4YMMA

Structure of human dna polymerase beta complexed with 7bg as the template base in a 1-nucleotide gapped dna
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structure of human DNA polymerase beta complexed with 7BG as the template base in a 1-nucleotide gapped DNA
rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 111
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ymmA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ymmA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ymmA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ymmA03
4TUPA 4ECYA 3H4BA 1ZQEA 4RT3A 4DSKA 2FMSA 7ICRA 1UEUA 4QZHA 2AQ0A 2XY6A 3RBDA 2V9WA 1NKCA 5DG7A 3C5GA 3Q8PB 4MF2A 4TUQA 4KTQA 3H8SA 1SKWA 1R8BA 4X4TA 5J2EA 2HHVA 3QZ7A 5DB8A 2BPGA 5KT7A 2ZUDA 3HIYA 5DBCA 2ZH3A 5EOZA 3MR6A 1TFRA 2C2RA 4GXIA 2DR7A 1UT8A 2Q0ZX 3RH4A 4RQ6A 5J2DA 1NKEA 1D9FA 4C8NA 4KLUA 3GV7B 2FPKA 4J9KA 3ISCA 2ASDA 4I2BA 1QTMA 4Z6EA 3EPGA 3FYHA 4YFKA 4NM1A 3LK9A 3HJ1A 2PBEA 3PMLA 1BPXA 2ISOA 1XU4A 4DO9A 3H39A 4QZGA 4MF8A 1C7YA 3JPTA 5KFUA 4IRDA 4O5EA 4E80A 4WC4A 4WC7A 2HHPA 1ZQCA 5HRGA 4J9OA 3GDXA 1XSLA 3MDCA 4EZ9A 4KLLA 3HJ4A 3PW4A 4LT6A 4WBYA 5DECA 5KFTA 3HW8A 3WFQE 5HREA 2W9CB 4F50A 3LWMA 2DFLA 3RB4A 4QZIA 4F5PA 4DQIA 1KNYA 1VJ7A 4O3QA 3C23A 1YLQA 3H37A 1R8AA 4DL6A 3NYBA 3T5HA 4YXJA 4YR2A 1LB2B 1S0OA 4KLDA 9ICJA 3H40A 2FLPA 4YG2A 4IQTA 5CB1A 3GIMA 3UXOA 2IBKA 8ICJA 4LVSA 3MFHA 3UQ2A 4Q43A 2NRWA 4I2DA 4RPXA 5HMMA 4DF4A 4M2YA 1RYSA 1ZQYA 4B9TA 3JPRA 8ICKA 4DFJA 7ICTA 4ECXA 9ICXA 4EBJA 3GV5B 4K4GA 4QWAA 3RB0A 4KLTA 4B9SA 4F8RA 2HVHA 8ICIA 1Q78A 1RXVA 4QWBA 2DPIA 2ZTEA 5KG3A 4XRHA 1ZYQA 2XCPA 4YMOA 4F5NA 4I2EA 7ICPA 7ICIA 2ZH5A 4FHXA 2V4RA 2R8GA 2HHTA 1XWLA 3C2MA 5DLFA 1XSPA 3BQ2A 1UT5A 2FMPA 2W9AA 4DL2A 3PVXA 3RH6A 4KLFA 9ICWA 5IIIA 9ICMA 4X4OA 4NXZA 5CA7A 1N56A 7ICOA 1DK3A 2BCUA 4ELTA 4UD5A 1NJYA 4C8MA 1NKBA 8ICEA 9ICFA 3MGIA 4NKUA 1BNOA 1DGSA 5J0UA 4WC2A 4M6WB 4F5RA 5D46A 5L1IA 1QSLA 1WCLA 5J0PA 5KFGA 3QZ8A 3M9OB 1BPBA 5HRBA 5KFSA 4ED0A 1L3VA 2IA6A 1SZPA 4O3PA 8ICZA 1NOMA 4GXJA 4RNNA 5J2GA 9ICIA 2VA3A 3RAXA 4XA5A 4ELVA 3MR2A 1S76D 5J0OA 1U4BA 3RRGA 2HVIA 1ZQXA 4ECWA 2IHMA 2BCVA 3V72A 1NJZA 5HHIA 4TQSA 2DR5A 4RQ8A 3RJHA 5IIKA 4ECZA 5F9NA 2ATLA 2IHNA 4DSJA 4GC7A 2R8JA 4DL3A 8ICAA 9ICSA 5DB9A 2RDJA 4M9LA 8ICQA 1KFTA 1JQRA 5L1JA 4QWCA 1RZTA 1NK9A 5KFXA 5DEDA 3MABA 4DSIA 2JZBB 4NY8A 5CP2A 1T7PA 5KFBA 4F2RA 2JEIA 8ICPA 4EP7A 9ICPA 2ZHAA 5KT6A 4JV1A 1MQ3A 1TK0A 1NK6A 3PR5B 5HRIA 4ELUA 3H3AA 4UBCA 4QW9A 4DLEA 5KFFA 5J0XA 1PZNA 3RB3A 1ZQOA 3TARA 4RPYA 2VA8A 1AROP 3MGHA 1KFSA 2V4QA 4FHVA 3AU2A 3RTVA 2ASLA 1S0VA 5KFWA 4BXOA 7ICSA 2ZH1A 4O5CA 1X9SA 3N4MB 4WC3A 1NJXA 5KFOA 5J2HA 2W9BA 4UB3A 1ZQGA 3JPOA 5DQIA 8ICUA 1BNPA 3ETLA 1ZQPA 2FLLA 3BDPA 4BXOB 4E8FA 1BPEA 2MUTA 4R8UA 2H5XA 5EWGA 5F9LA 3HPOA 1BGXT 9ICQA 3OUYA 4ECRA 1WCNA 4UB5A 3JPSA 4MFCA 3AQLA 4ATBB 2DRBA 3H7IA 2KZ3A 2BCSA 3T5LA 3OV7A 4PGQA 4MEYA 4DOAA 5DQGA 1JN3A 3OUYB 5IIMA 4F4WA 1UA0A 4LZGA 2NRVA 1HJPA 4K4IA 2R8HA 2KFZA 3NGDA 5DDYA 4RQ0A 4DEZA 4I2CA 3Q8SB 2BE3A 4KLQA 4FH5A 2W9MA 1T3NA 2AGPA 1LV5A 3RJFA 4TUSA 9ICHA 2RFFA 2HHXA 4GLXA 1S10A 2I1QA 2Y1IA 1ZQNA 4F5OA 2AGOA 7ICHA 9ICLA 5KFAA 4FHYA 2M9NA 1JMSA 1TV9A 4GC6A 4I2HA 4HYKA 4F3OA 8ICFA 3LDAA 4DL4A 8ICYA 5KG6A 5KT3A 1B43A 4P4PA 3RJGA 4I2GA 4QZDA 3SZ2A 4M9GA 4X0AA 5DGAA 4DS5A 2AJQA 4JUZA 4KLJA 3M8RA 3FDSA 3BQ0A 4UAWA 4F2SA 1VFGA 2W9CA 7ICLA 4RWPA 5DGBA 1SL2A 1ZQFA 7ICUA 2DR9A 4QZEA 1BPDA 4QZ8A 4YR3A 2Q66A 5IIJA 4IRKA 8ICTA 4ECSA 5J2JA 3JYYA 4X4QA 8ICGA 3M9NB 4FS1A 3SV4A 2DPJA 2FPMA 1JIHA 2A1JB 1ZQRA 4IQVA 5HRLA 2F1JA 1KEJA 4DSEA 4B9NA 8ICRA 1CEZA 1PX5A 2AQ4A 2GWSA 4YN4A 4AT7B 2F1HA 3H8JA 5DB6A 1ZQKA 4NKTA 3ISDA 1KSPA 2M2UA 1A76A 1KTQA 4PH5A 2XGPA 2HHUA 3AQMA 1U9LA 3H4DA 1B22A 2P6UA 2IMWP 1FA0A 2ISPA 7ICEA 1IXRA 1MC8A 5KFMA 3ZDEA 4EBDA 4J9PA 4DSFA 1RXWA 2P66A 9ICNA 4FHWA 4QZBA 3C21A 4J9MA 1ZQWA 3RJJA 1TAQA 4E0DA 4KLOA 1TAUA 9ICVA 1Q79A 4F93B 3MFIA 3GQCA 3WFOA 4UBBA 3BQ1A 1Z00B 4I29A 3MR5A 3G6YA 2VA2A 5KFYA 4JWNA 1V4AA 4KLMA 4ECQA 1HUZA 4MEXA 1MIYA 1L3UA 3ZDAA 1TFYA 4DFKA 1BPYA 1NK8A 4M6WA 4KLGA 5J2FA 3HX0A 1K1QA 4RT2A 3V7JA 5KT2A 3RAQA 2HHQA 4YXMA 4DQPA 4NLKA 5HMLA 1R89A 3L9DA 4AT8B 3BJYA 2AU0A 2BCQA 3PW7A 2BGWA 4DF8A 1D9DA 4FBTA 4RWQA 4WC0A 4BDPA 5KT5A 2UVUA 4P2HA 3GFKB 4MFAA 3K4GA 5HP4A 3RB6A 7ICMA 3OVBA 4O3NA 1CUKA 4B9UA 4RQ4A 4ECTA 3ORYA 1X9WA 3C2KA 2R8KA 4ECUA 1JAJA 1TK8A 3G6VA 1KFDA 3KHHA 2ZJ8A 3SV3A 4DWIA 1DOQA 5EWFA 5IILA 9ICKA 5KFNA 4ECVA 1ZETA 4CCHA 4NM2A 1QSYA 4RQ7A 5D49A 4M9JA 4M5DA 1TKDA 1L5UA 3Q8KA 2ZTDA 3ZD9A 7ICNA 4PHAA 5J2IA 2PFPA 1T4GA 4IG8A 5KFEA 3E2EA 5L1KA 2DRAA 8ICCA 2UVWA 1NK5A 3V7LA 2JZBA 3RJIA 3JPNA 4J9RA 3PV8A 2PFQA 9ICTA 1R8CA 1U49A 4F4ZA 1QSSA 4RNOA 2XO7A 4X0BA 3AUOA 5HRFA 4BWMA 3OGUA 3GIIA 2DR8A 2ZHBA 1S97A 1ZQSA 3JPQA 3MBYA 1RYRA 4EZ6A 1NJWA 3TQ1A 2BPFA 3UXNA 4P4OA 3B0XA 3OVAA 1COOA 1Y88A 5CJ7A 1ZQVA 2M2TA 2RDIA 4F5QA 4F4YA 1ZQDA 4KLEA 4IR1A 5J0WA 4Q8EA 5DQHA 3M9MB 5CR0A 3AU6A 3PO5A 4J9QA 4F91B 2FLNA 1ZQHA 1TVAA 4QZ9A 4FHPA 4JWMA 4WCWA 2ZH2A 4ZH4A 4KN4A 5J2AA 4Q44A 2XCAA 2ZH7A 2R8IA 5HR9A 2NRTA 4JV0A 5JUMA 4EBEA 4Z6CA 1L3SA 3C2LA 3Q8MA 4I2JA 4RU9A 3RBEA 3T3FA 4I28A 5KFZA 4P4MA 3RR8A 4NLGA 4ATBA 2P6RA 3EWAA 3RRHA 3B0YA 1ZQAA 4QZCA 5J0RA 1MIWA 3NTUA 4PHPA 2C28A 4EYIB 4I2IA 8ICVA 8ICLA 1ZQTA 2LYHA 1ZQIA 1X2IA 4O3OA 3THVA 3PW5A 5KT4A 5KG1A 4F4KA 4AT9B 1ZQJA 4NLNA 5DG8A 3OSPA 3KHRA 4R64A 4O9MA 4DOBA 4KMUA 4WC6A 4O0IA 3UPQA 2OWOA 4I2AA 5CHGA 4QW8A 4FS2A 1U48A 2MAXA 4YP3A 3QE9Y 3WFSC 7ICJA 5HRDA 2AGQA 1QLNA 4DLGA 1ZQZA 4MFFA 5HRHA 1XC9A 4EEYA 3EZ5A 1Z3EB 5KG4A 4Q45A 4M9HA 3TFRA 1NZPA 5HHHA 4DFPA 4E7XA 4O5KA 2BCRA 1NO5A 8ICWA 2W8LA 4IR9A 4FBUA 3N97B 9ICGA 2O1PA 3AQNA 4X4NA 4TQRA 4WBZA 4K4HA 2NRKA 4RWNA 5KG7A 3PNCA 5J2KA 3TFSA 2VANA 4PPXA 5TZVA 1H38A 3RJEA 4XUSA 5KFCA 7ICGA 4DFMA 5IINA 2A1JA 4ED3A 1NK4A 3JPPA 2J6UA 1SKSA 4M04A 4X4SA 9ICBA 2M2VA 4B9VA 5KFIA 3MDAA 8ICHA 9ICCA 4AT7A 5DDMA 4YMMA 2BR0A 4JK1A 3OHBA 5C5JA 3T5KA 2HHSA 4PHEA 3V6HA 2F1IA 1ZJMA 2HHWA 4KLIA 8ICOA 4QWEA 3OHAA 9ICOA 4PHDA 3HP6A 2C2EA 2ASJA 3IM1A 2NRXA 1TFWA 1IM4A 4YR0A 1ZQLA 1ZQMA 2J6TA 3BQTA 4YVZA 5J0YA 3UXPA 2ZJ5A 4F92B 4UB2A 3V7KA 1NK7A 2KN7A 1XO1A 3EYZA 2PXIA 4EBCA 2C2DA 4YCXA 4M47A 3C18A 2WTFA 1XSNA 5KFJA 1EXNA 2B21A 5L1LA 4NLZA 5F2VO 4UAZA 1Z00A 5KFKA 9ICAA 2NRZA 4DQSA 4Q8FA 1UEVA 4I2FA 1A77A 3C1ZA 4RPZA 4J9SA 5BPCA 1JXEA 4I27A 4ED8A 5KFDA 5J29A 5J0TA 2XC9A 3Q8LA 4B9MA 5DBAA 4UAYA 2KZZA 3PX0A 2KP7A 5HNKA 8ICNA 4G3IA 2KFNA 2BQUA 5CWRA 4B9LA 3TAPA 4AT8A 1BVSA 1SL1A 7ICQA 3ISBA 5KFHA 4J9LA 3V6JA 1JXLA 2ID1A 3OVSA 5DG9A 2Y1JA 4DL5A 3TAQA 2JEJA 3G6XA 2FMQA 3PO4A 2J6SA 2BDPA 3LQCB 1L3TA 1U45A 3OJUA 2XY5A 4DQQA 2PFOA 5KFQA 4X4UA 3ZDDA 2ZUBA 4PGYA 4M0AA 7ICVA 5HRKA 1K1SA 2ZH6A 3SI8A 1KRPA 2BHNA 3LWLA 1SL0A 4YQWA 2JEGA 2PI4A 5DKWA 3V6KA 3WFPA 4RNMA 1UA1A 3GV8B 1ZQQA 3PX6A 5J2BA 4WC5A 2XGQA 3OJSA 3PW0A 1TK5A 8ICBA 5KFPA 9ICUA 5D4BA 4RQ2A 4QZFA 3HWTA 1N48A 1HUOA 5DB7A 1KLNA 4LZDA 4Z6FA 1D8LA 4F4XA 4KLHA 4O3SA 4RQ3A 4EBKA 5J0QA 1SKRA 4M9NA 2KZMA 4KN7A 3SYZA 4X4VA 4UD4A 5BOLA 1T8EA 4JV2A 2HW3A 3AQKA 4X4RA 3EPIA 1ZJNA 4R63A 3EW9A 1NK0A 4FH3A 2PI5A 4BGDA 4J9NA 2ALZA 3IHQB 4X4PA 3RR7A 7ICKA 4ED1A 2ZH8A 2UVRA 8ICXA 4UB4A 1WOTA 3GIKA 3ZD8A 4X5VA 1OU5A 2BKEA 3PMNA 7ICFA 3K75D 5HC9A 3Q8RB 2M2WA 1U47A 1MQ2A 1RPLA 5KFRA 4KITB 4IQUA 3OSNA 3Q8QB 1MIVA 3C66A 1X9MA 4YMNA 1F5AA 5KG0A 1UETA 4IQWA 2O5AA 2ZH9A 4C8OA 5DBBA 4DL7A 1S9FA 3TI0A 3H8WA 2ZTCA 2PFNA 4R66A 3UPSA 2XY7A 4DQRA 4C8KA 9ICEA 5KG5A 1XS9D 1S0NA 1MSWD 3PW2A 5KTQA 5DLGA 3C1YA 4GXKA 4RUAA 5J2CA 3PY8A 8ICMA 4DOCA 1ZQBA 4Z6DA 3PX4A 1S0MA 5KFLA 3HT3A 3RJKA 4IRCA 5KFVA 4RZRA 4KLSA 2ZUCA 1JX4A 3C5FA 4XQ8A 4AT9A 3ZDCA 4FO6A 3KHGA 3ZDBA 4RWOA 2C22A 4ED2A 4ED6A 4R65A 4DSLA 2ZH4A 2BPCA 5L9XA 5BOMA 4WC1A 2BQ3A 4XQ7A 2DVIA 3WFRE 5IIOA 4BWJA 3TANA 3QEAZ 3RH5A 1KDHA 4TURA 4C8LA 4PGXA 3M8SA 2BQRA 4DS4A 4O3RA 4QZAA 4RQ1A 1ZQUA 4RUCA 4EYHB 8ICSA 5KG2A 1BPZA 1DK2A 3H38A 1V9PA 1S77D 2UVVA 2KTQA 2FPLA 4UB1A 3GIJA 4QWDA 3UQ0A 3GILA 1D8YA 2JEFA 4YD2A 2W9BB 3T5JA 4ED7A 3KTQA 4RQ5A 3PR4A 3JZ0A 5J0SA 3KHLA 3MR3A 9ICRA 2I9GA 2ZJAA 4YD1A 4UQGA 3QEBZ 4S3NA 5EWEA 2MUTB 2W8KA 4R8UB
chains in the Genus database with same CATH superfamily
1OW5A 1X6JA 1UEUA 1COKA 4J03A 2XY6A 1RQLA 1NKCA 3C5GA 1SKWA 1R8BA 3RF9A 1Z1VA 2QLTA 5EOZA 1TFRA 3FC4A 4GXIA 2B56A 1UT8A 4US9A 5ALQA 3GV7B 3EPGA 4NM1A 3HILA 4UARA 2PBEA 3H39A 1XU4A 4P0PB 4WC7A 4O5EA 5HRGA 4J9OA 3MDCA 4KLLA 2RHFA 3H8MA 3O0FA 2KE7A 3T5HA 1LB2B 2GH1A 4YG2A 3J81j 2ES6A 1RDFA 2G07A 3WK7A 3HKZF 4M2YA 2NRWA 4RPXA 5ALHA 5AKJA 4BX9C 4DF4A 3JPRA 8ICKA 1J2MA 2HVHA 4F8RA 8ICIA 2DPIA 3MC1A 4YMOA 4F72A 2ZH5A 4DL2A 3PVXA 3RH6A 4Y2YA 9ICMA 2Q4TA 4NXZA 7ICOA 1FFUA 2BCUA 2JV3A 4OO1J 4M6WB 4AYBC 2IA6A 4OJLA 1P7DA 2QARA 2RP5A 9ICIA 1L7OA 4EX7A 3RRGA 1ZQXA 2D8CA 1L7PA 4ECWA 2W54A 2DR5A 4ECZA 4WJ3B 4DSJA 3VC8A 4GC7A 2RDJA 1KFTA 1NK9A 1RZTA 5KFXA 3MABA 8ICPA 5KFBA 4F2RA 1ZD3A 2HI0A 2CN1A 4EP7A 1YZ7A 2EH9A 4UB8U 1MQ3A 4ZOHC 4ELUA 5AM1A 4DLEA 5J0XA 1PZNA 4QJFB 2F8LA 1KFSA 2OHFA 3QUBA 4FHVA 2ASLA 4BXOA 2H3FA 4O5CA 3OPXA 2LMRA 1BNPA 4UAUA 3ONNA 1ZQPA 1BPEA 2H5XA 3S6JA 3JPSA 3AQLA 2KZ3A 5ALEA 3OUYB 4CNQA 4GFJA 3WK8A 4LZGA 3NS1A 2KFZA 4DEZA 4I2CA 4KLQA 4FH5A 2W9MA 3NRZA 2K4HA 2YMQA 2GOLA 4TUSA 4EX6A 2I1QA 3DEEA 7ICHA 2VJ4A 3HKZC 3OTQA 3F5AA 4F3OA 2EAOA 2JMGA 5KT3A 4P4PA 4I2GA 3UMGA 5DGAA 4DS5A 1KQQA 3M8RA 3BQ0A 4UAWA 4U6PA 1RQNA 4IRKA 2ZXIA 5K4LA 2MSNA 3SV4A 2A1JB 1PX5A 2GWSA 4NKTA 1ZQKA 2M2UA 3ALRA 2HHUA 3UM9A 1ZD4A 3C29A 1MC8A 4FHWA 3ZDEA 9ICNA 3BS5B 4QZBA 9ICVA 4E0DA 3RJJA 2KK0A 4F93B 2EZZA 4Y2TA 4I29A 1Z00B 3G6YA 3NASA 4JWNA 4MEXA 1MIYA 3ZDAA 1NK8A 2JGAA 5J2FA 3HX0A 2B6GA 4NLKA 1R89A 3I28A 4AT8B 2W55A 2AU0A 2BCQA 4RWQA 3AQFA 2OH2A 3QX7A 1CUKA 2PKEA 3C2KA 4ECUA 3KHHA 5ALLA 4DWIA 3CK6A 5EWFA 5KFNA 5AKHA 4ECVA 4M9JA 1L5UA 3WKBA 4IG8A 1NK5A 4IL6U 2KOBA 3JPNA 4J9RA 1TE2A 1SIJA 1QSSA 4RNOA 3LVVA 1N63A 1LKYA 2OYYA 2CXYA 2XVTA 2BPFA 1ZQVA 1ZQDA 4KLEA 5J0WA 5DQHA 3PO5A 5ALRA 2H3VA 4JWMA 2ZH2A 5J2AA 2XCAA 2VIXA 2NRTA 5JUMA 4EBEA 4Z6CA 2KD1A 4I28A 4U7CA 3RR8A 2P6RA 5ALFA 1MIWA 4PHPA 2C28A 1XO0A 5KT4A 4F4KA 3KHRA 3M1YA 5CHGA 4QW8A 4FS2A 4NXWA 3KKAC 3QE9Y 5HRDA 4DLGA 1ZQZA 1WUDA 4EENA 3UMCA 1WYGA 1NZPA 5KAIU 4DFPA 3WKDA 2EANA 2BCRA 3DDHA 1DGJA 4BUGA 2QKQA 1NNLA 3TFSA 2VANA 2ESEA 5TZVA 2H3ZA 2DRBA 3M6ZA 4DFMA 5IINA 3L5KA 3KZXA 8ICHA 4BJQA 2KKPA 3OHBA 5C5JA 4PHEA 3V6HA 4KLIA 4EGWA 2D6FC 3AQEA 1XNSA 4F92B 1XO1A 3C18A 5KFJA 1YT3A 2G5HB 2DWQA 3NVYA 4WCWA 3C1ZA 5BPCA 5KFDA 4CE6A 5B3PA 2XC9A 1X42A 2KP7A 8ICNA 3V6JA 3AEVA 3ZI4A 5DG9A 2Y0SC 5D61A 1L7NA 3PSPA 2ZUBA 1KRPA 2BHNA 2HN2A 2PI4A 5DKWA 4K9BA 4WC5A 1QQ7A 3D2QA 3PW0A 5KFPA 4RQ2A 3HWTA 1Z4OA 2YMPA 4LZDA 1D8LA 4RQ3A 1X66A 4Y2PA 3SYZA 4NXXA 3GZFA 4USAA 4X4RA 3EW9A 2ZXHA 2UVRA 1WOTA 4X5VA 3PMNA 5HC9A 4HAIA 4Y2SA 4KITB 1MIVA 3OSNA 1Q46A 1F5AA 5KG0A 2ZH9A 4C8OA 2LM1A 4C4RA 9ICEA 5KG5A 1XS9D 1MSWD 2MA1A 2EQYA 5DLGA 2HOQA 4C4TA 5J2CA 1ZD2P 5E79U 4IRCA 5F3XB 3GU3A 1JX4A 2C22A 3NWIA 3HJEA 5L9XA 5BOMA 4Y2RA 2BQ3A 2O6KA 4CF3A 3WFRE 2ZIVB 3QUQA 1VJ5A 1ZQ1C 3IV6A 3IRUA 2KTQA 1TAMA 4QWDA 3GILA 4YD2A 3PR4A 3KHLA 9ICRA 2I9GA 3MCRA 4QZEA 5EWEA 1A6SA 4KB6A 4NXVA 4RT3A 7ICRA 4QZHA 2AQ0A 2V9WA 5ALOA 2JH7A 5DG7A 3Q8PB 4MF2A 4KTQA 3H8SA 5GTHU 5J2EA 3QUTA 2BPGA 5KT7A 2PMZF 5KL8B 3CRXA 2DR7A 2Y9TA 2XICA 5J2DA 1MN8A 2HOIA 4J9KA 2FPKA 2ASDA 4I2BA 3UMBA 3FYHA 4FZMA 1UQVA 5JTGA 4MF8A 1C7YA 3JPTA 4IRDA 4E80A 3M7DA 1ZQCA 4C7ZA 3BQ7A 4EZ9A 3HJ4A 3PW4A 3WFQE 2W9CB 2A1AA 4QZIA 4F5PA 4O3QA 2W3SA 2ZIWA 4YR2A 1S0OA 4C0ZA 5AK6A 3WK6A 3H40A 2B51A 2K4PA 3MFHA 2KIWA 4I2DA 5HMMA 1RYSA 4EV6A 2G0AA 2H3IA 4DFJA 4X4QA 4QWAA 3RB0A 4B9SA 4OD0A 1KBUA 2ZTEA 2OXOA 2XCPA 4F5NA 7ICIA 2V4RA 1XWLA 3QUCA 4PJ0U 3C2MA 9ICWA 1L7MA 2W9AA 4X4OA 5CA7A 4O6AA 1DK3A 5AKLA 1NKBA 4QIWF 1BNOA 5D46A 3QZ8A 3M9OB 2K8BB 4ED0A 4O3PA 2E1FA 4XA5A 4ELVA 3MR2A 1S76D 2CPRA 2HVIA 3V72A 4TQSA 3WK4A 2ATLA 3ER9B 2R8JA 4DL3A 1JROA 3BZKA 4QWCA 5DEDA 2JZBB 4NY8A 5CP2A 1T7PA 2JEIA 4JV1A 2IUBA 1NK6A 4F71A 4QW9A 4AYBF 1QQ6A 2QB0B 3TARA 5ALMA 2VA8A 1AROP 1N5XA 2PMZC 5KFWA 1Q8KA 2IOHA 3N7PD 2W9BA 4UB3A 5DQIA 2OEHA 2ZIUB 5AM0A 4E8FA 2MUTA 4R8UA 4CDGA 9ICQA 3HPOA 3OUYA 1M6YA 3NVOA 3H7IA 4DOAA 3N7RC 1JN3A 4C4SA 5IIMA 3NGDA 4RQ0A 2BZFA 1T3NA 1LV5A 5AHXA 2HHXA 4GLXA 2DKZA 2KICA 4US8A 3SAFA 2AGOA 5KFAA 4FHYA 1JMSA 2YY6A 4I2HA 2W03A 8ICFA 3A0BU 3LDAA 4DL4A 8ICYA 5ALDA 3SZ2A 5D62A 5ALWA 1FFVA 4JUZA 3FDSA 1VFGA 4RWPA 1ZQFA 4KM5A 1BPDA 4YR3A 2HBKA 5KAFU 2Q66A 1QCKA 3JYYA 4ECSA 3D2SA 4QIWC 3M9NB 1JI7A 4FS1A 2DPJA 3I76A 3WK9A 4DSEA 5AKGA 5DB6A 4K96A 1KTQA 3NVZA 2XGPA 1U9LA 3WK5A 3H4DA 2HDOA 2P6UA 1RM6C 2ISPA 4J9PA 2KG5A 3GQCA 2VA2A 5KFYA 1V4AA 5D63A 4DFKA 2HBLA 4KLGA 3V7JA 4YXMA 3L9DA 3BJYA 1D9DA 4WC0A 1SB3C 5H2FU 2K60A 3T79A 3ORYA 1SZHA 2EZYA 3G6VA 4OAHA 2ZJ8A 3SV3A 2DKXA 5IILA 3I1YA 9ICKA 3WKAA 2HN1A 4RQ7A 5D49A 2ZTDA 4LEVA 4PHAA 3E2EA 5L1KA 5CHEA 2DRAA 8ICCA 2UVWA 3RJIA 1SXDA 1R8CA 4DFDA 2KHVA 4F4ZA 3AUOA 4BWMA 2DR8A 3RFAA 2ZHBA 3JPQA 4EZ6A 1J97A 3UXNA 4F5QA 3C28A 1ZQHA 3OWGA 4QZ9A 1QH9A 4KN4A 3N7SC 4JV0A 1L3SA 3Q8MA 1JRPA 3R9KA 4ATBA 3RRHA 5J0RA 3NTUA 5G5GA 1SGGA 4CGZA 5KG1A 3IP4B 2LI6A 1PVPA 2E8MA 4O0IA 4I2AA 2GA9D 1ECWA 1U48A 4YP3A 2B4VA 4NXUA 1PK1A 2MU2A 2F44A 1X6IA 4MFFA 1XC9A 5KG4A 2OM6A 5JU5A 3TFRA 5HHHA 4O5KA 4P0QA 1NO5A 3SEIA 9ICGA 1RYUA 2NRKA 1N5WA 5J2KA 3IG5A 4PPXA 3KFUF 5AKEA 2QB1A 2FI1A 1NK4A 1O03A 3JPPA 4CRXA 9ICBA 5ALXA 3MDAA 4AT7A 5DDMA 4YMMA 2BR0A 5B3QA 2HHSA 1ZJMA 4OJ6A 3QU5A 4NWIA 3HP6A 2C2EA 2ASJA 2NRXA 1TFWA 1KN5A 4YR0A 1ZQMA 3BQTA 4YVZA 2KN7A 2PXIA 1X9XA 2JHDA 4YCXA 1XSNA 2K4IA 4NXTA 1EXNA 2B21A 5F2VO 1LVHA 4UAZA 1SV0A 4DQSA 4Q8FA 5ALZA 1A77A 4OJOA 3TADA 4LEWA 4O68A 5J0TA 3Q8LA 1L8LA 5DBAA 4UAYA 5CFSA 5L1MA 3PX0A 2KZZA 2KFNA 2WAQF 5CWRA 2WF8A 3L4PA 3TAPA 5AKIA 4DL5A 4ICAA 2BDPA 2W43A 3QNMA 3LQCB 1SWWA 2PFOA 4DQQA 3U26A 3ZDDA 2WFAA 3SI8A 2JEGA 4RNMA 1F5SA 2G08A 3FAHA 2XGQA 4I0UA 4WOYA 1HUOA 3L3FX 5DB7A 1KLNA 1S8OA 2ZIXA 4F4XA 4KLHA 1SKRA 1ED1A 4KN7A 4NL9C 4OCZA 4X4VA 5BOLA 3AQKA 2LYBA 4R63A 2PI5A 3CYMA 4J9NA 4PZNA 3RR7A 7ICKA 1SXEA 4ED1A 3GIKA 2Y0SF 3ZD8A 2BKEA 3K75D 1VDVA 4PL1A 3Q8RB 1MQ2A 4WQLA 1RPLA 2QARB 2Y9UA 5KFRA 1MA7A 5HR6A 2O5AA 5DBBA 4DL7A 1S9FA 2PFNA 5KL1B 2XY7A 4DQRA 3H0MB 1S0NA 2OCEA 3C1YA 4O69A 4LEZA 4RUAA 1OUQA 4DOCA 1ZQBA 4Z6DA 4KLSA 4RZRA 2MRLA 4AT9A 4XQ8A 4FO6A 3KHGA 4RWOA 2DQNB 2K89A 4ED6A 4DSLA 5EE0A 3EUB2 3JCFA 2EWRA 3TANA 2LHTA 3QEAZ 4K9AA 5CFUA 3M8SA 2BQRA 4N7RA 5AICA 1N62A 4EYHB 1PUZA 2BDUA 8ICSA 3H38A 4FZLA 2FPLA 3GIJA 4NLBA 4ED7A 3KTQA 5GTIU 5AM3A 1URJA 4X0BA 4HX0A 2ODGA 2W11A 4ECYA 1ZQEA 4EELA 4DSKA 3RBDA 2WAQC 1WG8A 2E5SA 3QZ7A 1ZRMA 3HIYA 2ZH3A 3MR6A 2C2RA 5ALVA 5AI9A 1NKEA 1D9FA 4C8NA 2ZG6A 3LYSA 3MGVA 4Z6EA 4YFKA 4UB6U 3HJ1A 3AMZA 5EE9A 1BPXA 2ISOA 4QZGA 4WC4A 5KFUA 2HHPA 1XSLA 3QU4A 2BBHA 5KFTA 3HW8A 3PHZA 5J8YC 4F50A 1KNYA 2DFLA 4NL9A 2LBOA 1YLQA 1B0XA 9ICJA 2D3DA 2KVCA 4FE3A 3QU2A 4LVSA 8ICJA 4OJPA 4B9TA 1ZQYA 9ICXA 3SAGA 7ICTA 2RQ5A 4ECXA 4EBJA 3GV5B 4KLTA 1ZOLA 3A0HU 4QWBA 3TACB 1ZYQA 3NUQA 3QU9A 1S5LU 4I2EA 2FE9A 2R8GA 5DLFA 5ALNA 1XSPA 2FMPA 5IIIA 5KNIA 1F44A 2B0CA 2KSOB 1VLBA 1N56A 1NJYA 4C8MA 5ALSA 8ICEA 4NKUA 1DGSA 4WC2A 4FZNA 4F5RA 1Q3UA 5L1IA 1QSLA 1WCLA 5HRBA 1L3VA 1SZPA 1NOMA 4GXJA 4RNNA 3D2NA 2DGZA 2W7PA 1U4BA 2BBJA 4RQ8A 3RJHA 5F9NA 2IHNA 3CP8A 3E58A 4UATA 1ZD5A 3SAHA 5DB9A 4M9LA 1FO4A 4Y2QA 4DSIA 9ICPA 2ZHAA 4JMUA 5KT6A 3PR5B 5HRIA 1Z1BA 4UBCA 3H3AA 5A0LA 1T94A 5KFFA 1LKYB 2JR5A 3MGHA 2KJ5A 5ALPA 2V4QA 3AU2A 3RTVA 1S0VA 5AM2A 3N4MB 2W04A 3SD7A 1K5OA 1ZQGA 5AK3A 3BDPA 5F9LA 1A0PA 1BGXT 4ECRA 4K97A 2G06A 2I6XA 3T5LA 3OV7A 5J8YA 3EF2A 1UA0A 2AXTU 2NRVA 4K4IA 2R8HA 5DDYA 2BE3A 3RJFA 2RFFA 1S10A 2Y1IA 1ZQNA 2AHOB 2M9NA 4GC6A 1JALA 4HYKA 3KBBA 2YB1A 5KG6A 4QZDA 2HOFA 4P0PA 2WF9A 2EAMA 5FP0A 3WKCA 4KLJA 4F2SA 1X40A 2F2AB 7ICLA 5DGBA 7ICUA 2DR9A 3AN1A 5IIJA 4CF5A 8ICTA 1PVQA 8ICGA 2FPMA 1JIHA 1IV8A 8ICRA 3ICXA 1CEZA 2AQ4A 4YN4A 3H8JA 1L6NA 3ISDA 4PH5A 4Y2VA 2IMWP 1IXRA 3PSFA 1RXWA 4DSFA 4J9MA 1TAUA 1ZQWA 4KLOA 4PL2A 1Q79A 3MFIA 4FO1A 4UBBA 2E1EA 4Y2XA 4ECQA 1HUZA 1L3UA 1TFYA 4M6WA 4C80A 1C20A 4RT2A 2HHQA 4DQPA 5HMLA 1N60A 1IG6A 1OXJA 4FBTA 3NRWA 5AI4A 4BDPA 5HP4A 2Z7JA 2K8CB 3OVBA 4O3NA 4B9UA 5CRXA 1X9WA 4ECTA 3ERCC 2R8KA 1JAJA 4C7YA 1ZETA 2JH1A 4NM2A 3Q8KA 7ICNA 5J2IA 2PFPA 1T4GA 2A3VA 3V7LA 3WU2U 4A8EA 3PV8A 2PFQA 9ICTA 3NVWA 1U49A 4OAFA 1S97A 1ZQSA 1RYRA 2EDUA 2YQEA 4P4OA 3B0XA 4QNLA 2I5HA 4Q8EA 2KKVA 5CR0A 1TVAA 2DBYA 2ZH7A 4NJ8A 1KL9A 4RU9A 5KFZA 4NLGA 1SWVA 3EWAA 3F53A 3B0YA 1ZQAA 4QZCA 2HMXA 4EYIB 8ICVA 1ZQTA 1AQ6A 1ZQIA 3HRDD 1FIQA 3PW5A 1ZQJA 4NLNA 1FEZA 3OSPA 4R64A 4O9MA 5G5HA 2OWOA 3H0LB 2IOFK 2AGQA 1QLNA 4B6JA 3EZ5A 5ALKA 4Q45A 5AIAA 4M9HA 5T14A 2G5IB 2NO4A 8ICWA 4FBUA 5C0YA 4MKPA 3AQNA 4X4NA 4TQRA 4RWNA 5JTIA 3PNCA 4X0AA 4XUSA 5KFCA 2A1JA 1O08A 2J6UA 1Z4NA 4M04A 4X4SA 4IS7A 9ICCA 4WC1A 2HHWA 4QWEA 3OHAA 3IM1A 2J6TA 5J0YA 3BS5A 3V7KA 4K98A 1NK7A 3EYZA 4EBCA 2WTFA 4NLZA 2EAPA 1N61A 1Z00A 2NRZA 4I27A 1JXEA 3QYPA 5HNKA 4G3IA 4Y2JA 1N2XA 2BQUA 4B9LA 4AT8A 3ISBA 5KFHA 2ID1A 2KJ9A 2L5YA 2ZIWB 1QQ5A 3TAQA 2JEJA 3G6XA 3PO4A 2J6SA 5ALUA 3BS7A 5JRTA 4X4UA 5HRKA 7ICVA 1K1SA 2KMDA 1SL0A 4YQWA 3GV8B 2WB1F 3OJSA 1TK5A 2HBJA 4QZFA 2LYAA 1ZXIA 2DF4B 5AKYA 1SV0C 4Z6FA 2YMMA 3TADC 2DUYA 5J0QA 4M9NA 2KZMA 3EPIA 2HCFA 1NK0A 1WWUA 4K8VA 2K4EA 2KV2A 4GIBA 4UB4A 7ICFA 2DL0A 1U47A 3Q8QB 3C66A 5AI6A 2GO7A 4IQWA 2CRXA 3UPSA 2YN4A 2ZTCA 3H8WA 4C8KA 3IG8A 3PW2A 4GXKA 8ICMA 3RJKA 5KFVA 2ZUCA 3C5FA 4EEKA 3ZDCA 4R65A 3NVVA 5IIOA 4BWJA 1KDHA 2KEYA 3RH5A 2E8PA 1F0MA 2KJ8A 3SENA 4PGXA 2YX8A 4O3RA 4DS4A 4RQ1A 1BPZA 1V9PA 2UVVA 2IHOA 4UB1A 3UQ0A 2W9BB 4OAGA 4RQ5A 3JZ0A 3MR3A 1UHUA 4YD1A 2HBMA 4UQGA 3QEBZ 2XIDA 4S3NA 1HEKA 2MUTB 2W8KA 4R8UB 4TUPA 2AH5A 3H4BA 2FMSA 3F2CA 1B4FA 2W3RA 4TUQA 1YZ6A 4X4TA 2HHVA 5DB8A 3PSIA 2LM4A 2ZUDA 5DBCA 2W7OA 2Q0ZX 4NV0A 3RH4A 3KD3A 4RQ6A 4KLUA 3ISCA 1QTMA 3LK9A 3PMLA 4DO9A 2WB1C 3GDXA 4LT6A 2FDRA 3BZCA 4WBYA 5DECA 1CI4A 5HREA 2F76X 3LWMA 3RB4A 2E3TA 4FFDA 4DQIA 1VJ7A 3C23A 3H37A 1R8AA 4DL6A 3NYBA 1PVRA 4KLDA 4YXJA 1UPHA 2FLPA 2KVSA 1Q3VA 4JLXA 4IQTA 4UASA 4LEYA 5CB1A 3GIMA 3UXOA 2IBKA 1IIPA 3UQ2A 4G9BA 4Q43A 3PZPA 2P35A 3WKEA 4K4GA 1Q78A 3QXGA 1RXVA 5KG3A 4XRHA 3F2BA 4Y2UA 7ICPA 4FHXA 2HHTA 2KSOA 3K7DA 1L8OA 3BQ2A 1UT5A 4KLFA 5EE1A 4O67A 4UD5A 4ELTA 2E8OA 9ICFA 3MGIA 2JRZA 5J0UA 3F2DA 1GPJA 3K1RB 5J0PA 5KFGA 1BPBA 5KFSA 8ICZA 5J2GA 2VA3A 1UCVA 5AKKA 3RAXA 1SV4A 2VJ5A 5J0OA 2IHMA 2BCVA 1NJZA 5HHIA 5IIKA 5AI5A 3CNHA 4JB3A 8ICAA 9ICSA 8ICQA 1JQRA 5AK4A 5L1JA 2NYVA 2KNJA 4KX5A 2G09A 1TK0A 2ZIVA 3QU7A 3RB3A 5B66U 4IC9A 1ZQOA 5AM5A 2KHQA 4RPYA 3KZIU 1DRGA 1KKXA 4EEBA 7ICSA 2ZH1A 1X9SA 2WHEA 4WC3A 1NJXA 5KFOA 5J2HA 4MHVA 4DCCA 3JPOA 8ICUA 2M0NA 3ETLA 2FLLA 4BXOB 3DV9A 5EWGA 2EZXA 1WCNA 4UB5A 4MFCA 3CW2C 4ATBB 2BCSA 5AKZA 5CEHA 5AI8A 4PGQA 4MEYA 5DQGA 4PZOA 4F4WA 5AIBA 1HJPA 3Q8SB 2AGPA 9ICHA 2A19A 2N1RA 1HIWA 4F5OA 9ICLA 1TV9A 1V85A 1PK1B 1B43A 4M9GA 3RJGA 4O3MA 4ACOA 2F3NA 2HSZA 5ALYA 2AJQA 1J2NA 4P0QB 2W9CA 1SL2A 3IDWA 5ALIA 4QZ8A 5J2JA 1ZQRA 4IQVA 5HRLA 2F1JA 1JUDA 1KEJA 4B9NA 4AP9A 4AT7B 2F1HA 1KSPA 1A76A 3AQMA 1B22A 5HR7A 1FA0A 7ICEA 4EBDA 5KFMA 5B5EU 2P66A 3C21A 1ZRNA 1TAQA 2VKQA 3AL0B 3WFOA 3BQ1A 3ER8C 3MR5A 4KLMA 4K99A 1BPYA 4UAVA 1K1QA 3RAQA 5KT2A 1V38A 4EEDA 3PW7A 2BGWA 4DF8A 3TKAA 2LKYA 5KT5A 2UVUA 4P2HA 3GFKB 2YTUA 3K4GA 4MFAA 3RB6A 7ICMA 4RQ4A 1TK8A 1KFDA 2WF6A 4OAIZ 1DOQA 3F5EA 4CCHA 2WF5A 1QSYA 4M5DA 5AKXA 1TKDA 3E0FA 3ZD9A 5KFEA 5EE3A 2JZBA 2FJ6A 2ZIXB 2XO7A 5HRFA 3OGUA 3GIIA 4RQNA 3MBYA 1NJWA 3TQ1A 2QB0A 3KKAA 3OVAA 1COOA 1Y88A 5CJ7A 2M2TA 2RDIA 4F4YA 3N28A 4IR1A 2GLEA 3M9MB 3AU6A 4J9QA 4F91B 2FLNA 4FHPA 4UW9A 4ZH4A 4Q44A 4KMOB 2R8IA 5HR9A 2RLTA 2ZIUA 1PK3A 3C2LA 4I2JA 3RBEA 3T3FA 4P4MA 3NKUA 5CFTA 8ICLA 4I2IA 2XI9A 2LYHA 3D6JA 1NZBA 1X2IA 4O3OA 3THVA 2YMLA 5TISU 4AT9B 3H0RB 5DG8A 2GAFD 4DOBA 4KMUA 4WC6A 3UPQA 2MAXA 3WFSC 7ICJA 3LVWA 5ALJA 3FM9A 5HRHA 4LJXA 4EEYA 1Z3EB 5AK5A 3SR6A 4E7XA 2W8LA 4IR9A 4XJEA 3N97B 2LPEA 2O1PA 4WBZA 4K4HA 3ED5A 5KG7A 1H38A 3RJEA 7ICGA 4ED3A 1SKSA 1RG6A 2M2VA 4B9VA 5KFIA 4WQKA 4JK1A 3T5KA 2F1IA 8ICOA 9ICOA 4PHDA 1IM4A 1ZQLA 1Z19A 3UXPA 2ZJ5A 4UB2A 2C2DA 4RQMA 3ETRA 4M47A 2RRDA 3SMVA 1CRXA 5L1LA 5AI0A 5KFKA 9ICAA 1UEVA 4I2FA 4RPZA 4J9SA 1T3QA 4ED8A 1DXSA 5J29A 4B9MA 3KOOA 2IOFA 2E8NA 1BVSA 1SL1A 7ICQA 1JXLA 4J9LA 4OJ5A 3M6KA 3OVSA 2Y1JA 2FMQA 2JXJA 1L3TA 1U45A 3OJUA 2XY5A 5KFQA 4PGYA 4M0AA 4KX3A 2KIVA 2ZH6A 3LWLA 3V6KA 2NO5A 3WFPA 1UA1A 2NV3A 3PX6A 5J2BA 1ZQQA 8ICBA 9ICUA 5D4BA 3PSTA 1N48A 5ALTA 4EBKA 4O3SA 3VCBA 4UD4A 1T8EA 2HW3A 1GO3F 4JV2A 1ZJNA 4FH3A 1V97A 4BGDA 2ALZA 3IHQB 2F8KA 4X4PA 2ZH8A 8ICXA 1OU5A 2FCLA 2K8AA 2M2WA 4NLCA 4IQUA 1X9MA 4YMNA 3IN5A 1UETA 3AM9A 3TI0A 4R66A 1KW4A 5KTQA 3B9JA 2YB4A 1NI3A 3PY8A 2F77X 3PX4A 2WF7A 5KFLA 3HT3A 1S0MA 4JLZA 4WH5A 4CF4A 5AM4A 3ZDBA 5ALGA 4ED2A 3K1ZA 2ZH4A 2BPCA 4XQ7A 2DVIA 4C8LA 2H3QA 4TURA 2R18A 4QZAA 1ZQUA 1D8BA 3SQIA 4RUCA 1DK2A 5KG2A 1S77D 1D8YA 2JEFA 3T5JA 5J0SA 2ZJAA 1WWVA
chains in the Genus database with same CATH topology
4TUPA 4ECYA 3H4BA 1ZQEA 4RT3A 4DSKA 2FMSA 7ICRA 1UEUA 4QZHA 2AQ0A 2XY6A 3RBDA 2V9WA 1NKCA 5DG7A 3C5GA 3Q8PB 4MF2A 4TUQA 4KTQA 3H8SA 1SKWA 1R8BA 4X4TA 5J2EA 2HHVA 3QZ7A 5DB8A 2BPGA 5KT7A 2ZUDA 3HIYA 5DBCA 2ZH3A 5EOZA 3MR6A 1TFRA 2C2RA 4GXIA 2DR7A 1UT8A 2Q0ZX 3RH4A 4RQ6A 5J2DA 1NKEA 1D9FA 4C8NA 4KLUA 3GV7B 2FPKA 4J9KA 3ISCA 2ASDA 4I2BA 1QTMA 4Z6EA 3EPGA 3FYHA 4YFKA 4NM1A 3LK9A 3HJ1A 2PBEA 3PMLA 1BPXA 2ISOA 1XU4A 4DO9A 3H39A 4QZGA 4MF8A 1C7YA 3JPTA 5KFUA 4IRDA 4O5EA 4E80A 4WC4A 4WC7A 2HHPA 1ZQCA 5HRGA 4J9OA 3GDXA 1XSLA 3MDCA 4EZ9A 4KLLA 3HJ4A 3PW4A 4LT6A 4WBYA 5DECA 5KFTA 3HW8A 3WFQE 5HREA 2W9CB 4F50A 3LWMA 2DFLA 3RB4A 4QZIA 4F5PA 4DQIA 1KNYA 1VJ7A 4O3QA 3C23A 1YLQA 3H37A 1R8AA 4DL6A 3NYBA 3T5HA 4YXJA 4YR2A 1LB2B 1S0OA 4KLDA 9ICJA 3H40A 2FLPA 4YG2A 4IQTA 5CB1A 3GIMA 3UXOA 2IBKA 8ICJA 4LVSA 3MFHA 3UQ2A 4Q43A 2NRWA 4I2DA 4RPXA 5HMMA 4DF4A 4M2YA 1RYSA 1ZQYA 4B9TA 3JPRA 8ICKA 4DFJA 7ICTA 4ECXA 9ICXA 4EBJA 3GV5B 4K4GA 4QWAA 3RB0A 4KLTA 4B9SA 4F8RA 2HVHA 8ICIA 1Q78A 1RXVA 4QWBA 2DPIA 2ZTEA 5KG3A 4XRHA 1ZYQA 2XCPA 4YMOA 4F5NA 4I2EA 7ICPA 7ICIA 2ZH5A 4FHXA 2V4RA 2R8GA 2HHTA 1XWLA 3C2MA 5DLFA 1XSPA 3BQ2A 1UT5A 2FMPA 2W9AA 4DL2A 3PVXA 3RH6A 4KLFA 9ICWA 5IIIA 9ICMA 4X4OA 4NXZA 5CA7A 1N56A 7ICOA 1DK3A 2BCUA 4ELTA 4UD5A 1NJYA 4C8MA 1NKBA 8ICEA 9ICFA 3MGIA 4NKUA 1BNOA 1DGSA 5J0UA 4WC2A 4M6WB 4F5RA 5D46A 5L1IA 1QSLA 1WCLA 5J0PA 5KFGA 3QZ8A 3M9OB 1BPBA 5HRBA 5KFSA 4ED0A 1L3VA 2IA6A 1SZPA 4O3PA 8ICZA 1NOMA 4GXJA 4RNNA 5J2GA 9ICIA 2VA3A 3RAXA 4XA5A 4ELVA 3MR2A 1S76D 5J0OA 1U4BA 3RRGA 2HVIA 1ZQXA 4ECWA 2IHMA 2BCVA 3V72A 1NJZA 5HHIA 4TQSA 2DR5A 4RQ8A 3RJHA 5IIKA 4ECZA 5F9NA 2ATLA 2IHNA 4DSJA 4GC7A 2R8JA 4DL3A 8ICAA 9ICSA 5DB9A 2RDJA 4M9LA 8ICQA 1KFTA 1JQRA 5L1JA 4QWCA 1RZTA 1NK9A 5KFXA 5DEDA 3MABA 4DSIA 2JZBB 4NY8A 5CP2A 1T7PA 5KFBA 4F2RA 2JEIA 8ICPA 4EP7A 9ICPA 2ZHAA 5KT6A 4JV1A 1MQ3A 1TK0A 1NK6A 3PR5B 5HRIA 4ELUA 3H3AA 4UBCA 4QW9A 4DLEA 5KFFA 5J0XA 1PZNA 3RB3A 1ZQOA 3TARA 4RPYA 2VA8A 1AROP 3MGHA 1KFSA 2V4QA 4FHVA 3AU2A 3RTVA 2ASLA 1S0VA 5KFWA 4BXOA 7ICSA 2ZH1A 4O5CA 1X9SA 3N4MB 4WC3A 1NJXA 5KFOA 5J2HA 2W9BA 4UB3A 1ZQGA 3JPOA 5DQIA 8ICUA 1BNPA 3ETLA 1ZQPA 2FLLA 3BDPA 4BXOB 4E8FA 1BPEA 2MUTA 4R8UA 2H5XA 5EWGA 5F9LA 3HPOA 1BGXT 9ICQA 3OUYA 4ECRA 1WCNA 4UB5A 3JPSA 4MFCA 3AQLA 4ATBB 2DRBA 3H7IA 2KZ3A 2BCSA 3T5LA 3OV7A 4PGQA 4MEYA 4DOAA 5DQGA 1JN3A 3OUYB 5IIMA 4F4WA 1UA0A 4LZGA 2NRVA 1HJPA 4K4IA 2R8HA 2KFZA 3NGDA 5DDYA 4RQ0A 4DEZA 4I2CA 3Q8SB 2BE3A 4KLQA 4FH5A 2W9MA 1T3NA 2AGPA 1LV5A 3RJFA 4TUSA 9ICHA 2RFFA 2HHXA 4GLXA 1S10A 2I1QA 2Y1IA 1ZQNA 4F5OA 2AGOA 7ICHA 9ICLA 5KFAA 4FHYA 2M9NA 1JMSA 1TV9A 4GC6A 4I2HA 4HYKA 4F3OA 8ICFA 3LDAA 4DL4A 8ICYA 5KG6A 5KT3A 1B43A 4P4PA 3RJGA 4I2GA 4QZDA 3SZ2A 4M9GA 4X0AA 5DGAA 4DS5A 2AJQA 4JUZA 4KLJA 3M8RA 3FDSA 3BQ0A 4UAWA 4F2SA 1VFGA 2W9CA 7ICLA 4RWPA 5DGBA 1SL2A 1ZQFA 7ICUA 2DR9A 4QZEA 1BPDA 4QZ8A 4YR3A 2Q66A 5IIJA 4IRKA 8ICTA 4ECSA 5J2JA 3JYYA 4X4QA 8ICGA 3M9NB 4FS1A 3SV4A 2DPJA 2FPMA 1JIHA 2A1JB 1ZQRA 4IQVA 5HRLA 2F1JA 1KEJA 4DSEA 4B9NA 8ICRA 1CEZA 1PX5A 2AQ4A 2GWSA 4YN4A 4AT7B 2F1HA 3H8JA 5DB6A 1ZQKA 4NKTA 3ISDA 1KSPA 2M2UA 1A76A 1KTQA 4PH5A 2XGPA 2HHUA 3AQMA 1U9LA 3H4DA 1B22A 2P6UA 2IMWP 1FA0A 2ISPA 7ICEA 1IXRA 1MC8A 5KFMA 3ZDEA 4EBDA 4J9PA 4DSFA 1RXWA 2P66A 9ICNA 4FHWA 4QZBA 3C21A 4J9MA 1ZQWA 3RJJA 1TAQA 4E0DA 4KLOA 1TAUA 9ICVA 1Q79A 4F93B 3MFIA 3GQCA 3WFOA 4UBBA 3BQ1A 1Z00B 4I29A 3MR5A 3G6YA 2VA2A 5KFYA 4JWNA 1V4AA 4KLMA 4ECQA 1HUZA 4MEXA 1MIYA 1L3UA 3ZDAA 1TFYA 4DFKA 1BPYA 1NK8A 4M6WA 4KLGA 5J2FA 3HX0A 1K1QA 4RT2A 3V7JA 5KT2A 3RAQA 2HHQA 4YXMA 4DQPA 4NLKA 5HMLA 1R89A 3L9DA 4AT8B 3BJYA 2AU0A 2BCQA 3PW7A 2BGWA 4DF8A 1D9DA 4FBTA 4RWQA 4WC0A 4BDPA 5KT5A 2UVUA 4P2HA 3GFKB 4MFAA 3K4GA 5HP4A 3RB6A 7ICMA 3OVBA 4O3NA 1CUKA 4B9UA 4RQ4A 4ECTA 3ORYA 1X9WA 3C2KA 2R8KA 4ECUA 1JAJA 1TK8A 3G6VA 1KFDA 3KHHA 2ZJ8A 3SV3A 4DWIA 1DOQA 5EWFA 5IILA 9ICKA 5KFNA 4ECVA 1ZETA 4CCHA 4NM2A 1QSYA 4RQ7A 5D49A 4M9JA 4M5DA 1TKDA 1L5UA 3Q8KA 2ZTDA 3ZD9A 7ICNA 4PHAA 5J2IA 2PFPA 1T4GA 4IG8A 5KFEA 3E2EA 5L1KA 2DRAA 8ICCA 2UVWA 1NK5A 3V7LA 2JZBA 3RJIA 3JPNA 4J9RA 3PV8A 2PFQA 9ICTA 1R8CA 1U49A 4F4ZA 1QSSA 4RNOA 2XO7A 4X0BA 3AUOA 5HRFA 4BWMA 3OGUA 3GIIA 2DR8A 2ZHBA 1S97A 1ZQSA 3JPQA 3MBYA 1RYRA 4EZ6A 1NJWA 3TQ1A 2BPFA 3UXNA 4P4OA 3B0XA 3OVAA 1COOA 1Y88A 5CJ7A 1ZQVA 2M2TA 2RDIA 4F5QA 4F4YA 1ZQDA 4KLEA 4IR1A 5J0WA 4Q8EA 5DQHA 3M9MB 5CR0A 3AU6A 3PO5A 4J9QA 4F91B 2FLNA 1ZQHA 1TVAA 4QZ9A 4FHPA 4JWMA 4WCWA 2ZH2A 4ZH4A 4KN4A 5J2AA 4Q44A 2XCAA 2ZH7A 2R8IA 5HR9A 2NRTA 4JV0A 5JUMA 4EBEA 4Z6CA 1L3SA 3C2LA 3Q8MA 4I2JA 4RU9A 3RBEA 3T3FA 4I28A 5KFZA 4P4MA 3RR8A 4NLGA 4ATBA 2P6RA 3EWAA 3RRHA 3B0YA 1ZQAA 4QZCA 5J0RA 1MIWA 3NTUA 4PHPA 2C28A 4EYIB 4I2IA 8ICVA 8ICLA 1ZQTA 2LYHA 1ZQIA 1X2IA 4O3OA 3THVA 3PW5A 5KT4A 5KG1A 4F4KA 4AT9B 1ZQJA 4NLNA 5DG8A 3OSPA 3KHRA 4R64A 4O9MA 4DOBA 4KMUA 4WC6A 4O0IA 3UPQA 2OWOA 4I2AA 5CHGA 4QW8A 4FS2A 1U48A 2MAXA 4YP3A 3QE9Y 3WFSC 7ICJA 5HRDA 2AGQA 1QLNA 4DLGA 1ZQZA 4MFFA 5HRHA 1XC9A 4EEYA 3EZ5A 1Z3EB 5KG4A 4Q45A 4M9HA 3TFRA 1NZPA 5HHHA 4DFPA 4E7XA 4O5KA 2BCRA 1NO5A 8ICWA 2W8LA 4IR9A 4FBUA 3N97B 9ICGA 2O1PA 3AQNA 4X4NA 4TQRA 4WBZA 4K4HA 2NRKA 4RWNA 5KG7A 3PNCA 5J2KA 3TFSA 2VANA 4PPXA 5TZVA 1H38A 3RJEA 4XUSA 5KFCA 7ICGA 4DFMA 5IINA 2A1JA 4ED3A 1NK4A 3JPPA 2J6UA 1SKSA 4M04A 4X4SA 9ICBA 2M2VA 4B9VA 5KFIA 3MDAA 8ICHA 9ICCA 4AT7A 5DDMA 4YMMA 2BR0A 4JK1A 3OHBA 5C5JA 3T5KA 2HHSA 4PHEA 3V6HA 2F1IA 1ZJMA 2HHWA 4KLIA 8ICOA 4QWEA 3OHAA 9ICOA 4PHDA 3HP6A 2C2EA 2ASJA 3IM1A 2NRXA 1TFWA 1IM4A 4YR0A 1ZQLA 1ZQMA 2J6TA 3BQTA 4YVZA 5J0YA 3UXPA 2ZJ5A 4F92B 4UB2A 3V7KA 1NK7A 2KN7A 1XO1A 3EYZA 2PXIA 4EBCA 2C2DA 4YCXA 4M47A 3C18A 2WTFA 1XSNA 5KFJA 1EXNA 2B21A 5L1LA 4NLZA 5F2VO 4UAZA 1Z00A 5KFKA 9ICAA 2NRZA 4DQSA 4Q8FA 1UEVA 4I2FA 1A77A 3C1ZA 4RPZA 4J9SA 5BPCA 1JXEA 4I27A 4ED8A 5KFDA 5J29A 5J0TA 2XC9A 3Q8LA 4B9MA 5DBAA 4UAYA 2KZZA 3PX0A 2KP7A 5HNKA 8ICNA 4G3IA 2KFNA 2BQUA 5CWRA 4B9LA 3TAPA 4AT8A 1BVSA 1SL1A 7ICQA 3ISBA 5KFHA 4J9LA 3V6JA 1JXLA 2ID1A 3OVSA 5DG9A 2Y1JA 4DL5A 3TAQA 2JEJA 3G6XA 2FMQA 3PO4A 2J6SA 2BDPA 3LQCB 1L3TA 1U45A 3OJUA 2XY5A 4DQQA 2PFOA 5KFQA 4X4UA 3ZDDA 2ZUBA 4PGYA 4M0AA 7ICVA 5HRKA 1K1SA 2ZH6A 3SI8A 1KRPA 2BHNA 3LWLA 1SL0A 4YQWA 2JEGA 2PI4A 5DKWA 3V6KA 3WFPA 4RNMA 1UA1A 3GV8B 1ZQQA 3PX6A 5J2BA 4WC5A 2XGQA 3OJSA 3PW0A 1TK5A 8ICBA 5KFPA 9ICUA 5D4BA 4RQ2A 4QZFA 3HWTA 1N48A 1HUOA 5DB7A 1KLNA 4LZDA 4Z6FA 1D8LA 4F4XA 4KLHA 4O3SA 4RQ3A 4EBKA 5J0QA 1SKRA 4M9NA 2KZMA 4KN7A 3SYZA 4X4VA 4UD4A 5BOLA 1T8EA 4JV2A 2HW3A 3AQKA 4X4RA 3EPIA 1ZJNA 4R63A 3EW9A 1NK0A 4FH3A 2PI5A 4BGDA 4J9NA 2ALZA 3IHQB 4X4PA 3RR7A 7ICKA 4ED1A 2ZH8A 2UVRA 8ICXA 4UB4A 1WOTA 3GIKA 3ZD8A 4X5VA 1OU5A 2BKEA 3PMNA 7ICFA 3K75D 5HC9A 3Q8RB 2M2WA 1U47A 1MQ2A 1RPLA 5KFRA 4KITB 4IQUA 3OSNA 3Q8QB 1MIVA 3C66A 1X9MA 4YMNA 1F5AA 5KG0A 1UETA 4IQWA 2O5AA 2ZH9A 4C8OA 5DBBA 4DL7A 1S9FA 3TI0A 3H8WA 2ZTCA 2PFNA 4R66A 3UPSA 2XY7A 4DQRA 4C8KA 9ICEA 5KG5A 1XS9D 1S0NA 1MSWD 3PW2A 5KTQA 5DLGA 3C1YA 4GXKA 4RUAA 5J2CA 3PY8A 8ICMA 4DOCA 1ZQBA 4Z6DA 3PX4A 1S0MA 5KFLA 3HT3A 3RJKA 4IRCA 5KFVA 4RZRA 4KLSA 2ZUCA 1JX4A 3C5FA 4XQ8A 4AT9A 3ZDCA 4FO6A 3KHGA 3ZDBA 4RWOA 2C22A 4ED2A 4ED6A 4R65A 4DSLA 2ZH4A 2BPCA 5L9XA 5BOMA 4WC1A 2BQ3A 4XQ7A 2DVIA 3WFRE 5IIOA 4BWJA 3TANA 3QEAZ 3RH5A 1KDHA 4TURA 4C8LA 4PGXA 3M8SA 2BQRA 4DS4A 4O3RA 4QZAA 4RQ1A 1ZQUA 4RUCA 4EYHB 8ICSA 5KG2A 1BPZA 1DK2A 3H38A 1V9PA 1S77D 2UVVA 2KTQA 2FPLA 4UB1A 3GIJA 4QWDA 3UQ0A 3GILA 1D8YA 2JEFA 4YD2A 2W9BB 3T5JA 4ED7A 3KTQA 4RQ5A 3PR4A 3JZ0A 5J0SA 3KHLA 3MR3A 9ICRA 2I9GA 2ZJAA 4YD1A 4UQGA 3QEBZ 4S3NA 5EWEA 2MUTB 2W8KA 4R8UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TUP A;  4ECY A;  3H4B A;  1ZQE A;  4RT3 A;  4DSK A;  2FMS A;  7ICR A;  1UEU A;  4QZH A;  2AQ0 A;  2XY6 A;  3RBD A;  2V9W A;  1NKC A;  5DG7 A;  3C5G A;  3Q8P B;  4MF2 A;  4TUQ A;  4KTQ A;  3H8S A;  1SKW A;  1R8B A;  4X4T A;  5J2E A;  2HHV A;  3QZ7 A;  5DB8 A;  2BPG A;  5KT7 A;  2ZUD A;  3HIY A;  5DBC A;  2ZH3 A;  5EOZ A;  3MR6 A;  1TFR A;  2C2R A;  4GXI A;  2DR7 A;  1UT8 A;  2Q0Z X;  3RH4 A;  4RQ6 A;  5J2D A;  1NKE A;  1D9F A;  4C8N A;  4KLU A;  3GV7 B;  2FPK A;  4J9K A;  3ISC A;  2ASD A;  4I2B A;  1QTM A;  4Z6E A;  3EPG A;  3FYH A;  4YFK A;  4NM1 A;  3LK9 A;  3HJ1 A;  2PBE A;  3PML A;  1BPX A;  2ISO A;  1XU4 A;  4DO9 A;  3H39 A;  4QZG A;  4MF8 A;  1C7Y A;  3JPT A;  5KFU A;  4IRD A;  4O5E A;  4E80 A;  4WC4 A;  4WC7 A;  2HHP A;  1ZQC A;  5HRG A;  4J9O A;  3GDX A;  1XSL A;  3MDC A;  4EZ9 A;  4KLL A;  3HJ4 A;  3PW4 A;  4LT6 A;  4WBY A;  5DEC A;  5KFT A;  3HW8 A;  3WFQ E;  5HRE A;  2W9C B;  4F50 A;  3LWM A;  2DFL A;  3RB4 A;  4QZI A;  4F5P A;  4DQI A;  1KNY A;  1VJ7 A;  4O3Q A;  3C23 A;  1YLQ A;  3H37 A;  1R8A A;  4DL6 A;  3NYB A;  3T5H A;  4YXJ A;  4YR2 A;  1LB2 B;  1S0O A;  4KLD A;  9ICJ A;  3H40 A;  2FLP A;  4YG2 A;  4IQT A;  5CB1 A;  3GIM A;  3UXO A;  2IBK A;  8ICJ A;  4LVS A;  3MFH A;  3UQ2 A;  4Q43 A;  2NRW A;  4I2D A;  4RPX A;  5HMM A;  4DF4 A;  4M2Y A;  1RYS A;  1ZQY A;  4B9T A;  3JPR A;  8ICK A;  4DFJ A;  7ICT A;  4ECX A;  9ICX A;  4EBJ A;  3GV5 B;  4K4G A;  4QWA A;  3RB0 A;  4KLT A;  4B9S A;  4F8R A;  2HVH A;  8ICI A;  1Q78 A;  1RXV A;  4QWB A;  2DPI A;  2ZTE A;  5KG3 A;  4XRH A;  1ZYQ A;  2XCP A;  4YMO A;  4F5N A;  4I2E A;  7ICP A;  7ICI A;  2ZH5 A;  4FHX A;  2V4R A;  2R8G A;  2HHT A;  1XWL A;  3C2M A;  5DLF A;  1XSP A;  3BQ2 A;  1UT5 A;  2FMP A;  2W9A A;  4DL2 A;  3PVX A;  3RH6 A;  4KLF A;  9ICW A;  5III A;  9ICM A;  4X4O A;  4NXZ A;  5CA7 A;  1N56 A;  7ICO A;  1DK3 A;  2BCU A;  4ELT A;  4UD5 A;  1NJY A;  4C8M A;  1NKB A;  8ICE A;  9ICF A;  3MGI A;  4NKU A;  1BNO A;  1DGS A;  5J0U A;  4WC2 A;  4M6W B;  4F5R A;  5D46 A;  5L1I A;  1QSL A;  1WCL A;  5J0P A;  5KFG A;  3QZ8 A;  3M9O B;  1BPB A;  5HRB A;  5KFS A;  4ED0 A;  1L3V A;  2IA6 A;  1SZP A;  4O3P A;  8ICZ A;  1NOM A;  4GXJ A;  4RNN A;  5J2G A;  9ICI A;  2VA3 A;  3RAX A;  4XA5 A;  4ELV A;  3MR2 A;  1S76 D;  5J0O A;  1U4B A;  3RRG A;  2HVI A;  1ZQX A;  4ECW A;  2IHM A;  2BCV A;  3V72 A;  1NJZ A;  5HHI A;  4TQS A;  2DR5 A;  4RQ8 A;  3RJH A;  5IIK A;  4ECZ A;  5F9N A;  2ATL A;  2IHN A;  4DSJ A;  4GC7 A;  2R8J A;  4DL3 A;  8ICA A;  9ICS A;  5DB9 A;  2RDJ A;  4M9L A;  8ICQ A;  1KFT A;  1JQR A;  5L1J A;  4QWC A;  1RZT A;  1NK9 A;  5KFX A;  5DED A;  3MAB A;  4DSI A;  2JZB B;  4NY8 A;  5CP2 A;  1T7P A;  5KFB A;  4F2R A;  2JEI A;  8ICP A;  4EP7 A;  9ICP A;  2ZHA A;  5KT6 A;  4JV1 A;  1MQ3 A;  1TK0 A;  1NK6 A;  3PR5 B;  5HRI A;  4ELU A;  3H3A A;  4UBC A;  4QW9 A;  4DLE A;  5KFF A;  5J0X A;  1PZN A;  3RB3 A;  1ZQO A;  3TAR A;  4RPY A;  2VA8 A;  1ARO P;  3MGH A;  1KFS A;  2V4Q A;  4FHV A;  3AU2 A;  3RTV A;  2ASL A;  1S0V A;  5KFW A;  4BXO A;  7ICS A;  2ZH1 A;  4O5C A;  1X9S A;  3N4M B;  4WC3 A;  1NJX A;  5KFO A;  5J2H A;  2W9B A;  4UB3 A;  1ZQG A;  3JPO A;  5DQI A;  8ICU A;  1BNP A;  3ETL A;  1ZQP A;  2FLL A;  3BDP A;  4BXO B;  4E8F A;  1BPE A;  2MUT A;  4R8U A;  2H5X A;  5EWG A;  5F9L A;  3HPO A;  1BGX T;  9ICQ A;  3OUY A;  4ECR A;  1WCN A;  4UB5 A;  3JPS A;  4MFC A;  3AQL A;  4ATB B;  2DRB A;  3H7I A;  2KZ3 A;  2BCS A;  3T5L A;  3OV7 A;  4PGQ A;  4MEY A;  4DOA A;  5DQG A;  1JN3 A;  3OUY B;  5IIM A;  4F4W A;  1UA0 A;  4LZG A;  2NRV A;  1HJP A;  4K4I A;  2R8H A;  2KFZ A;  3NGD A;  5DDY A;  4RQ0 A;  4DEZ A;  4I2C A;  3Q8S B;  2BE3 A;  4KLQ A;  4FH5 A;  2W9M A;  1T3N A;  2AGP A;  1LV5 A;  3RJF A;  4TUS A;  9ICH A;  2RFF A;  2HHX A;  4GLX A;  1S10 A;  2I1Q A;  2Y1I A;  1ZQN A;  4F5O A;  2AGO A;  7ICH A;  9ICL A;  5KFA A;  4FHY A;  2M9N A;  1JMS A;  1TV9 A;  4GC6 A;  4I2H A;  4HYK A;  4F3O A;  8ICF A;  3LDA A;  4DL4 A;  8ICY A;  5KG6 A;  5KT3 A;  1B43 A;  4P4P A;  3RJG A;  4I2G A;  4QZD A;  3SZ2 A;  4M9G A;  4X0A A;  5DGA A;  4DS5 A;  2AJQ A;  4JUZ A;  4KLJ A;  3M8R A;  3FDS A;  3BQ0 A;  4UAW A;  4F2S A;  1VFG A;  2W9C A;  7ICL A;  4RWP A;  5DGB A;  1SL2 A;  1ZQF A;  7ICU A;  2DR9 A;  4QZE A;  1BPD A;  4QZ8 A;  4YR3 A;  2Q66 A;  5IIJ A;  4IRK A;  8ICT A;  4ECS A;  5J2J A;  3JYY A;  4X4Q A;  8ICG A;  3M9N B;  4FS1 A;  3SV4 A;  2DPJ A;  2FPM A;  1JIH A;  2A1J B;  1ZQR A;  4IQV A;  5HRL A;  2F1J A;  1KEJ A;  4DSE A;  4B9N A;  8ICR A;  1CEZ A;  1PX5 A;  2AQ4 A;  2GWS A;  4YN4 A;  4AT7 B;  2F1H A;  3H8J A;  5DB6 A;  1ZQK A;  4NKT A;  3ISD A;  1KSP A;  2M2U A;  1A76 A;  1KTQ A;  4PH5 A;  2XGP A;  2HHU A;  3AQM A;  1U9L A;  3H4D A;  1B22 A;  2P6U A;  2IMW P;  1FA0 A;  2ISP A;  7ICE A;  1IXR A;  1MC8 A;  5KFM A;  3ZDE A;  4EBD A;  4J9P A;  4DSF A;  1RXW A;  2P66 A;  9ICN A;  4FHW A;  4QZB A;  3C21 A;  4J9M A;  1ZQW A;  3RJJ A;  1TAQ A;  4E0D A;  4KLO A;  1TAU A;  9ICV A;  1Q79 A;  4F93 B;  3MFI A;  3GQC A;  3WFO A;  4UBB A;  3BQ1 A;  1Z00 B;  4I29 A;  3MR5 A;  3G6Y A;  2VA2 A;  5KFY A;  4JWN A;  1V4A A;  4KLM A;  4ECQ A;  1HUZ A;  4MEX A;  1MIY A;  1L3U A;  3ZDA A;  1TFY A;  4DFK A;  1BPY A;  1NK8 A;  4M6W A;  4KLG A;  5J2F A;  3HX0 A;  1K1Q A;  4RT2 A;  3V7J A;  5KT2 A;  3RAQ A;  2HHQ A;  4YXM A;  4DQP A;  4NLK A;  5HML A;  1R89 A;  3L9D A;  4AT8 B;  3BJY A;  2AU0 A;  2BCQ A;  3PW7 A;  2BGW A;  4DF8 A;  1D9D A;  4FBT A;  4RWQ A;  4WC0 A;  4BDP A;  5KT5 A;  2UVU A;  4P2H A;  3GFK B;  4MFA A;  3K4G A;  5HP4 A;  3RB6 A;  7ICM A;  3OVB A;  4O3N A;  1CUK A;  4B9U A;  4RQ4 A;  4ECT A;  3ORY A;  1X9W A;  3C2K A;  2R8K A;  4ECU A;  1JAJ A;  1TK8 A;  3G6V A;  1KFD A;  3KHH A;  2ZJ8 A;  3SV3 A;  4DWI A;  1DOQ A;  5EWF A;  5IIL A;  9ICK A;  5KFN A;  4ECV A;  1ZET A;  4CCH A;  4NM2 A;  1QSY A;  4RQ7 A;  5D49 A;  4M9J A;  4M5D A;  1TKD A;  1L5U A;  3Q8K A;  2ZTD A;  3ZD9 A;  7ICN A;  4PHA A;  5J2I A;  2PFP A;  1T4G A;  4IG8 A;  5KFE A;  3E2E A;  5L1K A;  2DRA A;  8ICC A;  2UVW A;  1NK5 A;  3V7L A;  2JZB A;  3RJI A;  3JPN A;  4J9R A;  3PV8 A;  2PFQ A;  9ICT A;  1R8C A;  1U49 A;  4F4Z A;  1QSS A;  4RNO A;  2XO7 A;  4X0B A;  3AUO A;  5HRF A;  4BWM A;  3OGU A;  3GII A;  2DR8 A;  2ZHB A;  1S97 A;  1ZQS A;  3JPQ A;  3MBY A;  1RYR A;  4EZ6 A;  1NJW A;  3TQ1 A;  2BPF A;  3UXN A;  4P4O A;  3B0X A;  3OVA A;  1COO A;  1Y88 A;  5CJ7 A;  1ZQV A;  2M2T A;  2RDI A;  4F5Q A;  4F4Y A;  1ZQD A;  4KLE A;  4IR1 A;  5J0W A;  4Q8E A;  5DQH A;  3M9M B;  5CR0 A;  3AU6 A;  3PO5 A;  4J9Q A;  4F91 B;  2FLN A;  1ZQH A;  1TVA A;  4QZ9 A;  4FHP A;  4JWM A;  4WCW A;  2ZH2 A;  4ZH4 A;  4KN4 A;  5J2A A;  4Q44 A;  2XCA A;  2ZH7 A;  2R8I A;  5HR9 A;  2NRT A;  4JV0 A;  5JUM A;  4EBE A;  4Z6C A;  1L3S A;  3C2L A;  3Q8M A;  4I2J A;  4RU9 A;  3RBE A;  3T3F A;  4I28 A;  5KFZ A;  4P4M A;  3RR8 A;  4NLG A;  4ATB A;  2P6R A;  3EWA A;  3RRH A;  3B0Y A;  1ZQA A;  4QZC A;  5J0R A;  1MIW A;  3NTU A;  4PHP A;  2C28 A;  4EYI B;  4I2I A;  8ICV A;  8ICL A;  1ZQT A;  2LYH A;  1ZQI A;  1X2I A;  4O3O A;  3THV A;  3PW5 A;  5KT4 A;  5KG1 A;  4F4K A;  4AT9 B;  1ZQJ A;  4NLN A;  5DG8 A;  3OSP A;  3KHR A;  4R64 A;  4O9M A;  4DOB A;  4KMU A;  4WC6 A;  4O0I A;  3UPQ A;  2OWO A;  4I2A A;  5CHG A;  4QW8 A;  4FS2 A;  1U48 A;  2MAX A;  4YP3 A;  3QE9 Y;  3WFS C;  7ICJ A;  5HRD A;  2AGQ A;  1QLN A;  4DLG A;  1ZQZ A;  4MFF A;  5HRH A;  1XC9 A;  4EEY A;  3EZ5 A;  1Z3E B;  5KG4 A;  4Q45 A;  4M9H A;  3TFR A;  1NZP A;  5HHH A;  4DFP A;  4E7X A;  4O5K A;  2BCR A;  1NO5 A;  8ICW A;  2W8L A;  4IR9 A;  4FBU A;  3N97 B;  9ICG A;  2O1P A;  3AQN A;  4X4N A;  4TQR A;  4WBZ A;  4K4H A;  2NRK A;  4RWN A;  5KG7 A;  3PNC A;  5J2K A;  3TFS A;  2VAN A;  4PPX A;  5TZV A;  1H38 A;  3RJE A;  4XUS A;  5KFC A;  7ICG A;  4DFM A;  5IIN A;  2A1J A;  4ED3 A;  1NK4 A;  3JPP A;  2J6U A;  1SKS A;  4M04 A;  4X4S A;  9ICB A;  2M2V A;  4B9V A;  5KFI A;  3MDA A;  8ICH A;  9ICC A;  4AT7 A;  5DDM A;  4YMM A;  2BR0 A;  4JK1 A;  3OHB A;  5C5J A;  3T5K A;  2HHS A;  4PHE A;  3V6H A;  2F1I A;  1ZJM A;  2HHW A;  4KLI A;  8ICO A;  4QWE A;  3OHA A;  9ICO A;  4PHD A;  3HP6 A;  2C2E A;  2ASJ A;  3IM1 A;  2NRX A;  1TFW A;  1IM4 A;  4YR0 A;  1ZQL A;  1ZQM A;  2J6T A;  3BQT A;  4YVZ A;  5J0Y A;  3UXP A;  2ZJ5 A;  4F92 B;  4UB2 A;  3V7K A;  1NK7 A;  2KN7 A;  1XO1 A;  3EYZ A;  2PXI A;  4EBC A;  2C2D A;  4YCX A;  4M47 A;  3C18 A;  2WTF A;  1XSN A;  5KFJ A;  1EXN A;  2B21 A;  5L1L A;  4NLZ A;  5F2V O;  4UAZ A;  1Z00 A;  5KFK A;  9ICA A;  2NRZ A;  4DQS A;  4Q8F A;  1UEV A;  4I2F A;  1A77 A;  3C1Z A;  4RPZ A;  4J9S A;  5BPC A;  1JXE A;  4I27 A;  4ED8 A;  5KFD A;  5J29 A;  5J0T A;  2XC9 A;  3Q8L A;  4B9M A;  5DBA A;  4UAY A;  2KZZ A;  3PX0 A;  2KP7 A;  5HNK A;  8ICN A;  4G3I A;  2KFN A;  2BQU A;  5CWR A;  4B9L A;  3TAP A;  4AT8 A;  1BVS A;  1SL1 A;  7ICQ A;  3ISB A;  5KFH A;  4J9L A;  3V6J A;  1JXL A;  2ID1 A;  3OVS A;  5DG9 A;  2Y1J A;  4DL5 A;  3TAQ A;  2JEJ A;  3G6X A;  2FMQ A;  3PO4 A;  2J6S A;  2BDP A;  3LQC B;  1L3T A;  1U45 A;  3OJU A;  2XY5 A;  4DQQ A;  2PFO A;  5KFQ A;  4X4U A;  3ZDD A;  2ZUB A;  4PGY A;  4M0A A;  7ICV A;  5HRK A;  1K1S A;  2ZH6 A;  3SI8 A;  1KRP A;  2BHN A;  3LWL A;  1SL0 A;  4YQW A;  2JEG A;  2PI4 A;  5DKW A;  3V6K A;  3WFP A;  4RNM A;  1UA1 A;  3GV8 B;  1ZQQ A;  3PX6 A;  5J2B A;  4WC5 A;  2XGQ A;  3OJS A;  3PW0 A;  1TK5 A;  8ICB A;  5KFP A;  9ICU A;  5D4B A;  4RQ2 A;  4QZF A;  3HWT A;  1N48 A;  1HUO A;  5DB7 A;  1KLN A;  4LZD A;  4Z6F A;  1D8L A;  4F4X A;  4KLH A;  4O3S A;  4RQ3 A;  4EBK A;  5J0Q A;  1SKR A;  4M9N A;  2KZM A;  4KN7 A;  3SYZ A;  4X4V A;  4UD4 A;  5BOL A;  1T8E A;  4JV2 A;  2HW3 A;  3AQK A;  4X4R A;  3EPI A;  1ZJN A;  4R63 A;  3EW9 A;  1NK0 A;  4FH3 A;  2PI5 A;  4BGD A;  4J9N A;  2ALZ A;  3IHQ B;  4X4P A;  3RR7 A;  7ICK A;  4ED1 A;  2ZH8 A;  2UVR A;  8ICX A;  4UB4 A;  1WOT A;  3GIK A;  3ZD8 A;  4X5V A;  1OU5 A;  2BKE A;  3PMN A;  7ICF A;  3K75 D;  5HC9 A;  3Q8R B;  2M2W A;  1U47 A;  1MQ2 A;  1RPL A;  5KFR A;  4KIT B;  4IQU A;  3OSN A;  3Q8Q B;  1MIV A;  3C66 A;  1X9M A;  4YMN A;  1F5A A;  5KG0 A;  1UET A;  4IQW A;  2O5A A;  2ZH9 A;  4C8O A;  5DBB A;  4DL7 A;  1S9F A;  3TI0 A;  3H8W A;  2ZTC A;  2PFN A;  4R66 A;  3UPS A;  2XY7 A;  4DQR A;  4C8K A;  9ICE A;  5KG5 A;  1XS9 D;  1S0N A;  1MSW D;  3PW2 A;  5KTQ A;  5DLG A;  3C1Y A;  4GXK A;  4RUA A;  5J2C A;  3PY8 A;  8ICM A;  4DOC A;  1ZQB A;  4Z6D A;  3PX4 A;  1S0M A;  5KFL A;  3HT3 A;  3RJK A;  4IRC A;  5KFV A;  4RZR A;  4KLS A;  2ZUC A;  1JX4 A;  3C5F A;  4XQ8 A;  4AT9 A;  3ZDC A;  4FO6 A;  3KHG A;  3ZDB A;  4RWO A;  2C22 A;  4ED2 A;  4ED6 A;  4R65 A;  4DSL A;  2ZH4 A;  2BPC A;  5L9X A;  5BOM A;  4WC1 A;  2BQ3 A;  4XQ7 A;  2DVI A;  3WFR E;  5IIO A;  4BWJ A;  3TAN A;  3QEA Z;  3RH5 A;  1KDH A;  4TUR A;  4C8L A;  4PGX A;  3M8S A;  2BQR A;  4DS4 A;  4O3R A;  4QZA A;  4RQ1 A;  1ZQU A;  4RUC A;  4EYH B;  8ICS A;  5KG2 A;  1BPZ A;  1DK2 A;  3H38 A;  1V9P A;  1S77 D;  2UVV A;  2KTQ A;  2FPL A;  4UB1 A;  3GIJ A;  4QWD A;  3UQ0 A;  3GIL A;  1D8Y A;  2JEF A;  4YD2 A;  2W9B B;  3T5J A;  4ED7 A;  3KTQ A;  4RQ5 A;  3PR4 A;  3JZ0 A;  5J0S A;  3KHL A;  3MR3 A;  9ICR A;  2I9G A;  2ZJA A;  4YD1 A;  4UQG A;  3QEB Z;  4S3N A;  5EWE A;  2MUT B;  2W8K A;  4R8U B; 
#chains in the Genus database with same CATH topology
 1OW5 A;  1X6J A;  1UEU A;  1COK A;  4J03 A;  2XY6 A;  1RQL A;  1NKC A;  3C5G A;  1SKW A;  1R8B A;  3RF9 A;  1Z1V A;  2QLT A;  5EOZ A;  1TFR A;  3FC4 A;  4GXI A;  2B56 A;  1UT8 A;  4US9 A;  5ALQ A;  3GV7 B;  3EPG A;  4NM1 A;  3HIL A;  4UAR A;  2PBE A;  3H39 A;  1XU4 A;  4P0P B;  4WC7 A;  4O5E A;  5HRG A;  4J9O A;  3MDC A;  4KLL A;  2RHF A;  3H8M A;  3O0F A;  2KE7 A;  3T5H A;  1LB2 B;  2GH1 A;  4YG2 A;  3J81 j;  2ES6 A;  1RDF A;  2G07 A;  3WK7 A;  3HKZ F;  4M2Y A;  2NRW A;  4RPX A;  5ALH A;  5AKJ A;  4BX9 C;  4DF4 A;  3JPR A;  8ICK A;  1J2M A;  2HVH A;  4F8R A;  8ICI A;  2DPI A;  3MC1 A;  4YMO A;  4F72 A;  2ZH5 A;  4DL2 A;  3PVX A;  3RH6 A;  4Y2Y A;  9ICM A;  2Q4T A;  4NXZ A;  7ICO A;  1FFU A;  2BCU A;  2JV3 A;  4OO1 J;  4M6W B;  4AYB C;  2IA6 A;  4OJL A;  1P7D A;  2QAR A;  2RP5 A;  9ICI A;  1L7O A;  4EX7 A;  3RRG A;  1ZQX A;  2D8C A;  1L7P A;  4ECW A;  2W54 A;  2DR5 A;  4ECZ A;  4WJ3 B;  4DSJ A;  3VC8 A;  4GC7 A;  2RDJ A;  1KFT A;  1NK9 A;  1RZT A;  5KFX A;  3MAB A;  8ICP A;  5KFB A;  4F2R A;  1ZD3 A;  2HI0 A;  2CN1 A;  4EP7 A;  1YZ7 A;  2EH9 A;  4UB8 U;  1MQ3 A;  4ZOH C;  4ELU A;  5AM1 A;  4DLE A;  5J0X A;  1PZN A;  4QJF B;  2F8L A;  1KFS A;  2OHF A;  3QUB A;  4FHV A;  2ASL A;  4BXO A;  2H3F A;  4O5C A;  3OPX A;  2LMR A;  1BNP A;  4UAU A;  3ONN A;  1ZQP A;  1BPE A;  2H5X A;  3S6J A;  3JPS A;  3AQL A;  2KZ3 A;  5ALE A;  3OUY B;  4CNQ A;  4GFJ A;  3WK8 A;  4LZG A;  3NS1 A;  2KFZ A;  4DEZ A;  4I2C A;  4KLQ A;  4FH5 A;  2W9M A;  3NRZ A;  2K4H A;  2YMQ A;  2GOL A;  4TUS A;  4EX6 A;  2I1Q A;  3DEE A;  7ICH A;  2VJ4 A;  3HKZ C;  3OTQ A;  3F5A A;  4F3O A;  2EAO A;  2JMG A;  5KT3 A;  4P4P A;  4I2G A;  3UMG A;  5DGA A;  4DS5 A;  1KQQ A;  3M8R A;  3BQ0 A;  4UAW A;  4U6P A;  1RQN A;  4IRK A;  2ZXI A;  5K4L A;  2MSN A;  3SV4 A;  2A1J B;  1PX5 A;  2GWS A;  4NKT A;  1ZQK A;  2M2U A;  3ALR A;  2HHU A;  3UM9 A;  1ZD4 A;  3C29 A;  1MC8 A;  4FHW A;  3ZDE A;  9ICN A;  3BS5 B;  4QZB A;  9ICV A;  4E0D A;  3RJJ A;  2KK0 A;  4F93 B;  2EZZ A;  4Y2T A;  4I29 A;  1Z00 B;  3G6Y A;  3NAS A;  4JWN A;  4MEX A;  1MIY A;  3ZDA A;  1NK8 A;  2JGA A;  5J2F A;  3HX0 A;  2B6G A;  4NLK A;  1R89 A;  3I28 A;  4AT8 B;  2W55 A;  2AU0 A;  2BCQ A;  4RWQ A;  3AQF A;  2OH2 A;  3QX7 A;  1CUK A;  2PKE A;  3C2K A;  4ECU A;  3KHH A;  5ALL A;  4DWI A;  3CK6 A;  5EWF A;  5KFN A;  5AKH A;  4ECV A;  4M9J A;  1L5U A;  3WKB A;  4IG8 A;  1NK5 A;  4IL6 U;  2KOB A;  3JPN A;  4J9R A;  1TE2 A;  1SIJ A;  1QSS A;  4RNO A;  3LVV A;  1N63 A;  1LKY A;  2OYY A;  2CXY A;  2XVT A;  2BPF A;  1ZQV A;  1ZQD A;  4KLE A;  5J0W A;  5DQH A;  3PO5 A;  5ALR A;  2H3V A;  4JWM A;  2ZH2 A;  5J2A A;  2XCA A;  2VIX A;  2NRT A;  5JUM A;  4EBE A;  4Z6C A;  2KD1 A;  4I28 A;  4U7C A;  3RR8 A;  2P6R A;  5ALF A;  1MIW A;  4PHP A;  2C28 A;  1XO0 A;  5KT4 A;  4F4K A;  3KHR A;  3M1Y A;  5CHG A;  4QW8 A;  4FS2 A;  4NXW A;  3KKA C;  3QE9 Y;  5HRD A;  4DLG A;  1ZQZ A;  1WUD A;  4EEN A;  3UMC A;  1WYG A;  1NZP A;  5KAI U;  4DFP A;  3WKD A;  2EAN A;  2BCR A;  3DDH A;  1DGJ A;  4BUG A;  2QKQ A;  1NNL A;  3TFS A;  2VAN A;  2ESE A;  5TZV A;  2H3Z A;  2DRB A;  3M6Z A;  4DFM A;  5IIN A;  3L5K A;  3KZX A;  8ICH A;  4BJQ A;  2KKP A;  3OHB A;  5C5J A;  4PHE A;  3V6H A;  4KLI A;  4EGW A;  2D6F C;  3AQE A;  1XNS A;  4F92 B;  1XO1 A;  3C18 A;  5KFJ A;  1YT3 A;  2G5H B;  2DWQ A;  3NVY A;  4WCW A;  3C1Z A;  5BPC A;  5KFD A;  4CE6 A;  5B3P A;  2XC9 A;  1X42 A;  2KP7 A;  8ICN A;  3V6J A;  3AEV A;  3ZI4 A;  5DG9 A;  2Y0S C;  5D61 A;  1L7N A;  3PSP A;  2ZUB A;  1KRP A;  2BHN A;  2HN2 A;  2PI4 A;  5DKW A;  4K9B A;  4WC5 A;  1QQ7 A;  3D2Q A;  3PW0 A;  5KFP A;  4RQ2 A;  3HWT A;  1Z4O A;  2YMP A;  4LZD A;  1D8L A;  4RQ3 A;  1X66 A;  4Y2P A;  3SYZ A;  4NXX A;  3GZF A;  4USA A;  4X4R A;  3EW9 A;  2ZXH A;  2UVR A;  1WOT A;  4X5V A;  3PMN A;  5HC9 A;  4HAI A;  4Y2S A;  4KIT B;  1MIV A;  3OSN A;  1Q46 A;  1F5A A;  5KG0 A;  2ZH9 A;  4C8O A;  2LM1 A;  4C4R A;  9ICE A;  5KG5 A;  1XS9 D;  1MSW D;  2MA1 A;  2EQY A;  5DLG A;  2HOQ A;  4C4T A;  5J2C A;  1ZD2 P;  5E79 U;  4IRC A;  5F3X B;  3GU3 A;  1JX4 A;  2C22 A;  3NWI A;  3HJE A;  5L9X A;  5BOM A;  4Y2R A;  2BQ3 A;  2O6K A;  4CF3 A;  3WFR E;  2ZIV B;  3QUQ A;  1VJ5 A;  1ZQ1 C;  3IV6 A;  3IRU A;  2KTQ A;  1TAM A;  4QWD A;  3GIL A;  4YD2 A;  3PR4 A;  3KHL A;  9ICR A;  2I9G A;  3MCR A;  4QZE A;  5EWE A;  1A6S A;  4KB6 A;  4NXV A;  4RT3 A;  7ICR A;  4QZH A;  2AQ0 A;  2V9W A;  5ALO A;  2JH7 A;  5DG7 A;  3Q8P B;  4MF2 A;  4KTQ A;  3H8S A;  5GTH U;  5J2E A;  3QUT A;  2BPG A;  5KT7 A;  2PMZ F;  5KL8 B;  3CRX A;  2DR7 A;  2Y9T A;  2XIC A;  5J2D A;  1MN8 A;  2HOI A;  4J9K A;  2FPK A;  2ASD A;  4I2B A;  3UMB A;  3FYH A;  4FZM A;  1UQV A;  5JTG A;  4MF8 A;  1C7Y A;  3JPT A;  4IRD A;  4E80 A;  3M7D A;  1ZQC A;  4C7Z A;  3BQ7 A;  4EZ9 A;  3HJ4 A;  3PW4 A;  3WFQ E;  2W9C B;  2A1A A;  4QZI A;  4F5P A;  4O3Q A;  2W3S A;  2ZIW A;  4YR2 A;  1S0O A;  4C0Z A;  5AK6 A;  3WK6 A;  3H40 A;  2B51 A;  2K4P A;  3MFH A;  2KIW A;  4I2D A;  5HMM A;  1RYS A;  4EV6 A;  2G0A A;  2H3I A;  4DFJ A;  4X4Q A;  4QWA A;  3RB0 A;  4B9S A;  4OD0 A;  1KBU A;  2ZTE A;  2OXO A;  2XCP A;  4F5N A;  7ICI A;  2V4R A;  1XWL A;  3QUC A;  4PJ0 U;  3C2M A;  9ICW A;  1L7M A;  2W9A A;  4X4O A;  5CA7 A;  4O6A A;  1DK3 A;  5AKL A;  1NKB A;  4QIW F;  1BNO A;  5D46 A;  3QZ8 A;  3M9O B;  2K8B B;  4ED0 A;  4O3P A;  2E1F A;  4XA5 A;  4ELV A;  3MR2 A;  1S76 D;  2CPR A;  2HVI A;  3V72 A;  4TQS A;  3WK4 A;  2ATL A;  3ER9 B;  2R8J A;  4DL3 A;  1JRO A;  3BZK A;  4QWC A;  5DED A;  2JZB B;  4NY8 A;  5CP2 A;  1T7P A;  2JEI A;  4JV1 A;  2IUB A;  1NK6 A;  4F71 A;  4QW9 A;  4AYB F;  1QQ6 A;  2QB0 B;  3TAR A;  5ALM A;  2VA8 A;  1ARO P;  1N5X A;  2PMZ C;  5KFW A;  1Q8K A;  2IOH A;  3N7P D;  2W9B A;  4UB3 A;  5DQI A;  2OEH A;  2ZIU B;  5AM0 A;  4E8F A;  2MUT A;  4R8U A;  4CDG A;  9ICQ A;  3HPO A;  3OUY A;  1M6Y A;  3NVO A;  3H7I A;  4DOA A;  3N7R C;  1JN3 A;  4C4S A;  5IIM A;  3NGD A;  4RQ0 A;  2BZF A;  1T3N A;  1LV5 A;  5AHX A;  2HHX A;  4GLX A;  2DKZ A;  2KIC A;  4US8 A;  3SAF A;  2AGO A;  5KFA A;  4FHY A;  1JMS A;  2YY6 A;  4I2H A;  2W03 A;  8ICF A;  3A0B U;  3LDA A;  4DL4 A;  8ICY A;  5ALD A;  3SZ2 A;  5D62 A;  5ALW A;  1FFV A;  4JUZ A;  3FDS A;  1VFG A;  4RWP A;  1ZQF A;  4KM5 A;  1BPD A;  4YR3 A;  2HBK A;  5KAF U;  2Q66 A;  1QCK A;  3JYY A;  4ECS A;  3D2S A;  4QIW C;  3M9N B;  1JI7 A;  4FS1 A;  2DPJ A;  3I76 A;  3WK9 A;  4DSE A;  5AKG A;  5DB6 A;  4K96 A;  1KTQ A;  3NVZ A;  2XGP A;  1U9L A;  3WK5 A;  3H4D A;  2HDO A;  2P6U A;  1RM6 C;  2ISP A;  4J9P A;  2KG5 A;  3GQC A;  2VA2 A;  5KFY A;  1V4A A;  5D63 A;  4DFK A;  2HBL A;  4KLG A;  3V7J A;  4YXM A;  3L9D A;  3BJY A;  1D9D A;  4WC0 A;  1SB3 C;  5H2F U;  2K60 A;  3T79 A;  3ORY A;  1SZH A;  2EZY A;  3G6V A;  4OAH A;  2ZJ8 A;  3SV3 A;  2DKX A;  5IIL A;  3I1Y A;  9ICK A;  3WKA A;  2HN1 A;  4RQ7 A;  5D49 A;  2ZTD A;  4LEV A;  4PHA A;  3E2E A;  5L1K A;  5CHE A;  2DRA A;  8ICC A;  2UVW A;  3RJI A;  1SXD A;  1R8C A;  4DFD A;  2KHV A;  4F4Z A;  3AUO A;  4BWM A;  2DR8 A;  3RFA A;  2ZHB A;  3JPQ A;  4EZ6 A;  1J97 A;  3UXN A;  4F5Q A;  3C28 A;  1ZQH A;  3OWG A;  4QZ9 A;  1QH9 A;  4KN4 A;  3N7S C;  4JV0 A;  1L3S A;  3Q8M A;  1JRP A;  3R9K A;  4ATB A;  3RRH A;  5J0R A;  3NTU A;  5G5G A;  1SGG A;  4CGZ A;  5KG1 A;  3IP4 B;  2LI6 A;  1PVP A;  2E8M A;  4O0I A;  4I2A A;  2GA9 D;  1ECW A;  1U48 A;  4YP3 A;  2B4V A;  4NXU A;  1PK1 A;  2MU2 A;  2F44 A;  1X6I A;  4MFF A;  1XC9 A;  5KG4 A;  2OM6 A;  5JU5 A;  3TFR A;  5HHH A;  4O5K A;  4P0Q A;  1NO5 A;  3SEI A;  9ICG A;  1RYU A;  2NRK A;  1N5W A;  5J2K A;  3IG5 A;  4PPX A;  3KFU F;  5AKE A;  2QB1 A;  2FI1 A;  1NK4 A;  1O03 A;  3JPP A;  4CRX A;  9ICB A;  5ALX A;  3MDA A;  4AT7 A;  5DDM A;  4YMM A;  2BR0 A;  5B3Q A;  2HHS A;  1ZJM A;  4OJ6 A;  3QU5 A;  4NWI A;  3HP6 A;  2C2E A;  2ASJ A;  2NRX A;  1TFW A;  1KN5 A;  4YR0 A;  1ZQM A;  3BQT A;  4YVZ A;  2KN7 A;  2PXI A;  1X9X A;  2JHD A;  4YCX A;  1XSN A;  2K4I A;  4NXT A;  1EXN A;  2B21 A;  5F2V O;  1LVH A;  4UAZ A;  1SV0 A;  4DQS A;  4Q8F A;  5ALZ A;  1A77 A;  4OJO A;  3TAD A;  4LEW A;  4O68 A;  5J0T A;  3Q8L A;  1L8L A;  5DBA A;  4UAY A;  5CFS A;  5L1M A;  3PX0 A;  2KZZ A;  2KFN A;  2WAQ F;  5CWR A;  2WF8 A;  3L4P A;  3TAP A;  5AKI A;  4DL5 A;  4ICA A;  2BDP A;  2W43 A;  3QNM A;  3LQC B;  1SWW A;  2PFO A;  4DQQ A;  3U26 A;  3ZDD A;  2WFA A;  3SI8 A;  2JEG A;  4RNM A;  1F5S A;  2G08 A;  3FAH A;  2XGQ A;  4I0U A;  4WOY A;  1HUO A;  3L3F X;  5DB7 A;  1KLN A;  1S8O A;  2ZIX A;  4F4X A;  4KLH A;  1SKR A;  1ED1 A;  4KN7 A;  4NL9 C;  4OCZ A;  4X4V A;  5BOL A;  3AQK A;  2LYB A;  4R63 A;  2PI5 A;  3CYM A;  4J9N A;  4PZN A;  3RR7 A;  7ICK A;  1SXE A;  4ED1 A;  3GIK A;  2Y0S F;  3ZD8 A;  2BKE A;  3K75 D;  1VDV A;  4PL1 A;  3Q8R B;  1MQ2 A;  4WQL A;  1RPL A;  2QAR B;  2Y9U A;  5KFR A;  1MA7 A;  5HR6 A;  2O5A A;  5DBB A;  4DL7 A;  1S9F A;  2PFN A;  5KL1 B;  2XY7 A;  4DQR A;  3H0M B;  1S0N A;  2OCE A;  3C1Y A;  4O69 A;  4LEZ A;  4RUA A;  1OUQ A;  4DOC A;  1ZQB A;  4Z6D A;  4KLS A;  4RZR A;  2MRL A;  4AT9 A;  4XQ8 A;  4FO6 A;  3KHG A;  4RWO A;  2DQN B;  2K89 A;  4ED6 A;  4DSL A;  5EE0 A;  3EUB 2;  3JCF A;  2EWR A;  3TAN A;  2LHT A;  3QEA Z;  4K9A A;  5CFU A;  3M8S A;  2BQR A;  4N7R A;  5AIC A;  1N62 A;  4EYH B;  1PUZ A;  2BDU A;  8ICS A;  3H38 A;  4FZL A;  2FPL A;  3GIJ A;  4NLB A;  4ED7 A;  3KTQ A;  5GTI U;  5AM3 A;  1URJ A;  4X0B A;  4HX0 A;  2ODG A;  2W11 A;  4ECY A;  1ZQE A;  4EEL A;  4DSK A;  3RBD A;  2WAQ C;  1WG8 A;  2E5S A;  3QZ7 A;  1ZRM A;  3HIY A;  2ZH3 A;  3MR6 A;  2C2R A;  5ALV A;  5AI9 A;  1NKE A;  1D9F A;  4C8N A;  2ZG6 A;  3LYS A;  3MGV A;  4Z6E A;  4YFK A;  4UB6 U;  3HJ1 A;  3AMZ A;  5EE9 A;  1BPX A;  2ISO A;  4QZG A;  4WC4 A;  5KFU A;  2HHP A;  1XSL A;  3QU4 A;  2BBH A;  5KFT A;  3HW8 A;  3PHZ A;  5J8Y C;  4F50 A;  1KNY A;  2DFL A;  4NL9 A;  2LBO A;  1YLQ A;  1B0X A;  9ICJ A;  2D3D A;  2KVC A;  4FE3 A;  3QU2 A;  4LVS A;  8ICJ A;  4OJP A;  4B9T A;  1ZQY A;  9ICX A;  3SAG A;  7ICT A;  2RQ5 A;  4ECX A;  4EBJ A;  3GV5 B;  4KLT A;  1ZOL A;  3A0H U;  4QWB A;  3TAC B;  1ZYQ A;  3NUQ A;  3QU9 A;  1S5L U;  4I2E A;  2FE9 A;  2R8G A;  5DLF A;  5ALN A;  1XSP A;  2FMP A;  5III A;  5KNI A;  1F44 A;  2B0C A;  2KSO B;  1VLB A;  1N56 A;  1NJY A;  4C8M A;  5ALS A;  8ICE A;  4NKU A;  1DGS A;  4WC2 A;  4FZN A;  4F5R A;  1Q3U A;  5L1I A;  1QSL A;  1WCL A;  5HRB A;  1L3V A;  1SZP A;  1NOM A;  4GXJ A;  4RNN A;  3D2N A;  2DGZ A;  2W7P A;  1U4B A;  2BBJ A;  4RQ8 A;  3RJH A;  5F9N A;  2IHN A;  3CP8 A;  3E58 A;  4UAT A;  1ZD5 A;  3SAH A;  5DB9 A;  4M9L A;  1FO4 A;  4Y2Q A;  4DSI A;  9ICP A;  2ZHA A;  4JMU A;  5KT6 A;  3PR5 B;  5HRI A;  1Z1B A;  4UBC A;  3H3A A;  5A0L A;  1T94 A;  5KFF A;  1LKY B;  2JR5 A;  3MGH A;  2KJ5 A;  5ALP A;  2V4Q A;  3AU2 A;  3RTV A;  1S0V A;  5AM2 A;  3N4M B;  2W04 A;  3SD7 A;  1K5O A;  1ZQG A;  5AK3 A;  3BDP A;  5F9L A;  1A0P A;  1BGX T;  4ECR A;  4K97 A;  2G06 A;  2I6X A;  3T5L A;  3OV7 A;  5J8Y A;  3EF2 A;  1UA0 A;  2AXT U;  2NRV A;  4K4I A;  2R8H A;  5DDY A;  2BE3 A;  3RJF A;  2RFF A;  1S10 A;  2Y1I A;  1ZQN A;  2AHO B;  2M9N A;  4GC6 A;  1JAL A;  4HYK A;  3KBB A;  2YB1 A;  5KG6 A;  4QZD A;  2HOF A;  4P0P A;  2WF9 A;  2EAM A;  5FP0 A;  3WKC A;  4KLJ A;  4F2S A;  1X40 A;  2F2A B;  7ICL A;  5DGB A;  7ICU A;  2DR9 A;  3AN1 A;  5IIJ A;  4CF5 A;  8ICT A;  1PVQ A;  8ICG A;  2FPM A;  1JIH A;  1IV8 A;  8ICR A;  3ICX A;  1CEZ A;  2AQ4 A;  4YN4 A;  3H8J A;  1L6N A;  3ISD A;  4PH5 A;  4Y2V A;  2IMW P;  1IXR A;  3PSF A;  1RXW A;  4DSF A;  4J9M A;  1TAU A;  1ZQW A;  4KLO A;  4PL2 A;  1Q79 A;  3MFI A;  4FO1 A;  4UBB A;  2E1E A;  4Y2X A;  4ECQ A;  1HUZ A;  1L3U A;  1TFY A;  4M6W A;  4C80 A;  1C20 A;  4RT2 A;  2HHQ A;  4DQP A;  5HML A;  1N60 A;  1IG6 A;  1OXJ A;  4FBT A;  3NRW A;  5AI4 A;  4BDP A;  5HP4 A;  2Z7J A;  2K8C B;  3OVB A;  4O3N A;  4B9U A;  5CRX A;  1X9W A;  4ECT A;  3ERC C;  2R8K A;  1JAJ A;  4C7Y A;  1ZET A;  2JH1 A;  4NM2 A;  3Q8K A;  7ICN A;  5J2I A;  2PFP A;  1T4G A;  2A3V A;  3V7L A;  3WU2 U;  4A8E A;  3PV8 A;  2PFQ A;  9ICT A;  3NVW A;  1U49 A;  4OAF A;  1S97 A;  1ZQS A;  1RYR A;  2EDU A;  2YQE A;  4P4O A;  3B0X A;  4QNL A;  2I5H A;  4Q8E A;  2KKV A;  5CR0 A;  1TVA A;  2DBY A;  2ZH7 A;  4NJ8 A;  1KL9 A;  4RU9 A;  5KFZ A;  4NLG A;  1SWV A;  3EWA A;  3F53 A;  3B0Y A;  1ZQA A;  4QZC A;  2HMX A;  4EYI B;  8ICV A;  1ZQT A;  1AQ6 A;  1ZQI A;  3HRD D;  1FIQ A;  3PW5 A;  1ZQJ A;  4NLN A;  1FEZ A;  3OSP A;  4R64 A;  4O9M A;  5G5H A;  2OWO A;  3H0L B;  2IOF K;  2AGQ A;  1QLN A;  4B6J A;  3EZ5 A;  5ALK A;  4Q45 A;  5AIA A;  4M9H A;  5T14 A;  2G5I B;  2NO4 A;  8ICW A;  4FBU A;  5C0Y A;  4MKP A;  3AQN A;  4X4N A;  4TQR A;  4RWN A;  5JTI A;  3PNC A;  4X0A A;  4XUS A;  5KFC A;  2A1J A;  1O08 A;  2J6U A;  1Z4N A;  4M04 A;  4X4S A;  4IS7 A;  9ICC A;  4WC1 A;  2HHW A;  4QWE A;  3OHA A;  3IM1 A;  2J6T A;  5J0Y A;  3BS5 A;  3V7K A;  4K98 A;  1NK7 A;  3EYZ A;  4EBC A;  2WTF A;  4NLZ A;  2EAP A;  1N61 A;  1Z00 A;  2NRZ A;  4I27 A;  1JXE A;  3QYP A;  5HNK A;  4G3I A;  4Y2J A;  1N2X A;  2BQU A;  4B9L A;  4AT8 A;  3ISB A;  5KFH A;  2ID1 A;  2KJ9 A;  2L5Y A;  2ZIW B;  1QQ5 A;  3TAQ A;  2JEJ A;  3G6X A;  3PO4 A;  2J6S A;  5ALU A;  3BS7 A;  5JRT A;  4X4U A;  5HRK A;  7ICV A;  1K1S A;  2KMD A;  1SL0 A;  4YQW A;  3GV8 B;  2WB1 F;  3OJS A;  1TK5 A;  2HBJ A;  4QZF A;  2LYA A;  1ZXI A;  2DF4 B;  5AKY A;  1SV0 C;  4Z6F A;  2YMM A;  3TAD C;  2DUY A;  5J0Q A;  4M9N A;  2KZM A;  3EPI A;  2HCF A;  1NK0 A;  1WWU A;  4K8V A;  2K4E A;  2KV2 A;  4GIB A;  4UB4 A;  7ICF A;  2DL0 A;  1U47 A;  3Q8Q B;  3C66 A;  5AI6 A;  2GO7 A;  4IQW A;  2CRX A;  3UPS A;  2YN4 A;  2ZTC A;  3H8W A;  4C8K A;  3IG8 A;  3PW2 A;  4GXK A;  8ICM A;  3RJK A;  5KFV A;  2ZUC A;  3C5F A;  4EEK A;  3ZDC A;  4R65 A;  3NVV A;  5IIO A;  4BWJ A;  1KDH A;  2KEY A;  3RH5 A;  2E8P A;  1F0M A;  2KJ8 A;  3SEN A;  4PGX A;  2YX8 A;  4O3R A;  4DS4 A;  4RQ1 A;  1BPZ A;  1V9P A;  2UVV A;  2IHO A;  4UB1 A;  3UQ0 A;  2W9B B;  4OAG A;  4RQ5 A;  3JZ0 A;  3MR3 A;  1UHU A;  4YD1 A;  2HBM A;  4UQG A;  3QEB Z;  2XID A;  4S3N A;  1HEK A;  2MUT B;  2W8K A;  4R8U B;  4TUP A;  2AH5 A;  3H4B A;  2FMS A;  3F2C A;  1B4F A;  2W3R A;  4TUQ A;  1YZ6 A;  4X4T A;  2HHV A;  5DB8 A;  3PSI A;  2LM4 A;  2ZUD A;  5DBC A;  2W7O A;  2Q0Z X;  4NV0 A;  3RH4 A;  3KD3 A;  4RQ6 A;  4KLU A;  3ISC A;  1QTM A;  3LK9 A;  3PML A;  4DO9 A;  2WB1 C;  3GDX A;  4LT6 A;  2FDR A;  3BZC A;  4WBY A;  5DEC A;  1CI4 A;  5HRE A;  2F76 X;  3LWM A;  3RB4 A;  2E3T A;  4FFD A;  4DQI A;  1VJ7 A;  3C23 A;  3H37 A;  1R8A A;  4DL6 A;  3NYB A;  1PVR A;  4KLD A;  4YXJ A;  1UPH A;  2FLP A;  2KVS A;  1Q3V A;  4JLX A;  4IQT A;  4UAS A;  4LEY A;  5CB1 A;  3GIM A;  3UXO A;  2IBK A;  1IIP A;  3UQ2 A;  4G9B A;  4Q43 A;  3PZP A;  2P35 A;  3WKE A;  4K4G A;  1Q78 A;  3QXG A;  1RXV A;  5KG3 A;  4XRH A;  3F2B A;  4Y2U A;  7ICP A;  4FHX A;  2HHT A;  2KSO A;  3K7D A;  1L8O A;  3BQ2 A;  1UT5 A;  4KLF A;  5EE1 A;  4O67 A;  4UD5 A;  4ELT A;  2E8O A;  9ICF A;  3MGI A;  2JRZ A;  5J0U A;  3F2D A;  1GPJ A;  3K1R B;  5J0P A;  5KFG A;  1BPB A;  5KFS A;  8ICZ A;  5J2G A;  2VA3 A;  1UCV A;  5AKK A;  3RAX A;  1SV4 A;  2VJ5 A;  5J0O A;  2IHM A;  2BCV A;  1NJZ A;  5HHI A;  5IIK A;  5AI5 A;  3CNH A;  4JB3 A;  8ICA A;  9ICS A;  8ICQ A;  1JQR A;  5AK4 A;  5L1J A;  2NYV A;  2KNJ A;  4KX5 A;  2G09 A;  1TK0 A;  2ZIV A;  3QU7 A;  3RB3 A;  5B66 U;  4IC9 A;  1ZQO A;  5AM5 A;  2KHQ A;  4RPY A;  3KZI U;  1DRG A;  1KKX A;  4EEB A;  7ICS A;  2ZH1 A;  1X9S A;  2WHE A;  4WC3 A;  1NJX A;  5KFO A;  5J2H A;  4MHV A;  4DCC A;  3JPO A;  8ICU A;  2M0N A;  3ETL A;  2FLL A;  4BXO B;  3DV9 A;  5EWG A;  2EZX A;  1WCN A;  4UB5 A;  4MFC A;  3CW2 C;  4ATB B;  2BCS A;  5AKZ A;  5CEH A;  5AI8 A;  4PGQ A;  4MEY A;  5DQG A;  4PZO A;  4F4W A;  5AIB A;  1HJP A;  3Q8S B;  2AGP A;  9ICH A;  2A19 A;  2N1R A;  1HIW A;  4F5O A;  9ICL A;  1TV9 A;  1V85 A;  1PK1 B;  1B43 A;  4M9G A;  3RJG A;  4O3M A;  4ACO A;  2F3N A;  2HSZ A;  5ALY A;  2AJQ A;  1J2N A;  4P0Q B;  2W9C A;  1SL2 A;  3IDW A;  5ALI A;  4QZ8 A;  5J2J A;  1ZQR A;  4IQV A;  5HRL A;  2F1J A;  1JUD A;  1KEJ A;  4B9N A;  4AP9 A;  4AT7 B;  2F1H A;  1KSP A;  1A76 A;  3AQM A;  1B22 A;  5HR7 A;  1FA0 A;  7ICE A;  4EBD A;  5KFM A;  5B5E U;  2P66 A;  3C21 A;  1ZRN A;  1TAQ A;  2VKQ A;  3AL0 B;  3WFO A;  3BQ1 A;  3ER8 C;  3MR5 A;  4KLM A;  4K99 A;  1BPY A;  4UAV A;  1K1Q A;  3RAQ A;  5KT2 A;  1V38 A;  4EED A;  3PW7 A;  2BGW A;  4DF8 A;  3TKA A;  2LKY A;  5KT5 A;  2UVU A;  4P2H A;  3GFK B;  2YTU A;  3K4G A;  4MFA A;  3RB6 A;  7ICM A;  4RQ4 A;  1TK8 A;  1KFD A;  2WF6 A;  4OAI Z;  1DOQ A;  3F5E A;  4CCH A;  2WF5 A;  1QSY A;  4M5D A;  5AKX A;  1TKD A;  3E0F A;  3ZD9 A;  5KFE A;  5EE3 A;  2JZB A;  2FJ6 A;  2ZIX B;  2XO7 A;  5HRF A;  3OGU A;  3GII A;  4RQN A;  3MBY A;  1NJW A;  3TQ1 A;  2QB0 A;  3KKA A;  3OVA A;  1COO A;  1Y88 A;  5CJ7 A;  2M2T A;  2RDI A;  4F4Y A;  3N28 A;  4IR1 A;  2GLE A;  3M9M B;  3AU6 A;  4J9Q A;  4F91 B;  2FLN A;  4FHP A;  4UW9 A;  4ZH4 A;  4Q44 A;  4KMO B;  2R8I A;  5HR9 A;  2RLT A;  2ZIU A;  1PK3 A;  3C2L A;  4I2J A;  3RBE A;  3T3F A;  4P4M A;  3NKU A;  5CFT A;  8ICL A;  4I2I A;  2XI9 A;  2LYH A;  3D6J A;  1NZB A;  1X2I A;  4O3O A;  3THV A;  2YML A;  5TIS U;  4AT9 B;  3H0R B;  5DG8 A;  2GAF D;  4DOB A;  4KMU A;  4WC6 A;  3UPQ A;  2MAX A;  3WFS C;  7ICJ A;  3LVW A;  5ALJ A;  3FM9 A;  5HRH A;  4LJX A;  4EEY A;  1Z3E B;  5AK5 A;  3SR6 A;  4E7X A;  2W8L A;  4IR9 A;  4XJE A;  3N97 B;  2LPE A;  2O1P A;  4WBZ A;  4K4H A;  3ED5 A;  5KG7 A;  1H38 A;  3RJE A;  7ICG A;  4ED3 A;  1SKS A;  1RG6 A;  2M2V A;  4B9V A;  5KFI A;  4WQK A;  4JK1 A;  3T5K A;  2F1I A;  8ICO A;  9ICO A;  4PHD A;  1IM4 A;  1ZQL A;  1Z19 A;  3UXP A;  2ZJ5 A;  4UB2 A;  2C2D A;  4RQM A;  3ETR A;  4M47 A;  2RRD A;  3SMV A;  1CRX A;  5L1L A;  5AI0 A;  5KFK A;  9ICA A;  1UEV A;  4I2F A;  4RPZ A;  4J9S A;  1T3Q A;  4ED8 A;  1DXS A;  5J29 A;  4B9M A;  3KOO A;  2IOF A;  2E8N A;  1BVS A;  1SL1 A;  7ICQ A;  1JXL A;  4J9L A;  4OJ5 A;  3M6K A;  3OVS A;  2Y1J A;  2FMQ A;  2JXJ A;  1L3T A;  1U45 A;  3OJU A;  2XY5 A;  5KFQ A;  4PGY A;  4M0A A;  4KX3 A;  2KIV A;  2ZH6 A;  3LWL A;  3V6K A;  2NO5 A;  3WFP A;  1UA1 A;  2NV3 A;  3PX6 A;  5J2B A;  1ZQQ A;  8ICB A;  9ICU A;  5D4B A;  3PST A;  1N48 A;  5ALT A;  4EBK A;  4O3S A;  3VCB A;  4UD4 A;  1T8E A;  2HW3 A;  1GO3 F;  4JV2 A;  1ZJN A;  4FH3 A;  1V97 A;  4BGD A;  2ALZ A;  3IHQ B;  2F8K A;  4X4P A;  2ZH8 A;  8ICX A;  1OU5 A;  2FCL A;  2K8A A;  2M2W A;  4NLC A;  4IQU A;  1X9M A;  4YMN A;  3IN5 A;  1UET A;  3AM9 A;  3TI0 A;  4R66 A;  1KW4 A;  5KTQ A;  3B9J A;  2YB4 A;  1NI3 A;  3PY8 A;  2F77 X;  3PX4 A;  2WF7 A;  5KFL A;  3HT3 A;  1S0M A;  4JLZ A;  4WH5 A;  4CF4 A;  5AM4 A;  3ZDB A;  5ALG A;  4ED2 A;  3K1Z A;  2ZH4 A;  2BPC A;  4XQ7 A;  2DVI A;  4C8L A;  2H3Q A;  4TUR A;  2R18 A;  4QZA A;  1ZQU A;  1D8B A;  3SQI A;  4RUC A;  1DK2 A;  5KG2 A;  1S77 D;  1D8Y A;  2JEF A;  3T5J A;  5J0S A;  2ZJA A;  1WWV A; 
#chains in the Genus database with same CATH homology
 4TUP A;  4ECY A;  3H4B A;  1ZQE A;  4RT3 A;  4DSK A;  2FMS A;  7ICR A;  1UEU A;  4QZH A;  2AQ0 A;  2XY6 A;  3RBD A;  2V9W A;  1NKC A;  5DG7 A;  3C5G A;  3Q8P B;  4MF2 A;  4TUQ A;  4KTQ A;  3H8S A;  1SKW A;  1R8B A;  4X4T A;  5J2E A;  2HHV A;  3QZ7 A;  5DB8 A;  2BPG A;  5KT7 A;  2ZUD A;  3HIY A;  5DBC A;  2ZH3 A;  5EOZ A;  3MR6 A;  1TFR A;  2C2R A;  4GXI A;  2DR7 A;  1UT8 A;  2Q0Z X;  3RH4 A;  4RQ6 A;  5J2D A;  1NKE A;  1D9F A;  4C8N A;  4KLU A;  3GV7 B;  2FPK A;  4J9K A;  3ISC A;  2ASD A;  4I2B A;  1QTM A;  4Z6E A;  3EPG A;  3FYH A;  4YFK A;  4NM1 A;  3LK9 A;  3HJ1 A;  2PBE A;  3PML A;  1BPX A;  2ISO A;  1XU4 A;  4DO9 A;  3H39 A;  4QZG A;  4MF8 A;  1C7Y A;  3JPT A;  5KFU A;  4IRD A;  4O5E A;  4E80 A;  4WC4 A;  4WC7 A;  2HHP A;  1ZQC A;  5HRG A;  4J9O A;  3GDX A;  1XSL A;  3MDC A;  4EZ9 A;  4KLL A;  3HJ4 A;  3PW4 A;  4LT6 A;  4WBY A;  5DEC A;  5KFT A;  3HW8 A;  3WFQ E;  5HRE A;  2W9C B;  4F50 A;  3LWM A;  2DFL A;  3RB4 A;  4QZI A;  4F5P A;  4DQI A;  1KNY A;  1VJ7 A;  4O3Q A;  3C23 A;  1YLQ A;  3H37 A;  1R8A A;  4DL6 A;  3NYB A;  3T5H A;  4YXJ A;  4YR2 A;  1LB2 B;  1S0O A;  4KLD A;  9ICJ A;  3H40 A;  2FLP A;  4YG2 A;  4IQT A;  5CB1 A;  3GIM A;  3UXO A;  2IBK A;  8ICJ A;  4LVS A;  3MFH A;  3UQ2 A;  4Q43 A;  2NRW A;  4I2D A;  4RPX A;  5HMM A;  4DF4 A;  4M2Y A;  1RYS A;  1ZQY A;  4B9T A;  3JPR A;  8ICK A;  4DFJ A;  7ICT A;  4ECX A;  9ICX A;  4EBJ A;  3GV5 B;  4K4G A;  4QWA A;  3RB0 A;  4KLT A;  4B9S A;  4F8R A;  2HVH A;  8ICI A;  1Q78 A;  1RXV A;  4QWB A;  2DPI A;  2ZTE A;  5KG3 A;  4XRH A;  1ZYQ A;  2XCP A;  4YMO A;  4F5N A;  4I2E A;  7ICP A;  7ICI A;  2ZH5 A;  4FHX A;  2V4R A;  2R8G A;  2HHT A;  1XWL A;  3C2M A;  5DLF A;  1XSP A;  3BQ2 A;  1UT5 A;  2FMP A;  2W9A A;  4DL2 A;  3PVX A;  3RH6 A;  4KLF A;  9ICW A;  5III A;  9ICM A;  4X4O A;  4NXZ A;  5CA7 A;  1N56 A;  7ICO A;  1DK3 A;  2BCU A;  4ELT A;  4UD5 A;  1NJY A;  4C8M A;  1NKB A;  8ICE A;  9ICF A;  3MGI A;  4NKU A;  1BNO A;  1DGS A;  5J0U A;  4WC2 A;  4M6W B;  4F5R A;  5D46 A;  5L1I A;  1QSL A;  1WCL A;  5J0P A;  5KFG A;  3QZ8 A;  3M9O B;  1BPB A;  5HRB A;  5KFS A;  4ED0 A;  1L3V A;  2IA6 A;  1SZP A;  4O3P A;  8ICZ A;  1NOM A;  4GXJ A;  4RNN A;  5J2G A;  9ICI A;  2VA3 A;  3RAX A;  4XA5 A;  4ELV A;  3MR2 A;  1S76 D;  5J0O A;  1U4B A;  3RRG A;  2HVI A;  1ZQX A;  4ECW A;  2IHM A;  2BCV A;  3V72 A;  1NJZ A;  5HHI A;  4TQS A;  2DR5 A;  4RQ8 A;  3RJH A;  5IIK A;  4ECZ A;  5F9N A;  2ATL A;  2IHN A;  4DSJ A;  4GC7 A;  2R8J A;  4DL3 A;  8ICA A;  9ICS A;  5DB9 A;  2RDJ A;  4M9L A;  8ICQ A;  1KFT A;  1JQR A;  5L1J A;  4QWC A;  1RZT A;  1NK9 A;  5KFX A;  5DED A;  3MAB A;  4DSI A;  2JZB B;  4NY8 A;  5CP2 A;  1T7P A;  5KFB A;  4F2R A;  2JEI A;  8ICP A;  4EP7 A;  9ICP A;  2ZHA A;  5KT6 A;  4JV1 A;  1MQ3 A;  1TK0 A;  1NK6 A;  3PR5 B;  5HRI A;  4ELU A;  3H3A A;  4UBC A;  4QW9 A;  4DLE A;  5KFF A;  5J0X A;  1PZN A;  3RB3 A;  1ZQO A;  3TAR A;  4RPY A;  2VA8 A;  1ARO P;  3MGH A;  1KFS A;  2V4Q A;  4FHV A;  3AU2 A;  3RTV A;  2ASL A;  1S0V A;  5KFW A;  4BXO A;  7ICS A;  2ZH1 A;  4O5C A;  1X9S A;  3N4M B;  4WC3 A;  1NJX A;  5KFO A;  5J2H A;  2W9B A;  4UB3 A;  1ZQG A;  3JPO A;  5DQI A;  8ICU A;  1BNP A;  3ETL A;  1ZQP A;  2FLL A;  3BDP A;  4BXO B;  4E8F A;  1BPE A;  2MUT A;  4R8U A;  2H5X A;  5EWG A;  5F9L A;  3HPO A;  1BGX T;  9ICQ A;  3OUY A;  4ECR A;  1WCN A;  4UB5 A;  3JPS A;  4MFC A;  3AQL A;  4ATB B;  2DRB A;  3H7I A;  2KZ3 A;  2BCS A;  3T5L A;  3OV7 A;  4PGQ A;  4MEY A;  4DOA A;  5DQG A;  1JN3 A;  3OUY B;  5IIM A;  4F4W A;  1UA0 A;  4LZG A;  2NRV A;  1HJP A;  4K4I A;  2R8H A;  2KFZ A;  3NGD A;  5DDY A;  4RQ0 A;  4DEZ A;  4I2C A;  3Q8S B;  2BE3 A;  4KLQ A;  4FH5 A;  2W9M A;  1T3N A;  2AGP A;  1LV5 A;  3RJF A;  4TUS A;  9ICH A;  2RFF A;  2HHX A;  4GLX A;  1S10 A;  2I1Q A;  2Y1I A;  1ZQN A;  4F5O A;  2AGO A;  7ICH A;  9ICL A;  5KFA A;  4FHY A;  2M9N A;  1JMS A;  1TV9 A;  4GC6 A;  4I2H A;  4HYK A;  4F3O A;  8ICF A;  3LDA A;  4DL4 A;  8ICY A;  5KG6 A;  5KT3 A;  1B43 A;  4P4P A;  3RJG A;  4I2G A;  4QZD A;  3SZ2 A;  4M9G A;  4X0A A;  5DGA A;  4DS5 A;  2AJQ A;  4JUZ A;  4KLJ A;  3M8R A;  3FDS A;  3BQ0 A;  4UAW A;  4F2S A;  1VFG A;  2W9C A;  7ICL A;  4RWP A;  5DGB A;  1SL2 A;  1ZQF A;  7ICU A;  2DR9 A;  4QZE A;  1BPD A;  4QZ8 A;  4YR3 A;  2Q66 A;  5IIJ A;  4IRK A;  8ICT A;  4ECS A;  5J2J A;  3JYY A;  4X4Q A;  8ICG A;  3M9N B;  4FS1 A;  3SV4 A;  2DPJ A;  2FPM A;  1JIH A;  2A1J B;  1ZQR A;  4IQV A;  5HRL A;  2F1J A;  1KEJ A;  4DSE A;  4B9N A;  8ICR A;  1CEZ A;  1PX5 A;  2AQ4 A;  2GWS A;  4YN4 A;  4AT7 B;  2F1H A;  3H8J A;  5DB6 A;  1ZQK A;  4NKT A;  3ISD A;  1KSP A;  2M2U A;  1A76 A;  1KTQ A;  4PH5 A;  2XGP A;  2HHU A;  3AQM A;  1U9L A;  3H4D A;  1B22 A;  2P6U A;  2IMW P;  1FA0 A;  2ISP A;  7ICE A;  1IXR A;  1MC8 A;  5KFM A;  3ZDE A;  4EBD A;  4J9P A;  4DSF A;  1RXW A;  2P66 A;  9ICN A;  4FHW A;  4QZB A;  3C21 A;  4J9M A;  1ZQW A;  3RJJ A;  1TAQ A;  4E0D A;  4KLO A;  1TAU A;  9ICV A;  1Q79 A;  4F93 B;  3MFI A;  3GQC A;  3WFO A;  4UBB A;  3BQ1 A;  1Z00 B;  4I29 A;  3MR5 A;  3G6Y A;  2VA2 A;  5KFY A;  4JWN A;  1V4A A;  4KLM A;  4ECQ A;  1HUZ A;  4MEX A;  1MIY A;  1L3U A;  3ZDA A;  1TFY A;  4DFK A;  1BPY A;  1NK8 A;  4M6W A;  4KLG A;  5J2F A;  3HX0 A;  1K1Q A;  4RT2 A;  3V7J A;  5KT2 A;  3RAQ A;  2HHQ A;  4YXM A;  4DQP A;  4NLK A;  5HML A;  1R89 A;  3L9D A;  4AT8 B;  3BJY A;  2AU0 A;  2BCQ A;  3PW7 A;  2BGW A;  4DF8 A;  1D9D A;  4FBT A;  4RWQ A;  4WC0 A;  4BDP A;  5KT5 A;  2UVU A;  4P2H A;  3GFK B;  4MFA A;  3K4G A;  5HP4 A;  3RB6 A;  7ICM A;  3OVB A;  4O3N A;  1CUK A;  4B9U A;  4RQ4 A;  4ECT A;  3ORY A;  1X9W A;  3C2K A;  2R8K A;  4ECU A;  1JAJ A;  1TK8 A;  3G6V A;  1KFD A;  3KHH A;  2ZJ8 A;  3SV3 A;  4DWI A;  1DOQ A;  5EWF A;  5IIL A;  9ICK A;  5KFN A;  4ECV A;  1ZET A;  4CCH A;  4NM2 A;  1QSY A;  4RQ7 A;  5D49 A;  4M9J A;  4M5D A;  1TKD A;  1L5U A;  3Q8K A;  2ZTD A;  3ZD9 A;  7ICN A;  4PHA A;  5J2I A;  2PFP A;  1T4G A;  4IG8 A;  5KFE A;  3E2E A;  5L1K A;  2DRA A;  8ICC A;  2UVW A;  1NK5 A;  3V7L A;  2JZB A;  3RJI A;  3JPN A;  4J9R A;  3PV8 A;  2PFQ A;  9ICT A;  1R8C A;  1U49 A;  4F4Z A;  1QSS A;  4RNO A;  2XO7 A;  4X0B A;  3AUO A;  5HRF A;  4BWM A;  3OGU A;  3GII A;  2DR8 A;  2ZHB A;  1S97 A;  1ZQS A;  3JPQ A;  3MBY A;  1RYR A;  4EZ6 A;  1NJW A;  3TQ1 A;  2BPF A;  3UXN A;  4P4O A;  3B0X A;  3OVA A;  1COO A;  1Y88 A;  5CJ7 A;  1ZQV A;  2M2T A;  2RDI A;  4F5Q A;  4F4Y A;  1ZQD A;  4KLE A;  4IR1 A;  5J0W A;  4Q8E A;  5DQH A;  3M9M B;  5CR0 A;  3AU6 A;  3PO5 A;  4J9Q A;  4F91 B;  2FLN A;  1ZQH A;  1TVA A;  4QZ9 A;  4FHP A;  4JWM A;  4WCW A;  2ZH2 A;  4ZH4 A;  4KN4 A;  5J2A A;  4Q44 A;  2XCA A;  2ZH7 A;  2R8I A;  5HR9 A;  2NRT A;  4JV0 A;  5JUM A;  4EBE A;  4Z6C A;  1L3S A;  3C2L A;  3Q8M A;  4I2J A;  4RU9 A;  3RBE A;  3T3F A;  4I28 A;  5KFZ A;  4P4M A;  3RR8 A;  4NLG A;  4ATB A;  2P6R A;  3EWA A;  3RRH A;  3B0Y A;  1ZQA A;  4QZC A;  5J0R A;  1MIW A;  3NTU A;  4PHP A;  2C28 A;  4EYI B;  4I2I A;  8ICV A;  8ICL A;  1ZQT A;  2LYH A;  1ZQI A;  1X2I A;  4O3O A;  3THV A;  3PW5 A;  5KT4 A;  5KG1 A;  4F4K A;  4AT9 B;  1ZQJ A;  4NLN A;  5DG8 A;  3OSP A;  3KHR A;  4R64 A;  4O9M A;  4DOB A;  4KMU A;  4WC6 A;  4O0I A;  3UPQ A;  2OWO A;  4I2A A;  5CHG A;  4QW8 A;  4FS2 A;  1U48 A;  2MAX A;  4YP3 A;  3QE9 Y;  3WFS C;  7ICJ A;  5HRD A;  2AGQ A;  1QLN A;  4DLG A;  1ZQZ A;  4MFF A;  5HRH A;  1XC9 A;  4EEY A;  3EZ5 A;  1Z3E B;  5KG4 A;  4Q45 A;  4M9H A;  3TFR A;  1NZP A;  5HHH A;  4DFP A;  4E7X A;  4O5K A;  2BCR A;  1NO5 A;  8ICW A;  2W8L A;  4IR9 A;  4FBU A;  3N97 B;  9ICG A;  2O1P A;  3AQN A;  4X4N A;  4TQR A;  4WBZ A;  4K4H A;  2NRK A;  4RWN A;  5KG7 A;  3PNC A;  5J2K A;  3TFS A;  2VAN A;  4PPX A;  5TZV A;  1H38 A;  3RJE A;  4XUS A;  5KFC A;  7ICG A;  4DFM A;  5IIN A;  2A1J A;  4ED3 A;  1NK4 A;  3JPP A;  2J6U A;  1SKS A;  4M04 A;  4X4S A;  9ICB A;  2M2V A;  4B9V A;  5KFI A;  3MDA A;  8ICH A;  9ICC A;  4AT7 A;  5DDM A;  4YMM A;  2BR0 A;  4JK1 A;  3OHB A;  5C5J A;  3T5K A;  2HHS A;  4PHE A;  3V6H A;  2F1I A;  1ZJM A;  2HHW A;  4KLI A;  8ICO A;  4QWE A;  3OHA A;  9ICO A;  4PHD A;  3HP6 A;  2C2E A;  2ASJ A;  3IM1 A;  2NRX A;  1TFW A;  1IM4 A;  4YR0 A;  1ZQL A;  1ZQM A;  2J6T A;  3BQT A;  4YVZ A;  5J0Y A;  3UXP A;  2ZJ5 A;  4F92 B;  4UB2 A;  3V7K A;  1NK7 A;  2KN7 A;  1XO1 A;  3EYZ A;  2PXI A;  4EBC A;  2C2D A;  4YCX A;  4M47 A;  3C18 A;  2WTF A;  1XSN A;  5KFJ A;  1EXN A;  2B21 A;  5L1L A;  4NLZ A;  5F2V O;  4UAZ A;  1Z00 A;  5KFK A;  9ICA A;  2NRZ A;  4DQS A;  4Q8F A;  1UEV A;  4I2F A;  1A77 A;  3C1Z A;  4RPZ A;  4J9S A;  5BPC A;  1JXE A;  4I27 A;  4ED8 A;  5KFD A;  5J29 A;  5J0T A;  2XC9 A;  3Q8L A;  4B9M A;  5DBA A;  4UAY A;  2KZZ A;  3PX0 A;  2KP7 A;  5HNK A;  8ICN A;  4G3I A;  2KFN A;  2BQU A;  5CWR A;  4B9L A;  3TAP A;  4AT8 A;  1BVS A;  1SL1 A;  7ICQ A;  3ISB A;  5KFH A;  4J9L A;  3V6J A;  1JXL A;  2ID1 A;  3OVS A;  5DG9 A;  2Y1J A;  4DL5 A;  3TAQ A;  2JEJ A;  3G6X A;  2FMQ A;  3PO4 A;  2J6S A;  2BDP A;  3LQC B;  1L3T A;  1U45 A;  3OJU A;  2XY5 A;  4DQQ A;  2PFO A;  5KFQ A;  4X4U A;  3ZDD A;  2ZUB A;  4PGY A;  4M0A A;  7ICV A;  5HRK A;  1K1S A;  2ZH6 A;  3SI8 A;  1KRP A;  2BHN A;  3LWL A;  1SL0 A;  4YQW A;  2JEG A;  2PI4 A;  5DKW A;  3V6K A;  3WFP A;  4RNM A;  1UA1 A;  3GV8 B;  1ZQQ A;  3PX6 A;  5J2B A;  4WC5 A;  2XGQ A;  3OJS A;  3PW0 A;  1TK5 A;  8ICB A;  5KFP A;  9ICU A;  5D4B A;  4RQ2 A;  4QZF A;  3HWT A;  1N48 A;  1HUO A;  5DB7 A;  1KLN A;  4LZD A;  4Z6F A;  1D8L A;  4F4X A;  4KLH A;  4O3S A;  4RQ3 A;  4EBK A;  5J0Q A;  1SKR A;  4M9N A;  2KZM A;  4KN7 A;  3SYZ A;  4X4V A;  4UD4 A;  5BOL A;  1T8E A;  4JV2 A;  2HW3 A;  3AQK A;  4X4R A;  3EPI A;  1ZJN A;  4R63 A;  3EW9 A;  1NK0 A;  4FH3 A;  2PI5 A;  4BGD A;  4J9N A;  2ALZ A;  3IHQ B;  4X4P A;  3RR7 A;  7ICK A;  4ED1 A;  2ZH8 A;  2UVR A;  8ICX A;  4UB4 A;  1WOT A;  3GIK A;  3ZD8 A;  4X5V A;  1OU5 A;  2BKE A;  3PMN A;  7ICF A;  3K75 D;  5HC9 A;  3Q8R B;  2M2W A;  1U47 A;  1MQ2 A;  1RPL A;  5KFR A;  4KIT B;  4IQU A;  3OSN A;  3Q8Q B;  1MIV A;  3C66 A;  1X9M A;  4YMN A;  1F5A A;  5KG0 A;  1UET A;  4IQW A;  2O5A A;  2ZH9 A;  4C8O A;  5DBB A;  4DL7 A;  1S9F A;  3TI0 A;  3H8W A;  2ZTC A;  2PFN A;  4R66 A;  3UPS A;  2XY7 A;  4DQR A;  4C8K A;  9ICE A;  5KG5 A;  1XS9 D;  1S0N A;  1MSW D;  3PW2 A;  5KTQ A;  5DLG A;  3C1Y A;  4GXK A;  4RUA A;  5J2C A;  3PY8 A;  8ICM A;  4DOC A;  1ZQB A;  4Z6D A;  3PX4 A;  1S0M A;  5KFL A;  3HT3 A;  3RJK A;  4IRC A;  5KFV A;  4RZR A;  4KLS A;  2ZUC A;  1JX4 A;  3C5F A;  4XQ8 A;  4AT9 A;  3ZDC A;  4FO6 A;  3KHG A;  3ZDB A;  4RWO A;  2C22 A;  4ED2 A;  4ED6 A;  4R65 A;  4DSL A;  2ZH4 A;  2BPC A;  5L9X A;  5BOM A;  4WC1 A;  2BQ3 A;  4XQ7 A;  2DVI A;  3WFR E;  5IIO A;  4BWJ A;  3TAN A;  3QEA Z;  3RH5 A;  1KDH A;  4TUR A;  4C8L A;  4PGX A;  3M8S A;  2BQR A;  4DS4 A;  4O3R A;  4QZA A;  4RQ1 A;  1ZQU A;  4RUC A;  4EYH B;  8ICS A;  5KG2 A;  1BPZ A;  1DK2 A;  3H38 A;  1V9P A;  1S77 D;  2UVV A;  2KTQ A;  2FPL A;  4UB1 A;  3GIJ A;  4QWD A;  3UQ0 A;  3GIL A;  1D8Y A;  2JEF A;  4YD2 A;  2W9B B;  3T5J A;  4ED7 A;  3KTQ A;  4RQ5 A;  3PR4 A;  3JZ0 A;  5J0S A;  3KHL A;  3MR3 A;  9ICR A;  2I9G A;  2ZJA A;  4YD1 A;  4UQG A;  3QEB Z;  4S3N A;  5EWE A;  2MUT B;  2W8K A;  4R8U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...