4AT8A

Crystal structure of the nf90-nf45 dimerisation domain complex with atp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
333
structure length
333
Chain Sequence
SHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords INTERLEUKIN ENHANCER-BINDING FACTOR 2
publication title NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
pubmed doi rcsb
source organism Mus musculus
total genus 107
structure length 333
sequence length 333
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07528 DZF DZF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4at8A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4at8A02
1HUOA 2P66A 4OAGA 5DEDA 4I2GA 1ZQWA 2ID1A 4KLFA 5J0XA 4M2YA 3RJJA 4UBBA 3WFPA 1OU5A 1ZQLA 7ICVA 4S3NA 5J2CA 2O1PA 9ICTA 3UXOA 5BOMA 3JPRA 5HR9A 7ICJA 4PGXA 4O67A 1MQ3A 4O69A 5DBCA 4UB5A 3AQLA 4RT2A 4E80A 1VFGA 4GXKA 4I2IA 4X4TA 1UEVA 5J0QA 1TFYA 4K97A 1BPDA 1ZQSA 4I2DA 4UAZA 3ISCA 5CP2A 3UPQA 4X0AA 4MKPA 2NRKA 3AU6A 4TURA 5J0RA 8ICTA 4M9HA 4LT6A 5J0OA 1HUZA 1ZQAA 4QZFA 4AT9A 1ZQTA 4K4GA 3OVSA 4QZHA 4O5KA 4KLTA 3H38A 1UETA 2PFNA 4EBJA 8ICCA 8ICYA 4M9NA 9ICGA 4RQ2A 7ICRA 4X4SA 1Q79A 5HREA 5F2VO 9ICBA 4WC7A 4TUQA 7ICOA 2GWSA 4RQ8A 4X0BA 4I2EA 2FMSA 3AQNA 1R8BA 4MF2A 2M2UA 5IINA 7ICHA 3MGIA 5D46A 1ZQZA 4UAYA 4DO9A 2ZH1A 5HC9A 3HW8A 8ICNA 4FHWA 5HRIA 7ICIA 4I2BA 4QZGA 4K4IA 9ICXA 4X4NA 1NOMA 4WBZA 1JN3A 4XUSA 7ICFA 4E8FA 2W9MA 4KLMA 1KDHA 3V7LA 8ICHA 1ZQQA 4Z6FA 5J2DA 5DB7A 5IIKA 7ICQA 4OAFA 4QZEA 4QZBA 4JLZA 1MIVA 5CB1A 4QZDA 8ICOA 2DVIA 4I2AA 5J0UA 1ZQXA 5J2KA 3MDAA 2ZH2A 1XSNA 3OUYB 4PHDA 4I27A 3MBYA 3V7KA 3OV7A 3WFRE 2ZH3A 3C5GA 4YCXA 9ICNA 4X4UA 1MIWA 3C2KA 3AUOA 1R8CA 8ICKA 3LK9A 4KB6A 3JPOA 2DR5A 3MDCA 5J2EA 4UB2A 4DOBA 3RJHA 4KLEA 4KLUA 4M04A 1V4AA 4F5NA 4PPXA 4M5DA 3LQCB 1JAJA 2ZH5A 2IHMA 9ICPA 4E7XA 1F5AA 4O9MA 4RWNA 4M47A 5BOLA 5J2BA 1ZJMA 4KLIA 4PHAA 3WFQE 4R63A 4FHPA 1ZQNA 2FMPA 3WFOA 4O68A 1ZQDA 1ZQFA 3ISDA 4X4VA 7ICPA 4WC0A 3OVBA 1ZQKA 2HHPA 3B0YA 4ATBA 4P4MA 1VJ7A 4NKUA 4X4QA 3UXNA 3RJFA 3HIYA 1BPEA 4NM2A 4MFAA 4RQ3A 4DOAA 1BPZA 2Q66A 4UD4A 7ICKA 9ICWA 7ICGA 2PBEA 1ZQUA 4IQTA 5J2AA 4FHYA 4GXJA 5HRBA 4K99A 4X4RA 5DBAA 3RJIA 5CWRA 3L9DA 4P2HA 1ZQYA 3JPPA 3JPQA 8ICVA 4IQUA 2ZH8A 5J2HA 4XRHA 3C66A 3PNCA 2BPGA 3RH5A 1ZQJA 4I2HA 5DB9A 4PGYA 9ICVA 4YD1A 1TV9A 8ICXA 3C18A 8ICZA 4R65A 1PX5A 2ZH9A 9ICMA 8ICEA 3HWTA 2BCSA 4QZ9A 4MF8A 2RFFA 1WOTA 5IIMA 4YN4A 4WC4A 4QZ8A 4LEVA 5D4BA 4MFFA 2PXIA 3B0XA 4KLHA 4WOYA 2ZHAA 5HRDA 2M2WA 4UB4A 4KM5A 4NXZA 4FH3A 3H39A 1YLQA 4Z6DA 1JQRA 9ICHA 1ZQRA 8ICGA 4EBKA 5CJ7A 3H3AA 2DR7A 4K9BA 8ICJA 4KLGA 4AT7B 3UQ0A 2PFQA 2DRBA 9ICIA 5BPCA 3TFRA 4F5QA 8ICQA 7ICLA 3AQMA 5HRKA 4M9JA 4RPXA 4K98A 1R89A 3TFSA 4NXUA 8ICWA 3JPTA 1KEJA 4I28A 4UB1A 3K75D 9ICSA 5HRHA 5J29A 1BPYA 1UEUA 2ISPA 7ICUA 7ICEA 5DB6A 4FO6A 7ICTA 4QZAA 4WC3A 8ICBA 5HRLA 5TZVA 4RQ4A 2ZH4A 1XSLA 3PMLA 2BCRA 1JMSA 4PH5A 4I29A 4OAHA 7ICSA 2BCVA 4RWQA 1ZQPA 4XQ8A 4EP7A 1ZQHA 9ICRA 4AT8B 4UD5A 4RWPA 3OUYA 5J0WA 4UAWA 4UB3A 8ICRA 4RQ5A 4PGQA 4NXVA 2ISOA 4NY8A 4MFCA 4KLOA 9ICAA 3JPNA 9ICCA 4YMNA 4R66A 9ICLA 3C2MA 5CR0A 5J2IA 4K96A 4P4PA 4XA5A 1ZQMA 3RJEA 4GXIA 2M2TA 1NO5A 3NYBA 5HRFA 4NXTA 3WFSC 5IIJA 4RWOA 4WC5A 1ZQIA 1ZQCA 4TUSA 4IQWA 5HRGA 4PHPA 4X4OA 4TUPA 5IIIA 4QZIA 4M9GA 8ICFA 4F5PA 4LZGA 9ICFA 2BPCA 3MGHA 3RJKA 1ZQBA 3UQ2A 4M9LA 4FH5A 2PFOA 4RQ7A 4O5CA 4RPZA 1MQ2A 4AT9B 1TFWA 4JWNA 4LVSA 5EOZA 2BCUA 3JZ0A 9ICOA 4RQ6A 4QZCA 3OGUA 3JYYA 5CHGA 4R64A 4F5OA 4K8VA 5J0SA 2DRAA 4O6AA 4DOCA 4NXWA 1XSPA 3UXPA 3V72A 9ICUA 4K9AA 4RPYA 5J0PA 1KNYA 2PFPA 5HHIA 5HHHA 3V7JA 4F5RA 1ZQEA 3AU2A 4NLKA 3JPSA 1R8AA 1RZTA 5J0YA 5DBBA 8ICMA 8ICPA 3HX0A 3AQKA 4IQVA 5IILA 1BPBA 4I2JA 4LEZA 2DR9A 4LZDA 4Z6EA 4NXXA 4YMMA 3C2LA 4LEWA 1FA0A 2O5AA 4NM1A 3HJ1A 2DR8A 5DECA 3PMNA 4OAIZ 1ZJNA 4I2CA 4M0AA 4NLZA 1BPXA 2ZHBA 5DDYA 1ZQGA 3UPSA 8ICSA 4KLSA 4X4PA 4WC2A 5DDMA 4KLQA 2M2VA 4RQ1A 3OVAA 4YMOA 1ZQVA 4FHXA 3RH4A 3H37A 3HJ4A 5D49A 1RPLA 2VANA 1Q78A 7ICMA 4AT7A 4WBYA 4RT3A 3GDXA 8ICLA 3RH6A 5J2FA 8ICIA 3C5FA 9ICJA 5J2GA 4UBCA 4X5VA 4PHEA 4WCWA 2BCQA 2I9GA 4I2FA 4KLLA 5CA7A 4WC6A 4JWMA 4NKTA 4WC1A 3ISBA 4NLNA 4O5EA 2ZH7A 4YD2A 2FMQA 9ICEA 1ZQOA 4P4OA 2BPFA 8ICUA 4XQ7A 9ICKA 5DB8A 8ICAA 4KLJA 5J0TA 2ZH6A 5DKWA 4KLDA 4LEYA 2BE3A 3RJGA 5IIOA 4ATBB 1TVAA 4JLXA 4RQ0A 4K4HA 4IG8A 5J2JA 1MIYA 9ICQA 4Z6CA 7ICNA 4AT8A 4FHVA
chains in the Genus database with same CATH superfamily
1HUOA 2P66A 4OAGA 5DEDA 4I2GA 1ZQWA 2ID1A 4KLFA 5J0XA 4M2YA 3RJJA 4UBBA 3WFPA 1OU5A 1ZQLA 7ICVA 4S3NA 5J2CA 2O1PA 9ICTA 3UXOA 5BOMA 3JPRA 5HR9A 7ICJA 4PGXA 4O67A 1MQ3A 4O69A 5DBCA 4UB5A 3AQLA 4RT2A 4E80A 1VFGA 4GXKA 4I2IA 4X4TA 1UEVA 5J0QA 1TFYA 5D63A 4K97A 1BPDA 1ZQSA 4I2DA 4UAZA 3ISCA 5CP2A 3UPQA 4X0AA 4MKPA 2EWRA 2NRKA 3AU6A 4TURA 5J0RA 8ICTA 4M9HA 4LT6A 5J0OA 1HUZA 1ZQAA 4QZFA 4AT9A 1ZQTA 4K4GA 3OVSA 4QZHA 5CHEA 3PHZA 4O5KA 4KLTA 3H38A 1UETA 2PFNA 4EBJA 8ICCA 8ICYA 4M9NA 9ICGA 4RQ2A 7ICRA 4X4SA 1Q79A 5HREA 5D61A 5F2VO 9ICBA 4WC7A 4TUQA 7ICOA 2GWSA 4RQ8A 4X0BA 4I2EA 2FMSA 3AQNA 1R8BA 4MF2A 2M2UA 5IINA 7ICHA 3MGIA 1GPJA 5D46A 3ER9B 1ZQZA 4UAYA 4DO9A 2ZH1A 5HC9A 3HW8A 8ICNA 4FHWA 5HRIA 7ICIA 4I2BA 4QZGA 4K4IA 9ICXA 4X4NA 1NOMA 4WBZA 3ERCC 1JN3A 4XUSA 7ICFA 4E8FA 2W9MA 4KLMA 1KDHA 3V7LA 8ICHA 1ZQQA 4Z6FA 5J2DA 5DB7A 5IIKA 7ICQA 4OAFA 4QZEA 4QZBA 4JLZA 1MIVA 5CB1A 4QZDA 8ICOA 2DVIA 4I2AA 5J0UA 1ZQXA 5J2KA 2ZH2A 3MDAA 1XSNA 3CK6A 3OUYB 4PHDA 5D62A 3MBYA 4I27A 3V7KA 3OV7A 4HX0A 3WFRE 2ZH3A 5B3QA 3C5GA 4YCXA 9ICNA 4X4UA 1MIWA 3C2KA 3AUOA 2BBJA 1R8CA 5B3PA 8ICKA 3LK9A 4KB6A 3JCFA 3JPOA 2DR5A 4EV6A 3MDCA 5J2EA 4UB2A 4DOBA 3RJHA 4KLEA 4KLUA 4M04A 1V4AA 4F5NA 4PPXA 4M5DA 3LQCB 1JAJA 2ZH5A 2BBHA 2IHMA 9ICPA 4E7XA 1F5AA 4O9MA 2B4VA 4RWNA 4M47A 5BOLA 5J2BA 1ZJMA 5CFUA 4KLIA 4PHAA 3WFQE 4R63A 4FHPA 1ZQNA 2FMPA 3WFOA 4O68A 1ZQDA 1ZQFA 3ISDA 4X4VA 7ICPA 3OVBA 4WC0A 1ZQKA 2HHPA 3B0YA 4ATBA 4P4MA 1VJ7A 4NKUA 4X4QA 3UXNA 3RJFA 5CFSA 3HIYA 1BPEA 4NM2A 4MFAA 4RQ3A 3OWGA 4DOAA 1BPZA 2Q66A 4UD4A 7ICKA 9ICWA 7ICGA 2PBEA 1ZQUA 4IQTA 5J2AA 4FHYA 4GXJA 5HRBA 4X4RA 4K99A 4N7RA 5DBAA 3RJIA 5CWRA 3L9DA 4P2HA 1ZQYA 3JPPA 3JPQA 8ICVA 4IQUA 2ZH8A 5J2HA 4XRHA 3C66A 3PNCA 2BPGA 3RH5A 1ZQJA 4I2HA 5DB9A 4PGYA 9ICVA 4YD1A 1TV9A 8ICXA 3C18A 8ICZA 4R65A 1PX5A 2ZH9A 9ICMA 3NVOA 8ICEA 3HWTA 2BCSA 4QZ9A 4MF8A 2RFFA 1WOTA 5IIMA 4YN4A 4WC4A 4QZ8A 4LEVA 5D4BA 4MFFA 2PXIA 3B0XA 4KLHA 4WOYA 2ZHAA 5HRDA 2IHOA 2M2WA 4UB4A 4KM5A 4NXZA 4FH3A 3H39A 1YLQA 4Z6DA 1JQRA 9ICHA 1ZQRA 8ICGA 4EBKA 2DR7A 3H3AA 5CJ7A 4K9BA 8ICJA 4KLGA 4AT7B 3UQ0A 2PFQA 2DRBA 9ICIA 5BPCA 3TFRA 4F5QA 8ICQA 7ICLA 3AQMA 5HRKA 4M9JA 3K7DA 4RPXA 4K98A 1R89A 3TFSA 4NXUA 8ICWA 3JPTA 1KEJA 4I28A 4UB1A 3K75D 9ICSA 5HRHA 5J29A 1BPYA 1UEUA 2ISPA 4I0UA 7ICUA 7ICEA 5DB6A 4FO6A 7ICTA 4QZAA 4WC3A 8ICBA 5HRLA 5TZVA 4RQ4A 2ZH4A 1XSLA 5CFTA 3PMLA 2BCRA 1JMSA 4PH5A 4I29A 4OAHA 7ICSA 2BCVA 4RWQA 1ZQPA 4EP7A 4XQ8A 1ZQHA 9ICRA 4AT8B 4UD5A 4RWPA 3OUYA 5J0WA 4UAWA 3ER8C 4UB3A 8ICRA 4RQ5A 4PGQA 4NXVA 2ISOA 4NY8A 4MFCA 4KLOA 9ICAA 3JPNA 9ICCA 4YMNA 4R66A 9ICLA 3C2MA 5CR0A 5J2IA 4K96A 4P4PA 4XA5A 1ZQMA 3RJEA 4GXIA 2M2TA 3NYBA 1NO5A 5HRFA 4NXTA 3WFSC 5IIJA 4RWOA 4WC5A 1ZQIA 1ZQCA 4TUSA 4IQWA 5HRGA 4PHPA 4X4OA 4TUPA 5IIIA 4QZIA 4M9GA 8ICFA 4F5PA 4LZGA 9ICFA 2BPCA 3MGHA 3RJKA 1ZQBA 2IUBA 3UQ2A 4M9LA 4FH5A 2PFOA 4RQ7A 4O5CA 4RPZA 1MQ2A 4AT9B 1TFWA 2FCLA 4JWNA 4LVSA 5EOZA 4WH5A 3JZ0A 2BCUA 9ICOA 4RQ6A 4QZCA 3OGUA 3JYYA 5CHGA 3NKUA 4R64A 4F5OA 4K8VA 5J0SA 2DRAA 4EEDA 4O6AA 4DOCA 4NXWA 1XSPA 3UXPA 5JTGA 4FO1A 3V72A 9ICUA 4K9AA 4RPYA 5J0PA 1KNYA 2PFPA 5HHIA 5HHHA 3V7JA 4F5RA 1ZQEA 3AU2A 4NLKA 3JPSA 1R8AA 1RZTA 5J0YA 5DBBA 8ICMA 8ICPA 3HX0A 3AQKA 4IQVA 4XJEA 5IILA 1BPBA 4I2JA 2B51A 2DR9A 4LEZA 4LZDA 4Z6EA 4NXXA 3MCRA 4YMMA 3C2LA 4LEWA 2GA9D 4WQKA 1FA0A 2HN1A 2O5AA 4NM1A 3HJ1A 2DR8A 5DECA 4EEBA 3PMNA 4OAIZ 1ZJNA 4I2CA 4M0AA 4NLZA 1BPXA 2ZHBA 3EF2A 5DDYA 1ZQGA 3UPSA 8ICSA 4KLSA 4X4PA 2HN2A 4WC2A 5DDMA 4KLQA 2M2VA 4RQ1A 3OVAA 4YMOA 1ZQVA 4FHXA 3NWIA 3RH4A 3H37A 2GAFD 3HJ4A 5D49A 1RPLA 2VANA 4EGWA 1Q78A 7ICMA 4AT7A 4WBYA 4RT3A 3GDXA 8ICLA 3RH6A 5J2FA 8ICIA 3C5FA 9ICJA 5J2GA 4UBCA 4X5VA 4PHEA 4WCWA 2BCQA 2I9GA 4I2FA 4WQLA 4KLLA 5CA7A 4WC6A 4JWMA 4NKTA 4WC1A 3ISBA 4NLNA 4O5EA 2ZH7A 4YD2A 2B56A 2FMQA 9ICEA 1ZQOA 4P4OA 2BPFA 8ICUA 4XQ7A 9ICKA 5DB8A 8ICAA 4KLJA 5J0TA 2ZH6A 5DKWA 4KLDA 4LEYA 2BE3A 3RJGA 5IIOA 4ATBB 1TVAA 4JLXA 4RQ0A 4IG8A 4K4HA 5J2JA 1MIYA 9ICQA 4Z6CA 7ICNA 4AT8A 4FHVA
chains in the Genus database with same CATH topology
1HUOA 2P66A 4OAGA 5DEDA 4I2GA 1ZQWA 2ID1A 4KLFA 5J0XA 4M2YA 3RJJA 4UBBA 3WFPA 1OU5A 1ZQLA 7ICVA 4S3NA 5J2CA 2O1PA 9ICTA 3UXOA 5BOMA 3JPRA 5HR9A 7ICJA 4PGXA 4O67A 1MQ3A 4O69A 5DBCA 4UB5A 3AQLA 4RT2A 4E80A 1VFGA 4GXKA 4X4TA 4I2IA 1UEVA 5J0QA 1TFYA 4K97A 1BPDA 1ZQSA 4I2DA 4UAZA 3ISCA 5CP2A 3UPQA 4X0AA 4MKPA 2NRKA 3AU6A 4TURA 5J0RA 8ICTA 4M9HA 4LT6A 5J0OA 1HUZA 1ZQAA 4QZFA 4AT9A 1ZQTA 4K4GA 3OVSA 4QZHA 4O5KA 4KLTA 3H38A 1UETA 2PFNA 4EBJA 8ICCA 8ICYA 4M9NA 9ICGA 4RQ2A 7ICRA 4X4SA 1Q79A 5HREA 5F2VO 9ICBA 4WC7A 4TUQA 7ICOA 2GWSA 4RQ8A 4X0BA 4I2EA 2FMSA 3AQNA 1R8BA 4MF2A 2M2UA 5IINA 7ICHA 3MGIA 5D46A 1ZQZA 4UAYA 4DO9A 2ZH1A 5HC9A 3HW8A 8ICNA 4FHWA 5HRIA 7ICIA 4I2BA 4QZGA 4K4IA 9ICXA 4X4NA 1NOMA 4WBZA 1JN3A 4XUSA 7ICFA 4E8FA 2W9MA 4KLMA 1KDHA 3V7LA 8ICHA 1ZQQA 4Z6FA 5J2DA 5DB7A 5IIKA 7ICQA 4OAFA 4QZEA 4QZBA 4JLZA 1MIVA 5CB1A 4QZDA 8ICOA 2DVIA 4I2AA 5J0UA 1ZQXA 5J2KA 2ZH2A 3MDAA 1XSNA 3OUYB 4PHDA 4I27A 3MBYA 3V7KA 3OV7A 3WFRE 2ZH3A 3C5GA 4YCXA 9ICNA 4X4UA 1MIWA 3C2KA 3AUOA 1R8CA 8ICKA 3LK9A 4KB6A 3JPOA 2DR5A 3MDCA 5J2EA 4UB2A 4DOBA 3RJHA 4KLEA 4KLUA 4M04A 1V4AA 4F5NA 4PPXA 4M5DA 3LQCB 1JAJA 2ZH5A 2IHMA 9ICPA 4E7XA 1F5AA 4O9MA 2B4VA 4RWNA 4M47A 5BOLA 5J2BA 1ZJMA 4KLIA 4PHAA 3WFQE 4R63A 4FHPA 1ZQNA 2FMPA 3WFOA 4O68A 1ZQDA 1ZQFA 3ISDA 4X4VA 7ICPA 3OVBA 4WC0A 1ZQKA 2HHPA 3B0YA 4ATBA 4P4MA 1VJ7A 4NKUA 4X4QA 3UXNA 3RJFA 3HIYA 1BPEA 4NM2A 4MFAA 4RQ3A 4DOAA 1BPZA 2Q66A 4UD4A 7ICKA 9ICWA 7ICGA 2PBEA 1ZQUA 4IQTA 5J2AA 4FHYA 4GXJA 5HRBA 4X4RA 4K99A 5DBAA 3RJIA 5CWRA 3L9DA 4P2HA 1ZQYA 3JPPA 3JPQA 8ICVA 4IQUA 2ZH8A 5J2HA 4XRHA 3C66A 3PNCA 2BPGA 3RH5A 1ZQJA 4I2HA 5DB9A 4PGYA 9ICVA 4YD1A 1TV9A 8ICXA 3C18A 8ICZA 4R65A 1PX5A 2ZH9A 9ICMA 8ICEA 3HWTA 2BCSA 4QZ9A 4MF8A 2RFFA 1WOTA 5IIMA 4YN4A 4WC4A 4QZ8A 4LEVA 5D4BA 4MFFA 2PXIA 3B0XA 4KLHA 4WOYA 2ZHAA 5HRDA 2M2WA 4UB4A 4KM5A 4NXZA 4FH3A 3H39A 1YLQA 4Z6DA 1JQRA 9ICHA 1ZQRA 8ICGA 4EBKA 2DR7A 3H3AA 5CJ7A 4K9BA 8ICJA 4KLGA 4AT7B 3UQ0A 2PFQA 2DRBA 9ICIA 5BPCA 3TFRA 4F5QA 8ICQA 7ICLA 3AQMA 5HRKA 4M9JA 4RPXA 4K98A 1R89A 3TFSA 4NXUA 8ICWA 3JPTA 1KEJA 4I28A 4UB1A 3K75D 9ICSA 5HRHA 5J29A 1BPYA 1UEUA 2ISPA 7ICUA 7ICEA 5DB6A 4FO6A 7ICTA 4QZAA 4WC3A 8ICBA 5HRLA 5TZVA 4RQ4A 2ZH4A 1XSLA 3PMLA 2BCRA 1JMSA 4PH5A 4I29A 4OAHA 7ICSA 2BCVA 4RWQA 1ZQPA 4EP7A 4XQ8A 1ZQHA 9ICRA 4AT8B 4UD5A 4RWPA 3OUYA 5J0WA 4UAWA 4UB3A 8ICRA 4RQ5A 4PGQA 4NXVA 2ISOA 4NY8A 4MFCA 4KLOA 9ICAA 3JPNA 9ICCA 4YMNA 4R66A 9ICLA 3C2MA 5CR0A 5J2IA 4K96A 4P4PA 4XA5A 1ZQMA 3RJEA 4GXIA 2M2TA 3NYBA 1NO5A 5HRFA 4NXTA 3WFSC 5IIJA 4RWOA 4WC5A 1ZQIA 1ZQCA 4TUSA 4IQWA 5HRGA 4PHPA 4X4OA 4TUPA 5IIIA 4QZIA 4M9GA 8ICFA 4F5PA 4LZGA 9ICFA 2BPCA 3MGHA 3RJKA 1ZQBA 3UQ2A 4M9LA 4FH5A 2PFOA 4RQ7A 4O5CA 4RPZA 1MQ2A 4AT9B 1TFWA 4JWNA 4LVSA 5EOZA 2BCUA 3JZ0A 9ICOA 4RQ6A 4QZCA 3OGUA 3JYYA 5CHGA 4R64A 4F5OA 4K8VA 5J0SA 2DRAA 4O6AA 4DOCA 4NXWA 1XSPA 3UXPA 3V72A 9ICUA 4K9AA 4RPYA 5J0PA 1KNYA 2PFPA 5HHIA 5HHHA 3V7JA 4F5RA 1ZQEA 3AU2A 4NLKA 3JPSA 1R8AA 1RZTA 5J0YA 5DBBA 8ICMA 8ICPA 3HX0A 3AQKA 4IQVA 5IILA 1BPBA 4I2JA 2B51A 2DR9A 4LEZA 4LZDA 4Z6EA 4NXXA 4YMMA 3C2LA 4LEWA 1FA0A 2O5AA 4NM1A 3HJ1A 2DR8A 5DECA 3PMNA 4OAIZ 1ZJNA 4I2CA 4M0AA 4NLZA 1BPXA 2ZHBA 5DDYA 1ZQGA 3UPSA 8ICSA 4KLSA 4X4PA 4WC2A 5DDMA 4KLQA 2M2VA 4RQ1A 3OVAA 4YMOA 1ZQVA 4FHXA 3RH4A 3H37A 3HJ4A 5D49A 1RPLA 2VANA 1Q78A 7ICMA 4AT7A 4WBYA 4RT3A 3GDXA 8ICLA 3RH6A 5J2FA 8ICIA 3C5FA 9ICJA 5J2GA 4UBCA 4X5VA 4PHEA 4WCWA 2BCQA 2I9GA 4I2FA 4KLLA 5CA7A 4WC6A 4JWMA 4NKTA 4WC1A 3ISBA 4NLNA 4O5EA 2ZH7A 4YD2A 2B56A 2FMQA 9ICEA 1ZQOA 4P4OA 2BPFA 8ICUA 4XQ7A 9ICKA 5DB8A 8ICAA 4KLJA 5J0TA 2ZH6A 5DKWA 4KLDA 4LEYA 2BE3A 3RJGA 5IIOA 4ATBB 1TVAA 4JLXA 4RQ0A 4K4HA 4IG8A 5J2JA 1MIYA 9ICQA 4Z6CA 7ICNA 4AT8A 4FHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HUO A;  2P66 A;  4OAG A;  5DED A;  4I2G A;  1ZQW A;  2ID1 A;  4KLF A;  5J0X A;  4M2Y A;  3RJJ A;  4UBB A;  3WFP A;  1OU5 A;  1ZQL A;  7ICV A;  4S3N A;  5J2C A;  2O1P A;  9ICT A;  3UXO A;  5BOM A;  3JPR A;  5HR9 A;  7ICJ A;  4PGX A;  4O67 A;  1MQ3 A;  4O69 A;  5DBC A;  4UB5 A;  3AQL A;  4RT2 A;  4E80 A;  1VFG A;  4GXK A;  4I2I A;  4X4T A;  1UEV A;  5J0Q A;  1TFY A;  4K97 A;  1BPD A;  1ZQS A;  4I2D A;  4UAZ A;  3ISC A;  5CP2 A;  3UPQ A;  4X0A A;  4MKP A;  2NRK A;  3AU6 A;  4TUR A;  5J0R A;  8ICT A;  4M9H A;  4LT6 A;  5J0O A;  1HUZ A;  1ZQA A;  4QZF A;  4AT9 A;  1ZQT A;  4K4G A;  3OVS A;  4QZH A;  4O5K A;  4KLT A;  3H38 A;  1UET A;  2PFN A;  4EBJ A;  8ICC A;  8ICY A;  4M9N A;  9ICG A;  4RQ2 A;  7ICR A;  4X4S A;  1Q79 A;  5HRE A;  5F2V O;  9ICB A;  4WC7 A;  4TUQ A;  7ICO A;  2GWS A;  4RQ8 A;  4X0B A;  4I2E A;  2FMS A;  3AQN A;  1R8B A;  4MF2 A;  2M2U A;  5IIN A;  7ICH A;  3MGI A;  5D46 A;  1ZQZ A;  4UAY A;  4DO9 A;  2ZH1 A;  5HC9 A;  3HW8 A;  8ICN A;  4FHW A;  5HRI A;  7ICI A;  4I2B A;  4QZG A;  4K4I A;  9ICX A;  4X4N A;  1NOM A;  4WBZ A;  1JN3 A;  4XUS A;  7ICF A;  4E8F A;  2W9M A;  4KLM A;  1KDH A;  3V7L A;  8ICH A;  1ZQQ A;  4Z6F A;  5J2D A;  5DB7 A;  5IIK A;  7ICQ A;  4OAF A;  4QZE A;  4QZB A;  4JLZ A;  1MIV A;  5CB1 A;  4QZD A;  8ICO A;  2DVI A;  4I2A A;  5J0U A;  1ZQX A;  5J2K A;  3MDA A;  2ZH2 A;  1XSN A;  3OUY B;  4PHD A;  4I27 A;  3MBY A;  3V7K A;  3OV7 A;  3WFR E;  2ZH3 A;  3C5G A;  4YCX A;  9ICN A;  4X4U A;  1MIW A;  3C2K A;  3AUO A;  1R8C A;  8ICK A;  3LK9 A;  4KB6 A;  3JPO A;  2DR5 A;  3MDC A;  5J2E A;  4UB2 A;  4DOB A;  3RJH A;  4KLE A;  4KLU A;  4M04 A;  1V4A A;  4F5N A;  4PPX A;  4M5D A;  3LQC B;  1JAJ A;  2ZH5 A;  2IHM A;  9ICP A;  4E7X A;  1F5A A;  4O9M A;  4RWN A;  4M47 A;  5BOL A;  5J2B A;  1ZJM A;  4KLI A;  4PHA A;  3WFQ E;  4R63 A;  4FHP A;  1ZQN A;  2FMP A;  3WFO A;  4O68 A;  1ZQD A;  1ZQF A;  3ISD A;  4X4V A;  7ICP A;  4WC0 A;  3OVB A;  1ZQK A;  2HHP A;  3B0Y A;  4ATB A;  4P4M A;  1VJ7 A;  4NKU A;  4X4Q A;  3UXN A;  3RJF A;  3HIY A;  1BPE A;  4NM2 A;  4MFA A;  4RQ3 A;  4DOA A;  1BPZ A;  2Q66 A;  4UD4 A;  7ICK A;  9ICW A;  7ICG A;  2PBE A;  1ZQU A;  4IQT A;  5J2A A;  4FHY A;  4GXJ A;  5HRB A;  4K99 A;  4X4R A;  5DBA A;  3RJI A;  5CWR A;  3L9D A;  4P2H A;  1ZQY A;  3JPP A;  3JPQ A;  8ICV A;  4IQU A;  2ZH8 A;  5J2H A;  4XRH A;  3C66 A;  3PNC A;  2BPG A;  3RH5 A;  1ZQJ A;  4I2H A;  5DB9 A;  4PGY A;  9ICV A;  4YD1 A;  1TV9 A;  8ICX A;  3C18 A;  8ICZ A;  4R65 A;  1PX5 A;  2ZH9 A;  9ICM A;  8ICE A;  3HWT A;  2BCS A;  4QZ9 A;  4MF8 A;  2RFF A;  1WOT A;  5IIM A;  4YN4 A;  4WC4 A;  4QZ8 A;  4LEV A;  5D4B A;  4MFF A;  2PXI A;  3B0X A;  4KLH A;  4WOY A;  2ZHA A;  5HRD A;  2M2W A;  4UB4 A;  4KM5 A;  4NXZ A;  4FH3 A;  3H39 A;  1YLQ A;  4Z6D A;  1JQR A;  9ICH A;  1ZQR A;  8ICG A;  4EBK A;  5CJ7 A;  3H3A A;  2DR7 A;  4K9B A;  8ICJ A;  4KLG A;  4AT7 B;  3UQ0 A;  2PFQ A;  2DRB A;  9ICI A;  5BPC A;  3TFR A;  4F5Q A;  8ICQ A;  7ICL A;  3AQM A;  5HRK A;  4M9J A;  4RPX A;  4K98 A;  1R89 A;  3TFS A;  4NXU A;  8ICW A;  3JPT A;  1KEJ A;  4I28 A;  4UB1 A;  3K75 D;  9ICS A;  5HRH A;  5J29 A;  1BPY A;  1UEU A;  2ISP A;  7ICU A;  7ICE A;  5DB6 A;  4FO6 A;  7ICT A;  4QZA A;  4WC3 A;  8ICB A;  5HRL A;  5TZV A;  4RQ4 A;  2ZH4 A;  1XSL A;  3PML A;  2BCR A;  1JMS A;  4PH5 A;  4I29 A;  4OAH A;  7ICS A;  2BCV A;  4RWQ A;  1ZQP A;  4XQ8 A;  4EP7 A;  1ZQH A;  9ICR A;  4AT8 B;  4UD5 A;  4RWP A;  3OUY A;  5J0W A;  4UAW A;  4UB3 A;  8ICR A;  4RQ5 A;  4PGQ A;  4NXV A;  2ISO A;  4NY8 A;  4MFC A;  4KLO A;  9ICA A;  3JPN A;  9ICC A;  4YMN A;  4R66 A;  9ICL A;  3C2M A;  5CR0 A;  5J2I A;  4K96 A;  4P4P A;  4XA5 A;  1ZQM A;  3RJE A;  4GXI A;  2M2T A;  1NO5 A;  3NYB A;  5HRF A;  4NXT A;  3WFS C;  5IIJ A;  4RWO A;  4WC5 A;  1ZQI A;  1ZQC A;  4TUS A;  4IQW A;  5HRG A;  4PHP A;  4X4O A;  4TUP A;  5III A;  4QZI A;  4M9G A;  8ICF A;  4F5P A;  4LZG A;  9ICF A;  2BPC A;  3MGH A;  3RJK A;  1ZQB A;  3UQ2 A;  4M9L A;  4FH5 A;  2PFO A;  4RQ7 A;  4O5C A;  4RPZ A;  1MQ2 A;  4AT9 B;  1TFW A;  4JWN A;  4LVS A;  5EOZ A;  2BCU A;  3JZ0 A;  9ICO A;  4RQ6 A;  4QZC A;  3OGU A;  3JYY A;  5CHG A;  4R64 A;  4F5O A;  4K8V A;  5J0S A;  2DRA A;  4O6A A;  4DOC A;  4NXW A;  1XSP A;  3UXP A;  3V72 A;  9ICU A;  4K9A A;  4RPY A;  5J0P A;  1KNY A;  2PFP A;  5HHI A;  5HHH A;  3V7J A;  4F5R A;  1ZQE A;  3AU2 A;  4NLK A;  3JPS A;  1R8A A;  1RZT A;  5J0Y A;  5DBB A;  8ICM A;  8ICP A;  3HX0 A;  3AQK A;  4IQV A;  5IIL A;  1BPB A;  4I2J A;  4LEZ A;  2DR9 A;  4LZD A;  4Z6E A;  4NXX A;  4YMM A;  3C2L A;  4LEW A;  1FA0 A;  2O5A A;  4NM1 A;  3HJ1 A;  2DR8 A;  5DEC A;  3PMN A;  4OAI Z;  1ZJN A;  4I2C A;  4M0A A;  4NLZ A;  1BPX A;  2ZHB A;  5DDY A;  1ZQG A;  3UPS A;  8ICS A;  4KLS A;  4X4P A;  4WC2 A;  5DDM A;  4KLQ A;  2M2V A;  4RQ1 A;  3OVA A;  4YMO A;  1ZQV A;  4FHX A;  3RH4 A;  3H37 A;  3HJ4 A;  5D49 A;  1RPL A;  2VAN A;  1Q78 A;  7ICM A;  4AT7 A;  4WBY A;  4RT3 A;  3GDX A;  8ICL A;  3RH6 A;  5J2F A;  8ICI A;  3C5F A;  9ICJ A;  5J2G A;  4UBC A;  4X5V A;  4PHE A;  4WCW A;  2BCQ A;  2I9G A;  4I2F A;  4KLL A;  5CA7 A;  4WC6 A;  4JWM A;  4NKT A;  4WC1 A;  3ISB A;  4NLN A;  4O5E A;  2ZH7 A;  4YD2 A;  2FMQ A;  9ICE A;  1ZQO A;  4P4O A;  2BPF A;  8ICU A;  4XQ7 A;  9ICK A;  5DB8 A;  8ICA A;  4KLJ A;  5J0T A;  2ZH6 A;  5DKW A;  4KLD A;  4LEY A;  2BE3 A;  3RJG A;  5IIO A;  4ATB B;  1TVA A;  4JLX A;  4RQ0 A;  4K4H A;  4IG8 A;  5J2J A;  1MIY A;  9ICQ A;  4Z6C A;  7ICN A;  4AT8 A;  4FHV A; 
#chains in the Genus database with same CATH topology
 1HUO A;  2P66 A;  4OAG A;  5DED A;  4I2G A;  1ZQW A;  2ID1 A;  4KLF A;  5J0X A;  4M2Y A;  3RJJ A;  4UBB A;  3WFP A;  1OU5 A;  1ZQL A;  7ICV A;  4S3N A;  5J2C A;  2O1P A;  9ICT A;  3UXO A;  5BOM A;  3JPR A;  5HR9 A;  7ICJ A;  4PGX A;  4O67 A;  1MQ3 A;  4O69 A;  5DBC A;  4UB5 A;  3AQL A;  4RT2 A;  4E80 A;  1VFG A;  4GXK A;  4I2I A;  4X4T A;  1UEV A;  5J0Q A;  1TFY A;  5D63 A;  4K97 A;  1BPD A;  1ZQS A;  4I2D A;  4UAZ A;  3ISC A;  5CP2 A;  3UPQ A;  4X0A A;  4MKP A;  2EWR A;  2NRK A;  3AU6 A;  4TUR A;  5J0R A;  8ICT A;  4M9H A;  4LT6 A;  5J0O A;  1HUZ A;  1ZQA A;  4QZF A;  4AT9 A;  1ZQT A;  4K4G A;  3OVS A;  4QZH A;  5CHE A;  3PHZ A;  4O5K A;  4KLT A;  3H38 A;  1UET A;  2PFN A;  4EBJ A;  8ICC A;  8ICY A;  4M9N A;  9ICG A;  4RQ2 A;  7ICR A;  4X4S A;  1Q79 A;  5HRE A;  5D61 A;  5F2V O;  9ICB A;  4WC7 A;  4TUQ A;  7ICO A;  2GWS A;  4RQ8 A;  4X0B A;  4I2E A;  2FMS A;  3AQN A;  1R8B A;  4MF2 A;  2M2U A;  5IIN A;  7ICH A;  3MGI A;  1GPJ A;  5D46 A;  3ER9 B;  1ZQZ A;  4UAY A;  4DO9 A;  2ZH1 A;  5HC9 A;  3HW8 A;  8ICN A;  4FHW A;  5HRI A;  7ICI A;  4I2B A;  4QZG A;  4K4I A;  9ICX A;  4X4N A;  1NOM A;  4WBZ A;  3ERC C;  1JN3 A;  4XUS A;  7ICF A;  4E8F A;  2W9M A;  4KLM A;  1KDH A;  3V7L A;  8ICH A;  1ZQQ A;  4Z6F A;  5J2D A;  5DB7 A;  5IIK A;  7ICQ A;  4OAF A;  4QZE A;  4QZB A;  4JLZ A;  1MIV A;  5CB1 A;  4QZD A;  8ICO A;  2DVI A;  4I2A A;  5J0U A;  1ZQX A;  5J2K A;  2ZH2 A;  3MDA A;  1XSN A;  3CK6 A;  3OUY B;  4PHD A;  5D62 A;  3MBY A;  4I27 A;  3V7K A;  3OV7 A;  4HX0 A;  3WFR E;  2ZH3 A;  5B3Q A;  3C5G A;  4YCX A;  9ICN A;  4X4U A;  1MIW A;  3C2K A;  3AUO A;  2BBJ A;  1R8C A;  5B3P A;  8ICK A;  3LK9 A;  4KB6 A;  3JCF A;  3JPO A;  2DR5 A;  4EV6 A;  3MDC A;  5J2E A;  4UB2 A;  4DOB A;  3RJH A;  4KLE A;  4KLU A;  4M04 A;  1V4A A;  4F5N A;  4PPX A;  4M5D A;  3LQC B;  1JAJ A;  2ZH5 A;  2BBH A;  2IHM A;  9ICP A;  4E7X A;  1F5A A;  4O9M A;  2B4V A;  4RWN A;  4M47 A;  5BOL A;  5J2B A;  1ZJM A;  5CFU A;  4KLI A;  4PHA A;  3WFQ E;  4R63 A;  4FHP A;  1ZQN A;  2FMP A;  3WFO A;  4O68 A;  1ZQD A;  1ZQF A;  3ISD A;  4X4V A;  7ICP A;  3OVB A;  4WC0 A;  1ZQK A;  2HHP A;  3B0Y A;  4ATB A;  4P4M A;  1VJ7 A;  4NKU A;  4X4Q A;  3UXN A;  3RJF A;  5CFS A;  3HIY A;  1BPE A;  4NM2 A;  4MFA A;  4RQ3 A;  3OWG A;  4DOA A;  1BPZ A;  2Q66 A;  4UD4 A;  7ICK A;  9ICW A;  7ICG A;  2PBE A;  1ZQU A;  4IQT A;  5J2A A;  4FHY A;  4GXJ A;  5HRB A;  4X4R A;  4K99 A;  4N7R A;  5DBA A;  3RJI A;  5CWR A;  3L9D A;  4P2H A;  1ZQY A;  3JPP A;  3JPQ A;  8ICV A;  4IQU A;  2ZH8 A;  5J2H A;  4XRH A;  3C66 A;  3PNC A;  2BPG A;  3RH5 A;  1ZQJ A;  4I2H A;  5DB9 A;  4PGY A;  9ICV A;  4YD1 A;  1TV9 A;  8ICX A;  3C18 A;  8ICZ A;  4R65 A;  1PX5 A;  2ZH9 A;  9ICM A;  3NVO A;  8ICE A;  3HWT A;  2BCS A;  4QZ9 A;  4MF8 A;  2RFF A;  1WOT A;  5IIM A;  4YN4 A;  4WC4 A;  4QZ8 A;  4LEV A;  5D4B A;  4MFF A;  2PXI A;  3B0X A;  4KLH A;  4WOY A;  2ZHA A;  5HRD A;  2IHO A;  2M2W A;  4UB4 A;  4KM5 A;  4NXZ A;  4FH3 A;  3H39 A;  1YLQ A;  4Z6D A;  1JQR A;  9ICH A;  1ZQR A;  8ICG A;  4EBK A;  2DR7 A;  3H3A A;  5CJ7 A;  4K9B A;  8ICJ A;  4KLG A;  4AT7 B;  3UQ0 A;  2PFQ A;  2DRB A;  9ICI A;  5BPC A;  3TFR A;  4F5Q A;  8ICQ A;  7ICL A;  3AQM A;  5HRK A;  4M9J A;  3K7D A;  4RPX A;  4K98 A;  1R89 A;  3TFS A;  4NXU A;  8ICW A;  3JPT A;  1KEJ A;  4I28 A;  4UB1 A;  3K75 D;  9ICS A;  5HRH A;  5J29 A;  1BPY A;  1UEU A;  2ISP A;  4I0U A;  7ICU A;  7ICE A;  5DB6 A;  4FO6 A;  7ICT A;  4QZA A;  4WC3 A;  8ICB A;  5HRL A;  5TZV A;  4RQ4 A;  2ZH4 A;  1XSL A;  5CFT A;  3PML A;  2BCR A;  1JMS A;  4PH5 A;  4I29 A;  4OAH A;  7ICS A;  2BCV A;  4RWQ A;  1ZQP A;  4EP7 A;  4XQ8 A;  1ZQH A;  9ICR A;  4AT8 B;  4UD5 A;  4RWP A;  3OUY A;  5J0W A;  4UAW A;  3ER8 C;  4UB3 A;  8ICR A;  4RQ5 A;  4PGQ A;  4NXV A;  2ISO A;  4NY8 A;  4MFC A;  4KLO A;  9ICA A;  3JPN A;  9ICC A;  4YMN A;  4R66 A;  9ICL A;  3C2M A;  5CR0 A;  5J2I A;  4K96 A;  4P4P A;  4XA5 A;  1ZQM A;  3RJE A;  4GXI A;  2M2T A;  3NYB A;  1NO5 A;  5HRF A;  4NXT A;  3WFS C;  5IIJ A;  4RWO A;  4WC5 A;  1ZQI A;  1ZQC A;  4TUS A;  4IQW A;  5HRG A;  4PHP A;  4X4O A;  4TUP A;  5III A;  4QZI A;  4M9G A;  8ICF A;  4F5P A;  4LZG A;  9ICF A;  2BPC A;  3MGH A;  3RJK A;  1ZQB A;  2IUB A;  3UQ2 A;  4M9L A;  4FH5 A;  2PFO A;  4RQ7 A;  4O5C A;  4RPZ A;  1MQ2 A;  4AT9 B;  1TFW A;  2FCL A;  4JWN A;  4LVS A;  5EOZ A;  4WH5 A;  3JZ0 A;  2BCU A;  9ICO A;  4RQ6 A;  4QZC A;  3OGU A;  3JYY A;  5CHG A;  3NKU A;  4R64 A;  4F5O A;  4K8V A;  5J0S A;  2DRA A;  4EED A;  4O6A A;  4DOC A;  4NXW A;  1XSP A;  3UXP A;  5JTG A;  4FO1 A;  3V72 A;  9ICU A;  4K9A A;  4RPY A;  5J0P A;  1KNY A;  2PFP A;  5HHI A;  5HHH A;  3V7J A;  4F5R A;  1ZQE A;  3AU2 A;  4NLK A;  3JPS A;  1R8A A;  1RZT A;  5J0Y A;  5DBB A;  8ICM A;  8ICP A;  3HX0 A;  3AQK A;  4IQV A;  4XJE A;  5IIL A;  1BPB A;  4I2J A;  2B51 A;  2DR9 A;  4LEZ A;  4LZD A;  4Z6E A;  4NXX A;  3MCR A;  4YMM A;  3C2L A;  4LEW A;  2GA9 D;  4WQK A;  1FA0 A;  2HN1 A;  2O5A A;  4NM1 A;  3HJ1 A;  2DR8 A;  5DEC A;  4EEB A;  3PMN A;  4OAI Z;  1ZJN A;  4I2C A;  4M0A A;  4NLZ A;  1BPX A;  2ZHB A;  3EF2 A;  5DDY A;  1ZQG A;  3UPS A;  8ICS A;  4KLS A;  4X4P A;  2HN2 A;  4WC2 A;  5DDM A;  4KLQ A;  2M2V A;  4RQ1 A;  3OVA A;  4YMO A;  1ZQV A;  4FHX A;  3NWI A;  3RH4 A;  3H37 A;  2GAF D;  3HJ4 A;  5D49 A;  1RPL A;  2VAN A;  4EGW A;  1Q78 A;  7ICM A;  4AT7 A;  4WBY A;  4RT3 A;  3GDX A;  8ICL A;  3RH6 A;  5J2F A;  8ICI A;  3C5F A;  9ICJ A;  5J2G A;  4UBC A;  4X5V A;  4PHE A;  4WCW A;  2BCQ A;  2I9G A;  4I2F A;  4WQL A;  4KLL A;  5CA7 A;  4WC6 A;  4JWM A;  4NKT A;  4WC1 A;  3ISB A;  4NLN A;  4O5E A;  2ZH7 A;  4YD2 A;  2B56 A;  2FMQ A;  9ICE A;  1ZQO A;  4P4O A;  2BPF A;  8ICU A;  4XQ7 A;  9ICK A;  5DB8 A;  8ICA A;  4KLJ A;  5J0T A;  2ZH6 A;  5DKW A;  4KLD A;  4LEY A;  2BE3 A;  3RJG A;  5IIO A;  4ATB B;  1TVA A;  4JLX A;  4RQ0 A;  4IG8 A;  4K4H A;  5J2J A;  1MIY A;  9ICQ A;  4Z6C A;  7ICN A;  4AT8 A;  4FHV A; 
#chains in the Genus database with same CATH homology
 1HUO A;  2P66 A;  4OAG A;  5DED A;  4I2G A;  1ZQW A;  2ID1 A;  4KLF A;  5J0X A;  4M2Y A;  3RJJ A;  4UBB A;  3WFP A;  1OU5 A;  1ZQL A;  7ICV A;  4S3N A;  5J2C A;  2O1P A;  9ICT A;  3UXO A;  5BOM A;  3JPR A;  5HR9 A;  7ICJ A;  4PGX A;  4O67 A;  1MQ3 A;  4O69 A;  5DBC A;  4UB5 A;  3AQL A;  4RT2 A;  4E80 A;  1VFG A;  4GXK A;  4X4T A;  4I2I A;  1UEV A;  5J0Q A;  1TFY A;  4K97 A;  1BPD A;  1ZQS A;  4I2D A;  4UAZ A;  3ISC A;  5CP2 A;  3UPQ A;  4X0A A;  4MKP A;  2NRK A;  3AU6 A;  4TUR A;  5J0R A;  8ICT A;  4M9H A;  4LT6 A;  5J0O A;  1HUZ A;  1ZQA A;  4QZF A;  4AT9 A;  1ZQT A;  4K4G A;  3OVS A;  4QZH A;  4O5K A;  4KLT A;  3H38 A;  1UET A;  2PFN A;  4EBJ A;  8ICC A;  8ICY A;  4M9N A;  9ICG A;  4RQ2 A;  7ICR A;  4X4S A;  1Q79 A;  5HRE A;  5F2V O;  9ICB A;  4WC7 A;  4TUQ A;  7ICO A;  2GWS A;  4RQ8 A;  4X0B A;  4I2E A;  2FMS A;  3AQN A;  1R8B A;  4MF2 A;  2M2U A;  5IIN A;  7ICH A;  3MGI A;  5D46 A;  1ZQZ A;  4UAY A;  4DO9 A;  2ZH1 A;  5HC9 A;  3HW8 A;  8ICN A;  4FHW A;  5HRI A;  7ICI A;  4I2B A;  4QZG A;  4K4I A;  9ICX A;  4X4N A;  1NOM A;  4WBZ A;  1JN3 A;  4XUS A;  7ICF A;  4E8F A;  2W9M A;  4KLM A;  1KDH A;  3V7L A;  8ICH A;  1ZQQ A;  4Z6F A;  5J2D A;  5DB7 A;  5IIK A;  7ICQ A;  4OAF A;  4QZE A;  4QZB A;  4JLZ A;  1MIV A;  5CB1 A;  4QZD A;  8ICO A;  2DVI A;  4I2A A;  5J0U A;  1ZQX A;  5J2K A;  2ZH2 A;  3MDA A;  1XSN A;  3OUY B;  4PHD A;  4I27 A;  3MBY A;  3V7K A;  3OV7 A;  3WFR E;  2ZH3 A;  3C5G A;  4YCX A;  9ICN A;  4X4U A;  1MIW A;  3C2K A;  3AUO A;  1R8C A;  8ICK A;  3LK9 A;  4KB6 A;  3JPO A;  2DR5 A;  3MDC A;  5J2E A;  4UB2 A;  4DOB A;  3RJH A;  4KLE A;  4KLU A;  4M04 A;  1V4A A;  4F5N A;  4PPX A;  4M5D A;  3LQC B;  1JAJ A;  2ZH5 A;  2IHM A;  9ICP A;  4E7X A;  1F5A A;  4O9M A;  2B4V A;  4RWN A;  4M47 A;  5BOL A;  5J2B A;  1ZJM A;  4KLI A;  4PHA A;  3WFQ E;  4R63 A;  4FHP A;  1ZQN A;  2FMP A;  3WFO A;  4O68 A;  1ZQD A;  1ZQF A;  3ISD A;  4X4V A;  7ICP A;  3OVB A;  4WC0 A;  1ZQK A;  2HHP A;  3B0Y A;  4ATB A;  4P4M A;  1VJ7 A;  4NKU A;  4X4Q A;  3UXN A;  3RJF A;  3HIY A;  1BPE A;  4NM2 A;  4MFA A;  4RQ3 A;  4DOA A;  1BPZ A;  2Q66 A;  4UD4 A;  7ICK A;  9ICW A;  7ICG A;  2PBE A;  1ZQU A;  4IQT A;  5J2A A;  4FHY A;  4GXJ A;  5HRB A;  4X4R A;  4K99 A;  5DBA A;  3RJI A;  5CWR A;  3L9D A;  4P2H A;  1ZQY A;  3JPP A;  3JPQ A;  8ICV A;  4IQU A;  2ZH8 A;  5J2H A;  4XRH A;  3C66 A;  3PNC A;  2BPG A;  3RH5 A;  1ZQJ A;  4I2H A;  5DB9 A;  4PGY A;  9ICV A;  4YD1 A;  1TV9 A;  8ICX A;  3C18 A;  8ICZ A;  4R65 A;  1PX5 A;  2ZH9 A;  9ICM A;  8ICE A;  3HWT A;  2BCS A;  4QZ9 A;  4MF8 A;  2RFF A;  1WOT A;  5IIM A;  4YN4 A;  4WC4 A;  4QZ8 A;  4LEV A;  5D4B A;  4MFF A;  2PXI A;  3B0X A;  4KLH A;  4WOY A;  2ZHA A;  5HRD A;  2M2W A;  4UB4 A;  4KM5 A;  4NXZ A;  4FH3 A;  3H39 A;  1YLQ A;  4Z6D A;  1JQR A;  9ICH A;  1ZQR A;  8ICG A;  4EBK A;  2DR7 A;  3H3A A;  5CJ7 A;  4K9B A;  8ICJ A;  4KLG A;  4AT7 B;  3UQ0 A;  2PFQ A;  2DRB A;  9ICI A;  5BPC A;  3TFR A;  4F5Q A;  8ICQ A;  7ICL A;  3AQM A;  5HRK A;  4M9J A;  4RPX A;  4K98 A;  1R89 A;  3TFS A;  4NXU A;  8ICW A;  3JPT A;  1KEJ A;  4I28 A;  4UB1 A;  3K75 D;  9ICS A;  5HRH A;  5J29 A;  1BPY A;  1UEU A;  2ISP A;  7ICU A;  7ICE A;  5DB6 A;  4FO6 A;  7ICT A;  4QZA A;  4WC3 A;  8ICB A;  5HRL A;  5TZV A;  4RQ4 A;  2ZH4 A;  1XSL A;  3PML A;  2BCR A;  1JMS A;  4PH5 A;  4I29 A;  4OAH A;  7ICS A;  2BCV A;  4RWQ A;  1ZQP A;  4EP7 A;  4XQ8 A;  1ZQH A;  9ICR A;  4AT8 B;  4UD5 A;  4RWP A;  3OUY A;  5J0W A;  4UAW A;  4UB3 A;  8ICR A;  4RQ5 A;  4PGQ A;  4NXV A;  2ISO A;  4NY8 A;  4MFC A;  4KLO A;  9ICA A;  3JPN A;  9ICC A;  4YMN A;  4R66 A;  9ICL A;  3C2M A;  5CR0 A;  5J2I A;  4K96 A;  4P4P A;  4XA5 A;  1ZQM A;  3RJE A;  4GXI A;  2M2T A;  3NYB A;  1NO5 A;  5HRF A;  4NXT A;  3WFS C;  5IIJ A;  4RWO A;  4WC5 A;  1ZQI A;  1ZQC A;  4TUS A;  4IQW A;  5HRG A;  4PHP A;  4X4O A;  4TUP A;  5III A;  4QZI A;  4M9G A;  8ICF A;  4F5P A;  4LZG A;  9ICF A;  2BPC A;  3MGH A;  3RJK A;  1ZQB A;  3UQ2 A;  4M9L A;  4FH5 A;  2PFO A;  4RQ7 A;  4O5C A;  4RPZ A;  1MQ2 A;  4AT9 B;  1TFW A;  4JWN A;  4LVS A;  5EOZ A;  2BCU A;  3JZ0 A;  9ICO A;  4RQ6 A;  4QZC A;  3OGU A;  3JYY A;  5CHG A;  4R64 A;  4F5O A;  4K8V A;  5J0S A;  2DRA A;  4O6A A;  4DOC A;  4NXW A;  1XSP A;  3UXP A;  3V72 A;  9ICU A;  4K9A A;  4RPY A;  5J0P A;  1KNY A;  2PFP A;  5HHI A;  5HHH A;  3V7J A;  4F5R A;  1ZQE A;  3AU2 A;  4NLK A;  3JPS A;  1R8A A;  1RZT A;  5J0Y A;  5DBB A;  8ICM A;  8ICP A;  3HX0 A;  3AQK A;  4IQV A;  5IIL A;  1BPB A;  4I2J A;  2B51 A;  2DR9 A;  4LEZ A;  4LZD A;  4Z6E A;  4NXX A;  4YMM A;  3C2L A;  4LEW A;  1FA0 A;  2O5A A;  4NM1 A;  3HJ1 A;  2DR8 A;  5DEC A;  3PMN A;  4OAI Z;  1ZJN A;  4I2C A;  4M0A A;  4NLZ A;  1BPX A;  2ZHB A;  5DDY A;  1ZQG A;  3UPS A;  8ICS A;  4KLS A;  4X4P A;  4WC2 A;  5DDM A;  4KLQ A;  2M2V A;  4RQ1 A;  3OVA A;  4YMO A;  1ZQV A;  4FHX A;  3RH4 A;  3H37 A;  3HJ4 A;  5D49 A;  1RPL A;  2VAN A;  1Q78 A;  7ICM A;  4AT7 A;  4WBY A;  4RT3 A;  3GDX A;  8ICL A;  3RH6 A;  5J2F A;  8ICI A;  3C5F A;  9ICJ A;  5J2G A;  4UBC A;  4X5V A;  4PHE A;  4WCW A;  2BCQ A;  2I9G A;  4I2F A;  4KLL A;  5CA7 A;  4WC6 A;  4JWM A;  4NKT A;  4WC1 A;  3ISB A;  4NLN A;  4O5E A;  2ZH7 A;  4YD2 A;  2B56 A;  2FMQ A;  9ICE A;  1ZQO A;  4P4O A;  2BPF A;  8ICU A;  4XQ7 A;  9ICK A;  5DB8 A;  8ICA A;  4KLJ A;  5J0T A;  2ZH6 A;  5DKW A;  4KLD A;  4LEY A;  2BE3 A;  3RJG A;  5IIO A;  4ATB B;  1TVA A;  4JLX A;  4RQ0 A;  4K4H A;  4IG8 A;  5J2J A;  1MIY A;  9ICQ A;  4Z6C A;  7ICN A;  4AT8 A;  4FHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...