4M2YA

Structure of human dna polymerase beta complexed with 8-brg as the template base in a 1-nucleotide gapped dna
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
325
structure length
319
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 319
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m2yA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m2yA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m2yA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m2yA03
2HVHA 3RJIA 3V7JA 5IIJA 4RUAA 5DGAA 5CJ7A 3ISCA 8ICEA 5KFSA 2AGQA 4M2YA 2ZH7A 2DR9A 4DF8A 4E80A 2MUTB 4FO6A 5IILA 3PW4A 3M8SA 3TANA 4PPXA 3LDAA 2AQ4A 5DGBA 4K4IA 5KFVA 4DQPA 4KLHA 2DR7A 5KFDA 5D4BA 5D49A 4MEYA 4X4OA 3T5KA 4YMMA 1ZYQA 1YLQA 4QZ8A 2R8JA 3EW9A 4RQ2A 5KG0A 4O3PA 5KFXA 5BPCA 3TAPA 1NJWA 5KFIA 5J2GA 1RXWA 4PHDA 4NKTA 4FBTA 3KHLA 2ZHAA 3C66A 3RH5A 2ALZA 5KT3A 1IXRA 3AQNA 4ED2A 1LB2B 3PVXA 2I9GA 2H5XA 1WCNA 5IIOA 9ICAA 4RT2A 3JPNA 4IR9A 4DSLA 3C5GA 1N48A 3SV3A 4IRCA 4I2GA 4F91B 3GIMA 7ICGA 4C8MA 3HW8A 3WFQE 2W8KA 2ASJA 5KFPA 4MFAA 3BJYA 4X5VA 2R8GA 1BPYA 4DSJA 2ZH8A 4M0AA 5KFUA 4YMNA 4WC3A 4QZ9A 3LQCB 2DVIA 4EP7A 3UQ2A 4C8NA 2ZH1A 4RNNA 2A1JA 1UT5A 4QWCA 2JEIA 8ICJA 4RQ1A 5DLGA 2XO7A 5KFZA 4F5RA 4XRHA 4DL4A 4PHEA 4DF4A 4ED1A 1ZETA 4ELTA 7ICIA 4F2SA 2KFNA 2FMPA 3OHAA 4UD4A 4DSFA 4BWJA 3HJ1A 1F5AA 4O3NA 3H7IA 4Z6FA 4O0IA 3T5JA 4G3IA 4YG2A 5J2IA 2XY5A 1X9WA 4B9VA 5HRFA 3LWMA 2DR5A 3OJUA 3LWLA 5J2HA 2C2DA 4IQUA 2BCQA 2W9CA 4KLTA 1B22A 4KLUA 3OVAA 7ICFA 4I2BA 4NLZA 5KFEA 4MF8A 3JPSA 1TAQA 3C2KA 5DKWA 3G6XA 1RYSA 5J2DA 5F9NA 4QZCA 4K4GA 4F4ZA 8ICUA 5J0SA 1D9DA 3ZD9A 1L3UA 5KFRA 3THVA 2P6RA 4KMUA 3AU6A 1BPEA 2JEJA 4RWOA 1NK8A 3ZDDA 5L9XA 4UBBA 3C5FA 2ASLA 7ICKA 4E0DA 4JWNA 2XCPA 1V9PA 3KHGA 5J0PA 2BQUA 2ZTCA 4JK1A 4RUCA 9ICHA 4RNOA 9ICQA 4ED3A 4Z6DA 2VANA 5DBBA 5KFWA 1LV5A 4NKUA 1XO1A 2Q0ZX 4QW8A 2FPMA 5EOZA 4F3OA 4DFKA 4KLIA 8ICHA 3HIYA 4GXIA 5L1JA 3QE9Y 2UVUA 3AQKA 1TAUA 4M6WB 4YD1A 4DOAA 4M9NA 1TFYA 4AT7A 2C22A 3SYZA 1Z00B 3RJJA 4F92B 8ICNA 4DL6A 3BQTA 4MEXA 4YR2A 5DQIA 9ICJA 3T3FA 3RBDA 1XC9A 5DQHA 5KT2A 5IIKA 3RTVA 1HJPA 2F1IA 1NJYA 4KLOA 9ICTA 5HRDA 3WFRE 3M9OB 5J2FA 2ZH4A 4X4NA 4UD5A 3T5HA 2DRAA 3HX0A 4ECXA 9ICRA 1UA0A 1RXVA 4WC0A 3EYZA 5KFFA 5J2CA 5DQGA 4UB2A 4NLNA 1NO5A 2ZH9A 2M2VA 1TFWA 5EWFA 4Q43A 4YD2A 4UQGA 2DPJA 3AQMA 2ISOA 9ICOA 4RQ8A 1S77D 5KTQA 1DOQA 1AROP 5DDMA 3HT3A 9ICWA 4DQQA 3MR3A 2V4QA 1ZQKA 1NK0A 4NLGA 5CP2A 4P2HA 4DO9A 4QZBA 2ID1A 4Z6CA 3WFSC 4GC7A 2O5AA 4EBCA 1ZQQA 3BQ2A 4GXJA 4F8RA 4QWBA 5KFHA 4ECQA 3RAXA 4XQ7A 4I2EA 4TUQA 3C1YA 3H8JA 2NRTA 2BGWA 9ICEA 1JMSA 3MR5A 4IRDA 4XA5A 2NRVA 4ELUA 4ECWA 5HMMA 7ICTA 4X4RA 4PGQA 3SV4A 5HRIA 1T4GA 5EWGA 4NM1A 4YFKA 4TURA 1JXEA 3UQ0A 4DL5A 3RJGA 2ZJ8A 4QZDA 3OSPA 2M9NA 4ECUA 5IIIA 4AT9B 3MBYA 2IBKA 3ZDCA 2BCVA 4O3QA 3MR2A 9ICMA 2HHPA 5F9LA 1XU4A 9ICCA 1MQ2A 1PZNA 4XQ8A 5HHIA 1COOA 3PMLA 4BDPA 2ZTEA 1N56A 2RDIA 2ISPA 4M9LA 1A77A 5TZVA 1ZQXA 3MFIA 2PFNA 1U49A 5JUMA 1Y88A 2IHNA 2MUTA 4P4OA 4ECTA 4I27A 4M9JA 1SKWA 3LK9A 3RJEA 3GIIA 4NLKA 3N97B 4EZ9A 3C23A 5DG7A 8ICQA 9ICIA 8ICXA 3OVBA 5J2AA 5KFJA 3G6VA 5BOLA 4RPYA 3OVSA 3ORYA 4J9MA 3TI0A 3PR4A 7ICNA 5HRGA 4KLFA 4O9MA 4RWQA 4X4TA 3HWTA 2P66A 3ZDEA 4EEYA 2BQRA 2ATLA 1ZQWA 1KTQA 4YCXA 3IM1A 3RJFA 1BPZA 9ICFA 4F5NA 4QZIA 1TK0A 5KG3A 4FHYA 4WC6A 4CCHA 3EWAA 2ZJ5A 4YR0A 3MGHA 4Q8EA 2ZHBA 5J0WA 7ICSA 4UAZA 4YP3A 3TQ1A 4QZHA 1H38A 4EBJA 2J6SA 1RYRA 4DOBA 1ZJMA 2BCRA 2FLPA 4O5EA 9ICUA 3GILA 2V9WA 1U48A 4M5DA 9ICSA 9ICXA 4ED0A 4IQWA 8ICZA 7ICLA 4MF2A 3H40A 4B9LA 1QSLA 5C5JA 2MAXA 2J6TA 4WC4A 2C28A 2PXIA 3GFKB 4DLEA 4R63A 2OWOA 4I2FA 4DSIA 4O3SA 4KLDA 1T8EA 4E7XA 4RNMA 4RQ7A 1ZQJA 3HP6A 3Q8KA 5KFNA 1BPXA 5DDYA 4C8KA 1R8AA 4KLSA 1TK5A 1NZPA 4O5KA 9ICPA 4WC2A 3Q8QB 4QZGA 4DQRA 4UB1A 4X4UA 4LVSA 4I2JA 5D46A 4ELVA 4WBYA 2BQ3A 1NKEA 5J2JA 3JPOA 4QZFA 4F5OA 1XSPA 5DBCA 2FMSA 4JV2A 4RQ3A 3PR5B 3B0YA 1SL2A 1DGSA 4Q44A 1DK3A 5KFMA 1UEUA 3ZD8A 1X2IA 2W9BB 4GXKA 3FYHA 2W9BA 4MFFA 1MIVA 4RU9A 4J9QA 1NK6A 2BPGA 7ICJA 1KLNA 5KFTA 3QEBZ 1TKDA 1L5UA 1ZQEA 3H3AA 2PFQA 1UT8A 3KTQA 5J2EA 1ZQBA 1EXNA 2ZUBA 5DBAA 4UAYA 1UA1A 3H8WA 3C21A 4IQVA 5HHHA 5HC9A 2FLNA 4JV1A 2Q66A 3RAQA 4LZDA 2F1JA 3C1ZA 1TK8A 4FS2A 2ZTDA 4S3NA 3RRHA 4R8UB 3H8SA 1ZQYA 3BQ0A 4ED6A 5KG7A 3TARA 5F2VO 4M04A 5BOMA 4KLGA 3GV8B 8ICIA 4WCWA 2C2EA 2PFPA 4YXMA 2GWSA 4M6WA 2FMQA 4X0AA 4ZH4A 2NRWA 1KFDA 3OJSA 1Z00A 9ICVA 1MC8A 3HPOA 3FDSA 1R89A 4J9LA 2ZH2A 1NK9A 2JEGA 4DL2A 1T3NA 8ICLA 5KFLA 4PGYA 5KFQA 4QZAA 5HRKA 1MIWA 1WCLA 3H37A 2R8IA 4PHPA 4ED7A 3NTUA 1CUKA 4YMOA 3M8RA 5J0YA 4ECZA 3V6KA 3PX4A 3TAQA 2DPIA 2BDPA 4KLQA 5HMLA 2FPLA 4FH3A 3UXPA 3PY8A 8ICAA 4RZRA 5CB1A 3PX6A 3V6HA 3BQ1A 4AT8B 4DWIA 1JX4A 5KG1A 3NGDA 4JV0A 1U45A 4YQWA 1JIHA 3QZ8A 3RBEA 4ECSA 1ZQOA 1KFSA 1BNOA 3MGIA 2HHSA 5KT4A 1TVAA 9ICGA 2HVIA 5DLFA 1ZQTA 7ICVA 3Q8PB 3PW0A 4KLMA 4J9PA 4BXOB 4NM2A 4BWMA 1ZQFA 5KG5A 5EWEA 4ECVA 3RJHA 5J0XA 3GQCA 4RWNA 5KFAA 4UBCA 1BPDA 1D9FA 1S97A 4UAWA 2HHXA 2ZH6A 4IG8A 4KLJA 3V72A 1MQ3A 3MABA 2HHQA 3TFRA 4TUSA 3ZDAA 2WTFA 1HUOA 2AJQA 3WFPA 2V4RA 4J9NA 4FBUA 1V4AA 8ICBA 3OGUA 4AT9A 1Q78A 4R66A 1TFRA 3RRGA 4QW9A 5IINA 2FLLA 3ZDBA 2KZZA 3H39A 2KTQA 4F4XA 2UVWA 4UB4A 2LYHA 2C2RA 2FPKA 1S76D 7ICUA 3GIKA 3PV8A 3PO5A 5DB8A 1NKCA 5DB7A 1ZJNA 1DK2A 4X4SA 4YVZA 4P4MA 2BR0A 3N4MB 4DQSA 4RQ5A 7ICHA 2PFOA 8ICTA 1ZQAA 3Q8MA 4EBEA 1QSSA 2PBEA 2Y1IA 1KNYA 2O1PA 4B9MA 1KRPA 1BNPA 1HUZA 4F50A 5KFBA 2RFFA 1T7PA 4Q45A 4FHPA 2R8KA 2BPCA 4P4PA 2F1HA 4TQSA 5CA7A 5DECA 2ZUDA 1U4BA 1JQRA 4EBDA 5KFYA 4B9NA 4FHWA 1ZQPA 4F2RA 4M9HA 4WC5A 5DB6A 3OSNA 4RPXA 5L1LA 1ZQGA 3PO4A 3RR8A 3SI8A 1JAJA 3RB3A 3C2LA 5IIMA 3C18A 5KG4A 2VA3A 3QEAZ 3OHBA 1CEZA 1Z3EB 5KT6A 1NJXA 4GC6A 3IHQB 4RWPA 1C7YA 5J29A 4F4YA 3JPTA 1L3VA 2M2TA 2JEFA 8ICMA 2DRBA 2DFLA 1ZQNA 5KFKA 1NKBA 1BPBA 1ZQCA 1KFTA 1SL1A 4DS5A 4KITB 2KFZA 3ETLA 4F5PA 4I29A 4BGDA 3BDPA 1VJ7A 4JUZA 2UVVA 2ZH5A 1BGXT 5KFCA 5CHGA 3TFSA 4DSEA 1X9MA 3H38A 4YR3A 2VA8A 1A76A 3UXNA 1ZQSA 3RR7A 5HP4A 4EZ6A 2M2WA 5KT7A 2UVRA 3AU2A 3JPQA 2W9AA 4ECYA 3JYYA 4DSKA 2NRXA 4WC7A 4X4PA 1D8LA 3JPRA 3RB6A 4UB5A 5J0TA 4FHVA 1NK5A 4WC1A 1RPLA 2BKEA 2PI5A 4PGXA 3PW2A 2BPFA 2W9MA 8ICYA 4LT6A 4TQRA 4NY8A 3OUYB 3AUOA 2BCSA 3OUYA 2KZMA 4BXOA 4XUSA 4F5QA 2AQ0A 2HHWA 3NYBA 5HRLA 3KHRA 3GIJA 1KDHA 4EBKA 2XY6A 1Q79A 1VFGA 1L3TA 2XC9A 4FS1A 2AGPA 2PI4A 5KFOA 5CWRA 1XSLA 5HNKA 5HRBA 1B43A 4J9RA 5J0UA 2XY7A 1NJZA 4EYHB 2A1JB 4IR1A 8ICWA 1MIYA 4JWMA 2B21A 1S0VA 1WOTA 2ZH3A 1U9LA 1ZQHA 1OU5A 4F93B 3UPQA 4O3OA 3T5LA 2HW3A 1X9SA 2HHTA 4X4QA 1TV9A 4NXZA 3KHHA 4YXJA 4Z6EA 4DS4A 4I2AA 1UEVA 5HR9A 4R64A 3V7KA 4J9OA 3Q8LA 1SKRA 8ICCA 1IM4A 9ICNA 4KN4A 4MFCA 7ICPA 8ICOA 4R8UA 4IQTA 3HJ4A 1SKSA 1QSYA 4M47A 8ICGA 2P6UA 2W9CB 4DFMA 2M2UA 4RQ4A 4DL3A 1ZQLA 5DG9A 8ICFA 1XS9D 3RJKA 4I2HA 8ICKA 4F4WA 4KLLA 4FH5A 3MR6A 1U47A 1NK4A 3JPPA 1L3SA 4DOCA 4ECRA 3L9DA 4KN7A 4LZGA 2JZBB 5J2BA 2JZBA 3V7LA 2BE3A 4PH5A 1ZQMA 4DFPA 4I2IA 3M9NB 3V6JA 2IHMA 7ICQA 5L1IA 4C8LA 1R8BA 4X0BA 2KZ3A 1ZQRA 3Q8SB 2NRZA 7ICOA 1ZQDA 3SZ2A 1MSWD 1S10A 3EPIA 9ICLA 5DEDA 4B9UA 3GDXA 1S9FA 4DQIA 7ICEA 3JZ0A 3PMNA 1XSNA 1NOMA 4DFJA 2DR8A 4DEZA 3GV7B 1K1SA 4RQ6A 2HHUA 3WFOA 4RQ0A 1ZQIA 3RH4A 4I28A 4J9SA 5DG8A 4AT8A 4AT7B 4K4HA 3AQLA 4B9SA 5J0QA 4O5CA 5HRHA 3UXOA 8ICVA 2XGPA 9ICBA 4E8FA 4QZEA 2W8LA 3K4GA 2AU0A 5HREA 5KG6A 1S0MA 4B9TA 1R8CA 1UETA 2IA6A 1KEJA 1ZQZA 3MDCA 3ISBA 2ASDA 3H4BA 2J6UA 2VA2A 4QWEA 2HHVA 5J0OA 8ICSA 4ATBB 4ATBA 4C8OA 2ZJAA 3Q8RB 7ICRA 5KT5A 4WBZA 2BHNA 4YN4A 1JN3A 2KN7A 9ICKA 2NRKA 1S0OA 2KP7A 2XCAA 1NK7A 4Q8FA 1FA0A 4M9GA 1KSPA 2RDJA 2I1QA 3MDAA 3PW5A 3H4DA 5KFGA 5J2KA 4GLXA 3PX0A 4EYIB 5J0RA 3GV5B 3QZ7A 3RB0A 8ICPA 3C2MA 1BVSA 4R65A 4HYKA 4UB3A 5CR0A 3PW7A 1JXLA 3K75D 1RZTA 4I2DA 4TUPA 4X4VA 2AGOA 1QTMA 5L1KA 3UPSA 4KTQA 4DL7A 2IMWP 4RPZA 3E2EA 4I2CA 2XGQA 7ICMA 3M9MB 4QWAA 4RT3A 1S0NA 1D8YA 1K1QA 4QWDA 3EZ5A 5DB9A 4O3RA 1XWLA 3PNCA 5KG2A 2ZUCA 3RH6A 1SL0A 1ZQUA 2BCUA 1SZPA 4FHXA 1ZQVA 4KLEA 1PX5A 3EPGA 3MFHA 3G6YA 2R8HA 3B0XA 4J9KA 4DLGA 4ED8A 8ICRA 4F4KA 3OV7A 2Y1JA 1QLNA 3RB4A 4PHAA 3ISDA 4IRKA
chains in the Genus database with same CATH superfamily
2FI1A 2LMRA 5CJ7A 8ICEA 4FO6A 3H0MB 4NL9C 5DGBA 5KFVA 2LHTA 4X4OA 5AKZA 4YMMA 4QZ8A 1ECWA 3EW9A 3KOOA 4O3PA 2FJ6A 3U26A 4NKTA 3RH5A 2ALZA 2LKYA 2L5YA 2DL0A 4BX9C 4RT2A 2HN1A 2LBOA 4C8MA 5KFPA 4O67A 1BPYA 4Y2PA 4F71A 1PUZA 4WC3A 2YB1A 3ZI4A 4ICAA 4K9BA 4RQ1A 2XO7A 4PHEA 4DF4A 2KFNA 2E3TA 4UARA 2LYAA 2DR5A 3OJUA 5J2HA 2C2DA 4FO1A 2EQYA 4KLUA 3OVAA 1Z1BA 2RHFA 3PSIA 5F9NA 8ICUA 3SEIA 3TADC 4NJ8A 3THVA 5ALSA 4UBBA 2XCPA 5J0PA 2ZTCA 4Z6DA 2W54A 8ICHA 4F3OA 3HIYA 2UVUA 3VCBA 5AK4A 1TAUA 4AT7A 3RJJA 4MEXA 2XVTA 9ICJA 1XC9A 5KT2A 3AL0B 2DGZA 2KHQA 4X4NA 3T5HA 2DRAA 1COKA 3EYZA 2FCLA 4NLNA 2M2VA 1TFWA 4YD2A 4UQGA 9ICOA 4RQ8A 1S77D 1O08A 4NLGA 2KOBA 2ID1A 2O5AA 4EBCA 3BQ2A 5ALHA 3RAXA 3ALRA 3H8JA 2NRTA 3WK6A 5HMMA 7ICTA 3QUCA 3UQ0A 2M9NA 4ECUA 1RDFA 2IBKA 3F2DA 2BCVA 5ALXA 2CXYA 2JH7A 4XQ8A 2EAOA 4M9LA 5TZVA 1U49A 2KE7A 4WH5A 3UMBA 2E1FA 2MUTA 4I27A 2KKVA 3RJEA 1S5LU 3N97B 3C23A 5AK5A 4K98A 2OXOA 4PL1A 5BOLA 7ICNA 3HWTA 4EEYA 1KTQA 3IM1A 1RYUA 4QZIA 5KG3A 2ZIWB 3EWAA 3PSPA 7ICSA 4UAZA 4YP3A 2J6SA 1K5OA 2HN2A 9ICSA 3EF2A 9ICXA 8ICZA 3KBBA 3H40A 4CDGA 2J6TA 2C28A 1TE2A 2PXIA 4P0QA 2OWOA 4Y2QA 3Q8KA 5DDYA 4C8KA 2B4VA 5CFTA 4DCCA 4UB1A 3PSTA 2KD1A 4UAUA 3OWGA 4X4UA 4LVSA 5CFUA 5JRTA 4NWIA 2BQ3A 1NKEA 4EX6A 3JPOA 2IOFA 2O1PA 4RQ3A 3WK8A 4Q44A 1DK3A 1UEUA 1MIVA 1ZQEA 4Y2JA 2PFQA 5DBAA 1UA1A 3C21A 4IQVA 1OW5A 3RAQA 5B3PA 4FZMA 3BQ0A 5F2VO 3BS5A 2AH5A 8ICIA 2A19A 2C2EA 4U6PA 2PFPA 1UCVA 4YXMA 1ZD5A 4M6WA 2NRWA 2KV2A 4F72A 5AIAA 2ZH2A 1NK9A 2KICA 3D2QA 1MIWA 3AEVA 1WCLA 3H37A 2MRLA 2R8IA 4NLBA 4OAIZ 1HIWA 4KLQA 2BDPA 3PX4A 2FPLA 3UXPA 8ICAA 2H3QA 1YT3A 5KG1A 1JX4A 4YQWA 3RBEA 1ZQOA 1BNOA 2HHSA 4KB6A 3QNMA 7ICVA 5AK3A 3PW0A 4BXOB 5EWEA 1XNSA 2ZH6A 4IG8A 1MQ3A 3MABA 3RF9A 4OJ5A 1SWVA 5ALNA 4FBUA 4Y2XA 4U7CA 2KJ9A 3RRGA 2D8CA 5IINA 3ZDBA 3H39A 2KZZA 4LJXA 4EEBA 2KTQA 4F4XA 2C2RA 5ALUA 2KEYA 1N5WA 1NKCA 1ZJNA 1DK2A 4X4SA 4IL6U 4P4MA 5ALMA 2BR0A 4DQSA 3Q8MA 2K8BB 1L8OA 4PZNA 3MCRA 5CHEA 4FHPA 2H3ZA 3EUB2 2F1HA 4EGWA 4FHWA 4WC5A 3FM9A 3SI8A 3RB3A 5IIMA 1X66A 2OYYA 3QEAZ 2HBJA 2XI9A 3NVYA 5KT6A 1SZHA 5J29A 2B0CA 5EE3A 5ALQA 1ZQCA 2CRXA 1KKXA 1VJ7A 4JUZA 1BGXT 3H38A 5KT7A 2UVRA 3JPQA 3NVWA 2NRXA 4FHVA 4UB5A 1NK5A 1RPLA 4IC9A 2W9MA 4GFJA 3OUYA 3WKCA 4MHVA 5HRLA 3GIJA 2XY6A 1Q79A 2XC9A 1QQ5A 5HRBA 5HNKA 1B43A 4J9RA 8ICWA 1ZQHA 2K4IA 3UPQA 3T5LA 2HDOA 2DF4B 5ALFA 1UEVA 5EE0A 4Y2YA 4J9OA 3Q8LA 2OCEA 4C7YA 4K97A 1IM4A 1Q8KA 1ZD3A 4KN4A 7ICPA 4I0UA 4R8UA 8ICGA 2P6UA 1N5XA 2M2UA 4DL3A 5DG9A 1X40A 3SQIA 4I2HA 3L9DA 4DOCA 4C4RA 4KN7A 2HBKA 5J2BA 7ICQA 2KZ3A 2NRZA 1B4FA 3N28A 3KKAA 1F5SA 9ICLA 3PMNA 1XSNA 2QARA 1NOMA 3GV7B 4RQ6A 2NO5A 4RQ0A 4PZOA 1ZQIA 4AT8A 4AT7B 3AQFA 2KMDA 3K4GA 5KG6A 2WFAA 2DUYA 1WG8A 3Q8RB 1JN3A 5AM3A 4Q8FA 4M9GA 2RDJA 3PW5A 1Q46A 3H4DA 3DDHA 3FAHA 3GV5B 3ONNA 3PW7A 2HCFA 2WAQF 3K75D 2AGOA 2GOLA 4DL7A 2XGQA 1D8YA 1S0NA 1K1QA 1MN8A 4Y2TA 2JRZA 1KQQA 1VLBA 2LYBA 4KLEA 2OHFA 3G6YA 4ED8A 4F4KA 3ISDA 4IRKA 5DGAA 2MUTB 5IILA 3PW4A 2F2AB 4DQPA 5D4BA 1T94A 1YLQA 5AM4A 2R8JA 4RQ2A 5AI4A 2OM6A 4OCZA 2F44A 3I28A 3KHLA 2NV3A 3M7DA 3TKAA 1RQNA 2JHDA 3F5EA 4K99A 3IV6A 5IIOA 4IR9A 1N48A 3SV3A 4LEZA 4EENA 1PVQA 2ASJA 5CFSA 4CF4A 2R8GA 4DSJA 1L7MA 2DVIA 4EP7A 4C8NA 2JEIA 5KFZA 4F5RA 4UD4A 1YZ6A 1DRGA 2H3IA 4YG2A 5J2IA 5HRFA 7ICFA 4NLZA 1X42A 1TAQA 1L7PA 5DKWA 4K4GA 1D9DA 1L3UA 2K4EA 4QIWC 4RWOA 1NK8A 3ZDDA 5L9XA 2ASLA 3ICXA 3KHGA 2BQUA 4JK1A 1LV5A 3BS5B 5KFWA 1XO1A 3AN1A 4QW8A 1KBUA 2WF9A 4KLIA 4DFKA 3AQKA 4B6JA 1TFYA 4M6WB 4YD1A 1L7OA 2C22A 3SYZA 2ZIVA 4F92B 4DL6A 5DQIA 4AP9A 3T3FA 5DQHA 3M9OB 4UD5A 4OJ6A 9ICRA 1UA0A 1RXVA 1NO5A 4Q43A 3AQMA 2ISOA 5KTQA 2KKPA 3MR3A 4PJ0U 2G06A 5CP2A 4QZBA 4Z6CA 4F8RA 2KHVA 5KFHA 4ECQA 4TUQA 2W55A 2BGWA 4ECWA 3OTQA 2YB4A 3SV4A 1T4GA 1QQ7A 4TURA 4DL5A 3RJGA 3OSPA 5IIIA 3MBYA 5AM1A 3ZDCA 1XU4A 9ICCA 5HHIA 1DXSA 1JROA 2WF5A 1ZQXA 3ETRA 1Y88A 3R9KA 4OJPA 3OPXA 2PMZF 4P4OA 1JALA 8ICXA 8ICQA 5KFJA 2W11A 3QU2A 3PR4A 5HRGA 2P66A 3ZDEA 2BQRA 1ZQWA 2MSNA 1PK3A 4F5NA 1RG6A 4WC6A 4FHYA 4NXXA 4CCHA 2VKQA 1SB3C 2ZJ5A 4YR0A 4Q8EA 4EBJA 3ED5A 1J2NA 3CYMA 4DOBA 2V9WA 4IQWA 1KN5A 1QSLA 5C5JA 2MAXA 4WC4A 1SV0A 2BBHA 3GFKB 4I2FA 4R63A 4DSIA 4RQ7A 1KL9A 1ZQJA 3HP6A 3UMCA 1BPXA 1NZPA 1TK5A 4O5KA 2W43A 4DQRA 1SV4A 1UPHA 2BBJA 3VC8A 4ELVA 4WBYA 5AHXA 4CF3A 1XSPA 5DBCA 2FMSA 1SL2A 3PR5B 1D8BA 4MFFA 2W9BA 3NKUA 1NK6A 1KLNA 5KFTA 3QEBZ 5B5EU 3KTQA 1ZQBA 1PVPA 1DGJA 4JV1A 4LZDA 3MC1A 2ZTDA 4S3NA 4R8UB 5KG7A 2EZZA 2GWSA 4Y2UA 1NZBA 4X0AA 1Z00A 1R89A 4J9LA 2JEGA 1T3NA 5KFLA 5HRKA 5J8YA 1FFVA 4PHPA 1CUKA 4YMOA 3M8RA 1WWUA 3TAQA 2DPIA 4FH3A 3PY8A 4RZRA 5CB1A 3PX6A 1N61A 4AT8B 4DWIA 5HR7A 1JIHA 1CRXA 9ICGA 4LEWA 3Q8PB 4NM2A 3RJHA 4ECVA 2IUBA 4K8VA 3GQCA 5KFAA 5ALVA 1D9FA 2HHXA 3NS1A 3V72A 3N7SC 2WTFA 2V4RA 1V4AA 4ZOHC 1Q78A 3AMZA 1KW4A 2G5HB 4UB4A 2LYHA 3GIKA 3PV8A 5GTHU 3H0LB 2Z7JA 2GH1A 4YVZA 4EEDA 2PFOA 1ZQAA 3SAGA 3QU4A 2PBEA 5AI0A 3F2CA 1BNPA 2XIDA 1HUZA 4F50A 2R8KA 1IIPA 3KFUF 1U4BA 1JQRA 4EBDA 5KFYA 3OSNA 1ZOLA 5TISU 1SXEA 4RPXA 1ZQGA 3PO4A 2CPRA 3J81j 1CEZA 3QXGA 1NJXA 4GC6A 5ALTA 2DRBA 5E79U 1ZQNA 2W03A 2ES6A 2NYVA 4I29A 3BDPA 3RR7A 4EZ6A 4IS7A 1FIQA 3RB6A 4WC1A 2BKEA 1ZQ1C 4PGXA 2BPFA 4KX5A 4DFDA 1L8LA 1N2XA 3AUOA 2KZMA 2KSOA 2HHWA 1V85A 3KHRA 1KDHA 4EBKA 1J97A 1L3TA 4FS1A 5KFOA 1XSLA 2XY7A 5J0UA 1NJZA 2EDUA 4EYHB 4JWMA 2K4PA 1OU5A 4X4QA 1TV9A 3WK4A 2GO7A 4JLZA 8ICCA 2PKEA 2M0NA 4RQ4A 3RFAA 2ODGA 8ICFA 1NK4A 1L3SA 3JPPA 4ECRA 2JZBB 2I5HA 1HEKA 2IHMA 3D6JA 4QNLA 1ZQRA 3H8MA 3Q8SB 4JLXA 4CNQA 5ALOA 1ZQDA 1S10A 5DEDA 3GDXA 1Q3VA 5ALYA 5AKGA 1ZD2P 4DFJA 2DR8A 2HHUA 3CRXA 3RH4A 2N1RA 3SR6A 5DG8A 5HRHA 3A0BU 2W3SA 2YMPA 2AU0A 2W8LA 3KZXA 1RM6C 2ZIUA 3MDCA 3ISBA 2VA2A 8ICSA 4ATBB 4USAA 2VJ4A 3GZFA 5AIBA 1RQLA 2BHNA 4YN4A 2KN7A 2XCAA 1KSPA 2I1QA 3MDAA 2K8AA 5B66U 4GLXA 3PX0A 3C2MA 4R65A 4HYKA 2K89A 1X6IA 1QTMA 5KNIA 3HRDD 2QB0A 3UPSA 4RPZA 3E2EA 1VJ5A 4I2CA 5CRXA 4K96A 5ALIA 4RT3A 2ZIXB 5DB9A 2ESEA 2QLTA 4UATA 1XWLA 3QU5A 3PNCA 2YMMA 5KG2A 2ZUCA 3RH6A 4CE6A 4FHXA 1PX5A 3MFHA 4PHAA 1LKYA 2HOQA 4WJ3B 2H3VA 2D3DA 2ZH7A 2DR9A 2AGQA 4DF8A 5JTGA 1OXJA 3M8SA 3TANA 3LDAA 2AQ4A 4K4IA 2DR7A 4NXUA 4Y2RA 4MEYA 4OD0A 2R18A 5KFXA 3TAPA 2JV3A 5KFIA 1RXWA 4PHDA 4FBTA 2ZHAA 1LB2B 3SMVA 3PVXA 3NVOA 1WCNA 4OAFA 3QUQA 2RP5A 9ICAA 3JPNA 4DSLA 3SENA 3KKAC 1FO4A 4F91B 3SD7A 3GIMA 2E5SA 3HW8A 3WFQE 2W8KA 2AXTU 5KL8B 2KIWA 3WK5A 2ZH1A 4RNNA 2A1JA 1UT5A 4QWCA 8ICJA 2A3VA 4DL4A 7ICIA 4ED1A 1ZETA 2DWQA 4F2SA 3OHAA 4DSFA 1F5AA 1V38A 4O3NA 3H7IA 1F0MA 3B9JA 2FE9A 1X9WA 3AQEA 4B9VA 5AICA 3LWMA 3LWLA 4EELA 4IQUA 2W9CA 3F53A 4I2BA 5D61A 3JPSA 5D63A 3G6XA 1RYSA 5J2DA 4QZCA 1OUQA 3ZD9A 3AU6A 2P35A 7ICKA 4E0DA 4JWNA 3CNHA 4RUCA 9ICQA 4NKUA 4ED3A 5DBBA 2Q0ZX 4KM5A 5EOZA 2A1AA 1Z00B 8ICNA 3K1ZA 5IIKA 1AQ6A 1HJPA 3RTVA 1NJYA 4KLOA 2G5IB 5J2FA 2ZH4A 3HX0A 4ECXA 2EAPA 5AK6A 4QJFB 5KFFA 5J2CA 2ZH9A 2Y0SF 5EWFA 2DPJA 4NLCA 4BJQA 1AROP 5DDMA 4DO9A 2KVSA 4GC7A 1ZQQA 4GXJA 5AKEA 2EH9A 5GTIU 3M6KA 4IRDA 4X4RA 5HRIA 4NM1A 4YFKA 3ERCC 2ZJ8A 4QZDA 3CW2C 3MR2A 9ICMA 5F9LA 3WKDA 3PMLA 4BDPA 5AKXA 4HX0A 2RDIA 1XO0A 2ISPA 5ALJA 1A77A 3MFIA 3E0FA 2IHNA 1SXDA 4RQNA 3GIIA 4NLKA 1YZ7A 3OVBA 9ICIA 2F3NA 3G6VA 4RPYA 2PMZC 3TI0A 4KLFA 1S8OA 3QU7A 3RJFA 1N63A 5AM0A 3IP4B 4C0ZA 9ICFA 2ZIWA 2ZHBA 3TQ1A 1JI7A 1ZJMA 9ICUA 3GILA 4M5DA 5K4LA 7ICLA 4B9LA 4O69A 4DLEA 2KJ8A 4FFDA 4P0QB 1T8EA 1JUDA 3DV9A 9ICPA 4WQKA 3M1YA 4LEYA 4I2JA 5D46A 2FDRA 2E8NA 2KSOB 2KJ5A 2YMLA 4FZNA 4F5OA 3NRZA 3B0YA 1DGSA 1ZD4A 3ZD8A 2E8OA 3FYHA 4J9QA 2BPGA 2QKQA 3PHZA 1L5UA 2HOIA 3H3AA 2KK0A 1UT8A 4K9AA 1EXNA 1N60A 4P0PA 2FLNA 2Q66A 2F1JA 3WKAA 4FS2A 1ZQYA 4ED6A 3TARA 1ZRNA 4M04A 5BOMA 4KLGA 3GV8B 3ER9B 2FMQA 3OJSA 1KFDA 4C7ZA 9ICVA 4O68A 3HPOA 4DL2A 8ICLA 2F8LA 5KFQA 5C0YA 1Q3UA 2JR5A 1VDVA 1GO3F 4ED7A 5CEHA 3NTUA 3V6KA 5HMLA 3V6HA 5L1MA 3NGDA 1U45A 5EE9A 1A6SA 2EZYA 1SIJA 2F8KA 5KT4A 1TVAA 5ALGA 3HILA 2HVIA 4UB8U 2EWRA 4J9PA 1NNLA 3BZKA 5J0XA 2OEHA 4RWNA 4UBCA 1BPDA 1Z19A 1S97A 4UAWA 4G9BA 3SAHA 2W7OA 4TUSA 4CGZA 2AJQA 3WFPA 4J9NA 3JCFA 4AT9A 4R66A 2FLLA 2DBYA 1SV0C 7ICUA 2K4HA 3PO5A 4EV6A 2GAFD 5AI8A 4RQ5A 2IHOA 4EBEA 1QSSA 2Y1IA 1KNYA 4B9MA 1KRPA 2YY6A 3N7PD 5KFBA 4Q45A 2BPCA 2E8MA 2E1EA 5CA7A 5DECA 2ZUDA 2LM1A 4B9NA 1ZQPA 2RQ5A 3L4PA 5L1LA 3RR8A 1JAJA 3C2LA 3OHBA 1Z3EB 5AKIA 2YX8A 3A0HU 4RWPA 2HBMA 4F4YA 2JEFA 3TACB 2DFLA 4EEKA 5KFKA 1NKBA 2ZG6A 3IDWA 3LVWA 1KFTA 4DS5A 4KITB 1TAMA 1NI3A 4F5PA 4GIBA 2UVVA 2ZH5A 5CHGA 1T3QA 4BUGA 3TFSA 4DSEA 1X9MA 4UAVA 1ZQSA 2VA8A 3UXNA 4CF5A 5ALRA 5HP4A 3AU2A 4X4PA 4DSKA 5J8YC 1WUDA 5J0TA 4JB3A 3I76A 8ICYA 4LT6A 4TQRA 4NY8A 5AM2A 3OUYB 3QUTA 2AQ0A 3NYBA 5AKKA 1ZXIA 1VFGA 1JRPA 1PK1A 2PI4A 3C28A 1MIYA 2A1JB 4IR1A 2ZH3A 1X9XA 1X9SA 4I2AA 5G5HA 4NXZA 2WB1F 4Z6EA 3KHHA 5HR9A 4NL9A 3WKEA 4MFCA 8ICOA 3HJ4A 1SKSA 2W9CB 4DFMA 1ZQLA 4FH5A 2IOHA 1XS9D 3RJKA 4KLLA 5AKJA 1B0XA 3MR6A 4QIWF 1U47A 4OJLA 4LZGA 3IG8A 3V7LA 1IV8A 3H0RB 4DFPA 2WF7A 2IOFK 2RLTA 5AI9A 3HKZF 1MSWD 4B9UA 3JZ0A 2W3RA 2QARB 3LVVA 5AKYA 4AYBF 4B9SA 5J0QA 4O5CA 3UXOA 2DQNB 3UM9A 9ICBA 4E8FA 2I6XA 4B9TA 1R8CA 1KEJA 5T14A 2QB1A 2J6UA 2HHVA 1L7NA 4QWEA 5J0OA 4C8OA 2ZJAA 1UHUA 4WBZA 2NRKA 9ICKA 1S0OA 2KP7A 1NK7A 3DEEA 2MA1A 4C80A 4EYIB 2G08A 2JH1A 8ICPA 1BVSA 5CR0A 3TADA 4TUPA 4X4VA 5L1KA 2ZXIA 5ALWA 4NXTA 2B56A 7ICMA 3M9MB 2EZXA 2LM4A 2LI6A 2BCUA 1SZPA 1ZQVA 2RRDA 2YQEA 3EPGA 4US9A 4NXWA 2Y1JA 1QLNA 3RB4A 3SAFA 2JGAA 4MKPA 2HVHA 2YTUA 3RJIA 3V7JA 5IIJA 4RUAA 1A0PA 3ISCA 5KFSA 4M2YA 2YN4A 4E80A 4PPXA 4HAIA 4KLHA 5KFDA 5D49A 3T5KA 1ZYQA 3ER8C 5KG0A 2HI0A 2H3FA 5BPCA 1NJWA 5J2GA 5D62A 3C66A 5KT3A 1IXRA 3AQNA 4ED2A 2HMXA 2H5XA 2I9GA 3WK9A 3C5GA 4IRCA 1QH9A 4I2GA 7ICGA 4OAHA 4MFAA 3BJYA 4X5VA 2ZH8A 4M0AA 3NWIA 5KFUA 4YMNA 4O6AA 4QZ9A 3LQCB 3UQ2A 5DLGA 3NUQA 4XRHA 4ELTA 2FMPA 3T79A 4BWJA 3HJ1A 2GLEA 4Z6FA 2MU2A 4O0IA 3T5JA 3GU3A 4G3IA 2XY5A 2BCQA 4KLTA 1B22A 3QUBA 3KD3A 4NV0A 5KFEA 4MF8A 3C2KA 1QCKA 4F4ZA 5J0SA 2G09A 5KFRA 2P6RA 4KMUA 3CK6A 2W7PA 4CRXA 1BPEA 2JEJA 3NASA 4P0PB 3C5FA 1UQVA 4LEVA 2OH2A 4FE3A 1V9PA 9ICHA 2KIVA 4RNOA 2VANA 2FPMA 5ALDA 4GXIA 5L1JA 3QE9Y 2EANA 4M9NA 4DOAA 1PVRA 2ZIVB 3BQTA 4YR2A 1URJA 3RBDA 5HR6A 2D6FC 3K1RB 4OJOA 5HRDA 2F1IA 9ICTA 3WFRE 2XICA 3FC4A 4WC0A 4UB2A 5DQGA 4OAGA 1WWVA 3HT3A 1DOQA 4RQMA 3WK7A 9ICWA 4US8A 4DQQA 2V4QA 1ZQKA 1NK0A 2Y0SC 4P2HA 3WFSC 5AM5A 5JU5A 4QWBA 4XQ7A 3BS7A 4I2EA 3C1YA 9ICEA 1JMSA 5H2FU 3MR5A 4XA5A 3PZPA 2HBLA 2NRVA 4ELUA 2WAQC 4Y2VA 4PGQA 5EWGA 3O0FA 1JXEA 4A8EA 4AT9B 1FFUA 4O3QA 5KL1B 2HHPA 4NXVA 1MQ2A 1PZNA 4UASA 5AKLA 1COOA 2ZTEA 1N56A 1X6JA 5A0LA 2PFNA 5JUMA 1O03A 4ECTA 3CP8A 4M9JA 1SKWA 3LK9A 5B3QA 4EZ9A 5DG7A 3KZIU 5J2AA 3OVSA 2NO4A 3ORYA 4J9MA 4X4TA 2W04A 4O9MA 4RWQA 3S6JA 3MGVA 2ATLA 4YCXA 2YMQA 1BPZA 1TK0A 3L5KA 3MGHA 3HJEA 5J0WA 4QZHA 1H38A 3M6ZA 1RYRA 2FLPA 2BCRA 4O5EA 2K8CB 2E8PA 3D2SA 1U48A 4ED0A 4MF2A 1C20A 4E7XA 4ACOA 4KLDA 4O3SA 4RNMA 2B51A 1P7DA 5KFNA 1R8AA 5AI5A 4KLSA 4WC2A 3Q8QB 4QZGA 2LPEA 5AKHA 4OO1J 5J2JA 3L3FX 4QZFA 3OV7A 4JV2A 2BZFA 1ZRMA 4UB6U 1PK1B 5KFMA 1X2IA 5ALPA 2W9BB 4GXKA 2KNJA 4RU9A 7ICJA 1WYGA 1TKDA 3UMGA 5J2EA 2ZUBA 4UAYA 3H8WA 5FP0A 5HHHA 1F44A 5HC9A 3C1ZA 1TK8A 3RRHA 3H8SA 4C4SA 3BZCA 4WCWA 2HSZA 1FEZA 5ALEA 5AI6A 4ZH4A 1MC8A 3FDSA 2HOFA 2DKZA 2B6GA 4PGYA 4QZAA 5J0YA 4ECZA 3BQ1A 3PSFA 1SGGA 3QU9A 4JV0A 1SWWA 3QZ8A 4ECSA 1KFSA 2KVCA 2JXJA 3MGIA 5DLFA 1ZQTA 4KLMA 1ZQFA 4BWMA 4J03A 5KG5A 2ZXHA 4KLJA 5KAFU 2HHQA 2Y9TA 3TFRA 4JMUA 3ZDAA 1HUOA 8ICBA 3OGUA 1TFRA 4QW9A 1J2MA 2UVWA 3WKBA 5EE1A 3NRWA 1S76D 2FPKA 5DB8A 3IG5A 1CI4A 5DB7A 4FZLA 2WF8A 3N4MB 8ICTA 7ICHA 5KAIU 1LVHA 2AHOB 4C4TA 2VIXA 3LYSA 2RFFA 1T7PA 4P4PA 4TQSA 4O3MA 1IG6A 4PL2A 4F2RA 4M9HA 5DB6A 1V97A 3C18A 1QQ6A 5KG4A 2VA3A 4WQLA 4KMOB 4UW9A 1L6NA 3IHQB 1C7YA 1L3VA 2EAMA 3JPTA 2M2TA 2F76X 2G07A 3D2NA 8ICMA 4WOYA 1BPBA 1SL1A 1ED1A 1GPJA 2KFZA 3ETLA 4BGDA 4KX3A 5KFCA 4YR3A 3AM9A 1A76A 2M2WA 3JYYA 2W9AA 2WHEA 4ECYA 4WC7A 2VJ5A 1D8LA 3JPRA 2PI5A 2G0AA 3PW2A 1N62A 2K60A 2BCSA 4XJEA 2Y9UA 3QYPA 4XUSA 4F5QA 3K7DA 1Z4NA 2O6KA 3BQ7A 2AGPA 5CWRA 2B21A 1S0VA 1WOTA 1U9LA 3IRUA 4F93B 2HW3A 4O3OA 2HHTA 4YXJA 4DS4A 4R64A 3V7KA 3IN5A 1SKRA 4EX7A 9ICNA 3I1YA 4IQTA 1QSYA 2WB1C 4M47A 8ICKA 4F4WA 2BE3A 2JZBA 1Z4OA 4PH5A 1ZQMA 4I2IA 3M9NB 3V6JA 1R8BA 5L1IA 4C8LA 4X0BA 5F3XB 7ICOA 3SZ2A 1M6YA 3EPIA 1S9FA 4DQIA 3NVVA 7ICEA 3C29A 4DEZA 1K1SA 3WFOA 3N7RC 3HKZC 4I28A 4J9SA 5ALKA 5ALLA 4K4HA 3AQLA 2WF6A 2KG5A 4AYBC 2XGPA 4QZEA 5HREA 1S0MA 1UETA 2IA6A 1ZQZA 2ZIUB 2ASDA 4BXOA 8ICVA 3H4BA 3WU2U 4ATBA 4Y2SA 5ALZA 7ICRA 5KT5A 1FA0A 3QX7A 3E58A 5KFGA 5J2KA 5J0RA 5G5GA 2Q4TA 3QZ7A 3RB0A 1JXLA 4UB3A 3F2BA 1RZTA 4I2DA 1MA7A 2QB0B 2BDUA 4KTQA 2IMWP 3NVZA 3F5AA 4QWAA 3EZ5A 2ZIXA 4QWDA 4N7RA 4O3RA 1Z1VA 2CN1A 5JTIA 2JMGA 2DKXA 1SL0A 1ZQUA 2R8HA 3B0XA 4J9KA 4DLGA 2F77X 8ICRA 2GA9D 1LKYB
chains in the Genus database with same CATH topology
2HVHA 3RJIA 3V7JA 5IIJA 4RUAA 5DGAA 5CJ7A 3ISCA 8ICEA 5KFSA 2AGQA 4M2YA 2ZH7A 2DR9A 4DF8A 4E80A 2MUTB 4FO6A 5IILA 3PW4A 3M8SA 3TANA 4PPXA 3LDAA 2AQ4A 5DGBA 4K4IA 5KFVA 4DQPA 4KLHA 2DR7A 5KFDA 5D4BA 5D49A 4MEYA 4X4OA 3T5KA 4YMMA 1ZYQA 1YLQA 4QZ8A 2R8JA 3EW9A 4RQ2A 5KG0A 4O3PA 5KFXA 5BPCA 3TAPA 1NJWA 5KFIA 5J2GA 1RXWA 4PHDA 4NKTA 4FBTA 3KHLA 2ZHAA 3C66A 3RH5A 2ALZA 5KT3A 1IXRA 3AQNA 4ED2A 1LB2B 3PVXA 2I9GA 2H5XA 1WCNA 5IIOA 9ICAA 4RT2A 3JPNA 4IR9A 4DSLA 3C5GA 1N48A 3SV3A 4IRCA 4I2GA 4F91B 3GIMA 7ICGA 4C8MA 3HW8A 3WFQE 2W8KA 2ASJA 5KFPA 4MFAA 3BJYA 4X5VA 2R8GA 1BPYA 4DSJA 2ZH8A 4M0AA 5KFUA 4YMNA 4WC3A 4QZ9A 3LQCB 2DVIA 4EP7A 3UQ2A 4C8NA 2ZH1A 4RNNA 2A1JA 1UT5A 4QWCA 2JEIA 8ICJA 4RQ1A 5DLGA 2XO7A 5KFZA 4F5RA 4XRHA 4DL4A 4PHEA 4DF4A 4ED1A 1ZETA 4ELTA 7ICIA 4F2SA 2KFNA 2FMPA 3OHAA 4UD4A 4DSFA 4BWJA 3HJ1A 1F5AA 4O3NA 3H7IA 4Z6FA 4O0IA 3T5JA 4G3IA 4YG2A 5J2IA 2XY5A 1X9WA 4B9VA 5HRFA 3LWMA 2DR5A 3OJUA 3LWLA 5J2HA 2C2DA 4IQUA 2BCQA 2W9CA 4KLTA 1B22A 4KLUA 3OVAA 7ICFA 4I2BA 4NLZA 5KFEA 4MF8A 3JPSA 1TAQA 3C2KA 5DKWA 3G6XA 1RYSA 5J2DA 5F9NA 4QZCA 4K4GA 4F4ZA 8ICUA 5J0SA 1D9DA 3ZD9A 1L3UA 5KFRA 3THVA 2P6RA 4KMUA 3AU6A 1BPEA 2JEJA 4RWOA 1NK8A 3ZDDA 5L9XA 4UBBA 3C5FA 2ASLA 7ICKA 4E0DA 4JWNA 2XCPA 1V9PA 3KHGA 5J0PA 2BQUA 2ZTCA 4JK1A 4RUCA 9ICHA 4RNOA 9ICQA 4ED3A 4Z6DA 2VANA 5DBBA 5KFWA 1LV5A 4NKUA 1XO1A 2Q0ZX 4QW8A 2FPMA 5EOZA 4F3OA 4DFKA 4KLIA 8ICHA 3HIYA 4GXIA 5L1JA 3QE9Y 2UVUA 3AQKA 1TAUA 4M6WB 4YD1A 4DOAA 4M9NA 1TFYA 4AT7A 2C22A 3SYZA 1Z00B 3RJJA 4F92B 8ICNA 4DL6A 3BQTA 4MEXA 4YR2A 5DQIA 9ICJA 3T3FA 3RBDA 1XC9A 5DQHA 5KT2A 5IIKA 3RTVA 1HJPA 2F1IA 1NJYA 4KLOA 9ICTA 5HRDA 3WFRE 3M9OB 5J2FA 2ZH4A 4X4NA 4UD5A 3T5HA 2DRAA 3HX0A 4ECXA 9ICRA 1UA0A 1RXVA 4WC0A 3EYZA 5KFFA 5J2CA 5DQGA 4UB2A 4NLNA 1NO5A 2ZH9A 2M2VA 1TFWA 5EWFA 4Q43A 4YD2A 4UQGA 2DPJA 3AQMA 2ISOA 9ICOA 4RQ8A 1S77D 5KTQA 1DOQA 1AROP 5DDMA 3HT3A 9ICWA 4DQQA 3MR3A 2V4QA 1ZQKA 1NK0A 4NLGA 5CP2A 4P2HA 4DO9A 4QZBA 2ID1A 4Z6CA 3WFSC 4GC7A 2O5AA 4EBCA 1ZQQA 3BQ2A 4GXJA 4F8RA 4QWBA 5KFHA 4ECQA 3RAXA 4XQ7A 4I2EA 4TUQA 3C1YA 3H8JA 2NRTA 2BGWA 9ICEA 1JMSA 3MR5A 4IRDA 4XA5A 2NRVA 4ELUA 4ECWA 5HMMA 7ICTA 4X4RA 4PGQA 3SV4A 5HRIA 1T4GA 5EWGA 4NM1A 4YFKA 4TURA 1JXEA 3UQ0A 4DL5A 3RJGA 2ZJ8A 4QZDA 3OSPA 2M9NA 4ECUA 5IIIA 4AT9B 3MBYA 2IBKA 3ZDCA 2BCVA 4O3QA 3MR2A 9ICMA 2HHPA 5F9LA 1XU4A 9ICCA 1MQ2A 1PZNA 4XQ8A 5HHIA 1COOA 3PMLA 4BDPA 2ZTEA 1N56A 2RDIA 2ISPA 4M9LA 1A77A 5TZVA 1ZQXA 3MFIA 2PFNA 1U49A 5JUMA 1Y88A 2IHNA 2MUTA 4P4OA 4ECTA 4I27A 4M9JA 1SKWA 3LK9A 3RJEA 3GIIA 4NLKA 3N97B 4EZ9A 3C23A 5DG7A 8ICQA 9ICIA 8ICXA 3OVBA 5J2AA 5KFJA 3G6VA 5BOLA 4RPYA 3OVSA 3ORYA 4J9MA 3TI0A 3PR4A 7ICNA 5HRGA 4KLFA 4O9MA 4RWQA 4X4TA 3HWTA 2P66A 3ZDEA 4EEYA 2BQRA 2ATLA 1ZQWA 1KTQA 4YCXA 3IM1A 3RJFA 1BPZA 9ICFA 4F5NA 4QZIA 1TK0A 5KG3A 4FHYA 4WC6A 4CCHA 3EWAA 2ZJ5A 4YR0A 3MGHA 4Q8EA 2ZHBA 5J0WA 7ICSA 4UAZA 4YP3A 3TQ1A 4QZHA 1H38A 4EBJA 2J6SA 1RYRA 4DOBA 1ZJMA 2BCRA 2FLPA 4O5EA 9ICUA 3GILA 2V9WA 1U48A 4M5DA 9ICSA 9ICXA 4ED0A 4IQWA 8ICZA 7ICLA 4MF2A 3H40A 4B9LA 1QSLA 5C5JA 2MAXA 2J6TA 4WC4A 2C28A 2PXIA 3GFKB 4DLEA 4R63A 2OWOA 4I2FA 4DSIA 4O3SA 4KLDA 1T8EA 4E7XA 4RNMA 4RQ7A 1ZQJA 3HP6A 3Q8KA 5KFNA 1BPXA 5DDYA 4C8KA 1R8AA 4KLSA 1TK5A 1NZPA 4O5KA 9ICPA 4WC2A 3Q8QB 4QZGA 4DQRA 4UB1A 4X4UA 4LVSA 4I2JA 5D46A 4ELVA 4WBYA 2BQ3A 1NKEA 5J2JA 3JPOA 4QZFA 4F5OA 1XSPA 5DBCA 2FMSA 4JV2A 4RQ3A 3PR5B 3B0YA 1SL2A 1DGSA 4Q44A 1DK3A 5KFMA 1UEUA 3ZD8A 1X2IA 2W9BB 4GXKA 3FYHA 2W9BA 4MFFA 1MIVA 4RU9A 4J9QA 1NK6A 2BPGA 7ICJA 1KLNA 5KFTA 3QEBZ 1TKDA 1L5UA 1ZQEA 3H3AA 2PFQA 1UT8A 3KTQA 5J2EA 1ZQBA 1EXNA 2ZUBA 5DBAA 4UAYA 1UA1A 3H8WA 3C21A 4IQVA 5HHHA 5HC9A 2FLNA 4JV1A 2Q66A 3RAQA 4LZDA 2F1JA 3C1ZA 1TK8A 4FS2A 2ZTDA 4S3NA 3RRHA 4R8UB 3H8SA 1ZQYA 3BQ0A 4ED6A 5KG7A 3TARA 5F2VO 4M04A 5BOMA 4KLGA 3GV8B 8ICIA 4WCWA 2C2EA 2PFPA 4YXMA 2GWSA 4M6WA 2FMQA 4X0AA 4ZH4A 2NRWA 1KFDA 3OJSA 1Z00A 9ICVA 1MC8A 3HPOA 3FDSA 1R89A 4J9LA 2ZH2A 1NK9A 2JEGA 4DL2A 1T3NA 8ICLA 5KFLA 4PGYA 5KFQA 4QZAA 5HRKA 1MIWA 1WCLA 3H37A 2R8IA 4PHPA 4ED7A 3NTUA 1CUKA 4YMOA 3M8RA 5J0YA 4ECZA 3V6KA 3PX4A 3TAQA 2DPIA 2BDPA 4KLQA 5HMLA 2FPLA 4FH3A 3UXPA 3PY8A 8ICAA 4RZRA 5CB1A 3PX6A 3V6HA 3BQ1A 4AT8B 4DWIA 1JX4A 5KG1A 3NGDA 4JV0A 1U45A 4YQWA 1JIHA 3QZ8A 3RBEA 4ECSA 1ZQOA 1KFSA 1BNOA 3MGIA 2HHSA 5KT4A 1TVAA 9ICGA 2HVIA 5DLFA 1ZQTA 7ICVA 3Q8PB 3PW0A 4KLMA 4J9PA 4BXOB 4NM2A 4BWMA 1ZQFA 5KG5A 5EWEA 4ECVA 3RJHA 5J0XA 3GQCA 4RWNA 5KFAA 4UBCA 1BPDA 1D9FA 1S97A 4UAWA 2HHXA 2ZH6A 4IG8A 4KLJA 3V72A 1MQ3A 3MABA 2HHQA 3TFRA 4TUSA 3ZDAA 2WTFA 1HUOA 2AJQA 3WFPA 2V4RA 4J9NA 4FBUA 1V4AA 8ICBA 3OGUA 4AT9A 1Q78A 4R66A 1TFRA 3RRGA 4QW9A 5IINA 2FLLA 3ZDBA 2KZZA 3H39A 2KTQA 4F4XA 2UVWA 4UB4A 2LYHA 2C2RA 2FPKA 1S76D 7ICUA 3GIKA 3PV8A 3PO5A 5DB8A 1NKCA 5DB7A 1ZJNA 1DK2A 4X4SA 4YVZA 4P4MA 2BR0A 3N4MB 4DQSA 4RQ5A 7ICHA 2PFOA 8ICTA 1ZQAA 3Q8MA 4EBEA 1QSSA 2PBEA 2Y1IA 1KNYA 2O1PA 4B9MA 1KRPA 1BNPA 1HUZA 4F50A 5KFBA 2RFFA 1T7PA 4Q45A 4FHPA 2R8KA 2BPCA 4P4PA 2F1HA 4TQSA 5CA7A 5DECA 2ZUDA 1U4BA 1JQRA 4EBDA 5KFYA 4B9NA 4FHWA 1ZQPA 4F2RA 4M9HA 4WC5A 5DB6A 3OSNA 4RPXA 5L1LA 1ZQGA 3PO4A 3RR8A 3SI8A 1JAJA 3RB3A 3C2LA 5IIMA 3C18A 5KG4A 2VA3A 3QEAZ 3OHBA 1CEZA 1Z3EB 5KT6A 1NJXA 4GC6A 3IHQB 4RWPA 1C7YA 5J29A 4F4YA 3JPTA 1L3VA 2M2TA 2JEFA 8ICMA 2DRBA 2DFLA 1ZQNA 5KFKA 1NKBA 1BPBA 1ZQCA 1KFTA 1SL1A 4DS5A 4KITB 2KFZA 3ETLA 4F5PA 4I29A 4BGDA 3BDPA 1VJ7A 4JUZA 2UVVA 2ZH5A 1BGXT 5KFCA 5CHGA 3TFSA 4DSEA 1X9MA 3H38A 4YR3A 2VA8A 1A76A 3UXNA 1ZQSA 3RR7A 5HP4A 4EZ6A 2M2WA 5KT7A 2UVRA 3AU2A 3JPQA 2W9AA 4ECYA 3JYYA 4DSKA 2NRXA 4WC7A 4X4PA 1D8LA 3JPRA 3RB6A 4UB5A 5J0TA 4FHVA 1NK5A 4WC1A 1RPLA 2BKEA 2PI5A 4PGXA 3PW2A 2BPFA 2W9MA 8ICYA 4LT6A 4TQRA 4NY8A 3OUYB 3AUOA 2BCSA 3OUYA 2KZMA 4BXOA 4XUSA 4F5QA 2AQ0A 2HHWA 3NYBA 5HRLA 3KHRA 3GIJA 1KDHA 4EBKA 2XY6A 1Q79A 1VFGA 1L3TA 2XC9A 4FS1A 2AGPA 2PI4A 5KFOA 5CWRA 1XSLA 5HNKA 5HRBA 1B43A 4J9RA 5J0UA 2XY7A 1NJZA 4EYHB 2A1JB 4IR1A 8ICWA 1MIYA 4JWMA 2B21A 1S0VA 1WOTA 2ZH3A 1U9LA 1ZQHA 1OU5A 4F93B 3UPQA 4O3OA 3T5LA 2HW3A 1X9SA 2HHTA 4X4QA 1TV9A 4NXZA 3KHHA 4YXJA 4Z6EA 4DS4A 4I2AA 1UEVA 5HR9A 4R64A 3V7KA 4J9OA 3Q8LA 1SKRA 8ICCA 1IM4A 9ICNA 4KN4A 4MFCA 7ICPA 8ICOA 4R8UA 4IQTA 3HJ4A 1SKSA 1QSYA 4M47A 8ICGA 2P6UA 2W9CB 4DFMA 2M2UA 4RQ4A 4DL3A 1ZQLA 5DG9A 8ICFA 1XS9D 3RJKA 4I2HA 8ICKA 4F4WA 4KLLA 4FH5A 3MR6A 1U47A 1NK4A 3JPPA 1L3SA 4DOCA 4ECRA 3L9DA 4KN7A 4LZGA 2JZBB 5J2BA 2JZBA 3V7LA 2BE3A 4PH5A 1ZQMA 4DFPA 4I2IA 3M9NB 3V6JA 2IHMA 7ICQA 5L1IA 4C8LA 1R8BA 4X0BA 2KZ3A 1ZQRA 3Q8SB 2NRZA 7ICOA 1ZQDA 3SZ2A 1MSWD 1S10A 3EPIA 9ICLA 5DEDA 4B9UA 3GDXA 1S9FA 4DQIA 7ICEA 3JZ0A 3PMNA 1XSNA 1NOMA 4DFJA 2DR8A 4DEZA 3GV7B 1K1SA 4RQ6A 2HHUA 3WFOA 4RQ0A 1ZQIA 3RH4A 4I28A 4J9SA 5DG8A 4AT8A 4AT7B 4K4HA 3AQLA 4B9SA 5J0QA 4O5CA 5HRHA 3UXOA 8ICVA 2XGPA 9ICBA 4E8FA 4QZEA 2W8LA 3K4GA 2AU0A 5HREA 5KG6A 1S0MA 4B9TA 1R8CA 1UETA 2IA6A 1KEJA 1ZQZA 3MDCA 3ISBA 2ASDA 3H4BA 2J6UA 2VA2A 4QWEA 2HHVA 5J0OA 8ICSA 4ATBB 4ATBA 4C8OA 2ZJAA 3Q8RB 7ICRA 5KT5A 4WBZA 2BHNA 4YN4A 1JN3A 2KN7A 9ICKA 2NRKA 1S0OA 2KP7A 2XCAA 1NK7A 4Q8FA 1FA0A 4M9GA 1KSPA 2RDJA 2I1QA 3MDAA 3PW5A 3H4DA 5KFGA 5J2KA 4GLXA 3PX0A 4EYIB 5J0RA 3GV5B 3QZ7A 3RB0A 8ICPA 3C2MA 1BVSA 4R65A 4HYKA 4UB3A 5CR0A 3PW7A 1JXLA 3K75D 1RZTA 4I2DA 4TUPA 4X4VA 2AGOA 1QTMA 5L1KA 3UPSA 4KTQA 4DL7A 2IMWP 4RPZA 3E2EA 4I2CA 2XGQA 7ICMA 3M9MB 4QWAA 4RT3A 1S0NA 1D8YA 1K1QA 4QWDA 3EZ5A 5DB9A 4O3RA 1XWLA 3PNCA 5KG2A 2ZUCA 3RH6A 1SL0A 1ZQUA 2BCUA 1SZPA 4FHXA 1ZQVA 4KLEA 1PX5A 3EPGA 3MFHA 3G6YA 2R8HA 3B0XA 4J9KA 4DLGA 4ED8A 8ICRA 4F4KA 3OV7A 2Y1JA 1QLNA 3RB4A 4PHAA 3ISDA 4IRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVH A;  3RJI A;  3V7J A;  5IIJ A;  4RUA A;  5DGA A;  5CJ7 A;  3ISC A;  8ICE A;  5KFS A;  2AGQ A;  4M2Y A;  2ZH7 A;  2DR9 A;  4DF8 A;  4E80 A;  2MUT B;  4FO6 A;  5IIL A;  3PW4 A;  3M8S A;  3TAN A;  4PPX A;  3LDA A;  2AQ4 A;  5DGB A;  4K4I A;  5KFV A;  4DQP A;  4KLH A;  2DR7 A;  5KFD A;  5D4B A;  5D49 A;  4MEY A;  4X4O A;  3T5K A;  4YMM A;  1ZYQ A;  1YLQ A;  4QZ8 A;  2R8J A;  3EW9 A;  4RQ2 A;  5KG0 A;  4O3P A;  5KFX A;  5BPC A;  3TAP A;  1NJW A;  5KFI A;  5J2G A;  1RXW A;  4PHD A;  4NKT A;  4FBT A;  3KHL A;  2ZHA A;  3C66 A;  3RH5 A;  2ALZ A;  5KT3 A;  1IXR A;  3AQN A;  4ED2 A;  1LB2 B;  3PVX A;  2I9G A;  2H5X A;  1WCN A;  5IIO A;  9ICA A;  4RT2 A;  3JPN A;  4IR9 A;  4DSL A;  3C5G A;  1N48 A;  3SV3 A;  4IRC A;  4I2G A;  4F91 B;  3GIM A;  7ICG A;  4C8M A;  3HW8 A;  3WFQ E;  2W8K A;  2ASJ A;  5KFP A;  4MFA A;  3BJY A;  4X5V A;  2R8G A;  1BPY A;  4DSJ A;  2ZH8 A;  4M0A A;  5KFU A;  4YMN A;  4WC3 A;  4QZ9 A;  3LQC B;  2DVI A;  4EP7 A;  3UQ2 A;  4C8N A;  2ZH1 A;  4RNN A;  2A1J A;  1UT5 A;  4QWC A;  2JEI A;  8ICJ A;  4RQ1 A;  5DLG A;  2XO7 A;  5KFZ A;  4F5R A;  4XRH A;  4DL4 A;  4PHE A;  4DF4 A;  4ED1 A;  1ZET A;  4ELT A;  7ICI A;  4F2S A;  2KFN A;  2FMP A;  3OHA A;  4UD4 A;  4DSF A;  4BWJ A;  3HJ1 A;  1F5A A;  4O3N A;  3H7I A;  4Z6F A;  4O0I A;  3T5J A;  4G3I A;  4YG2 A;  5J2I A;  2XY5 A;  1X9W A;  4B9V A;  5HRF A;  3LWM A;  2DR5 A;  3OJU A;  3LWL A;  5J2H A;  2C2D A;  4IQU A;  2BCQ A;  2W9C A;  4KLT A;  1B22 A;  4KLU A;  3OVA A;  7ICF A;  4I2B A;  4NLZ A;  5KFE A;  4MF8 A;  3JPS A;  1TAQ A;  3C2K A;  5DKW A;  3G6X A;  1RYS A;  5J2D A;  5F9N A;  4QZC A;  4K4G A;  4F4Z A;  8ICU A;  5J0S A;  1D9D A;  3ZD9 A;  1L3U A;  5KFR A;  3THV A;  2P6R A;  4KMU A;  3AU6 A;  1BPE A;  2JEJ A;  4RWO A;  1NK8 A;  3ZDD A;  5L9X A;  4UBB A;  3C5F A;  2ASL A;  7ICK A;  4E0D A;  4JWN A;  2XCP A;  1V9P A;  3KHG A;  5J0P A;  2BQU A;  2ZTC A;  4JK1 A;  4RUC A;  9ICH A;  4RNO A;  9ICQ A;  4ED3 A;  4Z6D A;  2VAN A;  5DBB A;  5KFW A;  1LV5 A;  4NKU A;  1XO1 A;  2Q0Z X;  4QW8 A;  2FPM A;  5EOZ A;  4F3O A;  4DFK A;  4KLI A;  8ICH A;  3HIY A;  4GXI A;  5L1J A;  3QE9 Y;  2UVU A;  3AQK A;  1TAU A;  4M6W B;  4YD1 A;  4DOA A;  4M9N A;  1TFY A;  4AT7 A;  2C22 A;  3SYZ A;  1Z00 B;  3RJJ A;  4F92 B;  8ICN A;  4DL6 A;  3BQT A;  4MEX A;  4YR2 A;  5DQI A;  9ICJ A;  3T3F A;  3RBD A;  1XC9 A;  5DQH A;  5KT2 A;  5IIK A;  3RTV A;  1HJP A;  2F1I A;  1NJY A;  4KLO A;  9ICT A;  5HRD A;  3WFR E;  3M9O B;  5J2F A;  2ZH4 A;  4X4N A;  4UD5 A;  3T5H A;  2DRA A;  3HX0 A;  4ECX A;  9ICR A;  1UA0 A;  1RXV A;  4WC0 A;  3EYZ A;  5KFF A;  5J2C A;  5DQG A;  4UB2 A;  4NLN A;  1NO5 A;  2ZH9 A;  2M2V A;  1TFW A;  5EWF A;  4Q43 A;  4YD2 A;  4UQG A;  2DPJ A;  3AQM A;  2ISO A;  9ICO A;  4RQ8 A;  1S77 D;  5KTQ A;  1DOQ A;  1ARO P;  5DDM A;  3HT3 A;  9ICW A;  4DQQ A;  3MR3 A;  2V4Q A;  1ZQK A;  1NK0 A;  4NLG A;  5CP2 A;  4P2H A;  4DO9 A;  4QZB A;  2ID1 A;  4Z6C A;  3WFS C;  4GC7 A;  2O5A A;  4EBC A;  1ZQQ A;  3BQ2 A;  4GXJ A;  4F8R A;  4QWB A;  5KFH A;  4ECQ A;  3RAX A;  4XQ7 A;  4I2E A;  4TUQ A;  3C1Y A;  3H8J A;  2NRT A;  2BGW A;  9ICE A;  1JMS A;  3MR5 A;  4IRD A;  4XA5 A;  2NRV A;  4ELU A;  4ECW A;  5HMM A;  7ICT A;  4X4R A;  4PGQ A;  3SV4 A;  5HRI A;  1T4G A;  5EWG A;  4NM1 A;  4YFK A;  4TUR A;  1JXE A;  3UQ0 A;  4DL5 A;  3RJG A;  2ZJ8 A;  4QZD A;  3OSP A;  2M9N A;  4ECU A;  5III A;  4AT9 B;  3MBY A;  2IBK A;  3ZDC A;  2BCV A;  4O3Q A;  3MR2 A;  9ICM A;  2HHP A;  5F9L A;  1XU4 A;  9ICC A;  1MQ2 A;  1PZN A;  4XQ8 A;  5HHI A;  1COO A;  3PML A;  4BDP A;  2ZTE A;  1N56 A;  2RDI A;  2ISP A;  4M9L A;  1A77 A;  5TZV A;  1ZQX A;  3MFI A;  2PFN A;  1U49 A;  5JUM A;  1Y88 A;  2IHN A;  2MUT A;  4P4O A;  4ECT A;  4I27 A;  4M9J A;  1SKW A;  3LK9 A;  3RJE A;  3GII A;  4NLK A;  3N97 B;  4EZ9 A;  3C23 A;  5DG7 A;  8ICQ A;  9ICI A;  8ICX A;  3OVB A;  5J2A A;  5KFJ A;  3G6V A;  5BOL A;  4RPY A;  3OVS A;  3ORY A;  4J9M A;  3TI0 A;  3PR4 A;  7ICN A;  5HRG A;  4KLF A;  4O9M A;  4RWQ A;  4X4T A;  3HWT A;  2P66 A;  3ZDE A;  4EEY A;  2BQR A;  2ATL A;  1ZQW A;  1KTQ A;  4YCX A;  3IM1 A;  3RJF A;  1BPZ A;  9ICF A;  4F5N A;  4QZI A;  1TK0 A;  5KG3 A;  4FHY A;  4WC6 A;  4CCH A;  3EWA A;  2ZJ5 A;  4YR0 A;  3MGH A;  4Q8E A;  2ZHB A;  5J0W A;  7ICS A;  4UAZ A;  4YP3 A;  3TQ1 A;  4QZH A;  1H38 A;  4EBJ A;  2J6S A;  1RYR A;  4DOB A;  1ZJM A;  2BCR A;  2FLP A;  4O5E A;  9ICU A;  3GIL A;  2V9W A;  1U48 A;  4M5D A;  9ICS A;  9ICX A;  4ED0 A;  4IQW A;  8ICZ A;  7ICL A;  4MF2 A;  3H40 A;  4B9L A;  1QSL A;  5C5J A;  2MAX A;  2J6T A;  4WC4 A;  2C28 A;  2PXI A;  3GFK B;  4DLE A;  4R63 A;  2OWO A;  4I2F A;  4DSI A;  4O3S A;  4KLD A;  1T8E A;  4E7X A;  4RNM A;  4RQ7 A;  1ZQJ A;  3HP6 A;  3Q8K A;  5KFN A;  1BPX A;  5DDY A;  4C8K A;  1R8A A;  4KLS A;  1TK5 A;  1NZP A;  4O5K A;  9ICP A;  4WC2 A;  3Q8Q B;  4QZG A;  4DQR A;  4UB1 A;  4X4U A;  4LVS A;  4I2J A;  5D46 A;  4ELV A;  4WBY A;  2BQ3 A;  1NKE A;  5J2J A;  3JPO A;  4QZF A;  4F5O A;  1XSP A;  5DBC A;  2FMS A;  4JV2 A;  4RQ3 A;  3PR5 B;  3B0Y A;  1SL2 A;  1DGS A;  4Q44 A;  1DK3 A;  5KFM A;  1UEU A;  3ZD8 A;  1X2I A;  2W9B B;  4GXK A;  3FYH A;  2W9B A;  4MFF A;  1MIV A;  4RU9 A;  4J9Q A;  1NK6 A;  2BPG A;  7ICJ A;  1KLN A;  5KFT A;  3QEB Z;  1TKD A;  1L5U A;  1ZQE A;  3H3A A;  2PFQ A;  1UT8 A;  3KTQ A;  5J2E A;  1ZQB A;  1EXN A;  2ZUB A;  5DBA A;  4UAY A;  1UA1 A;  3H8W A;  3C21 A;  4IQV A;  5HHH A;  5HC9 A;  2FLN A;  4JV1 A;  2Q66 A;  3RAQ A;  4LZD A;  2F1J A;  3C1Z A;  1TK8 A;  4FS2 A;  2ZTD A;  4S3N A;  3RRH A;  4R8U B;  3H8S A;  1ZQY A;  3BQ0 A;  4ED6 A;  5KG7 A;  3TAR A;  5F2V O;  4M04 A;  5BOM A;  4KLG A;  3GV8 B;  8ICI A;  4WCW A;  2C2E A;  2PFP A;  4YXM A;  2GWS A;  4M6W A;  2FMQ A;  4X0A A;  4ZH4 A;  2NRW A;  1KFD A;  3OJS A;  1Z00 A;  9ICV A;  1MC8 A;  3HPO A;  3FDS A;  1R89 A;  4J9L A;  2ZH2 A;  1NK9 A;  2JEG A;  4DL2 A;  1T3N A;  8ICL A;  5KFL A;  4PGY A;  5KFQ A;  4QZA A;  5HRK A;  1MIW A;  1WCL A;  3H37 A;  2R8I A;  4PHP A;  4ED7 A;  3NTU A;  1CUK A;  4YMO A;  3M8R A;  5J0Y A;  4ECZ A;  3V6K A;  3PX4 A;  3TAQ A;  2DPI A;  2BDP A;  4KLQ A;  5HML A;  2FPL A;  4FH3 A;  3UXP A;  3PY8 A;  8ICA A;  4RZR A;  5CB1 A;  3PX6 A;  3V6H A;  3BQ1 A;  4AT8 B;  4DWI A;  1JX4 A;  5KG1 A;  3NGD A;  4JV0 A;  1U45 A;  4YQW A;  1JIH A;  3QZ8 A;  3RBE A;  4ECS A;  1ZQO A;  1KFS A;  1BNO A;  3MGI A;  2HHS A;  5KT4 A;  1TVA A;  9ICG A;  2HVI A;  5DLF A;  1ZQT A;  7ICV A;  3Q8P B;  3PW0 A;  4KLM A;  4J9P A;  4BXO B;  4NM2 A;  4BWM A;  1ZQF A;  5KG5 A;  5EWE A;  4ECV A;  3RJH A;  5J0X A;  3GQC A;  4RWN A;  5KFA A;  4UBC A;  1BPD A;  1D9F A;  1S97 A;  4UAW A;  2HHX A;  2ZH6 A;  4IG8 A;  4KLJ A;  3V72 A;  1MQ3 A;  3MAB A;  2HHQ A;  3TFR A;  4TUS A;  3ZDA A;  2WTF A;  1HUO A;  2AJQ A;  3WFP A;  2V4R A;  4J9N A;  4FBU A;  1V4A A;  8ICB A;  3OGU A;  4AT9 A;  1Q78 A;  4R66 A;  1TFR A;  3RRG A;  4QW9 A;  5IIN A;  2FLL A;  3ZDB A;  2KZZ A;  3H39 A;  2KTQ A;  4F4X A;  2UVW A;  4UB4 A;  2LYH A;  2C2R A;  2FPK A;  1S76 D;  7ICU A;  3GIK A;  3PV8 A;  3PO5 A;  5DB8 A;  1NKC A;  5DB7 A;  1ZJN A;  1DK2 A;  4X4S A;  4YVZ A;  4P4M A;  2BR0 A;  3N4M B;  4DQS A;  4RQ5 A;  7ICH A;  2PFO A;  8ICT A;  1ZQA A;  3Q8M A;  4EBE A;  1QSS A;  2PBE A;  2Y1I A;  1KNY A;  2O1P A;  4B9M A;  1KRP A;  1BNP A;  1HUZ A;  4F50 A;  5KFB A;  2RFF A;  1T7P A;  4Q45 A;  4FHP A;  2R8K A;  2BPC A;  4P4P A;  2F1H A;  4TQS A;  5CA7 A;  5DEC A;  2ZUD A;  1U4B A;  1JQR A;  4EBD A;  5KFY A;  4B9N A;  4FHW A;  1ZQP A;  4F2R A;  4M9H A;  4WC5 A;  5DB6 A;  3OSN A;  4RPX A;  5L1L A;  1ZQG A;  3PO4 A;  3RR8 A;  3SI8 A;  1JAJ A;  3RB3 A;  3C2L A;  5IIM A;  3C18 A;  5KG4 A;  2VA3 A;  3QEA Z;  3OHB A;  1CEZ A;  1Z3E B;  5KT6 A;  1NJX A;  4GC6 A;  3IHQ B;  4RWP A;  1C7Y A;  5J29 A;  4F4Y A;  3JPT A;  1L3V A;  2M2T A;  2JEF A;  8ICM A;  2DRB A;  2DFL A;  1ZQN A;  5KFK A;  1NKB A;  1BPB A;  1ZQC A;  1KFT A;  1SL1 A;  4DS5 A;  4KIT B;  2KFZ A;  3ETL A;  4F5P A;  4I29 A;  4BGD A;  3BDP A;  1VJ7 A;  4JUZ A;  2UVV A;  2ZH5 A;  1BGX T;  5KFC A;  5CHG A;  3TFS A;  4DSE A;  1X9M A;  3H38 A;  4YR3 A;  2VA8 A;  1A76 A;  3UXN A;  1ZQS A;  3RR7 A;  5HP4 A;  4EZ6 A;  2M2W A;  5KT7 A;  2UVR A;  3AU2 A;  3JPQ A;  2W9A A;  4ECY A;  3JYY A;  4DSK A;  2NRX A;  4WC7 A;  4X4P A;  1D8L A;  3JPR A;  3RB6 A;  4UB5 A;  5J0T A;  4FHV A;  1NK5 A;  4WC1 A;  1RPL A;  2BKE A;  2PI5 A;  4PGX A;  3PW2 A;  2BPF A;  2W9M A;  8ICY A;  4LT6 A;  4TQR A;  4NY8 A;  3OUY B;  3AUO A;  2BCS A;  3OUY A;  2KZM A;  4BXO A;  4XUS A;  4F5Q A;  2AQ0 A;  2HHW A;  3NYB A;  5HRL A;  3KHR A;  3GIJ A;  1KDH A;  4EBK A;  2XY6 A;  1Q79 A;  1VFG A;  1L3T A;  2XC9 A;  4FS1 A;  2AGP A;  2PI4 A;  5KFO A;  5CWR A;  1XSL A;  5HNK A;  5HRB A;  1B43 A;  4J9R A;  5J0U A;  2XY7 A;  1NJZ A;  4EYH B;  2A1J B;  4IR1 A;  8ICW A;  1MIY A;  4JWM A;  2B21 A;  1S0V A;  1WOT A;  2ZH3 A;  1U9L A;  1ZQH A;  1OU5 A;  4F93 B;  3UPQ A;  4O3O A;  3T5L A;  2HW3 A;  1X9S A;  2HHT A;  4X4Q A;  1TV9 A;  4NXZ A;  3KHH A;  4YXJ A;  4Z6E A;  4DS4 A;  4I2A A;  1UEV A;  5HR9 A;  4R64 A;  3V7K A;  4J9O A;  3Q8L A;  1SKR A;  8ICC A;  1IM4 A;  9ICN A;  4KN4 A;  4MFC A;  7ICP A;  8ICO A;  4R8U A;  4IQT A;  3HJ4 A;  1SKS A;  1QSY A;  4M47 A;  8ICG A;  2P6U A;  2W9C B;  4DFM A;  2M2U A;  4RQ4 A;  4DL3 A;  1ZQL A;  5DG9 A;  8ICF A;  1XS9 D;  3RJK A;  4I2H A;  8ICK A;  4F4W A;  4KLL A;  4FH5 A;  3MR6 A;  1U47 A;  1NK4 A;  3JPP A;  1L3S A;  4DOC A;  4ECR A;  3L9D A;  4KN7 A;  4LZG A;  2JZB B;  5J2B A;  2JZB A;  3V7L A;  2BE3 A;  4PH5 A;  1ZQM A;  4DFP A;  4I2I A;  3M9N B;  3V6J A;  2IHM A;  7ICQ A;  5L1I A;  4C8L A;  1R8B A;  4X0B A;  2KZ3 A;  1ZQR A;  3Q8S B;  2NRZ A;  7ICO A;  1ZQD A;  3SZ2 A;  1MSW D;  1S10 A;  3EPI A;  9ICL A;  5DED A;  4B9U A;  3GDX A;  1S9F A;  4DQI A;  7ICE A;  3JZ0 A;  3PMN A;  1XSN A;  1NOM A;  4DFJ A;  2DR8 A;  4DEZ A;  3GV7 B;  1K1S A;  4RQ6 A;  2HHU A;  3WFO A;  4RQ0 A;  1ZQI A;  3RH4 A;  4I28 A;  4J9S A;  5DG8 A;  4AT8 A;  4AT7 B;  4K4H A;  3AQL A;  4B9S A;  5J0Q A;  4O5C A;  5HRH A;  3UXO A;  8ICV A;  2XGP A;  9ICB A;  4E8F A;  4QZE A;  2W8L A;  3K4G A;  2AU0 A;  5HRE A;  5KG6 A;  1S0M A;  4B9T A;  1R8C A;  1UET A;  2IA6 A;  1KEJ A;  1ZQZ A;  3MDC A;  3ISB A;  2ASD A;  3H4B A;  2J6U A;  2VA2 A;  4QWE A;  2HHV A;  5J0O A;  8ICS A;  4ATB B;  4ATB A;  4C8O A;  2ZJA A;  3Q8R B;  7ICR A;  5KT5 A;  4WBZ A;  2BHN A;  4YN4 A;  1JN3 A;  2KN7 A;  9ICK A;  2NRK A;  1S0O A;  2KP7 A;  2XCA A;  1NK7 A;  4Q8F A;  1FA0 A;  4M9G A;  1KSP A;  2RDJ A;  2I1Q A;  3MDA A;  3PW5 A;  3H4D A;  5KFG A;  5J2K A;  4GLX A;  3PX0 A;  4EYI B;  5J0R A;  3GV5 B;  3QZ7 A;  3RB0 A;  8ICP A;  3C2M A;  1BVS A;  4R65 A;  4HYK A;  4UB3 A;  5CR0 A;  3PW7 A;  1JXL A;  3K75 D;  1RZT A;  4I2D A;  4TUP A;  4X4V A;  2AGO A;  1QTM A;  5L1K A;  3UPS A;  4KTQ A;  4DL7 A;  2IMW P;  4RPZ A;  3E2E A;  4I2C A;  2XGQ A;  7ICM A;  3M9M B;  4QWA A;  4RT3 A;  1S0N A;  1D8Y A;  1K1Q A;  4QWD A;  3EZ5 A;  5DB9 A;  4O3R A;  1XWL A;  3PNC A;  5KG2 A;  2ZUC A;  3RH6 A;  1SL0 A;  1ZQU A;  2BCU A;  1SZP A;  4FHX A;  1ZQV A;  4KLE A;  1PX5 A;  3EPG A;  3MFH A;  3G6Y A;  2R8H A;  3B0X A;  4J9K A;  4DLG A;  4ED8 A;  8ICR A;  4F4K A;  3OV7 A;  2Y1J A;  1QLN A;  3RB4 A;  4PHA A;  3ISD A;  4IRK A; 
#chains in the Genus database with same CATH topology
 2FI1 A;  2LMR A;  5CJ7 A;  8ICE A;  4FO6 A;  3H0M B;  4NL9 C;  5DGB A;  5KFV A;  2LHT A;  4X4O A;  5AKZ A;  4YMM A;  4QZ8 A;  1ECW A;  3EW9 A;  3KOO A;  4O3P A;  2FJ6 A;  3U26 A;  4NKT A;  3RH5 A;  2ALZ A;  2LKY A;  2L5Y A;  2DL0 A;  4BX9 C;  4RT2 A;  2HN1 A;  2LBO A;  4C8M A;  5KFP A;  4O67 A;  1BPY A;  4Y2P A;  4F71 A;  1PUZ A;  4WC3 A;  2YB1 A;  3ZI4 A;  4ICA A;  4K9B A;  4RQ1 A;  2XO7 A;  4PHE A;  4DF4 A;  2KFN A;  2E3T A;  4UAR A;  2LYA A;  2DR5 A;  3OJU A;  5J2H A;  2C2D A;  4FO1 A;  2EQY A;  4KLU A;  3OVA A;  1Z1B A;  2RHF A;  3PSI A;  5F9N A;  8ICU A;  3SEI A;  3TAD C;  4NJ8 A;  3THV A;  5ALS A;  4UBB A;  2XCP A;  5J0P A;  2ZTC A;  4Z6D A;  2W54 A;  8ICH A;  4F3O A;  3HIY A;  2UVU A;  3VCB A;  5AK4 A;  1TAU A;  4AT7 A;  3RJJ A;  4MEX A;  2XVT A;  9ICJ A;  1XC9 A;  5KT2 A;  3AL0 B;  2DGZ A;  2KHQ A;  4X4N A;  3T5H A;  2DRA A;  1COK A;  3EYZ A;  2FCL A;  4NLN A;  2M2V A;  1TFW A;  4YD2 A;  4UQG A;  9ICO A;  4RQ8 A;  1S77 D;  1O08 A;  4NLG A;  2KOB A;  2ID1 A;  2O5A A;  4EBC A;  3BQ2 A;  5ALH A;  3RAX A;  3ALR A;  3H8J A;  2NRT A;  3WK6 A;  5HMM A;  7ICT A;  3QUC A;  3UQ0 A;  2M9N A;  4ECU A;  1RDF A;  2IBK A;  3F2D A;  2BCV A;  5ALX A;  2CXY A;  2JH7 A;  4XQ8 A;  2EAO A;  4M9L A;  5TZV A;  1U49 A;  2KE7 A;  4WH5 A;  3UMB A;  2E1F A;  2MUT A;  4I27 A;  2KKV A;  3RJE A;  1S5L U;  3N97 B;  3C23 A;  5AK5 A;  4K98 A;  2OXO A;  4PL1 A;  5BOL A;  7ICN A;  3HWT A;  4EEY A;  1KTQ A;  3IM1 A;  1RYU A;  4QZI A;  5KG3 A;  2ZIW B;  3EWA A;  3PSP A;  7ICS A;  4UAZ A;  4YP3 A;  2J6S A;  1K5O A;  2HN2 A;  9ICS A;  3EF2 A;  9ICX A;  8ICZ A;  3KBB A;  3H40 A;  4CDG A;  2J6T A;  2C28 A;  1TE2 A;  2PXI A;  4P0Q A;  2OWO A;  4Y2Q A;  3Q8K A;  5DDY A;  4C8K A;  2B4V A;  5CFT A;  4DCC A;  4UB1 A;  3PST A;  2KD1 A;  4UAU A;  3OWG A;  4X4U A;  4LVS A;  5CFU A;  5JRT A;  4NWI A;  2BQ3 A;  1NKE A;  4EX6 A;  3JPO A;  2IOF A;  2O1P A;  4RQ3 A;  3WK8 A;  4Q44 A;  1DK3 A;  1UEU A;  1MIV A;  1ZQE A;  4Y2J A;  2PFQ A;  5DBA A;  1UA1 A;  3C21 A;  4IQV A;  1OW5 A;  3RAQ A;  5B3P A;  4FZM A;  3BQ0 A;  5F2V O;  3BS5 A;  2AH5 A;  8ICI A;  2A19 A;  2C2E A;  4U6P A;  2PFP A;  1UCV A;  4YXM A;  1ZD5 A;  4M6W A;  2NRW A;  2KV2 A;  4F72 A;  5AIA A;  2ZH2 A;  1NK9 A;  2KIC A;  3D2Q A;  1MIW A;  3AEV A;  1WCL A;  3H37 A;  2MRL A;  2R8I A;  4NLB A;  4OAI Z;  1HIW A;  4KLQ A;  2BDP A;  3PX4 A;  2FPL A;  3UXP A;  8ICA A;  2H3Q A;  1YT3 A;  5KG1 A;  1JX4 A;  4YQW A;  3RBE A;  1ZQO A;  1BNO A;  2HHS A;  4KB6 A;  3QNM A;  7ICV A;  5AK3 A;  3PW0 A;  4BXO B;  5EWE A;  1XNS A;  2ZH6 A;  4IG8 A;  1MQ3 A;  3MAB A;  3RF9 A;  4OJ5 A;  1SWV A;  5ALN A;  4FBU A;  4Y2X A;  4U7C A;  2KJ9 A;  3RRG A;  2D8C A;  5IIN A;  3ZDB A;  3H39 A;  2KZZ A;  4LJX A;  4EEB A;  2KTQ A;  4F4X A;  2C2R A;  5ALU A;  2KEY A;  1N5W A;  1NKC A;  1ZJN A;  1DK2 A;  4X4S A;  4IL6 U;  4P4M A;  5ALM A;  2BR0 A;  4DQS A;  3Q8M A;  2K8B B;  1L8O A;  4PZN A;  3MCR A;  5CHE A;  4FHP A;  2H3Z A;  3EUB 2;  2F1H A;  4EGW A;  4FHW A;  4WC5 A;  3FM9 A;  3SI8 A;  3RB3 A;  5IIM A;  1X66 A;  2OYY A;  3QEA Z;  2HBJ A;  2XI9 A;  3NVY A;  5KT6 A;  1SZH A;  5J29 A;  2B0C A;  5EE3 A;  5ALQ A;  1ZQC A;  2CRX A;  1KKX A;  1VJ7 A;  4JUZ A;  1BGX T;  3H38 A;  5KT7 A;  2UVR A;  3JPQ A;  3NVW A;  2NRX A;  4FHV A;  4UB5 A;  1NK5 A;  1RPL A;  4IC9 A;  2W9M A;  4GFJ A;  3OUY A;  3WKC A;  4MHV A;  5HRL A;  3GIJ A;  2XY6 A;  1Q79 A;  2XC9 A;  1QQ5 A;  5HRB A;  5HNK A;  1B43 A;  4J9R A;  8ICW A;  1ZQH A;  2K4I A;  3UPQ A;  3T5L A;  2HDO A;  2DF4 B;  5ALF A;  1UEV A;  5EE0 A;  4Y2Y A;  4J9O A;  3Q8L A;  2OCE A;  4C7Y A;  4K97 A;  1IM4 A;  1Q8K A;  1ZD3 A;  4KN4 A;  7ICP A;  4I0U A;  4R8U A;  8ICG A;  2P6U A;  1N5X A;  2M2U A;  4DL3 A;  5DG9 A;  1X40 A;  3SQI A;  4I2H A;  3L9D A;  4DOC A;  4C4R A;  4KN7 A;  2HBK A;  5J2B A;  7ICQ A;  2KZ3 A;  2NRZ A;  1B4F A;  3N28 A;  3KKA A;  1F5S A;  9ICL A;  3PMN A;  1XSN A;  2QAR A;  1NOM A;  3GV7 B;  4RQ6 A;  2NO5 A;  4RQ0 A;  4PZO A;  1ZQI A;  4AT8 A;  4AT7 B;  3AQF A;  2KMD A;  3K4G A;  5KG6 A;  2WFA A;  2DUY A;  1WG8 A;  3Q8R B;  1JN3 A;  5AM3 A;  4Q8F A;  4M9G A;  2RDJ A;  3PW5 A;  1Q46 A;  3H4D A;  3DDH A;  3FAH A;  3GV5 B;  3ONN A;  3PW7 A;  2HCF A;  2WAQ F;  3K75 D;  2AGO A;  2GOL A;  4DL7 A;  2XGQ A;  1D8Y A;  1S0N A;  1K1Q A;  1MN8 A;  4Y2T A;  2JRZ A;  1KQQ A;  1VLB A;  2LYB A;  4KLE A;  2OHF A;  3G6Y A;  4ED8 A;  4F4K A;  3ISD A;  4IRK A;  5DGA A;  2MUT B;  5IIL A;  3PW4 A;  2F2A B;  4DQP A;  5D4B A;  1T94 A;  1YLQ A;  5AM4 A;  2R8J A;  4RQ2 A;  5AI4 A;  2OM6 A;  4OCZ A;  2F44 A;  3I28 A;  3KHL A;  2NV3 A;  3M7D A;  3TKA A;  1RQN A;  2JHD A;  3F5E A;  4K99 A;  3IV6 A;  5IIO A;  4IR9 A;  1N48 A;  3SV3 A;  4LEZ A;  4EEN A;  1PVQ A;  2ASJ A;  5CFS A;  4CF4 A;  2R8G A;  4DSJ A;  1L7M A;  2DVI A;  4EP7 A;  4C8N A;  2JEI A;  5KFZ A;  4F5R A;  4UD4 A;  1YZ6 A;  1DRG A;  2H3I A;  4YG2 A;  5J2I A;  5HRF A;  7ICF A;  4NLZ A;  1X42 A;  1TAQ A;  1L7P A;  5DKW A;  4K4G A;  1D9D A;  1L3U A;  2K4E A;  4QIW C;  4RWO A;  1NK8 A;  3ZDD A;  5L9X A;  2ASL A;  3ICX A;  3KHG A;  2BQU A;  4JK1 A;  1LV5 A;  3BS5 B;  5KFW A;  1XO1 A;  3AN1 A;  4QW8 A;  1KBU A;  2WF9 A;  4KLI A;  4DFK A;  3AQK A;  4B6J A;  1TFY A;  4M6W B;  4YD1 A;  1L7O A;  2C22 A;  3SYZ A;  2ZIV A;  4F92 B;  4DL6 A;  5DQI A;  4AP9 A;  3T3F A;  5DQH A;  3M9O B;  4UD5 A;  4OJ6 A;  9ICR A;  1UA0 A;  1RXV A;  1NO5 A;  4Q43 A;  3AQM A;  2ISO A;  5KTQ A;  2KKP A;  3MR3 A;  4PJ0 U;  2G06 A;  5CP2 A;  4QZB A;  4Z6C A;  4F8R A;  2KHV A;  5KFH A;  4ECQ A;  4TUQ A;  2W55 A;  2BGW A;  4ECW A;  3OTQ A;  2YB4 A;  3SV4 A;  1T4G A;  1QQ7 A;  4TUR A;  4DL5 A;  3RJG A;  3OSP A;  5III A;  3MBY A;  5AM1 A;  3ZDC A;  1XU4 A;  9ICC A;  5HHI A;  1DXS A;  1JRO A;  2WF5 A;  1ZQX A;  3ETR A;  1Y88 A;  3R9K A;  4OJP A;  3OPX A;  2PMZ F;  4P4O A;  1JAL A;  8ICX A;  8ICQ A;  5KFJ A;  2W11 A;  3QU2 A;  3PR4 A;  5HRG A;  2P66 A;  3ZDE A;  2BQR A;  1ZQW A;  2MSN A;  1PK3 A;  4F5N A;  1RG6 A;  4WC6 A;  4FHY A;  4NXX A;  4CCH A;  2VKQ A;  1SB3 C;  2ZJ5 A;  4YR0 A;  4Q8E A;  4EBJ A;  3ED5 A;  1J2N A;  3CYM A;  4DOB A;  2V9W A;  4IQW A;  1KN5 A;  1QSL A;  5C5J A;  2MAX A;  4WC4 A;  1SV0 A;  2BBH A;  3GFK B;  4I2F A;  4R63 A;  4DSI A;  4RQ7 A;  1KL9 A;  1ZQJ A;  3HP6 A;  3UMC A;  1BPX A;  1NZP A;  1TK5 A;  4O5K A;  2W43 A;  4DQR A;  1SV4 A;  1UPH A;  2BBJ A;  3VC8 A;  4ELV A;  4WBY A;  5AHX A;  4CF3 A;  1XSP A;  5DBC A;  2FMS A;  1SL2 A;  3PR5 B;  1D8B A;  4MFF A;  2W9B A;  3NKU A;  1NK6 A;  1KLN A;  5KFT A;  3QEB Z;  5B5E U;  3KTQ A;  1ZQB A;  1PVP A;  1DGJ A;  4JV1 A;  4LZD A;  3MC1 A;  2ZTD A;  4S3N A;  4R8U B;  5KG7 A;  2EZZ A;  2GWS A;  4Y2U A;  1NZB A;  4X0A A;  1Z00 A;  1R89 A;  4J9L A;  2JEG A;  1T3N A;  5KFL A;  5HRK A;  5J8Y A;  1FFV A;  4PHP A;  1CUK A;  4YMO A;  3M8R A;  1WWU A;  3TAQ A;  2DPI A;  4FH3 A;  3PY8 A;  4RZR A;  5CB1 A;  3PX6 A;  1N61 A;  4AT8 B;  4DWI A;  5HR7 A;  1JIH A;  1CRX A;  9ICG A;  4LEW A;  3Q8P B;  4NM2 A;  3RJH A;  4ECV A;  2IUB A;  4K8V A;  3GQC A;  5KFA A;  5ALV A;  1D9F A;  2HHX A;  3NS1 A;  3V72 A;  3N7S C;  2WTF A;  2V4R A;  1V4A A;  4ZOH C;  1Q78 A;  3AMZ A;  1KW4 A;  2G5H B;  4UB4 A;  2LYH A;  3GIK A;  3PV8 A;  5GTH U;  3H0L B;  2Z7J A;  2GH1 A;  4YVZ A;  4EED A;  2PFO A;  1ZQA A;  3SAG A;  3QU4 A;  2PBE A;  5AI0 A;  3F2C A;  1BNP A;  2XID A;  1HUZ A;  4F50 A;  2R8K A;  1IIP A;  3KFU F;  1U4B A;  1JQR A;  4EBD A;  5KFY A;  3OSN A;  1ZOL A;  5TIS U;  1SXE A;  4RPX A;  1ZQG A;  3PO4 A;  2CPR A;  3J81 j;  1CEZ A;  3QXG A;  1NJX A;  4GC6 A;  5ALT A;  2DRB A;  5E79 U;  1ZQN A;  2W03 A;  2ES6 A;  2NYV A;  4I29 A;  3BDP A;  3RR7 A;  4EZ6 A;  4IS7 A;  1FIQ A;  3RB6 A;  4WC1 A;  2BKE A;  1ZQ1 C;  4PGX A;  2BPF A;  4KX5 A;  4DFD A;  1L8L A;  1N2X A;  3AUO A;  2KZM A;  2KSO A;  2HHW A;  1V85 A;  3KHR A;  1KDH A;  4EBK A;  1J97 A;  1L3T A;  4FS1 A;  5KFO A;  1XSL A;  2XY7 A;  5J0U A;  1NJZ A;  2EDU A;  4EYH B;  4JWM A;  2K4P A;  1OU5 A;  4X4Q A;  1TV9 A;  3WK4 A;  2GO7 A;  4JLZ A;  8ICC A;  2PKE A;  2M0N A;  4RQ4 A;  3RFA A;  2ODG A;  8ICF A;  1NK4 A;  1L3S A;  3JPP A;  4ECR A;  2JZB B;  2I5H A;  1HEK A;  2IHM A;  3D6J A;  4QNL A;  1ZQR A;  3H8M A;  3Q8S B;  4JLX A;  4CNQ A;  5ALO A;  1ZQD A;  1S10 A;  5DED A;  3GDX A;  1Q3V A;  5ALY A;  5AKG A;  1ZD2 P;  4DFJ A;  2DR8 A;  2HHU A;  3CRX A;  3RH4 A;  2N1R A;  3SR6 A;  5DG8 A;  5HRH A;  3A0B U;  2W3S A;  2YMP A;  2AU0 A;  2W8L A;  3KZX A;  1RM6 C;  2ZIU A;  3MDC A;  3ISB A;  2VA2 A;  8ICS A;  4ATB B;  4USA A;  2VJ4 A;  3GZF A;  5AIB A;  1RQL A;  2BHN A;  4YN4 A;  2KN7 A;  2XCA A;  1KSP A;  2I1Q A;  3MDA A;  2K8A A;  5B66 U;  4GLX A;  3PX0 A;  3C2M A;  4R65 A;  4HYK A;  2K89 A;  1X6I A;  1QTM A;  5KNI A;  3HRD D;  2QB0 A;  3UPS A;  4RPZ A;  3E2E A;  1VJ5 A;  4I2C A;  5CRX A;  4K96 A;  5ALI A;  4RT3 A;  2ZIX B;  5DB9 A;  2ESE A;  2QLT A;  4UAT A;  1XWL A;  3QU5 A;  3PNC A;  2YMM A;  5KG2 A;  2ZUC A;  3RH6 A;  4CE6 A;  4FHX A;  1PX5 A;  3MFH A;  4PHA A;  1LKY A;  2HOQ A;  4WJ3 B;  2H3V A;  2D3D A;  2ZH7 A;  2DR9 A;  2AGQ A;  4DF8 A;  5JTG A;  1OXJ A;  3M8S A;  3TAN A;  3LDA A;  2AQ4 A;  4K4I A;  2DR7 A;  4NXU A;  4Y2R A;  4MEY A;  4OD0 A;  2R18 A;  5KFX A;  3TAP A;  2JV3 A;  5KFI A;  1RXW A;  4PHD A;  4FBT A;  2ZHA A;  1LB2 B;  3SMV A;  3PVX A;  3NVO A;  1WCN A;  4OAF A;  3QUQ A;  2RP5 A;  9ICA A;  3JPN A;  4DSL A;  3SEN A;  3KKA C;  1FO4 A;  4F91 B;  3SD7 A;  3GIM A;  2E5S A;  3HW8 A;  3WFQ E;  2W8K A;  2AXT U;  5KL8 B;  2KIW A;  3WK5 A;  2ZH1 A;  4RNN A;  2A1J A;  1UT5 A;  4QWC A;  8ICJ A;  2A3V A;  4DL4 A;  7ICI A;  4ED1 A;  1ZET A;  2DWQ A;  4F2S A;  3OHA A;  4DSF A;  1F5A A;  1V38 A;  4O3N A;  3H7I A;  1F0M A;  3B9J A;  2FE9 A;  1X9W A;  3AQE A;  4B9V A;  5AIC A;  3LWM A;  3LWL A;  4EEL A;  4IQU A;  2W9C A;  3F53 A;  4I2B A;  5D61 A;  3JPS A;  5D63 A;  3G6X A;  1RYS A;  5J2D A;  4QZC A;  1OUQ A;  3ZD9 A;  3AU6 A;  2P35 A;  7ICK A;  4E0D A;  4JWN A;  3CNH A;  4RUC A;  9ICQ A;  4NKU A;  4ED3 A;  5DBB A;  2Q0Z X;  4KM5 A;  5EOZ A;  2A1A A;  1Z00 B;  8ICN A;  3K1Z A;  5IIK A;  1AQ6 A;  1HJP A;  3RTV A;  1NJY A;  4KLO A;  2G5I B;  5J2F A;  2ZH4 A;  3HX0 A;  4ECX A;  2EAP A;  5AK6 A;  4QJF B;  5KFF A;  5J2C A;  2ZH9 A;  2Y0S F;  5EWF A;  2DPJ A;  4NLC A;  4BJQ A;  1ARO P;  5DDM A;  4DO9 A;  2KVS A;  4GC7 A;  1ZQQ A;  4GXJ A;  5AKE A;  2EH9 A;  5GTI U;  3M6K A;  4IRD A;  4X4R A;  5HRI A;  4NM1 A;  4YFK A;  3ERC C;  2ZJ8 A;  4QZD A;  3CW2 C;  3MR2 A;  9ICM A;  5F9L A;  3WKD A;  3PML A;  4BDP A;  5AKX A;  4HX0 A;  2RDI A;  1XO0 A;  2ISP A;  5ALJ A;  1A77 A;  3MFI A;  3E0F A;  2IHN A;  1SXD A;  4RQN A;  3GII A;  4NLK A;  1YZ7 A;  3OVB A;  9ICI A;  2F3N A;  3G6V A;  4RPY A;  2PMZ C;  3TI0 A;  4KLF A;  1S8O A;  3QU7 A;  3RJF A;  1N63 A;  5AM0 A;  3IP4 B;  4C0Z A;  9ICF A;  2ZIW A;  2ZHB A;  3TQ1 A;  1JI7 A;  1ZJM A;  9ICU A;  3GIL A;  4M5D A;  5K4L A;  7ICL A;  4B9L A;  4O69 A;  4DLE A;  2KJ8 A;  4FFD A;  4P0Q B;  1T8E A;  1JUD A;  3DV9 A;  9ICP A;  4WQK A;  3M1Y A;  4LEY A;  4I2J A;  5D46 A;  2FDR A;  2E8N A;  2KSO B;  2KJ5 A;  2YML A;  4FZN A;  4F5O A;  3NRZ A;  3B0Y A;  1DGS A;  1ZD4 A;  3ZD8 A;  2E8O A;  3FYH A;  4J9Q A;  2BPG A;  2QKQ A;  3PHZ A;  1L5U A;  2HOI A;  3H3A A;  2KK0 A;  1UT8 A;  4K9A A;  1EXN A;  1N60 A;  4P0P A;  2FLN A;  2Q66 A;  2F1J A;  3WKA A;  4FS2 A;  1ZQY A;  4ED6 A;  3TAR A;  1ZRN A;  4M04 A;  5BOM A;  4KLG A;  3GV8 B;  3ER9 B;  2FMQ A;  3OJS A;  1KFD A;  4C7Z A;  9ICV A;  4O68 A;  3HPO A;  4DL2 A;  8ICL A;  2F8L A;  5KFQ A;  5C0Y A;  1Q3U A;  2JR5 A;  1VDV A;  1GO3 F;  4ED7 A;  5CEH A;  3NTU A;  3V6K A;  5HML A;  3V6H A;  5L1M A;  3NGD A;  1U45 A;  5EE9 A;  1A6S A;  2EZY A;  1SIJ A;  2F8K A;  5KT4 A;  1TVA A;  5ALG A;  3HIL A;  2HVI A;  4UB8 U;  2EWR A;  4J9P A;  1NNL A;  3BZK A;  5J0X A;  2OEH A;  4RWN A;  4UBC A;  1BPD A;  1Z19 A;  1S97 A;  4UAW A;  4G9B A;  3SAH A;  2W7O A;  4TUS A;  4CGZ A;  2AJQ A;  3WFP A;  4J9N A;  3JCF A;  4AT9 A;  4R66 A;  2FLL A;  2DBY A;  1SV0 C;  7ICU A;  2K4H A;  3PO5 A;  4EV6 A;  2GAF D;  5AI8 A;  4RQ5 A;  2IHO A;  4EBE A;  1QSS A;  2Y1I A;  1KNY A;  4B9M A;  1KRP A;  2YY6 A;  3N7P D;  5KFB A;  4Q45 A;  2BPC A;  2E8M A;  2E1E A;  5CA7 A;  5DEC A;  2ZUD A;  2LM1 A;  4B9N A;  1ZQP A;  2RQ5 A;  3L4P A;  5L1L A;  3RR8 A;  1JAJ A;  3C2L A;  3OHB A;  1Z3E B;  5AKI A;  2YX8 A;  3A0H U;  4RWP A;  2HBM A;  4F4Y A;  2JEF A;  3TAC B;  2DFL A;  4EEK A;  5KFK A;  1NKB A;  2ZG6 A;  3IDW A;  3LVW A;  1KFT A;  4DS5 A;  4KIT B;  1TAM A;  1NI3 A;  4F5P A;  4GIB A;  2UVV A;  2ZH5 A;  5CHG A;  1T3Q A;  4BUG A;  3TFS A;  4DSE A;  1X9M A;  4UAV A;  1ZQS A;  2VA8 A;  3UXN A;  4CF5 A;  5ALR A;  5HP4 A;  3AU2 A;  4X4P A;  4DSK A;  5J8Y C;  1WUD A;  5J0T A;  4JB3 A;  3I76 A;  8ICY A;  4LT6 A;  4TQR A;  4NY8 A;  5AM2 A;  3OUY B;  3QUT A;  2AQ0 A;  3NYB A;  5AKK A;  1ZXI A;  1VFG A;  1JRP A;  1PK1 A;  2PI4 A;  3C28 A;  1MIY A;  2A1J B;  4IR1 A;  2ZH3 A;  1X9X A;  1X9S A;  4I2A A;  5G5H A;  4NXZ A;  2WB1 F;  4Z6E A;  3KHH A;  5HR9 A;  4NL9 A;  3WKE A;  4MFC A;  8ICO A;  3HJ4 A;  1SKS A;  2W9C B;  4DFM A;  1ZQL A;  4FH5 A;  2IOH A;  1XS9 D;  3RJK A;  4KLL A;  5AKJ A;  1B0X A;  3MR6 A;  4QIW F;  1U47 A;  4OJL A;  4LZG A;  3IG8 A;  3V7L A;  1IV8 A;  3H0R B;  4DFP A;  2WF7 A;  2IOF K;  2RLT A;  5AI9 A;  3HKZ F;  1MSW D;  4B9U A;  3JZ0 A;  2W3R A;  2QAR B;  3LVV A;  5AKY A;  4AYB F;  4B9S A;  5J0Q A;  4O5C A;  3UXO A;  2DQN B;  3UM9 A;  9ICB A;  4E8F A;  2I6X A;  4B9T A;  1R8C A;  1KEJ A;  5T14 A;  2QB1 A;  2J6U A;  2HHV A;  1L7N A;  4QWE A;  5J0O A;  4C8O A;  2ZJA A;  1UHU A;  4WBZ A;  2NRK A;  9ICK A;  1S0O A;  2KP7 A;  1NK7 A;  3DEE A;  2MA1 A;  4C80 A;  4EYI B;  2G08 A;  2JH1 A;  8ICP A;  1BVS A;  5CR0 A;  3TAD A;  4TUP A;  4X4V A;  5L1K A;  2ZXI A;  5ALW A;  4NXT A;  2B56 A;  7ICM A;  3M9M B;  2EZX A;  2LM4 A;  2LI6 A;  2BCU A;  1SZP A;  1ZQV A;  2RRD A;  2YQE A;  3EPG A;  4US9 A;  4NXW A;  2Y1J A;  1QLN A;  3RB4 A;  3SAF A;  2JGA A;  4MKP A;  2HVH A;  2YTU A;  3RJI A;  3V7J A;  5IIJ A;  4RUA A;  1A0P A;  3ISC A;  5KFS A;  4M2Y A;  2YN4 A;  4E80 A;  4PPX A;  4HAI A;  4KLH A;  5KFD A;  5D49 A;  3T5K A;  1ZYQ A;  3ER8 C;  5KG0 A;  2HI0 A;  2H3F A;  5BPC A;  1NJW A;  5J2G A;  5D62 A;  3C66 A;  5KT3 A;  1IXR A;  3AQN A;  4ED2 A;  2HMX A;  2H5X A;  2I9G A;  3WK9 A;  3C5G A;  4IRC A;  1QH9 A;  4I2G A;  7ICG A;  4OAH A;  4MFA A;  3BJY A;  4X5V A;  2ZH8 A;  4M0A A;  3NWI A;  5KFU A;  4YMN A;  4O6A A;  4QZ9 A;  3LQC B;  3UQ2 A;  5DLG A;  3NUQ A;  4XRH A;  4ELT A;  2FMP A;  3T79 A;  4BWJ A;  3HJ1 A;  2GLE A;  4Z6F A;  2MU2 A;  4O0I A;  3T5J A;  3GU3 A;  4G3I A;  2XY5 A;  2BCQ A;  4KLT A;  1B22 A;  3QUB A;  3KD3 A;  4NV0 A;  5KFE A;  4MF8 A;  3C2K A;  1QCK A;  4F4Z A;  5J0S A;  2G09 A;  5KFR A;  2P6R A;  4KMU A;  3CK6 A;  2W7P A;  4CRX A;  1BPE A;  2JEJ A;  3NAS A;  4P0P B;  3C5F A;  1UQV A;  4LEV A;  2OH2 A;  4FE3 A;  1V9P A;  9ICH A;  2KIV A;  4RNO A;  2VAN A;  2FPM A;  5ALD A;  4GXI A;  5L1J A;  3QE9 Y;  2EAN A;  4M9N A;  4DOA A;  1PVR A;  2ZIV B;  3BQT A;  4YR2 A;  1URJ A;  3RBD A;  5HR6 A;  2D6F C;  3K1R B;  4OJO A;  5HRD A;  2F1I A;  9ICT A;  3WFR E;  2XIC A;  3FC4 A;  4WC0 A;  4UB2 A;  5DQG A;  4OAG A;  1WWV A;  3HT3 A;  1DOQ A;  4RQM A;  3WK7 A;  9ICW A;  4US8 A;  4DQQ A;  2V4Q A;  1ZQK A;  1NK0 A;  2Y0S C;  4P2H A;  3WFS C;  5AM5 A;  5JU5 A;  4QWB A;  4XQ7 A;  3BS7 A;  4I2E A;  3C1Y A;  9ICE A;  1JMS A;  5H2F U;  3MR5 A;  4XA5 A;  3PZP A;  2HBL A;  2NRV A;  4ELU A;  2WAQ C;  4Y2V A;  4PGQ A;  5EWG A;  3O0F A;  1JXE A;  4A8E A;  4AT9 B;  1FFU A;  4O3Q A;  5KL1 B;  2HHP A;  4NXV A;  1MQ2 A;  1PZN A;  4UAS A;  5AKL A;  1COO A;  2ZTE A;  1N56 A;  1X6J A;  5A0L A;  2PFN A;  5JUM A;  1O03 A;  4ECT A;  3CP8 A;  4M9J A;  1SKW A;  3LK9 A;  5B3Q A;  4EZ9 A;  5DG7 A;  3KZI U;  5J2A A;  3OVS A;  2NO4 A;  3ORY A;  4J9M A;  4X4T A;  2W04 A;  4O9M A;  4RWQ A;  3S6J A;  3MGV A;  2ATL A;  4YCX A;  2YMQ A;  1BPZ A;  1TK0 A;  3L5K A;  3MGH A;  3HJE A;  5J0W A;  4QZH A;  1H38 A;  3M6Z A;  1RYR A;  2FLP A;  2BCR A;  4O5E A;  2K8C B;  2E8P A;  3D2S A;  1U48 A;  4ED0 A;  4MF2 A;  1C20 A;  4E7X A;  4ACO A;  4KLD A;  4O3S A;  4RNM A;  2B51 A;  1P7D A;  5KFN A;  1R8A A;  5AI5 A;  4KLS A;  4WC2 A;  3Q8Q B;  4QZG A;  2LPE A;  5AKH A;  4OO1 J;  5J2J A;  3L3F X;  4QZF A;  3OV7 A;  4JV2 A;  2BZF A;  1ZRM A;  4UB6 U;  1PK1 B;  5KFM A;  1X2I A;  5ALP A;  2W9B B;  4GXK A;  2KNJ A;  4RU9 A;  7ICJ A;  1WYG A;  1TKD A;  3UMG A;  5J2E A;  2ZUB A;  4UAY A;  3H8W A;  5FP0 A;  5HHH A;  1F44 A;  5HC9 A;  3C1Z A;  1TK8 A;  3RRH A;  3H8S A;  4C4S A;  3BZC A;  4WCW A;  2HSZ A;  1FEZ A;  5ALE A;  5AI6 A;  4ZH4 A;  1MC8 A;  3FDS A;  2HOF A;  2DKZ A;  2B6G A;  4PGY A;  4QZA A;  5J0Y A;  4ECZ A;  3BQ1 A;  3PSF A;  1SGG A;  3QU9 A;  4JV0 A;  1SWW A;  3QZ8 A;  4ECS A;  1KFS A;  2KVC A;  2JXJ A;  3MGI A;  5DLF A;  1ZQT A;  4KLM A;  1ZQF A;  4BWM A;  4J03 A;  5KG5 A;  2ZXH A;  4KLJ A;  5KAF U;  2HHQ A;  2Y9T A;  3TFR A;  4JMU A;  3ZDA A;  1HUO A;  8ICB A;  3OGU A;  1TFR A;  4QW9 A;  1J2M A;  2UVW A;  3WKB A;  5EE1 A;  3NRW A;  1S76 D;  2FPK A;  5DB8 A;  3IG5 A;  1CI4 A;  5DB7 A;  4FZL A;  2WF8 A;  3N4M B;  8ICT A;  7ICH A;  5KAI U;  1LVH A;  2AHO B;  4C4T A;  2VIX A;  3LYS A;  2RFF A;  1T7P A;  4P4P A;  4TQS A;  4O3M A;  1IG6 A;  4PL2 A;  4F2R A;  4M9H A;  5DB6 A;  1V97 A;  3C18 A;  1QQ6 A;  5KG4 A;  2VA3 A;  4WQL A;  4KMO B;  4UW9 A;  1L6N A;  3IHQ B;  1C7Y A;  1L3V A;  2EAM A;  3JPT A;  2M2T A;  2F76 X;  2G07 A;  3D2N A;  8ICM A;  4WOY A;  1BPB A;  1SL1 A;  1ED1 A;  1GPJ A;  2KFZ A;  3ETL A;  4BGD A;  4KX3 A;  5KFC A;  4YR3 A;  3AM9 A;  1A76 A;  2M2W A;  3JYY A;  2W9A A;  2WHE A;  4ECY A;  4WC7 A;  2VJ5 A;  1D8L A;  3JPR A;  2PI5 A;  2G0A A;  3PW2 A;  1N62 A;  2K60 A;  2BCS A;  4XJE A;  2Y9U A;  3QYP A;  4XUS A;  4F5Q A;  3K7D A;  1Z4N A;  2O6K A;  3BQ7 A;  2AGP A;  5CWR A;  2B21 A;  1S0V A;  1WOT A;  1U9L A;  3IRU A;  4F93 B;  2HW3 A;  4O3O A;  2HHT A;  4YXJ A;  4DS4 A;  4R64 A;  3V7K A;  3IN5 A;  1SKR A;  4EX7 A;  9ICN A;  3I1Y A;  4IQT A;  1QSY A;  2WB1 C;  4M47 A;  8ICK A;  4F4W A;  2BE3 A;  2JZB A;  1Z4O A;  4PH5 A;  1ZQM A;  4I2I A;  3M9N B;  3V6J A;  1R8B A;  5L1I A;  4C8L A;  4X0B A;  5F3X B;  7ICO A;  3SZ2 A;  1M6Y A;  3EPI A;  1S9F A;  4DQI A;  3NVV A;  7ICE A;  3C29 A;  4DEZ A;  1K1S A;  3WFO A;  3N7R C;  3HKZ C;  4I28 A;  4J9S A;  5ALK A;  5ALL A;  4K4H A;  3AQL A;  2WF6 A;  2KG5 A;  4AYB C;  2XGP A;  4QZE A;  5HRE A;  1S0M A;  1UET A;  2IA6 A;  1ZQZ A;  2ZIU B;  2ASD A;  4BXO A;  8ICV A;  3H4B A;  3WU2 U;  4ATB A;  4Y2S A;  5ALZ A;  7ICR A;  5KT5 A;  1FA0 A;  3QX7 A;  3E58 A;  5KFG A;  5J2K A;  5J0R A;  5G5G A;  2Q4T A;  3QZ7 A;  3RB0 A;  1JXL A;  4UB3 A;  3F2B A;  1RZT A;  4I2D A;  1MA7 A;  2QB0 B;  2BDU A;  4KTQ A;  2IMW P;  3NVZ A;  3F5A A;  4QWA A;  3EZ5 A;  2ZIX A;  4QWD A;  4N7R A;  4O3R A;  1Z1V A;  2CN1 A;  5JTI A;  2JMG A;  2DKX A;  1SL0 A;  1ZQU A;  2R8H A;  3B0X A;  4J9K A;  4DLG A;  2F77 X;  8ICR A;  2GA9 D;  1LKY B; 
#chains in the Genus database with same CATH homology
 2HVH A;  3RJI A;  3V7J A;  5IIJ A;  4RUA A;  5DGA A;  5CJ7 A;  3ISC A;  8ICE A;  5KFS A;  2AGQ A;  4M2Y A;  2ZH7 A;  2DR9 A;  4DF8 A;  4E80 A;  2MUT B;  4FO6 A;  5IIL A;  3PW4 A;  3M8S A;  3TAN A;  4PPX A;  3LDA A;  2AQ4 A;  5DGB A;  4K4I A;  5KFV A;  4DQP A;  4KLH A;  2DR7 A;  5KFD A;  5D4B A;  5D49 A;  4MEY A;  4X4O A;  3T5K A;  4YMM A;  1ZYQ A;  1YLQ A;  4QZ8 A;  2R8J A;  3EW9 A;  4RQ2 A;  5KG0 A;  4O3P A;  5KFX A;  5BPC A;  3TAP A;  1NJW A;  5KFI A;  5J2G A;  1RXW A;  4PHD A;  4NKT A;  4FBT A;  3KHL A;  2ZHA A;  3C66 A;  3RH5 A;  2ALZ A;  5KT3 A;  1IXR A;  3AQN A;  4ED2 A;  1LB2 B;  3PVX A;  2I9G A;  2H5X A;  1WCN A;  5IIO A;  9ICA A;  4RT2 A;  3JPN A;  4IR9 A;  4DSL A;  3C5G A;  1N48 A;  3SV3 A;  4IRC A;  4I2G A;  4F91 B;  3GIM A;  7ICG A;  4C8M A;  3HW8 A;  3WFQ E;  2W8K A;  2ASJ A;  5KFP A;  4MFA A;  3BJY A;  4X5V A;  2R8G A;  1BPY A;  4DSJ A;  2ZH8 A;  4M0A A;  5KFU A;  4YMN A;  4WC3 A;  4QZ9 A;  3LQC B;  2DVI A;  4EP7 A;  3UQ2 A;  4C8N A;  2ZH1 A;  4RNN A;  2A1J A;  1UT5 A;  4QWC A;  2JEI A;  8ICJ A;  4RQ1 A;  5DLG A;  2XO7 A;  5KFZ A;  4F5R A;  4XRH A;  4DL4 A;  4PHE A;  4DF4 A;  4ED1 A;  1ZET A;  4ELT A;  7ICI A;  4F2S A;  2KFN A;  2FMP A;  3OHA A;  4UD4 A;  4DSF A;  4BWJ A;  3HJ1 A;  1F5A A;  4O3N A;  3H7I A;  4Z6F A;  4O0I A;  3T5J A;  4G3I A;  4YG2 A;  5J2I A;  2XY5 A;  1X9W A;  4B9V A;  5HRF A;  3LWM A;  2DR5 A;  3OJU A;  3LWL A;  5J2H A;  2C2D A;  4IQU A;  2BCQ A;  2W9C A;  4KLT A;  1B22 A;  4KLU A;  3OVA A;  7ICF A;  4I2B A;  4NLZ A;  5KFE A;  4MF8 A;  3JPS A;  1TAQ A;  3C2K A;  5DKW A;  3G6X A;  1RYS A;  5J2D A;  5F9N A;  4QZC A;  4K4G A;  4F4Z A;  8ICU A;  5J0S A;  1D9D A;  3ZD9 A;  1L3U A;  5KFR A;  3THV A;  2P6R A;  4KMU A;  3AU6 A;  1BPE A;  2JEJ A;  4RWO A;  1NK8 A;  3ZDD A;  5L9X A;  4UBB A;  3C5F A;  2ASL A;  7ICK A;  4E0D A;  4JWN A;  2XCP A;  1V9P A;  3KHG A;  5J0P A;  2BQU A;  2ZTC A;  4JK1 A;  4RUC A;  9ICH A;  4RNO A;  9ICQ A;  4ED3 A;  4Z6D A;  2VAN A;  5DBB A;  5KFW A;  1LV5 A;  4NKU A;  1XO1 A;  2Q0Z X;  4QW8 A;  2FPM A;  5EOZ A;  4F3O A;  4DFK A;  4KLI A;  8ICH A;  3HIY A;  4GXI A;  5L1J A;  3QE9 Y;  2UVU A;  3AQK A;  1TAU A;  4M6W B;  4YD1 A;  4DOA A;  4M9N A;  1TFY A;  4AT7 A;  2C22 A;  3SYZ A;  1Z00 B;  3RJJ A;  4F92 B;  8ICN A;  4DL6 A;  3BQT A;  4MEX A;  4YR2 A;  5DQI A;  9ICJ A;  3T3F A;  3RBD A;  1XC9 A;  5DQH A;  5KT2 A;  5IIK A;  3RTV A;  1HJP A;  2F1I A;  1NJY A;  4KLO A;  9ICT A;  5HRD A;  3WFR E;  3M9O B;  5J2F A;  2ZH4 A;  4X4N A;  4UD5 A;  3T5H A;  2DRA A;  3HX0 A;  4ECX A;  9ICR A;  1UA0 A;  1RXV A;  4WC0 A;  3EYZ A;  5KFF A;  5J2C A;  5DQG A;  4UB2 A;  4NLN A;  1NO5 A;  2ZH9 A;  2M2V A;  1TFW A;  5EWF A;  4Q43 A;  4YD2 A;  4UQG A;  2DPJ A;  3AQM A;  2ISO A;  9ICO A;  4RQ8 A;  1S77 D;  5KTQ A;  1DOQ A;  1ARO P;  5DDM A;  3HT3 A;  9ICW A;  4DQQ A;  3MR3 A;  2V4Q A;  1ZQK A;  1NK0 A;  4NLG A;  5CP2 A;  4P2H A;  4DO9 A;  4QZB A;  2ID1 A;  4Z6C A;  3WFS C;  4GC7 A;  2O5A A;  4EBC A;  1ZQQ A;  3BQ2 A;  4GXJ A;  4F8R A;  4QWB A;  5KFH A;  4ECQ A;  3RAX A;  4XQ7 A;  4I2E A;  4TUQ A;  3C1Y A;  3H8J A;  2NRT A;  2BGW A;  9ICE A;  1JMS A;  3MR5 A;  4IRD A;  4XA5 A;  2NRV A;  4ELU A;  4ECW A;  5HMM A;  7ICT A;  4X4R A;  4PGQ A;  3SV4 A;  5HRI A;  1T4G A;  5EWG A;  4NM1 A;  4YFK A;  4TUR A;  1JXE A;  3UQ0 A;  4DL5 A;  3RJG A;  2ZJ8 A;  4QZD A;  3OSP A;  2M9N A;  4ECU A;  5III A;  4AT9 B;  3MBY A;  2IBK A;  3ZDC A;  2BCV A;  4O3Q A;  3MR2 A;  9ICM A;  2HHP A;  5F9L A;  1XU4 A;  9ICC A;  1MQ2 A;  1PZN A;  4XQ8 A;  5HHI A;  1COO A;  3PML A;  4BDP A;  2ZTE A;  1N56 A;  2RDI A;  2ISP A;  4M9L A;  1A77 A;  5TZV A;  1ZQX A;  3MFI A;  2PFN A;  1U49 A;  5JUM A;  1Y88 A;  2IHN A;  2MUT A;  4P4O A;  4ECT A;  4I27 A;  4M9J A;  1SKW A;  3LK9 A;  3RJE A;  3GII A;  4NLK A;  3N97 B;  4EZ9 A;  3C23 A;  5DG7 A;  8ICQ A;  9ICI A;  8ICX A;  3OVB A;  5J2A A;  5KFJ A;  3G6V A;  5BOL A;  4RPY A;  3OVS A;  3ORY A;  4J9M A;  3TI0 A;  3PR4 A;  7ICN A;  5HRG A;  4KLF A;  4O9M A;  4RWQ A;  4X4T A;  3HWT A;  2P66 A;  3ZDE A;  4EEY A;  2BQR A;  2ATL A;  1ZQW A;  1KTQ A;  4YCX A;  3IM1 A;  3RJF A;  1BPZ A;  9ICF A;  4F5N A;  4QZI A;  1TK0 A;  5KG3 A;  4FHY A;  4WC6 A;  4CCH A;  3EWA A;  2ZJ5 A;  4YR0 A;  3MGH A;  4Q8E A;  2ZHB A;  5J0W A;  7ICS A;  4UAZ A;  4YP3 A;  3TQ1 A;  4QZH A;  1H38 A;  4EBJ A;  2J6S A;  1RYR A;  4DOB A;  1ZJM A;  2BCR A;  2FLP A;  4O5E A;  9ICU A;  3GIL A;  2V9W A;  1U48 A;  4M5D A;  9ICS A;  9ICX A;  4ED0 A;  4IQW A;  8ICZ A;  7ICL A;  4MF2 A;  3H40 A;  4B9L A;  1QSL A;  5C5J A;  2MAX A;  2J6T A;  4WC4 A;  2C28 A;  2PXI A;  3GFK B;  4DLE A;  4R63 A;  2OWO A;  4I2F A;  4DSI A;  4O3S A;  4KLD A;  1T8E A;  4E7X A;  4RNM A;  4RQ7 A;  1ZQJ A;  3HP6 A;  3Q8K A;  5KFN A;  1BPX A;  5DDY A;  4C8K A;  1R8A A;  4KLS A;  1TK5 A;  1NZP A;  4O5K A;  9ICP A;  4WC2 A;  3Q8Q B;  4QZG A;  4DQR A;  4UB1 A;  4X4U A;  4LVS A;  4I2J A;  5D46 A;  4ELV A;  4WBY A;  2BQ3 A;  1NKE A;  5J2J A;  3JPO A;  4QZF A;  4F5O A;  1XSP A;  5DBC A;  2FMS A;  4JV2 A;  4RQ3 A;  3PR5 B;  3B0Y A;  1SL2 A;  1DGS A;  4Q44 A;  1DK3 A;  5KFM A;  1UEU A;  3ZD8 A;  1X2I A;  2W9B B;  4GXK A;  3FYH A;  2W9B A;  4MFF A;  1MIV A;  4RU9 A;  4J9Q A;  1NK6 A;  2BPG A;  7ICJ A;  1KLN A;  5KFT A;  3QEB Z;  1TKD A;  1L5U A;  1ZQE A;  3H3A A;  2PFQ A;  1UT8 A;  3KTQ A;  5J2E A;  1ZQB A;  1EXN A;  2ZUB A;  5DBA A;  4UAY A;  1UA1 A;  3H8W A;  3C21 A;  4IQV A;  5HHH A;  5HC9 A;  2FLN A;  4JV1 A;  2Q66 A;  3RAQ A;  4LZD A;  2F1J A;  3C1Z A;  1TK8 A;  4FS2 A;  2ZTD A;  4S3N A;  3RRH A;  4R8U B;  3H8S A;  1ZQY A;  3BQ0 A;  4ED6 A;  5KG7 A;  3TAR A;  5F2V O;  4M04 A;  5BOM A;  4KLG A;  3GV8 B;  8ICI A;  4WCW A;  2C2E A;  2PFP A;  4YXM A;  2GWS A;  4M6W A;  2FMQ A;  4X0A A;  4ZH4 A;  2NRW A;  1KFD A;  3OJS A;  1Z00 A;  9ICV A;  1MC8 A;  3HPO A;  3FDS A;  1R89 A;  4J9L A;  2ZH2 A;  1NK9 A;  2JEG A;  4DL2 A;  1T3N A;  8ICL A;  5KFL A;  4PGY A;  5KFQ A;  4QZA A;  5HRK A;  1MIW A;  1WCL A;  3H37 A;  2R8I A;  4PHP A;  4ED7 A;  3NTU A;  1CUK A;  4YMO A;  3M8R A;  5J0Y A;  4ECZ A;  3V6K A;  3PX4 A;  3TAQ A;  2DPI A;  2BDP A;  4KLQ A;  5HML A;  2FPL A;  4FH3 A;  3UXP A;  3PY8 A;  8ICA A;  4RZR A;  5CB1 A;  3PX6 A;  3V6H A;  3BQ1 A;  4AT8 B;  4DWI A;  1JX4 A;  5KG1 A;  3NGD A;  4JV0 A;  1U45 A;  4YQW A;  1JIH A;  3QZ8 A;  3RBE A;  4ECS A;  1ZQO A;  1KFS A;  1BNO A;  3MGI A;  2HHS A;  5KT4 A;  1TVA A;  9ICG A;  2HVI A;  5DLF A;  1ZQT A;  7ICV A;  3Q8P B;  3PW0 A;  4KLM A;  4J9P A;  4BXO B;  4NM2 A;  4BWM A;  1ZQF A;  5KG5 A;  5EWE A;  4ECV A;  3RJH A;  5J0X A;  3GQC A;  4RWN A;  5KFA A;  4UBC A;  1BPD A;  1D9F A;  1S97 A;  4UAW A;  2HHX A;  2ZH6 A;  4IG8 A;  4KLJ A;  3V72 A;  1MQ3 A;  3MAB A;  2HHQ A;  3TFR A;  4TUS A;  3ZDA A;  2WTF A;  1HUO A;  2AJQ A;  3WFP A;  2V4R A;  4J9N A;  4FBU A;  1V4A A;  8ICB A;  3OGU A;  4AT9 A;  1Q78 A;  4R66 A;  1TFR A;  3RRG A;  4QW9 A;  5IIN A;  2FLL A;  3ZDB A;  2KZZ A;  3H39 A;  2KTQ A;  4F4X A;  2UVW A;  4UB4 A;  2LYH A;  2C2R A;  2FPK A;  1S76 D;  7ICU A;  3GIK A;  3PV8 A;  3PO5 A;  5DB8 A;  1NKC A;  5DB7 A;  1ZJN A;  1DK2 A;  4X4S A;  4YVZ A;  4P4M A;  2BR0 A;  3N4M B;  4DQS A;  4RQ5 A;  7ICH A;  2PFO A;  8ICT A;  1ZQA A;  3Q8M A;  4EBE A;  1QSS A;  2PBE A;  2Y1I A;  1KNY A;  2O1P A;  4B9M A;  1KRP A;  1BNP A;  1HUZ A;  4F50 A;  5KFB A;  2RFF A;  1T7P A;  4Q45 A;  4FHP A;  2R8K A;  2BPC A;  4P4P A;  2F1H A;  4TQS A;  5CA7 A;  5DEC A;  2ZUD A;  1U4B A;  1JQR A;  4EBD A;  5KFY A;  4B9N A;  4FHW A;  1ZQP A;  4F2R A;  4M9H A;  4WC5 A;  5DB6 A;  3OSN A;  4RPX A;  5L1L A;  1ZQG A;  3PO4 A;  3RR8 A;  3SI8 A;  1JAJ A;  3RB3 A;  3C2L A;  5IIM A;  3C18 A;  5KG4 A;  2VA3 A;  3QEA Z;  3OHB A;  1CEZ A;  1Z3E B;  5KT6 A;  1NJX A;  4GC6 A;  3IHQ B;  4RWP A;  1C7Y A;  5J29 A;  4F4Y A;  3JPT A;  1L3V A;  2M2T A;  2JEF A;  8ICM A;  2DRB A;  2DFL A;  1ZQN A;  5KFK A;  1NKB A;  1BPB A;  1ZQC A;  1KFT A;  1SL1 A;  4DS5 A;  4KIT B;  2KFZ A;  3ETL A;  4F5P A;  4I29 A;  4BGD A;  3BDP A;  1VJ7 A;  4JUZ A;  2UVV A;  2ZH5 A;  1BGX T;  5KFC A;  5CHG A;  3TFS A;  4DSE A;  1X9M A;  3H38 A;  4YR3 A;  2VA8 A;  1A76 A;  3UXN A;  1ZQS A;  3RR7 A;  5HP4 A;  4EZ6 A;  2M2W A;  5KT7 A;  2UVR A;  3AU2 A;  3JPQ A;  2W9A A;  4ECY A;  3JYY A;  4DSK A;  2NRX A;  4WC7 A;  4X4P A;  1D8L A;  3JPR A;  3RB6 A;  4UB5 A;  5J0T A;  4FHV A;  1NK5 A;  4WC1 A;  1RPL A;  2BKE A;  2PI5 A;  4PGX A;  3PW2 A;  2BPF A;  2W9M A;  8ICY A;  4LT6 A;  4TQR A;  4NY8 A;  3OUY B;  3AUO A;  2BCS A;  3OUY A;  2KZM A;  4BXO A;  4XUS A;  4F5Q A;  2AQ0 A;  2HHW A;  3NYB A;  5HRL A;  3KHR A;  3GIJ A;  1KDH A;  4EBK A;  2XY6 A;  1Q79 A;  1VFG A;  1L3T A;  2XC9 A;  4FS1 A;  2AGP A;  2PI4 A;  5KFO A;  5CWR A;  1XSL A;  5HNK A;  5HRB A;  1B43 A;  4J9R A;  5J0U A;  2XY7 A;  1NJZ A;  4EYH B;  2A1J B;  4IR1 A;  8ICW A;  1MIY A;  4JWM A;  2B21 A;  1S0V A;  1WOT A;  2ZH3 A;  1U9L A;  1ZQH A;  1OU5 A;  4F93 B;  3UPQ A;  4O3O A;  3T5L A;  2HW3 A;  1X9S A;  2HHT A;  4X4Q A;  1TV9 A;  4NXZ A;  3KHH A;  4YXJ A;  4Z6E A;  4DS4 A;  4I2A A;  1UEV A;  5HR9 A;  4R64 A;  3V7K A;  4J9O A;  3Q8L A;  1SKR A;  8ICC A;  1IM4 A;  9ICN A;  4KN4 A;  4MFC A;  7ICP A;  8ICO A;  4R8U A;  4IQT A;  3HJ4 A;  1SKS A;  1QSY A;  4M47 A;  8ICG A;  2P6U A;  2W9C B;  4DFM A;  2M2U A;  4RQ4 A;  4DL3 A;  1ZQL A;  5DG9 A;  8ICF A;  1XS9 D;  3RJK A;  4I2H A;  8ICK A;  4F4W A;  4KLL A;  4FH5 A;  3MR6 A;  1U47 A;  1NK4 A;  3JPP A;  1L3S A;  4DOC A;  4ECR A;  3L9D A;  4KN7 A;  4LZG A;  2JZB B;  5J2B A;  2JZB A;  3V7L A;  2BE3 A;  4PH5 A;  1ZQM A;  4DFP A;  4I2I A;  3M9N B;  3V6J A;  2IHM A;  7ICQ A;  5L1I A;  4C8L A;  1R8B A;  4X0B A;  2KZ3 A;  1ZQR A;  3Q8S B;  2NRZ A;  7ICO A;  1ZQD A;  3SZ2 A;  1MSW D;  1S10 A;  3EPI A;  9ICL A;  5DED A;  4B9U A;  3GDX A;  1S9F A;  4DQI A;  7ICE A;  3JZ0 A;  3PMN A;  1XSN A;  1NOM A;  4DFJ A;  2DR8 A;  4DEZ A;  3GV7 B;  1K1S A;  4RQ6 A;  2HHU A;  3WFO A;  4RQ0 A;  1ZQI A;  3RH4 A;  4I28 A;  4J9S A;  5DG8 A;  4AT8 A;  4AT7 B;  4K4H A;  3AQL A;  4B9S A;  5J0Q A;  4O5C A;  5HRH A;  3UXO A;  8ICV A;  2XGP A;  9ICB A;  4E8F A;  4QZE A;  2W8L A;  3K4G A;  2AU0 A;  5HRE A;  5KG6 A;  1S0M A;  4B9T A;  1R8C A;  1UET A;  2IA6 A;  1KEJ A;  1ZQZ A;  3MDC A;  3ISB A;  2ASD A;  3H4B A;  2J6U A;  2VA2 A;  4QWE A;  2HHV A;  5J0O A;  8ICS A;  4ATB B;  4ATB A;  4C8O A;  2ZJA A;  3Q8R B;  7ICR A;  5KT5 A;  4WBZ A;  2BHN A;  4YN4 A;  1JN3 A;  2KN7 A;  9ICK A;  2NRK A;  1S0O A;  2KP7 A;  2XCA A;  1NK7 A;  4Q8F A;  1FA0 A;  4M9G A;  1KSP A;  2RDJ A;  2I1Q A;  3MDA A;  3PW5 A;  3H4D A;  5KFG A;  5J2K A;  4GLX A;  3PX0 A;  4EYI B;  5J0R A;  3GV5 B;  3QZ7 A;  3RB0 A;  8ICP A;  3C2M A;  1BVS A;  4R65 A;  4HYK A;  4UB3 A;  5CR0 A;  3PW7 A;  1JXL A;  3K75 D;  1RZT A;  4I2D A;  4TUP A;  4X4V A;  2AGO A;  1QTM A;  5L1K A;  3UPS A;  4KTQ A;  4DL7 A;  2IMW P;  4RPZ A;  3E2E A;  4I2C A;  2XGQ A;  7ICM A;  3M9M B;  4QWA A;  4RT3 A;  1S0N A;  1D8Y A;  1K1Q A;  4QWD A;  3EZ5 A;  5DB9 A;  4O3R A;  1XWL A;  3PNC A;  5KG2 A;  2ZUC A;  3RH6 A;  1SL0 A;  1ZQU A;  2BCU A;  1SZP A;  4FHX A;  1ZQV A;  4KLE A;  1PX5 A;  3EPG A;  3MFH A;  3G6Y A;  2R8H A;  3B0X A;  4J9K A;  4DLG A;  4ED8 A;  8ICR A;  4F4K A;  3OV7 A;  2Y1J A;  1QLN A;  3RB4 A;  4PHA A;  3ISD A;  4IRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...