4E80A

Structural basis for the activity of a cytoplasmic rna terminal u-transferase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
339
structure length
317
Chain Sequence
HKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Structural basis for the activity of a cytoplasmic RNA terminal uridylyl transferase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe 972h-
total genus 106
structure length 317
sequence length 339
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4e80A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4e80A02
4QZCA 4P4PA 3L9DA 3V7KA 3RJHA 1V4AA 3K75D 1XSPA 5J2EA 1TVAA 3MGIA 4XA5A 4UBCA 2W9MA 4YMNA 4I2AA 5TZVA 8ICVA 1JAJA 4EBKA 1UEVA 5HR9A 8ICCA 1ZQRA 8ICRA 9ICGA 1Q79A 4P4OA 1R89A 7ICHA 4WCWA 2DRAA 5HRFA 1ZQGA 4I27A 1KDHA 4M5DA 4PHPA 5D46A 4I2FA 4Z6EA 4FHPA 4RQ6A 4IG8A 8ICNA 1WOTA 9ICEA 9ICLA 4AT7A 4F5QA 1KEJA 5IIOA 8ICQA 8ICTA 5DB7A 5HRGA 5DB9A 4X4QA 4X4UA 4M9GA 1R8CA 5J0RA 4O5KA 2ZH7A 3UPSA 4YMMA 2NRKA 5DBAA 4IQUA 3RJKA 1OU5A 1VFGA 3TFRA 2I9GA 1ZQJA 5D4BA 4KLDA 5EOZA 4R66A 1UETA 3OUYA 2DR8A 1TFWA 4PHAA 5J0TA 2PFOA 4I2CA 4P2HA 4E8FA 4X5VA 2BCRA 3B0YA 8ICOA 7ICPA 3AQMA 5CJ7A 7ICJA 4QZDA 2ZH2A 1ZQCA 5J0XA 7ICOA 9ICFA 3ISCA 3H3AA 4RQ0A 1BPXA 9ICHA 4KLEA 4UB1A 3OV7A 3MDAA 4XQ7A 4X4OA 3V7LA 2BCUA 3JPRA 3V7JA 9ICIA 1ZQPA 1ZQDA 3AU2A 4XQ8A 3HJ1A 4WC5A 4UB3A 4Z6CA 4ATBB 2O1PA 4KLLA 3RH4A 9ICMA 3AQKA 3RJJA 8ICBA 4NLZA 4WC0A 2BPGA 4RT2A 2BE3A 4RQ3A 1XSNA 1HUOA 4PGQA 1MQ2A 5BOLA 3HX0A 3C18A 3C2KA 4UB5A 4FHYA 1MIVA 3JPNA 2BCQA 5J2CA 4UAWA 4NLNA 4YN4A 4FHXA 7ICFA 4RT3A 3UPQA 2IHMA 3JPPA 3AQNA 1MQ3A 5DBCA 2PXIA 3UXOA 4QZFA 4KLHA 2ID1A 2ZH6A 3RH6A 9ICVA 4DOCA 5IILA 4F5OA 4I2IA 5J0QA 4X4VA 7ICIA 3OVBA 4IQVA 4WBYA 1ZQFA 4KLIA 1ZQZA 4RPZA 4TUPA 4JWMA 7ICVA 3HIYA 4E7XA 1UEUA 4WC2A 7ICUA 1XSLA 7ICLA 4RPXA 4DOAA 3MDCA 4KLUA 4NKTA 1ZJNA 4QZBA 5CR0A 4AT9A 5CB1A 4RQ2A 4O9MA 5IIMA 4F5NA 3HW8A 5J2GA 4M0AA 4UD5A 8ICXA 4WC1A 2B51A 3WFPA 3PMNA 4NKUA 5HRHA 4GXIA 4O5EA 5J0UA 4R65A 3JPQA 3C5GA 1HUZA 2ZHBA 5DDYA 3RJIA 4KLGA 4KLMA 3LK9A 5DEDA 3UQ0A 4X4RA 2ZH9A 4K4IA 9ICCA 3H39A 7ICKA 1ZQWA 1BPZA 4AT8B 4LVSA 1KNYA 4I2JA 2ZH3A 2BCVA 3WFOA 8ICKA 1ZQVA 4X0AA 3MBYA 4F5PA 3NYBA 4K4HA 2Q66A 5J2IA 5IIKA 4I28A 4RWNA 4M9HA 2ZH8A 7ICTA 4WC7A 9ICRA 1MIYA 5HRDA 4FH5A 4NXZA 1ZQMA 4NLKA 2ZH4A 1NOMA 4I29A 2ISOA 3OVAA 4RWOA 4MF8A 4FHWA 7ICNA 4RWPA 9ICTA 4RQ5A 4UB2A 1ZQAA 4UAYA 9ICNA 5HRIA 5HHHA 4QZGA 5J2KA 3C2LA 4NM2A 5J0YA 4Z6DA 1ZQOA 8ICYA 4EP7A 5BPCA 2P66A 1JQRA 1R8BA 4I2BA 4I2GA 5J2FA 9ICWA 5CA7A 2DVIA 1YLQA 4MFAA 4P4MA 3RJGA 2M2UA 3JZ0A 4M9LA 4X4TA 8ICPA 9ICOA 4I2EA 4AT7B 4RQ7A 4PHDA 7ICRA 2FMQA 5IIJA 1JN3A 2B4VA 9ICXA 4PGYA 2FMPA 3JPSA 4KLJA 4X4PA 8ICUA 1ZQBA 5DB6A 9ICQA 7ICSA 2BPFA 4UD4A 8ICAA 4RPYA 2HHPA 3WFRE 1Q78A 4GXKA 9ICBA 3JYYA 5HREA 7ICEA 2O5AA 5DBBA 3OVSA 5J0OA 5HC9A 3V72A 5DB8A 4S3NA 4UBBA 8ICEA 5DECA 9ICAA 4EBJA 5IINA 3OUYB 4XUSA 4X4NA 3JPTA 5HRKA 3OGUA 4KLFA 4MF2A 1ZQSA 9ICJA 4R63A 4XRHA 1RZTA 1RPLA 1ZJMA 4I2DA 3C5FA 4PGXA 3RJEA 2PFNA 1BPBA 4IQTA 8ICWA 4NY8A 4ATBA 3C66A 4M9NA 5HRLA 3HJ4A 1ZQHA 9ICSA 1ZQNA 4DO9A 3WFQE 2BCSA 2FMSA 8ICGA 2VANA 4QZ8A 2M2TA 4UB4A 4RWQA 1BPDA 4YMOA 4RQ8A 3RH5A 4LZGA 7ICQA 2PBEA 2B56A 1TFYA 4KLOA 4PH5A 2DR5A 5J2BA 3GDXA 4LT6A 1R8AA 4WBZA 4WC4A 4Z6FA 4JWNA 1ZQXA 9ICUA 3UQ2A 1JMSA 5D49A 3MGHA 5J29A 3PNCA 2DR9A 3AQLA 2PFQA 3B0XA 3LQCB 1PX5A 4FH3A 1ZQYA 9ICKA 2M2VA 4WC3A 4TURA 5HRBA 2RFFA 5DKWA 4E80A 3AU6A 4GXJA 8ICHA 4QZEA 4IQWA 1ZQTA 4YCXA 4R64A 1ZQEA 4TUSA 7ICGA 5HHIA 5CWRA 3H38A 1VJ7A 1MIWA 4PPXA 8ICLA 3ISBA 4DOBA 4WC6A 3UXPA 5DDMA 1ZQQA 5J2JA 4RQ4A 5CP2A 4MFFA 8ICFA 4MFCA 3ISDA 1ZQKA 4UAZA 4O5CA 8ICMA 2ZH5A 2DR7A 4F5RA 4FHVA 4QZHA 1ZQUA 4AT9B 3HWTA 5J2HA 5BOMA 4QZ9A 5J2AA 2ZH1A 4FO6A 1BPEA 2M2WA 1BPYA 4M04A 4PHEA 4M2YA 4KLTA 1FA0A 4X0BA 4K4GA 3TFSA 3RJFA 4AT8A 8ICSA 2ZHAA 8ICJA 3JPOA 3H37A 4M47A 4YD2A 4LZDA 4KLQA 4NM1A 1NO5A 1TV9A 5J2DA 4YD1A 1F5AA 4QZIA 2DRBA 4QZAA 9ICPA 5J0SA 1ZQIA 2GWSA 2PFPA 1ZQLA 2ISPA 8ICZA 2BPCA 5IIIA 3WFSC 4KLSA 4TUQA 5F2VO 4RQ1A 3C2MA 3UXNA 4I2HA 5CHGA 3AUOA 5J0WA 7ICMA 4M9JA 4X4SA 3PMLA 8ICIA 5J0PA
chains in the Genus database with same CATH superfamily
4QZCA 4P4PA 3L9DA 3V7KA 3RJHA 1V4AA 3K75D 1XSPA 5J2EA 1TVAA 4XA5A 4UBCA 3MGIA 2W9MA 4YMNA 4I2AA 5TZVA 8ICVA 1JAJA 4EBKA 1UEVA 5HR9A 8ICCA 1ZQRA 8ICRA 9ICGA 1Q79A 4P4OA 1R89A 7ICHA 4WCWA 2DRAA 4EEBA 5HRFA 1ZQGA 4I27A 1KDHA 4M5DA 4PHPA 5D46A 4I2FA 4Z6EA 4FHPA 4RQ6A 4IG8A 8ICNA 1WOTA 2EWRA 9ICEA 9ICLA 4AT7A 4F5QA 1KEJA 5IIOA 8ICQA 4NXWA 8ICTA 5DB7A 5HRGA 5DB9A 4K97A 4X4QA 4X4UA 3ERCC 4M9GA 1R8CA 5J0RA 4O5KA 2ZH7A 4MKPA 3UPSA 4YMMA 2NRKA 4O6AA 5DBAA 4IQUA 3RJKA 1OU5A 1VFGA 3TFRA 2I9GA 1ZQJA 5D4BA 3MCRA 4KLDA 4JLZA 5EOZA 4R66A 1UETA 3OUYA 2DR8A 4WH5A 3ER9B 1TFWA 4PHAA 5J0TA 2PFOA 4I2CA 4P2HA 4E8FA 4X5VA 2BCRA 3B0YA 8ICOA 7ICPA 3AQMA 5CJ7A 7ICJA 2ZH2A 4QZDA 1ZQCA 5J0XA 7ICOA 9ICFA 3ISCA 3H3AA 4RQ0A 1BPXA 9ICHA 4EV6A 4K9BA 4KLEA 4UB1A 2GA9D 3OV7A 3MDAA 4XQ7A 4X4OA 3V7LA 2BCUA 4KM5A 3JPRA 3V7JA 9ICIA 1ZQPA 1ZQDA 3AU2A 4XQ8A 3HJ1A 2HN1A 4WC5A 4UB3A 4Z6CA 2IHOA 4ATBB 2O1PA 4LEYA 4KLLA 3RH4A 9ICMA 3AQKA 3RJJA 8ICBA 4NLZA 4O68A 4WC0A 5B3PA 4NXXA 2BPGA 4RT2A 2BBJA 2BE3A 4RQ3A 1XSNA 1HUOA 4PGQA 1MQ2A 5BOLA 3HX0A 3C18A 3C2KA 4UB5A 4FHYA 1MIVA 3JPNA 2BCQA 5J2CA 4UAWA 4NLNA 4YN4A 4FHXA 7ICFA 4RT3A 3UPQA 2HN2A 2IHMA 3JPPA 3AQNA 1MQ3A 5DBCA 2PXIA 3UXOA 4N7RA 4XJEA 4QZFA 4KLHA 3PMLA 2ZH6A 2ID1A 1GPJA 3RH6A 9ICVA 4DOCA 3NVOA 5IILA 4F5OA 4I2IA 5J0QA 4X4VA 7ICIA 3OVBA 4IQVA 4WBYA 1ZQFA 4KLIA 1ZQZA 5CFTA 4RPZA 4TUPA 4JWMA 7ICVA 3HIYA 4E7XA 1UEUA 4WC2A 7ICUA 1XSLA 7ICLA 4RPXA 4DOAA 4LEZA 3MDCA 4JLXA 4KLUA 4NKTA 1ZJNA 2FCLA 4LEVA 4QZBA 5CR0A 4NXTA 3NWIA 4AT9A 5CB1A 4RQ2A 4O9MA 5IIMA 4F5NA 3HW8A 5J2GA 4M0AA 4UD5A 8ICXA 4WC1A 2B51A 3WFPA 3PMNA 4NKUA 5HRHA 4GXIA 3OWGA 4O5EA 5J0UA 4R65A 3JPQA 3C5GA 1HUZA 4NXVA 2ZHBA 5DDYA 3RJIA 4KLGA 4KLMA 3LK9A 5DEDA 3UQ0A 4X4RA 2ZH9A 4K4IA 9ICCA 3H39A 7ICKA 1ZQWA 1BPZA 4AT8B 4LVSA 1KNYA 4I2JA 2ZH3A 2BCVA 3WFOA 8ICKA 1ZQVA 4X0AA 4WQLA 3MBYA 4F5PA 3ER8C 3NYBA 4K4HA 2IUBA 2Q66A 5J2IA 5IIKA 4I28A 4RWNA 4M9HA 2ZH8A 7ICTA 4WC7A 9ICRA 1MIYA 5HRDA 5JTGA 4FH5A 4NXZA 1ZQMA 4NLKA 2ZH4A 4K98A 3PHZA 4I29A 2ISOA 3OVAA 4RWOA 4MF8A 4FHWA 7ICNA 3K7DA 4HX0A 5CFSA 4RWPA 9ICTA 4RQ5A 4OAHA 4UB2A 1ZQAA 4FO1A 4UAYA 9ICNA 5HRIA 5HHHA 4QZGA 5J2KA 3C2LA 4NM2A 5J0YA 4Z6DA 4OAGA 1ZQOA 8ICYA 4EP7A 3EF2A 5BPCA 2P66A 1JQRA 1R8BA 4I2BA 4I2GA 5J2FA 9ICWA 2DVIA 5CA7A 1YLQA 4MFAA 4P4MA 3RJGA 2M2UA 3JZ0A 4M9LA 4X4TA 5CFUA 4NXUA 8ICPA 9ICOA 4I2EA 4AT7B 4RQ7A 4PHDA 7ICRA 2FMQA 5IIJA 1JN3A 2B4VA 9ICXA 4PGYA 2FMPA 3JPSA 4KLJA 5D61A 4X4PA 3NKUA 8ICUA 1ZQBA 5DB6A 9ICQA 7ICSA 2BPFA 4UD4A 8ICAA 4K96A 4RPYA 2HHPA 3WFRE 1Q78A 4GXKA 9ICBA 4K99A 3JYYA 5HREA 7ICEA 2O5AA 3OVSA 5DBBA 5J0OA 5HC9A 3V72A 5DB8A 4S3NA 4UBBA 5B3QA 8ICEA 5DECA 9ICAA 4K8VA 4EBJA 5IINA 3OUYB 4XUSA 4X4NA 4OAIZ 3JPTA 5HRKA 3OGUA 4KLFA 4MF2A 1ZQSA 9ICJA 4R63A 4XRHA 4O67A 1RZTA 1RPLA 1ZJMA 2BBHA 4I2DA 3C5FA 4PGXA 3RJEA 2PFNA 1BPBA 4IQTA 8ICWA 4NY8A 4ATBA 3C66A 4M9NA 5HRLA 3HJ4A 1ZQHA 9ICSA 1ZQNA 4DO9A 3WFQE 2BCSA 2FMSA 4K9AA 8ICGA 2VANA 4KB6A 4QZ8A 2M2TA 4UB4A 4RWQA 4EEDA 4WOYA 1BPDA 4YMOA 4RQ8A 3RH5A 4LZGA 7ICQA 2PBEA 2B56A 1TFYA 4KLOA 4PH5A 2DR5A 5J2BA 3GDXA 1R8AA 4LT6A 4WBZA 4WC4A 4Z6FA 4JWNA 1ZQXA 9ICUA 4EGWA 1JMSA 5D49A 3MGHA 3UQ2A 3JCFA 5J29A 2DR9A 3PNCA 3AQLA 2PFQA 3B0XA 3LQCB 1PX5A 4FH3A 1ZQYA 9ICKA 2M2VA 4WC3A 4TURA 5HRBA 2RFFA 5DKWA 4E80A 3AU6A 4GXJA 4LEWA 8ICHA 4QZEA 4IQWA 1ZQTA 4I0UA 4YCXA 4R64A 1ZQEA 4TUSA 7ICGA 5HHIA 5CWRA 3H38A 1VJ7A 1MIWA 4PPXA 8ICLA 3ISBA 5D63A 4DOBA 4WC6A 5D62A 3CK6A 4OAFA 5DDMA 3UXPA 5J2JA 4RQ4A 1ZQQA 5CP2A 4MFFA 8ICFA 4MFCA 3ISDA 1ZQKA 4UAZA 4O5CA 8ICMA 4WQKA 2ZH5A 2DR7A 4F5RA 4FHVA 4QZHA 4AT9B 1ZQUA 3HWTA 5J2HA 5BOMA 4QZ9A 5J2AA 2ZH1A 4FO6A 1BPEA 2M2WA 1BPYA 4M04A 4PHEA 4M2YA 4KLTA 1FA0A 4X0BA 4K4GA 3TFSA 3RJFA 4AT8A 8ICSA 2ZHAA 2GAFD 8ICJA 3JPOA 3H37A 4M47A 4YD2A 4LZDA 4KLQA 4NM1A 1NO5A 1TV9A 5J2DA 4YD1A 1F5AA 5CHEA 4QZIA 4O69A 2DRBA 4QZAA 9ICPA 5J0SA 1ZQIA 2GWSA 2PFPA 1ZQLA 2ISPA 8ICZA 2BPCA 5IIIA 3WFSC 4KLSA 4TUQA 5F2VO 4RQ1A 3C2MA 3UXNA 4I2HA 5CHGA 3AUOA 5J0WA 7ICMA 4M9JA 4X4SA 1NOMA 8ICIA 5J0PA
chains in the Genus database with same CATH topology
4QZCA 4P4PA 3L9DA 3V7KA 3RJHA 1V4AA 3K75D 1XSPA 5J2EA 1TVAA 4XA5A 4UBCA 3MGIA 2W9MA 4YMNA 4I2AA 5TZVA 8ICVA 1JAJA 4EBKA 1UEVA 5HR9A 8ICCA 1ZQRA 8ICRA 9ICGA 1Q79A 4P4OA 1R89A 7ICHA 4WCWA 2DRAA 5HRFA 1ZQGA 4I27A 1KDHA 4M5DA 4PHPA 5D46A 4I2FA 4Z6EA 4FHPA 4RQ6A 4IG8A 8ICNA 1WOTA 9ICEA 9ICLA 4AT7A 4F5QA 1KEJA 5IIOA 8ICQA 4NXWA 8ICTA 5DB7A 5HRGA 5DB9A 4K97A 4X4QA 4X4UA 4M9GA 1R8CA 5J0RA 4O5KA 2ZH7A 4MKPA 3UPSA 4YMMA 2NRKA 4O6AA 5DBAA 4IQUA 3RJKA 1OU5A 1VFGA 3TFRA 2I9GA 1ZQJA 5D4BA 4KLDA 4JLZA 5EOZA 4R66A 1UETA 3OUYA 2DR8A 1TFWA 4PHAA 5J0TA 2PFOA 4I2CA 4P2HA 4E8FA 4X5VA 2BCRA 3B0YA 8ICOA 7ICPA 3AQMA 5CJ7A 7ICJA 2ZH2A 4QZDA 1ZQCA 5J0XA 7ICOA 9ICFA 3ISCA 3H3AA 4RQ0A 1BPXA 9ICHA 4K9BA 4KLEA 4UB1A 3OV7A 3MDAA 4XQ7A 4X4OA 3V7LA 2BCUA 4KM5A 3JPRA 3V7JA 9ICIA 1ZQPA 1ZQDA 3AU2A 4XQ8A 3HJ1A 4WC5A 4UB3A 4Z6CA 4ATBB 2O1PA 4LEYA 4KLLA 3RH4A 9ICMA 3AQKA 3RJJA 8ICBA 4NLZA 4O68A 4WC0A 4NXXA 2BPGA 4RT2A 2BE3A 4RQ3A 1XSNA 1HUOA 4PGQA 1MQ2A 5BOLA 3HX0A 3C18A 3C2KA 4UB5A 4FHYA 1MIVA 3JPNA 2BCQA 5J2CA 4UAWA 4NLNA 4YN4A 4FHXA 7ICFA 4RT3A 3UPQA 2IHMA 3JPPA 3AQNA 1MQ3A 5DBCA 2PXIA 3UXOA 4QZFA 4KLHA 3PMLA 2ZH6A 2ID1A 3RH6A 9ICVA 4DOCA 5IILA 4F5OA 4I2IA 5J0QA 4X4VA 7ICIA 3OVBA 4IQVA 4WBYA 1ZQFA 4KLIA 1ZQZA 4RPZA 4TUPA 4JWMA 7ICVA 3HIYA 4E7XA 1UEUA 4WC2A 7ICUA 1XSLA 7ICLA 4RPXA 4DOAA 4LEZA 3MDCA 4JLXA 4KLUA 4NKTA 1ZJNA 4LEVA 4QZBA 5CR0A 4NXTA 4AT9A 5CB1A 4RQ2A 4O9MA 5IIMA 4F5NA 3HW8A 5J2GA 4M0AA 4UD5A 8ICXA 4WC1A 2B51A 3WFPA 3PMNA 4NKUA 5HRHA 4GXIA 4O5EA 5J0UA 4R65A 3JPQA 3C5GA 1HUZA 4NXVA 2ZHBA 5DDYA 3RJIA 4KLGA 4KLMA 3LK9A 5DEDA 3UQ0A 4X4RA 2ZH9A 4K4IA 9ICCA 3H39A 7ICKA 1ZQWA 1BPZA 4AT8B 4LVSA 1KNYA 4I2JA 2ZH3A 2BCVA 3WFOA 8ICKA 1ZQVA 4X0AA 3MBYA 4F5PA 3NYBA 4K4HA 2Q66A 5J2IA 5IIKA 4I28A 4RWNA 4M9HA 2ZH8A 7ICTA 4WC7A 9ICRA 1MIYA 5HRDA 4FH5A 4NXZA 1ZQMA 4NLKA 2ZH4A 4K98A 4I29A 2ISOA 3OVAA 4RWOA 4MF8A 4FHWA 7ICNA 4RWPA 9ICTA 4RQ5A 4OAHA 4UB2A 1ZQAA 4UAYA 9ICNA 5HRIA 5HHHA 4QZGA 5J2KA 3C2LA 4NM2A 5J0YA 4Z6DA 4OAGA 1ZQOA 8ICYA 4EP7A 5BPCA 2P66A 1JQRA 1R8BA 4I2BA 4I2GA 5J2FA 9ICWA 2DVIA 5CA7A 1YLQA 4MFAA 4P4MA 3RJGA 2M2UA 3JZ0A 4M9LA 4X4TA 4NXUA 8ICPA 9ICOA 4I2EA 4AT7B 4RQ7A 4PHDA 7ICRA 2FMQA 5IIJA 1JN3A 2B4VA 9ICXA 4PGYA 2FMPA 3JPSA 4KLJA 4X4PA 8ICUA 1ZQBA 5DB6A 9ICQA 7ICSA 2BPFA 4UD4A 8ICAA 4K96A 4RPYA 2HHPA 3WFRE 1Q78A 4GXKA 9ICBA 4K99A 3JYYA 5HREA 7ICEA 2O5AA 3OVSA 5DBBA 5J0OA 5HC9A 3V72A 5DB8A 4S3NA 4UBBA 8ICEA 5DECA 9ICAA 4K8VA 4EBJA 5IINA 3OUYB 4XUSA 4X4NA 4OAIZ 3JPTA 5HRKA 3OGUA 4KLFA 4MF2A 1ZQSA 9ICJA 4R63A 4XRHA 4O67A 1RZTA 1RPLA 1ZJMA 4I2DA 3C5FA 4PGXA 3RJEA 2PFNA 1BPBA 4IQTA 8ICWA 4NY8A 4ATBA 3C66A 4M9NA 5HRLA 3HJ4A 1ZQHA 9ICSA 1ZQNA 4DO9A 3WFQE 2BCSA 2FMSA 4K9AA 8ICGA 2VANA 4KB6A 4QZ8A 2M2TA 4UB4A 4RWQA 4WOYA 1BPDA 4YMOA 4RQ8A 3RH5A 4LZGA 7ICQA 2PBEA 2B56A 1TFYA 4KLOA 4PH5A 2DR5A 5J2BA 3GDXA 1R8AA 4LT6A 4WBZA 4WC4A 4Z6FA 4JWNA 1ZQXA 9ICUA 3UQ2A 1JMSA 5D49A 3MGHA 5J29A 2DR9A 3PNCA 3AQLA 2PFQA 3B0XA 3LQCB 1PX5A 4FH3A 1ZQYA 9ICKA 2M2VA 4WC3A 4TURA 5HRBA 2RFFA 5DKWA 4E80A 3AU6A 4GXJA 4LEWA 8ICHA 4QZEA 4IQWA 1ZQTA 4YCXA 4R64A 1ZQEA 4TUSA 7ICGA 5HHIA 5CWRA 3H38A 1VJ7A 1MIWA 4PPXA 8ICLA 3ISBA 4DOBA 4WC6A 4OAFA 5DDMA 3UXPA 5J2JA 4RQ4A 1ZQQA 5CP2A 4MFFA 8ICFA 4MFCA 3ISDA 1ZQKA 4UAZA 4O5CA 8ICMA 2ZH5A 2DR7A 4F5RA 4FHVA 4QZHA 4AT9B 1ZQUA 3HWTA 5J2HA 5BOMA 4QZ9A 5J2AA 2ZH1A 4FO6A 1BPEA 2M2WA 1BPYA 4M04A 4PHEA 4M2YA 4KLTA 1FA0A 4X0BA 4K4GA 3TFSA 3RJFA 4AT8A 8ICSA 2ZHAA 8ICJA 3JPOA 3H37A 4M47A 4YD2A 4LZDA 4KLQA 4NM1A 1NO5A 1TV9A 5J2DA 4YD1A 1F5AA 4QZIA 4O69A 2DRBA 4QZAA 9ICPA 5J0SA 1ZQIA 2GWSA 2PFPA 1ZQLA 2ISPA 8ICZA 2BPCA 5IIIA 3WFSC 4KLSA 4TUQA 5F2VO 4RQ1A 3C2MA 3UXNA 4I2HA 5CHGA 3AUOA 5J0WA 7ICMA 4M9JA 4X4SA 1NOMA 8ICIA 5J0PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZC A;  4P4P A;  3L9D A;  3V7K A;  3RJH A;  1V4A A;  3K75 D;  1XSP A;  5J2E A;  1TVA A;  3MGI A;  4XA5 A;  4UBC A;  2W9M A;  4YMN A;  4I2A A;  5TZV A;  8ICV A;  1JAJ A;  4EBK A;  1UEV A;  5HR9 A;  8ICC A;  1ZQR A;  8ICR A;  9ICG A;  1Q79 A;  4P4O A;  1R89 A;  7ICH A;  4WCW A;  2DRA A;  5HRF A;  1ZQG A;  4I27 A;  1KDH A;  4M5D A;  4PHP A;  5D46 A;  4I2F A;  4Z6E A;  4FHP A;  4RQ6 A;  4IG8 A;  8ICN A;  1WOT A;  9ICE A;  9ICL A;  4AT7 A;  4F5Q A;  1KEJ A;  5IIO A;  8ICQ A;  8ICT A;  5DB7 A;  5HRG A;  5DB9 A;  4X4Q A;  4X4U A;  4M9G A;  1R8C A;  5J0R A;  4O5K A;  2ZH7 A;  3UPS A;  4YMM A;  2NRK A;  5DBA A;  4IQU A;  3RJK A;  1OU5 A;  1VFG A;  3TFR A;  2I9G A;  1ZQJ A;  5D4B A;  4KLD A;  5EOZ A;  4R66 A;  1UET A;  3OUY A;  2DR8 A;  1TFW A;  4PHA A;  5J0T A;  2PFO A;  4I2C A;  4P2H A;  4E8F A;  4X5V A;  2BCR A;  3B0Y A;  8ICO A;  7ICP A;  3AQM A;  5CJ7 A;  7ICJ A;  4QZD A;  2ZH2 A;  1ZQC A;  5J0X A;  7ICO A;  9ICF A;  3ISC A;  3H3A A;  4RQ0 A;  1BPX A;  9ICH A;  4KLE A;  4UB1 A;  3OV7 A;  3MDA A;  4XQ7 A;  4X4O A;  3V7L A;  2BCU A;  3JPR A;  3V7J A;  9ICI A;  1ZQP A;  1ZQD A;  3AU2 A;  4XQ8 A;  3HJ1 A;  4WC5 A;  4UB3 A;  4Z6C A;  4ATB B;  2O1P A;  4KLL A;  3RH4 A;  9ICM A;  3AQK A;  3RJJ A;  8ICB A;  4NLZ A;  4WC0 A;  2BPG A;  4RT2 A;  2BE3 A;  4RQ3 A;  1XSN A;  1HUO A;  4PGQ A;  1MQ2 A;  5BOL A;  3HX0 A;  3C18 A;  3C2K A;  4UB5 A;  4FHY A;  1MIV A;  3JPN A;  2BCQ A;  5J2C A;  4UAW A;  4NLN A;  4YN4 A;  4FHX A;  7ICF A;  4RT3 A;  3UPQ A;  2IHM A;  3JPP A;  3AQN A;  1MQ3 A;  5DBC A;  2PXI A;  3UXO A;  4QZF A;  4KLH A;  2ID1 A;  2ZH6 A;  3RH6 A;  9ICV A;  4DOC A;  5IIL A;  4F5O A;  4I2I A;  5J0Q A;  4X4V A;  7ICI A;  3OVB A;  4IQV A;  4WBY A;  1ZQF A;  4KLI A;  1ZQZ A;  4RPZ A;  4TUP A;  4JWM A;  7ICV A;  3HIY A;  4E7X A;  1UEU A;  4WC2 A;  7ICU A;  1XSL A;  7ICL A;  4RPX A;  4DOA A;  3MDC A;  4KLU A;  4NKT A;  1ZJN A;  4QZB A;  5CR0 A;  4AT9 A;  5CB1 A;  4RQ2 A;  4O9M A;  5IIM A;  4F5N A;  3HW8 A;  5J2G A;  4M0A A;  4UD5 A;  8ICX A;  4WC1 A;  2B51 A;  3WFP A;  3PMN A;  4NKU A;  5HRH A;  4GXI A;  4O5E A;  5J0U A;  4R65 A;  3JPQ A;  3C5G A;  1HUZ A;  2ZHB A;  5DDY A;  3RJI A;  4KLG A;  4KLM A;  3LK9 A;  5DED A;  3UQ0 A;  4X4R A;  2ZH9 A;  4K4I A;  9ICC A;  3H39 A;  7ICK A;  1ZQW A;  1BPZ A;  4AT8 B;  4LVS A;  1KNY A;  4I2J A;  2ZH3 A;  2BCV A;  3WFO A;  8ICK A;  1ZQV A;  4X0A A;  3MBY A;  4F5P A;  3NYB A;  4K4H A;  2Q66 A;  5J2I A;  5IIK A;  4I28 A;  4RWN A;  4M9H A;  2ZH8 A;  7ICT A;  4WC7 A;  9ICR A;  1MIY A;  5HRD A;  4FH5 A;  4NXZ A;  1ZQM A;  4NLK A;  2ZH4 A;  1NOM A;  4I29 A;  2ISO A;  3OVA A;  4RWO A;  4MF8 A;  4FHW A;  7ICN A;  4RWP A;  9ICT A;  4RQ5 A;  4UB2 A;  1ZQA A;  4UAY A;  9ICN A;  5HRI A;  5HHH A;  4QZG A;  5J2K A;  3C2L A;  4NM2 A;  5J0Y A;  4Z6D A;  1ZQO A;  8ICY A;  4EP7 A;  5BPC A;  2P66 A;  1JQR A;  1R8B A;  4I2B A;  4I2G A;  5J2F A;  9ICW A;  5CA7 A;  2DVI A;  1YLQ A;  4MFA A;  4P4M A;  3RJG A;  2M2U A;  3JZ0 A;  4M9L A;  4X4T A;  8ICP A;  9ICO A;  4I2E A;  4AT7 B;  4RQ7 A;  4PHD A;  7ICR A;  2FMQ A;  5IIJ A;  1JN3 A;  2B4V A;  9ICX A;  4PGY A;  2FMP A;  3JPS A;  4KLJ A;  4X4P A;  8ICU A;  1ZQB A;  5DB6 A;  9ICQ A;  7ICS A;  2BPF A;  4UD4 A;  8ICA A;  4RPY A;  2HHP A;  3WFR E;  1Q78 A;  4GXK A;  9ICB A;  3JYY A;  5HRE A;  7ICE A;  2O5A A;  5DBB A;  3OVS A;  5J0O A;  5HC9 A;  3V72 A;  5DB8 A;  4S3N A;  4UBB A;  8ICE A;  5DEC A;  9ICA A;  4EBJ A;  5IIN A;  3OUY B;  4XUS A;  4X4N A;  3JPT A;  5HRK A;  3OGU A;  4KLF A;  4MF2 A;  1ZQS A;  9ICJ A;  4R63 A;  4XRH A;  1RZT A;  1RPL A;  1ZJM A;  4I2D A;  3C5F A;  4PGX A;  3RJE A;  2PFN A;  1BPB A;  4IQT A;  8ICW A;  4NY8 A;  4ATB A;  3C66 A;  4M9N A;  5HRL A;  3HJ4 A;  1ZQH A;  9ICS A;  1ZQN A;  4DO9 A;  3WFQ E;  2BCS A;  2FMS A;  8ICG A;  2VAN A;  4QZ8 A;  2M2T A;  4UB4 A;  4RWQ A;  1BPD A;  4YMO A;  4RQ8 A;  3RH5 A;  4LZG A;  7ICQ A;  2PBE A;  2B56 A;  1TFY A;  4KLO A;  4PH5 A;  2DR5 A;  5J2B A;  3GDX A;  4LT6 A;  1R8A A;  4WBZ A;  4WC4 A;  4Z6F A;  4JWN A;  1ZQX A;  9ICU A;  3UQ2 A;  1JMS A;  5D49 A;  3MGH A;  5J29 A;  3PNC A;  2DR9 A;  3AQL A;  2PFQ A;  3B0X A;  3LQC B;  1PX5 A;  4FH3 A;  1ZQY A;  9ICK A;  2M2V A;  4WC3 A;  4TUR A;  5HRB A;  2RFF A;  5DKW A;  4E80 A;  3AU6 A;  4GXJ A;  8ICH A;  4QZE A;  4IQW A;  1ZQT A;  4YCX A;  4R64 A;  1ZQE A;  4TUS A;  7ICG A;  5HHI A;  5CWR A;  3H38 A;  1VJ7 A;  1MIW A;  4PPX A;  8ICL A;  3ISB A;  4DOB A;  4WC6 A;  3UXP A;  5DDM A;  1ZQQ A;  5J2J A;  4RQ4 A;  5CP2 A;  4MFF A;  8ICF A;  4MFC A;  3ISD A;  1ZQK A;  4UAZ A;  4O5C A;  8ICM A;  2ZH5 A;  2DR7 A;  4F5R A;  4FHV A;  4QZH A;  1ZQU A;  4AT9 B;  3HWT A;  5J2H A;  5BOM A;  4QZ9 A;  5J2A A;  2ZH1 A;  4FO6 A;  1BPE A;  2M2W A;  1BPY A;  4M04 A;  4PHE A;  4M2Y A;  4KLT A;  1FA0 A;  4X0B A;  4K4G A;  3TFS A;  3RJF A;  4AT8 A;  8ICS A;  2ZHA A;  8ICJ A;  3JPO A;  3H37 A;  4M47 A;  4YD2 A;  4LZD A;  4KLQ A;  4NM1 A;  1NO5 A;  1TV9 A;  5J2D A;  4YD1 A;  1F5A A;  4QZI A;  2DRB A;  4QZA A;  9ICP A;  5J0S A;  1ZQI A;  2GWS A;  2PFP A;  1ZQL A;  2ISP A;  8ICZ A;  2BPC A;  5III A;  3WFS C;  4KLS A;  4TUQ A;  5F2V O;  4RQ1 A;  3C2M A;  3UXN A;  4I2H A;  5CHG A;  3AUO A;  5J0W A;  7ICM A;  4M9J A;  4X4S A;  3PML A;  8ICI A;  5J0P A; 
#chains in the Genus database with same CATH topology
 4QZC A;  4P4P A;  3L9D A;  3V7K A;  3RJH A;  1V4A A;  3K75 D;  1XSP A;  5J2E A;  1TVA A;  4XA5 A;  4UBC A;  3MGI A;  2W9M A;  4YMN A;  4I2A A;  5TZV A;  8ICV A;  1JAJ A;  4EBK A;  1UEV A;  5HR9 A;  8ICC A;  1ZQR A;  8ICR A;  9ICG A;  1Q79 A;  4P4O A;  1R89 A;  7ICH A;  4WCW A;  2DRA A;  4EEB A;  5HRF A;  1ZQG A;  4I27 A;  1KDH A;  4M5D A;  4PHP A;  5D46 A;  4I2F A;  4Z6E A;  4FHP A;  4RQ6 A;  4IG8 A;  8ICN A;  1WOT A;  2EWR A;  9ICE A;  9ICL A;  4AT7 A;  4F5Q A;  1KEJ A;  5IIO A;  8ICQ A;  4NXW A;  8ICT A;  5DB7 A;  5HRG A;  5DB9 A;  4K97 A;  4X4Q A;  4X4U A;  3ERC C;  4M9G A;  1R8C A;  5J0R A;  4O5K A;  2ZH7 A;  4MKP A;  3UPS A;  4YMM A;  2NRK A;  4O6A A;  5DBA A;  4IQU A;  3RJK A;  1OU5 A;  1VFG A;  3TFR A;  2I9G A;  1ZQJ A;  5D4B A;  3MCR A;  4KLD A;  4JLZ A;  5EOZ A;  4R66 A;  1UET A;  3OUY A;  2DR8 A;  4WH5 A;  3ER9 B;  1TFW A;  4PHA A;  5J0T A;  2PFO A;  4I2C A;  4P2H A;  4E8F A;  4X5V A;  2BCR A;  3B0Y A;  8ICO A;  7ICP A;  3AQM A;  5CJ7 A;  7ICJ A;  2ZH2 A;  4QZD A;  1ZQC A;  5J0X A;  7ICO A;  9ICF A;  3ISC A;  3H3A A;  4RQ0 A;  1BPX A;  9ICH A;  4EV6 A;  4K9B A;  4KLE A;  4UB1 A;  2GA9 D;  3OV7 A;  3MDA A;  4XQ7 A;  4X4O A;  3V7L A;  2BCU A;  4KM5 A;  3JPR A;  3V7J A;  9ICI A;  1ZQP A;  1ZQD A;  3AU2 A;  4XQ8 A;  3HJ1 A;  2HN1 A;  4WC5 A;  4UB3 A;  4Z6C A;  2IHO A;  4ATB B;  2O1P A;  4LEY A;  4KLL A;  3RH4 A;  9ICM A;  3AQK A;  3RJJ A;  8ICB A;  4NLZ A;  4O68 A;  4WC0 A;  5B3P A;  4NXX A;  2BPG A;  4RT2 A;  2BBJ A;  2BE3 A;  4RQ3 A;  1XSN A;  1HUO A;  4PGQ A;  1MQ2 A;  5BOL A;  3HX0 A;  3C18 A;  3C2K A;  4UB5 A;  4FHY A;  1MIV A;  3JPN A;  2BCQ A;  5J2C A;  4UAW A;  4NLN A;  4YN4 A;  4FHX A;  7ICF A;  4RT3 A;  3UPQ A;  2HN2 A;  2IHM A;  3JPP A;  3AQN A;  1MQ3 A;  5DBC A;  2PXI A;  3UXO A;  4N7R A;  4XJE A;  4QZF A;  4KLH A;  3PML A;  2ZH6 A;  2ID1 A;  1GPJ A;  3RH6 A;  9ICV A;  4DOC A;  3NVO A;  5IIL A;  4F5O A;  4I2I A;  5J0Q A;  4X4V A;  7ICI A;  3OVB A;  4IQV A;  4WBY A;  1ZQF A;  4KLI A;  1ZQZ A;  5CFT A;  4RPZ A;  4TUP A;  4JWM A;  7ICV A;  3HIY A;  4E7X A;  1UEU A;  4WC2 A;  7ICU A;  1XSL A;  7ICL A;  4RPX A;  4DOA A;  4LEZ A;  3MDC A;  4JLX A;  4KLU A;  4NKT A;  1ZJN A;  2FCL A;  4LEV A;  4QZB A;  5CR0 A;  4NXT A;  3NWI A;  4AT9 A;  5CB1 A;  4RQ2 A;  4O9M A;  5IIM A;  4F5N A;  3HW8 A;  5J2G A;  4M0A A;  4UD5 A;  8ICX A;  4WC1 A;  2B51 A;  3WFP A;  3PMN A;  4NKU A;  5HRH A;  4GXI A;  3OWG A;  4O5E A;  5J0U A;  4R65 A;  3JPQ A;  3C5G A;  1HUZ A;  4NXV A;  2ZHB A;  5DDY A;  3RJI A;  4KLG A;  4KLM A;  3LK9 A;  5DED A;  3UQ0 A;  4X4R A;  2ZH9 A;  4K4I A;  9ICC A;  3H39 A;  7ICK A;  1ZQW A;  1BPZ A;  4AT8 B;  4LVS A;  1KNY A;  4I2J A;  2ZH3 A;  2BCV A;  3WFO A;  8ICK A;  1ZQV A;  4X0A A;  4WQL A;  3MBY A;  4F5P A;  3ER8 C;  3NYB A;  4K4H A;  2IUB A;  2Q66 A;  5J2I A;  5IIK A;  4I28 A;  4RWN A;  4M9H A;  2ZH8 A;  7ICT A;  4WC7 A;  9ICR A;  1MIY A;  5HRD A;  5JTG A;  4FH5 A;  4NXZ A;  1ZQM A;  4NLK A;  2ZH4 A;  4K98 A;  3PHZ A;  4I29 A;  2ISO A;  3OVA A;  4RWO A;  4MF8 A;  4FHW A;  7ICN A;  3K7D A;  4HX0 A;  5CFS A;  4RWP A;  9ICT A;  4RQ5 A;  4OAH A;  4UB2 A;  1ZQA A;  4FO1 A;  4UAY A;  9ICN A;  5HRI A;  5HHH A;  4QZG A;  5J2K A;  3C2L A;  4NM2 A;  5J0Y A;  4Z6D A;  4OAG A;  1ZQO A;  8ICY A;  4EP7 A;  3EF2 A;  5BPC A;  2P66 A;  1JQR A;  1R8B A;  4I2B A;  4I2G A;  5J2F A;  9ICW A;  2DVI A;  5CA7 A;  1YLQ A;  4MFA A;  4P4M A;  3RJG A;  2M2U A;  3JZ0 A;  4M9L A;  4X4T A;  5CFU A;  4NXU A;  8ICP A;  9ICO A;  4I2E A;  4AT7 B;  4RQ7 A;  4PHD A;  7ICR A;  2FMQ A;  5IIJ A;  1JN3 A;  2B4V A;  9ICX A;  4PGY A;  2FMP A;  3JPS A;  4KLJ A;  5D61 A;  4X4P A;  3NKU A;  8ICU A;  1ZQB A;  5DB6 A;  9ICQ A;  7ICS A;  2BPF A;  4UD4 A;  8ICA A;  4K96 A;  4RPY A;  2HHP A;  3WFR E;  1Q78 A;  4GXK A;  9ICB A;  4K99 A;  3JYY A;  5HRE A;  7ICE A;  2O5A A;  3OVS A;  5DBB A;  5J0O A;  5HC9 A;  3V72 A;  5DB8 A;  4S3N A;  4UBB A;  5B3Q A;  8ICE A;  5DEC A;  9ICA A;  4K8V A;  4EBJ A;  5IIN A;  3OUY B;  4XUS A;  4X4N A;  4OAI Z;  3JPT A;  5HRK A;  3OGU A;  4KLF A;  4MF2 A;  1ZQS A;  9ICJ A;  4R63 A;  4XRH A;  4O67 A;  1RZT A;  1RPL A;  1ZJM A;  2BBH A;  4I2D A;  3C5F A;  4PGX A;  3RJE A;  2PFN A;  1BPB A;  4IQT A;  8ICW A;  4NY8 A;  4ATB A;  3C66 A;  4M9N A;  5HRL A;  3HJ4 A;  1ZQH A;  9ICS A;  1ZQN A;  4DO9 A;  3WFQ E;  2BCS A;  2FMS A;  4K9A A;  8ICG A;  2VAN A;  4KB6 A;  4QZ8 A;  2M2T A;  4UB4 A;  4RWQ A;  4EED A;  4WOY A;  1BPD A;  4YMO A;  4RQ8 A;  3RH5 A;  4LZG A;  7ICQ A;  2PBE A;  2B56 A;  1TFY A;  4KLO A;  4PH5 A;  2DR5 A;  5J2B A;  3GDX A;  1R8A A;  4LT6 A;  4WBZ A;  4WC4 A;  4Z6F A;  4JWN A;  1ZQX A;  9ICU A;  4EGW A;  1JMS A;  5D49 A;  3MGH A;  3UQ2 A;  3JCF A;  5J29 A;  2DR9 A;  3PNC A;  3AQL A;  2PFQ A;  3B0X A;  3LQC B;  1PX5 A;  4FH3 A;  1ZQY A;  9ICK A;  2M2V A;  4WC3 A;  4TUR A;  5HRB A;  2RFF A;  5DKW A;  4E80 A;  3AU6 A;  4GXJ A;  4LEW A;  8ICH A;  4QZE A;  4IQW A;  1ZQT A;  4I0U A;  4YCX A;  4R64 A;  1ZQE A;  4TUS A;  7ICG A;  5HHI A;  5CWR A;  3H38 A;  1VJ7 A;  1MIW A;  4PPX A;  8ICL A;  3ISB A;  5D63 A;  4DOB A;  4WC6 A;  5D62 A;  3CK6 A;  4OAF A;  5DDM A;  3UXP A;  5J2J A;  4RQ4 A;  1ZQQ A;  5CP2 A;  4MFF A;  8ICF A;  4MFC A;  3ISD A;  1ZQK A;  4UAZ A;  4O5C A;  8ICM A;  4WQK A;  2ZH5 A;  2DR7 A;  4F5R A;  4FHV A;  4QZH A;  4AT9 B;  1ZQU A;  3HWT A;  5J2H A;  5BOM A;  4QZ9 A;  5J2A A;  2ZH1 A;  4FO6 A;  1BPE A;  2M2W A;  1BPY A;  4M04 A;  4PHE A;  4M2Y A;  4KLT A;  1FA0 A;  4X0B A;  4K4G A;  3TFS A;  3RJF A;  4AT8 A;  8ICS A;  2ZHA A;  2GAF D;  8ICJ A;  3JPO A;  3H37 A;  4M47 A;  4YD2 A;  4LZD A;  4KLQ A;  4NM1 A;  1NO5 A;  1TV9 A;  5J2D A;  4YD1 A;  1F5A A;  5CHE A;  4QZI A;  4O69 A;  2DRB A;  4QZA A;  9ICP A;  5J0S A;  1ZQI A;  2GWS A;  2PFP A;  1ZQL A;  2ISP A;  8ICZ A;  2BPC A;  5III A;  3WFS C;  4KLS A;  4TUQ A;  5F2V O;  4RQ1 A;  3C2M A;  3UXN A;  4I2H A;  5CHG A;  3AUO A;  5J0W A;  7ICM A;  4M9J A;  4X4S A;  1NOM A;  8ICI A;  5J0P A; 
#chains in the Genus database with same CATH homology
 4QZC A;  4P4P A;  3L9D A;  3V7K A;  3RJH A;  1V4A A;  3K75 D;  1XSP A;  5J2E A;  1TVA A;  4XA5 A;  4UBC A;  3MGI A;  2W9M A;  4YMN A;  4I2A A;  5TZV A;  8ICV A;  1JAJ A;  4EBK A;  1UEV A;  5HR9 A;  8ICC A;  1ZQR A;  8ICR A;  9ICG A;  1Q79 A;  4P4O A;  1R89 A;  7ICH A;  4WCW A;  2DRA A;  5HRF A;  1ZQG A;  4I27 A;  1KDH A;  4M5D A;  4PHP A;  5D46 A;  4I2F A;  4Z6E A;  4FHP A;  4RQ6 A;  4IG8 A;  8ICN A;  1WOT A;  9ICE A;  9ICL A;  4AT7 A;  4F5Q A;  1KEJ A;  5IIO A;  8ICQ A;  4NXW A;  8ICT A;  5DB7 A;  5HRG A;  5DB9 A;  4K97 A;  4X4Q A;  4X4U A;  4M9G A;  1R8C A;  5J0R A;  4O5K A;  2ZH7 A;  4MKP A;  3UPS A;  4YMM A;  2NRK A;  4O6A A;  5DBA A;  4IQU A;  3RJK A;  1OU5 A;  1VFG A;  3TFR A;  2I9G A;  1ZQJ A;  5D4B A;  4KLD A;  4JLZ A;  5EOZ A;  4R66 A;  1UET A;  3OUY A;  2DR8 A;  1TFW A;  4PHA A;  5J0T A;  2PFO A;  4I2C A;  4P2H A;  4E8F A;  4X5V A;  2BCR A;  3B0Y A;  8ICO A;  7ICP A;  3AQM A;  5CJ7 A;  7ICJ A;  2ZH2 A;  4QZD A;  1ZQC A;  5J0X A;  7ICO A;  9ICF A;  3ISC A;  3H3A A;  4RQ0 A;  1BPX A;  9ICH A;  4K9B A;  4KLE A;  4UB1 A;  3OV7 A;  3MDA A;  4XQ7 A;  4X4O A;  3V7L A;  2BCU A;  4KM5 A;  3JPR A;  3V7J A;  9ICI A;  1ZQP A;  1ZQD A;  3AU2 A;  4XQ8 A;  3HJ1 A;  4WC5 A;  4UB3 A;  4Z6C A;  4ATB B;  2O1P A;  4LEY A;  4KLL A;  3RH4 A;  9ICM A;  3AQK A;  3RJJ A;  8ICB A;  4NLZ A;  4O68 A;  4WC0 A;  4NXX A;  2BPG A;  4RT2 A;  2BE3 A;  4RQ3 A;  1XSN A;  1HUO A;  4PGQ A;  1MQ2 A;  5BOL A;  3HX0 A;  3C18 A;  3C2K A;  4UB5 A;  4FHY A;  1MIV A;  3JPN A;  2BCQ A;  5J2C A;  4UAW A;  4NLN A;  4YN4 A;  4FHX A;  7ICF A;  4RT3 A;  3UPQ A;  2IHM A;  3JPP A;  3AQN A;  1MQ3 A;  5DBC A;  2PXI A;  3UXO A;  4QZF A;  4KLH A;  3PML A;  2ZH6 A;  2ID1 A;  3RH6 A;  9ICV A;  4DOC A;  5IIL A;  4F5O A;  4I2I A;  5J0Q A;  4X4V A;  7ICI A;  3OVB A;  4IQV A;  4WBY A;  1ZQF A;  4KLI A;  1ZQZ A;  4RPZ A;  4TUP A;  4JWM A;  7ICV A;  3HIY A;  4E7X A;  1UEU A;  4WC2 A;  7ICU A;  1XSL A;  7ICL A;  4RPX A;  4DOA A;  4LEZ A;  3MDC A;  4JLX A;  4KLU A;  4NKT A;  1ZJN A;  4LEV A;  4QZB A;  5CR0 A;  4NXT A;  4AT9 A;  5CB1 A;  4RQ2 A;  4O9M A;  5IIM A;  4F5N A;  3HW8 A;  5J2G A;  4M0A A;  4UD5 A;  8ICX A;  4WC1 A;  2B51 A;  3WFP A;  3PMN A;  4NKU A;  5HRH A;  4GXI A;  4O5E A;  5J0U A;  4R65 A;  3JPQ A;  3C5G A;  1HUZ A;  4NXV A;  2ZHB A;  5DDY A;  3RJI A;  4KLG A;  4KLM A;  3LK9 A;  5DED A;  3UQ0 A;  4X4R A;  2ZH9 A;  4K4I A;  9ICC A;  3H39 A;  7ICK A;  1ZQW A;  1BPZ A;  4AT8 B;  4LVS A;  1KNY A;  4I2J A;  2ZH3 A;  2BCV A;  3WFO A;  8ICK A;  1ZQV A;  4X0A A;  3MBY A;  4F5P A;  3NYB A;  4K4H A;  2Q66 A;  5J2I A;  5IIK A;  4I28 A;  4RWN A;  4M9H A;  2ZH8 A;  7ICT A;  4WC7 A;  9ICR A;  1MIY A;  5HRD A;  4FH5 A;  4NXZ A;  1ZQM A;  4NLK A;  2ZH4 A;  4K98 A;  4I29 A;  2ISO A;  3OVA A;  4RWO A;  4MF8 A;  4FHW A;  7ICN A;  4RWP A;  9ICT A;  4RQ5 A;  4OAH A;  4UB2 A;  1ZQA A;  4UAY A;  9ICN A;  5HRI A;  5HHH A;  4QZG A;  5J2K A;  3C2L A;  4NM2 A;  5J0Y A;  4Z6D A;  4OAG A;  1ZQO A;  8ICY A;  4EP7 A;  5BPC A;  2P66 A;  1JQR A;  1R8B A;  4I2B A;  4I2G A;  5J2F A;  9ICW A;  2DVI A;  5CA7 A;  1YLQ A;  4MFA A;  4P4M A;  3RJG A;  2M2U A;  3JZ0 A;  4M9L A;  4X4T A;  4NXU A;  8ICP A;  9ICO A;  4I2E A;  4AT7 B;  4RQ7 A;  4PHD A;  7ICR A;  2FMQ A;  5IIJ A;  1JN3 A;  2B4V A;  9ICX A;  4PGY A;  2FMP A;  3JPS A;  4KLJ A;  4X4P A;  8ICU A;  1ZQB A;  5DB6 A;  9ICQ A;  7ICS A;  2BPF A;  4UD4 A;  8ICA A;  4K96 A;  4RPY A;  2HHP A;  3WFR E;  1Q78 A;  4GXK A;  9ICB A;  4K99 A;  3JYY A;  5HRE A;  7ICE A;  2O5A A;  3OVS A;  5DBB A;  5J0O A;  5HC9 A;  3V72 A;  5DB8 A;  4S3N A;  4UBB A;  8ICE A;  5DEC A;  9ICA A;  4K8V A;  4EBJ A;  5IIN A;  3OUY B;  4XUS A;  4X4N A;  4OAI Z;  3JPT A;  5HRK A;  3OGU A;  4KLF A;  4MF2 A;  1ZQS A;  9ICJ A;  4R63 A;  4XRH A;  4O67 A;  1RZT A;  1RPL A;  1ZJM A;  4I2D A;  3C5F A;  4PGX A;  3RJE A;  2PFN A;  1BPB A;  4IQT A;  8ICW A;  4NY8 A;  4ATB A;  3C66 A;  4M9N A;  5HRL A;  3HJ4 A;  1ZQH A;  9ICS A;  1ZQN A;  4DO9 A;  3WFQ E;  2BCS A;  2FMS A;  4K9A A;  8ICG A;  2VAN A;  4KB6 A;  4QZ8 A;  2M2T A;  4UB4 A;  4RWQ A;  4WOY A;  1BPD A;  4YMO A;  4RQ8 A;  3RH5 A;  4LZG A;  7ICQ A;  2PBE A;  2B56 A;  1TFY A;  4KLO A;  4PH5 A;  2DR5 A;  5J2B A;  3GDX A;  1R8A A;  4LT6 A;  4WBZ A;  4WC4 A;  4Z6F A;  4JWN A;  1ZQX A;  9ICU A;  3UQ2 A;  1JMS A;  5D49 A;  3MGH A;  5J29 A;  2DR9 A;  3PNC A;  3AQL A;  2PFQ A;  3B0X A;  3LQC B;  1PX5 A;  4FH3 A;  1ZQY A;  9ICK A;  2M2V A;  4WC3 A;  4TUR A;  5HRB A;  2RFF A;  5DKW A;  4E80 A;  3AU6 A;  4GXJ A;  4LEW A;  8ICH A;  4QZE A;  4IQW A;  1ZQT A;  4YCX A;  4R64 A;  1ZQE A;  4TUS A;  7ICG A;  5HHI A;  5CWR A;  3H38 A;  1VJ7 A;  1MIW A;  4PPX A;  8ICL A;  3ISB A;  4DOB A;  4WC6 A;  4OAF A;  5DDM A;  3UXP A;  5J2J A;  4RQ4 A;  1ZQQ A;  5CP2 A;  4MFF A;  8ICF A;  4MFC A;  3ISD A;  1ZQK A;  4UAZ A;  4O5C A;  8ICM A;  2ZH5 A;  2DR7 A;  4F5R A;  4FHV A;  4QZH A;  4AT9 B;  1ZQU A;  3HWT A;  5J2H A;  5BOM A;  4QZ9 A;  5J2A A;  2ZH1 A;  4FO6 A;  1BPE A;  2M2W A;  1BPY A;  4M04 A;  4PHE A;  4M2Y A;  4KLT A;  1FA0 A;  4X0B A;  4K4G A;  3TFS A;  3RJF A;  4AT8 A;  8ICS A;  2ZHA A;  8ICJ A;  3JPO A;  3H37 A;  4M47 A;  4YD2 A;  4LZD A;  4KLQ A;  4NM1 A;  1NO5 A;  1TV9 A;  5J2D A;  4YD1 A;  1F5A A;  4QZI A;  4O69 A;  2DRB A;  4QZA A;  9ICP A;  5J0S A;  1ZQI A;  2GWS A;  2PFP A;  1ZQL A;  2ISP A;  8ICZ A;  2BPC A;  5III A;  3WFS C;  4KLS A;  4TUQ A;  5F2V O;  4RQ1 A;  3C2M A;  3UXN A;  4I2H A;  5CHG A;  3AUO A;  5J0W A;  7ICM A;  4M9J A;  4X4S A;  1NOM A;  8ICI A;  5J0P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...