4YMMA

Structure of human dna polymerase beta complexed with 7bg as the template base in a 1-nucleotide gapped dna
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
molecule tags Transferase/dna
source organism Homo sapiens
publication title Structure of human DNA polymerase beta complexed with 7BG as the template base in a 1-nucleotide gapped DNA
rcsb
total genus 111
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ymmA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ymmA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ymmA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ymmA03
2JEFA 1ZQGA 3PV8A 5D46A 3TARA 1T4GA 4F4WA 3OSNA 4DL7A 4F5NA 3PX4A 4F4KA 1ZQEA 4I2CA 4M9NA 1NJWA 2HHQA 5KFKA 1NK4A 1ZQQA 4B9NA 4YMOA 4F4YA 2W9CB 1S10A 3ZDEA 2PFOA 4QZ9A 3QEAZ 1NKBA 5D49A 4ATBA 8ICAA 1DGSA 4Z6CA 2XGPA 4KLIA 2C28A 4X4RA 1FA0A 4MF8A 5IIIA 4KLMA 4DSFA 4FHYA 1UT8A 4F5RA 5HNKA 7ICMA 5EWEA 2ZH6A 3H7IA 2VA3A 5CP2A 4F2SA 5DDYA 4F5QA 3C21A 4LT6A 5KFVA 4DFJA 2R8GA 4DQSA 5IIOA 1ZETA 5KG3A 2Y1JA 3RJEA 1DK2A 4IR9A 2UVWA 3HJ1A 2V4RA 3C2MA 9ICPA 4J9PA 4M9HA 1ZQHA 1BPEA 2KFNA 1JN3A 5CWRA 4RT3A 3OJUA 1NKEA 1L3UA 4FBUA 7ICUA 4X4OA 1UA0A 5DG8A 1K1QA 1R89A 2P6UA 1XWLA 4EBCA 3T5JA 4RPYA 5KFJA 2R8HA 4DL6A 1KFSA 2BQ3A 4KLFA 2AGPA 4YR3A 1B43A 2PFQA 2VA2A 5KG4A 5KT5A 4X4VA 1ZQMA 3C2KA 4HYKA 3EZ5A 1NK7A 1JMSA 4QZCA 4B9SA 2XC9A 8ICPA 3RR7A 1UT5A 2Q0ZX 3C66A 4GXJA 4DS4A 4JWMA 1ZQJA 4ELUA 3MFIA 4KLDA 7ICQA 1S9FA 4KLLA 4DS5A 1X2IA 4YMNA 4BWMA 1XC9A 4J9QA 9ICAA 2V9WA 1NOMA 4RPZA 3RJIA 4CCHA 8ICFA 2DRBA 4QZAA 3GV5B 2W9AA 1JX4A 1JQRA 3MR2A 4XQ7A 2M2TA 8ICJA 1VJ7A 4RQ5A 1ZQCA 2J6SA 4ECXA 3BDPA 4IRCA 1BNPA 2F1HA 5EWFA 3FYHA 2ZTCA 2RDIA 4FHPA 2HHXA 5DB7A 3HWTA 4P4MA 4I2BA 1TAUA 7ICNA 3L9DA 4UB3A 4WC1A 4ED8A 1SKSA 4YCXA 1S0NA 4ZH4A 4PHDA 4TUPA 2KFZA 9ICLA 3ISBA 4ED3A 5IIMA 3RBEA 8ICWA 5KFTA 5L1KA 2R8KA 9ICWA 1IM4A 5HP4A 4RWOA 3KHLA 4DL2A 5KFIA 5EWGA 1ZYQA 2O5AA 1NZPA 4M9JA 3OVBA 4F2RA 4K4GA 4FS2A 4TQRA 4UB1A 1Z00B 4EBKA 1TFRA 3AQLA 3QZ8A 2C22A 7ICFA 4FHWA 4RNNA 1RYRA 1MQ3A 5L1LA 5F2VO 5KFPA 2ZHAA 5J2FA 2F1IA 3RRHA 5KT7A 3QZ7A 3FDSA 4KMUA 1L3VA 1NKCA 2ZJ8A 4UB2A 4BGDA 2FPLA 2BPFA 1RXWA 5IILA 1X9SA 4ELVA 7ICJA 2RFFA 5DGAA 4ECSA 1S0VA 3AUOA 4X5VA 4NM2A 2DPIA 4X0BA 1SL0A 4UBCA 8ICLA 3NTUA 4PHPA 1BNOA 4PGYA 4IG8A 4UD5A 8ICCA 1ZJNA 4FBTA 2FLNA 1XSPA 2C2EA 1X9MA 1NK6A 1N56A 2FLLA 5KFSA 4QW9A 3RJFA 4O3SA 3V72A 8ICVA 9ICEA 4F92B 4DF4A 1DOQA 5DQHA 3B0YA 1RZTA 4C8MA 2FMQA 3UXPA 2JEGA 2M2UA 2MUTA 3M9NB 1ZQYA 3ZDCA 5J0UA 3V7JA 4DL3A 3B0XA 1ZQNA 3PO5A 1R8CA 1TV9A 3RJGA 2ZH7A 1T7PA 4WC2A 3OV7A 3OHAA 8ICMA 1TAQA 8ICXA 3TANA 1MC8A 4B9MA 2BE3A 4EZ9A 8ICIA 2JZBB 4NLGA 4Z6EA 1V4AA 4AT8A 4YXJA 3GIKA 4TUSA 3TAQA 3BQ1A 4KLEA 7ICHA 2P6RA 5D4BA 4NLKA 1SZPA 4PGQA 5DBAA 1QLNA 3EPIA 1C7YA 1X9WA 5BOLA 4E80A 1UA1A 8ICRA 4UBBA 4R66A 1TVAA 3IHQB 4KLOA 8ICGA 3T3FA 4J9SA 3TI0A 5J0YA 4P4OA 4ECTA 4BXOA 2KZMA 4ED2A 4M9GA 2O1PA 4X4QA 3OVSA 4LVSA 1S77D 2ZH5A 4GLXA 2HHVA 2ZUBA 5DBBA 4X4PA 2ATLA 2AJQA 4RQ0A 5J2IA 3KHHA 4XUSA 5J2CA 3V7KA 3KHGA 2PXIA 1SKWA 3UXOA 4I2IA 8ICEA 2IBKA 4QZIA 2HVIA 4YVZA 1NJZA 3JPTA 4QWBA 4QZEA 4E0DA 1MSWD 5J2KA 4PHEA 4O0IA 3Q8SB 2IHMA 1ZQRA 3G6YA 4ELTA 4FH5A 1H38A 3RB4A 1QTMA 4O3QA 4I2HA 4QZHA 4EZ6A 4IQWA 5HC9A 5L1JA 5BOMA 2DR9A 3JPNA 1XO1A 9ICMA 9ICFA 4EBDA 3PVXA 5BPCA 5J0SA 4ECQA 4FHXA 3SI8A 1N48A 4JV0A 2DR8A 4DSKA 4O3NA 4O3OA 5KTQA 4DOAA 3Q8LA 3RJHA 2B21A 1S0MA 3H4DA 1RPLA 4K4HA 9ICHA 3WFRE 4QWAA 2I1QA 5KFCA 1COOA 3UPQA 4C8LA 3MFHA 4Q8EA 3RB0A 4ED0A 3C23A 3K4GA 5J0PA 5DB8A 3M8SA 4UAZA 5J0QA 4M2YA 3H8JA 3GILA 4MEYA 2W9CA 4EYHB 1ZQTA 1DK3A 4YN4A 5JUMA 3GV7B 4F4XA 3OVAA 9ICKA 4KN4A 4YQWA 1BVSA 4QWEA 1D8LA 5KG5A 5DLGA 2RDJA 3UXNA 3H8SA 4F3OA 1BPBA 3EWAA 5KFZA 3GDXA 3PW7A 2ASDA 2ISPA 8ICQA 4XQ8A 1ZQSA 5DBCA 1PX5A 2FMSA 4KLQA 4NXZA 3M9OB 4YR0A 4Q8FA 2XY5A 4BXOB 4BDPA 2HVHA 4EBJA 1BPZA 5TZVA 4J9MA 1NK0A 3JPOA 5CB1A 5KFYA 5CHGA 4GXKA 3RH4A 3RJJA 3OUYB 4NKUA 3QEBZ 2BCRA 1JXLA 9ICRA 4X4UA 4MFAA 2XY7A 3K75D 5KFXA 2AGQA 2KP7A 4RPXA 3RH6A 4RNOA 4LZDA 9ICUA 4DO9A 3ISDA 1D8YA 1KFDA 5KFMA 4I29A 2FPMA 5KFUA 1F5AA 4DOCA 5HREA 1MIYA 2UVUA 3LWLA 4X4SA 2F1JA 4MF2A 3EPGA 5CA7A 4P2HA 4QWCA 4IRDA 4O3PA 3Q8KA 2HHTA 4WC3A 2NRWA 4DEZA 5KT3A 4M9LA 1NO5A 5J2EA 3LQCB 4PHAA 1ZQAA 3TFRA 5DDMA 4Z6DA 3PNCA 5KG6A 3C2LA 4IR1A 3JPRA 3T5HA 7ICLA 3RAXA 3Q8MA 2MUTB 3HIYA 3RAQA 2H5XA 4ED6A 1HUZA 2BCVA 3THVA 1HJPA 4R8UA 4Q43A 3AQNA 4X0AA 1JAJA 5HMMA 3RRGA 2AGOA 9ICVA 1CEZA 4RUAA 5DB9A 4J9NA 8ICZA 4P4PA 4ECRA 4B9LA 4JWNA 5J2HA 4NM1A 1ZQWA 5J0TA 3ZD9A 4WC0A 4S3NA 4RQ2A 3HP6A 1SKRA 2BCSA 4ECYA 2DVIA 2XCPA 1NK9A 4KLTA 4RUCA 4FO6A 4RT2A 3AU6A 2BQRA 4KLUA 3WFQE 4UB5A 1EXNA 1R8BA 4RWNA 9ICOA 2LYHA 4ED7A 3H8WA 5KFFA 4KLJA 3OHBA 3ZD8A 4AT7A 2NRXA 3M8RA 2M9NA 5KFDA 3PY8A 9ICTA 4NKTA 5DB6A 3OUYA 1VFGA 2PBEA 5KG1A 1OU5A 3EYZA 2ISOA 3ISCA 2BQUA 3ZDAA 8ICHA 2OWOA 3C1YA 4J9KA 3JYYA 3MDAA 1KLNA 4LZGA 1KRPA 1K1SA 3ETLA 3GIMA 4J9OA 2ZH1A 1D9FA 4M47A 2NRKA 5KFAA 4RZRA 3KTQA 3H40A 3LK9A 4TURA 9ICCA 3H37A 3JPQA 1TK5A 4I2EA 4ECWA 4IQUA 4RWQA 1SL2A 3HW8A 3SZ2A 4YP3A 4F4ZA 3N97B 1NJYA 4RNMA 1S0OA 5HRFA 1JXEA 5J2DA 1L5UA 4MFFA 3GIIA 2BDPA 7ICVA 4WBYA 4B9TA 4F50A 4MEXA 1UETA 2DR5A 3M9MB 7ICKA 8ICKA 4I2AA 4X4NA 4R64A 5IIJA 9ICSA 1A77A 3PR4A 8ICBA 3V7LA 3HPOA 7ICSA 2ZJ5A 3PW4A 3JPPA 2JEJA 1S76D 1ZQXA 2ZUCA 4EYIB 3RB6A 4G3IA 2BGWA 5J0RA 4NY8A 2HHPA 5DGBA 3MGIA 4FS1A 5IIKA 3UQ0A 4RWPA 3WFOA 3GIJA 3LWMA 2HHUA 3PMNA 1ZQPA 4WC5A 2FLPA 2BPGA 4ATBB 2BCQA 4DLGA 3G6XA 2WTFA 2AQ4A 4Q44A 2DRAA 4M04A 4ECUA 5CJ7A 2BPCA 1TKDA 3AQMA 9ICIA 2ZHBA 3UQ2A 1CUKA 1U48A 1B22A 1QSSA 3ORYA 4IQVA 2ZUDA 1XU4A 4DQPA 5HRBA 5HRGA 4DFKA 1Q79A 5KFLA 3PMLA 2IHNA 4PH5A 4C8OA 2ZH2A 3V6JA 1QSYA 1V9PA 4J9RA 5HRKA 3OGUA 3AU2A 1KFTA 4M6WB 5KG0A 1BPYA 5DLFA 1RYSA 5KG7A 4RQ6A 4F8RA 5KFWA 3EW9A 5IINA 4GC6A 3E2EA 2ASLA 3PX0A 1KNYA 3T5LA 4YG2A 3T5KA 1L3SA 1JIHA 1ZQZA 1NK5A 9ICGA 4QZBA 4BWJA 3GFKB 5HHIA 4AT9B 3GV8B 7ICIA 4AT8B 4I27A 4EEYA 3C5GA 4DQIA 2NRVA 2Q66A 2DFLA 5HRIA 4FH3A 4PPXA 2NRTA 2A1JB 4YXMA 8ICTA 1UEVA 5C5JA 4I2GA 5HHHA 3LDAA 2ZH3A 3KHRA 2FMPA 4E8FA 4DSLA 2M2WA 1A76A 4IRKA 1KTQA 5J0OA 3HX0A 1LB2B 4J9LA 4WCWA 4UAYA 4QWDA 4DF8A 5KFHA 3PO4A 5KFGA 4DSJA 2KN7A 4ECZA 5J0WA 3H38A 4YFKA 1NJXA 5KFQA 1TK8A 1ZQDA 2P66A 4RQ7A 5HRDA 4QZ8A 3BQTA 5DQIA 3H4BA 2R8IA 5J2GA 5KFBA 2W9MA 3HT3A 1U4BA 4EP7A 4ECVA 4F5PA 2UVRA 2KTQA 1ZQIA 3Q8RB 4GXIA 4KTQA 3UPSA 4AT9A 5L9XA 4Z6FA 2W9BB 4F5OA 1ZQFA 3C1ZA 9ICXA 4UD4A 5KFEA 3QE9Y 4I2JA 2J6TA 1U9LA 5KFRA 5DG7A 2PFPA 4K4IA 4O5KA 8ICOA 7ICOA 4E7XA 5L1IA 5F9NA 1KDHA 1S97A 9ICQA 4M6WA 2XGQA 5KT4A 4DL5A 2BHNA 4RQ3A 1TK0A 4RQ1A 4NLNA 4C8NA 4B9UA 2Y1IA 1WCLA 2R8JA 1KEJA 1PZNA 3NYBA 3C18A 2VA8A 1L3TA 1IXRA 1U47A 4O5EA 5F9LA 3SV4A 2KZZA 3JPSA 4YD1A 5HMLA 8ICSA 3H39A 4F93B 1XS9D 4IQTA 3OJSA 4JV1A 2C2DA 2VANA 2PI4A 4MFCA 4TQSA 7ICTA 5DG9A 8ICNA 4YMMA 2AU0A 1LV5A 5CR0A 4DSEA 5DKWA 3PW5A 3Q8PB 3Q8QB 4C8KA 1Q78A 2GWSA 4WC6A 3TFSA 2NRZA 1AROP 3MABA 2ID1A 3NGDA 2BKEA 3PW2A 4I2DA 2W8LA 1BPDA 4ED1A 1NK8A 2ZH9A 5KG2A 4KLGA 4TUQA 1WCNA 4QZGA 3MGHA 1MIWA 4RQ8A 3GQCA 1ZJMA 3ZDDA 4M0AA 7ICEA 4DQQA 3RB3A 4JV2A 1ZQVA 1U49A 5KFOA 2ZTDA 4KN7A 2IA6A 8ICYA 4XRHA 2XO7A 4UAWA 1ZQUA 5J29A 1ZQLA 1ZQOA 2M2VA 7ICRA 4AT7B 4R63A 3PX6A 2JEIA 2ZTEA 3TQ1A 4X4TA 3PW0A 3RTVA 5HRHA 4O5CA 1UEUA 3PR5B 3RJKA 1TFYA 2HW3A 4DQRA 2DR7A 3BJYA 4KITB 2JZBA 4NLZA 3OSPA 4R65A 1T3NA 5J0XA 4DLEA 2BR0A 3BQ2A 2J6UA 4FHVA 4RU9A 4QZFA 4Q45A 2BCUA 3RBDA 3HJ4A 8ICUA 4RQ4A 2ASJA 2KZ3A 2XCAA 3MBYA 4WC7A 2C2RA 3JZ0A 1QSLA 1XSLA 2PFNA 4KLSA 1MIVA 4B9VA 2UVVA 2I9GA 4DSIA 2AQ0A 5DEDA 7ICGA 3MR6A 4JUZA 4DFPA 5J2JA 2MAXA 5J2AA 3MDCA 2W8KA 3V6KA 3ZDBA 3RR8A 3TAPA 4UQGA 3N4MB 1T8EA 5DQGA 1BPXA 1D9DA 2W9BA 3SYZA 7ICPA 4DFMA 1ZQKA 3AQKA 9ICJA 1MQ2A 3MR3A 4KLHA 2ZH8A 4XA5A 4YD2A 4GC7A 5KFNA 1KSPA 2DPJA 2IMWP 2PI5A 1XSNA 5HR9A 1R8AA 4DL4A 3C5FA 1U45A 9ICBA 1Y88A 2XY6A 3WFPA 5KT2A 2ZJAA 2FPKA 2HHSA 3V6HA 4M5DA 4YR2A 4R8UB 3WFSC 3MR5A 2V4QA 1YLQA 3RH5A 1BGXT 4DOBA 4QW8A 4EBEA 2ALZA 5J2BA 3IM1A 1ZQBA 4DWIA 1Z00A 4PGXA 1WOTA 1HUOA 2HHWA 1Z3EB 3SV3A 3BQ0A 1SL1A 4QZDA 4O9MA 5HRLA 5DECA 2ZH4A 4O3RA 9ICNA 4JK1A 3G6VA 4I2FA 4F91B 2A1JA 1RXVA 5EOZA 4UB4A 4I28A 3H3AA 4WC4A 4WBZA 1TFWA 5KT6A
chains in the Genus database with same CATH superfamily
2JEFA 1T4GA 3OSNA 1MA7A 1ZQQA 1X9XA 4F4YA 5AM5A 2PFOA 1DXSA 1TE2A 4Z6CA 1QQ5A 2XGPA 4FHYA 1UT8A 2ZH6A 3H7IA 5CP2A 4LT6A 4EV6A 2ODGA 2Y9TA 2R8GA 1ZETA 5IIOA 4CF5A 2V4RA 3OJUA 7ICUA 1NKEA 4K96A 1XWLA 5KFJA 2HSZA 2R8HA 4KLFA 2BQ3A 4YR3A 1B0XA 5B5EU 4X4VA 3EZ5A 1JMSA 4B9SA 3RR7A 3PHZA 3AL0B 1S9FA 1X2IA 4BWMA 1XC9A 4J9QA 3RJIA 4CCHA 2DRBA 1QCKA 1VJ7A 8ICJA 2PKEA 4ECXA 1LKYB 3BDPA 4NXVA 5EWFA 2A19A 2RDIA 5DB7A 2MU2A 3H8MA 3QX7A 2HBJA 1SKSA 4YCXA 1MN8A 9ICLA 4TUPA 3KZXA 3NRWA 2KFZA 3MGVA 5IIMA 5HP4A 4DL2A 1O08A 1ZYQA 2LPEA 4RQNA 4EBKA 2WFAA 3QZ8A 2C22A 5ALTA 5F2VO 2RP5A 5J2FA 4EEDA 5KT7A 2FPLA 1RXWA 5IILA 1X9SA 4ELVA 2WHEA 1S0VA 3SAFA 4PGYA 4LJXA 8ICCA 4FBTA 3OTQA 3HJEA 4Y2JA 1X9MA 4O3MA 2RHFA 2VKQA 4OJ6A 2JV3A 4C8MA 2FMQA 3UXPA 2JEGA 3V7JA 4UB8U 4RQMA 1T7PA 1TAQA 3SQIA 4Y2SA 2OH2A 2P35A 2RRDA 2HBMA 1TAMA 2K4IA 5DBAA 4EX6A 2GO7A 1C7YA 2DKXA 1UA1A 4NLCA 3T3FA 3TI0A 4KX3A 5J0YA 3F2DA 4OJPA 4P4OA 3OVSA 4LVSA 4X4PA 3KHHA 3KHGA 2PXIA 3UXOA 4I2IA 3JPTA 4QWBA 3QUCA 4OCZA 3F2BA 3M7DA 2FDRA 4PHEA 1ZQRA 4FH5A 2E8OA 5AM4A 1H38A 4O3QA 1VLBA 2EZYA 1J2NA 2F44A 1XO1A 1SWVA 3PVXA 4FHXA 1N48A 2DR8A 2IUBA 2KHVA 4DSKA 4O3NA 3K1RB 3Q8LA 3RJHA 2YMLA 5D63A 3WFRE 1COOA 4N7RA 2KMDA 4QNLA 3RB0A 2EH9A 2W9CA 5AI6A 3GILA 3GV7B 4F3OA 4WCWA 5KFZA 2ASDA 1L7NA 1Z1VA 5DBCA 1PX5A 3N28A 4YR0A 4BXOB 4UARA 2HVHA 4IC9A 5TZVA 4J9MA 3GZFA 5ALLA 1JXLA 9ICRA 1DGJA 4X4UA 2XY7A 1PK3A 4RPXA 4LZDA 4I29A 1KFDA 1F5AA 5CHEA 4DOCA 4X4SA 2F1JA 3EPGA 4IRDA 5KT3A 1NO5A 1GPJA 5ALOA 3LQCB 4Z6DA 3PNCA 4IR1A 3T5HA 3BS7A 2WAQC 3HIYA 1N63A 2MUTB 3RAQA 1HUZA 3THVA 1HJPA 4R8UA 4X0AA 3SEIA 9ICVA 4RUAA 4P4PA 3R9KA 4ECRA 2HN2A 5J2HA 3I28A 5J0TA 2XCPA 4FO6A 1XO0A 2YN4A 3M8RA 3PY8A 2WF8A 9ICTA 5AM2A 3EYZA 2JR5A 2OWOA 2GLEA 4J9KA 4LZGA 1KLNA 1NNLA 3GIMA 2W7PA 2ZH1A 1D9FA 2NRKA 4RZRA 5AK6A 4U6PA 5CRXA 2G07A 1TK5A 4OAHA 4RWQA 3N97B 4YP3A 4F4ZA 1S0OA 4NLBA 1SV0C 1IG6A 2BDPA 2E8PA 4MEXA 1UETA 4I2AA 5IIJA 3PR4A 2JEJA 1SXEA 3JPPA 4EYIB 5AKXA 3RB6A 1OW5A 2HHPA 5DGBA 3NVOA 3LWMA 1ZQPA 4DLGA 2A3VA 2WTFA 2AQ4A 5ALEA 4ECUA 1TKDA 1HEKA 3WK5A 9ICIA 1U48A 4IQVA 5JTIA 2ZUDA 1XU4A 4DQPA 1Q79A 5AIBA 3TADA 4FZNA 1SIJA 4C8OA 2ZIVB 1V9PA 2B56A 3OGUA 5DLFA 1RYSA 4F8RA 2KD1A 4GC6A 1KNYA 4YG2A 1L3SA 1ZQZA 2QARA 1JRPA 4BWJA 4PZOA 4AT8B 4FZLA 7ICIA 1JUDA 3IDWA 2NRVA 3NVYA 2KIVA 2HOQA 4I2GA 2M2WA 4FO1A 4OO1J 5K4LA 5KFGA 4KX5A 1ZQDA 2BBHA 4RQ7A 5DQIA 1U4BA 4WQKA 2KJ8A 4F5PA 2DBYA 2W9BB 4CF4A 2KK0A 4PL2A 5DG7A 3LVWA 5L1IA 3J81j 4DL5A 3WK9A 3LVVA 4NL9A 2R8JA 1KEJA 4UAVA 4YD1A 4F93B 4IQTA 3D6JA 3OJSA 5AKZA 2VANA 4C7YA 3Q8PB 4WC6A 3TKAA 2ID1A 3UM9A 2BKEA 1BPDA 4KLGA 1MIWA 4RQ8A 7ICEA 3RB3A 4JV2A 3IP4B 8ICYA 4QIWF 4UAWA 1O03A 1ZQOA 1ZQ1C 2ZTEA 4OD0A 4DQRA 5AK5A 2DF4B 4DLEA 1L7PA 2ZXIA 2HBKA 4UASA 2BCUA 2G5HB 3EF2A 1S5LU 2KZ3A 2YMMA 5AKGA 1FEZA 3MR6A 5A0LA 3V6KA 5CFUA 3TAPA 1T8EA 2W9BA 1CRXA 2NYVA 3AQKA 1MQ2A 2DGZA 2KKVA 2PI5A 5HR9A 3A0HU 4LEZA 1U45A 1Y88A 5KT2A 2ZJAA 2FPKA 4M5DA 3V6HA 3NKUA 2VIXA 3MR5A 5KL1B 3U26A 1PK1A 3BQ0A 1SL1A 5HRLA 5DECA 3K7DA 4O3RA 2ZH4A 4WC4A 4I28A 4WBZA 1TFWA 2JXJA 5KT6A 2ZXHA 4F4WA 1CI4A 4F4KA 4F5NA 1ZQEA 1NK4A 4QZ9A 1NKBA 8ICAA 4KLIA 2C28A 3UMCA 1X6JA 4MF8A 4DSFA 1SV4A 4F5RA 7ICMA 2VA3A 3ERCC 2W04A 2BZFA 5KFVA 4DQSA 4IR9A 2HI0A 4J9PA 1JN3A 4X4OA 1L3UA 4WJ3B 2HBLA 1K1QA 5DG8A 2P6UA 4EBCA 1LVHA 4RPYA 4AP9A 2AGPA 1B43A 5KT5A 4EEBA 1ZQMA 4DFDA 3C2KA 3WK6A 2XC9A 4O69A 1UT5A 3C66A 4PZNA 1ZQJA 4KLDA 7ICQA 2B51A 4KLLA 4DS5A 4P0PA 2V9WA 2Y9UA 4RPZA 8ICFA 3GV5B 2W9AA 5AI9A 3BQ7A 1JX4A 1JQRA 1ZQCA 5GTIU 4IRCA 1BNPA 3FYHA 4FHPA 2HHXA 5ALIA 2LHTA 3HWTA 1TAUA 5J8YC 1KW4A 4UB3A 1S0NA 4PHDA 3ISBA 3T79A 2F3NA 2KVSA 5ALYA 1IM4A 1YZ6A 3FC4A 5KFIA 3F2CA 1NZPA 4M9JA 4F2RA 4TQRA 3AQLA 7ICFA 2YY6A 1RQLA 4RNNA 1RYRA 4FHWA 3ER9B 5L1LA 5KFPA 2F1IA 3RRHA 2EAMA 1L3VA 4UB2A 4BGDA 1ZD4A 4LEYA 3NTUA 1XSPA 1NK6A 3C29A 4QW9A 3RJFA 3V72A 5AKLA 4Y2UA 3C28A 1RYUA 2YMQA 2M2UA 2MUTA 3IRUA 3ZDCA 5J0UA 3B0XA 5ALWA 1R8CA 1TV9A 2ZH7A 3OHAA 8ICXA 4O6AA 2BE3A 4EZ9A 8ICIA 5CFTA 1V4AA 4YXJA 3BQ1A 1QLNA 2KEYA 5BOLA 8ICRA 4KLOA 4J9SA 1IIPA 2B0CA 2KZMA 2AH5A 4ED2A 4M9GA 3QU7A 2ZUBA 5DBBA 2QLTA 2AJQA 4RQ0A 3E0FA 8ICEA 1SKWA 2A1AA 5AKEA 2YQEA 5AM0A 1NJZA 4NXXA 4O0IA 3Q8SB 2W03A 2LM1A 1JROA 4NL9C 1QTMA 4I2HA 5HC9A 5BOMA 5CFSA 3WK8A 4EBDA 2QB0B 4ECQA 4DOAA 1SWWA 4K4HA 4QWAA 3UPQA 4Q8EA 3MFHA 4ED0A 3C23A 3K4GA 5J0PA 2D6FC 2O6KA 4UAZA 4MEYA 4MHVA 3D2SA 3OVAA 4KN4A 5EE0A 4QWEA 4K99A 5DLGA 2RDJA 1YZ7A 8ICQA 1BPBA 3GDXA 1ZQSA 4KLQA 3M9OB 4HAIA 2XY5A 4EBJA 2D8CA 3OUYB 5CHGA 3RH4A 1M6YA 1Z4OA 2W54A 3K75D 5KFXA 2E1FA 5B3PA 9ICUA 2R18A 2JHDA 2K8AA 1MIYA 3PSTA 2GAFD 3LWLA 2M0NA 4P2HA 4O3PA 4IL6U 2HHTA 5J2EA 2HOIA 3BS5B 3JPRA 1B4FA 5JU5A 3M6ZA 2K60A 5D62A 2FCLA 2ZIVA 2BCVA 1VDVA 5L1MA 5ALMA 3AQNA 5AM3A 3RRGA 3HRDD 1Z19A 4NM1A 4B9LA 4WC0A 4S3NA 3HP6A 4ICAA 4RUCA 4KLUA 3WFQE 9ICOA 2ZG6A 4KLJA 3ZD8A 3WK4A 4FZMA 2PBEA 5KG1A 3JCFA 3ZDAA 2JMGA 2K89A 1KRPA 1K1SA 3H40A 3NRZA 9ICCA 3NVZA 5HRFA 1NJYA 4RNMA 4MFFA 7ICVA 4WBYA 4B9TA 1A77A 2ZIUA 3VCBA 3V7LA 3HPOA 3PW4A 3WU2U 1ZQXA 1WWVA 2RLTA 1FO4A 1PUZA 4NY8A 4FS1A 3WFOA 3GIJA 5JRTA 5G5HA 2FLPA 2BPGA 4ATBB 2BCQA 5CJ7A 2BPCA 3PSIA 1AQ6A 1URJA 2ZHBA 3UQ2A 2DL0A 1Z1BA 5HRGA 3E58A 4DFKA 5KFLA 2IHNA 5TISU 1QSYA 1KN5A 4J9RA 4BUGA 5KFWA 3SR6A 1T94A 3PX0A 2ASLA 2FJ6A 2HDOA 3A0BU 3IG5A 1JIHA 5FP0A 3GFKB 4I27A 3H0RB 2LYBA 4DQIA 4AYBC 5HRIA 4FH3A 1UEVA 2QKQA 2FMPA 4E8FA 2DKZA 3KOOA 1A76A 5ALVA 1Z4NA 4OAGA 1KTQA 5J0OA 4UAYA 4DF8A 5KFHA 1KQQA 4EEKA 1NJXA 5KFQA 5J2GA 5KFBA 3HT3A 4EP7A 4ECVA 2KTQA 1ZQIA 4KTQA 4F5OA 4Z6FA 5AHXA 1ZQFA 3C1ZA 9ICXA 5KFRA 2PFPA 4E7XA 2MSNA 5F9NA 3NWIA 9ICQA 4M6WA 5KT4A 1S8OA 3QUTA 1WCLA 1A6SA 3N7PD 3C18A 4O5EA 3SV4A 8ICSA 5AKJA 1P7DA 1WWUA 4TQSA 3TADC 5DKWA 5HR6A 1Q78A 3TFSA 2NRZA 2W43A 3MABA 1RG6A 3NGDA 5ALRA 4TUQA 3MGHA 2E5SA 3GQCA 2LYAA 2EAPA 5KFOA 2QB0A 4KN7A 4XRHA 1ZQUA 1ZQLA 2M2VA 4AT7B 7ICRA 2JEIA 3TQ1A 3WKBA 4X4TA 1WYGA 5HRHA 1KKXA 4O5CA 1TFYA 3RJKA 1T3QA 1L8LA 2OM6A 2DR7A 4NLZA 3OSPA 4R65A 1T3NA 2BR0A 4FHVA 5AI8A 4Q45A 3RBDA 4RQ4A 4ACOA 4WC7A 5H2FU 1QSLA 1XSLA 4KLSA 4B9VA 2WB1F 2I9GA 1RM6C 3HILA 4DSIA 5DEDA 4JUZA 2E8NA 3MDCA 2F76X 2W8KA 3ZDBA 3RR8A 3N4MB 3F5AA 1ZQKA 3I76A 1WG8A 4XA5A 1KSPA 2RQ5A 1R8AA 3C5FA 2XY6A 3WFSC 4R8UB 4P0QB 2QB1A 2ALZA 3PSFA 5ALQA 3IM1A 3WK7A 2VJ5A 1HUOA 2HHWA 1Z3EB 1VJ5A 2F77X 2HMXA 1RQNA 2WAQF 3SD7A 9ICNA 3G6VA 3H3AA 4F91B 1V38A 2A1JA 1RXVA 4UB4A 2E3TA 3PV8A 4MF2A 4DL7A 2HHQA 4I2CA 4M9NA 5B66U 5KFKA 2H3QA 4B9NA 4YMOA 1N61A 1S10A 3ZDEA 3QEAZ 4ATBA 4JLXA 1DGSA 2MA1A 3NS1A 1FA0A 5IIIA 2YB1A 5EWEA 4F2SA 3C21A 5ALJA 5KG3A 3RJEA 1DK2A 3D2NA 2UVWA 3HJ1A 4Y2VA 4HX0A 3C2MA 2CN1A 2EZZA 1ZQHA 1BPEA 4OAIZ 1UHUA 5CWRA 4RT3A 1UA0A 2XVTA 1F0MA 1QQ7A 2VA2A 5KG4A 1NK7A 4QZCA 2Q0ZX 4DS4A 3M1YA 9ICAA 1C20A 2B4VA 2ZIUB 4XQ7A 2JRZA 2M2TA 4WQLA 2ZTCA 4I2BA 3L9DA 4WC1A 1ED1A 4NJ8A 4NV0A 2H3ZA 3NASA 4ZH4A 5EE1A 4ED3A 8ICWA 5KFTA 3KHLA 4LEVA 4CF3A 2O5AA 3OVBA 4K4GA 5B3QA 4WOYA 2ZHAA 3QZ7A 2G08A 2BBJA 2BPFA 7ICJA 3KBBA 3BZCA 5AKYA 2RFFA 3VC8A 4ECSA 2NO4A 4X5VA 1SL0A 8ICLA 2KKPA 1ZJNA 2FLNA 4C80A 2C2EA 3WKCA 5AI0A 4C4SA 1N56A 2FLLA 5KFSA 4BX9C 8ICVA 4GIBA 4F92B 2YMPA 4DF4A 1DOQA 5ALSA 3SMVA 1RZTA 3DDHA 3M9NB 4O67A 1ZQYA 2FE9A 4WH5A 2WF6A 3RJGA 3ONNA 3OV7A 8ICMA 3TANA 1MC8A 4B9MA 4A8EA 2JZBB 4NLGA 1WUDA 2JH7A 3GIKA 4KLEA 2EZXA 5D4BA 4PGQA 3EPIA 5G5GA 4UBBA 1L7OA 4R66A 3IHQB 4Y2YA 1TVAA 2H3FA 2YB4A 4ECTA 4C0ZA 3WKEA 5J8YA 4P0PB 1S77D 2ZH5A 1F5SA 2ZIXA 2F2AB 1NZBA 4XUSA 5J2CA 4EGWA 4PL1A 2IBKA 4DCCA 4C4RA 4E0DA 1MSWD 5J2KA 1Q3VA 1UQVA 3UMGA 4OAFA 4Y2RA 4EZ6A 4IQWA 5AICA 3S6JA 5L1JA 2DR9A 2PMZC 3WKDA 3SENA 4JV0A 5C0YA 3M6KA 4O3OA 2B21A 2KOBA 3H4DA 1RPLA 2I1QA 4US9A 5ALZA 3M8SA 2F8LA 5J0QA 3H8JA 1ZQTA 3OWGA 3CW2C 4YN4A 5JUMA 4F4XA 1DRGA 4YQWA 1BVSA 1XNSA 3EWAA 3KKAA 3I1YA 4NXZA 2W3SA 5ALGA 1BPZA 3JPOA 5AK4A 5ALNA 4GXKA 5ALUA 5CB1A 2GOLA 2BCRA 4CE6A 2AGQA 4MFAA 3RH6A 1FIQA 2IOFK 3L4PA 4JLZA 1V85A 4DO9A 3ISDA 5KFMA 2FPMA 5CA7A 2KVCA 4QWCA 1N60A 4M9LA 3N7RC 1ZQAA 3TFRA 5DDMA 3C2LA 7ICLA 1X40A 2H5XA 4ED6A 2EWRA 4Q43A 3BS5A 3ED5A 4QIWC 3KFUF 2AGOA 1CEZA 5DB9A 4JWNA 3H0LB 4GFJA 3ZD9A 2G0AA 4RQ2A 1SKRA 4ECYA 2OEHA 2DVIA 1NK9A 2ZIWA 2BQRA 2K4PA 4RT2A 3AU6A 4UB5A 1EXNA 2LYHA 4ED7A 5KFFA 2NRXA 2M9NA 1J97A 5KFDA 4NKTA 3WKAA 3OUYA 2CRXA 4Y2PA 1OU5A 2W11A 2ISOA 8ICHA 2BQUA 3C1YA 1L6NA 3JYYA 1F44A 1FFVA 5KFAA 3KTQA 3AMZA 3LK9A 4CRXA 3F5EA 1QQ6A 3H37A 3JPQA 4I2EA 3KKAC 1SL2A 3HW8A 5HR7A 1JXEA 5J2DA 1L5UA 3GIIA 1V97A 4F50A 3M9MB 7ICKA 1J2MA 8ICKA 4X4NA 4R64A 8ICBA 1SV0A 2ZJ5A 3QUBA 4K9AA 4JB3A 3CRXA 3UQ0A 5IIKA 2HHUA 3PMNA 3AM9A 2DRAA 4Q44A 1QSSA 2Z7JA 3PMLA 3ZI4A 4PH5A 4USAA 1PK1B 3V6JA 4CDGA 1KFTA 4M6WB 5KG0A 2EQYA 5T14A 3EW9A 5IINA 3E2EA 1N62A 4XJEA 1OXJA 1NK5A 4QZBA 5AKKA 4AT9B 3GV8B 4IS7A 5GTHU 4EEYA 3QU2A 2Q66A 2DFLA 4PPXA 8ICTA 4YXMA 5HHHA 3LDAA 2ZH3A 3KHRA 4DSLA 1KBUA 3HX0A 4QWDA 3PO4A 1UPHA 2KSOA 2KN7A 1KL9A 4F71A 2WF9A 2P66A 5HRDA 2UVRA 5AM1A 4GXIA 3UPSA 5L9XA 3HKZF 4UD4A 2WF5A 4I2JA 5AK3A 1U9LA 4JMUA 4O5KA 2BHNA 1LKYA 3DEEA 4NLNA 1UCVA 4UATA 2DQNB 2KNJA 2KV2A 2VA8A 5AI4A 1L3TA 1IXRA 1U47A 5F9LA 2KZZA 3JPSA 4UAUA 5HMLA 1XS9D 3N7SC 5D61A 3L5KA 2C2DA 3QU5A 1SXDA 2PI4A 1GO3F 4PJ0U 1ZD5A 4YMMA 4DSEA 2B6GA 3Q8QB 3SAGA 4I2DA 4ED1A 2H3IA 1NK8A 1WCNA 1ZJMA 4M0AA 2D3DA 4DQQA 1ZQVA 1U49A 2HOFA 2W7OA 1A0PA 2XO7A 5AIAA 4R63A 2JGAA 4J03A 3PW0A 1UEUA 2K4HA 3CP8A 3PR5B 2HW3A 1COKA 4NWIA 1K5OA 2WF7A 2NO5A 4KITB 1Q8KA 3TACB 3BQ2A 2J6UA 3HJ4A 2ASJA 4UB6U 2KSOB 3JZ0A 2PFNA 2XIDA 7ICGA 1PVRA 4DFPA 2WB1C 5J2JA 1NI3A 1ZD3A 1BPXA 1D9DA 2HCFA 3SYZA 4OJOA 4DFMA 4CNQA 4KLHA 3MR3A 2ZH8A 2QARB 2IMWP 4GC7A 4G9BA 9ICBA 2I5HA 1YLQA 1BGXT 4EBEA 3QXGA 4ZOHC 4DWIA 1Z00A 2XICA 4O9MA 4QZDA 4FE3A 5EOZA 3AQEA 1ZQGA 5D46A 3TARA 3PX4A 2IHOA 1NJWA 5AKIA 2W9CB 2W55A 5D49A 1PVPA 5KL8B 4X4RA 4KLMA 3QUQA 5HNKA 2N1RA 4FFDA 2PMZF 5DDYA 4F5QA 4DFJA 2Y1JA 2W3RA 9ICPA 4M9HA 2K8CB 2KFNA 4FBUA 5AI5A 1R89A 4AYBF 3T5JA 1KFSA 2JH1A 4DL6A 2PFQA 4HYKA 8ICPA 4GXJA 4JWMA 4BJQA 4NXTA 4KB6A 4ELUA 1N2XA 2H3VA 4C7ZA 3MFIA 4YMNA 5KAIU 3B9JA 1ZXIA 1NOMA 1L8OA 4QZAA 3MR2A 4RQ5A 2J6SA 2F1HA 1N5XA 4P4MA 7ICNA 1HIWA 2KE7A 2L5YA 4ED8A 5EE9A 3RBEA 2LI6A 4C4TA 5L1KA 2R8KA 2OYYA 9ICWA 4RWOA 5EWGA 4FS2A 4UB1A 1Z00B 4Y2TA 4KMOB 1TFRA 5F3XB 2OHFA 4NXUA 1MQ3A 4EX7A 1X42A 1SZHA 3FDSA 4KMUA 1NKCA 2ZJ8A 2HN1A 5DGAA 3AUOA 4NM2A 2DPIA 4UBCA 1BNOA 4PHPA 4IG8A 4UD5A 5E79U 1OUQA 2ES6A 9ICEA 4O3SA 5DQHA 3B0YA 1ZRNA 3DV9A 3EUB2 2NV3A 4O68A 1ZQNA 4DL3A 3PO5A 2KIWA 4WC2A 3AN1A 4Z6EA 4AT8A 4TUSA 3TAQA 3NVVA 7ICHA 2P6RA 4NLKA 1SZPA 3ETRA 1X9WA 4E80A 8ICGA 2Q4TA 4OJ5A 4Y2QA 5EE3A 3OPXA 4X4QA 4BXOA 2O1PA 2G09A 4GLXA 1PVQA 2HHVA 1JALA 2ATLA 5J2IA 3V7KA 4QZIA 2HVIA 4YVZA 1SB3C 4QZEA 2ESEA 5ALKA 2IHMA 3G6YA 4ELTA 3RB4A 4QZHA 1IV8A 3JPNA 9ICMA 2BDUA 4K97A 9ICFA 5BPCA 5J0SA 3SI8A 5KTQA 3QU9A 5CEHA 1S0MA 9ICHA 4K8VA 5KFCA 4C8LA 4Y2XA 2EAOA 5DB8A 3K1ZA 4M2YA 4EYHB 1DK3A 3FAHA 9ICKA 1D8LA 5KG5A 3UXNA 3H8SA 3PW7A 2ISPA 4XQ8A 2AXTU 2ZIXB 2FMSA 2K8BB 2EANA 4Q8FA 3L3FX 4BDPA 1NK0A 2Y0SC 2KJ5A 5KFYA 3RJJA 4NKUA 3QEBZ 5KAFU 2KJ9A 2KP7A 3HKZC 4RNOA 3RF9A 2LM4A 1X6IA 1D8YA 5KFUA 5HREA 2UVUA 3GU3A 3ALRA 3Q8KA 3IN5A 4WC3A 2NRWA 1QH9A 4DEZA 4PHAA 3AQFA 5KG6A 3RAXA 3Q8MA 2YTUA 1JAJA 5HMMA 4J9NA 8ICZA 2IOHA 2VJ4A 1ZQWA 2AHOB 2BCSA 5JTGA 4KLTA 3F53A 3LYSA 1R8BA 2OXOA 4RWNA 3H8WA 3CNHA 4AT7A 3OHBA 2EDUA 2KHQA 1VFGA 5DB6A 3ISCA 3PZPA 3ER8C 3MDAA 4KM5A 3ETLA 4J9OA 4M47A 1Q3UA 4TURA 1ZRMA 4ECWA 4IQUA 3SZ2A 3ICXA 2DUYA 3CK6A 3QNMA 2DR5A 9ICSA 3IV6A 7ICSA 1S76D 2ZUCA 2DWQA 4G3IA 2BGWA 5J0RA 4RWPA 3MGIA 4WC5A 3G6XA 4M04A 3AQMA 4OJLA 5AKHA 4EENA 5ALFA 1CUKA 1B22A 3BZKA 3ORYA 3IG8A 5HRBA 2GA9D 3CYMA 2Y0SF 2ZH2A 1RDFA 5HRKA 3AU2A 1BPYA 2IOFA 5KG7A 4RQ6A 2F8KA 3T5LA 2E1EA 3T5KA 9ICGA 2I6XA 2MRLA 5HHIA 4X0BA 3C5GA 1JI7A 2NRTA 2A1JB 5C5JA 1YT3A 3PSPA 4US8A 4IRKA 1LB2B 4J9LA 5ALHA 2CPRA 4DSJA 1FFUA 4ECZA 5J0WA 3H38A 4YFKA 1TK8A 1Q46A 5ALXA 1ECWA 1ZD2P 4QZ8A 2XI9A 3BQTA 3H4BA 2G06A 2R8IA 2W9MA 2CXYA 2KG5A 3Q8RB 4AT9A 2YX8A 5KNIA 4F72A 5KFEA 3QE9Y 3UMBA 2J6TA 4K4IA 8ICOA 7ICOA 1KDHA 1S97A 2XGQA 4RQ3A 1TK0A 4RQ1A 4C8NA 4B9UA 2Y1IA 1PZNA 3NYBA 4I0UA 4QJFB 1L7MA 3H39A 3NUQA 2K4EA 4JV1A 2OCEA 4MFCA 7ICTA 5DG9A 4CGZA 8ICNA 2AU0A 3QYPA 1LV5A 3AEVA 5CR0A 3PW5A 4C8KA 1ZOLA 2GWSA 2LMRA 1AROP 4EELA 4K9BA 2LBOA 2KICA 3PW2A 2W8LA 2ZH9A 5KG2A 4QZGA 1SGGA 3FM9A 3ZDDA 2E8MA 2IA6A 2ZTDA 4LEWA 5J29A 4UW9A 3PX6A 4K98A 3MCRA 3RTVA 2GH1A 3O0FA 3BJYA 3D2QA 2JZBA 4B6JA 5J0XA 4RU9A 4QZFA 8ICUA 2XCAA 3MBYA 1X66A 2C2RA 1MIVA 3KZIU 5ALDA 2UVVA 4NXWA 2AQ0A 3KD3A 2MAXA 5J2AA 3SAHA 2ZIWB 4UQGA 5DQGA 7ICPA 1D8BA 3H0MB 9ICJA 4U7CA 4YD2A 3QU4A 5KFNA 3MC1A 2DPJA 1XSNA 2LKYA 2FI1A 4DL4A 3WFPA 2HHSA 4YR2A 2V4QA 3RH5A 4DOBA 4QW8A 4MKPA 5J2BA 1ZQBA 1WOTA 4PGXA 4P0QA 1N5WA 3SV3A 3RFAA 2G5IB 5ALPA 4JK1A 4I2FA 3NVWA
chains in the Genus database with same CATH topology
2JEFA 1ZQGA 3PV8A 5D46A 3TARA 1T4GA 4F4WA 3OSNA 4DL7A 4F5NA 3PX4A 4F4KA 1ZQEA 4I2CA 4M9NA 1NJWA 2HHQA 5KFKA 1NK4A 1ZQQA 4B9NA 4YMOA 4F4YA 2W9CB 1S10A 3ZDEA 2PFOA 4QZ9A 3QEAZ 1NKBA 5D49A 4ATBA 8ICAA 1DGSA 4Z6CA 2XGPA 4KLIA 2C28A 4X4RA 1FA0A 4MF8A 5IIIA 4KLMA 4DSFA 4FHYA 1UT8A 4F5RA 5HNKA 7ICMA 5EWEA 2ZH6A 3H7IA 2VA3A 5CP2A 4F2SA 5DDYA 4F5QA 3C21A 4LT6A 5KFVA 4DFJA 2R8GA 4DQSA 5IIOA 1ZETA 5KG3A 2Y1JA 3RJEA 1DK2A 4IR9A 2UVWA 3HJ1A 2V4RA 3C2MA 9ICPA 4J9PA 4M9HA 1ZQHA 1BPEA 2KFNA 1JN3A 5CWRA 4RT3A 3OJUA 1NKEA 1L3UA 4FBUA 7ICUA 4X4OA 1UA0A 5DG8A 1K1QA 1R89A 2P6UA 1XWLA 4EBCA 3T5JA 4RPYA 5KFJA 2R8HA 4DL6A 1KFSA 2BQ3A 4KLFA 2AGPA 4YR3A 1B43A 2PFQA 2VA2A 5KG4A 5KT5A 4X4VA 1ZQMA 3C2KA 4HYKA 3EZ5A 1NK7A 1JMSA 4QZCA 4B9SA 2XC9A 8ICPA 3RR7A 1UT5A 2Q0ZX 3C66A 4GXJA 4DS4A 4JWMA 1ZQJA 4ELUA 3MFIA 4KLDA 7ICQA 1S9FA 4KLLA 4DS5A 1X2IA 4YMNA 4BWMA 1XC9A 4J9QA 9ICAA 2V9WA 1NOMA 4RPZA 3RJIA 4CCHA 8ICFA 2DRBA 4QZAA 3GV5B 2W9AA 1JX4A 1JQRA 3MR2A 4XQ7A 2M2TA 8ICJA 1VJ7A 4RQ5A 1ZQCA 2J6SA 4ECXA 3BDPA 4IRCA 1BNPA 2F1HA 5EWFA 3FYHA 2ZTCA 2RDIA 4FHPA 2HHXA 5DB7A 3HWTA 4P4MA 4I2BA 1TAUA 7ICNA 3L9DA 4UB3A 4WC1A 4ED8A 1SKSA 4YCXA 1S0NA 4ZH4A 4PHDA 4TUPA 2KFZA 9ICLA 3ISBA 4ED3A 5IIMA 3RBEA 8ICWA 5KFTA 5L1KA 2R8KA 9ICWA 1IM4A 5HP4A 4RWOA 3KHLA 4DL2A 5KFIA 5EWGA 1ZYQA 2O5AA 1NZPA 4M9JA 3OVBA 4F2RA 4K4GA 4FS2A 4TQRA 4UB1A 1Z00B 4EBKA 1TFRA 3AQLA 3QZ8A 2C22A 7ICFA 4FHWA 4RNNA 1RYRA 1MQ3A 5L1LA 5F2VO 5KFPA 2ZHAA 5J2FA 2F1IA 3RRHA 5KT7A 3QZ7A 3FDSA 4KMUA 1L3VA 1NKCA 2ZJ8A 4UB2A 4BGDA 2FPLA 2BPFA 1RXWA 5IILA 1X9SA 4ELVA 7ICJA 2RFFA 5DGAA 4ECSA 1S0VA 3AUOA 4X5VA 4NM2A 2DPIA 4X0BA 1SL0A 4UBCA 8ICLA 3NTUA 4PHPA 1BNOA 4PGYA 4IG8A 4UD5A 8ICCA 1ZJNA 4FBTA 2FLNA 1XSPA 2C2EA 1X9MA 1NK6A 1N56A 2FLLA 5KFSA 4QW9A 3RJFA 4O3SA 3V72A 8ICVA 9ICEA 4F92B 4DF4A 1DOQA 5DQHA 3B0YA 1RZTA 4C8MA 2FMQA 3UXPA 2JEGA 2M2UA 2MUTA 3M9NB 1ZQYA 3ZDCA 5J0UA 3V7JA 4DL3A 3B0XA 1ZQNA 3PO5A 1R8CA 1TV9A 3RJGA 2ZH7A 1T7PA 4WC2A 3OV7A 3OHAA 8ICMA 1TAQA 8ICXA 3TANA 1MC8A 4B9MA 2BE3A 4EZ9A 8ICIA 2JZBB 4NLGA 4Z6EA 1V4AA 4AT8A 4YXJA 3GIKA 4TUSA 3TAQA 3BQ1A 4KLEA 7ICHA 2P6RA 5D4BA 4NLKA 1SZPA 4PGQA 5DBAA 1QLNA 3EPIA 1C7YA 1X9WA 5BOLA 4E80A 1UA1A 8ICRA 4UBBA 4R66A 1TVAA 3IHQB 4KLOA 8ICGA 3T3FA 4J9SA 3TI0A 5J0YA 4P4OA 4ECTA 4BXOA 2KZMA 4ED2A 4M9GA 2O1PA 4X4QA 3OVSA 4LVSA 1S77D 2ZH5A 4GLXA 2HHVA 2ZUBA 5DBBA 4X4PA 2ATLA 2AJQA 4RQ0A 5J2IA 3KHHA 4XUSA 5J2CA 3V7KA 3KHGA 2PXIA 1SKWA 3UXOA 4I2IA 8ICEA 2IBKA 4QZIA 2HVIA 4YVZA 1NJZA 3JPTA 4QWBA 4QZEA 4E0DA 1MSWD 5J2KA 4PHEA 4O0IA 3Q8SB 2IHMA 1ZQRA 3G6YA 4ELTA 4FH5A 1H38A 3RB4A 1QTMA 4O3QA 4I2HA 4QZHA 4EZ6A 4IQWA 5HC9A 5L1JA 5BOMA 2DR9A 3JPNA 1XO1A 9ICMA 9ICFA 4EBDA 3PVXA 5BPCA 5J0SA 4ECQA 4FHXA 3SI8A 1N48A 4JV0A 2DR8A 4DSKA 4O3NA 4O3OA 5KTQA 4DOAA 3Q8LA 3RJHA 2B21A 1S0MA 3H4DA 1RPLA 4K4HA 9ICHA 3WFRE 4QWAA 2I1QA 5KFCA 1COOA 3UPQA 4C8LA 3MFHA 4Q8EA 3RB0A 4ED0A 3C23A 3K4GA 5J0PA 5DB8A 3M8SA 4UAZA 5J0QA 4M2YA 3H8JA 3GILA 4MEYA 2W9CA 4EYHB 1ZQTA 1DK3A 4YN4A 5JUMA 3GV7B 4F4XA 3OVAA 9ICKA 4KN4A 4YQWA 1BVSA 4QWEA 1D8LA 5KG5A 5DLGA 2RDJA 3UXNA 3H8SA 4F3OA 1BPBA 3EWAA 5KFZA 3GDXA 3PW7A 2ASDA 2ISPA 8ICQA 4XQ8A 1ZQSA 5DBCA 1PX5A 2FMSA 4KLQA 4NXZA 3M9OB 4YR0A 4Q8FA 2XY5A 4BXOB 4BDPA 2HVHA 4EBJA 1BPZA 5TZVA 4J9MA 1NK0A 3JPOA 5CB1A 5KFYA 5CHGA 4GXKA 3RH4A 3RJJA 3OUYB 4NKUA 3QEBZ 2BCRA 1JXLA 9ICRA 4X4UA 4MFAA 2XY7A 3K75D 5KFXA 2AGQA 2KP7A 4RPXA 3RH6A 4RNOA 4LZDA 9ICUA 4DO9A 3ISDA 1D8YA 1KFDA 5KFMA 4I29A 2FPMA 5KFUA 1F5AA 4DOCA 5HREA 1MIYA 2UVUA 3LWLA 4X4SA 2F1JA 4MF2A 3EPGA 5CA7A 4P2HA 4QWCA 4IRDA 4O3PA 3Q8KA 2HHTA 4WC3A 2NRWA 4DEZA 5KT3A 4M9LA 1NO5A 5J2EA 3LQCB 4PHAA 1ZQAA 3TFRA 5DDMA 4Z6DA 3PNCA 5KG6A 3C2LA 4IR1A 3JPRA 3T5HA 7ICLA 3RAXA 3Q8MA 2MUTB 3HIYA 3RAQA 2H5XA 4ED6A 1HUZA 2BCVA 3THVA 1HJPA 4R8UA 4Q43A 3AQNA 4X0AA 1JAJA 5HMMA 3RRGA 2AGOA 9ICVA 1CEZA 4RUAA 5DB9A 4J9NA 8ICZA 4P4PA 4ECRA 4B9LA 4JWNA 5J2HA 4NM1A 1ZQWA 5J0TA 3ZD9A 4WC0A 4S3NA 4RQ2A 3HP6A 1SKRA 2BCSA 4ECYA 2DVIA 2XCPA 1NK9A 4KLTA 4RUCA 4FO6A 4RT2A 3AU6A 2BQRA 4KLUA 3WFQE 4UB5A 1EXNA 1R8BA 4RWNA 9ICOA 2LYHA 4ED7A 3H8WA 5KFFA 4KLJA 3OHBA 3ZD8A 4AT7A 2NRXA 3M8RA 2M9NA 5KFDA 3PY8A 9ICTA 4NKTA 5DB6A 3OUYA 1VFGA 2PBEA 5KG1A 1OU5A 3EYZA 2ISOA 3ISCA 2BQUA 3ZDAA 8ICHA 2OWOA 3C1YA 4J9KA 3JYYA 3MDAA 1KLNA 4LZGA 1KRPA 1K1SA 3ETLA 3GIMA 4J9OA 2ZH1A 1D9FA 4M47A 2NRKA 5KFAA 4RZRA 3KTQA 3H40A 3LK9A 4TURA 9ICCA 3H37A 3JPQA 1TK5A 4I2EA 4ECWA 4IQUA 4RWQA 1SL2A 3HW8A 3SZ2A 4YP3A 4F4ZA 3N97B 1NJYA 4RNMA 1S0OA 5HRFA 1JXEA 5J2DA 1L5UA 4MFFA 3GIIA 2BDPA 7ICVA 4WBYA 4B9TA 4F50A 4MEXA 1UETA 2DR5A 3M9MB 7ICKA 8ICKA 4I2AA 4X4NA 4R64A 5IIJA 9ICSA 1A77A 3PR4A 8ICBA 3V7LA 3HPOA 7ICSA 2ZJ5A 3PW4A 3JPPA 2JEJA 1S76D 1ZQXA 2ZUCA 4EYIB 3RB6A 4G3IA 2BGWA 5J0RA 4NY8A 2HHPA 5DGBA 3MGIA 4FS1A 5IIKA 3UQ0A 4RWPA 3WFOA 3GIJA 3LWMA 2HHUA 3PMNA 1ZQPA 4WC5A 2FLPA 2BPGA 4ATBB 2BCQA 4DLGA 3G6XA 2WTFA 2AQ4A 4Q44A 2DRAA 4M04A 4ECUA 5CJ7A 2BPCA 1TKDA 3AQMA 9ICIA 2ZHBA 3UQ2A 1CUKA 1U48A 1B22A 1QSSA 3ORYA 4IQVA 2ZUDA 1XU4A 4DQPA 5HRBA 5HRGA 4DFKA 1Q79A 5KFLA 3PMLA 2IHNA 4PH5A 4C8OA 2ZH2A 3V6JA 1QSYA 1V9PA 4J9RA 5HRKA 3OGUA 3AU2A 1KFTA 4M6WB 5KG0A 1BPYA 5DLFA 1RYSA 5KG7A 4RQ6A 4F8RA 5KFWA 3EW9A 5IINA 4GC6A 3E2EA 2ASLA 3PX0A 1KNYA 3T5LA 4YG2A 3T5KA 1L3SA 1JIHA 1ZQZA 1NK5A 9ICGA 4QZBA 4BWJA 3GFKB 5HHIA 4AT9B 3GV8B 7ICIA 4AT8B 4I27A 4EEYA 3C5GA 4DQIA 2NRVA 2Q66A 2DFLA 5HRIA 4FH3A 4PPXA 2NRTA 2A1JB 4YXMA 8ICTA 1UEVA 5C5JA 4I2GA 5HHHA 3LDAA 2ZH3A 3KHRA 2FMPA 4E8FA 4DSLA 2M2WA 1A76A 4IRKA 1KTQA 5J0OA 3HX0A 1LB2B 4J9LA 4WCWA 4UAYA 4QWDA 4DF8A 5KFHA 3PO4A 5KFGA 4DSJA 2KN7A 4ECZA 5J0WA 3H38A 4YFKA 1NJXA 5KFQA 1TK8A 1ZQDA 2P66A 4RQ7A 5HRDA 4QZ8A 3BQTA 5DQIA 3H4BA 2R8IA 5J2GA 5KFBA 2W9MA 3HT3A 1U4BA 4EP7A 4ECVA 4F5PA 2UVRA 2KTQA 1ZQIA 3Q8RB 4GXIA 4KTQA 3UPSA 4AT9A 5L9XA 4Z6FA 2W9BB 4F5OA 1ZQFA 3C1ZA 9ICXA 4UD4A 5KFEA 3QE9Y 4I2JA 2J6TA 1U9LA 5KFRA 5DG7A 2PFPA 4K4IA 4O5KA 8ICOA 7ICOA 4E7XA 5L1IA 5F9NA 1KDHA 1S97A 9ICQA 4M6WA 2XGQA 5KT4A 4DL5A 2BHNA 4RQ3A 1TK0A 4RQ1A 4NLNA 4C8NA 4B9UA 2Y1IA 1WCLA 2R8JA 1KEJA 1PZNA 3NYBA 3C18A 2VA8A 1L3TA 1IXRA 1U47A 4O5EA 5F9LA 3SV4A 2KZZA 3JPSA 4YD1A 5HMLA 8ICSA 3H39A 4F93B 1XS9D 4IQTA 3OJSA 4JV1A 2C2DA 2VANA 2PI4A 4MFCA 4TQSA 7ICTA 5DG9A 8ICNA 4YMMA 2AU0A 1LV5A 5CR0A 4DSEA 5DKWA 3PW5A 3Q8PB 3Q8QB 4C8KA 1Q78A 2GWSA 4WC6A 3TFSA 2NRZA 1AROP 3MABA 2ID1A 3NGDA 2BKEA 3PW2A 4I2DA 2W8LA 1BPDA 4ED1A 1NK8A 2ZH9A 5KG2A 4KLGA 4TUQA 1WCNA 4QZGA 3MGHA 1MIWA 4RQ8A 3GQCA 1ZJMA 3ZDDA 4M0AA 7ICEA 4DQQA 3RB3A 4JV2A 1ZQVA 1U49A 5KFOA 2ZTDA 4KN7A 2IA6A 8ICYA 4XRHA 2XO7A 4UAWA 1ZQUA 5J29A 1ZQLA 1ZQOA 2M2VA 7ICRA 4AT7B 4R63A 3PX6A 2JEIA 2ZTEA 3TQ1A 4X4TA 3PW0A 3RTVA 5HRHA 4O5CA 1UEUA 3PR5B 3RJKA 1TFYA 2HW3A 4DQRA 2DR7A 3BJYA 4KITB 2JZBA 4NLZA 3OSPA 4R65A 1T3NA 5J0XA 4DLEA 2BR0A 3BQ2A 2J6UA 4FHVA 4RU9A 4QZFA 4Q45A 2BCUA 3RBDA 3HJ4A 8ICUA 4RQ4A 2ASJA 2KZ3A 2XCAA 3MBYA 4WC7A 2C2RA 3JZ0A 1QSLA 1XSLA 2PFNA 4KLSA 1MIVA 4B9VA 2UVVA 2I9GA 4DSIA 2AQ0A 5DEDA 7ICGA 3MR6A 4JUZA 4DFPA 5J2JA 2MAXA 5J2AA 3MDCA 2W8KA 3V6KA 3ZDBA 3RR8A 3TAPA 4UQGA 3N4MB 1T8EA 5DQGA 1BPXA 1D9DA 2W9BA 3SYZA 7ICPA 4DFMA 1ZQKA 3AQKA 9ICJA 1MQ2A 3MR3A 4KLHA 2ZH8A 4XA5A 4YD2A 4GC7A 5KFNA 1KSPA 2DPJA 2IMWP 2PI5A 1XSNA 5HR9A 1R8AA 4DL4A 3C5FA 1U45A 9ICBA 1Y88A 2XY6A 3WFPA 5KT2A 2ZJAA 2FPKA 2HHSA 3V6HA 4M5DA 4YR2A 4R8UB 3WFSC 3MR5A 2V4QA 1YLQA 3RH5A 1BGXT 4DOBA 4QW8A 4EBEA 2ALZA 5J2BA 3IM1A 1ZQBA 4DWIA 1Z00A 4PGXA 1WOTA 1HUOA 2HHWA 1Z3EB 3SV3A 3BQ0A 1SL1A 4QZDA 4O9MA 5HRLA 5DECA 2ZH4A 4O3RA 9ICNA 4JK1A 3G6VA 4I2FA 4F91B 2A1JA 1RXVA 5EOZA 4UB4A 4I28A 3H3AA 4WC4A 4WBZA 1TFWA 5KT6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEF A;  1ZQG A;  3PV8 A;  5D46 A;  3TAR A;  1T4G A;  4F4W A;  3OSN A;  4DL7 A;  4F5N A;  3PX4 A;  4F4K A;  1ZQE A;  4I2C A;  4M9N A;  1NJW A;  2HHQ A;  5KFK A;  1NK4 A;  1ZQQ A;  4B9N A;  4YMO A;  4F4Y A;  2W9C B;  1S10 A;  3ZDE A;  2PFO A;  4QZ9 A;  3QEA Z;  1NKB A;  5D49 A;  4ATB A;  8ICA A;  1DGS A;  4Z6C A;  2XGP A;  4KLI A;  2C28 A;  4X4R A;  1FA0 A;  4MF8 A;  5III A;  4KLM A;  4DSF A;  4FHY A;  1UT8 A;  4F5R A;  5HNK A;  7ICM A;  5EWE A;  2ZH6 A;  3H7I A;  2VA3 A;  5CP2 A;  4F2S A;  5DDY A;  4F5Q A;  3C21 A;  4LT6 A;  5KFV A;  4DFJ A;  2R8G A;  4DQS A;  5IIO A;  1ZET A;  5KG3 A;  2Y1J A;  3RJE A;  1DK2 A;  4IR9 A;  2UVW A;  3HJ1 A;  2V4R A;  3C2M A;  9ICP A;  4J9P A;  4M9H A;  1ZQH A;  1BPE A;  2KFN A;  1JN3 A;  5CWR A;  4RT3 A;  3OJU A;  1NKE A;  1L3U A;  4FBU A;  7ICU A;  4X4O A;  1UA0 A;  5DG8 A;  1K1Q A;  1R89 A;  2P6U A;  1XWL A;  4EBC A;  3T5J A;  4RPY A;  5KFJ A;  2R8H A;  4DL6 A;  1KFS A;  2BQ3 A;  4KLF A;  2AGP A;  4YR3 A;  1B43 A;  2PFQ A;  2VA2 A;  5KG4 A;  5KT5 A;  4X4V A;  1ZQM A;  3C2K A;  4HYK A;  3EZ5 A;  1NK7 A;  1JMS A;  4QZC A;  4B9S A;  2XC9 A;  8ICP A;  3RR7 A;  1UT5 A;  2Q0Z X;  3C66 A;  4GXJ A;  4DS4 A;  4JWM A;  1ZQJ A;  4ELU A;  3MFI A;  4KLD A;  7ICQ A;  1S9F A;  4KLL A;  4DS5 A;  1X2I A;  4YMN A;  4BWM A;  1XC9 A;  4J9Q A;  9ICA A;  2V9W A;  1NOM A;  4RPZ A;  3RJI A;  4CCH A;  8ICF A;  2DRB A;  4QZA A;  3GV5 B;  2W9A A;  1JX4 A;  1JQR A;  3MR2 A;  4XQ7 A;  2M2T A;  8ICJ A;  1VJ7 A;  4RQ5 A;  1ZQC A;  2J6S A;  4ECX A;  3BDP A;  4IRC A;  1BNP A;  2F1H A;  5EWF A;  3FYH A;  2ZTC A;  2RDI A;  4FHP A;  2HHX A;  5DB7 A;  3HWT A;  4P4M A;  4I2B A;  1TAU A;  7ICN A;  3L9D A;  4UB3 A;  4WC1 A;  4ED8 A;  1SKS A;  4YCX A;  1S0N A;  4ZH4 A;  4PHD A;  4TUP A;  2KFZ A;  9ICL A;  3ISB A;  4ED3 A;  5IIM A;  3RBE A;  8ICW A;  5KFT A;  5L1K A;  2R8K A;  9ICW A;  1IM4 A;  5HP4 A;  4RWO A;  3KHL A;  4DL2 A;  5KFI A;  5EWG A;  1ZYQ A;  2O5A A;  1NZP A;  4M9J A;  3OVB A;  4F2R A;  4K4G A;  4FS2 A;  4TQR A;  4UB1 A;  1Z00 B;  4EBK A;  1TFR A;  3AQL A;  3QZ8 A;  2C22 A;  7ICF A;  4FHW A;  4RNN A;  1RYR A;  1MQ3 A;  5L1L A;  5F2V O;  5KFP A;  2ZHA A;  5J2F A;  2F1I A;  3RRH A;  5KT7 A;  3QZ7 A;  3FDS A;  4KMU A;  1L3V A;  1NKC A;  2ZJ8 A;  4UB2 A;  4BGD A;  2FPL A;  2BPF A;  1RXW A;  5IIL A;  1X9S A;  4ELV A;  7ICJ A;  2RFF A;  5DGA A;  4ECS A;  1S0V A;  3AUO A;  4X5V A;  4NM2 A;  2DPI A;  4X0B A;  1SL0 A;  4UBC A;  8ICL A;  3NTU A;  4PHP A;  1BNO A;  4PGY A;  4IG8 A;  4UD5 A;  8ICC A;  1ZJN A;  4FBT A;  2FLN A;  1XSP A;  2C2E A;  1X9M A;  1NK6 A;  1N56 A;  2FLL A;  5KFS A;  4QW9 A;  3RJF A;  4O3S A;  3V72 A;  8ICV A;  9ICE A;  4F92 B;  4DF4 A;  1DOQ A;  5DQH A;  3B0Y A;  1RZT A;  4C8M A;  2FMQ A;  3UXP A;  2JEG A;  2M2U A;  2MUT A;  3M9N B;  1ZQY A;  3ZDC A;  5J0U A;  3V7J A;  4DL3 A;  3B0X A;  1ZQN A;  3PO5 A;  1R8C A;  1TV9 A;  3RJG A;  2ZH7 A;  1T7P A;  4WC2 A;  3OV7 A;  3OHA A;  8ICM A;  1TAQ A;  8ICX A;  3TAN A;  1MC8 A;  4B9M A;  2BE3 A;  4EZ9 A;  8ICI A;  2JZB B;  4NLG A;  4Z6E A;  1V4A A;  4AT8 A;  4YXJ A;  3GIK A;  4TUS A;  3TAQ A;  3BQ1 A;  4KLE A;  7ICH A;  2P6R A;  5D4B A;  4NLK A;  1SZP A;  4PGQ A;  5DBA A;  1QLN A;  3EPI A;  1C7Y A;  1X9W A;  5BOL A;  4E80 A;  1UA1 A;  8ICR A;  4UBB A;  4R66 A;  1TVA A;  3IHQ B;  4KLO A;  8ICG A;  3T3F A;  4J9S A;  3TI0 A;  5J0Y A;  4P4O A;  4ECT A;  4BXO A;  2KZM A;  4ED2 A;  4M9G A;  2O1P A;  4X4Q A;  3OVS A;  4LVS A;  1S77 D;  2ZH5 A;  4GLX A;  2HHV A;  2ZUB A;  5DBB A;  4X4P A;  2ATL A;  2AJQ A;  4RQ0 A;  5J2I A;  3KHH A;  4XUS A;  5J2C A;  3V7K A;  3KHG A;  2PXI A;  1SKW A;  3UXO A;  4I2I A;  8ICE A;  2IBK A;  4QZI A;  2HVI A;  4YVZ A;  1NJZ A;  3JPT A;  4QWB A;  4QZE A;  4E0D A;  1MSW D;  5J2K A;  4PHE A;  4O0I A;  3Q8S B;  2IHM A;  1ZQR A;  3G6Y A;  4ELT A;  4FH5 A;  1H38 A;  3RB4 A;  1QTM A;  4O3Q A;  4I2H A;  4QZH A;  4EZ6 A;  4IQW A;  5HC9 A;  5L1J A;  5BOM A;  2DR9 A;  3JPN A;  1XO1 A;  9ICM A;  9ICF A;  4EBD A;  3PVX A;  5BPC A;  5J0S A;  4ECQ A;  4FHX A;  3SI8 A;  1N48 A;  4JV0 A;  2DR8 A;  4DSK A;  4O3N A;  4O3O A;  5KTQ A;  4DOA A;  3Q8L A;  3RJH A;  2B21 A;  1S0M A;  3H4D A;  1RPL A;  4K4H A;  9ICH A;  3WFR E;  4QWA A;  2I1Q A;  5KFC A;  1COO A;  3UPQ A;  4C8L A;  3MFH A;  4Q8E A;  3RB0 A;  4ED0 A;  3C23 A;  3K4G A;  5J0P A;  5DB8 A;  3M8S A;  4UAZ A;  5J0Q A;  4M2Y A;  3H8J A;  3GIL A;  4MEY A;  2W9C A;  4EYH B;  1ZQT A;  1DK3 A;  4YN4 A;  5JUM A;  3GV7 B;  4F4X A;  3OVA A;  9ICK A;  4KN4 A;  4YQW A;  1BVS A;  4QWE A;  1D8L A;  5KG5 A;  5DLG A;  2RDJ A;  3UXN A;  3H8S A;  4F3O A;  1BPB A;  3EWA A;  5KFZ A;  3GDX A;  3PW7 A;  2ASD A;  2ISP A;  8ICQ A;  4XQ8 A;  1ZQS A;  5DBC A;  1PX5 A;  2FMS A;  4KLQ A;  4NXZ A;  3M9O B;  4YR0 A;  4Q8F A;  2XY5 A;  4BXO B;  4BDP A;  2HVH A;  4EBJ A;  1BPZ A;  5TZV A;  4J9M A;  1NK0 A;  3JPO A;  5CB1 A;  5KFY A;  5CHG A;  4GXK A;  3RH4 A;  3RJJ A;  3OUY B;  4NKU A;  3QEB Z;  2BCR A;  1JXL A;  9ICR A;  4X4U A;  4MFA A;  2XY7 A;  3K75 D;  5KFX A;  2AGQ A;  2KP7 A;  4RPX A;  3RH6 A;  4RNO A;  4LZD A;  9ICU A;  4DO9 A;  3ISD A;  1D8Y A;  1KFD A;  5KFM A;  4I29 A;  2FPM A;  5KFU A;  1F5A A;  4DOC A;  5HRE A;  1MIY A;  2UVU A;  3LWL A;  4X4S A;  2F1J A;  4MF2 A;  3EPG A;  5CA7 A;  4P2H A;  4QWC A;  4IRD A;  4O3P A;  3Q8K A;  2HHT A;  4WC3 A;  2NRW A;  4DEZ A;  5KT3 A;  4M9L A;  1NO5 A;  5J2E A;  3LQC B;  4PHA A;  1ZQA A;  3TFR A;  5DDM A;  4Z6D A;  3PNC A;  5KG6 A;  3C2L A;  4IR1 A;  3JPR A;  3T5H A;  7ICL A;  3RAX A;  3Q8M A;  2MUT B;  3HIY A;  3RAQ A;  2H5X A;  4ED6 A;  1HUZ A;  2BCV A;  3THV A;  1HJP A;  4R8U A;  4Q43 A;  3AQN A;  4X0A A;  1JAJ A;  5HMM A;  3RRG A;  2AGO A;  9ICV A;  1CEZ A;  4RUA A;  5DB9 A;  4J9N A;  8ICZ A;  4P4P A;  4ECR A;  4B9L A;  4JWN A;  5J2H A;  4NM1 A;  1ZQW A;  5J0T A;  3ZD9 A;  4WC0 A;  4S3N A;  4RQ2 A;  3HP6 A;  1SKR A;  2BCS A;  4ECY A;  2DVI A;  2XCP A;  1NK9 A;  4KLT A;  4RUC A;  4FO6 A;  4RT2 A;  3AU6 A;  2BQR A;  4KLU A;  3WFQ E;  4UB5 A;  1EXN A;  1R8B A;  4RWN A;  9ICO A;  2LYH A;  4ED7 A;  3H8W A;  5KFF A;  4KLJ A;  3OHB A;  3ZD8 A;  4AT7 A;  2NRX A;  3M8R A;  2M9N A;  5KFD A;  3PY8 A;  9ICT A;  4NKT A;  5DB6 A;  3OUY A;  1VFG A;  2PBE A;  5KG1 A;  1OU5 A;  3EYZ A;  2ISO A;  3ISC A;  2BQU A;  3ZDA A;  8ICH A;  2OWO A;  3C1Y A;  4J9K A;  3JYY A;  3MDA A;  1KLN A;  4LZG A;  1KRP A;  1K1S A;  3ETL A;  3GIM A;  4J9O A;  2ZH1 A;  1D9F A;  4M47 A;  2NRK A;  5KFA A;  4RZR A;  3KTQ A;  3H40 A;  3LK9 A;  4TUR A;  9ICC A;  3H37 A;  3JPQ A;  1TK5 A;  4I2E A;  4ECW A;  4IQU A;  4RWQ A;  1SL2 A;  3HW8 A;  3SZ2 A;  4YP3 A;  4F4Z A;  3N97 B;  1NJY A;  4RNM A;  1S0O A;  5HRF A;  1JXE A;  5J2D A;  1L5U A;  4MFF A;  3GII A;  2BDP A;  7ICV A;  4WBY A;  4B9T A;  4F50 A;  4MEX A;  1UET A;  2DR5 A;  3M9M B;  7ICK A;  8ICK A;  4I2A A;  4X4N A;  4R64 A;  5IIJ A;  9ICS A;  1A77 A;  3PR4 A;  8ICB A;  3V7L A;  3HPO A;  7ICS A;  2ZJ5 A;  3PW4 A;  3JPP A;  2JEJ A;  1S76 D;  1ZQX A;  2ZUC A;  4EYI B;  3RB6 A;  4G3I A;  2BGW A;  5J0R A;  4NY8 A;  2HHP A;  5DGB A;  3MGI A;  4FS1 A;  5IIK A;  3UQ0 A;  4RWP A;  3WFO A;  3GIJ A;  3LWM A;  2HHU A;  3PMN A;  1ZQP A;  4WC5 A;  2FLP A;  2BPG A;  4ATB B;  2BCQ A;  4DLG A;  3G6X A;  2WTF A;  2AQ4 A;  4Q44 A;  2DRA A;  4M04 A;  4ECU A;  5CJ7 A;  2BPC A;  1TKD A;  3AQM A;  9ICI A;  2ZHB A;  3UQ2 A;  1CUK A;  1U48 A;  1B22 A;  1QSS A;  3ORY A;  4IQV A;  2ZUD A;  1XU4 A;  4DQP A;  5HRB A;  5HRG A;  4DFK A;  1Q79 A;  5KFL A;  3PML A;  2IHN A;  4PH5 A;  4C8O A;  2ZH2 A;  3V6J A;  1QSY A;  1V9P A;  4J9R A;  5HRK A;  3OGU A;  3AU2 A;  1KFT A;  4M6W B;  5KG0 A;  1BPY A;  5DLF A;  1RYS A;  5KG7 A;  4RQ6 A;  4F8R A;  5KFW A;  3EW9 A;  5IIN A;  4GC6 A;  3E2E A;  2ASL A;  3PX0 A;  1KNY A;  3T5L A;  4YG2 A;  3T5K A;  1L3S A;  1JIH A;  1ZQZ A;  1NK5 A;  9ICG A;  4QZB A;  4BWJ A;  3GFK B;  5HHI A;  4AT9 B;  3GV8 B;  7ICI A;  4AT8 B;  4I27 A;  4EEY A;  3C5G A;  4DQI A;  2NRV A;  2Q66 A;  2DFL A;  5HRI A;  4FH3 A;  4PPX A;  2NRT A;  2A1J B;  4YXM A;  8ICT A;  1UEV A;  5C5J A;  4I2G A;  5HHH A;  3LDA A;  2ZH3 A;  3KHR A;  2FMP A;  4E8F A;  4DSL A;  2M2W A;  1A76 A;  4IRK A;  1KTQ A;  5J0O A;  3HX0 A;  1LB2 B;  4J9L A;  4WCW A;  4UAY A;  4QWD A;  4DF8 A;  5KFH A;  3PO4 A;  5KFG A;  4DSJ A;  2KN7 A;  4ECZ A;  5J0W A;  3H38 A;  4YFK A;  1NJX A;  5KFQ A;  1TK8 A;  1ZQD A;  2P66 A;  4RQ7 A;  5HRD A;  4QZ8 A;  3BQT A;  5DQI A;  3H4B A;  2R8I A;  5J2G A;  5KFB A;  2W9M A;  3HT3 A;  1U4B A;  4EP7 A;  4ECV A;  4F5P A;  2UVR A;  2KTQ A;  1ZQI A;  3Q8R B;  4GXI A;  4KTQ A;  3UPS A;  4AT9 A;  5L9X A;  4Z6F A;  2W9B B;  4F5O A;  1ZQF A;  3C1Z A;  9ICX A;  4UD4 A;  5KFE A;  3QE9 Y;  4I2J A;  2J6T A;  1U9L A;  5KFR A;  5DG7 A;  2PFP A;  4K4I A;  4O5K A;  8ICO A;  7ICO A;  4E7X A;  5L1I A;  5F9N A;  1KDH A;  1S97 A;  9ICQ A;  4M6W A;  2XGQ A;  5KT4 A;  4DL5 A;  2BHN A;  4RQ3 A;  1TK0 A;  4RQ1 A;  4NLN A;  4C8N A;  4B9U A;  2Y1I A;  1WCL A;  2R8J A;  1KEJ A;  1PZN A;  3NYB A;  3C18 A;  2VA8 A;  1L3T A;  1IXR A;  1U47 A;  4O5E A;  5F9L A;  3SV4 A;  2KZZ A;  3JPS A;  4YD1 A;  5HML A;  8ICS A;  3H39 A;  4F93 B;  1XS9 D;  4IQT A;  3OJS A;  4JV1 A;  2C2D A;  2VAN A;  2PI4 A;  4MFC A;  4TQS A;  7ICT A;  5DG9 A;  8ICN A;  4YMM A;  2AU0 A;  1LV5 A;  5CR0 A;  4DSE A;  5DKW A;  3PW5 A;  3Q8P B;  3Q8Q B;  4C8K A;  1Q78 A;  2GWS A;  4WC6 A;  3TFS A;  2NRZ A;  1ARO P;  3MAB A;  2ID1 A;  3NGD A;  2BKE A;  3PW2 A;  4I2D A;  2W8L A;  1BPD A;  4ED1 A;  1NK8 A;  2ZH9 A;  5KG2 A;  4KLG A;  4TUQ A;  1WCN A;  4QZG A;  3MGH A;  1MIW A;  4RQ8 A;  3GQC A;  1ZJM A;  3ZDD A;  4M0A A;  7ICE A;  4DQQ A;  3RB3 A;  4JV2 A;  1ZQV A;  1U49 A;  5KFO A;  2ZTD A;  4KN7 A;  2IA6 A;  8ICY A;  4XRH A;  2XO7 A;  4UAW A;  1ZQU A;  5J29 A;  1ZQL A;  1ZQO A;  2M2V A;  7ICR A;  4AT7 B;  4R63 A;  3PX6 A;  2JEI A;  2ZTE A;  3TQ1 A;  4X4T A;  3PW0 A;  3RTV A;  5HRH A;  4O5C A;  1UEU A;  3PR5 B;  3RJK A;  1TFY A;  2HW3 A;  4DQR A;  2DR7 A;  3BJY A;  4KIT B;  2JZB A;  4NLZ A;  3OSP A;  4R65 A;  1T3N A;  5J0X A;  4DLE A;  2BR0 A;  3BQ2 A;  2J6U A;  4FHV A;  4RU9 A;  4QZF A;  4Q45 A;  2BCU A;  3RBD A;  3HJ4 A;  8ICU A;  4RQ4 A;  2ASJ A;  2KZ3 A;  2XCA A;  3MBY A;  4WC7 A;  2C2R A;  3JZ0 A;  1QSL A;  1XSL A;  2PFN A;  4KLS A;  1MIV A;  4B9V A;  2UVV A;  2I9G A;  4DSI A;  2AQ0 A;  5DED A;  7ICG A;  3MR6 A;  4JUZ A;  4DFP A;  5J2J A;  2MAX A;  5J2A A;  3MDC A;  2W8K A;  3V6K A;  3ZDB A;  3RR8 A;  3TAP A;  4UQG A;  3N4M B;  1T8E A;  5DQG A;  1BPX A;  1D9D A;  2W9B A;  3SYZ A;  7ICP A;  4DFM A;  1ZQK A;  3AQK A;  9ICJ A;  1MQ2 A;  3MR3 A;  4KLH A;  2ZH8 A;  4XA5 A;  4YD2 A;  4GC7 A;  5KFN A;  1KSP A;  2DPJ A;  2IMW P;  2PI5 A;  1XSN A;  5HR9 A;  1R8A A;  4DL4 A;  3C5F A;  1U45 A;  9ICB A;  1Y88 A;  2XY6 A;  3WFP A;  5KT2 A;  2ZJA A;  2FPK A;  2HHS A;  3V6H A;  4M5D A;  4YR2 A;  4R8U B;  3WFS C;  3MR5 A;  2V4Q A;  1YLQ A;  3RH5 A;  1BGX T;  4DOB A;  4QW8 A;  4EBE A;  2ALZ A;  5J2B A;  3IM1 A;  1ZQB A;  4DWI A;  1Z00 A;  4PGX A;  1WOT A;  1HUO A;  2HHW A;  1Z3E B;  3SV3 A;  3BQ0 A;  1SL1 A;  4QZD A;  4O9M A;  5HRL A;  5DEC A;  2ZH4 A;  4O3R A;  9ICN A;  4JK1 A;  3G6V A;  4I2F A;  4F91 B;  2A1J A;  1RXV A;  5EOZ A;  4UB4 A;  4I28 A;  3H3A A;  4WC4 A;  4WBZ A;  1TFW A;  5KT6 A; 
#chains in the Genus database with same CATH topology
 2JEF A;  1T4G A;  3OSN A;  1MA7 A;  1ZQQ A;  1X9X A;  4F4Y A;  5AM5 A;  2PFO A;  1DXS A;  1TE2 A;  4Z6C A;  1QQ5 A;  2XGP A;  4FHY A;  1UT8 A;  2ZH6 A;  3H7I A;  5CP2 A;  4LT6 A;  4EV6 A;  2ODG A;  2Y9T A;  2R8G A;  1ZET A;  5IIO A;  4CF5 A;  2V4R A;  3OJU A;  7ICU A;  1NKE A;  4K96 A;  1XWL A;  5KFJ A;  2HSZ A;  2R8H A;  4KLF A;  2BQ3 A;  4YR3 A;  1B0X A;  5B5E U;  4X4V A;  3EZ5 A;  1JMS A;  4B9S A;  3RR7 A;  3PHZ A;  3AL0 B;  1S9F A;  1X2I A;  4BWM A;  1XC9 A;  4J9Q A;  3RJI A;  4CCH A;  2DRB A;  1QCK A;  1VJ7 A;  8ICJ A;  2PKE A;  4ECX A;  1LKY B;  3BDP A;  4NXV A;  5EWF A;  2A19 A;  2RDI A;  5DB7 A;  2MU2 A;  3H8M A;  3QX7 A;  2HBJ A;  1SKS A;  4YCX A;  1MN8 A;  9ICL A;  4TUP A;  3KZX A;  3NRW A;  2KFZ A;  3MGV A;  5IIM A;  5HP4 A;  4DL2 A;  1O08 A;  1ZYQ A;  2LPE A;  4RQN A;  4EBK A;  2WFA A;  3QZ8 A;  2C22 A;  5ALT A;  5F2V O;  2RP5 A;  5J2F A;  4EED A;  5KT7 A;  2FPL A;  1RXW A;  5IIL A;  1X9S A;  4ELV A;  2WHE A;  1S0V A;  3SAF A;  4PGY A;  4LJX A;  8ICC A;  4FBT A;  3OTQ A;  3HJE A;  4Y2J A;  1X9M A;  4O3M A;  2RHF A;  2VKQ A;  4OJ6 A;  2JV3 A;  4C8M A;  2FMQ A;  3UXP A;  2JEG A;  3V7J A;  4UB8 U;  4RQM A;  1T7P A;  1TAQ A;  3SQI A;  4Y2S A;  2OH2 A;  2P35 A;  2RRD A;  2HBM A;  1TAM A;  2K4I A;  5DBA A;  4EX6 A;  2GO7 A;  1C7Y A;  2DKX A;  1UA1 A;  4NLC A;  3T3F A;  3TI0 A;  4KX3 A;  5J0Y A;  3F2D A;  4OJP A;  4P4O A;  3OVS A;  4LVS A;  4X4P A;  3KHH A;  3KHG A;  2PXI A;  3UXO A;  4I2I A;  3JPT A;  4QWB A;  3QUC A;  4OCZ A;  3F2B A;  3M7D A;  2FDR A;  4PHE A;  1ZQR A;  4FH5 A;  2E8O A;  5AM4 A;  1H38 A;  4O3Q A;  1VLB A;  2EZY A;  1J2N A;  2F44 A;  1XO1 A;  1SWV A;  3PVX A;  4FHX A;  1N48 A;  2DR8 A;  2IUB A;  2KHV A;  4DSK A;  4O3N A;  3K1R B;  3Q8L A;  3RJH A;  2YML A;  5D63 A;  3WFR E;  1COO A;  4N7R A;  2KMD A;  4QNL A;  3RB0 A;  2EH9 A;  2W9C A;  5AI6 A;  3GIL A;  3GV7 B;  4F3O A;  4WCW A;  5KFZ A;  2ASD A;  1L7N A;  1Z1V A;  5DBC A;  1PX5 A;  3N28 A;  4YR0 A;  4BXO B;  4UAR A;  2HVH A;  4IC9 A;  5TZV A;  4J9M A;  3GZF A;  5ALL A;  1JXL A;  9ICR A;  1DGJ A;  4X4U A;  2XY7 A;  1PK3 A;  4RPX A;  4LZD A;  4I29 A;  1KFD A;  1F5A A;  5CHE A;  4DOC A;  4X4S A;  2F1J A;  3EPG A;  4IRD A;  5KT3 A;  1NO5 A;  1GPJ A;  5ALO A;  3LQC B;  4Z6D A;  3PNC A;  4IR1 A;  3T5H A;  3BS7 A;  2WAQ C;  3HIY A;  1N63 A;  2MUT B;  3RAQ A;  1HUZ A;  3THV A;  1HJP A;  4R8U A;  4X0A A;  3SEI A;  9ICV A;  4RUA A;  4P4P A;  3R9K A;  4ECR A;  2HN2 A;  5J2H A;  3I28 A;  5J0T A;  2XCP A;  4FO6 A;  1XO0 A;  2YN4 A;  3M8R A;  3PY8 A;  2WF8 A;  9ICT A;  5AM2 A;  3EYZ A;  2JR5 A;  2OWO A;  2GLE A;  4J9K A;  4LZG A;  1KLN A;  1NNL A;  3GIM A;  2W7P A;  2ZH1 A;  1D9F A;  2NRK A;  4RZR A;  5AK6 A;  4U6P A;  5CRX A;  2G07 A;  1TK5 A;  4OAH A;  4RWQ A;  3N97 B;  4YP3 A;  4F4Z A;  1S0O A;  4NLB A;  1SV0 C;  1IG6 A;  2BDP A;  2E8P A;  4MEX A;  1UET A;  4I2A A;  5IIJ A;  3PR4 A;  2JEJ A;  1SXE A;  3JPP A;  4EYI B;  5AKX A;  3RB6 A;  1OW5 A;  2HHP A;  5DGB A;  3NVO A;  3LWM A;  1ZQP A;  4DLG A;  2A3V A;  2WTF A;  2AQ4 A;  5ALE A;  4ECU A;  1TKD A;  1HEK A;  3WK5 A;  9ICI A;  1U48 A;  4IQV A;  5JTI A;  2ZUD A;  1XU4 A;  4DQP A;  1Q79 A;  5AIB A;  3TAD A;  4FZN A;  1SIJ A;  4C8O A;  2ZIV B;  1V9P A;  2B56 A;  3OGU A;  5DLF A;  1RYS A;  4F8R A;  2KD1 A;  4GC6 A;  1KNY A;  4YG2 A;  1L3S A;  1ZQZ A;  2QAR A;  1JRP A;  4BWJ A;  4PZO A;  4AT8 B;  4FZL A;  7ICI A;  1JUD A;  3IDW A;  2NRV A;  3NVY A;  2KIV A;  2HOQ A;  4I2G A;  2M2W A;  4FO1 A;  4OO1 J;  5K4L A;  5KFG A;  4KX5 A;  1ZQD A;  2BBH A;  4RQ7 A;  5DQI A;  1U4B A;  4WQK A;  2KJ8 A;  4F5P A;  2DBY A;  2W9B B;  4CF4 A;  2KK0 A;  4PL2 A;  5DG7 A;  3LVW A;  5L1I A;  3J81 j;  4DL5 A;  3WK9 A;  3LVV A;  4NL9 A;  2R8J A;  1KEJ A;  4UAV A;  4YD1 A;  4F93 B;  4IQT A;  3D6J A;  3OJS A;  5AKZ A;  2VAN A;  4C7Y A;  3Q8P B;  4WC6 A;  3TKA A;  2ID1 A;  3UM9 A;  2BKE A;  1BPD A;  4KLG A;  1MIW A;  4RQ8 A;  7ICE A;  3RB3 A;  4JV2 A;  3IP4 B;  8ICY A;  4QIW F;  4UAW A;  1O03 A;  1ZQO A;  1ZQ1 C;  2ZTE A;  4OD0 A;  4DQR A;  5AK5 A;  2DF4 B;  4DLE A;  1L7P A;  2ZXI A;  2HBK A;  4UAS A;  2BCU A;  2G5H B;  3EF2 A;  1S5L U;  2KZ3 A;  2YMM A;  5AKG A;  1FEZ A;  3MR6 A;  5A0L A;  3V6K A;  5CFU A;  3TAP A;  1T8E A;  2W9B A;  1CRX A;  2NYV A;  3AQK A;  1MQ2 A;  2DGZ A;  2KKV A;  2PI5 A;  5HR9 A;  3A0H U;  4LEZ A;  1U45 A;  1Y88 A;  5KT2 A;  2ZJA A;  2FPK A;  4M5D A;  3V6H A;  3NKU A;  2VIX A;  3MR5 A;  5KL1 B;  3U26 A;  1PK1 A;  3BQ0 A;  1SL1 A;  5HRL A;  5DEC A;  3K7D A;  4O3R A;  2ZH4 A;  4WC4 A;  4I28 A;  4WBZ A;  1TFW A;  2JXJ A;  5KT6 A;  2ZXH A;  4F4W A;  1CI4 A;  4F4K A;  4F5N A;  1ZQE A;  1NK4 A;  4QZ9 A;  1NKB A;  8ICA A;  4KLI A;  2C28 A;  3UMC A;  1X6J A;  4MF8 A;  4DSF A;  1SV4 A;  4F5R A;  7ICM A;  2VA3 A;  3ERC C;  2W04 A;  2BZF A;  5KFV A;  4DQS A;  4IR9 A;  2HI0 A;  4J9P A;  1JN3 A;  4X4O A;  1L3U A;  4WJ3 B;  2HBL A;  1K1Q A;  5DG8 A;  2P6U A;  4EBC A;  1LVH A;  4RPY A;  4AP9 A;  2AGP A;  1B43 A;  5KT5 A;  4EEB A;  1ZQM A;  4DFD A;  3C2K A;  3WK6 A;  2XC9 A;  4O69 A;  1UT5 A;  3C66 A;  4PZN A;  1ZQJ A;  4KLD A;  7ICQ A;  2B51 A;  4KLL A;  4DS5 A;  4P0P A;  2V9W A;  2Y9U A;  4RPZ A;  8ICF A;  3GV5 B;  2W9A A;  5AI9 A;  3BQ7 A;  1JX4 A;  1JQR A;  1ZQC A;  5GTI U;  4IRC A;  1BNP A;  3FYH A;  4FHP A;  2HHX A;  5ALI A;  2LHT A;  3HWT A;  1TAU A;  5J8Y C;  1KW4 A;  4UB3 A;  1S0N A;  4PHD A;  3ISB A;  3T79 A;  2F3N A;  2KVS A;  5ALY A;  1IM4 A;  1YZ6 A;  3FC4 A;  5KFI A;  3F2C A;  1NZP A;  4M9J A;  4F2R A;  4TQR A;  3AQL A;  7ICF A;  2YY6 A;  1RQL A;  4RNN A;  1RYR A;  4FHW A;  3ER9 B;  5L1L A;  5KFP A;  2F1I A;  3RRH A;  2EAM A;  1L3V A;  4UB2 A;  4BGD A;  1ZD4 A;  4LEY A;  3NTU A;  1XSP A;  1NK6 A;  3C29 A;  4QW9 A;  3RJF A;  3V72 A;  5AKL A;  4Y2U A;  3C28 A;  1RYU A;  2YMQ A;  2M2U A;  2MUT A;  3IRU A;  3ZDC A;  5J0U A;  3B0X A;  5ALW A;  1R8C A;  1TV9 A;  2ZH7 A;  3OHA A;  8ICX A;  4O6A A;  2BE3 A;  4EZ9 A;  8ICI A;  5CFT A;  1V4A A;  4YXJ A;  3BQ1 A;  1QLN A;  2KEY A;  5BOL A;  8ICR A;  4KLO A;  4J9S A;  1IIP A;  2B0C A;  2KZM A;  2AH5 A;  4ED2 A;  4M9G A;  3QU7 A;  2ZUB A;  5DBB A;  2QLT A;  2AJQ A;  4RQ0 A;  3E0F A;  8ICE A;  1SKW A;  2A1A A;  5AKE A;  2YQE A;  5AM0 A;  1NJZ A;  4NXX A;  4O0I A;  3Q8S B;  2W03 A;  2LM1 A;  1JRO A;  4NL9 C;  1QTM A;  4I2H A;  5HC9 A;  5BOM A;  5CFS A;  3WK8 A;  4EBD A;  2QB0 B;  4ECQ A;  4DOA A;  1SWW A;  4K4H A;  4QWA A;  3UPQ A;  4Q8E A;  3MFH A;  4ED0 A;  3C23 A;  3K4G A;  5J0P A;  2D6F C;  2O6K A;  4UAZ A;  4MEY A;  4MHV A;  3D2S A;  3OVA A;  4KN4 A;  5EE0 A;  4QWE A;  4K99 A;  5DLG A;  2RDJ A;  1YZ7 A;  8ICQ A;  1BPB A;  3GDX A;  1ZQS A;  4KLQ A;  3M9O B;  4HAI A;  2XY5 A;  4EBJ A;  2D8C A;  3OUY B;  5CHG A;  3RH4 A;  1M6Y A;  1Z4O A;  2W54 A;  3K75 D;  5KFX A;  2E1F A;  5B3P A;  9ICU A;  2R18 A;  2JHD A;  2K8A A;  1MIY A;  3PST A;  2GAF D;  3LWL A;  2M0N A;  4P2H A;  4O3P A;  4IL6 U;  2HHT A;  5J2E A;  2HOI A;  3BS5 B;  3JPR A;  1B4F A;  5JU5 A;  3M6Z A;  2K60 A;  5D62 A;  2FCL A;  2ZIV A;  2BCV A;  1VDV A;  5L1M A;  5ALM A;  3AQN A;  5AM3 A;  3RRG A;  3HRD D;  1Z19 A;  4NM1 A;  4B9L A;  4WC0 A;  4S3N A;  3HP6 A;  4ICA A;  4RUC A;  4KLU A;  3WFQ E;  9ICO A;  2ZG6 A;  4KLJ A;  3ZD8 A;  3WK4 A;  4FZM A;  2PBE A;  5KG1 A;  3JCF A;  3ZDA A;  2JMG A;  2K89 A;  1KRP A;  1K1S A;  3H40 A;  3NRZ A;  9ICC A;  3NVZ A;  5HRF A;  1NJY A;  4RNM A;  4MFF A;  7ICV A;  4WBY A;  4B9T A;  1A77 A;  2ZIU A;  3VCB A;  3V7L A;  3HPO A;  3PW4 A;  3WU2 U;  1ZQX A;  1WWV A;  2RLT A;  1FO4 A;  1PUZ A;  4NY8 A;  4FS1 A;  3WFO A;  3GIJ A;  5JRT A;  5G5H A;  2FLP A;  2BPG A;  4ATB B;  2BCQ A;  5CJ7 A;  2BPC A;  3PSI A;  1AQ6 A;  1URJ A;  2ZHB A;  3UQ2 A;  2DL0 A;  1Z1B A;  5HRG A;  3E58 A;  4DFK A;  5KFL A;  2IHN A;  5TIS U;  1QSY A;  1KN5 A;  4J9R A;  4BUG A;  5KFW A;  3SR6 A;  1T94 A;  3PX0 A;  2ASL A;  2FJ6 A;  2HDO A;  3A0B U;  3IG5 A;  1JIH A;  5FP0 A;  3GFK B;  4I27 A;  3H0R B;  2LYB A;  4DQI A;  4AYB C;  5HRI A;  4FH3 A;  1UEV A;  2QKQ A;  2FMP A;  4E8F A;  2DKZ A;  3KOO A;  1A76 A;  5ALV A;  1Z4N A;  4OAG A;  1KTQ A;  5J0O A;  4UAY A;  4DF8 A;  5KFH A;  1KQQ A;  4EEK A;  1NJX A;  5KFQ A;  5J2G A;  5KFB A;  3HT3 A;  4EP7 A;  4ECV A;  2KTQ A;  1ZQI A;  4KTQ A;  4F5O A;  4Z6F A;  5AHX A;  1ZQF A;  3C1Z A;  9ICX A;  5KFR A;  2PFP A;  4E7X A;  2MSN A;  5F9N A;  3NWI A;  9ICQ A;  4M6W A;  5KT4 A;  1S8O A;  3QUT A;  1WCL A;  1A6S A;  3N7P D;  3C18 A;  4O5E A;  3SV4 A;  8ICS A;  5AKJ A;  1P7D A;  1WWU A;  4TQS A;  3TAD C;  5DKW A;  5HR6 A;  1Q78 A;  3TFS A;  2NRZ A;  2W43 A;  3MAB A;  1RG6 A;  3NGD A;  5ALR A;  4TUQ A;  3MGH A;  2E5S A;  3GQC A;  2LYA A;  2EAP A;  5KFO A;  2QB0 A;  4KN7 A;  4XRH A;  1ZQU A;  1ZQL A;  2M2V A;  4AT7 B;  7ICR A;  2JEI A;  3TQ1 A;  3WKB A;  4X4T A;  1WYG A;  5HRH A;  1KKX A;  4O5C A;  1TFY A;  3RJK A;  1T3Q A;  1L8L A;  2OM6 A;  2DR7 A;  4NLZ A;  3OSP A;  4R65 A;  1T3N A;  2BR0 A;  4FHV A;  5AI8 A;  4Q45 A;  3RBD A;  4RQ4 A;  4ACO A;  4WC7 A;  5H2F U;  1QSL A;  1XSL A;  4KLS A;  4B9V A;  2WB1 F;  2I9G A;  1RM6 C;  3HIL A;  4DSI A;  5DED A;  4JUZ A;  2E8N A;  3MDC A;  2F76 X;  2W8K A;  3ZDB A;  3RR8 A;  3N4M B;  3F5A A;  1ZQK A;  3I76 A;  1WG8 A;  4XA5 A;  1KSP A;  2RQ5 A;  1R8A A;  3C5F A;  2XY6 A;  3WFS C;  4R8U B;  4P0Q B;  2QB1 A;  2ALZ A;  3PSF A;  5ALQ A;  3IM1 A;  3WK7 A;  2VJ5 A;  1HUO A;  2HHW A;  1Z3E B;  1VJ5 A;  2F77 X;  2HMX A;  1RQN A;  2WAQ F;  3SD7 A;  9ICN A;  3G6V A;  3H3A A;  4F91 B;  1V38 A;  2A1J A;  1RXV A;  4UB4 A;  2E3T A;  3PV8 A;  4MF2 A;  4DL7 A;  2HHQ A;  4I2C A;  4M9N A;  5B66 U;  5KFK A;  2H3Q A;  4B9N A;  4YMO A;  1N61 A;  1S10 A;  3ZDE A;  3QEA Z;  4ATB A;  4JLX A;  1DGS A;  2MA1 A;  3NS1 A;  1FA0 A;  5III A;  2YB1 A;  5EWE A;  4F2S A;  3C21 A;  5ALJ A;  5KG3 A;  3RJE A;  1DK2 A;  3D2N A;  2UVW A;  3HJ1 A;  4Y2V A;  4HX0 A;  3C2M A;  2CN1 A;  2EZZ A;  1ZQH A;  1BPE A;  4OAI Z;  1UHU A;  5CWR A;  4RT3 A;  1UA0 A;  2XVT A;  1F0M A;  1QQ7 A;  2VA2 A;  5KG4 A;  1NK7 A;  4QZC A;  2Q0Z X;  4DS4 A;  3M1Y A;  9ICA A;  1C20 A;  2B4V A;  2ZIU B;  4XQ7 A;  2JRZ A;  2M2T A;  4WQL A;  2ZTC A;  4I2B A;  3L9D A;  4WC1 A;  1ED1 A;  4NJ8 A;  4NV0 A;  2H3Z A;  3NAS A;  4ZH4 A;  5EE1 A;  4ED3 A;  8ICW A;  5KFT A;  3KHL A;  4LEV A;  4CF3 A;  2O5A A;  3OVB A;  4K4G A;  5B3Q A;  4WOY A;  2ZHA A;  3QZ7 A;  2G08 A;  2BBJ A;  2BPF A;  7ICJ A;  3KBB A;  3BZC A;  5AKY A;  2RFF A;  3VC8 A;  4ECS A;  2NO4 A;  4X5V A;  1SL0 A;  8ICL A;  2KKP A;  1ZJN A;  2FLN A;  4C80 A;  2C2E A;  3WKC A;  5AI0 A;  4C4S A;  1N56 A;  2FLL A;  5KFS A;  4BX9 C;  8ICV A;  4GIB A;  4F92 B;  2YMP A;  4DF4 A;  1DOQ A;  5ALS A;  3SMV A;  1RZT A;  3DDH A;  3M9N B;  4O67 A;  1ZQY A;  2FE9 A;  4WH5 A;  2WF6 A;  3RJG A;  3ONN A;  3OV7 A;  8ICM A;  3TAN A;  1MC8 A;  4B9M A;  4A8E A;  2JZB B;  4NLG A;  1WUD A;  2JH7 A;  3GIK A;  4KLE A;  2EZX A;  5D4B A;  4PGQ A;  3EPI A;  5G5G A;  4UBB A;  1L7O A;  4R66 A;  3IHQ B;  4Y2Y A;  1TVA A;  2H3F A;  2YB4 A;  4ECT A;  4C0Z A;  3WKE A;  5J8Y A;  4P0P B;  1S77 D;  2ZH5 A;  1F5S A;  2ZIX A;  2F2A B;  1NZB A;  4XUS A;  5J2C A;  4EGW A;  4PL1 A;  2IBK A;  4DCC A;  4C4R A;  4E0D A;  1MSW D;  5J2K A;  1Q3V A;  1UQV A;  3UMG A;  4OAF A;  4Y2R A;  4EZ6 A;  4IQW A;  5AIC A;  3S6J A;  5L1J A;  2DR9 A;  2PMZ C;  3WKD A;  3SEN A;  4JV0 A;  5C0Y A;  3M6K A;  4O3O A;  2B21 A;  2KOB A;  3H4D A;  1RPL A;  2I1Q A;  4US9 A;  5ALZ A;  3M8S A;  2F8L A;  5J0Q A;  3H8J A;  1ZQT A;  3OWG A;  3CW2 C;  4YN4 A;  5JUM A;  4F4X A;  1DRG A;  4YQW A;  1BVS A;  1XNS A;  3EWA A;  3KKA A;  3I1Y A;  4NXZ A;  2W3S A;  5ALG A;  1BPZ A;  3JPO A;  5AK4 A;  5ALN A;  4GXK A;  5ALU A;  5CB1 A;  2GOL A;  2BCR A;  4CE6 A;  2AGQ A;  4MFA A;  3RH6 A;  1FIQ A;  2IOF K;  3L4P A;  4JLZ A;  1V85 A;  4DO9 A;  3ISD A;  5KFM A;  2FPM A;  5CA7 A;  2KVC A;  4QWC A;  1N60 A;  4M9L A;  3N7R C;  1ZQA A;  3TFR A;  5DDM A;  3C2L A;  7ICL A;  1X40 A;  2H5X A;  4ED6 A;  2EWR A;  4Q43 A;  3BS5 A;  3ED5 A;  4QIW C;  3KFU F;  2AGO A;  1CEZ A;  5DB9 A;  4JWN A;  3H0L B;  4GFJ A;  3ZD9 A;  2G0A A;  4RQ2 A;  1SKR A;  4ECY A;  2OEH A;  2DVI A;  1NK9 A;  2ZIW A;  2BQR A;  2K4P A;  4RT2 A;  3AU6 A;  4UB5 A;  1EXN A;  2LYH A;  4ED7 A;  5KFF A;  2NRX A;  2M9N A;  1J97 A;  5KFD A;  4NKT A;  3WKA A;  3OUY A;  2CRX A;  4Y2P A;  1OU5 A;  2W11 A;  2ISO A;  8ICH A;  2BQU A;  3C1Y A;  1L6N A;  3JYY A;  1F44 A;  1FFV A;  5KFA A;  3KTQ A;  3AMZ A;  3LK9 A;  4CRX A;  3F5E A;  1QQ6 A;  3H37 A;  3JPQ A;  4I2E A;  3KKA C;  1SL2 A;  3HW8 A;  5HR7 A;  1JXE A;  5J2D A;  1L5U A;  3GII A;  1V97 A;  4F50 A;  3M9M B;  7ICK A;  1J2M A;  8ICK A;  4X4N A;  4R64 A;  8ICB A;  1SV0 A;  2ZJ5 A;  3QUB A;  4K9A A;  4JB3 A;  3CRX A;  3UQ0 A;  5IIK A;  2HHU A;  3PMN A;  3AM9 A;  2DRA A;  4Q44 A;  1QSS A;  2Z7J A;  3PML A;  3ZI4 A;  4PH5 A;  4USA A;  1PK1 B;  3V6J A;  4CDG A;  1KFT A;  4M6W B;  5KG0 A;  2EQY A;  5T14 A;  3EW9 A;  5IIN A;  3E2E A;  1N62 A;  4XJE A;  1OXJ A;  1NK5 A;  4QZB A;  5AKK A;  4AT9 B;  3GV8 B;  4IS7 A;  5GTH U;  4EEY A;  3QU2 A;  2Q66 A;  2DFL A;  4PPX A;  8ICT A;  4YXM A;  5HHH A;  3LDA A;  2ZH3 A;  3KHR A;  4DSL A;  1KBU A;  3HX0 A;  4QWD A;  3PO4 A;  1UPH A;  2KSO A;  2KN7 A;  1KL9 A;  4F71 A;  2WF9 A;  2P66 A;  5HRD A;  2UVR A;  5AM1 A;  4GXI A;  3UPS A;  5L9X A;  3HKZ F;  4UD4 A;  2WF5 A;  4I2J A;  5AK3 A;  1U9L A;  4JMU A;  4O5K A;  2BHN A;  1LKY A;  3DEE A;  4NLN A;  1UCV A;  4UAT A;  2DQN B;  2KNJ A;  2KV2 A;  2VA8 A;  5AI4 A;  1L3T A;  1IXR A;  1U47 A;  5F9L A;  2KZZ A;  3JPS A;  4UAU A;  5HML A;  1XS9 D;  3N7S C;  5D61 A;  3L5K A;  2C2D A;  3QU5 A;  1SXD A;  2PI4 A;  1GO3 F;  4PJ0 U;  1ZD5 A;  4YMM A;  4DSE A;  2B6G A;  3Q8Q B;  3SAG A;  4I2D A;  4ED1 A;  2H3I A;  1NK8 A;  1WCN A;  1ZJM A;  4M0A A;  2D3D A;  4DQQ A;  1ZQV A;  1U49 A;  2HOF A;  2W7O A;  1A0P A;  2XO7 A;  5AIA A;  4R63 A;  2JGA A;  4J03 A;  3PW0 A;  1UEU A;  2K4H A;  3CP8 A;  3PR5 B;  2HW3 A;  1COK A;  4NWI A;  1K5O A;  2WF7 A;  2NO5 A;  4KIT B;  1Q8K A;  3TAC B;  3BQ2 A;  2J6U A;  3HJ4 A;  2ASJ A;  4UB6 U;  2KSO B;  3JZ0 A;  2PFN A;  2XID A;  7ICG A;  1PVR A;  4DFP A;  2WB1 C;  5J2J A;  1NI3 A;  1ZD3 A;  1BPX A;  1D9D A;  2HCF A;  3SYZ A;  4OJO A;  4DFM A;  4CNQ A;  4KLH A;  3MR3 A;  2ZH8 A;  2QAR B;  2IMW P;  4GC7 A;  4G9B A;  9ICB A;  2I5H A;  1YLQ A;  1BGX T;  4EBE A;  3QXG A;  4ZOH C;  4DWI A;  1Z00 A;  2XIC A;  4O9M A;  4QZD A;  4FE3 A;  5EOZ A;  3AQE A;  1ZQG A;  5D46 A;  3TAR A;  3PX4 A;  2IHO A;  1NJW A;  5AKI A;  2W9C B;  2W55 A;  5D49 A;  1PVP A;  5KL8 B;  4X4R A;  4KLM A;  3QUQ A;  5HNK A;  2N1R A;  4FFD A;  2PMZ F;  5DDY A;  4F5Q A;  4DFJ A;  2Y1J A;  2W3R A;  9ICP A;  4M9H A;  2K8C B;  2KFN A;  4FBU A;  5AI5 A;  1R89 A;  4AYB F;  3T5J A;  1KFS A;  2JH1 A;  4DL6 A;  2PFQ A;  4HYK A;  8ICP A;  4GXJ A;  4JWM A;  4BJQ A;  4NXT A;  4KB6 A;  4ELU A;  1N2X A;  2H3V A;  4C7Z A;  3MFI A;  4YMN A;  5KAI U;  3B9J A;  1ZXI A;  1NOM A;  1L8O A;  4QZA A;  3MR2 A;  4RQ5 A;  2J6S A;  2F1H A;  1N5X A;  4P4M A;  7ICN A;  1HIW A;  2KE7 A;  2L5Y A;  4ED8 A;  5EE9 A;  3RBE A;  2LI6 A;  4C4T A;  5L1K A;  2R8K A;  2OYY A;  9ICW A;  4RWO A;  5EWG A;  4FS2 A;  4UB1 A;  1Z00 B;  4Y2T A;  4KMO B;  1TFR A;  5F3X B;  2OHF A;  4NXU A;  1MQ3 A;  4EX7 A;  1X42 A;  1SZH A;  3FDS A;  4KMU A;  1NKC A;  2ZJ8 A;  2HN1 A;  5DGA A;  3AUO A;  4NM2 A;  2DPI A;  4UBC A;  1BNO A;  4PHP A;  4IG8 A;  4UD5 A;  5E79 U;  1OUQ A;  2ES6 A;  9ICE A;  4O3S A;  5DQH A;  3B0Y A;  1ZRN A;  3DV9 A;  3EUB 2;  2NV3 A;  4O68 A;  1ZQN A;  4DL3 A;  3PO5 A;  2KIW A;  4WC2 A;  3AN1 A;  4Z6E A;  4AT8 A;  4TUS A;  3TAQ A;  3NVV A;  7ICH A;  2P6R A;  4NLK A;  1SZP A;  3ETR A;  1X9W A;  4E80 A;  8ICG A;  2Q4T A;  4OJ5 A;  4Y2Q A;  5EE3 A;  3OPX A;  4X4Q A;  4BXO A;  2O1P A;  2G09 A;  4GLX A;  1PVQ A;  2HHV A;  1JAL A;  2ATL A;  5J2I A;  3V7K A;  4QZI A;  2HVI A;  4YVZ A;  1SB3 C;  4QZE A;  2ESE A;  5ALK A;  2IHM A;  3G6Y A;  4ELT A;  3RB4 A;  4QZH A;  1IV8 A;  3JPN A;  9ICM A;  2BDU A;  4K97 A;  9ICF A;  5BPC A;  5J0S A;  3SI8 A;  5KTQ A;  3QU9 A;  5CEH A;  1S0M A;  9ICH A;  4K8V A;  5KFC A;  4C8L A;  4Y2X A;  2EAO A;  5DB8 A;  3K1Z A;  4M2Y A;  4EYH B;  1DK3 A;  3FAH A;  9ICK A;  1D8L A;  5KG5 A;  3UXN A;  3H8S A;  3PW7 A;  2ISP A;  4XQ8 A;  2AXT U;  2ZIX B;  2FMS A;  2K8B B;  2EAN A;  4Q8F A;  3L3F X;  4BDP A;  1NK0 A;  2Y0S C;  2KJ5 A;  5KFY A;  3RJJ A;  4NKU A;  3QEB Z;  5KAF U;  2KJ9 A;  2KP7 A;  3HKZ C;  4RNO A;  3RF9 A;  2LM4 A;  1X6I A;  1D8Y A;  5KFU A;  5HRE A;  2UVU A;  3GU3 A;  3ALR A;  3Q8K A;  3IN5 A;  4WC3 A;  2NRW A;  1QH9 A;  4DEZ A;  4PHA A;  3AQF A;  5KG6 A;  3RAX A;  3Q8M A;  2YTU A;  1JAJ A;  5HMM A;  4J9N A;  8ICZ A;  2IOH A;  2VJ4 A;  1ZQW A;  2AHO B;  2BCS A;  5JTG A;  4KLT A;  3F53 A;  3LYS A;  1R8B A;  2OXO A;  4RWN A;  3H8W A;  3CNH A;  4AT7 A;  3OHB A;  2EDU A;  2KHQ A;  1VFG A;  5DB6 A;  3ISC A;  3PZP A;  3ER8 C;  3MDA A;  4KM5 A;  3ETL A;  4J9O A;  4M47 A;  1Q3U A;  4TUR A;  1ZRM A;  4ECW A;  4IQU A;  3SZ2 A;  3ICX A;  2DUY A;  3CK6 A;  3QNM A;  2DR5 A;  9ICS A;  3IV6 A;  7ICS A;  1S76 D;  2ZUC A;  2DWQ A;  4G3I A;  2BGW A;  5J0R A;  4RWP A;  3MGI A;  4WC5 A;  3G6X A;  4M04 A;  3AQM A;  4OJL A;  5AKH A;  4EEN A;  5ALF A;  1CUK A;  1B22 A;  3BZK A;  3ORY A;  3IG8 A;  5HRB A;  2GA9 D;  3CYM A;  2Y0S F;  2ZH2 A;  1RDF A;  5HRK A;  3AU2 A;  1BPY A;  2IOF A;  5KG7 A;  4RQ6 A;  2F8K A;  3T5L A;  2E1E A;  3T5K A;  9ICG A;  2I6X A;  2MRL A;  5HHI A;  4X0B A;  3C5G A;  1JI7 A;  2NRT A;  2A1J B;  5C5J A;  1YT3 A;  3PSP A;  4US8 A;  4IRK A;  1LB2 B;  4J9L A;  5ALH A;  2CPR A;  4DSJ A;  1FFU A;  4ECZ A;  5J0W A;  3H38 A;  4YFK A;  1TK8 A;  1Q46 A;  5ALX A;  1ECW A;  1ZD2 P;  4QZ8 A;  2XI9 A;  3BQT A;  3H4B A;  2G06 A;  2R8I A;  2W9M A;  2CXY A;  2KG5 A;  3Q8R B;  4AT9 A;  2YX8 A;  5KNI A;  4F72 A;  5KFE A;  3QE9 Y;  3UMB A;  2J6T A;  4K4I A;  8ICO A;  7ICO A;  1KDH A;  1S97 A;  2XGQ A;  4RQ3 A;  1TK0 A;  4RQ1 A;  4C8N A;  4B9U A;  2Y1I A;  1PZN A;  3NYB A;  4I0U A;  4QJF B;  1L7M A;  3H39 A;  3NUQ A;  2K4E A;  4JV1 A;  2OCE A;  4MFC A;  7ICT A;  5DG9 A;  4CGZ A;  8ICN A;  2AU0 A;  3QYP A;  1LV5 A;  3AEV A;  5CR0 A;  3PW5 A;  4C8K A;  1ZOL A;  2GWS A;  2LMR A;  1ARO P;  4EEL A;  4K9B A;  2LBO A;  2KIC A;  3PW2 A;  2W8L A;  2ZH9 A;  5KG2 A;  4QZG A;  1SGG A;  3FM9 A;  3ZDD A;  2E8M A;  2IA6 A;  2ZTD A;  4LEW A;  5J29 A;  4UW9 A;  3PX6 A;  4K98 A;  3MCR A;  3RTV A;  2GH1 A;  3O0F A;  3BJY A;  3D2Q A;  2JZB A;  4B6J A;  5J0X A;  4RU9 A;  4QZF A;  8ICU A;  2XCA A;  3MBY A;  1X66 A;  2C2R A;  1MIV A;  3KZI U;  5ALD A;  2UVV A;  4NXW A;  2AQ0 A;  3KD3 A;  2MAX A;  5J2A A;  3SAH A;  2ZIW B;  4UQG A;  5DQG A;  7ICP A;  1D8B A;  3H0M B;  9ICJ A;  4U7C A;  4YD2 A;  3QU4 A;  5KFN A;  3MC1 A;  2DPJ A;  1XSN A;  2LKY A;  2FI1 A;  4DL4 A;  3WFP A;  2HHS A;  4YR2 A;  2V4Q A;  3RH5 A;  4DOB A;  4QW8 A;  4MKP A;  5J2B A;  1ZQB A;  1WOT A;  4PGX A;  4P0Q A;  1N5W A;  3SV3 A;  3RFA A;  2G5I B;  5ALP A;  4JK1 A;  4I2F A;  3NVW A; 
#chains in the Genus database with same CATH homology
 2JEF A;  1ZQG A;  3PV8 A;  5D46 A;  3TAR A;  1T4G A;  4F4W A;  3OSN A;  4DL7 A;  4F5N A;  3PX4 A;  4F4K A;  1ZQE A;  4I2C A;  4M9N A;  1NJW A;  2HHQ A;  5KFK A;  1NK4 A;  1ZQQ A;  4B9N A;  4YMO A;  4F4Y A;  2W9C B;  1S10 A;  3ZDE A;  2PFO A;  4QZ9 A;  3QEA Z;  1NKB A;  5D49 A;  4ATB A;  8ICA A;  1DGS A;  4Z6C A;  2XGP A;  4KLI A;  2C28 A;  4X4R A;  1FA0 A;  4MF8 A;  5III A;  4KLM A;  4DSF A;  4FHY A;  1UT8 A;  4F5R A;  5HNK A;  7ICM A;  5EWE A;  2ZH6 A;  3H7I A;  2VA3 A;  5CP2 A;  4F2S A;  5DDY A;  4F5Q A;  3C21 A;  4LT6 A;  5KFV A;  4DFJ A;  2R8G A;  4DQS A;  5IIO A;  1ZET A;  5KG3 A;  2Y1J A;  3RJE A;  1DK2 A;  4IR9 A;  2UVW A;  3HJ1 A;  2V4R A;  3C2M A;  9ICP A;  4J9P A;  4M9H A;  1ZQH A;  1BPE A;  2KFN A;  1JN3 A;  5CWR A;  4RT3 A;  3OJU A;  1NKE A;  1L3U A;  4FBU A;  7ICU A;  4X4O A;  1UA0 A;  5DG8 A;  1K1Q A;  1R89 A;  2P6U A;  1XWL A;  4EBC A;  3T5J A;  4RPY A;  5KFJ A;  2R8H A;  4DL6 A;  1KFS A;  2BQ3 A;  4KLF A;  2AGP A;  4YR3 A;  1B43 A;  2PFQ A;  2VA2 A;  5KG4 A;  5KT5 A;  4X4V A;  1ZQM A;  3C2K A;  4HYK A;  3EZ5 A;  1NK7 A;  1JMS A;  4QZC A;  4B9S A;  2XC9 A;  8ICP A;  3RR7 A;  1UT5 A;  2Q0Z X;  3C66 A;  4GXJ A;  4DS4 A;  4JWM A;  1ZQJ A;  4ELU A;  3MFI A;  4KLD A;  7ICQ A;  1S9F A;  4KLL A;  4DS5 A;  1X2I A;  4YMN A;  4BWM A;  1XC9 A;  4J9Q A;  9ICA A;  2V9W A;  1NOM A;  4RPZ A;  3RJI A;  4CCH A;  8ICF A;  2DRB A;  4QZA A;  3GV5 B;  2W9A A;  1JX4 A;  1JQR A;  3MR2 A;  4XQ7 A;  2M2T A;  8ICJ A;  1VJ7 A;  4RQ5 A;  1ZQC A;  2J6S A;  4ECX A;  3BDP A;  4IRC A;  1BNP A;  2F1H A;  5EWF A;  3FYH A;  2ZTC A;  2RDI A;  4FHP A;  2HHX A;  5DB7 A;  3HWT A;  4P4M A;  4I2B A;  1TAU A;  7ICN A;  3L9D A;  4UB3 A;  4WC1 A;  4ED8 A;  1SKS A;  4YCX A;  1S0N A;  4ZH4 A;  4PHD A;  4TUP A;  2KFZ A;  9ICL A;  3ISB A;  4ED3 A;  5IIM A;  3RBE A;  8ICW A;  5KFT A;  5L1K A;  2R8K A;  9ICW A;  1IM4 A;  5HP4 A;  4RWO A;  3KHL A;  4DL2 A;  5KFI A;  5EWG A;  1ZYQ A;  2O5A A;  1NZP A;  4M9J A;  3OVB A;  4F2R A;  4K4G A;  4FS2 A;  4TQR A;  4UB1 A;  1Z00 B;  4EBK A;  1TFR A;  3AQL A;  3QZ8 A;  2C22 A;  7ICF A;  4FHW A;  4RNN A;  1RYR A;  1MQ3 A;  5L1L A;  5F2V O;  5KFP A;  2ZHA A;  5J2F A;  2F1I A;  3RRH A;  5KT7 A;  3QZ7 A;  3FDS A;  4KMU A;  1L3V A;  1NKC A;  2ZJ8 A;  4UB2 A;  4BGD A;  2FPL A;  2BPF A;  1RXW A;  5IIL A;  1X9S A;  4ELV A;  7ICJ A;  2RFF A;  5DGA A;  4ECS A;  1S0V A;  3AUO A;  4X5V A;  4NM2 A;  2DPI A;  4X0B A;  1SL0 A;  4UBC A;  8ICL A;  3NTU A;  4PHP A;  1BNO A;  4PGY A;  4IG8 A;  4UD5 A;  8ICC A;  1ZJN A;  4FBT A;  2FLN A;  1XSP A;  2C2E A;  1X9M A;  1NK6 A;  1N56 A;  2FLL A;  5KFS A;  4QW9 A;  3RJF A;  4O3S A;  3V72 A;  8ICV A;  9ICE A;  4F92 B;  4DF4 A;  1DOQ A;  5DQH A;  3B0Y A;  1RZT A;  4C8M A;  2FMQ A;  3UXP A;  2JEG A;  2M2U A;  2MUT A;  3M9N B;  1ZQY A;  3ZDC A;  5J0U A;  3V7J A;  4DL3 A;  3B0X A;  1ZQN A;  3PO5 A;  1R8C A;  1TV9 A;  3RJG A;  2ZH7 A;  1T7P A;  4WC2 A;  3OV7 A;  3OHA A;  8ICM A;  1TAQ A;  8ICX A;  3TAN A;  1MC8 A;  4B9M A;  2BE3 A;  4EZ9 A;  8ICI A;  2JZB B;  4NLG A;  4Z6E A;  1V4A A;  4AT8 A;  4YXJ A;  3GIK A;  4TUS A;  3TAQ A;  3BQ1 A;  4KLE A;  7ICH A;  2P6R A;  5D4B A;  4NLK A;  1SZP A;  4PGQ A;  5DBA A;  1QLN A;  3EPI A;  1C7Y A;  1X9W A;  5BOL A;  4E80 A;  1UA1 A;  8ICR A;  4UBB A;  4R66 A;  1TVA A;  3IHQ B;  4KLO A;  8ICG A;  3T3F A;  4J9S A;  3TI0 A;  5J0Y A;  4P4O A;  4ECT A;  4BXO A;  2KZM A;  4ED2 A;  4M9G A;  2O1P A;  4X4Q A;  3OVS A;  4LVS A;  1S77 D;  2ZH5 A;  4GLX A;  2HHV A;  2ZUB A;  5DBB A;  4X4P A;  2ATL A;  2AJQ A;  4RQ0 A;  5J2I A;  3KHH A;  4XUS A;  5J2C A;  3V7K A;  3KHG A;  2PXI A;  1SKW A;  3UXO A;  4I2I A;  8ICE A;  2IBK A;  4QZI A;  2HVI A;  4YVZ A;  1NJZ A;  3JPT A;  4QWB A;  4QZE A;  4E0D A;  1MSW D;  5J2K A;  4PHE A;  4O0I A;  3Q8S B;  2IHM A;  1ZQR A;  3G6Y A;  4ELT A;  4FH5 A;  1H38 A;  3RB4 A;  1QTM A;  4O3Q A;  4I2H A;  4QZH A;  4EZ6 A;  4IQW A;  5HC9 A;  5L1J A;  5BOM A;  2DR9 A;  3JPN A;  1XO1 A;  9ICM A;  9ICF A;  4EBD A;  3PVX A;  5BPC A;  5J0S A;  4ECQ A;  4FHX A;  3SI8 A;  1N48 A;  4JV0 A;  2DR8 A;  4DSK A;  4O3N A;  4O3O A;  5KTQ A;  4DOA A;  3Q8L A;  3RJH A;  2B21 A;  1S0M A;  3H4D A;  1RPL A;  4K4H A;  9ICH A;  3WFR E;  4QWA A;  2I1Q A;  5KFC A;  1COO A;  3UPQ A;  4C8L A;  3MFH A;  4Q8E A;  3RB0 A;  4ED0 A;  3C23 A;  3K4G A;  5J0P A;  5DB8 A;  3M8S A;  4UAZ A;  5J0Q A;  4M2Y A;  3H8J A;  3GIL A;  4MEY A;  2W9C A;  4EYH B;  1ZQT A;  1DK3 A;  4YN4 A;  5JUM A;  3GV7 B;  4F4X A;  3OVA A;  9ICK A;  4KN4 A;  4YQW A;  1BVS A;  4QWE A;  1D8L A;  5KG5 A;  5DLG A;  2RDJ A;  3UXN A;  3H8S A;  4F3O A;  1BPB A;  3EWA A;  5KFZ A;  3GDX A;  3PW7 A;  2ASD A;  2ISP A;  8ICQ A;  4XQ8 A;  1ZQS A;  5DBC A;  1PX5 A;  2FMS A;  4KLQ A;  4NXZ A;  3M9O B;  4YR0 A;  4Q8F A;  2XY5 A;  4BXO B;  4BDP A;  2HVH A;  4EBJ A;  1BPZ A;  5TZV A;  4J9M A;  1NK0 A;  3JPO A;  5CB1 A;  5KFY A;  5CHG A;  4GXK A;  3RH4 A;  3RJJ A;  3OUY B;  4NKU A;  3QEB Z;  2BCR A;  1JXL A;  9ICR A;  4X4U A;  4MFA A;  2XY7 A;  3K75 D;  5KFX A;  2AGQ A;  2KP7 A;  4RPX A;  3RH6 A;  4RNO A;  4LZD A;  9ICU A;  4DO9 A;  3ISD A;  1D8Y A;  1KFD A;  5KFM A;  4I29 A;  2FPM A;  5KFU A;  1F5A A;  4DOC A;  5HRE A;  1MIY A;  2UVU A;  3LWL A;  4X4S A;  2F1J A;  4MF2 A;  3EPG A;  5CA7 A;  4P2H A;  4QWC A;  4IRD A;  4O3P A;  3Q8K A;  2HHT A;  4WC3 A;  2NRW A;  4DEZ A;  5KT3 A;  4M9L A;  1NO5 A;  5J2E A;  3LQC B;  4PHA A;  1ZQA A;  3TFR A;  5DDM A;  4Z6D A;  3PNC A;  5KG6 A;  3C2L A;  4IR1 A;  3JPR A;  3T5H A;  7ICL A;  3RAX A;  3Q8M A;  2MUT B;  3HIY A;  3RAQ A;  2H5X A;  4ED6 A;  1HUZ A;  2BCV A;  3THV A;  1HJP A;  4R8U A;  4Q43 A;  3AQN A;  4X0A A;  1JAJ A;  5HMM A;  3RRG A;  2AGO A;  9ICV A;  1CEZ A;  4RUA A;  5DB9 A;  4J9N A;  8ICZ A;  4P4P A;  4ECR A;  4B9L A;  4JWN A;  5J2H A;  4NM1 A;  1ZQW A;  5J0T A;  3ZD9 A;  4WC0 A;  4S3N A;  4RQ2 A;  3HP6 A;  1SKR A;  2BCS A;  4ECY A;  2DVI A;  2XCP A;  1NK9 A;  4KLT A;  4RUC A;  4FO6 A;  4RT2 A;  3AU6 A;  2BQR A;  4KLU A;  3WFQ E;  4UB5 A;  1EXN A;  1R8B A;  4RWN A;  9ICO A;  2LYH A;  4ED7 A;  3H8W A;  5KFF A;  4KLJ A;  3OHB A;  3ZD8 A;  4AT7 A;  2NRX A;  3M8R A;  2M9N A;  5KFD A;  3PY8 A;  9ICT A;  4NKT A;  5DB6 A;  3OUY A;  1VFG A;  2PBE A;  5KG1 A;  1OU5 A;  3EYZ A;  2ISO A;  3ISC A;  2BQU A;  3ZDA A;  8ICH A;  2OWO A;  3C1Y A;  4J9K A;  3JYY A;  3MDA A;  1KLN A;  4LZG A;  1KRP A;  1K1S A;  3ETL A;  3GIM A;  4J9O A;  2ZH1 A;  1D9F A;  4M47 A;  2NRK A;  5KFA A;  4RZR A;  3KTQ A;  3H40 A;  3LK9 A;  4TUR A;  9ICC A;  3H37 A;  3JPQ A;  1TK5 A;  4I2E A;  4ECW A;  4IQU A;  4RWQ A;  1SL2 A;  3HW8 A;  3SZ2 A;  4YP3 A;  4F4Z A;  3N97 B;  1NJY A;  4RNM A;  1S0O A;  5HRF A;  1JXE A;  5J2D A;  1L5U A;  4MFF A;  3GII A;  2BDP A;  7ICV A;  4WBY A;  4B9T A;  4F50 A;  4MEX A;  1UET A;  2DR5 A;  3M9M B;  7ICK A;  8ICK A;  4I2A A;  4X4N A;  4R64 A;  5IIJ A;  9ICS A;  1A77 A;  3PR4 A;  8ICB A;  3V7L A;  3HPO A;  7ICS A;  2ZJ5 A;  3PW4 A;  3JPP A;  2JEJ A;  1S76 D;  1ZQX A;  2ZUC A;  4EYI B;  3RB6 A;  4G3I A;  2BGW A;  5J0R A;  4NY8 A;  2HHP A;  5DGB A;  3MGI A;  4FS1 A;  5IIK A;  3UQ0 A;  4RWP A;  3WFO A;  3GIJ A;  3LWM A;  2HHU A;  3PMN A;  1ZQP A;  4WC5 A;  2FLP A;  2BPG A;  4ATB B;  2BCQ A;  4DLG A;  3G6X A;  2WTF A;  2AQ4 A;  4Q44 A;  2DRA A;  4M04 A;  4ECU A;  5CJ7 A;  2BPC A;  1TKD A;  3AQM A;  9ICI A;  2ZHB A;  3UQ2 A;  1CUK A;  1U48 A;  1B22 A;  1QSS A;  3ORY A;  4IQV A;  2ZUD A;  1XU4 A;  4DQP A;  5HRB A;  5HRG A;  4DFK A;  1Q79 A;  5KFL A;  3PML A;  2IHN A;  4PH5 A;  4C8O A;  2ZH2 A;  3V6J A;  1QSY A;  1V9P A;  4J9R A;  5HRK A;  3OGU A;  3AU2 A;  1KFT A;  4M6W B;  5KG0 A;  1BPY A;  5DLF A;  1RYS A;  5KG7 A;  4RQ6 A;  4F8R A;  5KFW A;  3EW9 A;  5IIN A;  4GC6 A;  3E2E A;  2ASL A;  3PX0 A;  1KNY A;  3T5L A;  4YG2 A;  3T5K A;  1L3S A;  1JIH A;  1ZQZ A;  1NK5 A;  9ICG A;  4QZB A;  4BWJ A;  3GFK B;  5HHI A;  4AT9 B;  3GV8 B;  7ICI A;  4AT8 B;  4I27 A;  4EEY A;  3C5G A;  4DQI A;  2NRV A;  2Q66 A;  2DFL A;  5HRI A;  4FH3 A;  4PPX A;  2NRT A;  2A1J B;  4YXM A;  8ICT A;  1UEV A;  5C5J A;  4I2G A;  5HHH A;  3LDA A;  2ZH3 A;  3KHR A;  2FMP A;  4E8F A;  4DSL A;  2M2W A;  1A76 A;  4IRK A;  1KTQ A;  5J0O A;  3HX0 A;  1LB2 B;  4J9L A;  4WCW A;  4UAY A;  4QWD A;  4DF8 A;  5KFH A;  3PO4 A;  5KFG A;  4DSJ A;  2KN7 A;  4ECZ A;  5J0W A;  3H38 A;  4YFK A;  1NJX A;  5KFQ A;  1TK8 A;  1ZQD A;  2P66 A;  4RQ7 A;  5HRD A;  4QZ8 A;  3BQT A;  5DQI A;  3H4B A;  2R8I A;  5J2G A;  5KFB A;  2W9M A;  3HT3 A;  1U4B A;  4EP7 A;  4ECV A;  4F5P A;  2UVR A;  2KTQ A;  1ZQI A;  3Q8R B;  4GXI A;  4KTQ A;  3UPS A;  4AT9 A;  5L9X A;  4Z6F A;  2W9B B;  4F5O A;  1ZQF A;  3C1Z A;  9ICX A;  4UD4 A;  5KFE A;  3QE9 Y;  4I2J A;  2J6T A;  1U9L A;  5KFR A;  5DG7 A;  2PFP A;  4K4I A;  4O5K A;  8ICO A;  7ICO A;  4E7X A;  5L1I A;  5F9N A;  1KDH A;  1S97 A;  9ICQ A;  4M6W A;  2XGQ A;  5KT4 A;  4DL5 A;  2BHN A;  4RQ3 A;  1TK0 A;  4RQ1 A;  4NLN A;  4C8N A;  4B9U A;  2Y1I A;  1WCL A;  2R8J A;  1KEJ A;  1PZN A;  3NYB A;  3C18 A;  2VA8 A;  1L3T A;  1IXR A;  1U47 A;  4O5E A;  5F9L A;  3SV4 A;  2KZZ A;  3JPS A;  4YD1 A;  5HML A;  8ICS A;  3H39 A;  4F93 B;  1XS9 D;  4IQT A;  3OJS A;  4JV1 A;  2C2D A;  2VAN A;  2PI4 A;  4MFC A;  4TQS A;  7ICT A;  5DG9 A;  8ICN A;  4YMM A;  2AU0 A;  1LV5 A;  5CR0 A;  4DSE A;  5DKW A;  3PW5 A;  3Q8P B;  3Q8Q B;  4C8K A;  1Q78 A;  2GWS A;  4WC6 A;  3TFS A;  2NRZ A;  1ARO P;  3MAB A;  2ID1 A;  3NGD A;  2BKE A;  3PW2 A;  4I2D A;  2W8L A;  1BPD A;  4ED1 A;  1NK8 A;  2ZH9 A;  5KG2 A;  4KLG A;  4TUQ A;  1WCN A;  4QZG A;  3MGH A;  1MIW A;  4RQ8 A;  3GQC A;  1ZJM A;  3ZDD A;  4M0A A;  7ICE A;  4DQQ A;  3RB3 A;  4JV2 A;  1ZQV A;  1U49 A;  5KFO A;  2ZTD A;  4KN7 A;  2IA6 A;  8ICY A;  4XRH A;  2XO7 A;  4UAW A;  1ZQU A;  5J29 A;  1ZQL A;  1ZQO A;  2M2V A;  7ICR A;  4AT7 B;  4R63 A;  3PX6 A;  2JEI A;  2ZTE A;  3TQ1 A;  4X4T A;  3PW0 A;  3RTV A;  5HRH A;  4O5C A;  1UEU A;  3PR5 B;  3RJK A;  1TFY A;  2HW3 A;  4DQR A;  2DR7 A;  3BJY A;  4KIT B;  2JZB A;  4NLZ A;  3OSP A;  4R65 A;  1T3N A;  5J0X A;  4DLE A;  2BR0 A;  3BQ2 A;  2J6U A;  4FHV A;  4RU9 A;  4QZF A;  4Q45 A;  2BCU A;  3RBD A;  3HJ4 A;  8ICU A;  4RQ4 A;  2ASJ A;  2KZ3 A;  2XCA A;  3MBY A;  4WC7 A;  2C2R A;  3JZ0 A;  1QSL A;  1XSL A;  2PFN A;  4KLS A;  1MIV A;  4B9V A;  2UVV A;  2I9G A;  4DSI A;  2AQ0 A;  5DED A;  7ICG A;  3MR6 A;  4JUZ A;  4DFP A;  5J2J A;  2MAX A;  5J2A A;  3MDC A;  2W8K A;  3V6K A;  3ZDB A;  3RR8 A;  3TAP A;  4UQG A;  3N4M B;  1T8E A;  5DQG A;  1BPX A;  1D9D A;  2W9B A;  3SYZ A;  7ICP A;  4DFM A;  1ZQK A;  3AQK A;  9ICJ A;  1MQ2 A;  3MR3 A;  4KLH A;  2ZH8 A;  4XA5 A;  4YD2 A;  4GC7 A;  5KFN A;  1KSP A;  2DPJ A;  2IMW P;  2PI5 A;  1XSN A;  5HR9 A;  1R8A A;  4DL4 A;  3C5F A;  1U45 A;  9ICB A;  1Y88 A;  2XY6 A;  3WFP A;  5KT2 A;  2ZJA A;  2FPK A;  2HHS A;  3V6H A;  4M5D A;  4YR2 A;  4R8U B;  3WFS C;  3MR5 A;  2V4Q A;  1YLQ A;  3RH5 A;  1BGX T;  4DOB A;  4QW8 A;  4EBE A;  2ALZ A;  5J2B A;  3IM1 A;  1ZQB A;  4DWI A;  1Z00 A;  4PGX A;  1WOT A;  1HUO A;  2HHW A;  1Z3E B;  3SV3 A;  3BQ0 A;  1SL1 A;  4QZD A;  4O9M A;  5HRL A;  5DEC A;  2ZH4 A;  4O3R A;  9ICN A;  4JK1 A;  3G6V A;  4I2F A;  4F91 B;  2A1J A;  1RXV A;  5EOZ A;  4UB4 A;  4I28 A;  3H3A A;  4WC4 A;  4WBZ A;  1TFW A;  5KT6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...