5F2VO

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to ampcpp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
184
Chain Sequence
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
molecule tags Transferase
molecule keywords GTP pyrophosphokinase YjbM
total genus 59
structure length 184
sequence length 195
chains with identical sequence P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5f2vO02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5f2vO01
3OGUA 3HWTA 4UB2A 4I27A 4I2IA 4EBKA 5HRKA 9ICMA 4PGQA 5IIIA 1BPBA 7ICEA 2ZH4A 4WBYA 4X4OA 4QZIA 4X4SA 5CWRA 3MDCA 9ICKA 4KLUA 5J2AA 3HW8A 2BCRA 5HRGA 4QZCA 4M5DA 4NLNA 4FHXA 3TFRA 4Z6CA 1ZQRA 5DB7A 3OV7A 9ICJA 3RJJA 4PHAA 4AT8B 4E7XA 4I2JA 4UB3A 3OUYA 4IG8A 1R89A 3JPSA 4RQ2A 3RJEA 4XUSA 4WC5A 4WC6A 2ZH8A 2BCQA 4AT9A 3UQ0A 4WC1A 8ICJA 3MGHA 8ICUA 1YLQA 8ICOA 4KLEA 1ZQZA 3AQKA 4QZDA 4UAZA 3H38A 4WC7A 4RPYA 3V7KA 2ZH3A 1ZQGA 7ICUA 2BCVA 8ICPA 5HRBA 3RJIA 9ICHA 4X4NA 1BPYA 2BPFA 2ZHBA 3ISCA 4F5RA 2ZHAA 5EOZA 4I2GA 4LZDA 4Z6EA 4NM2A 4Z6DA 1ZQEA 3JPOA 8ICKA 4P4OA 4DOAA 5D49A 2DRBA 4FHYA 4GXKA 1ZJNA 4KLLA 4AT7B 9ICNA 1HUOA 7ICNA 3AQMA 1MQ3A 2DR9A 4YD1A 9ICEA 1R8CA 3PNCA 4KLIA 5J0SA 8ICCA 3OVSA 4O5CA 4PHEA 4RQ8A 2O5AA 7ICTA 2FMQA 4NKUA 3PMLA 3RJFA 4P2HA 4F5NA 4M9NA 2ZH7A 4KLMA 1ZQTA 3V7LA 1RZTA 2Q66A 4M2YA 4YN4A 7ICVA 8ICIA 2DVIA 4X0BA 4UBBA 8ICGA 4UD4A 8ICFA 2BCUA 4MFFA 4X4PA 4RQ4A 1WOTA 2M2TA 1ZQOA 7ICGA 9ICGA 4I29A 3C66A 1MQ2A 3UPQA 7ICIA 4R64A 8ICTA 4F5PA 3V72A 2PXIA 3K75D 5HHHA 8ICRA 1BPEA 4NXZA 4KLFA 3UPSA 4KLSA 5HRDA 4AT7A 5IIOA 4RT3A 4NLZA 5J2IA 2FMPA 4XQ8A 4UB4A 4X4TA 4RPXA 3B0YA 4I2AA 1JMSA 9ICTA 7ICPA 9ICBA 4QZ9A 3HIYA 3AU2A 5J0PA 4TUQA 1UETA 1V4AA 4M9HA 7ICRA 4O9MA 1Q78A 3OVBA 9ICWA 4XQ7A 1TVAA 1JAJA 3HJ4A 4E8FA 5HRIA 5J0YA 5DECA 3UXNA 4IQTA 5DEDA 4TUPA 1ZQFA 4P4PA 4LT6A 4QZAA 5DDMA 4UBCA 1ZQQA 8ICLA 4P4MA 3C5FA 3H39A 4I2HA 4M9JA 1MIWA 7ICLA 4FHWA 1NOMA 4RWPA 4PGXA 2PFPA 5D4BA 4UB5A 1KDHA 4NY8A 2ISOA 9ICLA 9ICSA 9ICIA 1KNYA 5CP2A 8ICWA 7ICSA 1VFGA 3TFSA 4Z6FA 2BE3A 1ZQXA 4QZHA 5DBBA 3RH5A 9ICPA 1FA0A 5BOLA 9ICVA 2PFNA 2ZH6A 3H37A 5J0TA 4X4UA 4UB1A 4KLJA 2P66A 5J2DA 8ICVA 1KEJA 4FHPA 4KLGA 4S3NA 7ICJA 4K4IA 4XRHA 7ICHA 4RQ3A 4WC3A 4PHDA 3C2LA 3MDAA 3LQCB 4X5VA 8ICQA 5J2CA 1BPXA 3ISDA 3WFSC 4WC4A 4JWNA 5IIJA 8ICNA 1ZQHA 4I2DA 4M04A 1ZQMA 8ICZA 9ICOA 7ICOA 3AQLA 4QZ8A 4E80A 1ZQWA 1R8AA 5HHIA 5DKWA 3AUOA 2O1PA 4DO9A 1ZQLA 4AT9B 3AU6A 4I2BA 5J29A 4NKTA 1ZQJA 4EBJA 2NRKA 3UQ2A 3WFOA 5J0OA 3OUYB 3NYBA 4WBZA 4TURA 5DBAA 4NM1A 4WCWA 4X4RA 2ID1A 4AT8A 2PFOA 2ZH1A 4I2FA 4KLHA 1NO5A 1Q79A 3OVAA 1ZJMA 4PPXA 4I28A 4MFAA 4TUSA 2BPCA 1XSPA 3H3AA 5J0XA 2BPGA 4I2EA 4IQVA 3C5GA 4UAYA 2IHMA 1XSNA 5HC9A 2DR8A 4YD2A 3JPNA 1TV9A 1ZQPA 4O5KA 4YCXA 3WFQE 5DB6A 2PBEA 5CR0A 5DDYA 1UEUA 5IIMA 2M2UA 3WFRE 1ZQSA 4GXIA 4QZEA 4YMNA 3GDXA 2DR7A 4R63A 4KLQA 4EP7A 5J2KA 3L9DA 4KLOA 2ZH5A 5DBCA 4MF8A 8ICHA 4F5OA 1MIVA 3LK9A 3JZ0A 1BPDA 5HRLA 4MF2A 4YMOA 8ICYA 2RFFA 4RT2A 4IQUA 4RPZA 3PMNA 3JPQA 3JYYA 2DRAA 9ICQA 4M9GA 5CB1A 3MGIA 4R65A 7ICMA 9ICCA 2I9GA 1F5AA 4ATBB 4X0AA 3WFPA 1ZQCA 4FH3A 3JPPA 4IQWA 4WC2A 1BPZA 9ICXA 9ICUA 3C2MA 4UAWA 4NLKA 4FH5A 1JN3A 1TFWA 5DB8A 2ISPA 4QZFA 5IINA 4O5EA 4M0AA 8ICEA 1PX5A 4QZGA 5J2BA 4PHPA 4JWMA 3RH6A 5IIKA 5J2JA 5BPCA 4I2CA 2W9MA 5D46A 2BCSA 4F5QA 1ZQYA 3RJHA 5HREA 1ZQBA 1TFYA 4PGYA 5CHGA 4WC0A 4M9LA 5HR9A 4UD5A 2M2VA 2VANA 4RQ0A 8ICXA 1ZQNA 4KLDA 5J0RA 3UXOA 5J0QA 4QZBA 1XSLA 4GXJA 4RQ6A 5HRHA 4R66A 5HRFA 3ISBA 3C2KA 1RPLA 4YMMA 5CA7A 2GWSA 3AQNA 3C18A 3JPRA 5J2GA 5J0WA 5BOMA 4RWQA 3HJ1A 8ICBA 3RJGA 8ICSA 2ZH2A 3JPTA 4RQ5A 3B0XA 4KLTA 1HUZA 5CJ7A 7ICKA 8ICMA 1UEVA 5J2FA 1ZQAA 3MBYA 2DR5A 4PH5A 4FO6A 5J2HA 3UXPA 2ZH9A 4RQ1A 5DB9A 4MFCA 1VJ7A 4LZGA 7ICQA 4LVSA 1ZQVA 9ICAA 4RWOA 1ZQDA 4RWNA 1JQRA 9ICFA 1ZQKA 4M47A 4X4VA 2PFQA 4K4GA 3RH4A 4K4HA 7ICFA 1OU5A 4XA5A 4FHVA 4ATBA 5J0UA 4X4QA 5IILA 1ZQIA 3HX0A 3RJKA 2FMSA 5TZVA 4DOCA 1MIYA 1R8BA 2HHPA 5F2VO 8ICAA 4RQ7A 9ICRA 3V7JA 5J2EA 2M2WA 4DOBA 1ZQUA
chains in the Genus database with same CATH superfamily
4Z1VA 3WB1A 1VQ4V 5HRKA 4WFAV 7ICEA 2DOSA 2W0XA 4HZ3A 4U3FH 2D3OW 1S76D 4X4SA 2UU9O 4LF8O 4CC5A 1V54C 5CB4A 1J5EO 3JCFA 2F4VO 4J9YB 4YHHO 1G8MA 5HRGA 1S5LZ 1R3KC 3TFRA 1H8EG 1ZQRA 3OV7A 1WP8A 4TQDA 1JFFA 4PA6A 2JEXA 5CN0A 4I2JA 3OUYA 1MABG 4IYIA 3RJEA 2H3OA 1D5NA 1PNKA 2QWPB 2ZH8A 4NKGB 3SJBC 2BCQA 4N23A 2PGGA 2GHYA 8ICUA 8ICOA 1ENVA 2KQXA 1Q6UA 5H2FZ 1ZQZA 1GRJA 3V7KA 2VRZA 5LXTB 1F7YA 4RO2A 7ICUA 3O9OA 4FLYA 5HRBA 3W7TA 5LMUO 1BPYA 2ZHBA 3KG2A 1M9NA 3CC4V 3CEIA 4DR4O 1JQ0A 1EN5A 1XNQB 4KM5A 2UUCB 2HP8A 4LZDA 4BW9A 1Y76A 4MKPA 3FB5C 5H9CA 4P4OA 2E5LO 5JJEB 3LSSA 1K5SA 4MW8A 1K4DC 5J2UB 1BE3H 3LDCA 3CJHA 3AQMA 5LL6Y 1FFTB 4MW3A 1Q7YW 5LP6C 1Z5WA 1D5AA 3FAVA 1R8CA 4O4JB 1BCCH 4GYCB 4DV7O 3PNCA 2ZM6O 5IT9N 4O5CA 5JJNB 1IXMA 1XILA 2XTAA 4RQ8A 1WB7A 2YXLA 5JTGA 1SZXA 5LP6B 4P2HA 3E83A 2YDEA 1OCRB 3ABUA 5L3CA 3RYCB 5IWAO 1SQPH 4DV4O 3B2EE 3QO7A 1VF6C 4X0BA 2BCUA 4W4KA 4MFFA 4RQ4A 1E79G 3BPZA 3OFNG 1ZQOA 2E74B 5LYJA 4JI4O 2G38A 2UXXA 2BOCC 3AG1C 1PL4A 2JDIG 3ZJZA 2A3QA 4R64A 3D3IA 4H37A 1Y4MA 1BT8A 3HKCB 3C3SA 3CB2A 3E8FA 4X66O 5HRDA 1M5IA 1X4TA 2KKWA 1FPOA 3AEIA 4KHPB 4GKKB 2PY5A 4GCZA 5IIOA 2UUAB 5J2IA 5C93A 2YEVA 4JI7O 4QPJA 4Q20A 1TAEA 5LHIA 3RYFB 4PDVA 2EZOA 3WB2A 1QCEA 4U3JB 1K73W 3ETQA 3BAAA 3HIYA 4DR3O 4TUQA 5J0PA 4M9HA 5B3SB 1V4AA 3NKUA 5IDJA 4EGWA 2Q68A 4O9MA 4PV1B 2ITCC 1Q78A 1KB9F 2QM4A 1NVPB 5EC2C 3R66A 4DRXA 2LJ2A 3CRCA 2DYRC 1GM9A 1XDCA 4PDMA 5IJ0B 3JAWB 3OGCC 5CA0B 2EILB 3K08A 4UB5A 1KP2A 3ML0A 4X9QA 1K9MW 2QM8A 4QIWF 4NY8A 1OCOB 2ISOA 5CA3A 1W59A 2YUAA 1AR1B 3K59A 2LGWA 1KNYA 5CP2A 2XAGA 4ICGA 4JI2B 2CUGA 2P4VA 5EZYB 1VFGA 1SF9A 3T1YB 4EFBA 5LA6B 3RH5A 9ICVA 2UU9B 5B3PA 1BQ0A 2ZH6A 5D5PA 3H37A 4X4UA 3ZRXA 2F93B 4UB1A 8ICVA 1K3EA 5JQGA 1MOFA 4XDKA 1XMOB 2ATKC 3JASA 2QWNB 2PF4E 1R73A 4O4HB 2LFRA 2BBJA 2ZCEA 5IYDO 2FYUH 1YTFB 2ADQB 4ASUG 3U0ZA 4JI1O 3K0DA 3TXQA 3MDAA 2R9RB 3IGAC 1BPXA 3ISDA 3WFSC 2X0LA 2R9IA 4RUFA 4NXMB 9ICOA 1QVFU 3LNMB 2VQFO 4U3JA 1S0VA 1H2SB 3OUFA 3A0HZ 4QZ8A 2UXCO 1Q6IA 2XNDG 4PA9A 2AW9A 4IHJA 5K1PA 3OTOB 3AUOA 1KP3A 2O1PA 4DO9A 2IU3A 2CK3G 4FIPC 5J29A 4A5UB 1ZQJA 1HNXB 5LMUB 5J0OA 3TXSA 3OUYB 4IL6Z 1BL8A 1P7GA 3CMEV 4TURA 1RPRA 3EVKA 3ABLB 4WCWA 2WLLA 2MK3A 5LYJB 2LO1A 2BBHA 3ZEDA 2P7TC 4DR1B 1NO5A 3CXCU 2QE7G 4DUYO 2QWRB 3F5TA 4LNUB 2BPCA 4K0KO 3H3AA 1HR0O 1SKVA 4JYAO 5FPOA 1NH2D 1KU9A 3B09A 1TV9A 3JPNA 4RQEA 3SPGA 1ZQPA 4MT8A 5C8YB 5DDYA 1M56B 3SYQA 1PP9H 1R6NA 3SGIA 4WOYA 1NBMG 4TWKA 2Q7GA 3SR2C 3D36A 3WFRE 4DO2A 1YJNV 2Z3YA 4QZEA 5BY1A 2IM9A 3CP1A 2GTAA 4NVPA 4DV4B 3QNEA 3T1HO 4ZIBA 4HAMA 4R63A 3W7UA 4EP7A 1KBHA 3L9DA 3A0BZ 5LGNA 2EIJC 2ZE7A 2ZH5A 5DBCA 4MF8A 8ICHA 3K5LA 1DGSA 1MIVA 1NTMH 2JS5A 4B3SO 2GAFD 3JZ0A 5HRLA 4CS2A 2HHHO 2YS8A 2FL4A 1JOYA 1JPXA 1H8HG 2JS3A 1I0HA 1I5XA 1S3JA 2R72A 3L71H 3PMNA 2YXYA 1YXBA 2UUBB 1H2GA 4IIJA 1FYJA 3JYYA 4M9GA 4PELA 7ICMA 1RP3B 9ICCA 3CC7V 1QU7A 4ATBB 4LEWA 2P5OA 1AP5A 2OCCC 1IURA 3QG5A 3JPPA 4JI4B 2FCLA 1BPZA 4OAIZ 2YXHA 1PNLA 2Z0AA 3VOUA 4QZFA 2IUBA 1KQSU 1F4MA 3T4ZA 3E8HA 1H2NA 4QZGA 2M7WA 5J2BA 4JWMA 3RH6A 2YIAA 4I0XB 5BPCA 2W9MA 2BCSA 3SPCA 3JAKA 4F5QA 4I50B 4YJ2B 1ZQBA 4MVRA 4O68A 4I9QA 3CRMA 1IBKO 4UD5A 2OCHA 1BHBA 1IBMO 5CB4B 4KLDA 2M6YA 5J0RA 4DK0A 3UXOA 4DR5B 5J0QA 2CH7B 1XSLA 2JGDA 2VWJA 2IH3C 5KUMA 5ITZB 5HRFA 3N2KA 4YIPA 1F23A 3C2KA 5CA7A 3QF7A 1H2MA 3JPRA 3M99B 3OAAG 1EFRG 5BOMA 3ICXA 1PM9A 2BTQB 2JJ1G 3C90A 3K5OA 3K3WA 1DK1A 2QSAA 1W0KG 1NKDA 4AQYB 4QJFB 4GX5A 4FLXA 4J7JA 1AI6A 1ZL8B 4JI3B 4DV3O 2JGDB 1BS3A 3K5MA 2CH7A 1VQ7V 1OCZB 1QQCA 4DV0B 4PH5A 2ZIOA 4I7ZB 1OHHG 4EEQA 5J2HA 4EV6A 3HKBB 3ETGA 5EYPA 1ZX3A 4DUZO 4FLWA 4K96A 1YITV 3JALA 2K9PA 1K33A 1YTFD 1IX9A 2KB1A 1JQRA 1QR9A 5CBGA 2YI8A 2HEPA 3EXAA 4JZ2A 4PA4A 3RH4A 5JWPA 1S5JA 1AROP 3E22A 2DN9A 1OU5A 4XA5A 4UCUA 4X4QA 3GB7C 2LW1A 3AG4B 2XAHA 2ILMA 3QO5A 4JI5O 1R8BA 2HHPA 1QLNA 3OM3B 3UO3A 1HNXO 3H1IH 2VQFB 3KZIZ 5J2EA 4DOBA 3HWTA 1R6KA 4UXNA 4EBKA 5KHGA 2UXCB 4PGQA 1S5HC 1YDXA 4K9AA 1MA1A 1P7BA 4DV6B 3DSQA 4I4TA 5BXZA 2ZH4A 4X1IB 3X2QB 3S3WA 3ZMUA 2Q67A 2ZQMA 4N21A 4TUYA 9ICKA 3SYOA 5GONA 5J2AA 5BR8B 3L70H 3ASOC 1HNWO 4M5DA 1MZEA 2X6CA 1HR0B 2X7RB 4NLNA 4FHXA 4KXRA 4I50A 4YJ2A 5DB7A 3J80N 2B1GA 1LUVA 4J7KA 3RJJA 3K04A 4UB3A 2UXNA 1V9PA 5HFMA 4OX9B 1N33O 4DUYB 4J11A 4AT9A 4LF6B 4BWAA 8ICJA 1R6TA 1YLQA 1Y6XA 4ZKIA 5JJJB 3HPLC 4Z1MG 3OWGA 1QNMA 3LUTB 3H01A 3T1HB 1TA8A 3P32A 4QZDA 4UAZA 1K34A 2ZH3A 1ZQGA 1D2DA 1OV9A 2JEUA 4MVOA 3CCEV 5JH7A 3RJIA 1OCCC 3HR0A 2HR3A 1FXKC 1ORQC 3G4SV 3ISCA 4JGSA 4I55B 1NQTA 3BY6A 4NXXA 5EOZA 4O2AB 1I08A 1Q43A 4I2GA 4ABMA 4TV8A 4HX0A 3SDLA 4Z6DA 1ZQEA 4DR6O 8ICKA 2BSKB 1FXHA 2BCCH 4WQKA 2DRBA 3ZS8C 4KLLA 2WLNA 5KX5B 4CH3A 1HUOA 2E75B 2DR9A 3LNNA 4O4LA 1ZL8A 9ICEA 2ZD9A 3CCRV 5KHHA 3DXRB 1CEZA 5J0SA 2KSDA 2ZXWC 2Q7EA 2FTKA 1N36B 2O5AA 2FMQA 4NKUA 3PMLA 4IIJB 4X20B 4F5NA 3IC7A 1FAFA 4H44B 1XI1A 1RZTA 1WP7A 2Q66A 4YN4A 1IBKB 2E5LB 1G6UA 4H13B 4NTWA 3RWRD 3BVOA 4NB5A 4DXWA 4UBBA 2DVIA 4UD4A 5JQGB 4DR5O 4TSFG 4LP8A 5CHEA 4X1YA 4JI8B 5GTHZ 1WOTA 2M2TA 1E1RG 3DXRA 3FKSG 4I29A 3AG7A 1ZUQA 1JFFB 3W7WA 3C66A 2EIJB 1MQ2A 1M57C 3AK1A 3UPQA 7ICIA 5A9GA 4C7UA 8ICTA 3ABKB 3L74H 1YI2V 2PXIA 3CCQV 4NXWA 3H1LH 1YF2A 1U97A 3DGEA 1IBMB 8ICRA 3PN1A 4AQYO 1H38A 2EIMB 4B08A 4KLSA 1ZSPA 4AT7A 3ETEA 4NXNO 4MVSA 1I5YA 4U7NA 1K97A 4FLZA 1M57B 2N74A 5K1XA 2UXBO 2FMPA 1XEQA 1GMGA 1I94B 4ZOLB 2ZIMA 4WFGA 3B4SA 2XAFA 2GDSA 4K8VA 4EEBA 4I2AA 7ICPA 1M93A 3SYPA 4QZ9A 1JCHA 2EJRA 1EZVH 2RMKB 5AG2A 2A9HA 3ZBHA 5KHJA 1G1XB 3MCRA 3OVBA 4UFZA 5HRIA 3E86A 5FL7G 3GWKC 4IQTA 3RN4A 1Q90D 4O2BB 2GUZA 3SYCA 1W2BU 4LT6A 2CDYA 2EZPA 5EBLC 3CC2V 2WPDG 2BTQA 1YZBA 4FHWA 4RWPA 4PGXA 2PFPA 4LF7O 4GX1A 3J7AU 1KDHA 4DR3B 3JD1A 1V55B 9ICSA 5LBQA 2EWRA 2B9ZA 5ITZA 2QKSA 4OPHA 2VS0A 1PKXA 4R6ZA 4WFBV 5E1AC 1K92A 2EINB 1US6A 5B66Z 2CE4A 4Z6FA 2BE3A 4JAAA 4B3RO 5IYCO 4OPAA 1SS3A 4FMTA 1EZJA 3BHPA 9ICPA 5BOLA 5D63A 3WG7B 5J0TA 4GX0A 3RBZA 1Q6HA 4KLJA 3CJHB 5J2DA 1Y66A 4FLTA 2EJ7A 3RGBA 1QR8A 1EM1A 1HNZB 4K35A 2Q4PA 3T1CA 2Q0AA 2GA9D 2WLKA 5BMVA 7ICJA 4XRHA 4EB6A 7ICHA 4RQ3A 4WC3A 3G6BA 2XOKG 3C2LA 8ICQA 1N33B 4JI2O 1VF7A 1Q3EA 8ICZA 4PHZA 7ICOA 2ZKOA 4LWSA 4X64B 4JI0O 4WFHA 1JMKC 4E80A 2WLIB 2RCVA 4JYBA 1R8AA 1X59A 5HHIA 4DR7B 3HB3B 4D6TH 2F95B 2YIBA 1ZQLA 3AU6A 4DV2O 4QE7A 5L3EA 4EBJA 2NRKA 4LF4O 4WBZA 2DYRB 3OGIB 1VQ9V 1LNQA 3LSQA 4X4RA 2ID1A 3B40A 1R3LC 2KG7A 2ZH1A 4I2FA 2V1DA 4LF5O 1XHXA 4DR6B 2CAZC 4LF9O 5J0XA 3C5GA 3UM7A 4PDLA 3RYCA 4DYLA 2IHMA 1XSNA 5HC9A 1KUQA 2DR8A 1SERA 1P4RA 4DR2B 4O2BA 5DN6G 3NR7A 3OEEG 3WFQE 5DB6A 3RVYA 3K57A 3SPHA 4GLXA 3LSUA 2M2UA 4F6EA 4WFFA 1NTZH 3ASNC 2DW4A 4DR1O 3GDXA 2ZE5A 2DWEC 3FD9A 2CGNA 2DR7A 1CPYA 4K0KB 4I4TB 1KD1W 1AI4A 5J2KA 3JAWA 3L75H 4KLOA 1KKCA 2FB5A 2Q6AA 4CS3A 2IH1C 3OR7C 2QKCA 1JVMA 4MF2A 1OCZC 1QBZA 2RFFA 3N2GA 4RPZA 1AI7A 1VF6A 4R7CA 4LH6A 1WNSA 4OXSA 4FM1A 1NZ6A 4FO1A 2I9GA 1F5AA 2XHBA 4B3TB 2F1MA 2HN2A 2AXTZ 1WA8B 2ZNIA 4UCVA 4IQWA 3VQYA 1R3IC 5LOVA 3CS5A 3UCSC 1AB3A 4NLKA 4WBNB 3DC6A 2YEVB 5IINA 3ZHVA 4X65B 4M0AA 1PX5A 3OUSA 1E1QG 1CP9A 3FYIB 4MVZA 4TV8B 4PHPA 5J2JA 1CXZB 3HKDA 4I2CA 3SPIA 5HREA 2JK5C 5E79Z 3E89A 2NLJC 1BSMA 3SYAA 3ZHRA 1NJIW 2WSSG 4RQ0A 3L73H 8ICXA 3OTFA 3OT7A 4JV5B 4FM2A 2AGAA 2L35A 4GXJA 1M1KW 1MSWD 2RJZA 5HRHA 4R66A 3ISBA 4LF7B 1FFXB 3CD6V 2DMXA 4PJ0Z 2AHZA 1RPLA 3B77A 4CH5A 3AQNA 5J0WA 4FK5C 3BCCH 1VQNV 2EIKB 3Q4HA 3HJ1A 4RWQA 3AG3B 3RJGA 8ICSA 1VQ6V 2ZH2A 1IDSA 1TUBB 3ZMTA 4RQ5A 1UJWB 4BW5A 4K3AA 1XMQO 5KA5A 4UB6Z 4EFEA 4KLTA 4MTOA 2B1IA 7ICKA 3K9SA 1XL6A 8ICMA 1UEVA 3GWOA 1AR4A 5EK0A 4PI2A 2KG7B 5J2UA 3AK2A 1ZQAA 4KUMA 3OW2U 1HNZO 1B3QA 4FLUA 4K9BA 2WA4A 1R1BA 1VJ7A 4LZGA 4LVSA 3E22B 1J95A 1COWG 4O2AA 2B51A 9ICAA 1ZQDA 4RWNA 2XAQA 2XUMA 4LFBB 4LFAO 3L72H 1ZQKA 4M47A 4X4VA 2PFQA 4K4GA 4X64O 5LA6A 4P9OA 5KUKA 4R8CA 1M56C 3G71V 1YJ9V 4JI3O 4ATBA 5IILA 2XAJA 1V55C 2OT5A 3HX0A 2CTQA 4AILC 2HVJC 5FNVB 1MIYA 4AHCA 5F2VO 2YIBD 4O4IA 4P9PA 3E2EA 4LEVA 4WH5A 4NYKA 4RQ7A 4X1IA 1N4CA 9ICRA 2ODMA 4NXTA 1TUBA 5LGUA 1KECA 3E8GA 4UB2A 4I27A 4Q6GA 2Y48A 1SA0A 1ZLZA 4NTXA 4I2IA 9ICMA 5IIIA 1BPBA 3D3QA 2LGQA 4DR7O 3WB0A 3JD3A 4RQFA 2PI5A 3ABLC 5CWRA 3MDCA 4DV2B 3VBBA 4KLUA 2ZXWB 3FB8C 3WU2Z 4LF4B 1NI8A 2IJHA 3HW8A 2BCRA 5KHIA 4LEZA 4ZHQA 4QZCA 3SJQC 3WG7C 4JI5B 5L3DA 4Z6CA 2HJFC 1J5EB 2W6IG 2P6JA 2R70A 1VMGA 4AT8B 4E7XA 2F4VB 4IG8A 1TGOA 4UVAA 3JPSA 4XUSA 2LW7A 4JTAB 4GT1A 1AILA 1SETA 2B56A 4WC1A 3MGHA 1AJPA 1IVSA 5KA6A 2P22C 5IJ9B 2A0LA 1AJQA 4RPYA 2HVKC 2QGNA 4CBCA 3JD4A 5BR8O 2BCVA 2PTMA 2A06H 5LOVB 4NXVA 4DK1A 2BPFA 1GO3F 3FAVB 5H6RA 2IJJA 4I9WA 1L0NH 2DYSB 4E2LA 1NR7A 3ETDA 2ZHAA 2E76B 4LF6O 4RWUA 1XNRO 3I55V 2UXDB 4NM2A 3JPOA 3ABMC 3MAQA 5D49A 1XNQO 4FHYA 2ZM6B 9ICNA 3T4DA 2NNUA 1SC5B 1GTOA 3CPWU 4AI8A 2F43G 1I7FA 4J9ZB 3OVSA 5BMVB 1GN4A 2QR4A 2LFSA 2EINC 1VP7A 5IWAB 3X2QC 3ABKC 4FJCC 1XOUA 4DV7B 1JA8A 1VF5B 3STZC 4M9NA 2D2CB 4UV9A 2W6JG 1ZQTA 3V7LA 2P4KA 1Q81W 3ZHTA 3F5WC 7ICVA 1URFA 2B4VA 8ICIA 2AZ2A 1JX9A 2H8PC 2W0FC 2MW2B 4UV8A 4MTFA 3ZRWB 2EBOA 4WBNA 3K9AA 5KAFZ 3FYEB 1EN4A 4DV1B 1MSDA 7ICGA 1MNGA 4L87A 4X1KA 3OMNB 4TQFA 5JH7B 4CS4A 3BRCA 4F5PA 3V72A 1GAXA 3K75D 3A0RA 5HHHA 1BPEA 4NXZA 4UCRA 5J2TA 4KLFA 5EIBD 3UPSA 2ZNJA 3N2GB 1U96A 1B6QA 4LFCO 3G67A 1NU1H 3A8TA 4RT3A 1XMQB 4UVBA 3EF2A 2ARHA 4BIZA 1N32B 4JI8O 4UB4A 2HJDA 3K5NA 4F4LA 4X4TA 1NTKH 2NN4A 3B0YA 9ICTA 4JYYA 3M8AA 3ZRVA 3AU2A 3CX5F 1UETA 1YCIA 4LWSB 3F7VC 2QTSA 9ICWA 1JAJA 1EBOA 1AJNA 1RFYA 1XHZA 5J0YA 1L8DA 4NTYA 4TUPA 3B8NA 5EBWC 1ROPA 4P4PA 1PV0A 1ZQQA 8ICLA 3FB6C 4TV9B 3H39A 4I2HA 1MIWA 4HNAB 3CCSV 3ER9B 3JATA 3UT5B 4DW0A 1NOMA 4N7RA 3JASB 1UFIA 4XBFA 5D4BA 4QNHB 4Z2WA 4G28B 3TCUA 9ICLA 3BFRA 9ICIA 3RYIA 3M7MX 3RYIB 2WLMA 1UPGA 1XBLA 1H2KA 3W7XA 4YXWG 2V4DA 3SJCC 4ZBMA 5EZYA 4B3MB 4B7KA 2IW5A 3TFSA 1AVMA 3LDDA 1ZQXA 2N05A 4JI6B 1FA0A 3H1KH 1RSOB 1TVKB 5KHKA 4OAFA 2P66A 1P49A 3EHBB 4MVQA 5IYZA 1NS1A 3T1YO 5CA0A 1JJ2U 2AHYA 4DV5O 1F4NA 3HKEA 4KLGA 4FM0A 4S3NA 4K4IA 3ASNB 3CK6A 1XMOO 2YSUB 4X5VA 3LQCB 5J2CA 8ICNA 4I2DA 1ZQMA 2Y4UA 5FNVA 1SQFA 2QDOA 3P30A 3SPJA 3N27A 4JI1B 1S72V 2AZ0A 3JARA 3RFRA 4JAUA 2Z5UA 2ZDIA 4R50A 1ZQWA 1VEWA 1LR1A 4AT9B 2EIKC 4ZOLA 1VQMV 4I2BA 4NKTA 2QEXV 5J2TB 2WLHA 5HFLA 3K58A 3UQ2A 3F7YC 1Q8IA 3TJTA 2JGUA 2QJ1A 3NYBA 2Y69C 5EIBC 1SQGA 4KFMA 5DBAA 4YJ3B 2Q0OC 3HKCA 2WWWA 4MTGA 5EBMC 4KLHA 3RYHA 3CE2A 2UXDO 1MZFA 1Q79A 4JYAB 4I28A 3IJ4A 4MFAA 2A7WA 1BMFG 1XSPA 3VQWA 2BPGA 4I2EA 4IQVA 2PZSA 4X88A 4DW1A 2Q69A 3BA8A 1KYOF 4YD2A 1Y74B 1DF4A 5KLVH 2GBOA 4O5KA 1AR5A 4YCXA 3CYOA 2JJ2G 1UEUA 1FFXA 3CHXA 1Q82W 1ZWIC 5IYBO 3TK1A 3C3TA 1RM1C 4K8ZA 1ZQSA 5GONB 1OZ0A 1W0JG 4YMNA 5JVDA 4LF5B 2CGOA 3CCVV 4B3SB 5IY5B 3G6EV 4KLQA 4DV1O 4J42A 4DRXB 1Y74A 4HNAA 4YIOA 4TV9A 5CA1A 3MD0A 4IQUA 5FPRA 2XT9A 1R3JC 2OWOA 3HKBA 2VQEO 5LP6A 2DRAA 2HHHB 4R65A 1SRYA 2BTOA 1BHAA 2P67A 4OGQB 4LFCB 5D62A 4X89A 3ZHUA 1LUWA 3WFVA 4FH3A 2QTOA 4WC2A 9ICXA 3C2MA 4UAWA 3KCYA 3GVMA 4FH5A 1N32O 1JN3A 5DB8A 5IJ9A 5C8YA 1Q5OA 4O69A 4JF3A 4EKWA 3ZIAG 1VQ8V 4D7SA 8ICEA 3ZN1A 3UO2A 2LP7A 2HN1A 5D5QA 5B1BC 1YSCA 4IT5A 5EYPB 1GN6A 4O4HA 3APOA 4X20A 1BQZA 5D46A 1ZQYA 4JLZA 2ZR2A 5LMNO 1KC8W 1SESA 4B3TO 4PGYA 5CHGA 2ETNA 4D7TA 4M9LA 1GKFA 2M2VA 2VANA 1NVPD 4JASA 4K97A 4O4JA 1HWYA 2RNBA 4O4LB 1OJHA 5B1AC 4FLVA 1B06A 3B8MA 4X62O 1RPOA 1QLEB 4X65O 4LBEC 4JTCB 4UCTA 5B1OA 4YMMA 4K99A 5CBHA 2GWSA 2Y0IA 1WPBA 3QO8A 5B1NA 2JIZG 4E4EA 3CWBH 3ZN0A 4DV0O 1S77D 2R9AA 3ABMB 4JI6O 3JD2A 3B0XA 1HUZA 5J9PC 1WA8A 4DUZB 2FKXA 1SQBH 1YEWA 1XL4A 2DR5A 3FX7A 2IU0A 3UXPA 4UCSA 3AG2B 4DV5B 4I0UA 2ZH9A 4B3MO 5BZBA 1K4CC 2WA3A 3CCMV 3CRQA 2F23A 4J10A 1ZQVA 7ICQA 3IAYA 1YHQV 2DE0X 3NWIA 4RWOA 2YIDA 1HW7A 3SJAC 1VARA 9ICFA 1FS0G 2OYQA 4LC1A 1PL0A 4L8JA 4RUEA 4O6AA 3RT3C 3JCZA 1FXKA 3OE7G 2GSMB 1ZQIA 5KMGA 2EULA 2Q8VA 5B5EZ 3RJKA 2FMSA 4YHHB 5TZVA 2K1EA 5JVDB 8ICAA 3HKEB 4FZ1A 4DV6O 3V7JA 1PPJH 5IYZB 3OGUA 2QM7A 1BZKA 2A79B 4LFAB 4ZI7B 3QTCA 5B1AB 5JCOA 4BAYA 5IY5C 4WBYA 4X4OA 4QZIA 1O9HA 4LEYA 1QHTA 3OEHG 3ER8C 2OTLV 3T2MA 1F51A 2X6BA 1YIJV 1VQKV 3VQXA 1N34O 5KAIZ 3PHZA 5D61A 3K7DA 3I56V 5CFTA 3FFQA 4X1KB 9ICJA 5KX5A 3KCXA 4PHAA 4X8AA 4PI0A 1R89A 3CMAV 1SQVH 1PNMA 5B3QA 4RQ2A 4YJ3A 2HG5C 4WC5A 4WC6A 3JAKB 3UQ0A 2C2AA 4IGGA 2UUCO 2ZINA 3A2FA 1VQOV 4OX9O 2WLIA 4KLEA 3AQKA 3ASOB 3H38A 4WC7A 2RDCA 4NR1A 3ZMVA 2OTJV 2QWQB 8ICPA 1Y67A 4GX2A 3FB7C 1Z2GA 9ICHA 4X4NA 4PA7A 1ZTEA 1MG1A 2X6AA 4F5RA 2HKOA 5L3GA 1IXBA 4F6RB 4JYCA 2DQ0A 3EFFK 4W4LA 4Z6EA 3MHSC 4DOAA 2B5UA 4UUJC 3JALB 4GXKA 1ZJNA 4AT7B 3AG4C 7ICNA 1GM8A 1MQ3A 2VWKA 1N36O 4YD1A 1B04A 3R65A 4ZHQB 4P2ZA 2N04A 3D8CA 1Z5VA 2QA4V 4KLIA 8ICCA 4PHEA 1O9GA 2ITDC 7ICTA 2JRIA 1VQ5V 3RJFA 1THZA 3H9VA 2YC0A 1XNRB 2ZH7A 1M4UA 1WJZA 5LMNB 4KLMA 4X66B 4FPPA 4M2YA 4GKKO 4KHPO 4GKJO 4IYHA 3JD0A 2Q7HA 3JATB 3UT5A 8ICGA 8ICFA 1K7DA 4JI7B 1DLBA 4X62B 4X4PA 2WAMA 5CMUA 1QVGU 1YVWA 3I5DA 4J41A 1BGYH 3DC5A 2IHOA 4HBNA 9ICGA 5L3FA 1OCRC 1GPJA 2OIGA 4HYOA 1KKDA 2PYLA 1XREA 2PUSA 3UQ8A 4FFKA 2WLLB 2O57A 4LH7A 3D36C 5FLXN 3ZHSA 3JCUZ 2Q73A 5CBFA 4NLZA 4ZI7A 4XQ8A 2RQ6A 4YY3B 1Q86W 3QVNA 3AK3A 5B1BB 4MS2A 4NXNB 4RPXA 5LGTA 2ZE6A 1JMSA 2V7QG 4QPKA 9ICBA 4PDRA 2UXBB 1I94O 7ICRA 3O65A 3OD4A 5CFUA 2LQTA 4XQ7A 1TVAA 5CA1B 3HJ4A 4E8FA 3AG1B 3APQA 5DECA 1IBLB 3UXNA 3K03A 5DEDA 2IJKA 1K5QA 1H2LA 1ZQFA 3P3PA 4QZAA 5DDMA 2Y69B 4BIOA 1L0LH 4UBCA 4P4MA 3C5FA 4M9JA 3KKYA 4JZGA 2GV9A 7ICLA 1DF5A 2OCCB 4XJEA 2YI9A 3RVZA 2FMLA 5GW7A 3TETA 4JTDB 8ICWA 4JAVA 7ICSA 4UB8Z 4FVMA 5KMGB 4NXMO 1DTOA 4O67A 3HKDB 1RM1B 4QZHA 4I0XA 5DBBA 4JPRA 1XQ8A 2PFNA 2BSKA 3E8BA 1AI5A 4TUYB 3ZRWA 1GH6A 4B3RB 4FFBA 3OTOO 4FFBB 1K8AW 1V54B 1KEJA 4O4IB 1TVKA 4I55A 1N8RW 2P06A 3VQVA 4PHDA 2ZT9B 4WQLA 4JI0B 1WB8A 4WC4A 4JWNA 2EX3A 2ZDIC 4PA3A 4UVCA 5IIJA 1ZQHA 4M04A 3H1HH 2OIEA 1FJGB 1YJWV 3AQLA 1N34B 2RN9A 2F66C 1FXVA 1T5EA 3S3XA 4J7ZA 5DKWA 1VQLV 4CH6A 4WFEA 3RYFA 4LF8B 4UCOA 1FD9A 3JARB 3WFOA 4MVMA 4XDJA 2NR5A 1TUEB 2ZE8A 4NM1A 3K06A 2IJIA 1N0NA 2DQ3A 2Y4TA 1GN3A 1IZ3A 1VQPV 4AT8A 4CZZA 2PFOA 3OVAA 3CCLV 1ZJMA 4PPXA 3BABA 3ABTA 4TUSA 4LCUC 2YICA 2PYJA 1P84F 5LHHA 4P30A 5H6QA 3LDEA 4EB6B 5IJ0A 4UAYA 4GZRB 2H94A 3H1JH 1FKAO 4WCEV 4LF9B 3ZRSA 2CTPA 4U7OA 3IC9A 4LNUA 3CCJV 4KL1A 2PBEA 3CXHF 5CR0A 4I5SA 5IIMA 2ADPA 3BA9A 2UUBO 4OAGA 4QE9A 1NH2B 4DR2O 4JLXA 4GXIA 2DWDC 2JVDA 3IFXA 3NVOA 5H5NA 4PD4F 5L3BA 1GN2A 4OAHA 2GTSA 3UKMA 2E3CA 3OMAB 3ZCCA 4RAIA 2CTRA 3AG2C 4F5OA 3LK9A 1BPDA 2XASA 4YMOA 1KMIZ 1GM7A 4NXUA 3ZMSA 1NT2B 4RT2A 2PI4A 1G4YB 8ICYA 2Q9LA 2BOBC 3ZHQA 3RW0A 4GKJB 4DR4B 4KB6A 3JPQA 3MDSA 9ICQA 5CB1A 3MGIA 3JAMN 3U11A 3JSNA 4KP4A 1SQXH 4X0AA 1JJOA 2EILC 1WAZA 3CRRA 3WFPA 1ZQCA 2EIMC 9ICUA 4XDLA 3ZX6A 4K98A 1TFWA 5GTIZ 5DM6V 2ISPA 3MHHC 1QLEC 5TISZ 1PD3A 4CH4A 5LXTA 1SZTA 4O5EA 5IE9A 2WLJA 3THOA 4BR6A 1MMMA 1HP8A 3NXSA 2ZR3A 1GK9A 5IIKA 4TOIA 5JCOC 2VQEB 4CC6A 2IBZH 3RJHA 3J81N 2CTWA 4YY3O 1WPXA 1TFYA 1IBLO 3BEHA 1RSOA 4B7EA 3RYHB 4MSWC 4WC0A 5HR9A 2Y0PA 3ZMZA 4DV3B 1ZQNA 2QKAA 2HLDG 4QZBA 3AG3C 1N0JA 4QGPA 4RQ6A 2DJVA 3CCUV 4JV5O 5CFSA 3ERCC 4X1YB 4BIUA 1Y76B 3C18A 4G27B 5J2GA 1WN7A 3CRAA 1L1FA 8ICBA 3DTUB 1JR9A 4F6RA 5A2QN 3N2KB 3OMIB 4MVUA 3JPTA 1VIBA 3G80A 2UUAO 3W7SA 4K8XA 5CJ7A 4TT3G 2L6LA 5EC1C 4WF9V 5J2FA 1M90W 3MBYA 4FO6A 3U10A 3JSLA 1AP6A 4J80A 2Q5ZA 4RQ1A 1A32A 4LFBO 5DB9A 4MFCA 3JYCA 3PJSK 2P90A 1FXKB 1XUQA 3OR6C 1SQQH 4EEDA 4FZ0A 1OCCB 3E35A 4G2KA 1HDJA 1SA0B 3K0GA 3TGUH 5B3SC 2GUZB 3P3NA 4K4HA 4GUNA 4IHJB 7ICFA 2HFEC 3CSXA 1WLEA 3K79A 4MTXA 5LHGA 4FHVA 5J0UA 2QWOB 4H0LB 2DYSC 1EN6A 3STLC 1NR1A 1ZAUA 1HNWB 4DOCA 4H33A 4LR3A 1OCOC 1FJGO 3Q4HB 4FHPA 2M2WA 1ZQUA
chains in the Genus database with same CATH topology
3OGUA 3HWTA 4UB2A 4I27A 4I2IA 4EBKA 5HRKA 9ICMA 4PGQA 5IIIA 1BPBA 7ICEA 2ZH4A 4WBYA 4X4OA 4QZIA 4X4SA 5CWRA 3MDCA 9ICKA 4KLUA 5J2AA 3HW8A 2BCRA 5HRGA 4QZCA 4M5DA 4NLNA 4FHXA 3TFRA 4Z6CA 1ZQRA 5DB7A 3OV7A 9ICJA 3RJJA 4PHAA 4AT8B 4E7XA 4I2JA 4UB3A 3OUYA 4IG8A 1R89A 3JPSA 4RQ2A 3RJEA 4XUSA 4WC5A 4WC6A 2ZH8A 2BCQA 4AT9A 3UQ0A 4WC1A 8ICJA 3MGHA 8ICUA 1YLQA 8ICOA 4KLEA 1ZQZA 3AQKA 4QZDA 4UAZA 3H38A 4WC7A 4RPYA 3V7KA 2ZH3A 1ZQGA 7ICUA 2BCVA 8ICPA 5HRBA 3RJIA 9ICHA 4X4NA 1BPYA 2BPFA 2ZHBA 3ISCA 4F5RA 2ZHAA 5EOZA 4I2GA 4LZDA 4Z6EA 4NM2A 4Z6DA 1ZQEA 3JPOA 8ICKA 4P4OA 4DOAA 5D49A 2DRBA 4FHYA 4GXKA 1ZJNA 4KLLA 4AT7B 9ICNA 1HUOA 7ICNA 3AQMA 1MQ3A 2DR9A 4YD1A 9ICEA 1R8CA 3PNCA 4KLIA 5J0SA 8ICCA 3OVSA 4O5CA 4PHEA 4RQ8A 2O5AA 7ICTA 2FMQA 4NKUA 3PMLA 3RJFA 4P2HA 4F5NA 4M9NA 2ZH7A 4KLMA 1ZQTA 3V7LA 1RZTA 2Q66A 4M2YA 4YN4A 7ICVA 8ICIA 2DVIA 4X0BA 4UBBA 8ICGA 4UD4A 8ICFA 2BCUA 4MFFA 4X4PA 4RQ4A 1WOTA 2M2TA 1ZQOA 7ICGA 9ICGA 4I29A 3C66A 1MQ2A 3UPQA 7ICIA 4R64A 8ICTA 4F5PA 3V72A 2PXIA 3K75D 5HHHA 8ICRA 1BPEA 4NXZA 4KLFA 3UPSA 4KLSA 5HRDA 4AT7A 5IIOA 4RT3A 4NLZA 5J2IA 2FMPA 4XQ8A 4UB4A 4X4TA 4RPXA 3B0YA 4I2AA 1JMSA 9ICTA 7ICPA 9ICBA 4QZ9A 3HIYA 3AU2A 5J0PA 4TUQA 1UETA 1V4AA 4M9HA 7ICRA 4O9MA 1Q78A 3OVBA 9ICWA 4XQ7A 1TVAA 1JAJA 3HJ4A 4E8FA 5HRIA 5J0YA 5DECA 3UXNA 4IQTA 5DEDA 4TUPA 1ZQFA 4P4PA 4LT6A 4QZAA 5DDMA 4UBCA 1ZQQA 8ICLA 4P4MA 3C5FA 3H39A 4I2HA 4M9JA 1MIWA 7ICLA 4FHWA 1NOMA 4RWPA 4PGXA 2PFPA 5D4BA 4UB5A 1KDHA 4NY8A 2ISOA 9ICLA 9ICSA 9ICIA 1KNYA 5CP2A 8ICWA 7ICSA 1VFGA 3TFSA 4Z6FA 2BE3A 1ZQXA 4QZHA 5DBBA 3RH5A 9ICPA 1FA0A 5BOLA 9ICVA 2PFNA 2ZH6A 3H37A 5J0TA 4X4UA 4UB1A 4KLJA 2P66A 5J2DA 8ICVA 1KEJA 4FHPA 4KLGA 4S3NA 7ICJA 4K4IA 4XRHA 7ICHA 4RQ3A 4WC3A 4PHDA 3C2LA 3MDAA 3LQCB 4X5VA 8ICQA 5J2CA 1BPXA 3ISDA 3WFSC 4WC4A 4JWNA 5IIJA 8ICNA 1ZQHA 4I2DA 4M04A 1ZQMA 8ICZA 9ICOA 7ICOA 3AQLA 4QZ8A 4E80A 1ZQWA 1R8AA 5HHIA 5DKWA 3AUOA 2O1PA 4DO9A 1ZQLA 4AT9B 3AU6A 4I2BA 5J29A 4NKTA 1ZQJA 4EBJA 2NRKA 3UQ2A 3WFOA 5J0OA 3OUYB 3NYBA 4WBZA 4TURA 5DBAA 4NM1A 4WCWA 4X4RA 2ID1A 4AT8A 2PFOA 2ZH1A 4I2FA 4KLHA 1NO5A 1Q79A 3OVAA 1ZJMA 4PPXA 4I28A 4MFAA 4TUSA 2BPCA 1XSPA 3H3AA 5J0XA 2BPGA 4I2EA 4IQVA 3C5GA 4UAYA 2IHMA 1XSNA 5HC9A 2DR8A 4YD2A 3JPNA 1TV9A 1ZQPA 4O5KA 4YCXA 3WFQE 5DB6A 2PBEA 5CR0A 5DDYA 1UEUA 5IIMA 2M2UA 3WFRE 1ZQSA 4GXIA 4QZEA 4YMNA 3GDXA 2DR7A 4R63A 4KLQA 4EP7A 5J2KA 3L9DA 4KLOA 2ZH5A 5DBCA 4MF8A 8ICHA 4F5OA 1MIVA 3LK9A 3JZ0A 1BPDA 5HRLA 4MF2A 4YMOA 8ICYA 2RFFA 4RT2A 4IQUA 4RPZA 3PMNA 3JPQA 3JYYA 2DRAA 9ICQA 4M9GA 5CB1A 3MGIA 4R65A 7ICMA 9ICCA 2I9GA 1F5AA 4ATBB 4X0AA 3WFPA 1ZQCA 4FH3A 3JPPA 4IQWA 4WC2A 1BPZA 9ICXA 9ICUA 3C2MA 4UAWA 4NLKA 4FH5A 1JN3A 1TFWA 5DB8A 2ISPA 4QZFA 5IINA 4O5EA 4M0AA 8ICEA 1PX5A 4QZGA 5J2BA 4PHPA 4JWMA 3RH6A 5IIKA 5J2JA 5BPCA 4I2CA 2W9MA 5D46A 2BCSA 4F5QA 1ZQYA 3RJHA 5HREA 1ZQBA 1TFYA 4PGYA 5CHGA 4WC0A 4M9LA 5HR9A 4UD5A 2M2VA 2VANA 4RQ0A 8ICXA 1ZQNA 4KLDA 5J0RA 3UXOA 5J0QA 4QZBA 1XSLA 4GXJA 4RQ6A 5HRHA 4R66A 5HRFA 3ISBA 3C2KA 1RPLA 4YMMA 5CA7A 2GWSA 3AQNA 3C18A 3JPRA 5J2GA 5J0WA 5BOMA 4RWQA 3HJ1A 8ICBA 3RJGA 8ICSA 2ZH2A 3JPTA 4RQ5A 3B0XA 4KLTA 1HUZA 5CJ7A 7ICKA 8ICMA 1UEVA 5J2FA 1ZQAA 3MBYA 2DR5A 4PH5A 4FO6A 5J2HA 3UXPA 2ZH9A 4RQ1A 5DB9A 4MFCA 1VJ7A 4LZGA 7ICQA 4LVSA 1ZQVA 9ICAA 4RWOA 1ZQDA 4RWNA 1JQRA 9ICFA 1ZQKA 4M47A 4X4VA 2PFQA 4K4GA 3RH4A 4K4HA 7ICFA 1OU5A 4XA5A 4FHVA 4ATBA 5J0UA 4X4QA 5IILA 1ZQIA 3HX0A 3RJKA 2FMSA 5TZVA 4DOCA 1MIYA 1R8BA 2HHPA 5F2VO 8ICAA 4RQ7A 9ICRA 3V7JA 5J2EA 2M2WA 4DOBA 1ZQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGU A;  3HWT A;  4UB2 A;  4I27 A;  4I2I A;  4EBK A;  5HRK A;  9ICM A;  4PGQ A;  5III A;  1BPB A;  7ICE A;  2ZH4 A;  4WBY A;  4X4O A;  4QZI A;  4X4S A;  5CWR A;  3MDC A;  9ICK A;  4KLU A;  5J2A A;  3HW8 A;  2BCR A;  5HRG A;  4QZC A;  4M5D A;  4NLN A;  4FHX A;  3TFR A;  4Z6C A;  1ZQR A;  5DB7 A;  3OV7 A;  9ICJ A;  3RJJ A;  4PHA A;  4AT8 B;  4E7X A;  4I2J A;  4UB3 A;  3OUY A;  4IG8 A;  1R89 A;  3JPS A;  4RQ2 A;  3RJE A;  4XUS A;  4WC5 A;  4WC6 A;  2ZH8 A;  2BCQ A;  4AT9 A;  3UQ0 A;  4WC1 A;  8ICJ A;  3MGH A;  8ICU A;  1YLQ A;  8ICO A;  4KLE A;  1ZQZ A;  3AQK A;  4QZD A;  4UAZ A;  3H38 A;  4WC7 A;  4RPY A;  3V7K A;  2ZH3 A;  1ZQG A;  7ICU A;  2BCV A;  8ICP A;  5HRB A;  3RJI A;  9ICH A;  4X4N A;  1BPY A;  2BPF A;  2ZHB A;  3ISC A;  4F5R A;  2ZHA A;  5EOZ A;  4I2G A;  4LZD A;  4Z6E A;  4NM2 A;  4Z6D A;  1ZQE A;  3JPO A;  8ICK A;  4P4O A;  4DOA A;  5D49 A;  2DRB A;  4FHY A;  4GXK A;  1ZJN A;  4KLL A;  4AT7 B;  9ICN A;  1HUO A;  7ICN A;  3AQM A;  1MQ3 A;  2DR9 A;  4YD1 A;  9ICE A;  1R8C A;  3PNC A;  4KLI A;  5J0S A;  8ICC A;  3OVS A;  4O5C A;  4PHE A;  4RQ8 A;  2O5A A;  7ICT A;  2FMQ A;  4NKU A;  3PML A;  3RJF A;  4P2H A;  4F5N A;  4M9N A;  2ZH7 A;  4KLM A;  1ZQT A;  3V7L A;  1RZT A;  2Q66 A;  4M2Y A;  4YN4 A;  7ICV A;  8ICI A;  2DVI A;  4X0B A;  4UBB A;  8ICG A;  4UD4 A;  8ICF A;  2BCU A;  4MFF A;  4X4P A;  4RQ4 A;  1WOT A;  2M2T A;  1ZQO A;  7ICG A;  9ICG A;  4I29 A;  3C66 A;  1MQ2 A;  3UPQ A;  7ICI A;  4R64 A;  8ICT A;  4F5P A;  3V72 A;  2PXI A;  3K75 D;  5HHH A;  8ICR A;  1BPE A;  4NXZ A;  4KLF A;  3UPS A;  4KLS A;  5HRD A;  4AT7 A;  5IIO A;  4RT3 A;  4NLZ A;  5J2I A;  2FMP A;  4XQ8 A;  4UB4 A;  4X4T A;  4RPX A;  3B0Y A;  4I2A A;  1JMS A;  9ICT A;  7ICP A;  9ICB A;  4QZ9 A;  3HIY A;  3AU2 A;  5J0P A;  4TUQ A;  1UET A;  1V4A A;  4M9H A;  7ICR A;  4O9M A;  1Q78 A;  3OVB A;  9ICW A;  4XQ7 A;  1TVA A;  1JAJ A;  3HJ4 A;  4E8F A;  5HRI A;  5J0Y A;  5DEC A;  3UXN A;  4IQT A;  5DED A;  4TUP A;  1ZQF A;  4P4P A;  4LT6 A;  4QZA A;  5DDM A;  4UBC A;  1ZQQ A;  8ICL A;  4P4M A;  3C5F A;  3H39 A;  4I2H A;  4M9J A;  1MIW A;  7ICL A;  4FHW A;  1NOM A;  4RWP A;  4PGX A;  2PFP A;  5D4B A;  4UB5 A;  1KDH A;  4NY8 A;  2ISO A;  9ICL A;  9ICS A;  9ICI A;  1KNY A;  5CP2 A;  8ICW A;  7ICS A;  1VFG A;  3TFS A;  4Z6F A;  2BE3 A;  1ZQX A;  4QZH A;  5DBB A;  3RH5 A;  9ICP A;  1FA0 A;  5BOL A;  9ICV A;  2PFN A;  2ZH6 A;  3H37 A;  5J0T A;  4X4U A;  4UB1 A;  4KLJ A;  2P66 A;  5J2D A;  8ICV A;  1KEJ A;  4FHP A;  4KLG A;  4S3N A;  7ICJ A;  4K4I A;  4XRH A;  7ICH A;  4RQ3 A;  4WC3 A;  4PHD A;  3C2L A;  3MDA A;  3LQC B;  4X5V A;  8ICQ A;  5J2C A;  1BPX A;  3ISD A;  3WFS C;  4WC4 A;  4JWN A;  5IIJ A;  8ICN A;  1ZQH A;  4I2D A;  4M04 A;  1ZQM A;  8ICZ A;  9ICO A;  7ICO A;  3AQL A;  4QZ8 A;  4E80 A;  1ZQW A;  1R8A A;  5HHI A;  5DKW A;  3AUO A;  2O1P A;  4DO9 A;  1ZQL A;  4AT9 B;  3AU6 A;  4I2B A;  5J29 A;  4NKT A;  1ZQJ A;  4EBJ A;  2NRK A;  3UQ2 A;  3WFO A;  5J0O A;  3OUY B;  3NYB A;  4WBZ A;  4TUR A;  5DBA A;  4NM1 A;  4WCW A;  4X4R A;  2ID1 A;  4AT8 A;  2PFO A;  2ZH1 A;  4I2F A;  4KLH A;  1NO5 A;  1Q79 A;  3OVA A;  1ZJM A;  4PPX A;  4I28 A;  4MFA A;  4TUS A;  2BPC A;  1XSP A;  3H3A A;  5J0X A;  2BPG A;  4I2E A;  4IQV A;  3C5G A;  4UAY A;  2IHM A;  1XSN A;  5HC9 A;  2DR8 A;  4YD2 A;  3JPN A;  1TV9 A;  1ZQP A;  4O5K A;  4YCX A;  3WFQ E;  5DB6 A;  2PBE A;  5CR0 A;  5DDY A;  1UEU A;  5IIM A;  2M2U A;  3WFR E;  1ZQS A;  4GXI A;  4QZE A;  4YMN A;  3GDX A;  2DR7 A;  4R63 A;  4KLQ A;  4EP7 A;  5J2K A;  3L9D A;  4KLO A;  2ZH5 A;  5DBC A;  4MF8 A;  8ICH A;  4F5O A;  1MIV A;  3LK9 A;  3JZ0 A;  1BPD A;  5HRL A;  4MF2 A;  4YMO A;  8ICY A;  2RFF A;  4RT2 A;  4IQU A;  4RPZ A;  3PMN A;  3JPQ A;  3JYY A;  2DRA A;  9ICQ A;  4M9G A;  5CB1 A;  3MGI A;  4R65 A;  7ICM A;  9ICC A;  2I9G A;  1F5A A;  4ATB B;  4X0A A;  3WFP A;  1ZQC A;  4FH3 A;  3JPP A;  4IQW A;  4WC2 A;  1BPZ A;  9ICX A;  9ICU A;  3C2M A;  4UAW A;  4NLK A;  4FH5 A;  1JN3 A;  1TFW A;  5DB8 A;  2ISP A;  4QZF A;  5IIN A;  4O5E A;  4M0A A;  8ICE A;  1PX5 A;  4QZG A;  5J2B A;  4PHP A;  4JWM A;  3RH6 A;  5IIK A;  5J2J A;  5BPC A;  4I2C A;  2W9M A;  5D46 A;  2BCS A;  4F5Q A;  1ZQY A;  3RJH A;  5HRE A;  1ZQB A;  1TFY A;  4PGY A;  5CHG A;  4WC0 A;  4M9L A;  5HR9 A;  4UD5 A;  2M2V A;  2VAN A;  4RQ0 A;  8ICX A;  1ZQN A;  4KLD A;  5J0R A;  3UXO A;  5J0Q A;  4QZB A;  1XSL A;  4GXJ A;  4RQ6 A;  5HRH A;  4R66 A;  5HRF A;  3ISB A;  3C2K A;  1RPL A;  4YMM A;  5CA7 A;  2GWS A;  3AQN A;  3C18 A;  3JPR A;  5J2G A;  5J0W A;  5BOM A;  4RWQ A;  3HJ1 A;  8ICB A;  3RJG A;  8ICS A;  2ZH2 A;  3JPT A;  4RQ5 A;  3B0X A;  4KLT A;  1HUZ A;  5CJ7 A;  7ICK A;  8ICM A;  1UEV A;  5J2F A;  1ZQA A;  3MBY A;  2DR5 A;  4PH5 A;  4FO6 A;  5J2H A;  3UXP A;  2ZH9 A;  4RQ1 A;  5DB9 A;  4MFC A;  1VJ7 A;  4LZG A;  7ICQ A;  4LVS A;  1ZQV A;  9ICA A;  4RWO A;  1ZQD A;  4RWN A;  1JQR A;  9ICF A;  1ZQK A;  4M47 A;  4X4V A;  2PFQ A;  4K4G A;  3RH4 A;  4K4H A;  7ICF A;  1OU5 A;  4XA5 A;  4FHV A;  4ATB A;  5J0U A;  4X4Q A;  5IIL A;  1ZQI A;  3HX0 A;  3RJK A;  2FMS A;  5TZV A;  4DOC A;  1MIY A;  1R8B A;  2HHP A;  5F2V O;  8ICA A;  4RQ7 A;  9ICR A;  3V7J A;  5J2E A;  2M2W A;  4DOB A;  1ZQU A; 
#chains in the Genus database with same CATH topology
 4Z1V A;  3WB1 A;  1VQ4 V;  5HRK A;  4WFA V;  7ICE A;  2DOS A;  2W0X A;  4HZ3 A;  4U3F H;  2D3O W;  1S76 D;  4X4S A;  2UU9 O;  4LF8 O;  4CC5 A;  1V54 C;  5CB4 A;  1J5E O;  3JCF A;  2F4V O;  4J9Y B;  4YHH O;  1G8M A;  5HRG A;  1S5L Z;  1R3K C;  3TFR A;  1H8E G;  1ZQR A;  3OV7 A;  1WP8 A;  4TQD A;  1JFF A;  4PA6 A;  2JEX A;  5CN0 A;  4I2J A;  3OUY A;  1MAB G;  4IYI A;  3RJE A;  2H3O A;  1D5N A;  1PNK A;  2QWP B;  2ZH8 A;  4NKG B;  3SJB C;  2BCQ A;  4N23 A;  2PGG A;  2GHY A;  8ICU A;  8ICO A;  1ENV A;  2KQX A;  1Q6U A;  5H2F Z;  1ZQZ A;  1GRJ A;  3V7K A;  2VRZ A;  5LXT B;  1F7Y A;  4RO2 A;  7ICU A;  3O9O A;  4FLY A;  5HRB A;  3W7T A;  5LMU O;  1BPY A;  2ZHB A;  3KG2 A;  1M9N A;  3CC4 V;  3CEI A;  4DR4 O;  1JQ0 A;  1EN5 A;  1XNQ B;  4KM5 A;  2UUC B;  2HP8 A;  4LZD A;  4BW9 A;  1Y76 A;  4MKP A;  3FB5 C;  5H9C A;  4P4O A;  2E5L O;  5JJE B;  3LSS A;  1K5S A;  4MW8 A;  1K4D C;  5J2U B;  1BE3 H;  3LDC A;  3CJH A;  3AQM A;  5LL6 Y;  1FFT B;  4MW3 A;  1Q7Y W;  5LP6 C;  1Z5W A;  1D5A A;  3FAV A;  1R8C A;  4O4J B;  1BCC H;  4GYC B;  4DV7 O;  3PNC A;  2ZM6 O;  5IT9 N;  4O5C A;  5JJN B;  1IXM A;  1XIL A;  2XTA A;  4RQ8 A;  1WB7 A;  2YXL A;  5JTG A;  1SZX A;  5LP6 B;  4P2H A;  3E83 A;  2YDE A;  1OCR B;  3ABU A;  5L3C A;  3RYC B;  5IWA O;  1SQP H;  4DV4 O;  3B2E E;  3QO7 A;  1VF6 C;  4X0B A;  2BCU A;  4W4K A;  4MFF A;  4RQ4 A;  1E79 G;  3BPZ A;  3OFN G;  1ZQO A;  2E74 B;  5LYJ A;  4JI4 O;  2G38 A;  2UXX A;  2BOC C;  3AG1 C;  1PL4 A;  2JDI G;  3ZJZ A;  2A3Q A;  4R64 A;  3D3I A;  4H37 A;  1Y4M A;  1BT8 A;  3HKC B;  3C3S A;  3CB2 A;  3E8F A;  4X66 O;  5HRD A;  1M5I A;  1X4T A;  2KKW A;  1FPO A;  3AEI A;  4KHP B;  4GKK B;  2PY5 A;  4GCZ A;  5IIO A;  2UUA B;  5J2I A;  5C93 A;  2YEV A;  4JI7 O;  4QPJ A;  4Q20 A;  1TAE A;  5LHI A;  3RYF B;  4PDV A;  2EZO A;  3WB2 A;  1QCE A;  4U3J B;  1K73 W;  3ETQ A;  3BAA A;  3HIY A;  4DR3 O;  4TUQ A;  5J0P A;  4M9H A;  5B3S B;  1V4A A;  3NKU A;  5IDJ A;  4EGW A;  2Q68 A;  4O9M A;  4PV1 B;  2ITC C;  1Q78 A;  1KB9 F;  2QM4 A;  1NVP B;  5EC2 C;  3R66 A;  4DRX A;  2LJ2 A;  3CRC A;  2DYR C;  1GM9 A;  1XDC A;  4PDM A;  5IJ0 B;  3JAW B;  3OGC C;  5CA0 B;  2EIL B;  3K08 A;  4UB5 A;  1KP2 A;  3ML0 A;  4X9Q A;  1K9M W;  2QM8 A;  4QIW F;  4NY8 A;  1OCO B;  2ISO A;  5CA3 A;  1W59 A;  2YUA A;  1AR1 B;  3K59 A;  2LGW A;  1KNY A;  5CP2 A;  2XAG A;  4ICG A;  4JI2 B;  2CUG A;  2P4V A;  5EZY B;  1VFG A;  1SF9 A;  3T1Y B;  4EFB A;  5LA6 B;  3RH5 A;  9ICV A;  2UU9 B;  5B3P A;  1BQ0 A;  2ZH6 A;  5D5P A;  3H37 A;  4X4U A;  3ZRX A;  2F93 B;  4UB1 A;  8ICV A;  1K3E A;  5JQG A;  1MOF A;  4XDK A;  1XMO B;  2ATK C;  3JAS A;  2QWN B;  2PF4 E;  1R73 A;  4O4H B;  2LFR A;  2BBJ A;  2ZCE A;  5IYD O;  2FYU H;  1YTF B;  2ADQ B;  4ASU G;  3U0Z A;  4JI1 O;  3K0D A;  3TXQ A;  3MDA A;  2R9R B;  3IGA C;  1BPX A;  3ISD A;  3WFS C;  2X0L A;  2R9I A;  4RUF A;  4NXM B;  9ICO A;  1QVF U;  3LNM B;  2VQF O;  4U3J A;  1S0V A;  1H2S B;  3OUF A;  3A0H Z;  4QZ8 A;  2UXC O;  1Q6I A;  2XND G;  4PA9 A;  2AW9 A;  4IHJ A;  5K1P A;  3OTO B;  3AUO A;  1KP3 A;  2O1P A;  4DO9 A;  2IU3 A;  2CK3 G;  4FIP C;  5J29 A;  4A5U B;  1ZQJ A;  1HNX B;  5LMU B;  5J0O A;  3TXS A;  3OUY B;  4IL6 Z;  1BL8 A;  1P7G A;  3CME V;  4TUR A;  1RPR A;  3EVK A;  3ABL B;  4WCW A;  2WLL A;  2MK3 A;  5LYJ B;  2LO1 A;  2BBH A;  3ZED A;  2P7T C;  4DR1 B;  1NO5 A;  3CXC U;  2QE7 G;  4DUY O;  2QWR B;  3F5T A;  4LNU B;  2BPC A;  4K0K O;  3H3A A;  1HR0 O;  1SKV A;  4JYA O;  5FPO A;  1NH2 D;  1KU9 A;  3B09 A;  1TV9 A;  3JPN A;  4RQE A;  3SPG A;  1ZQP A;  4MT8 A;  5C8Y B;  5DDY A;  1M56 B;  3SYQ A;  1PP9 H;  1R6N A;  3SGI A;  4WOY A;  1NBM G;  4TWK A;  2Q7G A;  3SR2 C;  3D36 A;  3WFR E;  4DO2 A;  1YJN V;  2Z3Y A;  4QZE A;  5BY1 A;  2IM9 A;  3CP1 A;  2GTA A;  4NVP A;  4DV4 B;  3QNE A;  3T1H O;  4ZIB A;  4HAM A;  4R63 A;  3W7U A;  4EP7 A;  1KBH A;  3L9D A;  3A0B Z;  5LGN A;  2EIJ C;  2ZE7 A;  2ZH5 A;  5DBC A;  4MF8 A;  8ICH A;  3K5L A;  1DGS A;  1MIV A;  1NTM H;  2JS5 A;  4B3S O;  2GAF D;  3JZ0 A;  5HRL A;  4CS2 A;  2HHH O;  2YS8 A;  2FL4 A;  1JOY A;  1JPX A;  1H8H G;  2JS3 A;  1I0H A;  1I5X A;  1S3J A;  2R72 A;  3L71 H;  3PMN A;  2YXY A;  1YXB A;  2UUB B;  1H2G A;  4IIJ A;  1FYJ A;  3JYY A;  4M9G A;  4PEL A;  7ICM A;  1RP3 B;  9ICC A;  3CC7 V;  1QU7 A;  4ATB B;  4LEW A;  2P5O A;  1AP5 A;  2OCC C;  1IUR A;  3QG5 A;  3JPP A;  4JI4 B;  2FCL A;  1BPZ A;  4OAI Z;  2YXH A;  1PNL A;  2Z0A A;  3VOU A;  4QZF A;  2IUB A;  1KQS U;  1F4M A;  3T4Z A;  3E8H A;  1H2N A;  4QZG A;  2M7W A;  5J2B A;  4JWM A;  3RH6 A;  2YIA A;  4I0X B;  5BPC A;  2W9M A;  2BCS A;  3SPC A;  3JAK A;  4F5Q A;  4I50 B;  4YJ2 B;  1ZQB A;  4MVR A;  4O68 A;  4I9Q A;  3CRM A;  1IBK O;  4UD5 A;  2OCH A;  1BHB A;  1IBM O;  5CB4 B;  4KLD A;  2M6Y A;  5J0R A;  4DK0 A;  3UXO A;  4DR5 B;  5J0Q A;  2CH7 B;  1XSL A;  2JGD A;  2VWJ A;  2IH3 C;  5KUM A;  5ITZ B;  5HRF A;  3N2K A;  4YIP A;  1F23 A;  3C2K A;  5CA7 A;  3QF7 A;  1H2M A;  3JPR A;  3M99 B;  3OAA G;  1EFR G;  5BOM A;  3ICX A;  1PM9 A;  2BTQ B;  2JJ1 G;  3C90 A;  3K5O A;  3K3W A;  1DK1 A;  2QSA A;  1W0K G;  1NKD A;  4AQY B;  4QJF B;  4GX5 A;  4FLX A;  4J7J A;  1AI6 A;  1ZL8 B;  4JI3 B;  4DV3 O;  2JGD B;  1BS3 A;  3K5M A;  2CH7 A;  1VQ7 V;  1OCZ B;  1QQC A;  4DV0 B;  4PH5 A;  2ZIO A;  4I7Z B;  1OHH G;  4EEQ A;  5J2H A;  4EV6 A;  3HKB B;  3ETG A;  5EYP A;  1ZX3 A;  4DUZ O;  4FLW A;  4K96 A;  1YIT V;  3JAL A;  2K9P A;  1K33 A;  1YTF D;  1IX9 A;  2KB1 A;  1JQR A;  1QR9 A;  5CBG A;  2YI8 A;  2HEP A;  3EXA A;  4JZ2 A;  4PA4 A;  3RH4 A;  5JWP A;  1S5J A;  1ARO P;  3E22 A;  2DN9 A;  1OU5 A;  4XA5 A;  4UCU A;  4X4Q A;  3GB7 C;  2LW1 A;  3AG4 B;  2XAH A;  2ILM A;  3QO5 A;  4JI5 O;  1R8B A;  2HHP A;  1QLN A;  3OM3 B;  3UO3 A;  1HNX O;  3H1I H;  2VQF B;  3KZI Z;  5J2E A;  4DOB A;  3HWT A;  1R6K A;  4UXN A;  4EBK A;  5KHG A;  2UXC B;  4PGQ A;  1S5H C;  1YDX A;  4K9A A;  1MA1 A;  1P7B A;  4DV6 B;  3DSQ A;  4I4T A;  5BXZ A;  2ZH4 A;  4X1I B;  3X2Q B;  3S3W A;  3ZMU A;  2Q67 A;  2ZQM A;  4N21 A;  4TUY A;  9ICK A;  3SYO A;  5GON A;  5J2A A;  5BR8 B;  3L70 H;  3ASO C;  1HNW O;  4M5D A;  1MZE A;  2X6C A;  1HR0 B;  2X7R B;  4NLN A;  4FHX A;  4KXR A;  4I50 A;  4YJ2 A;  5DB7 A;  3J80 N;  2B1G A;  1LUV A;  4J7K A;  3RJJ A;  3K04 A;  4UB3 A;  2UXN A;  1V9P A;  5HFM A;  4OX9 B;  1N33 O;  4DUY B;  4J11 A;  4AT9 A;  4LF6 B;  4BWA A;  8ICJ A;  1R6T A;  1YLQ A;  1Y6X A;  4ZKI A;  5JJJ B;  3HPL C;  4Z1M G;  3OWG A;  1QNM A;  3LUT B;  3H01 A;  3T1H B;  1TA8 A;  3P32 A;  4QZD A;  4UAZ A;  1K34 A;  2ZH3 A;  1ZQG A;  1D2D A;  1OV9 A;  2JEU A;  4MVO A;  3CCE V;  5JH7 A;  3RJI A;  1OCC C;  3HR0 A;  2HR3 A;  1FXK C;  1ORQ C;  3G4S V;  3ISC A;  4JGS A;  4I55 B;  1NQT A;  3BY6 A;  4NXX A;  5EOZ A;  4O2A B;  1I08 A;  1Q43 A;  4I2G A;  4ABM A;  4TV8 A;  4HX0 A;  3SDL A;  4Z6D A;  1ZQE A;  4DR6 O;  8ICK A;  2BSK B;  1FXH A;  2BCC H;  4WQK A;  2DRB A;  3ZS8 C;  4KLL A;  2WLN A;  5KX5 B;  4CH3 A;  1HUO A;  2E75 B;  2DR9 A;  3LNN A;  4O4L A;  1ZL8 A;  9ICE A;  2ZD9 A;  3CCR V;  5KHH A;  3DXR B;  1CEZ A;  5J0S A;  2KSD A;  2ZXW C;  2Q7E A;  2FTK A;  1N36 B;  2O5A A;  2FMQ A;  4NKU A;  3PML A;  4IIJ B;  4X20 B;  4F5N A;  3IC7 A;  1FAF A;  4H44 B;  1XI1 A;  1RZT A;  1WP7 A;  2Q66 A;  4YN4 A;  1IBK B;  2E5L B;  1G6U A;  4H13 B;  4NTW A;  3RWR D;  3BVO A;  4NB5 A;  4DXW A;  4UBB A;  2DVI A;  4UD4 A;  5JQG B;  4DR5 O;  4TSF G;  4LP8 A;  5CHE A;  4X1Y A;  4JI8 B;  5GTH Z;  1WOT A;  2M2T A;  1E1R G;  3DXR A;  3FKS G;  4I29 A;  3AG7 A;  1ZUQ A;  1JFF B;  3W7W A;  3C66 A;  2EIJ B;  1MQ2 A;  1M57 C;  3AK1 A;  3UPQ A;  7ICI A;  5A9G A;  4C7U A;  8ICT A;  3ABK B;  3L74 H;  1YI2 V;  2PXI A;  3CCQ V;  4NXW A;  3H1L H;  1YF2 A;  1U97 A;  3DGE A;  1IBM B;  8ICR A;  3PN1 A;  4AQY O;  1H38 A;  2EIM B;  4B08 A;  4KLS A;  1ZSP A;  4AT7 A;  3ETE A;  4NXN O;  4MVS A;  1I5Y A;  4U7N A;  1K97 A;  4FLZ A;  1M57 B;  2N74 A;  5K1X A;  2UXB O;  2FMP A;  1XEQ A;  1GMG A;  1I94 B;  4ZOL B;  2ZIM A;  4WFG A;  3B4S A;  2XAF A;  2GDS A;  4K8V A;  4EEB A;  4I2A A;  7ICP A;  1M93 A;  3SYP A;  4QZ9 A;  1JCH A;  2EJR A;  1EZV H;  2RMK B;  5AG2 A;  2A9H A;  3ZBH A;  5KHJ A;  1G1X B;  3MCR A;  3OVB A;  4UFZ A;  5HRI A;  3E86 A;  5FL7 G;  3GWK C;  4IQT A;  3RN4 A;  1Q90 D;  4O2B B;  2GUZ A;  3SYC A;  1W2B U;  4LT6 A;  2CDY A;  2EZP A;  5EBL C;  3CC2 V;  2WPD G;  2BTQ A;  1YZB A;  4FHW A;  4RWP A;  4PGX A;  2PFP A;  4LF7 O;  4GX1 A;  3J7A U;  1KDH A;  4DR3 B;  3JD1 A;  1V55 B;  9ICS A;  5LBQ A;  2EWR A;  2B9Z A;  5ITZ A;  2QKS A;  4OPH A;  2VS0 A;  1PKX A;  4R6Z A;  4WFB V;  5E1A C;  1K92 A;  2EIN B;  1US6 A;  5B66 Z;  2CE4 A;  4Z6F A;  2BE3 A;  4JAA A;  4B3R O;  5IYC O;  4OPA A;  1SS3 A;  4FMT A;  1EZJ A;  3BHP A;  9ICP A;  5BOL A;  5D63 A;  3WG7 B;  5J0T A;  4GX0 A;  3RBZ A;  1Q6H A;  4KLJ A;  3CJH B;  5J2D A;  1Y66 A;  4FLT A;  2EJ7 A;  3RGB A;  1QR8 A;  1EM1 A;  1HNZ B;  4K35 A;  2Q4P A;  3T1C A;  2Q0A A;  2GA9 D;  2WLK A;  5BMV A;  7ICJ A;  4XRH A;  4EB6 A;  7ICH A;  4RQ3 A;  4WC3 A;  3G6B A;  2XOK G;  3C2L A;  8ICQ A;  1N33 B;  4JI2 O;  1VF7 A;  1Q3E A;  8ICZ A;  4PHZ A;  7ICO A;  2ZKO A;  4LWS A;  4X64 B;  4JI0 O;  4WFH A;  1JMK C;  4E80 A;  2WLI B;  2RCV A;  4JYB A;  1R8A A;  1X59 A;  5HHI A;  4DR7 B;  3HB3 B;  4D6T H;  2F95 B;  2YIB A;  1ZQL A;  3AU6 A;  4DV2 O;  4QE7 A;  5L3E A;  4EBJ A;  2NRK A;  4LF4 O;  4WBZ A;  2DYR B;  3OGI B;  1VQ9 V;  1LNQ A;  3LSQ A;  4X4R A;  2ID1 A;  3B40 A;  1R3L C;  2KG7 A;  2ZH1 A;  4I2F A;  2V1D A;  4LF5 O;  1XHX A;  4DR6 B;  2CAZ C;  4LF9 O;  5J0X A;  3C5G A;  3UM7 A;  4PDL A;  3RYC A;  4DYL A;  2IHM A;  1XSN A;  5HC9 A;  1KUQ A;  2DR8 A;  1SER A;  1P4R A;  4DR2 B;  4O2B A;  5DN6 G;  3NR7 A;  3OEE G;  3WFQ E;  5DB6 A;  3RVY A;  3K57 A;  3SPH A;  4GLX A;  3LSU A;  2M2U A;  4F6E A;  4WFF A;  1NTZ H;  3ASN C;  2DW4 A;  4DR1 O;  3GDX A;  2ZE5 A;  2DWE C;  3FD9 A;  2CGN A;  2DR7 A;  1CPY A;  4K0K B;  4I4T B;  1KD1 W;  1AI4 A;  5J2K A;  3JAW A;  3L75 H;  4KLO A;  1KKC A;  2FB5 A;  2Q6A A;  4CS3 A;  2IH1 C;  3OR7 C;  2QKC A;  1JVM A;  4MF2 A;  1OCZ C;  1QBZ A;  2RFF A;  3N2G A;  4RPZ A;  1AI7 A;  1VF6 A;  4R7C A;  4LH6 A;  1WNS A;  4OXS A;  4FM1 A;  1NZ6 A;  4FO1 A;  2I9G A;  1F5A A;  2XHB A;  4B3T B;  2F1M A;  2HN2 A;  2AXT Z;  1WA8 B;  2ZNI A;  4UCV A;  4IQW A;  3VQY A;  1R3I C;  5LOV A;  3CS5 A;  3UCS C;  1AB3 A;  4NLK A;  4WBN B;  3DC6 A;  2YEV B;  5IIN A;  3ZHV A;  4X65 B;  4M0A A;  1PX5 A;  3OUS A;  1E1Q G;  1CP9 A;  3FYI B;  4MVZ A;  4TV8 B;  4PHP A;  5J2J A;  1CXZ B;  3HKD A;  4I2C A;  3SPI A;  5HRE A;  2JK5 C;  5E79 Z;  3E89 A;  2NLJ C;  1BSM A;  3SYA A;  3ZHR A;  1NJI W;  2WSS G;  4RQ0 A;  3L73 H;  8ICX A;  3OTF A;  3OT7 A;  4JV5 B;  4FM2 A;  2AGA A;  2L35 A;  4GXJ A;  1M1K W;  1MSW D;  2RJZ A;  5HRH A;  4R66 A;  3ISB A;  4LF7 B;  1FFX B;  3CD6 V;  2DMX A;  4PJ0 Z;  2AHZ A;  1RPL A;  3B77 A;  4CH5 A;  3AQN A;  5J0W A;  4FK5 C;  3BCC H;  1VQN V;  2EIK B;  3Q4H A;  3HJ1 A;  4RWQ A;  3AG3 B;  3RJG A;  8ICS A;  1VQ6 V;  2ZH2 A;  1IDS A;  1TUB B;  3ZMT A;  4RQ5 A;  1UJW B;  4BW5 A;  4K3A A;  1XMQ O;  5KA5 A;  4UB6 Z;  4EFE A;  4KLT A;  4MTO A;  2B1I A;  7ICK A;  3K9S A;  1XL6 A;  8ICM A;  1UEV A;  3GWO A;  1AR4 A;  5EK0 A;  4PI2 A;  2KG7 B;  5J2U A;  3AK2 A;  1ZQA A;  4KUM A;  3OW2 U;  1HNZ O;  1B3Q A;  4FLU A;  4K9B A;  2WA4 A;  1R1B A;  1VJ7 A;  4LZG A;  4LVS A;  3E22 B;  1J95 A;  1COW G;  4O2A A;  2B51 A;  9ICA A;  1ZQD A;  4RWN A;  2XAQ A;  2XUM A;  4LFB B;  4LFA O;  3L72 H;  1ZQK A;  4M47 A;  4X4V A;  2PFQ A;  4K4G A;  4X64 O;  5LA6 A;  4P9O A;  5KUK A;  4R8C A;  1M56 C;  3G71 V;  1YJ9 V;  4JI3 O;  4ATB A;  5IIL A;  2XAJ A;  1V55 C;  2OT5 A;  3HX0 A;  2CTQ A;  4AIL C;  2HVJ C;  5FNV B;  1MIY A;  4AHC A;  5F2V O;  2YIB D;  4O4I A;  4P9P A;  3E2E A;  4LEV A;  4WH5 A;  4NYK A;  4RQ7 A;  4X1I A;  1N4C A;  9ICR A;  2ODM A;  4NXT A;  1TUB A;  5LGU A;  1KEC A;  3E8G A;  4UB2 A;  4I27 A;  4Q6G A;  2Y48 A;  1SA0 A;  1ZLZ A;  4NTX A;  4I2I A;  9ICM A;  5III A;  1BPB A;  3D3Q A;  2LGQ A;  4DR7 O;  3WB0 A;  3JD3 A;  4RQF A;  2PI5 A;  3ABL C;  5CWR A;  3MDC A;  4DV2 B;  3VBB A;  4KLU A;  2ZXW B;  3FB8 C;  3WU2 Z;  4LF4 B;  1NI8 A;  2IJH A;  3HW8 A;  2BCR A;  5KHI A;  4LEZ A;  4ZHQ A;  4QZC A;  3SJQ C;  3WG7 C;  4JI5 B;  5L3D A;  4Z6C A;  2HJF C;  1J5E B;  2W6I G;  2P6J A;  2R70 A;  1VMG A;  4AT8 B;  4E7X A;  2F4V B;  4IG8 A;  1TGO A;  4UVA A;  3JPS A;  4XUS A;  2LW7 A;  4JTA B;  4GT1 A;  1AIL A;  1SET A;  2B56 A;  4WC1 A;  3MGH A;  1AJP A;  1IVS A;  5KA6 A;  2P22 C;  5IJ9 B;  2A0L A;  1AJQ A;  4RPY A;  2HVK C;  2QGN A;  4CBC A;  3JD4 A;  5BR8 O;  2BCV A;  2PTM A;  2A06 H;  5LOV B;  4NXV A;  4DK1 A;  2BPF A;  1GO3 F;  3FAV B;  5H6R A;  2IJJ A;  4I9W A;  1L0N H;  2DYS B;  4E2L A;  1NR7 A;  3ETD A;  2ZHA A;  2E76 B;  4LF6 O;  4RWU A;  1XNR O;  3I55 V;  2UXD B;  4NM2 A;  3JPO A;  3ABM C;  3MAQ A;  5D49 A;  1XNQ O;  4FHY A;  2ZM6 B;  9ICN A;  3T4D A;  2NNU A;  1SC5 B;  1GTO A;  3CPW U;  4AI8 A;  2F43 G;  1I7F A;  4J9Z B;  3OVS A;  5BMV B;  1GN4 A;  2QR4 A;  2LFS A;  2EIN C;  1VP7 A;  5IWA B;  3X2Q C;  3ABK C;  4FJC C;  1XOU A;  4DV7 B;  1JA8 A;  1VF5 B;  3STZ C;  4M9N A;  2D2C B;  4UV9 A;  2W6J G;  1ZQT A;  3V7L A;  2P4K A;  1Q81 W;  3ZHT A;  3F5W C;  7ICV A;  1URF A;  2B4V A;  8ICI A;  2AZ2 A;  1JX9 A;  2H8P C;  2W0F C;  2MW2 B;  4UV8 A;  4MTF A;  3ZRW B;  2EBO A;  4WBN A;  3K9A A;  5KAF Z;  3FYE B;  1EN4 A;  4DV1 B;  1MSD A;  7ICG A;  1MNG A;  4L87 A;  4X1K A;  3OMN B;  4TQF A;  5JH7 B;  4CS4 A;  3BRC A;  4F5P A;  3V72 A;  1GAX A;  3K75 D;  3A0R A;  5HHH A;  1BPE A;  4NXZ A;  4UCR A;  5J2T A;  4KLF A;  5EIB D;  3UPS A;  2ZNJ A;  3N2G B;  1U96 A;  1B6Q A;  4LFC O;  3G67 A;  1NU1 H;  3A8T A;  4RT3 A;  1XMQ B;  4UVB A;  3EF2 A;  2ARH A;  4BIZ A;  1N32 B;  4JI8 O;  4UB4 A;  2HJD A;  3K5N A;  4F4L A;  4X4T A;  1NTK H;  2NN4 A;  3B0Y A;  9ICT A;  4JYY A;  3M8A A;  3ZRV A;  3AU2 A;  3CX5 F;  1UET A;  1YCI A;  4LWS B;  3F7V C;  2QTS A;  9ICW A;  1JAJ A;  1EBO A;  1AJN A;  1RFY A;  1XHZ A;  5J0Y A;  1L8D A;  4NTY A;  4TUP A;  3B8N A;  5EBW C;  1ROP A;  4P4P A;  1PV0 A;  1ZQQ A;  8ICL A;  3FB6 C;  4TV9 B;  3H39 A;  4I2H A;  1MIW A;  4HNA B;  3CCS V;  3ER9 B;  3JAT A;  3UT5 B;  4DW0 A;  1NOM A;  4N7R A;  3JAS B;  1UFI A;  4XBF A;  5D4B A;  4QNH B;  4Z2W A;  4G28 B;  3TCU A;  9ICL A;  3BFR A;  9ICI A;  3RYI A;  3M7M X;  3RYI B;  2WLM A;  1UPG A;  1XBL A;  1H2K A;  3W7X A;  4YXW G;  2V4D A;  3SJC C;  4ZBM A;  5EZY A;  4B3M B;  4B7K A;  2IW5 A;  3TFS A;  1AVM A;  3LDD A;  1ZQX A;  2N05 A;  4JI6 B;  1FA0 A;  3H1K H;  1RSO B;  1TVK B;  5KHK A;  4OAF A;  2P66 A;  1P49 A;  3EHB B;  4MVQ A;  5IYZ A;  1NS1 A;  3T1Y O;  5CA0 A;  1JJ2 U;  2AHY A;  4DV5 O;  1F4N A;  3HKE A;  4KLG A;  4FM0 A;  4S3N A;  4K4I A;  3ASN B;  3CK6 A;  1XMO O;  2YSU B;  4X5V A;  3LQC B;  5J2C A;  8ICN A;  4I2D A;  1ZQM A;  2Y4U A;  5FNV A;  1SQF A;  2QDO A;  3P30 A;  3SPJ A;  3N27 A;  4JI1 B;  1S72 V;  2AZ0 A;  3JAR A;  3RFR A;  4JAU A;  2Z5U A;  2ZDI A;  4R50 A;  1ZQW A;  1VEW A;  1LR1 A;  4AT9 B;  2EIK C;  4ZOL A;  1VQM V;  4I2B A;  4NKT A;  2QEX V;  5J2T B;  2WLH A;  5HFL A;  3K58 A;  3UQ2 A;  3F7Y C;  1Q8I A;  3TJT A;  2JGU A;  2QJ1 A;  3NYB A;  2Y69 C;  5EIB C;  1SQG A;  4KFM A;  5DBA A;  4YJ3 B;  2Q0O C;  3HKC A;  2WWW A;  4MTG A;  5EBM C;  4KLH A;  3RYH A;  3CE2 A;  2UXD O;  1MZF A;  1Q79 A;  4JYA B;  4I28 A;  3IJ4 A;  4MFA A;  2A7W A;  1BMF G;  1XSP A;  3VQW A;  2BPG A;  4I2E A;  4IQV A;  2PZS A;  4X88 A;  4DW1 A;  2Q69 A;  3BA8 A;  1KYO F;  4YD2 A;  1Y74 B;  1DF4 A;  5KLV H;  2GBO A;  4O5K A;  1AR5 A;  4YCX A;  3CYO A;  2JJ2 G;  1UEU A;  1FFX A;  3CHX A;  1Q82 W;  1ZWI C;  5IYB O;  3TK1 A;  3C3T A;  1RM1 C;  4K8Z A;  1ZQS A;  5GON B;  1OZ0 A;  1W0J G;  4YMN A;  5JVD A;  4LF5 B;  2CGO A;  3CCV V;  4B3S B;  5IY5 B;  3G6E V;  4KLQ A;  4DV1 O;  4J42 A;  4DRX B;  1Y74 A;  4HNA A;  4YIO A;  4TV9 A;  5CA1 A;  3MD0 A;  4IQU A;  5FPR A;  2XT9 A;  1R3J C;  2OWO A;  3HKB A;  2VQE O;  5LP6 A;  2DRA A;  2HHH B;  4R65 A;  1SRY A;  2BTO A;  1BHA A;  2P67 A;  4OGQ B;  4LFC B;  5D62 A;  4X89 A;  3ZHU A;  1LUW A;  3WFV A;  4FH3 A;  2QTO A;  4WC2 A;  9ICX A;  3C2M A;  4UAW A;  3KCY A;  3GVM A;  4FH5 A;  1N32 O;  1JN3 A;  5DB8 A;  5IJ9 A;  5C8Y A;  1Q5O A;  4O69 A;  4JF3 A;  4EKW A;  3ZIA G;  1VQ8 V;  4D7S A;  8ICE A;  3ZN1 A;  3UO2 A;  2LP7 A;  2HN1 A;  5D5Q A;  5B1B C;  1YSC A;  4IT5 A;  5EYP B;  1GN6 A;  4O4H A;  3APO A;  4X20 A;  1BQZ A;  5D46 A;  1ZQY A;  4JLZ A;  2ZR2 A;  5LMN O;  1KC8 W;  1SES A;  4B3T O;  4PGY A;  5CHG A;  2ETN A;  4D7T A;  4M9L A;  1GKF A;  2M2V A;  2VAN A;  1NVP D;  4JAS A;  4K97 A;  4O4J A;  1HWY A;  2RNB A;  4O4L B;  1OJH A;  5B1A C;  4FLV A;  1B06 A;  3B8M A;  4X62 O;  1RPO A;  1QLE B;  4X65 O;  4LBE C;  4JTC B;  4UCT A;  5B1O A;  4YMM A;  4K99 A;  5CBH A;  2GWS A;  2Y0I A;  1WPB A;  3QO8 A;  5B1N A;  2JIZ G;  4E4E A;  3CWB H;  3ZN0 A;  4DV0 O;  1S77 D;  2R9A A;  3ABM B;  4JI6 O;  3JD2 A;  3B0X A;  1HUZ A;  5J9P C;  1WA8 A;  4DUZ B;  2FKX A;  1SQB H;  1YEW A;  1XL4 A;  2DR5 A;  3FX7 A;  2IU0 A;  3UXP A;  4UCS A;  3AG2 B;  4DV5 B;  4I0U A;  2ZH9 A;  4B3M O;  5BZB A;  1K4C C;  2WA3 A;  3CCM V;  3CRQ A;  2F23 A;  4J10 A;  1ZQV A;  7ICQ A;  3IAY A;  1YHQ V;  2DE0 X;  3NWI A;  4RWO A;  2YID A;  1HW7 A;  3SJA C;  1VAR A;  9ICF A;  1FS0 G;  2OYQ A;  4LC1 A;  1PL0 A;  4L8J A;  4RUE A;  4O6A A;  3RT3 C;  3JCZ A;  1FXK A;  3OE7 G;  2GSM B;  1ZQI A;  5KMG A;  2EUL A;  2Q8V A;  5B5E Z;  3RJK A;  2FMS A;  4YHH B;  5TZV A;  2K1E A;  5JVD B;  8ICA A;  3HKE B;  4FZ1 A;  4DV6 O;  3V7J A;  1PPJ H;  5IYZ B;  3OGU A;  2QM7 A;  1BZK A;  2A79 B;  4LFA B;  4ZI7 B;  3QTC A;  5B1A B;  5JCO A;  4BAY A;  5IY5 C;  4WBY A;  4X4O A;  4QZI A;  1O9H A;  4LEY A;  1QHT A;  3OEH G;  3ER8 C;  2OTL V;  3T2M A;  1F51 A;  2X6B A;  1YIJ V;  1VQK V;  3VQX A;  1N34 O;  5KAI Z;  3PHZ A;  5D61 A;  3K7D A;  3I56 V;  5CFT A;  3FFQ A;  4X1K B;  9ICJ A;  5KX5 A;  3KCX A;  4PHA A;  4X8A A;  4PI0 A;  1R89 A;  3CMA V;  1SQV H;  1PNM A;  5B3Q A;  4RQ2 A;  4YJ3 A;  2HG5 C;  4WC5 A;  4WC6 A;  3JAK B;  3UQ0 A;  2C2A A;  4IGG A;  2UUC O;  2ZIN A;  3A2F A;  1VQO V;  4OX9 O;  2WLI A;  4KLE A;  3AQK A;  3ASO B;  3H38 A;  4WC7 A;  2RDC A;  4NR1 A;  3ZMV A;  2OTJ V;  2QWQ B;  8ICP A;  1Y67 A;  4GX2 A;  3FB7 C;  1Z2G A;  9ICH A;  4X4N A;  4PA7 A;  1ZTE A;  1MG1 A;  2X6A A;  4F5R A;  2HKO A;  5L3G A;  1IXB A;  4F6R B;  4JYC A;  2DQ0 A;  3EFF K;  4W4L A;  4Z6E A;  3MHS C;  4DOA A;  2B5U A;  4UUJ C;  3JAL B;  4GXK A;  1ZJN A;  4AT7 B;  3AG4 C;  7ICN A;  1GM8 A;  1MQ3 A;  2VWK A;  1N36 O;  4YD1 A;  1B04 A;  3R65 A;  4ZHQ B;  4P2Z A;  2N04 A;  3D8C A;  1Z5V A;  2QA4 V;  4KLI A;  8ICC A;  4PHE A;  1O9G A;  2ITD C;  7ICT A;  2JRI A;  1VQ5 V;  3RJF A;  1THZ A;  3H9V A;  2YC0 A;  1XNR B;  2ZH7 A;  1M4U A;  1WJZ A;  5LMN B;  4KLM A;  4X66 B;  4FPP A;  4M2Y A;  4GKK O;  4KHP O;  4GKJ O;  4IYH A;  3JD0 A;  2Q7H A;  3JAT B;  3UT5 A;  8ICG A;  8ICF A;  1K7D A;  4JI7 B;  1DLB A;  4X62 B;  4X4P A;  2WAM A;  5CMU A;  1QVG U;  1YVW A;  3I5D A;  4J41 A;  1BGY H;  3DC5 A;  2IHO A;  4HBN A;  9ICG A;  5L3F A;  1OCR C;  1GPJ A;  2OIG A;  4HYO A;  1KKD A;  2PYL A;  1XRE A;  2PUS A;  3UQ8 A;  4FFK A;  2WLL B;  2O57 A;  4LH7 A;  3D36 C;  5FLX N;  3ZHS A;  3JCU Z;  2Q73 A;  5CBF A;  4NLZ A;  4ZI7 A;  4XQ8 A;  2RQ6 A;  4YY3 B;  1Q86 W;  3QVN A;  3AK3 A;  5B1B B;  4MS2 A;  4NXN B;  4RPX A;  5LGT A;  2ZE6 A;  1JMS A;  2V7Q G;  4QPK A;  9ICB A;  4PDR A;  2UXB B;  1I94 O;  7ICR A;  3O65 A;  3OD4 A;  5CFU A;  2LQT A;  4XQ7 A;  1TVA A;  5CA1 B;  3HJ4 A;  4E8F A;  3AG1 B;  3APQ A;  5DEC A;  1IBL B;  3UXN A;  3K03 A;  5DED A;  2IJK A;  1K5Q A;  1H2L A;  1ZQF A;  3P3P A;  4QZA A;  5DDM A;  2Y69 B;  4BIO A;  1L0L H;  4UBC A;  4P4M A;  3C5F A;  4M9J A;  3KKY A;  4JZG A;  2GV9 A;  7ICL A;  1DF5 A;  2OCC B;  4XJE A;  2YI9 A;  3RVZ A;  2FML A;  5GW7 A;  3TET A;  4JTD B;  8ICW A;  4JAV A;  7ICS A;  4UB8 Z;  4FVM A;  5KMG B;  4NXM O;  1DTO A;  4O67 A;  3HKD B;  1RM1 B;  4QZH A;  4I0X A;  5DBB A;  4JPR A;  1XQ8 A;  2PFN A;  2BSK A;  3E8B A;  1AI5 A;  4TUY B;  3ZRW A;  1GH6 A;  4B3R B;  4FFB A;  3OTO O;  4FFB B;  1K8A W;  1V54 B;  1KEJ A;  4O4I B;  1TVK A;  4I55 A;  1N8R W;  2P06 A;  3VQV A;  4PHD A;  2ZT9 B;  4WQL A;  4JI0 B;  1WB8 A;  4WC4 A;  4JWN A;  2EX3 A;  2ZDI C;  4PA3 A;  4UVC A;  5IIJ A;  1ZQH A;  4M04 A;  3H1H H;  2OIE A;  1FJG B;  1YJW V;  3AQL A;  1N34 B;  2RN9 A;  2F66 C;  1FXV A;  1T5E A;  3S3X A;  4J7Z A;  5DKW A;  1VQL V;  4CH6 A;  4WFE A;  3RYF A;  4LF8 B;  4UCO A;  1FD9 A;  3JAR B;  3WFO A;  4MVM A;  4XDJ A;  2NR5 A;  1TUE B;  2ZE8 A;  4NM1 A;  3K06 A;  2IJI A;  1N0N A;  2DQ3 A;  2Y4T A;  1GN3 A;  1IZ3 A;  1VQP V;  4AT8 A;  4CZZ A;  2PFO A;  3OVA A;  3CCL V;  1ZJM A;  4PPX A;  3BAB A;  3ABT A;  4TUS A;  4LCU C;  2YIC A;  2PYJ A;  1P84 F;  5LHH A;  4P30 A;  5H6Q A;  3LDE A;  4EB6 B;  5IJ0 A;  4UAY A;  4GZR B;  2H94 A;  3H1J H;  1FKA O;  4WCE V;  4LF9 B;  3ZRS A;  2CTP A;  4U7O A;  3IC9 A;  4LNU A;  3CCJ V;  4KL1 A;  2PBE A;  3CXH F;  5CR0 A;  4I5S A;  5IIM A;  2ADP A;  3BA9 A;  2UUB O;  4OAG A;  4QE9 A;  1NH2 B;  4DR2 O;  4JLX A;  4GXI A;  2DWD C;  2JVD A;  3IFX A;  3NVO A;  5H5N A;  4PD4 F;  5L3B A;  1GN2 A;  4OAH A;  2GTS A;  3UKM A;  2E3C A;  3OMA B;  3ZCC A;  4RAI A;  2CTR A;  3AG2 C;  4F5O A;  3LK9 A;  1BPD A;  2XAS A;  4YMO A;  1KMI Z;  1GM7 A;  4NXU A;  3ZMS A;  1NT2 B;  4RT2 A;  2PI4 A;  1G4Y B;  8ICY A;  2Q9L A;  2BOB C;  3ZHQ A;  3RW0 A;  4GKJ B;  4DR4 B;  4KB6 A;  3JPQ A;  3MDS A;  9ICQ A;  5CB1 A;  3MGI A;  3JAM N;  3U11 A;  3JSN A;  4KP4 A;  1SQX H;  4X0A A;  1JJO A;  2EIL C;  1WAZ A;  3CRR A;  3WFP A;  1ZQC A;  2EIM C;  9ICU A;  4XDL A;  3ZX6 A;  4K98 A;  1TFW A;  5GTI Z;  5DM6 V;  2ISP A;  3MHH C;  1QLE C;  5TIS Z;  1PD3 A;  4CH4 A;  5LXT A;  1SZT A;  4O5E A;  5IE9 A;  2WLJ A;  3THO A;  4BR6 A;  1MMM A;  1HP8 A;  3NXS A;  2ZR3 A;  1GK9 A;  5IIK A;  4TOI A;  5JCO C;  2VQE B;  4CC6 A;  2IBZ H;  3RJH A;  3J81 N;  2CTW A;  4YY3 O;  1WPX A;  1TFY A;  1IBL O;  3BEH A;  1RSO A;  4B7E A;  3RYH B;  4MSW C;  4WC0 A;  5HR9 A;  2Y0P A;  3ZMZ A;  4DV3 B;  1ZQN A;  2QKA A;  2HLD G;  4QZB A;  3AG3 C;  1N0J A;  4QGP A;  4RQ6 A;  2DJV A;  3CCU V;  4JV5 O;  5CFS A;  3ERC C;  4X1Y B;  4BIU A;  1Y76 B;  3C18 A;  4G27 B;  5J2G A;  1WN7 A;  3CRA A;  1L1F A;  8ICB A;  3DTU B;  1JR9 A;  4F6R A;  5A2Q N;  3N2K B;  3OMI B;  4MVU A;  3JPT A;  1VIB A;  3G80 A;  2UUA O;  3W7S A;  4K8X A;  5CJ7 A;  4TT3 G;  2L6L A;  5EC1 C;  4WF9 V;  5J2F A;  1M90 W;  3MBY A;  4FO6 A;  3U10 A;  3JSL A;  1AP6 A;  4J80 A;  2Q5Z A;  4RQ1 A;  1A32 A;  4LFB O;  5DB9 A;  4MFC A;  3JYC A;  3PJS K;  2P90 A;  1FXK B;  1XUQ A;  3OR6 C;  1SQQ H;  4EED A;  4FZ0 A;  1OCC B;  3E35 A;  4G2K A;  1HDJ A;  1SA0 B;  3K0G A;  3TGU H;  5B3S C;  2GUZ B;  3P3N A;  4K4H A;  4GUN A;  4IHJ B;  7ICF A;  2HFE C;  3CSX A;  1WLE A;  3K79 A;  4MTX A;  5LHG A;  4FHV A;  5J0U A;  2QWO B;  4H0L B;  2DYS C;  1EN6 A;  3STL C;  1NR1 A;  1ZAU A;  1HNW B;  4DOC A;  4H33 A;  4LR3 A;  1OCO C;  1FJG O;  3Q4H B;  4FHP A;  2M2W A;  1ZQU A; 
#chains in the Genus database with same CATH homology
 3OGU A;  3HWT A;  4UB2 A;  4I27 A;  4I2I A;  4EBK A;  5HRK A;  9ICM A;  4PGQ A;  5III A;  1BPB A;  7ICE A;  2ZH4 A;  4WBY A;  4X4O A;  4QZI A;  4X4S A;  5CWR A;  3MDC A;  9ICK A;  4KLU A;  5J2A A;  3HW8 A;  2BCR A;  5HRG A;  4QZC A;  4M5D A;  4NLN A;  4FHX A;  3TFR A;  4Z6C A;  1ZQR A;  5DB7 A;  3OV7 A;  9ICJ A;  3RJJ A;  4PHA A;  4AT8 B;  4E7X A;  4I2J A;  4UB3 A;  3OUY A;  4IG8 A;  1R89 A;  3JPS A;  4RQ2 A;  3RJE A;  4XUS A;  4WC5 A;  4WC6 A;  2ZH8 A;  2BCQ A;  4AT9 A;  3UQ0 A;  4WC1 A;  8ICJ A;  3MGH A;  8ICU A;  1YLQ A;  8ICO A;  4KLE A;  1ZQZ A;  3AQK A;  4QZD A;  4UAZ A;  3H38 A;  4WC7 A;  4RPY A;  3V7K A;  2ZH3 A;  1ZQG A;  7ICU A;  2BCV A;  8ICP A;  5HRB A;  3RJI A;  9ICH A;  4X4N A;  1BPY A;  2BPF A;  2ZHB A;  3ISC A;  4F5R A;  2ZHA A;  5EOZ A;  4I2G A;  4LZD A;  4Z6E A;  4NM2 A;  4Z6D A;  1ZQE A;  3JPO A;  8ICK A;  4P4O A;  4DOA A;  5D49 A;  2DRB A;  4FHY A;  4GXK A;  1ZJN A;  4KLL A;  4AT7 B;  9ICN A;  1HUO A;  7ICN A;  3AQM A;  1MQ3 A;  2DR9 A;  4YD1 A;  9ICE A;  1R8C A;  3PNC A;  4KLI A;  5J0S A;  8ICC A;  3OVS A;  4O5C A;  4PHE A;  4RQ8 A;  2O5A A;  7ICT A;  2FMQ A;  4NKU A;  3PML A;  3RJF A;  4P2H A;  4F5N A;  4M9N A;  2ZH7 A;  4KLM A;  1ZQT A;  3V7L A;  1RZT A;  2Q66 A;  4M2Y A;  4YN4 A;  7ICV A;  8ICI A;  2DVI A;  4X0B A;  4UBB A;  8ICG A;  4UD4 A;  8ICF A;  2BCU A;  4MFF A;  4X4P A;  4RQ4 A;  1WOT A;  2M2T A;  1ZQO A;  7ICG A;  9ICG A;  4I29 A;  3C66 A;  1MQ2 A;  3UPQ A;  7ICI A;  4R64 A;  8ICT A;  4F5P A;  3V72 A;  2PXI A;  3K75 D;  5HHH A;  8ICR A;  1BPE A;  4NXZ A;  4KLF A;  3UPS A;  4KLS A;  5HRD A;  4AT7 A;  5IIO A;  4RT3 A;  4NLZ A;  5J2I A;  2FMP A;  4XQ8 A;  4UB4 A;  4X4T A;  4RPX A;  3B0Y A;  4I2A A;  1JMS A;  9ICT A;  7ICP A;  9ICB A;  4QZ9 A;  3HIY A;  3AU2 A;  5J0P A;  4TUQ A;  1UET A;  1V4A A;  4M9H A;  7ICR A;  4O9M A;  1Q78 A;  3OVB A;  9ICW A;  4XQ7 A;  1TVA A;  1JAJ A;  3HJ4 A;  4E8F A;  5HRI A;  5J0Y A;  5DEC A;  3UXN A;  4IQT A;  5DED A;  4TUP A;  1ZQF A;  4P4P A;  4LT6 A;  4QZA A;  5DDM A;  4UBC A;  1ZQQ A;  8ICL A;  4P4M A;  3C5F A;  3H39 A;  4I2H A;  4M9J A;  1MIW A;  7ICL A;  4FHW A;  1NOM A;  4RWP A;  4PGX A;  2PFP A;  5D4B A;  4UB5 A;  1KDH A;  4NY8 A;  2ISO A;  9ICL A;  9ICS A;  9ICI A;  1KNY A;  5CP2 A;  8ICW A;  7ICS A;  1VFG A;  3TFS A;  4Z6F A;  2BE3 A;  1ZQX A;  4QZH A;  5DBB A;  3RH5 A;  9ICP A;  1FA0 A;  5BOL A;  9ICV A;  2PFN A;  2ZH6 A;  3H37 A;  5J0T A;  4X4U A;  4UB1 A;  4KLJ A;  2P66 A;  5J2D A;  8ICV A;  1KEJ A;  4FHP A;  4KLG A;  4S3N A;  7ICJ A;  4K4I A;  4XRH A;  7ICH A;  4RQ3 A;  4WC3 A;  4PHD A;  3C2L A;  3MDA A;  3LQC B;  4X5V A;  8ICQ A;  5J2C A;  1BPX A;  3ISD A;  3WFS C;  4WC4 A;  4JWN A;  5IIJ A;  8ICN A;  1ZQH A;  4I2D A;  4M04 A;  1ZQM A;  8ICZ A;  9ICO A;  7ICO A;  3AQL A;  4QZ8 A;  4E80 A;  1ZQW A;  1R8A A;  5HHI A;  5DKW A;  3AUO A;  2O1P A;  4DO9 A;  1ZQL A;  4AT9 B;  3AU6 A;  4I2B A;  5J29 A;  4NKT A;  1ZQJ A;  4EBJ A;  2NRK A;  3UQ2 A;  3WFO A;  5J0O A;  3OUY B;  3NYB A;  4WBZ A;  4TUR A;  5DBA A;  4NM1 A;  4WCW A;  4X4R A;  2ID1 A;  4AT8 A;  2PFO A;  2ZH1 A;  4I2F A;  4KLH A;  1NO5 A;  1Q79 A;  3OVA A;  1ZJM A;  4PPX A;  4I28 A;  4MFA A;  4TUS A;  2BPC A;  1XSP A;  3H3A A;  5J0X A;  2BPG A;  4I2E A;  4IQV A;  3C5G A;  4UAY A;  2IHM A;  1XSN A;  5HC9 A;  2DR8 A;  4YD2 A;  3JPN A;  1TV9 A;  1ZQP A;  4O5K A;  4YCX A;  3WFQ E;  5DB6 A;  2PBE A;  5CR0 A;  5DDY A;  1UEU A;  5IIM A;  2M2U A;  3WFR E;  1ZQS A;  4GXI A;  4QZE A;  4YMN A;  3GDX A;  2DR7 A;  4R63 A;  4KLQ A;  4EP7 A;  5J2K A;  3L9D A;  4KLO A;  2ZH5 A;  5DBC A;  4MF8 A;  8ICH A;  4F5O A;  1MIV A;  3LK9 A;  3JZ0 A;  1BPD A;  5HRL A;  4MF2 A;  4YMO A;  8ICY A;  2RFF A;  4RT2 A;  4IQU A;  4RPZ A;  3PMN A;  3JPQ A;  3JYY A;  2DRA A;  9ICQ A;  4M9G A;  5CB1 A;  3MGI A;  4R65 A;  7ICM A;  9ICC A;  2I9G A;  1F5A A;  4ATB B;  4X0A A;  3WFP A;  1ZQC A;  4FH3 A;  3JPP A;  4IQW A;  4WC2 A;  1BPZ A;  9ICX A;  9ICU A;  3C2M A;  4UAW A;  4NLK A;  4FH5 A;  1JN3 A;  1TFW A;  5DB8 A;  2ISP A;  4QZF A;  5IIN A;  4O5E A;  4M0A A;  8ICE A;  1PX5 A;  4QZG A;  5J2B A;  4PHP A;  4JWM A;  3RH6 A;  5IIK A;  5J2J A;  5BPC A;  4I2C A;  2W9M A;  5D46 A;  2BCS A;  4F5Q A;  1ZQY A;  3RJH A;  5HRE A;  1ZQB A;  1TFY A;  4PGY A;  5CHG A;  4WC0 A;  4M9L A;  5HR9 A;  4UD5 A;  2M2V A;  2VAN A;  4RQ0 A;  8ICX A;  1ZQN A;  4KLD A;  5J0R A;  3UXO A;  5J0Q A;  4QZB A;  1XSL A;  4GXJ A;  4RQ6 A;  5HRH A;  4R66 A;  5HRF A;  3ISB A;  3C2K A;  1RPL A;  4YMM A;  5CA7 A;  2GWS A;  3AQN A;  3C18 A;  3JPR A;  5J2G A;  5J0W A;  5BOM A;  4RWQ A;  3HJ1 A;  8ICB A;  3RJG A;  8ICS A;  2ZH2 A;  3JPT A;  4RQ5 A;  3B0X A;  4KLT A;  1HUZ A;  5CJ7 A;  7ICK A;  8ICM A;  1UEV A;  5J2F A;  1ZQA A;  3MBY A;  2DR5 A;  4PH5 A;  4FO6 A;  5J2H A;  3UXP A;  2ZH9 A;  4RQ1 A;  5DB9 A;  4MFC A;  1VJ7 A;  4LZG A;  7ICQ A;  4LVS A;  1ZQV A;  9ICA A;  4RWO A;  1ZQD A;  4RWN A;  1JQR A;  9ICF A;  1ZQK A;  4M47 A;  4X4V A;  2PFQ A;  4K4G A;  3RH4 A;  4K4H A;  7ICF A;  1OU5 A;  4XA5 A;  4FHV A;  4ATB A;  5J0U A;  4X4Q A;  5IIL A;  1ZQI A;  3HX0 A;  3RJK A;  2FMS A;  5TZV A;  4DOC A;  1MIY A;  1R8B A;  2HHP A;  5F2V O;  8ICA A;  4RQ7 A;  9ICR A;  3V7J A;  5J2E A;  2M2W A;  4DOB A;  1ZQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...