4FHWA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mggtp bound
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 107
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhwA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhwA02
4Z6DA 4MF2A 4PGXA 4P4OA 8ICOA 4AT7A 1BPEA 8ICVA 7ICVA 4R64A 4E80A 5BOMA 2M2TA 4X0AA 4MFFA 3NYBA 4YD1A 2I9GA 9ICVA 4MFCA 2DR7A 3WFQE 3L9DA 2PFPA 4I27A 1ZQAA 9ICQA 4E8FA 3ISCA 3C2MA 1VJ7A 2DRAA 3JPTA 7ICRA 5D46A 4JWNA 1WOTA 7ICEA 1ZQZA 2BCRA 5J2BA 7ICLA 3AQKA 4RWNA 4NM1A 3V72A 2IHMA 4FHYA 3RJGA 4RQ8A 4KLFA 4UB3A 3MGHA 4X4VA 9ICFA 4RWOA 8ICPA 4M5DA 7ICMA 1ZQTA 5CJ7A 2BCQA 4WC5A 4UB1A 1TV9A 2BE3A 2M2VA 5HRFA 3C2KA 2BCVA 8ICAA 4DOCA 3UXOA 5J0UA 4EBJA 5HRHA 4FHPA 4I2DA 4NM2A 4I2GA 7ICJA 3MGIA 5CWRA 4KLGA 8ICNA 3MDAA 4M9LA 8ICQA 9ICGA 5J0RA 4RPXA 5J0YA 3C2LA 3H39A 4YMMA 4M9GA 4Z6CA 8ICMA 8ICJA 4FHVA 1ZQJA 5IILA 4EP7A 1MQ3A 4IQVA 5J0WA 1Q79A 2PFQA 9ICCA 1KEJA 4QZFA 4PGYA 1JMSA 4PGQA 5HRKA 1ZQMA 2BPFA 3ISBA 1UEVA 9ICEA 2FMQA 4KLJA 4XRHA 5J2GA 3MDCA 4UAWA 2P66A 4FH5A 4XA5A 1TVAA 5HHHA 3JYYA 4LT6A 4DO9A 4AT9A 4PHAA 3RH4A 1ZQNA 4NXZA 4O5CA 1Q78A 4NLZA 5J29A 1ZQEA 3JZ0A 3B0YA 1UEUA 5DBAA 5J0SA 3PNCA 4FHWA 4NY8A 2BPGA 4ATBB 4UB5A 4RT3A 8ICHA 7ICTA 5HREA 9ICTA 4I2HA 3HWTA 5J2EA 2BCUA 5HC9A 4WC0A 2DR8A 4EBKA 4KLLA 5DDYA 4AT7B 3AQNA 4RQ5A 5J2IA 2ID1A 4FHXA 4WCWA 4RPZA 8ICWA 3AU2A 1R8CA 4UAZA 1HUOA 3GDXA 3H37A 4KLQA 3LQCB 5J0OA 3UXNA 1HUZA 4YCXA 5IIKA 1NOMA 2ZH3A 1MIVA 4QZ9A 1ZQCA 2ZHAA 4IG8A 4E7XA 1R89A 4M04A 4I28A 1ZQUA 2ZH2A 4QZHA 1PX5A 1ZQFA 8ICZA 9ICWA 2HHPA 2PBEA 4S3NA 4LZDA 1V4AA 4M9NA 3C66A 4YMNA 5J2AA 3V7LA 5HHIA 5CA7A 8ICUA 3JPOA 4KLTA 3RJIA 4NLNA 3PMLA 9ICSA 5J2KA 1ZJMA 4I2IA 8ICXA 4RWPA 3HJ4A 1JN3A 3WFRE 5J2CA 4QZIA 5J0XA 4P4MA 4KLEA 2ZH1A 5EOZA 1ZQVA 2M2WA 1R8AA 4RWQA 4WC2A 4WBZA 4X4NA 9ICIA 4X4QA 4R66A 2ZH5A 9ICBA 5J0TA 7ICOA 4R63A 1JAJA 1BPZA 5J2FA 3H38A 2BPCA 3JPSA 4LZGA 1MIYA 4IQTA 8ICLA 8ICEA 3C18A 4RQ3A 3RJJA 1NO5A 1MQ2A 4K4GA 4AT8B 5HR9A 5J2JA 3UPSA 4TUQA 2W9MA 4X0BA 4LVSA 4M9HA 2B56A 4F5NA 4O5EA 4KLDA 3OVAA 2M2UA 7ICGA 9ICNA 4WC6A 4PPXA 7ICQA 4PHDA 4I2JA 4KLSA 4I2EA 4XQ7A 1TFYA 4YMOA 1ZQPA 3WFSC 3OVSA 3AUOA 4XUSA 3JPPA 1ZQBA 4X4RA 3RJEA 4WBYA 4WC4A 4QZEA 4RQ0A 4UB4A 5HRIA 5DDMA 7ICKA 5J0QA 3OUYA 3WFOA 4Z6EA 4QZBA 4UBCA 2ZH8A 2ISPA 4Z6FA 2O1PA 5DEDA 3RH5A 8ICCA 1BPDA 4RPYA 4M2YA 5DBCA 4JWMA 4KLHA 4FO6A 1KNYA 4QZGA 4P4PA 1ZQOA 4TUPA 5HRGA 2ZHBA 5IINA 1ZQSA 2DVIA 5IIOA 4UD4A 2PFOA 5J2DA 3HW8A 4PH5A 5IIIA 3AU6A 1BPXA 9ICMA 3MBYA 3AQLA 4I29A 5DKWA 5J0PA 1BPYA 4X4PA 2DR5A 4I2FA 8ICBA 4WC3A 5CB1A 3TFRA 3RJFA 5DB8A 3RH6A 2RFFA 7ICUA 1XSLA 4M0AA 4UD5A 5HRDA 1ZJNA 4I2BA 1ZQXA 4M47A 4GXKA 4F5RA 3HIYA 5D49A 1BPBA 4KLIA 4K4HA 2GWSA 5DB9A 3V7JA 9ICJA 7ICNA 1OU5A 2FMPA 4WC1A 9ICHA 2Q66A 4R65A 7ICPA 4QZCA 8ICYA 1ZQIA 4YN4A 4QZDA 1XSNA 1ZQDA 4O5KA 9ICKA 4I2CA 4TUSA 3HX0A 4GXJA 3UQ0A 3RJKA 7ICFA 7ICSA 1JQRA 3OVBA 3JPQA 5IIJA 4DOBA 4F5PA 4KLOA 1FA0A 3V7KA 1XSPA 2NRKA 9ICAA 2DRBA 5DBBA 5J2HA 3ISDA 5DECA 4X4SA 4XQ8A 4MFAA 2B51A 3AQMA 4FH3A 9ICPA 4AT9B 4O9MA 1TFWA 1RPLA 9ICLA 5IIMA 1ZQKA 2O5AA 2ZH6A 4F5QA 1RZTA 9ICXA 8ICGA 4QZAA 5BOLA 2ZH4A 2ZH9A 3WFPA 4RQ2A 3OUYB 3JPNA 4GXIA 7ICHA 5TZVA 4RQ6A 2PXIA 8ICIA 3HJ1A 1ZQRA 3UXPA 4IQWA 1UETA 3OGUA 4MF8A 1ZQHA 4NKTA 9ICRA 5CP2A 4QZ8A 4PHEA 2ZH7A 1ZQQA 7ICIA 4IQUA 3K75D 1ZQLA 4I2AA 5BPCA 5F2VO 5HRBA 2FMSA 1YLQA 4F5OA 4AT8A 3JPRA 8ICKA 8ICFA 4RQ7A 3PMNA 1VFGA 5D4BA 8ICRA 4X5VA 9ICOA 3C5FA 4WC7A 4RQ1A 3B0XA 2DR9A 4K4IA 1ZQGA 3H3AA 4NKUA 4RQ4A 4X4OA 4KLMA 5CHGA 4KLUA 3UPQA 4PHPA 4P2HA 3LK9A 3OV7A 4M9JA 1F5AA 4YD2A 4X4TA 3UQ2A 9ICUA 2ISOA 2PFNA 8ICSA 1KDHA 1ZQWA 1R8BA 2B4VA 4NLKA 4RT2A 4UB2A 1MIWA 3TFSA 4TURA 4UAYA 2VANA 4ATBA 5DB6A 4X4UA 8ICTA 4DOAA 5CR0A 5DB7A 3RJHA 1ZQYA 3C5GA 5HRLA 2BCSA 4UBBA
chains in the Genus database with same CATH superfamily
4Z6DA 4MF2A 4PGXA 4P4OA 8ICOA 4AT7A 1BPEA 4K96A 8ICVA 7ICVA 4R64A 4E80A 5CFUA 5BOMA 2M2TA 4X0AA 4MFFA 3NYBA 4YD1A 2I9GA 9ICVA 4MFCA 2DR7A 3WFQE 3L9DA 2PFPA 4I27A 1ZQAA 9ICQA 4E8FA 3ISCA 3C2MA 2DRAA 1VJ7A 3JPTA 7ICRA 5D46A 4JWNA 1WOTA 7ICEA 1ZQZA 2BCRA 5J2BA 7ICLA 3AQKA 4RWNA 4NM1A 3V72A 2IHMA 4KB6A 4FHYA 3RJGA 4RQ8A 4KLFA 4UB3A 3MGHA 4OAIZ 4X4VA 9ICFA 4RWOA 8ICPA 4NXXA 4M5DA 7ICMA 1ZQTA 5CJ7A 2BCQA 4WC5A 4UB1A 1TV9A 5B3QA 2BE3A 2M2VA 5HRFA 3CK6A 3C2KA 2BCVA 8ICAA 3K7DA 4DOCA 3UXOA 5J0UA 4EBJA 5HRHA 4FHPA 4I2DA 4NM2A 4JLZA 4I2GA 7ICJA 3MGIA 5CWRA 4KLGA 8ICNA 3MDAA 4M9LA 8ICQA 9ICGA 5J0RA 4RPXA 5J0YA 3C2LA 3H39A 3ER9B 4YMMA 4M9GA 4Z6CA 8ICMA 8ICJA 4FHVA 1ZQJA 5IILA 4EP7A 1MQ3A 4IQVA 5J0WA 1Q79A 2PFQA 4O69A 9ICCA 1KEJA 4QZFA 2BBJA 4PGYA 1JMSA 4PGQA 5HRKA 1ZQMA 2BPFA 3ISBA 1UEVA 9ICEA 2FMQA 4KLJA 4XRHA 5J2GA 3MDCA 4UAWA 2P66A 5CHEA 4FH5A 4XA5A 1TVAA 5HHHA 3JYYA 4LT6A 4DO9A 4AT9A 4PHAA 3RH4A 1ZQNA 4NXZA 4O5CA 1Q78A 4NLZA 5J29A 1ZQEA 3JZ0A 3B0YA 1UEUA 4N7RA 5DBAA 5J0SA 3PNCA 4FHWA 4NY8A 2BPGA 4ATBB 4UB5A 4I0UA 4RT3A 8ICHA 4FO1A 7ICTA 5HREA 4K8VA 9ICTA 4I2HA 3HWTA 4WH5A 5J2EA 5CFSA 2BCUA 5HC9A 4WC0A 2DR8A 4EBKA 4KLLA 4AT7B 5DDYA 3AQNA 4RQ5A 3JCFA 5J2IA 2ID1A 4EEBA 4FHXA 4WCWA 4RPZA 8ICWA 3AU2A 1R8CA 4UAZA 1HUOA 3GDXA 3H37A 4KLQA 3LQCB 5J0OA 3UXNA 1HUZA 4YCXA 5IIKA 1NOMA 2ZH3A 1MIVA 4QZ9A 1ZQCA 2ZHAA 4IG8A 4E7XA 1R89A 4NXVA 4I28A 4M04A 4EEDA 1ZQUA 4K97A 5B3PA 2ZH2A 4QZHA 1PX5A 1ZQFA 4LEWA 8ICZA 9ICWA 2HHPA 4S3NA 2PBEA 2BBHA 4LZDA 1V4AA 4M9NA 3C66A 4YMNA 5J2AA 3V7LA 5HHIA 5CA7A 8ICUA 3JPOA 4KLTA 3RJIA 4NLNA 3PMLA 4JLXA 2IUBA 4O68A 9ICSA 5J2KA 1ZJMA 4I2IA 8ICXA 4RWPA 3HJ4A 1JN3A 3WFRE 5J2CA 4QZIA 5J0XA 4P4MA 4KLEA 2ZH1A 5EOZA 1ZQVA 2M2WA 1R8AA 4RWQA 4X4NA 4WBZA 4WC2A 9ICIA 4X4QA 2ZH5A 4R66A 4NXUA 9ICBA 5J0TA 7ICOA 4R63A 1JAJA 1BPZA 5J2FA 3H38A 2BPCA 3JPSA 4LZGA 1MIYA 4O6AA 4IQTA 8ICLA 8ICEA 3C18A 4RQ3A 3RJJA 1NO5A 4EV6A 1MQ2A 4K4GA 4AT8B 5HR9A 5J2JA 3UPSA 4TUQA 2W9MA 4X0BA 4LVSA 4M9HA 2HN2A 2B56A 4F5NA 4O5EA 4KLDA 3OVAA 3NVOA 2M2UA 4K98A 7ICGA 9ICNA 4WC6A 4PPXA 7ICQA 4PHDA 4I2JA 4KLSA 1TFYA 4XQ7A 3NWIA 4I2EA 4YMOA 1ZQPA 3OWGA 3WFSC 2IHOA 3OVSA 5JTGA 3AUOA 4XUSA 3JPPA 1ZQBA 4X4RA 2GAFD 3RJEA 4WBYA 4WC4A 4QZEA 4RQ0A 4UB4A 4LEYA 5HRIA 5DDMA 7ICKA 5J0QA 3OUYA 4LEZA 3WFOA 4Z6EA 4QZBA 4UBCA 2ZH8A 2ISPA 4Z6FA 4MKPA 2O1PA 5DEDA 3RH5A 8ICCA 1BPDA 4RPYA 4M2YA 5DBCA 4JWMA 4KLHA 4FO6A 4NXTA 1KNYA 4QZGA 4P4PA 1ZQOA 4TUPA 4K9BA 2ZHBA 5HRGA 5IINA 2DVIA 1ZQSA 5IIOA 4UD4A 4WQKA 2PFOA 4KM5A 5J2DA 3HW8A 4PH5A 5IIIA 3AU6A 1BPXA 9ICMA 3MBYA 3AQLA 4I29A 5DKWA 2DR5A 5J0PA 4X4PA 1BPYA 4I2FA 8ICBA 3ERCC 4WC3A 3ER8C 5CB1A 3TFRA 3RJFA 5DB8A 3RH6A 2RFFA 7ICUA 1XSLA 4M0AA 4UD5A 5D62A 5HRDA 1ZJNA 4I2BA 1ZQXA 4M47A 4GXKA 4F5RA 3HIYA 5D49A 2GA9D 1BPBA 4KLIA 4K4HA 2GWSA 5DB9A 3V7JA 9ICJA 7ICNA 1OU5A 2FMPA 4WC1A 9ICHA 2Q66A 4R65A 7ICPA 4QZCA 8ICYA 1ZQIA 4YN4A 4QZDA 1XSNA 1ZQDA 4O5KA 9ICKA 4I2CA 4TUSA 3HX0A 4GXJA 3UQ0A 3RJKA 7ICFA 7ICSA 2EWRA 1JQRA 3OVBA 3JPQA 5IIJA 4DOBA 4F5PA 5D61A 4KLOA 1FA0A 3V7KA 1XSPA 4OAHA 2NRKA 9ICAA 2DRBA 5DBBA 5J2HA 3ISDA 5DECA 3EF2A 4X4SA 4XQ8A 4MFAA 2B51A 3AQMA 4FH3A 9ICPA 4AT9B 1TFWA 4O9MA 1RPLA 9ICLA 5IIMA 1ZQKA 2O5AA 2ZH6A 4F5QA 1RZTA 4LEVA 9ICXA 8ICGA 2ZH4A 4QZAA 5BOLA 4WQLA 2ZH9A 3WFPA 3OUYB 4RQ2A 3JPNA 4GXIA 7ICHA 5TZVA 2FCLA 4WOYA 4RQ6A 2PXIA 8ICIA 3HJ1A 1ZQRA 4K99A 3UXPA 4IQWA 1UETA 3OGUA 4MF8A 1ZQHA 4NKTA 9ICRA 5CP2A 4QZ8A 4PHEA 2ZH7A 1ZQQA 7ICIA 4NXWA 4O67A 4IQUA 3K75D 1ZQLA 4I2AA 5BPCA 4XJEA 5F2VO 5HRBA 2HN1A 3PHZA 2FMSA 1GPJA 1YLQA 4F5OA 4AT8A 3JPRA 8ICKA 5D63A 8ICFA 4RQ7A 3PMNA 1VFGA 5D4BA 8ICRA 4X5VA 5CFTA 9ICOA 3C5FA 4EGWA 4WC7A 4RQ1A 3MCRA 3B0XA 2DR9A 4K4IA 1ZQGA 3H3AA 4NKUA 4RQ4A 4X4OA 4KLMA 5CHGA 4KLUA 3UPQA 4PHPA 4P2HA 3LK9A 3OV7A 4M9JA 1F5AA 4OAGA 4X4TA 4YD2A 3UQ2A 9ICUA 4HX0A 3NKUA 2ISOA 2PFNA 8ICSA 1KDHA 1ZQWA 1R8BA 2B4VA 4NLKA 4RT2A 4UB2A 1MIWA 3TFSA 4K9AA 4TURA 4UAYA 2VANA 4ATBA 5DB6A 4X4UA 8ICTA 4DOAA 5CR0A 5DB7A 3RJHA 4OAFA 1ZQYA 3C5GA 5HRLA 2BCSA 4UBBA
chains in the Genus database with same CATH topology
4Z6DA 4MF2A 4PGXA 4P4OA 8ICOA 4AT7A 1BPEA 4K96A 8ICVA 7ICVA 4R64A 4E80A 5BOMA 2M2TA 4X0AA 4MFFA 3NYBA 4YD1A 2I9GA 9ICVA 4MFCA 2DR7A 3WFQE 3L9DA 2PFPA 4I27A 1ZQAA 9ICQA 4E8FA 3ISCA 3C2MA 2DRAA 1VJ7A 3JPTA 7ICRA 5D46A 4JWNA 1WOTA 7ICEA 1ZQZA 2BCRA 5J2BA 7ICLA 3AQKA 4RWNA 4NM1A 3V72A 2IHMA 4KB6A 4FHYA 3RJGA 4RQ8A 4KLFA 4UB3A 3MGHA 4OAIZ 4X4VA 9ICFA 4RWOA 8ICPA 4NXXA 4M5DA 7ICMA 1ZQTA 5CJ7A 2BCQA 4WC5A 4UB1A 1TV9A 2BE3A 2M2VA 5HRFA 3C2KA 2BCVA 8ICAA 4DOCA 3UXOA 5J0UA 4EBJA 5HRHA 4FHPA 4I2DA 4NM2A 4JLZA 4I2GA 7ICJA 3MGIA 5CWRA 4KLGA 8ICNA 3MDAA 4M9LA 8ICQA 9ICGA 4RPXA 5J0RA 5J0YA 3C2LA 3H39A 4YMMA 4M9GA 4Z6CA 8ICMA 8ICJA 4FHVA 1ZQJA 5IILA 4EP7A 1MQ3A 4IQVA 5J0WA 1Q79A 2PFQA 4O69A 9ICCA 1KEJA 4QZFA 4PGYA 1JMSA 4PGQA 5HRKA 1ZQMA 2BPFA 3ISBA 1UEVA 9ICEA 2FMQA 4KLJA 4XRHA 5J2GA 3MDCA 4UAWA 2P66A 4FH5A 4XA5A 1TVAA 5HHHA 3JYYA 4LT6A 4DO9A 4AT9A 4PHAA 3RH4A 1ZQNA 4NXZA 4O5CA 1Q78A 4NLZA 5J29A 1ZQEA 3JZ0A 3B0YA 1UEUA 5DBAA 5J0SA 3PNCA 4FHWA 4NY8A 2BPGA 4ATBB 4UB5A 4RT3A 8ICHA 7ICTA 5HREA 4K8VA 9ICTA 4I2HA 3HWTA 5J2EA 2BCUA 5HC9A 4WC0A 2DR8A 4EBKA 4KLLA 4AT7B 5DDYA 3AQNA 4RQ5A 5J2IA 2ID1A 4FHXA 4WCWA 4RPZA 8ICWA 3AU2A 1R8CA 4UAZA 1HUOA 3GDXA 3H37A 4KLQA 3LQCB 5J0OA 3UXNA 1HUZA 4YCXA 5IIKA 1NOMA 2ZH3A 1MIVA 4QZ9A 1ZQCA 2ZHAA 4IG8A 4E7XA 1R89A 4NXVA 4I28A 4M04A 1ZQUA 4K97A 2ZH2A 4QZHA 1PX5A 1ZQFA 4LEWA 8ICZA 9ICWA 2HHPA 2PBEA 4S3NA 4LZDA 1V4AA 4M9NA 3C66A 4YMNA 5J2AA 3V7LA 5HHIA 5CA7A 8ICUA 3JPOA 4KLTA 3RJIA 4NLNA 3PMLA 4JLXA 4O68A 9ICSA 5J2KA 1ZJMA 4I2IA 8ICXA 4RWPA 3HJ4A 1JN3A 3WFRE 5J2CA 4QZIA 5J0XA 4P4MA 4KLEA 2ZH1A 5EOZA 1ZQVA 2M2WA 1R8AA 4X4NA 4RWQA 4WBZA 4WC2A 9ICIA 4X4QA 2ZH5A 4R66A 4NXUA 9ICBA 5J0TA 7ICOA 4R63A 1JAJA 1BPZA 5J2FA 3H38A 2BPCA 3JPSA 4LZGA 1MIYA 4O6AA 4IQTA 8ICLA 8ICEA 3C18A 4RQ3A 3RJJA 1NO5A 1MQ2A 4K4GA 4AT8B 5HR9A 5J2JA 3UPSA 4TUQA 2W9MA 4X0BA 4LVSA 4M9HA 2B56A 4F5NA 4O5EA 4KLDA 3OVAA 2M2UA 4K98A 7ICGA 9ICNA 4WC6A 4PPXA 7ICQA 4PHDA 4I2JA 4KLSA 1TFYA 4XQ7A 4I2EA 4YMOA 1ZQPA 3WFSC 3OVSA 3AUOA 4XUSA 3JPPA 1ZQBA 4X4RA 3RJEA 4WBYA 4WC4A 4QZEA 4RQ0A 4UB4A 4LEYA 5HRIA 5DDMA 7ICKA 5J0QA 3OUYA 4LEZA 3WFOA 4Z6EA 4QZBA 4UBCA 2ZH8A 2ISPA 4Z6FA 4MKPA 2O1PA 5DEDA 3RH5A 8ICCA 1BPDA 4RPYA 4M2YA 5DBCA 4JWMA 4KLHA 4FO6A 4NXTA 1KNYA 4QZGA 4P4PA 1ZQOA 4TUPA 4K9BA 2ZHBA 5HRGA 5IINA 2DVIA 1ZQSA 5IIOA 4UD4A 2PFOA 4KM5A 5J2DA 3HW8A 4PH5A 5IIIA 3AU6A 1BPXA 9ICMA 3MBYA 3AQLA 4I29A 5DKWA 2DR5A 5J0PA 4X4PA 1BPYA 4I2FA 8ICBA 4WC3A 5CB1A 3TFRA 3RJFA 5DB8A 3RH6A 2RFFA 7ICUA 1XSLA 4M0AA 4UD5A 5HRDA 1ZJNA 4I2BA 1ZQXA 4M47A 4GXKA 4F5RA 3HIYA 5D49A 1BPBA 4KLIA 4K4HA 2GWSA 5DB9A 3V7JA 9ICJA 7ICNA 1OU5A 2FMPA 4WC1A 9ICHA 2Q66A 4R65A 7ICPA 4QZCA 8ICYA 1ZQIA 4YN4A 4QZDA 1XSNA 1ZQDA 4O5KA 9ICKA 4I2CA 4TUSA 3HX0A 4GXJA 3UQ0A 3RJKA 7ICFA 7ICSA 1JQRA 3OVBA 3JPQA 5IIJA 4DOBA 4F5PA 4KLOA 1FA0A 3V7KA 1XSPA 4OAHA 2NRKA 9ICAA 2DRBA 5DBBA 5J2HA 3ISDA 5DECA 4X4SA 4XQ8A 4MFAA 2B51A 3AQMA 4FH3A 9ICPA 4AT9B 1TFWA 4O9MA 1RPLA 9ICLA 5IIMA 1ZQKA 2O5AA 2ZH6A 4F5QA 1RZTA 4LEVA 9ICXA 8ICGA 2ZH4A 4QZAA 5BOLA 2ZH9A 3WFPA 3OUYB 4RQ2A 3JPNA 4GXIA 7ICHA 5TZVA 4RQ6A 4WOYA 2PXIA 8ICIA 3HJ1A 1ZQRA 4K99A 3UXPA 4IQWA 1UETA 3OGUA 4MF8A 1ZQHA 4NKTA 9ICRA 5CP2A 4QZ8A 4PHEA 2ZH7A 1ZQQA 7ICIA 4NXWA 4O67A 4IQUA 3K75D 1ZQLA 4I2AA 5BPCA 5F2VO 5HRBA 2FMSA 1YLQA 4F5OA 4AT8A 3JPRA 8ICKA 8ICFA 4RQ7A 3PMNA 1VFGA 5D4BA 8ICRA 4X5VA 9ICOA 3C5FA 4WC7A 4RQ1A 3B0XA 2DR9A 4K4IA 1ZQGA 3H3AA 4NKUA 4RQ4A 4X4OA 4KLMA 5CHGA 4KLUA 3UPQA 4PHPA 4P2HA 3LK9A 3OV7A 4M9JA 1F5AA 4OAGA 4X4TA 4YD2A 3UQ2A 9ICUA 2ISOA 2PFNA 8ICSA 1KDHA 1ZQWA 1R8BA 2B4VA 4NLKA 4RT2A 4UB2A 1MIWA 3TFSA 4K9AA 4TURA 4UAYA 2VANA 4ATBA 5DB6A 4X4UA 8ICTA 4DOAA 5CR0A 5DB7A 3RJHA 4OAFA 1ZQYA 3C5GA 5HRLA 2BCSA 4UBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z6D A;  4MF2 A;  4PGX A;  4P4O A;  8ICO A;  4AT7 A;  1BPE A;  8ICV A;  7ICV A;  4R64 A;  4E80 A;  5BOM A;  2M2T A;  4X0A A;  4MFF A;  3NYB A;  4YD1 A;  2I9G A;  9ICV A;  4MFC A;  2DR7 A;  3WFQ E;  3L9D A;  2PFP A;  4I27 A;  1ZQA A;  9ICQ A;  4E8F A;  3ISC A;  3C2M A;  1VJ7 A;  2DRA A;  3JPT A;  7ICR A;  5D46 A;  4JWN A;  1WOT A;  7ICE A;  1ZQZ A;  2BCR A;  5J2B A;  7ICL A;  3AQK A;  4RWN A;  4NM1 A;  3V72 A;  2IHM A;  4FHY A;  3RJG A;  4RQ8 A;  4KLF A;  4UB3 A;  3MGH A;  4X4V A;  9ICF A;  4RWO A;  8ICP A;  4M5D A;  7ICM A;  1ZQT A;  5CJ7 A;  2BCQ A;  4WC5 A;  4UB1 A;  1TV9 A;  2BE3 A;  2M2V A;  5HRF A;  3C2K A;  2BCV A;  8ICA A;  4DOC A;  3UXO A;  5J0U A;  4EBJ A;  5HRH A;  4FHP A;  4I2D A;  4NM2 A;  4I2G A;  7ICJ A;  3MGI A;  5CWR A;  4KLG A;  8ICN A;  3MDA A;  4M9L A;  8ICQ A;  9ICG A;  5J0R A;  4RPX A;  5J0Y A;  3C2L A;  3H39 A;  4YMM A;  4M9G A;  4Z6C A;  8ICM A;  8ICJ A;  4FHV A;  1ZQJ A;  5IIL A;  4EP7 A;  1MQ3 A;  4IQV A;  5J0W A;  1Q79 A;  2PFQ A;  9ICC A;  1KEJ A;  4QZF A;  4PGY A;  1JMS A;  4PGQ A;  5HRK A;  1ZQM A;  2BPF A;  3ISB A;  1UEV A;  9ICE A;  2FMQ A;  4KLJ A;  4XRH A;  5J2G A;  3MDC A;  4UAW A;  2P66 A;  4FH5 A;  4XA5 A;  1TVA A;  5HHH A;  3JYY A;  4LT6 A;  4DO9 A;  4AT9 A;  4PHA A;  3RH4 A;  1ZQN A;  4NXZ A;  4O5C A;  1Q78 A;  4NLZ A;  5J29 A;  1ZQE A;  3JZ0 A;  3B0Y A;  1UEU A;  5DBA A;  5J0S A;  3PNC A;  4FHW A;  4NY8 A;  2BPG A;  4ATB B;  4UB5 A;  4RT3 A;  8ICH A;  7ICT A;  5HRE A;  9ICT A;  4I2H A;  3HWT A;  5J2E A;  2BCU A;  5HC9 A;  4WC0 A;  2DR8 A;  4EBK A;  4KLL A;  5DDY A;  4AT7 B;  3AQN A;  4RQ5 A;  5J2I A;  2ID1 A;  4FHX A;  4WCW A;  4RPZ A;  8ICW A;  3AU2 A;  1R8C A;  4UAZ A;  1HUO A;  3GDX A;  3H37 A;  4KLQ A;  3LQC B;  5J0O A;  3UXN A;  1HUZ A;  4YCX A;  5IIK A;  1NOM A;  2ZH3 A;  1MIV A;  4QZ9 A;  1ZQC A;  2ZHA A;  4IG8 A;  4E7X A;  1R89 A;  4M04 A;  4I28 A;  1ZQU A;  2ZH2 A;  4QZH A;  1PX5 A;  1ZQF A;  8ICZ A;  9ICW A;  2HHP A;  2PBE A;  4S3N A;  4LZD A;  1V4A A;  4M9N A;  3C66 A;  4YMN A;  5J2A A;  3V7L A;  5HHI A;  5CA7 A;  8ICU A;  3JPO A;  4KLT A;  3RJI A;  4NLN A;  3PML A;  9ICS A;  5J2K A;  1ZJM A;  4I2I A;  8ICX A;  4RWP A;  3HJ4 A;  1JN3 A;  3WFR E;  5J2C A;  4QZI A;  5J0X A;  4P4M A;  4KLE A;  2ZH1 A;  5EOZ A;  1ZQV A;  2M2W A;  1R8A A;  4RWQ A;  4WC2 A;  4WBZ A;  4X4N A;  9ICI A;  4X4Q A;  4R66 A;  2ZH5 A;  9ICB A;  5J0T A;  7ICO A;  4R63 A;  1JAJ A;  1BPZ A;  5J2F A;  3H38 A;  2BPC A;  3JPS A;  4LZG A;  1MIY A;  4IQT A;  8ICL A;  8ICE A;  3C18 A;  4RQ3 A;  3RJJ A;  1NO5 A;  1MQ2 A;  4K4G A;  4AT8 B;  5HR9 A;  5J2J A;  3UPS A;  4TUQ A;  2W9M A;  4X0B A;  4LVS A;  4M9H A;  2B56 A;  4F5N A;  4O5E A;  4KLD A;  3OVA A;  2M2U A;  7ICG A;  9ICN A;  4WC6 A;  4PPX A;  7ICQ A;  4PHD A;  4I2J A;  4KLS A;  4I2E A;  4XQ7 A;  1TFY A;  4YMO A;  1ZQP A;  3WFS C;  3OVS A;  3AUO A;  4XUS A;  3JPP A;  1ZQB A;  4X4R A;  3RJE A;  4WBY A;  4WC4 A;  4QZE A;  4RQ0 A;  4UB4 A;  5HRI A;  5DDM A;  7ICK A;  5J0Q A;  3OUY A;  3WFO A;  4Z6E A;  4QZB A;  4UBC A;  2ZH8 A;  2ISP A;  4Z6F A;  2O1P A;  5DED A;  3RH5 A;  8ICC A;  1BPD A;  4RPY A;  4M2Y A;  5DBC A;  4JWM A;  4KLH A;  4FO6 A;  1KNY A;  4QZG A;  4P4P A;  1ZQO A;  4TUP A;  5HRG A;  2ZHB A;  5IIN A;  1ZQS A;  2DVI A;  5IIO A;  4UD4 A;  2PFO A;  5J2D A;  3HW8 A;  4PH5 A;  5III A;  3AU6 A;  1BPX A;  9ICM A;  3MBY A;  3AQL A;  4I29 A;  5DKW A;  5J0P A;  1BPY A;  4X4P A;  2DR5 A;  4I2F A;  8ICB A;  4WC3 A;  5CB1 A;  3TFR A;  3RJF A;  5DB8 A;  3RH6 A;  2RFF A;  7ICU A;  1XSL A;  4M0A A;  4UD5 A;  5HRD A;  1ZJN A;  4I2B A;  1ZQX A;  4M47 A;  4GXK A;  4F5R A;  3HIY A;  5D49 A;  1BPB A;  4KLI A;  4K4H A;  2GWS A;  5DB9 A;  3V7J A;  9ICJ A;  7ICN A;  1OU5 A;  2FMP A;  4WC1 A;  9ICH A;  2Q66 A;  4R65 A;  7ICP A;  4QZC A;  8ICY A;  1ZQI A;  4YN4 A;  4QZD A;  1XSN A;  1ZQD A;  4O5K A;  9ICK A;  4I2C A;  4TUS A;  3HX0 A;  4GXJ A;  3UQ0 A;  3RJK A;  7ICF A;  7ICS A;  1JQR A;  3OVB A;  3JPQ A;  5IIJ A;  4DOB A;  4F5P A;  4KLO A;  1FA0 A;  3V7K A;  1XSP A;  2NRK A;  9ICA A;  2DRB A;  5DBB A;  5J2H A;  3ISD A;  5DEC A;  4X4S A;  4XQ8 A;  4MFA A;  2B51 A;  3AQM A;  4FH3 A;  9ICP A;  4AT9 B;  4O9M A;  1TFW A;  1RPL A;  9ICL A;  5IIM A;  1ZQK A;  2O5A A;  2ZH6 A;  4F5Q A;  1RZT A;  9ICX A;  8ICG A;  4QZA A;  5BOL A;  2ZH4 A;  2ZH9 A;  3WFP A;  4RQ2 A;  3OUY B;  3JPN A;  4GXI A;  7ICH A;  5TZV A;  4RQ6 A;  2PXI A;  8ICI A;  3HJ1 A;  1ZQR A;  3UXP A;  4IQW A;  1UET A;  3OGU A;  4MF8 A;  1ZQH A;  4NKT A;  9ICR A;  5CP2 A;  4QZ8 A;  4PHE A;  2ZH7 A;  1ZQQ A;  7ICI A;  4IQU A;  3K75 D;  1ZQL A;  4I2A A;  5BPC A;  5F2V O;  5HRB A;  2FMS A;  1YLQ A;  4F5O A;  4AT8 A;  3JPR A;  8ICK A;  8ICF A;  4RQ7 A;  3PMN A;  1VFG A;  5D4B A;  8ICR A;  4X5V A;  9ICO A;  3C5F A;  4WC7 A;  4RQ1 A;  3B0X A;  2DR9 A;  4K4I A;  1ZQG A;  3H3A A;  4NKU A;  4RQ4 A;  4X4O A;  4KLM A;  5CHG A;  4KLU A;  3UPQ A;  4PHP A;  4P2H A;  3LK9 A;  3OV7 A;  4M9J A;  1F5A A;  4YD2 A;  4X4T A;  3UQ2 A;  9ICU A;  2ISO A;  2PFN A;  8ICS A;  1KDH A;  1ZQW A;  1R8B A;  2B4V A;  4NLK A;  4RT2 A;  4UB2 A;  1MIW A;  3TFS A;  4TUR A;  4UAY A;  2VAN A;  4ATB A;  5DB6 A;  4X4U A;  8ICT A;  4DOA A;  5CR0 A;  5DB7 A;  3RJH A;  1ZQY A;  3C5G A;  5HRL A;  2BCS A;  4UBB A; 
#chains in the Genus database with same CATH topology
 4Z6D A;  4MF2 A;  4PGX A;  4P4O A;  8ICO A;  4AT7 A;  1BPE A;  4K96 A;  8ICV A;  7ICV A;  4R64 A;  4E80 A;  5CFU A;  5BOM A;  2M2T A;  4X0A A;  4MFF A;  3NYB A;  4YD1 A;  2I9G A;  9ICV A;  4MFC A;  2DR7 A;  3WFQ E;  3L9D A;  2PFP A;  4I27 A;  1ZQA A;  9ICQ A;  4E8F A;  3ISC A;  3C2M A;  2DRA A;  1VJ7 A;  3JPT A;  7ICR A;  5D46 A;  4JWN A;  1WOT A;  7ICE A;  1ZQZ A;  2BCR A;  5J2B A;  7ICL A;  3AQK A;  4RWN A;  4NM1 A;  3V72 A;  2IHM A;  4KB6 A;  4FHY A;  3RJG A;  4RQ8 A;  4KLF A;  4UB3 A;  3MGH A;  4OAI Z;  4X4V A;  9ICF A;  4RWO A;  8ICP A;  4NXX A;  4M5D A;  7ICM A;  1ZQT A;  5CJ7 A;  2BCQ A;  4WC5 A;  4UB1 A;  1TV9 A;  5B3Q A;  2BE3 A;  2M2V A;  5HRF A;  3CK6 A;  3C2K A;  2BCV A;  8ICA A;  3K7D A;  4DOC A;  3UXO A;  5J0U A;  4EBJ A;  5HRH A;  4FHP A;  4I2D A;  4NM2 A;  4JLZ A;  4I2G A;  7ICJ A;  3MGI A;  5CWR A;  4KLG A;  8ICN A;  3MDA A;  4M9L A;  8ICQ A;  9ICG A;  5J0R A;  4RPX A;  5J0Y A;  3C2L A;  3H39 A;  3ER9 B;  4YMM A;  4M9G A;  4Z6C A;  8ICM A;  8ICJ A;  4FHV A;  1ZQJ A;  5IIL A;  4EP7 A;  1MQ3 A;  4IQV A;  5J0W A;  1Q79 A;  2PFQ A;  4O69 A;  9ICC A;  1KEJ A;  4QZF A;  2BBJ A;  4PGY A;  1JMS A;  4PGQ A;  5HRK A;  1ZQM A;  2BPF A;  3ISB A;  1UEV A;  9ICE A;  2FMQ A;  4KLJ A;  4XRH A;  5J2G A;  3MDC A;  4UAW A;  2P66 A;  5CHE A;  4FH5 A;  4XA5 A;  1TVA A;  5HHH A;  3JYY A;  4LT6 A;  4DO9 A;  4AT9 A;  4PHA A;  3RH4 A;  1ZQN A;  4NXZ A;  4O5C A;  1Q78 A;  4NLZ A;  5J29 A;  1ZQE A;  3JZ0 A;  3B0Y A;  1UEU A;  4N7R A;  5DBA A;  5J0S A;  3PNC A;  4FHW A;  4NY8 A;  2BPG A;  4ATB B;  4UB5 A;  4I0U A;  4RT3 A;  8ICH A;  4FO1 A;  7ICT A;  5HRE A;  4K8V A;  9ICT A;  4I2H A;  3HWT A;  4WH5 A;  5J2E A;  5CFS A;  2BCU A;  5HC9 A;  4WC0 A;  2DR8 A;  4EBK A;  4KLL A;  4AT7 B;  5DDY A;  3AQN A;  4RQ5 A;  3JCF A;  5J2I A;  2ID1 A;  4EEB A;  4FHX A;  4WCW A;  4RPZ A;  8ICW A;  3AU2 A;  1R8C A;  4UAZ A;  1HUO A;  3GDX A;  3H37 A;  4KLQ A;  3LQC B;  5J0O A;  3UXN A;  1HUZ A;  4YCX A;  5IIK A;  1NOM A;  2ZH3 A;  1MIV A;  4QZ9 A;  1ZQC A;  2ZHA A;  4IG8 A;  4E7X A;  1R89 A;  4NXV A;  4I28 A;  4M04 A;  4EED A;  1ZQU A;  4K97 A;  5B3P A;  2ZH2 A;  4QZH A;  1PX5 A;  1ZQF A;  4LEW A;  8ICZ A;  9ICW A;  2HHP A;  4S3N A;  2PBE A;  2BBH A;  4LZD A;  1V4A A;  4M9N A;  3C66 A;  4YMN A;  5J2A A;  3V7L A;  5HHI A;  5CA7 A;  8ICU A;  3JPO A;  4KLT A;  3RJI A;  4NLN A;  3PML A;  4JLX A;  2IUB A;  4O68 A;  9ICS A;  5J2K A;  1ZJM A;  4I2I A;  8ICX A;  4RWP A;  3HJ4 A;  1JN3 A;  3WFR E;  5J2C A;  4QZI A;  5J0X A;  4P4M A;  4KLE A;  2ZH1 A;  5EOZ A;  1ZQV A;  2M2W A;  1R8A A;  4RWQ A;  4X4N A;  4WBZ A;  4WC2 A;  9ICI A;  4X4Q A;  2ZH5 A;  4R66 A;  4NXU A;  9ICB A;  5J0T A;  7ICO A;  4R63 A;  1JAJ A;  1BPZ A;  5J2F A;  3H38 A;  2BPC A;  3JPS A;  4LZG A;  1MIY A;  4O6A A;  4IQT A;  8ICL A;  8ICE A;  3C18 A;  4RQ3 A;  3RJJ A;  1NO5 A;  4EV6 A;  1MQ2 A;  4K4G A;  4AT8 B;  5HR9 A;  5J2J A;  3UPS A;  4TUQ A;  2W9M A;  4X0B A;  4LVS A;  4M9H A;  2HN2 A;  2B56 A;  4F5N A;  4O5E A;  4KLD A;  3OVA A;  3NVO A;  2M2U A;  4K98 A;  7ICG A;  9ICN A;  4WC6 A;  4PPX A;  7ICQ A;  4PHD A;  4I2J A;  4KLS A;  1TFY A;  4XQ7 A;  3NWI A;  4I2E A;  4YMO A;  1ZQP A;  3OWG A;  3WFS C;  2IHO A;  3OVS A;  5JTG A;  3AUO A;  4XUS A;  3JPP A;  1ZQB A;  4X4R A;  2GAF D;  3RJE A;  4WBY A;  4WC4 A;  4QZE A;  4RQ0 A;  4UB4 A;  4LEY A;  5HRI A;  5DDM A;  7ICK A;  5J0Q A;  3OUY A;  4LEZ A;  3WFO A;  4Z6E A;  4QZB A;  4UBC A;  2ZH8 A;  2ISP A;  4Z6F A;  4MKP A;  2O1P A;  5DED A;  3RH5 A;  8ICC A;  1BPD A;  4RPY A;  4M2Y A;  5DBC A;  4JWM A;  4KLH A;  4FO6 A;  4NXT A;  1KNY A;  4QZG A;  4P4P A;  1ZQO A;  4TUP A;  4K9B A;  2ZHB A;  5HRG A;  5IIN A;  2DVI A;  1ZQS A;  5IIO A;  4UD4 A;  4WQK A;  2PFO A;  4KM5 A;  5J2D A;  3HW8 A;  4PH5 A;  5III A;  3AU6 A;  1BPX A;  9ICM A;  3MBY A;  3AQL A;  4I29 A;  5DKW A;  2DR5 A;  5J0P A;  4X4P A;  1BPY A;  4I2F A;  8ICB A;  3ERC C;  4WC3 A;  3ER8 C;  5CB1 A;  3TFR A;  3RJF A;  5DB8 A;  3RH6 A;  2RFF A;  7ICU A;  1XSL A;  4M0A A;  4UD5 A;  5D62 A;  5HRD A;  1ZJN A;  4I2B A;  1ZQX A;  4M47 A;  4GXK A;  4F5R A;  3HIY A;  5D49 A;  2GA9 D;  1BPB A;  4KLI A;  4K4H A;  2GWS A;  5DB9 A;  3V7J A;  9ICJ A;  7ICN A;  1OU5 A;  2FMP A;  4WC1 A;  9ICH A;  2Q66 A;  4R65 A;  7ICP A;  4QZC A;  8ICY A;  1ZQI A;  4YN4 A;  4QZD A;  1XSN A;  1ZQD A;  4O5K A;  9ICK A;  4I2C A;  4TUS A;  3HX0 A;  4GXJ A;  3UQ0 A;  3RJK A;  7ICF A;  7ICS A;  2EWR A;  1JQR A;  3OVB A;  3JPQ A;  5IIJ A;  4DOB A;  4F5P A;  5D61 A;  4KLO A;  1FA0 A;  3V7K A;  1XSP A;  4OAH A;  2NRK A;  9ICA A;  2DRB A;  5DBB A;  5J2H A;  3ISD A;  5DEC A;  3EF2 A;  4X4S A;  4XQ8 A;  4MFA A;  2B51 A;  3AQM A;  4FH3 A;  9ICP A;  4AT9 B;  1TFW A;  4O9M A;  1RPL A;  9ICL A;  5IIM A;  1ZQK A;  2O5A A;  2ZH6 A;  4F5Q A;  1RZT A;  4LEV A;  9ICX A;  8ICG A;  2ZH4 A;  4QZA A;  5BOL A;  4WQL A;  2ZH9 A;  3WFP A;  3OUY B;  4RQ2 A;  3JPN A;  4GXI A;  7ICH A;  5TZV A;  2FCL A;  4WOY A;  4RQ6 A;  2PXI A;  8ICI A;  3HJ1 A;  1ZQR A;  4K99 A;  3UXP A;  4IQW A;  1UET A;  3OGU A;  4MF8 A;  1ZQH A;  4NKT A;  9ICR A;  5CP2 A;  4QZ8 A;  4PHE A;  2ZH7 A;  1ZQQ A;  7ICI A;  4NXW A;  4O67 A;  4IQU A;  3K75 D;  1ZQL A;  4I2A A;  5BPC A;  4XJE A;  5F2V O;  5HRB A;  2HN1 A;  3PHZ A;  2FMS A;  1GPJ A;  1YLQ A;  4F5O A;  4AT8 A;  3JPR A;  8ICK A;  5D63 A;  8ICF A;  4RQ7 A;  3PMN A;  1VFG A;  5D4B A;  8ICR A;  4X5V A;  5CFT A;  9ICO A;  3C5F A;  4EGW A;  4WC7 A;  4RQ1 A;  3MCR A;  3B0X A;  2DR9 A;  4K4I A;  1ZQG A;  3H3A A;  4NKU A;  4RQ4 A;  4X4O A;  4KLM A;  5CHG A;  4KLU A;  3UPQ A;  4PHP A;  4P2H A;  3LK9 A;  3OV7 A;  4M9J A;  1F5A A;  4OAG A;  4X4T A;  4YD2 A;  3UQ2 A;  9ICU A;  4HX0 A;  3NKU A;  2ISO A;  2PFN A;  8ICS A;  1KDH A;  1ZQW A;  1R8B A;  2B4V A;  4NLK A;  4RT2 A;  4UB2 A;  1MIW A;  3TFS A;  4K9A A;  4TUR A;  4UAY A;  2VAN A;  4ATB A;  5DB6 A;  4X4U A;  8ICT A;  4DOA A;  5CR0 A;  5DB7 A;  3RJH A;  4OAF A;  1ZQY A;  3C5G A;  5HRL A;  2BCS A;  4UBB A; 
#chains in the Genus database with same CATH homology
 4Z6D A;  4MF2 A;  4PGX A;  4P4O A;  8ICO A;  4AT7 A;  1BPE A;  4K96 A;  8ICV A;  7ICV A;  4R64 A;  4E80 A;  5BOM A;  2M2T A;  4X0A A;  4MFF A;  3NYB A;  4YD1 A;  2I9G A;  9ICV A;  4MFC A;  2DR7 A;  3WFQ E;  3L9D A;  2PFP A;  4I27 A;  1ZQA A;  9ICQ A;  4E8F A;  3ISC A;  3C2M A;  2DRA A;  1VJ7 A;  3JPT A;  7ICR A;  5D46 A;  4JWN A;  1WOT A;  7ICE A;  1ZQZ A;  2BCR A;  5J2B A;  7ICL A;  3AQK A;  4RWN A;  4NM1 A;  3V72 A;  2IHM A;  4KB6 A;  4FHY A;  3RJG A;  4RQ8 A;  4KLF A;  4UB3 A;  3MGH A;  4OAI Z;  4X4V A;  9ICF A;  4RWO A;  8ICP A;  4NXX A;  4M5D A;  7ICM A;  1ZQT A;  5CJ7 A;  2BCQ A;  4WC5 A;  4UB1 A;  1TV9 A;  2BE3 A;  2M2V A;  5HRF A;  3C2K A;  2BCV A;  8ICA A;  4DOC A;  3UXO A;  5J0U A;  4EBJ A;  5HRH A;  4FHP A;  4I2D A;  4NM2 A;  4JLZ A;  4I2G A;  7ICJ A;  3MGI A;  5CWR A;  4KLG A;  8ICN A;  3MDA A;  4M9L A;  8ICQ A;  9ICG A;  4RPX A;  5J0R A;  5J0Y A;  3C2L A;  3H39 A;  4YMM A;  4M9G A;  4Z6C A;  8ICM A;  8ICJ A;  4FHV A;  1ZQJ A;  5IIL A;  4EP7 A;  1MQ3 A;  4IQV A;  5J0W A;  1Q79 A;  2PFQ A;  4O69 A;  9ICC A;  1KEJ A;  4QZF A;  4PGY A;  1JMS A;  4PGQ A;  5HRK A;  1ZQM A;  2BPF A;  3ISB A;  1UEV A;  9ICE A;  2FMQ A;  4KLJ A;  4XRH A;  5J2G A;  3MDC A;  4UAW A;  2P66 A;  4FH5 A;  4XA5 A;  1TVA A;  5HHH A;  3JYY A;  4LT6 A;  4DO9 A;  4AT9 A;  4PHA A;  3RH4 A;  1ZQN A;  4NXZ A;  4O5C A;  1Q78 A;  4NLZ A;  5J29 A;  1ZQE A;  3JZ0 A;  3B0Y A;  1UEU A;  5DBA A;  5J0S A;  3PNC A;  4FHW A;  4NY8 A;  2BPG A;  4ATB B;  4UB5 A;  4RT3 A;  8ICH A;  7ICT A;  5HRE A;  4K8V A;  9ICT A;  4I2H A;  3HWT A;  5J2E A;  2BCU A;  5HC9 A;  4WC0 A;  2DR8 A;  4EBK A;  4KLL A;  4AT7 B;  5DDY A;  3AQN A;  4RQ5 A;  5J2I A;  2ID1 A;  4FHX A;  4WCW A;  4RPZ A;  8ICW A;  3AU2 A;  1R8C A;  4UAZ A;  1HUO A;  3GDX A;  3H37 A;  4KLQ A;  3LQC B;  5J0O A;  3UXN A;  1HUZ A;  4YCX A;  5IIK A;  1NOM A;  2ZH3 A;  1MIV A;  4QZ9 A;  1ZQC A;  2ZHA A;  4IG8 A;  4E7X A;  1R89 A;  4NXV A;  4I28 A;  4M04 A;  1ZQU A;  4K97 A;  2ZH2 A;  4QZH A;  1PX5 A;  1ZQF A;  4LEW A;  8ICZ A;  9ICW A;  2HHP A;  2PBE A;  4S3N A;  4LZD A;  1V4A A;  4M9N A;  3C66 A;  4YMN A;  5J2A A;  3V7L A;  5HHI A;  5CA7 A;  8ICU A;  3JPO A;  4KLT A;  3RJI A;  4NLN A;  3PML A;  4JLX A;  4O68 A;  9ICS A;  5J2K A;  1ZJM A;  4I2I A;  8ICX A;  4RWP A;  3HJ4 A;  1JN3 A;  3WFR E;  5J2C A;  4QZI A;  5J0X A;  4P4M A;  4KLE A;  2ZH1 A;  5EOZ A;  1ZQV A;  2M2W A;  1R8A A;  4X4N A;  4RWQ A;  4WBZ A;  4WC2 A;  9ICI A;  4X4Q A;  2ZH5 A;  4R66 A;  4NXU A;  9ICB A;  5J0T A;  7ICO A;  4R63 A;  1JAJ A;  1BPZ A;  5J2F A;  3H38 A;  2BPC A;  3JPS A;  4LZG A;  1MIY A;  4O6A A;  4IQT A;  8ICL A;  8ICE A;  3C18 A;  4RQ3 A;  3RJJ A;  1NO5 A;  1MQ2 A;  4K4G A;  4AT8 B;  5HR9 A;  5J2J A;  3UPS A;  4TUQ A;  2W9M A;  4X0B A;  4LVS A;  4M9H A;  2B56 A;  4F5N A;  4O5E A;  4KLD A;  3OVA A;  2M2U A;  4K98 A;  7ICG A;  9ICN A;  4WC6 A;  4PPX A;  7ICQ A;  4PHD A;  4I2J A;  4KLS A;  1TFY A;  4XQ7 A;  4I2E A;  4YMO A;  1ZQP A;  3WFS C;  3OVS A;  3AUO A;  4XUS A;  3JPP A;  1ZQB A;  4X4R A;  3RJE A;  4WBY A;  4WC4 A;  4QZE A;  4RQ0 A;  4UB4 A;  4LEY A;  5HRI A;  5DDM A;  7ICK A;  5J0Q A;  3OUY A;  4LEZ A;  3WFO A;  4Z6E A;  4QZB A;  4UBC A;  2ZH8 A;  2ISP A;  4Z6F A;  4MKP A;  2O1P A;  5DED A;  3RH5 A;  8ICC A;  1BPD A;  4RPY A;  4M2Y A;  5DBC A;  4JWM A;  4KLH A;  4FO6 A;  4NXT A;  1KNY A;  4QZG A;  4P4P A;  1ZQO A;  4TUP A;  4K9B A;  2ZHB A;  5HRG A;  5IIN A;  2DVI A;  1ZQS A;  5IIO A;  4UD4 A;  2PFO A;  4KM5 A;  5J2D A;  3HW8 A;  4PH5 A;  5III A;  3AU6 A;  1BPX A;  9ICM A;  3MBY A;  3AQL A;  4I29 A;  5DKW A;  2DR5 A;  5J0P A;  4X4P A;  1BPY A;  4I2F A;  8ICB A;  4WC3 A;  5CB1 A;  3TFR A;  3RJF A;  5DB8 A;  3RH6 A;  2RFF A;  7ICU A;  1XSL A;  4M0A A;  4UD5 A;  5HRD A;  1ZJN A;  4I2B A;  1ZQX A;  4M47 A;  4GXK A;  4F5R A;  3HIY A;  5D49 A;  1BPB A;  4KLI A;  4K4H A;  2GWS A;  5DB9 A;  3V7J A;  9ICJ A;  7ICN A;  1OU5 A;  2FMP A;  4WC1 A;  9ICH A;  2Q66 A;  4R65 A;  7ICP A;  4QZC A;  8ICY A;  1ZQI A;  4YN4 A;  4QZD A;  1XSN A;  1ZQD A;  4O5K A;  9ICK A;  4I2C A;  4TUS A;  3HX0 A;  4GXJ A;  3UQ0 A;  3RJK A;  7ICF A;  7ICS A;  1JQR A;  3OVB A;  3JPQ A;  5IIJ A;  4DOB A;  4F5P A;  4KLO A;  1FA0 A;  3V7K A;  1XSP A;  4OAH A;  2NRK A;  9ICA A;  2DRB A;  5DBB A;  5J2H A;  3ISD A;  5DEC A;  4X4S A;  4XQ8 A;  4MFA A;  2B51 A;  3AQM A;  4FH3 A;  9ICP A;  4AT9 B;  1TFW A;  4O9M A;  1RPL A;  9ICL A;  5IIM A;  1ZQK A;  2O5A A;  2ZH6 A;  4F5Q A;  1RZT A;  4LEV A;  9ICX A;  8ICG A;  2ZH4 A;  4QZA A;  5BOL A;  2ZH9 A;  3WFP A;  3OUY B;  4RQ2 A;  3JPN A;  4GXI A;  7ICH A;  5TZV A;  4RQ6 A;  4WOY A;  2PXI A;  8ICI A;  3HJ1 A;  1ZQR A;  4K99 A;  3UXP A;  4IQW A;  1UET A;  3OGU A;  4MF8 A;  1ZQH A;  4NKT A;  9ICR A;  5CP2 A;  4QZ8 A;  4PHE A;  2ZH7 A;  1ZQQ A;  7ICI A;  4NXW A;  4O67 A;  4IQU A;  3K75 D;  1ZQL A;  4I2A A;  5BPC A;  5F2V O;  5HRB A;  2FMS A;  1YLQ A;  4F5O A;  4AT8 A;  3JPR A;  8ICK A;  8ICF A;  4RQ7 A;  3PMN A;  1VFG A;  5D4B A;  8ICR A;  4X5V A;  9ICO A;  3C5F A;  4WC7 A;  4RQ1 A;  3B0X A;  2DR9 A;  4K4I A;  1ZQG A;  3H3A A;  4NKU A;  4RQ4 A;  4X4O A;  4KLM A;  5CHG A;  4KLU A;  3UPQ A;  4PHP A;  4P2H A;  3LK9 A;  3OV7 A;  4M9J A;  1F5A A;  4OAG A;  4X4T A;  4YD2 A;  3UQ2 A;  9ICU A;  2ISO A;  2PFN A;  8ICS A;  1KDH A;  1ZQW A;  1R8B A;  2B4V A;  4NLK A;  4RT2 A;  4UB2 A;  1MIW A;  3TFS A;  4K9A A;  4TUR A;  4UAY A;  2VAN A;  4ATB A;  5DB6 A;  4X4U A;  8ICT A;  4DOA A;  5CR0 A;  5DB7 A;  3RJH A;  4OAF A;  1ZQY A;  3C5G A;  5HRL A;  2BCS A;  4UBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...