4MFAA

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template o6mg and incoming ttp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
321
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title Structures of human DNA polymerase beta inserting bases opposite templating O6MG
rcsb
source organism Homo sapiens
total genus 108
structure length 321
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mfaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mfaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mfaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mfaA03
1AROP 4DOCA 1HJPA 3JPOA 3Q8KA 1TAUA 3MDAA 1ZQEA 2HW3A 2BCSA 4PGQA 3OJSA 2ZH6A 5KFPA 5DB7A 1NJXA 9ICHA 4WC5A 4X4OA 4QWEA 5KFVA 3G6XA 4JV0A 4YQWA 4YD2A 1NK9A 7ICIA 3GQCA 4QZIA 3KHLA 3RB3A 8ICZA 3MFIA 2J6SA 3UQ0A 4QZBA 4P4PA 4J9KA 3H37A 4YR3A 4Z6DA 5J0PA 2BPGA 4FHXA 4WBYA 3EWAA 7ICNA 4ED8A 5KFRA 1D8LA 2FPKA 3LWMA 1ZQHA 5KG4A 1L3SA 2ZH8A 3C2KA 4XQ8A 4RUCA 4KLMA 9ICOA 4WC3A 1RXVA 4B9MA 3UXNA 4WC6A 2HVHA 2BE3A 3SV3A 4C8NA 4DSKA 4RT2A 5DLFA 1OU5A 3T5JA 5J2DA 1Z00A 2W8LA 2ASJA 3GIJA 2BCQA 4RQ0A 4FBUA 4Q8EA 2AJQA 3MFHA 2KZ3A 4YCXA 2C2DA 1NK0A 3M8RA 2VANA 3K4GA 1Q79A 5DEDA 5KG2A 4XUSA 4AT9A 1X9SA 4IG8A 3M8SA 4WC1A 5KFBA 3AU2A 4R63A 5KFLA 4O3OA 3RAQA 3C66A 3RB0A 2HHVA 1ZQQA 4AT8B 4ZH4A 4MFFA 4LVSA 2IA6A 3PO4A 4EBJA 5DG8A 3QZ8A 5J0TA 3RR7A 5HHHA 4WBZA 1ZQIA 5EWGA 4UD4A 4WC7A 3RH6A 1TKDA 4P4OA 4LZGA 2ZUCA 3HPOA 3RJKA 2KTQA 4MFAA 4F8RA 2BQUA 4R64A 3TI0A 2P6RA 1ZQOA 1JIHA 5KT5A 1MSWD 2FLLA 5J2AA 4PH5A 4UAZA 3TFRA 4DQSA 1TK5A 4Q8FA 4NLZA 3GILA 2PFPA 4M9JA 4F4YA 5J0SA 4QZFA 4F5QA 1NK4A 1HUOA 4B9UA 1U47A 4ELUA 7ICLA 5IIIA 2RDJA 3GDXA 9ICWA 4GXIA 4DLGA 3RBEA 2FMQA 1ZQLA 3KHRA 3QE9Y 4I28A 1RZTA 3EW9A 4TQSA 5KFMA 4O5KA 1PX5A 4BWMA 4X0AA 2DR8A 4KITB 1U49A 5KFQA 4QZHA 1MIVA 5DBCA 4YD1A 2ZJAA 4IR9A 4DS4A 4AT8A 5KFSA 1BGXT 4FHYA 3RR8A 4EEYA 3SYZA 3PY8A 4DL6A 8ICUA 1K1SA 4IQUA 4FHWA 4JV2A 2I9GA 4DQQA 2ID1A 4RZRA 2HHUA 4AT7B 5JUMA 2J6TA 4X4PA 2C22A 1K1QA 5C5JA 3Q8RB 4PPXA 4NM2A 1ZQBA 8ICHA 3TAQA 4FO6A 1ZQZA 5J2JA 2XY6A 2BCUA 2AGPA 2PFOA 2PFQA 1MQ2A 1X9MA 4UB4A 3BQ0A 5J2CA 4F50A 1QSYA 3FDSA 1MC8A 4KLTA 4ED6A 4FHPA 2WTFA 1ZQPA 2IHMA 4RPYA 4JUZA 4UB5A 3H4DA 3HP6A 9ICCA 2O1PA 4KN4A 1KRPA 4M47A 2HHPA 1WOTA 1B43A 4QZ8A 4B9VA 1IM4A 5J0UA 4BGDA 2NRKA 1ZQXA 2JEJA 8ICMA 1B22A 3ISBA 5DB9A 4PGXA 4DSFA 3PNCA 4I27A 4KLGA 1ZQDA 1BNPA 1SKRA 1ZETA 1TK8A 5D46A 4UBCA 3ZDEA 4QZDA 3QEAZ 2JEIA 3JPPA 4YMOA 1HUZA 3H3AA 3M9NB 4KLDA 2ZJ5A 3RB4A 4O3RA 1KEJA 5DGAA 5DECA 1VFGA 1X2IA 2V9WA 5KG5A 3Q8LA 1S0MA 1NJYA 4AT7A 3B0XA 5DQHA 4DOBA 1XSPA 1ZQUA 1ZQFA 5DLGA 4EYHB 4F5OA 2V4RA 3H8WA 2KP7A 5J2BA 2BPCA 2Y1JA 4E8FA 7ICMA 2P6UA 4E7XA 2A1JB 4QW9A 2XGPA 2P66A 3OV7A 3IHQB 3MBYA 1NJZA 4KMUA 4R66A 1L3UA 7ICEA 4WC2A 1ZQAA 5KFTA 1JXEA 3V7JA 2XCAA 1NK7A 4O0IA 1NK5A 4BXOB 5L1LA 4ELVA 4F2RA 5KFGA 3TAPA 4QWCA 9ICGA 3MGIA 5KT4A 3GIMA 4J9OA 3ZD8A 1S77D 4KLEA 8ICTA 4UD5A 1ZQRA 4YMMA 5DBAA 5KT6A 5DBBA 9ICMA 4F5RA 4TUPA 2ASDA 2BPFA 4F3OA 4WC4A 1N48A 1SZPA 5HC9A 3TQ1A 4PHDA 8ICAA 3KTQA 3V7LA 4F4XA 1S0OA 4M9LA 3NTUA 3LWLA 4QWDA 5J0XA 1RYRA 4X4RA 4BDPA 5BOLA 5IIJA 5KFWA 5F9NA 3GIIA 4QW8A 5HRHA 1ZJNA 3SZ2A 1SL1A 3PW4A 2ZTDA 2R8GA 1NKBA 2W8KA 2XCPA 4C8LA 1QSLA 4IRCA 4ATBB 3PMNA 2J6UA 5CHGA 1U4BA 2DR7A 2A1JA 2UVUA 3LDAA 3C2MA 5J2EA 2M2VA 2Y1IA 5CR0A 5CB1A 4Q45A 4DO9A 4UB3A 4ECZA 4YG2A 4YR2A 4QZCA 4BXOA 4FH3A 5KFDA 4JWMA 9ICTA 3PR5B 4MF8A 2UVRA 4F91B 3E2EA 7ICPA 1ZQJA 3RJFA 4YXJA 5KFHA 4PHEA 3V6JA 3TARA 3THVA 1XC9A 4RT3A 5L1IA 7ICRA 4P4MA 2BDPA 4CCHA 2BKEA 4G3IA 1YLQA 3MGHA 3ISDA 4K4HA 3C5GA 4DL5A 2HHSA 4X4UA 1ZQVA 2VA8A 3RRGA 1S0VA 5IINA 1BVSA 4EBKA 1S0NA 4I29A 8ICSA 3GV8B 3ISCA 5KG6A 3FYHA 7ICVA 3AQKA 1BPYA 1JQRA 2XGQA 4IQWA 5KFEA 4O5EA 8ICGA 2ZHAA 4I2DA 2DPJA 4B9SA 2KFNA 1ZQSA 4UAYA 4J9RA 2W9CB 5DQIA 2R8HA 3M9MB 3TANA 1S97A 2AGQA 1KFDA 5HRDA 4ECUA 4J9MA 4UB2A 3PX0A 4DQPA 5F9LA 4B9LA 4XRHA 3WFSC 4KLOA 2ZTEA 3GIKA 4EZ9A 4B9NA 5KFJA 3OUYB 2R8IA 4YN4A 1XWLA 4KLHA 4DLEA 2HHXA 1S9FA 5KFKA 1ZQTA 1JX4A 4I2BA 4KLFA 4DSEA 5J0OA 4M9HA 9ICNA 3SI8A 4F5PA 1TFYA 8ICIA 1X9WA 5KFXA 1T3NA 3ZDAA 4FHVA 3BQTA 5D49A 4DEZA 4RQ6A 1D8YA 5L9XA 2MUTB 8ICLA 4DSJA 4RUAA 3MR3A 3JPNA 4MEYA 4O5CA 4XA5A 5L1KA 1S10A 8ICJA 3UPSA 2NRTA 3BDPA 2O5AA 2BCRA 2PI4A 1WCLA 1IXRA 4RPXA 4DOAA 1U9LA 4ED2A 5DG7A 1ZQYA 8ICRA 5IIKA 2FMPA 2BGWA 4ED3A 4KTQA 1NK8A 5KT3A 5EOZA 4DWIA 4M5DA 1BPDA 1Q78A 2Q0ZX 3PV8A 2W9CA 2PFNA 4RQ3A 4NKTA 4S3NA 4Z6CA 3AUOA 9ICUA 4TUQA 3T5KA 2C2EA 2B21A 1ZQGA 1NKCA 5DKWA 3RJJA 4X4VA 4QWBA 4RQ1A 4Q44A 3C5FA 2ZUDA 4YXMA 4DFKA 5CJ7A 4YVZA 5KT2A 2DPIA 3KHHA 2FLNA 3OUYA 2HHTA 2VA2A 2UVWA 4RWNA 4O3SA 4RNOA 5HNKA 2HVIA 3AQMA 1L3VA 4QZGA 3JPQA 2DR9A 5BPCA 5HMMA 2I1QA 4ECXA 3EZ5A 1UEUA 5D4BA 2MUTA 1T7PA 4ECWA 5HREA 5J2KA 1PZNA 1JMSA 4JK1A 4NXZA 3G6YA 5KFZA 1NJWA 1KDHA 1D9DA 4JWNA 4KLJA 2KZMA 1KSPA 4RQ4A 5IILA 4RQ2A 2ASLA 4B9TA 4EBCA 2ZH3A 1XS9D 2ZJ8A 4F4ZA 4ED1A 2UVVA 3H8JA 1A77A 3PR4A 8ICNA 1L5UA 2W9BB 3H38A 3PX6A 1XO1A 1QSSA 4DQRA 2GWSA 4DSIA 2ZH1A 2ZH9A 7ICOA 4PGYA 3QZ7A 4IRDA 4I2CA 4YMNA 3RBDA 4X4TA 5J29A 3ORYA 4IQVA 7ICKA 2OWOA 4E0DA 4I2EA 3AQLA 3AU6A 7ICGA 3WFPA 1DGSA 2NRVA 5J0WA 4TUSA 4KLSA 4BWJA 2PXIA 2C28A 3T5HA 2IHNA 8ICOA 3H8SA 3EYZA 5J0RA 1F5AA 1FA0A 2ZH7A 5CWRA 1H38A 1BPEA 2BR0A 5EWEA 2Q66A 1V4AA 1XSNA 5HRFA 5HR9A 4J9SA 1S76D 3UXPA 4FS2A 2BCVA 4RWPA 2H5XA 5IIMA 4F4KA 5J2HA 3B0YA 4ECQA 9ICKA 1A76A 1ZQKA 1QTMA 3PW2A 2KZZA 2V4QA 4GXJA 3PX4A 5CP2A 3OSNA 3V6HA 3H40A 5KFUA 1RYSA 1MIWA 5F2VO 4RU9A 4NLGA 1SL0A 5DB8A 3GV5B 2XY5A 2KFZA 3C18A 7ICHA 4UAWA 4ED0A 9ICVA 1UA0A 3JZ0A 2DR5A 1DOQA 4YP3A 4UB1A 2W9BA 4F4WA 4ECTA 3H4BA 3RTVA 1C7YA 2R8KA 1XU4A 2R8JA 5KT7A 9ICBA 1R8BA 2BHNA 4RQ8A 3V6KA 3PVXA 1ZYQA 1UETA 1JAJA 1U45A 9ICIA 3WFQE 4M2YA 9ICFA 1ZQMA 9ICEA 3Q8MA 3LQCB 5L1JA 3UQ2A 3OVSA 4DS5A 4F5NA 1MQ3A 3HX0A 3RJEA 4MFCA 8ICBA 3RJIA 4NKUA 5J2FA 1BPXA 4F2SA 3T3FA 1ZJMA 4YFKA 4DFMA 9ICAA 9ICRA 2W9AA 4KLUA 4M9GA 2M2WA 1TAQA 3NGDA 4NLNA 4FS1A 4PHAA 2KN7A 4UBBA 4ECVA 1RPLA 4I2GA 2FPLA 1TV9A 4R8UB 1R8AA 2DFLA 4DL2A 8ICPA 5HHIA 3JPRA 4RQ7A 2IMWP 3OHBA 3OVBA 8ICCA 1T8EA 2LYHA 4HYKA 9ICJA 3OSPA 4RPZA 1UEVA 3V7KA 4J9LA 1SL2A 2ZUBA 3C2LA 3Q8QB 5DDMA 3MR5A 3M9OB 2PI5A 1LV5A 9ICSA 4O3NA 9ICQA 5HRKA 3G6VA 1NKEA 3K75D 4IQTA 7ICSA 2XO7A 4DFJA 1DK3A 3GFKB 1TK0A 4I2IA 4ECSA 8ICQA 1L3TA 4EZ6A 1CUKA 2ZTCA 2FMSA 1T4GA 4ELTA 1R89A 4C8KA 9ICLA 4O3PA 3UPQA 5KFFA 4YR0A 4I2AA 4J9PA 4Z6EA 1JN3A 2ZH4A 5KFOA 8ICWA 4LZDA 5CA7A 1V9PA 2NRXA 3N97B 2BQRA 8ICYA 4DQIA 4GC6A 4FBTA 4IRKA 5HRGA 3AQNA 4X4QA 2IBKA 3HWTA 2FPMA 4GLXA 4QWAA 2W9MA 1Z3EB 4DFPA 3H39A 2ATLA 2AQ4A 3RAXA 4K4GA 4M04A 1KNYA 8ICVA 4WC0A 4MF2A 4DF4A 1ZQWA 4WCWA 1ZQNA 2MAXA 3C1ZA 3OHAA 2RFFA 5DDYA 4R8UA 3PMLA 5KTQA 5J2GA 5J0QA 3TFSA 1KLNA 4P2HA 7ICTA 4XQ7A 4QZ9A 3N4MB 8ICXA 3WFOA 3NYBA 2ZHBA 3BQ1A 3ETLA 4F92B 3ZDCA 3L9DA 3RH5A 1D9FA 4Q43A 4E80A 2BQ3A 9ICPA 1NZPA 4X4NA 8ICFA 4PHPA 3OGUA 2C2RA 4C8OA 4K4IA 1R8CA 3MR6A 4GC7A 3RB6A 3RJGA 1EXNA 4I2HA 4KLIA 2XY7A 4RNNA 1BNOA 2PBEA 5HMLA 4RQ5A 5J2IA 3RH4A 1DK2A 2RDIA 4KN7A 3BQ2A 1U48A 3Q8SB 4GXKA 2NRWA 3PW0A 3RJHA 4Z6FA 3UXOA 3LK9A 4FH5A 3EPIA 4J9QA 3MR2A 2JZBB 3C1YA 2VA3A 5HRIA 5KFYA 5KG7A 4O9MA 5KG1A 4DL4A 4DF8A 1VJ7A 1QLNA 3H7IA 3ZDBA 4ATBA 3PW7A 1RXWA 1N56A 1SKWA 4O3QA 3ZDDA 2AGOA 5KFAA 3JPSA 1NO5A 4EYIB 2F1JA 1UT5A 1XSLA 8ICEA 3C23A 1Y88A 1TVAA 5BOMA 4MEXA 3T5LA 5KG0A 4EBDA 2FLPA 4UQGA 1SKSA 2ISOA 3HIYA 3MABA 4I2FA 4M6WB 1NOMA 3Q8PB 4LT6A 4QZAA 5KFIA 7ICJA 2DVIA 1BPBA 4KLQA 2ZH5A 2DRAA 4F93B 2ISPA 3SV4A 1KFTA 4NY8A 3RRHA 4X5VA 5DQGA 4IR1A 7ICFA 3HT3A 4DL7A 4ECYA 4EBEA 4ECRA 2F1IA 3OJUA 5EWFA 3GV7B 2NRZA 1CEZA 1KTQA 4M9NA 3JYYA 4NLKA 3PW5A 4KLLA 2M2TA 1MIYA 5KFCA 4EP7A 4NM1A 5HRBA 3MDCA 3OVAA 5KFNA 3PO5A 4QZEA 3KHGA 3WFRE 3IM1A 1JXLA 4X4SA 2XC9A 2JEGA 1TFRA 2JZBA 1ZQCA 5TZVA 1BPZA 9ICXA 2ZH2A 7ICQA 4RWOA 4JV1A 4I2JA 8ICKA 3JPTA 3V72A 3BJYA 4DL3A 4J9NA 3HJ1A 5J0YA 4DSLA 5HRLA 5DB6A 4ED7A 2JEFA 3ZD9A 2M2UA 1LB2B 2HHWA 3C21A 5KG3A 1NK6A 2DRBA 2M9NA 4C8MA 4RWQA 1Z00B 1WCNA 3EPGA 7ICUA 2ALZA 1KFSA 3HJ4A 1UA1A 4M6WA 2F1HA 4RNMA 4R65A 4X0BA 1UT8A 5DGBA 3QEBZ 4TQRA 4TURA 1COOA 4M0AA 4AT9B 2AU0A 1TFWA 5DG9A 5HP4A 3HW8A 2HHQA 5IIOA 2AQ0A
chains in the Genus database with same CATH superfamily
2WF6A 4PGQA 3L3FX 9ICHA 3GQCA 4Y2QA 2DF4B 4QZIA 2F77X 2LBOA 7ICNA 3QU5A 1ZD5A 4DSKA 4RT2A 1Z19A 2BCQA 2H3ZA 4ICAA 1GO3F 4YCXA 2C2DA 1Q79A 3M8RA 5AKYA 2B56A 1N61A 2G09A 2B0CA 3M8SA 4WC1A 5KFBA 5KFLA 3NVVA 4O3OA 3HJEA 2F8KA 2W7PA 3RB0A 3C66A 2EAMA 1NZBA 5DG8A 3KKAA 5EE9A 2EAOA 5HHHA 3IG5A 4WC7A 5ALRA 3HPOA 2KTQA 1PVPA 4C4RA 5ALEA 4F8RA 4R64A 3TI0A 5KT5A 5ALMA 9ICRA 3GILA 1NK4A 4QZFA 4F5QA 4WQKA 1U47A 3RBEA 2FMQA 3EW9A 4TQSA 5KFMA 1U49A 5KFQA 3CRXA 4EENA 4FHYA 1L8LA 2HOFA 5AK3A 1O03A 4KX3A 5ALTA 4JV2A 4RZRA 1L7OA 5JUMA 5C5JA 4PPXA 3TAQA 3SR6A 5J2JA 3DDHA 4FO6A 1QCKA 2BCUA 2AGPA 1X9MA 5J2CA 4F50A 1QSYA 2EWRA 1OUQA 1MC8A 1M6YA 4ED6A 4FHPA 3NRZA 4RPYA 3IN5A 4WQLA 1FFVA 2HHPA 2B6GA 1VJ5A 2DKZA 4QZ8A 5HR7A 2VJ4A 1Q3VA 2LPEA 8ICMA 1ZD4A 3PNCA 4NLCA 1SKRA 1ZETA 1TK8A 3QEAZ 4UBCA 3ZDEA 5AM2A 2HCFA 1HUZA 3M9NB 3H3AA 2ZJ5A 1NI3A 5HR6A 5JTGA 5DGAA 2G5HB 4FZMA 4CDGA 1T94A 1XO0A 4C7ZA 1JROA 4LEVA 2DUYA 5AK4A 1WWUA 3SAFA 2P66A 3IHQB 2MU2A 3MBYA 4WC2A 1ZQAA 5KFTA 3V7JA 2IUBA 2XCAA 4O0IA 1N60A 5ALXA 1TE2A 3SENA 3MGIA 3GIMA 4J9OA 5C0YA 4KLEA 5ALKA 1ZQRA 2WAQC 5DBBA 4F5RA 4WC4A 1N48A 1Z4NA 2JH7A 8ICAA 5T14A 4F4XA 3NTUA 5J0XA 4BDPA 5BOLA 5KFWA 1N2XA 5CFUA 4QNLA 1UHUA 5AKGA 4Y2RA 4CNQA 3PW4A 2ZTDA 3PZPA 1SL1A 2W8KA 2J6UA 4UATA 2WHEA 2Y1IA 5CR0A 5CB1A 4Q45A 4UB3A 4ECZA 4YR2A 4QZCA 4BXOA 4EEDA 2EZYA 9ICTA 3BQ7A 2UVRA 3RJFA 4FZNA 4P4MA 4G3IA 3ISDA 2HHSA 2ZIVB 3N28A 1BVSA 4C7YA 2H3IA 4BUGA 4OCZA 3WK8A 1BPYA 2W3RA 2XGQA 2WF8A 3E0FA 2HOQA 4I2DA 2DPJA 2KFNA 3U26A 1ZQSA 2W9CB 1S97A 2AGQA 3NVOA 1FFUA 4UB2A 4CGZA 3KZIU 2YY6A 1SZHA 3WK7A 2R8IA 4KLHA 2XIDA 4AYBC 3AQFA 1L8OA 4I2BA 4KLFA 3SI8A 1TFYA 3QU9A 1T3NA 5D49A 5A0LA 3JPNA 5L1KA 4P0QA 5FP0A 3BDPA 1IXRA 1WYGA 4ED2A 2JH1A 2FMPA 4KTQA 1NK8A 5EOZA 1BPDA 4MKPA 1Q78A 4NKTA 4K9AA 3NWIA 3AUOA 2KKPA 3T5KA 4LJXA 5AKZA 2ZIXB 1UQVA 4YXMA 4DFKA 2FLNA 5CJ7A 2D3DA 4Y2UA 2VA2A 2JRZA 2UVWA 2K4HA 4RWNA 3HILA 4RNOA 3AQMA 2LKYA 2DR9A 5BPCA 2I1QA 4ECXA 1JMSA 5KFZA 4M5DA 2ZH3A 1XS9D 3H8JA 1XNSA 1A77A 8ICNA 4DSIA 4I2CA 4UB8U 4IQVA 3HKZF 4I2EA 1T3QA 7ICGA 2LM4A 3GU3A 1VLBA 4TUSA 4KLSA 8ICOA 3EYZA 1H38A 4NXTA 1UCVA 5EWEA 2DKXA 2G07A 3E58A 3UXPA 1S76D 2BCVA 5AHXA 4ECQA 9ICKA 1QTMA 1KBUA 2V4QA 4A8EA 3V6HA 4RU9A 1SL0A 2KFZA 1IV8A 1RM6C 3R9KA 2DR5A 3TKAA 4YP3A 2W9BA 4ECTA 1C7YA 2R8KA 3H4BA 3RTVA 3IV6A 2YMLA 5KT7A 5GTHU 2BHNA 5D62A 2F2AB 1ZYQA 1U45A 9ICIA 9ICFA 4DFDA 4F72A 5TISU 2GLEA 1MQ3A 5J2FA 3DEEA 4EX7A 1HIWA 2W9AA 2E8PA 1TAQA 3PHZA 1RPLA 4DL2A 2W3SA 2IMWP 3OHBA 3QU2A 8ICCA 1T8EA 1UEVA 4OJLA 2ZUBA 1WG8A 5DDMA 3MR5A 1LV5A 1NKEA 3K75D 4IQTA 7ICSA 4KX5A 5D63A 2FMSA 1T4GA 2QB0B 2AHOB 2ZH4A 5KFOA 4ATBB 5ALHA 3SAHA 5HRGA 2W9MA 3WKEA 4K4GA 8ICVA 4DF4A 1ZQWA 1ZQNA 3OHAA 2JGAA 2FE9A 5DDYA 5J0QA 2MA1A 4OJOA 3NYBA 2BQ3A 4X4NA 4PHPA 3MR6A 3RJGA 3BZKA 4I2HA 1BNOA 2PBEA 5HMLA 2OM6A 4KN7A 3Q8SB 2KIVA 4GXKA 3RJHA 3EPIA 5HRIA 5KFYA 4DL4A 2W43A 2VJ5A 4DF8A 5KAFU 1NO5A 2BDUA 2YB4A 2F1JA 8ICEA 2G06A 1TVAA 1NNLA 3DV9A 3T5LA 5KG0A 2ISOA 1SKSA 3AN1A 2KD1A 2W7OA 5ALJA 3I1YA 4Y2TA 4QZAA 2DVIA 1BPBA 3SMVA 4WJ3B 1KFTA 4Y2YA 5DQGA 4EBEA 4ECRA 2NRZA 4M9NA 4KLLA 5KFCA 4US8A 3MGVA 1TFRA 2JZBA 3I28A 5TZVA 1ZQCA 4RWOA 3ICXA 8ICKA 3JPTA 1QQ7A 3WU2U 2JEFA 2M2UA 5AIBA 2M9NA 4C8MA 2WAQF 1WCNA 3PSIA 3EPGA 2KICA 1UA1A 4M6WA 5AI5A 1PUZA 2F1HA 4R65A 4TQRA 1COOA 4M0AA 4AT9B 2AU0A 1TFWA 1PVRA 3Q8KA 1TAUA 2KNJA 2BCSA 2ZH6A 1NJXA 4WC5A 4X4OA 4QWEA 2JHDA 2ZIWA 4YD2A 3RB3A 8ICZA 5CFTA 3MFIA 2HI0A 2KSOA 2J6SA 4Z6DA 3EWAA 3NVYA 4ED8A 2FPKA 5KG4A 1L3SA 4XQ8A 1N63A 4B9MA 3UXNA 4WC6A 3T5JA 5B3QA 4RQ0A 4Q8EA 1NK0A 2VANA 3K4GA 4XUSA 2O6KA 1PK1B 3F53A 2HHVA 1ZQQA 4ZH4A 4BJQA 2Z7JA 2KV2A 5J0TA 4WBZA 1ZQIA 5EWGA 2GA9D 4O69A 2K4PA 3RJKA 4QIWF 2BQUA 1MSWD 4UAZA 4DQSA 4NLZA 2KKVA 7ICLA 5IIIA 9ICWA 1ZQLA 4O5KA 4BWMA 4QZHA 4IR9A 4AT8A 4C0ZA 5KFSA 2DL0A 4JLZA 4EEYA 3PY8A 2N1RA 4AT7B 2J6TA 1K5OA 4X4PA 1K1QA 1ZQBA 1LKYA 1ZQZA 5AI0A 2Y0SF 2PFOA 5AKLA 4NXXA 4UB4A 2WF7A 1RDFA 9ICCA 4M47A 1KRPA 1WOTA 1B43A 4BGDA 1ZQXA 5DB9A 4KLGA 2E1FA 4NL9A 1ZQDA 5ALWA 5D46A 4YMOA 4CF4A 1RYUA 2FCLA 4O3RA 1FEZA 1KEJA 4BX9C 5DECA 1X2IA 2E8OA 2DGZA 2V9WA 2M0NA 5DQHA 1ZQFA 5ALYA 2IOFK 2KP7A 2BPCA 2Y1JA 4E7XA 2A1JB 4FFDA 3OV7A 2KHVA 1VDVA 1NJZA 3LVWA 3AEVA 3S6JA 1JXEA 3NS1A 1NK5A 4UAUA 1V85A 3WK6A 5KFGA 4QWCA 1S77D 4UD5A 8ICTA 2OH2A 4YMMA 1Q3UA 1DGJA 3TQ1A 3KTQA 3V7LA 2LM1A 5F9NA 5AI9A 3SZ2A 1X42A 1NKBA 2XCPA 4C8LA 4IRCA 2GOLA 2DR7A 2B4VA 3LDAA 3F2DA 4YG2A 4JWMA 4MF8A 7ICPA 1ZQJA 3V6JA 3THVA 1XC9A 4J03A 3GZFA 2BDPA 4CCHA 2BKEA 1YLQA 3C29A 4F71A 1HEKA 3NVZA 3D6JA 3ZI4A 4I29A 2LMRA 8ICSA 3ISCA 3KBBA 5KL8B 2W04A 4O5EA 2A1AA 4G9BA 2W11A 4UARA 4J9RA 5DQIA 3ER9B 2BBHA 1A6SA 4J9MA 4GFJA 5F9LA 4AP9A 1GPJA 5KFJA 4O68A 2HHXA 1CI4A 1S9FA 1JX4A 2PMZC 4F5PA 3ZDAA 4FHVA 2G0AA 4MEYA 2IOHA 8ICJA 2YQEA 2NRTA 3H8MA 2PI4A 1WCLA 2HN1A 2Y9UA 3UM9A 1ZQYA 5DG7A 2NYVA 4ED3A 5EE3A 1URJA 2Q0ZX 2PFNA 3M6ZA 2G08A 4K8VA 4S3NA 9ICUA 2B21A 2LYAA 1ZQGA 5DKWA 3RJJA 3FC4A 4RQ1A 1ECWA 2G5IB 5JRTA 5KT2A 5B66U 2DPIA 3OUYA 4O3SA 2HVIA 4QZGA 3D2QA 2KJ9A 2MUTA 2P35A 4ECWA 2OXOA 1T7PA 5J2KA 3J81j 4KB6A 2H3QA 1D9DA 4B9TA 2ZJ8A 4K96A 3PR4A 1L5UA 2GWSA 4DQRA 3QZ7A 4LEZA 4X4TA 3ORYA 3PSPA 1L7NA 3BS7A 2R18A 4HAIA 2NRVA 1SGGA 2PXIA 2C28A 3A0BU 3H8SA 3OTQA 2XI9A 1BPEA 1X6JA 1V4AA 3QNMA 4RWPA 2QLTA 4QJFB 5JTIA 4WOYA 5J2HA 3B0YA 2YTUA 1A76A 3PW2A 4GXJA 3OSNA 1RYSA 2GH1A 3H40A 5F2VO 3GV5B 4ED0A 5ALQA 1DOQA 2KVSA 9ICBA 1S8OA 3NRWA 2AH5A 2ZG6A 1WUDA 4KMOB 2Q4TA 1UETA 1JAJA 4JMUA 1WWVA 4M2YA 5AIAA 1ZQMA 9ICEA 3Q8MA 1KKXA 4NWIA 3OVSA 4DS5A 4F5NA 8ICBA 4F2SA 3T3FA 9ICAA 2M2WA 2K4EA 3NGDA 2MRLA 2KN7A 4I2GA 3JPRA 4DCCA 3CK6A 2WB1C 1QQ5A 5ALZA 3CYMA 3C2LA 3Q8QB 3VCBA 9ICSA 3MC1A 3QUQA 4O3NA 5ALPA 5HRKA 3G6VA 3M6KA 2K8BB 2B51A 2XO7A 4DFJA 1L3TA 1ZQ1C 1CUKA 4C8KA 4O3PA 3UPQA 4B6JA 5KFFA 3M1YA 3SAGA 3N97B 2NRXA 3F5AA 8ICYA 1IG6A 4FBTA 4GC6A 2HBLA 3K7DA 4GLXA 2YMMA 4DFPA 2LI6A 3SD7A 3WKDA 3ER8C 4R8UA 5KTQA 5J2GA 4XQ7A 2ESEA 3WFOA 2GAFD 4JB3A 3ETLA 4F92B 5JU5A 3L9DA 4K97A 4K4IA 2C2RA 2JMGA 1EXNA 5GTIU 5J2IA 3BQ2A 4C80A 2NRWA 3UXOA 4ZOHC 5ALLA 4J9QA 3MR2A 2VA3A 3C1YA 4OAHA 5KG1A 2EANA 1VJ7A 3H7IA 3ZDBA 5AM4A 1RXWA 4O3QA 2AGOA 3KD3A 5KFAA 3F5EA 4EYIB 1UT5A 2ZIUA 4MEXA 5AKHA 4I2FA 5CRXA 1NOMA 2QARB 4KLQA 2ISPA 4NY8A 4UASA 3AM9A 4OJ6A 5AM1A 2M2TA 4EP7A 2W55A 2FI1A 4ACOA 2CN1A 2I5HA 3MDCA 3OVAA 5KFNA 3PO5A 4QZEA 4WH5A 3WFRE 4P0PA 3IM1A 1J97A 2XC9A 1COKA 9ICXA 1UPHA 7ICQA 1ED1A 4I2JA 4EEBA 2RP5A 4IS7A 3V72A 4DL3A 1SIJA 5J0YA 3N7SC 3ZD9A 1B4FA 3C21A 1Z1VA 1NK6A 2JV3A 4EGWA 7ICUA 2ALZA 1KFSA 3HJ4A 2OHFA 2F76X 3QEBZ 5DGBA 4TURA 5DG9A 3HW8A 2HHQA 2AQ0A 2E3TA 5E79U 1SWWA 3JPOA 4Y2PA 3MDAA 1YT3A 3OJSA 2EAPA 3BZCA 5KFPA 5DB7A 3G6XA 4JV0A 4YQWA 7ICIA 3KHLA 1F0MA 3L5KA 4P4PA 4J9KA 3UQ0A 3H37A 2BPGA 5KFRA 5ALGA 3AMZA 2WF5A 4KLMA 1ZRMA 3BS5A 1RXVA 4OJ5A 3KFUF 4C8NA 5ALNA 5J2DA 3D2SA 1Z00A 2W8LA 3GIJA 1SV0A 1L6NA 4UB6U 2DQNB 4FBUA 2AJQA 5DEDA 3M7DA 1X9SA 2JR5A 4OO1J 3PO4A 4EBJA 2IHOA 5AI6A 2RHFA 4U6PA 3RR7A 4UD4A 3RH6A 4USAA 2ZUCA 2OYYA 2PMZF 1AQ6A 2YMPA 4C4SA 3KKAC 4M9JA 2PFPA 7ICVA 4B9UA 1JQRA 2RDJA 3GDXA 5HRLA 4I28A 3H0LB 3QE9Y 4X0AA 2DR8A 1JRPA 1MIVA 5DBCA 2ZJAA 3RR8A 3SYZA 3L4PA 8ICUA 4IQUA 4FHWA 1O08A 2I9GA 4DQQA 2HHUA 2C22A 5CFSA 5CEHA 3Q8RB 8ICHA 4NM2A 3QUTA 1QH9A 1F44A 2PFQA 5G5HA 1MQ2A 3BQ0A 5AKEA 4KLTA 2WTFA 1ZQPA 1D8BA 2IHMA 3H4DA 4UB5A 2O1PA 3HP6A 4KN4A 2YN4A 2K8AA 4B9VA 1IM4A 5J0UA 2NRKA 5ALDA 2FDRA 2YB1A 3ISBA 2EQYA 2JEIA 3JPPA 3UMCA 1OW5A 1VFGA 5KG5A 3Q8LA 1S0MA 5B3PA 3B0XA 3VC8A 4DOBA 5AM0A 1ZQUA 1XSPA 4EYHB 4F5OA 3H8WA 5J2BA 2XICA 7ICMA 5K4LA 2L5YA 4U7CA 5KL1B 4QW9A 2XGPA 5AI8A 4R66A 4KMUA 3AQEA 1OXJA 2OCEA 1NK7A 4BXOB 3N7PD 5KT4A 3ZD8A 5ALFA 4HX0A 5DBAA 5KT6A 4TUPA 2ASDA 2BPFA 4F3OA 1SZPA 4PHDA 4K9BA 4M9LA 2KE7A 5ALOA 4CE6A 1TAMA 4O67A 1LVHA 3GIIA 5F3XB 4QW8A 3K1ZA 3PSFA 3PMNA 1U4BA 3SEIA 3C2MA 2M2VA 4K99A 4FH3A 1ZOLA 2EDUA 3E2EA 4YXJA 5KFHA 3TARA 5L1IA 1PK3A 4JLXA 3MGHA 4DL5A 1ZQVA 3RRGA 4P0QB 2EH9A 4EBKA 1S0NA 1KL9A 3AQKA 3FYHA 2W54A 4AYBF 4IQWA 4B9SA 2OEHA 2R8HA 3M9MB 1KFDA 4EX6A 4DQPA 4XRHA 2WF9A 2ZTEA 4B9NA 2D8CA 3CP8A 1XWLA 4DLEA 5KFKA 9ICNA 3QU7A 5KFXA 3BQTA 4DEZA 8ICLA 4DSJA 4RUAA 2Y9TA 4OJPA 2ZIVA 4XA5A 2KG5A 2BCRA 3F2BA 4DOAA 1J2NA 8ICRA 5IIKA 3FM9A 5KT3A 4UAVA 3PV8A 2W9CA 4RQ3A 1Z1BA 3TADA 4EEKA 1RQLA 4TUQA 4X4VA 3C5FA 2ZUDA 4YVZA 4US9A 1SV4A 2HMXA 5HNKA 3JPQA 1X6IA 1ZRNA 5KNIA 5HMMA 3EZ5A 5HREA 1PZNA 4JK1A 3G6YA 4KLJA 4RQ4A 5IILA 4RQ2A 5KAIU 1SB3C 4F4ZA 4ED1A 2UVVA 3IDWA 3F2CA 2W9BB 3H38A 1XO1A 2ZH9A 1N5WA 7ICOA 5G5GA 1JI7A 2HBKA 5J29A 7ICKA 3I76A 1YZ6A 4MHVA 2OWOA 3AQLA 4LEYA 4OAFA 3EUB2 4PJ0U 2ZIXA 5J0WA 3T5HA 2ZH7A 3WKBA 1XSNA 5HRFA 2H5XA 5IIMA 4F4KA 5CP2A 5KFUA 4NLGA 3C18A 5DB8A 2E8NA 9ICVA 3JZ0A 5B5EU 4F4WA 1MA7A 1XU4A 5AM3A 3UMGA 2LYBA 4RQ8A 5EE1A 1N5XA 3PVXA 2D6FC 4Y2XA 3WFQE 2XVTA 3NUQA 4NXUA 3LQCB 5L1JA 3UQ2A 1V97A 3RJIA 2H3VA 1BPXA 1ZJMA 4DFMA 3CW2C 4KLUA 2HN2A 4NLNA 4FS1A 3H0MB 1F5SA 2F44A 4PHAA 4ECVA 4UBBA 2FPLA 1R8AA 8ICPA 1JALA 2K8CB 5HHIA 5J8YA 4O6AA 2NO4A 4HYKA 2LYHA 4PZNA 1QQ6A 3OSPA 4J9LA 2PI5A 1DK3A 4OAGA 1TK0A 1X66A 2ZTCA 2EZXA 9ICLA 4I2AA 4J9PA 1JN3A 1SV0C 4FO1A 1YZ7A 5CA7A 3QU4A 5AKKA 2BQRA 4DQIA 2E8MA 3AQNA 3HWTA 2FPMA 1Z3EB 1A0PA 2ATLA 2AQ4A 1IIPA 4WCWA 3C1ZA 2RFFA 3TFSA 7ICTA 2ZHBA 4EELA 2CPRA 8ICXA 3ZDCA 1D9FA 4E80A 1NZPA 4C4TA 1SXDA 3OGUA 1R8CA 4GC7A 4IL6U 4KLIA 2PKEA 3RH4A 2QB1A 3PW0A 3IRUA 1C20A 4Z6FA 2JZBB 2QB0A 3ETRA 4ATBA 1N56A 1SKWA 4O3MA 3ZDDA 3JPSA 4EBDA 2FLPA 4FE3A 4UQGA 4M6WB 3Q8PB 2RLTA 7ICJA 4Y2JA 2DRAA 3QUBA 3SV4A 4X5VA 2K60A 4IR1A 7ICFA 4DL7A 3H39A 2F1IA 1CEZA 1KTQA 3JYYA 4NLKA 4NM1A 5HRBA 2ODGA 3KHGA 2ZIWB 1FIQA 3ONNA 4X4SA 4CRXA 2KSOB 1BPZA 2ZH2A 2HOIA 3FAHA 4JV1A 2KIWA 3BJYA 4J9NA 3HJ1A 5DB6A 4ED7A 2HHWA 5KG3A 5H2FU 4NJ8A 5AK5A 4RWQA 3IP4B 4RNMA 2CRXA 4IG8A 5IIOA 1AROP 4DOCA 2F8LA 1HJPA 1ZQEA 2HW3A 3ALRA 4UW9A 1MN8A 4EV6A 5KFVA 5AM5A 1NK9A 3LVVA 4QZBA 4FHXA 4YR3A 4WBYA 5J0PA 3LWMA 1D8LA 1ZQHA 4LEWA 1V38A 4NLBA 2ZH8A 3C2KA 4RUCA 9ICOA 4WC3A 2HVHA 2BE3A 3SV3A 4NXWA 5DLFA 1OU5A 2ASJA 4IC9A 3HRDD 3MFHA 2KZ3A 4CF5A 5KG2A 4AT9A 5AKXA 3AU2A 4R63A 2CXYA 3RAQA 1JUDA 4FZLA 4AT8B 4MFFA 4LVSA 2IA6A 1RG6A 1ZXIA 3QZ8A 2ZXHA 1LKYB 2YX8A 1TKDA 3ED5A 4P4OA 4LZGA 2KMDA 5ALUA 4MFAA 2P6RA 2DBYA 1JIHA 1ZQOA 2FLLA 2AXTU 5J2AA 4PH5A 3UMBA 1P7DA 2KVCA 3TFRA 1TK5A 4Q8FA 1S5LU 4F4YA 3QYPA 5J0SA 1HUOA 4ELUA 5AKJA 3LYSA 4GXIA 4DLGA 3KHRA 1PVQA 1RZTA 1PK1A 1PX5A 4KITB 4QIWC 2KJ8A 4YD1A 4DS4A 4PL1A 1BGXT 5ALIA 4DL6A 2NV3A 1K1SA 2H3FA 2ID1A 2XY6A 2HDOA 3H0RB 2KK0A 3QX7A 3FDSA 4K98A 3B9JA 2I6XA 4JUZA 1KW4A 2W03A 1X9XA 3JCFA 2A19A 3WK4A 2GO7A 2JEJA 2Y0SC 1B22A 4DSFA 4PGXA 4I27A 1BNPA 4KM5A 4QZDA 4KLDA 3RB4A 3TADC 4GIBA 3AL0B 1NJYA 4AT7A 3WK5A 5DLGA 3O0FA 2V4RA 3D2NA 4E8FA 2P6UA 2JXJA 4NL9C 1Q8KA 2BZFA 1L3UA 2EZZA 7ICEA 5L1LA 3QUCA 4ELVA 3C28A 4F2RA 3TAPA 9ICGA 4I0UA 4Y2SA 9ICMA 5HC9A 2MSNA 1S0OA 3LWLA 4QWDA 1RYRA 4X4RA 5IIJA 5HRHA 1ZJNA 2R8GA 1QSLA 3CNHA 3SQIA 5CHGA 2E5SA 2A1JA 1FO4A 2UVUA 5J2EA 5AK6A 4DO9A 5KFDA 3PR5B 4F91B 4PHEA 2HBMA 4RT3A 7ICRA 3EF2A 5AKIA 4K4HA 3C5GA 4X4UA 3WK9A 2KOBA 2VA8A 4N7RA 1S0VA 5IINA 4OD0A 2ES6A 3GV8B 5KG6A 2E1EA 2HBJA 5KFEA 2ZHAA 8ICGA 1L7MA 2F3NA 5L1MA 4UAYA 5HRDA 3TANA 3MCRA 1L7PA 3OPXA 4ECUA 3PX0A 3WFSC 4B9LA 4KLOA 3GIKA 4EZ9A 3OUYB 1B0XA 1X40A 4YN4A 3TACB 1KQQA 1ZQTA 4M9HA 4DSEA 5J0OA 5J8YC 8ICIA 1X9WA 4RQ6A 1D8YA 5L9XA 2MUTB 3MR3A 5EE0A 4O5CA 3UPSA 1S10A 2O5AA 4RPXA 1U9LA 1Z4OA 2IOFA 1DXSA 2BGWA 4DWIA 4Z6CA 2ZXIA 2C2EA 1NKCA 1CRXA 5CHEA 4QWBA 4Q44A 3KHHA 2HHTA 1KN5A 2VKQA 1L3VA 3ERCC 1DRGA 1UEUA 5D4BA 3KZXA 4NXZA 1KDHA 2K4IA 2HSZA 1NJWA 2KZMA 4JWNA 1KSPA 2RRDA 2ASLA 4EBCA 3PX6A 1QSSA 2ZH1A 4PGYA 4IRDA 4YMNA 3RBDA 3RF9A 4E0DA 3QXGA 3AU6A 3WFPA 1DGSA 4PL2A 3NKUA 4BWJA 2IHNA 1F5AA 5J0RA 1FA0A 5CWRA 2LHTA 2BR0A 2Q66A 5HR9A 4J9SA 4FS2A 1ZQKA 2KZZA 3PX4A 2WFAA 2YMQA 1MIWA 2XY5A 7ICHA 4UAWA 1UA0A 5ALVA 4UB1A 2R8JA 5AICA 1R8BA 2KHQA 3K1RB 3V6KA 2KEYA 3HX0A 3RJEA 2WB1F 4MFCA 1SWVA 4NKUA 4YFKA 3NASA 4M9GA 3OWGA 1SXEA 1TV9A 3RFAA 4R8UB 2DFLA 1J2MA 4RQ7A 1N62A 3OVBA 2VIXA 9ICJA 4RPZA 3WKAA 3V7KA 1SL2A 3M9OB 9ICQA 4XJEA 4NV0A 2QKQA 3GFKB 4I2IA 4ECSA 8ICQA 4EZ6A 1R89A 4ELTA 4YR0A 4Z6EA 2DWQA 8ICWA 4LZDA 1V9PA 4IRKA 4X4QA 2K89A 2IBKA 4QWAA 2ZIUB 3RAXA 1KNYA 3PSTA 4M04A 4WC0A 4MF2A 4RQNA 2MAXA 3PMLA 4CF3A 1KLNA 4P2HA 4QZ9A 3N4MB 3BQ1A 3RH5A 5D61A 4Q43A 9ICPA 8ICFA 1Q46A 4C8OA 3RB6A 3N7RC 4NXVA 2XY7A 4RNNA 4RQ5A 1DK2A 2RDIA 1U48A 4P0PB 3A0HU 4PZOA 3LK9A 4FH5A 5KG7A 4O9MA 2RQ5A 1QLNA 3PW7A 4OAIZ 2FJ6A 3T79A 4Y2VA 1XSLA 3C23A 1Y88A 5BOMA 2NO5A 3HIYA 2KJ5A 3MABA 5ALSA 4LT6A 2BBJA 5KFIA 2ZH5A 3NVWA 4F93B 3KOOA 3RRHA 3HT3A 4ECYA 3GV7B 3OJUA 5EWFA 3PW5A 1MIYA 4RQMA 1JXLA 1ZD2P 5AI4A 2JEGA 3IG8A 3HKZC 4DSLA 3BS5B 1LB2B 1RQNA 2DRBA 1Z00B 2QARA 3WKCA 2A3VA 4X0BA 1UT8A 5HP4A 1ZD3A
chains in the Genus database with same CATH topology
1AROP 4DOCA 1HJPA 3JPOA 3Q8KA 1TAUA 3MDAA 1ZQEA 2HW3A 2BCSA 4PGQA 3OJSA 2ZH6A 5KFPA 5DB7A 1NJXA 9ICHA 4WC5A 4X4OA 4QWEA 5KFVA 3G6XA 4JV0A 4YQWA 4YD2A 1NK9A 7ICIA 3GQCA 4QZIA 3KHLA 3RB3A 8ICZA 3MFIA 2J6SA 3UQ0A 4QZBA 4P4PA 4J9KA 3H37A 4YR3A 4Z6DA 5J0PA 2BPGA 4FHXA 4WBYA 3EWAA 7ICNA 4ED8A 5KFRA 1D8LA 2FPKA 3LWMA 1ZQHA 5KG4A 1L3SA 2ZH8A 3C2KA 4XQ8A 4RUCA 4KLMA 9ICOA 4WC3A 1RXVA 4B9MA 3UXNA 4WC6A 2HVHA 2BE3A 3SV3A 4C8NA 4DSKA 4RT2A 5DLFA 1OU5A 3T5JA 5J2DA 1Z00A 2W8LA 2ASJA 3GIJA 2BCQA 4RQ0A 4FBUA 4Q8EA 2AJQA 3MFHA 2KZ3A 4YCXA 2C2DA 1NK0A 3M8RA 2VANA 3K4GA 1Q79A 5DEDA 5KG2A 4XUSA 4AT9A 1X9SA 4IG8A 3M8SA 4WC1A 5KFBA 3AU2A 4R63A 5KFLA 4O3OA 3RAQA 3C66A 3RB0A 2HHVA 1ZQQA 4AT8B 4ZH4A 4MFFA 4LVSA 2IA6A 3PO4A 4EBJA 5DG8A 3QZ8A 5J0TA 3RR7A 5HHHA 4WBZA 1ZQIA 5EWGA 4UD4A 4WC7A 3RH6A 1TKDA 4P4OA 4LZGA 2ZUCA 3HPOA 3RJKA 2KTQA 4MFAA 4F8RA 2BQUA 4R64A 3TI0A 2P6RA 1ZQOA 1JIHA 5KT5A 1MSWD 2FLLA 5J2AA 4PH5A 4UAZA 3TFRA 4DQSA 1TK5A 4Q8FA 4NLZA 3GILA 2PFPA 4M9JA 4F4YA 5J0SA 4QZFA 4F5QA 1NK4A 1HUOA 4B9UA 1U47A 4ELUA 7ICLA 5IIIA 2RDJA 3GDXA 9ICWA 4GXIA 4DLGA 3RBEA 2FMQA 1ZQLA 3KHRA 3QE9Y 4I28A 1RZTA 3EW9A 4TQSA 5KFMA 4O5KA 1PX5A 4BWMA 4X0AA 2DR8A 4KITB 1U49A 5KFQA 4QZHA 1MIVA 5DBCA 4YD1A 2ZJAA 4IR9A 4DS4A 4AT8A 5KFSA 1BGXT 4FHYA 3RR8A 4EEYA 3SYZA 3PY8A 4DL6A 8ICUA 1K1SA 4IQUA 4FHWA 4JV2A 2I9GA 4DQQA 2ID1A 4RZRA 2HHUA 4AT7B 5JUMA 2J6TA 4X4PA 2C22A 1K1QA 5C5JA 3Q8RB 4PPXA 4NM2A 1ZQBA 8ICHA 3TAQA 4FO6A 1ZQZA 5J2JA 2XY6A 2BCUA 2AGPA 2PFOA 2PFQA 1MQ2A 1X9MA 4UB4A 3BQ0A 5J2CA 4F50A 1QSYA 3FDSA 1MC8A 4KLTA 4ED6A 4FHPA 2WTFA 1ZQPA 2IHMA 4RPYA 4JUZA 4UB5A 3H4DA 3HP6A 9ICCA 2O1PA 4KN4A 1KRPA 4M47A 2HHPA 1WOTA 1B43A 4QZ8A 4B9VA 1IM4A 5J0UA 4BGDA 2NRKA 1ZQXA 2JEJA 8ICMA 1B22A 3ISBA 5DB9A 4PGXA 4DSFA 3PNCA 4I27A 4KLGA 1ZQDA 1BNPA 1SKRA 1ZETA 1TK8A 5D46A 4UBCA 3ZDEA 4QZDA 3QEAZ 2JEIA 3JPPA 4YMOA 1HUZA 3H3AA 3M9NB 4KLDA 2ZJ5A 3RB4A 4O3RA 1KEJA 5DGAA 5DECA 1VFGA 1X2IA 2V9WA 5KG5A 3Q8LA 1S0MA 1NJYA 4AT7A 3B0XA 5DQHA 4DOBA 1XSPA 1ZQUA 1ZQFA 5DLGA 4EYHB 4F5OA 2V4RA 3H8WA 2KP7A 5J2BA 2BPCA 2Y1JA 4E8FA 7ICMA 2P6UA 4E7XA 2A1JB 4QW9A 2XGPA 2P66A 3OV7A 3IHQB 3MBYA 1NJZA 4KMUA 4R66A 1L3UA 7ICEA 4WC2A 1ZQAA 5KFTA 1JXEA 3V7JA 2XCAA 1NK7A 4O0IA 1NK5A 4BXOB 5L1LA 4ELVA 4F2RA 5KFGA 3TAPA 4QWCA 9ICGA 3MGIA 5KT4A 3GIMA 4J9OA 3ZD8A 1S77D 4KLEA 8ICTA 4UD5A 1ZQRA 4YMMA 5DBAA 5KT6A 5DBBA 9ICMA 4F5RA 4TUPA 2ASDA 2BPFA 4F3OA 4WC4A 1N48A 1SZPA 5HC9A 3TQ1A 4PHDA 8ICAA 3KTQA 3V7LA 4F4XA 1S0OA 4M9LA 3NTUA 3LWLA 4QWDA 5J0XA 1RYRA 4X4RA 4BDPA 5BOLA 5IIJA 5KFWA 5F9NA 3GIIA 4QW8A 5HRHA 1ZJNA 3SZ2A 1SL1A 3PW4A 2ZTDA 2R8GA 1NKBA 2W8KA 2XCPA 4C8LA 1QSLA 4IRCA 4ATBB 3PMNA 2J6UA 5CHGA 1U4BA 2DR7A 2A1JA 2UVUA 3LDAA 3C2MA 5J2EA 2M2VA 2Y1IA 5CR0A 5CB1A 4Q45A 4DO9A 4UB3A 4ECZA 4YG2A 4YR2A 4QZCA 4BXOA 4FH3A 5KFDA 4JWMA 9ICTA 3PR5B 4MF8A 2UVRA 4F91B 3E2EA 7ICPA 1ZQJA 3RJFA 4YXJA 5KFHA 4PHEA 3V6JA 3TARA 3THVA 1XC9A 4RT3A 5L1IA 7ICRA 4P4MA 2BDPA 4CCHA 2BKEA 4G3IA 1YLQA 3MGHA 3ISDA 4K4HA 3C5GA 4DL5A 2HHSA 4X4UA 1ZQVA 2VA8A 3RRGA 1S0VA 5IINA 1BVSA 4EBKA 1S0NA 4I29A 8ICSA 3GV8B 3ISCA 5KG6A 3FYHA 7ICVA 3AQKA 1BPYA 1JQRA 2XGQA 4IQWA 5KFEA 4O5EA 8ICGA 2ZHAA 4I2DA 2DPJA 4B9SA 2KFNA 1ZQSA 4UAYA 4J9RA 2W9CB 5DQIA 2R8HA 3M9MB 3TANA 1S97A 2AGQA 1KFDA 5HRDA 4ECUA 4J9MA 4UB2A 3PX0A 4DQPA 5F9LA 4B9LA 4XRHA 3WFSC 4KLOA 2ZTEA 3GIKA 4EZ9A 4B9NA 5KFJA 3OUYB 2R8IA 4YN4A 1XWLA 4KLHA 4DLEA 2HHXA 1S9FA 5KFKA 1ZQTA 1JX4A 4I2BA 4KLFA 4DSEA 5J0OA 4M9HA 9ICNA 3SI8A 4F5PA 1TFYA 8ICIA 1X9WA 5KFXA 1T3NA 3ZDAA 4FHVA 3BQTA 5D49A 4DEZA 4RQ6A 1D8YA 5L9XA 2MUTB 8ICLA 4DSJA 4RUAA 3MR3A 3JPNA 4MEYA 4O5CA 4XA5A 5L1KA 1S10A 8ICJA 3UPSA 2NRTA 3BDPA 2O5AA 2BCRA 2PI4A 1WCLA 1IXRA 4RPXA 4DOAA 1U9LA 4ED2A 5DG7A 1ZQYA 8ICRA 5IIKA 2FMPA 2BGWA 4ED3A 4KTQA 1NK8A 5KT3A 5EOZA 4DWIA 4M5DA 1BPDA 1Q78A 2Q0ZX 3PV8A 2W9CA 2PFNA 4RQ3A 4NKTA 4S3NA 4Z6CA 3AUOA 9ICUA 4TUQA 3T5KA 2C2EA 2B21A 1ZQGA 1NKCA 5DKWA 3RJJA 4X4VA 4QWBA 4RQ1A 4Q44A 3C5FA 2ZUDA 4YXMA 4DFKA 5CJ7A 4YVZA 5KT2A 2DPIA 3KHHA 2FLNA 3OUYA 2HHTA 2VA2A 2UVWA 4RWNA 4O3SA 4RNOA 5HNKA 2HVIA 3AQMA 1L3VA 4QZGA 3JPQA 2DR9A 5BPCA 5HMMA 2I1QA 4ECXA 3EZ5A 1UEUA 5D4BA 2MUTA 1T7PA 4ECWA 5HREA 5J2KA 1PZNA 1JMSA 4JK1A 4NXZA 3G6YA 5KFZA 1NJWA 1KDHA 1D9DA 4JWNA 4KLJA 2KZMA 1KSPA 4RQ4A 5IILA 4RQ2A 2ASLA 4B9TA 4EBCA 2ZH3A 1XS9D 2ZJ8A 4F4ZA 4ED1A 2UVVA 3H8JA 1A77A 3PR4A 8ICNA 1L5UA 2W9BB 3H38A 3PX6A 1XO1A 1QSSA 4DQRA 2GWSA 4DSIA 2ZH1A 2ZH9A 7ICOA 4PGYA 3QZ7A 4IRDA 4I2CA 4YMNA 3RBDA 4X4TA 5J29A 3ORYA 4IQVA 7ICKA 2OWOA 4E0DA 4I2EA 3AQLA 3AU6A 7ICGA 3WFPA 1DGSA 2NRVA 5J0WA 4TUSA 4KLSA 4BWJA 2PXIA 2C28A 3T5HA 2IHNA 8ICOA 3H8SA 3EYZA 5J0RA 1F5AA 1FA0A 2ZH7A 5CWRA 1H38A 1BPEA 2BR0A 5EWEA 2Q66A 1V4AA 1XSNA 5HRFA 5HR9A 4J9SA 1S76D 3UXPA 4FS2A 2BCVA 4RWPA 2H5XA 5IIMA 4F4KA 5J2HA 3B0YA 4ECQA 9ICKA 1A76A 1ZQKA 1QTMA 3PW2A 2KZZA 2V4QA 4GXJA 3PX4A 5CP2A 3OSNA 3V6HA 3H40A 5KFUA 1RYSA 1MIWA 5F2VO 4RU9A 4NLGA 1SL0A 5DB8A 3GV5B 2XY5A 2KFZA 3C18A 7ICHA 4UAWA 4ED0A 9ICVA 1UA0A 3JZ0A 2DR5A 1DOQA 4YP3A 4UB1A 2W9BA 4F4WA 4ECTA 3H4BA 3RTVA 1C7YA 2R8KA 1XU4A 2R8JA 5KT7A 9ICBA 1R8BA 2BHNA 4RQ8A 3V6KA 3PVXA 1ZYQA 1UETA 1JAJA 1U45A 9ICIA 3WFQE 4M2YA 9ICFA 1ZQMA 9ICEA 3Q8MA 3LQCB 5L1JA 3UQ2A 3OVSA 4DS5A 4F5NA 1MQ3A 3HX0A 3RJEA 4MFCA 8ICBA 3RJIA 4NKUA 5J2FA 1BPXA 4F2SA 3T3FA 1ZJMA 4YFKA 4DFMA 9ICAA 9ICRA 2W9AA 4KLUA 4M9GA 2M2WA 1TAQA 3NGDA 4NLNA 4FS1A 4PHAA 2KN7A 4UBBA 4ECVA 1RPLA 4I2GA 2FPLA 1TV9A 4R8UB 1R8AA 2DFLA 4DL2A 8ICPA 5HHIA 3JPRA 4RQ7A 2IMWP 3OHBA 3OVBA 8ICCA 1T8EA 2LYHA 4HYKA 9ICJA 3OSPA 4RPZA 1UEVA 3V7KA 4J9LA 1SL2A 2ZUBA 3C2LA 3Q8QB 5DDMA 3MR5A 3M9OB 2PI5A 1LV5A 9ICSA 4O3NA 9ICQA 5HRKA 3G6VA 1NKEA 3K75D 4IQTA 7ICSA 2XO7A 4DFJA 1DK3A 3GFKB 1TK0A 4I2IA 4ECSA 8ICQA 1L3TA 4EZ6A 1CUKA 2ZTCA 2FMSA 1T4GA 4ELTA 1R89A 4C8KA 9ICLA 4O3PA 3UPQA 5KFFA 4YR0A 4I2AA 4J9PA 4Z6EA 1JN3A 2ZH4A 5KFOA 8ICWA 4LZDA 5CA7A 1V9PA 2NRXA 3N97B 2BQRA 8ICYA 4DQIA 4GC6A 4FBTA 4IRKA 5HRGA 3AQNA 4X4QA 2IBKA 3HWTA 2FPMA 4GLXA 4QWAA 2W9MA 1Z3EB 4DFPA 3H39A 2ATLA 2AQ4A 3RAXA 4K4GA 4M04A 1KNYA 8ICVA 4WC0A 4MF2A 4DF4A 1ZQWA 4WCWA 1ZQNA 2MAXA 3C1ZA 3OHAA 2RFFA 5DDYA 4R8UA 3PMLA 5KTQA 5J2GA 5J0QA 3TFSA 1KLNA 4P2HA 7ICTA 4XQ7A 4QZ9A 3N4MB 8ICXA 3WFOA 3NYBA 2ZHBA 3BQ1A 3ETLA 4F92B 3ZDCA 3L9DA 3RH5A 1D9FA 4Q43A 4E80A 2BQ3A 9ICPA 1NZPA 4X4NA 8ICFA 4PHPA 3OGUA 2C2RA 4C8OA 4K4IA 1R8CA 3MR6A 4GC7A 3RB6A 3RJGA 1EXNA 4I2HA 4KLIA 2XY7A 4RNNA 1BNOA 2PBEA 5HMLA 4RQ5A 5J2IA 3RH4A 1DK2A 2RDIA 4KN7A 3BQ2A 1U48A 3Q8SB 4GXKA 2NRWA 3PW0A 3RJHA 4Z6FA 3UXOA 3LK9A 4FH5A 3EPIA 4J9QA 3MR2A 2JZBB 3C1YA 2VA3A 5HRIA 5KFYA 5KG7A 4O9MA 5KG1A 4DL4A 4DF8A 1VJ7A 1QLNA 3H7IA 3ZDBA 4ATBA 3PW7A 1RXWA 1N56A 1SKWA 4O3QA 3ZDDA 2AGOA 5KFAA 3JPSA 1NO5A 4EYIB 2F1JA 1UT5A 1XSLA 8ICEA 3C23A 1Y88A 1TVAA 5BOMA 4MEXA 3T5LA 5KG0A 4EBDA 2FLPA 4UQGA 1SKSA 2ISOA 3HIYA 3MABA 4I2FA 4M6WB 1NOMA 3Q8PB 4LT6A 4QZAA 5KFIA 7ICJA 2DVIA 1BPBA 4KLQA 2ZH5A 2DRAA 4F93B 2ISPA 3SV4A 1KFTA 4NY8A 3RRHA 4X5VA 5DQGA 4IR1A 7ICFA 3HT3A 4DL7A 4ECYA 4EBEA 4ECRA 2F1IA 3OJUA 5EWFA 3GV7B 2NRZA 1CEZA 1KTQA 4M9NA 3JYYA 4NLKA 3PW5A 4KLLA 2M2TA 1MIYA 5KFCA 4EP7A 4NM1A 5HRBA 3MDCA 3OVAA 5KFNA 3PO5A 4QZEA 3KHGA 3WFRE 3IM1A 1JXLA 4X4SA 2XC9A 2JEGA 1TFRA 2JZBA 1ZQCA 5TZVA 1BPZA 9ICXA 2ZH2A 7ICQA 4RWOA 4JV1A 4I2JA 8ICKA 3JPTA 3V72A 3BJYA 4DL3A 4J9NA 3HJ1A 5J0YA 4DSLA 5HRLA 5DB6A 4ED7A 2JEFA 3ZD9A 2M2UA 1LB2B 2HHWA 3C21A 5KG3A 1NK6A 2DRBA 2M9NA 4C8MA 4RWQA 1Z00B 1WCNA 3EPGA 7ICUA 2ALZA 1KFSA 3HJ4A 1UA1A 4M6WA 2F1HA 4RNMA 4R65A 4X0BA 1UT8A 5DGBA 3QEBZ 4TQRA 4TURA 1COOA 4M0AA 4AT9B 2AU0A 1TFWA 5DG9A 5HP4A 3HW8A 2HHQA 5IIOA 2AQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ARO P;  4DOC A;  1HJP A;  3JPO A;  3Q8K A;  1TAU A;  3MDA A;  1ZQE A;  2HW3 A;  2BCS A;  4PGQ A;  3OJS A;  2ZH6 A;  5KFP A;  5DB7 A;  1NJX A;  9ICH A;  4WC5 A;  4X4O A;  4QWE A;  5KFV A;  3G6X A;  4JV0 A;  4YQW A;  4YD2 A;  1NK9 A;  7ICI A;  3GQC A;  4QZI A;  3KHL A;  3RB3 A;  8ICZ A;  3MFI A;  2J6S A;  3UQ0 A;  4QZB A;  4P4P A;  4J9K A;  3H37 A;  4YR3 A;  4Z6D A;  5J0P A;  2BPG A;  4FHX A;  4WBY A;  3EWA A;  7ICN A;  4ED8 A;  5KFR A;  1D8L A;  2FPK A;  3LWM A;  1ZQH A;  5KG4 A;  1L3S A;  2ZH8 A;  3C2K A;  4XQ8 A;  4RUC A;  4KLM A;  9ICO A;  4WC3 A;  1RXV A;  4B9M A;  3UXN A;  4WC6 A;  2HVH A;  2BE3 A;  3SV3 A;  4C8N A;  4DSK A;  4RT2 A;  5DLF A;  1OU5 A;  3T5J A;  5J2D A;  1Z00 A;  2W8L A;  2ASJ A;  3GIJ A;  2BCQ A;  4RQ0 A;  4FBU A;  4Q8E A;  2AJQ A;  3MFH A;  2KZ3 A;  4YCX A;  2C2D A;  1NK0 A;  3M8R A;  2VAN A;  3K4G A;  1Q79 A;  5DED A;  5KG2 A;  4XUS A;  4AT9 A;  1X9S A;  4IG8 A;  3M8S A;  4WC1 A;  5KFB A;  3AU2 A;  4R63 A;  5KFL A;  4O3O A;  3RAQ A;  3C66 A;  3RB0 A;  2HHV A;  1ZQQ A;  4AT8 B;  4ZH4 A;  4MFF A;  4LVS A;  2IA6 A;  3PO4 A;  4EBJ A;  5DG8 A;  3QZ8 A;  5J0T A;  3RR7 A;  5HHH A;  4WBZ A;  1ZQI A;  5EWG A;  4UD4 A;  4WC7 A;  3RH6 A;  1TKD A;  4P4O A;  4LZG A;  2ZUC A;  3HPO A;  3RJK A;  2KTQ A;  4MFA A;  4F8R A;  2BQU A;  4R64 A;  3TI0 A;  2P6R A;  1ZQO A;  1JIH A;  5KT5 A;  1MSW D;  2FLL A;  5J2A A;  4PH5 A;  4UAZ A;  3TFR A;  4DQS A;  1TK5 A;  4Q8F A;  4NLZ A;  3GIL A;  2PFP A;  4M9J A;  4F4Y A;  5J0S A;  4QZF A;  4F5Q A;  1NK4 A;  1HUO A;  4B9U A;  1U47 A;  4ELU A;  7ICL A;  5III A;  2RDJ A;  3GDX A;  9ICW A;  4GXI A;  4DLG A;  3RBE A;  2FMQ A;  1ZQL A;  3KHR A;  3QE9 Y;  4I28 A;  1RZT A;  3EW9 A;  4TQS A;  5KFM A;  4O5K A;  1PX5 A;  4BWM A;  4X0A A;  2DR8 A;  4KIT B;  1U49 A;  5KFQ A;  4QZH A;  1MIV A;  5DBC A;  4YD1 A;  2ZJA A;  4IR9 A;  4DS4 A;  4AT8 A;  5KFS A;  1BGX T;  4FHY A;  3RR8 A;  4EEY A;  3SYZ A;  3PY8 A;  4DL6 A;  8ICU A;  1K1S A;  4IQU A;  4FHW A;  4JV2 A;  2I9G A;  4DQQ A;  2ID1 A;  4RZR A;  2HHU A;  4AT7 B;  5JUM A;  2J6T A;  4X4P A;  2C22 A;  1K1Q A;  5C5J A;  3Q8R B;  4PPX A;  4NM2 A;  1ZQB A;  8ICH A;  3TAQ A;  4FO6 A;  1ZQZ A;  5J2J A;  2XY6 A;  2BCU A;  2AGP A;  2PFO A;  2PFQ A;  1MQ2 A;  1X9M A;  4UB4 A;  3BQ0 A;  5J2C A;  4F50 A;  1QSY A;  3FDS A;  1MC8 A;  4KLT A;  4ED6 A;  4FHP A;  2WTF A;  1ZQP A;  2IHM A;  4RPY A;  4JUZ A;  4UB5 A;  3H4D A;  3HP6 A;  9ICC A;  2O1P A;  4KN4 A;  1KRP A;  4M47 A;  2HHP A;  1WOT A;  1B43 A;  4QZ8 A;  4B9V A;  1IM4 A;  5J0U A;  4BGD A;  2NRK A;  1ZQX A;  2JEJ A;  8ICM A;  1B22 A;  3ISB A;  5DB9 A;  4PGX A;  4DSF A;  3PNC A;  4I27 A;  4KLG A;  1ZQD A;  1BNP A;  1SKR A;  1ZET A;  1TK8 A;  5D46 A;  4UBC A;  3ZDE A;  4QZD A;  3QEA Z;  2JEI A;  3JPP A;  4YMO A;  1HUZ A;  3H3A A;  3M9N B;  4KLD A;  2ZJ5 A;  3RB4 A;  4O3R A;  1KEJ A;  5DGA A;  5DEC A;  1VFG A;  1X2I A;  2V9W A;  5KG5 A;  3Q8L A;  1S0M A;  1NJY A;  4AT7 A;  3B0X A;  5DQH A;  4DOB A;  1XSP A;  1ZQU A;  1ZQF A;  5DLG A;  4EYH B;  4F5O A;  2V4R A;  3H8W A;  2KP7 A;  5J2B A;  2BPC A;  2Y1J A;  4E8F A;  7ICM A;  2P6U A;  4E7X A;  2A1J B;  4QW9 A;  2XGP A;  2P66 A;  3OV7 A;  3IHQ B;  3MBY A;  1NJZ A;  4KMU A;  4R66 A;  1L3U A;  7ICE A;  4WC2 A;  1ZQA A;  5KFT A;  1JXE A;  3V7J A;  2XCA A;  1NK7 A;  4O0I A;  1NK5 A;  4BXO B;  5L1L A;  4ELV A;  4F2R A;  5KFG A;  3TAP A;  4QWC A;  9ICG A;  3MGI A;  5KT4 A;  3GIM A;  4J9O A;  3ZD8 A;  1S77 D;  4KLE A;  8ICT A;  4UD5 A;  1ZQR A;  4YMM A;  5DBA A;  5KT6 A;  5DBB A;  9ICM A;  4F5R A;  4TUP A;  2ASD A;  2BPF A;  4F3O A;  4WC4 A;  1N48 A;  1SZP A;  5HC9 A;  3TQ1 A;  4PHD A;  8ICA A;  3KTQ A;  3V7L A;  4F4X A;  1S0O A;  4M9L A;  3NTU A;  3LWL A;  4QWD A;  5J0X A;  1RYR A;  4X4R A;  4BDP A;  5BOL A;  5IIJ A;  5KFW A;  5F9N A;  3GII A;  4QW8 A;  5HRH A;  1ZJN A;  3SZ2 A;  1SL1 A;  3PW4 A;  2ZTD A;  2R8G A;  1NKB A;  2W8K A;  2XCP A;  4C8L A;  1QSL A;  4IRC A;  4ATB B;  3PMN A;  2J6U A;  5CHG A;  1U4B A;  2DR7 A;  2A1J A;  2UVU A;  3LDA A;  3C2M A;  5J2E A;  2M2V A;  2Y1I A;  5CR0 A;  5CB1 A;  4Q45 A;  4DO9 A;  4UB3 A;  4ECZ A;  4YG2 A;  4YR2 A;  4QZC A;  4BXO A;  4FH3 A;  5KFD A;  4JWM A;  9ICT A;  3PR5 B;  4MF8 A;  2UVR A;  4F91 B;  3E2E A;  7ICP A;  1ZQJ A;  3RJF A;  4YXJ A;  5KFH A;  4PHE A;  3V6J A;  3TAR A;  3THV A;  1XC9 A;  4RT3 A;  5L1I A;  7ICR A;  4P4M A;  2BDP A;  4CCH A;  2BKE A;  4G3I A;  1YLQ A;  3MGH A;  3ISD A;  4K4H A;  3C5G A;  4DL5 A;  2HHS A;  4X4U A;  1ZQV A;  2VA8 A;  3RRG A;  1S0V A;  5IIN A;  1BVS A;  4EBK A;  1S0N A;  4I29 A;  8ICS A;  3GV8 B;  3ISC A;  5KG6 A;  3FYH A;  7ICV A;  3AQK A;  1BPY A;  1JQR A;  2XGQ A;  4IQW A;  5KFE A;  4O5E A;  8ICG A;  2ZHA A;  4I2D A;  2DPJ A;  4B9S A;  2KFN A;  1ZQS A;  4UAY A;  4J9R A;  2W9C B;  5DQI A;  2R8H A;  3M9M B;  3TAN A;  1S97 A;  2AGQ A;  1KFD A;  5HRD A;  4ECU A;  4J9M A;  4UB2 A;  3PX0 A;  4DQP A;  5F9L A;  4B9L A;  4XRH A;  3WFS C;  4KLO A;  2ZTE A;  3GIK A;  4EZ9 A;  4B9N A;  5KFJ A;  3OUY B;  2R8I A;  4YN4 A;  1XWL A;  4KLH A;  4DLE A;  2HHX A;  1S9F A;  5KFK A;  1ZQT A;  1JX4 A;  4I2B A;  4KLF A;  4DSE A;  5J0O A;  4M9H A;  9ICN A;  3SI8 A;  4F5P A;  1TFY A;  8ICI A;  1X9W A;  5KFX A;  1T3N A;  3ZDA A;  4FHV A;  3BQT A;  5D49 A;  4DEZ A;  4RQ6 A;  1D8Y A;  5L9X A;  2MUT B;  8ICL A;  4DSJ A;  4RUA A;  3MR3 A;  3JPN A;  4MEY A;  4O5C A;  4XA5 A;  5L1K A;  1S10 A;  8ICJ A;  3UPS A;  2NRT A;  3BDP A;  2O5A A;  2BCR A;  2PI4 A;  1WCL A;  1IXR A;  4RPX A;  4DOA A;  1U9L A;  4ED2 A;  5DG7 A;  1ZQY A;  8ICR A;  5IIK A;  2FMP A;  2BGW A;  4ED3 A;  4KTQ A;  1NK8 A;  5KT3 A;  5EOZ A;  4DWI A;  4M5D A;  1BPD A;  1Q78 A;  2Q0Z X;  3PV8 A;  2W9C A;  2PFN A;  4RQ3 A;  4NKT A;  4S3N A;  4Z6C A;  3AUO A;  9ICU A;  4TUQ A;  3T5K A;  2C2E A;  2B21 A;  1ZQG A;  1NKC A;  5DKW A;  3RJJ A;  4X4V A;  4QWB A;  4RQ1 A;  4Q44 A;  3C5F A;  2ZUD A;  4YXM A;  4DFK A;  5CJ7 A;  4YVZ A;  5KT2 A;  2DPI A;  3KHH A;  2FLN A;  3OUY A;  2HHT A;  2VA2 A;  2UVW A;  4RWN A;  4O3S A;  4RNO A;  5HNK A;  2HVI A;  3AQM A;  1L3V A;  4QZG A;  3JPQ A;  2DR9 A;  5BPC A;  5HMM A;  2I1Q A;  4ECX A;  3EZ5 A;  1UEU A;  5D4B A;  2MUT A;  1T7P A;  4ECW A;  5HRE A;  5J2K A;  1PZN A;  1JMS A;  4JK1 A;  4NXZ A;  3G6Y A;  5KFZ A;  1NJW A;  1KDH A;  1D9D A;  4JWN A;  4KLJ A;  2KZM A;  1KSP A;  4RQ4 A;  5IIL A;  4RQ2 A;  2ASL A;  4B9T A;  4EBC A;  2ZH3 A;  1XS9 D;  2ZJ8 A;  4F4Z A;  4ED1 A;  2UVV A;  3H8J A;  1A77 A;  3PR4 A;  8ICN A;  1L5U A;  2W9B B;  3H38 A;  3PX6 A;  1XO1 A;  1QSS A;  4DQR A;  2GWS A;  4DSI A;  2ZH1 A;  2ZH9 A;  7ICO A;  4PGY A;  3QZ7 A;  4IRD A;  4I2C A;  4YMN A;  3RBD A;  4X4T A;  5J29 A;  3ORY A;  4IQV A;  7ICK A;  2OWO A;  4E0D A;  4I2E A;  3AQL A;  3AU6 A;  7ICG A;  3WFP A;  1DGS A;  2NRV A;  5J0W A;  4TUS A;  4KLS A;  4BWJ A;  2PXI A;  2C28 A;  3T5H A;  2IHN A;  8ICO A;  3H8S A;  3EYZ A;  5J0R A;  1F5A A;  1FA0 A;  2ZH7 A;  5CWR A;  1H38 A;  1BPE A;  2BR0 A;  5EWE A;  2Q66 A;  1V4A A;  1XSN A;  5HRF A;  5HR9 A;  4J9S A;  1S76 D;  3UXP A;  4FS2 A;  2BCV A;  4RWP A;  2H5X A;  5IIM A;  4F4K A;  5J2H A;  3B0Y A;  4ECQ A;  9ICK A;  1A76 A;  1ZQK A;  1QTM A;  3PW2 A;  2KZZ A;  2V4Q A;  4GXJ A;  3PX4 A;  5CP2 A;  3OSN A;  3V6H A;  3H40 A;  5KFU A;  1RYS A;  1MIW A;  5F2V O;  4RU9 A;  4NLG A;  1SL0 A;  5DB8 A;  3GV5 B;  2XY5 A;  2KFZ A;  3C18 A;  7ICH A;  4UAW A;  4ED0 A;  9ICV A;  1UA0 A;  3JZ0 A;  2DR5 A;  1DOQ A;  4YP3 A;  4UB1 A;  2W9B A;  4F4W A;  4ECT A;  3H4B A;  3RTV A;  1C7Y A;  2R8K A;  1XU4 A;  2R8J A;  5KT7 A;  9ICB A;  1R8B A;  2BHN A;  4RQ8 A;  3V6K A;  3PVX A;  1ZYQ A;  1UET A;  1JAJ A;  1U45 A;  9ICI A;  3WFQ E;  4M2Y A;  9ICF A;  1ZQM A;  9ICE A;  3Q8M A;  3LQC B;  5L1J A;  3UQ2 A;  3OVS A;  4DS5 A;  4F5N A;  1MQ3 A;  3HX0 A;  3RJE A;  4MFC A;  8ICB A;  3RJI A;  4NKU A;  5J2F A;  1BPX A;  4F2S A;  3T3F A;  1ZJM A;  4YFK A;  4DFM A;  9ICA A;  9ICR A;  2W9A A;  4KLU A;  4M9G A;  2M2W A;  1TAQ A;  3NGD A;  4NLN A;  4FS1 A;  4PHA A;  2KN7 A;  4UBB A;  4ECV A;  1RPL A;  4I2G A;  2FPL A;  1TV9 A;  4R8U B;  1R8A A;  2DFL A;  4DL2 A;  8ICP A;  5HHI A;  3JPR A;  4RQ7 A;  2IMW P;  3OHB A;  3OVB A;  8ICC A;  1T8E A;  2LYH A;  4HYK A;  9ICJ A;  3OSP A;  4RPZ A;  1UEV A;  3V7K A;  4J9L A;  1SL2 A;  2ZUB A;  3C2L A;  3Q8Q B;  5DDM A;  3MR5 A;  3M9O B;  2PI5 A;  1LV5 A;  9ICS A;  4O3N A;  9ICQ A;  5HRK A;  3G6V A;  1NKE A;  3K75 D;  4IQT A;  7ICS A;  2XO7 A;  4DFJ A;  1DK3 A;  3GFK B;  1TK0 A;  4I2I A;  4ECS A;  8ICQ A;  1L3T A;  4EZ6 A;  1CUK A;  2ZTC A;  2FMS A;  1T4G A;  4ELT A;  1R89 A;  4C8K A;  9ICL A;  4O3P A;  3UPQ A;  5KFF A;  4YR0 A;  4I2A A;  4J9P A;  4Z6E A;  1JN3 A;  2ZH4 A;  5KFO A;  8ICW A;  4LZD A;  5CA7 A;  1V9P A;  2NRX A;  3N97 B;  2BQR A;  8ICY A;  4DQI A;  4GC6 A;  4FBT A;  4IRK A;  5HRG A;  3AQN A;  4X4Q A;  2IBK A;  3HWT A;  2FPM A;  4GLX A;  4QWA A;  2W9M A;  1Z3E B;  4DFP A;  3H39 A;  2ATL A;  2AQ4 A;  3RAX A;  4K4G A;  4M04 A;  1KNY A;  8ICV A;  4WC0 A;  4MF2 A;  4DF4 A;  1ZQW A;  4WCW A;  1ZQN A;  2MAX A;  3C1Z A;  3OHA A;  2RFF A;  5DDY A;  4R8U A;  3PML A;  5KTQ A;  5J2G A;  5J0Q A;  3TFS A;  1KLN A;  4P2H A;  7ICT A;  4XQ7 A;  4QZ9 A;  3N4M B;  8ICX A;  3WFO A;  3NYB A;  2ZHB A;  3BQ1 A;  3ETL A;  4F92 B;  3ZDC A;  3L9D A;  3RH5 A;  1D9F A;  4Q43 A;  4E80 A;  2BQ3 A;  9ICP A;  1NZP A;  4X4N A;  8ICF A;  4PHP A;  3OGU A;  2C2R A;  4C8O A;  4K4I A;  1R8C A;  3MR6 A;  4GC7 A;  3RB6 A;  3RJG A;  1EXN A;  4I2H A;  4KLI A;  2XY7 A;  4RNN A;  1BNO A;  2PBE A;  5HML A;  4RQ5 A;  5J2I A;  3RH4 A;  1DK2 A;  2RDI A;  4KN7 A;  3BQ2 A;  1U48 A;  3Q8S B;  4GXK A;  2NRW A;  3PW0 A;  3RJH A;  4Z6F A;  3UXO A;  3LK9 A;  4FH5 A;  3EPI A;  4J9Q A;  3MR2 A;  2JZB B;  3C1Y A;  2VA3 A;  5HRI A;  5KFY A;  5KG7 A;  4O9M A;  5KG1 A;  4DL4 A;  4DF8 A;  1VJ7 A;  1QLN A;  3H7I A;  3ZDB A;  4ATB A;  3PW7 A;  1RXW A;  1N56 A;  1SKW A;  4O3Q A;  3ZDD A;  2AGO A;  5KFA A;  3JPS A;  1NO5 A;  4EYI B;  2F1J A;  1UT5 A;  1XSL A;  8ICE A;  3C23 A;  1Y88 A;  1TVA A;  5BOM A;  4MEX A;  3T5L A;  5KG0 A;  4EBD A;  2FLP A;  4UQG A;  1SKS A;  2ISO A;  3HIY A;  3MAB A;  4I2F A;  4M6W B;  1NOM A;  3Q8P B;  4LT6 A;  4QZA A;  5KFI A;  7ICJ A;  2DVI A;  1BPB A;  4KLQ A;  2ZH5 A;  2DRA A;  4F93 B;  2ISP A;  3SV4 A;  1KFT A;  4NY8 A;  3RRH A;  4X5V A;  5DQG A;  4IR1 A;  7ICF A;  3HT3 A;  4DL7 A;  4ECY A;  4EBE A;  4ECR A;  2F1I A;  3OJU A;  5EWF A;  3GV7 B;  2NRZ A;  1CEZ A;  1KTQ A;  4M9N A;  3JYY A;  4NLK A;  3PW5 A;  4KLL A;  2M2T A;  1MIY A;  5KFC A;  4EP7 A;  4NM1 A;  5HRB A;  3MDC A;  3OVA A;  5KFN A;  3PO5 A;  4QZE A;  3KHG A;  3WFR E;  3IM1 A;  1JXL A;  4X4S A;  2XC9 A;  2JEG A;  1TFR A;  2JZB A;  1ZQC A;  5TZV A;  1BPZ A;  9ICX A;  2ZH2 A;  7ICQ A;  4RWO A;  4JV1 A;  4I2J A;  8ICK A;  3JPT A;  3V72 A;  3BJY A;  4DL3 A;  4J9N A;  3HJ1 A;  5J0Y A;  4DSL A;  5HRL A;  5DB6 A;  4ED7 A;  2JEF A;  3ZD9 A;  2M2U A;  1LB2 B;  2HHW A;  3C21 A;  5KG3 A;  1NK6 A;  2DRB A;  2M9N A;  4C8M A;  4RWQ A;  1Z00 B;  1WCN A;  3EPG A;  7ICU A;  2ALZ A;  1KFS A;  3HJ4 A;  1UA1 A;  4M6W A;  2F1H A;  4RNM A;  4R65 A;  4X0B A;  1UT8 A;  5DGB A;  3QEB Z;  4TQR A;  4TUR A;  1COO A;  4M0A A;  4AT9 B;  2AU0 A;  1TFW A;  5DG9 A;  5HP4 A;  3HW8 A;  2HHQ A;  5IIO A;  2AQ0 A; 
#chains in the Genus database with same CATH topology
 2WF6 A;  4PGQ A;  3L3F X;  9ICH A;  3GQC A;  4Y2Q A;  2DF4 B;  4QZI A;  2F77 X;  2LBO A;  7ICN A;  3QU5 A;  1ZD5 A;  4DSK A;  4RT2 A;  1Z19 A;  2BCQ A;  2H3Z A;  4ICA A;  1GO3 F;  4YCX A;  2C2D A;  1Q79 A;  3M8R A;  5AKY A;  2B56 A;  1N61 A;  2G09 A;  2B0C A;  3M8S A;  4WC1 A;  5KFB A;  5KFL A;  3NVV A;  4O3O A;  3HJE A;  2F8K A;  2W7P A;  3RB0 A;  3C66 A;  2EAM A;  1NZB A;  5DG8 A;  3KKA A;  5EE9 A;  2EAO A;  5HHH A;  3IG5 A;  4WC7 A;  5ALR A;  3HPO A;  2KTQ A;  1PVP A;  4C4R A;  5ALE A;  4F8R A;  4R64 A;  3TI0 A;  5KT5 A;  5ALM A;  9ICR A;  3GIL A;  1NK4 A;  4QZF A;  4F5Q A;  4WQK A;  1U47 A;  3RBE A;  2FMQ A;  3EW9 A;  4TQS A;  5KFM A;  1U49 A;  5KFQ A;  3CRX A;  4EEN A;  4FHY A;  1L8L A;  2HOF A;  5AK3 A;  1O03 A;  4KX3 A;  5ALT A;  4JV2 A;  4RZR A;  1L7O A;  5JUM A;  5C5J A;  4PPX A;  3TAQ A;  3SR6 A;  5J2J A;  3DDH A;  4FO6 A;  1QCK A;  2BCU A;  2AGP A;  1X9M A;  5J2C A;  4F50 A;  1QSY A;  2EWR A;  1OUQ A;  1MC8 A;  1M6Y A;  4ED6 A;  4FHP A;  3NRZ A;  4RPY A;  3IN5 A;  4WQL A;  1FFV A;  2HHP A;  2B6G A;  1VJ5 A;  2DKZ A;  4QZ8 A;  5HR7 A;  2VJ4 A;  1Q3V A;  2LPE A;  8ICM A;  1ZD4 A;  3PNC A;  4NLC A;  1SKR A;  1ZET A;  1TK8 A;  3QEA Z;  4UBC A;  3ZDE A;  5AM2 A;  2HCF A;  1HUZ A;  3M9N B;  3H3A A;  2ZJ5 A;  1NI3 A;  5HR6 A;  5JTG A;  5DGA A;  2G5H B;  4FZM A;  4CDG A;  1T94 A;  1XO0 A;  4C7Z A;  1JRO A;  4LEV A;  2DUY A;  5AK4 A;  1WWU A;  3SAF A;  2P66 A;  3IHQ B;  2MU2 A;  3MBY A;  4WC2 A;  1ZQA A;  5KFT A;  3V7J A;  2IUB A;  2XCA A;  4O0I A;  1N60 A;  5ALX A;  1TE2 A;  3SEN A;  3MGI A;  3GIM A;  4J9O A;  5C0Y A;  4KLE A;  5ALK A;  1ZQR A;  2WAQ C;  5DBB A;  4F5R A;  4WC4 A;  1N48 A;  1Z4N A;  2JH7 A;  8ICA A;  5T14 A;  4F4X A;  3NTU A;  5J0X A;  4BDP A;  5BOL A;  5KFW A;  1N2X A;  5CFU A;  4QNL A;  1UHU A;  5AKG A;  4Y2R A;  4CNQ A;  3PW4 A;  2ZTD A;  3PZP A;  1SL1 A;  2W8K A;  2J6U A;  4UAT A;  2WHE A;  2Y1I A;  5CR0 A;  5CB1 A;  4Q45 A;  4UB3 A;  4ECZ A;  4YR2 A;  4QZC A;  4BXO A;  4EED A;  2EZY A;  9ICT A;  3BQ7 A;  2UVR A;  3RJF A;  4FZN A;  4P4M A;  4G3I A;  3ISD A;  2HHS A;  2ZIV B;  3N28 A;  1BVS A;  4C7Y A;  2H3I A;  4BUG A;  4OCZ A;  3WK8 A;  1BPY A;  2W3R A;  2XGQ A;  2WF8 A;  3E0F A;  2HOQ A;  4I2D A;  2DPJ A;  2KFN A;  3U26 A;  1ZQS A;  2W9C B;  1S97 A;  2AGQ A;  3NVO A;  1FFU A;  4UB2 A;  4CGZ A;  3KZI U;  2YY6 A;  1SZH A;  3WK7 A;  2R8I A;  4KLH A;  2XID A;  4AYB C;  3AQF A;  1L8O A;  4I2B A;  4KLF A;  3SI8 A;  1TFY A;  3QU9 A;  1T3N A;  5D49 A;  5A0L A;  3JPN A;  5L1K A;  4P0Q A;  5FP0 A;  3BDP A;  1IXR A;  1WYG A;  4ED2 A;  2JH1 A;  2FMP A;  4KTQ A;  1NK8 A;  5EOZ A;  1BPD A;  4MKP A;  1Q78 A;  4NKT A;  4K9A A;  3NWI A;  3AUO A;  2KKP A;  3T5K A;  4LJX A;  5AKZ A;  2ZIX B;  1UQV A;  4YXM A;  4DFK A;  2FLN A;  5CJ7 A;  2D3D A;  4Y2U A;  2VA2 A;  2JRZ A;  2UVW A;  2K4H A;  4RWN A;  3HIL A;  4RNO A;  3AQM A;  2LKY A;  2DR9 A;  5BPC A;  2I1Q A;  4ECX A;  1JMS A;  5KFZ A;  4M5D A;  2ZH3 A;  1XS9 D;  3H8J A;  1XNS A;  1A77 A;  8ICN A;  4DSI A;  4I2C A;  4UB8 U;  4IQV A;  3HKZ F;  4I2E A;  1T3Q A;  7ICG A;  2LM4 A;  3GU3 A;  1VLB A;  4TUS A;  4KLS A;  8ICO A;  3EYZ A;  1H38 A;  4NXT A;  1UCV A;  5EWE A;  2DKX A;  2G07 A;  3E58 A;  3UXP A;  1S76 D;  2BCV A;  5AHX A;  4ECQ A;  9ICK A;  1QTM A;  1KBU A;  2V4Q A;  4A8E A;  3V6H A;  4RU9 A;  1SL0 A;  2KFZ A;  1IV8 A;  1RM6 C;  3R9K A;  2DR5 A;  3TKA A;  4YP3 A;  2W9B A;  4ECT A;  1C7Y A;  2R8K A;  3H4B A;  3RTV A;  3IV6 A;  2YML A;  5KT7 A;  5GTH U;  2BHN A;  5D62 A;  2F2A B;  1ZYQ A;  1U45 A;  9ICI A;  9ICF A;  4DFD A;  4F72 A;  5TIS U;  2GLE A;  1MQ3 A;  5J2F A;  3DEE A;  4EX7 A;  1HIW A;  2W9A A;  2E8P A;  1TAQ A;  3PHZ A;  1RPL A;  4DL2 A;  2W3S A;  2IMW P;  3OHB A;  3QU2 A;  8ICC A;  1T8E A;  1UEV A;  4OJL A;  2ZUB A;  1WG8 A;  5DDM A;  3MR5 A;  1LV5 A;  1NKE A;  3K75 D;  4IQT A;  7ICS A;  4KX5 A;  5D63 A;  2FMS A;  1T4G A;  2QB0 B;  2AHO B;  2ZH4 A;  5KFO A;  4ATB B;  5ALH A;  3SAH A;  5HRG A;  2W9M A;  3WKE A;  4K4G A;  8ICV A;  4DF4 A;  1ZQW A;  1ZQN A;  3OHA A;  2JGA A;  2FE9 A;  5DDY A;  5J0Q A;  2MA1 A;  4OJO A;  3NYB A;  2BQ3 A;  4X4N A;  4PHP A;  3MR6 A;  3RJG A;  3BZK A;  4I2H A;  1BNO A;  2PBE A;  5HML A;  2OM6 A;  4KN7 A;  3Q8S B;  2KIV A;  4GXK A;  3RJH A;  3EPI A;  5HRI A;  5KFY A;  4DL4 A;  2W43 A;  2VJ5 A;  4DF8 A;  5KAF U;  1NO5 A;  2BDU A;  2YB4 A;  2F1J A;  8ICE A;  2G06 A;  1TVA A;  1NNL A;  3DV9 A;  3T5L A;  5KG0 A;  2ISO A;  1SKS A;  3AN1 A;  2KD1 A;  2W7O A;  5ALJ A;  3I1Y A;  4Y2T A;  4QZA A;  2DVI A;  1BPB A;  3SMV A;  4WJ3 B;  1KFT A;  4Y2Y A;  5DQG A;  4EBE A;  4ECR A;  2NRZ A;  4M9N A;  4KLL A;  5KFC A;  4US8 A;  3MGV A;  1TFR A;  2JZB A;  3I28 A;  5TZV A;  1ZQC A;  4RWO A;  3ICX A;  8ICK A;  3JPT A;  1QQ7 A;  3WU2 U;  2JEF A;  2M2U A;  5AIB A;  2M9N A;  4C8M A;  2WAQ F;  1WCN A;  3PSI A;  3EPG A;  2KIC A;  1UA1 A;  4M6W A;  5AI5 A;  1PUZ A;  2F1H A;  4R65 A;  4TQR A;  1COO A;  4M0A A;  4AT9 B;  2AU0 A;  1TFW A;  1PVR A;  3Q8K A;  1TAU A;  2KNJ A;  2BCS A;  2ZH6 A;  1NJX A;  4WC5 A;  4X4O A;  4QWE A;  2JHD A;  2ZIW A;  4YD2 A;  3RB3 A;  8ICZ A;  5CFT A;  3MFI A;  2HI0 A;  2KSO A;  2J6S A;  4Z6D A;  3EWA A;  3NVY A;  4ED8 A;  2FPK A;  5KG4 A;  1L3S A;  4XQ8 A;  1N63 A;  4B9M A;  3UXN A;  4WC6 A;  3T5J A;  5B3Q A;  4RQ0 A;  4Q8E A;  1NK0 A;  2VAN A;  3K4G A;  4XUS A;  2O6K A;  1PK1 B;  3F53 A;  2HHV A;  1ZQQ A;  4ZH4 A;  4BJQ A;  2Z7J A;  2KV2 A;  5J0T A;  4WBZ A;  1ZQI A;  5EWG A;  2GA9 D;  4O69 A;  2K4P A;  3RJK A;  4QIW F;  2BQU A;  1MSW D;  4UAZ A;  4DQS A;  4NLZ A;  2KKV A;  7ICL A;  5III A;  9ICW A;  1ZQL A;  4O5K A;  4BWM A;  4QZH A;  4IR9 A;  4AT8 A;  4C0Z A;  5KFS A;  2DL0 A;  4JLZ A;  4EEY A;  3PY8 A;  2N1R A;  4AT7 B;  2J6T A;  1K5O A;  4X4P A;  1K1Q A;  1ZQB A;  1LKY A;  1ZQZ A;  5AI0 A;  2Y0S F;  2PFO A;  5AKL A;  4NXX A;  4UB4 A;  2WF7 A;  1RDF A;  9ICC A;  4M47 A;  1KRP A;  1WOT A;  1B43 A;  4BGD A;  1ZQX A;  5DB9 A;  4KLG A;  2E1F A;  4NL9 A;  1ZQD A;  5ALW A;  5D46 A;  4YMO A;  4CF4 A;  1RYU A;  2FCL A;  4O3R A;  1FEZ A;  1KEJ A;  4BX9 C;  5DEC A;  1X2I A;  2E8O A;  2DGZ A;  2V9W A;  2M0N A;  5DQH A;  1ZQF A;  5ALY A;  2IOF K;  2KP7 A;  2BPC A;  2Y1J A;  4E7X A;  2A1J B;  4FFD A;  3OV7 A;  2KHV A;  1VDV A;  1NJZ A;  3LVW A;  3AEV A;  3S6J A;  1JXE A;  3NS1 A;  1NK5 A;  4UAU A;  1V85 A;  3WK6 A;  5KFG A;  4QWC A;  1S77 D;  4UD5 A;  8ICT A;  2OH2 A;  4YMM A;  1Q3U A;  1DGJ A;  3TQ1 A;  3KTQ A;  3V7L A;  2LM1 A;  5F9N A;  5AI9 A;  3SZ2 A;  1X42 A;  1NKB A;  2XCP A;  4C8L A;  4IRC A;  2GOL A;  2DR7 A;  2B4V A;  3LDA A;  3F2D A;  4YG2 A;  4JWM A;  4MF8 A;  7ICP A;  1ZQJ A;  3V6J A;  3THV A;  1XC9 A;  4J03 A;  3GZF A;  2BDP A;  4CCH A;  2BKE A;  1YLQ A;  3C29 A;  4F71 A;  1HEK A;  3NVZ A;  3D6J A;  3ZI4 A;  4I29 A;  2LMR A;  8ICS A;  3ISC A;  3KBB A;  5KL8 B;  2W04 A;  4O5E A;  2A1A A;  4G9B A;  2W11 A;  4UAR A;  4J9R A;  5DQI A;  3ER9 B;  2BBH A;  1A6S A;  4J9M A;  4GFJ A;  5F9L A;  4AP9 A;  1GPJ A;  5KFJ A;  4O68 A;  2HHX A;  1CI4 A;  1S9F A;  1JX4 A;  2PMZ C;  4F5P A;  3ZDA A;  4FHV A;  2G0A A;  4MEY A;  2IOH A;  8ICJ A;  2YQE A;  2NRT A;  3H8M A;  2PI4 A;  1WCL A;  2HN1 A;  2Y9U A;  3UM9 A;  1ZQY A;  5DG7 A;  2NYV A;  4ED3 A;  5EE3 A;  1URJ A;  2Q0Z X;  2PFN A;  3M6Z A;  2G08 A;  4K8V A;  4S3N A;  9ICU A;  2B21 A;  2LYA A;  1ZQG A;  5DKW A;  3RJJ A;  3FC4 A;  4RQ1 A;  1ECW A;  2G5I B;  5JRT A;  5KT2 A;  5B66 U;  2DPI A;  3OUY A;  4O3S A;  2HVI A;  4QZG A;  3D2Q A;  2KJ9 A;  2MUT A;  2P35 A;  4ECW A;  2OXO A;  1T7P A;  5J2K A;  3J81 j;  4KB6 A;  2H3Q A;  1D9D A;  4B9T A;  2ZJ8 A;  4K96 A;  3PR4 A;  1L5U A;  2GWS A;  4DQR A;  3QZ7 A;  4LEZ A;  4X4T A;  3ORY A;  3PSP A;  1L7N A;  3BS7 A;  2R18 A;  4HAI A;  2NRV A;  1SGG A;  2PXI A;  2C28 A;  3A0B U;  3H8S A;  3OTQ A;  2XI9 A;  1BPE A;  1X6J A;  1V4A A;  3QNM A;  4RWP A;  2QLT A;  4QJF B;  5JTI A;  4WOY A;  5J2H A;  3B0Y A;  2YTU A;  1A76 A;  3PW2 A;  4GXJ A;  3OSN A;  1RYS A;  2GH1 A;  3H40 A;  5F2V O;  3GV5 B;  4ED0 A;  5ALQ A;  1DOQ A;  2KVS A;  9ICB A;  1S8O A;  3NRW A;  2AH5 A;  2ZG6 A;  1WUD A;  4KMO B;  2Q4T A;  1UET A;  1JAJ A;  4JMU A;  1WWV A;  4M2Y A;  5AIA A;  1ZQM A;  9ICE A;  3Q8M A;  1KKX A;  4NWI A;  3OVS A;  4DS5 A;  4F5N A;  8ICB A;  4F2S A;  3T3F A;  9ICA A;  2M2W A;  2K4E A;  3NGD A;  2MRL A;  2KN7 A;  4I2G A;  3JPR A;  4DCC A;  3CK6 A;  2WB1 C;  1QQ5 A;  5ALZ A;  3CYM A;  3C2L A;  3Q8Q B;  3VCB A;  9ICS A;  3MC1 A;  3QUQ A;  4O3N A;  5ALP A;  5HRK A;  3G6V A;  3M6K A;  2K8B B;  2B51 A;  2XO7 A;  4DFJ A;  1L3T A;  1ZQ1 C;  1CUK A;  4C8K A;  4O3P A;  3UPQ A;  4B6J A;  5KFF A;  3M1Y A;  3SAG A;  3N97 B;  2NRX A;  3F5A A;  8ICY A;  1IG6 A;  4FBT A;  4GC6 A;  2HBL A;  3K7D A;  4GLX A;  2YMM A;  4DFP A;  2LI6 A;  3SD7 A;  3WKD A;  3ER8 C;  4R8U A;  5KTQ A;  5J2G A;  4XQ7 A;  2ESE A;  3WFO A;  2GAF D;  4JB3 A;  3ETL A;  4F92 B;  5JU5 A;  3L9D A;  4K97 A;  4K4I A;  2C2R A;  2JMG A;  1EXN A;  5GTI U;  5J2I A;  3BQ2 A;  4C80 A;  2NRW A;  3UXO A;  4ZOH C;  5ALL A;  4J9Q A;  3MR2 A;  2VA3 A;  3C1Y A;  4OAH A;  5KG1 A;  2EAN A;  1VJ7 A;  3H7I A;  3ZDB A;  5AM4 A;  1RXW A;  4O3Q A;  2AGO A;  3KD3 A;  5KFA A;  3F5E A;  4EYI B;  1UT5 A;  2ZIU A;  4MEX A;  5AKH A;  4I2F A;  5CRX A;  1NOM A;  2QAR B;  4KLQ A;  2ISP A;  4NY8 A;  4UAS A;  3AM9 A;  4OJ6 A;  5AM1 A;  2M2T A;  4EP7 A;  2W55 A;  2FI1 A;  4ACO A;  2CN1 A;  2I5H A;  3MDC A;  3OVA A;  5KFN A;  3PO5 A;  4QZE A;  4WH5 A;  3WFR E;  4P0P A;  3IM1 A;  1J97 A;  2XC9 A;  1COK A;  9ICX A;  1UPH A;  7ICQ A;  1ED1 A;  4I2J A;  4EEB A;  2RP5 A;  4IS7 A;  3V72 A;  4DL3 A;  1SIJ A;  5J0Y A;  3N7S C;  3ZD9 A;  1B4F A;  3C21 A;  1Z1V A;  1NK6 A;  2JV3 A;  4EGW A;  7ICU A;  2ALZ A;  1KFS A;  3HJ4 A;  2OHF A;  2F76 X;  3QEB Z;  5DGB A;  4TUR A;  5DG9 A;  3HW8 A;  2HHQ A;  2AQ0 A;  2E3T A;  5E79 U;  1SWW A;  3JPO A;  4Y2P A;  3MDA A;  1YT3 A;  3OJS A;  2EAP A;  3BZC A;  5KFP A;  5DB7 A;  3G6X A;  4JV0 A;  4YQW A;  7ICI A;  3KHL A;  1F0M A;  3L5K A;  4P4P A;  4J9K A;  3UQ0 A;  3H37 A;  2BPG A;  5KFR A;  5ALG A;  3AMZ A;  2WF5 A;  4KLM A;  1ZRM A;  3BS5 A;  1RXV A;  4OJ5 A;  3KFU F;  4C8N A;  5ALN A;  5J2D A;  3D2S A;  1Z00 A;  2W8L A;  3GIJ A;  1SV0 A;  1L6N A;  4UB6 U;  2DQN B;  4FBU A;  2AJQ A;  5DED A;  3M7D A;  1X9S A;  2JR5 A;  4OO1 J;  3PO4 A;  4EBJ A;  2IHO A;  5AI6 A;  2RHF A;  4U6P A;  3RR7 A;  4UD4 A;  3RH6 A;  4USA A;  2ZUC A;  2OYY A;  2PMZ F;  1AQ6 A;  2YMP A;  4C4S A;  3KKA C;  4M9J A;  2PFP A;  7ICV A;  4B9U A;  1JQR A;  2RDJ A;  3GDX A;  5HRL A;  4I28 A;  3H0L B;  3QE9 Y;  4X0A A;  2DR8 A;  1JRP A;  1MIV A;  5DBC A;  2ZJA A;  3RR8 A;  3SYZ A;  3L4P A;  8ICU A;  4IQU A;  4FHW A;  1O08 A;  2I9G A;  4DQQ A;  2HHU A;  2C22 A;  5CFS A;  5CEH A;  3Q8R B;  8ICH A;  4NM2 A;  3QUT A;  1QH9 A;  1F44 A;  2PFQ A;  5G5H A;  1MQ2 A;  3BQ0 A;  5AKE A;  4KLT A;  2WTF A;  1ZQP A;  1D8B A;  2IHM A;  3H4D A;  4UB5 A;  2O1P A;  3HP6 A;  4KN4 A;  2YN4 A;  2K8A A;  4B9V A;  1IM4 A;  5J0U A;  2NRK A;  5ALD A;  2FDR A;  2YB1 A;  3ISB A;  2EQY A;  2JEI A;  3JPP A;  3UMC A;  1OW5 A;  1VFG A;  5KG5 A;  3Q8L A;  1S0M A;  5B3P A;  3B0X A;  3VC8 A;  4DOB A;  5AM0 A;  1ZQU A;  1XSP A;  4EYH B;  4F5O A;  3H8W A;  5J2B A;  2XIC A;  7ICM A;  5K4L A;  2L5Y A;  4U7C A;  5KL1 B;  4QW9 A;  2XGP A;  5AI8 A;  4R66 A;  4KMU A;  3AQE A;  1OXJ A;  2OCE A;  1NK7 A;  4BXO B;  3N7P D;  5KT4 A;  3ZD8 A;  5ALF A;  4HX0 A;  5DBA A;  5KT6 A;  4TUP A;  2ASD A;  2BPF A;  4F3O A;  1SZP A;  4PHD A;  4K9B A;  4M9L A;  2KE7 A;  5ALO A;  4CE6 A;  1TAM A;  4O67 A;  1LVH A;  3GII A;  5F3X B;  4QW8 A;  3K1Z A;  3PSF A;  3PMN A;  1U4B A;  3SEI A;  3C2M A;  2M2V A;  4K99 A;  4FH3 A;  1ZOL A;  2EDU A;  3E2E A;  4YXJ A;  5KFH A;  3TAR A;  5L1I A;  1PK3 A;  4JLX A;  3MGH A;  4DL5 A;  1ZQV A;  3RRG A;  4P0Q B;  2EH9 A;  4EBK A;  1S0N A;  1KL9 A;  3AQK A;  3FYH A;  2W54 A;  4AYB F;  4IQW A;  4B9S A;  2OEH A;  2R8H A;  3M9M B;  1KFD A;  4EX6 A;  4DQP A;  4XRH A;  2WF9 A;  2ZTE A;  4B9N A;  2D8C A;  3CP8 A;  1XWL A;  4DLE A;  5KFK A;  9ICN A;  3QU7 A;  5KFX A;  3BQT A;  4DEZ A;  8ICL A;  4DSJ A;  4RUA A;  2Y9T A;  4OJP A;  2ZIV A;  4XA5 A;  2KG5 A;  2BCR A;  3F2B A;  4DOA A;  1J2N A;  8ICR A;  5IIK A;  3FM9 A;  5KT3 A;  4UAV A;  3PV8 A;  2W9C A;  4RQ3 A;  1Z1B A;  3TAD A;  4EEK A;  1RQL A;  4TUQ A;  4X4V A;  3C5F A;  2ZUD A;  4YVZ A;  4US9 A;  1SV4 A;  2HMX A;  5HNK A;  3JPQ A;  1X6I A;  1ZRN A;  5KNI A;  5HMM A;  3EZ5 A;  5HRE A;  1PZN A;  4JK1 A;  3G6Y A;  4KLJ A;  4RQ4 A;  5IIL A;  4RQ2 A;  5KAI U;  1SB3 C;  4F4Z A;  4ED1 A;  2UVV A;  3IDW A;  3F2C A;  2W9B B;  3H38 A;  1XO1 A;  2ZH9 A;  1N5W A;  7ICO A;  5G5G A;  1JI7 A;  2HBK A;  5J29 A;  7ICK A;  3I76 A;  1YZ6 A;  4MHV A;  2OWO A;  3AQL A;  4LEY A;  4OAF A;  3EUB 2;  4PJ0 U;  2ZIX A;  5J0W A;  3T5H A;  2ZH7 A;  3WKB A;  1XSN A;  5HRF A;  2H5X A;  5IIM A;  4F4K A;  5CP2 A;  5KFU A;  4NLG A;  3C18 A;  5DB8 A;  2E8N A;  9ICV A;  3JZ0 A;  5B5E U;  4F4W A;  1MA7 A;  1XU4 A;  5AM3 A;  3UMG A;  2LYB A;  4RQ8 A;  5EE1 A;  1N5X A;  3PVX A;  2D6F C;  4Y2X A;  3WFQ E;  2XVT A;  3NUQ A;  4NXU A;  3LQC B;  5L1J A;  3UQ2 A;  1V97 A;  3RJI A;  2H3V A;  1BPX A;  1ZJM A;  4DFM A;  3CW2 C;  4KLU A;  2HN2 A;  4NLN A;  4FS1 A;  3H0M B;  1F5S A;  2F44 A;  4PHA A;  4ECV A;  4UBB A;  2FPL A;  1R8A A;  8ICP A;  1JAL A;  2K8C B;  5HHI A;  5J8Y A;  4O6A A;  2NO4 A;  4HYK A;  2LYH A;  4PZN A;  1QQ6 A;  3OSP A;  4J9L A;  2PI5 A;  1DK3 A;  4OAG A;  1TK0 A;  1X66 A;  2ZTC A;  2EZX A;  9ICL A;  4I2A A;  4J9P A;  1JN3 A;  1SV0 C;  4FO1 A;  1YZ7 A;  5CA7 A;  3QU4 A;  5AKK A;  2BQR A;  4DQI A;  2E8M A;  3AQN A;  3HWT A;  2FPM A;  1Z3E B;  1A0P A;  2ATL A;  2AQ4 A;  1IIP A;  4WCW A;  3C1Z A;  2RFF A;  3TFS A;  7ICT A;  2ZHB A;  4EEL A;  2CPR A;  8ICX A;  3ZDC A;  1D9F A;  4E80 A;  1NZP A;  4C4T A;  1SXD A;  3OGU A;  1R8C A;  4GC7 A;  4IL6 U;  4KLI A;  2PKE A;  3RH4 A;  2QB1 A;  3PW0 A;  3IRU A;  1C20 A;  4Z6F A;  2JZB B;  2QB0 A;  3ETR A;  4ATB A;  1N56 A;  1SKW A;  4O3M A;  3ZDD A;  3JPS A;  4EBD A;  2FLP A;  4FE3 A;  4UQG A;  4M6W B;  3Q8P B;  2RLT A;  7ICJ A;  4Y2J A;  2DRA A;  3QUB A;  3SV4 A;  4X5V A;  2K60 A;  4IR1 A;  7ICF A;  4DL7 A;  3H39 A;  2F1I A;  1CEZ A;  1KTQ A;  3JYY A;  4NLK A;  4NM1 A;  5HRB A;  2ODG A;  3KHG A;  2ZIW B;  1FIQ A;  3ONN A;  4X4S A;  4CRX A;  2KSO B;  1BPZ A;  2ZH2 A;  2HOI A;  3FAH A;  4JV1 A;  2KIW A;  3BJY A;  4J9N A;  3HJ1 A;  5DB6 A;  4ED7 A;  2HHW A;  5KG3 A;  5H2F U;  4NJ8 A;  5AK5 A;  4RWQ A;  3IP4 B;  4RNM A;  2CRX A;  4IG8 A;  5IIO A;  1ARO P;  4DOC A;  2F8L A;  1HJP A;  1ZQE A;  2HW3 A;  3ALR A;  4UW9 A;  1MN8 A;  4EV6 A;  5KFV A;  5AM5 A;  1NK9 A;  3LVV A;  4QZB A;  4FHX A;  4YR3 A;  4WBY A;  5J0P A;  3LWM A;  1D8L A;  1ZQH A;  4LEW A;  1V38 A;  4NLB A;  2ZH8 A;  3C2K A;  4RUC A;  9ICO A;  4WC3 A;  2HVH A;  2BE3 A;  3SV3 A;  4NXW A;  5DLF A;  1OU5 A;  2ASJ A;  4IC9 A;  3HRD D;  3MFH A;  2KZ3 A;  4CF5 A;  5KG2 A;  4AT9 A;  5AKX A;  3AU2 A;  4R63 A;  2CXY A;  3RAQ A;  1JUD A;  4FZL A;  4AT8 B;  4MFF A;  4LVS A;  2IA6 A;  1RG6 A;  1ZXI A;  3QZ8 A;  2ZXH A;  1LKY B;  2YX8 A;  1TKD A;  3ED5 A;  4P4O A;  4LZG A;  2KMD A;  5ALU A;  4MFA A;  2P6R A;  2DBY A;  1JIH A;  1ZQO A;  2FLL A;  2AXT U;  5J2A A;  4PH5 A;  3UMB A;  1P7D A;  2KVC A;  3TFR A;  1TK5 A;  4Q8F A;  1S5L U;  4F4Y A;  3QYP A;  5J0S A;  1HUO A;  4ELU A;  5AKJ A;  3LYS A;  4GXI A;  4DLG A;  3KHR A;  1PVQ A;  1RZT A;  1PK1 A;  1PX5 A;  4KIT B;  4QIW C;  2KJ8 A;  4YD1 A;  4DS4 A;  4PL1 A;  1BGX T;  5ALI A;  4DL6 A;  2NV3 A;  1K1S A;  2H3F A;  2ID1 A;  2XY6 A;  2HDO A;  3H0R B;  2KK0 A;  3QX7 A;  3FDS A;  4K98 A;  3B9J A;  2I6X A;  4JUZ A;  1KW4 A;  2W03 A;  1X9X A;  3JCF A;  2A19 A;  3WK4 A;  2GO7 A;  2JEJ A;  2Y0S C;  1B22 A;  4DSF A;  4PGX A;  4I27 A;  1BNP A;  4KM5 A;  4QZD A;  4KLD A;  3RB4 A;  3TAD C;  4GIB A;  3AL0 B;  1NJY A;  4AT7 A;  3WK5 A;  5DLG A;  3O0F A;  2V4R A;  3D2N A;  4E8F A;  2P6U A;  2JXJ A;  4NL9 C;  1Q8K A;  2BZF A;  1L3U A;  2EZZ A;  7ICE A;  5L1L A;  3QUC A;  4ELV A;  3C28 A;  4F2R A;  3TAP A;  9ICG A;  4I0U A;  4Y2S A;  9ICM A;  5HC9 A;  2MSN A;  1S0O A;  3LWL A;  4QWD A;  1RYR A;  4X4R A;  5IIJ A;  5HRH A;  1ZJN A;  2R8G A;  1QSL A;  3CNH A;  3SQI A;  5CHG A;  2E5S A;  2A1J A;  1FO4 A;  2UVU A;  5J2E A;  5AK6 A;  4DO9 A;  5KFD A;  3PR5 B;  4F91 B;  4PHE A;  2HBM A;  4RT3 A;  7ICR A;  3EF2 A;  5AKI A;  4K4H A;  3C5G A;  4X4U A;  3WK9 A;  2KOB A;  2VA8 A;  4N7R A;  1S0V A;  5IIN A;  4OD0 A;  2ES6 A;  3GV8 B;  5KG6 A;  2E1E A;  2HBJ A;  5KFE A;  2ZHA A;  8ICG A;  1L7M A;  2F3N A;  5L1M A;  4UAY A;  5HRD A;  3TAN A;  3MCR A;  1L7P A;  3OPX A;  4ECU A;  3PX0 A;  3WFS C;  4B9L A;  4KLO A;  3GIK A;  4EZ9 A;  3OUY B;  1B0X A;  1X40 A;  4YN4 A;  3TAC B;  1KQQ A;  1ZQT A;  4M9H A;  4DSE A;  5J0O A;  5J8Y C;  8ICI A;  1X9W A;  4RQ6 A;  1D8Y A;  5L9X A;  2MUT B;  3MR3 A;  5EE0 A;  4O5C A;  3UPS A;  1S10 A;  2O5A A;  4RPX A;  1U9L A;  1Z4O A;  2IOF A;  1DXS A;  2BGW A;  4DWI A;  4Z6C A;  2ZXI A;  2C2E A;  1NKC A;  1CRX A;  5CHE A;  4QWB A;  4Q44 A;  3KHH A;  2HHT A;  1KN5 A;  2VKQ A;  1L3V A;  3ERC C;  1DRG A;  1UEU A;  5D4B A;  3KZX A;  4NXZ A;  1KDH A;  2K4I A;  2HSZ A;  1NJW A;  2KZM A;  4JWN A;  1KSP A;  2RRD A;  2ASL A;  4EBC A;  3PX6 A;  1QSS A;  2ZH1 A;  4PGY A;  4IRD A;  4YMN A;  3RBD A;  3RF9 A;  4E0D A;  3QXG A;  3AU6 A;  3WFP A;  1DGS A;  4PL2 A;  3NKU A;  4BWJ A;  2IHN A;  1F5A A;  5J0R A;  1FA0 A;  5CWR A;  2LHT A;  2BR0 A;  2Q66 A;  5HR9 A;  4J9S A;  4FS2 A;  1ZQK A;  2KZZ A;  3PX4 A;  2WFA A;  2YMQ A;  1MIW A;  2XY5 A;  7ICH A;  4UAW A;  1UA0 A;  5ALV A;  4UB1 A;  2R8J A;  5AIC A;  1R8B A;  2KHQ A;  3K1R B;  3V6K A;  2KEY A;  3HX0 A;  3RJE A;  2WB1 F;  4MFC A;  1SWV A;  4NKU A;  4YFK A;  3NAS A;  4M9G A;  3OWG A;  1SXE A;  1TV9 A;  3RFA A;  4R8U B;  2DFL A;  1J2M A;  4RQ7 A;  1N62 A;  3OVB A;  2VIX A;  9ICJ A;  4RPZ A;  3WKA A;  3V7K A;  1SL2 A;  3M9O B;  9ICQ A;  4XJE A;  4NV0 A;  2QKQ A;  3GFK B;  4I2I A;  4ECS A;  8ICQ A;  4EZ6 A;  1R89 A;  4ELT A;  4YR0 A;  4Z6E A;  2DWQ A;  8ICW A;  4LZD A;  1V9P A;  4IRK A;  4X4Q A;  2K89 A;  2IBK A;  4QWA A;  2ZIU B;  3RAX A;  1KNY A;  3PST A;  4M04 A;  4WC0 A;  4MF2 A;  4RQN A;  2MAX A;  3PML A;  4CF3 A;  1KLN A;  4P2H A;  4QZ9 A;  3N4M B;  3BQ1 A;  3RH5 A;  5D61 A;  4Q43 A;  9ICP A;  8ICF A;  1Q46 A;  4C8O A;  3RB6 A;  3N7R C;  4NXV A;  2XY7 A;  4RNN A;  4RQ5 A;  1DK2 A;  2RDI A;  1U48 A;  4P0P B;  3A0H U;  4PZO A;  3LK9 A;  4FH5 A;  5KG7 A;  4O9M A;  2RQ5 A;  1QLN A;  3PW7 A;  4OAI Z;  2FJ6 A;  3T79 A;  4Y2V A;  1XSL A;  3C23 A;  1Y88 A;  5BOM A;  2NO5 A;  3HIY A;  2KJ5 A;  3MAB A;  5ALS A;  4LT6 A;  2BBJ A;  5KFI A;  2ZH5 A;  3NVW A;  4F93 B;  3KOO A;  3RRH A;  3HT3 A;  4ECY A;  3GV7 B;  3OJU A;  5EWF A;  3PW5 A;  1MIY A;  4RQM A;  1JXL A;  1ZD2 P;  5AI4 A;  2JEG A;  3IG8 A;  3HKZ C;  4DSL A;  3BS5 B;  1LB2 B;  1RQN A;  2DRB A;  1Z00 B;  2QAR A;  3WKC A;  2A3V A;  4X0B A;  1UT8 A;  5HP4 A;  1ZD3 A; 
#chains in the Genus database with same CATH homology
 1ARO P;  4DOC A;  1HJP A;  3JPO A;  3Q8K A;  1TAU A;  3MDA A;  1ZQE A;  2HW3 A;  2BCS A;  4PGQ A;  3OJS A;  2ZH6 A;  5KFP A;  5DB7 A;  1NJX A;  9ICH A;  4WC5 A;  4X4O A;  4QWE A;  5KFV A;  3G6X A;  4JV0 A;  4YQW A;  4YD2 A;  1NK9 A;  7ICI A;  3GQC A;  4QZI A;  3KHL A;  3RB3 A;  8ICZ A;  3MFI A;  2J6S A;  3UQ0 A;  4QZB A;  4P4P A;  4J9K A;  3H37 A;  4YR3 A;  4Z6D A;  5J0P A;  2BPG A;  4FHX A;  4WBY A;  3EWA A;  7ICN A;  4ED8 A;  5KFR A;  1D8L A;  2FPK A;  3LWM A;  1ZQH A;  5KG4 A;  1L3S A;  2ZH8 A;  3C2K A;  4XQ8 A;  4RUC A;  4KLM A;  9ICO A;  4WC3 A;  1RXV A;  4B9M A;  3UXN A;  4WC6 A;  2HVH A;  2BE3 A;  3SV3 A;  4C8N A;  4DSK A;  4RT2 A;  5DLF A;  1OU5 A;  3T5J A;  5J2D A;  1Z00 A;  2W8L A;  2ASJ A;  3GIJ A;  2BCQ A;  4RQ0 A;  4FBU A;  4Q8E A;  2AJQ A;  3MFH A;  2KZ3 A;  4YCX A;  2C2D A;  1NK0 A;  3M8R A;  2VAN A;  3K4G A;  1Q79 A;  5DED A;  5KG2 A;  4XUS A;  4AT9 A;  1X9S A;  4IG8 A;  3M8S A;  4WC1 A;  5KFB A;  3AU2 A;  4R63 A;  5KFL A;  4O3O A;  3RAQ A;  3C66 A;  3RB0 A;  2HHV A;  1ZQQ A;  4AT8 B;  4ZH4 A;  4MFF A;  4LVS A;  2IA6 A;  3PO4 A;  4EBJ A;  5DG8 A;  3QZ8 A;  5J0T A;  3RR7 A;  5HHH A;  4WBZ A;  1ZQI A;  5EWG A;  4UD4 A;  4WC7 A;  3RH6 A;  1TKD A;  4P4O A;  4LZG A;  2ZUC A;  3HPO A;  3RJK A;  2KTQ A;  4MFA A;  4F8R A;  2BQU A;  4R64 A;  3TI0 A;  2P6R A;  1ZQO A;  1JIH A;  5KT5 A;  1MSW D;  2FLL A;  5J2A A;  4PH5 A;  4UAZ A;  3TFR A;  4DQS A;  1TK5 A;  4Q8F A;  4NLZ A;  3GIL A;  2PFP A;  4M9J A;  4F4Y A;  5J0S A;  4QZF A;  4F5Q A;  1NK4 A;  1HUO A;  4B9U A;  1U47 A;  4ELU A;  7ICL A;  5III A;  2RDJ A;  3GDX A;  9ICW A;  4GXI A;  4DLG A;  3RBE A;  2FMQ A;  1ZQL A;  3KHR A;  3QE9 Y;  4I28 A;  1RZT A;  3EW9 A;  4TQS A;  5KFM A;  4O5K A;  1PX5 A;  4BWM A;  4X0A A;  2DR8 A;  4KIT B;  1U49 A;  5KFQ A;  4QZH A;  1MIV A;  5DBC A;  4YD1 A;  2ZJA A;  4IR9 A;  4DS4 A;  4AT8 A;  5KFS A;  1BGX T;  4FHY A;  3RR8 A;  4EEY A;  3SYZ A;  3PY8 A;  4DL6 A;  8ICU A;  1K1S A;  4IQU A;  4FHW A;  4JV2 A;  2I9G A;  4DQQ A;  2ID1 A;  4RZR A;  2HHU A;  4AT7 B;  5JUM A;  2J6T A;  4X4P A;  2C22 A;  1K1Q A;  5C5J A;  3Q8R B;  4PPX A;  4NM2 A;  1ZQB A;  8ICH A;  3TAQ A;  4FO6 A;  1ZQZ A;  5J2J A;  2XY6 A;  2BCU A;  2AGP A;  2PFO A;  2PFQ A;  1MQ2 A;  1X9M A;  4UB4 A;  3BQ0 A;  5J2C A;  4F50 A;  1QSY A;  3FDS A;  1MC8 A;  4KLT A;  4ED6 A;  4FHP A;  2WTF A;  1ZQP A;  2IHM A;  4RPY A;  4JUZ A;  4UB5 A;  3H4D A;  3HP6 A;  9ICC A;  2O1P A;  4KN4 A;  1KRP A;  4M47 A;  2HHP A;  1WOT A;  1B43 A;  4QZ8 A;  4B9V A;  1IM4 A;  5J0U A;  4BGD A;  2NRK A;  1ZQX A;  2JEJ A;  8ICM A;  1B22 A;  3ISB A;  5DB9 A;  4PGX A;  4DSF A;  3PNC A;  4I27 A;  4KLG A;  1ZQD A;  1BNP A;  1SKR A;  1ZET A;  1TK8 A;  5D46 A;  4UBC A;  3ZDE A;  4QZD A;  3QEA Z;  2JEI A;  3JPP A;  4YMO A;  1HUZ A;  3H3A A;  3M9N B;  4KLD A;  2ZJ5 A;  3RB4 A;  4O3R A;  1KEJ A;  5DGA A;  5DEC A;  1VFG A;  1X2I A;  2V9W A;  5KG5 A;  3Q8L A;  1S0M A;  1NJY A;  4AT7 A;  3B0X A;  5DQH A;  4DOB A;  1XSP A;  1ZQU A;  1ZQF A;  5DLG A;  4EYH B;  4F5O A;  2V4R A;  3H8W A;  2KP7 A;  5J2B A;  2BPC A;  2Y1J A;  4E8F A;  7ICM A;  2P6U A;  4E7X A;  2A1J B;  4QW9 A;  2XGP A;  2P66 A;  3OV7 A;  3IHQ B;  3MBY A;  1NJZ A;  4KMU A;  4R66 A;  1L3U A;  7ICE A;  4WC2 A;  1ZQA A;  5KFT A;  1JXE A;  3V7J A;  2XCA A;  1NK7 A;  4O0I A;  1NK5 A;  4BXO B;  5L1L A;  4ELV A;  4F2R A;  5KFG A;  3TAP A;  4QWC A;  9ICG A;  3MGI A;  5KT4 A;  3GIM A;  4J9O A;  3ZD8 A;  1S77 D;  4KLE A;  8ICT A;  4UD5 A;  1ZQR A;  4YMM A;  5DBA A;  5KT6 A;  5DBB A;  9ICM A;  4F5R A;  4TUP A;  2ASD A;  2BPF A;  4F3O A;  4WC4 A;  1N48 A;  1SZP A;  5HC9 A;  3TQ1 A;  4PHD A;  8ICA A;  3KTQ A;  3V7L A;  4F4X A;  1S0O A;  4M9L A;  3NTU A;  3LWL A;  4QWD A;  5J0X A;  1RYR A;  4X4R A;  4BDP A;  5BOL A;  5IIJ A;  5KFW A;  5F9N A;  3GII A;  4QW8 A;  5HRH A;  1ZJN A;  3SZ2 A;  1SL1 A;  3PW4 A;  2ZTD A;  2R8G A;  1NKB A;  2W8K A;  2XCP A;  4C8L A;  1QSL A;  4IRC A;  4ATB B;  3PMN A;  2J6U A;  5CHG A;  1U4B A;  2DR7 A;  2A1J A;  2UVU A;  3LDA A;  3C2M A;  5J2E A;  2M2V A;  2Y1I A;  5CR0 A;  5CB1 A;  4Q45 A;  4DO9 A;  4UB3 A;  4ECZ A;  4YG2 A;  4YR2 A;  4QZC A;  4BXO A;  4FH3 A;  5KFD A;  4JWM A;  9ICT A;  3PR5 B;  4MF8 A;  2UVR A;  4F91 B;  3E2E A;  7ICP A;  1ZQJ A;  3RJF A;  4YXJ A;  5KFH A;  4PHE A;  3V6J A;  3TAR A;  3THV A;  1XC9 A;  4RT3 A;  5L1I A;  7ICR A;  4P4M A;  2BDP A;  4CCH A;  2BKE A;  4G3I A;  1YLQ A;  3MGH A;  3ISD A;  4K4H A;  3C5G A;  4DL5 A;  2HHS A;  4X4U A;  1ZQV A;  2VA8 A;  3RRG A;  1S0V A;  5IIN A;  1BVS A;  4EBK A;  1S0N A;  4I29 A;  8ICS A;  3GV8 B;  3ISC A;  5KG6 A;  3FYH A;  7ICV A;  3AQK A;  1BPY A;  1JQR A;  2XGQ A;  4IQW A;  5KFE A;  4O5E A;  8ICG A;  2ZHA A;  4I2D A;  2DPJ A;  4B9S A;  2KFN A;  1ZQS A;  4UAY A;  4J9R A;  2W9C B;  5DQI A;  2R8H A;  3M9M B;  3TAN A;  1S97 A;  2AGQ A;  1KFD A;  5HRD A;  4ECU A;  4J9M A;  4UB2 A;  3PX0 A;  4DQP A;  5F9L A;  4B9L A;  4XRH A;  3WFS C;  4KLO A;  2ZTE A;  3GIK A;  4EZ9 A;  4B9N A;  5KFJ A;  3OUY B;  2R8I A;  4YN4 A;  1XWL A;  4KLH A;  4DLE A;  2HHX A;  1S9F A;  5KFK A;  1ZQT A;  1JX4 A;  4I2B A;  4KLF A;  4DSE A;  5J0O A;  4M9H A;  9ICN A;  3SI8 A;  4F5P A;  1TFY A;  8ICI A;  1X9W A;  5KFX A;  1T3N A;  3ZDA A;  4FHV A;  3BQT A;  5D49 A;  4DEZ A;  4RQ6 A;  1D8Y A;  5L9X A;  2MUT B;  8ICL A;  4DSJ A;  4RUA A;  3MR3 A;  3JPN A;  4MEY A;  4O5C A;  4XA5 A;  5L1K A;  1S10 A;  8ICJ A;  3UPS A;  2NRT A;  3BDP A;  2O5A A;  2BCR A;  2PI4 A;  1WCL A;  1IXR A;  4RPX A;  4DOA A;  1U9L A;  4ED2 A;  5DG7 A;  1ZQY A;  8ICR A;  5IIK A;  2FMP A;  2BGW A;  4ED3 A;  4KTQ A;  1NK8 A;  5KT3 A;  5EOZ A;  4DWI A;  4M5D A;  1BPD A;  1Q78 A;  2Q0Z X;  3PV8 A;  2W9C A;  2PFN A;  4RQ3 A;  4NKT A;  4S3N A;  4Z6C A;  3AUO A;  9ICU A;  4TUQ A;  3T5K A;  2C2E A;  2B21 A;  1ZQG A;  1NKC A;  5DKW A;  3RJJ A;  4X4V A;  4QWB A;  4RQ1 A;  4Q44 A;  3C5F A;  2ZUD A;  4YXM A;  4DFK A;  5CJ7 A;  4YVZ A;  5KT2 A;  2DPI A;  3KHH A;  2FLN A;  3OUY A;  2HHT A;  2VA2 A;  2UVW A;  4RWN A;  4O3S A;  4RNO A;  5HNK A;  2HVI A;  3AQM A;  1L3V A;  4QZG A;  3JPQ A;  2DR9 A;  5BPC A;  5HMM A;  2I1Q A;  4ECX A;  3EZ5 A;  1UEU A;  5D4B A;  2MUT A;  1T7P A;  4ECW A;  5HRE A;  5J2K A;  1PZN A;  1JMS A;  4JK1 A;  4NXZ A;  3G6Y A;  5KFZ A;  1NJW A;  1KDH A;  1D9D A;  4JWN A;  4KLJ A;  2KZM A;  1KSP A;  4RQ4 A;  5IIL A;  4RQ2 A;  2ASL A;  4B9T A;  4EBC A;  2ZH3 A;  1XS9 D;  2ZJ8 A;  4F4Z A;  4ED1 A;  2UVV A;  3H8J A;  1A77 A;  3PR4 A;  8ICN A;  1L5U A;  2W9B B;  3H38 A;  3PX6 A;  1XO1 A;  1QSS A;  4DQR A;  2GWS A;  4DSI A;  2ZH1 A;  2ZH9 A;  7ICO A;  4PGY A;  3QZ7 A;  4IRD A;  4I2C A;  4YMN A;  3RBD A;  4X4T A;  5J29 A;  3ORY A;  4IQV A;  7ICK A;  2OWO A;  4E0D A;  4I2E A;  3AQL A;  3AU6 A;  7ICG A;  3WFP A;  1DGS A;  2NRV A;  5J0W A;  4TUS A;  4KLS A;  4BWJ A;  2PXI A;  2C28 A;  3T5H A;  2IHN A;  8ICO A;  3H8S A;  3EYZ A;  5J0R A;  1F5A A;  1FA0 A;  2ZH7 A;  5CWR A;  1H38 A;  1BPE A;  2BR0 A;  5EWE A;  2Q66 A;  1V4A A;  1XSN A;  5HRF A;  5HR9 A;  4J9S A;  1S76 D;  3UXP A;  4FS2 A;  2BCV A;  4RWP A;  2H5X A;  5IIM A;  4F4K A;  5J2H A;  3B0Y A;  4ECQ A;  9ICK A;  1A76 A;  1ZQK A;  1QTM A;  3PW2 A;  2KZZ A;  2V4Q A;  4GXJ A;  3PX4 A;  5CP2 A;  3OSN A;  3V6H A;  3H40 A;  5KFU A;  1RYS A;  1MIW A;  5F2V O;  4RU9 A;  4NLG A;  1SL0 A;  5DB8 A;  3GV5 B;  2XY5 A;  2KFZ A;  3C18 A;  7ICH A;  4UAW A;  4ED0 A;  9ICV A;  1UA0 A;  3JZ0 A;  2DR5 A;  1DOQ A;  4YP3 A;  4UB1 A;  2W9B A;  4F4W A;  4ECT A;  3H4B A;  3RTV A;  1C7Y A;  2R8K A;  1XU4 A;  2R8J A;  5KT7 A;  9ICB A;  1R8B A;  2BHN A;  4RQ8 A;  3V6K A;  3PVX A;  1ZYQ A;  1UET A;  1JAJ A;  1U45 A;  9ICI A;  3WFQ E;  4M2Y A;  9ICF A;  1ZQM A;  9ICE A;  3Q8M A;  3LQC B;  5L1J A;  3UQ2 A;  3OVS A;  4DS5 A;  4F5N A;  1MQ3 A;  3HX0 A;  3RJE A;  4MFC A;  8ICB A;  3RJI A;  4NKU A;  5J2F A;  1BPX A;  4F2S A;  3T3F A;  1ZJM A;  4YFK A;  4DFM A;  9ICA A;  9ICR A;  2W9A A;  4KLU A;  4M9G A;  2M2W A;  1TAQ A;  3NGD A;  4NLN A;  4FS1 A;  4PHA A;  2KN7 A;  4UBB A;  4ECV A;  1RPL A;  4I2G A;  2FPL A;  1TV9 A;  4R8U B;  1R8A A;  2DFL A;  4DL2 A;  8ICP A;  5HHI A;  3JPR A;  4RQ7 A;  2IMW P;  3OHB A;  3OVB A;  8ICC A;  1T8E A;  2LYH A;  4HYK A;  9ICJ A;  3OSP A;  4RPZ A;  1UEV A;  3V7K A;  4J9L A;  1SL2 A;  2ZUB A;  3C2L A;  3Q8Q B;  5DDM A;  3MR5 A;  3M9O B;  2PI5 A;  1LV5 A;  9ICS A;  4O3N A;  9ICQ A;  5HRK A;  3G6V A;  1NKE A;  3K75 D;  4IQT A;  7ICS A;  2XO7 A;  4DFJ A;  1DK3 A;  3GFK B;  1TK0 A;  4I2I A;  4ECS A;  8ICQ A;  1L3T A;  4EZ6 A;  1CUK A;  2ZTC A;  2FMS A;  1T4G A;  4ELT A;  1R89 A;  4C8K A;  9ICL A;  4O3P A;  3UPQ A;  5KFF A;  4YR0 A;  4I2A A;  4J9P A;  4Z6E A;  1JN3 A;  2ZH4 A;  5KFO A;  8ICW A;  4LZD A;  5CA7 A;  1V9P A;  2NRX A;  3N97 B;  2BQR A;  8ICY A;  4DQI A;  4GC6 A;  4FBT A;  4IRK A;  5HRG A;  3AQN A;  4X4Q A;  2IBK A;  3HWT A;  2FPM A;  4GLX A;  4QWA A;  2W9M A;  1Z3E B;  4DFP A;  3H39 A;  2ATL A;  2AQ4 A;  3RAX A;  4K4G A;  4M04 A;  1KNY A;  8ICV A;  4WC0 A;  4MF2 A;  4DF4 A;  1ZQW A;  4WCW A;  1ZQN A;  2MAX A;  3C1Z A;  3OHA A;  2RFF A;  5DDY A;  4R8U A;  3PML A;  5KTQ A;  5J2G A;  5J0Q A;  3TFS A;  1KLN A;  4P2H A;  7ICT A;  4XQ7 A;  4QZ9 A;  3N4M B;  8ICX A;  3WFO A;  3NYB A;  2ZHB A;  3BQ1 A;  3ETL A;  4F92 B;  3ZDC A;  3L9D A;  3RH5 A;  1D9F A;  4Q43 A;  4E80 A;  2BQ3 A;  9ICP A;  1NZP A;  4X4N A;  8ICF A;  4PHP A;  3OGU A;  2C2R A;  4C8O A;  4K4I A;  1R8C A;  3MR6 A;  4GC7 A;  3RB6 A;  3RJG A;  1EXN A;  4I2H A;  4KLI A;  2XY7 A;  4RNN A;  1BNO A;  2PBE A;  5HML A;  4RQ5 A;  5J2I A;  3RH4 A;  1DK2 A;  2RDI A;  4KN7 A;  3BQ2 A;  1U48 A;  3Q8S B;  4GXK A;  2NRW A;  3PW0 A;  3RJH A;  4Z6F A;  3UXO A;  3LK9 A;  4FH5 A;  3EPI A;  4J9Q A;  3MR2 A;  2JZB B;  3C1Y A;  2VA3 A;  5HRI A;  5KFY A;  5KG7 A;  4O9M A;  5KG1 A;  4DL4 A;  4DF8 A;  1VJ7 A;  1QLN A;  3H7I A;  3ZDB A;  4ATB A;  3PW7 A;  1RXW A;  1N56 A;  1SKW A;  4O3Q A;  3ZDD A;  2AGO A;  5KFA A;  3JPS A;  1NO5 A;  4EYI B;  2F1J A;  1UT5 A;  1XSL A;  8ICE A;  3C23 A;  1Y88 A;  1TVA A;  5BOM A;  4MEX A;  3T5L A;  5KG0 A;  4EBD A;  2FLP A;  4UQG A;  1SKS A;  2ISO A;  3HIY A;  3MAB A;  4I2F A;  4M6W B;  1NOM A;  3Q8P B;  4LT6 A;  4QZA A;  5KFI A;  7ICJ A;  2DVI A;  1BPB A;  4KLQ A;  2ZH5 A;  2DRA A;  4F93 B;  2ISP A;  3SV4 A;  1KFT A;  4NY8 A;  3RRH A;  4X5V A;  5DQG A;  4IR1 A;  7ICF A;  3HT3 A;  4DL7 A;  4ECY A;  4EBE A;  4ECR A;  2F1I A;  3OJU A;  5EWF A;  3GV7 B;  2NRZ A;  1CEZ A;  1KTQ A;  4M9N A;  3JYY A;  4NLK A;  3PW5 A;  4KLL A;  2M2T A;  1MIY A;  5KFC A;  4EP7 A;  4NM1 A;  5HRB A;  3MDC A;  3OVA A;  5KFN A;  3PO5 A;  4QZE A;  3KHG A;  3WFR E;  3IM1 A;  1JXL A;  4X4S A;  2XC9 A;  2JEG A;  1TFR A;  2JZB A;  1ZQC A;  5TZV A;  1BPZ A;  9ICX A;  2ZH2 A;  7ICQ A;  4RWO A;  4JV1 A;  4I2J A;  8ICK A;  3JPT A;  3V72 A;  3BJY A;  4DL3 A;  4J9N A;  3HJ1 A;  5J0Y A;  4DSL A;  5HRL A;  5DB6 A;  4ED7 A;  2JEF A;  3ZD9 A;  2M2U A;  1LB2 B;  2HHW A;  3C21 A;  5KG3 A;  1NK6 A;  2DRB A;  2M9N A;  4C8M A;  4RWQ A;  1Z00 B;  1WCN A;  3EPG A;  7ICU A;  2ALZ A;  1KFS A;  3HJ4 A;  1UA1 A;  4M6W A;  2F1H A;  4RNM A;  4R65 A;  4X0B A;  1UT8 A;  5DGB A;  3QEB Z;  4TQR A;  4TUR A;  1COO A;  4M0A A;  4AT9 B;  2AU0 A;  1TFW A;  5DG9 A;  5HP4 A;  3HW8 A;  2HHQ A;  5IIO A;  2AQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...