4WH5A

Crystal structure of lincosamide antibiotic adenylyltransferase lnua, lincomycin-bound
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
NNVTEKELFYILDLFEHMKVTYWLDGGWGVDVLTGKQQREHRDIDIDFDAQHTQKVIQKLEDIGYKIEVHWMPSRMELKHEEYGYLDIHPINLNDDGSITQANPEGGNYVFQNDWFSETNYKDRKIPCISKEAQLLFHSGYDLTETDHFDIKNLKSIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Lincosamide resistance protein
publication title CRYSTAL STRUCTURE OF LINCOSAMIDE ANTIBIOTIC ADENYLYLTRANSFERASE LNUA, LINCOMYCIN BOUND
rcsb
source organism Staphylococcus haemolyticus
total genus 46
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4wh5A00
4FO1A 4WQLA 2FCLA 5CFTA 4XJEA 5CFSA 5CFUA 2EWRA 4HX0A 4WH5A 4WQKA
chains in the Genus database with same CATH superfamily
4ATBA 4RT3A 1YLQA 4GXIA 4NXZA 1ZQZA 4QZCA 3TFSA 5IILA 8ICPA 4JLZA 4O5EA 2M2UA 4KLIA 3ER8C 4F5OA 4YCXA 3CK6A 7ICHA 2BCQA 4KLFA 5BOLA 4FO6A 2FCLA 2BPCA 7ICJA 5D61A 3AUOA 1ZQSA 2IHOA 2M2TA 4M9GA 3NVOA 5CHEA 1RZTA 5HRIA 3EF2A 4O5KA 4IQUA 4R66A 4I2GA 1UETA 4DOCA 8ICBA 3NKUA 3JPNA 4I28A 5J2GA 5DBAA 8ICXA 4RQ3A 4I2IA 4X4NA 4K9AA 1ZJNA 8ICLA 4NXXA 2DR5A 2HHPA 8ICSA 4WC6A 4YMMA 4I29A 3PMLA 9ICOA 3C2LA 4RWPA 4I2AA 5IIJA 2FMSA 3UPSA 3C18A 4WQKA 5B3QA 4RWOA 2BCRA 4QZDA 5J2JA 4RQ1A 2PFQA 5BOMA 4GXKA 1ZJMA 4TUPA 5IIIA 1GPJA 4M5DA 2ZHBA 4AT7A 5J0UA 5J2CA 3K7DA 4LZDA 4FHPA 4FH3A 3RJKA 5CJ7A 5J0XA 4LEWA 4R63A 4K9BA 4NLKA 4GXJA 1MIYA 3V7JA 7ICNA 8ICZA 3MDAA 3UPQA 2ID1A 4NXWA 4QZAA 3OVSA 4EEBA 3HX0A 4EP7A 3HWTA 4O69A 4KLOA 4N7RA 4R64A 1Q79A 4ATBB 9ICNA 4K99A 4XJEA 4KLJA 4FHYA 3UXPA 4K4IA 4M9NA 4TUQA 2ZH7A 4KLUA 2NRKA 4TUSA 4X4VA 4X5VA 2IHMA 3WFRE 3JPRA 4EEDA 3RJHA 4UAWA 3LK9A 4M2YA 4O5CA 1JQRA 7ICPA 4KLTA 2I9GA 4NLNA 2ZH8A 8ICKA 3TFRA 2DR7A 1NO5A 4RPYA 4IQTA 3HIYA 5HRHA 2PBEA 4X4QA 1XSLA 3UXNA 2O5AA 3HJ4A 1BPYA 4RWNA 4YMOA 3JCFA 4K97A 1NOMA 1OU5A 4X0AA 4DO9A 5IIKA 4WC4A 4MF8A 9ICRA 5J2AA 4KLDA 1ZQXA 7ICOA 4X4UA 8ICNA 8ICRA 2ZH6A 3H39A 5DBCA 4QZGA 2PFNA 5J0YA 4YMNA 4YN4A 8ICHA 5DEDA 3ISCA 5B3PA 4XRHA 1V4AA 4NXUA 7ICGA 5D63A 4X4SA 5DBBA 8ICUA 3L9DA 4YD1A 1MQ2A 4QZBA 3JPTA 4F5PA 2BBHA 2B4VA 4P4OA 1ZQMA 4YD2A 3RJIA 1BPXA 5J2IA 3NWIA 1R8AA 4AT8A 4FHWA 4UB2A 2BBJA 4M9HA 4XQ8A 1UEUA 5J2KA 4JWNA 4EBJA 4PPXA 7ICLA 3MDCA 3K75D 4AT7B 4IG8A 2P66A 4E7XA 7ICSA 5DB7A 2ZHAA 3WFPA 3JZ0A 9ICPA 4M9LA 7ICEA 5J2FA 1Q78A 4EV6A 3AU6A 4MFFA 3RJEA 5J0TA 9ICSA 1JAJA 1MQ3A 4QZHA 9ICUA 4K4GA 5TZVA 4MF2A 4I2BA 5J0QA 3OUYA 1ZQHA 3ERCC 4OAFA 8ICCA 4Z6CA 4O6AA 4WC5A 1R8BA 3C5FA 3RJFA 5J0OA 4PGXA 1BPZA 5DB6A 5JTGA 2FMQA 1TFWA 5DDMA 4PGQA 4TURA 4RT2A 2O1PA 5IINA 3MBYA 4AT9B 4WOYA 4UB3A 4M0AA 9ICHA 5CP2A 2DRAA 5IIOA 2B56A 5HHHA 3AQLA 4I2CA 5D4BA 4RQ4A 5J0PA 4XQ7A 8ICFA 3V7KA 4S3NA 1R89A 4I2EA 2GA9D 9ICLA 4OAIZ 4AT8B 4RQ8A 8ICVA 1ZQFA 7ICTA 4E80A 7ICVA 3B0XA 3AQMA 5D49A 1ZQVA 4KLHA 4PHDA 3AQKA 4LT6A 1XSPA 2HN1A 8ICMA 1R8CA 5HRKA 3WFSC 4UBCA 5CFUA 2PXIA 1XSNA 2B51A 4Z6DA 1TFYA 2BCUA 3JPQA 3OVAA 1ZQKA 5HRBA 4NKUA 2BPGA 2VANA 5HRFA 5DDYA 4NM2A 2DR9A 1ZQOA 4F5NA 2FMPA 5HR9A 8ICOA 4UB4A 3HW8A 3OUYB 4FHVA 8ICIA 3RH6A 5DB8A 4I2HA 4KLMA 3H38A 4P4MA 1WOTA 4WCWA 3RH5A 3WFQE 7ICFA 5DB9A 4K98A 9ICAA 4X4RA 1ZQLA 1BPEA 4PGYA 4E8FA 4RWQA 4EBKA 4EGWA 9ICBA 4P2HA 4X0BA 4M9JA 4QZ9A 3MGHA 5HRDA 3JPSA 8ICTA 8ICJA 1ZQAA 1ZQIA 5DKWA 4UAZA 3JPPA 9ICVA 4IQVA 3MGIA 3JYYA 3ISBA 4KLLA 4R65A 1FA0A 5J2BA 2DRBA 1ZQQA 3HJ1A 4UAYA 8ICEA 9ICXA 5CA7A 2ZH5A 9ICWA 4QZFA 5CWRA 9ICMA 4RQ2A 4NXVA 4K96A 3RJGA 1VFGA 4P4PA 1ZQYA 4NLZA 4K8VA 3UQ0A 8ICAA 3AQNA 5HRLA 4NXTA 2DR8A 3C2MA 3V72A 4I27A 5F2VO 1PX5A 4RQ5A 3H37A 4FO1A 4RQ0A 2GWSA 1TVAA 4OAHA 3OVBA 2DVIA 4WC2A 4NM1A 4WC1A 9ICIA 4M47A 1ZQPA 1BPBA 4UBBA 4LEYA 3C66A 4RPZA 3UQ2A 4RQ6A 5IIMA 3UXOA 5HHIA 3JPOA 2ISPA 2ISOA 2ZH9A 2HN2A 2BCVA 4WC7A 4I2JA 4XA5A 1ZQEA 4Z6EA 5D62A 5D46A 2GAFD 9ICGA 3GDXA 1MIWA 9ICTA 4PHAA 4DOAA 2BE3A 2PFPA 3OGUA 9ICQA 4JLXA 4I2DA 5CR0A 4MFCA 4M04A 2ZH3A 4KB6A 4LEVA 5CB1A 5J2DA 1ZQDA 1BPDA 7ICRA 4PHPA 5J0SA 2ZH1A 3WFOA 3MCRA 7ICUA 1UEVA 3C2KA 1KDHA 4QZEA 4UD5A 4X4TA 4MKPA 5J2HA 1ZQTA 5CHGA 3OV7A 5CFSA 3LQCB 4UB1A 4UD4A 1ZQNA 2ZH4A 4QZ8A 3PMNA 4WBZA 8ICGA 4XUSA 3NYBA 7ICIA 3AU2A 4X4OA 5BPCA 1ZQWA 2EWRA 5HREA 1ZQBA 9ICKA 1KEJA 4OAGA 4KLGA 5J0RA 5DECA 3ER9B 4F5RA 3C5GA 3RJJA 2M2VA 3PNCA 3RH4A 1JN3A 5HRGA 1F5AA 3OWGA 5CFTA 4WC3A 4FHXA 4WC0A 4LVSA 4KM5A 4QZIA 4PH5A 4WQLA 4NY8A 4I2FA 2RFFA 4WH5A 2Q66A 4KLSA 8ICWA 1JMSA 4F5QA 9ICEA 3H3AA 2M2WA 4X4PA 9ICJA 3V7LA 9ICCA 4O68A 5EOZA 4DOBA 1ZQJA 7ICMA 8ICYA 4KLQA 1RPLA 2W9MA 2BPFA 4RQ7A 2PFOA 1KNYA 1ZQCA 7ICQA 9ICFA 4MFAA 4UB5A 4Z6FA 4LZGA 4JWMA 4K4HA 1MIVA 2IUBA 4HX0A 4AT9A 5J2EA 4PHEA 4I0UA 4LEZA 1VJ7A 1HUZA 1ZQUA 1ZQGA 8ICQA 4O9MA 2ZH2A 5J0WA 5HC9A 7ICKA 4KLEA 4IQWA 1HUOA 4FH5A 3PHZA 1TV9A 4O67A 4RPXA 4NKTA 5J29A 3ISDA 1ZQRA 2BCSA 4WBYA 3B0YA
chains in the Genus database with same CATH topology
5B3QA 4NXTA 4WQLA 4K99A 3NKUA 4OAIZ 4XJEA 4JLXA 2EWRA 4HX0A 4FO1A 4JLZA 4OAHA 4WH5A 4LEZA 4KB6A 3ER8C 4OAGA 3ERCC 4LEVA 4WOYA 4LEYA 4K9AA 1GPJA 3ER9B 4OAFA 4NXXA 3K7DA 4WQKA 4O6AA 2B56A 4K9BA 2FCLA 4LEWA 3MCRA 4K98A 4NXVA 4K96A 5B3PA 5CFUA 4O68A 4NXUA 5D62A 4NXWA 2B51A 5D61A 2GAFD 2IHOA 3OWGA 3PHZA 4MKPA 5D63A 4O67A 4K8VA 5CHEA 5CFTA 5CFSA 4K97A 4O69A 3EF2A 4KM5A 2B4VA 4N7RA 2GA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FO1 A;  4WQL A;  2FCL A;  5CFT A;  4XJE A;  5CFS A;  5CFU A;  2EWR A;  4HX0 A;  4WH5 A;  4WQK A; 
#chains in the Genus database with same CATH topology
 4ATB A;  4RT3 A;  1YLQ A;  4GXI A;  4NXZ A;  1ZQZ A;  4QZC A;  3TFS A;  5IIL A;  8ICP A;  4JLZ A;  4O5E A;  2M2U A;  4KLI A;  3ER8 C;  4F5O A;  4YCX A;  3CK6 A;  7ICH A;  2BCQ A;  4KLF A;  5BOL A;  4FO6 A;  2FCL A;  2BPC A;  7ICJ A;  5D61 A;  3AUO A;  1ZQS A;  2IHO A;  2M2T A;  4M9G A;  3NVO A;  5CHE A;  1RZT A;  5HRI A;  3EF2 A;  4O5K A;  4IQU A;  4R66 A;  4I2G A;  1UET A;  4DOC A;  8ICB A;  3NKU A;  3JPN A;  4I28 A;  5J2G A;  5DBA A;  8ICX A;  4RQ3 A;  4I2I A;  4X4N A;  4K9A A;  1ZJN A;  8ICL A;  4NXX A;  2DR5 A;  2HHP A;  8ICS A;  4WC6 A;  4YMM A;  4I29 A;  3PML A;  9ICO A;  3C2L A;  4RWP A;  4I2A A;  5IIJ A;  2FMS A;  3UPS A;  3C18 A;  4WQK A;  5B3Q A;  4RWO A;  2BCR A;  4QZD A;  5J2J A;  4RQ1 A;  2PFQ A;  5BOM A;  4GXK A;  1ZJM A;  4TUP A;  5III A;  1GPJ A;  4M5D A;  2ZHB A;  4AT7 A;  5J0U A;  5J2C A;  3K7D A;  4LZD A;  4FHP A;  4FH3 A;  3RJK A;  5CJ7 A;  5J0X A;  4LEW A;  4R63 A;  4K9B A;  4NLK A;  4GXJ A;  1MIY A;  3V7J A;  7ICN A;  8ICZ A;  3MDA A;  3UPQ A;  2ID1 A;  4NXW A;  4QZA A;  3OVS A;  4EEB A;  3HX0 A;  4EP7 A;  3HWT A;  4O69 A;  4KLO A;  4N7R A;  4R64 A;  1Q79 A;  4ATB B;  9ICN A;  4K99 A;  4XJE A;  4KLJ A;  4FHY A;  3UXP A;  4K4I A;  4M9N A;  4TUQ A;  2ZH7 A;  4KLU A;  2NRK A;  4TUS A;  4X4V A;  4X5V A;  2IHM A;  3WFR E;  3JPR A;  4EED A;  3RJH A;  4UAW A;  3LK9 A;  4M2Y A;  4O5C A;  1JQR A;  7ICP A;  4KLT A;  2I9G A;  4NLN A;  2ZH8 A;  8ICK A;  3TFR A;  2DR7 A;  1NO5 A;  4RPY A;  4IQT A;  3HIY A;  5HRH A;  2PBE A;  4X4Q A;  1XSL A;  3UXN A;  2O5A A;  3HJ4 A;  1BPY A;  4RWN A;  4YMO A;  3JCF A;  4K97 A;  1NOM A;  1OU5 A;  4X0A A;  4DO9 A;  5IIK A;  4WC4 A;  4MF8 A;  9ICR A;  5J2A A;  4KLD A;  1ZQX A;  7ICO A;  4X4U A;  8ICN A;  8ICR A;  2ZH6 A;  3H39 A;  5DBC A;  4QZG A;  2PFN A;  5J0Y A;  4YMN A;  4YN4 A;  8ICH A;  5DED A;  3ISC A;  5B3P A;  4XRH A;  1V4A A;  4NXU A;  7ICG A;  5D63 A;  4X4S A;  5DBB A;  8ICU A;  3L9D A;  4YD1 A;  1MQ2 A;  4QZB A;  3JPT A;  4F5P A;  2BBH A;  2B4V A;  4P4O A;  1ZQM A;  4YD2 A;  3RJI A;  1BPX A;  5J2I A;  3NWI A;  1R8A A;  4AT8 A;  4FHW A;  4UB2 A;  2BBJ A;  4M9H A;  4XQ8 A;  1UEU A;  5J2K A;  4JWN A;  4EBJ A;  4PPX A;  7ICL A;  3MDC A;  3K75 D;  4AT7 B;  4IG8 A;  2P66 A;  4E7X A;  7ICS A;  5DB7 A;  2ZHA A;  3WFP A;  3JZ0 A;  9ICP A;  4M9L A;  7ICE A;  5J2F A;  1Q78 A;  4EV6 A;  3AU6 A;  4MFF A;  3RJE A;  5J0T A;  9ICS A;  1JAJ A;  1MQ3 A;  4QZH A;  9ICU A;  4K4G A;  5TZV A;  4MF2 A;  4I2B A;  5J0Q A;  3OUY A;  1ZQH A;  3ERC C;  4OAF A;  8ICC A;  4Z6C A;  4O6A A;  4WC5 A;  1R8B A;  3C5F A;  3RJF A;  5J0O A;  4PGX A;  1BPZ A;  5DB6 A;  5JTG A;  2FMQ A;  1TFW A;  5DDM A;  4PGQ A;  4TUR A;  4RT2 A;  2O1P A;  5IIN A;  3MBY A;  4AT9 B;  4WOY A;  4UB3 A;  4M0A A;  9ICH A;  5CP2 A;  2DRA A;  5IIO A;  2B56 A;  5HHH A;  3AQL A;  4I2C A;  5D4B A;  4RQ4 A;  5J0P A;  4XQ7 A;  8ICF A;  3V7K A;  4S3N A;  1R89 A;  4I2E A;  2GA9 D;  9ICL A;  4OAI Z;  4AT8 B;  4RQ8 A;  8ICV A;  1ZQF A;  7ICT A;  4E80 A;  7ICV A;  3B0X A;  3AQM A;  5D49 A;  1ZQV A;  4KLH A;  4PHD A;  3AQK A;  4LT6 A;  1XSP A;  2HN1 A;  8ICM A;  1R8C A;  5HRK A;  3WFS C;  4UBC A;  5CFU A;  2PXI A;  1XSN A;  2B51 A;  4Z6D A;  1TFY A;  2BCU A;  3JPQ A;  3OVA A;  1ZQK A;  5HRB A;  4NKU A;  2BPG A;  2VAN A;  5HRF A;  5DDY A;  4NM2 A;  2DR9 A;  1ZQO A;  4F5N A;  2FMP A;  5HR9 A;  8ICO A;  4UB4 A;  3HW8 A;  3OUY B;  4FHV A;  8ICI A;  3RH6 A;  5DB8 A;  4I2H A;  4KLM A;  3H38 A;  4P4M A;  1WOT A;  4WCW A;  3RH5 A;  3WFQ E;  7ICF A;  5DB9 A;  4K98 A;  9ICA A;  4X4R A;  1ZQL A;  1BPE A;  4PGY A;  4E8F A;  4RWQ A;  4EBK A;  4EGW A;  9ICB A;  4P2H A;  4X0B A;  4M9J A;  4QZ9 A;  3MGH A;  5HRD A;  3JPS A;  8ICT A;  8ICJ A;  1ZQA A;  1ZQI A;  5DKW A;  4UAZ A;  3JPP A;  9ICV A;  4IQV A;  3MGI A;  3JYY A;  3ISB A;  4KLL A;  4R65 A;  1FA0 A;  5J2B A;  2DRB A;  1ZQQ A;  3HJ1 A;  4UAY A;  8ICE A;  9ICX A;  5CA7 A;  2ZH5 A;  9ICW A;  4QZF A;  5CWR A;  9ICM A;  4RQ2 A;  4NXV A;  4K96 A;  3RJG A;  1VFG A;  4P4P A;  1ZQY A;  4NLZ A;  4K8V A;  3UQ0 A;  8ICA A;  3AQN A;  5HRL A;  4NXT A;  2DR8 A;  3C2M A;  3V72 A;  4I27 A;  5F2V O;  1PX5 A;  4RQ5 A;  3H37 A;  4FO1 A;  4RQ0 A;  2GWS A;  1TVA A;  4OAH A;  3OVB A;  2DVI A;  4WC2 A;  4NM1 A;  4WC1 A;  9ICI A;  4M47 A;  1ZQP A;  1BPB A;  4UBB A;  4LEY A;  3C66 A;  4RPZ A;  3UQ2 A;  4RQ6 A;  5IIM A;  3UXO A;  5HHI A;  3JPO A;  2ISP A;  2ISO A;  2ZH9 A;  2HN2 A;  2BCV A;  4WC7 A;  4I2J A;  4XA5 A;  1ZQE A;  4Z6E A;  5D62 A;  5D46 A;  2GAF D;  9ICG A;  3GDX A;  1MIW A;  9ICT A;  4PHA A;  4DOA A;  2BE3 A;  2PFP A;  3OGU A;  9ICQ A;  4JLX A;  4I2D A;  5CR0 A;  4MFC A;  4M04 A;  2ZH3 A;  4KB6 A;  4LEV A;  5CB1 A;  5J2D A;  1ZQD A;  1BPD A;  7ICR A;  4PHP A;  5J0S A;  2ZH1 A;  3WFO A;  3MCR A;  7ICU A;  1UEV A;  3C2K A;  1KDH A;  4QZE A;  4UD5 A;  4X4T A;  4MKP A;  5J2H A;  1ZQT A;  5CHG A;  3OV7 A;  5CFS A;  3LQC B;  4UB1 A;  4UD4 A;  1ZQN A;  2ZH4 A;  4QZ8 A;  3PMN A;  4WBZ A;  8ICG A;  4XUS A;  3NYB A;  7ICI A;  3AU2 A;  4X4O A;  5BPC A;  1ZQW A;  2EWR A;  5HRE A;  1ZQB A;  9ICK A;  1KEJ A;  4OAG A;  4KLG A;  5J0R A;  5DEC A;  3ER9 B;  4F5R A;  3C5G A;  3RJJ A;  2M2V A;  3PNC A;  3RH4 A;  1JN3 A;  5HRG A;  1F5A A;  3OWG A;  5CFT A;  4WC3 A;  4FHX A;  4WC0 A;  4LVS A;  4KM5 A;  4QZI A;  4PH5 A;  4WQL A;  4NY8 A;  4I2F A;  2RFF A;  4WH5 A;  2Q66 A;  4KLS A;  8ICW A;  1JMS A;  4F5Q A;  9ICE A;  3H3A A;  2M2W A;  4X4P A;  9ICJ A;  3V7L A;  9ICC A;  4O68 A;  5EOZ A;  4DOB A;  1ZQJ A;  7ICM A;  8ICY A;  4KLQ A;  1RPL A;  2W9M A;  2BPF A;  4RQ7 A;  2PFO A;  1KNY A;  1ZQC A;  7ICQ A;  9ICF A;  4MFA A;  4UB5 A;  4Z6F A;  4LZG A;  4JWM A;  4K4H A;  1MIV A;  2IUB A;  4HX0 A;  4AT9 A;  5J2E A;  4PHE A;  4I0U A;  4LEZ A;  1VJ7 A;  1HUZ A;  1ZQU A;  1ZQG A;  8ICQ A;  4O9M A;  2ZH2 A;  5J0W A;  5HC9 A;  7ICK A;  4KLE A;  4IQW A;  1HUO A;  4FH5 A;  3PHZ A;  1TV9 A;  4O67 A;  4RPX A;  4NKT A;  5J29 A;  3ISD A;  1ZQR A;  2BCS A;  4WBY A;  3B0Y A; 
#chains in the Genus database with same CATH homology
 5B3Q A;  4NXT A;  4WQL A;  4K99 A;  3NKU A;  4OAI Z;  4XJE A;  4JLX A;  2EWR A;  4HX0 A;  4FO1 A;  4JLZ A;  4OAH A;  4WH5 A;  4LEZ A;  4KB6 A;  3ER8 C;  4OAG A;  3ERC C;  4LEV A;  4WOY A;  4LEY A;  4K9A A;  1GPJ A;  3ER9 B;  4OAF A;  4NXX A;  3K7D A;  4WQK A;  4O6A A;  2B56 A;  4K9B A;  2FCL A;  4LEW A;  3MCR A;  4K98 A;  4NXV A;  4K96 A;  5B3P A;  5CFU A;  4O68 A;  4NXU A;  5D62 A;  4NXW A;  2B51 A;  5D61 A;  2GAF D;  2IHO A;  3OWG A;  3PHZ A;  4MKP A;  5D63 A;  4O67 A;  4K8V A;  5CHE A;  5CFT A;  5CFS A;  4K97 A;  4O69 A;  3EF2 A;  4KM5 A;  2B4V A;  4N7R A;  2GA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...