4OAIZ

Crystal structure of the cytosolic domain of mouse mid51 dimer mutant
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
330
structure length
328
Chain Sequence
SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELASFLRAKLPDMPLAAMYLSGSLYDDLQVVTADHIQLIVPLVLEAALWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
total genus 111
structure length 328
sequence length 330
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oaiZ01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oaiZ02
4JLXA 4OAIZ 4K9BA 4O67A 4NXUA 4AT8A 4AT9A 4ATBB 4O6AA 4NXTA 4NXWA 4WOYA 4NXXA 4OAHA 4LEWA 4K97A 4LEVA 4JLZA 4LEYA 4AT9B 4AT8B 4O69A 4K99A 4ATBA 4OAGA 4K96A 4OAFA 4MKPA 4K9AA 4O68A 4K98A 4K8VA 4LEZA 4AT7A 4NXVA 4AT7B 4KB6A 4KM5A
chains in the Genus database with same CATH superfamily
2GAFD 4RPYA 4NM2A 4PHPA 4R66A 2ISOA 8ICGA 4NXZA 5DBCA 2BBJA 4XRHA 3JZ0A 4FO1A 4O9MA 4NXTA 4KLTA 2DRBA 3WFSC 4KLUA 4K97A 3K7DA 3V7KA 3ERCC 1FA0A 4E80A 2ZH4A 5DKWA 5J0UA 1MQ3A 3AQLA 4O5CA 9ICUA 1F5AA 4YD2A 5IIKA 5J0RA 1VFGA 1R8BA 1ZQJA 5BOLA 5CB1A 4WH5A 3PMLA 4LT6A 4RQ3A 7ICFA 4YD1A 4UB2A 4K4HA 4E8FA 5IIJA 3HJ1A 4N7RA 4I2IA 3TFSA 8ICPA 4EV6A 4I2HA 2ZH9A 4I2AA 4WC2A 1R8CA 3UQ2A 1ZQFA 4I2FA 3C2LA 4WQKA 2P66A 1OU5A 2B51A 1ZQSA 5IIIA 1ZQCA 1UEVA 2HHPA 4S3NA 4M9GA 4GXIA 9ICPA 1ZJNA 4EBKA 2B4VA 2BCSA 3OWGA 4X4SA 8ICWA 8ICJA 5J2FA 4LVSA 2GWSA 3JYYA 4FH3A 1ZQEA 4EBJA 4ATBB 9ICIA 5CHGA 2ZHBA 2FCLA 4IQWA 2IHMA 8ICKA 9ICOA 4X4VA 1ZQBA 3NVOA 4P4OA 5HRLA 2GA9D 4UD5A 2ISPA 8ICHA 4FHYA 4WBYA 4MF2A 1XSNA 2ID1A 4X4QA 4KLDA 4QZHA 4KM5A 4JLXA 4RWOA 1ZQWA 1R89A 4I2DA 3WFOA 4EEDA 4WC1A 4UB4A 4OAHA 4KLLA 4AT9B 8ICSA 5CFUA 4Z6DA 4KLEA 5DECA 1HUZA 3GDXA 5J0SA 1ZQRA 4UAYA 4QZAA 5B3PA 3RJGA 1TVAA 4M2YA 5DB7A 1V4AA 8ICTA 5J0YA 9ICHA 7ICTA 3UXPA 2M2VA 4WC5A 2VANA 3JPSA 4F5RA 4YN4A 5D46A 3JPNA 4PHEA 4QZGA 2BCRA 4E7XA 7ICGA 1WOTA 3CK6A 5DB6A 1TFYA 5HRFA 4X4UA 3OUYB 4HX0A 5HRBA 4WOYA 4AT8B 4I2GA 4UAZA 1BPEA 4M0AA 1KDHA 4RQ5A 3V7JA 3V72A 3C18A 3UPQA 4MKPA 5B3QA 3RH6A 1VJ7A 2DR5A 4QZDA 4NLKA 1RPLA 4XUSA 4KLGA 4AT7A 3B0XA 4RQ8A 1NOMA 2Q66A 3UXNA 4WC6A 3NKUA 5HRGA 4QZEA 5J2IA 4X5VA 1PX5A 8ICXA 3WFQE 2PBEA 3UXOA 4EGWA 4P4MA 4NXWA 4MF8A 3V7LA 4RQ0A 4WC3A 2BPFA 8ICZA 2IHOA 4MFFA 4M9JA 2ZHAA 4TURA 4UB1A 3TFRA 4XQ8A 4NXVA 4AT7B 4I0UA 4F5PA 3UQ0A 3JCFA 4RT3A 4QZ9A 4IQUA 5BPCA 4MFCA 1UEUA 4RQ4A 3WFPA 2PFPA 4X4TA 8ICVA 4KLQA 9ICKA 3RH4A 5CFTA 9ICTA 7ICVA 1XSLA 9ICWA 3ER8C 5DDMA 3AUOA 1ZQAA 5D62A 4X0BA 3ISBA 1ZQGA 4RQ7A 5J0XA 4YMOA 4K8VA 2ZH7A 1TV9A 3LK9A 3K75D 8ICNA 2I9GA 1KNYA 4OAIZ 4QZ8A 3ER9B 2PFOA 1KEJA 3C2KA 4R65A 1ZQNA 3RJHA 5J0PA 9ICNA 4IG8A 5IILA 4R64A 9ICRA 4M47A 4LEYA 3MCRA 4JLZA 4F5NA 8ICAA 1RZTA 3C5FA 3AU2A 4F5QA 2HN2A 4K9AA 3B0YA 2EWRA 4FHXA 4GXKA 8ICRA 3MDCA 1JQRA 4K9BA 2BPGA 3MGHA 7ICSA 1MIYA 5J2DA 3ISCA 2W9MA 3AQKA 4UAWA 2M2WA 2PFQA 4RPZA 8ICFA 1GPJA 4UBCA 5CWRA 4PGXA 4GXJA 5D49A 4QZFA 3OUYA 2ZH5A 4O5EA 4X4NA 8ICQA 4M9HA 4QZIA 4O69A 3RH5A 4IQTA 1YLQA 4IQVA 5TZVA 2PFNA 4EEBA 4UB5A 4DOAA 2DR7A 3RJJA 5IIMA 4RQ6A 4K4GA 1TFWA 3OVBA 9ICMA 4I28A 4KB6A 1JMSA 2ZH8A 4Z6EA 3PHZA 1Q79A 4UBBA 7ICQA 4X4OA 1BPYA 4AT9A 2O1PA 1ZQUA 7ICIA 4X4PA 4O6AA 2ZH3A 3OGUA 4FHWA 1Q78A 4LEWA 2DVIA 3HX0A 5HC9A 4MFAA 5BOMA 3HIYA 9ICLA 9ICXA 4JWMA 9ICEA 7ICUA 4X4RA 4WC7A 7ICJA 4F5OA 5HHHA 2O5AA 4PGYA 1ZQIA 4WBZA 5J0WA 3H37A 4O67A 3JPPA 5CP2A 3PNCA 3JPQA 4I2JA 4QZCA 3AQNA 4PH5A 3OVAA 1ZQVA 4I2EA 4RT2A 4TUPA 2M2UA 1JN3A 4OAGA 4PHDA 3JPOA 4DOCA 5J0TA 1ZQMA 4Z6FA 5J2CA 7ICHA 3UPSA 5DB9A 4LEZA 2NRKA 8ICYA 3OVSA 1ZQQA 1NO5A 5DDYA 4FHPA 1ZQDA 8ICMA 4R63A 3RJIA 2B56A 2BBHA 5HRDA 4PPXA 9ICQA 4P4PA 4WC4A 4EP7A 4NY8A 1HUOA 4KLOA 4X0AA 4RQ1A 3JPTA 1MIVA 4NM1A 3C66A 2ZH2A 4NLZA 4I27A 2BCUA 5J2EA 5CA7A 2PXIA 1XSPA 4UD4A 5J2GA 3HJ4A 9ICVA 1ZQYA 4RPXA 4K98A 5J2KA 4M04A 4FH5A 9ICSA 3NWIA 2BCVA 7ICOA 9ICGA 4DO9A 9ICFA 2ZH6A 4Z6CA 5CFSA 5F2VO 5J0QA 4AT8A 4WQLA 5HREA 4KLHA 5IINA 1ZQLA 4KLSA 2HN1A 4XJEA 4XQ7A 4LEVA 5D61A 1ZQPA 4I2CA 4K99A 4TUSA 5J2JA 3H39A 4KLIA 4QZBA 1ZQXA 4O5KA 1UETA 7ICRA 1BPDA 7ICPA 4I29A 5HRKA 1BPXA 3JPRA 1BPBA 5HRHA 5HRIA 4M5DA 3RJKA 1ZQZA 5IIOA 3NYBA 4DOBA 1MQ2A 3RJEA 4NKTA 4KLFA 7ICMA 5D63A 4M9LA 3AQMA 2M2TA 5J29A 4YMNA 3OV7A 4JWNA 4KLJA 4PGQA 5DBBA 1JAJA 2FMSA 9ICCA 3ISDA 4RWNA 3LQCB 4WCWA 2BCQA 7ICEA 9ICJA 4ATBA 3L9DA 5CR0A 4YCXA 3C2MA 1ZQOA 4OAFA 5DBAA 4TUQA 2BE3A 5HHIA 4RWPA 3H3AA 1R8AA 7ICNA 4M9NA 2IUBA 3AU6A 2DR8A 3HW8A 4NXUA 2FMPA 2DRAA 7ICKA 3EF2A 4UB3A 3PMNA 4NKUA 5CHEA 8ICUA 5J2BA 3C5GA 8ICIA 5DB8A 4FHVA 4K96A 8ICOA 5CJ7A 8ICBA 3WFRE 2DR9A 3MGIA 1ZQKA 4O68A 4FO6A 7ICLA 4RQ2A 4KLMA 5EOZA 4WC0A 4LZGA 3MDAA 5DEDA 5D4BA 5HR9A 2FMQA 8ICCA 3RJFA 4P2HA 2RFFA 2BPCA 4LZDA 4PHAA 2ZH1A 1ZQHA 4XA5A 3H38A 5J0OA 4NXXA 5J2HA 4K4IA 5J2AA 9ICAA 9ICBA 3HWTA 4NLNA 4I2BA 1BPZA 1ZQTA 8ICEA 1ZJMA 5JTGA 1MIWA 4RWQA 3MBYA 4YMMA 8ICLA
chains in the Genus database with same CATH topology
2ZH6A 2GAFD 5CFSA 4E7XA 1GPJA 4AT8A 4WQLA 1TFYA 4FO1A 4X4UA 4NXTA 3OUYB 2ZH5A 3OUYA 4WOYA 2DRBA 4X4NA 4HX0A 4K97A 3K7DA 4LEVA 4XJEA 3ERCC 4AT8B 5D61A 1FA0A 4O69A 4K99A 4E80A 2ZH4A 1F5AA 2DR7A 1UETA 4MKPA 5B3QA 2DR5A 1R8BA 4AT7A 1TFWA 4M5DA 3OVBA 4KB6A 3NYBA 4WH5A 4LT6A 2Q66A 3NKUA 2ZH8A 4NKTA 3PHZA 1Q79A 5D63A 4E8FA 4X4OA 3OV7A 4AT9A 2O1PA 3HJ1A 4N7RA 4X4PA 4O6AA 4NXWA 2ZH3A 4FHWA 1Q78A 4LEWA 2DVIA 2ZH9A 3HIYA 1R8CA 2IHOA 4ATBA 2ZHAA 4WQKA 4X4RA 2B51A 4OAFA 1UEVA 2HHPA 4NXVA 4AT7B 2B4VA 1R8AA 3OWGA 4X4SA 4O67A 2DR8A 4NXUA 1UEUA 4FH3A 4X4TA 4ATBB 3OVAA 2DRAA 3EF2A 2ZHBA 4NKUA 2FCLA 5CFTA 5CHEA 4X4VA 3ER8C 4OAGA 4FHVA 2GA9D 4UD5A 4K96A 4FHYA 5D62A 2DR9A 4O68A 4K8VA 4X4QA 4LEZA 2ZH7A 4KM5A 4JLXA 4OAIZ 3ER9B 3OVSA 4FHPA 2ZH1A 1R89A 2B56A 4NXXA 4OAHA 4LEYA 3MCRA 4JLZA 4EP7A 4AT9B 5CFUA 3C66A 2ZH2A 5B3PA 4K9AA 4UD4A 3HJ4A 2EWRA 4K98A 4FHXA 4FH5A 4K9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JLX A;  4OAI Z;  4K9B A;  4O67 A;  4NXU A;  4AT8 A;  4AT9 A;  4ATB B;  4O6A A;  4NXT A;  4NXW A;  4WOY A;  4NXX A;  4OAH A;  4LEW A;  4K97 A;  4LEV A;  4JLZ A;  4LEY A;  4AT9 B;  4AT8 B;  4O69 A;  4K99 A;  4ATB A;  4OAG A;  4K96 A;  4OAF A;  4MKP A;  4K9A A;  4O68 A;  4K98 A;  4K8V A;  4LEZ A;  4AT7 A;  4NXV A;  4AT7 B;  4KB6 A;  4KM5 A; 
#chains in the Genus database with same CATH topology
 2GAF D;  4RPY A;  4NM2 A;  4PHP A;  4R66 A;  2ISO A;  8ICG A;  4NXZ A;  5DBC A;  2BBJ A;  4XRH A;  3JZ0 A;  4FO1 A;  4O9M A;  4NXT A;  4KLT A;  2DRB A;  3WFS C;  4KLU A;  4K97 A;  3K7D A;  3V7K A;  3ERC C;  1FA0 A;  4E80 A;  2ZH4 A;  5DKW A;  5J0U A;  1MQ3 A;  3AQL A;  4O5C A;  9ICU A;  1F5A A;  4YD2 A;  5IIK A;  5J0R A;  1VFG A;  1R8B A;  1ZQJ A;  5BOL A;  5CB1 A;  4WH5 A;  3PML A;  4LT6 A;  4RQ3 A;  7ICF A;  4YD1 A;  4UB2 A;  4K4H A;  4E8F A;  5IIJ A;  3HJ1 A;  4N7R A;  4I2I A;  3TFS A;  8ICP A;  4EV6 A;  4I2H A;  2ZH9 A;  4I2A A;  4WC2 A;  1R8C A;  3UQ2 A;  1ZQF A;  4I2F A;  3C2L A;  4WQK A;  2P66 A;  1OU5 A;  2B51 A;  1ZQS A;  5III A;  1ZQC A;  1UEV A;  2HHP A;  4S3N A;  4M9G A;  4GXI A;  9ICP A;  1ZJN A;  4EBK A;  2B4V A;  2BCS A;  3OWG A;  4X4S A;  8ICW A;  8ICJ A;  5J2F A;  4LVS A;  2GWS A;  3JYY A;  4FH3 A;  1ZQE A;  4EBJ A;  4ATB B;  9ICI A;  5CHG A;  2ZHB A;  2FCL A;  4IQW A;  2IHM A;  8ICK A;  9ICO A;  4X4V A;  1ZQB A;  3NVO A;  4P4O A;  5HRL A;  2GA9 D;  4UD5 A;  2ISP A;  8ICH A;  4FHY A;  4WBY A;  4MF2 A;  1XSN A;  2ID1 A;  4X4Q A;  4KLD A;  4QZH A;  4KM5 A;  4JLX A;  4RWO A;  1ZQW A;  1R89 A;  4I2D A;  3WFO A;  4EED A;  4WC1 A;  4UB4 A;  4OAH A;  4KLL A;  4AT9 B;  8ICS A;  5CFU A;  4Z6D A;  4KLE A;  5DEC A;  1HUZ A;  3GDX A;  5J0S A;  1ZQR A;  4UAY A;  4QZA A;  5B3P A;  3RJG A;  1TVA A;  4M2Y A;  5DB7 A;  1V4A A;  8ICT A;  5J0Y A;  9ICH A;  7ICT A;  3UXP A;  2M2V A;  4WC5 A;  2VAN A;  3JPS A;  4F5R A;  4YN4 A;  5D46 A;  3JPN A;  4PHE A;  4QZG A;  2BCR A;  4E7X A;  7ICG A;  1WOT A;  3CK6 A;  5DB6 A;  1TFY A;  5HRF A;  4X4U A;  3OUY B;  4HX0 A;  5HRB A;  4WOY A;  4AT8 B;  4I2G A;  4UAZ A;  1BPE A;  4M0A A;  1KDH A;  4RQ5 A;  3V7J A;  3V72 A;  3C18 A;  3UPQ A;  4MKP A;  5B3Q A;  3RH6 A;  1VJ7 A;  2DR5 A;  4QZD A;  4NLK A;  1RPL A;  4XUS A;  4KLG A;  4AT7 A;  3B0X A;  4RQ8 A;  1NOM A;  2Q66 A;  3UXN A;  4WC6 A;  3NKU A;  5HRG A;  4QZE A;  5J2I A;  4X5V A;  1PX5 A;  8ICX A;  3WFQ E;  2PBE A;  3UXO A;  4EGW A;  4P4M A;  4NXW A;  4MF8 A;  3V7L A;  4RQ0 A;  4WC3 A;  2BPF A;  8ICZ A;  2IHO A;  4MFF A;  4M9J A;  2ZHA A;  4TUR A;  4UB1 A;  3TFR A;  4XQ8 A;  4NXV A;  4AT7 B;  4I0U A;  4F5P A;  3UQ0 A;  3JCF A;  4RT3 A;  4QZ9 A;  4IQU A;  5BPC A;  4MFC A;  1UEU A;  4RQ4 A;  3WFP A;  2PFP A;  4X4T A;  8ICV A;  4KLQ A;  9ICK A;  3RH4 A;  5CFT A;  9ICT A;  7ICV A;  1XSL A;  9ICW A;  3ER8 C;  5DDM A;  3AUO A;  1ZQA A;  5D62 A;  4X0B A;  3ISB A;  1ZQG A;  4RQ7 A;  5J0X A;  4YMO A;  4K8V A;  2ZH7 A;  1TV9 A;  3LK9 A;  3K75 D;  8ICN A;  2I9G A;  1KNY A;  4OAI Z;  4QZ8 A;  3ER9 B;  2PFO A;  1KEJ A;  3C2K A;  4R65 A;  1ZQN A;  3RJH A;  5J0P A;  9ICN A;  4IG8 A;  5IIL A;  4R64 A;  9ICR A;  4M47 A;  4LEY A;  3MCR A;  4JLZ A;  4F5N A;  8ICA A;  1RZT A;  3C5F A;  3AU2 A;  4F5Q A;  2HN2 A;  4K9A A;  3B0Y A;  2EWR A;  4FHX A;  4GXK A;  8ICR A;  3MDC A;  1JQR A;  4K9B A;  2BPG A;  3MGH A;  7ICS A;  1MIY A;  5J2D A;  3ISC A;  2W9M A;  3AQK A;  4UAW A;  2M2W A;  2PFQ A;  4RPZ A;  8ICF A;  1GPJ A;  4UBC A;  5CWR A;  4PGX A;  4GXJ A;  5D49 A;  4QZF A;  3OUY A;  2ZH5 A;  4O5E A;  4X4N A;  8ICQ A;  4M9H A;  4QZI A;  4O69 A;  3RH5 A;  4IQT A;  1YLQ A;  4IQV A;  5TZV A;  2PFN A;  4EEB A;  4UB5 A;  4DOA A;  2DR7 A;  3RJJ A;  5IIM A;  4RQ6 A;  4K4G A;  1TFW A;  3OVB A;  9ICM A;  4I28 A;  4KB6 A;  1JMS A;  2ZH8 A;  4Z6E A;  3PHZ A;  1Q79 A;  4UBB A;  7ICQ A;  4X4O A;  1BPY A;  4AT9 A;  2O1P A;  1ZQU A;  7ICI A;  4X4P A;  4O6A A;  2ZH3 A;  3OGU A;  4FHW A;  1Q78 A;  4LEW A;  2DVI A;  3HX0 A;  5HC9 A;  4MFA A;  5BOM A;  3HIY A;  9ICL A;  9ICX A;  4JWM A;  9ICE A;  7ICU A;  4X4R A;  4WC7 A;  7ICJ A;  4F5O A;  5HHH A;  2O5A A;  4PGY A;  1ZQI A;  4WBZ A;  5J0W A;  3H37 A;  4O67 A;  3JPP A;  5CP2 A;  3PNC A;  3JPQ A;  4I2J A;  4QZC A;  3AQN A;  4PH5 A;  3OVA A;  1ZQV A;  4I2E A;  4RT2 A;  4TUP A;  2M2U A;  1JN3 A;  4OAG A;  4PHD A;  3JPO A;  4DOC A;  5J0T A;  1ZQM A;  4Z6F A;  5J2C A;  7ICH A;  3UPS A;  5DB9 A;  4LEZ A;  2NRK A;  8ICY A;  3OVS A;  1ZQQ A;  1NO5 A;  5DDY A;  4FHP A;  1ZQD A;  8ICM A;  4R63 A;  3RJI A;  2B56 A;  2BBH A;  5HRD A;  4PPX A;  9ICQ A;  4P4P A;  4WC4 A;  4EP7 A;  4NY8 A;  1HUO A;  4KLO A;  4X0A A;  4RQ1 A;  3JPT A;  1MIV A;  4NM1 A;  3C66 A;  2ZH2 A;  4NLZ A;  4I27 A;  2BCU A;  5J2E A;  5CA7 A;  2PXI A;  1XSP A;  4UD4 A;  5J2G A;  3HJ4 A;  9ICV A;  1ZQY A;  4RPX A;  4K98 A;  5J2K A;  4M04 A;  4FH5 A;  9ICS A;  3NWI A;  2BCV A;  7ICO A;  9ICG A;  4DO9 A;  9ICF A;  2ZH6 A;  4Z6C A;  5CFS A;  5F2V O;  5J0Q A;  4AT8 A;  4WQL A;  5HRE A;  4KLH A;  5IIN A;  1ZQL A;  4KLS A;  2HN1 A;  4XJE A;  4XQ7 A;  4LEV A;  5D61 A;  1ZQP A;  4I2C A;  4K99 A;  4TUS A;  5J2J A;  3H39 A;  4KLI A;  4QZB A;  1ZQX A;  4O5K A;  1UET A;  7ICR A;  1BPD A;  7ICP A;  4I29 A;  5HRK A;  1BPX A;  3JPR A;  1BPB A;  5HRH A;  5HRI A;  4M5D A;  3RJK A;  1ZQZ A;  5IIO A;  3NYB A;  4DOB A;  1MQ2 A;  3RJE A;  4NKT A;  4KLF A;  7ICM A;  5D63 A;  4M9L A;  3AQM A;  2M2T A;  5J29 A;  4YMN A;  3OV7 A;  4JWN A;  4KLJ A;  4PGQ A;  5DBB A;  1JAJ A;  2FMS A;  9ICC A;  3ISD A;  4RWN A;  3LQC B;  4WCW A;  2BCQ A;  7ICE A;  9ICJ A;  4ATB A;  3L9D A;  5CR0 A;  4YCX A;  3C2M A;  1ZQO A;  4OAF A;  5DBA A;  4TUQ A;  2BE3 A;  5HHI A;  4RWP A;  3H3A A;  1R8A A;  7ICN A;  4M9N A;  2IUB A;  3AU6 A;  2DR8 A;  3HW8 A;  4NXU A;  2FMP A;  2DRA A;  7ICK A;  3EF2 A;  4UB3 A;  3PMN A;  4NKU A;  5CHE A;  8ICU A;  5J2B A;  3C5G A;  8ICI A;  5DB8 A;  4FHV A;  4K96 A;  8ICO A;  5CJ7 A;  8ICB A;  3WFR E;  2DR9 A;  3MGI A;  1ZQK A;  4O68 A;  4FO6 A;  7ICL A;  4RQ2 A;  4KLM A;  5EOZ A;  4WC0 A;  4LZG A;  3MDA A;  5DED A;  5D4B A;  5HR9 A;  2FMQ A;  8ICC A;  3RJF A;  4P2H A;  2RFF A;  2BPC A;  4LZD A;  4PHA A;  2ZH1 A;  1ZQH A;  4XA5 A;  3H38 A;  5J0O A;  4NXX A;  5J2H A;  4K4I A;  5J2A A;  9ICA A;  9ICB A;  3HWT A;  4NLN A;  4I2B A;  1BPZ A;  1ZQT A;  8ICE A;  1ZJM A;  5JTG A;  1MIW A;  4RWQ A;  3MBY A;  4YMM A;  8ICL A; 
#chains in the Genus database with same CATH homology
 2ZH6 A;  2GAF D;  5CFS A;  4E7X A;  1GPJ A;  4AT8 A;  4WQL A;  1TFY A;  4FO1 A;  4X4U A;  4NXT A;  3OUY B;  2ZH5 A;  3OUY A;  4WOY A;  2DRB A;  4X4N A;  4HX0 A;  4K97 A;  3K7D A;  4LEV A;  4XJE A;  3ERC C;  4AT8 B;  5D61 A;  1FA0 A;  4O69 A;  4K99 A;  4E80 A;  2ZH4 A;  1F5A A;  2DR7 A;  1UET A;  4MKP A;  5B3Q A;  2DR5 A;  1R8B A;  4AT7 A;  1TFW A;  4M5D A;  3OVB A;  4KB6 A;  3NYB A;  4WH5 A;  4LT6 A;  2Q66 A;  3NKU A;  2ZH8 A;  4NKT A;  3PHZ A;  1Q79 A;  5D63 A;  4E8F A;  4X4O A;  3OV7 A;  4AT9 A;  2O1P A;  3HJ1 A;  4N7R A;  4X4P A;  4O6A A;  4NXW A;  2ZH3 A;  4FHW A;  1Q78 A;  4LEW A;  2DVI A;  2ZH9 A;  3HIY A;  1R8C A;  2IHO A;  4ATB A;  2ZHA A;  4WQK A;  4X4R A;  2B51 A;  4OAF A;  1UEV A;  2HHP A;  4NXV A;  4AT7 B;  2B4V A;  1R8A A;  3OWG A;  4X4S A;  4O67 A;  2DR8 A;  4NXU A;  1UEU A;  4FH3 A;  4X4T A;  4ATB B;  3OVA A;  2DRA A;  3EF2 A;  2ZHB A;  4NKU A;  2FCL A;  5CFT A;  5CHE A;  4X4V A;  3ER8 C;  4OAG A;  4FHV A;  2GA9 D;  4UD5 A;  4K96 A;  4FHY A;  5D62 A;  2DR9 A;  4O68 A;  4K8V A;  4X4Q A;  4LEZ A;  2ZH7 A;  4KM5 A;  4JLX A;  4OAI Z;  3ER9 B;  3OVS A;  4FHP A;  2ZH1 A;  1R89 A;  2B56 A;  4NXX A;  4OAH A;  4LEY A;  3MCR A;  4JLZ A;  4EP7 A;  4AT9 B;  5CFU A;  3C66 A;  2ZH2 A;  5B3P A;  4K9A A;  4UD4 A;  3HJ4 A;  2EWR A;  4K98 A;  4FHX A;  4FH5 A;  4K9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...