4OAIZ

Crystal structure of the cytosolic domain of mouse mid51 dimer mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
330
structure length
328
Chain Sequence
b'SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELASFLRAKLPDMPLAAMYLSGSLYDDLQVVTADHIQLIVPLVLEAALWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 111
structure length 328
sequence length 330
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oaiZ01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oaiZ02
4OAGA 4NXWA 4LEYA 4K9AA 4ATBA 4O6AA 4KB6A 4ATBB 4K97A 4LEWA 4O67A 4OAIZ 4OAHA 4OAFA 4MKPA 4K99A 4O68A 4KM5A 4K9BA 4NXVA 4K98A 4AT8A 4JLZA 4LEVA 4JLXA 4AT7A 4LEZA 4AT8B 4AT9A 4K96A 4O69A 4AT9B 4AT7B 4NXTA 4NXUA 4K8VA 4WOYA 4NXXA
chains in the Genus database with same CATH superfamily
2FMQA 5HRHA 4KLMA 4PPXA 4O6AA 4UAYA 3UXNA 8ICGA 3OUYA 4NLNA 3OVAA 4QZIA 3WFPA 4OAHA 4NM2A 5TZVA 4OAFA 4GXKA 4P2HA 5CB1A 2RFFA 4S3NA 2B51A 9ICRA 4FH5A 1BPYA 4N7RA 3OVBA 3RJIA 9ICQA 3HW8A 3NWIA 8ICJA 4KLLA 5J2GA 4PHAA 4TUSA 8ICZA 3ERCC 5J2JA 4LEYA 3V7KA 4M9HA 4WH5A 3UPSA 9ICAA 7ICNA 3JYYA 4NY8A 5J2IA 8ICSA 2DRBA 4E80A 1ZQXA 4KLQA 4WBYA 2DR8A 1JAJA 5HRBA 4UB5A 4QZHA 5HHHA 4Z6DA 3TFRA 2IHMA 4XRHA 1MQ3A 9ICLA 3HIYA 4KLSA 8ICLA 5IILA 4WC4A 4X4TA 5DB7A 5J2FA 4PGQA 8ICVA 1WOTA 4UAZA 4I2CA 5HREA 4PHPA 5HR9A 4XJEA 9ICTA 1JQRA 4QZDA 5CHEA 5D62A 4WC1A 4KLHA 4UBCA 3LK9A 5BOMA 1XSPA 3C5FA 4LEWA 7ICQA 4UD5A 3RH6A 1ZQKA 3ISBA 3HJ4A 7ICJA 9ICMA 2DR9A 7ICOA 4K9BA 5J2BA 4AT8A 9ICCA 2IUBA 4PGXA 9ICHA 4NXZA 1UEVA 4AT7A 3C2KA 1R89A 4UB4A 5J29A 4NXTA 2ZH9A 1GPJA 3AU2A 3JPPA 4K4GA 3H3AA 4MF2A 4X4VA 2BCUA 3V72A 4EP7A 4I2EA 3LQCB 2BCVA 4F5PA 2DRAA 4I2AA 4EV6A 4UB1A 4WC2A 1RZTA 4RQ2A 8ICNA 4RQ5A 5J2AA 4MKPA 5HRLA 3PNCA 3UPQA 1XSNA 1ZQFA 5J2EA 4YD1A 3AQNA 1ZQHA 4I2IA 4WBZA 4KLGA 5EOZA 1R8CA 4AT9A 4K96A 4O69A 1ZQAA 4M5DA 4KLIA 3AQKA 3RH4A 1TFYA 4M0AA 3V7JA 4YN4A 4WC7A 4Z6FA 4XA5A 4IQVA 2PFOA 5IIMA 3AQMA 7ICRA 1ZQEA 1ZJMA 5CJ7A 2PFNA 4X4OA 4X0AA 4QZAA 5HRKA 4WQLA 4KLUA 4EEBA 4IQTA 3C5GA 2BE3A 3RJKA 1RPLA 8ICKA 5IINA 4O5KA 1KNYA 1ZQMA 2O5AA 4FO1A 1ZQDA 4I29A 2HHPA 4JWMA 4MFFA 5B3PA 3UQ2A 1ZQCA 4M9LA 4YMNA 2BPGA 3RJHA 2DVIA 4F5OA 4GXJA 2Q66A 1ZQVA 3WFOA 4ATBB 2ZH7A 2IHOA 4OAIZ 4EEDA 5IIOA 2PXIA 3PHZA 4FHXA 1KDHA 4X4SA 4PH5A 7ICMA 4P4MA 5HC9A 2ISPA 4JLZA 2M2WA 3JPQA 4QZFA 9ICVA 4AT9B 2GAFD 3NKUA 9ICJA 5HRDA 2BCRA 1NOMA 4NXXA 4XQ7A 7ICUA 2O1PA 8ICQA 1UEUA 4RWOA 4DO9A 2HN2A 4I2GA 8ICPA 2GA9D 4X4NA 3TFSA 1ZQBA 4XQ8A 5DBCA 4KLFA 4K99A 4X4UA 5CFSA 3WFRE 4O5CA 4KM5A 4NXVA 4X4QA 1ZQUA 8ICBA 8ICAA 4RWNA 4TURA 5HHIA 1BPDA 3OVSA 2BPFA 4M04A 2ZH3A 1ZQTA 1R8AA 3H38A 2W9MA 4NKUA 1F5AA 3JCFA 5D63A 2B4VA 2BCSA 8ICFA 4QZEA 4WC6A 8ICMA 5DBBA 4RQ6A 4X4RA 3UXPA 4F5QA 1TV9A 9ICPA 4UB2A 5J2CA 3H39A 1XSLA 4MF8A 1NO5A 3OUYB 5J0OA 5J0XA 3WFSC 5DB9A 4LVSA 7ICLA 4I2BA 3MGIA 3RJGA 4O5EA 4NKTA 4RT2A 9ICNA 4LT6A 4TUPA 9ICKA 4UAWA 3MDCA 2DR7A 1ZQZA 4O9MA 4UD4A 4KLTA 5DKWA 8ICIA 1MIYA 3ISDA 4FHWA 2ZHBA 3HJ1A 4K4IA 5DEDA 1ZQYA 3JPRA 3ER9B 5HRFA 4MFCA 4X4PA 9ICBA 4EBKA 1ZQQA 3C66A 5J2DA 3RJFA 3UQ0A 9ICXA 5D49A 1ZQLA 4MFAA 5CWRA 8ICYA 1ZQPA 2BBJA 3B0XA 5D61A 4WC0A 2BBHA 2ZHAA 1UETA 2FCLA 4RQ0A 4IG8A 4E8FA 3C18A 4P4OA 3ISCA 5BPCA 4RPXA 4DOAA 3RJJA 3MGHA 3H37A 2HN1A 8ICOA 4RT3A 1ZQIA 4RPYA 4O68A 3OV7A 5J0QA 4M2YA 1ZQRA 4F5RA 5CFUA 4DOCA 4QZCA 9ICGA 1TFWA 4YMMA 1PX5A 4AT8B 4TUQA 2B56A 4RWQA 1ZJNA 2M2UA 4AT7B 1VFGA 4P4PA 4HX0A 4R65A 1BPEA 4IQWA 4OAGA 1HUZA 2M2VA 2BCQA 4M9JA 9ICWA 1V4AA 4K97A 4QZ8A 4I27A 4QZ9A 3JPNA 3C2MA 5F2VO 4RQ4A 7ICSA 5BOLA 3RH5A 3AU6A 4NLKA 4R64A 8ICXA 4K98A 3ER8C 3AQLA 3CK6A 4PGYA 3OGUA 3HX0A 1R8BA 5CR0A 2PFPA 3HWTA 4K4HA 4WCWA 5HRIA 4RQ7A 4M47A 4M9GA 4PHDA 3AUOA 2DR5A 2ZH8A 3PMLA 2EWRA 8ICHA 7ICVA 5B3QA 4X0BA 5CFTA 3JZ0A 4FO6A 1MQ2A 2ID1A 4JWNA 4WC5A 2ZH6A 4YMOA 3OWGA 3JPTA 7ICKA 9ICIA 3GDXA 2ISOA 2NRKA 3K75D 4FH3A 5J0RA 1ZQGA 5D4BA 1Q79A 1BPZA 7ICHA 5J2HA 9ICOA 2PFQA 8ICCA 4NLZA 4KLEA 3NYBA 2P66A 4E7XA 4NXWA 3C2LA 8ICWA 4K9AA 1ZQJA 4RPZA 4KLDA 4RQ1A 4KLJA 4XUSA 5DBAA 3MDAA 5DDYA 2VANA 3V7LA 4Z6EA 1ZQNA 8ICUA 4I2JA 2PBEA 4FHYA 4EGWA 1BPBA 1MIWA 3PMNA 5CA7A 9ICEA 7ICIA 2ZH1A 2ZH4A 4K8VA 3RJEA 9ICUA 4WC3A 4YCXA 4IQUA 1ZQWA 4QZBA 4R63A 7ICTA 4PHEA 3K7DA 1FA0A 5J2KA 2FMPA 4I28A 4O67A 4QZGA 4I2FA 1MIVA 1JN3A 9ICFA 2M2TA 3WFQE 4RQ3A 9ICSA 5J0TA 2GWSA 5J0SA 4UB3A 8ICEA 4DOBA 3B0YA 5IIKA 3UXOA 4JLXA 5J0WA 4YD2A 1KEJA 5HRGA 5D46A 4R66A 1Q78A 2BPCA 4RQ8A 4KLOA 4ATBA 5DECA 7ICPA 3JPSA 5IIJA 5IIIA 5CHGA 7ICFA 8ICTA 1BPXA 1JMSA 2I9GA 5J0UA 4NM1A 8ICRA 1VJ7A 1TVAA 5DB6A 4I2DA 4Z6CA 4I0UA 4EBJA 4GXIA 3MCRA 4FHPA 4WOYA 4UBBA 4NXUA 7ICGA 5CP2A 3EF2A 3JPOA 4F5NA 4KB6A 5DB8A 4LZGA 3L9DA 4RWPA 1HUOA 4I2HA 4X5VA 3NVOA 5JTGA 2FMSA 3MBYA 1YLQA 1ZQOA 4WQKA 1OU5A 4FHVA 5J0YA 2ZH5A 7ICEA 4LEVA 5DDMA 4M9NA 4LEZA 2ZH2A 5J0PA 1ZQSA 4LZDA
chains in the Genus database with same CATH topology
3NYBA 1TFYA 4E7XA 4FHWA 4NXWA 4K9AA 2ZHBA 3HJ1A 4O6AA 3ER9B 4X4PA 3OUYA 3OVAA 4OAHA 3C66A 4X4OA 4OAFA 4WQLA 4FHYA 2B51A 4FH5A 4N7RA 5D61A 3OVBA 4FO1A 2ZH1A 2ZH4A 4K8VA 2HHPA 2ZHAA 1UETA 2FCLA 4E8FA 5B3PA 3ERCC 4LEYA 4WH5A 2DVIA 3K7DA 2Q66A 1FA0A 4ATBB 2ZH7A 2IHOA 4O67A 4OAIZ 2DRBA 4E80A 3PHZA 4FHXA 4X4SA 4O68A 2DR8A 3OV7A 5CFUA 4JLZA 1TFWA 3HIYA 4JLXA 4AT8B 2B56A 4X4TA 4AT9B 4AT7B 2GAFD 3NKUA 1Q78A 4HX0A 4XJEA 4NXXA 4OAGA 2O1PA 5CHEA 5D62A 4ATBA 1UEUA 4K97A 2GA9D 4X4NA 4LEWA 4UD5A 3HJ4A 4K99A 4X4UA 5CFSA 2DR9A 4KM5A 4K9BA 4NXVA 4K98A 4X4QA 3ER8C 4AT8A 1R8BA 1UEVA 4AT7A 1R89A 3OVSA 3MCRA 4FHPA 4NXTA 2ZH9A 1GPJA 4WOYA 2ZH3A 1R8AA 4NXUA 4X4VA 4NKUA 1F5AA 5D63A 2B4VA 4EP7A 2DR5A 2ZH8A 2EWRA 3EF2A 5B3QA 4KB6A 2DRAA 4X4RA 5CFTA 3OUYB 4MKPA 2ZH6A 3OWGA 4WQKA 4NKTA 4FHVA 2ZH5A 4LT6A 4LEVA 4FH3A 4LEZA 1R8CA 4AT9A 4K96A 2DR7A 4O69A 4M5DA 2ZH2A 4UD4A 1Q79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAG A;  4NXW A;  4LEY A;  4K9A A;  4ATB A;  4O6A A;  4KB6 A;  4ATB B;  4K97 A;  4LEW A;  4O67 A;  4OAI Z;  4OAH A;  4OAF A;  4MKP A;  4K99 A;  4O68 A;  4KM5 A;  4K9B A;  4NXV A;  4K98 A;  4AT8 A;  4JLZ A;  4LEV A;  4JLX A;  4AT7 A;  4LEZ A;  4AT8 B;  4AT9 A;  4K96 A;  4O69 A;  4AT9 B;  4AT7 B;  4NXT A;  4NXU A;  4K8V A;  4WOY A;  4NXX A; 
#chains in the Genus database with same CATH topology
 2FMQ A;  5HRH A;  4KLM A;  4PPX A;  4O6A A;  4UAY A;  3UXN A;  8ICG A;  3OUY A;  4NLN A;  3OVA A;  4QZI A;  3WFP A;  4OAH A;  4NM2 A;  5TZV A;  4OAF A;  4GXK A;  4P2H A;  5CB1 A;  2RFF A;  4S3N A;  2B51 A;  9ICR A;  4FH5 A;  1BPY A;  4N7R A;  3OVB A;  3RJI A;  9ICQ A;  3HW8 A;  3NWI A;  8ICJ A;  4KLL A;  5J2G A;  4PHA A;  4TUS A;  8ICZ A;  3ERC C;  5J2J A;  4LEY A;  3V7K A;  4M9H A;  4WH5 A;  3UPS A;  9ICA A;  7ICN A;  3JYY A;  4NY8 A;  5J2I A;  8ICS A;  2DRB A;  4E80 A;  1ZQX A;  4KLQ A;  4WBY A;  2DR8 A;  1JAJ A;  5HRB A;  4UB5 A;  4QZH A;  5HHH A;  4Z6D A;  3TFR A;  2IHM A;  4XRH A;  1MQ3 A;  9ICL A;  3HIY A;  4KLS A;  8ICL A;  5IIL A;  4WC4 A;  4X4T A;  5DB7 A;  5J2F A;  4PGQ A;  8ICV A;  1WOT A;  4UAZ A;  4I2C A;  5HRE A;  4PHP A;  5HR9 A;  4XJE A;  9ICT A;  1JQR A;  4QZD A;  5CHE A;  5D62 A;  4WC1 A;  4KLH A;  4UBC A;  3LK9 A;  5BOM A;  1XSP A;  3C5F A;  4LEW A;  7ICQ A;  4UD5 A;  3RH6 A;  1ZQK A;  3ISB A;  3HJ4 A;  7ICJ A;  9ICM A;  2DR9 A;  7ICO A;  4K9B A;  5J2B A;  4AT8 A;  9ICC A;  2IUB A;  4PGX A;  9ICH A;  4NXZ A;  1UEV A;  4AT7 A;  3C2K A;  1R89 A;  4UB4 A;  5J29 A;  4NXT A;  2ZH9 A;  1GPJ A;  3AU2 A;  3JPP A;  4K4G A;  3H3A A;  4MF2 A;  4X4V A;  2BCU A;  3V72 A;  4EP7 A;  4I2E A;  3LQC B;  2BCV A;  4F5P A;  2DRA A;  4I2A A;  4EV6 A;  4UB1 A;  4WC2 A;  1RZT A;  4RQ2 A;  8ICN A;  4RQ5 A;  5J2A A;  4MKP A;  5HRL A;  3PNC A;  3UPQ A;  1XSN A;  1ZQF A;  5J2E A;  4YD1 A;  3AQN A;  1ZQH A;  4I2I A;  4WBZ A;  4KLG A;  5EOZ A;  1R8C A;  4AT9 A;  4K96 A;  4O69 A;  1ZQA A;  4M5D A;  4KLI A;  3AQK A;  3RH4 A;  1TFY A;  4M0A A;  3V7J A;  4YN4 A;  4WC7 A;  4Z6F A;  4XA5 A;  4IQV A;  2PFO A;  5IIM A;  3AQM A;  7ICR A;  1ZQE A;  1ZJM A;  5CJ7 A;  2PFN A;  4X4O A;  4X0A A;  4QZA A;  5HRK A;  4WQL A;  4KLU A;  4EEB A;  4IQT A;  3C5G A;  2BE3 A;  3RJK A;  1RPL A;  8ICK A;  5IIN A;  4O5K A;  1KNY A;  1ZQM A;  2O5A A;  4FO1 A;  1ZQD A;  4I29 A;  2HHP A;  4JWM A;  4MFF A;  5B3P A;  3UQ2 A;  1ZQC A;  4M9L A;  4YMN A;  2BPG A;  3RJH A;  2DVI A;  4F5O A;  4GXJ A;  2Q66 A;  1ZQV A;  3WFO A;  4ATB B;  2ZH7 A;  2IHO A;  4OAI Z;  4EED A;  5IIO A;  2PXI A;  3PHZ A;  4FHX A;  1KDH A;  4X4S A;  4PH5 A;  7ICM A;  4P4M A;  5HC9 A;  2ISP A;  4JLZ A;  2M2W A;  3JPQ A;  4QZF A;  9ICV A;  4AT9 B;  2GAF D;  3NKU A;  9ICJ A;  5HRD A;  2BCR A;  1NOM A;  4NXX A;  4XQ7 A;  7ICU A;  2O1P A;  8ICQ A;  1UEU A;  4RWO A;  4DO9 A;  2HN2 A;  4I2G A;  8ICP A;  2GA9 D;  4X4N A;  3TFS A;  1ZQB A;  4XQ8 A;  5DBC A;  4KLF A;  4K99 A;  4X4U A;  5CFS A;  3WFR E;  4O5C A;  4KM5 A;  4NXV A;  4X4Q A;  1ZQU A;  8ICB A;  8ICA A;  4RWN A;  4TUR A;  5HHI A;  1BPD A;  3OVS A;  2BPF A;  4M04 A;  2ZH3 A;  1ZQT A;  1R8A A;  3H38 A;  2W9M A;  4NKU A;  1F5A A;  3JCF A;  5D63 A;  2B4V A;  2BCS A;  8ICF A;  4QZE A;  4WC6 A;  8ICM A;  5DBB A;  4RQ6 A;  4X4R A;  3UXP A;  4F5Q A;  1TV9 A;  9ICP A;  4UB2 A;  5J2C A;  3H39 A;  1XSL A;  4MF8 A;  1NO5 A;  3OUY B;  5J0O A;  5J0X A;  3WFS C;  5DB9 A;  4LVS A;  7ICL A;  4I2B A;  3MGI A;  3RJG A;  4O5E A;  4NKT A;  4RT2 A;  9ICN A;  4LT6 A;  4TUP A;  9ICK A;  4UAW A;  3MDC A;  2DR7 A;  1ZQZ A;  4O9M A;  4UD4 A;  4KLT A;  5DKW A;  8ICI A;  1MIY A;  3ISD A;  4FHW A;  2ZHB A;  3HJ1 A;  4K4I A;  5DED A;  1ZQY A;  3JPR A;  3ER9 B;  5HRF A;  4MFC A;  4X4P A;  9ICB A;  4EBK A;  1ZQQ A;  3C66 A;  5J2D A;  3RJF A;  3UQ0 A;  9ICX A;  5D49 A;  1ZQL A;  4MFA A;  5CWR A;  8ICY A;  1ZQP A;  2BBJ A;  3B0X A;  5D61 A;  4WC0 A;  2BBH A;  2ZHA A;  1UET A;  2FCL A;  4RQ0 A;  4IG8 A;  4E8F A;  3C18 A;  4P4O A;  3ISC A;  5BPC A;  4RPX A;  4DOA A;  3RJJ A;  3MGH A;  3H37 A;  2HN1 A;  8ICO A;  4RT3 A;  1ZQI A;  4RPY A;  4O68 A;  3OV7 A;  5J0Q A;  4M2Y A;  1ZQR A;  4F5R A;  5CFU A;  4DOC A;  4QZC A;  9ICG A;  1TFW A;  4YMM A;  1PX5 A;  4AT8 B;  4TUQ A;  2B56 A;  4RWQ A;  1ZJN A;  2M2U A;  4AT7 B;  1VFG A;  4P4P A;  4HX0 A;  4R65 A;  1BPE A;  4IQW A;  4OAG A;  1HUZ A;  2M2V A;  2BCQ A;  4M9J A;  9ICW A;  1V4A A;  4K97 A;  4QZ8 A;  4I27 A;  4QZ9 A;  3JPN A;  3C2M A;  5F2V O;  4RQ4 A;  7ICS A;  5BOL A;  3RH5 A;  3AU6 A;  4NLK A;  4R64 A;  8ICX A;  4K98 A;  3ER8 C;  3AQL A;  3CK6 A;  4PGY A;  3OGU A;  3HX0 A;  1R8B A;  5CR0 A;  2PFP A;  3HWT A;  4K4H A;  4WCW A;  5HRI A;  4RQ7 A;  4M47 A;  4M9G A;  4PHD A;  3AUO A;  2DR5 A;  2ZH8 A;  3PML A;  2EWR A;  8ICH A;  7ICV A;  5B3Q A;  4X0B A;  5CFT A;  3JZ0 A;  4FO6 A;  1MQ2 A;  2ID1 A;  4JWN A;  4WC5 A;  2ZH6 A;  4YMO A;  3OWG A;  3JPT A;  7ICK A;  9ICI A;  3GDX A;  2ISO A;  2NRK A;  3K75 D;  4FH3 A;  5J0R A;  1ZQG A;  5D4B A;  1Q79 A;  1BPZ A;  7ICH A;  5J2H A;  9ICO A;  2PFQ A;  8ICC A;  4NLZ A;  4KLE A;  3NYB A;  2P66 A;  4E7X A;  4NXW A;  3C2L A;  8ICW A;  4K9A A;  1ZQJ A;  4RPZ A;  4KLD A;  4RQ1 A;  4KLJ A;  4XUS A;  5DBA A;  3MDA A;  5DDY A;  2VAN A;  3V7L A;  4Z6E A;  1ZQN A;  8ICU A;  4I2J A;  2PBE A;  4FHY A;  4EGW A;  1BPB A;  1MIW A;  3PMN A;  5CA7 A;  9ICE A;  7ICI A;  2ZH1 A;  2ZH4 A;  4K8V A;  3RJE A;  9ICU A;  4WC3 A;  4YCX A;  4IQU A;  1ZQW A;  4QZB A;  4R63 A;  7ICT A;  4PHE A;  3K7D A;  1FA0 A;  5J2K A;  2FMP A;  4I28 A;  4O67 A;  4QZG A;  4I2F A;  1MIV A;  1JN3 A;  9ICF A;  2M2T A;  3WFQ E;  4RQ3 A;  9ICS A;  5J0T A;  2GWS A;  5J0S A;  4UB3 A;  8ICE A;  4DOB A;  3B0Y A;  5IIK A;  3UXO A;  4JLX A;  5J0W A;  4YD2 A;  1KEJ A;  5HRG A;  5D46 A;  4R66 A;  1Q78 A;  2BPC A;  4RQ8 A;  4KLO A;  4ATB A;  5DEC A;  7ICP A;  3JPS A;  5IIJ A;  5III A;  5CHG A;  7ICF A;  8ICT A;  1BPX A;  1JMS A;  2I9G A;  5J0U A;  4NM1 A;  8ICR A;  1VJ7 A;  1TVA A;  5DB6 A;  4I2D A;  4Z6C A;  4I0U A;  4EBJ A;  4GXI A;  3MCR A;  4FHP A;  4WOY A;  4UBB A;  4NXU A;  7ICG A;  5CP2 A;  3EF2 A;  3JPO A;  4F5N A;  4KB6 A;  5DB8 A;  4LZG A;  3L9D A;  4RWP A;  1HUO A;  4I2H A;  4X5V A;  3NVO A;  5JTG A;  2FMS A;  3MBY A;  1YLQ A;  1ZQO A;  4WQK A;  1OU5 A;  4FHV A;  5J0Y A;  2ZH5 A;  7ICE A;  4LEV A;  5DDM A;  4M9N A;  4LEZ A;  2ZH2 A;  5J0P A;  1ZQS A;  4LZD A; 
#chains in the Genus database with same CATH homology
 3NYB A;  1TFY A;  4E7X A;  4FHW A;  4NXW A;  4K9A A;  2ZHB A;  3HJ1 A;  4O6A A;  3ER9 B;  4X4P A;  3OUY A;  3OVA A;  4OAH A;  3C66 A;  4X4O A;  4OAF A;  4WQL A;  4FHY A;  2B51 A;  4FH5 A;  4N7R A;  5D61 A;  3OVB A;  4FO1 A;  2ZH1 A;  2ZH4 A;  4K8V A;  2HHP A;  2ZHA A;  1UET A;  2FCL A;  4E8F A;  5B3P A;  3ERC C;  4LEY A;  4WH5 A;  2DVI A;  3K7D A;  2Q66 A;  1FA0 A;  4ATB B;  2ZH7 A;  2IHO A;  4O67 A;  4OAI Z;  2DRB A;  4E80 A;  3PHZ A;  4FHX A;  4X4S A;  4O68 A;  2DR8 A;  3OV7 A;  5CFU A;  4JLZ A;  1TFW A;  3HIY A;  4JLX A;  4AT8 B;  2B56 A;  4X4T A;  4AT9 B;  4AT7 B;  2GAF D;  3NKU A;  1Q78 A;  4HX0 A;  4XJE A;  4NXX A;  4OAG A;  2O1P A;  5CHE A;  5D62 A;  4ATB A;  1UEU A;  4K97 A;  2GA9 D;  4X4N A;  4LEW A;  4UD5 A;  3HJ4 A;  4K99 A;  4X4U A;  5CFS A;  2DR9 A;  4KM5 A;  4K9B A;  4NXV A;  4K98 A;  4X4Q A;  3ER8 C;  4AT8 A;  1R8B A;  1UEV A;  4AT7 A;  1R89 A;  3OVS A;  3MCR A;  4FHP A;  4NXT A;  2ZH9 A;  1GPJ A;  4WOY A;  2ZH3 A;  1R8A A;  4NXU A;  4X4V A;  4NKU A;  1F5A A;  5D63 A;  2B4V A;  4EP7 A;  2DR5 A;  2ZH8 A;  2EWR A;  3EF2 A;  5B3Q A;  4KB6 A;  2DRA A;  4X4R A;  5CFT A;  3OUY B;  4MKP A;  2ZH6 A;  3OWG A;  4WQK A;  4NKT A;  4FHV A;  2ZH5 A;  4LT6 A;  4LEV A;  4FH3 A;  4LEZ A;  1R8C A;  4AT9 A;  4K96 A;  2DR7 A;  4O69 A;  4M5D A;  2ZH2 A;  4UD4 A;  1Q79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...