5D63A

Moa-z-vad-fmk inhibitor complex, direct/inverted dual orientation
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Agglutinin
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
total genus 93
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d63A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d63A02
3IAGC 6I1BA 4P0LA 3FJIA 4DEPA 3OGFA 2VU9A 1JLYA 1NUNA 1JT7A 1W3FA 3E8LC 3I29B 3CA6A 1HCDA 3F62B 3WO3A 1YTOA 1G9BA 1JTCA 1IOBA 2BEBA 5DUYA 4L4IA 4IZXA 2AXMA 3R4UA 3R4SA 1JT4A 3ZXGA 2HWMA 1G9AA 2VUAA 4ZGRB 4GP3A 3FUOA 1A8DA 3FJ8A 1P63A 3FJCA 2DS0A 5EC5A 1M16A 2HZ9A 1I1EA 4X38A 4J2YA 4JKXB 1TP0A 3O49A 1XG6A 2D20A 4USOA 3HSMA 3AH1A 4KEJA 3WO2A 2FFUA 3AKFA 3VT0A 3V0BA 1AXMA 2NYYA 4P6AA 4WBCA 3CA1A 2D43A 1PZZA 1IJTA 5B2HA 2E4MA 1HWNB 5GAQA 3FJBA 1S0DA 1Q04A 4I1BA 3VSZA 4D0TA 1OQLB 1G9CA 4PC4A 3I2XA 4LO1C 4DCKC 5DSSB 4GOYA 1BFBA 1FN0A 4JQ0A 3N7KA 3PUBA 1PWAA 5D61A 3V0BB 7I1BA 1MC9A 5EG6C 4I4QA 5BP5A 4JP0A 1T9FA 2KKIA 2F2FC 1EPWA 2E4MC 1K5VA 4OUJA 4X37A 1CE7B 4D0ZA 1AVXB 1E0OA 1TIEA 2DRYA 3WINA 5D63A 3O4AA 1IRAX 1YBIA 2RSTA 4I37A 1BFCA 3BA5A 2X2SA 2Z49A 4USPA 4I6IA 4ZFWB 1AFCA 4J2XA 1DQGA 2RG9B 3VWCA 1HCEA 1L2HA 1JQZA 3N7JA 3IM7A 1R8NA 4YOLA 3I2AA 2MC2A 4EEEB 3FFZA 1AVWB 3AKHA 4GAFA 4A7KA 3Q7XA 2ZQNA 4P0KA 1FMZA 1JT3A 2KH2A 2Y9FA 5G00A 4ZFUB 3CRIA 3H6QA 1F31A 3IM6A 3A21A 3RSJA 3AJ6A 3IM5A 1ISXA 1S0LA 2Q9XA 1AVAC 3IIRA 4L4HA 3MPPG 3BAUA 4IQPA 3C9ZA 1ILR1 3BAGA 3N7MA 3HMYA 4P0JA 2WRYA 3UD9A 2VXTI 4IYBA 1ISYA 2UUSA 3NJ5A 2FFVA 1II4A 2M49A 4EB2B 1G82A 3V0AA 3OJMA 4I1EA 3Q7WA 4X39A 5E24E 4QD2B 1DZCA 4QD2C 1V6UA 3N7LA 4II0A 3VUOA 1DLLA 3PHZA 3PMEA 3VSFA 1EVTA 1ITBA 4JAWA 2Q3NB 4KBBA 3BX1C 1FMMS 5FZYA 4XKIA 4LO0C 9ILBA 3AKGA 3P6IA 4OWKA 1PUUB 1DIWA 3FJ9A 1AVUA 2GO2A 3V0AB 2VSEA 1FV3A 4R6UB 1TTUA 2J3PA 2MIBA 4EFPA 1RG8A 5BQUA 2BFHA 3F1RA 4LO7B 4A7YA 4LO7C 3HALA 2AFGA 1FQ9A 4I7IA 4I8MA 4Q9PA 4JPZA 1G9DA 4OWLA 2K8RA 1DFQA 3OGGA 1WD3A 4ZFYB 3WMUA 2LIQA 3B9UA 2Y9GA 3O44A 3AH2A 3UJ0A 1V6WA 1KNMA 5BQUC 4ZOTA 41BIA 4LO1A 3FJDA 4J2SA 5BXPA 1HWMB 1PUMB 3RTIB 3O4CA 3BRDA 5DVHA 1HWOB 3CA0A 2F2FA 2K43A 2K4AB 2Z48A 2NTDA 3A23A 4IONA 2VXRA 4JKQA 3RMXA 1XYFA 2KLLA 4I0YA 4TLPA 1QQKA 1S0FA 3BTAA 4IHZA 4I4OA 4DENA 2ERMA 3AJ5A 5F8WA 1BFFA 3VT2A 3S8JA 2LIEA 3N0KA 2AQZA 5JLVA 1S0BA 3BAHA 1J0SA 5HPZA 5F8YA 2Y9XE 4EFQA 2I1BA 2NVHA 3ZX7A 5BXRA 1S0CA 1YXWA 3FJEA 3D7WB 4ISQA 5DZUA 1JLXA 1ISWA 3BAOA 3OJ2A 1WBCA 2FGFA 2D23A 5JMCA 1EYLA 1TWMA 3RMYA 1IT0A 4LO8B 4XFUA 1CVSA 3O4OA 1FWVA 2KI6B 4LO2C 1Z2VA 1IILA 3HN1A 3AZVA 3P6JA 4OWJA 4I4XA 3UD8A 3CQAA 5BVPI 1JY0A 1BA7A 3A22A 1DQOA 3CA5A 1FV2A 1FWUA 2AAIB 4X3AA 3PG0A 2D24A 4G1RA 5FZUA 4FVVA 1BLDA 1NZKA 2GZBA 2Y9WC 4QBVA 3UJ4A 4Q9GA 1Q1UA 2XOAA 3RTJB 3BA7A 1V6VA 2IWTB 4F34A 4I4RA 1EV2A 4JRAA 4LO0A 3QR5A 4G6JA 3T8SA 3OBTA 3CU1B 3POKA 2L5XA 4G6MA 5F8SA 4HA2A 4AN7B 2QYIB 4GOVA 1RMLA 2NP0A 1N4KA 5BOWA 1QQLA 1IHKA 1GGPB 3S8KA 1SR4C 4G9NA 4ZKTB 4I4VA 1HIBA 21BIA 3FUQA 4GP0A 2DREA 3BRFA 3CRHA 5D62A 3AH4A 3BB2A 2HWAA 1M2TB 3HBWA 4LO3C 4A7ZA 3ZC9A 2ZQOA 1HKNA 1TFMB 1JT5A 5FNWA 3LLPA 3O4BA 3NBCA 4I4SA 5EHAA 4Q91A 1AF9A 1S0GA 3H6SE 2D1ZA 4I2SA 2KI4A 4G9MA 4QBCA 3ZC8A 2BEAA 2D7IA 1K5UA 2IHOA 3CAHA 4CJMA 4I4YA 1I1BA 2RQ9A 1YF8B 1FGAA 1MD6A 5FZZA 4I4PA 1Q03A 5I1BA 2X2TA 1T4QA 4QC4A 4QKRA 3FJKA 2NM1A 1Z4SA 4J2KA 1BFGA 1BLAA 2VLCA 4Z9WB 3KMVA 4GAIA 3NBNA 4KEKA 2NZ9A 1PC8B 1XHBA 1HWPB 4I4UA 3WO4A 3OJVA 1V6XA 2ET2A 1ISVA 2YUGA 2ZR1B 3BA4A 4XFTA 4XFSA 3UDAA 2FO1A 3WA1A 4LO2A 1W3GA 3AKIA 1WD4A 1YYNA 1DJSB 3K1XA 3NBEA 3EF2A 3V79C 4J23B 4OEFA 3WMVA 1S0EA 1QXMA 1RZOB 2R9KB 4HJJA 3P53A 3Q7YA 4OEGA 4H04A 2VSAA 4ISRA 3FJAA 3W9TA 1R8OA 5BXSA 2MLLB 3A07A 1TWEA 3SNVA 1SZ6B 1ONKB 3QYDA 4H9WA 2P23A 4IY9A 2D7RA 5BP5C 8I1BA 5FNXA 4KC3A 4QKSA 3VEQA 3VT1A 4Z8SB 1Z0HA 4EFRA 4ENDA 2FDBM 4EKXB 2HW9A 3UD7A 4KEIA 3LTQA 3ILAA 31BIA 3WINC 1RY7A 3ZXDA 4HR6C 2QN4A 3MALA 3NBDA 4QO3A 3FGMA 1SR4A 3H6RA 1DZDA 1WBAA 3BADA 3FJHA 1VCLA 5BXTA 1DFCA 3CA3A 2F8XC 2WBCA 3FJJA 4OEEA 1TOOA 1XZZA 3AZWA 3BAVA 1IRPA 3CRGA 3JRRA 1BARA 4LO3A 1UPSA 3JUTA 3TC2A 4FGFA 4I96A 5F90A 3HOMA 1ISZA 4I3NA 4IY8A 4ZA3B 3FJFA 4ZLBB 2D44A 1D0HA 3H6RB 2ESUA 3OBRA 4F83A 4IZEA 3BRGC 4ZBVB 3BAQA 1W3AA 1BASA 3O3QA 4D8HA 4OW4A 2DRZA 3CA4A 3O4DA 3O5WB 2D22A 4AN6A 1ABRB 4QALA 2P39A
chains in the Genus database with same CATH superfamily
1MIWA 4N7RA 5CB1A 1TV9A 3ISCA 3I29B 3CA6A 1ZQFA 4K9BA 5DUYA 4I28A 3R4SA 4FO6A 1JT4A 3ZXGA 3OUYA 4ZGRB 4UB4A 1NO5A 2DS0A 2HZ9A 3WFRE 4JKXB 1TP0A 2I9GA 5BPCA 3HSMA 4QZAA 3V0BA 4KLJA 4KLTA 5DDYA 3L9DA 4QZGA 1PZZA 1IJTA 5IIIA 3MGIA 1Q04A 4I1BA 2FMQA 3GDXA 3K75D 4JQ0A 3PUBA 5BOLA 1MC9A 4I4QA 4JP0A 1T9FA 1UETA 1K5VA 3ISDA 3LQCB 8ICLA 4LEWA 3JPNA 1AVXB 1E0OA 1YBIA 2RSTA 3BA5A 3RJJA 4J2XA 8ICYA 5DDMA 5JTGA 2BBHA 1R8NA 4R66A 3I2AA 3FFZA 3K7DA 4WBZA 2ZQNA 1ZQWA 2Y9FA 3OVBA 4NXVA 3HJ1A 4P4PA 4O5KA 4PHAA 1UEVA 3N7MA 3UD9A 7ICHA 5HRIA 4EB2B 4I1EA 3Q7WA 5E24E 1DZCA 4QD2C 1V6UA 3N7LA 4II0A 3VUOA 3VSFA 1EVTA 1DIWA 1AVUA 3V0AB 2VSEA 5J2JA 4R6UB 3MGHA 1RG8A 5BQUA 4UAYA 4LO7C 2K8RA 9ICXA 4JLZA 3O44A 1KNMA 3MCRA 4Z6FA 1JAJA 3BRDA 4ATBB 1BPYA 4NKTA 2VXRA 4M2YA 4JKQA 4I0YA 1QQKA 3BTAA 1TVAA 3AJ5A 4MZGB 1MQ2A 3WFSC 3VT2A 3JPOA 4FHYA 3S8JA 4MFAA 4PH5A 9ICVA 4I27A 5F8YA 4EFQA 2I1BA 5J2IA 5BXRA 1S0CA 3CK6A 1YXWA 3FJEA 1JLXA 2M2UA 3BAOA 3OJ2A 2D23A 1ZQHA 4LO8B 4WC6A 4OWJA 4K98A 9ICUA 1BA7A 4QZBA 4QZCA 1BLDA 4QBVA 4E7XA 9ICPA 9ICEA 1V6VA 4JRAA 3T8SA 3CU1B 4F5QA 5CJ7A 4UAWA 3AQMA 3RJGA 5TZVA 3RH5A 2O5AA 3S8KA 4QZHA 1SR4C 21BIA 4GP0A 3BRFA 3CRHA 5D62A 2DVIA 1M2TB 8ICPA 4LO3C 3PNCA 4I2CA 1HKNA 3NBCA 5EHAA 1KNYA 4MKPA 3H6SE 2BCUA 4G9MA 5J2EA 4RQ7A 5IIKA 4I4YA 4O9MA 1Q79A 4FHVA 5CP2A 3RH4A 5I1BA 4QKRA 1Z4SA 8ICBA 4Z9WB 4KLMA 3NBNA 5HRBA 5EOZA 1VJ7A 2ET2A 1MQ3A 3V7JA 7ICRA 2YUGA 3BA4A 2FO1A 4X4QA 1W3GA 3H39A 1YYNA 3B0XA 3HX0A 3NBEA 3V79C 4XUSA 4OEFA 4WBYA 5HRLA 5BXSA 4R65A 4IY9A 5BP5C 4O5EA 8I1BA 4FO1A 4QKSA 4EFRA 2FDBM 4EKXB 7ICKA 2NRKA 3UD7A 3WINC 2QN4A 4UB1A 7ICMA 1SR4A 8ICWA 4O69A 5CFSA 3HWTA 5IINA 1VCLA 3C5GA 1KEJA 3NYBA 5CHEA 2WBCA 4QZFA 3BAVA 5DB7A 3TC2A 1BARA 4LO3A 5DEDA 3HOMA 1ISZA 4IY8A 1D0HA 3OBRA 4F83A 4IZEA 4ZBVB 3BAQA 4RQ1A 9ICAA 4DOAA 7ICJA 4P0LA 3V7LA 4DEPA 3OGFA 4XA5A 1ZQRA 3AQKA 1NUNA 1JT7A 1W3FA 3E8LC 3F62B 2PFNA 1G9BA 4I29A 1IOBA 2BEBA 2HWMA 1G9AA 4NY8A 3FJ8A 1P63A 1M16A 2BBJA 3O49A 4USOA 4JWMA 4KEJA 3H3AA 2FFUA 3VT0A 1AXMA 1R8BA 2NYYA 1BPZA 3CA1A 4KLSA 2PBEA 2E4MA 1HWNB 4NXWA 1ZQKA 2DRBA 4PC4A 4M5DA 4K96A 5IIOA 1BFBA 1FN0A 3RJHA 2ISOA 7I1BA 4IQUA 8ICSA 5BP5A 2KKIA 3MBYA 4LVSA 4X37A 5HC9A 3WINA 5D63A 1BPXA 9ICNA 3C2LA 5B3QA 2Z49A 4IQVA 4MF8A 1DQGA 4RWNA 1HCEA 1JQZA 3N7JA 4PHEA 5DB6A 1XSNA 3Q7XA 4ZFUB 2KH2A 1RPLA 5J0UA 4RQ4A 4WC0A 2M2VA 3IM6A 4PGXA 3AJ6A 5DB9A 5J0WA 5J0PA 1AVAC 3MPPG 4IQPA 1ILR1 3BAGA 1ISYA 3NJ5A 2FFVA 1ZQMA 5J0OA 4QD2B 4KLHA 1DLLA 2Q3NB 5HRHA 4AT8A 4XKIA 9ICTA 9ILBA 4O6AA 3FJ9A 2GO2A 2BPFA 8ICXA 4X4OA 2J3PA 9ICHA 4NXUA 2BFHA 4LO7B 4A7YA 2AFGA 1FQ9A 4I7IA 4Q9PA 4JPZA 1G9DA 4OWLA 4RWOA 1DFQA 3B9UA 4O5CA 3UJ0A 1V6WA 4I2IA 5BQUC 4ZOTA 7ICLA 1NOMA 3FJDA 5DKWA 5D49A 4RQ2A 2BPCA 2ISPA 1HWOB 2K43A 2M2WA 8ICIA 3A23A 4IONA 1XYFA 4I4OA 2ERMA 4RT3A 4EGWA 7ICFA 1XSLA 4QZ8A 4O67A 4AT7A 4S3NA 5HRKA 3UXOA 2FMPA 1S0BA 4AT9A 2Y9XE 2HHPA 2NVHA 1WBCA 2FGFA 5JMCA 1EYLA 3RMYA 1IT0A 3UQ2A 4LO2C 7ICUA 4I4XA 3MDCA 5CFUA 3A22A 1DQOA 1FV2A 4YMMA 4I2HA 3UJ4A 4Q9GA 4F34A 4I4RA 3V72A 3WFQE 4AN7B 4LZGA 8ICAA 4GOVA 3C5FA 4K97A 5BOWA 1QQLA 5B3PA 1V4AA 3FUQA 3BB2A 2HWAA 3UPSA 3JYYA 3ZC9A 2ZQOA 4KLFA 4Q91A 4EV6A 2KI4A 4OAHA 8ICFA 4RWQA 4XQ7A 2PFOA 5FZZA 4I4PA 1Q03A 4QC4A 3FJKA 4J2KA 2VLCA 3OVSA 5HREA 4KEKA 1ZQXA 5HR9A 1PC8B 2BCQA 3OJVA 4XFTA 4XFSA 3UDAA 4UB5A 3WA1A 4LO2A 3AKIA 3AQLA 4RPXA 3K1XA 3WMVA 1S0EA 5J2AA 3Q7YA 4M0AA 2VSAA 3W9TA 3UXPA 2MLLB 3SNVA 1SZ6B 3ER8C 4M04A 4H9WA 4UBCA 2DR7A 2D7RA 4KC3A 2W9MA 4IQTA 4Z8SB 1RZTA 2HW9A 3ILAA 1RY7A 4HR6C 5HRFA 4QO3A 3H6RA 1WBAA 1ZQVA 3FJHA 4WOYA 4WCWA 1DFCA 3FJJA 3ERCC 3UQ0A 4EBJA 1IRPA 4NXXA 1UPSA 4FGFA 4NLNA 5F90A 4I3NA 4JLXA 2ZH4A 4D8HA 2DRZA 3CA4A 4AN6A 9ICBA 1ABRB 4LEZA 2ZHBA 2P39A 3IAGC 6I1BA 3FJIA 1JLYA 4MFFA 1OU5A 5J2FA 1HCDA 3JCFA 2FCLA 4WC4A 2ZH9A 4L4IA 4IZXA 8ICZA 3AU6A 2AXMA 1ZQOA 4R63A 4KLEA 3FUOA 4AT8B 3FJCA 1I1EA 4J2YA 2GA9D 3AU2A 1XG6A 4QZIA 4WC5A 4O68A 3AH1A 3WO2A 3OUYB 4WBCA 2ZH3A 2P66A 5GAQA 3FJBA 3VSZA 4D0TA 4I2GA 3I2XA 4DCKC 4GOYA 3V0BB 5D61A 3HJ4A 5EG6C 1EPWA 1BPEA 2E4MC 4OUJA 4D0ZA 1TIEA 9ICSA 3O4AA 1ZJNA 4I37A 5HRDA 4USPA 4Z6DA 4I6IA 4ZFWB 1AFCA 9ICRA 3RJIA 3UPQA 3VWCA 1L2HA 4K9AA 2HN2A 3IM7A 3JPSA 4K4HA 2MC2A 5J2KA 4EEEB 3AKHA 4A7KA 8ICQA 4P0KA 1FMZA 5G00A 7ICVA 3H6QA 4LEVA 3RH6A 1UEUA 4RQ0A 3A21A 3RJKA 8ICRA 3IM5A 1S0LA 4L4HA 3BAUA 4P0JA 4IYBA 4YMOA 2UUSA 5BOMA 5J2BA 3V0AA 4I2JA 2B51A 4X39A 7ICPA 3PHZA 3PMEA 4X4RA 4JAWA 4KBBA 3BX1C 1FMMS 5FZYA 1XSPA 4PHDA 3AKGA 3P6IA 1TTUA 1BPDA 1ZQEA 3HALA 4UBBA 4MZHA 4Z6CA 1WD3A 4ZFYB 2ZH1A 3WMUA 3JPQA 3C2KA 4IQWA 3AH2A 4RT2A 5DBBA 41BIA 1PUMB 3RTIB 3O4CA 5DVHA 3CA0A 4YD2A 2Z48A 4KM5A 2NTDA 3PMLA 4NLKA 4TLPA 4X4PA 9ICFA 3NVOA 8ICGA 3JPPA 2IUBA 3HW8A 4M47A 3NKUA 1ZQDA 5JLVA 5HPZA 4LZDA 3C18A 1HUZA 5F2VO 9ICWA 4I2EA 3D7WB 4FHPA 4UAZA 1ISWA 4I2BA 5DBAA 4QZEA 2DR9A 4XFUA 4UD5A 1CVSA 3O4OA 2KI6B 4M9GA 1IILA 3HN1A 3AZVA 4YMNA 4X4NA 4FHWA 3UD8A 3CQAA 1ZQLA 1JY0A 3CA5A 3HIYA 3B0YA 3OV7A 2AAIB 4G1RA 4XRHA 4FVVA 5J0RA 4RQ8A 1Q1UA 4EEDA 3OVAA 1MIYA 2IWTB 9ICQA 1EV2A 3OWGA 3QR5A 4F5OA 3POKA 2Q66A 2BPGA 4KLDA 1GPJA 1PX5A 2QYIB 2NP0A 1N4KA 3TFSA 4KLIA 4FH5A 1IHKA 4X4SA 3V7KA 1ZQAA 4ZKTB 1HIBA 2DRAA 3AH4A 8ICHA 3ER9B 4MF2A 1HUOA 4QZ9A 4OAIZ 1TFMB 1JT5A 5FNWA 3O4BA 4I4SA 1AF9A 1S0GA 2D1ZA 3C2MA 3RJFA 3C66A 4GXJA 4EP7A 4QBCA 3ZC8A 2RFFA 2D7IA 4WH5A 2IHOA 3CAHA 1ZQBA 1I1BA 4TUPA 1YF8B 1MD6A 3JPTA 2X2TA 4F5RA 4RWPA 4GAIA 4KLQA 1XHBA 1HWPB 1V6XA 1ZQQA 9ICLA 2ZR1B 1JN3A 2DR8A 2NS2A 3LK9A 4RQ3A 8ICNA 2GAFD 4TUQA 4HJJA 3P53A 4DOCA 4ISRA 3FJAA 4KLOA 1R8OA 1TWEA 4TURA 4PGQA 8ICOA 3OGUA 2ZHAA 2P23A 1VFGA 4K4GA 5FNXA 3VEQA 3VT1A 5CA7A 4R64A 4Z6EA 5HHIA 3LTQA 3ZXDA 1ZQIA 3MALA 4M9JA 3PMNA 1TFYA 1DZDA 5BXTA 3CA3A 2F8XC 8ICMA 4OEEA 1TOOA 1XZZA 3AZWA 8ICKA 3CRGA 3JRRA 4WC3A 4I96A 4ZLBB 2D44A 3BRGC 8ICJA 1W3AA 4HX0A 4MFCA 3O4DA 4RPZA 2D22A 4QALA 5J29A 2VU9A 3TFRA 5IIMA 1ZQZA 1ZQTA 3NWIA 3WO3A 1YTOA 4M9LA 1JTCA 3AQNA 3R4UA 2O1PA 2VUAA 4GP3A 1A8DA 4DOBA 5EC5A 4UD4A 4KB6A 4X38A 2D20A 4WQLA 3AKFA 5DBCA 4P6AA 1BPBA 2D43A 4P2HA 1FA0A 1ZQJA 5B2HA 4GXKA 4X0BA 4PPXA 1S0DA 4E80A 3AUOA 1OQLB 1G9CA 4LO1C 5DSSB 5J2DA 3N7KA 1PWAA 5CWRA 4X4UA 3H38A 4YCXA 2F2FC 1ZQUA 1CE7B 1JQRA 2DRYA 4MZFB 1IRAX 4K4IA 1BFCA 2X2SA 4UB3A 4PGYA 2RG9B 1ZQSA 4YOLA 1AVWB 4GAFA 4YD1A 1JT3A 3CRIA 5J0SA 1F31A 2ID1A 8ICCA 2ZH7A 4RPYA 3RSJA 2ZH6A 1ISXA 2Q9XA 3IIRA 5J2CA 3C9ZA 9ICJA 3HMYA 2WRYA 2VXTI 7ICOA 2PFQA 5IIJA 1II4A 2M49A 1G82A 3OJMA 4X0AA 4FHXA 5J2GA 4K8VA 5D46A 4DO9A 1ITBA 4NKUA 3ISBA 4LO0C 4OWKA 1PUUB 4TUSA 2BCVA 1FV3A 2MIBA 4EFPA 2B56A 3F1RA 4I8MA 7ICTA 3OGGA 2LIQA 2Y9GA 2GWSA 2ZH5A 4I2DA 4E8FA 2BCRA 4LO1A 4J2SA 5BXPA 4JWNA 1HWMB 3JZ0A 2F2FA 2K4AB 3RMXA 1KDHA 2KLLA 1S0FA 4IHZA 4DENA 5HRGA 5F8WA 1BFFA 2EWRA 2M2TA 2LIEA 2BCSA 5J0QA 3N0KA 3MDAA 2AQZA 3BAHA 1J0SA 3ZX7A 4ISQA 5DZUA 4AT7B 1JMSA 1TWMA 4NLZA 4UY4A 5CR0A 1FWVA 4AT9B 1Z2VA 1R89A 3P6JA 4QZDA 4GXIA 1Q78A 4WQKA 4LEYA 5BVPI 4I2AA 4LT6A 3JPRA 1FWUA 5J0YA 2ZH8A 4NM2A 4X3AA 3PG0A 2D24A 4I2FA 5FZUA 4M9NA 4YN4A 1NZKA 2GZBA 2Y9WC 2IHMA 2DR5A 2XOAA 4M9HA 3RTJB 3BA7A 4FH3A 1ZQNA 4LO0A 4G6JA 1ZQPA 9ICIA 8ICUA 3OBTA 5DECA 7ICEA 2L5XA 4G6MA 1ZQGA 5F8SA 9ICKA 4HA2A 4EEBA 2B4VA 2VANA 8ICEA 1RMLA 3H37A 1GGPB 4K99A 4G9NA 4I4VA 2DREA 8ICVA 3HBWA 5CHGA 4F5NA 4A7ZA 4P4OA 4X5VA 4ATBA 3LLPA 4OAFA 1R8AA 4I2SA 5D4BA 2BEAA 1K5UA 7ICQA 4KLLA 4WC2A 4CJMA 7ICIA 2RQ9A 5J0XA 1FGAA 1ZQYA 1T4QA 2NM1A 4RQ6A 1BFGA 1BLAA 1TFWA 3KMVA 4NXZA 2FMSA 7ICSA 7ICNA 2NZ9A 4I4UA 3WO4A 3WFPA 1YLQA 1ISVA 2HN1A 2ZH2A 4F5PA 4RQ5A 4IG8A 4NM1A 1WD4A 4H75A 1DJSB 3EF2A 4J23B 5J2HA 4PHPA 4I0UA 1QXMA 1RZOB 4EBKA 2R9KB 4NXTA 1ZQCA 5J0TA 4OEGA 4H04A 1F5AA 2PXIA 7ICGA 3A07A 5CFTA 1ONKB 9ICGA 3QYDA 1R8CA 2BE3A 5HHHA 8ICTA 3UXNA 5DB8A 4KLUA 4WC7A 9ICOA 1Z0HA 4ENDA 3WFOA 4X4VA 4X4TA 4KEIA 4OAGA 31BIA 4UB2A 2PFPA 3NBDA 3FGMA 1WOTA 9ICMA 3RJEA 3BADA 9ICCA 3JUTA 4WC1A 4P4MA 4ZA3B 3FJFA 4XQ8A 3H6RB 2ESUA 1MIVA 4KLGA 1BASA 1ZJMA 3O3QA 5IILA 4OW4A 3O5WB 4XJEA
chains in the Genus database with same CATH topology
3IAGC 6I1BA 4P0LA 3FJIA 4DEPA 3OGFA 2VU9A 4N7RA 1JLYA 1NUNA 1JT7A 1W3FA 3E8LC 3I29B 3CA6A 1HCDA 3F62B 3WO3A 1YTOA 1G9BA 2FCLA 1JTCA 4K9BA 1IOBA 2BEBA 5DUYA 4L4IA 4IZXA 2AXMA 3R4UA 3R4SA 1JT4A 3ZXGA 2HWMA 1G9AA 2VUAA 4ZGRB 4GP3A 3FUOA 1A8DA 3FJ8A 1P63A 3FJCA 2DS0A 5EC5A 1M16A 2HZ9A 1I1EA 4KB6A 4X38A 4J2YA 4JKXB 2GA9D 1TP0A 3O49A 1XG6A 2D20A 4USOA 3HSMA 4O68A 3AH1A 4KEJA 3WO2A 4WQLA 2FFUA 3AKFA 3VT0A 3V0BA 1AXMA 2NYYA 4P6AA 4WBCA 3CA1A 2D43A 1PZZA 1IJTA 5B2HA 2E4MA 1HWNB 5GAQA 3FJBA 1S0DA 1Q04A 4I1BA 4NXWA 3VSZA 4D0TA 1OQLB 1G9CA 4PC4A 4K96A 3I2XA 4LO1C 4DCKC 5DSSB 4GOYA 1BFBA 1FN0A 4JQ0A 3N7KA 3PUBA 1PWAA 5D61A 3V0BB 7I1BA 1MC9A 5EG6C 4I4QA 5BP5A 4JP0A 1T9FA 2KKIA 2F2FC 1EPWA 2E4MC 1K5VA 4OUJA 4X37A 1CE7B 4LEWA 4D0ZA 1AVXB 1E0OA 1TIEA 2DRYA 4MZFB 3WINA 5D63A 3O4AA 1IRAX 1YBIA 2RSTA 4I37A 1BFCA 3BA5A 5B3QA 2X2SA 2Z49A 4USPA 4I6IA 4ZFWB 1AFCA 4J2XA 1DQGA 2RG9B 3VWCA 1HCEA 1L2HA 1JQZA 4K9AA 3N7JA 3IM7A 1R8NA 4YOLA 3I2AA 2MC2A 4EEEB 3FFZA 1AVWB 3AKHA 4GAFA 4A7KA 3K7DA 3Q7XA 2ZQNA 4P0KA 1FMZA 1JT3A 2KH2A 2Y9FA 5G00A 4ZFUB 3CRIA 3H6QA 4LEVA 4NXVA 1F31A 3IM6A 3A21A 3RSJA 3AJ6A 3IM5A 1ISXA 1S0LA 2Q9XA 1AVAC 3IIRA 4L4HA 3MPPG 3BAUA 4IQPA 3C9ZA 1ILR1 3BAGA 3N7MA 3HMYA 4P0JA 2WRYA 3UD9A 2VXTI 4IYBA 1ISYA 2UUSA 3NJ5A 2FFVA 1II4A 2M49A 4EB2B 1G82A 3V0AA 2B51A 3OJMA 4I1EA 3Q7WA 4X39A 5E24E 4QD2B 1DZCA 4QD2C 1V6UA 3N7LA 4II0A 3VUOA 1DLLA 4K8VA 3PHZA 3PMEA 3VSFA 1EVTA 1ITBA 4JAWA 2Q3NB 4KBBA 3BX1C 1FMMS 5FZYA 4XKIA 4LO0C 9ILBA 3AKGA 4O6AA 3P6IA 4OWKA 1PUUB 1DIWA 3FJ9A 1AVUA 2GO2A 3V0AB 2VSEA 1FV3A 4R6UB 1TTUA 2J3PA 2MIBA 4EFPA 1RG8A 2B56A 5BQUA 4NXUA 2BFHA 3F1RA 4LO7B 4A7YA 4LO7C 3HALA 2AFGA 1FQ9A 4I7IA 4I8MA 4Q9PA 4JPZA 1G9DA 4MZHA 4OWLA 2K8RA 1DFQA 3OGGA 1WD3A 4ZFYB 4JLZA 3WMUA 2LIQA 3B9UA 2Y9GA 3O44A 3AH2A 3UJ0A 1V6WA 1KNMA 3MCRA 5BQUC 4ZOTA 41BIA 4LO1A 3FJDA 4J2SA 5BXPA 1HWMB 1PUMB 3RTIB 3O4CA 3BRDA 5DVHA 1HWOB 3CA0A 2F2FA 2K43A 2K4AB 2Z48A 4KM5A 2NTDA 3A23A 4IONA 2VXRA 4JKQA 3RMXA 1XYFA 2KLLA 4I0YA 4TLPA 1QQKA 1S0FA 3BTAA 4IHZA 4I4OA 4DENA 2ERMA 3AJ5A 5F8WA 4MZGB 1BFFA 3VT2A 2EWRA 4O67A 3S8JA 2LIEA 3NKUA 3N0KA 2AQZA 5JLVA 1S0BA 3BAHA 1J0SA 5HPZA 5F8YA 2Y9XE 4EFQA 2I1BA 2NVHA 3ZX7A 5BXRA 1S0CA 1YXWA 3FJEA 3D7WB 4ISQA 5DZUA 1JLXA 1ISWA 3BAOA 3OJ2A 1WBCA 2FGFA 2D23A 5JMCA 1EYLA 1TWMA 3RMYA 1IT0A 4LO8B 4UY4A 4XFUA 1CVSA 3O4OA 1FWVA 2KI6B 4LO2C 1Z2VA 1IILA 3HN1A 3AZVA 3P6JA 4OWJA 4WQKA 4I4XA 4K98A 4LEYA 3UD8A 3CQAA 5BVPI 1JY0A 5CFUA 1BA7A 3A22A 1DQOA 3CA5A 1FV2A 1FWUA 2AAIB 4X3AA 3PG0A 2D24A 4G1RA 5FZUA 4FVVA 1BLDA 1NZKA 2GZBA 2Y9WC 4QBVA 3UJ4A 4Q9GA 1Q1UA 2XOAA 3RTJB 3BA7A 1V6VA 2IWTB 4F34A 4I4RA 1EV2A 4JRAA 3OWGA 4LO0A 3QR5A 4G6JA 3T8SA 3OBTA 3CU1B 3POKA 2L5XA 4G6MA 5F8SA 4HA2A 1GPJA 4AN7B 2B4VA 2QYIB 4GOVA 1RMLA 2NP0A 4K97A 1N4KA 5BOWA 1QQLA 5B3PA 1IHKA 1GGPB 3S8KA 1SR4C 4K99A 4G9NA 4ZKTB 4I4VA 1HIBA 21BIA 3FUQA 4GP0A 2DREA 3BRFA 3CRHA 5D62A 3AH4A 3BB2A 2HWAA 1M2TB 3HBWA 3ER9B 4LO3C 4A7ZA 3ZC9A 2ZQOA 1HKNA 4OAIZ 1TFMB 1JT5A 5FNWA 3LLPA 3O4BA 3NBCA 4I4SA 5EHAA 4Q91A 1AF9A 1S0GA 3H6SE 4MKPA 4OAFA 2D1ZA 4I2SA 2KI4A 4G9MA 4QBCA 3ZC8A 2BEAA 4OAHA 2D7IA 1K5UA 4WH5A 2IHOA 3CAHA 4CJMA 4I4YA 1I1BA 2RQ9A 1YF8B 1FGAA 1MD6A 5FZZA 4I4PA 1Q03A 5I1BA 2X2TA 1T4QA 4QC4A 4QKRA 3FJKA 2NM1A 1Z4SA 4J2KA 1BFGA 1BLAA 2VLCA 4Z9WB 3KMVA 4GAIA 3NBNA 4KEKA 2NZ9A 1PC8B 1XHBA 1HWPB 4I4UA 3WO4A 3OJVA 1V6XA 2ET2A 1ISVA 2YUGA 2ZR1B 3BA4A 4XFTA 4XFSA 3UDAA 2FO1A 2NS2A 3WA1A 4LO2A 1W3GA 3AKIA 1WD4A 1YYNA 4H75A 1DJSB 3K1XA 3NBEA 3EF2A 3V79C 2GAFD 4J23B 4OEFA 3WMVA 1S0EA 1QXMA 1RZOB 2R9KB 4HJJA 4NXTA 3P53A 3Q7YA 4OEGA 4H04A 2VSAA 4ISRA 3FJAA 3W9TA 1R8OA 5BXSA 2MLLB 3A07A 1TWEA 3SNVA 1SZ6B 3ER8C 5CFTA 1ONKB 3QYDA 4H9WA 2P23A 4IY9A 2D7RA 5BP5C 8I1BA 5FNXA 4FO1A 4KC3A 4QKSA 3VEQA 3VT1A 4Z8SB 1Z0HA 4EFRA 4ENDA 2FDBM 4EKXB 2HW9A 3UD7A 4KEIA 3LTQA 3ILAA 31BIA 3WINC 4OAGA 1RY7A 3ZXDA 4HR6C 2QN4A 3MALA 4LEZA 3NBDA 4QO3A 3FGMA 1SR4A 3H6RA 4O69A 5CFSA 1DZDA 1WBAA 3BADA 3FJHA 4WOYA 1VCLA 5BXTA 5CHEA 1DFCA 3CA3A 2F8XC 2WBCA 3FJJA 4OEEA 1TOOA 1XZZA 3AZWA 3ERCC 3BAVA 1IRPA 3CRGA 3JRRA 1BARA 4LO3A 1UPSA 3JUTA 3TC2A 4NXXA 4FGFA 4I96A 5F90A 3HOMA 1ISZA 4I3NA 4IY8A 4ZA3B 3FJFA 4ZLBB 2D44A 1D0HA 3H6RB 2ESUA 3OBRA 4F83A 4IZEA 3BRGC 4ZBVB 3BAQA 4JLXA 1W3AA 1BASA 3O3QA 4HX0A 4D8HA 4OW4A 2DRZA 3CA4A 3O4DA 3O5WB 2D22A 4AN6A 1ABRB 4QALA 4XJEA 2P39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IAG C;  6I1B A;  4P0L A;  3FJI A;  4DEP A;  3OGF A;  2VU9 A;  1JLY A;  1NUN A;  1JT7 A;  1W3F A;  3E8L C;  3I29 B;  3CA6 A;  1HCD A;  3F62 B;  3WO3 A;  1YTO A;  1G9B A;  1JTC A;  1IOB A;  2BEB A;  5DUY A;  4L4I A;  4IZX A;  2AXM A;  3R4U A;  3R4S A;  1JT4 A;  3ZXG A;  2HWM A;  1G9A A;  2VUA A;  4ZGR B;  4GP3 A;  3FUO A;  1A8D A;  3FJ8 A;  1P63 A;  3FJC A;  2DS0 A;  5EC5 A;  1M16 A;  2HZ9 A;  1I1E A;  4X38 A;  4J2Y A;  4JKX B;  1TP0 A;  3O49 A;  1XG6 A;  2D20 A;  4USO A;  3HSM A;  3AH1 A;  4KEJ A;  3WO2 A;  2FFU A;  3AKF A;  3VT0 A;  3V0B A;  1AXM A;  2NYY A;  4P6A A;  4WBC A;  3CA1 A;  2D43 A;  1PZZ A;  1IJT A;  5B2H A;  2E4M A;  1HWN B;  5GAQ A;  3FJB A;  1S0D A;  1Q04 A;  4I1B A;  3VSZ A;  4D0T A;  1OQL B;  1G9C A;  4PC4 A;  3I2X A;  4LO1 C;  4DCK C;  5DSS B;  4GOY A;  1BFB A;  1FN0 A;  4JQ0 A;  3N7K A;  3PUB A;  1PWA A;  5D61 A;  3V0B B;  7I1B A;  1MC9 A;  5EG6 C;  4I4Q A;  5BP5 A;  4JP0 A;  1T9F A;  2KKI A;  2F2F C;  1EPW A;  2E4M C;  1K5V A;  4OUJ A;  4X37 A;  1CE7 B;  4D0Z A;  1AVX B;  1E0O A;  1TIE A;  2DRY A;  3WIN A;  5D63 A;  3O4A A;  1IRA X;  1YBI A;  2RST A;  4I37 A;  1BFC A;  3BA5 A;  2X2S A;  2Z49 A;  4USP A;  4I6I A;  4ZFW B;  1AFC A;  4J2X A;  1DQG A;  2RG9 B;  3VWC A;  1HCE A;  1L2H A;  1JQZ A;  3N7J A;  3IM7 A;  1R8N A;  4YOL A;  3I2A A;  2MC2 A;  4EEE B;  3FFZ A;  1AVW B;  3AKH A;  4GAF A;  4A7K A;  3Q7X A;  2ZQN A;  4P0K A;  1FMZ A;  1JT3 A;  2KH2 A;  2Y9F A;  5G00 A;  4ZFU B;  3CRI A;  3H6Q A;  1F31 A;  3IM6 A;  3A21 A;  3RSJ A;  3AJ6 A;  3IM5 A;  1ISX A;  1S0L A;  2Q9X A;  1AVA C;  3IIR A;  4L4H A;  3MPP G;  3BAU A;  4IQP A;  3C9Z A;  1ILR 1;  3BAG A;  3N7M A;  3HMY A;  4P0J A;  2WRY A;  3UD9 A;  2VXT I;  4IYB A;  1ISY A;  2UUS A;  3NJ5 A;  2FFV A;  1II4 A;  2M49 A;  4EB2 B;  1G82 A;  3V0A A;  3OJM A;  4I1E A;  3Q7W A;  4X39 A;  5E24 E;  4QD2 B;  1DZC A;  4QD2 C;  1V6U A;  3N7L A;  4II0 A;  3VUO A;  1DLL A;  3PHZ A;  3PME A;  3VSF A;  1EVT A;  1ITB A;  4JAW A;  2Q3N B;  4KBB A;  3BX1 C;  1FMM S;  5FZY A;  4XKI A;  4LO0 C;  9ILB A;  3AKG A;  3P6I A;  4OWK A;  1PUU B;  1DIW A;  3FJ9 A;  1AVU A;  2GO2 A;  3V0A B;  2VSE A;  1FV3 A;  4R6U B;  1TTU A;  2J3P A;  2MIB A;  4EFP A;  1RG8 A;  5BQU A;  2BFH A;  3F1R A;  4LO7 B;  4A7Y A;  4LO7 C;  3HAL A;  2AFG A;  1FQ9 A;  4I7I A;  4I8M A;  4Q9P A;  4JPZ A;  1G9D A;  4OWL A;  2K8R A;  1DFQ A;  3OGG A;  1WD3 A;  4ZFY B;  3WMU A;  2LIQ A;  3B9U A;  2Y9G A;  3O44 A;  3AH2 A;  3UJ0 A;  1V6W A;  1KNM A;  5BQU C;  4ZOT A;  41BI A;  4LO1 A;  3FJD A;  4J2S A;  5BXP A;  1HWM B;  1PUM B;  3RTI B;  3O4C A;  3BRD A;  5DVH A;  1HWO B;  3CA0 A;  2F2F A;  2K43 A;  2K4A B;  2Z48 A;  2NTD A;  3A23 A;  4ION A;  2VXR A;  4JKQ A;  3RMX A;  1XYF A;  2KLL A;  4I0Y A;  4TLP A;  1QQK A;  1S0F A;  3BTA A;  4IHZ A;  4I4O A;  4DEN A;  2ERM A;  3AJ5 A;  5F8W A;  1BFF A;  3VT2 A;  3S8J A;  2LIE A;  3N0K A;  2AQZ A;  5JLV A;  1S0B A;  3BAH A;  1J0S A;  5HPZ A;  5F8Y A;  2Y9X E;  4EFQ A;  2I1B A;  2NVH A;  3ZX7 A;  5BXR A;  1S0C A;  1YXW A;  3FJE A;  3D7W B;  4ISQ A;  5DZU A;  1JLX A;  1ISW A;  3BAO A;  3OJ2 A;  1WBC A;  2FGF A;  2D23 A;  5JMC A;  1EYL A;  1TWM A;  3RMY A;  1IT0 A;  4LO8 B;  4XFU A;  1CVS A;  3O4O A;  1FWV A;  2KI6 B;  4LO2 C;  1Z2V A;  1IIL A;  3HN1 A;  3AZV A;  3P6J A;  4OWJ A;  4I4X A;  3UD8 A;  3CQA A;  5BVP I;  1JY0 A;  1BA7 A;  3A22 A;  1DQO A;  3CA5 A;  1FV2 A;  1FWU A;  2AAI B;  4X3A A;  3PG0 A;  2D24 A;  4G1R A;  5FZU A;  4FVV A;  1BLD A;  1NZK A;  2GZB A;  2Y9W C;  4QBV A;  3UJ4 A;  4Q9G A;  1Q1U A;  2XOA A;  3RTJ B;  3BA7 A;  1V6V A;  2IWT B;  4F34 A;  4I4R A;  1EV2 A;  4JRA A;  4LO0 A;  3QR5 A;  4G6J A;  3T8S A;  3OBT A;  3CU1 B;  3POK A;  2L5X A;  4G6M A;  5F8S A;  4HA2 A;  4AN7 B;  2QYI B;  4GOV A;  1RML A;  2NP0 A;  1N4K A;  5BOW A;  1QQL A;  1IHK A;  1GGP B;  3S8K A;  1SR4 C;  4G9N A;  4ZKT B;  4I4V A;  1HIB A;  21BI A;  3FUQ A;  4GP0 A;  2DRE A;  3BRF A;  3CRH A;  5D62 A;  3AH4 A;  3BB2 A;  2HWA A;  1M2T B;  3HBW A;  4LO3 C;  4A7Z A;  3ZC9 A;  2ZQO A;  1HKN A;  1TFM B;  1JT5 A;  5FNW A;  3LLP A;  3O4B A;  3NBC A;  4I4S A;  5EHA A;  4Q91 A;  1AF9 A;  1S0G A;  3H6S E;  2D1Z A;  4I2S A;  2KI4 A;  4G9M A;  4QBC A;  3ZC8 A;  2BEA A;  2D7I A;  1K5U A;  2IHO A;  3CAH A;  4CJM A;  4I4Y A;  1I1B A;  2RQ9 A;  1YF8 B;  1FGA A;  1MD6 A;  5FZZ A;  4I4P A;  1Q03 A;  5I1B A;  2X2T A;  1T4Q A;  4QC4 A;  4QKR A;  3FJK A;  2NM1 A;  1Z4S A;  4J2K A;  1BFG A;  1BLA A;  2VLC A;  4Z9W B;  3KMV A;  4GAI A;  3NBN A;  4KEK A;  2NZ9 A;  1PC8 B;  1XHB A;  1HWP B;  4I4U A;  3WO4 A;  3OJV A;  1V6X A;  2ET2 A;  1ISV A;  2YUG A;  2ZR1 B;  3BA4 A;  4XFT A;  4XFS A;  3UDA A;  2FO1 A;  3WA1 A;  4LO2 A;  1W3G A;  3AKI A;  1WD4 A;  1YYN A;  1DJS B;  3K1X A;  3NBE A;  3EF2 A;  3V79 C;  4J23 B;  4OEF A;  3WMV A;  1S0E A;  1QXM A;  1RZO B;  2R9K B;  4HJJ A;  3P53 A;  3Q7Y A;  4OEG A;  4H04 A;  2VSA A;  4ISR A;  3FJA A;  3W9T A;  1R8O A;  5BXS A;  2MLL B;  3A07 A;  1TWE A;  3SNV A;  1SZ6 B;  1ONK B;  3QYD A;  4H9W A;  2P23 A;  4IY9 A;  2D7R A;  5BP5 C;  8I1B A;  5FNX A;  4KC3 A;  4QKS A;  3VEQ A;  3VT1 A;  4Z8S B;  1Z0H A;  4EFR A;  4END A;  2FDB M;  4EKX B;  2HW9 A;  3UD7 A;  4KEI A;  3LTQ A;  3ILA A;  31BI A;  3WIN C;  1RY7 A;  3ZXD A;  4HR6 C;  2QN4 A;  3MAL A;  3NBD A;  4QO3 A;  3FGM A;  1SR4 A;  3H6R A;  1DZD A;  1WBA A;  3BAD A;  3FJH A;  1VCL A;  5BXT A;  1DFC A;  3CA3 A;  2F8X C;  2WBC A;  3FJJ A;  4OEE A;  1TOO A;  1XZZ A;  3AZW A;  3BAV A;  1IRP A;  3CRG A;  3JRR A;  1BAR A;  4LO3 A;  1UPS A;  3JUT A;  3TC2 A;  4FGF A;  4I96 A;  5F90 A;  3HOM A;  1ISZ A;  4I3N A;  4IY8 A;  4ZA3 B;  3FJF A;  4ZLB B;  2D44 A;  1D0H A;  3H6R B;  2ESU A;  3OBR A;  4F83 A;  4IZE A;  3BRG C;  4ZBV B;  3BAQ A;  1W3A A;  1BAS A;  3O3Q A;  4D8H A;  4OW4 A;  2DRZ A;  3CA4 A;  3O4D A;  3O5W B;  2D22 A;  4AN6 A;  1ABR B;  4QAL A;  2P39 A; 
#chains in the Genus database with same CATH topology
 1MIW A;  4N7R A;  5CB1 A;  1TV9 A;  3ISC A;  3I29 B;  3CA6 A;  1ZQF A;  4K9B A;  5DUY A;  4I28 A;  3R4S A;  4FO6 A;  1JT4 A;  3ZXG A;  3OUY A;  4ZGR B;  4UB4 A;  1NO5 A;  2DS0 A;  2HZ9 A;  3WFR E;  4JKX B;  1TP0 A;  2I9G A;  5BPC A;  3HSM A;  4QZA A;  3V0B A;  4KLJ A;  4KLT A;  5DDY A;  3L9D A;  4QZG A;  1PZZ A;  1IJT A;  5III A;  3MGI A;  1Q04 A;  4I1B A;  2FMQ A;  3GDX A;  3K75 D;  4JQ0 A;  3PUB A;  5BOL A;  1MC9 A;  4I4Q A;  4JP0 A;  1T9F A;  1UET A;  1K5V A;  3ISD A;  3LQC B;  8ICL A;  4LEW A;  3JPN A;  1AVX B;  1E0O A;  1YBI A;  2RST A;  3BA5 A;  3RJJ A;  4J2X A;  8ICY A;  5DDM A;  5JTG A;  2BBH A;  1R8N A;  4R66 A;  3I2A A;  3FFZ A;  3K7D A;  4WBZ A;  2ZQN A;  1ZQW A;  2Y9F A;  3OVB A;  4NXV A;  3HJ1 A;  4P4P A;  4O5K A;  4PHA A;  1UEV A;  3N7M A;  3UD9 A;  7ICH A;  5HRI A;  4EB2 B;  4I1E A;  3Q7W A;  5E24 E;  1DZC A;  4QD2 C;  1V6U A;  3N7L A;  4II0 A;  3VUO A;  3VSF A;  1EVT A;  1DIW A;  1AVU A;  3V0A B;  2VSE A;  5J2J A;  4R6U B;  3MGH A;  1RG8 A;  5BQU A;  4UAY A;  4LO7 C;  2K8R A;  9ICX A;  4JLZ A;  3O44 A;  1KNM A;  3MCR A;  4Z6F A;  1JAJ A;  3BRD A;  4ATB B;  1BPY A;  4NKT A;  2VXR A;  4M2Y A;  4JKQ A;  4I0Y A;  1QQK A;  3BTA A;  1TVA A;  3AJ5 A;  4MZG B;  1MQ2 A;  3WFS C;  3VT2 A;  3JPO A;  4FHY A;  3S8J A;  4MFA A;  4PH5 A;  9ICV A;  4I27 A;  5F8Y A;  4EFQ A;  2I1B A;  5J2I A;  5BXR A;  1S0C A;  3CK6 A;  1YXW A;  3FJE A;  1JLX A;  2M2U A;  3BAO A;  3OJ2 A;  2D23 A;  1ZQH A;  4LO8 B;  4WC6 A;  4OWJ A;  4K98 A;  9ICU A;  1BA7 A;  4QZB A;  4QZC A;  1BLD A;  4QBV A;  4E7X A;  9ICP A;  9ICE A;  1V6V A;  4JRA A;  3T8S A;  3CU1 B;  4F5Q A;  5CJ7 A;  4UAW A;  3AQM A;  3RJG A;  5TZV A;  3RH5 A;  2O5A A;  3S8K A;  4QZH A;  1SR4 C;  21BI A;  4GP0 A;  3BRF A;  3CRH A;  5D62 A;  2DVI A;  1M2T B;  8ICP A;  4LO3 C;  3PNC A;  4I2C A;  1HKN A;  3NBC A;  5EHA A;  1KNY A;  4MKP A;  3H6S E;  2BCU A;  4G9M A;  5J2E A;  4RQ7 A;  5IIK A;  4I4Y A;  4O9M A;  1Q79 A;  4FHV A;  5CP2 A;  3RH4 A;  5I1B A;  4QKR A;  1Z4S A;  8ICB A;  4Z9W B;  4KLM A;  3NBN A;  5HRB A;  5EOZ A;  1VJ7 A;  2ET2 A;  1MQ3 A;  3V7J A;  7ICR A;  2YUG A;  3BA4 A;  2FO1 A;  4X4Q A;  1W3G A;  3H39 A;  1YYN A;  3B0X A;  3HX0 A;  3NBE A;  3V79 C;  4XUS A;  4OEF A;  4WBY A;  5HRL A;  5BXS A;  4R65 A;  4IY9 A;  5BP5 C;  4O5E A;  8I1B A;  4FO1 A;  4QKS A;  4EFR A;  2FDB M;  4EKX B;  7ICK A;  2NRK A;  3UD7 A;  3WIN C;  2QN4 A;  4UB1 A;  7ICM A;  1SR4 A;  8ICW A;  4O69 A;  5CFS A;  3HWT A;  5IIN A;  1VCL A;  3C5G A;  1KEJ A;  3NYB A;  5CHE A;  2WBC A;  4QZF A;  3BAV A;  5DB7 A;  3TC2 A;  1BAR A;  4LO3 A;  5DED A;  3HOM A;  1ISZ A;  4IY8 A;  1D0H A;  3OBR A;  4F83 A;  4IZE A;  4ZBV B;  3BAQ A;  4RQ1 A;  9ICA A;  4DOA A;  7ICJ A;  4P0L A;  3V7L A;  4DEP A;  3OGF A;  4XA5 A;  1ZQR A;  3AQK A;  1NUN A;  1JT7 A;  1W3F A;  3E8L C;  3F62 B;  2PFN A;  1G9B A;  4I29 A;  1IOB A;  2BEB A;  2HWM A;  1G9A A;  4NY8 A;  3FJ8 A;  1P63 A;  1M16 A;  2BBJ A;  3O49 A;  4USO A;  4JWM A;  4KEJ A;  3H3A A;  2FFU A;  3VT0 A;  1AXM A;  1R8B A;  2NYY A;  1BPZ A;  3CA1 A;  4KLS A;  2PBE A;  2E4M A;  1HWN B;  4NXW A;  1ZQK A;  2DRB A;  4PC4 A;  4M5D A;  4K96 A;  5IIO A;  1BFB A;  1FN0 A;  3RJH A;  2ISO A;  7I1B A;  4IQU A;  8ICS A;  5BP5 A;  2KKI A;  3MBY A;  4LVS A;  4X37 A;  5HC9 A;  3WIN A;  5D63 A;  1BPX A;  9ICN A;  3C2L A;  5B3Q A;  2Z49 A;  4IQV A;  4MF8 A;  1DQG A;  4RWN A;  1HCE A;  1JQZ A;  3N7J A;  4PHE A;  5DB6 A;  1XSN A;  3Q7X A;  4ZFU B;  2KH2 A;  1RPL A;  5J0U A;  4RQ4 A;  4WC0 A;  2M2V A;  3IM6 A;  4PGX A;  3AJ6 A;  5DB9 A;  5J0W A;  5J0P A;  1AVA C;  3MPP G;  4IQP A;  1ILR 1;  3BAG A;  1ISY A;  3NJ5 A;  2FFV A;  1ZQM A;  5J0O A;  4QD2 B;  4KLH A;  1DLL A;  2Q3N B;  5HRH A;  4AT8 A;  4XKI A;  9ICT A;  9ILB A;  4O6A A;  3FJ9 A;  2GO2 A;  2BPF A;  8ICX A;  4X4O A;  2J3P A;  9ICH A;  4NXU A;  2BFH A;  4LO7 B;  4A7Y A;  2AFG A;  1FQ9 A;  4I7I A;  4Q9P A;  4JPZ A;  1G9D A;  4OWL A;  4RWO A;  1DFQ A;  3B9U A;  4O5C A;  3UJ0 A;  1V6W A;  4I2I A;  5BQU C;  4ZOT A;  7ICL A;  1NOM A;  3FJD A;  5DKW A;  5D49 A;  4RQ2 A;  2BPC A;  2ISP A;  1HWO B;  2K43 A;  2M2W A;  8ICI A;  3A23 A;  4ION A;  1XYF A;  4I4O A;  2ERM A;  4RT3 A;  4EGW A;  7ICF A;  1XSL A;  4QZ8 A;  4O67 A;  4AT7 A;  4S3N A;  5HRK A;  3UXO A;  2FMP A;  1S0B A;  4AT9 A;  2Y9X E;  2HHP A;  2NVH A;  1WBC A;  2FGF A;  5JMC A;  1EYL A;  3RMY A;  1IT0 A;  3UQ2 A;  4LO2 C;  7ICU A;  4I4X A;  3MDC A;  5CFU A;  3A22 A;  1DQO A;  1FV2 A;  4YMM A;  4I2H A;  3UJ4 A;  4Q9G A;  4F34 A;  4I4R A;  3V72 A;  3WFQ E;  4AN7 B;  4LZG A;  8ICA A;  4GOV A;  3C5F A;  4K97 A;  5BOW A;  1QQL A;  5B3P A;  1V4A A;  3FUQ A;  3BB2 A;  2HWA A;  3UPS A;  3JYY A;  3ZC9 A;  2ZQO A;  4KLF A;  4Q91 A;  4EV6 A;  2KI4 A;  4OAH A;  8ICF A;  4RWQ A;  4XQ7 A;  2PFO A;  5FZZ A;  4I4P A;  1Q03 A;  4QC4 A;  3FJK A;  4J2K A;  2VLC A;  3OVS A;  5HRE A;  4KEK A;  1ZQX A;  5HR9 A;  1PC8 B;  2BCQ A;  3OJV A;  4XFT A;  4XFS A;  3UDA A;  4UB5 A;  3WA1 A;  4LO2 A;  3AKI A;  3AQL A;  4RPX A;  3K1X A;  3WMV A;  1S0E A;  5J2A A;  3Q7Y A;  4M0A A;  2VSA A;  3W9T A;  3UXP A;  2MLL B;  3SNV A;  1SZ6 B;  3ER8 C;  4M04 A;  4H9W A;  4UBC A;  2DR7 A;  2D7R A;  4KC3 A;  2W9M A;  4IQT A;  4Z8S B;  1RZT A;  2HW9 A;  3ILA A;  1RY7 A;  4HR6 C;  5HRF A;  4QO3 A;  3H6R A;  1WBA A;  1ZQV A;  3FJH A;  4WOY A;  4WCW A;  1DFC A;  3FJJ A;  3ERC C;  3UQ0 A;  4EBJ A;  1IRP A;  4NXX A;  1UPS A;  4FGF A;  4NLN A;  5F90 A;  4I3N A;  4JLX A;  2ZH4 A;  4D8H A;  2DRZ A;  3CA4 A;  4AN6 A;  9ICB A;  1ABR B;  4LEZ A;  2ZHB A;  2P39 A;  3IAG C;  6I1B A;  3FJI A;  1JLY A;  4MFF A;  1OU5 A;  5J2F A;  1HCD A;  3JCF A;  2FCL A;  4WC4 A;  2ZH9 A;  4L4I A;  4IZX A;  8ICZ A;  3AU6 A;  2AXM A;  1ZQO A;  4R63 A;  4KLE A;  3FUO A;  4AT8 B;  3FJC A;  1I1E A;  4J2Y A;  2GA9 D;  3AU2 A;  1XG6 A;  4QZI A;  4WC5 A;  4O68 A;  3AH1 A;  3WO2 A;  3OUY B;  4WBC A;  2ZH3 A;  2P66 A;  5GAQ A;  3FJB A;  3VSZ A;  4D0T A;  4I2G A;  3I2X A;  4DCK C;  4GOY A;  3V0B B;  5D61 A;  3HJ4 A;  5EG6 C;  1EPW A;  1BPE A;  2E4M C;  4OUJ A;  4D0Z A;  1TIE A;  9ICS A;  3O4A A;  1ZJN A;  4I37 A;  5HRD A;  4USP A;  4Z6D A;  4I6I A;  4ZFW B;  1AFC A;  9ICR A;  3RJI A;  3UPQ A;  3VWC A;  1L2H A;  4K9A A;  2HN2 A;  3IM7 A;  3JPS A;  4K4H A;  2MC2 A;  5J2K A;  4EEE B;  3AKH A;  4A7K A;  8ICQ A;  4P0K A;  1FMZ A;  5G00 A;  7ICV A;  3H6Q A;  4LEV A;  3RH6 A;  1UEU A;  4RQ0 A;  3A21 A;  3RJK A;  8ICR A;  3IM5 A;  1S0L A;  4L4H A;  3BAU A;  4P0J A;  4IYB A;  4YMO A;  2UUS A;  5BOM A;  5J2B A;  3V0A A;  4I2J A;  2B51 A;  4X39 A;  7ICP A;  3PHZ A;  3PME A;  4X4R A;  4JAW A;  4KBB A;  3BX1 C;  1FMM S;  5FZY A;  1XSP A;  4PHD A;  3AKG A;  3P6I A;  1TTU A;  1BPD A;  1ZQE A;  3HAL A;  4UBB A;  4MZH A;  4Z6C A;  1WD3 A;  4ZFY B;  2ZH1 A;  3WMU A;  3JPQ A;  3C2K A;  4IQW A;  3AH2 A;  4RT2 A;  5DBB A;  41BI A;  1PUM B;  3RTI B;  3O4C A;  5DVH A;  3CA0 A;  4YD2 A;  2Z48 A;  4KM5 A;  2NTD A;  3PML A;  4NLK A;  4TLP A;  4X4P A;  9ICF A;  3NVO A;  8ICG A;  3JPP A;  2IUB A;  3HW8 A;  4M47 A;  3NKU A;  1ZQD A;  5JLV A;  5HPZ A;  4LZD A;  3C18 A;  1HUZ A;  5F2V O;  9ICW A;  4I2E A;  3D7W B;  4FHP A;  4UAZ A;  1ISW A;  4I2B A;  5DBA A;  4QZE A;  2DR9 A;  4XFU A;  4UD5 A;  1CVS A;  3O4O A;  2KI6 B;  4M9G A;  1IIL A;  3HN1 A;  3AZV A;  4YMN A;  4X4N A;  4FHW A;  3UD8 A;  3CQA A;  1ZQL A;  1JY0 A;  3CA5 A;  3HIY A;  3B0Y A;  3OV7 A;  2AAI B;  4G1R A;  4XRH A;  4FVV A;  5J0R A;  4RQ8 A;  1Q1U A;  4EED A;  3OVA A;  1MIY A;  2IWT B;  9ICQ A;  1EV2 A;  3OWG A;  3QR5 A;  4F5O A;  3POK A;  2Q66 A;  2BPG A;  4KLD A;  1GPJ A;  1PX5 A;  2QYI B;  2NP0 A;  1N4K A;  3TFS A;  4KLI A;  4FH5 A;  1IHK A;  4X4S A;  3V7K A;  1ZQA A;  4ZKT B;  1HIB A;  2DRA A;  3AH4 A;  8ICH A;  3ER9 B;  4MF2 A;  1HUO A;  4QZ9 A;  4OAI Z;  1TFM B;  1JT5 A;  5FNW A;  3O4B A;  4I4S A;  1AF9 A;  1S0G A;  2D1Z A;  3C2M A;  3RJF A;  3C66 A;  4GXJ A;  4EP7 A;  4QBC A;  3ZC8 A;  2RFF A;  2D7I A;  4WH5 A;  2IHO A;  3CAH A;  1ZQB A;  1I1B A;  4TUP A;  1YF8 B;  1MD6 A;  3JPT A;  2X2T A;  4F5R A;  4RWP A;  4GAI A;  4KLQ A;  1XHB A;  1HWP B;  1V6X A;  1ZQQ A;  9ICL A;  2ZR1 B;  1JN3 A;  2DR8 A;  2NS2 A;  3LK9 A;  4RQ3 A;  8ICN A;  2GAF D;  4TUQ A;  4HJJ A;  3P53 A;  4DOC A;  4ISR A;  3FJA A;  4KLO A;  1R8O A;  1TWE A;  4TUR A;  4PGQ A;  8ICO A;  3OGU A;  2ZHA A;  2P23 A;  1VFG A;  4K4G A;  5FNX A;  3VEQ A;  3VT1 A;  5CA7 A;  4R64 A;  4Z6E A;  5HHI A;  3LTQ A;  3ZXD A;  1ZQI A;  3MAL A;  4M9J A;  3PMN A;  1TFY A;  1DZD A;  5BXT A;  3CA3 A;  2F8X C;  8ICM A;  4OEE A;  1TOO A;  1XZZ A;  3AZW A;  8ICK A;  3CRG A;  3JRR A;  4WC3 A;  4I96 A;  4ZLB B;  2D44 A;  3BRG C;  8ICJ A;  1W3A A;  4HX0 A;  4MFC A;  3O4D A;  4RPZ A;  2D22 A;  4QAL A;  5J29 A;  2VU9 A;  3TFR A;  5IIM A;  1ZQZ A;  1ZQT A;  3NWI A;  3WO3 A;  1YTO A;  4M9L A;  1JTC A;  3AQN A;  3R4U A;  2O1P A;  2VUA A;  4GP3 A;  1A8D A;  4DOB A;  5EC5 A;  4UD4 A;  4KB6 A;  4X38 A;  2D20 A;  4WQL A;  3AKF A;  5DBC A;  4P6A A;  1BPB A;  2D43 A;  4P2H A;  1FA0 A;  1ZQJ A;  5B2H A;  4GXK A;  4X0B A;  4PPX A;  1S0D A;  4E80 A;  3AUO A;  1OQL B;  1G9C A;  4LO1 C;  5DSS B;  5J2D A;  3N7K A;  1PWA A;  5CWR A;  4X4U A;  3H38 A;  4YCX A;  2F2F C;  1ZQU A;  1CE7 B;  1JQR A;  2DRY A;  4MZF B;  1IRA X;  4K4I A;  1BFC A;  2X2S A;  4UB3 A;  4PGY A;  2RG9 B;  1ZQS A;  4YOL A;  1AVW B;  4GAF A;  4YD1 A;  1JT3 A;  3CRI A;  5J0S A;  1F31 A;  2ID1 A;  8ICC A;  2ZH7 A;  4RPY A;  3RSJ A;  2ZH6 A;  1ISX A;  2Q9X A;  3IIR A;  5J2C A;  3C9Z A;  9ICJ A;  3HMY A;  2WRY A;  2VXT I;  7ICO A;  2PFQ A;  5IIJ A;  1II4 A;  2M49 A;  1G82 A;  3OJM A;  4X0A A;  4FHX A;  5J2G A;  4K8V A;  5D46 A;  4DO9 A;  1ITB A;  4NKU A;  3ISB A;  4LO0 C;  4OWK A;  1PUU B;  4TUS A;  2BCV A;  1FV3 A;  2MIB A;  4EFP A;  2B56 A;  3F1R A;  4I8M A;  7ICT A;  3OGG A;  2LIQ A;  2Y9G A;  2GWS A;  2ZH5 A;  4I2D A;  4E8F A;  2BCR A;  4LO1 A;  4J2S A;  5BXP A;  4JWN A;  1HWM B;  3JZ0 A;  2F2F A;  2K4A B;  3RMX A;  1KDH A;  2KLL A;  1S0F A;  4IHZ A;  4DEN A;  5HRG A;  5F8W A;  1BFF A;  2EWR A;  2M2T A;  2LIE A;  2BCS A;  5J0Q A;  3N0K A;  3MDA A;  2AQZ A;  3BAH A;  1J0S A;  3ZX7 A;  4ISQ A;  5DZU A;  4AT7 B;  1JMS A;  1TWM A;  4NLZ A;  4UY4 A;  5CR0 A;  1FWV A;  4AT9 B;  1Z2V A;  1R89 A;  3P6J A;  4QZD A;  4GXI A;  1Q78 A;  4WQK A;  4LEY A;  5BVP I;  4I2A A;  4LT6 A;  3JPR A;  1FWU A;  5J0Y A;  2ZH8 A;  4NM2 A;  4X3A A;  3PG0 A;  2D24 A;  4I2F A;  5FZU A;  4M9N A;  4YN4 A;  1NZK A;  2GZB A;  2Y9W C;  2IHM A;  2DR5 A;  2XOA A;  4M9H A;  3RTJ B;  3BA7 A;  4FH3 A;  1ZQN A;  4LO0 A;  4G6J A;  1ZQP A;  9ICI A;  8ICU A;  3OBT A;  5DEC A;  7ICE A;  2L5X A;  4G6M A;  1ZQG A;  5F8S A;  9ICK A;  4HA2 A;  4EEB A;  2B4V A;  2VAN A;  8ICE A;  1RML A;  3H37 A;  1GGP B;  4K99 A;  4G9N A;  4I4V A;  2DRE A;  8ICV A;  3HBW A;  5CHG A;  4F5N A;  4A7Z A;  4P4O A;  4X5V A;  4ATB A;  3LLP A;  4OAF A;  1R8A A;  4I2S A;  5D4B A;  2BEA A;  1K5U A;  7ICQ A;  4KLL A;  4WC2 A;  4CJM A;  7ICI A;  2RQ9 A;  5J0X A;  1FGA A;  1ZQY A;  1T4Q A;  2NM1 A;  4RQ6 A;  1BFG A;  1BLA A;  1TFW A;  3KMV A;  4NXZ A;  2FMS A;  7ICS A;  7ICN A;  2NZ9 A;  4I4U A;  3WO4 A;  3WFP A;  1YLQ A;  1ISV A;  2HN1 A;  2ZH2 A;  4F5P A;  4RQ5 A;  4IG8 A;  4NM1 A;  1WD4 A;  4H75 A;  1DJS B;  3EF2 A;  4J23 B;  5J2H A;  4PHP A;  4I0U A;  1QXM A;  1RZO B;  4EBK A;  2R9K B;  4NXT A;  1ZQC A;  5J0T A;  4OEG A;  4H04 A;  1F5A A;  2PXI A;  7ICG A;  3A07 A;  5CFT A;  1ONK B;  9ICG A;  3QYD A;  1R8C A;  2BE3 A;  5HHH A;  8ICT A;  3UXN A;  5DB8 A;  4KLU A;  4WC7 A;  9ICO A;  1Z0H A;  4END A;  3WFO A;  4X4V A;  4X4T A;  4KEI A;  4OAG A;  31BI A;  4UB2 A;  2PFP A;  3NBD A;  3FGM A;  1WOT A;  9ICM A;  3RJE A;  3BAD A;  9ICC A;  3JUT A;  4WC1 A;  4P4M A;  4ZA3 B;  3FJF A;  4XQ8 A;  3H6R B;  2ESU A;  1MIV A;  4KLG A;  1BAS A;  1ZJM A;  3O3Q A;  5IIL A;  4OW4 A;  3O5W B;  4XJE A; 
#chains in the Genus database with same CATH homology
 3IAG C;  6I1B A;  4P0L A;  3FJI A;  4DEP A;  3OGF A;  2VU9 A;  4N7R A;  1JLY A;  1NUN A;  1JT7 A;  1W3F A;  3E8L C;  3I29 B;  3CA6 A;  1HCD A;  3F62 B;  3WO3 A;  1YTO A;  1G9B A;  2FCL A;  1JTC A;  4K9B A;  1IOB A;  2BEB A;  5DUY A;  4L4I A;  4IZX A;  2AXM A;  3R4U A;  3R4S A;  1JT4 A;  3ZXG A;  2HWM A;  1G9A A;  2VUA A;  4ZGR B;  4GP3 A;  3FUO A;  1A8D A;  3FJ8 A;  1P63 A;  3FJC A;  2DS0 A;  5EC5 A;  1M16 A;  2HZ9 A;  1I1E A;  4KB6 A;  4X38 A;  4J2Y A;  4JKX B;  2GA9 D;  1TP0 A;  3O49 A;  1XG6 A;  2D20 A;  4USO A;  3HSM A;  4O68 A;  3AH1 A;  4KEJ A;  3WO2 A;  4WQL A;  2FFU A;  3AKF A;  3VT0 A;  3V0B A;  1AXM A;  2NYY A;  4P6A A;  4WBC A;  3CA1 A;  2D43 A;  1PZZ A;  1IJT A;  5B2H A;  2E4M A;  1HWN B;  5GAQ A;  3FJB A;  1S0D A;  1Q04 A;  4I1B A;  4NXW A;  3VSZ A;  4D0T A;  1OQL B;  1G9C A;  4PC4 A;  4K96 A;  3I2X A;  4LO1 C;  4DCK C;  5DSS B;  4GOY A;  1BFB A;  1FN0 A;  4JQ0 A;  3N7K A;  3PUB A;  1PWA A;  5D61 A;  3V0B B;  7I1B A;  1MC9 A;  5EG6 C;  4I4Q A;  5BP5 A;  4JP0 A;  1T9F A;  2KKI A;  2F2F C;  1EPW A;  2E4M C;  1K5V A;  4OUJ A;  4X37 A;  1CE7 B;  4LEW A;  4D0Z A;  1AVX B;  1E0O A;  1TIE A;  2DRY A;  4MZF B;  3WIN A;  5D63 A;  3O4A A;  1IRA X;  1YBI A;  2RST A;  4I37 A;  1BFC A;  3BA5 A;  5B3Q A;  2X2S A;  2Z49 A;  4USP A;  4I6I A;  4ZFW B;  1AFC A;  4J2X A;  1DQG A;  2RG9 B;  3VWC A;  1HCE A;  1L2H A;  1JQZ A;  4K9A A;  3N7J A;  3IM7 A;  1R8N A;  4YOL A;  3I2A A;  2MC2 A;  4EEE B;  3FFZ A;  1AVW B;  3AKH A;  4GAF A;  4A7K A;  3K7D A;  3Q7X A;  2ZQN A;  4P0K A;  1FMZ A;  1JT3 A;  2KH2 A;  2Y9F A;  5G00 A;  4ZFU B;  3CRI A;  3H6Q A;  4LEV A;  4NXV A;  1F31 A;  3IM6 A;  3A21 A;  3RSJ A;  3AJ6 A;  3IM5 A;  1ISX A;  1S0L A;  2Q9X A;  1AVA C;  3IIR A;  4L4H A;  3MPP G;  3BAU A;  4IQP A;  3C9Z A;  1ILR 1;  3BAG A;  3N7M A;  3HMY A;  4P0J A;  2WRY A;  3UD9 A;  2VXT I;  4IYB A;  1ISY A;  2UUS A;  3NJ5 A;  2FFV A;  1II4 A;  2M49 A;  4EB2 B;  1G82 A;  3V0A A;  2B51 A;  3OJM A;  4I1E A;  3Q7W A;  4X39 A;  5E24 E;  4QD2 B;  1DZC A;  4QD2 C;  1V6U A;  3N7L A;  4II0 A;  3VUO A;  1DLL A;  4K8V A;  3PHZ A;  3PME A;  3VSF A;  1EVT A;  1ITB A;  4JAW A;  2Q3N B;  4KBB A;  3BX1 C;  1FMM S;  5FZY A;  4XKI A;  4LO0 C;  9ILB A;  3AKG A;  4O6A A;  3P6I A;  4OWK A;  1PUU B;  1DIW A;  3FJ9 A;  1AVU A;  2GO2 A;  3V0A B;  2VSE A;  1FV3 A;  4R6U B;  1TTU A;  2J3P A;  2MIB A;  4EFP A;  1RG8 A;  2B56 A;  5BQU A;  4NXU A;  2BFH A;  3F1R A;  4LO7 B;  4A7Y A;  4LO7 C;  3HAL A;  2AFG A;  1FQ9 A;  4I7I A;  4I8M A;  4Q9P A;  4JPZ A;  1G9D A;  4MZH A;  4OWL A;  2K8R A;  1DFQ A;  3OGG A;  1WD3 A;  4ZFY B;  4JLZ A;  3WMU A;  2LIQ A;  3B9U A;  2Y9G A;  3O44 A;  3AH2 A;  3UJ0 A;  1V6W A;  1KNM A;  3MCR A;  5BQU C;  4ZOT A;  41BI A;  4LO1 A;  3FJD A;  4J2S A;  5BXP A;  1HWM B;  1PUM B;  3RTI B;  3O4C A;  3BRD A;  5DVH A;  1HWO B;  3CA0 A;  2F2F A;  2K43 A;  2K4A B;  2Z48 A;  4KM5 A;  2NTD A;  3A23 A;  4ION A;  2VXR A;  4JKQ A;  3RMX A;  1XYF A;  2KLL A;  4I0Y A;  4TLP A;  1QQK A;  1S0F A;  3BTA A;  4IHZ A;  4I4O A;  4DEN A;  2ERM A;  3AJ5 A;  5F8W A;  4MZG B;  1BFF A;  3VT2 A;  2EWR A;  4O67 A;  3S8J A;  2LIE A;  3NKU A;  3N0K A;  2AQZ A;  5JLV A;  1S0B A;  3BAH A;  1J0S A;  5HPZ A;  5F8Y A;  2Y9X E;  4EFQ A;  2I1B A;  2NVH A;  3ZX7 A;  5BXR A;  1S0C A;  1YXW A;  3FJE A;  3D7W B;  4ISQ A;  5DZU A;  1JLX A;  1ISW A;  3BAO A;  3OJ2 A;  1WBC A;  2FGF A;  2D23 A;  5JMC A;  1EYL A;  1TWM A;  3RMY A;  1IT0 A;  4LO8 B;  4UY4 A;  4XFU A;  1CVS A;  3O4O A;  1FWV A;  2KI6 B;  4LO2 C;  1Z2V A;  1IIL A;  3HN1 A;  3AZV A;  3P6J A;  4OWJ A;  4WQK A;  4I4X A;  4K98 A;  4LEY A;  3UD8 A;  3CQA A;  5BVP I;  1JY0 A;  5CFU A;  1BA7 A;  3A22 A;  1DQO A;  3CA5 A;  1FV2 A;  1FWU A;  2AAI B;  4X3A A;  3PG0 A;  2D24 A;  4G1R A;  5FZU A;  4FVV A;  1BLD A;  1NZK A;  2GZB A;  2Y9W C;  4QBV A;  3UJ4 A;  4Q9G A;  1Q1U A;  2XOA A;  3RTJ B;  3BA7 A;  1V6V A;  2IWT B;  4F34 A;  4I4R A;  1EV2 A;  4JRA A;  3OWG A;  4LO0 A;  3QR5 A;  4G6J A;  3T8S A;  3OBT A;  3CU1 B;  3POK A;  2L5X A;  4G6M A;  5F8S A;  4HA2 A;  1GPJ A;  4AN7 B;  2B4V A;  2QYI B;  4GOV A;  1RML A;  2NP0 A;  4K97 A;  1N4K A;  5BOW A;  1QQL A;  5B3P A;  1IHK A;  1GGP B;  3S8K A;  1SR4 C;  4K99 A;  4G9N A;  4ZKT B;  4I4V A;  1HIB A;  21BI A;  3FUQ A;  4GP0 A;  2DRE A;  3BRF A;  3CRH A;  5D62 A;  3AH4 A;  3BB2 A;  2HWA A;  1M2T B;  3HBW A;  3ER9 B;  4LO3 C;  4A7Z A;  3ZC9 A;  2ZQO A;  1HKN A;  4OAI Z;  1TFM B;  1JT5 A;  5FNW A;  3LLP A;  3O4B A;  3NBC A;  4I4S A;  5EHA A;  4Q91 A;  1AF9 A;  1S0G A;  3H6S E;  4MKP A;  4OAF A;  2D1Z A;  4I2S A;  2KI4 A;  4G9M A;  4QBC A;  3ZC8 A;  2BEA A;  4OAH A;  2D7I A;  1K5U A;  4WH5 A;  2IHO A;  3CAH A;  4CJM A;  4I4Y A;  1I1B A;  2RQ9 A;  1YF8 B;  1FGA A;  1MD6 A;  5FZZ A;  4I4P A;  1Q03 A;  5I1B A;  2X2T A;  1T4Q A;  4QC4 A;  4QKR A;  3FJK A;  2NM1 A;  1Z4S A;  4J2K A;  1BFG A;  1BLA A;  2VLC A;  4Z9W B;  3KMV A;  4GAI A;  3NBN A;  4KEK A;  2NZ9 A;  1PC8 B;  1XHB A;  1HWP B;  4I4U A;  3WO4 A;  3OJV A;  1V6X A;  2ET2 A;  1ISV A;  2YUG A;  2ZR1 B;  3BA4 A;  4XFT A;  4XFS A;  3UDA A;  2FO1 A;  2NS2 A;  3WA1 A;  4LO2 A;  1W3G A;  3AKI A;  1WD4 A;  1YYN A;  4H75 A;  1DJS B;  3K1X A;  3NBE A;  3EF2 A;  3V79 C;  2GAF D;  4J23 B;  4OEF A;  3WMV A;  1S0E A;  1QXM A;  1RZO B;  2R9K B;  4HJJ A;  4NXT A;  3P53 A;  3Q7Y A;  4OEG A;  4H04 A;  2VSA A;  4ISR A;  3FJA A;  3W9T A;  1R8O A;  5BXS A;  2MLL B;  3A07 A;  1TWE A;  3SNV A;  1SZ6 B;  3ER8 C;  5CFT A;  1ONK B;  3QYD A;  4H9W A;  2P23 A;  4IY9 A;  2D7R A;  5BP5 C;  8I1B A;  5FNX A;  4FO1 A;  4KC3 A;  4QKS A;  3VEQ A;  3VT1 A;  4Z8S B;  1Z0H A;  4EFR A;  4END A;  2FDB M;  4EKX B;  2HW9 A;  3UD7 A;  4KEI A;  3LTQ A;  3ILA A;  31BI A;  3WIN C;  4OAG A;  1RY7 A;  3ZXD A;  4HR6 C;  2QN4 A;  3MAL A;  4LEZ A;  3NBD A;  4QO3 A;  3FGM A;  1SR4 A;  3H6R A;  4O69 A;  5CFS A;  1DZD A;  1WBA A;  3BAD A;  3FJH A;  4WOY A;  1VCL A;  5BXT A;  5CHE A;  1DFC A;  3CA3 A;  2F8X C;  2WBC A;  3FJJ A;  4OEE A;  1TOO A;  1XZZ A;  3AZW A;  3ERC C;  3BAV A;  1IRP A;  3CRG A;  3JRR A;  1BAR A;  4LO3 A;  1UPS A;  3JUT A;  3TC2 A;  4NXX A;  4FGF A;  4I96 A;  5F90 A;  3HOM A;  1ISZ A;  4I3N A;  4IY8 A;  4ZA3 B;  3FJF A;  4ZLB B;  2D44 A;  1D0H A;  3H6R B;  2ESU A;  3OBR A;  4F83 A;  4IZE A;  3BRG C;  4ZBV B;  3BAQ A;  4JLX A;  1W3A A;  1BAS A;  3O3Q A;  4HX0 A;  4D8H A;  4OW4 A;  2DRZ A;  3CA4 A;  3O4D A;  3O5W B;  2D22 A;  4AN6 A;  1ABR B;  4QAL A;  4XJE A;  2P39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...