4AT8A

Crystal structure of the nf90-nf45 dimerisation domain complex with atp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
333
structure length
333
Chain Sequence
SHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN ENHANCER-BINDING FACTOR 2
publication title NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 107
structure length 333
sequence length 333
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07528 DZF DZF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4at8A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4at8A02
2ZH3A 4NXXA 3AQKA 8ICEA 8ICYA 9ICCA 4RPXA 2M2TA 4KLTA 3C18A 4EP7A 4R66A 5HR9A 1XSPA 3NYBA 5J2BA 4KLEA 4QZ9A 4KLFA 9ICNA 4NM1A 4LEVA 4JLZA 3C2MA 4MF8A 1ZQYA 4KLUA 1WOTA 8ICQA 4WC4A 3AQLA 4FHPA 9ICSA 1ZQJA 4S3NA 4M47A 1ZQUA 4FHVA 4QZCA 4RQ4A 8ICWA 3MBYA 1BPDA 4UAYA 3UXOA 4I27A 4O5KA 5J29A 4RPZA 4TUQA 4R64A 8ICAA 4Z6DA 3HWTA 4QZ8A 7ICMA 4LZDA 4E7XA 3PMNA 2ZH8A 5CB1A 5J0YA 9ICFA 3WFRE 4XQ8A 4EBJA 3RH4A 4YMMA 1ZQZA 5DDYA 4NLZA 4KLSA 1ZQVA 1XSNA 4KLJA 2ZHAA 4FHWA 4K9AA 4RWQA 8ICJA 5HRKA 4P4OA 5J2HA 3C2LA 3C5GA 4WC2A 2DVIA 5DKWA 5J0QA 3TFRA 3JPQA 1VJ7A 4I2HA 4UB4A 3B0YA 5D46A 3WFSC 2P66A 4PHDA 4DOCA 4IQWA 4I2AA 4ATBA 5CJ7A 1ZQIA 4WC1A 5F2VO 8ICKA 4EBKA 1MIVA 7ICPA 5J0TA 7ICFA 3OUYA 4RWPA 5TZVA 4UB2A 2BCVA 4KB6A 3H3AA 7ICTA 4MFCA 4KLGA 1ZQPA 3OVBA 4O6AA 3H39A 5HRLA 1R89A 3JPTA 1ZQDA 4AT9B 9ICQA 5J0PA 1ZQHA 1BPXA 3JPNA 4YD1A 1OU5A 2ZH6A 4DO9A 5CA7A 5HHHA 5J0RA 8ICLA 5J0XA 4GXKA 4I2GA 7ICKA 8ICBA 4M9NA 4UB5A 4KLOA 5DDMA 4MFAA 4AT7A 3K75D 5IIKA 4RT2A 4X0AA 1MIWA 5J0WA 5J2DA 5DB6A 4OAHA 4M04A 5J2FA 9ICLA 9ICBA 4MKPA 8ICXA 4NXZA 7ICUA 8ICVA 1ZQEA 4M9GA 7ICHA 9ICGA 4OAIZ 4TUSA 4K8VA 4NLNA 4X4SA 5J0UA 9ICOA 2BCSA 1RPLA 4M0AA 5HRGA 3MGIA 9ICEA 1ZQLA 4Z6FA 2PFOA 1UEVA 1BPEA 4TURA 2M2WA 3MDCA 4XUSA 4DOAA 1ZQSA 1ZQTA 4O68A 3LK9A 3GDXA 1ZQWA 1ZQCA 1Q78A 9ICRA 8ICHA 3V72A 5HRBA 4QZAA 5D4BA 4KM5A 4WCWA 4RQ5A 1ZQRA 2FMQA 4X4VA 4PHPA 4FHXA 5HRIA 4O69A 3MDAA 3AU6A 4K97A 3UPSA 7ICOA 3MGHA 3RH5A 9ICMA 4OAFA 3AUOA 2PFQA 4X4QA 2BPGA 3WFPA 5CHGA 1BPZA 4RT3A 2PBEA 2ZH4A 7ICEA 5J2EA 5BOMA 5CR0A 4UBCA 1MQ3A 3V7JA 1ZQNA 3JYYA 1KEJA 4TUPA 1TVAA 3RJKA 3WFQE 9ICXA 8ICIA 4PHAA 2ZH2A 4WOYA 5IIIA 2PXIA 2DR7A 3HJ4A 2BPCA 4RQ1A 3UXNA 5HHIA 4IQVA 7ICIA 2NRKA 1VFGA 4KLHA 4NKUA 4Z6EA 5J2JA 4I2CA 5DB9A 4LT6A 2O1PA 4WC0A 5HRFA 9ICAA 4FH3A 7ICQA 4JWNA 1JN3A 1ZQBA 1KNYA 2DR5A 1MQ2A 3TFSA 3RJGA 4IQTA 1R8CA 3OGUA 4NKTA 8ICOA 4I2EA 1NOMA 4K4HA 4X4OA 4ATBB 4F5NA 1PX5A 4XRHA 1ZJMA 4PGQA 4P4PA 1ZQKA 1KDHA 4O5EA 3OUYB 4Z6CA 3RJHA 4FHYA 4NXUA 8ICUA 2ZHBA 3UPQA 5J2CA 3B0XA 4UD4A 4AT9A 3C2KA 4I2DA 1JQRA 4RQ3A 3V7KA 4M9HA 3ISCA 2ISOA 2BCRA 7ICLA 4RQ8A 1TV9A 4F5QA 4QZEA 4GXIA 8ICPA 1ZQMA 7ICGA 2HHPA 2DRBA 4AT8A 2O5AA 5HRHA 4NXVA 4YMOA 3JPPA 4XA5A 9ICKA 5J2AA 4NY8A 8ICNA 2Q66A 4O67A 4K96A 2M2UA 4I2JA 3OVAA 2RFFA 4F5RA 9ICUA 3C66A 2DR9A 4RQ2A 5IIOA 2BE3A 4E8FA 5D49A 2PFNA 5HRDA 4UB1A 1ZQXA 5CP2A 4WC6A 4JLXA 4OAGA 1RZTA 4I28A 1JAJA 1MIYA 3UQ2A 3JZ0A 3C5FA 4KLQA 4LVSA 2W9MA 4KLMA 7ICVA 4LEWA 5IILA 4I2FA 4RPYA 3ISDA 4IG8A 4PGYA 4MFFA 3RH6A 1BPBA 5HC9A 7ICRA 3JPSA 4KLDA 2I9GA 5DBCA 3ISBA 2BPFA 8ICCA 5CWRA 4QZHA 5J2GA 4M9JA 4X4UA 1UETA 2FMPA 4K4IA 3UXPA 5IIJA 5DEDA 4NM2A 4NXTA 4F5OA 4X4TA 4LZGA 8ICFA 1ZQGA 4E80A 4NXWA 1V4AA 5DB8A 1UEUA 4YCXA 9ICIA 2DR8A 8ICRA 8ICMA 1HUZA 9ICHA 2ISPA 9ICTA 4I2BA 4I29A 4WC7A 5IINA 2BCUA 5BOLA 3HX0A 4WBZA 4X4RA 2PFPA 4QZGA 4RQ6A 4F5PA 4YD2A 2ID1A 4LEYA 4PPXA 9ICJA 5DBAA 3RJFA 5DECA 3AQMA 4PGXA 3RJJA 4IQUA 4P2HA 8ICZA 4RQ0A 4R63A 1TFYA 9ICVA 5J0SA 1ZQAA 4GXJA 4X4PA 3OV7A 4UAWA 1FA0A 8ICTA 4UB3A 4MF2A 4RQ7A 4K4GA 5EOZA 4I2IA 5J2KA 1ZQOA 4RWOA 5DBBA 4X4NA 1R8BA 1JMSA 5J0OA 2ZH5A 3H37A 4PH5A 4PHEA 4O9MA 5IIMA 3RJEA 1ZJNA 4UD5A 4RWNA 3HW8A 4UBBA 3HJ1A 4QZIA 4UAZA 3RJIA 1BPYA 3PMLA 5DB7A 2ZH1A 4YMNA 3UQ0A 1XSLA 1NO5A 1Q79A 3V7LA 2ZH9A 2IHMA 4X0BA 2ZH7A 7ICSA 8ICGA 1R8AA 3OVSA 9ICWA 3H38A 4QZDA 4WC3A 5J2IA 7ICNA 4M5DA 1ZQFA 4JWMA 4R65A 4XQ7A 3JPRA 4QZFA 3JPOA 3PNCA 4K98A 2VANA 4M9LA 4WBYA 4WC5A 2FMSA 3L9DA 5HREA 4AT7B 4O5CA 1YLQA 4DOBA 4NLKA 4AT8B 2DRAA 3LQCB 5BPCA 2GWSA 4M2YA 4FO6A 4KLIA 9ICPA 1F5AA 4K99A 4FH5A 4X5VA 4K9BA 1HUOA 3WFOA 2M2VA 2BCQA 3AU2A 4LEZA 3AQNA 8ICSA 4KLLA 3HIYA 1ZQQA 4P4MA 4YN4A 1TFWA 4QZBA 7ICJA
chains in the Genus database with same CATH superfamily
2ZH3A 4NXXA 3AQKA 8ICEA 8ICYA 9ICCA 4I0UA 4RPXA 2M2TA 4KLTA 4EP7A 3C18A 4R66A 5HR9A 1XSPA 3NYBA 5J2BA 4KLEA 4QZ9A 4KLFA 9ICNA 4NM1A 4LEVA 4JLZA 3C2MA 4MF8A 1ZQYA 4KLUA 1WOTA 8ICQA 4WC4A 3AQLA 4FHPA 9ICSA 1ZQJA 4S3NA 2BBHA 2HN2A 1ZQUA 4M47A 4FHVA 4QZCA 4RQ4A 8ICWA 3MBYA 1BPDA 4EGWA 4XJEA 4UAYA 3UXOA 4I27A 4O5KA 5J29A 4RPZA 4TUQA 4R64A 8ICAA 4Z6DA 3HWTA 4QZ8A 7ICMA 4LZDA 4E7XA 3PMNA 2ZH8A 5CB1A 5J0YA 9ICFA 3JCFA 3WFRE 4XQ8A 4EBJA 3RH4A 4YMMA 1ZQZA 5DDYA 2HN1A 4NLZA 4KLSA 1ZQVA 1XSNA 4KLJA 2ZHAA 4FHWA 4K9AA 4RWQA 8ICJA 5HRKA 4P4OA 5J2HA 3C2LA 3C5GA 2DVIA 4WC2A 5DKWA 5J0QA 3TFRA 3JPQA 1VJ7A 4I2HA 4UB4A 3B0YA 5D46A 3ER9B 3WFSC 2P66A 4PHDA 4DOCA 4IQWA 4I2AA 4ATBA 5CJ7A 1ZQIA 4WC1A 5F2VO 8ICKA 4EBKA 1MIVA 7ICPA 5J0TA 7ICFA 3OUYA 4RWPA 5TZVA 2GAFD 4UB2A 2BCVA 4KB6A 3H3AA 7ICTA 4MFCA 4KLGA 1ZQPA 3OVBA 5HRLA 4O6AA 3H39A 4HX0A 1R89A 3JPTA 1ZQDA 4AT9B 9ICQA 5J0PA 1ZQHA 1BPXA 3JPNA 4YD1A 1OU5A 2ZH6A 3K7DA 5CA7A 4DO9A 5HHHA 5J0RA 8ICLA 3CK6A 5J0XA 4GXKA 4I2GA 7ICKA 8ICBA 4M9NA 4UB5A 3ERCC 4KLOA 5DDMA 4MFAA 2IHOA 4AT7A 3K75D 5IIKA 4RT2A 4WH5A 4X0AA 1MIWA 5J0WA 5J2DA 2GA9D 5DB6A 4EEDA 4OAHA 4M04A 5J2FA 9ICLA 9ICBA 4MKPA 8ICXA 4NXZA 7ICUA 8ICVA 1ZQEA 4M9GA 7ICHA 9ICGA 4OAIZ 4TUSA 4K8VA 4NLNA 4X4SA 5J0UA 9ICOA 2BCSA 1RPLA 4M0AA 5HRGA 3MGIA 9ICEA 1ZQLA 4Z6FA 2PFOA 1UEVA 1BPEA 4TURA 2M2WA 3MDCA 4XUSA 4DOAA 1GPJA 1ZQSA 1ZQTA 4O68A 3LK9A 3GDXA 1ZQWA 1ZQCA 1Q78A 9ICRA 8ICHA 3V72A 5HRBA 4QZAA 5D4BA 4KM5A 4WCWA 4RQ5A 1ZQRA 2FMQA 4X4VA 4PHPA 4FHXA 5HRIA 4O69A 3MDAA 3AU6A 4K97A 3UPSA 7ICOA 3MGHA 2B51A 3RH5A 9ICMA 4OAFA 3AUOA 2PFQA 4X4QA 2BPGA 3WFPA 5CHGA 1BPZA 4RT3A 2PBEA 2ZH4A 7ICEA 5J2EA 5BOMA 5CR0A 4UBCA 2FCLA 1MQ3A 3V7JA 1ZQNA 3JYYA 1KEJA 4TUPA 1TVAA 3RJKA 3WFQE 9ICXA 8ICIA 5B3PA 4PHAA 2ZH2A 4WOYA 5IIIA 2PXIA 2DR7A 3HJ4A 2BPCA 4RQ1A 3UXNA 5HHIA 4IQVA 7ICIA 2NRKA 1VFGA 4NKUA 4KLHA 4Z6EA 5J2JA 4I2CA 5DB9A 4LT6A 5B3QA 2O1PA 4WC0A 5HRFA 9ICAA 4FH3A 7ICQA 4JWNA 1JN3A 1ZQBA 5CFTA 2DR5A 1KNYA 1MQ2A 3TFSA 3RJGA 4IQTA 1R8CA 3OGUA 4NKTA 8ICOA 4I2EA 1NOMA 3NWIA 4K4HA 4X4OA 4EV6A 4ATBB 4F5NA 1PX5A 4XRHA 1ZJMA 4PGQA 4P4PA 1ZQKA 1KDHA 4O5EA 3OUYB 5D62A 3NVOA 4Z6CA 3RJHA 4FHYA 4NXUA 8ICUA 2ZHBA 3UPQA 5J2CA 3B0XA 4UD4A 4AT9A 3C2KA 4I2DA 1JQRA 4RQ3A 3V7KA 4M9HA 3ISCA 2ISOA 2BCRA 7ICLA 4RQ8A 1TV9A 4F5QA 4QZEA 4GXIA 8ICPA 1ZQMA 7ICGA 2HHPA 2DRBA 4AT8A 2O5AA 5HRHA 4NXVA 4YMOA 3JPPA 4XA5A 9ICKA 5J2AA 4NY8A 8ICNA 2Q66A 4O67A 3NKUA 4K96A 2M2UA 3OWGA 3OVAA 4I2JA 2RFFA 4F5RA 9ICUA 3C66A 3EF2A 2DR9A 4RQ2A 5IIOA 5D63A 2BE3A 4E8FA 5D49A 2PFNA 5HRDA 4UB1A 1ZQXA 5CP2A 2BBJA 4WC6A 4JLXA 4OAGA 1RZTA 4I28A 1JAJA 1MIYA 3UQ2A 3JZ0A 3C5FA 4KLQA 4LVSA 5JTGA 2W9MA 4KLMA 7ICVA 4LEWA 5IILA 3MCRA 4I2FA 4RPYA 3ISDA 4IG8A 4PGYA 4MFFA 3RH6A 2EWRA 1BPBA 5HC9A 7ICRA 3JPSA 4KLDA 2I9GA 5DBCA 3ISBA 2BPFA 8ICCA 5CWRA 4QZHA 5J2GA 4M9JA 4X4UA 1UETA 2IUBA 2FMPA 4K4IA 3UXPA 5IIJA 4N7RA 5DEDA 4NM2A 4NXTA 4F5OA 4X4TA 4LZGA 8ICFA 1ZQGA 4E80A 4NXWA 1V4AA 3PHZA 5DB8A 1UEUA 4YCXA 9ICIA 2DR8A 8ICRA 8ICMA 1HUZA 9ICHA 2ISPA 9ICTA 2B56A 4I2BA 4I29A 5CHEA 4WC7A 5IINA 2BCUA 5BOLA 3HX0A 4WBZA 4X4RA 2PFPA 4QZGA 4RQ6A 4F5PA 4YD2A 2ID1A 4LEYA 4PPXA 9ICJA 5DBAA 3RJFA 5DECA 3AQMA 4PGXA 3RJJA 4IQUA 4P2HA 8ICZA 4RQ0A 4R63A 1TFYA 9ICVA 5J0SA 4WQKA 1ZQAA 4GXJA 4X4PA 3OV7A 4UAWA 1FA0A 8ICTA 4UB3A 4WQLA 4MF2A 4RQ7A 4K4GA 5EOZA 4I2IA 4X4NA 5J2KA 4RWOA 5DBBA 1ZQOA 1R8BA 2ZH5A 1JMSA 5J0OA 3H37A 4PH5A 4PHEA 4O9MA 5IIMA 3RJEA 5D61A 1ZJNA 4UD5A 4RWNA 3HW8A 4UBBA 3HJ1A 4QZIA 4UAZA 3RJIA 1BPYA 3PMLA 5DB7A 3ER8C 2ZH1A 4YMNA 3UQ0A 1XSLA 1Q79A 1NO5A 4EEBA 2ZH9A 3V7LA 2IHMA 4X0BA 2ZH7A 7ICSA 5CFSA 8ICGA 2B4VA 1R8AA 3OVSA 9ICWA 3H38A 4QZDA 4WC3A 5J2IA 7ICNA 4M5DA 1ZQFA 4JWMA 4R65A 4XQ7A 3JPRA 4QZFA 3JPOA 4FO1A 3PNCA 4K98A 2VANA 4M9LA 4WBYA 4WC5A 2FMSA 3L9DA 5HREA 4AT7B 4O5CA 1YLQA 4DOBA 4NLKA 4AT8B 2DRAA 3LQCB 5CFUA 5BPCA 2GWSA 4M2YA 4FO6A 4KLIA 9ICPA 1F5AA 4K99A 4FH5A 4X5VA 4K9BA 1HUOA 3WFOA 2M2VA 2BCQA 3AU2A 4LEZA 3AQNA 8ICSA 4KLLA 3HIYA 1ZQQA 4P4MA 4YN4A 1TFWA 4QZBA 7ICJA
chains in the Genus database with same CATH topology
2ZH3A 4NXXA 3AQKA 8ICEA 8ICYA 9ICCA 4RPXA 2M2TA 4KLTA 4EP7A 3C18A 4R66A 5HR9A 1XSPA 3NYBA 5J2BA 4KLEA 4QZ9A 4KLFA 9ICNA 4NM1A 4LEVA 4JLZA 3C2MA 4MF8A 1ZQYA 4KLUA 1WOTA 8ICQA 4WC4A 3AQLA 4FHPA 9ICSA 1ZQJA 4S3NA 4M47A 1ZQUA 4FHVA 4QZCA 4RQ4A 8ICWA 3MBYA 1BPDA 4UAYA 3UXOA 4I27A 4O5KA 5J29A 4RPZA 4TUQA 4R64A 8ICAA 4Z6DA 3HWTA 4QZ8A 7ICMA 4LZDA 4E7XA 3PMNA 2ZH8A 5CB1A 5J0YA 9ICFA 3WFRE 4XQ8A 4EBJA 3RH4A 4YMMA 1ZQZA 5DDYA 4NLZA 4KLSA 1ZQVA 1XSNA 4KLJA 2ZHAA 4FHWA 4K9AA 4RWQA 8ICJA 5HRKA 4P4OA 5J2HA 3C2LA 3C5GA 2DVIA 4WC2A 5DKWA 5J0QA 3TFRA 3JPQA 1VJ7A 4I2HA 4UB4A 3B0YA 5D46A 3WFSC 2P66A 4PHDA 4DOCA 4IQWA 4I2AA 4ATBA 5CJ7A 1ZQIA 4WC1A 5F2VO 8ICKA 4EBKA 1MIVA 7ICPA 5J0TA 7ICFA 3OUYA 4RWPA 5TZVA 4UB2A 2BCVA 4KB6A 3H3AA 7ICTA 4MFCA 4KLGA 1ZQPA 3OVBA 5HRLA 4O6AA 3H39A 1R89A 3JPTA 1ZQDA 4AT9B 9ICQA 5J0PA 1ZQHA 1BPXA 3JPNA 4YD1A 1OU5A 2ZH6A 4DO9A 5CA7A 5HHHA 5J0RA 8ICLA 5J0XA 4GXKA 4I2GA 7ICKA 8ICBA 4M9NA 4UB5A 4KLOA 5DDMA 4MFAA 4AT7A 3K75D 5IIKA 4RT2A 4X0AA 1MIWA 5J0WA 5J2DA 5DB6A 4OAHA 4M04A 5J2FA 9ICLA 9ICBA 4MKPA 8ICXA 4NXZA 7ICUA 8ICVA 1ZQEA 4M9GA 7ICHA 9ICGA 4OAIZ 4TUSA 4K8VA 4NLNA 4X4SA 5J0UA 9ICOA 2BCSA 1RPLA 4M0AA 5HRGA 3MGIA 9ICEA 1ZQLA 4Z6FA 2PFOA 1UEVA 1BPEA 4TURA 2M2WA 3MDCA 4XUSA 4DOAA 1ZQSA 1ZQTA 4O68A 3LK9A 3GDXA 1ZQWA 1ZQCA 1Q78A 9ICRA 8ICHA 3V72A 5HRBA 4QZAA 5D4BA 4KM5A 4WCWA 4RQ5A 1ZQRA 2FMQA 4X4VA 4PHPA 4FHXA 5HRIA 4O69A 3MDAA 3AU6A 4K97A 3UPSA 7ICOA 3MGHA 2B51A 3RH5A 9ICMA 4OAFA 3AUOA 2PFQA 4X4QA 2BPGA 3WFPA 5CHGA 1BPZA 4RT3A 2PBEA 2ZH4A 7ICEA 5J2EA 5BOMA 5CR0A 4UBCA 1MQ3A 3V7JA 1ZQNA 3JYYA 1KEJA 4TUPA 1TVAA 3RJKA 3WFQE 9ICXA 8ICIA 4PHAA 2ZH2A 4WOYA 5IIIA 2PXIA 2DR7A 3HJ4A 2BPCA 4RQ1A 3UXNA 5HHIA 4IQVA 7ICIA 2NRKA 1VFGA 4NKUA 4KLHA 4Z6EA 5J2JA 4I2CA 5DB9A 4LT6A 2O1PA 4WC0A 5HRFA 9ICAA 4FH3A 7ICQA 4JWNA 1JN3A 1ZQBA 2DR5A 1KNYA 1MQ2A 3TFSA 3RJGA 4IQTA 1R8CA 3OGUA 4NKTA 8ICOA 4I2EA 1NOMA 4K4HA 4X4OA 4ATBB 4F5NA 1PX5A 4XRHA 1ZJMA 4PGQA 4P4PA 1ZQKA 1KDHA 4O5EA 3OUYB 4Z6CA 3RJHA 4FHYA 4NXUA 8ICUA 2ZHBA 3UPQA 5J2CA 3B0XA 4UD4A 4AT9A 3C2KA 4I2DA 1JQRA 4RQ3A 3V7KA 4M9HA 3ISCA 2ISOA 2BCRA 7ICLA 4RQ8A 1TV9A 4F5QA 4QZEA 4GXIA 8ICPA 1ZQMA 7ICGA 2HHPA 2DRBA 4AT8A 2O5AA 5HRHA 4NXVA 4YMOA 3JPPA 4XA5A 9ICKA 5J2AA 4NY8A 8ICNA 2Q66A 4O67A 4K96A 2M2UA 4I2JA 3OVAA 2RFFA 4F5RA 9ICUA 3C66A 2DR9A 4RQ2A 5IIOA 2BE3A 4E8FA 5D49A 2PFNA 5HRDA 4UB1A 1ZQXA 5CP2A 4WC6A 4JLXA 4OAGA 1RZTA 4I28A 1JAJA 1MIYA 3UQ2A 3JZ0A 3C5FA 4KLQA 4LVSA 2W9MA 4KLMA 7ICVA 4LEWA 5IILA 4I2FA 4RPYA 3ISDA 4IG8A 4PGYA 4MFFA 3RH6A 1BPBA 5HC9A 7ICRA 3JPSA 4KLDA 2I9GA 5DBCA 3ISBA 2BPFA 8ICCA 5CWRA 4QZHA 5J2GA 4M9JA 4X4UA 1UETA 2FMPA 4K4IA 3UXPA 5IIJA 5DEDA 4NM2A 4NXTA 4F5OA 4X4TA 4LZGA 8ICFA 1ZQGA 4E80A 4NXWA 1V4AA 5DB8A 1UEUA 4YCXA 9ICIA 2DR8A 8ICRA 8ICMA 1HUZA 9ICHA 2ISPA 9ICTA 2B56A 4I2BA 4I29A 4WC7A 5IINA 2BCUA 5BOLA 3HX0A 4WBZA 4X4RA 2PFPA 4QZGA 4RQ6A 4F5PA 4YD2A 2ID1A 4LEYA 4PPXA 9ICJA 5DBAA 3RJFA 5DECA 3AQMA 4PGXA 3RJJA 4IQUA 4P2HA 8ICZA 4RQ0A 4R63A 1TFYA 9ICVA 5J0SA 1ZQAA 4GXJA 4X4PA 3OV7A 4UAWA 1FA0A 8ICTA 4UB3A 4MF2A 4RQ7A 4K4GA 5EOZA 4I2IA 4X4NA 5J2KA 4RWOA 5DBBA 1ZQOA 1R8BA 2ZH5A 1JMSA 5J0OA 3H37A 4PH5A 4PHEA 4O9MA 5IIMA 3RJEA 1ZJNA 4UD5A 4RWNA 3HW8A 4UBBA 3HJ1A 4QZIA 4UAZA 3RJIA 1BPYA 3PMLA 5DB7A 2ZH1A 4YMNA 3UQ0A 1XSLA 1Q79A 1NO5A 2ZH9A 3V7LA 2IHMA 4X0BA 2ZH7A 7ICSA 8ICGA 2B4VA 1R8AA 3OVSA 9ICWA 3H38A 4QZDA 4WC3A 5J2IA 7ICNA 4M5DA 1ZQFA 4JWMA 4R65A 4XQ7A 3JPRA 4QZFA 3JPOA 3PNCA 4K98A 2VANA 4M9LA 4WBYA 4WC5A 2FMSA 3L9DA 5HREA 4AT7B 4O5CA 1YLQA 4DOBA 4NLKA 4AT8B 2DRAA 3LQCB 5BPCA 2GWSA 4M2YA 4FO6A 4KLIA 9ICPA 1F5AA 4K99A 4FH5A 4X5VA 4K9BA 1HUOA 3WFOA 2M2VA 2BCQA 3AU2A 4LEZA 3AQNA 8ICSA 4KLLA 3HIYA 1ZQQA 4P4MA 4YN4A 1TFWA 4QZBA 7ICJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZH3 A;  4NXX A;  3AQK A;  8ICE A;  8ICY A;  9ICC A;  4RPX A;  2M2T A;  4KLT A;  3C18 A;  4EP7 A;  4R66 A;  5HR9 A;  1XSP A;  3NYB A;  5J2B A;  4KLE A;  4QZ9 A;  4KLF A;  9ICN A;  4NM1 A;  4LEV A;  4JLZ A;  3C2M A;  4MF8 A;  1ZQY A;  4KLU A;  1WOT A;  8ICQ A;  4WC4 A;  3AQL A;  4FHP A;  9ICS A;  1ZQJ A;  4S3N A;  4M47 A;  1ZQU A;  4FHV A;  4QZC A;  4RQ4 A;  8ICW A;  3MBY A;  1BPD A;  4UAY A;  3UXO A;  4I27 A;  4O5K A;  5J29 A;  4RPZ A;  4TUQ A;  4R64 A;  8ICA A;  4Z6D A;  3HWT A;  4QZ8 A;  7ICM A;  4LZD A;  4E7X A;  3PMN A;  2ZH8 A;  5CB1 A;  5J0Y A;  9ICF A;  3WFR E;  4XQ8 A;  4EBJ A;  3RH4 A;  4YMM A;  1ZQZ A;  5DDY A;  4NLZ A;  4KLS A;  1ZQV A;  1XSN A;  4KLJ A;  2ZHA A;  4FHW A;  4K9A A;  4RWQ A;  8ICJ A;  5HRK A;  4P4O A;  5J2H A;  3C2L A;  3C5G A;  4WC2 A;  2DVI A;  5DKW A;  5J0Q A;  3TFR A;  3JPQ A;  1VJ7 A;  4I2H A;  4UB4 A;  3B0Y A;  5D46 A;  3WFS C;  2P66 A;  4PHD A;  4DOC A;  4IQW A;  4I2A A;  4ATB A;  5CJ7 A;  1ZQI A;  4WC1 A;  5F2V O;  8ICK A;  4EBK A;  1MIV A;  7ICP A;  5J0T A;  7ICF A;  3OUY A;  4RWP A;  5TZV A;  4UB2 A;  2BCV A;  4KB6 A;  3H3A A;  7ICT A;  4MFC A;  4KLG A;  1ZQP A;  3OVB A;  4O6A A;  3H39 A;  5HRL A;  1R89 A;  3JPT A;  1ZQD A;  4AT9 B;  9ICQ A;  5J0P A;  1ZQH A;  1BPX A;  3JPN A;  4YD1 A;  1OU5 A;  2ZH6 A;  4DO9 A;  5CA7 A;  5HHH A;  5J0R A;  8ICL A;  5J0X A;  4GXK A;  4I2G A;  7ICK A;  8ICB A;  4M9N A;  4UB5 A;  4KLO A;  5DDM A;  4MFA A;  4AT7 A;  3K75 D;  5IIK A;  4RT2 A;  4X0A A;  1MIW A;  5J0W A;  5J2D A;  5DB6 A;  4OAH A;  4M04 A;  5J2F A;  9ICL A;  9ICB A;  4MKP A;  8ICX A;  4NXZ A;  7ICU A;  8ICV A;  1ZQE A;  4M9G A;  7ICH A;  9ICG A;  4OAI Z;  4TUS A;  4K8V A;  4NLN A;  4X4S A;  5J0U A;  9ICO A;  2BCS A;  1RPL A;  4M0A A;  5HRG A;  3MGI A;  9ICE A;  1ZQL A;  4Z6F A;  2PFO A;  1UEV A;  1BPE A;  4TUR A;  2M2W A;  3MDC A;  4XUS A;  4DOA A;  1ZQS A;  1ZQT A;  4O68 A;  3LK9 A;  3GDX A;  1ZQW A;  1ZQC A;  1Q78 A;  9ICR A;  8ICH A;  3V72 A;  5HRB A;  4QZA A;  5D4B A;  4KM5 A;  4WCW A;  4RQ5 A;  1ZQR A;  2FMQ A;  4X4V A;  4PHP A;  4FHX A;  5HRI A;  4O69 A;  3MDA A;  3AU6 A;  4K97 A;  3UPS A;  7ICO A;  3MGH A;  3RH5 A;  9ICM A;  4OAF A;  3AUO A;  2PFQ A;  4X4Q A;  2BPG A;  3WFP A;  5CHG A;  1BPZ A;  4RT3 A;  2PBE A;  2ZH4 A;  7ICE A;  5J2E A;  5BOM A;  5CR0 A;  4UBC A;  1MQ3 A;  3V7J A;  1ZQN A;  3JYY A;  1KEJ A;  4TUP A;  1TVA A;  3RJK A;  3WFQ E;  9ICX A;  8ICI A;  4PHA A;  2ZH2 A;  4WOY A;  5III A;  2PXI A;  2DR7 A;  3HJ4 A;  2BPC A;  4RQ1 A;  3UXN A;  5HHI A;  4IQV A;  7ICI A;  2NRK A;  1VFG A;  4KLH A;  4NKU A;  4Z6E A;  5J2J A;  4I2C A;  5DB9 A;  4LT6 A;  2O1P A;  4WC0 A;  5HRF A;  9ICA A;  4FH3 A;  7ICQ A;  4JWN A;  1JN3 A;  1ZQB A;  1KNY A;  2DR5 A;  1MQ2 A;  3TFS A;  3RJG A;  4IQT A;  1R8C A;  3OGU A;  4NKT A;  8ICO A;  4I2E A;  1NOM A;  4K4H A;  4X4O A;  4ATB B;  4F5N A;  1PX5 A;  4XRH A;  1ZJM A;  4PGQ A;  4P4P A;  1ZQK A;  1KDH A;  4O5E A;  3OUY B;  4Z6C A;  3RJH A;  4FHY A;  4NXU A;  8ICU A;  2ZHB A;  3UPQ A;  5J2C A;  3B0X A;  4UD4 A;  4AT9 A;  3C2K A;  4I2D A;  1JQR A;  4RQ3 A;  3V7K A;  4M9H A;  3ISC A;  2ISO A;  2BCR A;  7ICL A;  4RQ8 A;  1TV9 A;  4F5Q A;  4QZE A;  4GXI A;  8ICP A;  1ZQM A;  7ICG A;  2HHP A;  2DRB A;  4AT8 A;  2O5A A;  5HRH A;  4NXV A;  4YMO A;  3JPP A;  4XA5 A;  9ICK A;  5J2A A;  4NY8 A;  8ICN A;  2Q66 A;  4O67 A;  4K96 A;  2M2U A;  4I2J A;  3OVA A;  2RFF A;  4F5R A;  9ICU A;  3C66 A;  2DR9 A;  4RQ2 A;  5IIO A;  2BE3 A;  4E8F A;  5D49 A;  2PFN A;  5HRD A;  4UB1 A;  1ZQX A;  5CP2 A;  4WC6 A;  4JLX A;  4OAG A;  1RZT A;  4I28 A;  1JAJ A;  1MIY A;  3UQ2 A;  3JZ0 A;  3C5F A;  4KLQ A;  4LVS A;  2W9M A;  4KLM A;  7ICV A;  4LEW A;  5IIL A;  4I2F A;  4RPY A;  3ISD A;  4IG8 A;  4PGY A;  4MFF A;  3RH6 A;  1BPB A;  5HC9 A;  7ICR A;  3JPS A;  4KLD A;  2I9G A;  5DBC A;  3ISB A;  2BPF A;  8ICC A;  5CWR A;  4QZH A;  5J2G A;  4M9J A;  4X4U A;  1UET A;  2FMP A;  4K4I A;  3UXP A;  5IIJ A;  5DED A;  4NM2 A;  4NXT A;  4F5O A;  4X4T A;  4LZG A;  8ICF A;  1ZQG A;  4E80 A;  4NXW A;  1V4A A;  5DB8 A;  1UEU A;  4YCX A;  9ICI A;  2DR8 A;  8ICR A;  8ICM A;  1HUZ A;  9ICH A;  2ISP A;  9ICT A;  4I2B A;  4I29 A;  4WC7 A;  5IIN A;  2BCU A;  5BOL A;  3HX0 A;  4WBZ A;  4X4R A;  2PFP A;  4QZG A;  4RQ6 A;  4F5P A;  4YD2 A;  2ID1 A;  4LEY A;  4PPX A;  9ICJ A;  5DBA A;  3RJF A;  5DEC A;  3AQM A;  4PGX A;  3RJJ A;  4IQU A;  4P2H A;  8ICZ A;  4RQ0 A;  4R63 A;  1TFY A;  9ICV A;  5J0S A;  1ZQA A;  4GXJ A;  4X4P A;  3OV7 A;  4UAW A;  1FA0 A;  8ICT A;  4UB3 A;  4MF2 A;  4RQ7 A;  4K4G A;  5EOZ A;  4I2I A;  5J2K A;  1ZQO A;  4RWO A;  5DBB A;  4X4N A;  1R8B A;  1JMS A;  5J0O A;  2ZH5 A;  3H37 A;  4PH5 A;  4PHE A;  4O9M A;  5IIM A;  3RJE A;  1ZJN A;  4UD5 A;  4RWN A;  3HW8 A;  4UBB A;  3HJ1 A;  4QZI A;  4UAZ A;  3RJI A;  1BPY A;  3PML A;  5DB7 A;  2ZH1 A;  4YMN A;  3UQ0 A;  1XSL A;  1NO5 A;  1Q79 A;  3V7L A;  2ZH9 A;  2IHM A;  4X0B A;  2ZH7 A;  7ICS A;  8ICG A;  1R8A A;  3OVS A;  9ICW A;  3H38 A;  4QZD A;  4WC3 A;  5J2I A;  7ICN A;  4M5D A;  1ZQF A;  4JWM A;  4R65 A;  4XQ7 A;  3JPR A;  4QZF A;  3JPO A;  3PNC A;  4K98 A;  2VAN A;  4M9L A;  4WBY A;  4WC5 A;  2FMS A;  3L9D A;  5HRE A;  4AT7 B;  4O5C A;  1YLQ A;  4DOB A;  4NLK A;  4AT8 B;  2DRA A;  3LQC B;  5BPC A;  2GWS A;  4M2Y A;  4FO6 A;  4KLI A;  9ICP A;  1F5A A;  4K99 A;  4FH5 A;  4X5V A;  4K9B A;  1HUO A;  3WFO A;  2M2V A;  2BCQ A;  3AU2 A;  4LEZ A;  3AQN A;  8ICS A;  4KLL A;  3HIY A;  1ZQQ A;  4P4M A;  4YN4 A;  1TFW A;  4QZB A;  7ICJ A; 
#chains in the Genus database with same CATH topology
 2ZH3 A;  4NXX A;  3AQK A;  8ICE A;  8ICY A;  9ICC A;  4I0U A;  4RPX A;  2M2T A;  4KLT A;  4EP7 A;  3C18 A;  4R66 A;  5HR9 A;  1XSP A;  3NYB A;  5J2B A;  4KLE A;  4QZ9 A;  4KLF A;  9ICN A;  4NM1 A;  4LEV A;  4JLZ A;  3C2M A;  4MF8 A;  1ZQY A;  4KLU A;  1WOT A;  8ICQ A;  4WC4 A;  3AQL A;  4FHP A;  9ICS A;  1ZQJ A;  4S3N A;  2BBH A;  2HN2 A;  1ZQU A;  4M47 A;  4FHV A;  4QZC A;  4RQ4 A;  8ICW A;  3MBY A;  1BPD A;  4EGW A;  4XJE A;  4UAY A;  3UXO A;  4I27 A;  4O5K A;  5J29 A;  4RPZ A;  4TUQ A;  4R64 A;  8ICA A;  4Z6D A;  3HWT A;  4QZ8 A;  7ICM A;  4LZD A;  4E7X A;  3PMN A;  2ZH8 A;  5CB1 A;  5J0Y A;  9ICF A;  3JCF A;  3WFR E;  4XQ8 A;  4EBJ A;  3RH4 A;  4YMM A;  1ZQZ A;  5DDY A;  2HN1 A;  4NLZ A;  4KLS A;  1ZQV A;  1XSN A;  4KLJ A;  2ZHA A;  4FHW A;  4K9A A;  4RWQ A;  8ICJ A;  5HRK A;  4P4O A;  5J2H A;  3C2L A;  3C5G A;  2DVI A;  4WC2 A;  5DKW A;  5J0Q A;  3TFR A;  3JPQ A;  1VJ7 A;  4I2H A;  4UB4 A;  3B0Y A;  5D46 A;  3ER9 B;  3WFS C;  2P66 A;  4PHD A;  4DOC A;  4IQW A;  4I2A A;  4ATB A;  5CJ7 A;  1ZQI A;  4WC1 A;  5F2V O;  8ICK A;  4EBK A;  1MIV A;  7ICP A;  5J0T A;  7ICF A;  3OUY A;  4RWP A;  5TZV A;  2GAF D;  4UB2 A;  2BCV A;  4KB6 A;  3H3A A;  7ICT A;  4MFC A;  4KLG A;  1ZQP A;  3OVB A;  5HRL A;  4O6A A;  3H39 A;  4HX0 A;  1R89 A;  3JPT A;  1ZQD A;  4AT9 B;  9ICQ A;  5J0P A;  1ZQH A;  1BPX A;  3JPN A;  4YD1 A;  1OU5 A;  2ZH6 A;  3K7D A;  5CA7 A;  4DO9 A;  5HHH A;  5J0R A;  8ICL A;  3CK6 A;  5J0X A;  4GXK A;  4I2G A;  7ICK A;  8ICB A;  4M9N A;  4UB5 A;  3ERC C;  4KLO A;  5DDM A;  4MFA A;  2IHO A;  4AT7 A;  3K75 D;  5IIK A;  4RT2 A;  4WH5 A;  4X0A A;  1MIW A;  5J0W A;  5J2D A;  2GA9 D;  5DB6 A;  4EED A;  4OAH A;  4M04 A;  5J2F A;  9ICL A;  9ICB A;  4MKP A;  8ICX A;  4NXZ A;  7ICU A;  8ICV A;  1ZQE A;  4M9G A;  7ICH A;  9ICG A;  4OAI Z;  4TUS A;  4K8V A;  4NLN A;  4X4S A;  5J0U A;  9ICO A;  2BCS A;  1RPL A;  4M0A A;  5HRG A;  3MGI A;  9ICE A;  1ZQL A;  4Z6F A;  2PFO A;  1UEV A;  1BPE A;  4TUR A;  2M2W A;  3MDC A;  4XUS A;  4DOA A;  1GPJ A;  1ZQS A;  1ZQT A;  4O68 A;  3LK9 A;  3GDX A;  1ZQW A;  1ZQC A;  1Q78 A;  9ICR A;  8ICH A;  3V72 A;  5HRB A;  4QZA A;  5D4B A;  4KM5 A;  4WCW A;  4RQ5 A;  1ZQR A;  2FMQ A;  4X4V A;  4PHP A;  4FHX A;  5HRI A;  4O69 A;  3MDA A;  3AU6 A;  4K97 A;  3UPS A;  7ICO A;  3MGH A;  2B51 A;  3RH5 A;  9ICM A;  4OAF A;  3AUO A;  2PFQ A;  4X4Q A;  2BPG A;  3WFP A;  5CHG A;  1BPZ A;  4RT3 A;  2PBE A;  2ZH4 A;  7ICE A;  5J2E A;  5BOM A;  5CR0 A;  4UBC A;  2FCL A;  1MQ3 A;  3V7J A;  1ZQN A;  3JYY A;  1KEJ A;  4TUP A;  1TVA A;  3RJK A;  3WFQ E;  9ICX A;  8ICI A;  5B3P A;  4PHA A;  2ZH2 A;  4WOY A;  5III A;  2PXI A;  2DR7 A;  3HJ4 A;  2BPC A;  4RQ1 A;  3UXN A;  5HHI A;  4IQV A;  7ICI A;  2NRK A;  1VFG A;  4NKU A;  4KLH A;  4Z6E A;  5J2J A;  4I2C A;  5DB9 A;  4LT6 A;  5B3Q A;  2O1P A;  4WC0 A;  5HRF A;  9ICA A;  4FH3 A;  7ICQ A;  4JWN A;  1JN3 A;  1ZQB A;  5CFT A;  2DR5 A;  1KNY A;  1MQ2 A;  3TFS A;  3RJG A;  4IQT A;  1R8C A;  3OGU A;  4NKT A;  8ICO A;  4I2E A;  1NOM A;  3NWI A;  4K4H A;  4X4O A;  4EV6 A;  4ATB B;  4F5N A;  1PX5 A;  4XRH A;  1ZJM A;  4PGQ A;  4P4P A;  1ZQK A;  1KDH A;  4O5E A;  3OUY B;  5D62 A;  3NVO A;  4Z6C A;  3RJH A;  4FHY A;  4NXU A;  8ICU A;  2ZHB A;  3UPQ A;  5J2C A;  3B0X A;  4UD4 A;  4AT9 A;  3C2K A;  4I2D A;  1JQR A;  4RQ3 A;  3V7K A;  4M9H A;  3ISC A;  2ISO A;  2BCR A;  7ICL A;  4RQ8 A;  1TV9 A;  4F5Q A;  4QZE A;  4GXI A;  8ICP A;  1ZQM A;  7ICG A;  2HHP A;  2DRB A;  4AT8 A;  2O5A A;  5HRH A;  4NXV A;  4YMO A;  3JPP A;  4XA5 A;  9ICK A;  5J2A A;  4NY8 A;  8ICN A;  2Q66 A;  4O67 A;  3NKU A;  4K96 A;  2M2U A;  3OWG A;  3OVA A;  4I2J A;  2RFF A;  4F5R A;  9ICU A;  3C66 A;  3EF2 A;  2DR9 A;  4RQ2 A;  5IIO A;  5D63 A;  2BE3 A;  4E8F A;  5D49 A;  2PFN A;  5HRD A;  4UB1 A;  1ZQX A;  5CP2 A;  2BBJ A;  4WC6 A;  4JLX A;  4OAG A;  1RZT A;  4I28 A;  1JAJ A;  1MIY A;  3UQ2 A;  3JZ0 A;  3C5F A;  4KLQ A;  4LVS A;  5JTG A;  2W9M A;  4KLM A;  7ICV A;  4LEW A;  5IIL A;  3MCR A;  4I2F A;  4RPY A;  3ISD A;  4IG8 A;  4PGY A;  4MFF A;  3RH6 A;  2EWR A;  1BPB A;  5HC9 A;  7ICR A;  3JPS A;  4KLD A;  2I9G A;  5DBC A;  3ISB A;  2BPF A;  8ICC A;  5CWR A;  4QZH A;  5J2G A;  4M9J A;  4X4U A;  1UET A;  2IUB A;  2FMP A;  4K4I A;  3UXP A;  5IIJ A;  4N7R A;  5DED A;  4NM2 A;  4NXT A;  4F5O A;  4X4T A;  4LZG A;  8ICF A;  1ZQG A;  4E80 A;  4NXW A;  1V4A A;  3PHZ A;  5DB8 A;  1UEU A;  4YCX A;  9ICI A;  2DR8 A;  8ICR A;  8ICM A;  1HUZ A;  9ICH A;  2ISP A;  9ICT A;  2B56 A;  4I2B A;  4I29 A;  5CHE A;  4WC7 A;  5IIN A;  2BCU A;  5BOL A;  3HX0 A;  4WBZ A;  4X4R A;  2PFP A;  4QZG A;  4RQ6 A;  4F5P A;  4YD2 A;  2ID1 A;  4LEY A;  4PPX A;  9ICJ A;  5DBA A;  3RJF A;  5DEC A;  3AQM A;  4PGX A;  3RJJ A;  4IQU A;  4P2H A;  8ICZ A;  4RQ0 A;  4R63 A;  1TFY A;  9ICV A;  5J0S A;  4WQK A;  1ZQA A;  4GXJ A;  4X4P A;  3OV7 A;  4UAW A;  1FA0 A;  8ICT A;  4UB3 A;  4WQL A;  4MF2 A;  4RQ7 A;  4K4G A;  5EOZ A;  4I2I A;  4X4N A;  5J2K A;  4RWO A;  5DBB A;  1ZQO A;  1R8B A;  2ZH5 A;  1JMS A;  5J0O A;  3H37 A;  4PH5 A;  4PHE A;  4O9M A;  5IIM A;  3RJE A;  5D61 A;  1ZJN A;  4UD5 A;  4RWN A;  3HW8 A;  4UBB A;  3HJ1 A;  4QZI A;  4UAZ A;  3RJI A;  1BPY A;  3PML A;  5DB7 A;  3ER8 C;  2ZH1 A;  4YMN A;  3UQ0 A;  1XSL A;  1Q79 A;  1NO5 A;  4EEB A;  2ZH9 A;  3V7L A;  2IHM A;  4X0B A;  2ZH7 A;  7ICS A;  5CFS A;  8ICG A;  2B4V A;  1R8A A;  3OVS A;  9ICW A;  3H38 A;  4QZD A;  4WC3 A;  5J2I A;  7ICN A;  4M5D A;  1ZQF A;  4JWM A;  4R65 A;  4XQ7 A;  3JPR A;  4QZF A;  3JPO A;  4FO1 A;  3PNC A;  4K98 A;  2VAN A;  4M9L A;  4WBY A;  4WC5 A;  2FMS A;  3L9D A;  5HRE A;  4AT7 B;  4O5C A;  1YLQ A;  4DOB A;  4NLK A;  4AT8 B;  2DRA A;  3LQC B;  5CFU A;  5BPC A;  2GWS A;  4M2Y A;  4FO6 A;  4KLI A;  9ICP A;  1F5A A;  4K99 A;  4FH5 A;  4X5V A;  4K9B A;  1HUO A;  3WFO A;  2M2V A;  2BCQ A;  3AU2 A;  4LEZ A;  3AQN A;  8ICS A;  4KLL A;  3HIY A;  1ZQQ A;  4P4M A;  4YN4 A;  1TFW A;  4QZB A;  7ICJ A; 
#chains in the Genus database with same CATH homology
 2ZH3 A;  4NXX A;  3AQK A;  8ICE A;  8ICY A;  9ICC A;  4RPX A;  2M2T A;  4KLT A;  4EP7 A;  3C18 A;  4R66 A;  5HR9 A;  1XSP A;  3NYB A;  5J2B A;  4KLE A;  4QZ9 A;  4KLF A;  9ICN A;  4NM1 A;  4LEV A;  4JLZ A;  3C2M A;  4MF8 A;  1ZQY A;  4KLU A;  1WOT A;  8ICQ A;  4WC4 A;  3AQL A;  4FHP A;  9ICS A;  1ZQJ A;  4S3N A;  4M47 A;  1ZQU A;  4FHV A;  4QZC A;  4RQ4 A;  8ICW A;  3MBY A;  1BPD A;  4UAY A;  3UXO A;  4I27 A;  4O5K A;  5J29 A;  4RPZ A;  4TUQ A;  4R64 A;  8ICA A;  4Z6D A;  3HWT A;  4QZ8 A;  7ICM A;  4LZD A;  4E7X A;  3PMN A;  2ZH8 A;  5CB1 A;  5J0Y A;  9ICF A;  3WFR E;  4XQ8 A;  4EBJ A;  3RH4 A;  4YMM A;  1ZQZ A;  5DDY A;  4NLZ A;  4KLS A;  1ZQV A;  1XSN A;  4KLJ A;  2ZHA A;  4FHW A;  4K9A A;  4RWQ A;  8ICJ A;  5HRK A;  4P4O A;  5J2H A;  3C2L A;  3C5G A;  2DVI A;  4WC2 A;  5DKW A;  5J0Q A;  3TFR A;  3JPQ A;  1VJ7 A;  4I2H A;  4UB4 A;  3B0Y A;  5D46 A;  3WFS C;  2P66 A;  4PHD A;  4DOC A;  4IQW A;  4I2A A;  4ATB A;  5CJ7 A;  1ZQI A;  4WC1 A;  5F2V O;  8ICK A;  4EBK A;  1MIV A;  7ICP A;  5J0T A;  7ICF A;  3OUY A;  4RWP A;  5TZV A;  4UB2 A;  2BCV A;  4KB6 A;  3H3A A;  7ICT A;  4MFC A;  4KLG A;  1ZQP A;  3OVB A;  5HRL A;  4O6A A;  3H39 A;  1R89 A;  3JPT A;  1ZQD A;  4AT9 B;  9ICQ A;  5J0P A;  1ZQH A;  1BPX A;  3JPN A;  4YD1 A;  1OU5 A;  2ZH6 A;  4DO9 A;  5CA7 A;  5HHH A;  5J0R A;  8ICL A;  5J0X A;  4GXK A;  4I2G A;  7ICK A;  8ICB A;  4M9N A;  4UB5 A;  4KLO A;  5DDM A;  4MFA A;  4AT7 A;  3K75 D;  5IIK A;  4RT2 A;  4X0A A;  1MIW A;  5J0W A;  5J2D A;  5DB6 A;  4OAH A;  4M04 A;  5J2F A;  9ICL A;  9ICB A;  4MKP A;  8ICX A;  4NXZ A;  7ICU A;  8ICV A;  1ZQE A;  4M9G A;  7ICH A;  9ICG A;  4OAI Z;  4TUS A;  4K8V A;  4NLN A;  4X4S A;  5J0U A;  9ICO A;  2BCS A;  1RPL A;  4M0A A;  5HRG A;  3MGI A;  9ICE A;  1ZQL A;  4Z6F A;  2PFO A;  1UEV A;  1BPE A;  4TUR A;  2M2W A;  3MDC A;  4XUS A;  4DOA A;  1ZQS A;  1ZQT A;  4O68 A;  3LK9 A;  3GDX A;  1ZQW A;  1ZQC A;  1Q78 A;  9ICR A;  8ICH A;  3V72 A;  5HRB A;  4QZA A;  5D4B A;  4KM5 A;  4WCW A;  4RQ5 A;  1ZQR A;  2FMQ A;  4X4V A;  4PHP A;  4FHX A;  5HRI A;  4O69 A;  3MDA A;  3AU6 A;  4K97 A;  3UPS A;  7ICO A;  3MGH A;  2B51 A;  3RH5 A;  9ICM A;  4OAF A;  3AUO A;  2PFQ A;  4X4Q A;  2BPG A;  3WFP A;  5CHG A;  1BPZ A;  4RT3 A;  2PBE A;  2ZH4 A;  7ICE A;  5J2E A;  5BOM A;  5CR0 A;  4UBC A;  1MQ3 A;  3V7J A;  1ZQN A;  3JYY A;  1KEJ A;  4TUP A;  1TVA A;  3RJK A;  3WFQ E;  9ICX A;  8ICI A;  4PHA A;  2ZH2 A;  4WOY A;  5III A;  2PXI A;  2DR7 A;  3HJ4 A;  2BPC A;  4RQ1 A;  3UXN A;  5HHI A;  4IQV A;  7ICI A;  2NRK A;  1VFG A;  4NKU A;  4KLH A;  4Z6E A;  5J2J A;  4I2C A;  5DB9 A;  4LT6 A;  2O1P A;  4WC0 A;  5HRF A;  9ICA A;  4FH3 A;  7ICQ A;  4JWN A;  1JN3 A;  1ZQB A;  2DR5 A;  1KNY A;  1MQ2 A;  3TFS A;  3RJG A;  4IQT A;  1R8C A;  3OGU A;  4NKT A;  8ICO A;  4I2E A;  1NOM A;  4K4H A;  4X4O A;  4ATB B;  4F5N A;  1PX5 A;  4XRH A;  1ZJM A;  4PGQ A;  4P4P A;  1ZQK A;  1KDH A;  4O5E A;  3OUY B;  4Z6C A;  3RJH A;  4FHY A;  4NXU A;  8ICU A;  2ZHB A;  3UPQ A;  5J2C A;  3B0X A;  4UD4 A;  4AT9 A;  3C2K A;  4I2D A;  1JQR A;  4RQ3 A;  3V7K A;  4M9H A;  3ISC A;  2ISO A;  2BCR A;  7ICL A;  4RQ8 A;  1TV9 A;  4F5Q A;  4QZE A;  4GXI A;  8ICP A;  1ZQM A;  7ICG A;  2HHP A;  2DRB A;  4AT8 A;  2O5A A;  5HRH A;  4NXV A;  4YMO A;  3JPP A;  4XA5 A;  9ICK A;  5J2A A;  4NY8 A;  8ICN A;  2Q66 A;  4O67 A;  4K96 A;  2M2U A;  4I2J A;  3OVA A;  2RFF A;  4F5R A;  9ICU A;  3C66 A;  2DR9 A;  4RQ2 A;  5IIO A;  2BE3 A;  4E8F A;  5D49 A;  2PFN A;  5HRD A;  4UB1 A;  1ZQX A;  5CP2 A;  4WC6 A;  4JLX A;  4OAG A;  1RZT A;  4I28 A;  1JAJ A;  1MIY A;  3UQ2 A;  3JZ0 A;  3C5F A;  4KLQ A;  4LVS A;  2W9M A;  4KLM A;  7ICV A;  4LEW A;  5IIL A;  4I2F A;  4RPY A;  3ISD A;  4IG8 A;  4PGY A;  4MFF A;  3RH6 A;  1BPB A;  5HC9 A;  7ICR A;  3JPS A;  4KLD A;  2I9G A;  5DBC A;  3ISB A;  2BPF A;  8ICC A;  5CWR A;  4QZH A;  5J2G A;  4M9J A;  4X4U A;  1UET A;  2FMP A;  4K4I A;  3UXP A;  5IIJ A;  5DED A;  4NM2 A;  4NXT A;  4F5O A;  4X4T A;  4LZG A;  8ICF A;  1ZQG A;  4E80 A;  4NXW A;  1V4A A;  5DB8 A;  1UEU A;  4YCX A;  9ICI A;  2DR8 A;  8ICR A;  8ICM A;  1HUZ A;  9ICH A;  2ISP A;  9ICT A;  2B56 A;  4I2B A;  4I29 A;  4WC7 A;  5IIN A;  2BCU A;  5BOL A;  3HX0 A;  4WBZ A;  4X4R A;  2PFP A;  4QZG A;  4RQ6 A;  4F5P A;  4YD2 A;  2ID1 A;  4LEY A;  4PPX A;  9ICJ A;  5DBA A;  3RJF A;  5DEC A;  3AQM A;  4PGX A;  3RJJ A;  4IQU A;  4P2H A;  8ICZ A;  4RQ0 A;  4R63 A;  1TFY A;  9ICV A;  5J0S A;  1ZQA A;  4GXJ A;  4X4P A;  3OV7 A;  4UAW A;  1FA0 A;  8ICT A;  4UB3 A;  4MF2 A;  4RQ7 A;  4K4G A;  5EOZ A;  4I2I A;  4X4N A;  5J2K A;  4RWO A;  5DBB A;  1ZQO A;  1R8B A;  2ZH5 A;  1JMS A;  5J0O A;  3H37 A;  4PH5 A;  4PHE A;  4O9M A;  5IIM A;  3RJE A;  1ZJN A;  4UD5 A;  4RWN A;  3HW8 A;  4UBB A;  3HJ1 A;  4QZI A;  4UAZ A;  3RJI A;  1BPY A;  3PML A;  5DB7 A;  2ZH1 A;  4YMN A;  3UQ0 A;  1XSL A;  1Q79 A;  1NO5 A;  2ZH9 A;  3V7L A;  2IHM A;  4X0B A;  2ZH7 A;  7ICS A;  8ICG A;  2B4V A;  1R8A A;  3OVS A;  9ICW A;  3H38 A;  4QZD A;  4WC3 A;  5J2I A;  7ICN A;  4M5D A;  1ZQF A;  4JWM A;  4R65 A;  4XQ7 A;  3JPR A;  4QZF A;  3JPO A;  3PNC A;  4K98 A;  2VAN A;  4M9L A;  4WBY A;  4WC5 A;  2FMS A;  3L9D A;  5HRE A;  4AT7 B;  4O5C A;  1YLQ A;  4DOB A;  4NLK A;  4AT8 B;  2DRA A;  3LQC B;  5BPC A;  2GWS A;  4M2Y A;  4FO6 A;  4KLI A;  9ICP A;  1F5A A;  4K99 A;  4FH5 A;  4X5V A;  4K9B A;  1HUO A;  3WFO A;  2M2V A;  2BCQ A;  3AU2 A;  4LEZ A;  3AQN A;  8ICS A;  4KLL A;  3HIY A;  1ZQQ A;  4P4M A;  4YN4 A;  1TFW A;  4QZB A;  7ICJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...