4YMMA

Structure of human dna polymerase beta complexed with 7bg as the template base in a 1-nucleotide gapped dna
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human DNA polymerase beta complexed with 7BG as the template base in a 1-nucleotide gapped DNA
rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 111
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ymmA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ymmA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ymmA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ymmA03
5DBBA 5J2EA 5J2DA 2W9CB 5KG0A 3C5GA 1TK8A 4EZ6A 4LZGA 5EWFA 4F5PA 2KZMA 5KFUA 4AT9A 4TURA 2WTFA 1UT8A 5KTQA 3OJSA 4RPXA 1D9FA 4M5DA 3RJGA 5KT4A 4PH5A 2ZH3A 2JEJA 8ICIA 4M6WA 5DG8A 3OV7A 4RNNA 3C2KA 3TI0A 3PV8A 4Z6CA 1Q78A 5KFMA 5J0RA 1NOMA 4UB4A 4KLTA 3WFOA 3H8JA 1Z00B 4YQWA 1BVSA 3KHHA 2BDPA 2ZH7A 4NY8A 3BQ2A 4DOAA 3MR5A 4KLUA 4IQTA 1HUOA 4P2HA 1T7PA 3LQCB 3Q8QB 3GIMA 4GXJA 3PY8A 1S0VA 7ICVA 3OUYB 4J9LA 1TFWA 3WFSC 2AQ4A 4BXOA 4JUZA 5KFRA 3LWMA 5J2HA 2M2VA 3OUYA 4M9JA 5CR0A 3AQKA 5J2GA 3OSPA 1B43A 3N97B 1NK4A 4KLDA 5IIMA 4LVSA 1UEUA 2HHXA 1Z00A 1SKRA 1X9MA 4JWMA 5KT2A 4DL2A 2F1IA 2AU0A 5HR9A 3OVBA 4DQPA 1ZQTA 3K4GA 3ZD9A 5EOZA 4X4OA 4NKUA 2F1HA 3V6JA 3H3AA 1TK0A 3OVAA 4EBEA 2M2UA 4BXOB 4RPZA 3MR6A 3T3FA 4QWEA 5KFEA 4F5QA 4MFCA 4RQ1A 4O0IA 3RH4A 1XSPA 2W9BA 1TFYA 1VFGA 4YMOA 4C8LA 4EBJA 1BGXT 4F5OA 3ISDA 4ATBB 4Z6FA 4F4ZA 3ISBA 2IBKA 3G6YA 3ZDBA 5IIOA 4YG2A 5DG9A 4O3PA 3QEAZ 2KP7A 4DSIA 1S77D 2ZH4A 5IILA 3H8SA 4QZBA 4UAYA 4Z6EA 3UPQA 4ECUA 9ICUA 1VJ7A 4EP7A 4O3RA 5D4BA 4I2BA 4IR1A 3UQ0A 2KFNA 2BR0A 4C8MA 5HRGA 4K4IA 2UVVA 5HRLA 4X4TA 4RQ4A 9ICBA 3Q8LA 5DB6A 3KTQA 3AU2A 4WC4A 1ZQBA 2JEIA 4RQ0A 4F4XA 4ED3A 1QSSA 2BKEA 4BDPA 2FLNA 3HIYA 4B9TA 1MIYA 4I2AA 3ZDDA 7ICQA 3JPQA 3K75D 2R8HA 5J0UA 1KFSA 5DGBA 1ZQJA 4Q8FA 4E7XA 2Y1IA 2UVUA 1X9SA 2ZUCA 4DFMA 2BE3A 4EBKA 3H8WA 1X2IA 8ICNA 3BJYA 3RAQA 2PFOA 2KZZA 3GDXA 3SZ2A 4I28A 4MF8A 8ICRA 4DSFA 8ICEA 1WOTA 4IQUA 2FLLA 5F9LA 5DBAA 3C23A 5KFPA 1RPLA 7ICRA 5EWEA 4DWIA 4ED8A 5KFCA 3FYHA 1MC8A 3Q8RB 2W8LA 3TQ1A 2IMWP 4UB3A 1U49A 1UEVA 1JMSA 4Q44A 3OHBA 1NK8A 4KMUA 3M9NB 3V6KA 1N56A 1RYRA 4IR9A 2HVIA 1L3UA 4X4NA 5DB8A 5KFTA 3HPOA 1HUZA 3HT3A 3H39A 3TFRA 2HHVA 3MBYA 8ICCA 2ISOA 9ICMA 7ICLA 1ZQVA 3GFKB 4PGQA 4DL4A 3E2EA 4DSEA 5DLGA 3B0XA 3RAXA 1ZQGA 4XQ8A 1SL2A 4NM1A 9ICRA 4E0DA 4YN4A 1T8EA 8ICBA 4FHYA 4ECXA 4QW8A 3PW2A 1L3SA 5TZVA 4YXMA 3QZ7A 1MQ3A 3EYZA 2IHMA 8ICMA 1XSLA 4WC7A 1H38A 4QWCA 2RDIA 4K4GA 2F1JA 4DQSA 1BPBA 3BDPA 4DL6A 4QZCA 3JPPA 1L3VA 1ZQLA 4KLMA 5KFXA 4Q43A 2HHSA 4F4KA 3JPTA 3OSNA 1ZQPA 1RXWA 4I29A 9ICNA 4DO9A 4KLEA 4KLHA 1BPXA 4RUAA 3HW8A 4J9SA 1EXNA 9ICAA 2DVIA 2HHTA 1A76A 4J9OA 2BCSA 1ZQRA 3RJJA 5KG4A 2R8KA 4X4UA 1NK9A 2UVRA 2KN7A 2O5AA 3FDSA 5HNKA 4UAWA 2W9AA 4J9RA 4DS4A 4YD1A 2AGPA 3UXOA 4RT2A 4YCXA 4WC6A 5IIIA 1HJPA 5KFAA 4C8NA 4FHWA 2HHPA 5C5JA 2DR9A 2AGQA 3RJFA 1QTMA 2JZBA 1XS9D 4XRHA 3M8SA 2OWOA 3GV8B 2V4RA 3UQ2A 2AGOA 5HRDA 4KLLA 4AT7A 3PR4A 7ICMA 1ZQNA 4B9SA 3WFQE 7ICNA 4MFAA 3QE9Y 7ICIA 3OHAA 5DG7A 3UXNA 3MDCA 2P66A 4DQIA 9ICLA 2ZH6A 3PX6A 1NK7A 2BCRA 4YP3A 3ZDCA 9ICXA 1MIWA 4M04A 8ICZA 1UA1A 3M9MB 2M2WA 7ICEA 4RT3A 4QZEA 4GXKA 4ED0A 4AT8B 4MEYA 4DEZA 8ICAA 4F8RA 3H4BA 5DLFA 4O3SA 5KFBA 3THVA 1ZQKA 1XU4A 4RU9A 5HHIA 2ASLA 2BCVA 3H4DA 2XY6A 4RPYA 8ICQA 4FO6A 1B22A 4B9LA 9ICTA 4E80A 3RJHA 4DOBA 5J2IA 4ED2A 2XCAA 2BQRA 4GC6A 1WCNA 2BPGA 3RR7A 1JIHA 4RWNA 4NLNA 4UB5A 1Q79A 1NK5A 3PMLA 3Q8MA 4B9MA 1R8CA 4ED1A 2ALZA 4FHVA 1ZQUA 3WFPA 4P4PA 4ECVA 4R65A 3RJIA 4FS1A 1ZQEA 4I2FA 5F9NA 3MDAA 2P6UA 5DECA 2XY5A 2BQUA 4IRCA 3M8RA 1RXVA 1L5UA 4ELTA 2PI4A 1NKEA 4DF8A 3PW0A 3T5HA 1RZTA 1TV9A 4FBUA 2DRBA 4YMMA 4J9QA 9ICOA 4YMNA 1KFTA 3PR5B 3PO5A 3Q8SB 3MR3A 1COOA 3JPRA 3GV7B 1XC9A 1ZQAA 2A1JA 5J0PA 4G3IA 4EYIB 5DDMA 4GXIA 4ED7A 2BGWA 1C7YA 1S0OA 3OVSA 2FLPA 2ZH2A 4UD4A 5BOLA 8ICUA 5J2FA 2C28A 2DPJA 5KFOA 2AJQA 2DRAA 5J2BA 3H40A 2DFLA 4PHDA 3AU6A 4ATBA 3AQLA 5HHHA 3RBDA 3JPSA 4ECWA 3NGDA 9ICVA 4I2EA 1JQRA 5F2VO 2ASDA 2PBEA 3ISCA 2VA8A 4NXZA 2ZHBA 4F50A 4DL7A 8ICFA 1KNYA 2ID1A 4NKTA 5HC9A 1PZNA 4YVZA 5KFKA 4DS5A 5KFYA 2XGQA 3HWTA 4EBDA 5J2AA 1KTQA 4X5VA 1S10A 3EPGA 1ZQOA 1ZETA 4M9GA 3BQTA 1MSWD 9ICSA 3HJ1A 1KSPA 1DOQA 5KFWA 3IM1A 4C8KA 4RWPA 1ZQCA 4S3NA 2KZ3A 4QZ9A 3NTUA 1ZQQA 5IINA 5L1KA 4AT7B 4RQ5A 2XO7A 8ICSA 3C1ZA 4B9UA 1K1SA 8ICPA 5KG7A 3AUOA 9ICGA 4ECSA 1ZQXA 3V72A 1UT5A 1YLQA 3TAQA 3RJKA 1BPDA 3Q8PB 5CA7A 9ICPA 2ZH9A 4R8UA 4DSJA 2NRVA 1L3TA 3QEBZ 2A1JB 3RH5A 5KFHA 4I2GA 2HHWA 1U48A 1X9WA 3H38A 4X4VA 4R63A 4IRKA 3IHQB 1ZQZA 9ICCA 4P4OA 3V7KA 3TAPA 4EBCA 5DB9A 4RWQA 2PFPA 3UXPA 7ICOA 2KTQA 4ECRA 4RQ7A 5KT3A 2PI5A 2HVHA 3PVXA 3MFIA 4M47A 4QZGA 2Q0ZX 5CHGA 3PW5A 1UA0A 2VA2A 4P4MA 3EWAA 5KFJA 1ZQYA 1NJYA 4IRDA 5CP2A 4DSLA 4FHXA 2FPMA 2ZUDA 4WC0A 2W9CA 4YD2A 4AT8A 5DGAA 3RJEA 2C2EA 9ICJA 7ICFA 4KLJA 3V6HA 2ZJ8A 2GWSA 5HMLA 1U45A 7ICPA 1T3NA 3ORYA 4M6WB 1NKBA 3T5KA 4UD5A 3ZDEA 5DBCA 4JV0A 2VA3A 5J0OA 3M9OB 4F5RA 4M9NA 4QWBA 2W8KA 5KFVA 4UBBA 3GIJA 5BPCA 3JPOA 4J9NA 4YR2A 3RB4A 1XSNA 4KITB 5KG2A 1S76D 5J2KA 4R64A 1KEJA 4ECQA 3JPNA 2PFQA 4RQ2A 3MGIA 3ZD8A 3JYYA 7ICGA 4WBZA 1QLNA 5KFLA 1TKDA 5HRFA 1BPYA 1XWLA 4F92B 1ZQIA 1NK6A 4FH3A 2XGPA 4DQQA 4DF4A 4UB2A 1KLNA 4K4HA 1DK3A 4RZRA 4EZ9A 2ZTDA 3OGUA 2BPCA 4F2SA 2ZTCA 3MR2A 3RBEA 4QZFA 4UBCA 2DR8A 3OJUA 3SV4A 4QWDA 2DR7A 3LWLA 1ZJNA 1NJXA 3SV3A 1ZQFA 1A77A 1BNOA 3UPSA 4DSKA 4M9HA 2UVWA 4I2DA 3LDAA 3KHLA 3SYZA 4PHEA 2ASJA 1JXEA 5HRHA 4YFKA 2NRXA 1NK0A 5KT5A 1NJWA 4KLQA 4IG8A 2NRWA 2V4QA 1R8BA 1NO5A 4RNOA 1U9LA 1K1QA 4YR3A 4M2YA 4KLGA 4GLXA 1SZPA 2BQ3A 7ICJA 4O3QA 4F91B 3EZ5A 1IM4A 4CCHA 3C2LA 2HHUA 1OU5A 3L9DA 4I2CA 8ICYA 5KFIA 2M2TA 4KN7A 5KT6A 5KG1A 4PGYA 5L1JA 2C2DA 2DPIA 8ICTA 3GQCA 7ICSA 4XQ7A 4NLGA 5J2JA 7ICTA 1S0MA 7ICUA 4EYHB 4ZH4A 4ECTA 5HP4A 3JZ0A 4TUSA 3BQ0A 4DFKA 4Q45A 5J0QA 3N4MB 4UAZA 2ZTEA 4B9VA 3RR8A 4PHAA 3GIKA 4X4PA 1ZQMA 4DOCA 3V7LA 5KFNA 3TFSA 2J6TA 4DLGA 4O5EA 2ZHAA 9ICWA 5IIKA 3TARA 4O5KA 2XCPA 3ZDAA 1TAQA 1KRPA 5J0XA 3ETLA 4QZAA 5D46A 1RYSA 4RWOA 4FS2A 3WFRE 2LYHA 4IQWA 4YXJA 2BCQA 5L9XA 4QZ8A 5DQHA 2JEGA 3QZ8A 5J0TA 2MAXA 4RQ8A 5KFFA 4F93B 4O3NA 5J0SA 5J2CA 4DFJA 4WC1A 2C22A 3RB3A 3MABA 2FMSA 3PMNA 2R8IA 1V4AA 1TVAA 2XC9A 4I2JA 5BOMA 3RB6A 2HW3A 4X0BA 1T4GA 2BPFA 4QW9A 2R8JA 2FMPA 3PO4A 7ICKA 4DQRA 8ICJA 5HREA 3AQMA 3C5FA 4WC5A 1ZYQA 4IQVA 2RDJA 9ICFA 1ZJMA 1QSYA 5DQIA 4J9KA 3HP6A 2PXIA 2C2RA 4KN4A 4J9PA 3RRGA 3G6VA 4F5NA 5JUMA 4DL3A 3PW4A 1U47A 1S0NA 4B9NA 1R89A 4WC3A 4RNMA 4BGDA 1LB2B 4XUSA 4UQGA 1MIVA 4F3OA 2NRKA 4M9LA 4F2RA 2NRZA 5KT7A 4QWAA 4TUPA 4HYKA 2IA6A 3BQ1A 4O5CA 1N48A 3C21A 2Y1JA 1JXLA 5KFDA 4WBYA 4I2HA 4PPXA 1IXRA 4I2IA 4Q8EA 4QZDA 3C2MA 3SI8A 2I9GA 9ICKA 2RFFA 1U4BA 9ICHA 1JN3A 1CEZA 1D8YA 1BPEA 1NJZA 4DL5A 3PW7A 9ICQA 1PX5A 3T5JA 2VANA 3G6XA 2XY7A 7ICHA 5HRBA 8ICLA 3PX4A 5KFZA 4R66A 4PHPA 2JEFA 1TAUA 2ZUBA 4XA5A 2MUTA 1MQ2A 3C18A 4E8FA 8ICVA 4F4YA 1TK5A 2ZH8A 1CUKA 2B21A 2J6UA 2ISPA 4KLSA 8ICWA 2DR5A 2PFNA 3RRHA 4NLKA 3AQNA 5CJ7A 2FPLA 1WCLA 2ZJAA 8ICHA 2R8GA 5KFSA 4MF2A 1UETA 4Z6DA 3PX0A 4JK1A 3KHGA 4JWNA 5KG3A 3EPIA 4BWMA 1BNPA 2JZBB 1KFDA 2O1PA 3GILA 1D9DA 8ICXA 4TQRA 1SKWA 4GC7A 1ZQHA 3NYBA 1SL0A 4WC2A 3C1YA 1NKCA 2ZH5A 1AROP 3KHRA 4ED6A 3RB0A 1S97A 3EW9A 3Q8KA 3V7JA 1LV5A 2W9BB 4FHPA 4R8UB 4ECYA 4LT6A 4X0AA 2I1QA 4RUCA 4DFPA 5KFQA 1BPZA 2P6RA 4X4QA 2HHQA 4NM2A 3GV5B 2AQ0A 4EEYA 3C66A 4UB1A 2FMQA 5DDYA 4LZDA 5CWRA 4QZHA 3MFHA 4KTQA 1ZQWA 1JX4A 8ICOA 4FBTA 1JAJA 4RQ6A 2FPKA 5DB7A 5DQGA 5EWGA 5L1IA 2ATLA 4ELUA 3TANA 2IHNA 4KLIA 4I27A 1ZQDA 4F4WA 3RH6A 2BCUA 8ICKA 5J0YA 5IIJA 4TQSA 4ELVA 3H37A 4BWJA 3HJ4A 5KG5A 3LK9A 9ICEA 5J29A 4O9MA 2BHNA 2M9NA 2ZJ5A 1SL1A 1V9PA 4PGXA 3MGHA 4TUQA 3HX0A 2H5XA 1S9FA 4JV1A 4KLOA 4X4SA 4AT9B 3T5LA 4M0AA 5DKWA 4NLZA 1F5AA 1FA0A 4ECZA 4O3OA 1NZPA 5KFGA 4MFFA 5J0WA 4KLFA 4X4RA 2MUTB 5L1LA 1KDHA 1ZQSA 3B0YA 1Z3EB 2J6SA 4JV2A 1SKSA 8ICGA 5DEDA 9ICIA 5CB1A 4QZIA 4C8OA 4J9MA 3RTVA 2KFZA 3H7IA 1R8AA 2NRTA 4FH5A 4YR0A 2ZH1A 3PNCA 1XO1A 4MEXA 1DK2A 3GIIA 1DGSA 5D49A 1Y88A 5HMMA 5HRIA 4RQ3A 2V9WA 1TFRA 2Q66A 2W9MA 1QSLA 5HRKA 5KG6A 4DLEA 1D8LA 4WCWA
chains in the Genus database with same CATH superfamily
5DBBA 2DL0A 5CFTA 4TURA 2WTFA 2QB1A 1D9FA 3RJGA 2ZG6A 3TI0A 4Z6CA 3S6JA 5J0RA 1NOMA 4UB8U 2BDPA 4DOAA 3MR5A 4KLUA 1HUOA 4P2HA 5AICA 4J03A 3Q8QB 1S0VA 1TFWA 4JUZA 3OUYA 2P35A 4M9JA 5J2GA 3OSPA 2HHXA 1SKRA 1NNLA 3F53A 5HR9A 2EAMA 3H3AA 3WKEA 4K9BA 4RPZA 3MR6A 3T3FA 5AM0A 4RQ1A 1XSPA 3MC1A 4YMOA 4PL1A 4I0UA 3ISDA 2B56A 4ATBB 2IBKA 3G6YA 4YG2A 2KP7A 3TACB 2ZH4A 1VJ7A 4Z6EA 1WWVA 4O3RA 4I2BA 4X4TA 9ICBA 3KTQA 5DB6A 3H0RB 2JEIA 4F4XA 3C28A 2BKEA 4BDPA 5KNIA 3AL0B 3CNHA 1LVHA 3WK7A 1SWVA 3VC8A 4EBKA 2YMLA 1X2IA 1S8OA 4RQNA 3GDXA 4IQUA 2FLLA 5F9LA 7ICRA 4ED8A 3FYHA 2IMWP 3QUCA 4Q44A 3OHBA 4KMUA 1L3UA 1S5LU 5DB8A 5KFTA 1WWUA 3TFRA 1ZQVA 1M6YA 3E2EA 4DSEA 3B0XA 3RAXA 3D2QA 1UHUA 2KD1A 4YN4A 4ECXA 3PW2A 1L3SA 4CE6A 3QZ7A 2IHMA 3KZXA 2ZXHA 2RDIA 2F1JA 4DQSA 3BDPA 1ZQLA 1KW4A 4KLMA 3PSPA 4P0PA 2QLTA 1ZQPA 4I29A 4KLEA 2K8BB 5ALXA 2HBMA 9ICAA 4Y2PA 1A76A 3SR6A 1ZQRA 1NK9A 3PHZA 5HNKA 2AGPA 4YD1A 3UXOA 1HJPA 2NO4A 2JZBA 2G07A 4NV0A 3UQ2A 2AGOA 3PR4A 3WFQE 7ICNA 5AK5A 3OHAA 3PX6A 4YP3A 1MIWA 1LKYA 1UA1A 3CP8A 2W7PA 7ICEA 3TADC 4F8RA 5T14A 5KFBA 2BCVA 2ASLA 3RFAA 2EQYA 2XY6A 4RPYA 2DF4B 2BQRA 1VLBA 2B4VA 4GC6A 1WCNA 1LKYB 2BPGA 3RR7A 1JIHA 2GOLA 2EDUA 3KD3A 3WFPA 5AK3A 4I2FA 3DV9A 3DEEA 3MDAA 3AMZA 4IRCA 4ELTA 1NKEA 4OAFA 4DF8A 2DRBA 4Y2VA 9ICOA 1X9XA 1COKA 1COOA 2H3QA 4C80A 4GXIA 5G5GA 4KX3A 8ICUA 4MKPA 2DPJA 5KFOA 3AQLA 2HCFA 1JQRA 3ISCA 3DDHA 4DS5A 4X5VA 2XGQA 3HWTA 7ICKA 5J2AA 1ZETA 3OPXA 5AKYA 2KSOB 2D3DA 4RWPA 5L1KA 4RQ5A 8ICSA 3AUOA 9ICGA 2B51A 3V72A 3F5EA 4FE3A 1YLQA 1BPDA 3Q8PB 2HOIA 2OHFA 2E1FA 1N5WA 2KNJA 3H38A 1X9WA 4R63A 4O6AA 2LM1A 4EGWA 3WK6A 3IRUA 4RQ7A 1JALA 4M47A 2JH7A 4NXUA 3EWAA 5KFJA 4WC0A 4IRDA 3FM9A 4KLJA 3V6HA 1DRGA 3EF2A 3QUQA 7ICPA 3T5KA 4PZOA 4UD5A 2LI6A 5AKJA 3M9OB 4QWBA 2W8KA 2GO7A 4KITB 2W43A 4ECQA 4GIBA 4RQ2A 2PFQA 3MGIA 7ICGA 4WBZA 3KZIU 3NKUA 1XWLA 3KKAC 3FC4A 2GLEA 2XGPA 3RF9A 1KLNA 2LPEA 4BUGA 4RZRA 4EZ9A 3OGUA 4F2SA 2BPCA 5AI8A 4NL9C 5AM5A 1ZJNA 1NJXA 1YZ7A 3UPSA 4DSKA 2DUYA 5HRHA 2ASJA 1MN8A 2JR5A 5ALGA 4OAGA 2NRWA 2V4QA 1R8BA 2ZIXA 4KLGA 3SMVA 3SAFA 7ICJA 3R9KA 5D62A 2HHUA 1IM4A 1DGJA 3L9DA 8ICYA 5KT6A 5L1JA 4AT7A 1SGGA 4NLGA 2DKZA 3D2SA 7ICUA 3ERCC 2MRLA 4K96A 4Q45A 2YB1A 4UAZA 4O5EA 5KFNA 5IIKA 4O5KA 2KJ8A 1RYSA 5D46A 4FS2A 4MHVA 4QZ8A 5J0TA 2MAXA 4RQ8A 5J0SA 2G09A 4DFJA 3RB3A 4NL9A 3PMNA 2KIVA 3RB6A 4AYBC 2FMPA 2QARA 1N2XA 1ZYQA 4IQVA 2RDJA 1QSYA 5DQIA 4K9AA 2K4PA 2PXIA 3B9JA 4B9NA 4RNMA 4BGDA 2NRKA 4XUSA 4UQGA 1ECWA 4QWAA 4HYKA 2IA6A 3BQ1A 2Y1JA 4PPXA 1IXRA 4WQLA 2LMRA 2LYBA 2DWQA 1CEZA 5AHXA 1D8YA 1BPEA 1PX5A 1KBUA 4R66A 1TAUA 5AKEA 2ESEA 2W03A 3UMGA 2FJ6A 2J6UA 1PK1B 1PVPA 2F3NA 5KFSA 3N28A 2KK0A 1UETA 3BS5A 5KAIU 1YZ6A 4BJQA 3TADA 2O1PA 1BNPA 3GILA 1D9DA 8ICXA 4B6JA 3NYBA 1SL0A 4LEYA 4OJPA 2WF5A 2ZH5A 4ED6A 1LV5A 9ICJA 3V7JA 2CXYA 4DFPA 5KFQA 2EZYA 5CWRA 1JX4A 4FBTA 4JB3A 4RQ6A 5EWGA 4EEKA 2IHNA 4I27A 4F4WA 2BCUA 1X40A 2W3RA 2K4EA 3HJ4A 3LK9A 3MGHA 4PGXA 1S9FA 5ALVA 3T5LA 4ECZA 1NZPA 5J0WA 3K7DA 2LBOA 1SKSA 5CB1A 4C8OA 4J9MA 4FH5A 2ZH1A 4YR0A 2IUBA 3K1ZA 4MEXA 2XIDA 3F2DA 1DK2A 5HMMA 5HRIA 2EANA 1TFRA 1QSLA 5EE0A 4DLEA 5KG6A 1MA7A 2G0AA 5ALMA 3C5GA 1TK8A 4F5PA 4QNLA 1UT8A 2WF8A 4RPXA 4M5DA 5KT4A 4PH5A 8ICIA 4M6WA 4FZLA 3OV7A 2DKXA 4EX6A 4UB4A 4KLTA 3KHHA 3WKBA 1N5XA 1L7MA 1T7PA 3LQCB 3PY8A 2AQ4A 4BXOA 5J2HA 5ALSA 3N97B 2L5YA 1NK4A 1UEUA 5D63A 3U26A 1X9MA 5J8YA 2F1IA 4DQPA 4NKUA 4C4RA 1IG6A 2D6FC 3OVAA 1KN5A 2M2UA 4BXOB 4QWEA 5KFEA 1HIWA 4O0IA 5ALYA 1TFYA 2W9BA 1KKXA 1VFGA 2KOBA 4EBJA 1BGXT 4F5OA 2W04A 4Z6FA 4F4ZA 3ZDBA 5IIOA 5HR6A 3M6KA 4DSIA 4UAVA 3UPQA 1F0MA 3ETRA 5D4BA 5HRGA 5HRLA 3UQ0A 3AQKA 4C8MA 4WJ3B 4WC4A 3AU2A 5CFUA 4ED3A 1V97A 4CF5A 3WK8A 2HN2A 3WKCA 2E1EA 4B9TA 4I2AA 7ICQA 4UW9A 2ZIWA 2R8HA 1KFSA 5DGBA 2UVUA 4DFMA 3H8WA 8ICNA 1FIQA 4I28A 8ICRA 3C23A 5KFPA 1RPLA 5EWEA 5AKXA 5KFCA 2W8LA 1MC8A 4UB3A 1A0PA 2HVIA 3V6KA 1RYRA 3PSIA 4X4NA 2G5IB 3NVZA 3HPOA 3HT3A 4Y2QA 3H39A 2HHVA 2ISOA 9ICMA 3GFKB 5KAFU 4PGQA 4DL4A 4QIWC 1ZQGA 9ICRA 4E0DA 3EYZA 1XSLA 1H38A 4QWCA 2YY6A 4K4GA 1BPBA 4DL6A 5KFXA 4Q43A 4NJ8A 3JPTA 9ICNA 4DO9A 3BS7A 4KLHA 1BPXA 2JXJA 3QUBA 2HHTA 1WUDA 2I5HA 2BCSA 2R8KA 3NVYA 1HEKA 2KN7A 3FDSA 4HX0A 4J9RA 4WC6A 3K1RB 2NO5A 2WAQF 4EENA 4C8NA 2JMGA 3OWGA 2DR9A 5GTHU 3M8SA 2V4RA 1ZQNA 3A0HU 2P66A 9ICLA 2B0CA 3PSFA 9ICXA 4K99A 2IOHA 3D6JA 2KKPA 5DLFA 1RDFA 2RLTA 8ICQA 4FO6A 2A1AA 3CW2C 3OTQA 5EE1A 2PMZC 4RWNA 4NLNA 1Q79A 5ALHA 1ZQUA 4P4PA 2Q4TA 4FS1A 5F9NA 1WYGA 2BQUA 3M8RA 1RXVA 3CK6A 1L5UA 1J2NA 5AM1A 2W7OA 2PI4A 3PW0A 2AXTU 2WF6A 4YMMA 4CRXA 3UMCA 2HMXA 4OD0A 1SV0A 4FZNA 3MR3A 1ZQAA 2A1JA 4G3IA 2HN1A 4EYIB 3OVSA 2BGWA 4O68A 2FLPA 4UD4A 5J2FA 2KHQA 2AJQA 4FFDA 5AK6A 5AIBA 5J2BA 2DFLA 1TE2A 9ICVA 3WK5A 4I2EA 2VA8A 4F50A 2ID1A 2E8PA 5HC9A 1ZRMA 5JU5A 4EBDA 2LYAA 1ZQOA 2GAFD 9ICSA 3HJ1A 4C8KA 1ZQCA 2XO7A 2WB1C 8ICPA 4P0PB 3TAQA 3RJKA 4RQMA 9ICPA 2ZH9A 5ALQA 2NRVA 3QEBZ 2A1JB 1QH9A 4I2GA 2HHWA 2H3IA 4NWIA 4IRKA 1ZQZA 3TAPA 5DB9A 4GFJA 3UXPA 7ICOA 5ALDA 1PVRA 4ECRA 2PI5A 2DBYA 2H3FA 4QZGA 2Q0ZX 3PW5A 1UA0A 2H3VA 5AIAA 1NJYA 4UAUA 2W9CA 4AT8A 3E58A 5DGAA 2XICA 5AI0A 4WQKA 1N62A 5HMLA 3F2BA 2RQ5A 3ORYA 5ALNA 3NUQA 3ZDEA 4LEZA 2VA3A 4F5RA 5J0OA 4M9NA 5KFVA 4UBBA 3GIJA 4J9NA 3SD7A 1XSNA 4Y2JA 3JPNA 3BQ7A 5KFLA 1BPYA 1F5SA 4NXTA 4DF4A 1DK3A 4KM5A 2ZTDA 3QXGA 3OJUA 4PL2A 3LWLA 2DR7A 2QARB 3GU3A 3SV3A 1A77A 4M9HA 4I2DA 3SYZA 1NK0A 2NRXA 1U9LA 4LEWA 4E7XA 4F91B 1OU5A 3C2LA 4I2CA 2F76X 2K4HA 3IP4B 5KG1A 4C4SA 1Q3UA 1S0MA 4ZH4A 4ECTA 5HP4A 4B9VA 1ZQMA 3V7LA 3TFSA 5JTGA 9ICWA 1KRPA 4RWOA 4QZAA 1V38A 3WFRE 4K8VA 1PK1A 2BCQA 5DQHA 1NZBA 5KFFA 4QJFB 2C22A 3MABA 2FMSA 1UQVA 3BS5B 2R8IA 1V4AA 1TVAA 4I2JA 4X0BA 1T4GA 4QW9A 5HREA 4DQRA 8ICJA 4CF3A 3QU5A 3HP6A 2C2RA 5AKZA 3RRGA 4F5NA 1IV8A 4DL3A 1LB2B 1MIVA 4M9LA 4C7ZA 4TUPA 1QQ5A 4O5CA 1N48A 4WBYA 5KFDA 1RYUA 4QZDA 9ICHA 1JN3A 1UCVA 1NJZA 4DL5A 5K4LA 1SXDA 3G6XA 2I6XA 3FAHA 2XY7A 8ICLA 3UMBA 1MQ2A 4E8FA 2ODGA 4F4YA 2ZH8A 3H8MA 2EH9A 5CRXA 1QQ6A 2NYVA 2VJ4A 2DR5A 2PFNA 3RRHA 1WCLA 2K60A 4MF2A 4Z6DA 1QCKA 4JK1A 2OYYA 5KG3A 3EPIA 4BWMA 3CRXA 2HSZA 4WC2A 2HOQA 1OW5A 1DXSA 2JH1A 1NKCA 1AROP 1XNSA 4FHPA 4R8UB 4ECYA 1X66A 2P6RA 1NI3A 2HHQA 4CNQA 4UB1A 2FMQA 2KJ5A 4ICAA 1ZQWA 8ICOA 1GPJA 3ER8C 2ATLA 1L8OA 5DQGA 1V85A 2KSOA 4TQSA 4BWJA 1Q3VA 2OM6A 2XI9A 4O9MA 2ZJ5A 1SL1A 4TUQA 2H5XA 4AT9B 4M0AA 1F5AA 5KFGA 4Y2UA 2Y0SF 2W11A 1ZQSA 3SAHA 2YX8A 5HR7A 1Z3EB 8ICGA 2KFZA 1R8AA 2NRTA 3PNCA 1L7NA 1XO1A 3LVWA 5D49A 1Y88A 5JRTA 3H0MB 4RQ3A 3MCRA 4IC9A 4NXXA 5HRKA 1RM6C 1D8LA 4WCWA 4JLZA 5J2EA 5J2DA 4LZGA 5KG0A 4EZ6A 5EWFA 3OJSA 2ZH3A 1O03A 5DG8A 1VDVA 3C2KA 2LHTA 5KFMA 3WFOA 2KVCA 3SAGA 1Z00B 1BVSA 4NY8A 3BQ2A 4UASA 4IL6U 4IQTA 1Z1BA 2H3ZA 3WFSC 7ICVA 3OUYB 2MSNA 3LWMA 5KFRA 3PZPA 5CR0A 4EX7A 5CFSA 2KG5A 4LVSA 4KLDA 1Z00A 5EOZA 2F77X 3ZD9A 1Q8KA 4X4OA 2F1HA 3V6JA 1TK0A 4EBEA 4IS7A 1Z4OA 4C8LA 5ALWA 1Z4NA 4O3PA 2A3VA 4QZBA 5KL8B 2ZIXB 9ICUA 4EP7A 1O08A 1SZHA 2BR0A 4NXVA 4K4IA 2UVVA 4RQ4A 4RQ0A 2F44A 2FLNA 2OEHA 3HIYA 1MIYA 1PVQA 3ZDDA 4EELA 3JPQA 3K75D 4KB6A 2CN1A 5J0UA 1PK3A 2ZUCA 1X9SA 4EV6A 3BJYA 2KZZA 3SZ2A 4MF8A 8ICEA 5ALZA 3TQ1A 5AM4A 1UEVA 1ZD3A 2O6KA 2HBKA 1NK8A 3M9NB 1N56A 3J81j 3KBBA 1HUZA 8ICCA 5DLGA 3QNMA 1FEZA 3UM9A 4CF4A 4QW8A 5TZVA 8ICMA 5L1MA 1MQ3A 4WC7A 2ZIVA 1XO0A 3JPPA 3HILA 1Z1VA 4F4KA 3OSNA 4ACOA 1RXWA 2K8AA 2R18A 2JGAA 4RUAA 4J9SA 1X6JA 1EXNA 3AM9A 1GO3F 3NVVA 3RJJA 2UVRA 4OAIZ 4DS4A 2W9AA 4RT2A 4YCXA 5G5HA 5IIIA 4FHWA 4ZOHC 5FP0A 2LM4A 5C5JA 2AGQA 2WF7A 3RJFA 1QTMA 2OWOA 1FFVA 4KLLA 5ALTA 7ICMA 4B9SA 4MFAA 5DG7A 3UXNA 5AKIA 5B5EU 1NK7A 1B0XA 8ICZA 3M9MB 4G9BA 4RT3A 4UARA 4MEYA 4DEZA 3LYSA 1XU4A 4RU9A 3I76A 3H4DA 1B22A 1SXEA 9ICTA 5J2IA 4ED2A 3ONNA 3IG5A 4UB5A 1PUZA 3QU4A 1NK5A 3PMLA 3Q8MA 2ALZA 4ECVA 4R65A 5DECA 2ZIWB 2XY5A 2ZXIA 3T5HA 1RZTA 4FBUA 5B3QA 1KFTA 3PO5A 3SEIA 3Q8SB 2Y9TA 3GV7B 5DDMA 3WU2U 4ED7A 2A19A 1S0OA 2ZH2A 2K89A 3AQFA 3NVOA 4UB6U 4ATBA 5HHHA 3JPSA 4UATA 4F71A 3NGDA 2ASDA 2M0NA 4C0ZA 1KNYA 4DL7A 8ICFA 4NKTA 1PZNA 4YVZA 5KFYA 1S10A 4M9GA 3OVBA 3EPGA 2E8MA 1DOQA 4S3NA 1L6NA 2GH1A 5IINA 3QX7A 4B9UA 1K1SA 5KG7A 1UT5A 3NRZA 5CA7A 2VKQA 3RH5A 2Y9UA 5KFHA 4X4VA 1U48A 1SV0C 4NLBA 3IHQB 4P4OA 3V7KA 2PFPA 2B6GA 2BBJA 2G08A 2ZIUB 5KT3A 2VA2A 3NASA 4FHXA 5CP2A 3CYMA 2FPMA 2ZUDA 3WKAA 3QYPA 2C2EA 7ICFA 3ZI4A 5ALUA 1L7PA 3H0LB 2VJ5A 1T3NA 1NKBA 1VJ5A 4HAIA 5DBCA 5CHEA 5BPCA 5ALRA 4YR2A 3RB4A 4R64A 1KEJA 3KFUF 2WFAA 3JYYA 3N7RC 3PSTA 1QLNA 1TKDA 5AK4A 2YMPA 1ZQIA 1NK6A 4OJLA 4K4HA 3L5KA 2ZTCA 5ALOA 3MR2A 4QZFA 2DR8A 4CDGA 1TAMA 2FE9A 2UVWA 1ZQ1C 2QKQA 3I28A 3QU9A 4JLXA 4IG8A 1NJWA 4KLQA 1X42A 4M2YA 1K1QA 1SZPA 2BQ3A 4O3QA 3EZ5A 1J2MA 1CI4A 4CCHA 5KFIA 2M2TA 2XVTA 2C2DA 4PGYA 8ICTA 7ICSA 4XQ7A 3GQCA 5J2JA 5ALLA 2KIWA 4EYHB 1SV4A 4TUSA 3BQ0A 3WK9A 4DFKA 3N4MB 2KVSA 3IN5A 3RR8A 3GIKA 4X4PA 4US8A 4DOCA 4DLGA 2KJ9A 3ZDAA 1TAQA 3ETLA 2LYHA 5AI6A 4IQWA 5L9XA 3QZ8A 2EAOA 4F93B 4O3NA 3M6ZA 1RQNA 4WC1A 1K5OA 3HRDD 3LVVA 2F8LA 5J8YC 2XC9A 3PO4A 3AQMA 4WC5A 3C5FA 9ICFA 3AEVA 1ZJMA 4J9KA 2K8CB 4J9PA 4WH5A 3PW4A 2FDRA 5JUMA 1S0NA 1R89A 2FI1A 5AKHA 4QIWF 1N63A 2NRZA 2ES6A 4I2IA 2I9GA 3SI8A 3C29A 4Y2RA 2Z7JA 9ICQA 2OH2A 3T5JA 2VANA 3PX4A 2ZUBA 4XA5A 3C18A 2CPRA 3IG8A 2B21A 2MA1A 3N7SC 4KLSA 5C0YA 4NLKA 3AQNA 4DCCA 1QQ7A 5AI4A 4EEBA 3PX0A 2QB0A 3KHGA 4JWNA 4TQRA 3ER9B 4GC7A 3C1YA 1N60A 2W54A 5EE3A 4RUCA 1KQQA 1L8LA 4PJ0U 1ZXIA 4NM2A 2AQ0A 4EEYA 2F2AB 2MU2A 4LZDA 4QZHA 3WKDA 1JAJA 2FPKA 3TANA 4KLIA 8ICKA 1ZQDA 2YMMA 5J0YA 2QB0B 4ELVA 5AKGA 2YN4A 2M9NA 4ELUA 1V9PA 4KMOB 5JTIA 4X4SA 3HX0A 4JV1A 2EZXA 4LJXA 3KKAA 5DKWA 1FA0A 2AH5A 4KLFA 4X4RA 2MUTB 5B66U 3B0YA 4OJ5A 5ALKA 2J6SA 4JV2A 9ICIA 4QZIA 3RTVA 1DGSA 2V9WA 2Q66A 5HRBA 4FZMA 5CEHA 2W9CB 4AT8B 2KZMA 5KFUA 4AT9A 5KTQA 2LKYA 4C4TA 2JEJA 4RNNA 4P0QA 3PV8A 1Q78A 1Q46A 3H8JA 4YQWA 2ZH7A 4NXWA 4GXJA 3GIMA 4J9LA 2WB1F 2M2VA 1B43A 5IIMA 1RQLA 4JWMA 5KT2A 4DL2A 2AU0A 1ZQTA 1B4FA 1URJA 3IDWA 3K4GA 2DGZA 5AKKA 4OAHA 5ALIA 4F5QA 4MFCA 3BZKA 3RH4A 3ISBA 5DG9A 3QEAZ 1ZD2P 3O0FA 5ALJA 1S77D 5IILA 3H8SA 4UAYA 4ECUA 5ALPA 1ZD5A 4IR1A 1JRPA 2KFNA 3Q8LA 4OCZA 1ZQBA 3QU2A 1QSSA 2OXOA 5AM2A 5AI5A 2HDOA 4Q8FA 1ZQJA 2Y1IA 2VIXA 2BE3A 3RAQA 3M7DA 2PFOA 3QUTA 4F72A 4U6PA 4DSFA 2EZZA 1WOTA 5AI9A 5DBAA 4DWIA 3Q8RB 4AYBF 1U49A 1JMSA 1WG8A 4IR9A 2JRZA 7ICLA 3MBYA 2JV3A 1Z19A 4XQ8A 1SL2A 4NM1A 2FCLA 5ALFA 1T8EA 1ED1A 8ICBA 4FHYA 2E5SA 4YXMA 4OJ6A 4QZCA 2HHSA 1L3VA 5D61A 2AHOB 3HW8A 3VCBA 2DVIA 4PZNA 4J9OA 1P7DA 5KG4A 2HOFA 3L3FX 4X4UA 2O5AA 4UAWA 3ICXA 3WK4A 5KFAA 2BZFA 2RP5A 2HHPA 2W3SA 1XS9D 2IHOA 4XRHA 4JMUA 2DQNB 3GV8B 5HRDA 2RHFA 4WOYA 1YT3A 2E3TA 3QE9Y 7ICIA 4DQIA 2ZH6A 3MDCA 3BZCA 2F8KA 5B3PA 2BCRA 3ZDCA 3E0FA 4M04A 2M2WA 4QZEA 4GXKA 4USAA 4ED0A 8ICAA 4O3SA 3H4BA 3THVA 1ZQKA 2EWRA 4BX9C 5HHIA 4E80A 4B9LA 3RJHA 4DOBA 2XCAA 3IV6A 1JROA 4B9MA 1R8CA 4ED1A 4FHVA 3RJIA 1SB3C 1ZQEA 2P6UA 2CRXA 2KHVA 4O3MA 1TV9A 1C20A 4J9QA 4YMNA 2KKVA 2HBJA 3PR5B 3JPRA 1XC9A 5J0PA 1C7YA 2PMZF 5BOLA 3NWIA 2C28A 2DRAA 3F5AA 3D2NA 1FO4A 3H40A 3ED5A 2JHDA 4PHDA 3AU6A 4XJEA 2BDUA 3RBDA 4ECWA 5F2VO 2PBEA 4N7RA 4DFDA 4NXZA 2ZHBA 3KOOA 1F44A 5KFKA 1KTQA 3BQTA 1MSWD 1KSPA 5KFWA 3IM1A 1IIPA 1ZD4A 3N7PD 2KZ3A 4QZ9A 3NTUA 1ZQQA 1RG6A 4AT7B 2YMQA 3C1ZA 3TKAA 1CRXA 4ECSA 1ZQXA 2PKEA 3F2CA 4EEDA 3AN1A 3NRWA 4R8UA 4DSJA 5H2FU 5TISU 1L3TA 2G5HB 3T79A 9ICCA 4RWQA 4EBCA 3SENA 2KTQA 2HVHA 3PVXA 3MFIA 3NS1A 4LEVA 5CHGA 4P4MA 1ZQYA 4DSLA 2YQEA 4YD2A 2NV3A 3RJEA 2ZJ8A 2GWSA 1U45A 4M6WB 2G06A 4JV0A 1N61A 4O69A 1SWWA 2KV2A 3JPOA 1S76D 2IOFA 5KG2A 5J2KA 4O67A 5AM3A 1T3QA 3ZD8A 4CGZA 5HRFA 5A0LA 4F92B 4FH3A 4DQQA 4UB2A 1D8BA 3RBEA 4UBCA 3HKZC 4US9A 3SV4A 4QWDA 1ZQFA 4AP9A 1BNOA 1L7OA 3KHLA 3LDAA 4PHEA 1JXEA 2D8CA 5KL1B 4YFKA 5ALEA 1ZOLA 5KT5A 2KMDA 3ALRA 3HJEA 1NO5A 4RNOA 4YR3A 4GLXA 4Y2YA 3L4PA 4KN7A 2DPIA 1T94A 2E8NA 2KICA 7ICTA 5E79U 3JZ0A 3A0BU 5J0QA 4K98A 3HKZF 2ZTEA 4PHAA 2YB4A 4Y2TA 2J6TA 2ZHAA 3AQEA 4C7YA 3TARA 2XCPA 5J0XA 2EAPA 4YXJA 3MGVA 2JEGA 2IOFK 2WAQC 5J2CA 4P0QB 2KE7A 5F3XB 3EUB2 5BOMA 3SQIA 2HW3A 2BBHA 2BPFA 2R8JA 1OUQA 4Y2SA 4KN4A 1AQ6A 3G6VA 4WC3A 1U47A 3NVWA 4F3OA 4F2RA 5KT7A 2ZIUA 3C21A 1ZRNA 1JXLA 1JUDA 4I2HA 4Q8EA 3C2MA 9ICKA 1JI7A 2RFFA 1U4BA 3PW7A 1SIJA 7ICHA 5KFZA 2JEFA 4PHPA 2MUTA 2KEYA 1J97A 1TK5A 8ICVA 1CUKA 2ISPA 2WF9A 8ICWA 5CJ7A 2FPLA 2ZJAA 8ICHA 1OXJA 2R8GA 4OJOA 3M1YA 2JZBB 1KFDA 2WHEA 1SKWA 1ZQHA 3QU7A 2GA9D 3KHRA 3RB0A 1S97A 1X6IA 3EW9A 3Q8KA 2W9BB 4LT6A 4X0AA 2I1QA 1BPZA 4K97A 4U7CA 4X4QA 5GTIU 4NLCA 3GV5B 3C66A 2Y0SC 2YTUA 2W55A 2E8OA 2ZIVB 5DDYA 3MFHA 4KTQA 3GZFA 5DB7A 5L1IA 5EE9A 3RH6A 5IIJA 4KX5A 2OCEA 3H37A 5KG5A 9ICEA 5J29A 3JCFA 4FO1A 2BHNA 4OO1J 3I1YA 4KLOA 4NLZA 4O3OA 1A6SA 2HBLA 4MFFA 4A8EA 2RRDA 5L1LA 1KDHA 2K4IA 2HI0A 5DEDA 3H7IA 2N1RA 3GIIA 1UPHA 1KL9A 5AKLA 1FFUA 2W9MA 4Y2XA
chains in the Genus database with same CATH topology
5DBBA 5J2EA 5J2DA 2W9CB 5KG0A 3C5GA 1TK8A 4EZ6A 4LZGA 5EWFA 4F5PA 2KZMA 5KFUA 4AT9A 4TURA 2WTFA 1UT8A 5KTQA 3OJSA 4RPXA 1D9FA 4M5DA 3RJGA 5KT4A 4PH5A 2ZH3A 2JEJA 8ICIA 4M6WA 5DG8A 3OV7A 4RNNA 3C2KA 3TI0A 3PV8A 4Z6CA 1Q78A 5KFMA 5J0RA 1NOMA 4UB4A 4KLTA 3WFOA 3H8JA 1Z00B 4YQWA 1BVSA 3KHHA 2BDPA 2ZH7A 4NY8A 3BQ2A 4DOAA 3MR5A 4KLUA 4IQTA 1HUOA 4P2HA 1T7PA 3LQCB 3Q8QB 3GIMA 4GXJA 3PY8A 1S0VA 7ICVA 3OUYB 4J9LA 1TFWA 3WFSC 2AQ4A 4BXOA 4JUZA 5KFRA 3LWMA 5J2HA 2M2VA 3OUYA 4M9JA 5CR0A 3AQKA 5J2GA 3OSPA 1B43A 3N97B 1NK4A 4KLDA 5IIMA 4LVSA 1UEUA 2HHXA 1Z00A 1SKRA 1X9MA 4JWMA 5KT2A 4DL2A 2F1IA 2AU0A 5HR9A 3OVBA 4DQPA 1ZQTA 3K4GA 3ZD9A 5EOZA 4X4OA 4NKUA 2F1HA 3V6JA 3H3AA 1TK0A 3OVAA 4EBEA 2M2UA 4BXOB 4RPZA 3MR6A 3T3FA 4QWEA 5KFEA 4F5QA 4MFCA 4RQ1A 4O0IA 3RH4A 1XSPA 2W9BA 1TFYA 1VFGA 4YMOA 4C8LA 4EBJA 1BGXT 4F5OA 3ISDA 4ATBB 4Z6FA 4F4ZA 3ISBA 2IBKA 3G6YA 3ZDBA 5IIOA 4YG2A 5DG9A 4O3PA 3QEAZ 2KP7A 4DSIA 1S77D 2ZH4A 5IILA 3H8SA 4QZBA 4UAYA 4Z6EA 3UPQA 4ECUA 9ICUA 1VJ7A 4EP7A 4O3RA 5D4BA 4I2BA 4IR1A 3UQ0A 2KFNA 2BR0A 4C8MA 5HRGA 4K4IA 2UVVA 5HRLA 4X4TA 4RQ4A 9ICBA 3Q8LA 5DB6A 3KTQA 3AU2A 4WC4A 1ZQBA 2JEIA 4RQ0A 4F4XA 4ED3A 1QSSA 2BKEA 4BDPA 2FLNA 3HIYA 4B9TA 1MIYA 4I2AA 3ZDDA 7ICQA 3JPQA 3K75D 2R8HA 5J0UA 1KFSA 5DGBA 1ZQJA 4Q8FA 4E7XA 2Y1IA 2UVUA 1X9SA 2ZUCA 4DFMA 2BE3A 4EBKA 3H8WA 1X2IA 8ICNA 3BJYA 3RAQA 2PFOA 2KZZA 3GDXA 3SZ2A 4I28A 4MF8A 8ICRA 4DSFA 8ICEA 1WOTA 4IQUA 2FLLA 5F9LA 5DBAA 3C23A 5KFPA 1RPLA 7ICRA 5EWEA 4DWIA 4ED8A 5KFCA 3FYHA 1MC8A 3Q8RB 2W8LA 3TQ1A 2IMWP 4UB3A 1U49A 1UEVA 1JMSA 4Q44A 3OHBA 1NK8A 4KMUA 3M9NB 3V6KA 1N56A 1RYRA 4IR9A 2HVIA 1L3UA 4X4NA 5DB8A 5KFTA 3HPOA 1HUZA 3HT3A 3H39A 3TFRA 2HHVA 3MBYA 8ICCA 2ISOA 9ICMA 7ICLA 1ZQVA 3GFKB 4PGQA 4DL4A 3E2EA 4DSEA 5DLGA 3B0XA 3RAXA 1ZQGA 4XQ8A 1SL2A 4NM1A 9ICRA 4E0DA 4YN4A 1T8EA 8ICBA 4FHYA 4ECXA 4QW8A 3PW2A 1L3SA 5TZVA 4YXMA 3QZ7A 1MQ3A 3EYZA 2IHMA 8ICMA 1XSLA 4WC7A 1H38A 4QWCA 2RDIA 4K4GA 2F1JA 4DQSA 1BPBA 3BDPA 4DL6A 4QZCA 3JPPA 1L3VA 1ZQLA 4KLMA 5KFXA 4Q43A 2HHSA 4F4KA 3JPTA 3OSNA 1ZQPA 1RXWA 4I29A 9ICNA 4DO9A 4KLEA 4KLHA 1BPXA 4RUAA 3HW8A 4J9SA 1EXNA 9ICAA 2DVIA 2HHTA 1A76A 4J9OA 2BCSA 1ZQRA 3RJJA 5KG4A 2R8KA 4X4UA 1NK9A 2UVRA 2KN7A 2O5AA 3FDSA 5HNKA 4UAWA 2W9AA 4J9RA 4DS4A 4YD1A 2AGPA 3UXOA 4RT2A 4YCXA 4WC6A 5IIIA 1HJPA 5KFAA 4C8NA 4FHWA 2HHPA 5C5JA 2DR9A 2AGQA 3RJFA 1QTMA 2JZBA 1XS9D 4XRHA 3M8SA 2OWOA 3GV8B 2V4RA 3UQ2A 2AGOA 5HRDA 4KLLA 4AT7A 3PR4A 7ICMA 1ZQNA 4B9SA 3WFQE 7ICNA 4MFAA 3QE9Y 7ICIA 3OHAA 5DG7A 3UXNA 3MDCA 2P66A 4DQIA 9ICLA 2ZH6A 3PX6A 1NK7A 2BCRA 4YP3A 3ZDCA 9ICXA 1MIWA 4M04A 8ICZA 1UA1A 3M9MB 2M2WA 7ICEA 4RT3A 4QZEA 4GXKA 4ED0A 4AT8B 4MEYA 4DEZA 8ICAA 4F8RA 3H4BA 5DLFA 4O3SA 5KFBA 3THVA 1ZQKA 1XU4A 4RU9A 5HHIA 2ASLA 2BCVA 3H4DA 2XY6A 4RPYA 8ICQA 4FO6A 1B22A 4B9LA 9ICTA 4E80A 3RJHA 4DOBA 5J2IA 4ED2A 2XCAA 2BQRA 4GC6A 1WCNA 2BPGA 3RR7A 1JIHA 4RWNA 4NLNA 4UB5A 1Q79A 1NK5A 3PMLA 3Q8MA 4B9MA 1R8CA 4ED1A 2ALZA 4FHVA 1ZQUA 3WFPA 4P4PA 4ECVA 4R65A 3RJIA 4FS1A 1ZQEA 4I2FA 5F9NA 3MDAA 2P6UA 5DECA 2XY5A 2BQUA 4IRCA 3M8RA 1RXVA 1L5UA 4ELTA 2PI4A 1NKEA 4DF8A 3PW0A 3T5HA 1RZTA 1TV9A 4FBUA 2DRBA 4YMMA 4J9QA 9ICOA 4YMNA 1KFTA 3PR5B 3PO5A 3Q8SB 3MR3A 1COOA 3JPRA 3GV7B 1XC9A 1ZQAA 2A1JA 5J0PA 4G3IA 4EYIB 5DDMA 4GXIA 4ED7A 2BGWA 1C7YA 1S0OA 3OVSA 2FLPA 2ZH2A 4UD4A 5BOLA 8ICUA 5J2FA 2C28A 2DPJA 5KFOA 2AJQA 2DRAA 5J2BA 3H40A 2DFLA 4PHDA 3AU6A 4ATBA 3AQLA 5HHHA 3RBDA 3JPSA 4ECWA 3NGDA 9ICVA 4I2EA 1JQRA 5F2VO 2ASDA 2PBEA 3ISCA 2VA8A 4NXZA 2ZHBA 4F50A 4DL7A 8ICFA 1KNYA 2ID1A 4NKTA 5HC9A 1PZNA 4YVZA 5KFKA 4DS5A 5KFYA 2XGQA 3HWTA 4EBDA 5J2AA 1KTQA 4X5VA 1S10A 3EPGA 1ZQOA 1ZETA 4M9GA 3BQTA 1MSWD 9ICSA 3HJ1A 1KSPA 1DOQA 5KFWA 3IM1A 4C8KA 4RWPA 1ZQCA 4S3NA 2KZ3A 4QZ9A 3NTUA 1ZQQA 5IINA 5L1KA 4AT7B 4RQ5A 2XO7A 8ICSA 3C1ZA 4B9UA 1K1SA 8ICPA 5KG7A 3AUOA 9ICGA 4ECSA 1ZQXA 3V72A 1UT5A 1YLQA 3TAQA 3RJKA 1BPDA 3Q8PB 5CA7A 9ICPA 2ZH9A 4R8UA 4DSJA 2NRVA 1L3TA 3QEBZ 2A1JB 3RH5A 5KFHA 4I2GA 2HHWA 1U48A 1X9WA 3H38A 4X4VA 4R63A 4IRKA 3IHQB 1ZQZA 9ICCA 4P4OA 3V7KA 3TAPA 4EBCA 5DB9A 4RWQA 2PFPA 3UXPA 7ICOA 2KTQA 4ECRA 4RQ7A 5KT3A 2PI5A 2HVHA 3PVXA 3MFIA 4M47A 4QZGA 2Q0ZX 5CHGA 3PW5A 1UA0A 2VA2A 4P4MA 3EWAA 5KFJA 1ZQYA 1NJYA 4IRDA 5CP2A 4DSLA 4FHXA 2FPMA 2ZUDA 4WC0A 2W9CA 4YD2A 4AT8A 5DGAA 3RJEA 2C2EA 9ICJA 7ICFA 4KLJA 3V6HA 2ZJ8A 2GWSA 5HMLA 1U45A 7ICPA 1T3NA 3ORYA 4M6WB 1NKBA 3T5KA 4UD5A 3ZDEA 5DBCA 4JV0A 2VA3A 5J0OA 3M9OB 4F5RA 4M9NA 4QWBA 2W8KA 5KFVA 4UBBA 3GIJA 5BPCA 3JPOA 4J9NA 4YR2A 3RB4A 1XSNA 4KITB 5KG2A 1S76D 5J2KA 4R64A 1KEJA 4ECQA 3JPNA 2PFQA 4RQ2A 3MGIA 3ZD8A 3JYYA 7ICGA 4WBZA 1QLNA 5KFLA 1TKDA 5HRFA 1BPYA 1XWLA 4F92B 1ZQIA 1NK6A 4FH3A 2XGPA 4DQQA 4DF4A 4UB2A 1KLNA 4K4HA 1DK3A 4RZRA 4EZ9A 2ZTDA 3OGUA 2BPCA 4F2SA 2ZTCA 3MR2A 3RBEA 4QZFA 4UBCA 2DR8A 3OJUA 3SV4A 4QWDA 2DR7A 3LWLA 1ZJNA 1NJXA 3SV3A 1ZQFA 1A77A 1BNOA 3UPSA 4DSKA 4M9HA 2UVWA 4I2DA 3LDAA 3KHLA 3SYZA 4PHEA 2ASJA 1JXEA 5HRHA 4YFKA 2NRXA 1NK0A 5KT5A 1NJWA 4KLQA 4IG8A 2NRWA 2V4QA 1R8BA 1NO5A 4RNOA 1U9LA 1K1QA 4YR3A 4M2YA 4KLGA 4GLXA 1SZPA 2BQ3A 7ICJA 4O3QA 4F91B 3EZ5A 1IM4A 4CCHA 3C2LA 2HHUA 1OU5A 3L9DA 4I2CA 8ICYA 5KFIA 2M2TA 4KN7A 5KT6A 5KG1A 4PGYA 5L1JA 2C2DA 2DPIA 8ICTA 3GQCA 7ICSA 4XQ7A 4NLGA 5J2JA 7ICTA 1S0MA 7ICUA 4EYHB 4ZH4A 4ECTA 5HP4A 3JZ0A 4TUSA 3BQ0A 4DFKA 4Q45A 5J0QA 3N4MB 4UAZA 2ZTEA 4B9VA 3RR8A 4PHAA 3GIKA 4X4PA 1ZQMA 4DOCA 3V7LA 5KFNA 3TFSA 2J6TA 4DLGA 4O5EA 2ZHAA 9ICWA 5IIKA 3TARA 4O5KA 2XCPA 3ZDAA 1TAQA 1KRPA 5J0XA 3ETLA 4QZAA 5D46A 1RYSA 4RWOA 4FS2A 3WFRE 2LYHA 4IQWA 4YXJA 2BCQA 5L9XA 4QZ8A 5DQHA 2JEGA 3QZ8A 5J0TA 2MAXA 4RQ8A 5KFFA 4F93B 4O3NA 5J0SA 5J2CA 4DFJA 4WC1A 2C22A 3RB3A 3MABA 2FMSA 3PMNA 2R8IA 1V4AA 1TVAA 2XC9A 4I2JA 5BOMA 3RB6A 2HW3A 4X0BA 1T4GA 2BPFA 4QW9A 2R8JA 2FMPA 3PO4A 7ICKA 4DQRA 8ICJA 5HREA 3AQMA 3C5FA 4WC5A 1ZYQA 4IQVA 2RDJA 9ICFA 1ZJMA 1QSYA 5DQIA 4J9KA 3HP6A 2PXIA 2C2RA 4KN4A 4J9PA 3RRGA 3G6VA 4F5NA 5JUMA 4DL3A 3PW4A 1U47A 1S0NA 4B9NA 1R89A 4WC3A 4RNMA 4BGDA 1LB2B 4XUSA 4UQGA 1MIVA 4F3OA 2NRKA 4M9LA 4F2RA 2NRZA 5KT7A 4QWAA 4TUPA 4HYKA 2IA6A 3BQ1A 4O5CA 1N48A 3C21A 2Y1JA 1JXLA 5KFDA 4WBYA 4I2HA 4PPXA 1IXRA 4I2IA 4Q8EA 4QZDA 3C2MA 3SI8A 2I9GA 9ICKA 2RFFA 1U4BA 9ICHA 1JN3A 1CEZA 1D8YA 1BPEA 1NJZA 4DL5A 3PW7A 9ICQA 1PX5A 3T5JA 2VANA 3G6XA 2XY7A 7ICHA 5HRBA 8ICLA 3PX4A 5KFZA 4R66A 4PHPA 2JEFA 1TAUA 2ZUBA 4XA5A 2MUTA 1MQ2A 3C18A 4E8FA 8ICVA 4F4YA 1TK5A 2ZH8A 1CUKA 2B21A 2J6UA 2ISPA 4KLSA 8ICWA 2DR5A 2PFNA 3RRHA 4NLKA 3AQNA 5CJ7A 2FPLA 1WCLA 2ZJAA 8ICHA 2R8GA 5KFSA 4MF2A 1UETA 4Z6DA 3PX0A 4JK1A 3KHGA 4JWNA 5KG3A 3EPIA 4BWMA 1BNPA 2JZBB 1KFDA 2O1PA 3GILA 1D9DA 8ICXA 4TQRA 1SKWA 4GC7A 1ZQHA 3NYBA 1SL0A 4WC2A 3C1YA 1NKCA 2ZH5A 1AROP 3KHRA 4ED6A 3RB0A 1S97A 3EW9A 3Q8KA 3V7JA 1LV5A 2W9BB 4FHPA 4R8UB 4ECYA 4LT6A 4X0AA 2I1QA 4RUCA 4DFPA 5KFQA 1BPZA 2P6RA 4X4QA 2HHQA 4NM2A 3GV5B 2AQ0A 4EEYA 3C66A 4UB1A 2FMQA 5DDYA 4LZDA 5CWRA 4QZHA 3MFHA 4KTQA 1ZQWA 1JX4A 8ICOA 4FBTA 1JAJA 4RQ6A 2FPKA 5DB7A 5DQGA 5EWGA 5L1IA 2ATLA 4ELUA 3TANA 2IHNA 4KLIA 4I27A 1ZQDA 4F4WA 3RH6A 2BCUA 8ICKA 5J0YA 5IIJA 4TQSA 4ELVA 3H37A 4BWJA 3HJ4A 5KG5A 3LK9A 9ICEA 5J29A 4O9MA 2BHNA 2M9NA 2ZJ5A 1SL1A 1V9PA 4PGXA 3MGHA 4TUQA 3HX0A 2H5XA 1S9FA 4JV1A 4KLOA 4X4SA 4AT9B 3T5LA 4M0AA 5DKWA 4NLZA 1F5AA 1FA0A 4ECZA 4O3OA 1NZPA 5KFGA 4MFFA 5J0WA 4KLFA 4X4RA 2MUTB 5L1LA 1KDHA 1ZQSA 3B0YA 1Z3EB 2J6SA 4JV2A 1SKSA 8ICGA 5DEDA 9ICIA 5CB1A 4QZIA 4C8OA 4J9MA 3RTVA 2KFZA 3H7IA 1R8AA 2NRTA 4FH5A 4YR0A 2ZH1A 3PNCA 1XO1A 4MEXA 1DK2A 3GIIA 1DGSA 5D49A 1Y88A 5HMMA 5HRIA 4RQ3A 2V9WA 1TFRA 2Q66A 2W9MA 1QSLA 5HRKA 5KG6A 4DLEA 1D8LA 4WCWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBB A;  5J2E A;  5J2D A;  2W9C B;  5KG0 A;  3C5G A;  1TK8 A;  4EZ6 A;  4LZG A;  5EWF A;  4F5P A;  2KZM A;  5KFU A;  4AT9 A;  4TUR A;  2WTF A;  1UT8 A;  5KTQ A;  3OJS A;  4RPX A;  1D9F A;  4M5D A;  3RJG A;  5KT4 A;  4PH5 A;  2ZH3 A;  2JEJ A;  8ICI A;  4M6W A;  5DG8 A;  3OV7 A;  4RNN A;  3C2K A;  3TI0 A;  3PV8 A;  4Z6C A;  1Q78 A;  5KFM A;  5J0R A;  1NOM A;  4UB4 A;  4KLT A;  3WFO A;  3H8J A;  1Z00 B;  4YQW A;  1BVS A;  3KHH A;  2BDP A;  2ZH7 A;  4NY8 A;  3BQ2 A;  4DOA A;  3MR5 A;  4KLU A;  4IQT A;  1HUO A;  4P2H A;  1T7P A;  3LQC B;  3Q8Q B;  3GIM A;  4GXJ A;  3PY8 A;  1S0V A;  7ICV A;  3OUY B;  4J9L A;  1TFW A;  3WFS C;  2AQ4 A;  4BXO A;  4JUZ A;  5KFR A;  3LWM A;  5J2H A;  2M2V A;  3OUY A;  4M9J A;  5CR0 A;  3AQK A;  5J2G A;  3OSP A;  1B43 A;  3N97 B;  1NK4 A;  4KLD A;  5IIM A;  4LVS A;  1UEU A;  2HHX A;  1Z00 A;  1SKR A;  1X9M A;  4JWM A;  5KT2 A;  4DL2 A;  2F1I A;  2AU0 A;  5HR9 A;  3OVB A;  4DQP A;  1ZQT A;  3K4G A;  3ZD9 A;  5EOZ A;  4X4O A;  4NKU A;  2F1H A;  3V6J A;  3H3A A;  1TK0 A;  3OVA A;  4EBE A;  2M2U A;  4BXO B;  4RPZ A;  3MR6 A;  3T3F A;  4QWE A;  5KFE A;  4F5Q A;  4MFC A;  4RQ1 A;  4O0I A;  3RH4 A;  1XSP A;  2W9B A;  1TFY A;  1VFG A;  4YMO A;  4C8L A;  4EBJ A;  1BGX T;  4F5O A;  3ISD A;  4ATB B;  4Z6F A;  4F4Z A;  3ISB A;  2IBK A;  3G6Y A;  3ZDB A;  5IIO A;  4YG2 A;  5DG9 A;  4O3P A;  3QEA Z;  2KP7 A;  4DSI A;  1S77 D;  2ZH4 A;  5IIL A;  3H8S A;  4QZB A;  4UAY A;  4Z6E A;  3UPQ A;  4ECU A;  9ICU A;  1VJ7 A;  4EP7 A;  4O3R A;  5D4B A;  4I2B A;  4IR1 A;  3UQ0 A;  2KFN A;  2BR0 A;  4C8M A;  5HRG A;  4K4I A;  2UVV A;  5HRL A;  4X4T A;  4RQ4 A;  9ICB A;  3Q8L A;  5DB6 A;  3KTQ A;  3AU2 A;  4WC4 A;  1ZQB A;  2JEI A;  4RQ0 A;  4F4X A;  4ED3 A;  1QSS A;  2BKE A;  4BDP A;  2FLN A;  3HIY A;  4B9T A;  1MIY A;  4I2A A;  3ZDD A;  7ICQ A;  3JPQ A;  3K75 D;  2R8H A;  5J0U A;  1KFS A;  5DGB A;  1ZQJ A;  4Q8F A;  4E7X A;  2Y1I A;  2UVU A;  1X9S A;  2ZUC A;  4DFM A;  2BE3 A;  4EBK A;  3H8W A;  1X2I A;  8ICN A;  3BJY A;  3RAQ A;  2PFO A;  2KZZ A;  3GDX A;  3SZ2 A;  4I28 A;  4MF8 A;  8ICR A;  4DSF A;  8ICE A;  1WOT A;  4IQU A;  2FLL A;  5F9L A;  5DBA A;  3C23 A;  5KFP A;  1RPL A;  7ICR A;  5EWE A;  4DWI A;  4ED8 A;  5KFC A;  3FYH A;  1MC8 A;  3Q8R B;  2W8L A;  3TQ1 A;  2IMW P;  4UB3 A;  1U49 A;  1UEV A;  1JMS A;  4Q44 A;  3OHB A;  1NK8 A;  4KMU A;  3M9N B;  3V6K A;  1N56 A;  1RYR A;  4IR9 A;  2HVI A;  1L3U A;  4X4N A;  5DB8 A;  5KFT A;  3HPO A;  1HUZ A;  3HT3 A;  3H39 A;  3TFR A;  2HHV A;  3MBY A;  8ICC A;  2ISO A;  9ICM A;  7ICL A;  1ZQV A;  3GFK B;  4PGQ A;  4DL4 A;  3E2E A;  4DSE A;  5DLG A;  3B0X A;  3RAX A;  1ZQG A;  4XQ8 A;  1SL2 A;  4NM1 A;  9ICR A;  4E0D A;  4YN4 A;  1T8E A;  8ICB A;  4FHY A;  4ECX A;  4QW8 A;  3PW2 A;  1L3S A;  5TZV A;  4YXM A;  3QZ7 A;  1MQ3 A;  3EYZ A;  2IHM A;  8ICM A;  1XSL A;  4WC7 A;  1H38 A;  4QWC A;  2RDI A;  4K4G A;  2F1J A;  4DQS A;  1BPB A;  3BDP A;  4DL6 A;  4QZC A;  3JPP A;  1L3V A;  1ZQL A;  4KLM A;  5KFX A;  4Q43 A;  2HHS A;  4F4K A;  3JPT A;  3OSN A;  1ZQP A;  1RXW A;  4I29 A;  9ICN A;  4DO9 A;  4KLE A;  4KLH A;  1BPX A;  4RUA A;  3HW8 A;  4J9S A;  1EXN A;  9ICA A;  2DVI A;  2HHT A;  1A76 A;  4J9O A;  2BCS A;  1ZQR A;  3RJJ A;  5KG4 A;  2R8K A;  4X4U A;  1NK9 A;  2UVR A;  2KN7 A;  2O5A A;  3FDS A;  5HNK A;  4UAW A;  2W9A A;  4J9R A;  4DS4 A;  4YD1 A;  2AGP A;  3UXO A;  4RT2 A;  4YCX A;  4WC6 A;  5III A;  1HJP A;  5KFA A;  4C8N A;  4FHW A;  2HHP A;  5C5J A;  2DR9 A;  2AGQ A;  3RJF A;  1QTM A;  2JZB A;  1XS9 D;  4XRH A;  3M8S A;  2OWO A;  3GV8 B;  2V4R A;  3UQ2 A;  2AGO A;  5HRD A;  4KLL A;  4AT7 A;  3PR4 A;  7ICM A;  1ZQN A;  4B9S A;  3WFQ E;  7ICN A;  4MFA A;  3QE9 Y;  7ICI A;  3OHA A;  5DG7 A;  3UXN A;  3MDC A;  2P66 A;  4DQI A;  9ICL A;  2ZH6 A;  3PX6 A;  1NK7 A;  2BCR A;  4YP3 A;  3ZDC A;  9ICX A;  1MIW A;  4M04 A;  8ICZ A;  1UA1 A;  3M9M B;  2M2W A;  7ICE A;  4RT3 A;  4QZE A;  4GXK A;  4ED0 A;  4AT8 B;  4MEY A;  4DEZ A;  8ICA A;  4F8R A;  3H4B A;  5DLF A;  4O3S A;  5KFB A;  3THV A;  1ZQK A;  1XU4 A;  4RU9 A;  5HHI A;  2ASL A;  2BCV A;  3H4D A;  2XY6 A;  4RPY A;  8ICQ A;  4FO6 A;  1B22 A;  4B9L A;  9ICT A;  4E80 A;  3RJH A;  4DOB A;  5J2I A;  4ED2 A;  2XCA A;  2BQR A;  4GC6 A;  1WCN A;  2BPG A;  3RR7 A;  1JIH A;  4RWN A;  4NLN A;  4UB5 A;  1Q79 A;  1NK5 A;  3PML A;  3Q8M A;  4B9M A;  1R8C A;  4ED1 A;  2ALZ A;  4FHV A;  1ZQU A;  3WFP A;  4P4P A;  4ECV A;  4R65 A;  3RJI A;  4FS1 A;  1ZQE A;  4I2F A;  5F9N A;  3MDA A;  2P6U A;  5DEC A;  2XY5 A;  2BQU A;  4IRC A;  3M8R A;  1RXV A;  1L5U A;  4ELT A;  2PI4 A;  1NKE A;  4DF8 A;  3PW0 A;  3T5H A;  1RZT A;  1TV9 A;  4FBU A;  2DRB A;  4YMM A;  4J9Q A;  9ICO A;  4YMN A;  1KFT A;  3PR5 B;  3PO5 A;  3Q8S B;  3MR3 A;  1COO A;  3JPR A;  3GV7 B;  1XC9 A;  1ZQA A;  2A1J A;  5J0P A;  4G3I A;  4EYI B;  5DDM A;  4GXI A;  4ED7 A;  2BGW A;  1C7Y A;  1S0O A;  3OVS A;  2FLP A;  2ZH2 A;  4UD4 A;  5BOL A;  8ICU A;  5J2F A;  2C28 A;  2DPJ A;  5KFO A;  2AJQ A;  2DRA A;  5J2B A;  3H40 A;  2DFL A;  4PHD A;  3AU6 A;  4ATB A;  3AQL A;  5HHH A;  3RBD A;  3JPS A;  4ECW A;  3NGD A;  9ICV A;  4I2E A;  1JQR A;  5F2V O;  2ASD A;  2PBE A;  3ISC A;  2VA8 A;  4NXZ A;  2ZHB A;  4F50 A;  4DL7 A;  8ICF A;  1KNY A;  2ID1 A;  4NKT A;  5HC9 A;  1PZN A;  4YVZ A;  5KFK A;  4DS5 A;  5KFY A;  2XGQ A;  3HWT A;  4EBD A;  5J2A A;  1KTQ A;  4X5V A;  1S10 A;  3EPG A;  1ZQO A;  1ZET A;  4M9G A;  3BQT A;  1MSW D;  9ICS A;  3HJ1 A;  1KSP A;  1DOQ A;  5KFW A;  3IM1 A;  4C8K A;  4RWP A;  1ZQC A;  4S3N A;  2KZ3 A;  4QZ9 A;  3NTU A;  1ZQQ A;  5IIN A;  5L1K A;  4AT7 B;  4RQ5 A;  2XO7 A;  8ICS A;  3C1Z A;  4B9U A;  1K1S A;  8ICP A;  5KG7 A;  3AUO A;  9ICG A;  4ECS A;  1ZQX A;  3V72 A;  1UT5 A;  1YLQ A;  3TAQ A;  3RJK A;  1BPD A;  3Q8P B;  5CA7 A;  9ICP A;  2ZH9 A;  4R8U A;  4DSJ A;  2NRV A;  1L3T A;  3QEB Z;  2A1J B;  3RH5 A;  5KFH A;  4I2G A;  2HHW A;  1U48 A;  1X9W A;  3H38 A;  4X4V A;  4R63 A;  4IRK A;  3IHQ B;  1ZQZ A;  9ICC A;  4P4O A;  3V7K A;  3TAP A;  4EBC A;  5DB9 A;  4RWQ A;  2PFP A;  3UXP A;  7ICO A;  2KTQ A;  4ECR A;  4RQ7 A;  5KT3 A;  2PI5 A;  2HVH A;  3PVX A;  3MFI A;  4M47 A;  4QZG A;  2Q0Z X;  5CHG A;  3PW5 A;  1UA0 A;  2VA2 A;  4P4M A;  3EWA A;  5KFJ A;  1ZQY A;  1NJY A;  4IRD A;  5CP2 A;  4DSL A;  4FHX A;  2FPM A;  2ZUD A;  4WC0 A;  2W9C A;  4YD2 A;  4AT8 A;  5DGA A;  3RJE A;  2C2E A;  9ICJ A;  7ICF A;  4KLJ A;  3V6H A;  2ZJ8 A;  2GWS A;  5HML A;  1U45 A;  7ICP A;  1T3N A;  3ORY A;  4M6W B;  1NKB A;  3T5K A;  4UD5 A;  3ZDE A;  5DBC A;  4JV0 A;  2VA3 A;  5J0O A;  3M9O B;  4F5R A;  4M9N A;  4QWB A;  2W8K A;  5KFV A;  4UBB A;  3GIJ A;  5BPC A;  3JPO A;  4J9N A;  4YR2 A;  3RB4 A;  1XSN A;  4KIT B;  5KG2 A;  1S76 D;  5J2K A;  4R64 A;  1KEJ A;  4ECQ A;  3JPN A;  2PFQ A;  4RQ2 A;  3MGI A;  3ZD8 A;  3JYY A;  7ICG A;  4WBZ A;  1QLN A;  5KFL A;  1TKD A;  5HRF A;  1BPY A;  1XWL A;  4F92 B;  1ZQI A;  1NK6 A;  4FH3 A;  2XGP A;  4DQQ A;  4DF4 A;  4UB2 A;  1KLN A;  4K4H A;  1DK3 A;  4RZR A;  4EZ9 A;  2ZTD A;  3OGU A;  2BPC A;  4F2S A;  2ZTC A;  3MR2 A;  3RBE A;  4QZF A;  4UBC A;  2DR8 A;  3OJU A;  3SV4 A;  4QWD A;  2DR7 A;  3LWL A;  1ZJN A;  1NJX A;  3SV3 A;  1ZQF A;  1A77 A;  1BNO A;  3UPS A;  4DSK A;  4M9H A;  2UVW A;  4I2D A;  3LDA A;  3KHL A;  3SYZ A;  4PHE A;  2ASJ A;  1JXE A;  5HRH A;  4YFK A;  2NRX A;  1NK0 A;  5KT5 A;  1NJW A;  4KLQ A;  4IG8 A;  2NRW A;  2V4Q A;  1R8B A;  1NO5 A;  4RNO A;  1U9L A;  1K1Q A;  4YR3 A;  4M2Y A;  4KLG A;  4GLX A;  1SZP A;  2BQ3 A;  7ICJ A;  4O3Q A;  4F91 B;  3EZ5 A;  1IM4 A;  4CCH A;  3C2L A;  2HHU A;  1OU5 A;  3L9D A;  4I2C A;  8ICY A;  5KFI A;  2M2T A;  4KN7 A;  5KT6 A;  5KG1 A;  4PGY A;  5L1J A;  2C2D A;  2DPI A;  8ICT A;  3GQC A;  7ICS A;  4XQ7 A;  4NLG A;  5J2J A;  7ICT A;  1S0M A;  7ICU A;  4EYH B;  4ZH4 A;  4ECT A;  5HP4 A;  3JZ0 A;  4TUS A;  3BQ0 A;  4DFK A;  4Q45 A;  5J0Q A;  3N4M B;  4UAZ A;  2ZTE A;  4B9V A;  3RR8 A;  4PHA A;  3GIK A;  4X4P A;  1ZQM A;  4DOC A;  3V7L A;  5KFN A;  3TFS A;  2J6T A;  4DLG A;  4O5E A;  2ZHA A;  9ICW A;  5IIK A;  3TAR A;  4O5K A;  2XCP A;  3ZDA A;  1TAQ A;  1KRP A;  5J0X A;  3ETL A;  4QZA A;  5D46 A;  1RYS A;  4RWO A;  4FS2 A;  3WFR E;  2LYH A;  4IQW A;  4YXJ A;  2BCQ A;  5L9X A;  4QZ8 A;  5DQH A;  2JEG A;  3QZ8 A;  5J0T A;  2MAX A;  4RQ8 A;  5KFF A;  4F93 B;  4O3N A;  5J0S A;  5J2C A;  4DFJ A;  4WC1 A;  2C22 A;  3RB3 A;  3MAB A;  2FMS A;  3PMN A;  2R8I A;  1V4A A;  1TVA A;  2XC9 A;  4I2J A;  5BOM A;  3RB6 A;  2HW3 A;  4X0B A;  1T4G A;  2BPF A;  4QW9 A;  2R8J A;  2FMP A;  3PO4 A;  7ICK A;  4DQR A;  8ICJ A;  5HRE A;  3AQM A;  3C5F A;  4WC5 A;  1ZYQ A;  4IQV A;  2RDJ A;  9ICF A;  1ZJM A;  1QSY A;  5DQI A;  4J9K A;  3HP6 A;  2PXI A;  2C2R A;  4KN4 A;  4J9P A;  3RRG A;  3G6V A;  4F5N A;  5JUM A;  4DL3 A;  3PW4 A;  1U47 A;  1S0N A;  4B9N A;  1R89 A;  4WC3 A;  4RNM A;  4BGD A;  1LB2 B;  4XUS A;  4UQG A;  1MIV A;  4F3O A;  2NRK A;  4M9L A;  4F2R A;  2NRZ A;  5KT7 A;  4QWA A;  4TUP A;  4HYK A;  2IA6 A;  3BQ1 A;  4O5C A;  1N48 A;  3C21 A;  2Y1J A;  1JXL A;  5KFD A;  4WBY A;  4I2H A;  4PPX A;  1IXR A;  4I2I A;  4Q8E A;  4QZD A;  3C2M A;  3SI8 A;  2I9G A;  9ICK A;  2RFF A;  1U4B A;  9ICH A;  1JN3 A;  1CEZ A;  1D8Y A;  1BPE A;  1NJZ A;  4DL5 A;  3PW7 A;  9ICQ A;  1PX5 A;  3T5J A;  2VAN A;  3G6X A;  2XY7 A;  7ICH A;  5HRB A;  8ICL A;  3PX4 A;  5KFZ A;  4R66 A;  4PHP A;  2JEF A;  1TAU A;  2ZUB A;  4XA5 A;  2MUT A;  1MQ2 A;  3C18 A;  4E8F A;  8ICV A;  4F4Y A;  1TK5 A;  2ZH8 A;  1CUK A;  2B21 A;  2J6U A;  2ISP A;  4KLS A;  8ICW A;  2DR5 A;  2PFN A;  3RRH A;  4NLK A;  3AQN A;  5CJ7 A;  2FPL A;  1WCL A;  2ZJA A;  8ICH A;  2R8G A;  5KFS A;  4MF2 A;  1UET A;  4Z6D A;  3PX0 A;  4JK1 A;  3KHG A;  4JWN A;  5KG3 A;  3EPI A;  4BWM A;  1BNP A;  2JZB B;  1KFD A;  2O1P A;  3GIL A;  1D9D A;  8ICX A;  4TQR A;  1SKW A;  4GC7 A;  1ZQH A;  3NYB A;  1SL0 A;  4WC2 A;  3C1Y A;  1NKC A;  2ZH5 A;  1ARO P;  3KHR A;  4ED6 A;  3RB0 A;  1S97 A;  3EW9 A;  3Q8K A;  3V7J A;  1LV5 A;  2W9B B;  4FHP A;  4R8U B;  4ECY A;  4LT6 A;  4X0A A;  2I1Q A;  4RUC A;  4DFP A;  5KFQ A;  1BPZ A;  2P6R A;  4X4Q A;  2HHQ A;  4NM2 A;  3GV5 B;  2AQ0 A;  4EEY A;  3C66 A;  4UB1 A;  2FMQ A;  5DDY A;  4LZD A;  5CWR A;  4QZH A;  3MFH A;  4KTQ A;  1ZQW A;  1JX4 A;  8ICO A;  4FBT A;  1JAJ A;  4RQ6 A;  2FPK A;  5DB7 A;  5DQG A;  5EWG A;  5L1I A;  2ATL A;  4ELU A;  3TAN A;  2IHN A;  4KLI A;  4I27 A;  1ZQD A;  4F4W A;  3RH6 A;  2BCU A;  8ICK A;  5J0Y A;  5IIJ A;  4TQS A;  4ELV A;  3H37 A;  4BWJ A;  3HJ4 A;  5KG5 A;  3LK9 A;  9ICE A;  5J29 A;  4O9M A;  2BHN A;  2M9N A;  2ZJ5 A;  1SL1 A;  1V9P A;  4PGX A;  3MGH A;  4TUQ A;  3HX0 A;  2H5X A;  1S9F A;  4JV1 A;  4KLO A;  4X4S A;  4AT9 B;  3T5L A;  4M0A A;  5DKW A;  4NLZ A;  1F5A A;  1FA0 A;  4ECZ A;  4O3O A;  1NZP A;  5KFG A;  4MFF A;  5J0W A;  4KLF A;  4X4R A;  2MUT B;  5L1L A;  1KDH A;  1ZQS A;  3B0Y A;  1Z3E B;  2J6S A;  4JV2 A;  1SKS A;  8ICG A;  5DED A;  9ICI A;  5CB1 A;  4QZI A;  4C8O A;  4J9M A;  3RTV A;  2KFZ A;  3H7I A;  1R8A A;  2NRT A;  4FH5 A;  4YR0 A;  2ZH1 A;  3PNC A;  1XO1 A;  4MEX A;  1DK2 A;  3GII A;  1DGS A;  5D49 A;  1Y88 A;  5HMM A;  5HRI A;  4RQ3 A;  2V9W A;  1TFR A;  2Q66 A;  2W9M A;  1QSL A;  5HRK A;  5KG6 A;  4DLE A;  1D8L A;  4WCW A; 
#chains in the Genus database with same CATH topology
 5DBB A;  2DL0 A;  5CFT A;  4TUR A;  2WTF A;  2QB1 A;  1D9F A;  3RJG A;  2ZG6 A;  3TI0 A;  4Z6C A;  3S6J A;  5J0R A;  1NOM A;  4UB8 U;  2BDP A;  4DOA A;  3MR5 A;  4KLU A;  1HUO A;  4P2H A;  5AIC A;  4J03 A;  3Q8Q B;  1S0V A;  1TFW A;  4JUZ A;  3OUY A;  2P35 A;  4M9J A;  5J2G A;  3OSP A;  2HHX A;  1SKR A;  1NNL A;  3F53 A;  5HR9 A;  2EAM A;  3H3A A;  3WKE A;  4K9B A;  4RPZ A;  3MR6 A;  3T3F A;  5AM0 A;  4RQ1 A;  1XSP A;  3MC1 A;  4YMO A;  4PL1 A;  4I0U A;  3ISD A;  2B56 A;  4ATB B;  2IBK A;  3G6Y A;  4YG2 A;  2KP7 A;  3TAC B;  2ZH4 A;  1VJ7 A;  4Z6E A;  1WWV A;  4O3R A;  4I2B A;  4X4T A;  9ICB A;  3KTQ A;  5DB6 A;  3H0R B;  2JEI A;  4F4X A;  3C28 A;  2BKE A;  4BDP A;  5KNI A;  3AL0 B;  3CNH A;  1LVH A;  3WK7 A;  1SWV A;  3VC8 A;  4EBK A;  2YML A;  1X2I A;  1S8O A;  4RQN A;  3GDX A;  4IQU A;  2FLL A;  5F9L A;  7ICR A;  4ED8 A;  3FYH A;  2IMW P;  3QUC A;  4Q44 A;  3OHB A;  4KMU A;  1L3U A;  1S5L U;  5DB8 A;  5KFT A;  1WWU A;  3TFR A;  1ZQV A;  1M6Y A;  3E2E A;  4DSE A;  3B0X A;  3RAX A;  3D2Q A;  1UHU A;  2KD1 A;  4YN4 A;  4ECX A;  3PW2 A;  1L3S A;  4CE6 A;  3QZ7 A;  2IHM A;  3KZX A;  2ZXH A;  2RDI A;  2F1J A;  4DQS A;  3BDP A;  1ZQL A;  1KW4 A;  4KLM A;  3PSP A;  4P0P A;  2QLT A;  1ZQP A;  4I29 A;  4KLE A;  2K8B B;  5ALX A;  2HBM A;  9ICA A;  4Y2P A;  1A76 A;  3SR6 A;  1ZQR A;  1NK9 A;  3PHZ A;  5HNK A;  2AGP A;  4YD1 A;  3UXO A;  1HJP A;  2NO4 A;  2JZB A;  2G07 A;  4NV0 A;  3UQ2 A;  2AGO A;  3PR4 A;  3WFQ E;  7ICN A;  5AK5 A;  3OHA A;  3PX6 A;  4YP3 A;  1MIW A;  1LKY A;  1UA1 A;  3CP8 A;  2W7P A;  7ICE A;  3TAD C;  4F8R A;  5T14 A;  5KFB A;  2BCV A;  2ASL A;  3RFA A;  2EQY A;  2XY6 A;  4RPY A;  2DF4 B;  2BQR A;  1VLB A;  2B4V A;  4GC6 A;  1WCN A;  1LKY B;  2BPG A;  3RR7 A;  1JIH A;  2GOL A;  2EDU A;  3KD3 A;  3WFP A;  5AK3 A;  4I2F A;  3DV9 A;  3DEE A;  3MDA A;  3AMZ A;  4IRC A;  4ELT A;  1NKE A;  4OAF A;  4DF8 A;  2DRB A;  4Y2V A;  9ICO A;  1X9X A;  1COK A;  1COO A;  2H3Q A;  4C80 A;  4GXI A;  5G5G A;  4KX3 A;  8ICU A;  4MKP A;  2DPJ A;  5KFO A;  3AQL A;  2HCF A;  1JQR A;  3ISC A;  3DDH A;  4DS5 A;  4X5V A;  2XGQ A;  3HWT A;  7ICK A;  5J2A A;  1ZET A;  3OPX A;  5AKY A;  2KSO B;  2D3D A;  4RWP A;  5L1K A;  4RQ5 A;  8ICS A;  3AUO A;  9ICG A;  2B51 A;  3V72 A;  3F5E A;  4FE3 A;  1YLQ A;  1BPD A;  3Q8P B;  2HOI A;  2OHF A;  2E1F A;  1N5W A;  2KNJ A;  3H38 A;  1X9W A;  4R63 A;  4O6A A;  2LM1 A;  4EGW A;  3WK6 A;  3IRU A;  4RQ7 A;  1JAL A;  4M47 A;  2JH7 A;  4NXU A;  3EWA A;  5KFJ A;  4WC0 A;  4IRD A;  3FM9 A;  4KLJ A;  3V6H A;  1DRG A;  3EF2 A;  3QUQ A;  7ICP A;  3T5K A;  4PZO A;  4UD5 A;  2LI6 A;  5AKJ A;  3M9O B;  4QWB A;  2W8K A;  2GO7 A;  4KIT B;  2W43 A;  4ECQ A;  4GIB A;  4RQ2 A;  2PFQ A;  3MGI A;  7ICG A;  4WBZ A;  3KZI U;  3NKU A;  1XWL A;  3KKA C;  3FC4 A;  2GLE A;  2XGP A;  3RF9 A;  1KLN A;  2LPE A;  4BUG A;  4RZR A;  4EZ9 A;  3OGU A;  4F2S A;  2BPC A;  5AI8 A;  4NL9 C;  5AM5 A;  1ZJN A;  1NJX A;  1YZ7 A;  3UPS A;  4DSK A;  2DUY A;  5HRH A;  2ASJ A;  1MN8 A;  2JR5 A;  5ALG A;  4OAG A;  2NRW A;  2V4Q A;  1R8B A;  2ZIX A;  4KLG A;  3SMV A;  3SAF A;  7ICJ A;  3R9K A;  5D62 A;  2HHU A;  1IM4 A;  1DGJ A;  3L9D A;  8ICY A;  5KT6 A;  5L1J A;  4AT7 A;  1SGG A;  4NLG A;  2DKZ A;  3D2S A;  7ICU A;  3ERC C;  2MRL A;  4K96 A;  4Q45 A;  2YB1 A;  4UAZ A;  4O5E A;  5KFN A;  5IIK A;  4O5K A;  2KJ8 A;  1RYS A;  5D46 A;  4FS2 A;  4MHV A;  4QZ8 A;  5J0T A;  2MAX A;  4RQ8 A;  5J0S A;  2G09 A;  4DFJ A;  3RB3 A;  4NL9 A;  3PMN A;  2KIV A;  3RB6 A;  4AYB C;  2FMP A;  2QAR A;  1N2X A;  1ZYQ A;  4IQV A;  2RDJ A;  1QSY A;  5DQI A;  4K9A A;  2K4P A;  2PXI A;  3B9J A;  4B9N A;  4RNM A;  4BGD A;  2NRK A;  4XUS A;  4UQG A;  1ECW A;  4QWA A;  4HYK A;  2IA6 A;  3BQ1 A;  2Y1J A;  4PPX A;  1IXR A;  4WQL A;  2LMR A;  2LYB A;  2DWQ A;  1CEZ A;  5AHX A;  1D8Y A;  1BPE A;  1PX5 A;  1KBU A;  4R66 A;  1TAU A;  5AKE A;  2ESE A;  2W03 A;  3UMG A;  2FJ6 A;  2J6U A;  1PK1 B;  1PVP A;  2F3N A;  5KFS A;  3N28 A;  2KK0 A;  1UET A;  3BS5 A;  5KAI U;  1YZ6 A;  4BJQ A;  3TAD A;  2O1P A;  1BNP A;  3GIL A;  1D9D A;  8ICX A;  4B6J A;  3NYB A;  1SL0 A;  4LEY A;  4OJP A;  2WF5 A;  2ZH5 A;  4ED6 A;  1LV5 A;  9ICJ A;  3V7J A;  2CXY A;  4DFP A;  5KFQ A;  2EZY A;  5CWR A;  1JX4 A;  4FBT A;  4JB3 A;  4RQ6 A;  5EWG A;  4EEK A;  2IHN A;  4I27 A;  4F4W A;  2BCU A;  1X40 A;  2W3R A;  2K4E A;  3HJ4 A;  3LK9 A;  3MGH A;  4PGX A;  1S9F A;  5ALV A;  3T5L A;  4ECZ A;  1NZP A;  5J0W A;  3K7D A;  2LBO A;  1SKS A;  5CB1 A;  4C8O A;  4J9M A;  4FH5 A;  2ZH1 A;  4YR0 A;  2IUB A;  3K1Z A;  4MEX A;  2XID A;  3F2D A;  1DK2 A;  5HMM A;  5HRI A;  2EAN A;  1TFR A;  1QSL A;  5EE0 A;  4DLE A;  5KG6 A;  1MA7 A;  2G0A A;  5ALM A;  3C5G A;  1TK8 A;  4F5P A;  4QNL A;  1UT8 A;  2WF8 A;  4RPX A;  4M5D A;  5KT4 A;  4PH5 A;  8ICI A;  4M6W A;  4FZL A;  3OV7 A;  2DKX A;  4EX6 A;  4UB4 A;  4KLT A;  3KHH A;  3WKB A;  1N5X A;  1L7M A;  1T7P A;  3LQC B;  3PY8 A;  2AQ4 A;  4BXO A;  5J2H A;  5ALS A;  3N97 B;  2L5Y A;  1NK4 A;  1UEU A;  5D63 A;  3U26 A;  1X9M A;  5J8Y A;  2F1I A;  4DQP A;  4NKU A;  4C4R A;  1IG6 A;  2D6F C;  3OVA A;  1KN5 A;  2M2U A;  4BXO B;  4QWE A;  5KFE A;  1HIW A;  4O0I A;  5ALY A;  1TFY A;  2W9B A;  1KKX A;  1VFG A;  2KOB A;  4EBJ A;  1BGX T;  4F5O A;  2W04 A;  4Z6F A;  4F4Z A;  3ZDB A;  5IIO A;  5HR6 A;  3M6K A;  4DSI A;  4UAV A;  3UPQ A;  1F0M A;  3ETR A;  5D4B A;  5HRG A;  5HRL A;  3UQ0 A;  3AQK A;  4C8M A;  4WJ3 B;  4WC4 A;  3AU2 A;  5CFU A;  4ED3 A;  1V97 A;  4CF5 A;  3WK8 A;  2HN2 A;  3WKC A;  2E1E A;  4B9T A;  4I2A A;  7ICQ A;  4UW9 A;  2ZIW A;  2R8H A;  1KFS A;  5DGB A;  2UVU A;  4DFM A;  3H8W A;  8ICN A;  1FIQ A;  4I28 A;  8ICR A;  3C23 A;  5KFP A;  1RPL A;  5EWE A;  5AKX A;  5KFC A;  2W8L A;  1MC8 A;  4UB3 A;  1A0P A;  2HVI A;  3V6K A;  1RYR A;  3PSI A;  4X4N A;  2G5I B;  3NVZ A;  3HPO A;  3HT3 A;  4Y2Q A;  3H39 A;  2HHV A;  2ISO A;  9ICM A;  3GFK B;  5KAF U;  4PGQ A;  4DL4 A;  4QIW C;  1ZQG A;  9ICR A;  4E0D A;  3EYZ A;  1XSL A;  1H38 A;  4QWC A;  2YY6 A;  4K4G A;  1BPB A;  4DL6 A;  5KFX A;  4Q43 A;  4NJ8 A;  3JPT A;  9ICN A;  4DO9 A;  3BS7 A;  4KLH A;  1BPX A;  2JXJ A;  3QUB A;  2HHT A;  1WUD A;  2I5H A;  2BCS A;  2R8K A;  3NVY A;  1HEK A;  2KN7 A;  3FDS A;  4HX0 A;  4J9R A;  4WC6 A;  3K1R B;  2NO5 A;  2WAQ F;  4EEN A;  4C8N A;  2JMG A;  3OWG A;  2DR9 A;  5GTH U;  3M8S A;  2V4R A;  1ZQN A;  3A0H U;  2P66 A;  9ICL A;  2B0C A;  3PSF A;  9ICX A;  4K99 A;  2IOH A;  3D6J A;  2KKP A;  5DLF A;  1RDF A;  2RLT A;  8ICQ A;  4FO6 A;  2A1A A;  3CW2 C;  3OTQ A;  5EE1 A;  2PMZ C;  4RWN A;  4NLN A;  1Q79 A;  5ALH A;  1ZQU A;  4P4P A;  2Q4T A;  4FS1 A;  5F9N A;  1WYG A;  2BQU A;  3M8R A;  1RXV A;  3CK6 A;  1L5U A;  1J2N A;  5AM1 A;  2W7O A;  2PI4 A;  3PW0 A;  2AXT U;  2WF6 A;  4YMM A;  4CRX A;  3UMC A;  2HMX A;  4OD0 A;  1SV0 A;  4FZN A;  3MR3 A;  1ZQA A;  2A1J A;  4G3I A;  2HN1 A;  4EYI B;  3OVS A;  2BGW A;  4O68 A;  2FLP A;  4UD4 A;  5J2F A;  2KHQ A;  2AJQ A;  4FFD A;  5AK6 A;  5AIB A;  5J2B A;  2DFL A;  1TE2 A;  9ICV A;  3WK5 A;  4I2E A;  2VA8 A;  4F50 A;  2ID1 A;  2E8P A;  5HC9 A;  1ZRM A;  5JU5 A;  4EBD A;  2LYA A;  1ZQO A;  2GAF D;  9ICS A;  3HJ1 A;  4C8K A;  1ZQC A;  2XO7 A;  2WB1 C;  8ICP A;  4P0P B;  3TAQ A;  3RJK A;  4RQM A;  9ICP A;  2ZH9 A;  5ALQ A;  2NRV A;  3QEB Z;  2A1J B;  1QH9 A;  4I2G A;  2HHW A;  2H3I A;  4NWI A;  4IRK A;  1ZQZ A;  3TAP A;  5DB9 A;  4GFJ A;  3UXP A;  7ICO A;  5ALD A;  1PVR A;  4ECR A;  2PI5 A;  2DBY A;  2H3F A;  4QZG A;  2Q0Z X;  3PW5 A;  1UA0 A;  2H3V A;  5AIA A;  1NJY A;  4UAU A;  2W9C A;  4AT8 A;  3E58 A;  5DGA A;  2XIC A;  5AI0 A;  4WQK A;  1N62 A;  5HML A;  3F2B A;  2RQ5 A;  3ORY A;  5ALN A;  3NUQ A;  3ZDE A;  4LEZ A;  2VA3 A;  4F5R A;  5J0O A;  4M9N A;  5KFV A;  4UBB A;  3GIJ A;  4J9N A;  3SD7 A;  1XSN A;  4Y2J A;  3JPN A;  3BQ7 A;  5KFL A;  1BPY A;  1F5S A;  4NXT A;  4DF4 A;  1DK3 A;  4KM5 A;  2ZTD A;  3QXG A;  3OJU A;  4PL2 A;  3LWL A;  2DR7 A;  2QAR B;  3GU3 A;  3SV3 A;  1A77 A;  4M9H A;  4I2D A;  3SYZ A;  1NK0 A;  2NRX A;  1U9L A;  4LEW A;  4E7X A;  4F91 B;  1OU5 A;  3C2L A;  4I2C A;  2F76 X;  2K4H A;  3IP4 B;  5KG1 A;  4C4S A;  1Q3U A;  1S0M A;  4ZH4 A;  4ECT A;  5HP4 A;  4B9V A;  1ZQM A;  3V7L A;  3TFS A;  5JTG A;  9ICW A;  1KRP A;  4RWO A;  4QZA A;  1V38 A;  3WFR E;  4K8V A;  1PK1 A;  2BCQ A;  5DQH A;  1NZB A;  5KFF A;  4QJF B;  2C22 A;  3MAB A;  2FMS A;  1UQV A;  3BS5 B;  2R8I A;  1V4A A;  1TVA A;  4I2J A;  4X0B A;  1T4G A;  4QW9 A;  5HRE A;  4DQR A;  8ICJ A;  4CF3 A;  3QU5 A;  3HP6 A;  2C2R A;  5AKZ A;  3RRG A;  4F5N A;  1IV8 A;  4DL3 A;  1LB2 B;  1MIV A;  4M9L A;  4C7Z A;  4TUP A;  1QQ5 A;  4O5C A;  1N48 A;  4WBY A;  5KFD A;  1RYU A;  4QZD A;  9ICH A;  1JN3 A;  1UCV A;  1NJZ A;  4DL5 A;  5K4L A;  1SXD A;  3G6X A;  2I6X A;  3FAH A;  2XY7 A;  8ICL A;  3UMB A;  1MQ2 A;  4E8F A;  2ODG A;  4F4Y A;  2ZH8 A;  3H8M A;  2EH9 A;  5CRX A;  1QQ6 A;  2NYV A;  2VJ4 A;  2DR5 A;  2PFN A;  3RRH A;  1WCL A;  2K60 A;  4MF2 A;  4Z6D A;  1QCK A;  4JK1 A;  2OYY A;  5KG3 A;  3EPI A;  4BWM A;  3CRX A;  2HSZ A;  4WC2 A;  2HOQ A;  1OW5 A;  1DXS A;  2JH1 A;  1NKC A;  1ARO P;  1XNS A;  4FHP A;  4R8U B;  4ECY A;  1X66 A;  2P6R A;  1NI3 A;  2HHQ A;  4CNQ A;  4UB1 A;  2FMQ A;  2KJ5 A;  4ICA A;  1ZQW A;  8ICO A;  1GPJ A;  3ER8 C;  2ATL A;  1L8O A;  5DQG A;  1V85 A;  2KSO A;  4TQS A;  4BWJ A;  1Q3V A;  2OM6 A;  2XI9 A;  4O9M A;  2ZJ5 A;  1SL1 A;  4TUQ A;  2H5X A;  4AT9 B;  4M0A A;  1F5A A;  5KFG A;  4Y2U A;  2Y0S F;  2W11 A;  1ZQS A;  3SAH A;  2YX8 A;  5HR7 A;  1Z3E B;  8ICG A;  2KFZ A;  1R8A A;  2NRT A;  3PNC A;  1L7N A;  1XO1 A;  3LVW A;  5D49 A;  1Y88 A;  5JRT A;  3H0M B;  4RQ3 A;  3MCR A;  4IC9 A;  4NXX A;  5HRK A;  1RM6 C;  1D8L A;  4WCW A;  4JLZ A;  5J2E A;  5J2D A;  4LZG A;  5KG0 A;  4EZ6 A;  5EWF A;  3OJS A;  2ZH3 A;  1O03 A;  5DG8 A;  1VDV A;  3C2K A;  2LHT A;  5KFM A;  3WFO A;  2KVC A;  3SAG A;  1Z00 B;  1BVS A;  4NY8 A;  3BQ2 A;  4UAS A;  4IL6 U;  4IQT A;  1Z1B A;  2H3Z A;  3WFS C;  7ICV A;  3OUY B;  2MSN A;  3LWM A;  5KFR A;  3PZP A;  5CR0 A;  4EX7 A;  5CFS A;  2KG5 A;  4LVS A;  4KLD A;  1Z00 A;  5EOZ A;  2F77 X;  3ZD9 A;  1Q8K A;  4X4O A;  2F1H A;  3V6J A;  1TK0 A;  4EBE A;  4IS7 A;  1Z4O A;  4C8L A;  5ALW A;  1Z4N A;  4O3P A;  2A3V A;  4QZB A;  5KL8 B;  2ZIX B;  9ICU A;  4EP7 A;  1O08 A;  1SZH A;  2BR0 A;  4NXV A;  4K4I A;  2UVV A;  4RQ4 A;  4RQ0 A;  2F44 A;  2FLN A;  2OEH A;  3HIY A;  1MIY A;  1PVQ A;  3ZDD A;  4EEL A;  3JPQ A;  3K75 D;  4KB6 A;  2CN1 A;  5J0U A;  1PK3 A;  2ZUC A;  1X9S A;  4EV6 A;  3BJY A;  2KZZ A;  3SZ2 A;  4MF8 A;  8ICE A;  5ALZ A;  3TQ1 A;  5AM4 A;  1UEV A;  1ZD3 A;  2O6K A;  2HBK A;  1NK8 A;  3M9N B;  1N56 A;  3J81 j;  3KBB A;  1HUZ A;  8ICC A;  5DLG A;  3QNM A;  1FEZ A;  3UM9 A;  4CF4 A;  4QW8 A;  5TZV A;  8ICM A;  5L1M A;  1MQ3 A;  4WC7 A;  2ZIV A;  1XO0 A;  3JPP A;  3HIL A;  1Z1V A;  4F4K A;  3OSN A;  4ACO A;  1RXW A;  2K8A A;  2R18 A;  2JGA A;  4RUA A;  4J9S A;  1X6J A;  1EXN A;  3AM9 A;  1GO3 F;  3NVV A;  3RJJ A;  2UVR A;  4OAI Z;  4DS4 A;  2W9A A;  4RT2 A;  4YCX A;  5G5H A;  5III A;  4FHW A;  4ZOH C;  5FP0 A;  2LM4 A;  5C5J A;  2AGQ A;  2WF7 A;  3RJF A;  1QTM A;  2OWO A;  1FFV A;  4KLL A;  5ALT A;  7ICM A;  4B9S A;  4MFA A;  5DG7 A;  3UXN A;  5AKI A;  5B5E U;  1NK7 A;  1B0X A;  8ICZ A;  3M9M B;  4G9B A;  4RT3 A;  4UAR A;  4MEY A;  4DEZ A;  3LYS A;  1XU4 A;  4RU9 A;  3I76 A;  3H4D A;  1B22 A;  1SXE A;  9ICT A;  5J2I A;  4ED2 A;  3ONN A;  3IG5 A;  4UB5 A;  1PUZ A;  3QU4 A;  1NK5 A;  3PML A;  3Q8M A;  2ALZ A;  4ECV A;  4R65 A;  5DEC A;  2ZIW B;  2XY5 A;  2ZXI A;  3T5H A;  1RZT A;  4FBU A;  5B3Q A;  1KFT A;  3PO5 A;  3SEI A;  3Q8S B;  2Y9T A;  3GV7 B;  5DDM A;  3WU2 U;  4ED7 A;  2A19 A;  1S0O A;  2ZH2 A;  2K89 A;  3AQF A;  3NVO A;  4UB6 U;  4ATB A;  5HHH A;  3JPS A;  4UAT A;  4F71 A;  3NGD A;  2ASD A;  2M0N A;  4C0Z A;  1KNY A;  4DL7 A;  8ICF A;  4NKT A;  1PZN A;  4YVZ A;  5KFY A;  1S10 A;  4M9G A;  3OVB A;  3EPG A;  2E8M A;  1DOQ A;  4S3N A;  1L6N A;  2GH1 A;  5IIN A;  3QX7 A;  4B9U A;  1K1S A;  5KG7 A;  1UT5 A;  3NRZ A;  5CA7 A;  2VKQ A;  3RH5 A;  2Y9U A;  5KFH A;  4X4V A;  1U48 A;  1SV0 C;  4NLB A;  3IHQ B;  4P4O A;  3V7K A;  2PFP A;  2B6G A;  2BBJ A;  2G08 A;  2ZIU B;  5KT3 A;  2VA2 A;  3NAS A;  4FHX A;  5CP2 A;  3CYM A;  2FPM A;  2ZUD A;  3WKA A;  3QYP A;  2C2E A;  7ICF A;  3ZI4 A;  5ALU A;  1L7P A;  3H0L B;  2VJ5 A;  1T3N A;  1NKB A;  1VJ5 A;  4HAI A;  5DBC A;  5CHE A;  5BPC A;  5ALR A;  4YR2 A;  3RB4 A;  4R64 A;  1KEJ A;  3KFU F;  2WFA A;  3JYY A;  3N7R C;  3PST A;  1QLN A;  1TKD A;  5AK4 A;  2YMP A;  1ZQI A;  1NK6 A;  4OJL A;  4K4H A;  3L5K A;  2ZTC A;  5ALO A;  3MR2 A;  4QZF A;  2DR8 A;  4CDG A;  1TAM A;  2FE9 A;  2UVW A;  1ZQ1 C;  2QKQ A;  3I28 A;  3QU9 A;  4JLX A;  4IG8 A;  1NJW A;  4KLQ A;  1X42 A;  4M2Y A;  1K1Q A;  1SZP A;  2BQ3 A;  4O3Q A;  3EZ5 A;  1J2M A;  1CI4 A;  4CCH A;  5KFI A;  2M2T A;  2XVT A;  2C2D A;  4PGY A;  8ICT A;  7ICS A;  4XQ7 A;  3GQC A;  5J2J A;  5ALL A;  2KIW A;  4EYH B;  1SV4 A;  4TUS A;  3BQ0 A;  3WK9 A;  4DFK A;  3N4M B;  2KVS A;  3IN5 A;  3RR8 A;  3GIK A;  4X4P A;  4US8 A;  4DOC A;  4DLG A;  2KJ9 A;  3ZDA A;  1TAQ A;  3ETL A;  2LYH A;  5AI6 A;  4IQW A;  5L9X A;  3QZ8 A;  2EAO A;  4F93 B;  4O3N A;  3M6Z A;  1RQN A;  4WC1 A;  1K5O A;  3HRD D;  3LVV A;  2F8L A;  5J8Y C;  2XC9 A;  3PO4 A;  3AQM A;  4WC5 A;  3C5F A;  9ICF A;  3AEV A;  1ZJM A;  4J9K A;  2K8C B;  4J9P A;  4WH5 A;  3PW4 A;  2FDR A;  5JUM A;  1S0N A;  1R89 A;  2FI1 A;  5AKH A;  4QIW F;  1N63 A;  2NRZ A;  2ES6 A;  4I2I A;  2I9G A;  3SI8 A;  3C29 A;  4Y2R A;  2Z7J A;  9ICQ A;  2OH2 A;  3T5J A;  2VAN A;  3PX4 A;  2ZUB A;  4XA5 A;  3C18 A;  2CPR A;  3IG8 A;  2B21 A;  2MA1 A;  3N7S C;  4KLS A;  5C0Y A;  4NLK A;  3AQN A;  4DCC A;  1QQ7 A;  5AI4 A;  4EEB A;  3PX0 A;  2QB0 A;  3KHG A;  4JWN A;  4TQR A;  3ER9 B;  4GC7 A;  3C1Y A;  1N60 A;  2W54 A;  5EE3 A;  4RUC A;  1KQQ A;  1L8L A;  4PJ0 U;  1ZXI A;  4NM2 A;  2AQ0 A;  4EEY A;  2F2A B;  2MU2 A;  4LZD A;  4QZH A;  3WKD A;  1JAJ A;  2FPK A;  3TAN A;  4KLI A;  8ICK A;  1ZQD A;  2YMM A;  5J0Y A;  2QB0 B;  4ELV A;  5AKG A;  2YN4 A;  2M9N A;  4ELU A;  1V9P A;  4KMO B;  5JTI A;  4X4S A;  3HX0 A;  4JV1 A;  2EZX A;  4LJX A;  3KKA A;  5DKW A;  1FA0 A;  2AH5 A;  4KLF A;  4X4R A;  2MUT B;  5B66 U;  3B0Y A;  4OJ5 A;  5ALK A;  2J6S A;  4JV2 A;  9ICI A;  4QZI A;  3RTV A;  1DGS A;  2V9W A;  2Q66 A;  5HRB A;  4FZM A;  5CEH A;  2W9C B;  4AT8 B;  2KZM A;  5KFU A;  4AT9 A;  5KTQ A;  2LKY A;  4C4T A;  2JEJ A;  4RNN A;  4P0Q A;  3PV8 A;  1Q78 A;  1Q46 A;  3H8J A;  4YQW A;  2ZH7 A;  4NXW A;  4GXJ A;  3GIM A;  4J9L A;  2WB1 F;  2M2V A;  1B43 A;  5IIM A;  1RQL A;  4JWM A;  5KT2 A;  4DL2 A;  2AU0 A;  1ZQT A;  1B4F A;  1URJ A;  3IDW A;  3K4G A;  2DGZ A;  5AKK A;  4OAH A;  5ALI A;  4F5Q A;  4MFC A;  3BZK A;  3RH4 A;  3ISB A;  5DG9 A;  3QEA Z;  1ZD2 P;  3O0F A;  5ALJ A;  1S77 D;  5IIL A;  3H8S A;  4UAY A;  4ECU A;  5ALP A;  1ZD5 A;  4IR1 A;  1JRP A;  2KFN A;  3Q8L A;  4OCZ A;  1ZQB A;  3QU2 A;  1QSS A;  2OXO A;  5AM2 A;  5AI5 A;  2HDO A;  4Q8F A;  1ZQJ A;  2Y1I A;  2VIX A;  2BE3 A;  3RAQ A;  3M7D A;  2PFO A;  3QUT A;  4F72 A;  4U6P A;  4DSF A;  2EZZ A;  1WOT A;  5AI9 A;  5DBA A;  4DWI A;  3Q8R B;  4AYB F;  1U49 A;  1JMS A;  1WG8 A;  4IR9 A;  2JRZ A;  7ICL A;  3MBY A;  2JV3 A;  1Z19 A;  4XQ8 A;  1SL2 A;  4NM1 A;  2FCL A;  5ALF A;  1T8E A;  1ED1 A;  8ICB A;  4FHY A;  2E5S A;  4YXM A;  4OJ6 A;  4QZC A;  2HHS A;  1L3V A;  5D61 A;  2AHO B;  3HW8 A;  3VCB A;  2DVI A;  4PZN A;  4J9O A;  1P7D A;  5KG4 A;  2HOF A;  3L3F X;  4X4U A;  2O5A A;  4UAW A;  3ICX A;  3WK4 A;  5KFA A;  2BZF A;  2RP5 A;  2HHP A;  2W3S A;  1XS9 D;  2IHO A;  4XRH A;  4JMU A;  2DQN B;  3GV8 B;  5HRD A;  2RHF A;  4WOY A;  1YT3 A;  2E3T A;  3QE9 Y;  7ICI A;  4DQI A;  2ZH6 A;  3MDC A;  3BZC A;  2F8K A;  5B3P A;  2BCR A;  3ZDC A;  3E0F A;  4M04 A;  2M2W A;  4QZE A;  4GXK A;  4USA A;  4ED0 A;  8ICA A;  4O3S A;  3H4B A;  3THV A;  1ZQK A;  2EWR A;  4BX9 C;  5HHI A;  4E80 A;  4B9L A;  3RJH A;  4DOB A;  2XCA A;  3IV6 A;  1JRO A;  4B9M A;  1R8C A;  4ED1 A;  4FHV A;  3RJI A;  1SB3 C;  1ZQE A;  2P6U A;  2CRX A;  2KHV A;  4O3M A;  1TV9 A;  1C20 A;  4J9Q A;  4YMN A;  2KKV A;  2HBJ A;  3PR5 B;  3JPR A;  1XC9 A;  5J0P A;  1C7Y A;  2PMZ F;  5BOL A;  3NWI A;  2C28 A;  2DRA A;  3F5A A;  3D2N A;  1FO4 A;  3H40 A;  3ED5 A;  2JHD A;  4PHD A;  3AU6 A;  4XJE A;  2BDU A;  3RBD A;  4ECW A;  5F2V O;  2PBE A;  4N7R A;  4DFD A;  4NXZ A;  2ZHB A;  3KOO A;  1F44 A;  5KFK A;  1KTQ A;  3BQT A;  1MSW D;  1KSP A;  5KFW A;  3IM1 A;  1IIP A;  1ZD4 A;  3N7P D;  2KZ3 A;  4QZ9 A;  3NTU A;  1ZQQ A;  1RG6 A;  4AT7 B;  2YMQ A;  3C1Z A;  3TKA A;  1CRX A;  4ECS A;  1ZQX A;  2PKE A;  3F2C A;  4EED A;  3AN1 A;  3NRW A;  4R8U A;  4DSJ A;  5H2F U;  5TIS U;  1L3T A;  2G5H B;  3T79 A;  9ICC A;  4RWQ A;  4EBC A;  3SEN A;  2KTQ A;  2HVH A;  3PVX A;  3MFI A;  3NS1 A;  4LEV A;  5CHG A;  4P4M A;  1ZQY A;  4DSL A;  2YQE A;  4YD2 A;  2NV3 A;  3RJE A;  2ZJ8 A;  2GWS A;  1U45 A;  4M6W B;  2G06 A;  4JV0 A;  1N61 A;  4O69 A;  1SWW A;  2KV2 A;  3JPO A;  1S76 D;  2IOF A;  5KG2 A;  5J2K A;  4O67 A;  5AM3 A;  1T3Q A;  3ZD8 A;  4CGZ A;  5HRF A;  5A0L A;  4F92 B;  4FH3 A;  4DQQ A;  4UB2 A;  1D8B A;  3RBE A;  4UBC A;  3HKZ C;  4US9 A;  3SV4 A;  4QWD A;  1ZQF A;  4AP9 A;  1BNO A;  1L7O A;  3KHL A;  3LDA A;  4PHE A;  1JXE A;  2D8C A;  5KL1 B;  4YFK A;  5ALE A;  1ZOL A;  5KT5 A;  2KMD A;  3ALR A;  3HJE A;  1NO5 A;  4RNO A;  4YR3 A;  4GLX A;  4Y2Y A;  3L4P A;  4KN7 A;  2DPI A;  1T94 A;  2E8N A;  2KIC A;  7ICT A;  5E79 U;  3JZ0 A;  3A0B U;  5J0Q A;  4K98 A;  3HKZ F;  2ZTE A;  4PHA A;  2YB4 A;  4Y2T A;  2J6T A;  2ZHA A;  3AQE A;  4C7Y A;  3TAR A;  2XCP A;  5J0X A;  2EAP A;  4YXJ A;  3MGV A;  2JEG A;  2IOF K;  2WAQ C;  5J2C A;  4P0Q B;  2KE7 A;  5F3X B;  3EUB 2;  5BOM A;  3SQI A;  2HW3 A;  2BBH A;  2BPF A;  2R8J A;  1OUQ A;  4Y2S A;  4KN4 A;  1AQ6 A;  3G6V A;  4WC3 A;  1U47 A;  3NVW A;  4F3O A;  4F2R A;  5KT7 A;  2ZIU A;  3C21 A;  1ZRN A;  1JXL A;  1JUD A;  4I2H A;  4Q8E A;  3C2M A;  9ICK A;  1JI7 A;  2RFF A;  1U4B A;  3PW7 A;  1SIJ A;  7ICH A;  5KFZ A;  2JEF A;  4PHP A;  2MUT A;  2KEY A;  1J97 A;  1TK5 A;  8ICV A;  1CUK A;  2ISP A;  2WF9 A;  8ICW A;  5CJ7 A;  2FPL A;  2ZJA A;  8ICH A;  1OXJ A;  2R8G A;  4OJO A;  3M1Y A;  2JZB B;  1KFD A;  2WHE A;  1SKW A;  1ZQH A;  3QU7 A;  2GA9 D;  3KHR A;  3RB0 A;  1S97 A;  1X6I A;  3EW9 A;  3Q8K A;  2W9B B;  4LT6 A;  4X0A A;  2I1Q A;  1BPZ A;  4K97 A;  4U7C A;  4X4Q A;  5GTI U;  4NLC A;  3GV5 B;  3C66 A;  2Y0S C;  2YTU A;  2W55 A;  2E8O A;  2ZIV B;  5DDY A;  3MFH A;  4KTQ A;  3GZF A;  5DB7 A;  5L1I A;  5EE9 A;  3RH6 A;  5IIJ A;  4KX5 A;  2OCE A;  3H37 A;  5KG5 A;  9ICE A;  5J29 A;  3JCF A;  4FO1 A;  2BHN A;  4OO1 J;  3I1Y A;  4KLO A;  4NLZ A;  4O3O A;  1A6S A;  2HBL A;  4MFF A;  4A8E A;  2RRD A;  5L1L A;  1KDH A;  2K4I A;  2HI0 A;  5DED A;  3H7I A;  2N1R A;  3GII A;  1UPH A;  1KL9 A;  5AKL A;  1FFU A;  2W9M A;  4Y2X A; 
#chains in the Genus database with same CATH homology
 5DBB A;  5J2E A;  5J2D A;  2W9C B;  5KG0 A;  3C5G A;  1TK8 A;  4EZ6 A;  4LZG A;  5EWF A;  4F5P A;  2KZM A;  5KFU A;  4AT9 A;  4TUR A;  2WTF A;  1UT8 A;  5KTQ A;  3OJS A;  4RPX A;  1D9F A;  4M5D A;  3RJG A;  5KT4 A;  4PH5 A;  2ZH3 A;  2JEJ A;  8ICI A;  4M6W A;  5DG8 A;  3OV7 A;  4RNN A;  3C2K A;  3TI0 A;  3PV8 A;  4Z6C A;  1Q78 A;  5KFM A;  5J0R A;  1NOM A;  4UB4 A;  4KLT A;  3WFO A;  3H8J A;  1Z00 B;  4YQW A;  1BVS A;  3KHH A;  2BDP A;  2ZH7 A;  4NY8 A;  3BQ2 A;  4DOA A;  3MR5 A;  4KLU A;  4IQT A;  1HUO A;  4P2H A;  1T7P A;  3LQC B;  3Q8Q B;  3GIM A;  4GXJ A;  3PY8 A;  1S0V A;  7ICV A;  3OUY B;  4J9L A;  1TFW A;  3WFS C;  2AQ4 A;  4BXO A;  4JUZ A;  5KFR A;  3LWM A;  5J2H A;  2M2V A;  3OUY A;  4M9J A;  5CR0 A;  3AQK A;  5J2G A;  3OSP A;  1B43 A;  3N97 B;  1NK4 A;  4KLD A;  5IIM A;  4LVS A;  1UEU A;  2HHX A;  1Z00 A;  1SKR A;  1X9M A;  4JWM A;  5KT2 A;  4DL2 A;  2F1I A;  2AU0 A;  5HR9 A;  3OVB A;  4DQP A;  1ZQT A;  3K4G A;  3ZD9 A;  5EOZ A;  4X4O A;  4NKU A;  2F1H A;  3V6J A;  3H3A A;  1TK0 A;  3OVA A;  4EBE A;  2M2U A;  4BXO B;  4RPZ A;  3MR6 A;  3T3F A;  4QWE A;  5KFE A;  4F5Q A;  4MFC A;  4RQ1 A;  4O0I A;  3RH4 A;  1XSP A;  2W9B A;  1TFY A;  1VFG A;  4YMO A;  4C8L A;  4EBJ A;  1BGX T;  4F5O A;  3ISD A;  4ATB B;  4Z6F A;  4F4Z A;  3ISB A;  2IBK A;  3G6Y A;  3ZDB A;  5IIO A;  4YG2 A;  5DG9 A;  4O3P A;  3QEA Z;  2KP7 A;  4DSI A;  1S77 D;  2ZH4 A;  5IIL A;  3H8S A;  4QZB A;  4UAY A;  4Z6E A;  3UPQ A;  4ECU A;  9ICU A;  1VJ7 A;  4EP7 A;  4O3R A;  5D4B A;  4I2B A;  4IR1 A;  3UQ0 A;  2KFN A;  2BR0 A;  4C8M A;  5HRG A;  4K4I A;  2UVV A;  5HRL A;  4X4T A;  4RQ4 A;  9ICB A;  3Q8L A;  5DB6 A;  3KTQ A;  3AU2 A;  4WC4 A;  1ZQB A;  2JEI A;  4RQ0 A;  4F4X A;  4ED3 A;  1QSS A;  2BKE A;  4BDP A;  2FLN A;  3HIY A;  4B9T A;  1MIY A;  4I2A A;  3ZDD A;  7ICQ A;  3JPQ A;  3K75 D;  2R8H A;  5J0U A;  1KFS A;  5DGB A;  1ZQJ A;  4Q8F A;  4E7X A;  2Y1I A;  2UVU A;  1X9S A;  2ZUC A;  4DFM A;  2BE3 A;  4EBK A;  3H8W A;  1X2I A;  8ICN A;  3BJY A;  3RAQ A;  2PFO A;  2KZZ A;  3GDX A;  3SZ2 A;  4I28 A;  4MF8 A;  8ICR A;  4DSF A;  8ICE A;  1WOT A;  4IQU A;  2FLL A;  5F9L A;  5DBA A;  3C23 A;  5KFP A;  1RPL A;  7ICR A;  5EWE A;  4DWI A;  4ED8 A;  5KFC A;  3FYH A;  1MC8 A;  3Q8R B;  2W8L A;  3TQ1 A;  2IMW P;  4UB3 A;  1U49 A;  1UEV A;  1JMS A;  4Q44 A;  3OHB A;  1NK8 A;  4KMU A;  3M9N B;  3V6K A;  1N56 A;  1RYR A;  4IR9 A;  2HVI A;  1L3U A;  4X4N A;  5DB8 A;  5KFT A;  3HPO A;  1HUZ A;  3HT3 A;  3H39 A;  3TFR A;  2HHV A;  3MBY A;  8ICC A;  2ISO A;  9ICM A;  7ICL A;  1ZQV A;  3GFK B;  4PGQ A;  4DL4 A;  3E2E A;  4DSE A;  5DLG A;  3B0X A;  3RAX A;  1ZQG A;  4XQ8 A;  1SL2 A;  4NM1 A;  9ICR A;  4E0D A;  4YN4 A;  1T8E A;  8ICB A;  4FHY A;  4ECX A;  4QW8 A;  3PW2 A;  1L3S A;  5TZV A;  4YXM A;  3QZ7 A;  1MQ3 A;  3EYZ A;  2IHM A;  8ICM A;  1XSL A;  4WC7 A;  1H38 A;  4QWC A;  2RDI A;  4K4G A;  2F1J A;  4DQS A;  1BPB A;  3BDP A;  4DL6 A;  4QZC A;  3JPP A;  1L3V A;  1ZQL A;  4KLM A;  5KFX A;  4Q43 A;  2HHS A;  4F4K A;  3JPT A;  3OSN A;  1ZQP A;  1RXW A;  4I29 A;  9ICN A;  4DO9 A;  4KLE A;  4KLH A;  1BPX A;  4RUA A;  3HW8 A;  4J9S A;  1EXN A;  9ICA A;  2DVI A;  2HHT A;  1A76 A;  4J9O A;  2BCS A;  1ZQR A;  3RJJ A;  5KG4 A;  2R8K A;  4X4U A;  1NK9 A;  2UVR A;  2KN7 A;  2O5A A;  3FDS A;  5HNK A;  4UAW A;  2W9A A;  4J9R A;  4DS4 A;  4YD1 A;  2AGP A;  3UXO A;  4RT2 A;  4YCX A;  4WC6 A;  5III A;  1HJP A;  5KFA A;  4C8N A;  4FHW A;  2HHP A;  5C5J A;  2DR9 A;  2AGQ A;  3RJF A;  1QTM A;  2JZB A;  1XS9 D;  4XRH A;  3M8S A;  2OWO A;  3GV8 B;  2V4R A;  3UQ2 A;  2AGO A;  5HRD A;  4KLL A;  4AT7 A;  3PR4 A;  7ICM A;  1ZQN A;  4B9S A;  3WFQ E;  7ICN A;  4MFA A;  3QE9 Y;  7ICI A;  3OHA A;  5DG7 A;  3UXN A;  3MDC A;  2P66 A;  4DQI A;  9ICL A;  2ZH6 A;  3PX6 A;  1NK7 A;  2BCR A;  4YP3 A;  3ZDC A;  9ICX A;  1MIW A;  4M04 A;  8ICZ A;  1UA1 A;  3M9M B;  2M2W A;  7ICE A;  4RT3 A;  4QZE A;  4GXK A;  4ED0 A;  4AT8 B;  4MEY A;  4DEZ A;  8ICA A;  4F8R A;  3H4B A;  5DLF A;  4O3S A;  5KFB A;  3THV A;  1ZQK A;  1XU4 A;  4RU9 A;  5HHI A;  2ASL A;  2BCV A;  3H4D A;  2XY6 A;  4RPY A;  8ICQ A;  4FO6 A;  1B22 A;  4B9L A;  9ICT A;  4E80 A;  3RJH A;  4DOB A;  5J2I A;  4ED2 A;  2XCA A;  2BQR A;  4GC6 A;  1WCN A;  2BPG A;  3RR7 A;  1JIH A;  4RWN A;  4NLN A;  4UB5 A;  1Q79 A;  1NK5 A;  3PML A;  3Q8M A;  4B9M A;  1R8C A;  4ED1 A;  2ALZ A;  4FHV A;  1ZQU A;  3WFP A;  4P4P A;  4ECV A;  4R65 A;  3RJI A;  4FS1 A;  1ZQE A;  4I2F A;  5F9N A;  3MDA A;  2P6U A;  5DEC A;  2XY5 A;  2BQU A;  4IRC A;  3M8R A;  1RXV A;  1L5U A;  4ELT A;  2PI4 A;  1NKE A;  4DF8 A;  3PW0 A;  3T5H A;  1RZT A;  1TV9 A;  4FBU A;  2DRB A;  4YMM A;  4J9Q A;  9ICO A;  4YMN A;  1KFT A;  3PR5 B;  3PO5 A;  3Q8S B;  3MR3 A;  1COO A;  3JPR A;  3GV7 B;  1XC9 A;  1ZQA A;  2A1J A;  5J0P A;  4G3I A;  4EYI B;  5DDM A;  4GXI A;  4ED7 A;  2BGW A;  1C7Y A;  1S0O A;  3OVS A;  2FLP A;  2ZH2 A;  4UD4 A;  5BOL A;  8ICU A;  5J2F A;  2C28 A;  2DPJ A;  5KFO A;  2AJQ A;  2DRA A;  5J2B A;  3H40 A;  2DFL A;  4PHD A;  3AU6 A;  4ATB A;  3AQL A;  5HHH A;  3RBD A;  3JPS A;  4ECW A;  3NGD A;  9ICV A;  4I2E A;  1JQR A;  5F2V O;  2ASD A;  2PBE A;  3ISC A;  2VA8 A;  4NXZ A;  2ZHB A;  4F50 A;  4DL7 A;  8ICF A;  1KNY A;  2ID1 A;  4NKT A;  5HC9 A;  1PZN A;  4YVZ A;  5KFK A;  4DS5 A;  5KFY A;  2XGQ A;  3HWT A;  4EBD A;  5J2A A;  1KTQ A;  4X5V A;  1S10 A;  3EPG A;  1ZQO A;  1ZET A;  4M9G A;  3BQT A;  1MSW D;  9ICS A;  3HJ1 A;  1KSP A;  1DOQ A;  5KFW A;  3IM1 A;  4C8K A;  4RWP A;  1ZQC A;  4S3N A;  2KZ3 A;  4QZ9 A;  3NTU A;  1ZQQ A;  5IIN A;  5L1K A;  4AT7 B;  4RQ5 A;  2XO7 A;  8ICS A;  3C1Z A;  4B9U A;  1K1S A;  8ICP A;  5KG7 A;  3AUO A;  9ICG A;  4ECS A;  1ZQX A;  3V72 A;  1UT5 A;  1YLQ A;  3TAQ A;  3RJK A;  1BPD A;  3Q8P B;  5CA7 A;  9ICP A;  2ZH9 A;  4R8U A;  4DSJ A;  2NRV A;  1L3T A;  3QEB Z;  2A1J B;  3RH5 A;  5KFH A;  4I2G A;  2HHW A;  1U48 A;  1X9W A;  3H38 A;  4X4V A;  4R63 A;  4IRK A;  3IHQ B;  1ZQZ A;  9ICC A;  4P4O A;  3V7K A;  3TAP A;  4EBC A;  5DB9 A;  4RWQ A;  2PFP A;  3UXP A;  7ICO A;  2KTQ A;  4ECR A;  4RQ7 A;  5KT3 A;  2PI5 A;  2HVH A;  3PVX A;  3MFI A;  4M47 A;  4QZG A;  2Q0Z X;  5CHG A;  3PW5 A;  1UA0 A;  2VA2 A;  4P4M A;  3EWA A;  5KFJ A;  1ZQY A;  1NJY A;  4IRD A;  5CP2 A;  4DSL A;  4FHX A;  2FPM A;  2ZUD A;  4WC0 A;  2W9C A;  4YD2 A;  4AT8 A;  5DGA A;  3RJE A;  2C2E A;  9ICJ A;  7ICF A;  4KLJ A;  3V6H A;  2ZJ8 A;  2GWS A;  5HML A;  1U45 A;  7ICP A;  1T3N A;  3ORY A;  4M6W B;  1NKB A;  3T5K A;  4UD5 A;  3ZDE A;  5DBC A;  4JV0 A;  2VA3 A;  5J0O A;  3M9O B;  4F5R A;  4M9N A;  4QWB A;  2W8K A;  5KFV A;  4UBB A;  3GIJ A;  5BPC A;  3JPO A;  4J9N A;  4YR2 A;  3RB4 A;  1XSN A;  4KIT B;  5KG2 A;  1S76 D;  5J2K A;  4R64 A;  1KEJ A;  4ECQ A;  3JPN A;  2PFQ A;  4RQ2 A;  3MGI A;  3ZD8 A;  3JYY A;  7ICG A;  4WBZ A;  1QLN A;  5KFL A;  1TKD A;  5HRF A;  1BPY A;  1XWL A;  4F92 B;  1ZQI A;  1NK6 A;  4FH3 A;  2XGP A;  4DQQ A;  4DF4 A;  4UB2 A;  1KLN A;  4K4H A;  1DK3 A;  4RZR A;  4EZ9 A;  2ZTD A;  3OGU A;  2BPC A;  4F2S A;  2ZTC A;  3MR2 A;  3RBE A;  4QZF A;  4UBC A;  2DR8 A;  3OJU A;  3SV4 A;  4QWD A;  2DR7 A;  3LWL A;  1ZJN A;  1NJX A;  3SV3 A;  1ZQF A;  1A77 A;  1BNO A;  3UPS A;  4DSK A;  4M9H A;  2UVW A;  4I2D A;  3LDA A;  3KHL A;  3SYZ A;  4PHE A;  2ASJ A;  1JXE A;  5HRH A;  4YFK A;  2NRX A;  1NK0 A;  5KT5 A;  1NJW A;  4KLQ A;  4IG8 A;  2NRW A;  2V4Q A;  1R8B A;  1NO5 A;  4RNO A;  1U9L A;  1K1Q A;  4YR3 A;  4M2Y A;  4KLG A;  4GLX A;  1SZP A;  2BQ3 A;  7ICJ A;  4O3Q A;  4F91 B;  3EZ5 A;  1IM4 A;  4CCH A;  3C2L A;  2HHU A;  1OU5 A;  3L9D A;  4I2C A;  8ICY A;  5KFI A;  2M2T A;  4KN7 A;  5KT6 A;  5KG1 A;  4PGY A;  5L1J A;  2C2D A;  2DPI A;  8ICT A;  3GQC A;  7ICS A;  4XQ7 A;  4NLG A;  5J2J A;  7ICT A;  1S0M A;  7ICU A;  4EYH B;  4ZH4 A;  4ECT A;  5HP4 A;  3JZ0 A;  4TUS A;  3BQ0 A;  4DFK A;  4Q45 A;  5J0Q A;  3N4M B;  4UAZ A;  2ZTE A;  4B9V A;  3RR8 A;  4PHA A;  3GIK A;  4X4P A;  1ZQM A;  4DOC A;  3V7L A;  5KFN A;  3TFS A;  2J6T A;  4DLG A;  4O5E A;  2ZHA A;  9ICW A;  5IIK A;  3TAR A;  4O5K A;  2XCP A;  3ZDA A;  1TAQ A;  1KRP A;  5J0X A;  3ETL A;  4QZA A;  5D46 A;  1RYS A;  4RWO A;  4FS2 A;  3WFR E;  2LYH A;  4IQW A;  4YXJ A;  2BCQ A;  5L9X A;  4QZ8 A;  5DQH A;  2JEG A;  3QZ8 A;  5J0T A;  2MAX A;  4RQ8 A;  5KFF A;  4F93 B;  4O3N A;  5J0S A;  5J2C A;  4DFJ A;  4WC1 A;  2C22 A;  3RB3 A;  3MAB A;  2FMS A;  3PMN A;  2R8I A;  1V4A A;  1TVA A;  2XC9 A;  4I2J A;  5BOM A;  3RB6 A;  2HW3 A;  4X0B A;  1T4G A;  2BPF A;  4QW9 A;  2R8J A;  2FMP A;  3PO4 A;  7ICK A;  4DQR A;  8ICJ A;  5HRE A;  3AQM A;  3C5F A;  4WC5 A;  1ZYQ A;  4IQV A;  2RDJ A;  9ICF A;  1ZJM A;  1QSY A;  5DQI A;  4J9K A;  3HP6 A;  2PXI A;  2C2R A;  4KN4 A;  4J9P A;  3RRG A;  3G6V A;  4F5N A;  5JUM A;  4DL3 A;  3PW4 A;  1U47 A;  1S0N A;  4B9N A;  1R89 A;  4WC3 A;  4RNM A;  4BGD A;  1LB2 B;  4XUS A;  4UQG A;  1MIV A;  4F3O A;  2NRK A;  4M9L A;  4F2R A;  2NRZ A;  5KT7 A;  4QWA A;  4TUP A;  4HYK A;  2IA6 A;  3BQ1 A;  4O5C A;  1N48 A;  3C21 A;  2Y1J A;  1JXL A;  5KFD A;  4WBY A;  4I2H A;  4PPX A;  1IXR A;  4I2I A;  4Q8E A;  4QZD A;  3C2M A;  3SI8 A;  2I9G A;  9ICK A;  2RFF A;  1U4B A;  9ICH A;  1JN3 A;  1CEZ A;  1D8Y A;  1BPE A;  1NJZ A;  4DL5 A;  3PW7 A;  9ICQ A;  1PX5 A;  3T5J A;  2VAN A;  3G6X A;  2XY7 A;  7ICH A;  5HRB A;  8ICL A;  3PX4 A;  5KFZ A;  4R66 A;  4PHP A;  2JEF A;  1TAU A;  2ZUB A;  4XA5 A;  2MUT A;  1MQ2 A;  3C18 A;  4E8F A;  8ICV A;  4F4Y A;  1TK5 A;  2ZH8 A;  1CUK A;  2B21 A;  2J6U A;  2ISP A;  4KLS A;  8ICW A;  2DR5 A;  2PFN A;  3RRH A;  4NLK A;  3AQN A;  5CJ7 A;  2FPL A;  1WCL A;  2ZJA A;  8ICH A;  2R8G A;  5KFS A;  4MF2 A;  1UET A;  4Z6D A;  3PX0 A;  4JK1 A;  3KHG A;  4JWN A;  5KG3 A;  3EPI A;  4BWM A;  1BNP A;  2JZB B;  1KFD A;  2O1P A;  3GIL A;  1D9D A;  8ICX A;  4TQR A;  1SKW A;  4GC7 A;  1ZQH A;  3NYB A;  1SL0 A;  4WC2 A;  3C1Y A;  1NKC A;  2ZH5 A;  1ARO P;  3KHR A;  4ED6 A;  3RB0 A;  1S97 A;  3EW9 A;  3Q8K A;  3V7J A;  1LV5 A;  2W9B B;  4FHP A;  4R8U B;  4ECY A;  4LT6 A;  4X0A A;  2I1Q A;  4RUC A;  4DFP A;  5KFQ A;  1BPZ A;  2P6R A;  4X4Q A;  2HHQ A;  4NM2 A;  3GV5 B;  2AQ0 A;  4EEY A;  3C66 A;  4UB1 A;  2FMQ A;  5DDY A;  4LZD A;  5CWR A;  4QZH A;  3MFH A;  4KTQ A;  1ZQW A;  1JX4 A;  8ICO A;  4FBT A;  1JAJ A;  4RQ6 A;  2FPK A;  5DB7 A;  5DQG A;  5EWG A;  5L1I A;  2ATL A;  4ELU A;  3TAN A;  2IHN A;  4KLI A;  4I27 A;  1ZQD A;  4F4W A;  3RH6 A;  2BCU A;  8ICK A;  5J0Y A;  5IIJ A;  4TQS A;  4ELV A;  3H37 A;  4BWJ A;  3HJ4 A;  5KG5 A;  3LK9 A;  9ICE A;  5J29 A;  4O9M A;  2BHN A;  2M9N A;  2ZJ5 A;  1SL1 A;  1V9P A;  4PGX A;  3MGH A;  4TUQ A;  3HX0 A;  2H5X A;  1S9F A;  4JV1 A;  4KLO A;  4X4S A;  4AT9 B;  3T5L A;  4M0A A;  5DKW A;  4NLZ A;  1F5A A;  1FA0 A;  4ECZ A;  4O3O A;  1NZP A;  5KFG A;  4MFF A;  5J0W A;  4KLF A;  4X4R A;  2MUT B;  5L1L A;  1KDH A;  1ZQS A;  3B0Y A;  1Z3E B;  2J6S A;  4JV2 A;  1SKS A;  8ICG A;  5DED A;  9ICI A;  5CB1 A;  4QZI A;  4C8O A;  4J9M A;  3RTV A;  2KFZ A;  3H7I A;  1R8A A;  2NRT A;  4FH5 A;  4YR0 A;  2ZH1 A;  3PNC A;  1XO1 A;  4MEX A;  1DK2 A;  3GII A;  1DGS A;  5D49 A;  1Y88 A;  5HMM A;  5HRI A;  4RQ3 A;  2V9W A;  1TFR A;  2Q66 A;  2W9M A;  1QSL A;  5HRK A;  5KG6 A;  4DLE A;  1D8L A;  4WCW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...