4FH3A

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 112
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fh3A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fh3A02
4RPYA 2BPFA 4QZHA 3C66A 5J2CA 2PFQA 3RH6A 4I2BA 5DDMA 5DECA 2BCQA 1MIVA 1FA0A 8ICPA 3V7JA 8ICCA 4GXIA 4O5EA 4ATBB 3UPSA 4EBKA 4NKUA 2FMPA 7ICTA 9ICQA 8ICKA 8ICRA 4RQ6A 4X4RA 9ICSA 1MQ3A 4X4PA 3JPQA 2B4VA 1ZQEA 3AQMA 3H37A 4X4SA 4R64A 2BCVA 3WFRE 3JZ0A 4Z6EA 4QZGA 4PHEA 4IQTA 5DBBA 3MDCA 4KLEA 8ICMA 9ICXA 4KLLA 4RT3A 4RQ8A 2P66A 3OVBA 4NM1A 4NLKA 2VANA 9ICIA 5D49A 4UD5A 2ZH8A 3JPSA 2DR9A 1RPLA 2BCRA 4X5VA 4X4UA 3UXNA 1ZQLA 7ICMA 2ZH9A 1ZQQA 9ICTA 4AT8A 4P2HA 1TFWA 9ICBA 5DEDA 7ICFA 1YLQA 4WC1A 4KLHA 5HR9A 4NLNA 3H39A 4X4NA 2BCSA 1HUOA 4I2AA 4M9NA 4RQ3A 4M9LA 1ZQAA 5HRKA 4RT2A 5HRFA 5HREA 9ICRA 4QZ8A 3MGIA 5IIIA 3B0YA 4QZDA 3HWTA 5HRDA 4AT8B 4MF2A 4X0BA 4M9HA 3JPOA 4WC4A 3RJKA 1UETA 4X4OA 1PX5A 9ICJA 3B0XA 4PHPA 8ICFA 5D46A 5J0PA 4RWPA 4M9GA 4MFFA 7ICPA 9ICNA 7ICVA 3WFSC 3JPPA 4UB5A 3AUOA 3WFPA 5J2EA 3HJ1A 1R89A 3RJGA 2GWSA 5J0OA 4WC5A 1NO5A 4R63A 7ICOA 2I9GA 4XRHA 7ICLA 3OGUA 1NOMA 2W9MA 8ICEA 5HRIA 4UBBA 9ICEA 4I2HA 2DVIA 9ICOA 4FHPA 4LZGA 3C5FA 8ICWA 4I2IA 1MIYA 4WBZA 3TFRA 4PHDA 3HW8A 4PHAA 5DB7A 3V72A 3C2KA 4FHWA 4KLSA 4QZ9A 4TUQA 1HUZA 1Q79A 1ZQZA 4WCWA 3UXOA 5J0WA 9ICMA 8ICZA 4YN4A 2ZH1A 3AQLA 4DOBA 1ZQJA 1ZJNA 1BPBA 7ICHA 4MF8A 2BPGA 4AT7A 5J0YA 3ISDA 1VJ7A 4P4OA 4UAZA 2DR8A 4I2GA 4KLJA 4Z6DA 4RQ5A 4KLTA 3MDAA 2ZH4A 5J0QA 4E7XA 3RJHA 2PXIA 4AT7B 4PGXA 5J2HA 4NM2A 5J2JA 3ISBA 8ICLA 5CB1A 2PFPA 4QZIA 4UB1A 4DO9A 3OVSA 2FMQA 4F5OA 1UEUA 3K75D 4RQ0A 4PGQA 1JN3A 3JYYA 1ZQWA 4RQ1A 2M2VA 1MQ2A 5HRHA 1ZQVA 4F5QA 4WC2A 1JQRA 5HRGA 2ZH7A 2NRKA 9ICLA 8ICVA 3AQNA 4DOAA 1ZQIA 4KLGA 3AQKA 5J2FA 5HHIA 4RQ7A 1WOTA 2ZH6A 8ICIA 5J2IA 8ICXA 8ICTA 9ICHA 3JPRA 4I28A 2B56A 2PFOA 4QZAA 4IQUA 4RPZA 2O1PA 4YD2A 8ICSA 3PMNA 9ICVA 1BPYA 4FHVA 4F5PA 3LK9A 5CP2A 5HHHA 4DOCA 1ZQDA 4QZEA 1ZQHA 4I2FA 4XA5A 4F5RA 4UAYA 9ICWA 4O9MA 4KLOA 3V7LA 3L9DA 5BOLA 4WC6A 2ID1A 2FMSA 4YCXA 1ZQUA 2ZH5A 9ICCA 4M9JA 4I2JA 2ZH3A 1R8BA 1ZQFA 4X4VA 4K4HA 2DRAA 1R8AA 1ZQCA 2DR7A 4JWNA 3H3AA 3HJ4A 4RQ2A 4UB4A 3C2MA 4NY8A 3HIYA 4M2YA 1ZJMA 2O5AA 3RH5A 1JAJA 2B51A 2M2TA 4WC0A 5DBCA 3ISCA 4YMMA 4KLUA 4R65A 2BPCA 4I2EA 5CJ7A 5IIKA 7ICEA 4X4QA 5J0RA 4P4MA 4MFCA 1BPZA 4IQVA 4K4GA 4RWQA 4RQ4A 3MBYA 2HHPA 2RFFA 4E8FA 4X4TA 1ZQTA 5D4BA 4UAWA 3PMLA 4KLDA 2Q66A 4IQWA 5CHGA 7ICKA 4NXZA 4UB3A 5CR0A 4R66A 8ICNA 3RJJA 5DKWA 9ICFA 4NLZA 4F5NA 3OUYA 3UQ0A 8ICHA 1Q78A 3NYBA 2ZH2A 4I2DA 5IIJA 2ZHAA 4I27A 4KLFA 8ICYA 1BPEA 7ICSA 4Z6FA 2BCUA 5HRLA 4TUSA 3UPQA 1KNYA 1ZQGA 1RZTA 4UB2A 3OUYB 1UEVA 5DB8A 3HX0A 4Z6CA 4FHXA 1JMSA 5DB6A 5J0UA 3H38A 5BOMA 1ZQRA 1TV9A 5HRBA 1XSNA 2IHMA 3UXPA 4PPXA 5J29A 5TZVA 3UQ2A 4O5CA 4M04A 7ICGA 3C18A 4TUPA 1ZQYA 5DB9A 7ICQA 5DDYA 8ICQA 1TFYA 3C5GA 4PGYA 8ICGA 1R8CA 1ZQOA 7ICIA 4RWNA 8ICJA 4E80A 3AU6A 4WC3A 1KDHA 5IILA 4KLIA 3MGHA 1OU5A 4X0AA 4JWMA 1ZQMA 5CWRA 4M5DA 1V4AA 5BPCA 3V7KA 3C2LA 4K4IA 1ZQPA 4LZDA 2M2WA 2M2UA 5F2VO 3OV7A 4PH5A 1ZQXA 3LQCB 5HC9A 3RJFA 5J2AA 4KLMA 4WC7A 4RPXA 1ZQKA 2ISPA 8ICOA 4KLQA 5IIMA 4AT9A 4YMOA 3JPNA 1ZQSA 1XSPA 4M0AA 5J0XA 3RJEA 9ICKA 4I29A 2PBEA 5J0TA 2DRBA 4FH5A 5EOZA 5J0SA 2BE3A 1TVAA 2ZHBA 4AT9B 3OVAA 4FH3A 4RWOA 9ICAA 4MFAA 5DBAA 1ZQBA 2DR5A 7ICNA 5IINA 1XSLA 1MIWA 3AU2A 8ICAA 4EP7A 3WFQE 4O5KA 4XUSA 3WFOA 4YD1A 4QZFA 3RJIA 4QZBA 4FHYA 4TURA 5J2KA 7ICRA 4UBCA 4YMNA 5J2BA 5J2GA 4EBJA 9ICUA 7ICUA 4GXKA 1ZQNA 2PFNA 1F5AA 3RH4A 1BPXA 2ISOA 8ICUA 8ICBA 4IG8A 3PNCA 1VFGA 4NKTA 5CA7A 1KEJA 4UD4A 4LT6A 4S3NA 9ICPA 4XQ8A 7ICJA 4QZCA 4LVSA 3TFSA 9ICGA 5IIOA 4I2CA 3GDXA 4XQ7A 4WBYA 3JPTA 4FO6A 4GXJA 4M47A 1BPDA 5J2DA 4P4PA 4ATBA
chains in the Genus database with same CATH superfamily
4RPYA 2BPFA 4QZHA 3C66A 5J2CA 2PFQA 3RH6A 4I2BA 5DDMA 5DECA 2BCQA 1MIVA 1FA0A 8ICPA 4LEVA 3V7JA 4JLZA 8ICCA 4GXIA 4O5EA 5CHEA 4ATBB 3UPSA 4EBKA 2EWRA 4NKUA 2FMPA 7ICTA 9ICQA 8ICKA 8ICRA 4X4RA 4RQ6A 9ICSA 1MQ3A 4X4PA 3JPQA 2B4VA 1ZQEA 3AQMA 3H37A 4X4SA 4OAGA 4K96A 4R64A 3JZ0A 4Z6EA 4QZGA 2BCVA 3WFRE 2FCLA 4PHEA 4IQTA 5DBBA 3MDCA 4KLEA 8ICMA 9ICXA 4KLLA 4RT3A 4RQ8A 2P66A 3OVBA 4NM1A 4JLXA 4NLKA 2VANA 9ICIA 5D49A 4UD5A 2ZH8A 3JPSA 2DR9A 4NXTA 1RPLA 2BCRA 4X5VA 4X4UA 3UXNA 1ZQLA 7ICMA 2ZH9A 1ZQQA 9ICTA 4AT8A 1TFWA 4P2HA 9ICBA 5DEDA 7ICFA 1YLQA 4WC1A 4KLHA 5HR9A 4NLNA 3H39A 4X4NA 2BCSA 1HUOA 4I2AA 4M9NA 4RQ3A 4M9LA 1ZQAA 5HRKA 4RT2A 5HRFA 5HREA 9ICRA 4QZ8A 3MGIA 5IIIA 3B0YA 4QZDA 3HWTA 4LEWA 5HRDA 4AT8B 4OAFA 4MF2A 4X0BA 4M9HA 3JPOA 4WC4A 3RJKA 1UETA 4X4OA 1PX5A 9ICJA 3B0XA 4PHPA 5D62A 8ICFA 4EGWA 5D46A 5J0PA 4WH5A 4RWPA 4HX0A 4M9GA 4MFFA 7ICPA 9ICNA 7ICVA 3NKUA 3WFSC 3JPPA 4UB5A 2GAFD 3WFPA 3AUOA 5J2EA 3HJ1A 1R89A 3RJGA 2GWSA 5J0OA 1GPJA 4WC5A 1NO5A 4R63A 7ICOA 2I9GA 4XRHA 7ICLA 3OGUA 1NOMA 2W9MA 8ICEA 5HRIA 4UBBA 9ICEA 4I2HA 2DVIA 9ICOA 4FHPA 4LZGA 3C5FA 8ICWA 5CFSA 4I2IA 1MIYA 4EV6A 4WBZA 3TFRA 4PHDA 3HW8A 4PHAA 5DB7A 3V72A 3C2KA 4FHWA 2GA9D 4KLSA 4QZ9A 4TUQA 1HUZA 3ER9B 4NXUA 1Q79A 1ZQZA 4WCWA 3UXOA 5J0WA 9ICMA 8ICZA 4YN4A 2ZH1A 3AQLA 4DOBA 1ZQJA 1ZJNA 1BPBA 7ICHA 4MF8A 2BPGA 4AT7A 5J0YA 3ISDA 1VJ7A 4P4OA 4K99A 4EEBA 4KM5A 4UAZA 2DR8A 4I2GA 4KLJA 4Z6DA 4RQ5A 2IHOA 4KLTA 3MDAA 2ZH4A 5J0QA 4E7XA 3RJHA 2PXIA 4AT7B 4K98A 4PGXA 5J2HA 4NM2A 4N7RA 5J2JA 3ISBA 8ICLA 5CB1A 2PFPA 4QZIA 4UB1A 4DO9A 3OVSA 2FMQA 4F5OA 1UEUA 3K75D 4NXXA 4RQ0A 4PGQA 1JN3A 3JYYA 1ZQWA 4RQ1A 2M2VA 1MQ2A 5HRHA 1ZQVA 4K9BA 4F5QA 4WC2A 1JQRA 2ZH7A 5HRGA 2NRKA 9ICLA 8ICVA 3AQNA 4NXWA 4DOAA 1ZQIA 4KLGA 3AQKA 5J2FA 5HHIA 4RQ7A 4OAHA 1WOTA 2ZH6A 8ICIA 5J2IA 8ICXA 8ICTA 9ICHA 3JPRA 4I28A 2B56A 4O67A 4QZAA 4IQUA 4RPZA 2PFOA 2BBJA 2O1PA 4YD2A 8ICSA 3PMNA 9ICVA 1BPYA 4FHVA 4F5PA 3LK9A 5CP2A 5HHHA 4DOCA 1ZQDA 4QZEA 1ZQHA 4I2FA 4KB6A 4XA5A 4F5RA 4UAYA 9ICWA 5D63A 4WQKA 3ER8C 4O9MA 4KLOA 3V7LA 3L9DA 5BOLA 3EF2A 4WC6A 2ID1A 2FMSA 4YCXA 1ZQUA 2ZH5A 9ICCA 4M9JA 4I2JA 2ZH3A 1R8BA 1ZQFA 4X4VA 4K4HA 2DRAA 1R8AA 2DR7A 1ZQCA 4JWNA 3H3AA 3HJ4A 4RQ2A 4UB4A 3C2MA 4NY8A 3HIYA 4M2YA 4K97A 1ZJMA 2O5AA 4FO1A 3RH5A 1JAJA 2B51A 2M2TA 4WC0A 5DBCA 3ISCA 4YMMA 4KLUA 4R65A 4LEYA 2BPCA 4I2EA 5CJ7A 5IIKA 5D61A 7ICEA 4X4QA 5J0RA 4P4MA 4MFCA 3MCRA 1BPZA 4IQVA 4K4GA 4RWQA 4RQ4A 3MBYA 2HHPA 2RFFA 4MKPA 4E8FA 4X4TA 1ZQTA 5D4BA 4UAWA 3PMLA 3K7DA 4KLDA 2Q66A 3PHZA 4IQWA 5CHGA 7ICKA 5JTGA 4NXZA 4UB3A 5CR0A 4R66A 8ICNA 4EEDA 3RJJA 5DKWA 9ICFA 4NLZA 4F5NA 3OUYA 3UQ0A 8ICHA 1Q78A 3NYBA 2ZH2A 2ZHAA 4I2DA 5IIJA 4I27A 4KLFA 3NWIA 8ICYA 1BPEA 7ICSA 3CK6A 4Z6FA 2BCUA 5HRLA 4TUSA 3UPQA 1KNYA 1ZQGA 4O68A 1RZTA 4UB2A 3OUYB 3ERCC 1UEVA 5DB8A 3HX0A 4I0UA 4Z6CA 4FHXA 1JMSA 5DB6A 5J0UA 3H38A 5BOMA 1ZQRA 1TV9A 5HRBA 1XSNA 2IHMA 3UXPA 4PPXA 5J29A 3JCFA 5TZVA 5CFUA 3UQ2A 4O5CA 4M04A 7ICGA 3C18A 4TUPA 1ZQYA 5DB9A 7ICQA 4WQLA 5DDYA 8ICQA 1TFYA 3OWGA 2HN1A 4K9AA 3C5GA 4PGYA 8ICGA 1R8CA 1ZQOA 4RWNA 7ICIA 8ICJA 4E80A 3AU6A 4WC3A 1KDHA 5IILA 4K8VA 4KLIA 3MGHA 1OU5A 4X0AA 4JWMA 1ZQMA 5CWRA 4M5DA 1V4AA 5BPCA 3V7KA 3C2LA 4K4IA 1ZQPA 4LZDA 2M2WA 2M2UA 5F2VO 3OV7A 4PH5A 1ZQXA 3LQCB 5B3QA 5HC9A 3RJFA 5J2AA 4KLMA 3NVOA 2BBHA 4WC7A 4RPXA 4O6AA 1ZQKA 2ISPA 8ICOA 4KLQA 5IIMA 4AT9A 4YMOA 3JPNA 1ZQSA 1XSPA 4M0AA 5J0XA 4XJEA 3RJEA 4O69A 9ICKA 4I29A 2PBEA 2DRBA 4LEZA 5J0TA 4FH5A 5EOZA 5J0SA 2BE3A 1TVAA 2ZHBA 4AT9B 3OVAA 4NXVA 4FH3A 4RWOA 9ICAA 4MFAA 5DBAA 2DR5A 1ZQBA 7ICNA 5B3PA 4WOYA 5IINA 1XSLA 1MIWA 3AU2A 8ICAA 4EP7A 3WFQE 4O5KA 4XUSA 3WFOA 4YD1A 4QZFA 3RJIA 4QZBA 4FHYA 4TURA 5J2KA 7ICRA 4UBCA 4YMNA 5J2BA 5J2GA 4EBJA 9ICUA 2IUBA 7ICUA 4GXKA 1ZQNA 2PFNA 2HN2A 1F5AA 3RH4A 1BPXA 2ISOA 8ICUA 4OAIZ 8ICBA 4IG8A 3PNCA 1VFGA 4NKTA 5CA7A 1KEJA 4UD4A 4LT6A 4S3NA 9ICPA 4XQ8A 7ICJA 4QZCA 4LVSA 3TFSA 9ICGA 5CFTA 5IIOA 4I2CA 3GDXA 4XQ7A 4WBYA 3JPTA 4FO6A 4GXJA 4M47A 1BPDA 5J2DA 4P4PA 4ATBA
chains in the Genus database with same CATH topology
4RPYA 2BPFA 4QZHA 3C66A 5J2CA 2PFQA 3RH6A 4I2BA 5DDMA 5DECA 2BCQA 1MIVA 1FA0A 8ICPA 4LEVA 3V7JA 4JLZA 8ICCA 4GXIA 4O5EA 4ATBB 3UPSA 4EBKA 4NKUA 2FMPA 7ICTA 9ICQA 8ICKA 8ICRA 4X4RA 4RQ6A 9ICSA 1MQ3A 4X4PA 3JPQA 2B4VA 1ZQEA 3AQMA 3H37A 4X4SA 4OAGA 4K96A 4R64A 3JZ0A 4Z6EA 4QZGA 2BCVA 3WFRE 4PHEA 4IQTA 5DBBA 3MDCA 4KLEA 8ICMA 9ICXA 4KLLA 4RT3A 4RQ8A 2P66A 3OVBA 4NM1A 4JLXA 4NLKA 2VANA 9ICIA 5D49A 4UD5A 2ZH8A 3JPSA 2DR9A 4NXTA 1RPLA 2BCRA 4X5VA 4X4UA 3UXNA 1ZQLA 7ICMA 2ZH9A 1ZQQA 9ICTA 4AT8A 1TFWA 4P2HA 9ICBA 5DEDA 7ICFA 1YLQA 4WC1A 4KLHA 5HR9A 4NLNA 3H39A 4X4NA 2BCSA 1HUOA 4I2AA 4M9NA 4RQ3A 4M9LA 1ZQAA 5HRKA 4RT2A 5HRFA 5HREA 9ICRA 4QZ8A 3MGIA 5IIIA 3B0YA 4QZDA 3HWTA 4LEWA 5HRDA 4AT8B 4OAFA 4MF2A 4X0BA 4M9HA 3JPOA 4WC4A 3RJKA 1UETA 4X4OA 1PX5A 9ICJA 3B0XA 4PHPA 8ICFA 5D46A 5J0PA 4RWPA 4M9GA 4MFFA 7ICPA 9ICNA 7ICVA 3WFSC 3JPPA 4UB5A 3AUOA 3WFPA 5J2EA 3HJ1A 1R89A 3RJGA 2GWSA 5J0OA 4WC5A 1NO5A 4R63A 7ICOA 2I9GA 4XRHA 7ICLA 3OGUA 1NOMA 2W9MA 8ICEA 5HRIA 4UBBA 9ICEA 4I2HA 2DVIA 9ICOA 4FHPA 4LZGA 3C5FA 8ICWA 4I2IA 1MIYA 4WBZA 3TFRA 4PHDA 3HW8A 4PHAA 5DB7A 3V72A 3C2KA 4FHWA 4KLSA 4QZ9A 4TUQA 1HUZA 4NXUA 1Q79A 1ZQZA 4WCWA 3UXOA 5J0WA 9ICMA 8ICZA 4YN4A 2ZH1A 3AQLA 4DOBA 1ZQJA 1ZJNA 1BPBA 7ICHA 4MF8A 2BPGA 4AT7A 5J0YA 3ISDA 1VJ7A 4P4OA 4K99A 4KM5A 4UAZA 2DR8A 4I2GA 4KLJA 4Z6DA 4RQ5A 4KLTA 3MDAA 2ZH4A 5J0QA 4E7XA 3RJHA 2PXIA 4AT7B 4K98A 4PGXA 5J2HA 4NM2A 5J2JA 3ISBA 8ICLA 5CB1A 2PFPA 4QZIA 4UB1A 4DO9A 3OVSA 2FMQA 4F5OA 1UEUA 3K75D 4NXXA 4RQ0A 4PGQA 1JN3A 3JYYA 1ZQWA 4RQ1A 2M2VA 1MQ2A 5HRHA 1ZQVA 4K9BA 4F5QA 4WC2A 1JQRA 2ZH7A 5HRGA 2NRKA 9ICLA 8ICVA 3AQNA 4NXWA 4DOAA 1ZQIA 4KLGA 3AQKA 5J2FA 5HHIA 4RQ7A 4OAHA 1WOTA 2ZH6A 8ICIA 5J2IA 8ICXA 8ICTA 9ICHA 3JPRA 4I28A 2B56A 4O67A 4QZAA 4IQUA 4RPZA 2PFOA 2O1PA 4YD2A 8ICSA 3PMNA 9ICVA 1BPYA 4FHVA 4F5PA 3LK9A 5CP2A 5HHHA 4DOCA 1ZQDA 4QZEA 1ZQHA 4I2FA 4KB6A 4XA5A 4F5RA 4UAYA 9ICWA 4O9MA 4KLOA 3V7LA 3L9DA 5BOLA 4WC6A 2ID1A 2FMSA 4YCXA 1ZQUA 2ZH5A 9ICCA 4M9JA 4I2JA 2ZH3A 1R8BA 1ZQFA 4X4VA 4K4HA 2DRAA 1R8AA 2DR7A 1ZQCA 4JWNA 3H3AA 3HJ4A 4RQ2A 4UB4A 3C2MA 4NY8A 3HIYA 4M2YA 4K97A 1ZJMA 2O5AA 3RH5A 1JAJA 2B51A 2M2TA 4WC0A 5DBCA 3ISCA 4YMMA 4KLUA 4R65A 4LEYA 2BPCA 4I2EA 5CJ7A 5IIKA 7ICEA 4X4QA 5J0RA 4P4MA 4MFCA 1BPZA 4IQVA 4K4GA 4RWQA 4RQ4A 3MBYA 2HHPA 2RFFA 4MKPA 4E8FA 4X4TA 1ZQTA 5D4BA 4UAWA 3PMLA 4KLDA 2Q66A 4IQWA 5CHGA 7ICKA 4NXZA 4UB3A 5CR0A 4R66A 8ICNA 3RJJA 5DKWA 9ICFA 4NLZA 4F5NA 3OUYA 3UQ0A 8ICHA 1Q78A 3NYBA 2ZH2A 2ZHAA 4I2DA 5IIJA 4I27A 4KLFA 8ICYA 1BPEA 7ICSA 4Z6FA 2BCUA 5HRLA 4TUSA 3UPQA 1KNYA 1ZQGA 4O68A 1RZTA 4UB2A 3OUYB 1UEVA 5DB8A 3HX0A 4Z6CA 4FHXA 1JMSA 5DB6A 5J0UA 3H38A 5BOMA 1ZQRA 1TV9A 5HRBA 1XSNA 2IHMA 3UXPA 4PPXA 5J29A 5TZVA 3UQ2A 4O5CA 4M04A 7ICGA 3C18A 4TUPA 1ZQYA 5DB9A 7ICQA 5DDYA 8ICQA 1TFYA 4K9AA 3C5GA 4PGYA 8ICGA 1R8CA 1ZQOA 7ICIA 4RWNA 8ICJA 4E80A 3AU6A 4WC3A 1KDHA 5IILA 4K8VA 4KLIA 3MGHA 1OU5A 4X0AA 4JWMA 1ZQMA 5CWRA 4M5DA 1V4AA 5BPCA 3V7KA 3C2LA 4K4IA 1ZQPA 4LZDA 2M2WA 2M2UA 5F2VO 3OV7A 4PH5A 1ZQXA 3LQCB 5HC9A 3RJFA 5J2AA 4KLMA 4WC7A 4RPXA 4O6AA 1ZQKA 2ISPA 8ICOA 4KLQA 5IIMA 4AT9A 4YMOA 3JPNA 1ZQSA 1XSPA 4M0AA 5J0XA 3RJEA 9ICKA 4O69A 4I29A 2PBEA 2DRBA 4LEZA 5J0TA 4FH5A 5EOZA 5J0SA 2BE3A 1TVAA 2ZHBA 4AT9B 3OVAA 4NXVA 4FH3A 4RWOA 9ICAA 4MFAA 5DBAA 2DR5A 1ZQBA 7ICNA 5IINA 4WOYA 1XSLA 1MIWA 3AU2A 8ICAA 4EP7A 3WFQE 4O5KA 4XUSA 3WFOA 4YD1A 4QZFA 3RJIA 4QZBA 4FHYA 4TURA 5J2KA 7ICRA 4UBCA 4YMNA 5J2BA 5J2GA 4EBJA 9ICUA 7ICUA 4GXKA 1ZQNA 2PFNA 1F5AA 3RH4A 1BPXA 2ISOA 8ICUA 4OAIZ 8ICBA 4IG8A 3PNCA 1VFGA 4NKTA 5CA7A 1KEJA 4UD4A 4LT6A 4S3NA 9ICPA 4XQ8A 7ICJA 4QZCA 4LVSA 3TFSA 9ICGA 5IIOA 4I2CA 3GDXA 4XQ7A 4WBYA 3JPTA 4FO6A 4GXJA 4M47A 1BPDA 5J2DA 4P4PA 4ATBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RPY A;  2BPF A;  4QZH A;  3C66 A;  5J2C A;  2PFQ A;  3RH6 A;  4I2B A;  5DDM A;  5DEC A;  2BCQ A;  1MIV A;  1FA0 A;  8ICP A;  3V7J A;  8ICC A;  4GXI A;  4O5E A;  4ATB B;  3UPS A;  4EBK A;  4NKU A;  2FMP A;  7ICT A;  9ICQ A;  8ICK A;  8ICR A;  4RQ6 A;  4X4R A;  9ICS A;  1MQ3 A;  4X4P A;  3JPQ A;  2B4V A;  1ZQE A;  3AQM A;  3H37 A;  4X4S A;  4R64 A;  2BCV A;  3WFR E;  3JZ0 A;  4Z6E A;  4QZG A;  4PHE A;  4IQT A;  5DBB A;  3MDC A;  4KLE A;  8ICM A;  9ICX A;  4KLL A;  4RT3 A;  4RQ8 A;  2P66 A;  3OVB A;  4NM1 A;  4NLK A;  2VAN A;  9ICI A;  5D49 A;  4UD5 A;  2ZH8 A;  3JPS A;  2DR9 A;  1RPL A;  2BCR A;  4X5V A;  4X4U A;  3UXN A;  1ZQL A;  7ICM A;  2ZH9 A;  1ZQQ A;  9ICT A;  4AT8 A;  4P2H A;  1TFW A;  9ICB A;  5DED A;  7ICF A;  1YLQ A;  4WC1 A;  4KLH A;  5HR9 A;  4NLN A;  3H39 A;  4X4N A;  2BCS A;  1HUO A;  4I2A A;  4M9N A;  4RQ3 A;  4M9L A;  1ZQA A;  5HRK A;  4RT2 A;  5HRF A;  5HRE A;  9ICR A;  4QZ8 A;  3MGI A;  5III A;  3B0Y A;  4QZD A;  3HWT A;  5HRD A;  4AT8 B;  4MF2 A;  4X0B A;  4M9H A;  3JPO A;  4WC4 A;  3RJK A;  1UET A;  4X4O A;  1PX5 A;  9ICJ A;  3B0X A;  4PHP A;  8ICF A;  5D46 A;  5J0P A;  4RWP A;  4M9G A;  4MFF A;  7ICP A;  9ICN A;  7ICV A;  3WFS C;  3JPP A;  4UB5 A;  3AUO A;  3WFP A;  5J2E A;  3HJ1 A;  1R89 A;  3RJG A;  2GWS A;  5J0O A;  4WC5 A;  1NO5 A;  4R63 A;  7ICO A;  2I9G A;  4XRH A;  7ICL A;  3OGU A;  1NOM A;  2W9M A;  8ICE A;  5HRI A;  4UBB A;  9ICE A;  4I2H A;  2DVI A;  9ICO A;  4FHP A;  4LZG A;  3C5F A;  8ICW A;  4I2I A;  1MIY A;  4WBZ A;  3TFR A;  4PHD A;  3HW8 A;  4PHA A;  5DB7 A;  3V72 A;  3C2K A;  4FHW A;  4KLS A;  4QZ9 A;  4TUQ A;  1HUZ A;  1Q79 A;  1ZQZ A;  4WCW A;  3UXO A;  5J0W A;  9ICM A;  8ICZ A;  4YN4 A;  2ZH1 A;  3AQL A;  4DOB A;  1ZQJ A;  1ZJN A;  1BPB A;  7ICH A;  4MF8 A;  2BPG A;  4AT7 A;  5J0Y A;  3ISD A;  1VJ7 A;  4P4O A;  4UAZ A;  2DR8 A;  4I2G A;  4KLJ A;  4Z6D A;  4RQ5 A;  4KLT A;  3MDA A;  2ZH4 A;  5J0Q A;  4E7X A;  3RJH A;  2PXI A;  4AT7 B;  4PGX A;  5J2H A;  4NM2 A;  5J2J A;  3ISB A;  8ICL A;  5CB1 A;  2PFP A;  4QZI A;  4UB1 A;  4DO9 A;  3OVS A;  2FMQ A;  4F5O A;  1UEU A;  3K75 D;  4RQ0 A;  4PGQ A;  1JN3 A;  3JYY A;  1ZQW A;  4RQ1 A;  2M2V A;  1MQ2 A;  5HRH A;  1ZQV A;  4F5Q A;  4WC2 A;  1JQR A;  5HRG A;  2ZH7 A;  2NRK A;  9ICL A;  8ICV A;  3AQN A;  4DOA A;  1ZQI A;  4KLG A;  3AQK A;  5J2F A;  5HHI A;  4RQ7 A;  1WOT A;  2ZH6 A;  8ICI A;  5J2I A;  8ICX A;  8ICT A;  9ICH A;  3JPR A;  4I28 A;  2B56 A;  2PFO A;  4QZA A;  4IQU A;  4RPZ A;  2O1P A;  4YD2 A;  8ICS A;  3PMN A;  9ICV A;  1BPY A;  4FHV A;  4F5P A;  3LK9 A;  5CP2 A;  5HHH A;  4DOC A;  1ZQD A;  4QZE A;  1ZQH A;  4I2F A;  4XA5 A;  4F5R A;  4UAY A;  9ICW A;  4O9M A;  4KLO A;  3V7L A;  3L9D A;  5BOL A;  4WC6 A;  2ID1 A;  2FMS A;  4YCX A;  1ZQU A;  2ZH5 A;  9ICC A;  4M9J A;  4I2J A;  2ZH3 A;  1R8B A;  1ZQF A;  4X4V A;  4K4H A;  2DRA A;  1R8A A;  1ZQC A;  2DR7 A;  4JWN A;  3H3A A;  3HJ4 A;  4RQ2 A;  4UB4 A;  3C2M A;  4NY8 A;  3HIY A;  4M2Y A;  1ZJM A;  2O5A A;  3RH5 A;  1JAJ A;  2B51 A;  2M2T A;  4WC0 A;  5DBC A;  3ISC A;  4YMM A;  4KLU A;  4R65 A;  2BPC A;  4I2E A;  5CJ7 A;  5IIK A;  7ICE A;  4X4Q A;  5J0R A;  4P4M A;  4MFC A;  1BPZ A;  4IQV A;  4K4G A;  4RWQ A;  4RQ4 A;  3MBY A;  2HHP A;  2RFF A;  4E8F A;  4X4T A;  1ZQT A;  5D4B A;  4UAW A;  3PML A;  4KLD A;  2Q66 A;  4IQW A;  5CHG A;  7ICK A;  4NXZ A;  4UB3 A;  5CR0 A;  4R66 A;  8ICN A;  3RJJ A;  5DKW A;  9ICF A;  4NLZ A;  4F5N A;  3OUY A;  3UQ0 A;  8ICH A;  1Q78 A;  3NYB A;  2ZH2 A;  4I2D A;  5IIJ A;  2ZHA A;  4I27 A;  4KLF A;  8ICY A;  1BPE A;  7ICS A;  4Z6F A;  2BCU A;  5HRL A;  4TUS A;  3UPQ A;  1KNY A;  1ZQG A;  1RZT A;  4UB2 A;  3OUY B;  1UEV A;  5DB8 A;  3HX0 A;  4Z6C A;  4FHX A;  1JMS A;  5DB6 A;  5J0U A;  3H38 A;  5BOM A;  1ZQR A;  1TV9 A;  5HRB A;  1XSN A;  2IHM A;  3UXP A;  4PPX A;  5J29 A;  5TZV A;  3UQ2 A;  4O5C A;  4M04 A;  7ICG A;  3C18 A;  4TUP A;  1ZQY A;  5DB9 A;  7ICQ A;  5DDY A;  8ICQ A;  1TFY A;  3C5G A;  4PGY A;  8ICG A;  1R8C A;  1ZQO A;  7ICI A;  4RWN A;  8ICJ A;  4E80 A;  3AU6 A;  4WC3 A;  1KDH A;  5IIL A;  4KLI A;  3MGH A;  1OU5 A;  4X0A A;  4JWM A;  1ZQM A;  5CWR A;  4M5D A;  1V4A A;  5BPC A;  3V7K A;  3C2L A;  4K4I A;  1ZQP A;  4LZD A;  2M2W A;  2M2U A;  5F2V O;  3OV7 A;  4PH5 A;  1ZQX A;  3LQC B;  5HC9 A;  3RJF A;  5J2A A;  4KLM A;  4WC7 A;  4RPX A;  1ZQK A;  2ISP A;  8ICO A;  4KLQ A;  5IIM A;  4AT9 A;  4YMO A;  3JPN A;  1ZQS A;  1XSP A;  4M0A A;  5J0X A;  3RJE A;  9ICK A;  4I29 A;  2PBE A;  5J0T A;  2DRB A;  4FH5 A;  5EOZ A;  5J0S A;  2BE3 A;  1TVA A;  2ZHB A;  4AT9 B;  3OVA A;  4FH3 A;  4RWO A;  9ICA A;  4MFA A;  5DBA A;  1ZQB A;  2DR5 A;  7ICN A;  5IIN A;  1XSL A;  1MIW A;  3AU2 A;  8ICA A;  4EP7 A;  3WFQ E;  4O5K A;  4XUS A;  3WFO A;  4YD1 A;  4QZF A;  3RJI A;  4QZB A;  4FHY A;  4TUR A;  5J2K A;  7ICR A;  4UBC A;  4YMN A;  5J2B A;  5J2G A;  4EBJ A;  9ICU A;  7ICU A;  4GXK A;  1ZQN A;  2PFN A;  1F5A A;  3RH4 A;  1BPX A;  2ISO A;  8ICU A;  8ICB A;  4IG8 A;  3PNC A;  1VFG A;  4NKT A;  5CA7 A;  1KEJ A;  4UD4 A;  4LT6 A;  4S3N A;  9ICP A;  4XQ8 A;  7ICJ A;  4QZC A;  4LVS A;  3TFS A;  9ICG A;  5IIO A;  4I2C A;  3GDX A;  4XQ7 A;  4WBY A;  3JPT A;  4FO6 A;  4GXJ A;  4M47 A;  1BPD A;  5J2D A;  4P4P A;  4ATB A; 
#chains in the Genus database with same CATH topology
 4RPY A;  2BPF A;  4QZH A;  3C66 A;  5J2C A;  2PFQ A;  3RH6 A;  4I2B A;  5DDM A;  5DEC A;  2BCQ A;  1MIV A;  1FA0 A;  8ICP A;  4LEV A;  3V7J A;  4JLZ A;  8ICC A;  4GXI A;  4O5E A;  5CHE A;  4ATB B;  3UPS A;  4EBK A;  2EWR A;  4NKU A;  2FMP A;  7ICT A;  9ICQ A;  8ICK A;  8ICR A;  4X4R A;  4RQ6 A;  9ICS A;  1MQ3 A;  4X4P A;  3JPQ A;  2B4V A;  1ZQE A;  3AQM A;  3H37 A;  4X4S A;  4OAG A;  4K96 A;  4R64 A;  3JZ0 A;  4Z6E A;  4QZG A;  2BCV A;  3WFR E;  2FCL A;  4PHE A;  4IQT A;  5DBB A;  3MDC A;  4KLE A;  8ICM A;  9ICX A;  4KLL A;  4RT3 A;  4RQ8 A;  2P66 A;  3OVB A;  4NM1 A;  4JLX A;  4NLK A;  2VAN A;  9ICI A;  5D49 A;  4UD5 A;  2ZH8 A;  3JPS A;  2DR9 A;  4NXT A;  1RPL A;  2BCR A;  4X5V A;  4X4U A;  3UXN A;  1ZQL A;  7ICM A;  2ZH9 A;  1ZQQ A;  9ICT A;  4AT8 A;  1TFW A;  4P2H A;  9ICB A;  5DED A;  7ICF A;  1YLQ A;  4WC1 A;  4KLH A;  5HR9 A;  4NLN A;  3H39 A;  4X4N A;  2BCS A;  1HUO A;  4I2A A;  4M9N A;  4RQ3 A;  4M9L A;  1ZQA A;  5HRK A;  4RT2 A;  5HRF A;  5HRE A;  9ICR A;  4QZ8 A;  3MGI A;  5III A;  3B0Y A;  4QZD A;  3HWT A;  4LEW A;  5HRD A;  4AT8 B;  4OAF A;  4MF2 A;  4X0B A;  4M9H A;  3JPO A;  4WC4 A;  3RJK A;  1UET A;  4X4O A;  1PX5 A;  9ICJ A;  3B0X A;  4PHP A;  5D62 A;  8ICF A;  4EGW A;  5D46 A;  5J0P A;  4WH5 A;  4RWP A;  4HX0 A;  4M9G A;  4MFF A;  7ICP A;  9ICN A;  7ICV A;  3NKU A;  3WFS C;  3JPP A;  4UB5 A;  2GAF D;  3WFP A;  3AUO A;  5J2E A;  3HJ1 A;  1R89 A;  3RJG A;  2GWS A;  5J0O A;  1GPJ A;  4WC5 A;  1NO5 A;  4R63 A;  7ICO A;  2I9G A;  4XRH A;  7ICL A;  3OGU A;  1NOM A;  2W9M A;  8ICE A;  5HRI A;  4UBB A;  9ICE A;  4I2H A;  2DVI A;  9ICO A;  4FHP A;  4LZG A;  3C5F A;  8ICW A;  5CFS A;  4I2I A;  1MIY A;  4EV6 A;  4WBZ A;  3TFR A;  4PHD A;  3HW8 A;  4PHA A;  5DB7 A;  3V72 A;  3C2K A;  4FHW A;  2GA9 D;  4KLS A;  4QZ9 A;  4TUQ A;  1HUZ A;  3ER9 B;  4NXU A;  1Q79 A;  1ZQZ A;  4WCW A;  3UXO A;  5J0W A;  9ICM A;  8ICZ A;  4YN4 A;  2ZH1 A;  3AQL A;  4DOB A;  1ZQJ A;  1ZJN A;  1BPB A;  7ICH A;  4MF8 A;  2BPG A;  4AT7 A;  5J0Y A;  3ISD A;  1VJ7 A;  4P4O A;  4K99 A;  4EEB A;  4KM5 A;  4UAZ A;  2DR8 A;  4I2G A;  4KLJ A;  4Z6D A;  4RQ5 A;  2IHO A;  4KLT A;  3MDA A;  2ZH4 A;  5J0Q A;  4E7X A;  3RJH A;  2PXI A;  4AT7 B;  4K98 A;  4PGX A;  5J2H A;  4NM2 A;  4N7R A;  5J2J A;  3ISB A;  8ICL A;  5CB1 A;  2PFP A;  4QZI A;  4UB1 A;  4DO9 A;  3OVS A;  2FMQ A;  4F5O A;  1UEU A;  3K75 D;  4NXX A;  4RQ0 A;  4PGQ A;  1JN3 A;  3JYY A;  1ZQW A;  4RQ1 A;  2M2V A;  1MQ2 A;  5HRH A;  1ZQV A;  4K9B A;  4F5Q A;  4WC2 A;  1JQR A;  2ZH7 A;  5HRG A;  2NRK A;  9ICL A;  8ICV A;  3AQN A;  4NXW A;  4DOA A;  1ZQI A;  4KLG A;  3AQK A;  5J2F A;  5HHI A;  4RQ7 A;  4OAH A;  1WOT A;  2ZH6 A;  8ICI A;  5J2I A;  8ICX A;  8ICT A;  9ICH A;  3JPR A;  4I28 A;  2B56 A;  4O67 A;  4QZA A;  4IQU A;  4RPZ A;  2PFO A;  2BBJ A;  2O1P A;  4YD2 A;  8ICS A;  3PMN A;  9ICV A;  1BPY A;  4FHV A;  4F5P A;  3LK9 A;  5CP2 A;  5HHH A;  4DOC A;  1ZQD A;  4QZE A;  1ZQH A;  4I2F A;  4KB6 A;  4XA5 A;  4F5R A;  4UAY A;  9ICW A;  5D63 A;  4WQK A;  3ER8 C;  4O9M A;  4KLO A;  3V7L A;  3L9D A;  5BOL A;  3EF2 A;  4WC6 A;  2ID1 A;  2FMS A;  4YCX A;  1ZQU A;  2ZH5 A;  9ICC A;  4M9J A;  4I2J A;  2ZH3 A;  1R8B A;  1ZQF A;  4X4V A;  4K4H A;  2DRA A;  1R8A A;  2DR7 A;  1ZQC A;  4JWN A;  3H3A A;  3HJ4 A;  4RQ2 A;  4UB4 A;  3C2M A;  4NY8 A;  3HIY A;  4M2Y A;  4K97 A;  1ZJM A;  2O5A A;  4FO1 A;  3RH5 A;  1JAJ A;  2B51 A;  2M2T A;  4WC0 A;  5DBC A;  3ISC A;  4YMM A;  4KLU A;  4R65 A;  4LEY A;  2BPC A;  4I2E A;  5CJ7 A;  5IIK A;  5D61 A;  7ICE A;  4X4Q A;  5J0R A;  4P4M A;  4MFC A;  3MCR A;  1BPZ A;  4IQV A;  4K4G A;  4RWQ A;  4RQ4 A;  3MBY A;  2HHP A;  2RFF A;  4MKP A;  4E8F A;  4X4T A;  1ZQT A;  5D4B A;  4UAW A;  3PML A;  3K7D A;  4KLD A;  2Q66 A;  3PHZ A;  4IQW A;  5CHG A;  7ICK A;  5JTG A;  4NXZ A;  4UB3 A;  5CR0 A;  4R66 A;  8ICN A;  4EED A;  3RJJ A;  5DKW A;  9ICF A;  4NLZ A;  4F5N A;  3OUY A;  3UQ0 A;  8ICH A;  1Q78 A;  3NYB A;  2ZH2 A;  2ZHA A;  4I2D A;  5IIJ A;  4I27 A;  4KLF A;  3NWI A;  8ICY A;  1BPE A;  7ICS A;  3CK6 A;  4Z6F A;  2BCU A;  5HRL A;  4TUS A;  3UPQ A;  1KNY A;  1ZQG A;  4O68 A;  1RZT A;  4UB2 A;  3OUY B;  3ERC C;  1UEV A;  5DB8 A;  3HX0 A;  4I0U A;  4Z6C A;  4FHX A;  1JMS A;  5DB6 A;  5J0U A;  3H38 A;  5BOM A;  1ZQR A;  1TV9 A;  5HRB A;  1XSN A;  2IHM A;  3UXP A;  4PPX A;  5J29 A;  3JCF A;  5TZV A;  5CFU A;  3UQ2 A;  4O5C A;  4M04 A;  7ICG A;  3C18 A;  4TUP A;  1ZQY A;  5DB9 A;  7ICQ A;  4WQL A;  5DDY A;  8ICQ A;  1TFY A;  3OWG A;  2HN1 A;  4K9A A;  3C5G A;  4PGY A;  8ICG A;  1R8C A;  1ZQO A;  4RWN A;  7ICI A;  8ICJ A;  4E80 A;  3AU6 A;  4WC3 A;  1KDH A;  5IIL A;  4K8V A;  4KLI A;  3MGH A;  1OU5 A;  4X0A A;  4JWM A;  1ZQM A;  5CWR A;  4M5D A;  1V4A A;  5BPC A;  3V7K A;  3C2L A;  4K4I A;  1ZQP A;  4LZD A;  2M2W A;  2M2U A;  5F2V O;  3OV7 A;  4PH5 A;  1ZQX A;  3LQC B;  5B3Q A;  5HC9 A;  3RJF A;  5J2A A;  4KLM A;  3NVO A;  2BBH A;  4WC7 A;  4RPX A;  4O6A A;  1ZQK A;  2ISP A;  8ICO A;  4KLQ A;  5IIM A;  4AT9 A;  4YMO A;  3JPN A;  1ZQS A;  1XSP A;  4M0A A;  5J0X A;  4XJE A;  3RJE A;  4O69 A;  9ICK A;  4I29 A;  2PBE A;  2DRB A;  4LEZ A;  5J0T A;  4FH5 A;  5EOZ A;  5J0S A;  2BE3 A;  1TVA A;  2ZHB A;  4AT9 B;  3OVA A;  4NXV A;  4FH3 A;  4RWO A;  9ICA A;  4MFA A;  5DBA A;  2DR5 A;  1ZQB A;  7ICN A;  5B3P A;  4WOY A;  5IIN A;  1XSL A;  1MIW A;  3AU2 A;  8ICA A;  4EP7 A;  3WFQ E;  4O5K A;  4XUS A;  3WFO A;  4YD1 A;  4QZF A;  3RJI A;  4QZB A;  4FHY A;  4TUR A;  5J2K A;  7ICR A;  4UBC A;  4YMN A;  5J2B A;  5J2G A;  4EBJ A;  9ICU A;  2IUB A;  7ICU A;  4GXK A;  1ZQN A;  2PFN A;  2HN2 A;  1F5A A;  3RH4 A;  1BPX A;  2ISO A;  8ICU A;  4OAI Z;  8ICB A;  4IG8 A;  3PNC A;  1VFG A;  4NKT A;  5CA7 A;  1KEJ A;  4UD4 A;  4LT6 A;  4S3N A;  9ICP A;  4XQ8 A;  7ICJ A;  4QZC A;  4LVS A;  3TFS A;  9ICG A;  5CFT A;  5IIO A;  4I2C A;  3GDX A;  4XQ7 A;  4WBY A;  3JPT A;  4FO6 A;  4GXJ A;  4M47 A;  1BPD A;  5J2D A;  4P4P A;  4ATB A; 
#chains in the Genus database with same CATH homology
 4RPY A;  2BPF A;  4QZH A;  3C66 A;  5J2C A;  2PFQ A;  3RH6 A;  4I2B A;  5DDM A;  5DEC A;  2BCQ A;  1MIV A;  1FA0 A;  8ICP A;  4LEV A;  3V7J A;  4JLZ A;  8ICC A;  4GXI A;  4O5E A;  4ATB B;  3UPS A;  4EBK A;  4NKU A;  2FMP A;  7ICT A;  9ICQ A;  8ICK A;  8ICR A;  4X4R A;  4RQ6 A;  9ICS A;  1MQ3 A;  4X4P A;  3JPQ A;  2B4V A;  1ZQE A;  3AQM A;  3H37 A;  4X4S A;  4OAG A;  4K96 A;  4R64 A;  3JZ0 A;  4Z6E A;  4QZG A;  2BCV A;  3WFR E;  4PHE A;  4IQT A;  5DBB A;  3MDC A;  4KLE A;  8ICM A;  9ICX A;  4KLL A;  4RT3 A;  4RQ8 A;  2P66 A;  3OVB A;  4NM1 A;  4JLX A;  4NLK A;  2VAN A;  9ICI A;  5D49 A;  4UD5 A;  2ZH8 A;  3JPS A;  2DR9 A;  4NXT A;  1RPL A;  2BCR A;  4X5V A;  4X4U A;  3UXN A;  1ZQL A;  7ICM A;  2ZH9 A;  1ZQQ A;  9ICT A;  4AT8 A;  1TFW A;  4P2H A;  9ICB A;  5DED A;  7ICF A;  1YLQ A;  4WC1 A;  4KLH A;  5HR9 A;  4NLN A;  3H39 A;  4X4N A;  2BCS A;  1HUO A;  4I2A A;  4M9N A;  4RQ3 A;  4M9L A;  1ZQA A;  5HRK A;  4RT2 A;  5HRF A;  5HRE A;  9ICR A;  4QZ8 A;  3MGI A;  5III A;  3B0Y A;  4QZD A;  3HWT A;  4LEW A;  5HRD A;  4AT8 B;  4OAF A;  4MF2 A;  4X0B A;  4M9H A;  3JPO A;  4WC4 A;  3RJK A;  1UET A;  4X4O A;  1PX5 A;  9ICJ A;  3B0X A;  4PHP A;  8ICF A;  5D46 A;  5J0P A;  4RWP A;  4M9G A;  4MFF A;  7ICP A;  9ICN A;  7ICV A;  3WFS C;  3JPP A;  4UB5 A;  3AUO A;  3WFP A;  5J2E A;  3HJ1 A;  1R89 A;  3RJG A;  2GWS A;  5J0O A;  4WC5 A;  1NO5 A;  4R63 A;  7ICO A;  2I9G A;  4XRH A;  7ICL A;  3OGU A;  1NOM A;  2W9M A;  8ICE A;  5HRI A;  4UBB A;  9ICE A;  4I2H A;  2DVI A;  9ICO A;  4FHP A;  4LZG A;  3C5F A;  8ICW A;  4I2I A;  1MIY A;  4WBZ A;  3TFR A;  4PHD A;  3HW8 A;  4PHA A;  5DB7 A;  3V72 A;  3C2K A;  4FHW A;  4KLS A;  4QZ9 A;  4TUQ A;  1HUZ A;  4NXU A;  1Q79 A;  1ZQZ A;  4WCW A;  3UXO A;  5J0W A;  9ICM A;  8ICZ A;  4YN4 A;  2ZH1 A;  3AQL A;  4DOB A;  1ZQJ A;  1ZJN A;  1BPB A;  7ICH A;  4MF8 A;  2BPG A;  4AT7 A;  5J0Y A;  3ISD A;  1VJ7 A;  4P4O A;  4K99 A;  4KM5 A;  4UAZ A;  2DR8 A;  4I2G A;  4KLJ A;  4Z6D A;  4RQ5 A;  4KLT A;  3MDA A;  2ZH4 A;  5J0Q A;  4E7X A;  3RJH A;  2PXI A;  4AT7 B;  4K98 A;  4PGX A;  5J2H A;  4NM2 A;  5J2J A;  3ISB A;  8ICL A;  5CB1 A;  2PFP A;  4QZI A;  4UB1 A;  4DO9 A;  3OVS A;  2FMQ A;  4F5O A;  1UEU A;  3K75 D;  4NXX A;  4RQ0 A;  4PGQ A;  1JN3 A;  3JYY A;  1ZQW A;  4RQ1 A;  2M2V A;  1MQ2 A;  5HRH A;  1ZQV A;  4K9B A;  4F5Q A;  4WC2 A;  1JQR A;  2ZH7 A;  5HRG A;  2NRK A;  9ICL A;  8ICV A;  3AQN A;  4NXW A;  4DOA A;  1ZQI A;  4KLG A;  3AQK A;  5J2F A;  5HHI A;  4RQ7 A;  4OAH A;  1WOT A;  2ZH6 A;  8ICI A;  5J2I A;  8ICX A;  8ICT A;  9ICH A;  3JPR A;  4I28 A;  2B56 A;  4O67 A;  4QZA A;  4IQU A;  4RPZ A;  2PFO A;  2O1P A;  4YD2 A;  8ICS A;  3PMN A;  9ICV A;  1BPY A;  4FHV A;  4F5P A;  3LK9 A;  5CP2 A;  5HHH A;  4DOC A;  1ZQD A;  4QZE A;  1ZQH A;  4I2F A;  4KB6 A;  4XA5 A;  4F5R A;  4UAY A;  9ICW A;  4O9M A;  4KLO A;  3V7L A;  3L9D A;  5BOL A;  4WC6 A;  2ID1 A;  2FMS A;  4YCX A;  1ZQU A;  2ZH5 A;  9ICC A;  4M9J A;  4I2J A;  2ZH3 A;  1R8B A;  1ZQF A;  4X4V A;  4K4H A;  2DRA A;  1R8A A;  2DR7 A;  1ZQC A;  4JWN A;  3H3A A;  3HJ4 A;  4RQ2 A;  4UB4 A;  3C2M A;  4NY8 A;  3HIY A;  4M2Y A;  4K97 A;  1ZJM A;  2O5A A;  3RH5 A;  1JAJ A;  2B51 A;  2M2T A;  4WC0 A;  5DBC A;  3ISC A;  4YMM A;  4KLU A;  4R65 A;  4LEY A;  2BPC A;  4I2E A;  5CJ7 A;  5IIK A;  7ICE A;  4X4Q A;  5J0R A;  4P4M A;  4MFC A;  1BPZ A;  4IQV A;  4K4G A;  4RWQ A;  4RQ4 A;  3MBY A;  2HHP A;  2RFF A;  4MKP A;  4E8F A;  4X4T A;  1ZQT A;  5D4B A;  4UAW A;  3PML A;  4KLD A;  2Q66 A;  4IQW A;  5CHG A;  7ICK A;  4NXZ A;  4UB3 A;  5CR0 A;  4R66 A;  8ICN A;  3RJJ A;  5DKW A;  9ICF A;  4NLZ A;  4F5N A;  3OUY A;  3UQ0 A;  8ICH A;  1Q78 A;  3NYB A;  2ZH2 A;  2ZHA A;  4I2D A;  5IIJ A;  4I27 A;  4KLF A;  8ICY A;  1BPE A;  7ICS A;  4Z6F A;  2BCU A;  5HRL A;  4TUS A;  3UPQ A;  1KNY A;  1ZQG A;  4O68 A;  1RZT A;  4UB2 A;  3OUY B;  1UEV A;  5DB8 A;  3HX0 A;  4Z6C A;  4FHX A;  1JMS A;  5DB6 A;  5J0U A;  3H38 A;  5BOM A;  1ZQR A;  1TV9 A;  5HRB A;  1XSN A;  2IHM A;  3UXP A;  4PPX A;  5J29 A;  5TZV A;  3UQ2 A;  4O5C A;  4M04 A;  7ICG A;  3C18 A;  4TUP A;  1ZQY A;  5DB9 A;  7ICQ A;  5DDY A;  8ICQ A;  1TFY A;  4K9A A;  3C5G A;  4PGY A;  8ICG A;  1R8C A;  1ZQO A;  7ICI A;  4RWN A;  8ICJ A;  4E80 A;  3AU6 A;  4WC3 A;  1KDH A;  5IIL A;  4K8V A;  4KLI A;  3MGH A;  1OU5 A;  4X0A A;  4JWM A;  1ZQM A;  5CWR A;  4M5D A;  1V4A A;  5BPC A;  3V7K A;  3C2L A;  4K4I A;  1ZQP A;  4LZD A;  2M2W A;  2M2U A;  5F2V O;  3OV7 A;  4PH5 A;  1ZQX A;  3LQC B;  5HC9 A;  3RJF A;  5J2A A;  4KLM A;  4WC7 A;  4RPX A;  4O6A A;  1ZQK A;  2ISP A;  8ICO A;  4KLQ A;  5IIM A;  4AT9 A;  4YMO A;  3JPN A;  1ZQS A;  1XSP A;  4M0A A;  5J0X A;  3RJE A;  9ICK A;  4O69 A;  4I29 A;  2PBE A;  2DRB A;  4LEZ A;  5J0T A;  4FH5 A;  5EOZ A;  5J0S A;  2BE3 A;  1TVA A;  2ZHB A;  4AT9 B;  3OVA A;  4NXV A;  4FH3 A;  4RWO A;  9ICA A;  4MFA A;  5DBA A;  2DR5 A;  1ZQB A;  7ICN A;  5IIN A;  4WOY A;  1XSL A;  1MIW A;  3AU2 A;  8ICA A;  4EP7 A;  3WFQ E;  4O5K A;  4XUS A;  3WFO A;  4YD1 A;  4QZF A;  3RJI A;  4QZB A;  4FHY A;  4TUR A;  5J2K A;  7ICR A;  4UBC A;  4YMN A;  5J2B A;  5J2G A;  4EBJ A;  9ICU A;  7ICU A;  4GXK A;  1ZQN A;  2PFN A;  1F5A A;  3RH4 A;  1BPX A;  2ISO A;  8ICU A;  4OAI Z;  8ICB A;  4IG8 A;  3PNC A;  1VFG A;  4NKT A;  5CA7 A;  1KEJ A;  4UD4 A;  4LT6 A;  4S3N A;  9ICP A;  4XQ8 A;  7ICJ A;  4QZC A;  4LVS A;  3TFS A;  9ICG A;  5IIO A;  4I2C A;  3GDX A;  4XQ7 A;  4WBY A;  3JPT A;  4FO6 A;  4GXJ A;  4M47 A;  1BPD A;  5J2D A;  4P4P A;  4ATB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...