4WH5A

Crystal structure of lincosamide antibiotic adenylyltransferase lnua, lincomycin-bound
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
NNVTEKELFYILDLFEHMKVTYWLDGGWGVDVLTGKQQREHRDIDIDFDAQHTQKVIQKLEDIGYKIEVHWMPSRMELKHEEYGYLDIHPINLNDDGSITQANPEGGNYVFQNDWFSETNYKDRKIPCISKEAQLLFHSGYDLTETDHFDIKNLKSIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lincosamide resistance protein
publication title CRYSTAL STRUCTURE OF LINCOSAMIDE ANTIBIOTIC ADENYLYLTRANSFERASE LNUA, LINCOMYCIN BOUND
rcsb
source organism Staphylococcus haemolyticus
molecule tags Transferase/antibiotic
total genus 46
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4wh5A00
5CFUA 4HX0A 2FCLA 2EWRA 4WH5A 5CFTA 4FO1A 4WQLA 4XJEA 4WQKA 5CFSA
chains in the Genus database with same CATH superfamily
2B56A 4KLHA 7ICJA 8ICCA 5IIMA 3AQKA 4XQ8A 1ZQFA 4EP7A 1ZQDA 2PFNA 8ICFA 2NRKA 4I2BA 2BBHA 7ICFA 5DDMA 4I2JA 4YMNA 8ICQA 1VFGA 3UPSA 3JPQA 4WC1A 4RQ4A 3UXOA 4WCWA 4YCXA 1ZQHA 1ZQRA 4M5DA 5DEDA 3AU2A 4R66A 8ICJA 4PH5A 3TFRA 2BCUA 2ID1A 4NXZA 4QZ9A 3PNCA 4Z6CA 4DOAA 5HR9A 4XQ7A 1VJ7A 4KLUA 4RWOA 3ER8C 4M04A 3OUYA 3UQ2A 4Z6FA 3MBYA 4QZIA 4I2EA 2M2UA 4K99A 9ICMA 1ZQUA 7ICKA 5DB8A 4X4SA 4FHPA 1KDHA 3JCFA 4LEZA 1ZQJA 4PHPA 2ZHAA 4I2HA 7ICTA 2O5AA 2Q66A 1R8CA 4UAYA 4FHXA 3GDXA 5J2JA 4KLQA 2VANA 2IHMA 2GAFD 3C66A 3JZ0A 4OAHA 2DR9A 7ICPA 5EOZA 4UAWA 2HHPA 1XSNA 3JPPA 3C18A 1ZQQA 4AT7A 3V7KA 4QZ8A 5HRIA 2PFPA 4RWQA 4UB5A 4E80A 2B51A 9ICEA 2DR5A 8ICYA 7ICMA 4AT9B 4KLTA 5HHIA 1BPEA 1R89A 9ICUA 1BPZA 4XRHA 4M9NA 4KM5A 2PXIA 3RJGA 4IQUA 4WC6A 4TUPA 8ICKA 3V72A 4K4HA 3HJ4A 3OVSA 4O5EA 1R8BA 4AT8A 4KLGA 4EGWA 2DR8A 4NXVA 4I2CA 5D62A 1JN3A 3HW8A 4I2AA 4PGQA 5DECA 1ZQTA 4PGXA 1WOTA 4FO1A 4S3NA 4KLSA 4RQ1A 4YN4A 2M2WA 5J0XA 3PMLA 2DVIA 8ICHA 4QZCA 4XA5A 7ICEA 4YD1A 4PHDA 4K4GA 4KB6A 7ICSA 5DBBA 1ZQVA 4K8VA 2EWRA 1KNYA 5CA7A 4X4UA 4P2HA 4MFCA 5J29A 1NO5A 3HJ1A 3C2MA 5DBCA 1ZQOA 9ICRA 4M47A 5HRGA 3JPRA 3PHZA 1ZQCA 4QZDA 1ZQGA 4HX0A 1JMSA 4KLDA 2BPGA 1ZQMA 5CFUA 4OAFA 3NYBA 4AT8B 5IIOA 3WFOA 5J2FA 8ICIA 3UXNA 2GWSA 4UAZA 2BCRA 1JQRA 1Q79A 4LZGA 4WC2A 2ZH2A 3ISCA 3MGIA 1ZQPA 4WOYA 4P4PA 5D49A 3LQCB 4KLLA 1TV9A 4X0AA 7ICLA 5J2CA 4AT9A 4X4NA 8ICGA 8ICVA 4EBJA 2M2VA 1MIWA 3B0YA 5F2VO 2BCVA 4O6AA 1ZQYA 2ISPA 3RH6A 3JYYA 3C2KA 4I2FA 4NXUA 4FHWA 4LEVA 1UEUA 1ZJMA 3RJKA 5D61A 2ZH7A 4RPXA 5CHEA 5CP2A 4DOCA 4MF8A 5J2BA 2PFOA 5BOMA 9ICIA 8ICTA 4P4OA 4O68A 4QZGA 3OWGA 9ICGA 4PHEA 4X4PA 7ICUA 8ICLA 9ICXA 1XSLA 2FMPA 3RJHA 1JAJA 3OV7A 2HN1A 1MQ3A 4IQVA 4K98A 3HX0A 4RPYA 5J2IA 5J0RA 4K9BA 2ZH8A 5BOLA 4MFFA 4I29A 4R65A 3WFRE 1MQ2A 5HRHA 3C5GA 4K97A 5DB9A 5J0WA 1ZQNA 4DO9A 5J0PA 1ZQBA 5CFSA 5DB6A 3OVAA 9ICNA 5HRFA 8ICRA 9ICVA 5BPCA 4KLIA 2ZH5A 8ICUA 3H38A 4RT2A 4E7XA 3MDAA 7ICHA 4UD4A 4O9MA 4WC0A 3ISBA 1GPJA 4WC4A 2BPCA 4X4TA 4YMOA 4FHYA 8ICMA 5D46A 3AQMA 5DDYA 4FHVA 4M0AA 9ICOA 2DRAA 1ZJNA 8ICZA 4I0UA 8ICPA 2BBJA 1HUZA 4X4VA 4NM1A 5B3QA 5CR0A 5HREA 4UB1A 4KLJA 1HUOA 4F5NA 4QZEA 2FMSA 4LZDA 1ZQIA 4KLOA 4K4IA 1R8AA 4XUSA 2HN2A 4PGYA 4FH3A 3K75D 3NVOA 4O67A 2RFFA 5JTGA 4EBKA 2M2TA 7ICNA 2W9MA 5J2DA 5J0SA 2B4VA 5B3PA 8ICBA 2DRBA 1PX5A 3LK9A 4OAGA 9ICCA 4O69A 1Q78A 4X4QA 5IINA 5J0QA 4NLNA 8ICSA 9ICPA 3HWTA 4OAIZ 5DBAA 9ICKA 5HRDA 1OU5A 4MFAA 5J0UA 5IIIA 4UBBA 2ZH1A 3PMNA 4UBCA 4IQWA 3RJJA 4XJEA 1YLQA 9ICWA 5CWRA 4WC7A 5IIKA 1XSPA 8ICWA 1BPDA 1ZQEA 4I27A 4WBYA 9ICJA 3JPSA 3WFPA 3JPNA 4RQ3A 4WC3A 1TFYA 4TUQA 4EV6A 4LVSA 1UEVA 5CHGA 4N7RA 4WH5A 4RQ5A 5J0YA 8ICOA 3WFSC 1TVAA 3AQLA 9ICFA 5J0OA 3H37A 5J2GA 2ZHBA 4K9AA 4JLXA 3B0XA 2I9GA 4I2DA 4UB3A 3L9DA 4RQ6A 4NXXA 3OGUA 3HIYA 4Z6DA 5CFTA 5HRLA 3JPOA 4UB4A 4RQ8A 4E8FA 8ICEA 5D4BA 5J2AA 4M9LA 3UPQA 5HRBA 4PHAA 4YD2A 2GA9D 4X4RA 4RQ0A 4FO6A 4RWNA 4GXJA 1MIYA 4F5PA 4GXKA 3RJIA 4X5VA 4K96A 2ZH4A 5DB7A 3NKUA 4WC5A 4RPZA 4JLZA 3TFSA 2PFQA 4LEWA 4M9HA 9ICQA 4QZFA 1ZQAA 1MIVA 4WQLA 3EF2A 4NLKA 2PBEA 4PPXA 3NWIA 4UB2A 4NXWA 8ICXA 5TZVA 4F5RA 1ZQWA 4Z6EA 3V7LA 3ERCC 9ICAA 9ICBA 4WQKA 1RPLA 4M9GA 4RWPA 4TUSA 1RZTA 3RJEA 4RQ2A 5CJ7A 9ICSA 4NM2A 4KLEA 4UD5A 4QZHA 1BPBA 5J2EA 3AQNA 1V4AA 2ZH6A 2O1PA 1ZQLA 4M2YA 2IUBA 3RH4A 3MDCA 5D63A 4RT3A 3AU6A 3OVBA 3RH5A 4F5QA 4NXTA 4YMMA 8ICNA 2ZH3A 4ATBA 3JPTA 1ZQSA 1ZQKA 9ICTA 3ISDA 2BCQA 3OUYB 3C2LA 2DR7A 4JWMA 1UETA 1F5AA 2P66A 4O5CA 4MF2A 4LEYA 1ZQXA 3MGHA 3AUOA 1KEJA 7ICIA 1TFWA 4MKPA 4QZAA 5HRKA 4R64A 4IG8A 3ER9B 1NOMA 2ISOA 4EEBA 4RQ7A 4GXIA 3RJFA 2ZH9A 4F5OA 4X4OA 4EEDA 4NKTA 7ICOA 4I28A 4NLZA 5J2KA 4O5KA 4LT6A 7ICQA 4M9JA 4AT7B 9ICLA 4I2IA 4KLMA 2FMQA 2IHOA 4TURA 1BPXA 3UQ0A 5HHHA 3CK6A 4WBZA 4X0BA 1BPYA 2BPFA 3UXPA 5IIJA 3V7JA 5HC9A 4IQTA 2FCLA 5DKWA 4I2GA 3K7DA 4P4MA 5IILA 4JWNA 4FH5A 7ICRA 8ICAA 7ICGA 7ICVA 5J0TA 4NKUA 4ATBB 2BCSA 2BE3A 1FA0A 4DOBA 3H3AA 4QZBA 3H39A 4NY8A 5J2HA 5CB1A 3C5FA 9ICHA 4R63A 4KLFA 1ZQZA 3MCRA 3WFQE
chains in the Genus database with same CATH topology
2B56A 3NKUA 4K98A 2IHOA 4LEYA 3ER8C 1GPJA 4JLZA 4LEVA 4NXUA 3PHZA 4K9AA 4JLXA 4K9BA 4FO1A 5D61A 4XJEA 4O67A 4MKPA 4LEWA 4HX0A 4K99A 2FCLA 4NXXA 2B51A 3ER9B 3K7DA 5CHEA 2B4VA 4WOYA 5B3PA 5CFTA 4K97A 4WQLA 5D63A 3EF2A 4LEZA 4OAGA 5CFUA 4O69A 4NXWA 5B3QA 3ERCC 4NXTA 4OAFA 4KM5A 4KB6A 4O68A 3OWGA 5CFSA 2GA9D 4WQKA 4N7RA 4O6AA 2GAFD 4OAIZ 4K8VA 2EWRA 4WH5A 4OAHA 4NXVA 5D62A 4K96A 3MCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFU A;  4HX0 A;  2FCL A;  2EWR A;  4WH5 A;  5CFT A;  4FO1 A;  4WQL A;  4XJE A;  4WQK A;  5CFS A; 
#chains in the Genus database with same CATH topology
 2B56 A;  4KLH A;  7ICJ A;  8ICC A;  5IIM A;  3AQK A;  4XQ8 A;  1ZQF A;  4EP7 A;  1ZQD A;  2PFN A;  8ICF A;  2NRK A;  4I2B A;  2BBH A;  7ICF A;  5DDM A;  4I2J A;  4YMN A;  8ICQ A;  1VFG A;  3UPS A;  3JPQ A;  4WC1 A;  4RQ4 A;  3UXO A;  4WCW A;  4YCX A;  1ZQH A;  1ZQR A;  4M5D A;  5DED A;  3AU2 A;  4R66 A;  8ICJ A;  4PH5 A;  3TFR A;  2BCU A;  2ID1 A;  4NXZ A;  4QZ9 A;  3PNC A;  4Z6C A;  4DOA A;  5HR9 A;  4XQ7 A;  1VJ7 A;  4KLU A;  4RWO A;  3ER8 C;  4M04 A;  3OUY A;  3UQ2 A;  4Z6F A;  3MBY A;  4QZI A;  4I2E A;  2M2U A;  4K99 A;  9ICM A;  1ZQU A;  7ICK A;  5DB8 A;  4X4S A;  4FHP A;  1KDH A;  3JCF A;  4LEZ A;  1ZQJ A;  4PHP A;  2ZHA A;  4I2H A;  7ICT A;  2O5A A;  2Q66 A;  1R8C A;  4UAY A;  4FHX A;  3GDX A;  5J2J A;  4KLQ A;  2VAN A;  2IHM A;  2GAF D;  3C66 A;  3JZ0 A;  4OAH A;  2DR9 A;  7ICP A;  5EOZ A;  4UAW A;  2HHP A;  1XSN A;  3JPP A;  3C18 A;  1ZQQ A;  4AT7 A;  3V7K A;  4QZ8 A;  5HRI A;  2PFP A;  4RWQ A;  4UB5 A;  4E80 A;  2B51 A;  9ICE A;  2DR5 A;  8ICY A;  7ICM A;  4AT9 B;  4KLT A;  5HHI A;  1BPE A;  1R89 A;  9ICU A;  1BPZ A;  4XRH A;  4M9N A;  4KM5 A;  2PXI A;  3RJG A;  4IQU A;  4WC6 A;  4TUP A;  8ICK A;  3V72 A;  4K4H A;  3HJ4 A;  3OVS A;  4O5E A;  1R8B A;  4AT8 A;  4KLG A;  4EGW A;  2DR8 A;  4NXV A;  4I2C A;  5D62 A;  1JN3 A;  3HW8 A;  4I2A A;  4PGQ A;  5DEC A;  1ZQT A;  4PGX A;  1WOT A;  4FO1 A;  4S3N A;  4KLS A;  4RQ1 A;  4YN4 A;  2M2W A;  5J0X A;  3PML A;  2DVI A;  8ICH A;  4QZC A;  4XA5 A;  7ICE A;  4YD1 A;  4PHD A;  4K4G A;  4KB6 A;  7ICS A;  5DBB A;  1ZQV A;  4K8V A;  2EWR A;  1KNY A;  5CA7 A;  4X4U A;  4P2H A;  4MFC A;  5J29 A;  1NO5 A;  3HJ1 A;  3C2M A;  5DBC A;  1ZQO A;  9ICR A;  4M47 A;  5HRG A;  3JPR A;  3PHZ A;  1ZQC A;  4QZD A;  1ZQG A;  4HX0 A;  1JMS A;  4KLD A;  2BPG A;  1ZQM A;  5CFU A;  4OAF A;  3NYB A;  4AT8 B;  5IIO A;  3WFO A;  5J2F A;  8ICI A;  3UXN A;  2GWS A;  4UAZ A;  2BCR A;  1JQR A;  1Q79 A;  4LZG A;  4WC2 A;  2ZH2 A;  3ISC A;  3MGI A;  1ZQP A;  4WOY A;  4P4P A;  5D49 A;  3LQC B;  4KLL A;  1TV9 A;  4X0A A;  7ICL A;  5J2C A;  4AT9 A;  4X4N A;  8ICG A;  8ICV A;  4EBJ A;  2M2V A;  1MIW A;  3B0Y A;  5F2V O;  2BCV A;  4O6A A;  1ZQY A;  2ISP A;  3RH6 A;  3JYY A;  3C2K A;  4I2F A;  4NXU A;  4FHW A;  4LEV A;  1UEU A;  1ZJM A;  3RJK A;  5D61 A;  2ZH7 A;  4RPX A;  5CHE A;  5CP2 A;  4DOC A;  4MF8 A;  5J2B A;  2PFO A;  5BOM A;  9ICI A;  8ICT A;  4P4O A;  4O68 A;  4QZG A;  3OWG A;  9ICG A;  4PHE A;  4X4P A;  7ICU A;  8ICL A;  9ICX A;  1XSL A;  2FMP A;  3RJH A;  1JAJ A;  3OV7 A;  2HN1 A;  1MQ3 A;  4IQV A;  4K98 A;  3HX0 A;  4RPY A;  5J2I A;  5J0R A;  4K9B A;  2ZH8 A;  5BOL A;  4MFF A;  4I29 A;  4R65 A;  3WFR E;  1MQ2 A;  5HRH A;  3C5G A;  4K97 A;  5DB9 A;  5J0W A;  1ZQN A;  4DO9 A;  5J0P A;  1ZQB A;  5CFS A;  5DB6 A;  3OVA A;  9ICN A;  5HRF A;  8ICR A;  9ICV A;  5BPC A;  4KLI A;  2ZH5 A;  8ICU A;  3H38 A;  4RT2 A;  4E7X A;  3MDA A;  7ICH A;  4UD4 A;  4O9M A;  4WC0 A;  3ISB A;  1GPJ A;  4WC4 A;  2BPC A;  4X4T A;  4YMO A;  4FHY A;  8ICM A;  5D46 A;  3AQM A;  5DDY A;  4FHV A;  4M0A A;  9ICO A;  2DRA A;  1ZJN A;  8ICZ A;  4I0U A;  8ICP A;  2BBJ A;  1HUZ A;  4X4V A;  4NM1 A;  5B3Q A;  5CR0 A;  5HRE A;  4UB1 A;  4KLJ A;  1HUO A;  4F5N A;  4QZE A;  2FMS A;  4LZD A;  1ZQI A;  4KLO A;  4K4I A;  1R8A A;  4XUS A;  2HN2 A;  4PGY A;  4FH3 A;  3K75 D;  3NVO A;  4O67 A;  2RFF A;  5JTG A;  4EBK A;  2M2T A;  7ICN A;  2W9M A;  5J2D A;  5J0S A;  2B4V A;  5B3P A;  8ICB A;  2DRB A;  1PX5 A;  3LK9 A;  4OAG A;  9ICC A;  4O69 A;  1Q78 A;  4X4Q A;  5IIN A;  5J0Q A;  4NLN A;  8ICS A;  9ICP A;  3HWT A;  4OAI Z;  5DBA A;  9ICK A;  5HRD A;  1OU5 A;  4MFA A;  5J0U A;  5III A;  4UBB A;  2ZH1 A;  3PMN A;  4UBC A;  4IQW A;  3RJJ A;  4XJE A;  1YLQ A;  9ICW A;  5CWR A;  4WC7 A;  5IIK A;  1XSP A;  8ICW A;  1BPD A;  1ZQE A;  4I27 A;  4WBY A;  9ICJ A;  3JPS A;  3WFP A;  3JPN A;  4RQ3 A;  4WC3 A;  1TFY A;  4TUQ A;  4EV6 A;  4LVS A;  1UEV A;  5CHG A;  4N7R A;  4WH5 A;  4RQ5 A;  5J0Y A;  8ICO A;  3WFS C;  1TVA A;  3AQL A;  9ICF A;  5J0O A;  3H37 A;  5J2G A;  2ZHB A;  4K9A A;  4JLX A;  3B0X A;  2I9G A;  4I2D A;  4UB3 A;  3L9D A;  4RQ6 A;  4NXX A;  3OGU A;  3HIY A;  4Z6D A;  5CFT A;  5HRL A;  3JPO A;  4UB4 A;  4RQ8 A;  4E8F A;  8ICE A;  5D4B A;  5J2A A;  4M9L A;  3UPQ A;  5HRB A;  4PHA A;  4YD2 A;  2GA9 D;  4X4R A;  4RQ0 A;  4FO6 A;  4RWN A;  4GXJ A;  1MIY A;  4F5P A;  4GXK A;  3RJI A;  4X5V A;  4K96 A;  2ZH4 A;  5DB7 A;  3NKU A;  4WC5 A;  4RPZ A;  4JLZ A;  3TFS A;  2PFQ A;  4LEW A;  4M9H A;  9ICQ A;  4QZF A;  1ZQA A;  1MIV A;  4WQL A;  3EF2 A;  4NLK A;  2PBE A;  4PPX A;  3NWI A;  4UB2 A;  4NXW A;  8ICX A;  5TZV A;  4F5R A;  1ZQW A;  4Z6E A;  3V7L A;  3ERC C;  9ICA A;  9ICB A;  4WQK A;  1RPL A;  4M9G A;  4RWP A;  4TUS A;  1RZT A;  3RJE A;  4RQ2 A;  5CJ7 A;  9ICS A;  4NM2 A;  4KLE A;  4UD5 A;  4QZH A;  1BPB A;  5J2E A;  3AQN A;  1V4A A;  2ZH6 A;  2O1P A;  1ZQL A;  4M2Y A;  2IUB A;  3RH4 A;  3MDC A;  5D63 A;  4RT3 A;  3AU6 A;  3OVB A;  3RH5 A;  4F5Q A;  4NXT A;  4YMM A;  8ICN A;  2ZH3 A;  4ATB A;  3JPT A;  1ZQS A;  1ZQK A;  9ICT A;  3ISD A;  2BCQ A;  3OUY B;  3C2L A;  2DR7 A;  4JWM A;  1UET A;  1F5A A;  2P66 A;  4O5C A;  4MF2 A;  4LEY A;  1ZQX A;  3MGH A;  3AUO A;  1KEJ A;  7ICI A;  1TFW A;  4MKP A;  4QZA A;  5HRK A;  4R64 A;  4IG8 A;  3ER9 B;  1NOM A;  2ISO A;  4EEB A;  4RQ7 A;  4GXI A;  3RJF A;  2ZH9 A;  4F5O A;  4X4O A;  4EED A;  4NKT A;  7ICO A;  4I28 A;  4NLZ A;  5J2K A;  4O5K A;  4LT6 A;  7ICQ A;  4M9J A;  4AT7 B;  9ICL A;  4I2I A;  4KLM A;  2FMQ A;  2IHO A;  4TUR A;  1BPX A;  3UQ0 A;  5HHH A;  3CK6 A;  4WBZ A;  4X0B A;  1BPY A;  2BPF A;  3UXP A;  5IIJ A;  3V7J A;  5HC9 A;  4IQT A;  2FCL A;  5DKW A;  4I2G A;  3K7D A;  4P4M A;  5IIL A;  4JWN A;  4FH5 A;  7ICR A;  8ICA A;  7ICG A;  7ICV A;  5J0T A;  4NKU A;  4ATB B;  2BCS A;  2BE3 A;  1FA0 A;  4DOB A;  3H3A A;  4QZB A;  3H39 A;  4NY8 A;  5J2H A;  5CB1 A;  3C5F A;  9ICH A;  4R63 A;  4KLF A;  1ZQZ A;  3MCR A;  3WFQ E; 
#chains in the Genus database with same CATH homology
 2B56 A;  3NKU A;  4K98 A;  2IHO A;  4LEY A;  3ER8 C;  1GPJ A;  4JLZ A;  4LEV A;  4NXU A;  3PHZ A;  4K9A A;  4JLX A;  4K9B A;  4FO1 A;  5D61 A;  4XJE A;  4O67 A;  4MKP A;  4LEW A;  4HX0 A;  4K99 A;  2FCL A;  4NXX A;  2B51 A;  3ER9 B;  3K7D A;  5CHE A;  2B4V A;  4WOY A;  5B3P A;  5CFT A;  4K97 A;  4WQL A;  5D63 A;  3EF2 A;  4LEZ A;  4OAG A;  5CFU A;  4O69 A;  4NXW A;  5B3Q A;  3ERC C;  4NXT A;  4OAF A;  4KM5 A;  4KB6 A;  4O68 A;  3OWG A;  5CFS A;  2GA9 D;  4WQK A;  4N7R A;  4O6A A;  2GAF D;  4OAI Z;  4K8V A;  2EWR A;  4WH5 A;  4OAH A;  4NXV A;  5D62 A;  4K96 A;  3MCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...