A;  3AG3 B;  5H6Q A;  1CEZ A;  5D63 A;  4I2J A;  4GX0 A;  3F5T A;  3CCR V;  4RQ6 A;  1OU5 A;  4X4R A;  1MIV A;  5CB1 A;  1R6K A;  1H2G A;  1RPO A;  4UAY A;  2RJZ A;  1NTM H;  4HAM A;  4F5N A;  2Z5U A;  3B77 A;  3MD0 A;  1FPO A;  4DV3 B;  5LP6 B;  2DOS A;  4LF8 B;  5CFU A;  4PHE A;  5DBA A;  3TJT A;  1ZQM A;  4BAY A;  3ICX A;  3K0G A;  3WB1 A;  3AQL A;  1WNS A;  2ZR2 A;  9ICA A;  4XQ8 A;  2Y4U A;  1KQS U;  3UPS A;  2ZXW B;  5HRE A;  1WJZ A;  4E4E A;  2ZH9 A;  1NS1 A;  3ZHS A;  5HRI A;  1AB3 A;  4I29 A;  2CTW A;  4NXN B;  3AQM A;  3CPW U;  3PHZ A;  3C3T A;  3QO8 A;  2R9I A;  1COW G;  1SA0 B;  4DR4 O;  4I50 B;  4DV7 B;  8ICW A;  3ABL C;  4D7S A;  2EBO A;  4B3M O;  7ICP A;  3HIY A;  1F51 A;  5KMG A;  4O5K A;  4AT9 A;  4O2B B;  8ICG A;  2IU3 A;  3OV7 A;  2LP7 A;  3JSN A;  9ICH A;  4GCZ A;  4WFF A;  3NWI A;  2HHH O;  1XHX A;  5IYC O;  4WCE V;  3CCE V;  2HFE C;  3EF2 A;  1K34 A;  2ZE5 A;  3VQW A;  2IHM A;  3W7X A;  2JGU A;  4E80 A;  5JJJ B;  4QZE A;  5CWR A;  1OCC C;  2DMX A;  1EZV H;  1NR1 A;  2M2U A;  4M5D A;  2OIE A;  3ETD A;  9ICJ A;  3AU6 A;  3B8N A;  5KLV H;  4TSF G;  1KD1 W;  4X4N A;  1BPZ A;  1XRE A;  1XSL A;  4PI0 A;  1K4D C;  3B0X A;  1Q86 W;  3MAQ A;  1PM9 A;  4LNU A;  3CRM A;  3ZBH A;  3K5M A;  1Y76 A;  3FB5 C;  4ABM A;  2AZ2 A;  5DEC A;  1V55 C;  9ICR A;  5JTG A;  4FFB A;  3FD9 A;  5BOL A;  3E83 A;  4JGS A;  5GW7 A;  2DRA A;  3VQY A;  4ZHQ B;  2WA3 A;  3BA9 A;  4RQ1 A;  3CCJ V;  4K4I A;  3CCV V;  1MNG A;  3L73 H;  2NN4 A;  1OCR C;  2VS0 A;  5B1N A;  5JWP A;  1I94 B;  2CGO A;  1XMO O;  2YXY A;  4RQE A;  4DXW A;  1NU1 H;  2ZQM A;  2W0X A;  4CZZ A;  3K04 A;  1NTK H;  3LUT B;  4ZOL A;  4IL6 Z;  2P5O A;  2YUA A;  9ICS A;  1SQX H;  3SPH A;  3ZED A;  1GTO A;  4AT7 A;  4CS4 A;  1P49 A;  2LO1 A;  1ZL8 A;  4U3J A;  2W6J G;  1PNL A;  4FLU A;  1KYO F;  2X6B A;  1HNX B;  4NXT A;  9ICM A;  1F4N A;  1KU9 A;  5CB4 B;  2X7R B;  3DC6 A;  3D36 A;  2ZH4 A;  5IIL A;  4UV9 A;  3SYA A;  2ITD C;  2EIJ C;  4LVS A;  1F4M A;  3SJC C;  4PDR A;  1EFR G;  4FHV A;  3PNC A;  1SQV H;  3UM7 A;  1WA8 A;  4O4H A;  3ZRX A;  2OYQ A;  4K99 A;  3N2K B;  1EZJ A;  4LWS A;  4X1I B;  4DRX B;  5J0P A;  2BOC C;  2P22 C;  2UXB B;  1BL8 A;  2H8P C;  3AG4 B;  1SRY A;  1LR1 A;  4XDJ A;  5LXT B;  1RM1 C;  3ZRS A;  1ARO P;  2WLH A;  4UFZ A;  2ID1 A;  1BPX A;  2B1G A;  4NXM O;  4M47 A;  4RUF A;  3OUF A;  4DR1 B;  2PUS A;  1PV0 A;  2P6J A;  1R3I C;  3SPJ A;  5D5Q A;  2QDO A;  1Y67 A;  3M99 B;  4K35 A;  3E86 A;  4P4P A;  1BT8 A;  4NTW A;  3CHX A;  5BR8 O;  3D36 C;  3Q4H B;  4HNA A;  4NKU A;  1AI5 A;  3SGI A;  4LH7 A;  1QCE A;  3JCF A;  2WLM A;  1V9P A;  4WC1 A;  2QTO A;  3HKB A;  4Z6D A;  3JYC A;  1ZQR A;  1N34 O;  2ITC C;  4P4O A;  4YD2 A;  2FTK A;  5C8Y B;  1YZB A;  3V72 A;  4OGQ B;  5CBG A;  3JPN A;  3ZHV A;  3OMN B;  4I9W A;  4JTA B;  2Y48 A;  3K9S A;  3X2Q C;  3HX0 A;  3WG7 C;  2IBZ H;  1FS0 G;  8ICJ A;  1FFT B;  3E22 A;  3JAM N;  4WFA V;  1M1K W;  4DR6 B;  3AK1 A;  4I28 A;  5B3S B;  2BCU A;  1ZQY A;  3RYH A;  3W7S A;  3ZN0 A;  4PDV A;  5DBC A;  5DDM A;  1ZLZ A;  3MDS A;  5CA3 A;  4DV1 B;  4N7R A;  3PML A;  1YIT V;  1ZQJ A;  2BPF A;  5L3G A;  2UU9 O;  3RYI B;  3E8F A;  4Q6G A;  1B3Q A;  4EV6 A;  5BMV A;  1H8E G;  4WFE A;  4RT3 A;  1V4A A;  1Y66 A;  1XNQ O;  1EBO A;  1H2N A;  5JVD B;  4MW8 A;  4FM1 A;  4FO1 A;  2V1D A;  1YIJ V;  4HX0 A;  4K98 A;  1N32 O;  3CS5 A;  1M56 B;  4RAI A;  7ICR A;  4M9H A;  4K97 A;  2Q4P A;  4LF6 B;  1US6 A;  4MVO A;  5DDY A;  3LDD A;  3TFR A;  4RWN A;  4JI5 O;  5CA0 A;  3ABK B;  2BBH A;  3BRC A;  5J0X A;  9ICX A;  8ICV A;  5JJN B;  2DW4 A;  4Z6E A;  1GRJ A;  2YID A;  4UVC A;  1VQ4 V;  1SES A;  5C93 A;  4B3R B;  2QSA A;  1ORQ C;  4JLZ A;  2ZH2 A;  4WF9 V;  1UET A;  1BHB A;  4IIJ A;  9ICU A;  3RVZ A;  4F5Q A;  3FAV B;  2YEV B;  4N21 A;  1V54 C;  2DVI A;  1VQ6 V;  8ICP A;  7ICF A;  4LFA B;  3ETG A;  1KC8 W;  3DXR A;  3ABT A;  2GWS A;  7ICH A;  5EC1 C;  1OZ0 A;  1FD9 A;  5LHH A;  3CXC U;  4FHY A;  3P3N A;  5JQG B;  1XDC A;  3QF7 A;  4JPR A;  3HKE A;  4UB8 Z;  5FNV A;  3UT5 B;  4J10 A;  4E2L A;  2Q7E A;  3K59 A;  4PPX A;  5HR9 A;  2HKO A;  2PGG A;  2ZE7 A;  1XHZ A;  1S3J A;  3AK2 A;  1VF6 A;  3RT3 C;  2HP8 A;  2PFN A;  2A0L A;  3J7A U;  2DR5 A;  1UJW B;  1VQ5 V;  1MOF A;  3OGC C;  1M57 C;  3JAT A;  1GN2 A;  2Q7H A;  4CH3 A;  4LF9 O;  1HP8 A;  2YIB D;  2BTO A;  1H38 A;  4WC5 A;  4ZI7 A;  3CD6 V;  3SPG A;  1THZ A;  4FLT A;  8ICZ A;  2O1P A;  4YMO A;  4R65 A;  2Q6A A;  4YMM A;  4QE9 A;  4JWN A;  1YF2 A;  8ICU A;  4AT8 A;  4UB2 A;  4J11 A;  2ISP A;  4XQ7 A;  2CTQ A;  2AHZ A;  3C3S A;  4UCV A;  5LGT A;  1JJ2 U;  4EEB A;  2GUZ A;  2UXD B;  4E7X A;  1NI8 A;  4I2C A;  4KLE A;  1A32 A;  1VF6 C;  2EZO A;  2DWD C;  2FMP A;  4LF8 O;  4QGP A;  4U3J B;  1YTF D;  4FHP A;  4PHA A;  4JZ2 A;  4GXK A;  4UCR A;  1R8A A;  4X64 B;  5LP6 A;  4LFC B;  3STL C;  2OCC B;  2ZT9 B;  4MFC A;  4WBZ A;  3F5W C;  1Q6H A;  5BOM A;  4LEW A;  1P84 F;  4DW1 A;  3SYO A;  4UB3 A;  4O2A B;  5FPO A;  5J2T B;  3C2K A;  4M9G A;  3CRA A;  2RN9 A;  3FB6 C;  1JMS A;  1NH2 D;  4NXN O;  2Y0I A;  4X65 B;  4AQY B;  1FXV A;  4PH5 A;  3CX5 F;  1SF9 A;  3AQN A;  3ER9 B;  4F6E A;  2B4V A;  4JYA B;  5IIN A;  4KP4 A;  5H5N A;  3ZMZ A;  3M7M X;  1SZX A;  2XUM A;  2YS8 A;  2ZNJ A;  3AG3 C;  1SA0 A;  2EIK B;  1N0J A;  3JAK B;  4O5E A;  4I50 A;  3ABU A;  3FYI B;  3JAS B;  2UXC B;  1I7F A;  3D3I A;  3DSQ A;  3A8T A;  3AK3 A;  4QPK A;  2EIM B;  4DUY B;  3HJ4 A;  4F6R B;  3MDA A;  3LSS A;  4TUP A;  1R1B A;  4O2B A;  5BZB A;  1S5H C;  1QLN A;  5LP6 C;  1QBZ A;  4PDL A;  1K4C C;  1TVK B;  3ZN1 A;  4RPZ A;  4I2H A;  4L87 A;  1NTZ H;  1ZQG A;  2BPG A;  3CCS V;  2FL4 A;  2KQX A;  2WLN A;  2ZXW C;  3OEE G;  4PHZ A;  3P30 A;  4FO6 A;  3LSQ A;  1ROP A;  4MVS A;  4CS2 A;  7ICE A;  2ZIM A;  4X4O A;  4UCS A;  1NBM G;  4X4P A;  3JSL A;  4H0L B;  5GON B;  3PN1 A;  3BA8 A;  3VQV A;  3G6B A;  1ZQC A;  1ZQO A;  1VIB A;  2HEP A;  4UB6 Z;  4I2F A;  4R63 A;  1SKV A;  1B04 A;  4I9Q A;  4MVZ A;  3E22 B;  2CDY A;  5L3C A;  2BCR A;  4QE7 A;  3MCR A;  8ICX A;  2PFO A;  1H2K A;  1GAX A;  8ICB A;  4I2I A;  3MGH A;  2N74 A;  3BY6 A;  4J7Z A;  4JI1 B;  2JRI A;  3HKD A;  2FKX A;  2GAF D;  5DN6 G;  4G27 B;  4K0K B;  3K5N A;  5HHI A;  4ZHQ A;  4H44 B;  2RQ6 A;  2E5L B;  2B5U A;  3A2F A;  3ASO B;  4FLY A;  1QHT A;  1XOU A;  5CJ7 A;  2RDC A;  4WC6 A;  3CRQ A;  9ICT A;  4CC5 A;  3AG7 A;  2BOB C;  4F5P A;  1R3J C;  2W0F C;  4OAH A;  2ADP A;  5DB6 A;  4K9A A;  4PGY A;  4EKW A;  2EJ7 A;  4NLZ A;  7ICM A;  5TIS Z;  4WC3 A;  2EUL A;  1YSC A;  1ZQW A;  1FAF A;  3OVB A;  1K3E A;  2GTS A;  2L35 A;  5J0O A;  1OCZ B;  3OD4 A;  8ICH A;  5CB4 A;  4NTX A;  4IYI A;  1EN5 A;  4X4S A;  4AIL C;  2KSD A;  3I55 V;  4O67 A;  3IJ4 A;  1CP9 A;  5GTI Z;  8ICF A;  4LZD A;  2Z0A A;  5FNV B;  2ZHB A;  2UXB O;  3N2K A;  1XNR B;  2ZNI A;  4NY8 A;  3ISD A;  2LW7 A;  4J9Z B;  4DRX A;  2P7T C;  4LEV A;  4I2E A;  4XDL A;  3WFP A;  4QZG A;  2EIN C;  5LXT A;  4LF4 B;  5J2E A;  3OFN G;  4DR1 O;  4I2G A;  2QWR B;  2R72 A;  5J2C A;  5EK0 A;  2FML A;  2UXN A;  2XAG A;  2UUA B;  1WPX A;  9ICB A;  2DR7 A;  1P7G A;  2IJJ A;  3ERC C;  5III A;  1SQP H;  9ICO A;  1MIY A;  2B1I A;  3Q4H A;  2OIG A;  1FA0 A;  4MFA A;  2Q0O C;  2D2C B;  2EZP A;  3SDL A;  7ICS A;  4QZA A;  2DQ3 A;  1NQT A;  4LEY A;  4JZG A;  5KA6 A;  9ICV A;  5IDJ A;  4P9O A;  3F7Y C;  5C8Y A;  7ICN A;  2EIL B;  3AG4 C;  4R7C A;  1GM9 A;  4MF2 A;  4JI4 B;  5KA5 A;  3STZ C;  3K08 A;  1YHQ V;  5EIB C;  3H1H H;  2IJI A;  3KCY A;  3OUS A;  4DR6 O;  3ZHQ A;  1BQ0 A;  4IQT A;  4DR2 B;  1Q81 W;  3ZHU A;  4DV5 B;  4JYY A;  1MA1 A;  3WFQ E;  4DV1 O;  1N33 B;  4X89 A;  4ASU G;  4DK0 A;  1S77 D;  4R64 A;  5KHK A;  1YXB A;  3WB0 A;  3RYI A;  4RWU A;  1P4R A;  2GHY A;  4KLL A;  3ZJZ A;  1VAR A;  2JGD A;  9ICE A;  1F7Y A;  1ZQE A;  4MVU A;  4LF6 O;  5JVD A;  4LH6 A;  1VQO V;  1YLQ A;  4QJF B;  3U0Z A;  3FX7 A;  3OUY B;  5IYB O;  3SPI A;  3NYB A;  4KLD A;  3JPS A;  2N04 A;  4QZ9 A;  3JPQ A;  4R8C A;  4D7T A;  1ENV A;  2NR5 A;  4B3T B;  1TGO A;  1HR0 O;  2PFP A;  5D46 A;  4JI6 B;  3H9V A;  4JYB A;  2BCQ A;  2WA4 A;  1K97 A;  1Q90 D;  5B3S C;  2VWJ A;  4DOB A;  1OCO B;  4JTC B;  3RYC B;  3JD2 A;  1K8A W;  4LFA O;  3L9D A;  3FAV A;  2YEV A;  4JAU A;  4GXI A;  2W9M A;  2DWE C;  5HRF A;  4Q20 A;  3FB7 C;  3WFV A;  5EBM C;  3K5O A;  4FH3 A;  4LF7 O;  5H6R A;  4NR1 A;  2XT9 A;  1BE3 H;  4O4J B;  5JQG A;  1G1X B;  2O5A A;  4LF5 B;  1M56 C;  4NLN A;  3UT5 A;  5H9C A;  3W7W A;  2WLI B;  1YEW A;  3EHB B;  3D3Q A;  3FYE B;  4K96 A;  3V7K A;  3W7T A;  5DED A;  3C2M A;  3ABK C;  1YI2 V;  1BPB A;  8ICM A;  3ZHT A;  8ICR A;  5H2F Z;  4KLG A;  3RBZ A;  2BCS A;  4KL1 A;  2Y4T A;  3LDC A;  7ICG A;  3B40 A;  4I55 B;  1Q43 A;  3SYP A;  2YXL A;  1KMI Z;  4RQ7 A;  1N0N A;  3H1K H;  3S3W A;  2UUC B;  2FCL A;  1ZQS A;  4FJC C;  3NKU A;  3CYO A;  3HKD B;  2ZE6 A;  3E8H A;  1IBK B;  2DYS B;  3T1C A;  3RWR D;  1KP3 A;  2O57 A;  4XJE A;  1SQB H;  3L75 H;  3VQX A;  4U7N A;  2RCV A;  4FHX A;  5LA6 A;  1SET A;  2K9P A;  3LK9 A;  1HWY A;  2LJ2 A;  1I0H A;  4D6T H;  1WP8 A;  2UXD O;  5D62 A;  4KUM A;  1TA8 A;  1BHA A;  2GDS A;  4UBC A;  8ICE A;  5IE9 A;  3B4S A;  4PA4 A;  3TXQ A;  4EED A;  3ZRW B;  1I5Y A;  2Q68 A;  1HW7 A;  1D5N A;  4N23 A;  5LHG A;  3C5G A;  4EBJ A;  2JJ2 G;  3QG5 A;  2HLD G;  4FK5 C;  3KZI Z;  4LFC O;  1DGS A;  4YXW G;  1HNW O;  5L3B A;  1PP9 H;  1G8M A;  3TK1 A;  3K06 A;  3SR2 C;  4KLH A;  3OTO B;  4DR7 B;  1FXK B;  4NYK A;  9ICG A;  4X65 O;  4AQY O;  3OTF A;  4FLV A;  1JX9 A;  2K1E A;  3W7U A;  3AUO A;  1JJO A;  4O2A A;  5J2T A;  5IYZ B;  2Y69 B;  1AVM A;  2R9R B;  4PHP A;  1WOT A;  2CGN A;  1IX9 A;  4YMN A; 
#chains in the Genus database with same CATH homology
 5DB9 A;  4WBY A;  1R8B A;  4NKT A;  2P66 A;  2FMQ A;  5J2G A;  7ICT A;  5DB8 A;  2ZH6 A;  5J0S A;  4PPX A;  5HR9 A;  2ZH3 A;  4ATB A;  3RH6 A;  1R89 A;  5J2B A;  2PFN A;  4QZI A;  4UB5 A;  1KDH A;  2DR5 A;  4QZB A;  4I2B A;  3AQK A;  2BCV A;  4X4T A;  2ISO A;  4X4V A;  4WC5 A;  3TFS A;  3WFO A;  1PX5 A;  4FHW A;  3ISC A;  4UD4 A;  3WFS C;  8ICZ A;  4M2Y A;  2O1P A;  4YMO A;  4R65 A;  4KLQ A;  3ISB A;  4JWM A;  2ZH7 A;  4YMM A;  5HC9 A;  4JWN A;  4TUR A;  8ICU A;  4UB4 A;  1Q78 A;  4AT8 A;  4IQV A;  8ICY A;  1JQR A;  4UB2 A;  2ISP A;  4XQ7 A;  4F5R A;  4E7X A;  4KLT A;  4PHD A;  2HHP A;  4RQ5 A;  3HJ1 A;  4I2C A;  4KLE A;  9ICK A;  5BPC A;  2ZHA A;  8ICT A;  4RWO A;  1ZQP A;  2FMP A;  4X4Q A;  5J0Q A;  9ICW A;  5DKW A;  4O9M A;  4FHP A;  4PHA A;  4O5C A;  3H3A A;  3H38 A;  4GXK A;  1R8A A;  1UEV A;  4EBK A;  5J0Y A;  4TUQ A;  4MFC A;  4KLS A;  4WBZ A;  1XSP A;  3B0Y A;  4P2H A;  3PMN A;  5BOM A;  8ICI A;  9ICQ A;  4UB3 A;  5CHG A;  3C2K A;  4M9G A;  5J29 A;  4XA5 A;  1JMS A;  1ZQL A;  1NO5 A;  4X0A A;  4P4M A;  9ICC A;  3WFR E;  2Q66 A;  4PH5 A;  1ZQH A;  3AQN A;  3RJG A;  4M9L A;  5J0T A;  4RQ8 A;  4XUS A;  4UAW A;  5IIN A;  5DBB A;  4LZG A;  8ICA A;  3RH5 A;  4Z6F A;  4M0A A;  4O5E A;  4RQ0 A;  4K4H A;  1ZJN A;  4M9J A;  4QZH A;  4KLI A;  1ZQX A;  8ICC A;  4RPY A;  1WOT A;  1MQ2 A;  3HJ4 A;  3MDA A;  4TUP A;  4E8F A;  1MIW A;  3RJF A;  3C18 A;  1F5A A;  4GXJ A;  4RT2 A;  2I9G A;  2BPC A;  1ZQD A;  4I2D A;  1Q79 A;  1TFY A;  4M9N A;  1HUO A;  2M2T A;  4RPZ A;  4I2H A;  1ZQG A;  2BPG A;  4MFF A;  4AT8 B;  2DR9 A;  4FH5 A;  1ZQF A;  4FO6 A;  7ICE A;  3AU2 A;  4X4O A;  1ZQU A;  4I27 A;  4X4P A;  3UQ0 A;  4I2J A;  1BPY A;  4YD1 A;  3MDC A;  5J2J A;  3C5F A;  4RQ6 A;  1OU5 A;  4X4R A;  1MIV A;  5CP2 A;  5CB1 A;  1ZQC A;  1ZQO A;  5HRK A;  4UAY A;  2PXI A;  4I2F A;  4R63 A;  4KLF A;  5HRL A;  4F5N A;  3MBY A;  2DRB A;  7ICI A;  1ZQT A;  4PHE A;  2M2V A;  5DBA A;  2BCR A;  7ICL A;  1ZQM A;  5J2D A;  8ICX A;  3UQ2 A;  2PFO A;  5DB7 A;  8ICB A;  3AQL A;  4I2I A;  9ICA A;  3MGH A;  4XQ8 A;  4X5V A;  1UEU A;  3UPS A;  5HRE A;  2ZH9 A;  5HHI A;  4YMN A;  5HRI A;  4MF8 A;  5IIM A;  2NRK A;  4I29 A;  2ZH1 A;  3AQM A;  5D49 A;  4QZC A;  5CJ7 A;  8ICW A;  1ZQN A;  4WC6 A;  9ICT A;  4IG8 A;  4F5P A;  7ICP A;  9ICN A;  4WCW A;  1TV9 A;  2M2W A;  3HIY A;  4LT6 A;  4O5K A;  5DB6 A;  4RWQ A;  4PGY A;  4AT9 A;  8ICG A;  5F2V O;  4NLZ A;  7ICM A;  1XSN A;  4WC3 A;  1RZT A;  3HW8 A;  3OV7 A;  9ICH A;  1ZQW A;  4KLO A;  3OVB A;  3OVA A;  3GDX A;  5J0O A;  5J0U A;  8ICH A;  5HRD A;  4QZD A;  3V7L A;  1JAJ A;  4DOA A;  4IQU A;  4RQ4 A;  5J2K A;  4X4S A;  2IHM A;  4E80 A;  4QZE A;  4NXZ A;  5CWR A;  4M04 A;  8ICF A;  4LZD A;  4EP7 A;  2ZHB A;  2M2U A;  4M5D A;  5J0W A;  9ICJ A;  4NY8 A;  3AU6 A;  3ISD A;  4X4N A;  5IIK A;  1BPZ A;  1XSL A;  9ICF A;  4I2E A;  3B0X A;  3WFP A;  4QZG A;  4F5O A;  3RH4 A;  4ATB B;  2RFF A;  5J2E A;  1ZQZ A;  3OUY A;  5DEC A;  4I2G A;  9ICR A;  5J2C A;  4S3N A;  5BOL A;  4RQ3 A;  3C66 A;  9ICB A;  3RJE A;  2DRA A;  2DR7 A;  2DR8 A;  4RQ1 A;  4PGX A;  5III A;  1JN3 A;  7ICQ A;  9ICO A;  4KLM A;  1MIY A;  1ZQQ A;  4K4I A;  8ICQ A;  3UXO A;  1FA0 A;  9ICI A;  4MFA A;  7ICS A;  4TUS A;  4QZA A;  4RQ2 A;  4IQW A;  4AT9 B;  9ICV A;  1BPD A;  9ICS A;  1RPL A;  7ICN A;  5J2F A;  4MF2 A;  4QZ8 A;  1HUZ A;  9ICL A;  4UBB A;  1R8C A;  4AT7 A;  5TZV A;  4IQT A;  9ICM A;  3WFQ E;  8ICN A;  8ICL A;  3RJJ A;  4KLU A;  2ZH4 A;  5IIL A;  3JYY A;  3JPP A;  3OGU A;  4WC4 A;  1ZJM A;  4LVS A;  4R64 A;  8ICS A;  4FHV A;  3PNC A;  1ZQV A;  4NLK A;  4NM1 A;  4DO9 A;  9ICP A;  2FMS A;  5IIO A;  1ZQI A;  5HRB A;  5J0P A;  4KLL A;  2BE3 A;  9ICE A;  1ZQE A;  7ICU A;  2VAN A;  2PBE A;  3HWT A;  5CA7 A;  1YLQ A;  3OUY B;  2ID1 A;  7ICJ A;  1BPX A;  8ICK A;  4WC0 A;  3NYB A;  7ICK A;  4KLD A;  3JPS A;  4QZ9 A;  3JPQ A;  4M47 A;  4YN4 A;  3V7J A;  3RJI A;  4X0B A;  2PFP A;  5D46 A;  4P4P A;  2BCQ A;  4QZF A;  4R66 A;  4DOB A;  4NKU A;  4KLJ A;  4UB1 A;  2ZH8 A;  4DOC A;  1BPE A;  3L9D A;  3JPT A;  5HRH A;  4GXI A;  3RJK A;  2W9M A;  5HRF A;  1VJ7 A;  4WC1 A;  4Z6D A;  1ZQR A;  4FH3 A;  1TVA A;  4P4O A;  1KNY A;  4YD2 A;  7ICO A;  4WC7 A;  3JZ0 A;  3V72 A;  4UD5 A;  3JPN A;  2O5A A;  5HRG A;  4AT7 B;  4NLN A;  5J0R A;  3HX0 A;  3V7K A;  5DED A;  1NOM A;  3C2M A;  4X4U A;  8ICJ A;  1BPB A;  4K4G A;  8ICM A;  3RJH A;  8ICR A;  4KLG A;  4XRH A;  4I28 A;  2BCS A;  2BCU A;  7ICG A;  5J2I A;  5D4B A;  4WC2 A;  1ZQY A;  3K75 D;  8ICO A;  5DBC A;  4RQ7 A;  5DDM A;  3UXN A;  4PGQ A;  1ZQS A;  3PML A;  1ZQJ A;  2BPF A;  2PFQ A;  4Z6C A;  3UXP A;  3OVS A;  4FHX A;  4RT3 A;  1V4A A;  1VFG A;  4RPX A;  3MGI A;  3C2L A;  3LK9 A;  5IIJ A;  7ICR A;  4UAZ A;  4M9H A;  1KEJ A;  5DDY A;  4RWN A;  3TFR A;  3H39 A;  4UBC A;  4I2A A;  8ICE A;  5EOZ A;  1MQ3 A;  5J0X A;  9ICX A;  3H37 A;  1ZQB A;  8ICV A;  4Z6E A;  4RWP A;  3JPR A;  1TFW A;  3C5G A;  4EBJ A;  2ZH2 A;  1UET A;  9ICU A;  4F5Q A;  7ICV A;  1ZQK A;  2DVI A;  5J2H A;  8ICP A;  5CR0 A;  4KLH A;  7ICF A;  2GWS A;  4NM2 A;  7ICH A;  3JPO A;  9ICG A;  4FHY A;  3UPQ A;  3AUO A;  3LQC B;  4YCX A;  4PHP A;  2ZH5 A;  1ZQA A;  5HHH A;  5J2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...