5J0OA

Binary complex crystal structure of dna polymerase beta with a:a mismatch at the primer terminus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 107
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0oA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0oA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0oA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0oA03
4P4PA 2ASLA 1S0VA 2HHWA 1XSPA 4EBKA 4X4VA 2C2RA 2BCRA 7ICLA 1BNOA 4UAYA 2W9BA 1U47A 1NOMA 4JV0A 1HUOA 3RR8A 1MIVA 3H3AA 8ICMA 4FHPA 1RXVA 3Q8RB 9ICIA 3NGDA 3JPOA 3IM1A 2BR0A 3OHBA 4DL6A 3PW5A 1R89A 1JIHA 4I2JA 4FHWA 2ZH5A 1UEVA 4F91B 5HRKA 2FPLA 4KLEA 5KFRA 3HT3A 3OUYB 4RQ8A 2PFQA 4ED0A 2JEFA 5DDMA 2M2VA 4WC3A 5KFTA 3LWMA 3ISBA 2XY5A 3RBDA 1KFTA 3LDAA 4EBDA 4PHEA 2A1JB 3RB6A 4RPXA 2RDIA 8ICIA 1PZNA 1KSPA 2W8LA 4BWJA 5KFCA 1TVAA 9ICJA 2KZMA 1BGXT 1Z00A 2ZH9A 4K4GA 5KG3A 3Q8KA 1MQ2A 4I2BA 5KFKA 7ICHA 3HWTA 4X0BA 4IQTA 4NM2A 1LV5A 9ICRA 4P4OA 3OSPA 3JPQA 4DL2A 4RU9A 2ZH4A 3C2KA 1DGSA 1TKDA 4S3NA 1YLQA 9ICOA 4YMOA 4FHYA 5KG4A 3EYZA 7ICNA 2ZUBA 5J2IA 1S10A 3GIMA 4X4NA 1ZQMA 2BQUA 2FLPA 4NM1A 4NLZA 4J9NA 1L3SA 4LZDA 1X2IA 5DGBA 3FYHA 4JK1A 3C1ZA 3H4BA 2J6SA 1BPXA 3HJ4A 4RWOA 4X4SA 1JMSA 4ED7A 2HHSA 4G3IA 5KG1A 5J0YA 4GLXA 2PFOA 3MBYA 3PO5A 3RJFA 5KFAA 2OWOA 4TQSA 3ZD8A 4GC6A 2MUTB 3UQ2A 4IRKA 1UEUA 2PXIA 4ED1A 4YR3A 1T7PA 4EBJA 1ZQZA 1UETA 2WTFA 3PX6A 1B22A 4ED3A 1EXNA 2C28A 4B9SA 3RAXA 3EPGA 2BDPA 2DVIA 2R8GA 4I2HA 1XWLA 4R64A 3NTUA 2XO7A 4PH5A 1UT8A 2MUTA 2RDJA 2GWSA 1RXWA 3RRGA 1K1QA 4ATBA 3SV3A 3K4GA 4DSLA 4ECQA 4XA5A 5J2GA 2KFNA 3V6HA 3ZDCA 5DG8A 5J2AA 4DFPA 7ICUA 1FA0A 4QZDA 3GIKA 3PVXA 1H38A 1NJZA 5HRBA 1VJ7A 3V6JA 4F5RA 9ICEA 4FH5A 3LWLA 4KLIA 4RZRA 1ZQSA 1CEZA 2UVWA 1L3TA 5DKWA 4UAWA 3MR5A 8ICSA 2XCAA 4RUCA 4Z6FA 1IM4A 3ZDEA 4QWAA 4GXJA 3T5LA 4YN4A 5KFDA 4EYHB 2R8IA 4F92B 2W9MA 5KG2A 2BCQA 2IHNA 4EZ6A 8ICUA 9ICQA 3L9DA 4AT9B 4X4PA 5KT6A 2KZZA 4HYKA 3K75D 5IIOA 7ICPA 1UA0A 1Q78A 4C8NA 3SV4A 4F4XA 1U49A 4Q8EA 1RYRA 9ICXA 4XQ8A 1JXEA 3MR3A 2V4RA 2FLLA 4FS1A 3BQ1A 2ZH7A 5L1IA 1KDHA 4QZHA 4E7XA 1LB2B 4ECYA 4QZBA 5TZVA 2DPIA 4KLOA 4TUSA 5KT5A 2UVVA 1DOQA 5KFJA 1F5AA 2XGPA 2AGPA 4Q43A 5J0UA 3LK9A 2PBEA 4QWCA 3C2LA 1TFWA 3M8SA 2VANA 1WCLA 1XO1A 4R66A 5KFHA 5DEDA 4J9PA 4ED6A 2ZHBA 2ZTEA 1A77A 3TI0A 1NK4A 2ZH1A 4F5PA 4E8FA 4RUAA 3SZ2A 1ZQGA 5KT3A 1BPBA 2AJQA 2BCVA 5KFEA 3ISDA 3TFSA 3C1YA 4ELVA 3RB3A 8ICEA 1HJPA 4J9QA 5KFQA 4F5OA 3TARA 4JWNA 8ICVA 2NRWA 5DBBA 4C8KA 3TANA 3TAPA 5CB1A 2FLNA 1Z3EB 4QZIA 4PGXA 2FPKA 3N97B 4M9NA 4Q45A 5KFSA 1S76D 8ICWA 5HRFA 4R65A 4EEYA 4GXKA 3Q8LA 1ZQOA 4F3OA 5J29A 1S77D 4IRDA 3AQKA 3KHRA 3PX0A 3GV8B 5DGAA 5DLFA 2M2TA 2KN7A 1U45A 1XU4A 7ICJA 1TK5A 2FMSA 2ZJ5A 5DDYA 3T3FA 3RB4A 1ZQTA 3HW8A 5F2VO 1TAUA 5DBAA 5J0PA 4I2AA 5KFPA 4RQ3A 4FO6A 4DL5A 1MIWA 3EZ5A 2KTQA 2XY6A 4ECTA 4MFCA 3BQ2A 9ICBA 4NXZA 1RYSA 4XQ7A 4NY8A 4WCWA 5IIKA 4K4HA 4M04A 2R8HA 1KFDA 4KMUA 4M9LA 3B0XA 1NKCA 3JZ0A 2DR7A 4QW8A 4QZ9A 5KG6A 4I2CA 4I2EA 1ZQAA 5HP4A 8ICQA 1R8BA 4KLSA 3JPRA 1ZQPA 1ZQYA 4DL7A 1K1SA 2M9NA 1WOTA 4EP7A 4NLKA 1UA1A 3RJHA 2ZUCA 5HREA 3BQ0A 3MR6A 3QEAZ 3T5HA 8ICNA 4RQ0A 2ALZA 4Z6DA 8ICXA 3THVA 2NRZA 4IQVA 1L3UA 1TFRA 3GIJA 4KN4A 2HHXA 2HHTA 5CA7A 4IR1A 2A1JA 2IHMA 3HIYA 2XC9A 4M47A 4Q44A 1U9LA 4ECZA 4C8MA 4PGQA 1COOA 3UPSA 3G6YA 1BPZA 1NK9A 3RR7A 4I2FA 4O5KA 3V6KA 3MGIA 2NRKA 4DS4A 5DQIA 4DO9A 3UXOA 3C5FA 3OUYA 2W9CA 1SKWA 5J0OA 2PI4A 3KTQA 3MFHA 4M0AA 1DK2A 3NYBA 2DRBA 4KITB 2BQRA 3PR4A 1C7YA 4AT8A 3MABA 3TQ1A 3RH6A 5L1JA 1D9DA 5KG7A 2J6UA 4DQIA 3GILA 4QWEA 1T4GA 4MEXA 1U4BA 8ICOA 2ZH3A 1KEJA 2XY7A 2F1JA 5J2CA 4WC7A 3EW9A 4KLDA 2ZJAA 3H40A 4F93B 3C18A 5EOZA 4AT7A 4WC5A 3QZ7A 1ZQWA 1TK0A 1ZQBA 4KLHA 2BKEA 1Y88A 4QZFA 8ICZA 1Z00B 2ZH8A 5D49A 5BOLA 3UPQA 3PW0A 5HMMA 5IILA 1ZYQA 1BVSA 2ZUDA 4MF8A 1QTMA 4MFFA 2HW3A 1D8LA 1V4AA 3GDXA 4DOBA 2JEIA 2AGOA 3WFPA 3GV5B 3H8SA 9ICKA 3PR5B 2P6UA 2H5XA 4Q8FA 1NK8A 9ICMA 2NRXA 5KT2A 5DQGA 5J2BA 5CWRA 4NKUA 3AQNA 5HRDA 4X4RA 3M8RA 1SKSA 2PI5A 4DWIA 7ICQA 4E80A 2F1HA 3G6VA 4DOCA 3MDAA 3TFRA 1NK5A 2KP7A 4QZGA 3GV7B 4O3QA 5DBCA 1SL2A 3ISCA 1BPEA 1TV9A 4NKTA 4X4UA 3ETLA 4DLGA 4UB1A 2AQ4A 1QSSA 3H8WA 1S97A 1MQ3A 4C8OA 4KLFA 4F5QA 9ICPA 7ICVA 5HR9A 5CJ7A 4F5NA 3C23A 4WC1A 4BXOB 1S0MA 9ICLA 4RNMA 2DR5A 4DFMA 2ASDA 4YXMA 4O5CA 2BGWA 4WBZA 3IHQB 3OHAA 4X0AA 4B9NA 1ZQVA 2W9AA 4BXOA 8ICHA 3H38A 4FH3A 4RQ7A 4CCHA 4MFAA 4MEYA 2UVUA 4R8UA 5KFVA 4FBTA 3ORYA 4LZGA 4J9SA 2O5AA 3M9OB 4DOAA 2Y1JA 1NZPA 2XCPA 3BQTA 5L1KA 4F4YA 5D4BA 4DSFA 4NLNA 5IINA 2C22A 4F50A 3QE9Y 4IRCA 7ICFA 3M9MB 4PHDA 1IXRA 4ECWA 1N56A 3H8JA 5HRGA 5KT7A 4WBYA 4RQ2A 3JPSA 4F4WA 4ECXA 3PV8A 4KLMA 1BPDA 1ZQJA 5DG7A 4RQ5A 8ICGA 5KFUA 8ICCA 3GFKB 2R8JA 4DSEA 3JPNA 2BCSA 4UD4A 3WFOA 4O3PA 1QSYA 5DLGA 5HHIA 4DF4A 2V9WA 7ICKA 2ID1A 2ZHAA 4UAZA 1BNPA 1RPLA 3C5GA 1JX4A 4WC0A 2RFFA 3C66A 4I27A 4DEZA 5HNKA 3KHLA 5J2DA 4B9LA 4FS2A 8ICLA 3WFQE 1MSWD 2ZJ8A 5KFOA 3RH4A 9ICFA 4NLGA 9ICHA 2O1PA 2HHQA 4EBEA 2C2EA 3MDCA 2IBKA 2ZH6A 4P2HA 2Q66A 7ICRA 4MF2A 3OV7A 4LVSA 4E0DA 1DK3A 7ICSA 1JN3A 3V7LA 3TAQA 4C8LA 4M9GA 5HRHA 4PGYA 1RZTA 1ZQQA 1MIYA 4DQSA 1Q79A 3H39A 4RQ6A 2KZ3A 4YMMA 2ZTDA 1AROP 4LT6A 5KFNA 3RTVA 4AT7B 1TAQA 4TURA 4P4MA 4UB2A 4AT8B 5J0XA 5J0SA 4J9OA 3HP6A 4J9KA 9ICUA 3PO4A 2DPJA 4KLGA 3WFSC 3OJSA 4F8RA 4DQQA 4J9MA 4R63A 4RPYA 3Q8PB 3RRHA 3M9NB 3AU6A 2JEGA 5DQHA 3MR2A 4YCXA 4UB5A 1JAJA 4EYIB 4Z6CA 4M6WB 4UB4A 3Q8MA 4ATBB 5KFLA 1TK8A 4GXIA 1ZQCA 4YD2A 4B9MA 2BHNA 1XSNA 4R8UB 4X5VA 4B9VA 1ZJMA 2VA2A 3OGUA 4ELTA 8ICAA 4BWMA 1V9PA 2FMPA 4X4QA 4YP3A 3KHGA 3WFRE 3OJUA 1VFGA 2NRVA 1NKBA 3HPOA 4JV1A 5KFYA 4Z6EA 8ICFA 4PHAA 3QEBZ 4RT3A 1NJWA 1ZQKA 3PNCA 4O3OA 5KG5A 1TFYA 3ZDAA 4YMNA 3H37A 3MFIA 5CR0A 3V72A 4O0IA 4I28A 3OSNA 4O9MA 5J2FA 2LYHA 5J2HA 5KFGA 1OU5A 2HHPA 2ZH2A 3RBEA 1T3NA 2BQ3A 4F2RA 3GQCA 1ZQFA 2FMQA 2JEJA 1ZQHA 2IA6A 5KFFA 4RWPA 5KG0A 4BGDA 9ICSA 4FHVA 2ISPA 2AQ0A 4QWDA 1NJXA 9ICWA 4I2DA 3PMLA 4RNNA 2DR9A 4QZCA 2JZBB 2ATLA 1U48A 3Q8QB 1A76A 3Q8SB 5DB7A 8ICPA 5HRLA 9ICGA 3JPPA 4QZEA 3GIIA 4PHPA 5HC9A 4EZ9A 5BPCA 4QW9A 4UD5A 4JWMA 1WCNA 5IIJA 2KFZA 4X4OA 3H4DA 2PFNA 5KFWA 3RJGA 9ICCA 2XGQA 2B21A 5J0WA 4GC7A 3V7JA 3N4MB 2HVIA 7ICEA 3KHHA 2DR8A 3C2MA 1X9SA 4RT2A 1NK0A 4YR0A 4RWQA 2R8KA 1PX5A 1ZQXA 1UT5A 2VA8A 5KFIA 5CHGA 5DB8A 2C2DA 1T8EA 3AUOA 4B9UA 2NRTA 8ICYA 2UVRA 4YFKA 1JQRA 2VA3A 4BDPA 1QSLA 3HX0A 1X9MA 1KFSA 3EWAA 4ZH4A 4B9TA 5L1LA 4M9JA 3OVSA 1S0NA 4IR9A 2HVHA 2HHVA 5C5JA 3H7IA 5J2EA 3G6XA 1ZQDA 4IQWA 3ZD9A 2ASJA 9ICVA 5HRIA 5CP2A 2W9BB 2BE3A 2FPMA 1ZQUA 4M5DA 4DFJA 4F2SA 1SKRA 9ICTA 4DSJA 5KFXA 8ICJA 4RPZA 3UXNA 4TUQA 3UQ0A 4J9LA 1KRPA 5IIMA 3B0YA 5EWFA 1SL1A 2BPFA 4KTQA 7ICMA 2BPCA 2V4QA 2I9GA 4KLQA 1KNYA 3PY8A 2Q0ZX 3C21A 2M2UA 1N48A 4KLTA 3EPIA 4DF8A 8ICKA 4AT9A 5J0TA 5IIIA 3T5KA 4O5EA 1R8AA 5F9NA 5DG9A 3QZ8A 2W9CB 4ED8A 4DL4A 2PFPA 7ICOA 8ICTA 3HJ1A 4KLUA 4WC2A 2DRAA 1SZPA 2AU0A 2ISOA 2J6TA 1CUKA 1S0OA 5HHHA 4DSIA 1ZETA 4IQUA 4RWNA 2DFLA 3V7KA 4PPXA 4F4ZA 1B43A 4UB3A 1HUZA 4M6WA 3E2EA 1L5UA 5JUMA 4DSKA 2MAXA 5DB9A 2M2WA 1SL0A 4ECSA 2Y1IA 3T5JA 1NJYA 3OVAA 3AU2A 4DQRA 1S9FA 4DQPA 5J2JA 1XC9A 4QZAA 4KN7A 4JUZA 4QWBA 4DFKA 1ZQNA 4UBCA 1QLNA 3PW7A 4RQ4A 5DECA 4QZ8A 4XUSA 3PMNA 1NK7A 4JV2A 3AQLA 4EBCA 7ICTA 2I1QA 4YR2A 1X9WA 8ICRA 2HHUA 4X4TA 1L3VA 1XSLA 5BOMA 4DS5A 4IG8A 1XS9D 4I2GA 3ZDBA 4FBUA 4M2YA 8ICBA 1D8YA 3RAQA 2IMWP 3AQMA 1JXLA 1ZQRA 1NO5A 3OVBA 1ZQLA 4TQRA 4DLEA 4I2IA 3RB0A 1KTQA 1D9FA 3BJYA 3SYZA 5J0RA 4O3SA 3LQCB 3BDPA 2JZBA 4J9RA 5KTQA 4I29A 5DB6A 3ZDDA 1R8CA 3UXPA 4WC4A 1BPYA 3RJIA 2ZTCA 3RJKA 5J2KA 2W8KA 1NK6A 4ELUA 4O3RA 3PW2A 1NKEA 5KFBA 1KLNA 3RH5A 3PW4A 4TUPA 2BCUA 4O3NA 2BPGA 4UQGA 3RJJA 4YVZA 2P6RA 2P66A 5HMLA 3FDSA 4K4IA 4ECVA 4M9HA 4KLLA 3MGHA 1ZQIA 5F9LA 7ICIA 4F4KA 4FHXA 5EWEA 4ECUA 3RJEA 5D46A 5KFMA 1MC8A 4YD1A 4RNOA 4YG2A 4ED2A 1ZQEA 3JYYA 5L9XA 1ZJNA 4ECRA 3SI8A 4XRHA 5EWGA 7ICGA 3PX4A 2AGQA 9ICAA 5KFZA 5J0QA 3JPTA 9ICNA 2F1IA 4KLJA 4YQWA 4UBBA 4DL3A 4WC6A 4YXJA 4RQ1A 5KT4A
chains in the Genus database with same CATH superfamily
4EBKA 4EELA 3RFAA 5L1MA 2HN2A 7ICLA 3K7DA 3CK6A 1X6JA 1NOMA 1HUOA 3H3AA 3NGDA 3JPOA 3OWGA 5CFTA 4DL6A 1JIHA 4WOYA 3LVVA 2ZH5A 1L7MA 3OUYB 2YB4A 2YQEA 4ED0A 4LJXA 2M2VA 4ZOHC 2XY5A 3LDAA 4RPXA 1T94A 2RDIA 8ICIA 4CRXA 2DWQA 1TVAA 1BGXT 4PZNA 5KG3A 1MQ2A 1N5WA 5KFKA 7ICHA 5AM1A 4IQTA 9ICRA 2ZH4A 1TKDA 4YMOA 3NRWA 5KG4A 2ZUBA 5J2IA 4O3MA 1ZQMA 1N61A 4EEKA 4J9NA 1L3SA 4LZDA 3FYHA 3HJ4A 3UMGA 2MRLA 5ALEA 5J0YA 1RQNA 3MBYA 2OWOA 3ZD8A 4GC6A 4IRKA 1UEUA 4CDGA 3N7PD 3NUQA 1UETA 2WTFA 3PX6A 1B22A 4GFJA 4B9SA 2KIVA 3EPGA 2DVIA 1XWLA 2XO7A 4KM5A 4MHVA 2MUTA 3RRGA 1K1QA 2D6FC 1PK3A 2LMRA 4DSLA 2Y0SF 4DFPA 4KX5A 1L8OA 3NVZA 2CN1A 3D6JA 2LYAA 3GIKA 3PVXA 1VJ7A 1ZRNA 3N7RC 3TADA 4K97A 4RZRA 1ZQSA 3LYSA 2KMDA 5DKWA 3ZDEA 1KLNA 3OTQA 4QWAA 2IHNA 5KFDA 8ICUA 2BCQA 2YTUA 5ALIA 5ALGA 2EZYA 1RYRA 3ERCC 3MR3A 4ECYA 4QZBA 2HOFA 4QNLA 1L7OA 2E1FA 4TUSA 2BZFA 5J0UA 1TFWA 3C2LA 3IP4B 2OEHA 5KFHA 5DEDA 5J8YC 3SZ2A 4RUAA 5KT3A 5KFEA 8ICEA 4J9QA 3TARA 4JWNA 8ICVA 2FJ6A 5CB1A 4QZIA 2JMGA 4EEYA 3Q8LA 4F3OA 5J8YA 3GV8B 5DGAA 5AICA 5AKZA 2KN7A 2FMSA 3T3FA 5DDYA 1Q3UA 5DBAA 4C7ZA 1COKA 5KFPA 2F3NA 2XY6A 3BQ2A 5IIKA 3JZ0A 4QW8A 4I2EA 1R8BA 5HP4A 3JPRA 1OXJA 1WOTA 3HILA 4NLKA 4EGWA 4EP7A 3OPXA 3T5HA 4IQVA 1TFRA 3GIJA 2HHXA 2HHTA 3NWIA 4IR1A 2IHMA 4Y2PA 3NRZA 4C8MA 4PGQA 4O5KA 3RR7A 1NK9A 4KMOB 4EENA 2W9CA 2ZIWA 1SKWA 4C4RA 3NYBA 2L5YA 3MABA 5ALNA 3TQ1A 3WK8A 4QWEA 1U4BA 2ZH3A 5EOZA 1NZBA 4CF3A 2ZH8A 4QZFA 8ICZA 1WUDA 1Z00B 5BOLA 3PW0A 2HW3A 1ZYQA 2KV2A 2B0CA 2ZUDA 1QTMA 4DOBA 2JEIA 4NV0A 3GV5B 3PR5B 2H5XA 5CWRA 4NKUA 3M8RA 2PI5A 7ICQA 4DOCA 4KB6A 4C80A 4QZGA 3GV7B 4NKTA 2R18A 4X4UA 4DLGA 4C8OA 7ICVA 1MQ3A 4NXUA 4OJLA 4F5NA 4BXOB 1S0MA 4RNMA 4DFMA 1YT3A 2ASDA 4O5CA 3IHQB 1ZRMA 4X0AA 2W9AA 4CCHA 5AIAA 4OD0A 1NZPA 4CF5A 2XCPA 4O67A 4NLNA 2C22A 5HRGA 4F4WA 4RQ5A 2BCSA 3WFOA 3N7SC 5DLGA 5HHIA 2V9WA 3J81j 2RFFA 4I27A 2WHEA 2FE9A 5HNKA 3TACB 8ICLA 5KAIU 4EBEA 1Z1BA 2Q66A 2KE7A 1DK3A 1JN3A 3TAQA 4PGYA 1MIYA 2KZ3A 4YMMA 2ZTDA 3RTVA 5J0XA 1L6NA 4CE6A 3BS5A 5J0SA 2KICA 3PO4A 4DQQA 2JHDA 4RPYA 3AU6A 5DQHA 3MR2A 4YCXA 3QNMA 3WK4A 2ZG6A 4G9BA 2WAQC 4RQMA 1XSNA 4R8UB 4X5VA 3PSPA 4ELTA 4BWMA 3QYPA 3WFRE 3OJUA 5G5HA 4Y2XA 4JV1A 5AM5A 4BX9C 5KFYA 8ICFA 2DBYA 3I76A 3CRXA 1NJWA 5KG5A 1KL9A 4O0IA 5J2FA 5J2HA 4I0UA 5KFGA 1SIJA 5AI8A 1T3NA 2BQ3A 3F5AA 4F2RA 3AN1A 2G06A 4QWDA 1L7PA 3M7DA 4I2DA 3PMLA 4BJQA 5DB7A 2LKYA 9ICGA 1VJ5A 5HC9A 1KW4A 2FI1A 1WCNA 3H0MB 5AK3A 4X4OA 4US9A 9ICCA 5AKYA 7ICEA 4RT2A 1NK0A 4RWQA 1PX5A 4IRDA 3N28A 5CHGA 1T8EA 2JH1A 8ICYA 4M5DA 4YFKA 5AI4A 1JQRA 1QSLA 2H3QA 1ZXIA 5L1LA 4M9JA 4WH5A 4IR9A 2HVHA 2HHVA 5C5JA 2MA1A 5CP2A 2BE3A 5KFXA 8ICJA 4TUQA 3UQ0A 4FO1A 2WF8A 3SMVA 2XICA 4J9LA 1Z19A 2I9GA 3C21A 2M2UA 4DF8A 5J0TA 3QZ8A 2PFPA 2DRAA 2AU0A 3B9JA 2J6TA 3RF9A 1S0OA 1FFVA 3FC4A 5AM4A 2IHOA 1B43A 5JUMA 2ZIXB 1NJYA 2W03A 2Y1IA 4GIBA 1S9FA 4KN7A 4UBCA 3PW7A 4RQ4A 3PMNA 7ICTA 2I1QA 1X9WA 4X4TA 1XSLA 5BOMA 5AI0A 3DEEA 4IG8A 2GO7A 4OJOA 4I2GA 4FBUA 1D8YA 4K9BA 2DQNB 2KHVA 4DLEA 4I2IA 1QQ7A 4O3SA 2A1AA 4J9RA 3UXPA 1D8BA 4WQLA 4TUPA 3RJJA 2P6RA 2P66A 7ICIA 4ECVA 2KSOA 4F4KA 4FHXA 3RJEA 2WB1F 5KFMA 1MC8A 4QJFB 4RNOA 5D62A 1ZJNA 4ECRA 2QLTA 1AQ6A 3PX4A 3H0LB 4UARA 4YXJA 2MU2A 4P4PA 2HHWA 2BCRA 1SWVA 3SAFA 4FHPA 9ICIA 2BR0A 1R89A 3PW5A 2PMZC 4FHWA 4NXWA 1UEVA 4F91B 2FPLA 4KLEA 3HT3A 4WC3A 3ISBA 3RBDA 1KFTA 2E8OA 1PZNA 4UAUA 2W8LA 5KFCA 2YB1A 3QUBA 2ZIVB 3Q8KA 4OAFA 3JPQA 1DGSA 3KFUF 4FHYA 7ICNA 3GIMA 1DXSA 5JRTA 1X2IA 1LKYA 4JK1A 3C1ZA 2IOFK 5T14A 2BBHA 2W3RA 2W54A 1SGGA 1JROA 5KFAA 3UQ2A 5EE1A 4YR3A 2AH5A 4EEBA 3HKZC 1CRXA 1WWVA 4FFDA 2BDPA 3NTUA 4PH5A 1UT8A 2GWSA 4NLBA 4ATBA 3K4GA 3C28A 2KFNA 3NS1A 2VJ5A 3ZDCA 5DG8A 2I5HA 7ICUA 3ED5A 5HRBA 3QU2A 1X42A 4F5RA 1RG6A 3LWLA 1MA7A 4KLIA 3MR5A 4RUCA 5E79U 2ZH7A 5GTHU 2B51A 2R8IA 4F92B 4X4PA 4AYBF 1HIWA 1ZQ1C 2JRZA 3K75D 2KJ5A 5IIOA 1UA0A 7ICPA 1Z4OA 2FLLA 2LI6A 5L1IA 4E7XA 1S8OA 3LVWA 3QU7A 3EUB2 2PBEA 2XVTA 1TE2A 2VANA 1WCLA 4R66A 4J9PA 2EDUA 2ZTEA 2ZHBA 4F5PA 4E8FA 1ZQGA 5ALZA 2E8PA 3C1YA 2OHFA 1HJPA 4F5OA 2NRWA 5DBBA 3TANA 3WKBA 4Y2UA 2KNJA 2FPKA 5KFSA 3AQKA 1HEKA 4NXVA 2VKQA 2M2TA 2HN1A 4WQKA 1ZQTA 1PK1B 3HW8A 4AYBC 1TAUA 2EZXA 4RQ3A 2W7OA 4NJ8A 4DL5A 3QUTA 4ECTA 4MFCA 9ICBA 1QCKA 4K4HA 2DL0A 2R8HA 3ALRA 3A0BU 1NKCA 1QH9A 4QZ9A 4I2CA 2BDUA 4KLSA 1CI4A 1ZQYA 4DL7A 1K1SA 3D2NA 2M9NA 3IG5A 3BQ0A 3MR6A 1ECWA 2YMMA 4Z6DA 8ICXA 1L3UA 1PVRA 3KOOA 3L3FX 4Q44A 2W43A 3HKZF 3G6YA 4ICAA 1BPZA 1LKYB 3V6KA 1JRPA 3C5FA 1ZD2P 5J0OA 2PI4A 4AT8A 5L1JA 1D9DA 5KG7A 5CEHA 4DQIA 4MEXA 8ICOA 3CNHA 2PKEA 1KEJA 1KQQA 2OXOA 2ZJAA 5KL1B 1ZQWA 1TK0A 1ZQBA 1FO4A 2Y9UA 5D49A 5IILA 4MF8A 4MFFA 4EX7A 3WFPA 4Y2JA 2P6UA 2K8CB 2AHOB 4X4RA 3KZIU 5EE9A 1SKSA 3G6VA 1A0PA 1NK5A 2KP7A 1BPEA 4Y2RA 3ETLA 4UB1A 3H8WA 2LHTA 5CJ7A 4WC1A 9ICLA 4YXMA 2EZZA 2BGWA 3OHAA 4B9NA 1ZQVA 4BXOA 1S5LU 4FH3A 4MFAA 4MEYA 4NL9A 2KK0A 1OUQA 4FBTA 1T3QA 4J9SA 2Y1JA 5L1KA 2NYVA 2DGZA 2KSOB 4IRCA 3M9MB 1N56A 3H8JA 5KT7A 3KKAA 1IIPA 3QU5A 1BPDA 1ZQJA 5KFUA 2RP5A 4DSEA 3JPNA 4UD4A 4DCCA 7ICKA 2W55A 2K4HA 2EWRA 4K98A 4K99A 2E1EA 2HHQA 5AM0A 2IBKA 4P2HA 7ICRA 3AQFA 1JALA 4LVSA 4C8LA 1RZTA 3H39A 5KFNA 1TAQA 4TURA 4P4MA 4UB2A 5ALFA 3HP6A 4KLGA 3OJSA 4J9MA 3RRHA 3M9NB 1WG8A 2ZXIA 2W04A 4UB5A 4EYIB 4UB4A 3ICXA 5AM2A 4ATBB 5KFLA 2QB0A 3M6KA 1TK8A 1ZQCA 2BHNA 1ZJMA 2VA2A 4JLZA 4YP3A 3U26A 3KHGA 1VFGA 2NRVA 3HPOA 4PHAA 3KBBA 2WF5A 4RT3A 4O3OA 1TFYA 4YMNA 3H37A 3V72A 5K4LA 3OSNA 2ZH2A 2VJ4A 2KKPA 4FZNA 3GQCA 1ZQFA 1SV0A 4UB6U 2FMQA 4P0PA 2OM6A 1OW5A 5KFFA 4RWPA 9ICSA 1IV8A 4FHVA 2ISPA 9ICWA 3AEVA 4FZMA 3UMCA 2JZBB 4US8A 1A76A 4U6PA 8ICPA 4QZEA 1UQVA 5IIJA 2KFZA 2WFAA 2PMZF 1XNSA 2XGQA 2B21A 4J03A 5J0WA 2Y9TA 3FAHA 2VA8A 5KFIA 2C2DA 2H3FA 2K89A 1XO0A 4EV6A 4B9TA 5AKHA 2HBKA 1S0NA 3G6XA 2ASJA 3WKEA 1FFUA 2ODGA 2WF9A 2LBOA 2WB1C 4OCZA 2K8BB 4DSJA 3UXNA 4RQNA 1J2MA 5IIMA 3B0YA 5EWFA 4K8VA 3I28A 3PY8A 4USAA 1N48A 3T5KA 4O5EA 8ICTA 4ED8A 4C4TA 4WC2A 3CYMA 1SZPA 4LEVA 4DSIA 3A0HU 2W3SA 5AIBA 5HHHA 1ZETA 4UB3A 1L5UA 2MAXA 3IG8A 2M2WA 1SL0A 4ECSA 3T5JA 3OVAA 4DQRA 2ESEA 1MN8A 2G09A 1ZQNA 1QLNA 3IV6A 1NK7A 8ICRA 2NV3A 4M2YA 8ICBA 3AQMA 1GO3F 2RRDA 2ZIUB 3RB0A 1KTQA 1D9FA 3BJYA 2JZBA 3NVWA 4WC4A 3F53A 2ZTCA 4O3RA 5G5GA 1UPHA 3PW4A 4O3NA 4UQGA 4YVZA 4M9HA 5HMLA 3UPSA 3QX7A 5EWEA 4ECUA 1UCVA 3JYYA 3SI8A 4XRHA 2AGQA 1YZ6A 2F1IA 5ALMA 4UBBA 4DL3A 2JEFA 5AM3A 4X4VA 1S0VA 2HCFA 1XSPA 2C2RA 2GAFD 2E5SA 3RR8A 4JV0A 3WK6A 1MIVA 8ICMA 1RXVA 2G0AA 3Q8RB 1SB3C 4CF4A 3IM1A 3OHBA 1JUDA 2HOIA 5HRKA 3BZCA 3WKDA 4RQ8A 2PFQA 1A6SA 5KFTA 1B0XA 4MKPA 5F3XB 4PHEA 3RB6A 4BWJA 9ICJA 1Z00A 3K1RB 2E8MA 5ALXA 3OSPA 3C2KA 2OCEA 4S3NA 2YY6A 9ICOA 1N5XA 3EYZA 2KVCA 5JU5A 2BQUA 2FLPA 2WF6A 4NLZA 5DGBA 4RWOA 4JB3A 2J6SA 1BPXA 1JMSA 4Y2TA 1VDVA 3EF2A 3VC8A 3S6JA 2WAQF 2PXIA 4ED1A 2FCLA 1T7PA 3DDHA 1ZQZA 5ALQA 5B3PA 2CRXA 3MC1A 2C28A 2R8GA 4I2HA 3NASA 4R64A 4N7RA 3AQEA 2DUYA 2RDJA 2D8CA 1RXWA 5EE0A 3SV3A 4FE3A 4ECQA 2KJ8A 5J2GA 3V6HA 5J2AA 1X6IA 4QZDA 5CHEA 1H38A 1NJZA 5ALOA 1J2NA 3V6JA 3ZI4A 2KJ9A 3SR6A 2I6XA 1CEZA 4O68A 1N63A 4UAWA 8ICSA 2XCAA 4Z6FA 1IM4A 1N60A 4YN4A 5KG2A 2HBMA 2W9MA 4EZ6A 9ICQA 4AT9B 2KZZA 4IL6U 4HYKA 1Q78A 2KIWA 4C8NA 3SV4A 4F4XA 1U49A 9ICXA 4QZHA 4KLOA 2WF7A 1F5AA 5KFJA 2AGPA 4Q43A 3BS5B 4QWCA 5ALJA 2FDRA 5HR6A 1XO1A 3VCBA 4ED6A 1NK4A 2ZH1A 2EH9A 5ALUA 1BPBA 2G5HB 1Q46A 2AJQA 2BCVA 4ELVA 1NI3A 4F72A 4C8KA 3TAPA 4M9NA 4PGXA 3N97B 8ICWA 4Q45A 2F76X 1NNLA 5J29A 1K5OA 3PX0A 2K8AA 7ICJA 1TK5A 3RB4A 5F2VO 1N2XA 5J0PA 2JGAA 1SWWA 4HX0A 4FO6A 1MIWA 3EZ5A 2KTQA 5AKEA 5ALDA 1RYSA 4XQ7A 3D2QA 2LM1A 2LPEA 4M9LA 4JLXA 2DR7A 4QIWF 5KG6A 3IDWA 1ZQAA 3RJHA 3NVVA 5HREA 5ALKA 3QEAZ 8ICNA 4RQ0A 2ALZA 1O08A 3THVA 2NRZA 4O69A 4KN4A 5CA7A 2DF4B 4UASA 3HIYA 2XC9A 4IC9A 1U9LA 4ECZA 4I2FA 3OUYA 3MGIA 2F77X 4DS4A 5DQIA 2NRKA 3KTQA 4M0AA 4KITB 2NO5A 3PR4A 2KD1A 3KKAC 2J6UA 5ALHA 5B3QA 1ED1A 2XY7A 1RQLA 5J2CA 4KLDA 3H40A 4F93B 3WK5A 3F2BA 4AT7A 4WC5A 3QZ7A 1Q3VA 4KLHA 2BKEA 3UPQA 1BVSA 2EAPA 4KX3A 1B4FA 1O03A 4Q8FA 9ICMA 5KT2A 5DQGA 5J2BA 2QB1A 5HRDA 2EAMA 4E80A 2F1HA 3CW2C 3TFRA 4O3QA 5DBCA 1SL2A 3ISCA 1TV9A 2KEYA 4CNQA 2K4PA 2OH2A 4Y2SA 2AQ4A 1QSSA 1S97A 5HR9A 4UD5A 4O6AA 3NVYA 3C23A 2DR5A 3WU2U 3H38A 4UATA 1SV0C 3F2DA 2UVUA 5ALPA 4R8UA 5KFVA 2O5AA 3ORYA 5D4BA 4F4YA 2K4IA 5IINA 4F50A 3QE9Y 7ICFA 4ECWA 1X66A 4WBYA 4RQ2A 1L7NA 4KLMA 5DG7A 8ICGA 3GFKB 2R8JA 4O3PA 1KBUA 2ID1A 4OAIZ 1Z1VA 1BNPA 1JX4A 4WC0A 4DEZA 1F5SA 5J2DA 4B9LA 3WFQE 2ZJ8A 5KFOA 9ICFA 9ICHA 2C2EA 2ZH6A 3OV7A 4MF2A 4E0DA 1WYGA 4EX6A 7ICSA 5HRHA 4DQSA 4LT6A 3PHZA 4AT8B 4PZOA 1UHUA 2HBLA 4J9OA 4J9KA 3SD7A 2DPJA 4A8EA 4F8RA 4R63A 3Q8PB 3QU4A 4U7CA 4M6WB 3H0RB 4P0QB 2H3IA 3Q8MA 3O0FA 4YD2A 4B9VA 3OGUA 8ICAA 4X4QA 1VLBA 1NKBA 4Z6EA 1SZHA 1ZQKA 1LVHA 3PNCA 3ZDAA 5CR0A 4Y2VA 4I28A 2HHPA 4P0PB 3RBEA 2NO4A 2JEJA 1ZQHA 4BGDA 1Q8KA 1FEZA 2Q4TA 2IOFA 4QZCA 4AP9A 4EEDA 3Q8SB 5HRLA 3JPPA 3GIIA 4PHPA 4EZ9A 4QW9A 2PFNA 5KFWA 3RJGA 2F2AB 5JTIA 5AKXA 4HAIA 3KHHA 2DR8A 1PVPA 1X9SA 2R8KA 3AUOA 1V85A 2NRTA 2UVRA 3DV9A 1C20A 2ZIXA 2K4EA 3OVSA 3PZPA 4IQWA 2FPMA 1ZQUA 4DFJA 1SKRA 4RPZA 4K96A 2YN4A 2BPFA 4KTQA 2CXYA 4NWIA 2BPCA 4KLQA 7ICMA 1RM6C 2Q0ZX 2ES6A 8ICKA 1R8AA 2GLEA 3JCFA 5F9NA 5DG9A 2W9CB 4DL4A 2YMPA 2ISOA 3V7KA 1HUZA 4DSKA 5AI9A 5DB9A 1KKXA 2ZIWB 3AU2A 2DKXA 4QZAA 4DFKA 2M0NA 5DECA 4QZ8A 2E3TA 3AQLA 4EBCA 4YR2A 2HHUA 1L8LA 1L3VA 4DS5A 2B6GA 1XS9D 1M6YA 3RAQA 1JXLA 2Z7JA 1ZQRA 1NO5A 1ZQLA 4TQRA 3OVBA 4NLCA 5J0RA 3ER8C 3LQCB 4I29A 3AMZA 3F5EA 3AM9A 5KTQA 5DB6A 1R8CA 1BPYA 3WK7A 1NK6A 3PW2A 1N62A 3FDSA 4KLLA 3MGHA 5F9LA 3M1YA 5D46A 2IUBA 3GU3A 4YD1A 4ED2A 2A3VA 1ZQEA 3NKUA 2ZIVA 7ICGA 2Y0SC 5KFZA 5J0QA 1TAMA 4KLJA 4WJ3B 4WC6A 2GOLA 5KT4A 2ASLA 2QARB 1BNOA 4UAYA 2W9BA 1U47A 4I2JA 2XI9A 5B66U 4C0ZA 5KFRA 2KHQA 1FIQA 4OAGA 5DDMA 3LWMA 4EBDA 2A1JB 3PSTA 4Y2QA 1KSPA 1ZD4A 2ZH9A 4K4GA 4I2BA 4OJPA 3HWTA 4X0BA 4NM2A 1LV5A 4P4OA 4DL2A 3ETRA 4RU9A 2B56A 2OYYA 1YLQA 1PK1A 1QQ6A 1S10A 4X4NA 4NM1A 3QUCA 3H4BA 4X4SA 4ED7A 3BZKA 2HHSA 4G3IA 5KG1A 4GLXA 2PFOA 3PO5A 2ZXHA 3RJFA 5FP0A 5CFSA 4TQSA 2MUTB 5AK6A 1PUZA 2YMQA 2D3DA 1GPJA 4EBJA 4ED3A 1EXNA 3RAXA 4Y2YA 1SV4A 2F8KA 4XA5A 5ALSA 1IG6A 1FA0A 2N1RA 2B4VA 1QQ5A 9ICEA 1V97A 5AKJA 2JH7A 4FH5A 3SQIA 3PSIA 2UVWA 1L3TA 2IOHA 4LEZA 2KOBA 5B5EU 2KVSA 3T5LA 4GXJA 4EYHB 2ZHAA 4K9AA 3L9DA 4C7YA 5KT6A 2JXJA 4UAVA 4Q8EA 4XQ8A 1JXEA 2V4RA 3PSFA 4FS1A 3BQ1A 3FM9A 1KDHA 1LB2B 5TZVA 2DPIA 1KN5A 2XIDA 5KT5A 2UVVA 1DOQA 2XGPA 3LK9A 3ONNA 3M8SA 5CRXA 4OJ5A 1A77A 3TI0A 2KG5A 4PL2A 3ISDA 3TFSA 3RB3A 2EQYA 5KFQA 5ALTA 4DFDA 4FZLA 5D63A 2FLNA 1Z3EB 5ALYA 1S76D 5HRFA 3E58A 4R65A 4GXKA 1ZQOA 1S77D 3IN5A 5ALRA 4UB8U 1ZD3A 3KHRA 5DLFA 3E0FA 1U45A 1XU4A 3QUQA 2ZJ5A 3SAGA 2H3ZA 4I2AA 4NXZA 5ALWA 4NY8A 4WCWA 3HRDD 1V38A 1X40A 5AKGA 4M04A 1KFDA 1URJA 4KMUA 3B0XA 2ZIUA 8ICQA 2MSNA 1ZQPA 5AKLA 1UA1A 2ZUCA 5ALVA 2G5IB 2LM4A 4OO1J 3ER9B 4IS7A 2A1JA 5ALLA 4M47A 2RLTA 2VIXA 3AL0B 1COOA 1DGJA 1RDFA 3UM9A 4DO9A 3UXOA 2HOQA 1F0MA 1DK2A 3MFHA 2DRBA 4P0QA 2BQRA 1C7YA 3RH6A 3GILA 1T4GA 3SAHA 4C4SA 2F1JA 4WC7A 2QARA 3EW9A 3F2CA 3C18A 4ACOA 4RWNA 1Y88A 4LEWA 5CFUA 5HMMA 1D8LA 1V4AA 3GDXA 2AGOA 9ICKA 3H8SA 1NK8A 2NRXA 3AQNA 3L4PA 4DWIA 5AK5A 3KD3A 3MDAA 2HMXA 5HR7A 2CPRA 1SXDA 4LEYA 5C0YA 3MGVA 4KLFA 9ICPA 5AHXA 4F5QA 1JI7A 4BUGA 4WBZA 1YZ7A 8ICHA 5GTIU 2G08A 4RQ7A 2H3VA 4LZGA 2F8LA 3M9OB 4DOAA 3BQTA 4DSFA 3IRUA 2KKVA 3WKAA 4PHDA 1IXRA 5KL8B 5JTGA 3JPSA 4ECXA 3PV8A 2K60A 8ICCA 2HDOA 1QSYA 4DF4A 4UAZA 2JR5A 3BS7A 1RPLA 3C5GA 1WWUA 3C66A 3GZFA 4JMUA 1Z4NA 3KHLA 5D61A 5KAFU 4FS2A 3UMBA 1MSWD 3RH4A 2O1PA 4NLGA 5AK4A 3MDCA 5EE3A 2W7PA 5KNIA 3H8MA 3V7LA 3WKCA 4M9GA 1ZQQA 4RQ6A 1AROP 4AT7B 2HBJA 5AKKA 4OAHA 9ICUA 3KZXA 3WK9A 3WFSC 2QB0B 2W11A 2KZMA 1RYUA 2JEGA 1JAJA 1ZD5A 4Z6CA 4GXIA 4B9MA 3HJEA 2JV3A 3M6ZA 1V9PA 2FMPA 1P7DA 3QEBZ 4CGZA 3D2SA 5H2FU 3MFIA 5TISU 4O9MA 2LYHA 4B6JA 1OU5A 3T79A 4PL1A 2DKZA 2IA6A 5KG0A 2AQ0A 2G07A 1NJXA 3TKAA 4RNNA 2DR9A 4XJEA 2ATLA 1U48A 3Q8QB 2GA9D 2YX8A 5BPCA 2YMLA 3SENA 4JWMA 3H4DA 2RQ5A 4GC7A 3V7JA 3N4MB 2HVIA 2LYBA 2EAOA 3C2MA 1J97A 4YR0A 1ZQXA 1UT5A 3R9KA 5DB8A 4B9UA 2VA3A 4BDPA 3HX0A 1X9MA 3TADC 1KFSA 3EWAA 4ZH4A 3BQ7A 1Q79A 5J2EA 3H7IA 1ZQDA 5HRIA 3ZD9A 9ICVA 4NL9C 2W9BB 1ZOLA 4F2SA 4QIWC 1F44A 9ICTA 3MCRA 3SEIA 1KRPA 1SL1A 5AKIA 2F44A 2RHFA 2V4QA 1KNYA 2EANA 4KLTA 3EPIA 4AT9A 5IIIA 3HJ1A 7ICOA 2GH1A 2O6KA 4KLUA 1CUKA 2A19A 3L5KA 4IQUA 2DFLA 4PPXA 4F4ZA 3E2EA 4M6WA 1PVQA 4DQPA 5J2JA 1XC9A 4JUZA 4QWBA 2BBJA 5A0LA 4XUSA 4JV2A 2E8NA 2AXTU 1SXEA 2HSZA 3ZDBA 2IMWP 5AI6A 4F71A 3QXGA 3I1YA 2HI0A 3SYZA 3BDPA 2QKQA 3QU9A 3ZDDA 5AI5A 3RJIA 3RJKA 5J2KA 2W8KA 4ELUA 1NKEA 4PJ0U 5KFBA 3RH5A 2BCUA 4OJ6A 2BPGA 2P35A 4UW9A 4K4IA 4NXTA 3CP8A 1X9XA 1ZQIA 4NXXA 4YG2A 3K1ZA 5L9XA 5EWGA 9ICAA 9ICNA 3JPTA 4YQWA 3NVOA 4RQ1A 3C29A 1DRGA
chains in the Genus database with same CATH topology
4P4PA 2ASLA 1S0VA 2HHWA 1XSPA 4EBKA 4X4VA 2C2RA 2BCRA 7ICLA 1BNOA 4UAYA 2W9BA 1U47A 1NOMA 4JV0A 1HUOA 3RR8A 1MIVA 3H3AA 8ICMA 4FHPA 1RXVA 3Q8RB 9ICIA 3NGDA 3JPOA 3IM1A 2BR0A 3OHBA 4DL6A 3PW5A 1R89A 1JIHA 4I2JA 4FHWA 2ZH5A 1UEVA 4F91B 5HRKA 2FPLA 4KLEA 5KFRA 3HT3A 3OUYB 4RQ8A 2PFQA 4ED0A 2JEFA 5DDMA 2M2VA 4WC3A 5KFTA 3LWMA 3ISBA 2XY5A 3RBDA 1KFTA 3LDAA 4EBDA 4PHEA 2A1JB 3RB6A 4RPXA 2RDIA 8ICIA 1PZNA 1KSPA 2W8LA 4BWJA 5KFCA 1TVAA 9ICJA 2KZMA 1BGXT 1Z00A 2ZH9A 4K4GA 5KG3A 3Q8KA 1MQ2A 4I2BA 5KFKA 7ICHA 3HWTA 4X0BA 4IQTA 4NM2A 1LV5A 9ICRA 4P4OA 3OSPA 3JPQA 4DL2A 4RU9A 2ZH4A 3C2KA 1DGSA 1TKDA 4S3NA 1YLQA 9ICOA 4YMOA 4FHYA 5KG4A 3EYZA 7ICNA 2ZUBA 5J2IA 1S10A 3GIMA 4X4NA 1ZQMA 2BQUA 2FLPA 4NM1A 4NLZA 4J9NA 1L3SA 4LZDA 1X2IA 5DGBA 3FYHA 4JK1A 3C1ZA 3H4BA 2J6SA 1BPXA 3HJ4A 4RWOA 4X4SA 1JMSA 4ED7A 2HHSA 4G3IA 5KG1A 5J0YA 4GLXA 2PFOA 3MBYA 3PO5A 3RJFA 5KFAA 2OWOA 4TQSA 3ZD8A 4GC6A 2MUTB 3UQ2A 4IRKA 1UEUA 2PXIA 4ED1A 4YR3A 1T7PA 4EBJA 1ZQZA 1UETA 2WTFA 3PX6A 1B22A 4ED3A 1EXNA 2C28A 4B9SA 3RAXA 3EPGA 2BDPA 2DVIA 2R8GA 4I2HA 1XWLA 4R64A 3NTUA 2XO7A 4PH5A 1UT8A 2MUTA 2RDJA 2GWSA 1RXWA 3RRGA 1K1QA 4ATBA 3SV3A 3K4GA 4DSLA 4ECQA 4XA5A 5J2GA 2KFNA 3V6HA 3ZDCA 5DG8A 5J2AA 4DFPA 7ICUA 1FA0A 4QZDA 3GIKA 3PVXA 1H38A 1NJZA 5HRBA 1VJ7A 3V6JA 4F5RA 9ICEA 4FH5A 3LWLA 4KLIA 4RZRA 1ZQSA 1CEZA 2UVWA 1L3TA 5DKWA 4UAWA 3MR5A 8ICSA 2XCAA 4RUCA 4Z6FA 1IM4A 3ZDEA 4QWAA 4GXJA 3T5LA 4YN4A 5KFDA 4EYHB 2R8IA 4F92B 2W9MA 5KG2A 2BCQA 2IHNA 4EZ6A 8ICUA 9ICQA 3L9DA 4AT9B 4X4PA 5KT6A 2KZZA 4HYKA 3K75D 5IIOA 7ICPA 1UA0A 1Q78A 4C8NA 3SV4A 4F4XA 1U49A 4Q8EA 1RYRA 9ICXA 4XQ8A 1JXEA 3MR3A 2V4RA 2FLLA 4FS1A 3BQ1A 2ZH7A 5L1IA 1KDHA 4QZHA 4E7XA 1LB2B 4ECYA 4QZBA 5TZVA 2DPIA 4KLOA 4TUSA 5KT5A 2UVVA 1DOQA 5KFJA 1F5AA 2XGPA 2AGPA 4Q43A 5J0UA 3LK9A 2PBEA 4QWCA 3C2LA 1TFWA 3M8SA 2VANA 1WCLA 1XO1A 4R66A 5KFHA 5DEDA 4J9PA 4ED6A 2ZHBA 2ZTEA 1A77A 3TI0A 1NK4A 2ZH1A 4F5PA 4E8FA 4RUAA 3SZ2A 1ZQGA 5KT3A 1BPBA 2AJQA 2BCVA 5KFEA 3ISDA 3TFSA 3C1YA 4ELVA 3RB3A 8ICEA 1HJPA 4J9QA 5KFQA 4F5OA 3TARA 4JWNA 8ICVA 2NRWA 5DBBA 4C8KA 3TANA 3TAPA 5CB1A 2FLNA 1Z3EB 4QZIA 4PGXA 2FPKA 3N97B 4M9NA 4Q45A 5KFSA 1S76D 8ICWA 5HRFA 4R65A 4EEYA 4GXKA 3Q8LA 1ZQOA 4F3OA 5J29A 1S77D 4IRDA 3AQKA 3KHRA 3PX0A 3GV8B 5DGAA 5DLFA 2M2TA 2KN7A 1U45A 1XU4A 7ICJA 1TK5A 2FMSA 2ZJ5A 5DDYA 3T3FA 3RB4A 1ZQTA 3HW8A 5F2VO 1TAUA 5DBAA 5J0PA 4I2AA 5KFPA 4RQ3A 4FO6A 4DL5A 1MIWA 3EZ5A 2KTQA 2XY6A 4ECTA 4MFCA 3BQ2A 9ICBA 4NXZA 1RYSA 4XQ7A 4NY8A 4WCWA 5IIKA 4K4HA 4M04A 2R8HA 1KFDA 4KMUA 4M9LA 3B0XA 1NKCA 3JZ0A 2DR7A 4QW8A 4QZ9A 5KG6A 4I2CA 4I2EA 1ZQAA 5HP4A 8ICQA 1R8BA 4KLSA 3JPRA 1ZQPA 1ZQYA 4DL7A 1K1SA 2M9NA 1WOTA 4EP7A 4NLKA 1UA1A 3RJHA 2ZUCA 5HREA 3BQ0A 3MR6A 3QEAZ 3T5HA 8ICNA 4RQ0A 2ALZA 4Z6DA 8ICXA 3THVA 2NRZA 4IQVA 1L3UA 1TFRA 3GIJA 4KN4A 2HHXA 2HHTA 5CA7A 4IR1A 2A1JA 2IHMA 3HIYA 2XC9A 4M47A 4Q44A 1U9LA 4ECZA 4C8MA 4PGQA 1COOA 3UPSA 3G6YA 1BPZA 1NK9A 3RR7A 4I2FA 4O5KA 3V6KA 3MGIA 2NRKA 4DS4A 5DQIA 4DO9A 3UXOA 3C5FA 3OUYA 2W9CA 1SKWA 5J0OA 2PI4A 3KTQA 3MFHA 4M0AA 1DK2A 3NYBA 2DRBA 4KITB 2BQRA 3PR4A 1C7YA 4AT8A 3MABA 3TQ1A 3RH6A 5L1JA 1D9DA 5KG7A 2J6UA 4DQIA 3GILA 4QWEA 1T4GA 4MEXA 1U4BA 8ICOA 2ZH3A 1KEJA 2XY7A 2F1JA 5J2CA 4WC7A 3EW9A 4KLDA 2ZJAA 3H40A 4F93B 3C18A 5EOZA 4AT7A 4WC5A 3QZ7A 1ZQWA 1TK0A 1ZQBA 4KLHA 2BKEA 1Y88A 4QZFA 8ICZA 1Z00B 2ZH8A 5D49A 5BOLA 3UPQA 3PW0A 5HMMA 5IILA 1ZYQA 1BVSA 2ZUDA 4MF8A 1QTMA 4MFFA 2HW3A 1D8LA 1V4AA 3GDXA 4DOBA 2JEIA 2AGOA 3WFPA 3GV5B 3H8SA 9ICKA 3PR5B 2P6UA 2H5XA 4Q8FA 1NK8A 9ICMA 2NRXA 5KT2A 5DQGA 5J2BA 5CWRA 4NKUA 3AQNA 5HRDA 4X4RA 3M8RA 1SKSA 2PI5A 4DWIA 7ICQA 4E80A 2F1HA 3G6VA 4DOCA 3MDAA 3TFRA 1NK5A 2KP7A 4QZGA 3GV7B 4O3QA 5DBCA 1SL2A 3ISCA 1BPEA 1TV9A 4NKTA 4X4UA 3ETLA 4DLGA 4UB1A 2AQ4A 1QSSA 3H8WA 1S97A 1MQ3A 4C8OA 4KLFA 4F5QA 9ICPA 7ICVA 5HR9A 5CJ7A 4F5NA 3C23A 4WC1A 4BXOB 1S0MA 9ICLA 4RNMA 2DR5A 4DFMA 2ASDA 4YXMA 4O5CA 2BGWA 4WBZA 3IHQB 3OHAA 4X0AA 4B9NA 1ZQVA 2W9AA 4BXOA 8ICHA 3H38A 4FH3A 4RQ7A 4CCHA 4MFAA 4MEYA 2UVUA 4R8UA 5KFVA 4FBTA 3ORYA 4LZGA 4J9SA 2O5AA 3M9OB 4DOAA 2Y1JA 1NZPA 2XCPA 3BQTA 5L1KA 4F4YA 5D4BA 4DSFA 4NLNA 5IINA 2C22A 4F50A 3QE9Y 4IRCA 7ICFA 3M9MB 4PHDA 1IXRA 4ECWA 1N56A 3H8JA 5HRGA 5KT7A 4WBYA 4RQ2A 3JPSA 4F4WA 4ECXA 3PV8A 4KLMA 1BPDA 1ZQJA 5DG7A 4RQ5A 8ICGA 5KFUA 8ICCA 3GFKB 2R8JA 4DSEA 3JPNA 2BCSA 4UD4A 3WFOA 4O3PA 1QSYA 5DLGA 5HHIA 4DF4A 2V9WA 7ICKA 2ID1A 2ZHAA 4UAZA 1BNPA 1RPLA 3C5GA 1JX4A 4WC0A 2RFFA 3C66A 4I27A 4DEZA 5HNKA 3KHLA 5J2DA 4B9LA 4FS2A 8ICLA 3WFQE 1MSWD 2ZJ8A 5KFOA 3RH4A 9ICFA 4NLGA 9ICHA 2O1PA 2HHQA 4EBEA 2C2EA 3MDCA 2IBKA 2ZH6A 4P2HA 2Q66A 7ICRA 4MF2A 3OV7A 4LVSA 4E0DA 1DK3A 7ICSA 1JN3A 3V7LA 3TAQA 4C8LA 4M9GA 5HRHA 4PGYA 1RZTA 1ZQQA 1MIYA 4DQSA 1Q79A 3H39A 4RQ6A 2KZ3A 4YMMA 2ZTDA 1AROP 4LT6A 5KFNA 3RTVA 4AT7B 1TAQA 4TURA 4P4MA 4UB2A 4AT8B 5J0XA 5J0SA 4J9OA 3HP6A 4J9KA 9ICUA 3PO4A 2DPJA 4KLGA 3WFSC 3OJSA 4F8RA 4DQQA 4J9MA 4R63A 4RPYA 3Q8PB 3RRHA 3M9NB 3AU6A 2JEGA 5DQHA 3MR2A 4YCXA 4UB5A 1JAJA 4EYIB 4Z6CA 4M6WB 4UB4A 3Q8MA 4ATBB 5KFLA 1TK8A 4GXIA 1ZQCA 4YD2A 4B9MA 2BHNA 1XSNA 4R8UB 4X5VA 4B9VA 1ZJMA 2VA2A 3OGUA 4ELTA 8ICAA 4BWMA 1V9PA 2FMPA 4X4QA 4YP3A 3KHGA 3WFRE 3OJUA 1VFGA 2NRVA 1NKBA 3HPOA 4JV1A 5KFYA 4Z6EA 8ICFA 4PHAA 3QEBZ 4RT3A 1NJWA 1ZQKA 3PNCA 4O3OA 5KG5A 1TFYA 3ZDAA 4YMNA 3H37A 3MFIA 5CR0A 3V72A 4O0IA 4I28A 3OSNA 4O9MA 5J2FA 2LYHA 5J2HA 5KFGA 1OU5A 2HHPA 2ZH2A 3RBEA 1T3NA 2BQ3A 4F2RA 3GQCA 1ZQFA 2FMQA 2JEJA 1ZQHA 2IA6A 5KFFA 4RWPA 5KG0A 4BGDA 9ICSA 4FHVA 2ISPA 2AQ0A 4QWDA 1NJXA 9ICWA 4I2DA 3PMLA 4RNNA 2DR9A 4QZCA 2JZBB 2ATLA 1U48A 3Q8QB 1A76A 3Q8SB 5DB7A 8ICPA 5HRLA 9ICGA 3JPPA 4QZEA 3GIIA 4PHPA 5HC9A 4EZ9A 5BPCA 4QW9A 4UD5A 4JWMA 1WCNA 5IIJA 2KFZA 4X4OA 3H4DA 2PFNA 5KFWA 3RJGA 9ICCA 2XGQA 2B21A 5J0WA 4GC7A 3V7JA 3N4MB 2HVIA 7ICEA 3KHHA 2DR8A 3C2MA 1X9SA 4RT2A 1NK0A 4YR0A 4RWQA 2R8KA 1PX5A 1ZQXA 1UT5A 2VA8A 5KFIA 5CHGA 5DB8A 2C2DA 1T8EA 3AUOA 4B9UA 2NRTA 8ICYA 2UVRA 4YFKA 1JQRA 2VA3A 4BDPA 1QSLA 3HX0A 1X9MA 1KFSA 3EWAA 4ZH4A 4B9TA 5L1LA 4M9JA 3OVSA 1S0NA 4IR9A 2HVHA 2HHVA 5C5JA 3H7IA 5J2EA 3G6XA 1ZQDA 4IQWA 3ZD9A 2ASJA 9ICVA 5HRIA 5CP2A 2W9BB 2BE3A 2FPMA 1ZQUA 4M5DA 4DFJA 4F2SA 1SKRA 9ICTA 4DSJA 5KFXA 8ICJA 4RPZA 3UXNA 4TUQA 3UQ0A 4J9LA 1KRPA 5IIMA 3B0YA 5EWFA 1SL1A 2BPFA 4KTQA 7ICMA 2BPCA 2V4QA 2I9GA 4KLQA 1KNYA 3PY8A 2Q0ZX 3C21A 2M2UA 1N48A 4KLTA 3EPIA 4DF8A 8ICKA 4AT9A 5J0TA 5IIIA 3T5KA 4O5EA 1R8AA 5F9NA 5DG9A 3QZ8A 2W9CB 4ED8A 4DL4A 2PFPA 7ICOA 8ICTA 3HJ1A 4KLUA 4WC2A 2DRAA 1SZPA 2AU0A 2ISOA 2J6TA 1CUKA 1S0OA 5HHHA 4DSIA 1ZETA 4IQUA 4RWNA 2DFLA 3V7KA 4PPXA 4F4ZA 1B43A 4UB3A 1HUZA 4M6WA 3E2EA 1L5UA 5JUMA 4DSKA 2MAXA 5DB9A 2M2WA 1SL0A 4ECSA 2Y1IA 3T5JA 1NJYA 3OVAA 3AU2A 4DQRA 1S9FA 4DQPA 5J2JA 1XC9A 4QZAA 4KN7A 4JUZA 4QWBA 4DFKA 1ZQNA 4UBCA 1QLNA 3PW7A 4RQ4A 5DECA 4QZ8A 4XUSA 3PMNA 1NK7A 4JV2A 3AQLA 4EBCA 7ICTA 2I1QA 4YR2A 1X9WA 8ICRA 2HHUA 4X4TA 1L3VA 1XSLA 5BOMA 4DS5A 4IG8A 1XS9D 4I2GA 3ZDBA 4FBUA 4M2YA 8ICBA 1D8YA 3RAQA 2IMWP 3AQMA 1JXLA 1ZQRA 1NO5A 3OVBA 1ZQLA 4TQRA 4DLEA 4I2IA 3RB0A 1KTQA 1D9FA 3BJYA 3SYZA 5J0RA 4O3SA 3LQCB 3BDPA 2JZBA 4J9RA 5KTQA 4I29A 5DB6A 3ZDDA 1R8CA 3UXPA 4WC4A 1BPYA 3RJIA 2ZTCA 3RJKA 5J2KA 2W8KA 1NK6A 4ELUA 4O3RA 3PW2A 1NKEA 5KFBA 1KLNA 3RH5A 3PW4A 4TUPA 2BCUA 4O3NA 2BPGA 4UQGA 3RJJA 4YVZA 2P6RA 2P66A 5HMLA 3FDSA 4K4IA 4ECVA 4M9HA 4KLLA 3MGHA 1ZQIA 5F9LA 7ICIA 4F4KA 4FHXA 5EWEA 4ECUA 3RJEA 5D46A 5KFMA 1MC8A 4YD1A 4RNOA 4YG2A 4ED2A 1ZQEA 3JYYA 5L9XA 1ZJNA 4ECRA 3SI8A 4XRHA 5EWGA 7ICGA 3PX4A 2AGQA 9ICAA 5KFZA 5J0QA 3JPTA 9ICNA 2F1IA 4KLJA 4YQWA 4UBBA 4DL3A 4WC6A 4YXJA 4RQ1A 5KT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4P A;  2ASL A;  1S0V A;  2HHW A;  1XSP A;  4EBK A;  4X4V A;  2C2R A;  2BCR A;  7ICL A;  1BNO A;  4UAY A;  2W9B A;  1U47 A;  1NOM A;  4JV0 A;  1HUO A;  3RR8 A;  1MIV A;  3H3A A;  8ICM A;  4FHP A;  1RXV A;  3Q8R B;  9ICI A;  3NGD A;  3JPO A;  3IM1 A;  2BR0 A;  3OHB A;  4DL6 A;  3PW5 A;  1R89 A;  1JIH A;  4I2J A;  4FHW A;  2ZH5 A;  1UEV A;  4F91 B;  5HRK A;  2FPL A;  4KLE A;  5KFR A;  3HT3 A;  3OUY B;  4RQ8 A;  2PFQ A;  4ED0 A;  2JEF A;  5DDM A;  2M2V A;  4WC3 A;  5KFT A;  3LWM A;  3ISB A;  2XY5 A;  3RBD A;  1KFT A;  3LDA A;  4EBD A;  4PHE A;  2A1J B;  3RB6 A;  4RPX A;  2RDI A;  8ICI A;  1PZN A;  1KSP A;  2W8L A;  4BWJ A;  5KFC A;  1TVA A;  9ICJ A;  2KZM A;  1BGX T;  1Z00 A;  2ZH9 A;  4K4G A;  5KG3 A;  3Q8K A;  1MQ2 A;  4I2B A;  5KFK A;  7ICH A;  3HWT A;  4X0B A;  4IQT A;  4NM2 A;  1LV5 A;  9ICR A;  4P4O A;  3OSP A;  3JPQ A;  4DL2 A;  4RU9 A;  2ZH4 A;  3C2K A;  1DGS A;  1TKD A;  4S3N A;  1YLQ A;  9ICO A;  4YMO A;  4FHY A;  5KG4 A;  3EYZ A;  7ICN A;  2ZUB A;  5J2I A;  1S10 A;  3GIM A;  4X4N A;  1ZQM A;  2BQU A;  2FLP A;  4NM1 A;  4NLZ A;  4J9N A;  1L3S A;  4LZD A;  1X2I A;  5DGB A;  3FYH A;  4JK1 A;  3C1Z A;  3H4B A;  2J6S A;  1BPX A;  3HJ4 A;  4RWO A;  4X4S A;  1JMS A;  4ED7 A;  2HHS A;  4G3I A;  5KG1 A;  5J0Y A;  4GLX A;  2PFO A;  3MBY A;  3PO5 A;  3RJF A;  5KFA A;  2OWO A;  4TQS A;  3ZD8 A;  4GC6 A;  2MUT B;  3UQ2 A;  4IRK A;  1UEU A;  2PXI A;  4ED1 A;  4YR3 A;  1T7P A;  4EBJ A;  1ZQZ A;  1UET A;  2WTF A;  3PX6 A;  1B22 A;  4ED3 A;  1EXN A;  2C28 A;  4B9S A;  3RAX A;  3EPG A;  2BDP A;  2DVI A;  2R8G A;  4I2H A;  1XWL A;  4R64 A;  3NTU A;  2XO7 A;  4PH5 A;  1UT8 A;  2MUT A;  2RDJ A;  2GWS A;  1RXW A;  3RRG A;  1K1Q A;  4ATB A;  3SV3 A;  3K4G A;  4DSL A;  4ECQ A;  4XA5 A;  5J2G A;  2KFN A;  3V6H A;  3ZDC A;  5DG8 A;  5J2A A;  4DFP A;  7ICU A;  1FA0 A;  4QZD A;  3GIK A;  3PVX A;  1H38 A;  1NJZ A;  5HRB A;  1VJ7 A;  3V6J A;  4F5R A;  9ICE A;  4FH5 A;  3LWL A;  4KLI A;  4RZR A;  1ZQS A;  1CEZ A;  2UVW A;  1L3T A;  5DKW A;  4UAW A;  3MR5 A;  8ICS A;  2XCA A;  4RUC A;  4Z6F A;  1IM4 A;  3ZDE A;  4QWA A;  4GXJ A;  3T5L A;  4YN4 A;  5KFD A;  4EYH B;  2R8I A;  4F92 B;  2W9M A;  5KG2 A;  2BCQ A;  2IHN A;  4EZ6 A;  8ICU A;  9ICQ A;  3L9D A;  4AT9 B;  4X4P A;  5KT6 A;  2KZZ A;  4HYK A;  3K75 D;  5IIO A;  7ICP A;  1UA0 A;  1Q78 A;  4C8N A;  3SV4 A;  4F4X A;  1U49 A;  4Q8E A;  1RYR A;  9ICX A;  4XQ8 A;  1JXE A;  3MR3 A;  2V4R A;  2FLL A;  4FS1 A;  3BQ1 A;  2ZH7 A;  5L1I A;  1KDH A;  4QZH A;  4E7X A;  1LB2 B;  4ECY A;  4QZB A;  5TZV A;  2DPI A;  4KLO A;  4TUS A;  5KT5 A;  2UVV A;  1DOQ A;  5KFJ A;  1F5A A;  2XGP A;  2AGP A;  4Q43 A;  5J0U A;  3LK9 A;  2PBE A;  4QWC A;  3C2L A;  1TFW A;  3M8S A;  2VAN A;  1WCL A;  1XO1 A;  4R66 A;  5KFH A;  5DED A;  4J9P A;  4ED6 A;  2ZHB A;  2ZTE A;  1A77 A;  3TI0 A;  1NK4 A;  2ZH1 A;  4F5P A;  4E8F A;  4RUA A;  3SZ2 A;  1ZQG A;  5KT3 A;  1BPB A;  2AJQ A;  2BCV A;  5KFE A;  3ISD A;  3TFS A;  3C1Y A;  4ELV A;  3RB3 A;  8ICE A;  1HJP A;  4J9Q A;  5KFQ A;  4F5O A;  3TAR A;  4JWN A;  8ICV A;  2NRW A;  5DBB A;  4C8K A;  3TAN A;  3TAP A;  5CB1 A;  2FLN A;  1Z3E B;  4QZI A;  4PGX A;  2FPK A;  3N97 B;  4M9N A;  4Q45 A;  5KFS A;  1S76 D;  8ICW A;  5HRF A;  4R65 A;  4EEY A;  4GXK A;  3Q8L A;  1ZQO A;  4F3O A;  5J29 A;  1S77 D;  4IRD A;  3AQK A;  3KHR A;  3PX0 A;  3GV8 B;  5DGA A;  5DLF A;  2M2T A;  2KN7 A;  1U45 A;  1XU4 A;  7ICJ A;  1TK5 A;  2FMS A;  2ZJ5 A;  5DDY A;  3T3F A;  3RB4 A;  1ZQT A;  3HW8 A;  5F2V O;  1TAU A;  5DBA A;  5J0P A;  4I2A A;  5KFP A;  4RQ3 A;  4FO6 A;  4DL5 A;  1MIW A;  3EZ5 A;  2KTQ A;  2XY6 A;  4ECT A;  4MFC A;  3BQ2 A;  9ICB A;  4NXZ A;  1RYS A;  4XQ7 A;  4NY8 A;  4WCW A;  5IIK A;  4K4H A;  4M04 A;  2R8H A;  1KFD A;  4KMU A;  4M9L A;  3B0X A;  1NKC A;  3JZ0 A;  2DR7 A;  4QW8 A;  4QZ9 A;  5KG6 A;  4I2C A;  4I2E A;  1ZQA A;  5HP4 A;  8ICQ A;  1R8B A;  4KLS A;  3JPR A;  1ZQP A;  1ZQY A;  4DL7 A;  1K1S A;  2M9N A;  1WOT A;  4EP7 A;  4NLK A;  1UA1 A;  3RJH A;  2ZUC A;  5HRE A;  3BQ0 A;  3MR6 A;  3QEA Z;  3T5H A;  8ICN A;  4RQ0 A;  2ALZ A;  4Z6D A;  8ICX A;  3THV A;  2NRZ A;  4IQV A;  1L3U A;  1TFR A;  3GIJ A;  4KN4 A;  2HHX A;  2HHT A;  5CA7 A;  4IR1 A;  2A1J A;  2IHM A;  3HIY A;  2XC9 A;  4M47 A;  4Q44 A;  1U9L A;  4ECZ A;  4C8M A;  4PGQ A;  1COO A;  3UPS A;  3G6Y A;  1BPZ A;  1NK9 A;  3RR7 A;  4I2F A;  4O5K A;  3V6K A;  3MGI A;  2NRK A;  4DS4 A;  5DQI A;  4DO9 A;  3UXO A;  3C5F A;  3OUY A;  2W9C A;  1SKW A;  5J0O A;  2PI4 A;  3KTQ A;  3MFH A;  4M0A A;  1DK2 A;  3NYB A;  2DRB A;  4KIT B;  2BQR A;  3PR4 A;  1C7Y A;  4AT8 A;  3MAB A;  3TQ1 A;  3RH6 A;  5L1J A;  1D9D A;  5KG7 A;  2J6U A;  4DQI A;  3GIL A;  4QWE A;  1T4G A;  4MEX A;  1U4B A;  8ICO A;  2ZH3 A;  1KEJ A;  2XY7 A;  2F1J A;  5J2C A;  4WC7 A;  3EW9 A;  4KLD A;  2ZJA A;  3H40 A;  4F93 B;  3C18 A;  5EOZ A;  4AT7 A;  4WC5 A;  3QZ7 A;  1ZQW A;  1TK0 A;  1ZQB A;  4KLH A;  2BKE A;  1Y88 A;  4QZF A;  8ICZ A;  1Z00 B;  2ZH8 A;  5D49 A;  5BOL A;  3UPQ A;  3PW0 A;  5HMM A;  5IIL A;  1ZYQ A;  1BVS A;  2ZUD A;  4MF8 A;  1QTM A;  4MFF A;  2HW3 A;  1D8L A;  1V4A A;  3GDX A;  4DOB A;  2JEI A;  2AGO A;  3WFP A;  3GV5 B;  3H8S A;  9ICK A;  3PR5 B;  2P6U A;  2H5X A;  4Q8F A;  1NK8 A;  9ICM A;  2NRX A;  5KT2 A;  5DQG A;  5J2B A;  5CWR A;  4NKU A;  3AQN A;  5HRD A;  4X4R A;  3M8R A;  1SKS A;  2PI5 A;  4DWI A;  7ICQ A;  4E80 A;  2F1H A;  3G6V A;  4DOC A;  3MDA A;  3TFR A;  1NK5 A;  2KP7 A;  4QZG A;  3GV7 B;  4O3Q A;  5DBC A;  1SL2 A;  3ISC A;  1BPE A;  1TV9 A;  4NKT A;  4X4U A;  3ETL A;  4DLG A;  4UB1 A;  2AQ4 A;  1QSS A;  3H8W A;  1S97 A;  1MQ3 A;  4C8O A;  4KLF A;  4F5Q A;  9ICP A;  7ICV A;  5HR9 A;  5CJ7 A;  4F5N A;  3C23 A;  4WC1 A;  4BXO B;  1S0M A;  9ICL A;  4RNM A;  2DR5 A;  4DFM A;  2ASD A;  4YXM A;  4O5C A;  2BGW A;  4WBZ A;  3IHQ B;  3OHA A;  4X0A A;  4B9N A;  1ZQV A;  2W9A A;  4BXO A;  8ICH A;  3H38 A;  4FH3 A;  4RQ7 A;  4CCH A;  4MFA A;  4MEY A;  2UVU A;  4R8U A;  5KFV A;  4FBT A;  3ORY A;  4LZG A;  4J9S A;  2O5A A;  3M9O B;  4DOA A;  2Y1J A;  1NZP A;  2XCP A;  3BQT A;  5L1K A;  4F4Y A;  5D4B A;  4DSF A;  4NLN A;  5IIN A;  2C22 A;  4F50 A;  3QE9 Y;  4IRC A;  7ICF A;  3M9M B;  4PHD A;  1IXR A;  4ECW A;  1N56 A;  3H8J A;  5HRG A;  5KT7 A;  4WBY A;  4RQ2 A;  3JPS A;  4F4W A;  4ECX A;  3PV8 A;  4KLM A;  1BPD A;  1ZQJ A;  5DG7 A;  4RQ5 A;  8ICG A;  5KFU A;  8ICC A;  3GFK B;  2R8J A;  4DSE A;  3JPN A;  2BCS A;  4UD4 A;  3WFO A;  4O3P A;  1QSY A;  5DLG A;  5HHI A;  4DF4 A;  2V9W A;  7ICK A;  2ID1 A;  2ZHA A;  4UAZ A;  1BNP A;  1RPL A;  3C5G A;  1JX4 A;  4WC0 A;  2RFF A;  3C66 A;  4I27 A;  4DEZ A;  5HNK A;  3KHL A;  5J2D A;  4B9L A;  4FS2 A;  8ICL A;  3WFQ E;  1MSW D;  2ZJ8 A;  5KFO A;  3RH4 A;  9ICF A;  4NLG A;  9ICH A;  2O1P A;  2HHQ A;  4EBE A;  2C2E A;  3MDC A;  2IBK A;  2ZH6 A;  4P2H A;  2Q66 A;  7ICR A;  4MF2 A;  3OV7 A;  4LVS A;  4E0D A;  1DK3 A;  7ICS A;  1JN3 A;  3V7L A;  3TAQ A;  4C8L A;  4M9G A;  5HRH A;  4PGY A;  1RZT A;  1ZQQ A;  1MIY A;  4DQS A;  1Q79 A;  3H39 A;  4RQ6 A;  2KZ3 A;  4YMM A;  2ZTD A;  1ARO P;  4LT6 A;  5KFN A;  3RTV A;  4AT7 B;  1TAQ A;  4TUR A;  4P4M A;  4UB2 A;  4AT8 B;  5J0X A;  5J0S A;  4J9O A;  3HP6 A;  4J9K A;  9ICU A;  3PO4 A;  2DPJ A;  4KLG A;  3WFS C;  3OJS A;  4F8R A;  4DQQ A;  4J9M A;  4R63 A;  4RPY A;  3Q8P B;  3RRH A;  3M9N B;  3AU6 A;  2JEG A;  5DQH A;  3MR2 A;  4YCX A;  4UB5 A;  1JAJ A;  4EYI B;  4Z6C A;  4M6W B;  4UB4 A;  3Q8M A;  4ATB B;  5KFL A;  1TK8 A;  4GXI A;  1ZQC A;  4YD2 A;  4B9M A;  2BHN A;  1XSN A;  4R8U B;  4X5V A;  4B9V A;  1ZJM A;  2VA2 A;  3OGU A;  4ELT A;  8ICA A;  4BWM A;  1V9P A;  2FMP A;  4X4Q A;  4YP3 A;  3KHG A;  3WFR E;  3OJU A;  1VFG A;  2NRV A;  1NKB A;  3HPO A;  4JV1 A;  5KFY A;  4Z6E A;  8ICF A;  4PHA A;  3QEB Z;  4RT3 A;  1NJW A;  1ZQK A;  3PNC A;  4O3O A;  5KG5 A;  1TFY A;  3ZDA A;  4YMN A;  3H37 A;  3MFI A;  5CR0 A;  3V72 A;  4O0I A;  4I28 A;  3OSN A;  4O9M A;  5J2F A;  2LYH A;  5J2H A;  5KFG A;  1OU5 A;  2HHP A;  2ZH2 A;  3RBE A;  1T3N A;  2BQ3 A;  4F2R A;  3GQC A;  1ZQF A;  2FMQ A;  2JEJ A;  1ZQH A;  2IA6 A;  5KFF A;  4RWP A;  5KG0 A;  4BGD A;  9ICS A;  4FHV A;  2ISP A;  2AQ0 A;  4QWD A;  1NJX A;  9ICW A;  4I2D A;  3PML A;  4RNN A;  2DR9 A;  4QZC A;  2JZB B;  2ATL A;  1U48 A;  3Q8Q B;  1A76 A;  3Q8S B;  5DB7 A;  8ICP A;  5HRL A;  9ICG A;  3JPP A;  4QZE A;  3GII A;  4PHP A;  5HC9 A;  4EZ9 A;  5BPC A;  4QW9 A;  4UD5 A;  4JWM A;  1WCN A;  5IIJ A;  2KFZ A;  4X4O A;  3H4D A;  2PFN A;  5KFW A;  3RJG A;  9ICC A;  2XGQ A;  2B21 A;  5J0W A;  4GC7 A;  3V7J A;  3N4M B;  2HVI A;  7ICE A;  3KHH A;  2DR8 A;  3C2M A;  1X9S A;  4RT2 A;  1NK0 A;  4YR0 A;  4RWQ A;  2R8K A;  1PX5 A;  1ZQX A;  1UT5 A;  2VA8 A;  5KFI A;  5CHG A;  5DB8 A;  2C2D A;  1T8E A;  3AUO A;  4B9U A;  2NRT A;  8ICY A;  2UVR A;  4YFK A;  1JQR A;  2VA3 A;  4BDP A;  1QSL A;  3HX0 A;  1X9M A;  1KFS A;  3EWA A;  4ZH4 A;  4B9T A;  5L1L A;  4M9J A;  3OVS A;  1S0N A;  4IR9 A;  2HVH A;  2HHV A;  5C5J A;  3H7I A;  5J2E A;  3G6X A;  1ZQD A;  4IQW A;  3ZD9 A;  2ASJ A;  9ICV A;  5HRI A;  5CP2 A;  2W9B B;  2BE3 A;  2FPM A;  1ZQU A;  4M5D A;  4DFJ A;  4F2S A;  1SKR A;  9ICT A;  4DSJ A;  5KFX A;  8ICJ A;  4RPZ A;  3UXN A;  4TUQ A;  3UQ0 A;  4J9L A;  1KRP A;  5IIM A;  3B0Y A;  5EWF A;  1SL1 A;  2BPF A;  4KTQ A;  7ICM A;  2BPC A;  2V4Q A;  2I9G A;  4KLQ A;  1KNY A;  3PY8 A;  2Q0Z X;  3C21 A;  2M2U A;  1N48 A;  4KLT A;  3EPI A;  4DF8 A;  8ICK A;  4AT9 A;  5J0T A;  5III A;  3T5K A;  4O5E A;  1R8A A;  5F9N A;  5DG9 A;  3QZ8 A;  2W9C B;  4ED8 A;  4DL4 A;  2PFP A;  7ICO A;  8ICT A;  3HJ1 A;  4KLU A;  4WC2 A;  2DRA A;  1SZP A;  2AU0 A;  2ISO A;  2J6T A;  1CUK A;  1S0O A;  5HHH A;  4DSI A;  1ZET A;  4IQU A;  4RWN A;  2DFL A;  3V7K A;  4PPX A;  4F4Z A;  1B43 A;  4UB3 A;  1HUZ A;  4M6W A;  3E2E A;  1L5U A;  5JUM A;  4DSK A;  2MAX A;  5DB9 A;  2M2W A;  1SL0 A;  4ECS A;  2Y1I A;  3T5J A;  1NJY A;  3OVA A;  3AU2 A;  4DQR A;  1S9F A;  4DQP A;  5J2J A;  1XC9 A;  4QZA A;  4KN7 A;  4JUZ A;  4QWB A;  4DFK A;  1ZQN A;  4UBC A;  1QLN A;  3PW7 A;  4RQ4 A;  5DEC A;  4QZ8 A;  4XUS A;  3PMN A;  1NK7 A;  4JV2 A;  3AQL A;  4EBC A;  7ICT A;  2I1Q A;  4YR2 A;  1X9W A;  8ICR A;  2HHU A;  4X4T A;  1L3V A;  1XSL A;  5BOM A;  4DS5 A;  4IG8 A;  1XS9 D;  4I2G A;  3ZDB A;  4FBU A;  4M2Y A;  8ICB A;  1D8Y A;  3RAQ A;  2IMW P;  3AQM A;  1JXL A;  1ZQR A;  1NO5 A;  3OVB A;  1ZQL A;  4TQR A;  4DLE A;  4I2I A;  3RB0 A;  1KTQ A;  1D9F A;  3BJY A;  3SYZ A;  5J0R A;  4O3S A;  3LQC B;  3BDP A;  2JZB A;  4J9R A;  5KTQ A;  4I29 A;  5DB6 A;  3ZDD A;  1R8C A;  3UXP A;  4WC4 A;  1BPY A;  3RJI A;  2ZTC A;  3RJK A;  5J2K A;  2W8K A;  1NK6 A;  4ELU A;  4O3R A;  3PW2 A;  1NKE A;  5KFB A;  1KLN A;  3RH5 A;  3PW4 A;  4TUP A;  2BCU A;  4O3N A;  2BPG A;  4UQG A;  3RJJ A;  4YVZ A;  2P6R A;  2P66 A;  5HML A;  3FDS A;  4K4I A;  4ECV A;  4M9H A;  4KLL A;  3MGH A;  1ZQI A;  5F9L A;  7ICI A;  4F4K A;  4FHX A;  5EWE A;  4ECU A;  3RJE A;  5D46 A;  5KFM A;  1MC8 A;  4YD1 A;  4RNO A;  4YG2 A;  4ED2 A;  1ZQE A;  3JYY A;  5L9X A;  1ZJN A;  4ECR A;  3SI8 A;  4XRH A;  5EWG A;  7ICG A;  3PX4 A;  2AGQ A;  9ICA A;  5KFZ A;  5J0Q A;  3JPT A;  9ICN A;  2F1I A;  4KLJ A;  4YQW A;  4UBB A;  4DL3 A;  4WC6 A;  4YXJ A;  4RQ1 A;  5KT4 A; 
#chains in the Genus database with same CATH topology
 4EBK A;  4EEL A;  3RFA A;  5L1M A;  2HN2 A;  7ICL A;  3K7D A;  3CK6 A;  1X6J A;  1NOM A;  1HUO A;  3H3A A;  3NGD A;  3JPO A;  3OWG A;  5CFT A;  4DL6 A;  1JIH A;  4WOY A;  3LVV A;  2ZH5 A;  1L7M A;  3OUY B;  2YB4 A;  2YQE A;  4ED0 A;  4LJX A;  2M2V A;  4ZOH C;  2XY5 A;  3LDA A;  4RPX A;  1T94 A;  2RDI A;  8ICI A;  4CRX A;  2DWQ A;  1TVA A;  1BGX T;  4PZN A;  5KG3 A;  1MQ2 A;  1N5W A;  5KFK A;  7ICH A;  5AM1 A;  4IQT A;  9ICR A;  2ZH4 A;  1TKD A;  4YMO A;  3NRW A;  5KG4 A;  2ZUB A;  5J2I A;  4O3M A;  1ZQM A;  1N61 A;  4EEK A;  4J9N A;  1L3S A;  4LZD A;  3FYH A;  3HJ4 A;  3UMG A;  2MRL A;  5ALE A;  5J0Y A;  1RQN A;  3MBY A;  2OWO A;  3ZD8 A;  4GC6 A;  4IRK A;  1UEU A;  4CDG A;  3N7P D;  3NUQ A;  1UET A;  2WTF A;  3PX6 A;  1B22 A;  4GFJ A;  4B9S A;  2KIV A;  3EPG A;  2DVI A;  1XWL A;  2XO7 A;  4KM5 A;  4MHV A;  2MUT A;  3RRG A;  1K1Q A;  2D6F C;  1PK3 A;  2LMR A;  4DSL A;  2Y0S F;  4DFP A;  4KX5 A;  1L8O A;  3NVZ A;  2CN1 A;  3D6J A;  2LYA A;  3GIK A;  3PVX A;  1VJ7 A;  1ZRN A;  3N7R C;  3TAD A;  4K97 A;  4RZR A;  1ZQS A;  3LYS A;  2KMD A;  5DKW A;  3ZDE A;  1KLN A;  3OTQ A;  4QWA A;  2IHN A;  5KFD A;  8ICU A;  2BCQ A;  2YTU A;  5ALI A;  5ALG A;  2EZY A;  1RYR A;  3ERC C;  3MR3 A;  4ECY A;  4QZB A;  2HOF A;  4QNL A;  1L7O A;  2E1F A;  4TUS A;  2BZF A;  5J0U A;  1TFW A;  3C2L A;  3IP4 B;  2OEH A;  5KFH A;  5DED A;  5J8Y C;  3SZ2 A;  4RUA A;  5KT3 A;  5KFE A;  8ICE A;  4J9Q A;  3TAR A;  4JWN A;  8ICV A;  2FJ6 A;  5CB1 A;  4QZI A;  2JMG A;  4EEY A;  3Q8L A;  4F3O A;  5J8Y A;  3GV8 B;  5DGA A;  5AIC A;  5AKZ A;  2KN7 A;  2FMS A;  3T3F A;  5DDY A;  1Q3U A;  5DBA A;  4C7Z A;  1COK A;  5KFP A;  2F3N A;  2XY6 A;  3BQ2 A;  5IIK A;  3JZ0 A;  4QW8 A;  4I2E A;  1R8B A;  5HP4 A;  3JPR A;  1OXJ A;  1WOT A;  3HIL A;  4NLK A;  4EGW A;  4EP7 A;  3OPX A;  3T5H A;  4IQV A;  1TFR A;  3GIJ A;  2HHX A;  2HHT A;  3NWI A;  4IR1 A;  2IHM A;  4Y2P A;  3NRZ A;  4C8M A;  4PGQ A;  4O5K A;  3RR7 A;  1NK9 A;  4KMO B;  4EEN A;  2W9C A;  2ZIW A;  1SKW A;  4C4R A;  3NYB A;  2L5Y A;  3MAB A;  5ALN A;  3TQ1 A;  3WK8 A;  4QWE A;  1U4B A;  2ZH3 A;  5EOZ A;  1NZB A;  4CF3 A;  2ZH8 A;  4QZF A;  8ICZ A;  1WUD A;  1Z00 B;  5BOL A;  3PW0 A;  2HW3 A;  1ZYQ A;  2KV2 A;  2B0C A;  2ZUD A;  1QTM A;  4DOB A;  2JEI A;  4NV0 A;  3GV5 B;  3PR5 B;  2H5X A;  5CWR A;  4NKU A;  3M8R A;  2PI5 A;  7ICQ A;  4DOC A;  4KB6 A;  4C80 A;  4QZG A;  3GV7 B;  4NKT A;  2R18 A;  4X4U A;  4DLG A;  4C8O A;  7ICV A;  1MQ3 A;  4NXU A;  4OJL A;  4F5N A;  4BXO B;  1S0M A;  4RNM A;  4DFM A;  1YT3 A;  2ASD A;  4O5C A;  3IHQ B;  1ZRM A;  4X0A A;  2W9A A;  4CCH A;  5AIA A;  4OD0 A;  1NZP A;  4CF5 A;  2XCP A;  4O67 A;  4NLN A;  2C22 A;  5HRG A;  4F4W A;  4RQ5 A;  2BCS A;  3WFO A;  3N7S C;  5DLG A;  5HHI A;  2V9W A;  3J81 j;  2RFF A;  4I27 A;  2WHE A;  2FE9 A;  5HNK A;  3TAC B;  8ICL A;  5KAI U;  4EBE A;  1Z1B A;  2Q66 A;  2KE7 A;  1DK3 A;  1JN3 A;  3TAQ A;  4PGY A;  1MIY A;  2KZ3 A;  4YMM A;  2ZTD A;  3RTV A;  5J0X A;  1L6N A;  4CE6 A;  3BS5 A;  5J0S A;  2KIC A;  3PO4 A;  4DQQ A;  2JHD A;  4RPY A;  3AU6 A;  5DQH A;  3MR2 A;  4YCX A;  3QNM A;  3WK4 A;  2ZG6 A;  4G9B A;  2WAQ C;  4RQM A;  1XSN A;  4R8U B;  4X5V A;  3PSP A;  4ELT A;  4BWM A;  3QYP A;  3WFR E;  3OJU A;  5G5H A;  4Y2X A;  4JV1 A;  5AM5 A;  4BX9 C;  5KFY A;  8ICF A;  2DBY A;  3I76 A;  3CRX A;  1NJW A;  5KG5 A;  1KL9 A;  4O0I A;  5J2F A;  5J2H A;  4I0U A;  5KFG A;  1SIJ A;  5AI8 A;  1T3N A;  2BQ3 A;  3F5A A;  4F2R A;  3AN1 A;  2G06 A;  4QWD A;  1L7P A;  3M7D A;  4I2D A;  3PML A;  4BJQ A;  5DB7 A;  2LKY A;  9ICG A;  1VJ5 A;  5HC9 A;  1KW4 A;  2FI1 A;  1WCN A;  3H0M B;  5AK3 A;  4X4O A;  4US9 A;  9ICC A;  5AKY A;  7ICE A;  4RT2 A;  1NK0 A;  4RWQ A;  1PX5 A;  4IRD A;  3N28 A;  5CHG A;  1T8E A;  2JH1 A;  8ICY A;  4M5D A;  4YFK A;  5AI4 A;  1JQR A;  1QSL A;  2H3Q A;  1ZXI A;  5L1L A;  4M9J A;  4WH5 A;  4IR9 A;  2HVH A;  2HHV A;  5C5J A;  2MA1 A;  5CP2 A;  2BE3 A;  5KFX A;  8ICJ A;  4TUQ A;  3UQ0 A;  4FO1 A;  2WF8 A;  3SMV A;  2XIC A;  4J9L A;  1Z19 A;  2I9G A;  3C21 A;  2M2U A;  4DF8 A;  5J0T A;  3QZ8 A;  2PFP A;  2DRA A;  2AU0 A;  3B9J A;  2J6T A;  3RF9 A;  1S0O A;  1FFV A;  3FC4 A;  5AM4 A;  2IHO A;  1B43 A;  5JUM A;  2ZIX B;  1NJY A;  2W03 A;  2Y1I A;  4GIB A;  1S9F A;  4KN7 A;  4UBC A;  3PW7 A;  4RQ4 A;  3PMN A;  7ICT A;  2I1Q A;  1X9W A;  4X4T A;  1XSL A;  5BOM A;  5AI0 A;  3DEE A;  4IG8 A;  2GO7 A;  4OJO A;  4I2G A;  4FBU A;  1D8Y A;  4K9B A;  2DQN B;  2KHV A;  4DLE A;  4I2I A;  1QQ7 A;  4O3S A;  2A1A A;  4J9R A;  3UXP A;  1D8B A;  4WQL A;  4TUP A;  3RJJ A;  2P6R A;  2P66 A;  7ICI A;  4ECV A;  2KSO A;  4F4K A;  4FHX A;  3RJE A;  2WB1 F;  5KFM A;  1MC8 A;  4QJF B;  4RNO A;  5D62 A;  1ZJN A;  4ECR A;  2QLT A;  1AQ6 A;  3PX4 A;  3H0L B;  4UAR A;  4YXJ A;  2MU2 A;  4P4P A;  2HHW A;  2BCR A;  1SWV A;  3SAF A;  4FHP A;  9ICI A;  2BR0 A;  1R89 A;  3PW5 A;  2PMZ C;  4FHW A;  4NXW A;  1UEV A;  4F91 B;  2FPL A;  4KLE A;  3HT3 A;  4WC3 A;  3ISB A;  3RBD A;  1KFT A;  2E8O A;  1PZN A;  4UAU A;  2W8L A;  5KFC A;  2YB1 A;  3QUB A;  2ZIV B;  3Q8K A;  4OAF A;  3JPQ A;  1DGS A;  3KFU F;  4FHY A;  7ICN A;  3GIM A;  1DXS A;  5JRT A;  1X2I A;  1LKY A;  4JK1 A;  3C1Z A;  2IOF K;  5T14 A;  2BBH A;  2W3R A;  2W54 A;  1SGG A;  1JRO A;  5KFA A;  3UQ2 A;  5EE1 A;  4YR3 A;  2AH5 A;  4EEB A;  3HKZ C;  1CRX A;  1WWV A;  4FFD A;  2BDP A;  3NTU A;  4PH5 A;  1UT8 A;  2GWS A;  4NLB A;  4ATB A;  3K4G A;  3C28 A;  2KFN A;  3NS1 A;  2VJ5 A;  3ZDC A;  5DG8 A;  2I5H A;  7ICU A;  3ED5 A;  5HRB A;  3QU2 A;  1X42 A;  4F5R A;  1RG6 A;  3LWL A;  1MA7 A;  4KLI A;  3MR5 A;  4RUC A;  5E79 U;  2ZH7 A;  5GTH U;  2B51 A;  2R8I A;  4F92 B;  4X4P A;  4AYB F;  1HIW A;  1ZQ1 C;  2JRZ A;  3K75 D;  2KJ5 A;  5IIO A;  1UA0 A;  7ICP A;  1Z4O A;  2FLL A;  2LI6 A;  5L1I A;  4E7X A;  1S8O A;  3LVW A;  3QU7 A;  3EUB 2;  2PBE A;  2XVT A;  1TE2 A;  2VAN A;  1WCL A;  4R66 A;  4J9P A;  2EDU A;  2ZTE A;  2ZHB A;  4F5P A;  4E8F A;  1ZQG A;  5ALZ A;  2E8P A;  3C1Y A;  2OHF A;  1HJP A;  4F5O A;  2NRW A;  5DBB A;  3TAN A;  3WKB A;  4Y2U A;  2KNJ A;  2FPK A;  5KFS A;  3AQK A;  1HEK A;  4NXV A;  2VKQ A;  2M2T A;  2HN1 A;  4WQK A;  1ZQT A;  1PK1 B;  3HW8 A;  4AYB C;  1TAU A;  2EZX A;  4RQ3 A;  2W7O A;  4NJ8 A;  4DL5 A;  3QUT A;  4ECT A;  4MFC A;  9ICB A;  1QCK A;  4K4H A;  2DL0 A;  2R8H A;  3ALR A;  3A0B U;  1NKC A;  1QH9 A;  4QZ9 A;  4I2C A;  2BDU A;  4KLS A;  1CI4 A;  1ZQY A;  4DL7 A;  1K1S A;  3D2N A;  2M9N A;  3IG5 A;  3BQ0 A;  3MR6 A;  1ECW A;  2YMM A;  4Z6D A;  8ICX A;  1L3U A;  1PVR A;  3KOO A;  3L3F X;  4Q44 A;  2W43 A;  3HKZ F;  3G6Y A;  4ICA A;  1BPZ A;  1LKY B;  3V6K A;  1JRP A;  3C5F A;  1ZD2 P;  5J0O A;  2PI4 A;  4AT8 A;  5L1J A;  1D9D A;  5KG7 A;  5CEH A;  4DQI A;  4MEX A;  8ICO A;  3CNH A;  2PKE A;  1KEJ A;  1KQQ A;  2OXO A;  2ZJA A;  5KL1 B;  1ZQW A;  1TK0 A;  1ZQB A;  1FO4 A;  2Y9U A;  5D49 A;  5IIL A;  4MF8 A;  4MFF A;  4EX7 A;  3WFP A;  4Y2J A;  2P6U A;  2K8C B;  2AHO B;  4X4R A;  3KZI U;  5EE9 A;  1SKS A;  3G6V A;  1A0P A;  1NK5 A;  2KP7 A;  1BPE A;  4Y2R A;  3ETL A;  4UB1 A;  3H8W A;  2LHT A;  5CJ7 A;  4WC1 A;  9ICL A;  4YXM A;  2EZZ A;  2BGW A;  3OHA A;  4B9N A;  1ZQV A;  4BXO A;  1S5L U;  4FH3 A;  4MFA A;  4MEY A;  4NL9 A;  2KK0 A;  1OUQ A;  4FBT A;  1T3Q A;  4J9S A;  2Y1J A;  5L1K A;  2NYV A;  2DGZ A;  2KSO B;  4IRC A;  3M9M B;  1N56 A;  3H8J A;  5KT7 A;  3KKA A;  1IIP A;  3QU5 A;  1BPD A;  1ZQJ A;  5KFU A;  2RP5 A;  4DSE A;  3JPN A;  4UD4 A;  4DCC A;  7ICK A;  2W55 A;  2K4H A;  2EWR A;  4K98 A;  4K99 A;  2E1E A;  2HHQ A;  5AM0 A;  2IBK A;  4P2H A;  7ICR A;  3AQF A;  1JAL A;  4LVS A;  4C8L A;  1RZT A;  3H39 A;  5KFN A;  1TAQ A;  4TUR A;  4P4M A;  4UB2 A;  5ALF A;  3HP6 A;  4KLG A;  3OJS A;  4J9M A;  3RRH A;  3M9N B;  1WG8 A;  2ZXI A;  2W04 A;  4UB5 A;  4EYI B;  4UB4 A;  3ICX A;  5AM2 A;  4ATB B;  5KFL A;  2QB0 A;  3M6K A;  1TK8 A;  1ZQC A;  2BHN A;  1ZJM A;  2VA2 A;  4JLZ A;  4YP3 A;  3U26 A;  3KHG A;  1VFG A;  2NRV A;  3HPO A;  4PHA A;  3KBB A;  2WF5 A;  4RT3 A;  4O3O A;  1TFY A;  4YMN A;  3H37 A;  3V72 A;  5K4L A;  3OSN A;  2ZH2 A;  2VJ4 A;  2KKP A;  4FZN A;  3GQC A;  1ZQF A;  1SV0 A;  4UB6 U;  2FMQ A;  4P0P A;  2OM6 A;  1OW5 A;  5KFF A;  4RWP A;  9ICS A;  1IV8 A;  4FHV A;  2ISP A;  9ICW A;  3AEV A;  4FZM A;  3UMC A;  2JZB B;  4US8 A;  1A76 A;  4U6P A;  8ICP A;  4QZE A;  1UQV A;  5IIJ A;  2KFZ A;  2WFA A;  2PMZ F;  1XNS A;  2XGQ A;  2B21 A;  4J03 A;  5J0W A;  2Y9T A;  3FAH A;  2VA8 A;  5KFI A;  2C2D A;  2H3F A;  2K89 A;  1XO0 A;  4EV6 A;  4B9T A;  5AKH A;  2HBK A;  1S0N A;  3G6X A;  2ASJ A;  3WKE A;  1FFU A;  2ODG A;  2WF9 A;  2LBO A;  2WB1 C;  4OCZ A;  2K8B B;  4DSJ A;  3UXN A;  4RQN A;  1J2M A;  5IIM A;  3B0Y A;  5EWF A;  4K8V A;  3I28 A;  3PY8 A;  4USA A;  1N48 A;  3T5K A;  4O5E A;  8ICT A;  4ED8 A;  4C4T A;  4WC2 A;  3CYM A;  1SZP A;  4LEV A;  4DSI A;  3A0H U;  2W3S A;  5AIB A;  5HHH A;  1ZET A;  4UB3 A;  1L5U A;  2MAX A;  3IG8 A;  2M2W A;  1SL0 A;  4ECS A;  3T5J A;  3OVA A;  4DQR A;  2ESE A;  1MN8 A;  2G09 A;  1ZQN A;  1QLN A;  3IV6 A;  1NK7 A;  8ICR A;  2NV3 A;  4M2Y A;  8ICB A;  3AQM A;  1GO3 F;  2RRD A;  2ZIU B;  3RB0 A;  1KTQ A;  1D9F A;  3BJY A;  2JZB A;  3NVW A;  4WC4 A;  3F53 A;  2ZTC A;  4O3R A;  5G5G A;  1UPH A;  3PW4 A;  4O3N A;  4UQG A;  4YVZ A;  4M9H A;  5HML A;  3UPS A;  3QX7 A;  5EWE A;  4ECU A;  1UCV A;  3JYY A;  3SI8 A;  4XRH A;  2AGQ A;  1YZ6 A;  2F1I A;  5ALM A;  4UBB A;  4DL3 A;  2JEF A;  5AM3 A;  4X4V A;  1S0V A;  2HCF A;  1XSP A;  2C2R A;  2GAF D;  2E5S A;  3RR8 A;  4JV0 A;  3WK6 A;  1MIV A;  8ICM A;  1RXV A;  2G0A A;  3Q8R B;  1SB3 C;  4CF4 A;  3IM1 A;  3OHB A;  1JUD A;  2HOI A;  5HRK A;  3BZC A;  3WKD A;  4RQ8 A;  2PFQ A;  1A6S A;  5KFT A;  1B0X A;  4MKP A;  5F3X B;  4PHE A;  3RB6 A;  4BWJ A;  9ICJ A;  1Z00 A;  3K1R B;  2E8M A;  5ALX A;  3OSP A;  3C2K A;  2OCE A;  4S3N A;  2YY6 A;  9ICO A;  1N5X A;  3EYZ A;  2KVC A;  5JU5 A;  2BQU A;  2FLP A;  2WF6 A;  4NLZ A;  5DGB A;  4RWO A;  4JB3 A;  2J6S A;  1BPX A;  1JMS A;  4Y2T A;  1VDV A;  3EF2 A;  3VC8 A;  3S6J A;  2WAQ F;  2PXI A;  4ED1 A;  2FCL A;  1T7P A;  3DDH A;  1ZQZ A;  5ALQ A;  5B3P A;  2CRX A;  3MC1 A;  2C28 A;  2R8G A;  4I2H A;  3NAS A;  4R64 A;  4N7R A;  3AQE A;  2DUY A;  2RDJ A;  2D8C A;  1RXW A;  5EE0 A;  3SV3 A;  4FE3 A;  4ECQ A;  2KJ8 A;  5J2G A;  3V6H A;  5J2A A;  1X6I A;  4QZD A;  5CHE A;  1H38 A;  1NJZ A;  5ALO A;  1J2N A;  3V6J A;  3ZI4 A;  2KJ9 A;  3SR6 A;  2I6X A;  1CEZ A;  4O68 A;  1N63 A;  4UAW A;  8ICS A;  2XCA A;  4Z6F A;  1IM4 A;  1N60 A;  4YN4 A;  5KG2 A;  2HBM A;  2W9M A;  4EZ6 A;  9ICQ A;  4AT9 B;  2KZZ A;  4IL6 U;  4HYK A;  1Q78 A;  2KIW A;  4C8N A;  3SV4 A;  4F4X A;  1U49 A;  9ICX A;  4QZH A;  4KLO A;  2WF7 A;  1F5A A;  5KFJ A;  2AGP A;  4Q43 A;  3BS5 B;  4QWC A;  5ALJ A;  2FDR A;  5HR6 A;  1XO1 A;  3VCB A;  4ED6 A;  1NK4 A;  2ZH1 A;  2EH9 A;  5ALU A;  1BPB A;  2G5H B;  1Q46 A;  2AJQ A;  2BCV A;  4ELV A;  1NI3 A;  4F72 A;  4C8K A;  3TAP A;  4M9N A;  4PGX A;  3N97 B;  8ICW A;  4Q45 A;  2F76 X;  1NNL A;  5J29 A;  1K5O A;  3PX0 A;  2K8A A;  7ICJ A;  1TK5 A;  3RB4 A;  5F2V O;  1N2X A;  5J0P A;  2JGA A;  1SWW A;  4HX0 A;  4FO6 A;  1MIW A;  3EZ5 A;  2KTQ A;  5AKE A;  5ALD A;  1RYS A;  4XQ7 A;  3D2Q A;  2LM1 A;  2LPE A;  4M9L A;  4JLX A;  2DR7 A;  4QIW F;  5KG6 A;  3IDW A;  1ZQA A;  3RJH A;  3NVV A;  5HRE A;  5ALK A;  3QEA Z;  8ICN A;  4RQ0 A;  2ALZ A;  1O08 A;  3THV A;  2NRZ A;  4O69 A;  4KN4 A;  5CA7 A;  2DF4 B;  4UAS A;  3HIY A;  2XC9 A;  4IC9 A;  1U9L A;  4ECZ A;  4I2F A;  3OUY A;  3MGI A;  2F77 X;  4DS4 A;  5DQI A;  2NRK A;  3KTQ A;  4M0A A;  4KIT B;  2NO5 A;  3PR4 A;  2KD1 A;  3KKA C;  2J6U A;  5ALH A;  5B3Q A;  1ED1 A;  2XY7 A;  1RQL A;  5J2C A;  4KLD A;  3H40 A;  4F93 B;  3WK5 A;  3F2B A;  4AT7 A;  4WC5 A;  3QZ7 A;  1Q3V A;  4KLH A;  2BKE A;  3UPQ A;  1BVS A;  2EAP A;  4KX3 A;  1B4F A;  1O03 A;  4Q8F A;  9ICM A;  5KT2 A;  5DQG A;  5J2B A;  2QB1 A;  5HRD A;  2EAM A;  4E80 A;  2F1H A;  3CW2 C;  3TFR A;  4O3Q A;  5DBC A;  1SL2 A;  3ISC A;  1TV9 A;  2KEY A;  4CNQ A;  2K4P A;  2OH2 A;  4Y2S A;  2AQ4 A;  1QSS A;  1S97 A;  5HR9 A;  4UD5 A;  4O6A A;  3NVY A;  3C23 A;  2DR5 A;  3WU2 U;  3H38 A;  4UAT A;  1SV0 C;  3F2D A;  2UVU A;  5ALP A;  4R8U A;  5KFV A;  2O5A A;  3ORY A;  5D4B A;  4F4Y A;  2K4I A;  5IIN A;  4F50 A;  3QE9 Y;  7ICF A;  4ECW A;  1X66 A;  4WBY A;  4RQ2 A;  1L7N A;  4KLM A;  5DG7 A;  8ICG A;  3GFK B;  2R8J A;  4O3P A;  1KBU A;  2ID1 A;  4OAI Z;  1Z1V A;  1BNP A;  1JX4 A;  4WC0 A;  4DEZ A;  1F5S A;  5J2D A;  4B9L A;  3WFQ E;  2ZJ8 A;  5KFO A;  9ICF A;  9ICH A;  2C2E A;  2ZH6 A;  3OV7 A;  4MF2 A;  4E0D A;  1WYG A;  4EX6 A;  7ICS A;  5HRH A;  4DQS A;  4LT6 A;  3PHZ A;  4AT8 B;  4PZO A;  1UHU A;  2HBL A;  4J9O A;  4J9K A;  3SD7 A;  2DPJ A;  4A8E A;  4F8R A;  4R63 A;  3Q8P B;  3QU4 A;  4U7C A;  4M6W B;  3H0R B;  4P0Q B;  2H3I A;  3Q8M A;  3O0F A;  4YD2 A;  4B9V A;  3OGU A;  8ICA A;  4X4Q A;  1VLB A;  1NKB A;  4Z6E A;  1SZH A;  1ZQK A;  1LVH A;  3PNC A;  3ZDA A;  5CR0 A;  4Y2V A;  4I28 A;  2HHP A;  4P0P B;  3RBE A;  2NO4 A;  2JEJ A;  1ZQH A;  4BGD A;  1Q8K A;  1FEZ A;  2Q4T A;  2IOF A;  4QZC A;  4AP9 A;  4EED A;  3Q8S B;  5HRL A;  3JPP A;  3GII A;  4PHP A;  4EZ9 A;  4QW9 A;  2PFN A;  5KFW A;  3RJG A;  2F2A B;  5JTI A;  5AKX A;  4HAI A;  3KHH A;  2DR8 A;  1PVP A;  1X9S A;  2R8K A;  3AUO A;  1V85 A;  2NRT A;  2UVR A;  3DV9 A;  1C20 A;  2ZIX A;  2K4E A;  3OVS A;  3PZP A;  4IQW A;  2FPM A;  1ZQU A;  4DFJ A;  1SKR A;  4RPZ A;  4K96 A;  2YN4 A;  2BPF A;  4KTQ A;  2CXY A;  4NWI A;  2BPC A;  4KLQ A;  7ICM A;  1RM6 C;  2Q0Z X;  2ES6 A;  8ICK A;  1R8A A;  2GLE A;  3JCF A;  5F9N A;  5DG9 A;  2W9C B;  4DL4 A;  2YMP A;  2ISO A;  3V7K A;  1HUZ A;  4DSK A;  5AI9 A;  5DB9 A;  1KKX A;  2ZIW B;  3AU2 A;  2DKX A;  4QZA A;  4DFK A;  2M0N A;  5DEC A;  4QZ8 A;  2E3T A;  3AQL A;  4EBC A;  4YR2 A;  2HHU A;  1L8L A;  1L3V A;  4DS5 A;  2B6G A;  1XS9 D;  1M6Y A;  3RAQ A;  1JXL A;  2Z7J A;  1ZQR A;  1NO5 A;  1ZQL A;  4TQR A;  3OVB A;  4NLC A;  5J0R A;  3ER8 C;  3LQC B;  4I29 A;  3AMZ A;  3F5E A;  3AM9 A;  5KTQ A;  5DB6 A;  1R8C A;  1BPY A;  3WK7 A;  1NK6 A;  3PW2 A;  1N62 A;  3FDS A;  4KLL A;  3MGH A;  5F9L A;  3M1Y A;  5D46 A;  2IUB A;  3GU3 A;  4YD1 A;  4ED2 A;  2A3V A;  1ZQE A;  3NKU A;  2ZIV A;  7ICG A;  2Y0S C;  5KFZ A;  5J0Q A;  1TAM A;  4KLJ A;  4WJ3 B;  4WC6 A;  2GOL A;  5KT4 A;  2ASL A;  2QAR B;  1BNO A;  4UAY A;  2W9B A;  1U47 A;  4I2J A;  2XI9 A;  5B66 U;  4C0Z A;  5KFR A;  2KHQ A;  1FIQ A;  4OAG A;  5DDM A;  3LWM A;  4EBD A;  2A1J B;  3PST A;  4Y2Q A;  1KSP A;  1ZD4 A;  2ZH9 A;  4K4G A;  4I2B A;  4OJP A;  3HWT A;  4X0B A;  4NM2 A;  1LV5 A;  4P4O A;  4DL2 A;  3ETR A;  4RU9 A;  2B56 A;  2OYY A;  1YLQ A;  1PK1 A;  1QQ6 A;  1S10 A;  4X4N A;  4NM1 A;  3QUC A;  3H4B A;  4X4S A;  4ED7 A;  3BZK A;  2HHS A;  4G3I A;  5KG1 A;  4GLX A;  2PFO A;  3PO5 A;  2ZXH A;  3RJF A;  5FP0 A;  5CFS A;  4TQS A;  2MUT B;  5AK6 A;  1PUZ A;  2YMQ A;  2D3D A;  1GPJ A;  4EBJ A;  4ED3 A;  1EXN A;  3RAX A;  4Y2Y A;  1SV4 A;  2F8K A;  4XA5 A;  5ALS A;  1IG6 A;  1FA0 A;  2N1R A;  2B4V A;  1QQ5 A;  9ICE A;  1V97 A;  5AKJ A;  2JH7 A;  4FH5 A;  3SQI A;  3PSI A;  2UVW A;  1L3T A;  2IOH A;  4LEZ A;  2KOB A;  5B5E U;  2KVS A;  3T5L A;  4GXJ A;  4EYH B;  2ZHA A;  4K9A A;  3L9D A;  4C7Y A;  5KT6 A;  2JXJ A;  4UAV A;  4Q8E A;  4XQ8 A;  1JXE A;  2V4R A;  3PSF A;  4FS1 A;  3BQ1 A;  3FM9 A;  1KDH A;  1LB2 B;  5TZV A;  2DPI A;  1KN5 A;  2XID A;  5KT5 A;  2UVV A;  1DOQ A;  2XGP A;  3LK9 A;  3ONN A;  3M8S A;  5CRX A;  4OJ5 A;  1A77 A;  3TI0 A;  2KG5 A;  4PL2 A;  3ISD A;  3TFS A;  3RB3 A;  2EQY A;  5KFQ A;  5ALT A;  4DFD A;  4FZL A;  5D63 A;  2FLN A;  1Z3E B;  5ALY A;  1S76 D;  5HRF A;  3E58 A;  4R65 A;  4GXK A;  1ZQO A;  1S77 D;  3IN5 A;  5ALR A;  4UB8 U;  1ZD3 A;  3KHR A;  5DLF A;  3E0F A;  1U45 A;  1XU4 A;  3QUQ A;  2ZJ5 A;  3SAG A;  2H3Z A;  4I2A A;  4NXZ A;  5ALW A;  4NY8 A;  4WCW A;  3HRD D;  1V38 A;  1X40 A;  5AKG A;  4M04 A;  1KFD A;  1URJ A;  4KMU A;  3B0X A;  2ZIU A;  8ICQ A;  2MSN A;  1ZQP A;  5AKL A;  1UA1 A;  2ZUC A;  5ALV A;  2G5I B;  2LM4 A;  4OO1 J;  3ER9 B;  4IS7 A;  2A1J A;  5ALL A;  4M47 A;  2RLT A;  2VIX A;  3AL0 B;  1COO A;  1DGJ A;  1RDF A;  3UM9 A;  4DO9 A;  3UXO A;  2HOQ A;  1F0M A;  1DK2 A;  3MFH A;  2DRB A;  4P0Q A;  2BQR A;  1C7Y A;  3RH6 A;  3GIL A;  1T4G A;  3SAH A;  4C4S A;  2F1J A;  4WC7 A;  2QAR A;  3EW9 A;  3F2C A;  3C18 A;  4ACO A;  4RWN A;  1Y88 A;  4LEW A;  5CFU A;  5HMM A;  1D8L A;  1V4A A;  3GDX A;  2AGO A;  9ICK A;  3H8S A;  1NK8 A;  2NRX A;  3AQN A;  3L4P A;  4DWI A;  5AK5 A;  3KD3 A;  3MDA A;  2HMX A;  5HR7 A;  2CPR A;  1SXD A;  4LEY A;  5C0Y A;  3MGV A;  4KLF A;  9ICP A;  5AHX A;  4F5Q A;  1JI7 A;  4BUG A;  4WBZ A;  1YZ7 A;  8ICH A;  5GTI U;  2G08 A;  4RQ7 A;  2H3V A;  4LZG A;  2F8L A;  3M9O B;  4DOA A;  3BQT A;  4DSF A;  3IRU A;  2KKV A;  3WKA A;  4PHD A;  1IXR A;  5KL8 B;  5JTG A;  3JPS A;  4ECX A;  3PV8 A;  2K60 A;  8ICC A;  2HDO A;  1QSY A;  4DF4 A;  4UAZ A;  2JR5 A;  3BS7 A;  1RPL A;  3C5G A;  1WWU A;  3C66 A;  3GZF A;  4JMU A;  1Z4N A;  3KHL A;  5D61 A;  5KAF U;  4FS2 A;  3UMB A;  1MSW D;  3RH4 A;  2O1P A;  4NLG A;  5AK4 A;  3MDC A;  5EE3 A;  2W7P A;  5KNI A;  3H8M A;  3V7L A;  3WKC A;  4M9G A;  1ZQQ A;  4RQ6 A;  1ARO P;  4AT7 B;  2HBJ A;  5AKK A;  4OAH A;  9ICU A;  3KZX A;  3WK9 A;  3WFS C;  2QB0 B;  2W11 A;  2KZM A;  1RYU A;  2JEG A;  1JAJ A;  1ZD5 A;  4Z6C A;  4GXI A;  4B9M A;  3HJE A;  2JV3 A;  3M6Z A;  1V9P A;  2FMP A;  1P7D A;  3QEB Z;  4CGZ A;  3D2S A;  5H2F U;  3MFI A;  5TIS U;  4O9M A;  2LYH A;  4B6J A;  1OU5 A;  3T79 A;  4PL1 A;  2DKZ A;  2IA6 A;  5KG0 A;  2AQ0 A;  2G07 A;  1NJX A;  3TKA A;  4RNN A;  2DR9 A;  4XJE A;  2ATL A;  1U48 A;  3Q8Q B;  2GA9 D;  2YX8 A;  5BPC A;  2YML A;  3SEN A;  4JWM A;  3H4D A;  2RQ5 A;  4GC7 A;  3V7J A;  3N4M B;  2HVI A;  2LYB A;  2EAO A;  3C2M A;  1J97 A;  4YR0 A;  1ZQX A;  1UT5 A;  3R9K A;  5DB8 A;  4B9U A;  2VA3 A;  4BDP A;  3HX0 A;  1X9M A;  3TAD C;  1KFS A;  3EWA A;  4ZH4 A;  3BQ7 A;  1Q79 A;  5J2E A;  3H7I A;  1ZQD A;  5HRI A;  3ZD9 A;  9ICV A;  4NL9 C;  2W9B B;  1ZOL A;  4F2S A;  4QIW C;  1F44 A;  9ICT A;  3MCR A;  3SEI A;  1KRP A;  1SL1 A;  5AKI A;  2F44 A;  2RHF A;  2V4Q A;  1KNY A;  2EAN A;  4KLT A;  3EPI A;  4AT9 A;  5III A;  3HJ1 A;  7ICO A;  2GH1 A;  2O6K A;  4KLU A;  1CUK A;  2A19 A;  3L5K A;  4IQU A;  2DFL A;  4PPX A;  4F4Z A;  3E2E A;  4M6W A;  1PVQ A;  4DQP A;  5J2J A;  1XC9 A;  4JUZ A;  4QWB A;  2BBJ A;  5A0L A;  4XUS A;  4JV2 A;  2E8N A;  2AXT U;  1SXE A;  2HSZ A;  3ZDB A;  2IMW P;  5AI6 A;  4F71 A;  3QXG A;  3I1Y A;  2HI0 A;  3SYZ A;  3BDP A;  2QKQ A;  3QU9 A;  3ZDD A;  5AI5 A;  3RJI A;  3RJK A;  5J2K A;  2W8K A;  4ELU A;  1NKE A;  4PJ0 U;  5KFB A;  3RH5 A;  2BCU A;  4OJ6 A;  2BPG A;  2P35 A;  4UW9 A;  4K4I A;  4NXT A;  3CP8 A;  1X9X A;  1ZQI A;  4NXX A;  4YG2 A;  3K1Z A;  5L9X A;  5EWG A;  9ICA A;  9ICN A;  3JPT A;  4YQW A;  3NVO A;  4RQ1 A;  3C29 A;  1DRG A; 
#chains in the Genus database with same CATH homology
 4P4P A;  2ASL A;  1S0V A;  2HHW A;  1XSP A;  4EBK A;  4X4V A;  2C2R A;  2BCR A;  7ICL A;  1BNO A;  4UAY A;  2W9B A;  1U47 A;  1NOM A;  4JV0 A;  1HUO A;  3RR8 A;  1MIV A;  3H3A A;  8ICM A;  4FHP A;  1RXV A;  3Q8R B;  9ICI A;  3NGD A;  3JPO A;  3IM1 A;  2BR0 A;  3OHB A;  4DL6 A;  3PW5 A;  1R89 A;  1JIH A;  4I2J A;  4FHW A;  2ZH5 A;  1UEV A;  4F91 B;  5HRK A;  2FPL A;  4KLE A;  5KFR A;  3HT3 A;  3OUY B;  4RQ8 A;  2PFQ A;  4ED0 A;  2JEF A;  5DDM A;  2M2V A;  4WC3 A;  5KFT A;  3LWM A;  3ISB A;  2XY5 A;  3RBD A;  1KFT A;  3LDA A;  4EBD A;  4PHE A;  2A1J B;  3RB6 A;  4RPX A;  2RDI A;  8ICI A;  1PZN A;  1KSP A;  2W8L A;  4BWJ A;  5KFC A;  1TVA A;  9ICJ A;  2KZM A;  1BGX T;  1Z00 A;  2ZH9 A;  4K4G A;  5KG3 A;  3Q8K A;  1MQ2 A;  4I2B A;  5KFK A;  7ICH A;  3HWT A;  4X0B A;  4IQT A;  4NM2 A;  1LV5 A;  9ICR A;  4P4O A;  3OSP A;  3JPQ A;  4DL2 A;  4RU9 A;  2ZH4 A;  3C2K A;  1DGS A;  1TKD A;  4S3N A;  1YLQ A;  9ICO A;  4YMO A;  4FHY A;  5KG4 A;  3EYZ A;  7ICN A;  2ZUB A;  5J2I A;  1S10 A;  3GIM A;  4X4N A;  1ZQM A;  2BQU A;  2FLP A;  4NM1 A;  4NLZ A;  4J9N A;  1L3S A;  4LZD A;  1X2I A;  5DGB A;  3FYH A;  4JK1 A;  3C1Z A;  3H4B A;  2J6S A;  1BPX A;  3HJ4 A;  4RWO A;  4X4S A;  1JMS A;  4ED7 A;  2HHS A;  4G3I A;  5KG1 A;  5J0Y A;  4GLX A;  2PFO A;  3MBY A;  3PO5 A;  3RJF A;  5KFA A;  2OWO A;  4TQS A;  3ZD8 A;  4GC6 A;  2MUT B;  3UQ2 A;  4IRK A;  1UEU A;  2PXI A;  4ED1 A;  4YR3 A;  1T7P A;  4EBJ A;  1ZQZ A;  1UET A;  2WTF A;  3PX6 A;  1B22 A;  4ED3 A;  1EXN A;  2C28 A;  4B9S A;  3RAX A;  3EPG A;  2BDP A;  2DVI A;  2R8G A;  4I2H A;  1XWL A;  4R64 A;  3NTU A;  2XO7 A;  4PH5 A;  1UT8 A;  2MUT A;  2RDJ A;  2GWS A;  1RXW A;  3RRG A;  1K1Q A;  4ATB A;  3SV3 A;  3K4G A;  4DSL A;  4ECQ A;  4XA5 A;  5J2G A;  2KFN A;  3V6H A;  3ZDC A;  5DG8 A;  5J2A A;  4DFP A;  7ICU A;  1FA0 A;  4QZD A;  3GIK A;  3PVX A;  1H38 A;  1NJZ A;  5HRB A;  1VJ7 A;  3V6J A;  4F5R A;  9ICE A;  4FH5 A;  3LWL A;  4KLI A;  4RZR A;  1ZQS A;  1CEZ A;  2UVW A;  1L3T A;  5DKW A;  4UAW A;  3MR5 A;  8ICS A;  2XCA A;  4RUC A;  4Z6F A;  1IM4 A;  3ZDE A;  4QWA A;  4GXJ A;  3T5L A;  4YN4 A;  5KFD A;  4EYH B;  2R8I A;  4F92 B;  2W9M A;  5KG2 A;  2BCQ A;  2IHN A;  4EZ6 A;  8ICU A;  9ICQ A;  3L9D A;  4AT9 B;  4X4P A;  5KT6 A;  2KZZ A;  4HYK A;  3K75 D;  5IIO A;  7ICP A;  1UA0 A;  1Q78 A;  4C8N A;  3SV4 A;  4F4X A;  1U49 A;  4Q8E A;  1RYR A;  9ICX A;  4XQ8 A;  1JXE A;  3MR3 A;  2V4R A;  2FLL A;  4FS1 A;  3BQ1 A;  2ZH7 A;  5L1I A;  1KDH A;  4QZH A;  4E7X A;  1LB2 B;  4ECY A;  4QZB A;  5TZV A;  2DPI A;  4KLO A;  4TUS A;  5KT5 A;  2UVV A;  1DOQ A;  5KFJ A;  1F5A A;  2XGP A;  2AGP A;  4Q43 A;  5J0U A;  3LK9 A;  2PBE A;  4QWC A;  3C2L A;  1TFW A;  3M8S A;  2VAN A;  1WCL A;  1XO1 A;  4R66 A;  5KFH A;  5DED A;  4J9P A;  4ED6 A;  2ZHB A;  2ZTE A;  1A77 A;  3TI0 A;  1NK4 A;  2ZH1 A;  4F5P A;  4E8F A;  4RUA A;  3SZ2 A;  1ZQG A;  5KT3 A;  1BPB A;  2AJQ A;  2BCV A;  5KFE A;  3ISD A;  3TFS A;  3C1Y A;  4ELV A;  3RB3 A;  8ICE A;  1HJP A;  4J9Q A;  5KFQ A;  4F5O A;  3TAR A;  4JWN A;  8ICV A;  2NRW A;  5DBB A;  4C8K A;  3TAN A;  3TAP A;  5CB1 A;  2FLN A;  1Z3E B;  4QZI A;  4PGX A;  2FPK A;  3N97 B;  4M9N A;  4Q45 A;  5KFS A;  1S76 D;  8ICW A;  5HRF A;  4R65 A;  4EEY A;  4GXK A;  3Q8L A;  1ZQO A;  4F3O A;  5J29 A;  1S77 D;  4IRD A;  3AQK A;  3KHR A;  3PX0 A;  3GV8 B;  5DGA A;  5DLF A;  2M2T A;  2KN7 A;  1U45 A;  1XU4 A;  7ICJ A;  1TK5 A;  2FMS A;  2ZJ5 A;  5DDY A;  3T3F A;  3RB4 A;  1ZQT A;  3HW8 A;  5F2V O;  1TAU A;  5DBA A;  5J0P A;  4I2A A;  5KFP A;  4RQ3 A;  4FO6 A;  4DL5 A;  1MIW A;  3EZ5 A;  2KTQ A;  2XY6 A;  4ECT A;  4MFC A;  3BQ2 A;  9ICB A;  4NXZ A;  1RYS A;  4XQ7 A;  4NY8 A;  4WCW A;  5IIK A;  4K4H A;  4M04 A;  2R8H A;  1KFD A;  4KMU A;  4M9L A;  3B0X A;  1NKC A;  3JZ0 A;  2DR7 A;  4QW8 A;  4QZ9 A;  5KG6 A;  4I2C A;  4I2E A;  1ZQA A;  5HP4 A;  8ICQ A;  1R8B A;  4KLS A;  3JPR A;  1ZQP A;  1ZQY A;  4DL7 A;  1K1S A;  2M9N A;  1WOT A;  4EP7 A;  4NLK A;  1UA1 A;  3RJH A;  2ZUC A;  5HRE A;  3BQ0 A;  3MR6 A;  3QEA Z;  3T5H A;  8ICN A;  4RQ0 A;  2ALZ A;  4Z6D A;  8ICX A;  3THV A;  2NRZ A;  4IQV A;  1L3U A;  1TFR A;  3GIJ A;  4KN4 A;  2HHX A;  2HHT A;  5CA7 A;  4IR1 A;  2A1J A;  2IHM A;  3HIY A;  2XC9 A;  4M47 A;  4Q44 A;  1U9L A;  4ECZ A;  4C8M A;  4PGQ A;  1COO A;  3UPS A;  3G6Y A;  1BPZ A;  1NK9 A;  3RR7 A;  4I2F A;  4O5K A;  3V6K A;  3MGI A;  2NRK A;  4DS4 A;  5DQI A;  4DO9 A;  3UXO A;  3C5F A;  3OUY A;  2W9C A;  1SKW A;  5J0O A;  2PI4 A;  3KTQ A;  3MFH A;  4M0A A;  1DK2 A;  3NYB A;  2DRB A;  4KIT B;  2BQR A;  3PR4 A;  1C7Y A;  4AT8 A;  3MAB A;  3TQ1 A;  3RH6 A;  5L1J A;  1D9D A;  5KG7 A;  2J6U A;  4DQI A;  3GIL A;  4QWE A;  1T4G A;  4MEX A;  1U4B A;  8ICO A;  2ZH3 A;  1KEJ A;  2XY7 A;  2F1J A;  5J2C A;  4WC7 A;  3EW9 A;  4KLD A;  2ZJA A;  3H40 A;  4F93 B;  3C18 A;  5EOZ A;  4AT7 A;  4WC5 A;  3QZ7 A;  1ZQW A;  1TK0 A;  1ZQB A;  4KLH A;  2BKE A;  1Y88 A;  4QZF A;  8ICZ A;  1Z00 B;  2ZH8 A;  5D49 A;  5BOL A;  3UPQ A;  3PW0 A;  5HMM A;  5IIL A;  1ZYQ A;  1BVS A;  2ZUD A;  4MF8 A;  1QTM A;  4MFF A;  2HW3 A;  1D8L A;  1V4A A;  3GDX A;  4DOB A;  2JEI A;  2AGO A;  3WFP A;  3GV5 B;  3H8S A;  9ICK A;  3PR5 B;  2P6U A;  2H5X A;  4Q8F A;  1NK8 A;  9ICM A;  2NRX A;  5KT2 A;  5DQG A;  5J2B A;  5CWR A;  4NKU A;  3AQN A;  5HRD A;  4X4R A;  3M8R A;  1SKS A;  2PI5 A;  4DWI A;  7ICQ A;  4E80 A;  2F1H A;  3G6V A;  4DOC A;  3MDA A;  3TFR A;  1NK5 A;  2KP7 A;  4QZG A;  3GV7 B;  4O3Q A;  5DBC A;  1SL2 A;  3ISC A;  1BPE A;  1TV9 A;  4NKT A;  4X4U A;  3ETL A;  4DLG A;  4UB1 A;  2AQ4 A;  1QSS A;  3H8W A;  1S97 A;  1MQ3 A;  4C8O A;  4KLF A;  4F5Q A;  9ICP A;  7ICV A;  5HR9 A;  5CJ7 A;  4F5N A;  3C23 A;  4WC1 A;  4BXO B;  1S0M A;  9ICL A;  4RNM A;  2DR5 A;  4DFM A;  2ASD A;  4YXM A;  4O5C A;  2BGW A;  4WBZ A;  3IHQ B;  3OHA A;  4X0A A;  4B9N A;  1ZQV A;  2W9A A;  4BXO A;  8ICH A;  3H38 A;  4FH3 A;  4RQ7 A;  4CCH A;  4MFA A;  4MEY A;  2UVU A;  4R8U A;  5KFV A;  4FBT A;  3ORY A;  4LZG A;  4J9S A;  2O5A A;  3M9O B;  4DOA A;  2Y1J A;  1NZP A;  2XCP A;  3BQT A;  5L1K A;  4F4Y A;  5D4B A;  4DSF A;  4NLN A;  5IIN A;  2C22 A;  4F50 A;  3QE9 Y;  4IRC A;  7ICF A;  3M9M B;  4PHD A;  1IXR A;  4ECW A;  1N56 A;  3H8J A;  5HRG A;  5KT7 A;  4WBY A;  4RQ2 A;  3JPS A;  4F4W A;  4ECX A;  3PV8 A;  4KLM A;  1BPD A;  1ZQJ A;  5DG7 A;  4RQ5 A;  8ICG A;  5KFU A;  8ICC A;  3GFK B;  2R8J A;  4DSE A;  3JPN A;  2BCS A;  4UD4 A;  3WFO A;  4O3P A;  1QSY A;  5DLG A;  5HHI A;  4DF4 A;  2V9W A;  7ICK A;  2ID1 A;  2ZHA A;  4UAZ A;  1BNP A;  1RPL A;  3C5G A;  1JX4 A;  4WC0 A;  2RFF A;  3C66 A;  4I27 A;  4DEZ A;  5HNK A;  3KHL A;  5J2D A;  4B9L A;  4FS2 A;  8ICL A;  3WFQ E;  1MSW D;  2ZJ8 A;  5KFO A;  3RH4 A;  9ICF A;  4NLG A;  9ICH A;  2O1P A;  2HHQ A;  4EBE A;  2C2E A;  3MDC A;  2IBK A;  2ZH6 A;  4P2H A;  2Q66 A;  7ICR A;  4MF2 A;  3OV7 A;  4LVS A;  4E0D A;  1DK3 A;  7ICS A;  1JN3 A;  3V7L A;  3TAQ A;  4C8L A;  4M9G A;  5HRH A;  4PGY A;  1RZT A;  1ZQQ A;  1MIY A;  4DQS A;  1Q79 A;  3H39 A;  4RQ6 A;  2KZ3 A;  4YMM A;  2ZTD A;  1ARO P;  4LT6 A;  5KFN A;  3RTV A;  4AT7 B;  1TAQ A;  4TUR A;  4P4M A;  4UB2 A;  4AT8 B;  5J0X A;  5J0S A;  4J9O A;  3HP6 A;  4J9K A;  9ICU A;  3PO4 A;  2DPJ A;  4KLG A;  3WFS C;  3OJS A;  4F8R A;  4DQQ A;  4J9M A;  4R63 A;  4RPY A;  3Q8P B;  3RRH A;  3M9N B;  3AU6 A;  2JEG A;  5DQH A;  3MR2 A;  4YCX A;  4UB5 A;  1JAJ A;  4EYI B;  4Z6C A;  4M6W B;  4UB4 A;  3Q8M A;  4ATB B;  5KFL A;  1TK8 A;  4GXI A;  1ZQC A;  4YD2 A;  4B9M A;  2BHN A;  1XSN A;  4R8U B;  4X5V A;  4B9V A;  1ZJM A;  2VA2 A;  3OGU A;  4ELT A;  8ICA A;  4BWM A;  1V9P A;  2FMP A;  4X4Q A;  4YP3 A;  3KHG A;  3WFR E;  3OJU A;  1VFG A;  2NRV A;  1NKB A;  3HPO A;  4JV1 A;  5KFY A;  4Z6E A;  8ICF A;  4PHA A;  3QEB Z;  4RT3 A;  1NJW A;  1ZQK A;  3PNC A;  4O3O A;  5KG5 A;  1TFY A;  3ZDA A;  4YMN A;  3H37 A;  3MFI A;  5CR0 A;  3V72 A;  4O0I A;  4I28 A;  3OSN A;  4O9M A;  5J2F A;  2LYH A;  5J2H A;  5KFG A;  1OU5 A;  2HHP A;  2ZH2 A;  3RBE A;  1T3N A;  2BQ3 A;  4F2R A;  3GQC A;  1ZQF A;  2FMQ A;  2JEJ A;  1ZQH A;  2IA6 A;  5KFF A;  4RWP A;  5KG0 A;  4BGD A;  9ICS A;  4FHV A;  2ISP A;  2AQ0 A;  4QWD A;  1NJX A;  9ICW A;  4I2D A;  3PML A;  4RNN A;  2DR9 A;  4QZC A;  2JZB B;  2ATL A;  1U48 A;  3Q8Q B;  1A76 A;  3Q8S B;  5DB7 A;  8ICP A;  5HRL A;  9ICG A;  3JPP A;  4QZE A;  3GII A;  4PHP A;  5HC9 A;  4EZ9 A;  5BPC A;  4QW9 A;  4UD5 A;  4JWM A;  1WCN A;  5IIJ A;  2KFZ A;  4X4O A;  3H4D A;  2PFN A;  5KFW A;  3RJG A;  9ICC A;  2XGQ A;  2B21 A;  5J0W A;  4GC7 A;  3V7J A;  3N4M B;  2HVI A;  7ICE A;  3KHH A;  2DR8 A;  3C2M A;  1X9S A;  4RT2 A;  1NK0 A;  4YR0 A;  4RWQ A;  2R8K A;  1PX5 A;  1ZQX A;  1UT5 A;  2VA8 A;  5KFI A;  5CHG A;  5DB8 A;  2C2D A;  1T8E A;  3AUO A;  4B9U A;  2NRT A;  8ICY A;  2UVR A;  4YFK A;  1JQR A;  2VA3 A;  4BDP A;  1QSL A;  3HX0 A;  1X9M A;  1KFS A;  3EWA A;  4ZH4 A;  4B9T A;  5L1L A;  4M9J A;  3OVS A;  1S0N A;  4IR9 A;  2HVH A;  2HHV A;  5C5J A;  3H7I A;  5J2E A;  3G6X A;  1ZQD A;  4IQW A;  3ZD9 A;  2ASJ A;  9ICV A;  5HRI A;  5CP2 A;  2W9B B;  2BE3 A;  2FPM A;  1ZQU A;  4M5D A;  4DFJ A;  4F2S A;  1SKR A;  9ICT A;  4DSJ A;  5KFX A;  8ICJ A;  4RPZ A;  3UXN A;  4TUQ A;  3UQ0 A;  4J9L A;  1KRP A;  5IIM A;  3B0Y A;  5EWF A;  1SL1 A;  2BPF A;  4KTQ A;  7ICM A;  2BPC A;  2V4Q A;  2I9G A;  4KLQ A;  1KNY A;  3PY8 A;  2Q0Z X;  3C21 A;  2M2U A;  1N48 A;  4KLT A;  3EPI A;  4DF8 A;  8ICK A;  4AT9 A;  5J0T A;  5III A;  3T5K A;  4O5E A;  1R8A A;  5F9N A;  5DG9 A;  3QZ8 A;  2W9C B;  4ED8 A;  4DL4 A;  2PFP A;  7ICO A;  8ICT A;  3HJ1 A;  4KLU A;  4WC2 A;  2DRA A;  1SZP A;  2AU0 A;  2ISO A;  2J6T A;  1CUK A;  1S0O A;  5HHH A;  4DSI A;  1ZET A;  4IQU A;  4RWN A;  2DFL A;  3V7K A;  4PPX A;  4F4Z A;  1B43 A;  4UB3 A;  1HUZ A;  4M6W A;  3E2E A;  1L5U A;  5JUM A;  4DSK A;  2MAX A;  5DB9 A;  2M2W A;  1SL0 A;  4ECS A;  2Y1I A;  3T5J A;  1NJY A;  3OVA A;  3AU2 A;  4DQR A;  1S9F A;  4DQP A;  5J2J A;  1XC9 A;  4QZA A;  4KN7 A;  4JUZ A;  4QWB A;  4DFK A;  1ZQN A;  4UBC A;  1QLN A;  3PW7 A;  4RQ4 A;  5DEC A;  4QZ8 A;  4XUS A;  3PMN A;  1NK7 A;  4JV2 A;  3AQL A;  4EBC A;  7ICT A;  2I1Q A;  4YR2 A;  1X9W A;  8ICR A;  2HHU A;  4X4T A;  1L3V A;  1XSL A;  5BOM A;  4DS5 A;  4IG8 A;  1XS9 D;  4I2G A;  3ZDB A;  4FBU A;  4M2Y A;  8ICB A;  1D8Y A;  3RAQ A;  2IMW P;  3AQM A;  1JXL A;  1ZQR A;  1NO5 A;  3OVB A;  1ZQL A;  4TQR A;  4DLE A;  4I2I A;  3RB0 A;  1KTQ A;  1D9F A;  3BJY A;  3SYZ A;  5J0R A;  4O3S A;  3LQC B;  3BDP A;  2JZB A;  4J9R A;  5KTQ A;  4I29 A;  5DB6 A;  3ZDD A;  1R8C A;  3UXP A;  4WC4 A;  1BPY A;  3RJI A;  2ZTC A;  3RJK A;  5J2K A;  2W8K A;  1NK6 A;  4ELU A;  4O3R A;  3PW2 A;  1NKE A;  5KFB A;  1KLN A;  3RH5 A;  3PW4 A;  4TUP A;  2BCU A;  4O3N A;  2BPG A;  4UQG A;  3RJJ A;  4YVZ A;  2P6R A;  2P66 A;  5HML A;  3FDS A;  4K4I A;  4ECV A;  4M9H A;  4KLL A;  3MGH A;  1ZQI A;  5F9L A;  7ICI A;  4F4K A;  4FHX A;  5EWE A;  4ECU A;  3RJE A;  5D46 A;  5KFM A;  1MC8 A;  4YD1 A;  4RNO A;  4YG2 A;  4ED2 A;  1ZQE A;  3JYY A;  5L9X A;  1ZJN A;  4ECR A;  3SI8 A;  4XRH A;  5EWG A;  7ICG A;  3PX4 A;  2AGQ A;  9ICA A;  5KFZ A;  5J0Q A;  3JPT A;  9ICN A;  2F1I A;  4KLJ A;  4YQW A;  4UBB A;  4DL3 A;  4WC6 A;  4YXJ A;  4RQ1 A;  5KT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...