4YMMA

Structure of human dna polymerase beta complexed with 7bg as the template base in a 1-nucleotide gapped dna
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title Structure of human DNA polymerase beta complexed with 7BG as the template base in a 1-nucleotide gapped DNA
rcsb
source organism Homo sapiens
total genus 111
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ymmA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ymmA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ymmA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ymmA03
9ICTA 2XCPA 5J2CA 3MR5A 4MEYA 4J9SA 3PX0A 1RYRA 1LV5A 1B43A 3K75D 2F1HA 4ED0A 1H38A 2PFPA 4S3NA 4UD5A 3JPSA 1L3UA 2KTQA 4ECVA 2BPCA 1QSSA 4F4YA 7ICLA 4WBZA 4ECWA 1UETA 4WC5A 5BOLA 4ED7A 3ISBA 4RT3A 4KMUA 3BDPA 5KFBA 4KLHA 2UVVA 3LDAA 4UBCA 2R8IA 4EBCA 5KFDA 5DG8A 3OV7A 4RPYA 5KG1A 5HMMA 1MSWD 4JUZA 3C2LA 1ZQTA 4O3OA 3AQNA 3MFHA 4XUSA 5J2KA 8ICHA 2JZBA 2NRWA 4IQVA 4FS2A 3PO5A 5KFHA 3SV4A 1NK9A 2PI4A 2M2VA 1OU5A 5HP4A 1NZPA 2ZJ5A 4I2IA 2M2TA 3ISCA 4QWCA 3BJYA 5J0OA 5HNKA 3RJFA 1DOQA 5DQGA 3H39A 5L9XA 4F92B 1X9MA 2ZH8A 4Z6DA 3M9NB 4C8KA 5HC9A 2BDPA 1ZQCA 4RNOA 8ICXA 4YMOA 1RPLA 3OSNA 9ICSA 4J9PA 4K4GA 2AQ0A 4R8UB 2KFNA 1R89A 3KHRA 2XGPA 4UB5A 8ICTA 2DVIA 3Q8QB 4IQWA 4EBDA 9ICXA 1ZQPA 2HHVA 3T5LA 3RR8A 4QWBA 4P2HA 5J2AA 4IRDA 3OJSA 8ICBA 4FBUA 3C2KA 4EEYA 4M9HA 4FHWA 1S97A 2BCRA 1A77A 1X9SA 1KDHA 7ICUA 4LZDA 4QZ8A 7ICPA 1KSPA 4RT2A 4C8LA 1TK8A 2HHSA 2FPLA 2XGQA 4WC1A 5J0QA 3Q8KA 3OVSA 3T5KA 2KZ3A 3QEAZ 4F8RA 1Q79A 4GXIA 4P4MA 3RH6A 5J2DA 7ICJA 7ICSA 3Q8MA 4KLMA 3LK9A 2V4QA 4RPXA 5F9NA 2V9WA 5KFCA 9ICGA 1U9LA 4I2GA 4KITB 4X5VA 4KLGA 5HRIA 3Q8PB 4J9OA 2A1JB 1NK0A 1L3VA 3V6KA 1XC9A 1ZQQA 4X4UA 1ZQDA 5BPCA 4Q8EA 1ZQLA 4DL7A 3AU6A 4IR1A 1KRPA 3AUOA 1XS9D 3PW2A 2JEJA 1KTQA 3HT3A 4F5PA 2R8JA 4C8OA 4WCWA 5CWRA 5DEDA 4B9UA 3H7IA 3AU2A 5KG7A 4RQ1A 4DSIA 4ED1A 2HHXA 8ICLA 4I27A 3RJIA 4PHEA 1S0MA 3SI8A 1SKRA 4MFAA 9ICRA 1DK3A 9ICUA 2UVUA 4X4VA 1ZQHA 3PW4A 4XQ7A 1ZJNA 9ICBA 1MQ3A 4X4SA 5J2IA 3RR7A 4I28A 4NLKA 4M04A 8ICNA 1NK4A 4BXOB 3V72A 4I2HA 7ICIA 1SKWA 5HR9A 2W9MA 1NJYA 1NKEA 2BKEA 2ISPA 2HHPA 2ZHAA 4CCHA 2ZH4A 4ED6A 4DQIA 1ZQIA 2FLNA 2MUTA 2J6SA 4QW8A 9ICWA 2DRAA 1A76A 1Z00A 5CHGA 3EPIA 4I2FA 4RNNA 3RBDA 4RZRA 1ZQXA 5KG0A 2AQ4A 1S77D 3WFRE 3TAQA 4O3SA 7ICKA 1ZQRA 5J2JA 4ELUA 4M6WB 5DQHA 3MR2A 4DO9A 5DGBA 2Y1IA 3OSPA 3K4GA 2RDJA 4FS1A 1LB2B 4QZEA 2KP7A 2O5AA 4JK1A 2W9CB 5DBCA 3GIJA 3H8WA 3C1ZA 3H4BA 3Q8SB 4YFKA 4F5NA 2BCSA 5IIJA 2HHTA 5DBBA 2ZUBA 3HP6A 5CR0A 2BCUA 2RFFA 5KG6A 4YCXA 4YQWA 9ICAA 5HRGA 1JQRA 2XCAA 2P66A 3TI0A 2HVIA 5BOMA 3JPOA 3EWAA 5EWFA 4ED2A 1NJWA 4EZ6A 4Q8FA 5HRLA 3OUYB 5L1LA 3KTQA 1SZPA 3H3AA 1ZQOA 1KEJA 1ZQMA 4RPZA 2W9BA 4DSJA 4QZDA 3UXNA 4O5CA 4TQRA 1NJZA 4DFPA 1S0VA 2FLLA 1MIWA 3MGIA 3HX0A 1NK6A 1R8CA 3UXPA 4YR0A 4JWMA 4O5EA 4AT7B 1WCLA 3H38A 3EPGA 1SL1A 4WC2A 4DEZA 1BPDA 3T3FA 3GILA 9ICOA 1NO5A 5KT7A 3G6VA 3RAXA 2XO7A 2ZH2A 3EZ5A 2F1IA 4P4PA 1Y88A 5D4BA 4F50A 2UVWA 7ICQA 3HJ1A 4QWAA 1U4BA 5KFWA 3TAPA 3HW8A 2AGQA 1T7PA 2NRTA 4DOAA 1NKBA 4IQUA 4R65A 4LZGA 2BCQA 4QZCA 5DKWA 2UVRA 3UPSA 2W8LA 5J2GA 5KFZA 2Q0ZX 4PHAA 5DG9A 1XSLA 4FHVA 3PR5B 7ICHA 2KN7A 4KLUA 9ICCA 1EXNA 1IM4A 1D8YA 2NRXA 1CUKA 1D8LA 5HMLA 4BWJA 2KZZA 2KZMA 4EBJA 5KFVA 1JXEA 4M9LA 3OVBA 3ZD9A 3PNCA 2AGOA 4F4ZA 1SL2A 5KFOA 2ZJ8A 4RWPA 5IIOA 1ZQVA 5HHHA 5J0PA 2LYHA 2ZTEA 2DPJA 1VFGA 2C2EA 2ISOA 4YMNA 3C18A 1S76D 2FMPA 4X4TA 4DSFA 7ICOA 1U47A 2PBEA 3MR3A 1MIYA 4DL6A 8ICQA 4WC0A 4DS5A 1ZQWA 4YVZA 4UB1A 5DECA 4X4NA 4X4OA 4DFMA 4J9NA 9ICVA 1ZQSA 4KLFA 2XY7A 2XC9A 2IHNA 4EBKA 5C5JA 3V7LA 4UAWA 5DB7A 1S0OA 3OGUA 2RDIA 4ECQA 1BVSA 3MDAA 3T5HA 1BPXA 2R8HA 4KTQA 4E7XA 3PX6A 2R8GA 4I2CA 3HJ4A 5EOZA 4FH5A 5KFSA 2HVHA 5EWGA 2P6RA 2ID1A 2W9CA 8ICVA 3PW0A 4R63A 3L9DA 1RYSA 2M2WA 8ICAA 4I2BA 1XSNA 2BCVA 5HREA 4AT8B 4M9NA 8ICEA 2ZTDA 4I2DA 2ZH7A 4YP3A 5KG3A 1XWLA 1ZQAA 1ZQFA 2B21A 4B9NA 4B9VA 4AT9B 2FMQA 2IA6A 1BPYA 4IRCA 4QWDA 3RJHA 4FBTA 9ICJA 3KHHA 4ECSA 4M9JA 4RQ2A 3OHBA 3SV3A 2HHQA 4X0BA 7ICFA 1U49A 4QZ9A 3C5GA 4KLDA 3B0XA 3OHAA 2ZH9A 2FPMA 5DB6A 3M8RA 3GIMA 1C7YA 5KFXA 1VJ7A 4FH3A 1PZNA 4DF4A 4PGYA 4YD2A 3MR6A 1D9FA 5D49A 2VA8A 5KFKA 4AT7A 9ICPA 1XU4A 4JV0A 2ZH3A 2MAXA 1QTMA 1NK8A 5DBAA 3AQLA 1RZTA 4EP7A 4ATBB 1MC8A 4KLLA 5J2HA 4NKUA 5HRHA 2BHNA 4C8MA 5IIMA 5KFFA 4RQ5A 1N48A 3FDSA 1D9DA 3B0YA 4DFJA 4PPXA 2AGPA 2Y1JA 4J9RA 8ICSA 2ZTCA 4YN4A 2PFNA 1TFRA 1NKCA 4JV2A 3IM1A 1L3TA 1KLNA 5J0YA 4NM1A 1CEZA 5J0XA 4F5OA 3RJGA 4YR3A 5KFLA 3PY8A 2KFZA 1KFDA 3RH5A 1RXVA 4X4QA 2M2UA 2WTFA 1UA0A 4KLOA 1ZJMA 3AQMA 1QLNA 1X2IA 4M0AA 4O5KA 4F4WA 2NRKA 3V7JA 3KHLA 5DQIA 2VA3A 4BDPA 5KFAA 5KTQA 4J9QA 3RB6A 5HRFA 3TQ1A 3C66A 2ATLA 5KT4A 2VA2A 4GXKA 4RUCA 2IBKA 1V4AA 4PHDA 4B9LA 2NRVA 4UB3A 1ZQBA 3UXOA 4GC6A 2XY5A 4WC3A 4DWIA 5KT6A 4LVSA 3RB3A 5J2BA 3QZ8A 3BQ1A 4K4HA 4O3PA 3RJEA 2HHWA 8ICFA 4RWOA 5J2EA 2VANA 4DL2A 4DQQA 1QSYA 4PHPA 1KFTA 4RNMA 5KFYA 5JUMA 4NY8A 4R8UA 4DF8A 2ASLA 4XRHA 2XY6A 1L3SA 4TUSA 1L5UA 5KG2A 2DFLA 1ZQKA 1HUOA 3RRHA 2BQ3A 1JN3A 5J0WA 1COOA 2IMWP 2J6UA 2W9AA 5HRDA 3GV7B 4Q45A 1JAJA 3RBEA 4QZFA 3JPPA 3C21A 3C23A 5IIIA 4MEXA 4K4IA 4I2AA 1ZQUA 5KT5A 3V6HA 2FLPA 2PI5A 4HYKA 3NYBA 1SKSA 3ETLA 1AROP 4F2RA 3EYZA 2OWOA 3TFRA 3M8SA 4E0DA 3C2MA 1XO1A 3H8SA 4O9MA 5J2FA 3EW9A 3JPRA 2BQUA 4Z6FA 1N56A 2J6TA 1SL0A 3QEBZ 9ICMA 4DSEA 1PX5A 1MQ2A 4F4XA 4M5DA 4E8FA 3M9OB 2PFOA 3RJKA 5L1IA 4UQGA 1R8AA 5HRBA 3Q8LA 4AT9A 4MF8A 4WC7A 4B9MA 4I29A 2ASJA 4X0AA 2A1JA 4GXJA 3HWTA 3V7KA 4ECYA 4F4KA 3V6JA 3H40A 4MF2A 5HHIA 4XA5A 4ED3A 2AU0A 1HUZA 5KG4A 4EYIB 8ICMA 4NLGA 2FPKA 9ICQA 2ZUCA 1YLQA 5DB8A 4UAZA 3GIKA 3C5FA 5IILA 8ICZA 7ICGA 4ECUA 8ICPA 4FHPA 3OVAA 3JPNA 2F1JA 2ALZA 3M9MB 1WCNA 5KFEA 3FYHA 3Q8RB 2C2DA 4XQ8A 4DSLA 4ECRA 4NLNA 2BE3A 3JPQA 3UPQA 4ECTA 4UBBA 4DOBA 5DDYA 3HPOA 5D46A 4DFKA 1U48A 2DR8A 3PR4A 3QE9Y 4QWEA 3H4DA 4ECXA 5KFPA 3RAQA 1ZQJA 4KLTA 5DLFA 4BXOA 5J0RA 3MGHA 3BQTA 2NRZA 4UAYA 4QZBA 5L1KA 2DR7A 2H5XA 9ICKA 4YD1A 1X9WA 1T8EA 3WFSC 4J9LA 1ZQZA 4GC7A 1S10A 4F3OA 7ICMA 3PMLA 8ICUA 5J0TA 3KHGA 1B22A 1UEVA 3TFSA 1UT5A 1BGXT 3ZDAA 4KN7A 4UD4A 3WFOA 4C8NA 4PGXA 4RQ8A 3G6YA 3LWLA 2MUTB 2JEIA 1R8BA 4IQTA 1Z00B 2HHUA 1ZQYA 4UB4A 3LWMA 1UA1A 2JEGA 4BWMA 1S0NA 4O3RA 4KLSA 3LQCB 3WFPA 1S9FA 1K1QA 1TV9A 4NLZA 4KLEA 8ICRA 4M6WA 3MABA 7ICRA 5DG7A 1HJPA 2ZH6A 1TFWA 4I2EA 4F93B 5HRKA 4QW9A 3TANA 2W8KA 3UQ0A 4O3QA 1JIHA 5J29A 1BPBA 5J0SA 4RQ6A 3ZDEA 3PMNA 3JZ0A 3OJUA 5CP2A 5DGAA 5IIKA 4Z6CA 4IR9A 9ICFA 4GLXA 2C2RA 4KN4A 3MDCA 4DL5A 2DRBA 1K1SA 4R66A 4DOCA 5KFJA 4YXJA 5DDMA 4FHXA 4YG2A 1MIVA 5KG5A 3PO4A 1TAUA 9ICLA 1Q78A 3OUYA 4M9GA 4RQ4A 8ICYA 3ZDCA 4NM2A 2O1PA 4P4OA 3GQCA 1BPEA 4TURA 4PH5A 1BNOA 3JPTA 2ZH5A 4YXMA 4TUQA 2W9BB 2AJQA 1BNPA 5KT2A 7ICVA 3ZD8A 3GIIA 5CJ7A 2DPIA 1NK5A 1FA0A 5CA7A 5DLGA 4RQ0A 1NJXA 4YR2A 3RB0A 2PFQA 9ICEA 2ZHBA 4QZGA 4IRKA 5KFNA 4ZH4A 5DB9A 4QZIA 1TKDA 3ORYA 4F5QA 2GWSA 3HIYA 5CB1A 1JXLA 1DK2A 4PGQA 2I9GA 3NGDA 2C22A 5EWEA 4O0IA 5KFGA 5TZVA 4DQSA 4R64A 4G3IA 3THVA 1UT8A 4TUPA 2PXIA 4MFFA 1KNYA 4LT6A 4DS4A 3GV8B 4IG8A 1TFYA 3RH4A 5F2VO 8ICOA 4I2JA 5J0UA 4EZ9A 1ZQNA 3ISDA 1ZQGA 1UEUA 1RXWA 4DLGA 3ZDDA 3E2EA 4J9KA 2BPGA 3BQ2A 8ICKA 1JMSA 1ZETA 1IXRA 2JZBB 3PVXA 1U45A 4ECZA 4QZAA 3PX4A 3PV8A 4RQ7A 1Z3EB 4QZHA 1JX4A 2ZJAA 4TQSA 2IHMA 4F2SA 1V9PA 4WBYA 3IHQB 5KFUA 1ZYQA 7ICTA 2JEFA 2ZUDA 1DGSA 3BQ0A 3GV5B 2ASDA 2FMSA 5KFRA 3N4MB 8ICGA 5KFQA 3RJJA 4B9TA 1TK0A 4DLEA 4B9SA 9ICIA 4DQRA 3TARA 4DQPA 4Q43A 1T3NA 3RRGA 3PW7A 4DL4A 8ICJA 1ZQEA 8ICCA 4X4PA 4YMMA 3SYZA 4UB2A 4DSKA 3WFQE 3SZ2A 1XSPA 1NK7A 5KT3A 4KLIA 2Q66A 2BR0A 4NXZA 4KLQA 4WC4A 3UQ2A 4O3NA 7ICNA 4EYHB 2P6UA 3G6XA 3N97B 3RB4A 3H37A 4RU9A 5IINA 4FO6A 3PW5A 2DR9A 2C28A 3GFKB 3ZDBA 5F9LA 1QSLA 4M47A 1TAQA 4JV1A 4BGDA 4RQ3A 3MFIA 4MFCA 4ED8A 4KLJA 1TVAA 4AT8A 4NKTA 2HW3A 4RWQA 5KFIA 4EBEA 1T4GA 2V4RA 1TK5A 2BQRA 7ICEA 2BPFA 9ICNA 1NOMA 3H8JA 2M9NA 4F91B 4Q44A 3MBYA 5L1JA 1BPZA 4JWNA 4FHYA 4DL3A 3GDXA 1WOTA 4J9MA 4WC6A 4RWNA 3C1YA 4ELTA 2ZH1A 2I1QA 1KFSA 4RUAA 3RTVA 3NTUA 5KFMA 3QZ7A 9ICHA 8ICIA 4X4RA 3JYYA 3T5JA 4Z6EA 4M2YA 2DR5A 4F5RA 5KFTA 4E80A 8ICWA 3AQKA 4ELVA 2R8KA 2BGWA 4ATBA 1F5AA
chains in the Genus database with same CATH superfamily
5J2CA 3PX0A 2HMXA 4S3NA 4ECVA 4F4YA 1UETA 2JRZA 3ISBA 4KMUA 3LDAA 1SWVA 5AI6A 1ZQTA 4O3OA 4RQMA 5J2KA 8ICHA 4IQVA 5KFHA 1OU5A 5HP4A 4I2IA 2JXJA 2QB1A 2EDUA 5DQGA 3H39A 2LM4A 2JH7A 4Z6DA 4C8KA 2BDPA 4RNOA 9ICSA 5AKXA 4R8UB 2E1FA 2DVIA 2XGPA 2KHVA 4EBDA 1ZD4A 1ZD3A 3RR8A 3RF9A 2KE7A 8ICBA 3C2KA 4EEYA 4FHWA 2K60A 1UQVA 2DWQA 1KDHA 7ICPA 3C28A 1TK8A 2ZIUB 2RRDA 5J0QA 3T5KA 4HX0A 5KL1B 7ICJA 3LK9A 5F9NA 1U9LA 4I2GA 2LBOA 3QU4A 5HRIA 4KLGA 4J9OA 5AI9A 2A1JB 4DL7A 2G07A 1LKYB 2W55A 4F5PA 2JV3A 3KZXA 3SAFA 5ALEA 4WCWA 2EH9A 5DEDA 3A0BU 4BJQA 8ICLA 4I27A 5KAFU 2HBJA 4PHEA 3SI8A 1SKRA 2JH1A 3BZKA 4FZMA 5J2IA 4QNLA 4I28A 3V72A 3MGVA 3HKZF 2VIXA 1T94A 1WUDA 4CF3A 4CCHA 3ED5A 2KV2A 5CHGA 5JRTA 5CFSA 1ZQXA 5KG0A 5TISU 3BZCA 5J2JA 4ELUA 3MR2A 3KKAA 3OSPA 2KP7A 1ZQ1C 3GIJA 2YTUA 3SEIA 2BCSA 2ZUBA 2BCUA 5CR0A 4YQWA 1VLBA 5L1LA 1SZPA 1KEJA 2FE9A 1ZQMA 4DSJA 4QZDA 4DFPA 3HX0A 1R8CA 4AT7B 3UXPA 5AI0A 1WCLA 3EPGA 1SL1A 1BPDA 3AM9A 2NO4A 1Q3VA 5KT7A 4KB6A 5KFWA 3HW8A 5B3QA 4IQUA 2XI9A 2Q0ZX 1XSLA 2KN7A 5HMLA 1X9XA 2EAMA 2KZZA 2KZMA 5KFVA 1C20A 1SL2A 5AHXA 5HHHA 3DDHA 5J0PA 2XVTA 2ZTEA 1S76D 3CNHA 4DSFA 7ICOA 2YB1A 4EEKA 8ICQA 4YVZA 4DFMA 2WFAA 1ZQSA 1URJA 2QB0A 2IHNA 2CXYA 3TADA 2FMSA 3OGUA 1Q3UA 1BPXA 2R8HA 2HVHA 3F5AA 5EWGA 2P6RA 2VJ4A 2W9CA 3PW0A 2I5HA 4M9NA 2G5IB 2KNJA 2IA6A 4IRCA 1NO5A 1L7NA 3RJHA 4ECSA 2KVCA 4M9JA 3OWGA 4QZ9A 3M1YA 4KLDA 2ZH9A 4UAUA 4IC9A 5DB6A 3M8RA 3GIMA 1PZNA 1NI3A 1D9FA 5D49A 9ICPA 4NL9C 2MAXA 2YMPA 1QTMA 3EF2A 5DBAA 1RZTA 5AM4A 4ATBB 5IIMA 4C8MA 2E5SA 4GIBA 4EEDA 2K8CB 2K4EA 3UM9A 2Z7JA 5J0YA 1KLNA 2VKQA 1WWUA 2H3QA 3PY8A 4PJ0U 5AM5A 2WTFA 1UA0A 4KLOA 3AQMA 1QLNA 1N2XA 2NRKA 5ALKA 3KHLA 3V7JA 4BDPA 3TQ1A 5KT4A 4B9LA 4UB3A 1IIPA 4GC6A 1F44A 2F77X 2ZIXA 4DWIA 5KT6A 5EE0A 4LVSA 2KKPA 4DL2A 3SAGA 2QARA 2K8AA 1JALA 3WKBA 3AQFA 3GZFA 1L3SA 1L5UA 5KG2A 1HUOA 1JN3A 2IMWP 5HRDA 3GV7B 1B0XA 4Q45A 3BS5B 1ZD2P 4MEXA 5HR6A 4K4IA 2H3ZA 2PKEA 1Q8KA 2L5YA 3NYBA 4Y2YA 2OWOA 2NYVA 2BQUA 2J6TA 9ICMA 2ZIVA 1SL0A 5F3XB 4M5DA 4E8FA 1PK1B 5ALSA 4WC7A 4B9MA 4I29A 4X0AA 4F4KA 3V6JA 3H40A 4MF2A 5HHIA 8ICMA 1SB3C 2ZUCA 5DB8A 3GIKA 3C5FA 3M9MB 3FYHA 3IG5A 2R18A 4NLNA 5ALDA 1J97A 2ZXHA 5ALTA 1KQQA 4KM5A 3PR4A 3NUQA 3QU9A 3H4DA 3QE9Y 4ECXA 1ZQJA 4KLTA 4BXOA 3MGHA 2NRZA 1X9WA 1ZQZA 3UMCA 4F3OA 4XJEA 4IL6U 3PMLA 4BUGA 1UEVA 1Q46A 3G6YA 5AIBA 1UCVA 1UA1A 4PL1A 4KLEA 1K1QA 8ICRA 7ICRA 5DG7A 1HJPA 4LEZA 3TANA 1MA7A 1JIHA 2YB4A 5J0SA 5J29A 4RQ6A 3JZ0A 4IR9A 1QH9A 2C2RA 5EE3A 1K1SA 3HKZC 4R66A 5KFJA 2ZH5A 4FHXA 3OUYA 2G08A 4P4OA 3GQCA 1BNOA 3JPTA 3KBBA 2WB1C 5AIAA 5KT2A 1XNSA 1NK5A 2YMQA 5DLGA 5CA7A 5KFNA 4CNQA 5CB1A 4UB8U 4PGQA 2I9GA 2C22A 4G3IA 4LT6A 3CW2C 2K89A 5ALOA 4I2JA 1ZQGA 1UEUA 3ZDDA 3GU3A 3BQ2A 1JMSA 1U45A 2A3VA 3PV8A 4QZAA 4EELA 1Z3EB 3PSPA 2RP5A 5HR7A 5KFUA 1PVPA 2JEFA 4NXTA 3RJJA 5FP0A 4OAHA 4B9SA 4DLEA 3AEVA 1JROA 1SXDA 8ICJA 3NVOA 3ERCC 4OJPA 2IUBA 4EENA 4KLIA 2B4VA 1Z1VA 4WC4A 4KLQA 2QB0B 7ICNA 4ACOA 2P6UA 4KMOB 3G6XA 1N61A 3CRXA 3H37A 4RU9A 3PW5A 2DUYA 2KG5A 2GA9D 2WAQF 4M47A 1TAQA 4KLJA 2A1AA 2WHEA 2HW3A 7ICEA 1VDVA 4Q44A 5L1JA 4DL3A 2KEYA 1PVRA 3RTVA 9ICHA 3SQIA 8ICIA 4OAIZ 2DR5A 8ICWA 5AM1A 2HOQA 4C4SA 1DRGA 4C8OA 2G09A 1RYRA 4J9SA 2PFPA 1QQ7A 4UD5A 2KTQA 3IG8A 5JU5A 1QSSA 3F53A 4WC5A 4ED7A 3H0LB 4RT3A 5KFBA 2KICA 2LM1A 2KHQA 4JB3A 2OXOA 2D8CA 4XUSA 5EE1A 3MFHA 2JZBA 2M2VA 2EAPA 2M2TA 3ISCA 2HBLA 2ZIXB 3RJFA 1DOQA 4DFDA 4F92B 4DCCA 1CRXA 5HC9A 1RQLA 4K4GA 2AQ0A 1R89A 3KHRA 8ICTA 3AMZA 9ICXA 1ZQPA 2HHVA 4P2HA 4FBUA 3QU2A 4F72A 2BCRA 1A77A 1X9SA 4RT2A 1QQ6A 2HI0A 2AXTU 4K96A 4NWIA 4EX6A 4GXIA 2NO5A 4KLMA 2V4QA 3KOOA 2FJ6A 1NK0A 4Q8EA 5BPCA 2EWRA 4IR1A 1V97A 1XS9D 5KG7A 3AU2A 3IDWA 9ICRA 2JGAA 9ICUA 9ICBA 4BXOB 3M7DA 7ICIA 3QYPA 1PVQA 3NVZA 2ZH4A 4Y2XA 3EPIA 4Y2TA 4FO1A 5AKJA 3TAQA 3O0FA 7ICKA 1A6SA 1LB2B 3IP4B 2RDJA 4FS1A 2LMRA 3H4BA 4YFKA 4F5NA 5IIJA 2HHTA 1HIWA 3HP6A 1KL9A 3N7SC 5HRGA 2KSOB 2P66A 3TI0A 2HVIA 4UASA 3OUYB 4Q8FA 2JR5A 3KTQA 3H3AA 4FE3A 1ZQOA 2F2AB 3E0FA 4TQRA 2KIVA 1S0VA 2FLLA 1NK6A 4YR0A 4WC2A 5AKYA 5AKKA 4CF5A 3RAXA 2XO7A 5T14A 2ESEA 5D4BA 7ICQA 4MKPA 3HJ1A 2HN1A 3IRUA 1NKBA 4R65A 2BCQA 4QZCA 5DKWA 5J2GA 2DKZA 5DG9A 9ICCA 1D8YA 3OTQA 2NRXA 1CUKA 1D8LA 4BWJA 2Q4TA 3IV6A 4ICAA 5ALQA 3PNCA 2AGOA 3LVVA 1ZQVA 3D6JA 4EV6A 2LYHA 1VFGA 3C18A 3SMVA 2W7PA 5DECA 2JHDA 2B0CA 5KNIA 4X4OA 5C5JA 3V7LA 4UAWA 5DB7A 2RDIA 4E7XA 1SGGA 5EOZA 4FH5A 5KFSA 4LEWA 4R63A 1RYSA 2GLEA 4K97A 3H0MB 2E8PA 1XSNA 2BCVA 8ICEA 1ZQFA 2B21A 4B9NA 2FMQA 4FBTA 9ICJA 2IHOA 2HHQA 3B0XA 4FH3A 4PGYA 4YD2A 1D8BA 2ZH3A 5AM0A 2WAQC 2E1EA 3VC8A 5J2HA 1N48A 4RQ5A 3FDSA 3AL0B 3B0YA 2Y1JA 2PFNA 1TFRA 1NKCA 4JLZA 3IM1A 1L3TA 4NM1A 2KFZA 1KFDA 3RH5A 4F4WA 5DQIA 2VA3A 5HRFA 2WB1F 4GXKA 3CP8A 1ZQBA 4WC3A 4K4HA 4RWOA 8ICFA 2VANA 1QSYA 4DQQA 5KFYA 5JUMA 5B66U 3SAHA 2ASLA 1K5OA 2XY6A 4NXVA 4JMUA 3RRHA 2BQ3A 3VCBA 3JPPA 4AP9A 3WK7A 4K9BA 1ZQUA 4FFDA 5KT5A 1UHUA 3ETLA 3C2MA 2EZZA 3H8SA 1Q78A 4DSEA 3BS7A 3M9OB 2PFOA 3NVVA 2B51A 2OYYA 5HRBA 4AT9A 4GXJA 4ECYA 4KX5A 1HUZA 4XA5A 4ED3A 5KG4A 3NS1A 4NLGA 9ICQA 4K8VA 8ICZA 4FHPA 3JPNA 4ZOHC 2F1JA 1OW5A 3QU7A 3Q8RB 2C2DA 4ECRA 4ECTA 2LHTA 2AHOB 5DDYA 5D46A 3RAQA 5J0RA 3BQTA 2CRXA 1SXEA 2H5XA 2Y0SF 9ICKA 3QUTA 2W7OA 4J9LA 2ZXIA 1S10A 2HOIA 8ICUA 3HILA 4US9A 5J0TA 4UD4A 4C8NA 2JEIA 4RQ8A 4P0QA 2HHUA 5J8YC 4UB4A 1P7DA 2JEGA 4KLSA 3LQCB 3WFPA 2EAOA 1PUZA 3NWIA 4J03A 4M6WA 3MABA 5HRKA 3ONNA 3UQ0A 2WF8A 3ZDEA 5CP2A 4Z6CA 3MDCA 4DL5A 4FZLA 4DOCA 5DDMA 1TAUA 3ZDCA 4TURA 4YXMA 2AJQA 2KIWA 3SR6A 7ICVA 3ZD8A 2DPIA 2WF7A 1NJXA 3RB0A 2PFQA 2RQ5A 4OJ6A 3QNMA 3WK8A 1FIQA 1DK2A 2ZH1A 5EWEA 4O0IA 5TZVA 5CHEA 4R64A 1X42A 1UT8A 4TUPA 2PXIA 2W3SA 4O68A 4IG8A 3JCFA 1TFYA 3RH4A 5ALMA 4J9KA 2BPGA 3AN1A 1RG6A 1ZETA 3DEEA 4WOYA 3PVXA 3PX4A 4RQ7A 4WBYA 4F71A 7ICTA 2ZUDA 1DGSA 4A8EA 2MSNA 5KFQA 4CRXA 9ICIA 4C7YA 4DQPA 1T3NA 3PW7A 4Y2QA 8ICCA 4X4PA 4Y2JA 4YMMA 3SZ2A 1NK7A 1N63A 2Q66A 1L7MA 4USAA 1SIJA 4KX3A 1ECWA 4UW9A 4FO6A 2C28A 5AI5A 3GFKB 5F9LA 4BGDA 4MFCA 2HBMA 4AT8A 4NKTA 1T4GA 1TK5A 5D62A 2W54A 3MBYA 3PZPA 1WOTA 4WC6A 3C1YA 4C0ZA 2I1QA 1KFSA 3NTUA 3TACB 3BQ7A 1YT3A 3JYYA 3T5JA 2ODGA 1KW4A 2R8KA 2BGWA 1NK9A 9ICTA 2XCPA 3MR5A 1LV5A 1B43A 3K75D 2F1HA 4ED0A 1H38A 3JPSA 1L3UA 2BPCA 7ICLA 4WBZA 4ECWA 5BOLA 2FDRA 3SENA 2UVVA 2KJ9A 4UBCA 4EBCA 5KFDA 5DG8A 3OV7A 4RPYA 5KG1A 5JTIA 4FS2A 1J2NA 3PO5A 2PI4A 5AM2A 1NZPA 1UPHA 3D2QA 2ZJ5A 3ALRA 5ALGA 3BJYA 5J0OA 5HNKA 3WK5A 5ALPA 2ZH8A 1X9MA 1FFVA 2BBJA 3M9NB 2DF4B 1ZQCA 4YMOA 3OSNA 1NZBA 4QIWF 4J9PA 2KFNA 4UB5A 3Q8QB 4IQWA 3M6KA 3KZIU 1JRPA 3ICXA 3T5LA 5J2AA 2F8KA 4M9HA 2VJ5A 3I28A 3WKEA 3L4PA 7ICUA 4LZDA 4OD0A 2HHSA 3CK6A 2FPLA 4WC1A 3OVSA 3Q8KA 3I76A 2KZ3A 3QEAZ 1Q79A 4P4MA 7ICSA 3Q8MA 2G06A 4RPXA 2V9WA 3WK4A 2D6FC 4KITB 4X5VA 3Q8PB 1ZQQA 4X4UA 2H3FA 3AUOA 3PW2A 2JEJA 3HT3A 2CPRA 2E8MA 1F0MA 2R8JA 5CWRA 4B9UA 1TE2A 4Y2PA 4RQ1A 4ED1A 3EUB2 3NASA 4MFAA 4X4VA 3CYMA 1MQ3A 2CN1A 3RR7A 4NLKA 4M04A 8ICNA 1NK4A 4I2HA 4CGZA 2E8OA 2MU2A 1RDFA 3QX7A 1NJYA 4U6PA 2ZHAA 2OHFA 4ED6A 1ZQIA 5JTGA 4FZNA 2G5HB 2J6SA 9ICWA 2DRAA 1A76A 4I2FA 4P0QB 4RZRA 3QUCA 4M6WB 4DO9A 5DGBA 2O5AA 4QZEA 3NVWA 3UMBA 2W9CB 2IOFA 5DBCA 3H8WA 1N62A 3C1ZA 5ALIA 3Q8SB 2F44A 2RFFA 2YMLA 5KG6A 4YCXA 9ICAA 1JQRA 2Y0SC 2XCAA 5ALRA 5BOMA 4ED2A 1SV4A 1WYGA 5EWFA 1NJWA 4RPZA 2W9BA 3E58A 3UMGA 3UXNA 1N5XA 2GO7A 2ZIUA 1NJZA 4C4TA 4K9AA 2YMMA 1MIWA 4JWMA 3H38A 2YQEA 3T3FA 3GILA 2GOLA 9ICOA 2ZH2A 5CRXA 2G0AA 4P4PA 2UVWA 4QWAA 2ES6A 1IG6A 3TAPA 2AGQA 1T7PA 4DOAA 5AKEA 2OCEA 3UPSA 1LKYA 2W8LA 5KFZA 4PHAA 3KKAC 3PR5B 4KLUA 2N1RA 2Y9UA 1JUDA 4EBJA 5ALZA 3OVBA 4F4ZA 5E79U 5KFOA 4RWPA 5IIOA 2QARB 2ISOA 4YMNA 2FMPA 4NL9A 5GTHU 2PBEA 1TAMA 3MR3A 4DL6A 3T79A 4X4NA 2XY7A 2XC9A 5A0LA 2R8GA 4I2CA 3SD7A 2ID1A 2ZIVB 4O3MA 8ICAA 4AT8B 2KD1A 3I1YA 2ZTDA 4I2DA 2DBYA 5KG3A 1ZQAA 4QWDA 3KHHA 4RQ2A 4X0BA 3OHAA 2FPMA 1FEZA 2EZYA 5KFXA 3K1ZA 4OCZA 1L7PA 5AKZA 1L8OA 4AT7A 5CFTA 1XU4A 4JV0A 4NXWA 3N28A 2LKYA 3LYSA 2MRLA 4NLBA 2BHNA 1D9DA 3F2CA 4J9RA 4JV2A 1N5WA 2ZIWA 4Y2RA 1CEZA 4F5OA 1NNLA 4YR3A 2M2UA 1X2IA 4M0AA 4O5KA 5B5EU 3WKDA 4J9QA 3C66A 2VA2A 2IBKA 3RFAA 4RUCA 1V4AA 2M0NA 1F5SA 5J2BA 3QZ8A 2HHWA 4O3PA 5AKHA 5J2EA 2LYAA 2W04A 1LVHA 4RNMA 1KFTA 4GFJA 4NY8A 4DF8A 4XRHA 5J0WA 2J6UA 2W9AA 4MHVA 1JAJA 3RBEA 2HSZA 3C21A 4I2AA 2FLPA 3V6HA 2PI5A 1AROP 5AI4A 3TFRA 1COKA 1XO1A 4O9MA 3EW9A 3JPRA 1N56A 4Z6FA 4JLXA 3QEBZ 1PX5A 1ZRMA 1MQ2A 4F4XA 3D2NA 3RJKA 4UQGA 1DGJA 1R8AA 3F5EA 4MF8A 4QIWC 4NXUA 2EANA 3HWTA 3V7KA 1L8LA 4EYIB 2FPKA 4PZOA 4N7RA 7ICGA 4ECUA 2WF5A 3OVAA 2BZFA 5KL8B 1XO0A 3IN5A 2BE3A 3JPQA 3UPQA 2F3NA 5G5HA 4UBBA 4DFKA 1U48A 2DR8A 1Z19A 5AK4A 4NV0A 4UAYA 4QZBA 5L1KA 2D3DA 4YD1A 1T8EA 4GC7A 3N7RC 3QU5A 7ICMA 3TFSA 3PSTA 4KN7A 4PGXA 1ZQYA 3LWMA 4O3RA 1S0NA 4UARA 3NKUA 4NLZA 2W03A 2EZXA 4I2EA 4F93B 4O3QA 1BPBA 3OJUA 5DGAA 2FCLA 5IIKA 9ICFA 2WF9A 4GLXA 3FAHA 2MA1A 1M6YA 3BS5A 3FM9A 4YG2A 1MIVA 3PO4A 4LEYA 2O1PA 1BPEA 1GO3F 4PL2A 4PH5A 1BNPA 2W9BB 2W11A 4C4RA 5CJ7A 4Y2VA 4RQ0A 1PK1A 3PSIA 4YR2A 9ICEA 2ZHBA 4QZGA 4IRKA 5DB9A 4QZIA 4CF4A 2GWSA 5AKGA 1JXLA 3NGDA 1L7OA 4DQSA 3THVA 4MFFA 8ICOA 5J0UA 1ZQNA 3ISDA 1RXWA 3E2EA 3KD3A 4PZNA 2W3RA 2JZBB 1O03A 4QZHA 2ZJAA 4F2SA 1V9PA 4K99A 3GV5B 2ASDA 5KFRA 3N4MB 8ICGA 4CE6A 1TK0A 2HOFA 5ALJA 1ZQEA 4DSKA 1HEKA 3ETRA 1XSPA 5KT3A 2W43A 2BR0A 4NXZA 2O6KA 3UQ2A 4O3NA 2Y9TA 3KFUF 2LI6A 2DR9A 3F2DA 3ER9B 1QSLA 4RQ3A 1L6NA 4WQLA 3HRDD 4RWQA 5KFIA 4EBEA 2V4RA 2BQRA 9ICNA 3H8JA 2M9NA 4P0PA 1BPZA 4FHYA 2HCFA 4JWNA 4J9MA 2HBKA 4ELTA 3C29A 1GPJA 3QUBA 4BX9C 3QZ7A 2DKXA 3QXGA 4M2YA 3WK9A 4E80A 3L5KA 4MEYA 4Y2UA 4LEVA 3BDPA 2ZIWB 2DGZA 4KLHA 2R8IA 1MSWD 5HMMA 2AH5A 4JUZA 3C2LA 3AQNA 4AYBC 3WKAA 2NRWA 1SV0C 3SV4A 1T3QA 4QWCA 1PK3A 2I6XA 1ZD5A 1KN5A 5L9XA 3ER8C 2GH1A 4OJOA 5AK5A 5ALNA 8ICXA 1CI4A 1RPLA 2K4HA 4OAFA 1WG8A 3FC4A 5C0YA 2E3TA 4QWBA 4IRDA 3OJSA 1OUQA 4OJ5A 5ALXA 1S97A 2YN4A 2BDUA 4QZ8A 1Z1BA 1KSPA 2XICA 4C8LA 2XGQA 5ALYA 4F8RA 5ALFA 1FO4A 3RH6A 5J2DA 2GAFD 5KFCA 9ICGA 2NV3A 2YY6A 1L3VA 3V6KA 1XC9A 1ZQDA 1ZQLA 3AU6A 1KRPA 2JMGA 1KTQA 4O69A 2OM6A 5CEHA 1B4FA 3H7IA 5K4LA 4DSIA 2HHXA 3RJIA 1S0MA 1DK3A 1ED1A 2DL0A 2UVUA 1ZQHA 3DV9A 3PW4A 4XQ7A 1ZJNA 4X4SA 3WK6A 2F76X 1X40A 4US8A 3S6JA 3R9KA 1SKWA 1Z4OA 3NRWA 5HR9A 2W9MA 4IS7A 1NKEA 2BKEA 2ISPA 2HHPA 4DQIA 3N7PD 2FLNA 2MUTA 4QW8A 1Z00A 1X6IA 4RNNA 3HJEA 3RBDA 5B3PA 2AQ4A 1S77D 3WFRE 4O3SA 1ZQRA 1SWWA 5DQHA 2Y1IA 5AICA 3K4GA 4I0UA 4JK1A 5AK6A 5DBBA 5GTIU 3JPOA 3EWAA 4EZ6A 5HRLA 1IV8A 1QQ5A 1X66A 4UB6U 4O5CA 3MGIA 4O5EA 1J2MA 4DEZA 5AK3A 4UATA 2WF6A 3G6VA 2YX8A 3EZ5A 2F1IA 2K4IA 1Y88A 4F50A 2P35A 3QUQA 1U4BA 2KMDA 2NRTA 4LZGA 2UVRA 2RLTA 4LJXA 5G5GA 4FHVA 2HN2A 7ICHA 5AM3A 4EEBA 1IM4A 1EXNA 3OPXA 2B6GA 4NLCA 3PHZA 1JXEA 4M9LA 3ZD9A 5AKIA 4K98A 3D2SA 2ZJ8A 5EE9A 2XIDA 2DPJA 2RHFA 3L3FX 2QKQA 2PMZF 2C2EA 4X4TA 1U47A 1MIYA 5L1MA 4WC0A 1YZ6A 4DS5A 1ZQWA 4UB1A 4J9NA 9ICVA 4KLFA 4EBKA 3B9JA 3H8MA 1WWVA 4NXXA 1S0OA 3T5HA 4ECQA 1BVSA 3MDAA 4KTQA 3PX6A 3HJ4A 5KAIU 1QCKA 8ICVA 2M2WA 4I2BA 5HREA 2ZH7A 4YP3A 1XWLA 4AT9B 2KSOA 4B9VA 2KJ8A 4P0PB 1BPYA 3OHBA 3SV3A 4U7CA 4G9BA 7ICFA 1U49A 3C5GA 3WFSC 2KJ5A 1C7YA 2OH2A 1VJ7A 2QLTA 4DF4A 4WJ3B 3MR6A 3PSFA 2VA8A 5KFKA 1NK8A 1RM6C 5AKLA 4CDGA 3AQLA 4EP7A 1MC8A 4KLLA 4NKUA 3AQEA 5HRHA 5KFFA 4O6AA 4PPXA 4DFJA 3K7DA 2AGPA 8ICSA 4EGWA 2ZTCA 4YN4A 1RQNA 1OXJA 5J0XA 3RJGA 5KFLA 3U26A 1RXVA 4X4QA 1ZJMA 2KVSA 4Y2SA 5KFAA 5KTQA 3RB6A 2EQYA 4B6JA 2K4PA 2ATLA 4PHDA 2NRVA 3UXOA 2XY5A 3RB3A 1FFUA 3BQ1A 2F8LA 3RJEA 4PHPA 4O67A 4R8UA 2A19A 4TUSA 2DFLA 1ZQKA 1COOA 3M6ZA 3TKAA 1ZOLA 4QZFA 3C23A 5ALWA 5IIIA 4HYKA 1SKSA 4F2RA 3EYZA 5ALHA 3M8SA 4E0DA 4C80A 4EX7A 5J2FA 5F2VO 4NJ8A 3NRZA 3F2BA 1SV0A 5L1IA 1ZRNA 5AI8A 3Q8LA 5J8YA 2ASJA 2A1JA 1S5LU 4OJLA 2AU0A 1YLQA 4C7ZA 4UAZA 5IILA 1JI7A 8ICPA 2ALZA 4OO1J 1WCNA 5KFEA 4XQ8A 4DSLA 5D61A 1YZ7A 1Z4NA 1AQ6A 4DOBA 3HPOA 1MN8A 4QWEA 5KFPA 1N60A 5DLFA 4OAGA 2DR7A 1X6JA 3WU2U 4RQNA 3KHGA 1B22A 3J81j 1UT5A 1BGXT 3ZDAA 3WFOA 1KBUA 3LWLA 2MUTB 2B56A 2IOFK 1R8BA 4IQTA 1Z00B 2DQNB 3L9DA 4WH5A 2LYBA 4BWMA 1S9FA 1TV9A 2BBHA 4QJFB 5ALVA 5ALLA 4UAVA 2ZH6A 1TFWA 4QW9A 2W8KA 3PMNA 2ZG6A 4KN4A 2DRBA 4YXJA 4HAIA 5KG5A 9ICLA 5H2FU 4M9GA 4RQ4A 8ICYA 4NM2A 3H0RB 4AYBF 4TUQA 3GIIA 1FA0A 5D63A 2OEHA 4ZH4A 1TKDA 3ORYA 4F5QA 3HIYA 1SZHA 2IOHA 3TADC 5KFGA 1KNYA 4DS4A 1V85A 3K1RB 3GV8B 3MC1A 4EZ9A 4DLGA 8ICKA 1IXRA 4ECZA 2LPEA 2IHMA 1JX4A 4TQSA 5CFUA 1V38A 3IHQB 3LVWA 3ZI4A 1ZYQA 3BQ0A 3A0HU 2E8NA 4B9TA 4DQRA 3TARA 4Q43A 2KK0A 3RRGA 4DL4A 3SYZA 3WFQE 4UB2A 2H3IA 4EYHB 3N97B 3RB4A 1DXSA 5IINA 3ZDBA 3MCRA 2K8BB 4JV1A 1VJ5A 3MFIA 4ED8A 4WQKA 3WKCA 1TVAA 1ZXIA 2BPFA 1NOMA 2PMZC 4F91B 1S8OA 2H3VA 2HDOA 3GDXA 4RWNA 4RUAA 2KOBA 5KFMA 1KKXA 1RYUA 4X4RA 2KKVA 1A0PA 1O08A 4Z6EA 2FI1A 4F5RA 5ALUA 5KFTA 3NVYA 3AQKA 4ELVA 4ATBA 1F5AA
chains in the Genus database with same CATH topology
9ICTA 2XCPA 5J2CA 3MR5A 4MEYA 4J9SA 3PX0A 1RYRA 1LV5A 1B43A 3K75D 2F1HA 4ED0A 1H38A 2PFPA 4S3NA 4UD5A 3JPSA 1L3UA 2KTQA 4ECVA 2BPCA 1QSSA 4F4YA 7ICLA 4WBZA 4ECWA 1UETA 4WC5A 5BOLA 4ED7A 3ISBA 4RT3A 4KMUA 3BDPA 5KFBA 4KLHA 2UVVA 3LDAA 4UBCA 2R8IA 4EBCA 5KFDA 5DG8A 3OV7A 4RPYA 5KG1A 5HMMA 1MSWD 4JUZA 3C2LA 1ZQTA 4O3OA 3AQNA 3MFHA 4XUSA 5J2KA 8ICHA 2JZBA 2NRWA 4IQVA 4FS2A 3PO5A 5KFHA 3SV4A 1NK9A 2PI4A 2M2VA 1OU5A 5HP4A 1NZPA 2ZJ5A 4I2IA 2M2TA 3ISCA 4QWCA 3BJYA 5J0OA 5HNKA 3RJFA 1DOQA 5DQGA 3H39A 5L9XA 4F92B 1X9MA 2ZH8A 4Z6DA 3M9NB 4C8KA 5HC9A 2BDPA 1ZQCA 4RNOA 8ICXA 4YMOA 1RPLA 3OSNA 9ICSA 4J9PA 4K4GA 2AQ0A 4R8UB 2KFNA 1R89A 3KHRA 2XGPA 4UB5A 8ICTA 2DVIA 3Q8QB 4IQWA 4EBDA 9ICXA 1ZQPA 2HHVA 3T5LA 3RR8A 4QWBA 4P2HA 5J2AA 4IRDA 3OJSA 8ICBA 4FBUA 3C2KA 4EEYA 4M9HA 4FHWA 1S97A 2BCRA 1A77A 1X9SA 1KDHA 7ICUA 4LZDA 4QZ8A 7ICPA 1KSPA 4RT2A 4C8LA 1TK8A 2HHSA 2FPLA 2XGQA 4WC1A 5J0QA 3Q8KA 3OVSA 3T5KA 2KZ3A 3QEAZ 4F8RA 1Q79A 4GXIA 4P4MA 3RH6A 5J2DA 7ICJA 7ICSA 3Q8MA 4KLMA 3LK9A 2V4QA 4RPXA 5F9NA 2V9WA 5KFCA 9ICGA 1U9LA 4I2GA 4KITB 4X5VA 4KLGA 5HRIA 3Q8PB 4J9OA 2A1JB 1NK0A 1L3VA 3V6KA 1XC9A 1ZQQA 4X4UA 1ZQDA 5BPCA 4Q8EA 1ZQLA 4DL7A 3AU6A 4IR1A 1KRPA 3AUOA 1XS9D 3PW2A 2JEJA 1KTQA 3HT3A 4F5PA 2R8JA 4C8OA 4WCWA 5CWRA 5DEDA 4B9UA 3H7IA 3AU2A 5KG7A 4RQ1A 4DSIA 4ED1A 2HHXA 8ICLA 4I27A 3RJIA 4PHEA 1S0MA 3SI8A 1SKRA 4MFAA 9ICRA 1DK3A 9ICUA 2UVUA 4X4VA 1ZQHA 3PW4A 4XQ7A 1ZJNA 9ICBA 1MQ3A 4X4SA 5J2IA 3RR7A 4I28A 4NLKA 4M04A 8ICNA 1NK4A 4BXOB 3V72A 4I2HA 7ICIA 1SKWA 5HR9A 2W9MA 1NJYA 1NKEA 2BKEA 2ISPA 2HHPA 2ZHAA 4CCHA 2ZH4A 4ED6A 4DQIA 1ZQIA 2FLNA 2MUTA 2J6SA 4QW8A 9ICWA 2DRAA 1A76A 1Z00A 5CHGA 3EPIA 4I2FA 4RNNA 3RBDA 4RZRA 1ZQXA 5KG0A 2AQ4A 1S77D 3WFRE 3TAQA 4O3SA 7ICKA 1ZQRA 5J2JA 4ELUA 4M6WB 5DQHA 3MR2A 4DO9A 5DGBA 2Y1IA 3OSPA 3K4GA 2RDJA 4FS1A 1LB2B 4QZEA 2KP7A 2O5AA 4JK1A 2W9CB 5DBCA 3GIJA 3H8WA 3C1ZA 3H4BA 3Q8SB 4YFKA 4F5NA 2BCSA 5IIJA 2HHTA 5DBBA 2ZUBA 3HP6A 5CR0A 2BCUA 2RFFA 5KG6A 4YCXA 4YQWA 9ICAA 5HRGA 1JQRA 2XCAA 2P66A 3TI0A 2HVIA 5BOMA 3JPOA 3EWAA 5EWFA 4ED2A 1NJWA 4EZ6A 4Q8FA 5HRLA 3OUYB 5L1LA 3KTQA 1SZPA 3H3AA 1ZQOA 1KEJA 1ZQMA 4RPZA 2W9BA 4DSJA 4QZDA 3UXNA 4O5CA 4TQRA 1NJZA 4DFPA 1S0VA 2FLLA 1MIWA 3MGIA 3HX0A 1NK6A 1R8CA 3UXPA 4YR0A 4JWMA 4O5EA 4AT7B 1WCLA 3H38A 3EPGA 1SL1A 4WC2A 4DEZA 1BPDA 3T3FA 3GILA 9ICOA 1NO5A 5KT7A 3G6VA 3RAXA 2XO7A 2ZH2A 3EZ5A 2F1IA 4P4PA 1Y88A 5D4BA 4F50A 2UVWA 7ICQA 3HJ1A 4QWAA 1U4BA 5KFWA 3TAPA 3HW8A 2AGQA 1T7PA 2NRTA 4DOAA 1NKBA 4IQUA 4R65A 4LZGA 2BCQA 4QZCA 5DKWA 2UVRA 3UPSA 2W8LA 5J2GA 5KFZA 2Q0ZX 4PHAA 5DG9A 1XSLA 4FHVA 3PR5B 7ICHA 2KN7A 4KLUA 9ICCA 1EXNA 1IM4A 1D8YA 2NRXA 1CUKA 1D8LA 5HMLA 4BWJA 2KZZA 2KZMA 4EBJA 5KFVA 1JXEA 4M9LA 3OVBA 3ZD9A 3PNCA 2AGOA 4F4ZA 1SL2A 5KFOA 2ZJ8A 4RWPA 5IIOA 1ZQVA 5HHHA 5J0PA 2LYHA 2ZTEA 2DPJA 1VFGA 2C2EA 2ISOA 4YMNA 3C18A 1S76D 2FMPA 4X4TA 4DSFA 7ICOA 1U47A 2PBEA 3MR3A 1MIYA 4DL6A 8ICQA 4WC0A 4DS5A 1ZQWA 4YVZA 4UB1A 5DECA 4X4NA 4X4OA 4DFMA 4J9NA 9ICVA 1ZQSA 4KLFA 2XY7A 2XC9A 2IHNA 4EBKA 5C5JA 3V7LA 4UAWA 5DB7A 1S0OA 3OGUA 2RDIA 4ECQA 1BVSA 3MDAA 3T5HA 1BPXA 2R8HA 4KTQA 4E7XA 3PX6A 2R8GA 4I2CA 3HJ4A 5EOZA 4FH5A 5KFSA 2HVHA 5EWGA 2P6RA 2ID1A 2W9CA 8ICVA 3PW0A 4R63A 3L9DA 1RYSA 2M2WA 8ICAA 4I2BA 1XSNA 2BCVA 5HREA 4AT8B 4M9NA 8ICEA 2ZTDA 4I2DA 2ZH7A 4YP3A 5KG3A 1XWLA 1ZQAA 1ZQFA 2B21A 4B9NA 4B9VA 4AT9B 2FMQA 2IA6A 1BPYA 4IRCA 4QWDA 3RJHA 4FBTA 9ICJA 3KHHA 4ECSA 4M9JA 4RQ2A 3OHBA 3SV3A 2HHQA 4X0BA 7ICFA 1U49A 4QZ9A 3C5GA 4KLDA 3B0XA 3OHAA 2ZH9A 2FPMA 5DB6A 3M8RA 3GIMA 1C7YA 5KFXA 1VJ7A 4FH3A 1PZNA 4DF4A 4PGYA 4YD2A 3MR6A 1D9FA 5D49A 2VA8A 5KFKA 4AT7A 9ICPA 1XU4A 4JV0A 2ZH3A 2MAXA 1QTMA 1NK8A 5DBAA 3AQLA 1RZTA 4EP7A 4ATBB 1MC8A 4KLLA 5J2HA 4NKUA 5HRHA 2BHNA 4C8MA 5IIMA 5KFFA 4RQ5A 1N48A 3FDSA 1D9DA 3B0YA 4DFJA 4PPXA 2AGPA 2Y1JA 4J9RA 8ICSA 2ZTCA 4YN4A 2PFNA 1TFRA 1NKCA 4JV2A 3IM1A 1L3TA 1KLNA 5J0YA 4NM1A 1CEZA 5J0XA 4F5OA 3RJGA 4YR3A 5KFLA 3PY8A 2KFZA 1KFDA 3RH5A 1RXVA 4X4QA 2M2UA 2WTFA 1UA0A 4KLOA 1ZJMA 3AQMA 1QLNA 1X2IA 4M0AA 4O5KA 4F4WA 2NRKA 3V7JA 3KHLA 5DQIA 2VA3A 4BDPA 5KFAA 5KTQA 4J9QA 3RB6A 5HRFA 3TQ1A 3C66A 2ATLA 5KT4A 2VA2A 4GXKA 4RUCA 2IBKA 1V4AA 4PHDA 4B9LA 2NRVA 4UB3A 1ZQBA 3UXOA 4GC6A 2XY5A 4WC3A 4DWIA 5KT6A 4LVSA 3RB3A 5J2BA 3QZ8A 3BQ1A 4K4HA 4O3PA 3RJEA 2HHWA 8ICFA 4RWOA 5J2EA 2VANA 4DL2A 4DQQA 1QSYA 4PHPA 1KFTA 4RNMA 5KFYA 5JUMA 4NY8A 4R8UA 4DF8A 2ASLA 4XRHA 2XY6A 1L3SA 4TUSA 1L5UA 5KG2A 2DFLA 1ZQKA 1HUOA 3RRHA 2BQ3A 1JN3A 5J0WA 1COOA 2IMWP 2J6UA 2W9AA 5HRDA 3GV7B 4Q45A 1JAJA 3RBEA 4QZFA 3JPPA 3C21A 3C23A 5IIIA 4MEXA 4K4IA 4I2AA 1ZQUA 5KT5A 3V6HA 2FLPA 2PI5A 4HYKA 3NYBA 1SKSA 3ETLA 1AROP 4F2RA 3EYZA 2OWOA 3TFRA 3M8SA 4E0DA 3C2MA 1XO1A 3H8SA 4O9MA 5J2FA 3EW9A 3JPRA 2BQUA 4Z6FA 1N56A 2J6TA 1SL0A 3QEBZ 9ICMA 4DSEA 1PX5A 1MQ2A 4F4XA 4M5DA 4E8FA 3M9OB 2PFOA 3RJKA 5L1IA 4UQGA 1R8AA 5HRBA 3Q8LA 4AT9A 4MF8A 4WC7A 4B9MA 4I29A 2ASJA 4X0AA 2A1JA 4GXJA 3HWTA 3V7KA 4ECYA 4F4KA 3V6JA 3H40A 4MF2A 5HHIA 4XA5A 4ED3A 2AU0A 1HUZA 5KG4A 4EYIB 8ICMA 4NLGA 2FPKA 9ICQA 2ZUCA 1YLQA 5DB8A 4UAZA 3GIKA 3C5FA 5IILA 8ICZA 7ICGA 4ECUA 8ICPA 4FHPA 3OVAA 3JPNA 2F1JA 2ALZA 3M9MB 1WCNA 5KFEA 3FYHA 3Q8RB 2C2DA 4XQ8A 4DSLA 4ECRA 4NLNA 2BE3A 3JPQA 3UPQA 4ECTA 4UBBA 4DOBA 5DDYA 3HPOA 5D46A 4DFKA 1U48A 2DR8A 3PR4A 3QE9Y 4QWEA 3H4DA 4ECXA 5KFPA 3RAQA 1ZQJA 4KLTA 5DLFA 4BXOA 5J0RA 3MGHA 3BQTA 2NRZA 4UAYA 4QZBA 5L1KA 2DR7A 2H5XA 9ICKA 4YD1A 1X9WA 1T8EA 3WFSC 4J9LA 1ZQZA 4GC7A 1S10A 4F3OA 7ICMA 3PMLA 8ICUA 5J0TA 3KHGA 1B22A 1UEVA 3TFSA 1UT5A 1BGXT 3ZDAA 4KN7A 4UD4A 3WFOA 4C8NA 4PGXA 4RQ8A 3G6YA 3LWLA 2MUTB 2JEIA 1R8BA 4IQTA 1Z00B 2HHUA 1ZQYA 4UB4A 3LWMA 1UA1A 2JEGA 4BWMA 1S0NA 4O3RA 4KLSA 3LQCB 3WFPA 1S9FA 1K1QA 1TV9A 4NLZA 4KLEA 8ICRA 4M6WA 3MABA 7ICRA 5DG7A 1HJPA 2ZH6A 1TFWA 4I2EA 4F93B 5HRKA 4QW9A 3TANA 2W8KA 3UQ0A 4O3QA 1JIHA 5J29A 1BPBA 5J0SA 4RQ6A 3ZDEA 3PMNA 3JZ0A 3OJUA 5CP2A 5DGAA 5IIKA 4Z6CA 4IR9A 9ICFA 4GLXA 2C2RA 4KN4A 3MDCA 4DL5A 2DRBA 1K1SA 4R66A 4DOCA 5KFJA 4YXJA 5DDMA 4FHXA 4YG2A 1MIVA 5KG5A 3PO4A 1TAUA 9ICLA 1Q78A 3OUYA 4M9GA 4RQ4A 8ICYA 3ZDCA 4NM2A 2O1PA 4P4OA 3GQCA 1BPEA 4TURA 4PH5A 1BNOA 3JPTA 2ZH5A 4YXMA 4TUQA 2W9BB 2AJQA 1BNPA 5KT2A 7ICVA 3ZD8A 3GIIA 5CJ7A 2DPIA 1NK5A 1FA0A 5CA7A 5DLGA 4RQ0A 1NJXA 4YR2A 3RB0A 2PFQA 9ICEA 2ZHBA 4QZGA 4IRKA 5KFNA 4ZH4A 5DB9A 4QZIA 1TKDA 3ORYA 4F5QA 2GWSA 3HIYA 5CB1A 1JXLA 1DK2A 4PGQA 2I9GA 3NGDA 2C22A 5EWEA 4O0IA 5KFGA 5TZVA 4DQSA 4R64A 4G3IA 3THVA 1UT8A 4TUPA 2PXIA 4MFFA 1KNYA 4LT6A 4DS4A 3GV8B 4IG8A 1TFYA 3RH4A 5F2VO 8ICOA 4I2JA 5J0UA 4EZ9A 1ZQNA 3ISDA 1ZQGA 1UEUA 1RXWA 4DLGA 3ZDDA 3E2EA 4J9KA 2BPGA 3BQ2A 8ICKA 1JMSA 1ZETA 1IXRA 2JZBB 3PVXA 1U45A 4ECZA 4QZAA 3PX4A 3PV8A 4RQ7A 1Z3EB 4QZHA 1JX4A 2ZJAA 4TQSA 2IHMA 4F2SA 1V9PA 4WBYA 3IHQB 5KFUA 1ZYQA 7ICTA 2JEFA 2ZUDA 1DGSA 3BQ0A 3GV5B 2ASDA 2FMSA 5KFRA 3N4MB 8ICGA 5KFQA 3RJJA 4B9TA 1TK0A 4DLEA 4B9SA 9ICIA 4DQRA 3TARA 4DQPA 4Q43A 1T3NA 3RRGA 3PW7A 4DL4A 8ICJA 1ZQEA 8ICCA 4X4PA 4YMMA 3SYZA 4UB2A 4DSKA 3WFQE 3SZ2A 1XSPA 1NK7A 5KT3A 4KLIA 2Q66A 2BR0A 4NXZA 4KLQA 4WC4A 3UQ2A 4O3NA 7ICNA 4EYHB 2P6UA 3G6XA 3N97B 3RB4A 3H37A 4RU9A 5IINA 4FO6A 3PW5A 2DR9A 2C28A 3GFKB 3ZDBA 5F9LA 1QSLA 4M47A 1TAQA 4JV1A 4BGDA 4RQ3A 3MFIA 4MFCA 4ED8A 4KLJA 1TVAA 4AT8A 4NKTA 2HW3A 4RWQA 5KFIA 4EBEA 1T4GA 2V4RA 1TK5A 2BQRA 7ICEA 2BPFA 9ICNA 1NOMA 3H8JA 2M9NA 4F91B 4Q44A 3MBYA 5L1JA 1BPZA 4JWNA 4FHYA 4DL3A 3GDXA 1WOTA 4J9MA 4WC6A 4RWNA 3C1YA 4ELTA 2ZH1A 2I1QA 1KFSA 4RUAA 3RTVA 3NTUA 5KFMA 3QZ7A 9ICHA 8ICIA 4X4RA 3JYYA 3T5JA 4Z6EA 4M2YA 2DR5A 4F5RA 5KFTA 4E80A 8ICWA 3AQKA 4ELVA 2R8KA 2BGWA 4ATBA 1F5AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICT A;  2XCP A;  5J2C A;  3MR5 A;  4MEY A;  4J9S A;  3PX0 A;  1RYR A;  1LV5 A;  1B43 A;  3K75 D;  2F1H A;  4ED0 A;  1H38 A;  2PFP A;  4S3N A;  4UD5 A;  3JPS A;  1L3U A;  2KTQ A;  4ECV A;  2BPC A;  1QSS A;  4F4Y A;  7ICL A;  4WBZ A;  4ECW A;  1UET A;  4WC5 A;  5BOL A;  4ED7 A;  3ISB A;  4RT3 A;  4KMU A;  3BDP A;  5KFB A;  4KLH A;  2UVV A;  3LDA A;  4UBC A;  2R8I A;  4EBC A;  5KFD A;  5DG8 A;  3OV7 A;  4RPY A;  5KG1 A;  5HMM A;  1MSW D;  4JUZ A;  3C2L A;  1ZQT A;  4O3O A;  3AQN A;  3MFH A;  4XUS A;  5J2K A;  8ICH A;  2JZB A;  2NRW A;  4IQV A;  4FS2 A;  3PO5 A;  5KFH A;  3SV4 A;  1NK9 A;  2PI4 A;  2M2V A;  1OU5 A;  5HP4 A;  1NZP A;  2ZJ5 A;  4I2I A;  2M2T A;  3ISC A;  4QWC A;  3BJY A;  5J0O A;  5HNK A;  3RJF A;  1DOQ A;  5DQG A;  3H39 A;  5L9X A;  4F92 B;  1X9M A;  2ZH8 A;  4Z6D A;  3M9N B;  4C8K A;  5HC9 A;  2BDP A;  1ZQC A;  4RNO A;  8ICX A;  4YMO A;  1RPL A;  3OSN A;  9ICS A;  4J9P A;  4K4G A;  2AQ0 A;  4R8U B;  2KFN A;  1R89 A;  3KHR A;  2XGP A;  4UB5 A;  8ICT A;  2DVI A;  3Q8Q B;  4IQW A;  4EBD A;  9ICX A;  1ZQP A;  2HHV A;  3T5L A;  3RR8 A;  4QWB A;  4P2H A;  5J2A A;  4IRD A;  3OJS A;  8ICB A;  4FBU A;  3C2K A;  4EEY A;  4M9H A;  4FHW A;  1S97 A;  2BCR A;  1A77 A;  1X9S A;  1KDH A;  7ICU A;  4LZD A;  4QZ8 A;  7ICP A;  1KSP A;  4RT2 A;  4C8L A;  1TK8 A;  2HHS A;  2FPL A;  2XGQ A;  4WC1 A;  5J0Q A;  3Q8K A;  3OVS A;  3T5K A;  2KZ3 A;  3QEA Z;  4F8R A;  1Q79 A;  4GXI A;  4P4M A;  3RH6 A;  5J2D A;  7ICJ A;  7ICS A;  3Q8M A;  4KLM A;  3LK9 A;  2V4Q A;  4RPX A;  5F9N A;  2V9W A;  5KFC A;  9ICG A;  1U9L A;  4I2G A;  4KIT B;  4X5V A;  4KLG A;  5HRI A;  3Q8P B;  4J9O A;  2A1J B;  1NK0 A;  1L3V A;  3V6K A;  1XC9 A;  1ZQQ A;  4X4U A;  1ZQD A;  5BPC A;  4Q8E A;  1ZQL A;  4DL7 A;  3AU6 A;  4IR1 A;  1KRP A;  3AUO A;  1XS9 D;  3PW2 A;  2JEJ A;  1KTQ A;  3HT3 A;  4F5P A;  2R8J A;  4C8O A;  4WCW A;  5CWR A;  5DED A;  4B9U A;  3H7I A;  3AU2 A;  5KG7 A;  4RQ1 A;  4DSI A;  4ED1 A;  2HHX A;  8ICL A;  4I27 A;  3RJI A;  4PHE A;  1S0M A;  3SI8 A;  1SKR A;  4MFA A;  9ICR A;  1DK3 A;  9ICU A;  2UVU A;  4X4V A;  1ZQH A;  3PW4 A;  4XQ7 A;  1ZJN A;  9ICB A;  1MQ3 A;  4X4S A;  5J2I A;  3RR7 A;  4I28 A;  4NLK A;  4M04 A;  8ICN A;  1NK4 A;  4BXO B;  3V72 A;  4I2H A;  7ICI A;  1SKW A;  5HR9 A;  2W9M A;  1NJY A;  1NKE A;  2BKE A;  2ISP A;  2HHP A;  2ZHA A;  4CCH A;  2ZH4 A;  4ED6 A;  4DQI A;  1ZQI A;  2FLN A;  2MUT A;  2J6S A;  4QW8 A;  9ICW A;  2DRA A;  1A76 A;  1Z00 A;  5CHG A;  3EPI A;  4I2F A;  4RNN A;  3RBD A;  4RZR A;  1ZQX A;  5KG0 A;  2AQ4 A;  1S77 D;  3WFR E;  3TAQ A;  4O3S A;  7ICK A;  1ZQR A;  5J2J A;  4ELU A;  4M6W B;  5DQH A;  3MR2 A;  4DO9 A;  5DGB A;  2Y1I A;  3OSP A;  3K4G A;  2RDJ A;  4FS1 A;  1LB2 B;  4QZE A;  2KP7 A;  2O5A A;  4JK1 A;  2W9C B;  5DBC A;  3GIJ A;  3H8W A;  3C1Z A;  3H4B A;  3Q8S B;  4YFK A;  4F5N A;  2BCS A;  5IIJ A;  2HHT A;  5DBB A;  2ZUB A;  3HP6 A;  5CR0 A;  2BCU A;  2RFF A;  5KG6 A;  4YCX A;  4YQW A;  9ICA A;  5HRG A;  1JQR A;  2XCA A;  2P66 A;  3TI0 A;  2HVI A;  5BOM A;  3JPO A;  3EWA A;  5EWF A;  4ED2 A;  1NJW A;  4EZ6 A;  4Q8F A;  5HRL A;  3OUY B;  5L1L A;  3KTQ A;  1SZP A;  3H3A A;  1ZQO A;  1KEJ A;  1ZQM A;  4RPZ A;  2W9B A;  4DSJ A;  4QZD A;  3UXN A;  4O5C A;  4TQR A;  1NJZ A;  4DFP A;  1S0V A;  2FLL A;  1MIW A;  3MGI A;  3HX0 A;  1NK6 A;  1R8C A;  3UXP A;  4YR0 A;  4JWM A;  4O5E A;  4AT7 B;  1WCL A;  3H38 A;  3EPG A;  1SL1 A;  4WC2 A;  4DEZ A;  1BPD A;  3T3F A;  3GIL A;  9ICO A;  1NO5 A;  5KT7 A;  3G6V A;  3RAX A;  2XO7 A;  2ZH2 A;  3EZ5 A;  2F1I A;  4P4P A;  1Y88 A;  5D4B A;  4F50 A;  2UVW A;  7ICQ A;  3HJ1 A;  4QWA A;  1U4B A;  5KFW A;  3TAP A;  3HW8 A;  2AGQ A;  1T7P A;  2NRT A;  4DOA A;  1NKB A;  4IQU A;  4R65 A;  4LZG A;  2BCQ A;  4QZC A;  5DKW A;  2UVR A;  3UPS A;  2W8L A;  5J2G A;  5KFZ A;  2Q0Z X;  4PHA A;  5DG9 A;  1XSL A;  4FHV A;  3PR5 B;  7ICH A;  2KN7 A;  4KLU A;  9ICC A;  1EXN A;  1IM4 A;  1D8Y A;  2NRX A;  1CUK A;  1D8L A;  5HML A;  4BWJ A;  2KZZ A;  2KZM A;  4EBJ A;  5KFV A;  1JXE A;  4M9L A;  3OVB A;  3ZD9 A;  3PNC A;  2AGO A;  4F4Z A;  1SL2 A;  5KFO A;  2ZJ8 A;  4RWP A;  5IIO A;  1ZQV A;  5HHH A;  5J0P A;  2LYH A;  2ZTE A;  2DPJ A;  1VFG A;  2C2E A;  2ISO A;  4YMN A;  3C18 A;  1S76 D;  2FMP A;  4X4T A;  4DSF A;  7ICO A;  1U47 A;  2PBE A;  3MR3 A;  1MIY A;  4DL6 A;  8ICQ A;  4WC0 A;  4DS5 A;  1ZQW A;  4YVZ A;  4UB1 A;  5DEC A;  4X4N A;  4X4O A;  4DFM A;  4J9N A;  9ICV A;  1ZQS A;  4KLF A;  2XY7 A;  2XC9 A;  2IHN A;  4EBK A;  5C5J A;  3V7L A;  4UAW A;  5DB7 A;  1S0O A;  3OGU A;  2RDI A;  4ECQ A;  1BVS A;  3MDA A;  3T5H A;  1BPX A;  2R8H A;  4KTQ A;  4E7X A;  3PX6 A;  2R8G A;  4I2C A;  3HJ4 A;  5EOZ A;  4FH5 A;  5KFS A;  2HVH A;  5EWG A;  2P6R A;  2ID1 A;  2W9C A;  8ICV A;  3PW0 A;  4R63 A;  3L9D A;  1RYS A;  2M2W A;  8ICA A;  4I2B A;  1XSN A;  2BCV A;  5HRE A;  4AT8 B;  4M9N A;  8ICE A;  2ZTD A;  4I2D A;  2ZH7 A;  4YP3 A;  5KG3 A;  1XWL A;  1ZQA A;  1ZQF A;  2B21 A;  4B9N A;  4B9V A;  4AT9 B;  2FMQ A;  2IA6 A;  1BPY A;  4IRC A;  4QWD A;  3RJH A;  4FBT A;  9ICJ A;  3KHH A;  4ECS A;  4M9J A;  4RQ2 A;  3OHB A;  3SV3 A;  2HHQ A;  4X0B A;  7ICF A;  1U49 A;  4QZ9 A;  3C5G A;  4KLD A;  3B0X A;  3OHA A;  2ZH9 A;  2FPM A;  5DB6 A;  3M8R A;  3GIM A;  1C7Y A;  5KFX A;  1VJ7 A;  4FH3 A;  1PZN A;  4DF4 A;  4PGY A;  4YD2 A;  3MR6 A;  1D9F A;  5D49 A;  2VA8 A;  5KFK A;  4AT7 A;  9ICP A;  1XU4 A;  4JV0 A;  2ZH3 A;  2MAX A;  1QTM A;  1NK8 A;  5DBA A;  3AQL A;  1RZT A;  4EP7 A;  4ATB B;  1MC8 A;  4KLL A;  5J2H A;  4NKU A;  5HRH A;  2BHN A;  4C8M A;  5IIM A;  5KFF A;  4RQ5 A;  1N48 A;  3FDS A;  1D9D A;  3B0Y A;  4DFJ A;  4PPX A;  2AGP A;  2Y1J A;  4J9R A;  8ICS A;  2ZTC A;  4YN4 A;  2PFN A;  1TFR A;  1NKC A;  4JV2 A;  3IM1 A;  1L3T A;  1KLN A;  5J0Y A;  4NM1 A;  1CEZ A;  5J0X A;  4F5O A;  3RJG A;  4YR3 A;  5KFL A;  3PY8 A;  2KFZ A;  1KFD A;  3RH5 A;  1RXV A;  4X4Q A;  2M2U A;  2WTF A;  1UA0 A;  4KLO A;  1ZJM A;  3AQM A;  1QLN A;  1X2I A;  4M0A A;  4O5K A;  4F4W A;  2NRK A;  3V7J A;  3KHL A;  5DQI A;  2VA3 A;  4BDP A;  5KFA A;  5KTQ A;  4J9Q A;  3RB6 A;  5HRF A;  3TQ1 A;  3C66 A;  2ATL A;  5KT4 A;  2VA2 A;  4GXK A;  4RUC A;  2IBK A;  1V4A A;  4PHD A;  4B9L A;  2NRV A;  4UB3 A;  1ZQB A;  3UXO A;  4GC6 A;  2XY5 A;  4WC3 A;  4DWI A;  5KT6 A;  4LVS A;  3RB3 A;  5J2B A;  3QZ8 A;  3BQ1 A;  4K4H A;  4O3P A;  3RJE A;  2HHW A;  8ICF A;  4RWO A;  5J2E A;  2VAN A;  4DL2 A;  4DQQ A;  1QSY A;  4PHP A;  1KFT A;  4RNM A;  5KFY A;  5JUM A;  4NY8 A;  4R8U A;  4DF8 A;  2ASL A;  4XRH A;  2XY6 A;  1L3S A;  4TUS A;  1L5U A;  5KG2 A;  2DFL A;  1ZQK A;  1HUO A;  3RRH A;  2BQ3 A;  1JN3 A;  5J0W A;  1COO A;  2IMW P;  2J6U A;  2W9A A;  5HRD A;  3GV7 B;  4Q45 A;  1JAJ A;  3RBE A;  4QZF A;  3JPP A;  3C21 A;  3C23 A;  5III A;  4MEX A;  4K4I A;  4I2A A;  1ZQU A;  5KT5 A;  3V6H A;  2FLP A;  2PI5 A;  4HYK A;  3NYB A;  1SKS A;  3ETL A;  1ARO P;  4F2R A;  3EYZ A;  2OWO A;  3TFR A;  3M8S A;  4E0D A;  3C2M A;  1XO1 A;  3H8S A;  4O9M A;  5J2F A;  3EW9 A;  3JPR A;  2BQU A;  4Z6F A;  1N56 A;  2J6T A;  1SL0 A;  3QEB Z;  9ICM A;  4DSE A;  1PX5 A;  1MQ2 A;  4F4X A;  4M5D A;  4E8F A;  3M9O B;  2PFO A;  3RJK A;  5L1I A;  4UQG A;  1R8A A;  5HRB A;  3Q8L A;  4AT9 A;  4MF8 A;  4WC7 A;  4B9M A;  4I29 A;  2ASJ A;  4X0A A;  2A1J A;  4GXJ A;  3HWT A;  3V7K A;  4ECY A;  4F4K A;  3V6J A;  3H40 A;  4MF2 A;  5HHI A;  4XA5 A;  4ED3 A;  2AU0 A;  1HUZ A;  5KG4 A;  4EYI B;  8ICM A;  4NLG A;  2FPK A;  9ICQ A;  2ZUC A;  1YLQ A;  5DB8 A;  4UAZ A;  3GIK A;  3C5F A;  5IIL A;  8ICZ A;  7ICG A;  4ECU A;  8ICP A;  4FHP A;  3OVA A;  3JPN A;  2F1J A;  2ALZ A;  3M9M B;  1WCN A;  5KFE A;  3FYH A;  3Q8R B;  2C2D A;  4XQ8 A;  4DSL A;  4ECR A;  4NLN A;  2BE3 A;  3JPQ A;  3UPQ A;  4ECT A;  4UBB A;  4DOB A;  5DDY A;  3HPO A;  5D46 A;  4DFK A;  1U48 A;  2DR8 A;  3PR4 A;  3QE9 Y;  4QWE A;  3H4D A;  4ECX A;  5KFP A;  3RAQ A;  1ZQJ A;  4KLT A;  5DLF A;  4BXO A;  5J0R A;  3MGH A;  3BQT A;  2NRZ A;  4UAY A;  4QZB A;  5L1K A;  2DR7 A;  2H5X A;  9ICK A;  4YD1 A;  1X9W A;  1T8E A;  3WFS C;  4J9L A;  1ZQZ A;  4GC7 A;  1S10 A;  4F3O A;  7ICM A;  3PML A;  8ICU A;  5J0T A;  3KHG A;  1B22 A;  1UEV A;  3TFS A;  1UT5 A;  1BGX T;  3ZDA A;  4KN7 A;  4UD4 A;  3WFO A;  4C8N A;  4PGX A;  4RQ8 A;  3G6Y A;  3LWL A;  2MUT B;  2JEI A;  1R8B A;  4IQT A;  1Z00 B;  2HHU A;  1ZQY A;  4UB4 A;  3LWM A;  1UA1 A;  2JEG A;  4BWM A;  1S0N A;  4O3R A;  4KLS A;  3LQC B;  3WFP A;  1S9F A;  1K1Q A;  1TV9 A;  4NLZ A;  4KLE A;  8ICR A;  4M6W A;  3MAB A;  7ICR A;  5DG7 A;  1HJP A;  2ZH6 A;  1TFW A;  4I2E A;  4F93 B;  5HRK A;  4QW9 A;  3TAN A;  2W8K A;  3UQ0 A;  4O3Q A;  1JIH A;  5J29 A;  1BPB A;  5J0S A;  4RQ6 A;  3ZDE A;  3PMN A;  3JZ0 A;  3OJU A;  5CP2 A;  5DGA A;  5IIK A;  4Z6C A;  4IR9 A;  9ICF A;  4GLX A;  2C2R A;  4KN4 A;  3MDC A;  4DL5 A;  2DRB A;  1K1S A;  4R66 A;  4DOC A;  5KFJ A;  4YXJ A;  5DDM A;  4FHX A;  4YG2 A;  1MIV A;  5KG5 A;  3PO4 A;  1TAU A;  9ICL A;  1Q78 A;  3OUY A;  4M9G A;  4RQ4 A;  8ICY A;  3ZDC A;  4NM2 A;  2O1P A;  4P4O A;  3GQC A;  1BPE A;  4TUR A;  4PH5 A;  1BNO A;  3JPT A;  2ZH5 A;  4YXM A;  4TUQ A;  2W9B B;  2AJQ A;  1BNP A;  5KT2 A;  7ICV A;  3ZD8 A;  3GII A;  5CJ7 A;  2DPI A;  1NK5 A;  1FA0 A;  5CA7 A;  5DLG A;  4RQ0 A;  1NJX A;  4YR2 A;  3RB0 A;  2PFQ A;  9ICE A;  2ZHB A;  4QZG A;  4IRK A;  5KFN A;  4ZH4 A;  5DB9 A;  4QZI A;  1TKD A;  3ORY A;  4F5Q A;  2GWS A;  3HIY A;  5CB1 A;  1JXL A;  1DK2 A;  4PGQ A;  2I9G A;  3NGD A;  2C22 A;  5EWE A;  4O0I A;  5KFG A;  5TZV A;  4DQS A;  4R64 A;  4G3I A;  3THV A;  1UT8 A;  4TUP A;  2PXI A;  4MFF A;  1KNY A;  4LT6 A;  4DS4 A;  3GV8 B;  4IG8 A;  1TFY A;  3RH4 A;  5F2V O;  8ICO A;  4I2J A;  5J0U A;  4EZ9 A;  1ZQN A;  3ISD A;  1ZQG A;  1UEU A;  1RXW A;  4DLG A;  3ZDD A;  3E2E A;  4J9K A;  2BPG A;  3BQ2 A;  8ICK A;  1JMS A;  1ZET A;  1IXR A;  2JZB B;  3PVX A;  1U45 A;  4ECZ A;  4QZA A;  3PX4 A;  3PV8 A;  4RQ7 A;  1Z3E B;  4QZH A;  1JX4 A;  2ZJA A;  4TQS A;  2IHM A;  4F2S A;  1V9P A;  4WBY A;  3IHQ B;  5KFU A;  1ZYQ A;  7ICT A;  2JEF A;  2ZUD A;  1DGS A;  3BQ0 A;  3GV5 B;  2ASD A;  2FMS A;  5KFR A;  3N4M B;  8ICG A;  5KFQ A;  3RJJ A;  4B9T A;  1TK0 A;  4DLE A;  4B9S A;  9ICI A;  4DQR A;  3TAR A;  4DQP A;  4Q43 A;  1T3N A;  3RRG A;  3PW7 A;  4DL4 A;  8ICJ A;  1ZQE A;  8ICC A;  4X4P A;  4YMM A;  3SYZ A;  4UB2 A;  4DSK A;  3WFQ E;  3SZ2 A;  1XSP A;  1NK7 A;  5KT3 A;  4KLI A;  2Q66 A;  2BR0 A;  4NXZ A;  4KLQ A;  4WC4 A;  3UQ2 A;  4O3N A;  7ICN A;  4EYH B;  2P6U A;  3G6X A;  3N97 B;  3RB4 A;  3H37 A;  4RU9 A;  5IIN A;  4FO6 A;  3PW5 A;  2DR9 A;  2C28 A;  3GFK B;  3ZDB A;  5F9L A;  1QSL A;  4M47 A;  1TAQ A;  4JV1 A;  4BGD A;  4RQ3 A;  3MFI A;  4MFC A;  4ED8 A;  4KLJ A;  1TVA A;  4AT8 A;  4NKT A;  2HW3 A;  4RWQ A;  5KFI A;  4EBE A;  1T4G A;  2V4R A;  1TK5 A;  2BQR A;  7ICE A;  2BPF A;  9ICN A;  1NOM A;  3H8J A;  2M9N A;  4F91 B;  4Q44 A;  3MBY A;  5L1J A;  1BPZ A;  4JWN A;  4FHY A;  4DL3 A;  3GDX A;  1WOT A;  4J9M A;  4WC6 A;  4RWN A;  3C1Y A;  4ELT A;  2ZH1 A;  2I1Q A;  1KFS A;  4RUA A;  3RTV A;  3NTU A;  5KFM A;  3QZ7 A;  9ICH A;  8ICI A;  4X4R A;  3JYY A;  3T5J A;  4Z6E A;  4M2Y A;  2DR5 A;  4F5R A;  5KFT A;  4E80 A;  8ICW A;  3AQK A;  4ELV A;  2R8K A;  2BGW A;  4ATB A;  1F5A A; 
#chains in the Genus database with same CATH topology
 5J2C A;  3PX0 A;  2HMX A;  4S3N A;  4ECV A;  4F4Y A;  1UET A;  2JRZ A;  3ISB A;  4KMU A;  3LDA A;  1SWV A;  5AI6 A;  1ZQT A;  4O3O A;  4RQM A;  5J2K A;  8ICH A;  4IQV A;  5KFH A;  1OU5 A;  5HP4 A;  4I2I A;  2JXJ A;  2QB1 A;  2EDU A;  5DQG A;  3H39 A;  2LM4 A;  2JH7 A;  4Z6D A;  4C8K A;  2BDP A;  4RNO A;  9ICS A;  5AKX A;  4R8U B;  2E1F A;  2DVI A;  2XGP A;  2KHV A;  4EBD A;  1ZD4 A;  1ZD3 A;  3RR8 A;  3RF9 A;  2KE7 A;  8ICB A;  3C2K A;  4EEY A;  4FHW A;  2K60 A;  1UQV A;  2DWQ A;  1KDH A;  7ICP A;  3C28 A;  1TK8 A;  2ZIU B;  2RRD A;  5J0Q A;  3T5K A;  4HX0 A;  5KL1 B;  7ICJ A;  3LK9 A;  5F9N A;  1U9L A;  4I2G A;  2LBO A;  3QU4 A;  5HRI A;  4KLG A;  4J9O A;  5AI9 A;  2A1J B;  4DL7 A;  2G07 A;  1LKY B;  2W55 A;  4F5P A;  2JV3 A;  3KZX A;  3SAF A;  5ALE A;  4WCW A;  2EH9 A;  5DED A;  3A0B U;  4BJQ A;  8ICL A;  4I27 A;  5KAF U;  2HBJ A;  4PHE A;  3SI8 A;  1SKR A;  2JH1 A;  3BZK A;  4FZM A;  5J2I A;  4QNL A;  4I28 A;  3V72 A;  3MGV A;  3HKZ F;  2VIX A;  1T94 A;  1WUD A;  4CF3 A;  4CCH A;  3ED5 A;  2KV2 A;  5CHG A;  5JRT A;  5CFS A;  1ZQX A;  5KG0 A;  5TIS U;  3BZC A;  5J2J A;  4ELU A;  3MR2 A;  3KKA A;  3OSP A;  2KP7 A;  1ZQ1 C;  3GIJ A;  2YTU A;  3SEI A;  2BCS A;  2ZUB A;  2BCU A;  5CR0 A;  4YQW A;  1VLB A;  5L1L A;  1SZP A;  1KEJ A;  2FE9 A;  1ZQM A;  4DSJ A;  4QZD A;  4DFP A;  3HX0 A;  1R8C A;  4AT7 B;  3UXP A;  5AI0 A;  1WCL A;  3EPG A;  1SL1 A;  1BPD A;  3AM9 A;  2NO4 A;  1Q3V A;  5KT7 A;  4KB6 A;  5KFW A;  3HW8 A;  5B3Q A;  4IQU A;  2XI9 A;  2Q0Z X;  1XSL A;  2KN7 A;  5HML A;  1X9X A;  2EAM A;  2KZZ A;  2KZM A;  5KFV A;  1C20 A;  1SL2 A;  5AHX A;  5HHH A;  3DDH A;  5J0P A;  2XVT A;  2ZTE A;  1S76 D;  3CNH A;  4DSF A;  7ICO A;  2YB1 A;  4EEK A;  8ICQ A;  4YVZ A;  4DFM A;  2WFA A;  1ZQS A;  1URJ A;  2QB0 A;  2IHN A;  2CXY A;  3TAD A;  2FMS A;  3OGU A;  1Q3U A;  1BPX A;  2R8H A;  2HVH A;  3F5A A;  5EWG A;  2P6R A;  2VJ4 A;  2W9C A;  3PW0 A;  2I5H A;  4M9N A;  2G5I B;  2KNJ A;  2IA6 A;  4IRC A;  1NO5 A;  1L7N A;  3RJH A;  4ECS A;  2KVC A;  4M9J A;  3OWG A;  4QZ9 A;  3M1Y A;  4KLD A;  2ZH9 A;  4UAU A;  4IC9 A;  5DB6 A;  3M8R A;  3GIM A;  1PZN A;  1NI3 A;  1D9F A;  5D49 A;  9ICP A;  4NL9 C;  2MAX A;  2YMP A;  1QTM A;  3EF2 A;  5DBA A;  1RZT A;  5AM4 A;  4ATB B;  5IIM A;  4C8M A;  2E5S A;  4GIB A;  4EED A;  2K8C B;  2K4E A;  3UM9 A;  2Z7J A;  5J0Y A;  1KLN A;  2VKQ A;  1WWU A;  2H3Q A;  3PY8 A;  4PJ0 U;  5AM5 A;  2WTF A;  1UA0 A;  4KLO A;  3AQM A;  1QLN A;  1N2X A;  2NRK A;  5ALK A;  3KHL A;  3V7J A;  4BDP A;  3TQ1 A;  5KT4 A;  4B9L A;  4UB3 A;  1IIP A;  4GC6 A;  1F44 A;  2F77 X;  2ZIX A;  4DWI A;  5KT6 A;  5EE0 A;  4LVS A;  2KKP A;  4DL2 A;  3SAG A;  2QAR A;  2K8A A;  1JAL A;  3WKB A;  3AQF A;  3GZF A;  1L3S A;  1L5U A;  5KG2 A;  1HUO A;  1JN3 A;  2IMW P;  5HRD A;  3GV7 B;  1B0X A;  4Q45 A;  3BS5 B;  1ZD2 P;  4MEX A;  5HR6 A;  4K4I A;  2H3Z A;  2PKE A;  1Q8K A;  2L5Y A;  3NYB A;  4Y2Y A;  2OWO A;  2NYV A;  2BQU A;  2J6T A;  9ICM A;  2ZIV A;  1SL0 A;  5F3X B;  4M5D A;  4E8F A;  1PK1 B;  5ALS A;  4WC7 A;  4B9M A;  4I29 A;  4X0A A;  4F4K A;  3V6J A;  3H40 A;  4MF2 A;  5HHI A;  8ICM A;  1SB3 C;  2ZUC A;  5DB8 A;  3GIK A;  3C5F A;  3M9M B;  3FYH A;  3IG5 A;  2R18 A;  4NLN A;  5ALD A;  1J97 A;  2ZXH A;  5ALT A;  1KQQ A;  4KM5 A;  3PR4 A;  3NUQ A;  3QU9 A;  3H4D A;  3QE9 Y;  4ECX A;  1ZQJ A;  4KLT A;  4BXO A;  3MGH A;  2NRZ A;  1X9W A;  1ZQZ A;  3UMC A;  4F3O A;  4XJE A;  4IL6 U;  3PML A;  4BUG A;  1UEV A;  1Q46 A;  3G6Y A;  5AIB A;  1UCV A;  1UA1 A;  4PL1 A;  4KLE A;  1K1Q A;  8ICR A;  7ICR A;  5DG7 A;  1HJP A;  4LEZ A;  3TAN A;  1MA7 A;  1JIH A;  2YB4 A;  5J0S A;  5J29 A;  4RQ6 A;  3JZ0 A;  4IR9 A;  1QH9 A;  2C2R A;  5EE3 A;  1K1S A;  3HKZ C;  4R66 A;  5KFJ A;  2ZH5 A;  4FHX A;  3OUY A;  2G08 A;  4P4O A;  3GQC A;  1BNO A;  3JPT A;  3KBB A;  2WB1 C;  5AIA A;  5KT2 A;  1XNS A;  1NK5 A;  2YMQ A;  5DLG A;  5CA7 A;  5KFN A;  4CNQ A;  5CB1 A;  4UB8 U;  4PGQ A;  2I9G A;  2C22 A;  4G3I A;  4LT6 A;  3CW2 C;  2K89 A;  5ALO A;  4I2J A;  1ZQG A;  1UEU A;  3ZDD A;  3GU3 A;  3BQ2 A;  1JMS A;  1U45 A;  2A3V A;  3PV8 A;  4QZA A;  4EEL A;  1Z3E B;  3PSP A;  2RP5 A;  5HR7 A;  5KFU A;  1PVP A;  2JEF A;  4NXT A;  3RJJ A;  5FP0 A;  4OAH A;  4B9S A;  4DLE A;  3AEV A;  1JRO A;  1SXD A;  8ICJ A;  3NVO A;  3ERC C;  4OJP A;  2IUB A;  4EEN A;  4KLI A;  2B4V A;  1Z1V A;  4WC4 A;  4KLQ A;  2QB0 B;  7ICN A;  4ACO A;  2P6U A;  4KMO B;  3G6X A;  1N61 A;  3CRX A;  3H37 A;  4RU9 A;  3PW5 A;  2DUY A;  2KG5 A;  2GA9 D;  2WAQ F;  4M47 A;  1TAQ A;  4KLJ A;  2A1A A;  2WHE A;  2HW3 A;  7ICE A;  1VDV A;  4Q44 A;  5L1J A;  4DL3 A;  2KEY A;  1PVR A;  3RTV A;  9ICH A;  3SQI A;  8ICI A;  4OAI Z;  2DR5 A;  8ICW A;  5AM1 A;  2HOQ A;  4C4S A;  1DRG A;  4C8O A;  2G09 A;  1RYR A;  4J9S A;  2PFP A;  1QQ7 A;  4UD5 A;  2KTQ A;  3IG8 A;  5JU5 A;  1QSS A;  3F53 A;  4WC5 A;  4ED7 A;  3H0L B;  4RT3 A;  5KFB A;  2KIC A;  2LM1 A;  2KHQ A;  4JB3 A;  2OXO A;  2D8C A;  4XUS A;  5EE1 A;  3MFH A;  2JZB A;  2M2V A;  2EAP A;  2M2T A;  3ISC A;  2HBL A;  2ZIX B;  3RJF A;  1DOQ A;  4DFD A;  4F92 B;  4DCC A;  1CRX A;  5HC9 A;  1RQL A;  4K4G A;  2AQ0 A;  1R89 A;  3KHR A;  8ICT A;  3AMZ A;  9ICX A;  1ZQP A;  2HHV A;  4P2H A;  4FBU A;  3QU2 A;  4F72 A;  2BCR A;  1A77 A;  1X9S A;  4RT2 A;  1QQ6 A;  2HI0 A;  2AXT U;  4K96 A;  4NWI A;  4EX6 A;  4GXI A;  2NO5 A;  4KLM A;  2V4Q A;  3KOO A;  2FJ6 A;  1NK0 A;  4Q8E A;  5BPC A;  2EWR A;  4IR1 A;  1V97 A;  1XS9 D;  5KG7 A;  3AU2 A;  3IDW A;  9ICR A;  2JGA A;  9ICU A;  9ICB A;  4BXO B;  3M7D A;  7ICI A;  3QYP A;  1PVQ A;  3NVZ A;  2ZH4 A;  4Y2X A;  3EPI A;  4Y2T A;  4FO1 A;  5AKJ A;  3TAQ A;  3O0F A;  7ICK A;  1A6S A;  1LB2 B;  3IP4 B;  2RDJ A;  4FS1 A;  2LMR A;  3H4B A;  4YFK A;  4F5N A;  5IIJ A;  2HHT A;  1HIW A;  3HP6 A;  1KL9 A;  3N7S C;  5HRG A;  2KSO B;  2P66 A;  3TI0 A;  2HVI A;  4UAS A;  3OUY B;  4Q8F A;  2JR5 A;  3KTQ A;  3H3A A;  4FE3 A;  1ZQO A;  2F2A B;  3E0F A;  4TQR A;  2KIV A;  1S0V A;  2FLL A;  1NK6 A;  4YR0 A;  4WC2 A;  5AKY A;  5AKK A;  4CF5 A;  3RAX A;  2XO7 A;  5T14 A;  2ESE A;  5D4B A;  7ICQ A;  4MKP A;  3HJ1 A;  2HN1 A;  3IRU A;  1NKB A;  4R65 A;  2BCQ A;  4QZC A;  5DKW A;  5J2G A;  2DKZ A;  5DG9 A;  9ICC A;  1D8Y A;  3OTQ A;  2NRX A;  1CUK A;  1D8L A;  4BWJ A;  2Q4T A;  3IV6 A;  4ICA A;  5ALQ A;  3PNC A;  2AGO A;  3LVV A;  1ZQV A;  3D6J A;  4EV6 A;  2LYH A;  1VFG A;  3C18 A;  3SMV A;  2W7P A;  5DEC A;  2JHD A;  2B0C A;  5KNI A;  4X4O A;  5C5J A;  3V7L A;  4UAW A;  5DB7 A;  2RDI A;  4E7X A;  1SGG A;  5EOZ A;  4FH5 A;  5KFS A;  4LEW A;  4R63 A;  1RYS A;  2GLE A;  4K97 A;  3H0M B;  2E8P A;  1XSN A;  2BCV A;  8ICE A;  1ZQF A;  2B21 A;  4B9N A;  2FMQ A;  4FBT A;  9ICJ A;  2IHO A;  2HHQ A;  3B0X A;  4FH3 A;  4PGY A;  4YD2 A;  1D8B A;  2ZH3 A;  5AM0 A;  2WAQ C;  2E1E A;  3VC8 A;  5J2H A;  1N48 A;  4RQ5 A;  3FDS A;  3AL0 B;  3B0Y A;  2Y1J A;  2PFN A;  1TFR A;  1NKC A;  4JLZ A;  3IM1 A;  1L3T A;  4NM1 A;  2KFZ A;  1KFD A;  3RH5 A;  4F4W A;  5DQI A;  2VA3 A;  5HRF A;  2WB1 F;  4GXK A;  3CP8 A;  1ZQB A;  4WC3 A;  4K4H A;  4RWO A;  8ICF A;  2VAN A;  1QSY A;  4DQQ A;  5KFY A;  5JUM A;  5B66 U;  3SAH A;  2ASL A;  1K5O A;  2XY6 A;  4NXV A;  4JMU A;  3RRH A;  2BQ3 A;  3VCB A;  3JPP A;  4AP9 A;  3WK7 A;  4K9B A;  1ZQU A;  4FFD A;  5KT5 A;  1UHU A;  3ETL A;  3C2M A;  2EZZ A;  3H8S A;  1Q78 A;  4DSE A;  3BS7 A;  3M9O B;  2PFO A;  3NVV A;  2B51 A;  2OYY A;  5HRB A;  4AT9 A;  4GXJ A;  4ECY A;  4KX5 A;  1HUZ A;  4XA5 A;  4ED3 A;  5KG4 A;  3NS1 A;  4NLG A;  9ICQ A;  4K8V A;  8ICZ A;  4FHP A;  3JPN A;  4ZOH C;  2F1J A;  1OW5 A;  3QU7 A;  3Q8R B;  2C2D A;  4ECR A;  4ECT A;  2LHT A;  2AHO B;  5DDY A;  5D46 A;  3RAQ A;  5J0R A;  3BQT A;  2CRX A;  1SXE A;  2H5X A;  2Y0S F;  9ICK A;  3QUT A;  2W7O A;  4J9L A;  2ZXI A;  1S10 A;  2HOI A;  8ICU A;  3HIL A;  4US9 A;  5J0T A;  4UD4 A;  4C8N A;  2JEI A;  4RQ8 A;  4P0Q A;  2HHU A;  5J8Y C;  4UB4 A;  1P7D A;  2JEG A;  4KLS A;  3LQC B;  3WFP A;  2EAO A;  1PUZ A;  3NWI A;  4J03 A;  4M6W A;  3MAB A;  5HRK A;  3ONN A;  3UQ0 A;  2WF8 A;  3ZDE A;  5CP2 A;  4Z6C A;  3MDC A;  4DL5 A;  4FZL A;  4DOC A;  5DDM A;  1TAU A;  3ZDC A;  4TUR A;  4YXM A;  2AJQ A;  2KIW A;  3SR6 A;  7ICV A;  3ZD8 A;  2DPI A;  2WF7 A;  1NJX A;  3RB0 A;  2PFQ A;  2RQ5 A;  4OJ6 A;  3QNM A;  3WK8 A;  1FIQ A;  1DK2 A;  2ZH1 A;  5EWE A;  4O0I A;  5TZV A;  5CHE A;  4R64 A;  1X42 A;  1UT8 A;  4TUP A;  2PXI A;  2W3S A;  4O68 A;  4IG8 A;  3JCF A;  1TFY A;  3RH4 A;  5ALM A;  4J9K A;  2BPG A;  3AN1 A;  1RG6 A;  1ZET A;  3DEE A;  4WOY A;  3PVX A;  3PX4 A;  4RQ7 A;  4WBY A;  4F71 A;  7ICT A;  2ZUD A;  1DGS A;  4A8E A;  2MSN A;  5KFQ A;  4CRX A;  9ICI A;  4C7Y A;  4DQP A;  1T3N A;  3PW7 A;  4Y2Q A;  8ICC A;  4X4P A;  4Y2J A;  4YMM A;  3SZ2 A;  1NK7 A;  1N63 A;  2Q66 A;  1L7M A;  4USA A;  1SIJ A;  4KX3 A;  1ECW A;  4UW9 A;  4FO6 A;  2C28 A;  5AI5 A;  3GFK B;  5F9L A;  4BGD A;  4MFC A;  2HBM A;  4AT8 A;  4NKT A;  1T4G A;  1TK5 A;  5D62 A;  2W54 A;  3MBY A;  3PZP A;  1WOT A;  4WC6 A;  3C1Y A;  4C0Z A;  2I1Q A;  1KFS A;  3NTU A;  3TAC B;  3BQ7 A;  1YT3 A;  3JYY A;  3T5J A;  2ODG A;  1KW4 A;  2R8K A;  2BGW A;  1NK9 A;  9ICT A;  2XCP A;  3MR5 A;  1LV5 A;  1B43 A;  3K75 D;  2F1H A;  4ED0 A;  1H38 A;  3JPS A;  1L3U A;  2BPC A;  7ICL A;  4WBZ A;  4ECW A;  5BOL A;  2FDR A;  3SEN A;  2UVV A;  2KJ9 A;  4UBC A;  4EBC A;  5KFD A;  5DG8 A;  3OV7 A;  4RPY A;  5KG1 A;  5JTI A;  4FS2 A;  1J2N A;  3PO5 A;  2PI4 A;  5AM2 A;  1NZP A;  1UPH A;  3D2Q A;  2ZJ5 A;  3ALR A;  5ALG A;  3BJY A;  5J0O A;  5HNK A;  3WK5 A;  5ALP A;  2ZH8 A;  1X9M A;  1FFV A;  2BBJ A;  3M9N B;  2DF4 B;  1ZQC A;  4YMO A;  3OSN A;  1NZB A;  4QIW F;  4J9P A;  2KFN A;  4UB5 A;  3Q8Q B;  4IQW A;  3M6K A;  3KZI U;  1JRP A;  3ICX A;  3T5L A;  5J2A A;  2F8K A;  4M9H A;  2VJ5 A;  3I28 A;  3WKE A;  3L4P A;  7ICU A;  4LZD A;  4OD0 A;  2HHS A;  3CK6 A;  2FPL A;  4WC1 A;  3OVS A;  3Q8K A;  3I76 A;  2KZ3 A;  3QEA Z;  1Q79 A;  4P4M A;  7ICS A;  3Q8M A;  2G06 A;  4RPX A;  2V9W A;  3WK4 A;  2D6F C;  4KIT B;  4X5V A;  3Q8P B;  1ZQQ A;  4X4U A;  2H3F A;  3AUO A;  3PW2 A;  2JEJ A;  3HT3 A;  2CPR A;  2E8M A;  1F0M A;  2R8J A;  5CWR A;  4B9U A;  1TE2 A;  4Y2P A;  4RQ1 A;  4ED1 A;  3EUB 2;  3NAS A;  4MFA A;  4X4V A;  3CYM A;  1MQ3 A;  2CN1 A;  3RR7 A;  4NLK A;  4M04 A;  8ICN A;  1NK4 A;  4I2H A;  4CGZ A;  2E8O A;  2MU2 A;  1RDF A;  3QX7 A;  1NJY A;  4U6P A;  2ZHA A;  2OHF A;  4ED6 A;  1ZQI A;  5JTG A;  4FZN A;  2G5H B;  2J6S A;  9ICW A;  2DRA A;  1A76 A;  4I2F A;  4P0Q B;  4RZR A;  3QUC A;  4M6W B;  4DO9 A;  5DGB A;  2O5A A;  4QZE A;  3NVW A;  3UMB A;  2W9C B;  2IOF A;  5DBC A;  3H8W A;  1N62 A;  3C1Z A;  5ALI A;  3Q8S B;  2F44 A;  2RFF A;  2YML A;  5KG6 A;  4YCX A;  9ICA A;  1JQR A;  2Y0S C;  2XCA A;  5ALR A;  5BOM A;  4ED2 A;  1SV4 A;  1WYG A;  5EWF A;  1NJW A;  4RPZ A;  2W9B A;  3E58 A;  3UMG A;  3UXN A;  1N5X A;  2GO7 A;  2ZIU A;  1NJZ A;  4C4T A;  4K9A A;  2YMM A;  1MIW A;  4JWM A;  3H38 A;  2YQE A;  3T3F A;  3GIL A;  2GOL A;  9ICO A;  2ZH2 A;  5CRX A;  2G0A A;  4P4P A;  2UVW A;  4QWA A;  2ES6 A;  1IG6 A;  3TAP A;  2AGQ A;  1T7P A;  4DOA A;  5AKE A;  2OCE A;  3UPS A;  1LKY A;  2W8L A;  5KFZ A;  4PHA A;  3KKA C;  3PR5 B;  4KLU A;  2N1R A;  2Y9U A;  1JUD A;  4EBJ A;  5ALZ A;  3OVB A;  4F4Z A;  5E79 U;  5KFO A;  4RWP A;  5IIO A;  2QAR B;  2ISO A;  4YMN A;  2FMP A;  4NL9 A;  5GTH U;  2PBE A;  1TAM A;  3MR3 A;  4DL6 A;  3T79 A;  4X4N A;  2XY7 A;  2XC9 A;  5A0L A;  2R8G A;  4I2C A;  3SD7 A;  2ID1 A;  2ZIV B;  4O3M A;  8ICA A;  4AT8 B;  2KD1 A;  3I1Y A;  2ZTD A;  4I2D A;  2DBY A;  5KG3 A;  1ZQA A;  4QWD A;  3KHH A;  4RQ2 A;  4X0B A;  3OHA A;  2FPM A;  1FEZ A;  2EZY A;  5KFX A;  3K1Z A;  4OCZ A;  1L7P A;  5AKZ A;  1L8O A;  4AT7 A;  5CFT A;  1XU4 A;  4JV0 A;  4NXW A;  3N28 A;  2LKY A;  3LYS A;  2MRL A;  4NLB A;  2BHN A;  1D9D A;  3F2C A;  4J9R A;  4JV2 A;  1N5W A;  2ZIW A;  4Y2R A;  1CEZ A;  4F5O A;  1NNL A;  4YR3 A;  2M2U A;  1X2I A;  4M0A A;  4O5K A;  5B5E U;  3WKD A;  4J9Q A;  3C66 A;  2VA2 A;  2IBK A;  3RFA A;  4RUC A;  1V4A A;  2M0N A;  1F5S A;  5J2B A;  3QZ8 A;  2HHW A;  4O3P A;  5AKH A;  5J2E A;  2LYA A;  2W04 A;  1LVH A;  4RNM A;  1KFT A;  4GFJ A;  4NY8 A;  4DF8 A;  4XRH A;  5J0W A;  2J6U A;  2W9A A;  4MHV A;  1JAJ A;  3RBE A;  2HSZ A;  3C21 A;  4I2A A;  2FLP A;  3V6H A;  2PI5 A;  1ARO P;  5AI4 A;  3TFR A;  1COK A;  1XO1 A;  4O9M A;  3EW9 A;  3JPR A;  1N56 A;  4Z6F A;  4JLX A;  3QEB Z;  1PX5 A;  1ZRM A;  1MQ2 A;  4F4X A;  3D2N A;  3RJK A;  4UQG A;  1DGJ A;  1R8A A;  3F5E A;  4MF8 A;  4QIW C;  4NXU A;  2EAN A;  3HWT A;  3V7K A;  1L8L A;  4EYI B;  2FPK A;  4PZO A;  4N7R A;  7ICG A;  4ECU A;  2WF5 A;  3OVA A;  2BZF A;  5KL8 B;  1XO0 A;  3IN5 A;  2BE3 A;  3JPQ A;  3UPQ A;  2F3N A;  5G5H A;  4UBB A;  4DFK A;  1U48 A;  2DR8 A;  1Z19 A;  5AK4 A;  4NV0 A;  4UAY A;  4QZB A;  5L1K A;  2D3D A;  4YD1 A;  1T8E A;  4GC7 A;  3N7R C;  3QU5 A;  7ICM A;  3TFS A;  3PST A;  4KN7 A;  4PGX A;  1ZQY A;  3LWM A;  4O3R A;  1S0N A;  4UAR A;  3NKU A;  4NLZ A;  2W03 A;  2EZX A;  4I2E A;  4F93 B;  4O3Q A;  1BPB A;  3OJU A;  5DGA A;  2FCL A;  5IIK A;  9ICF A;  2WF9 A;  4GLX A;  3FAH A;  2MA1 A;  1M6Y A;  3BS5 A;  3FM9 A;  4YG2 A;  1MIV A;  3PO4 A;  4LEY A;  2O1P A;  1BPE A;  1GO3 F;  4PL2 A;  4PH5 A;  1BNP A;  2W9B B;  2W11 A;  4C4R A;  5CJ7 A;  4Y2V A;  4RQ0 A;  1PK1 A;  3PSI A;  4YR2 A;  9ICE A;  2ZHB A;  4QZG A;  4IRK A;  5DB9 A;  4QZI A;  4CF4 A;  2GWS A;  5AKG A;  1JXL A;  3NGD A;  1L7O A;  4DQS A;  3THV A;  4MFF A;  8ICO A;  5J0U A;  1ZQN A;  3ISD A;  1RXW A;  3E2E A;  3KD3 A;  4PZN A;  2W3R A;  2JZB B;  1O03 A;  4QZH A;  2ZJA A;  4F2S A;  1V9P A;  4K99 A;  3GV5 B;  2ASD A;  5KFR A;  3N4M B;  8ICG A;  4CE6 A;  1TK0 A;  2HOF A;  5ALJ A;  1ZQE A;  4DSK A;  1HEK A;  3ETR A;  1XSP A;  5KT3 A;  2W43 A;  2BR0 A;  4NXZ A;  2O6K A;  3UQ2 A;  4O3N A;  2Y9T A;  3KFU F;  2LI6 A;  2DR9 A;  3F2D A;  3ER9 B;  1QSL A;  4RQ3 A;  1L6N A;  4WQL A;  3HRD D;  4RWQ A;  5KFI A;  4EBE A;  2V4R A;  2BQR A;  9ICN A;  3H8J A;  2M9N A;  4P0P A;  1BPZ A;  4FHY A;  2HCF A;  4JWN A;  4J9M A;  2HBK A;  4ELT A;  3C29 A;  1GPJ A;  3QUB A;  4BX9 C;  3QZ7 A;  2DKX A;  3QXG A;  4M2Y A;  3WK9 A;  4E80 A;  3L5K A;  4MEY A;  4Y2U A;  4LEV A;  3BDP A;  2ZIW B;  2DGZ A;  4KLH A;  2R8I A;  1MSW D;  5HMM A;  2AH5 A;  4JUZ A;  3C2L A;  3AQN A;  4AYB C;  3WKA A;  2NRW A;  1SV0 C;  3SV4 A;  1T3Q A;  4QWC A;  1PK3 A;  2I6X A;  1ZD5 A;  1KN5 A;  5L9X A;  3ER8 C;  2GH1 A;  4OJO A;  5AK5 A;  5ALN A;  8ICX A;  1CI4 A;  1RPL A;  2K4H A;  4OAF A;  1WG8 A;  3FC4 A;  5C0Y A;  2E3T A;  4QWB A;  4IRD A;  3OJS A;  1OUQ A;  4OJ5 A;  5ALX A;  1S97 A;  2YN4 A;  2BDU A;  4QZ8 A;  1Z1B A;  1KSP A;  2XIC A;  4C8L A;  2XGQ A;  5ALY A;  4F8R A;  5ALF A;  1FO4 A;  3RH6 A;  5J2D A;  2GAF D;  5KFC A;  9ICG A;  2NV3 A;  2YY6 A;  1L3V A;  3V6K A;  1XC9 A;  1ZQD A;  1ZQL A;  3AU6 A;  1KRP A;  2JMG A;  1KTQ A;  4O69 A;  2OM6 A;  5CEH A;  1B4F A;  3H7I A;  5K4L A;  4DSI A;  2HHX A;  3RJI A;  1S0M A;  1DK3 A;  1ED1 A;  2DL0 A;  2UVU A;  1ZQH A;  3DV9 A;  3PW4 A;  4XQ7 A;  1ZJN A;  4X4S A;  3WK6 A;  2F76 X;  1X40 A;  4US8 A;  3S6J A;  3R9K A;  1SKW A;  1Z4O A;  3NRW A;  5HR9 A;  2W9M A;  4IS7 A;  1NKE A;  2BKE A;  2ISP A;  2HHP A;  4DQI A;  3N7P D;  2FLN A;  2MUT A;  4QW8 A;  1Z00 A;  1X6I A;  4RNN A;  3HJE A;  3RBD A;  5B3P A;  2AQ4 A;  1S77 D;  3WFR E;  4O3S A;  1ZQR A;  1SWW A;  5DQH A;  2Y1I A;  5AIC A;  3K4G A;  4I0U A;  4JK1 A;  5AK6 A;  5DBB A;  5GTI U;  3JPO A;  3EWA A;  4EZ6 A;  5HRL A;  1IV8 A;  1QQ5 A;  1X66 A;  4UB6 U;  4O5C A;  3MGI A;  4O5E A;  1J2M A;  4DEZ A;  5AK3 A;  4UAT A;  2WF6 A;  3G6V A;  2YX8 A;  3EZ5 A;  2F1I A;  2K4I A;  1Y88 A;  4F50 A;  2P35 A;  3QUQ A;  1U4B A;  2KMD A;  2NRT A;  4LZG A;  2UVR A;  2RLT A;  4LJX A;  5G5G A;  4FHV A;  2HN2 A;  7ICH A;  5AM3 A;  4EEB A;  1IM4 A;  1EXN A;  3OPX A;  2B6G A;  4NLC A;  3PHZ A;  1JXE A;  4M9L A;  3ZD9 A;  5AKI A;  4K98 A;  3D2S A;  2ZJ8 A;  5EE9 A;  2XID A;  2DPJ A;  2RHF A;  3L3F X;  2QKQ A;  2PMZ F;  2C2E A;  4X4T A;  1U47 A;  1MIY A;  5L1M A;  4WC0 A;  1YZ6 A;  4DS5 A;  1ZQW A;  4UB1 A;  4J9N A;  9ICV A;  4KLF A;  4EBK A;  3B9J A;  3H8M A;  1WWV A;  4NXX A;  1S0O A;  3T5H A;  4ECQ A;  1BVS A;  3MDA A;  4KTQ A;  3PX6 A;  3HJ4 A;  5KAI U;  1QCK A;  8ICV A;  2M2W A;  4I2B A;  5HRE A;  2ZH7 A;  4YP3 A;  1XWL A;  4AT9 B;  2KSO A;  4B9V A;  2KJ8 A;  4P0P B;  1BPY A;  3OHB A;  3SV3 A;  4U7C A;  4G9B A;  7ICF A;  1U49 A;  3C5G A;  3WFS C;  2KJ5 A;  1C7Y A;  2OH2 A;  1VJ7 A;  2QLT A;  4DF4 A;  4WJ3 B;  3MR6 A;  3PSF A;  2VA8 A;  5KFK A;  1NK8 A;  1RM6 C;  5AKL A;  4CDG A;  3AQL A;  4EP7 A;  1MC8 A;  4KLL A;  4NKU A;  3AQE A;  5HRH A;  5KFF A;  4O6A A;  4PPX A;  4DFJ A;  3K7D A;  2AGP A;  8ICS A;  4EGW A;  2ZTC A;  4YN4 A;  1RQN A;  1OXJ A;  5J0X A;  3RJG A;  5KFL A;  3U26 A;  1RXV A;  4X4Q A;  1ZJM A;  2KVS A;  4Y2S A;  5KFA A;  5KTQ A;  3RB6 A;  2EQY A;  4B6J A;  2K4P A;  2ATL A;  4PHD A;  2NRV A;  3UXO A;  2XY5 A;  3RB3 A;  1FFU A;  3BQ1 A;  2F8L A;  3RJE A;  4PHP A;  4O67 A;  4R8U A;  2A19 A;  4TUS A;  2DFL A;  1ZQK A;  1COO A;  3M6Z A;  3TKA A;  1ZOL A;  4QZF A;  3C23 A;  5ALW A;  5III A;  4HYK A;  1SKS A;  4F2R A;  3EYZ A;  5ALH A;  3M8S A;  4E0D A;  4C80 A;  4EX7 A;  5J2F A;  5F2V O;  4NJ8 A;  3NRZ A;  3F2B A;  1SV0 A;  5L1I A;  1ZRN A;  5AI8 A;  3Q8L A;  5J8Y A;  2ASJ A;  2A1J A;  1S5L U;  4OJL A;  2AU0 A;  1YLQ A;  4C7Z A;  4UAZ A;  5IIL A;  1JI7 A;  8ICP A;  2ALZ A;  4OO1 J;  1WCN A;  5KFE A;  4XQ8 A;  4DSL A;  5D61 A;  1YZ7 A;  1Z4N A;  1AQ6 A;  4DOB A;  3HPO A;  1MN8 A;  4QWE A;  5KFP A;  1N60 A;  5DLF A;  4OAG A;  2DR7 A;  1X6J A;  3WU2 U;  4RQN A;  3KHG A;  1B22 A;  3J81 j;  1UT5 A;  1BGX T;  3ZDA A;  3WFO A;  1KBU A;  3LWL A;  2MUT B;  2B56 A;  2IOF K;  1R8B A;  4IQT A;  1Z00 B;  2DQN B;  3L9D A;  4WH5 A;  2LYB A;  4BWM A;  1S9F A;  1TV9 A;  2BBH A;  4QJF B;  5ALV A;  5ALL A;  4UAV A;  2ZH6 A;  1TFW A;  4QW9 A;  2W8K A;  3PMN A;  2ZG6 A;  4KN4 A;  2DRB A;  4YXJ A;  4HAI A;  5KG5 A;  9ICL A;  5H2F U;  4M9G A;  4RQ4 A;  8ICY A;  4NM2 A;  3H0R B;  4AYB F;  4TUQ A;  3GII A;  1FA0 A;  5D63 A;  2OEH A;  4ZH4 A;  1TKD A;  3ORY A;  4F5Q A;  3HIY A;  1SZH A;  2IOH A;  3TAD C;  5KFG A;  1KNY A;  4DS4 A;  1V85 A;  3K1R B;  3GV8 B;  3MC1 A;  4EZ9 A;  4DLG A;  8ICK A;  1IXR A;  4ECZ A;  2LPE A;  2IHM A;  1JX4 A;  4TQS A;  5CFU A;  1V38 A;  3IHQ B;  3LVW A;  3ZI4 A;  1ZYQ A;  3BQ0 A;  3A0H U;  2E8N A;  4B9T A;  4DQR A;  3TAR A;  4Q43 A;  2KK0 A;  3RRG A;  4DL4 A;  3SYZ A;  3WFQ E;  4UB2 A;  2H3I A;  4EYH B;  3N97 B;  3RB4 A;  1DXS A;  5IIN A;  3ZDB A;  3MCR A;  2K8B B;  4JV1 A;  1VJ5 A;  3MFI A;  4ED8 A;  4WQK A;  3WKC A;  1TVA A;  1ZXI A;  2BPF A;  1NOM A;  2PMZ C;  4F91 B;  1S8O A;  2H3V A;  2HDO A;  3GDX A;  4RWN A;  4RUA A;  2KOB A;  5KFM A;  1KKX A;  1RYU A;  4X4R A;  2KKV A;  1A0P A;  1O08 A;  4Z6E A;  2FI1 A;  4F5R A;  5ALU A;  5KFT A;  3NVY A;  3AQK A;  4ELV A;  4ATB A;  1F5A A; 
#chains in the Genus database with same CATH homology
 9ICT A;  2XCP A;  5J2C A;  3MR5 A;  4MEY A;  4J9S A;  3PX0 A;  1RYR A;  1LV5 A;  1B43 A;  3K75 D;  2F1H A;  4ED0 A;  1H38 A;  2PFP A;  4S3N A;  4UD5 A;  3JPS A;  1L3U A;  2KTQ A;  4ECV A;  2BPC A;  1QSS A;  4F4Y A;  7ICL A;  4WBZ A;  4ECW A;  1UET A;  4WC5 A;  5BOL A;  4ED7 A;  3ISB A;  4RT3 A;  4KMU A;  3BDP A;  5KFB A;  4KLH A;  2UVV A;  3LDA A;  4UBC A;  2R8I A;  4EBC A;  5KFD A;  5DG8 A;  3OV7 A;  4RPY A;  5KG1 A;  5HMM A;  1MSW D;  4JUZ A;  3C2L A;  1ZQT A;  4O3O A;  3AQN A;  3MFH A;  4XUS A;  5J2K A;  8ICH A;  2JZB A;  2NRW A;  4IQV A;  4FS2 A;  3PO5 A;  5KFH A;  3SV4 A;  1NK9 A;  2PI4 A;  2M2V A;  1OU5 A;  5HP4 A;  1NZP A;  2ZJ5 A;  4I2I A;  2M2T A;  3ISC A;  4QWC A;  3BJY A;  5J0O A;  5HNK A;  3RJF A;  1DOQ A;  5DQG A;  3H39 A;  5L9X A;  4F92 B;  1X9M A;  2ZH8 A;  4Z6D A;  3M9N B;  4C8K A;  5HC9 A;  2BDP A;  1ZQC A;  4RNO A;  8ICX A;  4YMO A;  1RPL A;  3OSN A;  9ICS A;  4J9P A;  4K4G A;  2AQ0 A;  4R8U B;  2KFN A;  1R89 A;  3KHR A;  2XGP A;  4UB5 A;  8ICT A;  2DVI A;  3Q8Q B;  4IQW A;  4EBD A;  9ICX A;  1ZQP A;  2HHV A;  3T5L A;  3RR8 A;  4QWB A;  4P2H A;  5J2A A;  4IRD A;  3OJS A;  8ICB A;  4FBU A;  3C2K A;  4EEY A;  4M9H A;  4FHW A;  1S97 A;  2BCR A;  1A77 A;  1X9S A;  1KDH A;  7ICU A;  4LZD A;  4QZ8 A;  7ICP A;  1KSP A;  4RT2 A;  4C8L A;  1TK8 A;  2HHS A;  2FPL A;  2XGQ A;  4WC1 A;  5J0Q A;  3Q8K A;  3OVS A;  3T5K A;  2KZ3 A;  3QEA Z;  4F8R A;  1Q79 A;  4GXI A;  4P4M A;  3RH6 A;  5J2D A;  7ICJ A;  7ICS A;  3Q8M A;  4KLM A;  3LK9 A;  2V4Q A;  4RPX A;  5F9N A;  2V9W A;  5KFC A;  9ICG A;  1U9L A;  4I2G A;  4KIT B;  4X5V A;  4KLG A;  5HRI A;  3Q8P B;  4J9O A;  2A1J B;  1NK0 A;  1L3V A;  3V6K A;  1XC9 A;  1ZQQ A;  4X4U A;  1ZQD A;  5BPC A;  4Q8E A;  1ZQL A;  4DL7 A;  3AU6 A;  4IR1 A;  1KRP A;  3AUO A;  1XS9 D;  3PW2 A;  2JEJ A;  1KTQ A;  3HT3 A;  4F5P A;  2R8J A;  4C8O A;  4WCW A;  5CWR A;  5DED A;  4B9U A;  3H7I A;  3AU2 A;  5KG7 A;  4RQ1 A;  4DSI A;  4ED1 A;  2HHX A;  8ICL A;  4I27 A;  3RJI A;  4PHE A;  1S0M A;  3SI8 A;  1SKR A;  4MFA A;  9ICR A;  1DK3 A;  9ICU A;  2UVU A;  4X4V A;  1ZQH A;  3PW4 A;  4XQ7 A;  1ZJN A;  9ICB A;  1MQ3 A;  4X4S A;  5J2I A;  3RR7 A;  4I28 A;  4NLK A;  4M04 A;  8ICN A;  1NK4 A;  4BXO B;  3V72 A;  4I2H A;  7ICI A;  1SKW A;  5HR9 A;  2W9M A;  1NJY A;  1NKE A;  2BKE A;  2ISP A;  2HHP A;  2ZHA A;  4CCH A;  2ZH4 A;  4ED6 A;  4DQI A;  1ZQI A;  2FLN A;  2MUT A;  2J6S A;  4QW8 A;  9ICW A;  2DRA A;  1A76 A;  1Z00 A;  5CHG A;  3EPI A;  4I2F A;  4RNN A;  3RBD A;  4RZR A;  1ZQX A;  5KG0 A;  2AQ4 A;  1S77 D;  3WFR E;  3TAQ A;  4O3S A;  7ICK A;  1ZQR A;  5J2J A;  4ELU A;  4M6W B;  5DQH A;  3MR2 A;  4DO9 A;  5DGB A;  2Y1I A;  3OSP A;  3K4G A;  2RDJ A;  4FS1 A;  1LB2 B;  4QZE A;  2KP7 A;  2O5A A;  4JK1 A;  2W9C B;  5DBC A;  3GIJ A;  3H8W A;  3C1Z A;  3H4B A;  3Q8S B;  4YFK A;  4F5N A;  2BCS A;  5IIJ A;  2HHT A;  5DBB A;  2ZUB A;  3HP6 A;  5CR0 A;  2BCU A;  2RFF A;  5KG6 A;  4YCX A;  4YQW A;  9ICA A;  5HRG A;  1JQR A;  2XCA A;  2P66 A;  3TI0 A;  2HVI A;  5BOM A;  3JPO A;  3EWA A;  5EWF A;  4ED2 A;  1NJW A;  4EZ6 A;  4Q8F A;  5HRL A;  3OUY B;  5L1L A;  3KTQ A;  1SZP A;  3H3A A;  1ZQO A;  1KEJ A;  1ZQM A;  4RPZ A;  2W9B A;  4DSJ A;  4QZD A;  3UXN A;  4O5C A;  4TQR A;  1NJZ A;  4DFP A;  1S0V A;  2FLL A;  1MIW A;  3MGI A;  3HX0 A;  1NK6 A;  1R8C A;  3UXP A;  4YR0 A;  4JWM A;  4O5E A;  4AT7 B;  1WCL A;  3H38 A;  3EPG A;  1SL1 A;  4WC2 A;  4DEZ A;  1BPD A;  3T3F A;  3GIL A;  9ICO A;  1NO5 A;  5KT7 A;  3G6V A;  3RAX A;  2XO7 A;  2ZH2 A;  3EZ5 A;  2F1I A;  4P4P A;  1Y88 A;  5D4B A;  4F50 A;  2UVW A;  7ICQ A;  3HJ1 A;  4QWA A;  1U4B A;  5KFW A;  3TAP A;  3HW8 A;  2AGQ A;  1T7P A;  2NRT A;  4DOA A;  1NKB A;  4IQU A;  4R65 A;  4LZG A;  2BCQ A;  4QZC A;  5DKW A;  2UVR A;  3UPS A;  2W8L A;  5J2G A;  5KFZ A;  2Q0Z X;  4PHA A;  5DG9 A;  1XSL A;  4FHV A;  3PR5 B;  7ICH A;  2KN7 A;  4KLU A;  9ICC A;  1EXN A;  1IM4 A;  1D8Y A;  2NRX A;  1CUK A;  1D8L A;  5HML A;  4BWJ A;  2KZZ A;  2KZM A;  4EBJ A;  5KFV A;  1JXE A;  4M9L A;  3OVB A;  3ZD9 A;  3PNC A;  2AGO A;  4F4Z A;  1SL2 A;  5KFO A;  2ZJ8 A;  4RWP A;  5IIO A;  1ZQV A;  5HHH A;  5J0P A;  2LYH A;  2ZTE A;  2DPJ A;  1VFG A;  2C2E A;  2ISO A;  4YMN A;  3C18 A;  1S76 D;  2FMP A;  4X4T A;  4DSF A;  7ICO A;  1U47 A;  2PBE A;  3MR3 A;  1MIY A;  4DL6 A;  8ICQ A;  4WC0 A;  4DS5 A;  1ZQW A;  4YVZ A;  4UB1 A;  5DEC A;  4X4N A;  4X4O A;  4DFM A;  4J9N A;  9ICV A;  1ZQS A;  4KLF A;  2XY7 A;  2XC9 A;  2IHN A;  4EBK A;  5C5J A;  3V7L A;  4UAW A;  5DB7 A;  1S0O A;  3OGU A;  2RDI A;  4ECQ A;  1BVS A;  3MDA A;  3T5H A;  1BPX A;  2R8H A;  4KTQ A;  4E7X A;  3PX6 A;  2R8G A;  4I2C A;  3HJ4 A;  5EOZ A;  4FH5 A;  5KFS A;  2HVH A;  5EWG A;  2P6R A;  2ID1 A;  2W9C A;  8ICV A;  3PW0 A;  4R63 A;  3L9D A;  1RYS A;  2M2W A;  8ICA A;  4I2B A;  1XSN A;  2BCV A;  5HRE A;  4AT8 B;  4M9N A;  8ICE A;  2ZTD A;  4I2D A;  2ZH7 A;  4YP3 A;  5KG3 A;  1XWL A;  1ZQA A;  1ZQF A;  2B21 A;  4B9N A;  4B9V A;  4AT9 B;  2FMQ A;  2IA6 A;  1BPY A;  4IRC A;  4QWD A;  3RJH A;  4FBT A;  9ICJ A;  3KHH A;  4ECS A;  4M9J A;  4RQ2 A;  3OHB A;  3SV3 A;  2HHQ A;  4X0B A;  7ICF A;  1U49 A;  4QZ9 A;  3C5G A;  4KLD A;  3B0X A;  3OHA A;  2ZH9 A;  2FPM A;  5DB6 A;  3M8R A;  3GIM A;  1C7Y A;  5KFX A;  1VJ7 A;  4FH3 A;  1PZN A;  4DF4 A;  4PGY A;  4YD2 A;  3MR6 A;  1D9F A;  5D49 A;  2VA8 A;  5KFK A;  4AT7 A;  9ICP A;  1XU4 A;  4JV0 A;  2ZH3 A;  2MAX A;  1QTM A;  1NK8 A;  5DBA A;  3AQL A;  1RZT A;  4EP7 A;  4ATB B;  1MC8 A;  4KLL A;  5J2H A;  4NKU A;  5HRH A;  2BHN A;  4C8M A;  5IIM A;  5KFF A;  4RQ5 A;  1N48 A;  3FDS A;  1D9D A;  3B0Y A;  4DFJ A;  4PPX A;  2AGP A;  2Y1J A;  4J9R A;  8ICS A;  2ZTC A;  4YN4 A;  2PFN A;  1TFR A;  1NKC A;  4JV2 A;  3IM1 A;  1L3T A;  1KLN A;  5J0Y A;  4NM1 A;  1CEZ A;  5J0X A;  4F5O A;  3RJG A;  4YR3 A;  5KFL A;  3PY8 A;  2KFZ A;  1KFD A;  3RH5 A;  1RXV A;  4X4Q A;  2M2U A;  2WTF A;  1UA0 A;  4KLO A;  1ZJM A;  3AQM A;  1QLN A;  1X2I A;  4M0A A;  4O5K A;  4F4W A;  2NRK A;  3V7J A;  3KHL A;  5DQI A;  2VA3 A;  4BDP A;  5KFA A;  5KTQ A;  4J9Q A;  3RB6 A;  5HRF A;  3TQ1 A;  3C66 A;  2ATL A;  5KT4 A;  2VA2 A;  4GXK A;  4RUC A;  2IBK A;  1V4A A;  4PHD A;  4B9L A;  2NRV A;  4UB3 A;  1ZQB A;  3UXO A;  4GC6 A;  2XY5 A;  4WC3 A;  4DWI A;  5KT6 A;  4LVS A;  3RB3 A;  5J2B A;  3QZ8 A;  3BQ1 A;  4K4H A;  4O3P A;  3RJE A;  2HHW A;  8ICF A;  4RWO A;  5J2E A;  2VAN A;  4DL2 A;  4DQQ A;  1QSY A;  4PHP A;  1KFT A;  4RNM A;  5KFY A;  5JUM A;  4NY8 A;  4R8U A;  4DF8 A;  2ASL A;  4XRH A;  2XY6 A;  1L3S A;  4TUS A;  1L5U A;  5KG2 A;  2DFL A;  1ZQK A;  1HUO A;  3RRH A;  2BQ3 A;  1JN3 A;  5J0W A;  1COO A;  2IMW P;  2J6U A;  2W9A A;  5HRD A;  3GV7 B;  4Q45 A;  1JAJ A;  3RBE A;  4QZF A;  3JPP A;  3C21 A;  3C23 A;  5III A;  4MEX A;  4K4I A;  4I2A A;  1ZQU A;  5KT5 A;  3V6H A;  2FLP A;  2PI5 A;  4HYK A;  3NYB A;  1SKS A;  3ETL A;  1ARO P;  4F2R A;  3EYZ A;  2OWO A;  3TFR A;  3M8S A;  4E0D A;  3C2M A;  1XO1 A;  3H8S A;  4O9M A;  5J2F A;  3EW9 A;  3JPR A;  2BQU A;  4Z6F A;  1N56 A;  2J6T A;  1SL0 A;  3QEB Z;  9ICM A;  4DSE A;  1PX5 A;  1MQ2 A;  4F4X A;  4M5D A;  4E8F A;  3M9O B;  2PFO A;  3RJK A;  5L1I A;  4UQG A;  1R8A A;  5HRB A;  3Q8L A;  4AT9 A;  4MF8 A;  4WC7 A;  4B9M A;  4I29 A;  2ASJ A;  4X0A A;  2A1J A;  4GXJ A;  3HWT A;  3V7K A;  4ECY A;  4F4K A;  3V6J A;  3H40 A;  4MF2 A;  5HHI A;  4XA5 A;  4ED3 A;  2AU0 A;  1HUZ A;  5KG4 A;  4EYI B;  8ICM A;  4NLG A;  2FPK A;  9ICQ A;  2ZUC A;  1YLQ A;  5DB8 A;  4UAZ A;  3GIK A;  3C5F A;  5IIL A;  8ICZ A;  7ICG A;  4ECU A;  8ICP A;  4FHP A;  3OVA A;  3JPN A;  2F1J A;  2ALZ A;  3M9M B;  1WCN A;  5KFE A;  3FYH A;  3Q8R B;  2C2D A;  4XQ8 A;  4DSL A;  4ECR A;  4NLN A;  2BE3 A;  3JPQ A;  3UPQ A;  4ECT A;  4UBB A;  4DOB A;  5DDY A;  3HPO A;  5D46 A;  4DFK A;  1U48 A;  2DR8 A;  3PR4 A;  3QE9 Y;  4QWE A;  3H4D A;  4ECX A;  5KFP A;  3RAQ A;  1ZQJ A;  4KLT A;  5DLF A;  4BXO A;  5J0R A;  3MGH A;  3BQT A;  2NRZ A;  4UAY A;  4QZB A;  5L1K A;  2DR7 A;  2H5X A;  9ICK A;  4YD1 A;  1X9W A;  1T8E A;  3WFS C;  4J9L A;  1ZQZ A;  4GC7 A;  1S10 A;  4F3O A;  7ICM A;  3PML A;  8ICU A;  5J0T A;  3KHG A;  1B22 A;  1UEV A;  3TFS A;  1UT5 A;  1BGX T;  3ZDA A;  4KN7 A;  4UD4 A;  3WFO A;  4C8N A;  4PGX A;  4RQ8 A;  3G6Y A;  3LWL A;  2MUT B;  2JEI A;  1R8B A;  4IQT A;  1Z00 B;  2HHU A;  1ZQY A;  4UB4 A;  3LWM A;  1UA1 A;  2JEG A;  4BWM A;  1S0N A;  4O3R A;  4KLS A;  3LQC B;  3WFP A;  1S9F A;  1K1Q A;  1TV9 A;  4NLZ A;  4KLE A;  8ICR A;  4M6W A;  3MAB A;  7ICR A;  5DG7 A;  1HJP A;  2ZH6 A;  1TFW A;  4I2E A;  4F93 B;  5HRK A;  4QW9 A;  3TAN A;  2W8K A;  3UQ0 A;  4O3Q A;  1JIH A;  5J29 A;  1BPB A;  5J0S A;  4RQ6 A;  3ZDE A;  3PMN A;  3JZ0 A;  3OJU A;  5CP2 A;  5DGA A;  5IIK A;  4Z6C A;  4IR9 A;  9ICF A;  4GLX A;  2C2R A;  4KN4 A;  3MDC A;  4DL5 A;  2DRB A;  1K1S A;  4R66 A;  4DOC A;  5KFJ A;  4YXJ A;  5DDM A;  4FHX A;  4YG2 A;  1MIV A;  5KG5 A;  3PO4 A;  1TAU A;  9ICL A;  1Q78 A;  3OUY A;  4M9G A;  4RQ4 A;  8ICY A;  3ZDC A;  4NM2 A;  2O1P A;  4P4O A;  3GQC A;  1BPE A;  4TUR A;  4PH5 A;  1BNO A;  3JPT A;  2ZH5 A;  4YXM A;  4TUQ A;  2W9B B;  2AJQ A;  1BNP A;  5KT2 A;  7ICV A;  3ZD8 A;  3GII A;  5CJ7 A;  2DPI A;  1NK5 A;  1FA0 A;  5CA7 A;  5DLG A;  4RQ0 A;  1NJX A;  4YR2 A;  3RB0 A;  2PFQ A;  9ICE A;  2ZHB A;  4QZG A;  4IRK A;  5KFN A;  4ZH4 A;  5DB9 A;  4QZI A;  1TKD A;  3ORY A;  4F5Q A;  2GWS A;  3HIY A;  5CB1 A;  1JXL A;  1DK2 A;  4PGQ A;  2I9G A;  3NGD A;  2C22 A;  5EWE A;  4O0I A;  5KFG A;  5TZV A;  4DQS A;  4R64 A;  4G3I A;  3THV A;  1UT8 A;  4TUP A;  2PXI A;  4MFF A;  1KNY A;  4LT6 A;  4DS4 A;  3GV8 B;  4IG8 A;  1TFY A;  3RH4 A;  5F2V O;  8ICO A;  4I2J A;  5J0U A;  4EZ9 A;  1ZQN A;  3ISD A;  1ZQG A;  1UEU A;  1RXW A;  4DLG A;  3ZDD A;  3E2E A;  4J9K A;  2BPG A;  3BQ2 A;  8ICK A;  1JMS A;  1ZET A;  1IXR A;  2JZB B;  3PVX A;  1U45 A;  4ECZ A;  4QZA A;  3PX4 A;  3PV8 A;  4RQ7 A;  1Z3E B;  4QZH A;  1JX4 A;  2ZJA A;  4TQS A;  2IHM A;  4F2S A;  1V9P A;  4WBY A;  3IHQ B;  5KFU A;  1ZYQ A;  7ICT A;  2JEF A;  2ZUD A;  1DGS A;  3BQ0 A;  3GV5 B;  2ASD A;  2FMS A;  5KFR A;  3N4M B;  8ICG A;  5KFQ A;  3RJJ A;  4B9T A;  1TK0 A;  4DLE A;  4B9S A;  9ICI A;  4DQR A;  3TAR A;  4DQP A;  4Q43 A;  1T3N A;  3RRG A;  3PW7 A;  4DL4 A;  8ICJ A;  1ZQE A;  8ICC A;  4X4P A;  4YMM A;  3SYZ A;  4UB2 A;  4DSK A;  3WFQ E;  3SZ2 A;  1XSP A;  1NK7 A;  5KT3 A;  4KLI A;  2Q66 A;  2BR0 A;  4NXZ A;  4KLQ A;  4WC4 A;  3UQ2 A;  4O3N A;  7ICN A;  4EYH B;  2P6U A;  3G6X A;  3N97 B;  3RB4 A;  3H37 A;  4RU9 A;  5IIN A;  4FO6 A;  3PW5 A;  2DR9 A;  2C28 A;  3GFK B;  3ZDB A;  5F9L A;  1QSL A;  4M47 A;  1TAQ A;  4JV1 A;  4BGD A;  4RQ3 A;  3MFI A;  4MFC A;  4ED8 A;  4KLJ A;  1TVA A;  4AT8 A;  4NKT A;  2HW3 A;  4RWQ A;  5KFI A;  4EBE A;  1T4G A;  2V4R A;  1TK5 A;  2BQR A;  7ICE A;  2BPF A;  9ICN A;  1NOM A;  3H8J A;  2M9N A;  4F91 B;  4Q44 A;  3MBY A;  5L1J A;  1BPZ A;  4JWN A;  4FHY A;  4DL3 A;  3GDX A;  1WOT A;  4J9M A;  4WC6 A;  4RWN A;  3C1Y A;  4ELT A;  2ZH1 A;  2I1Q A;  1KFS A;  4RUA A;  3RTV A;  3NTU A;  5KFM A;  3QZ7 A;  9ICH A;  8ICI A;  4X4R A;  3JYY A;  3T5J A;  4Z6E A;  4M2Y A;  2DR5 A;  4F5R A;  5KFT A;  4E80 A;  8ICW A;  3AQK A;  4ELV A;  2R8K A;  2BGW A;  4ATB A;  1F5A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...