5F2VO

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to ampcpp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
184
Chain Sequence
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
total genus 59
structure length 184
sequence length 195
chains with identical sequence P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5f2vO02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5f2vO01
1RPLA 3ISDA 7ICKA 4KLOA 7ICSA 5HC9A 2PFQA 3AQNA 2DRAA 4KLMA 8ICLA 9ICOA 2O5AA 3UXOA 4RWPA 4UBBA 4Z6EA 2BCRA 3RJFA 3UXNA 4P4OA 2BPGA 2W9MA 4MF8A 2ISPA 5DDMA 4I2GA 4X0AA 8ICYA 8ICFA 4WC4A 2O1PA 9ICWA 4MFAA 5IIMA 3V7LA 4XQ8A 4UAZA 4Z6CA 4MFCA 4UD5A 1ZQHA 2PFPA 4EP7A 4YD2A 3AQMA 5CB1A 1ZQSA 1TFWA 4M9GA 3V72A 3B0XA 5J2BA 2VANA 4R64A 3V7KA 4QZ8A 4YMMA 3PNCA 4K4HA 7ICOA 4Z6FA 5DB7A 4PH5A 4QZAA 5HREA 3C2KA 3OVSA 3MDAA 2DR9A 4EBJA 5DDYA 4LZGA 4KLHA 4QZCA 4DO9A 5J29A 1ZQGA 1ZJNA 4IQVA 8ICMA 1WOTA 8ICBA 2ZH3A 9ICHA 7ICVA 3JPNA 1JAJA 5J2AA 3WFQE 4NXZA 4GXJA 4F5RA 1ZQUA 2BCVA 5DECA 3V7JA 5HRDA 4R66A 2BCUA 4LZDA 2FMPA 4S3NA 1ZQBA 1ZQQA 4KLSA 1ZQWA 3AQKA 3RJKA 9ICSA 3NYBA 1XSPA 7ICHA 5IILA 5EOZA 4E7XA 4P4MA 7ICIA 3OUYB 4X4SA 1RZTA 5J0OA 3HWTA 3WFOA 4WC3A 4O5KA 9ICIA 5CHGA 1BPBA 4QZIA 2ZH4A 2DRBA 4JWNA 8ICPA 1VJ7A 4TURA 4FHVA 1NOMA 9ICUA 4RQ1A 3JYYA 3JPSA 2DR5A 4K4IA 3HJ1A 1ZQPA 4P4PA 1ZQCA 1XSNA 1KEJA 7ICRA 2ZHAA 4IQWA 5CA7A 5DKWA 4XRHA 1F5AA 5TZVA 2ID1A 4AT7A 5J2IA 4M9LA 8ICRA 4UB3A 4YMNA 4UB5A 5DEDA 5J0RA 2ZH1A 4YMOA 8ICVA 3RH4A 2BPCA 2HHPA 4MFFA 3MGHA 8ICOA 5J2CA 8ICKA 5J0SA 1ZQYA 4NY8A 4KLJA 2BPFA 4M9HA 2ZH6A 4K4GA 4UB1A 9ICRA 3B0YA 8ICJA 3UXPA 5CP2A 1JQRA 4RWOA 1YLQA 5CWRA 7ICGA 2BE3A 2RFFA 4M0AA 5J2GA 2PFOA 2ZH2A 1ZQVA 4QZDA 4X4RA 3OVAA 5HRHA 1ZQAA 1HUOA 3HW8A 1ZQTA 1ZQIA 3C5FA 4MF2A 3LK9A 8ICCA 5HRGA 5J0PA 3ISCA 4TUPA 9ICGA 3WFPA 4DOCA 1V4AA 8ICHA 4WC7A 4XA5A 4O5EA 4DOBA 8ICAA 7ICJA 4AT8B 3C2MA 4LT6A 5HRFA 4PHEA 9ICBA 5HHIA 4UAYA 4F5PA 8ICTA 2NRKA 5J2HA 4IQTA 3OV7A 2ZHBA 4I2CA 3K75D 4IQUA 5DBCA 1MIVA 1ZJMA 4RQ7A 4I2HA 4RPYA 8ICNA 1MQ3A 1ZQOA 4I2EA 4AT9A 3L9DA 4WC1A 1JMSA 4QZEA 4QZBA 5HRKA 4I2IA 4TUSA 4RQ6A 1ZQJA 3JPOA 4RQ3A 5J0QA 8ICQA 4ATBA 2I9GA 4LVSA 1R8BA 4FHYA 3AUOA 4X4NA 5IIKA 4I2FA 2M2WA 4I27A 4UBCA 5DB6A 9ICVA 1R89A 4WC6A 2M2UA 5HRBA 4NLKA 5IINA 5DBAA 3TFSA 7ICFA 4KLLA 3C18A 5IIJA 2FMQA 4WC0A 2ZH5A 3MBYA 3OVBA 1MIYA 4UAWA 8ICUA 1ZQZA 4UB4A 3JPTA 4I2AA 5J0XA 4X4TA 9ICNA 4WC5A 3UQ2A 4PHDA 9ICXA 4UB2A 4RQ4A 4R65A 3LQCB 2ISOA 2DR7A 4QZ9A 1Q79A 4RWQA 7ICMA 9ICMA 4PGYA 3RJIA 1BPZA 4YCXA 4PPXA 1BPYA 4RWNA 4RQ8A 4IG8A 4NLNA 5DB9A 1UEVA 2PBEA 3RJJA 3TFRA 8ICEA 4QZHA 1VFGA 7ICPA 1UEUA 4I2DA 4KLUA 4F5NA 4RT2A 4PHAA 2PXIA 5HRLA 4RQ2A 2M2TA 3MDCA 3HJ4A 5D46A 4O5CA 4X4OA 4E8FA 8ICSA 1MQ2A 3C5GA 9ICFA 2ZH8A 9ICQA 5CR0A 4NM1A 4M47A 4XUSA 4P2HA 4WBYA 8ICWA 1ZQFA 4RQ5A 3JZ0A 5DB8A 1TFYA 4EBKA 5J0YA 4AT7B 9ICEA 9ICLA 4FHPA 4YN4A 4M9JA 4RPXA 4NKTA 1OU5A 4WCWA 3JPPA 4M5DA 3UPQA 4WBZA 1NO5A 1ZQXA 5J2DA 7ICUA 5CJ7A 5J0WA 8ICIA 1TVAA 4PHPA 3C66A 4GXKA 1UETA 3HX0A 9ICKA 3C2LA 1BPXA 3UQ0A 4X4VA 4M2YA 4NLZA 4FHXA 4RPZA 4FH5A 4X4PA 3OUYA 3PMNA 5D49A 1Q78A 3WFSC 4X5VA 3H37A 4YD1A 4FO6A 1ZQKA 1ZQLA 1ZQNA 3RJHA 1JN3A 7ICQA 3MGIA 2DVIA 4M04A 4Z6DA 3PMLA 4GXIA 4NM2A 1ZQRA 1XSLA 1TV9A 5BOMA 2ZH9A 3AU2A 5HHHA 5HRIA 1ZQMA 2DR8A 1ZQDA 4WC2A 2M2VA 4KLTA 5J2JA 1R8CA 5J0TA 4FH3A 5J2KA 3UPSA 4KLDA 4QZFA 1MIWA 9ICAA 1BPDA 3RJEA 4I28A 5BPCA 3ISBA 2P66A 4PGQA 4FHWA 4RT3A 4KLFA 1R8AA 4I2JA 3HIYA 2BCSA 5F2VO 2ZH7A 4I2BA 4X4UA 4DOAA 5J2FA 4E80A 8ICZA 2IHMA 5DBBA 4AT9B 4TUQA 4UD4A 4M9NA 3H38A 4PGXA 3H3AA 3H39A 5J2EA 1PX5A 5D4BA 2BCQA 7ICTA 3AQLA 5IIOA 1ZQEA 4O9MA 9ICTA 4KLQA 4NKUA 5BOLA 2FMSA 4ATBB 4QZGA 2GWSA 9ICPA 4R63A 1BPEA 5HR9A 4X0BA 4KLIA 1HUZA 1FA0A 5J0UA 9ICJA 4KLEA 4JWMA 3OGUA 2Q66A 3WFRE 3RJGA 4KLGA 5IIIA 7ICEA 8ICGA 3GDXA 7ICLA 3AU6A 3RH6A 1KNYA 4AT8A 4RQ0A 3JPQA 1KDHA 4F5OA 4XQ7A 7ICNA 4F5QA 3RH5A 9ICCA 2PFNA 4I29A 4X4QA 3JPRA 8ICXA
chains in the Genus database with same CATH superfamily
3CCEV 7ICKA 1K34A 3VQXA 4U3FH 3G71V 3A2FA 4FFBB 3ZHQA 2UUAB 4UFZA 2YICA 1XHZA 4JAUA 3K5OA 4MVOA 3X2QC 4KLMA 1HP8A 4YXWG 8ICLA 1W0JG 2FKXA 5LXTA 1I94B 4DV3O 4RWPA 1BZKA 3RJFA 4FZ0A 1FYJA 2N05A 1H8HG 4MF8A 2OYQA 1S72V 3ZRVA 3W7WA 2Z5UA 4OXSA 4GKJB 2PTMA 1OCCB 4RUEA 4WFEA 4ZI7B 4X64O 5HFMA 3E8HA 4K8ZA 4UD5A 4MS2A 2PZSA 2F43G 4MT8A 5CB1A 1QR9A 4DV1O 3V72A 5J2BA 1LUWA 4BW9A 3SPCA 4UVAA 4X1IA 2ODMA 5B3SC 4QZ8A 3PNCA 4Z6FA 2QWQB 4XDKA 4JI6B 5C8YA 3C2KA 4EBJA 5DDYA 3JCFA 3E89A 3OTOO 4QZCA 1SKVA 1O9GA 1Q8IA 5FNVB 1ZQGA 1ZJNA 2EZPA 4B3RO 2WA3A 3CCLV 4X9QA 3DC6A 5B1AC 2ZH3A 7ICVA 3JPNA 5CB4B 1BHBA 3T4ZA 1U97A 2LP7A 3THOA 5LHGA 4NXZA 1JFFB 2CE4A 2BCVA 1M56C 3DSQA 3CJHB 3Q4HB 3ZRSA 1ZQQA 2QM4A 2FB5A 4KLSA 2JEXA 3RJKA 2EX3A 4IIJB 5EK0A 4E7XA 4P4MA 4GKKO 1K4DC 1YZBA 3OUYB 4X4SA 1SA0B 4JI2O 5J0OA 4YJ3A 1YEWA 1PNLA 5CA3A 4FLVA 4U7OA 3HWTA 3WFOA 4WC3A 2LGWA 9ICIA 4DR4O 4ZHQB 5CHGA 3KCYA 1H2GA 1S5LZ 2DWEC 1FJGO 2DRBA 1SRYA 2CTQA 1K92A 1NTMH 1JX9A 1NOMA 3JPSA 2DYRC 1ZQPA 2X6BA 1KEJA 2QDOA 7ICRA 4IQWA 3VBBA 5CA7A 5BR8B 2IM9A 3CCMV 4XRHA 1F5AA 3ZHUA 2NR5A 3WG7B 4M9LA 2P22C 5KUMA 1VMGA 4LFCO 4NXNB 2EWRA 5DEDA 3ABUA 4EB6A 3E83A 3HKCA 4JAAA 2Z0AA 2BPCA 3ER9B 1X4TA 3JD0A 5JJNB 1NKDA 3G80A 4P9OA 3MGHA 2OIEA 1US6A 5D5QA 1Y74B 2ZINA 3K5MA 3F5TA 4O2AB 2BPFA 3HKEA 9ICRA 3B0YA 3FX7A 5KHHA 4RWOA 1EZJA 5JQGB 2BE3A 4J9ZB 1MABG 2E5LB 3A0HZ 4CH3A 2ZNIA 4K9AA 2Q68A 4K99A 4H13B 4UV8A 1J5EB 5HRHA 3AG2B 1Y67A 4RAIA 3FB5C 3HW8A 1ZQTA 4MF2A 3PN1A 4U3JA 4JYYA 4FZ1A 5CHEA 4UVBA 1K5QA 3ISCA 4TUPA 9ICGA 2HFEC 3ZN1A 3WFPA 1GN6A 4QPKA 2HP8A 1S77D 4XA5A 3C3SA 5IY5B 1IZ3A 8ICAA 3AG3B 2JRIA 3H1HH 1TVKA 2FCLA 1NBMG 1JFFA 4Z1VA 9ICBA 2BSKB 4F5PA 1PNKA 2H8PC 8ICTA 5H9CA 5TISZ 4I2CA 1R73A 4CS3A 3FYEB 4FJCC 5KA5A 1ZJMA 1VQLV 4K0KO 4DK0A 4RQ7A 2HN2A 4I2HA 5IJ9A 4EEQA 4RPYA 4JI0B 4X62O 1Q43A 2HKOA 1TAEA 4MTOA 1YJ9V 4AT9A 3OD4A 2DQ0A 4QIWF 3CCRV 1JMSA 4O6AA 4K8VA 4QZBA 4K8XA 4I2IA 4RQ6A 1Z2GA 2YIBA 1FKAO 1AJPA 3B2EE 3T2MA 1NH2D 1WA8A 4UCUA 4ATBA 4JI7B 1H2SB 4DV4O 3AUOA 1Y66A 5LOVB 4UBCA 1RP3B 1FXKA 2B56A 2UU9O 1Q81W 3IJ4A 2CTPA 4JI3O 2JJ2G 1OCRB 1H2LA 2EINC 5HRBA 1NVPB 5IINA 1SESA 1GN3A 3IGAC 1SQGA 4FLWA 2UXBO 4PDMA 2ZR2A 5IIJA 1WPXA 1YITV 3QTCA 4JYCA 4UAWA 2XAGA 4PHZA 1K5SA 4O2AA 4CS2A 4DR2O 1QU7A 3DXRA 3CC7V 2HVKC 5J0XA 2JS3A 3AG7A 4FM1A 9ICXA 4WFBV 3R65A 2YXYA 4JASA 2FMLA 5HFLA 1KMIZ 2Q0OC 4LF5B 2ARHA 3RJIA 4JI5B 4X66B 3W7SA 1NQTA 2HJFC 3ZHVA 1HR0O 3HPLC 4IG8A 1P4RA 3A8TA 1RM1B 3JALB 3RJJA 4QZHA 2DJVA 3BCCH 5JJEB 1Q6IA 4RO2A 2UUBO 4I5SA 4X20A 4RT2A 4OAHA 2HHHO 1P7BA 2JS5A 3T1CA 5J2TA 3ZMTA 3D3QA 3AG4C 1HNWB 3K5LA 2M2TA 3HJ4A 1N32B 4X4OA 2UXNA 4E8FA 8ICSA 1MQ2A 4LWSA 1IBLB 1ZLZA 4JI1B 9ICQA 3MCRA 4M47A 2Q7GA 5LGTA 4AHCA 4WOYA 3ZJZA 4P2HA 8ICWA 4KL1A 3JZ0A 2RMKB 4TV9B 5J0YA 3OR6C 2PUSA 4R8CA 1VIBA 4AT7B 9ICLA 4YN4A 3UO2A 4M9JA 4RPXA 3L75H 4WCWA 3JPPA 5KHKA 3UPQA 3P3NA 1OCCC 3LNMB 4HBNA 1XNQB 1H38A 5CJ7A 3VQWA 3H9VA 2VQEB 1Y76A 4B7EA 2MK3A 1FXHA 1W2BU 1VF5B 4M2YA 4KM5A 3ML0A 1Q6UA 4FHXA 3C90A 4RPZA 5IE9A 1LNQA 4X4PA 5KHJA 3PMNA 4D7TA 4QNHB 3ZIAG 3RJHA 1SQQH 7ICQA 4DV3B 3OEEG 1M5IA 2NN4A 1VQ9V 2V7QG 1NT2B 1DK1A 4EEBA 4DK1A 2F93B 3IFXA 1XSLA 4AQYO 4I50B 2EIMC 1FD9A 2DR8A 1ZQDA 3RYFB 4X1KB 3PHZA 2M2VA 4X64B 5J0TA 1KQSU 1AB3A 1YDXA 2PGGA 2QM7A 3ABLC 5BZBA 4DV1B 3FAVB 3EVKA 3JAWB 1V54C 4MVMA 2WLIB 3UM7A 5J2UB 2YXHA 5B1OA 4KLFA 3FYIB 4D6TH 2VWJA 1ZAUA 2DYSC 2KQXA 3HKBB 2FYUH 1ZTEA 4UB8Z 5J2FA 8ICZA 2Q67A 3CCJV 1OCZB 3OTOB 1R6KA 2RQ6A 1PX5A 3B8MA 5EZYA 4B3RB 4F4LA 1P49A 4NKUA 2FMSA 3QO7A 1FXKC 2A06H 1JJOA 1N33O 3L73H 2EILB 4X0BA 3WG7C 5BMVB 2WLHA 3SPHA 1HUZA 3JSNA 4Z1MG 1FA0A 3RW0A 4JWMA 1SQBH 2VQFO 5FLXN 4KLGA 4B3SO 7ICEA 2CH7B 4GKKB 3ZMVA 2QWPB 4QGPA 1ORQC 3SYOA 4JI2B 3ZMUA 4AT8A 5EYPB 3MAQA 1KDHA 4DR4B 4LEYA 3D36A 4K35A 4B3MO 1FJGB 2KSDA 9ICCA 5GONA 2PFNA 1B3QA 4I29A 1XOUA 1CXZB 3J81N 1RPLA 4KLOA 2L35A 4MTGA 2PFQA 1NZ6A 5LGNA 4O68A 2DRAA 5IJ0A 2FTKA 4PELA 3UXOA 1RFYA 4BIZA 3UXNA 2XASA 4P4OA 5L3CA 5LHIA 4LFCB 2OIGA 2V4DA 2H3OA 4OPAA 4I2GA 5CA1A 4OAGA 2R70A 2XHBA 9ICWA 4TWKA 4KFMA 4LNUA 5IIMA 1WJZA 4G2KA 4JTDB 4UAZA 3BAAA 1AP6A 2P5OA 4PDLA 1WB7A 3AQMA 1R3JC 4M9GA 4O4JA 1XHXA 3LDCA 3JAWA 1RSOA 1J95A 2HJDA 4K4HA 3RYCB 4DR3O 4EKWA 1VQKV 4PH5A 4QZAA 1JR9A 3JCZA 3RYIA 2OCCC 3MDAA 3DTUB 3HKBA 3OUSA 2KG7A 1BT8A 2ZNJA 2WLKA 4O4LA 2EIKC 4LP8A 4IQVA 4TV8A 2PF4E 4GUNA 3K03A 4EGWA 4RQFA 2GUZB 1WP7A 1RPRA 2GA9D 4QPJA 5J2AA 5GTIZ 4F5RA 3V7JA 1N4CA 2HLDG 3SGIA 2P90A 4WFAV 5IYCO 3KG2A 1KP2A 4W4KA 1LR1A 5BMVA 2Q7HA 1G8MA 4DXWA 4HNAA 1ZQWA 2X6AA 3NYBA 4JV5O 4TT3G 4WFHA 3K5NA 2ADPA 5EOZA 5IILA 4W4LA 4K0KB 4I55B 4FM2A 1TGOA 1K73W 4X62B 2CH7A 4TQDA 1EN4A 1ZX3A 4CC6A 1BPBA 4OGQB 4QZIA 2ZH4A 3CD6V 4JWNA 4KUMA 2P06A 3KCXA 1KP3A 4G27B 9ICUA 3OTFA 2YXLA 3JYYA 2DR5A 4K4IA 3HJ1A 4DV4B 1XL6A 3K0DA 1S0VA 1XSNA 3BEHA 2ZKOA 4GLXA 4Q20A 3D8CA 3D3IA 3OAAG 3CRCA 2UU9B 5KHGA 3CP1A 1Q90D 4JI3B 2ZDIA 8ICRA 2P67A 4UB3A 2Q6AA 4UB5A 2ITDC 4R7CA 4YMOA 1JJ2U 8ICVA 2UXBB 4LR3A 5JH7B 5LHHA 1IBMO 4CH5A 1BQ0A 8ICOA 5H6QA 1EZVH 3SJBC 3ABKB 2Q5ZA 3OFNG 4NY8A 2QWOB 2ZH6A 4UB1A 2F1MA 4DR2B 8ICJA 2JGDB 3OUFA 3U10A 3ABTA 5K1PA 1TUBB 1YXBA 3P30A 4LFAO 4M0AA 1IX9A 2AW9A 5D62A 5IYZA 3P32A 1HDJA 4DRXA 1VQ5V 3OVAA 1ZQAA 4X1YB 3K57A 2XAHA 3K0GA 1HR0B 1FFXB 1VF6A 3NWIA 1K4CC 5E1AC 5J0PA 4DV5O 3I55V 2JK5C 4DOCA 3O65A 1XDCA 2RCVA 3UT5A 5LBQA 1GAXA 4O5EA 5JJJB 2UUBB 3D36C 5IYBO 3R66A 2LGQA 2HHHB 4MVRA 4FLUA 1IBKO 3K08A 4PDVA 5JCOA 2AZ0A 4LT6A 2Z3YA 5HRFA 4PHEA 4MW3A 1KB9F 5J2HA 3OV7A 3OWGA 2C2AA 4LF9O 5C93A 3IAYA 4N7RA 3VOUA 2Q9LA 2ZE8A 1B06A 3S3WA 2Y4TA 3WFVA 4I55A 3RN4A 1MQ3A 4WC1A 4GX1A 2Y48A 2CAZC 5L3FA 2R9AA 5LP6A 2IJJA 2HN1A 3LDEA 2I9GA 2G38A 4BIUA 1VEWA 2EJRA 4CS4A 4X4NA 3OEHG 2M2WA 4FPPA 2XT9A 3OGCC 3H1JH 3VQYA 4I27A 4HZ3A 5GW7A 4NXVA 5DB6A 3ASNC 3RGBA 3ETQA 9ICVA 5CN0A 1R6NA 3I56V 4WC6A 1SETA 5LA6A 3CWBH 4JI4O 1F51A 3MDSA 5J9PC 3TFSA 4FO1A 2QJ1A 3C18A 4J42A 4UXNA 4WC0A 2QR4A 1M57B 3OVBA 1MIYA 8ICUA 5JH7A 3RBZA 2ATKC 1H2MA 1OV9A 3T1YO 5KMGB 4I2AA 4FFBA 3AG1C 9ICNA 1G6UA 3BA8A 4AQYB 2PI5A 5B1BB 4JLXA 2LQTA 2O57A 1K8AW 1TUBA 3CC4V 4R65A 1FAFA 4I7ZB 4JTAB 4QZ9A 1Q79A 1ROPA 4F6RB 3WB0A 4RWQA 4ABMA 3L70H 1KD1W 2WLLB 3CC2V 4PGYA 1IVSA 4YCXA 1QCEA 1SQXH 3JATB 2GBOA 2UXDO 3QNEA 1MNGA 5CFUA 4X1YA 4RQ8A 2F95B 1QLEB 3RVYA 1YSCA 3N27A 7ICPA 4UCOA 4ZI7A 4I2DA 3TXSA 4KLUA 2WAMA 1QR8A 2X7RB 4RQ2A 3MDCA 3E22B 1NH2B 3W7UA 3MD0A 2ZM6O 4O5CA 2ZXWB 5CBFA 1SERA 1Y6XA 2ZH8A 2ZE5A 1DGSA 2WLNA 1N33B 3ETGA 1ZQFA 5DB8A 1GH6A 2ZDIC 4EBKA 3CX5F 3N2GB 1IURA 3BA9A 5FNVA 1XMQO 1W59A 2GSMB 3ZRXA 1OU5A 3OE7G 2VQFB 1V55C 3CRRA 2Q7EA 4B3SB 5CB4A 3MHHC 4IYIA 5J2DA 7ICUA 3PJSK 8ICIA 3BHPA 1PM9A 2Y69C 3UKMA 3CJHA 3C66A 4GXKA 3G4SV 4TQFA 3HX0A 2GHYA 4B3MB 4H33A 3Q4HA 3LUTB 4UB6Z 3C2LA 2YEVB 1OCOC 2NNUA 4PA4A 5JVDB 3MHSC 1R3LC 4IIJA 3JASB 1W0KG 1BS3A 2CK3G 3ZHRA 1Q7YW 4J10A 4I9QA 1SA0A 3OUYA 1QVGU 5D49A 3ERCC 5LGUA 1Q78A 3CCQV 3STZC 2QEXV 3B09A 1PL4A 2PY5A 4ZHQA 1PP9H 3JAKB 4J7KA 1ZQLA 3CYOA 4K96A 1KYOF 1VF6C 1ENVA 3ETDA 2DVIA 4M04A 3PMLA 3E2EA 3NKUA 4GXIA 4NM2A 4NTWA 2JJ1G 4O67A 3T4DA 5ITZB 2CTWA 1TV9A 2ETNA 5BOMA 1YI2V 3AU2A 5HHHA 1BL8A 5JCOC 4DV7O 1MMMA 1GMGA 1WAZA 2ZT9B 2IJIA 4P30A 3WB1A 4WQLA 5J2KA 3JD2A 4LF6O 5KX5B 1MIWA 4CBCA 3RJEA 4I28A 2CGOA 3JATA 3ZRWB 5BPCA 3ISBA 3K9SA 2M6YA 5CA0B 4FHWA 4RT3A 1E1QG 3NR7A 1R8AA 4DR3B 3HIYA 2BCSA 1AROP 1Y74A 1BCCH 2QWNB 1LUVA 3U11A 5F2VO 4F6EA 2IHMA 5LP6C 1AI5A 5LYJB 3E35A 2ITCC 3H38A 4PGXA 5JQGA 2BCQA 3A0BZ 2YS8A 3CRAA 4QE7A 4PI2A 4ZIBA 2OWOA 4MTXA 1GM8A 5L3EA 9ICPA 2HR3A 4R63A 4O4IB 5HR9A 4KLIA 4HAMA 1URFA 2YC0A 4L8JA 3OMAB 3OGUA 4JV5B 5IIIA 2NLJC 2Q73A 1WPBA 2YDEA 3AU6A 4DUYO 4RQ0A 3RYHB 3DGEA 3TCUA 3K3WA 1N34O 4XQ7A 2BSKA 4F5QA 7ICNA 4J7JA 1IXBA 1YHQV 2IU3A 2YEVA 1IDSA 3F7YC 2EJ7A 5HC9A 4OAIZ 1YIJV 3JASA 4ZOLB 4EFEA 4WF9V 4E4EA 4BW5A 2BBHA 4LC1A 3SR2C 4LF8O 3X2QB 1THZA 4KP4A 2W9MA 2XAJA 3SYPA 5DDMA 4X0AA 4R50A 1AJQA 4FLXA 8ICFA 4WC4A 3HR0A 5ITZA 2O1PA 5LOVA 3JYCA 1VQOV 1IBMB 2DN9A 2LFSA 4MFAA 3V7LA 4XQ8A 2QKSA 4IYHA 4Z6CA 2OTJV 1ZQHA 2PFPA 1JA8A 5B5EZ 1R3KC 2XTAA 2GV9A 1TFWA 1KECA 1XNRO 3M7MX 2W6IG 2CUGA 5KX5A 5LL6Y 5KHIA 4LFAB 2KKWA 4R64A 2DOSA 3V7KA 4YMMA 3H01A 2BCCH 4IHJB 1VQ8V 2ZIOA 4AI8A 4DW0A 2CDYA 1L0NH 4J9YB 3OVSA 3B8NA 1AI7A 2EIJB 2V1DA 4KLHA 3K04A 4FFKA 5J29A 1XREA 1BSMA 4DV5B 1S5JA 2QWRB 4LF7O 3IC9A 1AP5A 4I4TB 1WOTA 8ICBA 9ICHA 5A9GA 1GPJA 1GN4A 3ABMB 1KKCA 2QSAA 3WFQE 1VQMV 3GWOA 4Q6GA 1IBKB 5DECA 5B1AB 4MW8A 3K59A 2Y4UA 1JVMA 3WB2A 1COWG 3LSUA 4UCVA 4O4IA 4ICGA 2FMPA 4MTFA 4J41A 1ZQBA 4DUZO 1K7DA 3SPGA 3JALA 4LF9B 3CHXA 4OX9O 5IWAO 2MW2B 4L87A 3ZX6A 1K33A 1NJIW 4FM0A 2YIDA 5EBWC 1K97A 1VF7A 1D2DA 4O5KA 1KU9A 4PA9A 4U7NA 4I0XB 1KC8W 2Q4PA 8ICPA 1B04A 4MVSA 2A9HA 4LEVA 1ZQCA 1F4MA 3FFQA 1OJHA 4JTCB 3CS5A 4TV9A 2RN9A 2ZHAA 3CRQA 2RJZA 2DYRB 4WH5A 4O2BB 5FL7G 4AT7A 5TZVA 5J2IA 4WFFA 2E75B 2AGAA 1PPJH 1VQPV 3OMNB 1N0JA 1PNMA 1XUQA 4JI4B 2WPDG 4OAFA 2BTQB 1OHHG 1EN5A 3AK1A 4YIOA 4AILC 3H1LH 3ZBHA 2YI9A 1KUQA 2Y0IA 4DR5O 3BABA 3SJQC 3BY6A 2K1EA 4PDRA 1GM9A 5J0SA 2JDIG 1CPYA 4UV9A 3EXAA 1JQRA 1GO3F 3S3XA 4B7KA 3T1YB 2EBOA 1ZL8B 1YLQA 5D63A 3CMEV 2RFFA 3AG2C 5J2GA 2PFOA 1QNMA 1K3EA 2ZIMA 5CFSA 2BTOA 2EZOA 1DLBA 2ZH2A 4QZDA 3U0ZA 3HKDB 3E86A 1HUOA 2CTRA 3N2KB 2UXCO 1ZQIA 3ZMZA 2UXDB 2JGUA 2OCHA 2ADQB 2XUMA 8ICCA 4XBFA 5IY5C 4I50A 1FPOA 3AG3C 1AR5A 1TA8A 3TK1A 2AZ2A 3RYFA 4X1KA 8ICHA 1MZFA 2D2CB 1L8DA 1S5HC 4DOBA 4H37A 3VQVA 1P7GA 1JCHA 3SPJA 4TUYB 2B1IA 4EFBA 3FAVA 2WLIA 2B9ZA 5HHIA 1L0LH 5J2UA 2NRKA 4IQTA 2ZHBA 2ZQMA 1QVFU 3K75D 1Q86W 5DBCA 4PD4F 4B3TO 1MIVA 5EC2C 1WP8A 1Y4MA 1GKFA 1GN2A 4I2EA 1ZSPA 4C7UA 4HYOA 4QZEA 3KKYA 4TUSA 4KB6A 1XL4A 4CZZA 4JZ2A 1ZQJA 3W7XA 3JPOA 4MSWC 4RQ3A 5J0QA 1WN7A 2AHYA 1R8BA 4DV2O 4FHYA 2Q0AA 2YUAA 3QO5A 3KZIZ 4I2FA 1OCRC 3WU2Z 3OMIB 4UCSA 4FLZA 3FB8C 2M2UA 1A32A 4O2BA 4DV0O 3EFFK 4NLKA 3ZHSA 2F23A 2PYLA 4H0LB 1FS0G 1YJNV 4X1IB 1O9HA 4BWAA 4KLLA 4DYLA 4LCUC 1R6TA 2BTQA 5EYPA 2FMQA 5IT9N 4JF3A 3MBYA 4DV6O 2LO1A 3M8AA 3TXQA 1ZQZA 4UB4A 3SDLA 4K9BA 3JPTA 4EV6A 4K97A 5CMUA 3RWRD 4WC5A 1ZL8A 2IU0A 4PHDA 3CPWU 3ZCCA 4UB2A 1QLNA 2UXXA 4DV7B 4NKGB 1RPOA 1XEQA 1QQCA 2ISOA 1RM1C 9ICMA 2VWKA 2Q69A 5D61A 4LF6B 1BPZA 1DF4A 4PPXA 4LBEC 3ZHTA 2IJHA 3ZS8C 4RWNA 3TGUH 4NLNA 1Q3EA 2DQ3A 1UEVA 1JMKC 2IH3C 3TFRA 8ICEA 2K9PA 1GRJA 1UEUA 5B66Z 2XAQA 4F5NA 1EM1A 4PHAA 2PXIA 4YJ3B 1CEZA 2A79B 4LEZA 4WFGA 4FLYA 5HRLA 4X88A 4YIPA 1YVWA 5EIBC 5KAIZ 3FKSG 3AG4B 2LFRA 1H2KA 9ICFA 2JVDA 3RYCA 3M99B 5CR0A 3J7AU 5DN6G 3LSSA 4P2ZA 3SYCA 4WBYA 1TFYA 3T1HO 4FK5C 3FB7C 2A7WA 4CC5A 1FFTB 5FPOA 1TUEB 5B3PA 3CXHF 1R1BA 4RQEA 2GUZA 4KHPO 4EB6B 4WBZA 1NO5A 3HKCB 4DUYB 5J0WA 1TVAA 4R6ZA 4PHPA 2PYJA 2OT5A 4NVPA 9ICKA 1N34B 4YY3O 2B1GA 1BPXA 2DMXA 2LJ2A 4IT5A 4X8AA 2IH1C 3UCSC 4NYKA 3HKEB 3W7TA 4NLZA 2PI4A 3WFSC 4X5VA 4YD1A 1B6QA 1SZTA 2XOKG 2P4KA 1VP7A 3APOA 1WNSA 1PKXA 1XILA 2EIJC 4LF8B 4LFBO 1SS3A 3OW2U 1IXMA 3JARB 4XDJA 1VQ7V 1ZQRA 4X89A 4U3JB 5A2QN 4OPHA 1YTFB 2ZH9A 3CRMA 2IBZH 2QKCA 5EBLC 5HRIA 1ZQMA 3TJTA 1KBHA 3ABMC 2F4VO 4WC2A 4JPRA 1GK9A 5J2JA 2EIMB 4FH3A 3UPSA 1E79G 4KLDA 4J7ZA 1HNXO 4DR7O 4P9PA 1XNRB 1TVKB 9ICAA 5KAFZ 1M9NA 3K58A 3ABLB 4PGQA 4I2JA 1V54B 1OCZC 4QE9A 1WLEA 5IJ9B 4I2BA 4X4UA 1MG1A 4E80A 1EBOA 1ZWIC 3QF7A 4AT9B 2DYSB 2JGDA 4JYAO 2JIZG 4M9NA 4FIPC 3L71H 3H3AA 1S76D 2VS0A 7ICTA 4LF7B 2QE7G 5IIOA 1XQ8A 1ZQEA 4O9MA 1WA8B 5H6RA 4KLQA 2EILC 3QG5A 5BOLA 1PD3A 4NR1A 4ATBB 3JD1A 2GWSA 5AG2A 1MA1A 1N36O 3FD9A 1BPEA 4PI0A 3CSXA 1FFXA 1FXKB 3NXSA 4N21A 1XMOO 2IHOA 5J0UA 3RFRA 4DUZB 1YTFD 1P84F 2QKAA 4O69A 4OX9B 5IWAB 4FMTA 1HW7A 2QGNA 1BQZA 8ICGA 7ICLA 4JGSA 4GX2A 3RH6A 5LMNO 4GZRB 1G4YB 4NB5A 1EN6A 4YHHO 4YJ2B 4F5OA 1I0HA 2R9IA 4X65O 1NTKH 1I5YA 2LW7A 4JI8O 3ASOB 4X4QA 8ICXA 3DXRB 3ISDA 4DR1O 7ICSA 3L74H 1DF5A 1JPXA 4B08A 4NXMO 3AQNA 4UCTA 1YJWV 5KLVH 9ICOA 2O5AA 3AEIA 4UBBA 4GT1A 3BRCA 4Z6EA 2BCRA 2YIBD 1SF9A 2BPGA 4O4HB 2ISPA 3JARA 2XNDG 8ICYA 1PV0A 4DW1A 1MSDA 4UUJC 1NR1A 2P4VA 2R9RB 2M7WA 4DR5B 4X20B 3STLC 4MFCA 4GYCB 5J2TB 4EP7A 4YD2A 1ZQSA 5B1NA 3B0XA 1U96A 2VANA 5JWPA 3BVOA 4K98A 3I5DA 1PL0A 4LWSB 7ICOA 1AI6A 3E8BA 4FVMA 5DB7A 2GAFD 3H1IH 3LSQA 1NI8A 2GDSA 5CBGA 1YCIA 5HREA 2DR9A 2UXCB 4N23A 5FPRA 4LZGA 5KMGA 2E3CA 2OTLV 5E79Z 2E76B 4DO9A 4DO2A 2OCCB 5EBMC 8ICMA 1NS1A 1GM7A 2EIKB 1JAJA 3CE2A 4ZBMA 4F6RA 4NTXA 3ZMSA 4GXJA 3L72H 2WLLA 1ZQUA 3JCUZ 5HRDA 4R66A 5LMUO 3ICXA 4DR6O 2BCUA 4LZDA 1Y76B 4S3NA 1V9PA 1BMFG 1N8RW 3AQKA 9ICSA 4ASUG 1XSPA 7ICHA 4ZKIA 4B3TB 1NU1H 2LW1A 2X6CA 3EF2A 2UUCO 7ICIA 1HNZO 4CH6A 1VQ6V 1RZTA 3CCSV 4IL6Z 4LF4O 1MOFA 3E22A 2IJKA 3E8GA 4YJ2A 1M4UA 4TOIA 3F5WC 3F7VC 1F4NA 1VJ7A 4TURA 4FHVA 4RQ1A 1VARA 4DV2B 2UUAO 2GTAA 3ZN0A 3CXCU 2ZCEA 3JD3A 4P4PA 3N2GA 5CFTA 5DKWA 1I94O 4BAYA 2ID1A 1FXVA 2A0LA 3JSLA 2CGNA 4BIOA 1DTOA 4DV0B 4LH7A 4YMNA 4Z2WA 5KA6A 4GKJO 5J0RA 2ZH1A 4O4HA 3ABKC 3RH4A 2HHPA 4MFFA 3SYQA 4K3AA 2P6JA 5IYDO 5J2CA 4DV6B 8ICKA 5JVDA 1ZQYA 4KLJA 3B77A 4M9HA 2WSSG 2ZE7A 4K4GA 3UO3A 2B51A 3UXPA 5CP2A 4PA7A 5DM6V 5CWRA 3CB2A 7ICGA 5EZYB 1I7FA 1NVPD 3JD4A 3LNNA 2YI8A 3JAKA 1ZQVA 2W6JG 4JI6O 4X4RA 1Z5VA 3TETA 3BPZA 1SQFA 2XAFA 3GB7C 1N0NA 3C5FA 2YIAA 5GTHZ 1UPGA 3LK9A 5HRGA 4H44B 3FB6C 1V4AA 4WC7A 7ICJA 4AT8B 3C2MA 3SPIA 2B5UA 4UAYA 4RUFA 2EULA 3ZRWA 5GONB 5CA0A 4IQUA 4IGGA 5B3SB 1T5EA 5KUKA 2DW4A 3B40A 3QO8A 8ICNA 3RVZA 3T1HB 5K1XA 5LYJA 5IJ0B 1ZQOA 1M90W 3L9DA 1NR7A 4KXRA 2BBJA 4G28B 2D3OW 4GCZA 5HRKA 3E8FA 4TSFG 8ICQA 4KHPB 4LVSA 4J11A 5CA1B 5IIKA 5EIBD 3A0RA 4BR6A 4LNUB 5IDJA 5BR8O 1M56B 4PV1B 4YY3B 3G6BA 5JTGA 1R89A 4NTYA 2WWWA 4NXNO 4EEDA 1Z5WA 4O4JB 5L3DA 3ASNB 4GX5A 1I08A 5DBAA 1M57C 2AXTZ 7ICFA 3OM3B 1XBLA 1RSOB 1I5XA 4MVZA 1X59A 3CCVV 3RYHA 4NXTA 1BHAA 3BFRA 2ZH5A 4JAVA 4LH6A 1BE3H 2RNBA 3RYIB 2A3QA 5B1BC 4LFBB 1QBZA 3K7DA 4UVCA 2KG7B 4O4LB 4WCEV 2BOCC 4QJFB 1YF2A 4X4TA 3H1KH 4I9WA 4TV8B 2JEUA 3UQ2A 4ZOLA 3RT3C 4GX0A 2E5LO 1AR4A 1QHTA 4RQ4A 2F4VB 3LQCB 4MVUA 3AG1B 2DR7A 1WB8A 1J5EO 3HB3B 7ICMA 1VQ4V 1QLEC 3ETEA 1D5NA 4WBNB 1HNXB 4DR7B 2WLMA 3IC7A 4J80A 1VQNV 2HEPA 4XJEA 1BPYA 1F23A 3O9OA 4XDLA 2ILMA 5DB9A 3ER8C 3GWKC 4HNAB 5H5NA 2PBEA 1M93A 5CBHA 1VFGA 4I0UA 1K9MW 2QTOA 2X0LA 2ZXWC 4NXUA 2DE0X 3GVMA 5BXZA 4JYAB 5D46A 3ASOC 3J80N 4NXXA 1JQ0A 5H2FZ 1JOYA 3CMAV 2VRZA 2QTSA 1SC5B 3C5GA 2IUBA 4IHJA 4NM1A 4XUSA 2P7TC 4D7SA 4JI0O 1HWYA 1N36B 4RQ5A 3CEIA 2ZD9A 1SQVH 2H94A 1XMOB 9ICEA 4FHPA 2RDCA 4NKTA 2WA4A 5B3QA 4I4TA 2L6LA 3EHBB 2E74B 4M5DA 4JI7O 1ZQXA 1Q6HA 1EFRG 5LMNB 1V55B 4FLTA 1UJWB 4YHHB 4PA6A 2ZM6B 2F66C 1UETA 1MZEA 4X65B 2W0FC 3DC5A 4RWUA 4JI8B 3OT7A 4PA3A 4LEWA 3UQ0A 4X4VA 2Y69B 3NVOA 1AR1B 5L3BA 2BOBC 2HVJC 3CCUV 3APQA 1G1XB 1AJNA 4DR1B 3SJCC 4FH5A 5EC1C 1OCOB 2HG5C 4JLZA 3SYAA 4NXMB 3K79A 1R3IC 5IYZB 2AHZA 5LXTB 3H37A 4DRXB 4FO6A 1Q5OA 4JYBA 1KKDA 1XMQB 1ZQNA 1ZQKA 1JN3A 2ZE6A 5L3GA 4I0XA 3MGIA 3LDDA 4Z6DA 3UQ8A 1L1FA 3JAMN 2WLJA 1CP9A 1GTOA 3CK6A 3K9AA 2IW5A 3UT5B 3AK2A 2ZR3A 4KLTA 2QA4V 1SZXA 1AILA 4LF5O 1R8CA 3AK3A 1H2NA 4JI5O 4X66O 4QZFA 3G67A 5BY1A 3QVNA 2EINB 4E2LA 1BPDA 1ZUQA 4WBNA 4A5UB 1D5AA 2P66A 3K06A 3SJAC 1M1KW 5C8YB 2ZH7A 3P3PA 2Q8VA 4DOAA 1SQPH 4MKPA 5DBBA 1HNWO 4TUQA 2DWDC 1H8EG 4HX0A 4UD4A 1XI1A 3H39A 1NTZH 3ZEDA 2FL4A 1N32O 2YSUB 5J2EA 5D4BA 5LP6B 3AQLA 1IBLO 1OZ0A 9ICTA 4JI1O 1BGYH 5D5PA 4QZGA 2KB1A 2W0XA 3HKDA 1S3JA 2Y0PA 1AVMA 3N2KA 5LMUB 4DR6B 2N74A 2R72A 4UCRA 2GTSA 4CH4A 4JZGA 9ICJA 4KLEA 5LA6B 2Q66A 2B4VA 3RJGA 3WFRE 2UUCB 1UFIA 3GDXA 1HNZB 1XNQO 3B4SA 1KNYA 4LF4B 2QM8A 4TUYA 4WQKA 4MVQA 3JPQA 3G6EV 2VQEO 3OR7C 3C3TA 3OGIB 1AI4A 1MSWD 3RH5A 2N04A 4NXWA 1F7YA 1E1RG 1Q82W 3JPRA 4PJ0Z
chains in the Genus database with same CATH topology
1RPLA 3ISDA 7ICKA 4KLOA 7ICSA 5HC9A 2PFQA 3AQNA 2DRAA 4KLMA 8ICLA 9ICOA 2O5AA 3UXOA 4RWPA 4UBBA 4Z6EA 2BCRA 3RJFA 3UXNA 4P4OA 2BPGA 2W9MA 4MF8A 2ISPA 5DDMA 4I2GA 4X0AA 8ICYA 8ICFA 4WC4A 2O1PA 9ICWA 4MFAA 5IIMA 3V7LA 4XQ8A 4UAZA 4Z6CA 4MFCA 4UD5A 1ZQHA 2PFPA 4EP7A 4YD2A 3AQMA 5CB1A 1ZQSA 1TFWA 4M9GA 3V72A 3B0XA 5J2BA 2VANA 4R64A 3V7KA 4QZ8A 4YMMA 3PNCA 4K4HA 7ICOA 4Z6FA 5DB7A 4PH5A 4QZAA 5HREA 3C2KA 3OVSA 3MDAA 2DR9A 4EBJA 5DDYA 4LZGA 4KLHA 4QZCA 4DO9A 5J29A 1ZQGA 1ZJNA 4IQVA 8ICMA 1WOTA 8ICBA 2ZH3A 9ICHA 7ICVA 3JPNA 1JAJA 5J2AA 3WFQE 4NXZA 4GXJA 4F5RA 1ZQUA 2BCVA 5DECA 3V7JA 5HRDA 4R66A 2BCUA 4LZDA 2FMPA 4S3NA 1ZQBA 1ZQQA 4KLSA 1ZQWA 3AQKA 3RJKA 9ICSA 3NYBA 1XSPA 7ICHA 5IILA 5EOZA 4E7XA 4P4MA 7ICIA 3OUYB 4X4SA 1RZTA 5J0OA 3HWTA 3WFOA 4WC3A 4O5KA 9ICIA 5CHGA 1BPBA 4QZIA 2ZH4A 2DRBA 4JWNA 8ICPA 1VJ7A 4TURA 4FHVA 1NOMA 9ICUA 4RQ1A 3JYYA 3JPSA 2DR5A 4K4IA 3HJ1A 1ZQPA 4P4PA 1ZQCA 1XSNA 1KEJA 7ICRA 2ZHAA 4IQWA 5CA7A 5DKWA 4XRHA 1F5AA 5TZVA 2ID1A 4AT7A 5J2IA 4M9LA 8ICRA 4UB3A 4YMNA 4UB5A 5DEDA 5J0RA 2ZH1A 4YMOA 8ICVA 3RH4A 2BPCA 2HHPA 4MFFA 3MGHA 8ICOA 5J2CA 8ICKA 5J0SA 1ZQYA 4NY8A 4KLJA 2BPFA 4M9HA 2ZH6A 4K4GA 4UB1A 9ICRA 3B0YA 8ICJA 3UXPA 5CP2A 1JQRA 4RWOA 1YLQA 5CWRA 7ICGA 2BE3A 2RFFA 4M0AA 5J2GA 2PFOA 2ZH2A 1ZQVA 4QZDA 4X4RA 3OVAA 5HRHA 1ZQAA 1HUOA 3HW8A 1ZQTA 1ZQIA 3C5FA 4MF2A 3LK9A 8ICCA 5HRGA 5J0PA 3ISCA 4TUPA 9ICGA 3WFPA 4DOCA 1V4AA 8ICHA 4WC7A 4XA5A 4O5EA 4DOBA 8ICAA 7ICJA 4AT8B 3C2MA 4LT6A 5HRFA 4PHEA 9ICBA 5HHIA 4UAYA 4F5PA 8ICTA 2NRKA 5J2HA 4IQTA 3OV7A 2ZHBA 4I2CA 3K75D 4IQUA 5DBCA 1MIVA 1ZJMA 4RQ7A 4I2HA 4RPYA 8ICNA 1MQ3A 1ZQOA 4I2EA 4AT9A 3L9DA 4WC1A 1JMSA 4QZEA 4QZBA 5HRKA 4I2IA 4TUSA 4RQ6A 1ZQJA 3JPOA 4RQ3A 5J0QA 8ICQA 4ATBA 2I9GA 4LVSA 1R8BA 4FHYA 3AUOA 4X4NA 5IIKA 4I2FA 2M2WA 4I27A 4UBCA 5DB6A 9ICVA 1R89A 4WC6A 2M2UA 5HRBA 4NLKA 5IINA 5DBAA 3TFSA 7ICFA 4KLLA 3C18A 5IIJA 2FMQA 4WC0A 2ZH5A 3MBYA 3OVBA 1MIYA 4UAWA 8ICUA 1ZQZA 4UB4A 3JPTA 4I2AA 5J0XA 4X4TA 9ICNA 4WC5A 3UQ2A 4PHDA 9ICXA 4UB2A 4RQ4A 4R65A 3LQCB 2ISOA 2DR7A 4QZ9A 1Q79A 4RWQA 7ICMA 9ICMA 4PGYA 3RJIA 1BPZA 4YCXA 4PPXA 1BPYA 4RWNA 4RQ8A 4IG8A 4NLNA 5DB9A 1UEVA 2PBEA 3RJJA 3TFRA 8ICEA 4QZHA 1VFGA 7ICPA 1UEUA 4I2DA 4KLUA 4F5NA 4RT2A 4PHAA 2PXIA 5HRLA 4RQ2A 2M2TA 3MDCA 3HJ4A 5D46A 4O5CA 4X4OA 4E8FA 8ICSA 1MQ2A 3C5GA 9ICFA 2ZH8A 9ICQA 5CR0A 4NM1A 4M47A 4XUSA 4P2HA 4WBYA 8ICWA 1ZQFA 4RQ5A 3JZ0A 5DB8A 1TFYA 4EBKA 5J0YA 4AT7B 9ICEA 9ICLA 4FHPA 4YN4A 4M9JA 4RPXA 4NKTA 1OU5A 4WCWA 3JPPA 4M5DA 3UPQA 4WBZA 1NO5A 1ZQXA 5J2DA 7ICUA 5CJ7A 5J0WA 8ICIA 1TVAA 4PHPA 3C66A 4GXKA 1UETA 3HX0A 9ICKA 3C2LA 1BPXA 3UQ0A 4X4VA 4M2YA 4NLZA 4FHXA 4RPZA 4FH5A 4X4PA 3OUYA 3PMNA 5D49A 1Q78A 3WFSC 4X5VA 3H37A 4YD1A 4FO6A 1ZQKA 1ZQLA 1ZQNA 3RJHA 1JN3A 7ICQA 3MGIA 2DVIA 4M04A 4Z6DA 3PMLA 4GXIA 4NM2A 1ZQRA 1XSLA 1TV9A 5BOMA 2ZH9A 3AU2A 5HHHA 5HRIA 1ZQMA 2DR8A 1ZQDA 4WC2A 2M2VA 4KLTA 5J2JA 1R8CA 5J0TA 4FH3A 5J2KA 3UPSA 4KLDA 4QZFA 1MIWA 9ICAA 1BPDA 3RJEA 4I28A 5BPCA 3ISBA 2P66A 4PGQA 4FHWA 4RT3A 4KLFA 1R8AA 4I2JA 3HIYA 2BCSA 5F2VO 2ZH7A 4I2BA 4X4UA 4DOAA 5J2FA 4E80A 8ICZA 2IHMA 5DBBA 4AT9B 4TUQA 4UD4A 4M9NA 3H38A 4PGXA 3H3AA 3H39A 5J2EA 1PX5A 5D4BA 2BCQA 7ICTA 3AQLA 5IIOA 1ZQEA 4O9MA 9ICTA 4KLQA 4NKUA 5BOLA 2FMSA 4ATBB 4QZGA 2GWSA 9ICPA 4R63A 1BPEA 5HR9A 4X0BA 4KLIA 1HUZA 1FA0A 5J0UA 9ICJA 4KLEA 4JWMA 3OGUA 2Q66A 3WFRE 3RJGA 4KLGA 5IIIA 7ICEA 8ICGA 3GDXA 7ICLA 3AU6A 3RH6A 1KNYA 4AT8A 4RQ0A 3JPQA 1KDHA 4F5OA 4XQ7A 7ICNA 4F5QA 3RH5A 9ICCA 2PFNA 4I29A 4X4QA 3JPRA 8ICXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RPL A;  3ISD A;  7ICK A;  4KLO A;  7ICS A;  5HC9 A;  2PFQ A;  3AQN A;  2DRA A;  4KLM A;  8ICL A;  9ICO A;  2O5A A;  3UXO A;  4RWP A;  4UBB A;  4Z6E A;  2BCR A;  3RJF A;  3UXN A;  4P4O A;  2BPG A;  2W9M A;  4MF8 A;  2ISP A;  5DDM A;  4I2G A;  4X0A A;  8ICY A;  8ICF A;  4WC4 A;  2O1P A;  9ICW A;  4MFA A;  5IIM A;  3V7L A;  4XQ8 A;  4UAZ A;  4Z6C A;  4MFC A;  4UD5 A;  1ZQH A;  2PFP A;  4EP7 A;  4YD2 A;  3AQM A;  5CB1 A;  1ZQS A;  1TFW A;  4M9G A;  3V72 A;  3B0X A;  5J2B A;  2VAN A;  4R64 A;  3V7K A;  4QZ8 A;  4YMM A;  3PNC A;  4K4H A;  7ICO A;  4Z6F A;  5DB7 A;  4PH5 A;  4QZA A;  5HRE A;  3C2K A;  3OVS A;  3MDA A;  2DR9 A;  4EBJ A;  5DDY A;  4LZG A;  4KLH A;  4QZC A;  4DO9 A;  5J29 A;  1ZQG A;  1ZJN A;  4IQV A;  8ICM A;  1WOT A;  8ICB A;  2ZH3 A;  9ICH A;  7ICV A;  3JPN A;  1JAJ A;  5J2A A;  3WFQ E;  4NXZ A;  4GXJ A;  4F5R A;  1ZQU A;  2BCV A;  5DEC A;  3V7J A;  5HRD A;  4R66 A;  2BCU A;  4LZD A;  2FMP A;  4S3N A;  1ZQB A;  1ZQQ A;  4KLS A;  1ZQW A;  3AQK A;  3RJK A;  9ICS A;  3NYB A;  1XSP A;  7ICH A;  5IIL A;  5EOZ A;  4E7X A;  4P4M A;  7ICI A;  3OUY B;  4X4S A;  1RZT A;  5J0O A;  3HWT A;  3WFO A;  4WC3 A;  4O5K A;  9ICI A;  5CHG A;  1BPB A;  4QZI A;  2ZH4 A;  2DRB A;  4JWN A;  8ICP A;  1VJ7 A;  4TUR A;  4FHV A;  1NOM A;  9ICU A;  4RQ1 A;  3JYY A;  3JPS A;  2DR5 A;  4K4I A;  3HJ1 A;  1ZQP A;  4P4P A;  1ZQC A;  1XSN A;  1KEJ A;  7ICR A;  2ZHA A;  4IQW A;  5CA7 A;  5DKW A;  4XRH A;  1F5A A;  5TZV A;  2ID1 A;  4AT7 A;  5J2I A;  4M9L A;  8ICR A;  4UB3 A;  4YMN A;  4UB5 A;  5DED A;  5J0R A;  2ZH1 A;  4YMO A;  8ICV A;  3RH4 A;  2BPC A;  2HHP A;  4MFF A;  3MGH A;  8ICO A;  5J2C A;  8ICK A;  5J0S A;  1ZQY A;  4NY8 A;  4KLJ A;  2BPF A;  4M9H A;  2ZH6 A;  4K4G A;  4UB1 A;  9ICR A;  3B0Y A;  8ICJ A;  3UXP A;  5CP2 A;  1JQR A;  4RWO A;  1YLQ A;  5CWR A;  7ICG A;  2BE3 A;  2RFF A;  4M0A A;  5J2G A;  2PFO A;  2ZH2 A;  1ZQV A;  4QZD A;  4X4R A;  3OVA A;  5HRH A;  1ZQA A;  1HUO A;  3HW8 A;  1ZQT A;  1ZQI A;  3C5F A;  4MF2 A;  3LK9 A;  8ICC A;  5HRG A;  5J0P A;  3ISC A;  4TUP A;  9ICG A;  3WFP A;  4DOC A;  1V4A A;  8ICH A;  4WC7 A;  4XA5 A;  4O5E A;  4DOB A;  8ICA A;  7ICJ A;  4AT8 B;  3C2M A;  4LT6 A;  5HRF A;  4PHE A;  9ICB A;  5HHI A;  4UAY A;  4F5P A;  8ICT A;  2NRK A;  5J2H A;  4IQT A;  3OV7 A;  2ZHB A;  4I2C A;  3K75 D;  4IQU A;  5DBC A;  1MIV A;  1ZJM A;  4RQ7 A;  4I2H A;  4RPY A;  8ICN A;  1MQ3 A;  1ZQO A;  4I2E A;  4AT9 A;  3L9D A;  4WC1 A;  1JMS A;  4QZE A;  4QZB A;  5HRK A;  4I2I A;  4TUS A;  4RQ6 A;  1ZQJ A;  3JPO A;  4RQ3 A;  5J0Q A;  8ICQ A;  4ATB A;  2I9G A;  4LVS A;  1R8B A;  4FHY A;  3AUO A;  4X4N A;  5IIK A;  4I2F A;  2M2W A;  4I27 A;  4UBC A;  5DB6 A;  9ICV A;  1R89 A;  4WC6 A;  2M2U A;  5HRB A;  4NLK A;  5IIN A;  5DBA A;  3TFS A;  7ICF A;  4KLL A;  3C18 A;  5IIJ A;  2FMQ A;  4WC0 A;  2ZH5 A;  3MBY A;  3OVB A;  1MIY A;  4UAW A;  8ICU A;  1ZQZ A;  4UB4 A;  3JPT A;  4I2A A;  5J0X A;  4X4T A;  9ICN A;  4WC5 A;  3UQ2 A;  4PHD A;  9ICX A;  4UB2 A;  4RQ4 A;  4R65 A;  3LQC B;  2ISO A;  2DR7 A;  4QZ9 A;  1Q79 A;  4RWQ A;  7ICM A;  9ICM A;  4PGY A;  3RJI A;  1BPZ A;  4YCX A;  4PPX A;  1BPY A;  4RWN A;  4RQ8 A;  4IG8 A;  4NLN A;  5DB9 A;  1UEV A;  2PBE A;  3RJJ A;  3TFR A;  8ICE A;  4QZH A;  1VFG A;  7ICP A;  1UEU A;  4I2D A;  4KLU A;  4F5N A;  4RT2 A;  4PHA A;  2PXI A;  5HRL A;  4RQ2 A;  2M2T A;  3MDC A;  3HJ4 A;  5D46 A;  4O5C A;  4X4O A;  4E8F A;  8ICS A;  1MQ2 A;  3C5G A;  9ICF A;  2ZH8 A;  9ICQ A;  5CR0 A;  4NM1 A;  4M47 A;  4XUS A;  4P2H A;  4WBY A;  8ICW A;  1ZQF A;  4RQ5 A;  3JZ0 A;  5DB8 A;  1TFY A;  4EBK A;  5J0Y A;  4AT7 B;  9ICE A;  9ICL A;  4FHP A;  4YN4 A;  4M9J A;  4RPX A;  4NKT A;  1OU5 A;  4WCW A;  3JPP A;  4M5D A;  3UPQ A;  4WBZ A;  1NO5 A;  1ZQX A;  5J2D A;  7ICU A;  5CJ7 A;  5J0W A;  8ICI A;  1TVA A;  4PHP A;  3C66 A;  4GXK A;  1UET A;  3HX0 A;  9ICK A;  3C2L A;  1BPX A;  3UQ0 A;  4X4V A;  4M2Y A;  4NLZ A;  4FHX A;  4RPZ A;  4FH5 A;  4X4P A;  3OUY A;  3PMN A;  5D49 A;  1Q78 A;  3WFS C;  4X5V A;  3H37 A;  4YD1 A;  4FO6 A;  1ZQK A;  1ZQL A;  1ZQN A;  3RJH A;  1JN3 A;  7ICQ A;  3MGI A;  2DVI A;  4M04 A;  4Z6D A;  3PML A;  4GXI A;  4NM2 A;  1ZQR A;  1XSL A;  1TV9 A;  5BOM A;  2ZH9 A;  3AU2 A;  5HHH A;  5HRI A;  1ZQM A;  2DR8 A;  1ZQD A;  4WC2 A;  2M2V A;  4KLT A;  5J2J A;  1R8C A;  5J0T A;  4FH3 A;  5J2K A;  3UPS A;  4KLD A;  4QZF A;  1MIW A;  9ICA A;  1BPD A;  3RJE A;  4I28 A;  5BPC A;  3ISB A;  2P66 A;  4PGQ A;  4FHW A;  4RT3 A;  4KLF A;  1R8A A;  4I2J A;  3HIY A;  2BCS A;  5F2V O;  2ZH7 A;  4I2B A;  4X4U A;  4DOA A;  5J2F A;  4E80 A;  8ICZ A;  2IHM A;  5DBB A;  4AT9 B;  4TUQ A;  4UD4 A;  4M9N A;  3H38 A;  4PGX A;  3H3A A;  3H39 A;  5J2E A;  1PX5 A;  5D4B A;  2BCQ A;  7ICT A;  3AQL A;  5IIO A;  1ZQE A;  4O9M A;  9ICT A;  4KLQ A;  4NKU A;  5BOL A;  2FMS A;  4ATB B;  4QZG A;  2GWS A;  9ICP A;  4R63 A;  1BPE A;  5HR9 A;  4X0B A;  4KLI A;  1HUZ A;  1FA0 A;  5J0U A;  9ICJ A;  4KLE A;  4JWM A;  3OGU A;  2Q66 A;  3WFR E;  3RJG A;  4KLG A;  5III A;  7ICE A;  8ICG A;  3GDX A;  7ICL A;  3AU6 A;  3RH6 A;  1KNY A;  4AT8 A;  4RQ0 A;  3JPQ A;  1KDH A;  4F5O A;  4XQ7 A;  7ICN A;  4F5Q A;  3RH5 A;  9ICC A;  2PFN A;  4I29 A;  4X4Q A;  3JPR A;  8ICX A; 
#chains in the Genus database with same CATH topology
 3CCE V;  7ICK A;  1K34 A;  3VQX A;  4U3F H;  3G71 V;  3A2F A;  4FFB B;  3ZHQ A;  2UUA B;  4UFZ A;  2YIC A;  1XHZ A;  4JAU A;  3K5O A;  4MVO A;  3X2Q C;  4KLM A;  1HP8 A;  4YXW G;  8ICL A;  1W0J G;  2FKX A;  5LXT A;  1I94 B;  4DV3 O;  4RWP A;  1BZK A;  3RJF A;  4FZ0 A;  1FYJ A;  2N05 A;  1H8H G;  4MF8 A;  2OYQ A;  1S72 V;  3ZRV A;  3W7W A;  2Z5U A;  4OXS A;  4GKJ B;  2PTM A;  1OCC B;  4RUE A;  4WFE A;  4ZI7 B;  4X64 O;  5HFM A;  3E8H A;  4K8Z A;  4UD5 A;  4MS2 A;  2PZS A;  2F43 G;  4MT8 A;  5CB1 A;  1QR9 A;  4DV1 O;  3V72 A;  5J2B A;  1LUW A;  4BW9 A;  3SPC A;  4UVA A;  4X1I A;  2ODM A;  5B3S C;  4QZ8 A;  3PNC A;  4Z6F A;  2QWQ B;  4XDK A;  4JI6 B;  5C8Y A;  3C2K A;  4EBJ A;  5DDY A;  3JCF A;  3E89 A;  3OTO O;  4QZC A;  1SKV A;  1O9G A;  1Q8I A;  5FNV B;  1ZQG A;  1ZJN A;  2EZP A;  4B3R O;  2WA3 A;  3CCL V;  4X9Q A;  3DC6 A;  5B1A C;  2ZH3 A;  7ICV A;  3JPN A;  5CB4 B;  1BHB A;  3T4Z A;  1U97 A;  2LP7 A;  3THO A;  5LHG A;  4NXZ A;  1JFF B;  2CE4 A;  2BCV A;  1M56 C;  3DSQ A;  3CJH B;  3Q4H B;  3ZRS A;  1ZQQ A;  2QM4 A;  2FB5 A;  4KLS A;  2JEX A;  3RJK A;  2EX3 A;  4IIJ B;  5EK0 A;  4E7X A;  4P4M A;  4GKK O;  1K4D C;  1YZB A;  3OUY B;  4X4S A;  1SA0 B;  4JI2 O;  5J0O A;  4YJ3 A;  1YEW A;  1PNL A;  5CA3 A;  4FLV A;  4U7O A;  3HWT A;  3WFO A;  4WC3 A;  2LGW A;  9ICI A;  4DR4 O;  4ZHQ B;  5CHG A;  3KCY A;  1H2G A;  1S5L Z;  2DWE C;  1FJG O;  2DRB A;  1SRY A;  2CTQ A;  1K92 A;  1NTM H;  1JX9 A;  1NOM A;  3JPS A;  2DYR C;  1ZQP A;  2X6B A;  1KEJ A;  2QDO A;  7ICR A;  4IQW A;  3VBB A;  5CA7 A;  5BR8 B;  2IM9 A;  3CCM V;  4XRH A;  1F5A A;  3ZHU A;  2NR5 A;  3WG7 B;  4M9L A;  2P22 C;  5KUM A;  1VMG A;  4LFC O;  4NXN B;  2EWR A;  5DED A;  3ABU A;  4EB6 A;  3E83 A;  3HKC A;  4JAA A;  2Z0A A;  2BPC A;  3ER9 B;  1X4T A;  3JD0 A;  5JJN B;  1NKD A;  3G80 A;  4P9O A;  3MGH A;  2OIE A;  1US6 A;  5D5Q A;  1Y74 B;  2ZIN A;  3K5M A;  3F5T A;  4O2A B;  2BPF A;  3HKE A;  9ICR A;  3B0Y A;  3FX7 A;  5KHH A;  4RWO A;  1EZJ A;  5JQG B;  2BE3 A;  4J9Z B;  1MAB G;  2E5L B;  3A0H Z;  4CH3 A;  2ZNI A;  4K9A A;  2Q68 A;  4K99 A;  4H13 B;  4UV8 A;  1J5E B;  5HRH A;  3AG2 B;  1Y67 A;  4RAI A;  3FB5 C;  3HW8 A;  1ZQT A;  4MF2 A;  3PN1 A;  4U3J A;  4JYY A;  4FZ1 A;  5CHE A;  4UVB A;  1K5Q A;  3ISC A;  4TUP A;  9ICG A;  2HFE C;  3ZN1 A;  3WFP A;  1GN6 A;  4QPK A;  2HP8 A;  1S77 D;  4XA5 A;  3C3S A;  5IY5 B;  1IZ3 A;  8ICA A;  3AG3 B;  2JRI A;  3H1H H;  1TVK A;  2FCL A;  1NBM G;  1JFF A;  4Z1V A;  9ICB A;  2BSK B;  4F5P A;  1PNK A;  2H8P C;  8ICT A;  5H9C A;  5TIS Z;  4I2C A;  1R73 A;  4CS3 A;  3FYE B;  4FJC C;  5KA5 A;  1ZJM A;  1VQL V;  4K0K O;  4DK0 A;  4RQ7 A;  2HN2 A;  4I2H A;  5IJ9 A;  4EEQ A;  4RPY A;  4JI0 B;  4X62 O;  1Q43 A;  2HKO A;  1TAE A;  4MTO A;  1YJ9 V;  4AT9 A;  3OD4 A;  2DQ0 A;  4QIW F;  3CCR V;  1JMS A;  4O6A A;  4K8V A;  4QZB A;  4K8X A;  4I2I A;  4RQ6 A;  1Z2G A;  2YIB A;  1FKA O;  1AJP A;  3B2E E;  3T2M A;  1NH2 D;  1WA8 A;  4UCU A;  4ATB A;  4JI7 B;  1H2S B;  4DV4 O;  3AUO A;  1Y66 A;  5LOV B;  4UBC A;  1RP3 B;  1FXK A;  2B56 A;  2UU9 O;  1Q81 W;  3IJ4 A;  2CTP A;  4JI3 O;  2JJ2 G;  1OCR B;  1H2L A;  2EIN C;  5HRB A;  1NVP B;  5IIN A;  1SES A;  1GN3 A;  3IGA C;  1SQG A;  4FLW A;  2UXB O;  4PDM A;  2ZR2 A;  5IIJ A;  1WPX A;  1YIT V;  3QTC A;  4JYC A;  4UAW A;  2XAG A;  4PHZ A;  1K5S A;  4O2A A;  4CS2 A;  4DR2 O;  1QU7 A;  3DXR A;  3CC7 V;  2HVK C;  5J0X A;  2JS3 A;  3AG7 A;  4FM1 A;  9ICX A;  4WFB V;  3R65 A;  2YXY A;  4JAS A;  2FML A;  5HFL A;  1KMI Z;  2Q0O C;  4LF5 B;  2ARH A;  3RJI A;  4JI5 B;  4X66 B;  3W7S A;  1NQT A;  2HJF C;  3ZHV A;  1HR0 O;  3HPL C;  4IG8 A;  1P4R A;  3A8T A;  1RM1 B;  3JAL B;  3RJJ A;  4QZH A;  2DJV A;  3BCC H;  5JJE B;  1Q6I A;  4RO2 A;  2UUB O;  4I5S A;  4X20 A;  4RT2 A;  4OAH A;  2HHH O;  1P7B A;  2JS5 A;  3T1C A;  5J2T A;  3ZMT A;  3D3Q A;  3AG4 C;  1HNW B;  3K5L A;  2M2T A;  3HJ4 A;  1N32 B;  4X4O A;  2UXN A;  4E8F A;  8ICS A;  1MQ2 A;  4LWS A;  1IBL B;  1ZLZ A;  4JI1 B;  9ICQ A;  3MCR A;  4M47 A;  2Q7G A;  5LGT A;  4AHC A;  4WOY A;  3ZJZ A;  4P2H A;  8ICW A;  4KL1 A;  3JZ0 A;  2RMK B;  4TV9 B;  5J0Y A;  3OR6 C;  2PUS A;  4R8C A;  1VIB A;  4AT7 B;  9ICL A;  4YN4 A;  3UO2 A;  4M9J A;  4RPX A;  3L75 H;  4WCW A;  3JPP A;  5KHK A;  3UPQ A;  3P3N A;  1OCC C;  3LNM B;  4HBN A;  1XNQ B;  1H38 A;  5CJ7 A;  3VQW A;  3H9V A;  2VQE B;  1Y76 A;  4B7E A;  2MK3 A;  1FXH A;  1W2B U;  1VF5 B;  4M2Y A;  4KM5 A;  3ML0 A;  1Q6U A;  4FHX A;  3C90 A;  4RPZ A;  5IE9 A;  1LNQ A;  4X4P A;  5KHJ A;  3PMN A;  4D7T A;  4QNH B;  3ZIA G;  3RJH A;  1SQQ H;  7ICQ A;  4DV3 B;  3OEE G;  1M5I A;  2NN4 A;  1VQ9 V;  2V7Q G;  1NT2 B;  1DK1 A;  4EEB A;  4DK1 A;  2F93 B;  3IFX A;  1XSL A;  4AQY O;  4I50 B;  2EIM C;  1FD9 A;  2DR8 A;  1ZQD A;  3RYF B;  4X1K B;  3PHZ A;  2M2V A;  4X64 B;  5J0T A;  1KQS U;  1AB3 A;  1YDX A;  2PGG A;  2QM7 A;  3ABL C;  5BZB A;  4DV1 B;  3FAV B;  3EVK A;  3JAW B;  1V54 C;  4MVM A;  2WLI B;  3UM7 A;  5J2U B;  2YXH A;  5B1O A;  4KLF A;  3FYI B;  4D6T H;  2VWJ A;  1ZAU A;  2DYS C;  2KQX A;  3HKB B;  2FYU H;  1ZTE A;  4UB8 Z;  5J2F A;  8ICZ A;  2Q67 A;  3CCJ V;  1OCZ B;  3OTO B;  1R6K A;  2RQ6 A;  1PX5 A;  3B8M A;  5EZY A;  4B3R B;  4F4L A;  1P49 A;  4NKU A;  2FMS A;  3QO7 A;  1FXK C;  2A06 H;  1JJO A;  1N33 O;  3L73 H;  2EIL B;  4X0B A;  3WG7 C;  5BMV B;  2WLH A;  3SPH A;  1HUZ A;  3JSN A;  4Z1M G;  1FA0 A;  3RW0 A;  4JWM A;  1SQB H;  2VQF O;  5FLX N;  4KLG A;  4B3S O;  7ICE A;  2CH7 B;  4GKK B;  3ZMV A;  2QWP B;  4QGP A;  1ORQ C;  3SYO A;  4JI2 B;  3ZMU A;  4AT8 A;  5EYP B;  3MAQ A;  1KDH A;  4DR4 B;  4LEY A;  3D36 A;  4K35 A;  4B3M O;  1FJG B;  2KSD A;  9ICC A;  5GON A;  2PFN A;  1B3Q A;  4I29 A;  1XOU A;  1CXZ B;  3J81 N;  1RPL A;  4KLO A;  2L35 A;  4MTG A;  2PFQ A;  1NZ6 A;  5LGN A;  4O68 A;  2DRA A;  5IJ0 A;  2FTK A;  4PEL A;  3UXO A;  1RFY A;  4BIZ A;  3UXN A;  2XAS A;  4P4O A;  5L3C A;  5LHI A;  4LFC B;  2OIG A;  2V4D A;  2H3O A;  4OPA A;  4I2G A;  5CA1 A;  4OAG A;  2R70 A;  2XHB A;  9ICW A;  4TWK A;  4KFM A;  4LNU A;  5IIM A;  1WJZ A;  4G2K A;  4JTD B;  4UAZ A;  3BAA A;  1AP6 A;  2P5O A;  4PDL A;  1WB7 A;  3AQM A;  1R3J C;  4M9G A;  4O4J A;  1XHX A;  3LDC A;  3JAW A;  1RSO A;  1J95 A;  2HJD A;  4K4H A;  3RYC B;  4DR3 O;  4EKW A;  1VQK V;  4PH5 A;  4QZA A;  1JR9 A;  3JCZ A;  3RYI A;  2OCC C;  3MDA A;  3DTU B;  3HKB A;  3OUS A;  2KG7 A;  1BT8 A;  2ZNJ A;  2WLK A;  4O4L A;  2EIK C;  4LP8 A;  4IQV A;  4TV8 A;  2PF4 E;  4GUN A;  3K03 A;  4EGW A;  4RQF A;  2GUZ B;  1WP7 A;  1RPR A;  2GA9 D;  4QPJ A;  5J2A A;  5GTI Z;  4F5R A;  3V7J A;  1N4C A;  2HLD G;  3SGI A;  2P90 A;  4WFA V;  5IYC O;  3KG2 A;  1KP2 A;  4W4K A;  1LR1 A;  5BMV A;  2Q7H A;  1G8M A;  4DXW A;  4HNA A;  1ZQW A;  2X6A A;  3NYB A;  4JV5 O;  4TT3 G;  4WFH A;  3K5N A;  2ADP A;  5EOZ A;  5IIL A;  4W4L A;  4K0K B;  4I55 B;  4FM2 A;  1TGO A;  1K73 W;  4X62 B;  2CH7 A;  4TQD A;  1EN4 A;  1ZX3 A;  4CC6 A;  1BPB A;  4OGQ B;  4QZI A;  2ZH4 A;  3CD6 V;  4JWN A;  4KUM A;  2P06 A;  3KCX A;  1KP3 A;  4G27 B;  9ICU A;  3OTF A;  2YXL A;  3JYY A;  2DR5 A;  4K4I A;  3HJ1 A;  4DV4 B;  1XL6 A;  3K0D A;  1S0V A;  1XSN A;  3BEH A;  2ZKO A;  4GLX A;  4Q20 A;  3D8C A;  3D3I A;  3OAA G;  3CRC A;  2UU9 B;  5KHG A;  3CP1 A;  1Q90 D;  4JI3 B;  2ZDI A;  8ICR A;  2P67 A;  4UB3 A;  2Q6A A;  4UB5 A;  2ITD C;  4R7C A;  4YMO A;  1JJ2 U;  8ICV A;  2UXB B;  4LR3 A;  5JH7 B;  5LHH A;  1IBM O;  4CH5 A;  1BQ0 A;  8ICO A;  5H6Q A;  1EZV H;  3SJB C;  3ABK B;  2Q5Z A;  3OFN G;  4NY8 A;  2QWO B;  2ZH6 A;  4UB1 A;  2F1M A;  4DR2 B;  8ICJ A;  2JGD B;  3OUF A;  3U10 A;  3ABT A;  5K1P A;  1TUB B;  1YXB A;  3P30 A;  4LFA O;  4M0A A;  1IX9 A;  2AW9 A;  5D62 A;  5IYZ A;  3P32 A;  1HDJ A;  4DRX A;  1VQ5 V;  3OVA A;  1ZQA A;  4X1Y B;  3K57 A;  2XAH A;  3K0G A;  1HR0 B;  1FFX B;  1VF6 A;  3NWI A;  1K4C C;  5E1A C;  5J0P A;  4DV5 O;  3I55 V;  2JK5 C;  4DOC A;  3O65 A;  1XDC A;  2RCV A;  3UT5 A;  5LBQ A;  1GAX A;  4O5E A;  5JJJ B;  2UUB B;  3D36 C;  5IYB O;  3R66 A;  2LGQ A;  2HHH B;  4MVR A;  4FLU A;  1IBK O;  3K08 A;  4PDV A;  5JCO A;  2AZ0 A;  4LT6 A;  2Z3Y A;  5HRF A;  4PHE A;  4MW3 A;  1KB9 F;  5J2H A;  3OV7 A;  3OWG A;  2C2A A;  4LF9 O;  5C93 A;  3IAY A;  4N7R A;  3VOU A;  2Q9L A;  2ZE8 A;  1B06 A;  3S3W A;  2Y4T A;  3WFV A;  4I55 A;  3RN4 A;  1MQ3 A;  4WC1 A;  4GX1 A;  2Y48 A;  2CAZ C;  5L3F A;  2R9A A;  5LP6 A;  2IJJ A;  2HN1 A;  3LDE A;  2I9G A;  2G38 A;  4BIU A;  1VEW A;  2EJR A;  4CS4 A;  4X4N A;  3OEH G;  2M2W A;  4FPP A;  2XT9 A;  3OGC C;  3H1J H;  3VQY A;  4I27 A;  4HZ3 A;  5GW7 A;  4NXV A;  5DB6 A;  3ASN C;  3RGB A;  3ETQ A;  9ICV A;  5CN0 A;  1R6N A;  3I56 V;  4WC6 A;  1SET A;  5LA6 A;  3CWB H;  4JI4 O;  1F51 A;  3MDS A;  5J9P C;  3TFS A;  4FO1 A;  2QJ1 A;  3C18 A;  4J42 A;  4UXN A;  4WC0 A;  2QR4 A;  1M57 B;  3OVB A;  1MIY A;  8ICU A;  5JH7 A;  3RBZ A;  2ATK C;  1H2M A;  1OV9 A;  3T1Y O;  5KMG B;  4I2A A;  4FFB A;  3AG1 C;  9ICN A;  1G6U A;  3BA8 A;  4AQY B;  2PI5 A;  5B1B B;  4JLX A;  2LQT A;  2O57 A;  1K8A W;  1TUB A;  3CC4 V;  4R65 A;  1FAF A;  4I7Z B;  4JTA B;  4QZ9 A;  1Q79 A;  1ROP A;  4F6R B;  3WB0 A;  4RWQ A;  4ABM A;  3L70 H;  1KD1 W;  2WLL B;  3CC2 V;  4PGY A;  1IVS A;  4YCX A;  1QCE A;  1SQX H;  3JAT B;  2GBO A;  2UXD O;  3QNE A;  1MNG A;  5CFU A;  4X1Y A;  4RQ8 A;  2F95 B;  1QLE B;  3RVY A;  1YSC A;  3N27 A;  7ICP A;  4UCO A;  4ZI7 A;  4I2D A;  3TXS A;  4KLU A;  2WAM A;  1QR8 A;  2X7R B;  4RQ2 A;  3MDC A;  3E22 B;  1NH2 B;  3W7U A;  3MD0 A;  2ZM6 O;  4O5C A;  2ZXW B;  5CBF A;  1SER A;  1Y6X A;  2ZH8 A;  2ZE5 A;  1DGS A;  2WLN A;  1N33 B;  3ETG A;  1ZQF A;  5DB8 A;  1GH6 A;  2ZDI C;  4EBK A;  3CX5 F;  3N2G B;  1IUR A;  3BA9 A;  5FNV A;  1XMQ O;  1W59 A;  2GSM B;  3ZRX A;  1OU5 A;  3OE7 G;  2VQF B;  1V55 C;  3CRR A;  2Q7E A;  4B3S B;  5CB4 A;  3MHH C;  4IYI A;  5J2D A;  7ICU A;  3PJS K;  8ICI A;  3BHP A;  1PM9 A;  2Y69 C;  3UKM A;  3CJH A;  3C66 A;  4GXK A;  3G4S V;  4TQF A;  3HX0 A;  2GHY A;  4B3M B;  4H33 A;  3Q4H A;  3LUT B;  4UB6 Z;  3C2L A;  2YEV B;  1OCO C;  2NNU A;  4PA4 A;  5JVD B;  3MHS C;  1R3L C;  4IIJ A;  3JAS B;  1W0K G;  1BS3 A;  2CK3 G;  3ZHR A;  1Q7Y W;  4J10 A;  4I9Q A;  1SA0 A;  3OUY A;  1QVG U;  5D49 A;  3ERC C;  5LGU A;  1Q78 A;  3CCQ V;  3STZ C;  2QEX V;  3B09 A;  1PL4 A;  2PY5 A;  4ZHQ A;  1PP9 H;  3JAK B;  4J7K A;  1ZQL A;  3CYO A;  4K96 A;  1KYO F;  1VF6 C;  1ENV A;  3ETD A;  2DVI A;  4M04 A;  3PML A;  3E2E A;  3NKU A;  4GXI A;  4NM2 A;  4NTW A;  2JJ1 G;  4O67 A;  3T4D A;  5ITZ B;  2CTW A;  1TV9 A;  2ETN A;  5BOM A;  1YI2 V;  3AU2 A;  5HHH A;  1BL8 A;  5JCO C;  4DV7 O;  1MMM A;  1GMG A;  1WAZ A;  2ZT9 B;  2IJI A;  4P30 A;  3WB1 A;  4WQL A;  5J2K A;  3JD2 A;  4LF6 O;  5KX5 B;  1MIW A;  4CBC A;  3RJE A;  4I28 A;  2CGO A;  3JAT A;  3ZRW B;  5BPC A;  3ISB A;  3K9S A;  2M6Y A;  5CA0 B;  4FHW A;  4RT3 A;  1E1Q G;  3NR7 A;  1R8A A;  4DR3 B;  3HIY A;  2BCS A;  1ARO P;  1Y74 A;  1BCC H;  2QWN B;  1LUV A;  3U11 A;  5F2V O;  4F6E A;  2IHM A;  5LP6 C;  1AI5 A;  5LYJ B;  3E35 A;  2ITC C;  3H38 A;  4PGX A;  5JQG A;  2BCQ A;  3A0B Z;  2YS8 A;  3CRA A;  4QE7 A;  4PI2 A;  4ZIB A;  2OWO A;  4MTX A;  1GM8 A;  5L3E A;  9ICP A;  2HR3 A;  4R63 A;  4O4I B;  5HR9 A;  4KLI A;  4HAM A;  1URF A;  2YC0 A;  4L8J A;  3OMA B;  3OGU A;  4JV5 B;  5III A;  2NLJ C;  2Q73 A;  1WPB A;  2YDE A;  3AU6 A;  4DUY O;  4RQ0 A;  3RYH B;  3DGE A;  3TCU A;  3K3W A;  1N34 O;  4XQ7 A;  2BSK A;  4F5Q A;  7ICN A;  4J7J A;  1IXB A;  1YHQ V;  2IU3 A;  2YEV A;  1IDS A;  3F7Y C;  2EJ7 A;  5HC9 A;  4OAI Z;  1YIJ V;  3JAS A;  4ZOL B;  4EFE A;  4WF9 V;  4E4E A;  4BW5 A;  2BBH A;  4LC1 A;  3SR2 C;  4LF8 O;  3X2Q B;  1THZ A;  4KP4 A;  2W9M A;  2XAJ A;  3SYP A;  5DDM A;  4X0A A;  4R50 A;  1AJQ A;  4FLX A;  8ICF A;  4WC4 A;  3HR0 A;  5ITZ A;  2O1P A;  5LOV A;  3JYC A;  1VQO V;  1IBM B;  2DN9 A;  2LFS A;  4MFA A;  3V7L A;  4XQ8 A;  2QKS A;  4IYH A;  4Z6C A;  2OTJ V;  1ZQH A;  2PFP A;  1JA8 A;  5B5E Z;  1R3K C;  2XTA A;  2GV9 A;  1TFW A;  1KEC A;  1XNR O;  3M7M X;  2W6I G;  2CUG A;  5KX5 A;  5LL6 Y;  5KHI A;  4LFA B;  2KKW A;  4R64 A;  2DOS A;  3V7K A;  4YMM A;  3H01 A;  2BCC H;  4IHJ B;  1VQ8 V;  2ZIO A;  4AI8 A;  4DW0 A;  2CDY A;  1L0N H;  4J9Y B;  3OVS A;  3B8N A;  1AI7 A;  2EIJ B;  2V1D A;  4KLH A;  3K04 A;  4FFK A;  5J29 A;  1XRE A;  1BSM A;  4DV5 B;  1S5J A;  2QWR B;  4LF7 O;  3IC9 A;  1AP5 A;  4I4T B;  1WOT A;  8ICB A;  9ICH A;  5A9G A;  1GPJ A;  1GN4 A;  3ABM B;  1KKC A;  2QSA A;  3WFQ E;  1VQM V;  3GWO A;  4Q6G A;  1IBK B;  5DEC A;  5B1A B;  4MW8 A;  3K59 A;  2Y4U A;  1JVM A;  3WB2 A;  1COW G;  3LSU A;  4UCV A;  4O4I A;  4ICG A;  2FMP A;  4MTF A;  4J41 A;  1ZQB A;  4DUZ O;  1K7D A;  3SPG A;  3JAL A;  4LF9 B;  3CHX A;  4OX9 O;  5IWA O;  2MW2 B;  4L87 A;  3ZX6 A;  1K33 A;  1NJI W;  4FM0 A;  2YID A;  5EBW C;  1K97 A;  1VF7 A;  1D2D A;  4O5K A;  1KU9 A;  4PA9 A;  4U7N A;  4I0X B;  1KC8 W;  2Q4P A;  8ICP A;  1B04 A;  4MVS A;  2A9H A;  4LEV A;  1ZQC A;  1F4M A;  3FFQ A;  1OJH A;  4JTC B;  3CS5 A;  4TV9 A;  2RN9 A;  2ZHA A;  3CRQ A;  2RJZ A;  2DYR B;  4WH5 A;  4O2B B;  5FL7 G;  4AT7 A;  5TZV A;  5J2I A;  4WFF A;  2E75 B;  2AGA A;  1PPJ H;  1VQP V;  3OMN B;  1N0J A;  1PNM A;  1XUQ A;  4JI4 B;  2WPD G;  4OAF A;  2BTQ B;  1OHH G;  1EN5 A;  3AK1 A;  4YIO A;  4AIL C;  3H1L H;  3ZBH A;  2YI9 A;  1KUQ A;  2Y0I A;  4DR5 O;  3BAB A;  3SJQ C;  3BY6 A;  2K1E A;  4PDR A;  1GM9 A;  5J0S A;  2JDI G;  1CPY A;  4UV9 A;  3EXA A;  1JQR A;  1GO3 F;  3S3X A;  4B7K A;  3T1Y B;  2EBO A;  1ZL8 B;  1YLQ A;  5D63 A;  3CME V;  2RFF A;  3AG2 C;  5J2G A;  2PFO A;  1QNM A;  1K3E A;  2ZIM A;  5CFS A;  2BTO A;  2EZO A;  1DLB A;  2ZH2 A;  4QZD A;  3U0Z A;  3HKD B;  3E86 A;  1HUO A;  2CTR A;  3N2K B;  2UXC O;  1ZQI A;  3ZMZ A;  2UXD B;  2JGU A;  2OCH A;  2ADQ B;  2XUM A;  8ICC A;  4XBF A;  5IY5 C;  4I50 A;  1FPO A;  3AG3 C;  1AR5 A;  1TA8 A;  3TK1 A;  2AZ2 A;  3RYF A;  4X1K A;  8ICH A;  1MZF A;  2D2C B;  1L8D A;  1S5H C;  4DOB A;  4H37 A;  3VQV A;  1P7G A;  1JCH A;  3SPJ A;  4TUY B;  2B1I A;  4EFB A;  3FAV A;  2WLI A;  2B9Z A;  5HHI A;  1L0L H;  5J2U A;  2NRK A;  4IQT A;  2ZHB A;  2ZQM A;  1QVF U;  3K75 D;  1Q86 W;  5DBC A;  4PD4 F;  4B3T O;  1MIV A;  5EC2 C;  1WP8 A;  1Y4M A;  1GKF A;  1GN2 A;  4I2E A;  1ZSP A;  4C7U A;  4HYO A;  4QZE A;  3KKY A;  4TUS A;  4KB6 A;  1XL4 A;  4CZZ A;  4JZ2 A;  1ZQJ A;  3W7X A;  3JPO A;  4MSW C;  4RQ3 A;  5J0Q A;  1WN7 A;  2AHY A;  1R8B A;  4DV2 O;  4FHY A;  2Q0A A;  2YUA A;  3QO5 A;  3KZI Z;  4I2F A;  1OCR C;  3WU2 Z;  3OMI B;  4UCS A;  4FLZ A;  3FB8 C;  2M2U A;  1A32 A;  4O2B A;  4DV0 O;  3EFF K;  4NLK A;  3ZHS A;  2F23 A;  2PYL A;  4H0L B;  1FS0 G;  1YJN V;  4X1I B;  1O9H A;  4BWA A;  4KLL A;  4DYL A;  4LCU C;  1R6T A;  2BTQ A;  5EYP A;  2FMQ A;  5IT9 N;  4JF3 A;  3MBY A;  4DV6 O;  2LO1 A;  3M8A A;  3TXQ A;  1ZQZ A;  4UB4 A;  3SDL A;  4K9B A;  3JPT A;  4EV6 A;  4K97 A;  5CMU A;  3RWR D;  4WC5 A;  1ZL8 A;  2IU0 A;  4PHD A;  3CPW U;  3ZCC A;  4UB2 A;  1QLN A;  2UXX A;  4DV7 B;  4NKG B;  1RPO A;  1XEQ A;  1QQC A;  2ISO A;  1RM1 C;  9ICM A;  2VWK A;  2Q69 A;  5D61 A;  4LF6 B;  1BPZ A;  1DF4 A;  4PPX A;  4LBE C;  3ZHT A;  2IJH A;  3ZS8 C;  4RWN A;  3TGU H;  4NLN A;  1Q3E A;  2DQ3 A;  1UEV A;  1JMK C;  2IH3 C;  3TFR A;  8ICE A;  2K9P A;  1GRJ A;  1UEU A;  5B66 Z;  2XAQ A;  4F5N A;  1EM1 A;  4PHA A;  2PXI A;  4YJ3 B;  1CEZ A;  2A79 B;  4LEZ A;  4WFG A;  4FLY A;  5HRL A;  4X88 A;  4YIP A;  1YVW A;  5EIB C;  5KAI Z;  3FKS G;  3AG4 B;  2LFR A;  1H2K A;  9ICF A;  2JVD A;  3RYC A;  3M99 B;  5CR0 A;  3J7A U;  5DN6 G;  3LSS A;  4P2Z A;  3SYC A;  4WBY A;  1TFY A;  3T1H O;  4FK5 C;  3FB7 C;  2A7W A;  4CC5 A;  1FFT B;  5FPO A;  1TUE B;  5B3P A;  3CXH F;  1R1B A;  4RQE A;  2GUZ A;  4KHP O;  4EB6 B;  4WBZ A;  1NO5 A;  3HKC B;  4DUY B;  5J0W A;  1TVA A;  4R6Z A;  4PHP A;  2PYJ A;  2OT5 A;  4NVP A;  9ICK A;  1N34 B;  4YY3 O;  2B1G A;  1BPX A;  2DMX A;  2LJ2 A;  4IT5 A;  4X8A A;  2IH1 C;  3UCS C;  4NYK A;  3HKE B;  3W7T A;  4NLZ A;  2PI4 A;  3WFS C;  4X5V A;  4YD1 A;  1B6Q A;  1SZT A;  2XOK G;  2P4K A;  1VP7 A;  3APO A;  1WNS A;  1PKX A;  1XIL A;  2EIJ C;  4LF8 B;  4LFB O;  1SS3 A;  3OW2 U;  1IXM A;  3JAR B;  4XDJ A;  1VQ7 V;  1ZQR A;  4X89 A;  4U3J B;  5A2Q N;  4OPH A;  1YTF B;  2ZH9 A;  3CRM A;  2IBZ H;  2QKC A;  5EBL C;  5HRI A;  1ZQM A;  3TJT A;  1KBH A;  3ABM C;  2F4V O;  4WC2 A;  4JPR A;  1GK9 A;  5J2J A;  2EIM B;  4FH3 A;  3UPS A;  1E79 G;  4KLD A;  4J7Z A;  1HNX O;  4DR7 O;  4P9P A;  1XNR B;  1TVK B;  9ICA A;  5KAF Z;  1M9N A;  3K58 A;  3ABL B;  4PGQ A;  4I2J A;  1V54 B;  1OCZ C;  4QE9 A;  1WLE A;  5IJ9 B;  4I2B A;  4X4U A;  1MG1 A;  4E80 A;  1EBO A;  1ZWI C;  3QF7 A;  4AT9 B;  2DYS B;  2JGD A;  4JYA O;  2JIZ G;  4M9N A;  4FIP C;  3L71 H;  3H3A A;  1S76 D;  2VS0 A;  7ICT A;  4LF7 B;  2QE7 G;  5IIO A;  1XQ8 A;  1ZQE A;  4O9M A;  1WA8 B;  5H6R A;  4KLQ A;  2EIL C;  3QG5 A;  5BOL A;  1PD3 A;  4NR1 A;  4ATB B;  3JD1 A;  2GWS A;  5AG2 A;  1MA1 A;  1N36 O;  3FD9 A;  1BPE A;  4PI0 A;  3CSX A;  1FFX A;  1FXK B;  3NXS A;  4N21 A;  1XMO O;  2IHO A;  5J0U A;  3RFR A;  4DUZ B;  1YTF D;  1P84 F;  2QKA A;  4O69 A;  4OX9 B;  5IWA B;  4FMT A;  1HW7 A;  2QGN A;  1BQZ A;  8ICG A;  7ICL A;  4JGS A;  4GX2 A;  3RH6 A;  5LMN O;  4GZR B;  1G4Y B;  4NB5 A;  1EN6 A;  4YHH O;  4YJ2 B;  4F5O A;  1I0H A;  2R9I A;  4X65 O;  1NTK H;  1I5Y A;  2LW7 A;  4JI8 O;  3ASO B;  4X4Q A;  8ICX A;  3DXR B;  3ISD A;  4DR1 O;  7ICS A;  3L74 H;  1DF5 A;  1JPX A;  4B08 A;  4NXM O;  3AQN A;  4UCT A;  1YJW V;  5KLV H;  9ICO A;  2O5A A;  3AEI A;  4UBB A;  4GT1 A;  3BRC A;  4Z6E A;  2BCR A;  2YIB D;  1SF9 A;  2BPG A;  4O4H B;  2ISP A;  3JAR A;  2XND G;  8ICY A;  1PV0 A;  4DW1 A;  1MSD A;  4UUJ C;  1NR1 A;  2P4V A;  2R9R B;  2M7W A;  4DR5 B;  4X20 B;  3STL C;  4MFC A;  4GYC B;  5J2T B;  4EP7 A;  4YD2 A;  1ZQS A;  5B1N A;  3B0X A;  1U96 A;  2VAN A;  5JWP A;  3BVO A;  4K98 A;  3I5D A;  1PL0 A;  4LWS B;  7ICO A;  1AI6 A;  3E8B A;  4FVM A;  5DB7 A;  2GAF D;  3H1I H;  3LSQ A;  1NI8 A;  2GDS A;  5CBG A;  1YCI A;  5HRE A;  2DR9 A;  2UXC B;  4N23 A;  5FPR A;  4LZG A;  5KMG A;  2E3C A;  2OTL V;  5E79 Z;  2E76 B;  4DO9 A;  4DO2 A;  2OCC B;  5EBM C;  8ICM A;  1NS1 A;  1GM7 A;  2EIK B;  1JAJ A;  3CE2 A;  4ZBM A;  4F6R A;  4NTX A;  3ZMS A;  4GXJ A;  3L72 H;  2WLL A;  1ZQU A;  3JCU Z;  5HRD A;  4R66 A;  5LMU O;  3ICX A;  4DR6 O;  2BCU A;  4LZD A;  1Y76 B;  4S3N A;  1V9P A;  1BMF G;  1N8R W;  3AQK A;  9ICS A;  4ASU G;  1XSP A;  7ICH A;  4ZKI A;  4B3T B;  1NU1 H;  2LW1 A;  2X6C A;  3EF2 A;  2UUC O;  7ICI A;  1HNZ O;  4CH6 A;  1VQ6 V;  1RZT A;  3CCS V;  4IL6 Z;  4LF4 O;  1MOF A;  3E22 A;  2IJK A;  3E8G A;  4YJ2 A;  1M4U A;  4TOI A;  3F5W C;  3F7V C;  1F4N A;  1VJ7 A;  4TUR A;  4FHV A;  4RQ1 A;  1VAR A;  4DV2 B;  2UUA O;  2GTA A;  3ZN0 A;  3CXC U;  2ZCE A;  3JD3 A;  4P4P A;  3N2G A;  5CFT A;  5DKW A;  1I94 O;  4BAY A;  2ID1 A;  1FXV A;  2A0L A;  3JSL A;  2CGN A;  4BIO A;  1DTO A;  4DV0 B;  4LH7 A;  4YMN A;  4Z2W A;  5KA6 A;  4GKJ O;  5J0R A;  2ZH1 A;  4O4H A;  3ABK C;  3RH4 A;  2HHP A;  4MFF A;  3SYQ A;  4K3A A;  2P6J A;  5IYD O;  5J2C A;  4DV6 B;  8ICK A;  5JVD A;  1ZQY A;  4KLJ A;  3B77 A;  4M9H A;  2WSS G;  2ZE7 A;  4K4G A;  3UO3 A;  2B51 A;  3UXP A;  5CP2 A;  4PA7 A;  5DM6 V;  5CWR A;  3CB2 A;  7ICG A;  5EZY B;  1I7F A;  1NVP D;  3JD4 A;  3LNN A;  2YI8 A;  3JAK A;  1ZQV A;  2W6J G;  4JI6 O;  4X4R A;  1Z5V A;  3TET A;  3BPZ A;  1SQF A;  2XAF A;  3GB7 C;  1N0N A;  3C5F A;  2YIA A;  5GTH Z;  1UPG A;  3LK9 A;  5HRG A;  4H44 B;  3FB6 C;  1V4A A;  4WC7 A;  7ICJ A;  4AT8 B;  3C2M A;  3SPI A;  2B5U A;  4UAY A;  4RUF A;  2EUL A;  3ZRW A;  5GON B;  5CA0 A;  4IQU A;  4IGG A;  5B3S B;  1T5E A;  5KUK A;  2DW4 A;  3B40 A;  3QO8 A;  8ICN A;  3RVZ A;  3T1H B;  5K1X A;  5LYJ A;  5IJ0 B;  1ZQO A;  1M90 W;  3L9D A;  1NR7 A;  4KXR A;  2BBJ A;  4G28 B;  2D3O W;  4GCZ A;  5HRK A;  3E8F A;  4TSF G;  8ICQ A;  4KHP B;  4LVS A;  4J11 A;  5CA1 B;  5IIK A;  5EIB D;  3A0R A;  4BR6 A;  4LNU B;  5IDJ A;  5BR8 O;  1M56 B;  4PV1 B;  4YY3 B;  3G6B A;  5JTG A;  1R89 A;  4NTY A;  2WWW A;  4NXN O;  4EED A;  1Z5W A;  4O4J B;  5L3D A;  3ASN B;  4GX5 A;  1I08 A;  5DBA A;  1M57 C;  2AXT Z;  7ICF A;  3OM3 B;  1XBL A;  1RSO B;  1I5X A;  4MVZ A;  1X59 A;  3CCV V;  3RYH A;  4NXT A;  1BHA A;  3BFR A;  2ZH5 A;  4JAV A;  4LH6 A;  1BE3 H;  2RNB A;  3RYI B;  2A3Q A;  5B1B C;  4LFB B;  1QBZ A;  3K7D A;  4UVC A;  2KG7 B;  4O4L B;  4WCE V;  2BOC C;  4QJF B;  1YF2 A;  4X4T A;  3H1K H;  4I9W A;  4TV8 B;  2JEU A;  3UQ2 A;  4ZOL A;  3RT3 C;  4GX0 A;  2E5L O;  1AR4 A;  1QHT A;  4RQ4 A;  2F4V B;  3LQC B;  4MVU A;  3AG1 B;  2DR7 A;  1WB8 A;  1J5E O;  3HB3 B;  7ICM A;  1VQ4 V;  1QLE C;  3ETE A;  1D5N A;  4WBN B;  1HNX B;  4DR7 B;  2WLM A;  3IC7 A;  4J80 A;  1VQN V;  2HEP A;  4XJE A;  1BPY A;  1F23 A;  3O9O A;  4XDL A;  2ILM A;  5DB9 A;  3ER8 C;  3GWK C;  4HNA B;  5H5N A;  2PBE A;  1M93 A;  5CBH A;  1VFG A;  4I0U A;  1K9M W;  2QTO A;  2X0L A;  2ZXW C;  4NXU A;  2DE0 X;  3GVM A;  5BXZ A;  4JYA B;  5D46 A;  3ASO C;  3J80 N;  4NXX A;  1JQ0 A;  5H2F Z;  1JOY A;  3CMA V;  2VRZ A;  2QTS A;  1SC5 B;  3C5G A;  2IUB A;  4IHJ A;  4NM1 A;  4XUS A;  2P7T C;  4D7S A;  4JI0 O;  1HWY A;  1N36 B;  4RQ5 A;  3CEI A;  2ZD9 A;  1SQV H;  2H94 A;  1XMO B;  9ICE A;  4FHP A;  2RDC A;  4NKT A;  2WA4 A;  5B3Q A;  4I4T A;  2L6L A;  3EHB B;  2E74 B;  4M5D A;  4JI7 O;  1ZQX A;  1Q6H A;  1EFR G;  5LMN B;  1V55 B;  4FLT A;  1UJW B;  4YHH B;  4PA6 A;  2ZM6 B;  2F66 C;  1UET A;  1MZE A;  4X65 B;  2W0F C;  3DC5 A;  4RWU A;  4JI8 B;  3OT7 A;  4PA3 A;  4LEW A;  3UQ0 A;  4X4V A;  2Y69 B;  3NVO A;  1AR1 B;  5L3B A;  2BOB C;  2HVJ C;  3CCU V;  3APQ A;  1G1X B;  1AJN A;  4DR1 B;  3SJC C;  4FH5 A;  5EC1 C;  1OCO B;  2HG5 C;  4JLZ A;  3SYA A;  4NXM B;  3K79 A;  1R3I C;  5IYZ B;  2AHZ A;  5LXT B;  3H37 A;  4DRX B;  4FO6 A;  1Q5O A;  4JYB A;  1KKD A;  1XMQ B;  1ZQN A;  1ZQK A;  1JN3 A;  2ZE6 A;  5L3G A;  4I0X A;  3MGI A;  3LDD A;  4Z6D A;  3UQ8 A;  1L1F A;  3JAM N;  2WLJ A;  1CP9 A;  1GTO A;  3CK6 A;  3K9A A;  2IW5 A;  3UT5 B;  3AK2 A;  2ZR3 A;  4KLT A;  2QA4 V;  1SZX A;  1AIL A;  4LF5 O;  1R8C A;  3AK3 A;  1H2N A;  4JI5 O;  4X66 O;  4QZF A;  3G67 A;  5BY1 A;  3QVN A;  2EIN B;  4E2L A;  1BPD A;  1ZUQ A;  4WBN A;  4A5U B;  1D5A A;  2P66 A;  3K06 A;  3SJA C;  1M1K W;  5C8Y B;  2ZH7 A;  3P3P A;  2Q8V A;  4DOA A;  1SQP H;  4MKP A;  5DBB A;  1HNW O;  4TUQ A;  2DWD C;  1H8E G;  4HX0 A;  4UD4 A;  1XI1 A;  3H39 A;  1NTZ H;  3ZED A;  2FL4 A;  1N32 O;  2YSU B;  5J2E A;  5D4B A;  5LP6 B;  3AQL A;  1IBL O;  1OZ0 A;  9ICT A;  4JI1 O;  1BGY H;  5D5P A;  4QZG A;  2KB1 A;  2W0X A;  3HKD A;  1S3J A;  2Y0P A;  1AVM A;  3N2K A;  5LMU B;  4DR6 B;  2N74 A;  2R72 A;  4UCR A;  2GTS A;  4CH4 A;  4JZG A;  9ICJ A;  4KLE A;  5LA6 B;  2Q66 A;  2B4V A;  3RJG A;  3WFR E;  2UUC B;  1UFI A;  3GDX A;  1HNZ B;  1XNQ O;  3B4S A;  1KNY A;  4LF4 B;  2QM8 A;  4TUY A;  4WQK A;  4MVQ A;  3JPQ A;  3G6E V;  2VQE O;  3OR7 C;  3C3T A;  3OGI B;  1AI4 A;  1MSW D;  3RH5 A;  2N04 A;  4NXW A;  1F7Y A;  1E1R G;  1Q82 W;  3JPR A;  4PJ0 Z; 
#chains in the Genus database with same CATH homology
 1RPL A;  3ISD A;  7ICK A;  4KLO A;  7ICS A;  5HC9 A;  2PFQ A;  3AQN A;  2DRA A;  4KLM A;  8ICL A;  9ICO A;  2O5A A;  3UXO A;  4RWP A;  4UBB A;  4Z6E A;  2BCR A;  3RJF A;  3UXN A;  4P4O A;  2BPG A;  2W9M A;  4MF8 A;  2ISP A;  5DDM A;  4I2G A;  4X0A A;  8ICY A;  8ICF A;  4WC4 A;  2O1P A;  9ICW A;  4MFA A;  5IIM A;  3V7L A;  4XQ8 A;  4UAZ A;  4Z6C A;  4MFC A;  4UD5 A;  1ZQH A;  2PFP A;  4EP7 A;  4YD2 A;  3AQM A;  5CB1 A;  1ZQS A;  1TFW A;  4M9G A;  3V72 A;  3B0X A;  5J2B A;  2VAN A;  4R64 A;  3V7K A;  4QZ8 A;  4YMM A;  3PNC A;  4K4H A;  7ICO A;  4Z6F A;  5DB7 A;  4PH5 A;  4QZA A;  5HRE A;  3C2K A;  3OVS A;  3MDA A;  2DR9 A;  4EBJ A;  5DDY A;  4LZG A;  4KLH A;  4QZC A;  4DO9 A;  5J29 A;  1ZQG A;  1ZJN A;  4IQV A;  8ICM A;  1WOT A;  8ICB A;  2ZH3 A;  9ICH A;  7ICV A;  3JPN A;  1JAJ A;  5J2A A;  3WFQ E;  4NXZ A;  4GXJ A;  4F5R A;  1ZQU A;  2BCV A;  5DEC A;  3V7J A;  5HRD A;  4R66 A;  2BCU A;  4LZD A;  2FMP A;  4S3N A;  1ZQB A;  1ZQQ A;  4KLS A;  1ZQW A;  3AQK A;  3RJK A;  9ICS A;  3NYB A;  1XSP A;  7ICH A;  5IIL A;  5EOZ A;  4E7X A;  4P4M A;  7ICI A;  3OUY B;  4X4S A;  1RZT A;  5J0O A;  3HWT A;  3WFO A;  4WC3 A;  4O5K A;  9ICI A;  5CHG A;  1BPB A;  4QZI A;  2ZH4 A;  2DRB A;  4JWN A;  8ICP A;  1VJ7 A;  4TUR A;  4FHV A;  1NOM A;  9ICU A;  4RQ1 A;  3JYY A;  3JPS A;  2DR5 A;  4K4I A;  3HJ1 A;  1ZQP A;  4P4P A;  1ZQC A;  1XSN A;  1KEJ A;  7ICR A;  2ZHA A;  4IQW A;  5CA7 A;  5DKW A;  4XRH A;  1F5A A;  5TZV A;  2ID1 A;  4AT7 A;  5J2I A;  4M9L A;  8ICR A;  4UB3 A;  4YMN A;  4UB5 A;  5DED A;  5J0R A;  2ZH1 A;  4YMO A;  8ICV A;  3RH4 A;  2BPC A;  2HHP A;  4MFF A;  3MGH A;  8ICO A;  5J2C A;  8ICK A;  5J0S A;  1ZQY A;  4NY8 A;  4KLJ A;  2BPF A;  4M9H A;  2ZH6 A;  4K4G A;  4UB1 A;  9ICR A;  3B0Y A;  8ICJ A;  3UXP A;  5CP2 A;  1JQR A;  4RWO A;  1YLQ A;  5CWR A;  7ICG A;  2BE3 A;  2RFF A;  4M0A A;  5J2G A;  2PFO A;  2ZH2 A;  1ZQV A;  4QZD A;  4X4R A;  3OVA A;  5HRH A;  1ZQA A;  1HUO A;  3HW8 A;  1ZQT A;  1ZQI A;  3C5F A;  4MF2 A;  3LK9 A;  8ICC A;  5HRG A;  5J0P A;  3ISC A;  4TUP A;  9ICG A;  3WFP A;  4DOC A;  1V4A A;  8ICH A;  4WC7 A;  4XA5 A;  4O5E A;  4DOB A;  8ICA A;  7ICJ A;  4AT8 B;  3C2M A;  4LT6 A;  5HRF A;  4PHE A;  9ICB A;  5HHI A;  4UAY A;  4F5P A;  8ICT A;  2NRK A;  5J2H A;  4IQT A;  3OV7 A;  2ZHB A;  4I2C A;  3K75 D;  4IQU A;  5DBC A;  1MIV A;  1ZJM A;  4RQ7 A;  4I2H A;  4RPY A;  8ICN A;  1MQ3 A;  1ZQO A;  4I2E A;  4AT9 A;  3L9D A;  4WC1 A;  1JMS A;  4QZE A;  4QZB A;  5HRK A;  4I2I A;  4TUS A;  4RQ6 A;  1ZQJ A;  3JPO A;  4RQ3 A;  5J0Q A;  8ICQ A;  4ATB A;  2I9G A;  4LVS A;  1R8B A;  4FHY A;  3AUO A;  4X4N A;  5IIK A;  4I2F A;  2M2W A;  4I27 A;  4UBC A;  5DB6 A;  9ICV A;  1R89 A;  4WC6 A;  2M2U A;  5HRB A;  4NLK A;  5IIN A;  5DBA A;  3TFS A;  7ICF A;  4KLL A;  3C18 A;  5IIJ A;  2FMQ A;  4WC0 A;  2ZH5 A;  3MBY A;  3OVB A;  1MIY A;  4UAW A;  8ICU A;  1ZQZ A;  4UB4 A;  3JPT A;  4I2A A;  5J0X A;  4X4T A;  9ICN A;  4WC5 A;  3UQ2 A;  4PHD A;  9ICX A;  4UB2 A;  4RQ4 A;  4R65 A;  3LQC B;  2ISO A;  2DR7 A;  4QZ9 A;  1Q79 A;  4RWQ A;  7ICM A;  9ICM A;  4PGY A;  3RJI A;  1BPZ A;  4YCX A;  4PPX A;  1BPY A;  4RWN A;  4RQ8 A;  4IG8 A;  4NLN A;  5DB9 A;  1UEV A;  2PBE A;  3RJJ A;  3TFR A;  8ICE A;  4QZH A;  1VFG A;  7ICP A;  1UEU A;  4I2D A;  4KLU A;  4F5N A;  4RT2 A;  4PHA A;  2PXI A;  5HRL A;  4RQ2 A;  2M2T A;  3MDC A;  3HJ4 A;  5D46 A;  4O5C A;  4X4O A;  4E8F A;  8ICS A;  1MQ2 A;  3C5G A;  9ICF A;  2ZH8 A;  9ICQ A;  5CR0 A;  4NM1 A;  4M47 A;  4XUS A;  4P2H A;  4WBY A;  8ICW A;  1ZQF A;  4RQ5 A;  3JZ0 A;  5DB8 A;  1TFY A;  4EBK A;  5J0Y A;  4AT7 B;  9ICE A;  9ICL A;  4FHP A;  4YN4 A;  4M9J A;  4RPX A;  4NKT A;  1OU5 A;  4WCW A;  3JPP A;  4M5D A;  3UPQ A;  4WBZ A;  1NO5 A;  1ZQX A;  5J2D A;  7ICU A;  5CJ7 A;  5J0W A;  8ICI A;  1TVA A;  4PHP A;  3C66 A;  4GXK A;  1UET A;  3HX0 A;  9ICK A;  3C2L A;  1BPX A;  3UQ0 A;  4X4V A;  4M2Y A;  4NLZ A;  4FHX A;  4RPZ A;  4FH5 A;  4X4P A;  3OUY A;  3PMN A;  5D49 A;  1Q78 A;  3WFS C;  4X5V A;  3H37 A;  4YD1 A;  4FO6 A;  1ZQK A;  1ZQL A;  1ZQN A;  3RJH A;  1JN3 A;  7ICQ A;  3MGI A;  2DVI A;  4M04 A;  4Z6D A;  3PML A;  4GXI A;  4NM2 A;  1ZQR A;  1XSL A;  1TV9 A;  5BOM A;  2ZH9 A;  3AU2 A;  5HHH A;  5HRI A;  1ZQM A;  2DR8 A;  1ZQD A;  4WC2 A;  2M2V A;  4KLT A;  5J2J A;  1R8C A;  5J0T A;  4FH3 A;  5J2K A;  3UPS A;  4KLD A;  4QZF A;  1MIW A;  9ICA A;  1BPD A;  3RJE A;  4I28 A;  5BPC A;  3ISB A;  2P66 A;  4PGQ A;  4FHW A;  4RT3 A;  4KLF A;  1R8A A;  4I2J A;  3HIY A;  2BCS A;  5F2V O;  2ZH7 A;  4I2B A;  4X4U A;  4DOA A;  5J2F A;  4E80 A;  8ICZ A;  2IHM A;  5DBB A;  4AT9 B;  4TUQ A;  4UD4 A;  4M9N A;  3H38 A;  4PGX A;  3H3A A;  3H39 A;  5J2E A;  1PX5 A;  5D4B A;  2BCQ A;  7ICT A;  3AQL A;  5IIO A;  1ZQE A;  4O9M A;  9ICT A;  4KLQ A;  4NKU A;  5BOL A;  2FMS A;  4ATB B;  4QZG A;  2GWS A;  9ICP A;  4R63 A;  1BPE A;  5HR9 A;  4X0B A;  4KLI A;  1HUZ A;  1FA0 A;  5J0U A;  9ICJ A;  4KLE A;  4JWM A;  3OGU A;  2Q66 A;  3WFR E;  3RJG A;  4KLG A;  5III A;  7ICE A;  8ICG A;  3GDX A;  7ICL A;  3AU6 A;  3RH6 A;  1KNY A;  4AT8 A;  4RQ0 A;  3JPQ A;  1KDH A;  4F5O A;  4XQ7 A;  7ICN A;  4F5Q A;  3RH5 A;  9ICC A;  2PFN A;  4I29 A;  4X4Q A;  3JPR A;  8ICX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...