4M9GA

Dna polymerase beta e295k binary complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
325
structure length
314
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 103
structure length 314
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9gA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9gA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9gA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9gA03
4CCHA 3RH6A 3HT3A 5KFAA 3GV7B 8ICSA 2IA6A 4YD1A 1U45A 5J0UA 4M6WA 2ZTDA 4P4OA 4B9SA 1D9DA 5KG2A 3GIMA 1Z00B 4KLMA 4DS4A 3G6VA 3Q8KA 5KFSA 2J6UA 7ICTA 1WOTA 3MFIA 1DK3A 1ZQGA 3OHAA 3V7LA 2R8IA 2DVIA 3RB3A 4QZCA 4IQTA 1JXLA 5KFFA 3LWMA 7ICQA 4X4VA 2DRAA 1DOQA 4MEXA 4PHEA 3PW2A 3PY8A 4RPZA 5KFVA 4YR2A 5C5JA 4J9OA 4IQUA 3C23A 4B9UA 4KTQA 9ICAA 4KLEA 2AGOA 1QSSA 8ICXA 1V4AA 4GC6A 4ATBA 4MFCA 2MUTB 4PH5A 5CWRA 2W8LA 4RT3A 3HJ4A 4PGQA 3V72A 4WBYA 3JPTA 3C2KA 3SI8A 4IR9A 4IG8A 5KG3A 4J9SA 2UVUA 3OSNA 4M9GA 3ZD8A 1UT5A 5KG0A 5F9LA 3MDCA 4TUQA 3BQ0A 4F5QA 4YMNA 4F5RA 3K4GA 1BVSA 4ECUA 5D49A 2I9GA 2ZH6A 5KFDA 9ICQA 4RQ8A 4EZ9A 2VA2A 2ZUBA 5BPCA 4DQQA 2BKEA 5IINA 1ZQXA 4F4WA 1ZQJA 1FA0A 4EYHB 4TUPA 2BCVA 2BCQA 1U9LA 4AT7A 4GXKA 4K4HA 1NK9A 4NM1A 4QZFA 3HIYA 4J9QA 2PI5A 3PO4A 2WTFA 2ZH5A 5BOLA 1TK0A 4WC7A 4F4XA 3UQ2A 1S0NA 3PO5A 4DFKA 2V4RA 2GWSA 5HP4A 1KRPA 3BQTA 8ICWA 4AT8B 4UB3A 8ICAA 4DL3A 3C66A 4RWNA 4UBBA 1TFYA 2JZBB 5CHGA 4DL4A 4PHAA 3C2MA 4WC5A 3RB4A 5L1JA 5DB8A 4UBCA 2ATLA 1MQ3A 1QLNA 4WC4A 3WFRE 4UB1A 4I2CA 3SZ2A 1S97A 4ED1A 4ELVA 3UXOA 5KFCA 5DG8A 1NO5A 1ZQWA 3MR2A 2NRKA 4FS2A 4X5VA 1NKEA 2ZJAA 3BJYA 5IIKA 1TKDA 1PX5A 4ELUA 1UT8A 4QW8A 1D8LA 1LV5A 1KFTA 8ICHA 4DQPA 3NTUA 1YLQA 4IRKA 3HW8A 3ZDDA 1NJZA 2PFNA 4YFKA 5JUMA 5J0XA 3KHRA 1ZQMA 4F2RA 4EBJA 4EP7A 3TFSA 2NRXA 5KTQA 4J9MA 5CP2A 1NOMA 7ICVA 4UAYA 2W9CA 3AQNA 2UVVA 3ZDAA 4F2SA 3E2EA 3OSPA 3C2LA 7ICIA 9ICPA 4WC0A 5J2FA 5KFLA 3L9DA 5KFIA 4JV0A 4O5CA 4YQWA 4DFPA 4Z6FA 4MF2A 4Q43A 1XSLA 1TAQA 5DDYA 3MR5A 4Q8FA 2ZH3A 4X4QA 3Q8QB 2BQ3A 9ICEA 8ICYA 4R65A 3HWTA 3IM1A 2XY5A 2P6RA 9ICMA 1JQRA 5HRFA 4ED6A 5J0RA 4GLXA 4ED0A 1ZQHA 4NM2A 5IIJA 2J6SA 2ZH1A 1ZJMA 3K75D 8ICRA 3PR4A 5L9XA 3GQCA 5KFHA 1WCNA 4DLEA 2Y1JA 7ICUA 5KG1A 9ICTA 2JZBA 3RR7A 4X4RA 2B21A 3SV3A 2C22A 3AQMA 5KFPA 2ZJ8A 2XGQA 5J0OA 3PX4A 1NJYA 1X2IA 5L1IA 8ICTA 8ICUA 3H4BA 2HHXA 4GC7A 4FBTA 4AT8A 4RPXA 4YN4A 3AUOA 3WFSC 5KG5A 3RR8A 9ICJA 5EWFA 3FDSA 5CR0A 8ICOA 4RUCA 4EBEA 2R8KA 2R8GA 2ID1A 4QZIA 3N4MB 3Q8SB 4P2HA 4J9NA 5EOZA 3HJ1A 3GV5B 3OGUA 3QEBZ 5DGBA 3Q8MA 2PI4A 1PZNA 1N56A 4RUAA 5DLFA 5KG6A 3G6YA 4FHVA 3IHQB 4F91B 1NK4A 2MUTA 4Q45A 4F3OA 4KLJA 2XO7A 4K4IA 2O1PA 2W9MA 3MBYA 4F4YA 3V6HA 2XY6A 3H39A 5J0YA 3PR5B 5KFXA 4F8RA 2JEFA 1SL1A 1BPZA 4Z6EA 3EPIA 5DGAA 2W9CB 1KFDA 2ALZA 1ZQIA 3RRHA 1T8EA 3UXNA 4UB4A 2M2UA 4MEYA 1MIVA 7ICSA 5HRBA 4R8UB 1ZQKA 3GDXA 1ZQVA 4YCXA 4QZGA 4XA5A 5HHHA 3C5FA 4C8NA 2BCUA 3Q8PB 5DDMA 4ED7A 3ISDA 4IR1A 1BPBA 1ZETA 8ICKA 4QWBA 1S10A 4RU9A 3TFRA 5J2CA 2BGWA 3JYYA 5KT2A 4EBDA 5J2EA 4QZDA 1X9WA 2VANA 4BWJA 1JX4A 3AU6A 4KMUA 4DF4A 4LZGA 4I2IA 2ASLA 4YR3A 3RJEA 2XC9A 1IM4A 5HR9A 2H5XA 3B0XA 4ECQA 3T3FA 1NZPA 2PBEA 2BHNA 3H4DA 3Q8RB 3M8SA 3TANA 1L3UA 5D46A 2V4QA 2FLLA 1XSPA 4P4PA 3MABA 3GIKA 3T5KA 4RQ3A 3PW5A 3RJGA 4YXMA 4YD2A 4X4NA 1RXWA 1NKBA 2PFQA 3PNCA 7ICOA 4M9LA 2ZTCA 5L1KA 2JEJA 3V7KA 4C8MA 4I2HA 2ZUDA 2KZMA 1UETA 4NY8A 4RQ4A 8ICBA 1HUZA 2DFLA 3C1ZA 3MGHA 3EYZA 3SYZA 4DQSA 5HHIA 4M9NA 4NKTA 4DL5A 2KFNA 3ETLA 3PMLA 3N97B 5DB9A 5BOMA 2O5AA 2DRBA 3RJHA 5KT4A 1NJXA 4EBCA 7ICHA 4WCWA 3WFOA 4DFMA 5IIIA 3JPPA 4UQGA 2ASJA 3GFKB 2IHMA 2BDPA 2P66A 4RZRA 3LDAA 4F4ZA 4F5OA 4M47A 1BNPA 4WBZA 1BPDA 5TZVA 4E7XA 2I1QA 3THVA 4R66A 4DQRA 4KITB 3QEAZ 1X9SA 3HX0A 4KLTA 1UEVA 4QWDA 1UA1A 4RT2A 2BQUA 1ZQNA 4G3IA 3HP6A 4BXOB 2KN7A 3C18A 3H3AA 2AQ0A 7ICEA 4JV1A 1R8BA 4DSEA 2HHTA 4QWEA 4DSJA 4IQVA 1U4BA 1TK5A 3RJIA 1S0VA 9ICXA 1KDHA 2BCSA 4KLLA 5HRGA 5DQIA 3EPGA 4DOBA 4DL6A 1L5UA 5KFJA 4DSKA 3GIIA 2FMPA 1Y88A 5KFTA 4DEZA 1ZQLA 3C5GA 3AU2A 3PW7A 1S0OA 3BDPA 5DB6A 5J0TA 8ICPA 4RQ6A 1ZQYA 5J2HA 1MIYA 4FHYA 2IHNA 5KG7A 4KLQA 3RAQA 3T5HA 1TK8A 2IMWP 4RQ5A 3HPOA 1V9PA 1L3TA 4NLNA 3TAQA 3H38A 5J2JA 5J2BA 2UVRA 4B9VA 1ZYQA 4WC1A 3GIJA 2BPCA 5J0WA 4M5DA 2ZJ5A 3OUYA 1JIHA 2FMSA 4M2YA 1D9FA 4MFAA 1UEUA 3UXPA 4GXIA 5DBBA 3SV4A 8ICEA 3GILA 4E0DA 1OU5A 2HHQA 4ZH4A 1TVAA 1NK0A 2FPLA 4EBKA 3OVSA 4F50A 3ZDEA 4I2FA 2J6TA 5CB1A 4ED2A 2C2DA 4KLGA 1QSLA 1ZQBA 2KTQA 5F9NA 2BPFA 2HHVA 4F5PA 2P6UA 5DQGA 3T5JA 4C8KA 4DSLA 4WC2A 4DQIA 4QZHA 2JEIA 2M2VA 4RQ0A 3BQ2A 3AQKA 2W9BA 4AT9A 5IIMA 5HMMA 4RQ1A 4ECRA 4O0IA 4DL7A 2Y1IA 7ICRA 3EWAA 4ECVA 1T3NA 1DK2A 7ICKA 3PW4A 4ED8A 4DF8A 4KLHA 5DBCA 1UA0A 3RRGA 4BDPA 4DFJA 4JWMA 4DL2A 2MAXA 1KSPA 1Q78A 4DSFA 1SL0A 5DG7A 4I28A 2ASDA 3ZDBA 2NRWA 1RYRA 2UVWA 4J9PA 4AT9B 1WCLA 4M0AA 1QTMA 1Q79A 4X4SA 5KT3A 3BQ1A 2PXIA 5IILA 3RBDA 3RAXA 4MF8A 3UPQA 2Q0ZX 4O5EA 2HW3A 1U49A 5HRIA 3OV7A 4TQSA 9ICIA 3MR6A 4I2GA 4ECWA 1NK6A 5KFWA 2PFOA 5HRHA 3QZ8A 1MQ2A 1ZQRA 4UB5A 1D8YA 4PGYA 1KNYA 3V7JA 4X4UA 4UD5A 3GV8B 4XQ8A 8ICMA 9ICCA 3RH5A 4YMMA 1A76A 3OHBA 3KHLA 2FLPA 5HRDA 2ZH7A 4DWIA 2AGQA 3LQCB 3B0YA 4I27A 1U47A 1ZJNA 4IRCA 5J2DA 4PHPA 2XCAA 1XS9D 2FLNA 4BWMA 5CJ7A 3EZ5A 3JPNA 4ECXA 3V6JA 1XC9A 2FMQA 5HC9A 3G6XA 4EEYA 2DPJA 9ICHA 4O3PA 4C8OA 4M6WB 1ZQTA 4NKUA 1ZQCA 7ICMA 2F1JA 1SZPA 4K4GA 4PPXA 2M2TA 1DGSA 2LYHA 4ED3A 1XSNA 1X9MA 5DBAA 4LVSA 5F2VO 3H8WA 1LB2B 3TAPA 4PHDA 3UQ0A 4DLGA 3TARA 3MDAA 3ORYA 5J29A 4QZBA 2KP7A 2ZH8A 3JPQA 3RB6A 1RZTA 5DKWA 2AJQA 1L3SA 3RBEA 2VA3A 2IBKA 1HUOA 7ICGA 3ZD9A 9ICUA 2RFFA 4FH5A 1RPLA 5HMLA 4FBUA 1L3VA 3JZ0A 1JAJA 4LT6A 4UAZA 1ZQSA 4YP3A 8ICZA 1BNOA 1ZQAA 5KFZA 2NRTA 4J9RA 3H7IA 3M9OB 2A1JA 3AQLA 4ECYA 4RWPA 5KT6A 4EZ6A 5EWGA 1IXRA 2DR7A 3RJJA 1Z00A 4PGXA 4BXOA 2ZHAA 3PX6A 4B9NA 1ZQFA 4RQ2A 1ZQUA 2AGPA 3ZDCA 4JWNA 2M9NA 5KT5A 1BPXA 1TAUA 9ICNA 4M9HA 5KFEA 4E8FA 3T5LA 4TQRA 2ZHBA 4RPYA 4Z6CA 4I2JA 2XGPA 4IQWA 1S0MA 1S77D 3RTVA 4KLIA 3PW0A 2HHWA 1TFRA 3WFPA 1EXNA 3EW9A 5KFKA 4UAWA 4LZDA 4RQ7A 4O3NA 3JPOA 2ISOA 2KZZA 8ICNA 7ICPA 5HRLA 3OJSA 3H8SA 1K1SA 5KFRA 7ICNA 3C1YA 1VFGA 3OVBA 9ICVA 1R8AA 4KLUA 4RWQA 4ELTA 5J2GA 2ZH9A 3LWLA 5KFBA 1C7YA 1T4GA 1MC8A 7ICJA 5EWEA 5KFYA 3KHGA 1B22A 4B9TA 4M04A 9ICOA 2DR5A 2JEGA 4X4TA 4P4MA 1T7PA 4O3RA 5J0QA 4FO6A 5DB7A 2HVIA 9ICKA 4KLFA 1COOA 5J2IA 2C28A 5DLGA 1U48A 1NJWA 3RJKA 2HVHA 1KEJA 2HHPA 2BCRA 5J0PA 2F1IA 4DSIA 2AQ4A 3MR3A 4NLZA 2M2WA 4RWOA 4X0AA 1Z3EB 4X0BA 2F1HA 1CUKA 2FPKA 1R89A 5DEDA 2RDIA 3ISBA 1KTQA 4DOCA 4TURA 1ZQPA 5J2AA 4J9KA 9ICGA 4XQ7A 3NYBA 8ICGA 4YVZA 1BGXT 5KT7A 1KLNA 2R8JA 2Q66A 5KFQA 5DG9A 2XCPA 1NK7A 4ECZA 1S9FA 1TV9A 4X4OA 1TFWA 5KFUA 4F5NA 3KTQA 5KFGA 3JPRA 4I29A 7ICLA 3M9MB 9ICBA 1H38A 1XU4A 5J2KA 4Q8EA 4FHPA 8ICLA 2NRZA 4KN7A 1CEZA 3RJFA 3WFQE 5KFMA 4S3NA 1SKSA 3H37A 4UD4A 1K1QA 4FHWA 4FS1A 2BPGA 5HREA 4DOAA 4JUZA 4I2AA 4FH3A 1VJ7A 2VA8A 1BPEA 4NXZA 1KFSA 1ZQZA 4RNMA 5D4BA 2XY7A 3PV8A 4JK1A 4R8UA 5CA7A 1NK8A 1SKRA 4I2EA 4FHXA 4I2DA 3OUYB 4AT7B 4NLGA 3NGDA 3QZ7A 1AROP 4Q44A 4R63A 1ZQDA 2C2RA 9ICRA 3OVAA 3V6KA 4NLKA 1B43A 4O3QA 3H40A 4E80A 4DO9A 1F5AA 4GXJA 4YR0A 3M8RA 1MIWA 3TQ1A 4MFFA 4O9MA 4QWAA 4O3SA 1MSWD 4YMOA 5L1LA 3OJUA 3TI0A 4B9MA 3UPSA 4XUSA 3RB0A 8ICIA 2V9WA 4ECTA 2AU0A 2OWOA 1A77A 4KN4A 4F92B 5DECA 1SL2A 8ICJA 4RNNA 4C8LA 2DR9A 4O5KA 4BGDA 4R64A 3C21A 2W9BB 1N48A 1RXVA 4J9LA 4KLDA 4WC6A 2ZH4A 3FYHA 5IIOA 2BR0A 3PX0A 1BPYA 4ECSA 2ZH2A 3H8JA 1QSYA 2ZTEA 2HHUA 5KG4A 3ISCA 1XWLA 5J0SA 3M9NB 2ISPA 2NRVA 3QE9Y 3LK9A 1ZQOA 4KLOA 4HYKA 3KHHA 1RYSA 4I2BA 4ATBB 1NK5A 4O3OA 4QW9A 1JMSA 3PVXA 8ICVA 3PMNA 8ICFA 8ICCA 2KZ3A 4WC3A 3MFHA 3Q8LA 1S76D 2ZUCA 1JN3A 5HNKA 2R8HA 4TUSA 2RDJA 5DQHA 3RH4A 1JXEA 4B9LA 7ICFA 5KFNA 4IRDA 4QZEA 2BE3A 5HRKA 2FPMA 9ICSA 5KFOA 4QWCA 1SKWA 4DS5A 2KFZA 4QZAA 2DPIA 1R8CA 4X4PA 3MGIA 2BQRA 2PFPA 2A1JB 4YG2A 4YXJA 2W8KA 4JV2A 4KLSA 2C2EA 9ICLA 4XRHA 4Z6DA 4QZ8A 4QZ9A 4UB2A 2W9AA 1ZQEA 9ICWA 4F4KA 4EYIB 8ICQA 9ICFA 2HHSA 1ZQQA 1NKCA 1XO1A 4F93B 1HJPA 4M9JA 4RNOA 2DR8A 3JPSA
chains in the Genus database with same CATH superfamily
2HBLA 2GA9D 4UASA 4KLMA 3G6VA 3MFIA 4CDGA 1ZQGA 2DVIA 4QZCA 4IQTA 2FDRA 2B56A 1DOQA 3WKBA 5AKHA 3PW2A 5KFVA 4CRXA 3NASA 4IQUA 3C23A 2AGOA 1V4AA 4GC6A 4UAUA 4PGQA 3V72A 3JPTA 4IR9A 4CNQA 2GH1A 1Q3UA 9ICWA 2KEYA 4YMNA 4ECUA 2E3TA 3SD7A 1WWUA 9ICQA 4K98A 3IN5A 2BKEA 4KMOB 4F4WA 2BCVA 1U9LA 4NM1A 2PI5A 1KN5A 1JROA 5BOLA 3UQ2A 3HKZC 2V4RA 1KRPA 8ICWA 2F8LA 4UB3A 2G5HB 4WC4A 1YZ6A 3SZ2A 4ED1A 3UXOA 3NKUA 1Q8KA 3NVWA 4WQKA 1KFTA 1D8LA 1LV5A 8ICHA 3NTUA 4IRKA 3ZDDA 2PFNA 3QX7A 5JUMA 2G07A 5KTQA 2YB4A 3AQNA 3E2EA 2QB1A 3C2LA 7ICIA 9ICPA 5KFLA 4DFPA 5H2FU 3MR5A 9ICEA 5AKKA 2BQ3A 4R65A 5HRFA 1ZQHA 2LM1A 5J0RA 4NM2A 5IIJA 3K75D 1WCNA 7ICUA 4X4RA 2JZBA 1QQ5A 3SV3A 4IL6U 2XGQA 8ICTA 3UMBA 2HHXA 4Y2TA 4K97A 4AT8A 4YN4A 3AUOA 1OUQA 5CR0A 8ICOA 4QZIA 3QU4A 3SENA 4J9NA 3OGUA 1PZNA 4PJ0U 2XO7A 4K4IA 4JB3A 3PR5B 2ALZA 3RRHA 1T8EA 3L3FX 4UB4A 1MIVA 4C4SA 2YMMA 1ZQVA 4QZGA 2BCUA 2KJ8A 3ISDA 1BPBA 2BGWA 5J2CA 1LKYB 2LBOA 5AM2A 1RQLA 3AU6A 3D2NA 2KIWA 4DF4A 3WK8A 2ASLA 4F71A 1UCVA 1IM4A 5HR9A 2JMGA 1GO3F 3B0XA 3T3FA 2PBEA 2BHNA 4WH5A 5GTIU 3N7RC 4P4PA 3GIKA 3PW5A 3RJGA 1X9XA 1NKBA 2PFQA 4M9LA 3V7KA 4C8MA 1UETA 1XNSA 8ICBA 1Z4NA 2DFLA 3EYZA 5HHIA 2P35A 2KFNA 3PMLA 2HMXA 2O5AA 3F53A 1TE2A 4U6PA 7ICHA 3WFOA 3JPPA 3MGVA 2BDPA 2HHWA 1M6YA 4RZRA 1S8OA 3THVA 4DQRA 1X9SA 1UEVA 4I0UA 2R18A 4G3IA 2QARB 3HP6A 1PUZA 5AM5A 5ALPA 4IQVA 1U4BA 1DXSA 4DOBA 4DL6A 4RQNA 3GIIA 1S0OA 3PW7A 4RQ6A 1PVPA 3L4PA 5KG7A 3RAQA 2EDUA 3QNMA 3HKZF 2WAQF 4WC1A 3GIJA 1AQ6A 1JIHA 2ES6A 1KL9A 2FMSA 1Q46A 4M2YA 3QYPA 4MFAA 4JLXA 3WK6A 1OU5A 3K1RB 4QIWF 4US9A 1NK0A 3OVSA 4F50A 5CB1A 4AYBC 4F5PA 2P6UA 5DQGA 3T5JA 4DSLA 4DQIA 1Z4OA 3C28A 1F0MA 7ICRA 4ECVA 1HIWA 4NWIA 4DF8A 1KQQA 3NRZA 5DBCA 3RRGA 4BDPA 2NRWA 3BZCA 2UVWA 4J9PA 2MU2A 4X4SA 5KT3A 3BQ1A 4QJFB 3UPQA 4I2GA 5KFWA 3M7DA 5HRHA 3QZ8A 1MQ2A 1KNYA 4XQ8A 9ICCA 3B9JA 3IDWA 5AKXA 4DWIA 2AGQA 3LQCB 1ZRNA 4PHPA 1XS9D 5AM0A 4BWMA 1XC9A 4ECXA 2DWQA 4M6WB 3TADA 1IG6A 2M2TA 4K4GA 1SZPA 4PPXA 5ALHA 2AHOB 1X9MA 4LVSA 4KX3A 1LB2B 4EEKA 3A0BU 3UQ0A 3TARA 2M0NA 2ZIUB 5J29A 1CRXA 3N7PD 4ZOHC 2AJQA 2QLTA 1ZD2P 1N62A 3ZD9A 2RFFA 2H3VA 5HMLA 2Y9TA 1L3VA 1KBUA 4LT6A 8ICZA 3D6JA 3H7IA 4ECYA 5KT6A 4EZ6A 5EWGA 3RJJA 4PGXA 1ZQUA 1TAUA 1JUDA 5JTGA 5ALKA 1BPXA 1N5WA 3WK9A 4RPYA 2HN1A 2XGPA 3EW9A 3R9KA 4RQ7A 4O3NA 8ICNA 3OJSA 7ICNA 4NXXA 2H3FA 1JALA 4ELTA 5J2GA 1C7YA 3PSPA 2ZXHA 3KD3A 1T7PA 1F5SA 2WHEA 2BCRA 3KKAA 4NLZA 4MKPA 3IRUA 2EZZA 3QUBA 4DOCA 3ISBA 4EENA 1OW5A 2W04A 2Q66A 5KFQA 5DG9A 1L8LA 2EQYA 5KFUA 5KFGA 1XU4A 4FHPA 3WFQE 2YMLA 4NL9C 5KFMA 4S3NA 3H37A 4UD4A 1K1QA 4FHWA 2ZIXB 4FH3A 3NS1A 1ZQZA 4OD0A 2XY7A 4R8UA 3OUYB 4AT7B 1CI4A 3EUB2 3NGDA 3QZ7A 4Q44A 3OVAA 4NLKA 2WF5A 2ZG6A 4O3QA 4DO9A 4GXJA 4YR0A 4CF5A 5ALWA 2K4HA 4BX9C 5L1LA 3UPSA 2WF6A 2OH2A 5FP0A 2V9WA 1NZBA 4KN4A 1SL2A 4RNNA 5HR6A 4O5KA 4UAVA 4R64A 2W9BB 2BR0A 2ZH2A 1TAMA 2PMZC 3OPXA 3QE9Y 4KLOA 2HDOA 4I2BA 2E8MA 3OTQA 3F2CA 5ALRA 3Q8LA 3DV9A 1S76D 2R8HA 4NV0A 4NXTA 4B9LA 1JXEA 5HRKA 5KAIU 4QWCA 1R8CA 9ICLA 2YMQA 4QZ8A 4F4KA 2A19A 3ZI4A 4F93B 4J03A 4RNOA 3HT3A 4YD1A 5J0UA 4P4OA 4B9SA 2XVTA 5KG2A 4NLCA 3M6ZA 2ZIWB 3Q8KA 1QH9A 1RM6C 1WOTA 3ERCC 1SZHA 5AI4A 5AKJA 2R8IA 5AKYA 3UMCA 1JXLA 2CPRA 5ALDA 7ICQA 4PHEA 4JLZA 4YR2A 4J9OA 2OEHA 4B9UA 4KTQA 3SR6A 1QSSA 2GLEA 3WKEA 4PH5A 5CWRA 2W55A 3SI8A 2LHTA 1RDFA 3ZD8A 3MDCA 4F5QA 3F5AA 3K4GA 1COKA 3SEIA 5KFDA 1QCKA 5BPCA 1X6IA 5IINA 4AT7A 1RG6A 2G5IB 1NK9A 2ZH5A 3IP4B 4WC7A 1S0NA 5KAFU 3BQTA 8ICAA 5ALTA 4RWNA 4UBBA 3WU2U 2JZBB 3C2MA 3RB4A 1UHUA 1QLNA 2CXYA 1T94A 2Y0SC 5ALUA 5KFCA 5K4LA 1NO5A 2NRKA 4FS2A 4X5VA 1NKEA 2ZJAA 2VKQA 2W43A 1X42A 1QQ7A 1P7DA 5L1MA 3HW8A 1NJZA 1ZQMA 5J0XA 2XICA 3KHRA 4EBJA 3TFSA 2NRXA 5ALVA 2N1RA 5CP2A 1NOMA 4N7RA 2W9CA 2WB1F 1L7NA 3ZDAA 4F2SA 3AN1A 4UB8U 4WC0A 4LEZA 5J2FA 1B0XA 4JV0A 3PSFA 3HILA 3WKCA 1TAQA 2ZH3A 1J2NA 1JQRA 1ZD5A 4ED6A 4ED0A 1ZJMA 8ICRA 5ALJA 4QNLA 3PR4A 5AKIA 2RQ5A 5KG1A 3RR7A 3NWIA 1SIJA 4EEDA 5D62A 3H4BA 4GC7A 1A0PA 4FBTA 5EWFA 4EBEA 1LVHA 3N4MB 3Q8SB 1O08A 4P2HA 4CF3A 5EOZA 2PI4A 5E79U 4RUAA 1L8OA 3KBBA 2KVCA 4F91B 4Q45A 4LEWA 3MBYA 2W11A 4USAA 4F4YA 5KFXA 2OCEA 2JEFA 4Z6EA 5DGAA 4EGWA 4BUGA 4MEYA 3CYMA 4C8NA 4IR1A 4OAGA 5ALYA 2K4IA 4RU9A 3TFRA 3JYYA 3ED5A 1X9WA 4BWJA 1JX4A 4KMUA 3NUQA 2YX8A 2XIDA 2E1EA 1UPHA 5AK6A 1RQNA 2F8KA 3Q8RB 3T5KA 3MABA 4RQ3A 4X4NA 1SB3C 1SV0A 4NY8A 3O0FA 2I5HA 3GZFA 3PSTA 3SYZA 4DQSA 4NKTA 2MA1A 4UATA 2K60A 3ETLA 5BOMA 2K8AA 4EBCA 4US8A 4DFMA 2ASJA 4UQGA 2HOIA 1BNPA 2P66A 2IUBA 2K4PA 4F5OA 2EAMA 2HOFA 5AIBA 4E7XA 3QEAZ 4KITB 4KLTA 1UA1A 4Y2QA 4DSEA 4QWEA 3TKAA 9ICXA 2H3IA 3RJIA 2BCSA 5DQIA 2RHFA 5KFJA 4DEZA 1ZQLA 1L7MA 1A6SA 4FHYA 4ICAA 2IHNA 4KLQA 1TK8A 2IMWP 3H38A 5B66U 4LEYA 2BBHA 2BPCA 5J0WA 2KVSA 4M5DA 2L5YA 4PL2A 2EAPA 3QU9A 1UEUA 3PHZA 3GILA 2QB0B 2KJ9A 1TVAA 2FPLA 3CP8A 4I2FA 3ZDEA 2J6TA 2EANA 4KLGA 1QSLA 4GIBA 3LVVA 2DKXA 4DCCA 1N63A 5A0LA 2M2VA 5IIMA 4RQ1A 4O0IA 2ZIUA 2Y1IA 3AEVA 1YZ7A 3BS5B 1KSPA 1SL0A 2GAFD 2PXIA 3RAXA 1U49A 2PFOA 1D8YA 1RYUA 3FM9A 5J8YA 4UD5A 8ICMA 3RH5A 3OHBA 3B0YA 4IRCA 1ZJNA 5J2DA 2FLNA 2F44A 2FMQA 5HC9A 4EEYA 5AI5A 4C8OA 9ICHA 1ZQTA 7ICMA 2F1JA 1DGSA 4C80A 1XSNA 3TAPA 2E5SA 4Y2UA 4DLGA 2HN2A 2RRDA 3MDAA 2KP7A 2HSZA 3JPQA 1SGGA 5AK5A 1RZTA 4FZNA 5CEHA 2D6FC 2VA3A 2WB1C 9ICUA 3WKDA 3JZ0A 2HBJA 2E8OA 1BNOA 4J9RA 2NRTA 1Z00A 2ZHAA 1ZQFA 1N5XA 4JWNA 3AQFA 4F72A 3T5LA 4TQRA 2NO4A 2ZHBA 4I2JA 4IQWA 3PW0A 4Y2VA 2LMRA 1TFRA 2CRXA 4LZDA 7ICPA 4LEVA 2QKQA 3H8SA 1K1SA 4HX0A 3OVBA 2KIVA 9ICVA 4KLUA 1VJ5A 2GOLA 5KFYA 2DGZA 5D61A 2F77X 2DR5A 2JEGA 4EV6A 5J0QA 1MA7A 5DB7A 3ICXA 5KL1B 1COOA 5J2IA 1U48A 1NJWA 5EE1A 2HVHA 5ALFA 2HHPA 2F1IA 3QUTA 4RWOA 2A1AA 5DEDA 1R89A 2MRLA 1N2XA 5J2AA 3CW2C 3NVYA 2VJ5A 8ICGA 2OM6A 1BGXT 2XCPA 5CHEA 1S9FA 4X4OA 1TFWA 3AQEA 3KTQA 4K99A 3JPRA 2LYAA 4I29A 3M9MB 9ICBA 1H38A 4Q8EA 1CEZA 3LYSA 4FS1A 4DOAA 3QU7A 4I2AA 4NXZA 5AICA 4RNMA 5D4BA 3PV8A 1ZOLA 4I2DA 1AROP 2OHFA 1F5AA 5AM1A 3M8RA 1MIWA 4O9MA 4YMOA 3OJUA 3RB0A 2ODGA 1F44A 3C21A 4G9BA 4KLDA 4WC6A 4J9LA 2JR5A 3PX0A 1ZD3A 2W7OA 1JI7A 4O3MA 5J0SA 3M9NB 2KMDA 4HYKA 3PVXA 8ICFA 1ED1A 4WC3A 3CNHA 1JN3A 2KNJA 5KFNA 2E1FA 2KKPA 9ICSA 5KFOA 3N7SC 2KFZA 4QZAA 2HCFA 2EH9A 1PK3A 2HBMA 4P0QA 4X4PA 2BQRA 2PFPA 2W8KA 4YG2A 3BZKA 5G5HA 4XRHA 1ZQEA 5HRGA 4QZ9A 2KK0A 4EYIB 2IOFA 2HHSA 4EELA 1NKCA 3QU5A 3PZPA 3VCBA 1HJPA 4M9JA 2DR8A 3JPSA 3RH6A 5KFAA 3FAHA 1JRPA 3GV7B 8ICSA 2YN4A 2ZTDA 1D9DA 1FIQA 1Z00B 1D8BA 4DS4A 7ICTA 1DK3A 4Y2YA 3V7LA 4FFDA 3UM9A 5KFFA 3LWMA 5CFSA 4K96A 4AYBF 5B3PA 8ICXA 4ATBA 2ESEA 4MFCA 2MUTB 4ACOA 2W8LA 4WBYA 2AH5A 4J9SA 3OSNA 4RQMA 5F9LA 2HHUA 3BQ0A 4TUQA 2ZH6A 5D49A 5G5GA 4AP9A 1K5OA 4RQ8A 2VA2A 2HI0A 2ZUBA 1ZQXA 4EYHB 4TUPA 2LPEA 4GXKA 3HIYA 4QZFA 4J9QA 3QUCA 3PO4A 1X66A 2WTFA 3L5KA 1TK0A 4F4XA 4DFKA 2GWSA 2ZIVA 4DL3A 1LKYA 2O6KA 4WC5A 2JHDA 5L1JA 5DB8A 2ATLA 1MQ3A 4P0QB 4I2CA 3AMZA 4ELVA 3MR2A 5AK3A 2WF8A 1V97A 3OWGA 5ALMA 1PX5A 5IIKA 4QW8A 3E58A 5ALNA 1YLQA 2IHOA 4YFKA 3I1YA 7ICVA 2E8PA 5AI9A 2UVVA 2OYYA 1Z1BA 3OSPA 3A0HU 4Q43A 5DDYA 3HWTA 2KSOB 3IM1A 2P6RA 4GLXA 2ZH1A 2J6SA 5ALZA 1KW4A 3GQCA 4DLEA 2B21A 3AQMA 2C22A 5KFPA 3PX4A 8ICUA 4O67A 1NJYA 4XQ7A 1X2IA 5L1IA 4RPXA 1L7OA 9ICJA 3FDSA 4RUCA 2R8GA 1ZD4A 5KL8B 3HJ1A 3Q8MA 5DGBA 5DLFA 5C0YA 5KG6A 3IHQB 2MUTA 2LM4A 4OJ6A 3AM9A 3GU3A 4F3OA 2O1PA 2ZXIA 2W9MA 3V6HA 2JH1A 2A3VA 5D63A 5J0YA 2ZIVB 4OAHA 2DQNB 3U26A 1SL1A 3EPIA 1ZQIA 4FO1A 2M2UA 2VIXA 1XO0A 5HR7A 5HRBA 4R8UB 3C5FA 2H3ZA 4IG8A 3Q8PB 5DDMA 8ICKA 1ZETA 4QWBA 5KT2A 4QZDA 4BJQA 2VANA 3KZXA 4I2IA 3RJEA 4ECQA 1NZPA 3H4DA 3M8SA 3TANA 1L3UA 5ALOA 2FLLA 1XSPA 4YXMA 4YD2A 7ICOA 4I2HA 2Y0SF 4RQ4A 1IV8A 2KICA 3C1ZA 4M9NA 4DL5A 5DB9A 3RJHA 5KT4A 1NJXA 2AXTU 4WCWA 5IIIA 4ELUA 4M47A 2IHMA 3HRDD 4WBZA 3LDAA 5TZVA 2FI1A 4R66A 4QWDA 4Y2PA 5AKGA 1T3QA 2BQUA 1ZQNA 4KX5A 1N61A 1FFUA 2KN7A 3C18A 2AQ0A 4WOYA 7ICEA 4OO1J 1R8BA 2HHTA 4DSJA 1J2MA 1KDHA 4KLLA 4OJPA 3EPGA 1Y88A 3BDPA 5DB6A 5J0TA 4RQ5A 3TAQA 5J8YC 1HEKA 1WG8A 5CRXA 5J2BA 2G09A 3WK4A 2KJ5A 2ZJ5A 5ALEA 3OUYA 2HOQA 2B0CA 1D9FA 3UXPA 4GXIA 5DBBA 3SV4A 4E0DA 1SXDA 2HHQA 4ZH4A 5AI8A 1WWVA 4ED2A 2C2DA 2F76X 1ZQBA 2KTQA 4Y2SA 2HHVA 2WAQC 4C8KA 2G06A 2D3DA 3AQKA 2JEIA 2W9BA 5HMMA 4ECRA 4DL7A 3EWAA 3H8MA 1DK2A 5AIAA 3T79A 3PW4A 4KLHA 1UA0A 4JWMA 4DFJA 4IC9A 3K7DA 5ALQA 1YT3A 4DSFA 5DG7A 4I28A 2ASDA 3ZDBA 1RYRA 3EF2A 1QTMA 1Q79A 5IILA 4O5EA 2JRZA 4JMUA 4MF8A 2HW3A 1ZQ1C 5HRIA 3CRXA 4TQSA 3MR6A 1NK6A 1ZQRA 4UB5A 4PGYA 3V7JA 4X4UA 4C4RA 5HRDA 2ZH7A 2FLPA 2XCAA 3V6JA 3EZ5A 3JPNA 2B6GA 3ER8C 3G6XA 3IG5A 1PK1B 4EX7A 4NKUA 3LVWA 1ZQCA 5TISU 1PVRA 2LYHA 4PL1A 4ED3A 5F2VO 3H8WA 2KE7A 1SXEA 4PHDA 4KM5A 4QZBA 2KKVA 2ZH8A 3ETRA 2YQEA 3RB6A 3I28A 3RBEA 4FH5A 1HUOA 2JGAA 4OJ5A 2KG5A 4FBUA 3QU2A 4WJ3B 3SAHA 4IS7A 1ZQSA 4YP3A 1GPJA 1ZQAA 3M9OB 1IXRA 4BXOA 2AGPA 9ICNA 4WC2A 2JXJA 4P0PA 4FE3A 5KFEA 1PVQA 4NJ8A 4Z6CA 1S77D 3RTVA 1FEZA 1ZXIA 2Y9UA 5KFKA 2ISOA 3JPOA 2KZZA 2DBYA 1VFGA 3C1YA 5AI6A 1FFVA 4LJXA 3FC4A 3KZIU 4K9AA 3D2QA 1MC8A 7ICJA 1B22A 3KHGA 4M04A 9ICOA 2WF9A 4P4MA 4O3RA 2HVIA 4FO6A 9ICKA 2C28A 3RJKA 5J0PA 3MR3A 2M2WA 2CN1A 1Z3EB 2JH7A 4X0BA 2F1HA 4C7ZA 1CUKA 2RDIA 2Z7JA 5GTHU 4J9KA 1ECWA 3NYBA 2EZYA 4YVZA 4HAIA 1NK7A 4ECZA 2D8CA 1TV9A 3N28A 4F5NA 7ICLA 4EX6A 5J2KA 8ICLA 5CFTA 1S5LU 4NXUA 4JUZA 2VA8A 3MCRA 3HJEA 2W3SA 1SKRA 2YB1A 1NK8A 4NLGA 4R63A 4CF4A 1SV4A 1B43A 3H40A 2DL0A 4MFFA 4B9MA 8ICIA 2ZIWA 2XI9A 5AKEA 5ALIA 5ALXA 1N48A 2ZH4A 5IIOA 2JV3A 4ECSA 2ZTEA 2BBJA 5EE0A 3VC8A 3LK9A 4QIWC 1N60A 3KHHA 4ATBB 1NK5A 4QW9A 1JMSA 3F2BA 8ICVA 3MFHA 4TUSA 4DFDA 4QZEA 2BE3A 3NRWA 1SKWA 2WF7A 2A1JB 4YXJA 4JV2A 5AHXA 4Z6DA 5AK4A 4UB2A 4A8EA 8ICQA 1XO1A 4WQLA 4CCHA 4NXVA 2IA6A 1U45A 4M6WA 1V38A 3GIMA 2J6UA 5KFSA 3OHAA 3DEEA 3RB3A 4KB6A 4X4VA 2DRAA 4MEXA 3IG8A 3WK7A 4RPZA 3PY8A 5C5JA 2NYVA 4PZNA 9ICAA 4KLEA 3DDHA 4RT3A 1C20A 3HJ4A 3C2KA 5KG3A 2UVUA 3KOOA 4M9GA 1UT5A 3E0FA 5EE9A 5KG0A 4F5RA 2I9GA 1BVSA 2F3NA 4EZ9A 4DQQA 2YMPA 3RF9A 1ZQJA 1FA0A 4O69A 2BCQA 1MN8A 3K1ZA 4K4HA 4Y2XA 4PZOA 4OJLA 3F2DA 2I6XA 3PO5A 5HP4A 4AT8B 3C66A 1TFYA 2HBKA 5CHGA 2RP5A 4PHAA 3C29A 4DL4A 2G08A 4OJOA 4UBCA 3WFRE 4UB1A 3NVZA 1S97A 2K89A 5DG8A 1ZQWA 4OAFA 2DUYA 3BJYA 1TKDA 1UT8A 4DQPA 5AI0A 2DF4B 4F2RA 4EP7A 3JCFA 1SWWA 4J9MA 4UAYA 3H0RB 3SAGA 4FZMA 4C4TA 3L9DA 5KFIA 4O5CA 4YQWA 4MF2A 4Z6FA 3WK5A 1XSLA 4Q8FA 4X4QA 3Q8QB 8ICYA 2XY5A 9ICMA 1X40A 2E8NA 2QARA 5L9XA 5KFHA 2Y1JA 9ICTA 2B4VA 2ZJ8A 5J0OA 3IV6A 3QXGA 5KG5A 3RR8A 3CK6A 4X4TA 2R8KA 2ID1A 2FE9A 3S6JA 3GV5B 3QEBZ 2K4EA 1N56A 2KSOA 5AM4A 3G6YA 4FHVA 1NK4A 4KLJA 2Q4TA 2KHVA 5CFUA 5AM3A 3H39A 2XY6A 1URJA 2GO7A 4F8RA 1BPZA 3J81j 2W9CB 1KFDA 3D2SA 1DRGA 1NNLA 3UXNA 1L6NA 7ICSA 1ZQKA 4NXWA 3GDXA 4YCXA 5HHHA 4XA5A 1FO4A 4AT9B 4ED7A 3H0LB 1S10A 5JU5A 3KFUF 4EBDA 5J2EA 1L7PA 2PMZF 4LZGA 4YR3A 1IIPA 2XC9A 1VLBA 2H5XA 2RLTA 5B5EU 2LI6A 5D46A 2V4QA 1RXWA 3PNCA 2ZTCA 5L1KA 1WYGA 2JEJA 2ZUDA 2KZMA 1HUZA 1WUDA 3NVVA 3MGHA 5ALGA 3N97B 2DRBA 3GFKB 1SWVA 4F4ZA 1B4FA 1BPDA 4UARA 3ER9B 1QQ6A 2I1QA 3HX0A 1NI3A 4UB6U 4RT2A 4BXOB 3H3AA 1J97A 4JV1A 5F3XB 1TK5A 1S0VA 4FZLA 1L5UA 4DSKA 2FMPA 5KFTA 3C5GA 3AU2A 2EZXA 2FCLA 5JTIA 8ICPA 4EEBA 1ZQYA 2OXOA 2QB0A 5J2HA 1MIYA 3SMVA 3T5HA 1UQVA 3HPOA 1V9PA 1L3TA 4NLNA 5J2JA 2UVRA 4B9VA 3AL0B 1ZYQA 4C7YA 3TACB 5AKLA 5KNIA 2F2AB 3SQIA 8ICEA 4O68A 2EAOA 1O03A 4EBKA 4CE6A 4B6JA 5F9NA 2BPFA 2PKEA 4U7CA 4QZHA 3UMGA 4RQ0A 3BQ2A 4AT9A 3M1YA 1X6JA 1T3NA 7ICKA 4ED8A 3BS7A 2NV3A 4DL2A 2MAXA 3H0MB 2EWRA 1Q78A 3M6KA 1WCLA 4M0AA 2DKZA 3RBDA 2Q0ZX 3OV7A 9ICIA 4ECWA 3BS5A 3QUQA 4Y2RA 3GV8B 5B3QA 3TADC 1A76A 2KV2A 4YMMA 3KHLA 4I27A 1U47A 3WKAA 5CJ7A 5ALSA 2ZIXA 2DPJA 4O3PA 2YTUA 3I76A 2K8CB 5DBAA 2W7PA 4K9BA 5ALLA 2BDUA 4Y2JA 3ORYA 5AKZA 2KOBA 4K8VA 5DKWA 1L3SA 7ICGA 2IBKA 1RPLA 1JAJA 5JRTA 4UAZA 4P0PB 4OAIZ 1Z19A 5KFZA 4RWPA 2A1JA 3AQLA 2DR7A 3PX6A 4B9NA 4RQ2A 2KD1A 3ZDCA 2M9NA 5KT5A 1Z1VA 4CGZA 4E8FA 4M9HA 2G0AA 4UW9A 1S0MA 4KLIA 3WFPA 1EXNA 4UAWA 5HRLA 5KFRA 3RFAA 1R8AA 2W03A 4RWQA 2ZH9A 3LWLA 5KFBA 1T4GA 4GFJA 5EWEA 4XJEA 4B9TA 4O6AA 3SAFA 4KLFA 5DLGA 2W54A 1KEJA 1ZRMA 1VDVA 4DSIA 2AQ4A 4X0AA 2B51A 1V85A 2FPKA 3WFSC 1KTQA 4TURA 1ZQPA 9ICGA 2BZFA 5KT7A 1KLNA 2R8JA 1Q3VA 2LYBA 2NRZA 4KN7A 3RJFA 5EE3A 1SKSA 4C0ZA 2BPGA 5HREA 1PK1A 1VJ7A 3MC1A 1BPEA 1KFSA 1OXJA 4JK1A 5CA7A 4I2EA 4FHXA 1ZQDA 9ICRA 2C2RA 3V6KA 3NVOA 4E80A 2IOFK 3TQ1A 4OCZA 2H3QA 4QWAA 4O3SA 1MSWD 3TI0A 4XUSA 3BQ7A 4ECTA 2AU0A 2OWOA 1A77A 5DECA 4F92B 3ALRA 3F5EA 8ICJA 3KKAC 3ONNA 4C8LA 2DR9A 4BGDA 1RXVA 2LKYA 3FYHA 1BPYA 3H8JA 1QSYA 5KG4A 3ISCA 1XWLA 2ISPA 2NRVA 1ZQOA 1RYSA 2NO5A 4O3OA 8ICCA 1DGJA 3PMNA 2KZ3A 2K8BB 2W3RA 2ZUCA 5HNKA 2RDJA 5DQHA 3RH4A 7ICFA 4NL9A 4IRDA 1SV0C 2FPMA 2KHQA 2IOHA 2WFAA 2VJ4A 2YY6A 4DS5A 2FJ6A 2DPIA 3MGIA 2MSNA 4KLSA 2C2EA 4NLBA 2W9AA 9ICFA 1ZQQA 4MHVA 1KKXA 3PSIA 5T14A
chains in the Genus database with same CATH topology
4CCHA 3RH6A 3HT3A 5KFAA 3GV7B 8ICSA 2IA6A 4YD1A 1U45A 5J0UA 4M6WA 2ZTDA 4P4OA 4B9SA 1D9DA 5KG2A 3GIMA 1Z00B 4KLMA 4DS4A 3G6VA 3Q8KA 5KFSA 2J6UA 7ICTA 1WOTA 3MFIA 1DK3A 1ZQGA 3OHAA 3V7LA 2R8IA 2DVIA 3RB3A 4QZCA 4IQTA 1JXLA 5KFFA 3LWMA 7ICQA 4X4VA 2DRAA 1DOQA 4MEXA 4PHEA 3PW2A 3PY8A 4RPZA 5KFVA 4YR2A 5C5JA 4J9OA 4IQUA 3C23A 4B9UA 4KTQA 9ICAA 4KLEA 2AGOA 1QSSA 8ICXA 1V4AA 4GC6A 4ATBA 4MFCA 2MUTB 4PH5A 5CWRA 2W8LA 4RT3A 3HJ4A 4PGQA 3V72A 4WBYA 3JPTA 3C2KA 3SI8A 4IR9A 4IG8A 5KG3A 4J9SA 2UVUA 3OSNA 4M9GA 3ZD8A 1UT5A 5KG0A 5F9LA 3MDCA 4TUQA 3BQ0A 4F5QA 4YMNA 4F5RA 3K4GA 1BVSA 4ECUA 5D49A 2I9GA 2ZH6A 5KFDA 9ICQA 4RQ8A 4EZ9A 2VA2A 2ZUBA 5BPCA 4DQQA 2BKEA 5IINA 1ZQXA 4F4WA 1ZQJA 1FA0A 4EYHB 4TUPA 2BCVA 2BCQA 1U9LA 4AT7A 4GXKA 4K4HA 1NK9A 4NM1A 4QZFA 3HIYA 4J9QA 2PI5A 3PO4A 2WTFA 2ZH5A 5BOLA 1TK0A 4WC7A 4F4XA 3UQ2A 1S0NA 3PO5A 4DFKA 2V4RA 2GWSA 5HP4A 1KRPA 3BQTA 8ICWA 4AT8B 4UB3A 8ICAA 4DL3A 3C66A 4RWNA 4UBBA 1TFYA 2JZBB 5CHGA 4DL4A 4PHAA 3C2MA 4WC5A 3RB4A 5L1JA 5DB8A 4UBCA 2ATLA 1MQ3A 1QLNA 4WC4A 3WFRE 4UB1A 4I2CA 3SZ2A 1S97A 4ED1A 4ELVA 3UXOA 5KFCA 5DG8A 1NO5A 1ZQWA 3MR2A 2NRKA 4FS2A 4X5VA 1NKEA 2ZJAA 3BJYA 5IIKA 1TKDA 1PX5A 4ELUA 1UT8A 4QW8A 1D8LA 1LV5A 1KFTA 8ICHA 4DQPA 3NTUA 1YLQA 4IRKA 3HW8A 3ZDDA 1NJZA 2PFNA 4YFKA 5JUMA 5J0XA 3KHRA 1ZQMA 4F2RA 4EBJA 4EP7A 3TFSA 2NRXA 5KTQA 4J9MA 5CP2A 1NOMA 7ICVA 4UAYA 2W9CA 3AQNA 2UVVA 3ZDAA 4F2SA 3E2EA 3OSPA 3C2LA 7ICIA 9ICPA 4WC0A 5J2FA 5KFLA 3L9DA 5KFIA 4JV0A 4O5CA 4YQWA 4DFPA 4Z6FA 4MF2A 4Q43A 1XSLA 1TAQA 5DDYA 3MR5A 4Q8FA 2ZH3A 4X4QA 3Q8QB 2BQ3A 9ICEA 8ICYA 4R65A 3HWTA 3IM1A 2XY5A 2P6RA 9ICMA 1JQRA 5HRFA 4ED6A 5J0RA 4GLXA 4ED0A 1ZQHA 4NM2A 5IIJA 2J6SA 2ZH1A 1ZJMA 3K75D 8ICRA 3PR4A 5L9XA 3GQCA 5KFHA 1WCNA 4DLEA 2Y1JA 7ICUA 5KG1A 9ICTA 2JZBA 3RR7A 4X4RA 2B21A 3SV3A 2C22A 3AQMA 5KFPA 2ZJ8A 2XGQA 5J0OA 3PX4A 1NJYA 1X2IA 5L1IA 8ICTA 8ICUA 3H4BA 2HHXA 4GC7A 4FBTA 4AT8A 4RPXA 4YN4A 3AUOA 3WFSC 5KG5A 3RR8A 9ICJA 5EWFA 3FDSA 5CR0A 8ICOA 4RUCA 4EBEA 2R8KA 2R8GA 2ID1A 4QZIA 3N4MB 3Q8SB 4P2HA 4J9NA 5EOZA 3HJ1A 3GV5B 3OGUA 3QEBZ 5DGBA 3Q8MA 2PI4A 1PZNA 1N56A 4RUAA 5DLFA 5KG6A 3G6YA 4FHVA 3IHQB 4F91B 1NK4A 2MUTA 4Q45A 4F3OA 4KLJA 2XO7A 4K4IA 2O1PA 2W9MA 3MBYA 4F4YA 3V6HA 2XY6A 3H39A 5J0YA 3PR5B 5KFXA 4F8RA 2JEFA 1SL1A 1BPZA 4Z6EA 3EPIA 5DGAA 2W9CB 1KFDA 2ALZA 1ZQIA 3RRHA 1T8EA 3UXNA 4UB4A 2M2UA 4MEYA 1MIVA 7ICSA 5HRBA 4R8UB 1ZQKA 3GDXA 1ZQVA 4YCXA 4QZGA 4XA5A 5HHHA 3C5FA 4C8NA 2BCUA 3Q8PB 5DDMA 4ED7A 3ISDA 4IR1A 1BPBA 1ZETA 8ICKA 4QWBA 1S10A 4RU9A 3TFRA 5J2CA 2BGWA 3JYYA 5KT2A 4EBDA 5J2EA 4QZDA 1X9WA 2VANA 4BWJA 1JX4A 3AU6A 4KMUA 4DF4A 4LZGA 4I2IA 2ASLA 4YR3A 3RJEA 2XC9A 1IM4A 5HR9A 2H5XA 3B0XA 4ECQA 3T3FA 1NZPA 2PBEA 2BHNA 3H4DA 3Q8RB 3M8SA 3TANA 1L3UA 5D46A 2V4QA 2FLLA 1XSPA 4P4PA 3MABA 3GIKA 3T5KA 4RQ3A 3PW5A 3RJGA 4YXMA 4YD2A 4X4NA 1RXWA 1NKBA 2PFQA 3PNCA 7ICOA 4M9LA 2ZTCA 5L1KA 2JEJA 3V7KA 4C8MA 4I2HA 2ZUDA 2KZMA 1UETA 4NY8A 4RQ4A 8ICBA 1HUZA 2DFLA 3C1ZA 3MGHA 3EYZA 3SYZA 4DQSA 5HHIA 4M9NA 4NKTA 4DL5A 2KFNA 3ETLA 3PMLA 3N97B 5DB9A 5BOMA 2O5AA 2DRBA 3RJHA 5KT4A 1NJXA 4EBCA 7ICHA 4WCWA 3WFOA 4DFMA 5IIIA 3JPPA 4UQGA 2ASJA 3GFKB 2IHMA 2BDPA 2P66A 4RZRA 3LDAA 4F4ZA 4F5OA 4M47A 1BNPA 4WBZA 1BPDA 5TZVA 4E7XA 2I1QA 3THVA 4R66A 4DQRA 4KITB 3QEAZ 1X9SA 3HX0A 4KLTA 1UEVA 4QWDA 1UA1A 4RT2A 2BQUA 1ZQNA 4G3IA 3HP6A 4BXOB 2KN7A 3C18A 3H3AA 2AQ0A 7ICEA 4JV1A 1R8BA 4DSEA 2HHTA 4QWEA 4DSJA 4IQVA 1U4BA 1TK5A 3RJIA 1S0VA 9ICXA 1KDHA 2BCSA 4KLLA 5HRGA 5DQIA 3EPGA 4DOBA 4DL6A 1L5UA 5KFJA 4DSKA 3GIIA 2FMPA 1Y88A 5KFTA 4DEZA 1ZQLA 3C5GA 3AU2A 3PW7A 1S0OA 3BDPA 5DB6A 5J0TA 8ICPA 4RQ6A 1ZQYA 5J2HA 1MIYA 4FHYA 2IHNA 5KG7A 4KLQA 3RAQA 3T5HA 1TK8A 2IMWP 4RQ5A 3HPOA 1V9PA 1L3TA 4NLNA 3TAQA 3H38A 5J2JA 5J2BA 2UVRA 4B9VA 1ZYQA 4WC1A 3GIJA 2BPCA 5J0WA 4M5DA 2ZJ5A 3OUYA 1JIHA 2FMSA 4M2YA 1D9FA 4MFAA 1UEUA 3UXPA 4GXIA 5DBBA 3SV4A 8ICEA 3GILA 4E0DA 1OU5A 2HHQA 4ZH4A 1TVAA 1NK0A 2FPLA 4EBKA 3OVSA 4F50A 3ZDEA 4I2FA 2J6TA 5CB1A 4ED2A 2C2DA 4KLGA 1QSLA 1ZQBA 2KTQA 5F9NA 2BPFA 2HHVA 4F5PA 2P6UA 5DQGA 3T5JA 4C8KA 4DSLA 4WC2A 4DQIA 4QZHA 2JEIA 2M2VA 4RQ0A 3BQ2A 3AQKA 2W9BA 4AT9A 5IIMA 5HMMA 4RQ1A 4ECRA 4O0IA 4DL7A 2Y1IA 7ICRA 3EWAA 4ECVA 1T3NA 1DK2A 7ICKA 3PW4A 4ED8A 4DF8A 4KLHA 5DBCA 1UA0A 3RRGA 4BDPA 4DFJA 4JWMA 4DL2A 2MAXA 1KSPA 1Q78A 4DSFA 1SL0A 5DG7A 4I28A 2ASDA 3ZDBA 2NRWA 1RYRA 2UVWA 4J9PA 4AT9B 1WCLA 4M0AA 1QTMA 1Q79A 4X4SA 5KT3A 3BQ1A 2PXIA 5IILA 3RBDA 3RAXA 4MF8A 3UPQA 2Q0ZX 4O5EA 2HW3A 1U49A 5HRIA 3OV7A 4TQSA 9ICIA 3MR6A 4I2GA 4ECWA 1NK6A 5KFWA 2PFOA 5HRHA 3QZ8A 1MQ2A 1ZQRA 4UB5A 1D8YA 4PGYA 1KNYA 3V7JA 4X4UA 4UD5A 3GV8B 4XQ8A 8ICMA 9ICCA 3RH5A 4YMMA 1A76A 3OHBA 3KHLA 2FLPA 5HRDA 2ZH7A 4DWIA 2AGQA 3LQCB 3B0YA 4I27A 1U47A 1ZJNA 4IRCA 5J2DA 4PHPA 2XCAA 1XS9D 2FLNA 4BWMA 5CJ7A 3EZ5A 3JPNA 4ECXA 3V6JA 1XC9A 2FMQA 5HC9A 3G6XA 4EEYA 2DPJA 9ICHA 4O3PA 4C8OA 4M6WB 1ZQTA 4NKUA 1ZQCA 7ICMA 2F1JA 1SZPA 4K4GA 4PPXA 2M2TA 1DGSA 2LYHA 4ED3A 1XSNA 1X9MA 5DBAA 4LVSA 5F2VO 3H8WA 1LB2B 3TAPA 4PHDA 3UQ0A 4DLGA 3TARA 3MDAA 3ORYA 5J29A 4QZBA 2KP7A 2ZH8A 3JPQA 3RB6A 1RZTA 5DKWA 2AJQA 1L3SA 3RBEA 2VA3A 2IBKA 1HUOA 7ICGA 3ZD9A 9ICUA 2RFFA 4FH5A 1RPLA 5HMLA 4FBUA 1L3VA 3JZ0A 1JAJA 4LT6A 4UAZA 1ZQSA 4YP3A 8ICZA 1BNOA 1ZQAA 5KFZA 2NRTA 4J9RA 3H7IA 3M9OB 2A1JA 3AQLA 4ECYA 4RWPA 5KT6A 4EZ6A 5EWGA 1IXRA 2DR7A 3RJJA 1Z00A 4PGXA 4BXOA 2ZHAA 3PX6A 4B9NA 1ZQFA 4RQ2A 1ZQUA 2AGPA 3ZDCA 4JWNA 2M9NA 5KT5A 1BPXA 1TAUA 9ICNA 4M9HA 5KFEA 4E8FA 3T5LA 4TQRA 2ZHBA 4RPYA 4Z6CA 4I2JA 2XGPA 4IQWA 1S0MA 1S77D 3RTVA 4KLIA 3PW0A 2HHWA 1TFRA 3WFPA 1EXNA 3EW9A 5KFKA 4UAWA 4LZDA 4RQ7A 4O3NA 3JPOA 2ISOA 2KZZA 8ICNA 7ICPA 5HRLA 3OJSA 3H8SA 1K1SA 5KFRA 7ICNA 3C1YA 1VFGA 3OVBA 9ICVA 1R8AA 4KLUA 4RWQA 4ELTA 5J2GA 2ZH9A 3LWLA 5KFBA 1C7YA 1T4GA 1MC8A 7ICJA 5EWEA 5KFYA 3KHGA 1B22A 4B9TA 4M04A 9ICOA 2DR5A 2JEGA 4X4TA 4P4MA 1T7PA 4O3RA 5J0QA 4FO6A 5DB7A 2HVIA 9ICKA 4KLFA 1COOA 5J2IA 2C28A 5DLGA 1U48A 1NJWA 3RJKA 2HVHA 1KEJA 2HHPA 2BCRA 5J0PA 2F1IA 4DSIA 2AQ4A 3MR3A 4NLZA 2M2WA 4RWOA 4X0AA 1Z3EB 4X0BA 2F1HA 1CUKA 2FPKA 1R89A 5DEDA 2RDIA 3ISBA 1KTQA 4DOCA 4TURA 1ZQPA 5J2AA 4J9KA 9ICGA 4XQ7A 3NYBA 8ICGA 4YVZA 1BGXT 5KT7A 1KLNA 2R8JA 2Q66A 5KFQA 5DG9A 2XCPA 1NK7A 4ECZA 1S9FA 1TV9A 4X4OA 1TFWA 5KFUA 4F5NA 3KTQA 5KFGA 3JPRA 4I29A 7ICLA 3M9MB 9ICBA 1H38A 1XU4A 5J2KA 4Q8EA 4FHPA 8ICLA 2NRZA 4KN7A 1CEZA 3RJFA 3WFQE 5KFMA 4S3NA 1SKSA 3H37A 4UD4A 1K1QA 4FHWA 4FS1A 2BPGA 5HREA 4DOAA 4JUZA 4I2AA 4FH3A 1VJ7A 2VA8A 1BPEA 4NXZA 1KFSA 1ZQZA 4RNMA 5D4BA 2XY7A 3PV8A 4JK1A 4R8UA 5CA7A 1NK8A 1SKRA 4I2EA 4FHXA 4I2DA 3OUYB 4AT7B 4NLGA 3NGDA 3QZ7A 1AROP 4Q44A 4R63A 1ZQDA 2C2RA 9ICRA 3OVAA 3V6KA 4NLKA 1B43A 4O3QA 3H40A 4E80A 4DO9A 1F5AA 4GXJA 4YR0A 3M8RA 1MIWA 3TQ1A 4MFFA 4O9MA 4QWAA 4O3SA 1MSWD 4YMOA 5L1LA 3OJUA 3TI0A 4B9MA 3UPSA 4XUSA 3RB0A 8ICIA 2V9WA 4ECTA 2AU0A 2OWOA 1A77A 4KN4A 4F92B 5DECA 1SL2A 8ICJA 4RNNA 4C8LA 2DR9A 4O5KA 4BGDA 4R64A 3C21A 2W9BB 1N48A 1RXVA 4J9LA 4KLDA 4WC6A 2ZH4A 3FYHA 5IIOA 2BR0A 3PX0A 1BPYA 4ECSA 2ZH2A 3H8JA 1QSYA 2ZTEA 2HHUA 5KG4A 3ISCA 1XWLA 5J0SA 3M9NB 2ISPA 2NRVA 3QE9Y 3LK9A 1ZQOA 4KLOA 4HYKA 3KHHA 1RYSA 4I2BA 4ATBB 1NK5A 4O3OA 4QW9A 1JMSA 3PVXA 8ICVA 3PMNA 8ICFA 8ICCA 2KZ3A 4WC3A 3MFHA 3Q8LA 1S76D 2ZUCA 1JN3A 5HNKA 2R8HA 4TUSA 2RDJA 5DQHA 3RH4A 1JXEA 4B9LA 7ICFA 5KFNA 4IRDA 4QZEA 2BE3A 5HRKA 2FPMA 9ICSA 5KFOA 4QWCA 1SKWA 4DS5A 2KFZA 4QZAA 2DPIA 1R8CA 4X4PA 3MGIA 2BQRA 2PFPA 2A1JB 4YG2A 4YXJA 2W8KA 4JV2A 4KLSA 2C2EA 9ICLA 4XRHA 4Z6DA 4QZ8A 4QZ9A 4UB2A 2W9AA 1ZQEA 9ICWA 4F4KA 4EYIB 8ICQA 9ICFA 2HHSA 1ZQQA 1NKCA 1XO1A 4F93B 1HJPA 4M9JA 4RNOA 2DR8A 3JPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CCH A;  3RH6 A;  3HT3 A;  5KFA A;  3GV7 B;  8ICS A;  2IA6 A;  4YD1 A;  1U45 A;  5J0U A;  4M6W A;  2ZTD A;  4P4O A;  4B9S A;  1D9D A;  5KG2 A;  3GIM A;  1Z00 B;  4KLM A;  4DS4 A;  3G6V A;  3Q8K A;  5KFS A;  2J6U A;  7ICT A;  1WOT A;  3MFI A;  1DK3 A;  1ZQG A;  3OHA A;  3V7L A;  2R8I A;  2DVI A;  3RB3 A;  4QZC A;  4IQT A;  1JXL A;  5KFF A;  3LWM A;  7ICQ A;  4X4V A;  2DRA A;  1DOQ A;  4MEX A;  4PHE A;  3PW2 A;  3PY8 A;  4RPZ A;  5KFV A;  4YR2 A;  5C5J A;  4J9O A;  4IQU A;  3C23 A;  4B9U A;  4KTQ A;  9ICA A;  4KLE A;  2AGO A;  1QSS A;  8ICX A;  1V4A A;  4GC6 A;  4ATB A;  4MFC A;  2MUT B;  4PH5 A;  5CWR A;  2W8L A;  4RT3 A;  3HJ4 A;  4PGQ A;  3V72 A;  4WBY A;  3JPT A;  3C2K A;  3SI8 A;  4IR9 A;  4IG8 A;  5KG3 A;  4J9S A;  2UVU A;  3OSN A;  4M9G A;  3ZD8 A;  1UT5 A;  5KG0 A;  5F9L A;  3MDC A;  4TUQ A;  3BQ0 A;  4F5Q A;  4YMN A;  4F5R A;  3K4G A;  1BVS A;  4ECU A;  5D49 A;  2I9G A;  2ZH6 A;  5KFD A;  9ICQ A;  4RQ8 A;  4EZ9 A;  2VA2 A;  2ZUB A;  5BPC A;  4DQQ A;  2BKE A;  5IIN A;  1ZQX A;  4F4W A;  1ZQJ A;  1FA0 A;  4EYH B;  4TUP A;  2BCV A;  2BCQ A;  1U9L A;  4AT7 A;  4GXK A;  4K4H A;  1NK9 A;  4NM1 A;  4QZF A;  3HIY A;  4J9Q A;  2PI5 A;  3PO4 A;  2WTF A;  2ZH5 A;  5BOL A;  1TK0 A;  4WC7 A;  4F4X A;  3UQ2 A;  1S0N A;  3PO5 A;  4DFK A;  2V4R A;  2GWS A;  5HP4 A;  1KRP A;  3BQT A;  8ICW A;  4AT8 B;  4UB3 A;  8ICA A;  4DL3 A;  3C66 A;  4RWN A;  4UBB A;  1TFY A;  2JZB B;  5CHG A;  4DL4 A;  4PHA A;  3C2M A;  4WC5 A;  3RB4 A;  5L1J A;  5DB8 A;  4UBC A;  2ATL A;  1MQ3 A;  1QLN A;  4WC4 A;  3WFR E;  4UB1 A;  4I2C A;  3SZ2 A;  1S97 A;  4ED1 A;  4ELV A;  3UXO A;  5KFC A;  5DG8 A;  1NO5 A;  1ZQW A;  3MR2 A;  2NRK A;  4FS2 A;  4X5V A;  1NKE A;  2ZJA A;  3BJY A;  5IIK A;  1TKD A;  1PX5 A;  4ELU A;  1UT8 A;  4QW8 A;  1D8L A;  1LV5 A;  1KFT A;  8ICH A;  4DQP A;  3NTU A;  1YLQ A;  4IRK A;  3HW8 A;  3ZDD A;  1NJZ A;  2PFN A;  4YFK A;  5JUM A;  5J0X A;  3KHR A;  1ZQM A;  4F2R A;  4EBJ A;  4EP7 A;  3TFS A;  2NRX A;  5KTQ A;  4J9M A;  5CP2 A;  1NOM A;  7ICV A;  4UAY A;  2W9C A;  3AQN A;  2UVV A;  3ZDA A;  4F2S A;  3E2E A;  3OSP A;  3C2L A;  7ICI A;  9ICP A;  4WC0 A;  5J2F A;  5KFL A;  3L9D A;  5KFI A;  4JV0 A;  4O5C A;  4YQW A;  4DFP A;  4Z6F A;  4MF2 A;  4Q43 A;  1XSL A;  1TAQ A;  5DDY A;  3MR5 A;  4Q8F A;  2ZH3 A;  4X4Q A;  3Q8Q B;  2BQ3 A;  9ICE A;  8ICY A;  4R65 A;  3HWT A;  3IM1 A;  2XY5 A;  2P6R A;  9ICM A;  1JQR A;  5HRF A;  4ED6 A;  5J0R A;  4GLX A;  4ED0 A;  1ZQH A;  4NM2 A;  5IIJ A;  2J6S A;  2ZH1 A;  1ZJM A;  3K75 D;  8ICR A;  3PR4 A;  5L9X A;  3GQC A;  5KFH A;  1WCN A;  4DLE A;  2Y1J A;  7ICU A;  5KG1 A;  9ICT A;  2JZB A;  3RR7 A;  4X4R A;  2B21 A;  3SV3 A;  2C22 A;  3AQM A;  5KFP A;  2ZJ8 A;  2XGQ A;  5J0O A;  3PX4 A;  1NJY A;  1X2I A;  5L1I A;  8ICT A;  8ICU A;  3H4B A;  2HHX A;  4GC7 A;  4FBT A;  4AT8 A;  4RPX A;  4YN4 A;  3AUO A;  3WFS C;  5KG5 A;  3RR8 A;  9ICJ A;  5EWF A;  3FDS A;  5CR0 A;  8ICO A;  4RUC A;  4EBE A;  2R8K A;  2R8G A;  2ID1 A;  4QZI A;  3N4M B;  3Q8S B;  4P2H A;  4J9N A;  5EOZ A;  3HJ1 A;  3GV5 B;  3OGU A;  3QEB Z;  5DGB A;  3Q8M A;  2PI4 A;  1PZN A;  1N56 A;  4RUA A;  5DLF A;  5KG6 A;  3G6Y A;  4FHV A;  3IHQ B;  4F91 B;  1NK4 A;  2MUT A;  4Q45 A;  4F3O A;  4KLJ A;  2XO7 A;  4K4I A;  2O1P A;  2W9M A;  3MBY A;  4F4Y A;  3V6H A;  2XY6 A;  3H39 A;  5J0Y A;  3PR5 B;  5KFX A;  4F8R A;  2JEF A;  1SL1 A;  1BPZ A;  4Z6E A;  3EPI A;  5DGA A;  2W9C B;  1KFD A;  2ALZ A;  1ZQI A;  3RRH A;  1T8E A;  3UXN A;  4UB4 A;  2M2U A;  4MEY A;  1MIV A;  7ICS A;  5HRB A;  4R8U B;  1ZQK A;  3GDX A;  1ZQV A;  4YCX A;  4QZG A;  4XA5 A;  5HHH A;  3C5F A;  4C8N A;  2BCU A;  3Q8P B;  5DDM A;  4ED7 A;  3ISD A;  4IR1 A;  1BPB A;  1ZET A;  8ICK A;  4QWB A;  1S10 A;  4RU9 A;  3TFR A;  5J2C A;  2BGW A;  3JYY A;  5KT2 A;  4EBD A;  5J2E A;  4QZD A;  1X9W A;  2VAN A;  4BWJ A;  1JX4 A;  3AU6 A;  4KMU A;  4DF4 A;  4LZG A;  4I2I A;  2ASL A;  4YR3 A;  3RJE A;  2XC9 A;  1IM4 A;  5HR9 A;  2H5X A;  3B0X A;  4ECQ A;  3T3F A;  1NZP A;  2PBE A;  2BHN A;  3H4D A;  3Q8R B;  3M8S A;  3TAN A;  1L3U A;  5D46 A;  2V4Q A;  2FLL A;  1XSP A;  4P4P A;  3MAB A;  3GIK A;  3T5K A;  4RQ3 A;  3PW5 A;  3RJG A;  4YXM A;  4YD2 A;  4X4N A;  1RXW A;  1NKB A;  2PFQ A;  3PNC A;  7ICO A;  4M9L A;  2ZTC A;  5L1K A;  2JEJ A;  3V7K A;  4C8M A;  4I2H A;  2ZUD A;  2KZM A;  1UET A;  4NY8 A;  4RQ4 A;  8ICB A;  1HUZ A;  2DFL A;  3C1Z A;  3MGH A;  3EYZ A;  3SYZ A;  4DQS A;  5HHI A;  4M9N A;  4NKT A;  4DL5 A;  2KFN A;  3ETL A;  3PML A;  3N97 B;  5DB9 A;  5BOM A;  2O5A A;  2DRB A;  3RJH A;  5KT4 A;  1NJX A;  4EBC A;  7ICH A;  4WCW A;  3WFO A;  4DFM A;  5III A;  3JPP A;  4UQG A;  2ASJ A;  3GFK B;  2IHM A;  2BDP A;  2P66 A;  4RZR A;  3LDA A;  4F4Z A;  4F5O A;  4M47 A;  1BNP A;  4WBZ A;  1BPD A;  5TZV A;  4E7X A;  2I1Q A;  3THV A;  4R66 A;  4DQR A;  4KIT B;  3QEA Z;  1X9S A;  3HX0 A;  4KLT A;  1UEV A;  4QWD A;  1UA1 A;  4RT2 A;  2BQU A;  1ZQN A;  4G3I A;  3HP6 A;  4BXO B;  2KN7 A;  3C18 A;  3H3A A;  2AQ0 A;  7ICE A;  4JV1 A;  1R8B A;  4DSE A;  2HHT A;  4QWE A;  4DSJ A;  4IQV A;  1U4B A;  1TK5 A;  3RJI A;  1S0V A;  9ICX A;  1KDH A;  2BCS A;  4KLL A;  5HRG A;  5DQI A;  3EPG A;  4DOB A;  4DL6 A;  1L5U A;  5KFJ A;  4DSK A;  3GII A;  2FMP A;  1Y88 A;  5KFT A;  4DEZ A;  1ZQL A;  3C5G A;  3AU2 A;  3PW7 A;  1S0O A;  3BDP A;  5DB6 A;  5J0T A;  8ICP A;  4RQ6 A;  1ZQY A;  5J2H A;  1MIY A;  4FHY A;  2IHN A;  5KG7 A;  4KLQ A;  3RAQ A;  3T5H A;  1TK8 A;  2IMW P;  4RQ5 A;  3HPO A;  1V9P A;  1L3T A;  4NLN A;  3TAQ A;  3H38 A;  5J2J A;  5J2B A;  2UVR A;  4B9V A;  1ZYQ A;  4WC1 A;  3GIJ A;  2BPC A;  5J0W A;  4M5D A;  2ZJ5 A;  3OUY A;  1JIH A;  2FMS A;  4M2Y A;  1D9F A;  4MFA A;  1UEU A;  3UXP A;  4GXI A;  5DBB A;  3SV4 A;  8ICE A;  3GIL A;  4E0D A;  1OU5 A;  2HHQ A;  4ZH4 A;  1TVA A;  1NK0 A;  2FPL A;  4EBK A;  3OVS A;  4F50 A;  3ZDE A;  4I2F A;  2J6T A;  5CB1 A;  4ED2 A;  2C2D A;  4KLG A;  1QSL A;  1ZQB A;  2KTQ A;  5F9N A;  2BPF A;  2HHV A;  4F5P A;  2P6U A;  5DQG A;  3T5J A;  4C8K A;  4DSL A;  4WC2 A;  4DQI A;  4QZH A;  2JEI A;  2M2V A;  4RQ0 A;  3BQ2 A;  3AQK A;  2W9B A;  4AT9 A;  5IIM A;  5HMM A;  4RQ1 A;  4ECR A;  4O0I A;  4DL7 A;  2Y1I A;  7ICR A;  3EWA A;  4ECV A;  1T3N A;  1DK2 A;  7ICK A;  3PW4 A;  4ED8 A;  4DF8 A;  4KLH A;  5DBC A;  1UA0 A;  3RRG A;  4BDP A;  4DFJ A;  4JWM A;  4DL2 A;  2MAX A;  1KSP A;  1Q78 A;  4DSF A;  1SL0 A;  5DG7 A;  4I28 A;  2ASD A;  3ZDB A;  2NRW A;  1RYR A;  2UVW A;  4J9P A;  4AT9 B;  1WCL A;  4M0A A;  1QTM A;  1Q79 A;  4X4S A;  5KT3 A;  3BQ1 A;  2PXI A;  5IIL A;  3RBD A;  3RAX A;  4MF8 A;  3UPQ A;  2Q0Z X;  4O5E A;  2HW3 A;  1U49 A;  5HRI A;  3OV7 A;  4TQS A;  9ICI A;  3MR6 A;  4I2G A;  4ECW A;  1NK6 A;  5KFW A;  2PFO A;  5HRH A;  3QZ8 A;  1MQ2 A;  1ZQR A;  4UB5 A;  1D8Y A;  4PGY A;  1KNY A;  3V7J A;  4X4U A;  4UD5 A;  3GV8 B;  4XQ8 A;  8ICM A;  9ICC A;  3RH5 A;  4YMM A;  1A76 A;  3OHB A;  3KHL A;  2FLP A;  5HRD A;  2ZH7 A;  4DWI A;  2AGQ A;  3LQC B;  3B0Y A;  4I27 A;  1U47 A;  1ZJN A;  4IRC A;  5J2D A;  4PHP A;  2XCA A;  1XS9 D;  2FLN A;  4BWM A;  5CJ7 A;  3EZ5 A;  3JPN A;  4ECX A;  3V6J A;  1XC9 A;  2FMQ A;  5HC9 A;  3G6X A;  4EEY A;  2DPJ A;  9ICH A;  4O3P A;  4C8O A;  4M6W B;  1ZQT A;  4NKU A;  1ZQC A;  7ICM A;  2F1J A;  1SZP A;  4K4G A;  4PPX A;  2M2T A;  1DGS A;  2LYH A;  4ED3 A;  1XSN A;  1X9M A;  5DBA A;  4LVS A;  5F2V O;  3H8W A;  1LB2 B;  3TAP A;  4PHD A;  3UQ0 A;  4DLG A;  3TAR A;  3MDA A;  3ORY A;  5J29 A;  4QZB A;  2KP7 A;  2ZH8 A;  3JPQ A;  3RB6 A;  1RZT A;  5DKW A;  2AJQ A;  1L3S A;  3RBE A;  2VA3 A;  2IBK A;  1HUO A;  7ICG A;  3ZD9 A;  9ICU A;  2RFF A;  4FH5 A;  1RPL A;  5HML A;  4FBU A;  1L3V A;  3JZ0 A;  1JAJ A;  4LT6 A;  4UAZ A;  1ZQS A;  4YP3 A;  8ICZ A;  1BNO A;  1ZQA A;  5KFZ A;  2NRT A;  4J9R A;  3H7I A;  3M9O B;  2A1J A;  3AQL A;  4ECY A;  4RWP A;  5KT6 A;  4EZ6 A;  5EWG A;  1IXR A;  2DR7 A;  3RJJ A;  1Z00 A;  4PGX A;  4BXO A;  2ZHA A;  3PX6 A;  4B9N A;  1ZQF A;  4RQ2 A;  1ZQU A;  2AGP A;  3ZDC A;  4JWN A;  2M9N A;  5KT5 A;  1BPX A;  1TAU A;  9ICN A;  4M9H A;  5KFE A;  4E8F A;  3T5L A;  4TQR A;  2ZHB A;  4RPY A;  4Z6C A;  4I2J A;  2XGP A;  4IQW A;  1S0M A;  1S77 D;  3RTV A;  4KLI A;  3PW0 A;  2HHW A;  1TFR A;  3WFP A;  1EXN A;  3EW9 A;  5KFK A;  4UAW A;  4LZD A;  4RQ7 A;  4O3N A;  3JPO A;  2ISO A;  2KZZ A;  8ICN A;  7ICP A;  5HRL A;  3OJS A;  3H8S A;  1K1S A;  5KFR A;  7ICN A;  3C1Y A;  1VFG A;  3OVB A;  9ICV A;  1R8A A;  4KLU A;  4RWQ A;  4ELT A;  5J2G A;  2ZH9 A;  3LWL A;  5KFB A;  1C7Y A;  1T4G A;  1MC8 A;  7ICJ A;  5EWE A;  5KFY A;  3KHG A;  1B22 A;  4B9T A;  4M04 A;  9ICO A;  2DR5 A;  2JEG A;  4X4T A;  4P4M A;  1T7P A;  4O3R A;  5J0Q A;  4FO6 A;  5DB7 A;  2HVI A;  9ICK A;  4KLF A;  1COO A;  5J2I A;  2C28 A;  5DLG A;  1U48 A;  1NJW A;  3RJK A;  2HVH A;  1KEJ A;  2HHP A;  2BCR A;  5J0P A;  2F1I A;  4DSI A;  2AQ4 A;  3MR3 A;  4NLZ A;  2M2W A;  4RWO A;  4X0A A;  1Z3E B;  4X0B A;  2F1H A;  1CUK A;  2FPK A;  1R89 A;  5DED A;  2RDI A;  3ISB A;  1KTQ A;  4DOC A;  4TUR A;  1ZQP A;  5J2A A;  4J9K A;  9ICG A;  4XQ7 A;  3NYB A;  8ICG A;  4YVZ A;  1BGX T;  5KT7 A;  1KLN A;  2R8J A;  2Q66 A;  5KFQ A;  5DG9 A;  2XCP A;  1NK7 A;  4ECZ A;  1S9F A;  1TV9 A;  4X4O A;  1TFW A;  5KFU A;  4F5N A;  3KTQ A;  5KFG A;  3JPR A;  4I29 A;  7ICL A;  3M9M B;  9ICB A;  1H38 A;  1XU4 A;  5J2K A;  4Q8E A;  4FHP A;  8ICL A;  2NRZ A;  4KN7 A;  1CEZ A;  3RJF A;  3WFQ E;  5KFM A;  4S3N A;  1SKS A;  3H37 A;  4UD4 A;  1K1Q A;  4FHW A;  4FS1 A;  2BPG A;  5HRE A;  4DOA A;  4JUZ A;  4I2A A;  4FH3 A;  1VJ7 A;  2VA8 A;  1BPE A;  4NXZ A;  1KFS A;  1ZQZ A;  4RNM A;  5D4B A;  2XY7 A;  3PV8 A;  4JK1 A;  4R8U A;  5CA7 A;  1NK8 A;  1SKR A;  4I2E A;  4FHX A;  4I2D A;  3OUY B;  4AT7 B;  4NLG A;  3NGD A;  3QZ7 A;  1ARO P;  4Q44 A;  4R63 A;  1ZQD A;  2C2R A;  9ICR A;  3OVA A;  3V6K A;  4NLK A;  1B43 A;  4O3Q A;  3H40 A;  4E80 A;  4DO9 A;  1F5A A;  4GXJ A;  4YR0 A;  3M8R A;  1MIW A;  3TQ1 A;  4MFF A;  4O9M A;  4QWA A;  4O3S A;  1MSW D;  4YMO A;  5L1L A;  3OJU A;  3TI0 A;  4B9M A;  3UPS A;  4XUS A;  3RB0 A;  8ICI A;  2V9W A;  4ECT A;  2AU0 A;  2OWO A;  1A77 A;  4KN4 A;  4F92 B;  5DEC A;  1SL2 A;  8ICJ A;  4RNN A;  4C8L A;  2DR9 A;  4O5K A;  4BGD A;  4R64 A;  3C21 A;  2W9B B;  1N48 A;  1RXV A;  4J9L A;  4KLD A;  4WC6 A;  2ZH4 A;  3FYH A;  5IIO A;  2BR0 A;  3PX0 A;  1BPY A;  4ECS A;  2ZH2 A;  3H8J A;  1QSY A;  2ZTE A;  2HHU A;  5KG4 A;  3ISC A;  1XWL A;  5J0S A;  3M9N B;  2ISP A;  2NRV A;  3QE9 Y;  3LK9 A;  1ZQO A;  4KLO A;  4HYK A;  3KHH A;  1RYS A;  4I2B A;  4ATB B;  1NK5 A;  4O3O A;  4QW9 A;  1JMS A;  3PVX A;  8ICV A;  3PMN A;  8ICF A;  8ICC A;  2KZ3 A;  4WC3 A;  3MFH A;  3Q8L A;  1S76 D;  2ZUC A;  1JN3 A;  5HNK A;  2R8H A;  4TUS A;  2RDJ A;  5DQH A;  3RH4 A;  1JXE A;  4B9L A;  7ICF A;  5KFN A;  4IRD A;  4QZE A;  2BE3 A;  5HRK A;  2FPM A;  9ICS A;  5KFO A;  4QWC A;  1SKW A;  4DS5 A;  2KFZ A;  4QZA A;  2DPI A;  1R8C A;  4X4P A;  3MGI A;  2BQR A;  2PFP A;  2A1J B;  4YG2 A;  4YXJ A;  2W8K A;  4JV2 A;  4KLS A;  2C2E A;  9ICL A;  4XRH A;  4Z6D A;  4QZ8 A;  4QZ9 A;  4UB2 A;  2W9A A;  1ZQE A;  9ICW A;  4F4K A;  4EYI B;  8ICQ A;  9ICF A;  2HHS A;  1ZQQ A;  1NKC A;  1XO1 A;  4F93 B;  1HJP A;  4M9J A;  4RNO A;  2DR8 A;  3JPS A; 
#chains in the Genus database with same CATH topology
 2HBL A;  2GA9 D;  4UAS A;  4KLM A;  3G6V A;  3MFI A;  4CDG A;  1ZQG A;  2DVI A;  4QZC A;  4IQT A;  2FDR A;  2B56 A;  1DOQ A;  3WKB A;  5AKH A;  3PW2 A;  5KFV A;  4CRX A;  3NAS A;  4IQU A;  3C23 A;  2AGO A;  1V4A A;  4GC6 A;  4UAU A;  4PGQ A;  3V72 A;  3JPT A;  4IR9 A;  4CNQ A;  2GH1 A;  1Q3U A;  9ICW A;  2KEY A;  4YMN A;  4ECU A;  2E3T A;  3SD7 A;  1WWU A;  9ICQ A;  4K98 A;  3IN5 A;  2BKE A;  4KMO B;  4F4W A;  2BCV A;  1U9L A;  4NM1 A;  2PI5 A;  1KN5 A;  1JRO A;  5BOL A;  3UQ2 A;  3HKZ C;  2V4R A;  1KRP A;  8ICW A;  2F8L A;  4UB3 A;  2G5H B;  4WC4 A;  1YZ6 A;  3SZ2 A;  4ED1 A;  3UXO A;  3NKU A;  1Q8K A;  3NVW A;  4WQK A;  1KFT A;  1D8L A;  1LV5 A;  8ICH A;  3NTU A;  4IRK A;  3ZDD A;  2PFN A;  3QX7 A;  5JUM A;  2G07 A;  5KTQ A;  2YB4 A;  3AQN A;  3E2E A;  2QB1 A;  3C2L A;  7ICI A;  9ICP A;  5KFL A;  4DFP A;  5H2F U;  3MR5 A;  9ICE A;  5AKK A;  2BQ3 A;  4R65 A;  5HRF A;  1ZQH A;  2LM1 A;  5J0R A;  4NM2 A;  5IIJ A;  3K75 D;  1WCN A;  7ICU A;  4X4R A;  2JZB A;  1QQ5 A;  3SV3 A;  4IL6 U;  2XGQ A;  8ICT A;  3UMB A;  2HHX A;  4Y2T A;  4K97 A;  4AT8 A;  4YN4 A;  3AUO A;  1OUQ A;  5CR0 A;  8ICO A;  4QZI A;  3QU4 A;  3SEN A;  4J9N A;  3OGU A;  1PZN A;  4PJ0 U;  2XO7 A;  4K4I A;  4JB3 A;  3PR5 B;  2ALZ A;  3RRH A;  1T8E A;  3L3F X;  4UB4 A;  1MIV A;  4C4S A;  2YMM A;  1ZQV A;  4QZG A;  2BCU A;  2KJ8 A;  3ISD A;  1BPB A;  2BGW A;  5J2C A;  1LKY B;  2LBO A;  5AM2 A;  1RQL A;  3AU6 A;  3D2N A;  2KIW A;  4DF4 A;  3WK8 A;  2ASL A;  4F71 A;  1UCV A;  1IM4 A;  5HR9 A;  2JMG A;  1GO3 F;  3B0X A;  3T3F A;  2PBE A;  2BHN A;  4WH5 A;  5GTI U;  3N7R C;  4P4P A;  3GIK A;  3PW5 A;  3RJG A;  1X9X A;  1NKB A;  2PFQ A;  4M9L A;  3V7K A;  4C8M A;  1UET A;  1XNS A;  8ICB A;  1Z4N A;  2DFL A;  3EYZ A;  5HHI A;  2P35 A;  2KFN A;  3PML A;  2HMX A;  2O5A A;  3F53 A;  1TE2 A;  4U6P A;  7ICH A;  3WFO A;  3JPP A;  3MGV A;  2BDP A;  2HHW A;  1M6Y A;  4RZR A;  1S8O A;  3THV A;  4DQR A;  1X9S A;  1UEV A;  4I0U A;  2R18 A;  4G3I A;  2QAR B;  3HP6 A;  1PUZ A;  5AM5 A;  5ALP A;  4IQV A;  1U4B A;  1DXS A;  4DOB A;  4DL6 A;  4RQN A;  3GII A;  1S0O A;  3PW7 A;  4RQ6 A;  1PVP A;  3L4P A;  5KG7 A;  3RAQ A;  2EDU A;  3QNM A;  3HKZ F;  2WAQ F;  4WC1 A;  3GIJ A;  1AQ6 A;  1JIH A;  2ES6 A;  1KL9 A;  2FMS A;  1Q46 A;  4M2Y A;  3QYP A;  4MFA A;  4JLX A;  3WK6 A;  1OU5 A;  3K1R B;  4QIW F;  4US9 A;  1NK0 A;  3OVS A;  4F50 A;  5CB1 A;  4AYB C;  4F5P A;  2P6U A;  5DQG A;  3T5J A;  4DSL A;  4DQI A;  1Z4O A;  3C28 A;  1F0M A;  7ICR A;  4ECV A;  1HIW A;  4NWI A;  4DF8 A;  1KQQ A;  3NRZ A;  5DBC A;  3RRG A;  4BDP A;  2NRW A;  3BZC A;  2UVW A;  4J9P A;  2MU2 A;  4X4S A;  5KT3 A;  3BQ1 A;  4QJF B;  3UPQ A;  4I2G A;  5KFW A;  3M7D A;  5HRH A;  3QZ8 A;  1MQ2 A;  1KNY A;  4XQ8 A;  9ICC A;  3B9J A;  3IDW A;  5AKX A;  4DWI A;  2AGQ A;  3LQC B;  1ZRN A;  4PHP A;  1XS9 D;  5AM0 A;  4BWM A;  1XC9 A;  4ECX A;  2DWQ A;  4M6W B;  3TAD A;  1IG6 A;  2M2T A;  4K4G A;  1SZP A;  4PPX A;  5ALH A;  2AHO B;  1X9M A;  4LVS A;  4KX3 A;  1LB2 B;  4EEK A;  3A0B U;  3UQ0 A;  3TAR A;  2M0N A;  2ZIU B;  5J29 A;  1CRX A;  3N7P D;  4ZOH C;  2AJQ A;  2QLT A;  1ZD2 P;  1N62 A;  3ZD9 A;  2RFF A;  2H3V A;  5HML A;  2Y9T A;  1L3V A;  1KBU A;  4LT6 A;  8ICZ A;  3D6J A;  3H7I A;  4ECY A;  5KT6 A;  4EZ6 A;  5EWG A;  3RJJ A;  4PGX A;  1ZQU A;  1TAU A;  1JUD A;  5JTG A;  5ALK A;  1BPX A;  1N5W A;  3WK9 A;  4RPY A;  2HN1 A;  2XGP A;  3EW9 A;  3R9K A;  4RQ7 A;  4O3N A;  8ICN A;  3OJS A;  7ICN A;  4NXX A;  2H3F A;  1JAL A;  4ELT A;  5J2G A;  1C7Y A;  3PSP A;  2ZXH A;  3KD3 A;  1T7P A;  1F5S A;  2WHE A;  2BCR A;  3KKA A;  4NLZ A;  4MKP A;  3IRU A;  2EZZ A;  3QUB A;  4DOC A;  3ISB A;  4EEN A;  1OW5 A;  2W04 A;  2Q66 A;  5KFQ A;  5DG9 A;  1L8L A;  2EQY A;  5KFU A;  5KFG A;  1XU4 A;  4FHP A;  3WFQ E;  2YML A;  4NL9 C;  5KFM A;  4S3N A;  3H37 A;  4UD4 A;  1K1Q A;  4FHW A;  2ZIX B;  4FH3 A;  3NS1 A;  1ZQZ A;  4OD0 A;  2XY7 A;  4R8U A;  3OUY B;  4AT7 B;  1CI4 A;  3EUB 2;  3NGD A;  3QZ7 A;  4Q44 A;  3OVA A;  4NLK A;  2WF5 A;  2ZG6 A;  4O3Q A;  4DO9 A;  4GXJ A;  4YR0 A;  4CF5 A;  5ALW A;  2K4H A;  4BX9 C;  5L1L A;  3UPS A;  2WF6 A;  2OH2 A;  5FP0 A;  2V9W A;  1NZB A;  4KN4 A;  1SL2 A;  4RNN A;  5HR6 A;  4O5K A;  4UAV A;  4R64 A;  2W9B B;  2BR0 A;  2ZH2 A;  1TAM A;  2PMZ C;  3OPX A;  3QE9 Y;  4KLO A;  2HDO A;  4I2B A;  2E8M A;  3OTQ A;  3F2C A;  5ALR A;  3Q8L A;  3DV9 A;  1S76 D;  2R8H A;  4NV0 A;  4NXT A;  4B9L A;  1JXE A;  5HRK A;  5KAI U;  4QWC A;  1R8C A;  9ICL A;  2YMQ A;  4QZ8 A;  4F4K A;  2A19 A;  3ZI4 A;  4F93 B;  4J03 A;  4RNO A;  3HT3 A;  4YD1 A;  5J0U A;  4P4O A;  4B9S A;  2XVT A;  5KG2 A;  4NLC A;  3M6Z A;  2ZIW B;  3Q8K A;  1QH9 A;  1RM6 C;  1WOT A;  3ERC C;  1SZH A;  5AI4 A;  5AKJ A;  2R8I A;  5AKY A;  3UMC A;  1JXL A;  2CPR A;  5ALD A;  7ICQ A;  4PHE A;  4JLZ A;  4YR2 A;  4J9O A;  2OEH A;  4B9U A;  4KTQ A;  3SR6 A;  1QSS A;  2GLE A;  3WKE A;  4PH5 A;  5CWR A;  2W55 A;  3SI8 A;  2LHT A;  1RDF A;  3ZD8 A;  3MDC A;  4F5Q A;  3F5A A;  3K4G A;  1COK A;  3SEI A;  5KFD A;  1QCK A;  5BPC A;  1X6I A;  5IIN A;  4AT7 A;  1RG6 A;  2G5I B;  1NK9 A;  2ZH5 A;  3IP4 B;  4WC7 A;  1S0N A;  5KAF U;  3BQT A;  8ICA A;  5ALT A;  4RWN A;  4UBB A;  3WU2 U;  2JZB B;  3C2M A;  3RB4 A;  1UHU A;  1QLN A;  2CXY A;  1T94 A;  2Y0S C;  5ALU A;  5KFC A;  5K4L A;  1NO5 A;  2NRK A;  4FS2 A;  4X5V A;  1NKE A;  2ZJA A;  2VKQ A;  2W43 A;  1X42 A;  1QQ7 A;  1P7D A;  5L1M A;  3HW8 A;  1NJZ A;  1ZQM A;  5J0X A;  2XIC A;  3KHR A;  4EBJ A;  3TFS A;  2NRX A;  5ALV A;  2N1R A;  5CP2 A;  1NOM A;  4N7R A;  2W9C A;  2WB1 F;  1L7N A;  3ZDA A;  4F2S A;  3AN1 A;  4UB8 U;  4WC0 A;  4LEZ A;  5J2F A;  1B0X A;  4JV0 A;  3PSF A;  3HIL A;  3WKC A;  1TAQ A;  2ZH3 A;  1J2N A;  1JQR A;  1ZD5 A;  4ED6 A;  4ED0 A;  1ZJM A;  8ICR A;  5ALJ A;  4QNL A;  3PR4 A;  5AKI A;  2RQ5 A;  5KG1 A;  3RR7 A;  3NWI A;  1SIJ A;  4EED A;  5D62 A;  3H4B A;  4GC7 A;  1A0P A;  4FBT A;  5EWF A;  4EBE A;  1LVH A;  3N4M B;  3Q8S B;  1O08 A;  4P2H A;  4CF3 A;  5EOZ A;  2PI4 A;  5E79 U;  4RUA A;  1L8O A;  3KBB A;  2KVC A;  4F91 B;  4Q45 A;  4LEW A;  3MBY A;  2W11 A;  4USA A;  4F4Y A;  5KFX A;  2OCE A;  2JEF A;  4Z6E A;  5DGA A;  4EGW A;  4BUG A;  4MEY A;  3CYM A;  4C8N A;  4IR1 A;  4OAG A;  5ALY A;  2K4I A;  4RU9 A;  3TFR A;  3JYY A;  3ED5 A;  1X9W A;  4BWJ A;  1JX4 A;  4KMU A;  3NUQ A;  2YX8 A;  2XID A;  2E1E A;  1UPH A;  5AK6 A;  1RQN A;  2F8K A;  3Q8R B;  3T5K A;  3MAB A;  4RQ3 A;  4X4N A;  1SB3 C;  1SV0 A;  4NY8 A;  3O0F A;  2I5H A;  3GZF A;  3PST A;  3SYZ A;  4DQS A;  4NKT A;  2MA1 A;  4UAT A;  2K60 A;  3ETL A;  5BOM A;  2K8A A;  4EBC A;  4US8 A;  4DFM A;  2ASJ A;  4UQG A;  2HOI A;  1BNP A;  2P66 A;  2IUB A;  2K4P A;  4F5O A;  2EAM A;  2HOF A;  5AIB A;  4E7X A;  3QEA Z;  4KIT B;  4KLT A;  1UA1 A;  4Y2Q A;  4DSE A;  4QWE A;  3TKA A;  9ICX A;  2H3I A;  3RJI A;  2BCS A;  5DQI A;  2RHF A;  5KFJ A;  4DEZ A;  1ZQL A;  1L7M A;  1A6S A;  4FHY A;  4ICA A;  2IHN A;  4KLQ A;  1TK8 A;  2IMW P;  3H38 A;  5B66 U;  4LEY A;  2BBH A;  2BPC A;  5J0W A;  2KVS A;  4M5D A;  2L5Y A;  4PL2 A;  2EAP A;  3QU9 A;  1UEU A;  3PHZ A;  3GIL A;  2QB0 B;  2KJ9 A;  1TVA A;  2FPL A;  3CP8 A;  4I2F A;  3ZDE A;  2J6T A;  2EAN A;  4KLG A;  1QSL A;  4GIB A;  3LVV A;  2DKX A;  4DCC A;  1N63 A;  5A0L A;  2M2V A;  5IIM A;  4RQ1 A;  4O0I A;  2ZIU A;  2Y1I A;  3AEV A;  1YZ7 A;  3BS5 B;  1KSP A;  1SL0 A;  2GAF D;  2PXI A;  3RAX A;  1U49 A;  2PFO A;  1D8Y A;  1RYU A;  3FM9 A;  5J8Y A;  4UD5 A;  8ICM A;  3RH5 A;  3OHB A;  3B0Y A;  4IRC A;  1ZJN A;  5J2D A;  2FLN A;  2F44 A;  2FMQ A;  5HC9 A;  4EEY A;  5AI5 A;  4C8O A;  9ICH A;  1ZQT A;  7ICM A;  2F1J A;  1DGS A;  4C80 A;  1XSN A;  3TAP A;  2E5S A;  4Y2U A;  4DLG A;  2HN2 A;  2RRD A;  3MDA A;  2KP7 A;  2HSZ A;  3JPQ A;  1SGG A;  5AK5 A;  1RZT A;  4FZN A;  5CEH A;  2D6F C;  2VA3 A;  2WB1 C;  9ICU A;  3WKD A;  3JZ0 A;  2HBJ A;  2E8O A;  1BNO A;  4J9R A;  2NRT A;  1Z00 A;  2ZHA A;  1ZQF A;  1N5X A;  4JWN A;  3AQF A;  4F72 A;  3T5L A;  4TQR A;  2NO4 A;  2ZHB A;  4I2J A;  4IQW A;  3PW0 A;  4Y2V A;  2LMR A;  1TFR A;  2CRX A;  4LZD A;  7ICP A;  4LEV A;  2QKQ A;  3H8S A;  1K1S A;  4HX0 A;  3OVB A;  2KIV A;  9ICV A;  4KLU A;  1VJ5 A;  2GOL A;  5KFY A;  2DGZ A;  5D61 A;  2F77 X;  2DR5 A;  2JEG A;  4EV6 A;  5J0Q A;  1MA7 A;  5DB7 A;  3ICX A;  5KL1 B;  1COO A;  5J2I A;  1U48 A;  1NJW A;  5EE1 A;  2HVH A;  5ALF A;  2HHP A;  2F1I A;  3QUT A;  4RWO A;  2A1A A;  5DED A;  1R89 A;  2MRL A;  1N2X A;  5J2A A;  3CW2 C;  3NVY A;  2VJ5 A;  8ICG A;  2OM6 A;  1BGX T;  2XCP A;  5CHE A;  1S9F A;  4X4O A;  1TFW A;  3AQE A;  3KTQ A;  4K99 A;  3JPR A;  2LYA A;  4I29 A;  3M9M B;  9ICB A;  1H38 A;  4Q8E A;  1CEZ A;  3LYS A;  4FS1 A;  4DOA A;  3QU7 A;  4I2A A;  4NXZ A;  5AIC A;  4RNM A;  5D4B A;  3PV8 A;  1ZOL A;  4I2D A;  1ARO P;  2OHF A;  1F5A A;  5AM1 A;  3M8R A;  1MIW A;  4O9M A;  4YMO A;  3OJU A;  3RB0 A;  2ODG A;  1F44 A;  3C21 A;  4G9B A;  4KLD A;  4WC6 A;  4J9L A;  2JR5 A;  3PX0 A;  1ZD3 A;  2W7O A;  1JI7 A;  4O3M A;  5J0S A;  3M9N B;  2KMD A;  4HYK A;  3PVX A;  8ICF A;  1ED1 A;  4WC3 A;  3CNH A;  1JN3 A;  2KNJ A;  5KFN A;  2E1F A;  2KKP A;  9ICS A;  5KFO A;  3N7S C;  2KFZ A;  4QZA A;  2HCF A;  2EH9 A;  1PK3 A;  2HBM A;  4P0Q A;  4X4P A;  2BQR A;  2PFP A;  2W8K A;  4YG2 A;  3BZK A;  5G5H A;  4XRH A;  1ZQE A;  5HRG A;  4QZ9 A;  2KK0 A;  4EYI B;  2IOF A;  2HHS A;  4EEL A;  1NKC A;  3QU5 A;  3PZP A;  3VCB A;  1HJP A;  4M9J A;  2DR8 A;  3JPS A;  3RH6 A;  5KFA A;  3FAH A;  1JRP A;  3GV7 B;  8ICS A;  2YN4 A;  2ZTD A;  1D9D A;  1FIQ A;  1Z00 B;  1D8B A;  4DS4 A;  7ICT A;  1DK3 A;  4Y2Y A;  3V7L A;  4FFD A;  3UM9 A;  5KFF A;  3LWM A;  5CFS A;  4K96 A;  4AYB F;  5B3P A;  8ICX A;  4ATB A;  2ESE A;  4MFC A;  2MUT B;  4ACO A;  2W8L A;  4WBY A;  2AH5 A;  4J9S A;  3OSN A;  4RQM A;  5F9L A;  2HHU A;  3BQ0 A;  4TUQ A;  2ZH6 A;  5D49 A;  5G5G A;  4AP9 A;  1K5O A;  4RQ8 A;  2VA2 A;  2HI0 A;  2ZUB A;  1ZQX A;  4EYH B;  4TUP A;  2LPE A;  4GXK A;  3HIY A;  4QZF A;  4J9Q A;  3QUC A;  3PO4 A;  1X66 A;  2WTF A;  3L5K A;  1TK0 A;  4F4X A;  4DFK A;  2GWS A;  2ZIV A;  4DL3 A;  1LKY A;  2O6K A;  4WC5 A;  2JHD A;  5L1J A;  5DB8 A;  2ATL A;  1MQ3 A;  4P0Q B;  4I2C A;  3AMZ A;  4ELV A;  3MR2 A;  5AK3 A;  2WF8 A;  1V97 A;  3OWG A;  5ALM A;  1PX5 A;  5IIK A;  4QW8 A;  3E58 A;  5ALN A;  1YLQ A;  2IHO A;  4YFK A;  3I1Y A;  7ICV A;  2E8P A;  5AI9 A;  2UVV A;  2OYY A;  1Z1B A;  3OSP A;  3A0H U;  4Q43 A;  5DDY A;  3HWT A;  2KSO B;  3IM1 A;  2P6R A;  4GLX A;  2ZH1 A;  2J6S A;  5ALZ A;  1KW4 A;  3GQC A;  4DLE A;  2B21 A;  3AQM A;  2C22 A;  5KFP A;  3PX4 A;  8ICU A;  4O67 A;  1NJY A;  4XQ7 A;  1X2I A;  5L1I A;  4RPX A;  1L7O A;  9ICJ A;  3FDS A;  4RUC A;  2R8G A;  1ZD4 A;  5KL8 B;  3HJ1 A;  3Q8M A;  5DGB A;  5DLF A;  5C0Y A;  5KG6 A;  3IHQ B;  2MUT A;  2LM4 A;  4OJ6 A;  3AM9 A;  3GU3 A;  4F3O A;  2O1P A;  2ZXI A;  2W9M A;  3V6H A;  2JH1 A;  2A3V A;  5D63 A;  5J0Y A;  2ZIV B;  4OAH A;  2DQN B;  3U26 A;  1SL1 A;  3EPI A;  1ZQI A;  4FO1 A;  2M2U A;  2VIX A;  1XO0 A;  5HR7 A;  5HRB A;  4R8U B;  3C5F A;  2H3Z A;  4IG8 A;  3Q8P B;  5DDM A;  8ICK A;  1ZET A;  4QWB A;  5KT2 A;  4QZD A;  4BJQ A;  2VAN A;  3KZX A;  4I2I A;  3RJE A;  4ECQ A;  1NZP A;  3H4D A;  3M8S A;  3TAN A;  1L3U A;  5ALO A;  2FLL A;  1XSP A;  4YXM A;  4YD2 A;  7ICO A;  4I2H A;  2Y0S F;  4RQ4 A;  1IV8 A;  2KIC A;  3C1Z A;  4M9N A;  4DL5 A;  5DB9 A;  3RJH A;  5KT4 A;  1NJX A;  2AXT U;  4WCW A;  5III A;  4ELU A;  4M47 A;  2IHM A;  3HRD D;  4WBZ A;  3LDA A;  5TZV A;  2FI1 A;  4R66 A;  4QWD A;  4Y2P A;  5AKG A;  1T3Q A;  2BQU A;  1ZQN A;  4KX5 A;  1N61 A;  1FFU A;  2KN7 A;  3C18 A;  2AQ0 A;  4WOY A;  7ICE A;  4OO1 J;  1R8B A;  2HHT A;  4DSJ A;  1J2M A;  1KDH A;  4KLL A;  4OJP A;  3EPG A;  1Y88 A;  3BDP A;  5DB6 A;  5J0T A;  4RQ5 A;  3TAQ A;  5J8Y C;  1HEK A;  1WG8 A;  5CRX A;  5J2B A;  2G09 A;  3WK4 A;  2KJ5 A;  2ZJ5 A;  5ALE A;  3OUY A;  2HOQ A;  2B0C A;  1D9F A;  3UXP A;  4GXI A;  5DBB A;  3SV4 A;  4E0D A;  1SXD A;  2HHQ A;  4ZH4 A;  5AI8 A;  1WWV A;  4ED2 A;  2C2D A;  2F76 X;  1ZQB A;  2KTQ A;  4Y2S A;  2HHV A;  2WAQ C;  4C8K A;  2G06 A;  2D3D A;  3AQK A;  2JEI A;  2W9B A;  5HMM A;  4ECR A;  4DL7 A;  3EWA A;  3H8M A;  1DK2 A;  5AIA A;  3T79 A;  3PW4 A;  4KLH A;  1UA0 A;  4JWM A;  4DFJ A;  4IC9 A;  3K7D A;  5ALQ A;  1YT3 A;  4DSF A;  5DG7 A;  4I28 A;  2ASD A;  3ZDB A;  1RYR A;  3EF2 A;  1QTM A;  1Q79 A;  5IIL A;  4O5E A;  2JRZ A;  4JMU A;  4MF8 A;  2HW3 A;  1ZQ1 C;  5HRI A;  3CRX A;  4TQS A;  3MR6 A;  1NK6 A;  1ZQR A;  4UB5 A;  4PGY A;  3V7J A;  4X4U A;  4C4R A;  5HRD A;  2ZH7 A;  2FLP A;  2XCA A;  3V6J A;  3EZ5 A;  3JPN A;  2B6G A;  3ER8 C;  3G6X A;  3IG5 A;  1PK1 B;  4EX7 A;  4NKU A;  3LVW A;  1ZQC A;  5TIS U;  1PVR A;  2LYH A;  4PL1 A;  4ED3 A;  5F2V O;  3H8W A;  2KE7 A;  1SXE A;  4PHD A;  4KM5 A;  4QZB A;  2KKV A;  2ZH8 A;  3ETR A;  2YQE A;  3RB6 A;  3I28 A;  3RBE A;  4FH5 A;  1HUO A;  2JGA A;  4OJ5 A;  2KG5 A;  4FBU A;  3QU2 A;  4WJ3 B;  3SAH A;  4IS7 A;  1ZQS A;  4YP3 A;  1GPJ A;  1ZQA A;  3M9O B;  1IXR A;  4BXO A;  2AGP A;  9ICN A;  4WC2 A;  2JXJ A;  4P0P A;  4FE3 A;  5KFE A;  1PVQ A;  4NJ8 A;  4Z6C A;  1S77 D;  3RTV A;  1FEZ A;  1ZXI A;  2Y9U A;  5KFK A;  2ISO A;  3JPO A;  2KZZ A;  2DBY A;  1VFG A;  3C1Y A;  5AI6 A;  1FFV A;  4LJX A;  3FC4 A;  3KZI U;  4K9A A;  3D2Q A;  1MC8 A;  7ICJ A;  1B22 A;  3KHG A;  4M04 A;  9ICO A;  2WF9 A;  4P4M A;  4O3R A;  2HVI A;  4FO6 A;  9ICK A;  2C28 A;  3RJK A;  5J0P A;  3MR3 A;  2M2W A;  2CN1 A;  1Z3E B;  2JH7 A;  4X0B A;  2F1H A;  4C7Z A;  1CUK A;  2RDI A;  2Z7J A;  5GTH U;  4J9K A;  1ECW A;  3NYB A;  2EZY A;  4YVZ A;  4HAI A;  1NK7 A;  4ECZ A;  2D8C A;  1TV9 A;  3N28 A;  4F5N A;  7ICL A;  4EX6 A;  5J2K A;  8ICL A;  5CFT A;  1S5L U;  4NXU A;  4JUZ A;  2VA8 A;  3MCR A;  3HJE A;  2W3S A;  1SKR A;  2YB1 A;  1NK8 A;  4NLG A;  4R63 A;  4CF4 A;  1SV4 A;  1B43 A;  3H40 A;  2DL0 A;  4MFF A;  4B9M A;  8ICI A;  2ZIW A;  2XI9 A;  5AKE A;  5ALI A;  5ALX A;  1N48 A;  2ZH4 A;  5IIO A;  2JV3 A;  4ECS A;  2ZTE A;  2BBJ A;  5EE0 A;  3VC8 A;  3LK9 A;  4QIW C;  1N60 A;  3KHH A;  4ATB B;  1NK5 A;  4QW9 A;  1JMS A;  3F2B A;  8ICV A;  3MFH A;  4TUS A;  4DFD A;  4QZE A;  2BE3 A;  3NRW A;  1SKW A;  2WF7 A;  2A1J B;  4YXJ A;  4JV2 A;  5AHX A;  4Z6D A;  5AK4 A;  4UB2 A;  4A8E A;  8ICQ A;  1XO1 A;  4WQL A;  4CCH A;  4NXV A;  2IA6 A;  1U45 A;  4M6W A;  1V38 A;  3GIM A;  2J6U A;  5KFS A;  3OHA A;  3DEE A;  3RB3 A;  4KB6 A;  4X4V A;  2DRA A;  4MEX A;  3IG8 A;  3WK7 A;  4RPZ A;  3PY8 A;  5C5J A;  2NYV A;  4PZN A;  9ICA A;  4KLE A;  3DDH A;  4RT3 A;  1C20 A;  3HJ4 A;  3C2K A;  5KG3 A;  2UVU A;  3KOO A;  4M9G A;  1UT5 A;  3E0F A;  5EE9 A;  5KG0 A;  4F5R A;  2I9G A;  1BVS A;  2F3N A;  4EZ9 A;  4DQQ A;  2YMP A;  3RF9 A;  1ZQJ A;  1FA0 A;  4O69 A;  2BCQ A;  1MN8 A;  3K1Z A;  4K4H A;  4Y2X A;  4PZO A;  4OJL A;  3F2D A;  2I6X A;  3PO5 A;  5HP4 A;  4AT8 B;  3C66 A;  1TFY A;  2HBK A;  5CHG A;  2RP5 A;  4PHA A;  3C29 A;  4DL4 A;  2G08 A;  4OJO A;  4UBC A;  3WFR E;  4UB1 A;  3NVZ A;  1S97 A;  2K89 A;  5DG8 A;  1ZQW A;  4OAF A;  2DUY A;  3BJY A;  1TKD A;  1UT8 A;  4DQP A;  5AI0 A;  2DF4 B;  4F2R A;  4EP7 A;  3JCF A;  1SWW A;  4J9M A;  4UAY A;  3H0R B;  3SAG A;  4FZM A;  4C4T A;  3L9D A;  5KFI A;  4O5C A;  4YQW A;  4MF2 A;  4Z6F A;  3WK5 A;  1XSL A;  4Q8F A;  4X4Q A;  3Q8Q B;  8ICY A;  2XY5 A;  9ICM A;  1X40 A;  2E8N A;  2QAR A;  5L9X A;  5KFH A;  2Y1J A;  9ICT A;  2B4V A;  2ZJ8 A;  5J0O A;  3IV6 A;  3QXG A;  5KG5 A;  3RR8 A;  3CK6 A;  4X4T A;  2R8K A;  2ID1 A;  2FE9 A;  3S6J A;  3GV5 B;  3QEB Z;  2K4E A;  1N56 A;  2KSO A;  5AM4 A;  3G6Y A;  4FHV A;  1NK4 A;  4KLJ A;  2Q4T A;  2KHV A;  5CFU A;  5AM3 A;  3H39 A;  2XY6 A;  1URJ A;  2GO7 A;  4F8R A;  1BPZ A;  3J81 j;  2W9C B;  1KFD A;  3D2S A;  1DRG A;  1NNL A;  3UXN A;  1L6N A;  7ICS A;  1ZQK A;  4NXW A;  3GDX A;  4YCX A;  5HHH A;  4XA5 A;  1FO4 A;  4AT9 B;  4ED7 A;  3H0L B;  1S10 A;  5JU5 A;  3KFU F;  4EBD A;  5J2E A;  1L7P A;  2PMZ F;  4LZG A;  4YR3 A;  1IIP A;  2XC9 A;  1VLB A;  2H5X A;  2RLT A;  5B5E U;  2LI6 A;  5D46 A;  2V4Q A;  1RXW A;  3PNC A;  2ZTC A;  5L1K A;  1WYG A;  2JEJ A;  2ZUD A;  2KZM A;  1HUZ A;  1WUD A;  3NVV A;  3MGH A;  5ALG A;  3N97 B;  2DRB A;  3GFK B;  1SWV A;  4F4Z A;  1B4F A;  1BPD A;  4UAR A;  3ER9 B;  1QQ6 A;  2I1Q A;  3HX0 A;  1NI3 A;  4UB6 U;  4RT2 A;  4BXO B;  3H3A A;  1J97 A;  4JV1 A;  5F3X B;  1TK5 A;  1S0V A;  4FZL A;  1L5U A;  4DSK A;  2FMP A;  5KFT A;  3C5G A;  3AU2 A;  2EZX A;  2FCL A;  5JTI A;  8ICP A;  4EEB A;  1ZQY A;  2OXO A;  2QB0 A;  5J2H A;  1MIY A;  3SMV A;  3T5H A;  1UQV A;  3HPO A;  1V9P A;  1L3T A;  4NLN A;  5J2J A;  2UVR A;  4B9V A;  3AL0 B;  1ZYQ A;  4C7Y A;  3TAC B;  5AKL A;  5KNI A;  2F2A B;  3SQI A;  8ICE A;  4O68 A;  2EAO A;  1O03 A;  4EBK A;  4CE6 A;  4B6J A;  5F9N A;  2BPF A;  2PKE A;  4U7C A;  4QZH A;  3UMG A;  4RQ0 A;  3BQ2 A;  4AT9 A;  3M1Y A;  1X6J A;  1T3N A;  7ICK A;  4ED8 A;  3BS7 A;  2NV3 A;  4DL2 A;  2MAX A;  3H0M B;  2EWR A;  1Q78 A;  3M6K A;  1WCL A;  4M0A A;  2DKZ A;  3RBD A;  2Q0Z X;  3OV7 A;  9ICI A;  4ECW A;  3BS5 A;  3QUQ A;  4Y2R A;  3GV8 B;  5B3Q A;  3TAD C;  1A76 A;  2KV2 A;  4YMM A;  3KHL A;  4I27 A;  1U47 A;  3WKA A;  5CJ7 A;  5ALS A;  2ZIX A;  2DPJ A;  4O3P A;  2YTU A;  3I76 A;  2K8C B;  5DBA A;  2W7P A;  4K9B A;  5ALL A;  2BDU A;  4Y2J A;  3ORY A;  5AKZ A;  2KOB A;  4K8V A;  5DKW A;  1L3S A;  7ICG A;  2IBK A;  1RPL A;  1JAJ A;  5JRT A;  4UAZ A;  4P0P B;  4OAI Z;  1Z19 A;  5KFZ A;  4RWP A;  2A1J A;  3AQL A;  2DR7 A;  3PX6 A;  4B9N A;  4RQ2 A;  2KD1 A;  3ZDC A;  2M9N A;  5KT5 A;  1Z1V A;  4CGZ A;  4E8F A;  4M9H A;  2G0A A;  4UW9 A;  1S0M A;  4KLI A;  3WFP A;  1EXN A;  4UAW A;  5HRL A;  5KFR A;  3RFA A;  1R8A A;  2W03 A;  4RWQ A;  2ZH9 A;  3LWL A;  5KFB A;  1T4G A;  4GFJ A;  5EWE A;  4XJE A;  4B9T A;  4O6A A;  3SAF A;  4KLF A;  5DLG A;  2W54 A;  1KEJ A;  1ZRM A;  1VDV A;  4DSI A;  2AQ4 A;  4X0A A;  2B51 A;  1V85 A;  2FPK A;  3WFS C;  1KTQ A;  4TUR A;  1ZQP A;  9ICG A;  2BZF A;  5KT7 A;  1KLN A;  2R8J A;  1Q3V A;  2LYB A;  2NRZ A;  4KN7 A;  3RJF A;  5EE3 A;  1SKS A;  4C0Z A;  2BPG A;  5HRE A;  1PK1 A;  1VJ7 A;  3MC1 A;  1BPE A;  1KFS A;  1OXJ A;  4JK1 A;  5CA7 A;  4I2E A;  4FHX A;  1ZQD A;  9ICR A;  2C2R A;  3V6K A;  3NVO A;  4E80 A;  2IOF K;  3TQ1 A;  4OCZ A;  2H3Q A;  4QWA A;  4O3S A;  1MSW D;  3TI0 A;  4XUS A;  3BQ7 A;  4ECT A;  2AU0 A;  2OWO A;  1A77 A;  5DEC A;  4F92 B;  3ALR A;  3F5E A;  8ICJ A;  3KKA C;  3ONN A;  4C8L A;  2DR9 A;  4BGD A;  1RXV A;  2LKY A;  3FYH A;  1BPY A;  3H8J A;  1QSY A;  5KG4 A;  3ISC A;  1XWL A;  2ISP A;  2NRV A;  1ZQO A;  1RYS A;  2NO5 A;  4O3O A;  8ICC A;  1DGJ A;  3PMN A;  2KZ3 A;  2K8B B;  2W3R A;  2ZUC A;  5HNK A;  2RDJ A;  5DQH A;  3RH4 A;  7ICF A;  4NL9 A;  4IRD A;  1SV0 C;  2FPM A;  2KHQ A;  2IOH A;  2WFA A;  2VJ4 A;  2YY6 A;  4DS5 A;  2FJ6 A;  2DPI A;  3MGI A;  2MSN A;  4KLS A;  2C2E A;  4NLB A;  2W9A A;  9ICF A;  1ZQQ A;  4MHV A;  1KKX A;  3PSI A;  5T14 A; 
#chains in the Genus database with same CATH homology
 4CCH A;  3RH6 A;  3HT3 A;  5KFA A;  3GV7 B;  8ICS A;  2IA6 A;  4YD1 A;  1U45 A;  5J0U A;  4M6W A;  2ZTD A;  4P4O A;  4B9S A;  1D9D A;  5KG2 A;  3GIM A;  1Z00 B;  4KLM A;  4DS4 A;  3G6V A;  3Q8K A;  5KFS A;  2J6U A;  7ICT A;  1WOT A;  3MFI A;  1DK3 A;  1ZQG A;  3OHA A;  3V7L A;  2R8I A;  2DVI A;  3RB3 A;  4QZC A;  4IQT A;  1JXL A;  5KFF A;  3LWM A;  7ICQ A;  4X4V A;  2DRA A;  1DOQ A;  4MEX A;  4PHE A;  3PW2 A;  3PY8 A;  4RPZ A;  5KFV A;  4YR2 A;  5C5J A;  4J9O A;  4IQU A;  3C23 A;  4B9U A;  4KTQ A;  9ICA A;  4KLE A;  2AGO A;  1QSS A;  8ICX A;  1V4A A;  4GC6 A;  4ATB A;  4MFC A;  2MUT B;  4PH5 A;  5CWR A;  2W8L A;  4RT3 A;  3HJ4 A;  4PGQ A;  3V72 A;  4WBY A;  3JPT A;  3C2K A;  3SI8 A;  4IR9 A;  4IG8 A;  5KG3 A;  4J9S A;  2UVU A;  3OSN A;  4M9G A;  3ZD8 A;  1UT5 A;  5KG0 A;  5F9L A;  3MDC A;  4TUQ A;  3BQ0 A;  4F5Q A;  4YMN A;  4F5R A;  3K4G A;  1BVS A;  4ECU A;  5D49 A;  2I9G A;  2ZH6 A;  5KFD A;  9ICQ A;  4RQ8 A;  4EZ9 A;  2VA2 A;  2ZUB A;  5BPC A;  4DQQ A;  2BKE A;  5IIN A;  1ZQX A;  4F4W A;  1ZQJ A;  1FA0 A;  4EYH B;  4TUP A;  2BCV A;  2BCQ A;  1U9L A;  4AT7 A;  4GXK A;  4K4H A;  1NK9 A;  4NM1 A;  4QZF A;  3HIY A;  4J9Q A;  2PI5 A;  3PO4 A;  2WTF A;  2ZH5 A;  5BOL A;  1TK0 A;  4WC7 A;  4F4X A;  3UQ2 A;  1S0N A;  3PO5 A;  4DFK A;  2V4R A;  2GWS A;  5HP4 A;  1KRP A;  3BQT A;  8ICW A;  4AT8 B;  4UB3 A;  8ICA A;  4DL3 A;  3C66 A;  4RWN A;  4UBB A;  1TFY A;  2JZB B;  5CHG A;  4DL4 A;  4PHA A;  3C2M A;  4WC5 A;  3RB4 A;  5L1J A;  5DB8 A;  4UBC A;  2ATL A;  1MQ3 A;  1QLN A;  4WC4 A;  3WFR E;  4UB1 A;  4I2C A;  3SZ2 A;  1S97 A;  4ED1 A;  4ELV A;  3UXO A;  5KFC A;  5DG8 A;  1NO5 A;  1ZQW A;  3MR2 A;  2NRK A;  4FS2 A;  4X5V A;  1NKE A;  2ZJA A;  3BJY A;  5IIK A;  1TKD A;  1PX5 A;  4ELU A;  1UT8 A;  4QW8 A;  1D8L A;  1LV5 A;  1KFT A;  8ICH A;  4DQP A;  3NTU A;  1YLQ A;  4IRK A;  3HW8 A;  3ZDD A;  1NJZ A;  2PFN A;  4YFK A;  5JUM A;  5J0X A;  3KHR A;  1ZQM A;  4F2R A;  4EBJ A;  4EP7 A;  3TFS A;  2NRX A;  5KTQ A;  4J9M A;  5CP2 A;  1NOM A;  7ICV A;  4UAY A;  2W9C A;  3AQN A;  2UVV A;  3ZDA A;  4F2S A;  3E2E A;  3OSP A;  3C2L A;  7ICI A;  9ICP A;  4WC0 A;  5J2F A;  5KFL A;  3L9D A;  5KFI A;  4JV0 A;  4O5C A;  4YQW A;  4DFP A;  4Z6F A;  4MF2 A;  4Q43 A;  1XSL A;  1TAQ A;  5DDY A;  3MR5 A;  4Q8F A;  2ZH3 A;  4X4Q A;  3Q8Q B;  2BQ3 A;  9ICE A;  8ICY A;  4R65 A;  3HWT A;  3IM1 A;  2XY5 A;  2P6R A;  9ICM A;  1JQR A;  5HRF A;  4ED6 A;  5J0R A;  4GLX A;  4ED0 A;  1ZQH A;  4NM2 A;  5IIJ A;  2J6S A;  2ZH1 A;  1ZJM A;  3K75 D;  8ICR A;  3PR4 A;  5L9X A;  3GQC A;  5KFH A;  1WCN A;  4DLE A;  2Y1J A;  7ICU A;  5KG1 A;  9ICT A;  2JZB A;  3RR7 A;  4X4R A;  2B21 A;  3SV3 A;  2C22 A;  3AQM A;  5KFP A;  2ZJ8 A;  2XGQ A;  5J0O A;  3PX4 A;  1NJY A;  1X2I A;  5L1I A;  8ICT A;  8ICU A;  3H4B A;  2HHX A;  4GC7 A;  4FBT A;  4AT8 A;  4RPX A;  4YN4 A;  3AUO A;  3WFS C;  5KG5 A;  3RR8 A;  9ICJ A;  5EWF A;  3FDS A;  5CR0 A;  8ICO A;  4RUC A;  4EBE A;  2R8K A;  2R8G A;  2ID1 A;  4QZI A;  3N4M B;  3Q8S B;  4P2H A;  4J9N A;  5EOZ A;  3HJ1 A;  3GV5 B;  3OGU A;  3QEB Z;  5DGB A;  3Q8M A;  2PI4 A;  1PZN A;  1N56 A;  4RUA A;  5DLF A;  5KG6 A;  3G6Y A;  4FHV A;  3IHQ B;  4F91 B;  1NK4 A;  2MUT A;  4Q45 A;  4F3O A;  4KLJ A;  2XO7 A;  4K4I A;  2O1P A;  2W9M A;  3MBY A;  4F4Y A;  3V6H A;  2XY6 A;  3H39 A;  5J0Y A;  3PR5 B;  5KFX A;  4F8R A;  2JEF A;  1SL1 A;  1BPZ A;  4Z6E A;  3EPI A;  5DGA A;  2W9C B;  1KFD A;  2ALZ A;  1ZQI A;  3RRH A;  1T8E A;  3UXN A;  4UB4 A;  2M2U A;  4MEY A;  1MIV A;  7ICS A;  5HRB A;  4R8U B;  1ZQK A;  3GDX A;  1ZQV A;  4YCX A;  4QZG A;  4XA5 A;  5HHH A;  3C5F A;  4C8N A;  2BCU A;  3Q8P B;  5DDM A;  4ED7 A;  3ISD A;  4IR1 A;  1BPB A;  1ZET A;  8ICK A;  4QWB A;  1S10 A;  4RU9 A;  3TFR A;  5J2C A;  2BGW A;  3JYY A;  5KT2 A;  4EBD A;  5J2E A;  4QZD A;  1X9W A;  2VAN A;  4BWJ A;  1JX4 A;  3AU6 A;  4KMU A;  4DF4 A;  4LZG A;  4I2I A;  2ASL A;  4YR3 A;  3RJE A;  2XC9 A;  1IM4 A;  5HR9 A;  2H5X A;  3B0X A;  4ECQ A;  3T3F A;  1NZP A;  2PBE A;  2BHN A;  3H4D A;  3Q8R B;  3M8S A;  3TAN A;  1L3U A;  5D46 A;  2V4Q A;  2FLL A;  1XSP A;  4P4P A;  3MAB A;  3GIK A;  3T5K A;  4RQ3 A;  3PW5 A;  3RJG A;  4YXM A;  4YD2 A;  4X4N A;  1RXW A;  1NKB A;  2PFQ A;  3PNC A;  7ICO A;  4M9L A;  2ZTC A;  5L1K A;  2JEJ A;  3V7K A;  4C8M A;  4I2H A;  2ZUD A;  2KZM A;  1UET A;  4NY8 A;  4RQ4 A;  8ICB A;  1HUZ A;  2DFL A;  3C1Z A;  3MGH A;  3EYZ A;  3SYZ A;  4DQS A;  5HHI A;  4M9N A;  4NKT A;  4DL5 A;  2KFN A;  3ETL A;  3PML A;  3N97 B;  5DB9 A;  5BOM A;  2O5A A;  2DRB A;  3RJH A;  5KT4 A;  1NJX A;  4EBC A;  7ICH A;  4WCW A;  3WFO A;  4DFM A;  5III A;  3JPP A;  4UQG A;  2ASJ A;  3GFK B;  2IHM A;  2BDP A;  2P66 A;  4RZR A;  3LDA A;  4F4Z A;  4F5O A;  4M47 A;  1BNP A;  4WBZ A;  1BPD A;  5TZV A;  4E7X A;  2I1Q A;  3THV A;  4R66 A;  4DQR A;  4KIT B;  3QEA Z;  1X9S A;  3HX0 A;  4KLT A;  1UEV A;  4QWD A;  1UA1 A;  4RT2 A;  2BQU A;  1ZQN A;  4G3I A;  3HP6 A;  4BXO B;  2KN7 A;  3C18 A;  3H3A A;  2AQ0 A;  7ICE A;  4JV1 A;  1R8B A;  4DSE A;  2HHT A;  4QWE A;  4DSJ A;  4IQV A;  1U4B A;  1TK5 A;  3RJI A;  1S0V A;  9ICX A;  1KDH A;  2BCS A;  4KLL A;  5HRG A;  5DQI A;  3EPG A;  4DOB A;  4DL6 A;  1L5U A;  5KFJ A;  4DSK A;  3GII A;  2FMP A;  1Y88 A;  5KFT A;  4DEZ A;  1ZQL A;  3C5G A;  3AU2 A;  3PW7 A;  1S0O A;  3BDP A;  5DB6 A;  5J0T A;  8ICP A;  4RQ6 A;  1ZQY A;  5J2H A;  1MIY A;  4FHY A;  2IHN A;  5KG7 A;  4KLQ A;  3RAQ A;  3T5H A;  1TK8 A;  2IMW P;  4RQ5 A;  3HPO A;  1V9P A;  1L3T A;  4NLN A;  3TAQ A;  3H38 A;  5J2J A;  5J2B A;  2UVR A;  4B9V A;  1ZYQ A;  4WC1 A;  3GIJ A;  2BPC A;  5J0W A;  4M5D A;  2ZJ5 A;  3OUY A;  1JIH A;  2FMS A;  4M2Y A;  1D9F A;  4MFA A;  1UEU A;  3UXP A;  4GXI A;  5DBB A;  3SV4 A;  8ICE A;  3GIL A;  4E0D A;  1OU5 A;  2HHQ A;  4ZH4 A;  1TVA A;  1NK0 A;  2FPL A;  4EBK A;  3OVS A;  4F50 A;  3ZDE A;  4I2F A;  2J6T A;  5CB1 A;  4ED2 A;  2C2D A;  4KLG A;  1QSL A;  1ZQB A;  2KTQ A;  5F9N A;  2BPF A;  2HHV A;  4F5P A;  2P6U A;  5DQG A;  3T5J A;  4C8K A;  4DSL A;  4WC2 A;  4DQI A;  4QZH A;  2JEI A;  2M2V A;  4RQ0 A;  3BQ2 A;  3AQK A;  2W9B A;  4AT9 A;  5IIM A;  5HMM A;  4RQ1 A;  4ECR A;  4O0I A;  4DL7 A;  2Y1I A;  7ICR A;  3EWA A;  4ECV A;  1T3N A;  1DK2 A;  7ICK A;  3PW4 A;  4ED8 A;  4DF8 A;  4KLH A;  5DBC A;  1UA0 A;  3RRG A;  4BDP A;  4DFJ A;  4JWM A;  4DL2 A;  2MAX A;  1KSP A;  1Q78 A;  4DSF A;  1SL0 A;  5DG7 A;  4I28 A;  2ASD A;  3ZDB A;  2NRW A;  1RYR A;  2UVW A;  4J9P A;  4AT9 B;  1WCL A;  4M0A A;  1QTM A;  1Q79 A;  4X4S A;  5KT3 A;  3BQ1 A;  2PXI A;  5IIL A;  3RBD A;  3RAX A;  4MF8 A;  3UPQ A;  2Q0Z X;  4O5E A;  2HW3 A;  1U49 A;  5HRI A;  3OV7 A;  4TQS A;  9ICI A;  3MR6 A;  4I2G A;  4ECW A;  1NK6 A;  5KFW A;  2PFO A;  5HRH A;  3QZ8 A;  1MQ2 A;  1ZQR A;  4UB5 A;  1D8Y A;  4PGY A;  1KNY A;  3V7J A;  4X4U A;  4UD5 A;  3GV8 B;  4XQ8 A;  8ICM A;  9ICC A;  3RH5 A;  4YMM A;  1A76 A;  3OHB A;  3KHL A;  2FLP A;  5HRD A;  2ZH7 A;  4DWI A;  2AGQ A;  3LQC B;  3B0Y A;  4I27 A;  1U47 A;  1ZJN A;  4IRC A;  5J2D A;  4PHP A;  2XCA A;  1XS9 D;  2FLN A;  4BWM A;  5CJ7 A;  3EZ5 A;  3JPN A;  4ECX A;  3V6J A;  1XC9 A;  2FMQ A;  5HC9 A;  3G6X A;  4EEY A;  2DPJ A;  9ICH A;  4O3P A;  4C8O A;  4M6W B;  1ZQT A;  4NKU A;  1ZQC A;  7ICM A;  2F1J A;  1SZP A;  4K4G A;  4PPX A;  2M2T A;  1DGS A;  2LYH A;  4ED3 A;  1XSN A;  1X9M A;  5DBA A;  4LVS A;  5F2V O;  3H8W A;  1LB2 B;  3TAP A;  4PHD A;  3UQ0 A;  4DLG A;  3TAR A;  3MDA A;  3ORY A;  5J29 A;  4QZB A;  2KP7 A;  2ZH8 A;  3JPQ A;  3RB6 A;  1RZT A;  5DKW A;  2AJQ A;  1L3S A;  3RBE A;  2VA3 A;  2IBK A;  1HUO A;  7ICG A;  3ZD9 A;  9ICU A;  2RFF A;  4FH5 A;  1RPL A;  5HML A;  4FBU A;  1L3V A;  3JZ0 A;  1JAJ A;  4LT6 A;  4UAZ A;  1ZQS A;  4YP3 A;  8ICZ A;  1BNO A;  1ZQA A;  5KFZ A;  2NRT A;  4J9R A;  3H7I A;  3M9O B;  2A1J A;  3AQL A;  4ECY A;  4RWP A;  5KT6 A;  4EZ6 A;  5EWG A;  1IXR A;  2DR7 A;  3RJJ A;  1Z00 A;  4PGX A;  4BXO A;  2ZHA A;  3PX6 A;  4B9N A;  1ZQF A;  4RQ2 A;  1ZQU A;  2AGP A;  3ZDC A;  4JWN A;  2M9N A;  5KT5 A;  1BPX A;  1TAU A;  9ICN A;  4M9H A;  5KFE A;  4E8F A;  3T5L A;  4TQR A;  2ZHB A;  4RPY A;  4Z6C A;  4I2J A;  2XGP A;  4IQW A;  1S0M A;  1S77 D;  3RTV A;  4KLI A;  3PW0 A;  2HHW A;  1TFR A;  3WFP A;  1EXN A;  3EW9 A;  5KFK A;  4UAW A;  4LZD A;  4RQ7 A;  4O3N A;  3JPO A;  2ISO A;  2KZZ A;  8ICN A;  7ICP A;  5HRL A;  3OJS A;  3H8S A;  1K1S A;  5KFR A;  7ICN A;  3C1Y A;  1VFG A;  3OVB A;  9ICV A;  1R8A A;  4KLU A;  4RWQ A;  4ELT A;  5J2G A;  2ZH9 A;  3LWL A;  5KFB A;  1C7Y A;  1T4G A;  1MC8 A;  7ICJ A;  5EWE A;  5KFY A;  3KHG A;  1B22 A;  4B9T A;  4M04 A;  9ICO A;  2DR5 A;  2JEG A;  4X4T A;  4P4M A;  1T7P A;  4O3R A;  5J0Q A;  4FO6 A;  5DB7 A;  2HVI A;  9ICK A;  4KLF A;  1COO A;  5J2I A;  2C28 A;  5DLG A;  1U48 A;  1NJW A;  3RJK A;  2HVH A;  1KEJ A;  2HHP A;  2BCR A;  5J0P A;  2F1I A;  4DSI A;  2AQ4 A;  3MR3 A;  4NLZ A;  2M2W A;  4RWO A;  4X0A A;  1Z3E B;  4X0B A;  2F1H A;  1CUK A;  2FPK A;  1R89 A;  5DED A;  2RDI A;  3ISB A;  1KTQ A;  4DOC A;  4TUR A;  1ZQP A;  5J2A A;  4J9K A;  9ICG A;  4XQ7 A;  3NYB A;  8ICG A;  4YVZ A;  1BGX T;  5KT7 A;  1KLN A;  2R8J A;  2Q66 A;  5KFQ A;  5DG9 A;  2XCP A;  1NK7 A;  4ECZ A;  1S9F A;  1TV9 A;  4X4O A;  1TFW A;  5KFU A;  4F5N A;  3KTQ A;  5KFG A;  3JPR A;  4I29 A;  7ICL A;  3M9M B;  9ICB A;  1H38 A;  1XU4 A;  5J2K A;  4Q8E A;  4FHP A;  8ICL A;  2NRZ A;  4KN7 A;  1CEZ A;  3RJF A;  3WFQ E;  5KFM A;  4S3N A;  1SKS A;  3H37 A;  4UD4 A;  1K1Q A;  4FHW A;  4FS1 A;  2BPG A;  5HRE A;  4DOA A;  4JUZ A;  4I2A A;  4FH3 A;  1VJ7 A;  2VA8 A;  1BPE A;  4NXZ A;  1KFS A;  1ZQZ A;  4RNM A;  5D4B A;  2XY7 A;  3PV8 A;  4JK1 A;  4R8U A;  5CA7 A;  1NK8 A;  1SKR A;  4I2E A;  4FHX A;  4I2D A;  3OUY B;  4AT7 B;  4NLG A;  3NGD A;  3QZ7 A;  1ARO P;  4Q44 A;  4R63 A;  1ZQD A;  2C2R A;  9ICR A;  3OVA A;  3V6K A;  4NLK A;  1B43 A;  4O3Q A;  3H40 A;  4E80 A;  4DO9 A;  1F5A A;  4GXJ A;  4YR0 A;  3M8R A;  1MIW A;  3TQ1 A;  4MFF A;  4O9M A;  4QWA A;  4O3S A;  1MSW D;  4YMO A;  5L1L A;  3OJU A;  3TI0 A;  4B9M A;  3UPS A;  4XUS A;  3RB0 A;  8ICI A;  2V9W A;  4ECT A;  2AU0 A;  2OWO A;  1A77 A;  4KN4 A;  4F92 B;  5DEC A;  1SL2 A;  8ICJ A;  4RNN A;  4C8L A;  2DR9 A;  4O5K A;  4BGD A;  4R64 A;  3C21 A;  2W9B B;  1N48 A;  1RXV A;  4J9L A;  4KLD A;  4WC6 A;  2ZH4 A;  3FYH A;  5IIO A;  2BR0 A;  3PX0 A;  1BPY A;  4ECS A;  2ZH2 A;  3H8J A;  1QSY A;  2ZTE A;  2HHU A;  5KG4 A;  3ISC A;  1XWL A;  5J0S A;  3M9N B;  2ISP A;  2NRV A;  3QE9 Y;  3LK9 A;  1ZQO A;  4KLO A;  4HYK A;  3KHH A;  1RYS A;  4I2B A;  4ATB B;  1NK5 A;  4O3O A;  4QW9 A;  1JMS A;  3PVX A;  8ICV A;  3PMN A;  8ICF A;  8ICC A;  2KZ3 A;  4WC3 A;  3MFH A;  3Q8L A;  1S76 D;  2ZUC A;  1JN3 A;  5HNK A;  2R8H A;  4TUS A;  2RDJ A;  5DQH A;  3RH4 A;  1JXE A;  4B9L A;  7ICF A;  5KFN A;  4IRD A;  4QZE A;  2BE3 A;  5HRK A;  2FPM A;  9ICS A;  5KFO A;  4QWC A;  1SKW A;  4DS5 A;  2KFZ A;  4QZA A;  2DPI A;  1R8C A;  4X4P A;  3MGI A;  2BQR A;  2PFP A;  2A1J B;  4YG2 A;  4YXJ A;  2W8K A;  4JV2 A;  4KLS A;  2C2E A;  9ICL A;  4XRH A;  4Z6D A;  4QZ8 A;  4QZ9 A;  4UB2 A;  2W9A A;  1ZQE A;  9ICW A;  4F4K A;  4EYI B;  8ICQ A;  9ICF A;  2HHS A;  1ZQQ A;  1NKC A;  1XO1 A;  4F93 B;  1HJP A;  4M9J A;  4RNO A;  2DR8 A;  3JPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...