4OAIZ

Crystal structure of the cytosolic domain of mouse mid51 dimer mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
330
structure length
328
Chain Sequence
SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELASFLRAKLPDMPLAAMYLSGSLYDDLQVVTADHIQLIVPLVLEAALWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
total genus 111
structure length 328
sequence length 330
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oaiZ01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oaiZ02
4KM5A 4OAHA 4AT9B 4OAGA 4MKPA 4NXXA 4K99A 4LEYA 4OAFA 4NXVA 4AT8A 4ATBA 4AT7A 4O6AA 4AT8B 4K9BA 4LEZA 4O69A 4OAIZ 4JLXA 4KB6A 4NXWA 4K9AA 4O67A 4K97A 4AT7B 4JLZA 4ATBB 4NXTA 4AT9A 4WOYA 4K98A 4O68A 4NXUA 4K8VA 4LEWA 4LEVA 4K96A
chains in the Genus database with same CATH superfamily
4M47A 1ZQVA 4WBYA 5J0UA 4PHEA 4IQUA 4X4TA 4F5RA 5DDMA 4M2YA 4P2HA 3ISDA 4UBBA 1MIWA 3TFRA 4IG8A 3UQ2A 3JPTA 9ICTA 4I2IA 4TURA 4JLZA 5TZVA 4AT9A 3OGUA 3OVBA 2PFQA 3OV7A 2DR8A 4UBCA 2BBHA 5DDYA 3UQ0A 1ZQJA 2FMQA 1JAJA 4AT9B 3V72A 3C5GA 1R8AA 3PMLA 4I29A 4X4NA 3NWIA 4AT8A 8ICUA 4TUPA 5HRIA 1JMSA 4FH5A 5HRFA 1R89A 1VJ7A 4ATBB 1ZQDA 4NLKA 4WBZA 4I2BA 4EP7A 3AQLA 3K7DA 9ICCA 4WC4A 9ICOA 1BPDA 3JPSA 1V4AA 5D46A 3RJKA 1VFGA 4JWMA 7ICRA 1YLQA 3UXOA 4NXXA 3NYBA 3WFRE 2GWSA 1Q78A 4PHDA 1ZQNA 4AT8B 9ICGA 4KLLA 4KLIA 4WC6A 9ICIA 4RQ1A 3AQKA 4F5NA 4RPXA 1Q79A 4FHPA 1ZQEA 4KLDA 5BOLA 4QZAA 5J2CA 4I0UA 7ICUA 8ICWA 4WQKA 5EOZA 4UD5A 4F5QA 5IIKA 1MQ3A 1BPBA 3OVAA 3JPOA 4RQ2A 4LT6A 4OAFA 4NXVA 5CB1A 3RJEA 2ZHBA 4YMOA 4WC3A 1TFWA 1PX5A 7ICTA 5IIOA 4M0AA 4FO1A 4K4IA 4UD4A 4LEZA 2M2VA 3WFQE 1ZQCA 4QZEA 5CFTA 5J2HA 4EBKA 3C2KA 2GA9D 4RT2A 4PGQA 5DBBA 4K96A 4RQ3A 8ICFA 5D63A 4K4GA 4NM2A 1GPJA 3HW8A 5J0QA 2DR7A 4QZHA 5CWRA 3NVOA 3PMNA 9ICPA 5DB8A 4MFAA 2BCVA 1RPLA 5J2AA 4QZ8A 8ICAA 4N7RA 2RFFA 5J0SA 4MFCA 7ICFA 9ICVA 2BCRA 4NXWA 3UPQA 4R63A 2DR5A 1BPEA 2PFNA 9ICJA 7ICJA 2BCUA 4YCXA 4K8VA 7ICGA 4RT3A 3HIYA 5CP2A 4WC1A 4RPYA 4XQ7A 4EEDA 4X4VA 3ER8C 4Z6EA 4UAWA 1ZJNA 1KEJA 9ICRA 4LEYA 5DBCA 8ICNA 2HHPA 5J0TA 4QZBA 4ATBA 1NOMA 1TVAA 4YMMA 4F5OA 5DB9A 4XA5A 4E80A 7ICHA 7ICEA 2GAFD 9ICKA 9ICNA 4LZDA 5HRHA 2ISOA 1FA0A 3PHZA 4I2CA 3CK6A 9ICBA 8ICLA 1ZQKA 4IQTA 5CHEA 5DB6A 3NKUA 3JYYA 4R66A 9ICWA 4X4OA 4UB2A 4IQWA 2ZH4A 3V7KA 4GXIA 2M2UA 3C66A 1NO5A 4I2JA 3V7JA 3LQCB 2BCSA 4RQ0A 1HUOA 4KLJA 4TUQA 4KLEA 1KDHA 3V7LA 8ICOA 4QZFA 4X0AA 3H37A 4KLHA 2IHOA 4FO6A 2NRKA 2ZH5A 3RH4A 1ZQIA 4E8FA 1BPZA 5DECA 4PPXA 1BPYA 8ICKA 2ZH7A 5DKWA 1RZTA 1ZQOA 2B51A 3RH5A 3RJJA 3H38A 5HR9A 5D4BA 1MIVA 1ZQYA 5B3QA 4NY8A 3RH6A 1XSLA 1ZQUA 3ER9B 2ZH8A 1ZQWA 4X4QA 7ICVA 4KLUA 7ICOA 5JTGA 4RQ5A 4EEBA 1XSNA 4I2GA 9ICXA 4YD2A 5DEDA 3HJ1A 3OWGA 4WOYA 5CFSA 1R8CA 1JQRA 2ZH6A 3AUOA 4M9GA 3AQMA 4PH5A 4RQ7A 4X4UA 4MF2A 3MDCA 3H39A 5J0OA 2PFPA 5DB7A 8ICVA 4K99A 4O5KA 9ICSA 3UXPA 9ICEA 4DOBA 2ZH3A 1UEUA 4I2DA 2PFOA 2ZHAA 1JN3A 2ZH2A 8ICRA 5CA7A 4O69A 9ICQA 4KB6A 2PBEA 5HRKA 3RJIA 3JCFA 5J29A 4S3NA 5J2IA 4UAYA 3RJFA 4KLGA 1BPXA 4EGWA 4LEVA 3UPSA 3LK9A 2M2WA 5J2JA 3JPQA 4EBJA 4X4RA 4KLQA 4OAHA 4PHPA 4X5VA 9ICHA 4EV6A 2B56A 3WFPA 4P4OA 1ZQTA 5CFUA 4I2EA 7ICIA 4GXKA 2P66A 2B4VA 2DR9A 4PGYA 4NXZA 4O6AA 4M5DA 8ICMA 3MBYA 1ZQZA 4K9BA 3JPRA 4I2HA 1WOTA 2BE3A 5J0PA 4DO9A 4WC5A 4K98A 2IUBA 2I9GA 8ICXA 4K9AA 5B3PA 4UB5A 3ISCA 3ERCC 4FHWA 3K75D 3HX0A 7ICKA 4X4SA 2VANA 4YD1A 4LVSA 7ICMA 4QZCA 4OAGA 2BPCA 8ICSA 5J0YA 1ZQRA 4WC7A 2Q66A 4E7XA 4TUSA 2M2TA 8ICPA 3UXNA 4P4PA 2ID1A 1MQ2A 7ICPA 3AU2A 4I28A 3C2LA 5IINA 4RQ6A 1ZQMA 4AT7B 5J0XA 4RWPA 1ZQPA 7ICSA 2DRBA 4UAZA 4O5EA 2BBJA 4XQ8A 5BPCA 3PNCA 3B0XA 3WFOA 4O5CA 2O5AA 4X4PA 4PHAA 3C5FA 4LZGA 4KLSA 3AU6A 5CHGA 4XRHA 1ZQHA 4M04A 3OVSA 8ICBA 2W9MA 4QZGA 8ICJA 1HUZA 4QZIA 4UB4A 2FMSA 5J2DA 9ICMA 2ISPA 9ICAA 4F5PA 4QZDA 8ICIA 1ZQGA 2BPGA 5HRBA 4YMNA 5IIIA 3L9DA 4NXUA 4LEWA 2PXIA 1ZQLA 1ZQXA 4NLZA 2EWRA 8ICEA 4KM5A 5HHIA 3TFSA 3C2MA 4FH3A 4M9LA 3JPNA 2HN2A 5J0WA 4NKTA 1F5AA 5HRLA 4YN4A 3HWTA 2IHMA 5HREA 5J2GA 4M9JA 5IILA 2DVIA 4O9MA 2ZH9A 4OAIZ 5F2VO 5J2EA 5HHHA 1ZJMA 8ICHA 4RWOA 1TFYA 4RQ8A 8ICZA 4NKUA 3C18A 4WC0A 2O1PA 4XUSA 3H3AA 5J0RA 3MGHA 4Z6CA 4RWQA 3RJHA 4NLNA 4UB1A 4UB3A 1OU5A 4JWNA 4Z6DA 4FHXA 3MGIA 9ICFA 5IIJA 4AT7A 1ZQFA 1UETA 2BCQA 4NM1A 1XSPA 4XJEA 7ICNA 1KNYA 9ICUA 4JLXA 4WQLA 2HN1A 7ICLA 7ICQA 4IQVA 4FHYA 4NXTA 8ICYA 4RQ4A 5D49A 4R64A 4O68A 1TV9A 3HJ4A 5BOMA 4QZ9A 3OUYB 3RJGA 5J2KA 5HC9A 1ZQBA 3GDXA 4K4HA 4DOCA 5D61A 5CR0A 5J2FA 4X0BA 4PGXA 2FMPA 4Z6FA 4R65A 4KLTA 5IIMA 3JPPA 3MCRA 8ICCA 1ZQSA 3JZ0A 4RPZA 5D62A 4KLOA 4O67A 4K97A 4WC2A 2FCLA 5HRDA 5DBAA 8ICTA 1ZQQA 4MFFA 4I2AA 4WH5A 3AQNA 4M9HA 4DOAA 1R8BA 4MF8A 4M9NA 2ZH1A 1UEVA 3OUYA 1MIYA 4MKPA 4GXJA 4KLFA 3WFSC 4KLMA 8ICQA 4FHVA 8ICGA 4HX0A 4WCWA 5CJ7A 3ISBA 3B0YA 4P4MA 4RWNA 9ICLA 2BPFA 1ZQAA 5HRGA 2DRAA 4I27A 3EF2A 5J2BA 3MDAA 4I2FA
chains in the Genus database with same CATH topology
4KM5A 5D63A 4X4TA 4FH3A 1GPJA 2DR7A 4K99A 4NKTA 1F5AA 2ZH3A 1UEUA 2ZHAA 2ZH2A 2DVIA 2ZH9A 4N7RA 4O69A 4OAIZ 4KB6A 4NXWA 2DR5A 4JLZA 4AT9A 1TFYA 3OVBA 4K8VA 4LEVA 4NKUA 3HIYA 2O1PA 4X4RA 4OAHA 3OV7A 2DR8A 4AT9B 2B56A 4X4VA 3ER8C 1R8AA 4X4NA 5CFUA 4LEYA 2B4VA 4FHXA 2HHPA 4AT8A 4ATBA 2DR9A 4AT7A 4O6AA 4M5DA 1UETA 4XJEA 4K9BA 4JLXA 4WQLA 4FH5A 4E80A 1R89A 4ATBB 2GAFD 4FHYA 4NXTA 4EP7A 3K7DA 4K98A 1FA0A 4O68A 3HJ4A 3PHZA 3OUYB 4K9AA 5B3PA 3ERCC 4FHWA 5CHEA 4X4SA 3NKUA 4OAGA 5D61A 4NXXA 4X4OA 3NYBA 2ZH4A 1Q78A 2Q66A 4E7XA 3MCRA 3C66A 5D62A 4AT8B 4O67A 4K97A 4AT7B 2FCLA 2IHOA 2DRBA 1Q79A 2ZH5A 4FHPA 4WH5A 4E8FA 1R8BA 4WQKA 4X4PA 4UD5A 2ZH1A 2ZH7A 1UEVA 3OUYA 3OVSA 2B51A 4MKPA 3OVAA 4LT6A 4OAFA 4NXVA 5B3QA 2ZHBA 3ER9B 1TFWA 4FHVA 2ZH8A 4X4QA 4HX0A 4FO1A 4UD4A 4LEZA 5CFTA 3HJ1A 2DRAA 3OWGA 4WOYA 5CFSA 1R8CA 2ZH6A 2GA9D 3EF2A 4NXUA 4LEWA 2EWRA 4K96A 4X4UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KM5 A;  4OAH A;  4AT9 B;  4OAG A;  4MKP A;  4NXX A;  4K99 A;  4LEY A;  4OAF A;  4NXV A;  4AT8 A;  4ATB A;  4AT7 A;  4O6A A;  4AT8 B;  4K9B A;  4LEZ A;  4O69 A;  4OAI Z;  4JLX A;  4KB6 A;  4NXW A;  4K9A A;  4O67 A;  4K97 A;  4AT7 B;  4JLZ A;  4ATB B;  4NXT A;  4AT9 A;  4WOY A;  4K98 A;  4O68 A;  4NXU A;  4K8V A;  4LEW A;  4LEV A;  4K96 A; 
#chains in the Genus database with same CATH topology
 4M47 A;  1ZQV A;  4WBY A;  5J0U A;  4PHE A;  4IQU A;  4X4T A;  4F5R A;  5DDM A;  4M2Y A;  4P2H A;  3ISD A;  4UBB A;  1MIW A;  3TFR A;  4IG8 A;  3UQ2 A;  3JPT A;  9ICT A;  4I2I A;  4TUR A;  4JLZ A;  5TZV A;  4AT9 A;  3OGU A;  3OVB A;  2PFQ A;  3OV7 A;  2DR8 A;  4UBC A;  2BBH A;  5DDY A;  3UQ0 A;  1ZQJ A;  2FMQ A;  1JAJ A;  4AT9 B;  3V72 A;  3C5G A;  1R8A A;  3PML A;  4I29 A;  4X4N A;  3NWI A;  4AT8 A;  8ICU A;  4TUP A;  5HRI A;  1JMS A;  4FH5 A;  5HRF A;  1R89 A;  1VJ7 A;  4ATB B;  1ZQD A;  4NLK A;  4WBZ A;  4I2B A;  4EP7 A;  3AQL A;  3K7D A;  9ICC A;  4WC4 A;  9ICO A;  1BPD A;  3JPS A;  1V4A A;  5D46 A;  3RJK A;  1VFG A;  4JWM A;  7ICR A;  1YLQ A;  3UXO A;  4NXX A;  3NYB A;  3WFR E;  2GWS A;  1Q78 A;  4PHD A;  1ZQN A;  4AT8 B;  9ICG A;  4KLL A;  4KLI A;  4WC6 A;  9ICI A;  4RQ1 A;  3AQK A;  4F5N A;  4RPX A;  1Q79 A;  4FHP A;  1ZQE A;  4KLD A;  5BOL A;  4QZA A;  5J2C A;  4I0U A;  7ICU A;  8ICW A;  4WQK A;  5EOZ A;  4UD5 A;  4F5Q A;  5IIK A;  1MQ3 A;  1BPB A;  3OVA A;  3JPO A;  4RQ2 A;  4LT6 A;  4OAF A;  4NXV A;  5CB1 A;  3RJE A;  2ZHB A;  4YMO A;  4WC3 A;  1TFW A;  1PX5 A;  7ICT A;  5IIO A;  4M0A A;  4FO1 A;  4K4I A;  4UD4 A;  4LEZ A;  2M2V A;  3WFQ E;  1ZQC A;  4QZE A;  5CFT A;  5J2H A;  4EBK A;  3C2K A;  2GA9 D;  4RT2 A;  4PGQ A;  5DBB A;  4K96 A;  4RQ3 A;  8ICF A;  5D63 A;  4K4G A;  4NM2 A;  1GPJ A;  3HW8 A;  5J0Q A;  2DR7 A;  4QZH A;  5CWR A;  3NVO A;  3PMN A;  9ICP A;  5DB8 A;  4MFA A;  2BCV A;  1RPL A;  5J2A A;  4QZ8 A;  8ICA A;  4N7R A;  2RFF A;  5J0S A;  4MFC A;  7ICF A;  9ICV A;  2BCR A;  4NXW A;  3UPQ A;  4R63 A;  2DR5 A;  1BPE A;  2PFN A;  9ICJ A;  7ICJ A;  2BCU A;  4YCX A;  4K8V A;  7ICG A;  4RT3 A;  3HIY A;  5CP2 A;  4WC1 A;  4RPY A;  4XQ7 A;  4EED A;  4X4V A;  3ER8 C;  4Z6E A;  4UAW A;  1ZJN A;  1KEJ A;  9ICR A;  4LEY A;  5DBC A;  8ICN A;  2HHP A;  5J0T A;  4QZB A;  4ATB A;  1NOM A;  1TVA A;  4YMM A;  4F5O A;  5DB9 A;  4XA5 A;  4E80 A;  7ICH A;  7ICE A;  2GAF D;  9ICK A;  9ICN A;  4LZD A;  5HRH A;  2ISO A;  1FA0 A;  3PHZ A;  4I2C A;  3CK6 A;  9ICB A;  8ICL A;  1ZQK A;  4IQT A;  5CHE A;  5DB6 A;  3NKU A;  3JYY A;  4R66 A;  9ICW A;  4X4O A;  4UB2 A;  4IQW A;  2ZH4 A;  3V7K A;  4GXI A;  2M2U A;  3C66 A;  1NO5 A;  4I2J A;  3V7J A;  3LQC B;  2BCS A;  4RQ0 A;  1HUO A;  4KLJ A;  4TUQ A;  4KLE A;  1KDH A;  3V7L A;  8ICO A;  4QZF A;  4X0A A;  3H37 A;  4KLH A;  2IHO A;  4FO6 A;  2NRK A;  2ZH5 A;  3RH4 A;  1ZQI A;  4E8F A;  1BPZ A;  5DEC A;  4PPX A;  1BPY A;  8ICK A;  2ZH7 A;  5DKW A;  1RZT A;  1ZQO A;  2B51 A;  3RH5 A;  3RJJ A;  3H38 A;  5HR9 A;  5D4B A;  1MIV A;  1ZQY A;  5B3Q A;  4NY8 A;  3RH6 A;  1XSL A;  1ZQU A;  3ER9 B;  2ZH8 A;  1ZQW A;  4X4Q A;  7ICV A;  4KLU A;  7ICO A;  5JTG A;  4RQ5 A;  4EEB A;  1XSN A;  4I2G A;  9ICX A;  4YD2 A;  5DED A;  3HJ1 A;  3OWG A;  4WOY A;  5CFS A;  1R8C A;  1JQR A;  2ZH6 A;  3AUO A;  4M9G A;  3AQM A;  4PH5 A;  4RQ7 A;  4X4U A;  4MF2 A;  3MDC A;  3H39 A;  5J0O A;  2PFP A;  5DB7 A;  8ICV A;  4K99 A;  4O5K A;  9ICS A;  3UXP A;  9ICE A;  4DOB A;  2ZH3 A;  1UEU A;  4I2D A;  2PFO A;  2ZHA A;  1JN3 A;  2ZH2 A;  8ICR A;  5CA7 A;  4O69 A;  9ICQ A;  4KB6 A;  2PBE A;  5HRK A;  3RJI A;  3JCF A;  5J29 A;  4S3N A;  5J2I A;  4UAY A;  3RJF A;  4KLG A;  1BPX A;  4EGW A;  4LEV A;  3UPS A;  3LK9 A;  2M2W A;  5J2J A;  3JPQ A;  4EBJ A;  4X4R A;  4KLQ A;  4OAH A;  4PHP A;  4X5V A;  9ICH A;  4EV6 A;  2B56 A;  3WFP A;  4P4O A;  1ZQT A;  5CFU A;  4I2E A;  7ICI A;  4GXK A;  2P66 A;  2B4V A;  2DR9 A;  4PGY A;  4NXZ A;  4O6A A;  4M5D A;  8ICM A;  3MBY A;  1ZQZ A;  4K9B A;  3JPR A;  4I2H A;  1WOT A;  2BE3 A;  5J0P A;  4DO9 A;  4WC5 A;  4K98 A;  2IUB A;  2I9G A;  8ICX A;  4K9A A;  5B3P A;  4UB5 A;  3ISC A;  3ERC C;  4FHW A;  3K75 D;  3HX0 A;  7ICK A;  4X4S A;  2VAN A;  4YD1 A;  4LVS A;  7ICM A;  4QZC A;  4OAG A;  2BPC A;  8ICS A;  5J0Y A;  1ZQR A;  4WC7 A;  2Q66 A;  4E7X A;  4TUS A;  2M2T A;  8ICP A;  3UXN A;  4P4P A;  2ID1 A;  1MQ2 A;  7ICP A;  3AU2 A;  4I28 A;  3C2L A;  5IIN A;  4RQ6 A;  1ZQM A;  4AT7 B;  5J0X A;  4RWP A;  1ZQP A;  7ICS A;  2DRB A;  4UAZ A;  4O5E A;  2BBJ A;  4XQ8 A;  5BPC A;  3PNC A;  3B0X A;  3WFO A;  4O5C A;  2O5A A;  4X4P A;  4PHA A;  3C5F A;  4LZG A;  4KLS A;  3AU6 A;  5CHG A;  4XRH A;  1ZQH A;  4M04 A;  3OVS A;  8ICB A;  2W9M A;  4QZG A;  8ICJ A;  1HUZ A;  4QZI A;  4UB4 A;  2FMS A;  5J2D A;  9ICM A;  2ISP A;  9ICA A;  4F5P A;  4QZD A;  8ICI A;  1ZQG A;  2BPG A;  5HRB A;  4YMN A;  5III A;  3L9D A;  4NXU A;  4LEW A;  2PXI A;  1ZQL A;  1ZQX A;  4NLZ A;  2EWR A;  8ICE A;  4KM5 A;  5HHI A;  3TFS A;  3C2M A;  4FH3 A;  4M9L A;  3JPN A;  2HN2 A;  5J0W A;  4NKT A;  1F5A A;  5HRL A;  4YN4 A;  3HWT A;  2IHM A;  5HRE A;  5J2G A;  4M9J A;  5IIL A;  2DVI A;  4O9M A;  2ZH9 A;  4OAI Z;  5F2V O;  5J2E A;  5HHH A;  1ZJM A;  8ICH A;  4RWO A;  1TFY A;  4RQ8 A;  8ICZ A;  4NKU A;  3C18 A;  4WC0 A;  2O1P A;  4XUS A;  3H3A A;  5J0R A;  3MGH A;  4Z6C A;  4RWQ A;  3RJH A;  4NLN A;  4UB1 A;  4UB3 A;  1OU5 A;  4JWN A;  4Z6D A;  4FHX A;  3MGI A;  9ICF A;  5IIJ A;  4AT7 A;  1ZQF A;  1UET A;  2BCQ A;  4NM1 A;  1XSP A;  4XJE A;  7ICN A;  1KNY A;  9ICU A;  4JLX A;  4WQL A;  2HN1 A;  7ICL A;  7ICQ A;  4IQV A;  4FHY A;  4NXT A;  8ICY A;  4RQ4 A;  5D49 A;  4R64 A;  4O68 A;  1TV9 A;  3HJ4 A;  5BOM A;  4QZ9 A;  3OUY B;  3RJG A;  5J2K A;  5HC9 A;  1ZQB A;  3GDX A;  4K4H A;  4DOC A;  5D61 A;  5CR0 A;  5J2F A;  4X0B A;  4PGX A;  2FMP A;  4Z6F A;  4R65 A;  4KLT A;  5IIM A;  3JPP A;  3MCR A;  8ICC A;  1ZQS A;  3JZ0 A;  4RPZ A;  5D62 A;  4KLO A;  4O67 A;  4K97 A;  4WC2 A;  2FCL A;  5HRD A;  5DBA A;  8ICT A;  1ZQQ A;  4MFF A;  4I2A A;  4WH5 A;  3AQN A;  4M9H A;  4DOA A;  1R8B A;  4MF8 A;  4M9N A;  2ZH1 A;  1UEV A;  3OUY A;  1MIY A;  4MKP A;  4GXJ A;  4KLF A;  3WFS C;  4KLM A;  8ICQ A;  4FHV A;  8ICG A;  4HX0 A;  4WCW A;  5CJ7 A;  3ISB A;  3B0Y A;  4P4M A;  4RWN A;  9ICL A;  2BPF A;  1ZQA A;  5HRG A;  2DRA A;  4I27 A;  3EF2 A;  5J2B A;  3MDA A;  4I2F A; 
#chains in the Genus database with same CATH homology
 4KM5 A;  5D63 A;  4X4T A;  4FH3 A;  1GPJ A;  2DR7 A;  4K99 A;  4NKT A;  1F5A A;  2ZH3 A;  1UEU A;  2ZHA A;  2ZH2 A;  2DVI A;  2ZH9 A;  4N7R A;  4O69 A;  4OAI Z;  4KB6 A;  4NXW A;  2DR5 A;  4JLZ A;  4AT9 A;  1TFY A;  3OVB A;  4K8V A;  4LEV A;  4NKU A;  3HIY A;  2O1P A;  4X4R A;  4OAH A;  3OV7 A;  2DR8 A;  4AT9 B;  2B56 A;  4X4V A;  3ER8 C;  1R8A A;  4X4N A;  5CFU A;  4LEY A;  2B4V A;  4FHX A;  2HHP A;  4AT8 A;  4ATB A;  2DR9 A;  4AT7 A;  4O6A A;  4M5D A;  1UET A;  4XJE A;  4K9B A;  4JLX A;  4WQL A;  4FH5 A;  4E80 A;  1R89 A;  4ATB B;  2GAF D;  4FHY A;  4NXT A;  4EP7 A;  3K7D A;  4K98 A;  1FA0 A;  4O68 A;  3HJ4 A;  3PHZ A;  3OUY B;  4K9A A;  5B3P A;  3ERC C;  4FHW A;  5CHE A;  4X4S A;  3NKU A;  4OAG A;  5D61 A;  4NXX A;  4X4O A;  3NYB A;  2ZH4 A;  1Q78 A;  2Q66 A;  4E7X A;  3MCR A;  3C66 A;  5D62 A;  4AT8 B;  4O67 A;  4K97 A;  4AT7 B;  2FCL A;  2IHO A;  2DRB A;  1Q79 A;  2ZH5 A;  4FHP A;  4WH5 A;  4E8F A;  1R8B A;  4WQK A;  4X4P A;  4UD5 A;  2ZH1 A;  2ZH7 A;  1UEV A;  3OUY A;  3OVS A;  2B51 A;  4MKP A;  3OVA A;  4LT6 A;  4OAF A;  4NXV A;  5B3Q A;  2ZHB A;  3ER9 B;  1TFW A;  4FHV A;  2ZH8 A;  4X4Q A;  4HX0 A;  4FO1 A;  4UD4 A;  4LEZ A;  5CFT A;  3HJ1 A;  2DRA A;  3OWG A;  4WOY A;  5CFS A;  1R8C A;  2ZH6 A;  2GA9 D;  3EF2 A;  4NXU A;  4LEW A;  2EWR A;  4K96 A;  4X4U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...