4OAGA

Crystal structure of the cytosolic domain of mouse mid51 bound to adp
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
330
structure length
328
Chain Sequence
SLQEKLLSYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEVLLQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
publication title The Mitochondrial Fission Receptor MiD51 Requires ADP as a Cofactor.
pubmed doi rcsb
source organism Mus musculus
total genus 112
structure length 328
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4oagA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4oagA02
4LEWA 4O69A 4K9AA 4WOYA 4K98A 4ATBB 4NXVA 4AT9A 4AT7A 4MKPA 4JLZA 4OAGA 4K8VA 4K9BA 4AT8B 4NXUA 4LEVA 4O68A 4JLXA 4NXXA 4LEYA 4OAFA 4LEZA 4ATBA 4K96A 4O67A 4KB6A 4AT7B 4KM5A 4AT9B 4NXWA 4NXTA 4K99A 4K97A 4OAIZ 4OAHA 4O6AA 4AT8A
chains in the Genus database with same CATH superfamily
4KLGA 5CP2A 4M9LA 5DDMA 5D49A 2VANA 4KLSA 5J0WA 5CR0A 5IIOA 7ICTA 4E7XA 4WC3A 3OVSA 2BPFA 3ISCA 5HR9A 4X4RA 3AQNA 4I2IA 4XA5A 8ICYA 3MGIA 2PFOA 5J0YA 3CK6A 1ZJMA 1BPZA 1ZQDA 2B51A 4X4QA 5J0RA 4FH3A 7ICIA 8ICGA 4OAHA 3MDCA 3MBYA 4AT8A 9ICKA 1V4AA 4K9AA 4NLNA 2HN2A 3UQ0A 3ER9B 8ICOA 5BOLA 7ICEA 4X0BA 1OU5A 5CWRA 2DVIA 3OWGA 3UQ2A 5DB6A 4R64A 2DRBA 4RQ4A 4R63A 4M47A 3OV7A 1MIVA 4O68A 4NXXA 4EBKA 4LEZA 1JMSA 4O67A 2PFQA 4UD4A 4DOCA 4IQTA 4QZ9A 8ICBA 8ICPA 2ZH3A 5HRFA 3RJGA 4O69A 4WC6A 4M9HA 2BCVA 3RJHA 3MGHA 2DR9A 2DR7A 4Z6EA 5EOZA 1JN3A 4YD1A 4FH5A 8ICZA 4M04A 2FCLA 4QZGA 1HUZA 4MFAA 4NY8A 2ZH4A 4LT6A 1BPYA 2M2UA 2HHPA 5CFSA 5D4BA 9ICMA 4LEVA 4O5CA 4PHAA 2ZH7A 4IQWA 5J0XA 1ZQCA 4OAFA 5DDYA 5D62A 2B4VA 4MFCA 5HRDA 5DBBA 2ZH9A 2ZH6A 9ICWA 3JPQA 4QZ8A 4O6AA 3L9DA 4WCWA 3C2KA 4WOYA 5D61A 4K98A 1R8CA 4F5PA 3C2MA 4M9JA 1MIWA 4EP7A 4M9NA 9ICAA 4RWOA 2BBJA 4AT8B 4NXUA 4EEBA 7ICPA 1JAJA 5IINA 2ID1A 3WFOA 4KLJA 2GWSA 8ICEA 4I2AA 3OVAA 1ZQLA 4RQ1A 3ERCC 4DOAA 5JTGA 3NYBA 4PHPA 4F5OA 3C2LA 3UXNA 4K4IA 1KNYA 4AT9A 3WFPA 4KLFA 9ICRA 5CHEA 5HRLA 1ZQXA 4X4PA 1PX5A 5IIIA 4GXKA 5TZVA 4FO6A 4TURA 7ICNA 4WC5A 5IILA 4RQ7A 4KLEA 4RT3A 2HN1A 7ICQA 3JPSA 1ZJNA 1GPJA 1VFGA 3WFRE 1KEJA 5CHGA 1F5AA 4WC4A 5J0PA 1MQ3A 1Q79A 4UAYA 3TFSA 5D63A 9ICIA 5IIJA 4XRHA 2M2VA 7ICSA 4YCXA 3RH5A 8ICJA 8ICSA 4K8VA 2ZH8A 5CB1A 2BPGA 2M2WA 5DECA 5DBAA 4LZGA 8ICKA 3UXOA 1ZQPA 4I2GA 9ICVA 8ICIA 5B3PA 5J2GA 4LEYA 2ISPA 1UETA 4IQUA 1XSPA 3V72A 8ICCA 1ZQJA 1ZQIA 2Q66A 4UB4A 4OAIZ 1BPDA 3C5GA 4UD5A 3H39A 2BCRA 4WQKA 5CFUA 1ZQSA 9ICXA 4QZEA 4MFFA 5CJ7A 2ZHBA 1ZQNA 4UAZA 4GXIA 4PGXA 4N7RA 2BBHA 1BPBA 3PMNA 1ZQBA 4PHDA 5HRBA 4FHYA 1NOMA 4FHXA 1ZQOA 3RJFA 5J0SA 4WC0A 4YMNA 3JYYA 1YLQA 4X4VA 3AQMA 4YD2A 3LK9A 8ICFA 8ICNA 9ICJA 7ICFA 4PHEA 5DBCA 3GDXA 1ZQWA 4NXVA 3UPSA 3RJJA 4FO1A 4P4OA 3HX0A 1ZQAA 7ICKA 3V7LA 5HRIA 1KDHA 3RH4A 4KLLA 2GA9D 4P2HA 8ICWA 4PGQA 3OGUA 1WOTA 1ZQTA 4XJEA 4X5VA 4K96A 4I29A 4UB5A 1R8AA 4E80A 4X4UA 5D46A 2RFFA 3C66A 9ICGA 4EGWA 8ICRA 4WBYA 5BPCA 5J2IA 4K9BA 7ICRA 4Z6DA 2PFPA 3AUOA 4UAWA 1MIYA 3RJKA 3V7JA 5J2HA 7ICHA 4NXTA 1ZQYA 4K97A 2FMSA 4KLTA 4M0AA 4WH5A 4UB2A 3JZ0A 5DB9A 4RPYA 2P66A 4FHPA 4QZCA 3EF2A 4PPXA 3LQCB 1UEVA 4QZAA 5F2VO 3C18A 4K4GA 4UBBA 7ICMA 4NKTA 4JLZA 5HRGA 3JPPA 4OAGA 2NRKA 4S3NA 4M9GA 5IIKA 9ICLA 2FMQA 5J2DA 4GXJA 4I2BA 4NKUA 3NWIA 3PNCA 4K4HA 2PBEA 4KLQA 1ZQGA 2PFNA 3JPNA 8ICAA 3MCRA 3JPTA 1XSNA 3JCFA 4NM2A 2B56A 5HRHA 4Z6FA 8ICLA 3HIYA 4TUQA 4UBCA 3WFQE 1R89A 4I2HA 3PHZA 3RJEA 4QZDA 4RQ5A 4X0AA 3HWTA 2BCSA 1MQ2A 2O5AA 2O1PA 4KLUA 4UB3A 4PGYA 4MF8A 9ICTA 1HUOA 1FA0A 3K7DA 4NLKA 1TVAA 3AQKA 2ZHAA 2IHOA 2FMPA 1UEUA 4XQ8A 4I2JA 4WBZA 4E8FA 5HHIA 3ISDA 2IHMA 4NLZA 4Z6CA 3H37A 5DB8A 4YMOA 9ICPA 7ICOA 3PMLA 5J2CA 9ICNA 4RWNA 4RQ6A 5HRKA 2ZH1A 3TFRA 5DEDA 3NVOA 4JWNA 2ZH5A 9ICUA 1XSLA 4RPZA 4M5DA 4RQ3A 4QZIA 3AQLA 4R65A 3OVBA 8ICHA 4NXZA 4AT9B 3C5FA 4X4OA 1ZQQA 1ZQHA 7ICUA 4RWQA 3UXPA 8ICXA 4KLIA 9ICFA 7ICLA 1ZQVA 4I2EA 4NM1A 2GAFD 4P4MA 9ICCA 2ISOA 3JPOA 4XUSA 4AT7A 4KLDA 4KLHA 4O5EA 5BOMA 2PXIA 4I28A 1RPLA 4LVSA 4WQLA 5J2EA 1ZQKA 2BCUA 4X4NA 3H3AA 4JLXA 3RJIA 9ICSA 1TV9A 1ZQMA 2M2TA 1ZQFA 4ATBA 5HREA 5J0UA 4NXWA 5J2BA 4I2CA 5J2KA 3UPQA 4O5KA 2BPCA 4LEWA 4TUSA 3WFSC 4FHVA 1ZQZA 5B3QA 5J0TA 4F5RA 1RZTA 3ISBA 2DRAA 5J0OA 3HW8A 3OUYA 2ZH2A 2EWRA 4X4SA 9ICQA 4RQ2A 4WC1A 4UB1A 3V7KA 5DKWA 8ICTA 1ZQEA 4PH5A 4EEDA 4RWPA 4IG8A 1TFYA 3ER8C 4QZBA 3MDAA 4M2YA 2W9MA 9ICOA 2BE3A 4F5QA 4X4TA 7ICVA 5CA7A 5HHHA 3H38A 4KLMA 4TUPA 3B0YA 5J2AA 1ZQRA 4I2FA 7ICGA 4MKPA 4I27A 5J0QA 4DOBA 3NKUA 4RQ8A 4JWMA 1Q78A 5DB7A 4EBJA 4MF2A 4I0UA 1JQRA 4YN4A 4RPXA 4KB6A 8ICUA 4AT7B 4KM5A 4WC2A 5IIMA 9ICHA 4LZDA 8ICVA 4XQ7A 1R8BA 1TFWA 3K75D 5J2JA 4KLOA 4IQVA 4O9MA 4RT2A 9ICEA 5HC9A 4HX0A 3AU2A 4ATBB 4P4PA 2I9GA 7ICJA 3HJ1A 4YMMA 4F5NA 1BPXA 8ICMA 3AU6A 1NO5A 2BCQA 1BPEA 2IUBA 5J29A 4WC7A 2DR5A 8ICQA 5CFTA 3HJ4A 3OUYB 3B0XA 4FHWA 4I2DA 1ZQUA 3JPRA 4EV6A 2DR8A 4QZHA 1VJ7A 4K99A 3RH6A 4DO9A 4QZFA 5J2FA 4R66A 4RQ0A 9ICBA
chains in the Genus database with same CATH topology
3ERCC 1R8AA 4E80A 4X4UA 3C66A 3NYBA 2GAFD 4AT9A 4AT7A 5CHEA 4X4PA 4E7XA 4K9BA 3OVSA 4WQLA 4X4NA 4JLXA 4X4RA 4ATBA 4NXWA 2B51A 4NXTA 4X4QA 1GPJA 4FH3A 4K97A 4OAHA 1F5AA 4WH5A 4AT8A 4LEWA 4K9AA 4FHVA 5B3QA 1Q79A 4FHPA 3EF2A 5D63A 2DRAA 3ER9B 3OUYA 1UEVA 2ZH2A 2EWRA 4X4SA 2DVIA 3OWGA 4NKTA 4JLZA 4OAGA 4K8VA 2ZH8A 2DRBA 3OV7A 4NKUA 4O68A 5B3PA 4NXXA 4LEYA 4LEZA 1TFYA 1UETA 4O67A 3ER8C 3MCRA 4UD4A 2B56A 2Q66A 4OAIZ 3HIYA 4X4TA 1R89A 2ZH3A 3PHZA 4O69A 4UD5A 2DR9A 2DR7A 4WQKA 5CFUA 4FH5A 4MKPA 2O1PA 2ZHBA 2FCLA 2ZH4A 4LT6A 2HHPA 3NKUA 5CFSA 4LEVA 4N7RA 2ZH7A 1Q78A 1FA0A 3K7DA 4OAFA 2ZHAA 4FHYA 4KB6A 5D62A 4AT7B 2B4VA 4KM5A 4FHXA 2IHOA 1TFWA 1R8BA 2ZH9A 1UEUA 2ZH6A 4E8FA 4X4VA 4O6AA 4WOYA 5D61A 4K98A 1R8CA 4HX0A 4ATBB 4NXVA 3HJ1A 4EP7A 4FO1A 2ZH1A 4AT8B 4NXUA 2ZH5A 4M5DA 2DR5A 5CFTA 3HJ4A 3OUYB 4FHWA 3OVBA 2GA9D 4AT9B 2DR8A 4X4OA 4K99A 4XJEA 3OVAA 4K96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LEW A;  4O69 A;  4K9A A;  4WOY A;  4K98 A;  4ATB B;  4NXV A;  4AT9 A;  4AT7 A;  4MKP A;  4JLZ A;  4OAG A;  4K8V A;  4K9B A;  4AT8 B;  4NXU A;  4LEV A;  4O68 A;  4JLX A;  4NXX A;  4LEY A;  4OAF A;  4LEZ A;  4ATB A;  4K96 A;  4O67 A;  4KB6 A;  4AT7 B;  4KM5 A;  4AT9 B;  4NXW A;  4NXT A;  4K99 A;  4K97 A;  4OAI Z;  4OAH A;  4O6A A;  4AT8 A; 
#chains in the Genus database with same CATH topology
 4KLG A;  5CP2 A;  4M9L A;  5DDM A;  5D49 A;  2VAN A;  4KLS A;  5J0W A;  5CR0 A;  5IIO A;  7ICT A;  4E7X A;  4WC3 A;  3OVS A;  2BPF A;  3ISC A;  5HR9 A;  4X4R A;  3AQN A;  4I2I A;  4XA5 A;  8ICY A;  3MGI A;  2PFO A;  5J0Y A;  3CK6 A;  1ZJM A;  1BPZ A;  1ZQD A;  2B51 A;  4X4Q A;  5J0R A;  4FH3 A;  7ICI A;  8ICG A;  4OAH A;  3MDC A;  3MBY A;  4AT8 A;  9ICK A;  1V4A A;  4K9A A;  4NLN A;  2HN2 A;  3UQ0 A;  3ER9 B;  8ICO A;  5BOL A;  7ICE A;  4X0B A;  1OU5 A;  5CWR A;  2DVI A;  3OWG A;  3UQ2 A;  5DB6 A;  4R64 A;  2DRB A;  4RQ4 A;  4R63 A;  4M47 A;  3OV7 A;  1MIV A;  4O68 A;  4NXX A;  4EBK A;  4LEZ A;  1JMS A;  4O67 A;  2PFQ A;  4UD4 A;  4DOC A;  4IQT A;  4QZ9 A;  8ICB A;  8ICP A;  2ZH3 A;  5HRF A;  3RJG A;  4O69 A;  4WC6 A;  4M9H A;  2BCV A;  3RJH A;  3MGH A;  2DR9 A;  2DR7 A;  4Z6E A;  5EOZ A;  1JN3 A;  4YD1 A;  4FH5 A;  8ICZ A;  4M04 A;  2FCL A;  4QZG A;  1HUZ A;  4MFA A;  4NY8 A;  2ZH4 A;  4LT6 A;  1BPY A;  2M2U A;  2HHP A;  5CFS A;  5D4B A;  9ICM A;  4LEV A;  4O5C A;  4PHA A;  2ZH7 A;  4IQW A;  5J0X A;  1ZQC A;  4OAF A;  5DDY A;  5D62 A;  2B4V A;  4MFC A;  5HRD A;  5DBB A;  2ZH9 A;  2ZH6 A;  9ICW A;  3JPQ A;  4QZ8 A;  4O6A A;  3L9D A;  4WCW A;  3C2K A;  4WOY A;  5D61 A;  4K98 A;  1R8C A;  4F5P A;  3C2M A;  4M9J A;  1MIW A;  4EP7 A;  4M9N A;  9ICA A;  4RWO A;  2BBJ A;  4AT8 B;  4NXU A;  4EEB A;  7ICP A;  1JAJ A;  5IIN A;  2ID1 A;  3WFO A;  4KLJ A;  2GWS A;  8ICE A;  4I2A A;  3OVA A;  1ZQL A;  4RQ1 A;  3ERC C;  4DOA A;  5JTG A;  3NYB A;  4PHP A;  4F5O A;  3C2L A;  3UXN A;  4K4I A;  1KNY A;  4AT9 A;  3WFP A;  4KLF A;  9ICR A;  5CHE A;  5HRL A;  1ZQX A;  4X4P A;  1PX5 A;  5III A;  4GXK A;  5TZV A;  4FO6 A;  4TUR A;  7ICN A;  4WC5 A;  5IIL A;  4RQ7 A;  4KLE A;  4RT3 A;  2HN1 A;  7ICQ A;  3JPS A;  1ZJN A;  1GPJ A;  1VFG A;  3WFR E;  1KEJ A;  5CHG A;  1F5A A;  4WC4 A;  5J0P A;  1MQ3 A;  1Q79 A;  4UAY A;  3TFS A;  5D63 A;  9ICI A;  5IIJ A;  4XRH A;  2M2V A;  7ICS A;  4YCX A;  3RH5 A;  8ICJ A;  8ICS A;  4K8V A;  2ZH8 A;  5CB1 A;  2BPG A;  2M2W A;  5DEC A;  5DBA A;  4LZG A;  8ICK A;  3UXO A;  1ZQP A;  4I2G A;  9ICV A;  8ICI A;  5B3P A;  5J2G A;  4LEY A;  2ISP A;  1UET A;  4IQU A;  1XSP A;  3V72 A;  8ICC A;  1ZQJ A;  1ZQI A;  2Q66 A;  4UB4 A;  4OAI Z;  1BPD A;  3C5G A;  4UD5 A;  3H39 A;  2BCR A;  4WQK A;  5CFU A;  1ZQS A;  9ICX A;  4QZE A;  4MFF A;  5CJ7 A;  2ZHB A;  1ZQN A;  4UAZ A;  4GXI A;  4PGX A;  4N7R A;  2BBH A;  1BPB A;  3PMN A;  1ZQB A;  4PHD A;  5HRB A;  4FHY A;  1NOM A;  4FHX A;  1ZQO A;  3RJF A;  5J0S A;  4WC0 A;  4YMN A;  3JYY A;  1YLQ A;  4X4V A;  3AQM A;  4YD2 A;  3LK9 A;  8ICF A;  8ICN A;  9ICJ A;  7ICF A;  4PHE A;  5DBC A;  3GDX A;  1ZQW A;  4NXV A;  3UPS A;  3RJJ A;  4FO1 A;  4P4O A;  3HX0 A;  1ZQA A;  7ICK A;  3V7L A;  5HRI A;  1KDH A;  3RH4 A;  4KLL A;  2GA9 D;  4P2H A;  8ICW A;  4PGQ A;  3OGU A;  1WOT A;  1ZQT A;  4XJE A;  4X5V A;  4K96 A;  4I29 A;  4UB5 A;  1R8A A;  4E80 A;  4X4U A;  5D46 A;  2RFF A;  3C66 A;  9ICG A;  4EGW A;  8ICR A;  4WBY A;  5BPC A;  5J2I A;  4K9B A;  7ICR A;  4Z6D A;  2PFP A;  3AUO A;  4UAW A;  1MIY A;  3RJK A;  3V7J A;  5J2H A;  7ICH A;  4NXT A;  1ZQY A;  4K97 A;  2FMS A;  4KLT A;  4M0A A;  4WH5 A;  4UB2 A;  3JZ0 A;  5DB9 A;  4RPY A;  2P66 A;  4FHP A;  4QZC A;  3EF2 A;  4PPX A;  3LQC B;  1UEV A;  4QZA A;  5F2V O;  3C18 A;  4K4G A;  4UBB A;  7ICM A;  4NKT A;  4JLZ A;  5HRG A;  3JPP A;  4OAG A;  2NRK A;  4S3N A;  4M9G A;  5IIK A;  9ICL A;  2FMQ A;  5J2D A;  4GXJ A;  4I2B A;  4NKU A;  3NWI A;  3PNC A;  4K4H A;  2PBE A;  4KLQ A;  1ZQG A;  2PFN A;  3JPN A;  8ICA A;  3MCR A;  3JPT A;  1XSN A;  3JCF A;  4NM2 A;  2B56 A;  5HRH A;  4Z6F A;  8ICL A;  3HIY A;  4TUQ A;  4UBC A;  3WFQ E;  1R89 A;  4I2H A;  3PHZ A;  3RJE A;  4QZD A;  4RQ5 A;  4X0A A;  3HWT A;  2BCS A;  1MQ2 A;  2O5A A;  2O1P A;  4KLU A;  4UB3 A;  4PGY A;  4MF8 A;  9ICT A;  1HUO A;  1FA0 A;  3K7D A;  4NLK A;  1TVA A;  3AQK A;  2ZHA A;  2IHO A;  2FMP A;  1UEU A;  4XQ8 A;  4I2J A;  4WBZ A;  4E8F A;  5HHI A;  3ISD A;  2IHM A;  4NLZ A;  4Z6C A;  3H37 A;  5DB8 A;  4YMO A;  9ICP A;  7ICO A;  3PML A;  5J2C A;  9ICN A;  4RWN A;  4RQ6 A;  5HRK A;  2ZH1 A;  3TFR A;  5DED A;  3NVO A;  4JWN A;  2ZH5 A;  9ICU A;  1XSL A;  4RPZ A;  4M5D A;  4RQ3 A;  4QZI A;  3AQL A;  4R65 A;  3OVB A;  8ICH A;  4NXZ A;  4AT9 B;  3C5F A;  4X4O A;  1ZQQ A;  1ZQH A;  7ICU A;  4RWQ A;  3UXP A;  8ICX A;  4KLI A;  9ICF A;  7ICL A;  1ZQV A;  4I2E A;  4NM1 A;  2GAF D;  4P4M A;  9ICC A;  2ISO A;  3JPO A;  4XUS A;  4AT7 A;  4KLD A;  4KLH A;  4O5E A;  5BOM A;  2PXI A;  4I28 A;  1RPL A;  4LVS A;  4WQL A;  5J2E A;  1ZQK A;  2BCU A;  4X4N A;  3H3A A;  4JLX A;  3RJI A;  9ICS A;  1TV9 A;  1ZQM A;  2M2T A;  1ZQF A;  4ATB A;  5HRE A;  5J0U A;  4NXW A;  5J2B A;  4I2C A;  5J2K A;  3UPQ A;  4O5K A;  2BPC A;  4LEW A;  4TUS A;  3WFS C;  4FHV A;  1ZQZ A;  5B3Q A;  5J0T A;  4F5R A;  1RZT A;  3ISB A;  2DRA A;  5J0O A;  3HW8 A;  3OUY A;  2ZH2 A;  2EWR A;  4X4S A;  9ICQ A;  4RQ2 A;  4WC1 A;  4UB1 A;  3V7K A;  5DKW A;  8ICT A;  1ZQE A;  4PH5 A;  4EED A;  4RWP A;  4IG8 A;  1TFY A;  3ER8 C;  4QZB A;  3MDA A;  4M2Y A;  2W9M A;  9ICO A;  2BE3 A;  4F5Q A;  4X4T A;  7ICV A;  5CA7 A;  5HHH A;  3H38 A;  4KLM A;  4TUP A;  3B0Y A;  5J2A A;  1ZQR A;  4I2F A;  7ICG A;  4MKP A;  4I27 A;  5J0Q A;  4DOB A;  3NKU A;  4RQ8 A;  4JWM A;  1Q78 A;  5DB7 A;  4EBJ A;  4MF2 A;  4I0U A;  1JQR A;  4YN4 A;  4RPX A;  4KB6 A;  8ICU A;  4AT7 B;  4KM5 A;  4WC2 A;  5IIM A;  9ICH A;  4LZD A;  8ICV A;  4XQ7 A;  1R8B A;  1TFW A;  3K75 D;  5J2J A;  4KLO A;  4IQV A;  4O9M A;  4RT2 A;  9ICE A;  5HC9 A;  4HX0 A;  3AU2 A;  4ATB B;  4P4P A;  2I9G A;  7ICJ A;  3HJ1 A;  4YMM A;  4F5N A;  1BPX A;  8ICM A;  3AU6 A;  1NO5 A;  2BCQ A;  1BPE A;  2IUB A;  5J29 A;  4WC7 A;  2DR5 A;  8ICQ A;  5CFT A;  3HJ4 A;  3OUY B;  3B0X A;  4FHW A;  4I2D A;  1ZQU A;  3JPR A;  4EV6 A;  2DR8 A;  4QZH A;  1VJ7 A;  4K99 A;  3RH6 A;  4DO9 A;  4QZF A;  5J2F A;  4R66 A;  4RQ0 A;  9ICB A; 
#chains in the Genus database with same CATH homology
 3ERC C;  1R8A A;  4E80 A;  4X4U A;  3C66 A;  3NYB A;  2GAF D;  4AT9 A;  4AT7 A;  5CHE A;  4X4P A;  4E7X A;  4K9B A;  3OVS A;  4WQL A;  4X4N A;  4JLX A;  4X4R A;  4ATB A;  4NXW A;  2B51 A;  4NXT A;  4X4Q A;  1GPJ A;  4FH3 A;  4K97 A;  4OAH A;  1F5A A;  4WH5 A;  4AT8 A;  4LEW A;  4K9A A;  4FHV A;  5B3Q A;  1Q79 A;  4FHP A;  3EF2 A;  5D63 A;  2DRA A;  3ER9 B;  3OUY A;  1UEV A;  2ZH2 A;  2EWR A;  4X4S A;  2DVI A;  3OWG A;  4NKT A;  4JLZ A;  4OAG A;  4K8V A;  2ZH8 A;  2DRB A;  3OV7 A;  4NKU A;  4O68 A;  5B3P A;  4NXX A;  4LEY A;  4LEZ A;  1TFY A;  1UET A;  4O67 A;  3ER8 C;  3MCR A;  4UD4 A;  2B56 A;  2Q66 A;  4OAI Z;  3HIY A;  4X4T A;  1R89 A;  2ZH3 A;  3PHZ A;  4O69 A;  4UD5 A;  2DR9 A;  2DR7 A;  4WQK A;  5CFU A;  4FH5 A;  4MKP A;  2O1P A;  2ZHB A;  2FCL A;  2ZH4 A;  4LT6 A;  2HHP A;  3NKU A;  5CFS A;  4LEV A;  4N7R A;  2ZH7 A;  1Q78 A;  1FA0 A;  3K7D A;  4OAF A;  2ZHA A;  4FHY A;  4KB6 A;  5D62 A;  4AT7 B;  2B4V A;  4KM5 A;  4FHX A;  2IHO A;  1TFW A;  1R8B A;  2ZH9 A;  1UEU A;  2ZH6 A;  4E8F A;  4X4V A;  4O6A A;  4WOY A;  5D61 A;  4K98 A;  1R8C A;  4HX0 A;  4ATB B;  4NXV A;  3HJ1 A;  4EP7 A;  4FO1 A;  2ZH1 A;  4AT8 B;  4NXU A;  2ZH5 A;  4M5D A;  2DR5 A;  5CFT A;  3HJ4 A;  3OUY B;  4FHW A;  3OVB A;  2GA9 D;  4AT9 B;  2DR8 A;  4X4O A;  4K99 A;  4XJE A;  3OVA A;  4K96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...