4M9GA

Dna polymerase beta e295k binary complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
325
structure length
314
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 103
structure length 314
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9gA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9gA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9gA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9gA03
2P6UA 3JPTA 4QZIA 4NKUA 1PZNA 4O3OA 3MDAA 1B22A 4F92B 4WC0A 3T5LA 2ALZA 2PFQA 3JZ0A 2BPFA 5HP4A 5IIOA 2NRKA 1IM4A 4KLGA 2FMPA 4FHXA 2JEJA 2AGOA 3GIKA 3B0XA 4O3SA 4KLHA 4LZDA 4PGYA 1D8LA 1KRPA 1RXWA 9ICEA 4WC1A 4MEXA 4KLOA 2IBKA 1XSLA 3OGUA 1NJWA 4ED3A 3RJKA 4DS5A 4B9UA 4K4HA 4J9SA 4X4VA 5KT7A 1UA1A 3RB0A 4KLQA 4WCWA 4AT9A 1JMSA 4DEZA 4I2HA 1KEJA 4YN4A 4X4SA 5KG5A 3H3AA 3ISBA 1TKDA 2BGWA 1U48A 1T3NA 4NLNA 5J0TA 4WC2A 3C1ZA 4RQ6A 4J9KA 2DR7A 9ICOA 8ICRA 2H5XA 4JWMA 1NK0A 2JZBB 2Y1JA 5J2IA 3N97B 4DQPA 2ZH2A 4ECQA 3HWTA 2PI4A 5CWRA 4C8LA 8ICLA 4RT3A 2ZJ8A 4IQWA 3EW9A 4KLTA 1V4AA 4NKTA 1NKEA 5F2VO 3B0YA 2ZUBA 4O0IA 3AQMA 3C1YA 1L3SA 5D4BA 5HREA 4ECWA 4JWNA 4YD1A 5KFNA 3Q8MA 4RZRA 5DB9A 1Y88A 4UBBA 5DDMA 1TAQA 4UB4A 2ASLA 5KG3A 2W9MA 3Q8RB 2BR0A 1ZQJA 1D9DA 4F3OA 1HUOA 2DR5A 3MFHA 1XSPA 3PR5B 4YR2A 3SV4A 2NRXA 3LDAA 4EYHB 5HRIA 4ED2A 3QZ7A 3PO5A 4DQRA 4O3QA 1BPBA 4UB2A 1ZJMA 4EBKA 4KLDA 3MGIA 4FBUA 3Q8KA 1BPXA 2IMWP 4O5CA 3OV7A 1TK8A 1NJYA 9ICFA 5CJ7A 2JEFA 4DWIA 3LWLA 1H38A 2FMSA 1BGXT 4M0AA 8ICOA 4DL3A 4RQ1A 8ICIA 3IM1A 4IG8A 4QWEA 4O3NA 4FHVA 1B43A 4Z6DA 4O3PA 4R63A 5KT4A 2BQRA 3TARA 4I2BA 2PBEA 3MR3A 4DFJA 3RJHA 3RR8A 2C28A 4C8OA 5J29A 2XY7A 1IXRA 5KFDA 4BDPA 8ICUA 5KFWA 4DL6A 1CEZA 9ICIA 4RPZA 3ISDA 2XCAA 4ED1A 4DL4A 4B9NA 5KFKA 7ICRA 5KFRA 4KLUA 1KSPA 4FH5A 4R66A 4RUCA 2IHNA 4KLJA 9ICAA 4UB3A 8ICSA 3LK9A 4DSKA 3T5JA 4X4PA 2ZTEA 9ICQA 1NZPA 1AROP 3WFQE 2UVUA 1F5AA 4Z6FA 3V7LA 5CA7A 4ED7A 2AU0A 5DB6A 5J2FA 3C18A 3PMNA 4RNMA 7ICVA 2DR8A 2ZH6A 5DEDA 5KFVA 1KDHA 2HHTA 1ZQEA 4KITB 1XO1A 2AGQA 2XC9A 5IIKA 1PX5A 4UD4A 5EWGA 1WCLA 5J0XA 1UT8A 3AQLA 5KFPA 1ZQFA 4PHEA 4EZ9A 2DR9A 2MUTA 4NLGA 7ICUA 4P2HA 4O9MA 3OVBA 9ICXA 1DGSA 3MGHA 1D8YA 1NOMA 1Z3EB 1BPEA 5DBCA 3MBYA 5J2DA 1NJXA 9ICNA 2ZHBA 4EBDA 3AU6A 1T4GA 3TAPA 4PPXA 4YR0A 2ASJA 4IR9A 8ICQA 1DK3A 9ICGA 4TURA 5DQHA 5KFTA 4TUQA 1DK2A 4YR3A 3EZ5A 4AT8A 1VFGA 2F1IA 2ZTCA 1Z00B 1ZQAA 2M2WA 2Q66A 5KFMA 1JX4A 2R8GA 4UQGA 3LWMA 1MQ3A 2HHXA 4FBTA 1HJPA 2UVRA 5KFUA 4UD5A 1R8BA 3RRHA 8ICYA 4X4RA 2C22A 3T5KA 7ICLA 4UB5A 1X9SA 3PO4A 4PH5A 3MFIA 3OSNA 1QSSA 1U45A 2FLNA 9ICLA 1ZQPA 4ECZA 4B9SA 4F5RA 4O5KA 4PGXA 4F8RA 3OVAA 4YQWA 5J0UA 1BPYA 1BNPA 3OHAA 2PFOA 1R89A 4WBYA 2ZH5A 4F50A 3C21A 1ZQVA 1SL2A 2BHNA 1UT5A 5EOZA 3HT3A 2ZTDA 8ICFA 8ICJA 3RB3A 1KLNA 8ICNA 3GIJA 3PVXA 1C7YA 4YMOA 2WTFA 2FLPA 4DSJA 4Q8EA 5J2JA 5KG7A 2V4QA 8ICEA 2LYHA 2KFNA 5HRBA 4KLIA 4S3NA 9ICTA 5DKWA 3MABA 3PW4A 2XGQA 4DOBA 3BQ0A 4JUZA 4FS2A 2FPMA 5HRLA 4RQ8A 5IIIA 3EPGA 3K75D 4ECYA 5BPCA 9ICSA 4I29A 1KTQA 4DSEA 2KZMA 4F4KA 5KFZA 4RPYA 4DL2A 2W9AA 3QEAZ 5F9LA 1BPZA 5L1JA 2FLLA 5HMLA 2BCQA 4IR1A 4ECVA 2DPIA 4IRDA 5TZVA 1S0VA 4RQ4A 1L3UA 3RAXA 7ICSA 4DL5A 4TQRA 3RJIA 2XY5A 4DOAA 3Q8PB 2ZJ5A 4O3RA 1N48A 1TK0A 4ELTA 3G6YA 3EPIA 4F4XA 4QZ9A 5KG6A 3OHBA 2C2EA 5KFEA 1ZQKA 3OUYA 4RNNA 4WC7A 1KNYA 4Z6CA 2NRZA 3HPOA 5L1LA 8ICGA 9ICVA 4J9PA 5J0SA 1Q79A 4DOCA 5DLGA 4Z6EA 4M9JA 2DPJA 2J6SA 1ZQRA 1D9FA 8ICXA 2ZH3A 4UAYA 1XWLA 4QZFA 4QW9A 4BXOA 2Y1IA 2PFNA 4I2CA 7ICEA 2ZHAA 1ZQIA 3H4BA 2HHUA 2VA2A 3RJGA 5KFAA 5L1KA 7ICHA 4KN7A 4NXZA 2UVWA 3HW8A 5KFCA 4LT6A 4J9MA 4P4OA 4QWCA 3QE9Y 4Q8FA 3GQCA 2BCVA 3ORYA 1VJ7A 3M9OB 1QLNA 2ID1A 8ICPA 5J0RA 2W8KA 4J9LA 3UQ0A 1XC9A 4ECRA 2PXIA 1S0OA 2F1JA 1QSYA 2PFPA 4QZAA 3T5HA 3Q8LA 1ZQUA 3PX6A 3RB6A 2KFZA 4M9LA 2Q0ZX 4X5VA 2NRWA 4KTQA 4J9NA 4GC6A 3RBDA 3RJJA 4MFCA 1ZQWA 5DQIA 4YCXA 2R8HA 1T7PA 3V6JA 4NM1A 2P6RA 8ICVA 5J2EA 2ASDA 3RB4A 2J6TA 3HJ1A 4RU9A 1ZQNA 4P4PA 4DQIA 2MAXA 4PHAA 4GXKA 4YFKA 4B9MA 9ICJA 4ZH4A 4GXJA 4LZGA 2ATLA 8ICKA 4F91B 3C5FA 4FO6A 4BXOB 1HUZA 3JPOA 2ZH7A 3KHGA 3RBEA 2VA8A 5DB7A 3SZ2A 4QZGA 1ZQDA 1ZQGA 4G3IA 4FHPA 4EBJA 3MR6A 3PX0A 4ED0A 4X0BA 4X4QA 2ZH9A 5DQGA 4DF4A 2HHWA 3ISCA 2M2VA 2PI5A 4WC4A 1SKSA 4UBCA 2FPKA 5KFJA 4QZHA 4MFFA 3EYZA 1KFDA 1JAJA 2O5AA 5J2BA 1TVAA 2ZUCA 5L9XA 2RFFA 3H40A 3PX4A 2NRVA 4BGDA 1ZQCA 4KLMA 1Q78A 4QZ8A 3GIIA 4UB1A 3HX0A 3BJYA 3SI8A 3RRGA 3PR4A 9ICWA 1WOTA 4AT8B 4NY8A 5HC9A 4EEYA 3HJ4A 3WFRE 4FH3A 4RUAA 2IHMA 4X4NA 4WC6A 3KHRA 1SL1A 1TFWA 3PV8A 4XA5A 5J0QA 4AT7B 4M9NA 4TUSA 2HHPA 4DLGA 7ICGA 4WC3A 4R65A 4MEYA 2MUTB 3V7JA 1K1SA 5DG8A 4X0AA 3OSPA 4YD2A 4E7XA 2HVIA 1CUKA 4RWNA 8ICMA 3MR2A 1JQRA 1ZQHA 1ZQTA 1UEUA 3V6KA 1MQ2A 5KT2A 1KFSA 2HHSA 7ICJA 1KFTA 3AUOA 4TQSA 1COOA 5KFFA 3OJSA 1NKBA 4I2EA 2NRTA 1T8EA 8ICZA 5HRHA 2ZH1A 5KFSA 2VA3A 4M2YA 4I2GA 5KT3A 4YXMA 5J2KA 4RQ0A 4ED6A 2XO7A 3WFPA 3AQNA 5J0OA 3H8WA 3L9DA 4R8UB 2RDJA 4K4GA 5J0PA 2P66A 1S76D 4RWOA 3RH6A 1YLQA 1ZQXA 4NLKA 4IQTA 4RWQA 3GFKB 4F5QA 1XSNA 4LVSA 4KLSA 3UXOA 5KFLA 3ZDDA 2AJQA 8ICCA 4M6WA 1X2IA 5D46A 5EWEA 4J9RA 4C8KA 5KFOA 9ICMA 2KP7A 4JV0A 2V4RA 4E8FA 2DVIA 2M2UA 5J2GA 1L3TA 3SYZA 2ISOA 3JPRA 2BQUA 4YVZA 4F5PA 3T3FA 4MF2A 3JPSA 4TUPA 3KHLA 2ZH8A 3V72A 1ZQLA 4F2RA 1ZQQA 4K4IA 3IHQB 5D49A 3M9NB 4DQSA 1ZQMA 4M04A 3KTQA 4B9VA 1A77A 3ZDCA 4QWDA 4QZEA 3M9MB 5DG7A 5J0YA 2F1HA 3RTVA 2JEIA 3ZD9A 3PW7A 3ZDBA 3PMLA 4RQ2A 4GC7A 4CCHA 4RT2A 1ZQYA 5C5JA 5KFBA 3TFSA 3H39A 3RAQA 1SKWA 4B9TA 4R64A 2BDPA 2BPCA 3C66A 4AT7A 3HP6A 4NM2A 3M8RA 2XGPA 1UETA 2C2RA 3PW5A 1EXNA 3TI0A 1NK7A 3NYBA 3K4GA 5DBBA 3KHHA 4QZDA 4P4MA 3C2KA 1BNOA 3WFSC 9ICRA 1S77D 1NK4A 5DG9A 5KG4A 4YP3A 3QZ8A 3AU2A 3PW2A 4FHYA 4PHPA 4M6WB 1JN3A 2RDIA 4F93B 2W9CB 1WCNA 1ZYQA 5J2CA 2OWOA 4ELUA 4M9GA 3WFOA 4RQ3A 4FS1A 5HHHA 5J2HA 2ZUDA 4DF8A 3H38A 5KFXA 2A1JB 1RXVA 2J6UA 3E2EA 1TFYA 1XU4A 3OVSA 5KFYA 2AGPA 9ICPA 2O1PA 2HW3A 3RJFA 1SKRA 2R8KA 4ATBB 1R8AA 4KN4A 4QW8A 1NJZA 5KFHA 4YMMA 1ZQSA 3BQTA 4RQ5A 1N56A 1LV5A 4RWPA 3ZD8A 5DBAA 4HYKA 2JZBA 3GV5B 3V6HA 2BCSA 2UVVA 5HRKA 3EWAA 1L3VA 1TK5A 7ICKA 2W8LA 9ICKA 4FHWA 4DFPA 5J2AA 1X9WA 2C2DA 3TQ1A 5DGBA 4XUSA 4ECSA 1QTMA 3ZDAA 7ICOA 4X4OA 4M5DA 3UQ2A 5DB8A 1RYSA 4WC5A 5CP2A 1L5UA 3UXPA 2IA6A 7ICMA 3H7IA 4I28A 2JEGA 4DLEA 1XS9D 1JXLA 4F2SA 3UPSA 2VANA 2FPLA 1MIWA 1S97A 5L1IA 5KT6A 4B9LA 5IILA 4IRCA 4DSFA 3TAQA 4I2IA 1ZETA 2GWSA 3TANA 4YXJA 1UA0A 1NK5A 4BWJA 1U47A 4ATBA 4KLLA 5CR0A 1MIVA 4NLZA 9ICCA 4BWMA 3ZDEA 1ZQOA 1ZQBA 4GLXA 9ICBA 4X4UA 4I2DA 3MR5A 1DOQA 5KT5A 1OU5A 1TAUA 4QWBA 2R8JA 1RPLA 2ISPA 4I2FA 5HRDA 4F4ZA 3BQ2A 4ECUA 3Q8QB 4ELVA 4QWAA 5HRGA 4XQ7A 3JPQA 4ED8A 3RJEA 3OUYB 2M9NA 4GXIA 2KZ3A 2BCRA 5KFQA 4EBCA 1MSWD 5HRFA 2R8IA 2BKEA 3JYYA 5DDYA 2XCPA 4YG2A 3PNCA 3C23A 5HNKA 3SV3A 1BVSA 4QZCA 9ICHA 5HHIA 1U9LA 5IIJA 4DQQA 8ICBA 3MDCA 4C8NA 4J9OA 4IRKA 4JV2A 3BDPA 2HHVA 9ICUA 1U4BA 3LQCB 3PY8A 5CHGA 2I1QA 4EP7A 3N4MB 1TV9A 8ICHA 4MF8A 5KG0A 1Z00A 2KN7A 1X9MA 1JIHA 1FA0A 3H37A 2DRBA 2XY6A 4DO9A 4ECTA 1RZTA 1S0MA 8ICWA 1NO5A 3JPNA 2DFLA 7ICTA 4EYIB 4F5NA 4RNOA 2FMQA 5DECA 3NGDA 5IIMA 4AT9B 1NK6A 3NTUA 1S9FA 3BQ1A 3M8SA 4EZ6A 2DRAA 1K1QA 5JUMA 4DFMA 1QSLA 4JV1A 4DS4A 5IINA 4PHDA 3RH5A 4E0DA 4I27A 1V9PA 3TFRA 2V9WA 2KZZA 4MFAA 2W9BA 1A76A 3GV8B 1TFRA 4YMNA 2BPGA 1S0NA 5KFGA 4EBEA 1ZJNA 7ICNA 4JK1A 2ZH4A 3H8SA 4Q43A 3C2MA 4XRHA 2BQ3A 4F5OA 3GILA 4C8MA 4J9QA 1NK9A 8ICTA 3ETLA 4DFKA 1SZPA 2W9BB 5DLFA 3QEBZ 3UPQA 3FYHA 2I9GA 4KLFA 5HMMA 1JXEA 3GDXA 2HVHA 1LB2B 2BCUA 3GV7B 3FDSA 3HIYA 5KTQA 3C2LA 2ZJAA 4M9HA 5HR9A 2BE3A 3G6VA 5BOLA 4KMUA 7ICPA 1MIYA 4R8UA 4RPXA 4IQVA 3RH4A 4UAWA 1NKCA 4I2AA 1U49A 3PW0A 2A1JA 3UXNA 4DL7A 2AQ4A 4Q45A 4I2JA 1NK8A 4KLEA 2KTQA 5KFIA 3AQKA 3Q8SB 5KG1A 3G6XA 3H4DA 4F4YA 3C5GA 4ECXA 1RYRA 4WBZA 5BOMA 2W9CA 4IQUA 1SL0A 1R8CA 5DGAA 4F4WA 7ICFA 3RR7A 3H8JA 4UAZA 5KG2A 4DSIA 1ZQZA 5CB1A 4QZBA 5F9NA 3THVA 8ICAA 3OJUA 7ICQA 1UEVA 4X4TA 1S10A 2M2TA 7ICIA 4Q44A 4RQ7A 4DSLA 5J0WA 4E80A 4XQ8A 2B21A 3GIMA 2HHQA 5EWFA 4M47A 3V7KA 4O5EA 1MC8A 3JPPA 1BPDA 2AQ0A 4PGQA
chains in the Genus database with same CATH superfamily
4NXTA 1B22A 1YZ7A 4WC0A 2BPFA 5IIOA 4O68A 4KLGA 4ATBB 1N60A 2K60A 4WC1A 2HI0A 2KE7A 4K97A 4K4HA 4K9BA 4J9SA 4WH5A 4DEZA 4I2HA 4YN4A 1DGJA 3ISBA 4J03A 1T3NA 2DR7A 8ICRA 2H5XA 2WHEA 1X66A 3MCRA 4KX3A 2D3DA 2PI4A 3HWTA 8ICLA 4DFDA 2LYAA 4IQWA 1V4AA 2XI9A 4O0IA 1L3SA 1D8BA 4JWNA 5ALJA 4CF5A 2HBKA 5ALGA 5DB9A 1OW5A 1TAQA 1YT3A 4UB4A 3QXGA 2YMLA 1HUOA 2R18A 1RYUA 4YR2A 5HRIA 3QZ7A 4O3QA 1BPBA 2QB0A 2ZIXB 5EE9A 1NJYA 3VCBA 5CJ7A 4KMOB 1PK1A 4M0AA 2FMSA 5L1MA 8ICOA 4OD0A 3ONNA 4U6PA 4RQ1A 1B43A 4I2BA 3TARA 4OAHA 2C28A 2Y0SF 5J29A 4BDPA 8ICUA 5KFDA 3ISDA 1AQ6A 5KFKA 4FH5A 4FZNA 2A1AA 4KLJA 4FO1A 2KKVA 1UPHA 2QARB 4P0QB 1ZQ1C 2K8BB 5EE1A 5CA7A 5J2FA 2DR8A 5HR6A 4KITB 5CEHA 3ERCC 2KIVA 1WCLA 4NLGA 7ICUA 3OVBA 9ICXA 1NOMA 1RDFA 1BPEA 1Z3EB 3MBYA 9ICNA 1KKXA 4YR0A 4IR9A 8ICQA 9ICGA 5DQHA 1LVHA 1S5LU 1ZRMA 3GU3A 3HJEA 2HHXA 4FBTA 2EWRA 2W7PA 8ICYA 2EAMA 2FLNA 3HKZF 4F8RA 3PSTA 1BPYA 4ACOA 3OHAA 2PFOA 1CI4A 3C29A 4F50A 2JXJA 3C21A 1SL2A 2ZTDA 3RB3A 3S6JA 2YMMA 1SGGA 5HRBA 2WF5A 1JALA 4S3NA 9ICTA 1KL9A 4O6AA 3EPGA 4USAA 2JMGA 5BPCA 2HBMA 4F4KA 2FLLA 4IR1A 4IRDA 4ECVA 1S0VA 1L3UA 5AM4A 3H0LB 4TQRA 3RJIA 4OJ6A 2ZJ5A 2FI1A 3G6YA 3EPIA 3OHBA 5KG6A 2F3NA 2XVTA 1ZQKA 4WC7A 1KNYA 1DXSA 1IV8A 3N28A 4C4RA 2K8AA 4DOCA 1ED1A 5DLGA 4M9JA 2DPJA 4CGZA 5K4LA 2ZH3A 3E58A 4QZFA 4PZNA 1ZQIA 3H4BA 3ALRA 3RJGA 7ICHA 3K7DA 4P4OA 3QE9Y 1VJ7A 1SV4A 1QLNA 4JB3A 1Q46A 4ECRA 2G09A 4QZAA 3PX6A 2Q0ZX 5CFUA 3HJ1A 5AKYA 4GXKA 9ICJA 4O3MA 4LZGA 2ATLA 3TKAA 3IN5A 2CRXA 2OM6A 3KHGA 5DB7A 3SZ2A 3QUQA 3MR6A 1KW4A 1ZD3A 4MKPA 2MSNA 2YY6A 1SB3C 3AQFA 4WC4A 3N7SC 2FPKA 3TADC 2O5AA 3FAHA 3OPXA 5J2BA 2NV3A 2RFFA 1ZQCA 3RRGA 4AT8B 4NY8A 4RUAA 4X4NA 3KHRA 3PV8A 4M9NA 4TUSA 4DLGA 7ICGA 4R65A 2MUTB 1RM6C 2ZIVA 3V7JA 4X0AA 4OJLA 2YTUA 2XICA 2HVIA 8ICMA 3MR2A 1ZQHA 1ZQTA 1UEUA 4TQSA 1NKBA 5KFFA 2NRTA 2ES6A 5KFSA 5J2KA 4ED6A 1Z19A 2OYYA 4C7YA 1S76D 4RWOA 1F0MA 4NLKA 4IQTA 3GFKB 4F5QA 4KLSA 2ESEA 3AEVA 4JV0A 5D62A 1L3TA 2H3VA 3T3FA 5ALXA 2JR5A 2WB1C 4K4IA 2NO5A 1A77A 4QWDA 4QZEA 5DG7A 3ZD9A 4N7RA 5HR7A 2HSZA 1NNLA 3M6KA 4RT2A 1ZQYA 4NL9C 3H39A 1SKWA 4QIWC 4B9TA 4NM2A 3M8RA 3WFSC 4JMUA 1RG6A 1S77D 1NK4A 3SEIA 5B3QA 4PHPA 2OWOA 1RQNA 4BX9C 5D61A 3NVYA 1OUQA 2CPRA 3AN1A 5J2HA 2ZUDA 3WK5A 5KFXA 2A1JB 2J6UA 3E2EA 2FJ6A 3QUCA 3OVSA 5KFYA 2AGPA 2KSOB 9ICPA 2HW3A 4FZMA 1R8AA 4YMMA 1QQ7A 3KKAA 3O0FA 3BQTA 1N61A 1N56A 1LV5A 4RWPA 2JZBA 9ICKA 2G07A 4NWIA 5AI9A 3TQ1A 5DGBA 1QTMA 7ICOA 3IV6A 1RYSA 2KJ8A 2IA6A 3H7IA 1DRGA 3AQEA 4DLEA 1JXLA 4F2SA 1MIWA 4EV6A 5IILA 4IRCA 4I2IA 2LI6A 1ZETA 3DEEA 3EF2A 5ALHA 4P0QA 1U47A 4KLLA 4I0UA 1MIVA 3NRZA 4NLZA 3ZDEA 4I2DA 1DOQA 3UMBA 2F76X 5HRDA 4ECUA 5HRGA 3JPQA 2BCRA 5KFQA 5HRFA 2G5IB 5KAFU 4YG2A 5HNKA 1BVSA 5J8YA 1X6JA 9ICHA 4DQQA 8ICBA 3MDCA 4J9OA 1VDVA 4JV2A 3EUB2 4EP7A 3CW2C 5AHXA 8ICHA 3WKAA 1JIHA 4LEWA 1RZTA 1NO5A 4EYIB 4RNOA 5AI6A 2HOQA 5JUMA 2YB1A 5AICA 1QSLA 4JV1A 5IINA 1JI7A 3RH5A 4I27A 2V9WA 5AI4A 1A76A 1TFRA 4YMNA 1A0PA 2G06A 3ETLA 1RQLA 2G08A 3QEBZ 3UPQA 4WOYA 2B56A 3GV7B 2ZIUB 3FDSA 5BOLA 4R8UA 3RH4A 1SV0C 2HMXA 3UXNA 4DL7A 4I2JA 3H4DA 2OXOA 4JLZA 5BOMA 2W9CA 2JRZA 1L7OA 1R8CA 5DGAA 4F4WA 3K1ZA 4UAZA 4U7CA 4X4TA 1S10A 4RQ7A 5AKZA 5J0WA 4XQ8A 3GIMA 5EWFA 4O5EA 1BPDA 2YQEA 4NKUA 2PFQA 2LHTA 3C28A 2HN1A 1IM4A 5G5GA 2MRLA 2JEJA 3F53A 3GIKA 4O3SA 4PGYA 1D8LA 1KRPA 5J8YC 4MEXA 4KLOA 2ZG6A 4K8VA 5B5EU 4DS5A 4B9UA 4X4VA 3RB0A 4AT9A 1JMSA 2DKXA 3H3AA 4Y2JA 2BGWA 3C1ZA 4RQ6A 4J9KA 9ICOA 4JWMA 1NK0A 2JZBB 4C8LA 4PJ0U 4Y2QA 1NKEA 3B0YA 1LKYB 5ALNA 5D4BA 5AKLA 5KFNA 1D9DA 2ASLA 1ZQJA 3CRXA 4HAIA 4O69A 3PR5B 5AIAA 2NRXA 5AKGA 2F44A 3PO5A 1PUZA 4DQRA 1T3QA 2PMZF 3Q8KA 2IMWP 1TK8A 4DWIA 1H38A 4DL3A 8ICIA 4IG8A 3KOOA 4O3NA 4FHVA 4Z6DA 2ZIXA 2BBJA 2XY7A 3L5KA 2DWQA 5AKJA 4LJXA 1WUDA 1J97A 9ICAA 2IHNA 2W7OA 3T5JA 4X4PA 2D8CA 5AKHA 9ICQA 3WFQE 1F5AA 4Z6FA 4ED7A 5ALVA 2AU0A 3PMNA 7ICVA 5KFVA 2GAFD 3WU2U 4UD4A 5EWGA 5KFPA 2P35A 2MUTA 1D8YA 3A0BU 5DBCA 1T4GA 3TAPA 2GO7A 3SQIA 5CRXA 2N1RA 1DK2A 4TUQA 4YR3A 4AT8A 3WK7A 2M2WA 5KFMA 1JX4A 1MQ3A 2RHFA 2E8OA 1Z1VA 1NZBA 3RRHA 2C22A 4UB5A 1X9SA 4PH5A 3MFIA 9ICLA 1U45A 5AKXA 1ZQPA 4O5KA 1ZRNA 2ZH5A 1SXEA 1ZQVA 5EOZA 2K4IA 4XJEA 3GIJA 3PVXA 1C7YA 5B3PA 5H2FU 4Q8EA 5J2JA 3PW4A 4DOBA 4FS2A 2OCEA 1WYGA 5IIIA 3K75D 4NXUA 1OXJA 1XO0A 9ICSA 1GPJA 3DDHA 2KZMA 3D6JA 5ALSA 4DL2A 3QEAZ 1N63A 4OJPA 4LEYA 3FM9A 3RAXA 4DL5A 2HOFA 2XY5A 4DOAA 2KVCA 4QZ9A 2C2EA 2KMDA 5KFEA 2F8LA 4Z6CA 2NRZA 2IHOA 3HPOA 5L1LA 4J9PA 5J0SA 1MN8A 5ALQA 5EE3A 4Y2VA 4BXOA 2Y1IA 1PK3A 3QU2A 3DV9A 2WF7A 5L1KA 4NXZA 2UVWA 3HW8A 5KFCA 4LT6A 8ICPA 3UQ0A 1S0OA 3Q8LA 1ZQUA 4M9LA 2FE9A 4KTQA 3RJJA 4MFCA 3N7RC 2P6RA 2YN4A 3RB4A 3FC4A 1FO4A 4RU9A 1ZQNA 2MAXA 4PHAA 1HEKA 4BJQA 4F91B 4BXOB 3F5EA 3RBEA 2KSOA 4UAUA 1ZQDA 1ZQGA 4ED0A 2W43A 4DF4A 2M2VA 4X4QA 5A0LA 4QZHA 1KFDA 1JAJA 2ZUCA 3H40A 3PX4A 2BZFA 1Q78A 4QZ8A 1N5WA 4UB1A 3BJYA 1WOTA 4EEYA 3HJ4A 2OEHA 1TFWA 4XA5A 2DKZA 4AT7B 1L8OA 3NRWA 5ALKA 3BZCA 4YD2A 4UAVA 7ICJA 1KFSA 1COOA 1T8EA 3CNHA 4IS7A 5HRHA 2VA3A 4M2YA 1VLBA 3JCFA 3L9DA 2RDJA 3CYMA 5J0PA 3OUYB 2H3FA 1ZQXA 1MC8A 3UXOA 4Y2SA 1X2IA 4J9RA 3QUBA 1VJ5A 2V4RA 4P0PA 2M2UA 5J2GA 3SYZA 2BQUA 3NUQA 3V72A 3IHQB 5D49A 3M9NB 2HHWA 3M9MB 2F1HA 2HN2A 3I76A 3ZDBA 3PMLA 3TFSA 2E5SA 2YMPA 2BPCA 3HP6A 1EXNA 3TI0A 2EZZA 3C2KA 3SENA 5DBBA 3WK9A 3AL0B 3PW2A 4OCZA 1P7DA 2W9CB 2RDIA 1FIQA 3IP4B 3LVWA 4M9GA 3WFOA 4RQ3A 4FS1A 2HBLA 5HHHA 1RXVA 5AKIA 4LEVA 1SKRA 2VJ5A 4QW8A 1NJZA 5KFHA 4OAGA 3QUTA 5DBAA 3V6HA 3GV5B 1PX5A 2UVVA 5HRKA 3KD3A 3QU4A 4FHWA 5J2AA 3KZIU 4M5DA 7ICMA 1QH9A 2JEGA 3CP8A 3IDWA 2VANA 2FPLA 5KT6A 5ALWA 1FFUA 3NKUA 3TAQA 1UA0A 4ATBA 2VJ4A 9ICCA 2LMRA 1ZQBA 1UQVA 3QYPA 5KT5A 1TAUA 4QWBA 2R8JA 2W03A 3BQ2A 4ELVA 4XQ7A 4ED8A 2RLTA 4GXIA 1MSWD 5ALLA 2WF6A 2F2AB 1CRXA 1F5SA 3PNCA 4ZOHC 5JRTA 3TACB 4K9AA 2WB1F 2E8PA 4C8NA 9ICUA 3LQCB 1U4BA 2EQYA 4MF8A 5KG0A 5B66U 2DRBA 2XY6A 1S0MA 3JPNA 2PKEA 1WWUA 2RQ5A 2FMQA 1L7PA 1UCVA 1S9FA 5ALOA 5AM2A 1PVQA 2AXTU 4DFMA 1L7NA 1S8OA 4RQMA 5JU5A 1IG6A 4E0DA 2QB1A 1S0NA 5KFGA 4JK1A 3H8SA 1X42A 2KD1A 4CRXA 1UHUA 3GILA 4J9QA 1ZD2P 1JRPA 1SZPA 4MHVA 4KLFA 1JXEA 4WC3A 3HIYA 1L8LA 2BCUA 2K4HA 2ZJAA 5HR9A 2BE3A 4KMUA 1MIYA 4IQVA 4WQKA 4UAWA 2AQ4A 1NK8A 3SD7A 3Q8SB 3AQKA 1O03A 3T79A 2K4EA 5KL1B 3H8JA 3D2SA 5KG2A 1ZQZA 7ICQA 8ICAA 4UW9A 4E80A 3WK8A 2HHQA 4P0PB 4M9HA 4B9NA 2P6UA 3JPTA 4QZIA 1PZNA 4O3OA 3QX7A 4F92B 2ALZA 3MC1A 4C0ZA 2NRKA 4AP9A 4FHXA 4LZDA 9ICEA 2IBKA 1NJWA 5EE0A 4ED3A 2L5YA 2KEYA 1PVPA 2W04A 4WCWA 3BS7A 3ICXA 1KEJA 2KICA 1TKDA 2HCFA 1U48A 4WC2A 4UARA 2Y1JA 1J2MA 5J2IA 3PZPA 3N97B 4DQPA 4AYBC 4ECQA 5ALPA 5CWRA 2DQNB 3UMGA 3UM9A 4RT3A 2F8KA 4IL6U 3EW9A 4NKTA 3CK6A 4HX0A 3C1YA 5HREA 2WAQC 4ECWA 4YD1A 3WKEA 2EAOA 4RZRA 4UBBA 5ALTA 5DDMA 2W9MA 1C20A 4QJFB 1SIJA 5AM3A 2Y0SC 5ALUA 4EYHB 4ED2A 4EBKA 3MGIA 4FBUA 1BPXA 4PZOA 4EX7A 2JEFA 3LWLA 1Q3UA 2JV3A 4QWEA 4A8EA 4R63A 5KT4A 2BQRA 3NWIA 2PBEA 3MR3A 4JLXA 3RJHA 2B4VA 4DL6A 9ICIA 4Y2TA 4ED1A 3NS1A 4KLUA 1KSPA 4R66A 3AMZA 4O67A 2XIDA 4DSKA 2Y9TA 2ZTEA 1FFVA 1K5OA 2EZYA 1NZPA 3OWGA 2KHVA 4EEKA 3V7LA 2KNJA 2ZH6A 1ZQEA 5AM0A 2AGQA 5IIKA 2KHQA 2B51A 4P2HA 4K96A 4G9BA 5J2DA 2IOHA 2ZHBA 3AU6A 2K89A 4TURA 3EZ5A 2ZTCA 1ZQAA 3F5AA 3VC8A 4UQGA 3LWMA 2PMZC 4UD5A 3HRDD 1R8BA 3T5KA 3AM9A 5CHEA 3OSNA 5AIBA 4B9SA 4F5RA 2EZXA 4PGXA 4YQWA 1X9XA 1R89A 4WBYA 1UT5A 3HT3A 4EELA 8ICJA 1KLNA 2WTFA 2FLPA 2GOLA 2KFNA 1JROA 8ICEA 1Z4OA 2LYHA 5CFSA 1ZD4A 2XGQA 3BQ0A 4JUZA 2FPMA 4RQ8A 4PL2A 1NI3A 4DSEA 5KFZA 1F44A 4RPYA 2W9AA 1V97A 2KK0A 4EENA 5F9LA 1BPZA 2DPIA 2VIXA 4RQ4A 7ICSA 3Q8PB 1TK0A 3M7DA 3OUYA 2E1FA 4RNNA 2YMQA 8ICGA 1Q79A 4Z6EA 2J6SA 4OAIZ 8ICXA 4UAYA 1XWLA 4QW9A 2PFNA 7ICEA 2HHUA 2VA2A 5GTHU 4KN7A 1COKA 4J9MA 4Q8FA 2W8KA 4J9LA 2O6KA 2F1JA 2PFPA 2OH2A 2ODGA 4X5VA 3ETRA 2NRWA 5C0YA 2M0NA 4PL1A 3RBDA 1ZQWA 5DQIA 4YCXA 2R8HA 3V6JA 8ICVA 2ASDA 1Z4NA 2KIWA 4P4PA 4DQIA 4YFKA 1SWVA 1T94A 2DF4B 4GXJA 8ICKA 3C5FA 1HUZA 2ZH7A 3PHZA 2VA8A 3NVVA 4FHPA 2BBHA 3PX0A 3ISCA 3SR6A 2QB0B 4UBCA 5KFJA 2DUYA 3EYZA 5L9XA 2NRVA 4BGDA 5ALIA 3GIIA 9ICWA 2HBJA 1B0XA 3H0RB 5ALZA 1O08A 3PR4A 1Z1BA 4FH3A 2IHMA 1SL1A 2LM1A 5ALFA 4MEYA 1K1SA 2OHFA 5DG8A 2G0AA 1CUKA 4RWNA 5G5HA 2F77X 1JQRA 4EX6A 3V6KA 1MQ2A 2HHSA 4OAFA 3WK6A 4I2GA 5KT3A 1A6SA 3WFPA 3AQNA 3UMCA 2BDUA 5FP0A 4R8UB 4K4GA 3RH6A 4E8FA 4QIWF 1XSNA 3ZDDA 4M6WA 5EWEA 4C8KA 2KP7A 5KFOA 9ICMA 1V38A 3BZKA 2ISOA 3JPRA 4F5PA 3JPSA 2ZH8A 3KHLA 1ZQLA 3IG5A 1ZQQA 4F2RA 3QU7A 4M04A 3D2QA 4B9VA 3WKCA 2IUBA 5J0YA 3RTVA 3PW7A 4RQ2A 4GC7A 5AM1A 4CCHA 3KZXA 5KFBA 3RAQA 4R64A 2BDPA 3H0MB 3C66A 2I6XA 1M6YA 2C2RA 3NYBA 3KHHA 4QZDA 9ICRA 5JTGA 3QZ8A 5KG4A 4FHYA 3B9JA 1JN3A 4F93B 4ELUA 5J2CA 4DF8A 1TFYA 2WF9A 2GLEA 2O1PA 3ER8C 2R8KA 1L7MA 2LKYA 1IIPA 4HYKA 2BCSA 3EWAA 1L3VA 1TK5A 2W8LA 4DFPA 2KOBA 2ZH2A 4ECSA 4XUSA 4Y2YA 3ZDAA 4WC5A 5DB8A 1SV0A 2QLTA 1XS9D 3UPSA 1S97A 5L1IA 2EDUA 4B9LA 4LEZA 4DSFA 4KM5A 2GWSA 3TANA 2KJ9A 4BWJA 1KN5A 3IRUA 5CR0A 1ZQOA 9ICBA 1KBUA 4X4UA 3MR5A 1OU5A 3H8MA 4K99A 2W3RA 4I2FA 1RPLA 2ISPA 4F4ZA 4QWAA 3RJEA 2M9NA 2R8IA 2BKEA 4UATA 3JYYA 5DDYA 2XCPA 2WF8A 4UASA 4BUGA 3C23A 4WJ3B 5IIJA 4NXVA 1SXDA 5CHGA 2I1QA 3N4MB 1TV9A 1X9MA 1FA0A 4CF4A 3H37A 2W11A 4DO9A 5AI5A 7ICTA 5IIMA 4AT9B 3A0HU 3NTUA 3BQ1A 4EZ6A 4F72A 2DRAA 1K1QA 4DS4A 1PK1B 2DBYA 1V9PA 3TFRA 2KZZA 2W9BA 4MFAA 3GV8B 2JHDA 4RQNA 2BPGA 5ALRA 2B0CA 1ZJNA 5AI8A 7ICNA 2ZH4A 4Q43A 4WQLA 2MA1A 3OTQA 1NK9A 1MA7A 3BS5B 5DLFA 3NASA 2I9GA 2HVHA 3GDXA 3G6VA 7ICPA 1X6IA 2ZIVB 1NKCA 1XNSA 1U49A 2A1JA 4Q45A 1Q3VA 5KFIA 2GA9D 1N2XA 3G6XA 5KG1A 3SAGA 4ECXA 3ED5A 3C5GA 2H3ZA 4IQUA 3SAFA 7ICFA 4Y2XA 3RR7A 4QZBA 3THVA 4AYBF 1UEVA 4CDGA 4NV0A 2M2TA 4Q44A 2B21A 1QCKA 3JPPA 4FE3A 2AQ0A 3MDAA 3T5LA 3JZ0A 4C4TA 4CE6A 5HP4A 1GO3F 3HILA 2FMPA 5CFTA 2AGOA 4KLHA 3B0XA 2EAPA 1RXWA 3K1RB 1XSLA 1TAMA 3OGUA 3RJKA 1ECWA 5KT7A 1UA1A 4KLQA 1ZD5A 4X4SA 5KG5A 4Y2PA 4NLNA 5J0TA 5GTIU 5AKKA 3PSFA 3QU5A 2ZJ8A 4KLTA 5F2VO 4KB6A 2KVSA 2ZUBA 3AQMA 5E79U 2K8CB 3Q8MA 2ZIUA 4NXXA 1Y88A 2BR0A 5KG3A 3Q8RB 4F3OA 2ZXHA 2E8MA 3HKZC 2DR5A 3MFHA 1XSPA 4C4SA 3SV4A 3LDAA 2KKPA 4UB2A 1ZJMA 4KLDA 1WG8A 4O5CA 2JH1A 9ICFA 2YB4A 3ER9B 1BGXT 3IM1A 4EGWA 4O3PA 4Y2RA 4DFJA 3RR8A 4OJOA 4C8OA 1IXRA 2H3IA 5KFWA 1CEZA 4RPZA 2XCAA 3NVZA 4DL4A 7ICRA 5KFRA 5ALYA 4RUCA 8ICSA 4UB3A 2LBOA 3LK9A 3I1YA 2HDOA 1AROP 2UVUA 5DB6A 3C18A 4RNMA 3BQ7A 5DEDA 1KDHA 2HHTA 5AK5A 1XO1A 3WK4A 2XC9A 4C80A 4NLBA 5J0XA 2GH1A 1UT8A 3AQLA 1ZQFA 4PHEA 4EZ9A 2DR9A 2WAQF 4O9MA 1DGSA 3MGHA 2I5HA 1NJXA 3I28A 3PSIA 4EBDA 3SAHA 4PPXA 2NO4A 1DK3A 2ASJA 3RF9A 1L6NA 1VFGA 5KFTA 2F1IA 2Q66A 1Z00B 2IOFA 2R8GA 4NLCA 4NL9A 5T14A 5D63A 1HJPA 2UVRA 5KFUA 4F71A 2W3SA 5ALMA 4X4RA 7ICLA 3PO4A 3E0FA 3N7PD 1QSSA 2Y9UA 4ECZA 3OVAA 5J0UA 1BNPA 4DCCA 3F2DA 1KQQA 2BHNA 3QU9A 8ICFA 1HIWA 8ICNA 3D2NA 5AK6A 4YMOA 4DSJA 5KG7A 2V4QA 4KLIA 3NVWA 5DKWA 3MABA 5HRLA 4ECYA 4I29A 1KTQA 2CN1A 5L1JA 2ZIWB 5HMLA 2BCQA 5TZVA 3M6ZA 4GIBA 4O3RA 1N48A 4ELTA 4F4XA 1ZOLA 3L3FX 5KL8B 2JH7A 9ICVA 2KV2A 1QQ5A 1URJA 2LYBA 3SMVA 1ZQRA 4UB6U 1D9FA 4I2CA 2ZHAA 2Q4TA 2E3TA 5KFAA 3RFAA 2W54A 4QWCA 2ID1A 3GQCA 2BCVA 3ORYA 3GZFA 3M9OB 5J0RA 1XC9A 2PXIA 1QSYA 3T5HA 1ZXIA 3RB6A 2KFZA 4OJ5A 4NJ8A 4J9NA 4GC6A 1T7PA 4NM1A 5J2EA 2J6TA 2CXYA 4US9A 1SWWA 5AK3A 4B9MA 4ZH4A 4FO6A 3LVVA 3JPOA 4FFDA 4Y2UA 4QNLA 4EBJA 1WWVA 4QZGA 4G3IA 4X0BA 2ZH9A 5DQGA 2PI5A 1SKSA 4MFFA 2FDRA 1TVAA 4KLMA 3HX0A 2E8NA 3SI8A 5HC9A 3WFRE 2ZIWA 4WC6A 1X40A 5J0QA 2HHPA 2G5HB 3KBBA 3OSPA 4E7XA 2YX8A 4K98A 4FZLA 3F2BA 1KFTA 5KT2A 3AUOA 3OJSA 4I2EA 2FCLA 8ICZA 2EH9A 2ZH1A 4YXMA 5JTIA 4RQ0A 2XO7A 5J0OA 3H8WA 5KNIA 3M1YA 5AK4A 2P66A 1YLQA 3R9KA 4RWQA 2AJQA 4LVSA 1Q8KA 5KFLA 8ICCA 5D46A 2DVIA 1PVRA 4YVZA 4MF2A 4TUPA 2W55A 1ZQMA 4DQSA 3KTQA 3ZDCA 2JEIA 2IOFK 4OO1J 4EEDA 3IG8A 5C5JA 3J81j 2RP5A 4AT7A 3ZI4A 2XGPA 2K4PA 1UETA 3PW5A 1NK7A 3K4GA 4P4MA 1BNOA 1V85A 5DG9A 1N62A 4YP3A 3AU2A 4M6WB 1ZYQA 1WCNA 3MGVA 5ALEA 3H38A 1TE2A 2RRDA 3TADA 1XU4A 3LYSA 3RJFA 4EEBA 4KN4A 1ZQSA 2KJ5A 4RQ5A 2WFAA 5TISU 3ZD8A 7ICKA 3L4PA 4CNQA 1X9WA 2C2DA 2ZXIA 4X4OA 2A3VA 3UQ2A 5AM5A 5CP2A 1L5UA 3UXPA 3WKDA 4I28A 1J2NA 1FEZA 4ICAA 4YXJA 5ALDA 1NK5A 2QARA 4BWMA 3PSPA 4GLXA 3U26A 1SZHA 3Q8QB 4GFJA 2KZ3A 4EBCA 4CF3A 2QKQA 2AH5A 3SV3A 4QZCA 2KG5A 5HHIA 1U9LA 2LM4A 2HHVA 5AKEA 4IRKA 3BDPA 2EANA 3PY8A 2KN7A 1Z00A 2Z7JA 2DGZA 1QQ6A 4ECTA 2D6FC 3KFUF 8ICWA 3WKBA 1JUDA 2DFLA 2NYVA 5AI0A 4F5NA 4US8A 5DECA 3NGDA 1NK6A 3M8SA 2B6GA 3KKAC 4PHDA 4NXWA 3BS5A 2VKQA 2A19A 2HOIA 3NVOA 4EBEA 2BQ3A 3C2MA 4XRHA 1LKYA 4F5OA 4C8MA 4KX5A 8ICTA 4DFKA 2W9BB 3FYHA 5HMMA 4B6JA 1LB2B 5KTQA 3C2LA 3OV7A 2DL0A 4RPXA 1N5XA 2MU2A 4I2AA 3PW0A 4KLEA 3F2CA 2KTQA 2JGAA 2AHOB 4F4YA 1RYRA 4WBZA 2E1EA 1YZ6A 1SL0A 4UB8U 5KAIU 4DSIA 5CB1A 1B4FA 5F9NA 3OJUA 7ICIA 2H3QA 2LPEA 4DSLA 5F3XB 4IC9A 4C7ZA 4M47A 3V7KA 3QNMA 4PGQA
chains in the Genus database with same CATH topology
2P6UA 3JPTA 4QZIA 4NKUA 1PZNA 4O3OA 3MDAA 1B22A 4F92B 4WC0A 3T5LA 2ALZA 2PFQA 3JZ0A 2BPFA 5HP4A 5IIOA 2NRKA 1IM4A 4KLGA 2FMPA 4FHXA 2JEJA 2AGOA 3GIKA 3B0XA 4O3SA 4KLHA 4LZDA 4PGYA 1D8LA 1KRPA 1RXWA 9ICEA 4WC1A 4MEXA 4KLOA 2IBKA 1XSLA 3OGUA 1NJWA 4ED3A 3RJKA 4DS5A 4B9UA 4K4HA 4J9SA 4X4VA 5KT7A 1UA1A 3RB0A 4KLQA 4WCWA 4AT9A 1JMSA 4DEZA 4I2HA 1KEJA 4YN4A 4X4SA 5KG5A 3H3AA 3ISBA 1TKDA 2BGWA 1U48A 1T3NA 4NLNA 5J0TA 4WC2A 3C1ZA 4RQ6A 4J9KA 2DR7A 9ICOA 8ICRA 2H5XA 4JWMA 1NK0A 2JZBB 2Y1JA 5J2IA 3N97B 4DQPA 2ZH2A 4ECQA 3HWTA 2PI4A 5CWRA 4C8LA 8ICLA 4RT3A 2ZJ8A 4IQWA 3EW9A 4KLTA 1V4AA 4NKTA 1NKEA 5F2VO 3B0YA 2ZUBA 4O0IA 3AQMA 3C1YA 1L3SA 5D4BA 5HREA 4ECWA 4JWNA 4YD1A 5KFNA 3Q8MA 4RZRA 5DB9A 1Y88A 4UBBA 5DDMA 1TAQA 4UB4A 2ASLA 5KG3A 2W9MA 3Q8RB 2BR0A 1ZQJA 1D9DA 4F3OA 1HUOA 2DR5A 3MFHA 1XSPA 3PR5B 4YR2A 3SV4A 2NRXA 3LDAA 4EYHB 5HRIA 4ED2A 3QZ7A 3PO5A 4DQRA 4O3QA 1BPBA 4UB2A 1ZJMA 4EBKA 4KLDA 3MGIA 4FBUA 3Q8KA 1BPXA 2IMWP 4O5CA 3OV7A 1TK8A 1NJYA 9ICFA 5CJ7A 2JEFA 4DWIA 3LWLA 1H38A 2FMSA 1BGXT 4M0AA 8ICOA 4DL3A 4RQ1A 8ICIA 3IM1A 4IG8A 4QWEA 4O3NA 4FHVA 1B43A 4Z6DA 4O3PA 4R63A 5KT4A 2BQRA 3TARA 4I2BA 2PBEA 3MR3A 4DFJA 3RJHA 3RR8A 2C28A 4C8OA 5J29A 2XY7A 1IXRA 5KFDA 4BDPA 8ICUA 5KFWA 4DL6A 1CEZA 9ICIA 4RPZA 3ISDA 2XCAA 4ED1A 4DL4A 4B9NA 5KFKA 7ICRA 5KFRA 4KLUA 1KSPA 4FH5A 4R66A 4RUCA 2IHNA 4KLJA 9ICAA 4UB3A 8ICSA 3LK9A 4DSKA 3T5JA 4X4PA 2ZTEA 9ICQA 1NZPA 1AROP 3WFQE 2UVUA 1F5AA 4Z6FA 3V7LA 5CA7A 4ED7A 2AU0A 5DB6A 5J2FA 3C18A 3PMNA 4RNMA 7ICVA 2DR8A 2ZH6A 5DEDA 5KFVA 1KDHA 2HHTA 1ZQEA 4KITB 1XO1A 2AGQA 2XC9A 5IIKA 1PX5A 4UD4A 5EWGA 1WCLA 5J0XA 1UT8A 3AQLA 5KFPA 1ZQFA 4PHEA 4EZ9A 2DR9A 2MUTA 4NLGA 7ICUA 4P2HA 4O9MA 3OVBA 9ICXA 1DGSA 3MGHA 1D8YA 1NOMA 1Z3EB 1BPEA 5DBCA 3MBYA 5J2DA 1NJXA 9ICNA 2ZHBA 4EBDA 3AU6A 1T4GA 3TAPA 4PPXA 4YR0A 2ASJA 4IR9A 8ICQA 1DK3A 9ICGA 4TURA 5DQHA 5KFTA 4TUQA 1DK2A 4YR3A 3EZ5A 4AT8A 1VFGA 2F1IA 2ZTCA 1Z00B 1ZQAA 2M2WA 2Q66A 5KFMA 1JX4A 2R8GA 4UQGA 3LWMA 1MQ3A 2HHXA 4FBTA 1HJPA 2UVRA 5KFUA 4UD5A 1R8BA 3RRHA 8ICYA 4X4RA 2C22A 3T5KA 7ICLA 4UB5A 1X9SA 3PO4A 4PH5A 3MFIA 3OSNA 1QSSA 1U45A 2FLNA 9ICLA 1ZQPA 4ECZA 4B9SA 4F5RA 4O5KA 4PGXA 4F8RA 3OVAA 4YQWA 5J0UA 1BPYA 1BNPA 3OHAA 2PFOA 1R89A 4WBYA 2ZH5A 4F50A 3C21A 1ZQVA 1SL2A 2BHNA 1UT5A 5EOZA 3HT3A 2ZTDA 8ICFA 8ICJA 3RB3A 1KLNA 8ICNA 3GIJA 3PVXA 1C7YA 4YMOA 2WTFA 2FLPA 4DSJA 4Q8EA 5J2JA 5KG7A 2V4QA 8ICEA 2LYHA 2KFNA 5HRBA 4KLIA 4S3NA 9ICTA 5DKWA 3MABA 3PW4A 2XGQA 4DOBA 3BQ0A 4JUZA 4FS2A 2FPMA 5HRLA 4RQ8A 5IIIA 3EPGA 3K75D 4ECYA 5BPCA 9ICSA 4I29A 1KTQA 4DSEA 2KZMA 4F4KA 5KFZA 4RPYA 4DL2A 2W9AA 3QEAZ 5F9LA 1BPZA 5L1JA 2FLLA 5HMLA 2BCQA 4IR1A 4ECVA 2DPIA 4IRDA 5TZVA 1S0VA 4RQ4A 1L3UA 3RAXA 7ICSA 4DL5A 4TQRA 3RJIA 2XY5A 4DOAA 3Q8PB 2ZJ5A 4O3RA 1N48A 1TK0A 4ELTA 3G6YA 3EPIA 4F4XA 4QZ9A 5KG6A 3OHBA 2C2EA 5KFEA 1ZQKA 3OUYA 4RNNA 4WC7A 1KNYA 4Z6CA 2NRZA 3HPOA 5L1LA 8ICGA 9ICVA 4J9PA 5J0SA 1Q79A 4DOCA 5DLGA 4Z6EA 4M9JA 2DPJA 2J6SA 1ZQRA 1D9FA 8ICXA 2ZH3A 4UAYA 1XWLA 4QZFA 4QW9A 4BXOA 2Y1IA 2PFNA 4I2CA 7ICEA 2ZHAA 1ZQIA 3H4BA 2HHUA 2VA2A 3RJGA 5KFAA 5L1KA 7ICHA 4KN7A 4NXZA 2UVWA 3HW8A 5KFCA 4LT6A 4J9MA 4P4OA 4QWCA 3QE9Y 4Q8FA 3GQCA 2BCVA 3ORYA 1VJ7A 3M9OB 1QLNA 2ID1A 8ICPA 5J0RA 2W8KA 4J9LA 3UQ0A 1XC9A 4ECRA 2PXIA 1S0OA 2F1JA 1QSYA 2PFPA 4QZAA 3T5HA 3Q8LA 1ZQUA 3PX6A 3RB6A 2KFZA 4M9LA 2Q0ZX 4X5VA 2NRWA 4KTQA 4J9NA 4GC6A 3RBDA 3RJJA 4MFCA 1ZQWA 5DQIA 4YCXA 2R8HA 1T7PA 3V6JA 4NM1A 2P6RA 8ICVA 5J2EA 2ASDA 3RB4A 2J6TA 3HJ1A 4RU9A 1ZQNA 4P4PA 4DQIA 2MAXA 4PHAA 4GXKA 4YFKA 4B9MA 9ICJA 4ZH4A 4GXJA 4LZGA 2ATLA 8ICKA 4F91B 3C5FA 4FO6A 4BXOB 1HUZA 3JPOA 2ZH7A 3KHGA 3RBEA 2VA8A 5DB7A 3SZ2A 4QZGA 1ZQDA 1ZQGA 4G3IA 4FHPA 4EBJA 3MR6A 3PX0A 4ED0A 4X0BA 4X4QA 2ZH9A 5DQGA 4DF4A 2HHWA 3ISCA 2M2VA 2PI5A 4WC4A 1SKSA 4UBCA 2FPKA 5KFJA 4QZHA 4MFFA 3EYZA 1KFDA 1JAJA 2O5AA 5J2BA 1TVAA 2ZUCA 5L9XA 2RFFA 3H40A 3PX4A 2NRVA 4BGDA 1ZQCA 4KLMA 1Q78A 4QZ8A 3GIIA 4UB1A 3HX0A 3BJYA 3SI8A 3RRGA 3PR4A 9ICWA 1WOTA 4AT8B 4NY8A 5HC9A 4EEYA 3HJ4A 3WFRE 4FH3A 4RUAA 2IHMA 4X4NA 4WC6A 3KHRA 1SL1A 1TFWA 3PV8A 4XA5A 5J0QA 4AT7B 4M9NA 4TUSA 2HHPA 4DLGA 7ICGA 4WC3A 4R65A 4MEYA 2MUTB 3V7JA 1K1SA 5DG8A 4X0AA 3OSPA 4YD2A 4E7XA 2HVIA 1CUKA 4RWNA 8ICMA 3MR2A 1JQRA 1ZQHA 1ZQTA 1UEUA 3V6KA 1MQ2A 5KT2A 1KFSA 2HHSA 7ICJA 1KFTA 3AUOA 4TQSA 1COOA 5KFFA 3OJSA 1NKBA 4I2EA 2NRTA 1T8EA 8ICZA 5HRHA 2ZH1A 5KFSA 2VA3A 4M2YA 4I2GA 5KT3A 4YXMA 5J2KA 4RQ0A 4ED6A 2XO7A 3WFPA 3AQNA 5J0OA 3H8WA 3L9DA 4R8UB 2RDJA 4K4GA 5J0PA 2P66A 1S76D 4RWOA 3RH6A 1YLQA 1ZQXA 4NLKA 4IQTA 4RWQA 3GFKB 4F5QA 1XSNA 4LVSA 4KLSA 3UXOA 5KFLA 3ZDDA 2AJQA 8ICCA 4M6WA 1X2IA 5D46A 5EWEA 4J9RA 4C8KA 5KFOA 9ICMA 2KP7A 4JV0A 2V4RA 4E8FA 2DVIA 2M2UA 5J2GA 1L3TA 3SYZA 2ISOA 3JPRA 2BQUA 4YVZA 4F5PA 3T3FA 4MF2A 3JPSA 4TUPA 3KHLA 2ZH8A 3V72A 1ZQLA 4F2RA 1ZQQA 4K4IA 3IHQB 5D49A 3M9NB 4DQSA 1ZQMA 4M04A 3KTQA 4B9VA 1A77A 3ZDCA 4QWDA 4QZEA 3M9MB 5DG7A 5J0YA 2F1HA 3RTVA 2JEIA 3ZD9A 3PW7A 3ZDBA 3PMLA 4RQ2A 4GC7A 4CCHA 4RT2A 1ZQYA 5C5JA 5KFBA 3TFSA 3H39A 3RAQA 1SKWA 4B9TA 4R64A 2BDPA 2BPCA 3C66A 4AT7A 3HP6A 4NM2A 3M8RA 2XGPA 1UETA 2C2RA 3PW5A 1EXNA 3TI0A 1NK7A 3NYBA 3K4GA 5DBBA 3KHHA 4QZDA 4P4MA 3C2KA 1BNOA 3WFSC 9ICRA 1S77D 1NK4A 5DG9A 5KG4A 4YP3A 3QZ8A 3AU2A 3PW2A 4FHYA 4PHPA 4M6WB 1JN3A 2RDIA 4F93B 2W9CB 1WCNA 1ZYQA 5J2CA 2OWOA 4ELUA 4M9GA 3WFOA 4RQ3A 4FS1A 5HHHA 5J2HA 2ZUDA 4DF8A 3H38A 5KFXA 2A1JB 1RXVA 2J6UA 3E2EA 1TFYA 1XU4A 3OVSA 5KFYA 2AGPA 9ICPA 2O1PA 2HW3A 3RJFA 1SKRA 2R8KA 4ATBB 1R8AA 4KN4A 4QW8A 1NJZA 5KFHA 4YMMA 1ZQSA 3BQTA 4RQ5A 1N56A 1LV5A 4RWPA 3ZD8A 5DBAA 4HYKA 2JZBA 3GV5B 3V6HA 2BCSA 2UVVA 5HRKA 3EWAA 1L3VA 1TK5A 7ICKA 2W8LA 9ICKA 4FHWA 4DFPA 5J2AA 1X9WA 2C2DA 3TQ1A 5DGBA 4XUSA 4ECSA 1QTMA 3ZDAA 7ICOA 4X4OA 4M5DA 3UQ2A 5DB8A 1RYSA 4WC5A 5CP2A 1L5UA 3UXPA 2IA6A 7ICMA 3H7IA 4I28A 2JEGA 4DLEA 1XS9D 1JXLA 4F2SA 3UPSA 2VANA 2FPLA 1MIWA 1S97A 5L1IA 5KT6A 4B9LA 5IILA 4IRCA 4DSFA 3TAQA 4I2IA 1ZETA 2GWSA 3TANA 4YXJA 1UA0A 1NK5A 4BWJA 1U47A 4ATBA 4KLLA 5CR0A 1MIVA 4NLZA 9ICCA 4BWMA 3ZDEA 1ZQOA 1ZQBA 4GLXA 9ICBA 4X4UA 4I2DA 3MR5A 1DOQA 5KT5A 1OU5A 1TAUA 4QWBA 2R8JA 1RPLA 2ISPA 4I2FA 5HRDA 4F4ZA 3BQ2A 4ECUA 3Q8QB 4ELVA 4QWAA 5HRGA 4XQ7A 3JPQA 4ED8A 3RJEA 3OUYB 2M9NA 4GXIA 2KZ3A 2BCRA 5KFQA 4EBCA 1MSWD 5HRFA 2R8IA 2BKEA 3JYYA 5DDYA 2XCPA 4YG2A 3PNCA 3C23A 5HNKA 3SV3A 1BVSA 4QZCA 9ICHA 5HHIA 1U9LA 5IIJA 4DQQA 8ICBA 3MDCA 4C8NA 4J9OA 4IRKA 4JV2A 3BDPA 2HHVA 9ICUA 1U4BA 3LQCB 3PY8A 5CHGA 2I1QA 4EP7A 3N4MB 1TV9A 8ICHA 4MF8A 5KG0A 1Z00A 2KN7A 1X9MA 1JIHA 1FA0A 3H37A 2DRBA 2XY6A 4DO9A 4ECTA 1RZTA 1S0MA 8ICWA 1NO5A 3JPNA 2DFLA 7ICTA 4EYIB 4F5NA 4RNOA 2FMQA 5DECA 3NGDA 5IIMA 4AT9B 1NK6A 3NTUA 1S9FA 3BQ1A 3M8SA 4EZ6A 2DRAA 1K1QA 5JUMA 4DFMA 1QSLA 4JV1A 4DS4A 5IINA 4PHDA 3RH5A 4E0DA 4I27A 1V9PA 3TFRA 2V9WA 2KZZA 4MFAA 2W9BA 1A76A 3GV8B 1TFRA 4YMNA 2BPGA 1S0NA 5KFGA 4EBEA 1ZJNA 7ICNA 4JK1A 2ZH4A 3H8SA 4Q43A 3C2MA 4XRHA 2BQ3A 4F5OA 3GILA 4C8MA 4J9QA 1NK9A 8ICTA 3ETLA 4DFKA 1SZPA 2W9BB 5DLFA 3QEBZ 3UPQA 3FYHA 2I9GA 4KLFA 5HMMA 1JXEA 3GDXA 2HVHA 1LB2B 2BCUA 3GV7B 3FDSA 3HIYA 5KTQA 3C2LA 2ZJAA 4M9HA 5HR9A 2BE3A 3G6VA 5BOLA 4KMUA 7ICPA 1MIYA 4R8UA 4RPXA 4IQVA 3RH4A 4UAWA 1NKCA 4I2AA 1U49A 3PW0A 2A1JA 3UXNA 4DL7A 2AQ4A 4Q45A 4I2JA 1NK8A 4KLEA 2KTQA 5KFIA 3AQKA 3Q8SB 5KG1A 3G6XA 3H4DA 4F4YA 3C5GA 4ECXA 1RYRA 4WBZA 5BOMA 2W9CA 4IQUA 1SL0A 1R8CA 5DGAA 4F4WA 7ICFA 3RR7A 3H8JA 4UAZA 5KG2A 4DSIA 1ZQZA 5CB1A 4QZBA 5F9NA 3THVA 8ICAA 3OJUA 7ICQA 1UEVA 4X4TA 1S10A 2M2TA 7ICIA 4Q44A 4RQ7A 4DSLA 5J0WA 4E80A 4XQ8A 2B21A 3GIMA 2HHQA 5EWFA 4M47A 3V7KA 4O5EA 1MC8A 3JPPA 1BPDA 2AQ0A 4PGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6U A;  3JPT A;  4QZI A;  4NKU A;  1PZN A;  4O3O A;  3MDA A;  1B22 A;  4F92 B;  4WC0 A;  3T5L A;  2ALZ A;  2PFQ A;  3JZ0 A;  2BPF A;  5HP4 A;  5IIO A;  2NRK A;  1IM4 A;  4KLG A;  2FMP A;  4FHX A;  2JEJ A;  2AGO A;  3GIK A;  3B0X A;  4O3S A;  4KLH A;  4LZD A;  4PGY A;  1D8L A;  1KRP A;  1RXW A;  9ICE A;  4WC1 A;  4MEX A;  4KLO A;  2IBK A;  1XSL A;  3OGU A;  1NJW A;  4ED3 A;  3RJK A;  4DS5 A;  4B9U A;  4K4H A;  4J9S A;  4X4V A;  5KT7 A;  1UA1 A;  3RB0 A;  4KLQ A;  4WCW A;  4AT9 A;  1JMS A;  4DEZ A;  4I2H A;  1KEJ A;  4YN4 A;  4X4S A;  5KG5 A;  3H3A A;  3ISB A;  1TKD A;  2BGW A;  1U48 A;  1T3N A;  4NLN A;  5J0T A;  4WC2 A;  3C1Z A;  4RQ6 A;  4J9K A;  2DR7 A;  9ICO A;  8ICR A;  2H5X A;  4JWM A;  1NK0 A;  2JZB B;  2Y1J A;  5J2I A;  3N97 B;  4DQP A;  2ZH2 A;  4ECQ A;  3HWT A;  2PI4 A;  5CWR A;  4C8L A;  8ICL A;  4RT3 A;  2ZJ8 A;  4IQW A;  3EW9 A;  4KLT A;  1V4A A;  4NKT A;  1NKE A;  5F2V O;  3B0Y A;  2ZUB A;  4O0I A;  3AQM A;  3C1Y A;  1L3S A;  5D4B A;  5HRE A;  4ECW A;  4JWN A;  4YD1 A;  5KFN A;  3Q8M A;  4RZR A;  5DB9 A;  1Y88 A;  4UBB A;  5DDM A;  1TAQ A;  4UB4 A;  2ASL A;  5KG3 A;  2W9M A;  3Q8R B;  2BR0 A;  1ZQJ A;  1D9D A;  4F3O A;  1HUO A;  2DR5 A;  3MFH A;  1XSP A;  3PR5 B;  4YR2 A;  3SV4 A;  2NRX A;  3LDA A;  4EYH B;  5HRI A;  4ED2 A;  3QZ7 A;  3PO5 A;  4DQR A;  4O3Q A;  1BPB A;  4UB2 A;  1ZJM A;  4EBK A;  4KLD A;  3MGI A;  4FBU A;  3Q8K A;  1BPX A;  2IMW P;  4O5C A;  3OV7 A;  1TK8 A;  1NJY A;  9ICF A;  5CJ7 A;  2JEF A;  4DWI A;  3LWL A;  1H38 A;  2FMS A;  1BGX T;  4M0A A;  8ICO A;  4DL3 A;  4RQ1 A;  8ICI A;  3IM1 A;  4IG8 A;  4QWE A;  4O3N A;  4FHV A;  1B43 A;  4Z6D A;  4O3P A;  4R63 A;  5KT4 A;  2BQR A;  3TAR A;  4I2B A;  2PBE A;  3MR3 A;  4DFJ A;  3RJH A;  3RR8 A;  2C28 A;  4C8O A;  5J29 A;  2XY7 A;  1IXR A;  5KFD A;  4BDP A;  8ICU A;  5KFW A;  4DL6 A;  1CEZ A;  9ICI A;  4RPZ A;  3ISD A;  2XCA A;  4ED1 A;  4DL4 A;  4B9N A;  5KFK A;  7ICR A;  5KFR A;  4KLU A;  1KSP A;  4FH5 A;  4R66 A;  4RUC A;  2IHN A;  4KLJ A;  9ICA A;  4UB3 A;  8ICS A;  3LK9 A;  4DSK A;  3T5J A;  4X4P A;  2ZTE A;  9ICQ A;  1NZP A;  1ARO P;  3WFQ E;  2UVU A;  1F5A A;  4Z6F A;  3V7L A;  5CA7 A;  4ED7 A;  2AU0 A;  5DB6 A;  5J2F A;  3C18 A;  3PMN A;  4RNM A;  7ICV A;  2DR8 A;  2ZH6 A;  5DED A;  5KFV A;  1KDH A;  2HHT A;  1ZQE A;  4KIT B;  1XO1 A;  2AGQ A;  2XC9 A;  5IIK A;  1PX5 A;  4UD4 A;  5EWG A;  1WCL A;  5J0X A;  1UT8 A;  3AQL A;  5KFP A;  1ZQF A;  4PHE A;  4EZ9 A;  2DR9 A;  2MUT A;  4NLG A;  7ICU A;  4P2H A;  4O9M A;  3OVB A;  9ICX A;  1DGS A;  3MGH A;  1D8Y A;  1NOM A;  1Z3E B;  1BPE A;  5DBC A;  3MBY A;  5J2D A;  1NJX A;  9ICN A;  2ZHB A;  4EBD A;  3AU6 A;  1T4G A;  3TAP A;  4PPX A;  4YR0 A;  2ASJ A;  4IR9 A;  8ICQ A;  1DK3 A;  9ICG A;  4TUR A;  5DQH A;  5KFT A;  4TUQ A;  1DK2 A;  4YR3 A;  3EZ5 A;  4AT8 A;  1VFG A;  2F1I A;  2ZTC A;  1Z00 B;  1ZQA A;  2M2W A;  2Q66 A;  5KFM A;  1JX4 A;  2R8G A;  4UQG A;  3LWM A;  1MQ3 A;  2HHX A;  4FBT A;  1HJP A;  2UVR A;  5KFU A;  4UD5 A;  1R8B A;  3RRH A;  8ICY A;  4X4R A;  2C22 A;  3T5K A;  7ICL A;  4UB5 A;  1X9S A;  3PO4 A;  4PH5 A;  3MFI A;  3OSN A;  1QSS A;  1U45 A;  2FLN A;  9ICL A;  1ZQP A;  4ECZ A;  4B9S A;  4F5R A;  4O5K A;  4PGX A;  4F8R A;  3OVA A;  4YQW A;  5J0U A;  1BPY A;  1BNP A;  3OHA A;  2PFO A;  1R89 A;  4WBY A;  2ZH5 A;  4F50 A;  3C21 A;  1ZQV A;  1SL2 A;  2BHN A;  1UT5 A;  5EOZ A;  3HT3 A;  2ZTD A;  8ICF A;  8ICJ A;  3RB3 A;  1KLN A;  8ICN A;  3GIJ A;  3PVX A;  1C7Y A;  4YMO A;  2WTF A;  2FLP A;  4DSJ A;  4Q8E A;  5J2J A;  5KG7 A;  2V4Q A;  8ICE A;  2LYH A;  2KFN A;  5HRB A;  4KLI A;  4S3N A;  9ICT A;  5DKW A;  3MAB A;  3PW4 A;  2XGQ A;  4DOB A;  3BQ0 A;  4JUZ A;  4FS2 A;  2FPM A;  5HRL A;  4RQ8 A;  5III A;  3EPG A;  3K75 D;  4ECY A;  5BPC A;  9ICS A;  4I29 A;  1KTQ A;  4DSE A;  2KZM A;  4F4K A;  5KFZ A;  4RPY A;  4DL2 A;  2W9A A;  3QEA Z;  5F9L A;  1BPZ A;  5L1J A;  2FLL A;  5HML A;  2BCQ A;  4IR1 A;  4ECV A;  2DPI A;  4IRD A;  5TZV A;  1S0V A;  4RQ4 A;  1L3U A;  3RAX A;  7ICS A;  4DL5 A;  4TQR A;  3RJI A;  2XY5 A;  4DOA A;  3Q8P B;  2ZJ5 A;  4O3R A;  1N48 A;  1TK0 A;  4ELT A;  3G6Y A;  3EPI A;  4F4X A;  4QZ9 A;  5KG6 A;  3OHB A;  2C2E A;  5KFE A;  1ZQK A;  3OUY A;  4RNN A;  4WC7 A;  1KNY A;  4Z6C A;  2NRZ A;  3HPO A;  5L1L A;  8ICG A;  9ICV A;  4J9P A;  5J0S A;  1Q79 A;  4DOC A;  5DLG A;  4Z6E A;  4M9J A;  2DPJ A;  2J6S A;  1ZQR A;  1D9F A;  8ICX A;  2ZH3 A;  4UAY A;  1XWL A;  4QZF A;  4QW9 A;  4BXO A;  2Y1I A;  2PFN A;  4I2C A;  7ICE A;  2ZHA A;  1ZQI A;  3H4B A;  2HHU A;  2VA2 A;  3RJG A;  5KFA A;  5L1K A;  7ICH A;  4KN7 A;  4NXZ A;  2UVW A;  3HW8 A;  5KFC A;  4LT6 A;  4J9M A;  4P4O A;  4QWC A;  3QE9 Y;  4Q8F A;  3GQC A;  2BCV A;  3ORY A;  1VJ7 A;  3M9O B;  1QLN A;  2ID1 A;  8ICP A;  5J0R A;  2W8K A;  4J9L A;  3UQ0 A;  1XC9 A;  4ECR A;  2PXI A;  1S0O A;  2F1J A;  1QSY A;  2PFP A;  4QZA A;  3T5H A;  3Q8L A;  1ZQU A;  3PX6 A;  3RB6 A;  2KFZ A;  4M9L A;  2Q0Z X;  4X5V A;  2NRW A;  4KTQ A;  4J9N A;  4GC6 A;  3RBD A;  3RJJ A;  4MFC A;  1ZQW A;  5DQI A;  4YCX A;  2R8H A;  1T7P A;  3V6J A;  4NM1 A;  2P6R A;  8ICV A;  5J2E A;  2ASD A;  3RB4 A;  2J6T A;  3HJ1 A;  4RU9 A;  1ZQN A;  4P4P A;  4DQI A;  2MAX A;  4PHA A;  4GXK A;  4YFK A;  4B9M A;  9ICJ A;  4ZH4 A;  4GXJ A;  4LZG A;  2ATL A;  8ICK A;  4F91 B;  3C5F A;  4FO6 A;  4BXO B;  1HUZ A;  3JPO A;  2ZH7 A;  3KHG A;  3RBE A;  2VA8 A;  5DB7 A;  3SZ2 A;  4QZG A;  1ZQD A;  1ZQG A;  4G3I A;  4FHP A;  4EBJ A;  3MR6 A;  3PX0 A;  4ED0 A;  4X0B A;  4X4Q A;  2ZH9 A;  5DQG A;  4DF4 A;  2HHW A;  3ISC A;  2M2V A;  2PI5 A;  4WC4 A;  1SKS A;  4UBC A;  2FPK A;  5KFJ A;  4QZH A;  4MFF A;  3EYZ A;  1KFD A;  1JAJ A;  2O5A A;  5J2B A;  1TVA A;  2ZUC A;  5L9X A;  2RFF A;  3H40 A;  3PX4 A;  2NRV A;  4BGD A;  1ZQC A;  4KLM A;  1Q78 A;  4QZ8 A;  3GII A;  4UB1 A;  3HX0 A;  3BJY A;  3SI8 A;  3RRG A;  3PR4 A;  9ICW A;  1WOT A;  4AT8 B;  4NY8 A;  5HC9 A;  4EEY A;  3HJ4 A;  3WFR E;  4FH3 A;  4RUA A;  2IHM A;  4X4N A;  4WC6 A;  3KHR A;  1SL1 A;  1TFW A;  3PV8 A;  4XA5 A;  5J0Q A;  4AT7 B;  4M9N A;  4TUS A;  2HHP A;  4DLG A;  7ICG A;  4WC3 A;  4R65 A;  4MEY A;  2MUT B;  3V7J A;  1K1S A;  5DG8 A;  4X0A A;  3OSP A;  4YD2 A;  4E7X A;  2HVI A;  1CUK A;  4RWN A;  8ICM A;  3MR2 A;  1JQR A;  1ZQH A;  1ZQT A;  1UEU A;  3V6K A;  1MQ2 A;  5KT2 A;  1KFS A;  2HHS A;  7ICJ A;  1KFT A;  3AUO A;  4TQS A;  1COO A;  5KFF A;  3OJS A;  1NKB A;  4I2E A;  2NRT A;  1T8E A;  8ICZ A;  5HRH A;  2ZH1 A;  5KFS A;  2VA3 A;  4M2Y A;  4I2G A;  5KT3 A;  4YXM A;  5J2K A;  4RQ0 A;  4ED6 A;  2XO7 A;  3WFP A;  3AQN A;  5J0O A;  3H8W A;  3L9D A;  4R8U B;  2RDJ A;  4K4G A;  5J0P A;  2P66 A;  1S76 D;  4RWO A;  3RH6 A;  1YLQ A;  1ZQX A;  4NLK A;  4IQT A;  4RWQ A;  3GFK B;  4F5Q A;  1XSN A;  4LVS A;  4KLS A;  3UXO A;  5KFL A;  3ZDD A;  2AJQ A;  8ICC A;  4M6W A;  1X2I A;  5D46 A;  5EWE A;  4J9R A;  4C8K A;  5KFO A;  9ICM A;  2KP7 A;  4JV0 A;  2V4R A;  4E8F A;  2DVI A;  2M2U A;  5J2G A;  1L3T A;  3SYZ A;  2ISO A;  3JPR A;  2BQU A;  4YVZ A;  4F5P A;  3T3F A;  4MF2 A;  3JPS A;  4TUP A;  3KHL A;  2ZH8 A;  3V72 A;  1ZQL A;  4F2R A;  1ZQQ A;  4K4I A;  3IHQ B;  5D49 A;  3M9N B;  4DQS A;  1ZQM A;  4M04 A;  3KTQ A;  4B9V A;  1A77 A;  3ZDC A;  4QWD A;  4QZE A;  3M9M B;  5DG7 A;  5J0Y A;  2F1H A;  3RTV A;  2JEI A;  3ZD9 A;  3PW7 A;  3ZDB A;  3PML A;  4RQ2 A;  4GC7 A;  4CCH A;  4RT2 A;  1ZQY A;  5C5J A;  5KFB A;  3TFS A;  3H39 A;  3RAQ A;  1SKW A;  4B9T A;  4R64 A;  2BDP A;  2BPC A;  3C66 A;  4AT7 A;  3HP6 A;  4NM2 A;  3M8R A;  2XGP A;  1UET A;  2C2R A;  3PW5 A;  1EXN A;  3TI0 A;  1NK7 A;  3NYB A;  3K4G A;  5DBB A;  3KHH A;  4QZD A;  4P4M A;  3C2K A;  1BNO A;  3WFS C;  9ICR A;  1S77 D;  1NK4 A;  5DG9 A;  5KG4 A;  4YP3 A;  3QZ8 A;  3AU2 A;  3PW2 A;  4FHY A;  4PHP A;  4M6W B;  1JN3 A;  2RDI A;  4F93 B;  2W9C B;  1WCN A;  1ZYQ A;  5J2C A;  2OWO A;  4ELU A;  4M9G A;  3WFO A;  4RQ3 A;  4FS1 A;  5HHH A;  5J2H A;  2ZUD A;  4DF8 A;  3H38 A;  5KFX A;  2A1J B;  1RXV A;  2J6U A;  3E2E A;  1TFY A;  1XU4 A;  3OVS A;  5KFY A;  2AGP A;  9ICP A;  2O1P A;  2HW3 A;  3RJF A;  1SKR A;  2R8K A;  4ATB B;  1R8A A;  4KN4 A;  4QW8 A;  1NJZ A;  5KFH A;  4YMM A;  1ZQS A;  3BQT A;  4RQ5 A;  1N56 A;  1LV5 A;  4RWP A;  3ZD8 A;  5DBA A;  4HYK A;  2JZB A;  3GV5 B;  3V6H A;  2BCS A;  2UVV A;  5HRK A;  3EWA A;  1L3V A;  1TK5 A;  7ICK A;  2W8L A;  9ICK A;  4FHW A;  4DFP A;  5J2A A;  1X9W A;  2C2D A;  3TQ1 A;  5DGB A;  4XUS A;  4ECS A;  1QTM A;  3ZDA A;  7ICO A;  4X4O A;  4M5D A;  3UQ2 A;  5DB8 A;  1RYS A;  4WC5 A;  5CP2 A;  1L5U A;  3UXP A;  2IA6 A;  7ICM A;  3H7I A;  4I28 A;  2JEG A;  4DLE A;  1XS9 D;  1JXL A;  4F2S A;  3UPS A;  2VAN A;  2FPL A;  1MIW A;  1S97 A;  5L1I A;  5KT6 A;  4B9L A;  5IIL A;  4IRC A;  4DSF A;  3TAQ A;  4I2I A;  1ZET A;  2GWS A;  3TAN A;  4YXJ A;  1UA0 A;  1NK5 A;  4BWJ A;  1U47 A;  4ATB A;  4KLL A;  5CR0 A;  1MIV A;  4NLZ A;  9ICC A;  4BWM A;  3ZDE A;  1ZQO A;  1ZQB A;  4GLX A;  9ICB A;  4X4U A;  4I2D A;  3MR5 A;  1DOQ A;  5KT5 A;  1OU5 A;  1TAU A;  4QWB A;  2R8J A;  1RPL A;  2ISP A;  4I2F A;  5HRD A;  4F4Z A;  3BQ2 A;  4ECU A;  3Q8Q B;  4ELV A;  4QWA A;  5HRG A;  4XQ7 A;  3JPQ A;  4ED8 A;  3RJE A;  3OUY B;  2M9N A;  4GXI A;  2KZ3 A;  2BCR A;  5KFQ A;  4EBC A;  1MSW D;  5HRF A;  2R8I A;  2BKE A;  3JYY A;  5DDY A;  2XCP A;  4YG2 A;  3PNC A;  3C23 A;  5HNK A;  3SV3 A;  1BVS A;  4QZC A;  9ICH A;  5HHI A;  1U9L A;  5IIJ A;  4DQQ A;  8ICB A;  3MDC A;  4C8N A;  4J9O A;  4IRK A;  4JV2 A;  3BDP A;  2HHV A;  9ICU A;  1U4B A;  3LQC B;  3PY8 A;  5CHG A;  2I1Q A;  4EP7 A;  3N4M B;  1TV9 A;  8ICH A;  4MF8 A;  5KG0 A;  1Z00 A;  2KN7 A;  1X9M A;  1JIH A;  1FA0 A;  3H37 A;  2DRB A;  2XY6 A;  4DO9 A;  4ECT A;  1RZT A;  1S0M A;  8ICW A;  1NO5 A;  3JPN A;  2DFL A;  7ICT A;  4EYI B;  4F5N A;  4RNO A;  2FMQ A;  5DEC A;  3NGD A;  5IIM A;  4AT9 B;  1NK6 A;  3NTU A;  1S9F A;  3BQ1 A;  3M8S A;  4EZ6 A;  2DRA A;  1K1Q A;  5JUM A;  4DFM A;  1QSL A;  4JV1 A;  4DS4 A;  5IIN A;  4PHD A;  3RH5 A;  4E0D A;  4I27 A;  1V9P A;  3TFR A;  2V9W A;  2KZZ A;  4MFA A;  2W9B A;  1A76 A;  3GV8 B;  1TFR A;  4YMN A;  2BPG A;  1S0N A;  5KFG A;  4EBE A;  1ZJN A;  7ICN A;  4JK1 A;  2ZH4 A;  3H8S A;  4Q43 A;  3C2M A;  4XRH A;  2BQ3 A;  4F5O A;  3GIL A;  4C8M A;  4J9Q A;  1NK9 A;  8ICT A;  3ETL A;  4DFK A;  1SZP A;  2W9B B;  5DLF A;  3QEB Z;  3UPQ A;  3FYH A;  2I9G A;  4KLF A;  5HMM A;  1JXE A;  3GDX A;  2HVH A;  1LB2 B;  2BCU A;  3GV7 B;  3FDS A;  3HIY A;  5KTQ A;  3C2L A;  2ZJA A;  4M9H A;  5HR9 A;  2BE3 A;  3G6V A;  5BOL A;  4KMU A;  7ICP A;  1MIY A;  4R8U A;  4RPX A;  4IQV A;  3RH4 A;  4UAW A;  1NKC A;  4I2A A;  1U49 A;  3PW0 A;  2A1J A;  3UXN A;  4DL7 A;  2AQ4 A;  4Q45 A;  4I2J A;  1NK8 A;  4KLE A;  2KTQ A;  5KFI A;  3AQK A;  3Q8S B;  5KG1 A;  3G6X A;  3H4D A;  4F4Y A;  3C5G A;  4ECX A;  1RYR A;  4WBZ A;  5BOM A;  2W9C A;  4IQU A;  1SL0 A;  1R8C A;  5DGA A;  4F4W A;  7ICF A;  3RR7 A;  3H8J A;  4UAZ A;  5KG2 A;  4DSI A;  1ZQZ A;  5CB1 A;  4QZB A;  5F9N A;  3THV A;  8ICA A;  3OJU A;  7ICQ A;  1UEV A;  4X4T A;  1S10 A;  2M2T A;  7ICI A;  4Q44 A;  4RQ7 A;  4DSL A;  5J0W A;  4E80 A;  4XQ8 A;  2B21 A;  3GIM A;  2HHQ A;  5EWF A;  4M47 A;  3V7K A;  4O5E A;  1MC8 A;  3JPP A;  1BPD A;  2AQ0 A;  4PGQ A; 
#chains in the Genus database with same CATH topology
 4NXT A;  1B22 A;  1YZ7 A;  4WC0 A;  2BPF A;  5IIO A;  4O68 A;  4KLG A;  4ATB B;  1N60 A;  2K60 A;  4WC1 A;  2HI0 A;  2KE7 A;  4K97 A;  4K4H A;  4K9B A;  4J9S A;  4WH5 A;  4DEZ A;  4I2H A;  4YN4 A;  1DGJ A;  3ISB A;  4J03 A;  1T3N A;  2DR7 A;  8ICR A;  2H5X A;  2WHE A;  1X66 A;  3MCR A;  4KX3 A;  2D3D A;  2PI4 A;  3HWT A;  8ICL A;  4DFD A;  2LYA A;  4IQW A;  1V4A A;  2XI9 A;  4O0I A;  1L3S A;  1D8B A;  4JWN A;  5ALJ A;  4CF5 A;  2HBK A;  5ALG A;  5DB9 A;  1OW5 A;  1TAQ A;  1YT3 A;  4UB4 A;  3QXG A;  2YML A;  1HUO A;  2R18 A;  1RYU A;  4YR2 A;  5HRI A;  3QZ7 A;  4O3Q A;  1BPB A;  2QB0 A;  2ZIX B;  5EE9 A;  1NJY A;  3VCB A;  5CJ7 A;  4KMO B;  1PK1 A;  4M0A A;  2FMS A;  5L1M A;  8ICO A;  4OD0 A;  3ONN A;  4U6P A;  4RQ1 A;  1B43 A;  4I2B A;  3TAR A;  4OAH A;  2C28 A;  2Y0S F;  5J29 A;  4BDP A;  8ICU A;  5KFD A;  3ISD A;  1AQ6 A;  5KFK A;  4FH5 A;  4FZN A;  2A1A A;  4KLJ A;  4FO1 A;  2KKV A;  1UPH A;  2QAR B;  4P0Q B;  1ZQ1 C;  2K8B B;  5EE1 A;  5CA7 A;  5J2F A;  2DR8 A;  5HR6 A;  4KIT B;  5CEH A;  3ERC C;  2KIV A;  1WCL A;  4NLG A;  7ICU A;  3OVB A;  9ICX A;  1NOM A;  1RDF A;  1BPE A;  1Z3E B;  3MBY A;  9ICN A;  1KKX A;  4YR0 A;  4IR9 A;  8ICQ A;  9ICG A;  5DQH A;  1LVH A;  1S5L U;  1ZRM A;  3GU3 A;  3HJE A;  2HHX A;  4FBT A;  2EWR A;  2W7P A;  8ICY A;  2EAM A;  2FLN A;  3HKZ F;  4F8R A;  3PST A;  1BPY A;  4ACO A;  3OHA A;  2PFO A;  1CI4 A;  3C29 A;  4F50 A;  2JXJ A;  3C21 A;  1SL2 A;  2ZTD A;  3RB3 A;  3S6J A;  2YMM A;  1SGG A;  5HRB A;  2WF5 A;  1JAL A;  4S3N A;  9ICT A;  1KL9 A;  4O6A A;  3EPG A;  4USA A;  2JMG A;  5BPC A;  2HBM A;  4F4K A;  2FLL A;  4IR1 A;  4IRD A;  4ECV A;  1S0V A;  1L3U A;  5AM4 A;  3H0L B;  4TQR A;  3RJI A;  4OJ6 A;  2ZJ5 A;  2FI1 A;  3G6Y A;  3EPI A;  3OHB A;  5KG6 A;  2F3N A;  2XVT A;  1ZQK A;  4WC7 A;  1KNY A;  1DXS A;  1IV8 A;  3N28 A;  4C4R A;  2K8A A;  4DOC A;  1ED1 A;  5DLG A;  4M9J A;  2DPJ A;  4CGZ A;  5K4L A;  2ZH3 A;  3E58 A;  4QZF A;  4PZN A;  1ZQI A;  3H4B A;  3ALR A;  3RJG A;  7ICH A;  3K7D A;  4P4O A;  3QE9 Y;  1VJ7 A;  1SV4 A;  1QLN A;  4JB3 A;  1Q46 A;  4ECR A;  2G09 A;  4QZA A;  3PX6 A;  2Q0Z X;  5CFU A;  3HJ1 A;  5AKY A;  4GXK A;  9ICJ A;  4O3M A;  4LZG A;  2ATL A;  3TKA A;  3IN5 A;  2CRX A;  2OM6 A;  3KHG A;  5DB7 A;  3SZ2 A;  3QUQ A;  3MR6 A;  1KW4 A;  1ZD3 A;  4MKP A;  2MSN A;  2YY6 A;  1SB3 C;  3AQF A;  4WC4 A;  3N7S C;  2FPK A;  3TAD C;  2O5A A;  3FAH A;  3OPX A;  5J2B A;  2NV3 A;  2RFF A;  1ZQC A;  3RRG A;  4AT8 B;  4NY8 A;  4RUA A;  4X4N A;  3KHR A;  3PV8 A;  4M9N A;  4TUS A;  4DLG A;  7ICG A;  4R65 A;  2MUT B;  1RM6 C;  2ZIV A;  3V7J A;  4X0A A;  4OJL A;  2YTU A;  2XIC A;  2HVI A;  8ICM A;  3MR2 A;  1ZQH A;  1ZQT A;  1UEU A;  4TQS A;  1NKB A;  5KFF A;  2NRT A;  2ES6 A;  5KFS A;  5J2K A;  4ED6 A;  1Z19 A;  2OYY A;  4C7Y A;  1S76 D;  4RWO A;  1F0M A;  4NLK A;  4IQT A;  3GFK B;  4F5Q A;  4KLS A;  2ESE A;  3AEV A;  4JV0 A;  5D62 A;  1L3T A;  2H3V A;  3T3F A;  5ALX A;  2JR5 A;  2WB1 C;  4K4I A;  2NO5 A;  1A77 A;  4QWD A;  4QZE A;  5DG7 A;  3ZD9 A;  4N7R A;  5HR7 A;  2HSZ A;  1NNL A;  3M6K A;  4RT2 A;  1ZQY A;  4NL9 C;  3H39 A;  1SKW A;  4QIW C;  4B9T A;  4NM2 A;  3M8R A;  3WFS C;  4JMU A;  1RG6 A;  1S77 D;  1NK4 A;  3SEI A;  5B3Q A;  4PHP A;  2OWO A;  1RQN A;  4BX9 C;  5D61 A;  3NVY A;  1OUQ A;  2CPR A;  3AN1 A;  5J2H A;  2ZUD A;  3WK5 A;  5KFX A;  2A1J B;  2J6U A;  3E2E A;  2FJ6 A;  3QUC A;  3OVS A;  5KFY A;  2AGP A;  2KSO B;  9ICP A;  2HW3 A;  4FZM A;  1R8A A;  4YMM A;  1QQ7 A;  3KKA A;  3O0F A;  3BQT A;  1N61 A;  1N56 A;  1LV5 A;  4RWP A;  2JZB A;  9ICK A;  2G07 A;  4NWI A;  5AI9 A;  3TQ1 A;  5DGB A;  1QTM A;  7ICO A;  3IV6 A;  1RYS A;  2KJ8 A;  2IA6 A;  3H7I A;  1DRG A;  3AQE A;  4DLE A;  1JXL A;  4F2S A;  1MIW A;  4EV6 A;  5IIL A;  4IRC A;  4I2I A;  2LI6 A;  1ZET A;  3DEE A;  3EF2 A;  5ALH A;  4P0Q A;  1U47 A;  4KLL A;  4I0U A;  1MIV A;  3NRZ A;  4NLZ A;  3ZDE A;  4I2D A;  1DOQ A;  3UMB A;  2F76 X;  5HRD A;  4ECU A;  5HRG A;  3JPQ A;  2BCR A;  5KFQ A;  5HRF A;  2G5I B;  5KAF U;  4YG2 A;  5HNK A;  1BVS A;  5J8Y A;  1X6J A;  9ICH A;  4DQQ A;  8ICB A;  3MDC A;  4J9O A;  1VDV A;  4JV2 A;  3EUB 2;  4EP7 A;  3CW2 C;  5AHX A;  8ICH A;  3WKA A;  1JIH A;  4LEW A;  1RZT A;  1NO5 A;  4EYI B;  4RNO A;  5AI6 A;  2HOQ A;  5JUM A;  2YB1 A;  5AIC A;  1QSL A;  4JV1 A;  5IIN A;  1JI7 A;  3RH5 A;  4I27 A;  2V9W A;  5AI4 A;  1A76 A;  1TFR A;  4YMN A;  1A0P A;  2G06 A;  3ETL A;  1RQL A;  2G08 A;  3QEB Z;  3UPQ A;  4WOY A;  2B56 A;  3GV7 B;  2ZIU B;  3FDS A;  5BOL A;  4R8U A;  3RH4 A;  1SV0 C;  2HMX A;  3UXN A;  4DL7 A;  4I2J A;  3H4D A;  2OXO A;  4JLZ A;  5BOM A;  2W9C A;  2JRZ A;  1L7O A;  1R8C A;  5DGA A;  4F4W A;  3K1Z A;  4UAZ A;  4U7C A;  4X4T A;  1S10 A;  4RQ7 A;  5AKZ A;  5J0W A;  4XQ8 A;  3GIM A;  5EWF A;  4O5E A;  1BPD A;  2YQE A;  4NKU A;  2PFQ A;  2LHT A;  3C28 A;  2HN1 A;  1IM4 A;  5G5G A;  2MRL A;  2JEJ A;  3F53 A;  3GIK A;  4O3S A;  4PGY A;  1D8L A;  1KRP A;  5J8Y C;  4MEX A;  4KLO A;  2ZG6 A;  4K8V A;  5B5E U;  4DS5 A;  4B9U A;  4X4V A;  3RB0 A;  4AT9 A;  1JMS A;  2DKX A;  3H3A A;  4Y2J A;  2BGW A;  3C1Z A;  4RQ6 A;  4J9K A;  9ICO A;  4JWM A;  1NK0 A;  2JZB B;  4C8L A;  4PJ0 U;  4Y2Q A;  1NKE A;  3B0Y A;  1LKY B;  5ALN A;  5D4B A;  5AKL A;  5KFN A;  1D9D A;  2ASL A;  1ZQJ A;  3CRX A;  4HAI A;  4O69 A;  3PR5 B;  5AIA A;  2NRX A;  5AKG A;  2F44 A;  3PO5 A;  1PUZ A;  4DQR A;  1T3Q A;  2PMZ F;  3Q8K A;  2IMW P;  1TK8 A;  4DWI A;  1H38 A;  4DL3 A;  8ICI A;  4IG8 A;  3KOO A;  4O3N A;  4FHV A;  4Z6D A;  2ZIX A;  2BBJ A;  2XY7 A;  3L5K A;  2DWQ A;  5AKJ A;  4LJX A;  1WUD A;  1J97 A;  9ICA A;  2IHN A;  2W7O A;  3T5J A;  4X4P A;  2D8C A;  5AKH A;  9ICQ A;  3WFQ E;  1F5A A;  4Z6F A;  4ED7 A;  5ALV A;  2AU0 A;  3PMN A;  7ICV A;  5KFV A;  2GAF D;  3WU2 U;  4UD4 A;  5EWG A;  5KFP A;  2P35 A;  2MUT A;  1D8Y A;  3A0B U;  5DBC A;  1T4G A;  3TAP A;  2GO7 A;  3SQI A;  5CRX A;  2N1R A;  1DK2 A;  4TUQ A;  4YR3 A;  4AT8 A;  3WK7 A;  2M2W A;  5KFM A;  1JX4 A;  1MQ3 A;  2RHF A;  2E8O A;  1Z1V A;  1NZB A;  3RRH A;  2C22 A;  4UB5 A;  1X9S A;  4PH5 A;  3MFI A;  9ICL A;  1U45 A;  5AKX A;  1ZQP A;  4O5K A;  1ZRN A;  2ZH5 A;  1SXE A;  1ZQV A;  5EOZ A;  2K4I A;  4XJE A;  3GIJ A;  3PVX A;  1C7Y A;  5B3P A;  5H2F U;  4Q8E A;  5J2J A;  3PW4 A;  4DOB A;  4FS2 A;  2OCE A;  1WYG A;  5III A;  3K75 D;  4NXU A;  1OXJ A;  1XO0 A;  9ICS A;  1GPJ A;  3DDH A;  2KZM A;  3D6J A;  5ALS A;  4DL2 A;  3QEA Z;  1N63 A;  4OJP A;  4LEY A;  3FM9 A;  3RAX A;  4DL5 A;  2HOF A;  2XY5 A;  4DOA A;  2KVC A;  4QZ9 A;  2C2E A;  2KMD A;  5KFE A;  2F8L A;  4Z6C A;  2NRZ A;  2IHO A;  3HPO A;  5L1L A;  4J9P A;  5J0S A;  1MN8 A;  5ALQ A;  5EE3 A;  4Y2V A;  4BXO A;  2Y1I A;  1PK3 A;  3QU2 A;  3DV9 A;  2WF7 A;  5L1K A;  4NXZ A;  2UVW A;  3HW8 A;  5KFC A;  4LT6 A;  8ICP A;  3UQ0 A;  1S0O A;  3Q8L A;  1ZQU A;  4M9L A;  2FE9 A;  4KTQ A;  3RJJ A;  4MFC A;  3N7R C;  2P6R A;  2YN4 A;  3RB4 A;  3FC4 A;  1FO4 A;  4RU9 A;  1ZQN A;  2MAX A;  4PHA A;  1HEK A;  4BJQ A;  4F91 B;  4BXO B;  3F5E A;  3RBE A;  2KSO A;  4UAU A;  1ZQD A;  1ZQG A;  4ED0 A;  2W43 A;  4DF4 A;  2M2V A;  4X4Q A;  5A0L A;  4QZH A;  1KFD A;  1JAJ A;  2ZUC A;  3H40 A;  3PX4 A;  2BZF A;  1Q78 A;  4QZ8 A;  1N5W A;  4UB1 A;  3BJY A;  1WOT A;  4EEY A;  3HJ4 A;  2OEH A;  1TFW A;  4XA5 A;  2DKZ A;  4AT7 B;  1L8O A;  3NRW A;  5ALK A;  3BZC A;  4YD2 A;  4UAV A;  7ICJ A;  1KFS A;  1COO A;  1T8E A;  3CNH A;  4IS7 A;  5HRH A;  2VA3 A;  4M2Y A;  1VLB A;  3JCF A;  3L9D A;  2RDJ A;  3CYM A;  5J0P A;  3OUY B;  2H3F A;  1ZQX A;  1MC8 A;  3UXO A;  4Y2S A;  1X2I A;  4J9R A;  3QUB A;  1VJ5 A;  2V4R A;  4P0P A;  2M2U A;  5J2G A;  3SYZ A;  2BQU A;  3NUQ A;  3V72 A;  3IHQ B;  5D49 A;  3M9N B;  2HHW A;  3M9M B;  2F1H A;  2HN2 A;  3I76 A;  3ZDB A;  3PML A;  3TFS A;  2E5S A;  2YMP A;  2BPC A;  3HP6 A;  1EXN A;  3TI0 A;  2EZZ A;  3C2K A;  3SEN A;  5DBB A;  3WK9 A;  3AL0 B;  3PW2 A;  4OCZ A;  1P7D A;  2W9C B;  2RDI A;  1FIQ A;  3IP4 B;  3LVW A;  4M9G A;  3WFO A;  4RQ3 A;  4FS1 A;  2HBL A;  5HHH A;  1RXV A;  5AKI A;  4LEV A;  1SKR A;  2VJ5 A;  4QW8 A;  1NJZ A;  5KFH A;  4OAG A;  3QUT A;  5DBA A;  3V6H A;  3GV5 B;  1PX5 A;  2UVV A;  5HRK A;  3KD3 A;  3QU4 A;  4FHW A;  5J2A A;  3KZI U;  4M5D A;  7ICM A;  1QH9 A;  2JEG A;  3CP8 A;  3IDW A;  2VAN A;  2FPL A;  5KT6 A;  5ALW A;  1FFU A;  3NKU A;  3TAQ A;  1UA0 A;  4ATB A;  2VJ4 A;  9ICC A;  2LMR A;  1ZQB A;  1UQV A;  3QYP A;  5KT5 A;  1TAU A;  4QWB A;  2R8J A;  2W03 A;  3BQ2 A;  4ELV A;  4XQ7 A;  4ED8 A;  2RLT A;  4GXI A;  1MSW D;  5ALL A;  2WF6 A;  2F2A B;  1CRX A;  1F5S A;  3PNC A;  4ZOH C;  5JRT A;  3TAC B;  4K9A A;  2WB1 F;  2E8P A;  4C8N A;  9ICU A;  3LQC B;  1U4B A;  2EQY A;  4MF8 A;  5KG0 A;  5B66 U;  2DRB A;  2XY6 A;  1S0M A;  3JPN A;  2PKE A;  1WWU A;  2RQ5 A;  2FMQ A;  1L7P A;  1UCV A;  1S9F A;  5ALO A;  5AM2 A;  1PVQ A;  2AXT U;  4DFM A;  1L7N A;  1S8O A;  4RQM A;  5JU5 A;  1IG6 A;  4E0D A;  2QB1 A;  1S0N A;  5KFG A;  4JK1 A;  3H8S A;  1X42 A;  2KD1 A;  4CRX A;  1UHU A;  3GIL A;  4J9Q A;  1ZD2 P;  1JRP A;  1SZP A;  4MHV A;  4KLF A;  1JXE A;  4WC3 A;  3HIY A;  1L8L A;  2BCU A;  2K4H A;  2ZJA A;  5HR9 A;  2BE3 A;  4KMU A;  1MIY A;  4IQV A;  4WQK A;  4UAW A;  2AQ4 A;  1NK8 A;  3SD7 A;  3Q8S B;  3AQK A;  1O03 A;  3T79 A;  2K4E A;  5KL1 B;  3H8J A;  3D2S A;  5KG2 A;  1ZQZ A;  7ICQ A;  8ICA A;  4UW9 A;  4E80 A;  3WK8 A;  2HHQ A;  4P0P B;  4M9H A;  4B9N A;  2P6U A;  3JPT A;  4QZI A;  1PZN A;  4O3O A;  3QX7 A;  4F92 B;  2ALZ A;  3MC1 A;  4C0Z A;  2NRK A;  4AP9 A;  4FHX A;  4LZD A;  9ICE A;  2IBK A;  1NJW A;  5EE0 A;  4ED3 A;  2L5Y A;  2KEY A;  1PVP A;  2W04 A;  4WCW A;  3BS7 A;  3ICX A;  1KEJ A;  2KIC A;  1TKD A;  2HCF A;  1U48 A;  4WC2 A;  4UAR A;  2Y1J A;  1J2M A;  5J2I A;  3PZP A;  3N97 B;  4DQP A;  4AYB C;  4ECQ A;  5ALP A;  5CWR A;  2DQN B;  3UMG A;  3UM9 A;  4RT3 A;  2F8K A;  4IL6 U;  3EW9 A;  4NKT A;  3CK6 A;  4HX0 A;  3C1Y A;  5HRE A;  2WAQ C;  4ECW A;  4YD1 A;  3WKE A;  2EAO A;  4RZR A;  4UBB A;  5ALT A;  5DDM A;  2W9M A;  1C20 A;  4QJF B;  1SIJ A;  5AM3 A;  2Y0S C;  5ALU A;  4EYH B;  4ED2 A;  4EBK A;  3MGI A;  4FBU A;  1BPX A;  4PZO A;  4EX7 A;  2JEF A;  3LWL A;  1Q3U A;  2JV3 A;  4QWE A;  4A8E A;  4R63 A;  5KT4 A;  2BQR A;  3NWI A;  2PBE A;  3MR3 A;  4JLX A;  3RJH A;  2B4V A;  4DL6 A;  9ICI A;  4Y2T A;  4ED1 A;  3NS1 A;  4KLU A;  1KSP A;  4R66 A;  3AMZ A;  4O67 A;  2XID A;  4DSK A;  2Y9T A;  2ZTE A;  1FFV A;  1K5O A;  2EZY A;  1NZP A;  3OWG A;  2KHV A;  4EEK A;  3V7L A;  2KNJ A;  2ZH6 A;  1ZQE A;  5AM0 A;  2AGQ A;  5IIK A;  2KHQ A;  2B51 A;  4P2H A;  4K96 A;  4G9B A;  5J2D A;  2IOH A;  2ZHB A;  3AU6 A;  2K89 A;  4TUR A;  3EZ5 A;  2ZTC A;  1ZQA A;  3F5A A;  3VC8 A;  4UQG A;  3LWM A;  2PMZ C;  4UD5 A;  3HRD D;  1R8B A;  3T5K A;  3AM9 A;  5CHE A;  3OSN A;  5AIB A;  4B9S A;  4F5R A;  2EZX A;  4PGX A;  4YQW A;  1X9X A;  1R89 A;  4WBY A;  1UT5 A;  3HT3 A;  4EEL A;  8ICJ A;  1KLN A;  2WTF A;  2FLP A;  2GOL A;  2KFN A;  1JRO A;  8ICE A;  1Z4O A;  2LYH A;  5CFS A;  1ZD4 A;  2XGQ A;  3BQ0 A;  4JUZ A;  2FPM A;  4RQ8 A;  4PL2 A;  1NI3 A;  4DSE A;  5KFZ A;  1F44 A;  4RPY A;  2W9A A;  1V97 A;  2KK0 A;  4EEN A;  5F9L A;  1BPZ A;  2DPI A;  2VIX A;  4RQ4 A;  7ICS A;  3Q8P B;  1TK0 A;  3M7D A;  3OUY A;  2E1F A;  4RNN A;  2YMQ A;  8ICG A;  1Q79 A;  4Z6E A;  2J6S A;  4OAI Z;  8ICX A;  4UAY A;  1XWL A;  4QW9 A;  2PFN A;  7ICE A;  2HHU A;  2VA2 A;  5GTH U;  4KN7 A;  1COK A;  4J9M A;  4Q8F A;  2W8K A;  4J9L A;  2O6K A;  2F1J A;  2PFP A;  2OH2 A;  2ODG A;  4X5V A;  3ETR A;  2NRW A;  5C0Y A;  2M0N A;  4PL1 A;  3RBD A;  1ZQW A;  5DQI A;  4YCX A;  2R8H A;  3V6J A;  8ICV A;  2ASD A;  1Z4N A;  2KIW A;  4P4P A;  4DQI A;  4YFK A;  1SWV A;  1T94 A;  2DF4 B;  4GXJ A;  8ICK A;  3C5F A;  1HUZ A;  2ZH7 A;  3PHZ A;  2VA8 A;  3NVV A;  4FHP A;  2BBH A;  3PX0 A;  3ISC A;  3SR6 A;  2QB0 B;  4UBC A;  5KFJ A;  2DUY A;  3EYZ A;  5L9X A;  2NRV A;  4BGD A;  5ALI A;  3GII A;  9ICW A;  2HBJ A;  1B0X A;  3H0R B;  5ALZ A;  1O08 A;  3PR4 A;  1Z1B A;  4FH3 A;  2IHM A;  1SL1 A;  2LM1 A;  5ALF A;  4MEY A;  1K1S A;  2OHF A;  5DG8 A;  2G0A A;  1CUK A;  4RWN A;  5G5H A;  2F77 X;  1JQR A;  4EX6 A;  3V6K A;  1MQ2 A;  2HHS A;  4OAF A;  3WK6 A;  4I2G A;  5KT3 A;  1A6S A;  3WFP A;  3AQN A;  3UMC A;  2BDU A;  5FP0 A;  4R8U B;  4K4G A;  3RH6 A;  4E8F A;  4QIW F;  1XSN A;  3ZDD A;  4M6W A;  5EWE A;  4C8K A;  2KP7 A;  5KFO A;  9ICM A;  1V38 A;  3BZK A;  2ISO A;  3JPR A;  4F5P A;  3JPS A;  2ZH8 A;  3KHL A;  1ZQL A;  3IG5 A;  1ZQQ A;  4F2R A;  3QU7 A;  4M04 A;  3D2Q A;  4B9V A;  3WKC A;  2IUB A;  5J0Y A;  3RTV A;  3PW7 A;  4RQ2 A;  4GC7 A;  5AM1 A;  4CCH A;  3KZX A;  5KFB A;  3RAQ A;  4R64 A;  2BDP A;  3H0M B;  3C66 A;  2I6X A;  1M6Y A;  2C2R A;  3NYB A;  3KHH A;  4QZD A;  9ICR A;  5JTG A;  3QZ8 A;  5KG4 A;  4FHY A;  3B9J A;  1JN3 A;  4F93 B;  4ELU A;  5J2C A;  4DF8 A;  1TFY A;  2WF9 A;  2GLE A;  2O1P A;  3ER8 C;  2R8K A;  1L7M A;  2LKY A;  1IIP A;  4HYK A;  2BCS A;  3EWA A;  1L3V A;  1TK5 A;  2W8L A;  4DFP A;  2KOB A;  2ZH2 A;  4ECS A;  4XUS A;  4Y2Y A;  3ZDA A;  4WC5 A;  5DB8 A;  1SV0 A;  2QLT A;  1XS9 D;  3UPS A;  1S97 A;  5L1I A;  2EDU A;  4B9L A;  4LEZ A;  4DSF A;  4KM5 A;  2GWS A;  3TAN A;  2KJ9 A;  4BWJ A;  1KN5 A;  3IRU A;  5CR0 A;  1ZQO A;  9ICB A;  1KBU A;  4X4U A;  3MR5 A;  1OU5 A;  3H8M A;  4K99 A;  2W3R A;  4I2F A;  1RPL A;  2ISP A;  4F4Z A;  4QWA A;  3RJE A;  2M9N A;  2R8I A;  2BKE A;  4UAT A;  3JYY A;  5DDY A;  2XCP A;  2WF8 A;  4UAS A;  4BUG A;  3C23 A;  4WJ3 B;  5IIJ A;  4NXV A;  1SXD A;  5CHG A;  2I1Q A;  3N4M B;  1TV9 A;  1X9M A;  1FA0 A;  4CF4 A;  3H37 A;  2W11 A;  4DO9 A;  5AI5 A;  7ICT A;  5IIM A;  4AT9 B;  3A0H U;  3NTU A;  3BQ1 A;  4EZ6 A;  4F72 A;  2DRA A;  1K1Q A;  4DS4 A;  1PK1 B;  2DBY A;  1V9P A;  3TFR A;  2KZZ A;  2W9B A;  4MFA A;  3GV8 B;  2JHD A;  4RQN A;  2BPG A;  5ALR A;  2B0C A;  1ZJN A;  5AI8 A;  7ICN A;  2ZH4 A;  4Q43 A;  4WQL A;  2MA1 A;  3OTQ A;  1NK9 A;  1MA7 A;  3BS5 B;  5DLF A;  3NAS A;  2I9G A;  2HVH A;  3GDX A;  3G6V A;  7ICP A;  1X6I A;  2ZIV B;  1NKC A;  1XNS A;  1U49 A;  2A1J A;  4Q45 A;  1Q3V A;  5KFI A;  2GA9 D;  1N2X A;  3G6X A;  5KG1 A;  3SAG A;  4ECX A;  3ED5 A;  3C5G A;  2H3Z A;  4IQU A;  3SAF A;  7ICF A;  4Y2X A;  3RR7 A;  4QZB A;  3THV A;  4AYB F;  1UEV A;  4CDG A;  4NV0 A;  2M2T A;  4Q44 A;  2B21 A;  1QCK A;  3JPP A;  4FE3 A;  2AQ0 A;  3MDA A;  3T5L A;  3JZ0 A;  4C4T A;  4CE6 A;  5HP4 A;  1GO3 F;  3HIL A;  2FMP A;  5CFT A;  2AGO A;  4KLH A;  3B0X A;  2EAP A;  1RXW A;  3K1R B;  1XSL A;  1TAM A;  3OGU A;  3RJK A;  1ECW A;  5KT7 A;  1UA1 A;  4KLQ A;  1ZD5 A;  4X4S A;  5KG5 A;  4Y2P A;  4NLN A;  5J0T A;  5GTI U;  5AKK A;  3PSF A;  3QU5 A;  2ZJ8 A;  4KLT A;  5F2V O;  4KB6 A;  2KVS A;  2ZUB A;  3AQM A;  5E79 U;  2K8C B;  3Q8M A;  2ZIU A;  4NXX A;  1Y88 A;  2BR0 A;  5KG3 A;  3Q8R B;  4F3O A;  2ZXH A;  2E8M A;  3HKZ C;  2DR5 A;  3MFH A;  1XSP A;  4C4S A;  3SV4 A;  3LDA A;  2KKP A;  4UB2 A;  1ZJM A;  4KLD A;  1WG8 A;  4O5C A;  2JH1 A;  9ICF A;  2YB4 A;  3ER9 B;  1BGX T;  3IM1 A;  4EGW A;  4O3P A;  4Y2R A;  4DFJ A;  3RR8 A;  4OJO A;  4C8O A;  1IXR A;  2H3I A;  5KFW A;  1CEZ A;  4RPZ A;  2XCA A;  3NVZ A;  4DL4 A;  7ICR A;  5KFR A;  5ALY A;  4RUC A;  8ICS A;  4UB3 A;  2LBO A;  3LK9 A;  3I1Y A;  2HDO A;  1ARO P;  2UVU A;  5DB6 A;  3C18 A;  4RNM A;  3BQ7 A;  5DED A;  1KDH A;  2HHT A;  5AK5 A;  1XO1 A;  3WK4 A;  2XC9 A;  4C80 A;  4NLB A;  5J0X A;  2GH1 A;  1UT8 A;  3AQL A;  1ZQF A;  4PHE A;  4EZ9 A;  2DR9 A;  2WAQ F;  4O9M A;  1DGS A;  3MGH A;  2I5H A;  1NJX A;  3I28 A;  3PSI A;  4EBD A;  3SAH A;  4PPX A;  2NO4 A;  1DK3 A;  2ASJ A;  3RF9 A;  1L6N A;  1VFG A;  5KFT A;  2F1I A;  2Q66 A;  1Z00 B;  2IOF A;  2R8G A;  4NLC A;  4NL9 A;  5T14 A;  5D63 A;  1HJP A;  2UVR A;  5KFU A;  4F71 A;  2W3S A;  5ALM A;  4X4R A;  7ICL A;  3PO4 A;  3E0F A;  3N7P D;  1QSS A;  2Y9U A;  4ECZ A;  3OVA A;  5J0U A;  1BNP A;  4DCC A;  3F2D A;  1KQQ A;  2BHN A;  3QU9 A;  8ICF A;  1HIW A;  8ICN A;  3D2N A;  5AK6 A;  4YMO A;  4DSJ A;  5KG7 A;  2V4Q A;  4KLI A;  3NVW A;  5DKW A;  3MAB A;  5HRL A;  4ECY A;  4I29 A;  1KTQ A;  2CN1 A;  5L1J A;  2ZIW B;  5HML A;  2BCQ A;  5TZV A;  3M6Z A;  4GIB A;  4O3R A;  1N48 A;  4ELT A;  4F4X A;  1ZOL A;  3L3F X;  5KL8 B;  2JH7 A;  9ICV A;  2KV2 A;  1QQ5 A;  1URJ A;  2LYB A;  3SMV A;  1ZQR A;  4UB6 U;  1D9F A;  4I2C A;  2ZHA A;  2Q4T A;  2E3T A;  5KFA A;  3RFA A;  2W54 A;  4QWC A;  2ID1 A;  3GQC A;  2BCV A;  3ORY A;  3GZF A;  3M9O B;  5J0R A;  1XC9 A;  2PXI A;  1QSY A;  3T5H A;  1ZXI A;  3RB6 A;  2KFZ A;  4OJ5 A;  4NJ8 A;  4J9N A;  4GC6 A;  1T7P A;  4NM1 A;  5J2E A;  2J6T A;  2CXY A;  4US9 A;  1SWW A;  5AK3 A;  4B9M A;  4ZH4 A;  4FO6 A;  3LVV A;  3JPO A;  4FFD A;  4Y2U A;  4QNL A;  4EBJ A;  1WWV A;  4QZG A;  4G3I A;  4X0B A;  2ZH9 A;  5DQG A;  2PI5 A;  1SKS A;  4MFF A;  2FDR A;  1TVA A;  4KLM A;  3HX0 A;  2E8N A;  3SI8 A;  5HC9 A;  3WFR E;  2ZIW A;  4WC6 A;  1X40 A;  5J0Q A;  2HHP A;  2G5H B;  3KBB A;  3OSP A;  4E7X A;  2YX8 A;  4K98 A;  4FZL A;  3F2B A;  1KFT A;  5KT2 A;  3AUO A;  3OJS A;  4I2E A;  2FCL A;  8ICZ A;  2EH9 A;  2ZH1 A;  4YXM A;  5JTI A;  4RQ0 A;  2XO7 A;  5J0O A;  3H8W A;  5KNI A;  3M1Y A;  5AK4 A;  2P66 A;  1YLQ A;  3R9K A;  4RWQ A;  2AJQ A;  4LVS A;  1Q8K A;  5KFL A;  8ICC A;  5D46 A;  2DVI A;  1PVR A;  4YVZ A;  4MF2 A;  4TUP A;  2W55 A;  1ZQM A;  4DQS A;  3KTQ A;  3ZDC A;  2JEI A;  2IOF K;  4OO1 J;  4EED A;  3IG8 A;  5C5J A;  3J81 j;  2RP5 A;  4AT7 A;  3ZI4 A;  2XGP A;  2K4P A;  1UET A;  3PW5 A;  1NK7 A;  3K4G A;  4P4M A;  1BNO A;  1V85 A;  5DG9 A;  1N62 A;  4YP3 A;  3AU2 A;  4M6W B;  1ZYQ A;  1WCN A;  3MGV A;  5ALE A;  3H38 A;  1TE2 A;  2RRD A;  3TAD A;  1XU4 A;  3LYS A;  3RJF A;  4EEB A;  4KN4 A;  1ZQS A;  2KJ5 A;  4RQ5 A;  2WFA A;  5TIS U;  3ZD8 A;  7ICK A;  3L4P A;  4CNQ A;  1X9W A;  2C2D A;  2ZXI A;  4X4O A;  2A3V A;  3UQ2 A;  5AM5 A;  5CP2 A;  1L5U A;  3UXP A;  3WKD A;  4I28 A;  1J2N A;  1FEZ A;  4ICA A;  4YXJ A;  5ALD A;  1NK5 A;  2QAR A;  4BWM A;  3PSP A;  4GLX A;  3U26 A;  1SZH A;  3Q8Q B;  4GFJ A;  2KZ3 A;  4EBC A;  4CF3 A;  2QKQ A;  2AH5 A;  3SV3 A;  4QZC A;  2KG5 A;  5HHI A;  1U9L A;  2LM4 A;  2HHV A;  5AKE A;  4IRK A;  3BDP A;  2EAN A;  3PY8 A;  2KN7 A;  1Z00 A;  2Z7J A;  2DGZ A;  1QQ6 A;  4ECT A;  2D6F C;  3KFU F;  8ICW A;  3WKB A;  1JUD A;  2DFL A;  2NYV A;  5AI0 A;  4F5N A;  4US8 A;  5DEC A;  3NGD A;  1NK6 A;  3M8S A;  2B6G A;  3KKA C;  4PHD A;  4NXW A;  3BS5 A;  2VKQ A;  2A19 A;  2HOI A;  3NVO A;  4EBE A;  2BQ3 A;  3C2M A;  4XRH A;  1LKY A;  4F5O A;  4C8M A;  4KX5 A;  8ICT A;  4DFK A;  2W9B B;  3FYH A;  5HMM A;  4B6J A;  1LB2 B;  5KTQ A;  3C2L A;  3OV7 A;  2DL0 A;  4RPX A;  1N5X A;  2MU2 A;  4I2A A;  3PW0 A;  4KLE A;  3F2C A;  2KTQ A;  2JGA A;  2AHO B;  4F4Y A;  1RYR A;  4WBZ A;  2E1E A;  1YZ6 A;  1SL0 A;  4UB8 U;  5KAI U;  4DSI A;  5CB1 A;  1B4F A;  5F9N A;  3OJU A;  7ICI A;  2H3Q A;  2LPE A;  4DSL A;  5F3X B;  4IC9 A;  4C7Z A;  4M47 A;  3V7K A;  3QNM A;  4PGQ A; 
#chains in the Genus database with same CATH homology
 2P6U A;  3JPT A;  4QZI A;  4NKU A;  1PZN A;  4O3O A;  3MDA A;  1B22 A;  4F92 B;  4WC0 A;  3T5L A;  2ALZ A;  2PFQ A;  3JZ0 A;  2BPF A;  5HP4 A;  5IIO A;  2NRK A;  1IM4 A;  4KLG A;  2FMP A;  4FHX A;  2JEJ A;  2AGO A;  3GIK A;  3B0X A;  4O3S A;  4KLH A;  4LZD A;  4PGY A;  1D8L A;  1KRP A;  1RXW A;  9ICE A;  4WC1 A;  4MEX A;  4KLO A;  2IBK A;  1XSL A;  3OGU A;  1NJW A;  4ED3 A;  3RJK A;  4DS5 A;  4B9U A;  4K4H A;  4J9S A;  4X4V A;  5KT7 A;  1UA1 A;  3RB0 A;  4KLQ A;  4WCW A;  4AT9 A;  1JMS A;  4DEZ A;  4I2H A;  1KEJ A;  4YN4 A;  4X4S A;  5KG5 A;  3H3A A;  3ISB A;  1TKD A;  2BGW A;  1U48 A;  1T3N A;  4NLN A;  5J0T A;  4WC2 A;  3C1Z A;  4RQ6 A;  4J9K A;  2DR7 A;  9ICO A;  8ICR A;  2H5X A;  4JWM A;  1NK0 A;  2JZB B;  2Y1J A;  5J2I A;  3N97 B;  4DQP A;  2ZH2 A;  4ECQ A;  3HWT A;  2PI4 A;  5CWR A;  4C8L A;  8ICL A;  4RT3 A;  2ZJ8 A;  4IQW A;  3EW9 A;  4KLT A;  1V4A A;  4NKT A;  1NKE A;  5F2V O;  3B0Y A;  2ZUB A;  4O0I A;  3AQM A;  3C1Y A;  1L3S A;  5D4B A;  5HRE A;  4ECW A;  4JWN A;  4YD1 A;  5KFN A;  3Q8M A;  4RZR A;  5DB9 A;  1Y88 A;  4UBB A;  5DDM A;  1TAQ A;  4UB4 A;  2ASL A;  5KG3 A;  2W9M A;  3Q8R B;  2BR0 A;  1ZQJ A;  1D9D A;  4F3O A;  1HUO A;  2DR5 A;  3MFH A;  1XSP A;  3PR5 B;  4YR2 A;  3SV4 A;  2NRX A;  3LDA A;  4EYH B;  5HRI A;  4ED2 A;  3QZ7 A;  3PO5 A;  4DQR A;  4O3Q A;  1BPB A;  4UB2 A;  1ZJM A;  4EBK A;  4KLD A;  3MGI A;  4FBU A;  3Q8K A;  1BPX A;  2IMW P;  4O5C A;  3OV7 A;  1TK8 A;  1NJY A;  9ICF A;  5CJ7 A;  2JEF A;  4DWI A;  3LWL A;  1H38 A;  2FMS A;  1BGX T;  4M0A A;  8ICO A;  4DL3 A;  4RQ1 A;  8ICI A;  3IM1 A;  4IG8 A;  4QWE A;  4O3N A;  4FHV A;  1B43 A;  4Z6D A;  4O3P A;  4R63 A;  5KT4 A;  2BQR A;  3TAR A;  4I2B A;  2PBE A;  3MR3 A;  4DFJ A;  3RJH A;  3RR8 A;  2C28 A;  4C8O A;  5J29 A;  2XY7 A;  1IXR A;  5KFD A;  4BDP A;  8ICU A;  5KFW A;  4DL6 A;  1CEZ A;  9ICI A;  4RPZ A;  3ISD A;  2XCA A;  4ED1 A;  4DL4 A;  4B9N A;  5KFK A;  7ICR A;  5KFR A;  4KLU A;  1KSP A;  4FH5 A;  4R66 A;  4RUC A;  2IHN A;  4KLJ A;  9ICA A;  4UB3 A;  8ICS A;  3LK9 A;  4DSK A;  3T5J A;  4X4P A;  2ZTE A;  9ICQ A;  1NZP A;  1ARO P;  3WFQ E;  2UVU A;  1F5A A;  4Z6F A;  3V7L A;  5CA7 A;  4ED7 A;  2AU0 A;  5DB6 A;  5J2F A;  3C18 A;  3PMN A;  4RNM A;  7ICV A;  2DR8 A;  2ZH6 A;  5DED A;  5KFV A;  1KDH A;  2HHT A;  1ZQE A;  4KIT B;  1XO1 A;  2AGQ A;  2XC9 A;  5IIK A;  1PX5 A;  4UD4 A;  5EWG A;  1WCL A;  5J0X A;  1UT8 A;  3AQL A;  5KFP A;  1ZQF A;  4PHE A;  4EZ9 A;  2DR9 A;  2MUT A;  4NLG A;  7ICU A;  4P2H A;  4O9M A;  3OVB A;  9ICX A;  1DGS A;  3MGH A;  1D8Y A;  1NOM A;  1Z3E B;  1BPE A;  5DBC A;  3MBY A;  5J2D A;  1NJX A;  9ICN A;  2ZHB A;  4EBD A;  3AU6 A;  1T4G A;  3TAP A;  4PPX A;  4YR0 A;  2ASJ A;  4IR9 A;  8ICQ A;  1DK3 A;  9ICG A;  4TUR A;  5DQH A;  5KFT A;  4TUQ A;  1DK2 A;  4YR3 A;  3EZ5 A;  4AT8 A;  1VFG A;  2F1I A;  2ZTC A;  1Z00 B;  1ZQA A;  2M2W A;  2Q66 A;  5KFM A;  1JX4 A;  2R8G A;  4UQG A;  3LWM A;  1MQ3 A;  2HHX A;  4FBT A;  1HJP A;  2UVR A;  5KFU A;  4UD5 A;  1R8B A;  3RRH A;  8ICY A;  4X4R A;  2C22 A;  3T5K A;  7ICL A;  4UB5 A;  1X9S A;  3PO4 A;  4PH5 A;  3MFI A;  3OSN A;  1QSS A;  1U45 A;  2FLN A;  9ICL A;  1ZQP A;  4ECZ A;  4B9S A;  4F5R A;  4O5K A;  4PGX A;  4F8R A;  3OVA A;  4YQW A;  5J0U A;  1BPY A;  1BNP A;  3OHA A;  2PFO A;  1R89 A;  4WBY A;  2ZH5 A;  4F50 A;  3C21 A;  1ZQV A;  1SL2 A;  2BHN A;  1UT5 A;  5EOZ A;  3HT3 A;  2ZTD A;  8ICF A;  8ICJ A;  3RB3 A;  1KLN A;  8ICN A;  3GIJ A;  3PVX A;  1C7Y A;  4YMO A;  2WTF A;  2FLP A;  4DSJ A;  4Q8E A;  5J2J A;  5KG7 A;  2V4Q A;  8ICE A;  2LYH A;  2KFN A;  5HRB A;  4KLI A;  4S3N A;  9ICT A;  5DKW A;  3MAB A;  3PW4 A;  2XGQ A;  4DOB A;  3BQ0 A;  4JUZ A;  4FS2 A;  2FPM A;  5HRL A;  4RQ8 A;  5III A;  3EPG A;  3K75 D;  4ECY A;  5BPC A;  9ICS A;  4I29 A;  1KTQ A;  4DSE A;  2KZM A;  4F4K A;  5KFZ A;  4RPY A;  4DL2 A;  2W9A A;  3QEA Z;  5F9L A;  1BPZ A;  5L1J A;  2FLL A;  5HML A;  2BCQ A;  4IR1 A;  4ECV A;  2DPI A;  4IRD A;  5TZV A;  1S0V A;  4RQ4 A;  1L3U A;  3RAX A;  7ICS A;  4DL5 A;  4TQR A;  3RJI A;  2XY5 A;  4DOA A;  3Q8P B;  2ZJ5 A;  4O3R A;  1N48 A;  1TK0 A;  4ELT A;  3G6Y A;  3EPI A;  4F4X A;  4QZ9 A;  5KG6 A;  3OHB A;  2C2E A;  5KFE A;  1ZQK A;  3OUY A;  4RNN A;  4WC7 A;  1KNY A;  4Z6C A;  2NRZ A;  3HPO A;  5L1L A;  8ICG A;  9ICV A;  4J9P A;  5J0S A;  1Q79 A;  4DOC A;  5DLG A;  4Z6E A;  4M9J A;  2DPJ A;  2J6S A;  1ZQR A;  1D9F A;  8ICX A;  2ZH3 A;  4UAY A;  1XWL A;  4QZF A;  4QW9 A;  4BXO A;  2Y1I A;  2PFN A;  4I2C A;  7ICE A;  2ZHA A;  1ZQI A;  3H4B A;  2HHU A;  2VA2 A;  3RJG A;  5KFA A;  5L1K A;  7ICH A;  4KN7 A;  4NXZ A;  2UVW A;  3HW8 A;  5KFC A;  4LT6 A;  4J9M A;  4P4O A;  4QWC A;  3QE9 Y;  4Q8F A;  3GQC A;  2BCV A;  3ORY A;  1VJ7 A;  3M9O B;  1QLN A;  2ID1 A;  8ICP A;  5J0R A;  2W8K A;  4J9L A;  3UQ0 A;  1XC9 A;  4ECR A;  2PXI A;  1S0O A;  2F1J A;  1QSY A;  2PFP A;  4QZA A;  3T5H A;  3Q8L A;  1ZQU A;  3PX6 A;  3RB6 A;  2KFZ A;  4M9L A;  2Q0Z X;  4X5V A;  2NRW A;  4KTQ A;  4J9N A;  4GC6 A;  3RBD A;  3RJJ A;  4MFC A;  1ZQW A;  5DQI A;  4YCX A;  2R8H A;  1T7P A;  3V6J A;  4NM1 A;  2P6R A;  8ICV A;  5J2E A;  2ASD A;  3RB4 A;  2J6T A;  3HJ1 A;  4RU9 A;  1ZQN A;  4P4P A;  4DQI A;  2MAX A;  4PHA A;  4GXK A;  4YFK A;  4B9M A;  9ICJ A;  4ZH4 A;  4GXJ A;  4LZG A;  2ATL A;  8ICK A;  4F91 B;  3C5F A;  4FO6 A;  4BXO B;  1HUZ A;  3JPO A;  2ZH7 A;  3KHG A;  3RBE A;  2VA8 A;  5DB7 A;  3SZ2 A;  4QZG A;  1ZQD A;  1ZQG A;  4G3I A;  4FHP A;  4EBJ A;  3MR6 A;  3PX0 A;  4ED0 A;  4X0B A;  4X4Q A;  2ZH9 A;  5DQG A;  4DF4 A;  2HHW A;  3ISC A;  2M2V A;  2PI5 A;  4WC4 A;  1SKS A;  4UBC A;  2FPK A;  5KFJ A;  4QZH A;  4MFF A;  3EYZ A;  1KFD A;  1JAJ A;  2O5A A;  5J2B A;  1TVA A;  2ZUC A;  5L9X A;  2RFF A;  3H40 A;  3PX4 A;  2NRV A;  4BGD A;  1ZQC A;  4KLM A;  1Q78 A;  4QZ8 A;  3GII A;  4UB1 A;  3HX0 A;  3BJY A;  3SI8 A;  3RRG A;  3PR4 A;  9ICW A;  1WOT A;  4AT8 B;  4NY8 A;  5HC9 A;  4EEY A;  3HJ4 A;  3WFR E;  4FH3 A;  4RUA A;  2IHM A;  4X4N A;  4WC6 A;  3KHR A;  1SL1 A;  1TFW A;  3PV8 A;  4XA5 A;  5J0Q A;  4AT7 B;  4M9N A;  4TUS A;  2HHP A;  4DLG A;  7ICG A;  4WC3 A;  4R65 A;  4MEY A;  2MUT B;  3V7J A;  1K1S A;  5DG8 A;  4X0A A;  3OSP A;  4YD2 A;  4E7X A;  2HVI A;  1CUK A;  4RWN A;  8ICM A;  3MR2 A;  1JQR A;  1ZQH A;  1ZQT A;  1UEU A;  3V6K A;  1MQ2 A;  5KT2 A;  1KFS A;  2HHS A;  7ICJ A;  1KFT A;  3AUO A;  4TQS A;  1COO A;  5KFF A;  3OJS A;  1NKB A;  4I2E A;  2NRT A;  1T8E A;  8ICZ A;  5HRH A;  2ZH1 A;  5KFS A;  2VA3 A;  4M2Y A;  4I2G A;  5KT3 A;  4YXM A;  5J2K A;  4RQ0 A;  4ED6 A;  2XO7 A;  3WFP A;  3AQN A;  5J0O A;  3H8W A;  3L9D A;  4R8U B;  2RDJ A;  4K4G A;  5J0P A;  2P66 A;  1S76 D;  4RWO A;  3RH6 A;  1YLQ A;  1ZQX A;  4NLK A;  4IQT A;  4RWQ A;  3GFK B;  4F5Q A;  1XSN A;  4LVS A;  4KLS A;  3UXO A;  5KFL A;  3ZDD A;  2AJQ A;  8ICC A;  4M6W A;  1X2I A;  5D46 A;  5EWE A;  4J9R A;  4C8K A;  5KFO A;  9ICM A;  2KP7 A;  4JV0 A;  2V4R A;  4E8F A;  2DVI A;  2M2U A;  5J2G A;  1L3T A;  3SYZ A;  2ISO A;  3JPR A;  2BQU A;  4YVZ A;  4F5P A;  3T3F A;  4MF2 A;  3JPS A;  4TUP A;  3KHL A;  2ZH8 A;  3V72 A;  1ZQL A;  4F2R A;  1ZQQ A;  4K4I A;  3IHQ B;  5D49 A;  3M9N B;  4DQS A;  1ZQM A;  4M04 A;  3KTQ A;  4B9V A;  1A77 A;  3ZDC A;  4QWD A;  4QZE A;  3M9M B;  5DG7 A;  5J0Y A;  2F1H A;  3RTV A;  2JEI A;  3ZD9 A;  3PW7 A;  3ZDB A;  3PML A;  4RQ2 A;  4GC7 A;  4CCH A;  4RT2 A;  1ZQY A;  5C5J A;  5KFB A;  3TFS A;  3H39 A;  3RAQ A;  1SKW A;  4B9T A;  4R64 A;  2BDP A;  2BPC A;  3C66 A;  4AT7 A;  3HP6 A;  4NM2 A;  3M8R A;  2XGP A;  1UET A;  2C2R A;  3PW5 A;  1EXN A;  3TI0 A;  1NK7 A;  3NYB A;  3K4G A;  5DBB A;  3KHH A;  4QZD A;  4P4M A;  3C2K A;  1BNO A;  3WFS C;  9ICR A;  1S77 D;  1NK4 A;  5DG9 A;  5KG4 A;  4YP3 A;  3QZ8 A;  3AU2 A;  3PW2 A;  4FHY A;  4PHP A;  4M6W B;  1JN3 A;  2RDI A;  4F93 B;  2W9C B;  1WCN A;  1ZYQ A;  5J2C A;  2OWO A;  4ELU A;  4M9G A;  3WFO A;  4RQ3 A;  4FS1 A;  5HHH A;  5J2H A;  2ZUD A;  4DF8 A;  3H38 A;  5KFX A;  2A1J B;  1RXV A;  2J6U A;  3E2E A;  1TFY A;  1XU4 A;  3OVS A;  5KFY A;  2AGP A;  9ICP A;  2O1P A;  2HW3 A;  3RJF A;  1SKR A;  2R8K A;  4ATB B;  1R8A A;  4KN4 A;  4QW8 A;  1NJZ A;  5KFH A;  4YMM A;  1ZQS A;  3BQT A;  4RQ5 A;  1N56 A;  1LV5 A;  4RWP A;  3ZD8 A;  5DBA A;  4HYK A;  2JZB A;  3GV5 B;  3V6H A;  2BCS A;  2UVV A;  5HRK A;  3EWA A;  1L3V A;  1TK5 A;  7ICK A;  2W8L A;  9ICK A;  4FHW A;  4DFP A;  5J2A A;  1X9W A;  2C2D A;  3TQ1 A;  5DGB A;  4XUS A;  4ECS A;  1QTM A;  3ZDA A;  7ICO A;  4X4O A;  4M5D A;  3UQ2 A;  5DB8 A;  1RYS A;  4WC5 A;  5CP2 A;  1L5U A;  3UXP A;  2IA6 A;  7ICM A;  3H7I A;  4I28 A;  2JEG A;  4DLE A;  1XS9 D;  1JXL A;  4F2S A;  3UPS A;  2VAN A;  2FPL A;  1MIW A;  1S97 A;  5L1I A;  5KT6 A;  4B9L A;  5IIL A;  4IRC A;  4DSF A;  3TAQ A;  4I2I A;  1ZET A;  2GWS A;  3TAN A;  4YXJ A;  1UA0 A;  1NK5 A;  4BWJ A;  1U47 A;  4ATB A;  4KLL A;  5CR0 A;  1MIV A;  4NLZ A;  9ICC A;  4BWM A;  3ZDE A;  1ZQO A;  1ZQB A;  4GLX A;  9ICB A;  4X4U A;  4I2D A;  3MR5 A;  1DOQ A;  5KT5 A;  1OU5 A;  1TAU A;  4QWB A;  2R8J A;  1RPL A;  2ISP A;  4I2F A;  5HRD A;  4F4Z A;  3BQ2 A;  4ECU A;  3Q8Q B;  4ELV A;  4QWA A;  5HRG A;  4XQ7 A;  3JPQ A;  4ED8 A;  3RJE A;  3OUY B;  2M9N A;  4GXI A;  2KZ3 A;  2BCR A;  5KFQ A;  4EBC A;  1MSW D;  5HRF A;  2R8I A;  2BKE A;  3JYY A;  5DDY A;  2XCP A;  4YG2 A;  3PNC A;  3C23 A;  5HNK A;  3SV3 A;  1BVS A;  4QZC A;  9ICH A;  5HHI A;  1U9L A;  5IIJ A;  4DQQ A;  8ICB A;  3MDC A;  4C8N A;  4J9O A;  4IRK A;  4JV2 A;  3BDP A;  2HHV A;  9ICU A;  1U4B A;  3LQC B;  3PY8 A;  5CHG A;  2I1Q A;  4EP7 A;  3N4M B;  1TV9 A;  8ICH A;  4MF8 A;  5KG0 A;  1Z00 A;  2KN7 A;  1X9M A;  1JIH A;  1FA0 A;  3H37 A;  2DRB A;  2XY6 A;  4DO9 A;  4ECT A;  1RZT A;  1S0M A;  8ICW A;  1NO5 A;  3JPN A;  2DFL A;  7ICT A;  4EYI B;  4F5N A;  4RNO A;  2FMQ A;  5DEC A;  3NGD A;  5IIM A;  4AT9 B;  1NK6 A;  3NTU A;  1S9F A;  3BQ1 A;  3M8S A;  4EZ6 A;  2DRA A;  1K1Q A;  5JUM A;  4DFM A;  1QSL A;  4JV1 A;  4DS4 A;  5IIN A;  4PHD A;  3RH5 A;  4E0D A;  4I27 A;  1V9P A;  3TFR A;  2V9W A;  2KZZ A;  4MFA A;  2W9B A;  1A76 A;  3GV8 B;  1TFR A;  4YMN A;  2BPG A;  1S0N A;  5KFG A;  4EBE A;  1ZJN A;  7ICN A;  4JK1 A;  2ZH4 A;  3H8S A;  4Q43 A;  3C2M A;  4XRH A;  2BQ3 A;  4F5O A;  3GIL A;  4C8M A;  4J9Q A;  1NK9 A;  8ICT A;  3ETL A;  4DFK A;  1SZP A;  2W9B B;  5DLF A;  3QEB Z;  3UPQ A;  3FYH A;  2I9G A;  4KLF A;  5HMM A;  1JXE A;  3GDX A;  2HVH A;  1LB2 B;  2BCU A;  3GV7 B;  3FDS A;  3HIY A;  5KTQ A;  3C2L A;  2ZJA A;  4M9H A;  5HR9 A;  2BE3 A;  3G6V A;  5BOL A;  4KMU A;  7ICP A;  1MIY A;  4R8U A;  4RPX A;  4IQV A;  3RH4 A;  4UAW A;  1NKC A;  4I2A A;  1U49 A;  3PW0 A;  2A1J A;  3UXN A;  4DL7 A;  2AQ4 A;  4Q45 A;  4I2J A;  1NK8 A;  4KLE A;  2KTQ A;  5KFI A;  3AQK A;  3Q8S B;  5KG1 A;  3G6X A;  3H4D A;  4F4Y A;  3C5G A;  4ECX A;  1RYR A;  4WBZ A;  5BOM A;  2W9C A;  4IQU A;  1SL0 A;  1R8C A;  5DGA A;  4F4W A;  7ICF A;  3RR7 A;  3H8J A;  4UAZ A;  5KG2 A;  4DSI A;  1ZQZ A;  5CB1 A;  4QZB A;  5F9N A;  3THV A;  8ICA A;  3OJU A;  7ICQ A;  1UEV A;  4X4T A;  1S10 A;  2M2T A;  7ICI A;  4Q44 A;  4RQ7 A;  4DSL A;  5J0W A;  4E80 A;  4XQ8 A;  2B21 A;  3GIM A;  2HHQ A;  5EWF A;  4M47 A;  3V7K A;  4O5E A;  1MC8 A;  3JPP A;  1BPD A;  2AQ0 A;  4PGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...