4MFAA

Structure of human dna polymerase beta complexed with nicked dna containing a mismatched template o6mg and incoming ttp
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
321
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of human DNA polymerase beta inserting bases opposite templating O6MG
rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 108
structure length 321
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mfaA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mfaA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mfaA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mfaA03
4R64A 1ZQCA 1RZTA 2KZZA 1NJZA 1HJPA 3ZD8A 3LWLA 2IBKA 3MFIA 4EZ6A 3Q8MA 3C5GA 8ICJA 9ICBA 2ZUBA 4DFKA 4C8MA 8ICQA 4QZ9A 1UT5A 5KFXA 2PFQA 4AT7B 3H7IA 5KFYA 4RNOA 2Y1IA 5KFOA 5KFNA 2ZJ5A 4ED0A 4KLUA 5J29A 1MC8A 1NKEA 5DBCA 2XCPA 2DR5A 1QSYA 5IIOA 1C7YA 4PHPA 2ZTEA 5BOLA 4DOCA 4KLLA 4JWNA 2VA2A 3RJEA 5DQIA 3JPTA 3OGUA 2UVWA 4F3OA 3JPQA 2BCUA 5IIJA 4J9NA 3JPSA 4EBEA 2Y1JA 4F8RA 4M9LA 3JPPA 2NRWA 4O3NA 3RH6A 4DSKA 4F2SA 4QZGA 4CCHA 5KFWA 3RRHA 1VJ7A 1UETA 4QW9A 3TAPA 1ZQMA 4QWBA 4UB2A 2FMPA 2A1JB 4QW8A 8ICNA 4FHPA 5KFZA 4UD4A 4WC1A 3OSPA 3HT3A 5KFTA 5KFBA 3AQNA 4YVZA 5BPCA 1KFSA 4KLMA 5KT2A 2FPMA 3Q8QB 2NRTA 1TV9A 1NK9A 1QTMA 3G6XA 3C2LA 5DB9A 2XO7A 9ICIA 3ORYA 8ICAA 1Y88A 1HUZA 4C8OA 4F4KA 4IQVA 7ICMA 1BNOA 1MIVA 1KTQA 1BPXA 1JMSA 1S76D 5KG1A 4IRKA 2PXIA 4J9OA 3Q8KA 1U48A 4F50A 4DL6A 2BE3A 1NKCA 4ZH4A 5J2AA 3QE9Y 4JK1A 5KG2A 5CJ7A 3GIIA 2BCRA 4YMMA 4XQ8A 1DK3A 4X4SA 3OVAA 4NKUA 1B22A 5EWGA 4TUSA 2XCAA 4Q44A 5IINA 3RB6A 1S10A 1NZPA 4WBZA 9ICMA 1QSLA 8ICSA 3ISDA 3RB0A 2KZMA 3V7KA 1BPDA 2M2UA 3QZ8A 3FDSA 4QWCA 5J0OA 3HJ1A 4KLFA 4DL2A 5CWRA 4KLSA 1TK8A 1ZQLA 1XO1A 3ZDCA 3OHBA 1BPBA 4F5OA 4GXKA 5J2IA 1YLQA 1ZQNA 8ICWA 5F2VO 4ATBA 4J9QA 1K1QA 2KZ3A 3BQTA 3HPOA 7ICNA 3MR5A 4J9SA 2M9NA 3C2MA 5J2BA 2BR0A 1S9FA 2VANA 1NO5A 4O3RA 4Q8EA 3RJIA 4RQ0A 4UQGA 4Q43A 1XSPA 8ICMA 5L1IA 4C8KA 2FPKA 3V7JA 2ZJ8A 8ICCA 3M9MB 5IIMA 3V72A 3PW0A 1V9PA 5J0TA 4PGYA 5IILA 4DL7A 4ELVA 4M2YA 1R8BA 3BQ1A 1L3SA 1D9FA 2W9CB 3OHAA 4DSIA 4P4OA 3M8SA 5KFPA 4J9PA 3N97B 1WOTA 4WC6A 2DR7A 1X9WA 2ZTCA 3EWAA 3K75D 3C5FA 5J0UA 4X5VA 1KRPA 4KLTA 5HMMA 5KT7A 4IR1A 7ICRA 4DL5A 5HC9A 2RDIA 2IHMA 8ICGA 1TKDA 3ZDDA 4AT8B 5KT5A 4Z6DA 1SKSA 4RQ5A 4O3QA 4I2AA 4KLOA 4O3PA 3ETLA 4QZDA 2NRZA 3TAQA 5HRGA 2UVRA 4NM2A 4DF8A 4EYHB 3LDAA 4PGXA 1MQ3A 4MFFA 2BQUA 4FS1A 1L5UA 1ZQRA 4PH5A 4YG2A 1TAQA 4O3OA 4QZEA 2ZHAA 2B21A 2KTQA 5L9XA 1S77D 1MSWD 3C18A 4I2HA 4BDPA 5HRLA 1A77A 4AT9A 1U47A 2I1QA 2MUTB 3OSNA 3Q8PB 4YXMA 4R8UB 1ZQOA 1ZQPA 4QZ8A 3RRGA 2ID1A 3V6KA 3RJGA 2F1JA 3GV5B 7ICFA 1XS9D 1F5AA 2BDPA 2R8JA 5CB1A 4YXJA 4UAWA 4C8LA 2KFNA 1Q78A 4EBKA 4RWPA 4WC7A 2W9BB 4ED7A 3UQ0A 3UXOA 5KG0A 2ISPA 7ICIA 1R89A 8ICVA 4JV2A 4F5RA 8ICIA 4NKTA 4YQWA 4M9NA 3MR3A 2RFFA 2C22A 4IQUA 2V4QA 4DL3A 3C21A 5DB6A 2ZH5A 5J2CA 1ZQAA 5KT4A 2PFOA 4X4OA 3PO5A 2HHSA 2AJQA 4X4NA 4E8FA 5KFUA 1SZPA 4WC3A 3T3FA 4PHDA 1RYSA 2HVHA 5J0QA 7ICEA 5KT6A 2XY7A 1T8EA 1D9DA 1KLNA 5IIIA 3SV3A 2UVVA 3PNCA 3BDPA 3TQ1A 4M47A 4KTQA 3MABA 3GIKA 4NXZA 1TFRA 3THVA 1TK5A 7ICGA 4YMNA 1R8AA 4DS5A 4WC5A 3EW9A 4RQ4A 1S97A 3LWMA 1VFGA 1ZQYA 4KLQA 5HMLA 3B0YA 4FH3A 7ICSA 1LV5A 4X4QA 4B9VA 1JAJA 2JZBB 3GV7B 1T7PA 3RJFA 1BVSA 4KLJA 1KEJA 2RDJA 3TANA 3UPSA 4X4PA 4J9MA 4I2DA 3EPIA 4DLGA 2KN7A 3OJSA 5KFHA 3RAQA 8ICEA 3GIMA 1SL1A 9ICPA 2XC9A 4RQ6A 4KLDA 1PZNA 3H3AA 3N4MB 5KFJA 1UA0A 1NK4A 1ZQKA 2F1IA 3M9OB 1BPZA 2BQ3A 4BWJA 4I2IA 3HX0A 2AGQA 3H39A 4TURA 3FYHA 4P4PA 4O5CA 8ICUA 5KFQA 1UEUA 3IM1A 3QEBZ 4RZRA 9ICAA 2P66A 5HRHA 4LZDA 5J2EA 3KHGA 8ICPA 4QZBA 4KN7A 3HP6A 1WCNA 1ZQXA 2NRXA 4F91B 3V6HA 4O5EA 8ICTA 2UVUA 3RR8A 4IR9A 7ICLA 3RR7A 4B9UA 1RPLA 1ZJNA 2AGPA 4RQ7A 1T3NA 1ZQBA 4RQ1A 5KG3A 4DO9A 7ICJA 3LQCB 1R8CA 2NRKA 1XSLA 3OV7A 1SKRA 2Q0ZX 5KG5A 4RWQA 3C2KA 1XWLA 4Z6EA 4RQ8A 4BXOA 1Z00A 3MDAA 2HHWA 2W8KA 2J6SA 1DK2A 5HRIA 4M6WB 1X2IA 3KHLA 5L1LA 1ZQHA 2J6UA 4ED1A 4FBTA 2M2TA 3C1ZA 4YP3A 5J2JA 4YR2A 3HW8A 3C1YA 3HWTA 1SKWA 3AUOA 4O0IA 4RU9A 2W9AA 1NOMA 1H38A 2VA3A 4ECVA 3PW2A 4ELTA 4ECQA 3Q8LA 2ZHBA 3AU6A 7ICUA 1XSNA 2DR9A 1T4GA 2O5AA 4B9LA 4I2GA 7ICQA 4RPXA 4RWNA 1DGSA 2HHXA 4DQIA 2W8LA 5DB7A 4KLIA 2AQ4A 3T5LA 3TFRA 2ASDA 3H37A 4QWEA 3OUYA 1NKBA 2KP7A 4EEYA 3KHHA 1WCLA 4K4GA 4JUZA 1PX5A 2ZUCA 1ZQFA 9ICHA 1N48A 3GIJA 4F4WA 5KFCA 3PR5B 3MDCA 2JEJA 2R8GA 4IG8A 3TARA 5KFDA 2P6UA 2ZTDA 1NJWA 4YD1A 3H4BA 4ED3A 3SI8A 4I28A 4Z6CA 4JV1A 4EP7A 4MEYA 2W9MA 3PMNA 3JPOA 3GV8B 4DLEA 5J0WA 3RB4A 2C28A 4I2CA 1JIHA 7ICHA 9ICGA 1EXNA 3RH4A 4B9NA 2ZUDA 4DFPA 3UXPA 4PGQA 2FMSA 4KN4A 5HP4A 4EYIB 2HHUA 4GC7A 5KFMA 4P2HA 2FLLA 3MGHA 1JXEA 3MR6A 1NJYA 4JWMA 5HRDA 2XY5A 2ATLA 3PV8A 2VA8A 1X9SA 5HR9A 3M9NB 2JEFA 9ICWA 3H4DA 1Q79A 5DQHA 5J0RA 3UPQA 9ICSA 5KFRA 3WFPA 2LYHA 2ZH3A 1S0NA 5KG7A 1JX4A 5CA7A 2ZH1A 5HNKA 4DWIA 4FHYA 4F5NA 4J9KA 3PVXA 4ELUA 3JYYA 4MEXA 5DECA 4F93B 4DSJA 4RNNA 2DRBA 4IQTA 4FO6A 4F5PA 3HJ4A 4DOAA 5CR0A 5DDMA 4DS4A 2FLPA 4AT7A 4ECUA 8ICBA 4RWOA 3H8JA 5HHHA 1FA0A 1A76A 4DQSA 1MQ2A 5KTQA 4I2BA 3IHQB 4MFCA 2R8HA 1CEZA 8ICKA 4FHVA 4ATBB 4O5KA 3NTUA 4KLHA 4E7XA 4I2JA 4YCXA 3JPRA 2BCVA 1D8LA 4RPZA 2ALZA 1UA1A 4J9RA 3UQ2A 1XU4A 4UBBA 3TI0A 5J0YA 3RJKA 3ZDEA 4ED6A 4RT3A 4XA5A 1D8YA 1U45A 3MR2A 1B43A 3B0XA 8ICRA 4EBDA 2ZJAA 4TQSA 2WTFA 1KFDA 3PW7A 4TUPA 1X9MA 1SL0A 3GILA 4M9JA 2HHTA 3OVSA 4WC4A 2C2EA 1NK6A 2BPCA 4M9GA 4M04A 2A1JA 9ICCA 4M0AA 5J0XA 2MAXA 2NRVA 5L1KA 4I2EA 3QEAZ 2BKEA 9ICOA 4FH5A 2KFZA 4G3IA 4WBYA 5F9LA 1ZQGA 1SL2A 2ZH6A 2ISOA 1BPEA 4ECZA 8ICXA 1S0MA 4FHWA 3PMLA 4FS2A 5CP2A 4WCWA 1TFYA 2C2DA 3PY8A 3RB3A 3V6JA 2FLNA 3WFRE 3ISBA 1OU5A 2DPIA 4LVSA 5DBBA 4RQ3A 1Z3EB 4ECRA 8ICYA 4KLEA 9ICJA 4UB1A 3QZ7A 4X4RA 1ZQDA 4F4XA 1NK0A 7ICKA 3EZ5A 5EOZA 4X4UA 2ZH9A 5DGAA 4QZCA 5KFFA 3AQLA 4AT9B 2IMWP 3KTQA 5KT3A 5DGBA 4IRDA 9ICRA 3V7LA 3RBDA 5L1JA 4LT6A 4F2RA 3G6YA 1QSSA 1K1SA 4PHAA 4LZGA 4GXJA 5DQGA 5DG9A 2PBEA 4Z6FA 5J0SA 3MFHA 1ZQEA 2I9GA 4XUSA 2PI5A 4X4VA 4I2FA 1UEVA 4RUAA 2BCSA 2H5XA 3Q8SB 1MIWA 2O1PA 1MIYA 4KMUA 5D46A 4NLKA 3C66A 4M5DA 5BOMA 2XY6A 4B9TA 2J6TA 4DFJA 4QZIA 4DF4A 8ICZA 3M8RA 4UAZA 5JUMA 4QWDA 4DL4A 4FHXA 2ZH8A 4UB4A 2HW3A 4ECTA 4YMOA 2BHNA 4R65A 3GQCA 5KFSA 1ZQQA 2HHVA 3H40A 1LB2B 5KFKA 3K4GA 2XGQA 3ZDBA 2W9CA 3OVBA 4WC0A 5DG8A 1L3TA 4DSLA 3EYZA 4YR3A 9ICNA 4YFKA 3JZ0A 3T5KA 3EPGA 1U9LA 1IXRA 3SZ2A 4UB5A 2BCQA 2PFPA 4MF2A 5DBAA 9ICLA 1KNYA 1RYRA 1RXVA 3OJUA 4X0BA 4QZAA 4GC6A 4AT8A 1ZYQA 4UBCA 2BPFA 5EWFA 2HHPA 3H8WA 2DFLA 9ICEA 3RBEA 7ICVA 2M2VA 3WFSC 9ICKA 3KHRA 2DR8A 2BPGA 8ICHA 2ASLA 1L3VA 1KSPA 5KFLA 1BNPA 4IRCA 2BQRA 3H38A 1S0OA 4C8NA 3ISCA 2HHQA 5HHIA 2ASJA 5DEDA 2FPLA 1COOA 5J2KA 3Q8RB 1NJXA 2MUTA 4QWAA 3UXNA 8ICOA 7ICPA 5HREA 5J0PA 4FBUA 5C5JA 4R8UA 4YD2A 3L9DA 3SV4A 1NK8A 5IIKA 5DDYA 3PW4A 4F4ZA 1TK0A 1IM4A 2P6RA 4R63A 4ECWA 5DG7A 9ICVA 1TVAA 1N56A 3NYBA 4EBJA 4MFAA 5EWEA 2XGPA 5J2FA 1RXWA 4M9HA 2AQ0A 2W9BA 1HUOA 4GXIA 5HRKA 4X0AA 4DEZA 1ZQWA 4MF8A 4NM1A 5KFVA 4K4IA 4NLZA 4DQQA 1U4BA 3SYZA 2JEGA 4I29A 4WC2A 4F5QA 3H8SA 5KFIA 5J2DA 4RPYA 1JQRA 5CHGA 5J2GA 3AQKA 3WFOA 7ICTA 3TFSA 5D49A 4DOBA 4EZ9A 2Q66A 2V4RA 4PHEA 9ICXA 4YR0A 2GWSA 4PPXA 5KFGA 3RAXA 3PO4A 4RT2A 4BXOB 5D4BA 1Z00B 4KITB 3AU2A 4RUCA 4RNMA 1NK7A 3WFQE 3LK9A 2JEIA 3RJHA 4NY8A 4J9LA 4E0DA 4XQ7A 4ED8A 1KDHA 1ZETA 2IHNA 1ZQJA 1ZQSA 4K4HA 4QZHA 1L3UA 4QZFA 3BQ0A 2BGWA 2PI4A 4ECYA 1ZQZA 4XRHA 1V4AA 3C23A 5DLGA 4O3SA 4E80A 1ZQIA 4GLXA 4NLGA 1JXLA 1ZQTA 1UT8A 2R8IA 3ZD9A 4S3NA 4X4TA 2JZBA 4F92B 2DVIA 1ZQVA 4BGDA 2V9WA 4DQPA 3RJJA 2DRAA 1BGXT 4TQRA 3T5HA 3PX4A 3OUYB 2ZH7A 2DPJA 3T5JA 1BPYA 1S0VA 3ZDAA 3HIYA 4R66A 9ICQA 3BQ2A 5J2HA 4BWMA 1ZQUA 5TZVA 3GFKB 3JPNA 2ZH4A 2AGOA 1XC9A 4ECXA 3PX6A 1CUKA 2F1HA 5F9NA 5KG6A 4O9MA 4UD5A 4DQRA 4IQWA 4ED2A 1JN3A 2HVIA 7ICOA 8ICLA 4EBCA 9ICFA 4HYKA 4TUQA 3G6VA 1DOQA 4P4MA 2AU0A 4I27A 3GDXA 4ECSA 5DB8A 2IA6A 4UAYA 1NK5A 4B9SA 1TAUA 2ZH2A 2OWOA 5HRBA 5KG4A 8ICFA 5KFEA 3NGDA 2FMQA 3PW5A 5HRFA 4YN4A 4NLNA 4DSFA 2PFNA 3RH5A 5KFAA 3MGIA 1AROP 5DLFA 2C2RA 4DSEA 3MBYA 1U49A 4KLGA 9ICTA 5DKWA 1KFTA 3PR4A 4Q8FA 4DFMA 3RTVA 1TFWA 3PX0A 3BJYA 4F4YA 9ICUA 2M2WA 1QLNA 2R8KA 4RQ2A 4B9MA 1ZJMA 4M6WA 4JV0A 3E2EA 4Q45A 3AQMA 4UB3A
chains in the Genus database with same CATH superfamily
4CF5A 3LWLA 2IBKA 3MFIA 4DFKA 1UT5A 2PFQA 1M6YA 4RNOA 2OHFA 2Y1IA 1NKEA 2XCPA 1FIQA 2KKVA 4JWNA 1FO4A 3RJEA 2UVWA 1B4FA 3JPTA 4F3OA 2BCUA 1TAMA 4M9LA 4DSKA 2NRWA 5H2FU 1LVHA 4UB2A 4NJ8A 8ICNA 5KFZA 4Y2JA 4C0ZA 3TKAA 2AHOB 1QTMA 5HR6A 1BNOA 1Y88A 2I5HA 4F4KA 1MIVA 4GIBA 1COKA 1JMSA 1SB3C 2Q4TA 1NKCA 4ZH4A 2BCRA 2DBYA 2XCAA 4Q44A 5IINA 1NZPA 3RB6A 1S10A 4WBZA 9ICMA 3RB0A 3RF9A 4KLFA 4O6AA 5CWRA 1V85A 2CPRA 1TK8A 1XO1A 1ZQLA 4WQKA 3OHBA 1BPBA 4F5OA 4GXKA 5J2IA 1ZQNA 4PL2A 2KZ3A 3BQTA 1L8LA 2M9NA 3C2MA 5J2BA 1RG6A 4Q8EA 3RJIA 8ICMA 5L1IA 3QU2A 1ZQ1C 5IIMA 3PW0A 1V9PA 5J0TA 4PGYA 4X4TA 2YMPA 1L3SA 5KFPA 4J9PA 2YMMA 3N97B 2XICA 4WC6A 3QXGA 2ZTCA 4X5VA 5J0UA 1Q46A 8ICGA 5ALXA 2KG5A 1SKSA 4KX5A 4C4RA 4O3PA 3TAQA 2ZIWB 1MQ3A 4FS1A 1L5UA 1ZQRA 4PH5A 2ZHAA 2KTQA 1MSWD 2WHEA 4EEBA 1O08A 4BDPA 4I2HA 2QB0B 3K7DA 1K5OA 4J03A 4YXMA 1ZQPA 4QZ8A 3RRGA 3F2BA 4ZOHC 1J2NA 7ICFA 2BDPA 5EE9A 5CB1A 4C8LA 1KW4A 4WC7A 4ED7A 4HAIA 3UQ0A 5KG0A 2ISPA 1R89A 2KSOA 4LEVA 4NKTA 1WWVA 8ICIA 4PL1A 1Z19A 1ECWA 2V4QA 5DB6A 4X4NA 5ALOA 4NLCA 1SZPA 1KLNA 5CRXA 2KIWA 4M47A 2G06A 1A6SA 1TK5A 1TFRA 1R8AA 3N28A 1S97A 3B0YA 4B9VA 2A3VA 1T7PA 1BVSA 3TANA 3UPSA 4J9MA 4B6JA 4EGWA 9ICPA 2XC9A 4RQ6A 4UB6U 4JLZA 3N4MB 3QYPA 1ZQKA 4OAFA 2F1IA 3M9OB 4BWJA 2AGQA 1L8OA 4C80A 4TURA 3QEBZ 5HRHA 5J2EA 4QZBA 4IR9A 3UM9A 2OYYA 7ICLA 3RR7A 1ZJNA 3LQCB 5AKEA 4F72A 1R8CA 2NRKA 1SWWA 2W04A 3KOOA 4RWQA 1XWLA 2FI1A 1Z00A 2KHVA 2LKYA 2HHWA 3UMCA 2J6SA 5HRIA 4M6WB 1JI7A 3D2SA 2XI9A 4ED1A 4FBTA 4Y2VA 3CP8A 4O0IA 2W9AA 2H3VA 1PUZA 1X6JA 2YB4A 2E8MA 2NO4A 4RWNA 2W8LA 2DQNB 3TFRA 1PK3A 4IC9A 2KP7A 1WCLA 4K4GA 5D61A 9ICHA 3SMVA 1SXDA 1V97A 2P6UA 2QB1A 3UMBA 4YD1A 5ALMA 4I28A 5AKLA 3JPOA 1ZXIA 3RB4A 4BUGA 1KL9A 3U26A 1VDVA 2EZYA 3RH4A 1T94A 2ZUDA 3FAHA 2FMSA 5HP4A 2HHUA 3KZIU 3MGHA 1JXEA 4JWMA 2XY5A 2HCFA 5HR9A 2GH1A 5J0RA 9ICSA 1JX4A 5ALVA 4DWIA 4F5NA 4ELUA 4OO1J 1JALA 4Y2TA 1XO0A 3OPXA 2WF6A 4C7YA 4F5PA 2DKZA 1NZBA 5DDMA 4Y2RA 3R9KA 1MQ2A 4O5KA 3NTUA 4I2JA 3JPRA 2EDUA 4UBBA 3RJKA 4ED6A 1D8YA 1B43A 5KL8B 1SIJA 2ZJAA 4TQSA 4WQLA 1KFDA 1X9MA 3OVSA 4IL6U 1NK6A 4M9GA 4M0AA 3QEAZ 3RFAA 4G3IA 4O3MA 5F9LA 1SL2A 2ISOA 1BPEA 2JV3A 3PMLA 4FS2A 2ESEA 3ISBA 1F0MA 2Y9TA 4F71A 1Z3EB 4LEWA 4ECRA 2QARB 4FZMA 5EOZA 3SR6A 4AT9B 2IMWP 4FO1A 5DGBA 3CK6A 4FE3A 2BZFA 2KHQA 4F2RA 1K1SA 2YB1A 2K8AA 4MHVA 1OXJA 2I9GA 2BCSA 4KM5A 2XY6A 4DFJA 2B56A 5C0YA 2K89A 3M8RA 5KFSA 2JR5A 3OVBA 1L3TA 1NI3A 3T5KA 3EPGA 1U9LA 1KNYA 5JU5A 5DBAA 9ICLA 4X0BA 2E8NA 1N61A 3IDWA 2HHPA 2HN2A 3WFSC 4BJQA 9ICKA 5ALGA 3KHRA 3IN5A 2DR8A 1KSPA 5KFLA 2BQRA 3IG8A 3GZFA 2HOIA 1NJXA 8ICOA 5HREA 4QWAA 3UXNA 1TK0A 4F4ZA 2P6RA 1IM4A 4ECWA 1N56A 2KVSA 5J2FA 1RXWA 2BBJA 2AQ0A 2W9BA 4GXIA 3AQEA 2K4PA 3EUB2 4NM1A 5KFVA 4DQQA 2ZIXB 3SYZA 1U4BA 2LI6A 3NS1A 3H8SA 3NUQA 5J2GA 3AQKA 3WFOA 5AKHA 2Q66A 3ALRA 3RAXA 3PO4A 3KKAC 4RT2A 4KITB 4RUCA 1NK7A 3LK9A 3RJHA 2K4HA 1KDHA 3KFUF 5AI9A 3SQIA 1QH9A 1ZQSA 4NLBA 4QZHA 4UASA 2PI4A 1QQ5A 3L3FX 1YZ7A 5DLGA 4E80A 4GLXA 4K99A 1UT8A 2A19A 2V9WA 1LKYB 3RJJA 1SV0C 4TQRA 3T5HA 3PX4A 2ZH7A 3T5JA 1S0VA 2Y0SF 1FFVA 5TZVA 2AGOA 3PX6A 1N63A 4OJOA 2HVIA 3SENA 3QU7A 1TAUA 2YN4A 2FMQA 4YN4A 4DSFA 5G5GA 3RH5A 5KFAA 5DLFA 4KLGA 5DKWA 1Z4NA 4F4YA 2RQ5A 4RQ2A 2DKXA 1ZJMA 5G5HA 2W54A 3E2EA 3WK8A 4R64A 1RZTA 2IHOA 1NJZA 3C5GA 2ZUBA 4QZ9A 2XIDA 4AT7B 2WB1F 5KFYA 5J29A 2DR5A 2DWQA 2VA2A 3JPQA 5IIJA 2Y1JA 3RH6A 4F2SA 4CCHA 2ZG6A 3RRHA 4QW9A 4QWBA 2A1JB 2BDUA 3MGVA 3FC4A 5KFBA 4YVZA 5BPCA 3DV9A 2ZIXA 3PSFA 1KFSA 4KLMA 2JXJA 5KT2A 3Q8QB 5ALRA 1TV9A 3G6XA 5A0LA 2XO7A 3ORYA 1N62A 4C8OA 1HUZA 4WCWA 4IQVA 1BPXA 1S76D 3Q8KA 4F50A 3QE9Y 4JK1A 5CJ7A 3OVAA 5AI6A 4TUSA 2MSNA 3GU3A 2KZMA 3NASA 3QZ8A 3FDSA 3ONNA 2MU2A 4AYBC 4KLSA 3M6KA 1YLQA 5F2VO 1K1QA 3HPOA 4J9SA 2BR0A 1S9FA 4UW9A 4Q43A 4WH5A 4NXXA 2FPKA 3V7JA 8ICCA 3M9MB 1R8BA 5IILA 4DL7A 4ELVA 2XVTA 1D9FA 3QU4A 2W9CB 2QKQA 3OHAA 4DSIA 2DR7A 2Y0SC 4UATA 5AIAA 5HC9A 5HMMA 2KJ5A 4IR1A 2IHMA 3ZDDA 5KT5A 4Z6DA 4RQ5A 4O3QA 3ETLA 5HRGA 2NRZA 2UVRA 3BZKA 4PGXA 5L9XA 1FFUA 1RM6C 2I1QA 2MUTB 3N7RC 4CE6A 1ZQOA 2ID1A 3V6KA 3RJGA 1F5SA 3GV5B 3IV6A 5AKXA 2R8JA 2IOFK 4YXJA 4UAWA 4EX7A 5ALJA 2EAPA 4EBKA 3UXOA 4GFJA 4UB8U 2C22A 5KAIU 4DL3A 2ZH5A 5J2CA 5CFUA 5B3QA 2HHSA 2WF5A 4EENA 3L4PA 5KFUA 4E8FA 3T3FA 1GO3F 1RYSA 7ICEA 2KOBA 2LMRA 3ETRA 1WUDA 2HSZA 5IIIA 3PNCA 3AQFA 3HJEA 4YMNA 4DS5A 3EW9A 1VFGA 1ZRMA 2OM6A 1ZQYA 5HMLA 7ICSA 2JZBB 2KN7A 1SL1A 4JMUA 1RYUA 1PZNA 3PSPA 1ZD4A 5CFTA 2ZIVA 1UA0A 1NK4A 2VJ5A 4I2IA 3HX0A 4LZDA 4O5EA 1ZQXA 4F91B 3V6HA 8ICTA 2B51A 3I76A 2UVUA 1L7MA 2AGPA 1T3NA 2HDOA 1ZQBA 4RQ1A 1SZHA 1OW5A 3IP4B 3OV7A 1S8OA 2Q0ZX 3C2KA 2FJ6A 2NYVA 1Q3VA 3MDAA 2W8KA 4OJPA 1DK2A 1X2IA 3KHLA 3NRWA 2CXYA 4YP3A 3HW8A 4YR2A 5ALNA 3KD3A 3AUOA 4RU9A 1NOMA 2D8CA 2ZHBA 2DR9A 7ICQA 4RPXA 1DGSA 2HHXA 4DQIA 3WKCA 2AQ4A 2ASDA 2JHDA 1NKBA 4EEYA 3KHHA 1N48A 3GIJA 3QNMA 2JEJA 2B6GA 3TARA 1L6NA 4XJEA 2W7PA 2W9MA 4DLEA 3PMNA 2ZIUB 9ICGA 4PGQA 2W3SA 2LYAA 4EYIB 4GC7A 4QJFB 4MKPA 5KFMA 5HRDA 2ATLA 1MA7A 3PV8A 9ICWA 3H4DA 1Q79A 5T14A 5HNKA 3L5KA 3H0MB 2HI0A 3JYYA 4CNQA 4MEXA 5JRTA 2DRBA 4IQTA 4FO6A 2LM1A 2H3FA 5EE3A 4OCZA 4DS4A 2DL0A 4RWOA 5HHHA 4I2BA 4MFCA 4FHVA 4ATBB 2R8HA 3NVZA 2GLEA 4E7XA 3QU5A 4RPZA 5AICA 2ALZA 1UA1A 4J9RA 3UQ2A 1XU4A 3ZDEA 2WF9A 1U45A 2WTFA 4M9JA 1Q8KA 3GILA 4M04A 4K98A 2W43A 2MAXA 2NRVA 3FM9A 5L1KA 9ICOA 4FH5A 2KFZA 5ALLA 3BS5B 5AI8A 4PZNA 5AM0A 2ZH6A 2EAMA 4FHWA 5CP2A 3RB3A 3V6JA 2FLNA 2DPIA 4LVSA 3HRDD 1IIPA 4HX0A 4KLEA 1ZQDA 4F4XA 5B5EU 5ALTA 2JGAA 2ZH9A 5DGAA 5KFFA 4X4UA 4IRDA 4LJXA 3V7LA 4NXWA 3G6YA 1QSSA 4OJ5A 5DQGA 4Z6FA 3WKDA 3MFHA 5J0SA 4X4VA 3A0HU 4RUAA 4M5DA 4B9TA 2J6TA 8ICZA 1L7NA 5JUMA 1J97A 3HKZC 4ECTA 2ES6A 5AM4A 5HR7A 1LB2B 2XGQA 3ERCC 2K8CB 1SV4A 4WC0A 3OWGA 9ICNA 4YFKA 2BCQA 3SZ2A 2PFPA 4QZAA 2K4IA 1QQ7A 3QX7A 3KKAA 1ZYQA 5AM5A 5EWFA 2E8OA 3H8WA 2ZIWA 2DFLA 3RBEA 2M2VA 5ALQA 4FZLA 3I1YA 3H38A 2H3QA 4IRCA 1S0OA 3ISCA 2HHQA 5HHIA 1ED1A 4OJLA 2QB0A 3NVWA 3CRXA 2K4EA 1O03A 3K1ZA 5DDYA 2HN1A 3WK7A 4R63A 1SV0A 4M9HA 5EWEA 2XGPA 1HUOA 5ALSA 2G09A 1ZQWA 1N2XA 4NLZA 4F5QA 3N7SC 4EZ9A 2V4RA 4PPXA 4BXOB 5D4BA 2LPEA 3WFQE 3WK9A 2E8PA 4J9LA 2YMQA 4ED8A 4XQ7A 1ZETA 2IHNA 1ZQJA 2BGWA 2DF4B 3H8MA 4ECYA 1ZQZA 1X66A 4Y2UA 3BS5A 4NLGA 1ZQTA 3ZD9A 4BGDA 3OUYB 1BPYA 2NO5A 2YX8A 2R18A 1DXSA 3WU2U 9ICQA 3HIYA 3GFKB 2ZH4A 1XC9A 4ECXA 4O9MA 1IG6A 5KG6A 4QIWC 4IQWA 1JN3A 7ICOA 4JB3A 4EBCA 4HYKA 4TUQA 3G6VA 4I27A 4P4MA 9ICFA 3GDXA 3QU9A 2IA6A 2ZH2A 4BX9C 5KG4A 2KVCA 2HBKA 5KFEA 5HRFA 1AROP 1U49A 4DSEA 4DCCA 3MBYA 9ICTA 1KFTA 4Q8FA 3A0BU 9ICUA 2M2WA 4IS7A 4B9MA 4NXTA 1GPJA 4M6WA 4JV0A 4C7ZA 4UB3A 2KZZA 3AEVA 1HJPA 1RQLA 3Q8MA 3ZI4A 3DDHA 2Z7JA 4C8MA 5KFXA 2H3ZA 4A8EA 5KFOA 5KFNA 2ZJ5A 5DBCA 4ICAA 1QSYA 4QNLA 1C7YA 4PHPA 5BOLA 4DOCA 2HOQA 5DQIA 5GTIU 2G07A 2W11A 1KKXA 4J9NA 3JPSA 4F8RA 3JPPA 4O3NA 2B0CA 1YZ6A 4QZGA 4FZNA 3IG5A 3TAPA 2FMPA 4FHPA 2OCEA 2AH5A 4UD4A 4WC1A 3OSPA 5KFTA 3AQNA 4K8VA 3CYMA 4O69A 2FPMA 2LBOA 2NRTA 1NK9A 2YQEA 2KEYA 3C2LA 2E5SA 1Z1BA 7ICMA 3NWIA 1KTQA 3WKBA 5KG1A 4DL6A 2BE3A 2WAQF 5J2AA 4X4SA 1QSLA 8ICSA 3V7KA 3S6JA 4QWCA 3HJ1A 5ALFA 4DL2A 5AKJA 3AMZA 2VKQA 8ICWA 2E3TA 7ICNA 1NO5A 4UARA 4P0PB 4UQGA 1XSPA 1YT3A 1JUDA 3V72A 4AYBF 5ALUA 5CHEA 4M2YA 2IOHA 1L7OA 2WF8A 1WOTA 2M0NA 4RQNA 7ICKA 1DGJA 1KRPA 4KLTA 4DL5A 2QLTA 1UHUA 1PVQA 4AT8B 1KN5A 2O6KA 4KB6A 5ALKA 4EYHB 4MFFA 2BQUA 2OEHA 4YG2A 4O3OA 2QARA 5CEHA 3DEEA 3C18A 1S77D 4AT9A 1U47A 3OSNA 3Q8PB 4R8UB 2F1JA 5ALZA 1F5AA 2KFNA 4NV0A 8ICVA 4F5RA 4U6PA 2RFFA 4IQUA 2GOLA 1ZQAA 4X4OA 2AJQA 1X6IA 1X40A 4PHDA 5J0QA 1D9DA 2IUBA 3SV3A 2KICA 3BDPA 4JLXA 4KTQA 1FEZA 1TE2A 3GIKA 4NXZA 4RQ4A 3LWMA 5E79U 4FH3A 1LV5A 5AKYA 1JAJA 3GV7B 3AL0B 3EPIA 4DLGA 3OJSA 5KFHA 3GIMA 3F53A 5KFJA 3ER9B 2G0AA 2KIVA 1BPZA 1VJ5A 2HOFA 4O67A 2WF7A 4P4PA 8ICUA 1PK1B 5KFQA 2P66A 4C4TA 4FFDA 2EANA 3KHGA 8ICPA 2WAQC 4KN7A 1WCNA 3HP6A 3LVVA 1N5XA 1QQ6A 4B9UA 1RPLA 4OAHA 2F44A 4DO9A 7ICJA 1L7PA 3LVWA 5AKKA 1AQ6A 3LYSA 1SKRA 5KG5A 3M7DA 4RQ8A 1ZQHA 2J6UA 5L1LA 3C1ZA 5J2JA 2VA3A 4ELTA 4ECVA 3Q8LA 1T4GA 2O5AA 2KJ9A 4B9LA 3CNHA 1LKYA 1JROA 5DB7A 2YTUA 3T5LA 2GO7A 4JUZA 2ZUCA 3PR5B 2R8GA 1N5WA 2ZTDA 2KD1A 2KJ8A 3NVOA 3SI8A 4Z6CA 3QUTA 2C28A 5AKZA 1JIHA 1WG8A 1ZD5A 4DFPA 3UXPA 2PMZC 5D63A 4P2HA 2FLLA 1ZD3A 1NJYA 3M9NB 5DQHA 5KFRA 3WFPA 5CA7A 2ZH1A 1URJA 5AI4A 4FHYA 5DECA 2F77X 5D62A 4RNNA 2JH1A 3HJ4A 2HBLA 4AT7A 4X4PA 4ECUA 8ICBA 3AM9A 4Y2PA 1A76A 1CEZA 5KTQA 4NL9C 3QUQA 1P7DA 4KLHA 2BCVA 1HIWA 2WFAA 2MA1A 2W03A 4UAUA 3TI0A 5J0YA 4XA5A 4Y2QA 3MR2A 8ICRA 4OAIZ 4EBDA 4KMOB 4TUPA 4WC4A 4CF4A 2A1JA 9ICCA 2Y9UA 4I2EA 2BKEA 5J8YC 4WBYA 1ZQGA 1KBUA 8ICXA 5JTGA 1TFYA 1OU5A 1Z4OA 5DBBA 4RQ3A 8ICYA 9ICJA 4X4RA 4UB1A 1NK0A 3AQLA 4QZCA 2EZZA 2JMGA 1SXEA 3UMGA 5KT3A 3KTQA 3RBDA 2HBJA 4GXJA 4DFDA 5AM2A 5DG9A 2PBEA 4Y2YA 5KAFU 1UEVA 3KZXA 2KSOB 1MIYA 2L5YA 4WOYA 4EV6A 5BOMA 2NV3A 4QZIA 3PHZA 3IRUA 4UAZA 4DL4A 4FHXA 3NVVA 2ZH8A 4UB4A 4YMOA 4I0UA 2F3NA 3GQCA 1ZQQA 2HHVA 3WK6A 3H40A 2W55A 2W9CA 4CRXA 4DSLA 3EYZA 4YR3A 4C4SA 2JH7A 1IXRA 4MF2A 4UB5A 5ALHA 3SD7A 4U7CA 3HKZF 4GC6A 2B4VA 5AM1A 4UBCA 2BPFA 2KMDA 9ICEA 7ICVA 4PJ0U 3OTQA 1UPHA 2ASLA 1D8BA 2W3RA 5DEDA 2ASJA 5AK3A 1COOA 5J2KA 3Q8RB 2MUTA 3L9DA 5C5JA 1QCKA 9ICVA 1TVAA 3NYBA 4EBJA 2RLTA 4MFAA 2I6XA 5HRKA 4X0AA 4MF8A 4K4IA 4I29A 5KFIA 5J2DA 5CHGA 7ICTA 3TFSA 4DOBA 9ICXA 4PHEA 4YR0A 5KFGA 1Z00B 3AU2A 2JEIA 4NY8A 2F2AB 5ALPA 1CRXA 1B0XA 1HEKA 1L3UA 1DRGA 4XRHA 3C23A 1ZQIA 1JXLA 1A0PA 4S3NA 2R8IA 2JZBA 1ZQVA 4DQPA 2DRAA 2DPJA 1XNSA 4R66A 5J2HA 4BWMA 1ZQUA 5ALIA 2F76X 3QUBA 2F1HA 4UD5A 2RP5A 4LEZA 4ED2A 4EEKA 2AU0A 4ECSA 5DB8A 1IV8A 4B9SA 8ICFA 3NGDA 4NLNA 3CW2C 1WWUA 3MGIA 4EELA 2LYBA 4QIWF 3E58A 2DUYA 3RTVA 1TFWA 4Y2XA 2LM4A 3BJYA 3H0RB 4P0QB 2HBMA 3TADC 2GA9D 2IOFA 3J81j 1ZQCA 3ZD8A 4EZ6A 3TACB 8ICJA 9ICBA 8ICQA 4NWIA 3H7IA 4ED0A 4KLUA 1MC8A 5IIOA 2ZTEA 4KLLA 2K8BB 3OGUA 5L1MA 5AHXA 4RQMA 1F44A 4EBEA 4CDGA 5ALYA 1C20A 2GAFD 5CFSA 5KFWA 2KV2A 3SAGA 1UETA 1VJ7A 1ZQMA 2ZIUA 4QW8A 3D2QA 4K97A 3HT3A 1CI4A 3F2DA 5DB9A 9ICIA 8ICAA 4IRKA 2PXIA 4J9OA 1U48A 5KG2A 1DK3A 3GIIA 4YMMA 4XQ8A 3C28A 4NKUA 5AIBA 1B22A 5EWGA 5AK6A 4PZOA 3ISDA 2M2UA 1BPDA 5J0OA 3ZDCA 4ATBA 4J9QA 3MR5A 4N7RA 2VANA 4O3RA 4RQ0A 4C8KA 2ZJ8A 2G08A 3BQ1A 2CRXA 4P4OA 3M8SA 2DGZA 1X9WA 2HMXA 3EWAA 3K75D 3C5FA 1FA0A 5KT7A 3PSIA 7ICRA 2RDIA 1TKDA 4KLOA 4I2AA 4O68A 4QZDA 4NM2A 4DF8A 3LDAA 4Y2SA 1TAQA 4QZEA 2B21A 1MN8A 4P0QA 3F5EA 5HRLA 1A77A 2EZXA 5K4LA 4OAGA 1XS9D 1Q78A 4RWPA 2W9BB 3JCFA 7ICIA 2LHTA 3QUCA 4JV2A 4YQWA 4M9NA 3MR3A 2YMLA 3C21A 5KT4A 1Q3UA 2PFOA 3PO5A 3E0FA 4WC3A 2HVHA 5KT6A 2XY7A 1T8EA 1ZRNA 2UVVA 5ALWA 3TQ1A 3MABA 3THVA 4WC5A 7ICGA 3WKEA 4KLQA 4X4QA 5AKIA 1X9XA 3RJFA 2AXTU 4KLJA 1KEJA 3M6ZA 3SEIA 2RDJA 5AK4A 4K96A 2W7OA 2G5HB 4I2DA 2RRDA 5AK5A 4EEDA 3RAQA 8ICEA 2G5IB 3SAHA 4KLDA 3KBBA 3H3AA 2VJ4A 3C29A 2EQYA 2BQ3A 3H39A 4O5CA 3FYHA 1UEUA 3IM1A 4RZRA 5ALEA 9ICAA 2JRZA 3D6JA 3I28A 2NRXA 3BZCA 3RR8A 4KX3A 3ICXA 4RQ7A 5F3XB 5KG3A 1V38A 1XSLA 3F5AA 4Z6EA 4BXOA 4NXVA 2M2TA 3C1YA 3HWTA 1SKWA 5KL1B 1H38A 3PW2A 4ECQA 3M1YA 3AU6A 7ICUA 1SGGA 1XSNA 4I2GA 4KLIA 2YY6A 3H37A 4QWEA 2KE7A 2P35A 3OUYA 3D2NA 1PX5A 4US8A 1ZQFA 3ED5A 4F4WA 5KFCA 3WK4A 3MDCA 4IG8A 2H3IA 5KFDA 1NJWA 3H4BA 4ED3A 3NVYA 4JV1A 4EP7A 5AI5A 4MEYA 5FP0A 3GV8B 4NL9A 4I2CA 5J0WA 7ICHA 1EXNA 4B9NA 3VC8A 4KN4A 1S5LU 3MR6A 1X9SA 2VA8A 2JEFA 2OH2A 3UPQA 4OJ6A 2LYHA 2ZH3A 3O0FA 5KG7A 1S0NA 2PMZF 2D3DA 2VIXA 5J8YA 4J9KA 3PVXA 4NXUA 2EH9A 4F93B 2FE9A 4ACOA 2ZXIA 2F8LA 4DOAA 5CR0A 1UCVA 2FLPA 3H8JA 4DQSA 3EF2A 8ICKA 3IHQB 5B66U 2CN1A 4US9A 4YCXA 3MCRA 1D8LA 1SWVA 2EAOA 4RT3A 1PVRA 5B3PA 5KNIA 3B0XA 3PW7A 4K9BA 1SL0A 2HHTA 2C2EA 2BPCA 2ODGA 2ZXHA 5J0XA 1RQNA 2FDRA 5JTIA 4ECZA 2MRLA 1S0MA 1VLBA 3PSTA 2C2DA 3PY8A 3WFRE 1PVPA 4USAA 5ALDA 5AI0A 3QZ7A 2OXOA 2E1EA 3EZ5A 9ICRA 1KQQA 3ER8C 5L1JA 4LT6A 3HILA 1UQVA 4PHAA 4LZGA 3WK5A 1ZQEA 2PI5A 4XUSA 5GTHU 4I2FA 1MIWA 2H5XA 3Q8SB 2O1PA 4KMUA 5D46A 4NLKA 3C66A 3N7PD 3PZPA 4DF4A 3SAFA 4P0PA 4QWDA 2HW3A 3T79A 2BHNA 2E1FA 4R65A 4CGZA 5KFKA 3K4GA 3ZDBA 1Z1VA 5DG8A 3JZ0A 1ZD2P 1RYRA 1X42A 3OJUA 1RXVA 3MC1A 1J2MA 4AT8A 1JRPA 5AM3A 1N60A 4K9AA 1T3QA 2KNJA 2BPGA 8ICHA 2K60A 1BNPA 1L3VA 4C8NA 5AKGA 2ZIVB 2FPLA 3BS7A 3NRZA 7ICPA 5J0PA 4FBUA 1ZOLA 4R8UA 4YD2A 3SV4A 1NK8A 5IIKA 3PW4A 4DSJA 2A1AA 2EWRA 4UAVA 5DG7A 3BQ7A 4EX6A 4DEZA 3VCBA 4WC2A 2JEGA 4RPYA 1JQRA 1NNLA 5D49A 1WYGA 2PKEA 2GWSA 3B9JA 4RNMA 4E0DA 4K4HA 4QZFA 3BQ0A 3AN1A 1V4AA 4O3SA 2F8KA 3NKUA 2BBHA 4F92B 2DVIA 2D6FC 1BGXT 2N1RA 3TADA 3K1RB 4LEYA 3ZDAA 3BQ2A 1OUQA 3JPNA 4WJ3B 2KK0A 1CUKA 5F9NA 3F2CA 4DQRA 2FCLA 8ICLA 3H0LB 5EE1A 1PK1A 1DOQA 4UAYA 1NK5A 2OWOA 5HRBA 3WKAA 4CF3A 3PW5A 2PFNA 2C2RA 2KKPA 4OD0A 4AP9A 3PR4A 1RDFA 5EE0A 4DFMA 5TISU 2WB1C 3PX0A 4G9BA 1QLNA 2R8KA 2RHFA 4Q45A 3AQMA
chains in the Genus database with same CATH topology
4R64A 1ZQCA 1RZTA 2KZZA 1NJZA 1HJPA 3ZD8A 3LWLA 2IBKA 3MFIA 4EZ6A 3Q8MA 3C5GA 8ICJA 9ICBA 2ZUBA 4DFKA 4C8MA 8ICQA 4QZ9A 1UT5A 5KFXA 2PFQA 4AT7B 3H7IA 5KFYA 4RNOA 2Y1IA 5KFOA 5KFNA 2ZJ5A 4ED0A 4KLUA 5J29A 1MC8A 1NKEA 5DBCA 2XCPA 2DR5A 1QSYA 5IIOA 1C7YA 4PHPA 2ZTEA 5BOLA 4DOCA 4KLLA 4JWNA 2VA2A 3RJEA 5DQIA 3JPTA 3OGUA 2UVWA 4F3OA 3JPQA 2BCUA 5IIJA 4J9NA 3JPSA 4EBEA 2Y1JA 4F8RA 4M9LA 3JPPA 2NRWA 4O3NA 3RH6A 4DSKA 4F2SA 4QZGA 4CCHA 5KFWA 3RRHA 1VJ7A 1UETA 4QW9A 3TAPA 1ZQMA 4QWBA 4UB2A 2FMPA 2A1JB 4QW8A 8ICNA 4FHPA 5KFZA 4UD4A 4WC1A 3OSPA 3HT3A 5KFTA 5KFBA 3AQNA 4YVZA 5BPCA 1KFSA 4KLMA 5KT2A 2FPMA 3Q8QB 2NRTA 1TV9A 1NK9A 1QTMA 3G6XA 3C2LA 5DB9A 2XO7A 9ICIA 3ORYA 8ICAA 1Y88A 1HUZA 4C8OA 4F4KA 4IQVA 7ICMA 1BNOA 1MIVA 1KTQA 1BPXA 1JMSA 1S76D 5KG1A 4IRKA 2PXIA 4J9OA 3Q8KA 1U48A 4F50A 4DL6A 2BE3A 1NKCA 4ZH4A 5J2AA 3QE9Y 4JK1A 5KG2A 5CJ7A 3GIIA 2BCRA 4YMMA 4XQ8A 1DK3A 4X4SA 3OVAA 4NKUA 1B22A 5EWGA 4TUSA 2XCAA 4Q44A 5IINA 3RB6A 1S10A 1NZPA 4WBZA 9ICMA 1QSLA 8ICSA 3ISDA 3RB0A 2KZMA 3V7KA 1BPDA 2M2UA 3QZ8A 3FDSA 4QWCA 5J0OA 3HJ1A 4KLFA 4DL2A 5CWRA 4KLSA 1TK8A 1ZQLA 1XO1A 3ZDCA 3OHBA 1BPBA 4F5OA 4GXKA 5J2IA 1YLQA 1ZQNA 8ICWA 5F2VO 4ATBA 4J9QA 1K1QA 2KZ3A 3BQTA 3HPOA 7ICNA 3MR5A 4J9SA 2M9NA 3C2MA 5J2BA 2BR0A 1S9FA 2VANA 1NO5A 4O3RA 4Q8EA 3RJIA 4RQ0A 4UQGA 4Q43A 1XSPA 8ICMA 5L1IA 4C8KA 2FPKA 3V7JA 2ZJ8A 8ICCA 3M9MB 5IIMA 3V72A 3PW0A 1V9PA 5J0TA 4PGYA 5IILA 4DL7A 4ELVA 4M2YA 1R8BA 3BQ1A 1L3SA 1D9FA 2W9CB 3OHAA 4DSIA 4P4OA 3M8SA 5KFPA 4J9PA 3N97B 1WOTA 4WC6A 2DR7A 1X9WA 2ZTCA 3EWAA 3K75D 3C5FA 5J0UA 4X5VA 1KRPA 4KLTA 5HMMA 5KT7A 4IR1A 7ICRA 4DL5A 5HC9A 2RDIA 2IHMA 8ICGA 1TKDA 3ZDDA 4AT8B 5KT5A 4Z6DA 1SKSA 4RQ5A 4O3QA 4I2AA 4KLOA 4O3PA 3ETLA 4QZDA 2NRZA 3TAQA 5HRGA 2UVRA 4NM2A 4DF8A 4EYHB 3LDAA 4PGXA 1MQ3A 4MFFA 2BQUA 4FS1A 1L5UA 1ZQRA 4PH5A 4YG2A 1TAQA 4O3OA 4QZEA 2ZHAA 2B21A 2KTQA 5L9XA 1S77D 1MSWD 3C18A 4I2HA 4BDPA 5HRLA 1A77A 4AT9A 1U47A 2I1QA 2MUTB 3OSNA 3Q8PB 4YXMA 4R8UB 1ZQOA 1ZQPA 4QZ8A 3RRGA 2ID1A 3V6KA 3RJGA 2F1JA 3GV5B 7ICFA 1XS9D 1F5AA 2BDPA 2R8JA 5CB1A 4YXJA 4UAWA 4C8LA 2KFNA 1Q78A 4EBKA 4RWPA 4WC7A 2W9BB 4ED7A 3UQ0A 3UXOA 5KG0A 2ISPA 7ICIA 1R89A 8ICVA 4JV2A 4F5RA 8ICIA 4NKTA 4YQWA 4M9NA 3MR3A 2RFFA 2C22A 4IQUA 2V4QA 4DL3A 3C21A 5DB6A 2ZH5A 5J2CA 1ZQAA 5KT4A 2PFOA 4X4OA 3PO5A 2HHSA 2AJQA 4X4NA 4E8FA 5KFUA 1SZPA 4WC3A 3T3FA 4PHDA 1RYSA 2HVHA 5J0QA 7ICEA 5KT6A 2XY7A 1T8EA 1D9DA 1KLNA 5IIIA 3SV3A 2UVVA 3PNCA 3BDPA 3TQ1A 4M47A 4KTQA 3MABA 3GIKA 4NXZA 1TFRA 3THVA 1TK5A 7ICGA 4YMNA 1R8AA 4DS5A 4WC5A 3EW9A 4RQ4A 1S97A 3LWMA 1VFGA 1ZQYA 4KLQA 5HMLA 3B0YA 4FH3A 7ICSA 1LV5A 4X4QA 4B9VA 1JAJA 2JZBB 3GV7B 1T7PA 3RJFA 1BVSA 4KLJA 1KEJA 2RDJA 3TANA 3UPSA 4X4PA 4J9MA 4I2DA 3EPIA 4DLGA 2KN7A 3OJSA 5KFHA 3RAQA 8ICEA 3GIMA 1SL1A 9ICPA 2XC9A 4RQ6A 4KLDA 1PZNA 3H3AA 3N4MB 5KFJA 1UA0A 1NK4A 1ZQKA 2F1IA 3M9OB 1BPZA 2BQ3A 4BWJA 4I2IA 3HX0A 2AGQA 3H39A 4TURA 3FYHA 4P4PA 4O5CA 8ICUA 5KFQA 1UEUA 3IM1A 3QEBZ 4RZRA 9ICAA 2P66A 5HRHA 4LZDA 5J2EA 3KHGA 8ICPA 4QZBA 4KN7A 3HP6A 1WCNA 1ZQXA 2NRXA 4F91B 3V6HA 4O5EA 8ICTA 2UVUA 3RR8A 4IR9A 7ICLA 3RR7A 4B9UA 1RPLA 1ZJNA 2AGPA 4RQ7A 1T3NA 1ZQBA 4RQ1A 5KG3A 4DO9A 7ICJA 3LQCB 1R8CA 2NRKA 1XSLA 3OV7A 1SKRA 2Q0ZX 5KG5A 4RWQA 3C2KA 1XWLA 4Z6EA 4RQ8A 4BXOA 1Z00A 3MDAA 2HHWA 2W8KA 2J6SA 1DK2A 5HRIA 4M6WB 1X2IA 3KHLA 5L1LA 1ZQHA 2J6UA 4ED1A 4FBTA 2M2TA 3C1ZA 4YP3A 5J2JA 4YR2A 3HW8A 3C1YA 3HWTA 1SKWA 3AUOA 4O0IA 4RU9A 2W9AA 1NOMA 1H38A 2VA3A 4ECVA 3PW2A 4ELTA 4ECQA 3Q8LA 2ZHBA 3AU6A 7ICUA 1XSNA 2DR9A 1T4GA 2O5AA 4B9LA 4I2GA 7ICQA 4RPXA 4RWNA 1DGSA 2HHXA 4DQIA 2W8LA 5DB7A 4KLIA 2AQ4A 3T5LA 3TFRA 2ASDA 3H37A 4QWEA 3OUYA 1NKBA 2KP7A 4EEYA 3KHHA 1WCLA 4K4GA 4JUZA 1PX5A 2ZUCA 1ZQFA 9ICHA 1N48A 3GIJA 4F4WA 5KFCA 3PR5B 3MDCA 2JEJA 2R8GA 4IG8A 3TARA 5KFDA 2P6UA 2ZTDA 1NJWA 4YD1A 3H4BA 4ED3A 3SI8A 4I28A 4Z6CA 4JV1A 4EP7A 4MEYA 2W9MA 3PMNA 3JPOA 3GV8B 4DLEA 5J0WA 3RB4A 2C28A 4I2CA 1JIHA 7ICHA 9ICGA 1EXNA 3RH4A 4B9NA 2ZUDA 4DFPA 3UXPA 4PGQA 2FMSA 4KN4A 5HP4A 4EYIB 2HHUA 4GC7A 5KFMA 4P2HA 2FLLA 3MGHA 1JXEA 3MR6A 1NJYA 4JWMA 5HRDA 2XY5A 2ATLA 3PV8A 2VA8A 1X9SA 5HR9A 3M9NB 2JEFA 9ICWA 3H4DA 1Q79A 5DQHA 5J0RA 3UPQA 9ICSA 5KFRA 3WFPA 2LYHA 2ZH3A 1S0NA 5KG7A 1JX4A 5CA7A 2ZH1A 5HNKA 4DWIA 4FHYA 4F5NA 4J9KA 3PVXA 4ELUA 3JYYA 4MEXA 5DECA 4F93B 4DSJA 4RNNA 2DRBA 4IQTA 4FO6A 4F5PA 3HJ4A 4DOAA 5CR0A 5DDMA 4DS4A 2FLPA 4AT7A 4ECUA 8ICBA 4RWOA 3H8JA 5HHHA 1FA0A 1A76A 4DQSA 1MQ2A 5KTQA 4I2BA 3IHQB 4MFCA 2R8HA 1CEZA 8ICKA 4FHVA 4ATBB 4O5KA 3NTUA 4KLHA 4E7XA 4I2JA 4YCXA 3JPRA 2BCVA 1D8LA 4RPZA 2ALZA 1UA1A 4J9RA 3UQ2A 1XU4A 4UBBA 3TI0A 5J0YA 3RJKA 3ZDEA 4ED6A 4RT3A 4XA5A 1D8YA 1U45A 3MR2A 1B43A 3B0XA 8ICRA 4EBDA 2ZJAA 4TQSA 2WTFA 1KFDA 3PW7A 4TUPA 1X9MA 1SL0A 3GILA 4M9JA 2HHTA 3OVSA 4WC4A 2C2EA 1NK6A 2BPCA 4M9GA 4M04A 2A1JA 9ICCA 4M0AA 5J0XA 2MAXA 2NRVA 5L1KA 4I2EA 3QEAZ 2BKEA 9ICOA 4FH5A 2KFZA 4G3IA 4WBYA 5F9LA 1ZQGA 1SL2A 2ZH6A 2ISOA 1BPEA 4ECZA 8ICXA 1S0MA 4FHWA 3PMLA 4FS2A 5CP2A 4WCWA 1TFYA 2C2DA 3PY8A 3RB3A 3V6JA 2FLNA 3WFRE 3ISBA 1OU5A 2DPIA 4LVSA 5DBBA 4RQ3A 1Z3EB 4ECRA 8ICYA 4KLEA 9ICJA 4UB1A 3QZ7A 4X4RA 1ZQDA 4F4XA 1NK0A 7ICKA 3EZ5A 5EOZA 4X4UA 2ZH9A 5DGAA 4QZCA 5KFFA 3AQLA 4AT9B 2IMWP 3KTQA 5KT3A 5DGBA 4IRDA 9ICRA 3V7LA 3RBDA 5L1JA 4LT6A 4F2RA 3G6YA 1QSSA 1K1SA 4PHAA 4LZGA 4GXJA 5DQGA 5DG9A 2PBEA 4Z6FA 5J0SA 3MFHA 1ZQEA 2I9GA 4XUSA 2PI5A 4X4VA 4I2FA 1UEVA 4RUAA 2BCSA 2H5XA 3Q8SB 1MIWA 2O1PA 1MIYA 4KMUA 5D46A 4NLKA 3C66A 4M5DA 5BOMA 2XY6A 4B9TA 2J6TA 4DFJA 4QZIA 4DF4A 8ICZA 3M8RA 4UAZA 5JUMA 4QWDA 4DL4A 4FHXA 2ZH8A 4UB4A 2HW3A 4ECTA 4YMOA 2BHNA 4R65A 3GQCA 5KFSA 1ZQQA 2HHVA 3H40A 1LB2B 5KFKA 3K4GA 2XGQA 3ZDBA 2W9CA 3OVBA 4WC0A 5DG8A 1L3TA 4DSLA 3EYZA 4YR3A 9ICNA 4YFKA 3JZ0A 3T5KA 3EPGA 1U9LA 1IXRA 3SZ2A 4UB5A 2BCQA 2PFPA 4MF2A 5DBAA 9ICLA 1KNYA 1RYRA 1RXVA 3OJUA 4X0BA 4QZAA 4GC6A 4AT8A 1ZYQA 4UBCA 2BPFA 5EWFA 2HHPA 3H8WA 2DFLA 9ICEA 3RBEA 7ICVA 2M2VA 3WFSC 9ICKA 3KHRA 2DR8A 2BPGA 8ICHA 2ASLA 1L3VA 1KSPA 5KFLA 1BNPA 4IRCA 2BQRA 3H38A 1S0OA 4C8NA 3ISCA 2HHQA 5HHIA 2ASJA 5DEDA 2FPLA 1COOA 5J2KA 3Q8RB 1NJXA 2MUTA 4QWAA 3UXNA 8ICOA 7ICPA 5HREA 5J0PA 4FBUA 5C5JA 4R8UA 4YD2A 3L9DA 3SV4A 1NK8A 5IIKA 5DDYA 3PW4A 4F4ZA 1TK0A 1IM4A 2P6RA 4R63A 4ECWA 5DG7A 9ICVA 1TVAA 1N56A 3NYBA 4EBJA 4MFAA 5EWEA 2XGPA 5J2FA 1RXWA 4M9HA 2AQ0A 2W9BA 1HUOA 4GXIA 5HRKA 4X0AA 4DEZA 1ZQWA 4MF8A 4NM1A 5KFVA 4K4IA 4NLZA 4DQQA 1U4BA 3SYZA 2JEGA 4I29A 4WC2A 4F5QA 3H8SA 5KFIA 5J2DA 4RPYA 1JQRA 5CHGA 5J2GA 3AQKA 3WFOA 7ICTA 3TFSA 5D49A 4DOBA 4EZ9A 2Q66A 2V4RA 4PHEA 9ICXA 4YR0A 2GWSA 4PPXA 5KFGA 3RAXA 3PO4A 4RT2A 4BXOB 5D4BA 1Z00B 4KITB 3AU2A 4RUCA 4RNMA 1NK7A 3WFQE 3LK9A 2JEIA 3RJHA 4NY8A 4J9LA 4E0DA 4XQ7A 4ED8A 1KDHA 1ZETA 2IHNA 1ZQJA 1ZQSA 4K4HA 4QZHA 1L3UA 4QZFA 3BQ0A 2BGWA 2PI4A 4ECYA 1ZQZA 4XRHA 1V4AA 3C23A 5DLGA 4O3SA 4E80A 1ZQIA 4GLXA 4NLGA 1JXLA 1ZQTA 1UT8A 2R8IA 3ZD9A 4S3NA 4X4TA 2JZBA 4F92B 2DVIA 1ZQVA 4BGDA 2V9WA 4DQPA 3RJJA 2DRAA 1BGXT 4TQRA 3T5HA 3PX4A 3OUYB 2ZH7A 2DPJA 3T5JA 1BPYA 1S0VA 3ZDAA 3HIYA 4R66A 9ICQA 3BQ2A 5J2HA 4BWMA 1ZQUA 5TZVA 3GFKB 3JPNA 2ZH4A 2AGOA 1XC9A 4ECXA 3PX6A 1CUKA 2F1HA 5F9NA 5KG6A 4O9MA 4UD5A 4DQRA 4IQWA 4ED2A 1JN3A 2HVIA 7ICOA 8ICLA 4EBCA 9ICFA 4HYKA 4TUQA 3G6VA 1DOQA 4P4MA 2AU0A 4I27A 3GDXA 4ECSA 5DB8A 2IA6A 4UAYA 1NK5A 4B9SA 1TAUA 2ZH2A 2OWOA 5HRBA 5KG4A 8ICFA 5KFEA 3NGDA 2FMQA 3PW5A 5HRFA 4YN4A 4NLNA 4DSFA 2PFNA 3RH5A 5KFAA 3MGIA 1AROP 5DLFA 2C2RA 4DSEA 3MBYA 1U49A 4KLGA 9ICTA 5DKWA 1KFTA 3PR4A 4Q8FA 4DFMA 3RTVA 1TFWA 3PX0A 3BJYA 4F4YA 9ICUA 2M2WA 1QLNA 2R8KA 4RQ2A 4B9MA 1ZJMA 4M6WA 4JV0A 3E2EA 4Q45A 3AQMA 4UB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R64 A;  1ZQC A;  1RZT A;  2KZZ A;  1NJZ A;  1HJP A;  3ZD8 A;  3LWL A;  2IBK A;  3MFI A;  4EZ6 A;  3Q8M A;  3C5G A;  8ICJ A;  9ICB A;  2ZUB A;  4DFK A;  4C8M A;  8ICQ A;  4QZ9 A;  1UT5 A;  5KFX A;  2PFQ A;  4AT7 B;  3H7I A;  5KFY A;  4RNO A;  2Y1I A;  5KFO A;  5KFN A;  2ZJ5 A;  4ED0 A;  4KLU A;  5J29 A;  1MC8 A;  1NKE A;  5DBC A;  2XCP A;  2DR5 A;  1QSY A;  5IIO A;  1C7Y A;  4PHP A;  2ZTE A;  5BOL A;  4DOC A;  4KLL A;  4JWN A;  2VA2 A;  3RJE A;  5DQI A;  3JPT A;  3OGU A;  2UVW A;  4F3O A;  3JPQ A;  2BCU A;  5IIJ A;  4J9N A;  3JPS A;  4EBE A;  2Y1J A;  4F8R A;  4M9L A;  3JPP A;  2NRW A;  4O3N A;  3RH6 A;  4DSK A;  4F2S A;  4QZG A;  4CCH A;  5KFW A;  3RRH A;  1VJ7 A;  1UET A;  4QW9 A;  3TAP A;  1ZQM A;  4QWB A;  4UB2 A;  2FMP A;  2A1J B;  4QW8 A;  8ICN A;  4FHP A;  5KFZ A;  4UD4 A;  4WC1 A;  3OSP A;  3HT3 A;  5KFT A;  5KFB A;  3AQN A;  4YVZ A;  5BPC A;  1KFS A;  4KLM A;  5KT2 A;  2FPM A;  3Q8Q B;  2NRT A;  1TV9 A;  1NK9 A;  1QTM A;  3G6X A;  3C2L A;  5DB9 A;  2XO7 A;  9ICI A;  3ORY A;  8ICA A;  1Y88 A;  1HUZ A;  4C8O A;  4F4K A;  4IQV A;  7ICM A;  1BNO A;  1MIV A;  1KTQ A;  1BPX A;  1JMS A;  1S76 D;  5KG1 A;  4IRK A;  2PXI A;  4J9O A;  3Q8K A;  1U48 A;  4F50 A;  4DL6 A;  2BE3 A;  1NKC A;  4ZH4 A;  5J2A A;  3QE9 Y;  4JK1 A;  5KG2 A;  5CJ7 A;  3GII A;  2BCR A;  4YMM A;  4XQ8 A;  1DK3 A;  4X4S A;  3OVA A;  4NKU A;  1B22 A;  5EWG A;  4TUS A;  2XCA A;  4Q44 A;  5IIN A;  3RB6 A;  1S10 A;  1NZP A;  4WBZ A;  9ICM A;  1QSL A;  8ICS A;  3ISD A;  3RB0 A;  2KZM A;  3V7K A;  1BPD A;  2M2U A;  3QZ8 A;  3FDS A;  4QWC A;  5J0O A;  3HJ1 A;  4KLF A;  4DL2 A;  5CWR A;  4KLS A;  1TK8 A;  1ZQL A;  1XO1 A;  3ZDC A;  3OHB A;  1BPB A;  4F5O A;  4GXK A;  5J2I A;  1YLQ A;  1ZQN A;  8ICW A;  5F2V O;  4ATB A;  4J9Q A;  1K1Q A;  2KZ3 A;  3BQT A;  3HPO A;  7ICN A;  3MR5 A;  4J9S A;  2M9N A;  3C2M A;  5J2B A;  2BR0 A;  1S9F A;  2VAN A;  1NO5 A;  4O3R A;  4Q8E A;  3RJI A;  4RQ0 A;  4UQG A;  4Q43 A;  1XSP A;  8ICM A;  5L1I A;  4C8K A;  2FPK A;  3V7J A;  2ZJ8 A;  8ICC A;  3M9M B;  5IIM A;  3V72 A;  3PW0 A;  1V9P A;  5J0T A;  4PGY A;  5IIL A;  4DL7 A;  4ELV A;  4M2Y A;  1R8B A;  3BQ1 A;  1L3S A;  1D9F A;  2W9C B;  3OHA A;  4DSI A;  4P4O A;  3M8S A;  5KFP A;  4J9P A;  3N97 B;  1WOT A;  4WC6 A;  2DR7 A;  1X9W A;  2ZTC A;  3EWA A;  3K75 D;  3C5F A;  5J0U A;  4X5V A;  1KRP A;  4KLT A;  5HMM A;  5KT7 A;  4IR1 A;  7ICR A;  4DL5 A;  5HC9 A;  2RDI A;  2IHM A;  8ICG A;  1TKD A;  3ZDD A;  4AT8 B;  5KT5 A;  4Z6D A;  1SKS A;  4RQ5 A;  4O3Q A;  4I2A A;  4KLO A;  4O3P A;  3ETL A;  4QZD A;  2NRZ A;  3TAQ A;  5HRG A;  2UVR A;  4NM2 A;  4DF8 A;  4EYH B;  3LDA A;  4PGX A;  1MQ3 A;  4MFF A;  2BQU A;  4FS1 A;  1L5U A;  1ZQR A;  4PH5 A;  4YG2 A;  1TAQ A;  4O3O A;  4QZE A;  2ZHA A;  2B21 A;  2KTQ A;  5L9X A;  1S77 D;  1MSW D;  3C18 A;  4I2H A;  4BDP A;  5HRL A;  1A77 A;  4AT9 A;  1U47 A;  2I1Q A;  2MUT B;  3OSN A;  3Q8P B;  4YXM A;  4R8U B;  1ZQO A;  1ZQP A;  4QZ8 A;  3RRG A;  2ID1 A;  3V6K A;  3RJG A;  2F1J A;  3GV5 B;  7ICF A;  1XS9 D;  1F5A A;  2BDP A;  2R8J A;  5CB1 A;  4YXJ A;  4UAW A;  4C8L A;  2KFN A;  1Q78 A;  4EBK A;  4RWP A;  4WC7 A;  2W9B B;  4ED7 A;  3UQ0 A;  3UXO A;  5KG0 A;  2ISP A;  7ICI A;  1R89 A;  8ICV A;  4JV2 A;  4F5R A;  8ICI A;  4NKT A;  4YQW A;  4M9N A;  3MR3 A;  2RFF A;  2C22 A;  4IQU A;  2V4Q A;  4DL3 A;  3C21 A;  5DB6 A;  2ZH5 A;  5J2C A;  1ZQA A;  5KT4 A;  2PFO A;  4X4O A;  3PO5 A;  2HHS A;  2AJQ A;  4X4N A;  4E8F A;  5KFU A;  1SZP A;  4WC3 A;  3T3F A;  4PHD A;  1RYS A;  2HVH A;  5J0Q A;  7ICE A;  5KT6 A;  2XY7 A;  1T8E A;  1D9D A;  1KLN A;  5III A;  3SV3 A;  2UVV A;  3PNC A;  3BDP A;  3TQ1 A;  4M47 A;  4KTQ A;  3MAB A;  3GIK A;  4NXZ A;  1TFR A;  3THV A;  1TK5 A;  7ICG A;  4YMN A;  1R8A A;  4DS5 A;  4WC5 A;  3EW9 A;  4RQ4 A;  1S97 A;  3LWM A;  1VFG A;  1ZQY A;  4KLQ A;  5HML A;  3B0Y A;  4FH3 A;  7ICS A;  1LV5 A;  4X4Q A;  4B9V A;  1JAJ A;  2JZB B;  3GV7 B;  1T7P A;  3RJF A;  1BVS A;  4KLJ A;  1KEJ A;  2RDJ A;  3TAN A;  3UPS A;  4X4P A;  4J9M A;  4I2D A;  3EPI A;  4DLG A;  2KN7 A;  3OJS A;  5KFH A;  3RAQ A;  8ICE A;  3GIM A;  1SL1 A;  9ICP A;  2XC9 A;  4RQ6 A;  4KLD A;  1PZN A;  3H3A A;  3N4M B;  5KFJ A;  1UA0 A;  1NK4 A;  1ZQK A;  2F1I A;  3M9O B;  1BPZ A;  2BQ3 A;  4BWJ A;  4I2I A;  3HX0 A;  2AGQ A;  3H39 A;  4TUR A;  3FYH A;  4P4P A;  4O5C A;  8ICU A;  5KFQ A;  1UEU A;  3IM1 A;  3QEB Z;  4RZR A;  9ICA A;  2P66 A;  5HRH A;  4LZD A;  5J2E A;  3KHG A;  8ICP A;  4QZB A;  4KN7 A;  3HP6 A;  1WCN A;  1ZQX A;  2NRX A;  4F91 B;  3V6H A;  4O5E A;  8ICT A;  2UVU A;  3RR8 A;  4IR9 A;  7ICL A;  3RR7 A;  4B9U A;  1RPL A;  1ZJN A;  2AGP A;  4RQ7 A;  1T3N A;  1ZQB A;  4RQ1 A;  5KG3 A;  4DO9 A;  7ICJ A;  3LQC B;  1R8C A;  2NRK A;  1XSL A;  3OV7 A;  1SKR A;  2Q0Z X;  5KG5 A;  4RWQ A;  3C2K A;  1XWL A;  4Z6E A;  4RQ8 A;  4BXO A;  1Z00 A;  3MDA A;  2HHW A;  2W8K A;  2J6S A;  1DK2 A;  5HRI A;  4M6W B;  1X2I A;  3KHL A;  5L1L A;  1ZQH A;  2J6U A;  4ED1 A;  4FBT A;  2M2T A;  3C1Z A;  4YP3 A;  5J2J A;  4YR2 A;  3HW8 A;  3C1Y A;  3HWT A;  1SKW A;  3AUO A;  4O0I A;  4RU9 A;  2W9A A;  1NOM A;  1H38 A;  2VA3 A;  4ECV A;  3PW2 A;  4ELT A;  4ECQ A;  3Q8L A;  2ZHB A;  3AU6 A;  7ICU A;  1XSN A;  2DR9 A;  1T4G A;  2O5A A;  4B9L A;  4I2G A;  7ICQ A;  4RPX A;  4RWN A;  1DGS A;  2HHX A;  4DQI A;  2W8L A;  5DB7 A;  4KLI A;  2AQ4 A;  3T5L A;  3TFR A;  2ASD A;  3H37 A;  4QWE A;  3OUY A;  1NKB A;  2KP7 A;  4EEY A;  3KHH A;  1WCL A;  4K4G A;  4JUZ A;  1PX5 A;  2ZUC A;  1ZQF A;  9ICH A;  1N48 A;  3GIJ A;  4F4W A;  5KFC A;  3PR5 B;  3MDC A;  2JEJ A;  2R8G A;  4IG8 A;  3TAR A;  5KFD A;  2P6U A;  2ZTD A;  1NJW A;  4YD1 A;  3H4B A;  4ED3 A;  3SI8 A;  4I28 A;  4Z6C A;  4JV1 A;  4EP7 A;  4MEY A;  2W9M A;  3PMN A;  3JPO A;  3GV8 B;  4DLE A;  5J0W A;  3RB4 A;  2C28 A;  4I2C A;  1JIH A;  7ICH A;  9ICG A;  1EXN A;  3RH4 A;  4B9N A;  2ZUD A;  4DFP A;  3UXP A;  4PGQ A;  2FMS A;  4KN4 A;  5HP4 A;  4EYI B;  2HHU A;  4GC7 A;  5KFM A;  4P2H A;  2FLL A;  3MGH A;  1JXE A;  3MR6 A;  1NJY A;  4JWM A;  5HRD A;  2XY5 A;  2ATL A;  3PV8 A;  2VA8 A;  1X9S A;  5HR9 A;  3M9N B;  2JEF A;  9ICW A;  3H4D A;  1Q79 A;  5DQH A;  5J0R A;  3UPQ A;  9ICS A;  5KFR A;  3WFP A;  2LYH A;  2ZH3 A;  1S0N A;  5KG7 A;  1JX4 A;  5CA7 A;  2ZH1 A;  5HNK A;  4DWI A;  4FHY A;  4F5N A;  4J9K A;  3PVX A;  4ELU A;  3JYY A;  4MEX A;  5DEC A;  4F93 B;  4DSJ A;  4RNN A;  2DRB A;  4IQT A;  4FO6 A;  4F5P A;  3HJ4 A;  4DOA A;  5CR0 A;  5DDM A;  4DS4 A;  2FLP A;  4AT7 A;  4ECU A;  8ICB A;  4RWO A;  3H8J A;  5HHH A;  1FA0 A;  1A76 A;  4DQS A;  1MQ2 A;  5KTQ A;  4I2B A;  3IHQ B;  4MFC A;  2R8H A;  1CEZ A;  8ICK A;  4FHV A;  4ATB B;  4O5K A;  3NTU A;  4KLH A;  4E7X A;  4I2J A;  4YCX A;  3JPR A;  2BCV A;  1D8L A;  4RPZ A;  2ALZ A;  1UA1 A;  4J9R A;  3UQ2 A;  1XU4 A;  4UBB A;  3TI0 A;  5J0Y A;  3RJK A;  3ZDE A;  4ED6 A;  4RT3 A;  4XA5 A;  1D8Y A;  1U45 A;  3MR2 A;  1B43 A;  3B0X A;  8ICR A;  4EBD A;  2ZJA A;  4TQS A;  2WTF A;  1KFD A;  3PW7 A;  4TUP A;  1X9M A;  1SL0 A;  3GIL A;  4M9J A;  2HHT A;  3OVS A;  4WC4 A;  2C2E A;  1NK6 A;  2BPC A;  4M9G A;  4M04 A;  2A1J A;  9ICC A;  4M0A A;  5J0X A;  2MAX A;  2NRV A;  5L1K A;  4I2E A;  3QEA Z;  2BKE A;  9ICO A;  4FH5 A;  2KFZ A;  4G3I A;  4WBY A;  5F9L A;  1ZQG A;  1SL2 A;  2ZH6 A;  2ISO A;  1BPE A;  4ECZ A;  8ICX A;  1S0M A;  4FHW A;  3PML A;  4FS2 A;  5CP2 A;  4WCW A;  1TFY A;  2C2D A;  3PY8 A;  3RB3 A;  3V6J A;  2FLN A;  3WFR E;  3ISB A;  1OU5 A;  2DPI A;  4LVS A;  5DBB A;  4RQ3 A;  1Z3E B;  4ECR A;  8ICY A;  4KLE A;  9ICJ A;  4UB1 A;  3QZ7 A;  4X4R A;  1ZQD A;  4F4X A;  1NK0 A;  7ICK A;  3EZ5 A;  5EOZ A;  4X4U A;  2ZH9 A;  5DGA A;  4QZC A;  5KFF A;  3AQL A;  4AT9 B;  2IMW P;  3KTQ A;  5KT3 A;  5DGB A;  4IRD A;  9ICR A;  3V7L A;  3RBD A;  5L1J A;  4LT6 A;  4F2R A;  3G6Y A;  1QSS A;  1K1S A;  4PHA A;  4LZG A;  4GXJ A;  5DQG A;  5DG9 A;  2PBE A;  4Z6F A;  5J0S A;  3MFH A;  1ZQE A;  2I9G A;  4XUS A;  2PI5 A;  4X4V A;  4I2F A;  1UEV A;  4RUA A;  2BCS A;  2H5X A;  3Q8S B;  1MIW A;  2O1P A;  1MIY A;  4KMU A;  5D46 A;  4NLK A;  3C66 A;  4M5D A;  5BOM A;  2XY6 A;  4B9T A;  2J6T A;  4DFJ A;  4QZI A;  4DF4 A;  8ICZ A;  3M8R A;  4UAZ A;  5JUM A;  4QWD A;  4DL4 A;  4FHX A;  2ZH8 A;  4UB4 A;  2HW3 A;  4ECT A;  4YMO A;  2BHN A;  4R65 A;  3GQC A;  5KFS A;  1ZQQ A;  2HHV A;  3H40 A;  1LB2 B;  5KFK A;  3K4G A;  2XGQ A;  3ZDB A;  2W9C A;  3OVB A;  4WC0 A;  5DG8 A;  1L3T A;  4DSL A;  3EYZ A;  4YR3 A;  9ICN A;  4YFK A;  3JZ0 A;  3T5K A;  3EPG A;  1U9L A;  1IXR A;  3SZ2 A;  4UB5 A;  2BCQ A;  2PFP A;  4MF2 A;  5DBA A;  9ICL A;  1KNY A;  1RYR A;  1RXV A;  3OJU A;  4X0B A;  4QZA A;  4GC6 A;  4AT8 A;  1ZYQ A;  4UBC A;  2BPF A;  5EWF A;  2HHP A;  3H8W A;  2DFL A;  9ICE A;  3RBE A;  7ICV A;  2M2V A;  3WFS C;  9ICK A;  3KHR A;  2DR8 A;  2BPG A;  8ICH A;  2ASL A;  1L3V A;  1KSP A;  5KFL A;  1BNP A;  4IRC A;  2BQR A;  3H38 A;  1S0O A;  4C8N A;  3ISC A;  2HHQ A;  5HHI A;  2ASJ A;  5DED A;  2FPL A;  1COO A;  5J2K A;  3Q8R B;  1NJX A;  2MUT A;  4QWA A;  3UXN A;  8ICO A;  7ICP A;  5HRE A;  5J0P A;  4FBU A;  5C5J A;  4R8U A;  4YD2 A;  3L9D A;  3SV4 A;  1NK8 A;  5IIK A;  5DDY A;  3PW4 A;  4F4Z A;  1TK0 A;  1IM4 A;  2P6R A;  4R63 A;  4ECW A;  5DG7 A;  9ICV A;  1TVA A;  1N56 A;  3NYB A;  4EBJ A;  4MFA A;  5EWE A;  2XGP A;  5J2F A;  1RXW A;  4M9H A;  2AQ0 A;  2W9B A;  1HUO A;  4GXI A;  5HRK A;  4X0A A;  4DEZ A;  1ZQW A;  4MF8 A;  4NM1 A;  5KFV A;  4K4I A;  4NLZ A;  4DQQ A;  1U4B A;  3SYZ A;  2JEG A;  4I29 A;  4WC2 A;  4F5Q A;  3H8S A;  5KFI A;  5J2D A;  4RPY A;  1JQR A;  5CHG A;  5J2G A;  3AQK A;  3WFO A;  7ICT A;  3TFS A;  5D49 A;  4DOB A;  4EZ9 A;  2Q66 A;  2V4R A;  4PHE A;  9ICX A;  4YR0 A;  2GWS A;  4PPX A;  5KFG A;  3RAX A;  3PO4 A;  4RT2 A;  4BXO B;  5D4B A;  1Z00 B;  4KIT B;  3AU2 A;  4RUC A;  4RNM A;  1NK7 A;  3WFQ E;  3LK9 A;  2JEI A;  3RJH A;  4NY8 A;  4J9L A;  4E0D A;  4XQ7 A;  4ED8 A;  1KDH A;  1ZET A;  2IHN A;  1ZQJ A;  1ZQS A;  4K4H A;  4QZH A;  1L3U A;  4QZF A;  3BQ0 A;  2BGW A;  2PI4 A;  4ECY A;  1ZQZ A;  4XRH A;  1V4A A;  3C23 A;  5DLG A;  4O3S A;  4E80 A;  1ZQI A;  4GLX A;  4NLG A;  1JXL A;  1ZQT A;  1UT8 A;  2R8I A;  3ZD9 A;  4S3N A;  4X4T A;  2JZB A;  4F92 B;  2DVI A;  1ZQV A;  4BGD A;  2V9W A;  4DQP A;  3RJJ A;  2DRA A;  1BGX T;  4TQR A;  3T5H A;  3PX4 A;  3OUY B;  2ZH7 A;  2DPJ A;  3T5J A;  1BPY A;  1S0V A;  3ZDA A;  3HIY A;  4R66 A;  9ICQ A;  3BQ2 A;  5J2H A;  4BWM A;  1ZQU A;  5TZV A;  3GFK B;  3JPN A;  2ZH4 A;  2AGO A;  1XC9 A;  4ECX A;  3PX6 A;  1CUK A;  2F1H A;  5F9N A;  5KG6 A;  4O9M A;  4UD5 A;  4DQR A;  4IQW A;  4ED2 A;  1JN3 A;  2HVI A;  7ICO A;  8ICL A;  4EBC A;  9ICF A;  4HYK A;  4TUQ A;  3G6V A;  1DOQ A;  4P4M A;  2AU0 A;  4I27 A;  3GDX A;  4ECS A;  5DB8 A;  2IA6 A;  4UAY A;  1NK5 A;  4B9S A;  1TAU A;  2ZH2 A;  2OWO A;  5HRB A;  5KG4 A;  8ICF A;  5KFE A;  3NGD A;  2FMQ A;  3PW5 A;  5HRF A;  4YN4 A;  4NLN A;  4DSF A;  2PFN A;  3RH5 A;  5KFA A;  3MGI A;  1ARO P;  5DLF A;  2C2R A;  4DSE A;  3MBY A;  1U49 A;  4KLG A;  9ICT A;  5DKW A;  1KFT A;  3PR4 A;  4Q8F A;  4DFM A;  3RTV A;  1TFW A;  3PX0 A;  3BJY A;  4F4Y A;  9ICU A;  2M2W A;  1QLN A;  2R8K A;  4RQ2 A;  4B9M A;  1ZJM A;  4M6W A;  4JV0 A;  3E2E A;  4Q45 A;  3AQM A;  4UB3 A; 
#chains in the Genus database with same CATH topology
 4CF5 A;  3LWL A;  2IBK A;  3MFI A;  4DFK A;  1UT5 A;  2PFQ A;  1M6Y A;  4RNO A;  2OHF A;  2Y1I A;  1NKE A;  2XCP A;  1FIQ A;  2KKV A;  4JWN A;  1FO4 A;  3RJE A;  2UVW A;  1B4F A;  3JPT A;  4F3O A;  2BCU A;  1TAM A;  4M9L A;  4DSK A;  2NRW A;  5H2F U;  1LVH A;  4UB2 A;  4NJ8 A;  8ICN A;  5KFZ A;  4Y2J A;  4C0Z A;  3TKA A;  2AHO B;  1QTM A;  5HR6 A;  1BNO A;  1Y88 A;  2I5H A;  4F4K A;  1MIV A;  4GIB A;  1COK A;  1JMS A;  1SB3 C;  2Q4T A;  1NKC A;  4ZH4 A;  2BCR A;  2DBY A;  2XCA A;  4Q44 A;  5IIN A;  1NZP A;  3RB6 A;  1S10 A;  4WBZ A;  9ICM A;  3RB0 A;  3RF9 A;  4KLF A;  4O6A A;  5CWR A;  1V85 A;  2CPR A;  1TK8 A;  1XO1 A;  1ZQL A;  4WQK A;  3OHB A;  1BPB A;  4F5O A;  4GXK A;  5J2I A;  1ZQN A;  4PL2 A;  2KZ3 A;  3BQT A;  1L8L A;  2M9N A;  3C2M A;  5J2B A;  1RG6 A;  4Q8E A;  3RJI A;  8ICM A;  5L1I A;  3QU2 A;  1ZQ1 C;  5IIM A;  3PW0 A;  1V9P A;  5J0T A;  4PGY A;  4X4T A;  2YMP A;  1L3S A;  5KFP A;  4J9P A;  2YMM A;  3N97 B;  2XIC A;  4WC6 A;  3QXG A;  2ZTC A;  4X5V A;  5J0U A;  1Q46 A;  8ICG A;  5ALX A;  2KG5 A;  1SKS A;  4KX5 A;  4C4R A;  4O3P A;  3TAQ A;  2ZIW B;  1MQ3 A;  4FS1 A;  1L5U A;  1ZQR A;  4PH5 A;  2ZHA A;  2KTQ A;  1MSW D;  2WHE A;  4EEB A;  1O08 A;  4BDP A;  4I2H A;  2QB0 B;  3K7D A;  1K5O A;  4J03 A;  4YXM A;  1ZQP A;  4QZ8 A;  3RRG A;  3F2B A;  4ZOH C;  1J2N A;  7ICF A;  2BDP A;  5EE9 A;  5CB1 A;  4C8L A;  1KW4 A;  4WC7 A;  4ED7 A;  4HAI A;  3UQ0 A;  5KG0 A;  2ISP A;  1R89 A;  2KSO A;  4LEV A;  4NKT A;  1WWV A;  8ICI A;  4PL1 A;  1Z19 A;  1ECW A;  2V4Q A;  5DB6 A;  4X4N A;  5ALO A;  4NLC A;  1SZP A;  1KLN A;  5CRX A;  2KIW A;  4M47 A;  2G06 A;  1A6S A;  1TK5 A;  1TFR A;  1R8A A;  3N28 A;  1S97 A;  3B0Y A;  4B9V A;  2A3V A;  1T7P A;  1BVS A;  3TAN A;  3UPS A;  4J9M A;  4B6J A;  4EGW A;  9ICP A;  2XC9 A;  4RQ6 A;  4UB6 U;  4JLZ A;  3N4M B;  3QYP A;  1ZQK A;  4OAF A;  2F1I A;  3M9O B;  4BWJ A;  2AGQ A;  1L8O A;  4C80 A;  4TUR A;  3QEB Z;  5HRH A;  5J2E A;  4QZB A;  4IR9 A;  3UM9 A;  2OYY A;  7ICL A;  3RR7 A;  1ZJN A;  3LQC B;  5AKE A;  4F72 A;  1R8C A;  2NRK A;  1SWW A;  2W04 A;  3KOO A;  4RWQ A;  1XWL A;  2FI1 A;  1Z00 A;  2KHV A;  2LKY A;  2HHW A;  3UMC A;  2J6S A;  5HRI A;  4M6W B;  1JI7 A;  3D2S A;  2XI9 A;  4ED1 A;  4FBT A;  4Y2V A;  3CP8 A;  4O0I A;  2W9A A;  2H3V A;  1PUZ A;  1X6J A;  2YB4 A;  2E8M A;  2NO4 A;  4RWN A;  2W8L A;  2DQN B;  3TFR A;  1PK3 A;  4IC9 A;  2KP7 A;  1WCL A;  4K4G A;  5D61 A;  9ICH A;  3SMV A;  1SXD A;  1V97 A;  2P6U A;  2QB1 A;  3UMB A;  4YD1 A;  5ALM A;  4I28 A;  5AKL A;  3JPO A;  1ZXI A;  3RB4 A;  4BUG A;  1KL9 A;  3U26 A;  1VDV A;  2EZY A;  3RH4 A;  1T94 A;  2ZUD A;  3FAH A;  2FMS A;  5HP4 A;  2HHU A;  3KZI U;  3MGH A;  1JXE A;  4JWM A;  2XY5 A;  2HCF A;  5HR9 A;  2GH1 A;  5J0R A;  9ICS A;  1JX4 A;  5ALV A;  4DWI A;  4F5N A;  4ELU A;  4OO1 J;  1JAL A;  4Y2T A;  1XO0 A;  3OPX A;  2WF6 A;  4C7Y A;  4F5P A;  2DKZ A;  1NZB A;  5DDM A;  4Y2R A;  3R9K A;  1MQ2 A;  4O5K A;  3NTU A;  4I2J A;  3JPR A;  2EDU A;  4UBB A;  3RJK A;  4ED6 A;  1D8Y A;  1B43 A;  5KL8 B;  1SIJ A;  2ZJA A;  4TQS A;  4WQL A;  1KFD A;  1X9M A;  3OVS A;  4IL6 U;  1NK6 A;  4M9G A;  4M0A A;  3QEA Z;  3RFA A;  4G3I A;  4O3M A;  5F9L A;  1SL2 A;  2ISO A;  1BPE A;  2JV3 A;  3PML A;  4FS2 A;  2ESE A;  3ISB A;  1F0M A;  2Y9T A;  4F71 A;  1Z3E B;  4LEW A;  4ECR A;  2QAR B;  4FZM A;  5EOZ A;  3SR6 A;  4AT9 B;  2IMW P;  4FO1 A;  5DGB A;  3CK6 A;  4FE3 A;  2BZF A;  2KHQ A;  4F2R A;  1K1S A;  2YB1 A;  2K8A A;  4MHV A;  1OXJ A;  2I9G A;  2BCS A;  4KM5 A;  2XY6 A;  4DFJ A;  2B56 A;  5C0Y A;  2K89 A;  3M8R A;  5KFS A;  2JR5 A;  3OVB A;  1L3T A;  1NI3 A;  3T5K A;  3EPG A;  1U9L A;  1KNY A;  5JU5 A;  5DBA A;  9ICL A;  4X0B A;  2E8N A;  1N61 A;  3IDW A;  2HHP A;  2HN2 A;  3WFS C;  4BJQ A;  9ICK A;  5ALG A;  3KHR A;  3IN5 A;  2DR8 A;  1KSP A;  5KFL A;  2BQR A;  3IG8 A;  3GZF A;  2HOI A;  1NJX A;  8ICO A;  5HRE A;  4QWA A;  3UXN A;  1TK0 A;  4F4Z A;  2P6R A;  1IM4 A;  4ECW A;  1N56 A;  2KVS A;  5J2F A;  1RXW A;  2BBJ A;  2AQ0 A;  2W9B A;  4GXI A;  3AQE A;  2K4P A;  3EUB 2;  4NM1 A;  5KFV A;  4DQQ A;  2ZIX B;  3SYZ A;  1U4B A;  2LI6 A;  3NS1 A;  3H8S A;  3NUQ A;  5J2G A;  3AQK A;  3WFO A;  5AKH A;  2Q66 A;  3ALR A;  3RAX A;  3PO4 A;  3KKA C;  4RT2 A;  4KIT B;  4RUC A;  1NK7 A;  3LK9 A;  3RJH A;  2K4H A;  1KDH A;  3KFU F;  5AI9 A;  3SQI A;  1QH9 A;  1ZQS A;  4NLB A;  4QZH A;  4UAS A;  2PI4 A;  1QQ5 A;  3L3F X;  1YZ7 A;  5DLG A;  4E80 A;  4GLX A;  4K99 A;  1UT8 A;  2A19 A;  2V9W A;  1LKY B;  3RJJ A;  1SV0 C;  4TQR A;  3T5H A;  3PX4 A;  2ZH7 A;  3T5J A;  1S0V A;  2Y0S F;  1FFV A;  5TZV A;  2AGO A;  3PX6 A;  1N63 A;  4OJO A;  2HVI A;  3SEN A;  3QU7 A;  1TAU A;  2YN4 A;  2FMQ A;  4YN4 A;  4DSF A;  5G5G A;  3RH5 A;  5KFA A;  5DLF A;  4KLG A;  5DKW A;  1Z4N A;  4F4Y A;  2RQ5 A;  4RQ2 A;  2DKX A;  1ZJM A;  5G5H A;  2W54 A;  3E2E A;  3WK8 A;  4R64 A;  1RZT A;  2IHO A;  1NJZ A;  3C5G A;  2ZUB A;  4QZ9 A;  2XID A;  4AT7 B;  2WB1 F;  5KFY A;  5J29 A;  2DR5 A;  2DWQ A;  2VA2 A;  3JPQ A;  5IIJ A;  2Y1J A;  3RH6 A;  4F2S A;  4CCH A;  2ZG6 A;  3RRH A;  4QW9 A;  4QWB A;  2A1J B;  2BDU A;  3MGV A;  3FC4 A;  5KFB A;  4YVZ A;  5BPC A;  3DV9 A;  2ZIX A;  3PSF A;  1KFS A;  4KLM A;  2JXJ A;  5KT2 A;  3Q8Q B;  5ALR A;  1TV9 A;  3G6X A;  5A0L A;  2XO7 A;  3ORY A;  1N62 A;  4C8O A;  1HUZ A;  4WCW A;  4IQV A;  1BPX A;  1S76 D;  3Q8K A;  4F50 A;  3QE9 Y;  4JK1 A;  5CJ7 A;  3OVA A;  5AI6 A;  4TUS A;  2MSN A;  3GU3 A;  2KZM A;  3NAS A;  3QZ8 A;  3FDS A;  3ONN A;  2MU2 A;  4AYB C;  4KLS A;  3M6K A;  1YLQ A;  5F2V O;  1K1Q A;  3HPO A;  4J9S A;  2BR0 A;  1S9F A;  4UW9 A;  4Q43 A;  4WH5 A;  4NXX A;  2FPK A;  3V7J A;  8ICC A;  3M9M B;  1R8B A;  5IIL A;  4DL7 A;  4ELV A;  2XVT A;  1D9F A;  3QU4 A;  2W9C B;  2QKQ A;  3OHA A;  4DSI A;  2DR7 A;  2Y0S C;  4UAT A;  5AIA A;  5HC9 A;  5HMM A;  2KJ5 A;  4IR1 A;  2IHM A;  3ZDD A;  5KT5 A;  4Z6D A;  4RQ5 A;  4O3Q A;  3ETL A;  5HRG A;  2NRZ A;  2UVR A;  3BZK A;  4PGX A;  5L9X A;  1FFU A;  1RM6 C;  2I1Q A;  2MUT B;  3N7R C;  4CE6 A;  1ZQO A;  2ID1 A;  3V6K A;  3RJG A;  1F5S A;  3GV5 B;  3IV6 A;  5AKX A;  2R8J A;  2IOF K;  4YXJ A;  4UAW A;  4EX7 A;  5ALJ A;  2EAP A;  4EBK A;  3UXO A;  4GFJ A;  4UB8 U;  2C22 A;  5KAI U;  4DL3 A;  2ZH5 A;  5J2C A;  5CFU A;  5B3Q A;  2HHS A;  2WF5 A;  4EEN A;  3L4P A;  5KFU A;  4E8F A;  3T3F A;  1GO3 F;  1RYS A;  7ICE A;  2KOB A;  2LMR A;  3ETR A;  1WUD A;  2HSZ A;  5III A;  3PNC A;  3AQF A;  3HJE A;  4YMN A;  4DS5 A;  3EW9 A;  1VFG A;  1ZRM A;  2OM6 A;  1ZQY A;  5HML A;  7ICS A;  2JZB B;  2KN7 A;  1SL1 A;  4JMU A;  1RYU A;  1PZN A;  3PSP A;  1ZD4 A;  5CFT A;  2ZIV A;  1UA0 A;  1NK4 A;  2VJ5 A;  4I2I A;  3HX0 A;  4LZD A;  4O5E A;  1ZQX A;  4F91 B;  3V6H A;  8ICT A;  2B51 A;  3I76 A;  2UVU A;  1L7M A;  2AGP A;  1T3N A;  2HDO A;  1ZQB A;  4RQ1 A;  1SZH A;  1OW5 A;  3IP4 B;  3OV7 A;  1S8O A;  2Q0Z X;  3C2K A;  2FJ6 A;  2NYV A;  1Q3V A;  3MDA A;  2W8K A;  4OJP A;  1DK2 A;  1X2I A;  3KHL A;  3NRW A;  2CXY A;  4YP3 A;  3HW8 A;  4YR2 A;  5ALN A;  3KD3 A;  3AUO A;  4RU9 A;  1NOM A;  2D8C A;  2ZHB A;  2DR9 A;  7ICQ A;  4RPX A;  1DGS A;  2HHX A;  4DQI A;  3WKC A;  2AQ4 A;  2ASD A;  2JHD A;  1NKB A;  4EEY A;  3KHH A;  1N48 A;  3GIJ A;  3QNM A;  2JEJ A;  2B6G A;  3TAR A;  1L6N A;  4XJE A;  2W7P A;  2W9M A;  4DLE A;  3PMN A;  2ZIU B;  9ICG A;  4PGQ A;  2W3S A;  2LYA A;  4EYI B;  4GC7 A;  4QJF B;  4MKP A;  5KFM A;  5HRD A;  2ATL A;  1MA7 A;  3PV8 A;  9ICW A;  3H4D A;  1Q79 A;  5T14 A;  5HNK A;  3L5K A;  3H0M B;  2HI0 A;  3JYY A;  4CNQ A;  4MEX A;  5JRT A;  2DRB A;  4IQT A;  4FO6 A;  2LM1 A;  2H3F A;  5EE3 A;  4OCZ A;  4DS4 A;  2DL0 A;  4RWO A;  5HHH A;  4I2B A;  4MFC A;  4FHV A;  4ATB B;  2R8H A;  3NVZ A;  2GLE A;  4E7X A;  3QU5 A;  4RPZ A;  5AIC A;  2ALZ A;  1UA1 A;  4J9R A;  3UQ2 A;  1XU4 A;  3ZDE A;  2WF9 A;  1U45 A;  2WTF A;  4M9J A;  1Q8K A;  3GIL A;  4M04 A;  4K98 A;  2W43 A;  2MAX A;  2NRV A;  3FM9 A;  5L1K A;  9ICO A;  4FH5 A;  2KFZ A;  5ALL A;  3BS5 B;  5AI8 A;  4PZN A;  5AM0 A;  2ZH6 A;  2EAM A;  4FHW A;  5CP2 A;  3RB3 A;  3V6J A;  2FLN A;  2DPI A;  4LVS A;  3HRD D;  1IIP A;  4HX0 A;  4KLE A;  1ZQD A;  4F4X A;  5B5E U;  5ALT A;  2JGA A;  2ZH9 A;  5DGA A;  5KFF A;  4X4U A;  4IRD A;  4LJX A;  3V7L A;  4NXW A;  3G6Y A;  1QSS A;  4OJ5 A;  5DQG A;  4Z6F A;  3WKD A;  3MFH A;  5J0S A;  4X4V A;  3A0H U;  4RUA A;  4M5D A;  4B9T A;  2J6T A;  8ICZ A;  1L7N A;  5JUM A;  1J97 A;  3HKZ C;  4ECT A;  2ES6 A;  5AM4 A;  5HR7 A;  1LB2 B;  2XGQ A;  3ERC C;  2K8C B;  1SV4 A;  4WC0 A;  3OWG A;  9ICN A;  4YFK A;  2BCQ A;  3SZ2 A;  2PFP A;  4QZA A;  2K4I A;  1QQ7 A;  3QX7 A;  3KKA A;  1ZYQ A;  5AM5 A;  5EWF A;  2E8O A;  3H8W A;  2ZIW A;  2DFL A;  3RBE A;  2M2V A;  5ALQ A;  4FZL A;  3I1Y A;  3H38 A;  2H3Q A;  4IRC A;  1S0O A;  3ISC A;  2HHQ A;  5HHI A;  1ED1 A;  4OJL A;  2QB0 A;  3NVW A;  3CRX A;  2K4E A;  1O03 A;  3K1Z A;  5DDY A;  2HN1 A;  3WK7 A;  4R63 A;  1SV0 A;  4M9H A;  5EWE A;  2XGP A;  1HUO A;  5ALS A;  2G09 A;  1ZQW A;  1N2X A;  4NLZ A;  4F5Q A;  3N7S C;  4EZ9 A;  2V4R A;  4PPX A;  4BXO B;  5D4B A;  2LPE A;  3WFQ E;  3WK9 A;  2E8P A;  4J9L A;  2YMQ A;  4ED8 A;  4XQ7 A;  1ZET A;  2IHN A;  1ZQJ A;  2BGW A;  2DF4 B;  3H8M A;  4ECY A;  1ZQZ A;  1X66 A;  4Y2U A;  3BS5 A;  4NLG A;  1ZQT A;  3ZD9 A;  4BGD A;  3OUY B;  1BPY A;  2NO5 A;  2YX8 A;  2R18 A;  1DXS A;  3WU2 U;  9ICQ A;  3HIY A;  3GFK B;  2ZH4 A;  1XC9 A;  4ECX A;  4O9M A;  1IG6 A;  5KG6 A;  4QIW C;  4IQW A;  1JN3 A;  7ICO A;  4JB3 A;  4EBC A;  4HYK A;  4TUQ A;  3G6V A;  4I27 A;  4P4M A;  9ICF A;  3GDX A;  3QU9 A;  2IA6 A;  2ZH2 A;  4BX9 C;  5KG4 A;  2KVC A;  2HBK A;  5KFE A;  5HRF A;  1ARO P;  1U49 A;  4DSE A;  4DCC A;  3MBY A;  9ICT A;  1KFT A;  4Q8F A;  3A0B U;  9ICU A;  2M2W A;  4IS7 A;  4B9M A;  4NXT A;  1GPJ A;  4M6W A;  4JV0 A;  4C7Z A;  4UB3 A;  2KZZ A;  3AEV A;  1HJP A;  1RQL A;  3Q8M A;  3ZI4 A;  3DDH A;  2Z7J A;  4C8M A;  5KFX A;  2H3Z A;  4A8E A;  5KFO A;  5KFN A;  2ZJ5 A;  5DBC A;  4ICA A;  1QSY A;  4QNL A;  1C7Y A;  4PHP A;  5BOL A;  4DOC A;  2HOQ A;  5DQI A;  5GTI U;  2G07 A;  2W11 A;  1KKX A;  4J9N A;  3JPS A;  4F8R A;  3JPP A;  4O3N A;  2B0C A;  1YZ6 A;  4QZG A;  4FZN A;  3IG5 A;  3TAP A;  2FMP A;  4FHP A;  2OCE A;  2AH5 A;  4UD4 A;  4WC1 A;  3OSP A;  5KFT A;  3AQN A;  4K8V A;  3CYM A;  4O69 A;  2FPM A;  2LBO A;  2NRT A;  1NK9 A;  2YQE A;  2KEY A;  3C2L A;  2E5S A;  1Z1B A;  7ICM A;  3NWI A;  1KTQ A;  3WKB A;  5KG1 A;  4DL6 A;  2BE3 A;  2WAQ F;  5J2A A;  4X4S A;  1QSL A;  8ICS A;  3V7K A;  3S6J A;  4QWC A;  3HJ1 A;  5ALF A;  4DL2 A;  5AKJ A;  3AMZ A;  2VKQ A;  8ICW A;  2E3T A;  7ICN A;  1NO5 A;  4UAR A;  4P0P B;  4UQG A;  1XSP A;  1YT3 A;  1JUD A;  3V72 A;  4AYB F;  5ALU A;  5CHE A;  4M2Y A;  2IOH A;  1L7O A;  2WF8 A;  1WOT A;  2M0N A;  4RQN A;  7ICK A;  1DGJ A;  1KRP A;  4KLT A;  4DL5 A;  2QLT A;  1UHU A;  1PVQ A;  4AT8 B;  1KN5 A;  2O6K A;  4KB6 A;  5ALK A;  4EYH B;  4MFF A;  2BQU A;  2OEH A;  4YG2 A;  4O3O A;  2QAR A;  5CEH A;  3DEE A;  3C18 A;  1S77 D;  4AT9 A;  1U47 A;  3OSN A;  3Q8P B;  4R8U B;  2F1J A;  5ALZ A;  1F5A A;  2KFN A;  4NV0 A;  8ICV A;  4F5R A;  4U6P A;  2RFF A;  4IQU A;  2GOL A;  1ZQA A;  4X4O A;  2AJQ A;  1X6I A;  1X40 A;  4PHD A;  5J0Q A;  1D9D A;  2IUB A;  3SV3 A;  2KIC A;  3BDP A;  4JLX A;  4KTQ A;  1FEZ A;  1TE2 A;  3GIK A;  4NXZ A;  4RQ4 A;  3LWM A;  5E79 U;  4FH3 A;  1LV5 A;  5AKY A;  1JAJ A;  3GV7 B;  3AL0 B;  3EPI A;  4DLG A;  3OJS A;  5KFH A;  3GIM A;  3F53 A;  5KFJ A;  3ER9 B;  2G0A A;  2KIV A;  1BPZ A;  1VJ5 A;  2HOF A;  4O67 A;  2WF7 A;  4P4P A;  8ICU A;  1PK1 B;  5KFQ A;  2P66 A;  4C4T A;  4FFD A;  2EAN A;  3KHG A;  8ICP A;  2WAQ C;  4KN7 A;  1WCN A;  3HP6 A;  3LVV A;  1N5X A;  1QQ6 A;  4B9U A;  1RPL A;  4OAH A;  2F44 A;  4DO9 A;  7ICJ A;  1L7P A;  3LVW A;  5AKK A;  1AQ6 A;  3LYS A;  1SKR A;  5KG5 A;  3M7D A;  4RQ8 A;  1ZQH A;  2J6U A;  5L1L A;  3C1Z A;  5J2J A;  2VA3 A;  4ELT A;  4ECV A;  3Q8L A;  1T4G A;  2O5A A;  2KJ9 A;  4B9L A;  3CNH A;  1LKY A;  1JRO A;  5DB7 A;  2YTU A;  3T5L A;  2GO7 A;  4JUZ A;  2ZUC A;  3PR5 B;  2R8G A;  1N5W A;  2ZTD A;  2KD1 A;  2KJ8 A;  3NVO A;  3SI8 A;  4Z6C A;  3QUT A;  2C28 A;  5AKZ A;  1JIH A;  1WG8 A;  1ZD5 A;  4DFP A;  3UXP A;  2PMZ C;  5D63 A;  4P2H A;  2FLL A;  1ZD3 A;  1NJY A;  3M9N B;  5DQH A;  5KFR A;  3WFP A;  5CA7 A;  2ZH1 A;  1URJ A;  5AI4 A;  4FHY A;  5DEC A;  2F77 X;  5D62 A;  4RNN A;  2JH1 A;  3HJ4 A;  2HBL A;  4AT7 A;  4X4P A;  4ECU A;  8ICB A;  3AM9 A;  4Y2P A;  1A76 A;  1CEZ A;  5KTQ A;  4NL9 C;  3QUQ A;  1P7D A;  4KLH A;  2BCV A;  1HIW A;  2WFA A;  2MA1 A;  2W03 A;  4UAU A;  3TI0 A;  5J0Y A;  4XA5 A;  4Y2Q A;  3MR2 A;  8ICR A;  4OAI Z;  4EBD A;  4KMO B;  4TUP A;  4WC4 A;  4CF4 A;  2A1J A;  9ICC A;  2Y9U A;  4I2E A;  2BKE A;  5J8Y C;  4WBY A;  1ZQG A;  1KBU A;  8ICX A;  5JTG A;  1TFY A;  1OU5 A;  1Z4O A;  5DBB A;  4RQ3 A;  8ICY A;  9ICJ A;  4X4R A;  4UB1 A;  1NK0 A;  3AQL A;  4QZC A;  2EZZ A;  2JMG A;  1SXE A;  3UMG A;  5KT3 A;  3KTQ A;  3RBD A;  2HBJ A;  4GXJ A;  4DFD A;  5AM2 A;  5DG9 A;  2PBE A;  4Y2Y A;  5KAF U;  1UEV A;  3KZX A;  2KSO B;  1MIY A;  2L5Y A;  4WOY A;  4EV6 A;  5BOM A;  2NV3 A;  4QZI A;  3PHZ A;  3IRU A;  4UAZ A;  4DL4 A;  4FHX A;  3NVV A;  2ZH8 A;  4UB4 A;  4YMO A;  4I0U A;  2F3N A;  3GQC A;  1ZQQ A;  2HHV A;  3WK6 A;  3H40 A;  2W55 A;  2W9C A;  4CRX A;  4DSL A;  3EYZ A;  4YR3 A;  4C4S A;  2JH7 A;  1IXR A;  4MF2 A;  4UB5 A;  5ALH A;  3SD7 A;  4U7C A;  3HKZ F;  4GC6 A;  2B4V A;  5AM1 A;  4UBC A;  2BPF A;  2KMD A;  9ICE A;  7ICV A;  4PJ0 U;  3OTQ A;  1UPH A;  2ASL A;  1D8B A;  2W3R A;  5DED A;  2ASJ A;  5AK3 A;  1COO A;  5J2K A;  3Q8R B;  2MUT A;  3L9D A;  5C5J A;  1QCK A;  9ICV A;  1TVA A;  3NYB A;  4EBJ A;  2RLT A;  4MFA A;  2I6X A;  5HRK A;  4X0A A;  4MF8 A;  4K4I A;  4I29 A;  5KFI A;  5J2D A;  5CHG A;  7ICT A;  3TFS A;  4DOB A;  9ICX A;  4PHE A;  4YR0 A;  5KFG A;  1Z00 B;  3AU2 A;  2JEI A;  4NY8 A;  2F2A B;  5ALP A;  1CRX A;  1B0X A;  1HEK A;  1L3U A;  1DRG A;  4XRH A;  3C23 A;  1ZQI A;  1JXL A;  1A0P A;  4S3N A;  2R8I A;  2JZB A;  1ZQV A;  4DQP A;  2DRA A;  2DPJ A;  1XNS A;  4R66 A;  5J2H A;  4BWM A;  1ZQU A;  5ALI A;  2F76 X;  3QUB A;  2F1H A;  4UD5 A;  2RP5 A;  4LEZ A;  4ED2 A;  4EEK A;  2AU0 A;  4ECS A;  5DB8 A;  1IV8 A;  4B9S A;  8ICF A;  3NGD A;  4NLN A;  3CW2 C;  1WWU A;  3MGI A;  4EEL A;  2LYB A;  4QIW F;  3E58 A;  2DUY A;  3RTV A;  1TFW A;  4Y2X A;  2LM4 A;  3BJY A;  3H0R B;  4P0Q B;  2HBM A;  3TAD C;  2GA9 D;  2IOF A;  3J81 j;  1ZQC A;  3ZD8 A;  4EZ6 A;  3TAC B;  8ICJ A;  9ICB A;  8ICQ A;  4NWI A;  3H7I A;  4ED0 A;  4KLU A;  1MC8 A;  5IIO A;  2ZTE A;  4KLL A;  2K8B B;  3OGU A;  5L1M A;  5AHX A;  4RQM A;  1F44 A;  4EBE A;  4CDG A;  5ALY A;  1C20 A;  2GAF D;  5CFS A;  5KFW A;  2KV2 A;  3SAG A;  1UET A;  1VJ7 A;  1ZQM A;  2ZIU A;  4QW8 A;  3D2Q A;  4K97 A;  3HT3 A;  1CI4 A;  3F2D A;  5DB9 A;  9ICI A;  8ICA A;  4IRK A;  2PXI A;  4J9O A;  1U48 A;  5KG2 A;  1DK3 A;  3GII A;  4YMM A;  4XQ8 A;  3C28 A;  4NKU A;  5AIB A;  1B22 A;  5EWG A;  5AK6 A;  4PZO A;  3ISD A;  2M2U A;  1BPD A;  5J0O A;  3ZDC A;  4ATB A;  4J9Q A;  3MR5 A;  4N7R A;  2VAN A;  4O3R A;  4RQ0 A;  4C8K A;  2ZJ8 A;  2G08 A;  3BQ1 A;  2CRX A;  4P4O A;  3M8S A;  2DGZ A;  1X9W A;  2HMX A;  3EWA A;  3K75 D;  3C5F A;  1FA0 A;  5KT7 A;  3PSI A;  7ICR A;  2RDI A;  1TKD A;  4KLO A;  4I2A A;  4O68 A;  4QZD A;  4NM2 A;  4DF8 A;  3LDA A;  4Y2S A;  1TAQ A;  4QZE A;  2B21 A;  1MN8 A;  4P0Q A;  3F5E A;  5HRL A;  1A77 A;  2EZX A;  5K4L A;  4OAG A;  1XS9 D;  1Q78 A;  4RWP A;  2W9B B;  3JCF A;  7ICI A;  2LHT A;  3QUC A;  4JV2 A;  4YQW A;  4M9N A;  3MR3 A;  2YML A;  3C21 A;  5KT4 A;  1Q3U A;  2PFO A;  3PO5 A;  3E0F A;  4WC3 A;  2HVH A;  5KT6 A;  2XY7 A;  1T8E A;  1ZRN A;  2UVV A;  5ALW A;  3TQ1 A;  3MAB A;  3THV A;  4WC5 A;  7ICG A;  3WKE A;  4KLQ A;  4X4Q A;  5AKI A;  1X9X A;  3RJF A;  2AXT U;  4KLJ A;  1KEJ A;  3M6Z A;  3SEI A;  2RDJ A;  5AK4 A;  4K96 A;  2W7O A;  2G5H B;  4I2D A;  2RRD A;  5AK5 A;  4EED A;  3RAQ A;  8ICE A;  2G5I B;  3SAH A;  4KLD A;  3KBB A;  3H3A A;  2VJ4 A;  3C29 A;  2EQY A;  2BQ3 A;  3H39 A;  4O5C A;  3FYH A;  1UEU A;  3IM1 A;  4RZR A;  5ALE A;  9ICA A;  2JRZ A;  3D6J A;  3I28 A;  2NRX A;  3BZC A;  3RR8 A;  4KX3 A;  3ICX A;  4RQ7 A;  5F3X B;  5KG3 A;  1V38 A;  1XSL A;  3F5A A;  4Z6E A;  4BXO A;  4NXV A;  2M2T A;  3C1Y A;  3HWT A;  1SKW A;  5KL1 B;  1H38 A;  3PW2 A;  4ECQ A;  3M1Y A;  3AU6 A;  7ICU A;  1SGG A;  1XSN A;  4I2G A;  4KLI A;  2YY6 A;  3H37 A;  4QWE A;  2KE7 A;  2P35 A;  3OUY A;  3D2N A;  1PX5 A;  4US8 A;  1ZQF A;  3ED5 A;  4F4W A;  5KFC A;  3WK4 A;  3MDC A;  4IG8 A;  2H3I A;  5KFD A;  1NJW A;  3H4B A;  4ED3 A;  3NVY A;  4JV1 A;  4EP7 A;  5AI5 A;  4MEY A;  5FP0 A;  3GV8 B;  4NL9 A;  4I2C A;  5J0W A;  7ICH A;  1EXN A;  4B9N A;  3VC8 A;  4KN4 A;  1S5L U;  3MR6 A;  1X9S A;  2VA8 A;  2JEF A;  2OH2 A;  3UPQ A;  4OJ6 A;  2LYH A;  2ZH3 A;  3O0F A;  5KG7 A;  1S0N A;  2PMZ F;  2D3D A;  2VIX A;  5J8Y A;  4J9K A;  3PVX A;  4NXU A;  2EH9 A;  4F93 B;  2FE9 A;  4ACO A;  2ZXI A;  2F8L A;  4DOA A;  5CR0 A;  1UCV A;  2FLP A;  3H8J A;  4DQS A;  3EF2 A;  8ICK A;  3IHQ B;  5B66 U;  2CN1 A;  4US9 A;  4YCX A;  3MCR A;  1D8L A;  1SWV A;  2EAO A;  4RT3 A;  1PVR A;  5B3P A;  5KNI A;  3B0X A;  3PW7 A;  4K9B A;  1SL0 A;  2HHT A;  2C2E A;  2BPC A;  2ODG A;  2ZXH A;  5J0X A;  1RQN A;  2FDR A;  5JTI A;  4ECZ A;  2MRL A;  1S0M A;  1VLB A;  3PST A;  2C2D A;  3PY8 A;  3WFR E;  1PVP A;  4USA A;  5ALD A;  5AI0 A;  3QZ7 A;  2OXO A;  2E1E A;  3EZ5 A;  9ICR A;  1KQQ A;  3ER8 C;  5L1J A;  4LT6 A;  3HIL A;  1UQV A;  4PHA A;  4LZG A;  3WK5 A;  1ZQE A;  2PI5 A;  4XUS A;  5GTH U;  4I2F A;  1MIW A;  2H5X A;  3Q8S B;  2O1P A;  4KMU A;  5D46 A;  4NLK A;  3C66 A;  3N7P D;  3PZP A;  4DF4 A;  3SAF A;  4P0P A;  4QWD A;  2HW3 A;  3T79 A;  2BHN A;  2E1F A;  4R65 A;  4CGZ A;  5KFK A;  3K4G A;  3ZDB A;  1Z1V A;  5DG8 A;  3JZ0 A;  1ZD2 P;  1RYR A;  1X42 A;  3OJU A;  1RXV A;  3MC1 A;  1J2M A;  4AT8 A;  1JRP A;  5AM3 A;  1N60 A;  4K9A A;  1T3Q A;  2KNJ A;  2BPG A;  8ICH A;  2K60 A;  1BNP A;  1L3V A;  4C8N A;  5AKG A;  2ZIV B;  2FPL A;  3BS7 A;  3NRZ A;  7ICP A;  5J0P A;  4FBU A;  1ZOL A;  4R8U A;  4YD2 A;  3SV4 A;  1NK8 A;  5IIK A;  3PW4 A;  4DSJ A;  2A1A A;  2EWR A;  4UAV A;  5DG7 A;  3BQ7 A;  4EX6 A;  4DEZ A;  3VCB A;  4WC2 A;  2JEG A;  4RPY A;  1JQR A;  1NNL A;  5D49 A;  1WYG A;  2PKE A;  2GWS A;  3B9J A;  4RNM A;  4E0D A;  4K4H A;  4QZF A;  3BQ0 A;  3AN1 A;  1V4A A;  4O3S A;  2F8K A;  3NKU A;  2BBH A;  4F92 B;  2DVI A;  2D6F C;  1BGX T;  2N1R A;  3TAD A;  3K1R B;  4LEY A;  3ZDA A;  3BQ2 A;  1OUQ A;  3JPN A;  4WJ3 B;  2KK0 A;  1CUK A;  5F9N A;  3F2C A;  4DQR A;  2FCL A;  8ICL A;  3H0L B;  5EE1 A;  1PK1 A;  1DOQ A;  4UAY A;  1NK5 A;  2OWO A;  5HRB A;  3WKA A;  4CF3 A;  3PW5 A;  2PFN A;  2C2R A;  2KKP A;  4OD0 A;  4AP9 A;  3PR4 A;  1RDF A;  5EE0 A;  4DFM A;  5TIS U;  2WB1 C;  3PX0 A;  4G9B A;  1QLN A;  2R8K A;  2RHF A;  4Q45 A;  3AQM A; 
#chains in the Genus database with same CATH homology
 4R64 A;  1ZQC A;  1RZT A;  2KZZ A;  1NJZ A;  1HJP A;  3ZD8 A;  3LWL A;  2IBK A;  3MFI A;  4EZ6 A;  3Q8M A;  3C5G A;  8ICJ A;  9ICB A;  2ZUB A;  4DFK A;  4C8M A;  8ICQ A;  4QZ9 A;  1UT5 A;  5KFX A;  2PFQ A;  4AT7 B;  3H7I A;  5KFY A;  4RNO A;  2Y1I A;  5KFO A;  5KFN A;  2ZJ5 A;  4ED0 A;  4KLU A;  5J29 A;  1MC8 A;  1NKE A;  5DBC A;  2XCP A;  2DR5 A;  1QSY A;  5IIO A;  1C7Y A;  4PHP A;  2ZTE A;  5BOL A;  4DOC A;  4KLL A;  4JWN A;  2VA2 A;  3RJE A;  5DQI A;  3JPT A;  3OGU A;  2UVW A;  4F3O A;  3JPQ A;  2BCU A;  5IIJ A;  4J9N A;  3JPS A;  4EBE A;  2Y1J A;  4F8R A;  4M9L A;  3JPP A;  2NRW A;  4O3N A;  3RH6 A;  4DSK A;  4F2S A;  4QZG A;  4CCH A;  5KFW A;  3RRH A;  1VJ7 A;  1UET A;  4QW9 A;  3TAP A;  1ZQM A;  4QWB A;  4UB2 A;  2FMP A;  2A1J B;  4QW8 A;  8ICN A;  4FHP A;  5KFZ A;  4UD4 A;  4WC1 A;  3OSP A;  3HT3 A;  5KFT A;  5KFB A;  3AQN A;  4YVZ A;  5BPC A;  1KFS A;  4KLM A;  5KT2 A;  2FPM A;  3Q8Q B;  2NRT A;  1TV9 A;  1NK9 A;  1QTM A;  3G6X A;  3C2L A;  5DB9 A;  2XO7 A;  9ICI A;  3ORY A;  8ICA A;  1Y88 A;  1HUZ A;  4C8O A;  4F4K A;  4IQV A;  7ICM A;  1BNO A;  1MIV A;  1KTQ A;  1BPX A;  1JMS A;  1S76 D;  5KG1 A;  4IRK A;  2PXI A;  4J9O A;  3Q8K A;  1U48 A;  4F50 A;  4DL6 A;  2BE3 A;  1NKC A;  4ZH4 A;  5J2A A;  3QE9 Y;  4JK1 A;  5KG2 A;  5CJ7 A;  3GII A;  2BCR A;  4YMM A;  4XQ8 A;  1DK3 A;  4X4S A;  3OVA A;  4NKU A;  1B22 A;  5EWG A;  4TUS A;  2XCA A;  4Q44 A;  5IIN A;  3RB6 A;  1S10 A;  1NZP A;  4WBZ A;  9ICM A;  1QSL A;  8ICS A;  3ISD A;  3RB0 A;  2KZM A;  3V7K A;  1BPD A;  2M2U A;  3QZ8 A;  3FDS A;  4QWC A;  5J0O A;  3HJ1 A;  4KLF A;  4DL2 A;  5CWR A;  4KLS A;  1TK8 A;  1ZQL A;  1XO1 A;  3ZDC A;  3OHB A;  1BPB A;  4F5O A;  4GXK A;  5J2I A;  1YLQ A;  1ZQN A;  8ICW A;  5F2V O;  4ATB A;  4J9Q A;  1K1Q A;  2KZ3 A;  3BQT A;  3HPO A;  7ICN A;  3MR5 A;  4J9S A;  2M9N A;  3C2M A;  5J2B A;  2BR0 A;  1S9F A;  2VAN A;  1NO5 A;  4O3R A;  4Q8E A;  3RJI A;  4RQ0 A;  4UQG A;  4Q43 A;  1XSP A;  8ICM A;  5L1I A;  4C8K A;  2FPK A;  3V7J A;  2ZJ8 A;  8ICC A;  3M9M B;  5IIM A;  3V72 A;  3PW0 A;  1V9P A;  5J0T A;  4PGY A;  5IIL A;  4DL7 A;  4ELV A;  4M2Y A;  1R8B A;  3BQ1 A;  1L3S A;  1D9F A;  2W9C B;  3OHA A;  4DSI A;  4P4O A;  3M8S A;  5KFP A;  4J9P A;  3N97 B;  1WOT A;  4WC6 A;  2DR7 A;  1X9W A;  2ZTC A;  3EWA A;  3K75 D;  3C5F A;  5J0U A;  4X5V A;  1KRP A;  4KLT A;  5HMM A;  5KT7 A;  4IR1 A;  7ICR A;  4DL5 A;  5HC9 A;  2RDI A;  2IHM A;  8ICG A;  1TKD A;  3ZDD A;  4AT8 B;  5KT5 A;  4Z6D A;  1SKS A;  4RQ5 A;  4O3Q A;  4I2A A;  4KLO A;  4O3P A;  3ETL A;  4QZD A;  2NRZ A;  3TAQ A;  5HRG A;  2UVR A;  4NM2 A;  4DF8 A;  4EYH B;  3LDA A;  4PGX A;  1MQ3 A;  4MFF A;  2BQU A;  4FS1 A;  1L5U A;  1ZQR A;  4PH5 A;  4YG2 A;  1TAQ A;  4O3O A;  4QZE A;  2ZHA A;  2B21 A;  2KTQ A;  5L9X A;  1S77 D;  1MSW D;  3C18 A;  4I2H A;  4BDP A;  5HRL A;  1A77 A;  4AT9 A;  1U47 A;  2I1Q A;  2MUT B;  3OSN A;  3Q8P B;  4YXM A;  4R8U B;  1ZQO A;  1ZQP A;  4QZ8 A;  3RRG A;  2ID1 A;  3V6K A;  3RJG A;  2F1J A;  3GV5 B;  7ICF A;  1XS9 D;  1F5A A;  2BDP A;  2R8J A;  5CB1 A;  4YXJ A;  4UAW A;  4C8L A;  2KFN A;  1Q78 A;  4EBK A;  4RWP A;  4WC7 A;  2W9B B;  4ED7 A;  3UQ0 A;  3UXO A;  5KG0 A;  2ISP A;  7ICI A;  1R89 A;  8ICV A;  4JV2 A;  4F5R A;  8ICI A;  4NKT A;  4YQW A;  4M9N A;  3MR3 A;  2RFF A;  2C22 A;  4IQU A;  2V4Q A;  4DL3 A;  3C21 A;  5DB6 A;  2ZH5 A;  5J2C A;  1ZQA A;  5KT4 A;  2PFO A;  4X4O A;  3PO5 A;  2HHS A;  2AJQ A;  4X4N A;  4E8F A;  5KFU A;  1SZP A;  4WC3 A;  3T3F A;  4PHD A;  1RYS A;  2HVH A;  5J0Q A;  7ICE A;  5KT6 A;  2XY7 A;  1T8E A;  1D9D A;  1KLN A;  5III A;  3SV3 A;  2UVV A;  3PNC A;  3BDP A;  3TQ1 A;  4M47 A;  4KTQ A;  3MAB A;  3GIK A;  4NXZ A;  1TFR A;  3THV A;  1TK5 A;  7ICG A;  4YMN A;  1R8A A;  4DS5 A;  4WC5 A;  3EW9 A;  4RQ4 A;  1S97 A;  3LWM A;  1VFG A;  1ZQY A;  4KLQ A;  5HML A;  3B0Y A;  4FH3 A;  7ICS A;  1LV5 A;  4X4Q A;  4B9V A;  1JAJ A;  2JZB B;  3GV7 B;  1T7P A;  3RJF A;  1BVS A;  4KLJ A;  1KEJ A;  2RDJ A;  3TAN A;  3UPS A;  4X4P A;  4J9M A;  4I2D A;  3EPI A;  4DLG A;  2KN7 A;  3OJS A;  5KFH A;  3RAQ A;  8ICE A;  3GIM A;  1SL1 A;  9ICP A;  2XC9 A;  4RQ6 A;  4KLD A;  1PZN A;  3H3A A;  3N4M B;  5KFJ A;  1UA0 A;  1NK4 A;  1ZQK A;  2F1I A;  3M9O B;  1BPZ A;  2BQ3 A;  4BWJ A;  4I2I A;  3HX0 A;  2AGQ A;  3H39 A;  4TUR A;  3FYH A;  4P4P A;  4O5C A;  8ICU A;  5KFQ A;  1UEU A;  3IM1 A;  3QEB Z;  4RZR A;  9ICA A;  2P66 A;  5HRH A;  4LZD A;  5J2E A;  3KHG A;  8ICP A;  4QZB A;  4KN7 A;  3HP6 A;  1WCN A;  1ZQX A;  2NRX A;  4F91 B;  3V6H A;  4O5E A;  8ICT A;  2UVU A;  3RR8 A;  4IR9 A;  7ICL A;  3RR7 A;  4B9U A;  1RPL A;  1ZJN A;  2AGP A;  4RQ7 A;  1T3N A;  1ZQB A;  4RQ1 A;  5KG3 A;  4DO9 A;  7ICJ A;  3LQC B;  1R8C A;  2NRK A;  1XSL A;  3OV7 A;  1SKR A;  2Q0Z X;  5KG5 A;  4RWQ A;  3C2K A;  1XWL A;  4Z6E A;  4RQ8 A;  4BXO A;  1Z00 A;  3MDA A;  2HHW A;  2W8K A;  2J6S A;  1DK2 A;  5HRI A;  4M6W B;  1X2I A;  3KHL A;  5L1L A;  1ZQH A;  2J6U A;  4ED1 A;  4FBT A;  2M2T A;  3C1Z A;  4YP3 A;  5J2J A;  4YR2 A;  3HW8 A;  3C1Y A;  3HWT A;  1SKW A;  3AUO A;  4O0I A;  4RU9 A;  2W9A A;  1NOM A;  1H38 A;  2VA3 A;  4ECV A;  3PW2 A;  4ELT A;  4ECQ A;  3Q8L A;  2ZHB A;  3AU6 A;  7ICU A;  1XSN A;  2DR9 A;  1T4G A;  2O5A A;  4B9L A;  4I2G A;  7ICQ A;  4RPX A;  4RWN A;  1DGS A;  2HHX A;  4DQI A;  2W8L A;  5DB7 A;  4KLI A;  2AQ4 A;  3T5L A;  3TFR A;  2ASD A;  3H37 A;  4QWE A;  3OUY A;  1NKB A;  2KP7 A;  4EEY A;  3KHH A;  1WCL A;  4K4G A;  4JUZ A;  1PX5 A;  2ZUC A;  1ZQF A;  9ICH A;  1N48 A;  3GIJ A;  4F4W A;  5KFC A;  3PR5 B;  3MDC A;  2JEJ A;  2R8G A;  4IG8 A;  3TAR A;  5KFD A;  2P6U A;  2ZTD A;  1NJW A;  4YD1 A;  3H4B A;  4ED3 A;  3SI8 A;  4I28 A;  4Z6C A;  4JV1 A;  4EP7 A;  4MEY A;  2W9M A;  3PMN A;  3JPO A;  3GV8 B;  4DLE A;  5J0W A;  3RB4 A;  2C28 A;  4I2C A;  1JIH A;  7ICH A;  9ICG A;  1EXN A;  3RH4 A;  4B9N A;  2ZUD A;  4DFP A;  3UXP A;  4PGQ A;  2FMS A;  4KN4 A;  5HP4 A;  4EYI B;  2HHU A;  4GC7 A;  5KFM A;  4P2H A;  2FLL A;  3MGH A;  1JXE A;  3MR6 A;  1NJY A;  4JWM A;  5HRD A;  2XY5 A;  2ATL A;  3PV8 A;  2VA8 A;  1X9S A;  5HR9 A;  3M9N B;  2JEF A;  9ICW A;  3H4D A;  1Q79 A;  5DQH A;  5J0R A;  3UPQ A;  9ICS A;  5KFR A;  3WFP A;  2LYH A;  2ZH3 A;  1S0N A;  5KG7 A;  1JX4 A;  5CA7 A;  2ZH1 A;  5HNK A;  4DWI A;  4FHY A;  4F5N A;  4J9K A;  3PVX A;  4ELU A;  3JYY A;  4MEX A;  5DEC A;  4F93 B;  4DSJ A;  4RNN A;  2DRB A;  4IQT A;  4FO6 A;  4F5P A;  3HJ4 A;  4DOA A;  5CR0 A;  5DDM A;  4DS4 A;  2FLP A;  4AT7 A;  4ECU A;  8ICB A;  4RWO A;  3H8J A;  5HHH A;  1FA0 A;  1A76 A;  4DQS A;  1MQ2 A;  5KTQ A;  4I2B A;  3IHQ B;  4MFC A;  2R8H A;  1CEZ A;  8ICK A;  4FHV A;  4ATB B;  4O5K A;  3NTU A;  4KLH A;  4E7X A;  4I2J A;  4YCX A;  3JPR A;  2BCV A;  1D8L A;  4RPZ A;  2ALZ A;  1UA1 A;  4J9R A;  3UQ2 A;  1XU4 A;  4UBB A;  3TI0 A;  5J0Y A;  3RJK A;  3ZDE A;  4ED6 A;  4RT3 A;  4XA5 A;  1D8Y A;  1U45 A;  3MR2 A;  1B43 A;  3B0X A;  8ICR A;  4EBD A;  2ZJA A;  4TQS A;  2WTF A;  1KFD A;  3PW7 A;  4TUP A;  1X9M A;  1SL0 A;  3GIL A;  4M9J A;  2HHT A;  3OVS A;  4WC4 A;  2C2E A;  1NK6 A;  2BPC A;  4M9G A;  4M04 A;  2A1J A;  9ICC A;  4M0A A;  5J0X A;  2MAX A;  2NRV A;  5L1K A;  4I2E A;  3QEA Z;  2BKE A;  9ICO A;  4FH5 A;  2KFZ A;  4G3I A;  4WBY A;  5F9L A;  1ZQG A;  1SL2 A;  2ZH6 A;  2ISO A;  1BPE A;  4ECZ A;  8ICX A;  1S0M A;  4FHW A;  3PML A;  4FS2 A;  5CP2 A;  4WCW A;  1TFY A;  2C2D A;  3PY8 A;  3RB3 A;  3V6J A;  2FLN A;  3WFR E;  3ISB A;  1OU5 A;  2DPI A;  4LVS A;  5DBB A;  4RQ3 A;  1Z3E B;  4ECR A;  8ICY A;  4KLE A;  9ICJ A;  4UB1 A;  3QZ7 A;  4X4R A;  1ZQD A;  4F4X A;  1NK0 A;  7ICK A;  3EZ5 A;  5EOZ A;  4X4U A;  2ZH9 A;  5DGA A;  4QZC A;  5KFF A;  3AQL A;  4AT9 B;  2IMW P;  3KTQ A;  5KT3 A;  5DGB A;  4IRD A;  9ICR A;  3V7L A;  3RBD A;  5L1J A;  4LT6 A;  4F2R A;  3G6Y A;  1QSS A;  1K1S A;  4PHA A;  4LZG A;  4GXJ A;  5DQG A;  5DG9 A;  2PBE A;  4Z6F A;  5J0S A;  3MFH A;  1ZQE A;  2I9G A;  4XUS A;  2PI5 A;  4X4V A;  4I2F A;  1UEV A;  4RUA A;  2BCS A;  2H5X A;  3Q8S B;  1MIW A;  2O1P A;  1MIY A;  4KMU A;  5D46 A;  4NLK A;  3C66 A;  4M5D A;  5BOM A;  2XY6 A;  4B9T A;  2J6T A;  4DFJ A;  4QZI A;  4DF4 A;  8ICZ A;  3M8R A;  4UAZ A;  5JUM A;  4QWD A;  4DL4 A;  4FHX A;  2ZH8 A;  4UB4 A;  2HW3 A;  4ECT A;  4YMO A;  2BHN A;  4R65 A;  3GQC A;  5KFS A;  1ZQQ A;  2HHV A;  3H40 A;  1LB2 B;  5KFK A;  3K4G A;  2XGQ A;  3ZDB A;  2W9C A;  3OVB A;  4WC0 A;  5DG8 A;  1L3T A;  4DSL A;  3EYZ A;  4YR3 A;  9ICN A;  4YFK A;  3JZ0 A;  3T5K A;  3EPG A;  1U9L A;  1IXR A;  3SZ2 A;  4UB5 A;  2BCQ A;  2PFP A;  4MF2 A;  5DBA A;  9ICL A;  1KNY A;  1RYR A;  1RXV A;  3OJU A;  4X0B A;  4QZA A;  4GC6 A;  4AT8 A;  1ZYQ A;  4UBC A;  2BPF A;  5EWF A;  2HHP A;  3H8W A;  2DFL A;  9ICE A;  3RBE A;  7ICV A;  2M2V A;  3WFS C;  9ICK A;  3KHR A;  2DR8 A;  2BPG A;  8ICH A;  2ASL A;  1L3V A;  1KSP A;  5KFL A;  1BNP A;  4IRC A;  2BQR A;  3H38 A;  1S0O A;  4C8N A;  3ISC A;  2HHQ A;  5HHI A;  2ASJ A;  5DED A;  2FPL A;  1COO A;  5J2K A;  3Q8R B;  1NJX A;  2MUT A;  4QWA A;  3UXN A;  8ICO A;  7ICP A;  5HRE A;  5J0P A;  4FBU A;  5C5J A;  4R8U A;  4YD2 A;  3L9D A;  3SV4 A;  1NK8 A;  5IIK A;  5DDY A;  3PW4 A;  4F4Z A;  1TK0 A;  1IM4 A;  2P6R A;  4R63 A;  4ECW A;  5DG7 A;  9ICV A;  1TVA A;  1N56 A;  3NYB A;  4EBJ A;  4MFA A;  5EWE A;  2XGP A;  5J2F A;  1RXW A;  4M9H A;  2AQ0 A;  2W9B A;  1HUO A;  4GXI A;  5HRK A;  4X0A A;  4DEZ A;  1ZQW A;  4MF8 A;  4NM1 A;  5KFV A;  4K4I A;  4NLZ A;  4DQQ A;  1U4B A;  3SYZ A;  2JEG A;  4I29 A;  4WC2 A;  4F5Q A;  3H8S A;  5KFI A;  5J2D A;  4RPY A;  1JQR A;  5CHG A;  5J2G A;  3AQK A;  3WFO A;  7ICT A;  3TFS A;  5D49 A;  4DOB A;  4EZ9 A;  2Q66 A;  2V4R A;  4PHE A;  9ICX A;  4YR0 A;  2GWS A;  4PPX A;  5KFG A;  3RAX A;  3PO4 A;  4RT2 A;  4BXO B;  5D4B A;  1Z00 B;  4KIT B;  3AU2 A;  4RUC A;  4RNM A;  1NK7 A;  3WFQ E;  3LK9 A;  2JEI A;  3RJH A;  4NY8 A;  4J9L A;  4E0D A;  4XQ7 A;  4ED8 A;  1KDH A;  1ZET A;  2IHN A;  1ZQJ A;  1ZQS A;  4K4H A;  4QZH A;  1L3U A;  4QZF A;  3BQ0 A;  2BGW A;  2PI4 A;  4ECY A;  1ZQZ A;  4XRH A;  1V4A A;  3C23 A;  5DLG A;  4O3S A;  4E80 A;  1ZQI A;  4GLX A;  4NLG A;  1JXL A;  1ZQT A;  1UT8 A;  2R8I A;  3ZD9 A;  4S3N A;  4X4T A;  2JZB A;  4F92 B;  2DVI A;  1ZQV A;  4BGD A;  2V9W A;  4DQP A;  3RJJ A;  2DRA A;  1BGX T;  4TQR A;  3T5H A;  3PX4 A;  3OUY B;  2ZH7 A;  2DPJ A;  3T5J A;  1BPY A;  1S0V A;  3ZDA A;  3HIY A;  4R66 A;  9ICQ A;  3BQ2 A;  5J2H A;  4BWM A;  1ZQU A;  5TZV A;  3GFK B;  3JPN A;  2ZH4 A;  2AGO A;  1XC9 A;  4ECX A;  3PX6 A;  1CUK A;  2F1H A;  5F9N A;  5KG6 A;  4O9M A;  4UD5 A;  4DQR A;  4IQW A;  4ED2 A;  1JN3 A;  2HVI A;  7ICO A;  8ICL A;  4EBC A;  9ICF A;  4HYK A;  4TUQ A;  3G6V A;  1DOQ A;  4P4M A;  2AU0 A;  4I27 A;  3GDX A;  4ECS A;  5DB8 A;  2IA6 A;  4UAY A;  1NK5 A;  4B9S A;  1TAU A;  2ZH2 A;  2OWO A;  5HRB A;  5KG4 A;  8ICF A;  5KFE A;  3NGD A;  2FMQ A;  3PW5 A;  5HRF A;  4YN4 A;  4NLN A;  4DSF A;  2PFN A;  3RH5 A;  5KFA A;  3MGI A;  1ARO P;  5DLF A;  2C2R A;  4DSE A;  3MBY A;  1U49 A;  4KLG A;  9ICT A;  5DKW A;  1KFT A;  3PR4 A;  4Q8F A;  4DFM A;  3RTV A;  1TFW A;  3PX0 A;  3BJY A;  4F4Y A;  9ICU A;  2M2W A;  1QLN A;  2R8K A;  4RQ2 A;  4B9M A;  1ZJM A;  4M6W A;  4JV0 A;  3E2E A;  4Q45 A;  3AQM A;  4UB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...