4AT8A

Crystal structure of the nf90-nf45 dimerisation domain complex with atp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
333
structure length
333
Chain Sequence
SHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN ENHANCER-BINDING FACTOR 2
publication title NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 107
structure length 333
sequence length 333
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07528 DZF DZF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4at8A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4at8A02
7ICKA 7ICLA 4IQVA 4NLZA 4I2BA 4AT7A 4X4SA 5CR0A 3C5GA 4X4PA 1BPZA 4LEVA 4YD1A 4DO9A 4GXKA 4IG8A 4RT3A 1YLQA 2I9GA 1MQ3A 5DB6A 4RQ4A 4M2YA 3HW8A 2IHMA 5D46A 4I2GA 3PMLA 4X4UA 5D49A 3LQCB 4P2HA 1ZQFA 2M2TA 7ICRA 4QZ8A 9ICCA 2Q66A 3WFRE 4DOCA 1ZQNA 1R8BA 4XRHA 1PX5A 1ZQIA 4NKUA 4O67A 1UETA 4P4OA 2HHPA 4UAZA 3OVSA 2W9MA 2BCSA 2VANA 4F5QA 2ZH3A 8ICCA 1ZQDA 9ICVA 4PGQA 2ZH9A 1ZQAA 2ZH5A 3H37A 1ZQMA 3HX0A 4M9LA 4O69A 1TFWA 5J0SA 2ISOA 9ICPA 3C66A 4I2CA 3UXOA 1ZQWA 4X4NA 4KLTA 3V7LA 4O5CA 4LEZA 4O9MA 4O68A 9ICOA 3TFSA 4KLLA 1ZQKA 1OU5A 5IIJA 3WFSC 4RWNA 4KLSA 4RPZA 4NXWA 4JLXA 4ATBB 4MFCA 5BPCA 3AQNA 5HREA 4EBJA 4R66A 5J2HA 1ZQJA 4UB4A 4TURA 8ICKA 1ZQGA 5DKWA 7ICPA 5J2KA 4YMNA 4PGYA 4F5RA 4TUPA 4K4GA 3AQKA 4XA5A 4ATBA 9ICFA 4WC2A 3K75D 1ZQSA 2DRAA 4NXZA 4JWMA 3GDXA 4KLQA 3AU2A 3MGIA 4WC1A 2PXIA 2DR7A 5J2CA 5J0XA 3RJIA 4WC0A 4OAGA 5J2EA 3MDAA 1ZQBA 4K8VA 3ISDA 4MF2A 3C2MA 4RWOA 4EBKA 3RJGA 3OVBA 5HRDA 4E7XA 3C18A 9ICJA 2FMQA 4KLIA 1ZQOA 4X4OA 4Z6CA 3JPSA 3RJFA 3MDCA 3JPPA 2ZH7A 1MIWA 3HJ1A 3NYBA 1ZQCA 4K9AA 1TFYA 1XSLA 2PFQA 4KM5A 1HUZA 2P66A 3PMNA 5J2GA 4M04A 4WBYA 9ICLA 4QZ9A 4M9JA 4RQ7A 4PPXA 4M5DA 4KB6A 3UXPA 4QZFA 8ICJA 4R65A 5HRFA 4E8FA 3ISBA 3AU6A 4NXTA 3V7KA 4XQ8A 5J2JA 5J2BA 2O5AA 4R63A 4FHXA 8ICFA 9ICHA 5BOLA 2BE3A 4UD5A 4I2HA 2PFOA 7ICFA 4K98A 3B0YA 4UAYA 9ICKA 4NLNA 4JWNA 5J0YA 4X4TA 1BPDA 3UPSA 3WFQE 4KLOA 1TVAA 1ZQYA 4MF8A 5IILA 5HRBA 4RPXA 4WC3A 7ICNA 1MIVA 1KDHA 4AT9B 3JZ0A 5J0TA 2ZH4A 1JN3A 4M9NA 8ICQA 5CWRA 3OVAA 4RQ2A 3WFPA 4WC6A 3RH4A 5DDMA 7ICJA 3V72A 8ICNA 5J2DA 4KLMA 8ICIA 4AT9A 5HRHA 2BCRA 1NO5A 4I2EA 8ICYA 4LT6A 2PBEA 4RQ8A 1F5AA 1ZQTA 4UB5A 9ICRA 4P4MA 9ICGA 8ICHA 3H38A 5J0UA 4NM2A 5HRGA 4WBZA 4RWPA 2ZHAA 1VJ7A 5DB7A 5DB8A 4FHWA 9ICAA 4MFAA 9ICSA 1JQRA 1VFGA 4KLJA 7ICGA 5IINA 4NXVA 5J2FA 3RJEA 7ICTA 5DB9A 3V7JA 3L9DA 4JLZA 4QZIA 1ZQQA 5F2VO 4WC5A 5J2IA 4F5PA 7ICQA 4K97A 4OAHA 1R89A 4NKTA 4PH5A 1ZQHA 4AT8B 4LZGA 5J0RA 7ICUA 4KLFA 4NY8A 4P4PA 3H3AA 1JMSA 4X5VA 7ICIA 2ZHBA 1ZQUA 4PHDA 4RPYA 3JPOA 4QZGA 3MGHA 4LVSA 4GXIA 4FO6A 7ICMA 5EOZA 4NXXA 4AT8A 4EP7A 4LEYA 2ISPA 4PHAA 4X4RA 4X4QA 4FH5A 7ICHA 1ZQZA 3OGUA 5CJ7A 2PFPA 4MKPA 4KLEA 4NXUA 8ICXA 4MFFA 4X0BA 9ICQA 4YD2A 8ICAA 4K96A 4KLDA 5BOMA 1MQ2A 3HJ4A 4R64A 9ICWA 4E80A 5J2AA 4X0AA 2BCUA 2BPFA 5J0PA 8ICZA 7ICSA 4F5NA 4WOYA 5HHHA 4Z6EA 3HIYA 3C2LA 5IIIA 4WCWA 1ZQVA 4DOBA 2FMSA 8ICRA 4M9GA 7ICEA 8ICPA 4RQ1A 4RQ0A 3UQ0A 1ZQRA 2BCQA 2DR8A 1BPBA 2M2UA 2BCVA 3RJKA 4YN4A 2PFNA 4FHPA 4IQTA 2M2WA 4RQ6A 4UBCA 3ISCA 3AUOA 7ICVA 5CHGA 5J29A 1ZJNA 1MIYA 4LZDA 4YMMA 1Q78A 1ZQLA 4O5KA 3TFRA 1TV9A 2ZH8A 4QZDA 2BPGA 4I2JA 8ICEA 5TZVA 3AQLA 2GWSA 4IQUA 2O1PA 3LK9A 4XQ7A 4XUSA 2ZH2A 2ID1A 4NM1A 4QZCA 1ZQPA 4PHEA 1FA0A 2DVIA 4RQ5A 4I28A 4LEWA 5HRKA 3UQ2A 8ICLA 3OUYB 3JYYA 3WFOA 1BPYA 3JPNA 1XSNA 3UXNA 4PGXA 1ZJMA 2DRBA 5CB1A 8ICVA 5DDYA 1R8AA 3RH5A 1XSPA 1BPXA 1RPLA 8ICOA 7ICOA 8ICUA 3OUYA 4M9HA 2DR5A 4OAFA 4WC4A 2ZH6A 4I2DA 5DEDA 4O5EA 9ICNA 2RFFA 5HHIA 4IQWA 5D4BA 2FMPA 4K4HA 8ICTA 4I29A 4KLGA 1JAJA 9ICBA 4DOAA 1ZQXA 5HC9A 3H39A 3AQMA 4WC7A 4UB3A 4X4VA 4Z6DA 4I2FA 5HRIA 5DBCA 4NLKA 4TUSA 1WOTA 8ICMA 2M2VA 4F5OA 4PHPA 9ICXA 3MBYA 1UEVA 4TUQA 5DECA 4KLHA 4FHVA 4GXJA 5DBAA 1V4AA 4O6AA 1UEUA 9ICUA 9ICMA 4K99A 4FHYA 4RWQA 4QZBA 4UD4A 4K4IA 3JPQA 1KEJA 4I2IA 8ICWA 4M0AA 4I2AA 4UB2A 9ICEA 9ICTA 2ZH1A 5J0WA 5J0OA 4UB1A 4OAIZ 3C2KA 4K9BA 5J0QA 1ZQEA 4RT2A 4Z6FA 3JPTA 5IIOA 1BPEA 3JPRA 1RZTA 1HUOA 5HRLA 3RJHA 4UAWA 4QZHA 5CP2A 5CA7A 4YCXA 8ICSA 1NOMA 2BPCA 2DR9A 3UPQA 3OV7A 4FH3A 5IIKA 5HR9A 3C5FA 4KLUA 4QZEA 8ICBA 4QZAA 4I27A 4RQ3A 5IIMA 1KNYA 4AT7B 3RJJA 3PNCA 4M47A 8ICGA 1R8CA 9ICIA 3B0XA 4S3NA 3HWTA 4UBBA 1Q79A 2NRKA 3RH6A 5DBBA 4YMOA
chains in the Genus database with same CATH superfamily
7ICKA 7ICLA 4WQKA 3MCRA 4IQVA 4I2BA 4NLZA 4AT7A 4X4SA 5CR0A 3C5GA 4X4PA 3NKUA 1BPZA 4LEVA 4YD1A 4DO9A 4IG8A 4GXKA 4RT3A 1YLQA 2I9GA 1MQ3A 5DB6A 4RQ4A 4M2YA 3HW8A 2IHMA 5D46A 4I2GA 4X4UA 3K7DA 5D49A 3PMLA 3LQCB 4P2HA 1ZQFA 2M2TA 2BBHA 7ICRA 4QZ8A 9ICCA 4EEDA 2Q66A 3WFRE 4DOCA 1ZQNA 1R8BA 4XRHA 1PX5A 1ZQIA 4NKUA 4O67A 1UETA 4P4OA 2HHPA 4UAZA 3OVSA 2W9MA 2BCSA 2VANA 4F5QA 2ZH3A 8ICCA 1ZQDA 9ICVA 4PGQA 2ZH9A 1ZQAA 5D62A 4EV6A 2ZH5A 3H37A 1ZQMA 3HX0A 4M9LA 4O69A 1TFWA 5J0SA 2ISOA 9ICPA 3C66A 4I2CA 5B3PA 3UXOA 1ZQWA 4X4NA 4KLTA 3V7LA 2FCLA 4O5CA 4LEZA 3ER8C 4O9MA 4O68A 9ICOA 3TFSA 4KLLA 1ZQKA 1OU5A 5IIJA 3WFSC 4RWNA 4KLSA 4RPZA 4WH5A 4NXWA 3JCFA 4JLXA 4ATBB 4MFCA 5BPCA 3AQNA 5HREA 4EBJA 4R66A 5J2HA 1ZQJA 4UB4A 4TURA 8ICKA 4XJEA 1ZQGA 5DKWA 7ICPA 5J2KA 4YMNA 4PGYA 4F5RA 4TUPA 4K4GA 3AQKA 4XA5A 4ATBA 9ICFA 4WC2A 3K75D 1ZQSA 2DRAA 4NXZA 4JWMA 3GDXA 4KLQA 3AU2A 3MGIA 4WC1A 2PXIA 2DR7A 5J2CA 5J0XA 3RJIA 4WC0A 4OAGA 5J2EA 3MDAA 1ZQBA 4K8VA 3ISDA 4MF2A 3C2MA 4EBKA 4RWOA 2B56A 3RJGA 1GPJA 3OVBA 5HRDA 4E7XA 3C18A 9ICJA 2FMQA 4KLIA 4HX0A 1ZQOA 5CFUA 4X4OA 4Z6CA 3JPSA 3RJFA 3MDCA 3JPPA 2ZH7A 1MIWA 2IUBA 3HJ1A 3NYBA 1ZQCA 4K9AA 1TFYA 1XSLA 2PFQA 4KM5A 1HUZA 2P66A 3PMNA 5J2GA 4M04A 4WBYA 9ICLA 4QZ9A 4M9JA 4RQ7A 4PPXA 5B3QA 4M5DA 4KB6A 3UXPA 4QZFA 8ICJA 4R65A 5HRFA 4E8FA 3ISBA 3AU6A 4NXTA 3V7KA 4XQ8A 5J2JA 5J2BA 2O5AA 4R63A 4FHXA 8ICFA 9ICHA 5BOLA 2BE3A 4UD5A 4I2HA 2PFOA 7ICFA 4K98A 3B0YA 4UAYA 9ICKA 3EF2A 4NLNA 4JWNA 5J0YA 4X4TA 1BPDA 3UPSA 2GA9D 2BBJA 3WFQE 4KLOA 1TVAA 1ZQYA 4MF8A 5IILA 5HRBA 4RPXA 4WC3A 7ICNA 1MIVA 1KDHA 4AT9B 3JZ0A 5J0TA 2ZH4A 1JN3A 4M9NA 8ICQA 3OVAA 5CWRA 5D63A 4RQ2A 3WFPA 4WC6A 2B4VA 3RH4A 5DDMA 7ICJA 3V72A 8ICNA 5J2DA 4KLMA 8ICIA 4AT9A 5HRHA 2BCRA 1NO5A 4I2EA 8ICYA 4LT6A 2PBEA 4RQ8A 1F5AA 1ZQTA 4UB5A 9ICRA 4P4MA 9ICGA 4I0UA 8ICHA 3H38A 5J0UA 4NM2A 5HRGA 4WBZA 4RWPA 2ZHAA 1VJ7A 2IHOA 5DB7A 5DB8A 4FHWA 9ICAA 4MFAA 9ICSA 1JQRA 1VFGA 4KLJA 7ICGA 5IINA 4NXVA 5J2FA 3RJEA 7ICTA 5DB9A 3V7JA 3L9DA 4JLZA 4QZIA 1ZQQA 5F2VO 4WC5A 5J2IA 4F5PA 2HN1A 4K97A 4EGWA 7ICQA 1R89A 4OAHA 4NKTA 4PH5A 1ZQHA 4AT8B 5CFTA 4LZGA 5J0RA 7ICUA 4KLFA 4NY8A 4P4PA 4WQLA 3H3AA 1JMSA 4X5VA 3OWGA 2ZHBA 1ZQUA 4N7RA 4PHDA 4RPYA 7ICIA 3JPOA 5D61A 4QZGA 3MGHA 4LVSA 4GXIA 4FO6A 7ICMA 5EOZA 4NXXA 4AT8A 4EP7A 4LEYA 3ERCC 2ISPA 4PHAA 4X4RA 4X4QA 4FH5A 7ICHA 1ZQZA 3OGUA 5CJ7A 2PFPA 4MKPA 4KLEA 4NXUA 8ICXA 4MFFA 4X0BA 9ICQA 4YD2A 8ICAA 2EWRA 4K96A 4KLDA 5BOMA 1MQ2A 3HJ4A 2GAFD 4R64A 9ICWA 4E80A 5J2AA 4X0AA 2BCUA 2BPFA 5J0PA 8ICZA 2HN2A 7ICSA 3NVOA 4F5NA 4WOYA 3ER9B 5HHHA 4Z6EA 3HIYA 3C2LA 5IIIA 4WCWA 1ZQVA 4DOBA 2FMSA 8ICRA 4M9GA 5JTGA 7ICEA 8ICPA 4RQ1A 4RQ0A 3UQ0A 1ZQRA 3PHZA 2BCQA 2DR8A 1BPBA 2M2UA 2BCVA 3RJKA 4YN4A 2PFNA 4FHPA 4IQTA 2M2WA 4RQ6A 4UBCA 3ISCA 3AUOA 7ICVA 5CHGA 3NWIA 5J29A 1ZJNA 1MIYA 4LZDA 2B51A 4YMMA 1Q78A 1ZQLA 4O5KA 3CK6A 3TFRA 1TV9A 2ZH8A 4QZDA 2BPGA 4I2JA 8ICEA 5TZVA 3AQLA 2GWSA 4IQUA 2O1PA 3LK9A 4XQ7A 2ZH2A 4XUSA 2ID1A 4NM1A 4QZCA 1ZQPA 4PHEA 1FA0A 2DVIA 4RQ5A 4I28A 4LEWA 5HRKA 3UQ2A 8ICLA 3OUYB 3JYYA 3WFOA 1BPYA 3JPNA 1XSNA 3UXNA 2DRBA 4PGXA 1ZJMA 5CB1A 8ICVA 5DDYA 1R8AA 3RH5A 1XSPA 1BPXA 1RPLA 8ICOA 7ICOA 8ICUA 3OUYA 4M9HA 2DR5A 4OAFA 2ZH6A 4WC4A 4I2DA 5DEDA 4O5EA 9ICNA 2RFFA 5HHIA 4IQWA 5D4BA 2FMPA 4K4HA 8ICTA 4I29A 4KLGA 1JAJA 9ICBA 4DOAA 1ZQXA 5HC9A 3H39A 3AQMA 4WC7A 4UB3A 4X4VA 4Z6DA 4I2FA 5HRIA 5CHEA 5DBCA 4NLKA 4TUSA 1WOTA 8ICMA 2M2VA 4F5OA 4PHPA 9ICXA 3MBYA 1UEVA 4TUQA 5DECA 4KLHA 4FHVA 4GXJA 5DBAA 1V4AA 4O6AA 1UEUA 9ICUA 9ICMA 4K99A 4FHYA 4RWQA 4QZBA 4UD4A 4K4IA 3JPQA 1KEJA 4I2IA 8ICWA 4M0AA 4I2AA 4UB2A 4FO1A 9ICEA 9ICTA 2ZH1A 5J0WA 5J0OA 4UB1A 4OAIZ 5CFSA 3C2KA 4K9BA 5J0QA 1ZQEA 4RT2A 4Z6FA 3JPTA 4EEBA 5IIOA 1BPEA 3JPRA 1RZTA 1HUOA 5HRLA 3RJHA 4UAWA 4QZHA 5CP2A 5CA7A 4YCXA 8ICSA 2DR9A 1NOMA 2BPCA 3UPQA 3OV7A 4FH3A 5IIKA 5HR9A 3C5FA 4KLUA 4QZEA 8ICBA 4QZAA 4I27A 4RQ3A 5IIMA 1KNYA 4AT7B 3RJJA 3PNCA 4M47A 8ICGA 1R8CA 9ICIA 3B0XA 4S3NA 3HWTA 4UBBA 1Q79A 2NRKA 3RH6A 5DBBA 4YMOA
chains in the Genus database with same CATH topology
7ICKA 7ICLA 4IQVA 4NLZA 4I2BA 4AT7A 4X4SA 5CR0A 3C5GA 4X4PA 1BPZA 4LEVA 4YD1A 4DO9A 4GXKA 4IG8A 4RT3A 1YLQA 2I9GA 1MQ3A 5DB6A 4RQ4A 4M2YA 3HW8A 2IHMA 5D46A 4I2GA 4X4UA 3PMLA 5D49A 3LQCB 4P2HA 1ZQFA 2M2TA 7ICRA 4QZ8A 9ICCA 2Q66A 3WFRE 4DOCA 1ZQNA 1R8BA 4XRHA 1PX5A 1ZQIA 4NKUA 4O67A 1UETA 4P4OA 2HHPA 4UAZA 3OVSA 2W9MA 2BCSA 2VANA 4F5QA 2ZH3A 8ICCA 1ZQDA 9ICVA 4PGQA 2ZH9A 1ZQAA 2ZH5A 3H37A 1ZQMA 3HX0A 4M9LA 4O69A 1TFWA 5J0SA 2ISOA 9ICPA 3C66A 4I2CA 3UXOA 1ZQWA 4X4NA 4KLTA 3V7LA 4O5CA 4LEZA 4O9MA 4O68A 9ICOA 3TFSA 4KLLA 1ZQKA 1OU5A 5IIJA 3WFSC 4RWNA 4KLSA 4RPZA 4NXWA 4JLXA 4ATBB 4MFCA 5BPCA 3AQNA 5HREA 4EBJA 4R66A 5J2HA 1ZQJA 4UB4A 4TURA 8ICKA 1ZQGA 5DKWA 7ICPA 5J2KA 4YMNA 4PGYA 4F5RA 4TUPA 4K4GA 3AQKA 4XA5A 4ATBA 9ICFA 4WC2A 3K75D 1ZQSA 2DRAA 4NXZA 4JWMA 3GDXA 4KLQA 3AU2A 3MGIA 4WC1A 2PXIA 2DR7A 5J2CA 5J0XA 3RJIA 4WC0A 4OAGA 5J2EA 3MDAA 1ZQBA 4K8VA 3ISDA 4MF2A 3C2MA 4RWOA 4EBKA 2B56A 3RJGA 3OVBA 5HRDA 4E7XA 3C18A 9ICJA 2FMQA 4KLIA 1ZQOA 4X4OA 4Z6CA 3JPSA 3RJFA 3MDCA 3JPPA 2ZH7A 1MIWA 3HJ1A 3NYBA 1ZQCA 4K9AA 1TFYA 1XSLA 2PFQA 4KM5A 1HUZA 2P66A 3PMNA 5J2GA 4M04A 4WBYA 9ICLA 4QZ9A 4M9JA 4RQ7A 4PPXA 4M5DA 4KB6A 3UXPA 4QZFA 8ICJA 4R65A 5HRFA 4E8FA 3ISBA 3AU6A 4NXTA 3V7KA 4XQ8A 5J2JA 5J2BA 2O5AA 4R63A 4FHXA 8ICFA 9ICHA 5BOLA 2BE3A 4UD5A 4I2HA 2PFOA 7ICFA 4K98A 3B0YA 4UAYA 9ICKA 4NLNA 4JWNA 5J0YA 4X4TA 1BPDA 3UPSA 3WFQE 4KLOA 1TVAA 1ZQYA 4MF8A 5IILA 5HRBA 4RPXA 4WC3A 7ICNA 1MIVA 1KDHA 4AT9B 3JZ0A 5J0TA 2ZH4A 1JN3A 4M9NA 8ICQA 3OVAA 5CWRA 4RQ2A 3WFPA 4WC6A 2B4VA 3RH4A 5DDMA 7ICJA 3V72A 8ICNA 5J2DA 4KLMA 8ICIA 4AT9A 5HRHA 2BCRA 1NO5A 4I2EA 8ICYA 4LT6A 2PBEA 4RQ8A 1F5AA 1ZQTA 4UB5A 9ICRA 4P4MA 9ICGA 8ICHA 3H38A 5J0UA 4NM2A 5HRGA 4WBZA 4RWPA 2ZHAA 1VJ7A 5DB7A 5DB8A 4FHWA 9ICAA 4MFAA 9ICSA 1JQRA 1VFGA 4KLJA 7ICGA 5IINA 4NXVA 5J2FA 3RJEA 7ICTA 5DB9A 3V7JA 3L9DA 4JLZA 4QZIA 1ZQQA 5F2VO 4WC5A 5J2IA 4F5PA 7ICQA 4K97A 1R89A 4OAHA 4NKTA 4PH5A 1ZQHA 4AT8B 4LZGA 5J0RA 7ICUA 4KLFA 4NY8A 4P4PA 3H3AA 1JMSA 4X5VA 7ICIA 2ZHBA 1ZQUA 4PHDA 4RPYA 3JPOA 4QZGA 3MGHA 4LVSA 4GXIA 4FO6A 7ICMA 5EOZA 4NXXA 4AT8A 4EP7A 4LEYA 2ISPA 4PHAA 4X4RA 4X4QA 4FH5A 7ICHA 1ZQZA 3OGUA 5CJ7A 2PFPA 4MKPA 4KLEA 4NXUA 8ICXA 4MFFA 4X0BA 9ICQA 4YD2A 8ICAA 4K96A 4KLDA 5BOMA 1MQ2A 3HJ4A 4R64A 9ICWA 4E80A 5J2AA 4X0AA 2BCUA 2BPFA 5J0PA 8ICZA 7ICSA 4F5NA 4WOYA 5HHHA 4Z6EA 3HIYA 3C2LA 5IIIA 4WCWA 1ZQVA 4DOBA 2FMSA 8ICRA 4M9GA 7ICEA 8ICPA 4RQ1A 4RQ0A 3UQ0A 1ZQRA 2BCQA 2DR8A 1BPBA 2M2UA 2BCVA 3RJKA 4YN4A 2PFNA 4FHPA 4IQTA 2M2WA 4RQ6A 4UBCA 3ISCA 3AUOA 7ICVA 5CHGA 5J29A 1ZJNA 1MIYA 4LZDA 2B51A 4YMMA 1Q78A 1ZQLA 4O5KA 3TFRA 1TV9A 2ZH8A 4QZDA 2BPGA 4I2JA 8ICEA 5TZVA 3AQLA 2GWSA 4IQUA 2O1PA 3LK9A 2ZH2A 4XQ7A 4XUSA 2ID1A 4NM1A 4QZCA 1ZQPA 4PHEA 1FA0A 2DVIA 4RQ5A 4I28A 4LEWA 5HRKA 3UQ2A 8ICLA 3OUYB 3JYYA 3WFOA 1BPYA 3JPNA 1XSNA 3UXNA 2DRBA 4PGXA 1ZJMA 5CB1A 8ICVA 5DDYA 1R8AA 3RH5A 1XSPA 1BPXA 1RPLA 8ICOA 7ICOA 8ICUA 3OUYA 4M9HA 2DR5A 4OAFA 2ZH6A 4WC4A 4I2DA 5DEDA 4O5EA 9ICNA 2RFFA 5HHIA 4IQWA 5D4BA 2FMPA 4K4HA 8ICTA 4I29A 4KLGA 1JAJA 9ICBA 4DOAA 1ZQXA 5HC9A 3H39A 3AQMA 4WC7A 4UB3A 4X4VA 4Z6DA 4I2FA 5HRIA 5DBCA 4NLKA 4TUSA 1WOTA 8ICMA 2M2VA 4F5OA 4PHPA 9ICXA 3MBYA 1UEVA 4TUQA 5DECA 4KLHA 4FHVA 4GXJA 5DBAA 1V4AA 4O6AA 1UEUA 9ICUA 9ICMA 4K99A 4FHYA 4RWQA 4QZBA 4UD4A 4K4IA 3JPQA 1KEJA 4I2IA 8ICWA 4M0AA 4I2AA 4UB2A 9ICEA 9ICTA 2ZH1A 5J0WA 5J0OA 4UB1A 4OAIZ 3C2KA 4K9BA 5J0QA 1ZQEA 4RT2A 4Z6FA 3JPTA 5IIOA 1BPEA 3JPRA 1RZTA 1HUOA 5HRLA 3RJHA 4UAWA 4QZHA 5CP2A 5CA7A 4YCXA 8ICSA 2DR9A 1NOMA 2BPCA 3UPQA 3OV7A 4FH3A 5IIKA 5HR9A 3C5FA 4KLUA 4QZEA 8ICBA 4QZAA 4I27A 4RQ3A 5IIMA 1KNYA 4AT7B 3RJJA 3PNCA 4M47A 8ICGA 1R8CA 9ICIA 3B0XA 4S3NA 3HWTA 4UBBA 1Q79A 2NRKA 3RH6A 5DBBA 4YMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7ICK A;  7ICL A;  4IQV A;  4NLZ A;  4I2B A;  4AT7 A;  4X4S A;  5CR0 A;  3C5G A;  4X4P A;  1BPZ A;  4LEV A;  4YD1 A;  4DO9 A;  4GXK A;  4IG8 A;  4RT3 A;  1YLQ A;  2I9G A;  1MQ3 A;  5DB6 A;  4RQ4 A;  4M2Y A;  3HW8 A;  2IHM A;  5D46 A;  4I2G A;  3PML A;  4X4U A;  5D49 A;  3LQC B;  4P2H A;  1ZQF A;  2M2T A;  7ICR A;  4QZ8 A;  9ICC A;  2Q66 A;  3WFR E;  4DOC A;  1ZQN A;  1R8B A;  4XRH A;  1PX5 A;  1ZQI A;  4NKU A;  4O67 A;  1UET A;  4P4O A;  2HHP A;  4UAZ A;  3OVS A;  2W9M A;  2BCS A;  2VAN A;  4F5Q A;  2ZH3 A;  8ICC A;  1ZQD A;  9ICV A;  4PGQ A;  2ZH9 A;  1ZQA A;  2ZH5 A;  3H37 A;  1ZQM A;  3HX0 A;  4M9L A;  4O69 A;  1TFW A;  5J0S A;  2ISO A;  9ICP A;  3C66 A;  4I2C A;  3UXO A;  1ZQW A;  4X4N A;  4KLT A;  3V7L A;  4O5C A;  4LEZ A;  4O9M A;  4O68 A;  9ICO A;  3TFS A;  4KLL A;  1ZQK A;  1OU5 A;  5IIJ A;  3WFS C;  4RWN A;  4KLS A;  4RPZ A;  4NXW A;  4JLX A;  4ATB B;  4MFC A;  5BPC A;  3AQN A;  5HRE A;  4EBJ A;  4R66 A;  5J2H A;  1ZQJ A;  4UB4 A;  4TUR A;  8ICK A;  1ZQG A;  5DKW A;  7ICP A;  5J2K A;  4YMN A;  4PGY A;  4F5R A;  4TUP A;  4K4G A;  3AQK A;  4XA5 A;  4ATB A;  9ICF A;  4WC2 A;  3K75 D;  1ZQS A;  2DRA A;  4NXZ A;  4JWM A;  3GDX A;  4KLQ A;  3AU2 A;  3MGI A;  4WC1 A;  2PXI A;  2DR7 A;  5J2C A;  5J0X A;  3RJI A;  4WC0 A;  4OAG A;  5J2E A;  3MDA A;  1ZQB A;  4K8V A;  3ISD A;  4MF2 A;  3C2M A;  4RWO A;  4EBK A;  3RJG A;  3OVB A;  5HRD A;  4E7X A;  3C18 A;  9ICJ A;  2FMQ A;  4KLI A;  1ZQO A;  4X4O A;  4Z6C A;  3JPS A;  3RJF A;  3MDC A;  3JPP A;  2ZH7 A;  1MIW A;  3HJ1 A;  3NYB A;  1ZQC A;  4K9A A;  1TFY A;  1XSL A;  2PFQ A;  4KM5 A;  1HUZ A;  2P66 A;  3PMN A;  5J2G A;  4M04 A;  4WBY A;  9ICL A;  4QZ9 A;  4M9J A;  4RQ7 A;  4PPX A;  4M5D A;  4KB6 A;  3UXP A;  4QZF A;  8ICJ A;  4R65 A;  5HRF A;  4E8F A;  3ISB A;  3AU6 A;  4NXT A;  3V7K A;  4XQ8 A;  5J2J A;  5J2B A;  2O5A A;  4R63 A;  4FHX A;  8ICF A;  9ICH A;  5BOL A;  2BE3 A;  4UD5 A;  4I2H A;  2PFO A;  7ICF A;  4K98 A;  3B0Y A;  4UAY A;  9ICK A;  4NLN A;  4JWN A;  5J0Y A;  4X4T A;  1BPD A;  3UPS A;  3WFQ E;  4KLO A;  1TVA A;  1ZQY A;  4MF8 A;  5IIL A;  5HRB A;  4RPX A;  4WC3 A;  7ICN A;  1MIV A;  1KDH A;  4AT9 B;  3JZ0 A;  5J0T A;  2ZH4 A;  1JN3 A;  4M9N A;  8ICQ A;  5CWR A;  3OVA A;  4RQ2 A;  3WFP A;  4WC6 A;  3RH4 A;  5DDM A;  7ICJ A;  3V72 A;  8ICN A;  5J2D A;  4KLM A;  8ICI A;  4AT9 A;  5HRH A;  2BCR A;  1NO5 A;  4I2E A;  8ICY A;  4LT6 A;  2PBE A;  4RQ8 A;  1F5A A;  1ZQT A;  4UB5 A;  9ICR A;  4P4M A;  9ICG A;  8ICH A;  3H38 A;  5J0U A;  4NM2 A;  5HRG A;  4WBZ A;  4RWP A;  2ZHA A;  1VJ7 A;  5DB7 A;  5DB8 A;  4FHW A;  9ICA A;  4MFA A;  9ICS A;  1JQR A;  1VFG A;  4KLJ A;  7ICG A;  5IIN A;  4NXV A;  5J2F A;  3RJE A;  7ICT A;  5DB9 A;  3V7J A;  3L9D A;  4JLZ A;  4QZI A;  1ZQQ A;  5F2V O;  4WC5 A;  5J2I A;  4F5P A;  7ICQ A;  4K97 A;  4OAH A;  1R89 A;  4NKT A;  4PH5 A;  1ZQH A;  4AT8 B;  4LZG A;  5J0R A;  7ICU A;  4KLF A;  4NY8 A;  4P4P A;  3H3A A;  1JMS A;  4X5V A;  7ICI A;  2ZHB A;  1ZQU A;  4PHD A;  4RPY A;  3JPO A;  4QZG A;  3MGH A;  4LVS A;  4GXI A;  4FO6 A;  7ICM A;  5EOZ A;  4NXX A;  4AT8 A;  4EP7 A;  4LEY A;  2ISP A;  4PHA A;  4X4R A;  4X4Q A;  4FH5 A;  7ICH A;  1ZQZ A;  3OGU A;  5CJ7 A;  2PFP A;  4MKP A;  4KLE A;  4NXU A;  8ICX A;  4MFF A;  4X0B A;  9ICQ A;  4YD2 A;  8ICA A;  4K96 A;  4KLD A;  5BOM A;  1MQ2 A;  3HJ4 A;  4R64 A;  9ICW A;  4E80 A;  5J2A A;  4X0A A;  2BCU A;  2BPF A;  5J0P A;  8ICZ A;  7ICS A;  4F5N A;  4WOY A;  5HHH A;  4Z6E A;  3HIY A;  3C2L A;  5III A;  4WCW A;  1ZQV A;  4DOB A;  2FMS A;  8ICR A;  4M9G A;  7ICE A;  8ICP A;  4RQ1 A;  4RQ0 A;  3UQ0 A;  1ZQR A;  2BCQ A;  2DR8 A;  1BPB A;  2M2U A;  2BCV A;  3RJK A;  4YN4 A;  2PFN A;  4FHP A;  4IQT A;  2M2W A;  4RQ6 A;  4UBC A;  3ISC A;  3AUO A;  7ICV A;  5CHG A;  5J29 A;  1ZJN A;  1MIY A;  4LZD A;  4YMM A;  1Q78 A;  1ZQL A;  4O5K A;  3TFR A;  1TV9 A;  2ZH8 A;  4QZD A;  2BPG A;  4I2J A;  8ICE A;  5TZV A;  3AQL A;  2GWS A;  4IQU A;  2O1P A;  3LK9 A;  4XQ7 A;  4XUS A;  2ZH2 A;  2ID1 A;  4NM1 A;  4QZC A;  1ZQP A;  4PHE A;  1FA0 A;  2DVI A;  4RQ5 A;  4I28 A;  4LEW A;  5HRK A;  3UQ2 A;  8ICL A;  3OUY B;  3JYY A;  3WFO A;  1BPY A;  3JPN A;  1XSN A;  3UXN A;  4PGX A;  1ZJM A;  2DRB A;  5CB1 A;  8ICV A;  5DDY A;  1R8A A;  3RH5 A;  1XSP A;  1BPX A;  1RPL A;  8ICO A;  7ICO A;  8ICU A;  3OUY A;  4M9H A;  2DR5 A;  4OAF A;  4WC4 A;  2ZH6 A;  4I2D A;  5DED A;  4O5E A;  9ICN A;  2RFF A;  5HHI A;  4IQW A;  5D4B A;  2FMP A;  4K4H A;  8ICT A;  4I29 A;  4KLG A;  1JAJ A;  9ICB A;  4DOA A;  1ZQX A;  5HC9 A;  3H39 A;  3AQM A;  4WC7 A;  4UB3 A;  4X4V A;  4Z6D A;  4I2F A;  5HRI A;  5DBC A;  4NLK A;  4TUS A;  1WOT A;  8ICM A;  2M2V A;  4F5O A;  4PHP A;  9ICX A;  3MBY A;  1UEV A;  4TUQ A;  5DEC A;  4KLH A;  4FHV A;  4GXJ A;  5DBA A;  1V4A A;  4O6A A;  1UEU A;  9ICU A;  9ICM A;  4K99 A;  4FHY A;  4RWQ A;  4QZB A;  4UD4 A;  4K4I A;  3JPQ A;  1KEJ A;  4I2I A;  8ICW A;  4M0A A;  4I2A A;  4UB2 A;  9ICE A;  9ICT A;  2ZH1 A;  5J0W A;  5J0O A;  4UB1 A;  4OAI Z;  3C2K A;  4K9B A;  5J0Q A;  1ZQE A;  4RT2 A;  4Z6F A;  3JPT A;  5IIO A;  1BPE A;  3JPR A;  1RZT A;  1HUO A;  5HRL A;  3RJH A;  4UAW A;  4QZH A;  5CP2 A;  5CA7 A;  4YCX A;  8ICS A;  1NOM A;  2BPC A;  2DR9 A;  3UPQ A;  3OV7 A;  4FH3 A;  5IIK A;  5HR9 A;  3C5F A;  4KLU A;  4QZE A;  8ICB A;  4QZA A;  4I27 A;  4RQ3 A;  5IIM A;  1KNY A;  4AT7 B;  3RJJ A;  3PNC A;  4M47 A;  8ICG A;  1R8C A;  9ICI A;  3B0X A;  4S3N A;  3HWT A;  4UBB A;  1Q79 A;  2NRK A;  3RH6 A;  5DBB A;  4YMO A; 
#chains in the Genus database with same CATH topology
 7ICK A;  7ICL A;  4WQK A;  3MCR A;  4IQV A;  4I2B A;  4NLZ A;  4AT7 A;  4X4S A;  5CR0 A;  3C5G A;  4X4P A;  3NKU A;  1BPZ A;  4LEV A;  4YD1 A;  4DO9 A;  4IG8 A;  4GXK A;  4RT3 A;  1YLQ A;  2I9G A;  1MQ3 A;  5DB6 A;  4RQ4 A;  4M2Y A;  3HW8 A;  2IHM A;  5D46 A;  4I2G A;  4X4U A;  3K7D A;  5D49 A;  3PML A;  3LQC B;  4P2H A;  1ZQF A;  2M2T A;  2BBH A;  7ICR A;  4QZ8 A;  9ICC A;  4EED A;  2Q66 A;  3WFR E;  4DOC A;  1ZQN A;  1R8B A;  4XRH A;  1PX5 A;  1ZQI A;  4NKU A;  4O67 A;  1UET A;  4P4O A;  2HHP A;  4UAZ A;  3OVS A;  2W9M A;  2BCS A;  2VAN A;  4F5Q A;  2ZH3 A;  8ICC A;  1ZQD A;  9ICV A;  4PGQ A;  2ZH9 A;  1ZQA A;  5D62 A;  4EV6 A;  2ZH5 A;  3H37 A;  1ZQM A;  3HX0 A;  4M9L A;  4O69 A;  1TFW A;  5J0S A;  2ISO A;  9ICP A;  3C66 A;  4I2C A;  5B3P A;  3UXO A;  1ZQW A;  4X4N A;  4KLT A;  3V7L A;  2FCL A;  4O5C A;  4LEZ A;  3ER8 C;  4O9M A;  4O68 A;  9ICO A;  3TFS A;  4KLL A;  1ZQK A;  1OU5 A;  5IIJ A;  3WFS C;  4RWN A;  4KLS A;  4RPZ A;  4WH5 A;  4NXW A;  3JCF A;  4JLX A;  4ATB B;  4MFC A;  5BPC A;  3AQN A;  5HRE A;  4EBJ A;  4R66 A;  5J2H A;  1ZQJ A;  4UB4 A;  4TUR A;  8ICK A;  4XJE A;  1ZQG A;  5DKW A;  7ICP A;  5J2K A;  4YMN A;  4PGY A;  4F5R A;  4TUP A;  4K4G A;  3AQK A;  4XA5 A;  4ATB A;  9ICF A;  4WC2 A;  3K75 D;  1ZQS A;  2DRA A;  4NXZ A;  4JWM A;  3GDX A;  4KLQ A;  3AU2 A;  3MGI A;  4WC1 A;  2PXI A;  2DR7 A;  5J2C A;  5J0X A;  3RJI A;  4WC0 A;  4OAG A;  5J2E A;  3MDA A;  1ZQB A;  4K8V A;  3ISD A;  4MF2 A;  3C2M A;  4EBK A;  4RWO A;  2B56 A;  3RJG A;  1GPJ A;  3OVB A;  5HRD A;  4E7X A;  3C18 A;  9ICJ A;  2FMQ A;  4KLI A;  4HX0 A;  1ZQO A;  5CFU A;  4X4O A;  4Z6C A;  3JPS A;  3RJF A;  3MDC A;  3JPP A;  2ZH7 A;  1MIW A;  2IUB A;  3HJ1 A;  3NYB A;  1ZQC A;  4K9A A;  1TFY A;  1XSL A;  2PFQ A;  4KM5 A;  1HUZ A;  2P66 A;  3PMN A;  5J2G A;  4M04 A;  4WBY A;  9ICL A;  4QZ9 A;  4M9J A;  4RQ7 A;  4PPX A;  5B3Q A;  4M5D A;  4KB6 A;  3UXP A;  4QZF A;  8ICJ A;  4R65 A;  5HRF A;  4E8F A;  3ISB A;  3AU6 A;  4NXT A;  3V7K A;  4XQ8 A;  5J2J A;  5J2B A;  2O5A A;  4R63 A;  4FHX A;  8ICF A;  9ICH A;  5BOL A;  2BE3 A;  4UD5 A;  4I2H A;  2PFO A;  7ICF A;  4K98 A;  3B0Y A;  4UAY A;  9ICK A;  3EF2 A;  4NLN A;  4JWN A;  5J0Y A;  4X4T A;  1BPD A;  3UPS A;  2GA9 D;  2BBJ A;  3WFQ E;  4KLO A;  1TVA A;  1ZQY A;  4MF8 A;  5IIL A;  5HRB A;  4RPX A;  4WC3 A;  7ICN A;  1MIV A;  1KDH A;  4AT9 B;  3JZ0 A;  5J0T A;  2ZH4 A;  1JN3 A;  4M9N A;  8ICQ A;  3OVA A;  5CWR A;  5D63 A;  4RQ2 A;  3WFP A;  4WC6 A;  2B4V A;  3RH4 A;  5DDM A;  7ICJ A;  3V72 A;  8ICN A;  5J2D A;  4KLM A;  8ICI A;  4AT9 A;  5HRH A;  2BCR A;  1NO5 A;  4I2E A;  8ICY A;  4LT6 A;  2PBE A;  4RQ8 A;  1F5A A;  1ZQT A;  4UB5 A;  9ICR A;  4P4M A;  9ICG A;  4I0U A;  8ICH A;  3H38 A;  5J0U A;  4NM2 A;  5HRG A;  4WBZ A;  4RWP A;  2ZHA A;  1VJ7 A;  2IHO A;  5DB7 A;  5DB8 A;  4FHW A;  9ICA A;  4MFA A;  9ICS A;  1JQR A;  1VFG A;  4KLJ A;  7ICG A;  5IIN A;  4NXV A;  5J2F A;  3RJE A;  7ICT A;  5DB9 A;  3V7J A;  3L9D A;  4JLZ A;  4QZI A;  1ZQQ A;  5F2V O;  4WC5 A;  5J2I A;  4F5P A;  2HN1 A;  4K97 A;  4EGW A;  7ICQ A;  1R89 A;  4OAH A;  4NKT A;  4PH5 A;  1ZQH A;  4AT8 B;  5CFT A;  4LZG A;  5J0R A;  7ICU A;  4KLF A;  4NY8 A;  4P4P A;  4WQL A;  3H3A A;  1JMS A;  4X5V A;  3OWG A;  2ZHB A;  1ZQU A;  4N7R A;  4PHD A;  4RPY A;  7ICI A;  3JPO A;  5D61 A;  4QZG A;  3MGH A;  4LVS A;  4GXI A;  4FO6 A;  7ICM A;  5EOZ A;  4NXX A;  4AT8 A;  4EP7 A;  4LEY A;  3ERC C;  2ISP A;  4PHA A;  4X4R A;  4X4Q A;  4FH5 A;  7ICH A;  1ZQZ A;  3OGU A;  5CJ7 A;  2PFP A;  4MKP A;  4KLE A;  4NXU A;  8ICX A;  4MFF A;  4X0B A;  9ICQ A;  4YD2 A;  8ICA A;  2EWR A;  4K96 A;  4KLD A;  5BOM A;  1MQ2 A;  3HJ4 A;  2GAF D;  4R64 A;  9ICW A;  4E80 A;  5J2A A;  4X0A A;  2BCU A;  2BPF A;  5J0P A;  8ICZ A;  2HN2 A;  7ICS A;  3NVO A;  4F5N A;  4WOY A;  3ER9 B;  5HHH A;  4Z6E A;  3HIY A;  3C2L A;  5III A;  4WCW A;  1ZQV A;  4DOB A;  2FMS A;  8ICR A;  4M9G A;  5JTG A;  7ICE A;  8ICP A;  4RQ1 A;  4RQ0 A;  3UQ0 A;  1ZQR A;  3PHZ A;  2BCQ A;  2DR8 A;  1BPB A;  2M2U A;  2BCV A;  3RJK A;  4YN4 A;  2PFN A;  4FHP A;  4IQT A;  2M2W A;  4RQ6 A;  4UBC A;  3ISC A;  3AUO A;  7ICV A;  5CHG A;  3NWI A;  5J29 A;  1ZJN A;  1MIY A;  4LZD A;  2B51 A;  4YMM A;  1Q78 A;  1ZQL A;  4O5K A;  3CK6 A;  3TFR A;  1TV9 A;  2ZH8 A;  4QZD A;  2BPG A;  4I2J A;  8ICE A;  5TZV A;  3AQL A;  2GWS A;  4IQU A;  2O1P A;  3LK9 A;  4XQ7 A;  2ZH2 A;  4XUS A;  2ID1 A;  4NM1 A;  4QZC A;  1ZQP A;  4PHE A;  1FA0 A;  2DVI A;  4RQ5 A;  4I28 A;  4LEW A;  5HRK A;  3UQ2 A;  8ICL A;  3OUY B;  3JYY A;  3WFO A;  1BPY A;  3JPN A;  1XSN A;  3UXN A;  2DRB A;  4PGX A;  1ZJM A;  5CB1 A;  8ICV A;  5DDY A;  1R8A A;  3RH5 A;  1XSP A;  1BPX A;  1RPL A;  8ICO A;  7ICO A;  8ICU A;  3OUY A;  4M9H A;  2DR5 A;  4OAF A;  2ZH6 A;  4WC4 A;  4I2D A;  5DED A;  4O5E A;  9ICN A;  2RFF A;  5HHI A;  4IQW A;  5D4B A;  2FMP A;  4K4H A;  8ICT A;  4I29 A;  4KLG A;  1JAJ A;  9ICB A;  4DOA A;  1ZQX A;  5HC9 A;  3H39 A;  3AQM A;  4WC7 A;  4UB3 A;  4X4V A;  4Z6D A;  4I2F A;  5HRI A;  5CHE A;  5DBC A;  4NLK A;  4TUS A;  1WOT A;  8ICM A;  2M2V A;  4F5O A;  4PHP A;  9ICX A;  3MBY A;  1UEV A;  4TUQ A;  5DEC A;  4KLH A;  4FHV A;  4GXJ A;  5DBA A;  1V4A A;  4O6A A;  1UEU A;  9ICU A;  9ICM A;  4K99 A;  4FHY A;  4RWQ A;  4QZB A;  4UD4 A;  4K4I A;  3JPQ A;  1KEJ A;  4I2I A;  8ICW A;  4M0A A;  4I2A A;  4UB2 A;  4FO1 A;  9ICE A;  9ICT A;  2ZH1 A;  5J0W A;  5J0O A;  4UB1 A;  4OAI Z;  5CFS A;  3C2K A;  4K9B A;  5J0Q A;  1ZQE A;  4RT2 A;  4Z6F A;  3JPT A;  4EEB A;  5IIO A;  1BPE A;  3JPR A;  1RZT A;  1HUO A;  5HRL A;  3RJH A;  4UAW A;  4QZH A;  5CP2 A;  5CA7 A;  4YCX A;  8ICS A;  2DR9 A;  1NOM A;  2BPC A;  3UPQ A;  3OV7 A;  4FH3 A;  5IIK A;  5HR9 A;  3C5F A;  4KLU A;  4QZE A;  8ICB A;  4QZA A;  4I27 A;  4RQ3 A;  5IIM A;  1KNY A;  4AT7 B;  3RJJ A;  3PNC A;  4M47 A;  8ICG A;  1R8C A;  9ICI A;  3B0X A;  4S3N A;  3HWT A;  4UBB A;  1Q79 A;  2NRK A;  3RH6 A;  5DBB A;  4YMO A; 
#chains in the Genus database with same CATH homology
 7ICK A;  7ICL A;  4IQV A;  4NLZ A;  4I2B A;  4AT7 A;  4X4S A;  5CR0 A;  3C5G A;  4X4P A;  1BPZ A;  4LEV A;  4YD1 A;  4DO9 A;  4GXK A;  4IG8 A;  4RT3 A;  1YLQ A;  2I9G A;  1MQ3 A;  5DB6 A;  4RQ4 A;  4M2Y A;  3HW8 A;  2IHM A;  5D46 A;  4I2G A;  4X4U A;  3PML A;  5D49 A;  3LQC B;  4P2H A;  1ZQF A;  2M2T A;  7ICR A;  4QZ8 A;  9ICC A;  2Q66 A;  3WFR E;  4DOC A;  1ZQN A;  1R8B A;  4XRH A;  1PX5 A;  1ZQI A;  4NKU A;  4O67 A;  1UET A;  4P4O A;  2HHP A;  4UAZ A;  3OVS A;  2W9M A;  2BCS A;  2VAN A;  4F5Q A;  2ZH3 A;  8ICC A;  1ZQD A;  9ICV A;  4PGQ A;  2ZH9 A;  1ZQA A;  2ZH5 A;  3H37 A;  1ZQM A;  3HX0 A;  4M9L A;  4O69 A;  1TFW A;  5J0S A;  2ISO A;  9ICP A;  3C66 A;  4I2C A;  3UXO A;  1ZQW A;  4X4N A;  4KLT A;  3V7L A;  4O5C A;  4LEZ A;  4O9M A;  4O68 A;  9ICO A;  3TFS A;  4KLL A;  1ZQK A;  1OU5 A;  5IIJ A;  3WFS C;  4RWN A;  4KLS A;  4RPZ A;  4NXW A;  4JLX A;  4ATB B;  4MFC A;  5BPC A;  3AQN A;  5HRE A;  4EBJ A;  4R66 A;  5J2H A;  1ZQJ A;  4UB4 A;  4TUR A;  8ICK A;  1ZQG A;  5DKW A;  7ICP A;  5J2K A;  4YMN A;  4PGY A;  4F5R A;  4TUP A;  4K4G A;  3AQK A;  4XA5 A;  4ATB A;  9ICF A;  4WC2 A;  3K75 D;  1ZQS A;  2DRA A;  4NXZ A;  4JWM A;  3GDX A;  4KLQ A;  3AU2 A;  3MGI A;  4WC1 A;  2PXI A;  2DR7 A;  5J2C A;  5J0X A;  3RJI A;  4WC0 A;  4OAG A;  5J2E A;  3MDA A;  1ZQB A;  4K8V A;  3ISD A;  4MF2 A;  3C2M A;  4RWO A;  4EBK A;  2B56 A;  3RJG A;  3OVB A;  5HRD A;  4E7X A;  3C18 A;  9ICJ A;  2FMQ A;  4KLI A;  1ZQO A;  4X4O A;  4Z6C A;  3JPS A;  3RJF A;  3MDC A;  3JPP A;  2ZH7 A;  1MIW A;  3HJ1 A;  3NYB A;  1ZQC A;  4K9A A;  1TFY A;  1XSL A;  2PFQ A;  4KM5 A;  1HUZ A;  2P66 A;  3PMN A;  5J2G A;  4M04 A;  4WBY A;  9ICL A;  4QZ9 A;  4M9J A;  4RQ7 A;  4PPX A;  4M5D A;  4KB6 A;  3UXP A;  4QZF A;  8ICJ A;  4R65 A;  5HRF A;  4E8F A;  3ISB A;  3AU6 A;  4NXT A;  3V7K A;  4XQ8 A;  5J2J A;  5J2B A;  2O5A A;  4R63 A;  4FHX A;  8ICF A;  9ICH A;  5BOL A;  2BE3 A;  4UD5 A;  4I2H A;  2PFO A;  7ICF A;  4K98 A;  3B0Y A;  4UAY A;  9ICK A;  4NLN A;  4JWN A;  5J0Y A;  4X4T A;  1BPD A;  3UPS A;  3WFQ E;  4KLO A;  1TVA A;  1ZQY A;  4MF8 A;  5IIL A;  5HRB A;  4RPX A;  4WC3 A;  7ICN A;  1MIV A;  1KDH A;  4AT9 B;  3JZ0 A;  5J0T A;  2ZH4 A;  1JN3 A;  4M9N A;  8ICQ A;  3OVA A;  5CWR A;  4RQ2 A;  3WFP A;  4WC6 A;  2B4V A;  3RH4 A;  5DDM A;  7ICJ A;  3V72 A;  8ICN A;  5J2D A;  4KLM A;  8ICI A;  4AT9 A;  5HRH A;  2BCR A;  1NO5 A;  4I2E A;  8ICY A;  4LT6 A;  2PBE A;  4RQ8 A;  1F5A A;  1ZQT A;  4UB5 A;  9ICR A;  4P4M A;  9ICG A;  8ICH A;  3H38 A;  5J0U A;  4NM2 A;  5HRG A;  4WBZ A;  4RWP A;  2ZHA A;  1VJ7 A;  5DB7 A;  5DB8 A;  4FHW A;  9ICA A;  4MFA A;  9ICS A;  1JQR A;  1VFG A;  4KLJ A;  7ICG A;  5IIN A;  4NXV A;  5J2F A;  3RJE A;  7ICT A;  5DB9 A;  3V7J A;  3L9D A;  4JLZ A;  4QZI A;  1ZQQ A;  5F2V O;  4WC5 A;  5J2I A;  4F5P A;  7ICQ A;  4K97 A;  1R89 A;  4OAH A;  4NKT A;  4PH5 A;  1ZQH A;  4AT8 B;  4LZG A;  5J0R A;  7ICU A;  4KLF A;  4NY8 A;  4P4P A;  3H3A A;  1JMS A;  4X5V A;  7ICI A;  2ZHB A;  1ZQU A;  4PHD A;  4RPY A;  3JPO A;  4QZG A;  3MGH A;  4LVS A;  4GXI A;  4FO6 A;  7ICM A;  5EOZ A;  4NXX A;  4AT8 A;  4EP7 A;  4LEY A;  2ISP A;  4PHA A;  4X4R A;  4X4Q A;  4FH5 A;  7ICH A;  1ZQZ A;  3OGU A;  5CJ7 A;  2PFP A;  4MKP A;  4KLE A;  4NXU A;  8ICX A;  4MFF A;  4X0B A;  9ICQ A;  4YD2 A;  8ICA A;  4K96 A;  4KLD A;  5BOM A;  1MQ2 A;  3HJ4 A;  4R64 A;  9ICW A;  4E80 A;  5J2A A;  4X0A A;  2BCU A;  2BPF A;  5J0P A;  8ICZ A;  7ICS A;  4F5N A;  4WOY A;  5HHH A;  4Z6E A;  3HIY A;  3C2L A;  5III A;  4WCW A;  1ZQV A;  4DOB A;  2FMS A;  8ICR A;  4M9G A;  7ICE A;  8ICP A;  4RQ1 A;  4RQ0 A;  3UQ0 A;  1ZQR A;  2BCQ A;  2DR8 A;  1BPB A;  2M2U A;  2BCV A;  3RJK A;  4YN4 A;  2PFN A;  4FHP A;  4IQT A;  2M2W A;  4RQ6 A;  4UBC A;  3ISC A;  3AUO A;  7ICV A;  5CHG A;  5J29 A;  1ZJN A;  1MIY A;  4LZD A;  2B51 A;  4YMM A;  1Q78 A;  1ZQL A;  4O5K A;  3TFR A;  1TV9 A;  2ZH8 A;  4QZD A;  2BPG A;  4I2J A;  8ICE A;  5TZV A;  3AQL A;  2GWS A;  4IQU A;  2O1P A;  3LK9 A;  2ZH2 A;  4XQ7 A;  4XUS A;  2ID1 A;  4NM1 A;  4QZC A;  1ZQP A;  4PHE A;  1FA0 A;  2DVI A;  4RQ5 A;  4I28 A;  4LEW A;  5HRK A;  3UQ2 A;  8ICL A;  3OUY B;  3JYY A;  3WFO A;  1BPY A;  3JPN A;  1XSN A;  3UXN A;  2DRB A;  4PGX A;  1ZJM A;  5CB1 A;  8ICV A;  5DDY A;  1R8A A;  3RH5 A;  1XSP A;  1BPX A;  1RPL A;  8ICO A;  7ICO A;  8ICU A;  3OUY A;  4M9H A;  2DR5 A;  4OAF A;  2ZH6 A;  4WC4 A;  4I2D A;  5DED A;  4O5E A;  9ICN A;  2RFF A;  5HHI A;  4IQW A;  5D4B A;  2FMP A;  4K4H A;  8ICT A;  4I29 A;  4KLG A;  1JAJ A;  9ICB A;  4DOA A;  1ZQX A;  5HC9 A;  3H39 A;  3AQM A;  4WC7 A;  4UB3 A;  4X4V A;  4Z6D A;  4I2F A;  5HRI A;  5DBC A;  4NLK A;  4TUS A;  1WOT A;  8ICM A;  2M2V A;  4F5O A;  4PHP A;  9ICX A;  3MBY A;  1UEV A;  4TUQ A;  5DEC A;  4KLH A;  4FHV A;  4GXJ A;  5DBA A;  1V4A A;  4O6A A;  1UEU A;  9ICU A;  9ICM A;  4K99 A;  4FHY A;  4RWQ A;  4QZB A;  4UD4 A;  4K4I A;  3JPQ A;  1KEJ A;  4I2I A;  8ICW A;  4M0A A;  4I2A A;  4UB2 A;  9ICE A;  9ICT A;  2ZH1 A;  5J0W A;  5J0O A;  4UB1 A;  4OAI Z;  3C2K A;  4K9B A;  5J0Q A;  1ZQE A;  4RT2 A;  4Z6F A;  3JPT A;  5IIO A;  1BPE A;  3JPR A;  1RZT A;  1HUO A;  5HRL A;  3RJH A;  4UAW A;  4QZH A;  5CP2 A;  5CA7 A;  4YCX A;  8ICS A;  2DR9 A;  1NOM A;  2BPC A;  3UPQ A;  3OV7 A;  4FH3 A;  5IIK A;  5HR9 A;  3C5F A;  4KLU A;  4QZE A;  8ICB A;  4QZA A;  4I27 A;  4RQ3 A;  5IIM A;  1KNY A;  4AT7 B;  3RJJ A;  3PNC A;  4M47 A;  8ICG A;  1R8C A;  9ICI A;  3B0X A;  4S3N A;  3HWT A;  4UBB A;  1Q79 A;  2NRK A;  3RH6 A;  5DBB A;  4YMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...