4MFAA

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template o6mg and incoming ttp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
321
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of human DNA polymerase beta inserting bases opposite templating O6MG
rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 108
structure length 321
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mfaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mfaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mfaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mfaA03
4F92B 5KFGA 4KLUA 3UPSA 2ZHBA 3MFHA 4LZDA 1ZQUA 2P6RA 1V9PA 3RR8A 2AU0A 8ICOA 3PX6A 2OWOA 3ZDCA 8ICLA 9ICFA 7ICQA 3OHAA 3TQ1A 1MQ2A 1TFWA 4DFMA 4DO9A 1K1QA 1RXWA 3OVAA 3M8RA 3V72A 2JEJA 4PGYA 4I2GA 1TAUA 3GIJA 2BKEA 1ZQGA 3HJ1A 1ZQRA 5KFKA 2KFZA 4WC4A 7ICRA 3MDAA 3H40A 3SZ2A 1KEJA 3PMLA 4QZHA 3H7IA 2W9AA 1NJYA 4DOBA 1JX4A 1ZQEA 5KFRA 2O1PA 4JK1A 5DBCA 3GIIA 2AGOA 2BPFA 2WTFA 2DR9A 5KFYA 4B9SA 3H8JA 5KG7A 3H4BA 3UQ0A 8ICHA 4QZ9A 4O0IA 1RXVA 4UAWA 3RBDA 4J9QA 1S0NA 4X4NA 4NKUA 4I2DA 4FS1A 5EWGA 1XO1A 1HUOA 5KT3A 4I2AA 4EYIB 4X4TA 1K1SA 4RPYA 1KFTA 5HRHA 3G6XA 2BHNA 4EBDA 5HNKA 4I29A 4PHAA 4Q8FA 2HHSA 1BPDA 1A76A 4UB5A 3SV3A 2FLPA 5DBBA 2HHXA 9ICIA 2ZTDA 7ICSA 8ICXA 4YD1A 3BQTA 4QZEA 2ASDA 1Q79A 1EXNA 3V7LA 2PFNA 4MFFA 5DB6A 5L1JA 5HP4A 5J0WA 5F9LA 4YR3A 3KHHA 1NKCA 4I2EA 4ATBB 4GLXA 2XY6A 1WCNA 1NK6A 4F8RA 2BE3A 3RJKA 5KT5A 3WFQE 1ZQWA 5KG1A 1R8AA 3HP6A 2ASLA 4AT9A 5BOLA 5KFMA 5J2BA 4TQRA 8ICCA 8ICZA 2ZH8A 4ECSA 1COOA 9ICLA 4FH5A 5KFHA 4F3OA 5EWEA 5EOZA 1UT5A 9ICHA 2R8GA 3AQKA 4QWDA 3RRHA 4QZDA 3PMNA 4IR1A 1BNOA 5KG4A 3PW7A 3TFRA 4ECUA 3UXPA 4DL2A 1XSNA 2HHVA 3L9DA 7ICMA 1UETA 2ZH9A 3WFSC 1KLNA 4FHXA 4F4YA 4PGXA 4ECYA 2R8JA 3RTVA 5KFSA 8ICRA 3JPTA 2AQ4A 2AGPA 2LYHA 1T8EA 2W8LA 1T4GA 4MF8A 4FS2A 3M9MB 4K4GA 1LV5A 3JPSA 5L1KA 4X4SA 2IBKA 3PO4A 4F2RA 4DL3A 1OU5A 3HWTA 3JPNA 3LWMA 4MEXA 8ICBA 5DBAA 3RB6A 3PV8A 4ECZA 3ISDA 7ICIA 2ZH7A 1C7YA 4AT7A 4KLMA 3T5HA 4C8NA 4C8MA 3FYHA 5C5JA 3IM1A 3ETLA 9ICCA 4RWQA 4GXIA 3EYZA 5L1IA 1NK9A 4DL4A 4JWNA 1UT8A 3PW5A 1IM4A 1XSLA 7ICEA 2IHNA 4RQ1A 4DSLA 4HYKA 4M47A 4M9GA 4FHYA 2UVWA 2ZUDA 4R66A 4DFPA 4E7XA 4Z6FA 1RYSA 4DL7A 1R8CA 5J0OA 4KITB 1NKBA 3PR4A 3OVBA 3B0YA 4EZ9A 9ICOA 3SV4A 3RJEA 4QZIA 4RZRA 3SYZA 2BCSA 4NY8A 3H39A 2BGWA 4QW9A 1NKEA 3LQCB 3T3FA 2C2DA 1XSPA 4FHVA 3V6JA 1B22A 1ZQTA 4F4KA 4O3NA 4KLQA 1ZQDA 4F5PA 2HVIA 1VJ7A 1V4AA 4ECQA 3RH5A 8ICIA 1JAJA 2R8IA 3RAQA 3PNCA 2M9NA 2M2WA 1RYRA 4RQ6A 4F93B 3C18A 5KFIA 5JUMA 4M0AA 1BPXA 1ZQJA 1U49A 5HRBA 4F5RA 5DQHA 4PGQA 4QWBA 1ZYQA 5HRFA 7ICHA 2I9GA 1U4BA 3MGIA 4KN7A 4JV2A 3ISBA 4EBKA 9ICXA 4XA5A 4J9KA 4KLFA 4X4RA 1ZQVA 1DOQA 5J29A 4DFJA 1BPYA 4RWNA 2HHWA 2ALZA 1F5AA 3T5JA 5KT4A 4KLDA 3QZ8A 4ED2A 3RH4A 1BNPA 4FH3A 4X4VA 4PPXA 5IIKA 3ZDBA 3C1ZA 4UBBA 2VANA 4K4HA 5HRDA 2NRXA 3HW8A 4LVSA 1JIHA 5IIIA 2JEGA 2IMWP 7ICPA 2ID1A 2IHMA 4Z6DA 4BDPA 1S76D 4BGDA 5HREA 4TUQA 1QSYA 4K4IA 2FPKA 5DDMA 4RNNA 1XS9D 4RQ0A 4M6WB 2W9CB 3C5GA 1QSLA 4F2SA 3EW9A 5IIJA 5IILA 1ZETA 2DR5A 4ATBA 1KTQA 2BCVA 2ZHAA 3OGUA 4UB4A 1QSSA 2FLLA 1HJPA 2FLNA 5KT7A 7ICLA 1SZPA 4UB3A 3MFIA 5KFEA 1BPEA 4MFAA 3MR6A 3RH6A 2FMSA 4RWOA 3HPOA 4Q44A 9ICUA 3E2EA 4QWAA 3OVSA 2KFNA 3FDSA 1ZQIA 4E0DA 9ICBA 4QZAA 3KHLA 1S77D 5IIOA 2XGPA 3IHQB 5KFXA 3MBYA 3EPGA 3RB0A 4BXOA 4C8KA 3QE9Y 5D46A 3RRGA 5CP2A 4F4ZA 3ZD9A 4ELTA 3JPOA 1LB2B 8ICWA 1NO5A 2Y1JA 1MIYA 3JYYA 1TFYA 1BPBA 3UPQA 3C5FA 4GXJA 4DSFA 4M9NA 3B0XA 4X4PA 1MSWD 1L3SA 4I27A 3M9NB 4TUSA 4J9NA 5D4BA 9ICTA 3OUYB 4ECVA 4DQSA 4M9LA 4DSEA 3V7KA 1JMSA 4QZBA 4QZGA 2PI5A 2XC9A 5HHHA 2XY5A 4IR9A 5HRGA 1U47A 1L5UA 4DS5A 2VA8A 4KLEA 4ED3A 1BVSA 4KLHA 3AQNA 4AT9B 8ICUA 1RPLA 4DF8A 1JN3A 1TK8A 4RNMA 7ICOA 3ISCA 1U48A 1XC9A 1DK2A 1SL2A 2FPLA 5DB8A 1ZQQA 4F5NA 3C66A 5IIMA 5HC9A 2FMPA 1NOMA 2NRWA 4ED7A 5BPCA 1ZQLA 2VA3A 3H3AA 4X4UA 3NTUA 2PFPA 9ICSA 4ZH4A 3ZD8A 5DB7A 2RFFA 3GQCA 2BCRA 2XCPA 4B9NA 3EPIA 5J2EA 1U45A 1X9MA 4YFKA 2AQ0A 3QZ7A 4E8FA 1Q78A 4C8LA 5DB9A 2ZUCA 5HMLA 2ASJA 4UD5A 3JPQA 3BJYA 3Q8LA 4EBCA 2MUTB 1KSPA 8ICKA 4X4QA 4KLTA 4Q45A 4QW8A 4DQRA 8ICGA 4QZ8A 4KN4A 2C2EA 1Z3EB 4I2FA 7ICFA 9ICNA 2PFOA 3TAQA 9ICWA 4X4OA 3G6VA 4RNOA 1NK4A 4WC2A 2A1JB 1IXRA 2W9MA 1X2IA 4UBCA 4EEYA 4IQTA 2PXIA 1TK5A 3RB4A 4FHPA 3BQ1A 4IRCA 2Q66A 1Z00B 2XGQA 2KTQA 1ZQXA 2C2RA 1N56A 4MEYA 5DG8A 2V4RA 9ICJA 3RJJA 4NLNA 4B9MA 5DEDA 3Q8SB 2JZBB 1TKDA 3PY8A 3PW0A 4DWIA 1UA0A 9ICVA 3LDAA 3H38A 4FBTA 2KP7A 4YR0A 3JPPA 4EBEA 3K4GA 4J9PA 4B9LA 5HMMA 3C1YA 3OV7A 1ZJMA 4RT3A 3ORYA 5J2AA 4UAZA 4TURA 1NK0A 4IRKA 4LZGA 5L9XA 4UAYA 4IQWA 2A1JA 3OHBA 2ISOA 2BQUA 1NJZA 5KFJA 8ICQA 1R89A 2DPIA 5L1LA 4RQ5A 2NRTA 4RUAA 1ZQKA 1S0OA 2VA2A 3H8SA 2KZ3A 1WOTA 3UXNA 4QWEA 5J2GA 2PFQA 8ICTA 1XU4A 3WFRE 5DLGA 4FO6A 5KFDA 3Q8KA 2C28A 1D9FA 4WC7A 4KLLA 1JQRA 1ZQYA 1UEUA 1S10A 2UVUA 4IQVA 3Q8RB 3N97B 5J0TA 2HVHA 4AT8B 3HIYA 4JUZA 3OSNA 4F91B 5HRLA 4RT2A 4KLSA 3JZ0A 4RQ8A 3TI0A 1KDHA 4RPXA 3V7JA 4J9LA 4DOCA 4ED8A 3GV5B 1S0MA 1WCLA 3TFSA 1UA1A 4B9TA 4DLGA 1JXEA 3UQ2A 4NLZA 3K75D 3MR2A 2JEFA 4P2HA 2HHTA 5J2KA 5DECA 3BDPA 4O5KA 2ZJ5A 5J2CA 3T5KA 4RQ7A 5KG6A 4R65A 3RJHA 4J9MA 4DQQA 3C23A 3OSPA 2KZMA 5KG3A 2XY7A 4R8UA 4R64A 1X9WA 4KLOA 4WC1A 5KFLA 4MF2A 1NK5A 4DQPA 2W9BB 3TAPA 2ZH5A 3T5LA 2RDJA 3THVA 4P4OA 2JEIA 1KNYA 3QEAZ 1TAQA 2PI4A 7ICUA 4EP7A 4M9JA 4XRHA 2HHPA 1ZQFA 4NLGA 4NXZA 4DS4A 1A77A 3MR5A 5KG0A 3QEBZ 3LK9A 2DPJA 2J6SA 4I2BA 4NM1A 7ICNA 4X0AA 3BQ0A 5KFTA 3Q8MA 2ZH1A 4ECTA 2GWSA 4XQ7A 5J0YA 3RBEA 5J0RA 2ATLA 3RJGA 5KFPA 3PO5A 5DQIA 3Q8QB 4O5CA 4DSIA 3C2KA 2KZZA 5TZVA 4DLEA 3AQMA 2ZTCA 3ZDAA 1SL1A 2ISPA 5J2DA 3PW2A 2O5AA 1FA0A 2DRBA 2ZH3A 3AU6A 5KFBA 1KFDA 4KLJA 3AQLA 2I1QA 3PW4A 8ICMA 4F4WA 2P6UA 4EZ6A 8ICEA 9ICQA 2BPGA 4ED0A 1S97A 3H4DA 4CCHA 1Y88A 5DQGA 4F50A 4O3SA 3AU2A 3NGDA 3G6YA 4UB2A 1NK8A 1T3NA 3Q8PB 4X5VA 3ZDEA 3HT3A 4C8OA 2DVIA 4M2YA 3MGHA 4RU9A 1ZQAA 2BCQA 5DGAA 4YD2A 2W9CA 4JV1A 3OUYA 4DSJA 4O3OA 4DQIA 4E80A 4IG8A 3GIMA 5IINA 2IA6A 4J9RA 4I2CA 1ZQHA 3LWLA 4I28A 1BGXT 4WC5A 3HJ4A 3MR3A 1L3TA 8ICPA 4WC3A 4O5EA 8ICJA 1Z00A 2MAXA 3PVXA 5J0PA 4P4MA 4GC7A 4KLGA 5CA7A 5KFZA 3TANA 9ICRA 3V6HA 4TUPA 5KFQA 3KHRA 1NJXA 1ZQCA 2BPCA 1TV9A 3OJSA 4AT7B 1ZQSA 4GC6A 4AT8A 3PX0A 5CR0A 1ZQZA 1KFSA 8ICYA 4GXKA 1TVAA 5CHGA 2P66A 4UQGA 5BOMA 4BXOB 5HRKA 3WFPA 2W9BA 5J0QA 1T7PA 2BDPA 4QZCA 5KFVA 8ICAA 4YXJA 4YQWA 3GILA 3EZ5A 1MQ3A 2UVRA 1N48A 8ICSA 4RQ4A 5KFNA 1QTMA 2M2VA 1NK7A 3H8WA 5KFUA 5KFFA 4ED6A 2C22A 2BQRA 1R8BA 1TFRA 4FHWA 3KHGA 4PHEA 5J2IA 3RJIA 4KMUA 5KG2A 4R8UB 7ICVA 5J2FA 1MIWA 1KRPA 4IRDA 2BCUA 2V9WA 5CJ7A 3OJUA 2HHQA 4F5QA 5KG5A 3RJFA 7ICJA 4O3PA 2J6TA 1D9DA 1HUZA 4RQ3A 5J2HA 4O9MA 5DG9A 1XWLA 4YR2A 4O3RA 1H38A 4DFKA 9ICPA 1AROP 4WBYA 1ZJNA 4ECWA 4NKTA 5HRIA 5KT2A 5J0UA 3V6KA 2HHUA 1ZQMA 3MABA 1RZTA 2BQ3A 7ICTA 4Z6CA 4X0BA 4NM2A 3AUOA 3MDCA 4F5OA 9ICKA 2NRZA 3PR5B 1UEVA 5DGBA 5KFOA 5DKWA 2Q0ZX 3RR7A 4P4PA 3TARA 4ED1A 4KTQA 4F4XA 1QLNA 4FBUA 4R63A 4YXMA 4WC6A 5KT6A 2KN7A 7ICGA 4DL5A 2HW3A 2M2TA 2PBEA 2XO7A 1DGSA 2Y1IA 4YCXA 5DG7A 4DF4A 4MFCA 1D8YA 3RAXA 4TQSA 2MUTA 4IQUA 1SKWA 4ECRA 2R8KA 5HHIA 4ELVA 3GV8B 4EYHB 5F2VO 4WBZA 1JXLA 4YG2A 2JZBA 4XQ8A 4WC0A 5CB1A 4JWMA 2DR7A 2H5XA 3GFKB 4S3NA 5DLFA 5F9NA 3GDXA 4YMMA 1BPZA 9ICEA 4PHDA 3BQ2A 1S0VA 4ECXA 1S9FA 1ZQNA 4DSKA 5DDYA 2ZH4A 4B9VA 2RDIA 4M5DA 3NYBA 4Q43A 1SKSA 4B9UA 5J2JA 2ZTEA 3C2MA 1TK0A 4Q8EA 2ZJAA 8ICNA 1DK3A 4I2IA 2M2UA 2NRVA 2DRAA 2R8HA 4DEZA 9ICGA 4YP3A 3KTQA 2AJQA 4YMOA 4XUSA 5CWRA 2UVVA 1MIVA 1VFGA 4YVZA 7ICKA 2F1JA 2ZUBA 4I2JA 2NRKA 4M6WA 4PHPA 1SL0A 3PX4A 5HR9A 5KFCA 3H37A 1PX5A 4O3QA 2B21A 1U9LA 2FMQA 4M9HA 1MC8A 3RB3A 5EWFA 1ZQOA 1CEZA 4UD4A 4WCWA 1D8LA 4BWMA 2J6UA 4ELUA 4RQ2A 1X9SA 2DFLA 1NJWA 3JPRA 8ICVA 4BWJA 4UB1A 3EWAA 1L3VA 4QWCA 1YLQA 3UXOA 2F1IA 1SKRA 3GIKA 2AGQA 2ZJ8A 4JV0A 5KFAA 2F1HA 4J9SA 1NZPA 4PH5A 5J0SA 2W8KA 1PZNA 3N4MB 5J0XA 2ZH2A 9ICAA 4RUCA 4YN4A 5D49A 3GV7B 4RWPA 4DOAA 4M04A 1ZQBA 3HX0A 4Z6EA 4DL6A 2BR0A 1L3UA 2ZH6A 4YMNA 4KLIA 4G3IA 3SI8A 4EBJA 4NLKA 4QZFA 1CUKA 2XCAA 2V4QA 3C2LA 4J9OA 8ICFA 9ICMA 2DR8A 5KFWA 4RPZA 5KTQA 3M8SA 3M9OB 3ZDDA 4LT6A 3C21A 3WFOA 1B43A 2FPMA 1ZQPA 4I2HA
chains in the Genus database with same CATH superfamily
4F92B 3UPSA 4F71A 3V72A 3HJ1A 2BKEA 3QYPA 1ZQRA 2H3FA 7ICRA 1KEJA 1JX4A 4JK1A 2AGOA 2BPFA 3H8JA 4Y2SA 4QZ9A 4O0IA 1ZQ1C 4C7ZA 3NS1A 1S0NA 2ZIUB 5ALHA 4NKUA 4OD0A 1HUOA 5ALKA 4X4TA 5HRHA 3G6XA 2BHNA 1SGGA 4I29A 3CP8A 1F5SA 3KKAA 8ICXA 3BQTA 1Q79A 3V7LA 1UQVA 2PFNA 2KEYA 2DBYA 5DB6A 5HP4A 1NKCA 1K5OA 4ATBB 4GLXA 2BE3A 3RJKA 2KHVA 3WFQE 2LPEA 5KG1A 4AT9A 5J2BA 2ZH8A 3BZCA 5EOZA 9ICHA 2R8GA 1KL9A 2CXYA 3M1YA 4DL2A 4F4YA 3UMGA 1YT3A 2R8JA 1YZ7A 2AQ4A 3EF2A 2W8LA 3M9MB 4K4GA 2QARB 3C29A 1LV5A 5L1KA 2IBKA 4F2RA 2K4EA 3JPNA 5DBAA 7ICIA 5AKKA 4UASA 4KLMA 1Q3VA 3LVWA 3EYZA 1NK9A 4JWNA 1UT8A 2EZZA 4O6AA 1XO0A 1T3QA 3IP4B 4M47A 4HYKA 4O3MA 3K1ZA 2UVWA 2B4VA 1R8CA 3PR4A 3B0YA 3RJEA 4RZRA 3NUQA 2BGWA 4QW9A 2C2DA 5AM0A 4FHVA 3V6JA 5AKLA 3WK6A 1ZQDA 2BDUA 2HVIA 1V4AA 3RH5A 3PNCA 4F93B 3C18A 5JUMA 1BPXA 1ZYQA 4JV2A 9ICXA 4J9KA 3ED5A 2XVTA 2JGAA 4ZOHC 5J29A 1Q46A 4RQNA 4BJQA 4KLDA 2EDUA 5ALFA 3TACB 2IOFA 4OJLA 4LVSA 2EAOA 1JIHA 4C4SA 4Z6DA 1SXDA 1SV4A 4TUQA 1QSYA 4RNNA 4RQ0A 5AM4A 1MN8A 3EW9A 4XJEA 4Y2TA 3TADA 2ZHAA 4UB3A 2ZIVB 5KFEA 3WKDA 1IIPA 3D2SA 9ICUA 4QWAA 5AKYA 4QZAA 3KHLA 1S77D 3RB0A 4BXOA 3QE9Y 3RRGA 2QARA 3ZD9A 3JPOA 4IC9A 3JYYA 1TFYA 2G08A 3B0XA 4I27A 4ECVA 4KM5A 3V7KA 2PMZF 4DFDA 4QZBA 3E58A 5EE1A 1U47A 2WF6A 2W54A 1L5UA 5E79U 4KLEA 4AT9B 1BVSA 2OEHA 1XC9A 2GAFD 1Z1VA 1ZQLA 5BPCA 3H3AA 3NWIA 9ICSA 4ZH4A 1U45A 3LYSA 1X9MA 4C8LA 5D61A 3MC1A 3JPQA 2MUTB 3D2QA 2ZXHA 2W3RA 2YMMA 4DQRA 8ICGA 4QZ8A 9ICNA 1Z3EB 4X4OA 5EE3A 4WC2A 2A1JB 4UBCA 1X2IA 1ZRMA 3B9JA 2FJ6A 4IQTA 2PXIA 3QU5A 2WAQC 3BQ1A 4IRCA 1Z00B 1ZQXA 4MEYA 5EE0A 5G5HA 1TKDA 3PY8A 3PW0A 1XNSA 4DWIA 3H38A 4YR0A 3K4GA 2MSNA 3E0FA 1KQQA 1ZJMA 5J2AA 4UAZA 4TURA 5L9XA 4UAYA 4OAHA 2ISOA 2BQUA 8ICQA 2E5SA 2NRTA 1KBUA 2VA2A 4Y2QA 4KX5A 4QWEA 3J81j 4FO6A 5KFDA 1D9FA 4OAFA 1F44A 1JQRA 1ZQYA 2UVUA 4AT8B 2HVHA 4F91B 3V7JA 4J9LA 1S0MA 2JXJA 3TFSA 4DLGA 1JXEA 1NI3A 3K75D 2JEFA 4O5KA 5J2CA 3AL0B 5KG6A 3ETRA 4DQQA 4R64A 1X9WA 3TAPA 5JRTA 5ALVA 1RYUA 3F5AA 2PI4A 7ICUA 4EP7A 2HOQA 2HHPA 2MRLA 2YMPA 1ZQFA 4DS4A 3MR5A 5KFTA 1X40A 2GWSA 4NXUA 1SZHA 1COKA 3ZDAA 2YX8A 2YB1A 2O5AA 4C80A 2ZH3A 2PKEA 1KFDA 3F2DA 4F4WA 8ICEA 9ICQA 4ED0A 3G6YA 3KZXA 1T3NA 4X5VA 2DVIA 5ALPA 2BCQA 5DGAA 2W9CA 4JV1A 4DQIA 2IA6A 1BGXT 5HR6A 3BZKA 2H3QA 1V97A 4WC3A 8ICJA 1FEZA 5CA7A 5KFZA 3TANA 5ALLA 3V6HA 4BUGA 5ALYA 3KHRA 1ZQCA 5AM1A 2BPCA 3D6JA 1ZQSA 3PX0A 5AKIA 5BOMA 4UQGA 3N7SC 2W9BA 1T7PA 2K8AA 8ICSA 2OYYA 2W04A 1QTMA 2M2VA 2GA9D 4FHWA 3KHGA 5J2IA 2LBOA 4PL1A 5J2FA 1D8BA 1S5LU 4F5QA 1D9DA 1HUZA 5DG9A 4O3RA 4DFKA 3IDWA 1ZJNA 5HRIA 2RP5A 3V6KA 2B51A 2BQ3A 7ICTA 4NM2A 2A1AA 3VC8A 1L7NA 1UEVA 5DGBA 2K60A 2ESEA 2Q0ZX 3TARA 4F4XA 4C4RA 4JMUA 4K97A 3JCFA 4R63A 4YXMA 2XO7A 4YCXA 5DG7A 1C20A 5TISU 4EX6A 4ELVA 3FM9A 1SKWA 2R8KA 2QLTA 5F2VO 2HMXA 2DR7A 1L7MA 2KKVA 4WQKA 3QUTA 2JHDA 3I28A 4Q43A 1SKSA 4B9UA 3C28A 5J2JA 2VIXA 3C2MA 1TK0A 8ICNA 4I2IA 1VFGA 4YVZA 7ICKA 2F1JA 4I2JA 1QQ6A 3F2CA 2NRKA 4M6WA 4PHPA 3PX4A 3H37A 3F5EA 1OW5A 2FMQA 3RB3A 1O03A 4UARA 1CEZA 4ELUA 5ALGA 3OWGA 1NJWA 5CFUA 4BWJA 3EWAA 1L3VA 4JV0A 4PH5A 3K7DA 1PZNA 5D49A 3NVWA 4RWPA 2K8BB 4DL6A 3FC4A 4QZFA 4USAA 2JR5A 3M8SA 3M9OB 3ZDDA 3WFOA 4PL2A 1N63A 3RR8A 8ICOA 1V9PA 2OWOA 9ICFA 1MQ2A 4DFMA 1WG8A 1K1QA 4I2GA 3GIJA 1ZQGA 4MHVA 2KFZA 2XI9A 2G07A 3DEEA 4P0PB 3H40A 2K4HA 2YB4A 3SZ2A 4QZHA 1NJYA 4DOBA 2DL0A 1ZQEA 4FE3A 3SAHA 5DBCA 1YZ6A 1RXVA 4J9QA 5J8YA 4I2DA 1L8OA 5EWGA 1XO1A 4I2AA 4EYIB 1Z4OA 1KFTA 4EBDA 4Q8FA 4EBKA 2HHSA 1BPDA 9ICIA 2HHXA 2HBKA 1EXNA 4MFFA 5L1JA 2W43A 1NZBA 1ZQWA 3HP6A 4O69A 1QH9A 9ICLA 4F3OA 5CHEA 5EWEA 1UT5A 4AYBC 2M0NA 3PMNA 1L7PA 4ECUA 2ZH9A 1KLNA 4FHXA 1IV8A 4CNQA 2I6XA 5KFSA 8ICRA 3N7RC 3JPTA 2AGPA 2KMDA 1T8EA 4FS2A 4EEDA 3NRZA 4K8VA 1OU5A 1HIWA 3PV8A 4ECZA 4UAVA 2ZH7A 2MU2A 4C8NA 4CRXA 9ICCA 4OCZA 4GXIA 5L1IA 2HOIA 1IM4A 1RG6A 2RQ5A 4Y2VA 4DCCA 4DL7A 5J0OA 2KJ5A 3SV4A 4QZIA 4NY8A 2HI0A 3H39A 1NKEA 4US9A 8ICIA 1JAJA 2M9NA 2M2WA 4RQ6A 5KFIA 1ZQJA 2WF8A 4F5RA 4QWBA 1U4BA 3ISBA 4XA5A 2OH2A 4RWNA 2RFFA 3T5JA 3RH4A 4FH3A 5T14A 3HW8A 7ICPA 2ID1A 2OM6A 1S76D 2FPKA 2W9CB 4KLQA 5IIJA 4ATBA 1KTQA 2EZXA 1VLBA 2G5IB 2FLLA 2HBJA 1BPEA 4MFAA 3RH6A 2YN4A 2FMSA 3HPOA 4EENA 4Q44A 3E2EA 2HBMA 1P7DA 3FDSA 9ICBA 3WK8A 3ALRA 3MBYA 2EZYA 3VCBA 4JB3A 4NXVA 2JRZA 1RDFA 1NO5A 3QU7A 2Y1JA 1MIYA 3QU9A 1BPBA 5ALEA 3C5FA 4GXJA 1L3SA 1Q3UA 4TUSA 4LEVA 3OUYB 1SXEA 2I5HA 4AYBF 2OCEA 1JI7A 3KKAC 1SIJA 2XC9A 1PK1A 1FFVA 5AM5A 5B5EU 2VA8A 1N60A 1KW4A 4KLHA 3IN5A 3R9KA 4DF8A 1JN3A 1TK8A 7ICOA 3ISCA 3NASA 1ZQQA 2KIVA 5IIMA 2G0AA 4X4UA 2NRWA 3NTUA 1PVQA 3ZD8A 5DB7A 4F72A 5J2EA 2KNJA 3CRXA 3QZ7A 1SWVA 1J2MA 5HMLA 2ASJA 4UD5A 5CFTA 3N28A 3BJYA 2GLEA 4EBCA 4K98A 4NWIA 5GTHU 4QW8A 3SAGA 3BS5B 4KN4A 2C2EA 4I2FA 2HOFA 3TAQA 2W9MA 1N5WA 3GZFA 4EEYA 2ODGA 3RB4A 2LI6A 2XGQA 4U6PA 2C2RA 4LEWA 3QUBA 9ICJA 1LVHA 1GO3F 2BBHA 1URJA 2JZBB 1OUQA 1CRXA 4K99A 4FBTA 4B6JA 3JPPA 1LKYB 1NK0A 4RT3A 4LZGA 4A8EA 5KFJA 4UB8U 2DPIA 2IOFK 2LHTA 3NRWA 1SWWA 4RUAA 1Q8KA 1S0OA 1ZD2P 2KZ3A 1WOTA 4K96A 3ONNA 1XU4A 1PVRA 5DLGA 3Q8KA 4WC7A 2C28A 2D6FC 3CK6A 4KLLA 3S6JA 1Z4NA 3UMBA 1S10A 1AQ6A 3OSNA 4RT2A 3JZ0A 5CEHA 4FO1A 4NXXA 2K89A 4EV6A 4P0PA 5DECA 4RQ7A 4LEZA 2O6KA 3OSPA 5KG3A 2XY7A 2E8MA 4OJ5A 5AM2A 2W9BB 2RDJA 3THVA 2JEIA 4XRHA 5KG0A 4IS7A 3LK9A 2CN1A 5J0YA 3RJGA 4O5CA 5KFPA 3Q8QB 4DLEA 4OAGA 1WUDA 1X9XA 3PW2A 2PMZC 3AMZA 2KV2A 5KFBA 3AU6A 2F77X 3AQLA 3PW4A 8ICMA 4EZ6A 2KK0A 4NL9A 5DQGA 3AU2A 3QU2A 4UB2A 3KFUF 3HT3A 4M2YA 5AICA 3SAFA 3OUYA 3GIMA 4I2CA 2WFAA 3EUB2 3HJ4A 1L3TA 1RQLA 4O5EA 1Z00A 4KLGA 2Y9TA 4Y2XA 5J0PA 2EQYA 4TUPA 1NJXA 3OJSA 4GC6A 1ZQZA 8ICYA 1TVAA 5CHGA 1X6JA 3WFPA 4O67A 2KJ9A 2WF5A 3DDHA 4I0UA 4YQWA 3EZ5A 2UVRA 1RQNA 1N48A 5KFUA 1ED1A 4PHEA 4KMUA 2KIWA 2CRXA 3CNHA 2FE9A 4IRDA 2ZIXA 2V9WA 5CJ7A 2HHQA 5KG5A 4O3PA 2J6TA 4RQ3A 5J2HA 2GH1A 1XWLA 9ICPA 4NV0A 4WBYA 4UAUA 4EEBA 3MABA 5JU5A 9ICKA 3CW2C 3PR5B 5ALZA 5KFOA 4HX0A 4WC6A 2KD1A 4DL5A 2H3ZA 4MFCA 2JH1A 2LYAA 3RAXA 2E1FA 4IQUA 4ECRA 5HHIA 3GV8B 4WBZA 3AQEA 4YG2A 5ALQA 3MGVA 4ACOA 4WC0A 5CB1A 2KICA 4S3NA 2H3VA 5F9NA 3GDXA 9ICEA 2G09A 4PZNA 3ER8C 4ECXA 2VJ5A 1S9FA 1ZQNA 4DSKA 2ZH4A 2RDIA 4M5DA 3NYBA 1T94A 2LYBA 2ZTEA 2M2UA 1DK3A 2DRAA 2R8HA 2AJQA 2YTUA 2DUYA 4YMOA 4XUSA 2UVVA 5AI9A 5HR9A 4O3QA 5EWFA 1ZQOA 4KB6A 1B4FA 4WCWA 2J6UA 4RQ2A 2DFLA 3BS7A 3JPRA 8ICVA 3TKAA 5AKXA 2AGQA 2ZJ8A 2EAMA 2F1HA 4LJXA 2W8KA 2KSOA 3N4MB 5J0XA 2ZH2A 4RUCA 4YN4A 2LMRA 3GV7B 2WF9A 4DOAA 1ZQBA 2LM1A 4Z6EA 2BR0A 4UB6U 4YMNA 4G3IA 4NLKA 2V4QA 3C2LA 9ICMA 5KFWA 5KTQA 3D2NA 4CF5A 3C21A 1B43A 2QB0B 2FPMA 3K1RB 5KFGA 4KLUA 5AHXA 3MFHA 4LZDA 2P6RA 2AU0A 3PX6A 3ZDCA 1N61A 2HBLA 1PK1B 3OVAA 3M8RA 1TAUA 2JEJA 5AI5A 5ALWA 5L1MA 5KFKA 3MDAA 1RM6C 1UCVA 2W9AA 5AKHA 2O1PA 3IRUA 3GIIA 2WTFA 5KFYA 4B9SA 3OTQA 4UAWA 4X4NA 3WK9A 4FS1A 1K1SA 4RPYA 2JH7A 5HNKA 4PHAA 1A76A 2FLPA 2ZTDA 4CE6A 4YD1A 2HCFA 5J0WA 5F9LA 3WKBA 4YR3A 2QKQA 3KHHA 2XY6A 1WCNA 1NK6A 4F8RA 2GOLA 3F2BA 3SR6A 2ASLA 5BOLA 2QB1A 5KFMA 2F3NA 4ECSA 1COOA 5ALRA 5KFHA 1ZD5A 3PSPA 4IL6U 3AQKA 4QWDA 1BNOA 4NLBA 3RRHA 5KG4A 1X6IA 5AKEA 2XIDA 3UXPA 2HHVA 3L9DA 1UETA 3QUQA 4PGXA 4ECYA 2IOHA 2DKXA 2LYHA 1T4GA 1KKXA 2KHQA 3OPXA 4U7CA 3PO4A 4DL3A 4MEXA 3LWMA 3H8MA 4ICAA 4OJOA 1C7YA 3PSIA 2LM4A 3IM1A 4O68A 4RWQA 5ALTA 4DL4A 3PW5A 1XSLA 1ZRNA 3UMCA 3A0BU 2E1EA 7ICEA 3PSFA 5AK3A 4RQ1A 4DSLA 4FHYA 4DFPA 2JMGA 4E7XA 5KAFU 4Z6FA 1NKBA 3NVVA 4EZ9A 9ICOA 2HN1A 2QB0A 3SYZA 2ZXIA 1XSPA 1WWUA 4Y2PA 1B22A 3PZPA 1ZQTA 4F4KA 4BX9C 4EELA 3KOOA 4F5PA 4ECQA 4RQMA 2R8IA 1RYRA 4M0AA 5HRBA 5DQHA 1QCKA 2BZFA 2I9GA 3MGIA 3WK4A 4KLFA 3HKZF 1ZQVA 1DOQA 4C7YA 3HILA 2ALZA 1BNPA 4ED2A 5IIKA 2VANA 5HRDA 4JLZA 2JEGA 2IHMA 4BDPA 1JALA 2DF4B 4BGDA 4JLXA 3KD3A 5HR7A 2DR5A 2G06A 4J03A 1ZETA 5IILA 2DQNB 2BCVA 4UB4A 1JRPA 7ICLA 5KT7A 1SZPA 3WK5A 3MR6A 4RWOA 1FFUA 3OVSA 4E0DA 3EPGA 3IHQB 1QQ7A 5AI6A 5CP2A 4F4ZA 2NV3A 4FFDA 1LB2B 8ICWA 1JROA 5J8YC 4M9NA 9ICTA 4J9NA 5ALNA 4DQSA 1Z19A 1TE2A 4M9LA 1JMSA 1CI4A 4QZGA 2OHFA 5HHHA 2XY5A 5HRGA 1VJ5A 3QNMA 5B66U 3H0LB 1RPLA 4RNMA 4LEYA 1U48A 1DK2A 1SL2A 2FPLA 3C66A 2FMPA 2IHOA 5ALUA 4ED7A 1O08A 2VA3A 2A3VA 2PFPA 2HDOA 2FI1A 4B9NA 2AQ0A 4E8FA 5KL1B 2ZUCA 3ERCC 2ZIVA 1KSPA 8ICKA 4X4QA 4Q45A 2F44A 7ICFA 2PFOA 9ICWA 1QQ5A 3G6VA 4RNOA 1IXRA 4FHPA 1LKYA 2Q66A 2YMQA 2KTQA 2K4PA 1N56A 5DG8A 2V4RA 4NLNA 5AKGA 5DEDA 5FP0A 2YY6A 3M6KA 3PSTA 3PHZA 1VDVA 2KP7A 3OV7A 3ORYA 4K9AA 5AIAA 1UHUA 2EH9A 4CDGA 1R89A 5L1LA 1ZQKA 3O0FA 3H8SA 3UXNA 2PFQA 5J2GA 8ICTA 2E8PA 3WFRE 1DGJA 4IQVA 3Q8RB 4JUZA 5HRLA 4OAIZ 2R18A 3HRDD 3TI0A 4RPXA 1KN5A 4DOCA 1OXJA 3GV5B 1WCLA 4NLZA 2HHTA 5A0LA 3T5KA 1A0PA 4R8UA 4MF2A 3DV9A 1NK5A 4DQPA 3WKEA 2ZH5A 3QEAZ 1TAQA 4P0QA 4M9JA 3NVYA 4NLGA 5AKJA 4NXZA 1A77A 3CYMA 2DPJA 3QEBZ 4NM1A 7ICNA 3BQ7A 3BQ0A 3Q8MA 4XQ7A 3RBEA 2ATLA 1MA7A 3PO5A 4DSIA 3C2KA 5TZVA 1SL1A 2ISPA 1L8LA 5J2DA 2ES6A 5KNIA 1FA0A 2F76X 2I1QA 3IG5A 2P6UA 1S97A 4PZOA 3H4DA 4CCHA 4O3SA 4F50A 2D3DA 3Q8PB 4C8OA 1S8OA 3MGHA 4RU9A 4IG8A 5IINA 1ZQHA 4I28A 4WC5A 1N5XA 3MR3A 5GTIU 9ICRA 2Q4TA 4UW9A 3RF9A 4NL9C 4NXWA 4AT7B 4G9BA 2VKQA 1KFSA 4GXKA 4BXOB 2BDPA 2DWQA 4QZCA 2RHFA 5KFVA 8ICAA 3GILA 4RQ4A 3H8WA 2C22A 1TFRA 4FZMA 5KG2A 4R8UB 7ICVA 1L6NA 1KRPA 3H0RB 2BCUA 3HJEA 4QIWF 7ICJA 4YR2A 5KL8B 1AROP 1J97A 4NKTA 1N62A 5KT2A 5KAIU 1RZTA 1ZOLA 4Z6CA 3AUOA 5DKWA 3I76A 4WQLA 2A19A 1X66A 5KT6A 1DGSA 3NVOA 5AI8A 4C0ZA 1D8YA 5ALDA 4TQSA 4EYHB 4WOYA 4CF3A 2JZBA 5AM3A 4XQ8A 3MCRA 2H5XA 3GFKB 5DLFA 3T79A 1BPZA 4Y2JA 4PHDA 5DDYA 1WYGA 4B9VA 3LVVA 3AQFA 4DEZA 2L5YA 3SQIA 2ZUBA 1SL0A 5KFCA 1PX5A 2YMLA 1U9LA 1MC8A 2WHEA 4UD4A 5B3PA 4BWMA 1SV0C 2W3SA 4UB1A 2RRDA 3M6ZA 5ALOA 4QWCA 3UXOA 2F1IA 1SKRA 3GIKA 4J9SA 2FCLA 5J0SA 1GPJA 5F3XB 4M04A 3A0HU 5K4LA 3WK7A 4KLIA 2DR8A 1CUKA 2XCAA 4J9OA 5ALSA 3ZI4A 1ZQPA 4I2HA 2ZHBA 2ZIXB 1ZQUA 7ICQA 8ICLA 1TFWA 3OHAA 3TQ1A 4DO9A 1RXWA 4PGYA 2P35A 4WC4A 3PMLA 3H7IA 2HSZA 5KFRA 4GFJA 2KG5A 1NNLA 2DR9A 5KG7A 2Y0SF 3H4BA 3UQ0A 8ICHA 3RBDA 1N2XA 2VJ4A 3SMVA 5B3QA 1HEKA 3BS5A 2Y9UA 5KT3A 1V85A 4WJ3B 1Q78A 3ICXA 4UB5A 3SV3A 5DBBA 3IV6A 7ICSA 2ZIUA 4QZEA 2ASDA 1PK3A 4I2EA 1F0MA 5KT5A 1R8AA 1WWVA 8ICZA 4TQRA 8ICCA 4FH5A 4IR1A 4QZDA 2E3TA 2E8OA 3PW7A 3TFRA 1XSNA 3WFSC 7ICMA 3RTVA 2F8KA 4MF8A 2CPRA 3F53A 3JPSA 4X4SA 4QJFB 4KMOB 3HWTA 8ICBA 3RB6A 3ISDA 3KBBA 4AT7A 3T5HA 4C8MA 3AN1A 3FYHA 5C5JA 3ETLA 2FDRA 3SEIA 2E8NA 4OJPA 2IHNA 4M9GA 2EANA 2ZUDA 4OJ6A 4R66A 1RYSA 4NLCA 4KITB 3OVBA 2N1RA 2WAQF 2BCSA 3LQCB 3T3FA 2AH5A 4O3NA 1ZD3A 1VJ7A 5AI0A 3L3FX 3RAQA 4OO1J 2DGZA 4FZNA 5C0YA 1U49A 5AK6A 4PGQA 5HRFA 7ICHA 4KN7A 5AK5A 4X4RA 3QUCA 4DFJA 1BPYA 2HHWA 1F5AA 5ALJA 5KT4A 3QZ8A 4X4VA 4PPXA 3ZDBA 3C1ZA 4UBBA 1Z1BA 4K4HA 2NRXA 2W03A 5IIIA 2IMWP 1A6SA 5HREA 2JV3A 4K4IA 2WB1F 5DDMA 1XS9D 3C5GA 4M6WB 1QSLA 4F2SA 1ZD4A 4Y2UA 5D62A 2Y0SC 3OGUA 1QSSA 1HJPA 2FLNA 3MFIA 2NO5A 5CFSA 2KFNA 3SD7A 1ZQIA 5ALXA 5IIOA 2XGPA 5KFXA 4C8KA 2B0CA 5D46A 4ELTA 3RFAA 5H2FU 3IG8A 4Y2YA 3UPQA 4DSFA 4CF4A 4X4PA 1MSWD 3L5KA 3M9NB 5D4BA 4DSEA 5CRXA 2PI5A 3H0MB 2KOBA 4IR9A 5ALMA 4DS5A 4ED3A 4C4TA 3AQNA 8ICUA 1PUZA 2KVSA 5G5GA 5DB8A 4F5NA 5HC9A 1NOMA 2D8CA 5AI4A 3GQCA 2BCRA 2XCPA 2W7PA 3EPIA 2KSOB 4YFKA 5DB9A 3Q8LA 3I1YA 2BBJA 4KLTA 3QX7A 3FAHA 1UPHA 1NK4A 2W11A 2W7OA 5D63A 1ZXIA 1TK5A 2MA1A 3KZIU 5ALIA 4NXTA 4UATA 1L7OA 3RJJA 4B9MA 3Q8SB 4K9BA 3SENA 1JUDA 1UA0A 9ICVA 3LDAA 2NYVA 4EBEA 4J9PA 4B9LA 5HMMA 3C1YA 1J2NA 4HAIA 4IRKA 1PVPA 4IQWA 2A1JA 2WF7A 3OHBA 1NJZA 4EX7A 5JTIA 5JTGA 4RQ5A 2XICA 2B56A 3WKCA 4GIBA 1UEUA 3N97B 5J0TA 3HIYA 4US8A 4KLSA 4RQ8A 1KDHA 4ED8A 4MKPA 2K4IA 1UA1A 4B9TA 3UQ2A 2GO7A 3MR2A 4P2HA 3L4PA 5J2KA 3BDPA 2KVCA 2ZJ5A 2EWRA 1SV0A 4R65A 3RJHA 4J9MA 2KZMA 3C23A 4WC1A 4KLOA 5KFLA 3T5LA 4P4OA 1KNYA 5AKZA 1FO4A 1V38A 2KJ8A 2KKPA 2Z7JA 2ZG6A 2J6SA 4I2BA 4X0AA 2ZH1A 4ECTA 5J0RA 2KZZA 5DQIA 5AIBA 3AQMA 2G5HB 2DKZA 2ZTCA 4QIWC 2DRBA 4KLJA 2BPGA 1Y88A 3ER9B 1NK8A 1X42A 3NGDA 3ZDEA 2ZIWB 1IG6A 1ZQAA 2RLTA 4YD2A 4DSJA 4O3OA 4E80A 4J9RA 1FIQA 3LWLA 1B0XA 8ICPA 1M6YA 3PVXA 2MAXA 3AM9A 4P4MA 4GC7A 3GU3A 2IUBA 2F8LA 3QXGA 5KFQA 1TV9A 3AEVA 4AT8A 4NJ8A 5CR0A 3U26A 2P66A 5HRKA 2LKYA 5J0QA 2HN2A 2K8CB 2EAPA 4Y2RA 4YXJA 1MQ3A 5KFNA 1NK7A 2F2AB 4ED6A 5KFFA 2BQRA 2YQEA 1R8BA 3RJIA 1MIWA 3OJUA 3RJFA 1DXSA 2AXTU 4O9MA 1H38A 2WB1C 4QNLA 1DRGA 4ECWA 4FZLA 3NKUA 3M7DA 5J0UA 2HHUA 1ZQMA 3NVZA 4X0BA 3TADC 3UM9A 3MDCA 4F5OA 2NRZA 2W55A 3RR7A 4P4PA 4KTQA 4ED1A 1QLNA 2AHOB 4FBUA 5AK4A 2OXOA 2KN7A 7ICGA 2HW3A 2M2TA 2PBEA 2Y1IA 4DF4A 2MUTA 4PJ0U 3WKAA 3WU2U 1JXLA 3QU4A 1ECWA 4JWMA 4CGZA 1TAMA 4P0QB 4YMMA 1S0VA 3BQ2A 4N7RA 2ZIWA 4Q8EA 2ZJAA 2NRVA 9ICGA 4YP3A 3KTQA 4AP9A 5CWRA 1MIVA 2KE7A 4EGWA 2B21A 3HKZC 4WH5A 4M9HA 3N7PD 4KX3A 1D8LA 1X9SA 2B6GA 1SB3C 1YLQA 2NO4A 5KFAA 1NZPA 9ICAA 3HX0A 5EE9A 1L3UA 2ZH6A 3SI8A 4EBJA 8ICFA 4EEKA 4RPZA 2H3IA 4LT6A
chains in the Genus database with same CATH topology
4F92B 5KFGA 4KLUA 3UPSA 2ZHBA 3MFHA 4LZDA 1ZQUA 2P6RA 1V9PA 3RR8A 2AU0A 8ICOA 3PX6A 2OWOA 3ZDCA 8ICLA 9ICFA 7ICQA 3OHAA 3TQ1A 1MQ2A 1TFWA 4DFMA 4DO9A 1K1QA 1RXWA 3OVAA 3M8RA 3V72A 2JEJA 4PGYA 4I2GA 1TAUA 3GIJA 2BKEA 1ZQGA 3HJ1A 1ZQRA 5KFKA 2KFZA 4WC4A 7ICRA 3MDAA 3H40A 3SZ2A 1KEJA 3PMLA 4QZHA 3H7IA 2W9AA 1NJYA 4DOBA 1JX4A 1ZQEA 5KFRA 2O1PA 4JK1A 5DBCA 3GIIA 2AGOA 2BPFA 2WTFA 2DR9A 5KFYA 4B9SA 3H8JA 5KG7A 3H4BA 3UQ0A 8ICHA 4QZ9A 4O0IA 1RXVA 4UAWA 3RBDA 4J9QA 1S0NA 4X4NA 4NKUA 4I2DA 4FS1A 5EWGA 1XO1A 1HUOA 5KT3A 4I2AA 4EYIB 4X4TA 1K1SA 4RPYA 1KFTA 5HRHA 3G6XA 2BHNA 4EBDA 5HNKA 4I29A 4PHAA 4Q8FA 2HHSA 1BPDA 1A76A 4UB5A 3SV3A 2FLPA 5DBBA 2HHXA 9ICIA 2ZTDA 7ICSA 8ICXA 4YD1A 3BQTA 4QZEA 2ASDA 1Q79A 1EXNA 3V7LA 2PFNA 4MFFA 5DB6A 5L1JA 5HP4A 5J0WA 5F9LA 4YR3A 3KHHA 1NKCA 4I2EA 4ATBB 4GLXA 2XY6A 1WCNA 1NK6A 4F8RA 2BE3A 3RJKA 5KT5A 3WFQE 1ZQWA 5KG1A 1R8AA 3HP6A 2ASLA 4AT9A 5BOLA 5KFMA 5J2BA 4TQRA 8ICCA 8ICZA 2ZH8A 4ECSA 1COOA 9ICLA 4FH5A 5KFHA 4F3OA 5EWEA 5EOZA 1UT5A 9ICHA 2R8GA 3AQKA 4QWDA 3RRHA 4QZDA 3PMNA 4IR1A 1BNOA 5KG4A 3PW7A 3TFRA 4ECUA 3UXPA 4DL2A 1XSNA 2HHVA 3L9DA 7ICMA 1UETA 2ZH9A 3WFSC 1KLNA 4FHXA 4F4YA 4PGXA 4ECYA 2R8JA 3RTVA 5KFSA 8ICRA 3JPTA 2AQ4A 2AGPA 2LYHA 1T8EA 2W8LA 1T4GA 4MF8A 4FS2A 3M9MB 4K4GA 1LV5A 3JPSA 5L1KA 4X4SA 2IBKA 3PO4A 4F2RA 4DL3A 1OU5A 3HWTA 3JPNA 3LWMA 4MEXA 8ICBA 5DBAA 3RB6A 3PV8A 4ECZA 3ISDA 7ICIA 2ZH7A 1C7YA 4AT7A 4KLMA 3T5HA 4C8NA 4C8MA 3FYHA 5C5JA 3IM1A 3ETLA 9ICCA 4RWQA 4GXIA 3EYZA 5L1IA 1NK9A 4DL4A 4JWNA 1UT8A 3PW5A 1IM4A 1XSLA 7ICEA 2IHNA 4RQ1A 4DSLA 4HYKA 4M47A 4M9GA 4FHYA 2UVWA 2ZUDA 4R66A 4DFPA 4E7XA 4Z6FA 1RYSA 4DL7A 1R8CA 5J0OA 4KITB 1NKBA 3PR4A 3OVBA 3B0YA 4EZ9A 9ICOA 3SV4A 3RJEA 4QZIA 4RZRA 3SYZA 2BCSA 4NY8A 3H39A 2BGWA 4QW9A 1NKEA 3LQCB 3T3FA 2C2DA 1XSPA 4FHVA 3V6JA 1B22A 1ZQTA 4F4KA 4O3NA 4KLQA 1ZQDA 4F5PA 2HVIA 1VJ7A 1V4AA 4ECQA 3RH5A 8ICIA 1JAJA 2R8IA 3RAQA 3PNCA 2M9NA 2M2WA 1RYRA 4RQ6A 4F93B 3C18A 5KFIA 5JUMA 4M0AA 1BPXA 1ZQJA 1U49A 5HRBA 4F5RA 5DQHA 4PGQA 4QWBA 1ZYQA 5HRFA 7ICHA 2I9GA 1U4BA 3MGIA 4KN7A 4JV2A 3ISBA 4EBKA 9ICXA 4XA5A 4J9KA 4KLFA 4X4RA 1ZQVA 1DOQA 5J29A 4DFJA 1BPYA 4RWNA 2HHWA 2ALZA 1F5AA 3T5JA 5KT4A 4KLDA 3QZ8A 4ED2A 3RH4A 1BNPA 4FH3A 4X4VA 4PPXA 5IIKA 3ZDBA 3C1ZA 4UBBA 2VANA 4K4HA 5HRDA 2NRXA 3HW8A 4LVSA 1JIHA 5IIIA 2JEGA 2IMWP 7ICPA 2ID1A 2IHMA 4Z6DA 4BDPA 1S76D 4BGDA 5HREA 4TUQA 1QSYA 4K4IA 2FPKA 5DDMA 4RNNA 1XS9D 4RQ0A 4M6WB 2W9CB 3C5GA 1QSLA 4F2SA 3EW9A 5IIJA 5IILA 1ZETA 2DR5A 4ATBA 1KTQA 2BCVA 2ZHAA 3OGUA 4UB4A 1QSSA 2FLLA 1HJPA 2FLNA 5KT7A 7ICLA 1SZPA 4UB3A 3MFIA 5KFEA 1BPEA 4MFAA 3MR6A 3RH6A 2FMSA 4RWOA 3HPOA 4Q44A 9ICUA 3E2EA 4QWAA 3OVSA 2KFNA 3FDSA 1ZQIA 4E0DA 9ICBA 4QZAA 3KHLA 1S77D 5IIOA 2XGPA 3IHQB 5KFXA 3MBYA 3EPGA 3RB0A 4BXOA 4C8KA 3QE9Y 5D46A 3RRGA 5CP2A 4F4ZA 3ZD9A 4ELTA 3JPOA 1LB2B 8ICWA 1NO5A 2Y1JA 1MIYA 3JYYA 1TFYA 1BPBA 3UPQA 3C5FA 4GXJA 4DSFA 4M9NA 3B0XA 4X4PA 1MSWD 1L3SA 4I27A 3M9NB 4TUSA 4J9NA 5D4BA 9ICTA 3OUYB 4ECVA 4DQSA 4M9LA 4DSEA 3V7KA 1JMSA 4QZBA 4QZGA 2PI5A 2XC9A 5HHHA 2XY5A 4IR9A 5HRGA 1U47A 1L5UA 4DS5A 2VA8A 4KLEA 4ED3A 1BVSA 4KLHA 3AQNA 4AT9B 8ICUA 1RPLA 4DF8A 1JN3A 1TK8A 4RNMA 7ICOA 3ISCA 1U48A 1XC9A 1DK2A 1SL2A 2FPLA 5DB8A 1ZQQA 4F5NA 3C66A 5IIMA 5HC9A 2FMPA 1NOMA 2NRWA 4ED7A 5BPCA 1ZQLA 2VA3A 3H3AA 4X4UA 3NTUA 2PFPA 9ICSA 4ZH4A 3ZD8A 5DB7A 2RFFA 3GQCA 2BCRA 2XCPA 4B9NA 3EPIA 5J2EA 1U45A 1X9MA 4YFKA 2AQ0A 3QZ7A 4E8FA 1Q78A 4C8LA 5DB9A 2ZUCA 5HMLA 2ASJA 4UD5A 3JPQA 3BJYA 3Q8LA 4EBCA 2MUTB 1KSPA 8ICKA 4X4QA 4KLTA 4Q45A 4QW8A 4DQRA 8ICGA 4QZ8A 4KN4A 2C2EA 1Z3EB 4I2FA 7ICFA 9ICNA 2PFOA 3TAQA 9ICWA 4X4OA 3G6VA 4RNOA 1NK4A 4WC2A 2A1JB 1IXRA 2W9MA 1X2IA 4UBCA 4EEYA 4IQTA 2PXIA 1TK5A 3RB4A 4FHPA 3BQ1A 4IRCA 2Q66A 1Z00B 2XGQA 2KTQA 1ZQXA 2C2RA 1N56A 4MEYA 5DG8A 2V4RA 9ICJA 3RJJA 4NLNA 4B9MA 5DEDA 3Q8SB 2JZBB 1TKDA 3PY8A 3PW0A 4DWIA 1UA0A 9ICVA 3LDAA 3H38A 4FBTA 2KP7A 4YR0A 3JPPA 4EBEA 3K4GA 4J9PA 4B9LA 5HMMA 3C1YA 3OV7A 1ZJMA 4RT3A 3ORYA 5J2AA 4UAZA 4TURA 1NK0A 4IRKA 4LZGA 5L9XA 4UAYA 4IQWA 2A1JA 3OHBA 2ISOA 2BQUA 1NJZA 5KFJA 8ICQA 1R89A 2DPIA 5L1LA 4RQ5A 2NRTA 4RUAA 1ZQKA 1S0OA 2VA2A 3H8SA 2KZ3A 1WOTA 3UXNA 4QWEA 5J2GA 2PFQA 8ICTA 1XU4A 3WFRE 5DLGA 4FO6A 5KFDA 3Q8KA 2C28A 1D9FA 4WC7A 4KLLA 1JQRA 1ZQYA 1UEUA 1S10A 2UVUA 4IQVA 3Q8RB 3N97B 5J0TA 2HVHA 4AT8B 3HIYA 4JUZA 3OSNA 4F91B 5HRLA 4RT2A 4KLSA 3JZ0A 4RQ8A 3TI0A 1KDHA 4RPXA 3V7JA 4J9LA 4DOCA 4ED8A 3GV5B 1S0MA 1WCLA 3TFSA 1UA1A 4B9TA 4DLGA 1JXEA 3UQ2A 4NLZA 3K75D 3MR2A 2JEFA 4P2HA 2HHTA 5J2KA 5DECA 3BDPA 4O5KA 2ZJ5A 5J2CA 3T5KA 4RQ7A 5KG6A 4R65A 3RJHA 4J9MA 4DQQA 3C23A 3OSPA 2KZMA 5KG3A 2XY7A 4R8UA 4R64A 1X9WA 4KLOA 4WC1A 5KFLA 4MF2A 1NK5A 4DQPA 2W9BB 3TAPA 2ZH5A 3T5LA 2RDJA 3THVA 4P4OA 2JEIA 1KNYA 3QEAZ 1TAQA 2PI4A 7ICUA 4EP7A 4M9JA 4XRHA 2HHPA 1ZQFA 4NLGA 4NXZA 4DS4A 1A77A 3MR5A 5KG0A 3QEBZ 3LK9A 2DPJA 2J6SA 4I2BA 4NM1A 7ICNA 4X0AA 3BQ0A 5KFTA 3Q8MA 2ZH1A 4ECTA 2GWSA 4XQ7A 5J0YA 3RBEA 5J0RA 2ATLA 3RJGA 5KFPA 3PO5A 5DQIA 3Q8QB 4O5CA 4DSIA 3C2KA 2KZZA 5TZVA 4DLEA 3AQMA 2ZTCA 3ZDAA 1SL1A 2ISPA 5J2DA 3PW2A 2O5AA 1FA0A 2DRBA 2ZH3A 3AU6A 5KFBA 1KFDA 4KLJA 3AQLA 2I1QA 3PW4A 8ICMA 4F4WA 2P6UA 4EZ6A 8ICEA 9ICQA 2BPGA 4ED0A 1S97A 3H4DA 4CCHA 1Y88A 5DQGA 4F50A 4O3SA 3AU2A 3NGDA 3G6YA 4UB2A 1NK8A 1T3NA 3Q8PB 4X5VA 3ZDEA 3HT3A 4C8OA 2DVIA 4M2YA 3MGHA 4RU9A 1ZQAA 2BCQA 5DGAA 4YD2A 2W9CA 4JV1A 3OUYA 4DSJA 4O3OA 4DQIA 4E80A 4IG8A 3GIMA 5IINA 2IA6A 4J9RA 4I2CA 1ZQHA 3LWLA 4I28A 1BGXT 4WC5A 3HJ4A 3MR3A 1L3TA 8ICPA 4WC3A 4O5EA 8ICJA 1Z00A 2MAXA 3PVXA 5J0PA 4P4MA 4GC7A 4KLGA 5CA7A 5KFZA 3TANA 9ICRA 3V6HA 4TUPA 5KFQA 3KHRA 1NJXA 1ZQCA 2BPCA 1TV9A 3OJSA 4AT7B 1ZQSA 4GC6A 4AT8A 3PX0A 5CR0A 1ZQZA 1KFSA 8ICYA 4GXKA 1TVAA 5CHGA 2P66A 4UQGA 5BOMA 4BXOB 5HRKA 3WFPA 2W9BA 5J0QA 1T7PA 2BDPA 4QZCA 5KFVA 8ICAA 4YXJA 4YQWA 3GILA 3EZ5A 1MQ3A 2UVRA 1N48A 8ICSA 4RQ4A 5KFNA 1QTMA 2M2VA 1NK7A 3H8WA 5KFUA 5KFFA 4ED6A 2C22A 2BQRA 1R8BA 1TFRA 4FHWA 3KHGA 4PHEA 5J2IA 3RJIA 4KMUA 5KG2A 4R8UB 7ICVA 5J2FA 1MIWA 1KRPA 4IRDA 2BCUA 2V9WA 5CJ7A 3OJUA 2HHQA 4F5QA 5KG5A 3RJFA 7ICJA 4O3PA 2J6TA 1D9DA 1HUZA 4RQ3A 5J2HA 4O9MA 5DG9A 1XWLA 4YR2A 4O3RA 1H38A 4DFKA 9ICPA 1AROP 4WBYA 1ZJNA 4ECWA 4NKTA 5HRIA 5KT2A 5J0UA 3V6KA 2HHUA 1ZQMA 3MABA 1RZTA 2BQ3A 7ICTA 4Z6CA 4X0BA 4NM2A 3AUOA 3MDCA 4F5OA 9ICKA 2NRZA 3PR5B 1UEVA 5DGBA 5KFOA 5DKWA 2Q0ZX 3RR7A 4P4PA 3TARA 4ED1A 4KTQA 4F4XA 1QLNA 4FBUA 4R63A 4YXMA 4WC6A 5KT6A 2KN7A 7ICGA 4DL5A 2HW3A 2M2TA 2PBEA 2XO7A 1DGSA 2Y1IA 4YCXA 5DG7A 4DF4A 4MFCA 1D8YA 3RAXA 4TQSA 2MUTA 4IQUA 1SKWA 4ECRA 2R8KA 5HHIA 4ELVA 3GV8B 4EYHB 5F2VO 4WBZA 1JXLA 4YG2A 2JZBA 4XQ8A 4WC0A 5CB1A 4JWMA 2DR7A 2H5XA 3GFKB 4S3NA 5DLFA 5F9NA 3GDXA 4YMMA 1BPZA 9ICEA 4PHDA 3BQ2A 1S0VA 4ECXA 1S9FA 1ZQNA 4DSKA 5DDYA 2ZH4A 4B9VA 2RDIA 4M5DA 3NYBA 4Q43A 1SKSA 4B9UA 5J2JA 2ZTEA 3C2MA 1TK0A 4Q8EA 2ZJAA 8ICNA 1DK3A 4I2IA 2M2UA 2NRVA 2DRAA 2R8HA 4DEZA 9ICGA 4YP3A 3KTQA 2AJQA 4YMOA 4XUSA 5CWRA 2UVVA 1MIVA 1VFGA 4YVZA 7ICKA 2F1JA 2ZUBA 4I2JA 2NRKA 4M6WA 4PHPA 1SL0A 3PX4A 5HR9A 5KFCA 3H37A 1PX5A 4O3QA 2B21A 1U9LA 2FMQA 4M9HA 1MC8A 3RB3A 5EWFA 1ZQOA 1CEZA 4UD4A 4WCWA 1D8LA 4BWMA 2J6UA 4ELUA 4RQ2A 1X9SA 2DFLA 1NJWA 3JPRA 8ICVA 4BWJA 4UB1A 3EWAA 1L3VA 4QWCA 1YLQA 3UXOA 2F1IA 1SKRA 3GIKA 2AGQA 2ZJ8A 4JV0A 5KFAA 2F1HA 4J9SA 1NZPA 4PH5A 5J0SA 2W8KA 1PZNA 3N4MB 5J0XA 2ZH2A 9ICAA 4RUCA 4YN4A 5D49A 3GV7B 4RWPA 4DOAA 4M04A 1ZQBA 3HX0A 4Z6EA 4DL6A 2BR0A 1L3UA 2ZH6A 4YMNA 4KLIA 4G3IA 3SI8A 4EBJA 4NLKA 4QZFA 1CUKA 2XCAA 2V4QA 3C2LA 4J9OA 8ICFA 9ICMA 2DR8A 5KFWA 4RPZA 5KTQA 3M8SA 3M9OB 3ZDDA 4LT6A 3C21A 3WFOA 1B43A 2FPMA 1ZQPA 4I2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F92 B;  5KFG A;  4KLU A;  3UPS A;  2ZHB A;  3MFH A;  4LZD A;  1ZQU A;  2P6R A;  1V9P A;  3RR8 A;  2AU0 A;  8ICO A;  3PX6 A;  2OWO A;  3ZDC A;  8ICL A;  9ICF A;  7ICQ A;  3OHA A;  3TQ1 A;  1MQ2 A;  1TFW A;  4DFM A;  4DO9 A;  1K1Q A;  1RXW A;  3OVA A;  3M8R A;  3V72 A;  2JEJ A;  4PGY A;  4I2G A;  1TAU A;  3GIJ A;  2BKE A;  1ZQG A;  3HJ1 A;  1ZQR A;  5KFK A;  2KFZ A;  4WC4 A;  7ICR A;  3MDA A;  3H40 A;  3SZ2 A;  1KEJ A;  3PML A;  4QZH A;  3H7I A;  2W9A A;  1NJY A;  4DOB A;  1JX4 A;  1ZQE A;  5KFR A;  2O1P A;  4JK1 A;  5DBC A;  3GII A;  2AGO A;  2BPF A;  2WTF A;  2DR9 A;  5KFY A;  4B9S A;  3H8J A;  5KG7 A;  3H4B A;  3UQ0 A;  8ICH A;  4QZ9 A;  4O0I A;  1RXV A;  4UAW A;  3RBD A;  4J9Q A;  1S0N A;  4X4N A;  4NKU A;  4I2D A;  4FS1 A;  5EWG A;  1XO1 A;  1HUO A;  5KT3 A;  4I2A A;  4EYI B;  4X4T A;  1K1S A;  4RPY A;  1KFT A;  5HRH A;  3G6X A;  2BHN A;  4EBD A;  5HNK A;  4I29 A;  4PHA A;  4Q8F A;  2HHS A;  1BPD A;  1A76 A;  4UB5 A;  3SV3 A;  2FLP A;  5DBB A;  2HHX A;  9ICI A;  2ZTD A;  7ICS A;  8ICX A;  4YD1 A;  3BQT A;  4QZE A;  2ASD A;  1Q79 A;  1EXN A;  3V7L A;  2PFN A;  4MFF A;  5DB6 A;  5L1J A;  5HP4 A;  5J0W A;  5F9L A;  4YR3 A;  3KHH A;  1NKC A;  4I2E A;  4ATB B;  4GLX A;  2XY6 A;  1WCN A;  1NK6 A;  4F8R A;  2BE3 A;  3RJK A;  5KT5 A;  3WFQ E;  1ZQW A;  5KG1 A;  1R8A A;  3HP6 A;  2ASL A;  4AT9 A;  5BOL A;  5KFM A;  5J2B A;  4TQR A;  8ICC A;  8ICZ A;  2ZH8 A;  4ECS A;  1COO A;  9ICL A;  4FH5 A;  5KFH A;  4F3O A;  5EWE A;  5EOZ A;  1UT5 A;  9ICH A;  2R8G A;  3AQK A;  4QWD A;  3RRH A;  4QZD A;  3PMN A;  4IR1 A;  1BNO A;  5KG4 A;  3PW7 A;  3TFR A;  4ECU A;  3UXP A;  4DL2 A;  1XSN A;  2HHV A;  3L9D A;  7ICM A;  1UET A;  2ZH9 A;  3WFS C;  1KLN A;  4FHX A;  4F4Y A;  4PGX A;  4ECY A;  2R8J A;  3RTV A;  5KFS A;  8ICR A;  3JPT A;  2AQ4 A;  2AGP A;  2LYH A;  1T8E A;  2W8L A;  1T4G A;  4MF8 A;  4FS2 A;  3M9M B;  4K4G A;  1LV5 A;  3JPS A;  5L1K A;  4X4S A;  2IBK A;  3PO4 A;  4F2R A;  4DL3 A;  1OU5 A;  3HWT A;  3JPN A;  3LWM A;  4MEX A;  8ICB A;  5DBA A;  3RB6 A;  3PV8 A;  4ECZ A;  3ISD A;  7ICI A;  2ZH7 A;  1C7Y A;  4AT7 A;  4KLM A;  3T5H A;  4C8N A;  4C8M A;  3FYH A;  5C5J A;  3IM1 A;  3ETL A;  9ICC A;  4RWQ A;  4GXI A;  3EYZ A;  5L1I A;  1NK9 A;  4DL4 A;  4JWN A;  1UT8 A;  3PW5 A;  1IM4 A;  1XSL A;  7ICE A;  2IHN A;  4RQ1 A;  4DSL A;  4HYK A;  4M47 A;  4M9G A;  4FHY A;  2UVW A;  2ZUD A;  4R66 A;  4DFP A;  4E7X A;  4Z6F A;  1RYS A;  4DL7 A;  1R8C A;  5J0O A;  4KIT B;  1NKB A;  3PR4 A;  3OVB A;  3B0Y A;  4EZ9 A;  9ICO A;  3SV4 A;  3RJE A;  4QZI A;  4RZR A;  3SYZ A;  2BCS A;  4NY8 A;  3H39 A;  2BGW A;  4QW9 A;  1NKE A;  3LQC B;  3T3F A;  2C2D A;  1XSP A;  4FHV A;  3V6J A;  1B22 A;  1ZQT A;  4F4K A;  4O3N A;  4KLQ A;  1ZQD A;  4F5P A;  2HVI A;  1VJ7 A;  1V4A A;  4ECQ A;  3RH5 A;  8ICI A;  1JAJ A;  2R8I A;  3RAQ A;  3PNC A;  2M9N A;  2M2W A;  1RYR A;  4RQ6 A;  4F93 B;  3C18 A;  5KFI A;  5JUM A;  4M0A A;  1BPX A;  1ZQJ A;  1U49 A;  5HRB A;  4F5R A;  5DQH A;  4PGQ A;  4QWB A;  1ZYQ A;  5HRF A;  7ICH A;  2I9G A;  1U4B A;  3MGI A;  4KN7 A;  4JV2 A;  3ISB A;  4EBK A;  9ICX A;  4XA5 A;  4J9K A;  4KLF A;  4X4R A;  1ZQV A;  1DOQ A;  5J29 A;  4DFJ A;  1BPY A;  4RWN A;  2HHW A;  2ALZ A;  1F5A A;  3T5J A;  5KT4 A;  4KLD A;  3QZ8 A;  4ED2 A;  3RH4 A;  1BNP A;  4FH3 A;  4X4V A;  4PPX A;  5IIK A;  3ZDB A;  3C1Z A;  4UBB A;  2VAN A;  4K4H A;  5HRD A;  2NRX A;  3HW8 A;  4LVS A;  1JIH A;  5III A;  2JEG A;  2IMW P;  7ICP A;  2ID1 A;  2IHM A;  4Z6D A;  4BDP A;  1S76 D;  4BGD A;  5HRE A;  4TUQ A;  1QSY A;  4K4I A;  2FPK A;  5DDM A;  4RNN A;  1XS9 D;  4RQ0 A;  4M6W B;  2W9C B;  3C5G A;  1QSL A;  4F2S A;  3EW9 A;  5IIJ A;  5IIL A;  1ZET A;  2DR5 A;  4ATB A;  1KTQ A;  2BCV A;  2ZHA A;  3OGU A;  4UB4 A;  1QSS A;  2FLL A;  1HJP A;  2FLN A;  5KT7 A;  7ICL A;  1SZP A;  4UB3 A;  3MFI A;  5KFE A;  1BPE A;  4MFA A;  3MR6 A;  3RH6 A;  2FMS A;  4RWO A;  3HPO A;  4Q44 A;  9ICU A;  3E2E A;  4QWA A;  3OVS A;  2KFN A;  3FDS A;  1ZQI A;  4E0D A;  9ICB A;  4QZA A;  3KHL A;  1S77 D;  5IIO A;  2XGP A;  3IHQ B;  5KFX A;  3MBY A;  3EPG A;  3RB0 A;  4BXO A;  4C8K A;  3QE9 Y;  5D46 A;  3RRG A;  5CP2 A;  4F4Z A;  3ZD9 A;  4ELT A;  3JPO A;  1LB2 B;  8ICW A;  1NO5 A;  2Y1J A;  1MIY A;  3JYY A;  1TFY A;  1BPB A;  3UPQ A;  3C5F A;  4GXJ A;  4DSF A;  4M9N A;  3B0X A;  4X4P A;  1MSW D;  1L3S A;  4I27 A;  3M9N B;  4TUS A;  4J9N A;  5D4B A;  9ICT A;  3OUY B;  4ECV A;  4DQS A;  4M9L A;  4DSE A;  3V7K A;  1JMS A;  4QZB A;  4QZG A;  2PI5 A;  2XC9 A;  5HHH A;  2XY5 A;  4IR9 A;  5HRG A;  1U47 A;  1L5U A;  4DS5 A;  2VA8 A;  4KLE A;  4ED3 A;  1BVS A;  4KLH A;  3AQN A;  4AT9 B;  8ICU A;  1RPL A;  4DF8 A;  1JN3 A;  1TK8 A;  4RNM A;  7ICO A;  3ISC A;  1U48 A;  1XC9 A;  1DK2 A;  1SL2 A;  2FPL A;  5DB8 A;  1ZQQ A;  4F5N A;  3C66 A;  5IIM A;  5HC9 A;  2FMP A;  1NOM A;  2NRW A;  4ED7 A;  5BPC A;  1ZQL A;  2VA3 A;  3H3A A;  4X4U A;  3NTU A;  2PFP A;  9ICS A;  4ZH4 A;  3ZD8 A;  5DB7 A;  2RFF A;  3GQC A;  2BCR A;  2XCP A;  4B9N A;  3EPI A;  5J2E A;  1U45 A;  1X9M A;  4YFK A;  2AQ0 A;  3QZ7 A;  4E8F A;  1Q78 A;  4C8L A;  5DB9 A;  2ZUC A;  5HML A;  2ASJ A;  4UD5 A;  3JPQ A;  3BJY A;  3Q8L A;  4EBC A;  2MUT B;  1KSP A;  8ICK A;  4X4Q A;  4KLT A;  4Q45 A;  4QW8 A;  4DQR A;  8ICG A;  4QZ8 A;  4KN4 A;  2C2E A;  1Z3E B;  4I2F A;  7ICF A;  9ICN A;  2PFO A;  3TAQ A;  9ICW A;  4X4O A;  3G6V A;  4RNO A;  1NK4 A;  4WC2 A;  2A1J B;  1IXR A;  2W9M A;  1X2I A;  4UBC A;  4EEY A;  4IQT A;  2PXI A;  1TK5 A;  3RB4 A;  4FHP A;  3BQ1 A;  4IRC A;  2Q66 A;  1Z00 B;  2XGQ A;  2KTQ A;  1ZQX A;  2C2R A;  1N56 A;  4MEY A;  5DG8 A;  2V4R A;  9ICJ A;  3RJJ A;  4NLN A;  4B9M A;  5DED A;  3Q8S B;  2JZB B;  1TKD A;  3PY8 A;  3PW0 A;  4DWI A;  1UA0 A;  9ICV A;  3LDA A;  3H38 A;  4FBT A;  2KP7 A;  4YR0 A;  3JPP A;  4EBE A;  3K4G A;  4J9P A;  4B9L A;  5HMM A;  3C1Y A;  3OV7 A;  1ZJM A;  4RT3 A;  3ORY A;  5J2A A;  4UAZ A;  4TUR A;  1NK0 A;  4IRK A;  4LZG A;  5L9X A;  4UAY A;  4IQW A;  2A1J A;  3OHB A;  2ISO A;  2BQU A;  1NJZ A;  5KFJ A;  8ICQ A;  1R89 A;  2DPI A;  5L1L A;  4RQ5 A;  2NRT A;  4RUA A;  1ZQK A;  1S0O A;  2VA2 A;  3H8S A;  2KZ3 A;  1WOT A;  3UXN A;  4QWE A;  5J2G A;  2PFQ A;  8ICT A;  1XU4 A;  3WFR E;  5DLG A;  4FO6 A;  5KFD A;  3Q8K A;  2C28 A;  1D9F A;  4WC7 A;  4KLL A;  1JQR A;  1ZQY A;  1UEU A;  1S10 A;  2UVU A;  4IQV A;  3Q8R B;  3N97 B;  5J0T A;  2HVH A;  4AT8 B;  3HIY A;  4JUZ A;  3OSN A;  4F91 B;  5HRL A;  4RT2 A;  4KLS A;  3JZ0 A;  4RQ8 A;  3TI0 A;  1KDH A;  4RPX A;  3V7J A;  4J9L A;  4DOC A;  4ED8 A;  3GV5 B;  1S0M A;  1WCL A;  3TFS A;  1UA1 A;  4B9T A;  4DLG A;  1JXE A;  3UQ2 A;  4NLZ A;  3K75 D;  3MR2 A;  2JEF A;  4P2H A;  2HHT A;  5J2K A;  5DEC A;  3BDP A;  4O5K A;  2ZJ5 A;  5J2C A;  3T5K A;  4RQ7 A;  5KG6 A;  4R65 A;  3RJH A;  4J9M A;  4DQQ A;  3C23 A;  3OSP A;  2KZM A;  5KG3 A;  2XY7 A;  4R8U A;  4R64 A;  1X9W A;  4KLO A;  4WC1 A;  5KFL A;  4MF2 A;  1NK5 A;  4DQP A;  2W9B B;  3TAP A;  2ZH5 A;  3T5L A;  2RDJ A;  3THV A;  4P4O A;  2JEI A;  1KNY A;  3QEA Z;  1TAQ A;  2PI4 A;  7ICU A;  4EP7 A;  4M9J A;  4XRH A;  2HHP A;  1ZQF A;  4NLG A;  4NXZ A;  4DS4 A;  1A77 A;  3MR5 A;  5KG0 A;  3QEB Z;  3LK9 A;  2DPJ A;  2J6S A;  4I2B A;  4NM1 A;  7ICN A;  4X0A A;  3BQ0 A;  5KFT A;  3Q8M A;  2ZH1 A;  4ECT A;  2GWS A;  4XQ7 A;  5J0Y A;  3RBE A;  5J0R A;  2ATL A;  3RJG A;  5KFP A;  3PO5 A;  5DQI A;  3Q8Q B;  4O5C A;  4DSI A;  3C2K A;  2KZZ A;  5TZV A;  4DLE A;  3AQM A;  2ZTC A;  3ZDA A;  1SL1 A;  2ISP A;  5J2D A;  3PW2 A;  2O5A A;  1FA0 A;  2DRB A;  2ZH3 A;  3AU6 A;  5KFB A;  1KFD A;  4KLJ A;  3AQL A;  2I1Q A;  3PW4 A;  8ICM A;  4F4W A;  2P6U A;  4EZ6 A;  8ICE A;  9ICQ A;  2BPG A;  4ED0 A;  1S97 A;  3H4D A;  4CCH A;  1Y88 A;  5DQG A;  4F50 A;  4O3S A;  3AU2 A;  3NGD A;  3G6Y A;  4UB2 A;  1NK8 A;  1T3N A;  3Q8P B;  4X5V A;  3ZDE A;  3HT3 A;  4C8O A;  2DVI A;  4M2Y A;  3MGH A;  4RU9 A;  1ZQA A;  2BCQ A;  5DGA A;  4YD2 A;  2W9C A;  4JV1 A;  3OUY A;  4DSJ A;  4O3O A;  4DQI A;  4E80 A;  4IG8 A;  3GIM A;  5IIN A;  2IA6 A;  4J9R A;  4I2C A;  1ZQH A;  3LWL A;  4I28 A;  1BGX T;  4WC5 A;  3HJ4 A;  3MR3 A;  1L3T A;  8ICP A;  4WC3 A;  4O5E A;  8ICJ A;  1Z00 A;  2MAX A;  3PVX A;  5J0P A;  4P4M A;  4GC7 A;  4KLG A;  5CA7 A;  5KFZ A;  3TAN A;  9ICR A;  3V6H A;  4TUP A;  5KFQ A;  3KHR A;  1NJX A;  1ZQC A;  2BPC A;  1TV9 A;  3OJS A;  4AT7 B;  1ZQS A;  4GC6 A;  4AT8 A;  3PX0 A;  5CR0 A;  1ZQZ A;  1KFS A;  8ICY A;  4GXK A;  1TVA A;  5CHG A;  2P66 A;  4UQG A;  5BOM A;  4BXO B;  5HRK A;  3WFP A;  2W9B A;  5J0Q A;  1T7P A;  2BDP A;  4QZC A;  5KFV A;  8ICA A;  4YXJ A;  4YQW A;  3GIL A;  3EZ5 A;  1MQ3 A;  2UVR A;  1N48 A;  8ICS A;  4RQ4 A;  5KFN A;  1QTM A;  2M2V A;  1NK7 A;  3H8W A;  5KFU A;  5KFF A;  4ED6 A;  2C22 A;  2BQR A;  1R8B A;  1TFR A;  4FHW A;  3KHG A;  4PHE A;  5J2I A;  3RJI A;  4KMU A;  5KG2 A;  4R8U B;  7ICV A;  5J2F A;  1MIW A;  1KRP A;  4IRD A;  2BCU A;  2V9W A;  5CJ7 A;  3OJU A;  2HHQ A;  4F5Q A;  5KG5 A;  3RJF A;  7ICJ A;  4O3P A;  2J6T A;  1D9D A;  1HUZ A;  4RQ3 A;  5J2H A;  4O9M A;  5DG9 A;  1XWL A;  4YR2 A;  4O3R A;  1H38 A;  4DFK A;  9ICP A;  1ARO P;  4WBY A;  1ZJN A;  4ECW A;  4NKT A;  5HRI A;  5KT2 A;  5J0U A;  3V6K A;  2HHU A;  1ZQM A;  3MAB A;  1RZT A;  2BQ3 A;  7ICT A;  4Z6C A;  4X0B A;  4NM2 A;  3AUO A;  3MDC A;  4F5O A;  9ICK A;  2NRZ A;  3PR5 B;  1UEV A;  5DGB A;  5KFO A;  5DKW A;  2Q0Z X;  3RR7 A;  4P4P A;  3TAR A;  4ED1 A;  4KTQ A;  4F4X A;  1QLN A;  4FBU A;  4R63 A;  4YXM A;  4WC6 A;  5KT6 A;  2KN7 A;  7ICG A;  4DL5 A;  2HW3 A;  2M2T A;  2PBE A;  2XO7 A;  1DGS A;  2Y1I A;  4YCX A;  5DG7 A;  4DF4 A;  4MFC A;  1D8Y A;  3RAX A;  4TQS A;  2MUT A;  4IQU A;  1SKW A;  4ECR A;  2R8K A;  5HHI A;  4ELV A;  3GV8 B;  4EYH B;  5F2V O;  4WBZ A;  1JXL A;  4YG2 A;  2JZB A;  4XQ8 A;  4WC0 A;  5CB1 A;  4JWM A;  2DR7 A;  2H5X A;  3GFK B;  4S3N A;  5DLF A;  5F9N A;  3GDX A;  4YMM A;  1BPZ A;  9ICE A;  4PHD A;  3BQ2 A;  1S0V A;  4ECX A;  1S9F A;  1ZQN A;  4DSK A;  5DDY A;  2ZH4 A;  4B9V A;  2RDI A;  4M5D A;  3NYB A;  4Q43 A;  1SKS A;  4B9U A;  5J2J A;  2ZTE A;  3C2M A;  1TK0 A;  4Q8E A;  2ZJA A;  8ICN A;  1DK3 A;  4I2I A;  2M2U A;  2NRV A;  2DRA A;  2R8H A;  4DEZ A;  9ICG A;  4YP3 A;  3KTQ A;  2AJQ A;  4YMO A;  4XUS A;  5CWR A;  2UVV A;  1MIV A;  1VFG A;  4YVZ A;  7ICK A;  2F1J A;  2ZUB A;  4I2J A;  2NRK A;  4M6W A;  4PHP A;  1SL0 A;  3PX4 A;  5HR9 A;  5KFC A;  3H37 A;  1PX5 A;  4O3Q A;  2B21 A;  1U9L A;  2FMQ A;  4M9H A;  1MC8 A;  3RB3 A;  5EWF A;  1ZQO A;  1CEZ A;  4UD4 A;  4WCW A;  1D8L A;  4BWM A;  2J6U A;  4ELU A;  4RQ2 A;  1X9S A;  2DFL A;  1NJW A;  3JPR A;  8ICV A;  4BWJ A;  4UB1 A;  3EWA A;  1L3V A;  4QWC A;  1YLQ A;  3UXO A;  2F1I A;  1SKR A;  3GIK A;  2AGQ A;  2ZJ8 A;  4JV0 A;  5KFA A;  2F1H A;  4J9S A;  1NZP A;  4PH5 A;  5J0S A;  2W8K A;  1PZN A;  3N4M B;  5J0X A;  2ZH2 A;  9ICA A;  4RUC A;  4YN4 A;  5D49 A;  3GV7 B;  4RWP A;  4DOA A;  4M04 A;  1ZQB A;  3HX0 A;  4Z6E A;  4DL6 A;  2BR0 A;  1L3U A;  2ZH6 A;  4YMN A;  4KLI A;  4G3I A;  3SI8 A;  4EBJ A;  4NLK A;  4QZF A;  1CUK A;  2XCA A;  2V4Q A;  3C2L A;  4J9O A;  8ICF A;  9ICM A;  2DR8 A;  5KFW A;  4RPZ A;  5KTQ A;  3M8S A;  3M9O B;  3ZDD A;  4LT6 A;  3C21 A;  3WFO A;  1B43 A;  2FPM A;  1ZQP A;  4I2H A; 
#chains in the Genus database with same CATH topology
 4F92 B;  3UPS A;  4F71 A;  3V72 A;  3HJ1 A;  2BKE A;  3QYP A;  1ZQR A;  2H3F A;  7ICR A;  1KEJ A;  1JX4 A;  4JK1 A;  2AGO A;  2BPF A;  3H8J A;  4Y2S A;  4QZ9 A;  4O0I A;  1ZQ1 C;  4C7Z A;  3NS1 A;  1S0N A;  2ZIU B;  5ALH A;  4NKU A;  4OD0 A;  1HUO A;  5ALK A;  4X4T A;  5HRH A;  3G6X A;  2BHN A;  1SGG A;  4I29 A;  3CP8 A;  1F5S A;  3KKA A;  8ICX A;  3BQT A;  1Q79 A;  3V7L A;  1UQV A;  2PFN A;  2KEY A;  2DBY A;  5DB6 A;  5HP4 A;  1NKC A;  1K5O A;  4ATB B;  4GLX A;  2BE3 A;  3RJK A;  2KHV A;  3WFQ E;  2LPE A;  5KG1 A;  4AT9 A;  5J2B A;  2ZH8 A;  3BZC A;  5EOZ A;  9ICH A;  2R8G A;  1KL9 A;  2CXY A;  3M1Y A;  4DL2 A;  4F4Y A;  3UMG A;  1YT3 A;  2R8J A;  1YZ7 A;  2AQ4 A;  3EF2 A;  2W8L A;  3M9M B;  4K4G A;  2QAR B;  3C29 A;  1LV5 A;  5L1K A;  2IBK A;  4F2R A;  2K4E A;  3JPN A;  5DBA A;  7ICI A;  5AKK A;  4UAS A;  4KLM A;  1Q3V A;  3LVW A;  3EYZ A;  1NK9 A;  4JWN A;  1UT8 A;  2EZZ A;  4O6A A;  1XO0 A;  1T3Q A;  3IP4 B;  4M47 A;  4HYK A;  4O3M A;  3K1Z A;  2UVW A;  2B4V A;  1R8C A;  3PR4 A;  3B0Y A;  3RJE A;  4RZR A;  3NUQ A;  2BGW A;  4QW9 A;  2C2D A;  5AM0 A;  4FHV A;  3V6J A;  5AKL A;  3WK6 A;  1ZQD A;  2BDU A;  2HVI A;  1V4A A;  3RH5 A;  3PNC A;  4F93 B;  3C18 A;  5JUM A;  1BPX A;  1ZYQ A;  4JV2 A;  9ICX A;  4J9K A;  3ED5 A;  2XVT A;  2JGA A;  4ZOH C;  5J29 A;  1Q46 A;  4RQN A;  4BJQ A;  4KLD A;  2EDU A;  5ALF A;  3TAC B;  2IOF A;  4OJL A;  4LVS A;  2EAO A;  1JIH A;  4C4S A;  4Z6D A;  1SXD A;  1SV4 A;  4TUQ A;  1QSY A;  4RNN A;  4RQ0 A;  5AM4 A;  1MN8 A;  3EW9 A;  4XJE A;  4Y2T A;  3TAD A;  2ZHA A;  4UB3 A;  2ZIV B;  5KFE A;  3WKD A;  1IIP A;  3D2S A;  9ICU A;  4QWA A;  5AKY A;  4QZA A;  3KHL A;  1S77 D;  3RB0 A;  4BXO A;  3QE9 Y;  3RRG A;  2QAR A;  3ZD9 A;  3JPO A;  4IC9 A;  3JYY A;  1TFY A;  2G08 A;  3B0X A;  4I27 A;  4ECV A;  4KM5 A;  3V7K A;  2PMZ F;  4DFD A;  4QZB A;  3E58 A;  5EE1 A;  1U47 A;  2WF6 A;  2W54 A;  1L5U A;  5E79 U;  4KLE A;  4AT9 B;  1BVS A;  2OEH A;  1XC9 A;  2GAF D;  1Z1V A;  1ZQL A;  5BPC A;  3H3A A;  3NWI A;  9ICS A;  4ZH4 A;  1U45 A;  3LYS A;  1X9M A;  4C8L A;  5D61 A;  3MC1 A;  3JPQ A;  2MUT B;  3D2Q A;  2ZXH A;  2W3R A;  2YMM A;  4DQR A;  8ICG A;  4QZ8 A;  9ICN A;  1Z3E B;  4X4O A;  5EE3 A;  4WC2 A;  2A1J B;  4UBC A;  1X2I A;  1ZRM A;  3B9J A;  2FJ6 A;  4IQT A;  2PXI A;  3QU5 A;  2WAQ C;  3BQ1 A;  4IRC A;  1Z00 B;  1ZQX A;  4MEY A;  5EE0 A;  5G5H A;  1TKD A;  3PY8 A;  3PW0 A;  1XNS A;  4DWI A;  3H38 A;  4YR0 A;  3K4G A;  2MSN A;  3E0F A;  1KQQ A;  1ZJM A;  5J2A A;  4UAZ A;  4TUR A;  5L9X A;  4UAY A;  4OAH A;  2ISO A;  2BQU A;  8ICQ A;  2E5S A;  2NRT A;  1KBU A;  2VA2 A;  4Y2Q A;  4KX5 A;  4QWE A;  3J81 j;  4FO6 A;  5KFD A;  1D9F A;  4OAF A;  1F44 A;  1JQR A;  1ZQY A;  2UVU A;  4AT8 B;  2HVH A;  4F91 B;  3V7J A;  4J9L A;  1S0M A;  2JXJ A;  3TFS A;  4DLG A;  1JXE A;  1NI3 A;  3K75 D;  2JEF A;  4O5K A;  5J2C A;  3AL0 B;  5KG6 A;  3ETR A;  4DQQ A;  4R64 A;  1X9W A;  3TAP A;  5JRT A;  5ALV A;  1RYU A;  3F5A A;  2PI4 A;  7ICU A;  4EP7 A;  2HOQ A;  2HHP A;  2MRL A;  2YMP A;  1ZQF A;  4DS4 A;  3MR5 A;  5KFT A;  1X40 A;  2GWS A;  4NXU A;  1SZH A;  1COK A;  3ZDA A;  2YX8 A;  2YB1 A;  2O5A A;  4C80 A;  2ZH3 A;  2PKE A;  1KFD A;  3F2D A;  4F4W A;  8ICE A;  9ICQ A;  4ED0 A;  3G6Y A;  3KZX A;  1T3N A;  4X5V A;  2DVI A;  5ALP A;  2BCQ A;  5DGA A;  2W9C A;  4JV1 A;  4DQI A;  2IA6 A;  1BGX T;  5HR6 A;  3BZK A;  2H3Q A;  1V97 A;  4WC3 A;  8ICJ A;  1FEZ A;  5CA7 A;  5KFZ A;  3TAN A;  5ALL A;  3V6H A;  4BUG A;  5ALY A;  3KHR A;  1ZQC A;  5AM1 A;  2BPC A;  3D6J A;  1ZQS A;  3PX0 A;  5AKI A;  5BOM A;  4UQG A;  3N7S C;  2W9B A;  1T7P A;  2K8A A;  8ICS A;  2OYY A;  2W04 A;  1QTM A;  2M2V A;  2GA9 D;  4FHW A;  3KHG A;  5J2I A;  2LBO A;  4PL1 A;  5J2F A;  1D8B A;  1S5L U;  4F5Q A;  1D9D A;  1HUZ A;  5DG9 A;  4O3R A;  4DFK A;  3IDW A;  1ZJN A;  5HRI A;  2RP5 A;  3V6K A;  2B51 A;  2BQ3 A;  7ICT A;  4NM2 A;  2A1A A;  3VC8 A;  1L7N A;  1UEV A;  5DGB A;  2K60 A;  2ESE A;  2Q0Z X;  3TAR A;  4F4X A;  4C4R A;  4JMU A;  4K97 A;  3JCF A;  4R63 A;  4YXM A;  2XO7 A;  4YCX A;  5DG7 A;  1C20 A;  5TIS U;  4EX6 A;  4ELV A;  3FM9 A;  1SKW A;  2R8K A;  2QLT A;  5F2V O;  2HMX A;  2DR7 A;  1L7M A;  2KKV A;  4WQK A;  3QUT A;  2JHD A;  3I28 A;  4Q43 A;  1SKS A;  4B9U A;  3C28 A;  5J2J A;  2VIX A;  3C2M A;  1TK0 A;  8ICN A;  4I2I A;  1VFG A;  4YVZ A;  7ICK A;  2F1J A;  4I2J A;  1QQ6 A;  3F2C A;  2NRK A;  4M6W A;  4PHP A;  3PX4 A;  3H37 A;  3F5E A;  1OW5 A;  2FMQ A;  3RB3 A;  1O03 A;  4UAR A;  1CEZ A;  4ELU A;  5ALG A;  3OWG A;  1NJW A;  5CFU A;  4BWJ A;  3EWA A;  1L3V A;  4JV0 A;  4PH5 A;  3K7D A;  1PZN A;  5D49 A;  3NVW A;  4RWP A;  2K8B B;  4DL6 A;  3FC4 A;  4QZF A;  4USA A;  2JR5 A;  3M8S A;  3M9O B;  3ZDD A;  3WFO A;  4PL2 A;  1N63 A;  3RR8 A;  8ICO A;  1V9P A;  2OWO A;  9ICF A;  1MQ2 A;  4DFM A;  1WG8 A;  1K1Q A;  4I2G A;  3GIJ A;  1ZQG A;  4MHV A;  2KFZ A;  2XI9 A;  2G07 A;  3DEE A;  4P0P B;  3H40 A;  2K4H A;  2YB4 A;  3SZ2 A;  4QZH A;  1NJY A;  4DOB A;  2DL0 A;  1ZQE A;  4FE3 A;  3SAH A;  5DBC A;  1YZ6 A;  1RXV A;  4J9Q A;  5J8Y A;  4I2D A;  1L8O A;  5EWG A;  1XO1 A;  4I2A A;  4EYI B;  1Z4O A;  1KFT A;  4EBD A;  4Q8F A;  4EBK A;  2HHS A;  1BPD A;  9ICI A;  2HHX A;  2HBK A;  1EXN A;  4MFF A;  5L1J A;  2W43 A;  1NZB A;  1ZQW A;  3HP6 A;  4O69 A;  1QH9 A;  9ICL A;  4F3O A;  5CHE A;  5EWE A;  1UT5 A;  4AYB C;  2M0N A;  3PMN A;  1L7P A;  4ECU A;  2ZH9 A;  1KLN A;  4FHX A;  1IV8 A;  4CNQ A;  2I6X A;  5KFS A;  8ICR A;  3N7R C;  3JPT A;  2AGP A;  2KMD A;  1T8E A;  4FS2 A;  4EED A;  3NRZ A;  4K8V A;  1OU5 A;  1HIW A;  3PV8 A;  4ECZ A;  4UAV A;  2ZH7 A;  2MU2 A;  4C8N A;  4CRX A;  9ICC A;  4OCZ A;  4GXI A;  5L1I A;  2HOI A;  1IM4 A;  1RG6 A;  2RQ5 A;  4Y2V A;  4DCC A;  4DL7 A;  5J0O A;  2KJ5 A;  3SV4 A;  4QZI A;  4NY8 A;  2HI0 A;  3H39 A;  1NKE A;  4US9 A;  8ICI A;  1JAJ A;  2M9N A;  2M2W A;  4RQ6 A;  5KFI A;  1ZQJ A;  2WF8 A;  4F5R A;  4QWB A;  1U4B A;  3ISB A;  4XA5 A;  2OH2 A;  4RWN A;  2RFF A;  3T5J A;  3RH4 A;  4FH3 A;  5T14 A;  3HW8 A;  7ICP A;  2ID1 A;  2OM6 A;  1S76 D;  2FPK A;  2W9C B;  4KLQ A;  5IIJ A;  4ATB A;  1KTQ A;  2EZX A;  1VLB A;  2G5I B;  2FLL A;  2HBJ A;  1BPE A;  4MFA A;  3RH6 A;  2YN4 A;  2FMS A;  3HPO A;  4EEN A;  4Q44 A;  3E2E A;  2HBM A;  1P7D A;  3FDS A;  9ICB A;  3WK8 A;  3ALR A;  3MBY A;  2EZY A;  3VCB A;  4JB3 A;  4NXV A;  2JRZ A;  1RDF A;  1NO5 A;  3QU7 A;  2Y1J A;  1MIY A;  3QU9 A;  1BPB A;  5ALE A;  3C5F A;  4GXJ A;  1L3S A;  1Q3U A;  4TUS A;  4LEV A;  3OUY B;  1SXE A;  2I5H A;  4AYB F;  2OCE A;  1JI7 A;  3KKA C;  1SIJ A;  2XC9 A;  1PK1 A;  1FFV A;  5AM5 A;  5B5E U;  2VA8 A;  1N60 A;  1KW4 A;  4KLH A;  3IN5 A;  3R9K A;  4DF8 A;  1JN3 A;  1TK8 A;  7ICO A;  3ISC A;  3NAS A;  1ZQQ A;  2KIV A;  5IIM A;  2G0A A;  4X4U A;  2NRW A;  3NTU A;  1PVQ A;  3ZD8 A;  5DB7 A;  4F72 A;  5J2E A;  2KNJ A;  3CRX A;  3QZ7 A;  1SWV A;  1J2M A;  5HML A;  2ASJ A;  4UD5 A;  5CFT A;  3N28 A;  3BJY A;  2GLE A;  4EBC A;  4K98 A;  4NWI A;  5GTH U;  4QW8 A;  3SAG A;  3BS5 B;  4KN4 A;  2C2E A;  4I2F A;  2HOF A;  3TAQ A;  2W9M A;  1N5W A;  3GZF A;  4EEY A;  2ODG A;  3RB4 A;  2LI6 A;  2XGQ A;  4U6P A;  2C2R A;  4LEW A;  3QUB A;  9ICJ A;  1LVH A;  1GO3 F;  2BBH A;  1URJ A;  2JZB B;  1OUQ A;  1CRX A;  4K99 A;  4FBT A;  4B6J A;  3JPP A;  1LKY B;  1NK0 A;  4RT3 A;  4LZG A;  4A8E A;  5KFJ A;  4UB8 U;  2DPI A;  2IOF K;  2LHT A;  3NRW A;  1SWW A;  4RUA A;  1Q8K A;  1S0O A;  1ZD2 P;  2KZ3 A;  1WOT A;  4K96 A;  3ONN A;  1XU4 A;  1PVR A;  5DLG A;  3Q8K A;  4WC7 A;  2C28 A;  2D6F C;  3CK6 A;  4KLL A;  3S6J A;  1Z4N A;  3UMB A;  1S10 A;  1AQ6 A;  3OSN A;  4RT2 A;  3JZ0 A;  5CEH A;  4FO1 A;  4NXX A;  2K89 A;  4EV6 A;  4P0P A;  5DEC A;  4RQ7 A;  4LEZ A;  2O6K A;  3OSP A;  5KG3 A;  2XY7 A;  2E8M A;  4OJ5 A;  5AM2 A;  2W9B B;  2RDJ A;  3THV A;  2JEI A;  4XRH A;  5KG0 A;  4IS7 A;  3LK9 A;  2CN1 A;  5J0Y A;  3RJG A;  4O5C A;  5KFP A;  3Q8Q B;  4DLE A;  4OAG A;  1WUD A;  1X9X A;  3PW2 A;  2PMZ C;  3AMZ A;  2KV2 A;  5KFB A;  3AU6 A;  2F77 X;  3AQL A;  3PW4 A;  8ICM A;  4EZ6 A;  2KK0 A;  4NL9 A;  5DQG A;  3AU2 A;  3QU2 A;  4UB2 A;  3KFU F;  3HT3 A;  4M2Y A;  5AIC A;  3SAF A;  3OUY A;  3GIM A;  4I2C A;  2WFA A;  3EUB 2;  3HJ4 A;  1L3T A;  1RQL A;  4O5E A;  1Z00 A;  4KLG A;  2Y9T A;  4Y2X A;  5J0P A;  2EQY A;  4TUP A;  1NJX A;  3OJS A;  4GC6 A;  1ZQZ A;  8ICY A;  1TVA A;  5CHG A;  1X6J A;  3WFP A;  4O67 A;  2KJ9 A;  2WF5 A;  3DDH A;  4I0U A;  4YQW A;  3EZ5 A;  2UVR A;  1RQN A;  1N48 A;  5KFU A;  1ED1 A;  4PHE A;  4KMU A;  2KIW A;  2CRX A;  3CNH A;  2FE9 A;  4IRD A;  2ZIX A;  2V9W A;  5CJ7 A;  2HHQ A;  5KG5 A;  4O3P A;  2J6T A;  4RQ3 A;  5J2H A;  2GH1 A;  1XWL A;  9ICP A;  4NV0 A;  4WBY A;  4UAU A;  4EEB A;  3MAB A;  5JU5 A;  9ICK A;  3CW2 C;  3PR5 B;  5ALZ A;  5KFO A;  4HX0 A;  4WC6 A;  2KD1 A;  4DL5 A;  2H3Z A;  4MFC A;  2JH1 A;  2LYA A;  3RAX A;  2E1F A;  4IQU A;  4ECR A;  5HHI A;  3GV8 B;  4WBZ A;  3AQE A;  4YG2 A;  5ALQ A;  3MGV A;  4ACO A;  4WC0 A;  5CB1 A;  2KIC A;  4S3N A;  2H3V A;  5F9N A;  3GDX A;  9ICE A;  2G09 A;  4PZN A;  3ER8 C;  4ECX A;  2VJ5 A;  1S9F A;  1ZQN A;  4DSK A;  2ZH4 A;  2RDI A;  4M5D A;  3NYB A;  1T94 A;  2LYB A;  2ZTE A;  2M2U A;  1DK3 A;  2DRA A;  2R8H A;  2AJQ A;  2YTU A;  2DUY A;  4YMO A;  4XUS A;  2UVV A;  5AI9 A;  5HR9 A;  4O3Q A;  5EWF A;  1ZQO A;  4KB6 A;  1B4F A;  4WCW A;  2J6U A;  4RQ2 A;  2DFL A;  3BS7 A;  3JPR A;  8ICV A;  3TKA A;  5AKX A;  2AGQ A;  2ZJ8 A;  2EAM A;  2F1H A;  4LJX A;  2W8K A;  2KSO A;  3N4M B;  5J0X A;  2ZH2 A;  4RUC A;  4YN4 A;  2LMR A;  3GV7 B;  2WF9 A;  4DOA A;  1ZQB A;  2LM1 A;  4Z6E A;  2BR0 A;  4UB6 U;  4YMN A;  4G3I A;  4NLK A;  2V4Q A;  3C2L A;  9ICM A;  5KFW A;  5KTQ A;  3D2N A;  4CF5 A;  3C21 A;  1B43 A;  2QB0 B;  2FPM A;  3K1R B;  5KFG A;  4KLU A;  5AHX A;  3MFH A;  4LZD A;  2P6R A;  2AU0 A;  3PX6 A;  3ZDC A;  1N61 A;  2HBL A;  1PK1 B;  3OVA A;  3M8R A;  1TAU A;  2JEJ A;  5AI5 A;  5ALW A;  5L1M A;  5KFK A;  3MDA A;  1RM6 C;  1UCV A;  2W9A A;  5AKH A;  2O1P A;  3IRU A;  3GII A;  2WTF A;  5KFY A;  4B9S A;  3OTQ A;  4UAW A;  4X4N A;  3WK9 A;  4FS1 A;  1K1S A;  4RPY A;  2JH7 A;  5HNK A;  4PHA A;  1A76 A;  2FLP A;  2ZTD A;  4CE6 A;  4YD1 A;  2HCF A;  5J0W A;  5F9L A;  3WKB A;  4YR3 A;  2QKQ A;  3KHH A;  2XY6 A;  1WCN A;  1NK6 A;  4F8R A;  2GOL A;  3F2B A;  3SR6 A;  2ASL A;  5BOL A;  2QB1 A;  5KFM A;  2F3N A;  4ECS A;  1COO A;  5ALR A;  5KFH A;  1ZD5 A;  3PSP A;  4IL6 U;  3AQK A;  4QWD A;  1BNO A;  4NLB A;  3RRH A;  5KG4 A;  1X6I A;  5AKE A;  2XID A;  3UXP A;  2HHV A;  3L9D A;  1UET A;  3QUQ A;  4PGX A;  4ECY A;  2IOH A;  2DKX A;  2LYH A;  1T4G A;  1KKX A;  2KHQ A;  3OPX A;  4U7C A;  3PO4 A;  4DL3 A;  4MEX A;  3LWM A;  3H8M A;  4ICA A;  4OJO A;  1C7Y A;  3PSI A;  2LM4 A;  3IM1 A;  4O68 A;  4RWQ A;  5ALT A;  4DL4 A;  3PW5 A;  1XSL A;  1ZRN A;  3UMC A;  3A0B U;  2E1E A;  7ICE A;  3PSF A;  5AK3 A;  4RQ1 A;  4DSL A;  4FHY A;  4DFP A;  2JMG A;  4E7X A;  5KAF U;  4Z6F A;  1NKB A;  3NVV A;  4EZ9 A;  9ICO A;  2HN1 A;  2QB0 A;  3SYZ A;  2ZXI A;  1XSP A;  1WWU A;  4Y2P A;  1B22 A;  3PZP A;  1ZQT A;  4F4K A;  4BX9 C;  4EEL A;  3KOO A;  4F5P A;  4ECQ A;  4RQM A;  2R8I A;  1RYR A;  4M0A A;  5HRB A;  5DQH A;  1QCK A;  2BZF A;  2I9G A;  3MGI A;  3WK4 A;  4KLF A;  3HKZ F;  1ZQV A;  1DOQ A;  4C7Y A;  3HIL A;  2ALZ A;  1BNP A;  4ED2 A;  5IIK A;  2VAN A;  5HRD A;  4JLZ A;  2JEG A;  2IHM A;  4BDP A;  1JAL A;  2DF4 B;  4BGD A;  4JLX A;  3KD3 A;  5HR7 A;  2DR5 A;  2G06 A;  4J03 A;  1ZET A;  5IIL A;  2DQN B;  2BCV A;  4UB4 A;  1JRP A;  7ICL A;  5KT7 A;  1SZP A;  3WK5 A;  3MR6 A;  4RWO A;  1FFU A;  3OVS A;  4E0D A;  3EPG A;  3IHQ B;  1QQ7 A;  5AI6 A;  5CP2 A;  4F4Z A;  2NV3 A;  4FFD A;  1LB2 B;  8ICW A;  1JRO A;  5J8Y C;  4M9N A;  9ICT A;  4J9N A;  5ALN A;  4DQS A;  1Z19 A;  1TE2 A;  4M9L A;  1JMS A;  1CI4 A;  4QZG A;  2OHF A;  5HHH A;  2XY5 A;  5HRG A;  1VJ5 A;  3QNM A;  5B66 U;  3H0L B;  1RPL A;  4RNM A;  4LEY A;  1U48 A;  1DK2 A;  1SL2 A;  2FPL A;  3C66 A;  2FMP A;  2IHO A;  5ALU A;  4ED7 A;  1O08 A;  2VA3 A;  2A3V A;  2PFP A;  2HDO A;  2FI1 A;  4B9N A;  2AQ0 A;  4E8F A;  5KL1 B;  2ZUC A;  3ERC C;  2ZIV A;  1KSP A;  8ICK A;  4X4Q A;  4Q45 A;  2F44 A;  7ICF A;  2PFO A;  9ICW A;  1QQ5 A;  3G6V A;  4RNO A;  1IXR A;  4FHP A;  1LKY A;  2Q66 A;  2YMQ A;  2KTQ A;  2K4P A;  1N56 A;  5DG8 A;  2V4R A;  4NLN A;  5AKG A;  5DED A;  5FP0 A;  2YY6 A;  3M6K A;  3PST A;  3PHZ A;  1VDV A;  2KP7 A;  3OV7 A;  3ORY A;  4K9A A;  5AIA A;  1UHU A;  2EH9 A;  4CDG A;  1R89 A;  5L1L A;  1ZQK A;  3O0F A;  3H8S A;  3UXN A;  2PFQ A;  5J2G A;  8ICT A;  2E8P A;  3WFR E;  1DGJ A;  4IQV A;  3Q8R B;  4JUZ A;  5HRL A;  4OAI Z;  2R18 A;  3HRD D;  3TI0 A;  4RPX A;  1KN5 A;  4DOC A;  1OXJ A;  3GV5 B;  1WCL A;  4NLZ A;  2HHT A;  5A0L A;  3T5K A;  1A0P A;  4R8U A;  4MF2 A;  3DV9 A;  1NK5 A;  4DQP A;  3WKE A;  2ZH5 A;  3QEA Z;  1TAQ A;  4P0Q A;  4M9J A;  3NVY A;  4NLG A;  5AKJ A;  4NXZ A;  1A77 A;  3CYM A;  2DPJ A;  3QEB Z;  4NM1 A;  7ICN A;  3BQ7 A;  3BQ0 A;  3Q8M A;  4XQ7 A;  3RBE A;  2ATL A;  1MA7 A;  3PO5 A;  4DSI A;  3C2K A;  5TZV A;  1SL1 A;  2ISP A;  1L8L A;  5J2D A;  2ES6 A;  5KNI A;  1FA0 A;  2F76 X;  2I1Q A;  3IG5 A;  2P6U A;  1S97 A;  4PZO A;  3H4D A;  4CCH A;  4O3S A;  4F50 A;  2D3D A;  3Q8P B;  4C8O A;  1S8O A;  3MGH A;  4RU9 A;  4IG8 A;  5IIN A;  1ZQH A;  4I28 A;  4WC5 A;  1N5X A;  3MR3 A;  5GTI U;  9ICR A;  2Q4T A;  4UW9 A;  3RF9 A;  4NL9 C;  4NXW A;  4AT7 B;  4G9B A;  2VKQ A;  1KFS A;  4GXK A;  4BXO B;  2BDP A;  2DWQ A;  4QZC A;  2RHF A;  5KFV A;  8ICA A;  3GIL A;  4RQ4 A;  3H8W A;  2C22 A;  1TFR A;  4FZM A;  5KG2 A;  4R8U B;  7ICV A;  1L6N A;  1KRP A;  3H0R B;  2BCU A;  3HJE A;  4QIW F;  7ICJ A;  4YR2 A;  5KL8 B;  1ARO P;  1J97 A;  4NKT A;  1N62 A;  5KT2 A;  5KAI U;  1RZT A;  1ZOL A;  4Z6C A;  3AUO A;  5DKW A;  3I76 A;  4WQL A;  2A19 A;  1X66 A;  5KT6 A;  1DGS A;  3NVO A;  5AI8 A;  4C0Z A;  1D8Y A;  5ALD A;  4TQS A;  4EYH B;  4WOY A;  4CF3 A;  2JZB A;  5AM3 A;  4XQ8 A;  3MCR A;  2H5X A;  3GFK B;  5DLF A;  3T79 A;  1BPZ A;  4Y2J A;  4PHD A;  5DDY A;  1WYG A;  4B9V A;  3LVV A;  3AQF A;  4DEZ A;  2L5Y A;  3SQI A;  2ZUB A;  1SL0 A;  5KFC A;  1PX5 A;  2YML A;  1U9L A;  1MC8 A;  2WHE A;  4UD4 A;  5B3P A;  4BWM A;  1SV0 C;  2W3S A;  4UB1 A;  2RRD A;  3M6Z A;  5ALO A;  4QWC A;  3UXO A;  2F1I A;  1SKR A;  3GIK A;  4J9S A;  2FCL A;  5J0S A;  1GPJ A;  5F3X B;  4M04 A;  3A0H U;  5K4L A;  3WK7 A;  4KLI A;  2DR8 A;  1CUK A;  2XCA A;  4J9O A;  5ALS A;  3ZI4 A;  1ZQP A;  4I2H A;  2ZHB A;  2ZIX B;  1ZQU A;  7ICQ A;  8ICL A;  1TFW A;  3OHA A;  3TQ1 A;  4DO9 A;  1RXW A;  4PGY A;  2P35 A;  4WC4 A;  3PML A;  3H7I A;  2HSZ A;  5KFR A;  4GFJ A;  2KG5 A;  1NNL A;  2DR9 A;  5KG7 A;  2Y0S F;  3H4B A;  3UQ0 A;  8ICH A;  3RBD A;  1N2X A;  2VJ4 A;  3SMV A;  5B3Q A;  1HEK A;  3BS5 A;  2Y9U A;  5KT3 A;  1V85 A;  4WJ3 B;  1Q78 A;  3ICX A;  4UB5 A;  3SV3 A;  5DBB A;  3IV6 A;  7ICS A;  2ZIU A;  4QZE A;  2ASD A;  1PK3 A;  4I2E A;  1F0M A;  5KT5 A;  1R8A A;  1WWV A;  8ICZ A;  4TQR A;  8ICC A;  4FH5 A;  4IR1 A;  4QZD A;  2E3T A;  2E8O A;  3PW7 A;  3TFR A;  1XSN A;  3WFS C;  7ICM A;  3RTV A;  2F8K A;  4MF8 A;  2CPR A;  3F53 A;  3JPS A;  4X4S A;  4QJF B;  4KMO B;  3HWT A;  8ICB A;  3RB6 A;  3ISD A;  3KBB A;  4AT7 A;  3T5H A;  4C8M A;  3AN1 A;  3FYH A;  5C5J A;  3ETL A;  2FDR A;  3SEI A;  2E8N A;  4OJP A;  2IHN A;  4M9G A;  2EAN A;  2ZUD A;  4OJ6 A;  4R66 A;  1RYS A;  4NLC A;  4KIT B;  3OVB A;  2N1R A;  2WAQ F;  2BCS A;  3LQC B;  3T3F A;  2AH5 A;  4O3N A;  1ZD3 A;  1VJ7 A;  5AI0 A;  3L3F X;  3RAQ A;  4OO1 J;  2DGZ A;  4FZN A;  5C0Y A;  1U49 A;  5AK6 A;  4PGQ A;  5HRF A;  7ICH A;  4KN7 A;  5AK5 A;  4X4R A;  3QUC A;  4DFJ A;  1BPY A;  2HHW A;  1F5A A;  5ALJ A;  5KT4 A;  3QZ8 A;  4X4V A;  4PPX A;  3ZDB A;  3C1Z A;  4UBB A;  1Z1B A;  4K4H A;  2NRX A;  2W03 A;  5III A;  2IMW P;  1A6S A;  5HRE A;  2JV3 A;  4K4I A;  2WB1 F;  5DDM A;  1XS9 D;  3C5G A;  4M6W B;  1QSL A;  4F2S A;  1ZD4 A;  4Y2U A;  5D62 A;  2Y0S C;  3OGU A;  1QSS A;  1HJP A;  2FLN A;  3MFI A;  2NO5 A;  5CFS A;  2KFN A;  3SD7 A;  1ZQI A;  5ALX A;  5IIO A;  2XGP A;  5KFX A;  4C8K A;  2B0C A;  5D46 A;  4ELT A;  3RFA A;  5H2F U;  3IG8 A;  4Y2Y A;  3UPQ A;  4DSF A;  4CF4 A;  4X4P A;  1MSW D;  3L5K A;  3M9N B;  5D4B A;  4DSE A;  5CRX A;  2PI5 A;  3H0M B;  2KOB A;  4IR9 A;  5ALM A;  4DS5 A;  4ED3 A;  4C4T A;  3AQN A;  8ICU A;  1PUZ A;  2KVS A;  5G5G A;  5DB8 A;  4F5N A;  5HC9 A;  1NOM A;  2D8C A;  5AI4 A;  3GQC A;  2BCR A;  2XCP A;  2W7P A;  3EPI A;  2KSO B;  4YFK A;  5DB9 A;  3Q8L A;  3I1Y A;  2BBJ A;  4KLT A;  3QX7 A;  3FAH A;  1UPH A;  1NK4 A;  2W11 A;  2W7O A;  5D63 A;  1ZXI A;  1TK5 A;  2MA1 A;  3KZI U;  5ALI A;  4NXT A;  4UAT A;  1L7O A;  3RJJ A;  4B9M A;  3Q8S B;  4K9B A;  3SEN A;  1JUD A;  1UA0 A;  9ICV A;  3LDA A;  2NYV A;  4EBE A;  4J9P A;  4B9L A;  5HMM A;  3C1Y A;  1J2N A;  4HAI A;  4IRK A;  1PVP A;  4IQW A;  2A1J A;  2WF7 A;  3OHB A;  1NJZ A;  4EX7 A;  5JTI A;  5JTG A;  4RQ5 A;  2XIC A;  2B56 A;  3WKC A;  4GIB A;  1UEU A;  3N97 B;  5J0T A;  3HIY A;  4US8 A;  4KLS A;  4RQ8 A;  1KDH A;  4ED8 A;  4MKP A;  2K4I A;  1UA1 A;  4B9T A;  3UQ2 A;  2GO7 A;  3MR2 A;  4P2H A;  3L4P A;  5J2K A;  3BDP A;  2KVC A;  2ZJ5 A;  2EWR A;  1SV0 A;  4R65 A;  3RJH A;  4J9M A;  2KZM A;  3C23 A;  4WC1 A;  4KLO A;  5KFL A;  3T5L A;  4P4O A;  1KNY A;  5AKZ A;  1FO4 A;  1V38 A;  2KJ8 A;  2KKP A;  2Z7J A;  2ZG6 A;  2J6S A;  4I2B A;  4X0A A;  2ZH1 A;  4ECT A;  5J0R A;  2KZZ A;  5DQI A;  5AIB A;  3AQM A;  2G5H B;  2DKZ A;  2ZTC A;  4QIW C;  2DRB A;  4KLJ A;  2BPG A;  1Y88 A;  3ER9 B;  1NK8 A;  1X42 A;  3NGD A;  3ZDE A;  2ZIW B;  1IG6 A;  1ZQA A;  2RLT A;  4YD2 A;  4DSJ A;  4O3O A;  4E80 A;  4J9R A;  1FIQ A;  3LWL A;  1B0X A;  8ICP A;  1M6Y A;  3PVX A;  2MAX A;  3AM9 A;  4P4M A;  4GC7 A;  3GU3 A;  2IUB A;  2F8L A;  3QXG A;  5KFQ A;  1TV9 A;  3AEV A;  4AT8 A;  4NJ8 A;  5CR0 A;  3U26 A;  2P66 A;  5HRK A;  2LKY A;  5J0Q A;  2HN2 A;  2K8C B;  2EAP A;  4Y2R A;  4YXJ A;  1MQ3 A;  5KFN A;  1NK7 A;  2F2A B;  4ED6 A;  5KFF A;  2BQR A;  2YQE A;  1R8B A;  3RJI A;  1MIW A;  3OJU A;  3RJF A;  1DXS A;  2AXT U;  4O9M A;  1H38 A;  2WB1 C;  4QNL A;  1DRG A;  4ECW A;  4FZL A;  3NKU A;  3M7D A;  5J0U A;  2HHU A;  1ZQM A;  3NVZ A;  4X0B A;  3TAD C;  3UM9 A;  3MDC A;  4F5O A;  2NRZ A;  2W55 A;  3RR7 A;  4P4P A;  4KTQ A;  4ED1 A;  1QLN A;  2AHO B;  4FBU A;  5AK4 A;  2OXO A;  2KN7 A;  7ICG A;  2HW3 A;  2M2T A;  2PBE A;  2Y1I A;  4DF4 A;  2MUT A;  4PJ0 U;  3WKA A;  3WU2 U;  1JXL A;  3QU4 A;  1ECW A;  4JWM A;  4CGZ A;  1TAM A;  4P0Q B;  4YMM A;  1S0V A;  3BQ2 A;  4N7R A;  2ZIW A;  4Q8E A;  2ZJA A;  2NRV A;  9ICG A;  4YP3 A;  3KTQ A;  4AP9 A;  5CWR A;  1MIV A;  2KE7 A;  4EGW A;  2B21 A;  3HKZ C;  4WH5 A;  4M9H A;  3N7P D;  4KX3 A;  1D8L A;  1X9S A;  2B6G A;  1SB3 C;  1YLQ A;  2NO4 A;  5KFA A;  1NZP A;  9ICA A;  3HX0 A;  5EE9 A;  1L3U A;  2ZH6 A;  3SI8 A;  4EBJ A;  8ICF A;  4EEK A;  4RPZ A;  2H3I A;  4LT6 A; 
#chains in the Genus database with same CATH homology
 4F92 B;  5KFG A;  4KLU A;  3UPS A;  2ZHB A;  3MFH A;  4LZD A;  1ZQU A;  2P6R A;  1V9P A;  3RR8 A;  2AU0 A;  8ICO A;  3PX6 A;  2OWO A;  3ZDC A;  8ICL A;  9ICF A;  7ICQ A;  3OHA A;  3TQ1 A;  1MQ2 A;  1TFW A;  4DFM A;  4DO9 A;  1K1Q A;  1RXW A;  3OVA A;  3M8R A;  3V72 A;  2JEJ A;  4PGY A;  4I2G A;  1TAU A;  3GIJ A;  2BKE A;  1ZQG A;  3HJ1 A;  1ZQR A;  5KFK A;  2KFZ A;  4WC4 A;  7ICR A;  3MDA A;  3H40 A;  3SZ2 A;  1KEJ A;  3PML A;  4QZH A;  3H7I A;  2W9A A;  1NJY A;  4DOB A;  1JX4 A;  1ZQE A;  5KFR A;  2O1P A;  4JK1 A;  5DBC A;  3GII A;  2AGO A;  2BPF A;  2WTF A;  2DR9 A;  5KFY A;  4B9S A;  3H8J A;  5KG7 A;  3H4B A;  3UQ0 A;  8ICH A;  4QZ9 A;  4O0I A;  1RXV A;  4UAW A;  3RBD A;  4J9Q A;  1S0N A;  4X4N A;  4NKU A;  4I2D A;  4FS1 A;  5EWG A;  1XO1 A;  1HUO A;  5KT3 A;  4I2A A;  4EYI B;  4X4T A;  1K1S A;  4RPY A;  1KFT A;  5HRH A;  3G6X A;  2BHN A;  4EBD A;  5HNK A;  4I29 A;  4PHA A;  4Q8F A;  2HHS A;  1BPD A;  1A76 A;  4UB5 A;  3SV3 A;  2FLP A;  5DBB A;  2HHX A;  9ICI A;  2ZTD A;  7ICS A;  8ICX A;  4YD1 A;  3BQT A;  4QZE A;  2ASD A;  1Q79 A;  1EXN A;  3V7L A;  2PFN A;  4MFF A;  5DB6 A;  5L1J A;  5HP4 A;  5J0W A;  5F9L A;  4YR3 A;  3KHH A;  1NKC A;  4I2E A;  4ATB B;  4GLX A;  2XY6 A;  1WCN A;  1NK6 A;  4F8R A;  2BE3 A;  3RJK A;  5KT5 A;  3WFQ E;  1ZQW A;  5KG1 A;  1R8A A;  3HP6 A;  2ASL A;  4AT9 A;  5BOL A;  5KFM A;  5J2B A;  4TQR A;  8ICC A;  8ICZ A;  2ZH8 A;  4ECS A;  1COO A;  9ICL A;  4FH5 A;  5KFH A;  4F3O A;  5EWE A;  5EOZ A;  1UT5 A;  9ICH A;  2R8G A;  3AQK A;  4QWD A;  3RRH A;  4QZD A;  3PMN A;  4IR1 A;  1BNO A;  5KG4 A;  3PW7 A;  3TFR A;  4ECU A;  3UXP A;  4DL2 A;  1XSN A;  2HHV A;  3L9D A;  7ICM A;  1UET A;  2ZH9 A;  3WFS C;  1KLN A;  4FHX A;  4F4Y A;  4PGX A;  4ECY A;  2R8J A;  3RTV A;  5KFS A;  8ICR A;  3JPT A;  2AQ4 A;  2AGP A;  2LYH A;  1T8E A;  2W8L A;  1T4G A;  4MF8 A;  4FS2 A;  3M9M B;  4K4G A;  1LV5 A;  3JPS A;  5L1K A;  4X4S A;  2IBK A;  3PO4 A;  4F2R A;  4DL3 A;  1OU5 A;  3HWT A;  3JPN A;  3LWM A;  4MEX A;  8ICB A;  5DBA A;  3RB6 A;  3PV8 A;  4ECZ A;  3ISD A;  7ICI A;  2ZH7 A;  1C7Y A;  4AT7 A;  4KLM A;  3T5H A;  4C8N A;  4C8M A;  3FYH A;  5C5J A;  3IM1 A;  3ETL A;  9ICC A;  4RWQ A;  4GXI A;  3EYZ A;  5L1I A;  1NK9 A;  4DL4 A;  4JWN A;  1UT8 A;  3PW5 A;  1IM4 A;  1XSL A;  7ICE A;  2IHN A;  4RQ1 A;  4DSL A;  4HYK A;  4M47 A;  4M9G A;  4FHY A;  2UVW A;  2ZUD A;  4R66 A;  4DFP A;  4E7X A;  4Z6F A;  1RYS A;  4DL7 A;  1R8C A;  5J0O A;  4KIT B;  1NKB A;  3PR4 A;  3OVB A;  3B0Y A;  4EZ9 A;  9ICO A;  3SV4 A;  3RJE A;  4QZI A;  4RZR A;  3SYZ A;  2BCS A;  4NY8 A;  3H39 A;  2BGW A;  4QW9 A;  1NKE A;  3LQC B;  3T3F A;  2C2D A;  1XSP A;  4FHV A;  3V6J A;  1B22 A;  1ZQT A;  4F4K A;  4O3N A;  4KLQ A;  1ZQD A;  4F5P A;  2HVI A;  1VJ7 A;  1V4A A;  4ECQ A;  3RH5 A;  8ICI A;  1JAJ A;  2R8I A;  3RAQ A;  3PNC A;  2M9N A;  2M2W A;  1RYR A;  4RQ6 A;  4F93 B;  3C18 A;  5KFI A;  5JUM A;  4M0A A;  1BPX A;  1ZQJ A;  1U49 A;  5HRB A;  4F5R A;  5DQH A;  4PGQ A;  4QWB A;  1ZYQ A;  5HRF A;  7ICH A;  2I9G A;  1U4B A;  3MGI A;  4KN7 A;  4JV2 A;  3ISB A;  4EBK A;  9ICX A;  4XA5 A;  4J9K A;  4KLF A;  4X4R A;  1ZQV A;  1DOQ A;  5J29 A;  4DFJ A;  1BPY A;  4RWN A;  2HHW A;  2ALZ A;  1F5A A;  3T5J A;  5KT4 A;  4KLD A;  3QZ8 A;  4ED2 A;  3RH4 A;  1BNP A;  4FH3 A;  4X4V A;  4PPX A;  5IIK A;  3ZDB A;  3C1Z A;  4UBB A;  2VAN A;  4K4H A;  5HRD A;  2NRX A;  3HW8 A;  4LVS A;  1JIH A;  5III A;  2JEG A;  2IMW P;  7ICP A;  2ID1 A;  2IHM A;  4Z6D A;  4BDP A;  1S76 D;  4BGD A;  5HRE A;  4TUQ A;  1QSY A;  4K4I A;  2FPK A;  5DDM A;  4RNN A;  1XS9 D;  4RQ0 A;  4M6W B;  2W9C B;  3C5G A;  1QSL A;  4F2S A;  3EW9 A;  5IIJ A;  5IIL A;  1ZET A;  2DR5 A;  4ATB A;  1KTQ A;  2BCV A;  2ZHA A;  3OGU A;  4UB4 A;  1QSS A;  2FLL A;  1HJP A;  2FLN A;  5KT7 A;  7ICL A;  1SZP A;  4UB3 A;  3MFI A;  5KFE A;  1BPE A;  4MFA A;  3MR6 A;  3RH6 A;  2FMS A;  4RWO A;  3HPO A;  4Q44 A;  9ICU A;  3E2E A;  4QWA A;  3OVS A;  2KFN A;  3FDS A;  1ZQI A;  4E0D A;  9ICB A;  4QZA A;  3KHL A;  1S77 D;  5IIO A;  2XGP A;  3IHQ B;  5KFX A;  3MBY A;  3EPG A;  3RB0 A;  4BXO A;  4C8K A;  3QE9 Y;  5D46 A;  3RRG A;  5CP2 A;  4F4Z A;  3ZD9 A;  4ELT A;  3JPO A;  1LB2 B;  8ICW A;  1NO5 A;  2Y1J A;  1MIY A;  3JYY A;  1TFY A;  1BPB A;  3UPQ A;  3C5F A;  4GXJ A;  4DSF A;  4M9N A;  3B0X A;  4X4P A;  1MSW D;  1L3S A;  4I27 A;  3M9N B;  4TUS A;  4J9N A;  5D4B A;  9ICT A;  3OUY B;  4ECV A;  4DQS A;  4M9L A;  4DSE A;  3V7K A;  1JMS A;  4QZB A;  4QZG A;  2PI5 A;  2XC9 A;  5HHH A;  2XY5 A;  4IR9 A;  5HRG A;  1U47 A;  1L5U A;  4DS5 A;  2VA8 A;  4KLE A;  4ED3 A;  1BVS A;  4KLH A;  3AQN A;  4AT9 B;  8ICU A;  1RPL A;  4DF8 A;  1JN3 A;  1TK8 A;  4RNM A;  7ICO A;  3ISC A;  1U48 A;  1XC9 A;  1DK2 A;  1SL2 A;  2FPL A;  5DB8 A;  1ZQQ A;  4F5N A;  3C66 A;  5IIM A;  5HC9 A;  2FMP A;  1NOM A;  2NRW A;  4ED7 A;  5BPC A;  1ZQL A;  2VA3 A;  3H3A A;  4X4U A;  3NTU A;  2PFP A;  9ICS A;  4ZH4 A;  3ZD8 A;  5DB7 A;  2RFF A;  3GQC A;  2BCR A;  2XCP A;  4B9N A;  3EPI A;  5J2E A;  1U45 A;  1X9M A;  4YFK A;  2AQ0 A;  3QZ7 A;  4E8F A;  1Q78 A;  4C8L A;  5DB9 A;  2ZUC A;  5HML A;  2ASJ A;  4UD5 A;  3JPQ A;  3BJY A;  3Q8L A;  4EBC A;  2MUT B;  1KSP A;  8ICK A;  4X4Q A;  4KLT A;  4Q45 A;  4QW8 A;  4DQR A;  8ICG A;  4QZ8 A;  4KN4 A;  2C2E A;  1Z3E B;  4I2F A;  7ICF A;  9ICN A;  2PFO A;  3TAQ A;  9ICW A;  4X4O A;  3G6V A;  4RNO A;  1NK4 A;  4WC2 A;  2A1J B;  1IXR A;  2W9M A;  1X2I A;  4UBC A;  4EEY A;  4IQT A;  2PXI A;  1TK5 A;  3RB4 A;  4FHP A;  3BQ1 A;  4IRC A;  2Q66 A;  1Z00 B;  2XGQ A;  2KTQ A;  1ZQX A;  2C2R A;  1N56 A;  4MEY A;  5DG8 A;  2V4R A;  9ICJ A;  3RJJ A;  4NLN A;  4B9M A;  5DED A;  3Q8S B;  2JZB B;  1TKD A;  3PY8 A;  3PW0 A;  4DWI A;  1UA0 A;  9ICV A;  3LDA A;  3H38 A;  4FBT A;  2KP7 A;  4YR0 A;  3JPP A;  4EBE A;  3K4G A;  4J9P A;  4B9L A;  5HMM A;  3C1Y A;  3OV7 A;  1ZJM A;  4RT3 A;  3ORY A;  5J2A A;  4UAZ A;  4TUR A;  1NK0 A;  4IRK A;  4LZG A;  5L9X A;  4UAY A;  4IQW A;  2A1J A;  3OHB A;  2ISO A;  2BQU A;  1NJZ A;  5KFJ A;  8ICQ A;  1R89 A;  2DPI A;  5L1L A;  4RQ5 A;  2NRT A;  4RUA A;  1ZQK A;  1S0O A;  2VA2 A;  3H8S A;  2KZ3 A;  1WOT A;  3UXN A;  4QWE A;  5J2G A;  2PFQ A;  8ICT A;  1XU4 A;  3WFR E;  5DLG A;  4FO6 A;  5KFD A;  3Q8K A;  2C28 A;  1D9F A;  4WC7 A;  4KLL A;  1JQR A;  1ZQY A;  1UEU A;  1S10 A;  2UVU A;  4IQV A;  3Q8R B;  3N97 B;  5J0T A;  2HVH A;  4AT8 B;  3HIY A;  4JUZ A;  3OSN A;  4F91 B;  5HRL A;  4RT2 A;  4KLS A;  3JZ0 A;  4RQ8 A;  3TI0 A;  1KDH A;  4RPX A;  3V7J A;  4J9L A;  4DOC A;  4ED8 A;  3GV5 B;  1S0M A;  1WCL A;  3TFS A;  1UA1 A;  4B9T A;  4DLG A;  1JXE A;  3UQ2 A;  4NLZ A;  3K75 D;  3MR2 A;  2JEF A;  4P2H A;  2HHT A;  5J2K A;  5DEC A;  3BDP A;  4O5K A;  2ZJ5 A;  5J2C A;  3T5K A;  4RQ7 A;  5KG6 A;  4R65 A;  3RJH A;  4J9M A;  4DQQ A;  3C23 A;  3OSP A;  2KZM A;  5KG3 A;  2XY7 A;  4R8U A;  4R64 A;  1X9W A;  4KLO A;  4WC1 A;  5KFL A;  4MF2 A;  1NK5 A;  4DQP A;  2W9B B;  3TAP A;  2ZH5 A;  3T5L A;  2RDJ A;  3THV A;  4P4O A;  2JEI A;  1KNY A;  3QEA Z;  1TAQ A;  2PI4 A;  7ICU A;  4EP7 A;  4M9J A;  4XRH A;  2HHP A;  1ZQF A;  4NLG A;  4NXZ A;  4DS4 A;  1A77 A;  3MR5 A;  5KG0 A;  3QEB Z;  3LK9 A;  2DPJ A;  2J6S A;  4I2B A;  4NM1 A;  7ICN A;  4X0A A;  3BQ0 A;  5KFT A;  3Q8M A;  2ZH1 A;  4ECT A;  2GWS A;  4XQ7 A;  5J0Y A;  3RBE A;  5J0R A;  2ATL A;  3RJG A;  5KFP A;  3PO5 A;  5DQI A;  3Q8Q B;  4O5C A;  4DSI A;  3C2K A;  2KZZ A;  5TZV A;  4DLE A;  3AQM A;  2ZTC A;  3ZDA A;  1SL1 A;  2ISP A;  5J2D A;  3PW2 A;  2O5A A;  1FA0 A;  2DRB A;  2ZH3 A;  3AU6 A;  5KFB A;  1KFD A;  4KLJ A;  3AQL A;  2I1Q A;  3PW4 A;  8ICM A;  4F4W A;  2P6U A;  4EZ6 A;  8ICE A;  9ICQ A;  2BPG A;  4ED0 A;  1S97 A;  3H4D A;  4CCH A;  1Y88 A;  5DQG A;  4F50 A;  4O3S A;  3AU2 A;  3NGD A;  3G6Y A;  4UB2 A;  1NK8 A;  1T3N A;  3Q8P B;  4X5V A;  3ZDE A;  3HT3 A;  4C8O A;  2DVI A;  4M2Y A;  3MGH A;  4RU9 A;  1ZQA A;  2BCQ A;  5DGA A;  4YD2 A;  2W9C A;  4JV1 A;  3OUY A;  4DSJ A;  4O3O A;  4DQI A;  4E80 A;  4IG8 A;  3GIM A;  5IIN A;  2IA6 A;  4J9R A;  4I2C A;  1ZQH A;  3LWL A;  4I28 A;  1BGX T;  4WC5 A;  3HJ4 A;  3MR3 A;  1L3T A;  8ICP A;  4WC3 A;  4O5E A;  8ICJ A;  1Z00 A;  2MAX A;  3PVX A;  5J0P A;  4P4M A;  4GC7 A;  4KLG A;  5CA7 A;  5KFZ A;  3TAN A;  9ICR A;  3V6H A;  4TUP A;  5KFQ A;  3KHR A;  1NJX A;  1ZQC A;  2BPC A;  1TV9 A;  3OJS A;  4AT7 B;  1ZQS A;  4GC6 A;  4AT8 A;  3PX0 A;  5CR0 A;  1ZQZ A;  1KFS A;  8ICY A;  4GXK A;  1TVA A;  5CHG A;  2P66 A;  4UQG A;  5BOM A;  4BXO B;  5HRK A;  3WFP A;  2W9B A;  5J0Q A;  1T7P A;  2BDP A;  4QZC A;  5KFV A;  8ICA A;  4YXJ A;  4YQW A;  3GIL A;  3EZ5 A;  1MQ3 A;  2UVR A;  1N48 A;  8ICS A;  4RQ4 A;  5KFN A;  1QTM A;  2M2V A;  1NK7 A;  3H8W A;  5KFU A;  5KFF A;  4ED6 A;  2C22 A;  2BQR A;  1R8B A;  1TFR A;  4FHW A;  3KHG A;  4PHE A;  5J2I A;  3RJI A;  4KMU A;  5KG2 A;  4R8U B;  7ICV A;  5J2F A;  1MIW A;  1KRP A;  4IRD A;  2BCU A;  2V9W A;  5CJ7 A;  3OJU A;  2HHQ A;  4F5Q A;  5KG5 A;  3RJF A;  7ICJ A;  4O3P A;  2J6T A;  1D9D A;  1HUZ A;  4RQ3 A;  5J2H A;  4O9M A;  5DG9 A;  1XWL A;  4YR2 A;  4O3R A;  1H38 A;  4DFK A;  9ICP A;  1ARO P;  4WBY A;  1ZJN A;  4ECW A;  4NKT A;  5HRI A;  5KT2 A;  5J0U A;  3V6K A;  2HHU A;  1ZQM A;  3MAB A;  1RZT A;  2BQ3 A;  7ICT A;  4Z6C A;  4X0B A;  4NM2 A;  3AUO A;  3MDC A;  4F5O A;  9ICK A;  2NRZ A;  3PR5 B;  1UEV A;  5DGB A;  5KFO A;  5DKW A;  2Q0Z X;  3RR7 A;  4P4P A;  3TAR A;  4ED1 A;  4KTQ A;  4F4X A;  1QLN A;  4FBU A;  4R63 A;  4YXM A;  4WC6 A;  5KT6 A;  2KN7 A;  7ICG A;  4DL5 A;  2HW3 A;  2M2T A;  2PBE A;  2XO7 A;  1DGS A;  2Y1I A;  4YCX A;  5DG7 A;  4DF4 A;  4MFC A;  1D8Y A;  3RAX A;  4TQS A;  2MUT A;  4IQU A;  1SKW A;  4ECR A;  2R8K A;  5HHI A;  4ELV A;  3GV8 B;  4EYH B;  5F2V O;  4WBZ A;  1JXL A;  4YG2 A;  2JZB A;  4XQ8 A;  4WC0 A;  5CB1 A;  4JWM A;  2DR7 A;  2H5X A;  3GFK B;  4S3N A;  5DLF A;  5F9N A;  3GDX A;  4YMM A;  1BPZ A;  9ICE A;  4PHD A;  3BQ2 A;  1S0V A;  4ECX A;  1S9F A;  1ZQN A;  4DSK A;  5DDY A;  2ZH4 A;  4B9V A;  2RDI A;  4M5D A;  3NYB A;  4Q43 A;  1SKS A;  4B9U A;  5J2J A;  2ZTE A;  3C2M A;  1TK0 A;  4Q8E A;  2ZJA A;  8ICN A;  1DK3 A;  4I2I A;  2M2U A;  2NRV A;  2DRA A;  2R8H A;  4DEZ A;  9ICG A;  4YP3 A;  3KTQ A;  2AJQ A;  4YMO A;  4XUS A;  5CWR A;  2UVV A;  1MIV A;  1VFG A;  4YVZ A;  7ICK A;  2F1J A;  2ZUB A;  4I2J A;  2NRK A;  4M6W A;  4PHP A;  1SL0 A;  3PX4 A;  5HR9 A;  5KFC A;  3H37 A;  1PX5 A;  4O3Q A;  2B21 A;  1U9L A;  2FMQ A;  4M9H A;  1MC8 A;  3RB3 A;  5EWF A;  1ZQO A;  1CEZ A;  4UD4 A;  4WCW A;  1D8L A;  4BWM A;  2J6U A;  4ELU A;  4RQ2 A;  1X9S A;  2DFL A;  1NJW A;  3JPR A;  8ICV A;  4BWJ A;  4UB1 A;  3EWA A;  1L3V A;  4QWC A;  1YLQ A;  3UXO A;  2F1I A;  1SKR A;  3GIK A;  2AGQ A;  2ZJ8 A;  4JV0 A;  5KFA A;  2F1H A;  4J9S A;  1NZP A;  4PH5 A;  5J0S A;  2W8K A;  1PZN A;  3N4M B;  5J0X A;  2ZH2 A;  9ICA A;  4RUC A;  4YN4 A;  5D49 A;  3GV7 B;  4RWP A;  4DOA A;  4M04 A;  1ZQB A;  3HX0 A;  4Z6E A;  4DL6 A;  2BR0 A;  1L3U A;  2ZH6 A;  4YMN A;  4KLI A;  4G3I A;  3SI8 A;  4EBJ A;  4NLK A;  4QZF A;  1CUK A;  2XCA A;  2V4Q A;  3C2L A;  4J9O A;  8ICF A;  9ICM A;  2DR8 A;  5KFW A;  4RPZ A;  5KTQ A;  3M8S A;  3M9O B;  3ZDD A;  4LT6 A;  3C21 A;  3WFO A;  1B43 A;  2FPM A;  1ZQP A;  4I2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...