5J0OA

Binary complex crystal structure of dna polymerase beta with a:a mismatch at the primer terminus
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0oA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0oA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0oA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0oA03
3TAQA 5KFLA 4M9GA 2Q0ZX 4FHYA 3NGDA 3RH5A 3LK9A 1HJPA 3TARA 1XS9D 2IHNA 3V7LA 5JUMA 3MFHA 3OVSA 4KLMA 1Z00A 1JAJA 8ICKA 2ZUCA 4Q43A 3OSPA 4I2GA 1TK0A 4DSIA 5J2CA 5BOLA 3GDXA 5J2KA 1HUOA 4DL3A 3RR8A 2W9CA 4M2YA 4QWEA 9ICGA 1BNOA 4QZBA 4Q45A 3PMLA 1L3UA 1MIVA 4F92B 4XUSA 4GLXA 4DFKA 1XSPA 3H39A 2R8KA 4UBCA 2HHXA 1MIWA 4PH5A 3OUYA 1Z3EB 1TKDA 3RB6A 4F91B 1ZYQA 3ZDCA 4DFMA 5J0OA 4WC6A 4UAYA 1L3TA 1FA0A 3IM1A 4ECSA 5F9LA 5L1KA 5KG7A 3H4BA 2ISPA 5DBCA 3C5FA 5IIOA 1X9WA 1RYRA 1NK5A 1RXWA 1BPXA 5HMMA 3C1ZA 4WC0A 1KDHA 5KFGA 5J2JA 1KTQA 4M47A 1JIHA 4EP7A 4NM1A 4O0IA 1ZQJA 1IM4A 8ICSA 3JPOA 4X4QA 4UAWA 4RZRA 1UETA 3EYZA 3PY8A 4YMNA 1S77D 2ID1A 1ZJMA 4DSFA 4IG8A 2AQ4A 1TV9A 4KLOA 4IRKA 4YCXA 5D49A 9ICHA 4Z6FA 4LZDA 3LWLA 8ICJA 3NYBA 3Q8LA 1ZQEA 5F2VO 4F4WA 2BGWA 5BOMA 2NRZA 3PX6A 3AQMA 4X0AA 3MR3A 5DDMA 2A1JB 1SL1A 2BPFA 3SZ2A 4YG2A 1V4AA 5DB6A 4FBTA 3RH4A 5HRGA 5DB7A 1TFWA 4B9NA 8ICYA 4QZGA 4DS5A 4ED8A 2AQ0A 3Q8MA 3H8WA 4C8MA 3BQ1A 4I2IA 5CA7A 2DR9A 4RU9A 2DPJA 1BPZA 4BXOB 5L1LA 4DSEA 4QWCA 4M0AA 4O3RA 2KFNA 2W9AA 1ZQAA 1QSLA 1UEUA 4R63A 3M9NB 4J9OA 4B9SA 4RQ7A 4CCHA 3C1YA 4RQ4A 1XSNA 4Q8EA 8ICLA 7ICHA 4M9NA 5HRKA 3GV5B 4JWMA 4KLEA 3HT3A 4GC7A 2ZH8A 1S0OA 5KT2A 4M9LA 4F2SA 5J0YA 4J9KA 5KFIA 4QWAA 1KLNA 5L9XA 1JXLA 4ED1A 4YFKA 3H7IA 1XO1A 5DG7A 2J6UA 5BPCA 4RQ5A 5HRBA 4K4IA 5IIMA 7ICNA 1R8AA 3ZD9A 2VA8A 4AT9B 4RWOA 4WC5A 1ZQCA 4F93B 3M8SA 2BQUA 1MQ3A 1ZQPA 7ICJA 1KFSA 4DQIA 4G3IA 4QZCA 4X4VA 5HRLA 2DRBA 4IQWA 1S0VA 9ICVA 4YMOA 4MFAA 4WCWA 2PXIA 4ECVA 7ICGA 3OGUA 4ED6A 1DGSA 1ZQGA 2XY7A 2DR5A 2RDJA 2BCQA 4RQ0A 3RJFA 1KEJA 7ICVA 3AQNA 4DQRA 3MABA 4X4TA 2F1HA 2NRVA 4F5NA 4WC3A 3GIKA 4RUCA 7ICIA 4K4HA 5C5JA 4KMUA 3ZD8A 4AT8A 3BQ2A 4I28A 2BPCA 5KFBA 3OHBA 4O3NA 4DSJA 1TAUA 7ICLA 1B22A 1OU5A 2BE3A 5DEDA 3AU6A 2DR7A 5KG1A 4P2HA 2ZH7A 5J2FA 4IQUA 1UA0A 5J0TA 5DBAA 9ICMA 2F1JA 4RPYA 3G6VA 3H3AA 3H4DA 1RXVA 2XCPA 4PPXA 4KN7A 2BCRA 4ED0A 2HVHA 2PBEA 5DECA 2ZH6A 4F4YA 5J29A 3EZ5A 1ZQFA 1MSWD 3MGHA 5CP2A 1BGXT 5EOZA 3LDAA 3GV8B 2Y1IA 3WFOA 4PHEA 4NLNA 2C2RA 3RRGA 1IXRA 2KFZA 4DO9A 1TVAA 1U4BA 4F2RA 1TK5A 4AT8B 4YQWA 4P4PA 4E7XA 1KRPA 4F4ZA 2ASLA 4WC4A 2FPLA 5KFEA 4EBCA 4O5EA 2HHQA 1WCNA 2ASJA 3HWTA 4ELUA 2ZH2A 3H40A 2V4QA 5IIKA 5KFDA 1DOQA 2ZTDA 3IHQB 3PW0A 2ATLA 4GC6A 8ICOA 5KFKA 4JK1A 4FO6A 4EYIB 3PO4A 4E0DA 4NY8A 4KLJA 2KZMA 2ALZA 5DLFA 4ELVA 2KZZA 4YD2A 3N4MB 5CR0A 8ICBA 5DG8A 2XY5A 3TQ1A 4IR9A 1KFTA 1PZNA 3C18A 2ZHBA 2Q66A 3WFRE 3RH6A 8ICZA 2P66A 1R89A 3JPQA 4ECYA 3T5HA 5IILA 5KG0A 2XGQA 2J6TA 4WBZA 4ECTA 4KLHA 2VANA 5KFMA 9ICUA 2PI5A 5KFSA 4C8NA 4F4XA 2NRKA 5HRHA 1T4GA 1JN3A 1X2IA 5J0SA 2V4RA 2JZBB 1ZQTA 2BCVA 4X4NA 4O9MA 2AU0A 4FS1A 2PFOA 5J0PA 2MUTB 7ICFA 9ICTA 4NKTA 4NXZA 4DQSA 3MGIA 8ICTA 4XA5A 8ICXA 1ZJNA 5DBBA 9ICBA 3LQCB 1JX4A 1RPLA 1U48A 2UVUA 3PNCA 2FPMA 4I2CA 2IHMA 4GXKA 2XY6A 1L3VA 4E8FA 2ZUDA 2BCSA 4JV1A 3GILA 3RJKA 4LT6A 4M6WA 1KFDA 2HVIA 5D4BA 2DPIA 4KLUA 5EWEA 5DGBA 2FPKA 2HHWA 3HW8A 5IINA 3B0XA 3C2LA 2A1JA 3AQLA 4X0BA 1SKSA 4I2AA 2R8GA 3RJJA 5KFOA 4EBEA 2UVVA 2MAXA 2I1QA 4GXIA 2J6SA 4YR2A 5DGAA 9ICRA 2BDPA 4BXOA 7ICTA 2RFFA 4QZIA 4MF8A 4YP3A 1ZQUA 3ORYA 3QEAZ 3UQ2A 4DF8A 4RT2A 3JYYA 1VJ7A 3MR6A 3UQ0A 4M6WB 1TAQA 1T8EA 1ZQMA 1A77A 3TFRA 2KP7A 3BQ0A 4BDPA 3JZ0A 7ICPA 8ICRA 2M2TA 4DQPA 3G6YA 3JPRA 5KFPA 5DQHA 5KTQA 5KT3A 3QEBZ 4PHPA 1Q79A 3GIIA 4AT9A 5KFHA 4X4RA 3ETLA 3RAXA 2NRXA 3UXNA 3V7KA 4WC7A 1AROP 3PW4A 2ZJAA 3K75D 1ZQQA 4RT3A 1NZPA 2KTQA 5KFXA 4I2BA 3SV3A 9ICEA 2C28A 1WOTA 4R8UB 5J2HA 3C2KA 4J9NA 1L5UA 3WFQE 5F9NA 4FS2A 2JEGA 5J2EA 4IR1A 4EBJA 2FMPA 5HP4A 4I27A 1UT8A 4RQ3A 2FLLA 3GV7B 7ICUA 3E2EA 2BHNA 5EWFA 1S97A 5J2DA 3JPPA 1ZQIA 4QZ8A 1NK8A 4IRCA 3PW2A 4TUSA 2W9BB 1ZQNA 3RAQA 5J2GA 5KFQA 2R8HA 2JEIA 2BQ3A 3C66A 4AT7B 4YMMA 9ICWA 4F3OA 1R8BA 1V9PA 2NRTA 2ZTCA 4QZFA 1N48A 1BPEA 4M9HA 3PW7A 5CJ7A 5KFYA 2BR0A 4XQ7A 4X5VA 1UT5A 4E80A 5KFFA 2W8LA 1UEVA 3MFIA 8ICIA 1SZPA 1ZQBA 4DL4A 4KLSA 3GIMA 8ICUA 1JQRA 2ZH3A 7ICKA 5KT5A 1EXNA 2KZ3A 3PR5B 2AJQA 3MBYA 3HP6A 3RTVA 4RQ6A 4FH5A 2ZJ8A 2W9MA 3EPGA 1D8YA 4DFPA 1S10A 3PX4A 4O3SA 9ICIA 4O3OA 3V6KA 2ASDA 2UVWA 4NLZA 2P6RA 2WTFA 4FHVA 1B43A 5DQIA 3KHHA 3RBDA 5DDYA 5KFWA 5KFZA 4DF4A 1T7PA 8ICPA 4ELTA 4KLGA 1ZQZA 5DG9A 4DL5A 1XSLA 1T3NA 4PHDA 8ICMA 3UXOA 1DK2A 1TK8A 1WCLA 2RDIA 5HNKA 3JPTA 2HW3A 1XU4A 4KLQA 1RYSA 4EZ6A 1H38A 4R65A 5HREA 4UD5A 3EPIA 5HR9A 1JXEA 1ZQRA 4QZEA 8ICNA 5J2AA 1BPDA 4F5PA 9ICOA 4I29A 5HRIA 4TURA 2IBKA 9ICKA 4UD4A 2IMWP 2DRAA 1ZQXA 4MFFA 5EWGA 3Q8KA 2M9NA 5KG6A 4Z6DA 4DEZA 3MR5A 3THVA 1N56A 1MQ2A 4J9QA 1ZQHA 7ICEA 4WC1A 4ATBA 4RUAA 5TZVA 3H8SA 2FMSA 4UQGA 3RRHA 1XC9A 1UA1A 1U49A 2JZBA 1NKBA 1NK4A 2BKEA 4QW8A 2MUTA 4DOAA 2XCAA 4S3NA 2HHTA 1ZQSA 1D8LA 1NOMA 4PGYA 2R8IA 2B21A 3HJ1A 3C23A 2P6UA 4B9LA 5KFTA 2M2VA 2PFNA 2ZH4A 4YR3A 1NKEA 4B9UA 3AUOA 5CHGA 1Q78A 2M2UA 4X4UA 8ICQA 3MDCA 3WFSC 4ECXA 2C2EA 9ICCA 2DVIA 3BJYA 1D9DA 4PHAA 4ATBB 4UBBA 3ISCA 3G6XA 1D9FA 1NK0A 3PO5A 3K4GA 2ISOA 2HHPA 8ICEA 4JUZA 3GQCA 4UB3A 4RWPA 5KFUA 1ZQLA 4F8RA 3OJUA 2HHSA 5KFRA 1NKCA 8ICWA 1DK3A 4Z6CA 2Y1JA 2F1IA 3V6JA 4MFCA 7ICQA 7ICRA 4DFJA 1NJXA 4UB1A 4QW9A 3PMNA 5KFVA 4EYHB 5DB8A 2M2WA 3OV7A 4KLFA 4DOBA 4DOCA 3EWAA 5KFCA 5J0RA 3UXPA 9ICSA 4O3QA 1X9MA 2BPGA 3QZ7A 5DLGA 2W8KA 2JEJA 4C8OA 4BWMA 4F4KA 3L9DA 3OVBA 3UPQA 3HX0A 1LB2B 2FLPA 4F5RA 1U9LA 2XC9A 3T3FA 1ZQOA 4I2DA 3OHAA 4RQ2A 2C2DA 2FLNA 2IA6A 4YR0A 3GIJA 3H37A 4KLLA 4K4GA 1S0NA 1SKRA 4R64A 3T5KA 3RJGA 5CWRA 4XRHA 3T5LA 3HIYA 1TFYA 4JV0A 4FHPA 1NK9A 4DSKA 2FMQA 4RPZA 3ISDA 1KSPA 3Q8RB 2R8JA 3ZDAA 1ZQKA 3ZDBA 4M04A 3Q8SB 1KNYA 4RPXA 5IIIA 5KT7A 4NM2A 5KFNA 4HYKA 2C22A 1C7YA 2VA2A 4RNOA 4FH3A 3OVAA 3AU2A 3EW9A 4QZAA 3RJIA 1S9FA 1Z00B 1ZQVA 2BCUA 4R8UA 5HRDA 2H5XA 4ECZA 5D46A 2ZH9A 2LYHA 5KFAA 4I2FA 3NTUA 4UB4A 2JEFA 5J2IA 4EEYA 2PFPA 2ZUBA 4KITB 4NLKA 2W9CB 1ZQDA 5J0UA 4Q8FA 4DSLA 3SYZA 4I2HA 2W9BA 5KG3A 4GXJA 1Y88A 1COOA 4QZDA 3SV4A 2XO7A 4DL7A 4AT7A 5HHIA 4RNNA 3OUYB 3WFPA 3PW5A 1SL2A 4RWQA 4J9SA 4M9JA 1U47A 3JPNA 5DB9A 2XGPA 4EBDA 3PR4A 4B9MA 2ZH5A 4JV2A 3T5JA 2HHUA 2OWOA 2NRWA 8ICFA 4MF2A 3PVXA 1NJWA 1NK7A 4IQVA 2HHVA 3BDPA 5HRFA 4DLEA 7ICSA 2ZJ5A 4MEXA 2KN7A 4WBYA 2VA3A 1SL0A 4TQRA 3SI8A 4YD1A 8ICAA 1K1SA 3RJEA 3HJ4A 3BQTA 1K1QA 4DWIA 4NKUA 4DL6A 1CUKA 1SKWA 4ED2A 5J2BA 4RQ8A 3RBEA 9ICQA 2ZHAA 4J9MA 4Z6EA 4ECRA 3KHRA 9ICAA 3C5GA 4XQ8A 1NJYA 1S76D 4ED7A 5KT6A 3UPSA 9ICNA 4UAZA 4QWBA 5KG4A 4J9RA 3M9OB 2AGOA 4QZ9A 3Q8QB 3Q8PB 4BGDA 4P4MA 5IIJA 1HUZA 1ZETA 4J9LA 3KHGA 1MC8A 5HHHA 4KN4A 3V72A 3QE9Y 2V9WA 1X9SA 2UVRA 9ICJA 4YXJA 4PGXA 3HPOA 3N97B 3RB4A 3RR7A 3LWMA 3QZ8A 4ECWA 2GWSA 8ICVA 3TFSA 5KFJA 2DR8A 1TFRA 3OJSA 4TUPA 1U45A 4FBUA 2AGPA 4O3PA 4JWNA 5HMLA 4DLGA 1QLNA 1ZQWA 1ZQYA 4YN4A 9ICLA 3TI0A 4F5OA 4KLTA 1RZTA 5J0XA 1CEZA 1NO5A 1R8CA 4QZHA 1YLQA 4MEYA 5L1JA 3B0YA 3H8JA 4YXMA 4IRDA 3FDSA 4KLDA 2ZTEA 2PI4A 3ISBA 3KTQA 9ICFA 4ZH4A 1JMSA 1A76A 4FHXA 5KG5A 3V7JA 3ZDDA 5KT4A 1QSYA 1BPBA 1QSSA 3OSNA 4EBKA 4X4PA 3H38A 4X4OA 4QWDA 4NLGA 1XWLA 5CB1A 4Q44A 4PGQA 4DL2A 4KLIA 4O5KA 8ICCA 7ICOA 5HC9A 4KTQA 4RNMA 4ECUA 4ECQA 4FHWA 5J0QA 4I2JA 9ICPA 4DS4A 4UB5A 3TAPA 3RB3A 1S0MA 3C21A 4DQQA 3M8RA 4B9TA 4YVZA 8ICHA 4WC2A 3PX0A 4R66A 4I2EA 3MDAA 1NJZA 4ED3A 4TQSA 3RJHA 5J0WA 2O1PA 3C2MA 4X4SA 3GFKB 4BWJA 3JPSA 1PX5A 1MIYA 2DFLA 4UB2A 1BVSA 2I9GA 5KG2A 1LV5A 4J9PA 2BQRA 1L3SA 5DKWA 3M9MB 1BNPA 3TANA 4F5QA 1QTMA 3AQKA 4F50A 4IQTA 3KHLA 1NK6A 7ICMA 4RQ1A 4LZGA 4RWNA 1F5AA 1VFGA 5L1IA 3V6HA 4M5DA 3PV8A 3RB0A 4C8KA 4B9VA 4C8LA 4LVSA 8ICGA 3ZDEA 3MR2A 9ICXA 2AGQA 4EZ9A 5DQGA 1BPYA 4P4OA 2PFQA 4TUQA 2ZH1A 4O5CA 2O5AA 3FYHA
chains in the Genus database with same CATH superfamily
2G0AA 5KFLA 4M9GA 2Q0ZX 3RH5A 3TARA 4Y2JA 3V7LA 4KLMA 2NO5A 8ICKA 4Q43A 2DKXA 2KOBA 5BOLA 1HUOA 4CF4A 9ICGA 2W9CA 4M2YA 2ZIVB 4F92B 4DFKA 2EDUA 2R8KA 1MIWA 4WJ3B 4QJFB 1TKDA 3RB6A 1ZYQA 5ALEA 3RFAA 4UAYA 1C20A 5F9LA 2JV3A 3H4BA 5DBCA 3C5FA 2XI9A 1FEZA 1IV8A 1WG8A 5HMMA 4WC0A 4M47A 2BBJA 1JIHA 2W11A 2EQYA 1ZQJA 1IM4A 4C80A 4YMNA 2ID1A 3MC1A 4XJEA 4JB3A 4IRKA 1DRGA 1L7OA 5AKJA 1ZQEA 2BGWA 5BOMA 3PX6A 2NO4A 1SL1A 2KG5A 3SZ2A 5L1MA 5DB7A 5T14A 4QZGA 4U6PA 2BDUA 4C8MA 2HOIA 4I2IA 2DPJA 4QWCA 4M0AA 1XSNA 3GV5B 4KLEA 2ZH8A 5KT2A 4J9KA 4QWAA 3H7IA 5IIMA 7ICNA 4AT9B 4RWOA 2VA8A 4WC5A 1ZQCA 7ICJA 4WH5A 1MQ3A 1ZQPA 3L4PA 4QZCA 4X4VA 4WCWA 2EWRA 2PXIA 7ICGA 1Q3VA 2XY7A 4RQ0A 2FDRA 2VIXA 7ICVA 2LM1A 3AQNA 4DQRA 1SZHA 2JR5A 2F1HA 5ALRA 4NJ8A 3K7DA 2YB1A 2WB1F 4K8VA 2DL0A 2G5HB 2ZH7A 5DBAA 2F1JA 1SGGA 1PK1B 4KN7A 9ICPA 3HJ4A 5CHEA 2Y1IA 4PHEA 3RRGA 4DO9A 1WYGA 4F2RA 1ZD2P 2F8KA 5D62A 4WC4A 4O5EA 1WCNA 5ALYA 2V4QA 3ZI4A 2ZTDA 3AEVA 8ICOA 1KBUA 4FO6A 4NY8A 2ZIVA 2YN4A 4ELVA 1RM6C 2CPRA 2KZZA 2DQNB 4GIBA 1R89A 2J6TA 4ECTA 4US9A 1N60A 3KZXA 4F4XA 5HRHA 1T4GA 1X2IA 4FZMA 5J0PA 9ICTA 2OM6A 3MGIA 1RPLA 3NVZA 4J03A 3PNCA 2FPMA 2UVUA 1QQ6A 2IHMA 5FP0A 3R9KA 1L3VA 2W7PA 4E8FA 2BCSA 5D4BA 4AYBF 4KLUA 5EWEA 5DGBA 5JTGA 3N28A 3HW8A 3C2LA 2MRLA 2I1QA 4LJXA 4GXIA 4ZOHC 4MF8A 4YP3A 1ZQUA 3ORYA 3JYYA 1VJ7A 3MR6A 4M6WB 3F2BA 1A77A 1X40A 3BQ0A 1KN5A 4BDPA 4DQPA 4K99A 4PHPA 4AT9A 4X4RA 3V7KA 3NRZA 1ZQQA 4RT3A 9ICEA 1N2XA 4J9NA 4FS2A 2WB1C 3E2EA 5EWFA 4UAUA 1CRXA 4QZ8A 7ICUA 3PW2A 3RAQA 5J2GA 5KFQA 2E3TA 2JEIA 2BQ3A 9ICWA 2KIWA 1R8BA 3K1RB 4UASA 1N48A 4M9HA 1PK1A 4XQ7A 3CW2C 8ICIA 2KIVA 1ZQBA 8ICUA 4OAFA 2MSNA 3RTVA 3WK4A 2W9MA 2EANA 1JRPA 3WK6A 1D8YA 3PX4A 9ICIA 3OV7A 3RBDA 5DDYA 5KFWA 4DF4A 4ELTA 2HN2A 1X66A 3I76A 2K8CB 4C7YA 3D2QA 1TK8A 2RDIA 3BS7A 4KLQA 1RYSA 4QZEA 2QB1A 1BPDA 4I29A 5HRIA 3QUCA 2DRAA 1Q8KA 3Q8KA 1SWWA 4J9QA 5JTIA 4ATBA 4C4RA 4RUAA 2F3NA 2K4IA 3H8SA 1JI7A 2BKEA 1L8OA 2JGAA 3VCBA 4PGYA 4QNLA 3C23A 4B9LA 5CEHA 2OH2A 2W43A 4B9UA 5ALGA 2M2UA 3SAGA 3PSIA 8ICQA 3WFSC 5CFTA 3BJYA 5ALQA 5AKGA 4UBBA 3G6XA 1D9FA 8ICEA 3GQCA 3TADC 1ZQLA 3OJUA 4F8RA 4Z6CA 2BBHA 4KX3A 4MFCA 7ICQA 2B51A 4UB1A 2A19A 4WQKA 4KLFA 9ICSA 5KFCA 5J0RA 2G06A 1X9MA 3QZ7A 5DLGA 4F5RA 3C29A 1ZQOA 4I2DA 3OHAA 2VJ5A 3GIJA 3HILA 2LI6A 3T5KA 3HIYA 1TFYA 2E5SA 3ZDBA 4M04A 3Q8RB 4HYKA 2YMMA 3AU2A 2OXOA 2BCUA 3SMVA 2H5XA 4ECZA 1TAMA 2ZUBA 4KITB 3E0FA 2LYBA 5J0UA 1L8LA 4QZDA 3SV4A 5CFUA 3PW5A 4RWQA 3JPNA 2EAPA 5AI8A 3T5JA 2HHUA 1MA7A 4DLEA 7ICSA 2ZJ5A 3HKZF 4WBYA 2DF4B 3ETRA 3RJEA 3RBEA 3LVVA 4ECRA 2QARB 3KHRA 4OAIZ 5KT6A 9ICNA 2NV3A 5AM2A 5KG4A 1PK3A 3AQFA 4BGDA 4P4MA 1ZETA 3KHGA 1MC8A 5HHHA 3V72A 2V9WA 1X9SA 4YXJA 3HPOA 3RR7A 5KFJA 5AI4A 4TUPA 4K96A 2Q4TA 1ZXIA 2HCFA 1ZQWA 3NUQA 1NO5A 1JUDA 3UMBA 4Y2VA 2VJ4A 3KTQA 9ICFA 5HR6A 1A76A 4FHXA 1BPBA 3ONNA 2ZXIA 1XWLA 4Q44A 4PGQA 4O5KA 8ICCA 4DCCA 2FJ6A 1VDVA 3UM9A 4RNMA 1O08A 5E79U 5ALZA 3C21A 3M8RA 4YVZA 3MDAA 3RJHA 5J0WA 4X4SA 3GFKB 1MIYA 2DFLA 5CRXA 5DKWA 4Y2UA 7ICMA 4LZGA 1RYUA 5L1IA 3RB0A 3ZDEA 3MR2A 1BPYA 2ZH1A 2O5AA 3TAQA 5CFSA 3NGDA 1HJPA 3QX7A 5JRTA 2Y9UA 3MFHA 1X6IA 4OD0A 1JAJA 1D8BA 4I2GA 3ALRA 4EGWA 2E8MA 2WHEA 4DSIA 1Z4OA 1BNOA 4DL3A 3RR8A 2RLTA 4QZBA 4Q45A 3PMLA 1L3UA 4XUSA 4GLXA 1XSPA 3UMCA 4K9BA 1Z3EB 3BZKA 4GFJA 4DFMA 3HKZC 5ALKA 1NI3A 3IM1A 5KG7A 5IIOA 2HSZA 1RYRA 1FFUA 3WKDA 4F71A 1V38A 4NM1A 1HIWA 3PSTA 3TACB 3JPOA 4X4QA 3M6KA 4C0ZA 5ALVA 1ZJMA 4IG8A 2QARA 2HBMA 4OJ5A 3NYBA 2OEHA 2KEYA 2LPEA 3AL0B 3AQMA 2NRZA 3H8MA 2BPFA 4X0AA 1V4AA 3UMGA 1L7MA 5DB6A 2HI0A 3L3FX 4DS5A 1PVQA 4NXVA 3E58A 3KKAA 1BPZA 5L1LA 2KFNA 1QSLA 4R63A 4OJLA 3C1YA 8ICLA 5HRKA 4M9NA 5ALMA 1XO1A 5BPCA 4RQ5A 5AKEA 1R8AA 3ZD9A 4US8A 4EEBA 4IS7A 5HRLA 3SD7A 4IQWA 1S0VA 4MFAA 1YT3A 4NXUA 3KBBA 4UB8U 5GTHU 1VLBA 2ZIXB 1ZQGA 1JALA 3QU9A 2DR5A 3RJFA 4X4TA 4NV0A 1URJA 2NRVA 4F5NA 4WC3A 3GIKA 4RUCA 3OWGA 4KMUA 3ZD8A 4AT8A 4I28A 1B22A 1OU5A 4O3NA 2ZIUB 4P2HA 5J2FA 5ALPA 1OUQA 3H3AA 3VC8A 3H4DA 1RXVA 5ALDA 1CI4A 2HVHA 2PBEA 2ZH6A 4F4YA 5J29A 3MGHA 1IXRA 4YQWA 1IIPA 4E7XA 5ALTA 3IP4B 2K8AA 2FPLA 2HHQA 4UARA 3HWTA 2ZH2A 4BUGA 4JK1A 2KZMA 4EYIB 2IHOA 2ALZA 3BZCA 5CR0A 2XY5A 4IR9A 3LYSA 1PZNA 2D8CA 3RH6A 2P66A 4LEZA 3JPQA 3T5HA 4FFDA 2VANA 9ICUA 1WUDA 4Y2RA 3WKEA 2HBKA 4I0UA 3GU3A 2V4RA 1ZQTA 5AI6A 2PFOA 2MUTB 7ICFA 5AHXA 4DQSA 4LEYA 1UCVA 8ICXA 9ICBA 1JX4A 1U48A 4I2CA 2ZG6A 2XY6A 2KICA 1V97A 4JV1A 1SXDA 4RQMA 4RQNA 5AK6A 4NL9C 2A3VA 1SKSA 5KFOA 4OJOA 4EBEA 4NXTA 3K1ZA 2DUYA 3F5EA 4YR2A 9ICRA 1GO3F 7ICTA 1QCKA 4C4TA 4KMOB 2E8OA 3UQ0A 2BZFA 2KP7A 3TFRA 2IOFA 1SV0C 3IG5A 5KT3A 3QEBZ 1MN8A 5ALUA 5KFHA 3RAXA 2KV2A 4WC7A 2IOFK 1AROP 3PW4A 2WAQF 1NZPA 2MU2A 2ZIXA 4R8UB 3WFQE 5F9NA 2FMPA 5HP4A 1UT8A 2FLLA 2RP5A 1S97A 3IDWA 1NK8A 1ZQNA 2K8BB 3C66A 4AT7B 2ZIUA 2DKZA 1TE2A 2RRDA 2ZTCA 4QZFA 3F5AA 5CJ7A 3PW7A 4E80A 2W8LA 3ER9B 1SZPA 2KE7A 4WOYA 4DL4A 4OAGA 3GIMA 1JQRA 2HOFA 1EXNA 2KJ5A 2AJQA 3HP6A 4FH5A 2ZJ8A 3M1YA 3V6KA 4FHVA 1B43A 4EBJA 1P7DA 8ICPA 3WKAA 1L7PA 3IV6A 5DG9A 3B9JA 8ICMA 3UXOA 1WCLA 1H38A 5HR9A 1ZQRA 9ICOA 4USAA 5ALSA 1LKYB 2IBKA 5EWGA 1N56A 5KG6A 7ICEA 1MQ2A 3THVA 1A0PA 5TZVA 2FMSA 1U49A 1XC9A 1UA1A 1NKBA 1ZQ1C 2KKPA 4QW8A 2MUTA 3NVWA 4S3NA 1UQVA 2R8IA 2B21A 3HJ1A 1FFVA 2M2VA 3AM9A 1NKEA 4EV6A 3AUOA 5CHGA 2C2EA 1ZRMA 3NASA 1D9DA 3N7SC 1QQ7A 4ATBB 3ISCA 2ISOA 2HHPA 3HJEA 4RWPA 5KFUA 1NKCA 3WK7A 3QYPA 1NJXA 4EYHB 5DB8A 4DOCA 1F44A 1COKA 4Y2TA 4C8OA 4F4KA 4BWMA 3HX0A 1LB2B 2FLPA 1M6YA 2XC9A 3T3FA 4RQ2A 1F5SA 2WAQC 3H37A 2EAOA 1S0NA 1SKRA 3RJGA 3WK5A 1HEKA 3M7DA 2IOHA 3ISDA 1ZQKA 2WF9A 3Q8SB 1L6NA 4RPXA 1X6JA 5KFNA 4RNOA 3OVAA 3EW9A 4QZAA 3RJIA 1S9FA 1Z00B 4R8UA 5D46A 2ZH9A 5KFAA 3NTUA 4UB4A 2JEFA 4EEYA 2PFPA 5AM5A 4Q8FA 5D63A 2DWQA 2B4VA 2KNJA 4GXJA 4DL7A 4AT7A 5HHIA 3OUYB 3WFPA 4J9SA 4M9JA 3SR6A 4MF2A 3PVXA 1NK7A 3DDHA 3BDPA 2KN7A 1SV4A 2VA3A 4B6JA 1SL0A 8ICAA 1K1SA 2KKVA 4EEKA 3BQTA 1K1QA 4NKUA 2QB0B 1CUKA 1SKWA 4ED2A 4J9MA 4KX5A 5G5GA 3C5GA 1NJYA 1S76D 5ALWA 3NVOA 4UAZA 4QWBA 2AGOA 4Y2XA 2JHDA 4J9LA 3QE9Y 9ICJA 3AN1A 1LKYA 3QZ8A 4CF5A 1TFRA 3OJSA 4K97A 1U45A 2AGPA 4P0PB 5ALHA 1QLNA 1V85A 3QU5A 9ICLA 1CEZA 5J0XA 1YLQA 3B0YA 1S5LU 2F8LA 3ERCC 2YB4A 2ZTEA 5AKLA 3V7JA 2PKEA 3KZIU 3OSNA 4EBKA 5C0YA 4KLIA 5HC9A 2CXYA 5ALJA 4UB5A 4B9TA 4DQQA 3PX0A 4TQSA 5AKZA 4EX7A 3JPSA 1BVSA 1N62A 1BNPA 3SAHA 3AQKA 4F50A 1SIJA 1NK6A 4RWNA 1F5AA 2F76X 2LM4A 3V6HA 2YQEA 9ICXA 5A0LA 5DQGA 4TUQA 4FHYA 3J81j 1XS9D 3OVSA 1Z00A 3SEIA 5B5EU 5KAIU 2ZUCA 2L5YA 5J2CA 1MIVA 1KQQA 4PL2A 3OUYA 4WC6A 5J0OA 1FA0A 3WKBA 5L1KA 2ISPA 5AM4A 1NK5A 1BPXA 2G09A 5H2FU 5KFGA 1KDHA 3D2SA 4EP7A 8ICSA 4UAWA 5ALFA 5JU5A 2QB0A 3PY8A 2AQ4A 1TV9A 1T94A 4KLOA 9ICHA 5D49A 4LZDA 2AXTU 5J8YA 3LWLA 2WF8A 5DDMA 5KAFU 2E1FA 4YG2A 4FBTA 2JRZA 2GO7A 3RH4A 1TFWA 5G5HA 4ED8A 3BQ1A 5CA7A 4RU9A 5HR7A 5AK4A 3BQ7A 2W9AA 1ZQAA 3NKUA 4B9SA 4Q8EA 4P0PA 2K4PA 3HT3A 4GC7A 1S0OA 4M9LA 4F2SA 5J0YA 5L9XA 1YZ7A 4YFKA 5HRBA 5DG7A 4NWIA 3M8SA 4EELA 2BQUA 2F77X 4DQIA 9ICVA 5AKYA 3WKCA 3OGUA 4ED6A 4K9AA 3SENA 1DGSA 2BCQA 5AKXA 1T3QA 2GAFD 1S8OA 2E8NA 2JMGA 3BQ2A 2BPCA 5DEDA 3AU6A 2DR7A 5KG1A 9ICMA 4IQUA 2VKQA 3G6VA 2XCPA 2BCRA 3EUB2 2B6GA 1MSWD 3JCFA 1BGXT 5EOZA 3LDAA 4ACOA 2E8PA 4NLNA 1FO4A 4AT8B 1TK5A 4WQLA 4F4ZA 4ELUA 3MGVA 3H40A 5KFDA 1DOQA 3IHQB 3PW0A 3ER8C 4GC6A 4E0DA 4NLBA 5DLFA 8ICBA 5DG8A 2Q66A 3WFRE 2H3FA 3KD3A 2GLEA 4ECYA 5KG0A 4WBZA 1NNLA 2EZYA 2JH1A 5KFMA 1OXJA 5KFSA 4C8NA 5AK3A 1JN3A 5J0SA 2BCVA 4FS1A 5ALIA 1SXEA 1X9XA 1ZJNA 4U7CA 3LQCB 1ZD4A 5EE0A 4OJPA 3GILA 3RJKA 2HVIA 1IG6A 1PVRA 2AHOB 4OCZA 4I2AA 4JLZA 2UVVA 1Z1BA 2MAXA 5DGAA 2BDPA 4UW9A 2RFFA 4Y2PA 4DF8A 1T8EA 1ZQMA 2JXJA 2H3VA 3JZ0A 7ICPA 8ICRA 3H0LB 2ZXHA 3G6YA 3JPRA 5KFPA 5DQHA 5KTQA 1Q79A 3GIIA 3NVYA 3F53A 3ETLA 2G07A 2NRXA 2ZJAA 5AICA 4OAHA 5KFXA 4I2BA 3SV3A 2C28A 1WOTA 5J2HA 1L5UA 3C2KA 2JEGA 5J2EA 2F44A 2Y9TA 4IR1A 4RQ3A 3NWIA 2BHNA 3A0HU 3JPPA 4TUSA 2GA9D 2QLTA 2NRTA 3M6ZA 2YMPA 1BPEA 1O03A 2BR0A 1UT5A 1UEVA 1Q46A 2ZH3A 2HOQA 3MBYA 4RQ6A 3EPGA 2EH9A 2F2AB 4O3SA 3MCRA 2UVWA 4NLZA 2HMXA 2WTFA 2P6RA 5DQIA 5B3PA 5KFZA 3ED5A 1SWVA 4KLGA 3HRDD 4LEVA 4DL5A 4IL6U 1XSLA 1KW4A 1T3NA 4PHDA 1VJ5A 1DK2A 3L5KA 2HW3A 3O0FA 3JPTA 1XU4A 4G9BA 5HREA 4UD5A 2NYVA 8ICNA 4F5PA 3N7PD 2M9NA 3MR5A 4Z6DA 4DEZA 5ALLA 3KFUF 1NK4A 5AK5A 1ZQSA 2P6UA 2ZH4A 3CRXA 3WK9A 3MDCA 9ICCA 2DVIA 4PHAA 3NRWA 5EE1A 1NK0A 3PO5A 3K4GA 4JUZA 4UB3A 4A8EA 2HHSA 8ICWA 3V6JA 7ICRA 4DFJA 3PMNA 5KFVA 4DOBA 3UXPA 1NZBA 4O3QA 4UATA 3CYMA 2JEJA 3L9DA 3OVBA 3UPQA 2W3RA 2C2DA 2IA6A 4K4GA 5CWRA 4XRHA 2Y0SF 4JV0A 4FHPA 1NK9A 4DSKA 1KSPA 5ALNA 5IIIA 4NM2A 1ECWA 2VA2A 1C7YA 4AP9A 5HRDA 1ZQVA 2B0CA 4CRXA 1Z19A 2P35A 3KKAC 4NLKA 1ZQDA 2PMZF 1KKXA 3SYZA 5KG3A 1Y88A 1COOA 1QH9A 1ZD3A 2XO7A 1RQNA 3PHZA 1SL2A 1U47A 2KMDA 5DB9A 2XGPA 4EBDA 4FZNA 4K98A 2OWOA 2NRWA 8ICFA 4PZNA 4QIWC 4IQVA 3FC4A 2HHVA 1SB3C 3QU7A 4TQRA 3N7RC 4YD1A 3SI8A 4JMUA 1RG6A 4DL6A 4RQ8A 3D6JA 2ZHAA 4Z6EA 9ICAA 4XQ8A 4ED7A 3UPSA 4QZ9A 3Q8QB 3Q8PB 5IIJA 1HUZA 4CDGA 3N97B 3RB4A 3IN5A 3LWMA 2DR8A 4Y2YA 4OJ6A 4DFDA 4FBUA 2W04A 4O3PA 4DLGA 3BS5B 4YN4A 2I5HA 1R8CA 5L1JA 3H8JA 2G08A 4LEWA 4KLDA 2FCLA 4ZH4A 1JMSA 4ICAA 5KG5A 5D61A 5KT4A 5AI0A 5AKHA 4X4PA 3H38A 5CB1A 4DL2A 5AM3A 7ICOA 4KTQA 2RHFA 4ECUA 4ECQA 4FHWA 2W55A 2K60A 1N5XA 4I2JA 5J0QA 1JROA 4DS4A 3RB3A 1S0MA 3QXGA 8ICHA 4O67A 3I1YA 3C2MA 1GPJA 3QU4A 4BWJA 1PX5A 3QUBA 4UB2A 4O3MA 2I9GA 5KG2A 3LVWA 2Z7JA 1L3SA 3M9MB 3TANA 2Y0SC 3D2NA 4PZOA 2WF7A 3KHLA 4RQ1A 1L7NA 5AIAA 3PV8A 4B9VA 4C8KA 4C8LA 8ICGA 2AGQA 4EZ9A 4P4OA 4O5CA 3FYHA 4CF3A 3QUTA 2H3ZA 2K4EA 3LK9A 2IHNA 2W54A 5JUMA 2PMZC 3AMZA 3OSPA 1RDFA 1TK0A 3GDXA 5J2KA 4QWEA 5GTIU 3H39A 1B4FA 2HHXA 4UBCA 2W03A 3AQEA 3TADA 4PH5A 4F91B 3ZDCA 5TISU 1L3TA 4ECSA 1WWVA 1WWUA 2HDOA 2HBJA 3EF2A 1X9WA 1RXWA 3C1ZA 5J2JA 1KTQA 2DGZA 4O0IA 3C28A 4RZRA 1UETA 3EYZA 1OW5A 1ZOLA 1S77D 4DSFA 2LYAA 4YCXA 4Z6FA 8ICJA 3Q8LA 2EZZA 1DXSA 5F2VO 4F4WA 3KOOA 3MR3A 2A1JB 5HRGA 4B9NA 8ICYA 2AQ0A 3Q8MA 3H8WA 2OYYA 2DR9A 2YTUA 4BXOB 4DSEA 4O3RA 1UEUA 3M9NB 4F72A 4J9OA 4RQ7A 4CCHA 4RQ4A 2KSOB 3BS5A 7ICHA 4JWMA 2XIDA 2HBLA 5KFIA 1KLNA 1JXLA 4ED1A 5EE3A 2J6UA 3QNMA 4P0QB 4K4IA 4F93B 2E1EA 1KFSA 1N61A 4G3IA 2DRBA 4YMOA 3IRUA 4ECVA 4KB6A 4O69A 2RDJA 2I6XA 1KEJA 3MABA 7ICIA 3FM9A 3H0MB 4K4HA 5C5JA 2FI1A 3TKAA 5KFBA 4DSJA 3OHBA 1TAUA 2BE3A 7ICLA 1UA0A 5J0TA 4RPYA 4CE6A 2OCEA 4PPXA 4ED0A 5DECA 3EZ5A 1ZQFA 3GV8B 5CP2A 2R18A 3WFOA 2FE9A 4JLXA 2C2RA 2KFZA 1TVAA 1U4BA 4CNQA 4P4PA 1KRPA 2ASLA 1J2NA 4HAIA 5KFEA 4EBCA 1XO0A 2ASJA 5AI5A 5IIKA 2ATLA 5KFKA 4KLJA 3PO4A 2JH7A 4FO1A 4YD2A 3N4MB 4AYBC 3TQ1A 2EZXA 1KFTA 3C18A 4NXXA 2ZHBA 8ICZA 5EE9A 5IILA 2XGQA 4KLHA 2PI5A 1FIQA 2NRKA 4BX9C 2KK0A 1N5WA 3WK8A 4X4NA 2JZBB 4O9MA 2AU0A 2DBYA 2LHTA 4NKTA 4NXZA 8ICTA 4XA5A 4C4SA 5DBBA 2YX8A 2D3DA 2KHQA 4PL1A 4GXKA 2ZUDA 1A6SA 4LT6A 4M6WA 1F0MA 1KFDA 2CN1A 2O6KA 2DPIA 2M0NA 2FPKA 2HHWA 1N63A 5IINA 3B0XA 3PZPA 2A1JA 2KD1A 3AQLA 4X0BA 1K5OA 2R8GA 4BJQA 3RJJA 3QU2A 3ICXA 5F3XB 2J6SA 2HN1A 2ZIWB 4BXOA 4QZIA 3QEAZ 3UQ2A 4RT2A 2KSOA 4FE3A 2OHFA 1TAQA 4UAVA 1AQ6A 2M2TA 2YMLA 4P0QA 3I28A 1Z1VA 3UXNA 2XVTA 2YMQA 5AIBA 3K75D 2KTQA 2YY6A 4N7RA 1DGJA 4I27A 2G5IB 4EENA 3GV7B 2LBOA 4FZLA 1ZD5A 5J2DA 1ZQIA 4IRCA 4EEDA 2W9BB 2R8HA 3CP8A 4YMMA 3H0RB 2W3SA 4F3OA 1V9PA 2WF6A 4IC9A 4NLCA 5KFYA 4X5VA 5KFFA 3MFIA 2KVSA 4KLSA 7ICKA 2ES6A 5KT5A 5KL8B 2KZ3A 3PR5B 3RF9A 3FAHA 4DFPA 1S10A 5AI9A 4O3OA 2ASDA 3KHHA 4C7ZA 3CNHA 1T7PA 2IUBA 1ZQZA 4KM5A 3WU2U 2LMRA 2KVCA 5HNKA 4PJ0U 4EZ6A 4R65A 3EPIA 1JXEA 5J2AA 4TURA 9ICKA 4UD4A 2IMWP 1ZQXA 4MFFA 4WC1A 1ZQHA 2D6FC 2GOLA 4UB6U 1RQLA 4MHVA 4UQGA 3RRHA 2JZBA 3PSFA 4DOAA 2XCAA 2HHTA 1D8LA 1NOMA 2ESEA 1UHUA 4Y2QA 5KFTA 2PFNA 4YR3A 1Q78A 4X4UA 2H3QA 4ECXA 5K4LA 2GH1A 1YZ6A 2CRXA 1PVPA 3A0BU 5KFRA 1DK3A 2Y1JA 2F1IA 4QW9A 2ZIWA 2M2WA 3EWAA 2A1AA 2BPGA 2W8KA 1B0XA 4HX0A 3IG8A 3PSPA 1ZRNA 1U9LA 2FLNA 1UPHA 5AM0A 4YR0A 4KLLA 2K89A 4R64A 3T5LA 5B3QA 1XNSA 2FMQA 4RPZA 1Z4NA 2R8JA 3ZDAA 1KNYA 5J8YC 5KT7A 2C22A 4FH3A 4O6AA 2KJ8A 4OO1J 2ODGA 5KL1B 5KNIA 2LYHA 4I2FA 5J2IA 2W9CB 4DSLA 4I2HA 2W9BA 4CGZA 4NL9A 5AM1A 2KHVA 4RNNA 1KL9A 4Y2SA 5ALOA 3PR4A 4B9MA 2ZH5A 2B56A 3T79A 4JV2A 2MA1A 3NS1A 1NJWA 5HRFA 4MEXA 2H3IA 1SV0A 5AKKA 4DWIA 1J2MA 2KJ9A 5J2BA 9ICQA 4EX6A 3F2CA 4J9RA 3M9OB 3QUQA 1QQ5A 2UVRA 4KN4A 4NXWA 4PGXA 3U26A 2EAMA 4ECWA 8ICVA 2GWSA 4QIWF 3TFSA 3GZFA 2N1RA 3OTQA 4JWNA 5HMLA 1ZQYA 3TI0A 4F5OA 4KLTA 3SQIA 1RZTA 4QZHA 2K4HA 4MEYA 1X42A 4YXMA 2AH5A 3NVVA 4IRDA 3FDSA 2PI4A 3ISBA 3DV9A 1PUZA 3ZDDA 1QSYA 1QSSA 3DEEA 3CK6A 4X4OA 1LVHA 5ALXA 4QWDA 4NLGA 2XICA 5B66U 4MKPA 2W7OA 3F2DA 2LKYA 3TAPA 2WF5A 4WC2A 3S6JA 4R66A 4I2EA 1NJZA 3OPXA 2RQ5A 4ED3A 2O1PA 1LV5A 4J9PA 2BQRA 1ED1A 4F5QA 1QTMA 2QKQA 3SAFA 5AKIA 4IQTA 4O68A 1VFGA 2WFAA 4M5DA 4LVSA 1J97A 1Q3UA 2PFQA
chains in the Genus database with same CATH topology
3TAQA 5KFLA 4M9GA 2Q0ZX 4FHYA 3NGDA 3RH5A 3LK9A 1HJPA 3TARA 1XS9D 2IHNA 3V7LA 5JUMA 3MFHA 3OVSA 4KLMA 1Z00A 1JAJA 8ICKA 2ZUCA 4Q43A 3OSPA 4I2GA 1TK0A 4DSIA 5J2CA 5BOLA 3GDXA 5J2KA 1HUOA 4DL3A 3RR8A 2W9CA 4M2YA 4QWEA 9ICGA 1BNOA 4QZBA 4Q45A 3PMLA 1L3UA 1MIVA 4F92B 4XUSA 4GLXA 4DFKA 1XSPA 3H39A 2R8KA 4UBCA 2HHXA 1MIWA 4PH5A 3OUYA 1Z3EB 1TKDA 3RB6A 4F91B 1ZYQA 3ZDCA 4DFMA 5J0OA 4WC6A 4UAYA 1L3TA 1FA0A 3IM1A 4ECSA 5F9LA 5L1KA 5KG7A 3H4BA 2ISPA 5DBCA 3C5FA 5IIOA 1X9WA 1RYRA 1NK5A 1RXWA 1BPXA 5HMMA 3C1ZA 4WC0A 1KDHA 5KFGA 5J2JA 1KTQA 4M47A 1JIHA 4EP7A 4NM1A 4O0IA 1ZQJA 1IM4A 8ICSA 3JPOA 4X4QA 4UAWA 4RZRA 1UETA 3EYZA 3PY8A 4YMNA 1S77D 2ID1A 1ZJMA 4DSFA 4IG8A 2AQ4A 1TV9A 4KLOA 4IRKA 4YCXA 5D49A 9ICHA 4Z6FA 4LZDA 3LWLA 8ICJA 3NYBA 3Q8LA 1ZQEA 5F2VO 4F4WA 2BGWA 5BOMA 2NRZA 3PX6A 3AQMA 4X0AA 3MR3A 5DDMA 2A1JB 1SL1A 2BPFA 3SZ2A 4YG2A 1V4AA 5DB6A 4FBTA 3RH4A 5HRGA 5DB7A 1TFWA 4B9NA 8ICYA 4QZGA 4DS5A 4ED8A 2AQ0A 3Q8MA 3H8WA 4C8MA 3BQ1A 4I2IA 5CA7A 2DR9A 4RU9A 2DPJA 1BPZA 4BXOB 5L1LA 4DSEA 4QWCA 4M0AA 4O3RA 2KFNA 2W9AA 1ZQAA 1QSLA 1UEUA 4R63A 3M9NB 4J9OA 4B9SA 4RQ7A 4CCHA 3C1YA 4RQ4A 1XSNA 4Q8EA 8ICLA 7ICHA 4M9NA 5HRKA 3GV5B 4JWMA 4KLEA 3HT3A 4GC7A 2ZH8A 1S0OA 5KT2A 4M9LA 4F2SA 5J0YA 4J9KA 5KFIA 4QWAA 1KLNA 5L9XA 1JXLA 4ED1A 4YFKA 3H7IA 1XO1A 5DG7A 2J6UA 5BPCA 4RQ5A 5HRBA 4K4IA 5IIMA 7ICNA 1R8AA 3ZD9A 2VA8A 4AT9B 4RWOA 4WC5A 1ZQCA 4F93B 3M8SA 2BQUA 1MQ3A 1ZQPA 7ICJA 1KFSA 4DQIA 4G3IA 4QZCA 4X4VA 5HRLA 2DRBA 4IQWA 1S0VA 9ICVA 4YMOA 4MFAA 4WCWA 2PXIA 4ECVA 7ICGA 3OGUA 4ED6A 1DGSA 1ZQGA 2XY7A 2DR5A 2RDJA 2BCQA 4RQ0A 3RJFA 1KEJA 7ICVA 3AQNA 4DQRA 3MABA 4X4TA 2F1HA 2NRVA 4F5NA 4WC3A 3GIKA 4RUCA 7ICIA 4K4HA 5C5JA 4KMUA 3ZD8A 4AT8A 3BQ2A 4I28A 2BPCA 5KFBA 3OHBA 4O3NA 4DSJA 1TAUA 7ICLA 1B22A 1OU5A 2BE3A 5DEDA 3AU6A 2DR7A 5KG1A 4P2HA 2ZH7A 5J2FA 4IQUA 1UA0A 5J0TA 5DBAA 9ICMA 2F1JA 4RPYA 3G6VA 3H3AA 3H4DA 1RXVA 2XCPA 4PPXA 4KN7A 2BCRA 4ED0A 2HVHA 2PBEA 5DECA 2ZH6A 4F4YA 5J29A 3EZ5A 1ZQFA 1MSWD 3MGHA 5CP2A 1BGXT 5EOZA 3LDAA 3GV8B 2Y1IA 3WFOA 4PHEA 4NLNA 2C2RA 3RRGA 1IXRA 2KFZA 4DO9A 1TVAA 1U4BA 4F2RA 1TK5A 4AT8B 4YQWA 4P4PA 4E7XA 1KRPA 4F4ZA 2ASLA 4WC4A 2FPLA 5KFEA 4EBCA 4O5EA 2HHQA 1WCNA 2ASJA 3HWTA 4ELUA 2ZH2A 3H40A 2V4QA 5IIKA 5KFDA 1DOQA 2ZTDA 3IHQB 3PW0A 2ATLA 4GC6A 8ICOA 5KFKA 4JK1A 4FO6A 4EYIB 3PO4A 4E0DA 4NY8A 4KLJA 2KZMA 2ALZA 5DLFA 4ELVA 2KZZA 4YD2A 3N4MB 5CR0A 8ICBA 5DG8A 2XY5A 3TQ1A 4IR9A 1KFTA 1PZNA 3C18A 2ZHBA 2Q66A 3WFRE 3RH6A 8ICZA 2P66A 1R89A 3JPQA 4ECYA 3T5HA 5IILA 5KG0A 2XGQA 2J6TA 4WBZA 4ECTA 4KLHA 2VANA 5KFMA 9ICUA 2PI5A 5KFSA 4C8NA 4F4XA 2NRKA 5HRHA 1T4GA 1JN3A 1X2IA 5J0SA 2V4RA 2JZBB 1ZQTA 2BCVA 4X4NA 4O9MA 2AU0A 4FS1A 2PFOA 5J0PA 2MUTB 7ICFA 9ICTA 4NKTA 4NXZA 4DQSA 3MGIA 8ICTA 4XA5A 8ICXA 1ZJNA 5DBBA 9ICBA 3LQCB 1JX4A 1RPLA 1U48A 2UVUA 3PNCA 2FPMA 4I2CA 2IHMA 4GXKA 2XY6A 1L3VA 4E8FA 2ZUDA 2BCSA 4JV1A 3GILA 3RJKA 4LT6A 4M6WA 1KFDA 2HVIA 5D4BA 2DPIA 4KLUA 5EWEA 5DGBA 2FPKA 2HHWA 3HW8A 5IINA 3B0XA 3C2LA 2A1JA 3AQLA 4X0BA 1SKSA 4I2AA 2R8GA 3RJJA 5KFOA 4EBEA 2UVVA 2MAXA 2I1QA 4GXIA 2J6SA 4YR2A 5DGAA 9ICRA 2BDPA 4BXOA 7ICTA 2RFFA 4QZIA 4MF8A 4YP3A 1ZQUA 3ORYA 3QEAZ 3UQ2A 4DF8A 4RT2A 3JYYA 1VJ7A 3MR6A 3UQ0A 4M6WB 1TAQA 1T8EA 1ZQMA 1A77A 3TFRA 2KP7A 3BQ0A 4BDPA 3JZ0A 7ICPA 8ICRA 2M2TA 4DQPA 3G6YA 3JPRA 5KFPA 5DQHA 5KTQA 5KT3A 3QEBZ 4PHPA 1Q79A 3GIIA 4AT9A 5KFHA 4X4RA 3ETLA 3RAXA 2NRXA 3UXNA 3V7KA 4WC7A 1AROP 3PW4A 2ZJAA 3K75D 1ZQQA 4RT3A 1NZPA 2KTQA 5KFXA 4I2BA 3SV3A 9ICEA 2C28A 1WOTA 4R8UB 5J2HA 3C2KA 4J9NA 1L5UA 3WFQE 5F9NA 4FS2A 2JEGA 5J2EA 4IR1A 4EBJA 2FMPA 5HP4A 4I27A 1UT8A 4RQ3A 2FLLA 3GV7B 7ICUA 3E2EA 2BHNA 5EWFA 1S97A 5J2DA 3JPPA 1ZQIA 4QZ8A 1NK8A 4IRCA 3PW2A 4TUSA 2W9BB 1ZQNA 3RAQA 5J2GA 5KFQA 2R8HA 2JEIA 2BQ3A 3C66A 4AT7B 4YMMA 9ICWA 4F3OA 1R8BA 1V9PA 2NRTA 2ZTCA 4QZFA 1N48A 1BPEA 4M9HA 3PW7A 5CJ7A 5KFYA 2BR0A 4XQ7A 4X5VA 1UT5A 4E80A 5KFFA 2W8LA 1UEVA 3MFIA 8ICIA 1SZPA 1ZQBA 4DL4A 4KLSA 3GIMA 8ICUA 1JQRA 2ZH3A 7ICKA 5KT5A 1EXNA 2KZ3A 3PR5B 2AJQA 3MBYA 3HP6A 3RTVA 4RQ6A 4FH5A 2ZJ8A 2W9MA 3EPGA 1D8YA 4DFPA 1S10A 3PX4A 4O3SA 9ICIA 4O3OA 3V6KA 2ASDA 2UVWA 4NLZA 2P6RA 2WTFA 4FHVA 1B43A 5DQIA 3KHHA 3RBDA 5DDYA 5KFWA 5KFZA 4DF4A 1T7PA 8ICPA 4ELTA 4KLGA 1ZQZA 5DG9A 4DL5A 1XSLA 1T3NA 4PHDA 8ICMA 3UXOA 1DK2A 1TK8A 1WCLA 2RDIA 5HNKA 3JPTA 2HW3A 1XU4A 4KLQA 1RYSA 4EZ6A 1H38A 4R65A 5HREA 4UD5A 3EPIA 5HR9A 1JXEA 1ZQRA 4QZEA 8ICNA 5J2AA 1BPDA 4F5PA 9ICOA 4I29A 5HRIA 4TURA 2IBKA 9ICKA 4UD4A 2IMWP 2DRAA 1ZQXA 4MFFA 5EWGA 3Q8KA 2M9NA 5KG6A 4Z6DA 4DEZA 3MR5A 3THVA 1N56A 1MQ2A 4J9QA 1ZQHA 7ICEA 4WC1A 4ATBA 4RUAA 5TZVA 3H8SA 2FMSA 4UQGA 3RRHA 1XC9A 1UA1A 1U49A 2JZBA 1NKBA 1NK4A 2BKEA 4QW8A 2MUTA 4DOAA 2XCAA 4S3NA 2HHTA 1ZQSA 1D8LA 1NOMA 4PGYA 2R8IA 2B21A 3HJ1A 3C23A 2P6UA 4B9LA 5KFTA 2M2VA 2PFNA 2ZH4A 4YR3A 1NKEA 4B9UA 3AUOA 5CHGA 1Q78A 2M2UA 4X4UA 8ICQA 3MDCA 3WFSC 4ECXA 2C2EA 9ICCA 2DVIA 3BJYA 1D9DA 4PHAA 4ATBB 4UBBA 3ISCA 3G6XA 1D9FA 1NK0A 3PO5A 3K4GA 2ISOA 2HHPA 8ICEA 4JUZA 3GQCA 4UB3A 4RWPA 5KFUA 1ZQLA 4F8RA 3OJUA 2HHSA 5KFRA 1NKCA 8ICWA 1DK3A 4Z6CA 2Y1JA 2F1IA 3V6JA 4MFCA 7ICQA 7ICRA 4DFJA 1NJXA 4UB1A 4QW9A 3PMNA 5KFVA 4EYHB 5DB8A 2M2WA 3OV7A 4KLFA 4DOBA 4DOCA 3EWAA 5KFCA 5J0RA 3UXPA 9ICSA 4O3QA 1X9MA 2BPGA 3QZ7A 5DLGA 2W8KA 2JEJA 4C8OA 4BWMA 4F4KA 3L9DA 3OVBA 3UPQA 3HX0A 1LB2B 2FLPA 4F5RA 1U9LA 2XC9A 3T3FA 1ZQOA 4I2DA 3OHAA 4RQ2A 2C2DA 2FLNA 2IA6A 4YR0A 3GIJA 3H37A 4KLLA 4K4GA 1S0NA 1SKRA 4R64A 3T5KA 3RJGA 5CWRA 4XRHA 3T5LA 3HIYA 1TFYA 4JV0A 4FHPA 1NK9A 4DSKA 2FMQA 4RPZA 3ISDA 1KSPA 3Q8RB 2R8JA 3ZDAA 1ZQKA 3ZDBA 4M04A 3Q8SB 1KNYA 4RPXA 5IIIA 5KT7A 4NM2A 5KFNA 4HYKA 2C22A 1C7YA 2VA2A 4RNOA 4FH3A 3OVAA 3AU2A 3EW9A 4QZAA 3RJIA 1S9FA 1Z00B 1ZQVA 2BCUA 4R8UA 5HRDA 2H5XA 4ECZA 5D46A 2ZH9A 2LYHA 5KFAA 4I2FA 3NTUA 4UB4A 2JEFA 5J2IA 4EEYA 2PFPA 2ZUBA 4KITB 4NLKA 2W9CB 1ZQDA 5J0UA 4Q8FA 4DSLA 3SYZA 4I2HA 2W9BA 5KG3A 4GXJA 1Y88A 1COOA 4QZDA 3SV4A 2XO7A 4DL7A 4AT7A 5HHIA 4RNNA 3OUYB 3WFPA 3PW5A 1SL2A 4RWQA 4J9SA 4M9JA 1U47A 3JPNA 5DB9A 2XGPA 4EBDA 3PR4A 4B9MA 2ZH5A 4JV2A 3T5JA 2HHUA 2OWOA 2NRWA 8ICFA 4MF2A 3PVXA 1NJWA 1NK7A 4IQVA 2HHVA 3BDPA 5HRFA 4DLEA 7ICSA 2ZJ5A 4MEXA 2KN7A 4WBYA 2VA3A 1SL0A 4TQRA 3SI8A 4YD1A 8ICAA 1K1SA 3RJEA 3HJ4A 3BQTA 1K1QA 4DWIA 4NKUA 4DL6A 1CUKA 1SKWA 4ED2A 5J2BA 4RQ8A 3RBEA 9ICQA 2ZHAA 4J9MA 4Z6EA 4ECRA 3KHRA 9ICAA 3C5GA 4XQ8A 1NJYA 1S76D 4ED7A 5KT6A 3UPSA 9ICNA 4UAZA 4QWBA 5KG4A 4J9RA 3M9OB 2AGOA 4QZ9A 3Q8QB 3Q8PB 4BGDA 4P4MA 5IIJA 1HUZA 1ZETA 4J9LA 3KHGA 1MC8A 5HHHA 4KN4A 3V72A 3QE9Y 2V9WA 1X9SA 2UVRA 9ICJA 4YXJA 4PGXA 3HPOA 3N97B 3RB4A 3RR7A 3LWMA 3QZ8A 4ECWA 2GWSA 8ICVA 3TFSA 5KFJA 2DR8A 1TFRA 3OJSA 4TUPA 1U45A 4FBUA 2AGPA 4O3PA 4JWNA 5HMLA 4DLGA 1QLNA 1ZQWA 1ZQYA 4YN4A 9ICLA 3TI0A 4F5OA 4KLTA 1RZTA 5J0XA 1CEZA 1NO5A 1R8CA 4QZHA 1YLQA 4MEYA 5L1JA 3B0YA 3H8JA 4YXMA 4IRDA 3FDSA 4KLDA 2ZTEA 2PI4A 3ISBA 3KTQA 9ICFA 4ZH4A 1JMSA 1A76A 4FHXA 5KG5A 3V7JA 3ZDDA 5KT4A 1QSYA 1BPBA 1QSSA 3OSNA 4EBKA 4X4PA 3H38A 4X4OA 4QWDA 4NLGA 1XWLA 5CB1A 4Q44A 4PGQA 4DL2A 4KLIA 4O5KA 8ICCA 7ICOA 5HC9A 4KTQA 4RNMA 4ECUA 4ECQA 4FHWA 5J0QA 4I2JA 9ICPA 4DS4A 4UB5A 3TAPA 3RB3A 1S0MA 3C21A 4DQQA 3M8RA 4B9TA 4YVZA 8ICHA 4WC2A 3PX0A 4R66A 4I2EA 3MDAA 1NJZA 4ED3A 4TQSA 3RJHA 5J0WA 2O1PA 3C2MA 4X4SA 3GFKB 4BWJA 3JPSA 1PX5A 1MIYA 2DFLA 4UB2A 1BVSA 2I9GA 5KG2A 1LV5A 4J9PA 2BQRA 1L3SA 5DKWA 3M9MB 1BNPA 3TANA 4F5QA 1QTMA 3AQKA 4F50A 4IQTA 3KHLA 1NK6A 7ICMA 4RQ1A 4LZGA 4RWNA 1F5AA 1VFGA 5L1IA 3V6HA 4M5DA 3PV8A 3RB0A 4C8KA 4B9VA 4C8LA 4LVSA 8ICGA 3ZDEA 3MR2A 9ICXA 2AGQA 4EZ9A 5DQGA 1BPYA 4P4OA 2PFQA 4TUQA 2ZH1A 4O5CA 2O5AA 3FYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAQ A;  5KFL A;  4M9G A;  2Q0Z X;  4FHY A;  3NGD A;  3RH5 A;  3LK9 A;  1HJP A;  3TAR A;  1XS9 D;  2IHN A;  3V7L A;  5JUM A;  3MFH A;  3OVS A;  4KLM A;  1Z00 A;  1JAJ A;  8ICK A;  2ZUC A;  4Q43 A;  3OSP A;  4I2G A;  1TK0 A;  4DSI A;  5J2C A;  5BOL A;  3GDX A;  5J2K A;  1HUO A;  4DL3 A;  3RR8 A;  2W9C A;  4M2Y A;  4QWE A;  9ICG A;  1BNO A;  4QZB A;  4Q45 A;  3PML A;  1L3U A;  1MIV A;  4F92 B;  4XUS A;  4GLX A;  4DFK A;  1XSP A;  3H39 A;  2R8K A;  4UBC A;  2HHX A;  1MIW A;  4PH5 A;  3OUY A;  1Z3E B;  1TKD A;  3RB6 A;  4F91 B;  1ZYQ A;  3ZDC A;  4DFM A;  5J0O A;  4WC6 A;  4UAY A;  1L3T A;  1FA0 A;  3IM1 A;  4ECS A;  5F9L A;  5L1K A;  5KG7 A;  3H4B A;  2ISP A;  5DBC A;  3C5F A;  5IIO A;  1X9W A;  1RYR A;  1NK5 A;  1RXW A;  1BPX A;  5HMM A;  3C1Z A;  4WC0 A;  1KDH A;  5KFG A;  5J2J A;  1KTQ A;  4M47 A;  1JIH A;  4EP7 A;  4NM1 A;  4O0I A;  1ZQJ A;  1IM4 A;  8ICS A;  3JPO A;  4X4Q A;  4UAW A;  4RZR A;  1UET A;  3EYZ A;  3PY8 A;  4YMN A;  1S77 D;  2ID1 A;  1ZJM A;  4DSF A;  4IG8 A;  2AQ4 A;  1TV9 A;  4KLO A;  4IRK A;  4YCX A;  5D49 A;  9ICH A;  4Z6F A;  4LZD A;  3LWL A;  8ICJ A;  3NYB A;  3Q8L A;  1ZQE A;  5F2V O;  4F4W A;  2BGW A;  5BOM A;  2NRZ A;  3PX6 A;  3AQM A;  4X0A A;  3MR3 A;  5DDM A;  2A1J B;  1SL1 A;  2BPF A;  3SZ2 A;  4YG2 A;  1V4A A;  5DB6 A;  4FBT A;  3RH4 A;  5HRG A;  5DB7 A;  1TFW A;  4B9N A;  8ICY A;  4QZG A;  4DS5 A;  4ED8 A;  2AQ0 A;  3Q8M A;  3H8W A;  4C8M A;  3BQ1 A;  4I2I A;  5CA7 A;  2DR9 A;  4RU9 A;  2DPJ A;  1BPZ A;  4BXO B;  5L1L A;  4DSE A;  4QWC A;  4M0A A;  4O3R A;  2KFN A;  2W9A A;  1ZQA A;  1QSL A;  1UEU A;  4R63 A;  3M9N B;  4J9O A;  4B9S A;  4RQ7 A;  4CCH A;  3C1Y A;  4RQ4 A;  1XSN A;  4Q8E A;  8ICL A;  7ICH A;  4M9N A;  5HRK A;  3GV5 B;  4JWM A;  4KLE A;  3HT3 A;  4GC7 A;  2ZH8 A;  1S0O A;  5KT2 A;  4M9L A;  4F2S A;  5J0Y A;  4J9K A;  5KFI A;  4QWA A;  1KLN A;  5L9X A;  1JXL A;  4ED1 A;  4YFK A;  3H7I A;  1XO1 A;  5DG7 A;  2J6U A;  5BPC A;  4RQ5 A;  5HRB A;  4K4I A;  5IIM A;  7ICN A;  1R8A A;  3ZD9 A;  2VA8 A;  4AT9 B;  4RWO A;  4WC5 A;  1ZQC A;  4F93 B;  3M8S A;  2BQU A;  1MQ3 A;  1ZQP A;  7ICJ A;  1KFS A;  4DQI A;  4G3I A;  4QZC A;  4X4V A;  5HRL A;  2DRB A;  4IQW A;  1S0V A;  9ICV A;  4YMO A;  4MFA A;  4WCW A;  2PXI A;  4ECV A;  7ICG A;  3OGU A;  4ED6 A;  1DGS A;  1ZQG A;  2XY7 A;  2DR5 A;  2RDJ A;  2BCQ A;  4RQ0 A;  3RJF A;  1KEJ A;  7ICV A;  3AQN A;  4DQR A;  3MAB A;  4X4T A;  2F1H A;  2NRV A;  4F5N A;  4WC3 A;  3GIK A;  4RUC A;  7ICI A;  4K4H A;  5C5J A;  4KMU A;  3ZD8 A;  4AT8 A;  3BQ2 A;  4I28 A;  2BPC A;  5KFB A;  3OHB A;  4O3N A;  4DSJ A;  1TAU A;  7ICL A;  1B22 A;  1OU5 A;  2BE3 A;  5DED A;  3AU6 A;  2DR7 A;  5KG1 A;  4P2H A;  2ZH7 A;  5J2F A;  4IQU A;  1UA0 A;  5J0T A;  5DBA A;  9ICM A;  2F1J A;  4RPY A;  3G6V A;  3H3A A;  3H4D A;  1RXV A;  2XCP A;  4PPX A;  4KN7 A;  2BCR A;  4ED0 A;  2HVH A;  2PBE A;  5DEC A;  2ZH6 A;  4F4Y A;  5J29 A;  3EZ5 A;  1ZQF A;  1MSW D;  3MGH A;  5CP2 A;  1BGX T;  5EOZ A;  3LDA A;  3GV8 B;  2Y1I A;  3WFO A;  4PHE A;  4NLN A;  2C2R A;  3RRG A;  1IXR A;  2KFZ A;  4DO9 A;  1TVA A;  1U4B A;  4F2R A;  1TK5 A;  4AT8 B;  4YQW A;  4P4P A;  4E7X A;  1KRP A;  4F4Z A;  2ASL A;  4WC4 A;  2FPL A;  5KFE A;  4EBC A;  4O5E A;  2HHQ A;  1WCN A;  2ASJ A;  3HWT A;  4ELU A;  2ZH2 A;  3H40 A;  2V4Q A;  5IIK A;  5KFD A;  1DOQ A;  2ZTD A;  3IHQ B;  3PW0 A;  2ATL A;  4GC6 A;  8ICO A;  5KFK A;  4JK1 A;  4FO6 A;  4EYI B;  3PO4 A;  4E0D A;  4NY8 A;  4KLJ A;  2KZM A;  2ALZ A;  5DLF A;  4ELV A;  2KZZ A;  4YD2 A;  3N4M B;  5CR0 A;  8ICB A;  5DG8 A;  2XY5 A;  3TQ1 A;  4IR9 A;  1KFT A;  1PZN A;  3C18 A;  2ZHB A;  2Q66 A;  3WFR E;  3RH6 A;  8ICZ A;  2P66 A;  1R89 A;  3JPQ A;  4ECY A;  3T5H A;  5IIL A;  5KG0 A;  2XGQ A;  2J6T A;  4WBZ A;  4ECT A;  4KLH A;  2VAN A;  5KFM A;  9ICU A;  2PI5 A;  5KFS A;  4C8N A;  4F4X A;  2NRK A;  5HRH A;  1T4G A;  1JN3 A;  1X2I A;  5J0S A;  2V4R A;  2JZB B;  1ZQT A;  2BCV A;  4X4N A;  4O9M A;  2AU0 A;  4FS1 A;  2PFO A;  5J0P A;  2MUT B;  7ICF A;  9ICT A;  4NKT A;  4NXZ A;  4DQS A;  3MGI A;  8ICT A;  4XA5 A;  8ICX A;  1ZJN A;  5DBB A;  9ICB A;  3LQC B;  1JX4 A;  1RPL A;  1U48 A;  2UVU A;  3PNC A;  2FPM A;  4I2C A;  2IHM A;  4GXK A;  2XY6 A;  1L3V A;  4E8F A;  2ZUD A;  2BCS A;  4JV1 A;  3GIL A;  3RJK A;  4LT6 A;  4M6W A;  1KFD A;  2HVI A;  5D4B A;  2DPI A;  4KLU A;  5EWE A;  5DGB A;  2FPK A;  2HHW A;  3HW8 A;  5IIN A;  3B0X A;  3C2L A;  2A1J A;  3AQL A;  4X0B A;  1SKS A;  4I2A A;  2R8G A;  3RJJ A;  5KFO A;  4EBE A;  2UVV A;  2MAX A;  2I1Q A;  4GXI A;  2J6S A;  4YR2 A;  5DGA A;  9ICR A;  2BDP A;  4BXO A;  7ICT A;  2RFF A;  4QZI A;  4MF8 A;  4YP3 A;  1ZQU A;  3ORY A;  3QEA Z;  3UQ2 A;  4DF8 A;  4RT2 A;  3JYY A;  1VJ7 A;  3MR6 A;  3UQ0 A;  4M6W B;  1TAQ A;  1T8E A;  1ZQM A;  1A77 A;  3TFR A;  2KP7 A;  3BQ0 A;  4BDP A;  3JZ0 A;  7ICP A;  8ICR A;  2M2T A;  4DQP A;  3G6Y A;  3JPR A;  5KFP A;  5DQH A;  5KTQ A;  5KT3 A;  3QEB Z;  4PHP A;  1Q79 A;  3GII A;  4AT9 A;  5KFH A;  4X4R A;  3ETL A;  3RAX A;  2NRX A;  3UXN A;  3V7K A;  4WC7 A;  1ARO P;  3PW4 A;  2ZJA A;  3K75 D;  1ZQQ A;  4RT3 A;  1NZP A;  2KTQ A;  5KFX A;  4I2B A;  3SV3 A;  9ICE A;  2C28 A;  1WOT A;  4R8U B;  5J2H A;  3C2K A;  4J9N A;  1L5U A;  3WFQ E;  5F9N A;  4FS2 A;  2JEG A;  5J2E A;  4IR1 A;  4EBJ A;  2FMP A;  5HP4 A;  4I27 A;  1UT8 A;  4RQ3 A;  2FLL A;  3GV7 B;  7ICU A;  3E2E A;  2BHN A;  5EWF A;  1S97 A;  5J2D A;  3JPP A;  1ZQI A;  4QZ8 A;  1NK8 A;  4IRC A;  3PW2 A;  4TUS A;  2W9B B;  1ZQN A;  3RAQ A;  5J2G A;  5KFQ A;  2R8H A;  2JEI A;  2BQ3 A;  3C66 A;  4AT7 B;  4YMM A;  9ICW A;  4F3O A;  1R8B A;  1V9P A;  2NRT A;  2ZTC A;  4QZF A;  1N48 A;  1BPE A;  4M9H A;  3PW7 A;  5CJ7 A;  5KFY A;  2BR0 A;  4XQ7 A;  4X5V A;  1UT5 A;  4E80 A;  5KFF A;  2W8L A;  1UEV A;  3MFI A;  8ICI A;  1SZP A;  1ZQB A;  4DL4 A;  4KLS A;  3GIM A;  8ICU A;  1JQR A;  2ZH3 A;  7ICK A;  5KT5 A;  1EXN A;  2KZ3 A;  3PR5 B;  2AJQ A;  3MBY A;  3HP6 A;  3RTV A;  4RQ6 A;  4FH5 A;  2ZJ8 A;  2W9M A;  3EPG A;  1D8Y A;  4DFP A;  1S10 A;  3PX4 A;  4O3S A;  9ICI A;  4O3O A;  3V6K A;  2ASD A;  2UVW A;  4NLZ A;  2P6R A;  2WTF A;  4FHV A;  1B43 A;  5DQI A;  3KHH A;  3RBD A;  5DDY A;  5KFW A;  5KFZ A;  4DF4 A;  1T7P A;  8ICP A;  4ELT A;  4KLG A;  1ZQZ A;  5DG9 A;  4DL5 A;  1XSL A;  1T3N A;  4PHD A;  8ICM A;  3UXO A;  1DK2 A;  1TK8 A;  1WCL A;  2RDI A;  5HNK A;  3JPT A;  2HW3 A;  1XU4 A;  4KLQ A;  1RYS A;  4EZ6 A;  1H38 A;  4R65 A;  5HRE A;  4UD5 A;  3EPI A;  5HR9 A;  1JXE A;  1ZQR A;  4QZE A;  8ICN A;  5J2A A;  1BPD A;  4F5P A;  9ICO A;  4I29 A;  5HRI A;  4TUR A;  2IBK A;  9ICK A;  4UD4 A;  2IMW P;  2DRA A;  1ZQX A;  4MFF A;  5EWG A;  3Q8K A;  2M9N A;  5KG6 A;  4Z6D A;  4DEZ A;  3MR5 A;  3THV A;  1N56 A;  1MQ2 A;  4J9Q A;  1ZQH A;  7ICE A;  4WC1 A;  4ATB A;  4RUA A;  5TZV A;  3H8S A;  2FMS A;  4UQG A;  3RRH A;  1XC9 A;  1UA1 A;  1U49 A;  2JZB A;  1NKB A;  1NK4 A;  2BKE A;  4QW8 A;  2MUT A;  4DOA A;  2XCA A;  4S3N A;  2HHT A;  1ZQS A;  1D8L A;  1NOM A;  4PGY A;  2R8I A;  2B21 A;  3HJ1 A;  3C23 A;  2P6U A;  4B9L A;  5KFT A;  2M2V A;  2PFN A;  2ZH4 A;  4YR3 A;  1NKE A;  4B9U A;  3AUO A;  5CHG A;  1Q78 A;  2M2U A;  4X4U A;  8ICQ A;  3MDC A;  3WFS C;  4ECX A;  2C2E A;  9ICC A;  2DVI A;  3BJY A;  1D9D A;  4PHA A;  4ATB B;  4UBB A;  3ISC A;  3G6X A;  1D9F A;  1NK0 A;  3PO5 A;  3K4G A;  2ISO A;  2HHP A;  8ICE A;  4JUZ A;  3GQC A;  4UB3 A;  4RWP A;  5KFU A;  1ZQL A;  4F8R A;  3OJU A;  2HHS A;  5KFR A;  1NKC A;  8ICW A;  1DK3 A;  4Z6C A;  2Y1J A;  2F1I A;  3V6J A;  4MFC A;  7ICQ A;  7ICR A;  4DFJ A;  1NJX A;  4UB1 A;  4QW9 A;  3PMN A;  5KFV A;  4EYH B;  5DB8 A;  2M2W A;  3OV7 A;  4KLF A;  4DOB A;  4DOC A;  3EWA A;  5KFC A;  5J0R A;  3UXP A;  9ICS A;  4O3Q A;  1X9M A;  2BPG A;  3QZ7 A;  5DLG A;  2W8K A;  2JEJ A;  4C8O A;  4BWM A;  4F4K A;  3L9D A;  3OVB A;  3UPQ A;  3HX0 A;  1LB2 B;  2FLP A;  4F5R A;  1U9L A;  2XC9 A;  3T3F A;  1ZQO A;  4I2D A;  3OHA A;  4RQ2 A;  2C2D A;  2FLN A;  2IA6 A;  4YR0 A;  3GIJ A;  3H37 A;  4KLL A;  4K4G A;  1S0N A;  1SKR A;  4R64 A;  3T5K A;  3RJG A;  5CWR A;  4XRH A;  3T5L A;  3HIY A;  1TFY A;  4JV0 A;  4FHP A;  1NK9 A;  4DSK A;  2FMQ A;  4RPZ A;  3ISD A;  1KSP A;  3Q8R B;  2R8J A;  3ZDA A;  1ZQK A;  3ZDB A;  4M04 A;  3Q8S B;  1KNY A;  4RPX A;  5III A;  5KT7 A;  4NM2 A;  5KFN A;  4HYK A;  2C22 A;  1C7Y A;  2VA2 A;  4RNO A;  4FH3 A;  3OVA A;  3AU2 A;  3EW9 A;  4QZA A;  3RJI A;  1S9F A;  1Z00 B;  1ZQV A;  2BCU A;  4R8U A;  5HRD A;  2H5X A;  4ECZ A;  5D46 A;  2ZH9 A;  2LYH A;  5KFA A;  4I2F A;  3NTU A;  4UB4 A;  2JEF A;  5J2I A;  4EEY A;  2PFP A;  2ZUB A;  4KIT B;  4NLK A;  2W9C B;  1ZQD A;  5J0U A;  4Q8F A;  4DSL A;  3SYZ A;  4I2H A;  2W9B A;  5KG3 A;  4GXJ A;  1Y88 A;  1COO A;  4QZD A;  3SV4 A;  2XO7 A;  4DL7 A;  4AT7 A;  5HHI A;  4RNN A;  3OUY B;  3WFP A;  3PW5 A;  1SL2 A;  4RWQ A;  4J9S A;  4M9J A;  1U47 A;  3JPN A;  5DB9 A;  2XGP A;  4EBD A;  3PR4 A;  4B9M A;  2ZH5 A;  4JV2 A;  3T5J A;  2HHU A;  2OWO A;  2NRW A;  8ICF A;  4MF2 A;  3PVX A;  1NJW A;  1NK7 A;  4IQV A;  2HHV A;  3BDP A;  5HRF A;  4DLE A;  7ICS A;  2ZJ5 A;  4MEX A;  2KN7 A;  4WBY A;  2VA3 A;  1SL0 A;  4TQR A;  3SI8 A;  4YD1 A;  8ICA A;  1K1S A;  3RJE A;  3HJ4 A;  3BQT A;  1K1Q A;  4DWI A;  4NKU A;  4DL6 A;  1CUK A;  1SKW A;  4ED2 A;  5J2B A;  4RQ8 A;  3RBE A;  9ICQ A;  2ZHA A;  4J9M A;  4Z6E A;  4ECR A;  3KHR A;  9ICA A;  3C5G A;  4XQ8 A;  1NJY A;  1S76 D;  4ED7 A;  5KT6 A;  3UPS A;  9ICN A;  4UAZ A;  4QWB A;  5KG4 A;  4J9R A;  3M9O B;  2AGO A;  4QZ9 A;  3Q8Q B;  3Q8P B;  4BGD A;  4P4M A;  5IIJ A;  1HUZ A;  1ZET A;  4J9L A;  3KHG A;  1MC8 A;  5HHH A;  4KN4 A;  3V72 A;  3QE9 Y;  2V9W A;  1X9S A;  2UVR A;  9ICJ A;  4YXJ A;  4PGX A;  3HPO A;  3N97 B;  3RB4 A;  3RR7 A;  3LWM A;  3QZ8 A;  4ECW A;  2GWS A;  8ICV A;  3TFS A;  5KFJ A;  2DR8 A;  1TFR A;  3OJS A;  4TUP A;  1U45 A;  4FBU A;  2AGP A;  4O3P A;  4JWN A;  5HML A;  4DLG A;  1QLN A;  1ZQW A;  1ZQY A;  4YN4 A;  9ICL A;  3TI0 A;  4F5O A;  4KLT A;  1RZT A;  5J0X A;  1CEZ A;  1NO5 A;  1R8C A;  4QZH A;  1YLQ A;  4MEY A;  5L1J A;  3B0Y A;  3H8J A;  4YXM A;  4IRD A;  3FDS A;  4KLD A;  2ZTE A;  2PI4 A;  3ISB A;  3KTQ A;  9ICF A;  4ZH4 A;  1JMS A;  1A76 A;  4FHX A;  5KG5 A;  3V7J A;  3ZDD A;  5KT4 A;  1QSY A;  1BPB A;  1QSS A;  3OSN A;  4EBK A;  4X4P A;  3H38 A;  4X4O A;  4QWD A;  4NLG A;  1XWL A;  5CB1 A;  4Q44 A;  4PGQ A;  4DL2 A;  4KLI A;  4O5K A;  8ICC A;  7ICO A;  5HC9 A;  4KTQ A;  4RNM A;  4ECU A;  4ECQ A;  4FHW A;  5J0Q A;  4I2J A;  9ICP A;  4DS4 A;  4UB5 A;  3TAP A;  3RB3 A;  1S0M A;  3C21 A;  4DQQ A;  3M8R A;  4B9T A;  4YVZ A;  8ICH A;  4WC2 A;  3PX0 A;  4R66 A;  4I2E A;  3MDA A;  1NJZ A;  4ED3 A;  4TQS A;  3RJH A;  5J0W A;  2O1P A;  3C2M A;  4X4S A;  3GFK B;  4BWJ A;  3JPS A;  1PX5 A;  1MIY A;  2DFL A;  4UB2 A;  1BVS A;  2I9G A;  5KG2 A;  1LV5 A;  4J9P A;  2BQR A;  1L3S A;  5DKW A;  3M9M B;  1BNP A;  3TAN A;  4F5Q A;  1QTM A;  3AQK A;  4F50 A;  4IQT A;  3KHL A;  1NK6 A;  7ICM A;  4RQ1 A;  4LZG A;  4RWN A;  1F5A A;  1VFG A;  5L1I A;  3V6H A;  4M5D A;  3PV8 A;  3RB0 A;  4C8K A;  4B9V A;  4C8L A;  4LVS A;  8ICG A;  3ZDE A;  3MR2 A;  9ICX A;  2AGQ A;  4EZ9 A;  5DQG A;  1BPY A;  4P4O A;  2PFQ A;  4TUQ A;  2ZH1 A;  4O5C A;  2O5A A;  3FYH A; 
#chains in the Genus database with same CATH topology
 2G0A A;  5KFL A;  4M9G A;  2Q0Z X;  3RH5 A;  3TAR A;  4Y2J A;  3V7L A;  4KLM A;  2NO5 A;  8ICK A;  4Q43 A;  2DKX A;  2KOB A;  5BOL A;  1HUO A;  4CF4 A;  9ICG A;  2W9C A;  4M2Y A;  2ZIV B;  4F92 B;  4DFK A;  2EDU A;  2R8K A;  1MIW A;  4WJ3 B;  4QJF B;  1TKD A;  3RB6 A;  1ZYQ A;  5ALE A;  3RFA A;  4UAY A;  1C20 A;  5F9L A;  2JV3 A;  3H4B A;  5DBC A;  3C5F A;  2XI9 A;  1FEZ A;  1IV8 A;  1WG8 A;  5HMM A;  4WC0 A;  4M47 A;  2BBJ A;  1JIH A;  2W11 A;  2EQY A;  1ZQJ A;  1IM4 A;  4C80 A;  4YMN A;  2ID1 A;  3MC1 A;  4XJE A;  4JB3 A;  4IRK A;  1DRG A;  1L7O A;  5AKJ A;  1ZQE A;  2BGW A;  5BOM A;  3PX6 A;  2NO4 A;  1SL1 A;  2KG5 A;  3SZ2 A;  5L1M A;  5DB7 A;  5T14 A;  4QZG A;  4U6P A;  2BDU A;  4C8M A;  2HOI A;  4I2I A;  2DPJ A;  4QWC A;  4M0A A;  1XSN A;  3GV5 B;  4KLE A;  2ZH8 A;  5KT2 A;  4J9K A;  4QWA A;  3H7I A;  5IIM A;  7ICN A;  4AT9 B;  4RWO A;  2VA8 A;  4WC5 A;  1ZQC A;  7ICJ A;  4WH5 A;  1MQ3 A;  1ZQP A;  3L4P A;  4QZC A;  4X4V A;  4WCW A;  2EWR A;  2PXI A;  7ICG A;  1Q3V A;  2XY7 A;  4RQ0 A;  2FDR A;  2VIX A;  7ICV A;  2LM1 A;  3AQN A;  4DQR A;  1SZH A;  2JR5 A;  2F1H A;  5ALR A;  4NJ8 A;  3K7D A;  2YB1 A;  2WB1 F;  4K8V A;  2DL0 A;  2G5H B;  2ZH7 A;  5DBA A;  2F1J A;  1SGG A;  1PK1 B;  4KN7 A;  9ICP A;  3HJ4 A;  5CHE A;  2Y1I A;  4PHE A;  3RRG A;  4DO9 A;  1WYG A;  4F2R A;  1ZD2 P;  2F8K A;  5D62 A;  4WC4 A;  4O5E A;  1WCN A;  5ALY A;  2V4Q A;  3ZI4 A;  2ZTD A;  3AEV A;  8ICO A;  1KBU A;  4FO6 A;  4NY8 A;  2ZIV A;  2YN4 A;  4ELV A;  1RM6 C;  2CPR A;  2KZZ A;  2DQN B;  4GIB A;  1R89 A;  2J6T A;  4ECT A;  4US9 A;  1N60 A;  3KZX A;  4F4X A;  5HRH A;  1T4G A;  1X2I A;  4FZM A;  5J0P A;  9ICT A;  2OM6 A;  3MGI A;  1RPL A;  3NVZ A;  4J03 A;  3PNC A;  2FPM A;  2UVU A;  1QQ6 A;  2IHM A;  5FP0 A;  3R9K A;  1L3V A;  2W7P A;  4E8F A;  2BCS A;  5D4B A;  4AYB F;  4KLU A;  5EWE A;  5DGB A;  5JTG A;  3N28 A;  3HW8 A;  3C2L A;  2MRL A;  2I1Q A;  4LJX A;  4GXI A;  4ZOH C;  4MF8 A;  4YP3 A;  1ZQU A;  3ORY A;  3JYY A;  1VJ7 A;  3MR6 A;  4M6W B;  3F2B A;  1A77 A;  1X40 A;  3BQ0 A;  1KN5 A;  4BDP A;  4DQP A;  4K99 A;  4PHP A;  4AT9 A;  4X4R A;  3V7K A;  3NRZ A;  1ZQQ A;  4RT3 A;  9ICE A;  1N2X A;  4J9N A;  4FS2 A;  2WB1 C;  3E2E A;  5EWF A;  4UAU A;  1CRX A;  4QZ8 A;  7ICU A;  3PW2 A;  3RAQ A;  5J2G A;  5KFQ A;  2E3T A;  2JEI A;  2BQ3 A;  9ICW A;  2KIW A;  1R8B A;  3K1R B;  4UAS A;  1N48 A;  4M9H A;  1PK1 A;  4XQ7 A;  3CW2 C;  8ICI A;  2KIV A;  1ZQB A;  8ICU A;  4OAF A;  2MSN A;  3RTV A;  3WK4 A;  2W9M A;  2EAN A;  1JRP A;  3WK6 A;  1D8Y A;  3PX4 A;  9ICI A;  3OV7 A;  3RBD A;  5DDY A;  5KFW A;  4DF4 A;  4ELT A;  2HN2 A;  1X66 A;  3I76 A;  2K8C B;  4C7Y A;  3D2Q A;  1TK8 A;  2RDI A;  3BS7 A;  4KLQ A;  1RYS A;  4QZE A;  2QB1 A;  1BPD A;  4I29 A;  5HRI A;  3QUC A;  2DRA A;  1Q8K A;  3Q8K A;  1SWW A;  4J9Q A;  5JTI A;  4ATB A;  4C4R A;  4RUA A;  2F3N A;  2K4I A;  3H8S A;  1JI7 A;  2BKE A;  1L8O A;  2JGA A;  3VCB A;  4PGY A;  4QNL A;  3C23 A;  4B9L A;  5CEH A;  2OH2 A;  2W43 A;  4B9U A;  5ALG A;  2M2U A;  3SAG A;  3PSI A;  8ICQ A;  3WFS C;  5CFT A;  3BJY A;  5ALQ A;  5AKG A;  4UBB A;  3G6X A;  1D9F A;  8ICE A;  3GQC A;  3TAD C;  1ZQL A;  3OJU A;  4F8R A;  4Z6C A;  2BBH A;  4KX3 A;  4MFC A;  7ICQ A;  2B51 A;  4UB1 A;  2A19 A;  4WQK A;  4KLF A;  9ICS A;  5KFC A;  5J0R A;  2G06 A;  1X9M A;  3QZ7 A;  5DLG A;  4F5R A;  3C29 A;  1ZQO A;  4I2D A;  3OHA A;  2VJ5 A;  3GIJ A;  3HIL A;  2LI6 A;  3T5K A;  3HIY A;  1TFY A;  2E5S A;  3ZDB A;  4M04 A;  3Q8R B;  4HYK A;  2YMM A;  3AU2 A;  2OXO A;  2BCU A;  3SMV A;  2H5X A;  4ECZ A;  1TAM A;  2ZUB A;  4KIT B;  3E0F A;  2LYB A;  5J0U A;  1L8L A;  4QZD A;  3SV4 A;  5CFU A;  3PW5 A;  4RWQ A;  3JPN A;  2EAP A;  5AI8 A;  3T5J A;  2HHU A;  1MA7 A;  4DLE A;  7ICS A;  2ZJ5 A;  3HKZ F;  4WBY A;  2DF4 B;  3ETR A;  3RJE A;  3RBE A;  3LVV A;  4ECR A;  2QAR B;  3KHR A;  4OAI Z;  5KT6 A;  9ICN A;  2NV3 A;  5AM2 A;  5KG4 A;  1PK3 A;  3AQF A;  4BGD A;  4P4M A;  1ZET A;  3KHG A;  1MC8 A;  5HHH A;  3V72 A;  2V9W A;  1X9S A;  4YXJ A;  3HPO A;  3RR7 A;  5KFJ A;  5AI4 A;  4TUP A;  4K96 A;  2Q4T A;  1ZXI A;  2HCF A;  1ZQW A;  3NUQ A;  1NO5 A;  1JUD A;  3UMB A;  4Y2V A;  2VJ4 A;  3KTQ A;  9ICF A;  5HR6 A;  1A76 A;  4FHX A;  1BPB A;  3ONN A;  2ZXI A;  1XWL A;  4Q44 A;  4PGQ A;  4O5K A;  8ICC A;  4DCC A;  2FJ6 A;  1VDV A;  3UM9 A;  4RNM A;  1O08 A;  5E79 U;  5ALZ A;  3C21 A;  3M8R A;  4YVZ A;  3MDA A;  3RJH A;  5J0W A;  4X4S A;  3GFK B;  1MIY A;  2DFL A;  5CRX A;  5DKW A;  4Y2U A;  7ICM A;  4LZG A;  1RYU A;  5L1I A;  3RB0 A;  3ZDE A;  3MR2 A;  1BPY A;  2ZH1 A;  2O5A A;  3TAQ A;  5CFS A;  3NGD A;  1HJP A;  3QX7 A;  5JRT A;  2Y9U A;  3MFH A;  1X6I A;  4OD0 A;  1JAJ A;  1D8B A;  4I2G A;  3ALR A;  4EGW A;  2E8M A;  2WHE A;  4DSI A;  1Z4O A;  1BNO A;  4DL3 A;  3RR8 A;  2RLT A;  4QZB A;  4Q45 A;  3PML A;  1L3U A;  4XUS A;  4GLX A;  1XSP A;  3UMC A;  4K9B A;  1Z3E B;  3BZK A;  4GFJ A;  4DFM A;  3HKZ C;  5ALK A;  1NI3 A;  3IM1 A;  5KG7 A;  5IIO A;  2HSZ A;  1RYR A;  1FFU A;  3WKD A;  4F71 A;  1V38 A;  4NM1 A;  1HIW A;  3PST A;  3TAC B;  3JPO A;  4X4Q A;  3M6K A;  4C0Z A;  5ALV A;  1ZJM A;  4IG8 A;  2QAR A;  2HBM A;  4OJ5 A;  3NYB A;  2OEH A;  2KEY A;  2LPE A;  3AL0 B;  3AQM A;  2NRZ A;  3H8M A;  2BPF A;  4X0A A;  1V4A A;  3UMG A;  1L7M A;  5DB6 A;  2HI0 A;  3L3F X;  4DS5 A;  1PVQ A;  4NXV A;  3E58 A;  3KKA A;  1BPZ A;  5L1L A;  2KFN A;  1QSL A;  4R63 A;  4OJL A;  3C1Y A;  8ICL A;  5HRK A;  4M9N A;  5ALM A;  1XO1 A;  5BPC A;  4RQ5 A;  5AKE A;  1R8A A;  3ZD9 A;  4US8 A;  4EEB A;  4IS7 A;  5HRL A;  3SD7 A;  4IQW A;  1S0V A;  4MFA A;  1YT3 A;  4NXU A;  3KBB A;  4UB8 U;  5GTH U;  1VLB A;  2ZIX B;  1ZQG A;  1JAL A;  3QU9 A;  2DR5 A;  3RJF A;  4X4T A;  4NV0 A;  1URJ A;  2NRV A;  4F5N A;  4WC3 A;  3GIK A;  4RUC A;  3OWG A;  4KMU A;  3ZD8 A;  4AT8 A;  4I28 A;  1B22 A;  1OU5 A;  4O3N A;  2ZIU B;  4P2H A;  5J2F A;  5ALP A;  1OUQ A;  3H3A A;  3VC8 A;  3H4D A;  1RXV A;  5ALD A;  1CI4 A;  2HVH A;  2PBE A;  2ZH6 A;  4F4Y A;  5J29 A;  3MGH A;  1IXR A;  4YQW A;  1IIP A;  4E7X A;  5ALT A;  3IP4 B;  2K8A A;  2FPL A;  2HHQ A;  4UAR A;  3HWT A;  2ZH2 A;  4BUG A;  4JK1 A;  2KZM A;  4EYI B;  2IHO A;  2ALZ A;  3BZC A;  5CR0 A;  2XY5 A;  4IR9 A;  3LYS A;  1PZN A;  2D8C A;  3RH6 A;  2P66 A;  4LEZ A;  3JPQ A;  3T5H A;  4FFD A;  2VAN A;  9ICU A;  1WUD A;  4Y2R A;  3WKE A;  2HBK A;  4I0U A;  3GU3 A;  2V4R A;  1ZQT A;  5AI6 A;  2PFO A;  2MUT B;  7ICF A;  5AHX A;  4DQS A;  4LEY A;  1UCV A;  8ICX A;  9ICB A;  1JX4 A;  1U48 A;  4I2C A;  2ZG6 A;  2XY6 A;  2KIC A;  1V97 A;  4JV1 A;  1SXD A;  4RQM A;  4RQN A;  5AK6 A;  4NL9 C;  2A3V A;  1SKS A;  5KFO A;  4OJO A;  4EBE A;  4NXT A;  3K1Z A;  2DUY A;  3F5E A;  4YR2 A;  9ICR A;  1GO3 F;  7ICT A;  1QCK A;  4C4T A;  4KMO B;  2E8O A;  3UQ0 A;  2BZF A;  2KP7 A;  3TFR A;  2IOF A;  1SV0 C;  3IG5 A;  5KT3 A;  3QEB Z;  1MN8 A;  5ALU A;  5KFH A;  3RAX A;  2KV2 A;  4WC7 A;  2IOF K;  1ARO P;  3PW4 A;  2WAQ F;  1NZP A;  2MU2 A;  2ZIX A;  4R8U B;  3WFQ E;  5F9N A;  2FMP A;  5HP4 A;  1UT8 A;  2FLL A;  2RP5 A;  1S97 A;  3IDW A;  1NK8 A;  1ZQN A;  2K8B B;  3C66 A;  4AT7 B;  2ZIU A;  2DKZ A;  1TE2 A;  2RRD A;  2ZTC A;  4QZF A;  3F5A A;  5CJ7 A;  3PW7 A;  4E80 A;  2W8L A;  3ER9 B;  1SZP A;  2KE7 A;  4WOY A;  4DL4 A;  4OAG A;  3GIM A;  1JQR A;  2HOF A;  1EXN A;  2KJ5 A;  2AJQ A;  3HP6 A;  4FH5 A;  2ZJ8 A;  3M1Y A;  3V6K A;  4FHV A;  1B43 A;  4EBJ A;  1P7D A;  8ICP A;  3WKA A;  1L7P A;  3IV6 A;  5DG9 A;  3B9J A;  8ICM A;  3UXO A;  1WCL A;  1H38 A;  5HR9 A;  1ZQR A;  9ICO A;  4USA A;  5ALS A;  1LKY B;  2IBK A;  5EWG A;  1N56 A;  5KG6 A;  7ICE A;  1MQ2 A;  3THV A;  1A0P A;  5TZV A;  2FMS A;  1U49 A;  1XC9 A;  1UA1 A;  1NKB A;  1ZQ1 C;  2KKP A;  4QW8 A;  2MUT A;  3NVW A;  4S3N A;  1UQV A;  2R8I A;  2B21 A;  3HJ1 A;  1FFV A;  2M2V A;  3AM9 A;  1NKE A;  4EV6 A;  3AUO A;  5CHG A;  2C2E A;  1ZRM A;  3NAS A;  1D9D A;  3N7S C;  1QQ7 A;  4ATB B;  3ISC A;  2ISO A;  2HHP A;  3HJE A;  4RWP A;  5KFU A;  1NKC A;  3WK7 A;  3QYP A;  1NJX A;  4EYH B;  5DB8 A;  4DOC A;  1F44 A;  1COK A;  4Y2T A;  4C8O A;  4F4K A;  4BWM A;  3HX0 A;  1LB2 B;  2FLP A;  1M6Y A;  2XC9 A;  3T3F A;  4RQ2 A;  1F5S A;  2WAQ C;  3H37 A;  2EAO A;  1S0N A;  1SKR A;  3RJG A;  3WK5 A;  1HEK A;  3M7D A;  2IOH A;  3ISD A;  1ZQK A;  2WF9 A;  3Q8S B;  1L6N A;  4RPX A;  1X6J A;  5KFN A;  4RNO A;  3OVA A;  3EW9 A;  4QZA A;  3RJI A;  1S9F A;  1Z00 B;  4R8U A;  5D46 A;  2ZH9 A;  5KFA A;  3NTU A;  4UB4 A;  2JEF A;  4EEY A;  2PFP A;  5AM5 A;  4Q8F A;  5D63 A;  2DWQ A;  2B4V A;  2KNJ A;  4GXJ A;  4DL7 A;  4AT7 A;  5HHI A;  3OUY B;  3WFP A;  4J9S A;  4M9J A;  3SR6 A;  4MF2 A;  3PVX A;  1NK7 A;  3DDH A;  3BDP A;  2KN7 A;  1SV4 A;  2VA3 A;  4B6J A;  1SL0 A;  8ICA A;  1K1S A;  2KKV A;  4EEK A;  3BQT A;  1K1Q A;  4NKU A;  2QB0 B;  1CUK A;  1SKW A;  4ED2 A;  4J9M A;  4KX5 A;  5G5G A;  3C5G A;  1NJY A;  1S76 D;  5ALW A;  3NVO A;  4UAZ A;  4QWB A;  2AGO A;  4Y2X A;  2JHD A;  4J9L A;  3QE9 Y;  9ICJ A;  3AN1 A;  1LKY A;  3QZ8 A;  4CF5 A;  1TFR A;  3OJS A;  4K97 A;  1U45 A;  2AGP A;  4P0P B;  5ALH A;  1QLN A;  1V85 A;  3QU5 A;  9ICL A;  1CEZ A;  5J0X A;  1YLQ A;  3B0Y A;  1S5L U;  2F8L A;  3ERC C;  2YB4 A;  2ZTE A;  5AKL A;  3V7J A;  2PKE A;  3KZI U;  3OSN A;  4EBK A;  5C0Y A;  4KLI A;  5HC9 A;  2CXY A;  5ALJ A;  4UB5 A;  4B9T A;  4DQQ A;  3PX0 A;  4TQS A;  5AKZ A;  4EX7 A;  3JPS A;  1BVS A;  1N62 A;  1BNP A;  3SAH A;  3AQK A;  4F50 A;  1SIJ A;  1NK6 A;  4RWN A;  1F5A A;  2F76 X;  2LM4 A;  3V6H A;  2YQE A;  9ICX A;  5A0L A;  5DQG A;  4TUQ A;  4FHY A;  3J81 j;  1XS9 D;  3OVS A;  1Z00 A;  3SEI A;  5B5E U;  5KAI U;  2ZUC A;  2L5Y A;  5J2C A;  1MIV A;  1KQQ A;  4PL2 A;  3OUY A;  4WC6 A;  5J0O A;  1FA0 A;  3WKB A;  5L1K A;  2ISP A;  5AM4 A;  1NK5 A;  1BPX A;  2G09 A;  5H2F U;  5KFG A;  1KDH A;  3D2S A;  4EP7 A;  8ICS A;  4UAW A;  5ALF A;  5JU5 A;  2QB0 A;  3PY8 A;  2AQ4 A;  1TV9 A;  1T94 A;  4KLO A;  9ICH A;  5D49 A;  4LZD A;  2AXT U;  5J8Y A;  3LWL A;  2WF8 A;  5DDM A;  5KAF U;  2E1F A;  4YG2 A;  4FBT A;  2JRZ A;  2GO7 A;  3RH4 A;  1TFW A;  5G5H A;  4ED8 A;  3BQ1 A;  5CA7 A;  4RU9 A;  5HR7 A;  5AK4 A;  3BQ7 A;  2W9A A;  1ZQA A;  3NKU A;  4B9S A;  4Q8E A;  4P0P A;  2K4P A;  3HT3 A;  4GC7 A;  1S0O A;  4M9L A;  4F2S A;  5J0Y A;  5L9X A;  1YZ7 A;  4YFK A;  5HRB A;  5DG7 A;  4NWI A;  3M8S A;  4EEL A;  2BQU A;  2F77 X;  4DQI A;  9ICV A;  5AKY A;  3WKC A;  3OGU A;  4ED6 A;  4K9A A;  3SEN A;  1DGS A;  2BCQ A;  5AKX A;  1T3Q A;  2GAF D;  1S8O A;  2E8N A;  2JMG A;  3BQ2 A;  2BPC A;  5DED A;  3AU6 A;  2DR7 A;  5KG1 A;  9ICM A;  4IQU A;  2VKQ A;  3G6V A;  2XCP A;  2BCR A;  3EUB 2;  2B6G A;  1MSW D;  3JCF A;  1BGX T;  5EOZ A;  3LDA A;  4ACO A;  2E8P A;  4NLN A;  1FO4 A;  4AT8 B;  1TK5 A;  4WQL A;  4F4Z A;  4ELU A;  3MGV A;  3H40 A;  5KFD A;  1DOQ A;  3IHQ B;  3PW0 A;  3ER8 C;  4GC6 A;  4E0D A;  4NLB A;  5DLF A;  8ICB A;  5DG8 A;  2Q66 A;  3WFR E;  2H3F A;  3KD3 A;  2GLE A;  4ECY A;  5KG0 A;  4WBZ A;  1NNL A;  2EZY A;  2JH1 A;  5KFM A;  1OXJ A;  5KFS A;  4C8N A;  5AK3 A;  1JN3 A;  5J0S A;  2BCV A;  4FS1 A;  5ALI A;  1SXE A;  1X9X A;  1ZJN A;  4U7C A;  3LQC B;  1ZD4 A;  5EE0 A;  4OJP A;  3GIL A;  3RJK A;  2HVI A;  1IG6 A;  1PVR A;  2AHO B;  4OCZ A;  4I2A A;  4JLZ A;  2UVV A;  1Z1B A;  2MAX A;  5DGA A;  2BDP A;  4UW9 A;  2RFF A;  4Y2P A;  4DF8 A;  1T8E A;  1ZQM A;  2JXJ A;  2H3V A;  3JZ0 A;  7ICP A;  8ICR A;  3H0L B;  2ZXH A;  3G6Y A;  3JPR A;  5KFP A;  5DQH A;  5KTQ A;  1Q79 A;  3GII A;  3NVY A;  3F53 A;  3ETL A;  2G07 A;  2NRX A;  2ZJA A;  5AIC A;  4OAH A;  5KFX A;  4I2B A;  3SV3 A;  2C28 A;  1WOT A;  5J2H A;  1L5U A;  3C2K A;  2JEG A;  5J2E A;  2F44 A;  2Y9T A;  4IR1 A;  4RQ3 A;  3NWI A;  2BHN A;  3A0H U;  3JPP A;  4TUS A;  2GA9 D;  2QLT A;  2NRT A;  3M6Z A;  2YMP A;  1BPE A;  1O03 A;  2BR0 A;  1UT5 A;  1UEV A;  1Q46 A;  2ZH3 A;  2HOQ A;  3MBY A;  4RQ6 A;  3EPG A;  2EH9 A;  2F2A B;  4O3S A;  3MCR A;  2UVW A;  4NLZ A;  2HMX A;  2WTF A;  2P6R A;  5DQI A;  5B3P A;  5KFZ A;  3ED5 A;  1SWV A;  4KLG A;  3HRD D;  4LEV A;  4DL5 A;  4IL6 U;  1XSL A;  1KW4 A;  1T3N A;  4PHD A;  1VJ5 A;  1DK2 A;  3L5K A;  2HW3 A;  3O0F A;  3JPT A;  1XU4 A;  4G9B A;  5HRE A;  4UD5 A;  2NYV A;  8ICN A;  4F5P A;  3N7P D;  2M9N A;  3MR5 A;  4Z6D A;  4DEZ A;  5ALL A;  3KFU F;  1NK4 A;  5AK5 A;  1ZQS A;  2P6U A;  2ZH4 A;  3CRX A;  3WK9 A;  3MDC A;  9ICC A;  2DVI A;  4PHA A;  3NRW A;  5EE1 A;  1NK0 A;  3PO5 A;  3K4G A;  4JUZ A;  4UB3 A;  4A8E A;  2HHS A;  8ICW A;  3V6J A;  7ICR A;  4DFJ A;  3PMN A;  5KFV A;  4DOB A;  3UXP A;  1NZB A;  4O3Q A;  4UAT A;  3CYM A;  2JEJ A;  3L9D A;  3OVB A;  3UPQ A;  2W3R A;  2C2D A;  2IA6 A;  4K4G A;  5CWR A;  4XRH A;  2Y0S F;  4JV0 A;  4FHP A;  1NK9 A;  4DSK A;  1KSP A;  5ALN A;  5III A;  4NM2 A;  1ECW A;  2VA2 A;  1C7Y A;  4AP9 A;  5HRD A;  1ZQV A;  2B0C A;  4CRX A;  1Z19 A;  2P35 A;  3KKA C;  4NLK A;  1ZQD A;  2PMZ F;  1KKX A;  3SYZ A;  5KG3 A;  1Y88 A;  1COO A;  1QH9 A;  1ZD3 A;  2XO7 A;  1RQN A;  3PHZ A;  1SL2 A;  1U47 A;  2KMD A;  5DB9 A;  2XGP A;  4EBD A;  4FZN A;  4K98 A;  2OWO A;  2NRW A;  8ICF A;  4PZN A;  4QIW C;  4IQV A;  3FC4 A;  2HHV A;  1SB3 C;  3QU7 A;  4TQR A;  3N7R C;  4YD1 A;  3SI8 A;  4JMU A;  1RG6 A;  4DL6 A;  4RQ8 A;  3D6J A;  2ZHA A;  4Z6E A;  9ICA A;  4XQ8 A;  4ED7 A;  3UPS A;  4QZ9 A;  3Q8Q B;  3Q8P B;  5IIJ A;  1HUZ A;  4CDG A;  3N97 B;  3RB4 A;  3IN5 A;  3LWM A;  2DR8 A;  4Y2Y A;  4OJ6 A;  4DFD A;  4FBU A;  2W04 A;  4O3P A;  4DLG A;  3BS5 B;  4YN4 A;  2I5H A;  1R8C A;  5L1J A;  3H8J A;  2G08 A;  4LEW A;  4KLD A;  2FCL A;  4ZH4 A;  1JMS A;  4ICA A;  5KG5 A;  5D61 A;  5KT4 A;  5AI0 A;  5AKH A;  4X4P A;  3H38 A;  5CB1 A;  4DL2 A;  5AM3 A;  7ICO A;  4KTQ A;  2RHF A;  4ECU A;  4ECQ A;  4FHW A;  2W55 A;  2K60 A;  1N5X A;  4I2J A;  5J0Q A;  1JRO A;  4DS4 A;  3RB3 A;  1S0M A;  3QXG A;  8ICH A;  4O67 A;  3I1Y A;  3C2M A;  1GPJ A;  3QU4 A;  4BWJ A;  1PX5 A;  3QUB A;  4UB2 A;  4O3M A;  2I9G A;  5KG2 A;  3LVW A;  2Z7J A;  1L3S A;  3M9M B;  3TAN A;  2Y0S C;  3D2N A;  4PZO A;  2WF7 A;  3KHL A;  4RQ1 A;  1L7N A;  5AIA A;  3PV8 A;  4B9V A;  4C8K A;  4C8L A;  8ICG A;  2AGQ A;  4EZ9 A;  4P4O A;  4O5C A;  3FYH A;  4CF3 A;  3QUT A;  2H3Z A;  2K4E A;  3LK9 A;  2IHN A;  2W54 A;  5JUM A;  2PMZ C;  3AMZ A;  3OSP A;  1RDF A;  1TK0 A;  3GDX A;  5J2K A;  4QWE A;  5GTI U;  3H39 A;  1B4F A;  2HHX A;  4UBC A;  2W03 A;  3AQE A;  3TAD A;  4PH5 A;  4F91 B;  3ZDC A;  5TIS U;  1L3T A;  4ECS A;  1WWV A;  1WWU A;  2HDO A;  2HBJ A;  3EF2 A;  1X9W A;  1RXW A;  3C1Z A;  5J2J A;  1KTQ A;  2DGZ A;  4O0I A;  3C28 A;  4RZR A;  1UET A;  3EYZ A;  1OW5 A;  1ZOL A;  1S77 D;  4DSF A;  2LYA A;  4YCX A;  4Z6F A;  8ICJ A;  3Q8L A;  2EZZ A;  1DXS A;  5F2V O;  4F4W A;  3KOO A;  3MR3 A;  2A1J B;  5HRG A;  4B9N A;  8ICY A;  2AQ0 A;  3Q8M A;  3H8W A;  2OYY A;  2DR9 A;  2YTU A;  4BXO B;  4DSE A;  4O3R A;  1UEU A;  3M9N B;  4F72 A;  4J9O A;  4RQ7 A;  4CCH A;  4RQ4 A;  2KSO B;  3BS5 A;  7ICH A;  4JWM A;  2XID A;  2HBL A;  5KFI A;  1KLN A;  1JXL A;  4ED1 A;  5EE3 A;  2J6U A;  3QNM A;  4P0Q B;  4K4I A;  4F93 B;  2E1E A;  1KFS A;  1N61 A;  4G3I A;  2DRB A;  4YMO A;  3IRU A;  4ECV A;  4KB6 A;  4O69 A;  2RDJ A;  2I6X A;  1KEJ A;  3MAB A;  7ICI A;  3FM9 A;  3H0M B;  4K4H A;  5C5J A;  2FI1 A;  3TKA A;  5KFB A;  4DSJ A;  3OHB A;  1TAU A;  2BE3 A;  7ICL A;  1UA0 A;  5J0T A;  4RPY A;  4CE6 A;  2OCE A;  4PPX A;  4ED0 A;  5DEC A;  3EZ5 A;  1ZQF A;  3GV8 B;  5CP2 A;  2R18 A;  3WFO A;  2FE9 A;  4JLX A;  2C2R A;  2KFZ A;  1TVA A;  1U4B A;  4CNQ A;  4P4P A;  1KRP A;  2ASL A;  1J2N A;  4HAI A;  5KFE A;  4EBC A;  1XO0 A;  2ASJ A;  5AI5 A;  5IIK A;  2ATL A;  5KFK A;  4KLJ A;  3PO4 A;  2JH7 A;  4FO1 A;  4YD2 A;  3N4M B;  4AYB C;  3TQ1 A;  2EZX A;  1KFT A;  3C18 A;  4NXX A;  2ZHB A;  8ICZ A;  5EE9 A;  5IIL A;  2XGQ A;  4KLH A;  2PI5 A;  1FIQ A;  2NRK A;  4BX9 C;  2KK0 A;  1N5W A;  3WK8 A;  4X4N A;  2JZB B;  4O9M A;  2AU0 A;  2DBY A;  2LHT A;  4NKT A;  4NXZ A;  8ICT A;  4XA5 A;  4C4S A;  5DBB A;  2YX8 A;  2D3D A;  2KHQ A;  4PL1 A;  4GXK A;  2ZUD A;  1A6S A;  4LT6 A;  4M6W A;  1F0M A;  1KFD A;  2CN1 A;  2O6K A;  2DPI A;  2M0N A;  2FPK A;  2HHW A;  1N63 A;  5IIN A;  3B0X A;  3PZP A;  2A1J A;  2KD1 A;  3AQL A;  4X0B A;  1K5O A;  2R8G A;  4BJQ A;  3RJJ A;  3QU2 A;  3ICX A;  5F3X B;  2J6S A;  2HN1 A;  2ZIW B;  4BXO A;  4QZI A;  3QEA Z;  3UQ2 A;  4RT2 A;  2KSO A;  4FE3 A;  2OHF A;  1TAQ A;  4UAV A;  1AQ6 A;  2M2T A;  2YML A;  4P0Q A;  3I28 A;  1Z1V A;  3UXN A;  2XVT A;  2YMQ A;  5AIB A;  3K75 D;  2KTQ A;  2YY6 A;  4N7R A;  1DGJ A;  4I27 A;  2G5I B;  4EEN A;  3GV7 B;  2LBO A;  4FZL A;  1ZD5 A;  5J2D A;  1ZQI A;  4IRC A;  4EED A;  2W9B B;  2R8H A;  3CP8 A;  4YMM A;  3H0R B;  2W3S A;  4F3O A;  1V9P A;  2WF6 A;  4IC9 A;  4NLC A;  5KFY A;  4X5V A;  5KFF A;  3MFI A;  2KVS A;  4KLS A;  7ICK A;  2ES6 A;  5KT5 A;  5KL8 B;  2KZ3 A;  3PR5 B;  3RF9 A;  3FAH A;  4DFP A;  1S10 A;  5AI9 A;  4O3O A;  2ASD A;  3KHH A;  4C7Z A;  3CNH A;  1T7P A;  2IUB A;  1ZQZ A;  4KM5 A;  3WU2 U;  2LMR A;  2KVC A;  5HNK A;  4PJ0 U;  4EZ6 A;  4R65 A;  3EPI A;  1JXE A;  5J2A A;  4TUR A;  9ICK A;  4UD4 A;  2IMW P;  1ZQX A;  4MFF A;  4WC1 A;  1ZQH A;  2D6F C;  2GOL A;  4UB6 U;  1RQL A;  4MHV A;  4UQG A;  3RRH A;  2JZB A;  3PSF A;  4DOA A;  2XCA A;  2HHT A;  1D8L A;  1NOM A;  2ESE A;  1UHU A;  4Y2Q A;  5KFT A;  2PFN A;  4YR3 A;  1Q78 A;  4X4U A;  2H3Q A;  4ECX A;  5K4L A;  2GH1 A;  1YZ6 A;  2CRX A;  1PVP A;  3A0B U;  5KFR A;  1DK3 A;  2Y1J A;  2F1I A;  4QW9 A;  2ZIW A;  2M2W A;  3EWA A;  2A1A A;  2BPG A;  2W8K A;  1B0X A;  4HX0 A;  3IG8 A;  3PSP A;  1ZRN A;  1U9L A;  2FLN A;  1UPH A;  5AM0 A;  4YR0 A;  4KLL A;  2K89 A;  4R64 A;  3T5L A;  5B3Q A;  1XNS A;  2FMQ A;  4RPZ A;  1Z4N A;  2R8J A;  3ZDA A;  1KNY A;  5J8Y C;  5KT7 A;  2C22 A;  4FH3 A;  4O6A A;  2KJ8 A;  4OO1 J;  2ODG A;  5KL1 B;  5KNI A;  2LYH A;  4I2F A;  5J2I A;  2W9C B;  4DSL A;  4I2H A;  2W9B A;  4CGZ A;  4NL9 A;  5AM1 A;  2KHV A;  4RNN A;  1KL9 A;  4Y2S A;  5ALO A;  3PR4 A;  4B9M A;  2ZH5 A;  2B56 A;  3T79 A;  4JV2 A;  2MA1 A;  3NS1 A;  1NJW A;  5HRF A;  4MEX A;  2H3I A;  1SV0 A;  5AKK A;  4DWI A;  1J2M A;  2KJ9 A;  5J2B A;  9ICQ A;  4EX6 A;  3F2C A;  4J9R A;  3M9O B;  3QUQ A;  1QQ5 A;  2UVR A;  4KN4 A;  4NXW A;  4PGX A;  3U26 A;  2EAM A;  4ECW A;  8ICV A;  2GWS A;  4QIW F;  3TFS A;  3GZF A;  2N1R A;  3OTQ A;  4JWN A;  5HML A;  1ZQY A;  3TI0 A;  4F5O A;  4KLT A;  3SQI A;  1RZT A;  4QZH A;  2K4H A;  4MEY A;  1X42 A;  4YXM A;  2AH5 A;  3NVV A;  4IRD A;  3FDS A;  2PI4 A;  3ISB A;  3DV9 A;  1PUZ A;  3ZDD A;  1QSY A;  1QSS A;  3DEE A;  3CK6 A;  4X4O A;  1LVH A;  5ALX A;  4QWD A;  4NLG A;  2XIC A;  5B66 U;  4MKP A;  2W7O A;  3F2D A;  2LKY A;  3TAP A;  2WF5 A;  4WC2 A;  3S6J A;  4R66 A;  4I2E A;  1NJZ A;  3OPX A;  2RQ5 A;  4ED3 A;  2O1P A;  1LV5 A;  4J9P A;  2BQR A;  1ED1 A;  4F5Q A;  1QTM A;  2QKQ A;  3SAF A;  5AKI A;  4IQT A;  4O68 A;  1VFG A;  2WFA A;  4M5D A;  4LVS A;  1J97 A;  1Q3U A;  2PFQ A; 
#chains in the Genus database with same CATH homology
 3TAQ A;  5KFL A;  4M9G A;  2Q0Z X;  4FHY A;  3NGD A;  3RH5 A;  3LK9 A;  1HJP A;  3TAR A;  1XS9 D;  2IHN A;  3V7L A;  5JUM A;  3MFH A;  3OVS A;  4KLM A;  1Z00 A;  1JAJ A;  8ICK A;  2ZUC A;  4Q43 A;  3OSP A;  4I2G A;  1TK0 A;  4DSI A;  5J2C A;  5BOL A;  3GDX A;  5J2K A;  1HUO A;  4DL3 A;  3RR8 A;  2W9C A;  4M2Y A;  4QWE A;  9ICG A;  1BNO A;  4QZB A;  4Q45 A;  3PML A;  1L3U A;  1MIV A;  4F92 B;  4XUS A;  4GLX A;  4DFK A;  1XSP A;  3H39 A;  2R8K A;  4UBC A;  2HHX A;  1MIW A;  4PH5 A;  3OUY A;  1Z3E B;  1TKD A;  3RB6 A;  4F91 B;  1ZYQ A;  3ZDC A;  4DFM A;  5J0O A;  4WC6 A;  4UAY A;  1L3T A;  1FA0 A;  3IM1 A;  4ECS A;  5F9L A;  5L1K A;  5KG7 A;  3H4B A;  2ISP A;  5DBC A;  3C5F A;  5IIO A;  1X9W A;  1RYR A;  1NK5 A;  1RXW A;  1BPX A;  5HMM A;  3C1Z A;  4WC0 A;  1KDH A;  5KFG A;  5J2J A;  1KTQ A;  4M47 A;  1JIH A;  4EP7 A;  4NM1 A;  4O0I A;  1ZQJ A;  1IM4 A;  8ICS A;  3JPO A;  4X4Q A;  4UAW A;  4RZR A;  1UET A;  3EYZ A;  3PY8 A;  4YMN A;  1S77 D;  2ID1 A;  1ZJM A;  4DSF A;  4IG8 A;  2AQ4 A;  1TV9 A;  4KLO A;  4IRK A;  4YCX A;  5D49 A;  9ICH A;  4Z6F A;  4LZD A;  3LWL A;  8ICJ A;  3NYB A;  3Q8L A;  1ZQE A;  5F2V O;  4F4W A;  2BGW A;  5BOM A;  2NRZ A;  3PX6 A;  3AQM A;  4X0A A;  3MR3 A;  5DDM A;  2A1J B;  1SL1 A;  2BPF A;  3SZ2 A;  4YG2 A;  1V4A A;  5DB6 A;  4FBT A;  3RH4 A;  5HRG A;  5DB7 A;  1TFW A;  4B9N A;  8ICY A;  4QZG A;  4DS5 A;  4ED8 A;  2AQ0 A;  3Q8M A;  3H8W A;  4C8M A;  3BQ1 A;  4I2I A;  5CA7 A;  2DR9 A;  4RU9 A;  2DPJ A;  1BPZ A;  4BXO B;  5L1L A;  4DSE A;  4QWC A;  4M0A A;  4O3R A;  2KFN A;  2W9A A;  1ZQA A;  1QSL A;  1UEU A;  4R63 A;  3M9N B;  4J9O A;  4B9S A;  4RQ7 A;  4CCH A;  3C1Y A;  4RQ4 A;  1XSN A;  4Q8E A;  8ICL A;  7ICH A;  4M9N A;  5HRK A;  3GV5 B;  4JWM A;  4KLE A;  3HT3 A;  4GC7 A;  2ZH8 A;  1S0O A;  5KT2 A;  4M9L A;  4F2S A;  5J0Y A;  4J9K A;  5KFI A;  4QWA A;  1KLN A;  5L9X A;  1JXL A;  4ED1 A;  4YFK A;  3H7I A;  1XO1 A;  5DG7 A;  2J6U A;  5BPC A;  4RQ5 A;  5HRB A;  4K4I A;  5IIM A;  7ICN A;  1R8A A;  3ZD9 A;  2VA8 A;  4AT9 B;  4RWO A;  4WC5 A;  1ZQC A;  4F93 B;  3M8S A;  2BQU A;  1MQ3 A;  1ZQP A;  7ICJ A;  1KFS A;  4DQI A;  4G3I A;  4QZC A;  4X4V A;  5HRL A;  2DRB A;  4IQW A;  1S0V A;  9ICV A;  4YMO A;  4MFA A;  4WCW A;  2PXI A;  4ECV A;  7ICG A;  3OGU A;  4ED6 A;  1DGS A;  1ZQG A;  2XY7 A;  2DR5 A;  2RDJ A;  2BCQ A;  4RQ0 A;  3RJF A;  1KEJ A;  7ICV A;  3AQN A;  4DQR A;  3MAB A;  4X4T A;  2F1H A;  2NRV A;  4F5N A;  4WC3 A;  3GIK A;  4RUC A;  7ICI A;  4K4H A;  5C5J A;  4KMU A;  3ZD8 A;  4AT8 A;  3BQ2 A;  4I28 A;  2BPC A;  5KFB A;  3OHB A;  4O3N A;  4DSJ A;  1TAU A;  7ICL A;  1B22 A;  1OU5 A;  2BE3 A;  5DED A;  3AU6 A;  2DR7 A;  5KG1 A;  4P2H A;  2ZH7 A;  5J2F A;  4IQU A;  1UA0 A;  5J0T A;  5DBA A;  9ICM A;  2F1J A;  4RPY A;  3G6V A;  3H3A A;  3H4D A;  1RXV A;  2XCP A;  4PPX A;  4KN7 A;  2BCR A;  4ED0 A;  2HVH A;  2PBE A;  5DEC A;  2ZH6 A;  4F4Y A;  5J29 A;  3EZ5 A;  1ZQF A;  1MSW D;  3MGH A;  5CP2 A;  1BGX T;  5EOZ A;  3LDA A;  3GV8 B;  2Y1I A;  3WFO A;  4PHE A;  4NLN A;  2C2R A;  3RRG A;  1IXR A;  2KFZ A;  4DO9 A;  1TVA A;  1U4B A;  4F2R A;  1TK5 A;  4AT8 B;  4YQW A;  4P4P A;  4E7X A;  1KRP A;  4F4Z A;  2ASL A;  4WC4 A;  2FPL A;  5KFE A;  4EBC A;  4O5E A;  2HHQ A;  1WCN A;  2ASJ A;  3HWT A;  4ELU A;  2ZH2 A;  3H40 A;  2V4Q A;  5IIK A;  5KFD A;  1DOQ A;  2ZTD A;  3IHQ B;  3PW0 A;  2ATL A;  4GC6 A;  8ICO A;  5KFK A;  4JK1 A;  4FO6 A;  4EYI B;  3PO4 A;  4E0D A;  4NY8 A;  4KLJ A;  2KZM A;  2ALZ A;  5DLF A;  4ELV A;  2KZZ A;  4YD2 A;  3N4M B;  5CR0 A;  8ICB A;  5DG8 A;  2XY5 A;  3TQ1 A;  4IR9 A;  1KFT A;  1PZN A;  3C18 A;  2ZHB A;  2Q66 A;  3WFR E;  3RH6 A;  8ICZ A;  2P66 A;  1R89 A;  3JPQ A;  4ECY A;  3T5H A;  5IIL A;  5KG0 A;  2XGQ A;  2J6T A;  4WBZ A;  4ECT A;  4KLH A;  2VAN A;  5KFM A;  9ICU A;  2PI5 A;  5KFS A;  4C8N A;  4F4X A;  2NRK A;  5HRH A;  1T4G A;  1JN3 A;  1X2I A;  5J0S A;  2V4R A;  2JZB B;  1ZQT A;  2BCV A;  4X4N A;  4O9M A;  2AU0 A;  4FS1 A;  2PFO A;  5J0P A;  2MUT B;  7ICF A;  9ICT A;  4NKT A;  4NXZ A;  4DQS A;  3MGI A;  8ICT A;  4XA5 A;  8ICX A;  1ZJN A;  5DBB A;  9ICB A;  3LQC B;  1JX4 A;  1RPL A;  1U48 A;  2UVU A;  3PNC A;  2FPM A;  4I2C A;  2IHM A;  4GXK A;  2XY6 A;  1L3V A;  4E8F A;  2ZUD A;  2BCS A;  4JV1 A;  3GIL A;  3RJK A;  4LT6 A;  4M6W A;  1KFD A;  2HVI A;  5D4B A;  2DPI A;  4KLU A;  5EWE A;  5DGB A;  2FPK A;  2HHW A;  3HW8 A;  5IIN A;  3B0X A;  3C2L A;  2A1J A;  3AQL A;  4X0B A;  1SKS A;  4I2A A;  2R8G A;  3RJJ A;  5KFO A;  4EBE A;  2UVV A;  2MAX A;  2I1Q A;  4GXI A;  2J6S A;  4YR2 A;  5DGA A;  9ICR A;  2BDP A;  4BXO A;  7ICT A;  2RFF A;  4QZI A;  4MF8 A;  4YP3 A;  1ZQU A;  3ORY A;  3QEA Z;  3UQ2 A;  4DF8 A;  4RT2 A;  3JYY A;  1VJ7 A;  3MR6 A;  3UQ0 A;  4M6W B;  1TAQ A;  1T8E A;  1ZQM A;  1A77 A;  3TFR A;  2KP7 A;  3BQ0 A;  4BDP A;  3JZ0 A;  7ICP A;  8ICR A;  2M2T A;  4DQP A;  3G6Y A;  3JPR A;  5KFP A;  5DQH A;  5KTQ A;  5KT3 A;  3QEB Z;  4PHP A;  1Q79 A;  3GII A;  4AT9 A;  5KFH A;  4X4R A;  3ETL A;  3RAX A;  2NRX A;  3UXN A;  3V7K A;  4WC7 A;  1ARO P;  3PW4 A;  2ZJA A;  3K75 D;  1ZQQ A;  4RT3 A;  1NZP A;  2KTQ A;  5KFX A;  4I2B A;  3SV3 A;  9ICE A;  2C28 A;  1WOT A;  4R8U B;  5J2H A;  3C2K A;  4J9N A;  1L5U A;  3WFQ E;  5F9N A;  4FS2 A;  2JEG A;  5J2E A;  4IR1 A;  4EBJ A;  2FMP A;  5HP4 A;  4I27 A;  1UT8 A;  4RQ3 A;  2FLL A;  3GV7 B;  7ICU A;  3E2E A;  2BHN A;  5EWF A;  1S97 A;  5J2D A;  3JPP A;  1ZQI A;  4QZ8 A;  1NK8 A;  4IRC A;  3PW2 A;  4TUS A;  2W9B B;  1ZQN A;  3RAQ A;  5J2G A;  5KFQ A;  2R8H A;  2JEI A;  2BQ3 A;  3C66 A;  4AT7 B;  4YMM A;  9ICW A;  4F3O A;  1R8B A;  1V9P A;  2NRT A;  2ZTC A;  4QZF A;  1N48 A;  1BPE A;  4M9H A;  3PW7 A;  5CJ7 A;  5KFY A;  2BR0 A;  4XQ7 A;  4X5V A;  1UT5 A;  4E80 A;  5KFF A;  2W8L A;  1UEV A;  3MFI A;  8ICI A;  1SZP A;  1ZQB A;  4DL4 A;  4KLS A;  3GIM A;  8ICU A;  1JQR A;  2ZH3 A;  7ICK A;  5KT5 A;  1EXN A;  2KZ3 A;  3PR5 B;  2AJQ A;  3MBY A;  3HP6 A;  3RTV A;  4RQ6 A;  4FH5 A;  2ZJ8 A;  2W9M A;  3EPG A;  1D8Y A;  4DFP A;  1S10 A;  3PX4 A;  4O3S A;  9ICI A;  4O3O A;  3V6K A;  2ASD A;  2UVW A;  4NLZ A;  2P6R A;  2WTF A;  4FHV A;  1B43 A;  5DQI A;  3KHH A;  3RBD A;  5DDY A;  5KFW A;  5KFZ A;  4DF4 A;  1T7P A;  8ICP A;  4ELT A;  4KLG A;  1ZQZ A;  5DG9 A;  4DL5 A;  1XSL A;  1T3N A;  4PHD A;  8ICM A;  3UXO A;  1DK2 A;  1TK8 A;  1WCL A;  2RDI A;  5HNK A;  3JPT A;  2HW3 A;  1XU4 A;  4KLQ A;  1RYS A;  4EZ6 A;  1H38 A;  4R65 A;  5HRE A;  4UD5 A;  3EPI A;  5HR9 A;  1JXE A;  1ZQR A;  4QZE A;  8ICN A;  5J2A A;  1BPD A;  4F5P A;  9ICO A;  4I29 A;  5HRI A;  4TUR A;  2IBK A;  9ICK A;  4UD4 A;  2IMW P;  2DRA A;  1ZQX A;  4MFF A;  5EWG A;  3Q8K A;  2M9N A;  5KG6 A;  4Z6D A;  4DEZ A;  3MR5 A;  3THV A;  1N56 A;  1MQ2 A;  4J9Q A;  1ZQH A;  7ICE A;  4WC1 A;  4ATB A;  4RUA A;  5TZV A;  3H8S A;  2FMS A;  4UQG A;  3RRH A;  1XC9 A;  1UA1 A;  1U49 A;  2JZB A;  1NKB A;  1NK4 A;  2BKE A;  4QW8 A;  2MUT A;  4DOA A;  2XCA A;  4S3N A;  2HHT A;  1ZQS A;  1D8L A;  1NOM A;  4PGY A;  2R8I A;  2B21 A;  3HJ1 A;  3C23 A;  2P6U A;  4B9L A;  5KFT A;  2M2V A;  2PFN A;  2ZH4 A;  4YR3 A;  1NKE A;  4B9U A;  3AUO A;  5CHG A;  1Q78 A;  2M2U A;  4X4U A;  8ICQ A;  3MDC A;  3WFS C;  4ECX A;  2C2E A;  9ICC A;  2DVI A;  3BJY A;  1D9D A;  4PHA A;  4ATB B;  4UBB A;  3ISC A;  3G6X A;  1D9F A;  1NK0 A;  3PO5 A;  3K4G A;  2ISO A;  2HHP A;  8ICE A;  4JUZ A;  3GQC A;  4UB3 A;  4RWP A;  5KFU A;  1ZQL A;  4F8R A;  3OJU A;  2HHS A;  5KFR A;  1NKC A;  8ICW A;  1DK3 A;  4Z6C A;  2Y1J A;  2F1I A;  3V6J A;  4MFC A;  7ICQ A;  7ICR A;  4DFJ A;  1NJX A;  4UB1 A;  4QW9 A;  3PMN A;  5KFV A;  4EYH B;  5DB8 A;  2M2W A;  3OV7 A;  4KLF A;  4DOB A;  4DOC A;  3EWA A;  5KFC A;  5J0R A;  3UXP A;  9ICS A;  4O3Q A;  1X9M A;  2BPG A;  3QZ7 A;  5DLG A;  2W8K A;  2JEJ A;  4C8O A;  4BWM A;  4F4K A;  3L9D A;  3OVB A;  3UPQ A;  3HX0 A;  1LB2 B;  2FLP A;  4F5R A;  1U9L A;  2XC9 A;  3T3F A;  1ZQO A;  4I2D A;  3OHA A;  4RQ2 A;  2C2D A;  2FLN A;  2IA6 A;  4YR0 A;  3GIJ A;  3H37 A;  4KLL A;  4K4G A;  1S0N A;  1SKR A;  4R64 A;  3T5K A;  3RJG A;  5CWR A;  4XRH A;  3T5L A;  3HIY A;  1TFY A;  4JV0 A;  4FHP A;  1NK9 A;  4DSK A;  2FMQ A;  4RPZ A;  3ISD A;  1KSP A;  3Q8R B;  2R8J A;  3ZDA A;  1ZQK A;  3ZDB A;  4M04 A;  3Q8S B;  1KNY A;  4RPX A;  5III A;  5KT7 A;  4NM2 A;  5KFN A;  4HYK A;  2C22 A;  1C7Y A;  2VA2 A;  4RNO A;  4FH3 A;  3OVA A;  3AU2 A;  3EW9 A;  4QZA A;  3RJI A;  1S9F A;  1Z00 B;  1ZQV A;  2BCU A;  4R8U A;  5HRD A;  2H5X A;  4ECZ A;  5D46 A;  2ZH9 A;  2LYH A;  5KFA A;  4I2F A;  3NTU A;  4UB4 A;  2JEF A;  5J2I A;  4EEY A;  2PFP A;  2ZUB A;  4KIT B;  4NLK A;  2W9C B;  1ZQD A;  5J0U A;  4Q8F A;  4DSL A;  3SYZ A;  4I2H A;  2W9B A;  5KG3 A;  4GXJ A;  1Y88 A;  1COO A;  4QZD A;  3SV4 A;  2XO7 A;  4DL7 A;  4AT7 A;  5HHI A;  4RNN A;  3OUY B;  3WFP A;  3PW5 A;  1SL2 A;  4RWQ A;  4J9S A;  4M9J A;  1U47 A;  3JPN A;  5DB9 A;  2XGP A;  4EBD A;  3PR4 A;  4B9M A;  2ZH5 A;  4JV2 A;  3T5J A;  2HHU A;  2OWO A;  2NRW A;  8ICF A;  4MF2 A;  3PVX A;  1NJW A;  1NK7 A;  4IQV A;  2HHV A;  3BDP A;  5HRF A;  4DLE A;  7ICS A;  2ZJ5 A;  4MEX A;  2KN7 A;  4WBY A;  2VA3 A;  1SL0 A;  4TQR A;  3SI8 A;  4YD1 A;  8ICA A;  1K1S A;  3RJE A;  3HJ4 A;  3BQT A;  1K1Q A;  4DWI A;  4NKU A;  4DL6 A;  1CUK A;  1SKW A;  4ED2 A;  5J2B A;  4RQ8 A;  3RBE A;  9ICQ A;  2ZHA A;  4J9M A;  4Z6E A;  4ECR A;  3KHR A;  9ICA A;  3C5G A;  4XQ8 A;  1NJY A;  1S76 D;  4ED7 A;  5KT6 A;  3UPS A;  9ICN A;  4UAZ A;  4QWB A;  5KG4 A;  4J9R A;  3M9O B;  2AGO A;  4QZ9 A;  3Q8Q B;  3Q8P B;  4BGD A;  4P4M A;  5IIJ A;  1HUZ A;  1ZET A;  4J9L A;  3KHG A;  1MC8 A;  5HHH A;  4KN4 A;  3V72 A;  3QE9 Y;  2V9W A;  1X9S A;  2UVR A;  9ICJ A;  4YXJ A;  4PGX A;  3HPO A;  3N97 B;  3RB4 A;  3RR7 A;  3LWM A;  3QZ8 A;  4ECW A;  2GWS A;  8ICV A;  3TFS A;  5KFJ A;  2DR8 A;  1TFR A;  3OJS A;  4TUP A;  1U45 A;  4FBU A;  2AGP A;  4O3P A;  4JWN A;  5HML A;  4DLG A;  1QLN A;  1ZQW A;  1ZQY A;  4YN4 A;  9ICL A;  3TI0 A;  4F5O A;  4KLT A;  1RZT A;  5J0X A;  1CEZ A;  1NO5 A;  1R8C A;  4QZH A;  1YLQ A;  4MEY A;  5L1J A;  3B0Y A;  3H8J A;  4YXM A;  4IRD A;  3FDS A;  4KLD A;  2ZTE A;  2PI4 A;  3ISB A;  3KTQ A;  9ICF A;  4ZH4 A;  1JMS A;  1A76 A;  4FHX A;  5KG5 A;  3V7J A;  3ZDD A;  5KT4 A;  1QSY A;  1BPB A;  1QSS A;  3OSN A;  4EBK A;  4X4P A;  3H38 A;  4X4O A;  4QWD A;  4NLG A;  1XWL A;  5CB1 A;  4Q44 A;  4PGQ A;  4DL2 A;  4KLI A;  4O5K A;  8ICC A;  7ICO A;  5HC9 A;  4KTQ A;  4RNM A;  4ECU A;  4ECQ A;  4FHW A;  5J0Q A;  4I2J A;  9ICP A;  4DS4 A;  4UB5 A;  3TAP A;  3RB3 A;  1S0M A;  3C21 A;  4DQQ A;  3M8R A;  4B9T A;  4YVZ A;  8ICH A;  4WC2 A;  3PX0 A;  4R66 A;  4I2E A;  3MDA A;  1NJZ A;  4ED3 A;  4TQS A;  3RJH A;  5J0W A;  2O1P A;  3C2M A;  4X4S A;  3GFK B;  4BWJ A;  3JPS A;  1PX5 A;  1MIY A;  2DFL A;  4UB2 A;  1BVS A;  2I9G A;  5KG2 A;  1LV5 A;  4J9P A;  2BQR A;  1L3S A;  5DKW A;  3M9M B;  1BNP A;  3TAN A;  4F5Q A;  1QTM A;  3AQK A;  4F50 A;  4IQT A;  3KHL A;  1NK6 A;  7ICM A;  4RQ1 A;  4LZG A;  4RWN A;  1F5A A;  1VFG A;  5L1I A;  3V6H A;  4M5D A;  3PV8 A;  3RB0 A;  4C8K A;  4B9V A;  4C8L A;  4LVS A;  8ICG A;  3ZDE A;  3MR2 A;  9ICX A;  2AGQ A;  4EZ9 A;  5DQG A;  1BPY A;  4P4O A;  2PFQ A;  4TUQ A;  2ZH1 A;  4O5C A;  2O5A A;  3FYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...