4E80A

Structural basis for the activity of a cytoplasmic rna terminal u-transferase
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
339
structure length
317
Chain Sequence
b'HKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSKDRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEAPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Structural basis for the activity of a cytoplasmic RNA terminal uridylyl transferase.
pubmed doi rcsb
source organism Schizosaccharomyces pombe 972h-
molecule tags Transferase
total genus 106
structure length 317
sequence length 339
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4e80A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4e80A02
2NRKA 4P4MA 4X4RA 3JZ0A 1ZQEA 9ICLA 5D46A 3UQ0A 3RJGA 3AU6A 3C5GA 3UXOA 9ICCA 5TZVA 1MQ2A 4I27A 8ICNA 1F5AA 4XUSA 3JPQA 3UPQA 1UEUA 1HUOA 2P66A 1ZQFA 1JAJA 4RWOA 3OV7A 1ZQMA 1TV9A 4QZ8A 4UB2A 4K4HA 1NOMA 5CP2A 4M9LA 5BOLA 4FH3A 2GWSA 4KLJA 4WC7A 2O5AA 4UBCA 4QZCA 4M2YA 2ZHBA 4RQ0A 4QZFA 7ICQA 4O5KA 2PXIA 4PHEA 5IILA 3OVAA 4TUQA 5J2GA 1OU5A 4PGQA 3OVBA 4KLHA 2HHPA 8ICLA 3H38A 3WFQE 3PMLA 8ICCA 2ZH9A 4RWQA 1ZQUA 4Z6CA 7ICGA 5J2FA 1ZQBA 1ZQNA 4X0AA 3PNCA 8ICYA 1ZQIA 4KLEA 2DRAA 5HREA 5J2CA 4F5OA 9ICNA 1ZJNA 3TFRA 1XSLA 9ICAA 9ICGA 9ICFA 4QZEA 4QZAA 4AT7B 2BPGA 4O5EA 3HW8A 3RJFA 4QZDA 8ICFA 2BCQA 3H3AA 9ICVA 4O5CA 3MDAA 5DBAA 3JPOA 4KLDA 3C66A 4UAZA 5CR0A 4XQ7A 4UB4A 3HJ1A 1R8CA 4WBYA 8ICBA 3AU2A 4WBZA 4Z6EA 5IIJA 4F5PA 2FMQA 4NKUA 7ICVA 7ICJA 5DB8A 9ICIA 9ICWA 1ZQAA 4X4PA 3LQCB 4PH5A 1R89A 4RPXA 4M5DA 4YMNA 5J2DA 2M2UA 4F5QA 9ICHA 1UEVA 5EOZA 4RWPA 3WFPA 8ICVA 5HRIA 2ISPA 1BPDA 9ICRA 4I29A 1YLQA 4QZBA 4JWMA 1ZQWA 8ICZA 4QZIA 4FO6A 4WC5A 3V7LA 5CWRA 2RFFA 4WC6A 4TUPA 1BPEA 3OUYA 1JMSA 4PHPA 4YD1A 4UBBA 4MFCA 4E80A 1MIVA 4YMOA 4IQUA 5HRLA 3AUOA 4FHVA 3AQKA 4AT9A 7ICKA 8ICAA 4M9HA 4WC4A 5IINA 4I2EA 4PPXA 4RQ5A 4M47A 3UPSA 5J0TA 2Q66A 8ICEA 4JWNA 2DR8A 9ICTA 4RQ4A 4F5RA 3TFSA 1KDHA 5J2AA 4I28A 5J29A 4NLNA 4RT2A 3HWTA 2DR9A 1TFWA 4P4PA 2BE3A 4P4OA 1ZQTA 8ICUA 3RH5A 3MGHA 3WFOA 4QZ9A 3C18A 1ZQZA 4RPZA 4TURA 3HJ4A 4ATBA 3H37A 1ZQVA 1VJ7A 5J0PA 3MDCA 1RZTA 1ZQXA 4YMMA 2PFQA 4UAWA 4R64A 4X5VA 4NXZA 3V72A 3RJKA 4E8FA 1ZQDA 2PBEA 9ICXA 9ICPA 8ICWA 4R66A 2ZHAA 4KLLA 3LK9A 4RQ2A 4XA5A 1TVAA 4NLZA 1ZQYA 9ICMA 5HRDA 3AQMA 5IIIA 2ZH6A 4GXIA 4LZGA 1XSNA 3AQNA 4RQ8A 5J0SA 5DB6A 4NY8A 1ZQQA 4UD5A 1VFGA 9ICUA 3MGIA 3V7JA 2B51A 5J0UA 8ICHA 2PFPA 7ICPA 1PX5A 5D4BA 3RH4A 4DOAA 2ZH8A 4XQ8A 2IHMA 5J2HA 9ICEA 8ICIA 4RT3A 4K4IA 3JPRA 4NM1A 3RJJA 7ICNA 8ICQA 4F5NA 2DR5A 4X4TA 2BCRA 2W9MA 5DECA 4RQ7A 3HX0A 4I2JA 4IG8A 8ICTA 4M0AA 4LZDA 2ZH5A 4LT6A 3C2LA 4M9GA 5IIOA 3JPPA 1KEJA 4NM2A 8ICOA 4X4NA 3GDXA 2B4VA 5DBBA 4X4UA 9ICJA 3B0YA 5J2JA 1ZQOA 4YN4A 1BPYA 2DVIA 3RH6A 2ZH2A 5DB9A 4NKTA 5HHIA 5HRHA 4FHPA 5DDMA 4GXKA 5DEDA 3C2MA 3OVSA 4O9MA 2B56A 2BCSA 7ICRA 4WC0A 5J0OA 5HRKA 4P2HA 1R8AA 3OUYB 4I2BA 4DOBA 4KLGA 5J2IA 2DR7A 7ICMA 4MF2A 4KLTA 8ICSA 4I2AA 3PMNA 3UQ2A 2FMSA 3H39A 4WC1A 1XSPA 4AT9B 4KLSA 1WOTA 3ISBA 5J0XA 2PFOA 1JQRA 5CA7A 4R63A 3C2KA 3WFSC 4X4VA 5HHHA 4RQ6A 5HRGA 1TFYA 4KLIA 4WC2A 2VANA 3JYYA 4QZHA 5BOMA 4RQ3A 1ZQHA 2ID1A 4DOCA 1UETA 4PGYA 4X4OA 1R8BA 2ISOA 4MFFA 3UXPA 4MF8A 4KLMA 8ICPA 3K75D 1ZQLA 3RJEA 5J2BA 1ZQCA 1ZQPA 9ICBA 4IQVA 5HRFA 3JPTA 2ZH7A 8ICGA 7ICHA 4FH5A 4I2DA 4MFAA 1RPLA 5HRBA 4WCWA 4IQWA 3JPNA 8ICMA 4ATBB 7ICEA 4YD2A 2ZH3A 5IIMA 2M2TA 9ICQA 1BPBA 1JN3A 4FHXA 5D49A 4GXJA 1ZQRA 4LVSA 7ICTA 4YCXA 7ICOA 3HIYA 2DRBA 9ICOA 1Q79A 4E7XA 3B0XA 4EBKA 3RJIA 7ICIA 4RWNA 5J0QA 3MBYA 5DDYA 4UB3A 5DBCA 4RPYA 8ICJA 7ICUA 4UAYA 4UB1A 3L9DA 4KLQA 4UB5A 2BPCA 4TUSA 5BPCA 4I2HA 4M9NA 7ICSA 1KNYA 4QZGA 1ZQKA 4KLUA 3ISDA 7ICFA 4Z6DA 5F2VO 8ICXA 2M2WA 1BPZA 1HUZA 3RJHA 5IIKA 4I2IA 4KLFA 1Q78A 4AT7A 5CJ7A 2ZH1A 3UXNA 5DKWA 2BPFA 4NLKA 3ISCA 7ICLA 5J0WA 4RQ1A 3OGUA 4X4QA 4EP7A 3V7KA 4UD4A 3WFRE 2O1PA 3JPSA 4PHAA 1ZQSA 2BCVA 4FHWA 5J2KA 5HR9A 1MIWA 4WC3A 1MIYA 9ICKA 4XRHA 1MQ3A 5J0RA 4M9JA 4AT8A 5HC9A 4R65A 1BPXA 4AT8B 4PHDA 4S3NA 2ZH4A 1NO5A 4X0BA 2I9GA 2BCUA 2PFNA 1FA0A 4PGXA 9ICSA 1ZQJA 3AQLA 5CHGA 4X4SA 4Z6FA 5J2EA 3C5FA 4I2FA 4IQTA 5CB1A 1ZJMA 4K4GA 4EBJA 4FHYA 4KLOA 2M2VA 1ZQGA 4I2CA 4DO9A 8ICKA 8ICRA 5J0YA 1V4AA 5DB7A 3NYBA 4I2GA 4M04A 2FMPA
chains in the Genus database with same CATH superfamily
2NRKA 1GPJA 4P4MA 4X4RA 3JZ0A 1ZQEA 2HN2A 9ICLA 5D46A 3UQ0A 3RJGA 3AU6A 3C5GA 3UXOA 3ERCC 9ICCA 5TZVA 1MQ2A 4I27A 8ICNA 1F5AA 4XUSA 3JPQA 3UPQA 4FO1A 1UEUA 1HUOA 2P66A 1ZQFA 1JAJA 4RWOA 4WQKA 3OV7A 4O67A 1ZQMA 1TV9A 4QZ8A 4UB2A 4K4HA 1NOMA 5CP2A 4M9LA 5BOLA 4FH3A 2GWSA 4KLJA 4WC7A 2O5AA 4UBCA 4QZCA 4M2YA 2ZHBA 4RQ0A 4KM5A 4QZFA 7ICQA 4O5KA 3K7DA 2PXIA 4PHEA 5IILA 3OVAA 4TUQA 4OAHA 3ER9B 5J2GA 1OU5A 3OVBA 4PGQA 4KLHA 2HHPA 8ICLA 3H38A 3WFQE 3PMLA 8ICCA 2ZH9A 4RWQA 1ZQUA 4Z6CA 7ICGA 5J2FA 1ZQBA 4EEDA 1ZQNA 4X0AA 3PNCA 8ICYA 1ZQIA 2DRAA 4KLEA 5HREA 5J2CA 4F5OA 9ICNA 1ZJNA 3TFRA 1XSLA 9ICAA 9ICGA 9ICFA 4NXVA 4QZEA 4QZAA 4AT7B 2BPGA 4O5EA 3HW8A 3RJFA 4QZDA 8ICFA 2BCQA 3H3AA 9ICVA 4O5CA 3MDAA 5DBAA 3JPOA 3PHZA 3C66A 4KLDA 4UAZA 5CR0A 2IHOA 4MKPA 4XQ7A 4UB4A 1R8CA 3HJ1A 4WBYA 3JCFA 4K98A 8ICBA 3AU2A 4WBZA 4Z6EA 5IIJA 4F5PA 2FMQA 4NKUA 7ICVA 7ICJA 4OAGA 5DB8A 9ICIA 9ICWA 1ZQAA 4X4PA 3LQCB 4PH5A 1R89A 4RPXA 4M5DA 4YMNA 4K96A 2M2UA 5J2DA 4F5QA 5D63A 9ICHA 1UEVA 5EOZA 2GAFD 4RWPA 3WFPA 8ICVA 5HRIA 2ISPA 1BPDA 9ICRA 4OAIZ 4I29A 1YLQA 4QZBA 4JWMA 1ZQWA 8ICZA 4QZIA 4FO6A 4LEZA 4WOYA 4WC5A 3V7LA 4WQLA 5CWRA 2RFFA 4WC6A 4TUPA 3OUYA 1BPEA 1JMSA 4JLXA 4PHPA 4YD1A 4UBBA 4MFCA 4E80A 4LEWA 1MIVA 5B3PA 4YMOA 4IQUA 5HRLA 3AUOA 4FHVA 3AQKA 4AT9A 7ICKA 8ICAA 4M9HA 4K8VA 4WC4A 5IINA 4I2EA 4PPXA 4EEBA 4RQ5A 4M47A 3UPSA 5J0TA 2Q66A 8ICEA 3OWGA 4JWNA 2DR8A 9ICTA 4RQ4A 4F5RA 3TFSA 1KDHA 5D62A 5J2AA 4I28A 5J29A 4NLNA 4RT2A 3HWTA 2DR9A 1TFWA 4P4PA 2BE3A 4P4OA 1ZQTA 8ICUA 3RH5A 3MGHA 3WFOA 2GA9D 4QZ9A 3C18A 1ZQZA 4RPZA 4TURA 3HJ4A 4ATBA 3H37A 1ZQVA 1VJ7A 5J0PA 3MDCA 1RZTA 1ZQXA 4YMMA 2PFQA 4UAWA 4R64A 4X5VA 4NXZA 3V72A 3RJKA 4E8FA 1ZQDA 2PBEA 9ICXA 9ICPA 8ICWA 4R66A 2ZHAA 4KLLA 3LK9A 4RQ2A 4K9BA 2BBJA 4XA5A 1TVAA 4NXXA 1ZQYA 4NLZA 5HRDA 9ICMA 3AQMA 5IIIA 2ZH6A 4GXIA 4LZGA 4HX0A 4O6AA 1XSNA 3AQNA 4RQ8A 5J0SA 5DB6A 4NY8A 1ZQQA 4UD5A 1VFGA 9ICUA 3MGIA 3V7JA 2B51A 4EV6A 5J0UA 8ICHA 2PFPA 7ICPA 4K9AA 1PX5A 5D4BA 3RH4A 3ER8C 4DOAA 2ZH8A 4XQ8A 2IHMA 5J2HA 9ICEA 4K97A 8ICIA 4RT3A 4K4IA 3JPRA 4NM1A 2IUBA 3RJJA 7ICNA 8ICQA 4F5NA 2DR5A 4X4TA 2BCRA 2W9MA 5DECA 4RQ7A 3HX0A 4I2JA 4IG8A 8ICTA 4M0AA 2ZH5A 4LZDA 4LT6A 3C2LA 4M9GA 5JTGA 5IIOA 3JPPA 1KEJA 4NM2A 8ICOA 4X4NA 3GDXA 2B4VA 5DBBA 2HN1A 4OAFA 4X4UA 9ICJA 3B0YA 5J2JA 1ZQOA 4YN4A 4I0UA 1BPYA 2DVIA 3RH6A 2ZH2A 5DB9A 4NKTA 5HHIA 5HRHA 4FHPA 4KB6A 5DDMA 4GXKA 5DEDA 3C2MA 3OVSA 4NXUA 4O9MA 2B56A 2BCSA 7ICRA 4WC0A 4K99A 5J0OA 5HRKA 4P2HA 1R8AA 3OUYB 4I2BA 4DOBA 4KLGA 5J2IA 2DR7A 7ICMA 4MF2A 4KLTA 8ICSA 4I2AA 3PMNA 3UQ2A 2FMSA 3NWIA 4O69A 3H39A 4WC1A 1XSPA 4AT9B 4KLSA 1WOTA 2FCLA 3ISBA 5J0XA 2PFOA 1JQRA 5CA7A 4R63A 5CFSA 3C2KA 3CK6A 3WFSC 4X4VA 5HHHA 4RQ6A 5HRGA 1TFYA 4KLIA 4WC2A 2VANA 3JYYA 4QZHA 5BOMA 4RQ3A 1ZQHA 2ID1A 4DOCA 5D61A 1UETA 4X4OA 4PGYA 1R8BA 2ISOA 4MFFA 3UXPA 5CFUA 4MF8A 4KLMA 8ICPA 3K75D 1ZQLA 4EGWA 4N7RA 3RJEA 5J2BA 1ZQCA 1ZQPA 9ICBA 4IQVA 5HRFA 3JPTA 2ZH7A 3NVOA 8ICGA 7ICHA 4FH5A 4I2DA 4MFAA 1RPLA 5HRBA 4WCWA 4IQWA 3JPNA 8ICMA 4JLZA 4ATBB 7ICEA 4YD2A 2ZH3A 5IIMA 4LEVA 2M2TA 9ICQA 1BPBA 1JN3A 5CFTA 4FHXA 5D49A 4GXJA 1ZQRA 4LVSA 7ICTA 4YCXA 7ICOA 3HIYA 2DRBA 9ICOA 1Q79A 4E7XA 3B0XA 4EBKA 3RJIA 7ICIA 4RWNA 5J0QA 3MBYA 5DDYA 4UB3A 5DBCA 2EWRA 4RPYA 8ICJA 7ICUA 4UAYA 4UB1A 3L9DA 4KLQA 4UB5A 2BPCA 4TUSA 5BPCA 4I2HA 4M9NA 7ICSA 1KNYA 4WH5A 4QZGA 1ZQKA 4KLUA 3ISDA 7ICFA 4Z6DA 5F2VO 8ICXA 2M2WA 1BPZA 1HUZA 3RJHA 5IIKA 4I2IA 4KLFA 1Q78A 4O68A 4AT7A 2BBHA 5CJ7A 2ZH1A 3UXNA 5DKWA 2BPFA 4NLKA 3ISCA 7ICLA 5J0WA 4RQ1A 3OGUA 5CHEA 4X4QA 4EP7A 3V7KA 4UD4A 3WFRE 2O1PA 3JPSA 4PHAA 1ZQSA 2BCVA 4FHWA 5J2KA 5HR9A 1MIWA 4WC3A 1MIYA 9ICKA 4XRHA 1MQ3A 5J0RA 4M9JA 4AT8A 5HC9A 4XJEA 4R65A 1BPXA 4AT8B 4PHDA 4NXTA 4S3NA 2ZH4A 3EF2A 1NO5A 4LEYA 4X0BA 2I9GA 2BCUA 2PFNA 1FA0A 4PGXA 9ICSA 1ZQJA 3NKUA 3AQLA 5CHGA 4X4SA 4Z6FA 5J2EA 3C5FA 4I2FA 3MCRA 4IQTA 5CB1A 5B3QA 1ZJMA 4EBJA 4K4GA 4FHYA 4KLOA 2M2VA 1ZQGA 4I2CA 4DO9A 8ICKA 8ICRA 4NXWA 5J0YA 1V4AA 5DB7A 3NYBA 4I2GA 4M04A 2FMPA
chains in the Genus database with same CATH topology
2NRKA 4P4MA 4X4RA 3JZ0A 1ZQEA 9ICLA 5D46A 3UQ0A 3RJGA 3AU6A 3C5GA 3UXOA 9ICCA 5TZVA 1MQ2A 4I27A 8ICNA 1F5AA 4XUSA 3JPQA 3UPQA 1UEUA 1HUOA 2P66A 1ZQFA 1JAJA 4RWOA 3OV7A 4O67A 1ZQMA 1TV9A 4QZ8A 4UB2A 4K4HA 1NOMA 5CP2A 4M9LA 5BOLA 4FH3A 2GWSA 4KLJA 4WC7A 2O5AA 4UBCA 4QZCA 4M2YA 2ZHBA 4RQ0A 4KM5A 4QZFA 7ICQA 4O5KA 2PXIA 4PHEA 5IILA 3OVAA 4TUQA 4OAHA 5J2GA 1OU5A 3OVBA 4PGQA 4KLHA 2HHPA 8ICLA 3H38A 3WFQE 3PMLA 8ICCA 2ZH9A 4RWQA 1ZQUA 4Z6CA 7ICGA 5J2FA 1ZQBA 1ZQNA 4X0AA 3PNCA 8ICYA 1ZQIA 2DRAA 4KLEA 5HREA 5J2CA 4F5OA 9ICNA 1ZJNA 3TFRA 1XSLA 9ICAA 9ICGA 9ICFA 4NXVA 4QZEA 4QZAA 4AT7B 2BPGA 4O5EA 3HW8A 3RJFA 4QZDA 8ICFA 2BCQA 3H3AA 9ICVA 4O5CA 3MDAA 5DBAA 3JPOA 4KLDA 3C66A 4UAZA 5CR0A 4MKPA 4XQ7A 4UB4A 1R8CA 3HJ1A 4WBYA 4K98A 8ICBA 3AU2A 4WBZA 4Z6EA 5IIJA 4F5PA 2FMQA 4NKUA 7ICVA 7ICJA 4OAGA 5DB8A 9ICIA 9ICWA 1ZQAA 4X4PA 3LQCB 4PH5A 1R89A 4RPXA 4M5DA 4YMNA 4K96A 2M2UA 5J2DA 4F5QA 9ICHA 1UEVA 5EOZA 4RWPA 3WFPA 8ICVA 5HRIA 2ISPA 1BPDA 9ICRA 4OAIZ 4I29A 1YLQA 4QZBA 4JWMA 1ZQWA 8ICZA 4QZIA 4FO6A 4LEZA 4WOYA 4WC5A 3V7LA 5CWRA 2RFFA 4WC6A 4TUPA 3OUYA 1BPEA 1JMSA 4JLXA 4PHPA 4YD1A 4UBBA 4MFCA 4E80A 4LEWA 1MIVA 4YMOA 4IQUA 5HRLA 3AUOA 4FHVA 3AQKA 4AT9A 7ICKA 8ICAA 4M9HA 4K8VA 4WC4A 5IINA 4I2EA 4PPXA 4RQ5A 4M47A 3UPSA 5J0TA 2Q66A 8ICEA 4JWNA 2DR8A 9ICTA 4RQ4A 4F5RA 3TFSA 1KDHA 5J2AA 4I28A 5J29A 4NLNA 4RT2A 3HWTA 2DR9A 1TFWA 4P4PA 2BE3A 4P4OA 1ZQTA 8ICUA 3RH5A 3MGHA 3WFOA 4QZ9A 3C18A 1ZQZA 4RPZA 4TURA 3HJ4A 4ATBA 3H37A 1ZQVA 1VJ7A 5J0PA 3MDCA 1RZTA 1ZQXA 4YMMA 2PFQA 4UAWA 4R64A 4X5VA 4NXZA 3V72A 3RJKA 4E8FA 1ZQDA 2PBEA 9ICXA 9ICPA 8ICWA 4R66A 2ZHAA 4KLLA 3LK9A 4RQ2A 4K9BA 4XA5A 1TVAA 4NXXA 1ZQYA 4NLZA 5HRDA 9ICMA 3AQMA 5IIIA 2ZH6A 4GXIA 4LZGA 4O6AA 1XSNA 3AQNA 4RQ8A 5J0SA 5DB6A 4NY8A 1ZQQA 4UD5A 1VFGA 9ICUA 3MGIA 3V7JA 2B51A 5J0UA 8ICHA 2PFPA 7ICPA 1PX5A 4K9AA 5D4BA 3RH4A 4DOAA 2ZH8A 4XQ8A 2IHMA 5J2HA 9ICEA 4K97A 8ICIA 4RT3A 4K4IA 3JPRA 4NM1A 3RJJA 7ICNA 8ICQA 4F5NA 2DR5A 4X4TA 2BCRA 2W9MA 5DECA 4RQ7A 3HX0A 4I2JA 4IG8A 8ICTA 4M0AA 2ZH5A 4LZDA 4LT6A 3C2LA 4M9GA 5IIOA 3JPPA 1KEJA 4NM2A 8ICOA 4X4NA 3GDXA 2B4VA 5DBBA 4OAFA 4X4UA 9ICJA 3B0YA 5J2JA 1ZQOA 4YN4A 1BPYA 2DVIA 3RH6A 2ZH2A 5DB9A 4NKTA 5HHIA 5HRHA 4FHPA 4KB6A 5DDMA 4GXKA 5DEDA 3C2MA 3OVSA 4NXUA 4O9MA 2B56A 2BCSA 7ICRA 4WC0A 4K99A 5J0OA 5HRKA 4P2HA 1R8AA 3OUYB 4I2BA 4DOBA 4KLGA 5J2IA 2DR7A 7ICMA 4MF2A 4KLTA 8ICSA 4I2AA 3PMNA 3UQ2A 2FMSA 4O69A 3H39A 4WC1A 1XSPA 4AT9B 4KLSA 1WOTA 3ISBA 5J0XA 2PFOA 1JQRA 5CA7A 4R63A 3C2KA 3WFSC 4X4VA 5HHHA 4RQ6A 5HRGA 1TFYA 4KLIA 4WC2A 2VANA 3JYYA 4QZHA 5BOMA 4RQ3A 1ZQHA 2ID1A 4DOCA 1UETA 4X4OA 4PGYA 1R8BA 2ISOA 4MFFA 3UXPA 4MF8A 4KLMA 8ICPA 3K75D 1ZQLA 3RJEA 5J2BA 1ZQCA 1ZQPA 9ICBA 4IQVA 5HRFA 3JPTA 2ZH7A 8ICGA 7ICHA 4FH5A 4I2DA 4MFAA 1RPLA 5HRBA 4WCWA 4IQWA 3JPNA 8ICMA 4JLZA 4ATBB 7ICEA 4YD2A 2ZH3A 5IIMA 4LEVA 2M2TA 9ICQA 1BPBA 1JN3A 4FHXA 5D49A 4GXJA 1ZQRA 4LVSA 7ICTA 4YCXA 7ICOA 3HIYA 2DRBA 9ICOA 1Q79A 4E7XA 3B0XA 4EBKA 3RJIA 7ICIA 4RWNA 5J0QA 3MBYA 5DDYA 4UB3A 5DBCA 4RPYA 8ICJA 7ICUA 4UAYA 4UB1A 3L9DA 4KLQA 4UB5A 2BPCA 4TUSA 5BPCA 4I2HA 4M9NA 7ICSA 1KNYA 4QZGA 1ZQKA 4KLUA 3ISDA 7ICFA 4Z6DA 5F2VO 8ICXA 2M2WA 1BPZA 1HUZA 3RJHA 5IIKA 4I2IA 4KLFA 1Q78A 4O68A 4AT7A 5CJ7A 2ZH1A 3UXNA 5DKWA 2BPFA 4NLKA 3ISCA 7ICLA 5J0WA 4RQ1A 3OGUA 4X4QA 4EP7A 3V7KA 4UD4A 3WFRE 2O1PA 3JPSA 4PHAA 1ZQSA 2BCVA 4FHWA 5J2KA 5HR9A 1MIWA 4WC3A 1MIYA 9ICKA 4XRHA 1MQ3A 5J0RA 4M9JA 4AT8A 5HC9A 4R65A 1BPXA 4AT8B 4PHDA 4NXTA 4S3NA 2ZH4A 1NO5A 4LEYA 4X0BA 2I9GA 2BCUA 2PFNA 1FA0A 4PGXA 9ICSA 1ZQJA 3AQLA 5CHGA 4X4SA 4Z6FA 5J2EA 3C5FA 4I2FA 4IQTA 5CB1A 1ZJMA 4K4GA 4EBJA 4FHYA 4KLOA 2M2VA 1ZQGA 4I2CA 4DO9A 8ICKA 8ICRA 4NXWA 5J0YA 1V4AA 5DB7A 3NYBA 4I2GA 4M04A 2FMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NRK A;  4P4M A;  4X4R A;  3JZ0 A;  1ZQE A;  9ICL A;  5D46 A;  3UQ0 A;  3RJG A;  3AU6 A;  3C5G A;  3UXO A;  9ICC A;  5TZV A;  1MQ2 A;  4I27 A;  8ICN A;  1F5A A;  4XUS A;  3JPQ A;  3UPQ A;  1UEU A;  1HUO A;  2P66 A;  1ZQF A;  1JAJ A;  4RWO A;  3OV7 A;  1ZQM A;  1TV9 A;  4QZ8 A;  4UB2 A;  4K4H A;  1NOM A;  5CP2 A;  4M9L A;  5BOL A;  4FH3 A;  2GWS A;  4KLJ A;  4WC7 A;  2O5A A;  4UBC A;  4QZC A;  4M2Y A;  2ZHB A;  4RQ0 A;  4QZF A;  7ICQ A;  4O5K A;  2PXI A;  4PHE A;  5IIL A;  3OVA A;  4TUQ A;  5J2G A;  1OU5 A;  4PGQ A;  3OVB A;  4KLH A;  2HHP A;  8ICL A;  3H38 A;  3WFQ E;  3PML A;  8ICC A;  2ZH9 A;  4RWQ A;  1ZQU A;  4Z6C A;  7ICG A;  5J2F A;  1ZQB A;  1ZQN A;  4X0A A;  3PNC A;  8ICY A;  1ZQI A;  4KLE A;  2DRA A;  5HRE A;  5J2C A;  4F5O A;  9ICN A;  1ZJN A;  3TFR A;  1XSL A;  9ICA A;  9ICG A;  9ICF A;  4QZE A;  4QZA A;  4AT7 B;  2BPG A;  4O5E A;  3HW8 A;  3RJF A;  4QZD A;  8ICF A;  2BCQ A;  3H3A A;  9ICV A;  4O5C A;  3MDA A;  5DBA A;  3JPO A;  4KLD A;  3C66 A;  4UAZ A;  5CR0 A;  4XQ7 A;  4UB4 A;  3HJ1 A;  1R8C A;  4WBY A;  8ICB A;  3AU2 A;  4WBZ A;  4Z6E A;  5IIJ A;  4F5P A;  2FMQ A;  4NKU A;  7ICV A;  7ICJ A;  5DB8 A;  9ICI A;  9ICW A;  1ZQA A;  4X4P A;  3LQC B;  4PH5 A;  1R89 A;  4RPX A;  4M5D A;  4YMN A;  5J2D A;  2M2U A;  4F5Q A;  9ICH A;  1UEV A;  5EOZ A;  4RWP A;  3WFP A;  8ICV A;  5HRI A;  2ISP A;  1BPD A;  9ICR A;  4I29 A;  1YLQ A;  4QZB A;  4JWM A;  1ZQW A;  8ICZ A;  4QZI A;  4FO6 A;  4WC5 A;  3V7L A;  5CWR A;  2RFF A;  4WC6 A;  4TUP A;  1BPE A;  3OUY A;  1JMS A;  4PHP A;  4YD1 A;  4UBB A;  4MFC A;  4E80 A;  1MIV A;  4YMO A;  4IQU A;  5HRL A;  3AUO A;  4FHV A;  3AQK A;  4AT9 A;  7ICK A;  8ICA A;  4M9H A;  4WC4 A;  5IIN A;  4I2E A;  4PPX A;  4RQ5 A;  4M47 A;  3UPS A;  5J0T A;  2Q66 A;  8ICE A;  4JWN A;  2DR8 A;  9ICT A;  4RQ4 A;  4F5R A;  3TFS A;  1KDH A;  5J2A A;  4I28 A;  5J29 A;  4NLN A;  4RT2 A;  3HWT A;  2DR9 A;  1TFW A;  4P4P A;  2BE3 A;  4P4O A;  1ZQT A;  8ICU A;  3RH5 A;  3MGH A;  3WFO A;  4QZ9 A;  3C18 A;  1ZQZ A;  4RPZ A;  4TUR A;  3HJ4 A;  4ATB A;  3H37 A;  1ZQV A;  1VJ7 A;  5J0P A;  3MDC A;  1RZT A;  1ZQX A;  4YMM A;  2PFQ A;  4UAW A;  4R64 A;  4X5V A;  4NXZ A;  3V72 A;  3RJK A;  4E8F A;  1ZQD A;  2PBE A;  9ICX A;  9ICP A;  8ICW A;  4R66 A;  2ZHA A;  4KLL A;  3LK9 A;  4RQ2 A;  4XA5 A;  1TVA A;  4NLZ A;  1ZQY A;  9ICM A;  5HRD A;  3AQM A;  5III A;  2ZH6 A;  4GXI A;  4LZG A;  1XSN A;  3AQN A;  4RQ8 A;  5J0S A;  5DB6 A;  4NY8 A;  1ZQQ A;  4UD5 A;  1VFG A;  9ICU A;  3MGI A;  3V7J A;  2B51 A;  5J0U A;  8ICH A;  2PFP A;  7ICP A;  1PX5 A;  5D4B A;  3RH4 A;  4DOA A;  2ZH8 A;  4XQ8 A;  2IHM A;  5J2H A;  9ICE A;  8ICI A;  4RT3 A;  4K4I A;  3JPR A;  4NM1 A;  3RJJ A;  7ICN A;  8ICQ A;  4F5N A;  2DR5 A;  4X4T A;  2BCR A;  2W9M A;  5DEC A;  4RQ7 A;  3HX0 A;  4I2J A;  4IG8 A;  8ICT A;  4M0A A;  4LZD A;  2ZH5 A;  4LT6 A;  3C2L A;  4M9G A;  5IIO A;  3JPP A;  1KEJ A;  4NM2 A;  8ICO A;  4X4N A;  3GDX A;  2B4V A;  5DBB A;  4X4U A;  9ICJ A;  3B0Y A;  5J2J A;  1ZQO A;  4YN4 A;  1BPY A;  2DVI A;  3RH6 A;  2ZH2 A;  5DB9 A;  4NKT A;  5HHI A;  5HRH A;  4FHP A;  5DDM A;  4GXK A;  5DED A;  3C2M A;  3OVS A;  4O9M A;  2B56 A;  2BCS A;  7ICR A;  4WC0 A;  5J0O A;  5HRK A;  4P2H A;  1R8A A;  3OUY B;  4I2B A;  4DOB A;  4KLG A;  5J2I A;  2DR7 A;  7ICM A;  4MF2 A;  4KLT A;  8ICS A;  4I2A A;  3PMN A;  3UQ2 A;  2FMS A;  3H39 A;  4WC1 A;  1XSP A;  4AT9 B;  4KLS A;  1WOT A;  3ISB A;  5J0X A;  2PFO A;  1JQR A;  5CA7 A;  4R63 A;  3C2K A;  3WFS C;  4X4V A;  5HHH A;  4RQ6 A;  5HRG A;  1TFY A;  4KLI A;  4WC2 A;  2VAN A;  3JYY A;  4QZH A;  5BOM A;  4RQ3 A;  1ZQH A;  2ID1 A;  4DOC A;  1UET A;  4PGY A;  4X4O A;  1R8B A;  2ISO A;  4MFF A;  3UXP A;  4MF8 A;  4KLM A;  8ICP A;  3K75 D;  1ZQL A;  3RJE A;  5J2B A;  1ZQC A;  1ZQP A;  9ICB A;  4IQV A;  5HRF A;  3JPT A;  2ZH7 A;  8ICG A;  7ICH A;  4FH5 A;  4I2D A;  4MFA A;  1RPL A;  5HRB A;  4WCW A;  4IQW A;  3JPN A;  8ICM A;  4ATB B;  7ICE A;  4YD2 A;  2ZH3 A;  5IIM A;  2M2T A;  9ICQ A;  1BPB A;  1JN3 A;  4FHX A;  5D49 A;  4GXJ A;  1ZQR A;  4LVS A;  7ICT A;  4YCX A;  7ICO A;  3HIY A;  2DRB A;  9ICO A;  1Q79 A;  4E7X A;  3B0X A;  4EBK A;  3RJI A;  7ICI A;  4RWN A;  5J0Q A;  3MBY A;  5DDY A;  4UB3 A;  5DBC A;  4RPY A;  8ICJ A;  7ICU A;  4UAY A;  4UB1 A;  3L9D A;  4KLQ A;  4UB5 A;  2BPC A;  4TUS A;  5BPC A;  4I2H A;  4M9N A;  7ICS A;  1KNY A;  4QZG A;  1ZQK A;  4KLU A;  3ISD A;  7ICF A;  4Z6D A;  5F2V O;  8ICX A;  2M2W A;  1BPZ A;  1HUZ A;  3RJH A;  5IIK A;  4I2I A;  4KLF A;  1Q78 A;  4AT7 A;  5CJ7 A;  2ZH1 A;  3UXN A;  5DKW A;  2BPF A;  4NLK A;  3ISC A;  7ICL A;  5J0W A;  4RQ1 A;  3OGU A;  4X4Q A;  4EP7 A;  3V7K A;  4UD4 A;  3WFR E;  2O1P A;  3JPS A;  4PHA A;  1ZQS A;  2BCV A;  4FHW A;  5J2K A;  5HR9 A;  1MIW A;  4WC3 A;  1MIY A;  9ICK A;  4XRH A;  1MQ3 A;  5J0R A;  4M9J A;  4AT8 A;  5HC9 A;  4R65 A;  1BPX A;  4AT8 B;  4PHD A;  4S3N A;  2ZH4 A;  1NO5 A;  4X0B A;  2I9G A;  2BCU A;  2PFN A;  1FA0 A;  4PGX A;  9ICS A;  1ZQJ A;  3AQL A;  5CHG A;  4X4S A;  4Z6F A;  5J2E A;  3C5F A;  4I2F A;  4IQT A;  5CB1 A;  1ZJM A;  4K4G A;  4EBJ A;  4FHY A;  4KLO A;  2M2V A;  1ZQG A;  4I2C A;  4DO9 A;  8ICK A;  8ICR A;  5J0Y A;  1V4A A;  5DB7 A;  3NYB A;  4I2G A;  4M04 A;  2FMP A; 
#chains in the Genus database with same CATH topology
 2NRK A;  1GPJ A;  4P4M A;  4X4R A;  3JZ0 A;  1ZQE A;  2HN2 A;  9ICL A;  5D46 A;  3UQ0 A;  3RJG A;  3AU6 A;  3C5G A;  3UXO A;  3ERC C;  9ICC A;  5TZV A;  1MQ2 A;  4I27 A;  8ICN A;  1F5A A;  4XUS A;  3JPQ A;  3UPQ A;  4FO1 A;  1UEU A;  1HUO A;  2P66 A;  1ZQF A;  1JAJ A;  4RWO A;  4WQK A;  3OV7 A;  4O67 A;  1ZQM A;  1TV9 A;  4QZ8 A;  4UB2 A;  4K4H A;  1NOM A;  5CP2 A;  4M9L A;  5BOL A;  4FH3 A;  2GWS A;  4KLJ A;  4WC7 A;  2O5A A;  4UBC A;  4QZC A;  4M2Y A;  2ZHB A;  4RQ0 A;  4KM5 A;  4QZF A;  7ICQ A;  4O5K A;  3K7D A;  2PXI A;  4PHE A;  5IIL A;  3OVA A;  4TUQ A;  4OAH A;  3ER9 B;  5J2G A;  1OU5 A;  3OVB A;  4PGQ A;  4KLH A;  2HHP A;  8ICL A;  3H38 A;  3WFQ E;  3PML A;  8ICC A;  2ZH9 A;  4RWQ A;  1ZQU A;  4Z6C A;  7ICG A;  5J2F A;  1ZQB A;  4EED A;  1ZQN A;  4X0A A;  3PNC A;  8ICY A;  1ZQI A;  2DRA A;  4KLE A;  5HRE A;  5J2C A;  4F5O A;  9ICN A;  1ZJN A;  3TFR A;  1XSL A;  9ICA A;  9ICG A;  9ICF A;  4NXV A;  4QZE A;  4QZA A;  4AT7 B;  2BPG A;  4O5E A;  3HW8 A;  3RJF A;  4QZD A;  8ICF A;  2BCQ A;  3H3A A;  9ICV A;  4O5C A;  3MDA A;  5DBA A;  3JPO A;  3PHZ A;  3C66 A;  4KLD A;  4UAZ A;  5CR0 A;  2IHO A;  4MKP A;  4XQ7 A;  4UB4 A;  1R8C A;  3HJ1 A;  4WBY A;  3JCF A;  4K98 A;  8ICB A;  3AU2 A;  4WBZ A;  4Z6E A;  5IIJ A;  4F5P A;  2FMQ A;  4NKU A;  7ICV A;  7ICJ A;  4OAG A;  5DB8 A;  9ICI A;  9ICW A;  1ZQA A;  4X4P A;  3LQC B;  4PH5 A;  1R89 A;  4RPX A;  4M5D A;  4YMN A;  4K96 A;  2M2U A;  5J2D A;  4F5Q A;  5D63 A;  9ICH A;  1UEV A;  5EOZ A;  2GAF D;  4RWP A;  3WFP A;  8ICV A;  5HRI A;  2ISP A;  1BPD A;  9ICR A;  4OAI Z;  4I29 A;  1YLQ A;  4QZB A;  4JWM A;  1ZQW A;  8ICZ A;  4QZI A;  4FO6 A;  4LEZ A;  4WOY A;  4WC5 A;  3V7L A;  4WQL A;  5CWR A;  2RFF A;  4WC6 A;  4TUP A;  3OUY A;  1BPE A;  1JMS A;  4JLX A;  4PHP A;  4YD1 A;  4UBB A;  4MFC A;  4E80 A;  4LEW A;  1MIV A;  5B3P A;  4YMO A;  4IQU A;  5HRL A;  3AUO A;  4FHV A;  3AQK A;  4AT9 A;  7ICK A;  8ICA A;  4M9H A;  4K8V A;  4WC4 A;  5IIN A;  4I2E A;  4PPX A;  4EEB A;  4RQ5 A;  4M47 A;  3UPS A;  5J0T A;  2Q66 A;  8ICE A;  3OWG A;  4JWN A;  2DR8 A;  9ICT A;  4RQ4 A;  4F5R A;  3TFS A;  1KDH A;  5D62 A;  5J2A A;  4I28 A;  5J29 A;  4NLN A;  4RT2 A;  3HWT A;  2DR9 A;  1TFW A;  4P4P A;  2BE3 A;  4P4O A;  1ZQT A;  8ICU A;  3RH5 A;  3MGH A;  3WFO A;  2GA9 D;  4QZ9 A;  3C18 A;  1ZQZ A;  4RPZ A;  4TUR A;  3HJ4 A;  4ATB A;  3H37 A;  1ZQV A;  1VJ7 A;  5J0P A;  3MDC A;  1RZT A;  1ZQX A;  4YMM A;  2PFQ A;  4UAW A;  4R64 A;  4X5V A;  4NXZ A;  3V72 A;  3RJK A;  4E8F A;  1ZQD A;  2PBE A;  9ICX A;  9ICP A;  8ICW A;  4R66 A;  2ZHA A;  4KLL A;  3LK9 A;  4RQ2 A;  4K9B A;  2BBJ A;  4XA5 A;  1TVA A;  4NXX A;  1ZQY A;  4NLZ A;  5HRD A;  9ICM A;  3AQM A;  5III A;  2ZH6 A;  4GXI A;  4LZG A;  4HX0 A;  4O6A A;  1XSN A;  3AQN A;  4RQ8 A;  5J0S A;  5DB6 A;  4NY8 A;  1ZQQ A;  4UD5 A;  1VFG A;  9ICU A;  3MGI A;  3V7J A;  2B51 A;  4EV6 A;  5J0U A;  8ICH A;  2PFP A;  7ICP A;  4K9A A;  1PX5 A;  5D4B A;  3RH4 A;  3ER8 C;  4DOA A;  2ZH8 A;  4XQ8 A;  2IHM A;  5J2H A;  9ICE A;  4K97 A;  8ICI A;  4RT3 A;  4K4I A;  3JPR A;  4NM1 A;  2IUB A;  3RJJ A;  7ICN A;  8ICQ A;  4F5N A;  2DR5 A;  4X4T A;  2BCR A;  2W9M A;  5DEC A;  4RQ7 A;  3HX0 A;  4I2J A;  4IG8 A;  8ICT A;  4M0A A;  2ZH5 A;  4LZD A;  4LT6 A;  3C2L A;  4M9G A;  5JTG A;  5IIO A;  3JPP A;  1KEJ A;  4NM2 A;  8ICO A;  4X4N A;  3GDX A;  2B4V A;  5DBB A;  2HN1 A;  4OAF A;  4X4U A;  9ICJ A;  3B0Y A;  5J2J A;  1ZQO A;  4YN4 A;  4I0U A;  1BPY A;  2DVI A;  3RH6 A;  2ZH2 A;  5DB9 A;  4NKT A;  5HHI A;  5HRH A;  4FHP A;  4KB6 A;  5DDM A;  4GXK A;  5DED A;  3C2M A;  3OVS A;  4NXU A;  4O9M A;  2B56 A;  2BCS A;  7ICR A;  4WC0 A;  4K99 A;  5J0O A;  5HRK A;  4P2H A;  1R8A A;  3OUY B;  4I2B A;  4DOB A;  4KLG A;  5J2I A;  2DR7 A;  7ICM A;  4MF2 A;  4KLT A;  8ICS A;  4I2A A;  3PMN A;  3UQ2 A;  2FMS A;  3NWI A;  4O69 A;  3H39 A;  4WC1 A;  1XSP A;  4AT9 B;  4KLS A;  1WOT A;  2FCL A;  3ISB A;  5J0X A;  2PFO A;  1JQR A;  5CA7 A;  4R63 A;  5CFS A;  3C2K A;  3CK6 A;  3WFS C;  4X4V A;  5HHH A;  4RQ6 A;  5HRG A;  1TFY A;  4KLI A;  4WC2 A;  2VAN A;  3JYY A;  4QZH A;  5BOM A;  4RQ3 A;  1ZQH A;  2ID1 A;  4DOC A;  5D61 A;  1UET A;  4X4O A;  4PGY A;  1R8B A;  2ISO A;  4MFF A;  3UXP A;  5CFU A;  4MF8 A;  4KLM A;  8ICP A;  3K75 D;  1ZQL A;  4EGW A;  4N7R A;  3RJE A;  5J2B A;  1ZQC A;  1ZQP A;  9ICB A;  4IQV A;  5HRF A;  3JPT A;  2ZH7 A;  3NVO A;  8ICG A;  7ICH A;  4FH5 A;  4I2D A;  4MFA A;  1RPL A;  5HRB A;  4WCW A;  4IQW A;  3JPN A;  8ICM A;  4JLZ A;  4ATB B;  7ICE A;  4YD2 A;  2ZH3 A;  5IIM A;  4LEV A;  2M2T A;  9ICQ A;  1BPB A;  1JN3 A;  5CFT A;  4FHX A;  5D49 A;  4GXJ A;  1ZQR A;  4LVS A;  7ICT A;  4YCX A;  7ICO A;  3HIY A;  2DRB A;  9ICO A;  1Q79 A;  4E7X A;  3B0X A;  4EBK A;  3RJI A;  7ICI A;  4RWN A;  5J0Q A;  3MBY A;  5DDY A;  4UB3 A;  5DBC A;  2EWR A;  4RPY A;  8ICJ A;  7ICU A;  4UAY A;  4UB1 A;  3L9D A;  4KLQ A;  4UB5 A;  2BPC A;  4TUS A;  5BPC A;  4I2H A;  4M9N A;  7ICS A;  1KNY A;  4WH5 A;  4QZG A;  1ZQK A;  4KLU A;  3ISD A;  7ICF A;  4Z6D A;  5F2V O;  8ICX A;  2M2W A;  1BPZ A;  1HUZ A;  3RJH A;  5IIK A;  4I2I A;  4KLF A;  1Q78 A;  4O68 A;  4AT7 A;  2BBH A;  5CJ7 A;  2ZH1 A;  3UXN A;  5DKW A;  2BPF A;  4NLK A;  3ISC A;  7ICL A;  5J0W A;  4RQ1 A;  3OGU A;  5CHE A;  4X4Q A;  4EP7 A;  3V7K A;  4UD4 A;  3WFR E;  2O1P A;  3JPS A;  4PHA A;  1ZQS A;  2BCV A;  4FHW A;  5J2K A;  5HR9 A;  1MIW A;  4WC3 A;  1MIY A;  9ICK A;  4XRH A;  1MQ3 A;  5J0R A;  4M9J A;  4AT8 A;  5HC9 A;  4XJE A;  4R65 A;  1BPX A;  4AT8 B;  4PHD A;  4NXT A;  4S3N A;  2ZH4 A;  3EF2 A;  1NO5 A;  4LEY A;  4X0B A;  2I9G A;  2BCU A;  2PFN A;  1FA0 A;  4PGX A;  9ICS A;  1ZQJ A;  3NKU A;  3AQL A;  5CHG A;  4X4S A;  4Z6F A;  5J2E A;  3C5F A;  4I2F A;  3MCR A;  4IQT A;  5CB1 A;  5B3Q A;  1ZJM A;  4EBJ A;  4K4G A;  4FHY A;  4KLO A;  2M2V A;  1ZQG A;  4I2C A;  4DO9 A;  8ICK A;  8ICR A;  4NXW A;  5J0Y A;  1V4A A;  5DB7 A;  3NYB A;  4I2G A;  4M04 A;  2FMP A; 
#chains in the Genus database with same CATH homology
 2NRK A;  4P4M A;  4X4R A;  3JZ0 A;  1ZQE A;  9ICL A;  5D46 A;  3UQ0 A;  3RJG A;  3AU6 A;  3C5G A;  3UXO A;  9ICC A;  5TZV A;  1MQ2 A;  4I27 A;  8ICN A;  1F5A A;  4XUS A;  3JPQ A;  3UPQ A;  1UEU A;  1HUO A;  2P66 A;  1ZQF A;  1JAJ A;  4RWO A;  3OV7 A;  4O67 A;  1ZQM A;  1TV9 A;  4QZ8 A;  4UB2 A;  4K4H A;  1NOM A;  5CP2 A;  4M9L A;  5BOL A;  4FH3 A;  2GWS A;  4KLJ A;  4WC7 A;  2O5A A;  4UBC A;  4QZC A;  4M2Y A;  2ZHB A;  4RQ0 A;  4KM5 A;  4QZF A;  7ICQ A;  4O5K A;  2PXI A;  4PHE A;  5IIL A;  3OVA A;  4TUQ A;  4OAH A;  5J2G A;  1OU5 A;  3OVB A;  4PGQ A;  4KLH A;  2HHP A;  8ICL A;  3H38 A;  3WFQ E;  3PML A;  8ICC A;  2ZH9 A;  4RWQ A;  1ZQU A;  4Z6C A;  7ICG A;  5J2F A;  1ZQB A;  1ZQN A;  4X0A A;  3PNC A;  8ICY A;  1ZQI A;  2DRA A;  4KLE A;  5HRE A;  5J2C A;  4F5O A;  9ICN A;  1ZJN A;  3TFR A;  1XSL A;  9ICA A;  9ICG A;  9ICF A;  4NXV A;  4QZE A;  4QZA A;  4AT7 B;  2BPG A;  4O5E A;  3HW8 A;  3RJF A;  4QZD A;  8ICF A;  2BCQ A;  3H3A A;  9ICV A;  4O5C A;  3MDA A;  5DBA A;  3JPO A;  4KLD A;  3C66 A;  4UAZ A;  5CR0 A;  4MKP A;  4XQ7 A;  4UB4 A;  1R8C A;  3HJ1 A;  4WBY A;  4K98 A;  8ICB A;  3AU2 A;  4WBZ A;  4Z6E A;  5IIJ A;  4F5P A;  2FMQ A;  4NKU A;  7ICV A;  7ICJ A;  4OAG A;  5DB8 A;  9ICI A;  9ICW A;  1ZQA A;  4X4P A;  3LQC B;  4PH5 A;  1R89 A;  4RPX A;  4M5D A;  4YMN A;  4K96 A;  2M2U A;  5J2D A;  4F5Q A;  9ICH A;  1UEV A;  5EOZ A;  4RWP A;  3WFP A;  8ICV A;  5HRI A;  2ISP A;  1BPD A;  9ICR A;  4OAI Z;  4I29 A;  1YLQ A;  4QZB A;  4JWM A;  1ZQW A;  8ICZ A;  4QZI A;  4FO6 A;  4LEZ A;  4WOY A;  4WC5 A;  3V7L A;  5CWR A;  2RFF A;  4WC6 A;  4TUP A;  3OUY A;  1BPE A;  1JMS A;  4JLX A;  4PHP A;  4YD1 A;  4UBB A;  4MFC A;  4E80 A;  4LEW A;  1MIV A;  4YMO A;  4IQU A;  5HRL A;  3AUO A;  4FHV A;  3AQK A;  4AT9 A;  7ICK A;  8ICA A;  4M9H A;  4K8V A;  4WC4 A;  5IIN A;  4I2E A;  4PPX A;  4RQ5 A;  4M47 A;  3UPS A;  5J0T A;  2Q66 A;  8ICE A;  4JWN A;  2DR8 A;  9ICT A;  4RQ4 A;  4F5R A;  3TFS A;  1KDH A;  5J2A A;  4I28 A;  5J29 A;  4NLN A;  4RT2 A;  3HWT A;  2DR9 A;  1TFW A;  4P4P A;  2BE3 A;  4P4O A;  1ZQT A;  8ICU A;  3RH5 A;  3MGH A;  3WFO A;  4QZ9 A;  3C18 A;  1ZQZ A;  4RPZ A;  4TUR A;  3HJ4 A;  4ATB A;  3H37 A;  1ZQV A;  1VJ7 A;  5J0P A;  3MDC A;  1RZT A;  1ZQX A;  4YMM A;  2PFQ A;  4UAW A;  4R64 A;  4X5V A;  4NXZ A;  3V72 A;  3RJK A;  4E8F A;  1ZQD A;  2PBE A;  9ICX A;  9ICP A;  8ICW A;  4R66 A;  2ZHA A;  4KLL A;  3LK9 A;  4RQ2 A;  4K9B A;  4XA5 A;  1TVA A;  4NXX A;  1ZQY A;  4NLZ A;  5HRD A;  9ICM A;  3AQM A;  5III A;  2ZH6 A;  4GXI A;  4LZG A;  4O6A A;  1XSN A;  3AQN A;  4RQ8 A;  5J0S A;  5DB6 A;  4NY8 A;  1ZQQ A;  4UD5 A;  1VFG A;  9ICU A;  3MGI A;  3V7J A;  2B51 A;  5J0U A;  8ICH A;  2PFP A;  7ICP A;  1PX5 A;  4K9A A;  5D4B A;  3RH4 A;  4DOA A;  2ZH8 A;  4XQ8 A;  2IHM A;  5J2H A;  9ICE A;  4K97 A;  8ICI A;  4RT3 A;  4K4I A;  3JPR A;  4NM1 A;  3RJJ A;  7ICN A;  8ICQ A;  4F5N A;  2DR5 A;  4X4T A;  2BCR A;  2W9M A;  5DEC A;  4RQ7 A;  3HX0 A;  4I2J A;  4IG8 A;  8ICT A;  4M0A A;  2ZH5 A;  4LZD A;  4LT6 A;  3C2L A;  4M9G A;  5IIO A;  3JPP A;  1KEJ A;  4NM2 A;  8ICO A;  4X4N A;  3GDX A;  2B4V A;  5DBB A;  4OAF A;  4X4U A;  9ICJ A;  3B0Y A;  5J2J A;  1ZQO A;  4YN4 A;  1BPY A;  2DVI A;  3RH6 A;  2ZH2 A;  5DB9 A;  4NKT A;  5HHI A;  5HRH A;  4FHP A;  4KB6 A;  5DDM A;  4GXK A;  5DED A;  3C2M A;  3OVS A;  4NXU A;  4O9M A;  2B56 A;  2BCS A;  7ICR A;  4WC0 A;  4K99 A;  5J0O A;  5HRK A;  4P2H A;  1R8A A;  3OUY B;  4I2B A;  4DOB A;  4KLG A;  5J2I A;  2DR7 A;  7ICM A;  4MF2 A;  4KLT A;  8ICS A;  4I2A A;  3PMN A;  3UQ2 A;  2FMS A;  4O69 A;  3H39 A;  4WC1 A;  1XSP A;  4AT9 B;  4KLS A;  1WOT A;  3ISB A;  5J0X A;  2PFO A;  1JQR A;  5CA7 A;  4R63 A;  3C2K A;  3WFS C;  4X4V A;  5HHH A;  4RQ6 A;  5HRG A;  1TFY A;  4KLI A;  4WC2 A;  2VAN A;  3JYY A;  4QZH A;  5BOM A;  4RQ3 A;  1ZQH A;  2ID1 A;  4DOC A;  1UET A;  4X4O A;  4PGY A;  1R8B A;  2ISO A;  4MFF A;  3UXP A;  4MF8 A;  4KLM A;  8ICP A;  3K75 D;  1ZQL A;  3RJE A;  5J2B A;  1ZQC A;  1ZQP A;  9ICB A;  4IQV A;  5HRF A;  3JPT A;  2ZH7 A;  8ICG A;  7ICH A;  4FH5 A;  4I2D A;  4MFA A;  1RPL A;  5HRB A;  4WCW A;  4IQW A;  3JPN A;  8ICM A;  4JLZ A;  4ATB B;  7ICE A;  4YD2 A;  2ZH3 A;  5IIM A;  4LEV A;  2M2T A;  9ICQ A;  1BPB A;  1JN3 A;  4FHX A;  5D49 A;  4GXJ A;  1ZQR A;  4LVS A;  7ICT A;  4YCX A;  7ICO A;  3HIY A;  2DRB A;  9ICO A;  1Q79 A;  4E7X A;  3B0X A;  4EBK A;  3RJI A;  7ICI A;  4RWN A;  5J0Q A;  3MBY A;  5DDY A;  4UB3 A;  5DBC A;  4RPY A;  8ICJ A;  7ICU A;  4UAY A;  4UB1 A;  3L9D A;  4KLQ A;  4UB5 A;  2BPC A;  4TUS A;  5BPC A;  4I2H A;  4M9N A;  7ICS A;  1KNY A;  4QZG A;  1ZQK A;  4KLU A;  3ISD A;  7ICF A;  4Z6D A;  5F2V O;  8ICX A;  2M2W A;  1BPZ A;  1HUZ A;  3RJH A;  5IIK A;  4I2I A;  4KLF A;  1Q78 A;  4O68 A;  4AT7 A;  5CJ7 A;  2ZH1 A;  3UXN A;  5DKW A;  2BPF A;  4NLK A;  3ISC A;  7ICL A;  5J0W A;  4RQ1 A;  3OGU A;  4X4Q A;  4EP7 A;  3V7K A;  4UD4 A;  3WFR E;  2O1P A;  3JPS A;  4PHA A;  1ZQS A;  2BCV A;  4FHW A;  5J2K A;  5HR9 A;  1MIW A;  4WC3 A;  1MIY A;  9ICK A;  4XRH A;  1MQ3 A;  5J0R A;  4M9J A;  4AT8 A;  5HC9 A;  4R65 A;  1BPX A;  4AT8 B;  4PHD A;  4NXT A;  4S3N A;  2ZH4 A;  1NO5 A;  4LEY A;  4X0B A;  2I9G A;  2BCU A;  2PFN A;  1FA0 A;  4PGX A;  9ICS A;  1ZQJ A;  3AQL A;  5CHG A;  4X4S A;  4Z6F A;  5J2E A;  3C5F A;  4I2F A;  4IQT A;  5CB1 A;  1ZJM A;  4K4G A;  4EBJ A;  4FHY A;  4KLO A;  2M2V A;  1ZQG A;  4I2C A;  4DO9 A;  8ICK A;  8ICR A;  4NXW A;  5J0Y A;  1V4A A;  5DB7 A;  3NYB A;  4I2G A;  4M04 A;  2FMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...