4M9GA

Dna polymerase beta e295k binary complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
325
structure length
314
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 314
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9gA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9gA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9gA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9gA03
5EWEA 3GILA 2HHQA 4TQRA 4O3PA 1NK8A 4IQTA 4GC7A 4RUCA 3AU2A 5KFOA 4R66A 2R8KA 4EBCA 4NLZA 4ELTA 4YG2A 5DGBA 4R8UB 2V4QA 1T3NA 1ZQAA 4MF2A 1R8AA 1R8CA 4I2IA 4K4IA 2ZHAA 1QSYA 4J9PA 4E7XA 2J6TA 2I1QA 4Q44A 3MDCA 4JWMA 4F4ZA 1TK0A 4RQ5A 3JPQA 2FLNA 5KT3A 2PFNA 2FPMA 3NGDA 5F9NA 3JPRA 4NLGA 2F1IA 4X0AA 2ZH9A 1JN3A 4KLTA 3ZD9A 1RXWA 4K4GA 8ICUA 3L9DA 3B0XA 2Y1JA 3C1ZA 1JXLA 1R89A 5DKWA 4M47A 7ICQA 2JZBB 2NRWA 4O5KA 2XY6A 8ICIA 1DGSA 9ICJA 3WFSC 1BPDA 2AQ4A 4DQSA 4DFJA 4EEYA 2KZZA 5IIKA 4XQ8A 3H7IA 5HMLA 5HRLA 5KFUA 1XSLA 4QZBA 4KLDA 1ZQNA 1SZPA 1K1QA 3ISBA 5KG1A 4QWEA 5J2HA 1TV9A 1C7YA 1D8YA 4IRDA 4M9JA 4UBCA 4UQGA 3LWLA 4UB1A 4DQIA 7ICUA 5CJ7A 2KN7A 5J0OA 4QWCA 1ZQLA 4KLMA 3RAXA 4ECYA 5HRHA 2XGQA 3AQNA 5J2JA 4UD4A 5J2DA 1BPYA 1S0OA 1T4GA 1BPZA 3HJ1A 4O3NA 2ZH4A 2JEFA 4B9MA 3N97B 1SL0A 3G6YA 4NLNA 3NYBA 4BWMA 3RRHA 4YR2A 5KT7A 4PHEA 3TFSA 1KFSA 4PHPA 1X9SA 4WC2A 5KT6A 4RQ6A 4RT2A 4WC7A 2FLPA 2XO7A 1XS9D 4DL6A 4UB3A 9ICTA 4QW8A 2BCSA 3FYHA 3RB3A 5D49A 5BOMA 3Q8PB 3M9MB 4F5OA 2HHSA 1FA0A 2VA2A 3T5JA 3TQ1A 8ICEA 9ICGA 7ICLA 5HRIA 5DLFA 4X4QA 3KHHA 2R8GA 1DK2A 1MSWD 2WTFA 7ICJA 3GQCA 1WOTA 1TFWA 5KG2A 4ZH4A 4O3OA 4EBJA 3OJUA 3V7KA 3T5LA 4UB2A 3PX6A 4PGXA 3RB0A 1XC9A 1U4BA 3UXOA 2ATLA 4DOBA 3PMLA 2BCRA 8ICZA 3PW0A 1BNPA 5KG3A 2XCPA 4MEXA 2NRKA 4E8FA 4Z6EA 4TUQA 2DR9A 4DSKA 9ICVA 2O1PA 1MIWA 3PV8A 4NM2A 3TAPA 4RU9A 8ICLA 4QZHA 4O3QA 2XY7A 5KFDA 3H8WA 5L1IA 4F2SA 9ICXA 2AGQA 4EZ9A 2DR7A 4QZIA 1JIHA 3RTVA 3RR7A 5DBCA 4I2EA 4KITB 3PX0A 4Z6FA 5KFHA 4F4YA 3BQ1A 3OUYA 4S3NA 4O9MA 3PR5B 3MR6A 5KFKA 3LDAA 5KFNA 9ICNA 4I2BA 4ELVA 4RQ1A 3Q8QB 8ICSA 5J0SA 3HWTA 4G3IA 4FHWA 4GXIA 4M9LA 2R8IA 2PI4A 5DBAA 3THVA 1ZQIA 3NTUA 3Q8MA 1RYSA 5HRDA 4O3RA 1V4AA 2HVHA 1T7PA 1NZPA 4J9QA 2ZH5A 1UA0A 2GWSA 5KFSA 4XA5A 4P4OA 4I2GA 3QEBZ 2JEGA 4RPYA 3RH6A 1S77D 4F50A 4MFCA 5HRFA 5KFQA 5DB9A 4ECSA 4Q45A 4UD5A 5J0YA 2J6SA 3OVSA 4QW9A 1B43A 1RZTA 4JWNA 9ICUA 2ZHBA 4AT8B 2ZH3A 4RZRA 2H5XA 3SZ2A 3RJJA 4RNOA 3H4BA 4K4HA 4KLQA 1S97A 2W9BA 4XQ7A 2XGPA 4ECWA 4RQ7A 1T8EA 1U47A 1RYRA 2HHTA 4X4NA 1ZQUA 4AT9A 5J0RA 1L3UA 5HR9A 4C8KA 1ZQOA 2HW3A 3OSPA 9ICBA 8ICGA 4F5NA 5BOLA 3RRGA 4JUZA 4DQQA 2XY5A 4O3SA 5CR0A 2KFNA 9ICMA 2Y1IA 1ZJNA 1ZYQA 4KLUA 2M2UA 3OVAA 3H3AA 2BGWA 2DRAA 3ETLA 3FDSA 5HMMA 4YXJA 2W8LA 1KFTA 3GV5B 4DLGA 5DDYA 4BXOA 5L1LA 1HUOA 3OVBA 4EBKA 3K75D 4RT3A 1UEVA 3C21A 7ICFA 7ICEA 2DR8A 1EXNA 3M9OB 5DQHA 2HHWA 4WBZA 4BDPA 4KLIA 1Y88A 1COOA 4KLFA 4M9NA 4ECZA 3SI8A 2IHMA 2C2RA 1TFRA 2DRBA 2A1JB 3SV3A 3PX4A 5CWRA 4DSIA 4RQ8A 4QZ8A 1Z00A 3KHRA 1YLQA 4RQ0A 3ZDBA 2NRVA 3ISCA 4MEYA 3HT3A 8ICKA 1NJXA 4ED1A 4YN4A 4JV0A 4RPXA 1TK8A 1LB2B 2BR0A 1N56A 4TUSA 5HHIA 4DO9A 1L3SA 2ID1A 2BCUA 2KP7A 4X4RA 1CUKA 3GV8B 4YMNA 5KFIA 2MUTA 3KHLA 3H4DA 4JV2A 4JV1A 5KFMA 4QZEA 2HVIA 1SL2A 8ICXA 3C18A 1N48A 4NKUA 4DWIA 3PW2A 4QZ9A 5J0UA 4I2HA 1S0MA 3BQTA 3UXPA 1NKCA 4BWJA 4WC4A 2ASJA 5J2FA 3MR2A 5DBBA 4C8LA 4I28A 4EP7A 3PW4A 2LYHA 3QZ7A 1S76D 1BPXA 1NK5A 2HHUA 4TURA 1NKEA 4ATBA 1RXVA 5KFBA 5DB6A 4CCHA 1Q79A 5KFXA 8ICYA 1NKBA 2PXIA 3V7JA 1NJWA 3E2EA 7ICMA 3RB6A 3JYYA 4AT7A 4YCXA 1ZQBA 3AQKA 4C8NA 5IINA 3ZD8A 3PW7A 3C2KA 1HJPA 3WFQE 1KTQA 2KZMA 2DVIA 4EBDA 2J6UA 4DSFA 4WC0A 4ED3A 3M9NB 9ICSA 5HHHA 4QZAA 1SL1A 4DOCA 4DL4A 3GV7B 1QSLA 1VFGA 4QWBA 3AUOA 5KG6A 4DSEA 8ICBA 8ICOA 4I27A 3GIIA 4YMOA 1QLNA 5J2GA 4KLHA 4YR0A 9ICFA 4NM1A 9ICEA 4C8MA 2BPCA 4RQ2A 4UAZA 5KFRA 4FBUA 1MIVA 1A76A 5KFAA 4YP3A 3OUYB 1KRPA 2ZJAA 4KLLA 4O5CA 4P4PA 4ECTA 5KFVA 5CHGA 4KLEA 4FHPA 3GFKB 5DGAA 3RH4A 1BPEA 4O5EA 3H37A 4HYKA 7ICGA 4EYHB 2RFFA 1NK0A 2PFOA 1TAQA 2FLLA 4WBYA 4P4MA 4GXKA 2W8KA 1ZQJA 4IQWA 4DSJA 3MGHA 2AJQA 8ICFA 3HIYA 1SKRA 5TZVA 3G6VA 4B9VA 1JXEA 4Z6CA 5DB8A 4NY8A 1KNYA 3OHBA 4B9LA 4UB4A 4RWNA 3RJEA 4IR1A 5L1JA 2DPIA 1SKWA 2P6UA 2UVRA 4X0BA 4ED6A 3MDAA 3T5HA 4IRCA 4KLJA 1TVAA 3QZ8A 9ICHA 2NRZA 3SV4A 1U45A 2BQRA 4UB5A 1VJ7A 1TKDA 4NLKA 1MC8A 9ICCA 1SKSA 3ISDA 3UPSA 3JPTA 3HP6A 4FS2A 5F2VO 4ECXA 5J2IA 4YD2A 4WC6A 5DQGA 4DF4A 1X9WA 1LV5A 3PO5A 8ICQA 4QZFA 3EZ5A 4DFKA 4DL7A 3QEAZ 1F5AA 5CP2A 3V6KA 2AGOA 3PY8A 4IQVA 9ICPA 4MFAA 4ECQA 4FH3A 1ZQCA 3OHAA 4ECVA 1NK4A 3N4MB 2W9CA 5EOZA 4ED8A 1WCLA 5KFTA 1XO1A 3OJSA 3M8RA 2IA6A 5DLGA 1NJYA 8ICVA 8ICAA 4F5PA 3MBYA 4LT6A 2FPLA 1S0VA 4F4KA 3H39A 3M8SA 3ZDCA 3B0YA 4TQSA 1ZJMA 2FMPA 3BQ2A 2JEIA 1CEZA 3MR3A 3RJHA 4F3OA 3PVXA 4X4PA 2ZH2A 1X9MA 5IIJA 1UEUA 2BHNA 1JQRA 3TAQA 1NK6A 1L5UA 7ICIA 5KFGA 4J9KA 3ZDDA 4KLGA 9ICQA 3OV7A 3Q8RB 2BDPA 3SYZA 3ZDEA 2W9BB 5BPCA 2P66A 1XU4A 5L9XA 1XWLA 5KG4A 5C5JA 1ZQKA 4B9TA 4AT9B 5DQIA 4E0DA 5HRKA 3Q8LA 4JK1A 4F91B 2ISOA 3WFOA 4UAYA 2Q0ZX 3C23A 3LQCB 4B9SA 5J2EA 1BNOA 5KFFA 8ICJA 4J9MA 9ICIA 5J0XA 4DLEA 5KFPA 1ZQVA 2PI5A 4F92B 3JPNA 3TANA 2M9NA 3HW8A 2R8JA 9ICLA 7ICRA 2PBEA 5KG0A 5KFWA 5J2BA 1TK5A 4F8RA 1XSPA 3BJYA 8ICRA 5KT2A 3V6HA 9ICKA 3RJIA 4M6WA 2BCQA 3ZDAA 4DF8A 4PPXA 1B22A 3V7LA 4FS1A 5KTQA 2BE3A 3UXNA 5KFLA 2B21A 3H8JA 4FHYA 2AQ0A 3KHGA 3HPOA 4J9RA 2C2EA 2AGPA 4RUAA 2ISPA 4KMUA 2BQ3A 2FPKA 2UVUA 1JAJA 3AQMA 1ZQGA 4YFKA 5HP4A 1ZQTA 4NKTA 2ZUCA 4J9SA 4WC3A 4R8UA 5DECA 2DR5A 5J0TA 4PHAA 8ICMA 4E80A 3WFRE 4QZGA 1DOQA 3TFRA 1BVSA 2C2DA 1UA1A 5IIIA 4YQWA 3T5KA 2UVVA 2DPJA 4B9UA 1MIYA 4X4TA 8ICHA 4R65A 1Z00B 1ZQPA 4M5DA 3Q8SB 1MQ3A 1MQ2A 3G6XA 4DL3A 4C8OA 4LZGA 3H40A 4IQUA 1RPLA 3PW5A 5CB1A 3C5FA 1IXRA 5IIOA 3C2LA 3RBDA 4EZ6A 8ICCA 4DOAA 3EYZA 2F1HA 5J2KA 2IHNA 2JZBA 4LZDA 1KLNA 4KLSA 4RWPA 3JZ0A 1H38A 2VA3A 3PO4A 2PFQA 7ICHA 2KFZA 2MAXA 3IM1A 5L1KA 4QZCA 4RWQA 2MUTB 3PNCA 8ICNA 5HNKA 4Q43A 1L3VA 3RJKA 4X4SA 1D8LA 7ICNA 2BKEA 4DS5A 5HREA 1ZQFA 3TI0A 2VA8A 4I2CA 3MFHA 3KTQA 3C66A 4PGYA 3GIMA 4RNMA 4DQPA 5EWFA 5J29A 5EWGA 7ICVA 3HX0A 4UAWA 7ICOA 3T3FA 5HC9A 4FH5A 1TAUA 2O5AA 1U9LA 4DQRA 7ICTA 4F4WA 1PZNA 1BGXT 4GC6A 1AROP 3RBEA 4DSLA 1PX5A 4ATBB 3JPPA 4M9HA 4DS4A 3RJFA 5KG5A 4O0IA 4R64A 1ZQMA 1QSSA 1D9FA 2PFPA 2ZUDA 5KFJA 5KFZA 4TUPA 1KSPA 2HHVA 5F9LA 3BQ0A 4J9LA 4B9NA 4AT7B 4I2DA 4XRHA 4F4XA 4NXZA 5J2AA 1NOMA 2ZTDA 3RAQA 1ZETA 1ZQSA 9ICWA 9ICOA 1JMSA 2HHPA 4XUSA 3JPOA 3LK9A 4X4OA 2ZH6A 3MGIA 3C1YA 2VANA 3PR4A 1HUZA 5HRBA 4MFFA 2RDJA 4M0AA 4P2HA 4Q8EA 5HRGA 4X5VA 1NJZA 5IILA 4RWOA 7ICKA 2R8HA 1JX4A 1Z3EB 5KFCA 2C28A 2ALZA 4I2AA 1OU5A 4IR9A 4YD1A 2IBKA 4J9OA 1NK9A 4WC1A 9ICRA 5CA7A 4ED2A 4I29A 5KG7A 2M2VA 4RNNA 2FMQA 2Q66A 4IG8A 2ZJ5A 3K4GA 5J0WA 1IM4A 2ASDA 4YMMA 4F5QA 1ZQHA 4YXMA 4YVZA 2P6RA 5J0PA 2BPGA 4R63A 2ZJ8A 3EPIA 5DG7A 2W9AA 2NRXA 3C5GA 1KFDA 4IRKA 1TFYA 1UT8A 4BGDA 3H38A 5DG9A 4RPZA 4RQ4A 3C2MA 3RH5A 3GIKA 2BQUA 2BCVA 3EW9A 4DEZA 4F5RA 1KDHA 2RDIA 4I2JA 3V72A 1S10A 1ZQQA 1UETA 4MF8A 5DEDA 3GIJA 2F1JA 1UT5A 2FMSA 3OGUA 3Q8KA 4FHXA 4YR3A 5DG8A 5JUMA 1DK3A 4WC5A 4ECRA 3ORYA 3BDPA 4M9GA 1S9FA 2OWOA 3EPGA 4AT8A 4WCWA 4QWDA 3MFIA 5KFYA 4ECUA 1U48A 1K1SA 5DDMA 4LVSA 3RB4A 4M2YA 2IMWP 3GDXA 8ICPA 3AQLA 4UBBA 5KFEA 2UVWA 4F2RA 3OSNA 4DFMA 4KTQA 4I2FA 4QZDA 4RQ3A 5D46A 8ICTA 3EWAA 5KT4A 3V6JA 5DB7A 4DL5A 4FHVA 2KTQA 2NRTA 3TARA 1ZQRA 2DFLA 4GLXA 4X4UA 2W9CB 4FBTA 3MR5A 5KT5A 1ZQEA 4Z6DA 7ICPA 1ZQYA 3IHQB 3AU6A 4PH5A 5J2CA 3H8SA 4ED7A 2BPFA 5J0QA 1S0NA 4DL2A 4GXJA 2JEJA 2ZH8A 3HJ4A 7ICSA 2HHXA 2ZTCA 1L3TA 1BPBA 5IIMA 1NO5A 1R8BA 2V4RA 2ASLA 3UQ0A 2AU0A 2W9MA 2M2WA 1WCNA 1ZQWA 1XSNA 2ZUBA 3PMNA 1NK7A 2V9WA 4KN4A 4BXOB 2XC9A 4ELUA 2KZ3A 1KEJA 4DFPA 1ZQZA 3MABA 4QWAA 2I9GA 3RJGA 1ZQDA 2A1JA 4PHDA 3UQ2A 1X2IA 3UPQA 4F93B 4FO6A 3QE9Y 1U49A 1D9DA 4KLOA 5D4BA 4Q8FA 2C22A 8ICWA 3JPSA 1Q78A 3WFPA 2ZH7A 4EYIB 2ZTEA 4ED0A 2XCAA 4X4VA 4M04A 3RR8A 3LWMA 1QTMA 4KN7A 2ZH1A 1A77A 4PGQA 4J9NA 1ZQXA 4EBEA 4M6WB 9ICAA 2M2TA 1V9PA
chains in the Genus database with same CATH superfamily
3GILA 3AQFA 3FM9A 2QB0A 5E79U 1NK8A 2QLTA 4MF2A 1T3NA 4K4IA 2ZHAA 1QSYA 4J9PA 2J6TA 5ALOA 4RQ5A 3JPQA 4KLTA 3ZD9A 1RXWA 4OO1J 2Y1JA 1JXLA 2JZBB 3KZIU 1DGSA 2EZXA 2KV2A 1BPDA 4UB6U 5ALEA 4EEYA 5KFUA 3U26A 2RP5A 3PZPA 4KLDA 4K9AA 1K1QA 4O6AA 4UB1A 4KLMA 4ECYA 5AK5A 5HRHA 3AQNA 5J2JA 5J2DA 5ALVA 1S0OA 3VCBA 2JEFA 3FAHA 5K4LA 4YR2A 1L7NA 5KT7A 2WAQF 1KFSA 4PHPA 4WC2A 4RQ6A 4RT2A 2FLPA 1XS9D 4DL6A 4QW8A 5BOMA 2HHSA 4NXWA 1X40A 3T5JA 3TQ1A 4X4QA 5DLFA 1TFWA 1WOTA 4ZH4A 2JHDA 4EBJA 3OJUA 1RM6C 3T5LA 3ER8C 4PGXA 3NASA 3UXOA 4DOBA 4LEVA 4Z6EA 3PV8A 4NM2A 4RU9A 8ICLA 4O3QA 5KFDA 3H8WA 5AM4A 4F2SA 9ICXA 1JIHA 4UASA 4Z6FA 5KFHA 2HDOA 3BQ1A 3OUYA 2L5YA 4O9MA 3PR5B 3MR6A 5KFKA 9ICNA 2ZIWA 4RQ1A 3VC8A 5ALKA 4M9LA 1UHUA 5ALNA 1ZQIA 3PSFA 1T7PA 5CFTA 4Y2VA 5AKIA 4XA5A 5HRFA 3M6KA 3MC1A 9ICUA 2KSOB 1Q8KA 1SV0C 1T8EA 4X4NA 4WJ3B 2LKYA 5AM3A 4EELA 1XNSA 1PK1A 4CRXA 1F44A 1ZYQA 3OVAA 2VIXA 2DRAA 5HMMA 3KBBA 2W8LA 1Z1BA 1KKXA 5DDYA 1L8LA 1Q46A 3T79A 3LVVA 7ICEA 3UMCA 3M9OB 5DQHA 1T3QA 1COOA 3ED5A 1OUQA 5EE1A 4Y2TA 3SI8A 2IHMA 3SV3A 4KX3A 3N7SC 3KHRA 3BS7A 2DGZA 2NRVA 3ISCA 4MEYA 4C4RA 8ICKA 5CEHA 1N56A 2HBJA 5HHIA 4X4RA 4WQLA 2HN1A 3GV8B 1NNLA 3KHLA 5KL8B 3PW2A 5AHXA 4I2HA 3R9KA 2F8KA 2ASJA 4EP7A 2YMQA 1QQ6A 1N60A 1DGJA 4IL6U 1NK5A 1SB3C 2HOIA 4CCHA 2W11A 1A6SA 1NKBA 1NJWA 4AT7A 3RB6A 3PW7A 1HJPA 4WQKA 4WC0A 4QZAA 1SV4A 4DL4A 4DSEA 8ICOA 2KKPA 2K4EA 3GIIA 4YMOA 2W3RA 2ES6A 4YR0A 2F76X 9ICEA 4C8MA 2BPCA 1A76A 5KFAA 3BZCA 2ZJAA 4KMOB 2MU2A 4KLEA 1ZD5A 3RH4A 2RFFA 1Q3VA 2FLLA 4JLXA 4P4MA 1SKRA 5TZVA 2FCLA 1KNYA 2W7OA 3RJEA 2GLEA 3MDAA 3TADA 9ICHA 2I6XA 2WB1C 2VJ5A 2BQRA 3QU2A 2HN2A 4HAIA 3ISDA 1MN8A 3UPSA 4A8EA 3HP6A 5AKGA 3M6ZA 4FFDA 2OH2A 4WC6A 4NXVA 4QZFA 4IQVA 4MFAA 4ECQA 1LKYB 3OHAA 1NK4A 2DRBA 5DLGA 1NJYA 4F5PA 4NJ8A 3JCFA 3M8SA 3B0YA 2OYYA 2JEIA 4X4PA 3MR3A 2ZH2A 1UEUA 2NO5A 2BBJA 4OD0A 5AM0A 4FE3A 5BPCA 1XU4A 4AT9B 4E0DA 2QARA 3WFOA 4JK1A 1QH9A 5KFFA 1F0MA 5ALGA 4NXTA 9ICIA 4DLEA 1ZQVA 2R8JA 5KFWA 4F8RA 1ZRMA 9ICKA 4NLCA 2E3TA 4M6WA 3ZDAA 4DF8A 3EF2A 3V7LA 2ZG6A 5KTQA 4UAVA 1PVRA 5KFLA 2B21A 2AQ0A 2C2EA 4RUAA 1SWVA 2UVUA 3AQMA 2OXOA 2KMDA 4NKTA 1ZQGA 1ZQTA 2ZUCA 2AXTU 5DECA 5J0TA 5JTIA 5B3PA 4QZGA 1DOQA 3TFRA 3T5KA 1MIYA 5ALTA 4M5DA 4PJ0U 4LZGA 1TE2A 2ZXIA 3C5FA 3C2LA 3RBDA 5IIOA 4RWPA 4KLSA 2JZBA 1KLNA 1Z19A 2JR5A 4HX0A 7ICHA 2MAXA 2G08A 1V97A 7ICVA 5KNIA 5HC9A 4K9BA 3NUQA 4F4WA 4ATBB 1B0XA 1KSPA 3BQ0A 4NXZA 3RAQA 9ICWA 2ZTDA 9ICOA 5JU5A 2LM1A 2ZH6A 3MGIA 2Y9UA 2KICA 4M0AA 4Q8EA 2YY6A 7ICKA 5KFCA 5AICA 2IBKA 2OCEA 3HILA 5CA7A 2Q4TA 2M2VA 2FMQA 4CDGA 2Q66A 3K4GA 5J0WA 1ZOLA 4YMMA 4YXMA 4YVZA 5J0PA 2ZJ8A 1SXDA 2W9AA 2XVTA 1TFYA 2E5SA 2E8MA 3H38A 5DG9A 3RH5A 4DEZA 1UETA 1ZQQA 2RDIA 1S10A 2K8CB 5AI0A 1FFVA 3SAFA 3OGUA 2ZIWB 3E0FA 3D2NA 2P35A 1DK3A 1JUDA 4WCWA 4F72A 3K1ZA 5KFYA 5DDMA 8ICPA 3AQLA 3NWIA 4F2RA 3OSNA 4KTQA 1FIQA 3EWAA 4EEKA 3HKZC 4FHVA 2NRTA 2DFLA 4GLXA 4FBTA 3MR5A 2KIWA 4Z6DA 3IHQB 1PK1B 2HHXA 2ESEA 3BQ7A 2V4RA 1JROA 3CYMA 2ZIXB 1XSNA 2ZUBA 4RQMA 2JV3A 2IHOA 3RJGA 4EX7A 3RJJA 1X2IA 1U49A 2ZH7A 3QU5A 3KD3A 2KVCA 2K60A 2WF7A 5EWEA 2WB1F 4TQRA 4O3PA 3E58A 4IQTA 3AU2A 4PL2A 4R66A 3I76A 4ELTA 4YG2A 5DGBA 4R8UB 1ZQAA 1R8CA 2VJ4A 4I2IA 2I1QA 4JWMA 2FLNA 5JTGA 2H3FA 4Y2SA 4EGWA 3NGDA 3JPRA 4UW9A 2EDUA 2F1IA 1ZRNA 2H3VA 5CFUA 3C1ZA 5DKWA 2EZYA 3HRDD 4M47A 2NRWA 5HR7A 2XY6A 2F3NA 3KKAA 2KZZA 3NVWA 5HRLA 1XSLA 4QZBA 2F77X 2HI0A 1D8YA 4K8VA 5KG1A 4DQIA 1IG6A 4QWCA 4UD4A 3L3FX 1BPYA 3N97B 1SL0A 3G6YA 2K89A 4BWMA 3TFSA 1X9SA 2LI6A 5AI4A 3NRZA 2IUBA 2XO7A 4UB3A 5A0LA 2KD1A 4F5OA 2W04A 2VA2A 2R8GA 1MSWD 3GQCA 3QUCA 3WKBA 1XC9A 4UB2A 3RB0A 1OXJA 2ATLA 2BCRA 2CPRA 3PW0A 8ICZA 5KG3A 1BNPA 3FC4A 2NRKA 4E8FA 9ICVA 2O1PA 4QZHA 2VKQA 2XY7A 2K4IA 4I2EA 1LKYA 3Q8QB 2MSNA 2KEYA 3NTUA 1RYSA 1V4AA 4O3RA 2FI1A 3NVVA 1UA0A 4P4OA 2JEGA 4MFCA 5KFQA 5J0YA 4QW9A 5AK6A 4JWNA 5FP0A 2ZHBA 4AT8B 2ZH3A 3AM9A 3H4BA 2XGPA 4ECWA 1SIJA 3GU3A 4AT9A 4U7CA 4CE6A 9ICBA 4F5NA 3OPXA 4MHVA 2IOFK 3RRGA 4JUZA 2XY5A 4O3SA 4P0QB 5CR0A 9ICMA 2HBLA 1ZJNA 5L1MA 1KFTA 5L1LA 2OHFA 4O68A 4RT3A 1UEVA 3C21A 2HCFA 4BDPA 1Y88A 4KLFA 5ALDA 3BS5B 2C2RA 5AK4A 4NL9C 4DSIA 2B56A 4RQ0A 1S8OA 2G5IB 3K7DA 3HT3A 4ED1A 3H0RB 4TUSA 3RFAA 2HOQA 2KP7A 3C28A 5D61A 1CUKA 2N1RA 5ALPA 5KFMA 4QZEA 1SL2A 3C18A 1NI3A 3BQTA 3UXPA 4WC4A 3PHZA 5EE0A 4N7RA 1BPXA 3HKZF 2HHUA 5B3QA 4ATBA 1RXVA 1ZXIA 5KFBA 4FZNA 5DB6A 5KFXA 2KJ8A 3SQIA 1ZD2P 4C8NA 3ZD8A 4BX9C 2KZMA 1UQVA 2GA9D 4ED3A 1SL1A 4DOCA 1QSLA 1YZ7A 3F2BA 8ICBA 1QLNA 4FBUA 4YP3A 1T94A 3DEEA 2GAFD 4KLLA 5KFVA 4FHPA 1BPEA 4HYKA 4PZNA 2QB1A 4WBYA 2LMRA 2W8KA 1ZQJA 4DSJA 3MGHA 3HIYA 3G6VA 1JXEA 4B9LA 4UB4A 4RWNA 2DPIA 2UVRA 4DFDA 4ED6A 4P0PA 1TVAA 5ALFA 5AKEA 1MA7A 9ICCA 1PK3A 3JPTA 2DKZA 4ECXA 1N62A 5J2IA 2CXYA 4DF4A 1X9WA 5J8YC 4EEDA 2GO7A 3QEAZ 2HMXA 5CP2A 3V6KA 2AGOA 3PY8A 4OAGA 1RDFA 4ED8A 1WCLA 3OJSA 3M8RA 4CF3A 2H3ZA 2M0NA 3H39A 2FMPA 2JGAA 3F2CA 2BHNA 2D6FC 1JQRA 7ICIA 4KLGA 4J9KA 2W9BB 2P66A 5L9XA 2ZIXA 4O67A 4B9TA 3Q8LA 3NVYA 4US9A 4UAYA 3UMGA 3C23A 1L6NA 4B9SA 5J2EA 1BNOA 3LQCB 8ICJA 3PSIA 5KFPA 1SV0A 5AM1A 4U6PA 2M9NA 2LM4A 1QQ5A 1XSPA 3BJYA 8ICRA 5ALXA 1YZ6A 2DUYA 3RJIA 2YTUA 4NXUA 1PUZA 1WG8A 3H8JA 3IRUA 2ISPA 2AGPA 1JAJA 4KMUA 2FPKA 4YFKA 4WC3A 4R8UA 4IC9A 8ICMA 2B51A 3WFRE 2C2DA 5IIIA 2I5HA 4YQWA 2DPJA 8ICHA 4R65A 1B4FA 1ZQPA 3G6XA 4DL3A 4IQUA 2F44A 8ICCA 3EYZA 2IHNA 3JZ0A 2RRDA 2G0AA 3PO4A 4RWQA 3PNCA 1L3VA 4X4SA 1D8LA 2DQNB 7ICNA 2BKEA 3CRXA 3C66A 3MFHA 3KTQA 4K96A 4PGYA 5EWFA 3HX0A 7ICOA 4FH5A 5ALIA 1PZNA 4DSLA 1PX5A 3RBEA 4M9HA 4DS4A 5KG5A 1ZQMA 4TUPA 2QKQA 5AM2A 4B9NA 4F4XA 2MA1A 4XUSA 3JPOA 3LK9A 2VANA 4FZMA 5HRBA 5HRGA 2W55A 5IILA 5AKHA 1JX4A 5ALQA 1GO3F 4I2AA 3WK5A 4YD1A 2XIDA 4Y2QA 2KIVA 9ICRA 4ED2A 2FDRA 5AI6A 2ZJ5A 4F5QA 1IIPA 2P6RA 3D6JA 3EPIA 2NRXA 4IRKA 1UT8A 2EH9A 1YT3A 3RR7A 3QU9A 1KDHA 4F5RA 3V72A 4I2JA 4CF5A 2LYAA 2PMZC 2F2AB 4C7ZA 4OJOA 4FHXA 5DG8A 4WC5A 2G07A 3ORYA 4M9GA 1S9FA 2OWOA 4AT8A 4ECUA 3RB4A 3QXGA 2IMWP 2Y0SC 3ERCC 2G09A 2YB4A 3H8MA 4NV0A 4RQ3A 3V6JA 5DB7A 4DL5A 2KTQA 3TARA 4NXXA 4X4UA 2Z7JA 2W9CB 4P0QA 5KT5A 5J2CA 3IG8A 3H8SA 3D2SA 1L7PA 1S0NA 4EENA 2ZH8A 3HJ4A 5ALMA 2R18A 1R8BA 1NO5A 4AP9A 3WK8A 3O0FA 3BS5A 1NK7A 3C29A 2KZ3A 2I9GA 4DFPA 4OAHA 3MABA 4M2YA 1ZQDA 4PHDA 2BE3A 3IG5A 1D9DA 2G5HB 4KLOA 8ICWA 2RQ5A 3AEVA 1SXEA 3WFPA 2ZTEA 2XCAA 4M04A 1QTMA 3AMZA 3SR6A 3F2DA 5AI9A 2JMGA 2HHQA 2RLTA 1Z4NA 4GC7A 2FJ6A 4RUCA 5KFOA 2R8KA 4EBCA 4NLZA 1R8AA 5D62A 4Q44A 4F4ZA 4CNQA 5KT3A 3SAGA 2FPMA 1FO4A 5F9NA 4NLGA 4X0AA 1JN3A 2W3SA 2DKXA 4UARA 3L9DA 4WH5A 5ALZA 4O5KA 9ICJA 2AQ4A 4DQSA 3H7IA 1ZQNA 1SZPA 4M9JA 1S77D 4QWEA 1TV9A 3LWLA 7ICUA 2KN7A 1ZQLA 2PKEA 3RAXA 2AHOB 4CGZA 3N7PD 1BPZA 1T4GA 3HJ1A 2YMLA 4B9MA 3K1RB 1V85A 3RRHA 4PHEA 4AYBC 5KT6A 2KJ5A 4OAFA 3FYHA 3RB3A 1HEKA 1FA0A 1V38A 9ICGA 3KHHA 2NO4A 7ICJA 3SD7A 3KOOA 4EZ6A 4KB6A 3SEIA 1U4BA 3PMLA 3WKCA 5AI8A 2XCPA 2DR9A 3UMBA 3WKDA 4C7YA 4DSKA 1MIWA 5JRTA 2WF6A 4P0PB 3MGVA 2DR7A 4EZ9A 4QZIA 5DBCA 2KK0A 4S3NA 1QCKA 3LDAA 5KFNA 4I2BA 8ICSA 2H3IA 2NYVA 4G3IA 4GXIA 4FHWA 2R8IA 2PI4A 2HVHA 1NZPA 3L5KA 2K8BB 2ZH5A 3GZFA 2B6GA 3OWGA 5KFSA 4RPYA 3RH6A 4F50A 4ECSA 4Q45A 2J6SA 4I0UA 1RZTA 2HSZA 3SZ2A 2WHEA 4KLQA 4UAUA 1S97A 2W9BA 4Y2YA 2A3VA 4XQ7A 1RYRA 1U47A 3M7DA 1ZQUA 1L3UA 1K5OA 4FZLA 2HW3A 4JMUA 1JALA 5BOLA 4DQQA 2LPEA 3NRWA 2Y1IA 4KLUA 2BGWA 4LEYA 1X66A 3FDSA 3J81j 4DLGA 1Z1VA 5AKJA 3K75D 3MCRA 1EXNA 1LVHA 4WBZA 4KLIA 3DDHA 3N7RC 1YLQA 1NZBA 2IOHA 4YN4A 4JV0A 4RPXA 2BR0A 1L3SA 2ID1A 2BCUA 4LJXA 4YMNA 5KFIA 4JV2A 3H4DA 4DCCA 5H2FU 4JV1A 4NKUA 1N48A 5J0UA 1S0MA 5AM5A 1NKCA 2Y0SF 4I28A 4C8LA 5DBBA 3PW4A 2ZXHA 1FEZA 2LYHA 3QZ7A 2Y9TA 1S76D 1NKEA 3CNHA 5ALSA 3V7JA 3E2EA 3QX7A 4YCXA 3AQKA 3WFQE 1COKA 4FO1A 3C2KA 2J6UA 3M9NB 1SGGA 5HHHA 2E1FA 3AUOA 4BJQA 4I27A 5J2GA 4NM1A 1MIVA 1KRPA 1OW5A 3A0BU 3QYPA 4P4PA 4ECTA 1L8OA 4OAIZ 5DGAA 3H37A 4EYHB 2EAPA 4IQWA 3H0MB 8ICFA 4QIWC 4B9VA 4XJEA 5DB8A 4NY8A 5AKKA 2KJ9A 5L1JA 1SKWA 2P6UA 4X0BA 4KLJA 2NRZA 3SV4A 1U45A 4UB5A 1VJ7A 2EAOA 5CHEA 1TKDA 1MC8A 1SKSA 2E8PA 4FS2A 8ICQA 2DWQA 4C4SA 4RQNA 4DFKA 4DL7A 1F5AA 2DL0A 3N4MB 1KW4A 2W9CA 4K99A 2IA6A 4LT6A 2A1AA 2BDUA 8ICVA 1S0VA 1TAMA 4TQSA 1ZJMA 1CEZA 3ONNA 4F3OA 2YMPA 3PVXA 5D63A 5IIJA 2KNJA 4KM5A 1J2MA 2HBKA 3TAQA 1NK6A 1L5UA 9ICQA 1SZHA 3PSTA 1XWLA 5KG4A 1ZQKA 5HRKA 2ISOA 5ALLA 3N28A 3NKUA 4J9MA 2B0CA 4QJFB 4ZOHC 5J2BA 1TK5A 3NVZA 4GIBA 3AQEA 5KT2A 2BCQA 4PPXA 1L7OA 1B22A 3WKEA 4FS1A 2AH5A 3KHGA 3HPOA 2BQ3A 2BBHA 5HP4A 2DR5A 4PHAA 4B9UA 1BVSA 1UA1A 4X4VA 1RG6A 1X42A 1Z4OA 1Z00B 3Q8SB 1MQ2A 4C8OA 3BZKA 3H40A 1RPLA 3PW5A 5CB1A 1IV8A 2E8NA 9ICPA 4DOAA 1FFUA 5J2KA 4LZDA 4NL9A 4LEZA 1H38A 1PVPA 2PFQA 2KFZA 2MUTB 3QU7A 5HNKA 3RJKA 3KFUF 1N63A 4DS5A 5HREA 3TI0A 2VA8A 5EE9A 3GIMA 4RNMA 5EWGA 4UAWA 3T3FA 3F5EA 1DRGA 2KVSA 7ICTA 1BGXT 1L7MA 4GC6A 2W54A 3RJFA 1QSSA 4F71A 2ZUDA 5KFJA 7ICLA 3AL0B 4XRHA 2W03A 4E80A 1NOMA 1ZQSA 1JMSA 2HHPA 4X4OA 3PR4A 1HUZA 4MKPA 2RDJA 1VDVA 3NVOA 1Z3EB 1OU5A 2JXJA 4J9OA 4OCZA 2ZIUB 4WC1A 4JB3A 4RNNA 1ZQ1C 2K8AA 1VLBA 3NS1A 2BPGA 4O3MA 4R63A 1Q3UA 5DG7A 3C5GA 1KFDA 4BGDA 2BCVA 3C2MA 2BQUA 3RR8A 1N5XA 4MF8A 2LYBA 3GIJA 4OJ6A 5DEDA 1UT5A 1VJ5A 4YR3A 3QUTA 1UCVA 5AKYA 3EPGA 4QWDA 3WU2U 4LVSA 3GDXA 3F5AA 5KFEA 4DFMA 4I2FA 8ICTA 5KT4A 1ZQRA 5KAIU 1C20A 3H0LB 1RQLA 7ICPA 4PH5A 1J2NA 5J8YA 4GXJA 2WFAA 3LYSA 1L3TA 2HOFA 5ALWA 1BPBA 5IIMA 2ASLA 3UQ0A 1F5SA 2W9MA 2M2WA 1ZQWA 5HR9A 2V9WA 3PMNA 4ELUA 1KEJA 1ZQZA 2OM6A 3QE9Y 3UPQA 7ICSA 4F93B 2EQYA 3JPSA 1X6JA 3I28A 4EYIB 4ED0A 4QIWF 5B5EU 4KN7A 4J9NA 3QNMA 4EBEA 9ICAA 1S5LU 4EX6A 4LEWA 5ALRA 4OJ5A 1CI4A 5KAFU 2V4QA 2OEHA 4E7XA 4QNLA 3MDCA 1TK0A 2XICA 2PFNA 5AIBA 1DXSA 2ZH9A 8ICUA 3TKAA 4K4GA 2FE9A 3B0XA 1PVQA 1R89A 2DBYA 5F3XB 7ICQA 8ICIA 2WF9A 5EE3A 3WFSC 4OJPA 2ZIVB 4DFJA 3F53A 5IIKA 4XQ8A 5HMLA 2RHFA 4Y2PA 3ISBA 1C7YA 5J2HA 4IRDA 2WF5A 4UBCA 4UQGA 3WK4A 5CJ7A 2YB1A 5J0OA 1D8BA 2XGQA 3QUBA 4CF4A 2ZH4A 2JH7A 4O3NA 3OTQA 4NLNA 3NYBA 2EANA 4WC7A 3A0HU 3TADC 9ICTA 1J97A 2BCSA 5B66U 5D49A 5AKLA 3Q8PB 2EZZA 3M9MB 8ICEA 5HRIA 1DK2A 4OJLA 2WTFA 5KG2A 4O3OA 3V7KA 3PX6A 2LHTA 5KL1B 4EEBA 4MEXA 4TUQA 2K4PA 3EUB2 3TAPA 3QUQA 4K97A 4C80A 5L1IA 2KKVA 2AGQA 3WK9A 3RTVA 3CW2C 4KITB 3PX0A 4F4YA 1SWWA 5CRXA 4ELVA 1O08A 4BUGA 5J0SA 3HWTA 5ALJA 5DBAA 3THVA 3Q8MA 5HRDA 4J9QA 2GWSA 4UATA 4KX5A 3QEBZ 4I2GA 2E1EA 1O03A 5DB9A 3OVSA 3IP4B 4UD5A 1B43A 4RZRA 2H5XA 1GPJA 4RNOA 4K4HA 2BZFA 4RQ7A 2HHTA 1P7DA 1X6IA 5J0RA 2W7PA 1ZQOA 4C8KA 2KE7A 3OSPA 8ICGA 4IS7A 3CK6A 2KFNA 1KBUA 4NWIA 2M2UA 3H3AA 3ETLA 4YXJA 3GV5B 4BXOA 2EWRA 1HUOA 3OVBA 4EBKA 7ICFA 2DR8A 2KOBA 4ICAA 2HHWA 4M9NA 4ECZA 1TFRA 2A1JB 3PX4A 5GTIU 5CWRA 2O6KA 4ACOA 4RQ8A 1RQNA 1Z00A 4QZ8A 3ZDBA 3ALRA 1ZD3A 3SMVA 1NJXA 3M1YA 1TK8A 1LB2B 4DO9A 2GH1A 2QB0B 2MUTA 1QQ7A 2HVIA 8ICXA 1ECWA 4DWIA 2JH1A 4QZ9A 4BWJA 5J2FA 3MR2A 2ODGA 2DF4B 5AK3A 2B4VA 4TURA 1X9XA 3UM9A 2WF8A 1Q79A 8ICYA 5ALUA 2PXIA 7ICMA 3JYYA 1ZQBA 5IINA 5ALHA 5T14A 1KTQA 2DVIA 4EBDA 5AKZA 4DSFA 9ICSA 1N2XA 3GV7B 2D3DA 1VFGA 4QWBA 5KG6A 4KLHA 1ZD4A 4GFJA 4RQ2A 4UAZA 5KFRA 4O5CA 2ZIUA 5CHGA 5C0YA 5TISU 3GFKB 4O5EA 2JRZA 3WKAA 7ICGA 1NK0A 2PFOA 1TAQA 3D2QA 4GXKA 2AJQA 2XI9A 4Z6CA 4Y2UA 3OHBA 4IR1A 4IRCA 3T5HA 3QZ8A 2LBOA 3ZI4A 2CN1A 5AI5A 4NLKA 3ICXA 4JLZA 5F2VO 4YD2A 5DQGA 1LV5A 3PO5A 5G5HA 3OUYB 3EZ5A 3CP8A 4FH3A 1ZQCA 4ECVA 3IN5A 5EOZA 5KFTA 3HJEA 1XO1A 8ICAA 2KSOA 3MBYA 4EV6A 2FPLA 2YQEA 1UPHA 4F4KA 1ED1A 3ZDCA 4WOYA 3BQ2A 3RJHA 1X9MA 4G9BA 5ALYA 4NLBA 5KFGA 3ZDDA 3OV7A 3TACB 3Q8RB 2BDPA 3SYZA 3ZDEA 2HBMA 5C5JA 2GOLA 5DQIA 4F91B 2Q0ZX 3IDWA 1HIWA 5J0XA 2PI5A 9ICLA 3WK6A 2WAQC 4F92B 3JPNA 3HW8A 3TANA 2PBEA 1AQ6A 2G06A 5KG0A 3V6HA 1WWUA 3UXNA 3AN1A 4US8A 4FHYA 2YN4A 4J9RA 4J9SA 3SAHA 2D8CA 2PMZF 7ICRA 2UVVA 4K98A 4X4TA 3KKAC 3RF9A 3B9JA 1MQ3A 1A0PA 2A19A 1IXRA 2F1HA 1N5WA 1KN5A 2VA3A 5L1KA 3IM1A 4QZCA 5GTHU 2ZIVA 3SENA 8ICNA 1KQQA 4Q43A 1ZQFA 4I2CA 4UB8U 4DQPA 2KHVA 5J29A 2NV3A 1XO0A 1TAUA 3KZXA 1U9LA 1WUDA 4DQRA 2O5AA 2KG5A 1AROP 3JPPA 4O0IA 4R64A 4O69A 1D9FA 2PFPA 5KFZA 5F9LA 4AT7B 4J9LA 2EAMA 4I2DA 5J2AA 2IOFA 1ZETA 4PZOA 1JRPA 3C1YA 5CFSA 1KL9A 4MFFA 4P2HA 4X5VA 3DV9A 1NJZA 1CRXA 4RWOA 3LVWA 2R8HA 2K4HA 2MRLA 2C28A 2ALZA 2CRXA 4IR9A 4PL1A 1NK9A 4I29A 5KG7A 1M6YA 2YX8A 4IG8A 1IM4A 2ASDA 4B6JA 1ZQHA 5AIAA 2KHQA 4RQ4A 4RPZA 3GIKA 2HHVA 3EW9A 2F8LA 2F1JA 2FMSA 4Y2XA 1WYGA 3Q8KA 5JUMA 4ECRA 3BDPA 4C0ZA 1N61A 4Y2RA 1URJA 3MFIA 1U48A 1K1SA 4USAA 4UBBA 2UVWA 4QZDA 2YMMA 5D46A 3ETRA 1JI7A 3PSPA 3IV6A 5AKXA 1ZQEA 1ZQYA 3AU6A 4ED7A 4AYBF 5J0QA 2BPFA 4DL2A 3S6JA 2JEJA 1WWVA 4C4TA 2ZTCA 3WK7A 2AU0A 5HR6A 3ER9B 1WCNA 4KN4A 4BXOB 2XC9A 2QARB 3L4PA 4QWAA 9ICFA 1RYUA 2A1JA 3UQ2A 4FO6A 1Q78A 4Q8FA 5G5GA 5D4BA 4J03A 2C22A 2W43A 3LWMA 2ZH1A 3QU4A 1A77A 4PGQA 1ZQXA 2E8OA 3I1YA 2H3QA 4M6WB 4Y2JA 2M2TA 1V9PA
chains in the Genus database with same CATH topology
5EWEA 3GILA 2HHQA 4TQRA 4O3PA 1NK8A 4IQTA 4GC7A 4RUCA 3AU2A 5KFOA 4R66A 2R8KA 4EBCA 4NLZA 4ELTA 4YG2A 5DGBA 4R8UB 2V4QA 1T3NA 1ZQAA 4MF2A 1R8AA 1R8CA 4I2IA 4K4IA 2ZHAA 1QSYA 4J9PA 4E7XA 2J6TA 2I1QA 4Q44A 3MDCA 4JWMA 4F4ZA 1TK0A 4RQ5A 3JPQA 2FLNA 5KT3A 2PFNA 2FPMA 3NGDA 5F9NA 3JPRA 4NLGA 2F1IA 4X0AA 2ZH9A 1JN3A 4KLTA 3ZD9A 1RXWA 4K4GA 8ICUA 3L9DA 3B0XA 2Y1JA 3C1ZA 1JXLA 1R89A 5DKWA 4M47A 7ICQA 2JZBB 2NRWA 4O5KA 2XY6A 8ICIA 1DGSA 9ICJA 3WFSC 1BPDA 2AQ4A 4DQSA 4DFJA 4EEYA 2KZZA 5IIKA 4XQ8A 3H7IA 5HMLA 5HRLA 5KFUA 1XSLA 4QZBA 4KLDA 1ZQNA 1SZPA 1K1QA 3ISBA 5KG1A 4QWEA 5J2HA 1TV9A 1C7YA 1D8YA 4IRDA 4M9JA 4UBCA 4UQGA 3LWLA 4UB1A 4DQIA 7ICUA 5CJ7A 2KN7A 5J0OA 4QWCA 1ZQLA 4KLMA 3RAXA 4ECYA 5HRHA 2XGQA 3AQNA 5J2JA 4UD4A 5J2DA 1BPYA 1S0OA 1T4GA 1BPZA 3HJ1A 4O3NA 2ZH4A 2JEFA 4B9MA 3N97B 1SL0A 3G6YA 4NLNA 3NYBA 4BWMA 3RRHA 4YR2A 5KT7A 4PHEA 3TFSA 1KFSA 4PHPA 1X9SA 4WC2A 5KT6A 4RQ6A 4RT2A 4WC7A 2FLPA 2XO7A 1XS9D 4DL6A 4UB3A 9ICTA 4QW8A 2BCSA 3FYHA 3RB3A 5D49A 5BOMA 3Q8PB 3M9MB 4F5OA 2HHSA 1FA0A 2VA2A 3T5JA 3TQ1A 8ICEA 9ICGA 7ICLA 5HRIA 5DLFA 4X4QA 3KHHA 2R8GA 1DK2A 1MSWD 2WTFA 7ICJA 3GQCA 1WOTA 1TFWA 5KG2A 4ZH4A 4O3OA 4EBJA 3OJUA 3V7KA 3T5LA 4UB2A 3PX6A 4PGXA 3RB0A 1XC9A 1U4BA 3UXOA 2ATLA 4DOBA 3PMLA 2BCRA 8ICZA 3PW0A 1BNPA 5KG3A 2XCPA 4MEXA 2NRKA 4E8FA 4Z6EA 4TUQA 2DR9A 4DSKA 9ICVA 2O1PA 1MIWA 3PV8A 4NM2A 3TAPA 4RU9A 8ICLA 4QZHA 4O3QA 2XY7A 5KFDA 3H8WA 5L1IA 4F2SA 9ICXA 2AGQA 4EZ9A 2DR7A 4QZIA 1JIHA 3RTVA 3RR7A 5DBCA 4I2EA 4KITB 3PX0A 4Z6FA 5KFHA 4F4YA 3BQ1A 3OUYA 4S3NA 4O9MA 3PR5B 3MR6A 5KFKA 3LDAA 5KFNA 9ICNA 4I2BA 4ELVA 4RQ1A 3Q8QB 8ICSA 5J0SA 3HWTA 4G3IA 4FHWA 4GXIA 4M9LA 2R8IA 2PI4A 5DBAA 3THVA 1ZQIA 3NTUA 3Q8MA 1RYSA 5HRDA 4O3RA 1V4AA 2HVHA 1T7PA 1NZPA 4J9QA 2ZH5A 1UA0A 2GWSA 5KFSA 4XA5A 4P4OA 4I2GA 3QEBZ 2JEGA 4RPYA 3RH6A 1S77D 4F50A 4MFCA 5HRFA 5KFQA 5DB9A 4ECSA 4Q45A 4UD5A 5J0YA 2J6SA 3OVSA 4QW9A 1B43A 1RZTA 4JWNA 9ICUA 2ZHBA 4AT8B 2ZH3A 4RZRA 2H5XA 3SZ2A 3RJJA 4RNOA 3H4BA 4K4HA 4KLQA 1S97A 2W9BA 4XQ7A 2XGPA 4ECWA 4RQ7A 1T8EA 1U47A 1RYRA 2HHTA 4X4NA 1ZQUA 4AT9A 5J0RA 1L3UA 5HR9A 4C8KA 1ZQOA 2HW3A 3OSPA 9ICBA 8ICGA 4F5NA 5BOLA 3RRGA 4JUZA 4DQQA 2XY5A 4O3SA 5CR0A 2KFNA 9ICMA 2Y1IA 1ZJNA 1ZYQA 4KLUA 2M2UA 3OVAA 3H3AA 2BGWA 2DRAA 3ETLA 3FDSA 5HMMA 4YXJA 2W8LA 1KFTA 3GV5B 4DLGA 5DDYA 4BXOA 5L1LA 1HUOA 3OVBA 4EBKA 3K75D 4RT3A 1UEVA 3C21A 7ICFA 7ICEA 2DR8A 1EXNA 3M9OB 5DQHA 2HHWA 4WBZA 4BDPA 4KLIA 1Y88A 1COOA 4KLFA 4M9NA 4ECZA 3SI8A 2IHMA 2C2RA 1TFRA 2DRBA 2A1JB 3SV3A 3PX4A 5CWRA 4DSIA 4RQ8A 4QZ8A 1Z00A 3KHRA 1YLQA 4RQ0A 3ZDBA 2NRVA 3ISCA 4MEYA 3HT3A 8ICKA 1NJXA 4ED1A 4YN4A 4JV0A 4RPXA 1TK8A 1LB2B 2BR0A 1N56A 4TUSA 5HHIA 4DO9A 1L3SA 2ID1A 2BCUA 2KP7A 4X4RA 1CUKA 3GV8B 4YMNA 5KFIA 2MUTA 3KHLA 3H4DA 4JV2A 4JV1A 5KFMA 4QZEA 2HVIA 1SL2A 8ICXA 3C18A 1N48A 4NKUA 4DWIA 3PW2A 4QZ9A 5J0UA 4I2HA 1S0MA 3BQTA 3UXPA 1NKCA 4BWJA 4WC4A 2ASJA 5J2FA 3MR2A 5DBBA 4C8LA 4I28A 4EP7A 3PW4A 2LYHA 3QZ7A 1S76D 1BPXA 1NK5A 2HHUA 4TURA 1NKEA 4ATBA 1RXVA 5KFBA 5DB6A 4CCHA 1Q79A 5KFXA 8ICYA 1NKBA 2PXIA 3V7JA 1NJWA 3E2EA 7ICMA 3RB6A 3JYYA 4AT7A 4YCXA 1ZQBA 3AQKA 4C8NA 5IINA 3ZD8A 3PW7A 3C2KA 1HJPA 3WFQE 1KTQA 2KZMA 2DVIA 4EBDA 2J6UA 4DSFA 4WC0A 4ED3A 3M9NB 9ICSA 5HHHA 4QZAA 1SL1A 4DOCA 4DL4A 3GV7B 1QSLA 1VFGA 4QWBA 3AUOA 5KG6A 4DSEA 8ICBA 8ICOA 4I27A 3GIIA 4YMOA 1QLNA 5J2GA 4KLHA 4YR0A 9ICFA 4NM1A 9ICEA 4C8MA 2BPCA 4RQ2A 4UAZA 5KFRA 4FBUA 1MIVA 1A76A 5KFAA 4YP3A 3OUYB 1KRPA 2ZJAA 4KLLA 4O5CA 4P4PA 4ECTA 5KFVA 5CHGA 4KLEA 4FHPA 3GFKB 5DGAA 3RH4A 1BPEA 4O5EA 3H37A 4HYKA 7ICGA 4EYHB 2RFFA 1NK0A 2PFOA 1TAQA 2FLLA 4WBYA 4P4MA 4GXKA 2W8KA 1ZQJA 4IQWA 4DSJA 3MGHA 2AJQA 8ICFA 3HIYA 1SKRA 5TZVA 3G6VA 4B9VA 1JXEA 4Z6CA 5DB8A 4NY8A 1KNYA 3OHBA 4B9LA 4UB4A 4RWNA 3RJEA 4IR1A 5L1JA 2DPIA 1SKWA 2P6UA 2UVRA 4X0BA 4ED6A 3MDAA 3T5HA 4IRCA 4KLJA 1TVAA 3QZ8A 9ICHA 2NRZA 3SV4A 1U45A 2BQRA 4UB5A 1VJ7A 1TKDA 4NLKA 1MC8A 9ICCA 1SKSA 3ISDA 3UPSA 3JPTA 3HP6A 4FS2A 5F2VO 4ECXA 5J2IA 4YD2A 4WC6A 5DQGA 4DF4A 1X9WA 1LV5A 3PO5A 8ICQA 4QZFA 3EZ5A 4DFKA 4DL7A 3QEAZ 1F5AA 5CP2A 3V6KA 2AGOA 3PY8A 4IQVA 9ICPA 4MFAA 4ECQA 4FH3A 1ZQCA 3OHAA 4ECVA 1NK4A 3N4MB 2W9CA 5EOZA 4ED8A 1WCLA 5KFTA 1XO1A 3OJSA 3M8RA 2IA6A 5DLGA 1NJYA 8ICVA 8ICAA 4F5PA 3MBYA 4LT6A 2FPLA 1S0VA 4F4KA 3H39A 3M8SA 3ZDCA 3B0YA 4TQSA 1ZJMA 2FMPA 3BQ2A 2JEIA 1CEZA 3MR3A 3RJHA 4F3OA 3PVXA 4X4PA 2ZH2A 1X9MA 5IIJA 1UEUA 2BHNA 1JQRA 3TAQA 1NK6A 1L5UA 7ICIA 5KFGA 4J9KA 3ZDDA 4KLGA 9ICQA 3OV7A 3Q8RB 2BDPA 3SYZA 3ZDEA 2W9BB 5BPCA 2P66A 1XU4A 5L9XA 1XWLA 5KG4A 5C5JA 1ZQKA 4B9TA 4AT9B 5DQIA 4E0DA 5HRKA 3Q8LA 4JK1A 4F91B 2ISOA 3WFOA 4UAYA 2Q0ZX 3C23A 3LQCB 4B9SA 5J2EA 1BNOA 5KFFA 8ICJA 4J9MA 9ICIA 5J0XA 4DLEA 5KFPA 1ZQVA 2PI5A 4F92B 3JPNA 3TANA 2M9NA 3HW8A 2R8JA 9ICLA 7ICRA 2PBEA 5KG0A 5KFWA 5J2BA 1TK5A 4F8RA 1XSPA 3BJYA 8ICRA 5KT2A 3V6HA 9ICKA 3RJIA 4M6WA 2BCQA 3ZDAA 4DF8A 4PPXA 1B22A 3V7LA 4FS1A 5KTQA 2BE3A 3UXNA 5KFLA 2B21A 3H8JA 4FHYA 2AQ0A 3KHGA 3HPOA 4J9RA 2C2EA 2AGPA 4RUAA 2ISPA 4KMUA 2BQ3A 2FPKA 2UVUA 1JAJA 3AQMA 1ZQGA 4YFKA 5HP4A 1ZQTA 4NKTA 2ZUCA 4J9SA 4WC3A 4R8UA 5DECA 2DR5A 5J0TA 4PHAA 8ICMA 4E80A 3WFRE 4QZGA 1DOQA 3TFRA 1BVSA 2C2DA 1UA1A 5IIIA 4YQWA 3T5KA 2UVVA 2DPJA 4B9UA 1MIYA 4X4TA 8ICHA 4R65A 1Z00B 1ZQPA 4M5DA 3Q8SB 1MQ3A 1MQ2A 3G6XA 4DL3A 4C8OA 4LZGA 3H40A 4IQUA 1RPLA 3PW5A 5CB1A 3C5FA 1IXRA 5IIOA 3C2LA 3RBDA 4EZ6A 8ICCA 4DOAA 3EYZA 2F1HA 5J2KA 2IHNA 2JZBA 4LZDA 1KLNA 4KLSA 4RWPA 3JZ0A 1H38A 2VA3A 3PO4A 2PFQA 7ICHA 2KFZA 2MAXA 3IM1A 5L1KA 4QZCA 4RWQA 2MUTB 3PNCA 8ICNA 5HNKA 4Q43A 1L3VA 3RJKA 4X4SA 1D8LA 7ICNA 2BKEA 4DS5A 5HREA 1ZQFA 3TI0A 2VA8A 4I2CA 3MFHA 3KTQA 3C66A 4PGYA 3GIMA 4RNMA 4DQPA 5EWFA 5J29A 5EWGA 7ICVA 3HX0A 4UAWA 7ICOA 3T3FA 5HC9A 4FH5A 1TAUA 2O5AA 1U9LA 4DQRA 7ICTA 4F4WA 1PZNA 1BGXT 4GC6A 1AROP 3RBEA 4DSLA 1PX5A 4ATBB 3JPPA 4M9HA 4DS4A 3RJFA 5KG5A 4O0IA 4R64A 1ZQMA 1QSSA 1D9FA 2PFPA 2ZUDA 5KFJA 5KFZA 4TUPA 1KSPA 2HHVA 5F9LA 3BQ0A 4J9LA 4B9NA 4AT7B 4I2DA 4XRHA 4F4XA 4NXZA 5J2AA 1NOMA 2ZTDA 3RAQA 1ZETA 1ZQSA 9ICWA 9ICOA 1JMSA 2HHPA 4XUSA 3JPOA 3LK9A 4X4OA 2ZH6A 3MGIA 3C1YA 2VANA 3PR4A 1HUZA 5HRBA 4MFFA 2RDJA 4M0AA 4P2HA 4Q8EA 5HRGA 4X5VA 1NJZA 5IILA 4RWOA 7ICKA 2R8HA 1JX4A 1Z3EB 5KFCA 2C28A 2ALZA 4I2AA 1OU5A 4IR9A 4YD1A 2IBKA 4J9OA 1NK9A 4WC1A 9ICRA 5CA7A 4ED2A 4I29A 5KG7A 2M2VA 4RNNA 2FMQA 2Q66A 4IG8A 2ZJ5A 3K4GA 5J0WA 1IM4A 2ASDA 4YMMA 4F5QA 1ZQHA 4YXMA 4YVZA 2P6RA 5J0PA 2BPGA 4R63A 2ZJ8A 3EPIA 5DG7A 2W9AA 2NRXA 3C5GA 1KFDA 4IRKA 1TFYA 1UT8A 4BGDA 3H38A 5DG9A 4RPZA 4RQ4A 3C2MA 3RH5A 3GIKA 2BQUA 2BCVA 3EW9A 4DEZA 4F5RA 1KDHA 2RDIA 4I2JA 3V72A 1S10A 1ZQQA 1UETA 4MF8A 5DEDA 3GIJA 2F1JA 1UT5A 2FMSA 3OGUA 3Q8KA 4FHXA 4YR3A 5DG8A 5JUMA 1DK3A 4WC5A 4ECRA 3ORYA 3BDPA 4M9GA 1S9FA 2OWOA 3EPGA 4AT8A 4WCWA 4QWDA 3MFIA 5KFYA 4ECUA 1U48A 1K1SA 5DDMA 4LVSA 3RB4A 4M2YA 2IMWP 3GDXA 8ICPA 3AQLA 4UBBA 5KFEA 2UVWA 4F2RA 3OSNA 4DFMA 4KTQA 4I2FA 4QZDA 4RQ3A 5D46A 8ICTA 3EWAA 5KT4A 3V6JA 5DB7A 4DL5A 4FHVA 2KTQA 2NRTA 3TARA 1ZQRA 2DFLA 4GLXA 4X4UA 2W9CB 4FBTA 3MR5A 5KT5A 1ZQEA 4Z6DA 7ICPA 1ZQYA 3IHQB 3AU6A 4PH5A 5J2CA 3H8SA 4ED7A 2BPFA 5J0QA 1S0NA 4DL2A 4GXJA 2JEJA 2ZH8A 3HJ4A 7ICSA 2HHXA 2ZTCA 1L3TA 1BPBA 5IIMA 1NO5A 1R8BA 2V4RA 2ASLA 3UQ0A 2AU0A 2W9MA 2M2WA 1WCNA 1ZQWA 1XSNA 2ZUBA 3PMNA 1NK7A 2V9WA 4KN4A 4BXOB 2XC9A 4ELUA 2KZ3A 1KEJA 4DFPA 1ZQZA 3MABA 4QWAA 2I9GA 3RJGA 1ZQDA 2A1JA 4PHDA 3UQ2A 1X2IA 3UPQA 4F93B 4FO6A 3QE9Y 1U49A 1D9DA 4KLOA 5D4BA 4Q8FA 2C22A 8ICWA 3JPSA 1Q78A 3WFPA 2ZH7A 4EYIB 2ZTEA 4ED0A 2XCAA 4X4VA 4M04A 3RR8A 3LWMA 1QTMA 4KN7A 2ZH1A 1A77A 4PGQA 4J9NA 1ZQXA 4EBEA 4M6WB 9ICAA 2M2TA 1V9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EWE A;  3GIL A;  2HHQ A;  4TQR A;  4O3P A;  1NK8 A;  4IQT A;  4GC7 A;  4RUC A;  3AU2 A;  5KFO A;  4R66 A;  2R8K A;  4EBC A;  4NLZ A;  4ELT A;  4YG2 A;  5DGB A;  4R8U B;  2V4Q A;  1T3N A;  1ZQA A;  4MF2 A;  1R8A A;  1R8C A;  4I2I A;  4K4I A;  2ZHA A;  1QSY A;  4J9P A;  4E7X A;  2J6T A;  2I1Q A;  4Q44 A;  3MDC A;  4JWM A;  4F4Z A;  1TK0 A;  4RQ5 A;  3JPQ A;  2FLN A;  5KT3 A;  2PFN A;  2FPM A;  3NGD A;  5F9N A;  3JPR A;  4NLG A;  2F1I A;  4X0A A;  2ZH9 A;  1JN3 A;  4KLT A;  3ZD9 A;  1RXW A;  4K4G A;  8ICU A;  3L9D A;  3B0X A;  2Y1J A;  3C1Z A;  1JXL A;  1R89 A;  5DKW A;  4M47 A;  7ICQ A;  2JZB B;  2NRW A;  4O5K A;  2XY6 A;  8ICI A;  1DGS A;  9ICJ A;  3WFS C;  1BPD A;  2AQ4 A;  4DQS A;  4DFJ A;  4EEY A;  2KZZ A;  5IIK A;  4XQ8 A;  3H7I A;  5HML A;  5HRL A;  5KFU A;  1XSL A;  4QZB A;  4KLD A;  1ZQN A;  1SZP A;  1K1Q A;  3ISB A;  5KG1 A;  4QWE A;  5J2H A;  1TV9 A;  1C7Y A;  1D8Y A;  4IRD A;  4M9J A;  4UBC A;  4UQG A;  3LWL A;  4UB1 A;  4DQI A;  7ICU A;  5CJ7 A;  2KN7 A;  5J0O A;  4QWC A;  1ZQL A;  4KLM A;  3RAX A;  4ECY A;  5HRH A;  2XGQ A;  3AQN A;  5J2J A;  4UD4 A;  5J2D A;  1BPY A;  1S0O A;  1T4G A;  1BPZ A;  3HJ1 A;  4O3N A;  2ZH4 A;  2JEF A;  4B9M A;  3N97 B;  1SL0 A;  3G6Y A;  4NLN A;  3NYB A;  4BWM A;  3RRH A;  4YR2 A;  5KT7 A;  4PHE A;  3TFS A;  1KFS A;  4PHP A;  1X9S A;  4WC2 A;  5KT6 A;  4RQ6 A;  4RT2 A;  4WC7 A;  2FLP A;  2XO7 A;  1XS9 D;  4DL6 A;  4UB3 A;  9ICT A;  4QW8 A;  2BCS A;  3FYH A;  3RB3 A;  5D49 A;  5BOM A;  3Q8P B;  3M9M B;  4F5O A;  2HHS A;  1FA0 A;  2VA2 A;  3T5J A;  3TQ1 A;  8ICE A;  9ICG A;  7ICL A;  5HRI A;  5DLF A;  4X4Q A;  3KHH A;  2R8G A;  1DK2 A;  1MSW D;  2WTF A;  7ICJ A;  3GQC A;  1WOT A;  1TFW A;  5KG2 A;  4ZH4 A;  4O3O A;  4EBJ A;  3OJU A;  3V7K A;  3T5L A;  4UB2 A;  3PX6 A;  4PGX A;  3RB0 A;  1XC9 A;  1U4B A;  3UXO A;  2ATL A;  4DOB A;  3PML A;  2BCR A;  8ICZ A;  3PW0 A;  1BNP A;  5KG3 A;  2XCP A;  4MEX A;  2NRK A;  4E8F A;  4Z6E A;  4TUQ A;  2DR9 A;  4DSK A;  9ICV A;  2O1P A;  1MIW A;  3PV8 A;  4NM2 A;  3TAP A;  4RU9 A;  8ICL A;  4QZH A;  4O3Q A;  2XY7 A;  5KFD A;  3H8W A;  5L1I A;  4F2S A;  9ICX A;  2AGQ A;  4EZ9 A;  2DR7 A;  4QZI A;  1JIH A;  3RTV A;  3RR7 A;  5DBC A;  4I2E A;  4KIT B;  3PX0 A;  4Z6F A;  5KFH A;  4F4Y A;  3BQ1 A;  3OUY A;  4S3N A;  4O9M A;  3PR5 B;  3MR6 A;  5KFK A;  3LDA A;  5KFN A;  9ICN A;  4I2B A;  4ELV A;  4RQ1 A;  3Q8Q B;  8ICS A;  5J0S A;  3HWT A;  4G3I A;  4FHW A;  4GXI A;  4M9L A;  2R8I A;  2PI4 A;  5DBA A;  3THV A;  1ZQI A;  3NTU A;  3Q8M A;  1RYS A;  5HRD A;  4O3R A;  1V4A A;  2HVH A;  1T7P A;  1NZP A;  4J9Q A;  2ZH5 A;  1UA0 A;  2GWS A;  5KFS A;  4XA5 A;  4P4O A;  4I2G A;  3QEB Z;  2JEG A;  4RPY A;  3RH6 A;  1S77 D;  4F50 A;  4MFC A;  5HRF A;  5KFQ A;  5DB9 A;  4ECS A;  4Q45 A;  4UD5 A;  5J0Y A;  2J6S A;  3OVS A;  4QW9 A;  1B43 A;  1RZT A;  4JWN A;  9ICU A;  2ZHB A;  4AT8 B;  2ZH3 A;  4RZR A;  2H5X A;  3SZ2 A;  3RJJ A;  4RNO A;  3H4B A;  4K4H A;  4KLQ A;  1S97 A;  2W9B A;  4XQ7 A;  2XGP A;  4ECW A;  4RQ7 A;  1T8E A;  1U47 A;  1RYR A;  2HHT A;  4X4N A;  1ZQU A;  4AT9 A;  5J0R A;  1L3U A;  5HR9 A;  4C8K A;  1ZQO A;  2HW3 A;  3OSP A;  9ICB A;  8ICG A;  4F5N A;  5BOL A;  3RRG A;  4JUZ A;  4DQQ A;  2XY5 A;  4O3S A;  5CR0 A;  2KFN A;  9ICM A;  2Y1I A;  1ZJN A;  1ZYQ A;  4KLU A;  2M2U A;  3OVA A;  3H3A A;  2BGW A;  2DRA A;  3ETL A;  3FDS A;  5HMM A;  4YXJ A;  2W8L A;  1KFT A;  3GV5 B;  4DLG A;  5DDY A;  4BXO A;  5L1L A;  1HUO A;  3OVB A;  4EBK A;  3K75 D;  4RT3 A;  1UEV A;  3C21 A;  7ICF A;  7ICE A;  2DR8 A;  1EXN A;  3M9O B;  5DQH A;  2HHW A;  4WBZ A;  4BDP A;  4KLI A;  1Y88 A;  1COO A;  4KLF A;  4M9N A;  4ECZ A;  3SI8 A;  2IHM A;  2C2R A;  1TFR A;  2DRB A;  2A1J B;  3SV3 A;  3PX4 A;  5CWR A;  4DSI A;  4RQ8 A;  4QZ8 A;  1Z00 A;  3KHR A;  1YLQ A;  4RQ0 A;  3ZDB A;  2NRV A;  3ISC A;  4MEY A;  3HT3 A;  8ICK A;  1NJX A;  4ED1 A;  4YN4 A;  4JV0 A;  4RPX A;  1TK8 A;  1LB2 B;  2BR0 A;  1N56 A;  4TUS A;  5HHI A;  4DO9 A;  1L3S A;  2ID1 A;  2BCU A;  2KP7 A;  4X4R A;  1CUK A;  3GV8 B;  4YMN A;  5KFI A;  2MUT A;  3KHL A;  3H4D A;  4JV2 A;  4JV1 A;  5KFM A;  4QZE A;  2HVI A;  1SL2 A;  8ICX A;  3C18 A;  1N48 A;  4NKU A;  4DWI A;  3PW2 A;  4QZ9 A;  5J0U A;  4I2H A;  1S0M A;  3BQT A;  3UXP A;  1NKC A;  4BWJ A;  4WC4 A;  2ASJ A;  5J2F A;  3MR2 A;  5DBB A;  4C8L A;  4I28 A;  4EP7 A;  3PW4 A;  2LYH A;  3QZ7 A;  1S76 D;  1BPX A;  1NK5 A;  2HHU A;  4TUR A;  1NKE A;  4ATB A;  1RXV A;  5KFB A;  5DB6 A;  4CCH A;  1Q79 A;  5KFX A;  8ICY A;  1NKB A;  2PXI A;  3V7J A;  1NJW A;  3E2E A;  7ICM A;  3RB6 A;  3JYY A;  4AT7 A;  4YCX A;  1ZQB A;  3AQK A;  4C8N A;  5IIN A;  3ZD8 A;  3PW7 A;  3C2K A;  1HJP A;  3WFQ E;  1KTQ A;  2KZM A;  2DVI A;  4EBD A;  2J6U A;  4DSF A;  4WC0 A;  4ED3 A;  3M9N B;  9ICS A;  5HHH A;  4QZA A;  1SL1 A;  4DOC A;  4DL4 A;  3GV7 B;  1QSL A;  1VFG A;  4QWB A;  3AUO A;  5KG6 A;  4DSE A;  8ICB A;  8ICO A;  4I27 A;  3GII A;  4YMO A;  1QLN A;  5J2G A;  4KLH A;  4YR0 A;  9ICF A;  4NM1 A;  9ICE A;  4C8M A;  2BPC A;  4RQ2 A;  4UAZ A;  5KFR A;  4FBU A;  1MIV A;  1A76 A;  5KFA A;  4YP3 A;  3OUY B;  1KRP A;  2ZJA A;  4KLL A;  4O5C A;  4P4P A;  4ECT A;  5KFV A;  5CHG A;  4KLE A;  4FHP A;  3GFK B;  5DGA A;  3RH4 A;  1BPE A;  4O5E A;  3H37 A;  4HYK A;  7ICG A;  4EYH B;  2RFF A;  1NK0 A;  2PFO A;  1TAQ A;  2FLL A;  4WBY A;  4P4M A;  4GXK A;  2W8K A;  1ZQJ A;  4IQW A;  4DSJ A;  3MGH A;  2AJQ A;  8ICF A;  3HIY A;  1SKR A;  5TZV A;  3G6V A;  4B9V A;  1JXE A;  4Z6C A;  5DB8 A;  4NY8 A;  1KNY A;  3OHB A;  4B9L A;  4UB4 A;  4RWN A;  3RJE A;  4IR1 A;  5L1J A;  2DPI A;  1SKW A;  2P6U A;  2UVR A;  4X0B A;  4ED6 A;  3MDA A;  3T5H A;  4IRC A;  4KLJ A;  1TVA A;  3QZ8 A;  9ICH A;  2NRZ A;  3SV4 A;  1U45 A;  2BQR A;  4UB5 A;  1VJ7 A;  1TKD A;  4NLK A;  1MC8 A;  9ICC A;  1SKS A;  3ISD A;  3UPS A;  3JPT A;  3HP6 A;  4FS2 A;  5F2V O;  4ECX A;  5J2I A;  4YD2 A;  4WC6 A;  5DQG A;  4DF4 A;  1X9W A;  1LV5 A;  3PO5 A;  8ICQ A;  4QZF A;  3EZ5 A;  4DFK A;  4DL7 A;  3QEA Z;  1F5A A;  5CP2 A;  3V6K A;  2AGO A;  3PY8 A;  4IQV A;  9ICP A;  4MFA A;  4ECQ A;  4FH3 A;  1ZQC A;  3OHA A;  4ECV A;  1NK4 A;  3N4M B;  2W9C A;  5EOZ A;  4ED8 A;  1WCL A;  5KFT A;  1XO1 A;  3OJS A;  3M8R A;  2IA6 A;  5DLG A;  1NJY A;  8ICV A;  8ICA A;  4F5P A;  3MBY A;  4LT6 A;  2FPL A;  1S0V A;  4F4K A;  3H39 A;  3M8S A;  3ZDC A;  3B0Y A;  4TQS A;  1ZJM A;  2FMP A;  3BQ2 A;  2JEI A;  1CEZ A;  3MR3 A;  3RJH A;  4F3O A;  3PVX A;  4X4P A;  2ZH2 A;  1X9M A;  5IIJ A;  1UEU A;  2BHN A;  1JQR A;  3TAQ A;  1NK6 A;  1L5U A;  7ICI A;  5KFG A;  4J9K A;  3ZDD A;  4KLG A;  9ICQ A;  3OV7 A;  3Q8R B;  2BDP A;  3SYZ A;  3ZDE A;  2W9B B;  5BPC A;  2P66 A;  1XU4 A;  5L9X A;  1XWL A;  5KG4 A;  5C5J A;  1ZQK A;  4B9T A;  4AT9 B;  5DQI A;  4E0D A;  5HRK A;  3Q8L A;  4JK1 A;  4F91 B;  2ISO A;  3WFO A;  4UAY A;  2Q0Z X;  3C23 A;  3LQC B;  4B9S A;  5J2E A;  1BNO A;  5KFF A;  8ICJ A;  4J9M A;  9ICI A;  5J0X A;  4DLE A;  5KFP A;  1ZQV A;  2PI5 A;  4F92 B;  3JPN A;  3TAN A;  2M9N A;  3HW8 A;  2R8J A;  9ICL A;  7ICR A;  2PBE A;  5KG0 A;  5KFW A;  5J2B A;  1TK5 A;  4F8R A;  1XSP A;  3BJY A;  8ICR A;  5KT2 A;  3V6H A;  9ICK A;  3RJI A;  4M6W A;  2BCQ A;  3ZDA A;  4DF8 A;  4PPX A;  1B22 A;  3V7L A;  4FS1 A;  5KTQ A;  2BE3 A;  3UXN A;  5KFL A;  2B21 A;  3H8J A;  4FHY A;  2AQ0 A;  3KHG A;  3HPO A;  4J9R A;  2C2E A;  2AGP A;  4RUA A;  2ISP A;  4KMU A;  2BQ3 A;  2FPK A;  2UVU A;  1JAJ A;  3AQM A;  1ZQG A;  4YFK A;  5HP4 A;  1ZQT A;  4NKT A;  2ZUC A;  4J9S A;  4WC3 A;  4R8U A;  5DEC A;  2DR5 A;  5J0T A;  4PHA A;  8ICM A;  4E80 A;  3WFR E;  4QZG A;  1DOQ A;  3TFR A;  1BVS A;  2C2D A;  1UA1 A;  5III A;  4YQW A;  3T5K A;  2UVV A;  2DPJ A;  4B9U A;  1MIY A;  4X4T A;  8ICH A;  4R65 A;  1Z00 B;  1ZQP A;  4M5D A;  3Q8S B;  1MQ3 A;  1MQ2 A;  3G6X A;  4DL3 A;  4C8O A;  4LZG A;  3H40 A;  4IQU A;  1RPL A;  3PW5 A;  5CB1 A;  3C5F A;  1IXR A;  5IIO A;  3C2L A;  3RBD A;  4EZ6 A;  8ICC A;  4DOA A;  3EYZ A;  2F1H A;  5J2K A;  2IHN A;  2JZB A;  4LZD A;  1KLN A;  4KLS A;  4RWP A;  3JZ0 A;  1H38 A;  2VA3 A;  3PO4 A;  2PFQ A;  7ICH A;  2KFZ A;  2MAX A;  3IM1 A;  5L1K A;  4QZC A;  4RWQ A;  2MUT B;  3PNC A;  8ICN A;  5HNK A;  4Q43 A;  1L3V A;  3RJK A;  4X4S A;  1D8L A;  7ICN A;  2BKE A;  4DS5 A;  5HRE A;  1ZQF A;  3TI0 A;  2VA8 A;  4I2C A;  3MFH A;  3KTQ A;  3C66 A;  4PGY A;  3GIM A;  4RNM A;  4DQP A;  5EWF A;  5J29 A;  5EWG A;  7ICV A;  3HX0 A;  4UAW A;  7ICO A;  3T3F A;  5HC9 A;  4FH5 A;  1TAU A;  2O5A A;  1U9L A;  4DQR A;  7ICT A;  4F4W A;  1PZN A;  1BGX T;  4GC6 A;  1ARO P;  3RBE A;  4DSL A;  1PX5 A;  4ATB B;  3JPP A;  4M9H A;  4DS4 A;  3RJF A;  5KG5 A;  4O0I A;  4R64 A;  1ZQM A;  1QSS A;  1D9F A;  2PFP A;  2ZUD A;  5KFJ A;  5KFZ A;  4TUP A;  1KSP A;  2HHV A;  5F9L A;  3BQ0 A;  4J9L A;  4B9N A;  4AT7 B;  4I2D A;  4XRH A;  4F4X A;  4NXZ A;  5J2A A;  1NOM A;  2ZTD A;  3RAQ A;  1ZET A;  1ZQS A;  9ICW A;  9ICO A;  1JMS A;  2HHP A;  4XUS A;  3JPO A;  3LK9 A;  4X4O A;  2ZH6 A;  3MGI A;  3C1Y A;  2VAN A;  3PR4 A;  1HUZ A;  5HRB A;  4MFF A;  2RDJ A;  4M0A A;  4P2H A;  4Q8E A;  5HRG A;  4X5V A;  1NJZ A;  5IIL A;  4RWO A;  7ICK A;  2R8H A;  1JX4 A;  1Z3E B;  5KFC A;  2C28 A;  2ALZ A;  4I2A A;  1OU5 A;  4IR9 A;  4YD1 A;  2IBK A;  4J9O A;  1NK9 A;  4WC1 A;  9ICR A;  5CA7 A;  4ED2 A;  4I29 A;  5KG7 A;  2M2V A;  4RNN A;  2FMQ A;  2Q66 A;  4IG8 A;  2ZJ5 A;  3K4G A;  5J0W A;  1IM4 A;  2ASD A;  4YMM A;  4F5Q A;  1ZQH A;  4YXM A;  4YVZ A;  2P6R A;  5J0P A;  2BPG A;  4R63 A;  2ZJ8 A;  3EPI A;  5DG7 A;  2W9A A;  2NRX A;  3C5G A;  1KFD A;  4IRK A;  1TFY A;  1UT8 A;  4BGD A;  3H38 A;  5DG9 A;  4RPZ A;  4RQ4 A;  3C2M A;  3RH5 A;  3GIK A;  2BQU A;  2BCV A;  3EW9 A;  4DEZ A;  4F5R A;  1KDH A;  2RDI A;  4I2J A;  3V72 A;  1S10 A;  1ZQQ A;  1UET A;  4MF8 A;  5DED A;  3GIJ A;  2F1J A;  1UT5 A;  2FMS A;  3OGU A;  3Q8K A;  4FHX A;  4YR3 A;  5DG8 A;  5JUM A;  1DK3 A;  4WC5 A;  4ECR A;  3ORY A;  3BDP A;  4M9G A;  1S9F A;  2OWO A;  3EPG A;  4AT8 A;  4WCW A;  4QWD A;  3MFI A;  5KFY A;  4ECU A;  1U48 A;  1K1S A;  5DDM A;  4LVS A;  3RB4 A;  4M2Y A;  2IMW P;  3GDX A;  8ICP A;  3AQL A;  4UBB A;  5KFE A;  2UVW A;  4F2R A;  3OSN A;  4DFM A;  4KTQ A;  4I2F A;  4QZD A;  4RQ3 A;  5D46 A;  8ICT A;  3EWA A;  5KT4 A;  3V6J A;  5DB7 A;  4DL5 A;  4FHV A;  2KTQ A;  2NRT A;  3TAR A;  1ZQR A;  2DFL A;  4GLX A;  4X4U A;  2W9C B;  4FBT A;  3MR5 A;  5KT5 A;  1ZQE A;  4Z6D A;  7ICP A;  1ZQY A;  3IHQ B;  3AU6 A;  4PH5 A;  5J2C A;  3H8S A;  4ED7 A;  2BPF A;  5J0Q A;  1S0N A;  4DL2 A;  4GXJ A;  2JEJ A;  2ZH8 A;  3HJ4 A;  7ICS A;  2HHX A;  2ZTC A;  1L3T A;  1BPB A;  5IIM A;  1NO5 A;  1R8B A;  2V4R A;  2ASL A;  3UQ0 A;  2AU0 A;  2W9M A;  2M2W A;  1WCN A;  1ZQW A;  1XSN A;  2ZUB A;  3PMN A;  1NK7 A;  2V9W A;  4KN4 A;  4BXO B;  2XC9 A;  4ELU A;  2KZ3 A;  1KEJ A;  4DFP A;  1ZQZ A;  3MAB A;  4QWA A;  2I9G A;  3RJG A;  1ZQD A;  2A1J A;  4PHD A;  3UQ2 A;  1X2I A;  3UPQ A;  4F93 B;  4FO6 A;  3QE9 Y;  1U49 A;  1D9D A;  4KLO A;  5D4B A;  4Q8F A;  2C22 A;  8ICW A;  3JPS A;  1Q78 A;  3WFP A;  2ZH7 A;  4EYI B;  2ZTE A;  4ED0 A;  2XCA A;  4X4V A;  4M04 A;  3RR8 A;  3LWM A;  1QTM A;  4KN7 A;  2ZH1 A;  1A77 A;  4PGQ A;  4J9N A;  1ZQX A;  4EBE A;  4M6W B;  9ICA A;  2M2T A;  1V9P A; 
#chains in the Genus database with same CATH topology
 3GIL A;  3AQF A;  3FM9 A;  2QB0 A;  5E79 U;  1NK8 A;  2QLT A;  4MF2 A;  1T3N A;  4K4I A;  2ZHA A;  1QSY A;  4J9P A;  2J6T A;  5ALO A;  4RQ5 A;  3JPQ A;  4KLT A;  3ZD9 A;  1RXW A;  4OO1 J;  2Y1J A;  1JXL A;  2JZB B;  3KZI U;  1DGS A;  2EZX A;  2KV2 A;  1BPD A;  4UB6 U;  5ALE A;  4EEY A;  5KFU A;  3U26 A;  2RP5 A;  3PZP A;  4KLD A;  4K9A A;  1K1Q A;  4O6A A;  4UB1 A;  4KLM A;  4ECY A;  5AK5 A;  5HRH A;  3AQN A;  5J2J A;  5J2D A;  5ALV A;  1S0O A;  3VCB A;  2JEF A;  3FAH A;  5K4L A;  4YR2 A;  1L7N A;  5KT7 A;  2WAQ F;  1KFS A;  4PHP A;  4WC2 A;  4RQ6 A;  4RT2 A;  2FLP A;  1XS9 D;  4DL6 A;  4QW8 A;  5BOM A;  2HHS A;  4NXW A;  1X40 A;  3T5J A;  3TQ1 A;  4X4Q A;  5DLF A;  1TFW A;  1WOT A;  4ZH4 A;  2JHD A;  4EBJ A;  3OJU A;  1RM6 C;  3T5L A;  3ER8 C;  4PGX A;  3NAS A;  3UXO A;  4DOB A;  4LEV A;  4Z6E A;  3PV8 A;  4NM2 A;  4RU9 A;  8ICL A;  4O3Q A;  5KFD A;  3H8W A;  5AM4 A;  4F2S A;  9ICX A;  1JIH A;  4UAS A;  4Z6F A;  5KFH A;  2HDO A;  3BQ1 A;  3OUY A;  2L5Y A;  4O9M A;  3PR5 B;  3MR6 A;  5KFK A;  9ICN A;  2ZIW A;  4RQ1 A;  3VC8 A;  5ALK A;  4M9L A;  1UHU A;  5ALN A;  1ZQI A;  3PSF A;  1T7P A;  5CFT A;  4Y2V A;  5AKI A;  4XA5 A;  5HRF A;  3M6K A;  3MC1 A;  9ICU A;  2KSO B;  1Q8K A;  1SV0 C;  1T8E A;  4X4N A;  4WJ3 B;  2LKY A;  5AM3 A;  4EEL A;  1XNS A;  1PK1 A;  4CRX A;  1F44 A;  1ZYQ A;  3OVA A;  2VIX A;  2DRA A;  5HMM A;  3KBB A;  2W8L A;  1Z1B A;  1KKX A;  5DDY A;  1L8L A;  1Q46 A;  3T79 A;  3LVV A;  7ICE A;  3UMC A;  3M9O B;  5DQH A;  1T3Q A;  1COO A;  3ED5 A;  1OUQ A;  5EE1 A;  4Y2T A;  3SI8 A;  2IHM A;  3SV3 A;  4KX3 A;  3N7S C;  3KHR A;  3BS7 A;  2DGZ A;  2NRV A;  3ISC A;  4MEY A;  4C4R A;  8ICK A;  5CEH A;  1N56 A;  2HBJ A;  5HHI A;  4X4R A;  4WQL A;  2HN1 A;  3GV8 B;  1NNL A;  3KHL A;  5KL8 B;  3PW2 A;  5AHX A;  4I2H A;  3R9K A;  2F8K A;  2ASJ A;  4EP7 A;  2YMQ A;  1QQ6 A;  1N60 A;  1DGJ A;  4IL6 U;  1NK5 A;  1SB3 C;  2HOI A;  4CCH A;  2W11 A;  1A6S A;  1NKB A;  1NJW A;  4AT7 A;  3RB6 A;  3PW7 A;  1HJP A;  4WQK A;  4WC0 A;  4QZA A;  1SV4 A;  4DL4 A;  4DSE A;  8ICO A;  2KKP A;  2K4E A;  3GII A;  4YMO A;  2W3R A;  2ES6 A;  4YR0 A;  2F76 X;  9ICE A;  4C8M A;  2BPC A;  1A76 A;  5KFA A;  3BZC A;  2ZJA A;  4KMO B;  2MU2 A;  4KLE A;  1ZD5 A;  3RH4 A;  2RFF A;  1Q3V A;  2FLL A;  4JLX A;  4P4M A;  1SKR A;  5TZV A;  2FCL A;  1KNY A;  2W7O A;  3RJE A;  2GLE A;  3MDA A;  3TAD A;  9ICH A;  2I6X A;  2WB1 C;  2VJ5 A;  2BQR A;  3QU2 A;  2HN2 A;  4HAI A;  3ISD A;  1MN8 A;  3UPS A;  4A8E A;  3HP6 A;  5AKG A;  3M6Z A;  4FFD A;  2OH2 A;  4WC6 A;  4NXV A;  4QZF A;  4IQV A;  4MFA A;  4ECQ A;  1LKY B;  3OHA A;  1NK4 A;  2DRB A;  5DLG A;  1NJY A;  4F5P A;  4NJ8 A;  3JCF A;  3M8S A;  3B0Y A;  2OYY A;  2JEI A;  4X4P A;  3MR3 A;  2ZH2 A;  1UEU A;  2NO5 A;  2BBJ A;  4OD0 A;  5AM0 A;  4FE3 A;  5BPC A;  1XU4 A;  4AT9 B;  4E0D A;  2QAR A;  3WFO A;  4JK1 A;  1QH9 A;  5KFF A;  1F0M A;  5ALG A;  4NXT A;  9ICI A;  4DLE A;  1ZQV A;  2R8J A;  5KFW A;  4F8R A;  1ZRM A;  9ICK A;  4NLC A;  2E3T A;  4M6W A;  3ZDA A;  4DF8 A;  3EF2 A;  3V7L A;  2ZG6 A;  5KTQ A;  4UAV A;  1PVR A;  5KFL A;  2B21 A;  2AQ0 A;  2C2E A;  4RUA A;  1SWV A;  2UVU A;  3AQM A;  2OXO A;  2KMD A;  4NKT A;  1ZQG A;  1ZQT A;  2ZUC A;  2AXT U;  5DEC A;  5J0T A;  5JTI A;  5B3P A;  4QZG A;  1DOQ A;  3TFR A;  3T5K A;  1MIY A;  5ALT A;  4M5D A;  4PJ0 U;  4LZG A;  1TE2 A;  2ZXI A;  3C5F A;  3C2L A;  3RBD A;  5IIO A;  4RWP A;  4KLS A;  2JZB A;  1KLN A;  1Z19 A;  2JR5 A;  4HX0 A;  7ICH A;  2MAX A;  2G08 A;  1V97 A;  7ICV A;  5KNI A;  5HC9 A;  4K9B A;  3NUQ A;  4F4W A;  4ATB B;  1B0X A;  1KSP A;  3BQ0 A;  4NXZ A;  3RAQ A;  9ICW A;  2ZTD A;  9ICO A;  5JU5 A;  2LM1 A;  2ZH6 A;  3MGI A;  2Y9U A;  2KIC A;  4M0A A;  4Q8E A;  2YY6 A;  7ICK A;  5KFC A;  5AIC A;  2IBK A;  2OCE A;  3HIL A;  5CA7 A;  2Q4T A;  2M2V A;  2FMQ A;  4CDG A;  2Q66 A;  3K4G A;  5J0W A;  1ZOL A;  4YMM A;  4YXM A;  4YVZ A;  5J0P A;  2ZJ8 A;  1SXD A;  2W9A A;  2XVT A;  1TFY A;  2E5S A;  2E8M A;  3H38 A;  5DG9 A;  3RH5 A;  4DEZ A;  1UET A;  1ZQQ A;  2RDI A;  1S10 A;  2K8C B;  5AI0 A;  1FFV A;  3SAF A;  3OGU A;  2ZIW B;  3E0F A;  3D2N A;  2P35 A;  1DK3 A;  1JUD A;  4WCW A;  4F72 A;  3K1Z A;  5KFY A;  5DDM A;  8ICP A;  3AQL A;  3NWI A;  4F2R A;  3OSN A;  4KTQ A;  1FIQ A;  3EWA A;  4EEK A;  3HKZ C;  4FHV A;  2NRT A;  2DFL A;  4GLX A;  4FBT A;  3MR5 A;  2KIW A;  4Z6D A;  3IHQ B;  1PK1 B;  2HHX A;  2ESE A;  3BQ7 A;  2V4R A;  1JRO A;  3CYM A;  2ZIX B;  1XSN A;  2ZUB A;  4RQM A;  2JV3 A;  2IHO A;  3RJG A;  4EX7 A;  3RJJ A;  1X2I A;  1U49 A;  2ZH7 A;  3QU5 A;  3KD3 A;  2KVC A;  2K60 A;  2WF7 A;  5EWE A;  2WB1 F;  4TQR A;  4O3P A;  3E58 A;  4IQT A;  3AU2 A;  4PL2 A;  4R66 A;  3I76 A;  4ELT A;  4YG2 A;  5DGB A;  4R8U B;  1ZQA A;  1R8C A;  2VJ4 A;  4I2I A;  2I1Q A;  4JWM A;  2FLN A;  5JTG A;  2H3F A;  4Y2S A;  4EGW A;  3NGD A;  3JPR A;  4UW9 A;  2EDU A;  2F1I A;  1ZRN A;  2H3V A;  5CFU A;  3C1Z A;  5DKW A;  2EZY A;  3HRD D;  4M47 A;  2NRW A;  5HR7 A;  2XY6 A;  2F3N A;  3KKA A;  2KZZ A;  3NVW A;  5HRL A;  1XSL A;  4QZB A;  2F77 X;  2HI0 A;  1D8Y A;  4K8V A;  5KG1 A;  4DQI A;  1IG6 A;  4QWC A;  4UD4 A;  3L3F X;  1BPY A;  3N97 B;  1SL0 A;  3G6Y A;  2K89 A;  4BWM A;  3TFS A;  1X9S A;  2LI6 A;  5AI4 A;  3NRZ A;  2IUB A;  2XO7 A;  4UB3 A;  5A0L A;  2KD1 A;  4F5O A;  2W04 A;  2VA2 A;  2R8G A;  1MSW D;  3GQC A;  3QUC A;  3WKB A;  1XC9 A;  4UB2 A;  3RB0 A;  1OXJ A;  2ATL A;  2BCR A;  2CPR A;  3PW0 A;  8ICZ A;  5KG3 A;  1BNP A;  3FC4 A;  2NRK A;  4E8F A;  9ICV A;  2O1P A;  4QZH A;  2VKQ A;  2XY7 A;  2K4I A;  4I2E A;  1LKY A;  3Q8Q B;  2MSN A;  2KEY A;  3NTU A;  1RYS A;  1V4A A;  4O3R A;  2FI1 A;  3NVV A;  1UA0 A;  4P4O A;  2JEG A;  4MFC A;  5KFQ A;  5J0Y A;  4QW9 A;  5AK6 A;  4JWN A;  5FP0 A;  2ZHB A;  4AT8 B;  2ZH3 A;  3AM9 A;  3H4B A;  2XGP A;  4ECW A;  1SIJ A;  3GU3 A;  4AT9 A;  4U7C A;  4CE6 A;  9ICB A;  4F5N A;  3OPX A;  4MHV A;  2IOF K;  3RRG A;  4JUZ A;  2XY5 A;  4O3S A;  4P0Q B;  5CR0 A;  9ICM A;  2HBL A;  1ZJN A;  5L1M A;  1KFT A;  5L1L A;  2OHF A;  4O68 A;  4RT3 A;  1UEV A;  3C21 A;  2HCF A;  4BDP A;  1Y88 A;  4KLF A;  5ALD A;  3BS5 B;  2C2R A;  5AK4 A;  4NL9 C;  4DSI A;  2B56 A;  4RQ0 A;  1S8O A;  2G5I B;  3K7D A;  3HT3 A;  4ED1 A;  3H0R B;  4TUS A;  3RFA A;  2HOQ A;  2KP7 A;  3C28 A;  5D61 A;  1CUK A;  2N1R A;  5ALP A;  5KFM A;  4QZE A;  1SL2 A;  3C18 A;  1NI3 A;  3BQT A;  3UXP A;  4WC4 A;  3PHZ A;  5EE0 A;  4N7R A;  1BPX A;  3HKZ F;  2HHU A;  5B3Q A;  4ATB A;  1RXV A;  1ZXI A;  5KFB A;  4FZN A;  5DB6 A;  5KFX A;  2KJ8 A;  3SQI A;  1ZD2 P;  4C8N A;  3ZD8 A;  4BX9 C;  2KZM A;  1UQV A;  2GA9 D;  4ED3 A;  1SL1 A;  4DOC A;  1QSL A;  1YZ7 A;  3F2B A;  8ICB A;  1QLN A;  4FBU A;  4YP3 A;  1T94 A;  3DEE A;  2GAF D;  4KLL A;  5KFV A;  4FHP A;  1BPE A;  4HYK A;  4PZN A;  2QB1 A;  4WBY A;  2LMR A;  2W8K A;  1ZQJ A;  4DSJ A;  3MGH A;  3HIY A;  3G6V A;  1JXE A;  4B9L A;  4UB4 A;  4RWN A;  2DPI A;  2UVR A;  4DFD A;  4ED6 A;  4P0P A;  1TVA A;  5ALF A;  5AKE A;  1MA7 A;  9ICC A;  1PK3 A;  3JPT A;  2DKZ A;  4ECX A;  1N62 A;  5J2I A;  2CXY A;  4DF4 A;  1X9W A;  5J8Y C;  4EED A;  2GO7 A;  3QEA Z;  2HMX A;  5CP2 A;  3V6K A;  2AGO A;  3PY8 A;  4OAG A;  1RDF A;  4ED8 A;  1WCL A;  3OJS A;  3M8R A;  4CF3 A;  2H3Z A;  2M0N A;  3H39 A;  2FMP A;  2JGA A;  3F2C A;  2BHN A;  2D6F C;  1JQR A;  7ICI A;  4KLG A;  4J9K A;  2W9B B;  2P66 A;  5L9X A;  2ZIX A;  4O67 A;  4B9T A;  3Q8L A;  3NVY A;  4US9 A;  4UAY A;  3UMG A;  3C23 A;  1L6N A;  4B9S A;  5J2E A;  1BNO A;  3LQC B;  8ICJ A;  3PSI A;  5KFP A;  1SV0 A;  5AM1 A;  4U6P A;  2M9N A;  2LM4 A;  1QQ5 A;  1XSP A;  3BJY A;  8ICR A;  5ALX A;  1YZ6 A;  2DUY A;  3RJI A;  2YTU A;  4NXU A;  1PUZ A;  1WG8 A;  3H8J A;  3IRU A;  2ISP A;  2AGP A;  1JAJ A;  4KMU A;  2FPK A;  4YFK A;  4WC3 A;  4R8U A;  4IC9 A;  8ICM A;  2B51 A;  3WFR E;  2C2D A;  5III A;  2I5H A;  4YQW A;  2DPJ A;  8ICH A;  4R65 A;  1B4F A;  1ZQP A;  3G6X A;  4DL3 A;  4IQU A;  2F44 A;  8ICC A;  3EYZ A;  2IHN A;  3JZ0 A;  2RRD A;  2G0A A;  3PO4 A;  4RWQ A;  3PNC A;  1L3V A;  4X4S A;  1D8L A;  2DQN B;  7ICN A;  2BKE A;  3CRX A;  3C66 A;  3MFH A;  3KTQ A;  4K96 A;  4PGY A;  5EWF A;  3HX0 A;  7ICO A;  4FH5 A;  5ALI A;  1PZN A;  4DSL A;  1PX5 A;  3RBE A;  4M9H A;  4DS4 A;  5KG5 A;  1ZQM A;  4TUP A;  2QKQ A;  5AM2 A;  4B9N A;  4F4X A;  2MA1 A;  4XUS A;  3JPO A;  3LK9 A;  2VAN A;  4FZM A;  5HRB A;  5HRG A;  2W55 A;  5IIL A;  5AKH A;  1JX4 A;  5ALQ A;  1GO3 F;  4I2A A;  3WK5 A;  4YD1 A;  2XID A;  4Y2Q A;  2KIV A;  9ICR A;  4ED2 A;  2FDR A;  5AI6 A;  2ZJ5 A;  4F5Q A;  1IIP A;  2P6R A;  3D6J A;  3EPI A;  2NRX A;  4IRK A;  1UT8 A;  2EH9 A;  1YT3 A;  3RR7 A;  3QU9 A;  1KDH A;  4F5R A;  3V72 A;  4I2J A;  4CF5 A;  2LYA A;  2PMZ C;  2F2A B;  4C7Z A;  4OJO A;  4FHX A;  5DG8 A;  4WC5 A;  2G07 A;  3ORY A;  4M9G A;  1S9F A;  2OWO A;  4AT8 A;  4ECU A;  3RB4 A;  3QXG A;  2IMW P;  2Y0S C;  3ERC C;  2G09 A;  2YB4 A;  3H8M A;  4NV0 A;  4RQ3 A;  3V6J A;  5DB7 A;  4DL5 A;  2KTQ A;  3TAR A;  4NXX A;  4X4U A;  2Z7J A;  2W9C B;  4P0Q A;  5KT5 A;  5J2C A;  3IG8 A;  3H8S A;  3D2S A;  1L7P A;  1S0N A;  4EEN A;  2ZH8 A;  3HJ4 A;  5ALM A;  2R18 A;  1R8B A;  1NO5 A;  4AP9 A;  3WK8 A;  3O0F A;  3BS5 A;  1NK7 A;  3C29 A;  2KZ3 A;  2I9G A;  4DFP A;  4OAH A;  3MAB A;  4M2Y A;  1ZQD A;  4PHD A;  2BE3 A;  3IG5 A;  1D9D A;  2G5H B;  4KLO A;  8ICW A;  2RQ5 A;  3AEV A;  1SXE A;  3WFP A;  2ZTE A;  2XCA A;  4M04 A;  1QTM A;  3AMZ A;  3SR6 A;  3F2D A;  5AI9 A;  2JMG A;  2HHQ A;  2RLT A;  1Z4N A;  4GC7 A;  2FJ6 A;  4RUC A;  5KFO A;  2R8K A;  4EBC A;  4NLZ A;  1R8A A;  5D62 A;  4Q44 A;  4F4Z A;  4CNQ A;  5KT3 A;  3SAG A;  2FPM A;  1FO4 A;  5F9N A;  4NLG A;  4X0A A;  1JN3 A;  2W3S A;  2DKX A;  4UAR A;  3L9D A;  4WH5 A;  5ALZ A;  4O5K A;  9ICJ A;  2AQ4 A;  4DQS A;  3H7I A;  1ZQN A;  1SZP A;  4M9J A;  1S77 D;  4QWE A;  1TV9 A;  3LWL A;  7ICU A;  2KN7 A;  1ZQL A;  2PKE A;  3RAX A;  2AHO B;  4CGZ A;  3N7P D;  1BPZ A;  1T4G A;  3HJ1 A;  2YML A;  4B9M A;  3K1R B;  1V85 A;  3RRH A;  4PHE A;  4AYB C;  5KT6 A;  2KJ5 A;  4OAF A;  3FYH A;  3RB3 A;  1HEK A;  1FA0 A;  1V38 A;  9ICG A;  3KHH A;  2NO4 A;  7ICJ A;  3SD7 A;  3KOO A;  4EZ6 A;  4KB6 A;  3SEI A;  1U4B A;  3PML A;  3WKC A;  5AI8 A;  2XCP A;  2DR9 A;  3UMB A;  3WKD A;  4C7Y A;  4DSK A;  1MIW A;  5JRT A;  2WF6 A;  4P0P B;  3MGV A;  2DR7 A;  4EZ9 A;  4QZI A;  5DBC A;  2KK0 A;  4S3N A;  1QCK A;  3LDA A;  5KFN A;  4I2B A;  8ICS A;  2H3I A;  2NYV A;  4G3I A;  4GXI A;  4FHW A;  2R8I A;  2PI4 A;  2HVH A;  1NZP A;  3L5K A;  2K8B B;  2ZH5 A;  3GZF A;  2B6G A;  3OWG A;  5KFS A;  4RPY A;  3RH6 A;  4F50 A;  4ECS A;  4Q45 A;  2J6S A;  4I0U A;  1RZT A;  2HSZ A;  3SZ2 A;  2WHE A;  4KLQ A;  4UAU A;  1S97 A;  2W9B A;  4Y2Y A;  2A3V A;  4XQ7 A;  1RYR A;  1U47 A;  3M7D A;  1ZQU A;  1L3U A;  1K5O A;  4FZL A;  2HW3 A;  4JMU A;  1JAL A;  5BOL A;  4DQQ A;  2LPE A;  3NRW A;  2Y1I A;  4KLU A;  2BGW A;  4LEY A;  1X66 A;  3FDS A;  3J81 j;  4DLG A;  1Z1V A;  5AKJ A;  3K75 D;  3MCR A;  1EXN A;  1LVH A;  4WBZ A;  4KLI A;  3DDH A;  3N7R C;  1YLQ A;  1NZB A;  2IOH A;  4YN4 A;  4JV0 A;  4RPX A;  2BR0 A;  1L3S A;  2ID1 A;  2BCU A;  4LJX A;  4YMN A;  5KFI A;  4JV2 A;  3H4D A;  4DCC A;  5H2F U;  4JV1 A;  4NKU A;  1N48 A;  5J0U A;  1S0M A;  5AM5 A;  1NKC A;  2Y0S F;  4I28 A;  4C8L A;  5DBB A;  3PW4 A;  2ZXH A;  1FEZ A;  2LYH A;  3QZ7 A;  2Y9T A;  1S76 D;  1NKE A;  3CNH A;  5ALS A;  3V7J A;  3E2E A;  3QX7 A;  4YCX A;  3AQK A;  3WFQ E;  1COK A;  4FO1 A;  3C2K A;  2J6U A;  3M9N B;  1SGG A;  5HHH A;  2E1F A;  3AUO A;  4BJQ A;  4I27 A;  5J2G A;  4NM1 A;  1MIV A;  1KRP A;  1OW5 A;  3A0B U;  3QYP A;  4P4P A;  4ECT A;  1L8O A;  4OAI Z;  5DGA A;  3H37 A;  4EYH B;  2EAP A;  4IQW A;  3H0M B;  8ICF A;  4QIW C;  4B9V A;  4XJE A;  5DB8 A;  4NY8 A;  5AKK A;  2KJ9 A;  5L1J A;  1SKW A;  2P6U A;  4X0B A;  4KLJ A;  2NRZ A;  3SV4 A;  1U45 A;  4UB5 A;  1VJ7 A;  2EAO A;  5CHE A;  1TKD A;  1MC8 A;  1SKS A;  2E8P A;  4FS2 A;  8ICQ A;  2DWQ A;  4C4S A;  4RQN A;  4DFK A;  4DL7 A;  1F5A A;  2DL0 A;  3N4M B;  1KW4 A;  2W9C A;  4K99 A;  2IA6 A;  4LT6 A;  2A1A A;  2BDU A;  8ICV A;  1S0V A;  1TAM A;  4TQS A;  1ZJM A;  1CEZ A;  3ONN A;  4F3O A;  2YMP A;  3PVX A;  5D63 A;  5IIJ A;  2KNJ A;  4KM5 A;  1J2M A;  2HBK A;  3TAQ A;  1NK6 A;  1L5U A;  9ICQ A;  1SZH A;  3PST A;  1XWL A;  5KG4 A;  1ZQK A;  5HRK A;  2ISO A;  5ALL A;  3N28 A;  3NKU A;  4J9M A;  2B0C A;  4QJF B;  4ZOH C;  5J2B A;  1TK5 A;  3NVZ A;  4GIB A;  3AQE A;  5KT2 A;  2BCQ A;  4PPX A;  1L7O A;  1B22 A;  3WKE A;  4FS1 A;  2AH5 A;  3KHG A;  3HPO A;  2BQ3 A;  2BBH A;  5HP4 A;  2DR5 A;  4PHA A;  4B9U A;  1BVS A;  1UA1 A;  4X4V A;  1RG6 A;  1X42 A;  1Z4O A;  1Z00 B;  3Q8S B;  1MQ2 A;  4C8O A;  3BZK A;  3H40 A;  1RPL A;  3PW5 A;  5CB1 A;  1IV8 A;  2E8N A;  9ICP A;  4DOA A;  1FFU A;  5J2K A;  4LZD A;  4NL9 A;  4LEZ A;  1H38 A;  1PVP A;  2PFQ A;  2KFZ A;  2MUT B;  3QU7 A;  5HNK A;  3RJK A;  3KFU F;  1N63 A;  4DS5 A;  5HRE A;  3TI0 A;  2VA8 A;  5EE9 A;  3GIM A;  4RNM A;  5EWG A;  4UAW A;  3T3F A;  3F5E A;  1DRG A;  2KVS A;  7ICT A;  1BGX T;  1L7M A;  4GC6 A;  2W54 A;  3RJF A;  1QSS A;  4F71 A;  2ZUD A;  5KFJ A;  7ICL A;  3AL0 B;  4XRH A;  2W03 A;  4E80 A;  1NOM A;  1ZQS A;  1JMS A;  2HHP A;  4X4O A;  3PR4 A;  1HUZ A;  4MKP A;  2RDJ A;  1VDV A;  3NVO A;  1Z3E B;  1OU5 A;  2JXJ A;  4J9O A;  4OCZ A;  2ZIU B;  4WC1 A;  4JB3 A;  4RNN A;  1ZQ1 C;  2K8A A;  1VLB A;  3NS1 A;  2BPG A;  4O3M A;  4R63 A;  1Q3U A;  5DG7 A;  3C5G A;  1KFD A;  4BGD A;  2BCV A;  3C2M A;  2BQU A;  3RR8 A;  1N5X A;  4MF8 A;  2LYB A;  3GIJ A;  4OJ6 A;  5DED A;  1UT5 A;  1VJ5 A;  4YR3 A;  3QUT A;  1UCV A;  5AKY A;  3EPG A;  4QWD A;  3WU2 U;  4LVS A;  3GDX A;  3F5A A;  5KFE A;  4DFM A;  4I2F A;  8ICT A;  5KT4 A;  1ZQR A;  5KAI U;  1C20 A;  3H0L B;  1RQL A;  7ICP A;  4PH5 A;  1J2N A;  5J8Y A;  4GXJ A;  2WFA A;  3LYS A;  1L3T A;  2HOF A;  5ALW A;  1BPB A;  5IIM A;  2ASL A;  3UQ0 A;  1F5S A;  2W9M A;  2M2W A;  1ZQW A;  5HR9 A;  2V9W A;  3PMN A;  4ELU A;  1KEJ A;  1ZQZ A;  2OM6 A;  3QE9 Y;  3UPQ A;  7ICS A;  4F93 B;  2EQY A;  3JPS A;  1X6J A;  3I28 A;  4EYI B;  4ED0 A;  4QIW F;  5B5E U;  4KN7 A;  4J9N A;  3QNM A;  4EBE A;  9ICA A;  1S5L U;  4EX6 A;  4LEW A;  5ALR A;  4OJ5 A;  1CI4 A;  5KAF U;  2V4Q A;  2OEH A;  4E7X A;  4QNL A;  3MDC A;  1TK0 A;  2XIC A;  2PFN A;  5AIB A;  1DXS A;  2ZH9 A;  8ICU A;  3TKA A;  4K4G A;  2FE9 A;  3B0X A;  1PVQ A;  1R89 A;  2DBY A;  5F3X B;  7ICQ A;  8ICI A;  2WF9 A;  5EE3 A;  3WFS C;  4OJP A;  2ZIV B;  4DFJ A;  3F53 A;  5IIK A;  4XQ8 A;  5HML A;  2RHF A;  4Y2P A;  3ISB A;  1C7Y A;  5J2H A;  4IRD A;  2WF5 A;  4UBC A;  4UQG A;  3WK4 A;  5CJ7 A;  2YB1 A;  5J0O A;  1D8B A;  2XGQ A;  3QUB A;  4CF4 A;  2ZH4 A;  2JH7 A;  4O3N A;  3OTQ A;  4NLN A;  3NYB A;  2EAN A;  4WC7 A;  3A0H U;  3TAD C;  9ICT A;  1J97 A;  2BCS A;  5B66 U;  5D49 A;  5AKL A;  3Q8P B;  2EZZ A;  3M9M B;  8ICE A;  5HRI A;  1DK2 A;  4OJL A;  2WTF A;  5KG2 A;  4O3O A;  3V7K A;  3PX6 A;  2LHT A;  5KL1 B;  4EEB A;  4MEX A;  4TUQ A;  2K4P A;  3EUB 2;  3TAP A;  3QUQ A;  4K97 A;  4C80 A;  5L1I A;  2KKV A;  2AGQ A;  3WK9 A;  3RTV A;  3CW2 C;  4KIT B;  3PX0 A;  4F4Y A;  1SWW A;  5CRX A;  4ELV A;  1O08 A;  4BUG A;  5J0S A;  3HWT A;  5ALJ A;  5DBA A;  3THV A;  3Q8M A;  5HRD A;  4J9Q A;  2GWS A;  4UAT A;  4KX5 A;  3QEB Z;  4I2G A;  2E1E A;  1O03 A;  5DB9 A;  3OVS A;  3IP4 B;  4UD5 A;  1B43 A;  4RZR A;  2H5X A;  1GPJ A;  4RNO A;  4K4H A;  2BZF A;  4RQ7 A;  2HHT A;  1P7D A;  1X6I A;  5J0R A;  2W7P A;  1ZQO A;  4C8K A;  2KE7 A;  3OSP A;  8ICG A;  4IS7 A;  3CK6 A;  2KFN A;  1KBU A;  4NWI A;  2M2U A;  3H3A A;  3ETL A;  4YXJ A;  3GV5 B;  4BXO A;  2EWR A;  1HUO A;  3OVB A;  4EBK A;  7ICF A;  2DR8 A;  2KOB A;  4ICA A;  2HHW A;  4M9N A;  4ECZ A;  1TFR A;  2A1J B;  3PX4 A;  5GTI U;  5CWR A;  2O6K A;  4ACO A;  4RQ8 A;  1RQN A;  1Z00 A;  4QZ8 A;  3ZDB A;  3ALR A;  1ZD3 A;  3SMV A;  1NJX A;  3M1Y A;  1TK8 A;  1LB2 B;  4DO9 A;  2GH1 A;  2QB0 B;  2MUT A;  1QQ7 A;  2HVI A;  8ICX A;  1ECW A;  4DWI A;  2JH1 A;  4QZ9 A;  4BWJ A;  5J2F A;  3MR2 A;  2ODG A;  2DF4 B;  5AK3 A;  2B4V A;  4TUR A;  1X9X A;  3UM9 A;  2WF8 A;  1Q79 A;  8ICY A;  5ALU A;  2PXI A;  7ICM A;  3JYY A;  1ZQB A;  5IIN A;  5ALH A;  5T14 A;  1KTQ A;  2DVI A;  4EBD A;  5AKZ A;  4DSF A;  9ICS A;  1N2X A;  3GV7 B;  2D3D A;  1VFG A;  4QWB A;  5KG6 A;  4KLH A;  1ZD4 A;  4GFJ A;  4RQ2 A;  4UAZ A;  5KFR A;  4O5C A;  2ZIU A;  5CHG A;  5C0Y A;  5TIS U;  3GFK B;  4O5E A;  2JRZ A;  3WKA A;  7ICG A;  1NK0 A;  2PFO A;  1TAQ A;  3D2Q A;  4GXK A;  2AJQ A;  2XI9 A;  4Z6C A;  4Y2U A;  3OHB A;  4IR1 A;  4IRC A;  3T5H A;  3QZ8 A;  2LBO A;  3ZI4 A;  2CN1 A;  5AI5 A;  4NLK A;  3ICX A;  4JLZ A;  5F2V O;  4YD2 A;  5DQG A;  1LV5 A;  3PO5 A;  5G5H A;  3OUY B;  3EZ5 A;  3CP8 A;  4FH3 A;  1ZQC A;  4ECV A;  3IN5 A;  5EOZ A;  5KFT A;  3HJE A;  1XO1 A;  8ICA A;  2KSO A;  3MBY A;  4EV6 A;  2FPL A;  2YQE A;  1UPH A;  4F4K A;  1ED1 A;  3ZDC A;  4WOY A;  3BQ2 A;  3RJH A;  1X9M A;  4G9B A;  5ALY A;  4NLB A;  5KFG A;  3ZDD A;  3OV7 A;  3TAC B;  3Q8R B;  2BDP A;  3SYZ A;  3ZDE A;  2HBM A;  5C5J A;  2GOL A;  5DQI A;  4F91 B;  2Q0Z X;  3IDW A;  1HIW A;  5J0X A;  2PI5 A;  9ICL A;  3WK6 A;  2WAQ C;  4F92 B;  3JPN A;  3HW8 A;  3TAN A;  2PBE A;  1AQ6 A;  2G06 A;  5KG0 A;  3V6H A;  1WWU A;  3UXN A;  3AN1 A;  4US8 A;  4FHY A;  2YN4 A;  4J9R A;  4J9S A;  3SAH A;  2D8C A;  2PMZ F;  7ICR A;  2UVV A;  4K98 A;  4X4T A;  3KKA C;  3RF9 A;  3B9J A;  1MQ3 A;  1A0P A;  2A19 A;  1IXR A;  2F1H A;  1N5W A;  1KN5 A;  2VA3 A;  5L1K A;  3IM1 A;  4QZC A;  5GTH U;  2ZIV A;  3SEN A;  8ICN A;  1KQQ A;  4Q43 A;  1ZQF A;  4I2C A;  4UB8 U;  4DQP A;  2KHV A;  5J29 A;  2NV3 A;  1XO0 A;  1TAU A;  3KZX A;  1U9L A;  1WUD A;  4DQR A;  2O5A A;  2KG5 A;  1ARO P;  3JPP A;  4O0I A;  4R64 A;  4O69 A;  1D9F A;  2PFP A;  5KFZ A;  5F9L A;  4AT7 B;  4J9L A;  2EAM A;  4I2D A;  5J2A A;  2IOF A;  1ZET A;  4PZO A;  1JRP A;  3C1Y A;  5CFS A;  1KL9 A;  4MFF A;  4P2H A;  4X5V A;  3DV9 A;  1NJZ A;  1CRX A;  4RWO A;  3LVW A;  2R8H A;  2K4H A;  2MRL A;  2C28 A;  2ALZ A;  2CRX A;  4IR9 A;  4PL1 A;  1NK9 A;  4I29 A;  5KG7 A;  1M6Y A;  2YX8 A;  4IG8 A;  1IM4 A;  2ASD A;  4B6J A;  1ZQH A;  5AIA A;  2KHQ A;  4RQ4 A;  4RPZ A;  3GIK A;  2HHV A;  3EW9 A;  2F8L A;  2F1J A;  2FMS A;  4Y2X A;  1WYG A;  3Q8K A;  5JUM A;  4ECR A;  3BDP A;  4C0Z A;  1N61 A;  4Y2R A;  1URJ A;  3MFI A;  1U48 A;  1K1S A;  4USA A;  4UBB A;  2UVW A;  4QZD A;  2YMM A;  5D46 A;  3ETR A;  1JI7 A;  3PSP A;  3IV6 A;  5AKX A;  1ZQE A;  1ZQY A;  3AU6 A;  4ED7 A;  4AYB F;  5J0Q A;  2BPF A;  4DL2 A;  3S6J A;  2JEJ A;  1WWV A;  4C4T A;  2ZTC A;  3WK7 A;  2AU0 A;  5HR6 A;  3ER9 B;  1WCN A;  4KN4 A;  4BXO B;  2XC9 A;  2QAR B;  3L4P A;  4QWA A;  9ICF A;  1RYU A;  2A1J A;  3UQ2 A;  4FO6 A;  1Q78 A;  4Q8F A;  5G5G A;  5D4B A;  4J03 A;  2C22 A;  2W43 A;  3LWM A;  2ZH1 A;  3QU4 A;  1A77 A;  4PGQ A;  1ZQX A;  2E8O A;  3I1Y A;  2H3Q A;  4M6W B;  4Y2J A;  2M2T A;  1V9P A; 
#chains in the Genus database with same CATH homology
 5EWE A;  3GIL A;  2HHQ A;  4TQR A;  4O3P A;  1NK8 A;  4IQT A;  4GC7 A;  4RUC A;  3AU2 A;  5KFO A;  4R66 A;  2R8K A;  4EBC A;  4NLZ A;  4ELT A;  4YG2 A;  5DGB A;  4R8U B;  2V4Q A;  1T3N A;  1ZQA A;  4MF2 A;  1R8A A;  1R8C A;  4I2I A;  4K4I A;  2ZHA A;  1QSY A;  4J9P A;  4E7X A;  2J6T A;  2I1Q A;  4Q44 A;  3MDC A;  4JWM A;  4F4Z A;  1TK0 A;  4RQ5 A;  3JPQ A;  2FLN A;  5KT3 A;  2PFN A;  2FPM A;  3NGD A;  5F9N A;  3JPR A;  4NLG A;  2F1I A;  4X0A A;  2ZH9 A;  1JN3 A;  4KLT A;  3ZD9 A;  1RXW A;  4K4G A;  8ICU A;  3L9D A;  3B0X A;  2Y1J A;  3C1Z A;  1JXL A;  1R89 A;  5DKW A;  4M47 A;  7ICQ A;  2JZB B;  2NRW A;  4O5K A;  2XY6 A;  8ICI A;  1DGS A;  9ICJ A;  3WFS C;  1BPD A;  2AQ4 A;  4DQS A;  4DFJ A;  4EEY A;  2KZZ A;  5IIK A;  4XQ8 A;  3H7I A;  5HML A;  5HRL A;  5KFU A;  1XSL A;  4QZB A;  4KLD A;  1ZQN A;  1SZP A;  1K1Q A;  3ISB A;  5KG1 A;  4QWE A;  5J2H A;  1TV9 A;  1C7Y A;  1D8Y A;  4IRD A;  4M9J A;  4UBC A;  4UQG A;  3LWL A;  4UB1 A;  4DQI A;  7ICU A;  5CJ7 A;  2KN7 A;  5J0O A;  4QWC A;  1ZQL A;  4KLM A;  3RAX A;  4ECY A;  5HRH A;  2XGQ A;  3AQN A;  5J2J A;  4UD4 A;  5J2D A;  1BPY A;  1S0O A;  1T4G A;  1BPZ A;  3HJ1 A;  4O3N A;  2ZH4 A;  2JEF A;  4B9M A;  3N97 B;  1SL0 A;  3G6Y A;  4NLN A;  3NYB A;  4BWM A;  3RRH A;  4YR2 A;  5KT7 A;  4PHE A;  3TFS A;  1KFS A;  4PHP A;  1X9S A;  4WC2 A;  5KT6 A;  4RQ6 A;  4RT2 A;  4WC7 A;  2FLP A;  2XO7 A;  1XS9 D;  4DL6 A;  4UB3 A;  9ICT A;  4QW8 A;  2BCS A;  3FYH A;  3RB3 A;  5D49 A;  5BOM A;  3Q8P B;  3M9M B;  4F5O A;  2HHS A;  1FA0 A;  2VA2 A;  3T5J A;  3TQ1 A;  8ICE A;  9ICG A;  7ICL A;  5HRI A;  5DLF A;  4X4Q A;  3KHH A;  2R8G A;  1DK2 A;  1MSW D;  2WTF A;  7ICJ A;  3GQC A;  1WOT A;  1TFW A;  5KG2 A;  4ZH4 A;  4O3O A;  4EBJ A;  3OJU A;  3V7K A;  3T5L A;  4UB2 A;  3PX6 A;  4PGX A;  3RB0 A;  1XC9 A;  1U4B A;  3UXO A;  2ATL A;  4DOB A;  3PML A;  2BCR A;  8ICZ A;  3PW0 A;  1BNP A;  5KG3 A;  2XCP A;  4MEX A;  2NRK A;  4E8F A;  4Z6E A;  4TUQ A;  2DR9 A;  4DSK A;  9ICV A;  2O1P A;  1MIW A;  3PV8 A;  4NM2 A;  3TAP A;  4RU9 A;  8ICL A;  4QZH A;  4O3Q A;  2XY7 A;  5KFD A;  3H8W A;  5L1I A;  4F2S A;  9ICX A;  2AGQ A;  4EZ9 A;  2DR7 A;  4QZI A;  1JIH A;  3RTV A;  3RR7 A;  5DBC A;  4I2E A;  4KIT B;  3PX0 A;  4Z6F A;  5KFH A;  4F4Y A;  3BQ1 A;  3OUY A;  4S3N A;  4O9M A;  3PR5 B;  3MR6 A;  5KFK A;  3LDA A;  5KFN A;  9ICN A;  4I2B A;  4ELV A;  4RQ1 A;  3Q8Q B;  8ICS A;  5J0S A;  3HWT A;  4G3I A;  4FHW A;  4GXI A;  4M9L A;  2R8I A;  2PI4 A;  5DBA A;  3THV A;  1ZQI A;  3NTU A;  3Q8M A;  1RYS A;  5HRD A;  4O3R A;  1V4A A;  2HVH A;  1T7P A;  1NZP A;  4J9Q A;  2ZH5 A;  1UA0 A;  2GWS A;  5KFS A;  4XA5 A;  4P4O A;  4I2G A;  3QEB Z;  2JEG A;  4RPY A;  3RH6 A;  1S77 D;  4F50 A;  4MFC A;  5HRF A;  5KFQ A;  5DB9 A;  4ECS A;  4Q45 A;  4UD5 A;  5J0Y A;  2J6S A;  3OVS A;  4QW9 A;  1B43 A;  1RZT A;  4JWN A;  9ICU A;  2ZHB A;  4AT8 B;  2ZH3 A;  4RZR A;  2H5X A;  3SZ2 A;  3RJJ A;  4RNO A;  3H4B A;  4K4H A;  4KLQ A;  1S97 A;  2W9B A;  4XQ7 A;  2XGP A;  4ECW A;  4RQ7 A;  1T8E A;  1U47 A;  1RYR A;  2HHT A;  4X4N A;  1ZQU A;  4AT9 A;  5J0R A;  1L3U A;  5HR9 A;  4C8K A;  1ZQO A;  2HW3 A;  3OSP A;  9ICB A;  8ICG A;  4F5N A;  5BOL A;  3RRG A;  4JUZ A;  4DQQ A;  2XY5 A;  4O3S A;  5CR0 A;  2KFN A;  9ICM A;  2Y1I A;  1ZJN A;  1ZYQ A;  4KLU A;  2M2U A;  3OVA A;  3H3A A;  2BGW A;  2DRA A;  3ETL A;  3FDS A;  5HMM A;  4YXJ A;  2W8L A;  1KFT A;  3GV5 B;  4DLG A;  5DDY A;  4BXO A;  5L1L A;  1HUO A;  3OVB A;  4EBK A;  3K75 D;  4RT3 A;  1UEV A;  3C21 A;  7ICF A;  7ICE A;  2DR8 A;  1EXN A;  3M9O B;  5DQH A;  2HHW A;  4WBZ A;  4BDP A;  4KLI A;  1Y88 A;  1COO A;  4KLF A;  4M9N A;  4ECZ A;  3SI8 A;  2IHM A;  2C2R A;  1TFR A;  2DRB A;  2A1J B;  3SV3 A;  3PX4 A;  5CWR A;  4DSI A;  4RQ8 A;  4QZ8 A;  1Z00 A;  3KHR A;  1YLQ A;  4RQ0 A;  3ZDB A;  2NRV A;  3ISC A;  4MEY A;  3HT3 A;  8ICK A;  1NJX A;  4ED1 A;  4YN4 A;  4JV0 A;  4RPX A;  1TK8 A;  1LB2 B;  2BR0 A;  1N56 A;  4TUS A;  5HHI A;  4DO9 A;  1L3S A;  2ID1 A;  2BCU A;  2KP7 A;  4X4R A;  1CUK A;  3GV8 B;  4YMN A;  5KFI A;  2MUT A;  3KHL A;  3H4D A;  4JV2 A;  4JV1 A;  5KFM A;  4QZE A;  2HVI A;  1SL2 A;  8ICX A;  3C18 A;  1N48 A;  4NKU A;  4DWI A;  3PW2 A;  4QZ9 A;  5J0U A;  4I2H A;  1S0M A;  3BQT A;  3UXP A;  1NKC A;  4BWJ A;  4WC4 A;  2ASJ A;  5J2F A;  3MR2 A;  5DBB A;  4C8L A;  4I28 A;  4EP7 A;  3PW4 A;  2LYH A;  3QZ7 A;  1S76 D;  1BPX A;  1NK5 A;  2HHU A;  4TUR A;  1NKE A;  4ATB A;  1RXV A;  5KFB A;  5DB6 A;  4CCH A;  1Q79 A;  5KFX A;  8ICY A;  1NKB A;  2PXI A;  3V7J A;  1NJW A;  3E2E A;  7ICM A;  3RB6 A;  3JYY A;  4AT7 A;  4YCX A;  1ZQB A;  3AQK A;  4C8N A;  5IIN A;  3ZD8 A;  3PW7 A;  3C2K A;  1HJP A;  3WFQ E;  1KTQ A;  2KZM A;  2DVI A;  4EBD A;  2J6U A;  4DSF A;  4WC0 A;  4ED3 A;  3M9N B;  9ICS A;  5HHH A;  4QZA A;  1SL1 A;  4DOC A;  4DL4 A;  3GV7 B;  1QSL A;  1VFG A;  4QWB A;  3AUO A;  5KG6 A;  4DSE A;  8ICB A;  8ICO A;  4I27 A;  3GII A;  4YMO A;  1QLN A;  5J2G A;  4KLH A;  4YR0 A;  9ICF A;  4NM1 A;  9ICE A;  4C8M A;  2BPC A;  4RQ2 A;  4UAZ A;  5KFR A;  4FBU A;  1MIV A;  1A76 A;  5KFA A;  4YP3 A;  3OUY B;  1KRP A;  2ZJA A;  4KLL A;  4O5C A;  4P4P A;  4ECT A;  5KFV A;  5CHG A;  4KLE A;  4FHP A;  3GFK B;  5DGA A;  3RH4 A;  1BPE A;  4O5E A;  3H37 A;  4HYK A;  7ICG A;  4EYH B;  2RFF A;  1NK0 A;  2PFO A;  1TAQ A;  2FLL A;  4WBY A;  4P4M A;  4GXK A;  2W8K A;  1ZQJ A;  4IQW A;  4DSJ A;  3MGH A;  2AJQ A;  8ICF A;  3HIY A;  1SKR A;  5TZV A;  3G6V A;  4B9V A;  1JXE A;  4Z6C A;  5DB8 A;  4NY8 A;  1KNY A;  3OHB A;  4B9L A;  4UB4 A;  4RWN A;  3RJE A;  4IR1 A;  5L1J A;  2DPI A;  1SKW A;  2P6U A;  2UVR A;  4X0B A;  4ED6 A;  3MDA A;  3T5H A;  4IRC A;  4KLJ A;  1TVA A;  3QZ8 A;  9ICH A;  2NRZ A;  3SV4 A;  1U45 A;  2BQR A;  4UB5 A;  1VJ7 A;  1TKD A;  4NLK A;  1MC8 A;  9ICC A;  1SKS A;  3ISD A;  3UPS A;  3JPT A;  3HP6 A;  4FS2 A;  5F2V O;  4ECX A;  5J2I A;  4YD2 A;  4WC6 A;  5DQG A;  4DF4 A;  1X9W A;  1LV5 A;  3PO5 A;  8ICQ A;  4QZF A;  3EZ5 A;  4DFK A;  4DL7 A;  3QEA Z;  1F5A A;  5CP2 A;  3V6K A;  2AGO A;  3PY8 A;  4IQV A;  9ICP A;  4MFA A;  4ECQ A;  4FH3 A;  1ZQC A;  3OHA A;  4ECV A;  1NK4 A;  3N4M B;  2W9C A;  5EOZ A;  4ED8 A;  1WCL A;  5KFT A;  1XO1 A;  3OJS A;  3M8R A;  2IA6 A;  5DLG A;  1NJY A;  8ICV A;  8ICA A;  4F5P A;  3MBY A;  4LT6 A;  2FPL A;  1S0V A;  4F4K A;  3H39 A;  3M8S A;  3ZDC A;  3B0Y A;  4TQS A;  1ZJM A;  2FMP A;  3BQ2 A;  2JEI A;  1CEZ A;  3MR3 A;  3RJH A;  4F3O A;  3PVX A;  4X4P A;  2ZH2 A;  1X9M A;  5IIJ A;  1UEU A;  2BHN A;  1JQR A;  3TAQ A;  1NK6 A;  1L5U A;  7ICI A;  5KFG A;  4J9K A;  3ZDD A;  4KLG A;  9ICQ A;  3OV7 A;  3Q8R B;  2BDP A;  3SYZ A;  3ZDE A;  2W9B B;  5BPC A;  2P66 A;  1XU4 A;  5L9X A;  1XWL A;  5KG4 A;  5C5J A;  1ZQK A;  4B9T A;  4AT9 B;  5DQI A;  4E0D A;  5HRK A;  3Q8L A;  4JK1 A;  4F91 B;  2ISO A;  3WFO A;  4UAY A;  2Q0Z X;  3C23 A;  3LQC B;  4B9S A;  5J2E A;  1BNO A;  5KFF A;  8ICJ A;  4J9M A;  9ICI A;  5J0X A;  4DLE A;  5KFP A;  1ZQV A;  2PI5 A;  4F92 B;  3JPN A;  3TAN A;  2M9N A;  3HW8 A;  2R8J A;  9ICL A;  7ICR A;  2PBE A;  5KG0 A;  5KFW A;  5J2B A;  1TK5 A;  4F8R A;  1XSP A;  3BJY A;  8ICR A;  5KT2 A;  3V6H A;  9ICK A;  3RJI A;  4M6W A;  2BCQ A;  3ZDA A;  4DF8 A;  4PPX A;  1B22 A;  3V7L A;  4FS1 A;  5KTQ A;  2BE3 A;  3UXN A;  5KFL A;  2B21 A;  3H8J A;  4FHY A;  2AQ0 A;  3KHG A;  3HPO A;  4J9R A;  2C2E A;  2AGP A;  4RUA A;  2ISP A;  4KMU A;  2BQ3 A;  2FPK A;  2UVU A;  1JAJ A;  3AQM A;  1ZQG A;  4YFK A;  5HP4 A;  1ZQT A;  4NKT A;  2ZUC A;  4J9S A;  4WC3 A;  4R8U A;  5DEC A;  2DR5 A;  5J0T A;  4PHA A;  8ICM A;  4E80 A;  3WFR E;  4QZG A;  1DOQ A;  3TFR A;  1BVS A;  2C2D A;  1UA1 A;  5III A;  4YQW A;  3T5K A;  2UVV A;  2DPJ A;  4B9U A;  1MIY A;  4X4T A;  8ICH A;  4R65 A;  1Z00 B;  1ZQP A;  4M5D A;  3Q8S B;  1MQ3 A;  1MQ2 A;  3G6X A;  4DL3 A;  4C8O A;  4LZG A;  3H40 A;  4IQU A;  1RPL A;  3PW5 A;  5CB1 A;  3C5F A;  1IXR A;  5IIO A;  3C2L A;  3RBD A;  4EZ6 A;  8ICC A;  4DOA A;  3EYZ A;  2F1H A;  5J2K A;  2IHN A;  2JZB A;  4LZD A;  1KLN A;  4KLS A;  4RWP A;  3JZ0 A;  1H38 A;  2VA3 A;  3PO4 A;  2PFQ A;  7ICH A;  2KFZ A;  2MAX A;  3IM1 A;  5L1K A;  4QZC A;  4RWQ A;  2MUT B;  3PNC A;  8ICN A;  5HNK A;  4Q43 A;  1L3V A;  3RJK A;  4X4S A;  1D8L A;  7ICN A;  2BKE A;  4DS5 A;  5HRE A;  1ZQF A;  3TI0 A;  2VA8 A;  4I2C A;  3MFH A;  3KTQ A;  3C66 A;  4PGY A;  3GIM A;  4RNM A;  4DQP A;  5EWF A;  5J29 A;  5EWG A;  7ICV A;  3HX0 A;  4UAW A;  7ICO A;  3T3F A;  5HC9 A;  4FH5 A;  1TAU A;  2O5A A;  1U9L A;  4DQR A;  7ICT A;  4F4W A;  1PZN A;  1BGX T;  4GC6 A;  1ARO P;  3RBE A;  4DSL A;  1PX5 A;  4ATB B;  3JPP A;  4M9H A;  4DS4 A;  3RJF A;  5KG5 A;  4O0I A;  4R64 A;  1ZQM A;  1QSS A;  1D9F A;  2PFP A;  2ZUD A;  5KFJ A;  5KFZ A;  4TUP A;  1KSP A;  2HHV A;  5F9L A;  3BQ0 A;  4J9L A;  4B9N A;  4AT7 B;  4I2D A;  4XRH A;  4F4X A;  4NXZ A;  5J2A A;  1NOM A;  2ZTD A;  3RAQ A;  1ZET A;  1ZQS A;  9ICW A;  9ICO A;  1JMS A;  2HHP A;  4XUS A;  3JPO A;  3LK9 A;  4X4O A;  2ZH6 A;  3MGI A;  3C1Y A;  2VAN A;  3PR4 A;  1HUZ A;  5HRB A;  4MFF A;  2RDJ A;  4M0A A;  4P2H A;  4Q8E A;  5HRG A;  4X5V A;  1NJZ A;  5IIL A;  4RWO A;  7ICK A;  2R8H A;  1JX4 A;  1Z3E B;  5KFC A;  2C28 A;  2ALZ A;  4I2A A;  1OU5 A;  4IR9 A;  4YD1 A;  2IBK A;  4J9O A;  1NK9 A;  4WC1 A;  9ICR A;  5CA7 A;  4ED2 A;  4I29 A;  5KG7 A;  2M2V A;  4RNN A;  2FMQ A;  2Q66 A;  4IG8 A;  2ZJ5 A;  3K4G A;  5J0W A;  1IM4 A;  2ASD A;  4YMM A;  4F5Q A;  1ZQH A;  4YXM A;  4YVZ A;  2P6R A;  5J0P A;  2BPG A;  4R63 A;  2ZJ8 A;  3EPI A;  5DG7 A;  2W9A A;  2NRX A;  3C5G A;  1KFD A;  4IRK A;  1TFY A;  1UT8 A;  4BGD A;  3H38 A;  5DG9 A;  4RPZ A;  4RQ4 A;  3C2M A;  3RH5 A;  3GIK A;  2BQU A;  2BCV A;  3EW9 A;  4DEZ A;  4F5R A;  1KDH A;  2RDI A;  4I2J A;  3V72 A;  1S10 A;  1ZQQ A;  1UET A;  4MF8 A;  5DED A;  3GIJ A;  2F1J A;  1UT5 A;  2FMS A;  3OGU A;  3Q8K A;  4FHX A;  4YR3 A;  5DG8 A;  5JUM A;  1DK3 A;  4WC5 A;  4ECR A;  3ORY A;  3BDP A;  4M9G A;  1S9F A;  2OWO A;  3EPG A;  4AT8 A;  4WCW A;  4QWD A;  3MFI A;  5KFY A;  4ECU A;  1U48 A;  1K1S A;  5DDM A;  4LVS A;  3RB4 A;  4M2Y A;  2IMW P;  3GDX A;  8ICP A;  3AQL A;  4UBB A;  5KFE A;  2UVW A;  4F2R A;  3OSN A;  4DFM A;  4KTQ A;  4I2F A;  4QZD A;  4RQ3 A;  5D46 A;  8ICT A;  3EWA A;  5KT4 A;  3V6J A;  5DB7 A;  4DL5 A;  4FHV A;  2KTQ A;  2NRT A;  3TAR A;  1ZQR A;  2DFL A;  4GLX A;  4X4U A;  2W9C B;  4FBT A;  3MR5 A;  5KT5 A;  1ZQE A;  4Z6D A;  7ICP A;  1ZQY A;  3IHQ B;  3AU6 A;  4PH5 A;  5J2C A;  3H8S A;  4ED7 A;  2BPF A;  5J0Q A;  1S0N A;  4DL2 A;  4GXJ A;  2JEJ A;  2ZH8 A;  3HJ4 A;  7ICS A;  2HHX A;  2ZTC A;  1L3T A;  1BPB A;  5IIM A;  1NO5 A;  1R8B A;  2V4R A;  2ASL A;  3UQ0 A;  2AU0 A;  2W9M A;  2M2W A;  1WCN A;  1ZQW A;  1XSN A;  2ZUB A;  3PMN A;  1NK7 A;  2V9W A;  4KN4 A;  4BXO B;  2XC9 A;  4ELU A;  2KZ3 A;  1KEJ A;  4DFP A;  1ZQZ A;  3MAB A;  4QWA A;  2I9G A;  3RJG A;  1ZQD A;  2A1J A;  4PHD A;  3UQ2 A;  1X2I A;  3UPQ A;  4F93 B;  4FO6 A;  3QE9 Y;  1U49 A;  1D9D A;  4KLO A;  5D4B A;  4Q8F A;  2C22 A;  8ICW A;  3JPS A;  1Q78 A;  3WFP A;  2ZH7 A;  4EYI B;  2ZTE A;  4ED0 A;  2XCA A;  4X4V A;  4M04 A;  3RR8 A;  3LWM A;  1QTM A;  4KN7 A;  2ZH1 A;  1A77 A;  4PGQ A;  4J9N A;  1ZQX A;  4EBE A;  4M6W B;  9ICA A;  2M2T A;  1V9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...