4FH3A

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 112
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fh3A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fh3A02
1MIVA 1ZQWA 4RQ8A 4I2AA 3C2KA 4M5DA 5J0TA 2FMPA 3AU2A 3RH6A 4X0AA 3JPRA 4QZ9A 4KLTA 9ICJA 4UB2A 4QZGA 4X4TA 5DB9A 2ZHBA 2B51A 3RJFA 2PXIA 3WFPA 4X4UA 4YD2A 1ZQIA 2I9GA 4X4PA 8ICRA 4I2FA 5DBAA 4K4IA 3V72A 4FHPA 3PMLA 2DRBA 1R8AA 4I2BA 9ICXA 4F5OA 2HHPA 2ZHAA 1HUZA 1ZQJA 5TZVA 3B0XA 5CA7A 5DB7A 2DR5A 4RWOA 4X4NA 1UETA 4P4OA 4TUPA 4KLSA 4X4VA 1ZJNA 5CWRA 4DO9A 3OUYB 4QZAA 4AT9B 3PMNA 1VJ7A 9ICPA 4RQ7A 3NYBA 8ICOA 5J0PA 4KLFA 4NM1A 4X5VA 4RQ1A 4QZHA 1JN3A 8ICVA 1BPXA 4P2HA 8ICLA 4M04A 1ZQSA 1F5AA 4I2CA 1MQ2A 7ICSA 4JWMA 2DVIA 3MDAA 1R89A 1FA0A 5HRKA 3OVAA 9ICHA 4KLGA 9ICVA 4RPXA 5IIJA 4PHPA 2BCRA 3H38A 4XUSA 4XRHA 4FHVA 5J2KA 4UAZA 9ICQA 4FH3A 4WC1A 5J2AA 1ZQAA 4YD1A 2DR9A 4RPYA 9ICBA 4RT2A 4KLIA 2ZH6A 1UEUA 5EOZA 9ICOA 3C2MA 4AT8B 2BE3A 1TVAA 1ZQRA 4DOBA 2ISPA 4FHXA 5J2JA 1HUOA 4E80A 4TUQA 3WFRE 4WC2A 1JMSA 4R63A 7ICTA 4K4HA 4P4PA 4NY8A 3PNCA 3HIYA 3JPTA 4NXZA 2BPCA 1KDHA 3AQLA 4I29A 4JWNA 3AU6A 1MIYA 3HW8A 3HJ4A 7ICJA 1ZQTA 4E7XA 4M9JA 5J0XA 2M2VA 4QZ8A 4QZFA 5HHIA 5DDYA 4MF8A 8ICFA 2VANA 5J2BA 4KLLA 4I28A 3TFRA 5J29A 4QZBA 1BPBA 5IIIA 4M47A 1TFWA 1ZQFA 2PFOA 1ZQDA 4PGXA 5F2VO 5J0OA 8ICHA 4RQ2A 1ZQLA 8ICGA 1VFGA 7ICNA 8ICEA 8ICAA 5BOMA 1ZQNA 4I2DA 4IQUA 4KLUA 3JPQA 1BPZA 7ICMA 5DKWA 1Q79A 1JQRA 4RPZA 3AUOA 1UEVA 7ICLA 3C2LA 5BPCA 4S3NA 2RFFA 3V7KA 8ICPA 1KNYA 4UB3A 4R65A 2GWSA 2B4VA 9ICAA 5HREA 8ICIA 4X0BA 1WOTA 5HC9A 4RT3A 4K4GA 4RQ4A 4YMMA 8ICBA 1ZQKA 5BOLA 4R64A 2FMSA 9ICEA 4I27A 4KLEA 4Z6DA 8ICJA 7ICEA 3OUYA 8ICCA 4FHYA 1ZQZA 7ICRA 3JPPA 4X4OA 2M2TA 4YN4A 2ZH3A 4KLMA 4X4SA 1JAJA 5J2IA 3OVSA 3AQMA 4GXKA 1ZQQA 5HR9A 5J2DA 3ISDA 4MFAA 2ZH9A 5CHGA 1V4AA 5HRFA 2BCVA 3UXPA 7ICFA 1KEJA 4EP7A 2O1PA 9ICWA 4O5KA 3B0YA 4I2EA 4O5EA 4Z6FA 5IINA 9ICSA 4IQTA 4KLOA 3RJGA 4ATBB 1BPEA 2ZH1A 3JPNA 2ISOA 5J0YA 4UB4A 3UQ0A 3JPSA 1ZQEA 2M2UA 3ISBA 5J0UA 8ICNA 4XQ7A 2BCUA 4NLZA 5DDMA 4IQWA 8ICMA 9ICGA 3RJJA 4X4QA 3LK9A 4UB1A 3WFOA 5J0QA 3V7JA 4LZDA 4M0AA 4MF2A 3JPOA 4IG8A 1OU5A 1BPDA 5CJ7A 8ICZA 4RQ6A 4NKTA 3HWTA 4FH5A 2PFPA 1ZQXA 4XQ8A 2PFNA 5J2FA 4WC6A 4LT6A 5J2HA 4AT7A 3L9DA 5IIOA 4PHAA 8ICXA 3JZ0A 5DBBA 8ICKA 4M9LA 4MFFA 4DOCA 1RPLA 5J2GA 4QZIA 4E8FA 4DOAA 5J2EA 5IILA 3OVBA 3WFSC 4M9NA 4RQ5A 4KLDA 3C5GA 3K75D 5DECA 3HJ1A 3UXOA 2O5AA 4UBCA 3ISCA 1ZQYA 9ICNA 1MIWA 5DEDA 4UD5A 4RWQA 4PGYA 2NRKA 5DB6A 4YMOA 1ZQVA 1NO5A 9ICTA 9ICUA 4IQVA 4XA5A 3UPQA 3H39A 4YCXA 9ICRA 3RJKA 1TFYA 4F5QA 1R8CA 3MDCA 4X4RA 5J0WA 3AQKA 3JYYA 7ICOA 3OV7A 4RWNA 4EBJA 2DR7A 4PH5A 3HX0A 5HRDA 1ZQUA 2PFQA 3C66A 4QZEA 2W9MA 2BCQA 4QZCA 7ICVA 1ZQHA 4I2IA 4MFCA 4Z6CA 4WBZA 1MQ3A 2BPGA 2DR8A 3RJHA 9ICKA 5HHHA 3MBYA 9ICIA 7ICKA 3RJEA 5HRIA 3MGHA 4QZDA 8ICSA 1ZQPA 7ICGA 4RQ0A 5HRBA 4WCWA 5DBCA 2B56A 4AT9A 3WFQE 8ICQA 1R8BA 4NLNA 4UAYA 3GDXA 2ZH8A 9ICFA 5CP2A 4FO6A 5HRLA 4WC5A 4R66A 3RJIA 4UB5A 3RH4A 4TURA 5IIMA 5CR0A 1YLQA 2Q66A 4I2JA 4WC0A 5CB1A 5IIKA 5J0SA 4NKUA 4WC4A 4O9MA 1ZQOA 4KLJA 3H3AA 9ICMA 4NLKA 4PHEA 4KLHA 4I2GA 4ATBA 7ICUA 3UPSA 1XSPA 4WC3A 5D46A 5J0RA 4M2YA 3MGIA 2BCSA 2IHMA 2ZH2A 5DB8A 7ICPA 2P66A 1TV9A 3RH5A 4PPXA 2M2WA 2ZH5A 1ZQBA 4F5PA 4F5RA 3C18A 9ICLA 1RZTA 4GXJA 4PHDA 5HRHA 4AT8A 1NOMA 1ZQGA 4Z6EA 5HRGA 3H37A 4KLQA 2FMQA 2BPFA 1XSLA 5D4BA 2DRAA 4M9HA 3UQ2A 4WC7A 4O5CA 4EBKA 1XSNA 4NM2A 4M9GA 4UBBA 3V7LA 3UXNA 8ICYA 1ZQCA 4LZGA 4YMNA 5D49A 4PGQA 4UD4A 3TFSA 9ICCA 4UAWA 1Q78A 2ID1A 4P4MA 4I2HA 8ICWA 7ICHA 7ICQA 4F5NA 3LQCB 8ICTA 4FHWA 2ZH7A 4WBYA 4LVSA 4AT7B 4RQ3A 1ZQMA 1BPYA 3OGUA 7ICIA 2PBEA 3AQNA 4TUSA 1ZJMA 8ICUA 2ZH4A 3C5FA 4RWPA 4GXIA 1PX5A 5J2CA
chains in the Genus database with same CATH superfamily
1MIVA 1ZQWA 4RQ8A 4I2AA 3C2KA 4M5DA 5J0TA 4LEVA 2FMPA 3AU2A 3RH6A 4X0AA 3JPRA 4QZ9A 4KLTA 9ICJA 4UB2A 4N7RA 4QZGA 4X4TA 5DB9A 2ZHBA 2B51A 3RJFA 2PXIA 3WFPA 4X4UA 4YD2A 1ZQIA 2I9GA 4X4PA 8ICRA 4I2FA 5DBAA 4K4IA 3V72A 4FHPA 3PMLA 3OWGA 2DRBA 1R8AA 4I2BA 9ICXA 4F5OA 2HHPA 2ZHAA 1HUZA 1ZQJA 5TZVA 3B0XA 4MKPA 5CA7A 5DB7A 2DR5A 4RWOA 4LEYA 4X4NA 2BBJA 1UETA 4LEZA 4P4OA 5CFSA 4TUPA 4KLSA 4X4VA 1ZJNA 5CWRA 4DO9A 3OUYB 4QZAA 4OAFA 4AT9B 3PMNA 1VJ7A 9ICPA 4RQ7A 4O69A 3NYBA 8ICOA 5J0PA 4KLFA 4NM1A 4X5VA 3NWIA 4RQ1A 4QZHA 1JN3A 8ICVA 1BPXA 4O67A 4P2HA 8ICLA 4NXTA 4M04A 1ZQSA 1F5AA 4I2CA 5D61A 1MQ2A 7ICSA 4JWMA 4OAHA 2DVIA 3MDAA 1R89A 1FA0A 3OVAA 5HRKA 9ICHA 4KLGA 9ICVA 4RPXA 5IIJA 4PHPA 2BCRA 3H38A 4XUSA 4XRHA 4NXVA 4FHVA 5J2KA 4UAZA 4WQKA 9ICQA 4FH3A 4WC1A 5J2AA 1ZQAA 4YD1A 2DR9A 3NKUA 4RPYA 9ICBA 4RT2A 4KLIA 2ZH6A 1UEUA 4K97A 2IUBA 5EOZA 5D63A 9ICOA 3C2MA 4AT8B 2BE3A 1TVAA 1ZQRA 4DOBA 2ISPA 4FHXA 5J2JA 1HUOA 4E80A 4TUQA 3WFRE 4WC2A 1JMSA 4R63A 7ICTA 4K4HA 4P4PA 4NY8A 4EEDA 3PNCA 5B3PA 3HIYA 3JPTA 4NXZA 2BPCA 1KDHA 3AQLA 4I29A 4JWNA 3AU6A 1MIYA 3HW8A 3HJ4A 7ICJA 1ZQTA 4E7XA 4M9JA 5J0XA 2M2VA 4QZ8A 4QZFA 5HHIA 4EGWA 5DDYA 4MF8A 8ICFA 2VANA 5J2BA 4KLLA 4I28A 3TFRA 5J29A 4QZBA 1BPBA 5IIIA 4M47A 1TFWA 1ZQFA 2PFOA 1ZQDA 3K7DA 4KM5A 4PGXA 2IHOA 5F2VO 5J0OA 8ICHA 4RQ2A 1ZQLA 8ICGA 4NXUA 1VFGA 7ICNA 8ICEA 8ICAA 5BOMA 4JLZA 1ZQNA 3PHZA 4I2DA 4IQUA 3JPQA 5JTGA 1BPZA 4KLUA 7ICMA 5DKWA 1Q79A 1JQRA 4RPZA 3AUOA 1UEVA 7ICLA 3C2LA 4S3NA 5BPCA 2RFFA 3V7KA 8ICPA 1KNYA 4UB3A 4WOYA 4R65A 2GWSA 2B4VA 9ICAA 4KB6A 1GPJA 5HREA 8ICIA 4X0BA 1WOTA 5HC9A 4RT3A 4K4GA 4RQ4A 4YMMA 8ICBA 3EF2A 1ZQKA 5BOLA 4R64A 2FMSA 9ICEA 4I27A 4KLEA 4K96A 4Z6DA 8ICJA 4FO1A 7ICEA 3OUYA 8ICCA 4FHYA 1ZQZA 7ICRA 3JPPA 4X4OA 2M2TA 4YN4A 2ZH3A 2BBHA 4KLMA 4X4SA 1JAJA 4O68A 5J2IA 3OVSA 3AQMA 4GXKA 1ZQQA 5HR9A 5J2DA 3ISDA 2ZH9A 4MFAA 5CHGA 1V4AA 5HRFA 2BCVA 3UXPA 7ICFA 4EV6A 1KEJA 4O6AA 4EP7A 5CHEA 2O1PA 9ICWA 4O5KA 3B0YA 4I2EA 4O5EA 4Z6FA 5IINA 9ICSA 4IQTA 4K8VA 4KLOA 3RJGA 4ATBB 1BPEA 2ZH1A 3JPNA 2ISOA 5J0YA 4UB4A 3UQ0A 3JPSA 1ZQEA 2M2UA 3ISBA 5J0UA 8ICNA 2EWRA 4XQ7A 2BCUA 4OAIZ 5DDMA 4NLZA 4IQWA 8ICMA 9ICGA 3RJJA 4X4QA 3LK9A 4UB1A 3WFOA 5J0QA 3V7JA 4LZDA 4M0AA 4MF2A 3JPOA 4IG8A 1OU5A 1BPDA 5CJ7A 8ICZA 4RQ6A 4NKTA 3HWTA 4JLXA 4FH5A 3ERCC 2PFPA 1ZQXA 4XQ8A 2PFNA 5J2FA 4WC6A 4LT6A 5J2HA 4AT7A 3L9DA 5IIOA 4PHAA 8ICXA 3JZ0A 5DBBA 8ICKA 4M9LA 4MFFA 4DOCA 1RPLA 5J2GA 4QZIA 4E8FA 4DOAA 4OAGA 2FCLA 3OVBA 4EEBA 5J2EA 5IILA 3WFSC 4WH5A 4M9NA 4RQ5A 4KLDA 3C5GA 3K75D 5DECA 3HJ1A 3UXOA 2O5AA 4UBCA 3ISCA 1ZQYA 9ICNA 1MIWA 5DEDA 4RWQA 4UD5A 4PGYA 2NRKA 5DB6A 4YMOA 1ZQVA 1NO5A 9ICTA 9ICUA 4XJEA 4IQVA 4XA5A 3UPQA 3H39A 4YCXA 9ICRA 3RJKA 1TFYA 4F5QA 4K9AA 3ER9B 1R8CA 3MDCA 4X4RA 5J0WA 3AQKA 3JYYA 4K9BA 7ICOA 3OV7A 4RWNA 4EBJA 2DR7A 4PH5A 3HX0A 5HRDA 1ZQUA 2PFQA 3C66A 3ER8C 4QZEA 2W9MA 2BCQA 4QZCA 7ICVA 1ZQHA 4I2IA 4MFCA 4Z6CA 4WBZA 1MQ3A 2BPGA 2DR8A 3RJHA 9ICKA 5HHHA 3MBYA 9ICIA 7ICKA 3RJEA 5HRIA 3MGHA 2HN2A 4QZDA 8ICSA 1ZQPA 7ICGA 4RQ0A 5HRBA 4WCWA 5DBCA 2B56A 4AT9A 3WFQE 3NVOA 8ICQA 1R8BA 4NLNA 4UAYA 3GDXA 4LEWA 2ZH8A 5CP2A 9ICFA 4FO6A 5HRLA 4WC5A 4R66A 5CFUA 3RJIA 4UB5A 3RH4A 4TURA 5IIMA 5CR0A 1YLQA 4K99A 2Q66A 4I2JA 4WC0A 5CB1A 2GA9D 5IIKA 5J0SA 4NKUA 4WC4A 4O9MA 1ZQOA 4KLJA 3H3AA 9ICMA 4NLKA 4PHEA 4KLHA 2HN1A 4ATBA 4I2GA 7ICUA 4K98A 3UPSA 1XSPA 5B3QA 5D46A 4WC3A 5J0RA 4M2YA 3MGIA 2BCSA 2IHMA 2ZH2A 5DB8A 7ICPA 2P66A 1TV9A 3MCRA 5CFTA 3RH5A 4PPXA 2ZH5A 4HX0A 4WQLA 2M2WA 1ZQBA 4F5PA 4F5RA 3C18A 9ICLA 1RZTA 4GXJA 4PHDA 5HRHA 4AT8A 1NOMA 1ZQGA 5HRGA 4Z6EA 3H37A 4I0UA 4KLQA 2FMQA 2BPFA 1XSLA 5D4BA 2GAFD 2DRAA 4M9HA 3UQ2A 4WC7A 4O5CA 4EBKA 1XSNA 4NM2A 4M9GA 4UBBA 3V7LA 3UXNA 5D62A 8ICYA 1ZQCA 4LZGA 4YMNA 5D49A 3JCFA 4PGQA 4UD4A 3TFSA 9ICCA 4UAWA 1Q78A 2ID1A 4P4MA 4I2HA 8ICWA 7ICHA 7ICQA 4F5NA 3CK6A 3LQCB 8ICTA 4FHWA 2ZH7A 4WBYA 4LVSA 4AT7B 4RQ3A 1ZQMA 1BPYA 3OGUA 4NXXA 7ICIA 2PBEA 3AQNA 4TUSA 1ZJMA 8ICUA 2ZH4A 3C5FA 4RWPA 4GXIA 1PX5A 5J2CA 4NXWA
chains in the Genus database with same CATH topology
1MIVA 1ZQWA 4RQ8A 4I2AA 3C2KA 4M5DA 5J0TA 4LEVA 2FMPA 3AU2A 3RH6A 4X0AA 3JPRA 4QZ9A 4KLTA 9ICJA 4UB2A 4QZGA 4X4TA 5DB9A 2ZHBA 2B51A 3RJFA 2PXIA 3WFPA 4X4UA 4YD2A 1ZQIA 2I9GA 4X4PA 8ICRA 4I2FA 5DBAA 4K4IA 3V72A 4FHPA 3PMLA 2DRBA 1R8AA 4I2BA 9ICXA 4F5OA 2HHPA 2ZHAA 1HUZA 1ZQJA 5TZVA 3B0XA 4MKPA 5CA7A 5DB7A 2DR5A 4RWOA 4LEYA 4X4NA 1UETA 4LEZA 4P4OA 4TUPA 4KLSA 4X4VA 1ZJNA 5CWRA 4DO9A 3OUYB 4QZAA 4OAFA 4AT9B 3PMNA 1VJ7A 9ICPA 4RQ7A 4O69A 3NYBA 8ICOA 5J0PA 4KLFA 4NM1A 4X5VA 4RQ1A 4QZHA 1JN3A 8ICVA 1BPXA 4O67A 4P2HA 8ICLA 4NXTA 4M04A 1ZQSA 1F5AA 4I2CA 1MQ2A 7ICSA 4JWMA 4OAHA 2DVIA 3MDAA 1R89A 1FA0A 3OVAA 5HRKA 9ICHA 4KLGA 9ICVA 4RPXA 5IIJA 4PHPA 2BCRA 3H38A 4XUSA 4XRHA 4NXVA 4FHVA 5J2KA 4UAZA 9ICQA 4FH3A 4WC1A 5J2AA 1ZQAA 4YD1A 2DR9A 4RPYA 9ICBA 4RT2A 4KLIA 2ZH6A 1UEUA 4K97A 5EOZA 9ICOA 3C2MA 4AT8B 2BE3A 1TVAA 1ZQRA 4DOBA 2ISPA 4FHXA 5J2JA 1HUOA 4E80A 4TUQA 3WFRE 4WC2A 1JMSA 4R63A 7ICTA 4K4HA 4P4PA 4NY8A 3PNCA 3HIYA 3JPTA 4NXZA 2BPCA 1KDHA 3AQLA 4I29A 4JWNA 3AU6A 1MIYA 3HW8A 3HJ4A 7ICJA 1ZQTA 4E7XA 4M9JA 5J0XA 2M2VA 4QZ8A 4QZFA 5HHIA 5DDYA 4MF8A 8ICFA 2VANA 5J2BA 4KLLA 4I28A 3TFRA 5J29A 4QZBA 1BPBA 5IIIA 4M47A 1TFWA 1ZQFA 2PFOA 1ZQDA 4KM5A 4PGXA 5F2VO 5J0OA 8ICHA 4RQ2A 1ZQLA 8ICGA 4NXUA 1VFGA 7ICNA 8ICEA 8ICAA 5BOMA 4JLZA 1ZQNA 4I2DA 4IQUA 4KLUA 3JPQA 1BPZA 7ICMA 5DKWA 1Q79A 1JQRA 4RPZA 3AUOA 1UEVA 7ICLA 3C2LA 5BPCA 4S3NA 2RFFA 3V7KA 8ICPA 1KNYA 4UB3A 4WOYA 4R65A 2GWSA 2B4VA 9ICAA 4KB6A 5HREA 8ICIA 4X0BA 1WOTA 5HC9A 4RT3A 4K4GA 4RQ4A 4YMMA 8ICBA 1ZQKA 5BOLA 4R64A 2FMSA 9ICEA 4I27A 4KLEA 4K96A 4Z6DA 8ICJA 7ICEA 3OUYA 8ICCA 4FHYA 1ZQZA 7ICRA 3JPPA 4X4OA 2M2TA 2ZH3A 4YN4A 4KLMA 4X4SA 1JAJA 4O68A 5J2IA 3OVSA 3AQMA 4GXKA 1ZQQA 5HR9A 5J2DA 3ISDA 2ZH9A 4MFAA 5CHGA 1V4AA 5HRFA 2BCVA 3UXPA 7ICFA 1KEJA 4O6AA 4EP7A 2O1PA 9ICWA 4O5KA 3B0YA 4I2EA 4O5EA 4Z6FA 5IINA 9ICSA 4IQTA 4K8VA 4KLOA 3RJGA 4ATBB 1BPEA 2ZH1A 3JPNA 2ISOA 5J0YA 4UB4A 3UQ0A 3JPSA 1ZQEA 2M2UA 3ISBA 5J0UA 8ICNA 4XQ7A 2BCUA 4OAIZ 5DDMA 4NLZA 4IQWA 8ICMA 9ICGA 3RJJA 4X4QA 3LK9A 4UB1A 3WFOA 5J0QA 3V7JA 4LZDA 4M0AA 4MF2A 3JPOA 4IG8A 1OU5A 1BPDA 5CJ7A 8ICZA 4RQ6A 4NKTA 3HWTA 4JLXA 4FH5A 2PFPA 1ZQXA 4XQ8A 2PFNA 5J2FA 4WC6A 4LT6A 5J2HA 4AT7A 3L9DA 5IIOA 4PHAA 8ICXA 3JZ0A 5DBBA 8ICKA 4M9LA 4MFFA 4DOCA 1RPLA 5J2GA 4QZIA 4E8FA 4DOAA 4OAGA 5J2EA 3OVBA 5IILA 3WFSC 4M9NA 4RQ5A 4KLDA 3C5GA 3K75D 5DECA 3HJ1A 3UXOA 2O5AA 4UBCA 3ISCA 1ZQYA 9ICNA 1MIWA 5DEDA 4UD5A 4RWQA 4PGYA 2NRKA 5DB6A 4YMOA 1ZQVA 1NO5A 9ICTA 9ICUA 4IQVA 4XA5A 3UPQA 3H39A 4YCXA 9ICRA 3RJKA 1TFYA 4F5QA 4K9AA 1R8CA 3MDCA 4X4RA 5J0WA 3AQKA 3JYYA 4K9BA 7ICOA 3OV7A 4RWNA 4EBJA 2DR7A 4PH5A 3HX0A 5HRDA 1ZQUA 2PFQA 3C66A 4QZEA 2W9MA 2BCQA 4QZCA 7ICVA 1ZQHA 4I2IA 4MFCA 4Z6CA 4WBZA 1MQ3A 2BPGA 2DR8A 3RJHA 9ICKA 5HHHA 3MBYA 9ICIA 7ICKA 3RJEA 5HRIA 3MGHA 4QZDA 8ICSA 1ZQPA 7ICGA 4RQ0A 5HRBA 4WCWA 5DBCA 2B56A 4AT9A 3WFQE 8ICQA 1R8BA 4NLNA 4UAYA 3GDXA 4LEWA 2ZH8A 5CP2A 9ICFA 4FO6A 5HRLA 4WC5A 4R66A 3RJIA 4UB5A 3RH4A 4TURA 5IIMA 5CR0A 1YLQA 4K99A 2Q66A 4I2JA 4WC0A 5CB1A 5IIKA 5J0SA 4NKUA 4WC4A 4O9MA 1ZQOA 4KLJA 3H3AA 9ICMA 4NLKA 4PHEA 4KLHA 4I2GA 4ATBA 7ICUA 4K98A 3UPSA 1XSPA 4WC3A 5D46A 5J0RA 4M2YA 3MGIA 2BCSA 2IHMA 2ZH2A 5DB8A 7ICPA 2P66A 1TV9A 3RH5A 4PPXA 2ZH5A 2M2WA 1ZQBA 4F5PA 4F5RA 3C18A 9ICLA 1RZTA 4GXJA 4PHDA 5HRHA 4AT8A 1NOMA 1ZQGA 4Z6EA 5HRGA 3H37A 4KLQA 2FMQA 2BPFA 1XSLA 5D4BA 2DRAA 4M9HA 3UQ2A 4WC7A 4O5CA 4EBKA 1XSNA 4NM2A 4M9GA 4UBBA 3V7LA 3UXNA 8ICYA 1ZQCA 4LZGA 4YMNA 5D49A 4PGQA 4UD4A 3TFSA 9ICCA 4UAWA 1Q78A 2ID1A 4P4MA 4I2HA 8ICWA 7ICHA 7ICQA 4F5NA 3LQCB 8ICTA 4FHWA 2ZH7A 4WBYA 4LVSA 4AT7B 4RQ3A 1ZQMA 1BPYA 3OGUA 4NXXA 7ICIA 2PBEA 3AQNA 4TUSA 1ZJMA 8ICUA 2ZH4A 3C5FA 4RWPA 4GXIA 1PX5A 5J2CA 4NXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIV A;  1ZQW A;  4RQ8 A;  4I2A A;  3C2K A;  4M5D A;  5J0T A;  2FMP A;  3AU2 A;  3RH6 A;  4X0A A;  3JPR A;  4QZ9 A;  4KLT A;  9ICJ A;  4UB2 A;  4QZG A;  4X4T A;  5DB9 A;  2ZHB A;  2B51 A;  3RJF A;  2PXI A;  3WFP A;  4X4U A;  4YD2 A;  1ZQI A;  2I9G A;  4X4P A;  8ICR A;  4I2F A;  5DBA A;  4K4I A;  3V72 A;  4FHP A;  3PML A;  2DRB A;  1R8A A;  4I2B A;  9ICX A;  4F5O A;  2HHP A;  2ZHA A;  1HUZ A;  1ZQJ A;  5TZV A;  3B0X A;  5CA7 A;  5DB7 A;  2DR5 A;  4RWO A;  4X4N A;  1UET A;  4P4O A;  4TUP A;  4KLS A;  4X4V A;  1ZJN A;  5CWR A;  4DO9 A;  3OUY B;  4QZA A;  4AT9 B;  3PMN A;  1VJ7 A;  9ICP A;  4RQ7 A;  3NYB A;  8ICO A;  5J0P A;  4KLF A;  4NM1 A;  4X5V A;  4RQ1 A;  4QZH A;  1JN3 A;  8ICV A;  1BPX A;  4P2H A;  8ICL A;  4M04 A;  1ZQS A;  1F5A A;  4I2C A;  1MQ2 A;  7ICS A;  4JWM A;  2DVI A;  3MDA A;  1R89 A;  1FA0 A;  5HRK A;  3OVA A;  9ICH A;  4KLG A;  9ICV A;  4RPX A;  5IIJ A;  4PHP A;  2BCR A;  3H38 A;  4XUS A;  4XRH A;  4FHV A;  5J2K A;  4UAZ A;  9ICQ A;  4FH3 A;  4WC1 A;  5J2A A;  1ZQA A;  4YD1 A;  2DR9 A;  4RPY A;  9ICB A;  4RT2 A;  4KLI A;  2ZH6 A;  1UEU A;  5EOZ A;  9ICO A;  3C2M A;  4AT8 B;  2BE3 A;  1TVA A;  1ZQR A;  4DOB A;  2ISP A;  4FHX A;  5J2J A;  1HUO A;  4E80 A;  4TUQ A;  3WFR E;  4WC2 A;  1JMS A;  4R63 A;  7ICT A;  4K4H A;  4P4P A;  4NY8 A;  3PNC A;  3HIY A;  3JPT A;  4NXZ A;  2BPC A;  1KDH A;  3AQL A;  4I29 A;  4JWN A;  3AU6 A;  1MIY A;  3HW8 A;  3HJ4 A;  7ICJ A;  1ZQT A;  4E7X A;  4M9J A;  5J0X A;  2M2V A;  4QZ8 A;  4QZF A;  5HHI A;  5DDY A;  4MF8 A;  8ICF A;  2VAN A;  5J2B A;  4KLL A;  4I28 A;  3TFR A;  5J29 A;  4QZB A;  1BPB A;  5III A;  4M47 A;  1TFW A;  1ZQF A;  2PFO A;  1ZQD A;  4PGX A;  5F2V O;  5J0O A;  8ICH A;  4RQ2 A;  1ZQL A;  8ICG A;  1VFG A;  7ICN A;  8ICE A;  8ICA A;  5BOM A;  1ZQN A;  4I2D A;  4IQU A;  4KLU A;  3JPQ A;  1BPZ A;  7ICM A;  5DKW A;  1Q79 A;  1JQR A;  4RPZ A;  3AUO A;  1UEV A;  7ICL A;  3C2L A;  5BPC A;  4S3N A;  2RFF A;  3V7K A;  8ICP A;  1KNY A;  4UB3 A;  4R65 A;  2GWS A;  2B4V A;  9ICA A;  5HRE A;  8ICI A;  4X0B A;  1WOT A;  5HC9 A;  4RT3 A;  4K4G A;  4RQ4 A;  4YMM A;  8ICB A;  1ZQK A;  5BOL A;  4R64 A;  2FMS A;  9ICE A;  4I27 A;  4KLE A;  4Z6D A;  8ICJ A;  7ICE A;  3OUY A;  8ICC A;  4FHY A;  1ZQZ A;  7ICR A;  3JPP A;  4X4O A;  2M2T A;  4YN4 A;  2ZH3 A;  4KLM A;  4X4S A;  1JAJ A;  5J2I A;  3OVS A;  3AQM A;  4GXK A;  1ZQQ A;  5HR9 A;  5J2D A;  3ISD A;  4MFA A;  2ZH9 A;  5CHG A;  1V4A A;  5HRF A;  2BCV A;  3UXP A;  7ICF A;  1KEJ A;  4EP7 A;  2O1P A;  9ICW A;  4O5K A;  3B0Y A;  4I2E A;  4O5E A;  4Z6F A;  5IIN A;  9ICS A;  4IQT A;  4KLO A;  3RJG A;  4ATB B;  1BPE A;  2ZH1 A;  3JPN A;  2ISO A;  5J0Y A;  4UB4 A;  3UQ0 A;  3JPS A;  1ZQE A;  2M2U A;  3ISB A;  5J0U A;  8ICN A;  4XQ7 A;  2BCU A;  4NLZ A;  5DDM A;  4IQW A;  8ICM A;  9ICG A;  3RJJ A;  4X4Q A;  3LK9 A;  4UB1 A;  3WFO A;  5J0Q A;  3V7J A;  4LZD A;  4M0A A;  4MF2 A;  3JPO A;  4IG8 A;  1OU5 A;  1BPD A;  5CJ7 A;  8ICZ A;  4RQ6 A;  4NKT A;  3HWT A;  4FH5 A;  2PFP A;  1ZQX A;  4XQ8 A;  2PFN A;  5J2F A;  4WC6 A;  4LT6 A;  5J2H A;  4AT7 A;  3L9D A;  5IIO A;  4PHA A;  8ICX A;  3JZ0 A;  5DBB A;  8ICK A;  4M9L A;  4MFF A;  4DOC A;  1RPL A;  5J2G A;  4QZI A;  4E8F A;  4DOA A;  5J2E A;  5IIL A;  3OVB A;  3WFS C;  4M9N A;  4RQ5 A;  4KLD A;  3C5G A;  3K75 D;  5DEC A;  3HJ1 A;  3UXO A;  2O5A A;  4UBC A;  3ISC A;  1ZQY A;  9ICN A;  1MIW A;  5DED A;  4UD5 A;  4RWQ A;  4PGY A;  2NRK A;  5DB6 A;  4YMO A;  1ZQV A;  1NO5 A;  9ICT A;  9ICU A;  4IQV A;  4XA5 A;  3UPQ A;  3H39 A;  4YCX A;  9ICR A;  3RJK A;  1TFY A;  4F5Q A;  1R8C A;  3MDC A;  4X4R A;  5J0W A;  3AQK A;  3JYY A;  7ICO A;  3OV7 A;  4RWN A;  4EBJ A;  2DR7 A;  4PH5 A;  3HX0 A;  5HRD A;  1ZQU A;  2PFQ A;  3C66 A;  4QZE A;  2W9M A;  2BCQ A;  4QZC A;  7ICV A;  1ZQH A;  4I2I A;  4MFC A;  4Z6C A;  4WBZ A;  1MQ3 A;  2BPG A;  2DR8 A;  3RJH A;  9ICK A;  5HHH A;  3MBY A;  9ICI A;  7ICK A;  3RJE A;  5HRI A;  3MGH A;  4QZD A;  8ICS A;  1ZQP A;  7ICG A;  4RQ0 A;  5HRB A;  4WCW A;  5DBC A;  2B56 A;  4AT9 A;  3WFQ E;  8ICQ A;  1R8B A;  4NLN A;  4UAY A;  3GDX A;  2ZH8 A;  9ICF A;  5CP2 A;  4FO6 A;  5HRL A;  4WC5 A;  4R66 A;  3RJI A;  4UB5 A;  3RH4 A;  4TUR A;  5IIM A;  5CR0 A;  1YLQ A;  2Q66 A;  4I2J A;  4WC0 A;  5CB1 A;  5IIK A;  5J0S A;  4NKU A;  4WC4 A;  4O9M A;  1ZQO A;  4KLJ A;  3H3A A;  9ICM A;  4NLK A;  4PHE A;  4KLH A;  4I2G A;  4ATB A;  7ICU A;  3UPS A;  1XSP A;  4WC3 A;  5D46 A;  5J0R A;  4M2Y A;  3MGI A;  2BCS A;  2IHM A;  2ZH2 A;  5DB8 A;  7ICP A;  2P66 A;  1TV9 A;  3RH5 A;  4PPX A;  2M2W A;  2ZH5 A;  1ZQB A;  4F5P A;  4F5R A;  3C18 A;  9ICL A;  1RZT A;  4GXJ A;  4PHD A;  5HRH A;  4AT8 A;  1NOM A;  1ZQG A;  4Z6E A;  5HRG A;  3H37 A;  4KLQ A;  2FMQ A;  2BPF A;  1XSL A;  5D4B A;  2DRA A;  4M9H A;  3UQ2 A;  4WC7 A;  4O5C A;  4EBK A;  1XSN A;  4NM2 A;  4M9G A;  4UBB A;  3V7L A;  3UXN A;  8ICY A;  1ZQC A;  4LZG A;  4YMN A;  5D49 A;  4PGQ A;  4UD4 A;  3TFS A;  9ICC A;  4UAW A;  1Q78 A;  2ID1 A;  4P4M A;  4I2H A;  8ICW A;  7ICH A;  7ICQ A;  4F5N A;  3LQC B;  8ICT A;  4FHW A;  2ZH7 A;  4WBY A;  4LVS A;  4AT7 B;  4RQ3 A;  1ZQM A;  1BPY A;  3OGU A;  7ICI A;  2PBE A;  3AQN A;  4TUS A;  1ZJM A;  8ICU A;  2ZH4 A;  3C5F A;  4RWP A;  4GXI A;  1PX5 A;  5J2C A; 
#chains in the Genus database with same CATH topology
 1MIV A;  1ZQW A;  4RQ8 A;  4I2A A;  3C2K A;  4M5D A;  5J0T A;  4LEV A;  2FMP A;  3AU2 A;  3RH6 A;  4X0A A;  3JPR A;  4QZ9 A;  4KLT A;  9ICJ A;  4UB2 A;  4N7R A;  4QZG A;  4X4T A;  5DB9 A;  2ZHB A;  2B51 A;  3RJF A;  2PXI A;  3WFP A;  4X4U A;  4YD2 A;  1ZQI A;  2I9G A;  4X4P A;  8ICR A;  4I2F A;  5DBA A;  4K4I A;  3V72 A;  4FHP A;  3PML A;  3OWG A;  2DRB A;  1R8A A;  4I2B A;  9ICX A;  4F5O A;  2HHP A;  2ZHA A;  1HUZ A;  1ZQJ A;  5TZV A;  3B0X A;  4MKP A;  5CA7 A;  5DB7 A;  2DR5 A;  4RWO A;  4LEY A;  4X4N A;  2BBJ A;  1UET A;  4LEZ A;  4P4O A;  5CFS A;  4TUP A;  4KLS A;  4X4V A;  1ZJN A;  5CWR A;  4DO9 A;  3OUY B;  4QZA A;  4OAF A;  4AT9 B;  3PMN A;  1VJ7 A;  9ICP A;  4RQ7 A;  4O69 A;  3NYB A;  8ICO A;  5J0P A;  4KLF A;  4NM1 A;  4X5V A;  3NWI A;  4RQ1 A;  4QZH A;  1JN3 A;  8ICV A;  1BPX A;  4O67 A;  4P2H A;  8ICL A;  4NXT A;  4M04 A;  1ZQS A;  1F5A A;  4I2C A;  5D61 A;  1MQ2 A;  7ICS A;  4JWM A;  4OAH A;  2DVI A;  3MDA A;  1R89 A;  1FA0 A;  3OVA A;  5HRK A;  9ICH A;  4KLG A;  9ICV A;  4RPX A;  5IIJ A;  4PHP A;  2BCR A;  3H38 A;  4XUS A;  4XRH A;  4NXV A;  4FHV A;  5J2K A;  4UAZ A;  4WQK A;  9ICQ A;  4FH3 A;  4WC1 A;  5J2A A;  1ZQA A;  4YD1 A;  2DR9 A;  3NKU A;  4RPY A;  9ICB A;  4RT2 A;  4KLI A;  2ZH6 A;  1UEU A;  4K97 A;  2IUB A;  5EOZ A;  5D63 A;  9ICO A;  3C2M A;  4AT8 B;  2BE3 A;  1TVA A;  1ZQR A;  4DOB A;  2ISP A;  4FHX A;  5J2J A;  1HUO A;  4E80 A;  4TUQ A;  3WFR E;  4WC2 A;  1JMS A;  4R63 A;  7ICT A;  4K4H A;  4P4P A;  4NY8 A;  4EED A;  3PNC A;  5B3P A;  3HIY A;  3JPT A;  4NXZ A;  2BPC A;  1KDH A;  3AQL A;  4I29 A;  4JWN A;  3AU6 A;  1MIY A;  3HW8 A;  3HJ4 A;  7ICJ A;  1ZQT A;  4E7X A;  4M9J A;  5J0X A;  2M2V A;  4QZ8 A;  4QZF A;  5HHI A;  4EGW A;  5DDY A;  4MF8 A;  8ICF A;  2VAN A;  5J2B A;  4KLL A;  4I28 A;  3TFR A;  5J29 A;  4QZB A;  1BPB A;  5III A;  4M47 A;  1TFW A;  1ZQF A;  2PFO A;  1ZQD A;  3K7D A;  4KM5 A;  4PGX A;  2IHO A;  5F2V O;  5J0O A;  8ICH A;  4RQ2 A;  1ZQL A;  8ICG A;  4NXU A;  1VFG A;  7ICN A;  8ICE A;  8ICA A;  5BOM A;  4JLZ A;  1ZQN A;  3PHZ A;  4I2D A;  4IQU A;  3JPQ A;  5JTG A;  1BPZ A;  4KLU A;  7ICM A;  5DKW A;  1Q79 A;  1JQR A;  4RPZ A;  3AUO A;  1UEV A;  7ICL A;  3C2L A;  4S3N A;  5BPC A;  2RFF A;  3V7K A;  8ICP A;  1KNY A;  4UB3 A;  4WOY A;  4R65 A;  2GWS A;  2B4V A;  9ICA A;  4KB6 A;  1GPJ A;  5HRE A;  8ICI A;  4X0B A;  1WOT A;  5HC9 A;  4RT3 A;  4K4G A;  4RQ4 A;  4YMM A;  8ICB A;  3EF2 A;  1ZQK A;  5BOL A;  4R64 A;  2FMS A;  9ICE A;  4I27 A;  4KLE A;  4K96 A;  4Z6D A;  8ICJ A;  4FO1 A;  7ICE A;  3OUY A;  8ICC A;  4FHY A;  1ZQZ A;  7ICR A;  3JPP A;  4X4O A;  2M2T A;  4YN4 A;  2ZH3 A;  2BBH A;  4KLM A;  4X4S A;  1JAJ A;  4O68 A;  5J2I A;  3OVS A;  3AQM A;  4GXK A;  1ZQQ A;  5HR9 A;  5J2D A;  3ISD A;  2ZH9 A;  4MFA A;  5CHG A;  1V4A A;  5HRF A;  2BCV A;  3UXP A;  7ICF A;  4EV6 A;  1KEJ A;  4O6A A;  4EP7 A;  5CHE A;  2O1P A;  9ICW A;  4O5K A;  3B0Y A;  4I2E A;  4O5E A;  4Z6F A;  5IIN A;  9ICS A;  4IQT A;  4K8V A;  4KLO A;  3RJG A;  4ATB B;  1BPE A;  2ZH1 A;  3JPN A;  2ISO A;  5J0Y A;  4UB4 A;  3UQ0 A;  3JPS A;  1ZQE A;  2M2U A;  3ISB A;  5J0U A;  8ICN A;  2EWR A;  4XQ7 A;  2BCU A;  4OAI Z;  5DDM A;  4NLZ A;  4IQW A;  8ICM A;  9ICG A;  3RJJ A;  4X4Q A;  3LK9 A;  4UB1 A;  3WFO A;  5J0Q A;  3V7J A;  4LZD A;  4M0A A;  4MF2 A;  3JPO A;  4IG8 A;  1OU5 A;  1BPD A;  5CJ7 A;  8ICZ A;  4RQ6 A;  4NKT A;  3HWT A;  4JLX A;  4FH5 A;  3ERC C;  2PFP A;  1ZQX A;  4XQ8 A;  2PFN A;  5J2F A;  4WC6 A;  4LT6 A;  5J2H A;  4AT7 A;  3L9D A;  5IIO A;  4PHA A;  8ICX A;  3JZ0 A;  5DBB A;  8ICK A;  4M9L A;  4MFF A;  4DOC A;  1RPL A;  5J2G A;  4QZI A;  4E8F A;  4DOA A;  4OAG A;  2FCL A;  3OVB A;  4EEB A;  5J2E A;  5IIL A;  3WFS C;  4WH5 A;  4M9N A;  4RQ5 A;  4KLD A;  3C5G A;  3K75 D;  5DEC A;  3HJ1 A;  3UXO A;  2O5A A;  4UBC A;  3ISC A;  1ZQY A;  9ICN A;  1MIW A;  5DED A;  4RWQ A;  4UD5 A;  4PGY A;  2NRK A;  5DB6 A;  4YMO A;  1ZQV A;  1NO5 A;  9ICT A;  9ICU A;  4XJE A;  4IQV A;  4XA5 A;  3UPQ A;  3H39 A;  4YCX A;  9ICR A;  3RJK A;  1TFY A;  4F5Q A;  4K9A A;  3ER9 B;  1R8C A;  3MDC A;  4X4R A;  5J0W A;  3AQK A;  3JYY A;  4K9B A;  7ICO A;  3OV7 A;  4RWN A;  4EBJ A;  2DR7 A;  4PH5 A;  3HX0 A;  5HRD A;  1ZQU A;  2PFQ A;  3C66 A;  3ER8 C;  4QZE A;  2W9M A;  2BCQ A;  4QZC A;  7ICV A;  1ZQH A;  4I2I A;  4MFC A;  4Z6C A;  4WBZ A;  1MQ3 A;  2BPG A;  2DR8 A;  3RJH A;  9ICK A;  5HHH A;  3MBY A;  9ICI A;  7ICK A;  3RJE A;  5HRI A;  3MGH A;  2HN2 A;  4QZD A;  8ICS A;  1ZQP A;  7ICG A;  4RQ0 A;  5HRB A;  4WCW A;  5DBC A;  2B56 A;  4AT9 A;  3WFQ E;  3NVO A;  8ICQ A;  1R8B A;  4NLN A;  4UAY A;  3GDX A;  4LEW A;  2ZH8 A;  5CP2 A;  9ICF A;  4FO6 A;  5HRL A;  4WC5 A;  4R66 A;  5CFU A;  3RJI A;  4UB5 A;  3RH4 A;  4TUR A;  5IIM A;  5CR0 A;  1YLQ A;  4K99 A;  2Q66 A;  4I2J A;  4WC0 A;  5CB1 A;  2GA9 D;  5IIK A;  5J0S A;  4NKU A;  4WC4 A;  4O9M A;  1ZQO A;  4KLJ A;  3H3A A;  9ICM A;  4NLK A;  4PHE A;  4KLH A;  2HN1 A;  4ATB A;  4I2G A;  7ICU A;  4K98 A;  3UPS A;  1XSP A;  5B3Q A;  5D46 A;  4WC3 A;  5J0R A;  4M2Y A;  3MGI A;  2BCS A;  2IHM A;  2ZH2 A;  5DB8 A;  7ICP A;  2P66 A;  1TV9 A;  3MCR A;  5CFT A;  3RH5 A;  4PPX A;  2ZH5 A;  4HX0 A;  4WQL A;  2M2W A;  1ZQB A;  4F5P A;  4F5R A;  3C18 A;  9ICL A;  1RZT A;  4GXJ A;  4PHD A;  5HRH A;  4AT8 A;  1NOM A;  1ZQG A;  5HRG A;  4Z6E A;  3H37 A;  4I0U A;  4KLQ A;  2FMQ A;  2BPF A;  1XSL A;  5D4B A;  2GAF D;  2DRA A;  4M9H A;  3UQ2 A;  4WC7 A;  4O5C A;  4EBK A;  1XSN A;  4NM2 A;  4M9G A;  4UBB A;  3V7L A;  3UXN A;  5D62 A;  8ICY A;  1ZQC A;  4LZG A;  4YMN A;  5D49 A;  3JCF A;  4PGQ A;  4UD4 A;  3TFS A;  9ICC A;  4UAW A;  1Q78 A;  2ID1 A;  4P4M A;  4I2H A;  8ICW A;  7ICH A;  7ICQ A;  4F5N A;  3CK6 A;  3LQC B;  8ICT A;  4FHW A;  2ZH7 A;  4WBY A;  4LVS A;  4AT7 B;  4RQ3 A;  1ZQM A;  1BPY A;  3OGU A;  4NXX A;  7ICI A;  2PBE A;  3AQN A;  4TUS A;  1ZJM A;  8ICU A;  2ZH4 A;  3C5F A;  4RWP A;  4GXI A;  1PX5 A;  5J2C A;  4NXW A; 
#chains in the Genus database with same CATH homology
 1MIV A;  1ZQW A;  4RQ8 A;  4I2A A;  3C2K A;  4M5D A;  5J0T A;  4LEV A;  2FMP A;  3AU2 A;  3RH6 A;  4X0A A;  3JPR A;  4QZ9 A;  4KLT A;  9ICJ A;  4UB2 A;  4QZG A;  4X4T A;  5DB9 A;  2ZHB A;  2B51 A;  3RJF A;  2PXI A;  3WFP A;  4X4U A;  4YD2 A;  1ZQI A;  2I9G A;  4X4P A;  8ICR A;  4I2F A;  5DBA A;  4K4I A;  3V72 A;  4FHP A;  3PML A;  2DRB A;  1R8A A;  4I2B A;  9ICX A;  4F5O A;  2HHP A;  2ZHA A;  1HUZ A;  1ZQJ A;  5TZV A;  3B0X A;  4MKP A;  5CA7 A;  5DB7 A;  2DR5 A;  4RWO A;  4LEY A;  4X4N A;  1UET A;  4LEZ A;  4P4O A;  4TUP A;  4KLS A;  4X4V A;  1ZJN A;  5CWR A;  4DO9 A;  3OUY B;  4QZA A;  4OAF A;  4AT9 B;  3PMN A;  1VJ7 A;  9ICP A;  4RQ7 A;  4O69 A;  3NYB A;  8ICO A;  5J0P A;  4KLF A;  4NM1 A;  4X5V A;  4RQ1 A;  4QZH A;  1JN3 A;  8ICV A;  1BPX A;  4O67 A;  4P2H A;  8ICL A;  4NXT A;  4M04 A;  1ZQS A;  1F5A A;  4I2C A;  1MQ2 A;  7ICS A;  4JWM A;  4OAH A;  2DVI A;  3MDA A;  1R89 A;  1FA0 A;  3OVA A;  5HRK A;  9ICH A;  4KLG A;  9ICV A;  4RPX A;  5IIJ A;  4PHP A;  2BCR A;  3H38 A;  4XUS A;  4XRH A;  4NXV A;  4FHV A;  5J2K A;  4UAZ A;  9ICQ A;  4FH3 A;  4WC1 A;  5J2A A;  1ZQA A;  4YD1 A;  2DR9 A;  4RPY A;  9ICB A;  4RT2 A;  4KLI A;  2ZH6 A;  1UEU A;  4K97 A;  5EOZ A;  9ICO A;  3C2M A;  4AT8 B;  2BE3 A;  1TVA A;  1ZQR A;  4DOB A;  2ISP A;  4FHX A;  5J2J A;  1HUO A;  4E80 A;  4TUQ A;  3WFR E;  4WC2 A;  1JMS A;  4R63 A;  7ICT A;  4K4H A;  4P4P A;  4NY8 A;  3PNC A;  3HIY A;  3JPT A;  4NXZ A;  2BPC A;  1KDH A;  3AQL A;  4I29 A;  4JWN A;  3AU6 A;  1MIY A;  3HW8 A;  3HJ4 A;  7ICJ A;  1ZQT A;  4E7X A;  4M9J A;  5J0X A;  2M2V A;  4QZ8 A;  4QZF A;  5HHI A;  5DDY A;  4MF8 A;  8ICF A;  2VAN A;  5J2B A;  4KLL A;  4I28 A;  3TFR A;  5J29 A;  4QZB A;  1BPB A;  5III A;  4M47 A;  1TFW A;  1ZQF A;  2PFO A;  1ZQD A;  4KM5 A;  4PGX A;  5F2V O;  5J0O A;  8ICH A;  4RQ2 A;  1ZQL A;  8ICG A;  4NXU A;  1VFG A;  7ICN A;  8ICE A;  8ICA A;  5BOM A;  4JLZ A;  1ZQN A;  4I2D A;  4IQU A;  4KLU A;  3JPQ A;  1BPZ A;  7ICM A;  5DKW A;  1Q79 A;  1JQR A;  4RPZ A;  3AUO A;  1UEV A;  7ICL A;  3C2L A;  5BPC A;  4S3N A;  2RFF A;  3V7K A;  8ICP A;  1KNY A;  4UB3 A;  4WOY A;  4R65 A;  2GWS A;  2B4V A;  9ICA A;  4KB6 A;  5HRE A;  8ICI A;  4X0B A;  1WOT A;  5HC9 A;  4RT3 A;  4K4G A;  4RQ4 A;  4YMM A;  8ICB A;  1ZQK A;  5BOL A;  4R64 A;  2FMS A;  9ICE A;  4I27 A;  4KLE A;  4K96 A;  4Z6D A;  8ICJ A;  7ICE A;  3OUY A;  8ICC A;  4FHY A;  1ZQZ A;  7ICR A;  3JPP A;  4X4O A;  2M2T A;  2ZH3 A;  4YN4 A;  4KLM A;  4X4S A;  1JAJ A;  4O68 A;  5J2I A;  3OVS A;  3AQM A;  4GXK A;  1ZQQ A;  5HR9 A;  5J2D A;  3ISD A;  2ZH9 A;  4MFA A;  5CHG A;  1V4A A;  5HRF A;  2BCV A;  3UXP A;  7ICF A;  1KEJ A;  4O6A A;  4EP7 A;  2O1P A;  9ICW A;  4O5K A;  3B0Y A;  4I2E A;  4O5E A;  4Z6F A;  5IIN A;  9ICS A;  4IQT A;  4K8V A;  4KLO A;  3RJG A;  4ATB B;  1BPE A;  2ZH1 A;  3JPN A;  2ISO A;  5J0Y A;  4UB4 A;  3UQ0 A;  3JPS A;  1ZQE A;  2M2U A;  3ISB A;  5J0U A;  8ICN A;  4XQ7 A;  2BCU A;  4OAI Z;  5DDM A;  4NLZ A;  4IQW A;  8ICM A;  9ICG A;  3RJJ A;  4X4Q A;  3LK9 A;  4UB1 A;  3WFO A;  5J0Q A;  3V7J A;  4LZD A;  4M0A A;  4MF2 A;  3JPO A;  4IG8 A;  1OU5 A;  1BPD A;  5CJ7 A;  8ICZ A;  4RQ6 A;  4NKT A;  3HWT A;  4JLX A;  4FH5 A;  2PFP A;  1ZQX A;  4XQ8 A;  2PFN A;  5J2F A;  4WC6 A;  4LT6 A;  5J2H A;  4AT7 A;  3L9D A;  5IIO A;  4PHA A;  8ICX A;  3JZ0 A;  5DBB A;  8ICK A;  4M9L A;  4MFF A;  4DOC A;  1RPL A;  5J2G A;  4QZI A;  4E8F A;  4DOA A;  4OAG A;  5J2E A;  3OVB A;  5IIL A;  3WFS C;  4M9N A;  4RQ5 A;  4KLD A;  3C5G A;  3K75 D;  5DEC A;  3HJ1 A;  3UXO A;  2O5A A;  4UBC A;  3ISC A;  1ZQY A;  9ICN A;  1MIW A;  5DED A;  4UD5 A;  4RWQ A;  4PGY A;  2NRK A;  5DB6 A;  4YMO A;  1ZQV A;  1NO5 A;  9ICT A;  9ICU A;  4IQV A;  4XA5 A;  3UPQ A;  3H39 A;  4YCX A;  9ICR A;  3RJK A;  1TFY A;  4F5Q A;  4K9A A;  1R8C A;  3MDC A;  4X4R A;  5J0W A;  3AQK A;  3JYY A;  4K9B A;  7ICO A;  3OV7 A;  4RWN A;  4EBJ A;  2DR7 A;  4PH5 A;  3HX0 A;  5HRD A;  1ZQU A;  2PFQ A;  3C66 A;  4QZE A;  2W9M A;  2BCQ A;  4QZC A;  7ICV A;  1ZQH A;  4I2I A;  4MFC A;  4Z6C A;  4WBZ A;  1MQ3 A;  2BPG A;  2DR8 A;  3RJH A;  9ICK A;  5HHH A;  3MBY A;  9ICI A;  7ICK A;  3RJE A;  5HRI A;  3MGH A;  4QZD A;  8ICS A;  1ZQP A;  7ICG A;  4RQ0 A;  5HRB A;  4WCW A;  5DBC A;  2B56 A;  4AT9 A;  3WFQ E;  8ICQ A;  1R8B A;  4NLN A;  4UAY A;  3GDX A;  4LEW A;  2ZH8 A;  5CP2 A;  9ICF A;  4FO6 A;  5HRL A;  4WC5 A;  4R66 A;  3RJI A;  4UB5 A;  3RH4 A;  4TUR A;  5IIM A;  5CR0 A;  1YLQ A;  4K99 A;  2Q66 A;  4I2J A;  4WC0 A;  5CB1 A;  5IIK A;  5J0S A;  4NKU A;  4WC4 A;  4O9M A;  1ZQO A;  4KLJ A;  3H3A A;  9ICM A;  4NLK A;  4PHE A;  4KLH A;  4I2G A;  4ATB A;  7ICU A;  4K98 A;  3UPS A;  1XSP A;  4WC3 A;  5D46 A;  5J0R A;  4M2Y A;  3MGI A;  2BCS A;  2IHM A;  2ZH2 A;  5DB8 A;  7ICP A;  2P66 A;  1TV9 A;  3RH5 A;  4PPX A;  2ZH5 A;  2M2W A;  1ZQB A;  4F5P A;  4F5R A;  3C18 A;  9ICL A;  1RZT A;  4GXJ A;  4PHD A;  5HRH A;  4AT8 A;  1NOM A;  1ZQG A;  4Z6E A;  5HRG A;  3H37 A;  4KLQ A;  2FMQ A;  2BPF A;  1XSL A;  5D4B A;  2DRA A;  4M9H A;  3UQ2 A;  4WC7 A;  4O5C A;  4EBK A;  1XSN A;  4NM2 A;  4M9G A;  4UBB A;  3V7L A;  3UXN A;  8ICY A;  1ZQC A;  4LZG A;  4YMN A;  5D49 A;  4PGQ A;  4UD4 A;  3TFS A;  9ICC A;  4UAW A;  1Q78 A;  2ID1 A;  4P4M A;  4I2H A;  8ICW A;  7ICH A;  7ICQ A;  4F5N A;  3LQC B;  8ICT A;  4FHW A;  2ZH7 A;  4WBY A;  4LVS A;  4AT7 B;  4RQ3 A;  1ZQM A;  1BPY A;  3OGU A;  4NXX A;  7ICI A;  2PBE A;  3AQN A;  4TUS A;  1ZJM A;  8ICU A;  2ZH4 A;  3C5F A;  4RWP A;  4GXI A;  1PX5 A;  5J2C A;  4NXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...