4M9GA

Dna polymerase beta e295k binary complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
325
structure length
314
Chain Sequence
b'LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 103
structure length 314
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9gA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9gA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9gA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9gA03
1A77A 4EEYA 4YN4A 1Z00B 5J0QA 2AGQA 4K4HA 1ZJMA 4UAZA 4MFAA 3T5LA 3H8SA 5KFMA 1LV5A 4M9HA 4RUCA 5DEDA 4XQ7A 4CCHA 2PBEA 2ISOA 9ICMA 5D46A 5CA7A 3LWMA 3JPNA 3RB4A 3OSNA 1HUZA 1ZQAA 3WFPA 4YQWA 3MBYA 2BCSA 4LT6A 2R8KA 3JZ0A 4C8OA 4RQ8A 5BPCA 4IQVA 5KFXA 3SZ2A 2ZUDA 3AUOA 1L3VA 1S76D 4C8NA 4ATBA 4R63A 5CR0A 4YD1A 2BHNA 4FO6A 1ZQHA 4DQPA 2HHXA 2ALZA 4KTQA 8ICYA 3TFSA 1F5AA 2XC9A 3T3FA 1RXVA 1UETA 4DS4A 1Y88A 9ICAA 4UQGA 4ECQA 9ICNA 4YXJA 2AU0A 4KN7A 5KFLA 3PMLA 3PR4A 2C28A 5KFBA 8ICJA 1VJ7A 3WFSC 4UB1A 7ICNA 2RDJA 4KLJA 1RZTA 1ZQJA 2M2VA 2C2DA 2R8JA 2W9AA 1U45A 1NO5A 5J29A 4NKTA 3TI0A 4WC1A 2HHSA 2A1JB 1ZQLA 4KN4A 4PHAA 2ZH7A 1ZQXA 3N97B 3V7JA 1SL0A 1ZQEA 9ICFA 4B9MA 2ZH3A 4IR9A 4DOAA 4DFMA 5J2CA 3GILA 2HHTA 5IIKA 4RQ3A 4NLNA 1UEVA 4QZDA 4WC3A 5DG9A 4JV2A 4MEXA 2J6TA 2HHQA 9ICWA 5L9XA 4RNMA 1U49A 4P4MA 1RYRA 4F5QA 3H4DA 5J0UA 3PVXA 3Q8RB 5J2IA 4E0DA 5KFGA 1T7PA 3NTUA 4DL2A 2ZHAA 4KITB 3PX4A 5KT6A 3KTQA 4IG8A 1XC9A 4KLDA 3ZDDA 1UEUA 2J6SA 3H40A 2A1JA 4IQUA 4PPXA 2BQUA 1A76A 2R8IA 4I2IA 4M9JA 4PGQA 4LZDA 1KFSA 2R8GA 4LVSA 3K75D 2FMPA 5EWFA 2PFQA 4DSIA 2ZHBA 4M6WB 5J0WA 3RH6A 7ICOA 4DFJA 4GXIA 4EYHB 4FS1A 4ELUA 2ZJ5A 3GQCA 4F2SA 4NLGA 5J2BA 4P2HA 2UVWA 4WBZA 3AU6A 2PXIA 3Q8LA 2IMWP 3PX0A 3ETLA 2ZJAA 3LK9A 2NRWA 4QW8A 3OGUA 3MR3A 3TFRA 1XSLA 3RRGA 2V4RA 3SV3A 4M5DA 4E8FA 4XRHA 4Q8EA 4J9LA 1QSYA 3EPGA 2HW3A 4I2DA 4RT2A 9ICJA 9ICCA 5HHHA 1S0MA 1DGSA 4WBYA 3NGDA 1BPEA 4O3PA 4ECUA 4X4QA 2DR7A 3IHQB 2H5XA 4DQIA 5KT4A 3OUYB 4M6WA 2JZBB 2XCPA 1V9PA 5KG2A 1DK3A 4QZ8A 1D8LA 5KFPA 1ZQIA 7ICTA 4UBBA 8ICTA 1Z3EB 1XSPA 4F5PA 3ZDEA 3RJEA 1XU4A 2KZZA 4F50A 3SV4A 3TAPA 5HHIA 5KFVA 3GIKA 1SKRA 5DB9A 4DL5A 1NK7A 4C8MA 4F4XA 9ICLA 2M2TA 5KFYA 4RPYA 4I29A 1L3UA 1CEZA 2ISPA 9ICQA 5KFEA 4YP3A 4ECZA 3QE9Y 1CUKA 1OU5A 8ICEA 1NK5A 3M9MB 4EZ6A 3RAXA 5EWEA 3UXNA 3KHRA 1NJWA 2BCUA 5KFCA 3OUYA 1ZQMA 3M9OB 4FS2A 2FLPA 5DB8A 3H39A 4RPXA 4ECRA 2BQ3A 1T4GA 4RT3A 5J2EA 3PW5A 8ICSA 4B9VA 2P66A 8ICVA 3MFIA 4JV0A 1SKWA 4KLGA 4RNOA 4X4RA 3JPRA 3PO5A 2NRXA 1SKSA 3AQKA 8ICAA 1S0NA 1ZQSA 3OSPA 1ZYQA 4B9LA 2W9BB 4QZFA 3C2LA 3RR8A 2F1IA 4QWDA 1X9SA 1JMSA 4DOBA 3AQMA 4FHWA 1X9WA 4QZEA 3HP6A 4GLXA 1EXNA 4ED0A 1UA0A 1L3SA 2LYHA 1ZQWA 2KZ3A 3MDAA 4J9PA 4DFKA 4DF8A 1S77D 4FHXA 4ATBB 1UT5A 4NLKA 4MF8A 4QZCA 3KHHA 2XO7A 4ECTA 5F9NA 5DB7A 4EYIB 5KFNA 4F4YA 3PW7A 5DDYA 3RJFA 5CHGA 3PR5B 4QZIA 1S97A 1PZNA 4DF4A 4I27A 5HRKA 3H4BA 3C21A 3RJKA 1BPZA 4RQ7A 1FA0A 1QLNA 4F5NA 4G3IA 3AQNA 5DECA 7ICIA 3UXPA 3SYZA 4GXKA 4NY8A 8ICPA 3K4GA 4UAWA 3OHAA 2W9BA 3RH4A 4WC7A 2FPMA 4BWMA 4RQ2A 5BOMA 4PH5A 3PW2A 3H8JA 4X0BA 4F4WA 5HRBA 1NK6A 1ZQOA 1C7YA 4Z6DA 7ICQA 4Q45A 4F5RA 2NRVA 2KTQA 3V72A 5J2HA 9ICUA 4O3OA 5DKWA 2Y1IA 1PX5A 3C5GA 4ELTA 1NKEA 4E80A 1K1SA 2BCQA 4TQSA 1X2IA 4DFPA 3T5JA 4DSLA 3Q8SB 1MQ3A 3ZDBA 4PGYA 1S0VA 4F4KA 1UA1A 3JYYA 2BR0A 2Q0ZX 3RH5A 8ICZA 3H8WA 4QZHA 2WTFA 3MGIA 1S10A 4C8LA 5CWRA 1RPLA 3GIIA 1KFTA 1L3TA 3RB0A 3NYBA 2AQ0A 9ICTA 4O5EA 3H7IA 2FLLA 4RUAA 3QZ8A 4F2RA 4R65A 3RJHA 1KDHA 4FBUA 4K4GA 4J9NA 5DG7A 2ZH9A 2W9MA 5KFOA 5KFWA 3EYZA 3KHLA 4I2FA 4I28A 4PHEA 1U9LA 3PMNA 3ZD9A 4UB5A 2ZUBA 2PFOA 3RJIA 1XS9D 4M47A 4Q8FA 4DSJA 2NRTA 4ECSA 3TQ1A 2HVIA 4J9QA 3RTVA 3N4MB 2BDPA 4X4TA 1ZETA 8ICUA 3IM1A 5KG7A 3RAQA 1U48A 3PO4A 1MIVA 2BPFA 1D9FA 3PW4A 4QZBA 4UB4A 4O3SA 2OWOA 3GDXA 3EPIA 1ZQBA 1ZQFA 4KLUA 1R89A 5DQHA 3RB3A 3ORYA 2V4QA 4K4IA 1ZQCA 4HYKA 2C2EA 1TAQA 4PHPA 2W9CB 1SZPA 4JWNA 4P4PA 4RZRA 3C1ZA 1TFRA 3RBDA 1T3NA 4KLOA 4ED7A 2KZMA 1MIWA 1R8BA 8ICRA 3RBEA 5KFJA 1NK8A 3QEBZ 2BPGA 3QEAZ 4J9KA 4ELVA 1JIHA 5HNKA 3JPPA 1SL1A 4DOCA 5BOLA 4UD5A 2W8LA 2VA3A 1BPDA 2VANA 5TZVA 2MAXA 4UB3A 4YR3A 3OVSA 2MUTB 2FMQA 4XUSA 5DLFA 5EOZA 2HHPA 4ECWA 4DWIA 4MFFA 5HMLA 2IA6A 3BQTA 3C23A 5L1JA 3THVA 1RYSA 4YR0A 8ICHA 4RU9A 3GFKB 4YXMA 3C2MA 5KG5A 9ICIA 5IIOA 2W8KA 3G6XA 1T8EA 4FH5A 5DGAA 7ICSA 2W9CA 5DQGA 2AGPA 5KFZA 2ZH1A 4DEZA 5HRHA 1N56A 9ICEA 3JPOA 5KFSA 3Q8MA 1NJZA 5DG8A 3M8RA 1NZPA 3HJ1A 2I1QA 7ICUA 3UQ0A 4YMNA 3QZ7A 2XGPA 5DBAA 2XCAA 5IIMA 3Q8KA 1ZQTA 4IQWA 3M9NB 1TAUA 4F92B 2M2UA 3HIYA 4NXZA 3HT3A 3M8SA 4ED1A 4X4PA 4YR2A 3BQ1A 5HMMA 3HPOA 5J0YA 2MUTA 5J2AA 4ED3A 7ICJA 7ICLA 5KFTA 4QZ9A 5CB1A 5J2FA 1HUOA 5HRDA 1HJPA 4KLEA 3V6KA 1ZQDA 8ICBA 1ZQYA 4F4ZA 3H38A 4X4SA 4BDPA 4DL7A 4PHDA 2HVHA 3TANA 4LZGA 4EP7A 4KLIA 4BGDA 2PFPA 2BQRA 4B9TA 1MQ2A 2ZTDA 3TAQA 1MIYA 4Z6EA 3GV8B 2ASJA 4J9RA 1KRPA 4B9NA 4IRDA 4M9GA 4E7XA 1KSPA 4O5CA 4X4OA 3BJYA 3B0YA 1ZQQA 5JUMA 2BCVA 4M0AA 3H37A 4NKUA 3OJUA 5J2JA 2JEFA 1BNPA 2RFFA 3OVAA 1NKCA 1UT8A 4ECXA 1KFDA 4GXJA 7ICKA 5HRGA 5KT7A 3ZD8A 1XWLA 2ASDA 1WCNA 1KEJA 4KLFA 1ZQUA 3MDCA 1TKDA 3HW8A 2JEGA 4M9NA 3PX6A 3GV7B 9ICKA 4FHPA 4YVZA 3GV5B 2ATLA 4M2YA 3LDAA 2BKEA 1JN3A 4WCWA 2M2WA 4ECVA 1QSLA 7ICFA 4RPZA 3E2EA 9ICBA 3LQCB 5KTQA 1ZQPA 3C1YA 3KHGA 4YFKA 3TARA 4DL3A 2AJQA 8ICNA 2UVVA 4IQTA 3BQ2A 4KLTA 9ICSA 3T5HA 5KFDA 4Z6CA 8ICQA 9ICRA 5DLGA 3JPTA 4M9LA 5F2VO 5HRIA 4F5OA 4O3NA 1XO1A 2HHWA 3JPSA 1BPBA 9ICHA 4EBJA 9ICVA 4O3QA 2Y1JA 4RWNA 1MSWD 2DPJA 1TFWA 4B9UA 4FH3A 4X0AA 4KLMA 4J9MA 2HHVA 8ICCA 1ZQRA 5EWGA 4TURA 4KLSA 1H38A 1NKBA 4ED6A 3LWLA 4TUPA 1JXEA 3OVBA 3AQLA 2RDIA 4EBCA 4O5KA 3T5KA 2J6UA 3C18A 2XY6A 1U4BA 4QWEA 3L9DA 3V7KA 2IBKA 5J2DA 8ICOA 1QSSA 4YG2A 4QWAA 4DLGA 3FYHA 4J9SA 2IHNA 4I2HA 5IINA 3RJJA 3RB6A 4I2BA 2KFZA 4JV1A 2DVIA 5L1KA 5D4BA 4TUQA 4YMMA 2DPIA 4QZGA 1S0OA 7ICPA 4X4UA 4RQ0A 4I2EA 5C5JA 5KFFA 3EW9A 4O0IA 5CJ7A 3RJGA 3ISDA 3PY8A 1Q79A 3EZ5A 4IRKA 1XSNA 8ICXA 4QZAA 4FHYA 4JK1A 2ZH8A 4ECYA 1B43A 5D49A 1NK4A 5DGBA 1JAJA 5J0XA 4DQQA 4O3RA 2PI4A 5J2GA 1SL2A 3MR5A 2I9GA 4MFCA 8ICMA 2ZH2A 2ZH4A 2P6RA 7ICVA 2R8HA 3UQ2A 1NK0A 4F3OA 1ZJNA 4NLZA 3PV8A 4I2GA 1B22A 7ICHA 4F93B 4UAYA 5HR9A 1AROP 2XGQA 1K1QA 1TK0A 8ICFA 8ICWA 4AT7B 3Q8QB 1Z00A 5IIJA 5KT2A 5KT3A 8ICLA 1YLQA 1BPYA 4IRCA 2ASLA 2V9WA 2ZH6A 5KFAA 3V6JA 5KG4A 3ISCA 3MR2A 3FDSA 3GIMA 1RXWA 3V7LA 5HRLA 2XY7A 2O1PA 4KLLA 2DR5A 4F91B 2BCRA 5J0OA 4AT9A 1R8CA 2C2RA 1KNYA 4WC2A 4EBEA 4DS5A 2B21A 3C5FA 1IXRA 2PFNA 2UVRA 8ICIA 4AT8B 4RQ1A 2GWSA 1NJXA 1TK8A 1WCLA 5J0TA 1KLNA 5CP2A 2P6UA 4DL4A 5J0PA 5L1LA 2FMSA 3WFOA 4AT7A 1BNOA 1ZQKA 2F1HA 3HWTA 4B9SA 3MABA 1D8YA 4NM2A 4YD2A 4GC6A 4MEYA 2ZH5A 2C22A 1JQRA 3MR6A 3HJ4A 2M9NA 4UD4A 3WFQE 2ZUCA 5DBCA 1ZQNA 5KFRA 1BPXA 2KP7A 4XA5A 4QWBA 4RQ6A 4JUZA 4BWJA 7ICGA 4DQSA 4QWCA 1NJYA 2FLNA 2JEIA 4DQRA 4AT8A 4I2JA 1LB2B 3OV7A 2BPCA 4BXOB 4TQRA 1VFGA 4GC7A 1IM4A 2FPLA 3Q8PB 4RQ5A 4NM1A 4FHVA 7ICRA 3RR7A 1ZQZA 5KFUA 1L5UA 4XQ8A 2ZTCA 4O9MA 4DSFA 4UBCA 1R8AA 4X4NA 4DSEA 4PGXA 5KFQA 9ICPA 4X5VA 1D9DA 1COOA 1BGXT 7ICMA 2ID1A 2HHUA 3AU2A 3ZDCA 2O5AA 3WFRE 2BGWA 4I2AA 5J0RA 1BVSA 4Q44A 3PNCA 4F8RA 4ZH4A 5L1IA 2F1JA 2Q66A 4MF2A 2NRZA 4ED8A 4TUSA 4UB2A 4KLQA 4BXOA 8ICKA 1ZQVA 3EWAA 4R64A 5KG3A 3UXOA 3ISBA 2FPKA 4EBDA 3OHBA 1N48A 1JXLA 1Q78A 2JEJA 3B0XA 5IILA 2VA8A 5DB6A 2ZTEA 2NRKA 4AT9B 5KG6A 4C8KA 5F9LA 5DQIA 3H3AA 3GIJA 2DFLA 4EBKA 4R66A 2DRAA 7ICEA 4M04A 3G6YA 4DSKA 3G6VA 4RWPA 4WC4A 4DLEA 1JX4A 8ICGA 3UPQA 4YMOA 5KFIA 2VA2A 2UVUA 3MGHA 4IR1A 3OJSA 3HX0A 4I2CA 4RQ4A 5IIIA 5HRFA 3BQ0A 2XY5A 2DR8A 1ZQGA 1NOMA 3JPQA 4RWOA 2DRBA 4R8UB 5KG0A 2AQ4A 5HREA 4DL6A 1S9FA 4J9OA 5HC9A 5J0SA 4KLHA 5KFKA 2ZJ8A 1X9MA 9ICGA 3C66A 3UPSA 4FBTA 5DBBA 5DDMA 5J2KA 2JZBA 4WC5A 4RNNA 3RRHA 5KFHA 2BE3A 2DR9A 1KTQA 3BDPA 3SI8A 4RWQA 5KG1A 1U47A 1DOQA 4P4OA 1TK5A 2KN7A 2PI5A 5HP4A 3MFHA 1DK2A 4QW9A 3ZDAA 4X4VA 4Q43A 4DO9A 4ED2A 4KMUA 2AGOA 4S3NA 4JWMA 1TFYA 1TVAA 4WC0A 3PW0A 1WOTA 4Z6FA 2IHMA 4EZ9A 4R8UA 1MC8A 3V6HA 1V4AA 4YCXA 4WC6A 1NK9A 9ICOA 9ICXA 2KFNA 1TV9A 1QTMA 5KT5A 3C2KA
chains in the Genus database with same CATH superfamily
1A77A 4YN4A 2AGQA 4UAZA 3R9KA 3H8SA 4OCZA 5KFMA 4USAA 4CCHA 2EAOA 2HN1A 1SWVA 1ZQAA 3WFPA 1NNLA 2R8KA 4NXTA 3WKAA 4C8OA 2KV2A 4C8NA 5CR0A 2BHNA 4FO6A 4KTQA 1ED1A 2K4HA 3TFSA 1L7OA 1Y88A 4ECQA 2C28A 1VJ7A 2DBYA 7ICNA 2RDJA 1RZTA 2KVSA 4K8VA 4CNQA 2ZH7A 4PHAA 3V7JA 4DOAA 4BJQA 3MCRA 5DG9A 4JV2A 4MEXA 2J6TA 4IC9A 1RYRA 1DGJA 3KOOA 4P4MA 4AYBC 5J2IA 4DL2A 4EELA 2ZHAA 3PX4A 3KTQA 4WQLA 4KLDA 3ZDDA 2A1JA 2BQUA 4M9JA 3SD7A 2JHDA 2PFQA 2FMPA 2F76X 4GXIA 2ZJ5A 3GQCA 4NLGA 3QU2A 2YY6A 4WBZA 3AU6A 3Q8LA 3ETLA 3QU7A 1XSLA 1UHUA 5AKKA 4XRHA 1QSYA 3EPGA 2YMMA 4RT2A 9ICCA 1S0MA 1DGSA 4U6PA 3KFUF 4P0PB 4O67A 3IHQB 3OUYB 3B9JA 2YQEA 1S8OA 4F50A 3SV4A 3GIKA 3TADC 3CYMA 5DB9A 3N28A 4C8MA 2VJ4A 2WF9A 2QB0A 1SV0A 1NK5A 5AI9A 2G5IB 3ERCC 2H3VA 3KHRA 5KFCA 3H39A 3M9OB 4FS2A 2FLPA 5DB8A 5A0LA 1SV4A 4ECRA 1AQ6A 3PW5A 3MFIA 5ALZA 4JV0A 1SKWA 1TE2A 4X4RA 1JRPA 3PO5A 3WK5A 3AQKA 4UARA 1ZQSA 4B9LA 3M6KA 3C2LA 1X9SA 4FHWA 4Y2QA 4QIWF 3QYPA 4DFKA 4NLKA 4QZCA 3KHHA 3UMBA 5DB7A 4EYIB 2ZH3A 3NVYA 4QZIA 1S97A 2WF5A 2G06A 2KHVA 5GTIU 3D6JA 4F5NA 1V97A 2F8LA 4MKPA 3SYZA 3OHAA 2Y9UA 3O0FA 1C7YA 2KD1A 4F5RA 5ALUA 5DKWA 2RP5A 1NKEA 4K97A 4DFDA 3Q8SB 3ZDBA 3RH5A 3SQIA 8ICZA 5CWRA 1RPLA 1FIQA 3RB0A 2WF6A 3H7IA 4F2RA 2F77X 2ZH9A 1URJA 4I2FA 3K1RB 3DDHA 2PFOA 3RJIA 1WWUA 1N5XA 3A0HU 4O3SA 3SMVA 2HDOA 3FAHA 2CRXA 2C2EA 4CF4A 1JROA 5D61A 1SZPA 2KJ5A 3D2QA 4P0QA 2BPGA 3QEAZ 4ELVA 3JPPA 5BOLA 5J8YC 4UB3A 2FMQA 5EOZA 4MFFA 5HMLA 3C23A 1RYSA 4YR0A 3C2MA 4FZLA 1T8EA 4RQNA 2DQNB 4UB8U 3L3FX 2ODGA 2W9CA 1MN8A 2FDRA 5KFSA 3Q8MA 1NJZA 2WB1C 4YMNA 1TAMA 3Q8KA 3M9NB 4F92B 4ED3A 7ICLA 7ICJA 4QZ9A 5CB1A 1ZQYA 3F5AA 3WKEA 2BQRA 1MQ2A 3TAQA 4Z6EA 4B9NA 1K5OA 3N7PD 5ALLA 1KSPA 1L7PA 3GZFA 2BCVA 4M0AA 2KK0A 3OJUA 5F3XB 7ICKA 2B6GA 5JU5A 5HRGA 3OTQA 1ZQUA 3PSFA 3GV5B 4M2YA 3QUQA 2W03A 1JN3A 3QUCA 4RPZA 2W3RA 9ICBA 2E5SA 3LQCB 2IHOA 3C1YA 3KHGA 5AKYA 2GLEA 4DL3A 2UVVA 4IQTA 5AI8A 8ICQA 2HHWA 4O3QA 5AM2A 2DPJA 4J9MA 2DUYA 3AQLA 3CRXA 2RDIA 3C18A 3L9DA 5EE3A 2KG5A 5J2DA 3H3AA 4J9SA 4I2HA 4I2BA 3RB6A 4EEKA 3M6ZA 4TUQA 4YMMA 2DPIA 3KZIU 3WK8A 4RQ0A 5KFFA 1QQ6A 3PY8A 3CP8A 8ICXA 1WUDA 1B43A 5D49A 2P6RA 2R8HA 3UQ2A 1NK0A 4I2GA 1B22A 3AM9A 8ICFA 4UAUA 1YLQA 3AEVA 2V9WA 2ZH6A 3V6JA 3ISCA 3IRUA 4UAVA 4C4RA 1RXWA 1SXDA 2BDUA 4KLLA 4AT9A 2D8CA 2UVRA 2B21A 8ICIA 1IXRA 4AT8B 3C29A 1TK8A 2E1FA 4CRXA 2FMSA 1DXSA 5ALJA 2ZH5A 5D63A 2C22A 5AKIA 3A0BU 2XVTA 2ZUCA 5DBCA 4XA5A 4RQ6A 4DQSA 1NJYA 4NWIA 2F8KA 3OV7A 1VFGA 1IM4A 2FPLA 4RQ5A 4O9MA 4KX5A 4DSEA 1RM6C 9ICPA 2ID1A 1GO3F 2HHUA 3AU2A 4CDGA 5J0RA 2KJ9A 2Q66A 4KLQA 3F2BA 4BXOA 2A19A 8ICPA 3UXOA 1QQ7A 2K8AA 3J81j 3OPXA 2VA8A 1D8BA 2NRKA 5F9LA 4R66A 2W7OA 3G6YA 3NVWA 4WC4A 1L7MA 1OW5A 4RQ4A 1KKXA 1B4FA 4RWOA 5ALNA 5HREA 4UATA 1S9FA 4J9OA 5HC9A 5J0SA 1X9MA 2ZJ8A 3C66A 5DBBA 2EDUA 1B0XA 3E58A 4WC5A 4RNNA 4Y2UA 3SI8A 1U47A 2Z7JA 4NXVA 1RDFA 2DL0A 3ZDAA 4NJ8A 4X4VA 4Q43A 4ED2A 5E79U 2AGOA 3AQFA 4WC0A 4Z6FA 2IHMA 1NK9A 1QTMA 5KT5A 3CW2C 3C2KA 2AXTU 2F44A 4EEYA 4K4HA 2MA1A 4UASA 1ECWA 2ZXHA 3QU9A 5DEDA 5D46A 4K96A 2KMDA 3F2DA 3OSNA 2KKVA 3MBYA 3D2NA 3NKUA 2Y0SF 2JR5A 5BPCA 3SZ2A 1S76D 2JRZA 3WKBA 4RWPA 1ZQHA 4DQPA 2HHXA 2XC9A 3T3FA 4DS4A 2F2AB 2B0CA 4KN7A 5H2FU 1FFVA 4EEBA 2B4VA 2EAMA 3TKAA 1ZQJA 2EQYA 2W9AA 1U45A 1ZQLA 1ZQXA 3N97B 1ZQEA 1V38A 4IR9A 5J2CA 2GAFD 4WC3A 2HHQA 4RNMA 2JH1A 3H4DA 4NXWA 3VCBA 2VKQA 4F71A 3Q8RB 1KQQA 2H3ZA 1ZD4A 3NTUA 5AKHA 5CFSA 4KITB 3UMCA 4IQUA 4PPXA 2KICA 1A76A 2YB1A 2DKXA 2R8IA 1PK3A 2R8GA 2ZIVB 2K89A 4ELUA 2PXIA 2HBLA 2ZJAA 4HAIA 3TFRA 3OGUA 4M5DA 3SV3A 1J2MA 4J9LA 2LBOA 2HW3A 1BPEA 1F5SA 2YMQA 4ECUA 4DQIA 4M6WA 1OXJA 2XCPA 4B6JA 1VJ5A 1J97A 4QZ8A 7ICTA 4BX9C 1Z3EB 3RJEA 5AKXA 3M1YA 2M2TA 5KFYA 2H3QA 4I29A 1L3UA 2EZYA 3F2CA 1MA7A 2ISPA 3M9MB 3RAXA 4NLBA 4NL9C 1NJWA 4U7CA 4RPXA 3F5EA 1T4GA 8ICSA 4B9VA 8ICVA 3IP4B 4KLGA 4C80A 2OCEA 1S0NA 3OSPA 5G5HA 4QZFA 1JMSA 4DOBA 1X9WA 4JLXA 1EXNA 4ED0A 1ZQWA 3IV6A 3MDAA 2E8NA 1UPHA 1UT5A 2P35A 5ALEA 4ATBB 4RQMA 2XO7A 4UW9A 5F9NA 3PW7A 5KFNA 3RJFA 5DDYA 3PR5B 1YZ7A 4CGZA 5HRKA 4RQ7A 1FA0A 3ICXA 4EX6A 3AQNA 2FI1A 7ICIA 5HR7A 4GXKA 3RH4A 1LKYB 4WC7A 2W9BA 5CEHA 5BOMA 2MRLA 2OM6A 1PVRA 3H8JA 4X0BA 1NK6A 1ZQOA 7ICQA 5J2HA 9ICUA 2OYYA 3C5GA 2XIDA 1FFUA 1K1SA 4DSLA 4TQSA 4PGYA 2BR0A 3H8WA 1S10A 2FLLA 5ALXA 2PMZC 3RJHA 4J9NA 2M0NA 2W9MA 5KFWA 3KHLA 4I28A 4PHEA 1U9LA 2EZXA 2ZIXA 4O3MA 4Q8FA 4M47A 4DSJA 4ECSA 3FC4A 2HVIA 2FJ6A 1LVHA 5KG7A 1QH9A 3RAQA 1MIVA 3KKAA 3PW4A 4QZBA 2E8PA 2OWOA 3EPIA 4KLUA 1R89A 5DQHA 3ORYA 2V4QA 4RZRA 1TFRA 8ICRA 3RBEA 3BQ7A 5KFJA 1NK8A 5AICA 3HKZC 1VLBA 1JIHA 1Z1BA 4UD5A 2W8LA 3OVSA 2MUTB 2IOHA 4PL1A 3IN5A 5DLFA 4DWIA 2B56A 4KX3A 3BQTA 3KBBA 2IA6A 4RU9A 4YXMA 5AK4A 1JALA 5DGAA 7ICSA 1ZD2P 4PZNA 5AI4A 2G5HB 4NXXA 3M8RA 3HJ1A 2I1QA 3UQ0A 2XGPA 5DBAA 1ZQTA 2YTUA 5AM0A 4ED1A 5K4LA 4X4PA 5HMMA 2DR7A 5J0YA 5J2AA 5HRDA 3V6KA 8ICBA 4X4SA 1CRXA 1QQ5A 1L8LA 4DL7A 2KSOB 2HVHA 4LEYA 4KLIA 5AKEA 2HBKA 4M9GA 4E7XA 4J9RA 2K4PA 3HILA 4IRDA 2LPEA 5ALPA 5EE0A 4WOYA 1BNPA 2LM1A 1NKCA 3OVAA 4FO1A 4KLFA 1TKDA 2JEGA 1N5WA 4M9NA 3GV7B 4OJOA 2BZFA 2ZIUA 2ATLA 1Q3VA 2M2WA 7ICFA 3BS5A 5AI6A 3AN1A 1ZQPA 3H8MA 4YFKA 3I76A 1SV0C 4KLTA 9ICSA 5F2VO 3JPTA 4O68A 3JPSA 4EBJA 9ICVA 1TFWA 2QARB 3NVZA 2ZIWA 1SGGA 4FH3A 4X0AA 2HHVA 1ZQRA 3LWLA 2HBMA 4TUPA 4OJ6A 4O5KA 3T5KA 1U4BA 3V7KA 1QSSA 3FYHA 5T14A 4JV1A 2DVIA 4K9AA 4QZGA 2ZG6A 7ICPA 4AP9A 4I2EA 5C5JA 4NLCA 1Q79A 1HIWA 4IRKA 4QZAA 1M6YA 1NK4A 5DGBA 2YMLA 5J0XA 5G5GA 4O3RA 2PI4A 1JAJA 1SL2A 2ZH2A 5KL1B 7ICVA 4F3OA 7ICHA 5AK6A 2KEYA 2XGQA 8ICWA 4AT7B 5IIJA 5KT2A 1BPYA 4IRCA 5KG4A 2XICA 3M7DA 3GIMA 2CPRA 1A0PA 4F91B 3QUTA 2PFNA 3C5FA 4RQ1A 3NVOA 4QNLA 1L8OA 2P6UA 2ESEA 4OAGA 3WFOA 2F1HA 2ZXIA 3MABA 2HI0A 3HJ4A 3WFQE 1BPXA 2KOBA 7ICGA 4BWJA 1SIJA 4QWCA 1ZXIA 2KIWA 2BPCA 3NRWA 3Q8PB 2YX8A 4NM1A 4FHVA 3RR7A 2HMXA 4XQ8A 4DSFA 1R8AA 4X4NA 3QX7A 1XNSA 4Y2RA 1COOA 1BGXT 3ETRA 4Y2SA 3ZDCA 2O5AA 2BGWA 3WFRE 4KMOB 4Q44A 3PNCA 4DCCA 2F1JA 4MF2A 4ED8A 4UB2A 3WKCA 4EBDA 2JEJA 5KG6A 4C8KA 3K7DA 2DRAA 7ICEA 4DLEA 3KD3A 5KFIA 2VA2A 3MGHA 2UVUA 3HX0A 5HRFA 5B3PA 2XY5A 2AHOB 1ZQGA 2DRBA 4DL6A 2GH1A 4KLHA 2JXJA 5KFKA 1P7DA 4FBTA 1YZ6A 3BS7A 5DDMA 1KTQA 3BDPA 5L1MA 2JV3A 2PI5A 5HP4A 1DK2A 1PVQA 4S3NA 4JWMA 1ZOLA 1TVAA 3PW0A 4EZ9A 4R8UA 1MC8A 5KL8B 1V4AA 3NVVA 2LI6A 4QZEA 1Z00B 1HEKA 4IL6U 3T5LA 3RFAA 1LV5A 4M9HA 4RUCA 4XQ7A 2PBEA 2ISOA 9ICMA 3LWMA 3JPNA 2OEHA 5AM4A 3RB4A 1HUZA 2BCSA 4QIWC 4IQVA 5KFXA 2ZUDA 4JLZA 1N60A 4ATBA 2NYVA 1YT3A 4R63A 5HR6A 8ICYA 1RXVA 1UETA 1T3QA 9ICAA 5ALWA 9ICNA 3H0RB 3PMLA 5KFBA 8ICJA 5ALRA 3WFSC 1IIPA 4KLJA 2M2VA 2NO5A 5KNIA 2C2DA 1NO5A 4NKTA 3C28A 2HHSA 2A1JB 3NRZA 1SL0A 9ICFA 1GPJA 4DFMA 1FEZA 3F53A 3GILA 5AKLA 4NLNA 2GO7A 5L9XA 3PVXA 5KFGA 1T7PA 2B51A 4IG8A 1XC9A 2O6KA 3PSTA 2J6SA 3H40A 1RQLA 2F3NA 4I2IA 5ALMA 5AI5A 5ALOA 4OJPA 3S6JA 3IG8A 4LVSA 3K75D 5EWFA 5J0WA 1Q3UA 2IMWP 3PX0A 3MR3A 2V4RA 4E8FA 2RLTA 4Q8EA 2QB0B 9ICJA 1CI4A 2OXOA 5AK5A 3DV9A 4WBYA 2KHQA 4X4QA 4KM5A 2K8BB 3RF9A 5KT4A 2HCFA 2JZBB 1V9PA 5KG2A 2OHFA 5ALYA 5KFPA 2W55A 4UBBA 4F5PA 3ZDEA 2DF4B 4DL5A 4F4XA 4RPYA 4G9BA 5AIBA 1CEZA 9ICQA 5KFEA 4ECZA 3QE9Y 1OU5A 8ICEA 4P0PA 3UXNA 2BCUA 3OUYA 1WG8A 2BQ3A 2WHEA 4RT3A 1PK1B 4RNOA 1F0MA 3JPRA 2F1IA 4Y2JA 4GLXA 1L3SA 2LYHA 2KZ3A 4J9PA 4DF8A 4Y2YA 4FHXA 3IG5A 1N61A 4F4YA 2AH5A 1X6IA 4I27A 3H4BA 2QB1A 3RJKA 1BPZA 1QLNA 3I28A 4G3IA 3TACB 2MSNA 4NY8A 3K4GA 4UAWA 2FPMA 3BZKA 5ALVA 3LYSA 4F4WA 1KBUA 5HRBA 4Z6DA 4Q45A 2KTQA 3V72A 2D3DA 1Z4OA 2Y1IA 2KE7A 1PX5A 2LYBA 2BCQA 1X2IA 1SWWA 3T5JA 1MQ3A 4OAHA 4N7RA 1UA1A 2Q0ZX 2QARA 2WTFA 1KL9A 4C8LA 2JH7A 1A6SA 5TISU 2AQ0A 4AYBF 1F44A 9ICTA 4RUAA 4FBUA 1RYUA 5DG7A 3L5KA 3QUBA 2PKEA 2YMPA 3PMNA 4UB5A 4P0QB 3U26A 4IS7A 1O03A 1XS9D 3RTVA 3N4MB 1ZETA 1U48A 3PO4A 2EWRA 2BPFA 1N62A 2LMRA 2G07A 1D9FA 3GDXA 1ZQBA 3QXGA 1ZQCA 1TAQA 4PHPA 2W9CB 4P4PA 4US8A 3D2SA 3RBDA 1T3NA 4KLOA 4ED7A 2KZMA 4OJ5A 1MIWA 1R8BA 3QEBZ 4J9KA 5HNKA 2VA3A 1BPDA 2VANA 2MAXA 2HHPA 2YB4A 5L1JA 8ICHA 5KG5A 4FH5A 4DEZA 1N56A 3JPOA 5AM5A 2HOIA 5DG8A 7ICUA 4PL2A 3QZ7A 2XCAA 4IQWA 3HT3A 3M8SA 4JMUA 2K4EA 4YR2A 3SAGA 2FCLA 4I0UA 5KFTA 1HJPA 1SZHA 4KLEA 1ZQDA 2RRDA 4BDPA 4PHDA 3TANA 4LZGA 4EP7A 4BGDA 4B9TA 3GV8B 1KRPA 3LVVA 4O5CA 3BJYA 2LYAA 3H37A 3N7RC 1WWVA 4NKUA 5J2JA 4FZNA 2RFFA 4EEDA 3WU2U 3NS1A 4ECXA 1KFDA 4GXJA 5KT7A 3ZD8A 1XWLA 5AKZA 2ASDA 1KEJA 3HW8A 4JB3A 2BKEA 4WCWA 4ECVA 2XI9A 1QSLA 3TARA 2AJQA 5EE9A 3T5HA 4LEVA 9ICRA 2WF8A 5DLGA 4K9BA 5HRIA 4F5OA 2JGAA 9ICHA 1BPBA 2Y1JA 3H0MB 4KLMA 8ICCA 3WK9A 2XY6A 4QWEA 8ICOA 8ICMA 4QWAA 2IHNA 4DLGA 1Q46A 5D4BA 5ALDA 4O0IA 3ISDA 3EZ5A 1XSNA 4FHYA 2ZH8A 4LEZA 1XO0A 4FFDA 4DQQA 4AT9B 1ZQ1C 5J2GA 2ZH4A 2I6XA 2W11A 4Y2VA 1ZJNA 3PV8A 5JRTA 1T94A 2LKYA 4UAYA 5HR9A 1AROP 1K1QA 2BBJA 1Z19A 1Z00A 5KT3A 3VC8A 4C7YA 2ASLA 5KFAA 3GU3A 2G08A 2WAQC 3FDSA 5C0YA 3V7LA 2O1PA 2XY7A 3MC1A 4OD0A 4Y2XA 2Y0SC 5ALSA 5J0OA 3CK6A 2C2RA 1KNYA 4EBEA 4DS5A 5CHEA 3SAFA 5AKJA 2GWSA 3AL0B 1WCLA 1KLNA 2WB1F 3NWIA 2KVCA 4DL4A 5J0PA 1BNOA 1IV8A 3KKAC 3HWTA 4EX7A 1O08A 2K60A 1UQVA 4MEYA 2CXYA 1JQRA 3WK4A 1RG6A 2M9NA 5AM3A 1PUZA 4CF5A 4OJLA 2QLTA 4JUZA 2FLNA 4DQRA 4AT8A 1NI3A 4I2JA 4BXOB 3SAHA 4GC7A 7ICRA 2ZTCA 3ALRA 4PGXA 5KFQA 3ONNA 1D9DA 7ICMA 4PJ0U 3SR6A 3TADA 4I2AA 4F8RA 2FE9A 4TUSA 3MGVA 5AM1A 1ZQVA 3EWAA 1N48A 5KG3A 1JXLA 3OVBA 1J2NA 1Q78A 3B0XA 2DGZA 4OAFA 3EUB2 4EENA 3GIJA 2DFLA 2RHFA 4M04A 1QCKA 4DSKA 4Y2PA 8ICGA 4YMOA 2KKPA 3IDWA 5IIIA 4CE6A 2DR8A 2AQ4A 5KG0A 2KNJA 4LEWA 2EANA 2DR9A 2JZBA 3RRHA 5KFHA 2BE3A 4C0ZA 4RWQA 2EZZA 5KG1A 4P4OA 3OWGA 5AK3A 2KN7A 3MFHA 4DO9A 4KMUA 1TFYA 1KN5A 2NO4A 3V6HA 4O6AA 2G09A 5CFUA 4YCXA 4WC6A 9ICXA 1Z4NA 5J0QA 4F72A 1ZJMA 4MFAA 1N2XA 1UCVA 1PK1A 5CA7A 4YQWA 3NUQA 5ALGA 4LT6A 3JZ0A 4ACOA 4RQ8A 3HJEA 2L5YA 3AUOA 1L3VA 3WK7A 4YD1A 1F5AA 2ALZA 4UQGA 4GFJA 4YXJA 5KFLA 3PR4A 2AU0A 1ZRMA 4UB1A 2OH2A 5ALHA 2W04A 2JMGA 2R8JA 2DKZA 5J29A 3TI0A 2IUBA 4WC1A 4KN4A 4B9MA 4ICAA 2IOFA 2HHTA 4GIBA 5IIKA 4RQ3A 5J8YA 4QZDA 1UEVA 5CRXA 9ICWA 1WYGA 1U49A 2Y9TA 4F5QA 5J0UA 4E0DA 2YN4A 5AI0A 1IG6A 5KT6A 4NXUA 4QJFB 1UEUA 1DRGA 2LHTA 5AIAA 4PGQA 4LZDA 1KFSA 4DSIA 2ZHBA 4M6WB 3RH6A 7ICOA 4DFJA 4EYHB 4FS1A 4F2SA 2I5HA 5J2BA 4P2HA 2UVWA 3UM9A 3LK9A 2NRWA 4QW8A 3RRGA 2GOLA 4Y2TA 4I2DA 3L4PA 5HHHA 5KAIU 3NGDA 2N1RA 4O3PA 2H5XA 4K99A 5ALFA 1DK3A 2ZIVA 4C4TA 1D8LA 1ZQIA 8ICTA 1XSPA 1XU4A 2VIXA 2KZZA 3TAPA 5HHIA 5KFVA 1SKRA 1NK7A 9ICLA 1Z1VA 4YP3A 1CUKA 2QKQA 4EZ6A 5EWEA 2HBJA 1ZQMA 4HX0A 2G0AA 5J2EA 2P66A 2NRXA 1SKSA 1RQNA 8ICAA 1ZYQA 2W9BB 3RR8A 4QWDA 3AQMA 3HP6A 1UA0A 4US9A 1S77D 4KB6A 4MF8A 3AMZA 4ECTA 2W54A 5CHGA 5CFTA 1PZNA 4DF4A 1C20A 2A3VA 3C21A 2CN1A 2LM4A 5DECA 3UXPA 2HOFA 4BWMA 4RQ2A 4PH5A 3PW2A 2NV3A 2ZIXB 5HRHA 2W3SA 1L6NA 2NRVA 4O3OA 2BBHA 4ELTA 4E80A 4DFPA 1S0VA 4F4KA 3JYYA 2MU2A 2Q4TA 2D6FC 3BZCA 4QZHA 3MGIA 3GIIA 1KFTA 1L3TA 4C4SA 3NYBA 4O5EA 2A1AA 3QZ8A 1LKYA 3I1YA 4R65A 4K4GA 1KDHA 3EYZA 5KFOA 3ZD9A 2ZUBA 5AHXA 1VDVA 2NRTA 4WJ3B 3TQ1A 4J9QA 2BDPA 4X4TA 5FP0A 1SXEA 8ICUA 3IM1A 2DWQA 4UB4A 5GTHU 1ZQFA 3RB3A 1NZBA 4K4IA 5ALQA 4HYKA 4LJXA 1KW4A 4JWNA 2E8OA 3C1ZA 4O69A 1SL1A 4WQKA 4DOCA 3QNMA 2KJ8A 5TZVA 2E3TA 2H3FA 4YR3A 5ALKA 4XUSA 4ECWA 3NASA 1SB3C 3THVA 9ICIA 2RQ5A 3GFKB 3HRDD 5IIOA 2W8KA 3G6XA 3UMGA 5DQGA 2AGPA 5KFZA 2ZH1A 3KZXA 9ICEA 1NZPA 1X40A 4FZMA 5IIMA 1TAUA 3HIYA 2M2UA 2HOQA 2EH9A 4NXZA 3BQ1A 3HPOA 2MUTA 5J2FA 1HUOA 2KIVA 3H38A 1L7NA 4F4ZA 2ZIUB 2PFPA 3BS5B 2ZTDA 1MIYA 2ASJA 4X4OA 1N63A 3B0YA 1ZQQA 5JUMA 3ER8C 2JEFA 1UT8A 1WCNA 1X9XA 2ZIWB 3MDCA 4FHPA 3PX6A 4PZOA 9ICKA 4YVZA 2KSOA 3LDAA 2W43A 4BUGA 3E2EA 5KTQA 8ICNA 3BQ2A 5KFDA 4Z6CA 4MHVA 4M9LA 5ALTA 4O3NA 1XO1A 3ER9B 4RWNA 1MSWD 1Q8KA 4B9UA 4KLSA 5EWGA 4TURA 1H38A 1NKBA 2K8CB 4ED6A 1JXEA 4EBCA 2VJ5A 2PMZF 2J6UA 1JUDA 3WKDA 3ZI4A 2IBKA 4YG2A 1ZD5A 4C7ZA 3SENA 5IINA 3RJJA 2KFZA 2ES6A 5L1KA 5B3QA 1S0OA 4X4UA 3JCFA 3EW9A 5CJ7A 3RJGA 2E1EA 1COKA 3N7SC 3PSPA 3PSIA 1ZRNA 4JK1A 2WAQF 4ECYA 1ZD3A 2W7PA 1X66A 5KAFU 3MR5A 2I9GA 4MFCA 1OUQA 2R18A 4NLZA 4OO1J 3EF2A 4EV6A 1JI7A 2EAPA 1S5LU 4F93B 1TK0A 3HKZF 3Q8QB 5B66U 8ICLA 4WH5A 3MR2A 5HRLA 3QU5A 2DR5A 2BCRA 3ED5A 3PZPA 1R8CA 4WC2A 5AKGA 1NJXA 5J0TA 5JTIA 4A8EA 5CP2A 3E0FA 4AT7A 5L1LA 5D62A 1ZQKA 4B9SA 1D8YA 4NM2A 4YD2A 4GC6A 5B5EU 3MR6A 4UD4A 4OAIZ 1ZQNA 5KFRA 2KP7A 4XJEA 4QWBA 2JEIA 5JTGA 1LB2B 4EGWA 4TQRA 4J03A 1ZQZA 4FE3A 5KFUA 2H3IA 1FO4A 2IOFK 1L5UA 4K98A 4UBCA 3WK6A 2HSZA 4X5VA 2GA9D 1BVSA 3PHZA 4ZH4A 5L1IA 2NRZA 4UB6U 4ZOHC 8ICKA 3ISBA 4R64A 2K4IA 2FPKA 1PVPA 3OHBA 3T79A 4NL9A 2E8MA 5IILA 5EE1A 2ZTEA 5DB6A 2HN2A 5DQIA 4EBKA 2WF7A 3K1ZA 3G6VA 1JX4A 3UPQA 3QU4A 4IR1A 4I2CA 3OJSA 1X42A 3BQ0A 4NV0A 1NOMA 3JPQA 3CNHA 4R8UB 3LVWA 3DEEA 9ICGA 3UPSA 3FM9A 5J2KA 3AQEA 1DOQA 3H0LB 1TK5A 4CF3A 1V85A 4QW9A 2WFAA 3SEIA 1WOTA 5ALIA 9ICOA 2KFNA 1TV9A 1X6JA
chains in the Genus database with same CATH topology
1A77A 4EEYA 4YN4A 1Z00B 5J0QA 2AGQA 4K4HA 1ZJMA 4UAZA 4MFAA 3T5LA 3H8SA 5KFMA 1LV5A 4M9HA 4RUCA 5DEDA 4XQ7A 4CCHA 2PBEA 2ISOA 9ICMA 5D46A 5CA7A 3LWMA 3JPNA 3RB4A 3OSNA 1HUZA 1ZQAA 3WFPA 4YQWA 3MBYA 2BCSA 4LT6A 2R8KA 3JZ0A 4C8OA 4RQ8A 5BPCA 4IQVA 5KFXA 3SZ2A 2ZUDA 3AUOA 1L3VA 1S76D 4C8NA 4ATBA 4R63A 5CR0A 4YD1A 2BHNA 4FO6A 1ZQHA 4DQPA 2HHXA 2ALZA 4KTQA 8ICYA 3TFSA 1F5AA 2XC9A 3T3FA 1RXVA 1UETA 4DS4A 1Y88A 9ICAA 4UQGA 4ECQA 9ICNA 4YXJA 2AU0A 4KN7A 5KFLA 3PMLA 3PR4A 2C28A 5KFBA 8ICJA 1VJ7A 3WFSC 4UB1A 7ICNA 2RDJA 4KLJA 1RZTA 1ZQJA 2M2VA 2C2DA 2R8JA 2W9AA 1U45A 1NO5A 5J29A 4NKTA 3TI0A 4WC1A 2HHSA 2A1JB 1ZQLA 4KN4A 4PHAA 2ZH7A 1ZQXA 3N97B 3V7JA 1SL0A 1ZQEA 9ICFA 4B9MA 2ZH3A 4IR9A 4DOAA 4DFMA 5J2CA 3GILA 2HHTA 5IIKA 4RQ3A 4NLNA 1UEVA 4QZDA 4WC3A 5DG9A 4JV2A 4MEXA 2J6TA 2HHQA 9ICWA 5L9XA 4RNMA 1U49A 4P4MA 1RYRA 4F5QA 3H4DA 5J0UA 3PVXA 3Q8RB 5J2IA 4E0DA 5KFGA 1T7PA 3NTUA 4DL2A 2ZHAA 4KITB 3PX4A 5KT6A 3KTQA 4IG8A 1XC9A 4KLDA 3ZDDA 1UEUA 2J6SA 3H40A 2A1JA 4IQUA 4PPXA 2BQUA 1A76A 2R8IA 4I2IA 4M9JA 4PGQA 4LZDA 1KFSA 2R8GA 4LVSA 3K75D 2FMPA 5EWFA 2PFQA 4DSIA 2ZHBA 4M6WB 5J0WA 3RH6A 7ICOA 4DFJA 4GXIA 4EYHB 4FS1A 4ELUA 2ZJ5A 3GQCA 4F2SA 4NLGA 5J2BA 4P2HA 2UVWA 4WBZA 3AU6A 2PXIA 3Q8LA 2IMWP 3PX0A 3ETLA 2ZJAA 3LK9A 2NRWA 4QW8A 3OGUA 3MR3A 3TFRA 1XSLA 3RRGA 2V4RA 3SV3A 4M5DA 4E8FA 4XRHA 4Q8EA 4J9LA 1QSYA 3EPGA 2HW3A 4I2DA 4RT2A 9ICJA 9ICCA 5HHHA 1S0MA 1DGSA 4WBYA 3NGDA 1BPEA 4O3PA 4ECUA 4X4QA 2DR7A 3IHQB 2H5XA 4DQIA 5KT4A 3OUYB 4M6WA 2JZBB 2XCPA 1V9PA 5KG2A 1DK3A 4QZ8A 1D8LA 5KFPA 1ZQIA 7ICTA 4UBBA 8ICTA 1Z3EB 1XSPA 4F5PA 3ZDEA 3RJEA 1XU4A 2KZZA 4F50A 3SV4A 3TAPA 5HHIA 5KFVA 3GIKA 1SKRA 5DB9A 4DL5A 1NK7A 4C8MA 4F4XA 9ICLA 2M2TA 5KFYA 4RPYA 4I29A 1L3UA 1CEZA 2ISPA 9ICQA 5KFEA 4YP3A 4ECZA 3QE9Y 1CUKA 1OU5A 8ICEA 1NK5A 3M9MB 4EZ6A 3RAXA 5EWEA 3UXNA 3KHRA 1NJWA 2BCUA 5KFCA 3OUYA 1ZQMA 3M9OB 4FS2A 2FLPA 5DB8A 3H39A 4RPXA 4ECRA 2BQ3A 1T4GA 4RT3A 5J2EA 3PW5A 8ICSA 4B9VA 2P66A 8ICVA 3MFIA 4JV0A 1SKWA 4KLGA 4RNOA 4X4RA 3JPRA 3PO5A 2NRXA 1SKSA 3AQKA 8ICAA 1S0NA 1ZQSA 3OSPA 1ZYQA 4B9LA 2W9BB 4QZFA 3C2LA 3RR8A 2F1IA 4QWDA 1X9SA 1JMSA 4DOBA 3AQMA 4FHWA 1X9WA 4QZEA 3HP6A 4GLXA 1EXNA 4ED0A 1UA0A 1L3SA 2LYHA 1ZQWA 2KZ3A 3MDAA 4J9PA 4DFKA 4DF8A 1S77D 4FHXA 4ATBB 1UT5A 4NLKA 4MF8A 4QZCA 3KHHA 2XO7A 4ECTA 5F9NA 5DB7A 4EYIB 5KFNA 4F4YA 3PW7A 5DDYA 3RJFA 5CHGA 3PR5B 4QZIA 1S97A 1PZNA 4DF4A 4I27A 5HRKA 3H4BA 3C21A 3RJKA 1BPZA 4RQ7A 1FA0A 1QLNA 4F5NA 4G3IA 3AQNA 5DECA 7ICIA 3UXPA 3SYZA 4GXKA 4NY8A 8ICPA 3K4GA 4UAWA 3OHAA 2W9BA 3RH4A 4WC7A 2FPMA 4BWMA 4RQ2A 5BOMA 4PH5A 3PW2A 3H8JA 4X0BA 4F4WA 5HRBA 1NK6A 1ZQOA 1C7YA 4Z6DA 7ICQA 4Q45A 4F5RA 2NRVA 2KTQA 3V72A 5J2HA 9ICUA 4O3OA 5DKWA 2Y1IA 1PX5A 3C5GA 4ELTA 1NKEA 4E80A 1K1SA 2BCQA 4TQSA 1X2IA 4DFPA 3T5JA 4DSLA 3Q8SB 1MQ3A 3ZDBA 4PGYA 1S0VA 4F4KA 1UA1A 3JYYA 2BR0A 2Q0ZX 3RH5A 8ICZA 3H8WA 4QZHA 2WTFA 3MGIA 1S10A 4C8LA 5CWRA 1RPLA 3GIIA 1KFTA 1L3TA 3RB0A 3NYBA 2AQ0A 9ICTA 4O5EA 3H7IA 2FLLA 4RUAA 3QZ8A 4F2RA 4R65A 3RJHA 1KDHA 4FBUA 4K4GA 4J9NA 5DG7A 2ZH9A 2W9MA 5KFOA 5KFWA 3EYZA 3KHLA 4I2FA 4I28A 4PHEA 1U9LA 3PMNA 3ZD9A 4UB5A 2ZUBA 2PFOA 3RJIA 1XS9D 4M47A 4Q8FA 4DSJA 2NRTA 4ECSA 3TQ1A 2HVIA 4J9QA 3RTVA 3N4MB 2BDPA 4X4TA 1ZETA 8ICUA 3IM1A 5KG7A 3RAQA 1U48A 3PO4A 1MIVA 2BPFA 1D9FA 3PW4A 4QZBA 4UB4A 4O3SA 2OWOA 3GDXA 3EPIA 1ZQBA 1ZQFA 4KLUA 1R89A 5DQHA 3RB3A 3ORYA 2V4QA 4K4IA 1ZQCA 4HYKA 2C2EA 1TAQA 4PHPA 2W9CB 1SZPA 4JWNA 4P4PA 4RZRA 3C1ZA 1TFRA 3RBDA 1T3NA 4KLOA 4ED7A 2KZMA 1MIWA 1R8BA 8ICRA 3RBEA 5KFJA 1NK8A 3QEBZ 2BPGA 3QEAZ 4J9KA 4ELVA 1JIHA 5HNKA 3JPPA 1SL1A 4DOCA 5BOLA 4UD5A 2W8LA 2VA3A 1BPDA 2VANA 5TZVA 2MAXA 4UB3A 4YR3A 3OVSA 2MUTB 2FMQA 4XUSA 5DLFA 5EOZA 2HHPA 4ECWA 4DWIA 4MFFA 5HMLA 2IA6A 3BQTA 3C23A 5L1JA 3THVA 1RYSA 4YR0A 8ICHA 4RU9A 3GFKB 4YXMA 3C2MA 5KG5A 9ICIA 5IIOA 2W8KA 3G6XA 1T8EA 4FH5A 5DGAA 7ICSA 2W9CA 5DQGA 2AGPA 5KFZA 2ZH1A 4DEZA 5HRHA 1N56A 9ICEA 3JPOA 5KFSA 3Q8MA 1NJZA 5DG8A 3M8RA 1NZPA 3HJ1A 2I1QA 7ICUA 3UQ0A 4YMNA 3QZ7A 2XGPA 5DBAA 2XCAA 5IIMA 3Q8KA 1ZQTA 4IQWA 3M9NB 1TAUA 4F92B 2M2UA 3HIYA 4NXZA 3HT3A 3M8SA 4ED1A 4X4PA 4YR2A 3BQ1A 5HMMA 3HPOA 5J0YA 2MUTA 5J2AA 4ED3A 7ICJA 7ICLA 5KFTA 4QZ9A 5CB1A 5J2FA 1HUOA 5HRDA 1HJPA 4KLEA 3V6KA 1ZQDA 8ICBA 1ZQYA 4F4ZA 3H38A 4X4SA 4BDPA 4DL7A 4PHDA 2HVHA 3TANA 4LZGA 4EP7A 4KLIA 4BGDA 2PFPA 2BQRA 4B9TA 1MQ2A 2ZTDA 3TAQA 1MIYA 4Z6EA 3GV8B 2ASJA 4J9RA 1KRPA 4B9NA 4IRDA 4M9GA 4E7XA 1KSPA 4O5CA 4X4OA 3BJYA 3B0YA 1ZQQA 5JUMA 2BCVA 4M0AA 3H37A 4NKUA 3OJUA 5J2JA 2JEFA 1BNPA 2RFFA 3OVAA 1NKCA 1UT8A 4ECXA 1KFDA 4GXJA 7ICKA 5HRGA 5KT7A 3ZD8A 1XWLA 2ASDA 1WCNA 1KEJA 4KLFA 1ZQUA 3MDCA 1TKDA 3HW8A 2JEGA 4M9NA 3PX6A 3GV7B 9ICKA 4FHPA 4YVZA 3GV5B 2ATLA 4M2YA 3LDAA 2BKEA 1JN3A 4WCWA 2M2WA 4ECVA 1QSLA 7ICFA 4RPZA 3E2EA 9ICBA 3LQCB 5KTQA 1ZQPA 3C1YA 3KHGA 4YFKA 3TARA 4DL3A 2AJQA 8ICNA 2UVVA 4IQTA 3BQ2A 4KLTA 9ICSA 3T5HA 5KFDA 4Z6CA 8ICQA 9ICRA 5DLGA 3JPTA 4M9LA 5F2VO 5HRIA 4F5OA 4O3NA 1XO1A 2HHWA 3JPSA 1BPBA 9ICHA 4EBJA 9ICVA 4O3QA 2Y1JA 4RWNA 1MSWD 2DPJA 1TFWA 4B9UA 4FH3A 4X0AA 4KLMA 4J9MA 2HHVA 8ICCA 1ZQRA 5EWGA 4TURA 4KLSA 1H38A 1NKBA 4ED6A 3LWLA 4TUPA 1JXEA 3OVBA 3AQLA 2RDIA 4EBCA 4O5KA 3T5KA 2J6UA 3C18A 2XY6A 1U4BA 4QWEA 3L9DA 3V7KA 2IBKA 5J2DA 8ICOA 1QSSA 4YG2A 4QWAA 4DLGA 3FYHA 4J9SA 2IHNA 4I2HA 5IINA 3RJJA 3RB6A 4I2BA 2KFZA 4JV1A 2DVIA 5L1KA 5D4BA 4TUQA 4YMMA 2DPIA 4QZGA 1S0OA 7ICPA 4X4UA 4RQ0A 4I2EA 5C5JA 5KFFA 3EW9A 4O0IA 5CJ7A 3RJGA 3ISDA 3PY8A 1Q79A 3EZ5A 4IRKA 1XSNA 8ICXA 4QZAA 4FHYA 4JK1A 2ZH8A 4ECYA 1B43A 5D49A 1NK4A 5DGBA 1JAJA 5J0XA 4DQQA 4O3RA 2PI4A 5J2GA 1SL2A 3MR5A 2I9GA 4MFCA 8ICMA 2ZH2A 2ZH4A 2P6RA 7ICVA 2R8HA 3UQ2A 1NK0A 4F3OA 1ZJNA 4NLZA 3PV8A 4I2GA 1B22A 7ICHA 4F93B 4UAYA 5HR9A 1AROP 2XGQA 1K1QA 1TK0A 8ICFA 8ICWA 4AT7B 3Q8QB 1Z00A 5IIJA 5KT2A 5KT3A 8ICLA 1YLQA 1BPYA 4IRCA 2ASLA 2V9WA 2ZH6A 5KFAA 3V6JA 5KG4A 3ISCA 3MR2A 3FDSA 3GIMA 1RXWA 3V7LA 5HRLA 2XY7A 2O1PA 4KLLA 2DR5A 4F91B 2BCRA 5J0OA 4AT9A 1R8CA 2C2RA 1KNYA 4WC2A 4EBEA 4DS5A 2B21A 3C5FA 1IXRA 2PFNA 2UVRA 8ICIA 4AT8B 4RQ1A 2GWSA 1NJXA 1TK8A 1WCLA 5J0TA 1KLNA 5CP2A 2P6UA 4DL4A 5J0PA 5L1LA 2FMSA 3WFOA 4AT7A 1BNOA 1ZQKA 2F1HA 3HWTA 4B9SA 3MABA 1D8YA 4NM2A 4YD2A 4GC6A 4MEYA 2ZH5A 2C22A 1JQRA 3MR6A 3HJ4A 2M9NA 4UD4A 3WFQE 2ZUCA 5DBCA 1ZQNA 5KFRA 1BPXA 2KP7A 4XA5A 4QWBA 4RQ6A 4JUZA 4BWJA 7ICGA 4DQSA 4QWCA 1NJYA 2FLNA 2JEIA 4DQRA 4AT8A 4I2JA 1LB2B 3OV7A 2BPCA 4BXOB 4TQRA 1VFGA 4GC7A 1IM4A 2FPLA 3Q8PB 4RQ5A 4NM1A 4FHVA 7ICRA 3RR7A 1ZQZA 5KFUA 1L5UA 4XQ8A 2ZTCA 4O9MA 4DSFA 4UBCA 1R8AA 4X4NA 4DSEA 4PGXA 5KFQA 9ICPA 4X5VA 1D9DA 1COOA 1BGXT 7ICMA 2ID1A 2HHUA 3AU2A 3ZDCA 2O5AA 3WFRE 2BGWA 4I2AA 5J0RA 1BVSA 4Q44A 3PNCA 4F8RA 4ZH4A 5L1IA 2F1JA 2Q66A 4MF2A 2NRZA 4ED8A 4TUSA 4UB2A 4KLQA 4BXOA 8ICKA 1ZQVA 3EWAA 4R64A 5KG3A 3UXOA 3ISBA 2FPKA 4EBDA 3OHBA 1N48A 1JXLA 1Q78A 2JEJA 3B0XA 5IILA 2VA8A 5DB6A 2ZTEA 2NRKA 4AT9B 5KG6A 4C8KA 5F9LA 5DQIA 3H3AA 3GIJA 2DFLA 4EBKA 4R66A 2DRAA 7ICEA 4M04A 3G6YA 4DSKA 3G6VA 4RWPA 4WC4A 4DLEA 1JX4A 8ICGA 3UPQA 4YMOA 5KFIA 2VA2A 2UVUA 3MGHA 4IR1A 3OJSA 3HX0A 4I2CA 4RQ4A 5IIIA 5HRFA 3BQ0A 2XY5A 2DR8A 1ZQGA 1NOMA 3JPQA 4RWOA 2DRBA 4R8UB 5KG0A 2AQ4A 5HREA 4DL6A 1S9FA 4J9OA 5HC9A 5J0SA 4KLHA 5KFKA 2ZJ8A 1X9MA 9ICGA 3C66A 3UPSA 4FBTA 5DBBA 5DDMA 5J2KA 2JZBA 4WC5A 4RNNA 3RRHA 5KFHA 2BE3A 2DR9A 1KTQA 3BDPA 3SI8A 4RWQA 5KG1A 1U47A 1DOQA 4P4OA 1TK5A 2KN7A 2PI5A 5HP4A 3MFHA 1DK2A 4QW9A 3ZDAA 4X4VA 4Q43A 4DO9A 4ED2A 4KMUA 2AGOA 4S3NA 4JWMA 1TFYA 1TVAA 4WC0A 3PW0A 1WOTA 4Z6FA 2IHMA 4EZ9A 4R8UA 1MC8A 3V6HA 1V4AA 4YCXA 4WC6A 1NK9A 9ICOA 9ICXA 2KFNA 1TV9A 1QTMA 5KT5A 3C2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A77 A;  4EEY A;  4YN4 A;  1Z00 B;  5J0Q A;  2AGQ A;  4K4H A;  1ZJM A;  4UAZ A;  4MFA A;  3T5L A;  3H8S A;  5KFM A;  1LV5 A;  4M9H A;  4RUC A;  5DED A;  4XQ7 A;  4CCH A;  2PBE A;  2ISO A;  9ICM A;  5D46 A;  5CA7 A;  3LWM A;  3JPN A;  3RB4 A;  3OSN A;  1HUZ A;  1ZQA A;  3WFP A;  4YQW A;  3MBY A;  2BCS A;  4LT6 A;  2R8K A;  3JZ0 A;  4C8O A;  4RQ8 A;  5BPC A;  4IQV A;  5KFX A;  3SZ2 A;  2ZUD A;  3AUO A;  1L3V A;  1S76 D;  4C8N A;  4ATB A;  4R63 A;  5CR0 A;  4YD1 A;  2BHN A;  4FO6 A;  1ZQH A;  4DQP A;  2HHX A;  2ALZ A;  4KTQ A;  8ICY A;  3TFS A;  1F5A A;  2XC9 A;  3T3F A;  1RXV A;  1UET A;  4DS4 A;  1Y88 A;  9ICA A;  4UQG A;  4ECQ A;  9ICN A;  4YXJ A;  2AU0 A;  4KN7 A;  5KFL A;  3PML A;  3PR4 A;  2C28 A;  5KFB A;  8ICJ A;  1VJ7 A;  3WFS C;  4UB1 A;  7ICN A;  2RDJ A;  4KLJ A;  1RZT A;  1ZQJ A;  2M2V A;  2C2D A;  2R8J A;  2W9A A;  1U45 A;  1NO5 A;  5J29 A;  4NKT A;  3TI0 A;  4WC1 A;  2HHS A;  2A1J B;  1ZQL A;  4KN4 A;  4PHA A;  2ZH7 A;  1ZQX A;  3N97 B;  3V7J A;  1SL0 A;  1ZQE A;  9ICF A;  4B9M A;  2ZH3 A;  4IR9 A;  4DOA A;  4DFM A;  5J2C A;  3GIL A;  2HHT A;  5IIK A;  4RQ3 A;  4NLN A;  1UEV A;  4QZD A;  4WC3 A;  5DG9 A;  4JV2 A;  4MEX A;  2J6T A;  2HHQ A;  9ICW A;  5L9X A;  4RNM A;  1U49 A;  4P4M A;  1RYR A;  4F5Q A;  3H4D A;  5J0U A;  3PVX A;  3Q8R B;  5J2I A;  4E0D A;  5KFG A;  1T7P A;  3NTU A;  4DL2 A;  2ZHA A;  4KIT B;  3PX4 A;  5KT6 A;  3KTQ A;  4IG8 A;  1XC9 A;  4KLD A;  3ZDD A;  1UEU A;  2J6S A;  3H40 A;  2A1J A;  4IQU A;  4PPX A;  2BQU A;  1A76 A;  2R8I A;  4I2I A;  4M9J A;  4PGQ A;  4LZD A;  1KFS A;  2R8G A;  4LVS A;  3K75 D;  2FMP A;  5EWF A;  2PFQ A;  4DSI A;  2ZHB A;  4M6W B;  5J0W A;  3RH6 A;  7ICO A;  4DFJ A;  4GXI A;  4EYH B;  4FS1 A;  4ELU A;  2ZJ5 A;  3GQC A;  4F2S A;  4NLG A;  5J2B A;  4P2H A;  2UVW A;  4WBZ A;  3AU6 A;  2PXI A;  3Q8L A;  2IMW P;  3PX0 A;  3ETL A;  2ZJA A;  3LK9 A;  2NRW A;  4QW8 A;  3OGU A;  3MR3 A;  3TFR A;  1XSL A;  3RRG A;  2V4R A;  3SV3 A;  4M5D A;  4E8F A;  4XRH A;  4Q8E A;  4J9L A;  1QSY A;  3EPG A;  2HW3 A;  4I2D A;  4RT2 A;  9ICJ A;  9ICC A;  5HHH A;  1S0M A;  1DGS A;  4WBY A;  3NGD A;  1BPE A;  4O3P A;  4ECU A;  4X4Q A;  2DR7 A;  3IHQ B;  2H5X A;  4DQI A;  5KT4 A;  3OUY B;  4M6W A;  2JZB B;  2XCP A;  1V9P A;  5KG2 A;  1DK3 A;  4QZ8 A;  1D8L A;  5KFP A;  1ZQI A;  7ICT A;  4UBB A;  8ICT A;  1Z3E B;  1XSP A;  4F5P A;  3ZDE A;  3RJE A;  1XU4 A;  2KZZ A;  4F50 A;  3SV4 A;  3TAP A;  5HHI A;  5KFV A;  3GIK A;  1SKR A;  5DB9 A;  4DL5 A;  1NK7 A;  4C8M A;  4F4X A;  9ICL A;  2M2T A;  5KFY A;  4RPY A;  4I29 A;  1L3U A;  1CEZ A;  2ISP A;  9ICQ A;  5KFE A;  4YP3 A;  4ECZ A;  3QE9 Y;  1CUK A;  1OU5 A;  8ICE A;  1NK5 A;  3M9M B;  4EZ6 A;  3RAX A;  5EWE A;  3UXN A;  3KHR A;  1NJW A;  2BCU A;  5KFC A;  3OUY A;  1ZQM A;  3M9O B;  4FS2 A;  2FLP A;  5DB8 A;  3H39 A;  4RPX A;  4ECR A;  2BQ3 A;  1T4G A;  4RT3 A;  5J2E A;  3PW5 A;  8ICS A;  4B9V A;  2P66 A;  8ICV A;  3MFI A;  4JV0 A;  1SKW A;  4KLG A;  4RNO A;  4X4R A;  3JPR A;  3PO5 A;  2NRX A;  1SKS A;  3AQK A;  8ICA A;  1S0N A;  1ZQS A;  3OSP A;  1ZYQ A;  4B9L A;  2W9B B;  4QZF A;  3C2L A;  3RR8 A;  2F1I A;  4QWD A;  1X9S A;  1JMS A;  4DOB A;  3AQM A;  4FHW A;  1X9W A;  4QZE A;  3HP6 A;  4GLX A;  1EXN A;  4ED0 A;  1UA0 A;  1L3S A;  2LYH A;  1ZQW A;  2KZ3 A;  3MDA A;  4J9P A;  4DFK A;  4DF8 A;  1S77 D;  4FHX A;  4ATB B;  1UT5 A;  4NLK A;  4MF8 A;  4QZC A;  3KHH A;  2XO7 A;  4ECT A;  5F9N A;  5DB7 A;  4EYI B;  5KFN A;  4F4Y A;  3PW7 A;  5DDY A;  3RJF A;  5CHG A;  3PR5 B;  4QZI A;  1S97 A;  1PZN A;  4DF4 A;  4I27 A;  5HRK A;  3H4B A;  3C21 A;  3RJK A;  1BPZ A;  4RQ7 A;  1FA0 A;  1QLN A;  4F5N A;  4G3I A;  3AQN A;  5DEC A;  7ICI A;  3UXP A;  3SYZ A;  4GXK A;  4NY8 A;  8ICP A;  3K4G A;  4UAW A;  3OHA A;  2W9B A;  3RH4 A;  4WC7 A;  2FPM A;  4BWM A;  4RQ2 A;  5BOM A;  4PH5 A;  3PW2 A;  3H8J A;  4X0B A;  4F4W A;  5HRB A;  1NK6 A;  1ZQO A;  1C7Y A;  4Z6D A;  7ICQ A;  4Q45 A;  4F5R A;  2NRV A;  2KTQ A;  3V72 A;  5J2H A;  9ICU A;  4O3O A;  5DKW A;  2Y1I A;  1PX5 A;  3C5G A;  4ELT A;  1NKE A;  4E80 A;  1K1S A;  2BCQ A;  4TQS A;  1X2I A;  4DFP A;  3T5J A;  4DSL A;  3Q8S B;  1MQ3 A;  3ZDB A;  4PGY A;  1S0V A;  4F4K A;  1UA1 A;  3JYY A;  2BR0 A;  2Q0Z X;  3RH5 A;  8ICZ A;  3H8W A;  4QZH A;  2WTF A;  3MGI A;  1S10 A;  4C8L A;  5CWR A;  1RPL A;  3GII A;  1KFT A;  1L3T A;  3RB0 A;  3NYB A;  2AQ0 A;  9ICT A;  4O5E A;  3H7I A;  2FLL A;  4RUA A;  3QZ8 A;  4F2R A;  4R65 A;  3RJH A;  1KDH A;  4FBU A;  4K4G A;  4J9N A;  5DG7 A;  2ZH9 A;  2W9M A;  5KFO A;  5KFW A;  3EYZ A;  3KHL A;  4I2F A;  4I28 A;  4PHE A;  1U9L A;  3PMN A;  3ZD9 A;  4UB5 A;  2ZUB A;  2PFO A;  3RJI A;  1XS9 D;  4M47 A;  4Q8F A;  4DSJ A;  2NRT A;  4ECS A;  3TQ1 A;  2HVI A;  4J9Q A;  3RTV A;  3N4M B;  2BDP A;  4X4T A;  1ZET A;  8ICU A;  3IM1 A;  5KG7 A;  3RAQ A;  1U48 A;  3PO4 A;  1MIV A;  2BPF A;  1D9F A;  3PW4 A;  4QZB A;  4UB4 A;  4O3S A;  2OWO A;  3GDX A;  3EPI A;  1ZQB A;  1ZQF A;  4KLU A;  1R89 A;  5DQH A;  3RB3 A;  3ORY A;  2V4Q A;  4K4I A;  1ZQC A;  4HYK A;  2C2E A;  1TAQ A;  4PHP A;  2W9C B;  1SZP A;  4JWN A;  4P4P A;  4RZR A;  3C1Z A;  1TFR A;  3RBD A;  1T3N A;  4KLO A;  4ED7 A;  2KZM A;  1MIW A;  1R8B A;  8ICR A;  3RBE A;  5KFJ A;  1NK8 A;  3QEB Z;  2BPG A;  3QEA Z;  4J9K A;  4ELV A;  1JIH A;  5HNK A;  3JPP A;  1SL1 A;  4DOC A;  5BOL A;  4UD5 A;  2W8L A;  2VA3 A;  1BPD A;  2VAN A;  5TZV A;  2MAX A;  4UB3 A;  4YR3 A;  3OVS A;  2MUT B;  2FMQ A;  4XUS A;  5DLF A;  5EOZ A;  2HHP A;  4ECW A;  4DWI A;  4MFF A;  5HML A;  2IA6 A;  3BQT A;  3C23 A;  5L1J A;  3THV A;  1RYS A;  4YR0 A;  8ICH A;  4RU9 A;  3GFK B;  4YXM A;  3C2M A;  5KG5 A;  9ICI A;  5IIO A;  2W8K A;  3G6X A;  1T8E A;  4FH5 A;  5DGA A;  7ICS A;  2W9C A;  5DQG A;  2AGP A;  5KFZ A;  2ZH1 A;  4DEZ A;  5HRH A;  1N56 A;  9ICE A;  3JPO A;  5KFS A;  3Q8M A;  1NJZ A;  5DG8 A;  3M8R A;  1NZP A;  3HJ1 A;  2I1Q A;  7ICU A;  3UQ0 A;  4YMN A;  3QZ7 A;  2XGP A;  5DBA A;  2XCA A;  5IIM A;  3Q8K A;  1ZQT A;  4IQW A;  3M9N B;  1TAU A;  4F92 B;  2M2U A;  3HIY A;  4NXZ A;  3HT3 A;  3M8S A;  4ED1 A;  4X4P A;  4YR2 A;  3BQ1 A;  5HMM A;  3HPO A;  5J0Y A;  2MUT A;  5J2A A;  4ED3 A;  7ICJ A;  7ICL A;  5KFT A;  4QZ9 A;  5CB1 A;  5J2F A;  1HUO A;  5HRD A;  1HJP A;  4KLE A;  3V6K A;  1ZQD A;  8ICB A;  1ZQY A;  4F4Z A;  3H38 A;  4X4S A;  4BDP A;  4DL7 A;  4PHD A;  2HVH A;  3TAN A;  4LZG A;  4EP7 A;  4KLI A;  4BGD A;  2PFP A;  2BQR A;  4B9T A;  1MQ2 A;  2ZTD A;  3TAQ A;  1MIY A;  4Z6E A;  3GV8 B;  2ASJ A;  4J9R A;  1KRP A;  4B9N A;  4IRD A;  4M9G A;  4E7X A;  1KSP A;  4O5C A;  4X4O A;  3BJY A;  3B0Y A;  1ZQQ A;  5JUM A;  2BCV A;  4M0A A;  3H37 A;  4NKU A;  3OJU A;  5J2J A;  2JEF A;  1BNP A;  2RFF A;  3OVA A;  1NKC A;  1UT8 A;  4ECX A;  1KFD A;  4GXJ A;  7ICK A;  5HRG A;  5KT7 A;  3ZD8 A;  1XWL A;  2ASD A;  1WCN A;  1KEJ A;  4KLF A;  1ZQU A;  3MDC A;  1TKD A;  3HW8 A;  2JEG A;  4M9N A;  3PX6 A;  3GV7 B;  9ICK A;  4FHP A;  4YVZ A;  3GV5 B;  2ATL A;  4M2Y A;  3LDA A;  2BKE A;  1JN3 A;  4WCW A;  2M2W A;  4ECV A;  1QSL A;  7ICF A;  4RPZ A;  3E2E A;  9ICB A;  3LQC B;  5KTQ A;  1ZQP A;  3C1Y A;  3KHG A;  4YFK A;  3TAR A;  4DL3 A;  2AJQ A;  8ICN A;  2UVV A;  4IQT A;  3BQ2 A;  4KLT A;  9ICS A;  3T5H A;  5KFD A;  4Z6C A;  8ICQ A;  9ICR A;  5DLG A;  3JPT A;  4M9L A;  5F2V O;  5HRI A;  4F5O A;  4O3N A;  1XO1 A;  2HHW A;  3JPS A;  1BPB A;  9ICH A;  4EBJ A;  9ICV A;  4O3Q A;  2Y1J A;  4RWN A;  1MSW D;  2DPJ A;  1TFW A;  4B9U A;  4FH3 A;  4X0A A;  4KLM A;  4J9M A;  2HHV A;  8ICC A;  1ZQR A;  5EWG A;  4TUR A;  4KLS A;  1H38 A;  1NKB A;  4ED6 A;  3LWL A;  4TUP A;  1JXE A;  3OVB A;  3AQL A;  2RDI A;  4EBC A;  4O5K A;  3T5K A;  2J6U A;  3C18 A;  2XY6 A;  1U4B A;  4QWE A;  3L9D A;  3V7K A;  2IBK A;  5J2D A;  8ICO A;  1QSS A;  4YG2 A;  4QWA A;  4DLG A;  3FYH A;  4J9S A;  2IHN A;  4I2H A;  5IIN A;  3RJJ A;  3RB6 A;  4I2B A;  2KFZ A;  4JV1 A;  2DVI A;  5L1K A;  5D4B A;  4TUQ A;  4YMM A;  2DPI A;  4QZG A;  1S0O A;  7ICP A;  4X4U A;  4RQ0 A;  4I2E A;  5C5J A;  5KFF A;  3EW9 A;  4O0I A;  5CJ7 A;  3RJG A;  3ISD A;  3PY8 A;  1Q79 A;  3EZ5 A;  4IRK A;  1XSN A;  8ICX A;  4QZA A;  4FHY A;  4JK1 A;  2ZH8 A;  4ECY A;  1B43 A;  5D49 A;  1NK4 A;  5DGB A;  1JAJ A;  5J0X A;  4DQQ A;  4O3R A;  2PI4 A;  5J2G A;  1SL2 A;  3MR5 A;  2I9G A;  4MFC A;  8ICM A;  2ZH2 A;  2ZH4 A;  2P6R A;  7ICV A;  2R8H A;  3UQ2 A;  1NK0 A;  4F3O A;  1ZJN A;  4NLZ A;  3PV8 A;  4I2G A;  1B22 A;  7ICH A;  4F93 B;  4UAY A;  5HR9 A;  1ARO P;  2XGQ A;  1K1Q A;  1TK0 A;  8ICF A;  8ICW A;  4AT7 B;  3Q8Q B;  1Z00 A;  5IIJ A;  5KT2 A;  5KT3 A;  8ICL A;  1YLQ A;  1BPY A;  4IRC A;  2ASL A;  2V9W A;  2ZH6 A;  5KFA A;  3V6J A;  5KG4 A;  3ISC A;  3MR2 A;  3FDS A;  3GIM A;  1RXW A;  3V7L A;  5HRL A;  2XY7 A;  2O1P A;  4KLL A;  2DR5 A;  4F91 B;  2BCR A;  5J0O A;  4AT9 A;  1R8C A;  2C2R A;  1KNY A;  4WC2 A;  4EBE A;  4DS5 A;  2B21 A;  3C5F A;  1IXR A;  2PFN A;  2UVR A;  8ICI A;  4AT8 B;  4RQ1 A;  2GWS A;  1NJX A;  1TK8 A;  1WCL A;  5J0T A;  1KLN A;  5CP2 A;  2P6U A;  4DL4 A;  5J0P A;  5L1L A;  2FMS A;  3WFO A;  4AT7 A;  1BNO A;  1ZQK A;  2F1H A;  3HWT A;  4B9S A;  3MAB A;  1D8Y A;  4NM2 A;  4YD2 A;  4GC6 A;  4MEY A;  2ZH5 A;  2C22 A;  1JQR A;  3MR6 A;  3HJ4 A;  2M9N A;  4UD4 A;  3WFQ E;  2ZUC A;  5DBC A;  1ZQN A;  5KFR A;  1BPX A;  2KP7 A;  4XA5 A;  4QWB A;  4RQ6 A;  4JUZ A;  4BWJ A;  7ICG A;  4DQS A;  4QWC A;  1NJY A;  2FLN A;  2JEI A;  4DQR A;  4AT8 A;  4I2J A;  1LB2 B;  3OV7 A;  2BPC A;  4BXO B;  4TQR A;  1VFG A;  4GC7 A;  1IM4 A;  2FPL A;  3Q8P B;  4RQ5 A;  4NM1 A;  4FHV A;  7ICR A;  3RR7 A;  1ZQZ A;  5KFU A;  1L5U A;  4XQ8 A;  2ZTC A;  4O9M A;  4DSF A;  4UBC A;  1R8A A;  4X4N A;  4DSE A;  4PGX A;  5KFQ A;  9ICP A;  4X5V A;  1D9D A;  1COO A;  1BGX T;  7ICM A;  2ID1 A;  2HHU A;  3AU2 A;  3ZDC A;  2O5A A;  3WFR E;  2BGW A;  4I2A A;  5J0R A;  1BVS A;  4Q44 A;  3PNC A;  4F8R A;  4ZH4 A;  5L1I A;  2F1J A;  2Q66 A;  4MF2 A;  2NRZ A;  4ED8 A;  4TUS A;  4UB2 A;  4KLQ A;  4BXO A;  8ICK A;  1ZQV A;  3EWA A;  4R64 A;  5KG3 A;  3UXO A;  3ISB A;  2FPK A;  4EBD A;  3OHB A;  1N48 A;  1JXL A;  1Q78 A;  2JEJ A;  3B0X A;  5IIL A;  2VA8 A;  5DB6 A;  2ZTE A;  2NRK A;  4AT9 B;  5KG6 A;  4C8K A;  5F9L A;  5DQI A;  3H3A A;  3GIJ A;  2DFL A;  4EBK A;  4R66 A;  2DRA A;  7ICE A;  4M04 A;  3G6Y A;  4DSK A;  3G6V A;  4RWP A;  4WC4 A;  4DLE A;  1JX4 A;  8ICG A;  3UPQ A;  4YMO A;  5KFI A;  2VA2 A;  2UVU A;  3MGH A;  4IR1 A;  3OJS A;  3HX0 A;  4I2C A;  4RQ4 A;  5III A;  5HRF A;  3BQ0 A;  2XY5 A;  2DR8 A;  1ZQG A;  1NOM A;  3JPQ A;  4RWO A;  2DRB A;  4R8U B;  5KG0 A;  2AQ4 A;  5HRE A;  4DL6 A;  1S9F A;  4J9O A;  5HC9 A;  5J0S A;  4KLH A;  5KFK A;  2ZJ8 A;  1X9M A;  9ICG A;  3C66 A;  3UPS A;  4FBT A;  5DBB A;  5DDM A;  5J2K A;  2JZB A;  4WC5 A;  4RNN A;  3RRH A;  5KFH A;  2BE3 A;  2DR9 A;  1KTQ A;  3BDP A;  3SI8 A;  4RWQ A;  5KG1 A;  1U47 A;  1DOQ A;  4P4O A;  1TK5 A;  2KN7 A;  2PI5 A;  5HP4 A;  3MFH A;  1DK2 A;  4QW9 A;  3ZDA A;  4X4V A;  4Q43 A;  4DO9 A;  4ED2 A;  4KMU A;  2AGO A;  4S3N A;  4JWM A;  1TFY A;  1TVA A;  4WC0 A;  3PW0 A;  1WOT A;  4Z6F A;  2IHM A;  4EZ9 A;  4R8U A;  1MC8 A;  3V6H A;  1V4A A;  4YCX A;  4WC6 A;  1NK9 A;  9ICO A;  9ICX A;  2KFN A;  1TV9 A;  1QTM A;  5KT5 A;  3C2K A; 
#chains in the Genus database with same CATH topology
 1A77 A;  4YN4 A;  2AGQ A;  4UAZ A;  3R9K A;  3H8S A;  4OCZ A;  5KFM A;  4USA A;  4CCH A;  2EAO A;  2HN1 A;  1SWV A;  1ZQA A;  3WFP A;  1NNL A;  2R8K A;  4NXT A;  3WKA A;  4C8O A;  2KV2 A;  4C8N A;  5CR0 A;  2BHN A;  4FO6 A;  4KTQ A;  1ED1 A;  2K4H A;  3TFS A;  1L7O A;  1Y88 A;  4ECQ A;  2C28 A;  1VJ7 A;  2DBY A;  7ICN A;  2RDJ A;  1RZT A;  2KVS A;  4K8V A;  4CNQ A;  2ZH7 A;  4PHA A;  3V7J A;  4DOA A;  4BJQ A;  3MCR A;  5DG9 A;  4JV2 A;  4MEX A;  2J6T A;  4IC9 A;  1RYR A;  1DGJ A;  3KOO A;  4P4M A;  4AYB C;  5J2I A;  4DL2 A;  4EEL A;  2ZHA A;  3PX4 A;  3KTQ A;  4WQL A;  4KLD A;  3ZDD A;  2A1J A;  2BQU A;  4M9J A;  3SD7 A;  2JHD A;  2PFQ A;  2FMP A;  2F76 X;  4GXI A;  2ZJ5 A;  3GQC A;  4NLG A;  3QU2 A;  2YY6 A;  4WBZ A;  3AU6 A;  3Q8L A;  3ETL A;  3QU7 A;  1XSL A;  1UHU A;  5AKK A;  4XRH A;  1QSY A;  3EPG A;  2YMM A;  4RT2 A;  9ICC A;  1S0M A;  1DGS A;  4U6P A;  3KFU F;  4P0P B;  4O67 A;  3IHQ B;  3OUY B;  3B9J A;  2YQE A;  1S8O A;  4F50 A;  3SV4 A;  3GIK A;  3TAD C;  3CYM A;  5DB9 A;  3N28 A;  4C8M A;  2VJ4 A;  2WF9 A;  2QB0 A;  1SV0 A;  1NK5 A;  5AI9 A;  2G5I B;  3ERC C;  2H3V A;  3KHR A;  5KFC A;  3H39 A;  3M9O B;  4FS2 A;  2FLP A;  5DB8 A;  5A0L A;  1SV4 A;  4ECR A;  1AQ6 A;  3PW5 A;  3MFI A;  5ALZ A;  4JV0 A;  1SKW A;  1TE2 A;  4X4R A;  1JRP A;  3PO5 A;  3WK5 A;  3AQK A;  4UAR A;  1ZQS A;  4B9L A;  3M6K A;  3C2L A;  1X9S A;  4FHW A;  4Y2Q A;  4QIW F;  3QYP A;  4DFK A;  4NLK A;  4QZC A;  3KHH A;  3UMB A;  5DB7 A;  4EYI B;  2ZH3 A;  3NVY A;  4QZI A;  1S97 A;  2WF5 A;  2G06 A;  2KHV A;  5GTI U;  3D6J A;  4F5N A;  1V97 A;  2F8L A;  4MKP A;  3SYZ A;  3OHA A;  2Y9U A;  3O0F A;  1C7Y A;  2KD1 A;  4F5R A;  5ALU A;  5DKW A;  2RP5 A;  1NKE A;  4K97 A;  4DFD A;  3Q8S B;  3ZDB A;  3RH5 A;  3SQI A;  8ICZ A;  5CWR A;  1RPL A;  1FIQ A;  3RB0 A;  2WF6 A;  3H7I A;  4F2R A;  2F77 X;  2ZH9 A;  1URJ A;  4I2F A;  3K1R B;  3DDH A;  2PFO A;  3RJI A;  1WWU A;  1N5X A;  3A0H U;  4O3S A;  3SMV A;  2HDO A;  3FAH A;  2CRX A;  2C2E A;  4CF4 A;  1JRO A;  5D61 A;  1SZP A;  2KJ5 A;  3D2Q A;  4P0Q A;  2BPG A;  3QEA Z;  4ELV A;  3JPP A;  5BOL A;  5J8Y C;  4UB3 A;  2FMQ A;  5EOZ A;  4MFF A;  5HML A;  3C23 A;  1RYS A;  4YR0 A;  3C2M A;  4FZL A;  1T8E A;  4RQN A;  2DQN B;  4UB8 U;  3L3F X;  2ODG A;  2W9C A;  1MN8 A;  2FDR A;  5KFS A;  3Q8M A;  1NJZ A;  2WB1 C;  4YMN A;  1TAM A;  3Q8K A;  3M9N B;  4F92 B;  4ED3 A;  7ICL A;  7ICJ A;  4QZ9 A;  5CB1 A;  1ZQY A;  3F5A A;  3WKE A;  2BQR A;  1MQ2 A;  3TAQ A;  4Z6E A;  4B9N A;  1K5O A;  3N7P D;  5ALL A;  1KSP A;  1L7P A;  3GZF A;  2BCV A;  4M0A A;  2KK0 A;  3OJU A;  5F3X B;  7ICK A;  2B6G A;  5JU5 A;  5HRG A;  3OTQ A;  1ZQU A;  3PSF A;  3GV5 B;  4M2Y A;  3QUQ A;  2W03 A;  1JN3 A;  3QUC A;  4RPZ A;  2W3R A;  9ICB A;  2E5S A;  3LQC B;  2IHO A;  3C1Y A;  3KHG A;  5AKY A;  2GLE A;  4DL3 A;  2UVV A;  4IQT A;  5AI8 A;  8ICQ A;  2HHW A;  4O3Q A;  5AM2 A;  2DPJ A;  4J9M A;  2DUY A;  3AQL A;  3CRX A;  2RDI A;  3C18 A;  3L9D A;  5EE3 A;  2KG5 A;  5J2D A;  3H3A A;  4J9S A;  4I2H A;  4I2B A;  3RB6 A;  4EEK A;  3M6Z A;  4TUQ A;  4YMM A;  2DPI A;  3KZI U;  3WK8 A;  4RQ0 A;  5KFF A;  1QQ6 A;  3PY8 A;  3CP8 A;  8ICX A;  1WUD A;  1B43 A;  5D49 A;  2P6R A;  2R8H A;  3UQ2 A;  1NK0 A;  4I2G A;  1B22 A;  3AM9 A;  8ICF A;  4UAU A;  1YLQ A;  3AEV A;  2V9W A;  2ZH6 A;  3V6J A;  3ISC A;  3IRU A;  4UAV A;  4C4R A;  1RXW A;  1SXD A;  2BDU A;  4KLL A;  4AT9 A;  2D8C A;  2UVR A;  2B21 A;  8ICI A;  1IXR A;  4AT8 B;  3C29 A;  1TK8 A;  2E1F A;  4CRX A;  2FMS A;  1DXS A;  5ALJ A;  2ZH5 A;  5D63 A;  2C22 A;  5AKI A;  3A0B U;  2XVT A;  2ZUC A;  5DBC A;  4XA5 A;  4RQ6 A;  4DQS A;  1NJY A;  4NWI A;  2F8K A;  3OV7 A;  1VFG A;  1IM4 A;  2FPL A;  4RQ5 A;  4O9M A;  4KX5 A;  4DSE A;  1RM6 C;  9ICP A;  2ID1 A;  1GO3 F;  2HHU A;  3AU2 A;  4CDG A;  5J0R A;  2KJ9 A;  2Q66 A;  4KLQ A;  3F2B A;  4BXO A;  2A19 A;  8ICP A;  3UXO A;  1QQ7 A;  2K8A A;  3J81 j;  3OPX A;  2VA8 A;  1D8B A;  2NRK A;  5F9L A;  4R66 A;  2W7O A;  3G6Y A;  3NVW A;  4WC4 A;  1L7M A;  1OW5 A;  4RQ4 A;  1KKX A;  1B4F A;  4RWO A;  5ALN A;  5HRE A;  4UAT A;  1S9F A;  4J9O A;  5HC9 A;  5J0S A;  1X9M A;  2ZJ8 A;  3C66 A;  5DBB A;  2EDU A;  1B0X A;  3E58 A;  4WC5 A;  4RNN A;  4Y2U A;  3SI8 A;  1U47 A;  2Z7J A;  4NXV A;  1RDF A;  2DL0 A;  3ZDA A;  4NJ8 A;  4X4V A;  4Q43 A;  4ED2 A;  5E79 U;  2AGO A;  3AQF A;  4WC0 A;  4Z6F A;  2IHM A;  1NK9 A;  1QTM A;  5KT5 A;  3CW2 C;  3C2K A;  2AXT U;  2F44 A;  4EEY A;  4K4H A;  2MA1 A;  4UAS A;  1ECW A;  2ZXH A;  3QU9 A;  5DED A;  5D46 A;  4K96 A;  2KMD A;  3F2D A;  3OSN A;  2KKV A;  3MBY A;  3D2N A;  3NKU A;  2Y0S F;  2JR5 A;  5BPC A;  3SZ2 A;  1S76 D;  2JRZ A;  3WKB A;  4RWP A;  1ZQH A;  4DQP A;  2HHX A;  2XC9 A;  3T3F A;  4DS4 A;  2F2A B;  2B0C A;  4KN7 A;  5H2F U;  1FFV A;  4EEB A;  2B4V A;  2EAM A;  3TKA A;  1ZQJ A;  2EQY A;  2W9A A;  1U45 A;  1ZQL A;  1ZQX A;  3N97 B;  1ZQE A;  1V38 A;  4IR9 A;  5J2C A;  2GAF D;  4WC3 A;  2HHQ A;  4RNM A;  2JH1 A;  3H4D A;  4NXW A;  3VCB A;  2VKQ A;  4F71 A;  3Q8R B;  1KQQ A;  2H3Z A;  1ZD4 A;  3NTU A;  5AKH A;  5CFS A;  4KIT B;  3UMC A;  4IQU A;  4PPX A;  2KIC A;  1A76 A;  2YB1 A;  2DKX A;  2R8I A;  1PK3 A;  2R8G A;  2ZIV B;  2K89 A;  4ELU A;  2PXI A;  2HBL A;  2ZJA A;  4HAI A;  3TFR A;  3OGU A;  4M5D A;  3SV3 A;  1J2M A;  4J9L A;  2LBO A;  2HW3 A;  1BPE A;  1F5S A;  2YMQ A;  4ECU A;  4DQI A;  4M6W A;  1OXJ A;  2XCP A;  4B6J A;  1VJ5 A;  1J97 A;  4QZ8 A;  7ICT A;  4BX9 C;  1Z3E B;  3RJE A;  5AKX A;  3M1Y A;  2M2T A;  5KFY A;  2H3Q A;  4I29 A;  1L3U A;  2EZY A;  3F2C A;  1MA7 A;  2ISP A;  3M9M B;  3RAX A;  4NLB A;  4NL9 C;  1NJW A;  4U7C A;  4RPX A;  3F5E A;  1T4G A;  8ICS A;  4B9V A;  8ICV A;  3IP4 B;  4KLG A;  4C80 A;  2OCE A;  1S0N A;  3OSP A;  5G5H A;  4QZF A;  1JMS A;  4DOB A;  1X9W A;  4JLX A;  1EXN A;  4ED0 A;  1ZQW A;  3IV6 A;  3MDA A;  2E8N A;  1UPH A;  1UT5 A;  2P35 A;  5ALE A;  4ATB B;  4RQM A;  2XO7 A;  4UW9 A;  5F9N A;  3PW7 A;  5KFN A;  3RJF A;  5DDY A;  3PR5 B;  1YZ7 A;  4CGZ A;  5HRK A;  4RQ7 A;  1FA0 A;  3ICX A;  4EX6 A;  3AQN A;  2FI1 A;  7ICI A;  5HR7 A;  4GXK A;  3RH4 A;  1LKY B;  4WC7 A;  2W9B A;  5CEH A;  5BOM A;  2MRL A;  2OM6 A;  1PVR A;  3H8J A;  4X0B A;  1NK6 A;  1ZQO A;  7ICQ A;  5J2H A;  9ICU A;  2OYY A;  3C5G A;  2XID A;  1FFU A;  1K1S A;  4DSL A;  4TQS A;  4PGY A;  2BR0 A;  3H8W A;  1S10 A;  2FLL A;  5ALX A;  2PMZ C;  3RJH A;  4J9N A;  2M0N A;  2W9M A;  5KFW A;  3KHL A;  4I28 A;  4PHE A;  1U9L A;  2EZX A;  2ZIX A;  4O3M A;  4Q8F A;  4M47 A;  4DSJ A;  4ECS A;  3FC4 A;  2HVI A;  2FJ6 A;  1LVH A;  5KG7 A;  1QH9 A;  3RAQ A;  1MIV A;  3KKA A;  3PW4 A;  4QZB A;  2E8P A;  2OWO A;  3EPI A;  4KLU A;  1R89 A;  5DQH A;  3ORY A;  2V4Q A;  4RZR A;  1TFR A;  8ICR A;  3RBE A;  3BQ7 A;  5KFJ A;  1NK8 A;  5AIC A;  3HKZ C;  1VLB A;  1JIH A;  1Z1B A;  4UD5 A;  2W8L A;  3OVS A;  2MUT B;  2IOH A;  4PL1 A;  3IN5 A;  5DLF A;  4DWI A;  2B56 A;  4KX3 A;  3BQT A;  3KBB A;  2IA6 A;  4RU9 A;  4YXM A;  5AK4 A;  1JAL A;  5DGA A;  7ICS A;  1ZD2 P;  4PZN A;  5AI4 A;  2G5H B;  4NXX A;  3M8R A;  3HJ1 A;  2I1Q A;  3UQ0 A;  2XGP A;  5DBA A;  1ZQT A;  2YTU A;  5AM0 A;  4ED1 A;  5K4L A;  4X4P A;  5HMM A;  2DR7 A;  5J0Y A;  5J2A A;  5HRD A;  3V6K A;  8ICB A;  4X4S A;  1CRX A;  1QQ5 A;  1L8L A;  4DL7 A;  2KSO B;  2HVH A;  4LEY A;  4KLI A;  5AKE A;  2HBK A;  4M9G A;  4E7X A;  4J9R A;  2K4P A;  3HIL A;  4IRD A;  2LPE A;  5ALP A;  5EE0 A;  4WOY A;  1BNP A;  2LM1 A;  1NKC A;  3OVA A;  4FO1 A;  4KLF A;  1TKD A;  2JEG A;  1N5W A;  4M9N A;  3GV7 B;  4OJO A;  2BZF A;  2ZIU A;  2ATL A;  1Q3V A;  2M2W A;  7ICF A;  3BS5 A;  5AI6 A;  3AN1 A;  1ZQP A;  3H8M A;  4YFK A;  3I76 A;  1SV0 C;  4KLT A;  9ICS A;  5F2V O;  3JPT A;  4O68 A;  3JPS A;  4EBJ A;  9ICV A;  1TFW A;  2QAR B;  3NVZ A;  2ZIW A;  1SGG A;  4FH3 A;  4X0A A;  2HHV A;  1ZQR A;  3LWL A;  2HBM A;  4TUP A;  4OJ6 A;  4O5K A;  3T5K A;  1U4B A;  3V7K A;  1QSS A;  3FYH A;  5T14 A;  4JV1 A;  2DVI A;  4K9A A;  4QZG A;  2ZG6 A;  7ICP A;  4AP9 A;  4I2E A;  5C5J A;  4NLC A;  1Q79 A;  1HIW A;  4IRK A;  4QZA A;  1M6Y A;  1NK4 A;  5DGB A;  2YML A;  5J0X A;  5G5G A;  4O3R A;  2PI4 A;  1JAJ A;  1SL2 A;  2ZH2 A;  5KL1 B;  7ICV A;  4F3O A;  7ICH A;  5AK6 A;  2KEY A;  2XGQ A;  8ICW A;  4AT7 B;  5IIJ A;  5KT2 A;  1BPY A;  4IRC A;  5KG4 A;  2XIC A;  3M7D A;  3GIM A;  2CPR A;  1A0P A;  4F91 B;  3QUT A;  2PFN A;  3C5F A;  4RQ1 A;  3NVO A;  4QNL A;  1L8O A;  2P6U A;  2ESE A;  4OAG A;  3WFO A;  2F1H A;  2ZXI A;  3MAB A;  2HI0 A;  3HJ4 A;  3WFQ E;  1BPX A;  2KOB A;  7ICG A;  4BWJ A;  1SIJ A;  4QWC A;  1ZXI A;  2KIW A;  2BPC A;  3NRW A;  3Q8P B;  2YX8 A;  4NM1 A;  4FHV A;  3RR7 A;  2HMX A;  4XQ8 A;  4DSF A;  1R8A A;  4X4N A;  3QX7 A;  1XNS A;  4Y2R A;  1COO A;  1BGX T;  3ETR A;  4Y2S A;  3ZDC A;  2O5A A;  2BGW A;  3WFR E;  4KMO B;  4Q44 A;  3PNC A;  4DCC A;  2F1J A;  4MF2 A;  4ED8 A;  4UB2 A;  3WKC A;  4EBD A;  2JEJ A;  5KG6 A;  4C8K A;  3K7D A;  2DRA A;  7ICE A;  4DLE A;  3KD3 A;  5KFI A;  2VA2 A;  3MGH A;  2UVU A;  3HX0 A;  5HRF A;  5B3P A;  2XY5 A;  2AHO B;  1ZQG A;  2DRB A;  4DL6 A;  2GH1 A;  4KLH A;  2JXJ A;  5KFK A;  1P7D A;  4FBT A;  1YZ6 A;  3BS7 A;  5DDM A;  1KTQ A;  3BDP A;  5L1M A;  2JV3 A;  2PI5 A;  5HP4 A;  1DK2 A;  1PVQ A;  4S3N A;  4JWM A;  1ZOL A;  1TVA A;  3PW0 A;  4EZ9 A;  4R8U A;  1MC8 A;  5KL8 B;  1V4A A;  3NVV A;  2LI6 A;  4QZE A;  1Z00 B;  1HEK A;  4IL6 U;  3T5L A;  3RFA A;  1LV5 A;  4M9H A;  4RUC A;  4XQ7 A;  2PBE A;  2ISO A;  9ICM A;  3LWM A;  3JPN A;  2OEH A;  5AM4 A;  3RB4 A;  1HUZ A;  2BCS A;  4QIW C;  4IQV A;  5KFX A;  2ZUD A;  4JLZ A;  1N60 A;  4ATB A;  2NYV A;  1YT3 A;  4R63 A;  5HR6 A;  8ICY A;  1RXV A;  1UET A;  1T3Q A;  9ICA A;  5ALW A;  9ICN A;  3H0R B;  3PML A;  5KFB A;  8ICJ A;  5ALR A;  3WFS C;  1IIP A;  4KLJ A;  2M2V A;  2NO5 A;  5KNI A;  2C2D A;  1NO5 A;  4NKT A;  3C28 A;  2HHS A;  2A1J B;  3NRZ A;  1SL0 A;  9ICF A;  1GPJ A;  4DFM A;  1FEZ A;  3F53 A;  3GIL A;  5AKL A;  4NLN A;  2GO7 A;  5L9X A;  3PVX A;  5KFG A;  1T7P A;  2B51 A;  4IG8 A;  1XC9 A;  2O6K A;  3PST A;  2J6S A;  3H40 A;  1RQL A;  2F3N A;  4I2I A;  5ALM A;  5AI5 A;  5ALO A;  4OJP A;  3S6J A;  3IG8 A;  4LVS A;  3K75 D;  5EWF A;  5J0W A;  1Q3U A;  2IMW P;  3PX0 A;  3MR3 A;  2V4R A;  4E8F A;  2RLT A;  4Q8E A;  2QB0 B;  9ICJ A;  1CI4 A;  2OXO A;  5AK5 A;  3DV9 A;  4WBY A;  2KHQ A;  4X4Q A;  4KM5 A;  2K8B B;  3RF9 A;  5KT4 A;  2HCF A;  2JZB B;  1V9P A;  5KG2 A;  2OHF A;  5ALY A;  5KFP A;  2W55 A;  4UBB A;  4F5P A;  3ZDE A;  2DF4 B;  4DL5 A;  4F4X A;  4RPY A;  4G9B A;  5AIB A;  1CEZ A;  9ICQ A;  5KFE A;  4ECZ A;  3QE9 Y;  1OU5 A;  8ICE A;  4P0P A;  3UXN A;  2BCU A;  3OUY A;  1WG8 A;  2BQ3 A;  2WHE A;  4RT3 A;  1PK1 B;  4RNO A;  1F0M A;  3JPR A;  2F1I A;  4Y2J A;  4GLX A;  1L3S A;  2LYH A;  2KZ3 A;  4J9P A;  4DF8 A;  4Y2Y A;  4FHX A;  3IG5 A;  1N61 A;  4F4Y A;  2AH5 A;  1X6I A;  4I27 A;  3H4B A;  2QB1 A;  3RJK A;  1BPZ A;  1QLN A;  3I28 A;  4G3I A;  3TAC B;  2MSN A;  4NY8 A;  3K4G A;  4UAW A;  2FPM A;  3BZK A;  5ALV A;  3LYS A;  4F4W A;  1KBU A;  5HRB A;  4Z6D A;  4Q45 A;  2KTQ A;  3V72 A;  2D3D A;  1Z4O A;  2Y1I A;  2KE7 A;  1PX5 A;  2LYB A;  2BCQ A;  1X2I A;  1SWW A;  3T5J A;  1MQ3 A;  4OAH A;  4N7R A;  1UA1 A;  2Q0Z X;  2QAR A;  2WTF A;  1KL9 A;  4C8L A;  2JH7 A;  1A6S A;  5TIS U;  2AQ0 A;  4AYB F;  1F44 A;  9ICT A;  4RUA A;  4FBU A;  1RYU A;  5DG7 A;  3L5K A;  3QUB A;  2PKE A;  2YMP A;  3PMN A;  4UB5 A;  4P0Q B;  3U26 A;  4IS7 A;  1O03 A;  1XS9 D;  3RTV A;  3N4M B;  1ZET A;  1U48 A;  3PO4 A;  2EWR A;  2BPF A;  1N62 A;  2LMR A;  2G07 A;  1D9F A;  3GDX A;  1ZQB A;  3QXG A;  1ZQC A;  1TAQ A;  4PHP A;  2W9C B;  4P4P A;  4US8 A;  3D2S A;  3RBD A;  1T3N A;  4KLO A;  4ED7 A;  2KZM A;  4OJ5 A;  1MIW A;  1R8B A;  3QEB Z;  4J9K A;  5HNK A;  2VA3 A;  1BPD A;  2VAN A;  2MAX A;  2HHP A;  2YB4 A;  5L1J A;  8ICH A;  5KG5 A;  4FH5 A;  4DEZ A;  1N56 A;  3JPO A;  5AM5 A;  2HOI A;  5DG8 A;  7ICU A;  4PL2 A;  3QZ7 A;  2XCA A;  4IQW A;  3HT3 A;  3M8S A;  4JMU A;  2K4E A;  4YR2 A;  3SAG A;  2FCL A;  4I0U A;  5KFT A;  1HJP A;  1SZH A;  4KLE A;  1ZQD A;  2RRD A;  4BDP A;  4PHD A;  3TAN A;  4LZG A;  4EP7 A;  4BGD A;  4B9T A;  3GV8 B;  1KRP A;  3LVV A;  4O5C A;  3BJY A;  2LYA A;  3H37 A;  3N7R C;  1WWV A;  4NKU A;  5J2J A;  4FZN A;  2RFF A;  4EED A;  3WU2 U;  3NS1 A;  4ECX A;  1KFD A;  4GXJ A;  5KT7 A;  3ZD8 A;  1XWL A;  5AKZ A;  2ASD A;  1KEJ A;  3HW8 A;  4JB3 A;  2BKE A;  4WCW A;  4ECV A;  2XI9 A;  1QSL A;  3TAR A;  2AJQ A;  5EE9 A;  3T5H A;  4LEV A;  9ICR A;  2WF8 A;  5DLG A;  4K9B A;  5HRI A;  4F5O A;  2JGA A;  9ICH A;  1BPB A;  2Y1J A;  3H0M B;  4KLM A;  8ICC A;  3WK9 A;  2XY6 A;  4QWE A;  8ICO A;  8ICM A;  4QWA A;  2IHN A;  4DLG A;  1Q46 A;  5D4B A;  5ALD A;  4O0I A;  3ISD A;  3EZ5 A;  1XSN A;  4FHY A;  2ZH8 A;  4LEZ A;  1XO0 A;  4FFD A;  4DQQ A;  4AT9 B;  1ZQ1 C;  5J2G A;  2ZH4 A;  2I6X A;  2W11 A;  4Y2V A;  1ZJN A;  3PV8 A;  5JRT A;  1T94 A;  2LKY A;  4UAY A;  5HR9 A;  1ARO P;  1K1Q A;  2BBJ A;  1Z19 A;  1Z00 A;  5KT3 A;  3VC8 A;  4C7Y A;  2ASL A;  5KFA A;  3GU3 A;  2G08 A;  2WAQ C;  3FDS A;  5C0Y A;  3V7L A;  2O1P A;  2XY7 A;  3MC1 A;  4OD0 A;  4Y2X A;  2Y0S C;  5ALS A;  5J0O A;  3CK6 A;  2C2R A;  1KNY A;  4EBE A;  4DS5 A;  5CHE A;  3SAF A;  5AKJ A;  2GWS A;  3AL0 B;  1WCL A;  1KLN A;  2WB1 F;  3NWI A;  2KVC A;  4DL4 A;  5J0P A;  1BNO A;  1IV8 A;  3KKA C;  3HWT A;  4EX7 A;  1O08 A;  2K60 A;  1UQV A;  4MEY A;  2CXY A;  1JQR A;  3WK4 A;  1RG6 A;  2M9N A;  5AM3 A;  1PUZ A;  4CF5 A;  4OJL A;  2QLT A;  4JUZ A;  2FLN A;  4DQR A;  4AT8 A;  1NI3 A;  4I2J A;  4BXO B;  3SAH A;  4GC7 A;  7ICR A;  2ZTC A;  3ALR A;  4PGX A;  5KFQ A;  3ONN A;  1D9D A;  7ICM A;  4PJ0 U;  3SR6 A;  3TAD A;  4I2A A;  4F8R A;  2FE9 A;  4TUS A;  3MGV A;  5AM1 A;  1ZQV A;  3EWA A;  1N48 A;  5KG3 A;  1JXL A;  3OVB A;  1J2N A;  1Q78 A;  3B0X A;  2DGZ A;  4OAF A;  3EUB 2;  4EEN A;  3GIJ A;  2DFL A;  2RHF A;  4M04 A;  1QCK A;  4DSK A;  4Y2P A;  8ICG A;  4YMO A;  2KKP A;  3IDW A;  5III A;  4CE6 A;  2DR8 A;  2AQ4 A;  5KG0 A;  2KNJ A;  4LEW A;  2EAN A;  2DR9 A;  2JZB A;  3RRH A;  5KFH A;  2BE3 A;  4C0Z A;  4RWQ A;  2EZZ A;  5KG1 A;  4P4O A;  3OWG A;  5AK3 A;  2KN7 A;  3MFH A;  4DO9 A;  4KMU A;  1TFY A;  1KN5 A;  2NO4 A;  3V6H A;  4O6A A;  2G09 A;  5CFU A;  4YCX A;  4WC6 A;  9ICX A;  1Z4N A;  5J0Q A;  4F72 A;  1ZJM A;  4MFA A;  1N2X A;  1UCV A;  1PK1 A;  5CA7 A;  4YQW A;  3NUQ A;  5ALG A;  4LT6 A;  3JZ0 A;  4ACO A;  4RQ8 A;  3HJE A;  2L5Y A;  3AUO A;  1L3V A;  3WK7 A;  4YD1 A;  1F5A A;  2ALZ A;  4UQG A;  4GFJ A;  4YXJ A;  5KFL A;  3PR4 A;  2AU0 A;  1ZRM A;  4UB1 A;  2OH2 A;  5ALH A;  2W04 A;  2JMG A;  2R8J A;  2DKZ A;  5J29 A;  3TI0 A;  2IUB A;  4WC1 A;  4KN4 A;  4B9M A;  4ICA A;  2IOF A;  2HHT A;  4GIB A;  5IIK A;  4RQ3 A;  5J8Y A;  4QZD A;  1UEV A;  5CRX A;  9ICW A;  1WYG A;  1U49 A;  2Y9T A;  4F5Q A;  5J0U A;  4E0D A;  2YN4 A;  5AI0 A;  1IG6 A;  5KT6 A;  4NXU A;  4QJF B;  1UEU A;  1DRG A;  2LHT A;  5AIA A;  4PGQ A;  4LZD A;  1KFS A;  4DSI A;  2ZHB A;  4M6W B;  3RH6 A;  7ICO A;  4DFJ A;  4EYH B;  4FS1 A;  4F2S A;  2I5H A;  5J2B A;  4P2H A;  2UVW A;  3UM9 A;  3LK9 A;  2NRW A;  4QW8 A;  3RRG A;  2GOL A;  4Y2T A;  4I2D A;  3L4P A;  5HHH A;  5KAI U;  3NGD A;  2N1R A;  4O3P A;  2H5X A;  4K99 A;  5ALF A;  1DK3 A;  2ZIV A;  4C4T A;  1D8L A;  1ZQI A;  8ICT A;  1XSP A;  1XU4 A;  2VIX A;  2KZZ A;  3TAP A;  5HHI A;  5KFV A;  1SKR A;  1NK7 A;  9ICL A;  1Z1V A;  4YP3 A;  1CUK A;  2QKQ A;  4EZ6 A;  5EWE A;  2HBJ A;  1ZQM A;  4HX0 A;  2G0A A;  5J2E A;  2P66 A;  2NRX A;  1SKS A;  1RQN A;  8ICA A;  1ZYQ A;  2W9B B;  3RR8 A;  4QWD A;  3AQM A;  3HP6 A;  1UA0 A;  4US9 A;  1S77 D;  4KB6 A;  4MF8 A;  3AMZ A;  4ECT A;  2W54 A;  5CHG A;  5CFT A;  1PZN A;  4DF4 A;  1C20 A;  2A3V A;  3C21 A;  2CN1 A;  2LM4 A;  5DEC A;  3UXP A;  2HOF A;  4BWM A;  4RQ2 A;  4PH5 A;  3PW2 A;  2NV3 A;  2ZIX B;  5HRH A;  2W3S A;  1L6N A;  2NRV A;  4O3O A;  2BBH A;  4ELT A;  4E80 A;  4DFP A;  1S0V A;  4F4K A;  3JYY A;  2MU2 A;  2Q4T A;  2D6F C;  3BZC A;  4QZH A;  3MGI A;  3GII A;  1KFT A;  1L3T A;  4C4S A;  3NYB A;  4O5E A;  2A1A A;  3QZ8 A;  1LKY A;  3I1Y A;  4R65 A;  4K4G A;  1KDH A;  3EYZ A;  5KFO A;  3ZD9 A;  2ZUB A;  5AHX A;  1VDV A;  2NRT A;  4WJ3 B;  3TQ1 A;  4J9Q A;  2BDP A;  4X4T A;  5FP0 A;  1SXE A;  8ICU A;  3IM1 A;  2DWQ A;  4UB4 A;  5GTH U;  1ZQF A;  3RB3 A;  1NZB A;  4K4I A;  5ALQ A;  4HYK A;  4LJX A;  1KW4 A;  4JWN A;  2E8O A;  3C1Z A;  4O69 A;  1SL1 A;  4WQK A;  4DOC A;  3QNM A;  2KJ8 A;  5TZV A;  2E3T A;  2H3F A;  4YR3 A;  5ALK A;  4XUS A;  4ECW A;  3NAS A;  1SB3 C;  3THV A;  9ICI A;  2RQ5 A;  3GFK B;  3HRD D;  5IIO A;  2W8K A;  3G6X A;  3UMG A;  5DQG A;  2AGP A;  5KFZ A;  2ZH1 A;  3KZX A;  9ICE A;  1NZP A;  1X40 A;  4FZM A;  5IIM A;  1TAU A;  3HIY A;  2M2U A;  2HOQ A;  2EH9 A;  4NXZ A;  3BQ1 A;  3HPO A;  2MUT A;  5J2F A;  1HUO A;  2KIV A;  3H38 A;  1L7N A;  4F4Z A;  2ZIU B;  2PFP A;  3BS5 B;  2ZTD A;  1MIY A;  2ASJ A;  4X4O A;  1N63 A;  3B0Y A;  1ZQQ A;  5JUM A;  3ER8 C;  2JEF A;  1UT8 A;  1WCN A;  1X9X A;  2ZIW B;  3MDC A;  4FHP A;  3PX6 A;  4PZO A;  9ICK A;  4YVZ A;  2KSO A;  3LDA A;  2W43 A;  4BUG A;  3E2E A;  5KTQ A;  8ICN A;  3BQ2 A;  5KFD A;  4Z6C A;  4MHV A;  4M9L A;  5ALT A;  4O3N A;  1XO1 A;  3ER9 B;  4RWN A;  1MSW D;  1Q8K A;  4B9U A;  4KLS A;  5EWG A;  4TUR A;  1H38 A;  1NKB A;  2K8C B;  4ED6 A;  1JXE A;  4EBC A;  2VJ5 A;  2PMZ F;  2J6U A;  1JUD A;  3WKD A;  3ZI4 A;  2IBK A;  4YG2 A;  1ZD5 A;  4C7Z A;  3SEN A;  5IIN A;  3RJJ A;  2KFZ A;  2ES6 A;  5L1K A;  5B3Q A;  1S0O A;  4X4U A;  3JCF A;  3EW9 A;  5CJ7 A;  3RJG A;  2E1E A;  1COK A;  3N7S C;  3PSP A;  3PSI A;  1ZRN A;  4JK1 A;  2WAQ F;  4ECY A;  1ZD3 A;  2W7P A;  1X66 A;  5KAF U;  3MR5 A;  2I9G A;  4MFC A;  1OUQ A;  2R18 A;  4NLZ A;  4OO1 J;  3EF2 A;  4EV6 A;  1JI7 A;  2EAP A;  1S5L U;  4F93 B;  1TK0 A;  3HKZ F;  3Q8Q B;  5B66 U;  8ICL A;  4WH5 A;  3MR2 A;  5HRL A;  3QU5 A;  2DR5 A;  2BCR A;  3ED5 A;  3PZP A;  1R8C A;  4WC2 A;  5AKG A;  1NJX A;  5J0T A;  5JTI A;  4A8E A;  5CP2 A;  3E0F A;  4AT7 A;  5L1L A;  5D62 A;  1ZQK A;  4B9S A;  1D8Y A;  4NM2 A;  4YD2 A;  4GC6 A;  5B5E U;  3MR6 A;  4UD4 A;  4OAI Z;  1ZQN A;  5KFR A;  2KP7 A;  4XJE A;  4QWB A;  2JEI A;  5JTG A;  1LB2 B;  4EGW A;  4TQR A;  4J03 A;  1ZQZ A;  4FE3 A;  5KFU A;  2H3I A;  1FO4 A;  2IOF K;  1L5U A;  4K98 A;  4UBC A;  3WK6 A;  2HSZ A;  4X5V A;  2GA9 D;  1BVS A;  3PHZ A;  4ZH4 A;  5L1I A;  2NRZ A;  4UB6 U;  4ZOH C;  8ICK A;  3ISB A;  4R64 A;  2K4I A;  2FPK A;  1PVP A;  3OHB A;  3T79 A;  4NL9 A;  2E8M A;  5IIL A;  5EE1 A;  2ZTE A;  5DB6 A;  2HN2 A;  5DQI A;  4EBK A;  2WF7 A;  3K1Z A;  3G6V A;  1JX4 A;  3UPQ A;  3QU4 A;  4IR1 A;  4I2C A;  3OJS A;  1X42 A;  3BQ0 A;  4NV0 A;  1NOM A;  3JPQ A;  3CNH A;  4R8U B;  3LVW A;  3DEE A;  9ICG A;  3UPS A;  3FM9 A;  5J2K A;  3AQE A;  1DOQ A;  3H0L B;  1TK5 A;  4CF3 A;  1V85 A;  4QW9 A;  2WFA A;  3SEI A;  1WOT A;  5ALI A;  9ICO A;  2KFN A;  1TV9 A;  1X6J A; 
#chains in the Genus database with same CATH homology
 1A77 A;  4EEY A;  4YN4 A;  1Z00 B;  5J0Q A;  2AGQ A;  4K4H A;  1ZJM A;  4UAZ A;  4MFA A;  3T5L A;  3H8S A;  5KFM A;  1LV5 A;  4M9H A;  4RUC A;  5DED A;  4XQ7 A;  4CCH A;  2PBE A;  2ISO A;  9ICM A;  5D46 A;  5CA7 A;  3LWM A;  3JPN A;  3RB4 A;  3OSN A;  1HUZ A;  1ZQA A;  3WFP A;  4YQW A;  3MBY A;  2BCS A;  4LT6 A;  2R8K A;  3JZ0 A;  4C8O A;  4RQ8 A;  5BPC A;  4IQV A;  5KFX A;  3SZ2 A;  2ZUD A;  3AUO A;  1L3V A;  1S76 D;  4C8N A;  4ATB A;  4R63 A;  5CR0 A;  4YD1 A;  2BHN A;  4FO6 A;  1ZQH A;  4DQP A;  2HHX A;  2ALZ A;  4KTQ A;  8ICY A;  3TFS A;  1F5A A;  2XC9 A;  3T3F A;  1RXV A;  1UET A;  4DS4 A;  1Y88 A;  9ICA A;  4UQG A;  4ECQ A;  9ICN A;  4YXJ A;  2AU0 A;  4KN7 A;  5KFL A;  3PML A;  3PR4 A;  2C28 A;  5KFB A;  8ICJ A;  1VJ7 A;  3WFS C;  4UB1 A;  7ICN A;  2RDJ A;  4KLJ A;  1RZT A;  1ZQJ A;  2M2V A;  2C2D A;  2R8J A;  2W9A A;  1U45 A;  1NO5 A;  5J29 A;  4NKT A;  3TI0 A;  4WC1 A;  2HHS A;  2A1J B;  1ZQL A;  4KN4 A;  4PHA A;  2ZH7 A;  1ZQX A;  3N97 B;  3V7J A;  1SL0 A;  1ZQE A;  9ICF A;  4B9M A;  2ZH3 A;  4IR9 A;  4DOA A;  4DFM A;  5J2C A;  3GIL A;  2HHT A;  5IIK A;  4RQ3 A;  4NLN A;  1UEV A;  4QZD A;  4WC3 A;  5DG9 A;  4JV2 A;  4MEX A;  2J6T A;  2HHQ A;  9ICW A;  5L9X A;  4RNM A;  1U49 A;  4P4M A;  1RYR A;  4F5Q A;  3H4D A;  5J0U A;  3PVX A;  3Q8R B;  5J2I A;  4E0D A;  5KFG A;  1T7P A;  3NTU A;  4DL2 A;  2ZHA A;  4KIT B;  3PX4 A;  5KT6 A;  3KTQ A;  4IG8 A;  1XC9 A;  4KLD A;  3ZDD A;  1UEU A;  2J6S A;  3H40 A;  2A1J A;  4IQU A;  4PPX A;  2BQU A;  1A76 A;  2R8I A;  4I2I A;  4M9J A;  4PGQ A;  4LZD A;  1KFS A;  2R8G A;  4LVS A;  3K75 D;  2FMP A;  5EWF A;  2PFQ A;  4DSI A;  2ZHB A;  4M6W B;  5J0W A;  3RH6 A;  7ICO A;  4DFJ A;  4GXI A;  4EYH B;  4FS1 A;  4ELU A;  2ZJ5 A;  3GQC A;  4F2S A;  4NLG A;  5J2B A;  4P2H A;  2UVW A;  4WBZ A;  3AU6 A;  2PXI A;  3Q8L A;  2IMW P;  3PX0 A;  3ETL A;  2ZJA A;  3LK9 A;  2NRW A;  4QW8 A;  3OGU A;  3MR3 A;  3TFR A;  1XSL A;  3RRG A;  2V4R A;  3SV3 A;  4M5D A;  4E8F A;  4XRH A;  4Q8E A;  4J9L A;  1QSY A;  3EPG A;  2HW3 A;  4I2D A;  4RT2 A;  9ICJ A;  9ICC A;  5HHH A;  1S0M A;  1DGS A;  4WBY A;  3NGD A;  1BPE A;  4O3P A;  4ECU A;  4X4Q A;  2DR7 A;  3IHQ B;  2H5X A;  4DQI A;  5KT4 A;  3OUY B;  4M6W A;  2JZB B;  2XCP A;  1V9P A;  5KG2 A;  1DK3 A;  4QZ8 A;  1D8L A;  5KFP A;  1ZQI A;  7ICT A;  4UBB A;  8ICT A;  1Z3E B;  1XSP A;  4F5P A;  3ZDE A;  3RJE A;  1XU4 A;  2KZZ A;  4F50 A;  3SV4 A;  3TAP A;  5HHI A;  5KFV A;  3GIK A;  1SKR A;  5DB9 A;  4DL5 A;  1NK7 A;  4C8M A;  4F4X A;  9ICL A;  2M2T A;  5KFY A;  4RPY A;  4I29 A;  1L3U A;  1CEZ A;  2ISP A;  9ICQ A;  5KFE A;  4YP3 A;  4ECZ A;  3QE9 Y;  1CUK A;  1OU5 A;  8ICE A;  1NK5 A;  3M9M B;  4EZ6 A;  3RAX A;  5EWE A;  3UXN A;  3KHR A;  1NJW A;  2BCU A;  5KFC A;  3OUY A;  1ZQM A;  3M9O B;  4FS2 A;  2FLP A;  5DB8 A;  3H39 A;  4RPX A;  4ECR A;  2BQ3 A;  1T4G A;  4RT3 A;  5J2E A;  3PW5 A;  8ICS A;  4B9V A;  2P66 A;  8ICV A;  3MFI A;  4JV0 A;  1SKW A;  4KLG A;  4RNO A;  4X4R A;  3JPR A;  3PO5 A;  2NRX A;  1SKS A;  3AQK A;  8ICA A;  1S0N A;  1ZQS A;  3OSP A;  1ZYQ A;  4B9L A;  2W9B B;  4QZF A;  3C2L A;  3RR8 A;  2F1I A;  4QWD A;  1X9S A;  1JMS A;  4DOB A;  3AQM A;  4FHW A;  1X9W A;  4QZE A;  3HP6 A;  4GLX A;  1EXN A;  4ED0 A;  1UA0 A;  1L3S A;  2LYH A;  1ZQW A;  2KZ3 A;  3MDA A;  4J9P A;  4DFK A;  4DF8 A;  1S77 D;  4FHX A;  4ATB B;  1UT5 A;  4NLK A;  4MF8 A;  4QZC A;  3KHH A;  2XO7 A;  4ECT A;  5F9N A;  5DB7 A;  4EYI B;  5KFN A;  4F4Y A;  3PW7 A;  5DDY A;  3RJF A;  5CHG A;  3PR5 B;  4QZI A;  1S97 A;  1PZN A;  4DF4 A;  4I27 A;  5HRK A;  3H4B A;  3C21 A;  3RJK A;  1BPZ A;  4RQ7 A;  1FA0 A;  1QLN A;  4F5N A;  4G3I A;  3AQN A;  5DEC A;  7ICI A;  3UXP A;  3SYZ A;  4GXK A;  4NY8 A;  8ICP A;  3K4G A;  4UAW A;  3OHA A;  2W9B A;  3RH4 A;  4WC7 A;  2FPM A;  4BWM A;  4RQ2 A;  5BOM A;  4PH5 A;  3PW2 A;  3H8J A;  4X0B A;  4F4W A;  5HRB A;  1NK6 A;  1ZQO A;  1C7Y A;  4Z6D A;  7ICQ A;  4Q45 A;  4F5R A;  2NRV A;  2KTQ A;  3V72 A;  5J2H A;  9ICU A;  4O3O A;  5DKW A;  2Y1I A;  1PX5 A;  3C5G A;  4ELT A;  1NKE A;  4E80 A;  1K1S A;  2BCQ A;  4TQS A;  1X2I A;  4DFP A;  3T5J A;  4DSL A;  3Q8S B;  1MQ3 A;  3ZDB A;  4PGY A;  1S0V A;  4F4K A;  1UA1 A;  3JYY A;  2BR0 A;  2Q0Z X;  3RH5 A;  8ICZ A;  3H8W A;  4QZH A;  2WTF A;  3MGI A;  1S10 A;  4C8L A;  5CWR A;  1RPL A;  3GII A;  1KFT A;  1L3T A;  3RB0 A;  3NYB A;  2AQ0 A;  9ICT A;  4O5E A;  3H7I A;  2FLL A;  4RUA A;  3QZ8 A;  4F2R A;  4R65 A;  3RJH A;  1KDH A;  4FBU A;  4K4G A;  4J9N A;  5DG7 A;  2ZH9 A;  2W9M A;  5KFO A;  5KFW A;  3EYZ A;  3KHL A;  4I2F A;  4I28 A;  4PHE A;  1U9L A;  3PMN A;  3ZD9 A;  4UB5 A;  2ZUB A;  2PFO A;  3RJI A;  1XS9 D;  4M47 A;  4Q8F A;  4DSJ A;  2NRT A;  4ECS A;  3TQ1 A;  2HVI A;  4J9Q A;  3RTV A;  3N4M B;  2BDP A;  4X4T A;  1ZET A;  8ICU A;  3IM1 A;  5KG7 A;  3RAQ A;  1U48 A;  3PO4 A;  1MIV A;  2BPF A;  1D9F A;  3PW4 A;  4QZB A;  4UB4 A;  4O3S A;  2OWO A;  3GDX A;  3EPI A;  1ZQB A;  1ZQF A;  4KLU A;  1R89 A;  5DQH A;  3RB3 A;  3ORY A;  2V4Q A;  4K4I A;  1ZQC A;  4HYK A;  2C2E A;  1TAQ A;  4PHP A;  2W9C B;  1SZP A;  4JWN A;  4P4P A;  4RZR A;  3C1Z A;  1TFR A;  3RBD A;  1T3N A;  4KLO A;  4ED7 A;  2KZM A;  1MIW A;  1R8B A;  8ICR A;  3RBE A;  5KFJ A;  1NK8 A;  3QEB Z;  2BPG A;  3QEA Z;  4J9K A;  4ELV A;  1JIH A;  5HNK A;  3JPP A;  1SL1 A;  4DOC A;  5BOL A;  4UD5 A;  2W8L A;  2VA3 A;  1BPD A;  2VAN A;  5TZV A;  2MAX A;  4UB3 A;  4YR3 A;  3OVS A;  2MUT B;  2FMQ A;  4XUS A;  5DLF A;  5EOZ A;  2HHP A;  4ECW A;  4DWI A;  4MFF A;  5HML A;  2IA6 A;  3BQT A;  3C23 A;  5L1J A;  3THV A;  1RYS A;  4YR0 A;  8ICH A;  4RU9 A;  3GFK B;  4YXM A;  3C2M A;  5KG5 A;  9ICI A;  5IIO A;  2W8K A;  3G6X A;  1T8E A;  4FH5 A;  5DGA A;  7ICS A;  2W9C A;  5DQG A;  2AGP A;  5KFZ A;  2ZH1 A;  4DEZ A;  5HRH A;  1N56 A;  9ICE A;  3JPO A;  5KFS A;  3Q8M A;  1NJZ A;  5DG8 A;  3M8R A;  1NZP A;  3HJ1 A;  2I1Q A;  7ICU A;  3UQ0 A;  4YMN A;  3QZ7 A;  2XGP A;  5DBA A;  2XCA A;  5IIM A;  3Q8K A;  1ZQT A;  4IQW A;  3M9N B;  1TAU A;  4F92 B;  2M2U A;  3HIY A;  4NXZ A;  3HT3 A;  3M8S A;  4ED1 A;  4X4P A;  4YR2 A;  3BQ1 A;  5HMM A;  3HPO A;  5J0Y A;  2MUT A;  5J2A A;  4ED3 A;  7ICJ A;  7ICL A;  5KFT A;  4QZ9 A;  5CB1 A;  5J2F A;  1HUO A;  5HRD A;  1HJP A;  4KLE A;  3V6K A;  1ZQD A;  8ICB A;  1ZQY A;  4F4Z A;  3H38 A;  4X4S A;  4BDP A;  4DL7 A;  4PHD A;  2HVH A;  3TAN A;  4LZG A;  4EP7 A;  4KLI A;  4BGD A;  2PFP A;  2BQR A;  4B9T A;  1MQ2 A;  2ZTD A;  3TAQ A;  1MIY A;  4Z6E A;  3GV8 B;  2ASJ A;  4J9R A;  1KRP A;  4B9N A;  4IRD A;  4M9G A;  4E7X A;  1KSP A;  4O5C A;  4X4O A;  3BJY A;  3B0Y A;  1ZQQ A;  5JUM A;  2BCV A;  4M0A A;  3H37 A;  4NKU A;  3OJU A;  5J2J A;  2JEF A;  1BNP A;  2RFF A;  3OVA A;  1NKC A;  1UT8 A;  4ECX A;  1KFD A;  4GXJ A;  7ICK A;  5HRG A;  5KT7 A;  3ZD8 A;  1XWL A;  2ASD A;  1WCN A;  1KEJ A;  4KLF A;  1ZQU A;  3MDC A;  1TKD A;  3HW8 A;  2JEG A;  4M9N A;  3PX6 A;  3GV7 B;  9ICK A;  4FHP A;  4YVZ A;  3GV5 B;  2ATL A;  4M2Y A;  3LDA A;  2BKE A;  1JN3 A;  4WCW A;  2M2W A;  4ECV A;  1QSL A;  7ICF A;  4RPZ A;  3E2E A;  9ICB A;  3LQC B;  5KTQ A;  1ZQP A;  3C1Y A;  3KHG A;  4YFK A;  3TAR A;  4DL3 A;  2AJQ A;  8ICN A;  2UVV A;  4IQT A;  3BQ2 A;  4KLT A;  9ICS A;  3T5H A;  5KFD A;  4Z6C A;  8ICQ A;  9ICR A;  5DLG A;  3JPT A;  4M9L A;  5F2V O;  5HRI A;  4F5O A;  4O3N A;  1XO1 A;  2HHW A;  3JPS A;  1BPB A;  9ICH A;  4EBJ A;  9ICV A;  4O3Q A;  2Y1J A;  4RWN A;  1MSW D;  2DPJ A;  1TFW A;  4B9U A;  4FH3 A;  4X0A A;  4KLM A;  4J9M A;  2HHV A;  8ICC A;  1ZQR A;  5EWG A;  4TUR A;  4KLS A;  1H38 A;  1NKB A;  4ED6 A;  3LWL A;  4TUP A;  1JXE A;  3OVB A;  3AQL A;  2RDI A;  4EBC A;  4O5K A;  3T5K A;  2J6U A;  3C18 A;  2XY6 A;  1U4B A;  4QWE A;  3L9D A;  3V7K A;  2IBK A;  5J2D A;  8ICO A;  1QSS A;  4YG2 A;  4QWA A;  4DLG A;  3FYH A;  4J9S A;  2IHN A;  4I2H A;  5IIN A;  3RJJ A;  3RB6 A;  4I2B A;  2KFZ A;  4JV1 A;  2DVI A;  5L1K A;  5D4B A;  4TUQ A;  4YMM A;  2DPI A;  4QZG A;  1S0O A;  7ICP A;  4X4U A;  4RQ0 A;  4I2E A;  5C5J A;  5KFF A;  3EW9 A;  4O0I A;  5CJ7 A;  3RJG A;  3ISD A;  3PY8 A;  1Q79 A;  3EZ5 A;  4IRK A;  1XSN A;  8ICX A;  4QZA A;  4FHY A;  4JK1 A;  2ZH8 A;  4ECY A;  1B43 A;  5D49 A;  1NK4 A;  5DGB A;  1JAJ A;  5J0X A;  4DQQ A;  4O3R A;  2PI4 A;  5J2G A;  1SL2 A;  3MR5 A;  2I9G A;  4MFC A;  8ICM A;  2ZH2 A;  2ZH4 A;  2P6R A;  7ICV A;  2R8H A;  3UQ2 A;  1NK0 A;  4F3O A;  1ZJN A;  4NLZ A;  3PV8 A;  4I2G A;  1B22 A;  7ICH A;  4F93 B;  4UAY A;  5HR9 A;  1ARO P;  2XGQ A;  1K1Q A;  1TK0 A;  8ICF A;  8ICW A;  4AT7 B;  3Q8Q B;  1Z00 A;  5IIJ A;  5KT2 A;  5KT3 A;  8ICL A;  1YLQ A;  1BPY A;  4IRC A;  2ASL A;  2V9W A;  2ZH6 A;  5KFA A;  3V6J A;  5KG4 A;  3ISC A;  3MR2 A;  3FDS A;  3GIM A;  1RXW A;  3V7L A;  5HRL A;  2XY7 A;  2O1P A;  4KLL A;  2DR5 A;  4F91 B;  2BCR A;  5J0O A;  4AT9 A;  1R8C A;  2C2R A;  1KNY A;  4WC2 A;  4EBE A;  4DS5 A;  2B21 A;  3C5F A;  1IXR A;  2PFN A;  2UVR A;  8ICI A;  4AT8 B;  4RQ1 A;  2GWS A;  1NJX A;  1TK8 A;  1WCL A;  5J0T A;  1KLN A;  5CP2 A;  2P6U A;  4DL4 A;  5J0P A;  5L1L A;  2FMS A;  3WFO A;  4AT7 A;  1BNO A;  1ZQK A;  2F1H A;  3HWT A;  4B9S A;  3MAB A;  1D8Y A;  4NM2 A;  4YD2 A;  4GC6 A;  4MEY A;  2ZH5 A;  2C22 A;  1JQR A;  3MR6 A;  3HJ4 A;  2M9N A;  4UD4 A;  3WFQ E;  2ZUC A;  5DBC A;  1ZQN A;  5KFR A;  1BPX A;  2KP7 A;  4XA5 A;  4QWB A;  4RQ6 A;  4JUZ A;  4BWJ A;  7ICG A;  4DQS A;  4QWC A;  1NJY A;  2FLN A;  2JEI A;  4DQR A;  4AT8 A;  4I2J A;  1LB2 B;  3OV7 A;  2BPC A;  4BXO B;  4TQR A;  1VFG A;  4GC7 A;  1IM4 A;  2FPL A;  3Q8P B;  4RQ5 A;  4NM1 A;  4FHV A;  7ICR A;  3RR7 A;  1ZQZ A;  5KFU A;  1L5U A;  4XQ8 A;  2ZTC A;  4O9M A;  4DSF A;  4UBC A;  1R8A A;  4X4N A;  4DSE A;  4PGX A;  5KFQ A;  9ICP A;  4X5V A;  1D9D A;  1COO A;  1BGX T;  7ICM A;  2ID1 A;  2HHU A;  3AU2 A;  3ZDC A;  2O5A A;  3WFR E;  2BGW A;  4I2A A;  5J0R A;  1BVS A;  4Q44 A;  3PNC A;  4F8R A;  4ZH4 A;  5L1I A;  2F1J A;  2Q66 A;  4MF2 A;  2NRZ A;  4ED8 A;  4TUS A;  4UB2 A;  4KLQ A;  4BXO A;  8ICK A;  1ZQV A;  3EWA A;  4R64 A;  5KG3 A;  3UXO A;  3ISB A;  2FPK A;  4EBD A;  3OHB A;  1N48 A;  1JXL A;  1Q78 A;  2JEJ A;  3B0X A;  5IIL A;  2VA8 A;  5DB6 A;  2ZTE A;  2NRK A;  4AT9 B;  5KG6 A;  4C8K A;  5F9L A;  5DQI A;  3H3A A;  3GIJ A;  2DFL A;  4EBK A;  4R66 A;  2DRA A;  7ICE A;  4M04 A;  3G6Y A;  4DSK A;  3G6V A;  4RWP A;  4WC4 A;  4DLE A;  1JX4 A;  8ICG A;  3UPQ A;  4YMO A;  5KFI A;  2VA2 A;  2UVU A;  3MGH A;  4IR1 A;  3OJS A;  3HX0 A;  4I2C A;  4RQ4 A;  5III A;  5HRF A;  3BQ0 A;  2XY5 A;  2DR8 A;  1ZQG A;  1NOM A;  3JPQ A;  4RWO A;  2DRB A;  4R8U B;  5KG0 A;  2AQ4 A;  5HRE A;  4DL6 A;  1S9F A;  4J9O A;  5HC9 A;  5J0S A;  4KLH A;  5KFK A;  2ZJ8 A;  1X9M A;  9ICG A;  3C66 A;  3UPS A;  4FBT A;  5DBB A;  5DDM A;  5J2K A;  2JZB A;  4WC5 A;  4RNN A;  3RRH A;  5KFH A;  2BE3 A;  2DR9 A;  1KTQ A;  3BDP A;  3SI8 A;  4RWQ A;  5KG1 A;  1U47 A;  1DOQ A;  4P4O A;  1TK5 A;  2KN7 A;  2PI5 A;  5HP4 A;  3MFH A;  1DK2 A;  4QW9 A;  3ZDA A;  4X4V A;  4Q43 A;  4DO9 A;  4ED2 A;  4KMU A;  2AGO A;  4S3N A;  4JWM A;  1TFY A;  1TVA A;  4WC0 A;  3PW0 A;  1WOT A;  4Z6F A;  2IHM A;  4EZ9 A;  4R8U A;  1MC8 A;  3V6H A;  1V4A A;  4YCX A;  4WC6 A;  1NK9 A;  9ICO A;  9ICX A;  2KFN A;  1TV9 A;  1QTM A;  5KT5 A;  3C2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...