4OAIZ

Crystal structure of the cytosolic domain of mouse mid51 dimer mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
330
structure length
328
Chain Sequence
SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELASFLRAKLPDMPLAAMYLSGSLYDDLQVVTADHIQLIVPLVLEAALWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
total genus 111
structure length 328
sequence length 330
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oaiZ01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oaiZ02
4O6AA 4OAIZ 4NXVA 4AT9A 4AT7A 4K9AA 4K99A 4ATBB 4KB6A 4JLZA 4NXXA 4AT8B 4OAHA 4MKPA 4K8VA 4JLXA 4OAFA 4K97A 4NXWA 4K98A 4LEZA 4O68A 4NXTA 4K9BA 4LEYA 4K96A 4KM5A 4O69A 4ATBA 4OAGA 4AT9B 4O67A 4AT8A 4NXUA 4AT7B 4LEVA 4WOYA 4LEWA
chains in the Genus database with same CATH superfamily
3OWGA 4M5DA 2GWSA 3B0XA 2DVIA 1NO5A 1MIVA 4M9NA 1BPDA 4XA5A 4I2DA 4KLIA 1Q78A 4PPXA 4KLFA 9ICCA 1ZQWA 5B3PA 3V72A 3WFQE 3AQMA 9ICWA 4I2AA 3HJ4A 2RFFA 4K98A 4TUPA 1ZQSA 7ICLA 5CR0A 8ICPA 7ICSA 3NKUA 1TVAA 4N7RA 5J0XA 4UAYA 2EWRA 2M2VA 8ICQA 5J0OA 2BBJA 7ICEA 2VANA 3LK9A 4JWMA 5DB6A 4KLQA 4O9MA 4EBJA 7ICOA 1BPXA 1ZQZA 1GPJA 5D62A 5BPCA 3JPRA 4E80A 4WBZA 4HX0A 1JAJA 5HRIA 8ICCA 4FH5A 3OUYA 8ICBA 4O68A 4UAZA 4XRHA 4KM5A 1YLQA 3OVSA 5J2BA 1R8AA 4LEWA 4UAWA 3AQLA 1HUZA 1KEJA 4EBKA 4QZFA 9ICSA 7ICQA 4X4SA 2BCQA 1FA0A 4DOCA 5BOLA 4NM1A 4WBYA 4K8VA 3K7DA 4M2YA 2FMPA 4LEYA 5J0RA 2O1PA 4E7XA 2ZH7A 4X0BA 8ICEA 4I2BA 9ICJA 2GA9D 4MF2A 4O6AA 1BPBA 3JZ0A 4X4RA 1HUOA 4RT2A 1VJ7A 4R63A 9ICAA 8ICLA 4RT3A 4E8FA 2ZH8A 4RWQA 9ICRA 2ISPA 5HRFA 5J2FA 5CFSA 1ZQHA 3WFRE 5B3QA 3NYBA 4XQ7A 3AU6A 4EEBA 2PFQA 2ZH5A 5J2DA 9ICHA 4KLEA 9ICMA 4I28A 2PFOA 5CHEA 1ZQUA 3C2KA 4AT8A 5IIIA 2P66A 5CB1A 5J0QA 9ICTA 1KDHA 1VFGA 4PHAA 5J29A 9ICPA 1RPLA 3WFSC 4AT9A 5HHIA 1ZQAA 3JPQA 3MDCA 4EP7A 4K9AA 4K99A 4M9JA 3MCRA 5D4BA 4UBBA 4K97A 4UB5A 9ICEA 1PX5A 3JPTA 4Z6CA 4RWPA 4PHPA 1XSLA 1ZQDA 8ICWA 5DDYA 4JWNA 4QZIA 1ZQPA 4YMNA 4QZGA 4LEVA 3WFOA 4M9LA 4PGYA 2HN1A 1TFWA 2Q66A 4RWOA 3JPSA 3H37A 4QZ9A 4KLGA 3H39A 3OGUA 4JLZA 4GXIA 4OAHA 4YMOA 1F5AA 7ICHA 4NXTA 2ZH9A 1BPZA 1Q79A 5HRGA 4WQLA 4P4OA 2NRKA 4IQWA 1ZQQA 3RH4A 4YCXA 1ZJNA 2B4VA 4K4IA 4FH3A 1UEVA 4FHWA 1R89A 4X4QA 3HWTA 4WC5A 4RQ6A 5J0YA 3CK6A 5HC9A 4F5PA 5IILA 4PGXA 5J2HA 4QZCA 4YD1A 4UD5A 3H38A 4QZHA 2BPCA 5JTGA 4RQ5A 7ICFA 2O5AA 9ICKA 4UBCA 5CHGA 4NY8A 3RJGA 4OAGA 1BPYA 3C18A 4WC0A 4RQ1A 4FO6A 4FHYA 4QZAA 5EOZA 3PMLA 4KLHA 5DBAA 4XJEA 1ZQKA 1R8BA 4WC1A 1ZQRA 4Z6DA 4IQVA 2PXIA 8ICMA 3UPQA 3RJKA 1JQRA 4O5KA 2DR9A 2DRBA 4EV6A 5J2GA 3TFSA 3RJFA 4ATBB 1ZQNA 2I9GA 5BOMA 1ZQVA 4QZEA 5DECA 1ZQBA 1MIWA 4FHPA 4LEZA 8ICAA 5IIJA 3MDAA 4K96A 1JMSA 4F5NA 9ICXA 4O67A 2PFPA 4KLLA 9ICGA 5J0UA 2W9MA 4RQ8A 4WOYA 3AU2A 7ICIA 3B0YA 4IQTA 4WH5A 4NKTA 4M47A 8ICVA 7ICGA 3H3AA 8ICJA 4RPXA 3UQ2A 3AUOA 4FO1A 4YN4A 4I0UA 3MGHA 4WC3A 5CA7A 2BE3A 8ICTA 5D46A 5HRKA 4EGWA 3JPPA 3UQ0A 3RJEA 4P2HA 4RQ7A 7ICPA 4TUQA 4JLXA 3JYYA 5HREA 4RQ2A 3K75D 5J2KA 4FHXA 4R64A 2ZH4A 1JN3A 4RQ4A 4RQ0A 5J0SA 3ISCA 4I2HA 4O5EA 4X4TA 4X0AA 4Z6EA 4AT7B 4YD2A 8ICHA 5HR9A 4XUSA 2BPGA 4I2FA 8ICRA 3RJIA 3C66A 3PNCA 4LVSA 4NXVA 4GXKA 3MBYA 1ZQOA 5HRDA 4I2CA 4KB6A 4RPYA 3AQKA 4WQKA 3EF2A 4I2GA 4MF8A 4WC6A 4UB4A 2IHOA 4QZDA 3JCFA 5DBBA 3ER8C 1KNYA 4KLDA 5HRLA 5DB7A 3HJ1A 4DO9A 4WCWA 1XSPA 1ZQJA 5IIOA 2HHPA 5J2IA 9ICFA 4M04A 2BBHA 1ZQIA 3L9DA 2ZH2A 2GAFD 4X4PA 4UB3A 2BCSA 5CJ7A 7ICUA 7ICKA 3C2MA 4NM2A 9ICLA 1R8CA 5J2JA 8ICSA 2ZH6A 5D63A 4QZBA 2IHMA 4F5OA 1UETA 4K9BA 4IQUA 4YMMA 2PFNA 5CP2A 4X4NA 4X4UA 4MFFA 5DEDA 5DB9A 3NVOA 1ZQGA 8ICKA 4O5CA 3MGIA 1ZQCA 9ICOA 4P4MA 4WC7A 5TZVA 2HN2A 4KLTA 2DR7A 4UD4A 3GDXA 8ICGA 2BPFA 4X5VA 3JPNA 4NLZA 4NLNA 4RWNA 2PBEA 1BPEA 5HRHA 4TUSA 4X4OA 4MFAA 4NXWA 4KLJA 8ICZA 3HX0A 8ICFA 4S3NA 1ZJMA 4DOAA 1ZQLA 1WOTA 4O69A 3C2LA 4DOBA 2FMSA 5HHHA 3PMNA 2M2TA 7ICNA 7ICJA 1MQ2A 5J2AA 4UB2A 4GXJA 9ICBA 3ISDA 9ICQA 3ERCC 3LQCB 4OAIZ 9ICVA 3OUYB 3V7KA 1TFYA 4LZDA 4F5QA 5CFTA 3C5GA 1ZQXA 3RJHA 2ZHAA 2ID1A 4NXZA 4EEDA 4KLOA 7ICRA 4F5RA 5J0WA 4MKPA 1ZQTA 5J0PA 4OAFA 1ZQEA 5D61A 1TV9A 1ZQFA 4PHDA 1NOMA 3UXPA 7ICVA 4MFCA 4ATBA 1RZTA 2BCVA 8ICYA 3OVAA 4QZ8A 4Z6FA 3HIYA 8ICOA 2B56A 2DR8A 1V4AA 2FMQA 3OV7A 8ICUA 2ZH1A 3HW8A 3NWIA 4XQ8A 4NLKA 8ICNA 2B51A 2BCRA 9ICNA 3ER9B 4PH5A 3TFRA 4I27A 4NXXA 4M9GA 4X4VA 4M0AA 3JPOA 4KLSA 4FHVA 9ICIA 5F2VO 1UEUA 5CFUA 5IINA 4LZGA 4NXUA 2ZHBA 4LT6A 5D49A 5CWRA 5HRBA 2DR5A 3OVBA 4RQ3A 2M2UA 4R65A 1OU5A 3V7JA 8ICXA 4AT7A 4I2JA 3RH5A 4TURA 3AQNA 5DKWA 1XSNA 4AT8B 5IIMA 4UB1A 3PHZA 2FCLA 5DBCA 4IG8A 4R66A 4AT9B 1ZQYA 4P4PA 3ISBA 3WFPA 4I2IA 1ZQMA 4PHEA 3RJJA 7ICMA 3UXNA 4WC4A 2DRAA 4K4HA 3C5FA 2IUBA 4KLMA 5J2CA 4K4GA 3UPSA 2ISOA 5IIKA 5J2EA 4NKUA 4I2EA 3V7LA 9ICUA 4RPZA 1MQ3A 2M2WA 4KLUA 2BCUA 4M9HA 5J0TA 7ICTA 3RH6A 1MIYA 4PGQA 5DB8A 3UXOA 2ZH3A 4I29A 4WC2A 8ICIA 5DDMA
chains in the Genus database with same CATH topology
3OWGA 4WH5A 4NKTA 4M5DA 2DVIA 3ERCC 4OAIZ 3OUYB 4AT9A 4FO1A 1TFYA 5CFTA 1Q78A 4EP7A 2ZHAA 4K9AA 4K99A 3MCRA 5B3PA 4MKPA 4JLXA 4OAFA 4K97A 3HJ4A 4K98A 5D61A 4FHXA 2ZH4A 3NKUA 4N7RA 4ATBA 2EWRA 4X4TA 3OVAA 4AT7B 4LEVA 3HIYA 1TFWA 2B56A 2Q66A 2DR8A 3C66A 3OV7A 2ZH1A 4NXVA 1GPJA 5D62A 4E80A 2B51A 4KB6A 3ER9B 4HX0A 4JLZA 3EF2A 4WQKA 4NXXA 4OAHA 4X4VA 2IHOA 4FH5A 1F5AA 3ER8C 3OUYA 4FHVA 4NXTA 4O68A 3HJ1A 4KM5A 1UEUA 2ZH9A 5CFUA 3OVSA 1Q79A 4WQLA 4NXUA 1R8AA 2ZHBA 4LEWA 2HHPA 4LT6A 2B4VA 4FH3A 1UEVA 2DR5A 3OVBA 4FHWA 1R89A 4X4QA 2ZH2A 4X4SA 2GAFD 4X4PA 4AT7A 1FA0A 4AT8B 1R8CA 4K8VA 3K7DA 3PHZA 2ZH6A 4UD5A 2FCLA 5D63A 1UETA 4K9BA 4LEYA 4AT9B 4OAGA 4X4NA 2O1PA 4E7XA 4X4UA 2ZH7A 4FHYA 2GA9D 4XJEA 1R8BA 4O6AA 4X4RA 2DRAA 4E8FA 2ZH8A 2DR9A 2DRBA 2DR7A 5CFSA 4UD4A 4ATBB 5B3QA 3NYBA 2ZH5A 4X4OA 4NXWA 4NKUA 4FHPA 4LEZA 4K96A 5CHEA 4O69A 2ZH3A 4O67A 4AT8A 4WOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6A A;  4OAI Z;  4NXV A;  4AT9 A;  4AT7 A;  4K9A A;  4K99 A;  4ATB B;  4KB6 A;  4JLZ A;  4NXX A;  4AT8 B;  4OAH A;  4MKP A;  4K8V A;  4JLX A;  4OAF A;  4K97 A;  4NXW A;  4K98 A;  4LEZ A;  4O68 A;  4NXT A;  4K9B A;  4LEY A;  4K96 A;  4KM5 A;  4O69 A;  4ATB A;  4OAG A;  4AT9 B;  4O67 A;  4AT8 A;  4NXU A;  4AT7 B;  4LEV A;  4WOY A;  4LEW A; 
#chains in the Genus database with same CATH topology
 3OWG A;  4M5D A;  2GWS A;  3B0X A;  2DVI A;  1NO5 A;  1MIV A;  4M9N A;  1BPD A;  4XA5 A;  4I2D A;  4KLI A;  1Q78 A;  4PPX A;  4KLF A;  9ICC A;  1ZQW A;  5B3P A;  3V72 A;  3WFQ E;  3AQM A;  9ICW A;  4I2A A;  3HJ4 A;  2RFF A;  4K98 A;  4TUP A;  1ZQS A;  7ICL A;  5CR0 A;  8ICP A;  7ICS A;  3NKU A;  1TVA A;  4N7R A;  5J0X A;  4UAY A;  2EWR A;  2M2V A;  8ICQ A;  5J0O A;  2BBJ A;  7ICE A;  2VAN A;  3LK9 A;  4JWM A;  5DB6 A;  4KLQ A;  4O9M A;  4EBJ A;  7ICO A;  1BPX A;  1ZQZ A;  1GPJ A;  5D62 A;  5BPC A;  3JPR A;  4E80 A;  4WBZ A;  4HX0 A;  1JAJ A;  5HRI A;  8ICC A;  4FH5 A;  3OUY A;  8ICB A;  4O68 A;  4UAZ A;  4XRH A;  4KM5 A;  1YLQ A;  3OVS A;  5J2B A;  1R8A A;  4LEW A;  4UAW A;  3AQL A;  1HUZ A;  1KEJ A;  4EBK A;  4QZF A;  9ICS A;  7ICQ A;  4X4S A;  2BCQ A;  1FA0 A;  4DOC A;  5BOL A;  4NM1 A;  4WBY A;  4K8V A;  3K7D A;  4M2Y A;  2FMP A;  4LEY A;  5J0R A;  2O1P A;  4E7X A;  2ZH7 A;  4X0B A;  8ICE A;  4I2B A;  9ICJ A;  2GA9 D;  4MF2 A;  4O6A A;  1BPB A;  3JZ0 A;  4X4R A;  1HUO A;  4RT2 A;  1VJ7 A;  4R63 A;  9ICA A;  8ICL A;  4RT3 A;  4E8F A;  2ZH8 A;  4RWQ A;  9ICR A;  2ISP A;  5HRF A;  5J2F A;  5CFS A;  1ZQH A;  3WFR E;  5B3Q A;  3NYB A;  4XQ7 A;  3AU6 A;  4EEB A;  2PFQ A;  2ZH5 A;  5J2D A;  9ICH A;  4KLE A;  9ICM A;  4I28 A;  2PFO A;  5CHE A;  1ZQU A;  3C2K A;  4AT8 A;  5III A;  2P66 A;  5CB1 A;  5J0Q A;  9ICT A;  1KDH A;  1VFG A;  4PHA A;  5J29 A;  9ICP A;  1RPL A;  3WFS C;  4AT9 A;  5HHI A;  1ZQA A;  3JPQ A;  3MDC A;  4EP7 A;  4K9A A;  4K99 A;  4M9J A;  3MCR A;  5D4B A;  4UBB A;  4K97 A;  4UB5 A;  9ICE A;  1PX5 A;  3JPT A;  4Z6C A;  4RWP A;  4PHP A;  1XSL A;  1ZQD A;  8ICW A;  5DDY A;  4JWN A;  4QZI A;  1ZQP A;  4YMN A;  4QZG A;  4LEV A;  3WFO A;  4M9L A;  4PGY A;  2HN1 A;  1TFW A;  2Q66 A;  4RWO A;  3JPS A;  3H37 A;  4QZ9 A;  4KLG A;  3H39 A;  3OGU A;  4JLZ A;  4GXI A;  4OAH A;  4YMO A;  1F5A A;  7ICH A;  4NXT A;  2ZH9 A;  1BPZ A;  1Q79 A;  5HRG A;  4WQL A;  4P4O A;  2NRK A;  4IQW A;  1ZQQ A;  3RH4 A;  4YCX A;  1ZJN A;  2B4V A;  4K4I A;  4FH3 A;  1UEV A;  4FHW A;  1R89 A;  4X4Q A;  3HWT A;  4WC5 A;  4RQ6 A;  5J0Y A;  3CK6 A;  5HC9 A;  4F5P A;  5IIL A;  4PGX A;  5J2H A;  4QZC A;  4YD1 A;  4UD5 A;  3H38 A;  4QZH A;  2BPC A;  5JTG A;  4RQ5 A;  7ICF A;  2O5A A;  9ICK A;  4UBC A;  5CHG A;  4NY8 A;  3RJG A;  4OAG A;  1BPY A;  3C18 A;  4WC0 A;  4RQ1 A;  4FO6 A;  4FHY A;  4QZA A;  5EOZ A;  3PML A;  4KLH A;  5DBA A;  4XJE A;  1ZQK A;  1R8B A;  4WC1 A;  1ZQR A;  4Z6D A;  4IQV A;  2PXI A;  8ICM A;  3UPQ A;  3RJK A;  1JQR A;  4O5K A;  2DR9 A;  2DRB A;  4EV6 A;  5J2G A;  3TFS A;  3RJF A;  4ATB B;  1ZQN A;  2I9G A;  5BOM A;  1ZQV A;  4QZE A;  5DEC A;  1ZQB A;  1MIW A;  4FHP A;  4LEZ A;  8ICA A;  5IIJ A;  3MDA A;  4K96 A;  1JMS A;  4F5N A;  9ICX A;  4O67 A;  2PFP A;  4KLL A;  9ICG A;  5J0U A;  2W9M A;  4RQ8 A;  4WOY A;  3AU2 A;  7ICI A;  3B0Y A;  4IQT A;  4WH5 A;  4NKT A;  4M47 A;  8ICV A;  7ICG A;  3H3A A;  8ICJ A;  4RPX A;  3UQ2 A;  3AUO A;  4FO1 A;  4YN4 A;  4I0U A;  3MGH A;  4WC3 A;  5CA7 A;  2BE3 A;  8ICT A;  5D46 A;  5HRK A;  4EGW A;  3JPP A;  3UQ0 A;  3RJE A;  4P2H A;  4RQ7 A;  7ICP A;  4TUQ A;  4JLX A;  3JYY A;  5HRE A;  4RQ2 A;  3K75 D;  5J2K A;  4FHX A;  4R64 A;  2ZH4 A;  1JN3 A;  4RQ4 A;  4RQ0 A;  5J0S A;  3ISC A;  4I2H A;  4O5E A;  4X4T A;  4X0A A;  4Z6E A;  4AT7 B;  4YD2 A;  8ICH A;  5HR9 A;  4XUS A;  2BPG A;  4I2F A;  8ICR A;  3RJI A;  3C66 A;  3PNC A;  4LVS A;  4NXV A;  4GXK A;  3MBY A;  1ZQO A;  5HRD A;  4I2C A;  4KB6 A;  4RPY A;  3AQK A;  4WQK A;  3EF2 A;  4I2G A;  4MF8 A;  4WC6 A;  4UB4 A;  2IHO A;  4QZD A;  3JCF A;  5DBB A;  3ER8 C;  1KNY A;  4KLD A;  5HRL A;  5DB7 A;  3HJ1 A;  4DO9 A;  4WCW A;  1XSP A;  1ZQJ A;  5IIO A;  2HHP A;  5J2I A;  9ICF A;  4M04 A;  2BBH A;  1ZQI A;  3L9D A;  2ZH2 A;  2GAF D;  4X4P A;  4UB3 A;  2BCS A;  5CJ7 A;  7ICU A;  7ICK A;  3C2M A;  4NM2 A;  9ICL A;  1R8C A;  5J2J A;  8ICS A;  2ZH6 A;  5D63 A;  4QZB A;  2IHM A;  4F5O A;  1UET A;  4K9B A;  4IQU A;  4YMM A;  2PFN A;  5CP2 A;  4X4N A;  4X4U A;  4MFF A;  5DED A;  5DB9 A;  3NVO A;  1ZQG A;  8ICK A;  4O5C A;  3MGI A;  1ZQC A;  9ICO A;  4P4M A;  4WC7 A;  5TZV A;  2HN2 A;  4KLT A;  2DR7 A;  4UD4 A;  3GDX A;  8ICG A;  2BPF A;  4X5V A;  3JPN A;  4NLZ A;  4NLN A;  4RWN A;  2PBE A;  1BPE A;  5HRH A;  4TUS A;  4X4O A;  4MFA A;  4NXW A;  4KLJ A;  8ICZ A;  3HX0 A;  8ICF A;  4S3N A;  1ZJM A;  4DOA A;  1ZQL A;  1WOT A;  4O69 A;  3C2L A;  4DOB A;  2FMS A;  5HHH A;  3PMN A;  2M2T A;  7ICN A;  7ICJ A;  1MQ2 A;  5J2A A;  4UB2 A;  4GXJ A;  9ICB A;  3ISD A;  9ICQ A;  3ERC C;  3LQC B;  4OAI Z;  9ICV A;  3OUY B;  3V7K A;  1TFY A;  4LZD A;  4F5Q A;  5CFT A;  3C5G A;  1ZQX A;  3RJH A;  2ZHA A;  2ID1 A;  4NXZ A;  4EED A;  4KLO A;  7ICR A;  4F5R A;  5J0W A;  4MKP A;  1ZQT A;  5J0P A;  4OAF A;  1ZQE A;  5D61 A;  1TV9 A;  1ZQF A;  4PHD A;  1NOM A;  3UXP A;  7ICV A;  4MFC A;  4ATB A;  1RZT A;  2BCV A;  8ICY A;  3OVA A;  4QZ8 A;  4Z6F A;  3HIY A;  8ICO A;  2B56 A;  2DR8 A;  1V4A A;  2FMQ A;  3OV7 A;  8ICU A;  2ZH1 A;  3HW8 A;  3NWI A;  4XQ8 A;  4NLK A;  8ICN A;  2B51 A;  2BCR A;  9ICN A;  3ER9 B;  4PH5 A;  3TFR A;  4I27 A;  4NXX A;  4M9G A;  4X4V A;  4M0A A;  3JPO A;  4KLS A;  4FHV A;  9ICI A;  5F2V O;  1UEU A;  5CFU A;  5IIN A;  4LZG A;  4NXU A;  2ZHB A;  4LT6 A;  5D49 A;  5CWR A;  5HRB A;  2DR5 A;  3OVB A;  4RQ3 A;  2M2U A;  4R65 A;  1OU5 A;  3V7J A;  8ICX A;  4AT7 A;  4I2J A;  3RH5 A;  4TUR A;  3AQN A;  5DKW A;  1XSN A;  4AT8 B;  5IIM A;  4UB1 A;  3PHZ A;  2FCL A;  5DBC A;  4IG8 A;  4R66 A;  4AT9 B;  1ZQY A;  4P4P A;  3ISB A;  3WFP A;  4I2I A;  1ZQM A;  4PHE A;  3RJJ A;  7ICM A;  3UXN A;  4WC4 A;  2DRA A;  4K4H A;  3C5F A;  2IUB A;  4KLM A;  5J2C A;  4K4G A;  3UPS A;  2ISO A;  5IIK A;  5J2E A;  4NKU A;  4I2E A;  3V7L A;  9ICU A;  4RPZ A;  1MQ3 A;  2M2W A;  4KLU A;  2BCU A;  4M9H A;  5J0T A;  7ICT A;  3RH6 A;  1MIY A;  4PGQ A;  5DB8 A;  3UXO A;  2ZH3 A;  4I29 A;  4WC2 A;  8ICI A;  5DDM A; 
#chains in the Genus database with same CATH homology
 3OWG A;  4WH5 A;  4NKT A;  4M5D A;  2DVI A;  3ERC C;  4OAI Z;  3OUY B;  4AT9 A;  4FO1 A;  1TFY A;  5CFT A;  1Q78 A;  4EP7 A;  2ZHA A;  4K9A A;  4K99 A;  3MCR A;  5B3P A;  4MKP A;  4JLX A;  4OAF A;  4K97 A;  3HJ4 A;  4K98 A;  5D61 A;  4FHX A;  2ZH4 A;  3NKU A;  4N7R A;  4ATB A;  2EWR A;  4X4T A;  3OVA A;  4AT7 B;  4LEV A;  3HIY A;  1TFW A;  2B56 A;  2Q66 A;  2DR8 A;  3C66 A;  3OV7 A;  2ZH1 A;  4NXV A;  1GPJ A;  5D62 A;  4E80 A;  2B51 A;  4KB6 A;  3ER9 B;  4HX0 A;  4JLZ A;  3EF2 A;  4WQK A;  4NXX A;  4OAH A;  4X4V A;  2IHO A;  4FH5 A;  1F5A A;  3ER8 C;  3OUY A;  4FHV A;  4NXT A;  4O68 A;  3HJ1 A;  4KM5 A;  1UEU A;  2ZH9 A;  5CFU A;  3OVS A;  1Q79 A;  4WQL A;  4NXU A;  1R8A A;  2ZHB A;  4LEW A;  2HHP A;  4LT6 A;  2B4V A;  4FH3 A;  1UEV A;  2DR5 A;  3OVB A;  4FHW A;  1R89 A;  4X4Q A;  2ZH2 A;  4X4S A;  2GAF D;  4X4P A;  4AT7 A;  1FA0 A;  4AT8 B;  1R8C A;  4K8V A;  3K7D A;  3PHZ A;  2ZH6 A;  4UD5 A;  2FCL A;  5D63 A;  1UET A;  4K9B A;  4LEY A;  4AT9 B;  4OAG A;  4X4N A;  2O1P A;  4E7X A;  4X4U A;  2ZH7 A;  4FHY A;  2GA9 D;  4XJE A;  1R8B A;  4O6A A;  4X4R A;  2DRA A;  4E8F A;  2ZH8 A;  2DR9 A;  2DRB A;  2DR7 A;  5CFS A;  4UD4 A;  4ATB B;  5B3Q A;  3NYB A;  2ZH5 A;  4X4O A;  4NXW A;  4NKU A;  4FHP A;  4LEZ A;  4K96 A;  5CHE A;  4O69 A;  2ZH3 A;  4O67 A;  4AT8 A;  4WOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...