4M9GA

Dna polymerase beta e295k binary complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
325
structure length
314
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 103
structure length 314
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9gA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9gA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9gA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9gA03
5TZVA 7ICEA 3G6VA 4PGQA 1R8BA 3Q8KA 2ZH1A 4QZCA 4YQWA 2DRBA 5KFYA 4F5RA 1ZQNA 5DECA 3B0YA 3QZ7A 2V4RA 4J9RA 3PW5A 4DS4A 4RQ3A 3H38A 4RQ7A 4QZHA 4QWEA 3LDAA 2AQ4A 2MUTA 3C2KA 5F9NA 1T3NA 2ZHAA 4GC7A 3RJIA 1D8YA 4IG8A 1V9PA 5KT3A 8ICYA 2ZTDA 4KN4A 3JPRA 4DLGA 1T8EA 1SKWA 3C5GA 4NKTA 4I2GA 1COOA 1ZQRA 9ICGA 7ICJA 2J6UA 4B9SA 1X2IA 1D8LA 4DS5A 2C2DA 1IM4A 3PX4A 2DPIA 1ZQMA 2ZUCA 3H39A 4O3OA 1L5UA 3M8RA 2PXIA 4E7XA 2ZH6A 1ZQPA 4R63A 5KG4A 3RAQA 3C18A 4PGYA 2A1JA 2BHNA 5IIOA 5CWRA 2R8GA 3TAQA 4PHAA 1MIVA 2ZH9A 4DL6A 1NK4A 2DR9A 4C8LA 4WBYA 3HJ4A 4ZH4A 2XY5A 1L3TA 3PR5B 3JPOA 3RJEA 2PI4A 4JV1A 4O3SA 4FS2A 1JAJA 5DKWA 3H37A 2NRWA 4KLJA 4O0IA 3SZ2A 4JWNA 3QZ8A 1S0OA 4RWPA 2XY7A 4PH5A 5HRDA 4F2RA 8ICEA 3KHLA 3PY8A 3PVXA 3ISCA 2C2RA 2PFPA 1NKBA 2IMWP 4F4KA 1KLNA 1NZPA 4WC3A 4EBKA 4F3OA 1NKCA 3THVA 2IHNA 8ICUA 1YLQA 4F5NA 2MUTB 5DQHA 4ELTA 4LT6A 2FPMA 5KFHA 3HX0A 1HUOA 4XA5A 4R65A 1UA0A 1ZQJA 4FBTA 8ICLA 4UD5A 3MR3A 2HHSA 8ICTA 4F2SA 4EP7A 3RH5A 2C28A 2HHQA 4DEZA 3LQCB 2WTFA 2NRKA 2XCPA 3MBYA 8ICBA 1UEUA 5J0QA 1OU5A 2ZH2A 3UPSA 1ZQDA 7ICRA 1UA1A 1WOTA 4I2FA 2P66A 4YG2A 4RUAA 1DGSA 4YP3A 5J2AA 3MFIA 4ECTA 4FO6A 5KFVA 2VA8A 4NLNA 3Q8MA 2MAXA 4RQ0A 4YMOA 4YN4A 4WC4A 1SL2A 5KFNA 4X4QA 4ED3A 5J0XA 5KFXA 4DL7A 1NK6A 4J9MA 3H4BA 3MABA 2W9CB 4ECYA 4X5VA 2AGQA 5DBCA 5DG9A 1RPLA 3C2MA 1NJYA 1ZQIA 1D9DA 2AU0A 2PFOA 3OV7A 1NO5A 5CA7A 3NGDA 3RJJA 5HP4A 4ED8A 1ZQBA 4F92B 3PW7A 2FPLA 3ORYA 4QW9A 2ASJA 3RR8A 4JUZA 5KFKA 3BQ1A 4IR1A 1U4BA 1X9WA 1TK5A 4IQVA 2Y1IA 3V6HA 4IQTA 1QSSA 1QLNA 3HP6A 1NKEA 8ICVA 4JK1A 2BDPA 1Q78A 3C66A 5KFEA 3C21A 4UAWA 3SI8A 7ICGA 5HRLA 4FH3A 4GXKA 4ED7A 4MFAA 5HREA 3ISBA 4E0DA 4O5EA 1S77D 8ICXA 1XWLA 5BOLA 7ICHA 2Q66A 4ECXA 1D9FA 1KFTA 4FHXA 5F2VO 1VFGA 4NM1A 1H38A 5D4BA 7ICSA 4MF8A 1BPBA 1ZJNA 1PZNA 2HHVA 3RTVA 4WC1A 1A77A 2BE3A 4RUCA 3MR6A 3UQ0A 4QZGA 1T7PA 7ICKA 5DDMA 2PBEA 9ICRA 5KFQA 1S0NA 4ATBA 3M9MB 4BGDA 5L1JA 4QZBA 2ALZA 8ICFA 2JZBA 3T5JA 5KFBA 8ICWA 2O1PA 5C5JA 1U47A 5L9XA 2R8IA 4RPYA 1SKRA 4I2BA 4DOAA 4DFPA 3RBEA 4PHEA 4RQ2A 5KFZA 4DQPA 1BPXA 8ICIA 2DR8A 5HRGA 2C2EA 4RNMA 5KG3A 4G3IA 1KFDA 4RNNA 3FDSA 4TUQA 2VA2A 4TQRA 4M2YA 3TI0A 3OJUA 2XGPA 1QTMA 4BWJA 9ICWA 2ID1A 4RQ4A 4S3NA 2W9BA 4DOCA 3BDPA 4B9NA 2ZH7A 1JMSA 4UB2A 2BPCA 3B0XA 2AGPA 1NJZA 4KLQA 1U9LA 3RH4A 3C1YA 2ASLA 1S10A 4FS1A 2BCRA 4O9MA 5J2IA 3KTQA 1R8CA 5HC9A 2DRAA 2ZHBA 4YXMA 4JV0A 3EPGA 9ICUA 4DSJA 5IIKA 4Z6DA 7ICVA 3JPQA 4J9LA 3T5LA 1ZQKA 2KZ3A 5KFGA 8ICSA 3KHRA 2ZTCA 2KFZA 4EYHB 4P4PA 3AQNA 2BQRA 3AQKA 4F5OA 4ATBB 2J6TA 1U45A 4YR0A 3Q8QB 1TFYA 2NRVA 2JZBB 1U48A 4WBZA 3PX6A 1ZQZA 4R8UA 5DG7A 4R64A 2PFNA 1BPZA 3IHQB 5EWGA 3ZDCA 1HJPA 5IIJA 4QWAA 3PW0A 3QEAZ 4KTQA 3GQCA 5DLFA 4LZGA 3OUYB 2ATLA 3WFSC 1XS9D 3SV4A 2B21A 4C8OA 2BQUA 4EBDA 1ZQUA 3RJHA 3JPNA 4F50A 2XY6A 1ZJMA 1TFWA 1XSPA 1JN3A 3H4DA 1S97A 4RPXA 1JXLA 4B9VA 3MGHA 9ICPA 1ZQLA 2FPKA 2F1JA 3UXNA 3HPOA 3UQ2A 1RXWA 9ICEA 4QZFA 1MC8A 2JEFA 2NRZA 4PGXA 2NRTA 2W9BB 2BQ3A 4EBCA 3N97B 1NJXA 4ECVA 1SKSA 8ICQA 5HRFA 2O5AA 4X4TA 3WFRE 2Y1JA 3N4MB 1T4GA 4YR2A 4RWOA 1V4AA 1RXVA 4DQRA 3OVSA 5HHHA 8ICAA 3MFHA 3KHHA 4J9SA 1CUKA 5KT4A 4B9UA 4KLUA 1BNOA 2ZH5A 3H8JA 3H8SA 4GLXA 3MR5A 2FLNA 4X4NA 3M8SA 1JIHA 5KG2A 4RU9A 4I2DA 4F91B 5J2EA 2W8LA 5DB9A 5F9LA 1ZQYA 3PMLA 3UXPA 3PW4A 2UVRA 4GXIA 1LV5A 4M9GA 4NLZA 3OVBA 4NKUA 1DK2A 4EZ6A 3RB0A 4FHYA 3K4GA 4M9JA 2ASDA 1UETA 1NK8A 3JZ0A 4QZIA 3H40A 9ICHA 1Q79A 4FH5A 4AT7A 3RR7A 2ZUBA 2KN7A 3MDAA 4I28A 1S76D 3RJGA 2HHPA 4XQ7A 4DFJA 2PI5A 4KLDA 1BPDA 1KEJA 2AQ0A 2VANA 4KLEA 3MR2A 2KP7A 2A1JB 5IIIA 3WFOA 2ZUDA 4DL5A 5KFMA 5BPCA 4UB1A 2OWOA 4YD2A 3MDCA 3T5KA 4B9TA 5CB1A 1TKDA 4C8KA 2M9NA 2F1IA 5D46A 5HNKA 4DFKA 9ICOA 2ZJAA 9ICVA 5DLGA 4DQQA 1RYSA 2M2TA 1ZQAA 1XSNA 3H8WA 4YVZA 4M6WA 8ICKA 4TQSA 4O3NA 1JXEA 5DBBA 4UAZA 3G6YA 2JEJA 4P4OA 4RZRA 4EEYA 1K1QA 1B43A 2RDIA 4UB5A 3RB4A 5CJ7A 1KSPA 2ISPA 9ICSA 4MEYA 5J2CA 3KHGA 5J0YA 2W9MA 4TURA 2HHTA 1MIWA 1NK9A 3PMNA 5KFPA 2ZTEA 1L3VA 5BOMA 3PO4A 7ICQA 5KG7A 3GIIA 5J2JA 1TFRA 3PV8A 3BQTA 3JPPA 4KMUA 2P6UA 4EYIB 3UXOA 5KFCA 4JWMA 4X4RA 3GIKA 2LYHA 3V6JA 1ZQGA 4DSIA 4M47A 4DOBA 9ICIA 1ZQHA 3Q8SB 2ZH8A 2DFLA 1K1SA 4EBJA 4Q8EA 4ELUA 5HRIA 4DSEA 2BR0A 1XC9A 5KFUA 9ICMA 5KT7A 2BCSA 5KFIA 1L3SA 4DL4A 3RRHA 2KZMA 3E2EA 4LVSA 3SV3A 1AROP 2C22A 4XRHA 2FMPA 4ED1A 4QZEA 4P2HA 5HR9A 5L1KA 4ED0A 9ICCA 5J2BA 4RPZA 4RQ6A 4MFCA 3GILA 4RQ8A 3T3FA 1L3UA 5KG6A 4AT8A 4EBEA 3Q8PB 4DF4A 3MGIA 4M6WB 4KLFA 4XUSA 3AQMA 3C1ZA 4WC0A 4KLOA 4F4XA 2BKEA 4IQUA 4Z6CA 5J2DA 4F93B 4J9PA 3TFRA 4I2IA 4C8NA 1XU4A 3EW9A 1A76A 4ECZA 4DL3A 4M9NA 2HHXA 5IILA 4AT9B 3GV7B 4I27A 3C5FA 5IINA 5CP2A 3EZ5A 4O3QA 3RB6A 1PX5A 5L1LA 4KLLA 5KFDA 4K4GA 3V6KA 8ICHA 9ICTA 2BPFA 4FHWA 5CR0A 4I2HA 5KFOA 3GV5B 3ZDAA 5HMLA 1F5AA 4PHPA 1EXNA 4BWMA 1BVSA 5KFTA 1TAQA 5IIMA 7ICOA 3Q8LA 3PO5A 1NJWA 2XCAA 5DQGA 5D49A 4DSFA 2I1QA 9ICXA 4ECRA 2DVIA 4P4MA 4NXZA 2FMSA 1ZQCA 1BNPA 4J9KA 3PW2A 1C7YA 4QZ9A 1ZETA 9ICFA 4KN7A 4Z6FA 2HVHA 4UB4A 4X4PA 4IRKA 3AU6A 4NY8A 4PPXA 4Q45A 1MSWD 4WC5A 2BCQA 3RBDA 4UAYA 3V7JA 3ZDBA 7ICIA 4NM2A 1WCLA 4M0AA 1NOMA 1QSYA 4O5CA 4Q44A 1Z3EB 5KG5A 2FLPA 2JEGA 2R8KA 4RQ5A 4R66A 3GIJA 3LWLA 7ICFA 4O5KA 3TANA 5HRHA 1ZQWA 3EPIA 1ZQTA 3PNCA 2UVWA 4TUPA 4I2EA 3M9OB 3HT3A 1CEZA 1TAUA 1Y88A 4C8MA 4DSKA 5J0WA 5KFLA 1JX4A 4M9LA 1KDHA 4X4VA 3GIMA 5J2FA 1ZQVA 1BPEA 3TQ1A 5EWEA 9ICAA 5HMMA 2M2VA 1XO1A 4QWCA 4YMMA 1HUZA 2KFNA 3RB3A 3ZD9A 5J0RA 1MQ2A 2XC9A 4O3RA 5DGAA 3OHAA 5KG0A 4MF2A 1NK7A 4J9OA 2W9AA 4O3PA 4RT2A 2BPGA 3SYZA 4CCHA 8ICOA 4QZDA 4I2JA 8ICGA 4M04A 2FLLA 4FBUA 4KLMA 4RNOA 1VJ7A 4RQ1A 2R8HA 4QZAA 4F5PA 3PX0A 4RWQA 5KG1A 3LK9A 3EYZA 3V72A 4J9NA 4QWBA 4AT9A 4IR9A 5KFJA 4R8UB 1X9SA 4JV2A 1DOQA 1R89A 4B9MA 3TFSA 8ICRA 4X4SA 3QE9Y 3ETLA 1NK0A 2P6RA 3RJFA 5KTQA 5KT5A 4ED6A 1ZQFA 4KLSA 4J9QA 2H5XA 2ZJ8A 5J0PA 3QEBZ 1JQRA 5J0OA 2PFQA 4KLHA 4F5QA 4F4YA 1TK0A 3H7IA 1SZPA 4WCWA 5J29A 3JPTA 2F1HA 2W9CA 3UPQA 7ICTA 2XGQA 3BJYA 1TK8A 1ZQSA 4ECWA 4Z6EA 2ZH4A 5HRKA 3OHBA 3Q8RB 3LWMA 2Q0ZX 2AGOA 4ECUA 4NLGA 4UB3A 4DWIA 1UT8A 4DQIA 1XSLA 4NLKA 9ICQA 2DR7A 3M9NB 2BGWA 5DB7A 7ICMA 2FMQA 5J2HA 3NYBA 2KZZA 4QZ8A 4BXOA 3GDXA 4I2CA 2M2UA 3HWTA 2DPJA 4UD4A 7ICUA 1B22A 2ZH3A 4UBBA 4DL2A 3RAXA 2UVUA 3FYHA 3BQ0A 7ICPA 3AUOA 1N56A 3T5HA 3K75D 2M2WA 1U49A 3V7KA 4LZDA 4YCXA 4WC2A 3NTUA 4I29A 9ICKA 4WC7A 8ICCA 2HVIA 4AT7B 4KLTA 5JUMA 3C2LA 1BGXT 4EZ9A 2R8JA 1MIYA 4WC6A 4IRDA 1ZQXA 4MEXA 1Z00A 5DGBA 1KTQA 3RJKA 2AJQA 4DQSA 1ZQQA 1IXRA 5DB8A 4X0BA 3BQ2A 4ELVA 4M5DA 7ICLA 4M9HA 8ICMA 3TARA 1ZYQA 5J0UA 1N48A 4PHDA 5J2GA 3GV8B 4F8RA 3ZDEA 4ECSA 9ICBA 2IBKA 2BCVA 5EOZA 1DK3A 3ZD8A 5DG8A 3IM1A 4RT3A 9ICLA 4QW8A 1WCNA 5J2KA 4GC6A 4F4ZA 4UBCA 1SL0A 1RYRA 3JYYA 4BXOB 4YFKA 4MFFA 4X4OA 4B9LA 3OSNA 3OSPA 5EWFA 4DFMA 4KITB 8ICZA 1KNYA 4YMNA 4K4HA 3HIYA 4RWNA 5DDYA 2RDJA 1ZQOA 3WFPA 4HYKA 1TVAA 3PR4A 3JPSA 3HW8A 1QSLA 4BDPA 3L9DA 5DEDA 4E80A 1KRPA 2V9WA 4KLIA 5KFRA 8ICJA 3OGUA 9ICJA 4Q8FA 5KFSA 4YD1A 2BCUA 2HHUA 4X0AA 5KT2A 3AU2A 3OVAA 1RZTA 4TUSA 3H3AA 2GWSA 1Z00B 5KFFA 5KT6A 2NRXA 4ECQA 2ZJ5A 5KFWA 5J0TA 1BPYA 3ISDA 5CHGA 1LB2B 4DSLA 1TV9A 1SL1A 5DB6A 1FA0A 2V4QA 1S0MA 3ZDDA 4FHVA 4KLGA 4YR3A 5DQIA 2IHMA 4E8FA 4DF8A 2KTQA 4YXJA 2RFFA 3RH6A 1X9MA 2XO7A 3G6XA 1MQ3A 5HRBA 2I9GA 3OUYA 9ICNA 4AT8B 4K4IA 2IA6A 4X4UA 2VA3A 1UT5A 4I2AA 2HHWA 4FHPA 5DBAA 2JEIA 1S9FA 8ICNA 3V7LA 3C23A 4IQWA 1UEVA 2J6SA 5J0SA 5KFAA 3TAPA 3AQLA 3EWAA 4IRCA 2DR5A 3OJSA 4F4WA 5HHIA 3WFQE 4DO9A 4XQ8A 1S0VA 1KFSA 2W8KA 3RRGA 3GFKB 5L1IA 7ICNA 4UQGA 4DLEA 1R8AA 2HW3A 4ED2A 1NK5A 4Q43A 4GXJA 4QWDA 1ZQEA 3HJ1A 2ISOA 8ICPA 2UVVA
chains in the Genus database with same CATH superfamily
3Q8KA 4BX9C 1XO0A 2VJ4A 4RQ3A 5JTGA 3KBBA 2MUTA 1T3NA 5F9NA 3RJIA 3OPXA 3T79A 2XVTA 3C5GA 4NKTA 1COOA 9ICGA 2XICA 1D8LA 2DPIA 1L8OA 4O3OA 3M8RA 1ZQPA 4PGYA 2A1JA 1WG8A 3D2SA 2R8GA 3TAQA 4DL6A 3NVYA 4C8LA 3PR5B 3H37A 1JAJA 2ZIWA 3I1YA 3QZ8A 4N7RA 4PH5A 8ICEA 3PVXA 2C2RA 1CI4A 1RQNA 2IHNA 3O0FA 2MUTB 4ELTA 5KFHA 1HUOA 2HN2A 3FM9A 2G09A 3RH5A 5TISU 5J0QA 3K1RB 4ECTA 4NLNA 3TADC 3Q8MA 2MAXA 4BUGA 4YMOA 2ZIWB 5KFXA 4ICAA 4J9MA 2W9CB 3MABA 1D9DA 5DBCA 2AU0A 1GO3F 1NO5A 3RJJA 4ED8A 3PW7A 4OAHA 5KFKA 3BQ1A 4IQTA 4JK1A 1JUDA 4NJ8A 5JRTA 3C66A 4UAWA 7ICGA 2EZYA 2JXJA 4ED7A 5HREA 4E0DA 4O5EA 3KKAA 4OJPA 4QIWC 3WU2U 4NM1A 7ICSA 1BPBA 2HHVA 5HR6A 3MR6A 1T7PA 5DDMA 9ICRA 5KFQA 5L1JA 4QZBA 2I5HA 2ALZA 8ICFA 2JZBA 3T5JA 1FIQA 4CNQA 1SKRA 5EE0A 4A8EA 5KFZA 2DR8A 1BPXA 5ALRA 1Z19A 2W03A 4RNMA 2C2EA 4G3IA 3FDSA 4TUQA 5AICA 2XGPA 1Q3VA 9ICWA 4DOCA 1JMSA 1U9LA 2BCRA 4FS1A 2IHOA 3SEIA 9ICUA 5IIKA 2CPRA 1ZQKA 5KFGA 3UMGA 3AQNA 2BQRA 2J6TA 1U45A 2NRVA 2JZBB 4WBZA 3PX6A 1ZQZA 2B0CA 3AN1A 3M6ZA 4HAIA 2K89A 2XY6A 3MGHA 9ICEA 2JEFA 5CHEA 4PGXA 2BQ3A 2OH2A 2EAOA 4EBCA 4X4TA 4ECVA 2H3ZA 3QUQA 1T4GA 1MA7A 4CGZA 2DGZA 1CUKA 4B9UA 1PK1A 3K7DA 3WKEA 3WK6A 3H0RB 4RU9A 2YMQA 1K5OA 5J2EA 4B6JA 3CW2C 1B4FA 2H3QA 4EZ6A 3RB0A 4MHVA 2FDRA 2F76X 1UETA 5CFSA 2KN7A 3MDAA 4XQ7A 3NVVA 4DFJA 4OJ5A 2PI5A 1WUDA 3M1YA 1BPDA 4F72A 2KP7A 3WFOA 4DL5A 2JHDA 4C8KA 3T5KA 3SAGA 9ICOA 5F3XB 2ZJAA 2E8OA 3IV6A 3H8WA 2IUBA 4QIWF 1PK1B 4UAVA 5GTIU 7ICQA 3PO4A 1FFUA 2LM4A 2P6UA 4EYIB 5KFCA 1D8BA 3GIKA 4M47A 3KZXA 2DFLA 4EV6A 4CDGA 4EEBA 2KKPA 5KFUA 1L3SA 3E2EA 1WYGA 3FC4A 4LVSA 3SV3A 5HR9A 2E3TA 4RQNA 9ICCA 2KSOA 3B9JA 5ALHA 3GILA 5KG6A 1RQLA 3PZPA 2NO4A 4KLFA 4F4XA 2BKEA 4NXUA 3AMZA 4F93B 4J9PA 3EW9A 3HKZC 4ECZA 5IILA 2K4EA 5CP2A 1SWVA 1PX5A 8ICHA 3V6KA 2HOIA 2BPFA 4I2HA 4NLBA 4I0UA 4BWMA 4PZNA 4HX0A 3Q8LA 1NJWA 2XCAA 3U26A 2DVIA 4Y2VA 2KSOB 1BNPA 2GO7A 4X4PA 3AU6A 4PPXA 2WB1F 4NM2A 3LYSA 1QSYA 5G5HA 4CE6A 2BBHA 1NZBA 2HOFA 4O5KA 7ICFA 1ZQWA 4UASA 2VIXA 3M9OB 1CEZA 1TAUA 2OM6A 4C8MA 1KDHA 1ZQVA 3RB3A 3ZD9A 4O3RA 4MF2A 3SYZA 5AKGA 2E1EA 4KLMA 4RQ1A 2R8HA 4RWQA 2Y0SC 2W43A 4AP9A 5ALWA 4QWBA 4IR9A 1SXEA 1X9SA 4JV2A 1ZD5A 2HBLA 3RJFA 5ALEA 1L7MA 2H5XA 3NRWA 1B0XA 5J0OA 4AYBF 4F5QA 1TK0A 4WCWA 3JPTA 3NKUA 5EE3A 3BJYA 4ECWA 1ZQ1C 3BZCA 3OHBA 3NVWA 1ZRNA 4ECUA 4NLGA 1UT8A 1XSLA 1ZRMA 2FMQA 2LHTA 4I2CA 4Y2RA 4K97A 1LKYA 1A0PA 2NO5A 2WF8A 3BQ0A 3T5HA 4MKPA 1U49A 2WF6A 4YCXA 3UM9A 5KAIU 4I29A 4EGWA 8ICCA 2CRXA 2R8JA 4MEXA 5DGBA 1KTQA 2JR5A 3CK6A 3BQ2A 4P0PA 1J2MA 1ZYQA 2JRZA 3ZDEA 4ECSA 2BCVA 4RT3A 3IM1A 9ICLA 2ZH9A 5J2KA 1WCNA 4F4ZA 4UBCA 2F2AB 3A0HU 4B9LA 3OSNA 4Y2UA 1J2NA 8ICZA 4K4HA 3WFPA 3ER9B 4HYKA 4YD1A 5KT2A 3MGVA 3WK4A 2GWSA 5KT6A 2NRXA 1BPYA 5CHGA 4DSLA 2V4QA 2KOBA 3ZDDA 4FHVA 4KLGA 3BS7A 4E8FA 2FCLA 2RFFA 3OUYA 5HRBA 1QQ7A 3E0FA 9ICNA 2GAFD 4I2AA 4FHPA 1SIJA 2OEHA 1ED1A 1T94A 3TACB 4CRXA 4IRCA 3OJSA 4F4WA 3TADA 2Y0SF 4OAFA 1R8AA 4ED2A 4GXJA 3LVVA 2ISOA 2YB4A 2UVVA 4ZOHC 7ICEA 1R8BA 5E79U 2DRBA 5KFYA 4F5RA 5DECA 2G5IB 2WAQF 5H2FU 4K8VA 4RQ7A 2XIDA 1SZHA 3C2KA 2ZHAA 1V9PA 2ZTDA 1T8EA 3EUB2 1ZQRA 1ZD4A 5AM3A 4USAA 2C2DA 3QUBA 2K4PA 2ZUCA 2ZH6A 3C18A 4NXTA 5IIOA 5CWRA 2FE9A 2DR9A 4WBYA 2XY5A 1L3TA 5B3QA 2ZH5A 4JV1A 3ERCC 2EZXA 4C4RA 4O3SA 3SZ2A 4JWNA 1C20A 3PY8A 3ISCA 1NKBA 2IMWP 4EX6A 1YLQA 4LEYA 2FPMA 1ZQJA 3MR3A 2HN1A 2CXYA 4EP7A 2XCPA 2ZH2A 2EQYA 2ES6A 4YG2A 4WQLA 1DGSA 3F2CA 3KOOA 3MFIA 5KFVA 2VA8A 5AI8A 4YN4A 1SL2A 2B6GA 5KFNA 2HSZA 3WK5A 4ECYA 1NJYA 3C2MA 2PFOA 1ZQIA 3SMVA 4KB6A 5AKKA 5A0LA 1ZQBA 2G06A 4IR1A 2ZG6A 2HOQA 4WH5A 3V6HA 1QSSA 2F8KA 3HP6A 2BDPA 5KFEA 1COKA 3SI8A 2QLTA 3ISBA 1KN5A 1QQ6A 2YMLA 4EENA 2YMMA 4UW9A 2Q66A 1KFTA 4MF8A 1A77A 4RUCA 3UQ0A 2OYYA 1S0NA 5KFBA 5C5JA 4NLCA 2R8IA 1PVRA 4DOAA 3RBEA 2KVCA 3NVZA 4DQPA 5KG3A 4RNNA 2VA2A 4TQRA 3TI0A 3OJUA 1F5SA 4PL2A 2XI9A 2BPCA 2AGPA 1NJZA 1J97A 4O9MA 5HC9A 1R8CA 1RG6A 2ZHBA 4OCZA 5ALFA 4JV0A 2A19A 8ICSA 3KHRA 3QUCA 1TFYA 4NXVA 4YR0A 3Q8QB 1BPZA 3ZDCA 1OXJA 5IIJA 4KM5A 4LZGA 3GQCA 1YZ6A 1XS9D 3SV4A 2B21A 4C8OA 2DKZA 2BQUA 3JPNA 4F50A 1V85A 1XSPA 3H4DA 9ICPA 5ALYA 4ACOA 2YTUA 2FPKA 1RXWA 4QZFA 2NRZA 2JH7A 2NRTA 8ICQA 1NJXA 2FJ6A 5HRFA 3QU5A 4JMUA 5AM5A 3QX7A 4YR2A 1RXVA 3OVSA 8ICAA 4J9SA 1UHUA 4FZMA 4XJEA 4KX5A 2FLNA 3AEVA 5JU5A 3M8SA 4X4NA 1JIHA 4I2DA 2GOLA 5F9LA 2IOFA 1ZQYA 3PW4A 4NLZA 2G5HB 5AKHA 2LM1A 3K4GA 3H40A 4AT7A 5ALMA 1N61A 1SV0A 1S76D 3RJGA 2GH1A 1V97A 3VC8A 2DKXA 4KLEA 1KEJA 2A1JB 5KFMA 4B9TA 3EF2A 1TKDA 3WKBA 1RM6C 2KHVA 2PMZC 9ICVA 4DQQA 2M2TA 2LYBA 4M6WA 1JXEA 2JEJA 2RLTA 3NRZA 4RZRA 1K1QA 1KSPA 3KHGA 5J0YA 2W9MA 2HHTA 5AM2A 1AQ6A 2R18A 5KFPA 5ALTA 1L3VA 5KG7A 1QCKA 3GIIA 3PV8A 3BQTA 3JPPA 4UAUA 2LYHA 1ZQGA 4DOBA 1ZQHA 4JLXA 5AKXA 4P0QA 2WFAA 4EBJA 5HRIA 4ELUA 1XC9A 5KFIA 4DL4A 1AROP 4LEWA 5L1KA 4ED0A 5J2BA 1ZXIA 2M0NA 4RQ8A 4EBEA 3I76A 3MGIA 4M6WB 4Y2JA 3C1ZA 4KLOA 4IQUA 3TFRA 4I2IA 1XU4A 3GV7B 4I27A 2ZIXA 1VLBA 5AK4A 3EZ5A 9ICTA 2W04A 2HBKA 5KFOA 3GV5B 4P0QB 2D8CA 4Y2TA 3KFUF 1BVSA 5AI9A 1TAQA 5IIMA 7ICOA 3PO5A 4ECRA 4P4MA 4NXZA 2FMSA 1ZQCA 3PW2A 4QZ9A 9ICFA 1OW5A 4KN7A 4Z6FA 4IRKA 3A0BU 3D2QA 4NY8A 1Z4OA 2BCQA 3RBDA 3IRUA 3ZDBA 1WCLA 1NOMA 4O5CA 2DL0A 4CF5A 2JEGA 2ZIXB 3TANA 3EPIA 4TUPA 2PKEA 3HT3A 4DSKA 5KFLA 3CNHA 4X4VA 2WF9A 5J2FA 1BPEA 5EWEA 1XO1A 4OJOA 4CF4A 2D6FC 5AHXA 2VJ5A 5KG0A 1NK7A 2BPGA 4O3PA 1Z4NA 4J03A 3ETRA 4I2JA 4M04A 2NYVA 2FLLA 2YY6A 2JH1A 3NVOA 2KE7A 3F5AA 4FE3A 2PMZF 3LK9A 3V72A 3WKCA 3MCRA 4Y2XA 4JB3A 5KAFU 1R89A 4X4SA 1ZOLA 4B9MA 3UMCA 5ALZA 3ETLA 1NK0A 5KTQA 5KT5A 3F2BA 1ZD2P 4J9QA 2ZJ8A 1JQRA 3QEBZ 2ESEA 5J29A 2F1HA 2XGQA 4FZNA 2ZH4A 3Q8RB 2Q0ZX 3BQ7A 4UB3A 1YT3A 4DWIA 4NLKA 2DR7A 2EAPA 3M9NB 2QB0A 5KL8B 5J2HA 3AM9A 4QZ8A 4BXOA 3GDXA 3QXGA 2M2UA 2DPJA 4WOYA 7ICUA 2E8PA 3M6KA 3AUOA 1N56A 3V7KA 3PSPA 3CRXA 4EZ9A 2LI6A 4WC6A 1HIWA 5AI0A 2AH5A 1Z00A 3RJKA 2AJQA 2Z7JA 3LVWA 5CFUA 1IXRA 4X0BA 4ELVA 4M5DA 1SB3C 4M9HA 3TARA 2H3IA 5J0UA 5J2GA 2IBKA 1DK3A 4QW8A 2QB0B 1JRPA 4BXOB 5FP0A 4X4OA 5EWFA 4DFMA 1KNYA 3HIYA 4RWNA 1OUQA 4K98A 3HW8A 2K4HA 3JPSA 4BDPA 4KX3A 4PJ0U 4KLIA 5KFRA 2EWRA 4Q8FA 4OAIZ 2HHUA 4X0AA 1SV0C 1O08A 3OVAA 2W7PA 3H3AA 1Z00B 5KFFA 4ECQA 2ZJ5A 3ISDA 1LB2B 5DB6A 4YR3A 4K99A 4DF8A 1IIPA 4NKUA 3RH6A 3G6XA 2I9GA 2VA3A 2KD1A 5DBAA 2JEIA 2RHFA 3V7LA 3C23A 4IQWA 1UEVA 2BZFA 2J6SA 4NL9A 3AQLA 4DO9A 2W8KA 3N7SC 7ICNA 1NK5A 3C29A 4Q43A 8ICPA 5TZVA 1IG6A 2ZH1A 1ZQNA 3B0YA 4RQMA 2V4RA 4J9RA 4DS4A 3M7DA 4QZHA 3L5KA 3AQEA 3LDAA 5AI6A 5ALXA 5CEHA 4GC7A 4IG8A 5KT3A 4KN4A 4UATA 3JPRA 4DLGA 7ICJA 2J6UA 5D61A 1X2IA 4DS5A 1IM4A 3PX4A 2DQNB 5AM0A 4E7XA 3RFAA 5ALGA 1L5UA 2PXIA 4R63A 1LVHA 1JALA 2N1RA 3WKDA 1NK4A 2VKQA 3HJ4A 4ZH4A 3JPOA 3HRDD 4FS2A 5DKWA 2NRWA 2A3VA 4RWPA 4F2RA 3KHLA 2PFPA 2LPEA 2ODGA 4F3OA 3R9KA 1NKCA 8ICUA 4F5NA 5DQHA 3HILA 1M6YA 4DCCA 4XA5A 1UA0A 4OAGA 2HHQA 2E1FA 2W54A 4DEZA 3LQCB 2NRKA 1UEUA 2QB1A 1OU5A 2EDUA 7ICRA 4I2FA 1N2XA 2P66A 4YP3A 5J2AA 3IG5A 3HKZF 4RQ0A 4X4QA 1SV4A 4OJLA 2I6XA 2KIVA 2EH9A 5CRXA 2LKYA 1WWVA 5CA7A 1P7DA 1L7PA 5HP4A 4AT9A 2ASJA 3ORYA 2BDUA 1X6JA 2HBMA 3L3FX 4JUZA 2G07A 1X9WA 1TK5A 2Y1IA 5AKYA 1QLNA 4C4SA 1Q78A 1PVPA 3C21A 5HRLA 4IL6U 4MFAA 1LKYB 1XWLA 5BOLA 4FHXA 5D4BA 1PZNA 3RTVA 2BE3A 2WF7A 3WKAA 7ICKA 2KKVA 2G0AA 4BGDA 1Q8KA 8ICWA 2O1PA 5L9XA 4RPYA 4US9A 4I2BA 4DFPA 5KL1B 4P0PB 1KW4A 4RQ2A 8ICIA 1TE2A 1N62A 5HRGA 1KFDA 4M2YA 4BWJA 1PVQA 5K4LA 2ID1A 4RQ4A 4S3NA 4B9NA 4UB2A 2E8MA 4KLQA 3DV9A 1CRXA 3RH4A 1S10A 1L7NA 2DRAA 5J2IA 3KTQA 3FAHA 1X66A 4Z6DA 3JPQA 4J9LA 3T5LA 2ZTCA 3ZI4A 1JI7A 4P4PA 3AQKA 1U48A 4R8UA 2KG5A 5DG7A 2PFNA 5AKZA 5B66U 3H39A 3PW0A 3OUYB 5DLFA 2ATLA 1X6IA 4EBDA 1ZQUA 2YB1A 1TFWA 1ZJMA 1JN3A 1JXLA 5AI5A 4RPXA 4NWIA 2F1JA 3UXNA 3QNMA 1MC8A 1L8LA 1GPJA 2O5AA 3N97B 1SKSA 1V4AA 5ALVA 4DQRA 5HHHA 3NASA 4KLUA 5KT4A 1BNOA 4OJ6A 3H8JA 2L5YA 1NI3A 4GLXA 3MR5A 4Y2PA 5KG2A 3MC1A 2UVRA 5B5EU 4EX7A 5DB9A 3UXPA 3PMLA 3NS1A 3OVBA 1O03A 1DK2A 4FHYA 4M9JA 2ASDA 1NK8A 3JZ0A 9ICHA 4FH5A 4EELA 4I28A 4KLDA 2KNJA 2AQ0A 3MR2A 4NL9C 4KMOB 4UB1A 3MDCA 4UB6U 2M9NA 2F1IA 5D46A 3PHZA 5L1MA 4EEDA 5DLGA 1RYSA 1ZQAA 1XSNA 8ICKA 4US8A 4O3NA 4TQSA 3G6YA 1KKXA 4P4OA 4EEYA 2RDIA 3RB4A 9ICSA 4NXXA 3PMNA 2ZTEA 3GZFA 5J2JA 2GA9D 4JWMA 1Q46A 4DSIA 2ZH8A 1XNSA 1K1SA 4Q8EA 2BR0A 3SAFA 2KZMA 3RRHA 4P2HA 4ED1A 1N5XA 1UQVA 2A1AA 4AT8A 3T3FA 3L4PA 1L3UA 3QU4A 4XUSA 2DBYA 4PL1A 4Z6CA 3SENA 4C8NA 4DL3A 3C5FA 3DDHA 3WK9A 3RB6A 4KLLA 5KFDA 4OD0A 3BZKA 4O67A 5CR0A 2ZXHA 1F44A 4NV0A 1KQQA 1F5AA 4PHPA 1EXNA 4OO1J 1N63A 5DQGA 3HJEA 9ICXA 4J9KA 5HR7A 4UB4A 1V38A 5AKEA 1MSWD 2LBOA 4WC5A 4UAYA 3V7JA 7ICIA 4M0AA 1ECWA 4Q44A 2F77X 3PSIA 5KG5A 2R8KA 4R66A 3GIJA 3LWLA 1L6NA 1FO4A 5HRHA 2MRLA 2RRDA 3I28A 4DFDA 1ZQTA 2UVWA 4I2EA 1Y88A 5J0WA 1JX4A 9ICAA 5HMMA 4NXWA 5J0RA 3ICXA 1MQ2A 3OHAA 2JV3A 2CN1A 4RT2A 4CCHA 1VJ7A 4FBUA 3IP4B 3H0LB 1S5LU 4QZAA 3PX0A 5KFJA 2F3NA 1DOQA 8ICRA 3PSTA 3QE9Y 3QU9A 2KHQA 4KLSA 1A6SA 4F4YA 3H7IA 1SZPA 2F8LA 1RYUA 2W9CA 3UPQA 1SGGA 1ZQSA 1QH9A 4FFDA 2YQEA 5HRKA 5AKIA 3LWMA 2AGOA 3N28A 4WJ3B 9ICQA 4DQIA 2KJ9A 2BGWA 5DB7A 1TAMA 4GFJA 1KBUA 4FO1A 2KZZA 3HWTA 2Q4TA 2W3RA 1B22A 5AIAA 5AM4A 3NTUA 2ZIUA 4UB8U 4AT7B 4KLTA 1RDFA 5JUMA 3C2LA 5AIBA 2K8BB 1MIYA 4IRDA 2EZZA 1ZQQA 2ZIVA 3PSFA 4QNLA 7ICLA 1N48A 5ALSA 4F8RA 5EOZA 3ZD8A 5DG8A 3JYYA 4MFFA 1VJ5A 2MSNA 3OSPA 1DRGA 5ALKA 4KITB 4YMNA 5DDYA 2RDJA 5EE1A 5DEDA 2ZIUB 3SAHA 1KRPA 8ICJA 2WF5A 1X42A 2BCUA 2IOHA 4WQKA 1SL1A 2ZIVB 5DQIA 3CP8A 4YXJA 4X4UA 1X9MA 2XO7A 1MQ3A 2KIWA 2IA6A 1UT5A 4O3MA 2HHWA 8ICNA 5KFAA 3EWAA 4C0ZA 3WFQE 4XQ8A 1S0VA 1KFSA 3GFKB 5L1IA 3F2DA 4DLEA 2WHEA 3HJ1A 1ZQEA 4QWDA 2E8NA 1PUZA 3G6VA 4PGQA 4QZCA 4YQWA 3F53A 3QZ7A 1YZ7A 3PW5A 3H38A 4QWEA 2AQ4A 1D8YA 1UCVA 8ICYA 3IDWA 1SKWA 3QU2A 4I2GA 2B4VA 3IN5A 4B9SA 2G08A 4U6PA 5AM1A 1JROA 5J8YC 1ZQMA 5KG4A 3RAQA 2BHNA 4PHAA 5T14A 1MIVA 2RQ5A 4IC9A 2DF4B 2YMPA 2PI4A 3RJEA 2WB1C 5EE9A 4KLJA 4O0IA 2DWQA 1S0OA 2D3DA 2XY7A 5HRDA 4F4KA 1KLNA 1NZPA 4WC3A 4EBKA 3THVA 4LT6A 9ICIA 3HX0A 4R65A 4FBTA 8ICLA 4UD5A 2HHSA 8ICTA 4F2SA 3ED5A 2C28A 2WTFA 3MBYA 8ICBA 2K60A 2JGAA 2QKQA 3UPSA 1ZQDA 1UA1A 1WOTA 4IS7A 4RUAA 4FO6A 1SWWA 4G9BA 4WC4A 3QYPA 3H8MA 4ED3A 5J0XA 4DL7A 1NK6A 5B3PA 3H4BA 4X5VA 2AGQA 2HHXA 5DG9A 3OV7A 1RPLA 4LJXA 3NGDA 5ALPA 4AYBC 2FPLA 4F92B 4QW9A 3RR8A 3AQFA 3N7RC 3F5EA 1U4BA 4IQVA 2GLEA 2KJ8A 2KV2A 2KK0A 1NKEA 8ICVA 4QJFB 4FH3A 2W7OA 4GXKA 1S77D 8ICXA 7ICHA 3IG8A 4ECXA 2KJ5A 1D9FA 5F2VO 1VFGA 1H38A 2W3SA 2YN4A 1ZJNA 4WC1A 2NV3A 4QZGA 2PBEA 3ONNA 3M9MB 4ATBA 1U47A 5ALNA 4PHEA 4LEZA 2KICA 4GIBA 3SR6A 2H3VA 5GTHU 3N7PD 1ZD3A 1QTMA 2EAMA 1X9XA 2ZH7A 3SQIA 2W9BA 3BDPA 3NUQA 3B0XA 2KVSA 2AXTU 3C1YA 2ASLA 4YXMA 3EPGA 4DSJA 2MA1A 5ALLA 7ICVA 2KZ3A 2B51A 2KFZA 4Y2SA 4EYHB 4ATBB 2QARA 4F5OA 5D62A 4R64A 3IHQB 5EWGA 1HJPA 4QWAA 3QEAZ 4KTQA 3BS5A 2FI1A 3RJHA 1S97A 4B9VA 2F44A 5AK3A 1ZQLA 3HPOA 3UQ2A 2W9BB 3WFRE 3KKAC 4O69A 2Y1JA 3N4MB 3MFHA 3KHHA 2DUYA 4O6AA 4F71A 1WWUA 3H8SA 3KD3A 5ALUA 2E5SA 2JMGA 4CF3A 2W8LA 4F91B 2Y9TA 2QARB 1VDVA 4K9BA 4FZLA 4GXIA 1LV5A 4M9GA 5AI4A 2K8AA 2MU2A 5CFTA 1KL9A 3BS5B 4QZIA 1Q79A 2WAQC 3RR7A 2ZUBA 2HHPA 2VANA 5IIIA 2ZUDA 1N60A 2OWOA 5BPCA 2LMRA 4YD2A 5CB1A 2OHFA 4Y2YA 4JLZA 5HNKA 1N5WA 3JCFA 1UPHA 4DFKA 3NWIA 2RP5A 3SD7A 4YVZA 4UAZA 2HMXA 3WK8A 5DBBA 4BJQA 2ISPA 4UB5A 1B43A 5CJ7A 4MEYA 5J2CA 4C4TA 4TURA 5ALQA 3OTQA 1MIWA 1NK9A 3OWGA 2LYAA 5BOMA 1FEZA 1PK3A 3AL0B 1TFRA 1HEKA 4KMUA 3UXOA 1SXDA 4X4RA 3V6JA 2KMDA 3Q8SB 5G5GA 1X40A 4DSEA 3WK7A 9ICMA 5KT7A 2BCSA 3CYMA 2C22A 4XRHA 2FMPA 4QZEA 4RPZA 2EANA 4RQ6A 4MFCA 5D63A 2OXOA 3Q8PB 1F0MA 4DF4A 4PZOA 4Y2QA 3AQMA 4WC0A 1IV8A 5J2DA 4M9NA 1A76A 4AT9B 5IINA 4O3QA 5L1LA 3D2NA 4K4GA 3C28A 4C7YA 4FHWA 1L7OA 3ZDAA 4O68A 5HMLA 5KFTA 5AKJA 3S6JA 5KNIA 5D49A 4DSFA 1FFVA 2I1QA 5ALDA 4U7CA 1C7YA 5ALJA 1ZETA 2HVHA 3J81j 4Q45A 1Z3EB 2FLPA 3E58A 4RQ5A 3TKAA 3ALRA 3PNCA 3DEEA 2HI0A 1Q3UA 4M9LA 3GIMA 3TQ1A 5JTIA 2M2VA 4QWCA 2Y9UA 4YMMA 1HUZA 2KFNA 2O6KA 2XC9A 5DGAA 2W55A 4J9OA 2W9AA 8ICOA 3QU7A 3D6JA 4QZDA 8ICGA 5AKLA 4RNOA 4UARA 4F5PA 4LEVA 5KG1A 3EYZA 2W11A 4K96A 4J9NA 2ZXIA 4R8UB 3KZIU 5ALOA 1NNLA 3TFSA 2P6RA 4ED6A 1ZQFA 2H3FA 5J0PA 2OCEA 4KLHA 2PFQA 3K1ZA 5AK5A 7ICTA 1TK8A 3QUTA 4Z6EA 1URJA 1S8OA 5C0YA 7ICMA 3NYBA 4UD4A 5ALIA 2ZH3A 4UBBA 4DL2A 1T3QA 3RAXA 2UVUA 3FYHA 3ER8C 7ICPA 3K75D 2M2WA 4LZDA 3GU3A 4WC2A 9ICKA 4WC7A 2HVIA 1BGXT 1ZQXA 2K4IA 2HCFA 2HBJA 1Z1VA 4DQSA 1DGJA 2BBJA 2P35A 5DB8A 8ICMA 1DXSA 4PHDA 3GV8B 5AK6A 9ICBA 4K9AA 4C7ZA 4RWOA 3VCBA 5J8YA 1SL0A 4GC6A 1RYRA 2YX8A 2AHOB 4YFKA 1ZQOA 1QSLA 1TVAA 3PR4A 3L9DA 4E80A 2V9WA 1Z1BA 2KEYA 3OGUA 1MN8A 9ICJA 5KFSA 4C80A 2HDOA 4EEKA 3AU2A 1RZTA 4TUSA 3RF9A 5KFWA 5J0TA 1FA0A 1TV9A 1QQ5A 1S0MA 2IHMA 2KTQA 3UMBA 2IOFK 4AT8B 4K4IA 2B56A 1S9FA 2K8CB 5J0SA 3TAPA 3H0MB 2DR5A 5HHIA 3RRGA 4UQGA 2HW3A 3WFSC
chains in the Genus database with same CATH topology
5TZVA 7ICEA 3G6VA 4PGQA 1R8BA 3Q8KA 2ZH1A 4QZCA 4YQWA 2DRBA 5KFYA 4F5RA 1ZQNA 5DECA 3B0YA 3QZ7A 2V4RA 4J9RA 3PW5A 4DS4A 4RQ3A 3H38A 4RQ7A 4QZHA 4QWEA 3LDAA 2AQ4A 2MUTA 3C2KA 5F9NA 1T3NA 2ZHAA 4GC7A 3RJIA 1D8YA 4IG8A 1V9PA 5KT3A 8ICYA 2ZTDA 4KN4A 3JPRA 4DLGA 1T8EA 1SKWA 3C5GA 4NKTA 4I2GA 1COOA 1ZQRA 9ICGA 7ICJA 2J6UA 4B9SA 1X2IA 1D8LA 4DS5A 2C2DA 1IM4A 3PX4A 2DPIA 1ZQMA 2ZUCA 3H39A 4O3OA 1L5UA 3M8RA 2PXIA 4E7XA 2ZH6A 1ZQPA 4R63A 5KG4A 3RAQA 3C18A 4PGYA 2A1JA 2BHNA 5IIOA 5CWRA 2R8GA 3TAQA 4PHAA 1MIVA 2ZH9A 4DL6A 1NK4A 2DR9A 4C8LA 4WBYA 3HJ4A 4ZH4A 2XY5A 1L3TA 3PR5B 3JPOA 3RJEA 2PI4A 4JV1A 4O3SA 4FS2A 1JAJA 5DKWA 3H37A 2NRWA 4KLJA 4O0IA 3SZ2A 4JWNA 3QZ8A 1S0OA 4RWPA 2XY7A 4PH5A 5HRDA 4F2RA 8ICEA 3KHLA 3PY8A 3PVXA 3ISCA 2C2RA 2PFPA 1NKBA 2IMWP 4F4KA 1KLNA 1NZPA 4WC3A 4EBKA 4F3OA 1NKCA 3THVA 2IHNA 8ICUA 1YLQA 4F5NA 2MUTB 5DQHA 4ELTA 4LT6A 2FPMA 5KFHA 3HX0A 1HUOA 4XA5A 4R65A 1UA0A 1ZQJA 4FBTA 8ICLA 4UD5A 3MR3A 2HHSA 8ICTA 4F2SA 4EP7A 3RH5A 2C28A 2HHQA 4DEZA 3LQCB 2WTFA 2NRKA 2XCPA 3MBYA 8ICBA 1UEUA 5J0QA 1OU5A 2ZH2A 3UPSA 1ZQDA 7ICRA 1UA1A 1WOTA 4I2FA 2P66A 4YG2A 4RUAA 1DGSA 4YP3A 5J2AA 3MFIA 4ECTA 4FO6A 5KFVA 2VA8A 4NLNA 3Q8MA 2MAXA 4RQ0A 4YMOA 4YN4A 4WC4A 1SL2A 5KFNA 4X4QA 4ED3A 5J0XA 5KFXA 4DL7A 1NK6A 4J9MA 3H4BA 3MABA 2W9CB 4ECYA 4X5VA 2AGQA 5DBCA 5DG9A 1RPLA 3C2MA 1NJYA 1ZQIA 1D9DA 2AU0A 2PFOA 3OV7A 1NO5A 5CA7A 3NGDA 3RJJA 5HP4A 4ED8A 1ZQBA 4F92B 3PW7A 2FPLA 3ORYA 4QW9A 2ASJA 3RR8A 4JUZA 5KFKA 3BQ1A 4IR1A 1U4BA 1X9WA 1TK5A 4IQVA 2Y1IA 3V6HA 4IQTA 1QSSA 1QLNA 3HP6A 1NKEA 8ICVA 4JK1A 2BDPA 1Q78A 3C66A 5KFEA 3C21A 4UAWA 3SI8A 7ICGA 5HRLA 4FH3A 4GXKA 4ED7A 4MFAA 5HREA 3ISBA 4E0DA 4O5EA 1S77D 8ICXA 1XWLA 5BOLA 7ICHA 2Q66A 4ECXA 1D9FA 1KFTA 4FHXA 5F2VO 1VFGA 4NM1A 1H38A 5D4BA 7ICSA 4MF8A 1BPBA 1ZJNA 1PZNA 2HHVA 3RTVA 4WC1A 1A77A 2BE3A 4RUCA 3MR6A 3UQ0A 4QZGA 1T7PA 7ICKA 5DDMA 2PBEA 9ICRA 5KFQA 1S0NA 4ATBA 3M9MB 4BGDA 5L1JA 4QZBA 2ALZA 8ICFA 2JZBA 3T5JA 5KFBA 8ICWA 2O1PA 5C5JA 1U47A 5L9XA 2R8IA 4RPYA 1SKRA 4I2BA 4DOAA 4DFPA 3RBEA 4PHEA 4RQ2A 5KFZA 4DQPA 1BPXA 8ICIA 2DR8A 5HRGA 2C2EA 4RNMA 5KG3A 4G3IA 1KFDA 4RNNA 3FDSA 4TUQA 2VA2A 4TQRA 4M2YA 3TI0A 3OJUA 2XGPA 1QTMA 4BWJA 9ICWA 2ID1A 4RQ4A 4S3NA 2W9BA 4DOCA 3BDPA 4B9NA 2ZH7A 1JMSA 4UB2A 2BPCA 3B0XA 2AGPA 1NJZA 4KLQA 1U9LA 3RH4A 3C1YA 2ASLA 1S10A 4FS1A 2BCRA 4O9MA 5J2IA 3KTQA 1R8CA 5HC9A 2DRAA 2ZHBA 4YXMA 4JV0A 3EPGA 9ICUA 4DSJA 5IIKA 4Z6DA 7ICVA 3JPQA 4J9LA 3T5LA 1ZQKA 2KZ3A 5KFGA 8ICSA 3KHRA 2ZTCA 2KFZA 4EYHB 4P4PA 3AQNA 2BQRA 3AQKA 4F5OA 4ATBB 2J6TA 1U45A 4YR0A 3Q8QB 1TFYA 2NRVA 2JZBB 1U48A 4WBZA 3PX6A 1ZQZA 4R8UA 5DG7A 4R64A 2PFNA 1BPZA 3IHQB 5EWGA 3ZDCA 1HJPA 5IIJA 4QWAA 3PW0A 3QEAZ 4KTQA 3GQCA 5DLFA 4LZGA 3OUYB 2ATLA 3WFSC 1XS9D 3SV4A 2B21A 4C8OA 2BQUA 4EBDA 1ZQUA 3RJHA 3JPNA 4F50A 2XY6A 1ZJMA 1TFWA 1XSPA 1JN3A 3H4DA 1S97A 4RPXA 1JXLA 4B9VA 3MGHA 9ICPA 1ZQLA 2FPKA 2F1JA 3UXNA 3HPOA 3UQ2A 1RXWA 9ICEA 4QZFA 1MC8A 2JEFA 2NRZA 4PGXA 2NRTA 2W9BB 2BQ3A 4EBCA 3N97B 1NJXA 4ECVA 1SKSA 8ICQA 5HRFA 2O5AA 4X4TA 3WFRE 2Y1JA 3N4MB 1T4GA 4YR2A 4RWOA 1V4AA 1RXVA 4DQRA 3OVSA 5HHHA 8ICAA 3MFHA 3KHHA 4J9SA 1CUKA 5KT4A 4B9UA 4KLUA 1BNOA 2ZH5A 3H8JA 3H8SA 4GLXA 3MR5A 2FLNA 4X4NA 3M8SA 1JIHA 5KG2A 4RU9A 4I2DA 4F91B 5J2EA 2W8LA 5DB9A 5F9LA 1ZQYA 3PMLA 3UXPA 3PW4A 2UVRA 4GXIA 1LV5A 4M9GA 4NLZA 3OVBA 4NKUA 1DK2A 4EZ6A 3RB0A 4FHYA 3K4GA 4M9JA 2ASDA 1UETA 1NK8A 3JZ0A 4QZIA 3H40A 9ICHA 1Q79A 4FH5A 4AT7A 3RR7A 2ZUBA 2KN7A 3MDAA 4I28A 1S76D 3RJGA 2HHPA 4XQ7A 4DFJA 2PI5A 4KLDA 1BPDA 1KEJA 2AQ0A 2VANA 4KLEA 3MR2A 2KP7A 2A1JB 5IIIA 3WFOA 2ZUDA 4DL5A 5KFMA 5BPCA 4UB1A 2OWOA 4YD2A 3MDCA 3T5KA 4B9TA 5CB1A 1TKDA 4C8KA 2M9NA 2F1IA 5D46A 5HNKA 4DFKA 9ICOA 2ZJAA 9ICVA 5DLGA 4DQQA 1RYSA 2M2TA 1ZQAA 1XSNA 3H8WA 4YVZA 4M6WA 8ICKA 4TQSA 4O3NA 1JXEA 5DBBA 4UAZA 3G6YA 2JEJA 4P4OA 4RZRA 4EEYA 1K1QA 1B43A 2RDIA 4UB5A 3RB4A 5CJ7A 1KSPA 2ISPA 9ICSA 4MEYA 5J2CA 3KHGA 5J0YA 2W9MA 4TURA 2HHTA 1MIWA 1NK9A 3PMNA 5KFPA 2ZTEA 1L3VA 5BOMA 3PO4A 7ICQA 5KG7A 3GIIA 5J2JA 1TFRA 3PV8A 3BQTA 3JPPA 4KMUA 2P6UA 4EYIB 3UXOA 5KFCA 4JWMA 4X4RA 3GIKA 2LYHA 3V6JA 1ZQGA 4DSIA 4M47A 4DOBA 9ICIA 1ZQHA 3Q8SB 2ZH8A 2DFLA 1K1SA 4EBJA 4Q8EA 4ELUA 5HRIA 4DSEA 2BR0A 1XC9A 5KFUA 9ICMA 5KT7A 2BCSA 5KFIA 1L3SA 4DL4A 3RRHA 2KZMA 3E2EA 4LVSA 3SV3A 1AROP 2C22A 4XRHA 2FMPA 4ED1A 4QZEA 4P2HA 5HR9A 5L1KA 4ED0A 9ICCA 5J2BA 4RPZA 4RQ6A 4MFCA 3GILA 4RQ8A 3T3FA 1L3UA 5KG6A 4AT8A 4EBEA 3Q8PB 4DF4A 3MGIA 4M6WB 4KLFA 4XUSA 3AQMA 3C1ZA 4WC0A 4KLOA 4F4XA 2BKEA 4IQUA 4Z6CA 5J2DA 4F93B 4J9PA 3TFRA 4I2IA 4C8NA 1XU4A 3EW9A 1A76A 4ECZA 4DL3A 4M9NA 2HHXA 5IILA 4AT9B 3GV7B 4I27A 3C5FA 5IINA 5CP2A 3EZ5A 4O3QA 3RB6A 1PX5A 5L1LA 4KLLA 5KFDA 4K4GA 3V6KA 8ICHA 9ICTA 2BPFA 4FHWA 5CR0A 4I2HA 5KFOA 3GV5B 3ZDAA 5HMLA 1F5AA 4PHPA 1EXNA 4BWMA 1BVSA 5KFTA 1TAQA 5IIMA 7ICOA 3Q8LA 3PO5A 1NJWA 2XCAA 5DQGA 5D49A 4DSFA 2I1QA 9ICXA 4ECRA 2DVIA 4P4MA 4NXZA 2FMSA 1ZQCA 1BNPA 4J9KA 3PW2A 1C7YA 4QZ9A 1ZETA 9ICFA 4KN7A 4Z6FA 2HVHA 4UB4A 4X4PA 4IRKA 3AU6A 4NY8A 4PPXA 4Q45A 1MSWD 4WC5A 2BCQA 3RBDA 4UAYA 3V7JA 3ZDBA 7ICIA 4NM2A 1WCLA 4M0AA 1NOMA 1QSYA 4O5CA 4Q44A 1Z3EB 5KG5A 2FLPA 2JEGA 2R8KA 4RQ5A 4R66A 3GIJA 3LWLA 7ICFA 4O5KA 3TANA 5HRHA 1ZQWA 3EPIA 1ZQTA 3PNCA 2UVWA 4TUPA 4I2EA 3M9OB 3HT3A 1CEZA 1TAUA 1Y88A 4C8MA 4DSKA 5J0WA 5KFLA 1JX4A 4M9LA 1KDHA 4X4VA 3GIMA 5J2FA 1ZQVA 1BPEA 3TQ1A 5EWEA 9ICAA 5HMMA 2M2VA 1XO1A 4QWCA 4YMMA 1HUZA 2KFNA 3RB3A 3ZD9A 5J0RA 1MQ2A 2XC9A 4O3RA 5DGAA 3OHAA 5KG0A 4MF2A 1NK7A 4J9OA 2W9AA 4O3PA 4RT2A 2BPGA 3SYZA 4CCHA 8ICOA 4QZDA 4I2JA 8ICGA 4M04A 2FLLA 4FBUA 4KLMA 4RNOA 1VJ7A 4RQ1A 2R8HA 4QZAA 4F5PA 3PX0A 4RWQA 5KG1A 3LK9A 3EYZA 3V72A 4J9NA 4QWBA 4AT9A 4IR9A 5KFJA 4R8UB 1X9SA 4JV2A 1DOQA 1R89A 4B9MA 3TFSA 8ICRA 4X4SA 3QE9Y 3ETLA 1NK0A 2P6RA 3RJFA 5KTQA 5KT5A 4ED6A 1ZQFA 4KLSA 4J9QA 2H5XA 2ZJ8A 5J0PA 3QEBZ 1JQRA 5J0OA 2PFQA 4KLHA 4F5QA 4F4YA 1TK0A 3H7IA 1SZPA 4WCWA 5J29A 3JPTA 2F1HA 2W9CA 3UPQA 7ICTA 2XGQA 3BJYA 1TK8A 1ZQSA 4ECWA 4Z6EA 2ZH4A 5HRKA 3OHBA 3Q8RB 3LWMA 2Q0ZX 2AGOA 4ECUA 4NLGA 4UB3A 4DWIA 1UT8A 4DQIA 1XSLA 4NLKA 9ICQA 2DR7A 3M9NB 2BGWA 5DB7A 7ICMA 2FMQA 5J2HA 3NYBA 2KZZA 4QZ8A 4BXOA 3GDXA 4I2CA 2M2UA 3HWTA 2DPJA 4UD4A 7ICUA 1B22A 2ZH3A 4UBBA 4DL2A 3RAXA 2UVUA 3FYHA 3BQ0A 7ICPA 3AUOA 1N56A 3T5HA 3K75D 2M2WA 1U49A 3V7KA 4LZDA 4YCXA 4WC2A 3NTUA 4I29A 9ICKA 4WC7A 8ICCA 2HVIA 4AT7B 4KLTA 5JUMA 3C2LA 1BGXT 4EZ9A 2R8JA 1MIYA 4WC6A 4IRDA 1ZQXA 4MEXA 1Z00A 5DGBA 1KTQA 3RJKA 2AJQA 4DQSA 1ZQQA 1IXRA 5DB8A 4X0BA 3BQ2A 4ELVA 4M5DA 7ICLA 4M9HA 8ICMA 3TARA 1ZYQA 5J0UA 1N48A 4PHDA 5J2GA 3GV8B 4F8RA 3ZDEA 4ECSA 9ICBA 2IBKA 2BCVA 5EOZA 1DK3A 3ZD8A 5DG8A 3IM1A 4RT3A 9ICLA 4QW8A 1WCNA 5J2KA 4GC6A 4F4ZA 4UBCA 1SL0A 1RYRA 3JYYA 4BXOB 4YFKA 4MFFA 4X4OA 4B9LA 3OSNA 3OSPA 5EWFA 4DFMA 4KITB 8ICZA 1KNYA 4YMNA 4K4HA 3HIYA 4RWNA 5DDYA 2RDJA 1ZQOA 3WFPA 4HYKA 1TVAA 3PR4A 3JPSA 3HW8A 1QSLA 4BDPA 3L9DA 5DEDA 4E80A 1KRPA 2V9WA 4KLIA 5KFRA 8ICJA 3OGUA 9ICJA 4Q8FA 5KFSA 4YD1A 2BCUA 2HHUA 4X0AA 5KT2A 3AU2A 3OVAA 1RZTA 4TUSA 3H3AA 2GWSA 1Z00B 5KFFA 5KT6A 2NRXA 4ECQA 2ZJ5A 5KFWA 5J0TA 1BPYA 3ISDA 5CHGA 1LB2B 4DSLA 1TV9A 1SL1A 5DB6A 1FA0A 2V4QA 1S0MA 3ZDDA 4FHVA 4KLGA 4YR3A 5DQIA 2IHMA 4E8FA 4DF8A 2KTQA 4YXJA 2RFFA 3RH6A 1X9MA 2XO7A 3G6XA 1MQ3A 5HRBA 2I9GA 3OUYA 9ICNA 4AT8B 4K4IA 2IA6A 4X4UA 2VA3A 1UT5A 4I2AA 2HHWA 4FHPA 5DBAA 2JEIA 1S9FA 8ICNA 3V7LA 3C23A 4IQWA 1UEVA 2J6SA 5J0SA 5KFAA 3TAPA 3AQLA 3EWAA 4IRCA 2DR5A 3OJSA 4F4WA 5HHIA 3WFQE 4DO9A 4XQ8A 1S0VA 1KFSA 2W8KA 3RRGA 3GFKB 5L1IA 7ICNA 4UQGA 4DLEA 1R8AA 2HW3A 4ED2A 1NK5A 4Q43A 4GXJA 4QWDA 1ZQEA 3HJ1A 2ISOA 8ICPA 2UVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TZV A;  7ICE A;  3G6V A;  4PGQ A;  1R8B A;  3Q8K A;  2ZH1 A;  4QZC A;  4YQW A;  2DRB A;  5KFY A;  4F5R A;  1ZQN A;  5DEC A;  3B0Y A;  3QZ7 A;  2V4R A;  4J9R A;  3PW5 A;  4DS4 A;  4RQ3 A;  3H38 A;  4RQ7 A;  4QZH A;  4QWE A;  3LDA A;  2AQ4 A;  2MUT A;  3C2K A;  5F9N A;  1T3N A;  2ZHA A;  4GC7 A;  3RJI A;  1D8Y A;  4IG8 A;  1V9P A;  5KT3 A;  8ICY A;  2ZTD A;  4KN4 A;  3JPR A;  4DLG A;  1T8E A;  1SKW A;  3C5G A;  4NKT A;  4I2G A;  1COO A;  1ZQR A;  9ICG A;  7ICJ A;  2J6U A;  4B9S A;  1X2I A;  1D8L A;  4DS5 A;  2C2D A;  1IM4 A;  3PX4 A;  2DPI A;  1ZQM A;  2ZUC A;  3H39 A;  4O3O A;  1L5U A;  3M8R A;  2PXI A;  4E7X A;  2ZH6 A;  1ZQP A;  4R63 A;  5KG4 A;  3RAQ A;  3C18 A;  4PGY A;  2A1J A;  2BHN A;  5IIO A;  5CWR A;  2R8G A;  3TAQ A;  4PHA A;  1MIV A;  2ZH9 A;  4DL6 A;  1NK4 A;  2DR9 A;  4C8L A;  4WBY A;  3HJ4 A;  4ZH4 A;  2XY5 A;  1L3T A;  3PR5 B;  3JPO A;  3RJE A;  2PI4 A;  4JV1 A;  4O3S A;  4FS2 A;  1JAJ A;  5DKW A;  3H37 A;  2NRW A;  4KLJ A;  4O0I A;  3SZ2 A;  4JWN A;  3QZ8 A;  1S0O A;  4RWP A;  2XY7 A;  4PH5 A;  5HRD A;  4F2R A;  8ICE A;  3KHL A;  3PY8 A;  3PVX A;  3ISC A;  2C2R A;  2PFP A;  1NKB A;  2IMW P;  4F4K A;  1KLN A;  1NZP A;  4WC3 A;  4EBK A;  4F3O A;  1NKC A;  3THV A;  2IHN A;  8ICU A;  1YLQ A;  4F5N A;  2MUT B;  5DQH A;  4ELT A;  4LT6 A;  2FPM A;  5KFH A;  3HX0 A;  1HUO A;  4XA5 A;  4R65 A;  1UA0 A;  1ZQJ A;  4FBT A;  8ICL A;  4UD5 A;  3MR3 A;  2HHS A;  8ICT A;  4F2S A;  4EP7 A;  3RH5 A;  2C28 A;  2HHQ A;  4DEZ A;  3LQC B;  2WTF A;  2NRK A;  2XCP A;  3MBY A;  8ICB A;  1UEU A;  5J0Q A;  1OU5 A;  2ZH2 A;  3UPS A;  1ZQD A;  7ICR A;  1UA1 A;  1WOT A;  4I2F A;  2P66 A;  4YG2 A;  4RUA A;  1DGS A;  4YP3 A;  5J2A A;  3MFI A;  4ECT A;  4FO6 A;  5KFV A;  2VA8 A;  4NLN A;  3Q8M A;  2MAX A;  4RQ0 A;  4YMO A;  4YN4 A;  4WC4 A;  1SL2 A;  5KFN A;  4X4Q A;  4ED3 A;  5J0X A;  5KFX A;  4DL7 A;  1NK6 A;  4J9M A;  3H4B A;  3MAB A;  2W9C B;  4ECY A;  4X5V A;  2AGQ A;  5DBC A;  5DG9 A;  1RPL A;  3C2M A;  1NJY A;  1ZQI A;  1D9D A;  2AU0 A;  2PFO A;  3OV7 A;  1NO5 A;  5CA7 A;  3NGD A;  3RJJ A;  5HP4 A;  4ED8 A;  1ZQB A;  4F92 B;  3PW7 A;  2FPL A;  3ORY A;  4QW9 A;  2ASJ A;  3RR8 A;  4JUZ A;  5KFK A;  3BQ1 A;  4IR1 A;  1U4B A;  1X9W A;  1TK5 A;  4IQV A;  2Y1I A;  3V6H A;  4IQT A;  1QSS A;  1QLN A;  3HP6 A;  1NKE A;  8ICV A;  4JK1 A;  2BDP A;  1Q78 A;  3C66 A;  5KFE A;  3C21 A;  4UAW A;  3SI8 A;  7ICG A;  5HRL A;  4FH3 A;  4GXK A;  4ED7 A;  4MFA A;  5HRE A;  3ISB A;  4E0D A;  4O5E A;  1S77 D;  8ICX A;  1XWL A;  5BOL A;  7ICH A;  2Q66 A;  4ECX A;  1D9F A;  1KFT A;  4FHX A;  5F2V O;  1VFG A;  4NM1 A;  1H38 A;  5D4B A;  7ICS A;  4MF8 A;  1BPB A;  1ZJN A;  1PZN A;  2HHV A;  3RTV A;  4WC1 A;  1A77 A;  2BE3 A;  4RUC A;  3MR6 A;  3UQ0 A;  4QZG A;  1T7P A;  7ICK A;  5DDM A;  2PBE A;  9ICR A;  5KFQ A;  1S0N A;  4ATB A;  3M9M B;  4BGD A;  5L1J A;  4QZB A;  2ALZ A;  8ICF A;  2JZB A;  3T5J A;  5KFB A;  8ICW A;  2O1P A;  5C5J A;  1U47 A;  5L9X A;  2R8I A;  4RPY A;  1SKR A;  4I2B A;  4DOA A;  4DFP A;  3RBE A;  4PHE A;  4RQ2 A;  5KFZ A;  4DQP A;  1BPX A;  8ICI A;  2DR8 A;  5HRG A;  2C2E A;  4RNM A;  5KG3 A;  4G3I A;  1KFD A;  4RNN A;  3FDS A;  4TUQ A;  2VA2 A;  4TQR A;  4M2Y A;  3TI0 A;  3OJU A;  2XGP A;  1QTM A;  4BWJ A;  9ICW A;  2ID1 A;  4RQ4 A;  4S3N A;  2W9B A;  4DOC A;  3BDP A;  4B9N A;  2ZH7 A;  1JMS A;  4UB2 A;  2BPC A;  3B0X A;  2AGP A;  1NJZ A;  4KLQ A;  1U9L A;  3RH4 A;  3C1Y A;  2ASL A;  1S10 A;  4FS1 A;  2BCR A;  4O9M A;  5J2I A;  3KTQ A;  1R8C A;  5HC9 A;  2DRA A;  2ZHB A;  4YXM A;  4JV0 A;  3EPG A;  9ICU A;  4DSJ A;  5IIK A;  4Z6D A;  7ICV A;  3JPQ A;  4J9L A;  3T5L A;  1ZQK A;  2KZ3 A;  5KFG A;  8ICS A;  3KHR A;  2ZTC A;  2KFZ A;  4EYH B;  4P4P A;  3AQN A;  2BQR A;  3AQK A;  4F5O A;  4ATB B;  2J6T A;  1U45 A;  4YR0 A;  3Q8Q B;  1TFY A;  2NRV A;  2JZB B;  1U48 A;  4WBZ A;  3PX6 A;  1ZQZ A;  4R8U A;  5DG7 A;  4R64 A;  2PFN A;  1BPZ A;  3IHQ B;  5EWG A;  3ZDC A;  1HJP A;  5IIJ A;  4QWA A;  3PW0 A;  3QEA Z;  4KTQ A;  3GQC A;  5DLF A;  4LZG A;  3OUY B;  2ATL A;  3WFS C;  1XS9 D;  3SV4 A;  2B21 A;  4C8O A;  2BQU A;  4EBD A;  1ZQU A;  3RJH A;  3JPN A;  4F50 A;  2XY6 A;  1ZJM A;  1TFW A;  1XSP A;  1JN3 A;  3H4D A;  1S97 A;  4RPX A;  1JXL A;  4B9V A;  3MGH A;  9ICP A;  1ZQL A;  2FPK A;  2F1J A;  3UXN A;  3HPO A;  3UQ2 A;  1RXW A;  9ICE A;  4QZF A;  1MC8 A;  2JEF A;  2NRZ A;  4PGX A;  2NRT A;  2W9B B;  2BQ3 A;  4EBC A;  3N97 B;  1NJX A;  4ECV A;  1SKS A;  8ICQ A;  5HRF A;  2O5A A;  4X4T A;  3WFR E;  2Y1J A;  3N4M B;  1T4G A;  4YR2 A;  4RWO A;  1V4A A;  1RXV A;  4DQR A;  3OVS A;  5HHH A;  8ICA A;  3MFH A;  3KHH A;  4J9S A;  1CUK A;  5KT4 A;  4B9U A;  4KLU A;  1BNO A;  2ZH5 A;  3H8J A;  3H8S A;  4GLX A;  3MR5 A;  2FLN A;  4X4N A;  3M8S A;  1JIH A;  5KG2 A;  4RU9 A;  4I2D A;  4F91 B;  5J2E A;  2W8L A;  5DB9 A;  5F9L A;  1ZQY A;  3PML A;  3UXP A;  3PW4 A;  2UVR A;  4GXI A;  1LV5 A;  4M9G A;  4NLZ A;  3OVB A;  4NKU A;  1DK2 A;  4EZ6 A;  3RB0 A;  4FHY A;  3K4G A;  4M9J A;  2ASD A;  1UET A;  1NK8 A;  3JZ0 A;  4QZI A;  3H40 A;  9ICH A;  1Q79 A;  4FH5 A;  4AT7 A;  3RR7 A;  2ZUB A;  2KN7 A;  3MDA A;  4I28 A;  1S76 D;  3RJG A;  2HHP A;  4XQ7 A;  4DFJ A;  2PI5 A;  4KLD A;  1BPD A;  1KEJ A;  2AQ0 A;  2VAN A;  4KLE A;  3MR2 A;  2KP7 A;  2A1J B;  5III A;  3WFO A;  2ZUD A;  4DL5 A;  5KFM A;  5BPC A;  4UB1 A;  2OWO A;  4YD2 A;  3MDC A;  3T5K A;  4B9T A;  5CB1 A;  1TKD A;  4C8K A;  2M9N A;  2F1I A;  5D46 A;  5HNK A;  4DFK A;  9ICO A;  2ZJA A;  9ICV A;  5DLG A;  4DQQ A;  1RYS A;  2M2T A;  1ZQA A;  1XSN A;  3H8W A;  4YVZ A;  4M6W A;  8ICK A;  4TQS A;  4O3N A;  1JXE A;  5DBB A;  4UAZ A;  3G6Y A;  2JEJ A;  4P4O A;  4RZR A;  4EEY A;  1K1Q A;  1B43 A;  2RDI A;  4UB5 A;  3RB4 A;  5CJ7 A;  1KSP A;  2ISP A;  9ICS A;  4MEY A;  5J2C A;  3KHG A;  5J0Y A;  2W9M A;  4TUR A;  2HHT A;  1MIW A;  1NK9 A;  3PMN A;  5KFP A;  2ZTE A;  1L3V A;  5BOM A;  3PO4 A;  7ICQ A;  5KG7 A;  3GII A;  5J2J A;  1TFR A;  3PV8 A;  3BQT A;  3JPP A;  4KMU A;  2P6U A;  4EYI B;  3UXO A;  5KFC A;  4JWM A;  4X4R A;  3GIK A;  2LYH A;  3V6J A;  1ZQG A;  4DSI A;  4M47 A;  4DOB A;  9ICI A;  1ZQH A;  3Q8S B;  2ZH8 A;  2DFL A;  1K1S A;  4EBJ A;  4Q8E A;  4ELU A;  5HRI A;  4DSE A;  2BR0 A;  1XC9 A;  5KFU A;  9ICM A;  5KT7 A;  2BCS A;  5KFI A;  1L3S A;  4DL4 A;  3RRH A;  2KZM A;  3E2E A;  4LVS A;  3SV3 A;  1ARO P;  2C22 A;  4XRH A;  2FMP A;  4ED1 A;  4QZE A;  4P2H A;  5HR9 A;  5L1K A;  4ED0 A;  9ICC A;  5J2B A;  4RPZ A;  4RQ6 A;  4MFC A;  3GIL A;  4RQ8 A;  3T3F A;  1L3U A;  5KG6 A;  4AT8 A;  4EBE A;  3Q8P B;  4DF4 A;  3MGI A;  4M6W B;  4KLF A;  4XUS A;  3AQM A;  3C1Z A;  4WC0 A;  4KLO A;  4F4X A;  2BKE A;  4IQU A;  4Z6C A;  5J2D A;  4F93 B;  4J9P A;  3TFR A;  4I2I A;  4C8N A;  1XU4 A;  3EW9 A;  1A76 A;  4ECZ A;  4DL3 A;  4M9N A;  2HHX A;  5IIL A;  4AT9 B;  3GV7 B;  4I27 A;  3C5F A;  5IIN A;  5CP2 A;  3EZ5 A;  4O3Q A;  3RB6 A;  1PX5 A;  5L1L A;  4KLL A;  5KFD A;  4K4G A;  3V6K A;  8ICH A;  9ICT A;  2BPF A;  4FHW A;  5CR0 A;  4I2H A;  5KFO A;  3GV5 B;  3ZDA A;  5HML A;  1F5A A;  4PHP A;  1EXN A;  4BWM A;  1BVS A;  5KFT A;  1TAQ A;  5IIM A;  7ICO A;  3Q8L A;  3PO5 A;  1NJW A;  2XCA A;  5DQG A;  5D49 A;  4DSF A;  2I1Q A;  9ICX A;  4ECR A;  2DVI A;  4P4M A;  4NXZ A;  2FMS A;  1ZQC A;  1BNP A;  4J9K A;  3PW2 A;  1C7Y A;  4QZ9 A;  1ZET A;  9ICF A;  4KN7 A;  4Z6F A;  2HVH A;  4UB4 A;  4X4P A;  4IRK A;  3AU6 A;  4NY8 A;  4PPX A;  4Q45 A;  1MSW D;  4WC5 A;  2BCQ A;  3RBD A;  4UAY A;  3V7J A;  3ZDB A;  7ICI A;  4NM2 A;  1WCL A;  4M0A A;  1NOM A;  1QSY A;  4O5C A;  4Q44 A;  1Z3E B;  5KG5 A;  2FLP A;  2JEG A;  2R8K A;  4RQ5 A;  4R66 A;  3GIJ A;  3LWL A;  7ICF A;  4O5K A;  3TAN A;  5HRH A;  1ZQW A;  3EPI A;  1ZQT A;  3PNC A;  2UVW A;  4TUP A;  4I2E A;  3M9O B;  3HT3 A;  1CEZ A;  1TAU A;  1Y88 A;  4C8M A;  4DSK A;  5J0W A;  5KFL A;  1JX4 A;  4M9L A;  1KDH A;  4X4V A;  3GIM A;  5J2F A;  1ZQV A;  1BPE A;  3TQ1 A;  5EWE A;  9ICA A;  5HMM A;  2M2V A;  1XO1 A;  4QWC A;  4YMM A;  1HUZ A;  2KFN A;  3RB3 A;  3ZD9 A;  5J0R A;  1MQ2 A;  2XC9 A;  4O3R A;  5DGA A;  3OHA A;  5KG0 A;  4MF2 A;  1NK7 A;  4J9O A;  2W9A A;  4O3P A;  4RT2 A;  2BPG A;  3SYZ A;  4CCH A;  8ICO A;  4QZD A;  4I2J A;  8ICG A;  4M04 A;  2FLL A;  4FBU A;  4KLM A;  4RNO A;  1VJ7 A;  4RQ1 A;  2R8H A;  4QZA A;  4F5P A;  3PX0 A;  4RWQ A;  5KG1 A;  3LK9 A;  3EYZ A;  3V72 A;  4J9N A;  4QWB A;  4AT9 A;  4IR9 A;  5KFJ A;  4R8U B;  1X9S A;  4JV2 A;  1DOQ A;  1R89 A;  4B9M A;  3TFS A;  8ICR A;  4X4S A;  3QE9 Y;  3ETL A;  1NK0 A;  2P6R A;  3RJF A;  5KTQ A;  5KT5 A;  4ED6 A;  1ZQF A;  4KLS A;  4J9Q A;  2H5X A;  2ZJ8 A;  5J0P A;  3QEB Z;  1JQR A;  5J0O A;  2PFQ A;  4KLH A;  4F5Q A;  4F4Y A;  1TK0 A;  3H7I A;  1SZP A;  4WCW A;  5J29 A;  3JPT A;  2F1H A;  2W9C A;  3UPQ A;  7ICT A;  2XGQ A;  3BJY A;  1TK8 A;  1ZQS A;  4ECW A;  4Z6E A;  2ZH4 A;  5HRK A;  3OHB A;  3Q8R B;  3LWM A;  2Q0Z X;  2AGO A;  4ECU A;  4NLG A;  4UB3 A;  4DWI A;  1UT8 A;  4DQI A;  1XSL A;  4NLK A;  9ICQ A;  2DR7 A;  3M9N B;  2BGW A;  5DB7 A;  7ICM A;  2FMQ A;  5J2H A;  3NYB A;  2KZZ A;  4QZ8 A;  4BXO A;  3GDX A;  4I2C A;  2M2U A;  3HWT A;  2DPJ A;  4UD4 A;  7ICU A;  1B22 A;  2ZH3 A;  4UBB A;  4DL2 A;  3RAX A;  2UVU A;  3FYH A;  3BQ0 A;  7ICP A;  3AUO A;  1N56 A;  3T5H A;  3K75 D;  2M2W A;  1U49 A;  3V7K A;  4LZD A;  4YCX A;  4WC2 A;  3NTU A;  4I29 A;  9ICK A;  4WC7 A;  8ICC A;  2HVI A;  4AT7 B;  4KLT A;  5JUM A;  3C2L A;  1BGX T;  4EZ9 A;  2R8J A;  1MIY A;  4WC6 A;  4IRD A;  1ZQX A;  4MEX A;  1Z00 A;  5DGB A;  1KTQ A;  3RJK A;  2AJQ A;  4DQS A;  1ZQQ A;  1IXR A;  5DB8 A;  4X0B A;  3BQ2 A;  4ELV A;  4M5D A;  7ICL A;  4M9H A;  8ICM A;  3TAR A;  1ZYQ A;  5J0U A;  1N48 A;  4PHD A;  5J2G A;  3GV8 B;  4F8R A;  3ZDE A;  4ECS A;  9ICB A;  2IBK A;  2BCV A;  5EOZ A;  1DK3 A;  3ZD8 A;  5DG8 A;  3IM1 A;  4RT3 A;  9ICL A;  4QW8 A;  1WCN A;  5J2K A;  4GC6 A;  4F4Z A;  4UBC A;  1SL0 A;  1RYR A;  3JYY A;  4BXO B;  4YFK A;  4MFF A;  4X4O A;  4B9L A;  3OSN A;  3OSP A;  5EWF A;  4DFM A;  4KIT B;  8ICZ A;  1KNY A;  4YMN A;  4K4H A;  3HIY A;  4RWN A;  5DDY A;  2RDJ A;  1ZQO A;  3WFP A;  4HYK A;  1TVA A;  3PR4 A;  3JPS A;  3HW8 A;  1QSL A;  4BDP A;  3L9D A;  5DED A;  4E80 A;  1KRP A;  2V9W A;  4KLI A;  5KFR A;  8ICJ A;  3OGU A;  9ICJ A;  4Q8F A;  5KFS A;  4YD1 A;  2BCU A;  2HHU A;  4X0A A;  5KT2 A;  3AU2 A;  3OVA A;  1RZT A;  4TUS A;  3H3A A;  2GWS A;  1Z00 B;  5KFF A;  5KT6 A;  2NRX A;  4ECQ A;  2ZJ5 A;  5KFW A;  5J0T A;  1BPY A;  3ISD A;  5CHG A;  1LB2 B;  4DSL A;  1TV9 A;  1SL1 A;  5DB6 A;  1FA0 A;  2V4Q A;  1S0M A;  3ZDD A;  4FHV A;  4KLG A;  4YR3 A;  5DQI A;  2IHM A;  4E8F A;  4DF8 A;  2KTQ A;  4YXJ A;  2RFF A;  3RH6 A;  1X9M A;  2XO7 A;  3G6X A;  1MQ3 A;  5HRB A;  2I9G A;  3OUY A;  9ICN A;  4AT8 B;  4K4I A;  2IA6 A;  4X4U A;  2VA3 A;  1UT5 A;  4I2A A;  2HHW A;  4FHP A;  5DBA A;  2JEI A;  1S9F A;  8ICN A;  3V7L A;  3C23 A;  4IQW A;  1UEV A;  2J6S A;  5J0S A;  5KFA A;  3TAP A;  3AQL A;  3EWA A;  4IRC A;  2DR5 A;  3OJS A;  4F4W A;  5HHI A;  3WFQ E;  4DO9 A;  4XQ8 A;  1S0V A;  1KFS A;  2W8K A;  3RRG A;  3GFK B;  5L1I A;  7ICN A;  4UQG A;  4DLE A;  1R8A A;  2HW3 A;  4ED2 A;  1NK5 A;  4Q43 A;  4GXJ A;  4QWD A;  1ZQE A;  3HJ1 A;  2ISO A;  8ICP A;  2UVV A; 
#chains in the Genus database with same CATH topology
 3Q8K A;  4BX9 C;  1XO0 A;  2VJ4 A;  4RQ3 A;  5JTG A;  3KBB A;  2MUT A;  1T3N A;  5F9N A;  3RJI A;  3OPX A;  3T79 A;  2XVT A;  3C5G A;  4NKT A;  1COO A;  9ICG A;  2XIC A;  1D8L A;  2DPI A;  1L8O A;  4O3O A;  3M8R A;  1ZQP A;  4PGY A;  2A1J A;  1WG8 A;  3D2S A;  2R8G A;  3TAQ A;  4DL6 A;  3NVY A;  4C8L A;  3PR5 B;  3H37 A;  1JAJ A;  2ZIW A;  3I1Y A;  3QZ8 A;  4N7R A;  4PH5 A;  8ICE A;  3PVX A;  2C2R A;  1CI4 A;  1RQN A;  2IHN A;  3O0F A;  2MUT B;  4ELT A;  5KFH A;  1HUO A;  2HN2 A;  3FM9 A;  2G09 A;  3RH5 A;  5TIS U;  5J0Q A;  3K1R B;  4ECT A;  4NLN A;  3TAD C;  3Q8M A;  2MAX A;  4BUG A;  4YMO A;  2ZIW B;  5KFX A;  4ICA A;  4J9M A;  2W9C B;  3MAB A;  1D9D A;  5DBC A;  2AU0 A;  1GO3 F;  1NO5 A;  3RJJ A;  4ED8 A;  3PW7 A;  4OAH A;  5KFK A;  3BQ1 A;  4IQT A;  4JK1 A;  1JUD A;  4NJ8 A;  5JRT A;  3C66 A;  4UAW A;  7ICG A;  2EZY A;  2JXJ A;  4ED7 A;  5HRE A;  4E0D A;  4O5E A;  3KKA A;  4OJP A;  4QIW C;  3WU2 U;  4NM1 A;  7ICS A;  1BPB A;  2HHV A;  5HR6 A;  3MR6 A;  1T7P A;  5DDM A;  9ICR A;  5KFQ A;  5L1J A;  4QZB A;  2I5H A;  2ALZ A;  8ICF A;  2JZB A;  3T5J A;  1FIQ A;  4CNQ A;  1SKR A;  5EE0 A;  4A8E A;  5KFZ A;  2DR8 A;  1BPX A;  5ALR A;  1Z19 A;  2W03 A;  4RNM A;  2C2E A;  4G3I A;  3FDS A;  4TUQ A;  5AIC A;  2XGP A;  1Q3V A;  9ICW A;  4DOC A;  1JMS A;  1U9L A;  2BCR A;  4FS1 A;  2IHO A;  3SEI A;  9ICU A;  5IIK A;  2CPR A;  1ZQK A;  5KFG A;  3UMG A;  3AQN A;  2BQR A;  2J6T A;  1U45 A;  2NRV A;  2JZB B;  4WBZ A;  3PX6 A;  1ZQZ A;  2B0C A;  3AN1 A;  3M6Z A;  4HAI A;  2K89 A;  2XY6 A;  3MGH A;  9ICE A;  2JEF A;  5CHE A;  4PGX A;  2BQ3 A;  2OH2 A;  2EAO A;  4EBC A;  4X4T A;  4ECV A;  2H3Z A;  3QUQ A;  1T4G A;  1MA7 A;  4CGZ A;  2DGZ A;  1CUK A;  4B9U A;  1PK1 A;  3K7D A;  3WKE A;  3WK6 A;  3H0R B;  4RU9 A;  2YMQ A;  1K5O A;  5J2E A;  4B6J A;  3CW2 C;  1B4F A;  2H3Q A;  4EZ6 A;  3RB0 A;  4MHV A;  2FDR A;  2F76 X;  1UET A;  5CFS A;  2KN7 A;  3MDA A;  4XQ7 A;  3NVV A;  4DFJ A;  4OJ5 A;  2PI5 A;  1WUD A;  3M1Y A;  1BPD A;  4F72 A;  2KP7 A;  3WFO A;  4DL5 A;  2JHD A;  4C8K A;  3T5K A;  3SAG A;  9ICO A;  5F3X B;  2ZJA A;  2E8O A;  3IV6 A;  3H8W A;  2IUB A;  4QIW F;  1PK1 B;  4UAV A;  5GTI U;  7ICQ A;  3PO4 A;  1FFU A;  2LM4 A;  2P6U A;  4EYI B;  5KFC A;  1D8B A;  3GIK A;  4M47 A;  3KZX A;  2DFL A;  4EV6 A;  4CDG A;  4EEB A;  2KKP A;  5KFU A;  1L3S A;  3E2E A;  1WYG A;  3FC4 A;  4LVS A;  3SV3 A;  5HR9 A;  2E3T A;  4RQN A;  9ICC A;  2KSO A;  3B9J A;  5ALH A;  3GIL A;  5KG6 A;  1RQL A;  3PZP A;  2NO4 A;  4KLF A;  4F4X A;  2BKE A;  4NXU A;  3AMZ A;  4F93 B;  4J9P A;  3EW9 A;  3HKZ C;  4ECZ A;  5IIL A;  2K4E A;  5CP2 A;  1SWV A;  1PX5 A;  8ICH A;  3V6K A;  2HOI A;  2BPF A;  4I2H A;  4NLB A;  4I0U A;  4BWM A;  4PZN A;  4HX0 A;  3Q8L A;  1NJW A;  2XCA A;  3U26 A;  2DVI A;  4Y2V A;  2KSO B;  1BNP A;  2GO7 A;  4X4P A;  3AU6 A;  4PPX A;  2WB1 F;  4NM2 A;  3LYS A;  1QSY A;  5G5H A;  4CE6 A;  2BBH A;  1NZB A;  2HOF A;  4O5K A;  7ICF A;  1ZQW A;  4UAS A;  2VIX A;  3M9O B;  1CEZ A;  1TAU A;  2OM6 A;  4C8M A;  1KDH A;  1ZQV A;  3RB3 A;  3ZD9 A;  4O3R A;  4MF2 A;  3SYZ A;  5AKG A;  2E1E A;  4KLM A;  4RQ1 A;  2R8H A;  4RWQ A;  2Y0S C;  2W43 A;  4AP9 A;  5ALW A;  4QWB A;  4IR9 A;  1SXE A;  1X9S A;  4JV2 A;  1ZD5 A;  2HBL A;  3RJF A;  5ALE A;  1L7M A;  2H5X A;  3NRW A;  1B0X A;  5J0O A;  4AYB F;  4F5Q A;  1TK0 A;  4WCW A;  3JPT A;  3NKU A;  5EE3 A;  3BJY A;  4ECW A;  1ZQ1 C;  3BZC A;  3OHB A;  3NVW A;  1ZRN A;  4ECU A;  4NLG A;  1UT8 A;  1XSL A;  1ZRM A;  2FMQ A;  2LHT A;  4I2C A;  4Y2R A;  4K97 A;  1LKY A;  1A0P A;  2NO5 A;  2WF8 A;  3BQ0 A;  3T5H A;  4MKP A;  1U49 A;  2WF6 A;  4YCX A;  3UM9 A;  5KAI U;  4I29 A;  4EGW A;  8ICC A;  2CRX A;  2R8J A;  4MEX A;  5DGB A;  1KTQ A;  2JR5 A;  3CK6 A;  3BQ2 A;  4P0P A;  1J2M A;  1ZYQ A;  2JRZ A;  3ZDE A;  4ECS A;  2BCV A;  4RT3 A;  3IM1 A;  9ICL A;  2ZH9 A;  5J2K A;  1WCN A;  4F4Z A;  4UBC A;  2F2A B;  3A0H U;  4B9L A;  3OSN A;  4Y2U A;  1J2N A;  8ICZ A;  4K4H A;  3WFP A;  3ER9 B;  4HYK A;  4YD1 A;  5KT2 A;  3MGV A;  3WK4 A;  2GWS A;  5KT6 A;  2NRX A;  1BPY A;  5CHG A;  4DSL A;  2V4Q A;  2KOB A;  3ZDD A;  4FHV A;  4KLG A;  3BS7 A;  4E8F A;  2FCL A;  2RFF A;  3OUY A;  5HRB A;  1QQ7 A;  3E0F A;  9ICN A;  2GAF D;  4I2A A;  4FHP A;  1SIJ A;  2OEH A;  1ED1 A;  1T94 A;  3TAC B;  4CRX A;  4IRC A;  3OJS A;  4F4W A;  3TAD A;  2Y0S F;  4OAF A;  1R8A A;  4ED2 A;  4GXJ A;  3LVV A;  2ISO A;  2YB4 A;  2UVV A;  4ZOH C;  7ICE A;  1R8B A;  5E79 U;  2DRB A;  5KFY A;  4F5R A;  5DEC A;  2G5I B;  2WAQ F;  5H2F U;  4K8V A;  4RQ7 A;  2XID A;  1SZH A;  3C2K A;  2ZHA A;  1V9P A;  2ZTD A;  1T8E A;  3EUB 2;  1ZQR A;  1ZD4 A;  5AM3 A;  4USA A;  2C2D A;  3QUB A;  2K4P A;  2ZUC A;  2ZH6 A;  3C18 A;  4NXT A;  5IIO A;  5CWR A;  2FE9 A;  2DR9 A;  4WBY A;  2XY5 A;  1L3T A;  5B3Q A;  2ZH5 A;  4JV1 A;  3ERC C;  2EZX A;  4C4R A;  4O3S A;  3SZ2 A;  4JWN A;  1C20 A;  3PY8 A;  3ISC A;  1NKB A;  2IMW P;  4EX6 A;  1YLQ A;  4LEY A;  2FPM A;  1ZQJ A;  3MR3 A;  2HN1 A;  2CXY A;  4EP7 A;  2XCP A;  2ZH2 A;  2EQY A;  2ES6 A;  4YG2 A;  4WQL A;  1DGS A;  3F2C A;  3KOO A;  3MFI A;  5KFV A;  2VA8 A;  5AI8 A;  4YN4 A;  1SL2 A;  2B6G A;  5KFN A;  2HSZ A;  3WK5 A;  4ECY A;  1NJY A;  3C2M A;  2PFO A;  1ZQI A;  3SMV A;  4KB6 A;  5AKK A;  5A0L A;  1ZQB A;  2G06 A;  4IR1 A;  2ZG6 A;  2HOQ A;  4WH5 A;  3V6H A;  1QSS A;  2F8K A;  3HP6 A;  2BDP A;  5KFE A;  1COK A;  3SI8 A;  2QLT A;  3ISB A;  1KN5 A;  1QQ6 A;  2YML A;  4EEN A;  2YMM A;  4UW9 A;  2Q66 A;  1KFT A;  4MF8 A;  1A77 A;  4RUC A;  3UQ0 A;  2OYY A;  1S0N A;  5KFB A;  5C5J A;  4NLC A;  2R8I A;  1PVR A;  4DOA A;  3RBE A;  2KVC A;  3NVZ A;  4DQP A;  5KG3 A;  4RNN A;  2VA2 A;  4TQR A;  3TI0 A;  3OJU A;  1F5S A;  4PL2 A;  2XI9 A;  2BPC A;  2AGP A;  1NJZ A;  1J97 A;  4O9M A;  5HC9 A;  1R8C A;  1RG6 A;  2ZHB A;  4OCZ A;  5ALF A;  4JV0 A;  2A19 A;  8ICS A;  3KHR A;  3QUC A;  1TFY A;  4NXV A;  4YR0 A;  3Q8Q B;  1BPZ A;  3ZDC A;  1OXJ A;  5IIJ A;  4KM5 A;  4LZG A;  3GQC A;  1YZ6 A;  1XS9 D;  3SV4 A;  2B21 A;  4C8O A;  2DKZ A;  2BQU A;  3JPN A;  4F50 A;  1V85 A;  1XSP A;  3H4D A;  9ICP A;  5ALY A;  4ACO A;  2YTU A;  2FPK A;  1RXW A;  4QZF A;  2NRZ A;  2JH7 A;  2NRT A;  8ICQ A;  1NJX A;  2FJ6 A;  5HRF A;  3QU5 A;  4JMU A;  5AM5 A;  3QX7 A;  4YR2 A;  1RXV A;  3OVS A;  8ICA A;  4J9S A;  1UHU A;  4FZM A;  4XJE A;  4KX5 A;  2FLN A;  3AEV A;  5JU5 A;  3M8S A;  4X4N A;  1JIH A;  4I2D A;  2GOL A;  5F9L A;  2IOF A;  1ZQY A;  3PW4 A;  4NLZ A;  2G5H B;  5AKH A;  2LM1 A;  3K4G A;  3H40 A;  4AT7 A;  5ALM A;  1N61 A;  1SV0 A;  1S76 D;  3RJG A;  2GH1 A;  1V97 A;  3VC8 A;  2DKX A;  4KLE A;  1KEJ A;  2A1J B;  5KFM A;  4B9T A;  3EF2 A;  1TKD A;  3WKB A;  1RM6 C;  2KHV A;  2PMZ C;  9ICV A;  4DQQ A;  2M2T A;  2LYB A;  4M6W A;  1JXE A;  2JEJ A;  2RLT A;  3NRZ A;  4RZR A;  1K1Q A;  1KSP A;  3KHG A;  5J0Y A;  2W9M A;  2HHT A;  5AM2 A;  1AQ6 A;  2R18 A;  5KFP A;  5ALT A;  1L3V A;  5KG7 A;  1QCK A;  3GII A;  3PV8 A;  3BQT A;  3JPP A;  4UAU A;  2LYH A;  1ZQG A;  4DOB A;  1ZQH A;  4JLX A;  5AKX A;  4P0Q A;  2WFA A;  4EBJ A;  5HRI A;  4ELU A;  1XC9 A;  5KFI A;  4DL4 A;  1ARO P;  4LEW A;  5L1K A;  4ED0 A;  5J2B A;  1ZXI A;  2M0N A;  4RQ8 A;  4EBE A;  3I76 A;  3MGI A;  4M6W B;  4Y2J A;  3C1Z A;  4KLO A;  4IQU A;  3TFR A;  4I2I A;  1XU4 A;  3GV7 B;  4I27 A;  2ZIX A;  1VLB A;  5AK4 A;  3EZ5 A;  9ICT A;  2W04 A;  2HBK A;  5KFO A;  3GV5 B;  4P0Q B;  2D8C A;  4Y2T A;  3KFU F;  1BVS A;  5AI9 A;  1TAQ A;  5IIM A;  7ICO A;  3PO5 A;  4ECR A;  4P4M A;  4NXZ A;  2FMS A;  1ZQC A;  3PW2 A;  4QZ9 A;  9ICF A;  1OW5 A;  4KN7 A;  4Z6F A;  4IRK A;  3A0B U;  3D2Q A;  4NY8 A;  1Z4O A;  2BCQ A;  3RBD A;  3IRU A;  3ZDB A;  1WCL A;  1NOM A;  4O5C A;  2DL0 A;  4CF5 A;  2JEG A;  2ZIX B;  3TAN A;  3EPI A;  4TUP A;  2PKE A;  3HT3 A;  4DSK A;  5KFL A;  3CNH A;  4X4V A;  2WF9 A;  5J2F A;  1BPE A;  5EWE A;  1XO1 A;  4OJO A;  4CF4 A;  2D6F C;  5AHX A;  2VJ5 A;  5KG0 A;  1NK7 A;  2BPG A;  4O3P A;  1Z4N A;  4J03 A;  3ETR A;  4I2J A;  4M04 A;  2NYV A;  2FLL A;  2YY6 A;  2JH1 A;  3NVO A;  2KE7 A;  3F5A A;  4FE3 A;  2PMZ F;  3LK9 A;  3V72 A;  3WKC A;  3MCR A;  4Y2X A;  4JB3 A;  5KAF U;  1R89 A;  4X4S A;  1ZOL A;  4B9M A;  3UMC A;  5ALZ A;  3ETL A;  1NK0 A;  5KTQ A;  5KT5 A;  3F2B A;  1ZD2 P;  4J9Q A;  2ZJ8 A;  1JQR A;  3QEB Z;  2ESE A;  5J29 A;  2F1H A;  2XGQ A;  4FZN A;  2ZH4 A;  3Q8R B;  2Q0Z X;  3BQ7 A;  4UB3 A;  1YT3 A;  4DWI A;  4NLK A;  2DR7 A;  2EAP A;  3M9N B;  2QB0 A;  5KL8 B;  5J2H A;  3AM9 A;  4QZ8 A;  4BXO A;  3GDX A;  3QXG A;  2M2U A;  2DPJ A;  4WOY A;  7ICU A;  2E8P A;  3M6K A;  3AUO A;  1N56 A;  3V7K A;  3PSP A;  3CRX A;  4EZ9 A;  2LI6 A;  4WC6 A;  1HIW A;  5AI0 A;  2AH5 A;  1Z00 A;  3RJK A;  2AJQ A;  2Z7J A;  3LVW A;  5CFU A;  1IXR A;  4X0B A;  4ELV A;  4M5D A;  1SB3 C;  4M9H A;  3TAR A;  2H3I A;  5J0U A;  5J2G A;  2IBK A;  1DK3 A;  4QW8 A;  2QB0 B;  1JRP A;  4BXO B;  5FP0 A;  4X4O A;  5EWF A;  4DFM A;  1KNY A;  3HIY A;  4RWN A;  1OUQ A;  4K98 A;  3HW8 A;  2K4H A;  3JPS A;  4BDP A;  4KX3 A;  4PJ0 U;  4KLI A;  5KFR A;  2EWR A;  4Q8F A;  4OAI Z;  2HHU A;  4X0A A;  1SV0 C;  1O08 A;  3OVA A;  2W7P A;  3H3A A;  1Z00 B;  5KFF A;  4ECQ A;  2ZJ5 A;  3ISD A;  1LB2 B;  5DB6 A;  4YR3 A;  4K99 A;  4DF8 A;  1IIP A;  4NKU A;  3RH6 A;  3G6X A;  2I9G A;  2VA3 A;  2KD1 A;  5DBA A;  2JEI A;  2RHF A;  3V7L A;  3C23 A;  4IQW A;  1UEV A;  2BZF A;  2J6S A;  4NL9 A;  3AQL A;  4DO9 A;  2W8K A;  3N7S C;  7ICN A;  1NK5 A;  3C29 A;  4Q43 A;  8ICP A;  5TZV A;  1IG6 A;  2ZH1 A;  1ZQN A;  3B0Y A;  4RQM A;  2V4R A;  4J9R A;  4DS4 A;  3M7D A;  4QZH A;  3L5K A;  3AQE A;  3LDA A;  5AI6 A;  5ALX A;  5CEH A;  4GC7 A;  4IG8 A;  5KT3 A;  4KN4 A;  4UAT A;  3JPR A;  4DLG A;  7ICJ A;  2J6U A;  5D61 A;  1X2I A;  4DS5 A;  1IM4 A;  3PX4 A;  2DQN B;  5AM0 A;  4E7X A;  3RFA A;  5ALG A;  1L5U A;  2PXI A;  4R63 A;  1LVH A;  1JAL A;  2N1R A;  3WKD A;  1NK4 A;  2VKQ A;  3HJ4 A;  4ZH4 A;  3JPO A;  3HRD D;  4FS2 A;  5DKW A;  2NRW A;  2A3V A;  4RWP A;  4F2R A;  3KHL A;  2PFP A;  2LPE A;  2ODG A;  4F3O A;  3R9K A;  1NKC A;  8ICU A;  4F5N A;  5DQH A;  3HIL A;  1M6Y A;  4DCC A;  4XA5 A;  1UA0 A;  4OAG A;  2HHQ A;  2E1F A;  2W54 A;  4DEZ A;  3LQC B;  2NRK A;  1UEU A;  2QB1 A;  1OU5 A;  2EDU A;  7ICR A;  4I2F A;  1N2X A;  2P66 A;  4YP3 A;  5J2A A;  3IG5 A;  3HKZ F;  4RQ0 A;  4X4Q A;  1SV4 A;  4OJL A;  2I6X A;  2KIV A;  2EH9 A;  5CRX A;  2LKY A;  1WWV A;  5CA7 A;  1P7D A;  1L7P A;  5HP4 A;  4AT9 A;  2ASJ A;  3ORY A;  2BDU A;  1X6J A;  2HBM A;  3L3F X;  4JUZ A;  2G07 A;  1X9W A;  1TK5 A;  2Y1I A;  5AKY A;  1QLN A;  4C4S A;  1Q78 A;  1PVP A;  3C21 A;  5HRL A;  4IL6 U;  4MFA A;  1LKY B;  1XWL A;  5BOL A;  4FHX A;  5D4B A;  1PZN A;  3RTV A;  2BE3 A;  2WF7 A;  3WKA A;  7ICK A;  2KKV A;  2G0A A;  4BGD A;  1Q8K A;  8ICW A;  2O1P A;  5L9X A;  4RPY A;  4US9 A;  4I2B A;  4DFP A;  5KL1 B;  4P0P B;  1KW4 A;  4RQ2 A;  8ICI A;  1TE2 A;  1N62 A;  5HRG A;  1KFD A;  4M2Y A;  4BWJ A;  1PVQ A;  5K4L A;  2ID1 A;  4RQ4 A;  4S3N A;  4B9N A;  4UB2 A;  2E8M A;  4KLQ A;  3DV9 A;  1CRX A;  3RH4 A;  1S10 A;  1L7N A;  2DRA A;  5J2I A;  3KTQ A;  3FAH A;  1X66 A;  4Z6D A;  3JPQ A;  4J9L A;  3T5L A;  2ZTC A;  3ZI4 A;  1JI7 A;  4P4P A;  3AQK A;  1U48 A;  4R8U A;  2KG5 A;  5DG7 A;  2PFN A;  5AKZ A;  5B66 U;  3H39 A;  3PW0 A;  3OUY B;  5DLF A;  2ATL A;  1X6I A;  4EBD A;  1ZQU A;  2YB1 A;  1TFW A;  1ZJM A;  1JN3 A;  1JXL A;  5AI5 A;  4RPX A;  4NWI A;  2F1J A;  3UXN A;  3QNM A;  1MC8 A;  1L8L A;  1GPJ A;  2O5A A;  3N97 B;  1SKS A;  1V4A A;  5ALV A;  4DQR A;  5HHH A;  3NAS A;  4KLU A;  5KT4 A;  1BNO A;  4OJ6 A;  3H8J A;  2L5Y A;  1NI3 A;  4GLX A;  3MR5 A;  4Y2P A;  5KG2 A;  3MC1 A;  2UVR A;  5B5E U;  4EX7 A;  5DB9 A;  3UXP A;  3PML A;  3NS1 A;  3OVB A;  1O03 A;  1DK2 A;  4FHY A;  4M9J A;  2ASD A;  1NK8 A;  3JZ0 A;  9ICH A;  4FH5 A;  4EEL A;  4I28 A;  4KLD A;  2KNJ A;  2AQ0 A;  3MR2 A;  4NL9 C;  4KMO B;  4UB1 A;  3MDC A;  4UB6 U;  2M9N A;  2F1I A;  5D46 A;  3PHZ A;  5L1M A;  4EED A;  5DLG A;  1RYS A;  1ZQA A;  1XSN A;  8ICK A;  4US8 A;  4O3N A;  4TQS A;  3G6Y A;  1KKX A;  4P4O A;  4EEY A;  2RDI A;  3RB4 A;  9ICS A;  4NXX A;  3PMN A;  2ZTE A;  3GZF A;  5J2J A;  2GA9 D;  4JWM A;  1Q46 A;  4DSI A;  2ZH8 A;  1XNS A;  1K1S A;  4Q8E A;  2BR0 A;  3SAF A;  2KZM A;  3RRH A;  4P2H A;  4ED1 A;  1N5X A;  1UQV A;  2A1A A;  4AT8 A;  3T3F A;  3L4P A;  1L3U A;  3QU4 A;  4XUS A;  2DBY A;  4PL1 A;  4Z6C A;  3SEN A;  4C8N A;  4DL3 A;  3C5F A;  3DDH A;  3WK9 A;  3RB6 A;  4KLL A;  5KFD A;  4OD0 A;  3BZK A;  4O67 A;  5CR0 A;  2ZXH A;  1F44 A;  4NV0 A;  1KQQ A;  1F5A A;  4PHP A;  1EXN A;  4OO1 J;  1N63 A;  5DQG A;  3HJE A;  9ICX A;  4J9K A;  5HR7 A;  4UB4 A;  1V38 A;  5AKE A;  1MSW D;  2LBO A;  4WC5 A;  4UAY A;  3V7J A;  7ICI A;  4M0A A;  1ECW A;  4Q44 A;  2F77 X;  3PSI A;  5KG5 A;  2R8K A;  4R66 A;  3GIJ A;  3LWL A;  1L6N A;  1FO4 A;  5HRH A;  2MRL A;  2RRD A;  3I28 A;  4DFD A;  1ZQT A;  2UVW A;  4I2E A;  1Y88 A;  5J0W A;  1JX4 A;  9ICA A;  5HMM A;  4NXW A;  5J0R A;  3ICX A;  1MQ2 A;  3OHA A;  2JV3 A;  2CN1 A;  4RT2 A;  4CCH A;  1VJ7 A;  4FBU A;  3IP4 B;  3H0L B;  1S5L U;  4QZA A;  3PX0 A;  5KFJ A;  2F3N A;  1DOQ A;  8ICR A;  3PST A;  3QE9 Y;  3QU9 A;  2KHQ A;  4KLS A;  1A6S A;  4F4Y A;  3H7I A;  1SZP A;  2F8L A;  1RYU A;  2W9C A;  3UPQ A;  1SGG A;  1ZQS A;  1QH9 A;  4FFD A;  2YQE A;  5HRK A;  5AKI A;  3LWM A;  2AGO A;  3N28 A;  4WJ3 B;  9ICQ A;  4DQI A;  2KJ9 A;  2BGW A;  5DB7 A;  1TAM A;  4GFJ A;  1KBU A;  4FO1 A;  2KZZ A;  3HWT A;  2Q4T A;  2W3R A;  1B22 A;  5AIA A;  5AM4 A;  3NTU A;  2ZIU A;  4UB8 U;  4AT7 B;  4KLT A;  1RDF A;  5JUM A;  3C2L A;  5AIB A;  2K8B B;  1MIY A;  4IRD A;  2EZZ A;  1ZQQ A;  2ZIV A;  3PSF A;  4QNL A;  7ICL A;  1N48 A;  5ALS A;  4F8R A;  5EOZ A;  3ZD8 A;  5DG8 A;  3JYY A;  4MFF A;  1VJ5 A;  2MSN A;  3OSP A;  1DRG A;  5ALK A;  4KIT B;  4YMN A;  5DDY A;  2RDJ A;  5EE1 A;  5DED A;  2ZIU B;  3SAH A;  1KRP A;  8ICJ A;  2WF5 A;  1X42 A;  2BCU A;  2IOH A;  4WQK A;  1SL1 A;  2ZIV B;  5DQI A;  3CP8 A;  4YXJ A;  4X4U A;  1X9M A;  2XO7 A;  1MQ3 A;  2KIW A;  2IA6 A;  1UT5 A;  4O3M A;  2HHW A;  8ICN A;  5KFA A;  3EWA A;  4C0Z A;  3WFQ E;  4XQ8 A;  1S0V A;  1KFS A;  3GFK B;  5L1I A;  3F2D A;  4DLE A;  2WHE A;  3HJ1 A;  1ZQE A;  4QWD A;  2E8N A;  1PUZ A;  3G6V A;  4PGQ A;  4QZC A;  4YQW A;  3F53 A;  3QZ7 A;  1YZ7 A;  3PW5 A;  3H38 A;  4QWE A;  2AQ4 A;  1D8Y A;  1UCV A;  8ICY A;  3IDW A;  1SKW A;  3QU2 A;  4I2G A;  2B4V A;  3IN5 A;  4B9S A;  2G08 A;  4U6P A;  5AM1 A;  1JRO A;  5J8Y C;  1ZQM A;  5KG4 A;  3RAQ A;  2BHN A;  4PHA A;  5T14 A;  1MIV A;  2RQ5 A;  4IC9 A;  2DF4 B;  2YMP A;  2PI4 A;  3RJE A;  2WB1 C;  5EE9 A;  4KLJ A;  4O0I A;  2DWQ A;  1S0O A;  2D3D A;  2XY7 A;  5HRD A;  4F4K A;  1KLN A;  1NZP A;  4WC3 A;  4EBK A;  3THV A;  4LT6 A;  9ICI A;  3HX0 A;  4R65 A;  4FBT A;  8ICL A;  4UD5 A;  2HHS A;  8ICT A;  4F2S A;  3ED5 A;  2C28 A;  2WTF A;  3MBY A;  8ICB A;  2K60 A;  2JGA A;  2QKQ A;  3UPS A;  1ZQD A;  1UA1 A;  1WOT A;  4IS7 A;  4RUA A;  4FO6 A;  1SWW A;  4G9B A;  4WC4 A;  3QYP A;  3H8M A;  4ED3 A;  5J0X A;  4DL7 A;  1NK6 A;  5B3P A;  3H4B A;  4X5V A;  2AGQ A;  2HHX A;  5DG9 A;  3OV7 A;  1RPL A;  4LJX A;  3NGD A;  5ALP A;  4AYB C;  2FPL A;  4F92 B;  4QW9 A;  3RR8 A;  3AQF A;  3N7R C;  3F5E A;  1U4B A;  4IQV A;  2GLE A;  2KJ8 A;  2KV2 A;  2KK0 A;  1NKE A;  8ICV A;  4QJF B;  4FH3 A;  2W7O A;  4GXK A;  1S77 D;  8ICX A;  7ICH A;  3IG8 A;  4ECX A;  2KJ5 A;  1D9F A;  5F2V O;  1VFG A;  1H38 A;  2W3S A;  2YN4 A;  1ZJN A;  4WC1 A;  2NV3 A;  4QZG A;  2PBE A;  3ONN A;  3M9M B;  4ATB A;  1U47 A;  5ALN A;  4PHE A;  4LEZ A;  2KIC A;  4GIB A;  3SR6 A;  2H3V A;  5GTH U;  3N7P D;  1ZD3 A;  1QTM A;  2EAM A;  1X9X A;  2ZH7 A;  3SQI A;  2W9B A;  3BDP A;  3NUQ A;  3B0X A;  2KVS A;  2AXT U;  3C1Y A;  2ASL A;  4YXM A;  3EPG A;  4DSJ A;  2MA1 A;  5ALL A;  7ICV A;  2KZ3 A;  2B51 A;  2KFZ A;  4Y2S A;  4EYH B;  4ATB B;  2QAR A;  4F5O A;  5D62 A;  4R64 A;  3IHQ B;  5EWG A;  1HJP A;  4QWA A;  3QEA Z;  4KTQ A;  3BS5 A;  2FI1 A;  3RJH A;  1S97 A;  4B9V A;  2F44 A;  5AK3 A;  1ZQL A;  3HPO A;  3UQ2 A;  2W9B B;  3WFR E;  3KKA C;  4O69 A;  2Y1J A;  3N4M B;  3MFH A;  3KHH A;  2DUY A;  4O6A A;  4F71 A;  1WWU A;  3H8S A;  3KD3 A;  5ALU A;  2E5S A;  2JMG A;  4CF3 A;  2W8L A;  4F91 B;  2Y9T A;  2QAR B;  1VDV A;  4K9B A;  4FZL A;  4GXI A;  1LV5 A;  4M9G A;  5AI4 A;  2K8A A;  2MU2 A;  5CFT A;  1KL9 A;  3BS5 B;  4QZI A;  1Q79 A;  2WAQ C;  3RR7 A;  2ZUB A;  2HHP A;  2VAN A;  5III A;  2ZUD A;  1N60 A;  2OWO A;  5BPC A;  2LMR A;  4YD2 A;  5CB1 A;  2OHF A;  4Y2Y A;  4JLZ A;  5HNK A;  1N5W A;  3JCF A;  1UPH A;  4DFK A;  3NWI A;  2RP5 A;  3SD7 A;  4YVZ A;  4UAZ A;  2HMX A;  3WK8 A;  5DBB A;  4BJQ A;  2ISP A;  4UB5 A;  1B43 A;  5CJ7 A;  4MEY A;  5J2C A;  4C4T A;  4TUR A;  5ALQ A;  3OTQ A;  1MIW A;  1NK9 A;  3OWG A;  2LYA A;  5BOM A;  1FEZ A;  1PK3 A;  3AL0 B;  1TFR A;  1HEK A;  4KMU A;  3UXO A;  1SXD A;  4X4R A;  3V6J A;  2KMD A;  3Q8S B;  5G5G A;  1X40 A;  4DSE A;  3WK7 A;  9ICM A;  5KT7 A;  2BCS A;  3CYM A;  2C22 A;  4XRH A;  2FMP A;  4QZE A;  4RPZ A;  2EAN A;  4RQ6 A;  4MFC A;  5D63 A;  2OXO A;  3Q8P B;  1F0M A;  4DF4 A;  4PZO A;  4Y2Q A;  3AQM A;  4WC0 A;  1IV8 A;  5J2D A;  4M9N A;  1A76 A;  4AT9 B;  5IIN A;  4O3Q A;  5L1L A;  3D2N A;  4K4G A;  3C28 A;  4C7Y A;  4FHW A;  1L7O A;  3ZDA A;  4O68 A;  5HML A;  5KFT A;  5AKJ A;  3S6J A;  5KNI A;  5D49 A;  4DSF A;  1FFV A;  2I1Q A;  5ALD A;  4U7C A;  1C7Y A;  5ALJ A;  1ZET A;  2HVH A;  3J81 j;  4Q45 A;  1Z3E B;  2FLP A;  3E58 A;  4RQ5 A;  3TKA A;  3ALR A;  3PNC A;  3DEE A;  2HI0 A;  1Q3U A;  4M9L A;  3GIM A;  3TQ1 A;  5JTI A;  2M2V A;  4QWC A;  2Y9U A;  4YMM A;  1HUZ A;  2KFN A;  2O6K A;  2XC9 A;  5DGA A;  2W55 A;  4J9O A;  2W9A A;  8ICO A;  3QU7 A;  3D6J A;  4QZD A;  8ICG A;  5AKL A;  4RNO A;  4UAR A;  4F5P A;  4LEV A;  5KG1 A;  3EYZ A;  2W11 A;  4K96 A;  4J9N A;  2ZXI A;  4R8U B;  3KZI U;  5ALO A;  1NNL A;  3TFS A;  2P6R A;  4ED6 A;  1ZQF A;  2H3F A;  5J0P A;  2OCE A;  4KLH A;  2PFQ A;  3K1Z A;  5AK5 A;  7ICT A;  1TK8 A;  3QUT A;  4Z6E A;  1URJ A;  1S8O A;  5C0Y A;  7ICM A;  3NYB A;  4UD4 A;  5ALI A;  2ZH3 A;  4UBB A;  4DL2 A;  1T3Q A;  3RAX A;  2UVU A;  3FYH A;  3ER8 C;  7ICP A;  3K75 D;  2M2W A;  4LZD A;  3GU3 A;  4WC2 A;  9ICK A;  4WC7 A;  2HVI A;  1BGX T;  1ZQX A;  2K4I A;  2HCF A;  2HBJ A;  1Z1V A;  4DQS A;  1DGJ A;  2BBJ A;  2P35 A;  5DB8 A;  8ICM A;  1DXS A;  4PHD A;  3GV8 B;  5AK6 A;  9ICB A;  4K9A A;  4C7Z A;  4RWO A;  3VCB A;  5J8Y A;  1SL0 A;  4GC6 A;  1RYR A;  2YX8 A;  2AHO B;  4YFK A;  1ZQO A;  1QSL A;  1TVA A;  3PR4 A;  3L9D A;  4E80 A;  2V9W A;  1Z1B A;  2KEY A;  3OGU A;  1MN8 A;  9ICJ A;  5KFS A;  4C80 A;  2HDO A;  4EEK A;  3AU2 A;  1RZT A;  4TUS A;  3RF9 A;  5KFW A;  5J0T A;  1FA0 A;  1TV9 A;  1QQ5 A;  1S0M A;  2IHM A;  2KTQ A;  3UMB A;  2IOF K;  4AT8 B;  4K4I A;  2B56 A;  1S9F A;  2K8C B;  5J0S A;  3TAP A;  3H0M B;  2DR5 A;  5HHI A;  3RRG A;  4UQG A;  2HW3 A;  3WFS C; 
#chains in the Genus database with same CATH homology
 5TZV A;  7ICE A;  3G6V A;  4PGQ A;  1R8B A;  3Q8K A;  2ZH1 A;  4QZC A;  4YQW A;  2DRB A;  5KFY A;  4F5R A;  1ZQN A;  5DEC A;  3B0Y A;  3QZ7 A;  2V4R A;  4J9R A;  3PW5 A;  4DS4 A;  4RQ3 A;  3H38 A;  4RQ7 A;  4QZH A;  4QWE A;  3LDA A;  2AQ4 A;  2MUT A;  3C2K A;  5F9N A;  1T3N A;  2ZHA A;  4GC7 A;  3RJI A;  1D8Y A;  4IG8 A;  1V9P A;  5KT3 A;  8ICY A;  2ZTD A;  4KN4 A;  3JPR A;  4DLG A;  1T8E A;  1SKW A;  3C5G A;  4NKT A;  4I2G A;  1COO A;  1ZQR A;  9ICG A;  7ICJ A;  2J6U A;  4B9S A;  1X2I A;  1D8L A;  4DS5 A;  2C2D A;  1IM4 A;  3PX4 A;  2DPI A;  1ZQM A;  2ZUC A;  3H39 A;  4O3O A;  1L5U A;  3M8R A;  2PXI A;  4E7X A;  2ZH6 A;  1ZQP A;  4R63 A;  5KG4 A;  3RAQ A;  3C18 A;  4PGY A;  2A1J A;  2BHN A;  5IIO A;  5CWR A;  2R8G A;  3TAQ A;  4PHA A;  1MIV A;  2ZH9 A;  4DL6 A;  1NK4 A;  2DR9 A;  4C8L A;  4WBY A;  3HJ4 A;  4ZH4 A;  2XY5 A;  1L3T A;  3PR5 B;  3JPO A;  3RJE A;  2PI4 A;  4JV1 A;  4O3S A;  4FS2 A;  1JAJ A;  5DKW A;  3H37 A;  2NRW A;  4KLJ A;  4O0I A;  3SZ2 A;  4JWN A;  3QZ8 A;  1S0O A;  4RWP A;  2XY7 A;  4PH5 A;  5HRD A;  4F2R A;  8ICE A;  3KHL A;  3PY8 A;  3PVX A;  3ISC A;  2C2R A;  2PFP A;  1NKB A;  2IMW P;  4F4K A;  1KLN A;  1NZP A;  4WC3 A;  4EBK A;  4F3O A;  1NKC A;  3THV A;  2IHN A;  8ICU A;  1YLQ A;  4F5N A;  2MUT B;  5DQH A;  4ELT A;  4LT6 A;  2FPM A;  5KFH A;  3HX0 A;  1HUO A;  4XA5 A;  4R65 A;  1UA0 A;  1ZQJ A;  4FBT A;  8ICL A;  4UD5 A;  3MR3 A;  2HHS A;  8ICT A;  4F2S A;  4EP7 A;  3RH5 A;  2C28 A;  2HHQ A;  4DEZ A;  3LQC B;  2WTF A;  2NRK A;  2XCP A;  3MBY A;  8ICB A;  1UEU A;  5J0Q A;  1OU5 A;  2ZH2 A;  3UPS A;  1ZQD A;  7ICR A;  1UA1 A;  1WOT A;  4I2F A;  2P66 A;  4YG2 A;  4RUA A;  1DGS A;  4YP3 A;  5J2A A;  3MFI A;  4ECT A;  4FO6 A;  5KFV A;  2VA8 A;  4NLN A;  3Q8M A;  2MAX A;  4RQ0 A;  4YMO A;  4YN4 A;  4WC4 A;  1SL2 A;  5KFN A;  4X4Q A;  4ED3 A;  5J0X A;  5KFX A;  4DL7 A;  1NK6 A;  4J9M A;  3H4B A;  3MAB A;  2W9C B;  4ECY A;  4X5V A;  2AGQ A;  5DBC A;  5DG9 A;  1RPL A;  3C2M A;  1NJY A;  1ZQI A;  1D9D A;  2AU0 A;  2PFO A;  3OV7 A;  1NO5 A;  5CA7 A;  3NGD A;  3RJJ A;  5HP4 A;  4ED8 A;  1ZQB A;  4F92 B;  3PW7 A;  2FPL A;  3ORY A;  4QW9 A;  2ASJ A;  3RR8 A;  4JUZ A;  5KFK A;  3BQ1 A;  4IR1 A;  1U4B A;  1X9W A;  1TK5 A;  4IQV A;  2Y1I A;  3V6H A;  4IQT A;  1QSS A;  1QLN A;  3HP6 A;  1NKE A;  8ICV A;  4JK1 A;  2BDP A;  1Q78 A;  3C66 A;  5KFE A;  3C21 A;  4UAW A;  3SI8 A;  7ICG A;  5HRL A;  4FH3 A;  4GXK A;  4ED7 A;  4MFA A;  5HRE A;  3ISB A;  4E0D A;  4O5E A;  1S77 D;  8ICX A;  1XWL A;  5BOL A;  7ICH A;  2Q66 A;  4ECX A;  1D9F A;  1KFT A;  4FHX A;  5F2V O;  1VFG A;  4NM1 A;  1H38 A;  5D4B A;  7ICS A;  4MF8 A;  1BPB A;  1ZJN A;  1PZN A;  2HHV A;  3RTV A;  4WC1 A;  1A77 A;  2BE3 A;  4RUC A;  3MR6 A;  3UQ0 A;  4QZG A;  1T7P A;  7ICK A;  5DDM A;  2PBE A;  9ICR A;  5KFQ A;  1S0N A;  4ATB A;  3M9M B;  4BGD A;  5L1J A;  4QZB A;  2ALZ A;  8ICF A;  2JZB A;  3T5J A;  5KFB A;  8ICW A;  2O1P A;  5C5J A;  1U47 A;  5L9X A;  2R8I A;  4RPY A;  1SKR A;  4I2B A;  4DOA A;  4DFP A;  3RBE A;  4PHE A;  4RQ2 A;  5KFZ A;  4DQP A;  1BPX A;  8ICI A;  2DR8 A;  5HRG A;  2C2E A;  4RNM A;  5KG3 A;  4G3I A;  1KFD A;  4RNN A;  3FDS A;  4TUQ A;  2VA2 A;  4TQR A;  4M2Y A;  3TI0 A;  3OJU A;  2XGP A;  1QTM A;  4BWJ A;  9ICW A;  2ID1 A;  4RQ4 A;  4S3N A;  2W9B A;  4DOC A;  3BDP A;  4B9N A;  2ZH7 A;  1JMS A;  4UB2 A;  2BPC A;  3B0X A;  2AGP A;  1NJZ A;  4KLQ A;  1U9L A;  3RH4 A;  3C1Y A;  2ASL A;  1S10 A;  4FS1 A;  2BCR A;  4O9M A;  5J2I A;  3KTQ A;  1R8C A;  5HC9 A;  2DRA A;  2ZHB A;  4YXM A;  4JV0 A;  3EPG A;  9ICU A;  4DSJ A;  5IIK A;  4Z6D A;  7ICV A;  3JPQ A;  4J9L A;  3T5L A;  1ZQK A;  2KZ3 A;  5KFG A;  8ICS A;  3KHR A;  2ZTC A;  2KFZ A;  4EYH B;  4P4P A;  3AQN A;  2BQR A;  3AQK A;  4F5O A;  4ATB B;  2J6T A;  1U45 A;  4YR0 A;  3Q8Q B;  1TFY A;  2NRV A;  2JZB B;  1U48 A;  4WBZ A;  3PX6 A;  1ZQZ A;  4R8U A;  5DG7 A;  4R64 A;  2PFN A;  1BPZ A;  3IHQ B;  5EWG A;  3ZDC A;  1HJP A;  5IIJ A;  4QWA A;  3PW0 A;  3QEA Z;  4KTQ A;  3GQC A;  5DLF A;  4LZG A;  3OUY B;  2ATL A;  3WFS C;  1XS9 D;  3SV4 A;  2B21 A;  4C8O A;  2BQU A;  4EBD A;  1ZQU A;  3RJH A;  3JPN A;  4F50 A;  2XY6 A;  1ZJM A;  1TFW A;  1XSP A;  1JN3 A;  3H4D A;  1S97 A;  4RPX A;  1JXL A;  4B9V A;  3MGH A;  9ICP A;  1ZQL A;  2FPK A;  2F1J A;  3UXN A;  3HPO A;  3UQ2 A;  1RXW A;  9ICE A;  4QZF A;  1MC8 A;  2JEF A;  2NRZ A;  4PGX A;  2NRT A;  2W9B B;  2BQ3 A;  4EBC A;  3N97 B;  1NJX A;  4ECV A;  1SKS A;  8ICQ A;  5HRF A;  2O5A A;  4X4T A;  3WFR E;  2Y1J A;  3N4M B;  1T4G A;  4YR2 A;  4RWO A;  1V4A A;  1RXV A;  4DQR A;  3OVS A;  5HHH A;  8ICA A;  3MFH A;  3KHH A;  4J9S A;  1CUK A;  5KT4 A;  4B9U A;  4KLU A;  1BNO A;  2ZH5 A;  3H8J A;  3H8S A;  4GLX A;  3MR5 A;  2FLN A;  4X4N A;  3M8S A;  1JIH A;  5KG2 A;  4RU9 A;  4I2D A;  4F91 B;  5J2E A;  2W8L A;  5DB9 A;  5F9L A;  1ZQY A;  3PML A;  3UXP A;  3PW4 A;  2UVR A;  4GXI A;  1LV5 A;  4M9G A;  4NLZ A;  3OVB A;  4NKU A;  1DK2 A;  4EZ6 A;  3RB0 A;  4FHY A;  3K4G A;  4M9J A;  2ASD A;  1UET A;  1NK8 A;  3JZ0 A;  4QZI A;  3H40 A;  9ICH A;  1Q79 A;  4FH5 A;  4AT7 A;  3RR7 A;  2ZUB A;  2KN7 A;  3MDA A;  4I28 A;  1S76 D;  3RJG A;  2HHP A;  4XQ7 A;  4DFJ A;  2PI5 A;  4KLD A;  1BPD A;  1KEJ A;  2AQ0 A;  2VAN A;  4KLE A;  3MR2 A;  2KP7 A;  2A1J B;  5III A;  3WFO A;  2ZUD A;  4DL5 A;  5KFM A;  5BPC A;  4UB1 A;  2OWO A;  4YD2 A;  3MDC A;  3T5K A;  4B9T A;  5CB1 A;  1TKD A;  4C8K A;  2M9N A;  2F1I A;  5D46 A;  5HNK A;  4DFK A;  9ICO A;  2ZJA A;  9ICV A;  5DLG A;  4DQQ A;  1RYS A;  2M2T A;  1ZQA A;  1XSN A;  3H8W A;  4YVZ A;  4M6W A;  8ICK A;  4TQS A;  4O3N A;  1JXE A;  5DBB A;  4UAZ A;  3G6Y A;  2JEJ A;  4P4O A;  4RZR A;  4EEY A;  1K1Q A;  1B43 A;  2RDI A;  4UB5 A;  3RB4 A;  5CJ7 A;  1KSP A;  2ISP A;  9ICS A;  4MEY A;  5J2C A;  3KHG A;  5J0Y A;  2W9M A;  4TUR A;  2HHT A;  1MIW A;  1NK9 A;  3PMN A;  5KFP A;  2ZTE A;  1L3V A;  5BOM A;  3PO4 A;  7ICQ A;  5KG7 A;  3GII A;  5J2J A;  1TFR A;  3PV8 A;  3BQT A;  3JPP A;  4KMU A;  2P6U A;  4EYI B;  3UXO A;  5KFC A;  4JWM A;  4X4R A;  3GIK A;  2LYH A;  3V6J A;  1ZQG A;  4DSI A;  4M47 A;  4DOB A;  9ICI A;  1ZQH A;  3Q8S B;  2ZH8 A;  2DFL A;  1K1S A;  4EBJ A;  4Q8E A;  4ELU A;  5HRI A;  4DSE A;  2BR0 A;  1XC9 A;  5KFU A;  9ICM A;  5KT7 A;  2BCS A;  5KFI A;  1L3S A;  4DL4 A;  3RRH A;  2KZM A;  3E2E A;  4LVS A;  3SV3 A;  1ARO P;  2C22 A;  4XRH A;  2FMP A;  4ED1 A;  4QZE A;  4P2H A;  5HR9 A;  5L1K A;  4ED0 A;  9ICC A;  5J2B A;  4RPZ A;  4RQ6 A;  4MFC A;  3GIL A;  4RQ8 A;  3T3F A;  1L3U A;  5KG6 A;  4AT8 A;  4EBE A;  3Q8P B;  4DF4 A;  3MGI A;  4M6W B;  4KLF A;  4XUS A;  3AQM A;  3C1Z A;  4WC0 A;  4KLO A;  4F4X A;  2BKE A;  4IQU A;  4Z6C A;  5J2D A;  4F93 B;  4J9P A;  3TFR A;  4I2I A;  4C8N A;  1XU4 A;  3EW9 A;  1A76 A;  4ECZ A;  4DL3 A;  4M9N A;  2HHX A;  5IIL A;  4AT9 B;  3GV7 B;  4I27 A;  3C5F A;  5IIN A;  5CP2 A;  3EZ5 A;  4O3Q A;  3RB6 A;  1PX5 A;  5L1L A;  4KLL A;  5KFD A;  4K4G A;  3V6K A;  8ICH A;  9ICT A;  2BPF A;  4FHW A;  5CR0 A;  4I2H A;  5KFO A;  3GV5 B;  3ZDA A;  5HML A;  1F5A A;  4PHP A;  1EXN A;  4BWM A;  1BVS A;  5KFT A;  1TAQ A;  5IIM A;  7ICO A;  3Q8L A;  3PO5 A;  1NJW A;  2XCA A;  5DQG A;  5D49 A;  4DSF A;  2I1Q A;  9ICX A;  4ECR A;  2DVI A;  4P4M A;  4NXZ A;  2FMS A;  1ZQC A;  1BNP A;  4J9K A;  3PW2 A;  1C7Y A;  4QZ9 A;  1ZET A;  9ICF A;  4KN7 A;  4Z6F A;  2HVH A;  4UB4 A;  4X4P A;  4IRK A;  3AU6 A;  4NY8 A;  4PPX A;  4Q45 A;  1MSW D;  4WC5 A;  2BCQ A;  3RBD A;  4UAY A;  3V7J A;  3ZDB A;  7ICI A;  4NM2 A;  1WCL A;  4M0A A;  1NOM A;  1QSY A;  4O5C A;  4Q44 A;  1Z3E B;  5KG5 A;  2FLP A;  2JEG A;  2R8K A;  4RQ5 A;  4R66 A;  3GIJ A;  3LWL A;  7ICF A;  4O5K A;  3TAN A;  5HRH A;  1ZQW A;  3EPI A;  1ZQT A;  3PNC A;  2UVW A;  4TUP A;  4I2E A;  3M9O B;  3HT3 A;  1CEZ A;  1TAU A;  1Y88 A;  4C8M A;  4DSK A;  5J0W A;  5KFL A;  1JX4 A;  4M9L A;  1KDH A;  4X4V A;  3GIM A;  5J2F A;  1ZQV A;  1BPE A;  3TQ1 A;  5EWE A;  9ICA A;  5HMM A;  2M2V A;  1XO1 A;  4QWC A;  4YMM A;  1HUZ A;  2KFN A;  3RB3 A;  3ZD9 A;  5J0R A;  1MQ2 A;  2XC9 A;  4O3R A;  5DGA A;  3OHA A;  5KG0 A;  4MF2 A;  1NK7 A;  4J9O A;  2W9A A;  4O3P A;  4RT2 A;  2BPG A;  3SYZ A;  4CCH A;  8ICO A;  4QZD A;  4I2J A;  8ICG A;  4M04 A;  2FLL A;  4FBU A;  4KLM A;  4RNO A;  1VJ7 A;  4RQ1 A;  2R8H A;  4QZA A;  4F5P A;  3PX0 A;  4RWQ A;  5KG1 A;  3LK9 A;  3EYZ A;  3V72 A;  4J9N A;  4QWB A;  4AT9 A;  4IR9 A;  5KFJ A;  4R8U B;  1X9S A;  4JV2 A;  1DOQ A;  1R89 A;  4B9M A;  3TFS A;  8ICR A;  4X4S A;  3QE9 Y;  3ETL A;  1NK0 A;  2P6R A;  3RJF A;  5KTQ A;  5KT5 A;  4ED6 A;  1ZQF A;  4KLS A;  4J9Q A;  2H5X A;  2ZJ8 A;  5J0P A;  3QEB Z;  1JQR A;  5J0O A;  2PFQ A;  4KLH A;  4F5Q A;  4F4Y A;  1TK0 A;  3H7I A;  1SZP A;  4WCW A;  5J29 A;  3JPT A;  2F1H A;  2W9C A;  3UPQ A;  7ICT A;  2XGQ A;  3BJY A;  1TK8 A;  1ZQS A;  4ECW A;  4Z6E A;  2ZH4 A;  5HRK A;  3OHB A;  3Q8R B;  3LWM A;  2Q0Z X;  2AGO A;  4ECU A;  4NLG A;  4UB3 A;  4DWI A;  1UT8 A;  4DQI A;  1XSL A;  4NLK A;  9ICQ A;  2DR7 A;  3M9N B;  2BGW A;  5DB7 A;  7ICM A;  2FMQ A;  5J2H A;  3NYB A;  2KZZ A;  4QZ8 A;  4BXO A;  3GDX A;  4I2C A;  2M2U A;  3HWT A;  2DPJ A;  4UD4 A;  7ICU A;  1B22 A;  2ZH3 A;  4UBB A;  4DL2 A;  3RAX A;  2UVU A;  3FYH A;  3BQ0 A;  7ICP A;  3AUO A;  1N56 A;  3T5H A;  3K75 D;  2M2W A;  1U49 A;  3V7K A;  4LZD A;  4YCX A;  4WC2 A;  3NTU A;  4I29 A;  9ICK A;  4WC7 A;  8ICC A;  2HVI A;  4AT7 B;  4KLT A;  5JUM A;  3C2L A;  1BGX T;  4EZ9 A;  2R8J A;  1MIY A;  4WC6 A;  4IRD A;  1ZQX A;  4MEX A;  1Z00 A;  5DGB A;  1KTQ A;  3RJK A;  2AJQ A;  4DQS A;  1ZQQ A;  1IXR A;  5DB8 A;  4X0B A;  3BQ2 A;  4ELV A;  4M5D A;  7ICL A;  4M9H A;  8ICM A;  3TAR A;  1ZYQ A;  5J0U A;  1N48 A;  4PHD A;  5J2G A;  3GV8 B;  4F8R A;  3ZDE A;  4ECS A;  9ICB A;  2IBK A;  2BCV A;  5EOZ A;  1DK3 A;  3ZD8 A;  5DG8 A;  3IM1 A;  4RT3 A;  9ICL A;  4QW8 A;  1WCN A;  5J2K A;  4GC6 A;  4F4Z A;  4UBC A;  1SL0 A;  1RYR A;  3JYY A;  4BXO B;  4YFK A;  4MFF A;  4X4O A;  4B9L A;  3OSN A;  3OSP A;  5EWF A;  4DFM A;  4KIT B;  8ICZ A;  1KNY A;  4YMN A;  4K4H A;  3HIY A;  4RWN A;  5DDY A;  2RDJ A;  1ZQO A;  3WFP A;  4HYK A;  1TVA A;  3PR4 A;  3JPS A;  3HW8 A;  1QSL A;  4BDP A;  3L9D A;  5DED A;  4E80 A;  1KRP A;  2V9W A;  4KLI A;  5KFR A;  8ICJ A;  3OGU A;  9ICJ A;  4Q8F A;  5KFS A;  4YD1 A;  2BCU A;  2HHU A;  4X0A A;  5KT2 A;  3AU2 A;  3OVA A;  1RZT A;  4TUS A;  3H3A A;  2GWS A;  1Z00 B;  5KFF A;  5KT6 A;  2NRX A;  4ECQ A;  2ZJ5 A;  5KFW A;  5J0T A;  1BPY A;  3ISD A;  5CHG A;  1LB2 B;  4DSL A;  1TV9 A;  1SL1 A;  5DB6 A;  1FA0 A;  2V4Q A;  1S0M A;  3ZDD A;  4FHV A;  4KLG A;  4YR3 A;  5DQI A;  2IHM A;  4E8F A;  4DF8 A;  2KTQ A;  4YXJ A;  2RFF A;  3RH6 A;  1X9M A;  2XO7 A;  3G6X A;  1MQ3 A;  5HRB A;  2I9G A;  3OUY A;  9ICN A;  4AT8 B;  4K4I A;  2IA6 A;  4X4U A;  2VA3 A;  1UT5 A;  4I2A A;  2HHW A;  4FHP A;  5DBA A;  2JEI A;  1S9F A;  8ICN A;  3V7L A;  3C23 A;  4IQW A;  1UEV A;  2J6S A;  5J0S A;  5KFA A;  3TAP A;  3AQL A;  3EWA A;  4IRC A;  2DR5 A;  3OJS A;  4F4W A;  5HHI A;  3WFQ E;  4DO9 A;  4XQ8 A;  1S0V A;  1KFS A;  2W8K A;  3RRG A;  3GFK B;  5L1I A;  7ICN A;  4UQG A;  4DLE A;  1R8A A;  2HW3 A;  4ED2 A;  1NK5 A;  4Q43 A;  4GXJ A;  4QWD A;  1ZQE A;  3HJ1 A;  2ISO A;  8ICP A;  2UVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...