4FHWA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mggtp bound
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 107
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhwA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhwA02
4RQ4A 3OGUA 4AT8B 4KLEA 4M2YA 1ZJNA 4RQ3A 4I2HA 9ICLA 5HRGA 3AUOA 4MF8A 1ZQTA 4AT7B 4YN4A 7ICOA 9ICBA 7ICSA 1RZTA 4I2IA 4RPZA 5HHHA 4Z6DA 1R8BA 2ZH2A 3MDAA 1ZQWA 4RT3A 4YMMA 1UEVA 3JPTA 5CHGA 2VANA 4QZGA 4X5VA 4I28A 4QZBA 4QZ9A 9ICEA 7ICKA 2M2VA 1BPBA 4TUSA 4KLTA 3C5GA 4FHVA 9ICHA 2BCQA 1V4AA 4X0BA 5DB9A 1XSPA 3UQ0A 4Z6CA 2BPFA 2ZH6A 4F5RA 2ZH5A 8ICLA 3B0YA 4F5QA 4PGXA 5J0YA 1ZQPA 3MGHA 5BOLA 3JPQA 5J29A 4P4PA 5J0TA 4LVSA 3C5FA 5J0QA 1VFGA 9ICAA 4RQ8A 3WFSC 1ZQZA 1MIVA 2BCRA 2DR9A 3RJFA 1MIYA 5CWRA 4KLHA 4QZ8A 3OV7A 4I27A 4GXIA 1ZQVA 4I2FA 5DBCA 1ZQUA 3RJHA 4AT9B 3RJGA 7ICMA 4KLUA 1ZQMA 4KLGA 4UB5A 1YLQA 4XA5A 2ZH7A 4QZAA 5CR0A 2BCSA 2FMPA 3AQLA 4NLZA 1UEUA 3PNCA 5J2KA 3RH4A 1KDHA 4K4GA 1KEJA 4EBJA 4KLLA 5IIIA 4EP7A 2ZH4A 3ISDA 8ICBA 3L9DA 5CJ7A 1ZQQA 7ICVA 4XUSA 4E80A 4PGYA 3C18A 4PPXA 2DRAA 1MIWA 3V7LA 8ICXA 5DEDA 4PHPA 5J0XA 4FO6A 1JMSA 3HIYA 4NLKA 4XQ7A 4X4PA 4AT8A 5DBBA 5IIMA 7ICQA 4EBKA 3WFRE 1ZQKA 4KLFA 4ATBB 4RQ5A 4AT7A 9ICOA 4UD4A 4O5CA 1F5AA 4Z6FA 4UB1A 4WCWA 5J0WA 4WC4A 4P2HA 1PX5A 4YD2A 8ICZA 3H39A 1ZQRA 9ICGA 3H37A 9ICVA 7ICHA 4I2EA 1VJ7A 1ZQIA 2FMSA 1TFYA 4S3NA 1NOMA 5EOZA 9ICQA 4M9HA 4I2DA 4X4OA 2P66A 3OUYB 1ZQHA 4X4QA 1BPXA 5DECA 2DR5A 1BPZA 8ICYA 1ZQNA 4WC2A 2IHMA 3V72A 3JPSA 4X0AA 4I2CA 9ICTA 9ICCA 2BE3A 4WBZA 3AQNA 2PFPA 4JWNA 3RJKA 5DB7A 8ICQA 8ICEA 1Q79A 1ZQCA 4X4SA 4TURA 4LT6A 1ZQXA 4DOBA 1ZQJA 3OVBA 3UXOA 2ID1A 4R63A 3MGIA 4DOAA 5CA7A 4PGQA 2PFNA 2PFQA 4M9LA 4PHDA 2B4VA 4AT9A 3C2MA 2ISOA 2DR7A 3JZ0A 4RPYA 4P4OA 5CB1A 1MQ3A 4F5NA 4FHWA 1ZQLA 7ICGA 4WC3A 1NO5A 2BCUA 5HRDA 4GXKA 1ZQOA 1FA0A 2ZH1A 3C2LA 4RWOA 2M2WA 1ZJMA 5TZVA 4WBYA 2DR8A 4NLNA 4O9MA 2RFFA 3GDXA 3OVSA 4UAWA 4QZDA 4I2GA 2BCVA 4UB3A 1XSNA 4M47A 5IILA 4IG8A 1JAJA 4P4MA 4FHYA 4KLSA 4LZGA 4IQWA 4K4HA 4X4VA 2B56A 5HRLA 4X4TA 1BPEA 4RQ0A 3RJIA 2PFOA 3WFOA 4WC7A 4MF2A 4NM2A 1ZQGA 4RQ6A 5J2AA 3ISBA 3RH6A 4DOCA 3MDCA 9ICFA 1UETA 5CP2A 5J2DA 2ZHAA 1HUOA 5HRHA 5HC9A 9ICPA 1ZQYA 4MFFA 4X4NA 7ICJA 4KLIA 4KLMA 4IQTA 5J2FA 3H38A 3HWTA 5IINA 1ZQSA 8ICHA 3AU2A 4K4IA 1ZQAA 4LZDA 4R66A 4DO9A 5HHIA 3C66A 5J2EA 3UQ2A 3OUYA 3HX0A 3RJEA 2ZH9A 1WOTA 4FHPA 4FH5A 4Z6EA 2O5AA 4F5PA 3RJJA 8ICGA 3HJ1A 9ICIA 1HUZA 2ZH8A 3AU6A 4UB4A 5IIKA 7ICPA 2M2TA 3PMLA 3WFQE 8ICCA 4FH3A 8ICJA 8ICOA 4M9NA 7ICTA 9ICSA 8ICRA 4WC1A 4R65A 3V7JA 5HR9A 4QZHA 3JYYA 5D46A 3MBYA 4RWPA 8ICPA 8ICWA 4RT2A 9ICNA 8ICUA 8ICIA 3JPOA 2HHPA 4RPXA 3JPPA 3OVAA 4NM1A 4I2BA 3UXNA 4KLDA 4GXJA 4O5EA 3TFRA 4I2JA 2PXIA 2I9GA 2B51A 9ICWA 5J2JA 3HJ4A 4YCXA 4YD1A 3AQKA 4M04A 4UAZA 3RH5A 4PH5A 4TUQA 4UAYA 5BPCA 5J2IA 3JPRA 8ICAA 5DKWA 8ICSA 9ICUA 5J0SA 4WC0A 1KNYA 4M9GA 9ICRA 4QZEA 4QZFA 1ZQEA 2NRKA 5DBAA 8ICNA 4JWMA 4RWQA 3HW8A 3C2KA 3K75D 4RQ1A 4RWNA 8ICFA 4WC5A 3JPNA 8ICVA 2GWSA 5J0PA 7ICFA 4PHEA 4QZIA 8ICMA 1TVAA 5F2VO 2W9MA 4UD5A 2Q66A 8ICTA 3WFPA 4RQ7A 4YMNA 2BPGA 4NXZA 5J2BA 3V7KA 4XRHA 5HRFA 1BPYA 4FHXA 5HRIA 3AQMA 1R89A 4ATBA 5HRBA 4F5OA 5D4BA 4I2AA 9ICXA 4E8FA 4PHAA 2M2UA 5BOMA 5J0OA 4O5KA 4M9JA 4UB2A 9ICMA 3NYBA 5DB6A 5HRKA 5IIOA 1OU5A 3UPSA 1ZQBA 2O1PA 2BPCA 1MQ2A 1JQRA 2ISPA 2ZHBA 2DVIA 5J0RA 1XSLA 4IQUA 4WC6A 4UBBA 3LQCB 5IIJA 3PMNA 4QZCA 4IQVA 5J2GA 2DRBA 3UXPA 5J2CA 5J0UA 4MFCA 7ICUA 4X4RA 4NKTA 4UBCA 3LK9A 1RPLA 4NY8A 1TV9A 5DB8A 4X4UA 4YMOA 9ICJA 3UPQA 4E7XA 5D49A 3TFSA 4RQ2A 1R8AA 4KLQA 1R8CA 1BPDA 5DDMA 9ICKA 4TUPA 7ICRA 4M5DA 5DDYA 7ICEA 3H3AA 4KLOA 4R64A 2ZH3A 1ZQFA 5J2HA 4M0AA 2FMQA 3ISCA 1TFWA 3B0XA 2PBEA 4MFAA 4I29A 4XQ8A 7ICNA 1Q78A 1JN3A 7ICIA 5HREA 7ICLA 1ZQDA 4NKUA 4KLJA 8ICKA
chains in the Genus database with same CATH superfamily
4RQ4A 3OGUA 4KM5A 4AT8B 4KLEA 4M2YA 1ZJNA 4RQ3A 4I2HA 9ICLA 5HRGA 3AUOA 4MF8A 1ZQTA 4AT7B 4YN4A 7ICOA 9ICBA 7ICSA 1RZTA 3ER8C 4I2IA 4RPZA 5HHHA 4Z6DA 1R8BA 2ZH2A 3MDAA 1ZQWA 4RT3A 4YMMA 1UEVA 2HN1A 3JPTA 5CHGA 2VANA 4QZGA 4X5VA 4I28A 4QZBA 4OAIZ 4QZ9A 9ICEA 7ICKA 2M2VA 1BPBA 4TUSA 4KLTA 3C5GA 4FHVA 9ICHA 2BCQA 1V4AA 4X0BA 5DB9A 1XSPA 3UQ0A 4Z6CA 2BPFA 2ZH6A 4F5RA 4NXXA 2ZH5A 8ICLA 3B0YA 4F5QA 4PGXA 5J0YA 4MKPA 1ZQPA 3MGHA 5BOLA 4LEYA 3JPQA 5J29A 4P4PA 5J0TA 4LVSA 3C5FA 5J0QA 1VFGA 9ICAA 4RQ8A 3WFSC 1ZQZA 1MIVA 2BCRA 2DR9A 3RJFA 1MIYA 5CWRA 4KLHA 4QZ8A 3OV7A 4I27A 4GXIA 1ZQVA 4WQKA 4I2FA 5DBCA 1ZQUA 3RJHA 4EEDA 4AT9B 3RJGA 7ICMA 4KLUA 1ZQMA 4KLGA 4UB5A 1YLQA 4XA5A 2ZH7A 4QZAA 5CR0A 2BCSA 4O67A 2FMPA 3AQLA 4NLZA 1UEUA 3PNCA 2IHOA 2GA9D 5J2KA 3RH4A 1KDHA 4K4GA 1KEJA 4EBJA 4KLLA 5IIIA 4EP7A 2ZH4A 3ISDA 8ICBA 3L9DA 5CJ7A 1ZQQA 7ICVA 4EEBA 4XUSA 4E80A 4PGYA 4OAFA 3C18A 5B3PA 4PPXA 2DRAA 4K9BA 4JLXA 4O69A 1MIWA 3V7LA 8ICXA 5DEDA 4PHPA 5J0XA 3ERCC 4FO6A 1JMSA 3HIYA 4NLKA 4LEVA 4XQ7A 4X4PA 5D63A 5CHEA 4AT8A 5DBBA 5IIMA 7ICQA 4EBKA 3WFRE 2IUBA 1ZQKA 4KLFA 4ATBB 4RQ5A 4AT7A 9ICOA 4UD4A 4O5CA 1F5AA 4Z6FA 4UB1A 4WCWA 5J0WA 4WC4A 4P2HA 1PX5A 4NXVA 4YD2A 8ICZA 3H39A 1ZQRA 9ICGA 3H37A 9ICVA 7ICHA 4I2EA 1VJ7A 1ZQIA 2FMSA 1TFYA 4S3NA 1NOMA 5EOZA 9ICQA 4M9HA 4I2DA 4X4OA 2P66A 3OUYB 1ZQHA 2FCLA 4X4QA 1BPXA 5DECA 2DR5A 1BPZA 8ICYA 1ZQNA 4WC2A 2IHMA 3V72A 3JPSA 4X0AA 4I2CA 9ICTA 9ICCA 2BE3A 4WBZA 3AQNA 2PFPA 2BBJA 4JWNA 3RJKA 5DB7A 8ICQA 8ICEA 4LEWA 2HN2A 1Q79A 1ZQCA 4X4SA 4TURA 4LT6A 3OVBA 1ZQXA 4DOBA 1ZQJA 3UXOA 2ID1A 4R63A 2BBHA 3MGIA 4DOAA 5CA7A 4PGQA 2PFNA 2PFQA 4M9LA 4PHDA 2B4VA 4HX0A 4AT9A 3C2MA 2ISOA 2DR7A 3JZ0A 4RPYA 4P4OA 5CB1A 1MQ3A 4F5NA 4FHWA 1ZQLA 7ICGA 4WC3A 1NO5A 2BCUA 5HRDA 4GXKA 1ZQOA 1FA0A 2ZH1A 3C2LA 4RWOA 4JLZA 2M2WA 1ZJMA 5TZVA 4WBYA 2DR8A 4OAGA 4NLNA 4O9MA 2RFFA 3GDXA 3OVSA 4UAWA 4QZDA 4I2GA 2BCVA 4UB3A 1XSNA 4M47A 5IILA 4IG8A 3MCRA 1JAJA 4P4MA 4FHYA 4KLSA 4LZGA 4IQWA 4X4VA 4K4HA 2B56A 5HRLA 4X4TA 4XJEA 1BPEA 4RQ0A 3RJIA 2PFOA 3WFOA 4WC7A 4MF2A 4NM2A 1ZQGA 4RQ6A 5J2AA 3ISBA 3RH6A 4DOCA 3MDCA 9ICFA 1UETA 5CP2A 5J2DA 2ZHAA 3PHZA 1HUOA 5HRHA 5HC9A 9ICPA 1ZQYA 4X4NA 4MFFA 7ICJA 4KLIA 4OAHA 4KLMA 4IQTA 5J2FA 3H38A 3HWTA 5IINA 1ZQSA 8ICHA 4N7RA 3AU2A 4K4IA 1ZQAA 4LZDA 4K99A 4R66A 4DO9A 5HHIA 3C66A 5J2EA 5CFUA 3UQ2A 3OUYA 3HX0A 3RJEA 2ZH9A 1WOTA 5CFTA 4FHPA 4FH5A 4Z6EA 5JTGA 2O5AA 4F5PA 3RJJA 8ICGA 3HJ1A 3JCFA 9ICIA 3CK6A 1HUZA 2ZH8A 4NXWA 3AU6A 3NWIA 4UB4A 5IIKA 1GPJA 2M2TA 7ICPA 3PMLA 3WFQE 8ICCA 4FH3A 8ICJA 8ICOA 4M9NA 3OWGA 7ICTA 9ICSA 8ICRA 4NXTA 4WC1A 4R65A 3V7JA 5HR9A 4QZHA 4KB6A 3NVOA 3JYYA 4FO1A 5D46A 3MBYA 4RWPA 8ICPA 8ICWA 4RT2A 9ICNA 8ICUA 8ICIA 3JPOA 2HHPA 4RPXA 3JPPA 3OVAA 4NM1A 4I2BA 3UXNA 4KLDA 4GXJA 4O5EA 3TFRA 4I2JA 2PXIA 2I9GA 2B51A 9ICWA 5J2JA 4O68A 4WH5A 3HJ4A 4YCXA 4YD1A 3AQKA 4M04A 4UAZA 3RH5A 4EV6A 4PH5A 4TUQA 4UAYA 5BPCA 5J2IA 3JPRA 8ICAA 5DKWA 8ICSA 9ICUA 5J0SA 4WC0A 1KNYA 4M9GA 9ICRA 4QZEA 4QZFA 1ZQEA 4O6AA 4WQLA 2NRKA 3NKUA 5DBAA 8ICNA 4JWMA 4RWQA 3HW8A 3C2KA 3K75D 4RQ1A 4RWNA 3EF2A 8ICFA 4WC5A 3JPNA 8ICVA 4EGWA 2GWSA 5J0PA 7ICFA 4PHEA 4QZIA 8ICMA 5D62A 4I0UA 5B3QA 1TVAA 5F2VO 4K98A 2W9MA 4UD5A 2Q66A 8ICTA 3WFPA 4RQ7A 3K7DA 4YMNA 2BPGA 4NXZA 5J2BA 3V7KA 4XRHA 5HRFA 1BPYA 4K9AA 4FHXA 5HRIA 3AQMA 5HRBA 1R89A 4ATBA 4F5OA 5D4BA 4I2AA 9ICXA 4E8FA 4PHAA 2M2UA 5BOMA 2EWRA 5J0OA 4O5KA 4M9JA 4UB2A 9ICMA 3NYBA 5DB6A 5HRKA 5IIOA 1OU5A 3UPSA 1ZQBA 2O1PA 2BPCA 1MQ2A 1JQRA 2ISPA 4WOYA 2ZHBA 2DVIA 5J0RA 1XSLA 4IQUA 4WC6A 4UBBA 3LQCB 5IIJA 3PMNA 4QZCA 4IQVA 2DRBA 5J2GA 3UXPA 4LEZA 5J2CA 5J0UA 4MFCA 7ICUA 4X4RA 4NKTA 4UBCA 3LK9A 1RPLA 4NY8A 4X4UA 5DB8A 1TV9A 2GAFD 4YMOA 4NXUA 9ICJA 3UPQA 4E7XA 4K97A 5D49A 3ER9B 5D61A 3TFSA 4RQ2A 1R8AA 4KLQA 4K96A 1R8CA 1BPDA 5DDMA 9ICKA 4TUPA 7ICRA 4M5DA 5DDYA 7ICEA 3H3AA 4KLOA 4K8VA 2ZH3A 4R64A 5J2HA 1ZQFA 4M0AA 2FMQA 1TFWA 3ISCA 3B0XA 2PBEA 4MFAA 4I29A 4XQ8A 7ICNA 1Q78A 1JN3A 7ICIA 5HREA 7ICLA 1ZQDA 4NKUA 4KLJA 8ICKA 5CFSA
chains in the Genus database with same CATH topology
4RQ4A 3OGUA 4KM5A 4AT8B 4KLEA 4M2YA 1ZJNA 4RQ3A 4I2HA 9ICLA 5HRGA 3AUOA 4MF8A 1ZQTA 4AT7B 4YN4A 7ICOA 9ICBA 7ICSA 1RZTA 4I2IA 4RPZA 5HHHA 4Z6DA 1R8BA 2ZH2A 3MDAA 1ZQWA 4RT3A 4YMMA 1UEVA 3JPTA 5CHGA 2VANA 4QZGA 4X5VA 4I28A 4QZBA 4OAIZ 4QZ9A 9ICEA 7ICKA 2M2VA 1BPBA 4TUSA 4KLTA 3C5GA 4FHVA 9ICHA 2BCQA 1V4AA 4X0BA 5DB9A 1XSPA 3UQ0A 4Z6CA 2BPFA 2ZH6A 4F5RA 4NXXA 2ZH5A 8ICLA 3B0YA 4F5QA 4PGXA 5J0YA 4MKPA 1ZQPA 3MGHA 5BOLA 4LEYA 3JPQA 5J29A 4P4PA 5J0TA 4LVSA 3C5FA 5J0QA 1VFGA 9ICAA 4RQ8A 3WFSC 1ZQZA 1MIVA 2BCRA 2DR9A 3RJFA 1MIYA 5CWRA 4KLHA 4QZ8A 3OV7A 4I27A 4GXIA 1ZQVA 4I2FA 5DBCA 1ZQUA 3RJHA 4AT9B 3RJGA 7ICMA 4KLUA 1ZQMA 4KLGA 4UB5A 1YLQA 4XA5A 2ZH7A 4QZAA 5CR0A 2BCSA 4O67A 2FMPA 3AQLA 4NLZA 1UEUA 3PNCA 5J2KA 3RH4A 1KDHA 4K4GA 1KEJA 4EBJA 4KLLA 5IIIA 4EP7A 2ZH4A 3ISDA 8ICBA 3L9DA 5CJ7A 1ZQQA 7ICVA 4XUSA 4E80A 4PGYA 4OAFA 3C18A 4PPXA 2DRAA 4K9BA 4JLXA 4O69A 1MIWA 3V7LA 8ICXA 5DEDA 4PHPA 5J0XA 4FO6A 1JMSA 3HIYA 4NLKA 4LEVA 4XQ7A 4X4PA 4AT8A 5DBBA 5IIMA 7ICQA 4EBKA 3WFRE 1ZQKA 4KLFA 4ATBB 4RQ5A 4AT7A 9ICOA 4UD4A 4O5CA 1F5AA 4Z6FA 4UB1A 4WCWA 5J0WA 4WC4A 4P2HA 1PX5A 4NXVA 4YD2A 8ICZA 3H39A 1ZQRA 9ICGA 3H37A 9ICVA 7ICHA 4I2EA 1VJ7A 1ZQIA 2FMSA 1TFYA 4S3NA 1NOMA 5EOZA 9ICQA 4M9HA 4I2DA 4X4OA 2P66A 3OUYB 1ZQHA 4X4QA 1BPXA 5DECA 2DR5A 1BPZA 8ICYA 1ZQNA 4WC2A 2IHMA 3V72A 3JPSA 4X0AA 4I2CA 9ICTA 9ICCA 2BE3A 4WBZA 3AQNA 2PFPA 4JWNA 3RJKA 5DB7A 8ICQA 8ICEA 4LEWA 1Q79A 1ZQCA 4X4SA 4TURA 4LT6A 3OVBA 1ZQXA 4DOBA 1ZQJA 3UXOA 2ID1A 4R63A 3MGIA 4DOAA 5CA7A 4PGQA 2PFNA 2PFQA 4M9LA 4PHDA 2B4VA 4AT9A 3C2MA 2ISOA 2DR7A 3JZ0A 4RPYA 4P4OA 5CB1A 1MQ3A 4F5NA 4FHWA 1ZQLA 7ICGA 4WC3A 1NO5A 2BCUA 5HRDA 4GXKA 1ZQOA 1FA0A 2ZH1A 3C2LA 4RWOA 4JLZA 2M2WA 1ZJMA 5TZVA 4WBYA 2DR8A 4OAGA 4NLNA 4O9MA 2RFFA 3GDXA 3OVSA 4UAWA 4QZDA 4I2GA 2BCVA 4UB3A 1XSNA 4M47A 5IILA 4IG8A 1JAJA 4P4MA 4FHYA 4KLSA 4LZGA 4IQWA 4X4VA 4K4HA 2B56A 5HRLA 4X4TA 1BPEA 4RQ0A 3RJIA 2PFOA 3WFOA 4WC7A 4MF2A 4NM2A 1ZQGA 4RQ6A 5J2AA 3ISBA 3RH6A 4DOCA 3MDCA 9ICFA 1UETA 5CP2A 5J2DA 2ZHAA 1HUOA 5HRHA 5HC9A 9ICPA 1ZQYA 4X4NA 4MFFA 7ICJA 4KLIA 4OAHA 4KLMA 4IQTA 5J2FA 3H38A 3HWTA 5IINA 1ZQSA 8ICHA 3AU2A 4K4IA 1ZQAA 4LZDA 4K99A 4R66A 4DO9A 5HHIA 3C66A 5J2EA 3UQ2A 3OUYA 3HX0A 3RJEA 2ZH9A 1WOTA 4FHPA 4FH5A 4Z6EA 2O5AA 4F5PA 3RJJA 8ICGA 3HJ1A 9ICIA 1HUZA 2ZH8A 4NXWA 3AU6A 4UB4A 5IIKA 7ICPA 2M2TA 3PMLA 3WFQE 8ICCA 4FH3A 8ICJA 8ICOA 4M9NA 7ICTA 9ICSA 8ICRA 4NXTA 4WC1A 4R65A 3V7JA 5HR9A 4QZHA 4KB6A 3JYYA 5D46A 3MBYA 4RWPA 8ICPA 8ICWA 4RT2A 9ICNA 8ICUA 8ICIA 3JPOA 2HHPA 4RPXA 3JPPA 3OVAA 4NM1A 4I2BA 3UXNA 4KLDA 4GXJA 4O5EA 3TFRA 4I2JA 2PXIA 2I9GA 2B51A 9ICWA 5J2JA 4O68A 3HJ4A 4YCXA 4YD1A 3AQKA 4M04A 4UAZA 3RH5A 4PH5A 4TUQA 4UAYA 5BPCA 5J2IA 3JPRA 8ICAA 5DKWA 8ICSA 9ICUA 5J0SA 4WC0A 1KNYA 4M9GA 9ICRA 4QZEA 4QZFA 1ZQEA 4O6AA 2NRKA 5DBAA 8ICNA 4JWMA 4RWQA 3HW8A 3C2KA 3K75D 4RQ1A 4RWNA 8ICFA 4WC5A 3JPNA 8ICVA 2GWSA 5J0PA 7ICFA 4PHEA 4QZIA 8ICMA 1TVAA 5F2VO 4K98A 2W9MA 4UD5A 2Q66A 8ICTA 3WFPA 4RQ7A 4YMNA 2BPGA 4NXZA 5J2BA 3V7KA 4XRHA 5HRFA 1BPYA 4K9AA 4FHXA 5HRIA 3AQMA 1R89A 4ATBA 5HRBA 4F5OA 5D4BA 4I2AA 9ICXA 4E8FA 4PHAA 2M2UA 5BOMA 5J0OA 4O5KA 4M9JA 4UB2A 9ICMA 3NYBA 5DB6A 5HRKA 5IIOA 1OU5A 3UPSA 1ZQBA 2O1PA 2BPCA 1MQ2A 1JQRA 2ISPA 4WOYA 2ZHBA 2DVIA 5J0RA 1XSLA 4IQUA 4WC6A 4UBBA 3LQCB 5IIJA 3PMNA 4QZCA 4IQVA 2DRBA 5J2GA 3UXPA 4LEZA 5J2CA 5J0UA 4MFCA 7ICUA 4X4RA 4NKTA 4UBCA 3LK9A 1RPLA 4NY8A 4X4UA 5DB8A 1TV9A 4YMOA 4NXUA 9ICJA 3UPQA 4E7XA 4K97A 5D49A 3TFSA 4RQ2A 1R8AA 4KLQA 4K96A 1R8CA 1BPDA 5DDMA 9ICKA 4TUPA 7ICRA 4M5DA 5DDYA 7ICEA 3H3AA 4KLOA 4K8VA 2ZH3A 4R64A 5J2HA 1ZQFA 4M0AA 2FMQA 1TFWA 3ISCA 3B0XA 2PBEA 4MFAA 4I29A 4XQ8A 7ICNA 1Q78A 1JN3A 7ICIA 5HREA 7ICLA 1ZQDA 4NKUA 4KLJA 8ICKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ4 A;  3OGU A;  4AT8 B;  4KLE A;  4M2Y A;  1ZJN A;  4RQ3 A;  4I2H A;  9ICL A;  5HRG A;  3AUO A;  4MF8 A;  1ZQT A;  4AT7 B;  4YN4 A;  7ICO A;  9ICB A;  7ICS A;  1RZT A;  4I2I A;  4RPZ A;  5HHH A;  4Z6D A;  1R8B A;  2ZH2 A;  3MDA A;  1ZQW A;  4RT3 A;  4YMM A;  1UEV A;  3JPT A;  5CHG A;  2VAN A;  4QZG A;  4X5V A;  4I28 A;  4QZB A;  4QZ9 A;  9ICE A;  7ICK A;  2M2V A;  1BPB A;  4TUS A;  4KLT A;  3C5G A;  4FHV A;  9ICH A;  2BCQ A;  1V4A A;  4X0B A;  5DB9 A;  1XSP A;  3UQ0 A;  4Z6C A;  2BPF A;  2ZH6 A;  4F5R A;  2ZH5 A;  8ICL A;  3B0Y A;  4F5Q A;  4PGX A;  5J0Y A;  1ZQP A;  3MGH A;  5BOL A;  3JPQ A;  5J29 A;  4P4P A;  5J0T A;  4LVS A;  3C5F A;  5J0Q A;  1VFG A;  9ICA A;  4RQ8 A;  3WFS C;  1ZQZ A;  1MIV A;  2BCR A;  2DR9 A;  3RJF A;  1MIY A;  5CWR A;  4KLH A;  4QZ8 A;  3OV7 A;  4I27 A;  4GXI A;  1ZQV A;  4I2F A;  5DBC A;  1ZQU A;  3RJH A;  4AT9 B;  3RJG A;  7ICM A;  4KLU A;  1ZQM A;  4KLG A;  4UB5 A;  1YLQ A;  4XA5 A;  2ZH7 A;  4QZA A;  5CR0 A;  2BCS A;  2FMP A;  3AQL A;  4NLZ A;  1UEU A;  3PNC A;  5J2K A;  3RH4 A;  1KDH A;  4K4G A;  1KEJ A;  4EBJ A;  4KLL A;  5III A;  4EP7 A;  2ZH4 A;  3ISD A;  8ICB A;  3L9D A;  5CJ7 A;  1ZQQ A;  7ICV A;  4XUS A;  4E80 A;  4PGY A;  3C18 A;  4PPX A;  2DRA A;  1MIW A;  3V7L A;  8ICX A;  5DED A;  4PHP A;  5J0X A;  4FO6 A;  1JMS A;  3HIY A;  4NLK A;  4XQ7 A;  4X4P A;  4AT8 A;  5DBB A;  5IIM A;  7ICQ A;  4EBK A;  3WFR E;  1ZQK A;  4KLF A;  4ATB B;  4RQ5 A;  4AT7 A;  9ICO A;  4UD4 A;  4O5C A;  1F5A A;  4Z6F A;  4UB1 A;  4WCW A;  5J0W A;  4WC4 A;  4P2H A;  1PX5 A;  4YD2 A;  8ICZ A;  3H39 A;  1ZQR A;  9ICG A;  3H37 A;  9ICV A;  7ICH A;  4I2E A;  1VJ7 A;  1ZQI A;  2FMS A;  1TFY A;  4S3N A;  1NOM A;  5EOZ A;  9ICQ A;  4M9H A;  4I2D A;  4X4O A;  2P66 A;  3OUY B;  1ZQH A;  4X4Q A;  1BPX A;  5DEC A;  2DR5 A;  1BPZ A;  8ICY A;  1ZQN A;  4WC2 A;  2IHM A;  3V72 A;  3JPS A;  4X0A A;  4I2C A;  9ICT A;  9ICC A;  2BE3 A;  4WBZ A;  3AQN A;  2PFP A;  4JWN A;  3RJK A;  5DB7 A;  8ICQ A;  8ICE A;  1Q79 A;  1ZQC A;  4X4S A;  4TUR A;  4LT6 A;  1ZQX A;  4DOB A;  1ZQJ A;  3OVB A;  3UXO A;  2ID1 A;  4R63 A;  3MGI A;  4DOA A;  5CA7 A;  4PGQ A;  2PFN A;  2PFQ A;  4M9L A;  4PHD A;  2B4V A;  4AT9 A;  3C2M A;  2ISO A;  2DR7 A;  3JZ0 A;  4RPY A;  4P4O A;  5CB1 A;  1MQ3 A;  4F5N A;  4FHW A;  1ZQL A;  7ICG A;  4WC3 A;  1NO5 A;  2BCU A;  5HRD A;  4GXK A;  1ZQO A;  1FA0 A;  2ZH1 A;  3C2L A;  4RWO A;  2M2W A;  1ZJM A;  5TZV A;  4WBY A;  2DR8 A;  4NLN A;  4O9M A;  2RFF A;  3GDX A;  3OVS A;  4UAW A;  4QZD A;  4I2G A;  2BCV A;  4UB3 A;  1XSN A;  4M47 A;  5IIL A;  4IG8 A;  1JAJ A;  4P4M A;  4FHY A;  4KLS A;  4LZG A;  4IQW A;  4K4H A;  4X4V A;  2B56 A;  5HRL A;  4X4T A;  1BPE A;  4RQ0 A;  3RJI A;  2PFO A;  3WFO A;  4WC7 A;  4MF2 A;  4NM2 A;  1ZQG A;  4RQ6 A;  5J2A A;  3ISB A;  3RH6 A;  4DOC A;  3MDC A;  9ICF A;  1UET A;  5CP2 A;  5J2D A;  2ZHA A;  1HUO A;  5HRH A;  5HC9 A;  9ICP A;  1ZQY A;  4MFF A;  4X4N A;  7ICJ A;  4KLI A;  4KLM A;  4IQT A;  5J2F A;  3H38 A;  3HWT A;  5IIN A;  1ZQS A;  8ICH A;  3AU2 A;  4K4I A;  1ZQA A;  4LZD A;  4R66 A;  4DO9 A;  5HHI A;  3C66 A;  5J2E A;  3UQ2 A;  3OUY A;  3HX0 A;  3RJE A;  2ZH9 A;  1WOT A;  4FHP A;  4FH5 A;  4Z6E A;  2O5A A;  4F5P A;  3RJJ A;  8ICG A;  3HJ1 A;  9ICI A;  1HUZ A;  2ZH8 A;  3AU6 A;  4UB4 A;  5IIK A;  7ICP A;  2M2T A;  3PML A;  3WFQ E;  8ICC A;  4FH3 A;  8ICJ A;  8ICO A;  4M9N A;  7ICT A;  9ICS A;  8ICR A;  4WC1 A;  4R65 A;  3V7J A;  5HR9 A;  4QZH A;  3JYY A;  5D46 A;  3MBY A;  4RWP A;  8ICP A;  8ICW A;  4RT2 A;  9ICN A;  8ICU A;  8ICI A;  3JPO A;  2HHP A;  4RPX A;  3JPP A;  3OVA A;  4NM1 A;  4I2B A;  3UXN A;  4KLD A;  4GXJ A;  4O5E A;  3TFR A;  4I2J A;  2PXI A;  2I9G A;  2B51 A;  9ICW A;  5J2J A;  3HJ4 A;  4YCX A;  4YD1 A;  3AQK A;  4M04 A;  4UAZ A;  3RH5 A;  4PH5 A;  4TUQ A;  4UAY A;  5BPC A;  5J2I A;  3JPR A;  8ICA A;  5DKW A;  8ICS A;  9ICU A;  5J0S A;  4WC0 A;  1KNY A;  4M9G A;  9ICR A;  4QZE A;  4QZF A;  1ZQE A;  2NRK A;  5DBA A;  8ICN A;  4JWM A;  4RWQ A;  3HW8 A;  3C2K A;  3K75 D;  4RQ1 A;  4RWN A;  8ICF A;  4WC5 A;  3JPN A;  8ICV A;  2GWS A;  5J0P A;  7ICF A;  4PHE A;  4QZI A;  8ICM A;  1TVA A;  5F2V O;  2W9M A;  4UD5 A;  2Q66 A;  8ICT A;  3WFP A;  4RQ7 A;  4YMN A;  2BPG A;  4NXZ A;  5J2B A;  3V7K A;  4XRH A;  5HRF A;  1BPY A;  4FHX A;  5HRI A;  3AQM A;  1R89 A;  4ATB A;  5HRB A;  4F5O A;  5D4B A;  4I2A A;  9ICX A;  4E8F A;  4PHA A;  2M2U A;  5BOM A;  5J0O A;  4O5K A;  4M9J A;  4UB2 A;  9ICM A;  3NYB A;  5DB6 A;  5HRK A;  5IIO A;  1OU5 A;  3UPS A;  1ZQB A;  2O1P A;  2BPC A;  1MQ2 A;  1JQR A;  2ISP A;  2ZHB A;  2DVI A;  5J0R A;  1XSL A;  4IQU A;  4WC6 A;  4UBB A;  3LQC B;  5IIJ A;  3PMN A;  4QZC A;  4IQV A;  5J2G A;  2DRB A;  3UXP A;  5J2C A;  5J0U A;  4MFC A;  7ICU A;  4X4R A;  4NKT A;  4UBC A;  3LK9 A;  1RPL A;  4NY8 A;  1TV9 A;  5DB8 A;  4X4U A;  4YMO A;  9ICJ A;  3UPQ A;  4E7X A;  5D49 A;  3TFS A;  4RQ2 A;  1R8A A;  4KLQ A;  1R8C A;  1BPD A;  5DDM A;  9ICK A;  4TUP A;  7ICR A;  4M5D A;  5DDY A;  7ICE A;  3H3A A;  4KLO A;  4R64 A;  2ZH3 A;  1ZQF A;  5J2H A;  4M0A A;  2FMQ A;  3ISC A;  1TFW A;  3B0X A;  2PBE A;  4MFA A;  4I29 A;  4XQ8 A;  7ICN A;  1Q78 A;  1JN3 A;  7ICI A;  5HRE A;  7ICL A;  1ZQD A;  4NKU A;  4KLJ A;  8ICK A; 
#chains in the Genus database with same CATH topology
 4RQ4 A;  3OGU A;  4KM5 A;  4AT8 B;  4KLE A;  4M2Y A;  1ZJN A;  4RQ3 A;  4I2H A;  9ICL A;  5HRG A;  3AUO A;  4MF8 A;  1ZQT A;  4AT7 B;  4YN4 A;  7ICO A;  9ICB A;  7ICS A;  1RZT A;  3ER8 C;  4I2I A;  4RPZ A;  5HHH A;  4Z6D A;  1R8B A;  2ZH2 A;  3MDA A;  1ZQW A;  4RT3 A;  4YMM A;  1UEV A;  2HN1 A;  3JPT A;  5CHG A;  2VAN A;  4QZG A;  4X5V A;  4I28 A;  4QZB A;  4OAI Z;  4QZ9 A;  9ICE A;  7ICK A;  2M2V A;  1BPB A;  4TUS A;  4KLT A;  3C5G A;  4FHV A;  9ICH A;  2BCQ A;  1V4A A;  4X0B A;  5DB9 A;  1XSP A;  3UQ0 A;  4Z6C A;  2BPF A;  2ZH6 A;  4F5R A;  4NXX A;  2ZH5 A;  8ICL A;  3B0Y A;  4F5Q A;  4PGX A;  5J0Y A;  4MKP A;  1ZQP A;  3MGH A;  5BOL A;  4LEY A;  3JPQ A;  5J29 A;  4P4P A;  5J0T A;  4LVS A;  3C5F A;  5J0Q A;  1VFG A;  9ICA A;  4RQ8 A;  3WFS C;  1ZQZ A;  1MIV A;  2BCR A;  2DR9 A;  3RJF A;  1MIY A;  5CWR A;  4KLH A;  4QZ8 A;  3OV7 A;  4I27 A;  4GXI A;  1ZQV A;  4WQK A;  4I2F A;  5DBC A;  1ZQU A;  3RJH A;  4EED A;  4AT9 B;  3RJG A;  7ICM A;  4KLU A;  1ZQM A;  4KLG A;  4UB5 A;  1YLQ A;  4XA5 A;  2ZH7 A;  4QZA A;  5CR0 A;  2BCS A;  4O67 A;  2FMP A;  3AQL A;  4NLZ A;  1UEU A;  3PNC A;  2IHO A;  2GA9 D;  5J2K A;  3RH4 A;  1KDH A;  4K4G A;  1KEJ A;  4EBJ A;  4KLL A;  5III A;  4EP7 A;  2ZH4 A;  3ISD A;  8ICB A;  3L9D A;  5CJ7 A;  1ZQQ A;  7ICV A;  4EEB A;  4XUS A;  4E80 A;  4PGY A;  4OAF A;  3C18 A;  5B3P A;  4PPX A;  2DRA A;  4K9B A;  4JLX A;  4O69 A;  1MIW A;  3V7L A;  8ICX A;  5DED A;  4PHP A;  5J0X A;  3ERC C;  4FO6 A;  1JMS A;  3HIY A;  4NLK A;  4LEV A;  4XQ7 A;  4X4P A;  5D63 A;  5CHE A;  4AT8 A;  5DBB A;  5IIM A;  7ICQ A;  4EBK A;  3WFR E;  2IUB A;  1ZQK A;  4KLF A;  4ATB B;  4RQ5 A;  4AT7 A;  9ICO A;  4UD4 A;  4O5C A;  1F5A A;  4Z6F A;  4UB1 A;  4WCW A;  5J0W A;  4WC4 A;  4P2H A;  1PX5 A;  4NXV A;  4YD2 A;  8ICZ A;  3H39 A;  1ZQR A;  9ICG A;  3H37 A;  9ICV A;  7ICH A;  4I2E A;  1VJ7 A;  1ZQI A;  2FMS A;  1TFY A;  4S3N A;  1NOM A;  5EOZ A;  9ICQ A;  4M9H A;  4I2D A;  4X4O A;  2P66 A;  3OUY B;  1ZQH A;  2FCL A;  4X4Q A;  1BPX A;  5DEC A;  2DR5 A;  1BPZ A;  8ICY A;  1ZQN A;  4WC2 A;  2IHM A;  3V72 A;  3JPS A;  4X0A A;  4I2C A;  9ICT A;  9ICC A;  2BE3 A;  4WBZ A;  3AQN A;  2PFP A;  2BBJ A;  4JWN A;  3RJK A;  5DB7 A;  8ICQ A;  8ICE A;  4LEW A;  2HN2 A;  1Q79 A;  1ZQC A;  4X4S A;  4TUR A;  4LT6 A;  3OVB A;  1ZQX A;  4DOB A;  1ZQJ A;  3UXO A;  2ID1 A;  4R63 A;  2BBH A;  3MGI A;  4DOA A;  5CA7 A;  4PGQ A;  2PFN A;  2PFQ A;  4M9L A;  4PHD A;  2B4V A;  4HX0 A;  4AT9 A;  3C2M A;  2ISO A;  2DR7 A;  3JZ0 A;  4RPY A;  4P4O A;  5CB1 A;  1MQ3 A;  4F5N A;  4FHW A;  1ZQL A;  7ICG A;  4WC3 A;  1NO5 A;  2BCU A;  5HRD A;  4GXK A;  1ZQO A;  1FA0 A;  2ZH1 A;  3C2L A;  4RWO A;  4JLZ A;  2M2W A;  1ZJM A;  5TZV A;  4WBY A;  2DR8 A;  4OAG A;  4NLN A;  4O9M A;  2RFF A;  3GDX A;  3OVS A;  4UAW A;  4QZD A;  4I2G A;  2BCV A;  4UB3 A;  1XSN A;  4M47 A;  5IIL A;  4IG8 A;  3MCR A;  1JAJ A;  4P4M A;  4FHY A;  4KLS A;  4LZG A;  4IQW A;  4X4V A;  4K4H A;  2B56 A;  5HRL A;  4X4T A;  4XJE A;  1BPE A;  4RQ0 A;  3RJI A;  2PFO A;  3WFO A;  4WC7 A;  4MF2 A;  4NM2 A;  1ZQG A;  4RQ6 A;  5J2A A;  3ISB A;  3RH6 A;  4DOC A;  3MDC A;  9ICF A;  1UET A;  5CP2 A;  5J2D A;  2ZHA A;  3PHZ A;  1HUO A;  5HRH A;  5HC9 A;  9ICP A;  1ZQY A;  4X4N A;  4MFF A;  7ICJ A;  4KLI A;  4OAH A;  4KLM A;  4IQT A;  5J2F A;  3H38 A;  3HWT A;  5IIN A;  1ZQS A;  8ICH A;  4N7R A;  3AU2 A;  4K4I A;  1ZQA A;  4LZD A;  4K99 A;  4R66 A;  4DO9 A;  5HHI A;  3C66 A;  5J2E A;  5CFU A;  3UQ2 A;  3OUY A;  3HX0 A;  3RJE A;  2ZH9 A;  1WOT A;  5CFT A;  4FHP A;  4FH5 A;  4Z6E A;  5JTG A;  2O5A A;  4F5P A;  3RJJ A;  8ICG A;  3HJ1 A;  3JCF A;  9ICI A;  3CK6 A;  1HUZ A;  2ZH8 A;  4NXW A;  3AU6 A;  3NWI A;  4UB4 A;  5IIK A;  1GPJ A;  2M2T A;  7ICP A;  3PML A;  3WFQ E;  8ICC A;  4FH3 A;  8ICJ A;  8ICO A;  4M9N A;  3OWG A;  7ICT A;  9ICS A;  8ICR A;  4NXT A;  4WC1 A;  4R65 A;  3V7J A;  5HR9 A;  4QZH A;  4KB6 A;  3NVO A;  3JYY A;  4FO1 A;  5D46 A;  3MBY A;  4RWP A;  8ICP A;  8ICW A;  4RT2 A;  9ICN A;  8ICU A;  8ICI A;  3JPO A;  2HHP A;  4RPX A;  3JPP A;  3OVA A;  4NM1 A;  4I2B A;  3UXN A;  4KLD A;  4GXJ A;  4O5E A;  3TFR A;  4I2J A;  2PXI A;  2I9G A;  2B51 A;  9ICW A;  5J2J A;  4O68 A;  4WH5 A;  3HJ4 A;  4YCX A;  4YD1 A;  3AQK A;  4M04 A;  4UAZ A;  3RH5 A;  4EV6 A;  4PH5 A;  4TUQ A;  4UAY A;  5BPC A;  5J2I A;  3JPR A;  8ICA A;  5DKW A;  8ICS A;  9ICU A;  5J0S A;  4WC0 A;  1KNY A;  4M9G A;  9ICR A;  4QZE A;  4QZF A;  1ZQE A;  4O6A A;  4WQL A;  2NRK A;  3NKU A;  5DBA A;  8ICN A;  4JWM A;  4RWQ A;  3HW8 A;  3C2K A;  3K75 D;  4RQ1 A;  4RWN A;  3EF2 A;  8ICF A;  4WC5 A;  3JPN A;  8ICV A;  4EGW A;  2GWS A;  5J0P A;  7ICF A;  4PHE A;  4QZI A;  8ICM A;  5D62 A;  4I0U A;  5B3Q A;  1TVA A;  5F2V O;  4K98 A;  2W9M A;  4UD5 A;  2Q66 A;  8ICT A;  3WFP A;  4RQ7 A;  3K7D A;  4YMN A;  2BPG A;  4NXZ A;  5J2B A;  3V7K A;  4XRH A;  5HRF A;  1BPY A;  4K9A A;  4FHX A;  5HRI A;  3AQM A;  5HRB A;  1R89 A;  4ATB A;  4F5O A;  5D4B A;  4I2A A;  9ICX A;  4E8F A;  4PHA A;  2M2U A;  5BOM A;  2EWR A;  5J0O A;  4O5K A;  4M9J A;  4UB2 A;  9ICM A;  3NYB A;  5DB6 A;  5HRK A;  5IIO A;  1OU5 A;  3UPS A;  1ZQB A;  2O1P A;  2BPC A;  1MQ2 A;  1JQR A;  2ISP A;  4WOY A;  2ZHB A;  2DVI A;  5J0R A;  1XSL A;  4IQU A;  4WC6 A;  4UBB A;  3LQC B;  5IIJ A;  3PMN A;  4QZC A;  4IQV A;  2DRB A;  5J2G A;  3UXP A;  4LEZ A;  5J2C A;  5J0U A;  4MFC A;  7ICU A;  4X4R A;  4NKT A;  4UBC A;  3LK9 A;  1RPL A;  4NY8 A;  4X4U A;  5DB8 A;  1TV9 A;  2GAF D;  4YMO A;  4NXU A;  9ICJ A;  3UPQ A;  4E7X A;  4K97 A;  5D49 A;  3ER9 B;  5D61 A;  3TFS A;  4RQ2 A;  1R8A A;  4KLQ A;  4K96 A;  1R8C A;  1BPD A;  5DDM A;  9ICK A;  4TUP A;  7ICR A;  4M5D A;  5DDY A;  7ICE A;  3H3A A;  4KLO A;  4K8V A;  2ZH3 A;  4R64 A;  5J2H A;  1ZQF A;  4M0A A;  2FMQ A;  1TFW A;  3ISC A;  3B0X A;  2PBE A;  4MFA A;  4I29 A;  4XQ8 A;  7ICN A;  1Q78 A;  1JN3 A;  7ICI A;  5HRE A;  7ICL A;  1ZQD A;  4NKU A;  4KLJ A;  8ICK A;  5CFS A; 
#chains in the Genus database with same CATH homology
 4RQ4 A;  3OGU A;  4KM5 A;  4AT8 B;  4KLE A;  4M2Y A;  1ZJN A;  4RQ3 A;  4I2H A;  9ICL A;  5HRG A;  3AUO A;  4MF8 A;  1ZQT A;  4AT7 B;  4YN4 A;  7ICO A;  9ICB A;  7ICS A;  1RZT A;  4I2I A;  4RPZ A;  5HHH A;  4Z6D A;  1R8B A;  2ZH2 A;  3MDA A;  1ZQW A;  4RT3 A;  4YMM A;  1UEV A;  3JPT A;  5CHG A;  2VAN A;  4QZG A;  4X5V A;  4I28 A;  4QZB A;  4OAI Z;  4QZ9 A;  9ICE A;  7ICK A;  2M2V A;  1BPB A;  4TUS A;  4KLT A;  3C5G A;  4FHV A;  9ICH A;  2BCQ A;  1V4A A;  4X0B A;  5DB9 A;  1XSP A;  3UQ0 A;  4Z6C A;  2BPF A;  2ZH6 A;  4F5R A;  4NXX A;  2ZH5 A;  8ICL A;  3B0Y A;  4F5Q A;  4PGX A;  5J0Y A;  4MKP A;  1ZQP A;  3MGH A;  5BOL A;  4LEY A;  3JPQ A;  5J29 A;  4P4P A;  5J0T A;  4LVS A;  3C5F A;  5J0Q A;  1VFG A;  9ICA A;  4RQ8 A;  3WFS C;  1ZQZ A;  1MIV A;  2BCR A;  2DR9 A;  3RJF A;  1MIY A;  5CWR A;  4KLH A;  4QZ8 A;  3OV7 A;  4I27 A;  4GXI A;  1ZQV A;  4I2F A;  5DBC A;  1ZQU A;  3RJH A;  4AT9 B;  3RJG A;  7ICM A;  4KLU A;  1ZQM A;  4KLG A;  4UB5 A;  1YLQ A;  4XA5 A;  2ZH7 A;  4QZA A;  5CR0 A;  2BCS A;  4O67 A;  2FMP A;  3AQL A;  4NLZ A;  1UEU A;  3PNC A;  5J2K A;  3RH4 A;  1KDH A;  4K4G A;  1KEJ A;  4EBJ A;  4KLL A;  5III A;  4EP7 A;  2ZH4 A;  3ISD A;  8ICB A;  3L9D A;  5CJ7 A;  1ZQQ A;  7ICV A;  4XUS A;  4E80 A;  4PGY A;  4OAF A;  3C18 A;  4PPX A;  2DRA A;  4K9B A;  4JLX A;  4O69 A;  1MIW A;  3V7L A;  8ICX A;  5DED A;  4PHP A;  5J0X A;  4FO6 A;  1JMS A;  3HIY A;  4NLK A;  4LEV A;  4XQ7 A;  4X4P A;  4AT8 A;  5DBB A;  5IIM A;  7ICQ A;  4EBK A;  3WFR E;  1ZQK A;  4KLF A;  4ATB B;  4RQ5 A;  4AT7 A;  9ICO A;  4UD4 A;  4O5C A;  1F5A A;  4Z6F A;  4UB1 A;  4WCW A;  5J0W A;  4WC4 A;  4P2H A;  1PX5 A;  4NXV A;  4YD2 A;  8ICZ A;  3H39 A;  1ZQR A;  9ICG A;  3H37 A;  9ICV A;  7ICH A;  4I2E A;  1VJ7 A;  1ZQI A;  2FMS A;  1TFY A;  4S3N A;  1NOM A;  5EOZ A;  9ICQ A;  4M9H A;  4I2D A;  4X4O A;  2P66 A;  3OUY B;  1ZQH A;  4X4Q A;  1BPX A;  5DEC A;  2DR5 A;  1BPZ A;  8ICY A;  1ZQN A;  4WC2 A;  2IHM A;  3V72 A;  3JPS A;  4X0A A;  4I2C A;  9ICT A;  9ICC A;  2BE3 A;  4WBZ A;  3AQN A;  2PFP A;  4JWN A;  3RJK A;  5DB7 A;  8ICQ A;  8ICE A;  4LEW A;  1Q79 A;  1ZQC A;  4X4S A;  4TUR A;  4LT6 A;  3OVB A;  1ZQX A;  4DOB A;  1ZQJ A;  3UXO A;  2ID1 A;  4R63 A;  3MGI A;  4DOA A;  5CA7 A;  4PGQ A;  2PFN A;  2PFQ A;  4M9L A;  4PHD A;  2B4V A;  4AT9 A;  3C2M A;  2ISO A;  2DR7 A;  3JZ0 A;  4RPY A;  4P4O A;  5CB1 A;  1MQ3 A;  4F5N A;  4FHW A;  1ZQL A;  7ICG A;  4WC3 A;  1NO5 A;  2BCU A;  5HRD A;  4GXK A;  1ZQO A;  1FA0 A;  2ZH1 A;  3C2L A;  4RWO A;  4JLZ A;  2M2W A;  1ZJM A;  5TZV A;  4WBY A;  2DR8 A;  4OAG A;  4NLN A;  4O9M A;  2RFF A;  3GDX A;  3OVS A;  4UAW A;  4QZD A;  4I2G A;  2BCV A;  4UB3 A;  1XSN A;  4M47 A;  5IIL A;  4IG8 A;  1JAJ A;  4P4M A;  4FHY A;  4KLS A;  4LZG A;  4IQW A;  4X4V A;  4K4H A;  2B56 A;  5HRL A;  4X4T A;  1BPE A;  4RQ0 A;  3RJI A;  2PFO A;  3WFO A;  4WC7 A;  4MF2 A;  4NM2 A;  1ZQG A;  4RQ6 A;  5J2A A;  3ISB A;  3RH6 A;  4DOC A;  3MDC A;  9ICF A;  1UET A;  5CP2 A;  5J2D A;  2ZHA A;  1HUO A;  5HRH A;  5HC9 A;  9ICP A;  1ZQY A;  4X4N A;  4MFF A;  7ICJ A;  4KLI A;  4OAH A;  4KLM A;  4IQT A;  5J2F A;  3H38 A;  3HWT A;  5IIN A;  1ZQS A;  8ICH A;  3AU2 A;  4K4I A;  1ZQA A;  4LZD A;  4K99 A;  4R66 A;  4DO9 A;  5HHI A;  3C66 A;  5J2E A;  3UQ2 A;  3OUY A;  3HX0 A;  3RJE A;  2ZH9 A;  1WOT A;  4FHP A;  4FH5 A;  4Z6E A;  2O5A A;  4F5P A;  3RJJ A;  8ICG A;  3HJ1 A;  9ICI A;  1HUZ A;  2ZH8 A;  4NXW A;  3AU6 A;  4UB4 A;  5IIK A;  7ICP A;  2M2T A;  3PML A;  3WFQ E;  8ICC A;  4FH3 A;  8ICJ A;  8ICO A;  4M9N A;  7ICT A;  9ICS A;  8ICR A;  4NXT A;  4WC1 A;  4R65 A;  3V7J A;  5HR9 A;  4QZH A;  4KB6 A;  3JYY A;  5D46 A;  3MBY A;  4RWP A;  8ICP A;  8ICW A;  4RT2 A;  9ICN A;  8ICU A;  8ICI A;  3JPO A;  2HHP A;  4RPX A;  3JPP A;  3OVA A;  4NM1 A;  4I2B A;  3UXN A;  4KLD A;  4GXJ A;  4O5E A;  3TFR A;  4I2J A;  2PXI A;  2I9G A;  2B51 A;  9ICW A;  5J2J A;  4O68 A;  3HJ4 A;  4YCX A;  4YD1 A;  3AQK A;  4M04 A;  4UAZ A;  3RH5 A;  4PH5 A;  4TUQ A;  4UAY A;  5BPC A;  5J2I A;  3JPR A;  8ICA A;  5DKW A;  8ICS A;  9ICU A;  5J0S A;  4WC0 A;  1KNY A;  4M9G A;  9ICR A;  4QZE A;  4QZF A;  1ZQE A;  4O6A A;  2NRK A;  5DBA A;  8ICN A;  4JWM A;  4RWQ A;  3HW8 A;  3C2K A;  3K75 D;  4RQ1 A;  4RWN A;  8ICF A;  4WC5 A;  3JPN A;  8ICV A;  2GWS A;  5J0P A;  7ICF A;  4PHE A;  4QZI A;  8ICM A;  1TVA A;  5F2V O;  4K98 A;  2W9M A;  4UD5 A;  2Q66 A;  8ICT A;  3WFP A;  4RQ7 A;  4YMN A;  2BPG A;  4NXZ A;  5J2B A;  3V7K A;  4XRH A;  5HRF A;  1BPY A;  4K9A A;  4FHX A;  5HRI A;  3AQM A;  1R89 A;  4ATB A;  5HRB A;  4F5O A;  5D4B A;  4I2A A;  9ICX A;  4E8F A;  4PHA A;  2M2U A;  5BOM A;  5J0O A;  4O5K A;  4M9J A;  4UB2 A;  9ICM A;  3NYB A;  5DB6 A;  5HRK A;  5IIO A;  1OU5 A;  3UPS A;  1ZQB A;  2O1P A;  2BPC A;  1MQ2 A;  1JQR A;  2ISP A;  4WOY A;  2ZHB A;  2DVI A;  5J0R A;  1XSL A;  4IQU A;  4WC6 A;  4UBB A;  3LQC B;  5IIJ A;  3PMN A;  4QZC A;  4IQV A;  2DRB A;  5J2G A;  3UXP A;  4LEZ A;  5J2C A;  5J0U A;  4MFC A;  7ICU A;  4X4R A;  4NKT A;  4UBC A;  3LK9 A;  1RPL A;  4NY8 A;  4X4U A;  5DB8 A;  1TV9 A;  4YMO A;  4NXU A;  9ICJ A;  3UPQ A;  4E7X A;  4K97 A;  5D49 A;  3TFS A;  4RQ2 A;  1R8A A;  4KLQ A;  4K96 A;  1R8C A;  1BPD A;  5DDM A;  9ICK A;  4TUP A;  7ICR A;  4M5D A;  5DDY A;  7ICE A;  3H3A A;  4KLO A;  4K8V A;  2ZH3 A;  4R64 A;  5J2H A;  1ZQF A;  4M0A A;  2FMQ A;  1TFW A;  3ISC A;  3B0X A;  2PBE A;  4MFA A;  4I29 A;  4XQ8 A;  7ICN A;  1Q78 A;  1JN3 A;  7ICI A;  5HRE A;  7ICL A;  1ZQD A;  4NKU A;  4KLJ A;  8ICK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...