5D63A

Moa-z-vad-fmk inhibitor complex, direct/inverted dual orientation
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Agglutinin
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Hydrolase
total genus 93
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d63A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d63A02
1M16A 2BEBA 2FFUA 4CJMA 1FWUA 3CRHA 2DRZA 4I3NA 4ISRA 3O5WB 2F8XC 2HWMA 1UPSA 2AQZA 2L5XA 2I1BA 1S0BA 1PZZA 3ZX7A 3HN1A 1EVTA 2Z49A 3BAVA 5BXSA 3FJ8A 4JKXB 1PUMB 4Z8SB 4GP3A 4LO3A 1P63A 3Q7WA 4QC4A 3CA0A 3RTJB 4OW4A 1T9FA 2HWAA 2P23A 3AKIA 1WBCA 3FUOA 1FN0A 3CA1A 4EEEB 1G82A 3IM5A 4X38A 4PC4A 3BA7A 3JUTA 2D23A 2Q9XA 4OEEA 3V0BA 7I1BA 4LO0A 3HALA 2NVHA 3WMVA 1DLLA 3CQAA 1NZKA 1AVUA 4IY9A 1ILR1 1M2TB 3W9TA 3O3QA 3HBWA 1IT0A 4LO7C 3FFZA 1S0FA 1IHKA 3WA1A 1FGAA 4IHZA 3BRGC 3PG0A 5DSSB 3N7MA 5DVHA 1W3GA 3R4SA 3PUBA 2D7IA 4LO2C 1BFBA 4GOVA 4KEIA 1CVSA 5BXRA 1Z0HA 4QKRA 1BARA 3BTAA 1T4QA 3CRGA 4KEJA 4EKXB 1IRAX 1JT5A 1V6XA 1DFQA 2ESUA 4G6JA 4Z9WB 3I2AA 5FZUA 3AKGA 3RSJA 3R4UA 3OJMA 3Q7XA 3V0AA 4OUJA 4I1BA 4GAFA 1XHBA 2RQ9A 2D1ZA 4D0ZA 1I1BA 4QD2C 1I1EA 9ILBA 4X39A 3QR5A 5BXTA 1SR4C 3NBEA 2UUSA 5F8WA 1PWAA 4I4UA 1ITBA 2FFVA 4QALA 1AXMA 4A7YA 1PUUB 5BQUC 1ABRB 1RG8A 4G6MA 2HZ9A 3ILAA 3LTQA 2K4AB 4L4IA 4GOYA 2ZQOA 1HWOB 1BFFA 3BAOA 4LO8B 4IYBA 1JTCA 3BX1C 4LO3C 3BAGA 3CAHA 1WBAA 3OJVA 4FGFA 3A23A 5HPZA 1ISWA 3BAUA 2NZ9A 2LIQA 3O49A 4D0TA 1Q03A 2IHOA 1ISXA 1Z4SA 3VWCA 2WBCA 3FJBA 3NBNA 1TP0A 1R8NA 3WO2A 5BXPA 1SR4A 4J23B 3AJ6A 2IWTB 3RTIB 3FJDA 2R9KB 4J2YA 3CA5A 2E4MC 4I8MA 4ZFWB 5BQUA 3I29B 5D63A 4R6UB 3C9ZA 1FWVA 5DZUA 1EV2A 4G1RA 1BA7A 4QBCA 1AVXB 1QXMA 2BFHA 2Y9FA 4EFPA 6I1BA 5I1BA 4A7ZA 5BOWA 3O4DA 3D7WB 3IM6A 2FDBM 4IY8A 3VT0A 1DJSB 3ZXDA 4G9MA 3VT2A 3WMUA 1FMZA 4I4QA 4YOLA 3A07A 4DEPA 4L4HA 4A7KA 2Y9XE 2F2FC 2Y9GA 2VXRA 1SZ6B 1JT3A 1Q04A 3N0KA 2NM1A 4GAIA 2X2TA 1ISVA 3CA4A 4Q9GA 4ENDA 2J3PA 2LIEA 3FJFA 3PMEA 1HCEA 1HWNB 2E4MA 4OWLA 1Q1UA 41BIA 3BRFA 1FV2A 2VSEA 3FJ9A 4OEFA 3BA4A 2XOAA 1YXWA 2VUAA 4OEGA 2AAIB 1DZCA 3WO3A 3UJ0A 1TWEA 3V0BB 1RY7A 1CE7B 1HIBA 1TTUA 3NBDA 3H6SE 4ZA3B 3N7KA 2FO1A 1WD3A 1XG6A 3CU1B 3POKA 3FGMA 2D43A 3P53A 4XFUA 1WD4A 4FVVA 3H6RA 4I1EA 4P0JA 4USOA 2VSAA 5F8SA 2Q3NB 2VXTI 2AFGA 2F2FA 1L2HA 2M49A 1IRPA 4OWKA 4I7IA 3MALA 3BADA 3BB2A 4QKSA 4HR6C 4EFRA 4J2KA 1V6UA 4OWJA 4QBVA 2X2SA 2GZBA 3IAGC 4I4PA 1D0HA 2MLLB 4I6IA 1YBIA 1AF9A 3BRDA 3AKFA 1BLAA 1YF8B 4I4RA 3WINC 3VT1A 2K43A 1E0OA 2ERMA 4GP0A 3FJKA 3CA3A 3P6IA 3O4AA 3FJHA 1NUNA 1N4KA 4EB2B 2D20A 4IZEA 2NTDA 4JPZA 4I37A 1MC9A 5BP5C 3EF2A 1DIWA 1YTOA 3I2XA 2KH2A 3FJJA 4HA2A 4IZXA 4F34A 4H04A 3VUOA 3V0AB 1TIEA 2KI6B 2RSTA 4LO7B 1HWMB 3H6QA 3P6JA 4KBBA 1A8DA 2KLLA 1QQKA 1IJTA 4KEKA 3AH2A 1EYLA 8I1BA 5G00A 3AKHA 4TLPA 1JY0A 2AXMA 5EG6C 3N7LA 3AZVA 5FZZA 3B9UA 2VU9A 2ET2A 3WINA 5D61A 1DQGA 4ZLBB 2DS0A 4I4SA 1IILA 4EFQA 4ISQA 1JLXA 1BASA 3UD7A 3HSMA 3O44A 4LO1C 3UD9A 5BP5A 1II4A 1K5UA 3UJ4A 5E24E 3F1RA 5GAQA 1RMLA 3AZWA 5JMCA 3CRIA 5B2HA 3FJAA 1JT4A 2HW9A 21BIA 4QO3A 4JQ0A 2D44A 3S8KA 1Z2VA 1TFMB 2K8RA 3F62B 3NBCA 1PC8B 4J2XA 5D62A 1DFCA 3FJEA 2MC2A 1XZZA 4AN6A 1G9CA 4ZOTA 1JT7A 3VSZA 1F31A 3RMYA 2NP0A 3TC2A 1HWPB 3FJCA 5JLVA 3K1XA 3O4OA 3WO4A 2ZQNA 4LO1A 1G9AA 3OBTA 4J2SA 3VEQA 3QYDA 2QYIB 2RG9B 4G9NA 3IM7A 5BVPI 1MD6A 4P0LA 1R8OA 4F83A 3OBRA 3OJ2A 1QQLA 3RMXA 3AH1A 2P39A 1AVWB 1AVAC 1JQZA 4II0A 1S0LA 2YUGA 5FNWA 4DENA 2DRYA 1YYNA 4P0KA 2DREA 1DQOA 3JRRA 4IQPA 3ZC8A 2FGFA 1JLYA 3FJIA 1HKNA 3LLPA 4HJJA 3A22A 1RZOB 1J0SA 1OQLB 1S0DA 2Z48A 4AN7B 2D22A 3NJ5A 2BEAA 2KI4A 5F8YA 2QN4A 1S0CA 3CA6A 4ZKTB 3UDAA 4KC3A 1HCDA 3FUQA 3Q7YA 1FV3A 2VLCA 1GGPB 2ZR1B 1W3FA 4D8HA 3H6RB 4WBCA 5EC5A 3BA5A 3AJ5A 4ZFYB 2MIBA 2KKIA 1IOBA 4X37A 2WRYA 4XFTA 3KMVA 1EPWA 2D24A 4I4XA 2GO2A 3MPPG 4I4YA 5EHAA 5F90A 1V6VA 3N7JA 1FQ9A 1W3AA 1XYFA 4I2SA 1BLDA 2D7RA 4ZBVB 1TWMA 3E8LC 3OGFA 4XKIA 4I96A 1BFCA 1AFCA 1ISYA 3BAQA 1S0GA 1VCLA 1S0EA 3V79C 4I4OA 4LO2A 5FZYA 4ZGRB 3T8SA 2Y9WC 3A21A 3O4BA 1K5VA 1BFGA 1ISZA 4P6AA 3OGGA 3UD8A 3ZXGA 1G9DA 1KNMA 3AH4A 4I0YA 4JAWA 3VSFA 3ZC9A 4H9WA 4USPA 4X3AA 3PHZA 4ZFUB 3HMYA 4JP0A 1G9BA 3IIRA 31BIA 1ONKB 4DCKC 2NYYA 4IONA 3BAHA 4JRAA 4XFSA 1V6WA 3S8JA 1TOOA 4I4VA 4Q91A 3HOMA 4QD2B 4JKQA 5FNXA 3SNVA 3O4CA 4LO0C 5DUYA 1DZDA 1FMMS 4Q9PA
chains in the Genus database with same CATH superfamily
2DRBA 4EGWA 4I3NA 3CRHA 4ISRA 3O5WB 2HWMA 1R8BA 3C2KA 4UB1A 2L5XA 4X4OA 1S0BA 4KLUA 8ICGA 3CA0A 5CHGA 4NM2A 1T9FA 2P23A 4EV6A 4NXVA 2ZH2A 2ZHBA 4KLTA 2D23A 5HRLA 4OAFA 2NVHA 3WMVA 3W9TA 5DKWA 4LO7C 4R63A 3WA1A 1FGAA 4KLIA 3HJ4A 2RFFA 4QZFA 2D7IA 5CFUA 4LO2C 1BFBA 4KEIA 4IQVA 1CVSA 2ZH8A 4RQ8A 5BXRA 1BARA 3CRGA 3ER8C 4EKXB 4G6JA 9ICWA 3AKGA 3OJMA 4RPXA 2ZHAA 2D1ZA 1ZQTA 4FH5A 2BPFA 4MKPA 3RJKA 4X4UA 1ZQIA 4QALA 4WC1A 1AXMA 9ICUA 8ICAA 4G6MA 2HZ9A 3ILAA 4L4IA 1MQ2A 4LT6A 3ER9B 4LO3C 3AUOA 3CAHA 8ICXA 3RJJA 4FGFA 5HPZA 3A23A 3BAUA 3MBYA 3C18A 4D0TA 4K99A 1ISXA 4QZHA 2IWTB 5J2GA 3RTIB 4GXJA 3OWGA 4I8MA 3B0XA 4QZAA 5D63A 2ID1A 4R6UB 3C9ZA 4G1RA 2NRKA 5I1BA 4EFPA 5BOWA 3O4DA 1JAJA 3WMUA 1FMZA 4A7KA 5DB8A 1PX5A 2VXRA 2PFOA 2X2TA 3CA4A 4P2HA 4AT9B 2BPGA 1TVAA 3PMEA 4OWLA 4X4VA 4I2AA 4OEFA 4XJEA 4Z6DA 1YXWA 2VUAA 1DZCA 3WO3A 5CR0A 1CE7B 1TTUA 1MIYA 4ZA3B 4YD1A 4F5RA 5DB6A 2B51A 2DR7A 1XG6A 1NO5A 2D43A 4FVVA 1ZQXA 5F8SA 1L2HA 1IRPA 4OWKA 3MALA 7ICRA 1R8AA 4EFRA 1ZQDA 3JPQA 4FH3A 2MLLB 4I6IA 9ICLA 5CFTA 1YBIA 4H75A 3AKFA 1BLAA 3VT1A 4MF2A 3CA3A 3O4AA 4IZEA 5BP5C 1YTOA 1ZQEA 4F34A 4KLMA 1TIEA 2HHPA 1ZJMA 2KLLA 4K9AA 1IJTA 3JYYA 5G00A 4O5EA 8ICVA 4PHDA 3HIYA 3N7LA 3AZVA 3B9UA 5D61A 1DQGA 4ZLBB 4JLZA 3C5GA 4YMOA 8ICKA 4KLFA 2EWRA 5BP5A 3H37A 3F1RA 1RMLA 4NXUA 2HW9A 3NKUA 21BIA 3UQ0A 5D49A 1TFMB 3ISBA 3NVOA 3FJEA 4X4RA 1BPZA 2BBHA 1MQ3A 3AQNA 4PGYA 2ZQNA 4J2SA 3RH4A 4WC6A 4G9NA 1ZQRA 9ICGA 3IM7A 5BVPI 8ICHA 7ICFA 1QQLA 3RMXA 3AH1A 4K9BA 4RQ7A 5FNWA 9ICTA 4DENA 2DRYA 4P4PA 5CJ7A 8ICRA 4P0KA 4IQPA 3ZC8A 2FGFA 9ICMA 1JLYA 4O67A 5B3PA 3FJIA 3OV7A 4UB2A 2Z48A 1OU5A 4PGXA 2BEAA 5F8YA 1ZQQA 1WOTA 4X4NA 5HRBA 4LEWA 3Q7YA 7ICUA 4D8HA 3H6RB 3BA5A 3AJ5A 2KKIA 4ATBB 5DECA 4K4IA 9ICRA 2PBEA 9ICNA 4RQ2A 4I2SA 1BLDA 4X4PA 1BFCA 1AFCA 1ISYA 5HR9A 3V79C 2Y9WC 3A21A 5D46A 1K5VA 3AU6A 3OGGA 1R89A 3OVBA 4JP0A 4KLJA 4WH5A 3NYBA 5BPCA 3OVSA 7ICKA 4XFSA 1V6WA 3S8JA 3AQKA 4QD2B 3O4CA 4LO0C 4CJMA 1UETA 3C5FA 1KNYA 7ICOA 4WCWA 3JCFA 5BXSA 3FJ8A 4K97A 1PUMB 4Z8SB 4GP3A 4QC4A 1JMSA 4RWQA 3RTJB 4X5VA 3AKIA 1WBCA 3IM5A 4DOAA 4WC0A 4X38A 3JUTA 2Q9XA 4OEEA 3V0BA 4LO0A 3GDXA 1DLLA 4IY9A 1M2TB 1IT0A 3FFZA 8ICEA 1IHKA 4WBYA 8ICZA 3BRGC 9ICPA 5DVHA 4F5NA 4M47A 2ZH9A 2NS2A 4UB5A 5CHEA 1Z0HA 1T4QA 5DDMA 4KEJA 3C2MA 2IHMA 1JT5A 1V6XA 4XA5A 1DFQA 4Z9WB 3K7DA 3V72A 3ERCC 4WQKA 4TUSA 4M9NA 3JPPA 4D0ZA 2B56A 4QD2C 1YLQA 9ILBA 4X39A 1KDHA 5HRIA 5BXTA 4O9MA 2UUSA 1ITBA 2FFVA 2HN1A 2ZH1A 1PUUB 4NM1A 3JZ0A 3LTQA 4YCXA 3BAOA 4LO8B 1JTCA 7ICQA 2ZH5A 1WBAA 4GXIA 3H3AA 1VJ7A 1ISWA 2NZ9A 4I2CA 2BCVA 2BPCA 1Z4SA 1ZQVA 3FJBA 1TP0A 3MDCA 1R8NA 5HRDA 4KM5A 4J23B 3AJ6A 5DB9A 9ICCA 3V7KA 1ZQHA 3FJDA 3CA5A 2FMPA 5DZUA 4M0AA 4RQ3A 2M2VA 1QXMA 3D7WB 3VT0A 1DJSB 3ZXDA 4G9MA 3VT2A 1ZQNA 4I4QA 3A07A 8ICOA 4L4HA 1JT3A 1Q04A 4ENDA 2J3PA 4I2IA 3BRFA 2VSEA 4MFAA 3BA4A 4R66A 3TFSA 4TUPA 4EP7A 4OEGA 3PMNA 5J0YA 3UJ0A 1TWEA 3UXOA 2FO1A 3POKA 3FGMA 3P53A 4XFUA 4USOA 3PNCA 1ZJNA 2M49A 1KEJA 1ZQMA 4QKSA 4J2KA 2IUBA 4OWJA 3MGIA 4AT8A 4I4PA 1BPXA 1AF9A 2K43A 1E0OA 2ERMA 4GP0A 3FJKA 4XQ8A 4PH5A 4I37A 1MC9A 2ZH3A 3EF2A 2KH2A 3V0AB 1BPBA 7ICTA 3H38A 9ICQA 1A8DA 8I1BA 3AKHA 4TLPA 4N7RA 3OUYB 3UPQA 4XQ7A 1ZQBA 4I2HA 5FZZA 2VU9A 4DOBA 4M9HA 2DR8A 4I4SA 1IILA 4XUSA 3LQCB 4FHWA 1XSNA 4LO1C 4RQ4A 1ZQOA 5GAQA 4I2DA 3AZWA 2M2UA 1JT4A 4QO3A 5J2CA 2K8RA 3NBCA 1PC8B 7ICSA 4MZFB 1DFCA 2VANA 2MC2A 1XZZA 3HJ1A 4EBKA 3VSZA 2O1PA 3TC2A 5JLVA 3C66A 4LO1A 3OBTA 4R65A 2RG9B 1MD6A 4UY4A 4F83A 3OBRA 5BOMA 3WFPA 1JQZA 4RWPA 4FO1A 4MZHA 3LLPA 9ICBA 5CB1A 4HJJA 1OQLB 3B0YA 1ZQZA 3CA6A 1UEVA 4ZKTB 1HCDA 2VLCA 1GGPB 2ZR1B 5D4BA 4IQWA 5EC5A 2MIBA 4XFTA 4NXWA 1TFYA 1EPWA 4MZGB 2D24A 1GPJA 2BCSA 3HW8A 4I4YA 4OAHA 1V6VA 1FQ9A 1XYFA 5IIIA 7ICGA 4RPZA 4ZBVB 7ICJA 1TWMA 3OGFA 4XKIA 1S0GA 4I4OA 5FZYA 4PHAA 3JPOA 5HHHA 1BFGA 8ICCA 1G9DA 4KLLA 3AH4A 4I0YA 4USPA 4X3AA 4P4OA 31BIA 5J0PA 4I2EA 7ICPA 4LVSA 4KB6A 1UEUA 1TOOA 4I4VA 4Q91A 4JKQA 4PGQA 7ICVA 4Q9PA 2BEBA 2FFUA 1FWUA 2AQZA 9ICKA 2I1BA 1PZZA 3ZX7A 3HN1A 2Z49A 3BAVA 8ICIA 1BPDA 4AT9A 9ICEA 4OW4A 2DR5A 5CP2A 2HWAA 3WFRE 4KLSA 1FA0A 1G82A 3UXPA 3RJIA 3BA7A 7I1BA 4NXXA 1NZKA 1AVUA 1ZQGA 5EOZA 4I2GA 9ICHA 5BOLA 3HBWA 4WC5A 1S0FA 2FMSA 4O68A 4YD2A 5J0SA 3PG0A 3N7MA 1ZQSA 3BTAA 1BPYA 4UB3A 5F2VO 5IIMA 1RPLA 1R8CA 2DR9A 4I28A 3R4UA 3WFSC 5IINA 4OAIZ 5IILA 4GAFA 1XHBA 2RQ9A 4Z6FA 3OVAA 1JN3A 1I1BA 4AT7B 3QR5A 5HREA 5F8WA 5CWRA 5HRGA 3K75D 4A7YA 5BQUC 1ABRB 1RG8A 4HX0A 2K4AB 4GOYA 4RT3A 4MF8A 1HWOB 1BFFA 5J0WA 4IYBA 3BAGA 4K96A 3OJVA 4UAZA 1ZQCA 4M9LA 2LIQA 1Q03A 2IHOA 4KLOA 3VWCA 4YN4A 5J2JA 2WBCA 5J2KA 3NBNA 5BXPA 4E8FA 2R9KB 4FHXA 4F5OA 2E4MC 5BQUA 3I29B 1FWVA 1EV2A 1BA7A 4QBCA 4K4GA 2W9MA 3IM6A 5J0RA 4M9JA 4YOLA 4DEPA 4YMMA 2Y9XE 3MDAA 9ICFA 2F2FC 2Y9GA 2ZH6A 8ICNA 1HUOA 4QZBA 2PFQA 1ISVA 4Q9GA 2LIEA 4O5CA 3FJFA 4I0UA 3JPNA 1HCEA 1HWNB 2E4MA 1Q1UA 3FJ9A 1TV9A 2XOAA 4JWNA 2AAIB 4NKUA 4JLXA 4EEDA 4X0AA 3NBDA 3N7KA 4TURA 1WD3A 4X4QA 1WD4A 3CK6A 3H6RA 4I1EA 2VSAA 2VXTI 3TFRA 2F2FA 4ATBA 4K4HA 3BADA 3BB2A 1NOMA 4FHPA 4DO9A 3IAGC 1D0HA 4WBZA 4LZDA 1YF8B 4QZ9A 4PHEA 8ICQA 2D20A 4S3NA 5IIOA 3I2XA 3FJJA 4IZXA 5J2EA 2PFNA 5DBAA 4LO7B 3H6QA 3P6JA 5DBCA 1QQKA 4KEKA 3H39A 3AH2A 3V7LA 1EYLA 8ICJA 1JY0A 3RH6A 5EG6C 4M2YA 5J0QA 1Q79A 5CA7A 3LK9A 4NLZA 1F5AA 9ICJA 4XRHA 2ET2A 9ICSA 2BBJA 4EFQA 4ISQA 4M04A 1JLXA 1BASA 4RT2A 3UD9A 5DBBA 5TZVA 4FO6A 1II4A 3UJ4A 5E24E 4MFCA 5JMCA 3CRIA 8ICFA 2P66A 3FJAA 5J29A 4JQ0A 2D44A 4Z6EA 2HN2A 3F62B 4J2XA 5D62A 1XSLA 4UB4A 3HWTA 4AN6A 4ZOTA 1JT7A 1F31A 4UBCA 1HWPB 3FJCA 3O4OA 2M2TA 3VEQA 7ICMA 4RQ0A 4K8VA 1AVAC 4II0A 4X4SA 7ICEA 3UXNA 4NLKA 2DREA 1HKNA 4LEYA 4Z6CA 1J0SA 8ICYA 1S0DA 2D22A 2KI4A 4KLDA 5HRFA 3UDAA 4KC3A 3FUQA 4M5DA 1XSPA 5HRKA 2BCUA 4WBCA 7ICHA 1IOBA 7ICIA 5HC9A 4I4XA 5EHAA 2I9GA 3N7JA 3RJHA 4QZ8A 3BAQA 1S0EA 5IIKA 4NY8A 5JTGA 4LO2A 4NXTA 3O4BA 2GAFD 4P6AA 5DB7A 3ZXGA 3UD8A 4IG8A 4QZDA 3RH5A 3V7JA 4JAWA 3JPRA 3VSFA 1Q78A 3ZC9A 3HMYA 1G9BA 5J2DA 2GWSA 3BAHA 4JRAA 3C2LA 5J2FA 4LEZA 4LZGA 5FNXA 7ICNA 4X0BA 5DUYA 1M16A 8ICUA 2F8XC 2DRZA 5J0OA 1UPSA 4RWOA 1ZQAA 1EVTA 5HHIA 4JKXB 3WFOA 4LO3A 1P63A 3Q7WA 2DRAA 3AQLA 5J2BA 4O6AA 3FUOA 1FN0A 3CA1A 4EEEB 4RPYA 4PC4A 3RJFA 4E7XA 4WOYA 3HALA 3CQAA 3AQMA 8ICMA 2DVIA 1ILR1 3O3QA 4I27A 4IHZA 4GXKA 9ICAA 5DSSB 2ISPA 4IQTA 1W3GA 3R4SA 3PUBA 3HX0A 4JWMA 4GOVA 4QKRA 4RQ6A 8ICTA 4P4MA 5J2AA 1IRAX 2ESUA 3I2AA 5CFSA 5FZUA 2ISOA 3RSJA 3Q7XA 3V0AA 1ZQLA 4OUJA 4I1BA 3ISDA 1I1EA 1SR4C 3NBEA 1PWAA 4I4UA 4DOCA 4PHPA 3OUYA 4IQUA 5DEDA 4M9GA 4K98A 4X4TA 2PXIA 1ZQKA 2ZQOA 3BX1C 3O49A 4QZCA 4I2JA 4F5QA 3WO2A 1SR4A 3JPTA 3UQ2A 4MFFA 4J2YA 4LEVA 5J2IA 4ZFWB 3UPSA 1AVXB 4NXZA 8ICLA 2BFHA 2Y9FA 6I1BA 4A7ZA 4FHYA 4IY8A 2FDBM 2PFPA 5HRHA 2B4VA 3OGUA 1BPEA 7ICLA 1SZ6B 4UAWA 3N0KA 2NM1A 4GAIA 1V4AA 4TUQA 4I29A 4E80A 41BIA 1FV2A 4OAGA 4KLQA 3V0BB 1RY7A 1HIBA 3H6SE 1ZQWA 4KLGA 4UD4A 4F5PA 3CU1B 4QZGA 4WC2A 4P0JA 2BCRA 5J0UA 2Q3NB 2AFGA 4I7IA 5DDYA 4HR6C 1V6UA 4QBVA 2X2SA 2GZBA 9ICXA 3BRDA 4R64A 4PPXA 4I4RA 3WINC 8ICSA 3P6IA 4RQ5A 2BE3A 3FJHA 1NUNA 1RZTA 1N4KA 4EB2B 4JPZA 2NTDA 4QZIA 1DIWA 4HA2A 3VUOA 4H04A 3NWIA 2KI6B 2RSTA 5J0XA 1HWMB 4WC7A 4KBBA 2M2WA 1ZQYA 9ICIA 2AXMA 4YMNA 4NLNA 3RJEA 3WINA 2DS0A 4UD5A 3MGHA 3UD7A 3HSMA 3O44A 5IIJA 1VFGA 1K5UA 4UAYA 1ZQUA 4FHVA 5B2HA 1ZQJA 3S8KA 1Z2VA 3AU2A 2ZH4A 5B3QA 1G9CA 2NP0A 3RMYA 5J0TA 4KLEA 3K1XA 3JPSA 3WO4A 1G9AA 4I2BA 3QYDA 2QYIB 1MIWA 4P0LA 1R8OA 5J2HA 4EBJA 3OJ2A 2P39A 1AVWB 4O69A 1S0LA 2YUGA 1YYNA 1DQOA 3JRRA 4O5KA 9ICOA 4NKTA 3A22A 4RQ1A 4QZEA 1RZOB 8ICBA 2O5AA 4AN7B 3NJ5A 2QN4A 1S0CA 1TFWA 2FMQA 1FV3A 4AT7A 4EEBA 1JQRA 1W3FA 1MIVA 4WC3A 4ZFYB 4I2FA 3L9DA 4X37A 2WRYA 8ICPA 3KMVA 2GO2A 3MPPG 4WQLA 2BCQA 5F90A 4AT8B 1W3AA 3PMLA 2D7RA 4KLHA 3E8LC 4I96A 2FCLA 1ZQPA 1VCLA 3RJGA 4ZGRB 3T8SA 3MCRA 1ISZA 1ZQFA 1KNMA 8ICWA 2GA9D 4WC4A 4RWNA 4H9WA 4ZFUB 3PHZA 3ISCA 4UBBA 3IIRA 2ZH7A 3WFQE 1ONKB 9ICVA 4DCKC 2NYYA 4IONA 1HUZA 2Q66A 3HOMA 3SNVA 1DZDA 1FMMS
chains in the Genus database with same CATH topology
1M16A 2BEBA 2FFUA 4CJMA 1FWUA 3CRHA 2DRZA 4I3NA 4ISRA 3O5WB 2F8XC 2HWMA 1UPSA 2AQZA 2L5XA 2I1BA 1S0BA 1PZZA 3ZX7A 3HN1A 1EVTA 2Z49A 3BAVA 5BXSA 3FJ8A 4K97A 4JKXB 1PUMB 4Z8SB 4GP3A 4LO3A 1P63A 3Q7WA 4QC4A 3CA0A 3RTJB 4OW4A 1T9FA 2HWAA 2P23A 3AKIA 4NXVA 4O6AA 1WBCA 3FUOA 1FN0A 3CA1A 4EEEB 1G82A 3IM5A 4X38A 4PC4A 3BA7A 3JUTA 2D23A 2Q9XA 4OEEA 3V0BA 7I1BA 4LO0A 4WOYA 3HALA 4NXXA 2NVHA 3WMVA 1DLLA 3CQAA 4OAFA 1NZKA 1AVUA 4IY9A 1ILR1 1M2TB 3W9TA 3O3QA 3HBWA 1IT0A 4LO7C 3FFZA 1S0FA 4O68A 1IHKA 3WA1A 1FGAA 4IHZA 3BRGC 3PG0A 5DSSB 3N7MA 5DVHA 1W3GA 3R4SA 3PUBA 2D7IA 5CFUA 4LO2C 1BFBA 4GOVA 4KEIA 1CVSA 2NS2A 5BXRA 5CHEA 1Z0HA 4QKRA 1BARA 3BTAA 1T4QA 3CRGA 3ER8C 4KEJA 4EKXB 1IRAX 1JT5A 1V6XA 1DFQA 2ESUA 4G6JA 4Z9WB 3K7DA 3ERCC 3I2AA 5CFSA 5FZUA 3AKGA 4WQKA 3RSJA 3R4UA 3OJMA 3Q7XA 3V0AA 4OAIZ 4OUJA 4I1BA 4GAFA 1XHBA 2RQ9A 2D1ZA 4D0ZA 2B56A 1I1BA 4QD2C 1I1EA 9ILBA 4X39A 4MKPA 3QR5A 5BXTA 1SR4C 3NBEA 2UUSA 5F8WA 1PWAA 4I4UA 1ITBA 2FFVA 4QALA 1AXMA 4A7YA 1PUUB 5BQUC 4K98A 1ABRB 1RG8A 4G6MA 2HZ9A 3ILAA 3LTQA 4HX0A 2K4AB 4L4IA 4GOYA 2ZQOA 1HWOB 1BFFA 3ER9B 3BAOA 4LO8B 4IYBA 1JTCA 3BX1C 4LO3C 3BAGA 3CAHA 1WBAA 4K96A 3OJVA 4FGFA 3A23A 5HPZA 1ISWA 3BAUA 2NZ9A 2LIQA 3O49A 4D0TA 1Q03A 2IHOA 4K99A 1ISXA 1Z4SA 3VWCA 2WBCA 3FJBA 3NBNA 1TP0A 1R8NA 3WO2A 5BXPA 1SR4A 4J23B 3AJ6A 4KM5A 2IWTB 3RTIB 3OWGA 3FJDA 2R9KB 4J2YA 3CA5A 4LEVA 2E4MC 4I8MA 4ZFWB 5BQUA 3I29B 5D63A 4R6UB 3C9ZA 1FWVA 5DZUA 1EV2A 4G1RA 1BA7A 4QBCA 1AVXB 1QXMA 2BFHA 2Y9FA 4EFPA 6I1BA 5I1BA 4A7ZA 5BOWA 3O4DA 3D7WB 3IM6A 2FDBM 4IY8A 3VT0A 1DJSB 3ZXDA 4G9MA 3VT2A 3WMUA 2B4VA 1FMZA 4I4QA 4YOLA 3A07A 4DEPA 4L4HA 4A7KA 2Y9XE 2F2FC 2Y9GA 2VXRA 1SZ6B 1JT3A 1Q04A 3N0KA 2NM1A 4GAIA 2X2TA 1ISVA 3CA4A 4Q9GA 4ENDA 2J3PA 2LIEA 3FJFA 3PMEA 1HCEA 1HWNB 2E4MA 4OWLA 1Q1UA 41BIA 3BRFA 1FV2A 2VSEA 3FJ9A 4OEFA 3BA4A 4XJEA 4OAGA 2XOAA 1YXWA 2VUAA 4OEGA 2AAIB 4JLXA 1DZCA 3WO3A 3UJ0A 1TWEA 3V0BB 1RY7A 1CE7B 1HIBA 1TTUA 3NBDA 3H6SE 4ZA3B 2B51A 3N7KA 2FO1A 1WD3A 1XG6A 3CU1B 3POKA 3FGMA 2D43A 3P53A 4XFUA 1WD4A 4FVVA 3H6RA 4I1EA 4P0JA 4USOA 2VSAA 5F8SA 2Q3NB 2VXTI 2AFGA 2F2FA 1L2HA 2M49A 1IRPA 4OWKA 4I7IA 3MALA 3BADA 3BB2A 4QKSA 4HR6C 4EFRA 4J2KA 1V6UA 4OWJA 4QBVA 2X2SA 2GZBA 3IAGC 4I4PA 1D0HA 2MLLB 4I6IA 5CFTA 1YBIA 1AF9A 4H75A 3AKFA 3BRDA 1BLAA 1YF8B 4I4RA 3WINC 3VT1A 2K43A 1E0OA 2ERMA 4GP0A 3FJKA 3CA3A 3P6IA 3O4AA 3FJHA 1NUNA 1N4KA 4EB2B 2D20A 4IZEA 2NTDA 4JPZA 4I37A 1MC9A 5BP5C 3EF2A 1DIWA 1YTOA 3I2XA 2KH2A 3FJJA 4HA2A 4IZXA 4F34A 4H04A 3VUOA 3V0AB 1TIEA 2KI6B 2RSTA 4LO7B 1HWMB 3H6QA 3P6JA 4KBBA 1A8DA 2KLLA 1QQKA 1IJTA 4K9AA 4KEKA 3AH2A 1EYLA 8I1BA 5G00A 3AKHA 4TLPA 4N7RA 1JY0A 2AXMA 5EG6C 3N7LA 3AZVA 5FZZA 3B9UA 2VU9A 2ET2A 3WINA 5D61A 1DQGA 4ZLBB 4JLZA 2DS0A 4I4SA 1IILA 4EFQA 4ISQA 1JLXA 1BASA 3UD7A 3HSMA 3O44A 4LO1C 3UD9A 5BP5A 2EWRA 1II4A 1K5UA 3UJ4A 5E24E 3F1RA 5GAQA 1RMLA 4NXUA 3AZWA 5JMCA 3CRIA 5B2HA 3FJAA 1JT4A 2HW9A 3NKUA 21BIA 4QO3A 4JQ0A 2D44A 3S8KA 1Z2VA 1TFMB 2K8RA 3F62B 3NBCA 1PC8B 4J2XA 5D62A 5B3QA 4MZFB 1DFCA 3FJEA 2MC2A 1XZZA 4AN6A 1G9CA 4ZOTA 1JT7A 3VSZA 1F31A 3RMYA 2NP0A 3TC2A 1HWPB 3FJCA 5JLVA 3K1XA 3O4OA 3WO4A 2ZQNA 4LO1A 1G9AA 3OBTA 4J2SA 3VEQA 3QYDA 2QYIB 2RG9B 4G9NA 3IM7A 5BVPI 1MD6A 4UY4A 4P0LA 1R8OA 4F83A 3OBRA 3OJ2A 1QQLA 3RMXA 3AH1A 2P39A 1AVWB 4K8VA 4O69A 4K9BA 1AVAC 1JQZA 4II0A 1S0LA 2YUGA 5FNWA 4DENA 2DRYA 4FO1A 1YYNA 4MZHA 4P0KA 2DREA 1DQOA 3JRRA 4IQPA 3ZC8A 2FGFA 1JLYA 4O67A 5B3PA 3FJIA 1HKNA 3LLPA 4LEYA 4HJJA 3A22A 1RZOB 1J0SA 1OQLB 1S0DA 2Z48A 4AN7B 2D22A 3NJ5A 2BEAA 2KI4A 5F8YA 2QN4A 1S0CA 3CA6A 4ZKTB 3UDAA 4KC3A 4LEWA 1HCDA 3FUQA 3Q7YA 1FV3A 2VLCA 1GGPB 2ZR1B 1W3FA 4D8HA 3H6RB 4WBCA 5EC5A 3BA5A 3AJ5A 4ZFYB 2MIBA 2KKIA 1IOBA 4X37A 2WRYA 4XFTA 3KMVA 4NXWA 1EPWA 4MZGB 2D24A 1GPJA 4I4XA 2GO2A 3MPPG 4I4YA 4OAHA 4WQLA 5EHAA 5F90A 1V6VA 3N7JA 1FQ9A 1W3AA 1XYFA 4I2SA 1BLDA 2D7RA 4ZBVB 1TWMA 3E8LC 3OGFA 4XKIA 4I96A 1BFCA 2FCLA 1AFCA 1ISYA 3BAQA 1S0GA 1VCLA 1S0EA 3V79C 4I4OA 4LO2A 5FZYA 4ZGRB 4NXTA 3T8SA 2Y9WC 3A21A 3O4BA 3MCRA 1K5VA 2GAFD 1BFGA 1ISZA 4P6AA 3OGGA 3UD8A 3ZXGA 1G9DA 1KNMA 3AH4A 2GA9D 4I0YA 4JAWA 3VSFA 3ZC9A 4H9WA 4USPA 4X3AA 3PHZA 4ZFUB 3HMYA 4JP0A 1G9BA 3IIRA 31BIA 4WH5A 1ONKB 4DCKC 2NYYA 4IONA 3BAHA 4JRAA 4XFSA 1V6WA 4KB6A 3S8JA 1TOOA 4I4VA 4Q91A 4LEZA 3HOMA 4QD2B 4JKQA 5FNXA 3SNVA 3O4CA 4LO0C 5DUYA 1DZDA 1FMMS 4Q9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M16 A;  2BEB A;  2FFU A;  4CJM A;  1FWU A;  3CRH A;  2DRZ A;  4I3N A;  4ISR A;  3O5W B;  2F8X C;  2HWM A;  1UPS A;  2AQZ A;  2L5X A;  2I1B A;  1S0B A;  1PZZ A;  3ZX7 A;  3HN1 A;  1EVT A;  2Z49 A;  3BAV A;  5BXS A;  3FJ8 A;  4JKX B;  1PUM B;  4Z8S B;  4GP3 A;  4LO3 A;  1P63 A;  3Q7W A;  4QC4 A;  3CA0 A;  3RTJ B;  4OW4 A;  1T9F A;  2HWA A;  2P23 A;  3AKI A;  1WBC A;  3FUO A;  1FN0 A;  3CA1 A;  4EEE B;  1G82 A;  3IM5 A;  4X38 A;  4PC4 A;  3BA7 A;  3JUT A;  2D23 A;  2Q9X A;  4OEE A;  3V0B A;  7I1B A;  4LO0 A;  3HAL A;  2NVH A;  3WMV A;  1DLL A;  3CQA A;  1NZK A;  1AVU A;  4IY9 A;  1ILR 1;  1M2T B;  3W9T A;  3O3Q A;  3HBW A;  1IT0 A;  4LO7 C;  3FFZ A;  1S0F A;  1IHK A;  3WA1 A;  1FGA A;  4IHZ A;  3BRG C;  3PG0 A;  5DSS B;  3N7M A;  5DVH A;  1W3G A;  3R4S A;  3PUB A;  2D7I A;  4LO2 C;  1BFB A;  4GOV A;  4KEI A;  1CVS A;  5BXR A;  1Z0H A;  4QKR A;  1BAR A;  3BTA A;  1T4Q A;  3CRG A;  4KEJ A;  4EKX B;  1IRA X;  1JT5 A;  1V6X A;  1DFQ A;  2ESU A;  4G6J A;  4Z9W B;  3I2A A;  5FZU A;  3AKG A;  3RSJ A;  3R4U A;  3OJM A;  3Q7X A;  3V0A A;  4OUJ A;  4I1B A;  4GAF A;  1XHB A;  2RQ9 A;  2D1Z A;  4D0Z A;  1I1B A;  4QD2 C;  1I1E A;  9ILB A;  4X39 A;  3QR5 A;  5BXT A;  1SR4 C;  3NBE A;  2UUS A;  5F8W A;  1PWA A;  4I4U A;  1ITB A;  2FFV A;  4QAL A;  1AXM A;  4A7Y A;  1PUU B;  5BQU C;  1ABR B;  1RG8 A;  4G6M A;  2HZ9 A;  3ILA A;  3LTQ A;  2K4A B;  4L4I A;  4GOY A;  2ZQO A;  1HWO B;  1BFF A;  3BAO A;  4LO8 B;  4IYB A;  1JTC A;  3BX1 C;  4LO3 C;  3BAG A;  3CAH A;  1WBA A;  3OJV A;  4FGF A;  3A23 A;  5HPZ A;  1ISW A;  3BAU A;  2NZ9 A;  2LIQ A;  3O49 A;  4D0T A;  1Q03 A;  2IHO A;  1ISX A;  1Z4S A;  3VWC A;  2WBC A;  3FJB A;  3NBN A;  1TP0 A;  1R8N A;  3WO2 A;  5BXP A;  1SR4 A;  4J23 B;  3AJ6 A;  2IWT B;  3RTI B;  3FJD A;  2R9K B;  4J2Y A;  3CA5 A;  2E4M C;  4I8M A;  4ZFW B;  5BQU A;  3I29 B;  5D63 A;  4R6U B;  3C9Z A;  1FWV A;  5DZU A;  1EV2 A;  4G1R A;  1BA7 A;  4QBC A;  1AVX B;  1QXM A;  2BFH A;  2Y9F A;  4EFP A;  6I1B A;  5I1B A;  4A7Z A;  5BOW A;  3O4D A;  3D7W B;  3IM6 A;  2FDB M;  4IY8 A;  3VT0 A;  1DJS B;  3ZXD A;  4G9M A;  3VT2 A;  3WMU A;  1FMZ A;  4I4Q A;  4YOL A;  3A07 A;  4DEP A;  4L4H A;  4A7K A;  2Y9X E;  2F2F C;  2Y9G A;  2VXR A;  1SZ6 B;  1JT3 A;  1Q04 A;  3N0K A;  2NM1 A;  4GAI A;  2X2T A;  1ISV A;  3CA4 A;  4Q9G A;  4END A;  2J3P A;  2LIE A;  3FJF A;  3PME A;  1HCE A;  1HWN B;  2E4M A;  4OWL A;  1Q1U A;  41BI A;  3BRF A;  1FV2 A;  2VSE A;  3FJ9 A;  4OEF A;  3BA4 A;  2XOA A;  1YXW A;  2VUA A;  4OEG A;  2AAI B;  1DZC A;  3WO3 A;  3UJ0 A;  1TWE A;  3V0B B;  1RY7 A;  1CE7 B;  1HIB A;  1TTU A;  3NBD A;  3H6S E;  4ZA3 B;  3N7K A;  2FO1 A;  1WD3 A;  1XG6 A;  3CU1 B;  3POK A;  3FGM A;  2D43 A;  3P53 A;  4XFU A;  1WD4 A;  4FVV A;  3H6R A;  4I1E A;  4P0J A;  4USO A;  2VSA A;  5F8S A;  2Q3N B;  2VXT I;  2AFG A;  2F2F A;  1L2H A;  2M49 A;  1IRP A;  4OWK A;  4I7I A;  3MAL A;  3BAD A;  3BB2 A;  4QKS A;  4HR6 C;  4EFR A;  4J2K A;  1V6U A;  4OWJ A;  4QBV A;  2X2S A;  2GZB A;  3IAG C;  4I4P A;  1D0H A;  2MLL B;  4I6I A;  1YBI A;  1AF9 A;  3BRD A;  3AKF A;  1BLA A;  1YF8 B;  4I4R A;  3WIN C;  3VT1 A;  2K43 A;  1E0O A;  2ERM A;  4GP0 A;  3FJK A;  3CA3 A;  3P6I A;  3O4A A;  3FJH A;  1NUN A;  1N4K A;  4EB2 B;  2D20 A;  4IZE A;  2NTD A;  4JPZ A;  4I37 A;  1MC9 A;  5BP5 C;  3EF2 A;  1DIW A;  1YTO A;  3I2X A;  2KH2 A;  3FJJ A;  4HA2 A;  4IZX A;  4F34 A;  4H04 A;  3VUO A;  3V0A B;  1TIE A;  2KI6 B;  2RST A;  4LO7 B;  1HWM B;  3H6Q A;  3P6J A;  4KBB A;  1A8D A;  2KLL A;  1QQK A;  1IJT A;  4KEK A;  3AH2 A;  1EYL A;  8I1B A;  5G00 A;  3AKH A;  4TLP A;  1JY0 A;  2AXM A;  5EG6 C;  3N7L A;  3AZV A;  5FZZ A;  3B9U A;  2VU9 A;  2ET2 A;  3WIN A;  5D61 A;  1DQG A;  4ZLB B;  2DS0 A;  4I4S A;  1IIL A;  4EFQ A;  4ISQ A;  1JLX A;  1BAS A;  3UD7 A;  3HSM A;  3O44 A;  4LO1 C;  3UD9 A;  5BP5 A;  1II4 A;  1K5U A;  3UJ4 A;  5E24 E;  3F1R A;  5GAQ A;  1RML A;  3AZW A;  5JMC A;  3CRI A;  5B2H A;  3FJA A;  1JT4 A;  2HW9 A;  21BI A;  4QO3 A;  4JQ0 A;  2D44 A;  3S8K A;  1Z2V A;  1TFM B;  2K8R A;  3F62 B;  3NBC A;  1PC8 B;  4J2X A;  5D62 A;  1DFC A;  3FJE A;  2MC2 A;  1XZZ A;  4AN6 A;  1G9C A;  4ZOT A;  1JT7 A;  3VSZ A;  1F31 A;  3RMY A;  2NP0 A;  3TC2 A;  1HWP B;  3FJC A;  5JLV A;  3K1X A;  3O4O A;  3WO4 A;  2ZQN A;  4LO1 A;  1G9A A;  3OBT A;  4J2S A;  3VEQ A;  3QYD A;  2QYI B;  2RG9 B;  4G9N A;  3IM7 A;  5BVP I;  1MD6 A;  4P0L A;  1R8O A;  4F83 A;  3OBR A;  3OJ2 A;  1QQL A;  3RMX A;  3AH1 A;  2P39 A;  1AVW B;  1AVA C;  1JQZ A;  4II0 A;  1S0L A;  2YUG A;  5FNW A;  4DEN A;  2DRY A;  1YYN A;  4P0K A;  2DRE A;  1DQO A;  3JRR A;  4IQP A;  3ZC8 A;  2FGF A;  1JLY A;  3FJI A;  1HKN A;  3LLP A;  4HJJ A;  3A22 A;  1RZO B;  1J0S A;  1OQL B;  1S0D A;  2Z48 A;  4AN7 B;  2D22 A;  3NJ5 A;  2BEA A;  2KI4 A;  5F8Y A;  2QN4 A;  1S0C A;  3CA6 A;  4ZKT B;  3UDA A;  4KC3 A;  1HCD A;  3FUQ A;  3Q7Y A;  1FV3 A;  2VLC A;  1GGP B;  2ZR1 B;  1W3F A;  4D8H A;  3H6R B;  4WBC A;  5EC5 A;  3BA5 A;  3AJ5 A;  4ZFY B;  2MIB A;  2KKI A;  1IOB A;  4X37 A;  2WRY A;  4XFT A;  3KMV A;  1EPW A;  2D24 A;  4I4X A;  2GO2 A;  3MPP G;  4I4Y A;  5EHA A;  5F90 A;  1V6V A;  3N7J A;  1FQ9 A;  1W3A A;  1XYF A;  4I2S A;  1BLD A;  2D7R A;  4ZBV B;  1TWM A;  3E8L C;  3OGF A;  4XKI A;  4I96 A;  1BFC A;  1AFC A;  1ISY A;  3BAQ A;  1S0G A;  1VCL A;  1S0E A;  3V79 C;  4I4O A;  4LO2 A;  5FZY A;  4ZGR B;  3T8S A;  2Y9W C;  3A21 A;  3O4B A;  1K5V A;  1BFG A;  1ISZ A;  4P6A A;  3OGG A;  3UD8 A;  3ZXG A;  1G9D A;  1KNM A;  3AH4 A;  4I0Y A;  4JAW A;  3VSF A;  3ZC9 A;  4H9W A;  4USP A;  4X3A A;  3PHZ A;  4ZFU B;  3HMY A;  4JP0 A;  1G9B A;  3IIR A;  31BI A;  1ONK B;  4DCK C;  2NYY A;  4ION A;  3BAH A;  4JRA A;  4XFS A;  1V6W A;  3S8J A;  1TOO A;  4I4V A;  4Q91 A;  3HOM A;  4QD2 B;  4JKQ A;  5FNX A;  3SNV A;  3O4C A;  4LO0 C;  5DUY A;  1DZD A;  1FMM S;  4Q9P A; 
#chains in the Genus database with same CATH topology
 2DRB A;  4EGW A;  4I3N A;  3CRH A;  4ISR A;  3O5W B;  2HWM A;  1R8B A;  3C2K A;  4UB1 A;  2L5X A;  4X4O A;  1S0B A;  4KLU A;  8ICG A;  3CA0 A;  5CHG A;  4NM2 A;  1T9F A;  2P23 A;  4EV6 A;  4NXV A;  2ZH2 A;  2ZHB A;  4KLT A;  2D23 A;  5HRL A;  4OAF A;  2NVH A;  3WMV A;  3W9T A;  5DKW A;  4LO7 C;  4R63 A;  3WA1 A;  1FGA A;  4KLI A;  3HJ4 A;  2RFF A;  4QZF A;  2D7I A;  5CFU A;  4LO2 C;  1BFB A;  4KEI A;  4IQV A;  1CVS A;  2ZH8 A;  4RQ8 A;  5BXR A;  1BAR A;  3CRG A;  3ER8 C;  4EKX B;  4G6J A;  9ICW A;  3AKG A;  3OJM A;  4RPX A;  2ZHA A;  2D1Z A;  1ZQT A;  4FH5 A;  2BPF A;  4MKP A;  3RJK A;  4X4U A;  1ZQI A;  4QAL A;  4WC1 A;  1AXM A;  9ICU A;  8ICA A;  4G6M A;  2HZ9 A;  3ILA A;  4L4I A;  1MQ2 A;  4LT6 A;  3ER9 B;  4LO3 C;  3AUO A;  3CAH A;  8ICX A;  3RJJ A;  4FGF A;  5HPZ A;  3A23 A;  3BAU A;  3MBY A;  3C18 A;  4D0T A;  4K99 A;  1ISX A;  4QZH A;  2IWT B;  5J2G A;  3RTI B;  4GXJ A;  3OWG A;  4I8M A;  3B0X A;  4QZA A;  5D63 A;  2ID1 A;  4R6U B;  3C9Z A;  4G1R A;  2NRK A;  5I1B A;  4EFP A;  5BOW A;  3O4D A;  1JAJ A;  3WMU A;  1FMZ A;  4A7K A;  5DB8 A;  1PX5 A;  2VXR A;  2PFO A;  2X2T A;  3CA4 A;  4P2H A;  4AT9 B;  2BPG A;  1TVA A;  3PME A;  4OWL A;  4X4V A;  4I2A A;  4OEF A;  4XJE A;  4Z6D A;  1YXW A;  2VUA A;  1DZC A;  3WO3 A;  5CR0 A;  1CE7 B;  1TTU A;  1MIY A;  4ZA3 B;  4YD1 A;  4F5R A;  5DB6 A;  2B51 A;  2DR7 A;  1XG6 A;  1NO5 A;  2D43 A;  4FVV A;  1ZQX A;  5F8S A;  1L2H A;  1IRP A;  4OWK A;  3MAL A;  7ICR A;  1R8A A;  4EFR A;  1ZQD A;  3JPQ A;  4FH3 A;  2MLL B;  4I6I A;  9ICL A;  5CFT A;  1YBI A;  4H75 A;  3AKF A;  1BLA A;  3VT1 A;  4MF2 A;  3CA3 A;  3O4A A;  4IZE A;  5BP5 C;  1YTO A;  1ZQE A;  4F34 A;  4KLM A;  1TIE A;  2HHP A;  1ZJM A;  2KLL A;  4K9A A;  1IJT A;  3JYY A;  5G00 A;  4O5E A;  8ICV A;  4PHD A;  3HIY A;  3N7L A;  3AZV A;  3B9U A;  5D61 A;  1DQG A;  4ZLB B;  4JLZ A;  3C5G A;  4YMO A;  8ICK A;  4KLF A;  2EWR A;  5BP5 A;  3H37 A;  3F1R A;  1RML A;  4NXU A;  2HW9 A;  3NKU A;  21BI A;  3UQ0 A;  5D49 A;  1TFM B;  3ISB A;  3NVO A;  3FJE A;  4X4R A;  1BPZ A;  2BBH A;  1MQ3 A;  3AQN A;  4PGY A;  2ZQN A;  4J2S A;  3RH4 A;  4WC6 A;  4G9N A;  1ZQR A;  9ICG A;  3IM7 A;  5BVP I;  8ICH A;  7ICF A;  1QQL A;  3RMX A;  3AH1 A;  4K9B A;  4RQ7 A;  5FNW A;  9ICT A;  4DEN A;  2DRY A;  4P4P A;  5CJ7 A;  8ICR A;  4P0K A;  4IQP A;  3ZC8 A;  2FGF A;  9ICM A;  1JLY A;  4O67 A;  5B3P A;  3FJI A;  3OV7 A;  4UB2 A;  2Z48 A;  1OU5 A;  4PGX A;  2BEA A;  5F8Y A;  1ZQQ A;  1WOT A;  4X4N A;  5HRB A;  4LEW A;  3Q7Y A;  7ICU A;  4D8H A;  3H6R B;  3BA5 A;  3AJ5 A;  2KKI A;  4ATB B;  5DEC A;  4K4I A;  9ICR A;  2PBE A;  9ICN A;  4RQ2 A;  4I2S A;  1BLD A;  4X4P A;  1BFC A;  1AFC A;  1ISY A;  5HR9 A;  3V79 C;  2Y9W C;  3A21 A;  5D46 A;  1K5V A;  3AU6 A;  3OGG A;  1R89 A;  3OVB A;  4JP0 A;  4KLJ A;  4WH5 A;  3NYB A;  5BPC A;  3OVS A;  7ICK A;  4XFS A;  1V6W A;  3S8J A;  3AQK A;  4QD2 B;  3O4C A;  4LO0 C;  4CJM A;  1UET A;  3C5F A;  1KNY A;  7ICO A;  4WCW A;  3JCF A;  5BXS A;  3FJ8 A;  4K97 A;  1PUM B;  4Z8S B;  4GP3 A;  4QC4 A;  1JMS A;  4RWQ A;  3RTJ B;  4X5V A;  3AKI A;  1WBC A;  3IM5 A;  4DOA A;  4WC0 A;  4X38 A;  3JUT A;  2Q9X A;  4OEE A;  3V0B A;  4LO0 A;  3GDX A;  1DLL A;  4IY9 A;  1M2T B;  1IT0 A;  3FFZ A;  8ICE A;  1IHK A;  4WBY A;  8ICZ A;  3BRG C;  9ICP A;  5DVH A;  4F5N A;  4M47 A;  2ZH9 A;  2NS2 A;  4UB5 A;  5CHE A;  1Z0H A;  1T4Q A;  5DDM A;  4KEJ A;  3C2M A;  2IHM A;  1JT5 A;  1V6X A;  4XA5 A;  1DFQ A;  4Z9W B;  3K7D A;  3V72 A;  3ERC C;  4WQK A;  4TUS A;  4M9N A;  3JPP A;  4D0Z A;  2B56 A;  4QD2 C;  1YLQ A;  9ILB A;  4X39 A;  1KDH A;  5HRI A;  5BXT A;  4O9M A;  2UUS A;  1ITB A;  2FFV A;  2HN1 A;  2ZH1 A;  1PUU B;  4NM1 A;  3JZ0 A;  3LTQ A;  4YCX A;  3BAO A;  4LO8 B;  1JTC A;  7ICQ A;  2ZH5 A;  1WBA A;  4GXI A;  3H3A A;  1VJ7 A;  1ISW A;  2NZ9 A;  4I2C A;  2BCV A;  2BPC A;  1Z4S A;  1ZQV A;  3FJB A;  1TP0 A;  3MDC A;  1R8N A;  5HRD A;  4KM5 A;  4J23 B;  3AJ6 A;  5DB9 A;  9ICC A;  3V7K A;  1ZQH A;  3FJD A;  3CA5 A;  2FMP A;  5DZU A;  4M0A A;  4RQ3 A;  2M2V A;  1QXM A;  3D7W B;  3VT0 A;  1DJS B;  3ZXD A;  4G9M A;  3VT2 A;  1ZQN A;  4I4Q A;  3A07 A;  8ICO A;  4L4H A;  1JT3 A;  1Q04 A;  4END A;  2J3P A;  4I2I A;  3BRF A;  2VSE A;  4MFA A;  3BA4 A;  4R66 A;  3TFS A;  4TUP A;  4EP7 A;  4OEG A;  3PMN A;  5J0Y A;  3UJ0 A;  1TWE A;  3UXO A;  2FO1 A;  3POK A;  3FGM A;  3P53 A;  4XFU A;  4USO A;  3PNC A;  1ZJN A;  2M49 A;  1KEJ A;  1ZQM A;  4QKS A;  4J2K A;  2IUB A;  4OWJ A;  3MGI A;  4AT8 A;  4I4P A;  1BPX A;  1AF9 A;  2K43 A;  1E0O A;  2ERM A;  4GP0 A;  3FJK A;  4XQ8 A;  4PH5 A;  4I37 A;  1MC9 A;  2ZH3 A;  3EF2 A;  2KH2 A;  3V0A B;  1BPB A;  7ICT A;  3H38 A;  9ICQ A;  1A8D A;  8I1B A;  3AKH A;  4TLP A;  4N7R A;  3OUY B;  3UPQ A;  4XQ7 A;  1ZQB A;  4I2H A;  5FZZ A;  2VU9 A;  4DOB A;  4M9H A;  2DR8 A;  4I4S A;  1IIL A;  4XUS A;  3LQC B;  4FHW A;  1XSN A;  4LO1 C;  4RQ4 A;  1ZQO A;  5GAQ A;  4I2D A;  3AZW A;  2M2U A;  1JT4 A;  4QO3 A;  5J2C A;  2K8R A;  3NBC A;  1PC8 B;  7ICS A;  4MZF B;  1DFC A;  2VAN A;  2MC2 A;  1XZZ A;  3HJ1 A;  4EBK A;  3VSZ A;  2O1P A;  3TC2 A;  5JLV A;  3C66 A;  4LO1 A;  3OBT A;  4R65 A;  2RG9 B;  1MD6 A;  4UY4 A;  4F83 A;  3OBR A;  5BOM A;  3WFP A;  1JQZ A;  4RWP A;  4FO1 A;  4MZH A;  3LLP A;  9ICB A;  5CB1 A;  4HJJ A;  1OQL B;  3B0Y A;  1ZQZ A;  3CA6 A;  1UEV A;  4ZKT B;  1HCD A;  2VLC A;  1GGP B;  2ZR1 B;  5D4B A;  4IQW A;  5EC5 A;  2MIB A;  4XFT A;  4NXW A;  1TFY A;  1EPW A;  4MZG B;  2D24 A;  1GPJ A;  2BCS A;  3HW8 A;  4I4Y A;  4OAH A;  1V6V A;  1FQ9 A;  1XYF A;  5III A;  7ICG A;  4RPZ A;  4ZBV B;  7ICJ A;  1TWM A;  3OGF A;  4XKI A;  1S0G A;  4I4O A;  5FZY A;  4PHA A;  3JPO A;  5HHH A;  1BFG A;  8ICC A;  1G9D A;  4KLL A;  3AH4 A;  4I0Y A;  4USP A;  4X3A A;  4P4O A;  31BI A;  5J0P A;  4I2E A;  7ICP A;  4LVS A;  4KB6 A;  1UEU A;  1TOO A;  4I4V A;  4Q91 A;  4JKQ A;  4PGQ A;  7ICV A;  4Q9P A;  2BEB A;  2FFU A;  1FWU A;  2AQZ A;  9ICK A;  2I1B A;  1PZZ A;  3ZX7 A;  3HN1 A;  2Z49 A;  3BAV A;  8ICI A;  1BPD A;  4AT9 A;  9ICE A;  4OW4 A;  2DR5 A;  5CP2 A;  2HWA A;  3WFR E;  4KLS A;  1FA0 A;  1G82 A;  3UXP A;  3RJI A;  3BA7 A;  7I1B A;  4NXX A;  1NZK A;  1AVU A;  1ZQG A;  5EOZ A;  4I2G A;  9ICH A;  5BOL A;  3HBW A;  4WC5 A;  1S0F A;  2FMS A;  4O68 A;  4YD2 A;  5J0S A;  3PG0 A;  3N7M A;  1ZQS A;  3BTA A;  1BPY A;  4UB3 A;  5F2V O;  5IIM A;  1RPL A;  1R8C A;  2DR9 A;  4I28 A;  3R4U A;  3WFS C;  5IIN A;  4OAI Z;  5IIL A;  4GAF A;  1XHB A;  2RQ9 A;  4Z6F A;  3OVA A;  1JN3 A;  1I1B A;  4AT7 B;  3QR5 A;  5HRE A;  5F8W A;  5CWR A;  5HRG A;  3K75 D;  4A7Y A;  5BQU C;  1ABR B;  1RG8 A;  4HX0 A;  2K4A B;  4GOY A;  4RT3 A;  4MF8 A;  1HWO B;  1BFF A;  5J0W A;  4IYB A;  3BAG A;  4K96 A;  3OJV A;  4UAZ A;  1ZQC A;  4M9L A;  2LIQ A;  1Q03 A;  2IHO A;  4KLO A;  3VWC A;  4YN4 A;  5J2J A;  2WBC A;  5J2K A;  3NBN A;  5BXP A;  4E8F A;  2R9K B;  4FHX A;  4F5O A;  2E4M C;  5BQU A;  3I29 B;  1FWV A;  1EV2 A;  1BA7 A;  4QBC A;  4K4G A;  2W9M A;  3IM6 A;  5J0R A;  4M9J A;  4YOL A;  4DEP A;  4YMM A;  2Y9X E;  3MDA A;  9ICF A;  2F2F C;  2Y9G A;  2ZH6 A;  8ICN A;  1HUO A;  4QZB A;  2PFQ A;  1ISV A;  4Q9G A;  2LIE A;  4O5C A;  3FJF A;  4I0U A;  3JPN A;  1HCE A;  1HWN B;  2E4M A;  1Q1U A;  3FJ9 A;  1TV9 A;  2XOA A;  4JWN A;  2AAI B;  4NKU A;  4JLX A;  4EED A;  4X0A A;  3NBD A;  3N7K A;  4TUR A;  1WD3 A;  4X4Q A;  1WD4 A;  3CK6 A;  3H6R A;  4I1E A;  2VSA A;  2VXT I;  3TFR A;  2F2F A;  4ATB A;  4K4H A;  3BAD A;  3BB2 A;  1NOM A;  4FHP A;  4DO9 A;  3IAG C;  1D0H A;  4WBZ A;  4LZD A;  1YF8 B;  4QZ9 A;  4PHE A;  8ICQ A;  2D20 A;  4S3N A;  5IIO A;  3I2X A;  3FJJ A;  4IZX A;  5J2E A;  2PFN A;  5DBA A;  4LO7 B;  3H6Q A;  3P6J A;  5DBC A;  1QQK A;  4KEK A;  3H39 A;  3AH2 A;  3V7L A;  1EYL A;  8ICJ A;  1JY0 A;  3RH6 A;  5EG6 C;  4M2Y A;  5J0Q A;  1Q79 A;  5CA7 A;  3LK9 A;  4NLZ A;  1F5A A;  9ICJ A;  4XRH A;  2ET2 A;  9ICS A;  2BBJ A;  4EFQ A;  4ISQ A;  4M04 A;  1JLX A;  1BAS A;  4RT2 A;  3UD9 A;  5DBB A;  5TZV A;  4FO6 A;  1II4 A;  3UJ4 A;  5E24 E;  4MFC A;  5JMC A;  3CRI A;  8ICF A;  2P66 A;  3FJA A;  5J29 A;  4JQ0 A;  2D44 A;  4Z6E A;  2HN2 A;  3F62 B;  4J2X A;  5D62 A;  1XSL A;  4UB4 A;  3HWT A;  4AN6 A;  4ZOT A;  1JT7 A;  1F31 A;  4UBC A;  1HWP B;  3FJC A;  3O4O A;  2M2T A;  3VEQ A;  7ICM A;  4RQ0 A;  4K8V A;  1AVA C;  4II0 A;  4X4S A;  7ICE A;  3UXN A;  4NLK A;  2DRE A;  1HKN A;  4LEY A;  4Z6C A;  1J0S A;  8ICY A;  1S0D A;  2D22 A;  2KI4 A;  4KLD A;  5HRF A;  3UDA A;  4KC3 A;  3FUQ A;  4M5D A;  1XSP A;  5HRK A;  2BCU A;  4WBC A;  7ICH A;  1IOB A;  7ICI A;  5HC9 A;  4I4X A;  5EHA A;  2I9G A;  3N7J A;  3RJH A;  4QZ8 A;  3BAQ A;  1S0E A;  5IIK A;  4NY8 A;  5JTG A;  4LO2 A;  4NXT A;  3O4B A;  2GAF D;  4P6A A;  5DB7 A;  3ZXG A;  3UD8 A;  4IG8 A;  4QZD A;  3RH5 A;  3V7J A;  4JAW A;  3JPR A;  3VSF A;  1Q78 A;  3ZC9 A;  3HMY A;  1G9B A;  5J2D A;  2GWS A;  3BAH A;  4JRA A;  3C2L A;  5J2F A;  4LEZ A;  4LZG A;  5FNX A;  7ICN A;  4X0B A;  5DUY A;  1M16 A;  8ICU A;  2F8X C;  2DRZ A;  5J0O A;  1UPS A;  4RWO A;  1ZQA A;  1EVT A;  5HHI A;  4JKX B;  3WFO A;  4LO3 A;  1P63 A;  3Q7W A;  2DRA A;  3AQL A;  5J2B A;  4O6A A;  3FUO A;  1FN0 A;  3CA1 A;  4EEE B;  4RPY A;  4PC4 A;  3RJF A;  4E7X A;  4WOY A;  3HAL A;  3CQA A;  3AQM A;  8ICM A;  2DVI A;  1ILR 1;  3O3Q A;  4I27 A;  4IHZ A;  4GXK A;  9ICA A;  5DSS B;  2ISP A;  4IQT A;  1W3G A;  3R4S A;  3PUB A;  3HX0 A;  4JWM A;  4GOV A;  4QKR A;  4RQ6 A;  8ICT A;  4P4M A;  5J2A A;  1IRA X;  2ESU A;  3I2A A;  5CFS A;  5FZU A;  2ISO A;  3RSJ A;  3Q7X A;  3V0A A;  1ZQL A;  4OUJ A;  4I1B A;  3ISD A;  1I1E A;  1SR4 C;  3NBE A;  1PWA A;  4I4U A;  4DOC A;  4PHP A;  3OUY A;  4IQU A;  5DED A;  4M9G A;  4K98 A;  4X4T A;  2PXI A;  1ZQK A;  2ZQO A;  3BX1 C;  3O49 A;  4QZC A;  4I2J A;  4F5Q A;  3WO2 A;  1SR4 A;  3JPT A;  3UQ2 A;  4MFF A;  4J2Y A;  4LEV A;  5J2I A;  4ZFW B;  3UPS A;  1AVX B;  4NXZ A;  8ICL A;  2BFH A;  2Y9F A;  6I1B A;  4A7Z A;  4FHY A;  4IY8 A;  2FDB M;  2PFP A;  5HRH A;  2B4V A;  3OGU A;  1BPE A;  7ICL A;  1SZ6 B;  4UAW A;  3N0K A;  2NM1 A;  4GAI A;  1V4A A;  4TUQ A;  4I29 A;  4E80 A;  41BI A;  1FV2 A;  4OAG A;  4KLQ A;  3V0B B;  1RY7 A;  1HIB A;  3H6S E;  1ZQW A;  4KLG A;  4UD4 A;  4F5P A;  3CU1 B;  4QZG A;  4WC2 A;  4P0J A;  2BCR A;  5J0U A;  2Q3N B;  2AFG A;  4I7I A;  5DDY A;  4HR6 C;  1V6U A;  4QBV A;  2X2S A;  2GZB A;  9ICX A;  3BRD A;  4R64 A;  4PPX A;  4I4R A;  3WIN C;  8ICS A;  3P6I A;  4RQ5 A;  2BE3 A;  3FJH A;  1NUN A;  1RZT A;  1N4K A;  4EB2 B;  4JPZ A;  2NTD A;  4QZI A;  1DIW A;  4HA2 A;  3VUO A;  4H04 A;  3NWI A;  2KI6 B;  2RST A;  5J0X A;  1HWM B;  4WC7 A;  4KBB A;  2M2W A;  1ZQY A;  9ICI A;  2AXM A;  4YMN A;  4NLN A;  3RJE A;  3WIN A;  2DS0 A;  4UD5 A;  3MGH A;  3UD7 A;  3HSM A;  3O44 A;  5IIJ A;  1VFG A;  1K5U A;  4UAY A;  1ZQU A;  4FHV A;  5B2H A;  1ZQJ A;  3S8K A;  1Z2V A;  3AU2 A;  2ZH4 A;  5B3Q A;  1G9C A;  2NP0 A;  3RMY A;  5J0T A;  4KLE A;  3K1X A;  3JPS A;  3WO4 A;  1G9A A;  4I2B A;  3QYD A;  2QYI B;  1MIW A;  4P0L A;  1R8O A;  5J2H A;  4EBJ A;  3OJ2 A;  2P39 A;  1AVW B;  4O69 A;  1S0L A;  2YUG A;  1YYN A;  1DQO A;  3JRR A;  4O5K A;  9ICO A;  4NKT A;  3A22 A;  4RQ1 A;  4QZE A;  1RZO B;  8ICB A;  2O5A A;  4AN7 B;  3NJ5 A;  2QN4 A;  1S0C A;  1TFW A;  2FMQ A;  1FV3 A;  4AT7 A;  4EEB A;  1JQR A;  1W3F A;  1MIV A;  4WC3 A;  4ZFY B;  4I2F A;  3L9D A;  4X37 A;  2WRY A;  8ICP A;  3KMV A;  2GO2 A;  3MPP G;  4WQL A;  2BCQ A;  5F90 A;  4AT8 B;  1W3A A;  3PML A;  2D7R A;  4KLH A;  3E8L C;  4I96 A;  2FCL A;  1ZQP A;  1VCL A;  3RJG A;  4ZGR B;  3T8S A;  3MCR A;  1ISZ A;  1ZQF A;  1KNM A;  8ICW A;  2GA9 D;  4WC4 A;  4RWN A;  4H9W A;  4ZFU B;  3PHZ A;  3ISC A;  4UBB A;  3IIR A;  2ZH7 A;  3WFQ E;  1ONK B;  9ICV A;  4DCK C;  2NYY A;  4ION A;  1HUZ A;  2Q66 A;  3HOM A;  3SNV A;  1DZD A;  1FMM S; 
#chains in the Genus database with same CATH homology
 1M16 A;  2BEB A;  2FFU A;  4CJM A;  1FWU A;  3CRH A;  2DRZ A;  4I3N A;  4ISR A;  3O5W B;  2F8X C;  2HWM A;  1UPS A;  2AQZ A;  2L5X A;  2I1B A;  1S0B A;  1PZZ A;  3ZX7 A;  3HN1 A;  1EVT A;  2Z49 A;  3BAV A;  5BXS A;  3FJ8 A;  4K97 A;  4JKX B;  1PUM B;  4Z8S B;  4GP3 A;  4LO3 A;  1P63 A;  3Q7W A;  4QC4 A;  3CA0 A;  3RTJ B;  4OW4 A;  1T9F A;  2HWA A;  2P23 A;  3AKI A;  4NXV A;  4O6A A;  1WBC A;  3FUO A;  1FN0 A;  3CA1 A;  4EEE B;  1G82 A;  3IM5 A;  4X38 A;  4PC4 A;  3BA7 A;  3JUT A;  2D23 A;  2Q9X A;  4OEE A;  3V0B A;  7I1B A;  4LO0 A;  4WOY A;  3HAL A;  4NXX A;  2NVH A;  3WMV A;  1DLL A;  3CQA A;  4OAF A;  1NZK A;  1AVU A;  4IY9 A;  1ILR 1;  1M2T B;  3W9T A;  3O3Q A;  3HBW A;  1IT0 A;  4LO7 C;  3FFZ A;  1S0F A;  4O68 A;  1IHK A;  3WA1 A;  1FGA A;  4IHZ A;  3BRG C;  3PG0 A;  5DSS B;  3N7M A;  5DVH A;  1W3G A;  3R4S A;  3PUB A;  2D7I A;  5CFU A;  4LO2 C;  1BFB A;  4GOV A;  4KEI A;  1CVS A;  2NS2 A;  5BXR A;  5CHE A;  1Z0H A;  4QKR A;  1BAR A;  3BTA A;  1T4Q A;  3CRG A;  3ER8 C;  4KEJ A;  4EKX B;  1IRA X;  1JT5 A;  1V6X A;  1DFQ A;  2ESU A;  4G6J A;  4Z9W B;  3K7D A;  3ERC C;  3I2A A;  5CFS A;  5FZU A;  3AKG A;  4WQK A;  3RSJ A;  3R4U A;  3OJM A;  3Q7X A;  3V0A A;  4OAI Z;  4OUJ A;  4I1B A;  4GAF A;  1XHB A;  2RQ9 A;  2D1Z A;  4D0Z A;  2B56 A;  1I1B A;  4QD2 C;  1I1E A;  9ILB A;  4X39 A;  4MKP A;  3QR5 A;  5BXT A;  1SR4 C;  3NBE A;  2UUS A;  5F8W A;  1PWA A;  4I4U A;  1ITB A;  2FFV A;  4QAL A;  1AXM A;  4A7Y A;  1PUU B;  5BQU C;  4K98 A;  1ABR B;  1RG8 A;  4G6M A;  2HZ9 A;  3ILA A;  3LTQ A;  4HX0 A;  2K4A B;  4L4I A;  4GOY A;  2ZQO A;  1HWO B;  1BFF A;  3ER9 B;  3BAO A;  4LO8 B;  4IYB A;  1JTC A;  3BX1 C;  4LO3 C;  3BAG A;  3CAH A;  1WBA A;  4K96 A;  3OJV A;  4FGF A;  3A23 A;  5HPZ A;  1ISW A;  3BAU A;  2NZ9 A;  2LIQ A;  3O49 A;  4D0T A;  1Q03 A;  2IHO A;  4K99 A;  1ISX A;  1Z4S A;  3VWC A;  2WBC A;  3FJB A;  3NBN A;  1TP0 A;  1R8N A;  3WO2 A;  5BXP A;  1SR4 A;  4J23 B;  3AJ6 A;  4KM5 A;  2IWT B;  3RTI B;  3OWG A;  3FJD A;  2R9K B;  4J2Y A;  3CA5 A;  4LEV A;  2E4M C;  4I8M A;  4ZFW B;  5BQU A;  3I29 B;  5D63 A;  4R6U B;  3C9Z A;  1FWV A;  5DZU A;  1EV2 A;  4G1R A;  1BA7 A;  4QBC A;  1AVX B;  1QXM A;  2BFH A;  2Y9F A;  4EFP A;  6I1B A;  5I1B A;  4A7Z A;  5BOW A;  3O4D A;  3D7W B;  3IM6 A;  2FDB M;  4IY8 A;  3VT0 A;  1DJS B;  3ZXD A;  4G9M A;  3VT2 A;  3WMU A;  2B4V A;  1FMZ A;  4I4Q A;  4YOL A;  3A07 A;  4DEP A;  4L4H A;  4A7K A;  2Y9X E;  2F2F C;  2Y9G A;  2VXR A;  1SZ6 B;  1JT3 A;  1Q04 A;  3N0K A;  2NM1 A;  4GAI A;  2X2T A;  1ISV A;  3CA4 A;  4Q9G A;  4END A;  2J3P A;  2LIE A;  3FJF A;  3PME A;  1HCE A;  1HWN B;  2E4M A;  4OWL A;  1Q1U A;  41BI A;  3BRF A;  1FV2 A;  2VSE A;  3FJ9 A;  4OEF A;  3BA4 A;  4XJE A;  4OAG A;  2XOA A;  1YXW A;  2VUA A;  4OEG A;  2AAI B;  4JLX A;  1DZC A;  3WO3 A;  3UJ0 A;  1TWE A;  3V0B B;  1RY7 A;  1CE7 B;  1HIB A;  1TTU A;  3NBD A;  3H6S E;  4ZA3 B;  2B51 A;  3N7K A;  2FO1 A;  1WD3 A;  1XG6 A;  3CU1 B;  3POK A;  3FGM A;  2D43 A;  3P53 A;  4XFU A;  1WD4 A;  4FVV A;  3H6R A;  4I1E A;  4P0J A;  4USO A;  2VSA A;  5F8S A;  2Q3N B;  2VXT I;  2AFG A;  2F2F A;  1L2H A;  2M49 A;  1IRP A;  4OWK A;  4I7I A;  3MAL A;  3BAD A;  3BB2 A;  4QKS A;  4HR6 C;  4EFR A;  4J2K A;  1V6U A;  4OWJ A;  4QBV A;  2X2S A;  2GZB A;  3IAG C;  4I4P A;  1D0H A;  2MLL B;  4I6I A;  5CFT A;  1YBI A;  1AF9 A;  4H75 A;  3AKF A;  3BRD A;  1BLA A;  1YF8 B;  4I4R A;  3WIN C;  3VT1 A;  2K43 A;  1E0O A;  2ERM A;  4GP0 A;  3FJK A;  3CA3 A;  3P6I A;  3O4A A;  3FJH A;  1NUN A;  1N4K A;  4EB2 B;  2D20 A;  4IZE A;  2NTD A;  4JPZ A;  4I37 A;  1MC9 A;  5BP5 C;  3EF2 A;  1DIW A;  1YTO A;  3I2X A;  2KH2 A;  3FJJ A;  4HA2 A;  4IZX A;  4F34 A;  4H04 A;  3VUO A;  3V0A B;  1TIE A;  2KI6 B;  2RST A;  4LO7 B;  1HWM B;  3H6Q A;  3P6J A;  4KBB A;  1A8D A;  2KLL A;  1QQK A;  1IJT A;  4K9A A;  4KEK A;  3AH2 A;  1EYL A;  8I1B A;  5G00 A;  3AKH A;  4TLP A;  4N7R A;  1JY0 A;  2AXM A;  5EG6 C;  3N7L A;  3AZV A;  5FZZ A;  3B9U A;  2VU9 A;  2ET2 A;  3WIN A;  5D61 A;  1DQG A;  4ZLB B;  4JLZ A;  2DS0 A;  4I4S A;  1IIL A;  4EFQ A;  4ISQ A;  1JLX A;  1BAS A;  3UD7 A;  3HSM A;  3O44 A;  4LO1 C;  3UD9 A;  5BP5 A;  2EWR A;  1II4 A;  1K5U A;  3UJ4 A;  5E24 E;  3F1R A;  5GAQ A;  1RML A;  4NXU A;  3AZW A;  5JMC A;  3CRI A;  5B2H A;  3FJA A;  1JT4 A;  2HW9 A;  3NKU A;  21BI A;  4QO3 A;  4JQ0 A;  2D44 A;  3S8K A;  1Z2V A;  1TFM B;  2K8R A;  3F62 B;  3NBC A;  1PC8 B;  4J2X A;  5D62 A;  5B3Q A;  4MZF B;  1DFC A;  3FJE A;  2MC2 A;  1XZZ A;  4AN6 A;  1G9C A;  4ZOT A;  1JT7 A;  3VSZ A;  1F31 A;  3RMY A;  2NP0 A;  3TC2 A;  1HWP B;  3FJC A;  5JLV A;  3K1X A;  3O4O A;  3WO4 A;  2ZQN A;  4LO1 A;  1G9A A;  3OBT A;  4J2S A;  3VEQ A;  3QYD A;  2QYI B;  2RG9 B;  4G9N A;  3IM7 A;  5BVP I;  1MD6 A;  4UY4 A;  4P0L A;  1R8O A;  4F83 A;  3OBR A;  3OJ2 A;  1QQL A;  3RMX A;  3AH1 A;  2P39 A;  1AVW B;  4K8V A;  4O69 A;  4K9B A;  1AVA C;  1JQZ A;  4II0 A;  1S0L A;  2YUG A;  5FNW A;  4DEN A;  2DRY A;  4FO1 A;  1YYN A;  4MZH A;  4P0K A;  2DRE A;  1DQO A;  3JRR A;  4IQP A;  3ZC8 A;  2FGF A;  1JLY A;  4O67 A;  5B3P A;  3FJI A;  1HKN A;  3LLP A;  4LEY A;  4HJJ A;  3A22 A;  1RZO B;  1J0S A;  1OQL B;  1S0D A;  2Z48 A;  4AN7 B;  2D22 A;  3NJ5 A;  2BEA A;  2KI4 A;  5F8Y A;  2QN4 A;  1S0C A;  3CA6 A;  4ZKT B;  3UDA A;  4KC3 A;  4LEW A;  1HCD A;  3FUQ A;  3Q7Y A;  1FV3 A;  2VLC A;  1GGP B;  2ZR1 B;  1W3F A;  4D8H A;  3H6R B;  4WBC A;  5EC5 A;  3BA5 A;  3AJ5 A;  4ZFY B;  2MIB A;  2KKI A;  1IOB A;  4X37 A;  2WRY A;  4XFT A;  3KMV A;  4NXW A;  1EPW A;  4MZG B;  2D24 A;  1GPJ A;  4I4X A;  2GO2 A;  3MPP G;  4I4Y A;  4OAH A;  4WQL A;  5EHA A;  5F90 A;  1V6V A;  3N7J A;  1FQ9 A;  1W3A A;  1XYF A;  4I2S A;  1BLD A;  2D7R A;  4ZBV B;  1TWM A;  3E8L C;  3OGF A;  4XKI A;  4I96 A;  1BFC A;  2FCL A;  1AFC A;  1ISY A;  3BAQ A;  1S0G A;  1VCL A;  1S0E A;  3V79 C;  4I4O A;  4LO2 A;  5FZY A;  4ZGR B;  4NXT A;  3T8S A;  2Y9W C;  3A21 A;  3O4B A;  3MCR A;  1K5V A;  2GAF D;  1BFG A;  1ISZ A;  4P6A A;  3OGG A;  3UD8 A;  3ZXG A;  1G9D A;  1KNM A;  3AH4 A;  2GA9 D;  4I0Y A;  4JAW A;  3VSF A;  3ZC9 A;  4H9W A;  4USP A;  4X3A A;  3PHZ A;  4ZFU B;  3HMY A;  4JP0 A;  1G9B A;  3IIR A;  31BI A;  4WH5 A;  1ONK B;  4DCK C;  2NYY A;  4ION A;  3BAH A;  4JRA A;  4XFS A;  1V6W A;  4KB6 A;  3S8J A;  1TOO A;  4I4V A;  4Q91 A;  4LEZ A;  3HOM A;  4QD2 B;  4JKQ A;  5FNX A;  3SNV A;  3O4C A;  4LO0 C;  5DUY A;  1DZD A;  1FMM S;  4Q9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...