5J0OA

Binary complex crystal structure of dna polymerase beta with a:a mismatch at the primer terminus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 107
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0oA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0oA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0oA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0oA03
4YFKA 4DF4A 1NK4A 2J6SA 4YP3A 2AJQA 4Z6CA 5J0QA 4DS5A 7ICEA 5DBCA 3RH4A 5DECA 2XY5A 3KHRA 4F3OA 2JEJA 3MR5A 2BPFA 2KFNA 1ZQTA 4QZCA 4DEZA 5KFGA 5J2CA 3MDAA 4O3NA 4J9LA 4F5QA 2HHQA 4RQ3A 3GV7B 7ICTA 8ICCA 4AT9B 2NRXA 2V4RA 4I2IA 4RWPA 5CB1A 9ICCA 4ECVA 5F9LA 3RRGA 4PHPA 3V6HA 2DR7A 1SZPA 2DRAA 5IIOA 4AT9A 5JUMA 5KFNA 2NRTA 2VANA 1BPXA 1MIVA 5IIIA 1TAUA 4F4WA 5J0WA 3H40A 2FLLA 1SKSA 4B9MA 7ICJA 1JIHA 4Q43A 1ZQYA 2ZTDA 3G6VA 3C2MA 4DLGA 3QZ7A 1C7YA 2R8IA 8ICKA 5HRDA 3BQ2A 1NJYA 1NK5A 3Q8SB 4XA5A 4ECYA 8ICBA 3L9DA 4EBKA 4X4OA 2BPCA 3QEBZ 1V9PA 5DBAA 2DVIA 4WC6A 1JX4A 5C5JA 3C2KA 7ICSA 4YR3A 1SL2A 4M47A 3WFPA 1XU4A 2KP7A 4ZH4A 4J9MA 1ZQBA 2DR8A 4X5VA 5F9NA 3Q8QB 3RJIA 1ZQMA 3HWTA 1KFDA 4IQTA 4I2DA 5KFPA 1TAQA 4KMUA 1A77A 4XQ8A 4KN4A 5J2EA 4RNOA 1MC8A 3M9MB 4DL3A 8ICZA 4X4TA 2XGQA 4QWBA 3SI8A 3GV8B 2I9GA 1UEUA 2C22A 4AT7A 4YXMA 1MQ3A 4B9LA 3PW5A 4YN4A 1NKCA 2J6UA 4X4QA 4UBBA 2ZUCA 1QSLA 2VA3A 4ATBB 4KLFA 2HHPA 2ZH2A 2JEGA 4KLLA 1S0MA 3UQ0A 3NTUA 4QZFA 4R65A 1U49A 4I2JA 3LQCB 3RTVA 4ATBA 2FPLA 1R8BA 3GDXA 4XUSA 5KG3A 3PV8A 5DLGA 5KG6A 1QSYA 5DDMA 2PXIA 3RH5A 2C2DA 4BGDA 5DG8A 4ED6A 4ED8A 1XSNA 1D9FA 3OGUA 5KT6A 2KZMA 1KFSA 3PO4A 3OJSA 4FBTA 3V72A 5KFUA 4FHWA 3HJ1A 1ZQJA 3V6KA 5IIJA 5CR0A 4KLIA 9ICHA 3NYBA 2I1QA 3AQLA 4WBZA 3H8SA 9ICKA 2HHTA 4F50A 5IIKA 4QWAA 3FDSA 3NGDA 1JXLA 4B9SA 9ICOA 4PHAA 3V7LA 4M9HA 4F4ZA 1CEZA 4EZ6A 4Q45A 4I27A 1XS9D 1ZETA 9ICTA 5KFKA 4E80A 8ICNA 4WC5A 1T7PA 3C2LA 3PW0A 3RB3A 1TFYA 1R89A 3UPQA 1X9SA 3HPOA 4DOCA 2UVRA 4ELUA 4UAWA 7ICHA 3JPNA 1NO5A 4RQ0A 5KFBA 4RQ4A 2V9WA 1SL1A 4PPXA 4WBYA 4I2EA 4RT3A 5KFAA 2BCQA 4DSFA 4RWOA 1ZQIA 1KRPA 1NKBA 3UXPA 4EEYA 2NRWA 5KFCA 5HRHA 3OSPA 2DR9A 2JZBB 4O3PA 4F91B 4ECXA 4ED7A 4F5RA 4KLSA 7ICPA 5KFFA 4YR2A 2FMPA 3OVSA 1S0NA 2FLNA 1L3VA 4LZDA 2JZBA 3ISBA 2KN7A 3Q8MA 4UQGA 2F1JA 2W9AA 2PI4A 3MFHA 4ECZA 4C8OA 4X4VA 2M2TA 4MF8A 4KLGA 3ISDA 2ATLA 9ICWA 7ICNA 8ICGA 3WFSC 1ZQRA 5DGBA 5J0PA 2UVVA 2R8KA 3HX0A 2GWSA 1L3UA 4DQIA 5KFWA 3H8JA 4PHDA 1RXVA 4FS2A 5D46A 5KTQA 1NK7A 3PW2A 2HHXA 3TARA 1KSPA 4I2HA 4UBCA 5IINA 4DL5A 1UT8A 3RB6A 1DGSA 1ZQUA 8ICPA 5J2DA 4RWQA 4GC7A 2M2UA 2PBEA 2BCSA 9ICQA 5J0YA 2P66A 4EYIB 4TQSA 2F1IA 1DOQA 1K1SA 2Q0ZX 1X9MA 4ELVA 4XQ7A 4KLDA 4JK1A 3H39A 5J0SA 4C8MA 3LWMA 4B9TA 3G6XA 5J2HA 4J9PA 2O1PA 4QZEA 1B43A 1DK3A 4BXOB 2PFPA 4O5EA 3RB4A 7ICVA 1UA1A 4Q8EA 3GIIA 2ZH9A 4J9SA 1D8LA 5L1IA 3RH6A 1N48A 4BXOA 3JPRA 1Y88A 1Q78A 4WCWA 3WFOA 4FS1A 4DQPA 1XO1A 3EPIA 4RQ8A 4CCHA 1HUZA 3MR3A 4GXKA 4GC6A 1WCLA 1NK9A 1PX5A 4M9JA 4DLEA 3BQTA 3T5KA 2H5XA 3B0YA 3T5LA 1NJXA 2OWOA 4NXZA 4M9NA 1XC9A 1K1QA 1JN3A 4RPXA 2KFZA 7ICMA 4O0IA 1VJ7A 2AQ4A 4AT7B 5KFIA 3M8RA 3H7IA 2ZH3A 4RQ5A 1S10A 2IHNA 4I2FA 2HHSA 1BPEA 4ED2A 4PGYA 5DEDA 3RR8A 4QWCA 3C1YA 3ZDDA 5HRFA 2LYHA 4IR1A 3M9NB 3TQ1A 4I2BA 1ZQKA 1PZNA 1TFWA 1XWLA 4BWMA 4QZDA 2ISPA 1S0VA 2RFFA 3UXNA 3GV5B 5CA7A 3MR6A 5D4BA 2P6UA 5DDYA 3QE9Y 1H38A 4YMNA 4J9QA 4RQ1A 5CP2A 3V7JA 1ZJMA 3Q8LA 2ISOA 5J2GA 4F8RA 5DBBA 5EWGA 4DFKA 1YLQA 4FO6A 2ZTEA 1KDHA 3ETLA 1KTQA 3C5FA 4ECWA 5KFRA 4C8LA 5HRBA 4BDPA 2IHMA 3G6YA 4EBDA 5HHIA 1ZQQA 9ICFA 4I2GA 1BPBA 2B21A 4WC2A 8ICUA 1XSLA 3PX4A 2ZH8A 1TFRA 3B0XA 4Q8FA 1R8AA 5KFDA 1F5AA 9ICRA 4DL2A 3IHQB 1QLNA 4RU9A 3T5JA 4EZ9A 1JAJA 3RAXA 3WFQE 4MFCA 4JWNA 3UPSA 2DR5A 2XY7A 1LV5A 4DL4A 1ZQFA 4QW9A 3TFRA 4LZGA 5CJ7A 4ELTA 4S3NA 4FHYA 1NK8A 2BDPA 2ZJ8A 4RNNA 4WC1A 4ECQA 3H3AA 4KLQA 8ICYA 3EPGA 7ICRA 1IM4A 5KFVA 5KG1A 5J0TA 3QZ8A 2RDJA 4K4GA 5KT2A 7ICIA 1ZYQA 1TK0A 1SL0A 2C28A 3AUOA 4KLHA 2HVHA 2PFNA 4RPZA 2IA6A 1Q79A 3TFSA 3C1ZA 3LDAA 3Q8PB 4J9NA 1TKDA 4C8NA 2BCUA 3MGIA 4F5PA 4I2AA 3JPPA 3GIKA 1UEVA 5KFXA 5CWRA 8ICJA 5HHHA 3TAPA 4MEYA 5J0OA 1Z00B 3UXOA 2R8JA 5EWFA 2C2EA 4DFPA 1TK5A 2BE3A 2ZH5A 1SKRA 5CHGA 4EBCA 1ZQXA 1U4BA 5KFJA 3MR2A 2FMQA 1Z00A 2ZUDA 4JV1A 4TURA 4MFFA 4ECTA 1OU5A 5J2FA 2DFLA 2DPJA 2PFOA 5HNKA 2BGWA 8ICHA 4I29A 4YG2A 5D49A 5HP4A 3TANA 4B9UA 2WTFA 5HC9A 4DL6A 4YD1A 3C66A 1RPLA 4DQQA 3PX6A 4FHVA 4DL7A 8ICSA 3PR5B 1FA0A 9ICBA 2XC9A 4TUPA 8ICWA 9ICSA 3WFRE 2AGPA 5J0XA 3TI0A 5KT4A 3ORYA 3GQCA 2IBKA 9ICLA 8ICFA 3H37A 2DRBA 3OSNA 4EBEA 1ZQCA 1CUKA 1TVAA 4MEXA 1R8CA 4NLZA 1ZQHA 2HVIA 1L3TA 5TZVA 3EZ5A 3PX0A 3K75D 3RJGA 3PR4A 4O3SA 8ICLA 3OHBA 4JWMA 3LK9A 4I2CA 5J2KA 4IRDA 4KTQA 1ZQEA 4F92B 2W9CB 1L3SA 4C8KA 1JMSA 4X0BA 4E8FA 5J2JA 8ICVA 7ICGA 4F4XA 4DSEA 2IMWP 4E7XA 2W9CA 1NKEA 3ZD9A 4IRCA 3ISCA 2MUTB 9ICGA 4FH5A 4KLOA 8ICAA 3SYZA 3V7KA 4B9NA 4IQUA 4QZ8A 4UB2A 4UB5A 3V6JA 2Y1IA 4UB4A 4AT8B 2ASJA 4I28A 2MUTA 3EWAA 5J2BA 4FBUA 3H4BA 4ECRA 4AT8A 4ED0A 5IIMA 4K4IA 4F5OA 3K4GA 4LVSA 2FPMA 1A76A 2Q66A 4KLUA 8ICOA 9ICIA 1MIWA 1BNPA 2RDIA 3JPOA 4X0AA 3OV7A 4WC4A 1RYRA 3JYYA 3MFIA 1ZQOA 1U45A 2NRKA 1BPDA 2A1JB 2ZH7A 4QW8A 2BCRA 1ZQZA 4KLMA 4X4SA 5IILA 5HR9A 5J0UA 4M0AA 3RJKA 3KTQA 3H38A 3HJ4A 1IXRA 2A1JA 4IG8A 5J2AA 4DF8A 3ZDAA 1NK6A 4UB3A 5BOLA 1ZJNA 3JPQA 4X4RA 3AQKA 3IM1A 4RUAA 4NKUA 2XCAA 3QEAZ 2VA2A 3RRHA 1NOMA 1S97A 2PFQA 2HW3A 2AGOA 8ICIA 3JPSA 4O3QA 2FLPA 3M9OB 4QWEA 1ZQPA 5KFEA 1S76D 5HRKA 4DOBA 4R8UB 4M2YA 2DPIA 5BPCA 3RJFA 1JQRA 4O3OA 4RQ6A 3RJHA 5F2VO 1VFGA 3M8SA 4QZBA 1BGXT 5KT5A 1U9LA 3MDCA 1TV9A 4YCXA 4R8UA 4YVZA 5L1LA 5L1KA 3AU6A 1U48A 4J9OA 2C2RA 1S9FA 3AQMA 2BPGA 1NZPA 2FPKA 4IQVA 3BDPA 4YQWA 3PY8A 3Q8RB 1ZQSA 4UD5A 3PW4A 3ZDBA 3KHHA 3PMNA 1B22A 9ICJA 1DK2A 7ICUA 5KFHA 5DKWA 4RUCA 5KFZA 3RAQA 1BPYA 4NLNA 1RZTA 8ICMA 1QTMA 5KFOA 4DSLA 2MAXA 4M5DA 4UD4A 4WC0A 4WC3A 2ZH1A 1X9WA 4M9GA 4UB1A 3T5HA 8ICRA 4O9MA 2J6TA 3AQNA 5J29A 4PHEA 4R66A 3BJYA 3BQ1A 5HRIA 1EXNA 2KZZA 1NJZA 2F1HA 1BNOA 4G3IA 4QWDA 4WC7A 4RT2A 7ICKA 3OUYB 4X4UA 1BPZA 4B9VA 4GXJA 4F4KA 5DB9A 4TQRA 4DQRA 3T3FA 4Z6DA 3PW7A 2M9NA 1L5UA 4IR9A 3OUYA 9ICNA 5KFMA 4DSKA 3ZDEA 3C5GA 4KLEA 4BWJA 4HYKA 2R8GA 4GLXA 2ASDA 1S0OA 4DOAA 4YD2A 7ICOA 3SV3A 1Z3EB 2BQRA 2FMSA 1UA0A 4NM2A 4F2SA 4P4OA 1COOA 4RQ7A 4QZGA 4J9RA 4F5NA 1NK0A 5DB6A 3EYZA 1LB2B 3MGHA 7ICQA 5DLFA 4KLJA 1ZQGA 4E0DA 3PNCA 3Q8KA 4YR0A 3SZ2A 4KLTA 4EP7A 4FHXA 1RXWA 1KFTA 4DO9A 3PO5A 2W9BB 5BOMA 2ZTCA 4MFAA 1MQ2A 5HMLA 4F2RA 3GIMA 3C21A 3HT3A 2VA8A 4DSJA 2AQ0A 1T8EA 9ICMA 2NRZA 2ID1A 4DFMA 2W9BA 2ALZA 2ZH4A 4GXIA 3GILA 4NLKA 4EBJA 2R8HA 1ZQWA 2Y1JA 3EW9A 4RNMA 3KHLA 1D9DA 8ICQA 3FYHA 2XCPA 3RBEA 2UVUA 1S77D 5HRLA 4RQ2A 5KG5A 1V4AA 3GIJA 4JV0A 4M6WB 5J0RA 4P4PA 2ASLA 2BQ3A 8ICXA 3OVAA 2KTQA 5KFSA 5KFYA 3HP6A 2ZJAA 7ICFA 2M2WA 4NKTA 4TUQA 2M2VA 3AU2A 3PVXA 2BKEA 4M6WA 4JUZA 3HW8A 4F4YA 3UQ2A 4ED1A 3OHAA 3BQ0A 5KT7A 3C18A 3H4DA 5KFLA 5KG2A 3E2EA 1UT5A 2ZHBA 2HHUA 4O3RA 5KT3A 1RYSA 4M04A 1JXEA 5EOZA 1ZQLA 4QZAA 9ICUA 2ZJ5A 1UETA 3OJUA 2BR0A 3MABA 4DQSA 2P6RA 9ICPA 4PGXA 2BQUA 4J9KA 4ECUA 4FH3A 4YMOA 4DSIA 2V4QA 3SV4A 1ZQAA 2PI5A 3RB0A 3HIYA 5L1JA 4MF2A 4YMMA 4PGQA 1WCNA 3ZD8A 1MSWD 5KFQA 4P2HA 8ICTA 2JEIA 2KZ3A 9ICVA 5DQIA 1N56A 2W8KA 3THVA 1SKWA 4KITB 4UAYA 3RJEA 4O5KA 5J2IA 1TK8A 2ZHAA 4IQWA 5KG4A 5EWEA 4F93B 4EYHB 4YXJA 1KEJA 4QZHA 4ED3A 3LWLA 2AGQA 1KLNA 2W8LA 5DB8A 1D8YA 9ICAA 2W9MA 4IRKA 4JV2A 5HRGA 3C23A 3RR7A 2HHVA 9ICEA 5KFTA 4O5CA 2NRVA 4PH5A 1T3NA 2O5AA 4DFJA 1ZQNA 2BHNA 4K4HA 5HREA 1KNYA 4M9LA 4FHPA 1HJPA 4R63A 4RPYA 2XY6A 1AROP 1NJWA 3ZDCA 3KHGA 1ZQDA 4DWIA 3TAQA 3JZ0A 4Q44A 4XRHA 2BCVA 2AU0A 1U47A 2XGPA 5DQHA 4NLGA 3MBYA 5DB7A 5DG7A 2UVWA 3GFKB 1T4GA 3RJJA 4P4MA 8ICEA 4NM1A 4X4PA 4NY8A 9ICXA 4R64A 5HMMA 5DQGA 1MIYA 4RWNA 4QZ9A 3N4MB 2ZH6A 2XO7A 4QZIA 4DS4A 1HUOA 1ZQVA 1QSSA 2JEFA 3JPTA 7ICLA 2ZUBA 5L9XA 5DG9A 4ECSA 1XSPA 1WOTA 3OVBA 1X2IA 4Z6FA 5KG7A 4UAZA 3PMLA 3N97B 4X4NA 4LT6A 4Z6EA 3H8WA 4TUSA 4RZRA 5DGAA 5KG0A 2HHWA 4KN7A 3RBDA 1BVSA
chains in the Genus database with same CATH superfamily
1NK4A 2J6SA 7ICEA 5CEHA 2XY5A 3KHRA 4F3OA 3MR5A 2ESEA 1SWVA 1ZQTA 4J9LA 4O3NA 2EAPA 4RWPA 3GV7B 5CB1A 9ICCA 4BX9C 3V6HA 2DR7A 2DRAA 5IIOA 5KFNA 1MIVA 4F4WA 2HBMA 3H40A 2FLLA 1JIHA 3G6VA 4DLGA 2R8IA 4N7RA 5E79U 1IG6A 3Q8SB 2BPCA 4WC6A 3C2KA 3WFPA 2KP7A 3CK6A 4QJFB 5F9NA 3HWTA 1KFDA 1A77A 1WWVA 5ALGA 2XGQA 2AH5A 3NKUA 4RQNA 4X4QA 5EE1A 5AI0A 3PSTA 2JEGA 2W11A 2LBOA 2RHFA 4R65A 1RQNA 3F5AA 3ERCC 2PXIA 2C2DA 2HN2A 2JRZA 5DG8A 4ED6A 3WK4A 3HJ1A 1ZQJA 3NYBA 5CR0A 4KLIA 2EQYA 2KKVA 3H8SA 4MHVA 4QWAA 3FDSA 4B9SA 9ICOA 2F8LA 3V7LA 4OAFA 1MA7A 1ED1A 5ALKA 9ICTA 5KFKA 1R89A 3UPQA 1X9SA 4DOCA 1OUQA 2UVRA 1D8BA 4KB6A 4UARA 2BBJA 4RT3A 2YQEA 4DSFA 1ZQIA 1Z4OA 5KNIA 2NRWA 2JZBB 4O3PA 1YZ7A 4F5RA 4YR2A 4P0PA 2QB0B 2FLNA 3ISBA 2W9AA 2F1JA 4MF8A 9ICWA 1ZQRA 3HX0A 2GWSA 1RXVA 4FS2A 5D46A 2HHXA 3PW2A 1F0MA 1KSPA 1M6YA 3RB6A 3SENA 4GC7A 2PBEA 3SQIA 4RQMA 2P66A 1K5OA 1Z19A 4U6PA 3E0FA 3G6XA 2O1PA 1B43A 3RB4A 3IDWA 1UA1A 2ZH9A 2HCFA 5JU5A 4WCWA 5AK5A 3MCRA 3WFOA 1L6NA 4DQPA 1XO1A 3EPIA 4UAVA 4CCHA 2YY6A 3MR3A 1NK9A 2F2AB 3T5LA 4M9NA 1NJXA 4NXZA 3PHZA 1WWUA 3AQFA 1JN3A 4NJ8A 4NL9C 2AXTU 3WU2U 1VJ7A 3DDHA 1JRPA 3IRUA 4I2FA 3QUQA 5DEDA 3HKZF 5HRFA 3C1YA 3LVWA 1XWLA 3UMCA 3MR6A 3AN1A 5DDYA 3WKDA 4HAIA 2OYYA 2W04A 1YLQA 5EWGA 4FO6A 3ETLA 2VIXA 2JV3A 3G6YA 4EBDA 9ICFA 5EE9A 1XSLA 2ZH8A 1TFRA 5AK3A 3GZFA 1L8LA 1MN8A 5AK4A 4QW9A 4ELTA 2XIDA 5B66U 4FHYA 4KLQA 5KG1A 1UQVA 3BZCA 4C8NA 4I2AA 1UEVA 5ALHA 5CWRA 5HHHA 3TAPA 4MEYA 2KSOA 3UXOA 5EWFA 4EBCA 4JV1A 2CPRA 2DF4B 4O68A 2DPJA 5AKYA 1J2NA 2WAQC 8ICHA 3C66A 4DL7A 1FA0A 3PR5B 2XC9A 3WFRE 1L7OA 9ICLA 1YT3A 3ORYA 2IBKA 2DRBA 2F8KA 4NLZA 1N5XA 4EEKA 5TZVA 2H3ZA 2IUBA 1X6IA 2KK0A 3LK9A 1ZQEA 2W9CB 5AM0A 4C8KA 1JMSA 1F5SA 4E8FA 4OJLA 4E7XA 4BUGA 4IRCA 3ISCA 4QZ8A 2Y1IA 2H3QA 3TADA 3EWAA 4ECRA 5AKXA 3WKCA 3K4GA 2FPMA 1A76A 1DRGA 4KLUA 2R18A 1BNPA 3OV7A 4OJ5A 1ZQOA 1U45A 2BCRA 1ZQZA 5HR9A 4M0AA 4K9AA 3VCBA 3H38A 2JH7A 2HBKA 2Y9TA 4DF8A 4Y2UA 3ZDAA 3SMVA 4X4RA 1NOMA 1KN5A 3JPSA 4O3QA 2FLPA 3M9OB 4PJ0U 5A0LA 4QWEA 4LEZA 4R8UB 4M2YA 2DPIA 5F2VO 4RQ6A 3SAFA 3AMZA 1U9LA 4NL9A 3AQMA 2BPGA 4C4SA 4IQVA 3PY8A 3PW4A 3ZDBA 3KHHA 4DCCA 3H8MA 4RUCA 1BPYA 4DSLA 4WC3A 3PZPA 3T5HA 8ICRA 4PHEA 5AM5A 3BJYA 3BQ1A 3D2SA 1NJZA 1C20A 4RT2A 4ACOA 3OUYB 4X4UA 4B9VA 4F4KA 4NXWA 1ECWA 1L5UA 2R8GA 2OXOA 3J81j 1XO0A 1S0OA 2BQRA 1UA0A 4P4OA 1COOA 1LB2B 3IG8A 4CRXA 7ICQA 1KW4A 4Y2PA 4E0DA 3PNCA 3Q8KA 2M0NA 4EP7A 3KD3A 2W9BB 3GIMA 3C21A 3HT3A 2VA8A 4MKPA 2ALZA 5CRXA 2K60A 3GILA 3EW9A 4RNMA 4O69A 2ZIUA 8ICQA 3FYHA 5KG5A 4JV0A 8ICXA 2KTQA 5KFYA 7ICFA 2M2VA 2G0AA 4JUZA 1N5WA 4ED1A 2DKZA 3C18A 5KFLA 3E2EA 3KBBA 2HHUA 5KT3A 4A8EA 2ZJ5A 2W43A 1UETA 1L7MA 4DQSA 3SD7A 2W55A 3LYSA 5FP0A 4J9KA 1QH9A 5EE0A 2V4QA 3L3FX 2PI5A 3RB0A 2EANA 1MSWD 8ICTA 3SAHA 3U26A 5DQIA 4KITB 3IP4B 4IQWA 2G06A 3D6JA 4EYHB 3WKEA 4YXJA 1KL9A 4QZHA 4F72A 4IRKA 2HHVA 4JLXA 4PH5A 4K4HA 2BHNA 3NVZA 2EAMA 4R63A 2XY6A 3KHGA 2FI1A 3TAQA 4DFDA 4XRHA 5DG7A 3GFKB 1T4GA 5AICA 4R64A 5HMMA 4RWNA 4QZ9A 4FFDA 2XO7A 4DS4A 2JEFA 2ZUBA 5DG9A 3F2BA 4LT6A 3QU4A 4KN7A 2WB1C 1BVSA 4C80A 4Z6CA 4DS5A 2QLTA 5ALUA 3RH4A 5DECA 3ZI4A 3JCFA 1SV4A 4QZCA 2HHQA 1V85A 2V4RA 1Q46A 5F9LA 1UCVA 2NRTA 5IIIA 3N7PD 1SKSA 1ZQQA 1X9XA 2ZTDA 5HRDA 1C7YA 8ICKA 3BQ2A 1NJYA 8ICBA 2WAQF 1V9PA 2DVIA 1JX4A 3QUTA 2DBYA 4YR3A 4M47A 1ZQBA 2YB1A 2DL0A 3OHAA 4AT7B 2Q4TA 4XQ8A 8ICZA 1MC8A 1P7DA 4YXMA 3HILA 4YN4A 2FCLA 2VA3A 4ATBB 2HBLA 4KLFA 2HHPA 1X40A 4KX5A 1U49A 1SWWA 3RTVA 3H0LB 3NUQA 4XUSA 1V38A 3NVWA 2EZZA 1QSYA 5DDMA 3RH5A 1WYGA 4BGDA 2JGAA 4ED8A 1KFSA 1SIJA 2DKXA 5GTHU 2K4EA 5IIJA 2I1QA 1UPHA 4F50A 1CEZA 4OAIZ 4Q45A 1XS9D 1X6JA 3SEIA 1ZETA 4E80A 3C2LA 4ELUA 2E8MA 2GAFD 1SL1A 4PPXA 2GA9D 1ZD2P 2ZIXB 2W3RA 1KRPA 2WF5A 4QNLA 3ONNA 1DXSA 3OSPA 4KLSA 3OVSA 2JZBA 3Q8MA 2KN7A 4UQGA 4C8OA 2QB0A 4KLGA 3ISDA 8ICGA 3NRWA 5DGBA 2B51A 1L3UA 4DQIA 5KFWA 3H8JA 4PHDA 5KTQA 4ZOHC 2KG5A 4DL5A 5IINA 1ZQUA 3M1YA 3MC1A 4TQSA 3F2DA 1COKA 3H39A 2A3VA 3LWMA 4J9PA 1DK3A 3OWGA 2RLTA 5AI8A 5ALWA 3JPRA 1Q78A 1HUZA 4GC6A 4DLEA 3BQTA 2ZXHA 3B0YA 3T5KA 2OWOA 2LKYA 1XC9A 4Y2XA 7ICMA 2AQ4A 2LYAA 3H7IA 1DGJA 2IOFA 3I76A 4RQ5A 1S10A 2IHOA 4O3MA 4ED2A 2MSNA 4QWCA 2E8OA 4IR1A 3TQ1A 2KVSA 1RM6C 2ISPA 2CRXA 4K99A 3UXNA 1IV8A 4YMNA 1SXEA 4J9QA 3KFUF 5CP2A 3V7JA 3Q8LA 5J2GA 1WG8A 3UM9A 5DBBA 5KFRA 5HHIA 2B21A 4WC2A 3PX4A 3B0XA 2HOQA 4Q8FA 1R8AA 3IHQB 1RQLA 5L1MA 1FFUA 1JAJA 3UPSA 4JWNA 4KX3A 1ZQFA 5CJ7A 4S3NA 3M6KA 1NK8A 2OEHA 2ZJ8A 4EX7A 4WC1A 8ICYA 7ICRA 1IM4A 5KFVA 4K4GA 5KT2A 1TK0A 3AUOA 3F5EA 4KLHA 2PFNA 4RPZA 3LDAA 2BCUA 4J9NA 4NWIA 2W7PA 3JPPA 3BS5B 2W7OA 5J0OA 1Z00B 4F71A 1SKRA 5KFJA 2YN4A 2ZUDA 2PFOA 2BGWA 4I29A 4YG2A 5HP4A 3UMBA 5HC9A 2WTFA 1TAMA 4DL6A 4DQQA 4FHVA 1FIQA 8ICWA 2WB1F 2HMXA 1ZQCA 1CUKA 3K1ZA 4AYBF 1RDFA 3RJGA 3PX0A 4O3SA 8ICLA 3CYMA 3OHBA 3TADC 4KMOB 5J2KA 2HOIA 1L3SA 1ZD4A 1J2MA 2W9CA 3ZD9A 2MUTB 3PSPA 3SYZA 4B9NA 4IQUA 4ED0A 4F5OA 1Q3VA 9ICIA 2RDIA 3OPXA 3JPOA 4X0AA 4WC4A 1RYRA 4GFJA 3AQEA 2A1JB 4QW8A 5J0UA 4IG8A 1IXRA 5J2AA 1NNLA 3JPQA 4NKUA 2VA2A 3RRHA 2OHFA 2HW3A 2O6KA 2KJ8A 4DOBA 1VFGA 4O3OA 3M8SA 2KICA 1TV9A 3EF2A 4YCXA 4R8UA 1U48A 1SGGA 4IS7A 5K4LA 2E1FA 3BZKA 1DK2A 2W3SA 5DKWA 5JTGA 8ICMA 4UB8U 4WC0A 2ZH1A 1X9WA 4M9GA 4UB1A 2BZFA 4O9MA 2J6TA 2KNJA 2K8AA 2KE7A 2KZZA 1BNOA 3HJEA 4QWDA 4G3IA 1PVRA 4GXJA 2W54A 5DB9A 4Z6DA 5AKJA 3OUYA 5AM3A 4DSKA 3ZDEA 4BWJA 4HYKA 2ASDA 2XICA 7ICOA 3SV3A 2E3TA 3NVOA 2FMSA 4NM2A 4F5NA 5ALQA 2LI6A 5DLFA 1WUDA 4KLJA 3L4PA 5AIAA 3SZ2A 4AP9A 2ZTCA 4FZNA 4F2RA 1YZ6A 4DSJA 2NRZA 4DFMA 2W9BA 2R8HA 1ZQWA 3KHLA 8ICSA 2DWQA 4OJ6A 4RQ2A 3WFQE 4M6WB 5J0RA 2K89A 1NZBA 2BQ3A 3PVXA 2BKEA 3HW8A 3UQ2A 4C0ZA 1S8OA 2FE9A 3H4DA 5KG2A 2IOFK 2ZHBA 2DGZA 4M04A 1JXEA 5H2FU 5EOZA 1ZQLA 5B3QA 4QZAA 4NXUA 2BR0A 2K8BB 9ICPA 2QB1A 1SXDA 2BQUA 4DSIA 3L5KA 4MF2A 2JXJA 1HIWA 5KFQA 2KZ3A 4USAA 3RJEA 4O5KA 4CGZA 4F93B 1O03A 1KEJA 4ED3A 2AGQA 1B4FA 2W9MA 1X42A 1T3QA 3C23A 9ICEA 5KFTA 1T3NA 5ALSA 5HREA 2Z7JA 3ZDCA 3I28A 4DWIA 1ZRMA 2QARB 1U47A 3MBYA 3RJJA 3N7RC 4X4PA 3SAGA 5AM1A 2GOLA 1MIYA 3N4MB 1CI4A 4QZIA 1QSSA 2BDUA 3OVBA 2F44A 1XSPA 4ECSA 5AHXA 1WOTA 1X2IA 4Z6FA 3PMLA 3N97B 4LEVA 4TUSA 5DGAA 2KEYA 5ALJA 2HHWA 2HSZA 4DF4A 4YP3A 5J0QA 5B3PA 5DBCA 2JEJA 2YMLA 2H3VA 4XJEA 2NO5A 4OAHA 5J2CA 4F5QA 4J03A 1PVQA 2IOHA 4RQ3A 4AT9B 1TFYA 4I2IA 4ECVA 4PHPA 4NV0A 2KJ5A 2VANA 5AI6A 5AKGA 1TAUA 5ALEA 4B9MA 7ICJA 2KHVA 3C2MA 2MA1A 4EBKA 4ECYA 3L9DA 5DBAA 2GO7A 5C5JA 1A0PA 2I5HA 2LMRA 4NLCA 1XU4A 2DR8A 4ZH4A 1FO4A 4OAGA 4PZOA 3RJIA 2C2EA 5J2EA 5KFPA 4I2DA 4KMUA 1TAQA 3MR2A 3M9MB 5CFSA 4KN4A 3SI8A 3GV8B 2I9GA 2C22A 4AT7A 1MQ3A 2J6UA 1NKCA 4UBBA 2ZUCA 1QSLA 4Y2VA 2ZH2A 4KLLA 4QZFA 3LQCB 4ATBA 2FPLA 1Z4NA 1R8BA 4GIBA 2EDUA 3EUB2 5DLGA 5KG6A 1D9FA 1XSNA 3BQ7A 2BBHA 3ER9B 5KT6A 2KZMA 4FBTA 4FHWA 3OJSA 5KFUA 4WBZA 2ZG6A 4UASA 3AQLA 3WK7A 4M9HA 5ALMA 3ALRA 4I27A 5TISU 4C4TA 4ICAA 5ALIA 8ICNA 2I6XA 4KM5A 3RB3A 2OH2A 3HPOA 2B56A 1F44A 4UAWA 7ICHA 2HBJA 5ALNA 3JPNA 3KKAC 4RQ0A 4NXXA 2EAOA 4WBYA 4NXVA 4I2EA 4WQLA 3IG5A 1NKBA 2ZIXA 5KFCA 5HRHA 3F53A 2DR9A 1PK1B 4ECXA 4ED7A 5KFFA 2FMPA 2CXYA 1L3VA 1O08A 4LZDA 4UATA 4ECZA 4X4VA 2M2TA 2ATLA 4CF3A 7ICNA 1RYUA 5J0PA 2YMQA 1NK7A 3TARA 5KL8B 4I2HA 2YMMA 3SR6A 8ICPA 1DGSA 2RRDA 5J2DA 4RWQA 3WKAA 2H3IA 2B4VA 4EYIB 1DOQA 1K1SA 4ELVA 2PKEA 4JK1A 4WQKA 4C8MA 4B9TA 5GTIU 4BXOB 4O5EA 2XVTA 5JRTA 3NASA 4Q8EA 3RH6A 1TE2A 3E58A 4OCZA 4FS1A 4PL1A 4RQ8A 3F2CA 1PX5A 3T79A 2H5XA 1B0XA 2KFZA 3QU9A 2YX8A 2DQNB 2IHNA 4PGYA 3RR8A 3ZDDA 2LYHA 2VJ5A 1TFWA 2GH1A 2LYBA 3GV5B 5CA7A 2K8CB 1X66A 4RQ1A 2ISOA 3WK6A 4DFKA 2ZTEA 1KDHA 1CRXA 4ECWA 4P0QB 1V97A 4WH5A 5ALZA 2IHMA 4K96A 2JHDA 1BPBA 8ICUA 2YMPA 5KFDA 2YB4A 9ICRA 1F5AA 5JTIA 3RAXA 2HN1A 4OJPA 2XY7A 1LV5A 2A1AA 1L7PA 2E8NA 3KOOA 4ECQA 3H3AA 3EPGA 4K8VA 5J0TA 4PZNA 3QZ8A 2RDJA 5AKHA 7ICIA 1ZYQA 2HVHA 3K7DA 3C1ZA 3Q8PB 1TKDA 1AQ6A 5AKEA 3GIKA 5KFXA 5ALOA 1JI7A 2R8JA 3DV9A 3BS5A 5CHGA 1U4BA 1ZQXA 2FMQA 1Z00A 2JR5A 4TURA 4MFFA 5J2FA 5HNKA 1JUDA 1Z1VA 2B0CA 5D49A 4YD1A 3QUCA 9ICBA 4TUPA 9ICSA 2ZIVB 5J0XA 5KT4A 3GQCA 3A0HU 3HRDD 3KKAA 3OSNA 1R8CA 1TVAA 4MEXA 3RF9A 1ZQHA 1L3TA 3FM9A 1N61A 2LM1A 4EEDA 1FFVA 4F92B 5J2JA 7ICGA 4BJQA 2IMWP 1NKEA 9ICGA 3RFAA 4US9A 4KLOA 8ICAA 5KAIU 3V7KA 4UB5A 3V6JA 4AT8B 2ASJA 2MUTA 2ZXIA 4EX6A 4Y2RA 3H4BA 4K4IA 5IIMA 1QQ6A 4LVSA 5T14A 8ICOA 2A19A 1BPDA 2ZH7A 3HJ4A 2KKPA 2A1JA 2ZIWB 2Y0SC 4UB3A 4C7ZA 4RUAA 2XCAA 1S97A 2PFQA 2AGOA 4QIWC 5KFEA 1S76D 5ALLA 3RJFA 4EGWA 4QZBA 1BGXT 5KT5A 5KAFU 4YVZA 5L1LA 3C29A 2C2RA 1N60A 1NZPA 2FPKA 3Q8RB 1ZQSA 4UD5A 5CFTA 1FEZA 9ICJA 2HI0A 7ICUA 1LKYB 5KFZA 3RAQA 2D3DA 1RZTA 1QTMA 3UMGA 2KJ9A 2NYVA 1LVHA 1ZXIA 5EE3A 5J29A 4R66A 1PUZA 1T94A 1EXNA 2KMDA 2GLEA 4DQRA 4TQRA 3T3FA 3PW7A 5G5HA 4IR9A 9ICNA 5KFMA 2EZYA 4U7CA 4DOAA 4YD2A 5D62A 4F2SA 4RQ7A 4QZGA 5DB6A 3EYZA 1ZD3A 1ZQGA 2DUYA 3M6ZA 1RXWA 3PO5A 5BOMA 2G09A 1OW5A 3AL0B 2AQ0A 1T8EA 9ICMA 2ID1A 1N62A 2Y1JA 2LM4A 1V4AA 3RBEA 2XCPA 1S77D 5HRLA 3GIJA 4P4PA 4C4RA 3D2QA 2M2WA 4NKTA 4TUQA 4M6WA 4F4YA 3BQ0A 3WK5A 5KT7A 1SZHA 1UT5A 1RYSA 1UHUA 4CF4A 1ZQ1C 2CN1A 3DEEA 3K1RB 5AM2A 3MABA 4EELA 4PGXA 3C28A 3IV6A 4FH3A 1PK3A 1N63A 3SV4A 1ZQAA 4OO1J 5AI5A 2KIWA 5D61A 2JEIA 4OJOA 2W8KA 3THVA 4UAYA 3NS1A 5J2IA 2ZHAA 5KG4A 5EWEA 3LWLA 2W8LA 5DB8A 4CNQA 9ICAA 4WOYA 4O5CA 3NVVA 3QUBA 3QU2A 2O5AA 4DFJA 1ZQNA 1Q8KA 4FHPA 4Y2TA 1AROP 1NJWA 1ZQDA 5D63A 2AU0A 4NLGA 5DQHA 5DB7A 2KV2A 2UVWA 8ICEA 4NM1A 9ICXA 5HR6A 2QARA 2N1RA 2ZH6A 7ICLA 1HUOA 2B6GA 5L9XA 1SV0A 4Z6EA 2D8CA 3H8WA 5KG0A 3NWIA 5F3XB 3RBDA 3H0MB 4YFKA 2AJQA 2WF8A 1OXJA 2BPFA 2KFNA 4EEBA 2E8PA 5ALDA 4DEZA 5KFGA 3MDAA 7ICTA 2KIVA 8ICCA 2NRXA 3RRGA 1SZPA 1ZRNA 4AT9A 5JUMA 2WF7A 1BPXA 2WF9A 5J0WA 4NXTA 4FZMA 4Q43A 1ZQYA 2P35A 3QZ7A 2D6FC 1NK5A 4X4OA 4XA5A 3QEBZ 7ICSA 1SL2A 4J9MA 2HOFA 4X5VA 3Q8QB 1ZQMA 4IQTA 3MGHA 4DL3A 4RNOA 5CFUA 2LHTA 4X4TA 2LPEA 2W03A 4QWBA 3QU7A 1UEUA 2NV3A 3QX7A 4B9LA 3PW5A 5ALRA 3FAHA 3UQ0A 1S0MA 3NTUA 4I2JA 4I0UA 3TACB 4FO1A 5ALYA 3GDXA 1VJ5A 5KG3A 3PV8A 2NO4A 2KOBA 2AHOB 2WFAA 4NLBA 3AEVA 2Y9UA 3OGUA 3PO4A 2K4HA 3V72A 3V6KA 9ICHA 3QYPA 9ICKA 2HHTA 5IIKA 3NGDA 1JXLA 2MU2A 4PHAA 3PSIA 4F4ZA 2F77X 4EZ6A 4UB6U 4WC5A 3CW2C 1T7PA 3MGVA 3PW0A 4CDGA 3WK8A 2Y0SF 1J97A 1NO5A 4RQ4A 3GU3A 5KFBA 2V9WA 2BCQA 3AM9A 5KFAA 5KL1B 4RWOA 1XNSA 4O67A 3UXPA 4QIWF 3WKBA 3CRXA 4EEYA 3R9KA 4P0PB 1N2XA 4F91B 7ICPA 5ALXA 5AIBA 1S0NA 1PK1A 2PI4A 5J8YC 3MFHA 3WFSC 3WK9A 2R8KA 2UVVA 2PMZC 4LEYA 3QNMA 4UBCA 1UT8A 4K9BA 2M2UA 2BCSA 4JMUA 5J0YA 9ICQA 1QQ5A 2F1IA 2Q0ZX 1X9MA 4XQ7A 4KLDA 1VDVA 3N28A 5J0SA 5J2HA 5AKIA 1JROA 4QZEA 7ICVA 2PFPA 3GIIA 4J9SA 1D8LA 5L1IA 1N48A 4BXOA 1Y88A 4GXKA 1WCLA 4M9JA 1K1QA 1A6SA 4RPXA 4O0IA 5KFIA 3M8RA 3IN5A 2EWRA 2ZH3A 1PVPA 2RP5A 2HHSA 1BPEA 3I1YA 3M9NB 5AKKA 4I2BA 1ZQKA 1PZNA 4O6AA 1KKXA 4BWMA 4QZDA 1S0VA 2RFFA 5HR7A 5D4BA 1JALA 2P6UA 3QE9Y 1H38A 4B6JA 1ZJMA 4K98A 4F8RA 2EZXA 2HDOA 2JH1A 3C5FA 1KTQA 4C8LA 5HRBA 4BDPA 4P0QA 4I2GA 3B9JA 1L8OA 1QCKA 2YTUA 4DL2A 1QLNA 4RU9A 3T5JA 4EZ9A 4MFCA 2DR5A 5AKZA 2G5HB 4DL4A 1QQ7A 3TFRA 2E5SA 4LZGA 2BDPA 4RNNA 2FDRA 4K97A 1NI3A 1SL0A 2C28A 2OCEA 4JB3A 4OD0A 3TFSA 2IA6A 1Q79A 2KSOB 3OTQA 3MGIA 4F5PA 4JLZA 3LVVA 4HX0A 8ICJA 4DFPA 4Y2YA 1TK5A 2BE3A 2ZH5A 2K4IA 2E1EA 4ECTA 1OU5A 2DFLA 5AKLA 3TANA 4B9UA 4US8A 1RPLA 3PX6A 1SB3C 2AGPA 3TI0A 3H37A 8ICFA 4EBEA 2ZIVA 1S5LU 3CNHA 2HVIA 3EZ5A 2ODGA 3K75D 3PR4A 1HEKA 4JWMA 4I2CA 4IRDA 4KTQA 4Y2SA 2JMGA 1URJA 3NRZA 4X0BA 3FC4A 1RG6A 5ALVA 8ICVA 4F4XA 4DSEA 4FH5A 2OM6A 1ZD5A 5J8YA 2ES6A 2F76X 1KQQA 4UAUA 3S6JA 4UB2A 4UB4A 4I28A 5AI4A 1GO3F 5J2BA 4FBUA 2L5YA 4AT8A 2Q66A 1MIWA 2VJ4A 3JYYA 4CE6A 3MFIA 2NRKA 4KLMA 4X4SA 5IILA 3RJKA 3KTQA 2MRLA 1NK6A 4FE3A 4Y2JA 2FJ6A 2G07A 1L7NA 5BOLA 1ZJNA 2ZIWA 3AQKA 3IM1A 3ED5A 3QEAZ 5AK6A 8ICIA 3TKAA 2F3NA 3PSFA 5AM4A 1ZQPA 5HRKA 5BPCA 1JQRA 3RJHA 3ICXA 4IL6U 5ALPA 3MDCA 3AU6A 4AYBC 5L1KA 4J9OA 4PL2A 1S9FA 4CF5A 4EV6A 3BDPA 4YQWA 3PMNA 1B22A 1VLBA 3N7SC 5KFHA 2WF6A 3A0BU 4NLNA 4UD4A 5KFOA 2MAXA 4M5DA 1LKYA 3KZXA 3QU5A 3AQNA 5HRIA 4WJ3B 3NVYA 2F1HA 4WC7A 1Z1BA 7ICKA 1BPZA 5B5EU 2M9NA 5AI9A 3C5GA 4KLEA 1ZOLA 4GLXA 1Z3EB 4Y2QA 4J9RA 1NK0A 3VC8A 5ALTA 2G08A 2WHEA 3ER8C 3ETRA 3KZIU 4YR0A 4KLTA 4FHXA 2XI9A 1KFTA 4DO9A 9ICUA 1MQ2A 4MFAA 2PMZF 5HMLA 2ZIUB 5CHEA 2ZH4A 3HKZC 4GXIA 4EBJA 4NLKA 3M7DA 1D9DA 2UVUA 3OVAA 2ASLA 4UW9A 4C7YA 5KFSA 3HP6A 2ZJAA 3O0FA 3AU2A 2G5IB 5ALFA 4O3RA 4LEWA 2K4PA 2KHQA 3D2NA 3OJUA 4EENA 2P6RA 4FZLA 1GPJA 2QKQA 4ECUA 4LJXA 4YMOA 3H0RB 3HIYA 5L1JA 2KVCA 4YMMA 4PGQA 1WCNA 3ZD8A 4P2HA 9ICVA 3BS7A 1N56A 1SKWA 2RQ5A 4IC9A 1TK8A 1KBUA 1KLNA 1D8YA 4JV2A 5HRGA 3RR7A 2NRVA 2H3FA 4G9BA 1KNYA 4M9LA 5C0YA 1HJPA 2EH9A 3QXGA 4RPYA 2VKQA 3JZ0A 1SV0C 4Q44A 2KD1A 2BCVA 2XGPA 4P4MA 4NY8A 5DQGA 1ZQVA 1Q3UA 3JPTA 3CP8A 5G5GA 5KG7A 4UAZA 4X4NA 4RZRA 1IIPA
chains in the Genus database with same CATH topology
4YFKA 4DF4A 1NK4A 2J6SA 4YP3A 2AJQA 4Z6CA 5J0QA 4DS5A 7ICEA 5DBCA 3RH4A 5DECA 2XY5A 3KHRA 4F3OA 2JEJA 3MR5A 2BPFA 2KFNA 1ZQTA 4QZCA 4DEZA 5KFGA 5J2CA 3MDAA 4O3NA 4J9LA 4F5QA 2HHQA 4RQ3A 3GV7B 7ICTA 8ICCA 4AT9B 2NRXA 2V4RA 4I2IA 4RWPA 5CB1A 9ICCA 4ECVA 5F9LA 3RRGA 4PHPA 3V6HA 2DR7A 1SZPA 2DRAA 5IIOA 4AT9A 5JUMA 5KFNA 2NRTA 2VANA 1BPXA 1MIVA 5IIIA 1TAUA 4F4WA 5J0WA 3H40A 2FLLA 1SKSA 4B9MA 7ICJA 1JIHA 4Q43A 1ZQYA 2ZTDA 3G6VA 3C2MA 4DLGA 3QZ7A 1C7YA 2R8IA 8ICKA 5HRDA 3BQ2A 1NJYA 1NK5A 3Q8SB 4XA5A 4ECYA 8ICBA 3L9DA 4EBKA 4X4OA 2BPCA 3QEBZ 1V9PA 5DBAA 2DVIA 4WC6A 1JX4A 5C5JA 3C2KA 7ICSA 4YR3A 1SL2A 4M47A 3WFPA 1XU4A 2KP7A 4ZH4A 4J9MA 1ZQBA 2DR8A 4X5VA 5F9NA 3Q8QB 3RJIA 1ZQMA 3HWTA 1KFDA 4IQTA 4I2DA 5KFPA 1TAQA 4KMUA 1A77A 4XQ8A 4KN4A 5J2EA 4RNOA 1MC8A 3M9MB 4DL3A 8ICZA 4X4TA 2XGQA 4QWBA 3SI8A 3GV8B 2I9GA 1UEUA 2C22A 4AT7A 4YXMA 1MQ3A 4B9LA 3PW5A 4YN4A 1NKCA 2J6UA 4X4QA 4UBBA 2ZUCA 1QSLA 2VA3A 4ATBB 4KLFA 2HHPA 2ZH2A 2JEGA 4KLLA 1S0MA 3UQ0A 3NTUA 4QZFA 4R65A 1U49A 4I2JA 3LQCB 3RTVA 4ATBA 2FPLA 1R8BA 3GDXA 4XUSA 5KG3A 3PV8A 5DLGA 5KG6A 1QSYA 5DDMA 2PXIA 3RH5A 2C2DA 4BGDA 5DG8A 4ED6A 4ED8A 1XSNA 1D9FA 3OGUA 5KT6A 2KZMA 1KFSA 3PO4A 3OJSA 4FBTA 3V72A 5KFUA 4FHWA 3HJ1A 1ZQJA 3V6KA 5IIJA 5CR0A 4KLIA 9ICHA 3NYBA 2I1QA 3AQLA 4WBZA 3H8SA 9ICKA 2HHTA 4F50A 5IIKA 4QWAA 3FDSA 3NGDA 1JXLA 4B9SA 9ICOA 4PHAA 3V7LA 4M9HA 4F4ZA 1CEZA 4EZ6A 4Q45A 4I27A 1XS9D 1ZETA 9ICTA 5KFKA 4E80A 8ICNA 4WC5A 1T7PA 3C2LA 3PW0A 3RB3A 1TFYA 1R89A 3UPQA 1X9SA 3HPOA 4DOCA 2UVRA 4ELUA 4UAWA 7ICHA 3JPNA 1NO5A 4RQ0A 5KFBA 4RQ4A 2V9WA 1SL1A 4PPXA 4WBYA 4I2EA 4RT3A 5KFAA 2BCQA 4DSFA 4RWOA 1ZQIA 1KRPA 1NKBA 3UXPA 4EEYA 2NRWA 5KFCA 5HRHA 3OSPA 2DR9A 2JZBB 4O3PA 4F91B 4ECXA 4ED7A 4F5RA 4KLSA 7ICPA 5KFFA 4YR2A 2FMPA 3OVSA 1S0NA 2FLNA 1L3VA 4LZDA 2JZBA 3ISBA 2KN7A 3Q8MA 4UQGA 2F1JA 2W9AA 2PI4A 3MFHA 4ECZA 4C8OA 4X4VA 2M2TA 4MF8A 4KLGA 3ISDA 2ATLA 9ICWA 7ICNA 8ICGA 3WFSC 1ZQRA 5DGBA 5J0PA 2UVVA 2R8KA 3HX0A 2GWSA 1L3UA 4DQIA 5KFWA 3H8JA 4PHDA 1RXVA 4FS2A 5D46A 5KTQA 1NK7A 3PW2A 2HHXA 3TARA 1KSPA 4I2HA 4UBCA 5IINA 4DL5A 1UT8A 3RB6A 1DGSA 1ZQUA 8ICPA 5J2DA 4RWQA 4GC7A 2M2UA 2PBEA 2BCSA 9ICQA 5J0YA 2P66A 4EYIB 4TQSA 2F1IA 1DOQA 1K1SA 2Q0ZX 1X9MA 4ELVA 4XQ7A 4KLDA 4JK1A 3H39A 5J0SA 4C8MA 3LWMA 4B9TA 3G6XA 5J2HA 4J9PA 2O1PA 4QZEA 1B43A 1DK3A 4BXOB 2PFPA 4O5EA 3RB4A 7ICVA 1UA1A 4Q8EA 3GIIA 2ZH9A 4J9SA 1D8LA 5L1IA 3RH6A 1N48A 4BXOA 3JPRA 1Y88A 1Q78A 4WCWA 3WFOA 4FS1A 4DQPA 1XO1A 3EPIA 4RQ8A 4CCHA 1HUZA 3MR3A 4GXKA 4GC6A 1WCLA 1NK9A 1PX5A 4M9JA 4DLEA 3BQTA 3T5KA 2H5XA 3B0YA 3T5LA 1NJXA 2OWOA 4NXZA 4M9NA 1XC9A 1K1QA 1JN3A 4RPXA 2KFZA 7ICMA 4O0IA 1VJ7A 2AQ4A 4AT7B 5KFIA 3M8RA 3H7IA 2ZH3A 4RQ5A 1S10A 2IHNA 4I2FA 2HHSA 1BPEA 4ED2A 4PGYA 5DEDA 3RR8A 4QWCA 3C1YA 3ZDDA 5HRFA 2LYHA 4IR1A 3M9NB 3TQ1A 4I2BA 1ZQKA 1PZNA 1TFWA 1XWLA 4BWMA 4QZDA 2ISPA 1S0VA 2RFFA 3UXNA 3GV5B 5CA7A 3MR6A 5D4BA 2P6UA 5DDYA 3QE9Y 1H38A 4YMNA 4J9QA 4RQ1A 5CP2A 3V7JA 1ZJMA 3Q8LA 2ISOA 5J2GA 4F8RA 5DBBA 5EWGA 4DFKA 1YLQA 4FO6A 2ZTEA 1KDHA 3ETLA 1KTQA 3C5FA 4ECWA 5KFRA 4C8LA 5HRBA 4BDPA 2IHMA 3G6YA 4EBDA 5HHIA 1ZQQA 9ICFA 4I2GA 1BPBA 2B21A 4WC2A 8ICUA 1XSLA 3PX4A 2ZH8A 1TFRA 3B0XA 4Q8FA 1R8AA 5KFDA 1F5AA 9ICRA 4DL2A 3IHQB 1QLNA 4RU9A 3T5JA 4EZ9A 1JAJA 3RAXA 3WFQE 4MFCA 4JWNA 3UPSA 2DR5A 2XY7A 1LV5A 4DL4A 1ZQFA 4QW9A 3TFRA 4LZGA 5CJ7A 4ELTA 4S3NA 4FHYA 1NK8A 2BDPA 2ZJ8A 4RNNA 4WC1A 4ECQA 3H3AA 4KLQA 8ICYA 3EPGA 7ICRA 1IM4A 5KFVA 5KG1A 5J0TA 3QZ8A 2RDJA 4K4GA 5KT2A 7ICIA 1ZYQA 1TK0A 1SL0A 2C28A 3AUOA 4KLHA 2HVHA 2PFNA 4RPZA 2IA6A 1Q79A 3TFSA 3C1ZA 3LDAA 3Q8PB 4J9NA 1TKDA 4C8NA 2BCUA 3MGIA 4F5PA 4I2AA 3JPPA 3GIKA 1UEVA 5KFXA 5CWRA 8ICJA 5HHHA 3TAPA 4MEYA 5J0OA 1Z00B 3UXOA 2R8JA 5EWFA 2C2EA 4DFPA 1TK5A 2BE3A 2ZH5A 1SKRA 5CHGA 4EBCA 1ZQXA 1U4BA 5KFJA 3MR2A 2FMQA 1Z00A 2ZUDA 4JV1A 4TURA 4MFFA 4ECTA 1OU5A 5J2FA 2DFLA 2DPJA 2PFOA 5HNKA 2BGWA 8ICHA 4I29A 4YG2A 5D49A 5HP4A 3TANA 4B9UA 2WTFA 5HC9A 4DL6A 4YD1A 3C66A 1RPLA 4DQQA 3PX6A 4FHVA 4DL7A 8ICSA 3PR5B 1FA0A 9ICBA 2XC9A 4TUPA 8ICWA 9ICSA 3WFRE 2AGPA 5J0XA 3TI0A 5KT4A 3ORYA 3GQCA 2IBKA 9ICLA 8ICFA 3H37A 2DRBA 3OSNA 4EBEA 1ZQCA 1CUKA 1TVAA 4MEXA 1R8CA 4NLZA 1ZQHA 2HVIA 1L3TA 5TZVA 3EZ5A 3PX0A 3K75D 3RJGA 3PR4A 4O3SA 8ICLA 3OHBA 4JWMA 3LK9A 4I2CA 5J2KA 4IRDA 4KTQA 1ZQEA 4F92B 2W9CB 1L3SA 4C8KA 1JMSA 4X0BA 4E8FA 5J2JA 8ICVA 7ICGA 4F4XA 4DSEA 2IMWP 4E7XA 2W9CA 1NKEA 3ZD9A 4IRCA 3ISCA 2MUTB 9ICGA 4FH5A 4KLOA 8ICAA 3SYZA 3V7KA 4B9NA 4IQUA 4QZ8A 4UB2A 4UB5A 3V6JA 2Y1IA 4UB4A 4AT8B 2ASJA 4I28A 2MUTA 3EWAA 5J2BA 4FBUA 3H4BA 4ECRA 4AT8A 4ED0A 5IIMA 4K4IA 4F5OA 3K4GA 4LVSA 2FPMA 1A76A 2Q66A 4KLUA 8ICOA 9ICIA 1MIWA 1BNPA 2RDIA 3JPOA 4X0AA 3OV7A 4WC4A 1RYRA 3JYYA 3MFIA 1ZQOA 1U45A 2NRKA 1BPDA 2A1JB 2ZH7A 4QW8A 2BCRA 1ZQZA 4KLMA 4X4SA 5IILA 5HR9A 5J0UA 4M0AA 3RJKA 3KTQA 3H38A 3HJ4A 1IXRA 2A1JA 4IG8A 5J2AA 4DF8A 3ZDAA 1NK6A 4UB3A 5BOLA 1ZJNA 3JPQA 4X4RA 3AQKA 3IM1A 4RUAA 4NKUA 2XCAA 3QEAZ 2VA2A 3RRHA 1NOMA 1S97A 2PFQA 2HW3A 2AGOA 8ICIA 3JPSA 4O3QA 2FLPA 3M9OB 4QWEA 1ZQPA 5KFEA 1S76D 5HRKA 4DOBA 4R8UB 4M2YA 2DPIA 5BPCA 3RJFA 1JQRA 4O3OA 4RQ6A 3RJHA 5F2VO 1VFGA 3M8SA 4QZBA 1BGXT 5KT5A 1U9LA 3MDCA 1TV9A 4YCXA 4R8UA 4YVZA 5L1LA 5L1KA 3AU6A 1U48A 4J9OA 2C2RA 1S9FA 3AQMA 2BPGA 1NZPA 2FPKA 4IQVA 3BDPA 4YQWA 3PY8A 3Q8RB 1ZQSA 4UD5A 3PW4A 3ZDBA 3KHHA 3PMNA 1B22A 9ICJA 1DK2A 7ICUA 5KFHA 5DKWA 4RUCA 5KFZA 3RAQA 1BPYA 4NLNA 1RZTA 8ICMA 1QTMA 5KFOA 4DSLA 2MAXA 4M5DA 4UD4A 4WC0A 4WC3A 2ZH1A 1X9WA 4M9GA 4UB1A 3T5HA 8ICRA 4O9MA 2J6TA 3AQNA 5J29A 4PHEA 4R66A 3BJYA 3BQ1A 5HRIA 1EXNA 2KZZA 1NJZA 2F1HA 1BNOA 4G3IA 4QWDA 4WC7A 4RT2A 7ICKA 3OUYB 4X4UA 1BPZA 4B9VA 4GXJA 4F4KA 5DB9A 4TQRA 4DQRA 3T3FA 4Z6DA 3PW7A 2M9NA 1L5UA 4IR9A 3OUYA 9ICNA 5KFMA 4DSKA 3ZDEA 3C5GA 4KLEA 4BWJA 4HYKA 2R8GA 4GLXA 2ASDA 1S0OA 4DOAA 4YD2A 7ICOA 3SV3A 1Z3EB 2BQRA 2FMSA 1UA0A 4NM2A 4F2SA 4P4OA 1COOA 4RQ7A 4QZGA 4J9RA 4F5NA 1NK0A 5DB6A 3EYZA 1LB2B 3MGHA 7ICQA 5DLFA 4KLJA 1ZQGA 4E0DA 3PNCA 3Q8KA 4YR0A 3SZ2A 4KLTA 4EP7A 4FHXA 1RXWA 1KFTA 4DO9A 3PO5A 2W9BB 5BOMA 2ZTCA 4MFAA 1MQ2A 5HMLA 4F2RA 3GIMA 3C21A 3HT3A 2VA8A 4DSJA 2AQ0A 1T8EA 9ICMA 2NRZA 2ID1A 4DFMA 2W9BA 2ALZA 2ZH4A 4GXIA 3GILA 4NLKA 4EBJA 2R8HA 1ZQWA 2Y1JA 3EW9A 4RNMA 3KHLA 1D9DA 8ICQA 3FYHA 2XCPA 3RBEA 2UVUA 1S77D 5HRLA 4RQ2A 5KG5A 1V4AA 3GIJA 4JV0A 4M6WB 5J0RA 4P4PA 2ASLA 2BQ3A 8ICXA 3OVAA 2KTQA 5KFSA 5KFYA 3HP6A 2ZJAA 7ICFA 2M2WA 4NKTA 4TUQA 2M2VA 3AU2A 3PVXA 2BKEA 4M6WA 4JUZA 3HW8A 4F4YA 3UQ2A 4ED1A 3OHAA 3BQ0A 5KT7A 3C18A 3H4DA 5KFLA 5KG2A 3E2EA 1UT5A 2ZHBA 2HHUA 4O3RA 5KT3A 1RYSA 4M04A 1JXEA 5EOZA 1ZQLA 4QZAA 9ICUA 2ZJ5A 1UETA 3OJUA 2BR0A 3MABA 4DQSA 2P6RA 9ICPA 4PGXA 2BQUA 4J9KA 4ECUA 4FH3A 4YMOA 4DSIA 2V4QA 3SV4A 1ZQAA 2PI5A 3RB0A 3HIYA 5L1JA 4MF2A 4YMMA 4PGQA 1WCNA 3ZD8A 1MSWD 5KFQA 4P2HA 8ICTA 2JEIA 2KZ3A 9ICVA 5DQIA 1N56A 2W8KA 3THVA 1SKWA 4KITB 4UAYA 3RJEA 4O5KA 5J2IA 1TK8A 2ZHAA 4IQWA 5KG4A 5EWEA 4F93B 4EYHB 4YXJA 1KEJA 4QZHA 4ED3A 3LWLA 2AGQA 1KLNA 2W8LA 5DB8A 1D8YA 9ICAA 2W9MA 4IRKA 4JV2A 5HRGA 3C23A 3RR7A 2HHVA 9ICEA 5KFTA 4O5CA 2NRVA 4PH5A 1T3NA 2O5AA 4DFJA 1ZQNA 2BHNA 4K4HA 5HREA 1KNYA 4M9LA 4FHPA 1HJPA 4R63A 4RPYA 2XY6A 1AROP 1NJWA 3ZDCA 3KHGA 1ZQDA 4DWIA 3TAQA 3JZ0A 4Q44A 4XRHA 2BCVA 2AU0A 1U47A 2XGPA 5DQHA 4NLGA 3MBYA 5DB7A 5DG7A 2UVWA 3GFKB 1T4GA 3RJJA 4P4MA 8ICEA 4NM1A 4X4PA 4NY8A 9ICXA 4R64A 5HMMA 5DQGA 1MIYA 4RWNA 4QZ9A 3N4MB 2ZH6A 2XO7A 4QZIA 4DS4A 1HUOA 1ZQVA 1QSSA 2JEFA 3JPTA 7ICLA 2ZUBA 5L9XA 5DG9A 4ECSA 1XSPA 1WOTA 3OVBA 1X2IA 4Z6FA 5KG7A 4UAZA 3PMLA 3N97B 4X4NA 4LT6A 4Z6EA 3H8WA 4TUSA 4RZRA 5DGAA 5KG0A 2HHWA 4KN7A 3RBDA 1BVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YFK A;  4DF4 A;  1NK4 A;  2J6S A;  4YP3 A;  2AJQ A;  4Z6C A;  5J0Q A;  4DS5 A;  7ICE A;  5DBC A;  3RH4 A;  5DEC A;  2XY5 A;  3KHR A;  4F3O A;  2JEJ A;  3MR5 A;  2BPF A;  2KFN A;  1ZQT A;  4QZC A;  4DEZ A;  5KFG A;  5J2C A;  3MDA A;  4O3N A;  4J9L A;  4F5Q A;  2HHQ A;  4RQ3 A;  3GV7 B;  7ICT A;  8ICC A;  4AT9 B;  2NRX A;  2V4R A;  4I2I A;  4RWP A;  5CB1 A;  9ICC A;  4ECV A;  5F9L A;  3RRG A;  4PHP A;  3V6H A;  2DR7 A;  1SZP A;  2DRA A;  5IIO A;  4AT9 A;  5JUM A;  5KFN A;  2NRT A;  2VAN A;  1BPX A;  1MIV A;  5III A;  1TAU A;  4F4W A;  5J0W A;  3H40 A;  2FLL A;  1SKS A;  4B9M A;  7ICJ A;  1JIH A;  4Q43 A;  1ZQY A;  2ZTD A;  3G6V A;  3C2M A;  4DLG A;  3QZ7 A;  1C7Y A;  2R8I A;  8ICK A;  5HRD A;  3BQ2 A;  1NJY A;  1NK5 A;  3Q8S B;  4XA5 A;  4ECY A;  8ICB A;  3L9D A;  4EBK A;  4X4O A;  2BPC A;  3QEB Z;  1V9P A;  5DBA A;  2DVI A;  4WC6 A;  1JX4 A;  5C5J A;  3C2K A;  7ICS A;  4YR3 A;  1SL2 A;  4M47 A;  3WFP A;  1XU4 A;  2KP7 A;  4ZH4 A;  4J9M A;  1ZQB A;  2DR8 A;  4X5V A;  5F9N A;  3Q8Q B;  3RJI A;  1ZQM A;  3HWT A;  1KFD A;  4IQT A;  4I2D A;  5KFP A;  1TAQ A;  4KMU A;  1A77 A;  4XQ8 A;  4KN4 A;  5J2E A;  4RNO A;  1MC8 A;  3M9M B;  4DL3 A;  8ICZ A;  4X4T A;  2XGQ A;  4QWB A;  3SI8 A;  3GV8 B;  2I9G A;  1UEU A;  2C22 A;  4AT7 A;  4YXM A;  1MQ3 A;  4B9L A;  3PW5 A;  4YN4 A;  1NKC A;  2J6U A;  4X4Q A;  4UBB A;  2ZUC A;  1QSL A;  2VA3 A;  4ATB B;  4KLF A;  2HHP A;  2ZH2 A;  2JEG A;  4KLL A;  1S0M A;  3UQ0 A;  3NTU A;  4QZF A;  4R65 A;  1U49 A;  4I2J A;  3LQC B;  3RTV A;  4ATB A;  2FPL A;  1R8B A;  3GDX A;  4XUS A;  5KG3 A;  3PV8 A;  5DLG A;  5KG6 A;  1QSY A;  5DDM A;  2PXI A;  3RH5 A;  2C2D A;  4BGD A;  5DG8 A;  4ED6 A;  4ED8 A;  1XSN A;  1D9F A;  3OGU A;  5KT6 A;  2KZM A;  1KFS A;  3PO4 A;  3OJS A;  4FBT A;  3V72 A;  5KFU A;  4FHW A;  3HJ1 A;  1ZQJ A;  3V6K A;  5IIJ A;  5CR0 A;  4KLI A;  9ICH A;  3NYB A;  2I1Q A;  3AQL A;  4WBZ A;  3H8S A;  9ICK A;  2HHT A;  4F50 A;  5IIK A;  4QWA A;  3FDS A;  3NGD A;  1JXL A;  4B9S A;  9ICO A;  4PHA A;  3V7L A;  4M9H A;  4F4Z A;  1CEZ A;  4EZ6 A;  4Q45 A;  4I27 A;  1XS9 D;  1ZET A;  9ICT A;  5KFK A;  4E80 A;  8ICN A;  4WC5 A;  1T7P A;  3C2L A;  3PW0 A;  3RB3 A;  1TFY A;  1R89 A;  3UPQ A;  1X9S A;  3HPO A;  4DOC A;  2UVR A;  4ELU A;  4UAW A;  7ICH A;  3JPN A;  1NO5 A;  4RQ0 A;  5KFB A;  4RQ4 A;  2V9W A;  1SL1 A;  4PPX A;  4WBY A;  4I2E A;  4RT3 A;  5KFA A;  2BCQ A;  4DSF A;  4RWO A;  1ZQI A;  1KRP A;  1NKB A;  3UXP A;  4EEY A;  2NRW A;  5KFC A;  5HRH A;  3OSP A;  2DR9 A;  2JZB B;  4O3P A;  4F91 B;  4ECX A;  4ED7 A;  4F5R A;  4KLS A;  7ICP A;  5KFF A;  4YR2 A;  2FMP A;  3OVS A;  1S0N A;  2FLN A;  1L3V A;  4LZD A;  2JZB A;  3ISB A;  2KN7 A;  3Q8M A;  4UQG A;  2F1J A;  2W9A A;  2PI4 A;  3MFH A;  4ECZ A;  4C8O A;  4X4V A;  2M2T A;  4MF8 A;  4KLG A;  3ISD A;  2ATL A;  9ICW A;  7ICN A;  8ICG A;  3WFS C;  1ZQR A;  5DGB A;  5J0P A;  2UVV A;  2R8K A;  3HX0 A;  2GWS A;  1L3U A;  4DQI A;  5KFW A;  3H8J A;  4PHD A;  1RXV A;  4FS2 A;  5D46 A;  5KTQ A;  1NK7 A;  3PW2 A;  2HHX A;  3TAR A;  1KSP A;  4I2H A;  4UBC A;  5IIN A;  4DL5 A;  1UT8 A;  3RB6 A;  1DGS A;  1ZQU A;  8ICP A;  5J2D A;  4RWQ A;  4GC7 A;  2M2U A;  2PBE A;  2BCS A;  9ICQ A;  5J0Y A;  2P66 A;  4EYI B;  4TQS A;  2F1I A;  1DOQ A;  1K1S A;  2Q0Z X;  1X9M A;  4ELV A;  4XQ7 A;  4KLD A;  4JK1 A;  3H39 A;  5J0S A;  4C8M A;  3LWM A;  4B9T A;  3G6X A;  5J2H A;  4J9P A;  2O1P A;  4QZE A;  1B43 A;  1DK3 A;  4BXO B;  2PFP A;  4O5E A;  3RB4 A;  7ICV A;  1UA1 A;  4Q8E A;  3GII A;  2ZH9 A;  4J9S A;  1D8L A;  5L1I A;  3RH6 A;  1N48 A;  4BXO A;  3JPR A;  1Y88 A;  1Q78 A;  4WCW A;  3WFO A;  4FS1 A;  4DQP A;  1XO1 A;  3EPI A;  4RQ8 A;  4CCH A;  1HUZ A;  3MR3 A;  4GXK A;  4GC6 A;  1WCL A;  1NK9 A;  1PX5 A;  4M9J A;  4DLE A;  3BQT A;  3T5K A;  2H5X A;  3B0Y A;  3T5L A;  1NJX A;  2OWO A;  4NXZ A;  4M9N A;  1XC9 A;  1K1Q A;  1JN3 A;  4RPX A;  2KFZ A;  7ICM A;  4O0I A;  1VJ7 A;  2AQ4 A;  4AT7 B;  5KFI A;  3M8R A;  3H7I A;  2ZH3 A;  4RQ5 A;  1S10 A;  2IHN A;  4I2F A;  2HHS A;  1BPE A;  4ED2 A;  4PGY A;  5DED A;  3RR8 A;  4QWC A;  3C1Y A;  3ZDD A;  5HRF A;  2LYH A;  4IR1 A;  3M9N B;  3TQ1 A;  4I2B A;  1ZQK A;  1PZN A;  1TFW A;  1XWL A;  4BWM A;  4QZD A;  2ISP A;  1S0V A;  2RFF A;  3UXN A;  3GV5 B;  5CA7 A;  3MR6 A;  5D4B A;  2P6U A;  5DDY A;  3QE9 Y;  1H38 A;  4YMN A;  4J9Q A;  4RQ1 A;  5CP2 A;  3V7J A;  1ZJM A;  3Q8L A;  2ISO A;  5J2G A;  4F8R A;  5DBB A;  5EWG A;  4DFK A;  1YLQ A;  4FO6 A;  2ZTE A;  1KDH A;  3ETL A;  1KTQ A;  3C5F A;  4ECW A;  5KFR A;  4C8L A;  5HRB A;  4BDP A;  2IHM A;  3G6Y A;  4EBD A;  5HHI A;  1ZQQ A;  9ICF A;  4I2G A;  1BPB A;  2B21 A;  4WC2 A;  8ICU A;  1XSL A;  3PX4 A;  2ZH8 A;  1TFR A;  3B0X A;  4Q8F A;  1R8A A;  5KFD A;  1F5A A;  9ICR A;  4DL2 A;  3IHQ B;  1QLN A;  4RU9 A;  3T5J A;  4EZ9 A;  1JAJ A;  3RAX A;  3WFQ E;  4MFC A;  4JWN A;  3UPS A;  2DR5 A;  2XY7 A;  1LV5 A;  4DL4 A;  1ZQF A;  4QW9 A;  3TFR A;  4LZG A;  5CJ7 A;  4ELT A;  4S3N A;  4FHY A;  1NK8 A;  2BDP A;  2ZJ8 A;  4RNN A;  4WC1 A;  4ECQ A;  3H3A A;  4KLQ A;  8ICY A;  3EPG A;  7ICR A;  1IM4 A;  5KFV A;  5KG1 A;  5J0T A;  3QZ8 A;  2RDJ A;  4K4G A;  5KT2 A;  7ICI A;  1ZYQ A;  1TK0 A;  1SL0 A;  2C28 A;  3AUO A;  4KLH A;  2HVH A;  2PFN A;  4RPZ A;  2IA6 A;  1Q79 A;  3TFS A;  3C1Z A;  3LDA A;  3Q8P B;  4J9N A;  1TKD A;  4C8N A;  2BCU A;  3MGI A;  4F5P A;  4I2A A;  3JPP A;  3GIK A;  1UEV A;  5KFX A;  5CWR A;  8ICJ A;  5HHH A;  3TAP A;  4MEY A;  5J0O A;  1Z00 B;  3UXO A;  2R8J A;  5EWF A;  2C2E A;  4DFP A;  1TK5 A;  2BE3 A;  2ZH5 A;  1SKR A;  5CHG A;  4EBC A;  1ZQX A;  1U4B A;  5KFJ A;  3MR2 A;  2FMQ A;  1Z00 A;  2ZUD A;  4JV1 A;  4TUR A;  4MFF A;  4ECT A;  1OU5 A;  5J2F A;  2DFL A;  2DPJ A;  2PFO A;  5HNK A;  2BGW A;  8ICH A;  4I29 A;  4YG2 A;  5D49 A;  5HP4 A;  3TAN A;  4B9U A;  2WTF A;  5HC9 A;  4DL6 A;  4YD1 A;  3C66 A;  1RPL A;  4DQQ A;  3PX6 A;  4FHV A;  4DL7 A;  8ICS A;  3PR5 B;  1FA0 A;  9ICB A;  2XC9 A;  4TUP A;  8ICW A;  9ICS A;  3WFR E;  2AGP A;  5J0X A;  3TI0 A;  5KT4 A;  3ORY A;  3GQC A;  2IBK A;  9ICL A;  8ICF A;  3H37 A;  2DRB A;  3OSN A;  4EBE A;  1ZQC A;  1CUK A;  1TVA A;  4MEX A;  1R8C A;  4NLZ A;  1ZQH A;  2HVI A;  1L3T A;  5TZV A;  3EZ5 A;  3PX0 A;  3K75 D;  3RJG A;  3PR4 A;  4O3S A;  8ICL A;  3OHB A;  4JWM A;  3LK9 A;  4I2C A;  5J2K A;  4IRD A;  4KTQ A;  1ZQE A;  4F92 B;  2W9C B;  1L3S A;  4C8K A;  1JMS A;  4X0B A;  4E8F A;  5J2J A;  8ICV A;  7ICG A;  4F4X A;  4DSE A;  2IMW P;  4E7X A;  2W9C A;  1NKE A;  3ZD9 A;  4IRC A;  3ISC A;  2MUT B;  9ICG A;  4FH5 A;  4KLO A;  8ICA A;  3SYZ A;  3V7K A;  4B9N A;  4IQU A;  4QZ8 A;  4UB2 A;  4UB5 A;  3V6J A;  2Y1I A;  4UB4 A;  4AT8 B;  2ASJ A;  4I28 A;  2MUT A;  3EWA A;  5J2B A;  4FBU A;  3H4B A;  4ECR A;  4AT8 A;  4ED0 A;  5IIM A;  4K4I A;  4F5O A;  3K4G A;  4LVS A;  2FPM A;  1A76 A;  2Q66 A;  4KLU A;  8ICO A;  9ICI A;  1MIW A;  1BNP A;  2RDI A;  3JPO A;  4X0A A;  3OV7 A;  4WC4 A;  1RYR A;  3JYY A;  3MFI A;  1ZQO A;  1U45 A;  2NRK A;  1BPD A;  2A1J B;  2ZH7 A;  4QW8 A;  2BCR A;  1ZQZ A;  4KLM A;  4X4S A;  5IIL A;  5HR9 A;  5J0U A;  4M0A A;  3RJK A;  3KTQ A;  3H38 A;  3HJ4 A;  1IXR A;  2A1J A;  4IG8 A;  5J2A A;  4DF8 A;  3ZDA A;  1NK6 A;  4UB3 A;  5BOL A;  1ZJN A;  3JPQ A;  4X4R A;  3AQK A;  3IM1 A;  4RUA A;  4NKU A;  2XCA A;  3QEA Z;  2VA2 A;  3RRH A;  1NOM A;  1S97 A;  2PFQ A;  2HW3 A;  2AGO A;  8ICI A;  3JPS A;  4O3Q A;  2FLP A;  3M9O B;  4QWE A;  1ZQP A;  5KFE A;  1S76 D;  5HRK A;  4DOB A;  4R8U B;  4M2Y A;  2DPI A;  5BPC A;  3RJF A;  1JQR A;  4O3O A;  4RQ6 A;  3RJH A;  5F2V O;  1VFG A;  3M8S A;  4QZB A;  1BGX T;  5KT5 A;  1U9L A;  3MDC A;  1TV9 A;  4YCX A;  4R8U A;  4YVZ A;  5L1L A;  5L1K A;  3AU6 A;  1U48 A;  4J9O A;  2C2R A;  1S9F A;  3AQM A;  2BPG A;  1NZP A;  2FPK A;  4IQV A;  3BDP A;  4YQW A;  3PY8 A;  3Q8R B;  1ZQS A;  4UD5 A;  3PW4 A;  3ZDB A;  3KHH A;  3PMN A;  1B22 A;  9ICJ A;  1DK2 A;  7ICU A;  5KFH A;  5DKW A;  4RUC A;  5KFZ A;  3RAQ A;  1BPY A;  4NLN A;  1RZT A;  8ICM A;  1QTM A;  5KFO A;  4DSL A;  2MAX A;  4M5D A;  4UD4 A;  4WC0 A;  4WC3 A;  2ZH1 A;  1X9W A;  4M9G A;  4UB1 A;  3T5H A;  8ICR A;  4O9M A;  2J6T A;  3AQN A;  5J29 A;  4PHE A;  4R66 A;  3BJY A;  3BQ1 A;  5HRI A;  1EXN A;  2KZZ A;  1NJZ A;  2F1H A;  1BNO A;  4G3I A;  4QWD A;  4WC7 A;  4RT2 A;  7ICK A;  3OUY B;  4X4U A;  1BPZ A;  4B9V A;  4GXJ A;  4F4K A;  5DB9 A;  4TQR A;  4DQR A;  3T3F A;  4Z6D A;  3PW7 A;  2M9N A;  1L5U A;  4IR9 A;  3OUY A;  9ICN A;  5KFM A;  4DSK A;  3ZDE A;  3C5G A;  4KLE A;  4BWJ A;  4HYK A;  2R8G A;  4GLX A;  2ASD A;  1S0O A;  4DOA A;  4YD2 A;  7ICO A;  3SV3 A;  1Z3E B;  2BQR A;  2FMS A;  1UA0 A;  4NM2 A;  4F2S A;  4P4O A;  1COO A;  4RQ7 A;  4QZG A;  4J9R A;  4F5N A;  1NK0 A;  5DB6 A;  3EYZ A;  1LB2 B;  3MGH A;  7ICQ A;  5DLF A;  4KLJ A;  1ZQG A;  4E0D A;  3PNC A;  3Q8K A;  4YR0 A;  3SZ2 A;  4KLT A;  4EP7 A;  4FHX A;  1RXW A;  1KFT A;  4DO9 A;  3PO5 A;  2W9B B;  5BOM A;  2ZTC A;  4MFA A;  1MQ2 A;  5HML A;  4F2R A;  3GIM A;  3C21 A;  3HT3 A;  2VA8 A;  4DSJ A;  2AQ0 A;  1T8E A;  9ICM A;  2NRZ A;  2ID1 A;  4DFM A;  2W9B A;  2ALZ A;  2ZH4 A;  4GXI A;  3GIL A;  4NLK A;  4EBJ A;  2R8H A;  1ZQW A;  2Y1J A;  3EW9 A;  4RNM A;  3KHL A;  1D9D A;  8ICQ A;  3FYH A;  2XCP A;  3RBE A;  2UVU A;  1S77 D;  5HRL A;  4RQ2 A;  5KG5 A;  1V4A A;  3GIJ A;  4JV0 A;  4M6W B;  5J0R A;  4P4P A;  2ASL A;  2BQ3 A;  8ICX A;  3OVA A;  2KTQ A;  5KFS A;  5KFY A;  3HP6 A;  2ZJA A;  7ICF A;  2M2W A;  4NKT A;  4TUQ A;  2M2V A;  3AU2 A;  3PVX A;  2BKE A;  4M6W A;  4JUZ A;  3HW8 A;  4F4Y A;  3UQ2 A;  4ED1 A;  3OHA A;  3BQ0 A;  5KT7 A;  3C18 A;  3H4D A;  5KFL A;  5KG2 A;  3E2E A;  1UT5 A;  2ZHB A;  2HHU A;  4O3R A;  5KT3 A;  1RYS A;  4M04 A;  1JXE A;  5EOZ A;  1ZQL A;  4QZA A;  9ICU A;  2ZJ5 A;  1UET A;  3OJU A;  2BR0 A;  3MAB A;  4DQS A;  2P6R A;  9ICP A;  4PGX A;  2BQU A;  4J9K A;  4ECU A;  4FH3 A;  4YMO A;  4DSI A;  2V4Q A;  3SV4 A;  1ZQA A;  2PI5 A;  3RB0 A;  3HIY A;  5L1J A;  4MF2 A;  4YMM A;  4PGQ A;  1WCN A;  3ZD8 A;  1MSW D;  5KFQ A;  4P2H A;  8ICT A;  2JEI A;  2KZ3 A;  9ICV A;  5DQI A;  1N56 A;  2W8K A;  3THV A;  1SKW A;  4KIT B;  4UAY A;  3RJE A;  4O5K A;  5J2I A;  1TK8 A;  2ZHA A;  4IQW A;  5KG4 A;  5EWE A;  4F93 B;  4EYH B;  4YXJ A;  1KEJ A;  4QZH A;  4ED3 A;  3LWL A;  2AGQ A;  1KLN A;  2W8L A;  5DB8 A;  1D8Y A;  9ICA A;  2W9M A;  4IRK A;  4JV2 A;  5HRG A;  3C23 A;  3RR7 A;  2HHV A;  9ICE A;  5KFT A;  4O5C A;  2NRV A;  4PH5 A;  1T3N A;  2O5A A;  4DFJ A;  1ZQN A;  2BHN A;  4K4H A;  5HRE A;  1KNY A;  4M9L A;  4FHP A;  1HJP A;  4R63 A;  4RPY A;  2XY6 A;  1ARO P;  1NJW A;  3ZDC A;  3KHG A;  1ZQD A;  4DWI A;  3TAQ A;  3JZ0 A;  4Q44 A;  4XRH A;  2BCV A;  2AU0 A;  1U47 A;  2XGP A;  5DQH A;  4NLG A;  3MBY A;  5DB7 A;  5DG7 A;  2UVW A;  3GFK B;  1T4G A;  3RJJ A;  4P4M A;  8ICE A;  4NM1 A;  4X4P A;  4NY8 A;  9ICX A;  4R64 A;  5HMM A;  5DQG A;  1MIY A;  4RWN A;  4QZ9 A;  3N4M B;  2ZH6 A;  2XO7 A;  4QZI A;  4DS4 A;  1HUO A;  1ZQV A;  1QSS A;  2JEF A;  3JPT A;  7ICL A;  2ZUB A;  5L9X A;  5DG9 A;  4ECS A;  1XSP A;  1WOT A;  3OVB A;  1X2I A;  4Z6F A;  5KG7 A;  4UAZ A;  3PML A;  3N97 B;  4X4N A;  4LT6 A;  4Z6E A;  3H8W A;  4TUS A;  4RZR A;  5DGA A;  5KG0 A;  2HHW A;  4KN7 A;  3RBD A;  1BVS A; 
#chains in the Genus database with same CATH topology
 1NK4 A;  2J6S A;  7ICE A;  5CEH A;  2XY5 A;  3KHR A;  4F3O A;  3MR5 A;  2ESE A;  1SWV A;  1ZQT A;  4J9L A;  4O3N A;  2EAP A;  4RWP A;  3GV7 B;  5CB1 A;  9ICC A;  4BX9 C;  3V6H A;  2DR7 A;  2DRA A;  5IIO A;  5KFN A;  1MIV A;  4F4W A;  2HBM A;  3H40 A;  2FLL A;  1JIH A;  3G6V A;  4DLG A;  2R8I A;  4N7R A;  5E79 U;  1IG6 A;  3Q8S B;  2BPC A;  4WC6 A;  3C2K A;  3WFP A;  2KP7 A;  3CK6 A;  4QJF B;  5F9N A;  3HWT A;  1KFD A;  1A77 A;  1WWV A;  5ALG A;  2XGQ A;  2AH5 A;  3NKU A;  4RQN A;  4X4Q A;  5EE1 A;  5AI0 A;  3PST A;  2JEG A;  2W11 A;  2LBO A;  2RHF A;  4R65 A;  1RQN A;  3F5A A;  3ERC C;  2PXI A;  2C2D A;  2HN2 A;  2JRZ A;  5DG8 A;  4ED6 A;  3WK4 A;  3HJ1 A;  1ZQJ A;  3NYB A;  5CR0 A;  4KLI A;  2EQY A;  2KKV A;  3H8S A;  4MHV A;  4QWA A;  3FDS A;  4B9S A;  9ICO A;  2F8L A;  3V7L A;  4OAF A;  1MA7 A;  1ED1 A;  5ALK A;  9ICT A;  5KFK A;  1R89 A;  3UPQ A;  1X9S A;  4DOC A;  1OUQ A;  2UVR A;  1D8B A;  4KB6 A;  4UAR A;  2BBJ A;  4RT3 A;  2YQE A;  4DSF A;  1ZQI A;  1Z4O A;  5KNI A;  2NRW A;  2JZB B;  4O3P A;  1YZ7 A;  4F5R A;  4YR2 A;  4P0P A;  2QB0 B;  2FLN A;  3ISB A;  2W9A A;  2F1J A;  4MF8 A;  9ICW A;  1ZQR A;  3HX0 A;  2GWS A;  1RXV A;  4FS2 A;  5D46 A;  2HHX A;  3PW2 A;  1F0M A;  1KSP A;  1M6Y A;  3RB6 A;  3SEN A;  4GC7 A;  2PBE A;  3SQI A;  4RQM A;  2P66 A;  1K5O A;  1Z19 A;  4U6P A;  3E0F A;  3G6X A;  2O1P A;  1B43 A;  3RB4 A;  3IDW A;  1UA1 A;  2ZH9 A;  2HCF A;  5JU5 A;  4WCW A;  5AK5 A;  3MCR A;  3WFO A;  1L6N A;  4DQP A;  1XO1 A;  3EPI A;  4UAV A;  4CCH A;  2YY6 A;  3MR3 A;  1NK9 A;  2F2A B;  3T5L A;  4M9N A;  1NJX A;  4NXZ A;  3PHZ A;  1WWU A;  3AQF A;  1JN3 A;  4NJ8 A;  4NL9 C;  2AXT U;  3WU2 U;  1VJ7 A;  3DDH A;  1JRP A;  3IRU A;  4I2F A;  3QUQ A;  5DED A;  3HKZ F;  5HRF A;  3C1Y A;  3LVW A;  1XWL A;  3UMC A;  3MR6 A;  3AN1 A;  5DDY A;  3WKD A;  4HAI A;  2OYY A;  2W04 A;  1YLQ A;  5EWG A;  4FO6 A;  3ETL A;  2VIX A;  2JV3 A;  3G6Y A;  4EBD A;  9ICF A;  5EE9 A;  1XSL A;  2ZH8 A;  1TFR A;  5AK3 A;  3GZF A;  1L8L A;  1MN8 A;  5AK4 A;  4QW9 A;  4ELT A;  2XID A;  5B66 U;  4FHY A;  4KLQ A;  5KG1 A;  1UQV A;  3BZC A;  4C8N A;  4I2A A;  1UEV A;  5ALH A;  5CWR A;  5HHH A;  3TAP A;  4MEY A;  2KSO A;  3UXO A;  5EWF A;  4EBC A;  4JV1 A;  2CPR A;  2DF4 B;  4O68 A;  2DPJ A;  5AKY A;  1J2N A;  2WAQ C;  8ICH A;  3C66 A;  4DL7 A;  1FA0 A;  3PR5 B;  2XC9 A;  3WFR E;  1L7O A;  9ICL A;  1YT3 A;  3ORY A;  2IBK A;  2DRB A;  2F8K A;  4NLZ A;  1N5X A;  4EEK A;  5TZV A;  2H3Z A;  2IUB A;  1X6I A;  2KK0 A;  3LK9 A;  1ZQE A;  2W9C B;  5AM0 A;  4C8K A;  1JMS A;  1F5S A;  4E8F A;  4OJL A;  4E7X A;  4BUG A;  4IRC A;  3ISC A;  4QZ8 A;  2Y1I A;  2H3Q A;  3TAD A;  3EWA A;  4ECR A;  5AKX A;  3WKC A;  3K4G A;  2FPM A;  1A76 A;  1DRG A;  4KLU A;  2R18 A;  1BNP A;  3OV7 A;  4OJ5 A;  1ZQO A;  1U45 A;  2BCR A;  1ZQZ A;  5HR9 A;  4M0A A;  4K9A A;  3VCB A;  3H38 A;  2JH7 A;  2HBK A;  2Y9T A;  4DF8 A;  4Y2U A;  3ZDA A;  3SMV A;  4X4R A;  1NOM A;  1KN5 A;  3JPS A;  4O3Q A;  2FLP A;  3M9O B;  4PJ0 U;  5A0L A;  4QWE A;  4LEZ A;  4R8U B;  4M2Y A;  2DPI A;  5F2V O;  4RQ6 A;  3SAF A;  3AMZ A;  1U9L A;  4NL9 A;  3AQM A;  2BPG A;  4C4S A;  4IQV A;  3PY8 A;  3PW4 A;  3ZDB A;  3KHH A;  4DCC A;  3H8M A;  4RUC A;  1BPY A;  4DSL A;  4WC3 A;  3PZP A;  3T5H A;  8ICR A;  4PHE A;  5AM5 A;  3BJY A;  3BQ1 A;  3D2S A;  1NJZ A;  1C20 A;  4RT2 A;  4ACO A;  3OUY B;  4X4U A;  4B9V A;  4F4K A;  4NXW A;  1ECW A;  1L5U A;  2R8G A;  2OXO A;  3J81 j;  1XO0 A;  1S0O A;  2BQR A;  1UA0 A;  4P4O A;  1COO A;  1LB2 B;  3IG8 A;  4CRX A;  7ICQ A;  1KW4 A;  4Y2P A;  4E0D A;  3PNC A;  3Q8K A;  2M0N A;  4EP7 A;  3KD3 A;  2W9B B;  3GIM A;  3C21 A;  3HT3 A;  2VA8 A;  4MKP A;  2ALZ A;  5CRX A;  2K60 A;  3GIL A;  3EW9 A;  4RNM A;  4O69 A;  2ZIU A;  8ICQ A;  3FYH A;  5KG5 A;  4JV0 A;  8ICX A;  2KTQ A;  5KFY A;  7ICF A;  2M2V A;  2G0A A;  4JUZ A;  1N5W A;  4ED1 A;  2DKZ A;  3C18 A;  5KFL A;  3E2E A;  3KBB A;  2HHU A;  5KT3 A;  4A8E A;  2ZJ5 A;  2W43 A;  1UET A;  1L7M A;  4DQS A;  3SD7 A;  2W55 A;  3LYS A;  5FP0 A;  4J9K A;  1QH9 A;  5EE0 A;  2V4Q A;  3L3F X;  2PI5 A;  3RB0 A;  2EAN A;  1MSW D;  8ICT A;  3SAH A;  3U26 A;  5DQI A;  4KIT B;  3IP4 B;  4IQW A;  2G06 A;  3D6J A;  4EYH B;  3WKE A;  4YXJ A;  1KL9 A;  4QZH A;  4F72 A;  4IRK A;  2HHV A;  4JLX A;  4PH5 A;  4K4H A;  2BHN A;  3NVZ A;  2EAM A;  4R63 A;  2XY6 A;  3KHG A;  2FI1 A;  3TAQ A;  4DFD A;  4XRH A;  5DG7 A;  3GFK B;  1T4G A;  5AIC A;  4R64 A;  5HMM A;  4RWN A;  4QZ9 A;  4FFD A;  2XO7 A;  4DS4 A;  2JEF A;  2ZUB A;  5DG9 A;  3F2B A;  4LT6 A;  3QU4 A;  4KN7 A;  2WB1 C;  1BVS A;  4C80 A;  4Z6C A;  4DS5 A;  2QLT A;  5ALU A;  3RH4 A;  5DEC A;  3ZI4 A;  3JCF A;  1SV4 A;  4QZC A;  2HHQ A;  1V85 A;  2V4R A;  1Q46 A;  5F9L A;  1UCV A;  2NRT A;  5III A;  3N7P D;  1SKS A;  1ZQQ A;  1X9X A;  2ZTD A;  5HRD A;  1C7Y A;  8ICK A;  3BQ2 A;  1NJY A;  8ICB A;  2WAQ F;  1V9P A;  2DVI A;  1JX4 A;  3QUT A;  2DBY A;  4YR3 A;  4M47 A;  1ZQB A;  2YB1 A;  2DL0 A;  3OHA A;  4AT7 B;  2Q4T A;  4XQ8 A;  8ICZ A;  1MC8 A;  1P7D A;  4YXM A;  3HIL A;  4YN4 A;  2FCL A;  2VA3 A;  4ATB B;  2HBL A;  4KLF A;  2HHP A;  1X40 A;  4KX5 A;  1U49 A;  1SWW A;  3RTV A;  3H0L B;  3NUQ A;  4XUS A;  1V38 A;  3NVW A;  2EZZ A;  1QSY A;  5DDM A;  3RH5 A;  1WYG A;  4BGD A;  2JGA A;  4ED8 A;  1KFS A;  1SIJ A;  2DKX A;  5GTH U;  2K4E A;  5IIJ A;  2I1Q A;  1UPH A;  4F50 A;  1CEZ A;  4OAI Z;  4Q45 A;  1XS9 D;  1X6J A;  3SEI A;  1ZET A;  4E80 A;  3C2L A;  4ELU A;  2E8M A;  2GAF D;  1SL1 A;  4PPX A;  2GA9 D;  1ZD2 P;  2ZIX B;  2W3R A;  1KRP A;  2WF5 A;  4QNL A;  3ONN A;  1DXS A;  3OSP A;  4KLS A;  3OVS A;  2JZB A;  3Q8M A;  2KN7 A;  4UQG A;  4C8O A;  2QB0 A;  4KLG A;  3ISD A;  8ICG A;  3NRW A;  5DGB A;  2B51 A;  1L3U A;  4DQI A;  5KFW A;  3H8J A;  4PHD A;  5KTQ A;  4ZOH C;  2KG5 A;  4DL5 A;  5IIN A;  1ZQU A;  3M1Y A;  3MC1 A;  4TQS A;  3F2D A;  1COK A;  3H39 A;  2A3V A;  3LWM A;  4J9P A;  1DK3 A;  3OWG A;  2RLT A;  5AI8 A;  5ALW A;  3JPR A;  1Q78 A;  1HUZ A;  4GC6 A;  4DLE A;  3BQT A;  2ZXH A;  3B0Y A;  3T5K A;  2OWO A;  2LKY A;  1XC9 A;  4Y2X A;  7ICM A;  2AQ4 A;  2LYA A;  3H7I A;  1DGJ A;  2IOF A;  3I76 A;  4RQ5 A;  1S10 A;  2IHO A;  4O3M A;  4ED2 A;  2MSN A;  4QWC A;  2E8O A;  4IR1 A;  3TQ1 A;  2KVS A;  1RM6 C;  2ISP A;  2CRX A;  4K99 A;  3UXN A;  1IV8 A;  4YMN A;  1SXE A;  4J9Q A;  3KFU F;  5CP2 A;  3V7J A;  3Q8L A;  5J2G A;  1WG8 A;  3UM9 A;  5DBB A;  5KFR A;  5HHI A;  2B21 A;  4WC2 A;  3PX4 A;  3B0X A;  2HOQ A;  4Q8F A;  1R8A A;  3IHQ B;  1RQL A;  5L1M A;  1FFU A;  1JAJ A;  3UPS A;  4JWN A;  4KX3 A;  1ZQF A;  5CJ7 A;  4S3N A;  3M6K A;  1NK8 A;  2OEH A;  2ZJ8 A;  4EX7 A;  4WC1 A;  8ICY A;  7ICR A;  1IM4 A;  5KFV A;  4K4G A;  5KT2 A;  1TK0 A;  3AUO A;  3F5E A;  4KLH A;  2PFN A;  4RPZ A;  3LDA A;  2BCU A;  4J9N A;  4NWI A;  2W7P A;  3JPP A;  3BS5 B;  2W7O A;  5J0O A;  1Z00 B;  4F71 A;  1SKR A;  5KFJ A;  2YN4 A;  2ZUD A;  2PFO A;  2BGW A;  4I29 A;  4YG2 A;  5HP4 A;  3UMB A;  5HC9 A;  2WTF A;  1TAM A;  4DL6 A;  4DQQ A;  4FHV A;  1FIQ A;  8ICW A;  2WB1 F;  2HMX A;  1ZQC A;  1CUK A;  3K1Z A;  4AYB F;  1RDF A;  3RJG A;  3PX0 A;  4O3S A;  8ICL A;  3CYM A;  3OHB A;  3TAD C;  4KMO B;  5J2K A;  2HOI A;  1L3S A;  1ZD4 A;  1J2M A;  2W9C A;  3ZD9 A;  2MUT B;  3PSP A;  3SYZ A;  4B9N A;  4IQU A;  4ED0 A;  4F5O A;  1Q3V A;  9ICI A;  2RDI A;  3OPX A;  3JPO A;  4X0A A;  4WC4 A;  1RYR A;  4GFJ A;  3AQE A;  2A1J B;  4QW8 A;  5J0U A;  4IG8 A;  1IXR A;  5J2A A;  1NNL A;  3JPQ A;  4NKU A;  2VA2 A;  3RRH A;  2OHF A;  2HW3 A;  2O6K A;  2KJ8 A;  4DOB A;  1VFG A;  4O3O A;  3M8S A;  2KIC A;  1TV9 A;  3EF2 A;  4YCX A;  4R8U A;  1U48 A;  1SGG A;  4IS7 A;  5K4L A;  2E1F A;  3BZK A;  1DK2 A;  2W3S A;  5DKW A;  5JTG A;  8ICM A;  4UB8 U;  4WC0 A;  2ZH1 A;  1X9W A;  4M9G A;  4UB1 A;  2BZF A;  4O9M A;  2J6T A;  2KNJ A;  2K8A A;  2KE7 A;  2KZZ A;  1BNO A;  3HJE A;  4QWD A;  4G3I A;  1PVR A;  4GXJ A;  2W54 A;  5DB9 A;  4Z6D A;  5AKJ A;  3OUY A;  5AM3 A;  4DSK A;  3ZDE A;  4BWJ A;  4HYK A;  2ASD A;  2XIC A;  7ICO A;  3SV3 A;  2E3T A;  3NVO A;  2FMS A;  4NM2 A;  4F5N A;  5ALQ A;  2LI6 A;  5DLF A;  1WUD A;  4KLJ A;  3L4P A;  5AIA A;  3SZ2 A;  4AP9 A;  2ZTC A;  4FZN A;  4F2R A;  1YZ6 A;  4DSJ A;  2NRZ A;  4DFM A;  2W9B A;  2R8H A;  1ZQW A;  3KHL A;  8ICS A;  2DWQ A;  4OJ6 A;  4RQ2 A;  3WFQ E;  4M6W B;  5J0R A;  2K89 A;  1NZB A;  2BQ3 A;  3PVX A;  2BKE A;  3HW8 A;  3UQ2 A;  4C0Z A;  1S8O A;  2FE9 A;  3H4D A;  5KG2 A;  2IOF K;  2ZHB A;  2DGZ A;  4M04 A;  1JXE A;  5H2F U;  5EOZ A;  1ZQL A;  5B3Q A;  4QZA A;  4NXU A;  2BR0 A;  2K8B B;  9ICP A;  2QB1 A;  1SXD A;  2BQU A;  4DSI A;  3L5K A;  4MF2 A;  2JXJ A;  1HIW A;  5KFQ A;  2KZ3 A;  4USA A;  3RJE A;  4O5K A;  4CGZ A;  4F93 B;  1O03 A;  1KEJ A;  4ED3 A;  2AGQ A;  1B4F A;  2W9M A;  1X42 A;  1T3Q A;  3C23 A;  9ICE A;  5KFT A;  1T3N A;  5ALS A;  5HRE A;  2Z7J A;  3ZDC A;  3I28 A;  4DWI A;  1ZRM A;  2QAR B;  1U47 A;  3MBY A;  3RJJ A;  3N7R C;  4X4P A;  3SAG A;  5AM1 A;  2GOL A;  1MIY A;  3N4M B;  1CI4 A;  4QZI A;  1QSS A;  2BDU A;  3OVB A;  2F44 A;  1XSP A;  4ECS A;  5AHX A;  1WOT A;  1X2I A;  4Z6F A;  3PML A;  3N97 B;  4LEV A;  4TUS A;  5DGA A;  2KEY A;  5ALJ A;  2HHW A;  2HSZ A;  4DF4 A;  4YP3 A;  5J0Q A;  5B3P A;  5DBC A;  2JEJ A;  2YML A;  2H3V A;  4XJE A;  2NO5 A;  4OAH A;  5J2C A;  4F5Q A;  4J03 A;  1PVQ A;  2IOH A;  4RQ3 A;  4AT9 B;  1TFY A;  4I2I A;  4ECV A;  4PHP A;  4NV0 A;  2KJ5 A;  2VAN A;  5AI6 A;  5AKG A;  1TAU A;  5ALE A;  4B9M A;  7ICJ A;  2KHV A;  3C2M A;  2MA1 A;  4EBK A;  4ECY A;  3L9D A;  5DBA A;  2GO7 A;  5C5J A;  1A0P A;  2I5H A;  2LMR A;  4NLC A;  1XU4 A;  2DR8 A;  4ZH4 A;  1FO4 A;  4OAG A;  4PZO A;  3RJI A;  2C2E A;  5J2E A;  5KFP A;  4I2D A;  4KMU A;  1TAQ A;  3MR2 A;  3M9M B;  5CFS A;  4KN4 A;  3SI8 A;  3GV8 B;  2I9G A;  2C22 A;  4AT7 A;  1MQ3 A;  2J6U A;  1NKC A;  4UBB A;  2ZUC A;  1QSL A;  4Y2V A;  2ZH2 A;  4KLL A;  4QZF A;  3LQC B;  4ATB A;  2FPL A;  1Z4N A;  1R8B A;  4GIB A;  2EDU A;  3EUB 2;  5DLG A;  5KG6 A;  1D9F A;  1XSN A;  3BQ7 A;  2BBH A;  3ER9 B;  5KT6 A;  2KZM A;  4FBT A;  4FHW A;  3OJS A;  5KFU A;  4WBZ A;  2ZG6 A;  4UAS A;  3AQL A;  3WK7 A;  4M9H A;  5ALM A;  3ALR A;  4I27 A;  5TIS U;  4C4T A;  4ICA A;  5ALI A;  8ICN A;  2I6X A;  4KM5 A;  3RB3 A;  2OH2 A;  3HPO A;  2B56 A;  1F44 A;  4UAW A;  7ICH A;  2HBJ A;  5ALN A;  3JPN A;  3KKA C;  4RQ0 A;  4NXX A;  2EAO A;  4WBY A;  4NXV A;  4I2E A;  4WQL A;  3IG5 A;  1NKB A;  2ZIX A;  5KFC A;  5HRH A;  3F53 A;  2DR9 A;  1PK1 B;  4ECX A;  4ED7 A;  5KFF A;  2FMP A;  2CXY A;  1L3V A;  1O08 A;  4LZD A;  4UAT A;  4ECZ A;  4X4V A;  2M2T A;  2ATL A;  4CF3 A;  7ICN A;  1RYU A;  5J0P A;  2YMQ A;  1NK7 A;  3TAR A;  5KL8 B;  4I2H A;  2YMM A;  3SR6 A;  8ICP A;  1DGS A;  2RRD A;  5J2D A;  4RWQ A;  3WKA A;  2H3I A;  2B4V A;  4EYI B;  1DOQ A;  1K1S A;  4ELV A;  2PKE A;  4JK1 A;  4WQK A;  4C8M A;  4B9T A;  5GTI U;  4BXO B;  4O5E A;  2XVT A;  5JRT A;  3NAS A;  4Q8E A;  3RH6 A;  1TE2 A;  3E58 A;  4OCZ A;  4FS1 A;  4PL1 A;  4RQ8 A;  3F2C A;  1PX5 A;  3T79 A;  2H5X A;  1B0X A;  2KFZ A;  3QU9 A;  2YX8 A;  2DQN B;  2IHN A;  4PGY A;  3RR8 A;  3ZDD A;  2LYH A;  2VJ5 A;  1TFW A;  2GH1 A;  2LYB A;  3GV5 B;  5CA7 A;  2K8C B;  1X66 A;  4RQ1 A;  2ISO A;  3WK6 A;  4DFK A;  2ZTE A;  1KDH A;  1CRX A;  4ECW A;  4P0Q B;  1V97 A;  4WH5 A;  5ALZ A;  2IHM A;  4K96 A;  2JHD A;  1BPB A;  8ICU A;  2YMP A;  5KFD A;  2YB4 A;  9ICR A;  1F5A A;  5JTI A;  3RAX A;  2HN1 A;  4OJP A;  2XY7 A;  1LV5 A;  2A1A A;  1L7P A;  2E8N A;  3KOO A;  4ECQ A;  3H3A A;  3EPG A;  4K8V A;  5J0T A;  4PZN A;  3QZ8 A;  2RDJ A;  5AKH A;  7ICI A;  1ZYQ A;  2HVH A;  3K7D A;  3C1Z A;  3Q8P B;  1TKD A;  1AQ6 A;  5AKE A;  3GIK A;  5KFX A;  5ALO A;  1JI7 A;  2R8J A;  3DV9 A;  3BS5 A;  5CHG A;  1U4B A;  1ZQX A;  2FMQ A;  1Z00 A;  2JR5 A;  4TUR A;  4MFF A;  5J2F A;  5HNK A;  1JUD A;  1Z1V A;  2B0C A;  5D49 A;  4YD1 A;  3QUC A;  9ICB A;  4TUP A;  9ICS A;  2ZIV B;  5J0X A;  5KT4 A;  3GQC A;  3A0H U;  3HRD D;  3KKA A;  3OSN A;  1R8C A;  1TVA A;  4MEX A;  3RF9 A;  1ZQH A;  1L3T A;  3FM9 A;  1N61 A;  2LM1 A;  4EED A;  1FFV A;  4F92 B;  5J2J A;  7ICG A;  4BJQ A;  2IMW P;  1NKE A;  9ICG A;  3RFA A;  4US9 A;  4KLO A;  8ICA A;  5KAI U;  3V7K A;  4UB5 A;  3V6J A;  4AT8 B;  2ASJ A;  2MUT A;  2ZXI A;  4EX6 A;  4Y2R A;  3H4B A;  4K4I A;  5IIM A;  1QQ6 A;  4LVS A;  5T14 A;  8ICO A;  2A19 A;  1BPD A;  2ZH7 A;  3HJ4 A;  2KKP A;  2A1J A;  2ZIW B;  2Y0S C;  4UB3 A;  4C7Z A;  4RUA A;  2XCA A;  1S97 A;  2PFQ A;  2AGO A;  4QIW C;  5KFE A;  1S76 D;  5ALL A;  3RJF A;  4EGW A;  4QZB A;  1BGX T;  5KT5 A;  5KAF U;  4YVZ A;  5L1L A;  3C29 A;  2C2R A;  1N60 A;  1NZP A;  2FPK A;  3Q8R B;  1ZQS A;  4UD5 A;  5CFT A;  1FEZ A;  9ICJ A;  2HI0 A;  7ICU A;  1LKY B;  5KFZ A;  3RAQ A;  2D3D A;  1RZT A;  1QTM A;  3UMG A;  2KJ9 A;  2NYV A;  1LVH A;  1ZXI A;  5EE3 A;  5J29 A;  4R66 A;  1PUZ A;  1T94 A;  1EXN A;  2KMD A;  2GLE A;  4DQR A;  4TQR A;  3T3F A;  3PW7 A;  5G5H A;  4IR9 A;  9ICN A;  5KFM A;  2EZY A;  4U7C A;  4DOA A;  4YD2 A;  5D62 A;  4F2S A;  4RQ7 A;  4QZG A;  5DB6 A;  3EYZ A;  1ZD3 A;  1ZQG A;  2DUY A;  3M6Z A;  1RXW A;  3PO5 A;  5BOM A;  2G09 A;  1OW5 A;  3AL0 B;  2AQ0 A;  1T8E A;  9ICM A;  2ID1 A;  1N62 A;  2Y1J A;  2LM4 A;  1V4A A;  3RBE A;  2XCP A;  1S77 D;  5HRL A;  3GIJ A;  4P4P A;  4C4R A;  3D2Q A;  2M2W A;  4NKT A;  4TUQ A;  4M6W A;  4F4Y A;  3BQ0 A;  3WK5 A;  5KT7 A;  1SZH A;  1UT5 A;  1RYS A;  1UHU A;  4CF4 A;  1ZQ1 C;  2CN1 A;  3DEE A;  3K1R B;  5AM2 A;  3MAB A;  4EEL A;  4PGX A;  3C28 A;  3IV6 A;  4FH3 A;  1PK3 A;  1N63 A;  3SV4 A;  1ZQA A;  4OO1 J;  5AI5 A;  2KIW A;  5D61 A;  2JEI A;  4OJO A;  2W8K A;  3THV A;  4UAY A;  3NS1 A;  5J2I A;  2ZHA A;  5KG4 A;  5EWE A;  3LWL A;  2W8L A;  5DB8 A;  4CNQ A;  9ICA A;  4WOY A;  4O5C A;  3NVV A;  3QUB A;  3QU2 A;  2O5A A;  4DFJ A;  1ZQN A;  1Q8K A;  4FHP A;  4Y2T A;  1ARO P;  1NJW A;  1ZQD A;  5D63 A;  2AU0 A;  4NLG A;  5DQH A;  5DB7 A;  2KV2 A;  2UVW A;  8ICE A;  4NM1 A;  9ICX A;  5HR6 A;  2QAR A;  2N1R A;  2ZH6 A;  7ICL A;  1HUO A;  2B6G A;  5L9X A;  1SV0 A;  4Z6E A;  2D8C A;  3H8W A;  5KG0 A;  3NWI A;  5F3X B;  3RBD A;  3H0M B;  4YFK A;  2AJQ A;  2WF8 A;  1OXJ A;  2BPF A;  2KFN A;  4EEB A;  2E8P A;  5ALD A;  4DEZ A;  5KFG A;  3MDA A;  7ICT A;  2KIV A;  8ICC A;  2NRX A;  3RRG A;  1SZP A;  1ZRN A;  4AT9 A;  5JUM A;  2WF7 A;  1BPX A;  2WF9 A;  5J0W A;  4NXT A;  4FZM A;  4Q43 A;  1ZQY A;  2P35 A;  3QZ7 A;  2D6F C;  1NK5 A;  4X4O A;  4XA5 A;  3QEB Z;  7ICS A;  1SL2 A;  4J9M A;  2HOF A;  4X5V A;  3Q8Q B;  1ZQM A;  4IQT A;  3MGH A;  4DL3 A;  4RNO A;  5CFU A;  2LHT A;  4X4T A;  2LPE A;  2W03 A;  4QWB A;  3QU7 A;  1UEU A;  2NV3 A;  3QX7 A;  4B9L A;  3PW5 A;  5ALR A;  3FAH A;  3UQ0 A;  1S0M A;  3NTU A;  4I2J A;  4I0U A;  3TAC B;  4FO1 A;  5ALY A;  3GDX A;  1VJ5 A;  5KG3 A;  3PV8 A;  2NO4 A;  2KOB A;  2AHO B;  2WFA A;  4NLB A;  3AEV A;  2Y9U A;  3OGU A;  3PO4 A;  2K4H A;  3V72 A;  3V6K A;  9ICH A;  3QYP A;  9ICK A;  2HHT A;  5IIK A;  3NGD A;  1JXL A;  2MU2 A;  4PHA A;  3PSI A;  4F4Z A;  2F77 X;  4EZ6 A;  4UB6 U;  4WC5 A;  3CW2 C;  1T7P A;  3MGV A;  3PW0 A;  4CDG A;  3WK8 A;  2Y0S F;  1J97 A;  1NO5 A;  4RQ4 A;  3GU3 A;  5KFB A;  2V9W A;  2BCQ A;  3AM9 A;  5KFA A;  5KL1 B;  4RWO A;  1XNS A;  4O67 A;  3UXP A;  4QIW F;  3WKB A;  3CRX A;  4EEY A;  3R9K A;  4P0P B;  1N2X A;  4F91 B;  7ICP A;  5ALX A;  5AIB A;  1S0N A;  1PK1 A;  2PI4 A;  5J8Y C;  3MFH A;  3WFS C;  3WK9 A;  2R8K A;  2UVV A;  2PMZ C;  4LEY A;  3QNM A;  4UBC A;  1UT8 A;  4K9B A;  2M2U A;  2BCS A;  4JMU A;  5J0Y A;  9ICQ A;  1QQ5 A;  2F1I A;  2Q0Z X;  1X9M A;  4XQ7 A;  4KLD A;  1VDV A;  3N28 A;  5J0S A;  5J2H A;  5AKI A;  1JRO A;  4QZE A;  7ICV A;  2PFP A;  3GII A;  4J9S A;  1D8L A;  5L1I A;  1N48 A;  4BXO A;  1Y88 A;  4GXK A;  1WCL A;  4M9J A;  1K1Q A;  1A6S A;  4RPX A;  4O0I A;  5KFI A;  3M8R A;  3IN5 A;  2EWR A;  2ZH3 A;  1PVP A;  2RP5 A;  2HHS A;  1BPE A;  3I1Y A;  3M9N B;  5AKK A;  4I2B A;  1ZQK A;  1PZN A;  4O6A A;  1KKX A;  4BWM A;  4QZD A;  1S0V A;  2RFF A;  5HR7 A;  5D4B A;  1JAL A;  2P6U A;  3QE9 Y;  1H38 A;  4B6J A;  1ZJM A;  4K98 A;  4F8R A;  2EZX A;  2HDO A;  2JH1 A;  3C5F A;  1KTQ A;  4C8L A;  5HRB A;  4BDP A;  4P0Q A;  4I2G A;  3B9J A;  1L8O A;  1QCK A;  2YTU A;  4DL2 A;  1QLN A;  4RU9 A;  3T5J A;  4EZ9 A;  4MFC A;  2DR5 A;  5AKZ A;  2G5H B;  4DL4 A;  1QQ7 A;  3TFR A;  2E5S A;  4LZG A;  2BDP A;  4RNN A;  2FDR A;  4K97 A;  1NI3 A;  1SL0 A;  2C28 A;  2OCE A;  4JB3 A;  4OD0 A;  3TFS A;  2IA6 A;  1Q79 A;  2KSO B;  3OTQ A;  3MGI A;  4F5P A;  4JLZ A;  3LVV A;  4HX0 A;  8ICJ A;  4DFP A;  4Y2Y A;  1TK5 A;  2BE3 A;  2ZH5 A;  2K4I A;  2E1E A;  4ECT A;  1OU5 A;  2DFL A;  5AKL A;  3TAN A;  4B9U A;  4US8 A;  1RPL A;  3PX6 A;  1SB3 C;  2AGP A;  3TI0 A;  3H37 A;  8ICF A;  4EBE A;  2ZIV A;  1S5L U;  3CNH A;  2HVI A;  3EZ5 A;  2ODG A;  3K75 D;  3PR4 A;  1HEK A;  4JWM A;  4I2C A;  4IRD A;  4KTQ A;  4Y2S A;  2JMG A;  1URJ A;  3NRZ A;  4X0B A;  3FC4 A;  1RG6 A;  5ALV A;  8ICV A;  4F4X A;  4DSE A;  4FH5 A;  2OM6 A;  1ZD5 A;  5J8Y A;  2ES6 A;  2F76 X;  1KQQ A;  4UAU A;  3S6J A;  4UB2 A;  4UB4 A;  4I28 A;  5AI4 A;  1GO3 F;  5J2B A;  4FBU A;  2L5Y A;  4AT8 A;  2Q66 A;  1MIW A;  2VJ4 A;  3JYY A;  4CE6 A;  3MFI A;  2NRK A;  4KLM A;  4X4S A;  5IIL A;  3RJK A;  3KTQ A;  2MRL A;  1NK6 A;  4FE3 A;  4Y2J A;  2FJ6 A;  2G07 A;  1L7N A;  5BOL A;  1ZJN A;  2ZIW A;  3AQK A;  3IM1 A;  3ED5 A;  3QEA Z;  5AK6 A;  8ICI A;  3TKA A;  2F3N A;  3PSF A;  5AM4 A;  1ZQP A;  5HRK A;  5BPC A;  1JQR A;  3RJH A;  3ICX A;  4IL6 U;  5ALP A;  3MDC A;  3AU6 A;  4AYB C;  5L1K A;  4J9O A;  4PL2 A;  1S9F A;  4CF5 A;  4EV6 A;  3BDP A;  4YQW A;  3PMN A;  1B22 A;  1VLB A;  3N7S C;  5KFH A;  2WF6 A;  3A0B U;  4NLN A;  4UD4 A;  5KFO A;  2MAX A;  4M5D A;  1LKY A;  3KZX A;  3QU5 A;  3AQN A;  5HRI A;  4WJ3 B;  3NVY A;  2F1H A;  4WC7 A;  1Z1B A;  7ICK A;  1BPZ A;  5B5E U;  2M9N A;  5AI9 A;  3C5G A;  4KLE A;  1ZOL A;  4GLX A;  1Z3E B;  4Y2Q A;  4J9R A;  1NK0 A;  3VC8 A;  5ALT A;  2G08 A;  2WHE A;  3ER8 C;  3ETR A;  3KZI U;  4YR0 A;  4KLT A;  4FHX A;  2XI9 A;  1KFT A;  4DO9 A;  9ICU A;  1MQ2 A;  4MFA A;  2PMZ F;  5HML A;  2ZIU B;  5CHE A;  2ZH4 A;  3HKZ C;  4GXI A;  4EBJ A;  4NLK A;  3M7D A;  1D9D A;  2UVU A;  3OVA A;  2ASL A;  4UW9 A;  4C7Y A;  5KFS A;  3HP6 A;  2ZJA A;  3O0F A;  3AU2 A;  2G5I B;  5ALF A;  4O3R A;  4LEW A;  2K4P A;  2KHQ A;  3D2N A;  3OJU A;  4EEN A;  2P6R A;  4FZL A;  1GPJ A;  2QKQ A;  4ECU A;  4LJX A;  4YMO A;  3H0R B;  3HIY A;  5L1J A;  2KVC A;  4YMM A;  4PGQ A;  1WCN A;  3ZD8 A;  4P2H A;  9ICV A;  3BS7 A;  1N56 A;  1SKW A;  2RQ5 A;  4IC9 A;  1TK8 A;  1KBU A;  1KLN A;  1D8Y A;  4JV2 A;  5HRG A;  3RR7 A;  2NRV A;  2H3F A;  4G9B A;  1KNY A;  4M9L A;  5C0Y A;  1HJP A;  2EH9 A;  3QXG A;  4RPY A;  2VKQ A;  3JZ0 A;  1SV0 C;  4Q44 A;  2KD1 A;  2BCV A;  2XGP A;  4P4M A;  4NY8 A;  5DQG A;  1ZQV A;  1Q3U A;  3JPT A;  3CP8 A;  5G5G A;  5KG7 A;  4UAZ A;  4X4N A;  4RZR A;  1IIP A; 
#chains in the Genus database with same CATH homology
 4YFK A;  4DF4 A;  1NK4 A;  2J6S A;  4YP3 A;  2AJQ A;  4Z6C A;  5J0Q A;  4DS5 A;  7ICE A;  5DBC A;  3RH4 A;  5DEC A;  2XY5 A;  3KHR A;  4F3O A;  2JEJ A;  3MR5 A;  2BPF A;  2KFN A;  1ZQT A;  4QZC A;  4DEZ A;  5KFG A;  5J2C A;  3MDA A;  4O3N A;  4J9L A;  4F5Q A;  2HHQ A;  4RQ3 A;  3GV7 B;  7ICT A;  8ICC A;  4AT9 B;  2NRX A;  2V4R A;  4I2I A;  4RWP A;  5CB1 A;  9ICC A;  4ECV A;  5F9L A;  3RRG A;  4PHP A;  3V6H A;  2DR7 A;  1SZP A;  2DRA A;  5IIO A;  4AT9 A;  5JUM A;  5KFN A;  2NRT A;  2VAN A;  1BPX A;  1MIV A;  5III A;  1TAU A;  4F4W A;  5J0W A;  3H40 A;  2FLL A;  1SKS A;  4B9M A;  7ICJ A;  1JIH A;  4Q43 A;  1ZQY A;  2ZTD A;  3G6V A;  3C2M A;  4DLG A;  3QZ7 A;  1C7Y A;  2R8I A;  8ICK A;  5HRD A;  3BQ2 A;  1NJY A;  1NK5 A;  3Q8S B;  4XA5 A;  4ECY A;  8ICB A;  3L9D A;  4EBK A;  4X4O A;  2BPC A;  3QEB Z;  1V9P A;  5DBA A;  2DVI A;  4WC6 A;  1JX4 A;  5C5J A;  3C2K A;  7ICS A;  4YR3 A;  1SL2 A;  4M47 A;  3WFP A;  1XU4 A;  2KP7 A;  4ZH4 A;  4J9M A;  1ZQB A;  2DR8 A;  4X5V A;  5F9N A;  3Q8Q B;  3RJI A;  1ZQM A;  3HWT A;  1KFD A;  4IQT A;  4I2D A;  5KFP A;  1TAQ A;  4KMU A;  1A77 A;  4XQ8 A;  4KN4 A;  5J2E A;  4RNO A;  1MC8 A;  3M9M B;  4DL3 A;  8ICZ A;  4X4T A;  2XGQ A;  4QWB A;  3SI8 A;  3GV8 B;  2I9G A;  1UEU A;  2C22 A;  4AT7 A;  4YXM A;  1MQ3 A;  4B9L A;  3PW5 A;  4YN4 A;  1NKC A;  2J6U A;  4X4Q A;  4UBB A;  2ZUC A;  1QSL A;  2VA3 A;  4ATB B;  4KLF A;  2HHP A;  2ZH2 A;  2JEG A;  4KLL A;  1S0M A;  3UQ0 A;  3NTU A;  4QZF A;  4R65 A;  1U49 A;  4I2J A;  3LQC B;  3RTV A;  4ATB A;  2FPL A;  1R8B A;  3GDX A;  4XUS A;  5KG3 A;  3PV8 A;  5DLG A;  5KG6 A;  1QSY A;  5DDM A;  2PXI A;  3RH5 A;  2C2D A;  4BGD A;  5DG8 A;  4ED6 A;  4ED8 A;  1XSN A;  1D9F A;  3OGU A;  5KT6 A;  2KZM A;  1KFS A;  3PO4 A;  3OJS A;  4FBT A;  3V72 A;  5KFU A;  4FHW A;  3HJ1 A;  1ZQJ A;  3V6K A;  5IIJ A;  5CR0 A;  4KLI A;  9ICH A;  3NYB A;  2I1Q A;  3AQL A;  4WBZ A;  3H8S A;  9ICK A;  2HHT A;  4F50 A;  5IIK A;  4QWA A;  3FDS A;  3NGD A;  1JXL A;  4B9S A;  9ICO A;  4PHA A;  3V7L A;  4M9H A;  4F4Z A;  1CEZ A;  4EZ6 A;  4Q45 A;  4I27 A;  1XS9 D;  1ZET A;  9ICT A;  5KFK A;  4E80 A;  8ICN A;  4WC5 A;  1T7P A;  3C2L A;  3PW0 A;  3RB3 A;  1TFY A;  1R89 A;  3UPQ A;  1X9S A;  3HPO A;  4DOC A;  2UVR A;  4ELU A;  4UAW A;  7ICH A;  3JPN A;  1NO5 A;  4RQ0 A;  5KFB A;  4RQ4 A;  2V9W A;  1SL1 A;  4PPX A;  4WBY A;  4I2E A;  4RT3 A;  5KFA A;  2BCQ A;  4DSF A;  4RWO A;  1ZQI A;  1KRP A;  1NKB A;  3UXP A;  4EEY A;  2NRW A;  5KFC A;  5HRH A;  3OSP A;  2DR9 A;  2JZB B;  4O3P A;  4F91 B;  4ECX A;  4ED7 A;  4F5R A;  4KLS A;  7ICP A;  5KFF A;  4YR2 A;  2FMP A;  3OVS A;  1S0N A;  2FLN A;  1L3V A;  4LZD A;  2JZB A;  3ISB A;  2KN7 A;  3Q8M A;  4UQG A;  2F1J A;  2W9A A;  2PI4 A;  3MFH A;  4ECZ A;  4C8O A;  4X4V A;  2M2T A;  4MF8 A;  4KLG A;  3ISD A;  2ATL A;  9ICW A;  7ICN A;  8ICG A;  3WFS C;  1ZQR A;  5DGB A;  5J0P A;  2UVV A;  2R8K A;  3HX0 A;  2GWS A;  1L3U A;  4DQI A;  5KFW A;  3H8J A;  4PHD A;  1RXV A;  4FS2 A;  5D46 A;  5KTQ A;  1NK7 A;  3PW2 A;  2HHX A;  3TAR A;  1KSP A;  4I2H A;  4UBC A;  5IIN A;  4DL5 A;  1UT8 A;  3RB6 A;  1DGS A;  1ZQU A;  8ICP A;  5J2D A;  4RWQ A;  4GC7 A;  2M2U A;  2PBE A;  2BCS A;  9ICQ A;  5J0Y A;  2P66 A;  4EYI B;  4TQS A;  2F1I A;  1DOQ A;  1K1S A;  2Q0Z X;  1X9M A;  4ELV A;  4XQ7 A;  4KLD A;  4JK1 A;  3H39 A;  5J0S A;  4C8M A;  3LWM A;  4B9T A;  3G6X A;  5J2H A;  4J9P A;  2O1P A;  4QZE A;  1B43 A;  1DK3 A;  4BXO B;  2PFP A;  4O5E A;  3RB4 A;  7ICV A;  1UA1 A;  4Q8E A;  3GII A;  2ZH9 A;  4J9S A;  1D8L A;  5L1I A;  3RH6 A;  1N48 A;  4BXO A;  3JPR A;  1Y88 A;  1Q78 A;  4WCW A;  3WFO A;  4FS1 A;  4DQP A;  1XO1 A;  3EPI A;  4RQ8 A;  4CCH A;  1HUZ A;  3MR3 A;  4GXK A;  4GC6 A;  1WCL A;  1NK9 A;  1PX5 A;  4M9J A;  4DLE A;  3BQT A;  3T5K A;  2H5X A;  3B0Y A;  3T5L A;  1NJX A;  2OWO A;  4NXZ A;  4M9N A;  1XC9 A;  1K1Q A;  1JN3 A;  4RPX A;  2KFZ A;  7ICM A;  4O0I A;  1VJ7 A;  2AQ4 A;  4AT7 B;  5KFI A;  3M8R A;  3H7I A;  2ZH3 A;  4RQ5 A;  1S10 A;  2IHN A;  4I2F A;  2HHS A;  1BPE A;  4ED2 A;  4PGY A;  5DED A;  3RR8 A;  4QWC A;  3C1Y A;  3ZDD A;  5HRF A;  2LYH A;  4IR1 A;  3M9N B;  3TQ1 A;  4I2B A;  1ZQK A;  1PZN A;  1TFW A;  1XWL A;  4BWM A;  4QZD A;  2ISP A;  1S0V A;  2RFF A;  3UXN A;  3GV5 B;  5CA7 A;  3MR6 A;  5D4B A;  2P6U A;  5DDY A;  3QE9 Y;  1H38 A;  4YMN A;  4J9Q A;  4RQ1 A;  5CP2 A;  3V7J A;  1ZJM A;  3Q8L A;  2ISO A;  5J2G A;  4F8R A;  5DBB A;  5EWG A;  4DFK A;  1YLQ A;  4FO6 A;  2ZTE A;  1KDH A;  3ETL A;  1KTQ A;  3C5F A;  4ECW A;  5KFR A;  4C8L A;  5HRB A;  4BDP A;  2IHM A;  3G6Y A;  4EBD A;  5HHI A;  1ZQQ A;  9ICF A;  4I2G A;  1BPB A;  2B21 A;  4WC2 A;  8ICU A;  1XSL A;  3PX4 A;  2ZH8 A;  1TFR A;  3B0X A;  4Q8F A;  1R8A A;  5KFD A;  1F5A A;  9ICR A;  4DL2 A;  3IHQ B;  1QLN A;  4RU9 A;  3T5J A;  4EZ9 A;  1JAJ A;  3RAX A;  3WFQ E;  4MFC A;  4JWN A;  3UPS A;  2DR5 A;  2XY7 A;  1LV5 A;  4DL4 A;  1ZQF A;  4QW9 A;  3TFR A;  4LZG A;  5CJ7 A;  4ELT A;  4S3N A;  4FHY A;  1NK8 A;  2BDP A;  2ZJ8 A;  4RNN A;  4WC1 A;  4ECQ A;  3H3A A;  4KLQ A;  8ICY A;  3EPG A;  7ICR A;  1IM4 A;  5KFV A;  5KG1 A;  5J0T A;  3QZ8 A;  2RDJ A;  4K4G A;  5KT2 A;  7ICI A;  1ZYQ A;  1TK0 A;  1SL0 A;  2C28 A;  3AUO A;  4KLH A;  2HVH A;  2PFN A;  4RPZ A;  2IA6 A;  1Q79 A;  3TFS A;  3C1Z A;  3LDA A;  3Q8P B;  4J9N A;  1TKD A;  4C8N A;  2BCU A;  3MGI A;  4F5P A;  4I2A A;  3JPP A;  3GIK A;  1UEV A;  5KFX A;  5CWR A;  8ICJ A;  5HHH A;  3TAP A;  4MEY A;  5J0O A;  1Z00 B;  3UXO A;  2R8J A;  5EWF A;  2C2E A;  4DFP A;  1TK5 A;  2BE3 A;  2ZH5 A;  1SKR A;  5CHG A;  4EBC A;  1ZQX A;  1U4B A;  5KFJ A;  3MR2 A;  2FMQ A;  1Z00 A;  2ZUD A;  4JV1 A;  4TUR A;  4MFF A;  4ECT A;  1OU5 A;  5J2F A;  2DFL A;  2DPJ A;  2PFO A;  5HNK A;  2BGW A;  8ICH A;  4I29 A;  4YG2 A;  5D49 A;  5HP4 A;  3TAN A;  4B9U A;  2WTF A;  5HC9 A;  4DL6 A;  4YD1 A;  3C66 A;  1RPL A;  4DQQ A;  3PX6 A;  4FHV A;  4DL7 A;  8ICS A;  3PR5 B;  1FA0 A;  9ICB A;  2XC9 A;  4TUP A;  8ICW A;  9ICS A;  3WFR E;  2AGP A;  5J0X A;  3TI0 A;  5KT4 A;  3ORY A;  3GQC A;  2IBK A;  9ICL A;  8ICF A;  3H37 A;  2DRB A;  3OSN A;  4EBE A;  1ZQC A;  1CUK A;  1TVA A;  4MEX A;  1R8C A;  4NLZ A;  1ZQH A;  2HVI A;  1L3T A;  5TZV A;  3EZ5 A;  3PX0 A;  3K75 D;  3RJG A;  3PR4 A;  4O3S A;  8ICL A;  3OHB A;  4JWM A;  3LK9 A;  4I2C A;  5J2K A;  4IRD A;  4KTQ A;  1ZQE A;  4F92 B;  2W9C B;  1L3S A;  4C8K A;  1JMS A;  4X0B A;  4E8F A;  5J2J A;  8ICV A;  7ICG A;  4F4X A;  4DSE A;  2IMW P;  4E7X A;  2W9C A;  1NKE A;  3ZD9 A;  4IRC A;  3ISC A;  2MUT B;  9ICG A;  4FH5 A;  4KLO A;  8ICA A;  3SYZ A;  3V7K A;  4B9N A;  4IQU A;  4QZ8 A;  4UB2 A;  4UB5 A;  3V6J A;  2Y1I A;  4UB4 A;  4AT8 B;  2ASJ A;  4I28 A;  2MUT A;  3EWA A;  5J2B A;  4FBU A;  3H4B A;  4ECR A;  4AT8 A;  4ED0 A;  5IIM A;  4K4I A;  4F5O A;  3K4G A;  4LVS A;  2FPM A;  1A76 A;  2Q66 A;  4KLU A;  8ICO A;  9ICI A;  1MIW A;  1BNP A;  2RDI A;  3JPO A;  4X0A A;  3OV7 A;  4WC4 A;  1RYR A;  3JYY A;  3MFI A;  1ZQO A;  1U45 A;  2NRK A;  1BPD A;  2A1J B;  2ZH7 A;  4QW8 A;  2BCR A;  1ZQZ A;  4KLM A;  4X4S A;  5IIL A;  5HR9 A;  5J0U A;  4M0A A;  3RJK A;  3KTQ A;  3H38 A;  3HJ4 A;  1IXR A;  2A1J A;  4IG8 A;  5J2A A;  4DF8 A;  3ZDA A;  1NK6 A;  4UB3 A;  5BOL A;  1ZJN A;  3JPQ A;  4X4R A;  3AQK A;  3IM1 A;  4RUA A;  4NKU A;  2XCA A;  3QEA Z;  2VA2 A;  3RRH A;  1NOM A;  1S97 A;  2PFQ A;  2HW3 A;  2AGO A;  8ICI A;  3JPS A;  4O3Q A;  2FLP A;  3M9O B;  4QWE A;  1ZQP A;  5KFE A;  1S76 D;  5HRK A;  4DOB A;  4R8U B;  4M2Y A;  2DPI A;  5BPC A;  3RJF A;  1JQR A;  4O3O A;  4RQ6 A;  3RJH A;  5F2V O;  1VFG A;  3M8S A;  4QZB A;  1BGX T;  5KT5 A;  1U9L A;  3MDC A;  1TV9 A;  4YCX A;  4R8U A;  4YVZ A;  5L1L A;  5L1K A;  3AU6 A;  1U48 A;  4J9O A;  2C2R A;  1S9F A;  3AQM A;  2BPG A;  1NZP A;  2FPK A;  4IQV A;  3BDP A;  4YQW A;  3PY8 A;  3Q8R B;  1ZQS A;  4UD5 A;  3PW4 A;  3ZDB A;  3KHH A;  3PMN A;  1B22 A;  9ICJ A;  1DK2 A;  7ICU A;  5KFH A;  5DKW A;  4RUC A;  5KFZ A;  3RAQ A;  1BPY A;  4NLN A;  1RZT A;  8ICM A;  1QTM A;  5KFO A;  4DSL A;  2MAX A;  4M5D A;  4UD4 A;  4WC0 A;  4WC3 A;  2ZH1 A;  1X9W A;  4M9G A;  4UB1 A;  3T5H A;  8ICR A;  4O9M A;  2J6T A;  3AQN A;  5J29 A;  4PHE A;  4R66 A;  3BJY A;  3BQ1 A;  5HRI A;  1EXN A;  2KZZ A;  1NJZ A;  2F1H A;  1BNO A;  4G3I A;  4QWD A;  4WC7 A;  4RT2 A;  7ICK A;  3OUY B;  4X4U A;  1BPZ A;  4B9V A;  4GXJ A;  4F4K A;  5DB9 A;  4TQR A;  4DQR A;  3T3F A;  4Z6D A;  3PW7 A;  2M9N A;  1L5U A;  4IR9 A;  3OUY A;  9ICN A;  5KFM A;  4DSK A;  3ZDE A;  3C5G A;  4KLE A;  4BWJ A;  4HYK A;  2R8G A;  4GLX A;  2ASD A;  1S0O A;  4DOA A;  4YD2 A;  7ICO A;  3SV3 A;  1Z3E B;  2BQR A;  2FMS A;  1UA0 A;  4NM2 A;  4F2S A;  4P4O A;  1COO A;  4RQ7 A;  4QZG A;  4J9R A;  4F5N A;  1NK0 A;  5DB6 A;  3EYZ A;  1LB2 B;  3MGH A;  7ICQ A;  5DLF A;  4KLJ A;  1ZQG A;  4E0D A;  3PNC A;  3Q8K A;  4YR0 A;  3SZ2 A;  4KLT A;  4EP7 A;  4FHX A;  1RXW A;  1KFT A;  4DO9 A;  3PO5 A;  2W9B B;  5BOM A;  2ZTC A;  4MFA A;  1MQ2 A;  5HML A;  4F2R A;  3GIM A;  3C21 A;  3HT3 A;  2VA8 A;  4DSJ A;  2AQ0 A;  1T8E A;  9ICM A;  2NRZ A;  2ID1 A;  4DFM A;  2W9B A;  2ALZ A;  2ZH4 A;  4GXI A;  3GIL A;  4NLK A;  4EBJ A;  2R8H A;  1ZQW A;  2Y1J A;  3EW9 A;  4RNM A;  3KHL A;  1D9D A;  8ICQ A;  3FYH A;  2XCP A;  3RBE A;  2UVU A;  1S77 D;  5HRL A;  4RQ2 A;  5KG5 A;  1V4A A;  3GIJ A;  4JV0 A;  4M6W B;  5J0R A;  4P4P A;  2ASL A;  2BQ3 A;  8ICX A;  3OVA A;  2KTQ A;  5KFS A;  5KFY A;  3HP6 A;  2ZJA A;  7ICF A;  2M2W A;  4NKT A;  4TUQ A;  2M2V A;  3AU2 A;  3PVX A;  2BKE A;  4M6W A;  4JUZ A;  3HW8 A;  4F4Y A;  3UQ2 A;  4ED1 A;  3OHA A;  3BQ0 A;  5KT7 A;  3C18 A;  3H4D A;  5KFL A;  5KG2 A;  3E2E A;  1UT5 A;  2ZHB A;  2HHU A;  4O3R A;  5KT3 A;  1RYS A;  4M04 A;  1JXE A;  5EOZ A;  1ZQL A;  4QZA A;  9ICU A;  2ZJ5 A;  1UET A;  3OJU A;  2BR0 A;  3MAB A;  4DQS A;  2P6R A;  9ICP A;  4PGX A;  2BQU A;  4J9K A;  4ECU A;  4FH3 A;  4YMO A;  4DSI A;  2V4Q A;  3SV4 A;  1ZQA A;  2PI5 A;  3RB0 A;  3HIY A;  5L1J A;  4MF2 A;  4YMM A;  4PGQ A;  1WCN A;  3ZD8 A;  1MSW D;  5KFQ A;  4P2H A;  8ICT A;  2JEI A;  2KZ3 A;  9ICV A;  5DQI A;  1N56 A;  2W8K A;  3THV A;  1SKW A;  4KIT B;  4UAY A;  3RJE A;  4O5K A;  5J2I A;  1TK8 A;  2ZHA A;  4IQW A;  5KG4 A;  5EWE A;  4F93 B;  4EYH B;  4YXJ A;  1KEJ A;  4QZH A;  4ED3 A;  3LWL A;  2AGQ A;  1KLN A;  2W8L A;  5DB8 A;  1D8Y A;  9ICA A;  2W9M A;  4IRK A;  4JV2 A;  5HRG A;  3C23 A;  3RR7 A;  2HHV A;  9ICE A;  5KFT A;  4O5C A;  2NRV A;  4PH5 A;  1T3N A;  2O5A A;  4DFJ A;  1ZQN A;  2BHN A;  4K4H A;  5HRE A;  1KNY A;  4M9L A;  4FHP A;  1HJP A;  4R63 A;  4RPY A;  2XY6 A;  1ARO P;  1NJW A;  3ZDC A;  3KHG A;  1ZQD A;  4DWI A;  3TAQ A;  3JZ0 A;  4Q44 A;  4XRH A;  2BCV A;  2AU0 A;  1U47 A;  2XGP A;  5DQH A;  4NLG A;  3MBY A;  5DB7 A;  5DG7 A;  2UVW A;  3GFK B;  1T4G A;  3RJJ A;  4P4M A;  8ICE A;  4NM1 A;  4X4P A;  4NY8 A;  9ICX A;  4R64 A;  5HMM A;  5DQG A;  1MIY A;  4RWN A;  4QZ9 A;  3N4M B;  2ZH6 A;  2XO7 A;  4QZI A;  4DS4 A;  1HUO A;  1ZQV A;  1QSS A;  2JEF A;  3JPT A;  7ICL A;  2ZUB A;  5L9X A;  5DG9 A;  4ECS A;  1XSP A;  1WOT A;  3OVB A;  1X2I A;  4Z6F A;  5KG7 A;  4UAZ A;  3PML A;  3N97 B;  4X4N A;  4LT6 A;  4Z6E A;  3H8W A;  4TUS A;  4RZR A;  5DGA A;  5KG0 A;  2HHW A;  4KN7 A;  3RBD A;  1BVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...