5F2VO

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to ampcpp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
184
Chain Sequence
b'DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
molecule tags Transferase
total genus 59
structure length 184
sequence length 195
chains with identical sequence P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5f2vO02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5f2vO01
3HW8A 5DB6A 4QZFA 3AU6A 4K4GA 9ICAA 4YMMA 1FA0A 5HREA 9ICXA 1ZQCA 9ICPA 7ICQA 3JPRA 5J2FA 4JWNA 4RQ5A 4K4IA 9ICFA 5IIOA 3WFRE 8ICAA 4RWPA 2M2VA 4TURA 9ICNA 4YMNA 1KEJA 3AQLA 4QZBA 1ZQDA 4F5PA 4X4SA 1MIYA 3H39A 2PFQA 2FMPA 3MGIA 5CWRA 4Z6CA 4RT2A 1R8CA 2P66A 5DB7A 1MIWA 4R64A 4KLUA 8ICQA 3MGHA 1TV9A 4LT6A 4RQ4A 2M2WA 3V7KA 5J0WA 4IQUA 1ZQEA 1XSPA 4M0AA 1NO5A 5J2KA 2DR7A 4UBBA 4RQ0A 4UD5A 4GXJA 4RWOA 7ICPA 4WBYA 4GXKA 4MFFA 4XUSA 5CP2A 4IQVA 7ICJA 1UETA 4QZGA 3UQ2A 4IG8A 8ICIA 5J0QA 9ICKA 4KLMA 4X4QA 5CHGA 4FO6A 3WFOA 4EBKA 5J0TA 1ZQGA 2PBEA 4WC1A 5J0UA 3MDCA 1ZJNA 4JWMA 4M9NA 4KLIA 4I27A 2DR8A 4GXIA 5J2EA 1PX5A 5F2VO 1BPEA 3UPSA 4F5RA 4KLTA 4MFCA 4TUPA 5TZVA 4RT3A 1BPXA 3ISCA 4I2BA 4KLFA 4PGYA 5HRLA 1Q79A 2NRKA 3C2MA 4KLLA 1ZQKA 4FHXA 9ICLA 4X4UA 4S3NA 4X0AA 4I2IA 5HC9A 2ZH2A 4KLEA 4I2DA 4AT9A 4X4TA 2ZH6A 4UAWA 2BCSA 3UXNA 5J0RA 3V72A 1JMSA 2PXIA 4I2FA 4NM1A 4NLNA 3JPPA 4NLKA 2ZH5A 2DRBA 9ICUA 1XSNA 5CB1A 1RZTA 7ICHA 5IIMA 4RPYA 1ZQHA 8ICVA 8ICRA 4KLDA 2O1PA 2VANA 2FMSA 3OGUA 4PGXA 4X5VA 3TFSA 4TUQA 5IIIA 1HUOA 4PHAA 3RH6A 1VFGA 4NKUA 4WC7A 1ZQMA 4M9HA 1ZQBA 9ICSA 8ICOA 1R89A 5HRFA 5HRDA 3OV7A 1WOTA 4KLOA 2ZHAA 8ICWA 4M47A 3AU2A 2IHMA 3JZ0A 2PFPA 4M5DA 2BCQA 2O5AA 4Z6FA 2BCVA 2FMQA 7ICTA 2ZH4A 1BPBA 1ZQFA 4EBJA 4XQ8A 1XSLA 5DDYA 4DOCA 5BPCA 4XRHA 5BOMA 7ICIA 3C5GA 1ZQOA 8ICSA 2PFOA 3UXOA 4UAZA 1ZQQA 3HJ1A 3C66A 2M2UA 1ZQIA 5CR0A 8ICKA 4WC3A 4AT7B 4DOAA 1V4AA 5J2IA 4RQ6A 7ICUA 1R8BA 3AQMA 4PHPA 4AT7A 1ZQNA 1ZQWA 4FHVA 4YCXA 8ICFA 5J0OA 5DEDA 1KNYA 4YD2A 2ISPA 8ICBA 5HHHA 1ZQUA 4M9LA 9ICBA 4YN4A 5D49A 7ICNA 3MBYA 4R66A 3OUYB 4IQTA 9ICRA 4PHDA 4E8FA 2ZH7A 4X4OA 4DO9A 3RJHA 3OUYA 2ISOA 9ICHA 3C2LA 4M9GA 3UQ0A 3JPTA 9ICQA 4RPZA 4QZAA 4LVSA 3HWTA 3GDXA 4WC2A 5D46A 5BOLA 4I2HA 4I2EA 4UB2A 3WFQE 4X4PA 5HR9A 4MF8A 3RJJA 9ICCA 5HHIA 2RFFA 3JYYA 4QZDA 4QZ8A 4K4HA 4X0BA 8ICGA 4FHPA 1MIVA 3RJEA 4Z6DA 4PHEA 5DKWA 3LQCB 4P4PA 4AT9B 4QZCA 4FHYA 1TFYA 4LZDA 5J2DA 4M04A 1ZQRA 8ICPA 3B0XA 4M9JA 4O5EA 7ICVA 3RH5A 1ZQAA 4QZEA 3V7JA 2M2TA 5DB9A 3OVBA 5DECA 1ZQXA 2ZHBA 4EP7A 2PFNA 9ICEA 4NLZA 8ICCA 3LK9A 4Z6EA 4UB5A 4KLHA 3ISDA 3C5FA 5DB8A 3JPNA 5CA7A 5J2BA 2ID1A 3UXPA 4DOBA 4RQ3A 4PH5A 5HRGA 4ATBB 4QZIA 4F5OA 2DVIA 4MFAA 4FHWA 9ICWA 4ATBA 3RH4A 3AQNA 3RJKA 4NXZA 2BPCA 5J2JA 3OVAA 5J0XA 3B0YA 9ICJA 4RQ7A 4UBCA 4KLJA 4F5QA 3C18A 4X4NA 1UEUA 8ICEA 2ZH1A 1HUZA 3RJGA 7ICKA 4WC5A 7ICSA 1RPLA 9ICTA 4XA5A 4UB1A 1NOMA 4YMOA 4RQ1A 1ZJMA 4RQ8A 2BPFA 5HRBA 1ZQJA 4PPXA 2BPGA 5IIKA 5HRHA 1MQ3A 7ICGA 2BE3A 5EOZA 4UB3A 5HRIA 1F5AA 1UEVA 4I28A 1BPYA 2DRAA 3PNCA 1R8AA 5DDMA 3H38A 4LZGA 2Q66A 8ICNA 2DR9A 4P2HA 4TUSA 4I29A 2W9MA 8ICJA 4IQWA 1BPDA 4NM2A 3TFRA 4QZ9A 4RQ2A 7ICOA 5DBAA 5J2GA 4WBZA 2BCUA 4KLGA 1ZQSA 4YD1A 5IINA 4I2CA 4RWNA 1KDHA 2BCRA 5D4BA 3ISBA 5J0YA 4P4MA 9ICIA 4O5KA 3C2KA 3L9DA 4UAYA 4QZHA 2HHPA 1JQRA 5J0PA 3HIYA 3MDAA 1MQ2A 5IIJA 3JPSA 4UB4A 1ZQLA 4WCWA 3WFSC 3RJIA 3H3AA 4NY8A 7ICFA 7ICMA 3RJFA 9ICGA 5IILA 2ZH8A 4PGQA 5J2CA 2ZH3A 5DBCA 4WC0A 3JPQA 4F5NA 4I2GA 3K75D 5J29A 4I2JA 1ZQYA 4R65A 5CJ7A 4P4OA 3HJ4A 3NYBA 4M2YA 9ICVA 3PMLA 1Q78A 4UD4A 3UPQA 1TVAA 4O5CA 3V7LA 8ICYA 3H37A 2I9GA 4I2AA 4WC6A 1ZQZA 8ICLA 1TFWA 3HX0A 4X4RA 3JPOA 1ZQPA 4FH5A 4E80A 9ICOA 1YLQA 1JN3A 3PMNA 4KLQA 4NKTA 4R63A 8ICZA 5DBBA 1BPZA 8ICXA 1VJ7A 1OU5A 4RPXA 8ICTA 1JAJA 4E7XA 2GWSA 4AT8B 5J0SA 7ICRA 1ZQTA 1ZQVA 2ZH9A 4WC4A 9ICMA 4AT8A 3AUOA 4XQ7A 5J2AA 7ICLA 5J2HA 4MF2A 4O9MA 8ICMA 4FH3A 3AQKA 5HRKA 4RWQA 3OVSA 3WFPA 4KLSA 8ICHA 4X4VA 7ICEA 2DR5A 8ICUA
chains in the Genus database with same CATH superfamily
4QZFA 5KHHA 4K4GA 2XUMA 4RAIA 2Z0AA 5AG2A 4YMMA 2LJ2A 4HX0A 2EIMC 4E2LA 4JI5O 7ICQA 2WPDG 2AXTZ 4O68A 5KLVH 3HKBA 4JWNA 4LEWA 4RQ5A 4PA4A 1AJPA 2LGWA 2DYRC 1YJNV 2M2VA 1Z5VA 2XHBA 2Q8VA 9ICNA 4KXRA 3DXRA 2CH7B 3SYCA 5BR8O 2VQFO 1VQ6V 3AQLA 1L1FA 1RP3B 4BWAA 1DTOA 1US6A 1YVWA 3D36A 4GX0A 1VQMV 4UV8A 4PV1B 4MVUA 2A06H 1ENVA 3NKUA 2EJRA 2HHHB 2WLJA 1NQTA 2GAFD 4QNHB 1YTFB 2P66A 3CRQA 4KUMA 1GMGA 1JFFB 3CMEV 4X64B 3Q4HB 1MIWA 2XASA 5IJ9B 5D62A 4O4IB 3RBZA 3MGHA 3FD9A 4O2AA 3CRCA 4EKWA 2L35A 1XDCA 3FYEB 4MVRA 1EN4A 3JAWB 3IFXA 1P4RA 5LMNB 1OCRB 2P06A 5J2KA 3K9SA 4WFEA 4PA6A 4B7KA 4RQ0A 3ER8C 3S3WA 1F51A 3UO2A 7ICPA 1EZVH 2UUAB 4GXKA 1K5SA 4AQYO 3WG7C 1GN3A 5EBMC 4X1YA 2Y69B 1UETA 1SRYA 3ZHQA 3ASNB 3ZMVA 4EFEA 2GSMB 3UQ2A 4IG8A 1XNRO 3AK2A 5JH7A 1YI2V 5J0TA 3D3QA 5J2UA 4WC1A 5J0UA 4FMTA 1PKXA 5BXZA 4I27A 1NTMH 2X6BA 4GXIA 5IYDO 1K8AW 1PX5A 5F2VO 3UPSA 4FM0A 3EXAA 1F4NA 4U3FH 3WB1A 1IURA 1R6NA 2KQXA 3U11A 4JI4O 4QJFB 5A9GA 4CC5A 2N74A 1URFA 2W0FC 2HJDA 4PGYA 1Q6UA 2YIDA 2NRKA 2CE4A 3TGUH 2ZCEA 4DV4O 3ZMZA 1ZQKA 4X0AA 1AR4A 2WLIB 2E5LB 1Q3EA 2CTPA 4AT9A 2E76B 3WB0A 3SJAC 1CEZA 4UAWA 2BCSA 4B3RO 5J0RA 4CH4A 4TUYA 1KUQA 1BCCH 3T1HB 3G67A 1HP8A 4RPYA 4JYCA 4K98A 4XBFA 1N8RW 1LNQA 5D5QA 2GTAA 3AK3A 4UCTA 4JYYA 3TFSA 3UM7A 2Q7HA 4X1KA 4NKUA 3T1YB 1GN6A 1WA8B 2B4VA 4WC7A 2JGDA 2RCVA 5B3SC 1SF9A 1ZQBA 3RYCA 4DXWA 3P3PA 3OFNG 1R89A 1GPJA 1ORQC 5LHGA 5HRDA 4MVZA 2ZHAA 3W7SA 3AU2A 2IJIA 5JQGB 1LUWA 4DR5O 1L8DA 4M5DA 1XOUA 2RJZA 4AHCA 4Z6FA 2GV9A 5FPRA 5L3BA 4LH6A 2BCVA 4U7NA 3HR0A 4DV1O 4TQDA 1BPBA 3CC2V 4PA9A 3MDSA 5EZYA 5KHGA 1TUBB 1XSLA 3JATB 3E8HA 4UXNA 4I4TA 3JCZA 1AJNA 2EZPA 1RSOB 2VS0A 3QO5A 4ASUG 3FYIB 3EF2A 1OJHA 1XHZA 1OCOC 4LBEC 1DGSA 4DUZB 4HNAA 1G1XB 1AR5A 4YHHO 4IGGA 3OMNB 1WPXA 3TETA 5J2IA 2F4VO 1JCHA 1QHTA 5B1AB 1BL8A 2LP7A 3VBBA 3AQMA 1M5IA 1SQFA 2WLLB 1AI7A 2UXDO 2OIEA 5BMVB 1KNYA 4YD2A 2IU3A 1Y66A 2X6AA 5LXTA 2FB5A 2DMXA 1B04A 4BAYA 3A0HZ 2PYLA 4J9ZB 4RWUA 1F4MA 1OZ0A 4PHDA 4E8FA 1VMGA 1PPJH 4P2ZA 4JLXA 3OUYA 4JI3O 2R70A 3AG3C 2JEUA 1VF6C 4ZI7A 4UCVA 3CCMV 4DV5O 9ICQA 3FB6C 4TV8A 3HWTA 1IBLO 5HR9A 4CS2A 2IU0A 2DOSA 5GTHZ 2RFFA 4X66B 1XMQB 1XNRB 4X0BA 4FHPA 4MT8A 4X88A 4PDVA 3W7WA 2YIAA 3OE7G 3FB7C 3RJEA 5FL7G 4EEDA 5LBQA 3H1IH 2ADPA 2Z5UA 2IJKA 3JALA 1TFYA 2QE7G 2KG7A 2IH1C 1X59A 3B0XA 8ICPA 2ADQB 3BFRA 3HKEA 2H8PC 4QZEA 4CZZA 5EK0A 3JD2A 1YJ9V 4JI4B 2K9PA 2ZQMA 3T2MA 2ZHBA 3JD4A 2QTOA 3LK9A 2HVJC 1NS1A 4CS3A 4DV4B 2Y4UA 4O4JA 4FLXA 1V54C 1MSWD 3C5FA 1P49A 3JPNA 1SQQH 4CC6A 1FD9A 4DOBA 4PH5A 2EWRA 2JDIG 4ATBB 3CHXA 4F5OA 9ICWA 2IJJA 1NVPB 4I0XA 3AG1B 1NR7A 3JARB 4BIUA 3O65A 1YHQV 2W0XA 1KQSU 4FLWA 5FNVA 3ETGA 3SYOA 8ICEA 3F7YC 2ZNJA 4DK0A 2PF4E 4DR3O 3SJCC 4D7SA 3GVMA 1KMIZ 1K9MW 7ICSA 4KP4A 4LR3A 1EZJA 4GX5A 3T1CA 1K97A 2LW1A 4H33A 1R1BA 4K3AA 1WPBA 2B1GA 5HRBA 2BPFA 2BPGA 2UU9O 4MVOA 1MQ3A 3HKCB 5EOZA 1YITV 1Y6XA 3GWOA 1BPYA 4X20A 2KKWA 2CAZC 4DV1B 4ZHQB 5JCOA 3ZN0A 2DR9A 4P2HA 4WF9V 5C8YB 4IQWA 2P22C 4Z1VA 4L8JA 4QZ9A 3D3IA 2ZE8A 2WLKA 1PM9A 4MVQA 5GONB 3QTCA 4PA3A 3Q4HA 2ILMA 4YHHB 1QLEB 2CTQA 2CTWA 1P7GA 5IJ9A 2FTKA 2WLHA 3K5OA 4JTCB 3AG4C 3IJ4A 2QA4V 1VQ9V 1GN2A 2HFEC 3L75H 2WAMA 4UB4A 4LFBB 2UXDB 3ABLB 1ZQLA 1AILA 4DR6B 1Z5WA 3FX7A 1CXZB 5B1NA 7ICMA 5B3PA 1I7FA 3NWIA 1CPYA 1M9NA 3RJFA 3I5DA 5IILA 3FB8C 3ZRVA 1EBOA 1SS3A 5IY5B 5DBCA 4O4HB 4Z2WA 1WB7A 3LDEA 3VQVA 4WC0A 3U10A 1UJWB 1M56C 4O6AA 1K73W 3PN1A 2WLMA 3CCSV 1KU9A 2HN2A 1JVMA 5J29A 1MG1A 3K04A 4YJ3B 5CJ7A 4DV2B 4WFFA 3HKDA 1XNQB 5EBWC 4O5CA 1IBLB 3K5MA 4OPAA 4LF9B 3VQWA 3I55V 1XL6A 1ZQZA 4WC6A 4J7ZA 5EC2C 1Q8IA 3K58A 2EILC 2ZDIC 4NXWA 5D61A 3JPOA 2UUBB 3IAYA 2EIKC 4B3TB 2YSUB 1N33O 3HB3B 4KLQA 2GBOA 2BCCH 4J10A 4WQKA 1VJ7A 2PTMA 4KB6A 2YS8A 2WLIA 1JAJA 4E7XA 4DUYB 4AT8B 2ZE7A 1ZQTA 5LA6A 3CE2A 5EC1C 1FFXB 4PDMA 1WP7A 4O2BA 5J2AA 2ITCC 1WNSA 4B3SO 4O9MA 2ZINA 4JTDB 5HRKA 5B1BC 1AI5A 3WFPA 8ICHA 1PL0A 4GYCB 4LF7B 8ICUA 1HNXB 2FKXA 5DB6A 3I56V 5KA6A 2QR4A 2GUZB 4LEYA 4X1IB 2YEVA 4I50A 2YICA 2ZIMA 5FLXN 2HHHO 5LGUA 4RWPA 3OM3B 3STZC 2B9ZA 1KEJA 4X64O 4DO2A 1M57B 3L74H 1I0HA 2BSKA 1ZQDA 5DM6V 4UUJC 4TOIA 3SYQA 2FL4A 4FLUA 1N32B 4X4SA 2ODMA 1WLEA 3H39A 1MMMA 1NZ6A 1ZL8B 2ZT9B 4RT2A 2QKCA 1R8CA 3B4SA 2WSSG 5LMNO 2ZXWB 3A2FA 3ZBHA 4KLUA 2ZM6B 4WFHA 2YXHA 3BCCH 4QIWF 1QR9A 2UUAO 1TV9A 5E1AC 4OAHA 2H94A 3OMAB 3E35A 4MW8A 4IQUA 1OCRC 1ZQEA 4JYAB 3VQXA 1GAXA 4M0AA 4J41A 1E1RG 2DR7A 3OUFA 2P6JA 4UD5A 3ZRWB 1M1KW 1X4TA 2BTQB 2BBHA 3ABMB 3ZIAG 4WBNA 1Y76B 4TV9B 2Y69C 2F23A 3UCSC 4NXUA 5LYJA 2X7RB 3K08A 3ASNC 1Y74B 3APOA 8ICIA 2AZ2A 3SYAA 2PBEA 1A32A 2AZ0A 5L3DA 4JWMA 3IGAC 2Q73A 2ETNA 4L87A 1VQLV 3LUTB 1Q90D 1FXKB 2KSDA 2E5LO 5J2EA 3E8GA 4KLTA 3AG7A 2O57A 4A5UB 2YUAA 3ZHUA 4MKPA 4BIZA 4I2BA 3CCRV 3T1HO 1R6TA 4LEVA 5HRLA 3C2MA 4K8VA 4WH5A 5EYPA 4FHXA 5KAIZ 1J5EO 1JOYA 4I2IA 4KLEA 2XNDG 1F23A 3N2KB 1MZEA 3UXNA 1VF7A 4JF3A 2YIBA 1JMSA 3HPLC 4JPRA 1BQ0A 3JPPA 4NLKA 1OCZB 1DLBA 1E79G 5IYZA 1N33B 1RZTA 2EIJB 8ICVA 8ICRA 4KLDA 4DW0A 2IBZH 5KMGB 2RMKB 5CN0A 2VWJA 3K0DA 3CXHF 1B06A 4OX9B 4KM5A 3RH6A 1MNGA 3K7DA 5EIBC 1IVSA 4JTAB 4I0UA 4O4LB 1WB8A 4B3SB 8ICOA 2FCLA 3SPCA 2F1MA 1WOTA 1V55B 4JI1O 3S3XA 2IHMA 4LWSB 3JZ0A 4ZOLA 1SERA 5JJNB 2OIGA 4CH3A 2FMQA 2Y0IA 2GHYA 3L70H 2DJVA 4DUZO 3BHPA 3WFVA 3JAMN 3RYIB 5BPCA 4XRHA 4FLVA 3C5GA 3ETEA 1ZQOA 5IWAB 4UAZA 3HKCA 1U97A 3C66A 4JAUA 2M2UA 3F5TA 4WCEV 4LF8B 1ZQIA 4DR7B 4WC3A 4AT7B 4ZHQA 4GX2A 1XREA 1H2NA 1V4AA 5B1AC 1AI6A 5C8YA 1B6QA 3N2GB 1JR9A 1SESA 4K8XA 4CH5A 1ZQNA 4P9OA 1MZFA 4LF6B 4FHVA 5H6RA 4YCXA 3LSSA 5JJJB 4LF4O 2ISPA 5HHHA 1NU1H 4IHJB 4M9LA 1S0VA 1ZUQA 3X2QB 2DQ0A 1R3JC 1Q6IA 5CHEA 1KKCA 4X66O 1XMQO 3JASB 4X4OA 1KP2A 3RJHA 9ICHA 1BE3H 3C2LA 4R50A 4M9GA 2ZE6A 1ZSPA 2YDEA 4LVSA 2W6JG 2YI9A 3GDXA 4WC2A 5D46A 4I2HA 1VF6A 4I55A 4X4PA 4F6RA 1NR1A 5IJ0B 4MF8A 3ABUA 4PELA 4GUNA 4K99A 4JYBA 4K4HA 2A7WA 1K5QA 3T4ZA 2Q9LA 5K1XA 1XILA 3LQCB 4MW3A 4P4PA 2K1EA 1H2SB 4X89A 1ZQRA 5KAFZ 4O5EA 3U0ZA 5CB4A 5LL6Y 2QM8A 5L3GA 1B3QA 5DECA 3J7AU 3TK1A 2PFNA 4JV5B 1XMOB 1N0NA 2ZR3A 4NLZA 3RVYA 1KC8W 4EB6B 3FAVA 1XUQA 3PJSK 3RYHB 1J5EB 3K9AA 5GW7A 3ISDA 3TJTA 2F95B 3QNEA 1OHHG 2OWOA 4QPKA 1IX9A 2DVIA 4ICGA 3AG1C 2LFRA 1I08A 4J11A 3RH4A 1YCIA 3IC7A 2BPCA 5J2JA 3OVAA 3F5WC 4KL1A 3B0YA 2JGUA 1QQCA 4RQ7A 4EEQA 5KHKA 4KLJA 1UEUA 3C90A 4J7KA 7ICKA 2DYSB 3FKSG 3E22A 2PUSA 1NOMA 4YMOA 2C2AA 3CRAA 4JI7O 5CA1A 2RDCA 5B1OA 3BEHA 4JI8O 3AK1A 5K1PA 1H2GA 3JAKB 4NXXA 2GUZA 4JI1B 7ICGA 2OCHA 5LP6B 5HRIA 4X65B 3A8TA 3DC6A 1UEVA 5C93A 3RW0A 5ITZA 4N7RA 2N05A 4BW5A 3CK6A 1R8AA 2M6YA 4YJ2B 3BY6A 4DV7O 1TVKA 4Q20A 4LNUA 3NXSA 4I7ZB 4YIPA 3TXQA 1FXVA 5LHHA 1PL4A 2W9MA 3ASOB 3UT5B 8ICJA 3RYFB 4RO2A 1BPDA 1IBKB 1ZWIC 2ATKC 2LGQA 2V1DA 1JPXA 4RQ2A 7ICOA 2QTSA 2BCUA 5KX5B 4LFBO 4AI8A 4DR6O 3AG2B 5HFLA 2PI5A 4G27B 5D4BA 3ISBA 1M4UA 5J0YA 4P4MA 9ICIA 2HLDG 4O5KA 1QLEC 2R72A 1FPOA 2A9HA 3H9VA 3KCXA 2HR3A 4UAYA 3CEIA 4K96A 2IJHA 2JVDA 2R9AA 1MQ2A 5JVDA 1SQVH 3ABLC 1N36O 3BA9A 3WFSC 4NY8A 7ICFA 4LF4B 4FZ1A 2VWKA 1K92A 4HZ3A 4DV2O 5H6QA 1MSDA 3B40A 1FFTB 3E2EA 3OTFA 2PY5A 1IZ3A 1ZTEA 1XNQO 2ZH8A 4PGQA 4GKKB 2PYJA 5IY5C 3STLC 4WFGA 4LF9O 3SPHA 4I2GA 2ZIOA 5IYBO 4WOYA 4I2JA 3CXCU 4U3JB 2WLNA 4P4OA 2UUBO 3OMIB 2OCCB 3HJ4A 4DW1A 4B3TO 9ICVA 1R3KC 4DRXB 4FFBA 2BBJA 2ZNIA 2P90A 3CC7V 1Q78A 5CBHA 3V7LA 2P4KA 5CA0A 2I9GA 1IXMA 4PDLA 3M7MX 3CP1A 4DUYO 1RPOA 4OXSA 3SPIA 4EFBA 4LFAB 5HFMA 2ZDIA 1JN3A 3B09A 4NKTA 1TA8A 4K9BA 5BY1A 4R63A 5DBBA 8ICXA 3SPGA 2OT5A 2X6CA 3A0BZ 2R9RB 4JI0B 5KUKA 4LF7O 1Q81W 1SQXH 5KA5A 3ZJZA 1HNXO 4OPHA 3B77A 1GH6A 5LOVB 1SA0B 4HAMA 4WC4A 1PNLA 9ICMA 2ZR2A 1H8EG 3AUOA 2LFSA 3CCVV 4RWQA 1SC5B 2WA4A 1QBZA 3KG2A 4X4VA 1NJIW 4OAIZ 7ICEA 1R3IC 1VQ4V 3MCRA 3HW8A 3SPJA 3AU6A 4O69A 5HREA 3HKBB 1ZQCA 2AW9A 1HNWB 1N32O 1G8MA 4K4IA 4YXWG 4DR4O 9ICFA 3EFFK 3WFRE 3TXSA 8ICAA 3G71V 3DXRB 4UB8Z 4TURA 4UCRA 3SDLA 5E79Z 1WP8A 1M57C 1S76D 2ZM6O 1YEWA 3QG5A 4JI7B 2JRIA 4LH7A 4PD4F 4JI8B 3ZRXA 2XAGA 2CH7A 1Q82W 3CRRA 2FMPA 4LF5B 4LP8A 3MAQA 2UUCB 1KBHA 5CBFA 2Q5ZA 4WFBV 2ZXWC 2HG5C 3CC4V 4JYAO 1RM1B 4DV7B 4WQLA 4O2AB 1COWG 2QM7A 1JFFA 3UKMA 2CDYA 3WB2A 1EN6A 2Q68A 4LT6A 5IT9N 2RNBA 5KUMA 3QO7A 1VQNV 4O4IA 4B7EA 5LGNA 2EZOA 2EBOA 2ITDC 3V7KA 3BA8A 2A79B 1HDJA 1H2MA 2PI4A 2HP8A 3ZHRA 1NO5A 2KB1A 5LMUO 4UBBA 3JAWA 2EINB 4GXJA 4RWOA 1GM8A 2D2CB 4X1YB 3ABMC 3ZMSA 4MFFA 4XUSA 4RUFA 2YC0A 2HVKC 4QZGA 2QSAA 1JJOA 4FLZA 4X62O 5JH7B 5LGTA 1N36B 4IHJA 3UQ8A 4EV6A 4K8ZA 1FKAO 5J2UB 3T4DA 9ICKA 4X4QA 5CHGA 4FO6A 1Z2GA 3EHBB 3ETDA 1HW7A 1K3EA 2F93B 3MDCA 4JASA 4FK5C 2DR8A 1O9HA 1NTZH 2L6LA 3ER9B 1FXKC 5EIBD 4F5RA 2F66C 5L3FA 1NI8A 5TZVA 3CSXA 4G28B 1S77D 4X8AA 5IJ0A 4KLFA 3R66A 2QEXV 4LEZA 3DGEA 3E8FA 3CJHB 9ICLA 3CS5A 1YJWV 4S3NA 1N4CA 3SGIA 2ZH2A 1KYOF 4TUYB 4I2DA 1NKDA 4R6ZA 2PXIA 1VQ7V 4NM1A 4OX9O 1OCZC 2ZH5A 1EFRG 5J2TB 1QVFU 2JJ1G 7ICHA 1R73A 5IIMA 4CS4A 3OWGA 2EIJC 2O1PA 3H1HH 3CRMA 1HNZB 2VANA 3OGUA 4X1KB 4PGXA 3SJBC 4X5VA 2JGDB 4J80A 1VQPV 5L3EA 4TUQA 2QWNB 1WAZA 2Q0AA 5IIIA 2UXCB 2HN1A 4ZIBA 3RYCB 1IBMO 2XOKG 1ZQMA 3E8BA 3G4SV 4M9HA 1WA8A 1AVMA 1S5HC 5HRFA 3OV7A 3FFQA 4TSFG 3LSQA 3J81N 8ICWA 1V55C 4ABMA 5JJEB 5IWAO 2O5AA 5EZYB 2BCQA 4P9PA 2W6IG 2H3OA 5L3CA 5JQGA 2YXYA 4GZRB 1IXBA 2ZH4A 4R7CA 1ZQFA 5DDYA 4LF8O 4DR7O 4DOCA 4DR4B 4LC1A 3RGBA 1NH2D 2YI8A 1TUBA 3R65A 3JATA 2NR5A 3K06A 2Q67A 4HBNA 4NR1A 4LF6O 3UXOA 1ZQQA 1RSOA 3APQA 3HJ1A 1AP6A 4GT1A 3CPWU 2PZSA 4QE7A 1AI4A 3LNMB 3H1LH 4HYOA 5BZBA 1SQBH 5CR0A 3CWBH 1WN7A 5DN6G 1R8BA 3RYFA 1EM1A 1ZQWA 2YIBD 3JCUZ 1LUVA 5LXTB 1GN4A 2WLLA 4JI2O 3LDCA 5BMVA 1ZQUA 3KKYA 3CMAV 4LFCB 3X2QC 3K57A 2HKOA 4H37A 4EEBA 5D49A 4NXMO 3MBYA 4R66A 3OUYB 3K3WA 4TT3G 3P32A 5LMUB 3ERCC 2ZH7A 1BHAA 5TISZ 4ZI7B 4DO9A 1SQGA 1RPRA 4TV8B 2R9IA 3UQ0A 4UVAA 3JPTA 2IM9A 4RPZA 1THZA 1QVGU 1YXBA 4I2EA 3WFQE 2B51A 4Q6GA 4X62B 1MOFA 2UXNA 1YDXA 4QZ8A 4I9WA 4DV6B 1MIVA 2DWEC 3JD1A 4JV5O 3MHSC 1XMOO 4Z6DA 3OGCC 3JALB 2KG7B 3ZS8C 5DKWA 4DV3B 1S5LZ 2UXXA 3MHHC 2UXBB 4QZCA 3HKEB 4IIJB 4U3JA 4LZDA 5J2DA 4M04A 1K4DC 7ICVA 4JI6B 3RH5A 2B56A 2M7WA 2QGNA 1S5JA 2RN9A 1ZQXA 2Y48A 3OD4A 4O4JB 3SJQC 1D5NA 3BPZA 4CBCA 9ICEA 8ICCA 1BZKA 3B8NA 4Z6EA 2F43G 4UB5A 1SZTA 4R8CA 5JWPA 3GB7C 5CA7A 4OAFA 2ID1A 1W0JG 5B66Z 4D7TA 3KZIZ 4WFAV 4RQ3A 4I0XB 1F7YA 4QGPA 4QZIA 2Q69A 4MFAA 4FHWA 4XDJA 3ZHVA 5FNVB 4ATBA 3CCEV 1GRJA 3AQNA 1QNMA 2E74B 5LOVA 3ETQA 1S72V 4GCZA 3JARA 9ICJA 4UBCA 1UFIA 2X0LA 2OTLV 2ZH1A 3RJGA 2YXLA 1E1QG 3M99B 4X65O 2DYSC 3ZX6A 1IBMB 4D6TH 2QWRB 1GM9A 1RPLA 3ZMUA 4XA5A 4UB1A 1ZJMA 2EX3A 4RQ8A 4GLXA 4PPXA 2NLJC 4QPJA 1IBKO 4P30A 3OEHG 4X20B 1VQKV 1GO3F 3O9OA 5HRHA 5LP6C 2BE3A 5H5NA 4UB3A 1F5AA 2DRAA 4I28A 1KECA 2JIZG 3ZRSA 4GKJB 5DDMA 3H38A 4LZGA 2Q66A 8ICNA 1OCCB 4W4LA 4I29A 3ASOC 5CBGA 4UVCA 1H2LA 3DSQA 3C3TA 4NM2A 3OTOB 4IYHA 5J2GA 2CGNA 1VP7A 3ABKB 3CCQV 3AG2C 5IINA 4I2CA 5IE9A 2BCRA 1GM7A 4RWNA 2QKAA 1Q7YW 5B3QA 4BW9A 1HWYA 3SR2C 3RT3C 3C2KA 5GONA 4QZHA 2HHPA 4GKKO 1ZLZA 5J0PA 3HIYA 3MDAA 1I5XA 5IIJA 3JPSA 4WCWA 4DV0B 1LR1A 2AHZA 4BIOA 1XL4A 4JI2B 9ICGA 1KKDA 4JLZA 1BGYH 4K97A 2E75B 5CA3A 1DF4A 5J2CA 2ZH3A 4NXMB 4F5NA 4XDKA 1AJQA 4O4HA 1IDSA 1D5AA 3HKDB 3K5LA 2Y4TA 3H1KH 4R65A 4OAGA 4LFAO 2JJ2G 2OCCC 2VQEO 3JSLA 2P4VA 4M2YA 2DQ3A 4YJ3A 2JS5A 1TVAA 3NR7A 1XI1A 4DR1B 4EGWA 1ZAUA 4I2AA 5IDJA 2QWQB 1GTOA 1G4YB 4PA7A 4JI0O 4QE9A 4F4LA 1BS3A 3HX0A 1JX9A 3A0RA 1VARA 2NNUA 1N34B 3NVOA 1ZQPA 4FH5A 3F7VC 4E80A 1YLQA 1Q5OA 1Q43A 3L72H 5LHIA 3DTUB 3BRCA 8ICZA 4ZKIA 4N23A 3OUSA 2JEXA 3P30A 3CJHA 5LA6B 1I94B 4RPXA 4O2BB 5J0SA 1ZQVA 2ZH9A 5B5EZ 1SZXA 3ABTA 2Q7GA 4BR6A 2NN4A 4AT8A 1HNWO 4MF2A 4RUEA 5J2TA 1FJGB 8ICMA 3ZMTA 1FFXA 2IW5A 4FH3A 4KLSA 3TCUA 1YIJV 4JAAA 2VRZA 9ICAA 1FA0A 2YEVB 4I50B 1DK1A 9ICXA 3QF7A 2EIMB 9ICPA 5CFUA 2XAFA 3JPRA 5J2FA 2D3OW 1K7DA 1G6UA 3W7XA 1PNKA 4K0KB 5IIOA 4LF5O 4X1IA 2DYRB 4PI0A 1WJZA 4W4KA 3JCFA 2UUCO 5IYCO 3GWKC 1HR0B 1GK9A 2BSKB 4YMNA 3D36C 3JYCA 3BABA 2G38A 1AB3A 4QZBA 4K9AA 4JI5B 4F5PA 5J9PC 4NTYA 4PJ0Z 1MIYA 2PFQA 3MGIA 2GTSA 4Z6CA 4FLYA 5CWRA 1R3LC 4NXVA 4RQEA 1RM1C 1UPGA 1ZL8A 4I9QA 3CD6V 5DB7A 4R64A 5BR8B 2VQFB 3CCLV 8ICQA 1VQOV 1QR8A 2Y0PA 3ZHTA 4G2KA 4RQ4A 2M2WA 1JA8A 2N04A 1DF5A 1L0NH 4JZ2A 5J0WA 1BSMA 4NXTA 1XSPA 4NYKA 2ZKOA 3J80N 1I5YA 4NKGB 1PP9H 4WBNB 2EINC 3UO3A 4MVSA 3EVKA 1TAEA 4WBYA 1MA1A 2EULA 4YIOA 4J9YB 1QLNA 2B5UA 1AP5A 5LYJB 2V4DA 3WG7B 3ZRWA 4IL6Z 4DYLA 4CH6A 4KHPO 5CP2A 2BTQA 4UCUA 4IQVA 7ICJA 1FXHA 1Y76A 3OR6C 3K79A 4TV9A 3OAAG 4B08A 5J0QA 4KLMA 4DK1A 3WFOA 4EBKA 1ZQGA 1Y74A 1GKFA 1M93A 4H13B 3RFRA 1NH2B 1QCEA 1ZJNA 4AQYB 4M9NA 4KLIA 4KFMA 1H8HG 1L0LH 1W2BU 1BPEA 5CFTA 4NB5A 4MFCA 1VF5B 4TUPA 4NVPA 1FXKA 4RT3A 1BPXA 3ISCA 5EYPB 2VQEB 1Q79A 4KLLA 1H2KA 1ZX3A 4RQFA 4X4UA 3CCJV 1HNZO 5HC9A 4FPPA 1O9GA 2CGOA 2ZH6A 2JK5C 4X4TA 4MVMA 4IIJA 2V7QG 3V72A 5IYZB 2UXCO 4I2FA 4NLNA 3N2KA 2DRBA 9ICUA 1YTFD 1XSNA 5CB1A 4YY3O 1ZQHA 2AGAA 2P7TC 3CCUV 3RVZA 3ZEDA 4MTOA 3K59A 2FMSA 1BT8A 2WWWA 3L73H 4B3RB 2DE0X 1HUOA 4FM1A 3JD3A 4PHAA 5KMGA 1VFGA 4OGQB 5B3SB 3B2EE 4JGSA 1EN5A 1SQPH 4UCSA 3L71H 9ICSA 2Q7EA 1NTKH 2XAQA 4ZOLB 4MTFA 3G80A 4KLOA 1K4CC 4O4LA 4FIPC 1YF2A 4M47A 4PI2A 2PFPA 1KD1W 1ROPA 3ML0A 2QM4A 2CK3G 3E86A 4J42A 1BMFG 2QWOB 4LWSA 3H1JH 4JAVA 7ICTA 1S3JA 4EBJA 1AROP 1VQ8V 2P67A 1P84F 4XQ8A 5GTIZ 3E89A 5EBLC 5BOMA 2DW4A 4FZ0A 4X9QA 1SKVA 4DR2O 4NXNO 4DR5B 3RYIA 7ICIA 4U7OA 8ICSA 2PFOA 4NTXA 4MS2A 1R6KA 2RQ6A 1OCOB 1TUEB 2JS3A 1VQ5V 2ZD9A 8ICKA 3VOUA 4UB6Z 4DOAA 3H01A 4LFCO 4RQ6A 7ICUA 4FFKA 2QKSA 3JD0A 4PHPA 4AT7A 3N2GA 3ZN1A 8ICFA 5J0OA 1TGOA 5DEDA 3M8AA 8ICBA 3BAAA 2A0LA 3LSUA 1W59A 3RN4A 3BVOA 4IYIA 2F4VB 4LCUC 4YN4A 9ICBA 7ICNA 5H2FZ 4IQTA 4K35A 4NTWA 4UV9A 9ICRA 2ARHA 1AR1B 4DV6O 3OEEG 2ISOA 1PNMA 3AG3B 3JASA 4DV3O 1VIBA 4QZAA 1Y67A 4I55B 2HEPA 4F6RB 4KHPB 1N0JA 2UXBO 2IHOA 3CB2A 5BOLA 3C3SA 4UB2A 4C7UA 3OT7A 3RJJA 4JI6O 9ICCA 1M90W 5HHIA 3ICXA 2E3CA 3JYYA 4QZDA 8ICGA 1FAFA 4PHZA 4JI3B 4PHEA 2XAHA 2CTRA 4MTXA 3OW2U 2QWPB 4FO1A 1V9PA 4H0LB 4DV5B 4E4EA 4AT9B 1PD3A 4XDLA 5CB4B 4FHYA 2Q4PA 2IUBA 2PGGA 4ZBMA 3VQYA 4B3MO 4M9JA 2WA3A 4AILC 1BHBA 1ZQAA 3V7JA 2M2TA 5DB9A 3OVBA 1U96A 3FAVB 5JTGA 1XHXA 4XJEA 4EP7A 4TQFA 4IT5A 2BOCC 4UVBA 3LDDA 4KLHA 1V54B 4EB6A 5DB8A 3RYHA 5J2BA 2LO1A 1YSCA 1T5EA 3UXPA 1CP9A 5CFSA 2P5OA 5HRGA 1H38A 3OGIB 4YY3B 1FYJA 3RJKA 1QU7A 4NXZA 3PHZA 2Q0OC 5J0XA 3OR7C 2DN9A 4MSWC 2BTOA 3AEIA 3IC9A 5D63A 4F5QA 5FPOA 3C18A 4X4NA 3E22B 1D2DA 1HUZA 4MTGA 4WC5A 3D8CA 5CA1B 4GKJO 1W0KG 3ZCCA 9ICTA 4I4TB 4RQ1A 4UFZA 1ZQJA 1NBMG 5ITZB 5IIKA 4F6EA 2EJ7A 3OTOO 1XEQA 2MW2B 4DR3B 1TVKB 5JCOC 4FJCC 3N27A 4LNUB 3PNCA 4GX1A 3JAKA 1KP3A 3QO8A 3WU2Z 5LP6A 4HNAB 2BOBC 4JZGA 1OCCC 2HJFC 4TUSA 1JJ2U 4YJ2A 2GA9D 2UU9B 3E83A 3SYPA 3TFRA 1K33A 3QVNA 4DR2B 3G6EV 5DBAA 3UT5A 2XAJA 4NXNB 2QDOA 4Z1MG 4WBZA 4KLGA 1ZQSA 4O67A 4DV0O 3ABKC 4YD1A 1YZBA 1KDHA 3K03A 1XQ8A 5KX5A 1Q86W 4N21A 1SETA 3L9DA 4TWKA 2FYUH 1BQZA 5JVDB 1JQRA 5H9CA 2Q6AA 1FS0G 3AG4B 2IH3C 2XT9A 2XTAA 3RJIA 2AHYA 3H3AA 3ZHSA 3THOA 2Z3YA 3K0GA 3CYOA 1NVPD 4DR1O 1NT2B 2A3QA 1MABG 3JPQA 1M56B 3G6BA 3K75D 5CMUA 2FMLA 2GDSA 4PDRA 1JMKC 3FB5C 1ZQYA 4FFBB 1N34O 2LW7A 3NYBA 4H44B 3PMLA 1OV9A 5CA0B 3W7UA 1P7BA 4UD4A 3UPQA 4I5SA 8ICYA 2QJ1A 3KCYA 3H37A 4FM2A 4DRXA 3W7TA 1Y4MA 2OTJV 1I94O 8ICLA 1Q6HA 1J95A 1TFWA 2EILB 3MD0A 4X4RA 3DC5A 4FVMA 2EIKB 9ICOA 5KHJA 5KHIA 3PMNA 4B3MB 1KB9F 1FJGO 3P3NA 1BPZA 2ZE5A 3RWRD 5A2QN 3LNNA 1OU5A 2LQTA 4UCOA 1JQ0A 8ICTA 1PV0A 2GWSA 7ICRA 3CX5F 5D5PA 3T1YO 1RFYA 1XBLA 2MK3A 3B8MA 4XQ7A 7ICLA 5J2HA 1SA0A 1K34A 2CUGA 2OYQA 3AQKA 5B1BB 4K0KO 1VEWA 3OVSA 2B1IA 4J7JA 3K5NA 4FLTA 1HR0O 2DR5A 2DWDC 3JSNA
chains in the Genus database with same CATH topology
3HW8A 5DB6A 4QZFA 3AU6A 4K4GA 9ICAA 4YMMA 1FA0A 5HREA 9ICXA 1ZQCA 9ICPA 7ICQA 3JPRA 5J2FA 4JWNA 4RQ5A 4K4IA 9ICFA 5IIOA 3WFRE 8ICAA 4RWPA 2M2VA 4TURA 9ICNA 4YMNA 1KEJA 3AQLA 4QZBA 1ZQDA 4F5PA 4X4SA 1MIYA 3H39A 2PFQA 2FMPA 3MGIA 5CWRA 4Z6CA 4RT2A 1R8CA 2P66A 5DB7A 1MIWA 4R64A 4KLUA 8ICQA 3MGHA 1TV9A 4LT6A 4RQ4A 2M2WA 3V7KA 5J0WA 4IQUA 1ZQEA 1XSPA 4M0AA 1NO5A 5J2KA 2DR7A 4UBBA 4RQ0A 4UD5A 4GXJA 4RWOA 7ICPA 4WBYA 4GXKA 4MFFA 4XUSA 5CP2A 4IQVA 7ICJA 1UETA 4QZGA 3UQ2A 4IG8A 8ICIA 5J0QA 9ICKA 4KLMA 4X4QA 5CHGA 4FO6A 3WFOA 4EBKA 5J0TA 1ZQGA 2PBEA 4WC1A 5J0UA 3MDCA 1ZJNA 4JWMA 4M9NA 4KLIA 4I27A 2DR8A 4GXIA 5J2EA 1PX5A 5F2VO 1BPEA 3UPSA 4F5RA 4KLTA 4MFCA 4TUPA 5TZVA 4RT3A 1BPXA 3ISCA 4I2BA 4KLFA 4PGYA 5HRLA 1Q79A 2NRKA 3C2MA 4KLLA 1ZQKA 4FHXA 9ICLA 4X4UA 4S3NA 4X0AA 4I2IA 5HC9A 2ZH2A 4KLEA 4I2DA 4AT9A 4X4TA 2ZH6A 4UAWA 2BCSA 3UXNA 5J0RA 3V72A 1JMSA 2PXIA 4I2FA 4NM1A 4NLNA 3JPPA 4NLKA 2ZH5A 2DRBA 9ICUA 1XSNA 5CB1A 1RZTA 7ICHA 5IIMA 4RPYA 1ZQHA 8ICVA 8ICRA 4KLDA 2O1PA 2VANA 2FMSA 3OGUA 4PGXA 4X5VA 3TFSA 4TUQA 5IIIA 1HUOA 4PHAA 3RH6A 1VFGA 4NKUA 4WC7A 1ZQMA 4M9HA 1ZQBA 9ICSA 8ICOA 1R89A 5HRFA 5HRDA 3OV7A 1WOTA 4KLOA 2ZHAA 8ICWA 4M47A 3AU2A 2IHMA 3JZ0A 2PFPA 4M5DA 2BCQA 2O5AA 4Z6FA 2BCVA 2FMQA 7ICTA 2ZH4A 1BPBA 1ZQFA 4EBJA 4XQ8A 1XSLA 5DDYA 4DOCA 5BPCA 4XRHA 5BOMA 7ICIA 3C5GA 1ZQOA 8ICSA 2PFOA 3UXOA 4UAZA 1ZQQA 3HJ1A 3C66A 2M2UA 1ZQIA 5CR0A 8ICKA 4WC3A 4AT7B 4DOAA 1V4AA 5J2IA 4RQ6A 7ICUA 1R8BA 3AQMA 4PHPA 4AT7A 1ZQNA 1ZQWA 4FHVA 4YCXA 8ICFA 5J0OA 5DEDA 1KNYA 4YD2A 2ISPA 8ICBA 5HHHA 1ZQUA 4M9LA 9ICBA 4YN4A 5D49A 7ICNA 3MBYA 4R66A 3OUYB 4IQTA 9ICRA 4PHDA 4E8FA 2ZH7A 4X4OA 4DO9A 3RJHA 3OUYA 2ISOA 9ICHA 3C2LA 4M9GA 3UQ0A 3JPTA 9ICQA 4RPZA 4QZAA 4LVSA 3HWTA 3GDXA 4WC2A 5D46A 5BOLA 4I2HA 4I2EA 4UB2A 3WFQE 4X4PA 5HR9A 4MF8A 3RJJA 9ICCA 5HHIA 2RFFA 3JYYA 4QZDA 4QZ8A 4K4HA 4X0BA 8ICGA 4FHPA 1MIVA 3RJEA 4Z6DA 4PHEA 5DKWA 3LQCB 4P4PA 4AT9B 4QZCA 4FHYA 1TFYA 4LZDA 5J2DA 4M04A 1ZQRA 8ICPA 3B0XA 4M9JA 4O5EA 7ICVA 3RH5A 1ZQAA 4QZEA 3V7JA 2M2TA 5DB9A 3OVBA 5DECA 1ZQXA 2ZHBA 4EP7A 2PFNA 9ICEA 4NLZA 8ICCA 3LK9A 4Z6EA 4UB5A 4KLHA 3ISDA 3C5FA 5DB8A 3JPNA 5CA7A 5J2BA 2ID1A 3UXPA 4DOBA 4RQ3A 4PH5A 5HRGA 4ATBB 4QZIA 4F5OA 2DVIA 4MFAA 4FHWA 9ICWA 4ATBA 3RH4A 3AQNA 3RJKA 4NXZA 2BPCA 5J2JA 3OVAA 5J0XA 3B0YA 9ICJA 4RQ7A 4UBCA 4KLJA 4F5QA 3C18A 4X4NA 1UEUA 8ICEA 2ZH1A 1HUZA 3RJGA 7ICKA 4WC5A 7ICSA 1RPLA 9ICTA 4XA5A 4UB1A 1NOMA 4YMOA 4RQ1A 1ZJMA 4RQ8A 2BPFA 5HRBA 1ZQJA 4PPXA 2BPGA 5IIKA 5HRHA 1MQ3A 7ICGA 2BE3A 5EOZA 4UB3A 5HRIA 1F5AA 1UEVA 4I28A 1BPYA 2DRAA 3PNCA 1R8AA 5DDMA 3H38A 4LZGA 2Q66A 8ICNA 2DR9A 4P2HA 4TUSA 4I29A 2W9MA 8ICJA 4IQWA 1BPDA 4NM2A 3TFRA 4QZ9A 4RQ2A 7ICOA 5DBAA 5J2GA 4WBZA 2BCUA 4KLGA 1ZQSA 4YD1A 5IINA 4I2CA 4RWNA 1KDHA 2BCRA 5D4BA 3ISBA 5J0YA 4P4MA 9ICIA 4O5KA 3C2KA 3L9DA 4UAYA 4QZHA 2HHPA 1JQRA 5J0PA 3HIYA 3MDAA 1MQ2A 5IIJA 3JPSA 4UB4A 1ZQLA 4WCWA 3WFSC 3RJIA 3H3AA 4NY8A 7ICFA 7ICMA 3RJFA 9ICGA 5IILA 2ZH8A 4PGQA 5J2CA 2ZH3A 5DBCA 4WC0A 3JPQA 4F5NA 4I2GA 3K75D 5J29A 4I2JA 1ZQYA 4R65A 5CJ7A 4P4OA 3HJ4A 3NYBA 4M2YA 9ICVA 3PMLA 1Q78A 4UD4A 3UPQA 1TVAA 4O5CA 3V7LA 8ICYA 3H37A 2I9GA 4I2AA 4WC6A 1ZQZA 8ICLA 1TFWA 3HX0A 4X4RA 3JPOA 1ZQPA 4FH5A 4E80A 9ICOA 1YLQA 1JN3A 3PMNA 4KLQA 4NKTA 4R63A 8ICZA 5DBBA 1BPZA 8ICXA 1VJ7A 1OU5A 4RPXA 8ICTA 1JAJA 4E7XA 2GWSA 4AT8B 5J0SA 7ICRA 1ZQTA 1ZQVA 2ZH9A 4WC4A 9ICMA 4AT8A 3AUOA 4XQ7A 5J2AA 7ICLA 5J2HA 4MF2A 4O9MA 8ICMA 4FH3A 3AQKA 5HRKA 4RWQA 3OVSA 3WFPA 4KLSA 8ICHA 4X4VA 7ICEA 2DR5A 8ICUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HW8 A;  5DB6 A;  4QZF A;  3AU6 A;  4K4G A;  9ICA A;  4YMM A;  1FA0 A;  5HRE A;  9ICX A;  1ZQC A;  9ICP A;  7ICQ A;  3JPR A;  5J2F A;  4JWN A;  4RQ5 A;  4K4I A;  9ICF A;  5IIO A;  3WFR E;  8ICA A;  4RWP A;  2M2V A;  4TUR A;  9ICN A;  4YMN A;  1KEJ A;  3AQL A;  4QZB A;  1ZQD A;  4F5P A;  4X4S A;  1MIY A;  3H39 A;  2PFQ A;  2FMP A;  3MGI A;  5CWR A;  4Z6C A;  4RT2 A;  1R8C A;  2P66 A;  5DB7 A;  1MIW A;  4R64 A;  4KLU A;  8ICQ A;  3MGH A;  1TV9 A;  4LT6 A;  4RQ4 A;  2M2W A;  3V7K A;  5J0W A;  4IQU A;  1ZQE A;  1XSP A;  4M0A A;  1NO5 A;  5J2K A;  2DR7 A;  4UBB A;  4RQ0 A;  4UD5 A;  4GXJ A;  4RWO A;  7ICP A;  4WBY A;  4GXK A;  4MFF A;  4XUS A;  5CP2 A;  4IQV A;  7ICJ A;  1UET A;  4QZG A;  3UQ2 A;  4IG8 A;  8ICI A;  5J0Q A;  9ICK A;  4KLM A;  4X4Q A;  5CHG A;  4FO6 A;  3WFO A;  4EBK A;  5J0T A;  1ZQG A;  2PBE A;  4WC1 A;  5J0U A;  3MDC A;  1ZJN A;  4JWM A;  4M9N A;  4KLI A;  4I27 A;  2DR8 A;  4GXI A;  5J2E A;  1PX5 A;  5F2V O;  1BPE A;  3UPS A;  4F5R A;  4KLT A;  4MFC A;  4TUP A;  5TZV A;  4RT3 A;  1BPX A;  3ISC A;  4I2B A;  4KLF A;  4PGY A;  5HRL A;  1Q79 A;  2NRK A;  3C2M A;  4KLL A;  1ZQK A;  4FHX A;  9ICL A;  4X4U A;  4S3N A;  4X0A A;  4I2I A;  5HC9 A;  2ZH2 A;  4KLE A;  4I2D A;  4AT9 A;  4X4T A;  2ZH6 A;  4UAW A;  2BCS A;  3UXN A;  5J0R A;  3V72 A;  1JMS A;  2PXI A;  4I2F A;  4NM1 A;  4NLN A;  3JPP A;  4NLK A;  2ZH5 A;  2DRB A;  9ICU A;  1XSN A;  5CB1 A;  1RZT A;  7ICH A;  5IIM A;  4RPY A;  1ZQH A;  8ICV A;  8ICR A;  4KLD A;  2O1P A;  2VAN A;  2FMS A;  3OGU A;  4PGX A;  4X5V A;  3TFS A;  4TUQ A;  5III A;  1HUO A;  4PHA A;  3RH6 A;  1VFG A;  4NKU A;  4WC7 A;  1ZQM A;  4M9H A;  1ZQB A;  9ICS A;  8ICO A;  1R89 A;  5HRF A;  5HRD A;  3OV7 A;  1WOT A;  4KLO A;  2ZHA A;  8ICW A;  4M47 A;  3AU2 A;  2IHM A;  3JZ0 A;  2PFP A;  4M5D A;  2BCQ A;  2O5A A;  4Z6F A;  2BCV A;  2FMQ A;  7ICT A;  2ZH4 A;  1BPB A;  1ZQF A;  4EBJ A;  4XQ8 A;  1XSL A;  5DDY A;  4DOC A;  5BPC A;  4XRH A;  5BOM A;  7ICI A;  3C5G A;  1ZQO A;  8ICS A;  2PFO A;  3UXO A;  4UAZ A;  1ZQQ A;  3HJ1 A;  3C66 A;  2M2U A;  1ZQI A;  5CR0 A;  8ICK A;  4WC3 A;  4AT7 B;  4DOA A;  1V4A A;  5J2I A;  4RQ6 A;  7ICU A;  1R8B A;  3AQM A;  4PHP A;  4AT7 A;  1ZQN A;  1ZQW A;  4FHV A;  4YCX A;  8ICF A;  5J0O A;  5DED A;  1KNY A;  4YD2 A;  2ISP A;  8ICB A;  5HHH A;  1ZQU A;  4M9L A;  9ICB A;  4YN4 A;  5D49 A;  7ICN A;  3MBY A;  4R66 A;  3OUY B;  4IQT A;  9ICR A;  4PHD A;  4E8F A;  2ZH7 A;  4X4O A;  4DO9 A;  3RJH A;  3OUY A;  2ISO A;  9ICH A;  3C2L A;  4M9G A;  3UQ0 A;  3JPT A;  9ICQ A;  4RPZ A;  4QZA A;  4LVS A;  3HWT A;  3GDX A;  4WC2 A;  5D46 A;  5BOL A;  4I2H A;  4I2E A;  4UB2 A;  3WFQ E;  4X4P A;  5HR9 A;  4MF8 A;  3RJJ A;  9ICC A;  5HHI A;  2RFF A;  3JYY A;  4QZD A;  4QZ8 A;  4K4H A;  4X0B A;  8ICG A;  4FHP A;  1MIV A;  3RJE A;  4Z6D A;  4PHE A;  5DKW A;  3LQC B;  4P4P A;  4AT9 B;  4QZC A;  4FHY A;  1TFY A;  4LZD A;  5J2D A;  4M04 A;  1ZQR A;  8ICP A;  3B0X A;  4M9J A;  4O5E A;  7ICV A;  3RH5 A;  1ZQA A;  4QZE A;  3V7J A;  2M2T A;  5DB9 A;  3OVB A;  5DEC A;  1ZQX A;  2ZHB A;  4EP7 A;  2PFN A;  9ICE A;  4NLZ A;  8ICC A;  3LK9 A;  4Z6E A;  4UB5 A;  4KLH A;  3ISD A;  3C5F A;  5DB8 A;  3JPN A;  5CA7 A;  5J2B A;  2ID1 A;  3UXP A;  4DOB A;  4RQ3 A;  4PH5 A;  5HRG A;  4ATB B;  4QZI A;  4F5O A;  2DVI A;  4MFA A;  4FHW A;  9ICW A;  4ATB A;  3RH4 A;  3AQN A;  3RJK A;  4NXZ A;  2BPC A;  5J2J A;  3OVA A;  5J0X A;  3B0Y A;  9ICJ A;  4RQ7 A;  4UBC A;  4KLJ A;  4F5Q A;  3C18 A;  4X4N A;  1UEU A;  8ICE A;  2ZH1 A;  1HUZ A;  3RJG A;  7ICK A;  4WC5 A;  7ICS A;  1RPL A;  9ICT A;  4XA5 A;  4UB1 A;  1NOM A;  4YMO A;  4RQ1 A;  1ZJM A;  4RQ8 A;  2BPF A;  5HRB A;  1ZQJ A;  4PPX A;  2BPG A;  5IIK A;  5HRH A;  1MQ3 A;  7ICG A;  2BE3 A;  5EOZ A;  4UB3 A;  5HRI A;  1F5A A;  1UEV A;  4I28 A;  1BPY A;  2DRA A;  3PNC A;  1R8A A;  5DDM A;  3H38 A;  4LZG A;  2Q66 A;  8ICN A;  2DR9 A;  4P2H A;  4TUS A;  4I29 A;  2W9M A;  8ICJ A;  4IQW A;  1BPD A;  4NM2 A;  3TFR A;  4QZ9 A;  4RQ2 A;  7ICO A;  5DBA A;  5J2G A;  4WBZ A;  2BCU A;  4KLG A;  1ZQS A;  4YD1 A;  5IIN A;  4I2C A;  4RWN A;  1KDH A;  2BCR A;  5D4B A;  3ISB A;  5J0Y A;  4P4M A;  9ICI A;  4O5K A;  3C2K A;  3L9D A;  4UAY A;  4QZH A;  2HHP A;  1JQR A;  5J0P A;  3HIY A;  3MDA A;  1MQ2 A;  5IIJ A;  3JPS A;  4UB4 A;  1ZQL A;  4WCW A;  3WFS C;  3RJI A;  3H3A A;  4NY8 A;  7ICF A;  7ICM A;  3RJF A;  9ICG A;  5IIL A;  2ZH8 A;  4PGQ A;  5J2C A;  2ZH3 A;  5DBC A;  4WC0 A;  3JPQ A;  4F5N A;  4I2G A;  3K75 D;  5J29 A;  4I2J A;  1ZQY A;  4R65 A;  5CJ7 A;  4P4O A;  3HJ4 A;  3NYB A;  4M2Y A;  9ICV A;  3PML A;  1Q78 A;  4UD4 A;  3UPQ A;  1TVA A;  4O5C A;  3V7L A;  8ICY A;  3H37 A;  2I9G A;  4I2A A;  4WC6 A;  1ZQZ A;  8ICL A;  1TFW A;  3HX0 A;  4X4R A;  3JPO A;  1ZQP A;  4FH5 A;  4E80 A;  9ICO A;  1YLQ A;  1JN3 A;  3PMN A;  4KLQ A;  4NKT A;  4R63 A;  8ICZ A;  5DBB A;  1BPZ A;  8ICX A;  1VJ7 A;  1OU5 A;  4RPX A;  8ICT A;  1JAJ A;  4E7X A;  2GWS A;  4AT8 B;  5J0S A;  7ICR A;  1ZQT A;  1ZQV A;  2ZH9 A;  4WC4 A;  9ICM A;  4AT8 A;  3AUO A;  4XQ7 A;  5J2A A;  7ICL A;  5J2H A;  4MF2 A;  4O9M A;  8ICM A;  4FH3 A;  3AQK A;  5HRK A;  4RWQ A;  3OVS A;  3WFP A;  4KLS A;  8ICH A;  4X4V A;  7ICE A;  2DR5 A;  8ICU A; 
#chains in the Genus database with same CATH topology
 4QZF A;  5KHH A;  4K4G A;  2XUM A;  4RAI A;  2Z0A A;  5AG2 A;  4YMM A;  2LJ2 A;  4HX0 A;  2EIM C;  4E2L A;  4JI5 O;  7ICQ A;  2WPD G;  2AXT Z;  4O68 A;  5KLV H;  3HKB A;  4JWN A;  4LEW A;  4RQ5 A;  4PA4 A;  1AJP A;  2LGW A;  2DYR C;  1YJN V;  2M2V A;  1Z5V A;  2XHB A;  2Q8V A;  9ICN A;  4KXR A;  3DXR A;  2CH7 B;  3SYC A;  5BR8 O;  2VQF O;  1VQ6 V;  3AQL A;  1L1F A;  1RP3 B;  4BWA A;  1DTO A;  1US6 A;  1YVW A;  3D36 A;  4GX0 A;  1VQM V;  4UV8 A;  4PV1 B;  4MVU A;  2A06 H;  1ENV A;  3NKU A;  2EJR A;  2HHH B;  2WLJ A;  1NQT A;  2GAF D;  4QNH B;  1YTF B;  2P66 A;  3CRQ A;  4KUM A;  1GMG A;  1JFF B;  3CME V;  4X64 B;  3Q4H B;  1MIW A;  2XAS A;  5IJ9 B;  5D62 A;  4O4I B;  3RBZ A;  3MGH A;  3FD9 A;  4O2A A;  3CRC A;  4EKW A;  2L35 A;  1XDC A;  3FYE B;  4MVR A;  1EN4 A;  3JAW B;  3IFX A;  1P4R A;  5LMN B;  1OCR B;  2P06 A;  5J2K A;  3K9S A;  4WFE A;  4PA6 A;  4B7K A;  4RQ0 A;  3ER8 C;  3S3W A;  1F51 A;  3UO2 A;  7ICP A;  1EZV H;  2UUA B;  4GXK A;  1K5S A;  4AQY O;  3WG7 C;  1GN3 A;  5EBM C;  4X1Y A;  2Y69 B;  1UET A;  1SRY A;  3ZHQ A;  3ASN B;  3ZMV A;  4EFE A;  2GSM B;  3UQ2 A;  4IG8 A;  1XNR O;  3AK2 A;  5JH7 A;  1YI2 V;  5J0T A;  3D3Q A;  5J2U A;  4WC1 A;  5J0U A;  4FMT A;  1PKX A;  5BXZ A;  4I27 A;  1NTM H;  2X6B A;  4GXI A;  5IYD O;  1K8A W;  1PX5 A;  5F2V O;  3UPS A;  4FM0 A;  3EXA A;  1F4N A;  4U3F H;  3WB1 A;  1IUR A;  1R6N A;  2KQX A;  3U11 A;  4JI4 O;  4QJF B;  5A9G A;  4CC5 A;  2N74 A;  1URF A;  2W0F C;  2HJD A;  4PGY A;  1Q6U A;  2YID A;  2NRK A;  2CE4 A;  3TGU H;  2ZCE A;  4DV4 O;  3ZMZ A;  1ZQK A;  4X0A A;  1AR4 A;  2WLI B;  2E5L B;  1Q3E A;  2CTP A;  4AT9 A;  2E76 B;  3WB0 A;  3SJA C;  1CEZ A;  4UAW A;  2BCS A;  4B3R O;  5J0R A;  4CH4 A;  4TUY A;  1KUQ A;  1BCC H;  3T1H B;  3G67 A;  1HP8 A;  4RPY A;  4JYC A;  4K98 A;  4XBF A;  1N8R W;  1LNQ A;  5D5Q A;  2GTA A;  3AK3 A;  4UCT A;  4JYY A;  3TFS A;  3UM7 A;  2Q7H A;  4X1K A;  4NKU A;  3T1Y B;  1GN6 A;  1WA8 B;  2B4V A;  4WC7 A;  2JGD A;  2RCV A;  5B3S C;  1SF9 A;  1ZQB A;  3RYC A;  4DXW A;  3P3P A;  3OFN G;  1R89 A;  1GPJ A;  1ORQ C;  5LHG A;  5HRD A;  4MVZ A;  2ZHA A;  3W7S A;  3AU2 A;  2IJI A;  5JQG B;  1LUW A;  4DR5 O;  1L8D A;  4M5D A;  1XOU A;  2RJZ A;  4AHC A;  4Z6F A;  2GV9 A;  5FPR A;  5L3B A;  4LH6 A;  2BCV A;  4U7N A;  3HR0 A;  4DV1 O;  4TQD A;  1BPB A;  3CC2 V;  4PA9 A;  3MDS A;  5EZY A;  5KHG A;  1TUB B;  1XSL A;  3JAT B;  3E8H A;  4UXN A;  4I4T A;  3JCZ A;  1AJN A;  2EZP A;  1RSO B;  2VS0 A;  3QO5 A;  4ASU G;  3FYI B;  3EF2 A;  1OJH A;  1XHZ A;  1OCO C;  4LBE C;  1DGS A;  4DUZ B;  4HNA A;  1G1X B;  1AR5 A;  4YHH O;  4IGG A;  3OMN B;  1WPX A;  3TET A;  5J2I A;  2F4V O;  1JCH A;  1QHT A;  5B1A B;  1BL8 A;  2LP7 A;  3VBB A;  3AQM A;  1M5I A;  1SQF A;  2WLL B;  1AI7 A;  2UXD O;  2OIE A;  5BMV B;  1KNY A;  4YD2 A;  2IU3 A;  1Y66 A;  2X6A A;  5LXT A;  2FB5 A;  2DMX A;  1B04 A;  4BAY A;  3A0H Z;  2PYL A;  4J9Z B;  4RWU A;  1F4M A;  1OZ0 A;  4PHD A;  4E8F A;  1VMG A;  1PPJ H;  4P2Z A;  4JLX A;  3OUY A;  4JI3 O;  2R70 A;  3AG3 C;  2JEU A;  1VF6 C;  4ZI7 A;  4UCV A;  3CCM V;  4DV5 O;  9ICQ A;  3FB6 C;  4TV8 A;  3HWT A;  1IBL O;  5HR9 A;  4CS2 A;  2IU0 A;  2DOS A;  5GTH Z;  2RFF A;  4X66 B;  1XMQ B;  1XNR B;  4X0B A;  4FHP A;  4MT8 A;  4X88 A;  4PDV A;  3W7W A;  2YIA A;  3OE7 G;  3FB7 C;  3RJE A;  5FL7 G;  4EED A;  5LBQ A;  3H1I H;  2ADP A;  2Z5U A;  2IJK A;  3JAL A;  1TFY A;  2QE7 G;  2KG7 A;  2IH1 C;  1X59 A;  3B0X A;  8ICP A;  2ADQ B;  3BFR A;  3HKE A;  2H8P C;  4QZE A;  4CZZ A;  5EK0 A;  3JD2 A;  1YJ9 V;  4JI4 B;  2K9P A;  2ZQM A;  3T2M A;  2ZHB A;  3JD4 A;  2QTO A;  3LK9 A;  2HVJ C;  1NS1 A;  4CS3 A;  4DV4 B;  2Y4U A;  4O4J A;  4FLX A;  1V54 C;  1MSW D;  3C5F A;  1P49 A;  3JPN A;  1SQQ H;  4CC6 A;  1FD9 A;  4DOB A;  4PH5 A;  2EWR A;  2JDI G;  4ATB B;  3CHX A;  4F5O A;  9ICW A;  2IJJ A;  1NVP B;  4I0X A;  3AG1 B;  1NR7 A;  3JAR B;  4BIU A;  3O65 A;  1YHQ V;  2W0X A;  1KQS U;  4FLW A;  5FNV A;  3ETG A;  3SYO A;  8ICE A;  3F7Y C;  2ZNJ A;  4DK0 A;  2PF4 E;  4DR3 O;  3SJC C;  4D7S A;  3GVM A;  1KMI Z;  1K9M W;  7ICS A;  4KP4 A;  4LR3 A;  1EZJ A;  4GX5 A;  3T1C A;  1K97 A;  2LW1 A;  4H33 A;  1R1B A;  4K3A A;  1WPB A;  2B1G A;  5HRB A;  2BPF A;  2BPG A;  2UU9 O;  4MVO A;  1MQ3 A;  3HKC B;  5EOZ A;  1YIT V;  1Y6X A;  3GWO A;  1BPY A;  4X20 A;  2KKW A;  2CAZ C;  4DV1 B;  4ZHQ B;  5JCO A;  3ZN0 A;  2DR9 A;  4P2H A;  4WF9 V;  5C8Y B;  4IQW A;  2P22 C;  4Z1V A;  4L8J A;  4QZ9 A;  3D3I A;  2ZE8 A;  2WLK A;  1PM9 A;  4MVQ A;  5GON B;  3QTC A;  4PA3 A;  3Q4H A;  2ILM A;  4YHH B;  1QLE B;  2CTQ A;  2CTW A;  1P7G A;  5IJ9 A;  2FTK A;  2WLH A;  3K5O A;  4JTC B;  3AG4 C;  3IJ4 A;  2QA4 V;  1VQ9 V;  1GN2 A;  2HFE C;  3L75 H;  2WAM A;  4UB4 A;  4LFB B;  2UXD B;  3ABL B;  1ZQL A;  1AIL A;  4DR6 B;  1Z5W A;  3FX7 A;  1CXZ B;  5B1N A;  7ICM A;  5B3P A;  1I7F A;  3NWI A;  1CPY A;  1M9N A;  3RJF A;  3I5D A;  5IIL A;  3FB8 C;  3ZRV A;  1EBO A;  1SS3 A;  5IY5 B;  5DBC A;  4O4H B;  4Z2W A;  1WB7 A;  3LDE A;  3VQV A;  4WC0 A;  3U10 A;  1UJW B;  1M56 C;  4O6A A;  1K73 W;  3PN1 A;  2WLM A;  3CCS V;  1KU9 A;  2HN2 A;  1JVM A;  5J29 A;  1MG1 A;  3K04 A;  4YJ3 B;  5CJ7 A;  4DV2 B;  4WFF A;  3HKD A;  1XNQ B;  5EBW C;  4O5C A;  1IBL B;  3K5M A;  4OPA A;  4LF9 B;  3VQW A;  3I55 V;  1XL6 A;  1ZQZ A;  4WC6 A;  4J7Z A;  5EC2 C;  1Q8I A;  3K58 A;  2EIL C;  2ZDI C;  4NXW A;  5D61 A;  3JPO A;  2UUB B;  3IAY A;  2EIK C;  4B3T B;  2YSU B;  1N33 O;  3HB3 B;  4KLQ A;  2GBO A;  2BCC H;  4J10 A;  4WQK A;  1VJ7 A;  2PTM A;  4KB6 A;  2YS8 A;  2WLI A;  1JAJ A;  4E7X A;  4DUY B;  4AT8 B;  2ZE7 A;  1ZQT A;  5LA6 A;  3CE2 A;  5EC1 C;  1FFX B;  4PDM A;  1WP7 A;  4O2B A;  5J2A A;  2ITC C;  1WNS A;  4B3S O;  4O9M A;  2ZIN A;  4JTD B;  5HRK A;  5B1B C;  1AI5 A;  3WFP A;  8ICH A;  1PL0 A;  4GYC B;  4LF7 B;  8ICU A;  1HNX B;  2FKX A;  5DB6 A;  3I56 V;  5KA6 A;  2QR4 A;  2GUZ B;  4LEY A;  4X1I B;  2YEV A;  4I50 A;  2YIC A;  2ZIM A;  5FLX N;  2HHH O;  5LGU A;  4RWP A;  3OM3 B;  3STZ C;  2B9Z A;  1KEJ A;  4X64 O;  4DO2 A;  1M57 B;  3L74 H;  1I0H A;  2BSK A;  1ZQD A;  5DM6 V;  4UUJ C;  4TOI A;  3SYQ A;  2FL4 A;  4FLU A;  1N32 B;  4X4S A;  2ODM A;  1WLE A;  3H39 A;  1MMM A;  1NZ6 A;  1ZL8 B;  2ZT9 B;  4RT2 A;  2QKC A;  1R8C A;  3B4S A;  2WSS G;  5LMN O;  2ZXW B;  3A2F A;  3ZBH A;  4KLU A;  2ZM6 B;  4WFH A;  2YXH A;  3BCC H;  4QIW F;  1QR9 A;  2UUA O;  1TV9 A;  5E1A C;  4OAH A;  2H94 A;  3OMA B;  3E35 A;  4MW8 A;  4IQU A;  1OCR C;  1ZQE A;  4JYA B;  3VQX A;  1GAX A;  4M0A A;  4J41 A;  1E1R G;  2DR7 A;  3OUF A;  2P6J A;  4UD5 A;  3ZRW B;  1M1K W;  1X4T A;  2BTQ B;  2BBH A;  3ABM B;  3ZIA G;  4WBN A;  1Y76 B;  4TV9 B;  2Y69 C;  2F23 A;  3UCS C;  4NXU A;  5LYJ A;  2X7R B;  3K08 A;  3ASN C;  1Y74 B;  3APO A;  8ICI A;  2AZ2 A;  3SYA A;  2PBE A;  1A32 A;  2AZ0 A;  5L3D A;  4JWM A;  3IGA C;  2Q73 A;  2ETN A;  4L87 A;  1VQL V;  3LUT B;  1Q90 D;  1FXK B;  2KSD A;  2E5L O;  5J2E A;  3E8G A;  4KLT A;  3AG7 A;  2O57 A;  4A5U B;  2YUA A;  3ZHU A;  4MKP A;  4BIZ A;  4I2B A;  3CCR V;  3T1H O;  1R6T A;  4LEV A;  5HRL A;  3C2M A;  4K8V A;  4WH5 A;  5EYP A;  4FHX A;  5KAI Z;  1J5E O;  1JOY A;  4I2I A;  4KLE A;  2XND G;  1F23 A;  3N2K B;  1MZE A;  3UXN A;  1VF7 A;  4JF3 A;  2YIB A;  1JMS A;  3HPL C;  4JPR A;  1BQ0 A;  3JPP A;  4NLK A;  1OCZ B;  1DLB A;  1E79 G;  5IYZ A;  1N33 B;  1RZT A;  2EIJ B;  8ICV A;  8ICR A;  4KLD A;  4DW0 A;  2IBZ H;  5KMG B;  2RMK B;  5CN0 A;  2VWJ A;  3K0D A;  3CXH F;  1B06 A;  4OX9 B;  4KM5 A;  3RH6 A;  1MNG A;  3K7D A;  5EIB C;  1IVS A;  4JTA B;  4I0U A;  4O4L B;  1WB8 A;  4B3S B;  8ICO A;  2FCL A;  3SPC A;  2F1M A;  1WOT A;  1V55 B;  4JI1 O;  3S3X A;  2IHM A;  4LWS B;  3JZ0 A;  4ZOL A;  1SER A;  5JJN B;  2OIG A;  4CH3 A;  2FMQ A;  2Y0I A;  2GHY A;  3L70 H;  2DJV A;  4DUZ O;  3BHP A;  3WFV A;  3JAM N;  3RYI B;  5BPC A;  4XRH A;  4FLV A;  3C5G A;  3ETE A;  1ZQO A;  5IWA B;  4UAZ A;  3HKC A;  1U97 A;  3C66 A;  4JAU A;  2M2U A;  3F5T A;  4WCE V;  4LF8 B;  1ZQI A;  4DR7 B;  4WC3 A;  4AT7 B;  4ZHQ A;  4GX2 A;  1XRE A;  1H2N A;  1V4A A;  5B1A C;  1AI6 A;  5C8Y A;  1B6Q A;  3N2G B;  1JR9 A;  1SES A;  4K8X A;  4CH5 A;  1ZQN A;  4P9O A;  1MZF A;  4LF6 B;  4FHV A;  5H6R A;  4YCX A;  3LSS A;  5JJJ B;  4LF4 O;  2ISP A;  5HHH A;  1NU1 H;  4IHJ B;  4M9L A;  1S0V A;  1ZUQ A;  3X2Q B;  2DQ0 A;  1R3J C;  1Q6I A;  5CHE A;  1KKC A;  4X66 O;  1XMQ O;  3JAS B;  4X4O A;  1KP2 A;  3RJH A;  9ICH A;  1BE3 H;  3C2L A;  4R50 A;  4M9G A;  2ZE6 A;  1ZSP A;  2YDE A;  4LVS A;  2W6J G;  2YI9 A;  3GDX A;  4WC2 A;  5D46 A;  4I2H A;  1VF6 A;  4I55 A;  4X4P A;  4F6R A;  1NR1 A;  5IJ0 B;  4MF8 A;  3ABU A;  4PEL A;  4GUN A;  4K99 A;  4JYB A;  4K4H A;  2A7W A;  1K5Q A;  3T4Z A;  2Q9L A;  5K1X A;  1XIL A;  3LQC B;  4MW3 A;  4P4P A;  2K1E A;  1H2S B;  4X89 A;  1ZQR A;  5KAF Z;  4O5E A;  3U0Z A;  5CB4 A;  5LL6 Y;  2QM8 A;  5L3G A;  1B3Q A;  5DEC A;  3J7A U;  3TK1 A;  2PFN A;  4JV5 B;  1XMO B;  1N0N A;  2ZR3 A;  4NLZ A;  3RVY A;  1KC8 W;  4EB6 B;  3FAV A;  1XUQ A;  3PJS K;  3RYH B;  1J5E B;  3K9A A;  5GW7 A;  3ISD A;  3TJT A;  2F95 B;  3QNE A;  1OHH G;  2OWO A;  4QPK A;  1IX9 A;  2DVI A;  4ICG A;  3AG1 C;  2LFR A;  1I08 A;  4J11 A;  3RH4 A;  1YCI A;  3IC7 A;  2BPC A;  5J2J A;  3OVA A;  3F5W C;  4KL1 A;  3B0Y A;  2JGU A;  1QQC A;  4RQ7 A;  4EEQ A;  5KHK A;  4KLJ A;  1UEU A;  3C90 A;  4J7K A;  7ICK A;  2DYS B;  3FKS G;  3E22 A;  2PUS A;  1NOM A;  4YMO A;  2C2A A;  3CRA A;  4JI7 O;  5CA1 A;  2RDC A;  5B1O A;  3BEH A;  4JI8 O;  3AK1 A;  5K1P A;  1H2G A;  3JAK B;  4NXX A;  2GUZ A;  4JI1 B;  7ICG A;  2OCH A;  5LP6 B;  5HRI A;  4X65 B;  3A8T A;  3DC6 A;  1UEV A;  5C93 A;  3RW0 A;  5ITZ A;  4N7R A;  2N05 A;  4BW5 A;  3CK6 A;  1R8A A;  2M6Y A;  4YJ2 B;  3BY6 A;  4DV7 O;  1TVK A;  4Q20 A;  4LNU A;  3NXS A;  4I7Z B;  4YIP A;  3TXQ A;  1FXV A;  5LHH A;  1PL4 A;  2W9M A;  3ASO B;  3UT5 B;  8ICJ A;  3RYF B;  4RO2 A;  1BPD A;  1IBK B;  1ZWI C;  2ATK C;  2LGQ A;  2V1D A;  1JPX A;  4RQ2 A;  7ICO A;  2QTS A;  2BCU A;  5KX5 B;  4LFB O;  4AI8 A;  4DR6 O;  3AG2 B;  5HFL A;  2PI5 A;  4G27 B;  5D4B A;  3ISB A;  1M4U A;  5J0Y A;  4P4M A;  9ICI A;  2HLD G;  4O5K A;  1QLE C;  2R72 A;  1FPO A;  2A9H A;  3H9V A;  3KCX A;  2HR3 A;  4UAY A;  3CEI A;  4K96 A;  2IJH A;  2JVD A;  2R9A A;  1MQ2 A;  5JVD A;  1SQV H;  3ABL C;  1N36 O;  3BA9 A;  3WFS C;  4NY8 A;  7ICF A;  4LF4 B;  4FZ1 A;  2VWK A;  1K92 A;  4HZ3 A;  4DV2 O;  5H6Q A;  1MSD A;  3B40 A;  1FFT B;  3E2E A;  3OTF A;  2PY5 A;  1IZ3 A;  1ZTE A;  1XNQ O;  2ZH8 A;  4PGQ A;  4GKK B;  2PYJ A;  5IY5 C;  3STL C;  4WFG A;  4LF9 O;  3SPH A;  4I2G A;  2ZIO A;  5IYB O;  4WOY A;  4I2J A;  3CXC U;  4U3J B;  2WLN A;  4P4O A;  2UUB O;  3OMI B;  2OCC B;  3HJ4 A;  4DW1 A;  4B3T O;  9ICV A;  1R3K C;  4DRX B;  4FFB A;  2BBJ A;  2ZNI A;  2P90 A;  3CC7 V;  1Q78 A;  5CBH A;  3V7L A;  2P4K A;  5CA0 A;  2I9G A;  1IXM A;  4PDL A;  3M7M X;  3CP1 A;  4DUY O;  1RPO A;  4OXS A;  3SPI A;  4EFB A;  4LFA B;  5HFM A;  2ZDI A;  1JN3 A;  3B09 A;  4NKT A;  1TA8 A;  4K9B A;  5BY1 A;  4R63 A;  5DBB A;  8ICX A;  3SPG A;  2OT5 A;  2X6C A;  3A0B Z;  2R9R B;  4JI0 B;  5KUK A;  4LF7 O;  1Q81 W;  1SQX H;  5KA5 A;  3ZJZ A;  1HNX O;  4OPH A;  3B77 A;  1GH6 A;  5LOV B;  1SA0 B;  4HAM A;  4WC4 A;  1PNL A;  9ICM A;  2ZR2 A;  1H8E G;  3AUO A;  2LFS A;  3CCV V;  4RWQ A;  1SC5 B;  2WA4 A;  1QBZ A;  3KG2 A;  4X4V A;  1NJI W;  4OAI Z;  7ICE A;  1R3I C;  1VQ4 V;  3MCR A;  3HW8 A;  3SPJ A;  3AU6 A;  4O69 A;  5HRE A;  3HKB B;  1ZQC A;  2AW9 A;  1HNW B;  1N32 O;  1G8M A;  4K4I A;  4YXW G;  4DR4 O;  9ICF A;  3EFF K;  3WFR E;  3TXS A;  8ICA A;  3G71 V;  3DXR B;  4UB8 Z;  4TUR A;  4UCR A;  3SDL A;  5E79 Z;  1WP8 A;  1M57 C;  1S76 D;  2ZM6 O;  1YEW A;  3QG5 A;  4JI7 B;  2JRI A;  4LH7 A;  4PD4 F;  4JI8 B;  3ZRX A;  2XAG A;  2CH7 A;  1Q82 W;  3CRR A;  2FMP A;  4LF5 B;  4LP8 A;  3MAQ A;  2UUC B;  1KBH A;  5CBF A;  2Q5Z A;  4WFB V;  2ZXW C;  2HG5 C;  3CC4 V;  4JYA O;  1RM1 B;  4DV7 B;  4WQL A;  4O2A B;  1COW G;  2QM7 A;  1JFF A;  3UKM A;  2CDY A;  3WB2 A;  1EN6 A;  2Q68 A;  4LT6 A;  5IT9 N;  2RNB A;  5KUM A;  3QO7 A;  1VQN V;  4O4I A;  4B7E A;  5LGN A;  2EZO A;  2EBO A;  2ITD C;  3V7K A;  3BA8 A;  2A79 B;  1HDJ A;  1H2M A;  2PI4 A;  2HP8 A;  3ZHR A;  1NO5 A;  2KB1 A;  5LMU O;  4UBB A;  3JAW A;  2EIN B;  4GXJ A;  4RWO A;  1GM8 A;  2D2C B;  4X1Y B;  3ABM C;  3ZMS A;  4MFF A;  4XUS A;  4RUF A;  2YC0 A;  2HVK C;  4QZG A;  2QSA A;  1JJO A;  4FLZ A;  4X62 O;  5JH7 B;  5LGT A;  1N36 B;  4IHJ A;  3UQ8 A;  4EV6 A;  4K8Z A;  1FKA O;  5J2U B;  3T4D A;  9ICK A;  4X4Q A;  5CHG A;  4FO6 A;  1Z2G A;  3EHB B;  3ETD A;  1HW7 A;  1K3E A;  2F93 B;  3MDC A;  4JAS A;  4FK5 C;  2DR8 A;  1O9H A;  1NTZ H;  2L6L A;  3ER9 B;  1FXK C;  5EIB D;  4F5R A;  2F66 C;  5L3F A;  1NI8 A;  5TZV A;  3CSX A;  4G28 B;  1S77 D;  4X8A A;  5IJ0 A;  4KLF A;  3R66 A;  2QEX V;  4LEZ A;  3DGE A;  3E8F A;  3CJH B;  9ICL A;  3CS5 A;  1YJW V;  4S3N A;  1N4C A;  3SGI A;  2ZH2 A;  1KYO F;  4TUY B;  4I2D A;  1NKD A;  4R6Z A;  2PXI A;  1VQ7 V;  4NM1 A;  4OX9 O;  1OCZ C;  2ZH5 A;  1EFR G;  5J2T B;  1QVF U;  2JJ1 G;  7ICH A;  1R73 A;  5IIM A;  4CS4 A;  3OWG A;  2EIJ C;  2O1P A;  3H1H H;  3CRM A;  1HNZ B;  2VAN A;  3OGU A;  4X1K B;  4PGX A;  3SJB C;  4X5V A;  2JGD B;  4J80 A;  1VQP V;  5L3E A;  4TUQ A;  2QWN B;  1WAZ A;  2Q0A A;  5III A;  2UXC B;  2HN1 A;  4ZIB A;  3RYC B;  1IBM O;  2XOK G;  1ZQM A;  3E8B A;  3G4S V;  4M9H A;  1WA8 A;  1AVM A;  1S5H C;  5HRF A;  3OV7 A;  3FFQ A;  4TSF G;  3LSQ A;  3J81 N;  8ICW A;  1V55 C;  4ABM A;  5JJE B;  5IWA O;  2O5A A;  5EZY B;  2BCQ A;  4P9P A;  2W6I G;  2H3O A;  5L3C A;  5JQG A;  2YXY A;  4GZR B;  1IXB A;  2ZH4 A;  4R7C A;  1ZQF A;  5DDY A;  4LF8 O;  4DR7 O;  4DOC A;  4DR4 B;  4LC1 A;  3RGB A;  1NH2 D;  2YI8 A;  1TUB A;  3R65 A;  3JAT A;  2NR5 A;  3K06 A;  2Q67 A;  4HBN A;  4NR1 A;  4LF6 O;  3UXO A;  1ZQQ A;  1RSO A;  3APQ A;  3HJ1 A;  1AP6 A;  4GT1 A;  3CPW U;  2PZS A;  4QE7 A;  1AI4 A;  3LNM B;  3H1L H;  4HYO A;  5BZB A;  1SQB H;  5CR0 A;  3CWB H;  1WN7 A;  5DN6 G;  1R8B A;  3RYF A;  1EM1 A;  1ZQW A;  2YIB D;  3JCU Z;  1LUV A;  5LXT B;  1GN4 A;  2WLL A;  4JI2 O;  3LDC A;  5BMV A;  1ZQU A;  3KKY A;  3CMA V;  4LFC B;  3X2Q C;  3K57 A;  2HKO A;  4H37 A;  4EEB A;  5D49 A;  4NXM O;  3MBY A;  4R66 A;  3OUY B;  3K3W A;  4TT3 G;  3P32 A;  5LMU B;  3ERC C;  2ZH7 A;  1BHA A;  5TIS Z;  4ZI7 B;  4DO9 A;  1SQG A;  1RPR A;  4TV8 B;  2R9I A;  3UQ0 A;  4UVA A;  3JPT A;  2IM9 A;  4RPZ A;  1THZ A;  1QVG U;  1YXB A;  4I2E A;  3WFQ E;  2B51 A;  4Q6G A;  4X62 B;  1MOF A;  2UXN A;  1YDX A;  4QZ8 A;  4I9W A;  4DV6 B;  1MIV A;  2DWE C;  3JD1 A;  4JV5 O;  3MHS C;  1XMO O;  4Z6D A;  3OGC C;  3JAL B;  2KG7 B;  3ZS8 C;  5DKW A;  4DV3 B;  1S5L Z;  2UXX A;  3MHH C;  2UXB B;  4QZC A;  3HKE B;  4IIJ B;  4U3J A;  4LZD A;  5J2D A;  4M04 A;  1K4D C;  7ICV A;  4JI6 B;  3RH5 A;  2B56 A;  2M7W A;  2QGN A;  1S5J A;  2RN9 A;  1ZQX A;  2Y48 A;  3OD4 A;  4O4J B;  3SJQ C;  1D5N A;  3BPZ A;  4CBC A;  9ICE A;  8ICC A;  1BZK A;  3B8N A;  4Z6E A;  2F43 G;  4UB5 A;  1SZT A;  4R8C A;  5JWP A;  3GB7 C;  5CA7 A;  4OAF A;  2ID1 A;  1W0J G;  5B66 Z;  4D7T A;  3KZI Z;  4WFA V;  4RQ3 A;  4I0X B;  1F7Y A;  4QGP A;  4QZI A;  2Q69 A;  4MFA A;  4FHW A;  4XDJ A;  3ZHV A;  5FNV B;  4ATB A;  3CCE V;  1GRJ A;  3AQN A;  1QNM A;  2E74 B;  5LOV A;  3ETQ A;  1S72 V;  4GCZ A;  3JAR A;  9ICJ A;  4UBC A;  1UFI A;  2X0L A;  2OTL V;  2ZH1 A;  3RJG A;  2YXL A;  1E1Q G;  3M99 B;  4X65 O;  2DYS C;  3ZX6 A;  1IBM B;  4D6T H;  2QWR B;  1GM9 A;  1RPL A;  3ZMU A;  4XA5 A;  4UB1 A;  1ZJM A;  2EX3 A;  4RQ8 A;  4GLX A;  4PPX A;  2NLJ C;  4QPJ A;  1IBK O;  4P30 A;  3OEH G;  4X20 B;  1VQK V;  1GO3 F;  3O9O A;  5HRH A;  5LP6 C;  2BE3 A;  5H5N A;  4UB3 A;  1F5A A;  2DRA A;  4I28 A;  1KEC A;  2JIZ G;  3ZRS A;  4GKJ B;  5DDM A;  3H38 A;  4LZG A;  2Q66 A;  8ICN A;  1OCC B;  4W4L A;  4I29 A;  3ASO C;  5CBG A;  4UVC A;  1H2L A;  3DSQ A;  3C3T A;  4NM2 A;  3OTO B;  4IYH A;  5J2G A;  2CGN A;  1VP7 A;  3ABK B;  3CCQ V;  3AG2 C;  5IIN A;  4I2C A;  5IE9 A;  2BCR A;  1GM7 A;  4RWN A;  2QKA A;  1Q7Y W;  5B3Q A;  4BW9 A;  1HWY A;  3SR2 C;  3RT3 C;  3C2K A;  5GON A;  4QZH A;  2HHP A;  4GKK O;  1ZLZ A;  5J0P A;  3HIY A;  3MDA A;  1I5X A;  5IIJ A;  3JPS A;  4WCW A;  4DV0 B;  1LR1 A;  2AHZ A;  4BIO A;  1XL4 A;  4JI2 B;  9ICG A;  1KKD A;  4JLZ A;  1BGY H;  4K97 A;  2E75 B;  5CA3 A;  1DF4 A;  5J2C A;  2ZH3 A;  4NXM B;  4F5N A;  4XDK A;  1AJQ A;  4O4H A;  1IDS A;  1D5A A;  3HKD B;  3K5L A;  2Y4T A;  3H1K H;  4R65 A;  4OAG A;  4LFA O;  2JJ2 G;  2OCC C;  2VQE O;  3JSL A;  2P4V A;  4M2Y A;  2DQ3 A;  4YJ3 A;  2JS5 A;  1TVA A;  3NR7 A;  1XI1 A;  4DR1 B;  4EGW A;  1ZAU A;  4I2A A;  5IDJ A;  2QWQ B;  1GTO A;  1G4Y B;  4PA7 A;  4JI0 O;  4QE9 A;  4F4L A;  1BS3 A;  3HX0 A;  1JX9 A;  3A0R A;  1VAR A;  2NNU A;  1N34 B;  3NVO A;  1ZQP A;  4FH5 A;  3F7V C;  4E80 A;  1YLQ A;  1Q5O A;  1Q43 A;  3L72 H;  5LHI A;  3DTU B;  3BRC A;  8ICZ A;  4ZKI A;  4N23 A;  3OUS A;  2JEX A;  3P30 A;  3CJH A;  5LA6 B;  1I94 B;  4RPX A;  4O2B B;  5J0S A;  1ZQV A;  2ZH9 A;  5B5E Z;  1SZX A;  3ABT A;  2Q7G A;  4BR6 A;  2NN4 A;  4AT8 A;  1HNW O;  4MF2 A;  4RUE A;  5J2T A;  1FJG B;  8ICM A;  3ZMT A;  1FFX A;  2IW5 A;  4FH3 A;  4KLS A;  3TCU A;  1YIJ V;  4JAA A;  2VRZ A;  9ICA A;  1FA0 A;  2YEV B;  4I50 B;  1DK1 A;  9ICX A;  3QF7 A;  2EIM B;  9ICP A;  5CFU A;  2XAF A;  3JPR A;  5J2F A;  2D3O W;  1K7D A;  1G6U A;  3W7X A;  1PNK A;  4K0K B;  5IIO A;  4LF5 O;  4X1I A;  2DYR B;  4PI0 A;  1WJZ A;  4W4K A;  3JCF A;  2UUC O;  5IYC O;  3GWK C;  1HR0 B;  1GK9 A;  2BSK B;  4YMN A;  3D36 C;  3JYC A;  3BAB A;  2G38 A;  1AB3 A;  4QZB A;  4K9A A;  4JI5 B;  4F5P A;  5J9P C;  4NTY A;  4PJ0 Z;  1MIY A;  2PFQ A;  3MGI A;  2GTS A;  4Z6C A;  4FLY A;  5CWR A;  1R3L C;  4NXV A;  4RQE A;  1RM1 C;  1UPG A;  1ZL8 A;  4I9Q A;  3CD6 V;  5DB7 A;  4R64 A;  5BR8 B;  2VQF B;  3CCL V;  8ICQ A;  1VQO V;  1QR8 A;  2Y0P A;  3ZHT A;  4G2K A;  4RQ4 A;  2M2W A;  1JA8 A;  2N04 A;  1DF5 A;  1L0N H;  4JZ2 A;  5J0W A;  1BSM A;  4NXT A;  1XSP A;  4NYK A;  2ZKO A;  3J80 N;  1I5Y A;  4NKG B;  1PP9 H;  4WBN B;  2EIN C;  3UO3 A;  4MVS A;  3EVK A;  1TAE A;  4WBY A;  1MA1 A;  2EUL A;  4YIO A;  4J9Y B;  1QLN A;  2B5U A;  1AP5 A;  5LYJ B;  2V4D A;  3WG7 B;  3ZRW A;  4IL6 Z;  4DYL A;  4CH6 A;  4KHP O;  5CP2 A;  2BTQ A;  4UCU A;  4IQV A;  7ICJ A;  1FXH A;  1Y76 A;  3OR6 C;  3K79 A;  4TV9 A;  3OAA G;  4B08 A;  5J0Q A;  4KLM A;  4DK1 A;  3WFO A;  4EBK A;  1ZQG A;  1Y74 A;  1GKF A;  1M93 A;  4H13 B;  3RFR A;  1NH2 B;  1QCE A;  1ZJN A;  4AQY B;  4M9N A;  4KLI A;  4KFM A;  1H8H G;  1L0L H;  1W2B U;  1BPE A;  5CFT A;  4NB5 A;  4MFC A;  1VF5 B;  4TUP A;  4NVP A;  1FXK A;  4RT3 A;  1BPX A;  3ISC A;  5EYP B;  2VQE B;  1Q79 A;  4KLL A;  1H2K A;  1ZX3 A;  4RQF A;  4X4U A;  3CCJ V;  1HNZ O;  5HC9 A;  4FPP A;  1O9G A;  2CGO A;  2ZH6 A;  2JK5 C;  4X4T A;  4MVM A;  4IIJ A;  2V7Q G;  3V72 A;  5IYZ B;  2UXC O;  4I2F A;  4NLN A;  3N2K A;  2DRB A;  9ICU A;  1YTF D;  1XSN A;  5CB1 A;  4YY3 O;  1ZQH A;  2AGA A;  2P7T C;  3CCU V;  3RVZ A;  3ZED A;  4MTO A;  3K59 A;  2FMS A;  1BT8 A;  2WWW A;  3L73 H;  4B3R B;  2DE0 X;  1HUO A;  4FM1 A;  3JD3 A;  4PHA A;  5KMG A;  1VFG A;  4OGQ B;  5B3S B;  3B2E E;  4JGS A;  1EN5 A;  1SQP H;  4UCS A;  3L71 H;  9ICS A;  2Q7E A;  1NTK H;  2XAQ A;  4ZOL B;  4MTF A;  3G80 A;  4KLO A;  1K4C C;  4O4L A;  4FIP C;  1YF2 A;  4M47 A;  4PI2 A;  2PFP A;  1KD1 W;  1ROP A;  3ML0 A;  2QM4 A;  2CK3 G;  3E86 A;  4J42 A;  1BMF G;  2QWO B;  4LWS A;  3H1J H;  4JAV A;  7ICT A;  1S3J A;  4EBJ A;  1ARO P;  1VQ8 V;  2P67 A;  1P84 F;  4XQ8 A;  5GTI Z;  3E89 A;  5EBL C;  5BOM A;  2DW4 A;  4FZ0 A;  4X9Q A;  1SKV A;  4DR2 O;  4NXN O;  4DR5 B;  3RYI A;  7ICI A;  4U7O A;  8ICS A;  2PFO A;  4NTX A;  4MS2 A;  1R6K A;  2RQ6 A;  1OCO B;  1TUE B;  2JS3 A;  1VQ5 V;  2ZD9 A;  8ICK A;  3VOU A;  4UB6 Z;  4DOA A;  3H01 A;  4LFC O;  4RQ6 A;  7ICU A;  4FFK A;  2QKS A;  3JD0 A;  4PHP A;  4AT7 A;  3N2G A;  3ZN1 A;  8ICF A;  5J0O A;  1TGO A;  5DED A;  3M8A A;  8ICB A;  3BAA A;  2A0L A;  3LSU A;  1W59 A;  3RN4 A;  3BVO A;  4IYI A;  2F4V B;  4LCU C;  4YN4 A;  9ICB A;  7ICN A;  5H2F Z;  4IQT A;  4K35 A;  4NTW A;  4UV9 A;  9ICR A;  2ARH A;  1AR1 B;  4DV6 O;  3OEE G;  2ISO A;  1PNM A;  3AG3 B;  3JAS A;  4DV3 O;  1VIB A;  4QZA A;  1Y67 A;  4I55 B;  2HEP A;  4F6R B;  4KHP B;  1N0J A;  2UXB O;  2IHO A;  3CB2 A;  5BOL A;  3C3S A;  4UB2 A;  4C7U A;  3OT7 A;  3RJJ A;  4JI6 O;  9ICC A;  1M90 W;  5HHI A;  3ICX A;  2E3C A;  3JYY A;  4QZD A;  8ICG A;  1FAF A;  4PHZ A;  4JI3 B;  4PHE A;  2XAH A;  2CTR A;  4MTX A;  3OW2 U;  2QWP B;  4FO1 A;  1V9P A;  4H0L B;  4DV5 B;  4E4E A;  4AT9 B;  1PD3 A;  4XDL A;  5CB4 B;  4FHY A;  2Q4P A;  2IUB A;  2PGG A;  4ZBM A;  3VQY A;  4B3M O;  4M9J A;  2WA3 A;  4AIL C;  1BHB A;  1ZQA A;  3V7J A;  2M2T A;  5DB9 A;  3OVB A;  1U96 A;  3FAV B;  5JTG A;  1XHX A;  4XJE A;  4EP7 A;  4TQF A;  4IT5 A;  2BOC C;  4UVB A;  3LDD A;  4KLH A;  1V54 B;  4EB6 A;  5DB8 A;  3RYH A;  5J2B A;  2LO1 A;  1YSC A;  1T5E A;  3UXP A;  1CP9 A;  5CFS A;  2P5O A;  5HRG A;  1H38 A;  3OGI B;  4YY3 B;  1FYJ A;  3RJK A;  1QU7 A;  4NXZ A;  3PHZ A;  2Q0O C;  5J0X A;  3OR7 C;  2DN9 A;  4MSW C;  2BTO A;  3AEI A;  3IC9 A;  5D63 A;  4F5Q A;  5FPO A;  3C18 A;  4X4N A;  3E22 B;  1D2D A;  1HUZ A;  4MTG A;  4WC5 A;  3D8C A;  5CA1 B;  4GKJ O;  1W0K G;  3ZCC A;  9ICT A;  4I4T B;  4RQ1 A;  4UFZ A;  1ZQJ A;  1NBM G;  5ITZ B;  5IIK A;  4F6E A;  2EJ7 A;  3OTO O;  1XEQ A;  2MW2 B;  4DR3 B;  1TVK B;  5JCO C;  4FJC C;  3N27 A;  4LNU B;  3PNC A;  4GX1 A;  3JAK A;  1KP3 A;  3QO8 A;  3WU2 Z;  5LP6 A;  4HNA B;  2BOB C;  4JZG A;  1OCC C;  2HJF C;  4TUS A;  1JJ2 U;  4YJ2 A;  2GA9 D;  2UU9 B;  3E83 A;  3SYP A;  3TFR A;  1K33 A;  3QVN A;  4DR2 B;  3G6E V;  5DBA A;  3UT5 A;  2XAJ A;  4NXN B;  2QDO A;  4Z1M G;  4WBZ A;  4KLG A;  1ZQS A;  4O67 A;  4DV0 O;  3ABK C;  4YD1 A;  1YZB A;  1KDH A;  3K03 A;  1XQ8 A;  5KX5 A;  1Q86 W;  4N21 A;  1SET A;  3L9D A;  4TWK A;  2FYU H;  1BQZ A;  5JVD B;  1JQR A;  5H9C A;  2Q6A A;  1FS0 G;  3AG4 B;  2IH3 C;  2XT9 A;  2XTA A;  3RJI A;  2AHY A;  3H3A A;  3ZHS A;  3THO A;  2Z3Y A;  3K0G A;  3CYO A;  1NVP D;  4DR1 O;  1NT2 B;  2A3Q A;  1MAB G;  3JPQ A;  1M56 B;  3G6B A;  3K75 D;  5CMU A;  2FML A;  2GDS A;  4PDR A;  1JMK C;  3FB5 C;  1ZQY A;  4FFB B;  1N34 O;  2LW7 A;  3NYB A;  4H44 B;  3PML A;  1OV9 A;  5CA0 B;  3W7U A;  1P7B A;  4UD4 A;  3UPQ A;  4I5S A;  8ICY A;  2QJ1 A;  3KCY A;  3H37 A;  4FM2 A;  4DRX A;  3W7T A;  1Y4M A;  2OTJ V;  1I94 O;  8ICL A;  1Q6H A;  1J95 A;  1TFW A;  2EIL B;  3MD0 A;  4X4R A;  3DC5 A;  4FVM A;  2EIK B;  9ICO A;  5KHJ A;  5KHI A;  3PMN A;  4B3M B;  1KB9 F;  1FJG O;  3P3N A;  1BPZ A;  2ZE5 A;  3RWR D;  5A2Q N;  3LNN A;  1OU5 A;  2LQT A;  4UCO A;  1JQ0 A;  8ICT A;  1PV0 A;  2GWS A;  7ICR A;  3CX5 F;  5D5P A;  3T1Y O;  1RFY A;  1XBL A;  2MK3 A;  3B8M A;  4XQ7 A;  7ICL A;  5J2H A;  1SA0 A;  1K34 A;  2CUG A;  2OYQ A;  3AQK A;  5B1B B;  4K0K O;  1VEW A;  3OVS A;  2B1I A;  4J7J A;  3K5N A;  4FLT A;  1HR0 O;  2DR5 A;  2DWD C;  3JSN A; 
#chains in the Genus database with same CATH homology
 3HW8 A;  5DB6 A;  4QZF A;  3AU6 A;  4K4G A;  9ICA A;  4YMM A;  1FA0 A;  5HRE A;  9ICX A;  1ZQC A;  9ICP A;  7ICQ A;  3JPR A;  5J2F A;  4JWN A;  4RQ5 A;  4K4I A;  9ICF A;  5IIO A;  3WFR E;  8ICA A;  4RWP A;  2M2V A;  4TUR A;  9ICN A;  4YMN A;  1KEJ A;  3AQL A;  4QZB A;  1ZQD A;  4F5P A;  4X4S A;  1MIY A;  3H39 A;  2PFQ A;  2FMP A;  3MGI A;  5CWR A;  4Z6C A;  4RT2 A;  1R8C A;  2P66 A;  5DB7 A;  1MIW A;  4R64 A;  4KLU A;  8ICQ A;  3MGH A;  1TV9 A;  4LT6 A;  4RQ4 A;  2M2W A;  3V7K A;  5J0W A;  4IQU A;  1ZQE A;  1XSP A;  4M0A A;  1NO5 A;  5J2K A;  2DR7 A;  4UBB A;  4RQ0 A;  4UD5 A;  4GXJ A;  4RWO A;  7ICP A;  4WBY A;  4GXK A;  4MFF A;  4XUS A;  5CP2 A;  4IQV A;  7ICJ A;  1UET A;  4QZG A;  3UQ2 A;  4IG8 A;  8ICI A;  5J0Q A;  9ICK A;  4KLM A;  4X4Q A;  5CHG A;  4FO6 A;  3WFO A;  4EBK A;  5J0T A;  1ZQG A;  2PBE A;  4WC1 A;  5J0U A;  3MDC A;  1ZJN A;  4JWM A;  4M9N A;  4KLI A;  4I27 A;  2DR8 A;  4GXI A;  5J2E A;  1PX5 A;  5F2V O;  1BPE A;  3UPS A;  4F5R A;  4KLT A;  4MFC A;  4TUP A;  5TZV A;  4RT3 A;  1BPX A;  3ISC A;  4I2B A;  4KLF A;  4PGY A;  5HRL A;  1Q79 A;  2NRK A;  3C2M A;  4KLL A;  1ZQK A;  4FHX A;  9ICL A;  4X4U A;  4S3N A;  4X0A A;  4I2I A;  5HC9 A;  2ZH2 A;  4KLE A;  4I2D A;  4AT9 A;  4X4T A;  2ZH6 A;  4UAW A;  2BCS A;  3UXN A;  5J0R A;  3V72 A;  1JMS A;  2PXI A;  4I2F A;  4NM1 A;  4NLN A;  3JPP A;  4NLK A;  2ZH5 A;  2DRB A;  9ICU A;  1XSN A;  5CB1 A;  1RZT A;  7ICH A;  5IIM A;  4RPY A;  1ZQH A;  8ICV A;  8ICR A;  4KLD A;  2O1P A;  2VAN A;  2FMS A;  3OGU A;  4PGX A;  4X5V A;  3TFS A;  4TUQ A;  5III A;  1HUO A;  4PHA A;  3RH6 A;  1VFG A;  4NKU A;  4WC7 A;  1ZQM A;  4M9H A;  1ZQB A;  9ICS A;  8ICO A;  1R89 A;  5HRF A;  5HRD A;  3OV7 A;  1WOT A;  4KLO A;  2ZHA A;  8ICW A;  4M47 A;  3AU2 A;  2IHM A;  3JZ0 A;  2PFP A;  4M5D A;  2BCQ A;  2O5A A;  4Z6F A;  2BCV A;  2FMQ A;  7ICT A;  2ZH4 A;  1BPB A;  1ZQF A;  4EBJ A;  4XQ8 A;  1XSL A;  5DDY A;  4DOC A;  5BPC A;  4XRH A;  5BOM A;  7ICI A;  3C5G A;  1ZQO A;  8ICS A;  2PFO A;  3UXO A;  4UAZ A;  1ZQQ A;  3HJ1 A;  3C66 A;  2M2U A;  1ZQI A;  5CR0 A;  8ICK A;  4WC3 A;  4AT7 B;  4DOA A;  1V4A A;  5J2I A;  4RQ6 A;  7ICU A;  1R8B A;  3AQM A;  4PHP A;  4AT7 A;  1ZQN A;  1ZQW A;  4FHV A;  4YCX A;  8ICF A;  5J0O A;  5DED A;  1KNY A;  4YD2 A;  2ISP A;  8ICB A;  5HHH A;  1ZQU A;  4M9L A;  9ICB A;  4YN4 A;  5D49 A;  7ICN A;  3MBY A;  4R66 A;  3OUY B;  4IQT A;  9ICR A;  4PHD A;  4E8F A;  2ZH7 A;  4X4O A;  4DO9 A;  3RJH A;  3OUY A;  2ISO A;  9ICH A;  3C2L A;  4M9G A;  3UQ0 A;  3JPT A;  9ICQ A;  4RPZ A;  4QZA A;  4LVS A;  3HWT A;  3GDX A;  4WC2 A;  5D46 A;  5BOL A;  4I2H A;  4I2E A;  4UB2 A;  3WFQ E;  4X4P A;  5HR9 A;  4MF8 A;  3RJJ A;  9ICC A;  5HHI A;  2RFF A;  3JYY A;  4QZD A;  4QZ8 A;  4K4H A;  4X0B A;  8ICG A;  4FHP A;  1MIV A;  3RJE A;  4Z6D A;  4PHE A;  5DKW A;  3LQC B;  4P4P A;  4AT9 B;  4QZC A;  4FHY A;  1TFY A;  4LZD A;  5J2D A;  4M04 A;  1ZQR A;  8ICP A;  3B0X A;  4M9J A;  4O5E A;  7ICV A;  3RH5 A;  1ZQA A;  4QZE A;  3V7J A;  2M2T A;  5DB9 A;  3OVB A;  5DEC A;  1ZQX A;  2ZHB A;  4EP7 A;  2PFN A;  9ICE A;  4NLZ A;  8ICC A;  3LK9 A;  4Z6E A;  4UB5 A;  4KLH A;  3ISD A;  3C5F A;  5DB8 A;  3JPN A;  5CA7 A;  5J2B A;  2ID1 A;  3UXP A;  4DOB A;  4RQ3 A;  4PH5 A;  5HRG A;  4ATB B;  4QZI A;  4F5O A;  2DVI A;  4MFA A;  4FHW A;  9ICW A;  4ATB A;  3RH4 A;  3AQN A;  3RJK A;  4NXZ A;  2BPC A;  5J2J A;  3OVA A;  5J0X A;  3B0Y A;  9ICJ A;  4RQ7 A;  4UBC A;  4KLJ A;  4F5Q A;  3C18 A;  4X4N A;  1UEU A;  8ICE A;  2ZH1 A;  1HUZ A;  3RJG A;  7ICK A;  4WC5 A;  7ICS A;  1RPL A;  9ICT A;  4XA5 A;  4UB1 A;  1NOM A;  4YMO A;  4RQ1 A;  1ZJM A;  4RQ8 A;  2BPF A;  5HRB A;  1ZQJ A;  4PPX A;  2BPG A;  5IIK A;  5HRH A;  1MQ3 A;  7ICG A;  2BE3 A;  5EOZ A;  4UB3 A;  5HRI A;  1F5A A;  1UEV A;  4I28 A;  1BPY A;  2DRA A;  3PNC A;  1R8A A;  5DDM A;  3H38 A;  4LZG A;  2Q66 A;  8ICN A;  2DR9 A;  4P2H A;  4TUS A;  4I29 A;  2W9M A;  8ICJ A;  4IQW A;  1BPD A;  4NM2 A;  3TFR A;  4QZ9 A;  4RQ2 A;  7ICO A;  5DBA A;  5J2G A;  4WBZ A;  2BCU A;  4KLG A;  1ZQS A;  4YD1 A;  5IIN A;  4I2C A;  4RWN A;  1KDH A;  2BCR A;  5D4B A;  3ISB A;  5J0Y A;  4P4M A;  9ICI A;  4O5K A;  3C2K A;  3L9D A;  4UAY A;  4QZH A;  2HHP A;  1JQR A;  5J0P A;  3HIY A;  3MDA A;  1MQ2 A;  5IIJ A;  3JPS A;  4UB4 A;  1ZQL A;  4WCW A;  3WFS C;  3RJI A;  3H3A A;  4NY8 A;  7ICF A;  7ICM A;  3RJF A;  9ICG A;  5IIL A;  2ZH8 A;  4PGQ A;  5J2C A;  2ZH3 A;  5DBC A;  4WC0 A;  3JPQ A;  4F5N A;  4I2G A;  3K75 D;  5J29 A;  4I2J A;  1ZQY A;  4R65 A;  5CJ7 A;  4P4O A;  3HJ4 A;  3NYB A;  4M2Y A;  9ICV A;  3PML A;  1Q78 A;  4UD4 A;  3UPQ A;  1TVA A;  4O5C A;  3V7L A;  8ICY A;  3H37 A;  2I9G A;  4I2A A;  4WC6 A;  1ZQZ A;  8ICL A;  1TFW A;  3HX0 A;  4X4R A;  3JPO A;  1ZQP A;  4FH5 A;  4E80 A;  9ICO A;  1YLQ A;  1JN3 A;  3PMN A;  4KLQ A;  4NKT A;  4R63 A;  8ICZ A;  5DBB A;  1BPZ A;  8ICX A;  1VJ7 A;  1OU5 A;  4RPX A;  8ICT A;  1JAJ A;  4E7X A;  2GWS A;  4AT8 B;  5J0S A;  7ICR A;  1ZQT A;  1ZQV A;  2ZH9 A;  4WC4 A;  9ICM A;  4AT8 A;  3AUO A;  4XQ7 A;  5J2A A;  7ICL A;  5J2H A;  4MF2 A;  4O9M A;  8ICM A;  4FH3 A;  3AQK A;  5HRK A;  4RWQ A;  3OVS A;  3WFP A;  4KLS A;  8ICH A;  4X4V A;  7ICE A;  2DR5 A;  8ICU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...