5F2VO

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to ampcpp
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
195
structure length
184
Chain Sequence
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
molecule tags Transferase
molecule keywords GTP pyrophosphokinase YjbM
total genus 59
structure length 184
sequence length 195
chains with identical sequence P, Q, R, S, T, U, V, W, X, Y, Z
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5f2vO02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5f2vO01
1ZQSA 7ICLA 5HRGA 4UB4A 4AT8B 5HRIA 4E8FA 4WC2A 4QZGA 4NKTA 4QZEA 1UETA 4TUPA 3TFSA 4FHYA 4IQVA 4RPYA 8ICAA 5HR9A 4TURA 5BOLA 4PHAA 2W9MA 3RH6A 5HRFA 5J0UA 3RJIA 1ZQMA 7ICNA 4I2EA 4E7XA 8ICWA 4I2BA 4MFAA 3JPPA 9ICUA 1MIVA 4WC7A 3HIYA 4IQUA 9ICGA 1XSPA 1ZQYA 4DOBA 4ATBA 8ICHA 9ICMA 3UPSA 2FMSA 3WFRE 3LQCB 4IQTA 4PGXA 2I9GA 3MGHA 5CWRA 1BPDA 3AQMA 4LZDA 4WC1A 1JQRA 5J2DA 9ICLA 4FHWA 1TVAA 4TUSA 5IIKA 4FHXA 1KEJA 1ZQTA 5HREA 4NXZA 4NY8A 3AQNA 3RJGA 8ICIA 4EBJA 1BPYA 4MF8A 4NM2A 4E80A 4XRHA 3MDAA 4UBBA 3WFSC 5J2FA 4RQ1A 4M5DA 5IIMA 5J0SA 1BPXA 4KLGA 1UEUA 5HRHA 4Z6DA 2ZH3A 7ICEA 5J2BA 4X4TA 4X5VA 9ICSA 1ZJMA 8ICNA 4X4OA 3OUYA 3L9DA 1HUZA 5CB1A 1R8AA 3AUOA 4KLDA 3OVSA 4QZBA 1HUOA 3JYYA 3JPSA 4RWPA 5J29A 3JZ0A 4RPXA 5J0WA 3MGIA 4F5OA 1JAJA 3LK9A 8ICMA 2BPCA 4TUQA 4QZCA 4RT3A 2DVIA 9ICTA 5F2VO 3B0XA 4RT2A 8ICFA 4UAWA 3HX0A 1BPBA 4NM1A 1ZQZA 4LT6A 2BCQA 4KLIA 3OVBA 4I27A 3TFRA 4P4PA 7ICHA 2IHMA 8ICGA 2NRKA 4DOCA 4KLQA 4XQ7A 4RQ8A 3RJFA 4KLTA 5D4BA 9ICWA 5HRKA 4R65A 3C18A 4WC5A 4GXIA 5J2EA 4M9HA 2DR9A 4UAZA 4O5CA 4WBZA 3AU2A 9ICXA 5IIOA 4I28A 4FH5A 4O5KA 3UXPA 4PHPA 5DBCA 4DOAA 4DO9A 4YD1A 5CR0A 4I2IA 4F5NA 4WC6A 4M9NA 1Q78A 2HHPA 1BPZA 4MF2A 4UD5A 3C66A 1ZQUA 3JPTA 8ICEA 2PFPA 2M2WA 3V72A 3AU6A 5HHHA 4GXJA 1ZQBA 1ZQJA 1ZQGA 5CP2A 2M2TA 1VFGA 7ICQA 1BPEA 5J0RA 1V4AA 4RQ4A 2BPGA 4X4PA 4QZFA 3OGUA 4F5RA 4P4MA 5BPCA 3UXOA 2ZHBA 4WBYA 5HRBA 5BOMA 1ZQCA 4X0AA 1MQ3A 4WC0A 9ICJA 7ICMA 5J0TA 3MDCA 5DEDA 5HRLA 4IQWA 4YN4A 3HJ4A 2ZH5A 9ICVA 9ICOA 4UB3A 4M9JA 4O5EA 5J2AA 4R64A 1TFYA 1R89A 4R66A 2BCUA 7ICOA 3UPQA 1NO5A 4NLNA 4FHVA 8ICBA 4I2CA 7ICRA 1MQ2A 3HWTA 2ZH6A 2DR7A 2GWSA 9ICBA 8ICJA 1OU5A 4O9MA 5DB9A 4NKUA 3WFOA 4I2AA 3RJKA 1VJ7A 9ICKA 8ICSA 3C5FA 2FMPA 3RJEA 1YLQA 2P66A 7ICTA 4PGYA 2O1PA 9ICNA 2BCVA 4WCWA 7ICPA 4QZHA 1R8BA 4K4IA 4KLMA 2BPFA 5J0PA 2PFNA 8ICPA 4QZAA 5DDMA 1ZQVA 4M9GA 4P4OA 4KLEA 5CA7A 4QZDA 5J0OA 4M47A 9ICRA 8ICRA 3C5GA 7ICSA 5J0XA 4X0BA 4YMNA 7ICUA 3OUYB 2DR8A 4YCXA 5DBBA 4GXKA 4M0AA 3WFQE 3AQLA 1ZQXA 4FH3A 5HRDA 1ZQLA 4WC3A 1TFWA 5EOZA 4PGQA 2M2UA 1ZQQA 2ISPA 4NLKA 3NYBA 5J2CA 4RQ0A 1ZQRA 4I2FA 5DKWA 8ICYA 5DBAA 4UBCA 3C2LA 3RJJA 5CJ7A 5IIIA 4KLOA 3H38A 7ICFA 1ZQIA 9ICCA 4R63A 2FMQA 4YD2A 4F5QA 5IIJA 4RQ5A 8ICTA 2VANA 3AQKA 3JPQA 4F5PA 4IG8A 4RWOA 2ZH1A 1TV9A 7ICJA 1RZTA 3WFPA 1ZQOA 4X4VA 1ZQAA 2ZH7A 1MIYA 4S3NA 4PHDA 3RH5A 4RQ2A 4M9LA 1ZQNA 3H39A 4UAYA 1ZQEA 4JWNA 4LVSA 3OV7A 1XSNA 1JN3A 3ISBA 5J2GA 4QZ8A 9ICEA 1R8CA 4QZ9A 3MBYA 5IILA 1JMSA 3C2KA 2PBEA 3V7LA 3C2MA 4PHEA 4X4UA 4ATBB 3RJHA 2M2VA 2DRAA 3GDXA 2ZHAA 3V7KA 3HJ1A 4I2DA 4EBKA 8ICVA 4X4SA 4JWMA 1ZQHA 1KNYA 1FA0A 2RFFA 4PH5A 8ICKA 4EP7A 7ICVA 4UB1A 2Q66A 9ICFA 4I2GA 4KLSA 1ZQDA 4KLHA 9ICAA 4UD4A 3UQ0A 5DB8A 4QZIA 3B0YA 1XSLA 4RPZA 5J2KA 4I2HA 3JPRA 2BCSA 9ICPA 4FO6A 1RPLA 3HW8A 8ICXA 1NOMA 4Z6FA 4K4HA 7ICKA 4RQ7A 4M2YA 2ZH2A 4XA5A 9ICHA 4XQ8A 4AT7A 4I29A 7ICIA 8ICQA 2BE3A 1ZQKA 5J2HA 4AT7B 4RWNA 4YMMA 4X4QA 5CHGA 5J0QA 4X4RA 3JPNA 9ICIA 2DRBA 8ICCA 5J2JA 4KLUA 4Z6EA 3UQ2A 1ZJNA 2PFOA 1WOTA 4RQ6A 4UB5A 4AT9B 2ZH9A 1MIWA 3ISDA 1UEVA 8ICZA 4KLFA 4MFFA 3H3AA 2ISOA 2PXIA 4AT9A 4WC4A 2BCRA 4YMOA 3JPOA 4RWQA 1KDHA 4NLZA 1ZQWA 4LZGA 5HHIA 3PNCA 2ZH8A 2ZH4A 4FHPA 5DECA 3K75D 5TZVA 7ICGA 5IINA 4XUSA 4UB2A 8ICUA 4RQ3A 5DDYA 5DB7A 3OVAA 4MFCA 5DB6A 5HC9A 4AT8A 1F5AA 4Z6CA 5J0YA 4I2JA 8ICOA 2DR5A 3RH4A 3ISCA 9ICQA 4M04A 4K4GA 3H37A 3UXNA 5J2IA 1ZQFA 5D49A 4P2HA 2PFQA 1PX5A 1Q79A 4X4NA 3PMNA 3PMLA 4PPXA 4KLJA 5D46A 1ZQPA 8ICLA 3V7JA 2ID1A 4KLLA 2O5AA
chains in the Genus database with same CATH superfamily
4ZBMA 2Q4PA 3WU2Z 5HRIA 4E8FA 1OCOB 4NKTA 3CEIA 1KMIZ 1ENVA 4DV1B 1CP9A 1XI1A 3JYCA 1PV0A 1QNMA 5KHIA 1K5SA 2ATKC 4DV6B 3C3TA 4PHAA 2P22C 3RH6A 5HRFA 4NB5A 5J0UA 3RJIA 2EBOA 7ICNA 4I2EA 2EX3A 2P67A 1F51A 4I2BA 4X1KB 4WF9V 4TOIA 2OYQA 4WC7A 1IBKO 1KQSU 5IWAO 2OCCB 1AVMA 2ZQMA 2BCCH 1SZXA 3MGHA 2JDIG 3CMAV 4QNHB 3FYEB 1BPDA 1UPGA 1GPJA 1NH2D 3ABTA 1GRJA 1KC8W 4FHWA 1TVAA 4TUSA 4O4LB 1J5EB 4JAAA 1L0LH 1R6KA 2NR5A 4DR3O 2EULA 4KP4A 5HREA 1D5AA 4O4LA 3A8TA 3OGIB 2CGOA 3RJGA 3K03A 4K97A 4XRHA 5E1AC 3E83A 2P4KA 2ADQB 1UEUA 1AP6A 4Z6DA 1L8DA 4KB6A 2CTQA 7ICEA 4NXUA 1K7DA 8ICNA 3L71H 2AHYA 4UCVA 3QO7A 2Q5ZA 4JYCA 3AUOA 2Q7GA 4QZBA 3ETQA 3CCSV 3JYYA 3JPSA 1PNLA 3AG3C 5FPRA 1JPXA 1EFRG 2DW4A 4IHJA 4J80A 5FL7G 3BA9A 4QIWF 3JZ0A 4RPXA 1KYOF 2ZE7A 4IHJB 5J0WA 3D3QA 1LUVA 3G67A 1VF7A 2N74A 3DTUB 1JAJA 3ZRWA 8ICMA 2BPCA 2ZIMA 4TUQA 1VQMV 2Y4UA 1KBHA 1MABG 9ICTA 5F2VO 4GX2A 3X2QB 4FK5C 3HR0A 4X9QA 4UCUA 1TGOA 5LP6B 1ZQZA 3SJAC 2GTAA 1X4TA 5LP6A 7ICHA 3MHSC 2NRKA 4TV9B 4PA4A 5HFMA 5A9GA 2BBJA 3ZHTA 2QWNB 4GX0A 3RJFA 2VWJA 1ZWIC 4A5UB 4DR3B 1J5EO 1M1KW 4JTAB 2XAGA 4GXIA 1YSCA 4UAZA 3ASNB 3JD0A 3ABKB 4U3FH 1S76D 5AG2A 4CZZA 1GM9A 1PD3A 4PA9A 3K5NA 5EBMC 1R73A 5JQGB 4O5KA 5IWAB 4NKGB 1NH2B 3SYCA 3BRCA 2JIZG 4DOAA 2BSKA 3KCXA 2V4DA 4NXMB 5EC1C 3F7YC 4LEZA 1NBMG 4DV7O 1AILA 2R72A 4WC6A 1S5HC 1Q78A 4MF2A 3JCUZ 5LHHA 4UD5A 3OT7A 4X64B 4K0KO 3MCRA 3JPTA 3IC7A 4D6TH 3AU6A 4DV1O 1Y6XA 2FKXA 4H0LB 1ZQGA 1QR9A 4U3JB 2XT9A 4NTXA 3JCZA 2M2TA 5LMUB 2Z3YA 2P5OA 4X4PA 1MZFA 1XL6A 2KB1A 4B08A 4C7UA 4F5RA 5BPCA 2VS0A 4K9BA 1W0JG 3LNNA 4NVPA 4X0AA 3DC6A 2PI4A 1OCCB 1MQ3A 4Q20A 4JTDB 1V55B 3VOUA 4O4IA 3CCRV 9ICJA 4GKJB 5KMGA 1RM1B 3MDCA 1B06A 5GTHZ 4JI3B 4UB3A 2GUZB 1RM1C 1V9PA 1SETA 4ZKIA 4PI2A 3M99B 2GUZA 3UPQA 3E2EA 4DUZB 1XREA 4B3SO 3CK6A 1YJWV 3HWTA 3AG1C 2A3QA 2DYRB 3HPLC 3ABMB 9ICBA 3RYFA 1XMOO 2RDCA 3RYHB 1SKVA 2YUAA 4NXNB 3RJKA 1DLBA 4PELA 2EIKB 2O1PA 1HDJA 4QZHA 1K97A 4GX5A 2QSAA 3IGAC 2BPFA 2GSMB 1ZQVA 4M9GA 1OV9A 3AK3A 4JGSA 5CA7A 4NXTA 3CCVV 2CAZC 3OWGA 4K99A 1YDXA 1R1BA 3O9OA 3C5GA 7ICSA 1H38A 3C3SA 7ICUA 5CFSA 3OUYB 3CXCU 4TQFA 2DR8A 3F5TA 3QG5A 4YCXA 4B7EA 2QKSA 1ZQXA 1TFWA 5HFLA 2RMKB 5B5EZ 5EOZA 4BW9A 1WPBA 2ISPA 3N2GB 4NLKA 4FO1A 3NYBA 2IM9A 1XMQO 2WA4A 4I2FA 4X64O 4NYKA 3N2GA 2RCVA 4LWSA 4LNUB 5DBAA 5E79Z 3L72H 5J9PC 5J2UA 2RJZA 1FFXB 3C2LA 3ZHRA 2CTRA 4DV7B 3W7TA 1AI6A 1KU9A 3W7WA 4LEYA 7ICFA 4LFCO 3NKUA 1S5JA 4F5QA 5IIJA 3CCLV 3AQKA 4TUYB 3EVKA 3QF7A 4WFGA 2XHBA 4F5PA 4RWOA 5FPOA 2ZH1A 2HKOA 1VQKV 2P4VA 2ZH7A 4X1IA 1WN7A 3U10A 4J42A 4ZHQA 2F1MA 3RH5A 3FAVB 1EBOA 1M9NA 3OR7C 1ZQNA 1NQTA 1VARA 3M7MX 2WSSG 3UKMA 4I4TB 1CEZA 1XSNA 2HHHB 3AK2A 5CFUA 3ISBA 1BS3A 3WG7B 9ICEA 2ITDC 4QZ9A 4D7SA 5BR8B 4O67A 3RYIA 5JJJB 4UVCA 3QVNA 2PBEA 1M57B 1P4RA 3JATB 3CSXA 3AG3B 2YXYA 5LA6A 2ZHAA 2Y0PA 3JATA 4OPHA 4DR6B 4I2DA 3AG2C 2NLJC 3JASA 1OJHA 5JVDA 4DR2B 4HX0A 3NWIA 2RFFA 1AROP 4UVBA 5KHHA 5A2QN 3A0RA 4EP7A 2WLIB 4YHHO 7ICVA 3B09A 1N0JA 5J2TB 2Q66A 2L6LA 3G80A 2N04A 2WAMA 5DM6V 4I2GA 4KLSA 5J2TA 1ZQDA 5JH7B 3ABUA 4BWAA 4KLHA 2OIEA 4PI0A 4PDRA 5DB8A 3OUFA 4J7KA 4X20B 2V7QG 1JFFB 3I55V 2OT5A 3H1KH 4I2HA 2F23A 2WLLB 3SPJA 2EINB 2IBZH 4X20A 1SA0B 9ICPA 1R3JC 5BMVB 2PTMA 1NOMA 4Z6FA 1JFFA 1Y74B 3KZIZ 5EYPB 1M90W 3JCFA 4RQ7A 2ZH2A 1SA0A 5BMVA 4AT7A 1Y74A 3NXSA 4L87A 8ICQA 4O4JA 4AT7B 4RWNA 5DN6G 4X4QA 2IW5A 4K3AA 4PDVA 1XBLA 4X4RA 3ER9B 1FXKB 3JPNA 4EGWA 9ICIA 2G38A 3CRCA 5EK0A 3AG1B 2ZR2A 4Z6EA 4DK0A 4UXNA 1GN4A 4PDLA 4DV3B 2PFOA 4UCSA 3FX7A 3ISDA 1UEVA 5IJ9B 2QWPB 2Z5UA 4LEVA 2ISOA 4KLFA 4JI0B 2PXIA 1U97A 2IH3C 4YMOA 2H3OA 1GH6A 5D5PA 2JK5C 4RWQA 3CRQA 3EHBB 2F4VB 2ZH4A 1E1QG 3K75D 7ICGA 4NXXA 4XUSA 2M6YA 5DDYA 5DB6A 4WQLA 2L35A 4MSWC 4DR1B 2ARHA 3H1HH 1VQ4V 3HKEB 4WFHA 3LDDA 4MTFA 2IJIA 3PN1A 2W0FC 2RNBA 3LNMB 1WP7A 2AHZA 4HYOA 3UXNA 5J2IA 1ZQFA 1QLEC 1BQ0A 2PY5A 4LF9O 4J7ZA 1PX5A 2PFQA 1YIJV 3G6EV 4X4NA 3PMNA 4G27B 2ETNA 4PPXA 2A9HA 4KLJA 1ZQPA 3ABMC 5C93A 4KLLA 2O5AA 1XNRO 1VF6A 1L1FA 1PPJH 2E75B 4HBNA 4FIPC 3CRAA 4AT8B 2GTSA 3SJCC 4WC2A 3SPHA 4ASUG 4TUPA 2F4VO 3TFSA 4FHYA 1URFA 8ICAA 4TURA 3AG4C 2W9MA 2WLHA 1ZQMA 3JAKA 2RQ6A 2MK3A 4JYAO 1WB8A 3EFFK 1JOYA 1FXHA 3E22B 4MFAA 1K34A 3JPPA 1MIVA 4DV3O 3WG7C 4IQUA 9ICGA 1XSPA 5KHJA 4ATBA 2DYRC 9ICMA 3UPSA 3ASOB 3TK1A 3LQCB 4PGXA 4U7OA 1NVPD 3AQMA 5GTIZ 5JCOA 4WC1A 1JQRA 9ICLA 1Y76B 4LH6A 5IIKA 4J41A 3G4SV 4DR5B 2Q7EA 5LGUA 1ZQTA 2RN9A 3ETDA 4JI7B 1YJ9V 3GWKC 4DW0A 4H44B 4G2KA 1Z5VA 3MDAA 1MG1A 2Y48A 5LMNB 2QTOA 5KA6A 2AXTZ 5J0SA 5IIMA 4JLXA 2ZDIC 2DWDC 1B6QA 4ICGA 2ZH3A 4CH4A 3CC7V 4F4LA 3EXAA 4JZ2A 4X5VA 9ICSA 5LYJB 5CB4B 2YEVA 4X4OA 3ZRVA 1AI4A 4KHPO 3OUYA 3L9DA 3CRRA 1HUZA 1Q7YW 5LYJA 4TV9A 1RPOA 5CB1A 2N05A 2X6CA 3K3WA 3OVSA 3SPIA 4X8AA 2PGGA 2EINC 4RWPA 3RT3C 3CYOA 1H2NA 3KG2A 1ZAUA 4JZGA 4AQYB 5J29A 1R3IC 4DR6O 4JV5O 4LNUA 3MGIA 3X2QC 4F5OA 2XNDG 3TXQA 3H1IH 1US6A 4RT3A 1S0VA 5LP6C 3ZMVA 3B0XA 2DVIA 1SQBH 2BOCC 5KUMA 4RT2A 3K9SA 4UAWA 4IL6Z 4UB6Z 2AW9A 2LFRA 4E4EA 4LT6A 4OAGA 3P30A 2PYJA 3NVOA 4TUYA 4B7KA 1AR5A 4X1IB 5IE9A 3FB7C 4XQ7A 4KM5A 5D4BA 3A0HZ 9ICWA 4R6ZA 4RQEA 5HRKA 4JI4B 4LH7A 4LF5B 5J2EA 4M9HA 2HG5C 3ZMUA 1Q3EA 4FPPA 3FB8C 4AILC 3ZS8C 4X1YA 4I28A 4UVAA 4YJ2A 4DUYO 1A32A 3ZHUA 1M57C 2Y0IA 3UXPA 4JTCB 5LXTA 5IT9N 2JEXA 1QHTA 5DBCA 1M56C 1HNZB 4LF6B 1N0NA 2GHYA 5CR0A 2UXBO 2OCHA 5KMGB 1JCHA 1Z5WA 3MDSA 3K59A 5LA6B 3PHZA 5CN0A 3K58A 1XMQB 1QLEB 1VQ8V 1R6NA 5LGNA 2PFPA 2M2WA 3T4ZA 3V72A 2EIMB 4WQKA 2YICA 1E79G 1XUQA 3UO2A 1HNXB 1ZQBA 4LF8O 5IYBO 2VQFO 3K7DA 1P7GA 2DYSB 3CJHB 1K4DC 1NI8A 2WLIA 2YS8A 3ABLB 2JRIA 7ICQA 3LDCA 1P84F 4RQ4A 2P7TC 4QZFA 4PV1B 4EEBA 2X7RB 3ABLC 4IIJA 2E5LO 4K35A 2HP8A 2AZ2A 5BOMA 1ZQCA 1GKFA 2C2AA 5CBGA 5J0TA 1Q90D 3ZHSA 3ZHQA 5DEDA 5KA5A 3HKDA 3AG4B 1TVKB 2WLLA 3CCJV 2Y4TA 2WLKA 4H37A 2H94A 5ITZB 1IBLO 4R64A 4LC1A 3UQ8A 5ITZA 5FNVA 4N23A 2DJVA 4NLNA 4NXNO 3SDLA 4I2CA 3SYQA 2E3CA 1XMOB 4K96A 2Q0OC 2GWSA 8ICJA 4B3SB 3WFOA 4I2AA 1FXKA 2WLJA 1P7BA 1AR1B 1VJ7A 9ICKA 1GO3F 3C5FA 1YLQA 2P66A 1HWYA 5CHEA 2BCVA 4GUNA 4JI3O 4JI5O 4K4IA 4KLMA 2PFNA 4LWSB 5EBLC 4GKJO 3ZN1A 3ZN0A 1DGSA 3BFRA 4FLTA 3OE7G 3EF2A 1XOUA 1EZVH 2UXDO 5J0OA 4M47A 9ICRA 2QEXV 5IYDO 1Q43A 1F4NA 3L75H 5J0XA 4B3RO 4YMNA 4FFKA 1K33A 3FB6C 1K73W 4TQDA 4IGGA 2ADPA 3UO3A 4DV2O 3SPCA 1TA8A 4MVMA 4WC3A 2CTPA 4PGQA 1ZQQA 2QGNA 2ZNJA 4N7RA 4RQ0A 5J2CA 3W7SA 3FKSG 1VQ6V 2UUCO 5KUKA 4I0UA 1BHAA 1EM1A 3T1HO 4JI8B 1KECA 4FVMA 2HVKC 4JAVA 1G4YB 1ZQIA 1MOFA 4CS3A 5BXZA 1Y4MA 3CX5F 4YD2A 3ER8C 1YEWA 3J7AU 2VANA 5LOVB 4WCEV 1NVPB 4IG8A 7ICJA 3WFPA 4JI1B 1ZQAA 1JA8A 1SERA 4S3NA 3CCQV 4B3TB 4RQ2A 4DR4B 3H39A 4TWKA 2LP7A 1BCCH 4CC6A 2B56A 3JAKB 1SZTA 5B1AB 4QZ8A 3AEIA 3E22A 3RN4A 4WBNA 1LUWA 2Q6AA 4LBEC 5IILA 5IY5C 1WA8A 3C2KA 5JH7A 4WBNB 3OD4A 1ZX3A 2F66C 4ATBB 1QQCA 4JAUA 4NTWA 3SJQC 2QKAA 3QO5A 3ZRXA 3GDXA 5LHGA 2AZ0A 5L3DA 4EBKA 4DR4O 8ICVA 4X4SA 3I5DA 2UXCO 2EJRA 1GM8A 4QE7A 5B1NA 1FA0A 2O57A 4PH5A 5H6QA 1RP3B 1VF5B 2HEPA 4J7JA 1CPYA 2E74B 4E2LA 1SQVH 2ZE8A 3JD4A 3UCSC 1XHXA 2F95B 2WWWA 3ZIAG 1OZ0A 1YCIA 4MW8A 4UD4A 3LSQA 2HLDG 3K08A 3WB1A 2P90A 1XSLA 3CB2A 3N2KB 2YEVB 5J2KA 3U0ZA 4FLYA 2P6JA 2X6BA 4JYYA 5IJ9A 2GA9D 2ZKOA 2LFSA 4M2YA 3RBZA 4BIOA 1KB9F 9ICHA 2ZT9B 1I5XA 1NU1H 4AI8A 2BE3A 1AP5A 4YMMA 5CHGA 5J0QA 3B40A 2XASA 4B3RB 4NXVA 1WJZA 1GK9A 4YXWG 3ZJZA 2BSKB 3T4DA 3BCCH 2YXHA 4UCRA 1IBKB 4JYBA 2LJ2A 3HB3B 3JAWA 4RQ6A 4UB5A 4MVRA 1NR7A 2A06H 4LR3A 3CRMA 5TISZ 3H3AA 1RSOB 4LFAB 2KG7B 3M8AA 1GN2A 1RSOA 5D62A 4ZI7B 1ZQWA 5HHIA 1VQ7V 3PNCA 2YSUB 5DECA 8ICUA 3OVAA 1YVWA 4J10A 5L3CA 3WB2A 2D3OW 1VQ9V 4AT8A 1BSMA 4X1YB 1F5AA 4Z6CA 5J0YA 2BTOA 1FAFA 3BAAA 3SR2C 3ZCCA 3RH4A 4YIOA 1ZSPA 2YI8A 2Q69A 5D49A 4P2HA 1M4UA 4Z2WA 1Q79A 2DOSA 3PMLA 3RGBA 2QA4V 5D46A 2DN9A 2CUGA 4OAHA 1MZEA 2EIJC 1ZQSA 7ICLA 3ZBHA 4JI2O 4X62O 1IXMA 1Z2GA 1NKDA 3BA8A 4QZEA 1H2SB 2EZPA 1Y76A 1IBMO 1UETA 4IQVA 4RPYA 1N36B 5BOLA 3STZC 2UU9O 2B9ZA 1D5NA 4X66B 2QWQB 4X65B 3CXHF 3HKCB 2UXBB 4E7XA 1FJGB 3HKDB 2F93B 2HVJC 8ICWA 3OFNG 4TV8A 4LF6O 1HNZO 3WB0A 4CH6A 4JI6B 1KD1W 3L74H 1ZQYA 4DOBA 8ICHA 2FMSA 3WFRE 1FD9A 5CWRA 4LZDA 2B5UA 4MVQA 1JR9A 1VQ5V 4PD4F 4RO2A 4ABMA 3OUSA 2JEUA 4LF5O 4UCOA 3E86A 1XQ8A 4NXZA 4GKKB 4FZ1A 2M7WA 4MKPA 3BVOA 3A0BZ 1SQPH 1MSWD 1BPYA 4MF8A 4NM2A 4E80A 1YXBA 3K04A 1N32B 2QE7G 4M5DA 3R66A 2MW2B 3LSUA 1WNSA 4WFAV 3MAQA 5HRHA 3TJTA 1DF4A 1NTZH 2WPDG 4PA7A 4X4TA 2EJ7A 3APOA 4ZHQB 1HR0B 2CDYA 4AQYO 3K79A 1R8AA 1JJ2U 4KLDA 4GZRB 4I7ZB 3FAVA 4KUMA 3BPZA 1SC5B 1M93A 2GBOA 3K5OA 4PA3A 3DGEA 4WFBV 4I4TA 3K0GA 1TAEA 4KHPB 1WPXA 1M56B 5KAIZ 5CA1B 2ZXWC 3LK9A 5H2FZ 2DQ3A 4YJ2B 4QZCA 2ILMA 3G6BA 5CA1A 8ICFA 1BPBA 1L0NH 4NM1A 3GB7C 4I50B 3AG2B 2BCQA 4KLIA 3OVBA 1SQXH 4B3MB 3TFRA 4I27A 5LOVA 1WAZA 1UFIA 4JLZA 2IHMA 4LF4O 8ICGA 3I56V 4GKKO 2HN1A 2DYSC 3JASB 5JVDB 4UUJC 4KLQA 4OAIZ 4RQ8A 2ZD9A 5CBHA 2B4VA 4R65A 3C18A 4BIZA 2DR9A 1Y66A 1I7FA 2CH7B 2QWOB 3BEHA 1Q6HA 2PZSA 5C8YA 5IY5B 3STLC 2HR3A 5KHGA 1QVGU 4FH5A 3ZMSA 3ZEDA 4PHPA 4DW1A 4IIJB 4BW5A 4UV9A 4DO9A 4QPJA 3RWRD 4JASA 4JYAB 4I2IA 4X65O 1H8HG 4O2AA 4X66O 2HHPA 1JX9A 3IC9A 4GYCB 1U96A 1N36O 1H8EG 2WA3A 4O4JB 2DQ0A 5HHHA 3ZHVA 4GXJA 1Q5OA 3QTCA 4EEQA 2ZINA 1ZQJA 2PI5A 4DV4B 1VFGA 4X62B 3JAMN 1FS0G 3D8CA 1BPEA 1XNRB 1V4AA 2BPGA 4MVSA 4I0XB 4P4MA 2YXLA 1FFTB 4QGPA 4DV5O 1BZKA 5B1BB 4UCTA 4OXSA 1GTOA 3FD9A 5HRLA 4CC5A 1XDCA 3HJ4A 4YN4A 5B1BC 1SQQH 1LR1A 4OX9O 4LFBO 1OCRB 4M9JA 1VQLV 2FMLA 5J2AA 2W6IG 3UT5B 1F23A 3N27A 4LF7B 1N33B 3VBBA 2HFEC 4YY3B 1TFYA 3LUTB 4R66A 4K9AA 2BCUA 4DRXB 3UT5A 4P9PA 1NO5A 4DR1O 4R8CA 8ICBA 1I5YA 7ICRA 2QR4A 5IDJA 3H9VA 1MQ2A 1BL8A 2ZH6A 4EB6B 2JGUA 1OU5A 4O9MA 3HKEA 5DB9A 4NKUA 5CBFA 1PNMA 4OPAA 4EB6A 5CA0B 2FMPA 3RJEA 4YY3O 5CA0A 4LF7O 1YHQV 1N33O 1PP9H 4JI0O 3OTFA 2E76B 4ZOLB 7ICPA 3OEEG 4OX9B 4LFBB 5J0PA 3AG7A 5JWPA 4FMTA 1AR4A 5D63A 4QZAA 2EIJB 2XAFA 4P4OA 1IZ3A 1OCCC 2LGWA 2KG7A 2OTJV 4DV5B 1B3QA 2IH1C 2X6AA 5H6RA 4QZDA 4HZ3A 4YJ3B 3ZRSA 2HJDA 1N4CA 8ICRA 4PJ0Z 4RWUA 2YIBA 2CTWA 1H2GA 4YJ3A 3E35A 1F4MA 2QM7A 4DV4O 5D5QA 5DBBA 3SYOA 1K5QA 4M0AA 1PNKA 3WFQE 3AQLA 4KL1A 4FH3A 3RYCB 1ZQLA 4L8JA 4R50A 3MHHC 2V1DA 5BY1A 1ZQRA 2R9IA 3OMIB 3LDEA 1WP8A 5DKWA 2JGDB 4UBCA 3ASOC 1N34B 2EIKC 2WLNA 4DV0O 5CJ7A 3OMNB 2ZR3A 1MSDA 9ICCA 1WA8B 4K8XA 3DC5A 2UUBO 2FMQA 8ICTA 1J95A 2GAFD 2IJKA 3E8HA 4YHHB 3JPQA 2FCLA 1TV9A 1RZTA 1R3KC 4X4VA 2JS3A 4MVUA 1HP8A 1QR8A 2R9RB 1QCEA 4DR2O 4FM0A 4I5SA 1V54B 4FLWA 4M9LA 4NR1A 1W59A 4UAYA 1ZQEA 4ZIBA 1PL0A 1NTKH 4LVSA 4LF4B 1GN3A 5JJEB 1JN3A 4B3MO 1QBZA 2ZDIA 4CH5A 4I55A 5IYZB 1THZA 4MTXA 4FM1A 4EFBA 4HNAB 3CC4V 3O65A 5CB4A 4X4UA 4RAIA 5JTGA 1VP7A 2FL4A 2Q9LA 4HNAA 2HHHO 4KFMA 2M2VA 2DRAA 1COWG 3N2KA 1IXBA 1AJQA 3V7KA 3HJ1A 2YIBD 3UM7A 5EBWC 4G28B 3TGUH 1G1XB 3IJ4A 1K8AW 4JWMA 2ZXWB 3K57A 1GN6A 1HNWO 1ZQHA 4O68A 8ICKA 4O69A 3ETEA 3MD0A 3CHXA 4JI1O 3T1YO 2XAHA 1HR0O 2WLMA 1XNQO 4UB1A 3T1CA 3P3PA 4LFCB 9ICAA 1H2MA 4P2ZA 1DK1A 3UQ0A 3RVZA 1NTMH 4XDLA 1Q6IA 4XBFA 3T1HB 3IAYA 3B0YA 4O2BB 1R6TA 3JAWB 1N32O 4RPZA 2UUCB 3JPRA 8ICXA 2B51A 4O2BA 1PL4A 4K4HA 4FLUA 4XJEA 3D36A 3H01A 3WFVA 4XA5A 1Y67A 1OCRC 1Q86W 7ICIA 4ZI7A 4UV8A 1ZQKA 2IHOA 4BAYA 5LGTA 2K9PA 1ZUQA 5LXTB 1G8MA 3OR6C 4R7CA 3JARB 3VQVA 2Z0AA 2DRBA 3B77A 3GWOA 2LO1A 3AK1A 3UQ2A 1ZJNA 1OCZC 1T5EA 4JI6O 3JARA 3J80N 1WOTA 2BBHA 1TUBB 3ML0A 5L3EA 4AT9B 2ZH9A 1MIWA 3W7UA 2EIMC 1FJGO 2XUMA 4AT9A 2PF4E 3S3XA 3ZMTA 4BR6A 4WC4A 2NNUA 1V55C 4XDJA 4TSFG 1ORQC 4XDKA 1KDHA 3KCYA 4NLZA 4MTOA 2VQEO 2F43G 3CJHA 4LCUC 2UUAO 2R9AA 4FHPA 5TZVA 5IINA 1K3EA 1TUEB 4WFEA 4DUZO 4QPKA 2UXNA 3RYFB 5EC2C 4IYHA 3FFQA 4AHCA 2B1GA 2IUBA 1ZL8B 2DR5A 9ICQA 4Z1VA 4M04A 1S72V 4IT5A 4K4GA 2PUSA 1TVKA 1YTFB 1S77D 5L3BA 3QNEA 4TV8B 2ZNIA 3CE2A 1YTFD 1RPRA 5FNVB 4EFEA 2UXXA 2ID1A 4J9YB 5B3QA 5LMUO 1FXVA 1NJIW 1K92A 5HRGA 4UB4A 2XTAA 1KP3A 1CXZB 4P30A 5IJ0B 4Z1MG 3OW2U 2VQFB 4QZGA 1HNXO 1OHHG 3B8NA 2CK3G 2UUAB 5IJ0A 2VQEB 4LEWA 3JD1A 3DXRB 3JALA 3CMEV 5HR9A 4K0KB 3BHPA 2QM4A 4MTGA 2IU3A 3DXRA 3JALB 4LFAO 4HAMA 3APQA 4NXMO 2KQXA 4KXRA 1FFXA 2A7WA 9ICUA 1O9GA 2K1EA 3HIYA 4WH5A 1SF9A 4PHZA 3OAAG 2I9GA 1SQFA 4IQTA 5EZYA 1IDSA 3P32A 1YF2A 4F6RA 1Q81W 5J2DA 5EZYB 3OMAB 1P49A 1MMMA 4FHXA 4DXWA 1KEJA 3TXSA 4OAFA 1VQPV 4NY8A 2EZOA 1OCOC 4QJFB 3AQNA 3SYPA 4ZOLA 8ICIA 3E89A 3K9AA 4FM2A 4EBJA 4X1KA 3Q4HB 4UBBA 3WFSC 5J2FA 4MVZA 4RQ1A 1BPXA 4JF3A 4KLGA 1FYJA 4LP8A 3Q4HA 3CD6V 3RYIB 1YI2V 2FTKA 4MVOA 5J2BA 5L3FA 4I50A 4EKWA 1AJPA 1ZJMA 4JV5B 1XNQB 1KKDA 3T1YB 3E8GA 3RYCA 1HUOA 2HN2A 5D61A 2ZCEA 1HNWB 4O4HA 2UXCB 5H9CA 4UB8Z 1S5LZ 2QDOA 3ERCC 1BGYH 3SYAA 4O4HB 3HKBB 5B1OA 4PDMA 2JGDA 4I9QA 3TCUA 4X88A 3HKBA 3HX0A 2YIAA 1E1RG 4W4LA 3THOA 1SESA 4P4PA 1AJNA 3KKYA 2JJ2G 4O2AB 2ITCC 4Q6GA 4JI7O 4DOCA 4K8ZA 2Q7HA 4KLTA 4FLVA 2Q67A 1XHZA 3K06A 4B3TO 5GONB 4DR5O 4WC5A 3VQWA 4O5CA 2QTSA 1BQZA 4WBZA 3AU2A 5GONA 2ZIOA 9ICXA 5IIOA 1XEQA 1ROPA 2FYUH 3BABA 3B2EE 4RUEA 1H2KA 4I55B 2UUBB 5IYZA 2JVDA 3U11A 4X89A 1VQNV 4YD1A 2XAJA 4DV0B 1FXKC 3IFXA 3JSNA 4JI8O 1N34O 5B3SC 1ZLZA 4F5NA 1W0KG 2JJ1G 4M9NA 1BPZA 3L70H 1UJWB 3C66A 4DV6O 3F5WC 1GM7A 1ZQUA 5EIBC 2DMXA 3L73H 2ZE6A 1QVFU 8ICEA 1GMGA 3CWBH 1I0HA 4FLZA 4DV2B 5CP2A 5J0RA 5JQGA 5H5NA 2H8PC 1VEWA 3OGUA 3ABKC 3UXOA 2ZHBA 4WBYA 2A0LA 1Q8IA 3SPGA 1XILA 1SRYA 5HRBA 3OTOB 3G71V 2UXDB 5K1XA 1FKAO 4WC0A 2VRZA 1BHBA 4WOYA 7ICMA 4LF9B 2ZM6B 2R70A 2YI9A 4IQWA 9ICVA 5L3GA 2ZH5A 9ICOA 3F7VC 4JI5B 4O5EA 1R89A 3D3IA 2LW7A 3FB5C 1YJNV 7ICOA 3A2FA 3W7XA 4FHVA 3ZX6A 4GX1A 4U3JA 3VQYA 2DR7A 2OCCC 1JMKC 2Q68A 3K5MA 4GCZA 2BOBC 1OCZB 4GT1A 8ICSA 5LL6Y 1PKXA 1GAXA 4RUFA 3JD3A 7ICTA 4PGYA 9ICNA 2EILC 3LSSA 1I94O 1LNQA 1BT8A 1IBLB 1TUBA 4WCWA 2CE4A 2A79B 1R8BA 3DSQA 1Q82W 8ICPA 2NN4A 5DDMA 2GDSA 3CCUV 3RVYA 1EN5A 4KLEA 1VQOV 1IX9A 4OGQB 4P9OA 1ZTEA 2LGQA 3B4SA 4CH3A 2E5LB 1JQ0A 4MS2A 5KAFZ 4GLXA 1B04A 3QO8A 4X0BA 1V54C 1HW7A 4CS4A 5LBQA 4UFZA 4GXKA 1XL4A 4DYLA 4LF8B 5HRDA 2AGAA 4W4KA 4FLXA 3RFRA 2M2UA 2KKWA 1N8RW 1IURA 3PJSK 3HKCA 2OTLV 1EN6A 5K1PA 8ICYA 5CA3A 2X0LA 3ZRWB 1RFYA 4FJCC 5B66Z 3FYIB 3RJJA 3ZMZA 5IIIA 1WLEA 4KLOA 3H38A 5JCOC 1MA1A 4R63A 1NZ6A 2VWKA 3K5LA 3K0DA 4RQ5A 1WB7A 2YC0A 4DUYB 2Q73A 1VIBA 4QE9A 1DTOA 1SS3A 1ZQOA 5IYCO 3GVMA 4K98A 3S3WA 1MIYA 1G6UA 4PHDA 4JI4O 1IVSA 2W0XA 1PM9A 1W2BU 4PA6A 4JWNA 3P3NA 1X59A 3OV7A 1KUQA 2QWRB 4DO2A 2DWEC 1KP2A 2DE0X 3OM3B 5J2GA 1R8CA 4DR7B 1NT2B 2OWOA 4YIPA 3MBYA 1JMSA 4RQFA 4CBCA 3H1JH 3SJBC 3T2MA 3V7LA 3C2MA 4PHEA 5BR8O 4DR7O 3H1LH 2EWRA 5B3PA 3RJHA 4FFBB 2YDEA 2QKCA 3B8MA 4F6RB 4FFBA 1FPOA 5FLXN 5B3SB 2YIDA 4MW3A 2XAQA 1KNYA 3CCMV 4I9WA 3VQXA 4MT8A 1I08A 5CMUA 3CS5A 1YITV 4J9ZB 4D7TA 5KLVH 9ICFA 3CP1A 4BIUA 4EV6A 3OGCC 3ASNC 1MNGA 1KKCA 2P06A 3TETA 3CCEV 3ETGA 1BMFG 2OIGA 1QU7A 4O4IB 4QZIA 2W6JG 5LMNO 5B1AC 2LW1A 2B1IA 1YZBA 2Q0AA 2Y69B 2BCSA 3SGIA 1RPLA 3HW8A 4FO6A 2IJJA 7ICKA 1EN4A 3R65A 4F6EA 2Y69C 3JD2A 4JPRA 4XQ8A 4I29A 1K4CC 1JJOA 4EEDA 2QJ1A 3D36C 2CGNA 2CH7A 5J2HA 2IJHA 5C8YB 4WFFA 3CPWU 3RYHA 1Q6UA 4FZ0A 4H13B 3ICXA 1VF6C 8ICCA 5J2JA 1AI7A 1H2LA 2ZE5A 4KLUA 1AB3A 4CS2A 4IYIA 3CC2V 1ZL8A 2QM8A 5LHIA 8ICZA 3C90A 4K8VA 4MFFA 2EILB 1R3LC 5EYPA 2KSDA 1K9MW 1I94B 2UU9B 2XOKG 4N21A 2BCRA 3JPOA 1DF5A 1D2DA 4H33A 5JJNB 5EIBD 3RW0A 4LZGA 1JVMA 1AI5A 1O9HA 2PYLA 2HJFC 2GV9A 2ZH8A 1VMGA 1IBMB 5KX5A 2ODMA 1EZJA 4UB2A 4RQ3A 4DK1A 4TT3G 5DB7A 1M5IA 4MFCA 2LQTA 5HC9A 4I0XA 3BY6A 3NR7A 5KX5B 1SQGA 3OEHG 4J11A 5BZBA 4JI2B 4I2JA 2D2CB 2BTQA 2FB5A 8ICOA 2JS5A 2BTQB 3ISCA 1S3JA 2IU0A 3E8FA 4NTYA 1BE3H 4O6AA 3H37A 1NS1A 1QLNA 2ZM6O 1NR1A 5CFTA 5J2UB 5GW7A 1F7YA 3OTOO 4DRXA 4NXWA 3JSLA 8ICLA 5KHKA 3V7JA 2Q8VA 3J81N 4U7NA 3E8BA
chains in the Genus database with same CATH topology
1ZQSA 7ICLA 5HRGA 4UB4A 4AT8B 5HRIA 4E8FA 4WC2A 4QZGA 4NKTA 4QZEA 1UETA 4TUPA 3TFSA 4FHYA 4IQVA 4RPYA 8ICAA 5HR9A 4TURA 5BOLA 4PHAA 2W9MA 3RH6A 5HRFA 5J0UA 3RJIA 1ZQMA 7ICNA 4I2EA 4E7XA 8ICWA 4I2BA 4MFAA 3JPPA 9ICUA 1MIVA 4WC7A 3HIYA 4IQUA 9ICGA 1XSPA 1ZQYA 4DOBA 4ATBA 8ICHA 9ICMA 3UPSA 2FMSA 3WFRE 3LQCB 4IQTA 4PGXA 2I9GA 3MGHA 5CWRA 1BPDA 3AQMA 4LZDA 4WC1A 1JQRA 5J2DA 9ICLA 4FHWA 1TVAA 4TUSA 5IIKA 4FHXA 1KEJA 1ZQTA 5HREA 4NXZA 4NY8A 3AQNA 3RJGA 8ICIA 4EBJA 1BPYA 4MF8A 4NM2A 4E80A 4XRHA 3MDAA 4UBBA 3WFSC 5J2FA 4RQ1A 4M5DA 5IIMA 5J0SA 1BPXA 4KLGA 1UEUA 5HRHA 4Z6DA 2ZH3A 7ICEA 5J2BA 4X4TA 4X5VA 9ICSA 1ZJMA 8ICNA 4X4OA 3OUYA 3L9DA 1HUZA 5CB1A 1R8AA 3AUOA 4KLDA 3OVSA 4QZBA 1HUOA 3JYYA 3JPSA 4RWPA 5J29A 3JZ0A 4RPXA 5J0WA 3MGIA 4F5OA 1JAJA 3LK9A 8ICMA 2BPCA 4TUQA 4QZCA 4RT3A 2DVIA 9ICTA 5F2VO 3B0XA 4RT2A 8ICFA 4UAWA 3HX0A 1BPBA 4NM1A 1ZQZA 4LT6A 2BCQA 4KLIA 3OVBA 4I27A 3TFRA 4P4PA 7ICHA 2IHMA 8ICGA 2NRKA 4DOCA 4KLQA 4XQ7A 4RQ8A 3RJFA 4KLTA 5D4BA 9ICWA 5HRKA 4R65A 3C18A 4WC5A 4GXIA 5J2EA 4M9HA 2DR9A 4UAZA 4O5CA 4WBZA 3AU2A 9ICXA 5IIOA 4I28A 4FH5A 4O5KA 3UXPA 4PHPA 5DBCA 4DOAA 4DO9A 4YD1A 5CR0A 4I2IA 4F5NA 4WC6A 4M9NA 1Q78A 2HHPA 1BPZA 4MF2A 4UD5A 3C66A 1ZQUA 3JPTA 8ICEA 2PFPA 2M2WA 3V72A 3AU6A 5HHHA 4GXJA 1ZQBA 1ZQJA 1ZQGA 5CP2A 2M2TA 1VFGA 7ICQA 1BPEA 5J0RA 1V4AA 4RQ4A 2BPGA 4X4PA 4QZFA 3OGUA 4F5RA 4P4MA 5BPCA 3UXOA 2ZHBA 4WBYA 5HRBA 5BOMA 1ZQCA 4X0AA 1MQ3A 4WC0A 9ICJA 7ICMA 5J0TA 3MDCA 5DEDA 5HRLA 4IQWA 4YN4A 3HJ4A 2ZH5A 9ICVA 9ICOA 4UB3A 4M9JA 4O5EA 5J2AA 4R64A 1TFYA 1R89A 4R66A 2BCUA 7ICOA 3UPQA 1NO5A 4NLNA 4FHVA 8ICBA 4I2CA 7ICRA 1MQ2A 3HWTA 2ZH6A 2DR7A 2GWSA 9ICBA 8ICJA 1OU5A 4O9MA 5DB9A 4NKUA 3WFOA 4I2AA 3RJKA 1VJ7A 9ICKA 8ICSA 3C5FA 2FMPA 3RJEA 1YLQA 2P66A 7ICTA 4PGYA 2O1PA 9ICNA 2BCVA 4WCWA 7ICPA 4QZHA 1R8BA 4K4IA 4KLMA 2BPFA 5J0PA 2PFNA 8ICPA 4QZAA 5DDMA 1ZQVA 4M9GA 4P4OA 4KLEA 5CA7A 4QZDA 5J0OA 4M47A 9ICRA 8ICRA 3C5GA 7ICSA 5J0XA 4X0BA 4YMNA 7ICUA 3OUYB 2DR8A 4YCXA 5DBBA 4GXKA 4M0AA 3WFQE 3AQLA 1ZQXA 4FH3A 5HRDA 1ZQLA 4WC3A 1TFWA 5EOZA 4PGQA 2M2UA 1ZQQA 2ISPA 4NLKA 3NYBA 5J2CA 4RQ0A 1ZQRA 4I2FA 5DKWA 8ICYA 5DBAA 4UBCA 3C2LA 3RJJA 5CJ7A 5IIIA 4KLOA 3H38A 7ICFA 1ZQIA 9ICCA 4R63A 2FMQA 4YD2A 4F5QA 5IIJA 4RQ5A 8ICTA 2VANA 3AQKA 3JPQA 4F5PA 4IG8A 4RWOA 2ZH1A 1TV9A 7ICJA 1RZTA 3WFPA 1ZQOA 4X4VA 1ZQAA 2ZH7A 1MIYA 4S3NA 4PHDA 3RH5A 4RQ2A 4M9LA 1ZQNA 3H39A 4UAYA 1ZQEA 4JWNA 4LVSA 3OV7A 1XSNA 1JN3A 3ISBA 5J2GA 4QZ8A 9ICEA 1R8CA 4QZ9A 3MBYA 5IILA 1JMSA 3C2KA 2PBEA 3V7LA 3C2MA 4PHEA 4X4UA 4ATBB 3RJHA 2M2VA 2DRAA 3GDXA 2ZHAA 3V7KA 3HJ1A 4I2DA 4EBKA 8ICVA 4X4SA 4JWMA 1ZQHA 1KNYA 1FA0A 2RFFA 4PH5A 8ICKA 4EP7A 7ICVA 4UB1A 2Q66A 9ICFA 4I2GA 4KLSA 1ZQDA 4KLHA 9ICAA 4UD4A 3UQ0A 5DB8A 4QZIA 3B0YA 1XSLA 4RPZA 5J2KA 4I2HA 3JPRA 2BCSA 9ICPA 4FO6A 1RPLA 3HW8A 8ICXA 1NOMA 4Z6FA 4K4HA 7ICKA 4RQ7A 4M2YA 2ZH2A 4XA5A 9ICHA 4XQ8A 4AT7A 4I29A 7ICIA 8ICQA 2BE3A 1ZQKA 5J2HA 4AT7B 4RWNA 4YMMA 4X4QA 5CHGA 5J0QA 4X4RA 3JPNA 9ICIA 2DRBA 8ICCA 5J2JA 4KLUA 4Z6EA 3UQ2A 1ZJNA 2PFOA 1WOTA 4RQ6A 4UB5A 4AT9B 2ZH9A 1MIWA 3ISDA 1UEVA 8ICZA 4KLFA 4MFFA 3H3AA 2ISOA 2PXIA 4AT9A 4WC4A 2BCRA 4YMOA 3JPOA 4RWQA 1KDHA 4NLZA 1ZQWA 4LZGA 5HHIA 3PNCA 2ZH8A 2ZH4A 4FHPA 5DECA 3K75D 5TZVA 7ICGA 5IINA 4XUSA 4UB2A 8ICUA 4RQ3A 5DDYA 5DB7A 3OVAA 4MFCA 5DB6A 5HC9A 4AT8A 1F5AA 4Z6CA 5J0YA 4I2JA 8ICOA 2DR5A 3RH4A 3ISCA 9ICQA 4M04A 4K4GA 3H37A 3UXNA 5J2IA 1ZQFA 5D49A 4P2HA 2PFQA 1PX5A 1Q79A 4X4NA 3PMNA 3PMLA 4PPXA 4KLJA 5D46A 1ZQPA 8ICLA 3V7JA 2ID1A 4KLLA 2O5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQS A;  7ICL A;  5HRG A;  4UB4 A;  4AT8 B;  5HRI A;  4E8F A;  4WC2 A;  4QZG A;  4NKT A;  4QZE A;  1UET A;  4TUP A;  3TFS A;  4FHY A;  4IQV A;  4RPY A;  8ICA A;  5HR9 A;  4TUR A;  5BOL A;  4PHA A;  2W9M A;  3RH6 A;  5HRF A;  5J0U A;  3RJI A;  1ZQM A;  7ICN A;  4I2E A;  4E7X A;  8ICW A;  4I2B A;  4MFA A;  3JPP A;  9ICU A;  1MIV A;  4WC7 A;  3HIY A;  4IQU A;  9ICG A;  1XSP A;  1ZQY A;  4DOB A;  4ATB A;  8ICH A;  9ICM A;  3UPS A;  2FMS A;  3WFR E;  3LQC B;  4IQT A;  4PGX A;  2I9G A;  3MGH A;  5CWR A;  1BPD A;  3AQM A;  4LZD A;  4WC1 A;  1JQR A;  5J2D A;  9ICL A;  4FHW A;  1TVA A;  4TUS A;  5IIK A;  4FHX A;  1KEJ A;  1ZQT A;  5HRE A;  4NXZ A;  4NY8 A;  3AQN A;  3RJG A;  8ICI A;  4EBJ A;  1BPY A;  4MF8 A;  4NM2 A;  4E80 A;  4XRH A;  3MDA A;  4UBB A;  3WFS C;  5J2F A;  4RQ1 A;  4M5D A;  5IIM A;  5J0S A;  1BPX A;  4KLG A;  1UEU A;  5HRH A;  4Z6D A;  2ZH3 A;  7ICE A;  5J2B A;  4X4T A;  4X5V A;  9ICS A;  1ZJM A;  8ICN A;  4X4O A;  3OUY A;  3L9D A;  1HUZ A;  5CB1 A;  1R8A A;  3AUO A;  4KLD A;  3OVS A;  4QZB A;  1HUO A;  3JYY A;  3JPS A;  4RWP A;  5J29 A;  3JZ0 A;  4RPX A;  5J0W A;  3MGI A;  4F5O A;  1JAJ A;  3LK9 A;  8ICM A;  2BPC A;  4TUQ A;  4QZC A;  4RT3 A;  2DVI A;  9ICT A;  5F2V O;  3B0X A;  4RT2 A;  8ICF A;  4UAW A;  3HX0 A;  1BPB A;  4NM1 A;  1ZQZ A;  4LT6 A;  2BCQ A;  4KLI A;  3OVB A;  4I27 A;  3TFR A;  4P4P A;  7ICH A;  2IHM A;  8ICG A;  2NRK A;  4DOC A;  4KLQ A;  4XQ7 A;  4RQ8 A;  3RJF A;  4KLT A;  5D4B A;  9ICW A;  5HRK A;  4R65 A;  3C18 A;  4WC5 A;  4GXI A;  5J2E A;  4M9H A;  2DR9 A;  4UAZ A;  4O5C A;  4WBZ A;  3AU2 A;  9ICX A;  5IIO A;  4I28 A;  4FH5 A;  4O5K A;  3UXP A;  4PHP A;  5DBC A;  4DOA A;  4DO9 A;  4YD1 A;  5CR0 A;  4I2I A;  4F5N A;  4WC6 A;  4M9N A;  1Q78 A;  2HHP A;  1BPZ A;  4MF2 A;  4UD5 A;  3C66 A;  1ZQU A;  3JPT A;  8ICE A;  2PFP A;  2M2W A;  3V72 A;  3AU6 A;  5HHH A;  4GXJ A;  1ZQB A;  1ZQJ A;  1ZQG A;  5CP2 A;  2M2T A;  1VFG A;  7ICQ A;  1BPE A;  5J0R A;  1V4A A;  4RQ4 A;  2BPG A;  4X4P A;  4QZF A;  3OGU A;  4F5R A;  4P4M A;  5BPC A;  3UXO A;  2ZHB A;  4WBY A;  5HRB A;  5BOM A;  1ZQC A;  4X0A A;  1MQ3 A;  4WC0 A;  9ICJ A;  7ICM A;  5J0T A;  3MDC A;  5DED A;  5HRL A;  4IQW A;  4YN4 A;  3HJ4 A;  2ZH5 A;  9ICV A;  9ICO A;  4UB3 A;  4M9J A;  4O5E A;  5J2A A;  4R64 A;  1TFY A;  1R89 A;  4R66 A;  2BCU A;  7ICO A;  3UPQ A;  1NO5 A;  4NLN A;  4FHV A;  8ICB A;  4I2C A;  7ICR A;  1MQ2 A;  3HWT A;  2ZH6 A;  2DR7 A;  2GWS A;  9ICB A;  8ICJ A;  1OU5 A;  4O9M A;  5DB9 A;  4NKU A;  3WFO A;  4I2A A;  3RJK A;  1VJ7 A;  9ICK A;  8ICS A;  3C5F A;  2FMP A;  3RJE A;  1YLQ A;  2P66 A;  7ICT A;  4PGY A;  2O1P A;  9ICN A;  2BCV A;  4WCW A;  7ICP A;  4QZH A;  1R8B A;  4K4I A;  4KLM A;  2BPF A;  5J0P A;  2PFN A;  8ICP A;  4QZA A;  5DDM A;  1ZQV A;  4M9G A;  4P4O A;  4KLE A;  5CA7 A;  4QZD A;  5J0O A;  4M47 A;  9ICR A;  8ICR A;  3C5G A;  7ICS A;  5J0X A;  4X0B A;  4YMN A;  7ICU A;  3OUY B;  2DR8 A;  4YCX A;  5DBB A;  4GXK A;  4M0A A;  3WFQ E;  3AQL A;  1ZQX A;  4FH3 A;  5HRD A;  1ZQL A;  4WC3 A;  1TFW A;  5EOZ A;  4PGQ A;  2M2U A;  1ZQQ A;  2ISP A;  4NLK A;  3NYB A;  5J2C A;  4RQ0 A;  1ZQR A;  4I2F A;  5DKW A;  8ICY A;  5DBA A;  4UBC A;  3C2L A;  3RJJ A;  5CJ7 A;  5III A;  4KLO A;  3H38 A;  7ICF A;  1ZQI A;  9ICC A;  4R63 A;  2FMQ A;  4YD2 A;  4F5Q A;  5IIJ A;  4RQ5 A;  8ICT A;  2VAN A;  3AQK A;  3JPQ A;  4F5P A;  4IG8 A;  4RWO A;  2ZH1 A;  1TV9 A;  7ICJ A;  1RZT A;  3WFP A;  1ZQO A;  4X4V A;  1ZQA A;  2ZH7 A;  1MIY A;  4S3N A;  4PHD A;  3RH5 A;  4RQ2 A;  4M9L A;  1ZQN A;  3H39 A;  4UAY A;  1ZQE A;  4JWN A;  4LVS A;  3OV7 A;  1XSN A;  1JN3 A;  3ISB A;  5J2G A;  4QZ8 A;  9ICE A;  1R8C A;  4QZ9 A;  3MBY A;  5IIL A;  1JMS A;  3C2K A;  2PBE A;  3V7L A;  3C2M A;  4PHE A;  4X4U A;  4ATB B;  3RJH A;  2M2V A;  2DRA A;  3GDX A;  2ZHA A;  3V7K A;  3HJ1 A;  4I2D A;  4EBK A;  8ICV A;  4X4S A;  4JWM A;  1ZQH A;  1KNY A;  1FA0 A;  2RFF A;  4PH5 A;  8ICK A;  4EP7 A;  7ICV A;  4UB1 A;  2Q66 A;  9ICF A;  4I2G A;  4KLS A;  1ZQD A;  4KLH A;  9ICA A;  4UD4 A;  3UQ0 A;  5DB8 A;  4QZI A;  3B0Y A;  1XSL A;  4RPZ A;  5J2K A;  4I2H A;  3JPR A;  2BCS A;  9ICP A;  4FO6 A;  1RPL A;  3HW8 A;  8ICX A;  1NOM A;  4Z6F A;  4K4H A;  7ICK A;  4RQ7 A;  4M2Y A;  2ZH2 A;  4XA5 A;  9ICH A;  4XQ8 A;  4AT7 A;  4I29 A;  7ICI A;  8ICQ A;  2BE3 A;  1ZQK A;  5J2H A;  4AT7 B;  4RWN A;  4YMM A;  4X4Q A;  5CHG A;  5J0Q A;  4X4R A;  3JPN A;  9ICI A;  2DRB A;  8ICC A;  5J2J A;  4KLU A;  4Z6E A;  3UQ2 A;  1ZJN A;  2PFO A;  1WOT A;  4RQ6 A;  4UB5 A;  4AT9 B;  2ZH9 A;  1MIW A;  3ISD A;  1UEV A;  8ICZ A;  4KLF A;  4MFF A;  3H3A A;  2ISO A;  2PXI A;  4AT9 A;  4WC4 A;  2BCR A;  4YMO A;  3JPO A;  4RWQ A;  1KDH A;  4NLZ A;  1ZQW A;  4LZG A;  5HHI A;  3PNC A;  2ZH8 A;  2ZH4 A;  4FHP A;  5DEC A;  3K75 D;  5TZV A;  7ICG A;  5IIN A;  4XUS A;  4UB2 A;  8ICU A;  4RQ3 A;  5DDY A;  5DB7 A;  3OVA A;  4MFC A;  5DB6 A;  5HC9 A;  4AT8 A;  1F5A A;  4Z6C A;  5J0Y A;  4I2J A;  8ICO A;  2DR5 A;  3RH4 A;  3ISC A;  9ICQ A;  4M04 A;  4K4G A;  3H37 A;  3UXN A;  5J2I A;  1ZQF A;  5D49 A;  4P2H A;  2PFQ A;  1PX5 A;  1Q79 A;  4X4N A;  3PMN A;  3PML A;  4PPX A;  4KLJ A;  5D46 A;  1ZQP A;  8ICL A;  3V7J A;  2ID1 A;  4KLL A;  2O5A A; 
#chains in the Genus database with same CATH topology
 4ZBM A;  2Q4P A;  3WU2 Z;  5HRI A;  4E8F A;  1OCO B;  4NKT A;  3CEI A;  1KMI Z;  1ENV A;  4DV1 B;  1CP9 A;  1XI1 A;  3JYC A;  1PV0 A;  1QNM A;  5KHI A;  1K5S A;  2ATK C;  4DV6 B;  3C3T A;  4PHA A;  2P22 C;  3RH6 A;  5HRF A;  4NB5 A;  5J0U A;  3RJI A;  2EBO A;  7ICN A;  4I2E A;  2EX3 A;  2P67 A;  1F51 A;  4I2B A;  4X1K B;  4WF9 V;  4TOI A;  2OYQ A;  4WC7 A;  1IBK O;  1KQS U;  5IWA O;  2OCC B;  1AVM A;  2ZQM A;  2BCC H;  1SZX A;  3MGH A;  2JDI G;  3CMA V;  4QNH B;  3FYE B;  1BPD A;  1UPG A;  1GPJ A;  1NH2 D;  3ABT A;  1GRJ A;  1KC8 W;  4FHW A;  1TVA A;  4TUS A;  4O4L B;  1J5E B;  4JAA A;  1L0L H;  1R6K A;  2NR5 A;  4DR3 O;  2EUL A;  4KP4 A;  5HRE A;  1D5A A;  4O4L A;  3A8T A;  3OGI B;  2CGO A;  3RJG A;  3K03 A;  4K97 A;  4XRH A;  5E1A C;  3E83 A;  2P4K A;  2ADQ B;  1UEU A;  1AP6 A;  4Z6D A;  1L8D A;  4KB6 A;  2CTQ A;  7ICE A;  4NXU A;  1K7D A;  8ICN A;  3L71 H;  2AHY A;  4UCV A;  3QO7 A;  2Q5Z A;  4JYC A;  3AUO A;  2Q7G A;  4QZB A;  3ETQ A;  3CCS V;  3JYY A;  3JPS A;  1PNL A;  3AG3 C;  5FPR A;  1JPX A;  1EFR G;  2DW4 A;  4IHJ A;  4J80 A;  5FL7 G;  3BA9 A;  4QIW F;  3JZ0 A;  4RPX A;  1KYO F;  2ZE7 A;  4IHJ B;  5J0W A;  3D3Q A;  1LUV A;  3G67 A;  1VF7 A;  2N74 A;  3DTU B;  1JAJ A;  3ZRW A;  8ICM A;  2BPC A;  2ZIM A;  4TUQ A;  1VQM V;  2Y4U A;  1KBH A;  1MAB G;  9ICT A;  5F2V O;  4GX2 A;  3X2Q B;  4FK5 C;  3HR0 A;  4X9Q A;  4UCU A;  1TGO A;  5LP6 B;  1ZQZ A;  3SJA C;  2GTA A;  1X4T A;  5LP6 A;  7ICH A;  3MHS C;  2NRK A;  4TV9 B;  4PA4 A;  5HFM A;  5A9G A;  2BBJ A;  3ZHT A;  2QWN B;  4GX0 A;  3RJF A;  2VWJ A;  1ZWI C;  4A5U B;  4DR3 B;  1J5E O;  1M1K W;  4JTA B;  2XAG A;  4GXI A;  1YSC A;  4UAZ A;  3ASN B;  3JD0 A;  3ABK B;  4U3F H;  1S76 D;  5AG2 A;  4CZZ A;  1GM9 A;  1PD3 A;  4PA9 A;  3K5N A;  5EBM C;  1R73 A;  5JQG B;  4O5K A;  5IWA B;  4NKG B;  1NH2 B;  3SYC A;  3BRC A;  2JIZ G;  4DOA A;  2BSK A;  3KCX A;  2V4D A;  4NXM B;  5EC1 C;  3F7Y C;  4LEZ A;  1NBM G;  4DV7 O;  1AIL A;  2R72 A;  4WC6 A;  1S5H C;  1Q78 A;  4MF2 A;  3JCU Z;  5LHH A;  4UD5 A;  3OT7 A;  4X64 B;  4K0K O;  3MCR A;  3JPT A;  3IC7 A;  4D6T H;  3AU6 A;  4DV1 O;  1Y6X A;  2FKX A;  4H0L B;  1ZQG A;  1QR9 A;  4U3J B;  2XT9 A;  4NTX A;  3JCZ A;  2M2T A;  5LMU B;  2Z3Y A;  2P5O A;  4X4P A;  1MZF A;  1XL6 A;  2KB1 A;  4B08 A;  4C7U A;  4F5R A;  5BPC A;  2VS0 A;  4K9B A;  1W0J G;  3LNN A;  4NVP A;  4X0A A;  3DC6 A;  2PI4 A;  1OCC B;  1MQ3 A;  4Q20 A;  4JTD B;  1V55 B;  3VOU A;  4O4I A;  3CCR V;  9ICJ A;  4GKJ B;  5KMG A;  1RM1 B;  3MDC A;  1B06 A;  5GTH Z;  4JI3 B;  4UB3 A;  2GUZ B;  1RM1 C;  1V9P A;  1SET A;  4ZKI A;  4PI2 A;  3M99 B;  2GUZ A;  3UPQ A;  3E2E A;  4DUZ B;  1XRE A;  4B3S O;  3CK6 A;  1YJW V;  3HWT A;  3AG1 C;  2A3Q A;  2DYR B;  3HPL C;  3ABM B;  9ICB A;  3RYF A;  1XMO O;  2RDC A;  3RYH B;  1SKV A;  2YUA A;  4NXN B;  3RJK A;  1DLB A;  4PEL A;  2EIK B;  2O1P A;  1HDJ A;  4QZH A;  1K97 A;  4GX5 A;  2QSA A;  3IGA C;  2BPF A;  2GSM B;  1ZQV A;  4M9G A;  1OV9 A;  3AK3 A;  4JGS A;  5CA7 A;  4NXT A;  3CCV V;  2CAZ C;  3OWG A;  4K99 A;  1YDX A;  1R1B A;  3O9O A;  3C5G A;  7ICS A;  1H38 A;  3C3S A;  7ICU A;  5CFS A;  3OUY B;  3CXC U;  4TQF A;  2DR8 A;  3F5T A;  3QG5 A;  4YCX A;  4B7E A;  2QKS A;  1ZQX A;  1TFW A;  5HFL A;  2RMK B;  5B5E Z;  5EOZ A;  4BW9 A;  1WPB A;  2ISP A;  3N2G B;  4NLK A;  4FO1 A;  3NYB A;  2IM9 A;  1XMQ O;  2WA4 A;  4I2F A;  4X64 O;  4NYK A;  3N2G A;  2RCV A;  4LWS A;  4LNU B;  5DBA A;  5E79 Z;  3L72 H;  5J9P C;  5J2U A;  2RJZ A;  1FFX B;  3C2L A;  3ZHR A;  2CTR A;  4DV7 B;  3W7T A;  1AI6 A;  1KU9 A;  3W7W A;  4LEY A;  7ICF A;  4LFC O;  3NKU A;  1S5J A;  4F5Q A;  5IIJ A;  3CCL V;  3AQK A;  4TUY B;  3EVK A;  3QF7 A;  4WFG A;  2XHB A;  4F5P A;  4RWO A;  5FPO A;  2ZH1 A;  2HKO A;  1VQK V;  2P4V A;  2ZH7 A;  4X1I A;  1WN7 A;  3U10 A;  4J42 A;  4ZHQ A;  2F1M A;  3RH5 A;  3FAV B;  1EBO A;  1M9N A;  3OR7 C;  1ZQN A;  1NQT A;  1VAR A;  3M7M X;  2WSS G;  3UKM A;  4I4T B;  1CEZ A;  1XSN A;  2HHH B;  3AK2 A;  5CFU A;  3ISB A;  1BS3 A;  3WG7 B;  9ICE A;  2ITD C;  4QZ9 A;  4D7S A;  5BR8 B;  4O67 A;  3RYI A;  5JJJ B;  4UVC A;  3QVN A;  2PBE A;  1M57 B;  1P4R A;  3JAT B;  3CSX A;  3AG3 B;  2YXY A;  5LA6 A;  2ZHA A;  2Y0P A;  3JAT A;  4OPH A;  4DR6 B;  4I2D A;  3AG2 C;  2NLJ C;  3JAS A;  1OJH A;  5JVD A;  4DR2 B;  4HX0 A;  3NWI A;  2RFF A;  1ARO P;  4UVB A;  5KHH A;  5A2Q N;  3A0R A;  4EP7 A;  2WLI B;  4YHH O;  7ICV A;  3B09 A;  1N0J A;  5J2T B;  2Q66 A;  2L6L A;  3G80 A;  2N04 A;  2WAM A;  5DM6 V;  4I2G A;  4KLS A;  5J2T A;  1ZQD A;  5JH7 B;  3ABU A;  4BWA A;  4KLH A;  2OIE A;  4PI0 A;  4PDR A;  5DB8 A;  3OUF A;  4J7K A;  4X20 B;  2V7Q G;  1JFF B;  3I55 V;  2OT5 A;  3H1K H;  4I2H A;  2F23 A;  2WLL B;  3SPJ A;  2EIN B;  2IBZ H;  4X20 A;  1SA0 B;  9ICP A;  1R3J C;  5BMV B;  2PTM A;  1NOM A;  4Z6F A;  1JFF A;  1Y74 B;  3KZI Z;  5EYP B;  1M90 W;  3JCF A;  4RQ7 A;  2ZH2 A;  1SA0 A;  5BMV A;  4AT7 A;  1Y74 A;  3NXS A;  4L87 A;  8ICQ A;  4O4J A;  4AT7 B;  4RWN A;  5DN6 G;  4X4Q A;  2IW5 A;  4K3A A;  4PDV A;  1XBL A;  4X4R A;  3ER9 B;  1FXK B;  3JPN A;  4EGW A;  9ICI A;  2G38 A;  3CRC A;  5EK0 A;  3AG1 B;  2ZR2 A;  4Z6E A;  4DK0 A;  4UXN A;  1GN4 A;  4PDL A;  4DV3 B;  2PFO A;  4UCS A;  3FX7 A;  3ISD A;  1UEV A;  5IJ9 B;  2QWP B;  2Z5U A;  4LEV A;  2ISO A;  4KLF A;  4JI0 B;  2PXI A;  1U97 A;  2IH3 C;  4YMO A;  2H3O A;  1GH6 A;  5D5P A;  2JK5 C;  4RWQ A;  3CRQ A;  3EHB B;  2F4V B;  2ZH4 A;  1E1Q G;  3K75 D;  7ICG A;  4NXX A;  4XUS A;  2M6Y A;  5DDY A;  5DB6 A;  4WQL A;  2L35 A;  4MSW C;  4DR1 B;  2ARH A;  3H1H H;  1VQ4 V;  3HKE B;  4WFH A;  3LDD A;  4MTF A;  2IJI A;  3PN1 A;  2W0F C;  2RNB A;  3LNM B;  1WP7 A;  2AHZ A;  4HYO A;  3UXN A;  5J2I A;  1ZQF A;  1QLE C;  1BQ0 A;  2PY5 A;  4LF9 O;  4J7Z A;  1PX5 A;  2PFQ A;  1YIJ V;  3G6E V;  4X4N A;  3PMN A;  4G27 B;  2ETN A;  4PPX A;  2A9H A;  4KLJ A;  1ZQP A;  3ABM C;  5C93 A;  4KLL A;  2O5A A;  1XNR O;  1VF6 A;  1L1F A;  1PPJ H;  2E75 B;  4HBN A;  4FIP C;  3CRA A;  4AT8 B;  2GTS A;  3SJC C;  4WC2 A;  3SPH A;  4ASU G;  4TUP A;  2F4V O;  3TFS A;  4FHY A;  1URF A;  8ICA A;  4TUR A;  3AG4 C;  2W9M A;  2WLH A;  1ZQM A;  3JAK A;  2RQ6 A;  2MK3 A;  4JYA O;  1WB8 A;  3EFF K;  1JOY A;  1FXH A;  3E22 B;  4MFA A;  1K34 A;  3JPP A;  1MIV A;  4DV3 O;  3WG7 C;  4IQU A;  9ICG A;  1XSP A;  5KHJ A;  4ATB A;  2DYR C;  9ICM A;  3UPS A;  3ASO B;  3TK1 A;  3LQC B;  4PGX A;  4U7O A;  1NVP D;  3AQM A;  5GTI Z;  5JCO A;  4WC1 A;  1JQR A;  9ICL A;  1Y76 B;  4LH6 A;  5IIK A;  4J41 A;  3G4S V;  4DR5 B;  2Q7E A;  5LGU A;  1ZQT A;  2RN9 A;  3ETD A;  4JI7 B;  1YJ9 V;  3GWK C;  4DW0 A;  4H44 B;  4G2K A;  1Z5V A;  3MDA A;  1MG1 A;  2Y48 A;  5LMN B;  2QTO A;  5KA6 A;  2AXT Z;  5J0S A;  5IIM A;  4JLX A;  2ZDI C;  2DWD C;  1B6Q A;  4ICG A;  2ZH3 A;  4CH4 A;  3CC7 V;  4F4L A;  3EXA A;  4JZ2 A;  4X5V A;  9ICS A;  5LYJ B;  5CB4 B;  2YEV A;  4X4O A;  3ZRV A;  1AI4 A;  4KHP O;  3OUY A;  3L9D A;  3CRR A;  1HUZ A;  1Q7Y W;  5LYJ A;  4TV9 A;  1RPO A;  5CB1 A;  2N05 A;  2X6C A;  3K3W A;  3OVS A;  3SPI A;  4X8A A;  2PGG A;  2EIN C;  4RWP A;  3RT3 C;  3CYO A;  1H2N A;  3KG2 A;  1ZAU A;  4JZG A;  4AQY B;  5J29 A;  1R3I C;  4DR6 O;  4JV5 O;  4LNU A;  3MGI A;  3X2Q C;  4F5O A;  2XND G;  3TXQ A;  3H1I H;  1US6 A;  4RT3 A;  1S0V A;  5LP6 C;  3ZMV A;  3B0X A;  2DVI A;  1SQB H;  2BOC C;  5KUM A;  4RT2 A;  3K9S A;  4UAW A;  4IL6 Z;  4UB6 Z;  2AW9 A;  2LFR A;  4E4E A;  4LT6 A;  4OAG A;  3P30 A;  2PYJ A;  3NVO A;  4TUY A;  4B7K A;  1AR5 A;  4X1I B;  5IE9 A;  3FB7 C;  4XQ7 A;  4KM5 A;  5D4B A;  3A0H Z;  9ICW A;  4R6Z A;  4RQE A;  5HRK A;  4JI4 B;  4LH7 A;  4LF5 B;  5J2E A;  4M9H A;  2HG5 C;  3ZMU A;  1Q3E A;  4FPP A;  3FB8 C;  4AIL C;  3ZS8 C;  4X1Y A;  4I28 A;  4UVA A;  4YJ2 A;  4DUY O;  1A32 A;  3ZHU A;  1M57 C;  2Y0I A;  3UXP A;  4JTC B;  5LXT A;  5IT9 N;  2JEX A;  1QHT A;  5DBC A;  1M56 C;  1HNZ B;  4LF6 B;  1N0N A;  2GHY A;  5CR0 A;  2UXB O;  2OCH A;  5KMG B;  1JCH A;  1Z5W A;  3MDS A;  3K59 A;  5LA6 B;  3PHZ A;  5CN0 A;  3K58 A;  1XMQ B;  1QLE B;  1VQ8 V;  1R6N A;  5LGN A;  2PFP A;  2M2W A;  3T4Z A;  3V72 A;  2EIM B;  4WQK A;  2YIC A;  1E79 G;  1XUQ A;  3UO2 A;  1HNX B;  1ZQB A;  4LF8 O;  5IYB O;  2VQF O;  3K7D A;  1P7G A;  2DYS B;  3CJH B;  1K4D C;  1NI8 A;  2WLI A;  2YS8 A;  3ABL B;  2JRI A;  7ICQ A;  3LDC A;  1P84 F;  4RQ4 A;  2P7T C;  4QZF A;  4PV1 B;  4EEB A;  2X7R B;  3ABL C;  4IIJ A;  2E5L O;  4K35 A;  2HP8 A;  2AZ2 A;  5BOM A;  1ZQC A;  1GKF A;  2C2A A;  5CBG A;  5J0T A;  1Q90 D;  3ZHS A;  3ZHQ A;  5DED A;  5KA5 A;  3HKD A;  3AG4 B;  1TVK B;  2WLL A;  3CCJ V;  2Y4T A;  2WLK A;  4H37 A;  2H94 A;  5ITZ B;  1IBL O;  4R64 A;  4LC1 A;  3UQ8 A;  5ITZ A;  5FNV A;  4N23 A;  2DJV A;  4NLN A;  4NXN O;  3SDL A;  4I2C A;  3SYQ A;  2E3C A;  1XMO B;  4K96 A;  2Q0O C;  2GWS A;  8ICJ A;  4B3S B;  3WFO A;  4I2A A;  1FXK A;  2WLJ A;  1P7B A;  1AR1 B;  1VJ7 A;  9ICK A;  1GO3 F;  3C5F A;  1YLQ A;  2P66 A;  1HWY A;  5CHE A;  2BCV A;  4GUN A;  4JI3 O;  4JI5 O;  4K4I A;  4KLM A;  2PFN A;  4LWS B;  5EBL C;  4GKJ O;  3ZN1 A;  3ZN0 A;  1DGS A;  3BFR A;  4FLT A;  3OE7 G;  3EF2 A;  1XOU A;  1EZV H;  2UXD O;  5J0O A;  4M47 A;  9ICR A;  2QEX V;  5IYD O;  1Q43 A;  1F4N A;  3L75 H;  5J0X A;  4B3R O;  4YMN A;  4FFK A;  1K33 A;  3FB6 C;  1K73 W;  4TQD A;  4IGG A;  2ADP A;  3UO3 A;  4DV2 O;  3SPC A;  1TA8 A;  4MVM A;  4WC3 A;  2CTP A;  4PGQ A;  1ZQQ A;  2QGN A;  2ZNJ A;  4N7R A;  4RQ0 A;  5J2C A;  3W7S A;  3FKS G;  1VQ6 V;  2UUC O;  5KUK A;  4I0U A;  1BHA A;  1EM1 A;  3T1H O;  4JI8 B;  1KEC A;  4FVM A;  2HVK C;  4JAV A;  1G4Y B;  1ZQI A;  1MOF A;  4CS3 A;  5BXZ A;  1Y4M A;  3CX5 F;  4YD2 A;  3ER8 C;  1YEW A;  3J7A U;  2VAN A;  5LOV B;  4WCE V;  1NVP B;  4IG8 A;  7ICJ A;  3WFP A;  4JI1 B;  1ZQA A;  1JA8 A;  1SER A;  4S3N A;  3CCQ V;  4B3T B;  4RQ2 A;  4DR4 B;  3H39 A;  4TWK A;  2LP7 A;  1BCC H;  4CC6 A;  2B56 A;  3JAK B;  1SZT A;  5B1A B;  4QZ8 A;  3AEI A;  3E22 A;  3RN4 A;  4WBN A;  1LUW A;  2Q6A A;  4LBE C;  5IIL A;  5IY5 C;  1WA8 A;  3C2K A;  5JH7 A;  4WBN B;  3OD4 A;  1ZX3 A;  2F66 C;  4ATB B;  1QQC A;  4JAU A;  4NTW A;  3SJQ C;  2QKA A;  3QO5 A;  3ZRX A;  3GDX A;  5LHG A;  2AZ0 A;  5L3D A;  4EBK A;  4DR4 O;  8ICV A;  4X4S A;  3I5D A;  2UXC O;  2EJR A;  1GM8 A;  4QE7 A;  5B1N A;  1FA0 A;  2O57 A;  4PH5 A;  5H6Q A;  1RP3 B;  1VF5 B;  2HEP A;  4J7J A;  1CPY A;  2E74 B;  4E2L A;  1SQV H;  2ZE8 A;  3JD4 A;  3UCS C;  1XHX A;  2F95 B;  2WWW A;  3ZIA G;  1OZ0 A;  1YCI A;  4MW8 A;  4UD4 A;  3LSQ A;  2HLD G;  3K08 A;  3WB1 A;  2P90 A;  1XSL A;  3CB2 A;  3N2K B;  2YEV B;  5J2K A;  3U0Z A;  4FLY A;  2P6J A;  2X6B A;  4JYY A;  5IJ9 A;  2GA9 D;  2ZKO A;  2LFS A;  4M2Y A;  3RBZ A;  4BIO A;  1KB9 F;  9ICH A;  2ZT9 B;  1I5X A;  1NU1 H;  4AI8 A;  2BE3 A;  1AP5 A;  4YMM A;  5CHG A;  5J0Q A;  3B40 A;  2XAS A;  4B3R B;  4NXV A;  1WJZ A;  1GK9 A;  4YXW G;  3ZJZ A;  2BSK B;  3T4D A;  3BCC H;  2YXH A;  4UCR A;  1IBK B;  4JYB A;  2LJ2 A;  3HB3 B;  3JAW A;  4RQ6 A;  4UB5 A;  4MVR A;  1NR7 A;  2A06 H;  4LR3 A;  3CRM A;  5TIS Z;  3H3A A;  1RSO B;  4LFA B;  2KG7 B;  3M8A A;  1GN2 A;  1RSO A;  5D62 A;  4ZI7 B;  1ZQW A;  5HHI A;  1VQ7 V;  3PNC A;  2YSU B;  5DEC A;  8ICU A;  3OVA A;  1YVW A;  4J10 A;  5L3C A;  3WB2 A;  2D3O W;  1VQ9 V;  4AT8 A;  1BSM A;  4X1Y B;  1F5A A;  4Z6C A;  5J0Y A;  2BTO A;  1FAF A;  3BAA A;  3SR2 C;  3ZCC A;  3RH4 A;  4YIO A;  1ZSP A;  2YI8 A;  2Q69 A;  5D49 A;  4P2H A;  1M4U A;  4Z2W A;  1Q79 A;  2DOS A;  3PML A;  3RGB A;  2QA4 V;  5D46 A;  2DN9 A;  2CUG A;  4OAH A;  1MZE A;  2EIJ C;  1ZQS A;  7ICL A;  3ZBH A;  4JI2 O;  4X62 O;  1IXM A;  1Z2G A;  1NKD A;  3BA8 A;  4QZE A;  1H2S B;  2EZP A;  1Y76 A;  1IBM O;  1UET A;  4IQV A;  4RPY A;  1N36 B;  5BOL A;  3STZ C;  2UU9 O;  2B9Z A;  1D5N A;  4X66 B;  2QWQ B;  4X65 B;  3CXH F;  3HKC B;  2UXB B;  4E7X A;  1FJG B;  3HKD B;  2F93 B;  2HVJ C;  8ICW A;  3OFN G;  4TV8 A;  4LF6 O;  1HNZ O;  3WB0 A;  4CH6 A;  4JI6 B;  1KD1 W;  3L74 H;  1ZQY A;  4DOB A;  8ICH A;  2FMS A;  3WFR E;  1FD9 A;  5CWR A;  4LZD A;  2B5U A;  4MVQ A;  1JR9 A;  1VQ5 V;  4PD4 F;  4RO2 A;  4ABM A;  3OUS A;  2JEU A;  4LF5 O;  4UCO A;  3E86 A;  1XQ8 A;  4NXZ A;  4GKK B;  4FZ1 A;  2M7W A;  4MKP A;  3BVO A;  3A0B Z;  1SQP H;  1MSW D;  1BPY A;  4MF8 A;  4NM2 A;  4E80 A;  1YXB A;  3K04 A;  1N32 B;  2QE7 G;  4M5D A;  3R66 A;  2MW2 B;  3LSU A;  1WNS A;  4WFA V;  3MAQ A;  5HRH A;  3TJT A;  1DF4 A;  1NTZ H;  2WPD G;  4PA7 A;  4X4T A;  2EJ7 A;  3APO A;  4ZHQ B;  1HR0 B;  2CDY A;  4AQY O;  3K79 A;  1R8A A;  1JJ2 U;  4KLD A;  4GZR B;  4I7Z B;  3FAV A;  4KUM A;  3BPZ A;  1SC5 B;  1M93 A;  2GBO A;  3K5O A;  4PA3 A;  3DGE A;  4WFB V;  4I4T A;  3K0G A;  1TAE A;  4KHP B;  1WPX A;  1M56 B;  5KAI Z;  5CA1 B;  2ZXW C;  3LK9 A;  5H2F Z;  2DQ3 A;  4YJ2 B;  4QZC A;  2ILM A;  3G6B A;  5CA1 A;  8ICF A;  1BPB A;  1L0N H;  4NM1 A;  3GB7 C;  4I50 B;  3AG2 B;  2BCQ A;  4KLI A;  3OVB A;  1SQX H;  4B3M B;  3TFR A;  4I27 A;  5LOV A;  1WAZ A;  1UFI A;  4JLZ A;  2IHM A;  4LF4 O;  8ICG A;  3I56 V;  4GKK O;  2HN1 A;  2DYS C;  3JAS B;  5JVD B;  4UUJ C;  4KLQ A;  4OAI Z;  4RQ8 A;  2ZD9 A;  5CBH A;  2B4V A;  4R65 A;  3C18 A;  4BIZ A;  2DR9 A;  1Y66 A;  1I7F A;  2CH7 B;  2QWO B;  3BEH A;  1Q6H A;  2PZS A;  5C8Y A;  5IY5 B;  3STL C;  2HR3 A;  5KHG A;  1QVG U;  4FH5 A;  3ZMS A;  3ZED A;  4PHP A;  4DW1 A;  4IIJ B;  4BW5 A;  4UV9 A;  4DO9 A;  4QPJ A;  3RWR D;  4JAS A;  4JYA B;  4I2I A;  4X65 O;  1H8H G;  4O2A A;  4X66 O;  2HHP A;  1JX9 A;  3IC9 A;  4GYC B;  1U96 A;  1N36 O;  1H8E G;  2WA3 A;  4O4J B;  2DQ0 A;  5HHH A;  3ZHV A;  4GXJ A;  1Q5O A;  3QTC A;  4EEQ A;  2ZIN A;  1ZQJ A;  2PI5 A;  4DV4 B;  1VFG A;  4X62 B;  3JAM N;  1FS0 G;  3D8C A;  1BPE A;  1XNR B;  1V4A A;  2BPG A;  4MVS A;  4I0X B;  4P4M A;  2YXL A;  1FFT B;  4QGP A;  4DV5 O;  1BZK A;  5B1B B;  4UCT A;  4OXS A;  1GTO A;  3FD9 A;  5HRL A;  4CC5 A;  1XDC A;  3HJ4 A;  4YN4 A;  5B1B C;  1SQQ H;  1LR1 A;  4OX9 O;  4LFB O;  1OCR B;  4M9J A;  1VQL V;  2FML A;  5J2A A;  2W6I G;  3UT5 B;  1F23 A;  3N27 A;  4LF7 B;  1N33 B;  3VBB A;  2HFE C;  4YY3 B;  1TFY A;  3LUT B;  4R66 A;  4K9A A;  2BCU A;  4DRX B;  3UT5 A;  4P9P A;  1NO5 A;  4DR1 O;  4R8C A;  8ICB A;  1I5Y A;  7ICR A;  2QR4 A;  5IDJ A;  3H9V A;  1MQ2 A;  1BL8 A;  2ZH6 A;  4EB6 B;  2JGU A;  1OU5 A;  4O9M A;  3HKE A;  5DB9 A;  4NKU A;  5CBF A;  1PNM A;  4OPA A;  4EB6 A;  5CA0 B;  2FMP A;  3RJE A;  4YY3 O;  5CA0 A;  4LF7 O;  1YHQ V;  1N33 O;  1PP9 H;  4JI0 O;  3OTF A;  2E76 B;  4ZOL B;  7ICP A;  3OEE G;  4OX9 B;  4LFB B;  5J0P A;  3AG7 A;  5JWP A;  4FMT A;  1AR4 A;  5D63 A;  4QZA A;  2EIJ B;  2XAF A;  4P4O A;  1IZ3 A;  1OCC C;  2LGW A;  2KG7 A;  2OTJ V;  4DV5 B;  1B3Q A;  2IH1 C;  2X6A A;  5H6R A;  4QZD A;  4HZ3 A;  4YJ3 B;  3ZRS A;  2HJD A;  1N4C A;  8ICR A;  4PJ0 Z;  4RWU A;  2YIB A;  2CTW A;  1H2G A;  4YJ3 A;  3E35 A;  1F4M A;  2QM7 A;  4DV4 O;  5D5Q A;  5DBB A;  3SYO A;  1K5Q A;  4M0A A;  1PNK A;  3WFQ E;  3AQL A;  4KL1 A;  4FH3 A;  3RYC B;  1ZQL A;  4L8J A;  4R50 A;  3MHH C;  2V1D A;  5BY1 A;  1ZQR A;  2R9I A;  3OMI B;  3LDE A;  1WP8 A;  5DKW A;  2JGD B;  4UBC A;  3ASO C;  1N34 B;  2EIK C;  2WLN A;  4DV0 O;  5CJ7 A;  3OMN B;  2ZR3 A;  1MSD A;  9ICC A;  1WA8 B;  4K8X A;  3DC5 A;  2UUB O;  2FMQ A;  8ICT A;  1J95 A;  2GAF D;  2IJK A;  3E8H A;  4YHH B;  3JPQ A;  2FCL A;  1TV9 A;  1RZT A;  1R3K C;  4X4V A;  2JS3 A;  4MVU A;  1HP8 A;  1QR8 A;  2R9R B;  1QCE A;  4DR2 O;  4FM0 A;  4I5S A;  1V54 B;  4FLW A;  4M9L A;  4NR1 A;  1W59 A;  4UAY A;  1ZQE A;  4ZIB A;  1PL0 A;  1NTK H;  4LVS A;  4LF4 B;  1GN3 A;  5JJE B;  1JN3 A;  4B3M O;  1QBZ A;  2ZDI A;  4CH5 A;  4I55 A;  5IYZ B;  1THZ A;  4MTX A;  4FM1 A;  4EFB A;  4HNA B;  3CC4 V;  3O65 A;  5CB4 A;  4X4U A;  4RAI A;  5JTG A;  1VP7 A;  2FL4 A;  2Q9L A;  4HNA A;  2HHH O;  4KFM A;  2M2V A;  2DRA A;  1COW G;  3N2K A;  1IXB A;  1AJQ A;  3V7K A;  3HJ1 A;  2YIB D;  3UM7 A;  5EBW C;  4G28 B;  3TGU H;  1G1X B;  3IJ4 A;  1K8A W;  4JWM A;  2ZXW B;  3K57 A;  1GN6 A;  1HNW O;  1ZQH A;  4O68 A;  8ICK A;  4O69 A;  3ETE A;  3MD0 A;  3CHX A;  4JI1 O;  3T1Y O;  2XAH A;  1HR0 O;  2WLM A;  1XNQ O;  4UB1 A;  3T1C A;  3P3P A;  4LFC B;  9ICA A;  1H2M A;  4P2Z A;  1DK1 A;  3UQ0 A;  3RVZ A;  1NTM H;  4XDL A;  1Q6I A;  4XBF A;  3T1H B;  3IAY A;  3B0Y A;  4O2B B;  1R6T A;  3JAW B;  1N32 O;  4RPZ A;  2UUC B;  3JPR A;  8ICX A;  2B51 A;  4O2B A;  1PL4 A;  4K4H A;  4FLU A;  4XJE A;  3D36 A;  3H01 A;  3WFV A;  4XA5 A;  1Y67 A;  1OCR C;  1Q86 W;  7ICI A;  4ZI7 A;  4UV8 A;  1ZQK A;  2IHO A;  4BAY A;  5LGT A;  2K9P A;  1ZUQ A;  5LXT B;  1G8M A;  3OR6 C;  4R7C A;  3JAR B;  3VQV A;  2Z0A A;  2DRB A;  3B77 A;  3GWO A;  2LO1 A;  3AK1 A;  3UQ2 A;  1ZJN A;  1OCZ C;  1T5E A;  4JI6 O;  3JAR A;  3J80 N;  1WOT A;  2BBH A;  1TUB B;  3ML0 A;  5L3E A;  4AT9 B;  2ZH9 A;  1MIW A;  3W7U A;  2EIM C;  1FJG O;  2XUM A;  4AT9 A;  2PF4 E;  3S3X A;  3ZMT A;  4BR6 A;  4WC4 A;  2NNU A;  1V55 C;  4XDJ A;  4TSF G;  1ORQ C;  4XDK A;  1KDH A;  3KCY A;  4NLZ A;  4MTO A;  2VQE O;  2F43 G;  3CJH A;  4LCU C;  2UUA O;  2R9A A;  4FHP A;  5TZV A;  5IIN A;  1K3E A;  1TUE B;  4WFE A;  4DUZ O;  4QPK A;  2UXN A;  3RYF B;  5EC2 C;  4IYH A;  3FFQ A;  4AHC A;  2B1G A;  2IUB A;  1ZL8 B;  2DR5 A;  9ICQ A;  4Z1V A;  4M04 A;  1S72 V;  4IT5 A;  4K4G A;  2PUS A;  1TVK A;  1YTF B;  1S77 D;  5L3B A;  3QNE A;  4TV8 B;  2ZNI A;  3CE2 A;  1YTF D;  1RPR A;  5FNV B;  4EFE A;  2UXX A;  2ID1 A;  4J9Y B;  5B3Q A;  5LMU O;  1FXV A;  1NJI W;  1K92 A;  5HRG A;  4UB4 A;  2XTA A;  1KP3 A;  1CXZ B;  4P30 A;  5IJ0 B;  4Z1M G;  3OW2 U;  2VQF B;  4QZG A;  1HNX O;  1OHH G;  3B8N A;  2CK3 G;  2UUA B;  5IJ0 A;  2VQE B;  4LEW A;  3JD1 A;  3DXR B;  3JAL A;  3CME V;  5HR9 A;  4K0K B;  3BHP A;  2QM4 A;  4MTG A;  2IU3 A;  3DXR A;  3JAL B;  4LFA O;  4HAM A;  3APQ A;  4NXM O;  2KQX A;  4KXR A;  1FFX A;  2A7W A;  9ICU A;  1O9G A;  2K1E A;  3HIY A;  4WH5 A;  1SF9 A;  4PHZ A;  3OAA G;  2I9G A;  1SQF A;  4IQT A;  5EZY A;  1IDS A;  3P32 A;  1YF2 A;  4F6R A;  1Q81 W;  5J2D A;  5EZY B;  3OMA B;  1P49 A;  1MMM A;  4FHX A;  4DXW A;  1KEJ A;  3TXS A;  4OAF A;  1VQP V;  4NY8 A;  2EZO A;  1OCO C;  4QJF B;  3AQN A;  3SYP A;  4ZOL A;  8ICI A;  3E89 A;  3K9A A;  4FM2 A;  4EBJ A;  4X1K A;  3Q4H B;  4UBB A;  3WFS C;  5J2F A;  4MVZ A;  4RQ1 A;  1BPX A;  4JF3 A;  4KLG A;  1FYJ A;  4LP8 A;  3Q4H A;  3CD6 V;  3RYI B;  1YI2 V;  2FTK A;  4MVO A;  5J2B A;  5L3F A;  4I50 A;  4EKW A;  1AJP A;  1ZJM A;  4JV5 B;  1XNQ B;  1KKD A;  3T1Y B;  3E8G A;  3RYC A;  1HUO A;  2HN2 A;  5D61 A;  2ZCE A;  1HNW B;  4O4H A;  2UXC B;  5H9C A;  4UB8 Z;  1S5L Z;  2QDO A;  3ERC C;  1BGY H;  3SYA A;  4O4H B;  3HKB B;  5B1O A;  4PDM A;  2JGD A;  4I9Q A;  3TCU A;  4X88 A;  3HKB A;  3HX0 A;  2YIA A;  1E1R G;  4W4L A;  3THO A;  1SES A;  4P4P A;  1AJN A;  3KKY A;  2JJ2 G;  4O2A B;  2ITC C;  4Q6G A;  4JI7 O;  4DOC A;  4K8Z A;  2Q7H A;  4KLT A;  4FLV A;  2Q67 A;  1XHZ A;  3K06 A;  4B3T O;  5GON B;  4DR5 O;  4WC5 A;  3VQW A;  4O5C A;  2QTS A;  1BQZ A;  4WBZ A;  3AU2 A;  5GON A;  2ZIO A;  9ICX A;  5IIO A;  1XEQ A;  1ROP A;  2FYU H;  3BAB A;  3B2E E;  4RUE A;  1H2K A;  4I55 B;  2UUB B;  5IYZ A;  2JVD A;  3U11 A;  4X89 A;  1VQN V;  4YD1 A;  2XAJ A;  4DV0 B;  1FXK C;  3IFX A;  3JSN A;  4JI8 O;  1N34 O;  5B3S C;  1ZLZ A;  4F5N A;  1W0K G;  2JJ1 G;  4M9N A;  1BPZ A;  3L70 H;  1UJW B;  3C66 A;  4DV6 O;  3F5W C;  1GM7 A;  1ZQU A;  5EIB C;  2DMX A;  3L73 H;  2ZE6 A;  1QVF U;  8ICE A;  1GMG A;  3CWB H;  1I0H A;  4FLZ A;  4DV2 B;  5CP2 A;  5J0R A;  5JQG A;  5H5N A;  2H8P C;  1VEW A;  3OGU A;  3ABK C;  3UXO A;  2ZHB A;  4WBY A;  2A0L A;  1Q8I A;  3SPG A;  1XIL A;  1SRY A;  5HRB A;  3OTO B;  3G71 V;  2UXD B;  5K1X A;  1FKA O;  4WC0 A;  2VRZ A;  1BHB A;  4WOY A;  7ICM A;  4LF9 B;  2ZM6 B;  2R70 A;  2YI9 A;  4IQW A;  9ICV A;  5L3G A;  2ZH5 A;  9ICO A;  3F7V C;  4JI5 B;  4O5E A;  1R89 A;  3D3I A;  2LW7 A;  3FB5 C;  1YJN V;  7ICO A;  3A2F A;  3W7X A;  4FHV A;  3ZX6 A;  4GX1 A;  4U3J A;  3VQY A;  2DR7 A;  2OCC C;  1JMK C;  2Q68 A;  3K5M A;  4GCZ A;  2BOB C;  1OCZ B;  4GT1 A;  8ICS A;  5LL6 Y;  1PKX A;  1GAX A;  4RUF A;  3JD3 A;  7ICT A;  4PGY A;  9ICN A;  2EIL C;  3LSS A;  1I94 O;  1LNQ A;  1BT8 A;  1IBL B;  1TUB A;  4WCW A;  2CE4 A;  2A79 B;  1R8B A;  3DSQ A;  1Q82 W;  8ICP A;  2NN4 A;  5DDM A;  2GDS A;  3CCU V;  3RVY A;  1EN5 A;  4KLE A;  1VQO V;  1IX9 A;  4OGQ B;  4P9O A;  1ZTE A;  2LGQ A;  3B4S A;  4CH3 A;  2E5L B;  1JQ0 A;  4MS2 A;  5KAF Z;  4GLX A;  1B04 A;  3QO8 A;  4X0B A;  1V54 C;  1HW7 A;  4CS4 A;  5LBQ A;  4UFZ A;  4GXK A;  1XL4 A;  4DYL A;  4LF8 B;  5HRD A;  2AGA A;  4W4K A;  4FLX A;  3RFR A;  2M2U A;  2KKW A;  1N8R W;  1IUR A;  3PJS K;  3HKC A;  2OTL V;  1EN6 A;  5K1P A;  8ICY A;  5CA3 A;  2X0L A;  3ZRW B;  1RFY A;  4FJC C;  5B66 Z;  3FYI B;  3RJJ A;  3ZMZ A;  5III A;  1WLE A;  4KLO A;  3H38 A;  5JCO C;  1MA1 A;  4R63 A;  1NZ6 A;  2VWK A;  3K5L A;  3K0D A;  4RQ5 A;  1WB7 A;  2YC0 A;  4DUY B;  2Q73 A;  1VIB A;  4QE9 A;  1DTO A;  1SS3 A;  1ZQO A;  5IYC O;  3GVM A;  4K98 A;  3S3W A;  1MIY A;  1G6U A;  4PHD A;  4JI4 O;  1IVS A;  2W0X A;  1PM9 A;  1W2B U;  4PA6 A;  4JWN A;  3P3N A;  1X59 A;  3OV7 A;  1KUQ A;  2QWR B;  4DO2 A;  2DWE C;  1KP2 A;  2DE0 X;  3OM3 B;  5J2G A;  1R8C A;  4DR7 B;  1NT2 B;  2OWO A;  4YIP A;  3MBY A;  1JMS A;  4RQF A;  4CBC A;  3H1J H;  3SJB C;  3T2M A;  3V7L A;  3C2M A;  4PHE A;  5BR8 O;  4DR7 O;  3H1L H;  2EWR A;  5B3P A;  3RJH A;  4FFB B;  2YDE A;  2QKC A;  3B8M A;  4F6R B;  4FFB A;  1FPO A;  5FLX N;  5B3S B;  2YID A;  4MW3 A;  2XAQ A;  1KNY A;  3CCM V;  4I9W A;  3VQX A;  4MT8 A;  1I08 A;  5CMU A;  3CS5 A;  1YIT V;  4J9Z B;  4D7T A;  5KLV H;  9ICF A;  3CP1 A;  4BIU A;  4EV6 A;  3OGC C;  3ASN C;  1MNG A;  1KKC A;  2P06 A;  3TET A;  3CCE V;  3ETG A;  1BMF G;  2OIG A;  1QU7 A;  4O4I B;  4QZI A;  2W6J G;  5LMN O;  5B1A C;  2LW1 A;  2B1I A;  1YZB A;  2Q0A A;  2Y69 B;  2BCS A;  3SGI A;  1RPL A;  3HW8 A;  4FO6 A;  2IJJ A;  7ICK A;  1EN4 A;  3R65 A;  4F6E A;  2Y69 C;  3JD2 A;  4JPR A;  4XQ8 A;  4I29 A;  1K4C C;  1JJO A;  4EED A;  2QJ1 A;  3D36 C;  2CGN A;  2CH7 A;  5J2H A;  2IJH A;  5C8Y B;  4WFF A;  3CPW U;  3RYH A;  1Q6U A;  4FZ0 A;  4H13 B;  3ICX A;  1VF6 C;  8ICC A;  5J2J A;  1AI7 A;  1H2L A;  2ZE5 A;  4KLU A;  1AB3 A;  4CS2 A;  4IYI A;  3CC2 V;  1ZL8 A;  2QM8 A;  5LHI A;  8ICZ A;  3C90 A;  4K8V A;  4MFF A;  2EIL B;  1R3L C;  5EYP A;  2KSD A;  1K9M W;  1I94 B;  2UU9 B;  2XOK G;  4N21 A;  2BCR A;  3JPO A;  1DF5 A;  1D2D A;  4H33 A;  5JJN B;  5EIB D;  3RW0 A;  4LZG A;  1JVM A;  1AI5 A;  1O9H A;  2PYL A;  2HJF C;  2GV9 A;  2ZH8 A;  1VMG A;  1IBM B;  5KX5 A;  2ODM A;  1EZJ A;  4UB2 A;  4RQ3 A;  4DK1 A;  4TT3 G;  5DB7 A;  1M5I A;  4MFC A;  2LQT A;  5HC9 A;  4I0X A;  3BY6 A;  3NR7 A;  5KX5 B;  1SQG A;  3OEH G;  4J11 A;  5BZB A;  4JI2 B;  4I2J A;  2D2C B;  2BTQ A;  2FB5 A;  8ICO A;  2JS5 A;  2BTQ B;  3ISC A;  1S3J A;  2IU0 A;  3E8F A;  4NTY A;  1BE3 H;  4O6A A;  3H37 A;  1NS1 A;  1QLN A;  2ZM6 O;  1NR1 A;  5CFT A;  5J2U B;  5GW7 A;  1F7Y A;  3OTO O;  4DRX A;  4NXW A;  3JSL A;  8ICL A;  5KHK A;  3V7J A;  2Q8V A;  3J81 N;  4U7N A;  3E8B A; 
#chains in the Genus database with same CATH homology
 1ZQS A;  7ICL A;  5HRG A;  4UB4 A;  4AT8 B;  5HRI A;  4E8F A;  4WC2 A;  4QZG A;  4NKT A;  4QZE A;  1UET A;  4TUP A;  3TFS A;  4FHY A;  4IQV A;  4RPY A;  8ICA A;  5HR9 A;  4TUR A;  5BOL A;  4PHA A;  2W9M A;  3RH6 A;  5HRF A;  5J0U A;  3RJI A;  1ZQM A;  7ICN A;  4I2E A;  4E7X A;  8ICW A;  4I2B A;  4MFA A;  3JPP A;  9ICU A;  1MIV A;  4WC7 A;  3HIY A;  4IQU A;  9ICG A;  1XSP A;  1ZQY A;  4DOB A;  4ATB A;  8ICH A;  9ICM A;  3UPS A;  2FMS A;  3WFR E;  3LQC B;  4IQT A;  4PGX A;  2I9G A;  3MGH A;  5CWR A;  1BPD A;  3AQM A;  4LZD A;  4WC1 A;  1JQR A;  5J2D A;  9ICL A;  4FHW A;  1TVA A;  4TUS A;  5IIK A;  4FHX A;  1KEJ A;  1ZQT A;  5HRE A;  4NXZ A;  4NY8 A;  3AQN A;  3RJG A;  8ICI A;  4EBJ A;  1BPY A;  4MF8 A;  4NM2 A;  4E80 A;  4XRH A;  3MDA A;  4UBB A;  3WFS C;  5J2F A;  4RQ1 A;  4M5D A;  5IIM A;  5J0S A;  1BPX A;  4KLG A;  1UEU A;  5HRH A;  4Z6D A;  2ZH3 A;  7ICE A;  5J2B A;  4X4T A;  4X5V A;  9ICS A;  1ZJM A;  8ICN A;  4X4O A;  3OUY A;  3L9D A;  1HUZ A;  5CB1 A;  1R8A A;  3AUO A;  4KLD A;  3OVS A;  4QZB A;  1HUO A;  3JYY A;  3JPS A;  4RWP A;  5J29 A;  3JZ0 A;  4RPX A;  5J0W A;  3MGI A;  4F5O A;  1JAJ A;  3LK9 A;  8ICM A;  2BPC A;  4TUQ A;  4QZC A;  4RT3 A;  2DVI A;  9ICT A;  5F2V O;  3B0X A;  4RT2 A;  8ICF A;  4UAW A;  3HX0 A;  1BPB A;  4NM1 A;  1ZQZ A;  4LT6 A;  2BCQ A;  4KLI A;  3OVB A;  4I27 A;  3TFR A;  4P4P A;  7ICH A;  2IHM A;  8ICG A;  2NRK A;  4DOC A;  4KLQ A;  4XQ7 A;  4RQ8 A;  3RJF A;  4KLT A;  5D4B A;  9ICW A;  5HRK A;  4R65 A;  3C18 A;  4WC5 A;  4GXI A;  5J2E A;  4M9H A;  2DR9 A;  4UAZ A;  4O5C A;  4WBZ A;  3AU2 A;  9ICX A;  5IIO A;  4I28 A;  4FH5 A;  4O5K A;  3UXP A;  4PHP A;  5DBC A;  4DOA A;  4DO9 A;  4YD1 A;  5CR0 A;  4I2I A;  4F5N A;  4WC6 A;  4M9N A;  1Q78 A;  2HHP A;  1BPZ A;  4MF2 A;  4UD5 A;  3C66 A;  1ZQU A;  3JPT A;  8ICE A;  2PFP A;  2M2W A;  3V72 A;  3AU6 A;  5HHH A;  4GXJ A;  1ZQB A;  1ZQJ A;  1ZQG A;  5CP2 A;  2M2T A;  1VFG A;  7ICQ A;  1BPE A;  5J0R A;  1V4A A;  4RQ4 A;  2BPG A;  4X4P A;  4QZF A;  3OGU A;  4F5R A;  4P4M A;  5BPC A;  3UXO A;  2ZHB A;  4WBY A;  5HRB A;  5BOM A;  1ZQC A;  4X0A A;  1MQ3 A;  4WC0 A;  9ICJ A;  7ICM A;  5J0T A;  3MDC A;  5DED A;  5HRL A;  4IQW A;  4YN4 A;  3HJ4 A;  2ZH5 A;  9ICV A;  9ICO A;  4UB3 A;  4M9J A;  4O5E A;  5J2A A;  4R64 A;  1TFY A;  1R89 A;  4R66 A;  2BCU A;  7ICO A;  3UPQ A;  1NO5 A;  4NLN A;  4FHV A;  8ICB A;  4I2C A;  7ICR A;  1MQ2 A;  3HWT A;  2ZH6 A;  2DR7 A;  2GWS A;  9ICB A;  8ICJ A;  1OU5 A;  4O9M A;  5DB9 A;  4NKU A;  3WFO A;  4I2A A;  3RJK A;  1VJ7 A;  9ICK A;  8ICS A;  3C5F A;  2FMP A;  3RJE A;  1YLQ A;  2P66 A;  7ICT A;  4PGY A;  2O1P A;  9ICN A;  2BCV A;  4WCW A;  7ICP A;  4QZH A;  1R8B A;  4K4I A;  4KLM A;  2BPF A;  5J0P A;  2PFN A;  8ICP A;  4QZA A;  5DDM A;  1ZQV A;  4M9G A;  4P4O A;  4KLE A;  5CA7 A;  4QZD A;  5J0O A;  4M47 A;  9ICR A;  8ICR A;  3C5G A;  7ICS A;  5J0X A;  4X0B A;  4YMN A;  7ICU A;  3OUY B;  2DR8 A;  4YCX A;  5DBB A;  4GXK A;  4M0A A;  3WFQ E;  3AQL A;  1ZQX A;  4FH3 A;  5HRD A;  1ZQL A;  4WC3 A;  1TFW A;  5EOZ A;  4PGQ A;  2M2U A;  1ZQQ A;  2ISP A;  4NLK A;  3NYB A;  5J2C A;  4RQ0 A;  1ZQR A;  4I2F A;  5DKW A;  8ICY A;  5DBA A;  4UBC A;  3C2L A;  3RJJ A;  5CJ7 A;  5III A;  4KLO A;  3H38 A;  7ICF A;  1ZQI A;  9ICC A;  4R63 A;  2FMQ A;  4YD2 A;  4F5Q A;  5IIJ A;  4RQ5 A;  8ICT A;  2VAN A;  3AQK A;  3JPQ A;  4F5P A;  4IG8 A;  4RWO A;  2ZH1 A;  1TV9 A;  7ICJ A;  1RZT A;  3WFP A;  1ZQO A;  4X4V A;  1ZQA A;  2ZH7 A;  1MIY A;  4S3N A;  4PHD A;  3RH5 A;  4RQ2 A;  4M9L A;  1ZQN A;  3H39 A;  4UAY A;  1ZQE A;  4JWN A;  4LVS A;  3OV7 A;  1XSN A;  1JN3 A;  3ISB A;  5J2G A;  4QZ8 A;  9ICE A;  1R8C A;  4QZ9 A;  3MBY A;  5IIL A;  1JMS A;  3C2K A;  2PBE A;  3V7L A;  3C2M A;  4PHE A;  4X4U A;  4ATB B;  3RJH A;  2M2V A;  2DRA A;  3GDX A;  2ZHA A;  3V7K A;  3HJ1 A;  4I2D A;  4EBK A;  8ICV A;  4X4S A;  4JWM A;  1ZQH A;  1KNY A;  1FA0 A;  2RFF A;  4PH5 A;  8ICK A;  4EP7 A;  7ICV A;  4UB1 A;  2Q66 A;  9ICF A;  4I2G A;  4KLS A;  1ZQD A;  4KLH A;  9ICA A;  4UD4 A;  3UQ0 A;  5DB8 A;  4QZI A;  3B0Y A;  1XSL A;  4RPZ A;  5J2K A;  4I2H A;  3JPR A;  2BCS A;  9ICP A;  4FO6 A;  1RPL A;  3HW8 A;  8ICX A;  1NOM A;  4Z6F A;  4K4H A;  7ICK A;  4RQ7 A;  4M2Y A;  2ZH2 A;  4XA5 A;  9ICH A;  4XQ8 A;  4AT7 A;  4I29 A;  7ICI A;  8ICQ A;  2BE3 A;  1ZQK A;  5J2H A;  4AT7 B;  4RWN A;  4YMM A;  4X4Q A;  5CHG A;  5J0Q A;  4X4R A;  3JPN A;  9ICI A;  2DRB A;  8ICC A;  5J2J A;  4KLU A;  4Z6E A;  3UQ2 A;  1ZJN A;  2PFO A;  1WOT A;  4RQ6 A;  4UB5 A;  4AT9 B;  2ZH9 A;  1MIW A;  3ISD A;  1UEV A;  8ICZ A;  4KLF A;  4MFF A;  3H3A A;  2ISO A;  2PXI A;  4AT9 A;  4WC4 A;  2BCR A;  4YMO A;  3JPO A;  4RWQ A;  1KDH A;  4NLZ A;  1ZQW A;  4LZG A;  5HHI A;  3PNC A;  2ZH8 A;  2ZH4 A;  4FHP A;  5DEC A;  3K75 D;  5TZV A;  7ICG A;  5IIN A;  4XUS A;  4UB2 A;  8ICU A;  4RQ3 A;  5DDY A;  5DB7 A;  3OVA A;  4MFC A;  5DB6 A;  5HC9 A;  4AT8 A;  1F5A A;  4Z6C A;  5J0Y A;  4I2J A;  8ICO A;  2DR5 A;  3RH4 A;  3ISC A;  9ICQ A;  4M04 A;  4K4G A;  3H37 A;  3UXN A;  5J2I A;  1ZQF A;  5D49 A;  4P2H A;  2PFQ A;  1PX5 A;  1Q79 A;  4X4N A;  3PMN A;  3PML A;  4PPX A;  4KLJ A;  5D46 A;  1ZQP A;  8ICL A;  3V7J A;  2ID1 A;  4KLL A;  2O5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...