4OAGA

Crystal structure of the cytosolic domain of mouse mid51 bound to adp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
330
structure length
328
Chain Sequence
SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 112
structure length 328
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oagA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oagA02
4AT9A 4K8VA 4LEVA 4ATBA 4OAIZ 4NXUA 4O68A 4OAGA 4AT8A 4LEWA 4O69A 4O6AA 4LEZA 4K97A 4K9BA 4KM5A 4K9AA 4LEYA 4MKPA 4K99A 4NXTA 4AT7B 4NXVA 4WOYA 4AT8B 4KB6A 4K98A 4NXWA 4OAHA 4OAFA 4AT9B 4ATBB 4K96A 4O67A 4AT7A 4JLXA 4JLZA 4NXXA
chains in the Genus database with same CATH superfamily
4I0UA 5J2BA 3JPQA 4K97A 4M9GA 4MF2A 5CWRA 2BE3A 3PMLA 9ICXA 2BBHA 4WC1A 4GXJA 9ICKA 7ICVA 4WQLA 7ICQA 4RPZA 4XQ8A 4QZEA 4AT8B 4KB6A 1ZJMA 1YLQA 1V4AA 2ZHBA 4UAYA 2EWRA 1NOMA 3NYBA 8ICMA 4JLXA 4RQ0A 3AUOA 4P4PA 4I2HA 1ZQXA 4AT9A 4M9HA 4O5CA 4RWOA 3RJIA 5D4BA 5CP2A 2M2TA 4IQUA 4LZDA 4DOBA 4UD4A 3K75D 4K99A 4PPXA 4YMOA 2FCLA 4S3NA 4WC7A 9ICOA 5CFSA 4XQ7A 2NRKA 4M9NA 4QZBA 9ICNA 4FHPA 4XJEA 5DDYA 4NXXA 3WFRE 1RPLA 5J29A 3WFPA 2P66A 4RPXA 1ZQYA 8ICJA 4M9JA 4IQWA 4KLDA 2O1PA 4PHAA 4M47A 4WC4A 4KM5A 4X4NA 5DBBA 9ICJA 2ZH5A 1BPYA 4EBJA 3LK9A 1TFYA 4XA5A 3V7JA 2Q66A 2PFPA 4WCWA 4N7RA 4O67A 1PX5A 1UEVA 4R64A 5J0PA 3V72A 5DB9A 4X0BA 4WBZA 4MFCA 4M0AA 4LEWA 2BCRA 4NLKA 5DECA 3L9DA 7ICEA 8ICUA 5IIOA 5DBAA 3JPTA 8ICKA 2ZH9A 1JAJA 1R8CA 3AU2A 9ICBA 4NXTA 4EGWA 3AQLA 4WH5A 4MFAA 3B0XA 1JN3A 4DOCA 3V7LA 4NXWA 4KLHA 3MDAA 3C66A 1JQRA 1BPBA 4Z6CA 2BBJA 3JPRA 2M2VA 3OVAA 2FMQA 5J0WA 4RQ8A 4YN4A 4WC3A 4EV6A 4FO1A 4X4QA 4NXUA 5HRGA 4KLJA 3JYYA 4E8FA 4XUSA 4RQ7A 3C2MA 4EBKA 2ID1A 4M9LA 5J0SA 4K9AA 7ICKA 4X4UA 5TZVA 8ICYA 1Q79A 4FHYA 7ICGA 4O5KA 1HUZA 4KLUA 3UPSA 4NM1A 4KLTA 2BPGA 4RT2A 3EF2A 5DEDA 4WBYA 4IQVA 5J0UA 7ICPA 4WC6A 8ICVA 2BPCA 5HRBA 4UAWA 4QZIA 3CK6A 4FHVA 4FHWA 3C2KA 3RJKA 4X4OA 4E80A 5HHIA 4QZHA 5CFUA 3RH4A 4RWNA 1ZQSA 9ICRA 4KLEA 8ICNA 3ISCA 2IHMA 4UBCA 1ZQPA 3HJ4A 1VFGA 1TVAA 4I2IA 4Z6EA 4PH5A 1XSPA 4WOYA 4F5NA 4PGXA 9ICUA 1ZQQA 1ZJNA 3UQ2A 5IINA 2PXIA 2ZH7A 4AT7A 1UEUA 1MQ3A 2BCVA 3PNCA 4K4GA 1R8BA 4JLZA 3JPPA 4QZAA 4JWNA 9ICCA 4LEVA 3C18A 3H37A 4K4IA 3ER8C 8ICRA 4R66A 4O68A 4O69A 4FH3A 1GPJA 5IIMA 5BPCA 8ICXA 3PHZA 1F5AA 7ICJA 4RWQA 4R65A 2HHPA 4I2JA 4RQ4A 8ICOA 4TUQA 2M2UA 2O5AA 7ICFA 5HRFA 1KDHA 4NXVA 3HJ1A 3OUYA 3OVSA 2GA9D 5HR9A 5B3QA 4I2DA 4I2GA 3NKUA 9ICMA 2HN1A 3WFSC 4MF8A 4WC2A 5IILA 4RQ3A 4K8VA 2GWSA 4O5EA 4IQTA 2DRBA 4O6AA 3AQNA 8ICPA 4GXKA 1ZQAA 2RFFA 5CHEA 4NLZA 4UB3A 2ZH8A 1HUOA 9ICIA 1WOTA 3JCFA 4X5VA 3WFOA 7ICNA 2ZH1A 2ZH3A 5HC9A 4FHXA 2DR9A 4PGQA 4F5OA 1KNYA 4P2HA 4NY8A 9ICLA 5CA7A 4ATBA 3WFQE 4TUPA 5DKWA 9ICVA 4RWPA 4NKUA 4K9BA 1ZQVA 8ICZA 2ZH4A 4WC0A 3H39A 5B3PA 2BCSA 9ICAA 5HRDA 1ZQLA 4IG8A 3NWIA 2IUBA 4YD1A 9ICPA 4OAFA 4OAHA 4AT9B 4M2YA 5DB8A 8ICAA 7ICLA 3RJFA 4O9MA 1ZQOA 4WC5A 3TFSA 8ICFA 8ICSA 4UAZA 7ICHA 4AT8A 5J2EA 4UD5A 4M5DA 5J2GA 7ICSA 4R63A 4PHEA 4I27A 3OWGA 4X4SA 4F5RA 3HWTA 4LT6A 3ERCC 4KLFA 8ICWA 3V7KA 1R89A 4F5QA 5J0OA 9ICFA 9ICQA 4UB2A 8ICHA 4QZGA 4RQ5A 2B56A 7ICMA 4XRHA 5J2AA 3AQMA 5D61A 4P4MA 3MGHA 4EEDA 2FMPA 4K98A 4Z6FA 4YMNA 4QZDA 5HREA 4YD2A 7ICOA 4WQKA 4I2EA 4I28A 3H38A 4RQ2A 3OGUA 4MKPA 2HN2A 3JPOA 4KLGA 1RZTA 3UQ0A 1ZQFA 5IIJA 5J0QA 1UETA 2IHOA 4TUSA 1XSNA 3JZ0A 3TFRA 3HW8A 4EP7A 4M04A 4JWMA 8ICCA 4I29A 1ZQKA 2M2WA 3AQKA 4YCXA 5J0RA 8ICLA 5J2DA 4MFFA 4EEBA 3MDCA 4I2CA 4GXIA 2I9GA 9ICHA 2BCUA 8ICBA 1JMSA 5J2FA 4RQ1A 9ICEA 3UXOA 3NVOA 3MCRA 2B4VA 1R8AA 3H3AA 4UB5A 3ISBA 4UB1A 8ICGA 7ICRA 5HRKA 4KLSA 4RT3A 1ZQDA 3RH5A 1ZQJA 5DBCA 2ZH6A 4E7XA 3RJJA 8ICIA 4DO9A 5HRIA 2PFOA 2VANA 3RJHA 7ICTA 2B51A 1ZQHA 5D62A 1TV9A 2ZHAA 3OVBA 5J2CA 4PGYA 3OV7A 1ZQWA 4LEYA 4X4VA 5CR0A 1VJ7A 4FO6A 4X4PA 2GAFD 8ICQA 1MIVA 3ISDA 2ZH2A 2ISOA 5IIIA 1MIWA 3MGIA 4X4TA 5DB7A 5F2VO 4DOAA 9ICGA 1ZQCA 3MBYA 4KLMA 1ZQNA 4TURA 3K7DA 1Q78A 5DDMA 1ZQMA 5DB6A 5J0YA 1BPDA 1FA0A 5HRLA 1ZQTA 2DR7A 7ICIA 3JPSA 5J2IA 5J2KA 4KLLA 1ZQUA 2W9MA 4QZFA 2DR5A 4AT7B 5J0TA 5J0XA 3JPNA 4K96A 1ZQZA 1MQ2A 3ER9B 4QZ9A 8ICEA 4KLIA 5D49A 9ICTA 3LQCB 1OU5A 3HIYA 3RJGA 4P4OA 2PFNA 2DVIA 4X0AA 3C5FA 4QZCA 3UXPA 1ZQBA 5D63A 9ICSA 2DRAA 4OAGA 4LEZA 1NO5A 4NM2A 5CFTA 1ZQRA 3OUYB 4QZ8A 2PFQA 3RJEA 8ICTA 4LVSA 3RH6A 4UB4A 4X4RA 5CHGA 2ISPA 5EOZA 5CB1A 1ZQIA 5IIKA 2FMSA 3GDXA 2BPFA 1XSLA 1ZQEA 1ZQGA 5CJ7A 4YMMA 4HX0A 4PHPA 5J2HA 2PBEA 5BOLA 1TFWA 4PHDA 9ICWA 5BOMA 4RQ6A 4OAIZ 1MIYA 3C5GA 5JTGA 4UBBA 2DR8A 4NLNA 4FH5A 4KLQA 3HX0A 4F5PA 4I2FA 5HHHA 4LZGA 5HRHA 4NKTA 5J2JA 4NXZA 4RPYA 5D46A 3B0YA 7ICUA 3C2LA 4I2BA 1KEJA 3UXNA 4ATBB 1BPEA 1BPZA 1BPXA 4K4HA 4KLOA 3UPQA 4I2AA 2BCQA 3PMNA 4Z6DA 3AU6A
chains in the Genus database with same CATH topology
4ATBA 4FO1A 4X4QA 2B51A 4NXUA 5D62A 4E8FA 4NKUA 2ZHAA 4K97A 4K9BA 3OVBA 3OV7A 2ZH4A 4K9AA 4LEYA 4X4UA 4X4VA 1Q79A 4X4PA 4FHYA 2GAFD 5B3PA 2ZH2A 3EF2A 4WQLA 4AT8B 4X4TA 4KB6A 4OAFA 4OAHA 4AT9B 2ZHBA 2EWRA 4FHVA 3NYBA 4FHWA 4JLXA 4E80A 4X4OA 5CFUA 3K7DA 4AT8A 1Q78A 4UD5A 4AT9A 4M5DA 1FA0A 2DR7A 3HJ4A 3OWGA 4X4SA 4LT6A 3ERCC 4UD4A 4K99A 1R89A 2DR5A 4AT7B 2FCLA 4WOYA 5CFSA 2B56A 4K96A 3ER9B 2ZH7A 4AT7A 4FHPA 1UEUA 5D61A 3HIYA 1R8BA 4XJEA 4JLZA 4LEVA 4NXXA 4K98A 3ER8C 2DVIA 5D63A 4WQKA 2DRAA 4O68A 4OAGA 4LEZA 2O1PA 4O69A 4FH3A 1GPJA 5CFTA 3PHZA 1F5AA 3OUYB 4KM5A 4X4NA 2HHPA 4MKPA 2ZH5A 4X4RA 4NXVA 3HJ1A 3OUYA 1TFYA 1UETA 2IHOA 3OVSA 2Q66A 2GA9D 5B3QA 4N7RA 4O67A 3NKUA 4EP7A 1UEVA 4HX0A 4K8VA 1TFWA 4OAIZ 2DRBA 4LEWA 4O6AA 2DR8A 4FH5A 5CHEA 2ZH9A 3MCRA 1R8CA 2B4VA 1R8AA 2ZH8A 4NXTA 4NKTA 4WH5A 4NXWA 4ATBB 3C66A 2ZH6A 4E7XA 2ZH1A 2ZH3A 4FHXA 3OVAA 2DR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AT9 A;  4K8V A;  4LEV A;  4ATB A;  4OAI Z;  4NXU A;  4O68 A;  4OAG A;  4AT8 A;  4LEW A;  4O69 A;  4O6A A;  4LEZ A;  4K97 A;  4K9B A;  4KM5 A;  4K9A A;  4LEY A;  4MKP A;  4K99 A;  4NXT A;  4AT7 B;  4NXV A;  4WOY A;  4AT8 B;  4KB6 A;  4K98 A;  4NXW A;  4OAH A;  4OAF A;  4AT9 B;  4ATB B;  4K96 A;  4O67 A;  4AT7 A;  4JLX A;  4JLZ A;  4NXX A; 
#chains in the Genus database with same CATH topology
 4I0U A;  5J2B A;  3JPQ A;  4K97 A;  4M9G A;  4MF2 A;  5CWR A;  2BE3 A;  3PML A;  9ICX A;  2BBH A;  4WC1 A;  4GXJ A;  9ICK A;  7ICV A;  4WQL A;  7ICQ A;  4RPZ A;  4XQ8 A;  4QZE A;  4AT8 B;  4KB6 A;  1ZJM A;  1YLQ A;  1V4A A;  2ZHB A;  4UAY A;  2EWR A;  1NOM A;  3NYB A;  8ICM A;  4JLX A;  4RQ0 A;  3AUO A;  4P4P A;  4I2H A;  1ZQX A;  4AT9 A;  4M9H A;  4O5C A;  4RWO A;  3RJI A;  5D4B A;  5CP2 A;  2M2T A;  4IQU A;  4LZD A;  4DOB A;  4UD4 A;  3K75 D;  4K99 A;  4PPX A;  4YMO A;  2FCL A;  4S3N A;  4WC7 A;  9ICO A;  5CFS A;  4XQ7 A;  2NRK A;  4M9N A;  4QZB A;  9ICN A;  4FHP A;  4XJE A;  5DDY A;  4NXX A;  3WFR E;  1RPL A;  5J29 A;  3WFP A;  2P66 A;  4RPX A;  1ZQY A;  8ICJ A;  4M9J A;  4IQW A;  4KLD A;  2O1P A;  4PHA A;  4M47 A;  4WC4 A;  4KM5 A;  4X4N A;  5DBB A;  9ICJ A;  2ZH5 A;  1BPY A;  4EBJ A;  3LK9 A;  1TFY A;  4XA5 A;  3V7J A;  2Q66 A;  2PFP A;  4WCW A;  4N7R A;  4O67 A;  1PX5 A;  1UEV A;  4R64 A;  5J0P A;  3V72 A;  5DB9 A;  4X0B A;  4WBZ A;  4MFC A;  4M0A A;  4LEW A;  2BCR A;  4NLK A;  5DEC A;  3L9D A;  7ICE A;  8ICU A;  5IIO A;  5DBA A;  3JPT A;  8ICK A;  2ZH9 A;  1JAJ A;  1R8C A;  3AU2 A;  9ICB A;  4NXT A;  4EGW A;  3AQL A;  4WH5 A;  4MFA A;  3B0X A;  1JN3 A;  4DOC A;  3V7L A;  4NXW A;  4KLH A;  3MDA A;  3C66 A;  1JQR A;  1BPB A;  4Z6C A;  2BBJ A;  3JPR A;  2M2V A;  3OVA A;  2FMQ A;  5J0W A;  4RQ8 A;  4YN4 A;  4WC3 A;  4EV6 A;  4FO1 A;  4X4Q A;  4NXU A;  5HRG A;  4KLJ A;  3JYY A;  4E8F A;  4XUS A;  4RQ7 A;  3C2M A;  4EBK A;  2ID1 A;  4M9L A;  5J0S A;  4K9A A;  7ICK A;  4X4U A;  5TZV A;  8ICY A;  1Q79 A;  4FHY A;  7ICG A;  4O5K A;  1HUZ A;  4KLU A;  3UPS A;  4NM1 A;  4KLT A;  2BPG A;  4RT2 A;  3EF2 A;  5DED A;  4WBY A;  4IQV A;  5J0U A;  7ICP A;  4WC6 A;  8ICV A;  2BPC A;  5HRB A;  4UAW A;  4QZI A;  3CK6 A;  4FHV A;  4FHW A;  3C2K A;  3RJK A;  4X4O A;  4E80 A;  5HHI A;  4QZH A;  5CFU A;  3RH4 A;  4RWN A;  1ZQS A;  9ICR A;  4KLE A;  8ICN A;  3ISC A;  2IHM A;  4UBC A;  1ZQP A;  3HJ4 A;  1VFG A;  1TVA A;  4I2I A;  4Z6E A;  4PH5 A;  1XSP A;  4WOY A;  4F5N A;  4PGX A;  9ICU A;  1ZQQ A;  1ZJN A;  3UQ2 A;  5IIN A;  2PXI A;  2ZH7 A;  4AT7 A;  1UEU A;  1MQ3 A;  2BCV A;  3PNC A;  4K4G A;  1R8B A;  4JLZ A;  3JPP A;  4QZA A;  4JWN A;  9ICC A;  4LEV A;  3C18 A;  3H37 A;  4K4I A;  3ER8 C;  8ICR A;  4R66 A;  4O68 A;  4O69 A;  4FH3 A;  1GPJ A;  5IIM A;  5BPC A;  8ICX A;  3PHZ A;  1F5A A;  7ICJ A;  4RWQ A;  4R65 A;  2HHP A;  4I2J A;  4RQ4 A;  8ICO A;  4TUQ A;  2M2U A;  2O5A A;  7ICF A;  5HRF A;  1KDH A;  4NXV A;  3HJ1 A;  3OUY A;  3OVS A;  2GA9 D;  5HR9 A;  5B3Q A;  4I2D A;  4I2G A;  3NKU A;  9ICM A;  2HN1 A;  3WFS C;  4MF8 A;  4WC2 A;  5IIL A;  4RQ3 A;  4K8V A;  2GWS A;  4O5E A;  4IQT A;  2DRB A;  4O6A A;  3AQN A;  8ICP A;  4GXK A;  1ZQA A;  2RFF A;  5CHE A;  4NLZ A;  4UB3 A;  2ZH8 A;  1HUO A;  9ICI A;  1WOT A;  3JCF A;  4X5V A;  3WFO A;  7ICN A;  2ZH1 A;  2ZH3 A;  5HC9 A;  4FHX A;  2DR9 A;  4PGQ A;  4F5O A;  1KNY A;  4P2H A;  4NY8 A;  9ICL A;  5CA7 A;  4ATB A;  3WFQ E;  4TUP A;  5DKW A;  9ICV A;  4RWP A;  4NKU A;  4K9B A;  1ZQV A;  8ICZ A;  2ZH4 A;  4WC0 A;  3H39 A;  5B3P A;  2BCS A;  9ICA A;  5HRD A;  1ZQL A;  4IG8 A;  3NWI A;  2IUB A;  4YD1 A;  9ICP A;  4OAF A;  4OAH A;  4AT9 B;  4M2Y A;  5DB8 A;  8ICA A;  7ICL A;  3RJF A;  4O9M A;  1ZQO A;  4WC5 A;  3TFS A;  8ICF A;  8ICS A;  4UAZ A;  7ICH A;  4AT8 A;  5J2E A;  4UD5 A;  4M5D A;  5J2G A;  7ICS A;  4R63 A;  4PHE A;  4I27 A;  3OWG A;  4X4S A;  4F5R A;  3HWT A;  4LT6 A;  3ERC C;  4KLF A;  8ICW A;  3V7K A;  1R89 A;  4F5Q A;  5J0O A;  9ICF A;  9ICQ A;  4UB2 A;  8ICH A;  4QZG A;  4RQ5 A;  2B56 A;  7ICM A;  4XRH A;  5J2A A;  3AQM A;  5D61 A;  4P4M A;  3MGH A;  4EED A;  2FMP A;  4K98 A;  4Z6F A;  4YMN A;  4QZD A;  5HRE A;  4YD2 A;  7ICO A;  4WQK A;  4I2E A;  4I28 A;  3H38 A;  4RQ2 A;  3OGU A;  4MKP A;  2HN2 A;  3JPO A;  4KLG A;  1RZT A;  3UQ0 A;  1ZQF A;  5IIJ A;  5J0Q A;  1UET A;  2IHO A;  4TUS A;  1XSN A;  3JZ0 A;  3TFR A;  3HW8 A;  4EP7 A;  4M04 A;  4JWM A;  8ICC A;  4I29 A;  1ZQK A;  2M2W A;  3AQK A;  4YCX A;  5J0R A;  8ICL A;  5J2D A;  4MFF A;  4EEB A;  3MDC A;  4I2C A;  4GXI A;  2I9G A;  9ICH A;  2BCU A;  8ICB A;  1JMS A;  5J2F A;  4RQ1 A;  9ICE A;  3UXO A;  3NVO A;  3MCR A;  2B4V A;  1R8A A;  3H3A A;  4UB5 A;  3ISB A;  4UB1 A;  8ICG A;  7ICR A;  5HRK A;  4KLS A;  4RT3 A;  1ZQD A;  3RH5 A;  1ZQJ A;  5DBC A;  2ZH6 A;  4E7X A;  3RJJ A;  8ICI A;  4DO9 A;  5HRI A;  2PFO A;  2VAN A;  3RJH A;  7ICT A;  2B51 A;  1ZQH A;  5D62 A;  1TV9 A;  2ZHA A;  3OVB A;  5J2C A;  4PGY A;  3OV7 A;  1ZQW A;  4LEY A;  4X4V A;  5CR0 A;  1VJ7 A;  4FO6 A;  4X4P A;  2GAF D;  8ICQ A;  1MIV A;  3ISD A;  2ZH2 A;  2ISO A;  5III A;  1MIW A;  3MGI A;  4X4T A;  5DB7 A;  5F2V O;  4DOA A;  9ICG A;  1ZQC A;  3MBY A;  4KLM A;  1ZQN A;  4TUR A;  3K7D A;  1Q78 A;  5DDM A;  1ZQM A;  5DB6 A;  5J0Y A;  1BPD A;  1FA0 A;  5HRL A;  1ZQT A;  2DR7 A;  7ICI A;  3JPS A;  5J2I A;  5J2K A;  4KLL A;  1ZQU A;  2W9M A;  4QZF A;  2DR5 A;  4AT7 B;  5J0T A;  5J0X A;  3JPN A;  4K96 A;  1ZQZ A;  1MQ2 A;  3ER9 B;  4QZ9 A;  8ICE A;  4KLI A;  5D49 A;  9ICT A;  3LQC B;  1OU5 A;  3HIY A;  3RJG A;  4P4O A;  2PFN A;  2DVI A;  4X0A A;  3C5F A;  4QZC A;  3UXP A;  1ZQB A;  5D63 A;  9ICS A;  2DRA A;  4OAG A;  4LEZ A;  1NO5 A;  4NM2 A;  5CFT A;  1ZQR A;  3OUY B;  4QZ8 A;  2PFQ A;  3RJE A;  8ICT A;  4LVS A;  3RH6 A;  4UB4 A;  4X4R A;  5CHG A;  2ISP A;  5EOZ A;  5CB1 A;  1ZQI A;  5IIK A;  2FMS A;  3GDX A;  2BPF A;  1XSL A;  1ZQE A;  1ZQG A;  5CJ7 A;  4YMM A;  4HX0 A;  4PHP A;  5J2H A;  2PBE A;  5BOL A;  1TFW A;  4PHD A;  9ICW A;  5BOM A;  4RQ6 A;  4OAI Z;  1MIY A;  3C5G A;  5JTG A;  4UBB A;  2DR8 A;  4NLN A;  4FH5 A;  4KLQ A;  3HX0 A;  4F5P A;  4I2F A;  5HHH A;  4LZG A;  5HRH A;  4NKT A;  5J2J A;  4NXZ A;  4RPY A;  5D46 A;  3B0Y A;  7ICU A;  3C2L A;  4I2B A;  1KEJ A;  3UXN A;  4ATB B;  1BPE A;  1BPZ A;  1BPX A;  4K4H A;  4KLO A;  3UPQ A;  4I2A A;  2BCQ A;  3PMN A;  4Z6D A;  3AU6 A; 
#chains in the Genus database with same CATH homology
 4ATB A;  4FO1 A;  4X4Q A;  2B51 A;  4NXU A;  5D62 A;  4E8F A;  4NKU A;  2ZHA A;  4K97 A;  4K9B A;  3OVB A;  3OV7 A;  2ZH4 A;  4K9A A;  4LEY A;  4X4U A;  4X4V A;  1Q79 A;  4X4P A;  4FHY A;  2GAF D;  5B3P A;  2ZH2 A;  3EF2 A;  4WQL A;  4AT8 B;  4X4T A;  4KB6 A;  4OAF A;  4OAH A;  4AT9 B;  2ZHB A;  2EWR A;  4FHV A;  3NYB A;  4FHW A;  4JLX A;  4E80 A;  4X4O A;  5CFU A;  3K7D A;  4AT8 A;  1Q78 A;  4UD5 A;  4AT9 A;  4M5D A;  1FA0 A;  2DR7 A;  3HJ4 A;  3OWG A;  4X4S A;  4LT6 A;  3ERC C;  4UD4 A;  4K99 A;  1R89 A;  2DR5 A;  4AT7 B;  2FCL A;  4WOY A;  5CFS A;  2B56 A;  4K96 A;  3ER9 B;  2ZH7 A;  4AT7 A;  4FHP A;  1UEU A;  5D61 A;  3HIY A;  1R8B A;  4XJE A;  4JLZ A;  4LEV A;  4NXX A;  4K98 A;  3ER8 C;  2DVI A;  5D63 A;  4WQK A;  2DRA A;  4O68 A;  4OAG A;  4LEZ A;  2O1P A;  4O69 A;  4FH3 A;  1GPJ A;  5CFT A;  3PHZ A;  1F5A A;  3OUY B;  4KM5 A;  4X4N A;  2HHP A;  4MKP A;  2ZH5 A;  4X4R A;  4NXV A;  3HJ1 A;  3OUY A;  1TFY A;  1UET A;  2IHO A;  3OVS A;  2Q66 A;  2GA9 D;  5B3Q A;  4N7R A;  4O67 A;  3NKU A;  4EP7 A;  1UEV A;  4HX0 A;  4K8V A;  1TFW A;  4OAI Z;  2DRB A;  4LEW A;  4O6A A;  2DR8 A;  4FH5 A;  5CHE A;  2ZH9 A;  3MCR A;  1R8C A;  2B4V A;  1R8A A;  2ZH8 A;  4NXT A;  4NKT A;  4WH5 A;  4NXW A;  4ATB B;  3C66 A;  2ZH6 A;  4E7X A;  2ZH1 A;  2ZH3 A;  4FHX A;  3OVA A;  2DR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...