5D63A

Moa-z-vad-fmk inhibitor complex, direct/inverted dual orientation
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Unusual Member of the Papain Superfamily: Mapping the Catalytic Cleft of the Marasmius oreades agglutinin (MOA) with a Caspase Inhibitor.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Hydrolase
molecule keywords Agglutinin
total genus 93
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2015-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5d63A01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5d63A02
1AXMA 4GAIA 1JT3A 1FWVA 2BEBA 2HW9A 4I2SA 2FFVA 5BXRA 1PWAA 2X2SA 5BXTA 1WD4A 4ZKTB 2J3PA 4LO2A 1G9DA 5F8WA 4QALA 3F62B 4QO3A 5GAQA 3FJ8A 1BFBA 4IZEA 1Q04A 3N0KA 1ISXA 3CA5A 3Q7YA 4EKXB 1TFMB 3H6RB 1ISVA 3IIRA 1FV3A 4D8HA 3O4DA 2AQZA 4LO1C 2D20A 3RMXA 3AKFA 1N4KA 2Y9WC 2KI6B 4KC3A 4YOLA 1TIEA 3CRHA 1UPSA 1S0FA 4I4QA 2AAIB 4I4XA 3A21A 3TC2A 3RMYA 1T9FA 4KEIA 3UD8A 4DCKC 1OQLB 2UUSA 2D7IA 3AJ6A 4GAFA 2VUAA 5EG6C 2WRYA 4PC4A 1V6UA 3BA7A 3H6RA 4IONA 3N7MA 3R4UA 1WBAA 4J23B 5G00A 1S0DA 2Z48A 2Y9FA 3CQAA 5FNXA 4A7KA 4ZOTA 5DVHA 2HWMA 3N7KA 2RG9B 1DFQA 4DENA 1W3GA 2IWTB 2WBCA 4P0LA 3UD7A 3JUTA 3O49A 3O4AA 1XG6A 4Q91A 1IILA 5EC5A 4ZFYB 3BA5A 1XZZA 4QBVA 1P63A 4QKRA 2P39A 3H6QA 4GOVA 1IJTA 2VU9A 3BAUA 4CJMA 4I4RA 5EHAA 4JP0A 3WINA 4JAWA 1JLXA 1HWNB 3CRGA 1PUUB 3AZWA 4A7ZA 3UDAA 1RG8A 1DQGA 3ZX7A 3FJBA 4X37A 2HWAA 41BIA 3WINC 4I37A 3FJHA 1EPWA 5HPZA 1S0GA 2D44A 2IHOA 3CA3A 1BFFA 1PZZA 4QBCA 3A07A 4OEFA 31BIA 1I1BA 1JT5A 5BXSA 4KBBA 1CE7B 4QD2C 5DZUA 3NBCA 4LO8B 2BEAA 3PG0A 1IRPA 4EB2B 3O4BA 3AZVA 4J2SA 3W9TA 3WMUA 4XFTA 3FJEA 3LLPA 1NZKA 3V0AA 4WBCA 1DIWA 1ABRB 3OJVA 3QYDA 1EVTA 3PHZA 5DSSB 3WO4A 3OGFA 3ZC9A 1DZDA 2RQ9A 2RSTA 4D0TA 3OBRA 3WMVA 4AN7B 2VSAA 1RMLA 3CRIA 3P6IA 2DREA 1FMZA 4I1EA 2I1BA 3B9UA 1DZCA 4ENDA 3BADA 2FDBM 3C9ZA 3EF2A 5F90A 2NM1A 1K5VA 3BAVA 1JLYA 3MPPG 3ZC8A 1RZOB 3HN1A 4EFRA 2DRZA 5BVPI 2ZQNA 3P6JA 3IM5A 3FJJA 4JKQA 1Q1UA 1JTCA 3BB2A 3BAHA 5D61A 4F34A 2ERMA 3IAGC 2KI4A 1M2TB 3AH2A 1HCDA 1G9BA 3V0AB 4GP3A 4JPZA 3BAQA 1DLLA 1MC9A 4I4VA 4II0A 3CA6A 1HWMB 4Q9PA 4OWKA 1ISWA 5FZZA 4FVVA 2K4AB 4P0KA 3BRDA 3OJMA 3UJ0A 4LO3A 3HSMA 5E24E 2P23A 2D23A 5JLVA 1TTUA 4I3NA 3S8JA 5D62A 1AVAC 1ONKB 1WBCA 3HBWA 4OUJA 5FZUA 4LO0A 2KLLA 1FMMS 1RY7A 1V6XA 2AXMA 3P53A 1WD3A 1CVSA 2DS0A 2Y9GA 3OBTA 1G9CA 4JQ0A 3CA1A 3VT2A 3I2XA 3BA4A 1S0BA 9ILBA 3QR5A 4EEEB 1AF9A 4Z9WB 1W3FA 1FWUA 5BP5A 4I4SA 1FN0A 2NTDA 1Z0HA 3E8LC 4HA2A 2VXTI 3WA1A 2BFHA 1L2HA 6I1BA 2NVHA 5D63A 1GGPB 4TLPA 3JRRA 4OEEA 4J2XA 2HZ9A 1V6WA 2ESUA 2KKIA 5I1BA 4G1RA 2QN4A 4ZFUB 1HIBA 1TWMA 4XKIA 2Z49A 2LIEA 3FJFA 3S8KA 2D22A 1DFCA 1VCLA 1ITBA 3NBNA 2F2FA 1DJSB 4ZGRB 4HR6C 4LO0C 3FUOA 3MALA 3UD9A 4H04A 5F8SA 3SNVA 2FFUA 2YUGA 4H9WA 3NBEA 1JT7A 5BXPA 3N7LA 1BFCA 2XOAA 1JY0A 2MLLB 2NZ9A 3NJ5A 3PMEA 1FGAA 3V0BB 3O3QA 4G9MA 1HCEA 1AVXB 4QKSA 2X2TA 3BTAA 1R8NA 1BLAA 1PUMB 3FFZA 3NBDA 3VT0A 1SR4A 4ZBVB 4G6JA 3ZXDA 1TWEA 4Q9GA 2ZR1B 3VT1A 4IQPA 2KH2A 1QXMA 2FGFA 2VXRA 4IYBA 4I4UA 4I7IA 3O4OA 1R8OA 1G82A 3N7JA 4LO7B 21BIA 3I2AA 1IRAX 2E4MA 3BAGA 3OGGA 5FZYA 3AKHA 3CA4A 3FJKA 1A8DA 4X3AA 5BP5C 4OW4A 4P6AA 3AJ5A 3O4CA 4AN6A 2NYYA 4HJJA 4Z8SB 1ISYA 3CA0A 3RTIB 4LO7C 1AFCA 2LIQA 3D7WB 3HOMA 5BQUA 4DEPA 4IY8A 1FV2A 3VEQA 3IM7A 2MC2A 1PC8B 3BRFA 1JT4A 1D0HA 2FO1A 2VSEA 1BA7A 1F31A 2K8RA 3Q7XA 1YYNA 1E0OA 4I4YA 4I8MA 4L4HA 3HALA 3OJ2A 3ZXGA 3WO3A 1S0EA 2R9KB 3R4SA 2D1ZA 3CAHA 1W3AA 3HMYA 4ISQA 3K1XA 1T4QA 4I0YA 1SR4C 2Y9XE 3O5WB 4L4IA 4G6MA 3BRGC 3A23A 3F1RA 3KMVA 5B2HA 4G9NA 1BARA 3AH1A 4ZFWB 4USPA 7I1BA 4I1BA 4J2YA 4ZLBB 4GOYA 4J2KA 3A22A 4IY9A 4KEKA 5F8YA 5JMCA 1V6VA 1IHKA 1XHBA 3FJDA 1Z2VA 4X39A 3V79C 3FJ9A 3I29B 1YF8B 1HKNA 1ILR1 1YTOA 1Z4SA 1BASA 3FJIA 1IOBA 1SZ6B 2F8XC 4IHZA 4EFQA 1DQOA 4LO2C 3PUBA 1TOOA 3V0BA 3BAOA 1TP0A 1HWPB 1YXWA 4KEJA 3ILAA 3CU1B 4JKXB 1MD6A 3O44A 1EV2A 1AVWB 4D0ZA 2GZBA 2D24A 3FUQA 2E4MC 1EYLA 2AFGA 4I4PA 4ISRA 4XFUA 2K43A 3FJAA 4P0JA 1J0SA 4EFPA 3H6SE 4I6IA 4GP0A 3FGMA 1S0LA 2ET2A 1I1EA 3FJCA 1JQZA 4LO1A 4XFSA 4IZXA 3Q7WA 4A7YA 1II4A 1YBIA 3AKIA 1BLDA 2VLCA 3RSJA 1XYFA 3LTQA 4X38A 3VSZA 3WO2A 1ISZA 1QQLA 5FNWA 3VSFA 1G9AA 2L5XA 3RTJB 3UJ4A 1NUNA 2M49A 1Q03A 3POKA 2Q9XA 4ZA3B 4QC4A 4OEGA 1M16A 5DUYA 1FQ9A 2DRYA 8I1BA 3AKGA 4JRAA 4OWJA 4LO3C 5BQUC 1AVUA 1S0CA 1K5UA 4OWLA 4I96A 1KNMA 1IT0A 2ZQOA 4F83A 3AH4A 4USOA 3VUOA 2QYIB 2GO2A 5BOWA 4R6UB 2D43A 3T8SA 3IM6A 4I4OA 3BX1C 3VWCA 1HWOB 2Q3NB 2NP0A 1BFGA 4QD2B 4FGFA 2D7RA 1QQKA 2F2FC 2MIBA
chains in the Genus database with same CATH superfamily
1AXMA 4GAIA 5CFUA 4F5OA 8ICPA 1JT3A 4FHXA 2ZH6A 1FWVA 2BEBA 2HW9A 5J0UA 4I2SA 3TFRA 2FFVA 4EBJA 3AUOA 2BCSA 8ICHA 7ICLA 5BXRA 1PWAA 2X2SA 4KLIA 5BXTA 1WD4A 4YCXA 3OUYB 4ZKTB 1VFGA 2J3PA 4FHPA 4LO2A 7ICGA 3LK9A 1G9DA 1R8BA 4RQ4A 5F8WA 4LEVA 4QALA 4MF2A 3F62B 4TUPA 3WFPA 4F5NA 4QO3A 2NS2A 5GAQA 3FJ8A 4F5PA 1BFBA 4IZEA 1Q04A 3N0KA 5J0OA 5DB7A 1ISXA 1BPYA 3CA5A 3Q7YA 4EKXB 1TFMB 1ZQFA 3H6RB 1ISVA 3IIRA 4M9LA 2PFQA 1FV3A 4D8HA 4O69A 3O4DA 2AQZA 1ZQOA 4LO1C 4KLGA 2D20A 4IQTA 4R64A 3RMXA 3AKFA 1BPXA 1N4KA 2Y9WC 2KI6B 4KC3A 4YOLA 1NOMA 3PMLA 4K98A 1TIEA 4PPXA 8ICXA 3CRHA 4FHWA 1UPSA 1S0FA 4I4QA 4GXKA 2AAIB 4I4XA 4KLJA 1GPJA 3WFQE 3MBYA 4WCWA 3A21A 3TC2A 3RMYA 1T9FA 4O9MA 1KEJA 1WOTA 2DR5A 4KLMA 4KEIA 3WFOA 4RQ2A 3UD8A 9ICBA 4DCKC 1OQLB 4UB5A 2DR7A 1R89A 2UUSA 2D7IA 3AJ6A 4X4PA 4GAFA 2VUAA 3HWTA 5EG6C 4K4GA 2WRYA 4PC4A 1XSNA 3AQNA 4EEDA 1V6UA 2ISOA 3BA7A 3H6RA 4IONA 3N7MA 3R4UA 1ZJMA 9ICUA 4KLFA 1WBAA 4RWQA 2B56A 4K4IA 4J23B 4IQWA 4I2HA 2BPFA 5G00A 1S0DA 2Z48A 2Y9FA 3CQAA 3C5FA 5FNXA 4A7KA 4ZOTA 5DVHA 4JLZA 4RQ3A 2HWMA 5JTGA 3N7KA 2RG9B 1DFQA 4DENA 1W3GA 2IWTB 3V7KA 3V7JA 4WBYA 2WBCA 4M5DA 4P0LA 3UD7A 2PXIA 3JPNA 3JUTA 4YN4A 2VANA 3O49A 5IIOA 1ZJNA 4MZGB 3O4AA 1XG6A 4Q91A 1IILA 5EC5A 4ZFYB 4I2JA 3BA5A 5J0PA 4WH5A 8ICMA 3NWIA 4NM1A 3JZ0A 5J0YA 4KB6A 1XZZA 3OVBA 1BPDA 1KDHA 3HJ4A 1ZQCA 4QBVA 1P63A 5J0XA 4QKRA 4NXZA 4X4SA 9ICWA 3RJGA 2EWRA 2P39A 3H6QA 4GOVA 2ZH7A 7ICMA 1IJTA 2VU9A 4NKUA 4KLSA 8ICJA 5HRLA 3BAUA 4CJMA 4PHPA 5HREA 4WC7A 4I4RA 5EHAA 3ER8C 4HX0A 4JP0A 5HHHA 3WINA 4WC4A 2PFPA 4JAWA 3ISDA 4I2CA 1JLXA 1HWNB 3CRGA 4TURA 1HUZA 1PUUB 3AZWA 4QZBA 4A7ZA 4RQ0A 4NY8A 4RWNA 9ICLA 3OGUA 3UDAA 2FMPA 1RG8A 5J2EA 4FH5A 1DQGA 3ZX7A 3FJBA 4X37A 2HWAA 41BIA 3WINC 8ICTA 4P2HA 4I37A 3FJHA 1EPWA 5HPZA 4ATBB 4WC5A 3C2LA 1S0GA 2D44A 4Z6DA 2IHOA 4QZCA 5J2AA 3CA3A 4P4PA 1UEVA 1BFFA 9ICSA 5J2CA 1PZZA 4WC1A 4QBCA 3A07A 4OEFA 4NXTA 5BOMA 8ICWA 5J2BA 31BIA 5J29A 4IG8A 4WC2A 1I1BA 9ICXA 4RQ1A 1JT5A 5EOZA 3RJIA 4WC6A 4M2YA 5BXSA 4LZGA 2ZH1A 4KBBA 1CE7B 4KLHA 4QD2C 5DZUA 1JN3A 3NBCA 4LO8B 1PX5A 5CHEA 1HUOA 4LZDA 2BEAA 3PG0A 1IRPA 4EB2B 3HJ1A 3O4BA 3AZVA 4J2SA 3W9TA 3WMUA 4XFTA 4UAZA 8ICBA 3FJEA 3LLPA 1NZKA 3V0AA 4LEZA 3JPTA 4WBCA 5HC9A 7ICRA 1DIWA 5B3PA 1ABRB 3OJVA 3QYDA 1EVTA 3PHZA 5DSSB 3WO4A 4FHVA 7ICEA 8ICSA 5HHIA 3OGFA 4WQKA 7ICTA 3ZC9A 1DZDA 4YMNA 2RQ9A 1ZQZA 3RJEA 2RSTA 4F5QA 4D0TA 3OBRA 3WMVA 4AN7B 4I0UA 1RZTA 4X4NA 2VSAA 1VJ7A 4DOCA 4KLEA 1RMLA 3CRIA 4QZ8A 4KLTA 3NVOA 3RH5A 4EP7A 3P6IA 2DREA 1FMZA 4I1EA 2I1BA 3B9UA 1DZCA 4ENDA 1ZQXA 1ZQQA 3RJKA 3BADA 2FDBM 3C9ZA 3EF2A 5F90A 4QZ9A 3B0XA 4K9BA 2NM1A 1BPBA 5CR0A 1K5VA 3BAVA 7ICNA 1JLYA 3MPPG 3ZC8A 4P4MA 1RZOB 4MFCA 3HN1A 4EFRA 2DRZA 5BVPI 8ICEA 2ZQNA 3P6JA 4NXXA 3IM5A 3FJJA 4JKQA 4O68A 2PBEA 3AU2A 1Q1UA 1JTCA 3BB2A 3BAHA 5D61A 4H75A 4YMOA 4F34A 2ERMA 3IAGC 5HRDA 5BPCA 9ICTA 2KI4A 1M2TB 3AU6A 4UB4A 3AH2A 4QZEA 1ZQAA 1HCDA 1G9BA 3V0AB 4E80A 5DB6A 4GP3A 1MIWA 4I27A 4JPZA 4M9GA 3BAQA 1ZQTA 1DLLA 3C2MA 1MC9A 4I4VA 4II0A 1R8CA 4NKTA 3CA6A 1OU5A 4NLZA 4K96A 3H38A 4UB2A 1HWMB 4Q9PA 4NLNA 5DB8A 5DBAA 7ICIA 4OWKA 1ISWA 1V4AA 1ZQWA 5FZZA 4TUQA 4FVVA 2K4AB 4P0KA 3BRDA 3H39A 1ZQNA 3OJMA 2BBJA 2M2TA 3UJ0A 9ICPA 1ZQYA 4LO3A 4RPZA 3HSMA 5DDMA 2P66A 3C18A 5E24E 1UETA 2P23A 3MDAA 1R8AA 2D23A 5JLVA 1BPEA 5CA7A 1ZQGA 1TTUA 5J0TA 3JPQA 4I3NA 3S8JA 5D62A 1AVAC 1ONKB 3K7DA 5B3QA 3MGHA 4UD4A 9ICEA 2DR8A 1WBCA 3HBWA 4OUJA 5FZUA 4LO0A 2KLLA 1FMMS 1RY7A 4I2AA 1V6XA 2AXMA 4NXVA 5J2HA 4AT8A 4AT8B 5J0RA 3P53A 3JPPA 1WD3A 1CVSA 1MIYA 2DS0A 2Y9GA 3OBTA 1G9CA 4AT7B 4EEBA 1ZQPA 2GWSA 3GDXA 4JQ0A 3ISCA 4M9HA 3CA1A 1ZQKA 4M04A 3VT2A 3I2XA 3BA4A 1YLQA 5DDYA 2ZH9A 1S0BA 9ILBA 3QR5A 4EEEB 4R63A 1AF9A 4UAYA 4Z9WB 8ICQA 1W3FA 9ICCA 2ZHAA 1FWUA 3OWGA 5BP5A 4I4SA 1FN0A 4YMMA 2NTDA 4JLXA 1Z0HA 4RQ8A 9ICGA 3E8LC 5CFSA 4HA2A 4FO6A 2VXTI 7ICFA 4I2DA 4NXWA 3WA1A 2BFHA 4PGYA 4EGWA 2FCLA 3JPRA 4PGQA 1L2HA 6I1BA 9ICAA 4KM5A 2NVHA 5D63A 1GGPB 7ICOA 8ICVA 4TLPA 5DECA 3MDCA 2DRBA 3JPOA 3JRRA 3HX0A 4OEEA 4J2XA 2W9MA 4X5VA 1ZQDA 2DVIA 2PFNA 2HZ9A 1V6WA 4Z6EA 4FHYA 2ESUA 2KKIA 3AQKA 5I1BA 1MIVA 4FO1A 4Z6CA 4G1RA 2QN4A 4ZFUB 3MGIA 1UEUA 2ZH3A 4AT7A 1HIBA 1TWMA 4XKIA 4K8VA 4UBBA 4RQ7A 4PH5A 2Z49A 4P4OA 4NLKA 1KNYA 9ICVA 2LIEA 3FJFA 3S8KA 5D46A 2D22A 1DFCA 9ICRA 5J2JA 4K99A 2HN2A 1VCLA 5HRHA 1ITBA 3NBNA 2BE3A 2F2FA 1DJSB 2B51A 4ZGRB 4HR6C 4PHAA 4LO0C 3FUOA 4LVSA 3MALA 4O5CA 3UD9A 9ICJA 4H04A 5CHGA 4X4RA 5F8SA 3SNVA 2FFUA 4I29A 2YUGA 4H9WA 3OV7A 8ICOA 3NBEA 4WBZA 2FMQA 7ICPA 1JT7A 5BXPA 2ZH2A 3N7LA 4O6AA 1BFCA 2XOAA 1JY0A 2MLLB 2HN1A 3RJFA 1XSLA 2NZ9A 3JCFA 5HRIA 2ZH4A 3ER9B 3NJ5A 3PMEA 1FGAA 4MZFB 3V0BB 4OAHA 4RT2A 2ZHBA 4O5EA 3CK6A 3O3QA 3UXNA 4X0AA 1ZQRA 1ZQBA 2BCVA 4JWMA 4QZGA 4G9MA 4X4OA 1HCEA 1AVXB 4UY4A 4EBKA 4QKSA 4NM2A 2X2TA 4KLDA 2Q66A 4I28A 3BTAA 2ZH8A 1R8NA 1BLAA 1PUMB 3FFZA 3NBDA 3VT0A 5IIKA 4WC0A 1SR4A 4ZBVB 4S3NA 2DRAA 4G6JA 3ZXDA 1TWEA 4Q9GA 2ZR1B 4IQUA 3VT1A 4IQPA 2KH2A 1QXMA 2FGFA 2VXRA 4IYBA 4I4UA 4I7IA 1ZQUA 4ATBA 2O5AA 3O4OA 1R8OA 1ZQHA 1G82A 3N7JA 4LO7B 4OAIZ 4QZFA 21BIA 4UD5A 4UAWA 3I2AA 1IRAX 2E4MA 3BAGA 3OGGA 5FZYA 3AKHA 3CA4A 4QZIA 4RQ5A 3FJKA 1A8DA 4X3AA 5BP5C 9ICMA 1FA0A 5DBCA 4E7XA 4OW4A 4P6AA 4N7RA 4DOBA 4PHEA 3AJ5A 3JPSA 2BCRA 3O4CA 4AN6A 1ZQJA 2NYYA 4HJJA 4Z8SB 4PGXA 2M2WA 1ISYA 3CA0A 3RTIB 4LO7C 3H37A 1AFCA 2LIQA 3D7WB 3HOMA 3UQ2A 1ZQSA 5BQUA 3RJHA 4DEPA 4IY8A 4NXUA 1FV2A 3VEQA 4RWPA 3IM7A 2MC2A 1PC8B 3BRFA 1JT4A 1D0HA 2FO1A 2VSEA 1BA7A 5J2GA 3C5GA 3UPQA 1F31A 2K8RA 4XJEA 4UBCA 9ICKA 3C66A 5D4BA 4DO9A 3Q7XA 3K75D 1YYNA 5CFTA 1BPZA 1E0OA 4I4YA 4I8MA 3AQLA 4XRHA 4UB1A 4L4HA 3HALA 3OJ2A 3ZXGA 3WO3A 1S0EA 2R9KB 5DEDA 4YD1A 3R4SA 8ICYA 4KLLA 2D1ZA 4WQLA 3CAHA 1W3AA 4I2IA 4JWNA 2BBHA 9ICHA 4LEWA 4X4VA 3V72A 3HMYA 4K97A 9ICNA 1ZQVA 4ISQA 3K1XA 1T4QA 4I0YA 4XUSA 4OAFA 4QZDA 4RPYA 2BCQA 5BOLA 1SR4C 2Y9XE 3O5WB 4L4IA 4F5RA 4X0BA 4G6MA 4WC3A 4GXJA 3BRGC 3A23A 3F1RA 1JAJA 4RPXA 3KMVA 4EV6A 3UXPA 5B2HA 4G9NA 2GA9D 5TZVA 1BARA 3AH1A 4ZFWB 4USPA 5IINA 2DR9A 4DOAA 4RQ6A 7I1BA 8ICZA 1TFYA 4I1BA 1ZQMA 1Q78A 4J2YA 4ZLBB 4R65A 2IUBA 2M2VA 4GOYA 4I2GA 4J2KA 3A22A 4IY9A 4KEKA 5J0QA 4M9JA 5F8YA 5JMCA 1V6VA 1IHKA 1XHBA 3LQCB 3FJDA 1F5AA 5HRFA 4X4TA 7ICHA 5HRGA 1Z2VA 4QZHA 4X39A 3V79C 5J2DA 3FJ9A 5IIJA 3I29B 1YF8B 3OUYA 8ICGA 8ICUA 5D49A 1HKNA 5IILA 1ZQEA 4QZAA 1TVAA 1MQ2A 2I9GA 4KLQA 5CWRA 2NRKA 2HHPA 4KLOA 8ICNA 1ILR1 1YTOA 1Z4SA 4WOYA 3RH4A 3WFSC 1BASA 3OVSA 3FJIA 1ZQIA 1IOBA 3PMNA 1SZ6B 2F8XC 5HRBA 4IHZA 4EFQA 5J2KA 1DQOA 4LO2C 4MFAA 3PNCA 3PUBA 1TOOA 4M9NA 8ICAA 3V0BA 3AQMA 4O67A 2M2UA 3V7LA 2BPGA 8ICCA 4YD2A 3BAOA 7ICKA 3HIYA 5IIIA 1TP0A 4Z6FA 2BCUA 7ICVA 1HWPB 1YXWA 4KEJA 1XSPA 2B4VA 3OVAA 4KLUA 7ICUA 8ICLA 4MKPA 3ILAA 4OAGA 3CU1B 4JKXB 1MD6A 3O44A 1EV2A 1AVWB 4D0ZA 2GZBA 4LT6A 2D24A 4E8FA 5HRKA 3FUQA 4I2EA 2E4MC 8ICRA 1EYLA 2AFGA 5CB1A 7ICJA 4I4PA 4ISRA 4XFUA 2K43A 5F2VO 3FJAA 2FMSA 5DB9A 1TFWA 1ZQLA 4UB3A 2PFOA 4P0JA 1J0SA 2RFFA 4LEYA 4EFPA 3H6SE 4I6IA 4GP0A 4MZHA 4XQ8A 3FGMA 5CJ7A 8ICKA 1S0LA 2ET2A 5J2FA 1I1EA 3FJCA 2ISPA 3C2KA 1JQZA 3TFSA 4TUSA 1JQRA 4LO1A 4XFSA 4IZXA 3Q7WA 4A7YA 1II4A 5DKWA 5J2IA 9ICIA 1YBIA 3AKIA 3H3AA 1BLDA 3UPSA 2VLCA 3RSJA 1XYFA 3LTQA 4X38A 3VSZA 3WO2A 2GAFD 4XA5A 1ISZA 1QQLA 5FNWA 3VSFA 1G9AA 4XQ7A 4M47A 2L5XA 3RTJB 3UJ4A 4PHDA 1NUNA 2M49A 1Q03A 1JMSA 2BPCA 4IQVA 1MQ3A 3POKA 2Q9XA 4ZA3B 4QC4A 4OEGA 5DBBA 4I2FA 1TV9A 3L9DA 1RPLA 1M16A 4FH3A 5J0WA 4I2BA 5DUYA 4K4HA 1FQ9A 2DRYA 8I1BA 7ICSA 3AKGA 4JRAA 4OWJA 8ICFA 4RT3A 1NO5A 2O1PA 4R66A 4LO3C 5CP2A 5BQUC 3WFRE 9ICQA 1AVUA 1S0CA 1K5UA 4OWLA 4I96A 3HW8A 1KNMA 1IT0A 4GXIA 3UQ0A 5IIMA 2IHMA 3NYBA 4M0AA 4RWOA 3RJJA 4MFFA 3UXOA 3MCRA 3ERCC 2ZQOA 9ICOA 4F83A 1Q79A 3B0YA 4O5KA 3ISBA 3AH4A 4USOA 3VUOA 9ICFA 2QYIB 5J0SA 2GO2A 4X4UA 5BOWA 3NKUA 4MF8A 4R6UB 8ICIA 2D43A 3T8SA 5HR9A 2ZH5A 3IM6A 3JYYA 4I4OA 4AT9B 3BX1C 4AT9A 3VWCA 1HWOB 4X4QA 3RH6A 2Q3NB 2NP0A 1BFGA 4QD2B 4FGFA 2D7RA 1QQKA 2ID1A 7ICQA 2F2FC 4K9AA 2MIBA
chains in the Genus database with same CATH topology
1AXMA 4GAIA 5CFUA 1JT3A 1FWVA 2BEBA 2HW9A 4I2SA 2FFVA 5BXRA 1PWAA 2X2SA 5BXTA 1WD4A 4ZKTB 2J3PA 4LO2A 1G9DA 5F8WA 4LEVA 4QALA 3F62B 4QO3A 2NS2A 5GAQA 3FJ8A 1BFBA 4IZEA 1Q04A 3N0KA 1ISXA 3CA5A 3Q7YA 4EKXB 1TFMB 3H6RB 1ISVA 3IIRA 1FV3A 4D8HA 4O69A 3O4DA 2AQZA 4LO1C 2D20A 3RMXA 3AKFA 1N4KA 2Y9WC 2KI6B 4KC3A 4YOLA 4K98A 1TIEA 3CRHA 1UPSA 1S0FA 4I4QA 2AAIB 4I4XA 1GPJA 3A21A 3TC2A 3RMYA 1T9FA 4KEIA 3UD8A 4DCKC 1OQLB 2UUSA 2D7IA 3AJ6A 4GAFA 2VUAA 5EG6C 2WRYA 4PC4A 1V6UA 3BA7A 3H6RA 4IONA 3N7MA 3R4UA 1WBAA 2B56A 4J23B 5G00A 1S0DA 2Z48A 2Y9FA 3CQAA 5FNXA 4A7KA 4ZOTA 5DVHA 4JLZA 2HWMA 3N7KA 2RG9B 1DFQA 4DENA 1W3GA 2IWTB 2WBCA 4P0LA 3UD7A 3JUTA 3O49A 4MZGB 3O4AA 1XG6A 4Q91A 1IILA 5EC5A 4ZFYB 3BA5A 4WH5A 4KB6A 1XZZA 4QBVA 1P63A 4QKRA 2EWRA 2P39A 3H6QA 4GOVA 1IJTA 2VU9A 3BAUA 4CJMA 3ER8C 4I4RA 5EHAA 4HX0A 4JP0A 3WINA 4JAWA 1JLXA 1HWNB 3CRGA 1PUUB 3AZWA 4A7ZA 3UDAA 1RG8A 1DQGA 3ZX7A 3FJBA 4X37A 2HWAA 41BIA 3WINC 4I37A 3FJHA 1EPWA 5HPZA 1S0GA 2D44A 2IHOA 3CA3A 1BFFA 1PZZA 4QBCA 3A07A 4OEFA 4NXTA 31BIA 1I1BA 1JT5A 5BXSA 4KBBA 1CE7B 4QD2C 5DZUA 3NBCA 4LO8B 5CHEA 2BEAA 3PG0A 1IRPA 4EB2B 3O4BA 3AZVA 4J2SA 3W9TA 3WMUA 4XFTA 3FJEA 3LLPA 1NZKA 3V0AA 4LEZA 4WBCA 1DIWA 5B3PA 1ABRB 3OJVA 3QYDA 1EVTA 3PHZA 5DSSB 3WO4A 3OGFA 4WQKA 3ZC9A 1DZDA 2RQ9A 2RSTA 4D0TA 3OBRA 3WMVA 4AN7B 2VSAA 1RMLA 3CRIA 3P6IA 2DREA 1FMZA 4I1EA 2I1BA 3B9UA 1DZCA 4ENDA 3BADA 2FDBM 3C9ZA 3EF2A 5F90A 4K9BA 2NM1A 1K5VA 3BAVA 1JLYA 3MPPG 3ZC8A 1RZOB 3HN1A 4EFRA 2DRZA 5BVPI 2ZQNA 3P6JA 4NXXA 3IM5A 3FJJA 4JKQA 4O68A 1Q1UA 1JTCA 3BB2A 3BAHA 5D61A 4H75A 4F34A 2ERMA 3IAGC 2KI4A 1M2TB 3AH2A 1HCDA 1G9BA 3V0AB 4GP3A 4JPZA 3BAQA 1DLLA 1MC9A 4I4VA 4II0A 3CA6A 4K96A 1HWMB 4Q9PA 4OWKA 1ISWA 5FZZA 4FVVA 2K4AB 4P0KA 3BRDA 3OJMA 3UJ0A 4LO3A 3HSMA 5E24E 2P23A 2D23A 5JLVA 1TTUA 4I3NA 3S8JA 5D62A 1AVAC 1ONKB 3K7DA 5B3QA 1WBCA 3HBWA 4OUJA 5FZUA 4LO0A 2KLLA 1FMMS 1RY7A 1V6XA 2AXMA 4NXVA 3P53A 1WD3A 1CVSA 2DS0A 2Y9GA 3OBTA 1G9CA 4JQ0A 3CA1A 3VT2A 3I2XA 3BA4A 1S0BA 9ILBA 3QR5A 4EEEB 1AF9A 4Z9WB 1W3FA 1FWUA 3OWGA 5BP5A 4I4SA 1FN0A 2NTDA 4JLXA 1Z0HA 3E8LC 5CFSA 4HA2A 2VXTI 4NXWA 3WA1A 2BFHA 2FCLA 1L2HA 6I1BA 4KM5A 2NVHA 5D63A 1GGPB 4TLPA 3JRRA 4OEEA 4J2XA 2HZ9A 1V6WA 2ESUA 2KKIA 5I1BA 4FO1A 4G1RA 2QN4A 4ZFUB 1HIBA 1TWMA 4XKIA 4K8VA 2Z49A 2LIEA 3FJFA 3S8KA 2D22A 1DFCA 4K99A 1VCLA 1ITBA 3NBNA 2F2FA 1DJSB 2B51A 4ZGRB 4HR6C 4LO0C 3FUOA 3MALA 3UD9A 4H04A 5F8SA 3SNVA 2FFUA 2YUGA 4H9WA 3NBEA 1JT7A 5BXPA 3N7LA 4O6AA 1BFCA 2XOAA 1JY0A 2MLLB 2NZ9A 3ER9B 3NJ5A 3PMEA 1FGAA 4MZFB 3V0BB 4OAHA 3O3QA 4G9MA 1HCEA 1AVXB 4UY4A 4QKSA 2X2TA 3BTAA 1R8NA 1BLAA 1PUMB 3FFZA 3NBDA 3VT0A 1SR4A 4ZBVB 4G6JA 3ZXDA 1TWEA 4Q9GA 2ZR1B 3VT1A 4IQPA 2KH2A 1QXMA 2FGFA 2VXRA 4IYBA 4I4UA 4I7IA 3O4OA 1R8OA 1G82A 3N7JA 4LO7B 4OAIZ 21BIA 3I2AA 1IRAX 2E4MA 3BAGA 3OGGA 5FZYA 3AKHA 3CA4A 3FJKA 1A8DA 4X3AA 5BP5C 4OW4A 4P6AA 4N7RA 3AJ5A 3O4CA 4AN6A 2NYYA 4HJJA 4Z8SB 1ISYA 3CA0A 3RTIB 4LO7C 1AFCA 2LIQA 3D7WB 3HOMA 5BQUA 4DEPA 4IY8A 4NXUA 1FV2A 3VEQA 3IM7A 2MC2A 1PC8B 3BRFA 1JT4A 1D0HA 2FO1A 2VSEA 1BA7A 1F31A 2K8RA 4XJEA 3Q7XA 5CFTA 1YYNA 1E0OA 4I4YA 4I8MA 4L4HA 3HALA 3OJ2A 3ZXGA 3WO3A 1S0EA 2R9KB 3R4SA 2D1ZA 4WQLA 3CAHA 1W3AA 4LEWA 3HMYA 4K97A 4ISQA 3K1XA 1T4QA 4I0YA 4OAFA 1SR4C 2Y9XE 3O5WB 4L4IA 4G6MA 3BRGC 3A23A 3F1RA 3KMVA 5B2HA 4G9NA 2GA9D 1BARA 3AH1A 4ZFWB 4USPA 7I1BA 4I1BA 4J2YA 4ZLBB 4GOYA 4J2KA 3A22A 4IY9A 4KEKA 5F8YA 5JMCA 1V6VA 1IHKA 1XHBA 3FJDA 1Z2VA 4X39A 3V79C 3FJ9A 3I29B 1YF8B 1HKNA 1ILR1 1YTOA 1Z4SA 4WOYA 1BASA 3FJIA 1IOBA 1SZ6B 2F8XC 4IHZA 4EFQA 1DQOA 4LO2C 3PUBA 1TOOA 3V0BA 4O67A 3BAOA 1TP0A 1HWPB 1YXWA 4KEJA 2B4VA 4MKPA 3ILAA 4OAGA 3CU1B 4JKXB 1MD6A 3O44A 1EV2A 1AVWB 4D0ZA 2GZBA 2D24A 3FUQA 2E4MC 1EYLA 2AFGA 4I4PA 4ISRA 4XFUA 2K43A 3FJAA 4LEYA 4P0JA 1J0SA 4EFPA 3H6SE 4I6IA 4GP0A 4MZHA 3FGMA 1S0LA 2ET2A 1I1EA 3FJCA 1JQZA 4LO1A 4XFSA 4IZXA 3Q7WA 4A7YA 1II4A 1YBIA 3AKIA 1BLDA 2VLCA 3RSJA 1XYFA 3LTQA 4X38A 3VSZA 3WO2A 2GAFD 1ISZA 1QQLA 5FNWA 3VSFA 1G9AA 2L5XA 3RTJB 3UJ4A 1NUNA 2M49A 1Q03A 3POKA 2Q9XA 4ZA3B 4QC4A 4OEGA 1M16A 5DUYA 1FQ9A 2DRYA 8I1BA 3AKGA 4JRAA 4OWJA 4LO3C 5BQUC 1AVUA 1S0CA 1K5UA 4OWLA 4I96A 1KNMA 1IT0A 3ERCC 3MCRA 2ZQOA 4F83A 3AH4A 4USOA 3VUOA 2QYIB 2GO2A 5BOWA 3NKUA 4R6UB 2D43A 3T8SA 3IM6A 4I4OA 3BX1C 3VWCA 1HWOB 2Q3NB 2NP0A 1BFGA 4QD2B 4FGFA 2D7RA 1QQKA 2F2FC 4K9AA 2MIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AXM A;  4GAI A;  1JT3 A;  1FWV A;  2BEB A;  2HW9 A;  4I2S A;  2FFV A;  5BXR A;  1PWA A;  2X2S A;  5BXT A;  1WD4 A;  4ZKT B;  2J3P A;  4LO2 A;  1G9D A;  5F8W A;  4QAL A;  3F62 B;  4QO3 A;  5GAQ A;  3FJ8 A;  1BFB A;  4IZE A;  1Q04 A;  3N0K A;  1ISX A;  3CA5 A;  3Q7Y A;  4EKX B;  1TFM B;  3H6R B;  1ISV A;  3IIR A;  1FV3 A;  4D8H A;  3O4D A;  2AQZ A;  4LO1 C;  2D20 A;  3RMX A;  3AKF A;  1N4K A;  2Y9W C;  2KI6 B;  4KC3 A;  4YOL A;  1TIE A;  3CRH A;  1UPS A;  1S0F A;  4I4Q A;  2AAI B;  4I4X A;  3A21 A;  3TC2 A;  3RMY A;  1T9F A;  4KEI A;  3UD8 A;  4DCK C;  1OQL B;  2UUS A;  2D7I A;  3AJ6 A;  4GAF A;  2VUA A;  5EG6 C;  2WRY A;  4PC4 A;  1V6U A;  3BA7 A;  3H6R A;  4ION A;  3N7M A;  3R4U A;  1WBA A;  4J23 B;  5G00 A;  1S0D A;  2Z48 A;  2Y9F A;  3CQA A;  5FNX A;  4A7K A;  4ZOT A;  5DVH A;  2HWM A;  3N7K A;  2RG9 B;  1DFQ A;  4DEN A;  1W3G A;  2IWT B;  2WBC A;  4P0L A;  3UD7 A;  3JUT A;  3O49 A;  3O4A A;  1XG6 A;  4Q91 A;  1IIL A;  5EC5 A;  4ZFY B;  3BA5 A;  1XZZ A;  4QBV A;  1P63 A;  4QKR A;  2P39 A;  3H6Q A;  4GOV A;  1IJT A;  2VU9 A;  3BAU A;  4CJM A;  4I4R A;  5EHA A;  4JP0 A;  3WIN A;  4JAW A;  1JLX A;  1HWN B;  3CRG A;  1PUU B;  3AZW A;  4A7Z A;  3UDA A;  1RG8 A;  1DQG A;  3ZX7 A;  3FJB A;  4X37 A;  2HWA A;  41BI A;  3WIN C;  4I37 A;  3FJH A;  1EPW A;  5HPZ A;  1S0G A;  2D44 A;  2IHO A;  3CA3 A;  1BFF A;  1PZZ A;  4QBC A;  3A07 A;  4OEF A;  31BI A;  1I1B A;  1JT5 A;  5BXS A;  4KBB A;  1CE7 B;  4QD2 C;  5DZU A;  3NBC A;  4LO8 B;  2BEA A;  3PG0 A;  1IRP A;  4EB2 B;  3O4B A;  3AZV A;  4J2S A;  3W9T A;  3WMU A;  4XFT A;  3FJE A;  3LLP A;  1NZK A;  3V0A A;  4WBC A;  1DIW A;  1ABR B;  3OJV A;  3QYD A;  1EVT A;  3PHZ A;  5DSS B;  3WO4 A;  3OGF A;  3ZC9 A;  1DZD A;  2RQ9 A;  2RST A;  4D0T A;  3OBR A;  3WMV A;  4AN7 B;  2VSA A;  1RML A;  3CRI A;  3P6I A;  2DRE A;  1FMZ A;  4I1E A;  2I1B A;  3B9U A;  1DZC A;  4END A;  3BAD A;  2FDB M;  3C9Z A;  3EF2 A;  5F90 A;  2NM1 A;  1K5V A;  3BAV A;  1JLY A;  3MPP G;  3ZC8 A;  1RZO B;  3HN1 A;  4EFR A;  2DRZ A;  5BVP I;  2ZQN A;  3P6J A;  3IM5 A;  3FJJ A;  4JKQ A;  1Q1U A;  1JTC A;  3BB2 A;  3BAH A;  5D61 A;  4F34 A;  2ERM A;  3IAG C;  2KI4 A;  1M2T B;  3AH2 A;  1HCD A;  1G9B A;  3V0A B;  4GP3 A;  4JPZ A;  3BAQ A;  1DLL A;  1MC9 A;  4I4V A;  4II0 A;  3CA6 A;  1HWM B;  4Q9P A;  4OWK A;  1ISW A;  5FZZ A;  4FVV A;  2K4A B;  4P0K A;  3BRD A;  3OJM A;  3UJ0 A;  4LO3 A;  3HSM A;  5E24 E;  2P23 A;  2D23 A;  5JLV A;  1TTU A;  4I3N A;  3S8J A;  5D62 A;  1AVA C;  1ONK B;  1WBC A;  3HBW A;  4OUJ A;  5FZU A;  4LO0 A;  2KLL A;  1FMM S;  1RY7 A;  1V6X A;  2AXM A;  3P53 A;  1WD3 A;  1CVS A;  2DS0 A;  2Y9G A;  3OBT A;  1G9C A;  4JQ0 A;  3CA1 A;  3VT2 A;  3I2X A;  3BA4 A;  1S0B A;  9ILB A;  3QR5 A;  4EEE B;  1AF9 A;  4Z9W B;  1W3F A;  1FWU A;  5BP5 A;  4I4S A;  1FN0 A;  2NTD A;  1Z0H A;  3E8L C;  4HA2 A;  2VXT I;  3WA1 A;  2BFH A;  1L2H A;  6I1B A;  2NVH A;  5D63 A;  1GGP B;  4TLP A;  3JRR A;  4OEE A;  4J2X A;  2HZ9 A;  1V6W A;  2ESU A;  2KKI A;  5I1B A;  4G1R A;  2QN4 A;  4ZFU B;  1HIB A;  1TWM A;  4XKI A;  2Z49 A;  2LIE A;  3FJF A;  3S8K A;  2D22 A;  1DFC A;  1VCL A;  1ITB A;  3NBN A;  2F2F A;  1DJS B;  4ZGR B;  4HR6 C;  4LO0 C;  3FUO A;  3MAL A;  3UD9 A;  4H04 A;  5F8S A;  3SNV A;  2FFU A;  2YUG A;  4H9W A;  3NBE A;  1JT7 A;  5BXP A;  3N7L A;  1BFC A;  2XOA A;  1JY0 A;  2MLL B;  2NZ9 A;  3NJ5 A;  3PME A;  1FGA A;  3V0B B;  3O3Q A;  4G9M A;  1HCE A;  1AVX B;  4QKS A;  2X2T A;  3BTA A;  1R8N A;  1BLA A;  1PUM B;  3FFZ A;  3NBD A;  3VT0 A;  1SR4 A;  4ZBV B;  4G6J A;  3ZXD A;  1TWE A;  4Q9G A;  2ZR1 B;  3VT1 A;  4IQP A;  2KH2 A;  1QXM A;  2FGF A;  2VXR A;  4IYB A;  4I4U A;  4I7I A;  3O4O A;  1R8O A;  1G82 A;  3N7J A;  4LO7 B;  21BI A;  3I2A A;  1IRA X;  2E4M A;  3BAG A;  3OGG A;  5FZY A;  3AKH A;  3CA4 A;  3FJK A;  1A8D A;  4X3A A;  5BP5 C;  4OW4 A;  4P6A A;  3AJ5 A;  3O4C A;  4AN6 A;  2NYY A;  4HJJ A;  4Z8S B;  1ISY A;  3CA0 A;  3RTI B;  4LO7 C;  1AFC A;  2LIQ A;  3D7W B;  3HOM A;  5BQU A;  4DEP A;  4IY8 A;  1FV2 A;  3VEQ A;  3IM7 A;  2MC2 A;  1PC8 B;  3BRF A;  1JT4 A;  1D0H A;  2FO1 A;  2VSE A;  1BA7 A;  1F31 A;  2K8R A;  3Q7X A;  1YYN A;  1E0O A;  4I4Y A;  4I8M A;  4L4H A;  3HAL A;  3OJ2 A;  3ZXG A;  3WO3 A;  1S0E A;  2R9K B;  3R4S A;  2D1Z A;  3CAH A;  1W3A A;  3HMY A;  4ISQ A;  3K1X A;  1T4Q A;  4I0Y A;  1SR4 C;  2Y9X E;  3O5W B;  4L4I A;  4G6M A;  3BRG C;  3A23 A;  3F1R A;  3KMV A;  5B2H A;  4G9N A;  1BAR A;  3AH1 A;  4ZFW B;  4USP A;  7I1B A;  4I1B A;  4J2Y A;  4ZLB B;  4GOY A;  4J2K A;  3A22 A;  4IY9 A;  4KEK A;  5F8Y A;  5JMC A;  1V6V A;  1IHK A;  1XHB A;  3FJD A;  1Z2V A;  4X39 A;  3V79 C;  3FJ9 A;  3I29 B;  1YF8 B;  1HKN A;  1ILR 1;  1YTO A;  1Z4S A;  1BAS A;  3FJI A;  1IOB A;  1SZ6 B;  2F8X C;  4IHZ A;  4EFQ A;  1DQO A;  4LO2 C;  3PUB A;  1TOO A;  3V0B A;  3BAO A;  1TP0 A;  1HWP B;  1YXW A;  4KEJ A;  3ILA A;  3CU1 B;  4JKX B;  1MD6 A;  3O44 A;  1EV2 A;  1AVW B;  4D0Z A;  2GZB A;  2D24 A;  3FUQ A;  2E4M C;  1EYL A;  2AFG A;  4I4P A;  4ISR A;  4XFU A;  2K43 A;  3FJA A;  4P0J A;  1J0S A;  4EFP A;  3H6S E;  4I6I A;  4GP0 A;  3FGM A;  1S0L A;  2ET2 A;  1I1E A;  3FJC A;  1JQZ A;  4LO1 A;  4XFS A;  4IZX A;  3Q7W A;  4A7Y A;  1II4 A;  1YBI A;  3AKI A;  1BLD A;  2VLC A;  3RSJ A;  1XYF A;  3LTQ A;  4X38 A;  3VSZ A;  3WO2 A;  1ISZ A;  1QQL A;  5FNW A;  3VSF A;  1G9A A;  2L5X A;  3RTJ B;  3UJ4 A;  1NUN A;  2M49 A;  1Q03 A;  3POK A;  2Q9X A;  4ZA3 B;  4QC4 A;  4OEG A;  1M16 A;  5DUY A;  1FQ9 A;  2DRY A;  8I1B A;  3AKG A;  4JRA A;  4OWJ A;  4LO3 C;  5BQU C;  1AVU A;  1S0C A;  1K5U A;  4OWL A;  4I96 A;  1KNM A;  1IT0 A;  2ZQO A;  4F83 A;  3AH4 A;  4USO A;  3VUO A;  2QYI B;  2GO2 A;  5BOW A;  4R6U B;  2D43 A;  3T8S A;  3IM6 A;  4I4O A;  3BX1 C;  3VWC A;  1HWO B;  2Q3N B;  2NP0 A;  1BFG A;  4QD2 B;  4FGF A;  2D7R A;  1QQK A;  2F2F C;  2MIB A; 
#chains in the Genus database with same CATH topology
 1AXM A;  4GAI A;  5CFU A;  4F5O A;  8ICP A;  1JT3 A;  4FHX A;  2ZH6 A;  1FWV A;  2BEB A;  2HW9 A;  5J0U A;  4I2S A;  3TFR A;  2FFV A;  4EBJ A;  3AUO A;  2BCS A;  8ICH A;  7ICL A;  5BXR A;  1PWA A;  2X2S A;  4KLI A;  5BXT A;  1WD4 A;  4YCX A;  3OUY B;  4ZKT B;  1VFG A;  2J3P A;  4FHP A;  4LO2 A;  7ICG A;  3LK9 A;  1G9D A;  1R8B A;  4RQ4 A;  5F8W A;  4LEV A;  4QAL A;  4MF2 A;  3F62 B;  4TUP A;  3WFP A;  4F5N A;  4QO3 A;  2NS2 A;  5GAQ A;  3FJ8 A;  4F5P A;  1BFB A;  4IZE A;  1Q04 A;  3N0K A;  5J0O A;  5DB7 A;  1ISX A;  1BPY A;  3CA5 A;  3Q7Y A;  4EKX B;  1TFM B;  1ZQF A;  3H6R B;  1ISV A;  3IIR A;  4M9L A;  2PFQ A;  1FV3 A;  4D8H A;  4O69 A;  3O4D A;  2AQZ A;  1ZQO A;  4LO1 C;  4KLG A;  2D20 A;  4IQT A;  4R64 A;  3RMX A;  3AKF A;  1BPX A;  1N4K A;  2Y9W C;  2KI6 B;  4KC3 A;  4YOL A;  1NOM A;  3PML A;  4K98 A;  1TIE A;  4PPX A;  8ICX A;  3CRH A;  4FHW A;  1UPS A;  1S0F A;  4I4Q A;  4GXK A;  2AAI B;  4I4X A;  4KLJ A;  1GPJ A;  3WFQ E;  3MBY A;  4WCW A;  3A21 A;  3TC2 A;  3RMY A;  1T9F A;  4O9M A;  1KEJ A;  1WOT A;  2DR5 A;  4KLM A;  4KEI A;  3WFO A;  4RQ2 A;  3UD8 A;  9ICB A;  4DCK C;  1OQL B;  4UB5 A;  2DR7 A;  1R89 A;  2UUS A;  2D7I A;  3AJ6 A;  4X4P A;  4GAF A;  2VUA A;  3HWT A;  5EG6 C;  4K4G A;  2WRY A;  4PC4 A;  1XSN A;  3AQN A;  4EED A;  1V6U A;  2ISO A;  3BA7 A;  3H6R A;  4ION A;  3N7M A;  3R4U A;  1ZJM A;  9ICU A;  4KLF A;  1WBA A;  4RWQ A;  2B56 A;  4K4I A;  4J23 B;  4IQW A;  4I2H A;  2BPF A;  5G00 A;  1S0D A;  2Z48 A;  2Y9F A;  3CQA A;  3C5F A;  5FNX A;  4A7K A;  4ZOT A;  5DVH A;  4JLZ A;  4RQ3 A;  2HWM A;  5JTG A;  3N7K A;  2RG9 B;  1DFQ A;  4DEN A;  1W3G A;  2IWT B;  3V7K A;  3V7J A;  4WBY A;  2WBC A;  4M5D A;  4P0L A;  3UD7 A;  2PXI A;  3JPN A;  3JUT A;  4YN4 A;  2VAN A;  3O49 A;  5IIO A;  1ZJN A;  4MZG B;  3O4A A;  1XG6 A;  4Q91 A;  1IIL A;  5EC5 A;  4ZFY B;  4I2J A;  3BA5 A;  5J0P A;  4WH5 A;  8ICM A;  3NWI A;  4NM1 A;  3JZ0 A;  5J0Y A;  4KB6 A;  1XZZ A;  3OVB A;  1BPD A;  1KDH A;  3HJ4 A;  1ZQC A;  4QBV A;  1P63 A;  5J0X A;  4QKR A;  4NXZ A;  4X4S A;  9ICW A;  3RJG A;  2EWR A;  2P39 A;  3H6Q A;  4GOV A;  2ZH7 A;  7ICM A;  1IJT A;  2VU9 A;  4NKU A;  4KLS A;  8ICJ A;  5HRL A;  3BAU A;  4CJM A;  4PHP A;  5HRE A;  4WC7 A;  4I4R A;  5EHA A;  3ER8 C;  4HX0 A;  4JP0 A;  5HHH A;  3WIN A;  4WC4 A;  2PFP A;  4JAW A;  3ISD A;  4I2C A;  1JLX A;  1HWN B;  3CRG A;  4TUR A;  1HUZ A;  1PUU B;  3AZW A;  4QZB A;  4A7Z A;  4RQ0 A;  4NY8 A;  4RWN A;  9ICL A;  3OGU A;  3UDA A;  2FMP A;  1RG8 A;  5J2E A;  4FH5 A;  1DQG A;  3ZX7 A;  3FJB A;  4X37 A;  2HWA A;  41BI A;  3WIN C;  8ICT A;  4P2H A;  4I37 A;  3FJH A;  1EPW A;  5HPZ A;  4ATB B;  4WC5 A;  3C2L A;  1S0G A;  2D44 A;  4Z6D A;  2IHO A;  4QZC A;  5J2A A;  3CA3 A;  4P4P A;  1UEV A;  1BFF A;  9ICS A;  5J2C A;  1PZZ A;  4WC1 A;  4QBC A;  3A07 A;  4OEF A;  4NXT A;  5BOM A;  8ICW A;  5J2B A;  31BI A;  5J29 A;  4IG8 A;  4WC2 A;  1I1B A;  9ICX A;  4RQ1 A;  1JT5 A;  5EOZ A;  3RJI A;  4WC6 A;  4M2Y A;  5BXS A;  4LZG A;  2ZH1 A;  4KBB A;  1CE7 B;  4KLH A;  4QD2 C;  5DZU A;  1JN3 A;  3NBC A;  4LO8 B;  1PX5 A;  5CHE A;  1HUO A;  4LZD A;  2BEA A;  3PG0 A;  1IRP A;  4EB2 B;  3HJ1 A;  3O4B A;  3AZV A;  4J2S A;  3W9T A;  3WMU A;  4XFT A;  4UAZ A;  8ICB A;  3FJE A;  3LLP A;  1NZK A;  3V0A A;  4LEZ A;  3JPT A;  4WBC A;  5HC9 A;  7ICR A;  1DIW A;  5B3P A;  1ABR B;  3OJV A;  3QYD A;  1EVT A;  3PHZ A;  5DSS B;  3WO4 A;  4FHV A;  7ICE A;  8ICS A;  5HHI A;  3OGF A;  4WQK A;  7ICT A;  3ZC9 A;  1DZD A;  4YMN A;  2RQ9 A;  1ZQZ A;  3RJE A;  2RST A;  4F5Q A;  4D0T A;  3OBR A;  3WMV A;  4AN7 B;  4I0U A;  1RZT A;  4X4N A;  2VSA A;  1VJ7 A;  4DOC A;  4KLE A;  1RML A;  3CRI A;  4QZ8 A;  4KLT A;  3NVO A;  3RH5 A;  4EP7 A;  3P6I A;  2DRE A;  1FMZ A;  4I1E A;  2I1B A;  3B9U A;  1DZC A;  4END A;  1ZQX A;  1ZQQ A;  3RJK A;  3BAD A;  2FDB M;  3C9Z A;  3EF2 A;  5F90 A;  4QZ9 A;  3B0X A;  4K9B A;  2NM1 A;  1BPB A;  5CR0 A;  1K5V A;  3BAV A;  7ICN A;  1JLY A;  3MPP G;  3ZC8 A;  4P4M A;  1RZO B;  4MFC A;  3HN1 A;  4EFR A;  2DRZ A;  5BVP I;  8ICE A;  2ZQN A;  3P6J A;  4NXX A;  3IM5 A;  3FJJ A;  4JKQ A;  4O68 A;  2PBE A;  3AU2 A;  1Q1U A;  1JTC A;  3BB2 A;  3BAH A;  5D61 A;  4H75 A;  4YMO A;  4F34 A;  2ERM A;  3IAG C;  5HRD A;  5BPC A;  9ICT A;  2KI4 A;  1M2T B;  3AU6 A;  4UB4 A;  3AH2 A;  4QZE A;  1ZQA A;  1HCD A;  1G9B A;  3V0A B;  4E80 A;  5DB6 A;  4GP3 A;  1MIW A;  4I27 A;  4JPZ A;  4M9G A;  3BAQ A;  1ZQT A;  1DLL A;  3C2M A;  1MC9 A;  4I4V A;  4II0 A;  1R8C A;  4NKT A;  3CA6 A;  1OU5 A;  4NLZ A;  4K96 A;  3H38 A;  4UB2 A;  1HWM B;  4Q9P A;  4NLN A;  5DB8 A;  5DBA A;  7ICI A;  4OWK A;  1ISW A;  1V4A A;  1ZQW A;  5FZZ A;  4TUQ A;  4FVV A;  2K4A B;  4P0K A;  3BRD A;  3H39 A;  1ZQN A;  3OJM A;  2BBJ A;  2M2T A;  3UJ0 A;  9ICP A;  1ZQY A;  4LO3 A;  4RPZ A;  3HSM A;  5DDM A;  2P66 A;  3C18 A;  5E24 E;  1UET A;  2P23 A;  3MDA A;  1R8A A;  2D23 A;  5JLV A;  1BPE A;  5CA7 A;  1ZQG A;  1TTU A;  5J0T A;  3JPQ A;  4I3N A;  3S8J A;  5D62 A;  1AVA C;  1ONK B;  3K7D A;  5B3Q A;  3MGH A;  4UD4 A;  9ICE A;  2DR8 A;  1WBC A;  3HBW A;  4OUJ A;  5FZU A;  4LO0 A;  2KLL A;  1FMM S;  1RY7 A;  4I2A A;  1V6X A;  2AXM A;  4NXV A;  5J2H A;  4AT8 A;  4AT8 B;  5J0R A;  3P53 A;  3JPP A;  1WD3 A;  1CVS A;  1MIY A;  2DS0 A;  2Y9G A;  3OBT A;  1G9C A;  4AT7 B;  4EEB A;  1ZQP A;  2GWS A;  3GDX A;  4JQ0 A;  3ISC A;  4M9H A;  3CA1 A;  1ZQK A;  4M04 A;  3VT2 A;  3I2X A;  3BA4 A;  1YLQ A;  5DDY A;  2ZH9 A;  1S0B A;  9ILB A;  3QR5 A;  4EEE B;  4R63 A;  1AF9 A;  4UAY A;  4Z9W B;  8ICQ A;  1W3F A;  9ICC A;  2ZHA A;  1FWU A;  3OWG A;  5BP5 A;  4I4S A;  1FN0 A;  4YMM A;  2NTD A;  4JLX A;  1Z0H A;  4RQ8 A;  9ICG A;  3E8L C;  5CFS A;  4HA2 A;  4FO6 A;  2VXT I;  7ICF A;  4I2D A;  4NXW A;  3WA1 A;  2BFH A;  4PGY A;  4EGW A;  2FCL A;  3JPR A;  4PGQ A;  1L2H A;  6I1B A;  9ICA A;  4KM5 A;  2NVH A;  5D63 A;  1GGP B;  7ICO A;  8ICV A;  4TLP A;  5DEC A;  3MDC A;  2DRB A;  3JPO A;  3JRR A;  3HX0 A;  4OEE A;  4J2X A;  2W9M A;  4X5V A;  1ZQD A;  2DVI A;  2PFN A;  2HZ9 A;  1V6W A;  4Z6E A;  4FHY A;  2ESU A;  2KKI A;  3AQK A;  5I1B A;  1MIV A;  4FO1 A;  4Z6C A;  4G1R A;  2QN4 A;  4ZFU B;  3MGI A;  1UEU A;  2ZH3 A;  4AT7 A;  1HIB A;  1TWM A;  4XKI A;  4K8V A;  4UBB A;  4RQ7 A;  4PH5 A;  2Z49 A;  4P4O A;  4NLK A;  1KNY A;  9ICV A;  2LIE A;  3FJF A;  3S8K A;  5D46 A;  2D22 A;  1DFC A;  9ICR A;  5J2J A;  4K99 A;  2HN2 A;  1VCL A;  5HRH A;  1ITB A;  3NBN A;  2BE3 A;  2F2F A;  1DJS B;  2B51 A;  4ZGR B;  4HR6 C;  4PHA A;  4LO0 C;  3FUO A;  4LVS A;  3MAL A;  4O5C A;  3UD9 A;  9ICJ A;  4H04 A;  5CHG A;  4X4R A;  5F8S A;  3SNV A;  2FFU A;  4I29 A;  2YUG A;  4H9W A;  3OV7 A;  8ICO A;  3NBE A;  4WBZ A;  2FMQ A;  7ICP A;  1JT7 A;  5BXP A;  2ZH2 A;  3N7L A;  4O6A A;  1BFC A;  2XOA A;  1JY0 A;  2MLL B;  2HN1 A;  3RJF A;  1XSL A;  2NZ9 A;  3JCF A;  5HRI A;  2ZH4 A;  3ER9 B;  3NJ5 A;  3PME A;  1FGA A;  4MZF B;  3V0B B;  4OAH A;  4RT2 A;  2ZHB A;  4O5E A;  3CK6 A;  3O3Q A;  3UXN A;  4X0A A;  1ZQR A;  1ZQB A;  2BCV A;  4JWM A;  4QZG A;  4G9M A;  4X4O A;  1HCE A;  1AVX B;  4UY4 A;  4EBK A;  4QKS A;  4NM2 A;  2X2T A;  4KLD A;  2Q66 A;  4I28 A;  3BTA A;  2ZH8 A;  1R8N A;  1BLA A;  1PUM B;  3FFZ A;  3NBD A;  3VT0 A;  5IIK A;  4WC0 A;  1SR4 A;  4ZBV B;  4S3N A;  2DRA A;  4G6J A;  3ZXD A;  1TWE A;  4Q9G A;  2ZR1 B;  4IQU A;  3VT1 A;  4IQP A;  2KH2 A;  1QXM A;  2FGF A;  2VXR A;  4IYB A;  4I4U A;  4I7I A;  1ZQU A;  4ATB A;  2O5A A;  3O4O A;  1R8O A;  1ZQH A;  1G82 A;  3N7J A;  4LO7 B;  4OAI Z;  4QZF A;  21BI A;  4UD5 A;  4UAW A;  3I2A A;  1IRA X;  2E4M A;  3BAG A;  3OGG A;  5FZY A;  3AKH A;  3CA4 A;  4QZI A;  4RQ5 A;  3FJK A;  1A8D A;  4X3A A;  5BP5 C;  9ICM A;  1FA0 A;  5DBC A;  4E7X A;  4OW4 A;  4P6A A;  4N7R A;  4DOB A;  4PHE A;  3AJ5 A;  3JPS A;  2BCR A;  3O4C A;  4AN6 A;  1ZQJ A;  2NYY A;  4HJJ A;  4Z8S B;  4PGX A;  2M2W A;  1ISY A;  3CA0 A;  3RTI B;  4LO7 C;  3H37 A;  1AFC A;  2LIQ A;  3D7W B;  3HOM A;  3UQ2 A;  1ZQS A;  5BQU A;  3RJH A;  4DEP A;  4IY8 A;  4NXU A;  1FV2 A;  3VEQ A;  4RWP A;  3IM7 A;  2MC2 A;  1PC8 B;  3BRF A;  1JT4 A;  1D0H A;  2FO1 A;  2VSE A;  1BA7 A;  5J2G A;  3C5G A;  3UPQ A;  1F31 A;  2K8R A;  4XJE A;  4UBC A;  9ICK A;  3C66 A;  5D4B A;  4DO9 A;  3Q7X A;  3K75 D;  1YYN A;  5CFT A;  1BPZ A;  1E0O A;  4I4Y A;  4I8M A;  3AQL A;  4XRH A;  4UB1 A;  4L4H A;  3HAL A;  3OJ2 A;  3ZXG A;  3WO3 A;  1S0E A;  2R9K B;  5DED A;  4YD1 A;  3R4S A;  8ICY A;  4KLL A;  2D1Z A;  4WQL A;  3CAH A;  1W3A A;  4I2I A;  4JWN A;  2BBH A;  9ICH A;  4LEW A;  4X4V A;  3V72 A;  3HMY A;  4K97 A;  9ICN A;  1ZQV A;  4ISQ A;  3K1X A;  1T4Q A;  4I0Y A;  4XUS A;  4OAF A;  4QZD A;  4RPY A;  2BCQ A;  5BOL A;  1SR4 C;  2Y9X E;  3O5W B;  4L4I A;  4F5R A;  4X0B A;  4G6M A;  4WC3 A;  4GXJ A;  3BRG C;  3A23 A;  3F1R A;  1JAJ A;  4RPX A;  3KMV A;  4EV6 A;  3UXP A;  5B2H A;  4G9N A;  2GA9 D;  5TZV A;  1BAR A;  3AH1 A;  4ZFW B;  4USP A;  5IIN A;  2DR9 A;  4DOA A;  4RQ6 A;  7I1B A;  8ICZ A;  1TFY A;  4I1B A;  1ZQM A;  1Q78 A;  4J2Y A;  4ZLB B;  4R65 A;  2IUB A;  2M2V A;  4GOY A;  4I2G A;  4J2K A;  3A22 A;  4IY9 A;  4KEK A;  5J0Q A;  4M9J A;  5F8Y A;  5JMC A;  1V6V A;  1IHK A;  1XHB A;  3LQC B;  3FJD A;  1F5A A;  5HRF A;  4X4T A;  7ICH A;  5HRG A;  1Z2V A;  4QZH A;  4X39 A;  3V79 C;  5J2D A;  3FJ9 A;  5IIJ A;  3I29 B;  1YF8 B;  3OUY A;  8ICG A;  8ICU A;  5D49 A;  1HKN A;  5IIL A;  1ZQE A;  4QZA A;  1TVA A;  1MQ2 A;  2I9G A;  4KLQ A;  5CWR A;  2NRK A;  2HHP A;  4KLO A;  8ICN A;  1ILR 1;  1YTO A;  1Z4S A;  4WOY A;  3RH4 A;  3WFS C;  1BAS A;  3OVS A;  3FJI A;  1ZQI A;  1IOB A;  3PMN A;  1SZ6 B;  2F8X C;  5HRB A;  4IHZ A;  4EFQ A;  5J2K A;  1DQO A;  4LO2 C;  4MFA A;  3PNC A;  3PUB A;  1TOO A;  4M9N A;  8ICA A;  3V0B A;  3AQM A;  4O67 A;  2M2U A;  3V7L A;  2BPG A;  8ICC A;  4YD2 A;  3BAO A;  7ICK A;  3HIY A;  5III A;  1TP0 A;  4Z6F A;  2BCU A;  7ICV A;  1HWP B;  1YXW A;  4KEJ A;  1XSP A;  2B4V A;  3OVA A;  4KLU A;  7ICU A;  8ICL A;  4MKP A;  3ILA A;  4OAG A;  3CU1 B;  4JKX B;  1MD6 A;  3O44 A;  1EV2 A;  1AVW B;  4D0Z A;  2GZB A;  4LT6 A;  2D24 A;  4E8F A;  5HRK A;  3FUQ A;  4I2E A;  2E4M C;  8ICR A;  1EYL A;  2AFG A;  5CB1 A;  7ICJ A;  4I4P A;  4ISR A;  4XFU A;  2K43 A;  5F2V O;  3FJA A;  2FMS A;  5DB9 A;  1TFW A;  1ZQL A;  4UB3 A;  2PFO A;  4P0J A;  1J0S A;  2RFF A;  4LEY A;  4EFP A;  3H6S E;  4I6I A;  4GP0 A;  4MZH A;  4XQ8 A;  3FGM A;  5CJ7 A;  8ICK A;  1S0L A;  2ET2 A;  5J2F A;  1I1E A;  3FJC A;  2ISP A;  3C2K A;  1JQZ A;  3TFS A;  4TUS A;  1JQR A;  4LO1 A;  4XFS A;  4IZX A;  3Q7W A;  4A7Y A;  1II4 A;  5DKW A;  5J2I A;  9ICI A;  1YBI A;  3AKI A;  3H3A A;  1BLD A;  3UPS A;  2VLC A;  3RSJ A;  1XYF A;  3LTQ A;  4X38 A;  3VSZ A;  3WO2 A;  2GAF D;  4XA5 A;  1ISZ A;  1QQL A;  5FNW A;  3VSF A;  1G9A A;  4XQ7 A;  4M47 A;  2L5X A;  3RTJ B;  3UJ4 A;  4PHD A;  1NUN A;  2M49 A;  1Q03 A;  1JMS A;  2BPC A;  4IQV A;  1MQ3 A;  3POK A;  2Q9X A;  4ZA3 B;  4QC4 A;  4OEG A;  5DBB A;  4I2F A;  1TV9 A;  3L9D A;  1RPL A;  1M16 A;  4FH3 A;  5J0W A;  4I2B A;  5DUY A;  4K4H A;  1FQ9 A;  2DRY A;  8I1B A;  7ICS A;  3AKG A;  4JRA A;  4OWJ A;  8ICF A;  4RT3 A;  1NO5 A;  2O1P A;  4R66 A;  4LO3 C;  5CP2 A;  5BQU C;  3WFR E;  9ICQ A;  1AVU A;  1S0C A;  1K5U A;  4OWL A;  4I96 A;  3HW8 A;  1KNM A;  1IT0 A;  4GXI A;  3UQ0 A;  5IIM A;  2IHM A;  3NYB A;  4M0A A;  4RWO A;  3RJJ A;  4MFF A;  3UXO A;  3MCR A;  3ERC C;  2ZQO A;  9ICO A;  4F83 A;  1Q79 A;  3B0Y A;  4O5K A;  3ISB A;  3AH4 A;  4USO A;  3VUO A;  9ICF A;  2QYI B;  5J0S A;  2GO2 A;  4X4U A;  5BOW A;  3NKU A;  4MF8 A;  4R6U B;  8ICI A;  2D43 A;  3T8S A;  5HR9 A;  2ZH5 A;  3IM6 A;  3JYY A;  4I4O A;  4AT9 B;  3BX1 C;  4AT9 A;  3VWC A;  1HWO B;  4X4Q A;  3RH6 A;  2Q3N B;  2NP0 A;  1BFG A;  4QD2 B;  4FGF A;  2D7R A;  1QQK A;  2ID1 A;  7ICQ A;  2F2F C;  4K9A A;  2MIB A; 
#chains in the Genus database with same CATH homology
 1AXM A;  4GAI A;  5CFU A;  1JT3 A;  1FWV A;  2BEB A;  2HW9 A;  4I2S A;  2FFV A;  5BXR A;  1PWA A;  2X2S A;  5BXT A;  1WD4 A;  4ZKT B;  2J3P A;  4LO2 A;  1G9D A;  5F8W A;  4LEV A;  4QAL A;  3F62 B;  4QO3 A;  2NS2 A;  5GAQ A;  3FJ8 A;  1BFB A;  4IZE A;  1Q04 A;  3N0K A;  1ISX A;  3CA5 A;  3Q7Y A;  4EKX B;  1TFM B;  3H6R B;  1ISV A;  3IIR A;  1FV3 A;  4D8H A;  4O69 A;  3O4D A;  2AQZ A;  4LO1 C;  2D20 A;  3RMX A;  3AKF A;  1N4K A;  2Y9W C;  2KI6 B;  4KC3 A;  4YOL A;  4K98 A;  1TIE A;  3CRH A;  1UPS A;  1S0F A;  4I4Q A;  2AAI B;  4I4X A;  1GPJ A;  3A21 A;  3TC2 A;  3RMY A;  1T9F A;  4KEI A;  3UD8 A;  4DCK C;  1OQL B;  2UUS A;  2D7I A;  3AJ6 A;  4GAF A;  2VUA A;  5EG6 C;  2WRY A;  4PC4 A;  1V6U A;  3BA7 A;  3H6R A;  4ION A;  3N7M A;  3R4U A;  1WBA A;  2B56 A;  4J23 B;  5G00 A;  1S0D A;  2Z48 A;  2Y9F A;  3CQA A;  5FNX A;  4A7K A;  4ZOT A;  5DVH A;  4JLZ A;  2HWM A;  3N7K A;  2RG9 B;  1DFQ A;  4DEN A;  1W3G A;  2IWT B;  2WBC A;  4P0L A;  3UD7 A;  3JUT A;  3O49 A;  4MZG B;  3O4A A;  1XG6 A;  4Q91 A;  1IIL A;  5EC5 A;  4ZFY B;  3BA5 A;  4WH5 A;  4KB6 A;  1XZZ A;  4QBV A;  1P63 A;  4QKR A;  2EWR A;  2P39 A;  3H6Q A;  4GOV A;  1IJT A;  2VU9 A;  3BAU A;  4CJM A;  3ER8 C;  4I4R A;  5EHA A;  4HX0 A;  4JP0 A;  3WIN A;  4JAW A;  1JLX A;  1HWN B;  3CRG A;  1PUU B;  3AZW A;  4A7Z A;  3UDA A;  1RG8 A;  1DQG A;  3ZX7 A;  3FJB A;  4X37 A;  2HWA A;  41BI A;  3WIN C;  4I37 A;  3FJH A;  1EPW A;  5HPZ A;  1S0G A;  2D44 A;  2IHO A;  3CA3 A;  1BFF A;  1PZZ A;  4QBC A;  3A07 A;  4OEF A;  4NXT A;  31BI A;  1I1B A;  1JT5 A;  5BXS A;  4KBB A;  1CE7 B;  4QD2 C;  5DZU A;  3NBC A;  4LO8 B;  5CHE A;  2BEA A;  3PG0 A;  1IRP A;  4EB2 B;  3O4B A;  3AZV A;  4J2S A;  3W9T A;  3WMU A;  4XFT A;  3FJE A;  3LLP A;  1NZK A;  3V0A A;  4LEZ A;  4WBC A;  1DIW A;  5B3P A;  1ABR B;  3OJV A;  3QYD A;  1EVT A;  3PHZ A;  5DSS B;  3WO4 A;  3OGF A;  4WQK A;  3ZC9 A;  1DZD A;  2RQ9 A;  2RST A;  4D0T A;  3OBR A;  3WMV A;  4AN7 B;  2VSA A;  1RML A;  3CRI A;  3P6I A;  2DRE A;  1FMZ A;  4I1E A;  2I1B A;  3B9U A;  1DZC A;  4END A;  3BAD A;  2FDB M;  3C9Z A;  3EF2 A;  5F90 A;  4K9B A;  2NM1 A;  1K5V A;  3BAV A;  1JLY A;  3MPP G;  3ZC8 A;  1RZO B;  3HN1 A;  4EFR A;  2DRZ A;  5BVP I;  2ZQN A;  3P6J A;  4NXX A;  3IM5 A;  3FJJ A;  4JKQ A;  4O68 A;  1Q1U A;  1JTC A;  3BB2 A;  3BAH A;  5D61 A;  4H75 A;  4F34 A;  2ERM A;  3IAG C;  2KI4 A;  1M2T B;  3AH2 A;  1HCD A;  1G9B A;  3V0A B;  4GP3 A;  4JPZ A;  3BAQ A;  1DLL A;  1MC9 A;  4I4V A;  4II0 A;  3CA6 A;  4K96 A;  1HWM B;  4Q9P A;  4OWK A;  1ISW A;  5FZZ A;  4FVV A;  2K4A B;  4P0K A;  3BRD A;  3OJM A;  3UJ0 A;  4LO3 A;  3HSM A;  5E24 E;  2P23 A;  2D23 A;  5JLV A;  1TTU A;  4I3N A;  3S8J A;  5D62 A;  1AVA C;  1ONK B;  3K7D A;  5B3Q A;  1WBC A;  3HBW A;  4OUJ A;  5FZU A;  4LO0 A;  2KLL A;  1FMM S;  1RY7 A;  1V6X A;  2AXM A;  4NXV A;  3P53 A;  1WD3 A;  1CVS A;  2DS0 A;  2Y9G A;  3OBT A;  1G9C A;  4JQ0 A;  3CA1 A;  3VT2 A;  3I2X A;  3BA4 A;  1S0B A;  9ILB A;  3QR5 A;  4EEE B;  1AF9 A;  4Z9W B;  1W3F A;  1FWU A;  3OWG A;  5BP5 A;  4I4S A;  1FN0 A;  2NTD A;  4JLX A;  1Z0H A;  3E8L C;  5CFS A;  4HA2 A;  2VXT I;  4NXW A;  3WA1 A;  2BFH A;  2FCL A;  1L2H A;  6I1B A;  4KM5 A;  2NVH A;  5D63 A;  1GGP B;  4TLP A;  3JRR A;  4OEE A;  4J2X A;  2HZ9 A;  1V6W A;  2ESU A;  2KKI A;  5I1B A;  4FO1 A;  4G1R A;  2QN4 A;  4ZFU B;  1HIB A;  1TWM A;  4XKI A;  4K8V A;  2Z49 A;  2LIE A;  3FJF A;  3S8K A;  2D22 A;  1DFC A;  4K99 A;  1VCL A;  1ITB A;  3NBN A;  2F2F A;  1DJS B;  2B51 A;  4ZGR B;  4HR6 C;  4LO0 C;  3FUO A;  3MAL A;  3UD9 A;  4H04 A;  5F8S A;  3SNV A;  2FFU A;  2YUG A;  4H9W A;  3NBE A;  1JT7 A;  5BXP A;  3N7L A;  4O6A A;  1BFC A;  2XOA A;  1JY0 A;  2MLL B;  2NZ9 A;  3ER9 B;  3NJ5 A;  3PME A;  1FGA A;  4MZF B;  3V0B B;  4OAH A;  3O3Q A;  4G9M A;  1HCE A;  1AVX B;  4UY4 A;  4QKS A;  2X2T A;  3BTA A;  1R8N A;  1BLA A;  1PUM B;  3FFZ A;  3NBD A;  3VT0 A;  1SR4 A;  4ZBV B;  4G6J A;  3ZXD A;  1TWE A;  4Q9G A;  2ZR1 B;  3VT1 A;  4IQP A;  2KH2 A;  1QXM A;  2FGF A;  2VXR A;  4IYB A;  4I4U A;  4I7I A;  3O4O A;  1R8O A;  1G82 A;  3N7J A;  4LO7 B;  4OAI Z;  21BI A;  3I2A A;  1IRA X;  2E4M A;  3BAG A;  3OGG A;  5FZY A;  3AKH A;  3CA4 A;  3FJK A;  1A8D A;  4X3A A;  5BP5 C;  4OW4 A;  4P6A A;  4N7R A;  3AJ5 A;  3O4C A;  4AN6 A;  2NYY A;  4HJJ A;  4Z8S B;  1ISY A;  3CA0 A;  3RTI B;  4LO7 C;  1AFC A;  2LIQ A;  3D7W B;  3HOM A;  5BQU A;  4DEP A;  4IY8 A;  4NXU A;  1FV2 A;  3VEQ A;  3IM7 A;  2MC2 A;  1PC8 B;  3BRF A;  1JT4 A;  1D0H A;  2FO1 A;  2VSE A;  1BA7 A;  1F31 A;  2K8R A;  4XJE A;  3Q7X A;  5CFT A;  1YYN A;  1E0O A;  4I4Y A;  4I8M A;  4L4H A;  3HAL A;  3OJ2 A;  3ZXG A;  3WO3 A;  1S0E A;  2R9K B;  3R4S A;  2D1Z A;  4WQL A;  3CAH A;  1W3A A;  4LEW A;  3HMY A;  4K97 A;  4ISQ A;  3K1X A;  1T4Q A;  4I0Y A;  4OAF A;  1SR4 C;  2Y9X E;  3O5W B;  4L4I A;  4G6M A;  3BRG C;  3A23 A;  3F1R A;  3KMV A;  5B2H A;  4G9N A;  2GA9 D;  1BAR A;  3AH1 A;  4ZFW B;  4USP A;  7I1B A;  4I1B A;  4J2Y A;  4ZLB B;  4GOY A;  4J2K A;  3A22 A;  4IY9 A;  4KEK A;  5F8Y A;  5JMC A;  1V6V A;  1IHK A;  1XHB A;  3FJD A;  1Z2V A;  4X39 A;  3V79 C;  3FJ9 A;  3I29 B;  1YF8 B;  1HKN A;  1ILR 1;  1YTO A;  1Z4S A;  4WOY A;  1BAS A;  3FJI A;  1IOB A;  1SZ6 B;  2F8X C;  4IHZ A;  4EFQ A;  1DQO A;  4LO2 C;  3PUB A;  1TOO A;  3V0B A;  4O67 A;  3BAO A;  1TP0 A;  1HWP B;  1YXW A;  4KEJ A;  2B4V A;  4MKP A;  3ILA A;  4OAG A;  3CU1 B;  4JKX B;  1MD6 A;  3O44 A;  1EV2 A;  1AVW B;  4D0Z A;  2GZB A;  2D24 A;  3FUQ A;  2E4M C;  1EYL A;  2AFG A;  4I4P A;  4ISR A;  4XFU A;  2K43 A;  3FJA A;  4LEY A;  4P0J A;  1J0S A;  4EFP A;  3H6S E;  4I6I A;  4GP0 A;  4MZH A;  3FGM A;  1S0L A;  2ET2 A;  1I1E A;  3FJC A;  1JQZ A;  4LO1 A;  4XFS A;  4IZX A;  3Q7W A;  4A7Y A;  1II4 A;  1YBI A;  3AKI A;  1BLD A;  2VLC A;  3RSJ A;  1XYF A;  3LTQ A;  4X38 A;  3VSZ A;  3WO2 A;  2GAF D;  1ISZ A;  1QQL A;  5FNW A;  3VSF A;  1G9A A;  2L5X A;  3RTJ B;  3UJ4 A;  1NUN A;  2M49 A;  1Q03 A;  3POK A;  2Q9X A;  4ZA3 B;  4QC4 A;  4OEG A;  1M16 A;  5DUY A;  1FQ9 A;  2DRY A;  8I1B A;  3AKG A;  4JRA A;  4OWJ A;  4LO3 C;  5BQU C;  1AVU A;  1S0C A;  1K5U A;  4OWL A;  4I96 A;  1KNM A;  1IT0 A;  3ERC C;  3MCR A;  2ZQO A;  4F83 A;  3AH4 A;  4USO A;  3VUO A;  2QYI B;  2GO2 A;  5BOW A;  3NKU A;  4R6U B;  2D43 A;  3T8S A;  3IM6 A;  4I4O A;  3BX1 C;  3VWC A;  1HWO B;  2Q3N B;  2NP0 A;  1BFG A;  4QD2 B;  4FGF A;  2D7R A;  1QQK A;  2F2F C;  4K9A A;  2MIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...