5DB8A

Structure of human dna polymerase beta host-guest complex with the n7mg base paired with a da
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5db8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5db8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5db8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5db8A03
1N56A 5DDYA 2J6SA 4JV1A 4P2HA 3WFOA 2J6UA 1TAQA 2ZTDA 4X4PA 3OUYA 4IQVA 4Z6EA 4P4PA 2HVHA 4R8UA 1NK9A 5EWFA 1NK6A 4KLGA 4IR1A 8ICAA 4DFPA 5KFVA 2AQ4A 1D9DA 4XUSA 5BOMA 2VA3A 5KG4A 4KLEA 3RAQA 3EPIA 4MFAA 5HP4A 4PGQA 4JWMA 4NLGA 3JPOA 3BQ0A 4FS2A 3C5FA 4TUPA 1XS9D 4YD2A 5DKWA 2AGOA 2HHUA 1BVSA 2UVWA 3UXOA 8ICYA 1R8BA 4FHPA 3WFQE 1ZQVA 1RZTA 4G3IA 7ICGA 4PPXA 4DSIA 1KNYA 4PHEA 3M9MB 4TQSA 1ZQKA 2PFOA 1A76A 1ZQRA 3GIKA 1UT5A 1U47A 9ICHA 3V6JA 1Z3EB 1XSLA 2Q0ZX 2HHQA 3OJSA 1ZQMA 3GIMA 1ZYQA 4YVZA 3EZ5A 3RB0A 1R8AA 9ICNA 4B9UA 4ECTA 5KFYA 2BCVA 4F92B 4F4WA 2PI5A 8ICSA 4IG8A 3ORYA 2RFFA 4GC6A 5KFZA 2UVRA 1BPBA 4ZH4A 2NRVA 4AT9B 3V7KA 2HVIA 4KLMA 4I29A 2RDJA 3BQTA 5D49A 1BNOA 4KLUA 5J2KA 4EBEA 2IA6A 3ZDCA 4X4VA 1ZQBA 5KFRA 7ICJA 3RB6A 1QLNA 1T3NA 4DSLA 5KG7A 1NK8A 4FBUA 3JPPA 4IQTA 4DFKA 4RPXA 3Q8QB 4Z6FA 2XCAA 3MR6A 4DLGA 3K4GA 4EBDA 4YMOA 3RAXA 1C7YA 2FLPA 2W9CA 1MQ2A 4MF2A 1DOQA 4PHDA 5KFHA 5CWRA 4NLKA 5BOLA 4B9SA 4GLXA 3ISCA 2MUTB 1FA0A 3AQLA 4PH5A 3PO5A 4BXOA 4QWEA 2C2DA 4KLTA 3OGUA 4LZGA 3TANA 3SZ2A 1ZQEA 3JZ0A 1SKWA 1TAUA 4R64A 2BDPA 1X2IA 1XU4A 2VANA 4UAWA 5CJ7A 1TV9A 1U4BA 4O5CA 1SKSA 5KFAA 1KRPA 4QWBA 4M0AA 4DWIA 2BCSA 4UD4A 9ICUA 3EWAA 4DSEA 1K1SA 3QE9Y 3LQCB 4KLQA 4AT7B 4X4NA 2KFZA 3GFKB 4YMMA 2DRBA 2LYHA 4DF4A 4DSJA 4GXJA 4YXJA 3C2LA 4O3OA 4YCXA 1RYSA 2KTQA 4ECWA 8ICWA 3GV8B 4I2BA 8ICQA 2DR5A 4WC1A 4JK1A 5J2EA 4IR9A 4WC4A 2M2UA 4F4XA 1NK5A 2GWSA 1NK7A 1ZQAA 1KFDA 5KFFA 4MFCA 5KT3A 3ZDBA 2NRXA 1KSPA 2B21A 4O3NA 3BDPA 7ICPA 5DB6A 3GIJA 4F5OA 1NKBA 2KZZA 2ZH8A 5KFLA 4IRKA 1KDHA 4RQ5A 5L9XA 4J9OA 4F2SA 7ICNA 7ICVA 4WC2A 5J29A 4F2RA 8ICMA 3MGIA 3HIYA 4ELVA 4RQ6A 1UA1A 4YR0A 4MFFA 4O3RA 4WCWA 1X9WA 4GC7A 2F1IA 4UB5A 5DGBA 3T3FA 1LB2B 4ATBB 1LV5A 5CB1A 3RR7A 8ICEA 4C8OA 8ICLA 4I2GA 3M8SA 1XSPA 1ZQTA 1JXLA 3PX6A 4YMNA 2Y1JA 3KTQA 8ICFA 4KLLA 4ELTA 7ICUA 9ICKA 3RRGA 8ICKA 4X4RA 3H38A 4C8NA 2H5XA 3C21A 3PV8A 4F5NA 3TARA 2BPCA 1NK4A 4IQWA 7ICTA 2JZBB 4O9MA 3WFSC 5J0UA 5KFJA 5BPCA 3HW8A 4FBTA 1JQRA 5KG5A 1Z00A 2P6UA 3G6VA 3RJKA 3H7IA 3KHGA 1QSLA 4F8RA 4WC0A 1SKRA 2Q66A 4X4QA 2R8IA 3PMLA 4F50A 3KHHA 4ED8A 2DPIA 1PX5A 4BGDA 4ECZA 4NM1A 4YQWA 3N4MB 3AQKA 4O0IA 2DPJA 4JV0A 5KFPA 4BDPA 7ICHA 3C1YA 3HWTA 2ZH6A 1NO5A 3NYBA 4E80A 4UB2A 5CR0A 2ISOA 4I2AA 5J0QA 2DVIA 4I2CA 4QZBA 4DSKA 3MBYA 4YR3A 4DL3A 4M47A 4AT8B 1TK5A 3HJ4A 4UBBA 2PFQA 3RH4A 4TQRA 1ZQPA 5L1KA 2ZTCA 3MABA 1X9SA 9ICQA 3E2EA 3PR5B 3M9NB 4UB4A 3V7LA 1S76D 4FS1A 1U49A 4DL5A 1D9FA 5KFCA 4RU9A 2XGQA 2RDIA 2W9BA 2V4QA 4ED3A 1BPZA 3KHLA 1T7PA 4B9NA 2HHWA 1ZQXA 4X4SA 2J6TA 2HHVA 5J0OA 4UD5A 5DDMA 4EZ9A 5HMLA 3V6KA 1QSYA 4CCHA 5DECA 2P6RA 3MR5A 2MAXA 4YD1A 2FPLA 4UB1A 4QZDA 3C2MA 2ISPA 2M2VA 2A1JB 1MQ3A 4KLFA 8ICBA 7ICQA 4HYKA 2FMSA 4FHWA 2ASDA 4KLOA 4I2EA 5IILA 4X0AA 2NRZA 3B0YA 5KG6A 4ED1A 4M9HA 2M2TA 5DG8A 4M6WB 4RQ2A 4P4OA 4R66A 1SL0A 3TAPA 2BR0A 1D8LA 2M9NA 1YLQA 3OSPA 1JX4A 9ICSA 4DOAA 7ICKA 3H3AA 2BPGA 3K75D 4R8UB 1X9MA 8ICPA 4IQUA 3ZDEA 4Q8EA 2PI4A 1DGSA 2I9GA 1BNPA 2R8JA 1NKEA 1TK0A 3GIIA 1RXWA 1JAJA 3WFPA 4EBJA 1AROP 5JUMA 5KFNA 4DFJA 1K1QA 1NJZA 4O5KA 4RNMA 4ECRA 3ETLA 4BWJA 4RQ1A 3OVBA 2HHTA 2BCRA 4ECVA 4RQ7A 3EW9A 2C2RA 4B9VA 3JYYA 2ZH7A 1HJPA 4K4HA 3WFRE 1JMSA 1NOMA 5HNKA 3KHRA 3RH5A 2IHNA 3IHQB 2PFPA 1MSWD 4RQ8A 3H8WA 2P66A 2R8KA 4F91B 4JWNA 8ICZA 4RNOA 3TQ1A 5DG9A 4DLEA 2XC9A 1S0OA 4K4GA 4RZRA 3MGHA 4DOCA 2HHPA 4E7XA 2W9AA 4RUAA 4EZ6A 2O1PA 5J2DA 3RJJA 3TFSA 2ZJ5A 4PGXA 3ISDA 2PXIA 4F5RA 7ICIA 9ICIA 1L5UA 3IM1A 4DOBA 5KFBA 3AQNA 4Q43A 1TFWA 4Q8FA 3RH6A 1OU5A 3AU2A 2BQ3A 1ZETA 3HX0A 4QZIA 9ICCA 4DF8A 5HREA 5KFUA 5L1JA 4DQIA 1TKDA 3Q8RB 9ICLA 5HRGA 4YG2A 4M9NA 4KLDA 2UVUA 3C18A 1N48A 2XGPA 4JV2A 4FHYA 5KG1A 1PZNA 3H40A 1L3SA 4KLSA 4EBCA 1T4GA 2ZH4A 4RWNA 3UPSA 2MUTA 1JXEA 4UB3A 4RT2A 3N97B 4QZ9A 4QZAA 1ZQLA 2F1JA 2HW3A 3RBEA 3BQ2A 2W9CB 3MDCA 2O5AA 4RQ3A 2XY7A 5J0WA 2ATLA 2ALZA 4M9JA 1RYRA 5IIMA 5HRIA 1V9PA 4YN4A 4ECUA 4AT7A 3Q8MA 4ECSA 2BHNA 4O3QA 4RPZA 5HRHA 2NRKA 5KFWA 2W8LA 2ZH5A 5CP2A 5KTQA 4XQ7A 4J9KA 7ICSA 5KFXA 1ZQIA 3HJ1A 4RT3A 4MEYA 4NM2A 4QW9A 5IINA 4O3SA 4WC3A 5J2CA 4X0BA 4WC5A 4ECQA 2FLLA 4M9GA 1KLNA 2HHSA 2AU0A 4RQ0A 8ICGA 4F5QA 2I1QA 4I2JA 5IIOA 4IRCA 3RRHA 2C28A 1ZQCA 4WC7A 1F5AA 1ZQGA 5D4BA 5F9NA 2ZH1A 4DO9A 1D8YA 2F1HA 9ICEA 2BGWA 5HC9A 5KFQA 3PW4A 2JEIA 2XO7A 1WCLA 1L3TA 4NKUA 3BQ1A 4B9MA 7ICLA 4ATBA 1XO1A 9ICMA 3H4DA 1ZQZA 2HHXA 2W8KA 4X4TA 1UETA 5DB8A 2ZUDA 5IIKA 5D46A 1CUKA 4DFMA 9ICTA 5KFDA 4UQGA 4QZ8A 1ZJMA 4RPYA 8ICNA 5IIJA 3M9OB 3OHBA 4M5DA 2VA2A 3PVXA 4PGYA 3ZDAA 7ICEA 1BPEA 4TUSA 3JPQA 3SYZA 4KLHA 2JZBA 4ECXA 3GQCA 4EYIB 1B43A 1RXVA 4RQ4A 9ICWA 3GDXA 4DS4A 3HT3A 4J9PA 4FH5A 2BPFA 9ICRA 3OVAA 1R8CA 1UT8A 4ED6A 1S97A 3G6XA 3PY8A 3JPNA 1BPYA 1CEZA 4M04A 3NGDA 1ZQDA 2W9MA 5HMMA 3QEBZ 8ICUA 4DL6A 3Q8PB 3H8JA 3HP6A 4EYHB 1VFGA 9ICFA 5HRDA 4E8FA 4UAYA 1T8EA 3QEAZ 1UA0A 5HRKA 3C5GA 2C2EA 4R65A 1BPXA 9ICJA 4QWCA 1U9LA 4P4MA 4I28A 4GXIA 5KFIA 2PFNA 3PO4A 4FHXA 3QZ8A 3AUOA 3RJFA 2R8HA 3LDAA 1UEUA 1TK8A 4Z6DA 1SL2A 2IMWP 5KFKA 5KFEA 4K4IA 3T5JA 3HPOA 2ZH2A 4Q45A 9ICOA 3RJGA 3JPTA 5KFMA 4J9NA 3ISBA 2W9BB 4IRDA 2BE3A 3H39A 3T5KA 2A1JA 4I2FA 5L1LA 2ZHBA 5KG2A 4I27A 2KP7A 1XC9A 5HRFA 2XY6A 2FPMA 3OUYB 2ZUBA 2ZH9A 5DBAA 4EP7A 4KN7A 2V4RA 1ZQUA 1VJ7A 3C23A 4M9LA 5CA7A 4PHAA 3AQMA 2DR9A 5J2IA 3MDAA 2NRWA 3SV3A 5L1IA 4DL7A 4O3PA 5KT6A 5KT2A 7ICRA 5HRLA 3UQ2A 1ZQOA 3GV5B 4FHVA 3V72A 3TI0A 3TAQA 2FMQA 4XA5A 2C22A 9ICXA 1B22A 4YP3A 3C66A 1ZQWA 3T5LA 3GILA 4YXMA 3PNCA 5J2AA 2PBEA 5DGAA 5CHGA 4B9LA 4LVSA 2BQUA 1ZQNA 7ICMA 1ZQFA 2ID1A 2DR7A 3OVSA 3OSNA 5DLGA 5J0SA 4Q44A 3RTVA 5DB7A 3V6HA 3THVA 1DK3A 1L3VA 2JEFA 4AT9A 3RBDA 3T5HA 2DRAA 5EWEA 5J2BA 3NTUA 4RNNA 2XCPA 5HHIA 1COOA 4QZCA 4DQSA 2OWOA 4ELUA 2KFNA 3MR3A 2FPKA 3PW2A 4QZFA 3OV7A 2KN7A 1SL1A 4XRHA 1L3UA 1H38A 1ZQQA 4B9TA 4NY8A 1HUOA 2R8GA 1ZQSA 2FMPA 3PW7A 5EOZA 4BWMA 3AU6A 5F2VO 2ZUCA 3OHAA 4M2YA 3FYHA 2AQ0A 2AJQA 4C8MA 4KLIA 9ICVA 2M2WA 3SI8A 4XQ8A 1KFSA 1QSSA 1ZJNA 8ICRA 1UEVA 2WTFA 7ICOA 2ZHAA 2ZJ8A 1S0NA 2ASJA 3RB4A 4LZDA 2AGQA 1BGXT 1SZPA 4QWDA 4C8KA 4EBKA 2IHMA 3H4BA 1U45A 1XSNA 1V4AA 4EEYA 5J2HA 1S10A 4YR2A 4F3OA 1WCNA 2BCUA 4ED0A 5KG3A 4QZEA 5J2JA 1IM4A 5EWGA 3UXNA 4BXOB 5KG0A 3ZD8A 4NXZA 4UBCA 4WBZA 4DL2A 8ICTA 3PMNA 5J0RA 9ICGA 1NJXA 1R89A 4QZHA 5DQHA 4F4ZA 5DB9A 4RWQA 3Q8LA 8ICOA 3RR8A 5DQIA 5KFGA 4F4KA 8ICXA 4O5EA 1U48A 2DR8A 4X4UA 1HUZA 4X5VA 1MIYA 3EPGA 8ICIA 1NJYA 4KTQA 5TZVA 1S77D 1Q78A 5DBCA 1S0VA 5J2GA 5DLFA 8ICJA 1JIHA 1NZPA 4Z6CA 2BCQA 2FLNA 4WBYA 4RWPA 5F9LA 4S3NA 4DSFA 3SV4A 2BQRA 2KZ3A 2NRTA 5J0YA 3QZ7A 4KLJA 2KZMA 1MIVA 4F5PA 3RJHA 4NKTA 4UAZA 3BJYA 4F93B 3OJUA 5KT7A 3RJEA 4MF8A 8ICVA 4I2DA 4YFKA 3RJIA 4PHPA 4DQQA 3PW0A 4AT8A 4FH3A 1EXNA 1TFYA 3UXPA 2XY5A 5C5JA 9ICBA 4C8LA 2Y1IA 3H8SA 2IBKA 3LWLA 3G6YA 4J9MA 3V7JA 4NLZA 4X4OA 2ZH3A 1KFTA 4F4YA 3RB3A 4E0DA 4DEZA 1NK0A 4RWOA 1NJWA 4WC6A 2JEGA 4TURA 2UVVA 5J2FA 3L9DA 3LWMA 1ZQJA 1WOTA 2BKEA 4JUZA 1Z00B 4FO6A 2VA8A 3TFRA 1S9FA 1QTMA 3B0XA 9ICAA 3MR2A 1NKCA 4DL4A 1S0MA 1DK2A 1Q79A 1XWLA 1JN3A 4QW8A 3PW5A 4DQRA 3PR4A 1ZQYA 3LK9A 4J9QA 4KN4A 5KT4A 5DBBA 4ED7A 3EYZA 4R63A 3C1ZA 3MFIA 3PX4A 8ICCA 3M8RA 3UPQA 2AGPA 1KTQA 5HR9A 5DG7A 5DEDA 3GV7B 4MEXA 3H37A 5HHHA 1BPDA 1A77A 3Q8SB 3MFHA 5KT5A 2ASLA 4RUCA 8ICHA 2ZTEA 1IXRA 2ZJAA 1RPLA 5J0XA 4J9SA 3UQ0A 4LT6A 4I2HA 5DQGA 3JPSA 4J9LA 4DS5A 4I2IA 4J9RA 1Y88A 3FDSA 5IIIA 2V9WA 4NLNA 9ICPA 3C2KA 3ZDDA 1KEJA 3JPRA 5HRBA 1ZQHA 1MIWA 4DQPA 1TVAA 7ICFA 4ECYA 2DFLA 4GXKA 1TFRA 5KFSA 3PX0A 4QWAA 5J0PA 5KFTA 3ZD9A 5KFOA 4QZGA 2JEJA 4KITB 3Q8KA 1MC8A 4M6WA 4KMUA 4ED2A 4TUQA 5J0TA
chains in the Genus database with same CATH superfamily
5DDYA 4P2HA 2J6UA 5CFUA 4P4PA 5EWFA 8ICAA 4IR1A 1VDVA 4MFAA 3GU3A 4NL9A 1XS9D 4FHPA 2MSNA 2ZIVB 2KHVA 3M9MB 2KE7A 1ZQKA 2PFOA 2QLTA 1UT5A 3NVOA 1IG6A 2Q0ZX 5KL1B 3OJSA 1ZYQA 9ICNA 4B9UA 2NO4A 4ECTA 3NVWA 2RFFA 2UVRA 4NWIA 4WQLA 2NRVA 3V7KA 3BQTA 5J2KA 2IA6A 5KFRA 4LEVA 3I76A 2QKQA 4FBUA 3JPPA 3CK6A 4Z6FA 1DGJA 4XJEA 3K4GA 4MF2A 1DOQA 4NLKA 4B9SA 4GLXA 1FA0A 4PH5A 3PO5A 4QWEA 2RP5A 3JZ0A 3TANA 1TAUA 4R64A 2ZH5A 4EV6A 5CJ7A 4US8A 4DWIA 4OJPA 4AT7B 2K4IA 3QE9Y 3LQCB 2KFZA 3QX7A 3ETRA 4DF4A 4DSJA 3C2LA 8ICQA 4WC4A 5J2EA 4F4XA 1NK5A 1NK7A 5KFFA 3ZI4A 3QU2A 3GIJA 4IRKA 1KDHA 1QQ5A 4F2SA 4WC2A 2OCEA 4F2RA 3MGIA 2B4VA 4MFFA 5DGBA 1LV5A 4C7YA 5CB1A 1ZQTA 2BZFA 3PX6A 4AT8B 4JLXA 2ZIWB 3RRGA 4UATA 1OUQA 3C21A 3PV8A 4F5NA 1NK4A 2BPCA 3BQ7A 2P6UA 2JMGA 1FIQA 1SB3C 4Y2YA 4NLBA 2B6GA 4EEKA 4O0IA 2DPJA 4U7CA 2W11A 2KV2A 2YTUA 4UB2A 3D2SA 4I2AA 4CF4A 4QZBA 3MBYA 4YR3A 1TK5A 5ALEA 1J2NA 3BS5A 3E2EA 3PR5B 3M9NB 4I0UA 4DL5A 5KFCA 2HHWA 4NJ8A 1T7PA 1ZQXA 1F5SA 2J6TA 2HHVA 5J0OA 3MCRA 4EZ9A 1QSYA 3MR5A 2MAXA 1L7NA 2JV3A 4UB1A 2A1JB 4KLFA 8ICBA 4FHWA 4HYKA 3F5AA 3K1ZA 2NRZA 4M9HA 4M6WB 2BR0A 1YLQA 2I6XA 1JX4A 9ICSA 3K75D 8ICPA 4Q8EA 3KBBA 1DGSA 1BNPA 1RXWA 1AROP 2E1EA 4DFJA 1K1QA 3HRDD 3U26A 2HHTA 2BCRA 4RQ7A 3EW9A 3JYYA 1X40A 2KIWA 1MSWD 3WFRE 3S6JA 2PFPA 5GTHU 3H8WA 4RQ8A 3WK4A 4F91B 8ICZA 4CE6A 3QYPA 2XC9A 4K4GA 4UW9A 3NRZA 2O1PA 4F5RA 3O0FA 4DOBA 4K9AA 1TFWA 4Q8FA 1ZETA 3QUQA 3VCBA 2E8MA 4QZIA 9ICCA 4DF8A 5HREA 5KFUA 5L1JA 4Y2PA 9ICLA 4WH5A 3WKAA 3WK7A 2DUYA 4JV2A 5KG1A 4K96A 1PZNA 5CFSA 4EBCA 2ZH4A 3UPSA 2VJ5A 4LEWA 4QZAA 1ZQLA 2F1JA 2O5AA 2W9CB 2JH1A 2YQEA 5IIMA 4ECUA 4AT7A 5A0LA 2QB0A 5KFWA 2Q4TA 4XQ7A 7ICSA 5KFXA 2KHQA 5J2CA 4ECQA 2FLLA 1TE2A 8ICGA 2I1QA 4WC7A 1F5AA 5F9NA 2ZH1A 9ICEA 2BGWA 3PW4A 2JEIA 1WCLA 4NV0A 9ICMA 1PVQA 1UETA 2K8CB 2ZUDA 1FFUA 2XVTA 2HMXA 2YN4A 5KFDA 4QZ8A 4RPYA 2HBLA 3H0MB 3ZDAA 7ICEA 2YMQA 3KKAC 2WHEA 4WJ3B 1B43A 2IUBA 3GDXA 4DS4A 1QQ6A 4FH5A 5T14A 2BPFA 5D61A 2BBJA 1S97A 4BUGA 4CF5A 4RQMA 3QEBZ 1X9XA 1VFGA 3WK6A 1T8EA 3QEAZ 2XICA 1UA0A 4R65A 1BPXA 1HIWA 1U9LA 4I28A 2GA9D 5KFIA 4QJFB 4HAIA 4Z6DA 5JRTA 3ED5A 3HPOA 3T5JA 2EAPA 9ICOA 2KJ9A 4IRDA 3H39A 2A1JA 5L1LA 2Y9TA 1L8OA 1XC9A 3PSTA 2CN1A 1VJ7A 3C23A 4M9LA 2DR9A 5J2IA 5ALNA 5CRXA 4O3PA 3UQ2A 4O68A 2KIVA 3V72A 2HCFA 5AM4A 4YP3A 3WKCA 3T5LA 4YXMA 5J2AA 4KMOB 4B9LA 4NXTA 7ICMA 3OVSA 3T5HA 2DRAA 5HHIA 4QZCA 2OWOA 2KFNA 4UB6U 3OV7A 4B9TA 1ZQQA 4NY8A 1ZQSA 2FMPA 5F2VO 3OHAA 4M2YA 4C8MA 3HILA 3SI8A 2JXJA 1QSSA 4Y2XA 1UEVA 2WTFA 2ZHAA 2ASJA 2AGQA 1SZPA 2DBYA 1KN5A 2MA1A 4ED0A 4QZEA 3DDHA 5AICA 3UXNA 5G5HA 1QH9A 2DWQA 2I5HA 4UBCA 4WBZA 1JUDA 5DQHA 2KD1A 1XNSA 8ICOA 8ICXA 4O5EA 5B3PA 4KTQA 1S0VA 2ESEA 4NL9C 5J2GA 5JU5A 5ALPA 2BCQA 2AXTU 4QNLA 4WBYA 4RWPA 4S3NA 1Z4OA 4LJXA 2NRTA 4KLJA 1MIVA 4F5PA 2WF8A 1WG8A 3OJUA 5KT7A 4MF8A 2ZG6A 1SIJA 2F8LA 4JMUA 3T79A 4PHPA 4DQQA 5C5JA 1FFVA 4NLZA 5FP0A 4J9MA 4C4TA 2KOBA 3HKZF 2ZIXA 4P0QB 4F4YA 2KG5A 1NK0A 4WC6A 1NJWA 2EAOA 1X6JA 2UVVA 1GPJA 2BKEA 4JUZA 1Z00B 3TFRA 1DK2A 1XWLA 1JN3A 1ZQYA 5DBBA 4R63A 3C1ZA 8ICCA 3UPQA 4O6AA 5DEDA 5B66U 3GV7B 1V38A 3NASA 3MFHA 5HHHA 2ASLA 1KL9A 2ZTEA 1A0PA 1LKYB 2WFAA 3AN1A 4DS5A 9ICPA 3ZDDA 2F8KA 1ZQHA 2E8PA 3ZD9A 4KITB 1JALA 2AH5A 2J6SA 2NO5A 4OAIZ 2ZTDA 4IQVA 2HVHA 3KZIU 3MC1A 4DFPA 4XUSA 2VA3A 4KLEA 3RAQA 2PKEA 5HP4A 4PGQA 4NLGA 1OW5A 3C5FA 4TUPA 5DKWA 2UVWA 1R8BA 4G3IA 7ICGA 4TQSA 1PVRA 2YB1A 3H0RB 1ZQRA 1U47A 1Z3EB 1F0MA 2D8CA 5AM2A 2KJ8A 3RB0A 2G09A 4C80A 2HBJA 5KFYA 4F4WA 3ICXA 3ORYA 4GC6A 5AKIA 1BPBA 4AT9B 4I29A 4EBEA 3ZDCA 4X4VA 7ICJA 3L3FX 1UPHA 1COKA 1Z4NA 1NK8A 2E8NA 4IQTA 3Q8QB 3MR6A 3RAXA 2XCAA 1C7YA 1L7OA 4PHDA 5CWRA 2F3NA 2MUTB 2C2DA 3OGUA 1ZQEA 2RQ5A 1N61A 4O5CA 2VANA 1TV9A 5ALXA 2NYVA 2BCSA 2DQNB 1K1SA 4KLQA 4X4NA 4YMMA 2LYHA 1L8LA 4YXJA 4GXJA 4O3OA 4I2BA 2DR5A 4WC1A 4JK1A 4IR9A 2M2UA 3N7PD 4MFCA 2NRXA 3QXGA 5DB6A 4F5OA 2G5HB 7ICVA 4RQ5A 4J9OA 5J29A 3HIYA 8ICMA 4YR0A 4O3RA 4ATBB 1X9WA 4GC7A 1Z1BA 2EZZA 3QNMA 8ICLA 3M8SA 1XSPA 4P0QA 3WK9A 2Y1JA 9ICKA 3KTQA 7ICUA 2JGAA 5J8YA 2WF5A 2JZBB 2Y9UA 4O9MA 5ALHA 5J0UA 3HW8A 3WFSC 1Z00A 3RJKA 3H7IA 4WC0A 2R8IA 4BGDA 2W3RA 7ICHA 1J2MA 3HWTA 3NYBA 2ISOA 3EF2A 4I2CA 4DL3A 4M47A 3HJ4A 4UBBA 2PFQA 5AKGA 3NUQA 5D62A 9ICQA 1LKYA 2FDRA 2KVSA 3IN5A 2B0CA 4AYBC 3WK5A 4RU9A 2RDIA 4B9NA 2V4QA 1BPZA 5ALTA 1SGGA 1HEKA 5HMLA 4CCHA 2P6RA 4ICAA 3JCFA 1CRXA 2FPLA 2LHTA 2M2VA 2VJ4A 1MQ3A 2Y0SF 4I2EA 5IILA 2YMMA 5KG6A 1D8LA 4C7ZA 2BPGA 4R8UB 1X9MA 2HDOA 4EBJA 1A6SA 3TADA 3ETLA 4BWJA 1JI7A 4RQ1A 4ECVA 4JB3A 1HJPA 2FJ6A 5ALOA 1NOMA 5HNKA 3KHRA 3D6JA 4Y2QA 4HX0A 4RNOA 4A8EA 3AL0B 4Y2VA 3MGHA 4DOCA 1ZRNA 2W9AA 1N63A 3RJJA 5KAIU 2ZJ5A 2PXIA 7ICIA 9ICIA 2A3VA 3SMVA 5L1MA 3AU2A 3HX0A 3OTQA 2N1RA 2HOFA 4KX5A 5EE9A 4YG2A 2ZIUB 4M9NA 2XGPA 4FHYA 4KLSA 1T4GA 2MUTA 1JXEA 1ED1A 4GFJA 4P0PB 2EAMA 2HW3A 3BQ2A 4OJ5A 2ALZA 4PL2A 5HRIA 4YN4A 3Q8MA 3KFUF 2BHNA 4O3QA 4RPZA 5HRHA 3UMBA 5KTQA 4J9KA 4WC3A 4QW9A 5AI8A 5K4LA 1KLNA 5CEHA 1N2XA 3RRHA 2C28A 1ZQGA 2M0NA 3C29A 4DO9A 2R18A 5HC9A 5KFQA 3NRWA 3BQ1A 4ATBA 3H4DA 2W8KA 2KVCA 1CUKA 9ICTA 2A1AA 3I28A 1ZJMA 4UQGA 2CXYA 2IOFK 2W03A 4M5DA 2WAQC 2QB1A 1SV4A 2JZBA 2JR5A 4RQ4A 9ICWA 4K99A 2B56A 2VKQA 2GLEA 5ALYA 3G6XA 4O3MA 1ZQDA 2E3TA 1Q3UA 1M6YA 4DL6A 1QCKA 3H8JA 4EYHB 5HRDA 4CGZA 4UAYA 1RYUA 5HRKA 2C2EA 3NWIA 4EX6A 4P4MA 2G08A 3NVZA 3QZ8A 3RJFA 2ZXHA 3FAHA 5KFEA 4K4IA 2ZH2A 4Q45A 4K8VA 2OHFA 5ALIA 5KFMA 3LVVA 3ISBA 2W9BB 4I2FA 2ZHBA 2FPMA 2XIDA 3OUYB 1J97A 2V4RA 1ZQUA 3AQMA 5CA7A 5AM3A 4Y2RA 2ZIVA 4CNQA 1IIPA 5KT2A 7ICRA 5HRLA 1ZQOA 3GV5B 2WB1F 3TI0A 3M6ZA 4XA5A 1B22A 3CYMA 1PK1B 2GAFD 4N7RA 3PNCA 5KAFU 2PBEA 5CHGA 4LVSA 2BQUA 2ID1A 3OSNA 2HI0A 3RTVA 1DK3A 2P35A 5DB7A 3THVA 2JEFA 5EWEA 4RNNA 3NTUA 1COOA 3PW2A 4FZMA 4QZFA 4OAHA 2KN7A 1SL1A 3F2CA 4XRHA 1ECWA 3PW7A 4Y2SA 2ZUCA 2AJQA 4KLIA 9ICVA 3A0HU 4XQ8A 2H3ZA 1ZJNA 1BGXT 3AQFA 4EBKA 4OAGA 3H4BA 1U45A 5ALQA 1AQ6A 2EH9A 5KG3A 5J2JA 4P0PA 3BZKA 3RR8A 5DQIA 5KFGA 1WYGA 1U48A 2DR8A 1MIYA 2IHOA 5TZVA 5DLFA 4Z6CA 2PMZF 2K89A 5F9LA 3SV4A 5E79U 3QZ7A 1NNLA 2YMPA 2KICA 4F93B 1SZHA 4AT8A 1EXNA 2ZIWA 1SWWA 2Y1IA 2O6KA 3LWLA 2WF9A 3C28A 3RB3A 4E0DA 4RWOA 4TURA 3L9DA 5J2FA 3LWMA 2JRZA 1WOTA 4DFDA 4FO6A 1QTMA 2VA8A 3B0XA 1OXJA 3SD7A 4DQRA 4J9QA 2K8AA 1B4FA 5ALRA 5KT4A 4KM5A 3MFIA 3PX4A 3N28A 2AGPA 1KTQA 5HR9A 3L4PA 1V85A 3H37A 2HN1A 1BPDA 4K97A 3UQ0A 5J0XA 5ALKA 4Y2JA 4J9LA 1VJ5A 3FDSA 4K98A 1KEJA 5EE1A 1MIWA 4DQPA 3PX0A 1TFRA 5KFTA 2JEJA 5KFOA 1V97A 1MC8A 4M6WA 4KMUA 4ED2A 4U6PA 1N56A 3WFOA 2G07A 3OUYA 4Z6EA 1NK9A 1NK6A 4IC9A 4KLGA 5KFVA 1D9DA 5BOMA 5KG4A 4JWMA 4FZNA 3JPOA 3BQ0A 4FS2A 1L6NA 4YD2A 2LYBA 1BVSA 5EE3A 3UXOA 2HHUA 8ICYA 3WFQE 5J8YC 2EZYA 1PK1A 4PPXA 1KNYA 2LBOA 4PHEA 2DKZA 1UHUA 2BDUA 3V6JA 1XSLA 1ZQMA 3GIMA 1S8OA 4YVZA 1R8AA 2MU2A 4GIBA 8ICSA 5KFZA 3RF9A 4ZH4A 3TACB 5KNIA 2HVIA 1SWVA 4KLMA 3WKBA 2RDJA 3AMZA 1L7PA 4OO1J 1ZQBA 3K1RB 2KKVA 1QLNA 2GH1A 4DSLA 2G0AA 2LPEA 4MKPA 4DFKA 4RPXA 4DLGA 1YZ6A 7ICLA 2ES6A 2W9CA 1MQ2A 5AI0A 5KFHA 3BS7A 4OJOA 1SKWA 1X2IA 2VIXA 1U4BA 1XO0A 4UD4A 1VLBA 3EWAA 3CNHA 2F44A 3GFKB 2DRBA 1RYSA 4YCXA 4ECWA 3GV8B 3LYSA 3IV6A 3F2BA 1ZQAA 1KFDA 3TADC 5KT3A 2KMDA 3ZDBA 5AI9A 2OXOA 2KZZA 2ZH8A 5L9XA 4ELVA 1UA1A 3H8MA 4UB5A 3F5EA 3RR7A 8ICEA 4C8OA 3NVVA 1JXLA 4KLLA 4ELTA 4J03A 4X4RA 8ICKA 3H38A 1MN8A 4KB6A 3TARA 7ICTA 5BPCA 5KFJA 4QIWC 2H3VA 3UM9A 1ZOLA 2LKYA 4F8RA 1SKRA 1K5OA 5AKZA 1PX5A 1UCVA 4ECZA 3AQKA 4BDPA 4JV0A 2ZH6A 5AKXA 5CR0A 5J0QA 5D63A 3WKDA 4DSKA 2HSZA 1N5XA 3SQIA 2ZTCA 3MABA 5AI5A 1X9SA 2K8BB 2ODGA 4LEZA 3V7LA 4FS1A 1U49A 2XGQA 5ALSA 5CHEA 4YD1A 3FC4A 4QZDA 3EUB2 7ICQA 2FMSA 3QU5A 2ASDA 4KLOA 2HOQA 3B0YA 4ED1A 5DG8A 1SL0A 4P4OA 4R66A 3TAPA 3OSPA 3CW2C 4IQUA 3ZDEA 1N5WA 2I9GA 5EE0A 2R8JA 1NKEA 1TK0A 1RM6C 4CRXA 5JUMA 4O5KA 3E0FA 2JH7A 1NJZA 4RNMA 5CFTA 5H2FU 1CI4A 2C2RA 4B9VA 2ZH7A 2YX8A 1NZBA 3B9JA 2RHFA 1JMSA 4C0ZA 3RH5A 3TQ1A 4DLEA 1S0OA 2FI1A 2HHPA 4E7XA 2XI9A 4RUAA 3TFSA 4PGXA 3ISDA 1L5UA 3IM1A 4FFDA 1OU5A 2BQ3A 4IL6U 2GO7A 5HRGA 4KLDA 1N48A 5B5EU 1WUDA 1X66A 3KD3A 4QZ9A 2F77X 4NXXA 3MDCA 2K60A 4RQ3A 2L5YA 2XY7A 2ATLA 2IOFA 4M9JA 1RYRA 1V9PA 2DF4B 3FM9A 1RDFA 5AI4A 1O08A 2W8LA 5AKJA 3SAHA 1ZQIA 3HJ1A 5IINA 3QU9A 3GZFA 3VC8A 4M9GA 5AKLA 2LI6A 4RQ0A 4I2JA 4IRCA 5IIOA 1ZQCA 5D4BA 4ZOHC 5G5GA 1ZRMA 2D3DA 1D8YA 1C20A 4NKUA 4CF3A 5DB8A 5IIKA 5D46A 8ICNA 3OHBA 3PVXA 1BPEA 4TUSA 3JPQA 4KLHA 4EYIB 4FZLA 1RXVA 3SAFA 3HT3A 4J9PA 2EQYA 3OVAA 1R8CA 2F76X 4UAVA 2HN2A 2E1FA 1RQNA 2W9MA 5HMMA 2E8OA 3HP6A 9ICFA 1O03A 3WU2U 3C5GA 9ICJA 3SEIA 3PO4A 2PFNA 1YT3A 3AUOA 4NXVA 5AM5A 1TK8A 2K4PA 1SL2A 3RJGA 3JPTA 4J9NA 3T5KA 5KG2A 2KP7A 2XY6A 2ZUBA 5ALFA 2ZH9A 5DBAA 2LM1A 4EP7A 4PHAA 1ZD4A 5KT6A 2KNJA 2KSOB 3TAQA 1ZD3A 2WF7A 2OH2A 5DGAA 3DV9A 2K4EA 2DR7A 4IS7A 4LEYA 2H3QA 5DLGA 4Q44A 4AT9A 2WF6A 1ZD5A 3RBDA 4DQSA 5J2BA 2XCPA 4OAFA 3K7DA 4EENA 2FPKA 2RRDA 2DL0A 1H38A 2R8GA 1Z1VA 3AU6A 2OM6A 5TISU 2AQ0A 3BZCA 5ALGA 5AM0A 1X42A 1KFSA 2ZJ8A 3AM9A 1S0NA 3RB4A 1FEZA 4C8KA 4QWDA 3HJEA 1V4AA 4EEYA 5J2HA 1S10A 1WCNA 4OD0A 2G5IB 1IM4A 3E58A 4BXOB 5KG0A 3ZD8A 3AEVA 2EANA 4DL2A 9ICGA 3PMNA 1NJXA 4RWQA 1MA7A 1T94A 5F3XB 3ER9B 3UMCA 1HUZA 3EPGA 2H3IA 1S77D 3PSFA 3QUCA 2FLNA 4EGWA 2QB0B 2BQRA 2KZ3A 5J0YA 4F71A 4UAZA 3BJYA 4WQKA 4NXUA 3RJEA 4YFKA 3RJIA 3PW0A 3PZPA 4FH3A 4NXWA 9ICBA 1SV0A 4OCZA 4EEDA 2IBKA 3G6YA 3V7JA 4X4OA 2ZH3A 3N7SC 4DEZA 2JEGA 1ZXIA 1ZQJA 2JHDA 4DCCA 5AIBA 2DKXA 9ICAA 1NKCA 4DL4A 1Q79A 3LK9A 2YMLA 4KN4A 4ED7A 2BBHA 3EYZA 3L5KA 1SXEA 1A77A 5ALUA 5KT5A 5AK6A 4RUCA 4EEBA 1Q46A 4J9SA 1RPLA 4LT6A 4I2IA 4J9RA 1Y88A 4FHVA 5IIIA 3C2KA 5HRBA 3JPRA 2DFLA 4GXKA 5KFSA 4QWAA 2IOHA 3Q8KA 4PZNA 4TUQA 5J0TA 4JV1A 5HR7A 1TAMA 1TAQA 4X4PA 3N7RC 4R8UA 2EDUA 2AQ4A 2HBKA 3EPIA 1NI3A 2KSOA 2AGOA 5ALMA 3ALRA 3SR6A 4CDGA 1ZQVA 1RZTA 5JTGA 4DSIA 1A76A 9ICHA 3GIKA 3MGVA 2LM4A 2HHQA 3EZ5A 2BCVA 4F92B 2PI5A 3NS1A 2Y0SC 1BNOA 5D49A 4KLUA 2ZIUA 3RB6A 2W3SA 1T3NA 5KG7A 3F53A 1KBUA 3ONNA 5AIAA 4IG8A 4EBDA 4YMOA 2FLPA 5BOLA 3ISCA 3AQLA 4WOYA 2KKPA 3QU7A 4ACOA 4BXOA 4KLTA 2MRLA 4UB8U 4LZGA 3SZ2A 4UASA 2FCLA 2BDPA 1XU4A 4UAWA 1SKSA 5KFAA 1KRPA 1YZ7A 4QWBA 4M0AA 9ICUA 4DSEA 3NKUA 3LVWA 4K9BA 1WWVA 4C4SA 2KTQA 8ICWA 4QIWF 2A19A 3QU4A 5AHXA 2GWSA 1F44A 1RQLA 1KSPA 2LMRA 2B21A 3D2QA 4O3NA 3BDPA 7ICPA 1NKBA 5KFLA 7ICNA 4RQ6A 4WCWA 1LB2B 2F1IA 3T3FA 2E5SA 3QUBA 4I2GA 1FO4A 8ICFA 4YMNA 4C8NA 2H5XA 1IV8A 4IQWA 2ZIXB 4FBTA 1JQRA 3IG8A 5KG5A 4FE3A 4Y2UA 3G6VA 3KHGA 2Q66A 1QSLA 5B3QA 4X4QA 3PMLA 4F50A 3KHHA 4ED8A 2DPIA 4NM1A 4YQWA 3N4MB 5KFPA 3C1YA 1NO5A 4E80A 2B51A 2DVIA 2LYAA 4PZOA 3RH4A 4O69A 4TQRA 1ZQPA 5L1KA 4UB4A 1S76D 2OEHA 1ZD2P 1D9FA 1KKXA 2W9BA 4ED3A 3KHLA 4X4SA 4UD5A 5DDMA 1JROA 3V6KA 1B0XA 5DECA 3SENA 3C2MA 2ISPA 4B6JA 3PHZA 1GO3F 2Z7JA 5C0YA 1Q8KA 4X0AA 2M2TA 4RQ2A 4USAA 2M9NA 4C4RA 5ALWA 4DOAA 7ICKA 3H3AA 5AKKA 2PI4A 5AKHA 4PL1A 3GIIA 3WFPA 1JAJA 2ZXIA 5KFNA 4ECRA 3OVBA 3RFAA 4RQNA 2AHOB 4K4HA 2IHNA 3IHQB 2P66A 2R8KA 4JWNA 5DG9A 4RZRA 4US9A 2D6FC 4EZ6A 5J2DA 2KEYA 2W55A 5ALDA 5KFBA 3AQNA 4Q43A 2W54A 3RH6A 1PK3A 4DQIA 1TKDA 3Q8RB 4NLCA 2YB4A 2UVUA 2WB1C 4KX3A 3C18A 3IP4B 3H40A 1L3SA 5GTIU 4RWNA 1L7MA 4UB3A 4RT2A 3N97B 1DXSA 3RBEA 1N62A 3AQEA 5J0WA 5KL8B 1Q3VA 4AP9A 4ECSA 3KOOA 1KQQA 2NRKA 5CP2A 4JLZA 1Z19A 5AK5A 4BJQA 4MEYA 4NM2A 2W04A 4RT3A 2W7OA 4O3SA 3R9KA 4X0BA 4OJLA 4WC5A 2HHSA 2AU0A 4F5QA 4PJ0U 3H0LB 2G06A 2CPRA 1N60A 3NVYA 1URJA 3KZXA 2W43A 2F1HA 1PUZA 2XO7A 1L3TA 4B9MA 1XO1A 2HHXA 1ZQZA 4X4TA 3QUTA 4AYBF 5AK4A 4DFMA 3CRXA 5HR6A 3M6KA 5IIJA 3M9OB 5JTIA 2VA2A 4PGYA 3SYZA 3IG5A 5AKEA 4ECXA 3GQCA 4F72A 4FO1A 9ICRA 1LVHA 2PMZC 1QQ7A 1UT8A 4ED6A 3PY8A 1UQVA 3JPNA 1BPYA 1CEZA 4M04A 3NGDA 8ICUA 2QARB 3PSIA 3Q8PB 2YY6A 3ERCC 4E8FA 3TKAA 4UAUA 4QWCA 4OJ6A 5AI6A 2FE9A 2EZXA 3OPXA 4GXIA 4FHXA 2R8HA 3LDAA 1UEUA 2OYYA 2IMWP 5KFKA 2HOIA 2BE3A 2HBMA 3ER8C 2W7PA 4I27A 5HRFA 1JRPA 3PSPA 3M1YA 4KN7A 5ALVA 3MDAA 2NRWA 1SV0C 3SV3A 5L1IA 4DL7A 5AK3A 2FMQA 4EX7A 2C22A 9ICXA 3C66A 1ZQWA 5AKYA 3GILA 1ZQNA 1ZQFA 5ALLA 5J0SA 3V6HA 1X6IA 1L3VA 1WWUA 4ELUA 3MR3A 2H3FA 1L3UA 1HUOA 5EOZA 4BWMA 3WK8A 3FYHA 4EELA 3KKAA 2M2WA 1RG6A 3DEEA 4Y2TA 1KW4A 8ICRA 7ICOA 3CP8A 2K4HA 4BX9C 4LZDA 2IHMA 1DRGA 1XSNA 4YR2A 4F3OA 2BCUA 3UMGA 5EWGA 4MHVA 4NXZA 8ICTA 5J0RA 1R89A 4QZHA 4F4ZA 1PVPA 2WAQF 5DB9A 3Q8LA 4F4KA 4X4UA 3WKEA 1Q78A 4X5VA 3D2NA 1NJYA 8ICIA 5DBCA 8ICJA 1NZPA 1JIHA 2F2AB 3IDWA 4DSFA 2KZMA 4O67A 3RJHA 4NKTA 8ICVA 4I2DA 3J81j 1P7DA 3M7DA 1TFYA 3UXPA 2XY5A 4C8LA 1SXDA 3H8SA 2GOLA 3A0BU 1KFTA 1T3QA 2CRXA 3SAGA 2NV3A 2RLTA 1S5LU 2KJ5A 2EWRA 1S9FA 2DGZA 3MR2A 1S0MA 3IRUA 4QW8A 3PW5A 3PR4A 1D8BA 3F2DA 4G9BA 5ALJA 3M8RA 2QARA 5DG7A 4MEXA 3Q8SB 8ICHA 5ALZA 2KK0A 1IXRA 2ZJAA 3I1YA 3HKZC 4I2HA 5DQGA 3JPSA 3BS5B 3OWGA 1ZQ1C 2V9WA 4NLNA 1TVAA 7ICFA 4ECYA 5J0PA 4UARA 4QZGA 5AM1A
chains in the Genus database with same CATH topology
1N56A 5DDYA 2J6SA 4JV1A 4P2HA 3WFOA 2J6UA 1TAQA 2ZTDA 4X4PA 3OUYA 4IQVA 4Z6EA 4P4PA 2HVHA 4R8UA 1NK9A 5EWFA 1NK6A 4KLGA 4IR1A 8ICAA 4DFPA 5KFVA 2AQ4A 1D9DA 4XUSA 5BOMA 2VA3A 5KG4A 4KLEA 3RAQA 3EPIA 4MFAA 5HP4A 4PGQA 4JWMA 4NLGA 3JPOA 3BQ0A 4FS2A 3C5FA 4TUPA 1XS9D 4YD2A 5DKWA 2AGOA 2HHUA 1BVSA 2UVWA 3UXOA 8ICYA 1R8BA 4FHPA 3WFQE 1ZQVA 1RZTA 4G3IA 7ICGA 4PPXA 4DSIA 1KNYA 4PHEA 3M9MB 4TQSA 1ZQKA 2PFOA 1A76A 1ZQRA 3GIKA 1UT5A 1U47A 9ICHA 3V6JA 1Z3EB 1XSLA 2Q0ZX 2HHQA 3OJSA 1ZQMA 3GIMA 1ZYQA 4YVZA 3EZ5A 3RB0A 1R8AA 9ICNA 4B9UA 4ECTA 5KFYA 2BCVA 4F92B 4F4WA 2PI5A 8ICSA 4IG8A 3ORYA 2RFFA 4GC6A 5KFZA 2UVRA 1BPBA 4ZH4A 2NRVA 4AT9B 3V7KA 2HVIA 4KLMA 4I29A 2RDJA 3BQTA 5D49A 1BNOA 4KLUA 5J2KA 4EBEA 2IA6A 3ZDCA 4X4VA 1ZQBA 5KFRA 7ICJA 3RB6A 1QLNA 1T3NA 4DSLA 5KG7A 1NK8A 4FBUA 3JPPA 4IQTA 4DFKA 4RPXA 3Q8QB 4Z6FA 2XCAA 3MR6A 4DLGA 3K4GA 4EBDA 4YMOA 3RAXA 1C7YA 2FLPA 2W9CA 1MQ2A 4MF2A 1DOQA 4PHDA 5KFHA 5CWRA 4NLKA 5BOLA 4B9SA 4GLXA 3ISCA 2MUTB 1FA0A 3AQLA 4PH5A 3PO5A 4BXOA 4QWEA 2C2DA 4KLTA 3OGUA 4LZGA 3TANA 3SZ2A 1ZQEA 3JZ0A 1SKWA 1TAUA 4R64A 2BDPA 1X2IA 1XU4A 2VANA 4UAWA 5CJ7A 1TV9A 1U4BA 4O5CA 1SKSA 5KFAA 1KRPA 4QWBA 4M0AA 4DWIA 2BCSA 4UD4A 9ICUA 3EWAA 4DSEA 1K1SA 3QE9Y 3LQCB 4KLQA 4AT7B 4X4NA 2KFZA 3GFKB 4YMMA 2DRBA 2LYHA 4DF4A 4DSJA 4GXJA 4YXJA 3C2LA 4O3OA 4YCXA 1RYSA 2KTQA 4ECWA 8ICWA 3GV8B 4I2BA 8ICQA 2DR5A 4WC1A 4JK1A 5J2EA 4IR9A 4WC4A 2M2UA 4F4XA 1NK5A 2GWSA 1NK7A 1ZQAA 1KFDA 5KFFA 4MFCA 5KT3A 3ZDBA 2NRXA 1KSPA 2B21A 4O3NA 3BDPA 7ICPA 5DB6A 3GIJA 4F5OA 1NKBA 2KZZA 2ZH8A 5KFLA 4IRKA 1KDHA 4RQ5A 5L9XA 4J9OA 4F2SA 7ICNA 7ICVA 4WC2A 5J29A 4F2RA 8ICMA 3MGIA 3HIYA 4ELVA 4RQ6A 1UA1A 4YR0A 4MFFA 4O3RA 4WCWA 1X9WA 4GC7A 2F1IA 4UB5A 5DGBA 3T3FA 1LB2B 4ATBB 1LV5A 5CB1A 3RR7A 8ICEA 4C8OA 8ICLA 4I2GA 3M8SA 1XSPA 1ZQTA 1JXLA 3PX6A 4YMNA 2Y1JA 3KTQA 8ICFA 4KLLA 4ELTA 7ICUA 9ICKA 3RRGA 8ICKA 4X4RA 3H38A 4C8NA 2H5XA 3C21A 3PV8A 4F5NA 3TARA 2BPCA 1NK4A 4IQWA 7ICTA 2JZBB 4O9MA 3WFSC 5J0UA 5KFJA 5BPCA 3HW8A 4FBTA 1JQRA 5KG5A 1Z00A 2P6UA 3G6VA 3RJKA 3H7IA 3KHGA 1QSLA 4F8RA 4WC0A 1SKRA 2Q66A 4X4QA 2R8IA 3PMLA 4F50A 3KHHA 4ED8A 2DPIA 1PX5A 4BGDA 4ECZA 4NM1A 4YQWA 3N4MB 3AQKA 4O0IA 2DPJA 4JV0A 5KFPA 4BDPA 7ICHA 3C1YA 3HWTA 2ZH6A 1NO5A 3NYBA 4E80A 4UB2A 5CR0A 2ISOA 4I2AA 5J0QA 2DVIA 4I2CA 4QZBA 4DSKA 3MBYA 4YR3A 4DL3A 4M47A 4AT8B 1TK5A 3HJ4A 4UBBA 2PFQA 3RH4A 4TQRA 1ZQPA 5L1KA 2ZTCA 3MABA 1X9SA 9ICQA 3E2EA 3PR5B 3M9NB 4UB4A 3V7LA 1S76D 4FS1A 1U49A 4DL5A 1D9FA 5KFCA 4RU9A 2XGQA 2RDIA 2W9BA 2V4QA 4ED3A 1BPZA 3KHLA 1T7PA 4B9NA 2HHWA 1ZQXA 4X4SA 2J6TA 2HHVA 5J0OA 4UD5A 5DDMA 4EZ9A 5HMLA 3V6KA 1QSYA 4CCHA 5DECA 2P6RA 3MR5A 2MAXA 4YD1A 2FPLA 4UB1A 4QZDA 3C2MA 2ISPA 2M2VA 2A1JB 1MQ3A 4KLFA 8ICBA 7ICQA 4HYKA 2FMSA 4FHWA 2ASDA 4KLOA 4I2EA 5IILA 4X0AA 2NRZA 3B0YA 5KG6A 4ED1A 4M9HA 2M2TA 5DG8A 4M6WB 4RQ2A 4P4OA 4R66A 1SL0A 3TAPA 2BR0A 1D8LA 2M9NA 1YLQA 3OSPA 1JX4A 9ICSA 4DOAA 7ICKA 3H3AA 2BPGA 3K75D 4R8UB 1X9MA 8ICPA 4IQUA 3ZDEA 4Q8EA 2PI4A 1DGSA 2I9GA 1BNPA 2R8JA 1NKEA 1TK0A 3GIIA 1RXWA 1JAJA 3WFPA 4EBJA 1AROP 5JUMA 5KFNA 4DFJA 1K1QA 1NJZA 4O5KA 4RNMA 4ECRA 3ETLA 4BWJA 4RQ1A 3OVBA 2HHTA 2BCRA 4ECVA 4RQ7A 3EW9A 2C2RA 4B9VA 3JYYA 2ZH7A 1HJPA 4K4HA 3WFRE 1JMSA 1NOMA 5HNKA 3KHRA 3RH5A 2IHNA 3IHQB 2PFPA 1MSWD 4RQ8A 3H8WA 2P66A 2R8KA 4F91B 4JWNA 8ICZA 4RNOA 3TQ1A 5DG9A 4DLEA 2XC9A 1S0OA 4K4GA 4RZRA 3MGHA 4DOCA 2HHPA 4E7XA 2W9AA 4RUAA 4EZ6A 2O1PA 5J2DA 3RJJA 3TFSA 2ZJ5A 4PGXA 3ISDA 2PXIA 4F5RA 7ICIA 9ICIA 1L5UA 3IM1A 4DOBA 5KFBA 3AQNA 4Q43A 1TFWA 4Q8FA 3RH6A 1OU5A 3AU2A 2BQ3A 1ZETA 3HX0A 4QZIA 9ICCA 4DF8A 5HREA 5KFUA 5L1JA 4DQIA 1TKDA 3Q8RB 9ICLA 5HRGA 4YG2A 4M9NA 4KLDA 2UVUA 3C18A 1N48A 2XGPA 4JV2A 4FHYA 5KG1A 1PZNA 3H40A 1L3SA 4KLSA 4EBCA 1T4GA 2ZH4A 4RWNA 3UPSA 2MUTA 1JXEA 4UB3A 4RT2A 3N97B 4QZ9A 4QZAA 1ZQLA 2F1JA 2HW3A 3RBEA 3BQ2A 2W9CB 3MDCA 2O5AA 4RQ3A 2XY7A 5J0WA 2ATLA 2ALZA 4M9JA 1RYRA 5IIMA 5HRIA 1V9PA 4YN4A 4ECUA 4AT7A 3Q8MA 4ECSA 2BHNA 4O3QA 4RPZA 5HRHA 2NRKA 5KFWA 2W8LA 2ZH5A 5CP2A 5KTQA 4XQ7A 4J9KA 7ICSA 5KFXA 1ZQIA 3HJ1A 4RT3A 4MEYA 4NM2A 4QW9A 5IINA 4O3SA 4WC3A 5J2CA 4X0BA 4WC5A 4ECQA 2FLLA 4M9GA 1KLNA 2HHSA 2AU0A 4RQ0A 8ICGA 4F5QA 2I1QA 4I2JA 5IIOA 4IRCA 3RRHA 2C28A 1ZQCA 4WC7A 1F5AA 1ZQGA 5D4BA 5F9NA 2ZH1A 4DO9A 1D8YA 2F1HA 9ICEA 2BGWA 5HC9A 5KFQA 3PW4A 2JEIA 2XO7A 1WCLA 1L3TA 4NKUA 3BQ1A 4B9MA 7ICLA 4ATBA 1XO1A 9ICMA 3H4DA 1ZQZA 2HHXA 2W8KA 4X4TA 1UETA 5DB8A 2ZUDA 5IIKA 5D46A 1CUKA 4DFMA 9ICTA 5KFDA 4UQGA 4QZ8A 1ZJMA 4RPYA 8ICNA 5IIJA 3M9OB 3OHBA 4M5DA 2VA2A 3PVXA 4PGYA 3ZDAA 7ICEA 1BPEA 4TUSA 3JPQA 3SYZA 4KLHA 2JZBA 4ECXA 3GQCA 4EYIB 1B43A 1RXVA 4RQ4A 9ICWA 3GDXA 4DS4A 3HT3A 4J9PA 4FH5A 2BPFA 9ICRA 3OVAA 1R8CA 1UT8A 4ED6A 1S97A 3G6XA 3PY8A 3JPNA 1BPYA 1CEZA 4M04A 3NGDA 1ZQDA 2W9MA 5HMMA 3QEBZ 8ICUA 4DL6A 3Q8PB 3H8JA 3HP6A 4EYHB 1VFGA 9ICFA 5HRDA 4E8FA 4UAYA 1T8EA 3QEAZ 1UA0A 5HRKA 3C5GA 2C2EA 4R65A 1BPXA 9ICJA 4QWCA 1U9LA 4P4MA 4I28A 4GXIA 5KFIA 2PFNA 3PO4A 4FHXA 3QZ8A 3AUOA 3RJFA 2R8HA 3LDAA 1UEUA 1TK8A 4Z6DA 1SL2A 2IMWP 5KFKA 5KFEA 4K4IA 3T5JA 3HPOA 2ZH2A 4Q45A 9ICOA 3RJGA 3JPTA 5KFMA 4J9NA 3ISBA 2W9BB 4IRDA 2BE3A 3H39A 3T5KA 2A1JA 4I2FA 5L1LA 2ZHBA 5KG2A 4I27A 2KP7A 1XC9A 5HRFA 2XY6A 2FPMA 3OUYB 2ZUBA 2ZH9A 5DBAA 4EP7A 4KN7A 2V4RA 1ZQUA 1VJ7A 3C23A 4M9LA 5CA7A 4PHAA 3AQMA 2DR9A 5J2IA 3MDAA 2NRWA 3SV3A 5L1IA 4DL7A 4O3PA 5KT6A 5KT2A 7ICRA 5HRLA 3UQ2A 1ZQOA 3GV5B 4FHVA 3V72A 3TI0A 3TAQA 2FMQA 4XA5A 2C22A 9ICXA 1B22A 4YP3A 3C66A 1ZQWA 3T5LA 3GILA 4YXMA 3PNCA 5J2AA 2PBEA 5DGAA 5CHGA 4B9LA 4LVSA 2BQUA 1ZQNA 7ICMA 1ZQFA 2ID1A 2DR7A 3OVSA 3OSNA 5DLGA 5J0SA 4Q44A 3RTVA 5DB7A 3V6HA 3THVA 1DK3A 1L3VA 2JEFA 4AT9A 3RBDA 3T5HA 2DRAA 5EWEA 5J2BA 3NTUA 4RNNA 2XCPA 5HHIA 1COOA 4QZCA 4DQSA 2OWOA 4ELUA 2KFNA 3MR3A 2FPKA 3PW2A 4QZFA 3OV7A 2KN7A 1SL1A 4XRHA 1L3UA 1H38A 1ZQQA 4B9TA 4NY8A 1HUOA 2R8GA 1ZQSA 2FMPA 3PW7A 5EOZA 4BWMA 3AU6A 5F2VO 2ZUCA 3OHAA 4M2YA 3FYHA 2AQ0A 2AJQA 4C8MA 4KLIA 9ICVA 2M2WA 3SI8A 4XQ8A 1KFSA 1QSSA 1ZJNA 8ICRA 1UEVA 2WTFA 7ICOA 2ZHAA 2ZJ8A 1S0NA 2ASJA 3RB4A 4LZDA 2AGQA 1BGXT 1SZPA 4QWDA 4C8KA 4EBKA 2IHMA 3H4BA 1U45A 1XSNA 1V4AA 4EEYA 5J2HA 1S10A 4YR2A 4F3OA 1WCNA 2BCUA 4ED0A 5KG3A 4QZEA 5J2JA 1IM4A 5EWGA 3UXNA 4BXOB 5KG0A 3ZD8A 4NXZA 4UBCA 4WBZA 4DL2A 8ICTA 3PMNA 5J0RA 9ICGA 1NJXA 1R89A 4QZHA 5DQHA 4F4ZA 5DB9A 4RWQA 3Q8LA 8ICOA 3RR8A 5DQIA 5KFGA 4F4KA 8ICXA 4O5EA 1U48A 2DR8A 4X4UA 1HUZA 4X5VA 1MIYA 3EPGA 8ICIA 1NJYA 4KTQA 5TZVA 1S77D 1Q78A 5DBCA 1S0VA 5J2GA 5DLFA 8ICJA 1JIHA 1NZPA 4Z6CA 2BCQA 2FLNA 4WBYA 4RWPA 5F9LA 4S3NA 4DSFA 3SV4A 2BQRA 2KZ3A 2NRTA 5J0YA 3QZ7A 4KLJA 2KZMA 1MIVA 4F5PA 3RJHA 4NKTA 4UAZA 3BJYA 4F93B 3OJUA 5KT7A 3RJEA 4MF8A 8ICVA 4I2DA 4YFKA 3RJIA 4PHPA 4DQQA 3PW0A 4AT8A 4FH3A 1EXNA 1TFYA 3UXPA 2XY5A 5C5JA 9ICBA 4C8LA 2Y1IA 3H8SA 2IBKA 3LWLA 3G6YA 4J9MA 3V7JA 4NLZA 4X4OA 2ZH3A 1KFTA 4F4YA 3RB3A 4E0DA 4DEZA 1NK0A 4RWOA 1NJWA 4WC6A 2JEGA 4TURA 2UVVA 5J2FA 3L9DA 3LWMA 1ZQJA 1WOTA 2BKEA 4JUZA 1Z00B 4FO6A 2VA8A 3TFRA 1S9FA 1QTMA 3B0XA 9ICAA 3MR2A 1NKCA 4DL4A 1S0MA 1DK2A 1Q79A 1XWLA 1JN3A 4QW8A 3PW5A 4DQRA 3PR4A 1ZQYA 3LK9A 4J9QA 4KN4A 5KT4A 5DBBA 4ED7A 3EYZA 4R63A 3C1ZA 3MFIA 3PX4A 8ICCA 3M8RA 3UPQA 2AGPA 1KTQA 5HR9A 5DG7A 5DEDA 3GV7B 4MEXA 3H37A 5HHHA 1BPDA 1A77A 3Q8SB 3MFHA 5KT5A 2ASLA 4RUCA 8ICHA 2ZTEA 1IXRA 2ZJAA 1RPLA 5J0XA 4J9SA 3UQ0A 4LT6A 4I2HA 5DQGA 3JPSA 4J9LA 4DS5A 4I2IA 4J9RA 1Y88A 3FDSA 5IIIA 2V9WA 4NLNA 9ICPA 3C2KA 3ZDDA 1KEJA 3JPRA 5HRBA 1ZQHA 1MIWA 4DQPA 1TVAA 7ICFA 4ECYA 2DFLA 4GXKA 1TFRA 5KFSA 3PX0A 4QWAA 5J0PA 5KFTA 3ZD9A 5KFOA 4QZGA 2JEJA 4KITB 3Q8KA 1MC8A 4M6WA 4KMUA 4ED2A 4TUQA 5J0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N56 A;  5DDY A;  2J6S A;  4JV1 A;  4P2H A;  3WFO A;  2J6U A;  1TAQ A;  2ZTD A;  4X4P A;  3OUY A;  4IQV A;  4Z6E A;  4P4P A;  2HVH A;  4R8U A;  1NK9 A;  5EWF A;  1NK6 A;  4KLG A;  4IR1 A;  8ICA A;  4DFP A;  5KFV A;  2AQ4 A;  1D9D A;  4XUS A;  5BOM A;  2VA3 A;  5KG4 A;  4KLE A;  3RAQ A;  3EPI A;  4MFA A;  5HP4 A;  4PGQ A;  4JWM A;  4NLG A;  3JPO A;  3BQ0 A;  4FS2 A;  3C5F A;  4TUP A;  1XS9 D;  4YD2 A;  5DKW A;  2AGO A;  2HHU A;  1BVS A;  2UVW A;  3UXO A;  8ICY A;  1R8B A;  4FHP A;  3WFQ E;  1ZQV A;  1RZT A;  4G3I A;  7ICG A;  4PPX A;  4DSI A;  1KNY A;  4PHE A;  3M9M B;  4TQS A;  1ZQK A;  2PFO A;  1A76 A;  1ZQR A;  3GIK A;  1UT5 A;  1U47 A;  9ICH A;  3V6J A;  1Z3E B;  1XSL A;  2Q0Z X;  2HHQ A;  3OJS A;  1ZQM A;  3GIM A;  1ZYQ A;  4YVZ A;  3EZ5 A;  3RB0 A;  1R8A A;  9ICN A;  4B9U A;  4ECT A;  5KFY A;  2BCV A;  4F92 B;  4F4W A;  2PI5 A;  8ICS A;  4IG8 A;  3ORY A;  2RFF A;  4GC6 A;  5KFZ A;  2UVR A;  1BPB A;  4ZH4 A;  2NRV A;  4AT9 B;  3V7K A;  2HVI A;  4KLM A;  4I29 A;  2RDJ A;  3BQT A;  5D49 A;  1BNO A;  4KLU A;  5J2K A;  4EBE A;  2IA6 A;  3ZDC A;  4X4V A;  1ZQB A;  5KFR A;  7ICJ A;  3RB6 A;  1QLN A;  1T3N A;  4DSL A;  5KG7 A;  1NK8 A;  4FBU A;  3JPP A;  4IQT A;  4DFK A;  4RPX A;  3Q8Q B;  4Z6F A;  2XCA A;  3MR6 A;  4DLG A;  3K4G A;  4EBD A;  4YMO A;  3RAX A;  1C7Y A;  2FLP A;  2W9C A;  1MQ2 A;  4MF2 A;  1DOQ A;  4PHD A;  5KFH A;  5CWR A;  4NLK A;  5BOL A;  4B9S A;  4GLX A;  3ISC A;  2MUT B;  1FA0 A;  3AQL A;  4PH5 A;  3PO5 A;  4BXO A;  4QWE A;  2C2D A;  4KLT A;  3OGU A;  4LZG A;  3TAN A;  3SZ2 A;  1ZQE A;  3JZ0 A;  1SKW A;  1TAU A;  4R64 A;  2BDP A;  1X2I A;  1XU4 A;  2VAN A;  4UAW A;  5CJ7 A;  1TV9 A;  1U4B A;  4O5C A;  1SKS A;  5KFA A;  1KRP A;  4QWB A;  4M0A A;  4DWI A;  2BCS A;  4UD4 A;  9ICU A;  3EWA A;  4DSE A;  1K1S A;  3QE9 Y;  3LQC B;  4KLQ A;  4AT7 B;  4X4N A;  2KFZ A;  3GFK B;  4YMM A;  2DRB A;  2LYH A;  4DF4 A;  4DSJ A;  4GXJ A;  4YXJ A;  3C2L A;  4O3O A;  4YCX A;  1RYS A;  2KTQ A;  4ECW A;  8ICW A;  3GV8 B;  4I2B A;  8ICQ A;  2DR5 A;  4WC1 A;  4JK1 A;  5J2E A;  4IR9 A;  4WC4 A;  2M2U A;  4F4X A;  1NK5 A;  2GWS A;  1NK7 A;  1ZQA A;  1KFD A;  5KFF A;  4MFC A;  5KT3 A;  3ZDB A;  2NRX A;  1KSP A;  2B21 A;  4O3N A;  3BDP A;  7ICP A;  5DB6 A;  3GIJ A;  4F5O A;  1NKB A;  2KZZ A;  2ZH8 A;  5KFL A;  4IRK A;  1KDH A;  4RQ5 A;  5L9X A;  4J9O A;  4F2S A;  7ICN A;  7ICV A;  4WC2 A;  5J29 A;  4F2R A;  8ICM A;  3MGI A;  3HIY A;  4ELV A;  4RQ6 A;  1UA1 A;  4YR0 A;  4MFF A;  4O3R A;  4WCW A;  1X9W A;  4GC7 A;  2F1I A;  4UB5 A;  5DGB A;  3T3F A;  1LB2 B;  4ATB B;  1LV5 A;  5CB1 A;  3RR7 A;  8ICE A;  4C8O A;  8ICL A;  4I2G A;  3M8S A;  1XSP A;  1ZQT A;  1JXL A;  3PX6 A;  4YMN A;  2Y1J A;  3KTQ A;  8ICF A;  4KLL A;  4ELT A;  7ICU A;  9ICK A;  3RRG A;  8ICK A;  4X4R A;  3H38 A;  4C8N A;  2H5X A;  3C21 A;  3PV8 A;  4F5N A;  3TAR A;  2BPC A;  1NK4 A;  4IQW A;  7ICT A;  2JZB B;  4O9M A;  3WFS C;  5J0U A;  5KFJ A;  5BPC A;  3HW8 A;  4FBT A;  1JQR A;  5KG5 A;  1Z00 A;  2P6U A;  3G6V A;  3RJK A;  3H7I A;  3KHG A;  1QSL A;  4F8R A;  4WC0 A;  1SKR A;  2Q66 A;  4X4Q A;  2R8I A;  3PML A;  4F50 A;  3KHH A;  4ED8 A;  2DPI A;  1PX5 A;  4BGD A;  4ECZ A;  4NM1 A;  4YQW A;  3N4M B;  3AQK A;  4O0I A;  2DPJ A;  4JV0 A;  5KFP A;  4BDP A;  7ICH A;  3C1Y A;  3HWT A;  2ZH6 A;  1NO5 A;  3NYB A;  4E80 A;  4UB2 A;  5CR0 A;  2ISO A;  4I2A A;  5J0Q A;  2DVI A;  4I2C A;  4QZB A;  4DSK A;  3MBY A;  4YR3 A;  4DL3 A;  4M47 A;  4AT8 B;  1TK5 A;  3HJ4 A;  4UBB A;  2PFQ A;  3RH4 A;  4TQR A;  1ZQP A;  5L1K A;  2ZTC A;  3MAB A;  1X9S A;  9ICQ A;  3E2E A;  3PR5 B;  3M9N B;  4UB4 A;  3V7L A;  1S76 D;  4FS1 A;  1U49 A;  4DL5 A;  1D9F A;  5KFC A;  4RU9 A;  2XGQ A;  2RDI A;  2W9B A;  2V4Q A;  4ED3 A;  1BPZ A;  3KHL A;  1T7P A;  4B9N A;  2HHW A;  1ZQX A;  4X4S A;  2J6T A;  2HHV A;  5J0O A;  4UD5 A;  5DDM A;  4EZ9 A;  5HML A;  3V6K A;  1QSY A;  4CCH A;  5DEC A;  2P6R A;  3MR5 A;  2MAX A;  4YD1 A;  2FPL A;  4UB1 A;  4QZD A;  3C2M A;  2ISP A;  2M2V A;  2A1J B;  1MQ3 A;  4KLF A;  8ICB A;  7ICQ A;  4HYK A;  2FMS A;  4FHW A;  2ASD A;  4KLO A;  4I2E A;  5IIL A;  4X0A A;  2NRZ A;  3B0Y A;  5KG6 A;  4ED1 A;  4M9H A;  2M2T A;  5DG8 A;  4M6W B;  4RQ2 A;  4P4O A;  4R66 A;  1SL0 A;  3TAP A;  2BR0 A;  1D8L A;  2M9N A;  1YLQ A;  3OSP A;  1JX4 A;  9ICS A;  4DOA A;  7ICK A;  3H3A A;  2BPG A;  3K75 D;  4R8U B;  1X9M A;  8ICP A;  4IQU A;  3ZDE A;  4Q8E A;  2PI4 A;  1DGS A;  2I9G A;  1BNP A;  2R8J A;  1NKE A;  1TK0 A;  3GII A;  1RXW A;  1JAJ A;  3WFP A;  4EBJ A;  1ARO P;  5JUM A;  5KFN A;  4DFJ A;  1K1Q A;  1NJZ A;  4O5K A;  4RNM A;  4ECR A;  3ETL A;  4BWJ A;  4RQ1 A;  3OVB A;  2HHT A;  2BCR A;  4ECV A;  4RQ7 A;  3EW9 A;  2C2R A;  4B9V A;  3JYY A;  2ZH7 A;  1HJP A;  4K4H A;  3WFR E;  1JMS A;  1NOM A;  5HNK A;  3KHR A;  3RH5 A;  2IHN A;  3IHQ B;  2PFP A;  1MSW D;  4RQ8 A;  3H8W A;  2P66 A;  2R8K A;  4F91 B;  4JWN A;  8ICZ A;  4RNO A;  3TQ1 A;  5DG9 A;  4DLE A;  2XC9 A;  1S0O A;  4K4G A;  4RZR A;  3MGH A;  4DOC A;  2HHP A;  4E7X A;  2W9A A;  4RUA A;  4EZ6 A;  2O1P A;  5J2D A;  3RJJ A;  3TFS A;  2ZJ5 A;  4PGX A;  3ISD A;  2PXI A;  4F5R A;  7ICI A;  9ICI A;  1L5U A;  3IM1 A;  4DOB A;  5KFB A;  3AQN A;  4Q43 A;  1TFW A;  4Q8F A;  3RH6 A;  1OU5 A;  3AU2 A;  2BQ3 A;  1ZET A;  3HX0 A;  4QZI A;  9ICC A;  4DF8 A;  5HRE A;  5KFU A;  5L1J A;  4DQI A;  1TKD A;  3Q8R B;  9ICL A;  5HRG A;  4YG2 A;  4M9N A;  4KLD A;  2UVU A;  3C18 A;  1N48 A;  2XGP A;  4JV2 A;  4FHY A;  5KG1 A;  1PZN A;  3H40 A;  1L3S A;  4KLS A;  4EBC A;  1T4G A;  2ZH4 A;  4RWN A;  3UPS A;  2MUT A;  1JXE A;  4UB3 A;  4RT2 A;  3N97 B;  4QZ9 A;  4QZA A;  1ZQL A;  2F1J A;  2HW3 A;  3RBE A;  3BQ2 A;  2W9C B;  3MDC A;  2O5A A;  4RQ3 A;  2XY7 A;  5J0W A;  2ATL A;  2ALZ A;  4M9J A;  1RYR A;  5IIM A;  5HRI A;  1V9P A;  4YN4 A;  4ECU A;  4AT7 A;  3Q8M A;  4ECS A;  2BHN A;  4O3Q A;  4RPZ A;  5HRH A;  2NRK A;  5KFW A;  2W8L A;  2ZH5 A;  5CP2 A;  5KTQ A;  4XQ7 A;  4J9K A;  7ICS A;  5KFX A;  1ZQI A;  3HJ1 A;  4RT3 A;  4MEY A;  4NM2 A;  4QW9 A;  5IIN A;  4O3S A;  4WC3 A;  5J2C A;  4X0B A;  4WC5 A;  4ECQ A;  2FLL A;  4M9G A;  1KLN A;  2HHS A;  2AU0 A;  4RQ0 A;  8ICG A;  4F5Q A;  2I1Q A;  4I2J A;  5IIO A;  4IRC A;  3RRH A;  2C28 A;  1ZQC A;  4WC7 A;  1F5A A;  1ZQG A;  5D4B A;  5F9N A;  2ZH1 A;  4DO9 A;  1D8Y A;  2F1H A;  9ICE A;  2BGW A;  5HC9 A;  5KFQ A;  3PW4 A;  2JEI A;  2XO7 A;  1WCL A;  1L3T A;  4NKU A;  3BQ1 A;  4B9M A;  7ICL A;  4ATB A;  1XO1 A;  9ICM A;  3H4D A;  1ZQZ A;  2HHX A;  2W8K A;  4X4T A;  1UET A;  5DB8 A;  2ZUD A;  5IIK A;  5D46 A;  1CUK A;  4DFM A;  9ICT A;  5KFD A;  4UQG A;  4QZ8 A;  1ZJM A;  4RPY A;  8ICN A;  5IIJ A;  3M9O B;  3OHB A;  4M5D A;  2VA2 A;  3PVX A;  4PGY A;  3ZDA A;  7ICE A;  1BPE A;  4TUS A;  3JPQ A;  3SYZ A;  4KLH A;  2JZB A;  4ECX A;  3GQC A;  4EYI B;  1B43 A;  1RXV A;  4RQ4 A;  9ICW A;  3GDX A;  4DS4 A;  3HT3 A;  4J9P A;  4FH5 A;  2BPF A;  9ICR A;  3OVA A;  1R8C A;  1UT8 A;  4ED6 A;  1S97 A;  3G6X A;  3PY8 A;  3JPN A;  1BPY A;  1CEZ A;  4M04 A;  3NGD A;  1ZQD A;  2W9M A;  5HMM A;  3QEB Z;  8ICU A;  4DL6 A;  3Q8P B;  3H8J A;  3HP6 A;  4EYH B;  1VFG A;  9ICF A;  5HRD A;  4E8F A;  4UAY A;  1T8E A;  3QEA Z;  1UA0 A;  5HRK A;  3C5G A;  2C2E A;  4R65 A;  1BPX A;  9ICJ A;  4QWC A;  1U9L A;  4P4M A;  4I28 A;  4GXI A;  5KFI A;  2PFN A;  3PO4 A;  4FHX A;  3QZ8 A;  3AUO A;  3RJF A;  2R8H A;  3LDA A;  1UEU A;  1TK8 A;  4Z6D A;  1SL2 A;  2IMW P;  5KFK A;  5KFE A;  4K4I A;  3T5J A;  3HPO A;  2ZH2 A;  4Q45 A;  9ICO A;  3RJG A;  3JPT A;  5KFM A;  4J9N A;  3ISB A;  2W9B B;  4IRD A;  2BE3 A;  3H39 A;  3T5K A;  2A1J A;  4I2F A;  5L1L A;  2ZHB A;  5KG2 A;  4I27 A;  2KP7 A;  1XC9 A;  5HRF A;  2XY6 A;  2FPM A;  3OUY B;  2ZUB A;  2ZH9 A;  5DBA A;  4EP7 A;  4KN7 A;  2V4R A;  1ZQU A;  1VJ7 A;  3C23 A;  4M9L A;  5CA7 A;  4PHA A;  3AQM A;  2DR9 A;  5J2I A;  3MDA A;  2NRW A;  3SV3 A;  5L1I A;  4DL7 A;  4O3P A;  5KT6 A;  5KT2 A;  7ICR A;  5HRL A;  3UQ2 A;  1ZQO A;  3GV5 B;  4FHV A;  3V72 A;  3TI0 A;  3TAQ A;  2FMQ A;  4XA5 A;  2C22 A;  9ICX A;  1B22 A;  4YP3 A;  3C66 A;  1ZQW A;  3T5L A;  3GIL A;  4YXM A;  3PNC A;  5J2A A;  2PBE A;  5DGA A;  5CHG A;  4B9L A;  4LVS A;  2BQU A;  1ZQN A;  7ICM A;  1ZQF A;  2ID1 A;  2DR7 A;  3OVS A;  3OSN A;  5DLG A;  5J0S A;  4Q44 A;  3RTV A;  5DB7 A;  3V6H A;  3THV A;  1DK3 A;  1L3V A;  2JEF A;  4AT9 A;  3RBD A;  3T5H A;  2DRA A;  5EWE A;  5J2B A;  3NTU A;  4RNN A;  2XCP A;  5HHI A;  1COO A;  4QZC A;  4DQS A;  2OWO A;  4ELU A;  2KFN A;  3MR3 A;  2FPK A;  3PW2 A;  4QZF A;  3OV7 A;  2KN7 A;  1SL1 A;  4XRH A;  1L3U A;  1H38 A;  1ZQQ A;  4B9T A;  4NY8 A;  1HUO A;  2R8G A;  1ZQS A;  2FMP A;  3PW7 A;  5EOZ A;  4BWM A;  3AU6 A;  5F2V O;  2ZUC A;  3OHA A;  4M2Y A;  3FYH A;  2AQ0 A;  2AJQ A;  4C8M A;  4KLI A;  9ICV A;  2M2W A;  3SI8 A;  4XQ8 A;  1KFS A;  1QSS A;  1ZJN A;  8ICR A;  1UEV A;  2WTF A;  7ICO A;  2ZHA A;  2ZJ8 A;  1S0N A;  2ASJ A;  3RB4 A;  4LZD A;  2AGQ A;  1BGX T;  1SZP A;  4QWD A;  4C8K A;  4EBK A;  2IHM A;  3H4B A;  1U45 A;  1XSN A;  1V4A A;  4EEY A;  5J2H A;  1S10 A;  4YR2 A;  4F3O A;  1WCN A;  2BCU A;  4ED0 A;  5KG3 A;  4QZE A;  5J2J A;  1IM4 A;  5EWG A;  3UXN A;  4BXO B;  5KG0 A;  3ZD8 A;  4NXZ A;  4UBC A;  4WBZ A;  4DL2 A;  8ICT A;  3PMN A;  5J0R A;  9ICG A;  1NJX A;  1R89 A;  4QZH A;  5DQH A;  4F4Z A;  5DB9 A;  4RWQ A;  3Q8L A;  8ICO A;  3RR8 A;  5DQI A;  5KFG A;  4F4K A;  8ICX A;  4O5E A;  1U48 A;  2DR8 A;  4X4U A;  1HUZ A;  4X5V A;  1MIY A;  3EPG A;  8ICI A;  1NJY A;  4KTQ A;  5TZV A;  1S77 D;  1Q78 A;  5DBC A;  1S0V A;  5J2G A;  5DLF A;  8ICJ A;  1JIH A;  1NZP A;  4Z6C A;  2BCQ A;  2FLN A;  4WBY A;  4RWP A;  5F9L A;  4S3N A;  4DSF A;  3SV4 A;  2BQR A;  2KZ3 A;  2NRT A;  5J0Y A;  3QZ7 A;  4KLJ A;  2KZM A;  1MIV A;  4F5P A;  3RJH A;  4NKT A;  4UAZ A;  3BJY A;  4F93 B;  3OJU A;  5KT7 A;  3RJE A;  4MF8 A;  8ICV A;  4I2D A;  4YFK A;  3RJI A;  4PHP A;  4DQQ A;  3PW0 A;  4AT8 A;  4FH3 A;  1EXN A;  1TFY A;  3UXP A;  2XY5 A;  5C5J A;  9ICB A;  4C8L A;  2Y1I A;  3H8S A;  2IBK A;  3LWL A;  3G6Y A;  4J9M A;  3V7J A;  4NLZ A;  4X4O A;  2ZH3 A;  1KFT A;  4F4Y A;  3RB3 A;  4E0D A;  4DEZ A;  1NK0 A;  4RWO A;  1NJW A;  4WC6 A;  2JEG A;  4TUR A;  2UVV A;  5J2F A;  3L9D A;  3LWM A;  1ZQJ A;  1WOT A;  2BKE A;  4JUZ A;  1Z00 B;  4FO6 A;  2VA8 A;  3TFR A;  1S9F A;  1QTM A;  3B0X A;  9ICA A;  3MR2 A;  1NKC A;  4DL4 A;  1S0M A;  1DK2 A;  1Q79 A;  1XWL A;  1JN3 A;  4QW8 A;  3PW5 A;  4DQR A;  3PR4 A;  1ZQY A;  3LK9 A;  4J9Q A;  4KN4 A;  5KT4 A;  5DBB A;  4ED7 A;  3EYZ A;  4R63 A;  3C1Z A;  3MFI A;  3PX4 A;  8ICC A;  3M8R A;  3UPQ A;  2AGP A;  1KTQ A;  5HR9 A;  5DG7 A;  5DED A;  3GV7 B;  4MEX A;  3H37 A;  5HHH A;  1BPD A;  1A77 A;  3Q8S B;  3MFH A;  5KT5 A;  2ASL A;  4RUC A;  8ICH A;  2ZTE A;  1IXR A;  2ZJA A;  1RPL A;  5J0X A;  4J9S A;  3UQ0 A;  4LT6 A;  4I2H A;  5DQG A;  3JPS A;  4J9L A;  4DS5 A;  4I2I A;  4J9R A;  1Y88 A;  3FDS A;  5III A;  2V9W A;  4NLN A;  9ICP A;  3C2K A;  3ZDD A;  1KEJ A;  3JPR A;  5HRB A;  1ZQH A;  1MIW A;  4DQP A;  1TVA A;  7ICF A;  4ECY A;  2DFL A;  4GXK A;  1TFR A;  5KFS A;  3PX0 A;  4QWA A;  5J0P A;  5KFT A;  3ZD9 A;  5KFO A;  4QZG A;  2JEJ A;  4KIT B;  3Q8K A;  1MC8 A;  4M6W A;  4KMU A;  4ED2 A;  4TUQ A;  5J0T A; 
#chains in the Genus database with same CATH topology
 5DDY A;  4P2H A;  2J6U A;  5CFU A;  4P4P A;  5EWF A;  8ICA A;  4IR1 A;  1VDV A;  4MFA A;  3GU3 A;  4NL9 A;  1XS9 D;  4FHP A;  2MSN A;  2ZIV B;  2KHV A;  3M9M B;  2KE7 A;  1ZQK A;  2PFO A;  2QLT A;  1UT5 A;  3NVO A;  1IG6 A;  2Q0Z X;  5KL1 B;  3OJS A;  1ZYQ A;  9ICN A;  4B9U A;  2NO4 A;  4ECT A;  3NVW A;  2RFF A;  2UVR A;  4NWI A;  4WQL A;  2NRV A;  3V7K A;  3BQT A;  5J2K A;  2IA6 A;  5KFR A;  4LEV A;  3I76 A;  2QKQ A;  4FBU A;  3JPP A;  3CK6 A;  4Z6F A;  1DGJ A;  4XJE A;  3K4G A;  4MF2 A;  1DOQ A;  4NLK A;  4B9S A;  4GLX A;  1FA0 A;  4PH5 A;  3PO5 A;  4QWE A;  2RP5 A;  3JZ0 A;  3TAN A;  1TAU A;  4R64 A;  2ZH5 A;  4EV6 A;  5CJ7 A;  4US8 A;  4DWI A;  4OJP A;  4AT7 B;  2K4I A;  3QE9 Y;  3LQC B;  2KFZ A;  3QX7 A;  3ETR A;  4DF4 A;  4DSJ A;  3C2L A;  8ICQ A;  4WC4 A;  5J2E A;  4F4X A;  1NK5 A;  1NK7 A;  5KFF A;  3ZI4 A;  3QU2 A;  3GIJ A;  4IRK A;  1KDH A;  1QQ5 A;  4F2S A;  4WC2 A;  2OCE A;  4F2R A;  3MGI A;  2B4V A;  4MFF A;  5DGB A;  1LV5 A;  4C7Y A;  5CB1 A;  1ZQT A;  2BZF A;  3PX6 A;  4AT8 B;  4JLX A;  2ZIW B;  3RRG A;  4UAT A;  1OUQ A;  3C21 A;  3PV8 A;  4F5N A;  1NK4 A;  2BPC A;  3BQ7 A;  2P6U A;  2JMG A;  1FIQ A;  1SB3 C;  4Y2Y A;  4NLB A;  2B6G A;  4EEK A;  4O0I A;  2DPJ A;  4U7C A;  2W11 A;  2KV2 A;  2YTU A;  4UB2 A;  3D2S A;  4I2A A;  4CF4 A;  4QZB A;  3MBY A;  4YR3 A;  1TK5 A;  5ALE A;  1J2N A;  3BS5 A;  3E2E A;  3PR5 B;  3M9N B;  4I0U A;  4DL5 A;  5KFC A;  2HHW A;  4NJ8 A;  1T7P A;  1ZQX A;  1F5S A;  2J6T A;  2HHV A;  5J0O A;  3MCR A;  4EZ9 A;  1QSY A;  3MR5 A;  2MAX A;  1L7N A;  2JV3 A;  4UB1 A;  2A1J B;  4KLF A;  8ICB A;  4FHW A;  4HYK A;  3F5A A;  3K1Z A;  2NRZ A;  4M9H A;  4M6W B;  2BR0 A;  1YLQ A;  2I6X A;  1JX4 A;  9ICS A;  3K75 D;  8ICP A;  4Q8E A;  3KBB A;  1DGS A;  1BNP A;  1RXW A;  1ARO P;  2E1E A;  4DFJ A;  1K1Q A;  3HRD D;  3U26 A;  2HHT A;  2BCR A;  4RQ7 A;  3EW9 A;  3JYY A;  1X40 A;  2KIW A;  1MSW D;  3WFR E;  3S6J A;  2PFP A;  5GTH U;  3H8W A;  4RQ8 A;  3WK4 A;  4F91 B;  8ICZ A;  4CE6 A;  3QYP A;  2XC9 A;  4K4G A;  4UW9 A;  3NRZ A;  2O1P A;  4F5R A;  3O0F A;  4DOB A;  4K9A A;  1TFW A;  4Q8F A;  1ZET A;  3QUQ A;  3VCB A;  2E8M A;  4QZI A;  9ICC A;  4DF8 A;  5HRE A;  5KFU A;  5L1J A;  4Y2P A;  9ICL A;  4WH5 A;  3WKA A;  3WK7 A;  2DUY A;  4JV2 A;  5KG1 A;  4K96 A;  1PZN A;  5CFS A;  4EBC A;  2ZH4 A;  3UPS A;  2VJ5 A;  4LEW A;  4QZA A;  1ZQL A;  2F1J A;  2O5A A;  2W9C B;  2JH1 A;  2YQE A;  5IIM A;  4ECU A;  4AT7 A;  5A0L A;  2QB0 A;  5KFW A;  2Q4T A;  4XQ7 A;  7ICS A;  5KFX A;  2KHQ A;  5J2C A;  4ECQ A;  2FLL A;  1TE2 A;  8ICG A;  2I1Q A;  4WC7 A;  1F5A A;  5F9N A;  2ZH1 A;  9ICE A;  2BGW A;  3PW4 A;  2JEI A;  1WCL A;  4NV0 A;  9ICM A;  1PVQ A;  1UET A;  2K8C B;  2ZUD A;  1FFU A;  2XVT A;  2HMX A;  2YN4 A;  5KFD A;  4QZ8 A;  4RPY A;  2HBL A;  3H0M B;  3ZDA A;  7ICE A;  2YMQ A;  3KKA C;  2WHE A;  4WJ3 B;  1B43 A;  2IUB A;  3GDX A;  4DS4 A;  1QQ6 A;  4FH5 A;  5T14 A;  2BPF A;  5D61 A;  2BBJ A;  1S97 A;  4BUG A;  4CF5 A;  4RQM A;  3QEB Z;  1X9X A;  1VFG A;  3WK6 A;  1T8E A;  3QEA Z;  2XIC A;  1UA0 A;  4R65 A;  1BPX A;  1HIW A;  1U9L A;  4I28 A;  2GA9 D;  5KFI A;  4QJF B;  4HAI A;  4Z6D A;  5JRT A;  3ED5 A;  3HPO A;  3T5J A;  2EAP A;  9ICO A;  2KJ9 A;  4IRD A;  3H39 A;  2A1J A;  5L1L A;  2Y9T A;  1L8O A;  1XC9 A;  3PST A;  2CN1 A;  1VJ7 A;  3C23 A;  4M9L A;  2DR9 A;  5J2I A;  5ALN A;  5CRX A;  4O3P A;  3UQ2 A;  4O68 A;  2KIV A;  3V72 A;  2HCF A;  5AM4 A;  4YP3 A;  3WKC A;  3T5L A;  4YXM A;  5J2A A;  4KMO B;  4B9L A;  4NXT A;  7ICM A;  3OVS A;  3T5H A;  2DRA A;  5HHI A;  4QZC A;  2OWO A;  2KFN A;  4UB6 U;  3OV7 A;  4B9T A;  1ZQQ A;  4NY8 A;  1ZQS A;  2FMP A;  5F2V O;  3OHA A;  4M2Y A;  4C8M A;  3HIL A;  3SI8 A;  2JXJ A;  1QSS A;  4Y2X A;  1UEV A;  2WTF A;  2ZHA A;  2ASJ A;  2AGQ A;  1SZP A;  2DBY A;  1KN5 A;  2MA1 A;  4ED0 A;  4QZE A;  3DDH A;  5AIC A;  3UXN A;  5G5H A;  1QH9 A;  2DWQ A;  2I5H A;  4UBC A;  4WBZ A;  1JUD A;  5DQH A;  2KD1 A;  1XNS A;  8ICO A;  8ICX A;  4O5E A;  5B3P A;  4KTQ A;  1S0V A;  2ESE A;  4NL9 C;  5J2G A;  5JU5 A;  5ALP A;  2BCQ A;  2AXT U;  4QNL A;  4WBY A;  4RWP A;  4S3N A;  1Z4O A;  4LJX A;  2NRT A;  4KLJ A;  1MIV A;  4F5P A;  2WF8 A;  1WG8 A;  3OJU A;  5KT7 A;  4MF8 A;  2ZG6 A;  1SIJ A;  2F8L A;  4JMU A;  3T79 A;  4PHP A;  4DQQ A;  5C5J A;  1FFV A;  4NLZ A;  5FP0 A;  4J9M A;  4C4T A;  2KOB A;  3HKZ F;  2ZIX A;  4P0Q B;  4F4Y A;  2KG5 A;  1NK0 A;  4WC6 A;  1NJW A;  2EAO A;  1X6J A;  2UVV A;  1GPJ A;  2BKE A;  4JUZ A;  1Z00 B;  3TFR A;  1DK2 A;  1XWL A;  1JN3 A;  1ZQY A;  5DBB A;  4R63 A;  3C1Z A;  8ICC A;  3UPQ A;  4O6A A;  5DED A;  5B66 U;  3GV7 B;  1V38 A;  3NAS A;  3MFH A;  5HHH A;  2ASL A;  1KL9 A;  2ZTE A;  1A0P A;  1LKY B;  2WFA A;  3AN1 A;  4DS5 A;  9ICP A;  3ZDD A;  2F8K A;  1ZQH A;  2E8P A;  3ZD9 A;  4KIT B;  1JAL A;  2AH5 A;  2J6S A;  2NO5 A;  4OAI Z;  2ZTD A;  4IQV A;  2HVH A;  3KZI U;  3MC1 A;  4DFP A;  4XUS A;  2VA3 A;  4KLE A;  3RAQ A;  2PKE A;  5HP4 A;  4PGQ A;  4NLG A;  1OW5 A;  3C5F A;  4TUP A;  5DKW A;  2UVW A;  1R8B A;  4G3I A;  7ICG A;  4TQS A;  1PVR A;  2YB1 A;  3H0R B;  1ZQR A;  1U47 A;  1Z3E B;  1F0M A;  2D8C A;  5AM2 A;  2KJ8 A;  3RB0 A;  2G09 A;  4C80 A;  2HBJ A;  5KFY A;  4F4W A;  3ICX A;  3ORY A;  4GC6 A;  5AKI A;  1BPB A;  4AT9 B;  4I29 A;  4EBE A;  3ZDC A;  4X4V A;  7ICJ A;  3L3F X;  1UPH A;  1COK A;  1Z4N A;  1NK8 A;  2E8N A;  4IQT A;  3Q8Q B;  3MR6 A;  3RAX A;  2XCA A;  1C7Y A;  1L7O A;  4PHD A;  5CWR A;  2F3N A;  2MUT B;  2C2D A;  3OGU A;  1ZQE A;  2RQ5 A;  1N61 A;  4O5C A;  2VAN A;  1TV9 A;  5ALX A;  2NYV A;  2BCS A;  2DQN B;  1K1S A;  4KLQ A;  4X4N A;  4YMM A;  2LYH A;  1L8L A;  4YXJ A;  4GXJ A;  4O3O A;  4I2B A;  2DR5 A;  4WC1 A;  4JK1 A;  4IR9 A;  2M2U A;  3N7P D;  4MFC A;  2NRX A;  3QXG A;  5DB6 A;  4F5O A;  2G5H B;  7ICV A;  4RQ5 A;  4J9O A;  5J29 A;  3HIY A;  8ICM A;  4YR0 A;  4O3R A;  4ATB B;  1X9W A;  4GC7 A;  1Z1B A;  2EZZ A;  3QNM A;  8ICL A;  3M8S A;  1XSP A;  4P0Q A;  3WK9 A;  2Y1J A;  9ICK A;  3KTQ A;  7ICU A;  2JGA A;  5J8Y A;  2WF5 A;  2JZB B;  2Y9U A;  4O9M A;  5ALH A;  5J0U A;  3HW8 A;  3WFS C;  1Z00 A;  3RJK A;  3H7I A;  4WC0 A;  2R8I A;  4BGD A;  2W3R A;  7ICH A;  1J2M A;  3HWT A;  3NYB A;  2ISO A;  3EF2 A;  4I2C A;  4DL3 A;  4M47 A;  3HJ4 A;  4UBB A;  2PFQ A;  5AKG A;  3NUQ A;  5D62 A;  9ICQ A;  1LKY A;  2FDR A;  2KVS A;  3IN5 A;  2B0C A;  4AYB C;  3WK5 A;  4RU9 A;  2RDI A;  4B9N A;  2V4Q A;  1BPZ A;  5ALT A;  1SGG A;  1HEK A;  5HML A;  4CCH A;  2P6R A;  4ICA A;  3JCF A;  1CRX A;  2FPL A;  2LHT A;  2M2V A;  2VJ4 A;  1MQ3 A;  2Y0S F;  4I2E A;  5IIL A;  2YMM A;  5KG6 A;  1D8L A;  4C7Z A;  2BPG A;  4R8U B;  1X9M A;  2HDO A;  4EBJ A;  1A6S A;  3TAD A;  3ETL A;  4BWJ A;  1JI7 A;  4RQ1 A;  4ECV A;  4JB3 A;  1HJP A;  2FJ6 A;  5ALO A;  1NOM A;  5HNK A;  3KHR A;  3D6J A;  4Y2Q A;  4HX0 A;  4RNO A;  4A8E A;  3AL0 B;  4Y2V A;  3MGH A;  4DOC A;  1ZRN A;  2W9A A;  1N63 A;  3RJJ A;  5KAI U;  2ZJ5 A;  2PXI A;  7ICI A;  9ICI A;  2A3V A;  3SMV A;  5L1M A;  3AU2 A;  3HX0 A;  3OTQ A;  2N1R A;  2HOF A;  4KX5 A;  5EE9 A;  4YG2 A;  2ZIU B;  4M9N A;  2XGP A;  4FHY A;  4KLS A;  1T4G A;  2MUT A;  1JXE A;  1ED1 A;  4GFJ A;  4P0P B;  2EAM A;  2HW3 A;  3BQ2 A;  4OJ5 A;  2ALZ A;  4PL2 A;  5HRI A;  4YN4 A;  3Q8M A;  3KFU F;  2BHN A;  4O3Q A;  4RPZ A;  5HRH A;  3UMB A;  5KTQ A;  4J9K A;  4WC3 A;  4QW9 A;  5AI8 A;  5K4L A;  1KLN A;  5CEH A;  1N2X A;  3RRH A;  2C28 A;  1ZQG A;  2M0N A;  3C29 A;  4DO9 A;  2R18 A;  5HC9 A;  5KFQ A;  3NRW A;  3BQ1 A;  4ATB A;  3H4D A;  2W8K A;  2KVC A;  1CUK A;  9ICT A;  2A1A A;  3I28 A;  1ZJM A;  4UQG A;  2CXY A;  2IOF K;  2W03 A;  4M5D A;  2WAQ C;  2QB1 A;  1SV4 A;  2JZB A;  2JR5 A;  4RQ4 A;  9ICW A;  4K99 A;  2B56 A;  2VKQ A;  2GLE A;  5ALY A;  3G6X A;  4O3M A;  1ZQD A;  2E3T A;  1Q3U A;  1M6Y A;  4DL6 A;  1QCK A;  3H8J A;  4EYH B;  5HRD A;  4CGZ A;  4UAY A;  1RYU A;  5HRK A;  2C2E A;  3NWI A;  4EX6 A;  4P4M A;  2G08 A;  3NVZ A;  3QZ8 A;  3RJF A;  2ZXH A;  3FAH A;  5KFE A;  4K4I A;  2ZH2 A;  4Q45 A;  4K8V A;  2OHF A;  5ALI A;  5KFM A;  3LVV A;  3ISB A;  2W9B B;  4I2F A;  2ZHB A;  2FPM A;  2XID A;  3OUY B;  1J97 A;  2V4R A;  1ZQU A;  3AQM A;  5CA7 A;  5AM3 A;  4Y2R A;  2ZIV A;  4CNQ A;  1IIP A;  5KT2 A;  7ICR A;  5HRL A;  1ZQO A;  3GV5 B;  2WB1 F;  3TI0 A;  3M6Z A;  4XA5 A;  1B22 A;  3CYM A;  1PK1 B;  2GAF D;  4N7R A;  3PNC A;  5KAF U;  2PBE A;  5CHG A;  4LVS A;  2BQU A;  2ID1 A;  3OSN A;  2HI0 A;  3RTV A;  1DK3 A;  2P35 A;  5DB7 A;  3THV A;  2JEF A;  5EWE A;  4RNN A;  3NTU A;  1COO A;  3PW2 A;  4FZM A;  4QZF A;  4OAH A;  2KN7 A;  1SL1 A;  3F2C A;  4XRH A;  1ECW A;  3PW7 A;  4Y2S A;  2ZUC A;  2AJQ A;  4KLI A;  9ICV A;  3A0H U;  4XQ8 A;  2H3Z A;  1ZJN A;  1BGX T;  3AQF A;  4EBK A;  4OAG A;  3H4B A;  1U45 A;  5ALQ A;  1AQ6 A;  2EH9 A;  5KG3 A;  5J2J A;  4P0P A;  3BZK A;  3RR8 A;  5DQI A;  5KFG A;  1WYG A;  1U48 A;  2DR8 A;  1MIY A;  2IHO A;  5TZV A;  5DLF A;  4Z6C A;  2PMZ F;  2K89 A;  5F9L A;  3SV4 A;  5E79 U;  3QZ7 A;  1NNL A;  2YMP A;  2KIC A;  4F93 B;  1SZH A;  4AT8 A;  1EXN A;  2ZIW A;  1SWW A;  2Y1I A;  2O6K A;  3LWL A;  2WF9 A;  3C28 A;  3RB3 A;  4E0D A;  4RWO A;  4TUR A;  3L9D A;  5J2F A;  3LWM A;  2JRZ A;  1WOT A;  4DFD A;  4FO6 A;  1QTM A;  2VA8 A;  3B0X A;  1OXJ A;  3SD7 A;  4DQR A;  4J9Q A;  2K8A A;  1B4F A;  5ALR A;  5KT4 A;  4KM5 A;  3MFI A;  3PX4 A;  3N28 A;  2AGP A;  1KTQ A;  5HR9 A;  3L4P A;  1V85 A;  3H37 A;  2HN1 A;  1BPD A;  4K97 A;  3UQ0 A;  5J0X A;  5ALK A;  4Y2J A;  4J9L A;  1VJ5 A;  3FDS A;  4K98 A;  1KEJ A;  5EE1 A;  1MIW A;  4DQP A;  3PX0 A;  1TFR A;  5KFT A;  2JEJ A;  5KFO A;  1V97 A;  1MC8 A;  4M6W A;  4KMU A;  4ED2 A;  4U6P A;  1N56 A;  3WFO A;  2G07 A;  3OUY A;  4Z6E A;  1NK9 A;  1NK6 A;  4IC9 A;  4KLG A;  5KFV A;  1D9D A;  5BOM A;  5KG4 A;  4JWM A;  4FZN A;  3JPO A;  3BQ0 A;  4FS2 A;  1L6N A;  4YD2 A;  2LYB A;  1BVS A;  5EE3 A;  3UXO A;  2HHU A;  8ICY A;  3WFQ E;  5J8Y C;  2EZY A;  1PK1 A;  4PPX A;  1KNY A;  2LBO A;  4PHE A;  2DKZ A;  1UHU A;  2BDU A;  3V6J A;  1XSL A;  1ZQM A;  3GIM A;  1S8O A;  4YVZ A;  1R8A A;  2MU2 A;  4GIB A;  8ICS A;  5KFZ A;  3RF9 A;  4ZH4 A;  3TAC B;  5KNI A;  2HVI A;  1SWV A;  4KLM A;  3WKB A;  2RDJ A;  3AMZ A;  1L7P A;  4OO1 J;  1ZQB A;  3K1R B;  2KKV A;  1QLN A;  2GH1 A;  4DSL A;  2G0A A;  2LPE A;  4MKP A;  4DFK A;  4RPX A;  4DLG A;  1YZ6 A;  7ICL A;  2ES6 A;  2W9C A;  1MQ2 A;  5AI0 A;  5KFH A;  3BS7 A;  4OJO A;  1SKW A;  1X2I A;  2VIX A;  1U4B A;  1XO0 A;  4UD4 A;  1VLB A;  3EWA A;  3CNH A;  2F44 A;  3GFK B;  2DRB A;  1RYS A;  4YCX A;  4ECW A;  3GV8 B;  3LYS A;  3IV6 A;  3F2B A;  1ZQA A;  1KFD A;  3TAD C;  5KT3 A;  2KMD A;  3ZDB A;  5AI9 A;  2OXO A;  2KZZ A;  2ZH8 A;  5L9X A;  4ELV A;  1UA1 A;  3H8M A;  4UB5 A;  3F5E A;  3RR7 A;  8ICE A;  4C8O A;  3NVV A;  1JXL A;  4KLL A;  4ELT A;  4J03 A;  4X4R A;  8ICK A;  3H38 A;  1MN8 A;  4KB6 A;  3TAR A;  7ICT A;  5BPC A;  5KFJ A;  4QIW C;  2H3V A;  3UM9 A;  1ZOL A;  2LKY A;  4F8R A;  1SKR A;  1K5O A;  5AKZ A;  1PX5 A;  1UCV A;  4ECZ A;  3AQK A;  4BDP A;  4JV0 A;  2ZH6 A;  5AKX A;  5CR0 A;  5J0Q A;  5D63 A;  3WKD A;  4DSK A;  2HSZ A;  1N5X A;  3SQI A;  2ZTC A;  3MAB A;  5AI5 A;  1X9S A;  2K8B B;  2ODG A;  4LEZ A;  3V7L A;  4FS1 A;  1U49 A;  2XGQ A;  5ALS A;  5CHE A;  4YD1 A;  3FC4 A;  4QZD A;  3EUB 2;  7ICQ A;  2FMS A;  3QU5 A;  2ASD A;  4KLO A;  2HOQ A;  3B0Y A;  4ED1 A;  5DG8 A;  1SL0 A;  4P4O A;  4R66 A;  3TAP A;  3OSP A;  3CW2 C;  4IQU A;  3ZDE A;  1N5W A;  2I9G A;  5EE0 A;  2R8J A;  1NKE A;  1TK0 A;  1RM6 C;  4CRX A;  5JUM A;  4O5K A;  3E0F A;  2JH7 A;  1NJZ A;  4RNM A;  5CFT A;  5H2F U;  1CI4 A;  2C2R A;  4B9V A;  2ZH7 A;  2YX8 A;  1NZB A;  3B9J A;  2RHF A;  1JMS A;  4C0Z A;  3RH5 A;  3TQ1 A;  4DLE A;  1S0O A;  2FI1 A;  2HHP A;  4E7X A;  2XI9 A;  4RUA A;  3TFS A;  4PGX A;  3ISD A;  1L5U A;  3IM1 A;  4FFD A;  1OU5 A;  2BQ3 A;  4IL6 U;  2GO7 A;  5HRG A;  4KLD A;  1N48 A;  5B5E U;  1WUD A;  1X66 A;  3KD3 A;  4QZ9 A;  2F77 X;  4NXX A;  3MDC A;  2K60 A;  4RQ3 A;  2L5Y A;  2XY7 A;  2ATL A;  2IOF A;  4M9J A;  1RYR A;  1V9P A;  2DF4 B;  3FM9 A;  1RDF A;  5AI4 A;  1O08 A;  2W8L A;  5AKJ A;  3SAH A;  1ZQI A;  3HJ1 A;  5IIN A;  3QU9 A;  3GZF A;  3VC8 A;  4M9G A;  5AKL A;  2LI6 A;  4RQ0 A;  4I2J A;  4IRC A;  5IIO A;  1ZQC A;  5D4B A;  4ZOH C;  5G5G A;  1ZRM A;  2D3D A;  1D8Y A;  1C20 A;  4NKU A;  4CF3 A;  5DB8 A;  5IIK A;  5D46 A;  8ICN A;  3OHB A;  3PVX A;  1BPE A;  4TUS A;  3JPQ A;  4KLH A;  4EYI B;  4FZL A;  1RXV A;  3SAF A;  3HT3 A;  4J9P A;  2EQY A;  3OVA A;  1R8C A;  2F76 X;  4UAV A;  2HN2 A;  2E1F A;  1RQN A;  2W9M A;  5HMM A;  2E8O A;  3HP6 A;  9ICF A;  1O03 A;  3WU2 U;  3C5G A;  9ICJ A;  3SEI A;  3PO4 A;  2PFN A;  1YT3 A;  3AUO A;  4NXV A;  5AM5 A;  1TK8 A;  2K4P A;  1SL2 A;  3RJG A;  3JPT A;  4J9N A;  3T5K A;  5KG2 A;  2KP7 A;  2XY6 A;  2ZUB A;  5ALF A;  2ZH9 A;  5DBA A;  2LM1 A;  4EP7 A;  4PHA A;  1ZD4 A;  5KT6 A;  2KNJ A;  2KSO B;  3TAQ A;  1ZD3 A;  2WF7 A;  2OH2 A;  5DGA A;  3DV9 A;  2K4E A;  2DR7 A;  4IS7 A;  4LEY A;  2H3Q A;  5DLG A;  4Q44 A;  4AT9 A;  2WF6 A;  1ZD5 A;  3RBD A;  4DQS A;  5J2B A;  2XCP A;  4OAF A;  3K7D A;  4EEN A;  2FPK A;  2RRD A;  2DL0 A;  1H38 A;  2R8G A;  1Z1V A;  3AU6 A;  2OM6 A;  5TIS U;  2AQ0 A;  3BZC A;  5ALG A;  5AM0 A;  1X42 A;  1KFS A;  2ZJ8 A;  3AM9 A;  1S0N A;  3RB4 A;  1FEZ A;  4C8K A;  4QWD A;  3HJE A;  1V4A A;  4EEY A;  5J2H A;  1S10 A;  1WCN A;  4OD0 A;  2G5I B;  1IM4 A;  3E58 A;  4BXO B;  5KG0 A;  3ZD8 A;  3AEV A;  2EAN A;  4DL2 A;  9ICG A;  3PMN A;  1NJX A;  4RWQ A;  1MA7 A;  1T94 A;  5F3X B;  3ER9 B;  3UMC A;  1HUZ A;  3EPG A;  2H3I A;  1S77 D;  3PSF A;  3QUC A;  2FLN A;  4EGW A;  2QB0 B;  2BQR A;  2KZ3 A;  5J0Y A;  4F71 A;  4UAZ A;  3BJY A;  4WQK A;  4NXU A;  3RJE A;  4YFK A;  3RJI A;  3PW0 A;  3PZP A;  4FH3 A;  4NXW A;  9ICB A;  1SV0 A;  4OCZ A;  4EED A;  2IBK A;  3G6Y A;  3V7J A;  4X4O A;  2ZH3 A;  3N7S C;  4DEZ A;  2JEG A;  1ZXI A;  1ZQJ A;  2JHD A;  4DCC A;  5AIB A;  2DKX A;  9ICA A;  1NKC A;  4DL4 A;  1Q79 A;  3LK9 A;  2YML A;  4KN4 A;  4ED7 A;  2BBH A;  3EYZ A;  3L5K A;  1SXE A;  1A77 A;  5ALU A;  5KT5 A;  5AK6 A;  4RUC A;  4EEB A;  1Q46 A;  4J9S A;  1RPL A;  4LT6 A;  4I2I A;  4J9R A;  1Y88 A;  4FHV A;  5III A;  3C2K A;  5HRB A;  3JPR A;  2DFL A;  4GXK A;  5KFS A;  4QWA A;  2IOH A;  3Q8K A;  4PZN A;  4TUQ A;  5J0T A;  4JV1 A;  5HR7 A;  1TAM A;  1TAQ A;  4X4P A;  3N7R C;  4R8U A;  2EDU A;  2AQ4 A;  2HBK A;  3EPI A;  1NI3 A;  2KSO A;  2AGO A;  5ALM A;  3ALR A;  3SR6 A;  4CDG A;  1ZQV A;  1RZT A;  5JTG A;  4DSI A;  1A76 A;  9ICH A;  3GIK A;  3MGV A;  2LM4 A;  2HHQ A;  3EZ5 A;  2BCV A;  4F92 B;  2PI5 A;  3NS1 A;  2Y0S C;  1BNO A;  5D49 A;  4KLU A;  2ZIU A;  3RB6 A;  2W3S A;  1T3N A;  5KG7 A;  3F53 A;  1KBU A;  3ONN A;  5AIA A;  4IG8 A;  4EBD A;  4YMO A;  2FLP A;  5BOL A;  3ISC A;  3AQL A;  4WOY A;  2KKP A;  3QU7 A;  4ACO A;  4BXO A;  4KLT A;  2MRL A;  4UB8 U;  4LZG A;  3SZ2 A;  4UAS A;  2FCL A;  2BDP A;  1XU4 A;  4UAW A;  1SKS A;  5KFA A;  1KRP A;  1YZ7 A;  4QWB A;  4M0A A;  9ICU A;  4DSE A;  3NKU A;  3LVW A;  4K9B A;  1WWV A;  4C4S A;  2KTQ A;  8ICW A;  4QIW F;  2A19 A;  3QU4 A;  5AHX A;  2GWS A;  1F44 A;  1RQL A;  1KSP A;  2LMR A;  2B21 A;  3D2Q A;  4O3N A;  3BDP A;  7ICP A;  1NKB A;  5KFL A;  7ICN A;  4RQ6 A;  4WCW A;  1LB2 B;  2F1I A;  3T3F A;  2E5S A;  3QUB A;  4I2G A;  1FO4 A;  8ICF A;  4YMN A;  4C8N A;  2H5X A;  1IV8 A;  4IQW A;  2ZIX B;  4FBT A;  1JQR A;  3IG8 A;  5KG5 A;  4FE3 A;  4Y2U A;  3G6V A;  3KHG A;  2Q66 A;  1QSL A;  5B3Q A;  4X4Q A;  3PML A;  4F50 A;  3KHH A;  4ED8 A;  2DPI A;  4NM1 A;  4YQW A;  3N4M B;  5KFP A;  3C1Y A;  1NO5 A;  4E80 A;  2B51 A;  2DVI A;  2LYA A;  4PZO A;  3RH4 A;  4O69 A;  4TQR A;  1ZQP A;  5L1K A;  4UB4 A;  1S76 D;  2OEH A;  1ZD2 P;  1D9F A;  1KKX A;  2W9B A;  4ED3 A;  3KHL A;  4X4S A;  4UD5 A;  5DDM A;  1JRO A;  3V6K A;  1B0X A;  5DEC A;  3SEN A;  3C2M A;  2ISP A;  4B6J A;  3PHZ A;  1GO3 F;  2Z7J A;  5C0Y A;  1Q8K A;  4X0A A;  2M2T A;  4RQ2 A;  4USA A;  2M9N A;  4C4R A;  5ALW A;  4DOA A;  7ICK A;  3H3A A;  5AKK A;  2PI4 A;  5AKH A;  4PL1 A;  3GII A;  3WFP A;  1JAJ A;  2ZXI A;  5KFN A;  4ECR A;  3OVB A;  3RFA A;  4RQN A;  2AHO B;  4K4H A;  2IHN A;  3IHQ B;  2P66 A;  2R8K A;  4JWN A;  5DG9 A;  4RZR A;  4US9 A;  2D6F C;  4EZ6 A;  5J2D A;  2KEY A;  2W55 A;  5ALD A;  5KFB A;  3AQN A;  4Q43 A;  2W54 A;  3RH6 A;  1PK3 A;  4DQI A;  1TKD A;  3Q8R B;  4NLC A;  2YB4 A;  2UVU A;  2WB1 C;  4KX3 A;  3C18 A;  3IP4 B;  3H40 A;  1L3S A;  5GTI U;  4RWN A;  1L7M A;  4UB3 A;  4RT2 A;  3N97 B;  1DXS A;  3RBE A;  1N62 A;  3AQE A;  5J0W A;  5KL8 B;  1Q3V A;  4AP9 A;  4ECS A;  3KOO A;  1KQQ A;  2NRK A;  5CP2 A;  4JLZ A;  1Z19 A;  5AK5 A;  4BJQ A;  4MEY A;  4NM2 A;  2W04 A;  4RT3 A;  2W7O A;  4O3S A;  3R9K A;  4X0B A;  4OJL A;  4WC5 A;  2HHS A;  2AU0 A;  4F5Q A;  4PJ0 U;  3H0L B;  2G06 A;  2CPR A;  1N60 A;  3NVY A;  1URJ A;  3KZX A;  2W43 A;  2F1H A;  1PUZ A;  2XO7 A;  1L3T A;  4B9M A;  1XO1 A;  2HHX A;  1ZQZ A;  4X4T A;  3QUT A;  4AYB F;  5AK4 A;  4DFM A;  3CRX A;  5HR6 A;  3M6K A;  5IIJ A;  3M9O B;  5JTI A;  2VA2 A;  4PGY A;  3SYZ A;  3IG5 A;  5AKE A;  4ECX A;  3GQC A;  4F72 A;  4FO1 A;  9ICR A;  1LVH A;  2PMZ C;  1QQ7 A;  1UT8 A;  4ED6 A;  3PY8 A;  1UQV A;  3JPN A;  1BPY A;  1CEZ A;  4M04 A;  3NGD A;  8ICU A;  2QAR B;  3PSI A;  3Q8P B;  2YY6 A;  3ERC C;  4E8F A;  3TKA A;  4UAU A;  4QWC A;  4OJ6 A;  5AI6 A;  2FE9 A;  2EZX A;  3OPX A;  4GXI A;  4FHX A;  2R8H A;  3LDA A;  1UEU A;  2OYY A;  2IMW P;  5KFK A;  2HOI A;  2BE3 A;  2HBM A;  3ER8 C;  2W7P A;  4I27 A;  5HRF A;  1JRP A;  3PSP A;  3M1Y A;  4KN7 A;  5ALV A;  3MDA A;  2NRW A;  1SV0 C;  3SV3 A;  5L1I A;  4DL7 A;  5AK3 A;  2FMQ A;  4EX7 A;  2C22 A;  9ICX A;  3C66 A;  1ZQW A;  5AKY A;  3GIL A;  1ZQN A;  1ZQF A;  5ALL A;  5J0S A;  3V6H A;  1X6I A;  1L3V A;  1WWU A;  4ELU A;  3MR3 A;  2H3F A;  1L3U A;  1HUO A;  5EOZ A;  4BWM A;  3WK8 A;  3FYH A;  4EEL A;  3KKA A;  2M2W A;  1RG6 A;  3DEE A;  4Y2T A;  1KW4 A;  8ICR A;  7ICO A;  3CP8 A;  2K4H A;  4BX9 C;  4LZD A;  2IHM A;  1DRG A;  1XSN A;  4YR2 A;  4F3O A;  2BCU A;  3UMG A;  5EWG A;  4MHV A;  4NXZ A;  8ICT A;  5J0R A;  1R89 A;  4QZH A;  4F4Z A;  1PVP A;  2WAQ F;  5DB9 A;  3Q8L A;  4F4K A;  4X4U A;  3WKE A;  1Q78 A;  4X5V A;  3D2N A;  1NJY A;  8ICI A;  5DBC A;  8ICJ A;  1NZP A;  1JIH A;  2F2A B;  3IDW A;  4DSF A;  2KZM A;  4O67 A;  3RJH A;  4NKT A;  8ICV A;  4I2D A;  3J81 j;  1P7D A;  3M7D A;  1TFY A;  3UXP A;  2XY5 A;  4C8L A;  1SXD A;  3H8S A;  2GOL A;  3A0B U;  1KFT A;  1T3Q A;  2CRX A;  3SAG A;  2NV3 A;  2RLT A;  1S5L U;  2KJ5 A;  2EWR A;  1S9F A;  2DGZ A;  3MR2 A;  1S0M A;  3IRU A;  4QW8 A;  3PW5 A;  3PR4 A;  1D8B A;  3F2D A;  4G9B A;  5ALJ A;  3M8R A;  2QAR A;  5DG7 A;  4MEX A;  3Q8S B;  8ICH A;  5ALZ A;  2KK0 A;  1IXR A;  2ZJA A;  3I1Y A;  3HKZ C;  4I2H A;  5DQG A;  3JPS A;  3BS5 B;  3OWG A;  1ZQ1 C;  2V9W A;  4NLN A;  1TVA A;  7ICF A;  4ECY A;  5J0P A;  4UAR A;  4QZG A;  5AM1 A; 
#chains in the Genus database with same CATH homology
 1N56 A;  5DDY A;  2J6S A;  4JV1 A;  4P2H A;  3WFO A;  2J6U A;  1TAQ A;  2ZTD A;  4X4P A;  3OUY A;  4IQV A;  4Z6E A;  4P4P A;  2HVH A;  4R8U A;  1NK9 A;  5EWF A;  1NK6 A;  4KLG A;  4IR1 A;  8ICA A;  4DFP A;  5KFV A;  2AQ4 A;  1D9D A;  4XUS A;  5BOM A;  2VA3 A;  5KG4 A;  4KLE A;  3RAQ A;  3EPI A;  4MFA A;  5HP4 A;  4PGQ A;  4JWM A;  4NLG A;  3JPO A;  3BQ0 A;  4FS2 A;  3C5F A;  4TUP A;  1XS9 D;  4YD2 A;  5DKW A;  2AGO A;  2HHU A;  1BVS A;  2UVW A;  3UXO A;  8ICY A;  1R8B A;  4FHP A;  3WFQ E;  1ZQV A;  1RZT A;  4G3I A;  7ICG A;  4PPX A;  4DSI A;  1KNY A;  4PHE A;  3M9M B;  4TQS A;  1ZQK A;  2PFO A;  1A76 A;  1ZQR A;  3GIK A;  1UT5 A;  1U47 A;  9ICH A;  3V6J A;  1Z3E B;  1XSL A;  2Q0Z X;  2HHQ A;  3OJS A;  1ZQM A;  3GIM A;  1ZYQ A;  4YVZ A;  3EZ5 A;  3RB0 A;  1R8A A;  9ICN A;  4B9U A;  4ECT A;  5KFY A;  2BCV A;  4F92 B;  4F4W A;  2PI5 A;  8ICS A;  4IG8 A;  3ORY A;  2RFF A;  4GC6 A;  5KFZ A;  2UVR A;  1BPB A;  4ZH4 A;  2NRV A;  4AT9 B;  3V7K A;  2HVI A;  4KLM A;  4I29 A;  2RDJ A;  3BQT A;  5D49 A;  1BNO A;  4KLU A;  5J2K A;  4EBE A;  2IA6 A;  3ZDC A;  4X4V A;  1ZQB A;  5KFR A;  7ICJ A;  3RB6 A;  1QLN A;  1T3N A;  4DSL A;  5KG7 A;  1NK8 A;  4FBU A;  3JPP A;  4IQT A;  4DFK A;  4RPX A;  3Q8Q B;  4Z6F A;  2XCA A;  3MR6 A;  4DLG A;  3K4G A;  4EBD A;  4YMO A;  3RAX A;  1C7Y A;  2FLP A;  2W9C A;  1MQ2 A;  4MF2 A;  1DOQ A;  4PHD A;  5KFH A;  5CWR A;  4NLK A;  5BOL A;  4B9S A;  4GLX A;  3ISC A;  2MUT B;  1FA0 A;  3AQL A;  4PH5 A;  3PO5 A;  4BXO A;  4QWE A;  2C2D A;  4KLT A;  3OGU A;  4LZG A;  3TAN A;  3SZ2 A;  1ZQE A;  3JZ0 A;  1SKW A;  1TAU A;  4R64 A;  2BDP A;  1X2I A;  1XU4 A;  2VAN A;  4UAW A;  5CJ7 A;  1TV9 A;  1U4B A;  4O5C A;  1SKS A;  5KFA A;  1KRP A;  4QWB A;  4M0A A;  4DWI A;  2BCS A;  4UD4 A;  9ICU A;  3EWA A;  4DSE A;  1K1S A;  3QE9 Y;  3LQC B;  4KLQ A;  4AT7 B;  4X4N A;  2KFZ A;  3GFK B;  4YMM A;  2DRB A;  2LYH A;  4DF4 A;  4DSJ A;  4GXJ A;  4YXJ A;  3C2L A;  4O3O A;  4YCX A;  1RYS A;  2KTQ A;  4ECW A;  8ICW A;  3GV8 B;  4I2B A;  8ICQ A;  2DR5 A;  4WC1 A;  4JK1 A;  5J2E A;  4IR9 A;  4WC4 A;  2M2U A;  4F4X A;  1NK5 A;  2GWS A;  1NK7 A;  1ZQA A;  1KFD A;  5KFF A;  4MFC A;  5KT3 A;  3ZDB A;  2NRX A;  1KSP A;  2B21 A;  4O3N A;  3BDP A;  7ICP A;  5DB6 A;  3GIJ A;  4F5O A;  1NKB A;  2KZZ A;  2ZH8 A;  5KFL A;  4IRK A;  1KDH A;  4RQ5 A;  5L9X A;  4J9O A;  4F2S A;  7ICN A;  7ICV A;  4WC2 A;  5J29 A;  4F2R A;  8ICM A;  3MGI A;  3HIY A;  4ELV A;  4RQ6 A;  1UA1 A;  4YR0 A;  4MFF A;  4O3R A;  4WCW A;  1X9W A;  4GC7 A;  2F1I A;  4UB5 A;  5DGB A;  3T3F A;  1LB2 B;  4ATB B;  1LV5 A;  5CB1 A;  3RR7 A;  8ICE A;  4C8O A;  8ICL A;  4I2G A;  3M8S A;  1XSP A;  1ZQT A;  1JXL A;  3PX6 A;  4YMN A;  2Y1J A;  3KTQ A;  8ICF A;  4KLL A;  4ELT A;  7ICU A;  9ICK A;  3RRG A;  8ICK A;  4X4R A;  3H38 A;  4C8N A;  2H5X A;  3C21 A;  3PV8 A;  4F5N A;  3TAR A;  2BPC A;  1NK4 A;  4IQW A;  7ICT A;  2JZB B;  4O9M A;  3WFS C;  5J0U A;  5KFJ A;  5BPC A;  3HW8 A;  4FBT A;  1JQR A;  5KG5 A;  1Z00 A;  2P6U A;  3G6V A;  3RJK A;  3H7I A;  3KHG A;  1QSL A;  4F8R A;  4WC0 A;  1SKR A;  2Q66 A;  4X4Q A;  2R8I A;  3PML A;  4F50 A;  3KHH A;  4ED8 A;  2DPI A;  1PX5 A;  4BGD A;  4ECZ A;  4NM1 A;  4YQW A;  3N4M B;  3AQK A;  4O0I A;  2DPJ A;  4JV0 A;  5KFP A;  4BDP A;  7ICH A;  3C1Y A;  3HWT A;  2ZH6 A;  1NO5 A;  3NYB A;  4E80 A;  4UB2 A;  5CR0 A;  2ISO A;  4I2A A;  5J0Q A;  2DVI A;  4I2C A;  4QZB A;  4DSK A;  3MBY A;  4YR3 A;  4DL3 A;  4M47 A;  4AT8 B;  1TK5 A;  3HJ4 A;  4UBB A;  2PFQ A;  3RH4 A;  4TQR A;  1ZQP A;  5L1K A;  2ZTC A;  3MAB A;  1X9S A;  9ICQ A;  3E2E A;  3PR5 B;  3M9N B;  4UB4 A;  3V7L A;  1S76 D;  4FS1 A;  1U49 A;  4DL5 A;  1D9F A;  5KFC A;  4RU9 A;  2XGQ A;  2RDI A;  2W9B A;  2V4Q A;  4ED3 A;  1BPZ A;  3KHL A;  1T7P A;  4B9N A;  2HHW A;  1ZQX A;  4X4S A;  2J6T A;  2HHV A;  5J0O A;  4UD5 A;  5DDM A;  4EZ9 A;  5HML A;  3V6K A;  1QSY A;  4CCH A;  5DEC A;  2P6R A;  3MR5 A;  2MAX A;  4YD1 A;  2FPL A;  4UB1 A;  4QZD A;  3C2M A;  2ISP A;  2M2V A;  2A1J B;  1MQ3 A;  4KLF A;  8ICB A;  7ICQ A;  4HYK A;  2FMS A;  4FHW A;  2ASD A;  4KLO A;  4I2E A;  5IIL A;  4X0A A;  2NRZ A;  3B0Y A;  5KG6 A;  4ED1 A;  4M9H A;  2M2T A;  5DG8 A;  4M6W B;  4RQ2 A;  4P4O A;  4R66 A;  1SL0 A;  3TAP A;  2BR0 A;  1D8L A;  2M9N A;  1YLQ A;  3OSP A;  1JX4 A;  9ICS A;  4DOA A;  7ICK A;  3H3A A;  2BPG A;  3K75 D;  4R8U B;  1X9M A;  8ICP A;  4IQU A;  3ZDE A;  4Q8E A;  2PI4 A;  1DGS A;  2I9G A;  1BNP A;  2R8J A;  1NKE A;  1TK0 A;  3GII A;  1RXW A;  1JAJ A;  3WFP A;  4EBJ A;  1ARO P;  5JUM A;  5KFN A;  4DFJ A;  1K1Q A;  1NJZ A;  4O5K A;  4RNM A;  4ECR A;  3ETL A;  4BWJ A;  4RQ1 A;  3OVB A;  2HHT A;  2BCR A;  4ECV A;  4RQ7 A;  3EW9 A;  2C2R A;  4B9V A;  3JYY A;  2ZH7 A;  1HJP A;  4K4H A;  3WFR E;  1JMS A;  1NOM A;  5HNK A;  3KHR A;  3RH5 A;  2IHN A;  3IHQ B;  2PFP A;  1MSW D;  4RQ8 A;  3H8W A;  2P66 A;  2R8K A;  4F91 B;  4JWN A;  8ICZ A;  4RNO A;  3TQ1 A;  5DG9 A;  4DLE A;  2XC9 A;  1S0O A;  4K4G A;  4RZR A;  3MGH A;  4DOC A;  2HHP A;  4E7X A;  2W9A A;  4RUA A;  4EZ6 A;  2O1P A;  5J2D A;  3RJJ A;  3TFS A;  2ZJ5 A;  4PGX A;  3ISD A;  2PXI A;  4F5R A;  7ICI A;  9ICI A;  1L5U A;  3IM1 A;  4DOB A;  5KFB A;  3AQN A;  4Q43 A;  1TFW A;  4Q8F A;  3RH6 A;  1OU5 A;  3AU2 A;  2BQ3 A;  1ZET A;  3HX0 A;  4QZI A;  9ICC A;  4DF8 A;  5HRE A;  5KFU A;  5L1J A;  4DQI A;  1TKD A;  3Q8R B;  9ICL A;  5HRG A;  4YG2 A;  4M9N A;  4KLD A;  2UVU A;  3C18 A;  1N48 A;  2XGP A;  4JV2 A;  4FHY A;  5KG1 A;  1PZN A;  3H40 A;  1L3S A;  4KLS A;  4EBC A;  1T4G A;  2ZH4 A;  4RWN A;  3UPS A;  2MUT A;  1JXE A;  4UB3 A;  4RT2 A;  3N97 B;  4QZ9 A;  4QZA A;  1ZQL A;  2F1J A;  2HW3 A;  3RBE A;  3BQ2 A;  2W9C B;  3MDC A;  2O5A A;  4RQ3 A;  2XY7 A;  5J0W A;  2ATL A;  2ALZ A;  4M9J A;  1RYR A;  5IIM A;  5HRI A;  1V9P A;  4YN4 A;  4ECU A;  4AT7 A;  3Q8M A;  4ECS A;  2BHN A;  4O3Q A;  4RPZ A;  5HRH A;  2NRK A;  5KFW A;  2W8L A;  2ZH5 A;  5CP2 A;  5KTQ A;  4XQ7 A;  4J9K A;  7ICS A;  5KFX A;  1ZQI A;  3HJ1 A;  4RT3 A;  4MEY A;  4NM2 A;  4QW9 A;  5IIN A;  4O3S A;  4WC3 A;  5J2C A;  4X0B A;  4WC5 A;  4ECQ A;  2FLL A;  4M9G A;  1KLN A;  2HHS A;  2AU0 A;  4RQ0 A;  8ICG A;  4F5Q A;  2I1Q A;  4I2J A;  5IIO A;  4IRC A;  3RRH A;  2C28 A;  1ZQC A;  4WC7 A;  1F5A A;  1ZQG A;  5D4B A;  5F9N A;  2ZH1 A;  4DO9 A;  1D8Y A;  2F1H A;  9ICE A;  2BGW A;  5HC9 A;  5KFQ A;  3PW4 A;  2JEI A;  2XO7 A;  1WCL A;  1L3T A;  4NKU A;  3BQ1 A;  4B9M A;  7ICL A;  4ATB A;  1XO1 A;  9ICM A;  3H4D A;  1ZQZ A;  2HHX A;  2W8K A;  4X4T A;  1UET A;  5DB8 A;  2ZUD A;  5IIK A;  5D46 A;  1CUK A;  4DFM A;  9ICT A;  5KFD A;  4UQG A;  4QZ8 A;  1ZJM A;  4RPY A;  8ICN A;  5IIJ A;  3M9O B;  3OHB A;  4M5D A;  2VA2 A;  3PVX A;  4PGY A;  3ZDA A;  7ICE A;  1BPE A;  4TUS A;  3JPQ A;  3SYZ A;  4KLH A;  2JZB A;  4ECX A;  3GQC A;  4EYI B;  1B43 A;  1RXV A;  4RQ4 A;  9ICW A;  3GDX A;  4DS4 A;  3HT3 A;  4J9P A;  4FH5 A;  2BPF A;  9ICR A;  3OVA A;  1R8C A;  1UT8 A;  4ED6 A;  1S97 A;  3G6X A;  3PY8 A;  3JPN A;  1BPY A;  1CEZ A;  4M04 A;  3NGD A;  1ZQD A;  2W9M A;  5HMM A;  3QEB Z;  8ICU A;  4DL6 A;  3Q8P B;  3H8J A;  3HP6 A;  4EYH B;  1VFG A;  9ICF A;  5HRD A;  4E8F A;  4UAY A;  1T8E A;  3QEA Z;  1UA0 A;  5HRK A;  3C5G A;  2C2E A;  4R65 A;  1BPX A;  9ICJ A;  4QWC A;  1U9L A;  4P4M A;  4I28 A;  4GXI A;  5KFI A;  2PFN A;  3PO4 A;  4FHX A;  3QZ8 A;  3AUO A;  3RJF A;  2R8H A;  3LDA A;  1UEU A;  1TK8 A;  4Z6D A;  1SL2 A;  2IMW P;  5KFK A;  5KFE A;  4K4I A;  3T5J A;  3HPO A;  2ZH2 A;  4Q45 A;  9ICO A;  3RJG A;  3JPT A;  5KFM A;  4J9N A;  3ISB A;  2W9B B;  4IRD A;  2BE3 A;  3H39 A;  3T5K A;  2A1J A;  4I2F A;  5L1L A;  2ZHB A;  5KG2 A;  4I27 A;  2KP7 A;  1XC9 A;  5HRF A;  2XY6 A;  2FPM A;  3OUY B;  2ZUB A;  2ZH9 A;  5DBA A;  4EP7 A;  4KN7 A;  2V4R A;  1ZQU A;  1VJ7 A;  3C23 A;  4M9L A;  5CA7 A;  4PHA A;  3AQM A;  2DR9 A;  5J2I A;  3MDA A;  2NRW A;  3SV3 A;  5L1I A;  4DL7 A;  4O3P A;  5KT6 A;  5KT2 A;  7ICR A;  5HRL A;  3UQ2 A;  1ZQO A;  3GV5 B;  4FHV A;  3V72 A;  3TI0 A;  3TAQ A;  2FMQ A;  4XA5 A;  2C22 A;  9ICX A;  1B22 A;  4YP3 A;  3C66 A;  1ZQW A;  3T5L A;  3GIL A;  4YXM A;  3PNC A;  5J2A A;  2PBE A;  5DGA A;  5CHG A;  4B9L A;  4LVS A;  2BQU A;  1ZQN A;  7ICM A;  1ZQF A;  2ID1 A;  2DR7 A;  3OVS A;  3OSN A;  5DLG A;  5J0S A;  4Q44 A;  3RTV A;  5DB7 A;  3V6H A;  3THV A;  1DK3 A;  1L3V A;  2JEF A;  4AT9 A;  3RBD A;  3T5H A;  2DRA A;  5EWE A;  5J2B A;  3NTU A;  4RNN A;  2XCP A;  5HHI A;  1COO A;  4QZC A;  4DQS A;  2OWO A;  4ELU A;  2KFN A;  3MR3 A;  2FPK A;  3PW2 A;  4QZF A;  3OV7 A;  2KN7 A;  1SL1 A;  4XRH A;  1L3U A;  1H38 A;  1ZQQ A;  4B9T A;  4NY8 A;  1HUO A;  2R8G A;  1ZQS A;  2FMP A;  3PW7 A;  5EOZ A;  4BWM A;  3AU6 A;  5F2V O;  2ZUC A;  3OHA A;  4M2Y A;  3FYH A;  2AQ0 A;  2AJQ A;  4C8M A;  4KLI A;  9ICV A;  2M2W A;  3SI8 A;  4XQ8 A;  1KFS A;  1QSS A;  1ZJN A;  8ICR A;  1UEV A;  2WTF A;  7ICO A;  2ZHA A;  2ZJ8 A;  1S0N A;  2ASJ A;  3RB4 A;  4LZD A;  2AGQ A;  1BGX T;  1SZP A;  4QWD A;  4C8K A;  4EBK A;  2IHM A;  3H4B A;  1U45 A;  1XSN A;  1V4A A;  4EEY A;  5J2H A;  1S10 A;  4YR2 A;  4F3O A;  1WCN A;  2BCU A;  4ED0 A;  5KG3 A;  4QZE A;  5J2J A;  1IM4 A;  5EWG A;  3UXN A;  4BXO B;  5KG0 A;  3ZD8 A;  4NXZ A;  4UBC A;  4WBZ A;  4DL2 A;  8ICT A;  3PMN A;  5J0R A;  9ICG A;  1NJX A;  1R89 A;  4QZH A;  5DQH A;  4F4Z A;  5DB9 A;  4RWQ A;  3Q8L A;  8ICO A;  3RR8 A;  5DQI A;  5KFG A;  4F4K A;  8ICX A;  4O5E A;  1U48 A;  2DR8 A;  4X4U A;  1HUZ A;  4X5V A;  1MIY A;  3EPG A;  8ICI A;  1NJY A;  4KTQ A;  5TZV A;  1S77 D;  1Q78 A;  5DBC A;  1S0V A;  5J2G A;  5DLF A;  8ICJ A;  1JIH A;  1NZP A;  4Z6C A;  2BCQ A;  2FLN A;  4WBY A;  4RWP A;  5F9L A;  4S3N A;  4DSF A;  3SV4 A;  2BQR A;  2KZ3 A;  2NRT A;  5J0Y A;  3QZ7 A;  4KLJ A;  2KZM A;  1MIV A;  4F5P A;  3RJH A;  4NKT A;  4UAZ A;  3BJY A;  4F93 B;  3OJU A;  5KT7 A;  3RJE A;  4MF8 A;  8ICV A;  4I2D A;  4YFK A;  3RJI A;  4PHP A;  4DQQ A;  3PW0 A;  4AT8 A;  4FH3 A;  1EXN A;  1TFY A;  3UXP A;  2XY5 A;  5C5J A;  9ICB A;  4C8L A;  2Y1I A;  3H8S A;  2IBK A;  3LWL A;  3G6Y A;  4J9M A;  3V7J A;  4NLZ A;  4X4O A;  2ZH3 A;  1KFT A;  4F4Y A;  3RB3 A;  4E0D A;  4DEZ A;  1NK0 A;  4RWO A;  1NJW A;  4WC6 A;  2JEG A;  4TUR A;  2UVV A;  5J2F A;  3L9D A;  3LWM A;  1ZQJ A;  1WOT A;  2BKE A;  4JUZ A;  1Z00 B;  4FO6 A;  2VA8 A;  3TFR A;  1S9F A;  1QTM A;  3B0X A;  9ICA A;  3MR2 A;  1NKC A;  4DL4 A;  1S0M A;  1DK2 A;  1Q79 A;  1XWL A;  1JN3 A;  4QW8 A;  3PW5 A;  4DQR A;  3PR4 A;  1ZQY A;  3LK9 A;  4J9Q A;  4KN4 A;  5KT4 A;  5DBB A;  4ED7 A;  3EYZ A;  4R63 A;  3C1Z A;  3MFI A;  3PX4 A;  8ICC A;  3M8R A;  3UPQ A;  2AGP A;  1KTQ A;  5HR9 A;  5DG7 A;  5DED A;  3GV7 B;  4MEX A;  3H37 A;  5HHH A;  1BPD A;  1A77 A;  3Q8S B;  3MFH A;  5KT5 A;  2ASL A;  4RUC A;  8ICH A;  2ZTE A;  1IXR A;  2ZJA A;  1RPL A;  5J0X A;  4J9S A;  3UQ0 A;  4LT6 A;  4I2H A;  5DQG A;  3JPS A;  4J9L A;  4DS5 A;  4I2I A;  4J9R A;  1Y88 A;  3FDS A;  5III A;  2V9W A;  4NLN A;  9ICP A;  3C2K A;  3ZDD A;  1KEJ A;  3JPR A;  5HRB A;  1ZQH A;  1MIW A;  4DQP A;  1TVA A;  7ICF A;  4ECY A;  2DFL A;  4GXK A;  1TFR A;  5KFS A;  3PX0 A;  4QWA A;  5J0P A;  5KFT A;  3ZD9 A;  5KFO A;  4QZG A;  2JEJ A;  4KIT B;  3Q8K A;  1MC8 A;  4M6W A;  4KMU A;  4ED2 A;  4TUQ A;  5J0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...