4WH5A

Crystal structure of lincosamide antibiotic adenylyltransferase lnua, lincomycin-bound
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
NNVTEKELFYILDLFEHMKVTYWLDGGWGVDVLTGKQQREHRDIDIDFDAQHTQKVIQKLEDIGYKIEVHWMPSRMELKHEEYGYLDIHPINLNDDGSITQANPEGGNYVFQNDWFSETNYKDRKIPCISKEAQLLFHSGYDLTETDHFDIKNLKSIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lincosamide resistance protein
publication title CRYSTAL STRUCTURE OF LINCOSAMIDE ANTIBIOTIC ADENYLYLTRANSFERASE LNUA, LINCOMYCIN BOUND
rcsb
source organism Staphylococcus haemolyticus
molecule tags Transferase/antibiotic
total genus 46
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4wh5A00
2FCLA 4HX0A 5CFSA 4XJEA 4WH5A 4FO1A 5CFTA 5CFUA 4WQKA 2EWRA 4WQLA
chains in the Genus database with same CATH superfamily
4ATBA 5CR0A 9ICJA 2DRBA 4O5KA 4LZDA 7ICUA 1YLQA 4M2YA 1GPJA 4KLIA 1MQ2A 4WC0A 5D62A 3ISBA 5DB9A 3AUOA 4EEDA 7ICJA 4X4PA 3EF2A 4OAIZ 3NWIA 2BCSA 4AT9A 4X4NA 8ICMA 7ICTA 4M9JA 7ICOA 4K96A 4KLHA 4RT3A 4Z6DA 2ZHAA 4NKUA 1ZQNA 2ZH7A 7ICEA 4NLNA 5EOZA 4PHPA 4RT2A 4NXUA 4LVSA 4AT8A 7ICPA 2ZH4A 1ZQSA 8ICNA 4FH5A 4PHAA 3RJJA 3HWTA 1ZQPA 7ICNA 4M9NA 4O5CA 2DR5A 4PPXA 4NLKA 3B0XA 4NKTA 2ZH6A 4KLMA 2IHOA 5J2CA 3JPQA 1ZQDA 1BPEA 9ICQA 1VJ7A 1TV9A 4X0BA 2ZH8A 9ICPA 2BPGA 4NXXA 7ICGA 2PFPA 4K8VA 3JPSA 3GDXA 5HREA 3ISDA 4WCWA 5BOLA 5J0PA 3RJIA 4LEYA 8ICJA 5J2IA 7ICVA 4O6AA 5J0SA 3UXPA 3UQ2A 3RH5A 4QZGA 4O5EA 4P4OA 4UAWA 4FHPA 3NKUA 4DOAA 2DRAA 3OUYA 3OVSA 2GWSA 1BPDA 3MGHA 7ICHA 5IIMA 4RQ1A 9ICSA 3OV7A 1UEUA 3V7JA 4X4OA 4YMOA 5CFUA 4R66A 5CB1A 4FHVA 1KNYA 4UD5A 3C18A 1UEVA 3JCFA 3B0YA 1ZQFA 3LK9A 1RZTA 3C5GA 1ZQTA 4X0AA 3MGIA 8ICAA 5J2BA 4RWQA 1R8BA 5CHGA 4QZ8A 4RQ6A 3JPRA 3UXOA 7ICKA 5CP2A 1ZQZA 4K98A 1ZJMA 2GA9D 5DB7A 4RQ8A 3RJFA 4AT7B 2DVIA 5J0QA 4GXIA 4QZAA 4WQLA 4I2AA 4FHYA 4XRHA 4JWNA 4IQVA 2P66A 5B3PA 4P4MA 3PMLA 3MBYA 1WOTA 5J0RA 2M2WA 5D46A 4IQTA 1ZQRA 5J0XA 2BCVA 2W9MA 4I2DA 4YN4A 3HJ4A 2PFNA 1ZQGA 2DR8A 4K97A 4RWOA 5BPCA 2EWRA 1ZJNA 4RQ5A 4Z6EA 4O67A 3H39A 1BPXA 3HIYA 4NXVA 2ZH1A 9ICNA 4Z6CA 5HRGA 4FH3A 1OU5A 9ICTA 1JMSA 3JPPA 5HRFA 3WFSC 4X4UA 5CHEA 4NXTA 5D49A 5D63A 1ZQEA 7ICMA 5D61A 3HW8A 7ICFA 5HRKA 3WFQE 4X5VA 2BPFA 2PFQA 5TZVA 8ICUA 3V7LA 1HUOA 4FO1A 1TFWA 5J2EA 4IQWA 4R65A 8ICQA 1MQ3A 8ICRA 4KLQA 8ICSA 9ICFA 1MIWA 3RH6A 4I2CA 8ICKA 1NOMA 3UXNA 4KLTA 3ISCA 4RQ2A 5J0WA 4TURA 8ICPA 4PGQA 4E8FA 2B4VA 7ICLA 5HHIA 4KLLA 4I0UA 1XSLA 2I9GA 3H38A 3TFSA 2DR7A 4QZCA 5J2JA 4YD2A 4UD4A 3JPNA 3V7KA 4WOYA 4KLSA 4R63A 4UBCA 4Z6FA 4AT7A 1ZQVA 1JQRA 4O68A 5CFTA 4X4VA 8ICCA 1ZQQA 4YMMA 3RJGA 4X4QA 5F2VO 4EEBA 8ICIA 4E80A 5IILA 4OAHA 4M9HA 4KM5A 5J2DA 1ZQXA 2B51A 2FCLA 4YCXA 5DKWA 5J2GA 2M2TA 7ICSA 4UB1A 4N7RA 2M2UA 3JYYA 4LT6A 3HJ1A 4XQ8A 1FA0A 2ISOA 5IIOA 5JTGA 3V72A 3K75D 3AU2A 2BCRA 4KLGA 3UQ0A 4MF2A 4WC3A 5DEDA 4UB2A 2Q66A 5HRLA 4QZIA 2ISPA 3AQMA 5J2FA 5IIJA 4TUPA 4F5OA 3ER9B 3HX0A 4YMNA 4OAGA 2ID1A 4QZHA 5D4BA 1ZQUA 9ICOA 5CJ7A 4RWPA 8ICZA 4WQKA 5J2AA 4KB6A 4WC5A 1TVAA 3OGUA 9ICRA 4X4SA 2ZH3A 3C2KA 9ICLA 2ZH5A 4DOBA 4P2HA 4RQ7A 1ZQCA 9ICCA 4O9MA 1MIYA 2GAFD 4F5QA 4RPZA 4WC4A 3H37A 2RFFA 5IIKA 2PXIA 8ICBA 1KEJA 9ICEA 3C66A 4NM1A 2ZHBA 5J29A 4I2EA 1ZQWA 4GXJA 4M47A 3K7DA 1JAJA 1ZQHA 3JPTA 4QZBA 4NXWA 2IUBA 4WC7A 3OWGA 1HUZA 3AQNA 2ZH9A 4K4GA 4F5PA 4K4IA 4I2JA 4I2GA 4UB4A 4X4TA 9ICMA 4WBYA 3ERCC 3C5FA 4LEZA 8ICWA 9ICHA 4K9AA 3AQLA 8ICYA 4OAFA 4LEVA 5J2HA 3OVBA 5HRHA 4K99A 4MFAA 4F5NA 4F5RA 1TFYA 2O1PA 4I2HA 1BPYA 4IG8A 2BBJA 3PHZA 2NRKA 3NYBA 4M9LA 1F5AA 1UETA 5DDMA 5DECA 4KLUA 1KDHA 4IQUA 5BOMA 4DOCA 1ZQOA 8ICEA 4I2FA 5HR9A 5DB6A 5B3QA 4MF8A 1ZQMA 4M9GA 4FHWA 2HN1A 9ICKA 3RJHA 3C2MA 4PGYA 4I2BA 4MFFA 3ER8C 2BCQA 4HX0A 4RQ3A 7ICQA 4WH5A 4KLEA 1XSPA 2DR9A 3MCRA 4JLXA 8ICHA 4FO6A 4E7XA 4RPXA 2M2VA 3H3AA 8ICLA 1ZQKA 5HRBA 2VANA 4RPYA 4WC6A 1VFGA 1R8AA 4RQ0A 7ICIA 4RQ4A 4JWMA 4QZFA 4XUSA 4UAYA 4UBBA 4I29A 4QZDA 5CFSA 9ICXA 5CWRA 4EBKA 4PHEA 2B56A 8ICTA 2FMSA 4EGWA 1ZQIA 3PNCA 4EBJA 4PH5A 3MDCA 9ICIA 4O69A 2O5AA 3JZ0A 4P4PA 2HHPA 9ICVA 3L9DA 4K9BA 3NVOA 4NLZA 4M5DA 4KLFA 4I27A 5J0TA 9ICWA 5DBCA 4ATBB 2ZH2A 1MIVA 4UB5A 4M04A 3AU6A 3RH4A 4EP7A 2FMQA 1ZQAA 4QZ9A 3OVAA 4I2IA 4X4RA 4GXKA 2HN2A 3TFRA 2BPCA 4DO9A 3WFRE 4KLJA 5J0YA 3UPQA 5HRDA 5DBBA 2BCUA 4YD1A 4R64A 1ZQYA 4UB3A 1Q78A 1Q79A 5IIIA 4XJEA 4QZEA 4K4HA 1PX5A 4AT9B 2PFOA 5HRIA 4RWNA 4XQ7A 5HHHA 5DBAA 3RJKA 4NY8A 1ZQLA 2PBEA 3MDAA 9ICAA 5J2KA 1NO5A 5J0UA 5J0OA 4AT8B 3CK6A 1BPZA 4I28A 1ZQBA 1V4AA 2FMPA 1JN3A 8ICOA 9ICBA 7ICRA 3JPOA 8ICGA 5CA7A 1BPBA 4PGXA 4M0AA 4KLDA 4PHDA 2BE3A 1R8CA 4WC2A 1XSNA 1R89A 3RJEA 1ZQJA 3WFOA 3UPSA 3C2LA 2IHMA 5HC9A 4NM2A 4FHXA 4KLOA 8ICVA 4WC1A 4LZGA 9ICGA 4TUQA 4UAZA 4JLZA 2BBHA 4MFCA 4S3NA 4MKPA 8ICXA 4XA5A 5DB8A 5DDYA 4EV6A 3OUYB 4LEWA 5IINA 4NXZA 3AQKA 1RPLA 3WFPA 4WBZA 4TUSA 3LQCB 3PMNA 9ICUA 8ICFA
chains in the Genus database with same CATH topology
4NXXA 4K96A 5D61A 4OAHA 2B4VA 4K8VA 3ERCC 4KM5A 5B3QA 2GAFD 4LEZA 4LEYA 2B51A 2FCLA 4K9AA 4O6AA 5CFSA 4OAFA 4LEVA 3ER9B 2B56A 4OAGA 4K97A 4K99A 4FO1A 3ER8C 4NXUA 4WOYA 2EWRA 4N7RA 4K98A 2GA9D 1GPJA 4O69A 4JLZA 4HX0A 4O67A 3K7DA 4WH5A 3NKUA 4MKPA 5D62A 4JLXA 3MCRA 3PHZA 4O68A 4WQKA 4LEWA 4KB6A 4WQLA 4NXWA 4NXVA 5CFTA 3OWGA 4K9BA 3EF2A 4XJEA 2IHOA 4OAIZ 5CFUA 5CHEA 4NXTA 5B3PA 5D63A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCL A;  4HX0 A;  5CFS A;  4XJE A;  4WH5 A;  4FO1 A;  5CFT A;  5CFU A;  4WQK A;  2EWR A;  4WQL A; 
#chains in the Genus database with same CATH topology
 4ATB A;  5CR0 A;  9ICJ A;  2DRB A;  4O5K A;  4LZD A;  7ICU A;  1YLQ A;  4M2Y A;  1GPJ A;  4KLI A;  1MQ2 A;  4WC0 A;  5D62 A;  3ISB A;  5DB9 A;  3AUO A;  4EED A;  7ICJ A;  4X4P A;  3EF2 A;  4OAI Z;  3NWI A;  2BCS A;  4AT9 A;  4X4N A;  8ICM A;  7ICT A;  4M9J A;  7ICO A;  4K96 A;  4KLH A;  4RT3 A;  4Z6D A;  2ZHA A;  4NKU A;  1ZQN A;  2ZH7 A;  7ICE A;  4NLN A;  5EOZ A;  4PHP A;  4RT2 A;  4NXU A;  4LVS A;  4AT8 A;  7ICP A;  2ZH4 A;  1ZQS A;  8ICN A;  4FH5 A;  4PHA A;  3RJJ A;  3HWT A;  1ZQP A;  7ICN A;  4M9N A;  4O5C A;  2DR5 A;  4PPX A;  4NLK A;  3B0X A;  4NKT A;  2ZH6 A;  4KLM A;  2IHO A;  5J2C A;  3JPQ A;  1ZQD A;  1BPE A;  9ICQ A;  1VJ7 A;  1TV9 A;  4X0B A;  2ZH8 A;  9ICP A;  2BPG A;  4NXX A;  7ICG A;  2PFP A;  4K8V A;  3JPS A;  3GDX A;  5HRE A;  3ISD A;  4WCW A;  5BOL A;  5J0P A;  3RJI A;  4LEY A;  8ICJ A;  5J2I A;  7ICV A;  4O6A A;  5J0S A;  3UXP A;  3UQ2 A;  3RH5 A;  4QZG A;  4O5E A;  4P4O A;  4UAW A;  4FHP A;  3NKU A;  4DOA A;  2DRA A;  3OUY A;  3OVS A;  2GWS A;  1BPD A;  3MGH A;  7ICH A;  5IIM A;  4RQ1 A;  9ICS A;  3OV7 A;  1UEU A;  3V7J A;  4X4O A;  4YMO A;  5CFU A;  4R66 A;  5CB1 A;  4FHV A;  1KNY A;  4UD5 A;  3C18 A;  1UEV A;  3JCF A;  3B0Y A;  1ZQF A;  3LK9 A;  1RZT A;  3C5G A;  1ZQT A;  4X0A A;  3MGI A;  8ICA A;  5J2B A;  4RWQ A;  1R8B A;  5CHG A;  4QZ8 A;  4RQ6 A;  3JPR A;  3UXO A;  7ICK A;  5CP2 A;  1ZQZ A;  4K98 A;  1ZJM A;  2GA9 D;  5DB7 A;  4RQ8 A;  3RJF A;  4AT7 B;  2DVI A;  5J0Q A;  4GXI A;  4QZA A;  4WQL A;  4I2A A;  4FHY A;  4XRH A;  4JWN A;  4IQV A;  2P66 A;  5B3P A;  4P4M A;  3PML A;  3MBY A;  1WOT A;  5J0R A;  2M2W A;  5D46 A;  4IQT A;  1ZQR A;  5J0X A;  2BCV A;  2W9M A;  4I2D A;  4YN4 A;  3HJ4 A;  2PFN A;  1ZQG A;  2DR8 A;  4K97 A;  4RWO A;  5BPC A;  2EWR A;  1ZJN A;  4RQ5 A;  4Z6E A;  4O67 A;  3H39 A;  1BPX A;  3HIY A;  4NXV A;  2ZH1 A;  9ICN A;  4Z6C A;  5HRG A;  4FH3 A;  1OU5 A;  9ICT A;  1JMS A;  3JPP A;  5HRF A;  3WFS C;  4X4U A;  5CHE A;  4NXT A;  5D49 A;  5D63 A;  1ZQE A;  7ICM A;  5D61 A;  3HW8 A;  7ICF A;  5HRK A;  3WFQ E;  4X5V A;  2BPF A;  2PFQ A;  5TZV A;  8ICU A;  3V7L A;  1HUO A;  4FO1 A;  1TFW A;  5J2E A;  4IQW A;  4R65 A;  8ICQ A;  1MQ3 A;  8ICR A;  4KLQ A;  8ICS A;  9ICF A;  1MIW A;  3RH6 A;  4I2C A;  8ICK A;  1NOM A;  3UXN A;  4KLT A;  3ISC A;  4RQ2 A;  5J0W A;  4TUR A;  8ICP A;  4PGQ A;  4E8F A;  2B4V A;  7ICL A;  5HHI A;  4KLL A;  4I0U A;  1XSL A;  2I9G A;  3H38 A;  3TFS A;  2DR7 A;  4QZC A;  5J2J A;  4YD2 A;  4UD4 A;  3JPN A;  3V7K A;  4WOY A;  4KLS A;  4R63 A;  4UBC A;  4Z6F A;  4AT7 A;  1ZQV A;  1JQR A;  4O68 A;  5CFT A;  4X4V A;  8ICC A;  1ZQQ A;  4YMM A;  3RJG A;  4X4Q A;  5F2V O;  4EEB A;  8ICI A;  4E80 A;  5IIL A;  4OAH A;  4M9H A;  4KM5 A;  5J2D A;  1ZQX A;  2B51 A;  2FCL A;  4YCX A;  5DKW A;  5J2G A;  2M2T A;  7ICS A;  4UB1 A;  4N7R A;  2M2U A;  3JYY A;  4LT6 A;  3HJ1 A;  4XQ8 A;  1FA0 A;  2ISO A;  5IIO A;  5JTG A;  3V72 A;  3K75 D;  3AU2 A;  2BCR A;  4KLG A;  3UQ0 A;  4MF2 A;  4WC3 A;  5DED A;  4UB2 A;  2Q66 A;  5HRL A;  4QZI A;  2ISP A;  3AQM A;  5J2F A;  5IIJ A;  4TUP A;  4F5O A;  3ER9 B;  3HX0 A;  4YMN A;  4OAG A;  2ID1 A;  4QZH A;  5D4B A;  1ZQU A;  9ICO A;  5CJ7 A;  4RWP A;  8ICZ A;  4WQK A;  5J2A A;  4KB6 A;  4WC5 A;  1TVA A;  3OGU A;  9ICR A;  4X4S A;  2ZH3 A;  3C2K A;  9ICL A;  2ZH5 A;  4DOB A;  4P2H A;  4RQ7 A;  1ZQC A;  9ICC A;  4O9M A;  1MIY A;  2GAF D;  4F5Q A;  4RPZ A;  4WC4 A;  3H37 A;  2RFF A;  5IIK A;  2PXI A;  8ICB A;  1KEJ A;  9ICE A;  3C66 A;  4NM1 A;  2ZHB A;  5J29 A;  4I2E A;  1ZQW A;  4GXJ A;  4M47 A;  3K7D A;  1JAJ A;  1ZQH A;  3JPT A;  4QZB A;  4NXW A;  2IUB A;  4WC7 A;  3OWG A;  1HUZ A;  3AQN A;  2ZH9 A;  4K4G A;  4F5P A;  4K4I A;  4I2J A;  4I2G A;  4UB4 A;  4X4T A;  9ICM A;  4WBY A;  3ERC C;  3C5F A;  4LEZ A;  8ICW A;  9ICH A;  4K9A A;  3AQL A;  8ICY A;  4OAF A;  4LEV A;  5J2H A;  3OVB A;  5HRH A;  4K99 A;  4MFA A;  4F5N A;  4F5R A;  1TFY A;  2O1P A;  4I2H A;  1BPY A;  4IG8 A;  2BBJ A;  3PHZ A;  2NRK A;  3NYB A;  4M9L A;  1F5A A;  1UET A;  5DDM A;  5DEC A;  4KLU A;  1KDH A;  4IQU A;  5BOM A;  4DOC A;  1ZQO A;  8ICE A;  4I2F A;  5HR9 A;  5DB6 A;  5B3Q A;  4MF8 A;  1ZQM A;  4M9G A;  4FHW A;  2HN1 A;  9ICK A;  3RJH A;  3C2M A;  4PGY A;  4I2B A;  4MFF A;  3ER8 C;  2BCQ A;  4HX0 A;  4RQ3 A;  7ICQ A;  4WH5 A;  4KLE A;  1XSP A;  2DR9 A;  3MCR A;  4JLX A;  8ICH A;  4FO6 A;  4E7X A;  4RPX A;  2M2V A;  3H3A A;  8ICL A;  1ZQK A;  5HRB A;  2VAN A;  4RPY A;  4WC6 A;  1VFG A;  1R8A A;  4RQ0 A;  7ICI A;  4RQ4 A;  4JWM A;  4QZF A;  4XUS A;  4UAY A;  4UBB A;  4I29 A;  4QZD A;  5CFS A;  9ICX A;  5CWR A;  4EBK A;  4PHE A;  2B56 A;  8ICT A;  2FMS A;  4EGW A;  1ZQI A;  3PNC A;  4EBJ A;  4PH5 A;  3MDC A;  9ICI A;  4O69 A;  2O5A A;  3JZ0 A;  4P4P A;  2HHP A;  9ICV A;  3L9D A;  4K9B A;  3NVO A;  4NLZ A;  4M5D A;  4KLF A;  4I27 A;  5J0T A;  9ICW A;  5DBC A;  4ATB B;  2ZH2 A;  1MIV A;  4UB5 A;  4M04 A;  3AU6 A;  3RH4 A;  4EP7 A;  2FMQ A;  1ZQA A;  4QZ9 A;  3OVA A;  4I2I A;  4X4R A;  4GXK A;  2HN2 A;  3TFR A;  2BPC A;  4DO9 A;  3WFR E;  4KLJ A;  5J0Y A;  3UPQ A;  5HRD A;  5DBB A;  2BCU A;  4YD1 A;  4R64 A;  1ZQY A;  4UB3 A;  1Q78 A;  1Q79 A;  5III A;  4XJE A;  4QZE A;  4K4H A;  1PX5 A;  4AT9 B;  2PFO A;  5HRI A;  4RWN A;  4XQ7 A;  5HHH A;  5DBA A;  3RJK A;  4NY8 A;  1ZQL A;  2PBE A;  3MDA A;  9ICA A;  5J2K A;  1NO5 A;  5J0U A;  5J0O A;  4AT8 B;  3CK6 A;  1BPZ A;  4I28 A;  1ZQB A;  1V4A A;  2FMP A;  1JN3 A;  8ICO A;  9ICB A;  7ICR A;  3JPO A;  8ICG A;  5CA7 A;  1BPB A;  4PGX A;  4M0A A;  4KLD A;  4PHD A;  2BE3 A;  1R8C A;  4WC2 A;  1XSN A;  1R89 A;  3RJE A;  1ZQJ A;  3WFO A;  3UPS A;  3C2L A;  2IHM A;  5HC9 A;  4NM2 A;  4FHX A;  4KLO A;  8ICV A;  4WC1 A;  4LZG A;  9ICG A;  4TUQ A;  4UAZ A;  4JLZ A;  2BBH A;  4MFC A;  4S3N A;  4MKP A;  8ICX A;  4XA5 A;  5DB8 A;  5DDY A;  4EV6 A;  3OUY B;  4LEW A;  5IIN A;  4NXZ A;  3AQK A;  1RPL A;  3WFP A;  4WBZ A;  4TUS A;  3LQC B;  3PMN A;  9ICU A;  8ICF A; 
#chains in the Genus database with same CATH homology
 4NXX A;  4K96 A;  5D61 A;  4OAH A;  2B4V A;  4K8V A;  3ERC C;  4KM5 A;  5B3Q A;  2GAF D;  4LEZ A;  4LEY A;  2B51 A;  2FCL A;  4K9A A;  4O6A A;  5CFS A;  4OAF A;  4LEV A;  3ER9 B;  2B56 A;  4OAG A;  4K97 A;  4K99 A;  4FO1 A;  3ER8 C;  4NXU A;  4WOY A;  2EWR A;  4N7R A;  4K98 A;  2GA9 D;  1GPJ A;  4O69 A;  4JLZ A;  4HX0 A;  4O67 A;  3K7D A;  4WH5 A;  3NKU A;  4MKP A;  5D62 A;  4JLX A;  3MCR A;  3PHZ A;  4O68 A;  4WQK A;  4LEW A;  4KB6 A;  4WQL A;  4NXW A;  4NXV A;  5CFT A;  3OWG A;  4K9B A;  3EF2 A;  4XJE A;  2IHO A;  4OAI Z;  5CFU A;  5CHE A;  4NXT A;  5B3P A;  5D63 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...