4M2YA

Structure of human dna polymerase beta complexed with 8-brg as the template base in a 1-nucleotide gapped dna
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
325
structure length
319
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 106
structure length 319
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m2yA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m2yA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m2yA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m2yA03
1TK5A 1B22A 4UQGA 2XCAA 1BGXT 4DQPA 4UB1A 4X4UA 4FO6A 2C22A 1SL1A 3Q8SB 4QZAA 3EPGA 1R89A 2PI5A 3UQ2A 1Q78A 1DGSA 4Z6DA 1DOQA 4FS1A 5HRBA 4BWJA 4YXMA 3PW4A 3MABA 1ZQUA 1NKEA 5DBCA 2NRZA 5KFIA 3RJJA 9ICQA 5HRKA 5KFXA 7ICRA 1JXEA 1K1QA 1ZYQA 5DKWA 4EP7A 3UXOA 7ICOA 4UB3A 8ICYA 3LDAA 5DB9A 2FPMA 3ZD8A 5DG9A 3MDAA 5TZVA 3T5KA 4X4QA 1KRPA 1MSWD 1WOTA 1NK4A 9ICWA 2DPJA 5IIJA 4LT6A 4FHXA 5D4BA 4RNOA 1U45A 5J2DA 1U4BA 3NYBA 1S76D 4RNMA 3PNCA 3GIMA 3TAQA 3K75D 3THVA 4XQ8A 5DDMA 4KLQA 8ICVA 3HP6A 4ELVA 4R65A 5L1IA 5DB8A 2NRKA 4ED0A 4MF2A 4QW8A 1FA0A 4Q45A 3QZ8A 4GC7A 2ZTEA 4X5VA 1AROP 2J6TA 5KFVA 9ICUA 2HW3A 4I27A 4F3OA 1ZQZA 1S77D 1JQRA 1UEUA 3C2MA 2HHUA 4C8LA 4M9LA 4XA5A 2ZH9A 2W9AA 5KFCA 4C8OA 2BE3A 2W9MA 1T4GA 2VA3A 1KSPA 3JZ0A 4PGXA 5HRLA 4QZIA 1A77A 1ZJMA 4E7XA 2BQ3A 5KFQA 1HUZA 1YLQA 5HC9A 1UT8A 4NLGA 3N97B 3AQNA 4GXIA 4JV1A 1NKBA 4X4VA 2R8HA 4K4IA 4LZDA 3RJIA 4J9KA 3JPNA 5KT2A 3HW8A 1X9WA 1ZQEA 5HMMA 1N48A 5DQGA 2FPKA 4UAYA 4B9TA 4WC7A 4ECSA 1UA1A 5KG5A 8ICQA 3GDXA 3AQLA 3M9MB 2LYHA 4IQTA 7ICNA 4J9RA 3EW9A 2OWOA 3HJ1A 4FHWA 3PW7A 3PX4A 2BQUA 4WC4A 2F1JA 4ED6A 2JEGA 2ASDA 5DDYA 1BPZA 5KG1A 3ZDDA 3HPOA 2NRVA 1XS9D 2BDPA 2ZTCA 5KFGA 3SYZA 1N56A 2A1JB 1NK8A 1CUKA 1V9PA 3UXPA 5DQIA 1S0NA 2UVUA 7ICFA 3H37A 2DRBA 1ZQQA 4QWEA 1L3UA 9ICSA 4FH3A 4P4PA 3TFRA 1NKCA 7ICLA 4JWMA 3B0XA 4NM1A 4ECWA 5KFFA 3C23A 1SL0A 4R63A 3BQTA 4NLNA 2KZ3A 1HJPA 4UD5A 4Z6EA 4DL4A 4AT9A 4EBJA 1VFGA 5L1KA 4MFCA 4RQ8A 3T5LA 4F92B 4IQVA 3SZ2A 5J0SA 4J9OA 2BQRA 2C2EA 1HUOA 2HHTA 8ICZA 1JMSA 1L3VA 4F5NA 1TFYA 3Q8PB 3GV8B 2A1JA 3MGHA 4DSJA 2M2TA 9ICVA 1RXWA 3HX0A 4HYKA 4TUQA 3LWMA 3BJYA 3AU2A 2FLLA 4DQSA 3OSPA 5HHIA 4R8UB 4DSFA 4RQ7A 8ICFA 5KFPA 3M9OB 3JPOA 3HWTA 3H8WA 1T8EA 2BGWA 5J2HA 5KTQA 4DLEA 3AU6A 4M04A 1ZQYA 1KFDA 2Y1JA 2BCSA 1QSLA 2JEIA 2ZHAA 5DQHA 4RUAA 4ED1A 3RB6A 4P4OA 4RPXA 4X4RA 4UBCA 4RWNA 2JZBB 3JPTA 1ZQMA 1KLNA 7ICJA 1NOMA 4O0IA 4EEYA 4PPXA 9ICFA 4BWMA 4DL6A 7ICPA 1TFWA 3HT3A 3H4BA 4ED3A 4RWPA 4I2GA 1MIVA 2M2VA 4EBDA 1IXRA 2XGPA 2I9GA 4DSLA 4KLFA 4PGYA 3H39A 4R8UA 5EWFA 4DQRA 1JN3A 4MF8A 2PFQA 3IM1A 4F4WA 3Q8RB 5KFYA 2PBEA 1NK6A 3AQKA 3H3AA 2ZJ5A 4UB4A 4B9SA 2R8GA 4DFMA 3Q8QB 2KN7A 5KG6A 1TV9A 4I2IA 2UVWA 3RB4A 4ATBA 4YD2A 2R8JA 4YG2A 2DFLA 3RJFA 4I2CA 4O9MA 4PHAA 3V7KA 2BHNA 2ZUCA 5KT7A 3WFOA 4Q44A 1R8CA 3TANA 3H4DA 5IINA 4YVZA 2C28A 4R66A 3LWLA 4J9LA 1DK2A 2ZHBA 4LVSA 3OVSA 1BPYA 1F5AA 3C1ZA 4YFKA 8ICIA 4RT3A 5CR0A 3PO4A 4DL7A 4NLZA 4ED2A 2AQ4A 4WC1A 3G6VA 1XSPA 1KFSA 9ICPA 3SI8A 4M2YA 5DB6A 5KT6A 1BVSA 1U49A 5DECA 2WTFA 1ZJNA 8ICPA 2VANA 1SKSA 3ZDAA 4F2RA 1VJ7A 4EYHB 3N4MB 4DL3A 2ISPA 4DFKA 2P6RA 1ZQVA 2ZUBA 1KDHA 2ZH4A 4F93B 4Q8FA 2O1PA 3HIYA 4NY8A 4F5OA 3M9NB 3V6JA 4TQSA 3JPRA 4B9VA 3MFIA 4O3QA 1ZQJA 4UD4A 1XO1A 2IMWP 3MR2A 4I2EA 3RJGA 3PR5B 1KFTA 1NJZA 1ZQKA 4BDPA 4F5QA 2IA6A 7ICSA 2FPLA 5CWRA 4WC6A 1R8AA 4KLTA 1PZNA 4ED8A 2AGPA 5C5JA 3GILA 4IQWA 1TAUA 3GIIA 3H7IA 9ICNA 3KHLA 4DOAA 4I2DA 8ICJA 4EBEA 4FHYA 1Z3EB 1RYRA 4K4GA 1X9MA 3PR4A 2XO7A 4DO9A 4J9PA 4GXKA 1TK8A 4KLGA 2M2UA 2ZUDA 5KT4A 3UXNA 3LK9A 4I2BA 5J0WA 2XC9A 4KITB 1ZQOA 4O5KA 4M9HA 1XSLA 4JK1A 2HHVA 5CJ7A 3M8RA 4EYIB 4DL2A 2NRTA 3KHHA 2DPIA 2V4RA 4ECYA 3TFSA 3C1YA 2XY7A 4YXJA 4PHPA 4RZRA 5KFDA 4MEXA 4MFFA 3E2EA 1TK0A 7ICMA 4M9GA 4Z6CA 4MEYA 3LQCB 2H5XA 4RT2A 2AGQA 3Q8MA 2BCUA 2ATLA 4JWNA 1DK3A 2HHQA 5IILA 4IRKA 2ZH7A 3OHBA 2FLNA 4QZCA 5HNKA 2ZJ8A 4FHVA 4YD1A 3OJUA 4RQ4A 3PMLA 3SV4A 5J2BA 1RYSA 3PO5A 3AUOA 1BPBA 4RQ6A 2VA2A 4AT9B 4ED7A 4M0AA 5KFAA 5J0UA 1XU4A 1D9DA 1SZPA 3L9DA 4ECVA 4NKTA 1RPLA 5DGAA 4GLXA 2PI4A 4RQ1A 4IR9A 3TQ1A 2JEFA 4I2HA 4O3RA 8ICXA 2FLPA 4UAWA 8ICAA 1D8LA 4GXJA 5KFBA 1BNOA 3PY8A 4M47A 2AQ0A 4QWAA 3ISCA 3JPPA 1ZQBA 3KHGA 2DRAA 2KP7A 7ICTA 9ICRA 4DS4A 1ZQWA 4DF8A 3BQ1A 1S0OA 2ISOA 1S0VA 2MAXA 1SKWA 4BXOA 1XSNA 1CEZA 1T7PA 5EWGA 3OV7A 3V7LA 3QEAZ 4JV0A 2BCRA 4KLOA 4YQWA 4O3PA 1RZTA 2ZH3A 1L3SA 1XWLA 3UPSA 3RTVA 1ZQRA 3RH5A 5HMLA 4UB5A 3MGIA 5KFKA 3PVXA 4TUSA 1NK7A 3BDPA 5J0PA 4KLDA 1QLNA 2NRXA 1WCLA 1MQ2A 4F4KA 3GV7B 4PH5A 4QZ8A 4DSEA 2AJQA 5HREA 3C2KA 4WC0A 2KFZA 4WBYA 4I2FA 4RU9A 2XCPA 4TURA 3V6KA 2XY6A 8ICWA 4KLSA 5EWEA 3H8SA 5EOZA 4MFAA 2IBKA 4DQIA 3T5JA 5J2JA 8ICSA 7ICVA 2ZH2A 5J2IA 4NM2A 3RJHA 4ATBB 2DR7A 2HHWA 5KG3A 3RB3A 9ICAA 4WC5A 1X2IA 4CCHA 4QZ9A 9ICOA 5KFNA 3MFHA 7ICQA 1QTMA 5KFHA 3C5GA 1UEVA 1MQ3A 4E80A 3OUYA 3T3FA 1ZQIA 2W9CB 4O3SA 1NJYA 5J2EA 4FS2A 3FYHA 2ASLA 1UA0A 2P66A 3ZDBA 2P6UA 4M6WB 2UVRA 2KZMA 2W9BA 3NTUA 2V9WA 3G6XA 4I2AA 1QSYA 5HHHA 5J0OA 4JUZA 1SKRA 2J6UA 4RPYA 1A76A 3K4GA 3V6HA 5DLGA 4F5RA 3MBYA 4DS5A 4DQQA 1LB2B 4XRHA 5F9NA 4DOBA 3WFQE 4QZHA 1KEJA 4S3NA 3RH6A 3QEBZ 4AT7A 3NGDA 5DBBA 4DFJA 4YCXA 4RQ5A 1LV5A 2RDIA 2FMQA 3RR8A 3TI0A 4KLMA 3IHQB 2W9CA 4XQ7A 1MIYA 9ICGA 3JPQA 4DSKA 3H38A 2ZH5A 2HHSA 1ZQCA 2HVIA 4XUSA 4M6WA 2DR8A 4YR2A 1UT5A 3OHAA 5L1LA 4YR0A 1MC8A 9ICHA 5BPCA 1XC9A 3SV3A 2M9NA 3ORYA 4B9MA 5HRDA 1WCNA 3C2LA 4M5DA 2IHNA 1TKDA 1S97A 1NZPA 1ZQAA 4I29A 8ICCA 4WBZA 5HR9A 4WC2A 4KLEA 4ECXA 2UVVA 8ICMA 2ZTDA 5J2AA 4J9SA 3RRGA 7ICHA 1ZQNA 3OJSA 2HHPA 4X4NA 5DEDA 4LZGA 2FMPA 5J2FA 4YMNA 3PW2A 5CA7A 1S0MA 1NJXA 1Z00B 3RJEA 7ICIA 1V4AA 4I2JA 4QZGA 4F2SA 5IIKA 4DF4A 3KTQA 5D49A 5IIIA 3MR5A 2XY5A 5KFZA 1BPEA 3QE9Y 5J0QA 3WFSC 4NXZA 4ECZA 2HHXA 2NRWA 3ETLA 4BGDA 9ICCA 5KG2A 4ZH4A 4ECRA 4Z6FA 3BQ2A 8ICLA 4QZDA 1D9FA 1KTQA 1ZETA 2BPFA 4K4HA 4NKUA 2MUTB 2PFPA 5HRIA 1S10A 2ZH6A 2DVIA 5CP2A 3PW0A 4TUPA 4UBBA 5HP4A 4C8KA 5KFOA 4FBTA 4X4OA 5HRHA 4RWOA 1Z00A 3QZ7A 4E0DA 2PFOA 4KLUA 1Y88A 2F1IA 4KN7A 3OSNA 3M8SA 1R8BA 2DR5A 4QWCA 3C21A 3WFRE 4RQ3A 3Q8KA 5KT3A 2ZJAA 4DL5A 2IHMA 3C66A 2DR9A 9ICJA 5IIMA 2AGOA 5J0TA 2HVHA 4EBCA 4F50A 4P2HA 5BOLA 8ICOA 1PX5A 4RQ2A 2MUTA 1ZQGA 1ZQXA 3ISBA 4IRDA 4EBKA 2JEJA 3GQCA 4X0BA 4PHDA 8ICEA 3PV8A 2GWSA 2XGQA 3ZD9A 2Y1IA 1TVAA 1KNYA 3G6YA 4B9UA 8ICBA 4DFPA 5F9LA 5HRGA 2ID1A 3JPSA 5KFWA 3OVAA 1BPDA 4BXOB 5J0RA 5JUMA 3OVBA 1JXLA 1JIHA 5KG4A 1ZQTA 2W8LA 4X0AA 4QZFA 1NK0A 3H8JA 4J9MA 1ZQPA 8ICNA 5KG7A 2RDJA 3C18A 4RWQA 4IQUA 2F1HA 2Q0ZX 5KFSA 1L3TA 4DLGA 5J2CA 9ICMA 3UPQA 1BNPA 4YR3A 4FH5A 4DEZA 4QWBA 5DB7A 5J0YA 4EZ9A 4GC6A 2KZZA 4UAZA 5CHGA 4FBUA 3EZ5A 4IR1A 5KFJA 1RXVA 4O5EA 7ICKA 2BPGA 4ELUA 3UQ0A 3RAQA 4Q43A 2V4QA 1NO5A 2BKEA 4NLKA 4WCWA 4WC3A 4X4TA 5CB1A 3WFPA 9ICKA 2PXIA 2BR0A 5DBAA 2BCVA 5KFRA 3TARA 1U47A 4B9NA 3OGUA 2C2DA 2B21A 5KG0A 3ISDA 1UETA 4AT8B 9ICXA 2ZH8A 2VA8A 4IG8A 5J0XA 3FDSA 3T5HA 1S9FA 3RR7A 4IRCA 9ICBA 5KFMA 1MIWA 3OUYB 4RUCA 2Q66A 4G3IA 2R8KA 4PHEA 2ALZA 5KFLA 1TAQA 4RPZA 3RH4A 7ICEA 4E8FA 3KHRA 3Q8LA 2W9BB 4QZBA 2BPCA 8ICGA 1COOA 4O3OA 8ICRA 9ICIA 4C8MA 1NK5A 3GFKB 4J9QA 4ELTA 4Q8EA 7ICUA 3BQ0A 4M9JA 4YMMA 3MR3A 3RAXA 2W8KA 2KTQA 5HRFA 3EPIA 1B43A 4I28A 8ICTA 5DLFA 1L5UA 4AT8A 4P4MA 4F5PA 1SL2A 4AT7B 1T3NA 2ASJA 3H40A 4J9NA 3PX0A 3RBDA 1U48A 4PGQA 5DG7A 4C8NA 4R64A 5KFEA 3GV5B 3GIKA 4F4YA 4EZ6A 1JAJA 4KN4A 4DSIA 4DOCA 4YN4A 2O5AA 3MDCA 1C7YA 9ICTA 8ICKA 3RJKA 4QWDA 4UB2A 1X9SA 4KTQA 3PX6A 4QW9A 3RRHA 1ZQSA 4X4PA 4ECUA 1OU5A 3PW5A 5KFUA 5F2VO 7ICGA 4KLJA 8ICHA 5J2KA 3GIJA 3HJ4A 1NK9A 2FMSA 4B9LA 4FHPA 2AU0A 3EYZA 4QZEA 3V72A 1K1SA 4DWIA 9ICEA 3RBEA 9ICLA 4X4SA 4ECTA 1ZQFA 5D46A 4KLHA 2RFFA 5L1JA 1EXNA 4F4ZA 3ZDCA 3ZDEA 2ZH1A 5KFTA 3AQMA 3JYYA 1U9LA 1H38A 1JX4A 3MR6A 4M9NA 3B0YA 4RNNA 2M2WA 2BCQA 1Q79A 2KFNA 3TAPA 3C5FA 5L9XA 1D8YA 2J6SA 8ICUA 5DGBA 1ZQLA 3PMNA 4YP3A 3EWAA 2R8IA 4ECQA 4KLIA 4O5CA 4F8RA 1NJWA 1ZQHA 5DG8A 4TQRA 2PFNA 1QSSA 5IIOA 4JV2A 2C2RA 4KLLA 2JZBA 5J29A 3RB0A 4RQ0A 4F4XA 1TFRA 2I1QA 4F91B 5BOMA 4O3NA 5J2GA 4YMOA 4KMUA 1BPXA 5KT5A 1IM4A 3V7JA 1ZQDA
chains in the Genus database with same CATH superfamily
1TK5A 2XCAA 4DQPA 3L3FX 5B3PA 4FO6A 1SL1A 4QZAA 5ALQA 3EPGA 1FEZA 4PL1A 2WF5A 3UQ2A 2EWRA 4FS1A 4BWJA 3ICXA 3MABA 3RJJA 1P7DA 1K1QA 3ONNA 4EP7A 1L7OA 3UXOA 7ICOA 4USAA 2FPMA 5DG9A 3T5KA 2YX8A 9ICWA 3WKBA 4FHXA 1U4BA 1SV0A 4RNMA 3PNCA 3NVWA 8ICVA 5DB8A 1RDFA 3RFAA 1FA0A 2EAMA 4QW8A 4KM5A 4Q45A 3AMZA 4GC7A 4NXTA 2HW3A 4F3OA 3C2MA 4Y2YA 5CFUA 2GA9D 4PGXA 1A77A 3SAGA 3MGVA 1HUZA 4NLGA 4GXIA 4JV1A 4K99A 1L7NA 5KNIA 3RJIA 3JPNA 3PHZA 1QQ7A 2ZIUB 5B66U 4ECSA 5ALDA 8ICQA 4IQTA 3HJ1A 3PX4A 2F1JA 4ACOA 2JEGA 2ASDA 1BPZA 2DF4B 3HPOA 2ZTCA 2HDOA 3SYZA 1NK8A 2UVUA 3H37A 2DRBA 1ZQQA 4QWEA 4P4PA 4LEZA 3AN1A 4ECWA 2ZIUA 2DL0A 4UD5A 4EV6A 5L1KA 2BQRA 2HHTA 1ZD3A 5J0SA 2LM4A 1JMSA 5ALXA 3SR6A 4F5NA 1TFYA 1NNLA 2M2TA 3MGHA 3NRZA 3HX0A 4HYKA 1URJA 3M9OB 1T8EA 4GIBA 5KTQA 4DLEA 2DUYA 2LPEA 5DQHA 4RUAA 4EEBA 4UBCA 3JPTA 2W54A 2GO7A 4WH5A 1NOMA 4EEYA 1TFWA 1PK1B 1FFVA 4RWPA 2E8NA 2KEYA 3QUCA 5ALFA 1J2MA 3F5AA 2M2VA 3QNMA 4EBDA 1IXRA 5B5EU 5EWFA 2PBEA 1JN3A 4UAUA 3Q8RB 1SWWA 3H3AA 3Q8QB 2KN7A 4YD2A 4Y2RA 4YG2A 2DFLA 2ZUCA 3H4DA 3SAHA 4K9AA 4R66A 4J9LA 1DK2A 2ZHBA 2ZXHA 4YFKA 3PO4A 2AQ4A 4WC1A 1KFSA 2Y0SC 3SI8A 2P35A 3C29A 2WF9A 2YB4A 4A8EA 2VANA 8ICPA 4CNQA 4DFKA 1ZQVA 1KL9A 1KDHA 4Q8FA 2O1PA 3JPRA 3H0LB 1ZQJA 4UD4A 2WHEA 1KFTA 1ZQKA 3I76A 4BDPA 4F5QA 7ICSA 2FPLA 1R8AA 4KLTA 1PVQA 5J8YA 9ICNA 3H7IA 3K1RB 5AKZA 4EBEA 1RYRA 4NL9A 4GXKA 3N7SC 2ZUDA 5D62A 1ZQOA 2HHVA 2DPIA 4U6PA 2W3RA 5KFDA 4MEXA 4Z6CA 2LM1A 2XIDA 2H5XA 2AGQA 3Q8MA 1DK3A 4JWNA 1F5SA 2A3VA 5HNKA 4CF3A 4YD1A 1HIWA 3PMLA 3OJUA 3SV4A 1A0PA 2VA2A 1WYGA 3K7DA 4M0AA 1RPLA 5DGAA 4GLXA 4IR9A 4O3RA 2E8OA 4PZOA 2F2AB 4M47A 2BBHA 3ISCA 3JPPA 1ZQBA 2ISOA 4DF8A 1XO0A 1S0VA 2MAXA 1SKWA 1T7PA 3QEAZ 1RZTA 2R18A 3RTVA 3C28A 3PVXA 5KFKA 2XVTA 4KLDA 4Y2XA 4CF5A 2KMDA 5HREA 3C2KA 3NVOA 4WC0A 4X4RA 8ICWA 4TURA 2XY6A 3H8SA 5EWEA 5EOZA 8ICSA 4NM2A 2HHWA 9ICAA 4QZ9A 9ICOA 4OO1J 5KFHA 1MQ3A 1ZQIA 2W9CB 4O3SA 5J2EA 2ASLA 2P6UA 2KZMA 4N7RA 1SKRA 3KZXA 1A76A 3K4GA 3V6HA 3MBYA 2HBMA 2YMMA 5F9NA 3B9JA 4HX0A 1KEJA 3M6KA 3N28A 2ODGA 5AI9A 4KLMA 1SWVA 3IHQB 3SEIA 2W9CA 1ZRNA 4DSKA 1Q3UA 2HVIA 1T94A 4YR2A 5BPCA 3SV3A 1SGGA 2M9NA 3ORYA 3D2SA 4OD0A 8ICCA 5HR9A 4ECXA 2UVVA 8ICMA 2ZTDA 2HHPA 4X4NA 4YMNA 1S0MA 7ICIA 1V4AA 3I1YA 2D8CA 5AKGA 3KTQA 2KJ9A 1BPEA 1X6JA 3UMCA 2OH2A 9ICCA 4Z6FA 4BUGA 8ICLA 4QZDA 1SZHA 4K4HA 4WOYA 4WQKA 2YY6A 2RRDA 2FI1A 5JTIA 4E0DA 1Y88A 4CE6A 1R8BA 2W04A 2LHTA 2KICA 2IHMA 2AGOA 4C4TA 4RQ2A 1ZQXA 2CN1A 3PV8A 3ZD9A 2W7PA 1TVAA 1KNYA 3JPSA 1L8OA 4EEKA 5JUMA 1JXLA 1WWUA 3C18A 1ZQPA 4J9MA 4IQUA 2F1HA 1J2NA 3ED5A 5GTIU 4QIWC 4DLGA 2DQNB 9ICMA 3F53A 3AQFA 2K4PA 4UAZA 4FBUA 3EZ5A 4O5EA 4ELUA 1L7MA 3UQ0A 3RAQA 2V4QA 4NLKA 5CRXA 5AM4A 2BCVA 5KFRA 3TARA 2B21A 1N5WA 1UETA 9ICXA 4JMUA 2VA8A 5J0XA 2Q66A 3MC1A 5KFLA 3RH4A 4E8FA 2I5HA 2W43A 4QZBA 8ICGA 2B4VA 7ICUA 3HKZF 3KKAC 4YMMA 3MR3A 2HMXA 3RAXA 2W8KA 1N2XA 5DLFA 4P4MA 4AT7B 2EAPA 2ASJA 4J03A 4EENA 4C8NA 1NI3A 3GV5B 1V85A 2LYAA 1JAJA 1MA7A 4YN4A 5ALNA 2O5AA 3RJKA 4QWDA 4UB2A 2AXTU 3PX6A 4X4PA 5ALHA 4ECUA 1OU5A 2OXOA 3AL0B 3CNHA 1NK9A 3HJ4A 1K1SA 4KLHA 3QU5A 3QUQA 3ZDEA 5KFTA 3JCFA 2DKZA 4B6JA 2YMQA 2J6SA 8ICUA 2R8IA 2PMZC 2WB1F 1IIPA 5A0LA 1N62A 1FFUA 5J29A 2W7OA 1WUDA 2I1QA 3L4PA 2D6FC 5BOMA 4KMUA 1ZQDA 3I28A 4BX9C 1BGXT 1R89A 2PI5A 3NASA 4YXMA 2FJ6A 2NRZA 5KFIA 2CRXA 3OWGA 3LDAA 2RHFA 5DB9A 3MDAA 4X4QA 3D2NA 1X6IA 2F8LA 5K4LA 2E8MA 1U45A 1JROA 3THVA 3TAQA 4XQ8A 5DDMA 4ELVA 4R65A 5ALWA 3QZ8A 4X5VA 2ZTEA 1ZQZA 1S77D 4I0UA 2VJ4A 4C8LA 4M9LA 4XA5A 2ZH9A 1OXJA 4C8OA 2BE3A 2W9MA 2VA3A 3JZ0A 2K4HA 1ZJMA 2CPRA 4P0QB 3R9KA 4CGZA 5HC9A 1UT8A 3N97B 5AI0A 2B56A 4LZDA 2GH1A 5KT2A 3HW8A 1X9WA 3GDXA 2KSOB 7ICNA 1Z4NA 3AM9A 3EW9A 1DXSA 3PW7A 5DDYA 3ZDDA 1XS9D 1N56A 3UXPA 5AIBA 1SV4A 3TFRA 3B0XA 5AM2A 2QB1A 4R63A 4K97A 2NO5A 2KZ3A 4NXUA 2KSOA 5AKKA 4DL4A 3WK9A 2KHQA 4C4SA 2E1EA 3SZ2A 8ICZA 4DSJA 4TUQA 3BJYA 3AU2A 2FLLA 3H8MA 5AM0A 3OSPA 5HHIA 2W11A 1TAMA 4RQ7A 5KFPA 2BGWA 4M04A 3QUTA 1PVPA 3RB6A 4RPXA 7ICJA 4LJXA 4PPXA 4G9BA 3H39A 4DQRA 4F4WA 2ZXIA 3WKDA 4DFMA 2XI9A 5KG6A 4UB8U 1TV9A 2BHNA 4FE3A 5KT7A 4Q44A 4YVZA 3LWLA 4LVSA 3KBBA 5AI6A 1RQLA 2IOFK 5CR0A 4DL7A 3N7PD 4UAVA 5ALLA 9ICPA 5DB6A 5KT6A 3IV6A 2W3SA 4FZNA 2WTFA 3QU2A 4NLCA 3M6ZA 4F71A 2ZUBA 2ZH4A 2IUBA 4NY8A 4TQSA 4O3QA 1XO1A 1M6YA 3PR5B 1NJZA 1PZNA 5C5JA 3GILA 4IQWA 1ZD4A 3KHLA 5CHEA 3NVYA 5KL8B 3PR4A 1TK8A 5JTGA 2M2UA 4K8VA 5J0WA 3TADA 4EGWA 4C4RA 4JK1A 3M8RA 2XY7A 4PHPA 4OJ6A 1SV0C 1N5XA 1ZQ1C 4M9GA 2BCUA 4NLBA 2ATLA 2EAOA 2A19A 2ZH7A 2FLNA 4QZCA 3UM9A 3HILA 3AUOA 1BPBA 3WK8A 4ED7A 3ETRA 5KFAA 5J0UA 1XU4A 3L9DA 4JB3A 2WF7A 4RQ1A 2JEFA 4UAWA 1D8LA 5KFBA 2Z7JA 2AQ0A 3EF2A 4QWAA 4LEYA 3BQ7A 4DS4A 1ZQWA 2RQ5A 1XNSA 3OV7A 4JV0A 4KLOA 4YQWA 4O3PA 2ZH3A 1QCKA 4OJLA 3RH5A 2K60A 3BDPA 1S8OA 4F4KA 4EX6A 4PH5A 2D3DA 1UQVA 4RU9A 3V6KA 4KLSA 1Z1VA 2ZH2A 4Y2UA 5J2IA 3RJHA 1L6NA 4CCHA 5KFNA 2QARB 2RP5A 3MFHA 3OUYA 3T3FA 4FS2A 2EZZA 2K8BB 3FYHA 5TISU 2W55A 4M6WB 2UVRA 4Y2PA 3NTUA 3WKAA 1QSYA 2J6UA 4RPYA 1LB2B 1O08A 4DOBA 3NWIA 3WFQE 4QZHA 4QJFB 4AYBC 2QARA 5DBBA 4DFJA 1LV5A 5EE0A 1MIYA 3JPQA 3H38A 1ZOLA 1ZQCA 4M6WA 5L1LA 1WCNA 1TKDA 1NZPA 1ZQAA 1PVRA 4WBZA 4KLEA 4J9SA 5AK4A 4LZGA 2Q4TA 1LKYB 4QZGA 4F2SA 5IIKA 4DF4A 5D49A 5ALJA 3F2BA 5J0QA 3UMBA 1KKXA 3WFSC 4NXZA 4ECZA 2HHXA 3ETLA 4BGDA 5AK3A 3BQ2A 3PSTA 1D9FA 1KTQA 2BPFA 3HRDD 4NKUA 2HBLA 4OAGA 2DVIA 3CP8A 3PW0A 2PFOA 1LKYA 3OSNA 4KN7A 3M8SA 2DR5A 3C21A 1B0XA 2KOBA 3Q8KA 1RM6C 4DL5A 3C66A 1GO3F 1UCVA 9ICJA 5IIMA 4P2HA 3AQEA 3EUB2 4Y2QA 1ZQGA 4EBKA 4X0BA 2JEJA 4MHVA 4X4VA 2G5HB 2GWSA 2Y0SF 3G6YA 5HRGA 2ID1A 1BPDA 4NXVA 1ZD2P 1ZQTA 2W8LA 4QZFA 3H8JA 1A6SA 5KG7A 2YN4A 1L3TA 5KAIU 2HSZA 3OTQA 3UPQA 4FH5A 4YR3A 5DB7A 4QWBA 4GC6A 2KZZA 5KFJA 2BKEA 4WCWA 4WC3A 2WFAA 5CB1A 2PXIA 3QUBA 3OGUA 4AT8B 3ERCC 3T5HA 9ICBA 5KFMA 5AKXA 2HBJA 2LKYA 4PHEA 2ALZA 1TAQA 8ICRA 4C8MA 1NK5A 3GFKB 4ELTA 2DGZA 5HRFA 1PK3A 4AT8A 3F5EA 4F5PA 3RBDA 4PGQA 5DG7A 4R64A 5KFEA 4DOCA 4KX3A 1C7YA 8ICKA 1X9SA 4QW9A 7ICGA 4JLXA 1FIQA 5J2KA 2FMSA 4FHPA 2AU0A 4ECTA 4OJPA 2RFFA 5L1JA 3ZDCA 2ZH1A 1U9LA 1H38A 3N7RC 4C7YA 2KFNA 2BZFA 4OAHA 4OJOA 3ER8C 1T3QA 2JH7A 2G06A 4NXWA 1NJWA 1ZQHA 3QYPA 2PFNA 2JZBA 4K96A 4RQ0A 1TFRA 2B51A 4UASA 4O3NA 2G5IB 1IM4A 2K89A 4UQGA 2G09A 4X4UA 2OCEA 2QKQA 1DOQA 3PW4A 1ZQUA 5HR7A 5DBCA 2JXJA 9ICQA 1IG6A 5HRKA 5KFXA 7ICRA 1JXEA 8ICYA 1KRPA 4OAFA 1MSWD 1NK4A 4LT6A 2DPJA 5IIJA 4RNOA 4KX5A 3GIMA 3K75D 4KLQA 3HP6A 2NRKA 1J97A 4ED0A 3FAHA 1AROP 9ICUA 5KFVA 3BZCA 1UEUA 5AK6A 1JQRA 3L5KA 2HHUA 4OCZA 2W9AA 3MCRA 5FP0A 5KFCA 2K8CB 1KSPA 2E1FA 5HRLA 3DEEA 3DV9A 3HKZC 1NKBA 2R8HA 5L1MA 4J9KA 2QB0B 1N48A 4WC7A 1UA1A 5KG5A 2WAQC 4J9RA 4FHWA 2BQUA 4ED6A 5KG1A 2BDPA 5KFGA 1CUKA 1V9PA 1S0NA 5DQIA 1KQQA 2WF6A 7ICFA 4FH3A 2QB0A 9ICSA 1NKCA 2KKPA 4JWMA 5KFFA 1SL0A 3BQTA 1CI4A 3KKAA 3OPXA 1HJPA 4Z6EA 4AT9A 4EBJA 3IDWA 3NS1A 3WK7A 4IQVA 1HUOA 2C2EA 3CW2C 3Q8PB 9ICVA 2WB1C 1VJ5A 4R8UB 4DSFA 1WWVA 8ICFA 4QIWF 3JPOA 4K98A 5J2HA 1Z1BA 2Y1JA 2JEIA 3QU4A 4ED1A 4P4OA 4RWNA 1DRGA 1S5LU 4O0IA 4NWIA 5ALZA 4DL6A 2E3TA 4I2GA 1DGJA 1MIVA 1C20A 2I9GA 4DSLA 4PGYA 4R8UA 1VFGA 4MF8A 4C7ZA 3IM1A 2O6KA 1NK6A 4UB4A 1NZBA 2MRLA 2R8GA 2UVWA 3RB4A 4ATBA 2R8JA 2XICA 4O9MA 3V7KA 3WFOA 3HJEA 4Y2SA 3TANA 5AI4A 2C28A 4HAIA 3SQIA 3C1ZA 8ICIA 4RT3A 3NVZA 4NLZA 4M2YA 1L8LA 1BVSA 1CRXA 4UW9A 2GOLA 1U49A 5DECA 4ZOHC 1ZJNA 1SKSA 3ZDAA 4F2RA 3IG8A 1JI7A 3N4MB 2ISPA 4F93B 3HIYA 2H3FA 4F5OA 3M9NB 4B9VA 3MFIA 2IMWP 4I2EA 3RJGA 4IS7A 3WKEA 4ED8A 2AGPA 2GLEA 1VLBA 4I2DA 4RQNA 8ICJA 4FHYA 1KW4A 1X9MA 2XO7A 4DO9A 3WK5A 5CFTA 2PMZF 4I2BA 3LK9A 5AKEA 2EDUA 4KITB 3QU9A 4M9HA 1XSLA 4EYIB 4DL2A 2NRTA 3BZKA 2V4RA 5GTHU 4ECYA 3TFSA 4YXJA 3WK4A 4P0PB 7ICMA 1O03A 3LQCB 1FO4A 4RT2A 5AI8A 2HHQA 3OHBA 4FHVA 3PO5A 2DRAA 1K5OA 1D9DA 4EELA 1SZPA 4ECVA 2YTUA 2KV2A 2PI4A 5AKYA 8ICXA 2NV3A 2H3VA 2OM6A 2FLPA 3SAFA 8ICAA 4P0PA 2ZIVB 3PY8A 3GU3A 2L5YA 3KZIU 2KP7A 3BQ1A 1SXDA 1S0OA 4BXOA 5ALGA 1QQ6A 5EWGA 3V7LA 2BCRA 1XWLA 4K9BA 2EANA 5HMLA 5J0PA 1QLNA 2NRXA 1WCLA 2ZIVA 1MQ2A 3GV7B 1X9XA 4I2FA 2NYVA 5KAFU 4DQIA 3T5JA 5J2JA 3D6JA 1X2IA 1JRPA 7ICQA 2LI6A 4CF4A 2Y9TA 2P66A 2PKEA 3ZDBA 2EZYA 2BBJA 5AM1A 2W9BA 2V9WA 3G6XA 4O3MA 1ZRMA 2H3ZA 2Y9UA 4IL6U 2AHOB 5J0OA 4JUZA 4F5RA 4DS5A 2A1AA 2N1RA 3RH6A 3QEBZ 3RR8A 3TI0A 2H3IA 2ZH5A 4NV0A 4ICAA 4FFDA 1MC8A 1XC9A 5F3XB 3C2LA 3LVVA 2OYYA 2HN1A 4I29A 1Z19A 5J2AA 2HOFA 3OJSA 4US8A 2HBKA 5J2FA 3SD7A 2XY5A 5KFZA 2HI0A 3K1ZA 3FC4A 2NRWA 4ZH4A 2JHDA 4ECRA 1X40A 4US9A 1ZETA 1JUDA 2PFPA 5HRIA 1S10A 2ZH6A 2WF8A 4UBBA 2ZIWB 4C8KA 4X4OA 4FBTA 4RWOA 3QZ7A 4KLUA 2F1IA 2E8PA 3WFRE 2FE9A 2B0CA 4FO1A 4F50A 3IN5A 5BOLA 3BS7A 3QX7A 4IRDA 3GQCA 4PHDA 4M5DA 2ZIWA 2Y1IA 3GZFA 2EH9A 3OVAA 2K8AA 3TADC 3OVBA 5KG4A 4Y2JA 4X0AA 8ICNA 2F8KA 2RDJA 2Q0ZX 5ALIA 5KFSA 3ER9B 5G5GA 2HN2A 1BNPA 1GPJA 4DEZA 3E58A 4FZLA 1RXVA 2BPGA 4Q43A 4NXXA 9ICKA 5T14A 5KG0A 1IV8A 1OUQA 3FDSA 3OUYB 4IRCA 1MIWA 3PSIA 4RUCA 4G3IA 2R8KA 5G5HA 7ICEA 5EE1A 1F44A 2MU2A 3CYMA 3Q8LA 3PSPA 1QQ5A 2BPCA 1COOA 4O3OA 4Q8EA 4J9QA 2KNJA 3BQ0A 4M9JA 4EEDA 3EPIA 4I28A 8ICTA 5EE9A 2KKVA 4PJ0U 1U48A 5CEHA 4F4YA 4DSIA 4LEVA 2JR5A 3MDCA 4KTQA 2LBOA 2OHFA 1ZQSA 4U7CA 4KLJA 5AIAA 3M1YA 3EYZA 4DWIA 9ICLA 3RBEA 5AI5A 1ZQFA 5D46A 1EXNA 1COKA 3NUQA 3PSFA 3MR6A 2F77X 1VDVA 4RNNA 2M2WA 2MA1A 3C5FA 1D8YA 5DGBA 2KG5A 1ZQLA 4KLIA 4O5CA 4PZNA 2HOQA 3O0FA 5IIOA 4C0ZA 2C2RA 4JV2A 4KLLA 3RB0A 4F4XA 3A0BU 3KD3A 1KN5A 1PK1A 4F91B 4YMOA 5KT5A 5AHXA 4I27A 1B22A 3ALRA 4UB1A 2C22A 1ZXIA 3Q8SB 5ALTA 1Q78A 1DGSA 4Z6DA 5HRBA 5AK5A 1NKEA 4NJ8A 1ZYQA 5DKWA 3LVWA 4PL2A 4UB3A 4EX7A 2VIXA 3ZD8A 4AYBF 5TZVA 1WOTA 1SIJA 5D4BA 2E5SA 4Y2VA 5J2DA 3NYBA 1S76D 5J8YC 1UPHA 5L1IA 4OJ5A 4MF2A 4NL9C 2J6TA 4WJ3B 2H3QA 1RYUA 4UATA 1T4GA 4QZIA 3IG5A 4E7XA 5JRTA 2BQ3A 5KFQA 4MKPA 1YLQA 3NRWA 1UHUA 3AQNA 2JH1A 4K4IA 3WU2U 1ZQEA 5HMMA 3QXGA 5DQGA 2FPKA 4UAYA 4B9TA 3AQLA 3M9MB 2LYHA 2OWOA 2F76X 4BJQA 4WC4A 2NRVA 2JRZA 1Q46A 2A1JB 3U26A 3H0RB 1L3UA 2HOIA 2RLTA 1Q8KA 7ICLA 4NM1A 4CDGA 3C23A 1D8BA 5ALRA 4NLNA 3AEVA 2K4EA 4MFCA 4RQ8A 3T5LA 4F92B 4J9OA 1N60A 1L3VA 3GV8B 2A1JA 1RXWA 3LWMA 4DQSA 4DFDA 2KJ8A 3HWTA 3H8WA 5AKHA 3D2QA 3AU6A 1ZQYA 1KFDA 2BCSA 1QSLA 4FZMA 3VCBA 3ZI4A 2ZHAA 1HEKA 4IC9A 3FM9A 2JZBB 1ZQMA 1KLNA 1RG6A 3LYSA 9ICFA 4BWMA 7ICPA 3HT3A 3H4BA 2JV3A 4ED3A 5B3QA 2XGPA 4KLFA 2MSNA 2PFQA 2KIWA 1N63A 3AQKA 4O6AA 5KFYA 3M7DA 3F2DA 2ZJ5A 4B9SA 2KHVA 4I2IA 4I2CA 3RJFA 3QU7A 1ZD5A 2KVSA 4PHAA 3A0HU 1R8CA 5JU5A 5IINA 3OVSA 1BPYA 1F5AA 5AICA 4ED2A 3G6VA 1XSPA 2ZIXB 4GFJA 3TACB 1VJ7A 4EYHB 5ALOA 2KJ5A 4DL3A 2P6RA 5AM5A 2YMLA 3V6JA 2HCFA 3MR2A 1Q3VA 2EQYA 2IA6A 5CWRA 4WC6A 5HR6A 1B4FA 2ZIXA 1KBUA 1TAUA 2LMRA 3GIIA 4DOAA 1Z3EB 4K4GA 4F72A 4J9PA 5ALPA 3IP4B 4KLGA 1MN8A 5KT4A 3UXNA 1X66A 2XC9A 2KD1A 4O5KA 3VC8A 4OAIZ 5CJ7A 5ALYA 3KHHA 3C1YA 4RZRA 4MFFA 3E2EA 1TK0A 4MEYA 5IILA 4IRKA 2JMGA 2ZJ8A 4RQ4A 2IHOA 5J2BA 1RYSA 4RQ6A 4AT9B 4NKTA 3SENA 4JLZA 3CRXA 3WKCA 4I2HA 3TQ1A 4GXJA 1BNOA 2CXYA 2YB1A 3KHGA 1YT3A 4O67A 2KVCA 4RQMA 7ICTA 9ICRA 5C0YA 1XSNA 1CEZA 2AH5A 2DWQA 3F2CA 1L3SA 3S6JA 3UPSA 5KL1B 1ZQRA 4UB5A 3MGIA 1NK7A 4TUSA 5AKIA 4QZ8A 4DSEA 2AJQA 1X42A 4DCCA 2KFZA 5E79U 3KOOA 4WBYA 2XCPA 2QLTA 2IBKA 1SB3C 4MFAA 7ICVA 4LEWA 5AM3A 1JALA 4ATBB 2DR7A 5KG3A 3RB3A 4WC5A 1QTMA 3C5GA 1UEVA 4UARA 4E80A 1NJYA 2VJ5A 1LVHA 2WAQF 1UA0A 3H0MB 5EE3A 4I2AA 2FDRA 5HHHA 2K4IA 2VKQA 3BS5B 5DLGA 5AKLA 4DQQA 4XRHA 2YQEA 2F3NA 2W03A 4S3NA 4AT7A 3NKUA 3NGDA 2DKXA 4YCXA 4RQ5A 2ES6A 2RDIA 2FMQA 1WG8A 3UMGA 4XQ7A 9ICGA 5CFSA 2HHSA 4XUSA 2DR8A 5AKJA 1UT5A 3OHAA 4YR0A 9ICHA 3PZPA 1PUZA 4B9MA 5HRDA 2IHNA 3BS5A 2FCLA 1S97A 4WC2A 7ICHA 3RRGA 1ZQNA 4XJEA 4WQLA 2KE7A 5DEDA 2FMPA 4O68A 3PW2A 5CA7A 3E0FA 1NJXA 1Z00B 3RJEA 5D63A 4I2JA 1L7PA 4CRXA 5H2FU 5IIIA 1V38A 3MR5A 3QE9Y 1OW5A 5KG2A 4QNLA 2G07A 3CK6A 2MUTB 5CP2A 2JGAA 5ALVA 4TUPA 2ESEA 3KFUF 1SXEA 5HP4A 2KIVA 5KFOA 5HRHA 1Z00A 4AP9A 2G0AA 4QWCA 2LYBA 4RQ3A 5KT3A 2IOHA 2ZJAA 2DR9A 1ED1A 5ALSA 1YZ6A 5J0TA 2HVHA 4EBCA 8ICOA 1PX5A 4O69A 2MUTA 3ISBA 8ICEA 5ALUA 2XGQA 4B9UA 8ICBA 4DFPA 5F9LA 3WK6A 5KFWA 2GAFD 4BXOB 4KB6A 5J0RA 1JIHA 1NK0A 4RWQA 2G08A 2M0NA 5J2CA 2KK0A 1V97A 2F44A 5J0YA 4EZ9A 5CHGA 4IR1A 7ICKA 1NO5A 4X4TA 1TE2A 3WFPA 2ZG6A 2BR0A 5DBAA 1Z4OA 4B9NA 1U47A 2C2DA 3ISDA 4C80A 3NVVA 2ZH8A 4IG8A 1S9FA 4P0QA 3RR7A 5D61A 4RPZA 3J81j 1QH9A 3KHRA 2YMPA 2W9BB 9ICIA 2KTQA 1B43A 1L5UA 1SL2A 2OEHA 1T3NA 3H40A 4J9NA 3PX0A 4UB6U 1N61A 1YZ7A 3GIKA 4EZ6A 4KN4A 4KMOB 3T79A 2IOFA 9ICTA 3RRHA 1AQ6A 3PW5A 5ALMA 5KFUA 5F2VO 8ICHA 3GIJA 3SMVA 4B9LA 1F0MA 2BDUA 4QZEA 3V72A 9ICEA 4X4SA 2I6XA 4F4ZA 3AQMA 3JYYA 5ALEA 1JX4A 4M9NA 1ECWA 3B0YA 5ALKA 3TKAA 2BCQA 3RF9A 1Q79A 3TAPA 5L9XA 2DBYA 3PMNA 4YP3A 1RQNA 3EWAA 4ECQA 4F8RA 2EZXA 5DG8A 4TQRA 2B6GA 1QSSA 2NO4A 5J2GA 1BPXA 3DDHA 4Y2TA 3V7JA 3IRUA
chains in the Genus database with same CATH topology
1TK5A 1B22A 4UQGA 2XCAA 1BGXT 4DQPA 4UB1A 4X4UA 4FO6A 2C22A 1SL1A 3Q8SB 4QZAA 3EPGA 1R89A 2PI5A 3UQ2A 1Q78A 1DGSA 4Z6DA 1DOQA 4FS1A 5HRBA 4BWJA 4YXMA 3PW4A 3MABA 1ZQUA 1NKEA 5DBCA 2NRZA 5KFIA 3RJJA 9ICQA 5HRKA 5KFXA 7ICRA 1JXEA 1K1QA 1ZYQA 5DKWA 4EP7A 3UXOA 7ICOA 4UB3A 8ICYA 3LDAA 5DB9A 2FPMA 3ZD8A 5DG9A 3MDAA 5TZVA 3T5KA 4X4QA 1KRPA 1MSWD 1WOTA 1NK4A 9ICWA 2DPJA 5IIJA 4LT6A 4FHXA 5D4BA 4RNOA 1U45A 5J2DA 1U4BA 3NYBA 1S76D 4RNMA 3PNCA 3GIMA 3TAQA 3K75D 3THVA 4XQ8A 5DDMA 4KLQA 8ICVA 3HP6A 4ELVA 4R65A 5L1IA 5DB8A 2NRKA 4ED0A 4MF2A 4QW8A 1FA0A 4Q45A 3QZ8A 4GC7A 2ZTEA 4X5VA 1AROP 2J6TA 5KFVA 9ICUA 2HW3A 4I27A 4F3OA 1ZQZA 1S77D 1JQRA 1UEUA 3C2MA 2HHUA 4C8LA 4M9LA 4XA5A 2ZH9A 2W9AA 5KFCA 4C8OA 2BE3A 2W9MA 1T4GA 2VA3A 1KSPA 3JZ0A 4PGXA 5HRLA 4QZIA 1A77A 1ZJMA 4E7XA 2BQ3A 5KFQA 1HUZA 1YLQA 5HC9A 1UT8A 4NLGA 3N97B 3AQNA 4GXIA 4JV1A 1NKBA 4X4VA 2R8HA 4K4IA 4LZDA 3RJIA 4J9KA 3JPNA 5KT2A 3HW8A 1X9WA 1ZQEA 5HMMA 1N48A 5DQGA 2FPKA 4UAYA 4B9TA 4WC7A 4ECSA 1UA1A 5KG5A 8ICQA 3GDXA 3AQLA 3M9MB 2LYHA 4IQTA 7ICNA 4J9RA 3EW9A 2OWOA 3HJ1A 4FHWA 3PW7A 3PX4A 2BQUA 4WC4A 2F1JA 4ED6A 2JEGA 2ASDA 5DDYA 1BPZA 5KG1A 3ZDDA 3HPOA 2NRVA 1XS9D 2BDPA 2ZTCA 5KFGA 3SYZA 1N56A 2A1JB 1NK8A 1CUKA 1V9PA 3UXPA 5DQIA 1S0NA 2UVUA 7ICFA 3H37A 2DRBA 1ZQQA 4QWEA 1L3UA 9ICSA 4FH3A 4P4PA 3TFRA 1NKCA 7ICLA 4JWMA 3B0XA 4NM1A 4ECWA 5KFFA 3C23A 1SL0A 4R63A 3BQTA 4NLNA 2KZ3A 1HJPA 4UD5A 4Z6EA 4DL4A 4AT9A 4EBJA 1VFGA 5L1KA 4MFCA 4RQ8A 3T5LA 4F92B 4IQVA 3SZ2A 5J0SA 4J9OA 2BQRA 2C2EA 1HUOA 2HHTA 8ICZA 1JMSA 1L3VA 4F5NA 1TFYA 3Q8PB 3GV8B 2A1JA 3MGHA 4DSJA 2M2TA 9ICVA 1RXWA 3HX0A 4HYKA 4TUQA 3LWMA 3BJYA 3AU2A 2FLLA 4DQSA 3OSPA 5HHIA 4R8UB 4DSFA 4RQ7A 8ICFA 5KFPA 3M9OB 3JPOA 3HWTA 3H8WA 1T8EA 2BGWA 5J2HA 5KTQA 4DLEA 3AU6A 4M04A 1ZQYA 1KFDA 2Y1JA 2BCSA 1QSLA 2JEIA 2ZHAA 5DQHA 4RUAA 4ED1A 3RB6A 4P4OA 4RPXA 4X4RA 4UBCA 4RWNA 2JZBB 3JPTA 1ZQMA 1KLNA 7ICJA 1NOMA 4O0IA 4EEYA 4PPXA 9ICFA 4BWMA 4DL6A 7ICPA 1TFWA 3HT3A 3H4BA 4ED3A 4RWPA 4I2GA 1MIVA 2M2VA 4EBDA 1IXRA 2XGPA 2I9GA 4DSLA 4KLFA 4PGYA 3H39A 4R8UA 5EWFA 4DQRA 1JN3A 4MF8A 2PFQA 3IM1A 4F4WA 3Q8RB 5KFYA 2PBEA 1NK6A 3AQKA 3H3AA 2ZJ5A 4UB4A 4B9SA 2R8GA 4DFMA 3Q8QB 2KN7A 5KG6A 1TV9A 4I2IA 2UVWA 3RB4A 4ATBA 4YD2A 2R8JA 4YG2A 2DFLA 3RJFA 4I2CA 4O9MA 4PHAA 3V7KA 2BHNA 2ZUCA 5KT7A 3WFOA 4Q44A 1R8CA 3TANA 3H4DA 5IINA 4YVZA 2C28A 4R66A 3LWLA 4J9LA 1DK2A 2ZHBA 4LVSA 3OVSA 1BPYA 1F5AA 3C1ZA 4YFKA 8ICIA 4RT3A 5CR0A 3PO4A 4DL7A 4NLZA 4ED2A 2AQ4A 4WC1A 3G6VA 1XSPA 1KFSA 9ICPA 3SI8A 4M2YA 5DB6A 5KT6A 1BVSA 1U49A 5DECA 2WTFA 1ZJNA 8ICPA 2VANA 1SKSA 3ZDAA 4F2RA 1VJ7A 4EYHB 3N4MB 4DL3A 2ISPA 4DFKA 2P6RA 1ZQVA 2ZUBA 1KDHA 2ZH4A 4F93B 4Q8FA 2O1PA 3HIYA 4NY8A 4F5OA 3M9NB 3V6JA 4TQSA 3JPRA 4B9VA 3MFIA 4O3QA 1ZQJA 4UD4A 1XO1A 2IMWP 3MR2A 4I2EA 3RJGA 3PR5B 1KFTA 1NJZA 1ZQKA 4BDPA 4F5QA 2IA6A 7ICSA 2FPLA 5CWRA 4WC6A 1R8AA 4KLTA 1PZNA 4ED8A 2AGPA 5C5JA 3GILA 4IQWA 1TAUA 3GIIA 3H7IA 9ICNA 3KHLA 4DOAA 4I2DA 8ICJA 4EBEA 4FHYA 1Z3EB 1RYRA 4K4GA 1X9MA 3PR4A 2XO7A 4DO9A 4J9PA 4GXKA 1TK8A 4KLGA 2M2UA 2ZUDA 5KT4A 3UXNA 3LK9A 4I2BA 5J0WA 2XC9A 4KITB 1ZQOA 4O5KA 4M9HA 1XSLA 4JK1A 2HHVA 5CJ7A 3M8RA 4EYIB 4DL2A 2NRTA 3KHHA 2DPIA 2V4RA 4ECYA 3TFSA 3C1YA 2XY7A 4YXJA 4PHPA 4RZRA 5KFDA 4MEXA 4MFFA 3E2EA 1TK0A 7ICMA 4M9GA 4Z6CA 4MEYA 3LQCB 2H5XA 4RT2A 2AGQA 3Q8MA 2BCUA 2ATLA 4JWNA 1DK3A 2HHQA 5IILA 4IRKA 2ZH7A 3OHBA 2FLNA 4QZCA 5HNKA 2ZJ8A 4FHVA 4YD1A 3OJUA 4RQ4A 3PMLA 3SV4A 5J2BA 1RYSA 3PO5A 3AUOA 1BPBA 4RQ6A 2VA2A 4AT9B 4ED7A 4M0AA 5KFAA 5J0UA 1XU4A 1D9DA 1SZPA 3L9DA 4ECVA 4NKTA 1RPLA 5DGAA 4GLXA 2PI4A 4RQ1A 4IR9A 3TQ1A 2JEFA 4I2HA 4O3RA 8ICXA 2FLPA 4UAWA 8ICAA 1D8LA 4GXJA 5KFBA 1BNOA 3PY8A 4M47A 2AQ0A 4QWAA 3ISCA 3JPPA 1ZQBA 3KHGA 2DRAA 2KP7A 7ICTA 9ICRA 4DS4A 1ZQWA 4DF8A 3BQ1A 1S0OA 2ISOA 1S0VA 2MAXA 1SKWA 4BXOA 1XSNA 1CEZA 1T7PA 5EWGA 3OV7A 3V7LA 3QEAZ 4JV0A 2BCRA 4KLOA 4YQWA 4O3PA 1RZTA 2ZH3A 1L3SA 1XWLA 3UPSA 3RTVA 1ZQRA 3RH5A 5HMLA 4UB5A 3MGIA 5KFKA 3PVXA 4TUSA 1NK7A 3BDPA 5J0PA 4KLDA 1QLNA 2NRXA 1WCLA 1MQ2A 4F4KA 3GV7B 4PH5A 4QZ8A 4DSEA 2AJQA 5HREA 3C2KA 4WC0A 2KFZA 4WBYA 4I2FA 4RU9A 2XCPA 4TURA 3V6KA 2XY6A 8ICWA 4KLSA 5EWEA 3H8SA 5EOZA 4MFAA 2IBKA 4DQIA 3T5JA 5J2JA 8ICSA 7ICVA 2ZH2A 5J2IA 4NM2A 3RJHA 4ATBB 2DR7A 2HHWA 5KG3A 3RB3A 9ICAA 4WC5A 1X2IA 4CCHA 4QZ9A 9ICOA 5KFNA 3MFHA 7ICQA 1QTMA 5KFHA 3C5GA 1UEVA 1MQ3A 4E80A 3OUYA 3T3FA 1ZQIA 2W9CB 4O3SA 1NJYA 5J2EA 4FS2A 3FYHA 2ASLA 1UA0A 2P66A 3ZDBA 2P6UA 4M6WB 2UVRA 2KZMA 2W9BA 3NTUA 2V9WA 3G6XA 4I2AA 1QSYA 5HHHA 5J0OA 4JUZA 1SKRA 2J6UA 4RPYA 1A76A 3K4GA 3V6HA 5DLGA 4F5RA 3MBYA 4DS5A 4DQQA 1LB2B 4XRHA 5F9NA 4DOBA 3WFQE 4QZHA 1KEJA 4S3NA 3RH6A 3QEBZ 4AT7A 3NGDA 5DBBA 4DFJA 4YCXA 4RQ5A 1LV5A 2RDIA 2FMQA 3RR8A 3TI0A 4KLMA 3IHQB 2W9CA 4XQ7A 1MIYA 9ICGA 3JPQA 4DSKA 3H38A 2ZH5A 2HHSA 1ZQCA 2HVIA 4XUSA 4M6WA 2DR8A 4YR2A 1UT5A 3OHAA 5L1LA 4YR0A 1MC8A 9ICHA 5BPCA 1XC9A 3SV3A 2M9NA 3ORYA 4B9MA 5HRDA 1WCNA 3C2LA 4M5DA 2IHNA 1TKDA 1S97A 1NZPA 1ZQAA 4I29A 8ICCA 4WBZA 5HR9A 4WC2A 4KLEA 4ECXA 2UVVA 8ICMA 2ZTDA 5J2AA 4J9SA 3RRGA 7ICHA 1ZQNA 3OJSA 2HHPA 4X4NA 5DEDA 4LZGA 2FMPA 5J2FA 4YMNA 3PW2A 5CA7A 1S0MA 1NJXA 1Z00B 3RJEA 7ICIA 1V4AA 4I2JA 4QZGA 4F2SA 5IIKA 4DF4A 3KTQA 5D49A 5IIIA 3MR5A 2XY5A 5KFZA 1BPEA 3QE9Y 5J0QA 3WFSC 4NXZA 4ECZA 2HHXA 2NRWA 3ETLA 4BGDA 9ICCA 5KG2A 4ZH4A 4ECRA 4Z6FA 3BQ2A 8ICLA 4QZDA 1D9FA 1KTQA 1ZETA 2BPFA 4K4HA 4NKUA 2MUTB 2PFPA 5HRIA 1S10A 2ZH6A 2DVIA 5CP2A 3PW0A 4TUPA 4UBBA 5HP4A 4C8KA 5KFOA 4FBTA 4X4OA 5HRHA 4RWOA 1Z00A 3QZ7A 4E0DA 2PFOA 4KLUA 1Y88A 2F1IA 4KN7A 3OSNA 3M8SA 1R8BA 2DR5A 4QWCA 3C21A 3WFRE 4RQ3A 3Q8KA 5KT3A 2ZJAA 4DL5A 2IHMA 3C66A 2DR9A 9ICJA 5IIMA 2AGOA 5J0TA 2HVHA 4EBCA 4F50A 4P2HA 5BOLA 8ICOA 1PX5A 4RQ2A 2MUTA 1ZQGA 1ZQXA 3ISBA 4IRDA 4EBKA 2JEJA 3GQCA 4X0BA 4PHDA 8ICEA 3PV8A 2GWSA 2XGQA 3ZD9A 2Y1IA 1TVAA 1KNYA 3G6YA 4B9UA 8ICBA 4DFPA 5F9LA 5HRGA 2ID1A 3JPSA 5KFWA 3OVAA 1BPDA 4BXOB 5J0RA 5JUMA 3OVBA 1JXLA 1JIHA 5KG4A 1ZQTA 2W8LA 4X0AA 4QZFA 1NK0A 3H8JA 4J9MA 1ZQPA 8ICNA 5KG7A 2RDJA 3C18A 4RWQA 4IQUA 2F1HA 2Q0ZX 5KFSA 1L3TA 4DLGA 5J2CA 9ICMA 3UPQA 1BNPA 4YR3A 4FH5A 4DEZA 4QWBA 5DB7A 5J0YA 4EZ9A 4GC6A 2KZZA 4UAZA 5CHGA 4FBUA 3EZ5A 4IR1A 5KFJA 1RXVA 4O5EA 7ICKA 2BPGA 4ELUA 3UQ0A 3RAQA 4Q43A 2V4QA 1NO5A 2BKEA 4NLKA 4WCWA 4WC3A 4X4TA 5CB1A 3WFPA 9ICKA 2PXIA 2BR0A 5DBAA 2BCVA 5KFRA 3TARA 1U47A 4B9NA 3OGUA 2C2DA 2B21A 5KG0A 3ISDA 1UETA 4AT8B 9ICXA 2ZH8A 2VA8A 4IG8A 5J0XA 3FDSA 3T5HA 1S9FA 3RR7A 4IRCA 9ICBA 5KFMA 1MIWA 3OUYB 4RUCA 2Q66A 4G3IA 2R8KA 4PHEA 2ALZA 5KFLA 1TAQA 4RPZA 3RH4A 7ICEA 4E8FA 3KHRA 3Q8LA 2W9BB 4QZBA 2BPCA 8ICGA 1COOA 4O3OA 8ICRA 9ICIA 4C8MA 1NK5A 3GFKB 4J9QA 4ELTA 4Q8EA 7ICUA 3BQ0A 4M9JA 4YMMA 3MR3A 3RAXA 2W8KA 2KTQA 5HRFA 3EPIA 1B43A 4I28A 8ICTA 5DLFA 1L5UA 4AT8A 4P4MA 4F5PA 1SL2A 4AT7B 1T3NA 2ASJA 3H40A 4J9NA 3PX0A 3RBDA 1U48A 4PGQA 5DG7A 4C8NA 4R64A 5KFEA 3GV5B 3GIKA 4F4YA 4EZ6A 1JAJA 4KN4A 4DSIA 4DOCA 4YN4A 2O5AA 3MDCA 1C7YA 9ICTA 8ICKA 3RJKA 4QWDA 4UB2A 1X9SA 4KTQA 3PX6A 4QW9A 3RRHA 1ZQSA 4X4PA 4ECUA 1OU5A 3PW5A 5KFUA 5F2VO 7ICGA 4KLJA 8ICHA 5J2KA 3GIJA 3HJ4A 1NK9A 2FMSA 4B9LA 4FHPA 2AU0A 3EYZA 4QZEA 3V72A 1K1SA 4DWIA 9ICEA 3RBEA 9ICLA 4X4SA 4ECTA 1ZQFA 5D46A 4KLHA 2RFFA 5L1JA 1EXNA 4F4ZA 3ZDCA 3ZDEA 2ZH1A 5KFTA 3AQMA 3JYYA 1U9LA 1H38A 1JX4A 3MR6A 4M9NA 3B0YA 4RNNA 2M2WA 2BCQA 1Q79A 2KFNA 3TAPA 3C5FA 5L9XA 1D8YA 2J6SA 8ICUA 5DGBA 1ZQLA 3PMNA 4YP3A 3EWAA 2R8IA 4ECQA 4KLIA 4O5CA 4F8RA 1NJWA 1ZQHA 5DG8A 4TQRA 2PFNA 1QSSA 5IIOA 4JV2A 2C2RA 4KLLA 2JZBA 5J29A 3RB0A 4RQ0A 4F4XA 1TFRA 2I1QA 4F91B 5BOMA 4O3NA 5J2GA 4YMOA 4KMUA 1BPXA 5KT5A 1IM4A 3V7JA 1ZQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TK5 A;  1B22 A;  4UQG A;  2XCA A;  1BGX T;  4DQP A;  4UB1 A;  4X4U A;  4FO6 A;  2C22 A;  1SL1 A;  3Q8S B;  4QZA A;  3EPG A;  1R89 A;  2PI5 A;  3UQ2 A;  1Q78 A;  1DGS A;  4Z6D A;  1DOQ A;  4FS1 A;  5HRB A;  4BWJ A;  4YXM A;  3PW4 A;  3MAB A;  1ZQU A;  1NKE A;  5DBC A;  2NRZ A;  5KFI A;  3RJJ A;  9ICQ A;  5HRK A;  5KFX A;  7ICR A;  1JXE A;  1K1Q A;  1ZYQ A;  5DKW A;  4EP7 A;  3UXO A;  7ICO A;  4UB3 A;  8ICY A;  3LDA A;  5DB9 A;  2FPM A;  3ZD8 A;  5DG9 A;  3MDA A;  5TZV A;  3T5K A;  4X4Q A;  1KRP A;  1MSW D;  1WOT A;  1NK4 A;  9ICW A;  2DPJ A;  5IIJ A;  4LT6 A;  4FHX A;  5D4B A;  4RNO A;  1U45 A;  5J2D A;  1U4B A;  3NYB A;  1S76 D;  4RNM A;  3PNC A;  3GIM A;  3TAQ A;  3K75 D;  3THV A;  4XQ8 A;  5DDM A;  4KLQ A;  8ICV A;  3HP6 A;  4ELV A;  4R65 A;  5L1I A;  5DB8 A;  2NRK A;  4ED0 A;  4MF2 A;  4QW8 A;  1FA0 A;  4Q45 A;  3QZ8 A;  4GC7 A;  2ZTE A;  4X5V A;  1ARO P;  2J6T A;  5KFV A;  9ICU A;  2HW3 A;  4I27 A;  4F3O A;  1ZQZ A;  1S77 D;  1JQR A;  1UEU A;  3C2M A;  2HHU A;  4C8L A;  4M9L A;  4XA5 A;  2ZH9 A;  2W9A A;  5KFC A;  4C8O A;  2BE3 A;  2W9M A;  1T4G A;  2VA3 A;  1KSP A;  3JZ0 A;  4PGX A;  5HRL A;  4QZI A;  1A77 A;  1ZJM A;  4E7X A;  2BQ3 A;  5KFQ A;  1HUZ A;  1YLQ A;  5HC9 A;  1UT8 A;  4NLG A;  3N97 B;  3AQN A;  4GXI A;  4JV1 A;  1NKB A;  4X4V A;  2R8H A;  4K4I A;  4LZD A;  3RJI A;  4J9K A;  3JPN A;  5KT2 A;  3HW8 A;  1X9W A;  1ZQE A;  5HMM A;  1N48 A;  5DQG A;  2FPK A;  4UAY A;  4B9T A;  4WC7 A;  4ECS A;  1UA1 A;  5KG5 A;  8ICQ A;  3GDX A;  3AQL A;  3M9M B;  2LYH A;  4IQT A;  7ICN A;  4J9R A;  3EW9 A;  2OWO A;  3HJ1 A;  4FHW A;  3PW7 A;  3PX4 A;  2BQU A;  4WC4 A;  2F1J A;  4ED6 A;  2JEG A;  2ASD A;  5DDY A;  1BPZ A;  5KG1 A;  3ZDD A;  3HPO A;  2NRV A;  1XS9 D;  2BDP A;  2ZTC A;  5KFG A;  3SYZ A;  1N56 A;  2A1J B;  1NK8 A;  1CUK A;  1V9P A;  3UXP A;  5DQI A;  1S0N A;  2UVU A;  7ICF A;  3H37 A;  2DRB A;  1ZQQ A;  4QWE A;  1L3U A;  9ICS A;  4FH3 A;  4P4P A;  3TFR A;  1NKC A;  7ICL A;  4JWM A;  3B0X A;  4NM1 A;  4ECW A;  5KFF A;  3C23 A;  1SL0 A;  4R63 A;  3BQT A;  4NLN A;  2KZ3 A;  1HJP A;  4UD5 A;  4Z6E A;  4DL4 A;  4AT9 A;  4EBJ A;  1VFG A;  5L1K A;  4MFC A;  4RQ8 A;  3T5L A;  4F92 B;  4IQV A;  3SZ2 A;  5J0S A;  4J9O A;  2BQR A;  2C2E A;  1HUO A;  2HHT A;  8ICZ A;  1JMS A;  1L3V A;  4F5N A;  1TFY A;  3Q8P B;  3GV8 B;  2A1J A;  3MGH A;  4DSJ A;  2M2T A;  9ICV A;  1RXW A;  3HX0 A;  4HYK A;  4TUQ A;  3LWM A;  3BJY A;  3AU2 A;  2FLL A;  4DQS A;  3OSP A;  5HHI A;  4R8U B;  4DSF A;  4RQ7 A;  8ICF A;  5KFP A;  3M9O B;  3JPO A;  3HWT A;  3H8W A;  1T8E A;  2BGW A;  5J2H A;  5KTQ A;  4DLE A;  3AU6 A;  4M04 A;  1ZQY A;  1KFD A;  2Y1J A;  2BCS A;  1QSL A;  2JEI A;  2ZHA A;  5DQH A;  4RUA A;  4ED1 A;  3RB6 A;  4P4O A;  4RPX A;  4X4R A;  4UBC A;  4RWN A;  2JZB B;  3JPT A;  1ZQM A;  1KLN A;  7ICJ A;  1NOM A;  4O0I A;  4EEY A;  4PPX A;  9ICF A;  4BWM A;  4DL6 A;  7ICP A;  1TFW A;  3HT3 A;  3H4B A;  4ED3 A;  4RWP A;  4I2G A;  1MIV A;  2M2V A;  4EBD A;  1IXR A;  2XGP A;  2I9G A;  4DSL A;  4KLF A;  4PGY A;  3H39 A;  4R8U A;  5EWF A;  4DQR A;  1JN3 A;  4MF8 A;  2PFQ A;  3IM1 A;  4F4W A;  3Q8R B;  5KFY A;  2PBE A;  1NK6 A;  3AQK A;  3H3A A;  2ZJ5 A;  4UB4 A;  4B9S A;  2R8G A;  4DFM A;  3Q8Q B;  2KN7 A;  5KG6 A;  1TV9 A;  4I2I A;  2UVW A;  3RB4 A;  4ATB A;  4YD2 A;  2R8J A;  4YG2 A;  2DFL A;  3RJF A;  4I2C A;  4O9M A;  4PHA A;  3V7K A;  2BHN A;  2ZUC A;  5KT7 A;  3WFO A;  4Q44 A;  1R8C A;  3TAN A;  3H4D A;  5IIN A;  4YVZ A;  2C28 A;  4R66 A;  3LWL A;  4J9L A;  1DK2 A;  2ZHB A;  4LVS A;  3OVS A;  1BPY A;  1F5A A;  3C1Z A;  4YFK A;  8ICI A;  4RT3 A;  5CR0 A;  3PO4 A;  4DL7 A;  4NLZ A;  4ED2 A;  2AQ4 A;  4WC1 A;  3G6V A;  1XSP A;  1KFS A;  9ICP A;  3SI8 A;  4M2Y A;  5DB6 A;  5KT6 A;  1BVS A;  1U49 A;  5DEC A;  2WTF A;  1ZJN A;  8ICP A;  2VAN A;  1SKS A;  3ZDA A;  4F2R A;  1VJ7 A;  4EYH B;  3N4M B;  4DL3 A;  2ISP A;  4DFK A;  2P6R A;  1ZQV A;  2ZUB A;  1KDH A;  2ZH4 A;  4F93 B;  4Q8F A;  2O1P A;  3HIY A;  4NY8 A;  4F5O A;  3M9N B;  3V6J A;  4TQS A;  3JPR A;  4B9V A;  3MFI A;  4O3Q A;  1ZQJ A;  4UD4 A;  1XO1 A;  2IMW P;  3MR2 A;  4I2E A;  3RJG A;  3PR5 B;  1KFT A;  1NJZ A;  1ZQK A;  4BDP A;  4F5Q A;  2IA6 A;  7ICS A;  2FPL A;  5CWR A;  4WC6 A;  1R8A A;  4KLT A;  1PZN A;  4ED8 A;  2AGP A;  5C5J A;  3GIL A;  4IQW A;  1TAU A;  3GII A;  3H7I A;  9ICN A;  3KHL A;  4DOA A;  4I2D A;  8ICJ A;  4EBE A;  4FHY A;  1Z3E B;  1RYR A;  4K4G A;  1X9M A;  3PR4 A;  2XO7 A;  4DO9 A;  4J9P A;  4GXK A;  1TK8 A;  4KLG A;  2M2U A;  2ZUD A;  5KT4 A;  3UXN A;  3LK9 A;  4I2B A;  5J0W A;  2XC9 A;  4KIT B;  1ZQO A;  4O5K A;  4M9H A;  1XSL A;  4JK1 A;  2HHV A;  5CJ7 A;  3M8R A;  4EYI B;  4DL2 A;  2NRT A;  3KHH A;  2DPI A;  2V4R A;  4ECY A;  3TFS A;  3C1Y A;  2XY7 A;  4YXJ A;  4PHP A;  4RZR A;  5KFD A;  4MEX A;  4MFF A;  3E2E A;  1TK0 A;  7ICM A;  4M9G A;  4Z6C A;  4MEY A;  3LQC B;  2H5X A;  4RT2 A;  2AGQ A;  3Q8M A;  2BCU A;  2ATL A;  4JWN A;  1DK3 A;  2HHQ A;  5IIL A;  4IRK A;  2ZH7 A;  3OHB A;  2FLN A;  4QZC A;  5HNK A;  2ZJ8 A;  4FHV A;  4YD1 A;  3OJU A;  4RQ4 A;  3PML A;  3SV4 A;  5J2B A;  1RYS A;  3PO5 A;  3AUO A;  1BPB A;  4RQ6 A;  2VA2 A;  4AT9 B;  4ED7 A;  4M0A A;  5KFA A;  5J0U A;  1XU4 A;  1D9D A;  1SZP A;  3L9D A;  4ECV A;  4NKT A;  1RPL A;  5DGA A;  4GLX A;  2PI4 A;  4RQ1 A;  4IR9 A;  3TQ1 A;  2JEF A;  4I2H A;  4O3R A;  8ICX A;  2FLP A;  4UAW A;  8ICA A;  1D8L A;  4GXJ A;  5KFB A;  1BNO A;  3PY8 A;  4M47 A;  2AQ0 A;  4QWA A;  3ISC A;  3JPP A;  1ZQB A;  3KHG A;  2DRA A;  2KP7 A;  7ICT A;  9ICR A;  4DS4 A;  1ZQW A;  4DF8 A;  3BQ1 A;  1S0O A;  2ISO A;  1S0V A;  2MAX A;  1SKW A;  4BXO A;  1XSN A;  1CEZ A;  1T7P A;  5EWG A;  3OV7 A;  3V7L A;  3QEA Z;  4JV0 A;  2BCR A;  4KLO A;  4YQW A;  4O3P A;  1RZT A;  2ZH3 A;  1L3S A;  1XWL A;  3UPS A;  3RTV A;  1ZQR A;  3RH5 A;  5HML A;  4UB5 A;  3MGI A;  5KFK A;  3PVX A;  4TUS A;  1NK7 A;  3BDP A;  5J0P A;  4KLD A;  1QLN A;  2NRX A;  1WCL A;  1MQ2 A;  4F4K A;  3GV7 B;  4PH5 A;  4QZ8 A;  4DSE A;  2AJQ A;  5HRE A;  3C2K A;  4WC0 A;  2KFZ A;  4WBY A;  4I2F A;  4RU9 A;  2XCP A;  4TUR A;  3V6K A;  2XY6 A;  8ICW A;  4KLS A;  5EWE A;  3H8S A;  5EOZ A;  4MFA A;  2IBK A;  4DQI A;  3T5J A;  5J2J A;  8ICS A;  7ICV A;  2ZH2 A;  5J2I A;  4NM2 A;  3RJH A;  4ATB B;  2DR7 A;  2HHW A;  5KG3 A;  3RB3 A;  9ICA A;  4WC5 A;  1X2I A;  4CCH A;  4QZ9 A;  9ICO A;  5KFN A;  3MFH A;  7ICQ A;  1QTM A;  5KFH A;  3C5G A;  1UEV A;  1MQ3 A;  4E80 A;  3OUY A;  3T3F A;  1ZQI A;  2W9C B;  4O3S A;  1NJY A;  5J2E A;  4FS2 A;  3FYH A;  2ASL A;  1UA0 A;  2P66 A;  3ZDB A;  2P6U A;  4M6W B;  2UVR A;  2KZM A;  2W9B A;  3NTU A;  2V9W A;  3G6X A;  4I2A A;  1QSY A;  5HHH A;  5J0O A;  4JUZ A;  1SKR A;  2J6U A;  4RPY A;  1A76 A;  3K4G A;  3V6H A;  5DLG A;  4F5R A;  3MBY A;  4DS5 A;  4DQQ A;  1LB2 B;  4XRH A;  5F9N A;  4DOB A;  3WFQ E;  4QZH A;  1KEJ A;  4S3N A;  3RH6 A;  3QEB Z;  4AT7 A;  3NGD A;  5DBB A;  4DFJ A;  4YCX A;  4RQ5 A;  1LV5 A;  2RDI A;  2FMQ A;  3RR8 A;  3TI0 A;  4KLM A;  3IHQ B;  2W9C A;  4XQ7 A;  1MIY A;  9ICG A;  3JPQ A;  4DSK A;  3H38 A;  2ZH5 A;  2HHS A;  1ZQC A;  2HVI A;  4XUS A;  4M6W A;  2DR8 A;  4YR2 A;  1UT5 A;  3OHA A;  5L1L A;  4YR0 A;  1MC8 A;  9ICH A;  5BPC A;  1XC9 A;  3SV3 A;  2M9N A;  3ORY A;  4B9M A;  5HRD A;  1WCN A;  3C2L A;  4M5D A;  2IHN A;  1TKD A;  1S97 A;  1NZP A;  1ZQA A;  4I29 A;  8ICC A;  4WBZ A;  5HR9 A;  4WC2 A;  4KLE A;  4ECX A;  2UVV A;  8ICM A;  2ZTD A;  5J2A A;  4J9S A;  3RRG A;  7ICH A;  1ZQN A;  3OJS A;  2HHP A;  4X4N A;  5DED A;  4LZG A;  2FMP A;  5J2F A;  4YMN A;  3PW2 A;  5CA7 A;  1S0M A;  1NJX A;  1Z00 B;  3RJE A;  7ICI A;  1V4A A;  4I2J A;  4QZG A;  4F2S A;  5IIK A;  4DF4 A;  3KTQ A;  5D49 A;  5III A;  3MR5 A;  2XY5 A;  5KFZ A;  1BPE A;  3QE9 Y;  5J0Q A;  3WFS C;  4NXZ A;  4ECZ A;  2HHX A;  2NRW A;  3ETL A;  4BGD A;  9ICC A;  5KG2 A;  4ZH4 A;  4ECR A;  4Z6F A;  3BQ2 A;  8ICL A;  4QZD A;  1D9F A;  1KTQ A;  1ZET A;  2BPF A;  4K4H A;  4NKU A;  2MUT B;  2PFP A;  5HRI A;  1S10 A;  2ZH6 A;  2DVI A;  5CP2 A;  3PW0 A;  4TUP A;  4UBB A;  5HP4 A;  4C8K A;  5KFO A;  4FBT A;  4X4O A;  5HRH A;  4RWO A;  1Z00 A;  3QZ7 A;  4E0D A;  2PFO A;  4KLU A;  1Y88 A;  2F1I A;  4KN7 A;  3OSN A;  3M8S A;  1R8B A;  2DR5 A;  4QWC A;  3C21 A;  3WFR E;  4RQ3 A;  3Q8K A;  5KT3 A;  2ZJA A;  4DL5 A;  2IHM A;  3C66 A;  2DR9 A;  9ICJ A;  5IIM A;  2AGO A;  5J0T A;  2HVH A;  4EBC A;  4F50 A;  4P2H A;  5BOL A;  8ICO A;  1PX5 A;  4RQ2 A;  2MUT A;  1ZQG A;  1ZQX A;  3ISB A;  4IRD A;  4EBK A;  2JEJ A;  3GQC A;  4X0B A;  4PHD A;  8ICE A;  3PV8 A;  2GWS A;  2XGQ A;  3ZD9 A;  2Y1I A;  1TVA A;  1KNY A;  3G6Y A;  4B9U A;  8ICB A;  4DFP A;  5F9L A;  5HRG A;  2ID1 A;  3JPS A;  5KFW A;  3OVA A;  1BPD A;  4BXO B;  5J0R A;  5JUM A;  3OVB A;  1JXL A;  1JIH A;  5KG4 A;  1ZQT A;  2W8L A;  4X0A A;  4QZF A;  1NK0 A;  3H8J A;  4J9M A;  1ZQP A;  8ICN A;  5KG7 A;  2RDJ A;  3C18 A;  4RWQ A;  4IQU A;  2F1H A;  2Q0Z X;  5KFS A;  1L3T A;  4DLG A;  5J2C A;  9ICM A;  3UPQ A;  1BNP A;  4YR3 A;  4FH5 A;  4DEZ A;  4QWB A;  5DB7 A;  5J0Y A;  4EZ9 A;  4GC6 A;  2KZZ A;  4UAZ A;  5CHG A;  4FBU A;  3EZ5 A;  4IR1 A;  5KFJ A;  1RXV A;  4O5E A;  7ICK A;  2BPG A;  4ELU A;  3UQ0 A;  3RAQ A;  4Q43 A;  2V4Q A;  1NO5 A;  2BKE A;  4NLK A;  4WCW A;  4WC3 A;  4X4T A;  5CB1 A;  3WFP A;  9ICK A;  2PXI A;  2BR0 A;  5DBA A;  2BCV A;  5KFR A;  3TAR A;  1U47 A;  4B9N A;  3OGU A;  2C2D A;  2B21 A;  5KG0 A;  3ISD A;  1UET A;  4AT8 B;  9ICX A;  2ZH8 A;  2VA8 A;  4IG8 A;  5J0X A;  3FDS A;  3T5H A;  1S9F A;  3RR7 A;  4IRC A;  9ICB A;  5KFM A;  1MIW A;  3OUY B;  4RUC A;  2Q66 A;  4G3I A;  2R8K A;  4PHE A;  2ALZ A;  5KFL A;  1TAQ A;  4RPZ A;  3RH4 A;  7ICE A;  4E8F A;  3KHR A;  3Q8L A;  2W9B B;  4QZB A;  2BPC A;  8ICG A;  1COO A;  4O3O A;  8ICR A;  9ICI A;  4C8M A;  1NK5 A;  3GFK B;  4J9Q A;  4ELT A;  4Q8E A;  7ICU A;  3BQ0 A;  4M9J A;  4YMM A;  3MR3 A;  3RAX A;  2W8K A;  2KTQ A;  5HRF A;  3EPI A;  1B43 A;  4I28 A;  8ICT A;  5DLF A;  1L5U A;  4AT8 A;  4P4M A;  4F5P A;  1SL2 A;  4AT7 B;  1T3N A;  2ASJ A;  3H40 A;  4J9N A;  3PX0 A;  3RBD A;  1U48 A;  4PGQ A;  5DG7 A;  4C8N A;  4R64 A;  5KFE A;  3GV5 B;  3GIK A;  4F4Y A;  4EZ6 A;  1JAJ A;  4KN4 A;  4DSI A;  4DOC A;  4YN4 A;  2O5A A;  3MDC A;  1C7Y A;  9ICT A;  8ICK A;  3RJK A;  4QWD A;  4UB2 A;  1X9S A;  4KTQ A;  3PX6 A;  4QW9 A;  3RRH A;  1ZQS A;  4X4P A;  4ECU A;  1OU5 A;  3PW5 A;  5KFU A;  5F2V O;  7ICG A;  4KLJ A;  8ICH A;  5J2K A;  3GIJ A;  3HJ4 A;  1NK9 A;  2FMS A;  4B9L A;  4FHP A;  2AU0 A;  3EYZ A;  4QZE A;  3V72 A;  1K1S A;  4DWI A;  9ICE A;  3RBE A;  9ICL A;  4X4S A;  4ECT A;  1ZQF A;  5D46 A;  4KLH A;  2RFF A;  5L1J A;  1EXN A;  4F4Z A;  3ZDC A;  3ZDE A;  2ZH1 A;  5KFT A;  3AQM A;  3JYY A;  1U9L A;  1H38 A;  1JX4 A;  3MR6 A;  4M9N A;  3B0Y A;  4RNN A;  2M2W A;  2BCQ A;  1Q79 A;  2KFN A;  3TAP A;  3C5F A;  5L9X A;  1D8Y A;  2J6S A;  8ICU A;  5DGB A;  1ZQL A;  3PMN A;  4YP3 A;  3EWA A;  2R8I A;  4ECQ A;  4KLI A;  4O5C A;  4F8R A;  1NJW A;  1ZQH A;  5DG8 A;  4TQR A;  2PFN A;  1QSS A;  5IIO A;  4JV2 A;  2C2R A;  4KLL A;  2JZB A;  5J29 A;  3RB0 A;  4RQ0 A;  4F4X A;  1TFR A;  2I1Q A;  4F91 B;  5BOM A;  4O3N A;  5J2G A;  4YMO A;  4KMU A;  1BPX A;  5KT5 A;  1IM4 A;  3V7J A;  1ZQD A; 
#chains in the Genus database with same CATH topology
 1TK5 A;  2XCA A;  4DQP A;  3L3F X;  5B3P A;  4FO6 A;  1SL1 A;  4QZA A;  5ALQ A;  3EPG A;  1FEZ A;  4PL1 A;  2WF5 A;  3UQ2 A;  2EWR A;  4FS1 A;  4BWJ A;  3ICX A;  3MAB A;  3RJJ A;  1P7D A;  1K1Q A;  3ONN A;  4EP7 A;  1L7O A;  3UXO A;  7ICO A;  4USA A;  2FPM A;  5DG9 A;  3T5K A;  2YX8 A;  9ICW A;  3WKB A;  4FHX A;  1U4B A;  1SV0 A;  4RNM A;  3PNC A;  3NVW A;  8ICV A;  5DB8 A;  1RDF A;  3RFA A;  1FA0 A;  2EAM A;  4QW8 A;  4KM5 A;  4Q45 A;  3AMZ A;  4GC7 A;  4NXT A;  2HW3 A;  4F3O A;  3C2M A;  4Y2Y A;  5CFU A;  2GA9 D;  4PGX A;  1A77 A;  3SAG A;  3MGV A;  1HUZ A;  4NLG A;  4GXI A;  4JV1 A;  4K99 A;  1L7N A;  5KNI A;  3RJI A;  3JPN A;  3PHZ A;  1QQ7 A;  2ZIU B;  5B66 U;  4ECS A;  5ALD A;  8ICQ A;  4IQT A;  3HJ1 A;  3PX4 A;  2F1J A;  4ACO A;  2JEG A;  2ASD A;  1BPZ A;  2DF4 B;  3HPO A;  2ZTC A;  2HDO A;  3SYZ A;  1NK8 A;  2UVU A;  3H37 A;  2DRB A;  1ZQQ A;  4QWE A;  4P4P A;  4LEZ A;  3AN1 A;  4ECW A;  2ZIU A;  2DL0 A;  4UD5 A;  4EV6 A;  5L1K A;  2BQR A;  2HHT A;  1ZD3 A;  5J0S A;  2LM4 A;  1JMS A;  5ALX A;  3SR6 A;  4F5N A;  1TFY A;  1NNL A;  2M2T A;  3MGH A;  3NRZ A;  3HX0 A;  4HYK A;  1URJ A;  3M9O B;  1T8E A;  4GIB A;  5KTQ A;  4DLE A;  2DUY A;  2LPE A;  5DQH A;  4RUA A;  4EEB A;  4UBC A;  3JPT A;  2W54 A;  2GO7 A;  4WH5 A;  1NOM A;  4EEY A;  1TFW A;  1PK1 B;  1FFV A;  4RWP A;  2E8N A;  2KEY A;  3QUC A;  5ALF A;  1J2M A;  3F5A A;  2M2V A;  3QNM A;  4EBD A;  1IXR A;  5B5E U;  5EWF A;  2PBE A;  1JN3 A;  4UAU A;  3Q8R B;  1SWW A;  3H3A A;  3Q8Q B;  2KN7 A;  4YD2 A;  4Y2R A;  4YG2 A;  2DFL A;  2ZUC A;  3H4D A;  3SAH A;  4K9A A;  4R66 A;  4J9L A;  1DK2 A;  2ZHB A;  2ZXH A;  4YFK A;  3PO4 A;  2AQ4 A;  4WC1 A;  1KFS A;  2Y0S C;  3SI8 A;  2P35 A;  3C29 A;  2WF9 A;  2YB4 A;  4A8E A;  2VAN A;  8ICP A;  4CNQ A;  4DFK A;  1ZQV A;  1KL9 A;  1KDH A;  4Q8F A;  2O1P A;  3JPR A;  3H0L B;  1ZQJ A;  4UD4 A;  2WHE A;  1KFT A;  1ZQK A;  3I76 A;  4BDP A;  4F5Q A;  7ICS A;  2FPL A;  1R8A A;  4KLT A;  1PVQ A;  5J8Y A;  9ICN A;  3H7I A;  3K1R B;  5AKZ A;  4EBE A;  1RYR A;  4NL9 A;  4GXK A;  3N7S C;  2ZUD A;  5D62 A;  1ZQO A;  2HHV A;  2DPI A;  4U6P A;  2W3R A;  5KFD A;  4MEX A;  4Z6C A;  2LM1 A;  2XID A;  2H5X A;  2AGQ A;  3Q8M A;  1DK3 A;  4JWN A;  1F5S A;  2A3V A;  5HNK A;  4CF3 A;  4YD1 A;  1HIW A;  3PML A;  3OJU A;  3SV4 A;  1A0P A;  2VA2 A;  1WYG A;  3K7D A;  4M0A A;  1RPL A;  5DGA A;  4GLX A;  4IR9 A;  4O3R A;  2E8O A;  4PZO A;  2F2A B;  4M47 A;  2BBH A;  3ISC A;  3JPP A;  1ZQB A;  2ISO A;  4DF8 A;  1XO0 A;  1S0V A;  2MAX A;  1SKW A;  1T7P A;  3QEA Z;  1RZT A;  2R18 A;  3RTV A;  3C28 A;  3PVX A;  5KFK A;  2XVT A;  4KLD A;  4Y2X A;  4CF5 A;  2KMD A;  5HRE A;  3C2K A;  3NVO A;  4WC0 A;  4X4R A;  8ICW A;  4TUR A;  2XY6 A;  3H8S A;  5EWE A;  5EOZ A;  8ICS A;  4NM2 A;  2HHW A;  9ICA A;  4QZ9 A;  9ICO A;  4OO1 J;  5KFH A;  1MQ3 A;  1ZQI A;  2W9C B;  4O3S A;  5J2E A;  2ASL A;  2P6U A;  2KZM A;  4N7R A;  1SKR A;  3KZX A;  1A76 A;  3K4G A;  3V6H A;  3MBY A;  2HBM A;  2YMM A;  5F9N A;  3B9J A;  4HX0 A;  1KEJ A;  3M6K A;  3N28 A;  2ODG A;  5AI9 A;  4KLM A;  1SWV A;  3IHQ B;  3SEI A;  2W9C A;  1ZRN A;  4DSK A;  1Q3U A;  2HVI A;  1T94 A;  4YR2 A;  5BPC A;  3SV3 A;  1SGG A;  2M9N A;  3ORY A;  3D2S A;  4OD0 A;  8ICC A;  5HR9 A;  4ECX A;  2UVV A;  8ICM A;  2ZTD A;  2HHP A;  4X4N A;  4YMN A;  1S0M A;  7ICI A;  1V4A A;  3I1Y A;  2D8C A;  5AKG A;  3KTQ A;  2KJ9 A;  1BPE A;  1X6J A;  3UMC A;  2OH2 A;  9ICC A;  4Z6F A;  4BUG A;  8ICL A;  4QZD A;  1SZH A;  4K4H A;  4WOY A;  4WQK A;  2YY6 A;  2RRD A;  2FI1 A;  5JTI A;  4E0D A;  1Y88 A;  4CE6 A;  1R8B A;  2W04 A;  2LHT A;  2KIC A;  2IHM A;  2AGO A;  4C4T A;  4RQ2 A;  1ZQX A;  2CN1 A;  3PV8 A;  3ZD9 A;  2W7P A;  1TVA A;  1KNY A;  3JPS A;  1L8O A;  4EEK A;  5JUM A;  1JXL A;  1WWU A;  3C18 A;  1ZQP A;  4J9M A;  4IQU A;  2F1H A;  1J2N A;  3ED5 A;  5GTI U;  4QIW C;  4DLG A;  2DQN B;  9ICM A;  3F53 A;  3AQF A;  2K4P A;  4UAZ A;  4FBU A;  3EZ5 A;  4O5E A;  4ELU A;  1L7M A;  3UQ0 A;  3RAQ A;  2V4Q A;  4NLK A;  5CRX A;  5AM4 A;  2BCV A;  5KFR A;  3TAR A;  2B21 A;  1N5W A;  1UET A;  9ICX A;  4JMU A;  2VA8 A;  5J0X A;  2Q66 A;  3MC1 A;  5KFL A;  3RH4 A;  4E8F A;  2I5H A;  2W43 A;  4QZB A;  8ICG A;  2B4V A;  7ICU A;  3HKZ F;  3KKA C;  4YMM A;  3MR3 A;  2HMX A;  3RAX A;  2W8K A;  1N2X A;  5DLF A;  4P4M A;  4AT7 B;  2EAP A;  2ASJ A;  4J03 A;  4EEN A;  4C8N A;  1NI3 A;  3GV5 B;  1V85 A;  2LYA A;  1JAJ A;  1MA7 A;  4YN4 A;  5ALN A;  2O5A A;  3RJK A;  4QWD A;  4UB2 A;  2AXT U;  3PX6 A;  4X4P A;  5ALH A;  4ECU A;  1OU5 A;  2OXO A;  3AL0 B;  3CNH A;  1NK9 A;  3HJ4 A;  1K1S A;  4KLH A;  3QU5 A;  3QUQ A;  3ZDE A;  5KFT A;  3JCF A;  2DKZ A;  4B6J A;  2YMQ A;  2J6S A;  8ICU A;  2R8I A;  2PMZ C;  2WB1 F;  1IIP A;  5A0L A;  1N62 A;  1FFU A;  5J29 A;  2W7O A;  1WUD A;  2I1Q A;  3L4P A;  2D6F C;  5BOM A;  4KMU A;  1ZQD A;  3I28 A;  4BX9 C;  1BGX T;  1R89 A;  2PI5 A;  3NAS A;  4YXM A;  2FJ6 A;  2NRZ A;  5KFI A;  2CRX A;  3OWG A;  3LDA A;  2RHF A;  5DB9 A;  3MDA A;  4X4Q A;  3D2N A;  1X6I A;  2F8L A;  5K4L A;  2E8M A;  1U45 A;  1JRO A;  3THV A;  3TAQ A;  4XQ8 A;  5DDM A;  4ELV A;  4R65 A;  5ALW A;  3QZ8 A;  4X5V A;  2ZTE A;  1ZQZ A;  1S77 D;  4I0U A;  2VJ4 A;  4C8L A;  4M9L A;  4XA5 A;  2ZH9 A;  1OXJ A;  4C8O A;  2BE3 A;  2W9M A;  2VA3 A;  3JZ0 A;  2K4H A;  1ZJM A;  2CPR A;  4P0Q B;  3R9K A;  4CGZ A;  5HC9 A;  1UT8 A;  3N97 B;  5AI0 A;  2B56 A;  4LZD A;  2GH1 A;  5KT2 A;  3HW8 A;  1X9W A;  3GDX A;  2KSO B;  7ICN A;  1Z4N A;  3AM9 A;  3EW9 A;  1DXS A;  3PW7 A;  5DDY A;  3ZDD A;  1XS9 D;  1N56 A;  3UXP A;  5AIB A;  1SV4 A;  3TFR A;  3B0X A;  5AM2 A;  2QB1 A;  4R63 A;  4K97 A;  2NO5 A;  2KZ3 A;  4NXU A;  2KSO A;  5AKK A;  4DL4 A;  3WK9 A;  2KHQ A;  4C4S A;  2E1E A;  3SZ2 A;  8ICZ A;  4DSJ A;  4TUQ A;  3BJY A;  3AU2 A;  2FLL A;  3H8M A;  5AM0 A;  3OSP A;  5HHI A;  2W11 A;  1TAM A;  4RQ7 A;  5KFP A;  2BGW A;  4M04 A;  3QUT A;  1PVP A;  3RB6 A;  4RPX A;  7ICJ A;  4LJX A;  4PPX A;  4G9B A;  3H39 A;  4DQR A;  4F4W A;  2ZXI A;  3WKD A;  4DFM A;  2XI9 A;  5KG6 A;  4UB8 U;  1TV9 A;  2BHN A;  4FE3 A;  5KT7 A;  4Q44 A;  4YVZ A;  3LWL A;  4LVS A;  3KBB A;  5AI6 A;  1RQL A;  2IOF K;  5CR0 A;  4DL7 A;  3N7P D;  4UAV A;  5ALL A;  9ICP A;  5DB6 A;  5KT6 A;  3IV6 A;  2W3S A;  4FZN A;  2WTF A;  3QU2 A;  4NLC A;  3M6Z A;  4F71 A;  2ZUB A;  2ZH4 A;  2IUB A;  4NY8 A;  4TQS A;  4O3Q A;  1XO1 A;  1M6Y A;  3PR5 B;  1NJZ A;  1PZN A;  5C5J A;  3GIL A;  4IQW A;  1ZD4 A;  3KHL A;  5CHE A;  3NVY A;  5KL8 B;  3PR4 A;  1TK8 A;  5JTG A;  2M2U A;  4K8V A;  5J0W A;  3TAD A;  4EGW A;  4C4R A;  4JK1 A;  3M8R A;  2XY7 A;  4PHP A;  4OJ6 A;  1SV0 C;  1N5X A;  1ZQ1 C;  4M9G A;  2BCU A;  4NLB A;  2ATL A;  2EAO A;  2A19 A;  2ZH7 A;  2FLN A;  4QZC A;  3UM9 A;  3HIL A;  3AUO A;  1BPB A;  3WK8 A;  4ED7 A;  3ETR A;  5KFA A;  5J0U A;  1XU4 A;  3L9D A;  4JB3 A;  2WF7 A;  4RQ1 A;  2JEF A;  4UAW A;  1D8L A;  5KFB A;  2Z7J A;  2AQ0 A;  3EF2 A;  4QWA A;  4LEY A;  3BQ7 A;  4DS4 A;  1ZQW A;  2RQ5 A;  1XNS A;  3OV7 A;  4JV0 A;  4KLO A;  4YQW A;  4O3P A;  2ZH3 A;  1QCK A;  4OJL A;  3RH5 A;  2K60 A;  3BDP A;  1S8O A;  4F4K A;  4EX6 A;  4PH5 A;  2D3D A;  1UQV A;  4RU9 A;  3V6K A;  4KLS A;  1Z1V A;  2ZH2 A;  4Y2U A;  5J2I A;  3RJH A;  1L6N A;  4CCH A;  5KFN A;  2QAR B;  2RP5 A;  3MFH A;  3OUY A;  3T3F A;  4FS2 A;  2EZZ A;  2K8B B;  3FYH A;  5TIS U;  2W55 A;  4M6W B;  2UVR A;  4Y2P A;  3NTU A;  3WKA A;  1QSY A;  2J6U A;  4RPY A;  1LB2 B;  1O08 A;  4DOB A;  3NWI A;  3WFQ E;  4QZH A;  4QJF B;  4AYB C;  2QAR A;  5DBB A;  4DFJ A;  1LV5 A;  5EE0 A;  1MIY A;  3JPQ A;  3H38 A;  1ZOL A;  1ZQC A;  4M6W A;  5L1L A;  1WCN A;  1TKD A;  1NZP A;  1ZQA A;  1PVR A;  4WBZ A;  4KLE A;  4J9S A;  5AK4 A;  4LZG A;  2Q4T A;  1LKY B;  4QZG A;  4F2S A;  5IIK A;  4DF4 A;  5D49 A;  5ALJ A;  3F2B A;  5J0Q A;  3UMB A;  1KKX A;  3WFS C;  4NXZ A;  4ECZ A;  2HHX A;  3ETL A;  4BGD A;  5AK3 A;  3BQ2 A;  3PST A;  1D9F A;  1KTQ A;  2BPF A;  3HRD D;  4NKU A;  2HBL A;  4OAG A;  2DVI A;  3CP8 A;  3PW0 A;  2PFO A;  1LKY A;  3OSN A;  4KN7 A;  3M8S A;  2DR5 A;  3C21 A;  1B0X A;  2KOB A;  3Q8K A;  1RM6 C;  4DL5 A;  3C66 A;  1GO3 F;  1UCV A;  9ICJ A;  5IIM A;  4P2H A;  3AQE A;  3EUB 2;  4Y2Q A;  1ZQG A;  4EBK A;  4X0B A;  2JEJ A;  4MHV A;  4X4V A;  2G5H B;  2GWS A;  2Y0S F;  3G6Y A;  5HRG A;  2ID1 A;  1BPD A;  4NXV A;  1ZD2 P;  1ZQT A;  2W8L A;  4QZF A;  3H8J A;  1A6S A;  5KG7 A;  2YN4 A;  1L3T A;  5KAI U;  2HSZ A;  3OTQ A;  3UPQ A;  4FH5 A;  4YR3 A;  5DB7 A;  4QWB A;  4GC6 A;  2KZZ A;  5KFJ A;  2BKE A;  4WCW A;  4WC3 A;  2WFA A;  5CB1 A;  2PXI A;  3QUB A;  3OGU A;  4AT8 B;  3ERC C;  3T5H A;  9ICB A;  5KFM A;  5AKX A;  2HBJ A;  2LKY A;  4PHE A;  2ALZ A;  1TAQ A;  8ICR A;  4C8M A;  1NK5 A;  3GFK B;  4ELT A;  2DGZ A;  5HRF A;  1PK3 A;  4AT8 A;  3F5E A;  4F5P A;  3RBD A;  4PGQ A;  5DG7 A;  4R64 A;  5KFE A;  4DOC A;  4KX3 A;  1C7Y A;  8ICK A;  1X9S A;  4QW9 A;  7ICG A;  4JLX A;  1FIQ A;  5J2K A;  2FMS A;  4FHP A;  2AU0 A;  4ECT A;  4OJP A;  2RFF A;  5L1J A;  3ZDC A;  2ZH1 A;  1U9L A;  1H38 A;  3N7R C;  4C7Y A;  2KFN A;  2BZF A;  4OAH A;  4OJO A;  3ER8 C;  1T3Q A;  2JH7 A;  2G06 A;  4NXW A;  1NJW A;  1ZQH A;  3QYP A;  2PFN A;  2JZB A;  4K96 A;  4RQ0 A;  1TFR A;  2B51 A;  4UAS A;  4O3N A;  2G5I B;  1IM4 A;  2K89 A;  4UQG A;  2G09 A;  4X4U A;  2OCE A;  2QKQ A;  1DOQ A;  3PW4 A;  1ZQU A;  5HR7 A;  5DBC A;  2JXJ A;  9ICQ A;  1IG6 A;  5HRK A;  5KFX A;  7ICR A;  1JXE A;  8ICY A;  1KRP A;  4OAF A;  1MSW D;  1NK4 A;  4LT6 A;  2DPJ A;  5IIJ A;  4RNO A;  4KX5 A;  3GIM A;  3K75 D;  4KLQ A;  3HP6 A;  2NRK A;  1J97 A;  4ED0 A;  3FAH A;  1ARO P;  9ICU A;  5KFV A;  3BZC A;  1UEU A;  5AK6 A;  1JQR A;  3L5K A;  2HHU A;  4OCZ A;  2W9A A;  3MCR A;  5FP0 A;  5KFC A;  2K8C B;  1KSP A;  2E1F A;  5HRL A;  3DEE A;  3DV9 A;  3HKZ C;  1NKB A;  2R8H A;  5L1M A;  4J9K A;  2QB0 B;  1N48 A;  4WC7 A;  1UA1 A;  5KG5 A;  2WAQ C;  4J9R A;  4FHW A;  2BQU A;  4ED6 A;  5KG1 A;  2BDP A;  5KFG A;  1CUK A;  1V9P A;  1S0N A;  5DQI A;  1KQQ A;  2WF6 A;  7ICF A;  4FH3 A;  2QB0 A;  9ICS A;  1NKC A;  2KKP A;  4JWM A;  5KFF A;  1SL0 A;  3BQT A;  1CI4 A;  3KKA A;  3OPX A;  1HJP A;  4Z6E A;  4AT9 A;  4EBJ A;  3IDW A;  3NS1 A;  3WK7 A;  4IQV A;  1HUO A;  2C2E A;  3CW2 C;  3Q8P B;  9ICV A;  2WB1 C;  1VJ5 A;  4R8U B;  4DSF A;  1WWV A;  8ICF A;  4QIW F;  3JPO A;  4K98 A;  5J2H A;  1Z1B A;  2Y1J A;  2JEI A;  3QU4 A;  4ED1 A;  4P4O A;  4RWN A;  1DRG A;  1S5L U;  4O0I A;  4NWI A;  5ALZ A;  4DL6 A;  2E3T A;  4I2G A;  1DGJ A;  1MIV A;  1C20 A;  2I9G A;  4DSL A;  4PGY A;  4R8U A;  1VFG A;  4MF8 A;  4C7Z A;  3IM1 A;  2O6K A;  1NK6 A;  4UB4 A;  1NZB A;  2MRL A;  2R8G A;  2UVW A;  3RB4 A;  4ATB A;  2R8J A;  2XIC A;  4O9M A;  3V7K A;  3WFO A;  3HJE A;  4Y2S A;  3TAN A;  5AI4 A;  2C28 A;  4HAI A;  3SQI A;  3C1Z A;  8ICI A;  4RT3 A;  3NVZ A;  4NLZ A;  4M2Y A;  1L8L A;  1BVS A;  1CRX A;  4UW9 A;  2GOL A;  1U49 A;  5DEC A;  4ZOH C;  1ZJN A;  1SKS A;  3ZDA A;  4F2R A;  3IG8 A;  1JI7 A;  3N4M B;  2ISP A;  4F93 B;  3HIY A;  2H3F A;  4F5O A;  3M9N B;  4B9V A;  3MFI A;  2IMW P;  4I2E A;  3RJG A;  4IS7 A;  3WKE A;  4ED8 A;  2AGP A;  2GLE A;  1VLB A;  4I2D A;  4RQN A;  8ICJ A;  4FHY A;  1KW4 A;  1X9M A;  2XO7 A;  4DO9 A;  3WK5 A;  5CFT A;  2PMZ F;  4I2B A;  3LK9 A;  5AKE A;  2EDU A;  4KIT B;  3QU9 A;  4M9H A;  1XSL A;  4EYI B;  4DL2 A;  2NRT A;  3BZK A;  2V4R A;  5GTH U;  4ECY A;  3TFS A;  4YXJ A;  3WK4 A;  4P0P B;  7ICM A;  1O03 A;  3LQC B;  1FO4 A;  4RT2 A;  5AI8 A;  2HHQ A;  3OHB A;  4FHV A;  3PO5 A;  2DRA A;  1K5O A;  1D9D A;  4EEL A;  1SZP A;  4ECV A;  2YTU A;  2KV2 A;  2PI4 A;  5AKY A;  8ICX A;  2NV3 A;  2H3V A;  2OM6 A;  2FLP A;  3SAF A;  8ICA A;  4P0P A;  2ZIV B;  3PY8 A;  3GU3 A;  2L5Y A;  3KZI U;  2KP7 A;  3BQ1 A;  1SXD A;  1S0O A;  4BXO A;  5ALG A;  1QQ6 A;  5EWG A;  3V7L A;  2BCR A;  1XWL A;  4K9B A;  2EAN A;  5HML A;  5J0P A;  1QLN A;  2NRX A;  1WCL A;  2ZIV A;  1MQ2 A;  3GV7 B;  1X9X A;  4I2F A;  2NYV A;  5KAF U;  4DQI A;  3T5J A;  5J2J A;  3D6J A;  1X2I A;  1JRP A;  7ICQ A;  2LI6 A;  4CF4 A;  2Y9T A;  2P66 A;  2PKE A;  3ZDB A;  2EZY A;  2BBJ A;  5AM1 A;  2W9B A;  2V9W A;  3G6X A;  4O3M A;  1ZRM A;  2H3Z A;  2Y9U A;  4IL6 U;  2AHO B;  5J0O A;  4JUZ A;  4F5R A;  4DS5 A;  2A1A A;  2N1R A;  3RH6 A;  3QEB Z;  3RR8 A;  3TI0 A;  2H3I A;  2ZH5 A;  4NV0 A;  4ICA A;  4FFD A;  1MC8 A;  1XC9 A;  5F3X B;  3C2L A;  3LVV A;  2OYY A;  2HN1 A;  4I29 A;  1Z19 A;  5J2A A;  2HOF A;  3OJS A;  4US8 A;  2HBK A;  5J2F A;  3SD7 A;  2XY5 A;  5KFZ A;  2HI0 A;  3K1Z A;  3FC4 A;  2NRW A;  4ZH4 A;  2JHD A;  4ECR A;  1X40 A;  4US9 A;  1ZET A;  1JUD A;  2PFP A;  5HRI A;  1S10 A;  2ZH6 A;  2WF8 A;  4UBB A;  2ZIW B;  4C8K A;  4X4O A;  4FBT A;  4RWO A;  3QZ7 A;  4KLU A;  2F1I A;  2E8P A;  3WFR E;  2FE9 A;  2B0C A;  4FO1 A;  4F50 A;  3IN5 A;  5BOL A;  3BS7 A;  3QX7 A;  4IRD A;  3GQC A;  4PHD A;  4M5D A;  2ZIW A;  2Y1I A;  3GZF A;  2EH9 A;  3OVA A;  2K8A A;  3TAD C;  3OVB A;  5KG4 A;  4Y2J A;  4X0A A;  8ICN A;  2F8K A;  2RDJ A;  2Q0Z X;  5ALI A;  5KFS A;  3ER9 B;  5G5G A;  2HN2 A;  1BNP A;  1GPJ A;  4DEZ A;  3E58 A;  4FZL A;  1RXV A;  2BPG A;  4Q43 A;  4NXX A;  9ICK A;  5T14 A;  5KG0 A;  1IV8 A;  1OUQ A;  3FDS A;  3OUY B;  4IRC A;  1MIW A;  3PSI A;  4RUC A;  4G3I A;  2R8K A;  5G5H A;  7ICE A;  5EE1 A;  1F44 A;  2MU2 A;  3CYM A;  3Q8L A;  3PSP A;  1QQ5 A;  2BPC A;  1COO A;  4O3O A;  4Q8E A;  4J9Q A;  2KNJ A;  3BQ0 A;  4M9J A;  4EED A;  3EPI A;  4I28 A;  8ICT A;  5EE9 A;  2KKV A;  4PJ0 U;  1U48 A;  5CEH A;  4F4Y A;  4DSI A;  4LEV A;  2JR5 A;  3MDC A;  4KTQ A;  2LBO A;  2OHF A;  1ZQS A;  4U7C A;  4KLJ A;  5AIA A;  3M1Y A;  3EYZ A;  4DWI A;  9ICL A;  3RBE A;  5AI5 A;  1ZQF A;  5D46 A;  1EXN A;  1COK A;  3NUQ A;  3PSF A;  3MR6 A;  2F77 X;  1VDV A;  4RNN A;  2M2W A;  2MA1 A;  3C5F A;  1D8Y A;  5DGB A;  2KG5 A;  1ZQL A;  4KLI A;  4O5C A;  4PZN A;  2HOQ A;  3O0F A;  5IIO A;  4C0Z A;  2C2R A;  4JV2 A;  4KLL A;  3RB0 A;  4F4X A;  3A0B U;  3KD3 A;  1KN5 A;  1PK1 A;  4F91 B;  4YMO A;  5KT5 A;  5AHX A;  4I27 A;  1B22 A;  3ALR A;  4UB1 A;  2C22 A;  1ZXI A;  3Q8S B;  5ALT A;  1Q78 A;  1DGS A;  4Z6D A;  5HRB A;  5AK5 A;  1NKE A;  4NJ8 A;  1ZYQ A;  5DKW A;  3LVW A;  4PL2 A;  4UB3 A;  4EX7 A;  2VIX A;  3ZD8 A;  4AYB F;  5TZV A;  1WOT A;  1SIJ A;  5D4B A;  2E5S A;  4Y2V A;  5J2D A;  3NYB A;  1S76 D;  5J8Y C;  1UPH A;  5L1I A;  4OJ5 A;  4MF2 A;  4NL9 C;  2J6T A;  4WJ3 B;  2H3Q A;  1RYU A;  4UAT A;  1T4G A;  4QZI A;  3IG5 A;  4E7X A;  5JRT A;  2BQ3 A;  5KFQ A;  4MKP A;  1YLQ A;  3NRW A;  1UHU A;  3AQN A;  2JH1 A;  4K4I A;  3WU2 U;  1ZQE A;  5HMM A;  3QXG A;  5DQG A;  2FPK A;  4UAY A;  4B9T A;  3AQL A;  3M9M B;  2LYH A;  2OWO A;  2F76 X;  4BJQ A;  4WC4 A;  2NRV A;  2JRZ A;  1Q46 A;  2A1J B;  3U26 A;  3H0R B;  1L3U A;  2HOI A;  2RLT A;  1Q8K A;  7ICL A;  4NM1 A;  4CDG A;  3C23 A;  1D8B A;  5ALR A;  4NLN A;  3AEV A;  2K4E A;  4MFC A;  4RQ8 A;  3T5L A;  4F92 B;  4J9O A;  1N60 A;  1L3V A;  3GV8 B;  2A1J A;  1RXW A;  3LWM A;  4DQS A;  4DFD A;  2KJ8 A;  3HWT A;  3H8W A;  5AKH A;  3D2Q A;  3AU6 A;  1ZQY A;  1KFD A;  2BCS A;  1QSL A;  4FZM A;  3VCB A;  3ZI4 A;  2ZHA A;  1HEK A;  4IC9 A;  3FM9 A;  2JZB B;  1ZQM A;  1KLN A;  1RG6 A;  3LYS A;  9ICF A;  4BWM A;  7ICP A;  3HT3 A;  3H4B A;  2JV3 A;  4ED3 A;  5B3Q A;  2XGP A;  4KLF A;  2MSN A;  2PFQ A;  2KIW A;  1N63 A;  3AQK A;  4O6A A;  5KFY A;  3M7D A;  3F2D A;  2ZJ5 A;  4B9S A;  2KHV A;  4I2I A;  4I2C A;  3RJF A;  3QU7 A;  1ZD5 A;  2KVS A;  4PHA A;  3A0H U;  1R8C A;  5JU5 A;  5IIN A;  3OVS A;  1BPY A;  1F5A A;  5AIC A;  4ED2 A;  3G6V A;  1XSP A;  2ZIX B;  4GFJ A;  3TAC B;  1VJ7 A;  4EYH B;  5ALO A;  2KJ5 A;  4DL3 A;  2P6R A;  5AM5 A;  2YML A;  3V6J A;  2HCF A;  3MR2 A;  1Q3V A;  2EQY A;  2IA6 A;  5CWR A;  4WC6 A;  5HR6 A;  1B4F A;  2ZIX A;  1KBU A;  1TAU A;  2LMR A;  3GII A;  4DOA A;  1Z3E B;  4K4G A;  4F72 A;  4J9P A;  5ALP A;  3IP4 B;  4KLG A;  1MN8 A;  5KT4 A;  3UXN A;  1X66 A;  2XC9 A;  2KD1 A;  4O5K A;  3VC8 A;  4OAI Z;  5CJ7 A;  5ALY A;  3KHH A;  3C1Y A;  4RZR A;  4MFF A;  3E2E A;  1TK0 A;  4MEY A;  5IIL A;  4IRK A;  2JMG A;  2ZJ8 A;  4RQ4 A;  2IHO A;  5J2B A;  1RYS A;  4RQ6 A;  4AT9 B;  4NKT A;  3SEN A;  4JLZ A;  3CRX A;  3WKC A;  4I2H A;  3TQ1 A;  4GXJ A;  1BNO A;  2CXY A;  2YB1 A;  3KHG A;  1YT3 A;  4O67 A;  2KVC A;  4RQM A;  7ICT A;  9ICR A;  5C0Y A;  1XSN A;  1CEZ A;  2AH5 A;  2DWQ A;  3F2C A;  1L3S A;  3S6J A;  3UPS A;  5KL1 B;  1ZQR A;  4UB5 A;  3MGI A;  1NK7 A;  4TUS A;  5AKI A;  4QZ8 A;  4DSE A;  2AJQ A;  1X42 A;  4DCC A;  2KFZ A;  5E79 U;  3KOO A;  4WBY A;  2XCP A;  2QLT A;  2IBK A;  1SB3 C;  4MFA A;  7ICV A;  4LEW A;  5AM3 A;  1JAL A;  4ATB B;  2DR7 A;  5KG3 A;  3RB3 A;  4WC5 A;  1QTM A;  3C5G A;  1UEV A;  4UAR A;  4E80 A;  1NJY A;  2VJ5 A;  1LVH A;  2WAQ F;  1UA0 A;  3H0M B;  5EE3 A;  4I2A A;  2FDR A;  5HHH A;  2K4I A;  2VKQ A;  3BS5 B;  5DLG A;  5AKL A;  4DQQ A;  4XRH A;  2YQE A;  2F3N A;  2W03 A;  4S3N A;  4AT7 A;  3NKU A;  3NGD A;  2DKX A;  4YCX A;  4RQ5 A;  2ES6 A;  2RDI A;  2FMQ A;  1WG8 A;  3UMG A;  4XQ7 A;  9ICG A;  5CFS A;  2HHS A;  4XUS A;  2DR8 A;  5AKJ A;  1UT5 A;  3OHA A;  4YR0 A;  9ICH A;  3PZP A;  1PUZ A;  4B9M A;  5HRD A;  2IHN A;  3BS5 A;  2FCL A;  1S97 A;  4WC2 A;  7ICH A;  3RRG A;  1ZQN A;  4XJE A;  4WQL A;  2KE7 A;  5DED A;  2FMP A;  4O68 A;  3PW2 A;  5CA7 A;  3E0F A;  1NJX A;  1Z00 B;  3RJE A;  5D63 A;  4I2J A;  1L7P A;  4CRX A;  5H2F U;  5III A;  1V38 A;  3MR5 A;  3QE9 Y;  1OW5 A;  5KG2 A;  4QNL A;  2G07 A;  3CK6 A;  2MUT B;  5CP2 A;  2JGA A;  5ALV A;  4TUP A;  2ESE A;  3KFU F;  1SXE A;  5HP4 A;  2KIV A;  5KFO A;  5HRH A;  1Z00 A;  4AP9 A;  2G0A A;  4QWC A;  2LYB A;  4RQ3 A;  5KT3 A;  2IOH A;  2ZJA A;  2DR9 A;  1ED1 A;  5ALS A;  1YZ6 A;  5J0T A;  2HVH A;  4EBC A;  8ICO A;  1PX5 A;  4O69 A;  2MUT A;  3ISB A;  8ICE A;  5ALU A;  2XGQ A;  4B9U A;  8ICB A;  4DFP A;  5F9L A;  3WK6 A;  5KFW A;  2GAF D;  4BXO B;  4KB6 A;  5J0R A;  1JIH A;  1NK0 A;  4RWQ A;  2G08 A;  2M0N A;  5J2C A;  2KK0 A;  1V97 A;  2F44 A;  5J0Y A;  4EZ9 A;  5CHG A;  4IR1 A;  7ICK A;  1NO5 A;  4X4T A;  1TE2 A;  3WFP A;  2ZG6 A;  2BR0 A;  5DBA A;  1Z4O A;  4B9N A;  1U47 A;  2C2D A;  3ISD A;  4C80 A;  3NVV A;  2ZH8 A;  4IG8 A;  1S9F A;  4P0Q A;  3RR7 A;  5D61 A;  4RPZ A;  3J81 j;  1QH9 A;  3KHR A;  2YMP A;  2W9B B;  9ICI A;  2KTQ A;  1B43 A;  1L5U A;  1SL2 A;  2OEH A;  1T3N A;  3H40 A;  4J9N A;  3PX0 A;  4UB6 U;  1N61 A;  1YZ7 A;  3GIK A;  4EZ6 A;  4KN4 A;  4KMO B;  3T79 A;  2IOF A;  9ICT A;  3RRH A;  1AQ6 A;  3PW5 A;  5ALM A;  5KFU A;  5F2V O;  8ICH A;  3GIJ A;  3SMV A;  4B9L A;  1F0M A;  2BDU A;  4QZE A;  3V72 A;  9ICE A;  4X4S A;  2I6X A;  4F4Z A;  3AQM A;  3JYY A;  5ALE A;  1JX4 A;  4M9N A;  1ECW A;  3B0Y A;  5ALK A;  3TKA A;  2BCQ A;  3RF9 A;  1Q79 A;  3TAP A;  5L9X A;  2DBY A;  3PMN A;  4YP3 A;  1RQN A;  3EWA A;  4ECQ A;  4F8R A;  2EZX A;  5DG8 A;  4TQR A;  2B6G A;  1QSS A;  2NO4 A;  5J2G A;  1BPX A;  3DDH A;  4Y2T A;  3V7J A;  3IRU A; 
#chains in the Genus database with same CATH homology
 1TK5 A;  1B22 A;  4UQG A;  2XCA A;  1BGX T;  4DQP A;  4UB1 A;  4X4U A;  4FO6 A;  2C22 A;  1SL1 A;  3Q8S B;  4QZA A;  3EPG A;  1R89 A;  2PI5 A;  3UQ2 A;  1Q78 A;  1DGS A;  4Z6D A;  1DOQ A;  4FS1 A;  5HRB A;  4BWJ A;  4YXM A;  3PW4 A;  3MAB A;  1ZQU A;  1NKE A;  5DBC A;  2NRZ A;  5KFI A;  3RJJ A;  9ICQ A;  5HRK A;  5KFX A;  7ICR A;  1JXE A;  1K1Q A;  1ZYQ A;  5DKW A;  4EP7 A;  3UXO A;  7ICO A;  4UB3 A;  8ICY A;  3LDA A;  5DB9 A;  2FPM A;  3ZD8 A;  5DG9 A;  3MDA A;  5TZV A;  3T5K A;  4X4Q A;  1KRP A;  1MSW D;  1WOT A;  1NK4 A;  9ICW A;  2DPJ A;  5IIJ A;  4LT6 A;  4FHX A;  5D4B A;  4RNO A;  1U45 A;  5J2D A;  1U4B A;  3NYB A;  1S76 D;  4RNM A;  3PNC A;  3GIM A;  3TAQ A;  3K75 D;  3THV A;  4XQ8 A;  5DDM A;  4KLQ A;  8ICV A;  3HP6 A;  4ELV A;  4R65 A;  5L1I A;  5DB8 A;  2NRK A;  4ED0 A;  4MF2 A;  4QW8 A;  1FA0 A;  4Q45 A;  3QZ8 A;  4GC7 A;  2ZTE A;  4X5V A;  1ARO P;  2J6T A;  5KFV A;  9ICU A;  2HW3 A;  4I27 A;  4F3O A;  1ZQZ A;  1S77 D;  1JQR A;  1UEU A;  3C2M A;  2HHU A;  4C8L A;  4M9L A;  4XA5 A;  2ZH9 A;  2W9A A;  5KFC A;  4C8O A;  2BE3 A;  2W9M A;  1T4G A;  2VA3 A;  1KSP A;  3JZ0 A;  4PGX A;  5HRL A;  4QZI A;  1A77 A;  1ZJM A;  4E7X A;  2BQ3 A;  5KFQ A;  1HUZ A;  1YLQ A;  5HC9 A;  1UT8 A;  4NLG A;  3N97 B;  3AQN A;  4GXI A;  4JV1 A;  1NKB A;  4X4V A;  2R8H A;  4K4I A;  4LZD A;  3RJI A;  4J9K A;  3JPN A;  5KT2 A;  3HW8 A;  1X9W A;  1ZQE A;  5HMM A;  1N48 A;  5DQG A;  2FPK A;  4UAY A;  4B9T A;  4WC7 A;  4ECS A;  1UA1 A;  5KG5 A;  8ICQ A;  3GDX A;  3AQL A;  3M9M B;  2LYH A;  4IQT A;  7ICN A;  4J9R A;  3EW9 A;  2OWO A;  3HJ1 A;  4FHW A;  3PW7 A;  3PX4 A;  2BQU A;  4WC4 A;  2F1J A;  4ED6 A;  2JEG A;  2ASD A;  5DDY A;  1BPZ A;  5KG1 A;  3ZDD A;  3HPO A;  2NRV A;  1XS9 D;  2BDP A;  2ZTC A;  5KFG A;  3SYZ A;  1N56 A;  2A1J B;  1NK8 A;  1CUK A;  1V9P A;  3UXP A;  5DQI A;  1S0N A;  2UVU A;  7ICF A;  3H37 A;  2DRB A;  1ZQQ A;  4QWE A;  1L3U A;  9ICS A;  4FH3 A;  4P4P A;  3TFR A;  1NKC A;  7ICL A;  4JWM A;  3B0X A;  4NM1 A;  4ECW A;  5KFF A;  3C23 A;  1SL0 A;  4R63 A;  3BQT A;  4NLN A;  2KZ3 A;  1HJP A;  4UD5 A;  4Z6E A;  4DL4 A;  4AT9 A;  4EBJ A;  1VFG A;  5L1K A;  4MFC A;  4RQ8 A;  3T5L A;  4F92 B;  4IQV A;  3SZ2 A;  5J0S A;  4J9O A;  2BQR A;  2C2E A;  1HUO A;  2HHT A;  8ICZ A;  1JMS A;  1L3V A;  4F5N A;  1TFY A;  3Q8P B;  3GV8 B;  2A1J A;  3MGH A;  4DSJ A;  2M2T A;  9ICV A;  1RXW A;  3HX0 A;  4HYK A;  4TUQ A;  3LWM A;  3BJY A;  3AU2 A;  2FLL A;  4DQS A;  3OSP A;  5HHI A;  4R8U B;  4DSF A;  4RQ7 A;  8ICF A;  5KFP A;  3M9O B;  3JPO A;  3HWT A;  3H8W A;  1T8E A;  2BGW A;  5J2H A;  5KTQ A;  4DLE A;  3AU6 A;  4M04 A;  1ZQY A;  1KFD A;  2Y1J A;  2BCS A;  1QSL A;  2JEI A;  2ZHA A;  5DQH A;  4RUA A;  4ED1 A;  3RB6 A;  4P4O A;  4RPX A;  4X4R A;  4UBC A;  4RWN A;  2JZB B;  3JPT A;  1ZQM A;  1KLN A;  7ICJ A;  1NOM A;  4O0I A;  4EEY A;  4PPX A;  9ICF A;  4BWM A;  4DL6 A;  7ICP A;  1TFW A;  3HT3 A;  3H4B A;  4ED3 A;  4RWP A;  4I2G A;  1MIV A;  2M2V A;  4EBD A;  1IXR A;  2XGP A;  2I9G A;  4DSL A;  4KLF A;  4PGY A;  3H39 A;  4R8U A;  5EWF A;  4DQR A;  1JN3 A;  4MF8 A;  2PFQ A;  3IM1 A;  4F4W A;  3Q8R B;  5KFY A;  2PBE A;  1NK6 A;  3AQK A;  3H3A A;  2ZJ5 A;  4UB4 A;  4B9S A;  2R8G A;  4DFM A;  3Q8Q B;  2KN7 A;  5KG6 A;  1TV9 A;  4I2I A;  2UVW A;  3RB4 A;  4ATB A;  4YD2 A;  2R8J A;  4YG2 A;  2DFL A;  3RJF A;  4I2C A;  4O9M A;  4PHA A;  3V7K A;  2BHN A;  2ZUC A;  5KT7 A;  3WFO A;  4Q44 A;  1R8C A;  3TAN A;  3H4D A;  5IIN A;  4YVZ A;  2C28 A;  4R66 A;  3LWL A;  4J9L A;  1DK2 A;  2ZHB A;  4LVS A;  3OVS A;  1BPY A;  1F5A A;  3C1Z A;  4YFK A;  8ICI A;  4RT3 A;  5CR0 A;  3PO4 A;  4DL7 A;  4NLZ A;  4ED2 A;  2AQ4 A;  4WC1 A;  3G6V A;  1XSP A;  1KFS A;  9ICP A;  3SI8 A;  4M2Y A;  5DB6 A;  5KT6 A;  1BVS A;  1U49 A;  5DEC A;  2WTF A;  1ZJN A;  8ICP A;  2VAN A;  1SKS A;  3ZDA A;  4F2R A;  1VJ7 A;  4EYH B;  3N4M B;  4DL3 A;  2ISP A;  4DFK A;  2P6R A;  1ZQV A;  2ZUB A;  1KDH A;  2ZH4 A;  4F93 B;  4Q8F A;  2O1P A;  3HIY A;  4NY8 A;  4F5O A;  3M9N B;  3V6J A;  4TQS A;  3JPR A;  4B9V A;  3MFI A;  4O3Q A;  1ZQJ A;  4UD4 A;  1XO1 A;  2IMW P;  3MR2 A;  4I2E A;  3RJG A;  3PR5 B;  1KFT A;  1NJZ A;  1ZQK A;  4BDP A;  4F5Q A;  2IA6 A;  7ICS A;  2FPL A;  5CWR A;  4WC6 A;  1R8A A;  4KLT A;  1PZN A;  4ED8 A;  2AGP A;  5C5J A;  3GIL A;  4IQW A;  1TAU A;  3GII A;  3H7I A;  9ICN A;  3KHL A;  4DOA A;  4I2D A;  8ICJ A;  4EBE A;  4FHY A;  1Z3E B;  1RYR A;  4K4G A;  1X9M A;  3PR4 A;  2XO7 A;  4DO9 A;  4J9P A;  4GXK A;  1TK8 A;  4KLG A;  2M2U A;  2ZUD A;  5KT4 A;  3UXN A;  3LK9 A;  4I2B A;  5J0W A;  2XC9 A;  4KIT B;  1ZQO A;  4O5K A;  4M9H A;  1XSL A;  4JK1 A;  2HHV A;  5CJ7 A;  3M8R A;  4EYI B;  4DL2 A;  2NRT A;  3KHH A;  2DPI A;  2V4R A;  4ECY A;  3TFS A;  3C1Y A;  2XY7 A;  4YXJ A;  4PHP A;  4RZR A;  5KFD A;  4MEX A;  4MFF A;  3E2E A;  1TK0 A;  7ICM A;  4M9G A;  4Z6C A;  4MEY A;  3LQC B;  2H5X A;  4RT2 A;  2AGQ A;  3Q8M A;  2BCU A;  2ATL A;  4JWN A;  1DK3 A;  2HHQ A;  5IIL A;  4IRK A;  2ZH7 A;  3OHB A;  2FLN A;  4QZC A;  5HNK A;  2ZJ8 A;  4FHV A;  4YD1 A;  3OJU A;  4RQ4 A;  3PML A;  3SV4 A;  5J2B A;  1RYS A;  3PO5 A;  3AUO A;  1BPB A;  4RQ6 A;  2VA2 A;  4AT9 B;  4ED7 A;  4M0A A;  5KFA A;  5J0U A;  1XU4 A;  1D9D A;  1SZP A;  3L9D A;  4ECV A;  4NKT A;  1RPL A;  5DGA A;  4GLX A;  2PI4 A;  4RQ1 A;  4IR9 A;  3TQ1 A;  2JEF A;  4I2H A;  4O3R A;  8ICX A;  2FLP A;  4UAW A;  8ICA A;  1D8L A;  4GXJ A;  5KFB A;  1BNO A;  3PY8 A;  4M47 A;  2AQ0 A;  4QWA A;  3ISC A;  3JPP A;  1ZQB A;  3KHG A;  2DRA A;  2KP7 A;  7ICT A;  9ICR A;  4DS4 A;  1ZQW A;  4DF8 A;  3BQ1 A;  1S0O A;  2ISO A;  1S0V A;  2MAX A;  1SKW A;  4BXO A;  1XSN A;  1CEZ A;  1T7P A;  5EWG A;  3OV7 A;  3V7L A;  3QEA Z;  4JV0 A;  2BCR A;  4KLO A;  4YQW A;  4O3P A;  1RZT A;  2ZH3 A;  1L3S A;  1XWL A;  3UPS A;  3RTV A;  1ZQR A;  3RH5 A;  5HML A;  4UB5 A;  3MGI A;  5KFK A;  3PVX A;  4TUS A;  1NK7 A;  3BDP A;  5J0P A;  4KLD A;  1QLN A;  2NRX A;  1WCL A;  1MQ2 A;  4F4K A;  3GV7 B;  4PH5 A;  4QZ8 A;  4DSE A;  2AJQ A;  5HRE A;  3C2K A;  4WC0 A;  2KFZ A;  4WBY A;  4I2F A;  4RU9 A;  2XCP A;  4TUR A;  3V6K A;  2XY6 A;  8ICW A;  4KLS A;  5EWE A;  3H8S A;  5EOZ A;  4MFA A;  2IBK A;  4DQI A;  3T5J A;  5J2J A;  8ICS A;  7ICV A;  2ZH2 A;  5J2I A;  4NM2 A;  3RJH A;  4ATB B;  2DR7 A;  2HHW A;  5KG3 A;  3RB3 A;  9ICA A;  4WC5 A;  1X2I A;  4CCH A;  4QZ9 A;  9ICO A;  5KFN A;  3MFH A;  7ICQ A;  1QTM A;  5KFH A;  3C5G A;  1UEV A;  1MQ3 A;  4E80 A;  3OUY A;  3T3F A;  1ZQI A;  2W9C B;  4O3S A;  1NJY A;  5J2E A;  4FS2 A;  3FYH A;  2ASL A;  1UA0 A;  2P66 A;  3ZDB A;  2P6U A;  4M6W B;  2UVR A;  2KZM A;  2W9B A;  3NTU A;  2V9W A;  3G6X A;  4I2A A;  1QSY A;  5HHH A;  5J0O A;  4JUZ A;  1SKR A;  2J6U A;  4RPY A;  1A76 A;  3K4G A;  3V6H A;  5DLG A;  4F5R A;  3MBY A;  4DS5 A;  4DQQ A;  1LB2 B;  4XRH A;  5F9N A;  4DOB A;  3WFQ E;  4QZH A;  1KEJ A;  4S3N A;  3RH6 A;  3QEB Z;  4AT7 A;  3NGD A;  5DBB A;  4DFJ A;  4YCX A;  4RQ5 A;  1LV5 A;  2RDI A;  2FMQ A;  3RR8 A;  3TI0 A;  4KLM A;  3IHQ B;  2W9C A;  4XQ7 A;  1MIY A;  9ICG A;  3JPQ A;  4DSK A;  3H38 A;  2ZH5 A;  2HHS A;  1ZQC A;  2HVI A;  4XUS A;  4M6W A;  2DR8 A;  4YR2 A;  1UT5 A;  3OHA A;  5L1L A;  4YR0 A;  1MC8 A;  9ICH A;  5BPC A;  1XC9 A;  3SV3 A;  2M9N A;  3ORY A;  4B9M A;  5HRD A;  1WCN A;  3C2L A;  4M5D A;  2IHN A;  1TKD A;  1S97 A;  1NZP A;  1ZQA A;  4I29 A;  8ICC A;  4WBZ A;  5HR9 A;  4WC2 A;  4KLE A;  4ECX A;  2UVV A;  8ICM A;  2ZTD A;  5J2A A;  4J9S A;  3RRG A;  7ICH A;  1ZQN A;  3OJS A;  2HHP A;  4X4N A;  5DED A;  4LZG A;  2FMP A;  5J2F A;  4YMN A;  3PW2 A;  5CA7 A;  1S0M A;  1NJX A;  1Z00 B;  3RJE A;  7ICI A;  1V4A A;  4I2J A;  4QZG A;  4F2S A;  5IIK A;  4DF4 A;  3KTQ A;  5D49 A;  5III A;  3MR5 A;  2XY5 A;  5KFZ A;  1BPE A;  3QE9 Y;  5J0Q A;  3WFS C;  4NXZ A;  4ECZ A;  2HHX A;  2NRW A;  3ETL A;  4BGD A;  9ICC A;  5KG2 A;  4ZH4 A;  4ECR A;  4Z6F A;  3BQ2 A;  8ICL A;  4QZD A;  1D9F A;  1KTQ A;  1ZET A;  2BPF A;  4K4H A;  4NKU A;  2MUT B;  2PFP A;  5HRI A;  1S10 A;  2ZH6 A;  2DVI A;  5CP2 A;  3PW0 A;  4TUP A;  4UBB A;  5HP4 A;  4C8K A;  5KFO A;  4FBT A;  4X4O A;  5HRH A;  4RWO A;  1Z00 A;  3QZ7 A;  4E0D A;  2PFO A;  4KLU A;  1Y88 A;  2F1I A;  4KN7 A;  3OSN A;  3M8S A;  1R8B A;  2DR5 A;  4QWC A;  3C21 A;  3WFR E;  4RQ3 A;  3Q8K A;  5KT3 A;  2ZJA A;  4DL5 A;  2IHM A;  3C66 A;  2DR9 A;  9ICJ A;  5IIM A;  2AGO A;  5J0T A;  2HVH A;  4EBC A;  4F50 A;  4P2H A;  5BOL A;  8ICO A;  1PX5 A;  4RQ2 A;  2MUT A;  1ZQG A;  1ZQX A;  3ISB A;  4IRD A;  4EBK A;  2JEJ A;  3GQC A;  4X0B A;  4PHD A;  8ICE A;  3PV8 A;  2GWS A;  2XGQ A;  3ZD9 A;  2Y1I A;  1TVA A;  1KNY A;  3G6Y A;  4B9U A;  8ICB A;  4DFP A;  5F9L A;  5HRG A;  2ID1 A;  3JPS A;  5KFW A;  3OVA A;  1BPD A;  4BXO B;  5J0R A;  5JUM A;  3OVB A;  1JXL A;  1JIH A;  5KG4 A;  1ZQT A;  2W8L A;  4X0A A;  4QZF A;  1NK0 A;  3H8J A;  4J9M A;  1ZQP A;  8ICN A;  5KG7 A;  2RDJ A;  3C18 A;  4RWQ A;  4IQU A;  2F1H A;  2Q0Z X;  5KFS A;  1L3T A;  4DLG A;  5J2C A;  9ICM A;  3UPQ A;  1BNP A;  4YR3 A;  4FH5 A;  4DEZ A;  4QWB A;  5DB7 A;  5J0Y A;  4EZ9 A;  4GC6 A;  2KZZ A;  4UAZ A;  5CHG A;  4FBU A;  3EZ5 A;  4IR1 A;  5KFJ A;  1RXV A;  4O5E A;  7ICK A;  2BPG A;  4ELU A;  3UQ0 A;  3RAQ A;  4Q43 A;  2V4Q A;  1NO5 A;  2BKE A;  4NLK A;  4WCW A;  4WC3 A;  4X4T A;  5CB1 A;  3WFP A;  9ICK A;  2PXI A;  2BR0 A;  5DBA A;  2BCV A;  5KFR A;  3TAR A;  1U47 A;  4B9N A;  3OGU A;  2C2D A;  2B21 A;  5KG0 A;  3ISD A;  1UET A;  4AT8 B;  9ICX A;  2ZH8 A;  2VA8 A;  4IG8 A;  5J0X A;  3FDS A;  3T5H A;  1S9F A;  3RR7 A;  4IRC A;  9ICB A;  5KFM A;  1MIW A;  3OUY B;  4RUC A;  2Q66 A;  4G3I A;  2R8K A;  4PHE A;  2ALZ A;  5KFL A;  1TAQ A;  4RPZ A;  3RH4 A;  7ICE A;  4E8F A;  3KHR A;  3Q8L A;  2W9B B;  4QZB A;  2BPC A;  8ICG A;  1COO A;  4O3O A;  8ICR A;  9ICI A;  4C8M A;  1NK5 A;  3GFK B;  4J9Q A;  4ELT A;  4Q8E A;  7ICU A;  3BQ0 A;  4M9J A;  4YMM A;  3MR3 A;  3RAX A;  2W8K A;  2KTQ A;  5HRF A;  3EPI A;  1B43 A;  4I28 A;  8ICT A;  5DLF A;  1L5U A;  4AT8 A;  4P4M A;  4F5P A;  1SL2 A;  4AT7 B;  1T3N A;  2ASJ A;  3H40 A;  4J9N A;  3PX0 A;  3RBD A;  1U48 A;  4PGQ A;  5DG7 A;  4C8N A;  4R64 A;  5KFE A;  3GV5 B;  3GIK A;  4F4Y A;  4EZ6 A;  1JAJ A;  4KN4 A;  4DSI A;  4DOC A;  4YN4 A;  2O5A A;  3MDC A;  1C7Y A;  9ICT A;  8ICK A;  3RJK A;  4QWD A;  4UB2 A;  1X9S A;  4KTQ A;  3PX6 A;  4QW9 A;  3RRH A;  1ZQS A;  4X4P A;  4ECU A;  1OU5 A;  3PW5 A;  5KFU A;  5F2V O;  7ICG A;  4KLJ A;  8ICH A;  5J2K A;  3GIJ A;  3HJ4 A;  1NK9 A;  2FMS A;  4B9L A;  4FHP A;  2AU0 A;  3EYZ A;  4QZE A;  3V72 A;  1K1S A;  4DWI A;  9ICE A;  3RBE A;  9ICL A;  4X4S A;  4ECT A;  1ZQF A;  5D46 A;  4KLH A;  2RFF A;  5L1J A;  1EXN A;  4F4Z A;  3ZDC A;  3ZDE A;  2ZH1 A;  5KFT A;  3AQM A;  3JYY A;  1U9L A;  1H38 A;  1JX4 A;  3MR6 A;  4M9N A;  3B0Y A;  4RNN A;  2M2W A;  2BCQ A;  1Q79 A;  2KFN A;  3TAP A;  3C5F A;  5L9X A;  1D8Y A;  2J6S A;  8ICU A;  5DGB A;  1ZQL A;  3PMN A;  4YP3 A;  3EWA A;  2R8I A;  4ECQ A;  4KLI A;  4O5C A;  4F8R A;  1NJW A;  1ZQH A;  5DG8 A;  4TQR A;  2PFN A;  1QSS A;  5IIO A;  4JV2 A;  2C2R A;  4KLL A;  2JZB A;  5J29 A;  3RB0 A;  4RQ0 A;  4F4X A;  1TFR A;  2I1Q A;  4F91 B;  5BOM A;  4O3N A;  5J2G A;  4YMO A;  4KMU A;  1BPX A;  5KT5 A;  1IM4 A;  3V7J A;  1ZQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...