4M2YA

Structure of human dna polymerase beta complexed with 8-brg as the template base in a 1-nucleotide gapped dna
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
325
structure length
319
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 106
structure length 319
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m2yA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m2yA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m2yA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m2yA03
4F8RA 3E2EA 3NGDA 5KTQA 2W8LA 4DQQA 1TK0A 2NRZA 2P66A 5KFUA 4FHWA 1RYSA 4M9LA 4I2EA 4GXJA 2M9NA 5KFAA 3ORYA 4GXIA 3OGUA 4C8LA 3MR2A 4RNOA 2IA6A 1SKWA 4R63A 3EPIA 1S77D 2AGPA 4F4XA 3SV4A 1UT8A 1TKDA 1FA0A 9ICTA 2C2EA 5KG4A 5DB6A 3MGIA 4RPYA 3V7JA 3JZ0A 4IG8A 3AQNA 4DSLA 1RPLA 5CR0A 1BPZA 3RR8A 4F2RA 4FBTA 2HHWA 2UVVA 2ISPA 3PMNA 1X2IA 4QWBA 4O3PA 5DDYA 2XO7A 4F5RA 1N48A 2DRAA 4DOAA 4ECUA 3ZDCA 7ICIA 4KITB 1TAQA 5D49A 1TK8A 1NK9A 5HRBA 1PZNA 9ICRA 4JV2A 2DR9A 5F2VO 2BDPA 4GC7A 1ZYQA 5IIOA 4GC6A 3TARA 3V7KA 2ZTDA 2XCPA 4KLTA 3TFSA 2AJQA 9ICUA 4E80A 2AU0A 4RNNA 2NRWA 4O5KA 1KEJA 2OWOA 3RRHA 2XCAA 2FPMA 4I2AA 1ZQZA 4K4IA 5DG7A 1A77A 9ICSA 4QWAA 5L1KA 4KLGA 4QZDA 4I28A 4ECYA 2VA8A 2VA3A 4DSEA 3C66A 4TUSA 1NJWA 5IIIA 4B9VA 4B9TA 4P2HA 3H40A 1HJPA 1KRPA 5HRFA 4QWEA 3RBDA 4UQGA 5D4BA 1MIVA 2NRKA 2ZH1A 5HRGA 2ZH8A 4TQSA 1ZQBA 4R8UB 3OUYA 2ZH2A 5J0OA 1UETA 3FDSA 2PFOA 9ICMA 5HREA 3C23A 1ZQFA 1JAJA 3L9DA 4YD1A 5KFOA 4ED8A 3ZDAA 4WC2A 5DBCA 2HHSA 4ECXA 5J2EA 7ICPA 4EZ9A 4C8NA 4UB1A 1S76D 3UQ2A 8ICJA 3C18A 4YD2A 3HW8A 5KFNA 2MUTA 4EYHB 1R89A 3ZD9A 4F2SA 2ZH4A 1D8YA 3M9OB 2ZJAA 2F1HA 1JIHA 4UAYA 3WFPA 2V4QA 3UPSA 4XUSA 3H8WA 3AQLA 5KT5A 4M04A 4X4VA 2XGQA 5KFMA 4QZFA 3THVA 1T8EA 1NKBA 1TV9A 4C8KA 4RQ3A 2ASLA 9ICIA 2FPKA 5J0YA 4UD4A 4ATBB 4XQ7A 5KFDA 1BPYA 1RYRA 2R8IA 4I2JA 3BQ1A 4QZCA 1PX5A 4RQ0A 3PV8A 2O5AA 2O1PA 4KLDA 5D46A 4CCHA 7ICFA 4AT8A 4ELTA 9ICVA 2DRBA 5DGBA 2F1IA 2H5XA 4O3QA 4QW9A 1T7PA 2W9CA 2ZH7A 3MR3A 4RPZA 4YR0A 4J9RA 2ZH9A 3PVXA 2VA2A 5DG8A 5DEDA 2W8KA 3KHRA 5J0PA 4AT9B 5J2FA 3V7LA 2IHNA 4TUQA 3B0YA 4DOCA 8ICFA 3WFRE 2JZBB 4MEXA 1BNPA 4F3OA 5CJ7A 5KG7A 3IHQB 4PGXA 3H37A 5CP2A 4RUAA 1S10A 3M9MB 4ECTA 1NZPA 3MFHA 4ECQA 4IRKA 3RRGA 1YLQA 1LV5A 1SL0A 5IIKA 3ISDA 3RJJA 3EPGA 1BPXA 4B9LA 5L9XA 5DB9A 4DQRA 3H3AA 4YR3A 2C22A 1ZQXA 1ZQCA 4M6WA 1ZQNA 1SZPA 4I29A 1NOMA 5KFPA 4NKTA 1UEVA 4FO6A 5KFXA 2NRTA 3UXPA 1SL1A 3BQTA 1QSLA 4DFKA 3PW7A 4JWNA 1AROP 3C1YA 4J9PA 1U49A 3T5LA 2ZHAA 2HVHA 4BGDA 4QWDA 2BCUA 1L3SA 3FYHA 2VANA 5DLGA 5J0TA 7ICLA 4WC6A 2DR7A 4DSIA 4Q8FA 3T5HA 3T3FA 4M9NA 1ZQOA 1Q79A 4X4QA 4DSFA 2FMQA 4X4UA 2AQ0A 4M9GA 2BGWA 4QZ9A 5DQIA 1L5UA 5J0RA 1S0OA 4RQ2A 3EYZA 3HPOA 3BJYA 3LDAA 5J2IA 4GLXA 4EBCA 5BOLA 4Z6EA 1JMSA 4FS1A 3V6JA 2A1JB 1HUZA 3HX0A 4KLHA 4IQVA 1KFDA 1ZQEA 2BQRA 3JPTA 4J9SA 4B9SA 5HHHA 4I27A 4NLZA 8ICZA 3RB3A 4MF2A 1XWLA 3H39A 5DECA 4NLNA 3PO5A 3PW2A 1Y88A 3PX0A 4EZ6A 5L1JA 4O3SA 9ICXA 4AT8B 3MDCA 4M5DA 3RB4A 5CWRA 3WFOA 3C21A 1XS9D 9ICWA 3GILA 1U9LA 4C8MA 4UBCA 3JPNA 1S0NA 1X9MA 4JV0A 2BCSA 4ED6A 1D9FA 3RJKA 3PR4A 2RFFA 2AGOA 2W9BA 3RR7A 1XC9A 8ICQA 3SV3A 3C1ZA 4F5QA 1Z00B 1S0MA 1KDHA 4BXOB 8ICSA 5HRDA 4RWNA 1WOTA 2J6UA 5KFVA 2HVIA 4FH5A 3GIJA 4XQ8A 4RQ6A 2HW3A 1ZQGA 3MDAA 1OU5A 1TFYA 9ICKA 3Q8KA 1ZETA 5EWGA 4UAZA 3AUOA 1S97A 3RAXA 1V9PA 1TAUA 4UAWA 4QZGA 3HWTA 4DLGA 1NK5A 3PY8A 4I2CA 3GV5B 9ICLA 2BCVA 4KMUA 3JPQA 2JEJA 2R8GA 2IHMA 2PI5A 4UB5A 4BXOA 5HRHA 3AQMA 4NM2A 1B22A 1R8BA 2ZH6A 4DS5A 1SKRA 5IILA 4DO9A 1MQ3A 4FHPA 1UA0A 1ZQTA 4YN4A 2FLLA 4J9QA 7ICJA 4YXMA 8ICNA 4WC1A 2PFNA 3TANA 1NKEA 2DPIA 4KLEA 5KG2A 3EZ5A 7ICNA 1ZJMA 4MFFA 8ICAA 2J6SA 2AGQA 3B0XA 5J2GA 1U4BA 3OJUA 2RDJA 4BWMA 1ZQVA 4ED7A 2FPLA 4KLSA 4X4TA 2M2WA 4QW8A 4RWQA 4RQ4A 3OHAA 2KP7A 4IQTA 9ICFA 3ZDEA 5KT2A 3HT3A 3SZ2A 4MFCA 4AT7A 3OSPA 4QZAA 3OVBA 1BPBA 4I2DA 4M9JA 4BWJA 4EBJA 4KLUA 5KFTA 1N56A 9ICPA 2DR8A 3AU6A 1S0VA 1UT5A 4QZ8A 3KHGA 3LWLA 4Z6DA 4MF8A 3KHLA 5IIMA 7ICTA 3MBYA 4C8OA 4JV1A 3C2KA 3PW5A 4IR1A 1VJ7A 5HMLA 3Q8LA 4TURA 4PHAA 4DQIA 1UEUA 5J0WA 4YCXA 3OJSA 2R8HA 4Q43A 4F4ZA 2R8KA 3SYZA 4KLLA 2HHVA 9ICBA 9ICQA 4KLIA 3V72A 2M2VA 1D8LA 1K1SA 5KG3A 4G3IA 7ICQA 4XA5A 1DK2A 5KFCA 2PI4A 2MUTB 5HP4A 4JUZA 2BQUA 4E0DA 4PGQA 5J0XA 1NKCA 4FHVA 5KG6A 4WCWA 4DF4A 2UVRA 3HIYA 2BE3A 2HHPA 2JZBA 8ICTA 4P4MA 2DFLA 4IQWA 3TFRA 4NXZA 3EWAA 5EOZA 4DL5A 3C5FA 2I9GA 1RXVA 2FLNA 9ICGA 2BCRA 4LZDA 3ZDBA 2ASJA 4O3NA 4Q8EA 2AQ4A 1MQ2A 3M8RA 4F5OA 1ZQLA 4KTQA 1QLNA 4E7XA 2V4RA 4ECVA 1RXWA 4YMNA 4FH3A 2P6RA 5KFFA 2FLPA 3K4GA 4O0IA 3LWMA 4YMMA 2HHTA 5HRIA 4FHXA 3M8SA 3GQCA 3LQCB 4WC3A 4UB2A 2XY6A 3OV7A 5DDMA 4DOBA 8ICKA 3JYYA 7ICEA 4PGYA 4ZH4A 8ICGA 2PXIA 2HHXA 2MAXA 4RQ8A 4EEYA 5DQGA 1HUOA 2KTQA 4J9LA 4ELUA 4NLGA 2RDIA 4DFPA 1KTQA 2Y1IA 5JUMA 5KFBA 4KLMA 5HNKA 4DL4A 1ZQSA 3RH6A 4FS2A 5DG9A 3PW4A 2BPGA 8ICOA 1A76A 1IM4A 3PW0A 2KZMA 5HR9A 1F5AA 4RQ1A 1D9DA 3H38A 4NKUA 1X9WA 4F5PA 4ELVA 3BQ0A 2KFZA 1U47A 4DEZA 4M0AA 2I1QA 1Q78A 2BR0A 4O3RA 3NYBA 3N4MB 3GV8B 8ICCA 9ICJA 2ZUBA 3RJGA 4ED3A 4RPXA 2BKEA 4B9NA 2UVWA 1XSNA 3RJHA 4K4GA 8ICVA 3KTQA 3RBEA 4NM1A 1NJYA 5J2CA 3GIIA 4RQ5A 8ICUA 5DBBA 3HJ1A 2IBKA 4YR2A 4BDPA 2B21A 4KN4A 3PR5B 2HHUA 3MGHA 4R66A 4M2YA 3UXNA 9ICEA 1JXLA 3OUYB 2ZJ8A 3RB0A 4KLFA 4X4RA 1V4AA 2KZZA 2ZH3A 4EYIB 7ICSA 5DB7A 9ICCA 3JPOA 2P6UA 4ECZA 1H38A 5KFZA 4YXJA 4QZIA 4DL7A 5EWFA 4PH5A 3PNCA 4KLJA 5J2KA 1CEZA 1TK5A 4I2GA 5F9NA 1C7YA 2DPJA 2FMSA 8ICHA 4IQUA 2PFQA 4DSJA 4DWIA 3ISCA 4X4PA 3RH4A 2BCQA 1VFGA 1ZQAA 7ICMA 1JX4A 3PX4A 4RQ7A 4JWMA 1NK4A 8ICBA 1JXEA 5KFWA 3RJFA 2ZUDA 4DFMA 2ATLA 4O5CA 8ICWA 4WC7A 1NK6A 3K75D 1WCLA 2BPCA 1TFRA 4RNMA 4KN7A 4ED2A 1KFTA 1DOQA 2XY5A 4F5NA 1QTMA 4WBYA 2ALZA 4PHDA 7ICRA 3IM1A 3H7IA 4R65A 4O9MA 4DFJA 4TQRA 4DL3A 4AT9A 5DQHA 3C2LA 1ZQYA 5J2BA 1BPDA 1L3TA 1MC8A 4DQSA 4Q44A 3GV7B 1NJZA 5TZVA 5J0UA 1CUKA 4R8UA 4DLEA 4YQWA 4TUPA 2ID1A 1R8CA 1DGSA 4JK1A 5J2JA 5F9LA 3RJEA 4ED1A 3V6HA 4RT3A 3QEBZ 1COOA 3BDPA 4HYKA 2Y1JA 5HRKA 2ZUCA 5KFHA 2BQ3A 1NK7A 2ISOA 1QSSA 4IR9A 4LVSA 3RH5A 9ICHA 2J6TA 1NO5A 1SL2A 3BQ2A 5L1LA 4XRHA 4PHEA 2A1JA 4RWOA 1ZQHA 4I2IA 1TVAA 1ZQJA 8ICPA 5CHGA 1R8AA 3Q8SB 3GIMA 2IMWP 3TQ1A 3UPQA 4EBEA 2XY7A 4QZBA 4Z6CA 5J2AA 1NK8A 4EP7A 4X4NA 4X0AA 1XU4A 3QE9Y 1U48A 4F50A 2WTFA 1NK0A 4QWCA 3TAPA 4PPXA 5J29A 1ZQDA 1KNYA 3HJ4A 1XSLA 9ICOA 5KFYA 1ZQUA 4F4YA 2ASDA 2ZH5A 2DR5A 1EXNA 1LB2B 1IXRA 2W9MA 4LZGA 7ICKA 1S9FA 5CB1A 5KG0A 3LK9A 3G6VA 3Q8PB 3MABA 4YG2A 3PX6A 3TI0A 1MSWD 4RT2A 1KLNA 3H4DA 3H4BA 3C5GA 3PMLA 5J2HA 2NRVA 9ICNA 5CA7A 4RZRA 4F93B 3PO4A 1JN3A 4I2FA 4WBZA 5KFRA 3ZD8A 3Q8RB 2KFNA 3H8JA 4YFKA 4Q45A 4B9MA 8ICYA 1BGXT 5KFLA 1KFSA 2ZHBA 5HC9A 4DL2A 4B9UA 4Z6FA 5J0QA 8ICRA 5KT4A 4X0BA 5BPCA 2FMPA 1ZQRA 3QZ7A 4M6WB 4O3OA 3JPPA 3M9NB 5DKWA 2NRXA 4MFAA 3T5JA 7ICHA 1BNOA 4WC0A 4QZEA 4YMOA 4ECSA 5DLFA 1XSPA 3KHHA 8ICEA 4YP3A 3MFIA 3G6XA 1Z3EB 4WC4A 5DBAA 1Z00A 4F91B 2PBEA 4FHYA 3ETLA 4UBBA 4R64A 2Q66A 3G6YA 4ATBA 2R8JA 4J9MA 1ZQIA 3C2MA 3QZ8A 4ED0A 1UA1A 4KLQA 4RWPA 4J9NA 2XGPA 2ZTCA 3MR6A 1QSYA 3JPRA 3MR5A 3OVAA 3GFKB 4NLKA 5IIJA 5J2DA 5BOMA 2C2DA 5KT6A 1RZTA 1K1QA 2JEGA 1MIWA 4E8FA 5KT3A 5L1IA 3N97B 4ECWA 3GDXA 2V9WA 2DVIA 1BVSA 4ECRA 4F92B 2C28A 2F1JA 4YVZA 3JPSA 8ICXA 4K4HA 5KFQA 4UB3A 2W9AA 4MEYA 2JEFA 2M2UA 3SI8A 4EBDA 8ICIA 4DF8A 3OHBA 1ZQQA 4J9KA 1ZQWA 5J0SA 4FBUA 1BPEA 7ICUA 3WFQE 3OSNA 8ICMA 3H8SA 3NTUA 4NY8A 4PHPA 4RUCA 4P4PA 2W9BB 3ZDDA 1B43A 1ZQKA 2XC9A 4UB4A 4S3NA 4X4SA 5KFJA 4KLOA 3WFSC 5DB8A 2Q0ZX 4X5VA 3RTVA 7ICGA 2C2RA 5KFGA 5KFIA 4F4WA 3UQ0A 1L3UA 4EBKA 5HHIA 4LT6A 1T3NA 1WCNA 5IINA 3ISBA 5EWEA 3T5KA 5DGAA 1NJXA 1TFWA 4DL6A 9ICAA 4RU9A 3Q8QB 3GIKA 1XO1A 5KT7A 3AQKA 5KFKA 3RAQA 1SKSA 2JEIA 4QZHA 4J9OA 4P4OA 2ZTEA 1ZJNA 2W9CB 4M47A 7ICVA 3AU2A 4F4KA 4O5EA 4UD5A 4X4OA 3HP6A 2PFPA 3RJIA 3OVSA 1ZQPA 2BPFA 3RB6A 3TAQA 2ZJ5A 8ICLA 4WC5A 1JQRA 4IRCA 3Q8MA 2LYHA 4M9HA 4I2BA 2HHQA 2M2TA 4DQPA 1X9SA 3V6KA 1KSPA 5KG1A 4IRDA 2KN7A 2GWSA 1DK3A 1U45A 2BHNA 4DS4A 5KG5A 1L3VA 1T4GA 4AT7B 5HMMA 2KZ3A 3EW9A 4GXKA 4DSKA 4I2HA 7ICOA 1ZQMA 3QEAZ 5HRLA 3UXOA 1MIYA 5KFSA 5C5JA 2UVUA 5KFEA
chains in the Genus database with same CATH superfamily
3NGDA 1N62A 2RQ5A 2NRZA 5KFUA 1RYSA 3ORYA 4EX6A 4EENA 2YB1A 4R63A 5ALFA 1IV8A 4F4XA 5AKYA 2C2EA 3MGIA 4RPYA 1RPLA 5CR0A 4P0QB 3PMNA 3N7RC 4O3PA 2XO7A 5KAFU 4DOAA 2YB4A 2W54A 4NJ8A 2YN4A 2G5IB 5HRBA 1OUQA 9ICRA 2DR9A 5IIOA 4OCZA 3CYMA 2GAFD 2NRWA 1GPJA 1KEJA 5DG7A 1A77A 5AI0A 2ZIWA 5L1KA 4KLGA 2QLTA 1B4FA 4TUSA 4OJ6A 5HRFA 3KZIU 1ZOLA 4UQGA 4EELA 4TQSA 2QKQA 3FDSA 9ICMA 3L9DA 2HHSA 4EZ9A 4C8NA 4UB1A 3C18A 3QXGA 4EYHB 4F2SA 1JIHA 1KN5A 2KG5A 4BJQA 3UPSA 2WAQF 3SEIA 1NKBA 4ATBB 4XQ7A 2YTUA 1BPYA 2QB0A 2O5AA 3NVWA 4KLDA 4CCHA 7ICFA 1WUDA 4ELTA 2DRBA 3NUQA 2IOFK 5ALTA 2F1IA 1HIWA 1SIJA 4RPZA 3QUBA 5DEDA 2W8KA 1L7PA 4AT9B 4G9BA 1N5WA 3V7LA 2K8AA 1ZD3A 4LEYA 1NZPA 3RRGA 1YLQA 5IIKA 4B9LA 4DQRA 5AM5A 2GA9D 4YR3A 1ZQCA 2BBHA 3H3AA 4M6WA 1NOMA 4CNQA 2WFAA 3PW7A 1U49A 3C1YA 4J9PA 4F72A 4BGDA 1PK1A 3SQIA 4LJXA 4DSIA 1Q79A 5JRTA 4K9BA 2BGWA 3KOOA 3V6JA 4FS1A 2BQRA 4J9SA 3DEEA 3RB3A 4MF2A 5DECA 3AQEA 3PO5A 4O3SA 2ZIVA 4AT8B 2OEHA 3TACB 3RB4A 3C21A 2DGZA 1S0NA 1D9FA 2K8BB 4ED6A 2AGOA 3CW2C 8ICSA 4F5QA 1Z00B 2YY6A 3CK6A 2KJ5A 3MDAA 1OU5A 1TFYA 3NRWA 5EWGA 1S97A 3RAXA 5B3QA 2DBYA 4QZGA 3HWTA 3PY8A 5ALXA 5HRHA 1R8BA 2ZH6A 2AHOB 1FFVA 4K98A 4YN4A 2K60A 7ICJA 4YXMA 4KLEA 4LEWA 2FPLA 5E79U 4QW8A 2ZIXB 9ICFA 4MFCA 4QZAA 4F71A 1F44A 4EBJA 2JGAA 5KFTA 1N56A 2DR8A 5AIBA 1S0VA 3RFAA 1PVQA 4MF8A 4KMOB 1PK1B 4IR1A 5HMLA 3Q8LA 3AM9A 4LEVA 1UEUA 5J0WA 3OJSA 1BNPA 4KLLA 5EE1A 5KG3A 2LPEA 4XA5A 5KFCA 2PI4A 1PUZA 3TADC 4PGQA 3DDHA 1N60A 2HHPA 4P4MA 2DFLA 4IQWA 3HRDD 3TFRA 2YMLA 3EWAA 1Z1VA 1RXVA 2ASJA 5CFTA 4Q8EA 1F0MA 1QLNA 2JV3A 4ECVA 4CGZA 3BQ7A 4C80A 5HRIA 3K4GA 3KBBA 4YMMA 4FHXA 3M8SA 3GQCA 4WC3A 2GLEA 4DOBA 3JYYA 2OXOA 4Y2VA 7ICEA 4CRXA 1HUOA 5DQGA 2FCLA 4DFPA 2F2AB 5JUMA 4KLMA 3PW4A 8ICOA 2BPGA 5HR9A 4NKUA 1X9WA 1A0PA 4F5PA 4DEZA 2I1QA 3NYBA 2BR0A 3GV8B 3WKAA 8ICCA 3L4PA 3RJGA 5HR6A 4ED3A 5AKHA 2MA1A 2KK0A 1XSNA 8ICVA 1VDVA 1NJYA 8ICUA 4FZMA 3PR5B 2WB1C 4M2YA 9ICEA 2B4VA 2ZJ8A 4EYIB 3JPOA 4PH5A 1CEZA 2WB1F 8ICHA 5KFWA 1O03A 2WF8A 2ZUDA 3E0FA 3RJFA 1WCLA 5ALYA 4KN7A 1DOQA 4WBYA 4PHDA 7ICRA 4OJPA 4O9MA 2KHVA 4TQRA 4DL3A 4NL9C 4AT9A 1ZQYA 5ALKA 5TZVA 5J0UA 1JRPA 1DGSA 4JK1A 2KNJA 5AK5A 3QEBZ 1COOA 2F77X 2I5HA 3BDPA 5KFHA 2ISOA 3HJ1A 1QSSA 4CF5A 3RH5A 1DGJA 4Y2JA 1SL2A 3BQ2A 4XRHA 4RWOA 5GTHU 1ZQJA 1YZ7A 3Q8SB 3F5AA 4RQMA 4EBEA 2XY7A 1NK8A 4EP7A 2EDUA 4X4NA 2LM4A 3TAPA 4PPXA 3HJ4A 1RQLA 4HAIA 9ICOA 5KFYA 1QQ6A 1ZQUA 2ASDA 5CRXA 2ZH5A 2DR5A 5ALHA 1LB2B 2W9MA 4LZGA 1Z4OA 5KG0A 2HOIA 1QQ5A 3MABA 4K99A 3H4BA 3PMLA 5J2HA 5ALIA 3Q8RB 3H8JA 3WKBA 1BGXT 1KFSA 4DL2A 8ICRA 4Z6FA 2DUYA 5KT4A 3IG8A 2K89A 3M6KA 2FMPA 1ZQRA 2YX8A 2NRXA 4MFAA 4WC0A 4QZEA 4U6PA 4ECSA 2E3TA 3KHHA 3G6XA 1L8OA 1Z00A 4QJFB 2E8MA 4UBBA 2DF4B 4ED0A 4RWPA 2KV2A 2QB0B 5J8YA 4OAHA 3CP8A 4J9NA 2KIVA 1QSYA 1PK3A 2JEGA 5KT6A 1K1QA 1MIWA 5L1IA 3AL0B 8ICXA 4YVZA 4K4HA 4UB3A 4EBDA 2QB1A 1SV0C 3WFQE 8ICMA 3FC4A 4PHPA 2XC9A 5KFJA 2ES6A 4X5VA 3UQ0A 3IDWA 4EBKA 2OCEA 1NJXA 3ISBA 5EWEA 5DGAA 4O67A 3Q8QB 3GIKA 2KJ8A 2JEIA 2HOQA 2KKPA 4F4KA 3HP6A 2ZXIA 2ZIUA 2ZJ5A 4WC5A 3VCBA 4Y2RA 3BZCA 3VC8A 2M2TA 2W7OA 1X9SA 2JRZA 5KG1A 2WF7A 1X66A 2P35A 3AMZA 3MGVA 4I2HA 3UXOA 4J9KA 5C5JA 5KFEA 3UMBA 3SENA 5AM3A 4P0QA 4FHWA 4I2EA 2FDRA 5KFAA 4GXIA 2K4EA 2AGPA 1TKDA 1UT8A 9ICTA 3AQNA 2DKXA 4FBTA 1NZBA 2HHWA 2UVVA 1X2IA 4QWBA 1N48A 5DDYA 4F5RA 3D2NA 7ICIA 4FE3A 2K4IA 3WK9A 1B0XA 5D49A 1PZNA 4P0PB 5F2VO 2BDPA 4GC7A 4GC6A 3TARA 3V7KA 3R9KA 4KLTA 5AKZA 3TFSA 4E80A 4RNNA 2RRDA 2FPMA 3U26A 4QWAA 2HDOA 4BX9C 4DSEA 4B9VA 1HJPA 3RBDA 5AKEA 3OUYA 1UETA 2PFOA 5CFSA 2HMXA 1ZQFA 5KFOA 4BUGA 4WC2A 4ECXA 3UQ2A 8ICJA 1R89A 3ZD9A 1D8YA 3M9OB 3ER9B 1WWUA 4C4TA 4GFJA 3WFPA 2V4QA 4X4VA 5EE0A 4C7YA 1VLBA 5KFMA 3THVA 4C8KA 4RQ3A 5B3PA 4UAVA 1V97A 2R8IA 3BQ1A 1RYRA 4EEKA 5D46A 2HBMA 1SB3C 2ZH9A 4Y2XA 2VA2A 1UQVA 3KHRA 2LYAA 3I76A 2L5YA 3J81j 3AQFA 5B5EU 2JZBB 4MEXA 3QU5A 5L1MA 3OTQA 5KG7A 5CJ7A 3IHQB 3H37A 1S10A 3ETRA 4ECTA 3WK4A 2W11A 3ISDA 1BPXA 3JCFA 3IN5A 1P7DA 4I29A 1SZPA 4NKTA 2IUBA 4FO6A 5KFXA 1SL1A 4DFKA 4P0PA 2ZHAA 2HVHA 1SXDA 2BCUA 5J0TA 4IS7A 3F2BA 4X4QA 4DSFA 2Y9TA 5J8YC 3HILA 4M9GA 3QU4A 5DQIA 4RQ2A 4GLXA 2W3SA 3LDAA 1HUZA 1M6YA 1JMSA 4Z6EA 4UW9A 3HX0A 1KFDA 4NLZA 4I27A 3JPTA 3ERCC 5C0YA 2JHDA 4NLNA 2WHEA 2AXTU 5ALSA 1XS9D 4UBCA 4C8MA 4LT6A 2RHFA 3PR4A 2HSZA 8ICQA 2W9BA 2PMZF 4EEBA 2EAPA 3SV3A 1KDHA 5HRDA 4XQ8A 2HN1A 5AI4A 1ZETA 3AUOA 1TAUA 9ICLA 4DLGA 2BCVA 2R8GA 3AQMA 2IHMA 2PI5A 2D6FC 4NM2A 3E58A 4FHPA 3QNMA 2FE9A 5AKXA 3TANA 1NKEA 4WQKA 4JLXA 3B0XA 4X4TA 3OJUA 2RDJA 4ED7A 1ZQVA 2M2WA 3OHAA 1SV4A 3ZDEA 3BS5A 3SZ2A 3KD3A 3D6JA 4AT7A 3OSPA 3OVBA 4NL9A 4C4RA 4M9JA 4BWJA 3S6JA 4KLUA 9ICPA 2EZXA 3AU6A 1ZD4A 4K8VA 7ICTA 2KJ9A 5ALWA 5IIMA 5ALVA 4JV1A 1OXJA 3PW5A 4PHAA 5ALQA 1L7MA 4YCXA 2R8HA 1UEVA 2DL0A 3SYZA 2R8KA 2HHVA 5AKKA 4WC6A 4KLIA 1D8LA 1K1SA 1QCKA 4IL6U 4G3IA 1DK2A 2MUTB 5HP4A 4JUZA 1ZRMA 2BQUA 3DV9A 4FHVA 2HBJA 4WCWA 4C4SA 3HIYA 8ICTA 1N2XA 4NXZA 4DL5A 3C5FA 9ICGA 3ZDBA 4O3NA 1J2NA 2B6GA 2OH2A 4F5OA 4E7XA 2KOBA 4UATA 2V4RA 2F3NA 4YMNA 5KFFA 3K1RB 2FLPA 4O0IA 2HHTA 4K96A 3LQCB 3L3FX 5DDMA 8ICKA 1X42A 3NVYA 3A0HU 2KMDA 3QU7A 2HHXA 4RQ8A 3SD7A 2KTQA 4ELUA 4NLGA 1KTQA 4EV6A 2EZZA 2KZMA 1FO4A 2KFZA 3BQ0A 1U47A 4M0AA 1Q3UA 4UB6U 3GU3A 2KHQA 5ALEA 2ZUBA 4B9NA 3WK8A 5AICA 2HN2A 2EANA 5ALLA 3F5EA 1Z4NA 2EZYA 3MGHA 3UXNA 3RB0A 4C7ZA 3LVWA 4C0ZA 1YT3A 9ICCA 2W3RA 1ZD5A 4QZIA 1FIQA 3PNCA 4I2GA 2DPJA 2FMSA 3ISCA 4X4PA 4GIBA 1VFGA 1JI7A 3NRZA 7ICMA 3PX4A 8ICBA 1L7NA 1NK4A 5JU5A 1JUDA 2ATLA 4WC7A 1NK6A 4RNMA 4FFDA 1KFTA 2XY5A 2E8NA 2IOFA 4NWIA 1L3TA 4DQSA 1J2MA 1J97A 2Y9UA 1CUKA 2K4HA 4YQWA 4TUPA 2ID1A 1R8CA 2EWRA 5J2JA 5F9LA 3V6HA 4ED1A 2LHTA 4A8EA 4RT3A 4HYKA 5HRKA 2BQ3A 9ICHA 2J6TA 2HOFA 1N63A 5JTGA 4PHEA 2A1JA 1ZQHA 8ICPA 5CHGA 2A3VA 3GIMA 3TQ1A 3UPQA 2GOLA 3QE9Y 4DFDA 1ZQDA 3N7SC 4F4YA 3D2QA 1QQ7A 1IXRA 2XIDA 5CB1A 3G6VA 4RT2A 2NRVA 5CA7A 4YFKA 5J0QA 1ZQ1C 3QZ7A 5DKWA 7ICHA 3T5JA 3L5KA 3F53A 5DLFA 4Y2YA 4YP3A 3MFIA 4WC4A 2PBEA 3ETLA 3G6YA 4K97A 1ZQIA 2LBOA 2ZTCA 3MR6A 3JPRA 3MR5A 4NLKA 3RF9A 1RZTA 3K7DA 3D2SA 4E8FA 2C28A 5KFQA 2K8CB 2KVCA 5ALOA 2E5SA 3SAFA 3OHBA 1BPEA 7ICUA 3H0RB 2W9BB 1B43A 1ZQKA 2WF5A 2B56A 3WFSC 5DB8A 2Q0ZX 2C2RA 2HBKA 1T94A 1IG6A 1WCNA 1UPHA 2XVTA 4DL6A 3AQKA 3BZKA 3FAHA 5ALPA 5KT7A 1ECWA 3WKEA 2ZTEA 1ZJNA 2W9CB 4M47A 4UD5A 3AU2A 4DCCA 5D61A 1COKA 2BPFA 5AM0A 3WU2U 2LYHA 3PSTA 1XO0A 4LEZA 3V6KA 2RLTA 1NNLA 1U45A 1L3VA 5AM1A 4AT7B 5HMMA 3EW9A 4UASA 1X6JA 3QEAZ 5HRLA 1MIYA 1Z1BA 5GTIU 2W8LA 4WQLA 1N61A 1TK0A 4GXJA 4C8LA 2IA6A 1SKWA 5A0LA 3EPIA 1S77D 3QUCA 3SV4A 4IG8A 3CNHA 4DSLA 1BPZA 4F2RA 3QU2A 1Q8KA 2ISPA 3M7DA 4ECUA 5AK3A 1TAQA 4KX3A 4ACOA 2B0CA 3QUTA 1PVPA 2XCPA 3BS5B 2AU0A 2HBLA 3K1ZA 2DKZA 2OWOA 4K4IA 3RRHA 9ICSA 4O68A 3B9JA 2VA3A 3C66A 1ZXIA 5IIIA 5HR7A 4B9TA 4U7CA 4P2HA 2XI9A 1KRPA 4QWEA 5D4BA 2NRKA 2ZH1A 5HRGA 2FJ6A 1ZQBA 3BS7A 5J0OA 3C23A 3NWIA 4YD1A 5DBCA 7ICPA 1S76D 3HW8A 5KFNA 2MUTA 2F1HA 4UAYA 3AQLA 3H8WA 5KT5A 2XGQA 4QZFA 2ASLA 9ICIA 2E8OA 2KVSA 4RQ0A 4RQNA 2O1PA 5DGBA 2H5XA 3FM9A 1T7PA 2W9CA 5KAIU 3PVXA 5DG8A 2HI0A 1X40A 5J2FA 2IHNA 3B0YA 8ICFA 2Q4TA 4PGXA 5CP2A 4RUAA 2Z7JA 3EPGA 2C22A 1ZQXA 1ZQNA 5KFPA 2NRTA 3BQTA 1AROP 3T5LA 2VANA 4I0UA 7ICLA 2DR7A 2CRXA 3KKAC 4M9NA 2H3QA 1ZQOA 2PKEA 4X4UA 4QZ9A 3EYZA 3HPOA 3BJYA 2PFNA 4FH3A 5BOLA 2A1JB 4IQVA 4B9SA 5HHHA 3H39A 1RM6C 4O6AA 3PX0A 4EZ6A 4M5DA 5CWRA 3WFOA 3HKZF 1SV0A 1U9LA 2BCSA 2RFFA 4JV0A 2RP5A 1XC9A 3C1ZA 1WOTA 5ALMA 3GIJA 2KIWA 4RQ6A 2HW3A 9ICKA 1V9PA 5ALGA 1NK5A 4I2CA 3JPQA 4BXOA 3KZXA 4UB5A 3M6ZA 1OW5A 2R18A 3GZFA 4DS5A 2Y0SC 5IILA 5AKGA 1L8LA 1ZQTA 8ICNA 3T79A 4WC1A 1QH9A 5KG2A 3EZ5A 8ICAA 4MFFA 2J6SA 1URJA 2AGQA 5J2GA 1U4BA 4BWMA 4RWQA 2KP7A 4RQ4A 5KT2A 4QNLA 3NVOA 1AQ6A 3MC1A 3SAHA 1N5XA 5ALJA 1UT5A 3KHGA 3KHLA 4Z6DA 4C8OA 5CEHA 3C2KA 3LVVA 1V38A 4DQIA 4JLZA 2M2VA 9ICBA 1L6NA 3V72A 2KSOA 1WWVA 4MHVA 4E0DA 2Y0SF 5J0XA 1NKCA 4DF4A 2QARA 2M0NA 4UARA 2H3IA 2BE3A 2NYVA 2I9GA 2FLNA 4LZDA 5AKJA 3ICXA 3M8RA 1ZQLA 4KTQA 1RXWA 1UHUA 2ESEA 2KD1A 3QX7A 4PGYA 4ZH4A 4QIWF 4J9LA 2RDIA 3O0FA 3ED5A 4JMUA 5HNKA 4DL4A 3RH6A 1ZQSA 5D62A 4AT8A 5DG9A 1F5AA 1X6IA 4RQ1A 1D9DA 3WKDA 4ELVA 2H3FA 3H8MA 3N4MB 1Q46A 9ICJA 5AHXA 1PVRA 2MSNA 4PJ0U 2BKEA 2UVWA 1S8OA 2EQYA 3KTQA 1WYGA 2F76X 2W43A 3RBEA 4NM1A 5ALDA 1KBUA 5AIAA 1FEZA 2B21A 2BDUA 2D3DA 2VJ5A 3EUB2 4KN4A 4R66A 3OUYB 2VIXA 4KLFA 4X4RA 1V4AA 2KZZA 7ICSA 4ECZA 2P6UA 1H38A 4YXJA 4DL7A 5EWFA 4US9A 2LI6A 4KLJA 5J2KA 1TK5A 4NLBA 5F9NA 1C7YA 1T3QA 2JXJA 4IQUA 5TISU 2PFQA 4CF4A 2BCQA 1JX4A 4RQ7A 4JWMA 4PZOA 3C29A 4DFMA 8ICWA 2BPCA 4F5NA 3IM1A 3SAGA 4DFJA 4US8A 5DQHA 3C2LA 1MC8A 3GV7B 4DLEA 2G08A 1SXEA 2ZUCA 4LVSA 5L1LA 4Y2PA 1R8AA 2IMWP 4QZBA 5J2AA 2MU2A 1XU4A 4X0AA 2BBJA 2MRLA 2QARB 2WTFA 4QWCA 5ALUA 5J29A 1XSLA 5CFUA 2ZIUB 1EXNA 1YZ6A 3ALRA 3TI0A 4XJEA 3PX6A 4OAFA 3C5GA 2O6KA 2YMMA 9ICNA 2ODGA 2JR5A 1JN3A 5G5HA 4I2FA 4WBZA 4B9MA 5KFLA 4B9UA 5BPCA 2NV3A 5T14A 4M6WB 4O3OA 3NVVA 3MCRA 3IG5A 1Z3EB 4F91B 1DRGA 2Q66A 5AI9A 4NLCA 4ATBA 2W04A 2R8JA 2G07A 3WK5A 3QZ8A 1UA1A 3NASA 3WKCA 1SGGA 3GFKB 5BOMA 2C2DA 3H0MB 5KT3A 3N97B 2I6XA 5AM2A 4ICAA 3GDXA 2DVIA 1BVSA 1LVHA 2F1JA 3JPSA 2W9AA 1CRXA 5KL8B 4CF3A 2JMGA 4N7RA 5ALZA 3PSIA 3H8SA 4NY8A 3ZDDA 2ZIVB 4UB4A 4X4SA 2EAOA 1KW4A 4KLOA 4O69A 3RTVA 7ICGA 5KFGA 4USAA 4OJ5A 4FZNA 1L3UA 2VJ4A 1TFWA 3T5KA 5EE9A 5KFKA 3RAQA 4P4OA 2YMPA 3WK6A 4X4OA 1C20A 2PFPA 3RJIA 3OPXA 3RB6A 8ICLA 1LKYB 4IRCA 1JQRA 4NXUA 4UB8U 4J03A 4M9HA 2F8KA 2XICA 4IRDA 5K4LA 2KN7A 2GWSA 2GH1A 4Y2TA 4DS4A 5KG5A 1T4GA 2KZ3A 4KX5A 3AEVA 1ZQMA 1DXSA 5KFSA 2UVUA 4F8RA 3E2EA 5KTQA 4DQQA 4NXTA 2P66A 4M9LA 1ED1A 2M9NA 3OGUA 3MR2A 4RNOA 4KB6A 3I28A 4ZOHC 4EX7A 1FA0A 5KG4A 5DB6A 1FFUA 3V7JA 3JZ0A 3RR8A 3HJEA 3SR6A 1SZHA 2DRAA 3ZDCA 4KITB 4WH5A 2E1FA 1TK8A 1NK9A 4JV2A 3PHZA 1SWVA 1ZYQA 9ICUA 2ZTDA 2AJQA 2ZG6A 4O5KA 4I2AA 2XCAA 3M1YA 1ZQZA 2GO7A 2E8PA 4QZDA 4I28A 4ECYA 2VA8A 1NI3A 1NJWA 3H40A 2G5HB 4PL2A 1MIVA 2ZH8A 2ZXHA 4R8UB 2ZH2A 5HREA 1RDFA 3EF2A 3AN1A 4UAUA 1JAJA 4ED8A 3ZDAA 5AI8A 5J2EA 4EGWA 4YD2A 2ZH4A 1JROA 2ZJAA 4AP9A 3NKUA 4XUSA 4M04A 1X9XA 2G0AA 2YMQA 1WG8A 1T8EA 2KICA 2WF6A 1TV9A 1GO3F 2VKQA 2FPKA 5J0YA 4UD4A 5KFDA 1PX5A 1TE2A 3NS1A 4I2JA 4QZCA 3PV8A 1Z19A 9ICVA 2K4PA 4O3QA 4QW9A 2LMRA 2ZH7A 3MR3A 4YR0A 4J9RA 5J0PA 4TUQA 4DOCA 3WFRE 1MN8A 4F3OA 4FO1A 3M9MB 3MFHA 2F8LA 5AKIA 4IRKA 4HX0A 1LV5A 1SL0A 3RJJA 5L9XA 2DWQA 5DB9A 3IV6A 3UXPA 1QSLA 2W55A 4OJOA 4JWNA 4EEDA 5ALNA 4QWDA 3ONNA 1L3SA 2DQNB 3FYHA 2LKYA 5EE3A 5DLGA 4Q8FA 3T5HA 3T3FA 2FMQA 2AQ0A 3TKAA 1L5UA 5J0RA 1S0OA 5J2IA 4EBCA 4KLHA 1ZQEA 8ICZA 2WAQC 1UCVA 1XWLA 3PW2A 1Y88A 5L1JA 9ICXA 3NVZA 3MDCA 3OWGA 9ICWA 3GILA 3JPNA 3RJKA 1X9MA 3PSPA 3RR7A 1S0MA 2W03A 1O08A 1D8BA 4RWNA 5KNIA 4BXOB 2NO5A 2J6UA 5KFVA 2HVIA 4FH5A 3PSFA 1ZQGA 4Y2SA 3Q8KA 4UAZA 4UAWA 3GV5B 4KMUA 2JEJA 4WJ3B 1F5SA 1B22A 4CDGA 4K9AA 1A6SA 1SKRA 2LYBA 5H2FU 4DO9A 1MQ3A 2B51A 2F44A 1UA0A 3ZI4A 2FLLA 4J9QA 2DPIA 7ICNA 1ZJMA 4MKPA 4KLSA 2FI1A 5B66U 4IQTA 4AYBF 3HT3A 1KKXA 1VJ5A 1BPBA 4I2DA 2KEYA 2ZIWB 2AH5A 4IC9A 4QZ8A 3LWLA 3UMCA 2IHOA 3MBYA 1VJ7A 3ER8C 2NO4A 2A19A 4TURA 2D8CA 4F4ZA 4Q43A 4QIWC 3H38A 9ICQA 5AI6A 5F3XB 7ICQA 3TADA 3F2CA 2H3ZA 2YQEA 5KG6A 2UVRA 4OD0A 2OYYA 2JZBA 4NXVA 5EOZA 2BCRA 5CHEA 2AQ4A 1MQ2A 5AK4A 2KKVA 3UMGA 2A1AA 2CXYA 2P6RA 3LWMA 2PMZC 4UB2A 2XY6A 4FZLA 3OV7A 4Y2UA 1LKYA 1RYUA 3HKZC 8ICGA 2PXIA 2MAXA 4EEYA 2Y1IA 5KFBA 4WOYA 3CRXA 4FS2A 1IM4A 1A76A 3PW0A 1MA7A 1Q3VA 1Q78A 4O3RA 1ZRNA 2BZFA 4RPXA 4KM5A 4B6JA 3PZPA 3IP4B 3RJHA 4K4GA 5G5GA 5J2CA 3GIIA 4RQ5A 4O3MA 5DBBA 2IBKA 4YR2A 4NV0A 4BDPA 2HHUA 1JXLA 2ZH3A 2JH7A 5DB7A 5KFZA 1CI4A 3I1YA 4OAIZ 1KL9A 4NXXA 4DSJA 4DWIA 4OAGA 3RH4A 1ZQAA 2OM6A 1JXEA 4O5CA 3K75D 1TFRA 4ED2A 1QTMA 2ALZA 2EAMA 3A0BU 3H7IA 4R65A 2KE7A 5J2BA 1BPDA 1XNSA 1KQQA 5D63A 4Q44A 1NJZA 4R8UA 5AKLA 1JALA 2H3VA 3RJEA 2Y1JA 1NK7A 4IR9A 1NO5A 5FP0A 4NXWA 4I2IA 1TVAA 2G06A 4Z6CA 3LYSA 3QU9A 4PZNA 1U48A 4F50A 4JB3A 1NK0A 2N1RA 3WK7A 1KNYA 4OO1J 1V85A 7ICKA 5AM4A 1S9FA 3LK9A 4PL1A 3Q8PB 4YG2A 1MSWD 1KLNA 3H4DA 4RZRA 3N7PD 4F93B 3PO4A 5KFRA 3ZD8A 2KFNA 2WF9A 1S5LU 8ICYA 4Q45A 3KFUF 1TAMA 2ZHBA 5HC9A 4X0BA 5JTIA 1IIPA 3JPPA 1RG6A 3M9NB 1BNOA 4YMOA 1ZD2P 1XSPA 8ICEA 3N28A 5DBAA 4FHYA 3UM9A 4R64A 2HCFA 4J9MA 3C2MA 4KLQA 2W7PA 3QUQA 2XGPA 3SMVA 2EH9A 3KKAA 3OVAA 1SWWA 5IIJA 5J2DA 1K5OA 4CE6A 4ECWA 2V9WA 4ECRA 4F92B 2JEFA 4MEYA 2M2UA 3SI8A 3IRUA 5KL1B 8ICIA 4DF8A 2E1EA 1ZQQA 1ZQWA 5J0SA 4FBUA 3QYPA 4OJLA 2CN1A 3OSNA 4AYBC 3NTUA 4RUCA 4P4PA 2OHFA 4S3NA 5ALRA 5AK6A 2G09A 3H0LB 5KFIA 4F4WA 2JH1A 5HHIA 1HEKA 2ZIXA 1T3NA 5IINA 9ICAA 4RU9A 1XO1A 1RQNA 1SKSA 4QZHA 4J9OA 7ICVA 3F2DA 4O5EA 3OVSA 1ZQPA 3TAQA 5AI5A 3Q8MA 2LM1A 4I2BA 2HHQA 4DQPA 4Y2QA 1KSPA 2IOHA 1DK3A 2BHNA 2KSOB 3C28A 4DSKA 4GXKA 7ICOA 2CPRA 1L7OA 4ECQA
chains in the Genus database with same CATH topology
4F8RA 3E2EA 3NGDA 5KTQA 2W8LA 4DQQA 1TK0A 2NRZA 2P66A 5KFUA 4FHWA 1RYSA 4M9LA 4I2EA 4GXJA 2M9NA 5KFAA 3ORYA 4GXIA 3OGUA 4C8LA 3MR2A 4RNOA 2IA6A 1SKWA 4R63A 3EPIA 1S77D 2AGPA 4F4XA 3SV4A 1UT8A 1TKDA 1FA0A 9ICTA 2C2EA 5KG4A 5DB6A 3MGIA 4RPYA 3V7JA 3JZ0A 4IG8A 3AQNA 4DSLA 1RPLA 5CR0A 1BPZA 3RR8A 4F2RA 4FBTA 2HHWA 2UVVA 2ISPA 3PMNA 1X2IA 4QWBA 4O3PA 5DDYA 2XO7A 4F5RA 1N48A 2DRAA 4DOAA 4ECUA 3ZDCA 7ICIA 4KITB 1TAQA 5D49A 1TK8A 1NK9A 5HRBA 1PZNA 9ICRA 4JV2A 2DR9A 5F2VO 2BDPA 4GC7A 1ZYQA 5IIOA 4GC6A 3TARA 3V7KA 2ZTDA 2XCPA 4KLTA 3TFSA 2AJQA 9ICUA 4E80A 2AU0A 4RNNA 2NRWA 4O5KA 1KEJA 2OWOA 3RRHA 2XCAA 2FPMA 4I2AA 1ZQZA 4K4IA 5DG7A 1A77A 9ICSA 4QWAA 5L1KA 4KLGA 4QZDA 4I28A 4ECYA 2VA8A 2VA3A 4DSEA 3C66A 4TUSA 1NJWA 5IIIA 4B9VA 4B9TA 4P2HA 3H40A 1HJPA 1KRPA 5HRFA 4QWEA 3RBDA 4UQGA 5D4BA 1MIVA 2NRKA 2ZH1A 5HRGA 2ZH8A 4TQSA 1ZQBA 4R8UB 3OUYA 2ZH2A 5J0OA 1UETA 3FDSA 2PFOA 9ICMA 5HREA 3C23A 1ZQFA 1JAJA 3L9DA 4YD1A 5KFOA 4ED8A 3ZDAA 4WC2A 5DBCA 2HHSA 4ECXA 5J2EA 7ICPA 4EZ9A 4C8NA 4UB1A 1S76D 3UQ2A 8ICJA 3C18A 4YD2A 3HW8A 5KFNA 2MUTA 4EYHB 1R89A 3ZD9A 4F2SA 2ZH4A 1D8YA 3M9OB 2ZJAA 2F1HA 1JIHA 4UAYA 3WFPA 2V4QA 3UPSA 4XUSA 3H8WA 3AQLA 5KT5A 4M04A 4X4VA 2XGQA 5KFMA 4QZFA 3THVA 1T8EA 1NKBA 1TV9A 4C8KA 4RQ3A 2ASLA 9ICIA 2FPKA 5J0YA 4UD4A 4ATBB 4XQ7A 5KFDA 1BPYA 1RYRA 2R8IA 4I2JA 3BQ1A 4QZCA 1PX5A 4RQ0A 3PV8A 2O5AA 2O1PA 4KLDA 5D46A 4CCHA 7ICFA 4AT8A 4ELTA 9ICVA 2DRBA 5DGBA 2F1IA 2H5XA 4O3QA 4QW9A 1T7PA 2W9CA 2ZH7A 3MR3A 4RPZA 4YR0A 4J9RA 2ZH9A 3PVXA 2VA2A 5DG8A 5DEDA 2W8KA 3KHRA 5J0PA 4AT9B 5J2FA 3V7LA 2IHNA 4TUQA 3B0YA 4DOCA 8ICFA 3WFRE 2JZBB 4MEXA 1BNPA 4F3OA 5CJ7A 5KG7A 3IHQB 4PGXA 3H37A 5CP2A 4RUAA 1S10A 3M9MB 4ECTA 1NZPA 3MFHA 4ECQA 4IRKA 3RRGA 1YLQA 1LV5A 1SL0A 5IIKA 3ISDA 3RJJA 3EPGA 1BPXA 4B9LA 5L9XA 5DB9A 4DQRA 3H3AA 4YR3A 2C22A 1ZQXA 1ZQCA 4M6WA 1ZQNA 1SZPA 4I29A 1NOMA 5KFPA 4NKTA 1UEVA 4FO6A 5KFXA 2NRTA 3UXPA 1SL1A 3BQTA 1QSLA 4DFKA 3PW7A 4JWNA 1AROP 3C1YA 4J9PA 1U49A 3T5LA 2ZHAA 2HVHA 4BGDA 4QWDA 2BCUA 1L3SA 3FYHA 2VANA 5DLGA 5J0TA 7ICLA 4WC6A 2DR7A 4DSIA 4Q8FA 3T5HA 3T3FA 4M9NA 1ZQOA 1Q79A 4X4QA 4DSFA 2FMQA 4X4UA 2AQ0A 4M9GA 2BGWA 4QZ9A 5DQIA 1L5UA 5J0RA 1S0OA 4RQ2A 3EYZA 3HPOA 3BJYA 3LDAA 5J2IA 4GLXA 4EBCA 5BOLA 4Z6EA 1JMSA 4FS1A 3V6JA 2A1JB 1HUZA 3HX0A 4KLHA 4IQVA 1KFDA 1ZQEA 2BQRA 3JPTA 4J9SA 4B9SA 5HHHA 4I27A 4NLZA 8ICZA 3RB3A 4MF2A 1XWLA 3H39A 5DECA 4NLNA 3PO5A 3PW2A 1Y88A 3PX0A 4EZ6A 5L1JA 4O3SA 9ICXA 4AT8B 3MDCA 4M5DA 3RB4A 5CWRA 3WFOA 3C21A 1XS9D 9ICWA 3GILA 1U9LA 4C8MA 4UBCA 3JPNA 1S0NA 1X9MA 4JV0A 2BCSA 4ED6A 1D9FA 3RJKA 3PR4A 2RFFA 2AGOA 2W9BA 3RR7A 1XC9A 8ICQA 3SV3A 3C1ZA 4F5QA 1Z00B 1S0MA 1KDHA 4BXOB 8ICSA 5HRDA 4RWNA 1WOTA 2J6UA 5KFVA 2HVIA 4FH5A 3GIJA 4XQ8A 4RQ6A 2HW3A 1ZQGA 3MDAA 1OU5A 1TFYA 9ICKA 3Q8KA 1ZETA 5EWGA 4UAZA 3AUOA 1S97A 3RAXA 1V9PA 1TAUA 4UAWA 4QZGA 3HWTA 4DLGA 1NK5A 3PY8A 4I2CA 3GV5B 9ICLA 2BCVA 4KMUA 3JPQA 2JEJA 2R8GA 2IHMA 2PI5A 4UB5A 4BXOA 5HRHA 3AQMA 4NM2A 1B22A 1R8BA 2ZH6A 4DS5A 1SKRA 5IILA 4DO9A 1MQ3A 4FHPA 1UA0A 1ZQTA 4YN4A 2FLLA 4J9QA 7ICJA 4YXMA 8ICNA 4WC1A 2PFNA 3TANA 1NKEA 2DPIA 4KLEA 5KG2A 3EZ5A 7ICNA 1ZJMA 4MFFA 8ICAA 2J6SA 2AGQA 3B0XA 5J2GA 1U4BA 3OJUA 2RDJA 4BWMA 1ZQVA 4ED7A 2FPLA 4KLSA 4X4TA 2M2WA 4QW8A 4RWQA 4RQ4A 3OHAA 2KP7A 4IQTA 9ICFA 3ZDEA 5KT2A 3HT3A 3SZ2A 4MFCA 4AT7A 3OSPA 4QZAA 3OVBA 1BPBA 4I2DA 4M9JA 4BWJA 4EBJA 4KLUA 5KFTA 1N56A 9ICPA 2DR8A 3AU6A 1S0VA 1UT5A 4QZ8A 3KHGA 3LWLA 4Z6DA 4MF8A 3KHLA 5IIMA 7ICTA 3MBYA 4C8OA 4JV1A 3C2KA 3PW5A 4IR1A 1VJ7A 5HMLA 3Q8LA 4TURA 4PHAA 4DQIA 1UEUA 5J0WA 4YCXA 3OJSA 2R8HA 4Q43A 4F4ZA 2R8KA 3SYZA 4KLLA 2HHVA 9ICBA 9ICQA 4KLIA 3V72A 2M2VA 1D8LA 1K1SA 5KG3A 4G3IA 7ICQA 4XA5A 1DK2A 5KFCA 2PI4A 2MUTB 5HP4A 4JUZA 2BQUA 4E0DA 4PGQA 5J0XA 1NKCA 4FHVA 5KG6A 4WCWA 4DF4A 2UVRA 3HIYA 2BE3A 2HHPA 2JZBA 8ICTA 4P4MA 2DFLA 4IQWA 3TFRA 4NXZA 3EWAA 5EOZA 4DL5A 3C5FA 2I9GA 1RXVA 2FLNA 9ICGA 2BCRA 4LZDA 3ZDBA 2ASJA 4O3NA 4Q8EA 2AQ4A 1MQ2A 3M8RA 4F5OA 1ZQLA 4KTQA 1QLNA 4E7XA 2V4RA 4ECVA 1RXWA 4YMNA 4FH3A 2P6RA 5KFFA 2FLPA 3K4GA 4O0IA 3LWMA 4YMMA 2HHTA 5HRIA 4FHXA 3M8SA 3GQCA 3LQCB 4WC3A 4UB2A 2XY6A 3OV7A 5DDMA 4DOBA 8ICKA 3JYYA 7ICEA 4PGYA 4ZH4A 8ICGA 2PXIA 2HHXA 2MAXA 4RQ8A 4EEYA 5DQGA 1HUOA 2KTQA 4J9LA 4ELUA 4NLGA 2RDIA 4DFPA 1KTQA 2Y1IA 5JUMA 5KFBA 4KLMA 5HNKA 4DL4A 1ZQSA 3RH6A 4FS2A 5DG9A 3PW4A 2BPGA 8ICOA 1A76A 1IM4A 3PW0A 2KZMA 5HR9A 1F5AA 4RQ1A 1D9DA 3H38A 4NKUA 1X9WA 4F5PA 4ELVA 3BQ0A 2KFZA 1U47A 4DEZA 4M0AA 2I1QA 1Q78A 2BR0A 4O3RA 3NYBA 3N4MB 3GV8B 8ICCA 9ICJA 2ZUBA 3RJGA 4ED3A 4RPXA 2BKEA 4B9NA 2UVWA 1XSNA 3RJHA 4K4GA 8ICVA 3KTQA 3RBEA 4NM1A 1NJYA 5J2CA 3GIIA 4RQ5A 8ICUA 5DBBA 3HJ1A 2IBKA 4YR2A 4BDPA 2B21A 4KN4A 3PR5B 2HHUA 3MGHA 4R66A 4M2YA 3UXNA 9ICEA 1JXLA 3OUYB 2ZJ8A 3RB0A 4KLFA 4X4RA 1V4AA 2KZZA 2ZH3A 4EYIB 7ICSA 5DB7A 9ICCA 3JPOA 2P6UA 4ECZA 1H38A 5KFZA 4YXJA 4QZIA 4DL7A 5EWFA 4PH5A 3PNCA 4KLJA 5J2KA 1CEZA 1TK5A 4I2GA 5F9NA 1C7YA 2DPJA 2FMSA 8ICHA 4IQUA 2PFQA 4DSJA 4DWIA 3ISCA 4X4PA 3RH4A 2BCQA 1VFGA 1ZQAA 7ICMA 1JX4A 3PX4A 4RQ7A 4JWMA 1NK4A 8ICBA 1JXEA 5KFWA 3RJFA 2ZUDA 4DFMA 2ATLA 4O5CA 8ICWA 4WC7A 1NK6A 3K75D 1WCLA 2BPCA 1TFRA 4RNMA 4KN7A 4ED2A 1KFTA 1DOQA 2XY5A 4F5NA 1QTMA 4WBYA 2ALZA 4PHDA 7ICRA 3IM1A 3H7IA 4R65A 4O9MA 4DFJA 4TQRA 4DL3A 4AT9A 5DQHA 3C2LA 1ZQYA 5J2BA 1BPDA 1L3TA 1MC8A 4DQSA 4Q44A 3GV7B 1NJZA 5TZVA 5J0UA 1CUKA 4R8UA 4DLEA 4YQWA 4TUPA 2ID1A 1R8CA 1DGSA 4JK1A 5J2JA 5F9LA 3RJEA 4ED1A 3V6HA 4RT3A 3QEBZ 1COOA 3BDPA 4HYKA 2Y1JA 5HRKA 2ZUCA 5KFHA 2BQ3A 1NK7A 2ISOA 1QSSA 4IR9A 4LVSA 3RH5A 9ICHA 2J6TA 1NO5A 1SL2A 3BQ2A 5L1LA 4XRHA 4PHEA 2A1JA 4RWOA 1ZQHA 4I2IA 1TVAA 1ZQJA 8ICPA 5CHGA 1R8AA 3Q8SB 3GIMA 2IMWP 3TQ1A 3UPQA 4EBEA 2XY7A 4QZBA 4Z6CA 5J2AA 1NK8A 4EP7A 4X4NA 4X0AA 1XU4A 3QE9Y 1U48A 4F50A 2WTFA 1NK0A 4QWCA 3TAPA 4PPXA 5J29A 1ZQDA 1KNYA 3HJ4A 1XSLA 9ICOA 5KFYA 1ZQUA 4F4YA 2ASDA 2ZH5A 2DR5A 1EXNA 1LB2B 1IXRA 2W9MA 4LZGA 7ICKA 1S9FA 5CB1A 5KG0A 3LK9A 3G6VA 3Q8PB 3MABA 4YG2A 3PX6A 3TI0A 1MSWD 4RT2A 1KLNA 3H4DA 3H4BA 3C5GA 3PMLA 5J2HA 2NRVA 9ICNA 5CA7A 4RZRA 4F93B 3PO4A 1JN3A 4I2FA 4WBZA 5KFRA 3ZD8A 3Q8RB 2KFNA 3H8JA 4YFKA 4Q45A 4B9MA 8ICYA 1BGXT 5KFLA 1KFSA 2ZHBA 5HC9A 4DL2A 4B9UA 4Z6FA 5J0QA 8ICRA 5KT4A 4X0BA 5BPCA 2FMPA 1ZQRA 3QZ7A 4M6WB 4O3OA 3JPPA 3M9NB 5DKWA 2NRXA 4MFAA 3T5JA 7ICHA 1BNOA 4WC0A 4QZEA 4YMOA 4ECSA 5DLFA 1XSPA 3KHHA 8ICEA 4YP3A 3MFIA 3G6XA 1Z3EB 4WC4A 5DBAA 1Z00A 4F91B 2PBEA 4FHYA 3ETLA 4UBBA 4R64A 2Q66A 3G6YA 4ATBA 2R8JA 4J9MA 1ZQIA 3C2MA 3QZ8A 4ED0A 1UA1A 4KLQA 4RWPA 4J9NA 2XGPA 2ZTCA 3MR6A 1QSYA 3JPRA 3MR5A 3OVAA 3GFKB 4NLKA 5IIJA 5J2DA 5BOMA 2C2DA 5KT6A 1RZTA 1K1QA 2JEGA 1MIWA 4E8FA 5KT3A 5L1IA 3N97B 4ECWA 3GDXA 2V9WA 2DVIA 1BVSA 4ECRA 4F92B 2C28A 2F1JA 4YVZA 3JPSA 8ICXA 4K4HA 5KFQA 4UB3A 2W9AA 4MEYA 2JEFA 2M2UA 3SI8A 4EBDA 8ICIA 4DF8A 3OHBA 1ZQQA 4J9KA 1ZQWA 5J0SA 4FBUA 1BPEA 7ICUA 3WFQE 3OSNA 8ICMA 3H8SA 3NTUA 4NY8A 4PHPA 4RUCA 4P4PA 2W9BB 3ZDDA 1B43A 1ZQKA 2XC9A 4UB4A 4S3NA 4X4SA 5KFJA 4KLOA 3WFSC 5DB8A 2Q0ZX 4X5VA 3RTVA 7ICGA 2C2RA 5KFGA 5KFIA 4F4WA 3UQ0A 1L3UA 4EBKA 5HHIA 4LT6A 1T3NA 1WCNA 5IINA 3ISBA 5EWEA 3T5KA 5DGAA 1NJXA 1TFWA 4DL6A 9ICAA 4RU9A 3Q8QB 3GIKA 1XO1A 5KT7A 3AQKA 5KFKA 3RAQA 1SKSA 2JEIA 4QZHA 4J9OA 4P4OA 2ZTEA 1ZJNA 2W9CB 4M47A 7ICVA 3AU2A 4F4KA 4O5EA 4UD5A 4X4OA 3HP6A 2PFPA 3RJIA 3OVSA 1ZQPA 2BPFA 3RB6A 3TAQA 2ZJ5A 8ICLA 4WC5A 1JQRA 4IRCA 3Q8MA 2LYHA 4M9HA 4I2BA 2HHQA 2M2TA 4DQPA 1X9SA 3V6KA 1KSPA 5KG1A 4IRDA 2KN7A 2GWSA 1DK3A 1U45A 2BHNA 4DS4A 5KG5A 1L3VA 1T4GA 4AT7B 5HMMA 2KZ3A 3EW9A 4GXKA 4DSKA 4I2HA 7ICOA 1ZQMA 3QEAZ 5HRLA 3UXOA 1MIYA 5KFSA 5C5JA 2UVUA 5KFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8R A;  3E2E A;  3NGD A;  5KTQ A;  2W8L A;  4DQQ A;  1TK0 A;  2NRZ A;  2P66 A;  5KFU A;  4FHW A;  1RYS A;  4M9L A;  4I2E A;  4GXJ A;  2M9N A;  5KFA A;  3ORY A;  4GXI A;  3OGU A;  4C8L A;  3MR2 A;  4RNO A;  2IA6 A;  1SKW A;  4R63 A;  3EPI A;  1S77 D;  2AGP A;  4F4X A;  3SV4 A;  1UT8 A;  1TKD A;  1FA0 A;  9ICT A;  2C2E A;  5KG4 A;  5DB6 A;  3MGI A;  4RPY A;  3V7J A;  3JZ0 A;  4IG8 A;  3AQN A;  4DSL A;  1RPL A;  5CR0 A;  1BPZ A;  3RR8 A;  4F2R A;  4FBT A;  2HHW A;  2UVV A;  2ISP A;  3PMN A;  1X2I A;  4QWB A;  4O3P A;  5DDY A;  2XO7 A;  4F5R A;  1N48 A;  2DRA A;  4DOA A;  4ECU A;  3ZDC A;  7ICI A;  4KIT B;  1TAQ A;  5D49 A;  1TK8 A;  1NK9 A;  5HRB A;  1PZN A;  9ICR A;  4JV2 A;  2DR9 A;  5F2V O;  2BDP A;  4GC7 A;  1ZYQ A;  5IIO A;  4GC6 A;  3TAR A;  3V7K A;  2ZTD A;  2XCP A;  4KLT A;  3TFS A;  2AJQ A;  9ICU A;  4E80 A;  2AU0 A;  4RNN A;  2NRW A;  4O5K A;  1KEJ A;  2OWO A;  3RRH A;  2XCA A;  2FPM A;  4I2A A;  1ZQZ A;  4K4I A;  5DG7 A;  1A77 A;  9ICS A;  4QWA A;  5L1K A;  4KLG A;  4QZD A;  4I28 A;  4ECY A;  2VA8 A;  2VA3 A;  4DSE A;  3C66 A;  4TUS A;  1NJW A;  5III A;  4B9V A;  4B9T A;  4P2H A;  3H40 A;  1HJP A;  1KRP A;  5HRF A;  4QWE A;  3RBD A;  4UQG A;  5D4B A;  1MIV A;  2NRK A;  2ZH1 A;  5HRG A;  2ZH8 A;  4TQS A;  1ZQB A;  4R8U B;  3OUY A;  2ZH2 A;  5J0O A;  1UET A;  3FDS A;  2PFO A;  9ICM A;  5HRE A;  3C23 A;  1ZQF A;  1JAJ A;  3L9D A;  4YD1 A;  5KFO A;  4ED8 A;  3ZDA A;  4WC2 A;  5DBC A;  2HHS A;  4ECX A;  5J2E A;  7ICP A;  4EZ9 A;  4C8N A;  4UB1 A;  1S76 D;  3UQ2 A;  8ICJ A;  3C18 A;  4YD2 A;  3HW8 A;  5KFN A;  2MUT A;  4EYH B;  1R89 A;  3ZD9 A;  4F2S A;  2ZH4 A;  1D8Y A;  3M9O B;  2ZJA A;  2F1H A;  1JIH A;  4UAY A;  3WFP A;  2V4Q A;  3UPS A;  4XUS A;  3H8W A;  3AQL A;  5KT5 A;  4M04 A;  4X4V A;  2XGQ A;  5KFM A;  4QZF A;  3THV A;  1T8E A;  1NKB A;  1TV9 A;  4C8K A;  4RQ3 A;  2ASL A;  9ICI A;  2FPK A;  5J0Y A;  4UD4 A;  4ATB B;  4XQ7 A;  5KFD A;  1BPY A;  1RYR A;  2R8I A;  4I2J A;  3BQ1 A;  4QZC A;  1PX5 A;  4RQ0 A;  3PV8 A;  2O5A A;  2O1P A;  4KLD A;  5D46 A;  4CCH A;  7ICF A;  4AT8 A;  4ELT A;  9ICV A;  2DRB A;  5DGB A;  2F1I A;  2H5X A;  4O3Q A;  4QW9 A;  1T7P A;  2W9C A;  2ZH7 A;  3MR3 A;  4RPZ A;  4YR0 A;  4J9R A;  2ZH9 A;  3PVX A;  2VA2 A;  5DG8 A;  5DED A;  2W8K A;  3KHR A;  5J0P A;  4AT9 B;  5J2F A;  3V7L A;  2IHN A;  4TUQ A;  3B0Y A;  4DOC A;  8ICF A;  3WFR E;  2JZB B;  4MEX A;  1BNP A;  4F3O A;  5CJ7 A;  5KG7 A;  3IHQ B;  4PGX A;  3H37 A;  5CP2 A;  4RUA A;  1S10 A;  3M9M B;  4ECT A;  1NZP A;  3MFH A;  4ECQ A;  4IRK A;  3RRG A;  1YLQ A;  1LV5 A;  1SL0 A;  5IIK A;  3ISD A;  3RJJ A;  3EPG A;  1BPX A;  4B9L A;  5L9X A;  5DB9 A;  4DQR A;  3H3A A;  4YR3 A;  2C22 A;  1ZQX A;  1ZQC A;  4M6W A;  1ZQN A;  1SZP A;  4I29 A;  1NOM A;  5KFP A;  4NKT A;  1UEV A;  4FO6 A;  5KFX A;  2NRT A;  3UXP A;  1SL1 A;  3BQT A;  1QSL A;  4DFK A;  3PW7 A;  4JWN A;  1ARO P;  3C1Y A;  4J9P A;  1U49 A;  3T5L A;  2ZHA A;  2HVH A;  4BGD A;  4QWD A;  2BCU A;  1L3S A;  3FYH A;  2VAN A;  5DLG A;  5J0T A;  7ICL A;  4WC6 A;  2DR7 A;  4DSI A;  4Q8F A;  3T5H A;  3T3F A;  4M9N A;  1ZQO A;  1Q79 A;  4X4Q A;  4DSF A;  2FMQ A;  4X4U A;  2AQ0 A;  4M9G A;  2BGW A;  4QZ9 A;  5DQI A;  1L5U A;  5J0R A;  1S0O A;  4RQ2 A;  3EYZ A;  3HPO A;  3BJY A;  3LDA A;  5J2I A;  4GLX A;  4EBC A;  5BOL A;  4Z6E A;  1JMS A;  4FS1 A;  3V6J A;  2A1J B;  1HUZ A;  3HX0 A;  4KLH A;  4IQV A;  1KFD A;  1ZQE A;  2BQR A;  3JPT A;  4J9S A;  4B9S A;  5HHH A;  4I27 A;  4NLZ A;  8ICZ A;  3RB3 A;  4MF2 A;  1XWL A;  3H39 A;  5DEC A;  4NLN A;  3PO5 A;  3PW2 A;  1Y88 A;  3PX0 A;  4EZ6 A;  5L1J A;  4O3S A;  9ICX A;  4AT8 B;  3MDC A;  4M5D A;  3RB4 A;  5CWR A;  3WFO A;  3C21 A;  1XS9 D;  9ICW A;  3GIL A;  1U9L A;  4C8M A;  4UBC A;  3JPN A;  1S0N A;  1X9M A;  4JV0 A;  2BCS A;  4ED6 A;  1D9F A;  3RJK A;  3PR4 A;  2RFF A;  2AGO A;  2W9B A;  3RR7 A;  1XC9 A;  8ICQ A;  3SV3 A;  3C1Z A;  4F5Q A;  1Z00 B;  1S0M A;  1KDH A;  4BXO B;  8ICS A;  5HRD A;  4RWN A;  1WOT A;  2J6U A;  5KFV A;  2HVI A;  4FH5 A;  3GIJ A;  4XQ8 A;  4RQ6 A;  2HW3 A;  1ZQG A;  3MDA A;  1OU5 A;  1TFY A;  9ICK A;  3Q8K A;  1ZET A;  5EWG A;  4UAZ A;  3AUO A;  1S97 A;  3RAX A;  1V9P A;  1TAU A;  4UAW A;  4QZG A;  3HWT A;  4DLG A;  1NK5 A;  3PY8 A;  4I2C A;  3GV5 B;  9ICL A;  2BCV A;  4KMU A;  3JPQ A;  2JEJ A;  2R8G A;  2IHM A;  2PI5 A;  4UB5 A;  4BXO A;  5HRH A;  3AQM A;  4NM2 A;  1B22 A;  1R8B A;  2ZH6 A;  4DS5 A;  1SKR A;  5IIL A;  4DO9 A;  1MQ3 A;  4FHP A;  1UA0 A;  1ZQT A;  4YN4 A;  2FLL A;  4J9Q A;  7ICJ A;  4YXM A;  8ICN A;  4WC1 A;  2PFN A;  3TAN A;  1NKE A;  2DPI A;  4KLE A;  5KG2 A;  3EZ5 A;  7ICN A;  1ZJM A;  4MFF A;  8ICA A;  2J6S A;  2AGQ A;  3B0X A;  5J2G A;  1U4B A;  3OJU A;  2RDJ A;  4BWM A;  1ZQV A;  4ED7 A;  2FPL A;  4KLS A;  4X4T A;  2M2W A;  4QW8 A;  4RWQ A;  4RQ4 A;  3OHA A;  2KP7 A;  4IQT A;  9ICF A;  3ZDE A;  5KT2 A;  3HT3 A;  3SZ2 A;  4MFC A;  4AT7 A;  3OSP A;  4QZA A;  3OVB A;  1BPB A;  4I2D A;  4M9J A;  4BWJ A;  4EBJ A;  4KLU A;  5KFT A;  1N56 A;  9ICP A;  2DR8 A;  3AU6 A;  1S0V A;  1UT5 A;  4QZ8 A;  3KHG A;  3LWL A;  4Z6D A;  4MF8 A;  3KHL A;  5IIM A;  7ICT A;  3MBY A;  4C8O A;  4JV1 A;  3C2K A;  3PW5 A;  4IR1 A;  1VJ7 A;  5HML A;  3Q8L A;  4TUR A;  4PHA A;  4DQI A;  1UEU A;  5J0W A;  4YCX A;  3OJS A;  2R8H A;  4Q43 A;  4F4Z A;  2R8K A;  3SYZ A;  4KLL A;  2HHV A;  9ICB A;  9ICQ A;  4KLI A;  3V72 A;  2M2V A;  1D8L A;  1K1S A;  5KG3 A;  4G3I A;  7ICQ A;  4XA5 A;  1DK2 A;  5KFC A;  2PI4 A;  2MUT B;  5HP4 A;  4JUZ A;  2BQU A;  4E0D A;  4PGQ A;  5J0X A;  1NKC A;  4FHV A;  5KG6 A;  4WCW A;  4DF4 A;  2UVR A;  3HIY A;  2BE3 A;  2HHP A;  2JZB A;  8ICT A;  4P4M A;  2DFL A;  4IQW A;  3TFR A;  4NXZ A;  3EWA A;  5EOZ A;  4DL5 A;  3C5F A;  2I9G A;  1RXV A;  2FLN A;  9ICG A;  2BCR A;  4LZD A;  3ZDB A;  2ASJ A;  4O3N A;  4Q8E A;  2AQ4 A;  1MQ2 A;  3M8R A;  4F5O A;  1ZQL A;  4KTQ A;  1QLN A;  4E7X A;  2V4R A;  4ECV A;  1RXW A;  4YMN A;  4FH3 A;  2P6R A;  5KFF A;  2FLP A;  3K4G A;  4O0I A;  3LWM A;  4YMM A;  2HHT A;  5HRI A;  4FHX A;  3M8S A;  3GQC A;  3LQC B;  4WC3 A;  4UB2 A;  2XY6 A;  3OV7 A;  5DDM A;  4DOB A;  8ICK A;  3JYY A;  7ICE A;  4PGY A;  4ZH4 A;  8ICG A;  2PXI A;  2HHX A;  2MAX A;  4RQ8 A;  4EEY A;  5DQG A;  1HUO A;  2KTQ A;  4J9L A;  4ELU A;  4NLG A;  2RDI A;  4DFP A;  1KTQ A;  2Y1I A;  5JUM A;  5KFB A;  4KLM A;  5HNK A;  4DL4 A;  1ZQS A;  3RH6 A;  4FS2 A;  5DG9 A;  3PW4 A;  2BPG A;  8ICO A;  1A76 A;  1IM4 A;  3PW0 A;  2KZM A;  5HR9 A;  1F5A A;  4RQ1 A;  1D9D A;  3H38 A;  4NKU A;  1X9W A;  4F5P A;  4ELV A;  3BQ0 A;  2KFZ A;  1U47 A;  4DEZ A;  4M0A A;  2I1Q A;  1Q78 A;  2BR0 A;  4O3R A;  3NYB A;  3N4M B;  3GV8 B;  8ICC A;  9ICJ A;  2ZUB A;  3RJG A;  4ED3 A;  4RPX A;  2BKE A;  4B9N A;  2UVW A;  1XSN A;  3RJH A;  4K4G A;  8ICV A;  3KTQ A;  3RBE A;  4NM1 A;  1NJY A;  5J2C A;  3GII A;  4RQ5 A;  8ICU A;  5DBB A;  3HJ1 A;  2IBK A;  4YR2 A;  4BDP A;  2B21 A;  4KN4 A;  3PR5 B;  2HHU A;  3MGH A;  4R66 A;  4M2Y A;  3UXN A;  9ICE A;  1JXL A;  3OUY B;  2ZJ8 A;  3RB0 A;  4KLF A;  4X4R A;  1V4A A;  2KZZ A;  2ZH3 A;  4EYI B;  7ICS A;  5DB7 A;  9ICC A;  3JPO A;  2P6U A;  4ECZ A;  1H38 A;  5KFZ A;  4YXJ A;  4QZI A;  4DL7 A;  5EWF A;  4PH5 A;  3PNC A;  4KLJ A;  5J2K A;  1CEZ A;  1TK5 A;  4I2G A;  5F9N A;  1C7Y A;  2DPJ A;  2FMS A;  8ICH A;  4IQU A;  2PFQ A;  4DSJ A;  4DWI A;  3ISC A;  4X4P A;  3RH4 A;  2BCQ A;  1VFG A;  1ZQA A;  7ICM A;  1JX4 A;  3PX4 A;  4RQ7 A;  4JWM A;  1NK4 A;  8ICB A;  1JXE A;  5KFW A;  3RJF A;  2ZUD A;  4DFM A;  2ATL A;  4O5C A;  8ICW A;  4WC7 A;  1NK6 A;  3K75 D;  1WCL A;  2BPC A;  1TFR A;  4RNM A;  4KN7 A;  4ED2 A;  1KFT A;  1DOQ A;  2XY5 A;  4F5N A;  1QTM A;  4WBY A;  2ALZ A;  4PHD A;  7ICR A;  3IM1 A;  3H7I A;  4R65 A;  4O9M A;  4DFJ A;  4TQR A;  4DL3 A;  4AT9 A;  5DQH A;  3C2L A;  1ZQY A;  5J2B A;  1BPD A;  1L3T A;  1MC8 A;  4DQS A;  4Q44 A;  3GV7 B;  1NJZ A;  5TZV A;  5J0U A;  1CUK A;  4R8U A;  4DLE A;  4YQW A;  4TUP A;  2ID1 A;  1R8C A;  1DGS A;  4JK1 A;  5J2J A;  5F9L A;  3RJE A;  4ED1 A;  3V6H A;  4RT3 A;  3QEB Z;  1COO A;  3BDP A;  4HYK A;  2Y1J A;  5HRK A;  2ZUC A;  5KFH A;  2BQ3 A;  1NK7 A;  2ISO A;  1QSS A;  4IR9 A;  4LVS A;  3RH5 A;  9ICH A;  2J6T A;  1NO5 A;  1SL2 A;  3BQ2 A;  5L1L A;  4XRH A;  4PHE A;  2A1J A;  4RWO A;  1ZQH A;  4I2I A;  1TVA A;  1ZQJ A;  8ICP A;  5CHG A;  1R8A A;  3Q8S B;  3GIM A;  2IMW P;  3TQ1 A;  3UPQ A;  4EBE A;  2XY7 A;  4QZB A;  4Z6C A;  5J2A A;  1NK8 A;  4EP7 A;  4X4N A;  4X0A A;  1XU4 A;  3QE9 Y;  1U48 A;  4F50 A;  2WTF A;  1NK0 A;  4QWC A;  3TAP A;  4PPX A;  5J29 A;  1ZQD A;  1KNY A;  3HJ4 A;  1XSL A;  9ICO A;  5KFY A;  1ZQU A;  4F4Y A;  2ASD A;  2ZH5 A;  2DR5 A;  1EXN A;  1LB2 B;  1IXR A;  2W9M A;  4LZG A;  7ICK A;  1S9F A;  5CB1 A;  5KG0 A;  3LK9 A;  3G6V A;  3Q8P B;  3MAB A;  4YG2 A;  3PX6 A;  3TI0 A;  1MSW D;  4RT2 A;  1KLN A;  3H4D A;  3H4B A;  3C5G A;  3PML A;  5J2H A;  2NRV A;  9ICN A;  5CA7 A;  4RZR A;  4F93 B;  3PO4 A;  1JN3 A;  4I2F A;  4WBZ A;  5KFR A;  3ZD8 A;  3Q8R B;  2KFN A;  3H8J A;  4YFK A;  4Q45 A;  4B9M A;  8ICY A;  1BGX T;  5KFL A;  1KFS A;  2ZHB A;  5HC9 A;  4DL2 A;  4B9U A;  4Z6F A;  5J0Q A;  8ICR A;  5KT4 A;  4X0B A;  5BPC A;  2FMP A;  1ZQR A;  3QZ7 A;  4M6W B;  4O3O A;  3JPP A;  3M9N B;  5DKW A;  2NRX A;  4MFA A;  3T5J A;  7ICH A;  1BNO A;  4WC0 A;  4QZE A;  4YMO A;  4ECS A;  5DLF A;  1XSP A;  3KHH A;  8ICE A;  4YP3 A;  3MFI A;  3G6X A;  1Z3E B;  4WC4 A;  5DBA A;  1Z00 A;  4F91 B;  2PBE A;  4FHY A;  3ETL A;  4UBB A;  4R64 A;  2Q66 A;  3G6Y A;  4ATB A;  2R8J A;  4J9M A;  1ZQI A;  3C2M A;  3QZ8 A;  4ED0 A;  1UA1 A;  4KLQ A;  4RWP A;  4J9N A;  2XGP A;  2ZTC A;  3MR6 A;  1QSY A;  3JPR A;  3MR5 A;  3OVA A;  3GFK B;  4NLK A;  5IIJ A;  5J2D A;  5BOM A;  2C2D A;  5KT6 A;  1RZT A;  1K1Q A;  2JEG A;  1MIW A;  4E8F A;  5KT3 A;  5L1I A;  3N97 B;  4ECW A;  3GDX A;  2V9W A;  2DVI A;  1BVS A;  4ECR A;  4F92 B;  2C28 A;  2F1J A;  4YVZ A;  3JPS A;  8ICX A;  4K4H A;  5KFQ A;  4UB3 A;  2W9A A;  4MEY A;  2JEF A;  2M2U A;  3SI8 A;  4EBD A;  8ICI A;  4DF8 A;  3OHB A;  1ZQQ A;  4J9K A;  1ZQW A;  5J0S A;  4FBU A;  1BPE A;  7ICU A;  3WFQ E;  3OSN A;  8ICM A;  3H8S A;  3NTU A;  4NY8 A;  4PHP A;  4RUC A;  4P4P A;  2W9B B;  3ZDD A;  1B43 A;  1ZQK A;  2XC9 A;  4UB4 A;  4S3N A;  4X4S A;  5KFJ A;  4KLO A;  3WFS C;  5DB8 A;  2Q0Z X;  4X5V A;  3RTV A;  7ICG A;  2C2R A;  5KFG A;  5KFI A;  4F4W A;  3UQ0 A;  1L3U A;  4EBK A;  5HHI A;  4LT6 A;  1T3N A;  1WCN A;  5IIN A;  3ISB A;  5EWE A;  3T5K A;  5DGA A;  1NJX A;  1TFW A;  4DL6 A;  9ICA A;  4RU9 A;  3Q8Q B;  3GIK A;  1XO1 A;  5KT7 A;  3AQK A;  5KFK A;  3RAQ A;  1SKS A;  2JEI A;  4QZH A;  4J9O A;  4P4O A;  2ZTE A;  1ZJN A;  2W9C B;  4M47 A;  7ICV A;  3AU2 A;  4F4K A;  4O5E A;  4UD5 A;  4X4O A;  3HP6 A;  2PFP A;  3RJI A;  3OVS A;  1ZQP A;  2BPF A;  3RB6 A;  3TAQ A;  2ZJ5 A;  8ICL A;  4WC5 A;  1JQR A;  4IRC A;  3Q8M A;  2LYH A;  4M9H A;  4I2B A;  2HHQ A;  2M2T A;  4DQP A;  1X9S A;  3V6K A;  1KSP A;  5KG1 A;  4IRD A;  2KN7 A;  2GWS A;  1DK3 A;  1U45 A;  2BHN A;  4DS4 A;  5KG5 A;  1L3V A;  1T4G A;  4AT7 B;  5HMM A;  2KZ3 A;  3EW9 A;  4GXK A;  4DSK A;  4I2H A;  7ICO A;  1ZQM A;  3QEA Z;  5HRL A;  3UXO A;  1MIY A;  5KFS A;  5C5J A;  2UVU A;  5KFE A; 
#chains in the Genus database with same CATH topology
 3NGD A;  1N62 A;  2RQ5 A;  2NRZ A;  5KFU A;  1RYS A;  3ORY A;  4EX6 A;  4EEN A;  2YB1 A;  4R63 A;  5ALF A;  1IV8 A;  4F4X A;  5AKY A;  2C2E A;  3MGI A;  4RPY A;  1RPL A;  5CR0 A;  4P0Q B;  3PMN A;  3N7R C;  4O3P A;  2XO7 A;  5KAF U;  4DOA A;  2YB4 A;  2W54 A;  4NJ8 A;  2YN4 A;  2G5I B;  5HRB A;  1OUQ A;  9ICR A;  2DR9 A;  5IIO A;  4OCZ A;  3CYM A;  2GAF D;  2NRW A;  1GPJ A;  1KEJ A;  5DG7 A;  1A77 A;  5AI0 A;  2ZIW A;  5L1K A;  4KLG A;  2QLT A;  1B4F A;  4TUS A;  4OJ6 A;  5HRF A;  3KZI U;  1ZOL A;  4UQG A;  4EEL A;  4TQS A;  2QKQ A;  3FDS A;  9ICM A;  3L9D A;  2HHS A;  4EZ9 A;  4C8N A;  4UB1 A;  3C18 A;  3QXG A;  4EYH B;  4F2S A;  1JIH A;  1KN5 A;  2KG5 A;  4BJQ A;  3UPS A;  2WAQ F;  3SEI A;  1NKB A;  4ATB B;  4XQ7 A;  2YTU A;  1BPY A;  2QB0 A;  2O5A A;  3NVW A;  4KLD A;  4CCH A;  7ICF A;  1WUD A;  4ELT A;  2DRB A;  3NUQ A;  2IOF K;  5ALT A;  2F1I A;  1HIW A;  1SIJ A;  4RPZ A;  3QUB A;  5DED A;  2W8K A;  1L7P A;  4AT9 B;  4G9B A;  1N5W A;  3V7L A;  2K8A A;  1ZD3 A;  4LEY A;  1NZP A;  3RRG A;  1YLQ A;  5IIK A;  4B9L A;  4DQR A;  5AM5 A;  2GA9 D;  4YR3 A;  1ZQC A;  2BBH A;  3H3A A;  4M6W A;  1NOM A;  4CNQ A;  2WFA A;  3PW7 A;  1U49 A;  3C1Y A;  4J9P A;  4F72 A;  4BGD A;  1PK1 A;  3SQI A;  4LJX A;  4DSI A;  1Q79 A;  5JRT A;  4K9B A;  2BGW A;  3KOO A;  3V6J A;  4FS1 A;  2BQR A;  4J9S A;  3DEE A;  3RB3 A;  4MF2 A;  5DEC A;  3AQE A;  3PO5 A;  4O3S A;  2ZIV A;  4AT8 B;  2OEH A;  3TAC B;  3RB4 A;  3C21 A;  2DGZ A;  1S0N A;  1D9F A;  2K8B B;  4ED6 A;  2AGO A;  3CW2 C;  8ICS A;  4F5Q A;  1Z00 B;  2YY6 A;  3CK6 A;  2KJ5 A;  3MDA A;  1OU5 A;  1TFY A;  3NRW A;  5EWG A;  1S97 A;  3RAX A;  5B3Q A;  2DBY A;  4QZG A;  3HWT A;  3PY8 A;  5ALX A;  5HRH A;  1R8B A;  2ZH6 A;  2AHO B;  1FFV A;  4K98 A;  4YN4 A;  2K60 A;  7ICJ A;  4YXM A;  4KLE A;  4LEW A;  2FPL A;  5E79 U;  4QW8 A;  2ZIX B;  9ICF A;  4MFC A;  4QZA A;  4F71 A;  1F44 A;  4EBJ A;  2JGA A;  5KFT A;  1N56 A;  2DR8 A;  5AIB A;  1S0V A;  3RFA A;  1PVQ A;  4MF8 A;  4KMO B;  1PK1 B;  4IR1 A;  5HML A;  3Q8L A;  3AM9 A;  4LEV A;  1UEU A;  5J0W A;  3OJS A;  1BNP A;  4KLL A;  5EE1 A;  5KG3 A;  2LPE A;  4XA5 A;  5KFC A;  2PI4 A;  1PUZ A;  3TAD C;  4PGQ A;  3DDH A;  1N60 A;  2HHP A;  4P4M A;  2DFL A;  4IQW A;  3HRD D;  3TFR A;  2YML A;  3EWA A;  1Z1V A;  1RXV A;  2ASJ A;  5CFT A;  4Q8E A;  1F0M A;  1QLN A;  2JV3 A;  4ECV A;  4CGZ A;  3BQ7 A;  4C80 A;  5HRI A;  3K4G A;  3KBB A;  4YMM A;  4FHX A;  3M8S A;  3GQC A;  4WC3 A;  2GLE A;  4DOB A;  3JYY A;  2OXO A;  4Y2V A;  7ICE A;  4CRX A;  1HUO A;  5DQG A;  2FCL A;  4DFP A;  2F2A B;  5JUM A;  4KLM A;  3PW4 A;  8ICO A;  2BPG A;  5HR9 A;  4NKU A;  1X9W A;  1A0P A;  4F5P A;  4DEZ A;  2I1Q A;  3NYB A;  2BR0 A;  3GV8 B;  3WKA A;  8ICC A;  3L4P A;  3RJG A;  5HR6 A;  4ED3 A;  5AKH A;  2MA1 A;  2KK0 A;  1XSN A;  8ICV A;  1VDV A;  1NJY A;  8ICU A;  4FZM A;  3PR5 B;  2WB1 C;  4M2Y A;  9ICE A;  2B4V A;  2ZJ8 A;  4EYI B;  3JPO A;  4PH5 A;  1CEZ A;  2WB1 F;  8ICH A;  5KFW A;  1O03 A;  2WF8 A;  2ZUD A;  3E0F A;  3RJF A;  1WCL A;  5ALY A;  4KN7 A;  1DOQ A;  4WBY A;  4PHD A;  7ICR A;  4OJP A;  4O9M A;  2KHV A;  4TQR A;  4DL3 A;  4NL9 C;  4AT9 A;  1ZQY A;  5ALK A;  5TZV A;  5J0U A;  1JRP A;  1DGS A;  4JK1 A;  2KNJ A;  5AK5 A;  3QEB Z;  1COO A;  2F77 X;  2I5H A;  3BDP A;  5KFH A;  2ISO A;  3HJ1 A;  1QSS A;  4CF5 A;  3RH5 A;  1DGJ A;  4Y2J A;  1SL2 A;  3BQ2 A;  4XRH A;  4RWO A;  5GTH U;  1ZQJ A;  1YZ7 A;  3Q8S B;  3F5A A;  4RQM A;  4EBE A;  2XY7 A;  1NK8 A;  4EP7 A;  2EDU A;  4X4N A;  2LM4 A;  3TAP A;  4PPX A;  3HJ4 A;  1RQL A;  4HAI A;  9ICO A;  5KFY A;  1QQ6 A;  1ZQU A;  2ASD A;  5CRX A;  2ZH5 A;  2DR5 A;  5ALH A;  1LB2 B;  2W9M A;  4LZG A;  1Z4O A;  5KG0 A;  2HOI A;  1QQ5 A;  3MAB A;  4K99 A;  3H4B A;  3PML A;  5J2H A;  5ALI A;  3Q8R B;  3H8J A;  3WKB A;  1BGX T;  1KFS A;  4DL2 A;  8ICR A;  4Z6F A;  2DUY A;  5KT4 A;  3IG8 A;  2K89 A;  3M6K A;  2FMP A;  1ZQR A;  2YX8 A;  2NRX A;  4MFA A;  4WC0 A;  4QZE A;  4U6P A;  4ECS A;  2E3T A;  3KHH A;  3G6X A;  1L8O A;  1Z00 A;  4QJF B;  2E8M A;  4UBB A;  2DF4 B;  4ED0 A;  4RWP A;  2KV2 A;  2QB0 B;  5J8Y A;  4OAH A;  3CP8 A;  4J9N A;  2KIV A;  1QSY A;  1PK3 A;  2JEG A;  5KT6 A;  1K1Q A;  1MIW A;  5L1I A;  3AL0 B;  8ICX A;  4YVZ A;  4K4H A;  4UB3 A;  4EBD A;  2QB1 A;  1SV0 C;  3WFQ E;  8ICM A;  3FC4 A;  4PHP A;  2XC9 A;  5KFJ A;  2ES6 A;  4X5V A;  3UQ0 A;  3IDW A;  4EBK A;  2OCE A;  1NJX A;  3ISB A;  5EWE A;  5DGA A;  4O67 A;  3Q8Q B;  3GIK A;  2KJ8 A;  2JEI A;  2HOQ A;  2KKP A;  4F4K A;  3HP6 A;  2ZXI A;  2ZIU A;  2ZJ5 A;  4WC5 A;  3VCB A;  4Y2R A;  3BZC A;  3VC8 A;  2M2T A;  2W7O A;  1X9S A;  2JRZ A;  5KG1 A;  2WF7 A;  1X66 A;  2P35 A;  3AMZ A;  3MGV A;  4I2H A;  3UXO A;  4J9K A;  5C5J A;  5KFE A;  3UMB A;  3SEN A;  5AM3 A;  4P0Q A;  4FHW A;  4I2E A;  2FDR A;  5KFA A;  4GXI A;  2K4E A;  2AGP A;  1TKD A;  1UT8 A;  9ICT A;  3AQN A;  2DKX A;  4FBT A;  1NZB A;  2HHW A;  2UVV A;  1X2I A;  4QWB A;  1N48 A;  5DDY A;  4F5R A;  3D2N A;  7ICI A;  4FE3 A;  2K4I A;  3WK9 A;  1B0X A;  5D49 A;  1PZN A;  4P0P B;  5F2V O;  2BDP A;  4GC7 A;  4GC6 A;  3TAR A;  3V7K A;  3R9K A;  4KLT A;  5AKZ A;  3TFS A;  4E80 A;  4RNN A;  2RRD A;  2FPM A;  3U26 A;  4QWA A;  2HDO A;  4BX9 C;  4DSE A;  4B9V A;  1HJP A;  3RBD A;  5AKE A;  3OUY A;  1UET A;  2PFO A;  5CFS A;  2HMX A;  1ZQF A;  5KFO A;  4BUG A;  4WC2 A;  4ECX A;  3UQ2 A;  8ICJ A;  1R89 A;  3ZD9 A;  1D8Y A;  3M9O B;  3ER9 B;  1WWU A;  4C4T A;  4GFJ A;  3WFP A;  2V4Q A;  4X4V A;  5EE0 A;  4C7Y A;  1VLB A;  5KFM A;  3THV A;  4C8K A;  4RQ3 A;  5B3P A;  4UAV A;  1V97 A;  2R8I A;  3BQ1 A;  1RYR A;  4EEK A;  5D46 A;  2HBM A;  1SB3 C;  2ZH9 A;  4Y2X A;  2VA2 A;  1UQV A;  3KHR A;  2LYA A;  3I76 A;  2L5Y A;  3J81 j;  3AQF A;  5B5E U;  2JZB B;  4MEX A;  3QU5 A;  5L1M A;  3OTQ A;  5KG7 A;  5CJ7 A;  3IHQ B;  3H37 A;  1S10 A;  3ETR A;  4ECT A;  3WK4 A;  2W11 A;  3ISD A;  1BPX A;  3JCF A;  3IN5 A;  1P7D A;  4I29 A;  1SZP A;  4NKT A;  2IUB A;  4FO6 A;  5KFX A;  1SL1 A;  4DFK A;  4P0P A;  2ZHA A;  2HVH A;  1SXD A;  2BCU A;  5J0T A;  4IS7 A;  3F2B A;  4X4Q A;  4DSF A;  2Y9T A;  5J8Y C;  3HIL A;  4M9G A;  3QU4 A;  5DQI A;  4RQ2 A;  4GLX A;  2W3S A;  3LDA A;  1HUZ A;  1M6Y A;  1JMS A;  4Z6E A;  4UW9 A;  3HX0 A;  1KFD A;  4NLZ A;  4I27 A;  3JPT A;  3ERC C;  5C0Y A;  2JHD A;  4NLN A;  2WHE A;  2AXT U;  5ALS A;  1XS9 D;  4UBC A;  4C8M A;  4LT6 A;  2RHF A;  3PR4 A;  2HSZ A;  8ICQ A;  2W9B A;  2PMZ F;  4EEB A;  2EAP A;  3SV3 A;  1KDH A;  5HRD A;  4XQ8 A;  2HN1 A;  5AI4 A;  1ZET A;  3AUO A;  1TAU A;  9ICL A;  4DLG A;  2BCV A;  2R8G A;  3AQM A;  2IHM A;  2PI5 A;  2D6F C;  4NM2 A;  3E58 A;  4FHP A;  3QNM A;  2FE9 A;  5AKX A;  3TAN A;  1NKE A;  4WQK A;  4JLX A;  3B0X A;  4X4T A;  3OJU A;  2RDJ A;  4ED7 A;  1ZQV A;  2M2W A;  3OHA A;  1SV4 A;  3ZDE A;  3BS5 A;  3SZ2 A;  3KD3 A;  3D6J A;  4AT7 A;  3OSP A;  3OVB A;  4NL9 A;  4C4R A;  4M9J A;  4BWJ A;  3S6J A;  4KLU A;  9ICP A;  2EZX A;  3AU6 A;  1ZD4 A;  4K8V A;  7ICT A;  2KJ9 A;  5ALW A;  5IIM A;  5ALV A;  4JV1 A;  1OXJ A;  3PW5 A;  4PHA A;  5ALQ A;  1L7M A;  4YCX A;  2R8H A;  1UEV A;  2DL0 A;  3SYZ A;  2R8K A;  2HHV A;  5AKK A;  4WC6 A;  4KLI A;  1D8L A;  1K1S A;  1QCK A;  4IL6 U;  4G3I A;  1DK2 A;  2MUT B;  5HP4 A;  4JUZ A;  1ZRM A;  2BQU A;  3DV9 A;  4FHV A;  2HBJ A;  4WCW A;  4C4S A;  3HIY A;  8ICT A;  1N2X A;  4NXZ A;  4DL5 A;  3C5F A;  9ICG A;  3ZDB A;  4O3N A;  1J2N A;  2B6G A;  2OH2 A;  4F5O A;  4E7X A;  2KOB A;  4UAT A;  2V4R A;  2F3N A;  4YMN A;  5KFF A;  3K1R B;  2FLP A;  4O0I A;  2HHT A;  4K96 A;  3LQC B;  3L3F X;  5DDM A;  8ICK A;  1X42 A;  3NVY A;  3A0H U;  2KMD A;  3QU7 A;  2HHX A;  4RQ8 A;  3SD7 A;  2KTQ A;  4ELU A;  4NLG A;  1KTQ A;  4EV6 A;  2EZZ A;  2KZM A;  1FO4 A;  2KFZ A;  3BQ0 A;  1U47 A;  4M0A A;  1Q3U A;  4UB6 U;  3GU3 A;  2KHQ A;  5ALE A;  2ZUB A;  4B9N A;  3WK8 A;  5AIC A;  2HN2 A;  2EAN A;  5ALL A;  3F5E A;  1Z4N A;  2EZY A;  3MGH A;  3UXN A;  3RB0 A;  4C7Z A;  3LVW A;  4C0Z A;  1YT3 A;  9ICC A;  2W3R A;  1ZD5 A;  4QZI A;  1FIQ A;  3PNC A;  4I2G A;  2DPJ A;  2FMS A;  3ISC A;  4X4P A;  4GIB A;  1VFG A;  1JI7 A;  3NRZ A;  7ICM A;  3PX4 A;  8ICB A;  1L7N A;  1NK4 A;  5JU5 A;  1JUD A;  2ATL A;  4WC7 A;  1NK6 A;  4RNM A;  4FFD A;  1KFT A;  2XY5 A;  2E8N A;  2IOF A;  4NWI A;  1L3T A;  4DQS A;  1J2M A;  1J97 A;  2Y9U A;  1CUK A;  2K4H A;  4YQW A;  4TUP A;  2ID1 A;  1R8C A;  2EWR A;  5J2J A;  5F9L A;  3V6H A;  4ED1 A;  2LHT A;  4A8E A;  4RT3 A;  4HYK A;  5HRK A;  2BQ3 A;  9ICH A;  2J6T A;  2HOF A;  1N63 A;  5JTG A;  4PHE A;  2A1J A;  1ZQH A;  8ICP A;  5CHG A;  2A3V A;  3GIM A;  3TQ1 A;  3UPQ A;  2GOL A;  3QE9 Y;  4DFD A;  1ZQD A;  3N7S C;  4F4Y A;  3D2Q A;  1QQ7 A;  1IXR A;  2XID A;  5CB1 A;  3G6V A;  4RT2 A;  2NRV A;  5CA7 A;  4YFK A;  5J0Q A;  1ZQ1 C;  3QZ7 A;  5DKW A;  7ICH A;  3T5J A;  3L5K A;  3F53 A;  5DLF A;  4Y2Y A;  4YP3 A;  3MFI A;  4WC4 A;  2PBE A;  3ETL A;  3G6Y A;  4K97 A;  1ZQI A;  2LBO A;  2ZTC A;  3MR6 A;  3JPR A;  3MR5 A;  4NLK A;  3RF9 A;  1RZT A;  3K7D A;  3D2S A;  4E8F A;  2C28 A;  5KFQ A;  2K8C B;  2KVC A;  5ALO A;  2E5S A;  3SAF A;  3OHB A;  1BPE A;  7ICU A;  3H0R B;  2W9B B;  1B43 A;  1ZQK A;  2WF5 A;  2B56 A;  3WFS C;  5DB8 A;  2Q0Z X;  2C2R A;  2HBK A;  1T94 A;  1IG6 A;  1WCN A;  1UPH A;  2XVT A;  4DL6 A;  3AQK A;  3BZK A;  3FAH A;  5ALP A;  5KT7 A;  1ECW A;  3WKE A;  2ZTE A;  1ZJN A;  2W9C B;  4M47 A;  4UD5 A;  3AU2 A;  4DCC A;  5D61 A;  1COK A;  2BPF A;  5AM0 A;  3WU2 U;  2LYH A;  3PST A;  1XO0 A;  4LEZ A;  3V6K A;  2RLT A;  1NNL A;  1U45 A;  1L3V A;  5AM1 A;  4AT7 B;  5HMM A;  3EW9 A;  4UAS A;  1X6J A;  3QEA Z;  5HRL A;  1MIY A;  1Z1B A;  5GTI U;  2W8L A;  4WQL A;  1N61 A;  1TK0 A;  4GXJ A;  4C8L A;  2IA6 A;  1SKW A;  5A0L A;  3EPI A;  1S77 D;  3QUC A;  3SV4 A;  4IG8 A;  3CNH A;  4DSL A;  1BPZ A;  4F2R A;  3QU2 A;  1Q8K A;  2ISP A;  3M7D A;  4ECU A;  5AK3 A;  1TAQ A;  4KX3 A;  4ACO A;  2B0C A;  3QUT A;  1PVP A;  2XCP A;  3BS5 B;  2AU0 A;  2HBL A;  3K1Z A;  2DKZ A;  2OWO A;  4K4I A;  3RRH A;  9ICS A;  4O68 A;  3B9J A;  2VA3 A;  3C66 A;  1ZXI A;  5III A;  5HR7 A;  4B9T A;  4U7C A;  4P2H A;  2XI9 A;  1KRP A;  4QWE A;  5D4B A;  2NRK A;  2ZH1 A;  5HRG A;  2FJ6 A;  1ZQB A;  3BS7 A;  5J0O A;  3C23 A;  3NWI A;  4YD1 A;  5DBC A;  7ICP A;  1S76 D;  3HW8 A;  5KFN A;  2MUT A;  2F1H A;  4UAY A;  3AQL A;  3H8W A;  5KT5 A;  2XGQ A;  4QZF A;  2ASL A;  9ICI A;  2E8O A;  2KVS A;  4RQ0 A;  4RQN A;  2O1P A;  5DGB A;  2H5X A;  3FM9 A;  1T7P A;  2W9C A;  5KAI U;  3PVX A;  5DG8 A;  2HI0 A;  1X40 A;  5J2F A;  2IHN A;  3B0Y A;  8ICF A;  2Q4T A;  4PGX A;  5CP2 A;  4RUA A;  2Z7J A;  3EPG A;  2C22 A;  1ZQX A;  1ZQN A;  5KFP A;  2NRT A;  3BQT A;  1ARO P;  3T5L A;  2VAN A;  4I0U A;  7ICL A;  2DR7 A;  2CRX A;  3KKA C;  4M9N A;  2H3Q A;  1ZQO A;  2PKE A;  4X4U A;  4QZ9 A;  3EYZ A;  3HPO A;  3BJY A;  2PFN A;  4FH3 A;  5BOL A;  2A1J B;  4IQV A;  4B9S A;  5HHH A;  3H39 A;  1RM6 C;  4O6A A;  3PX0 A;  4EZ6 A;  4M5D A;  5CWR A;  3WFO A;  3HKZ F;  1SV0 A;  1U9L A;  2BCS A;  2RFF A;  4JV0 A;  2RP5 A;  1XC9 A;  3C1Z A;  1WOT A;  5ALM A;  3GIJ A;  2KIW A;  4RQ6 A;  2HW3 A;  9ICK A;  1V9P A;  5ALG A;  1NK5 A;  4I2C A;  3JPQ A;  4BXO A;  3KZX A;  4UB5 A;  3M6Z A;  1OW5 A;  2R18 A;  3GZF A;  4DS5 A;  2Y0S C;  5IIL A;  5AKG A;  1L8L A;  1ZQT A;  8ICN A;  3T79 A;  4WC1 A;  1QH9 A;  5KG2 A;  3EZ5 A;  8ICA A;  4MFF A;  2J6S A;  1URJ A;  2AGQ A;  5J2G A;  1U4B A;  4BWM A;  4RWQ A;  2KP7 A;  4RQ4 A;  5KT2 A;  4QNL A;  3NVO A;  1AQ6 A;  3MC1 A;  3SAH A;  1N5X A;  5ALJ A;  1UT5 A;  3KHG A;  3KHL A;  4Z6D A;  4C8O A;  5CEH A;  3C2K A;  3LVV A;  1V38 A;  4DQI A;  4JLZ A;  2M2V A;  9ICB A;  1L6N A;  3V72 A;  2KSO A;  1WWV A;  4MHV A;  4E0D A;  2Y0S F;  5J0X A;  1NKC A;  4DF4 A;  2QAR A;  2M0N A;  4UAR A;  2H3I A;  2BE3 A;  2NYV A;  2I9G A;  2FLN A;  4LZD A;  5AKJ A;  3ICX A;  3M8R A;  1ZQL A;  4KTQ A;  1RXW A;  1UHU A;  2ESE A;  2KD1 A;  3QX7 A;  4PGY A;  4ZH4 A;  4QIW F;  4J9L A;  2RDI A;  3O0F A;  3ED5 A;  4JMU A;  5HNK A;  4DL4 A;  3RH6 A;  1ZQS A;  5D62 A;  4AT8 A;  5DG9 A;  1F5A A;  1X6I A;  4RQ1 A;  1D9D A;  3WKD A;  4ELV A;  2H3F A;  3H8M A;  3N4M B;  1Q46 A;  9ICJ A;  5AHX A;  1PVR A;  2MSN A;  4PJ0 U;  2BKE A;  2UVW A;  1S8O A;  2EQY A;  3KTQ A;  1WYG A;  2F76 X;  2W43 A;  3RBE A;  4NM1 A;  5ALD A;  1KBU A;  5AIA A;  1FEZ A;  2B21 A;  2BDU A;  2D3D A;  2VJ5 A;  3EUB 2;  4KN4 A;  4R66 A;  3OUY B;  2VIX A;  4KLF A;  4X4R A;  1V4A A;  2KZZ A;  7ICS A;  4ECZ A;  2P6U A;  1H38 A;  4YXJ A;  4DL7 A;  5EWF A;  4US9 A;  2LI6 A;  4KLJ A;  5J2K A;  1TK5 A;  4NLB A;  5F9N A;  1C7Y A;  1T3Q A;  2JXJ A;  4IQU A;  5TIS U;  2PFQ A;  4CF4 A;  2BCQ A;  1JX4 A;  4RQ7 A;  4JWM A;  4PZO A;  3C29 A;  4DFM A;  8ICW A;  2BPC A;  4F5N A;  3IM1 A;  3SAG A;  4DFJ A;  4US8 A;  5DQH A;  3C2L A;  1MC8 A;  3GV7 B;  4DLE A;  2G08 A;  1SXE A;  2ZUC A;  4LVS A;  5L1L A;  4Y2P A;  1R8A A;  2IMW P;  4QZB A;  5J2A A;  2MU2 A;  1XU4 A;  4X0A A;  2BBJ A;  2MRL A;  2QAR B;  2WTF A;  4QWC A;  5ALU A;  5J29 A;  1XSL A;  5CFU A;  2ZIU B;  1EXN A;  1YZ6 A;  3ALR A;  3TI0 A;  4XJE A;  3PX6 A;  4OAF A;  3C5G A;  2O6K A;  2YMM A;  9ICN A;  2ODG A;  2JR5 A;  1JN3 A;  5G5H A;  4I2F A;  4WBZ A;  4B9M A;  5KFL A;  4B9U A;  5BPC A;  2NV3 A;  5T14 A;  4M6W B;  4O3O A;  3NVV A;  3MCR A;  3IG5 A;  1Z3E B;  4F91 B;  1DRG A;  2Q66 A;  5AI9 A;  4NLC A;  4ATB A;  2W04 A;  2R8J A;  2G07 A;  3WK5 A;  3QZ8 A;  1UA1 A;  3NAS A;  3WKC A;  1SGG A;  3GFK B;  5BOM A;  2C2D A;  3H0M B;  5KT3 A;  3N97 B;  2I6X A;  5AM2 A;  4ICA A;  3GDX A;  2DVI A;  1BVS A;  1LVH A;  2F1J A;  3JPS A;  2W9A A;  1CRX A;  5KL8 B;  4CF3 A;  2JMG A;  4N7R A;  5ALZ A;  3PSI A;  3H8S A;  4NY8 A;  3ZDD A;  2ZIV B;  4UB4 A;  4X4S A;  2EAO A;  1KW4 A;  4KLO A;  4O69 A;  3RTV A;  7ICG A;  5KFG A;  4USA A;  4OJ5 A;  4FZN A;  1L3U A;  2VJ4 A;  1TFW A;  3T5K A;  5EE9 A;  5KFK A;  3RAQ A;  4P4O A;  2YMP A;  3WK6 A;  4X4O A;  1C20 A;  2PFP A;  3RJI A;  3OPX A;  3RB6 A;  8ICL A;  1LKY B;  4IRC A;  1JQR A;  4NXU A;  4UB8 U;  4J03 A;  4M9H A;  2F8K A;  2XIC A;  4IRD A;  5K4L A;  2KN7 A;  2GWS A;  2GH1 A;  4Y2T A;  4DS4 A;  5KG5 A;  1T4G A;  2KZ3 A;  4KX5 A;  3AEV A;  1ZQM A;  1DXS A;  5KFS A;  2UVU A;  4F8R A;  3E2E A;  5KTQ A;  4DQQ A;  4NXT A;  2P66 A;  4M9L A;  1ED1 A;  2M9N A;  3OGU A;  3MR2 A;  4RNO A;  4KB6 A;  3I28 A;  4ZOH C;  4EX7 A;  1FA0 A;  5KG4 A;  5DB6 A;  1FFU A;  3V7J A;  3JZ0 A;  3RR8 A;  3HJE A;  3SR6 A;  1SZH A;  2DRA A;  3ZDC A;  4KIT B;  4WH5 A;  2E1F A;  1TK8 A;  1NK9 A;  4JV2 A;  3PHZ A;  1SWV A;  1ZYQ A;  9ICU A;  2ZTD A;  2AJQ A;  2ZG6 A;  4O5K A;  4I2A A;  2XCA A;  3M1Y A;  1ZQZ A;  2GO7 A;  2E8P A;  4QZD A;  4I28 A;  4ECY A;  2VA8 A;  1NI3 A;  1NJW A;  3H40 A;  2G5H B;  4PL2 A;  1MIV A;  2ZH8 A;  2ZXH A;  4R8U B;  2ZH2 A;  5HRE A;  1RDF A;  3EF2 A;  3AN1 A;  4UAU A;  1JAJ A;  4ED8 A;  3ZDA A;  5AI8 A;  5J2E A;  4EGW A;  4YD2 A;  2ZH4 A;  1JRO A;  2ZJA A;  4AP9 A;  3NKU A;  4XUS A;  4M04 A;  1X9X A;  2G0A A;  2YMQ A;  1WG8 A;  1T8E A;  2KIC A;  2WF6 A;  1TV9 A;  1GO3 F;  2VKQ A;  2FPK A;  5J0Y A;  4UD4 A;  5KFD A;  1PX5 A;  1TE2 A;  3NS1 A;  4I2J A;  4QZC A;  3PV8 A;  1Z19 A;  9ICV A;  2K4P A;  4O3Q A;  4QW9 A;  2LMR A;  2ZH7 A;  3MR3 A;  4YR0 A;  4J9R A;  5J0P A;  4TUQ A;  4DOC A;  3WFR E;  1MN8 A;  4F3O A;  4FO1 A;  3M9M B;  3MFH A;  2F8L A;  5AKI A;  4IRK A;  4HX0 A;  1LV5 A;  1SL0 A;  3RJJ A;  5L9X A;  2DWQ A;  5DB9 A;  3IV6 A;  3UXP A;  1QSL A;  2W55 A;  4OJO A;  4JWN A;  4EED A;  5ALN A;  4QWD A;  3ONN A;  1L3S A;  2DQN B;  3FYH A;  2LKY A;  5EE3 A;  5DLG A;  4Q8F A;  3T5H A;  3T3F A;  2FMQ A;  2AQ0 A;  3TKA A;  1L5U A;  5J0R A;  1S0O A;  5J2I A;  4EBC A;  4KLH A;  1ZQE A;  8ICZ A;  2WAQ C;  1UCV A;  1XWL A;  3PW2 A;  1Y88 A;  5L1J A;  9ICX A;  3NVZ A;  3MDC A;  3OWG A;  9ICW A;  3GIL A;  3JPN A;  3RJK A;  1X9M A;  3PSP A;  3RR7 A;  1S0M A;  2W03 A;  1O08 A;  1D8B A;  4RWN A;  5KNI A;  4BXO B;  2NO5 A;  2J6U A;  5KFV A;  2HVI A;  4FH5 A;  3PSF A;  1ZQG A;  4Y2S A;  3Q8K A;  4UAZ A;  4UAW A;  3GV5 B;  4KMU A;  2JEJ A;  4WJ3 B;  1F5S A;  1B22 A;  4CDG A;  4K9A A;  1A6S A;  1SKR A;  2LYB A;  5H2F U;  4DO9 A;  1MQ3 A;  2B51 A;  2F44 A;  1UA0 A;  3ZI4 A;  2FLL A;  4J9Q A;  2DPI A;  7ICN A;  1ZJM A;  4MKP A;  4KLS A;  2FI1 A;  5B66 U;  4IQT A;  4AYB F;  3HT3 A;  1KKX A;  1VJ5 A;  1BPB A;  4I2D A;  2KEY A;  2ZIW B;  2AH5 A;  4IC9 A;  4QZ8 A;  3LWL A;  3UMC A;  2IHO A;  3MBY A;  1VJ7 A;  3ER8 C;  2NO4 A;  2A19 A;  4TUR A;  2D8C A;  4F4Z A;  4Q43 A;  4QIW C;  3H38 A;  9ICQ A;  5AI6 A;  5F3X B;  7ICQ A;  3TAD A;  3F2C A;  2H3Z A;  2YQE A;  5KG6 A;  2UVR A;  4OD0 A;  2OYY A;  2JZB A;  4NXV A;  5EOZ A;  2BCR A;  5CHE A;  2AQ4 A;  1MQ2 A;  5AK4 A;  2KKV A;  3UMG A;  2A1A A;  2CXY A;  2P6R A;  3LWM A;  2PMZ C;  4UB2 A;  2XY6 A;  4FZL A;  3OV7 A;  4Y2U A;  1LKY A;  1RYU A;  3HKZ C;  8ICG A;  2PXI A;  2MAX A;  4EEY A;  2Y1I A;  5KFB A;  4WOY A;  3CRX A;  4FS2 A;  1IM4 A;  1A76 A;  3PW0 A;  1MA7 A;  1Q3V A;  1Q78 A;  4O3R A;  1ZRN A;  2BZF A;  4RPX A;  4KM5 A;  4B6J A;  3PZP A;  3IP4 B;  3RJH A;  4K4G A;  5G5G A;  5J2C A;  3GII A;  4RQ5 A;  4O3M A;  5DBB A;  2IBK A;  4YR2 A;  4NV0 A;  4BDP A;  2HHU A;  1JXL A;  2ZH3 A;  2JH7 A;  5DB7 A;  5KFZ A;  1CI4 A;  3I1Y A;  4OAI Z;  1KL9 A;  4NXX A;  4DSJ A;  4DWI A;  4OAG A;  3RH4 A;  1ZQA A;  2OM6 A;  1JXE A;  4O5C A;  3K75 D;  1TFR A;  4ED2 A;  1QTM A;  2ALZ A;  2EAM A;  3A0B U;  3H7I A;  4R65 A;  2KE7 A;  5J2B A;  1BPD A;  1XNS A;  1KQQ A;  5D63 A;  4Q44 A;  1NJZ A;  4R8U A;  5AKL A;  1JAL A;  2H3V A;  3RJE A;  2Y1J A;  1NK7 A;  4IR9 A;  1NO5 A;  5FP0 A;  4NXW A;  4I2I A;  1TVA A;  2G06 A;  4Z6C A;  3LYS A;  3QU9 A;  4PZN A;  1U48 A;  4F50 A;  4JB3 A;  1NK0 A;  2N1R A;  3WK7 A;  1KNY A;  4OO1 J;  1V85 A;  7ICK A;  5AM4 A;  1S9F A;  3LK9 A;  4PL1 A;  3Q8P B;  4YG2 A;  1MSW D;  1KLN A;  3H4D A;  4RZR A;  3N7P D;  4F93 B;  3PO4 A;  5KFR A;  3ZD8 A;  2KFN A;  2WF9 A;  1S5L U;  8ICY A;  4Q45 A;  3KFU F;  1TAM A;  2ZHB A;  5HC9 A;  4X0B A;  5JTI A;  1IIP A;  3JPP A;  1RG6 A;  3M9N B;  1BNO A;  4YMO A;  1ZD2 P;  1XSP A;  8ICE A;  3N28 A;  5DBA A;  4FHY A;  3UM9 A;  4R64 A;  2HCF A;  4J9M A;  3C2M A;  4KLQ A;  2W7P A;  3QUQ A;  2XGP A;  3SMV A;  2EH9 A;  3KKA A;  3OVA A;  1SWW A;  5IIJ A;  5J2D A;  1K5O A;  4CE6 A;  4ECW A;  2V9W A;  4ECR A;  4F92 B;  2JEF A;  4MEY A;  2M2U A;  3SI8 A;  3IRU A;  5KL1 B;  8ICI A;  4DF8 A;  2E1E A;  1ZQQ A;  1ZQW A;  5J0S A;  4FBU A;  3QYP A;  4OJL A;  2CN1 A;  3OSN A;  4AYB C;  3NTU A;  4RUC A;  4P4P A;  2OHF A;  4S3N A;  5ALR A;  5AK6 A;  2G09 A;  3H0L B;  5KFI A;  4F4W A;  2JH1 A;  5HHI A;  1HEK A;  2ZIX A;  1T3N A;  5IIN A;  9ICA A;  4RU9 A;  1XO1 A;  1RQN A;  1SKS A;  4QZH A;  4J9O A;  7ICV A;  3F2D A;  4O5E A;  3OVS A;  1ZQP A;  3TAQ A;  5AI5 A;  3Q8M A;  2LM1 A;  4I2B A;  2HHQ A;  4DQP A;  4Y2Q A;  1KSP A;  2IOH A;  1DK3 A;  2BHN A;  2KSO B;  3C28 A;  4DSK A;  4GXK A;  7ICO A;  2CPR A;  1L7O A;  4ECQ A; 
#chains in the Genus database with same CATH homology
 4F8R A;  3E2E A;  3NGD A;  5KTQ A;  2W8L A;  4DQQ A;  1TK0 A;  2NRZ A;  2P66 A;  5KFU A;  4FHW A;  1RYS A;  4M9L A;  4I2E A;  4GXJ A;  2M9N A;  5KFA A;  3ORY A;  4GXI A;  3OGU A;  4C8L A;  3MR2 A;  4RNO A;  2IA6 A;  1SKW A;  4R63 A;  3EPI A;  1S77 D;  2AGP A;  4F4X A;  3SV4 A;  1UT8 A;  1TKD A;  1FA0 A;  9ICT A;  2C2E A;  5KG4 A;  5DB6 A;  3MGI A;  4RPY A;  3V7J A;  3JZ0 A;  4IG8 A;  3AQN A;  4DSL A;  1RPL A;  5CR0 A;  1BPZ A;  3RR8 A;  4F2R A;  4FBT A;  2HHW A;  2UVV A;  2ISP A;  3PMN A;  1X2I A;  4QWB A;  4O3P A;  5DDY A;  2XO7 A;  4F5R A;  1N48 A;  2DRA A;  4DOA A;  4ECU A;  3ZDC A;  7ICI A;  4KIT B;  1TAQ A;  5D49 A;  1TK8 A;  1NK9 A;  5HRB A;  1PZN A;  9ICR A;  4JV2 A;  2DR9 A;  5F2V O;  2BDP A;  4GC7 A;  1ZYQ A;  5IIO A;  4GC6 A;  3TAR A;  3V7K A;  2ZTD A;  2XCP A;  4KLT A;  3TFS A;  2AJQ A;  9ICU A;  4E80 A;  2AU0 A;  4RNN A;  2NRW A;  4O5K A;  1KEJ A;  2OWO A;  3RRH A;  2XCA A;  2FPM A;  4I2A A;  1ZQZ A;  4K4I A;  5DG7 A;  1A77 A;  9ICS A;  4QWA A;  5L1K A;  4KLG A;  4QZD A;  4I28 A;  4ECY A;  2VA8 A;  2VA3 A;  4DSE A;  3C66 A;  4TUS A;  1NJW A;  5III A;  4B9V A;  4B9T A;  4P2H A;  3H40 A;  1HJP A;  1KRP A;  5HRF A;  4QWE A;  3RBD A;  4UQG A;  5D4B A;  1MIV A;  2NRK A;  2ZH1 A;  5HRG A;  2ZH8 A;  4TQS A;  1ZQB A;  4R8U B;  3OUY A;  2ZH2 A;  5J0O A;  1UET A;  3FDS A;  2PFO A;  9ICM A;  5HRE A;  3C23 A;  1ZQF A;  1JAJ A;  3L9D A;  4YD1 A;  5KFO A;  4ED8 A;  3ZDA A;  4WC2 A;  5DBC A;  2HHS A;  4ECX A;  5J2E A;  7ICP A;  4EZ9 A;  4C8N A;  4UB1 A;  1S76 D;  3UQ2 A;  8ICJ A;  3C18 A;  4YD2 A;  3HW8 A;  5KFN A;  2MUT A;  4EYH B;  1R89 A;  3ZD9 A;  4F2S A;  2ZH4 A;  1D8Y A;  3M9O B;  2ZJA A;  2F1H A;  1JIH A;  4UAY A;  3WFP A;  2V4Q A;  3UPS A;  4XUS A;  3H8W A;  3AQL A;  5KT5 A;  4M04 A;  4X4V A;  2XGQ A;  5KFM A;  4QZF A;  3THV A;  1T8E A;  1NKB A;  1TV9 A;  4C8K A;  4RQ3 A;  2ASL A;  9ICI A;  2FPK A;  5J0Y A;  4UD4 A;  4ATB B;  4XQ7 A;  5KFD A;  1BPY A;  1RYR A;  2R8I A;  4I2J A;  3BQ1 A;  4QZC A;  1PX5 A;  4RQ0 A;  3PV8 A;  2O5A A;  2O1P A;  4KLD A;  5D46 A;  4CCH A;  7ICF A;  4AT8 A;  4ELT A;  9ICV A;  2DRB A;  5DGB A;  2F1I A;  2H5X A;  4O3Q A;  4QW9 A;  1T7P A;  2W9C A;  2ZH7 A;  3MR3 A;  4RPZ A;  4YR0 A;  4J9R A;  2ZH9 A;  3PVX A;  2VA2 A;  5DG8 A;  5DED A;  2W8K A;  3KHR A;  5J0P A;  4AT9 B;  5J2F A;  3V7L A;  2IHN A;  4TUQ A;  3B0Y A;  4DOC A;  8ICF A;  3WFR E;  2JZB B;  4MEX A;  1BNP A;  4F3O A;  5CJ7 A;  5KG7 A;  3IHQ B;  4PGX A;  3H37 A;  5CP2 A;  4RUA A;  1S10 A;  3M9M B;  4ECT A;  1NZP A;  3MFH A;  4ECQ A;  4IRK A;  3RRG A;  1YLQ A;  1LV5 A;  1SL0 A;  5IIK A;  3ISD A;  3RJJ A;  3EPG A;  1BPX A;  4B9L A;  5L9X A;  5DB9 A;  4DQR A;  3H3A A;  4YR3 A;  2C22 A;  1ZQX A;  1ZQC A;  4M6W A;  1ZQN A;  1SZP A;  4I29 A;  1NOM A;  5KFP A;  4NKT A;  1UEV A;  4FO6 A;  5KFX A;  2NRT A;  3UXP A;  1SL1 A;  3BQT A;  1QSL A;  4DFK A;  3PW7 A;  4JWN A;  1ARO P;  3C1Y A;  4J9P A;  1U49 A;  3T5L A;  2ZHA A;  2HVH A;  4BGD A;  4QWD A;  2BCU A;  1L3S A;  3FYH A;  2VAN A;  5DLG A;  5J0T A;  7ICL A;  4WC6 A;  2DR7 A;  4DSI A;  4Q8F A;  3T5H A;  3T3F A;  4M9N A;  1ZQO A;  1Q79 A;  4X4Q A;  4DSF A;  2FMQ A;  4X4U A;  2AQ0 A;  4M9G A;  2BGW A;  4QZ9 A;  5DQI A;  1L5U A;  5J0R A;  1S0O A;  4RQ2 A;  3EYZ A;  3HPO A;  3BJY A;  3LDA A;  5J2I A;  4GLX A;  4EBC A;  5BOL A;  4Z6E A;  1JMS A;  4FS1 A;  3V6J A;  2A1J B;  1HUZ A;  3HX0 A;  4KLH A;  4IQV A;  1KFD A;  1ZQE A;  2BQR A;  3JPT A;  4J9S A;  4B9S A;  5HHH A;  4I27 A;  4NLZ A;  8ICZ A;  3RB3 A;  4MF2 A;  1XWL A;  3H39 A;  5DEC A;  4NLN A;  3PO5 A;  3PW2 A;  1Y88 A;  3PX0 A;  4EZ6 A;  5L1J A;  4O3S A;  9ICX A;  4AT8 B;  3MDC A;  4M5D A;  3RB4 A;  5CWR A;  3WFO A;  3C21 A;  1XS9 D;  9ICW A;  3GIL A;  1U9L A;  4C8M A;  4UBC A;  3JPN A;  1S0N A;  1X9M A;  4JV0 A;  2BCS A;  4ED6 A;  1D9F A;  3RJK A;  3PR4 A;  2RFF A;  2AGO A;  2W9B A;  3RR7 A;  1XC9 A;  8ICQ A;  3SV3 A;  3C1Z A;  4F5Q A;  1Z00 B;  1S0M A;  1KDH A;  4BXO B;  8ICS A;  5HRD A;  4RWN A;  1WOT A;  2J6U A;  5KFV A;  2HVI A;  4FH5 A;  3GIJ A;  4XQ8 A;  4RQ6 A;  2HW3 A;  1ZQG A;  3MDA A;  1OU5 A;  1TFY A;  9ICK A;  3Q8K A;  1ZET A;  5EWG A;  4UAZ A;  3AUO A;  1S97 A;  3RAX A;  1V9P A;  1TAU A;  4UAW A;  4QZG A;  3HWT A;  4DLG A;  1NK5 A;  3PY8 A;  4I2C A;  3GV5 B;  9ICL A;  2BCV A;  4KMU A;  3JPQ A;  2JEJ A;  2R8G A;  2IHM A;  2PI5 A;  4UB5 A;  4BXO A;  5HRH A;  3AQM A;  4NM2 A;  1B22 A;  1R8B A;  2ZH6 A;  4DS5 A;  1SKR A;  5IIL A;  4DO9 A;  1MQ3 A;  4FHP A;  1UA0 A;  1ZQT A;  4YN4 A;  2FLL A;  4J9Q A;  7ICJ A;  4YXM A;  8ICN A;  4WC1 A;  2PFN A;  3TAN A;  1NKE A;  2DPI A;  4KLE A;  5KG2 A;  3EZ5 A;  7ICN A;  1ZJM A;  4MFF A;  8ICA A;  2J6S A;  2AGQ A;  3B0X A;  5J2G A;  1U4B A;  3OJU A;  2RDJ A;  4BWM A;  1ZQV A;  4ED7 A;  2FPL A;  4KLS A;  4X4T A;  2M2W A;  4QW8 A;  4RWQ A;  4RQ4 A;  3OHA A;  2KP7 A;  4IQT A;  9ICF A;  3ZDE A;  5KT2 A;  3HT3 A;  3SZ2 A;  4MFC A;  4AT7 A;  3OSP A;  4QZA A;  3OVB A;  1BPB A;  4I2D A;  4M9J A;  4BWJ A;  4EBJ A;  4KLU A;  5KFT A;  1N56 A;  9ICP A;  2DR8 A;  3AU6 A;  1S0V A;  1UT5 A;  4QZ8 A;  3KHG A;  3LWL A;  4Z6D A;  4MF8 A;  3KHL A;  5IIM A;  7ICT A;  3MBY A;  4C8O A;  4JV1 A;  3C2K A;  3PW5 A;  4IR1 A;  1VJ7 A;  5HML A;  3Q8L A;  4TUR A;  4PHA A;  4DQI A;  1UEU A;  5J0W A;  4YCX A;  3OJS A;  2R8H A;  4Q43 A;  4F4Z A;  2R8K A;  3SYZ A;  4KLL A;  2HHV A;  9ICB A;  9ICQ A;  4KLI A;  3V72 A;  2M2V A;  1D8L A;  1K1S A;  5KG3 A;  4G3I A;  7ICQ A;  4XA5 A;  1DK2 A;  5KFC A;  2PI4 A;  2MUT B;  5HP4 A;  4JUZ A;  2BQU A;  4E0D A;  4PGQ A;  5J0X A;  1NKC A;  4FHV A;  5KG6 A;  4WCW A;  4DF4 A;  2UVR A;  3HIY A;  2BE3 A;  2HHP A;  2JZB A;  8ICT A;  4P4M A;  2DFL A;  4IQW A;  3TFR A;  4NXZ A;  3EWA A;  5EOZ A;  4DL5 A;  3C5F A;  2I9G A;  1RXV A;  2FLN A;  9ICG A;  2BCR A;  4LZD A;  3ZDB A;  2ASJ A;  4O3N A;  4Q8E A;  2AQ4 A;  1MQ2 A;  3M8R A;  4F5O A;  1ZQL A;  4KTQ A;  1QLN A;  4E7X A;  2V4R A;  4ECV A;  1RXW A;  4YMN A;  4FH3 A;  2P6R A;  5KFF A;  2FLP A;  3K4G A;  4O0I A;  3LWM A;  4YMM A;  2HHT A;  5HRI A;  4FHX A;  3M8S A;  3GQC A;  3LQC B;  4WC3 A;  4UB2 A;  2XY6 A;  3OV7 A;  5DDM A;  4DOB A;  8ICK A;  3JYY A;  7ICE A;  4PGY A;  4ZH4 A;  8ICG A;  2PXI A;  2HHX A;  2MAX A;  4RQ8 A;  4EEY A;  5DQG A;  1HUO A;  2KTQ A;  4J9L A;  4ELU A;  4NLG A;  2RDI A;  4DFP A;  1KTQ A;  2Y1I A;  5JUM A;  5KFB A;  4KLM A;  5HNK A;  4DL4 A;  1ZQS A;  3RH6 A;  4FS2 A;  5DG9 A;  3PW4 A;  2BPG A;  8ICO A;  1A76 A;  1IM4 A;  3PW0 A;  2KZM A;  5HR9 A;  1F5A A;  4RQ1 A;  1D9D A;  3H38 A;  4NKU A;  1X9W A;  4F5P A;  4ELV A;  3BQ0 A;  2KFZ A;  1U47 A;  4DEZ A;  4M0A A;  2I1Q A;  1Q78 A;  2BR0 A;  4O3R A;  3NYB A;  3N4M B;  3GV8 B;  8ICC A;  9ICJ A;  2ZUB A;  3RJG A;  4ED3 A;  4RPX A;  2BKE A;  4B9N A;  2UVW A;  1XSN A;  3RJH A;  4K4G A;  8ICV A;  3KTQ A;  3RBE A;  4NM1 A;  1NJY A;  5J2C A;  3GII A;  4RQ5 A;  8ICU A;  5DBB A;  3HJ1 A;  2IBK A;  4YR2 A;  4BDP A;  2B21 A;  4KN4 A;  3PR5 B;  2HHU A;  3MGH A;  4R66 A;  4M2Y A;  3UXN A;  9ICE A;  1JXL A;  3OUY B;  2ZJ8 A;  3RB0 A;  4KLF A;  4X4R A;  1V4A A;  2KZZ A;  2ZH3 A;  4EYI B;  7ICS A;  5DB7 A;  9ICC A;  3JPO A;  2P6U A;  4ECZ A;  1H38 A;  5KFZ A;  4YXJ A;  4QZI A;  4DL7 A;  5EWF A;  4PH5 A;  3PNC A;  4KLJ A;  5J2K A;  1CEZ A;  1TK5 A;  4I2G A;  5F9N A;  1C7Y A;  2DPJ A;  2FMS A;  8ICH A;  4IQU A;  2PFQ A;  4DSJ A;  4DWI A;  3ISC A;  4X4P A;  3RH4 A;  2BCQ A;  1VFG A;  1ZQA A;  7ICM A;  1JX4 A;  3PX4 A;  4RQ7 A;  4JWM A;  1NK4 A;  8ICB A;  1JXE A;  5KFW A;  3RJF A;  2ZUD A;  4DFM A;  2ATL A;  4O5C A;  8ICW A;  4WC7 A;  1NK6 A;  3K75 D;  1WCL A;  2BPC A;  1TFR A;  4RNM A;  4KN7 A;  4ED2 A;  1KFT A;  1DOQ A;  2XY5 A;  4F5N A;  1QTM A;  4WBY A;  2ALZ A;  4PHD A;  7ICR A;  3IM1 A;  3H7I A;  4R65 A;  4O9M A;  4DFJ A;  4TQR A;  4DL3 A;  4AT9 A;  5DQH A;  3C2L A;  1ZQY A;  5J2B A;  1BPD A;  1L3T A;  1MC8 A;  4DQS A;  4Q44 A;  3GV7 B;  1NJZ A;  5TZV A;  5J0U A;  1CUK A;  4R8U A;  4DLE A;  4YQW A;  4TUP A;  2ID1 A;  1R8C A;  1DGS A;  4JK1 A;  5J2J A;  5F9L A;  3RJE A;  4ED1 A;  3V6H A;  4RT3 A;  3QEB Z;  1COO A;  3BDP A;  4HYK A;  2Y1J A;  5HRK A;  2ZUC A;  5KFH A;  2BQ3 A;  1NK7 A;  2ISO A;  1QSS A;  4IR9 A;  4LVS A;  3RH5 A;  9ICH A;  2J6T A;  1NO5 A;  1SL2 A;  3BQ2 A;  5L1L A;  4XRH A;  4PHE A;  2A1J A;  4RWO A;  1ZQH A;  4I2I A;  1TVA A;  1ZQJ A;  8ICP A;  5CHG A;  1R8A A;  3Q8S B;  3GIM A;  2IMW P;  3TQ1 A;  3UPQ A;  4EBE A;  2XY7 A;  4QZB A;  4Z6C A;  5J2A A;  1NK8 A;  4EP7 A;  4X4N A;  4X0A A;  1XU4 A;  3QE9 Y;  1U48 A;  4F50 A;  2WTF A;  1NK0 A;  4QWC A;  3TAP A;  4PPX A;  5J29 A;  1ZQD A;  1KNY A;  3HJ4 A;  1XSL A;  9ICO A;  5KFY A;  1ZQU A;  4F4Y A;  2ASD A;  2ZH5 A;  2DR5 A;  1EXN A;  1LB2 B;  1IXR A;  2W9M A;  4LZG A;  7ICK A;  1S9F A;  5CB1 A;  5KG0 A;  3LK9 A;  3G6V A;  3Q8P B;  3MAB A;  4YG2 A;  3PX6 A;  3TI0 A;  1MSW D;  4RT2 A;  1KLN A;  3H4D A;  3H4B A;  3C5G A;  3PML A;  5J2H A;  2NRV A;  9ICN A;  5CA7 A;  4RZR A;  4F93 B;  3PO4 A;  1JN3 A;  4I2F A;  4WBZ A;  5KFR A;  3ZD8 A;  3Q8R B;  2KFN A;  3H8J A;  4YFK A;  4Q45 A;  4B9M A;  8ICY A;  1BGX T;  5KFL A;  1KFS A;  2ZHB A;  5HC9 A;  4DL2 A;  4B9U A;  4Z6F A;  5J0Q A;  8ICR A;  5KT4 A;  4X0B A;  5BPC A;  2FMP A;  1ZQR A;  3QZ7 A;  4M6W B;  4O3O A;  3JPP A;  3M9N B;  5DKW A;  2NRX A;  4MFA A;  3T5J A;  7ICH A;  1BNO A;  4WC0 A;  4QZE A;  4YMO A;  4ECS A;  5DLF A;  1XSP A;  3KHH A;  8ICE A;  4YP3 A;  3MFI A;  3G6X A;  1Z3E B;  4WC4 A;  5DBA A;  1Z00 A;  4F91 B;  2PBE A;  4FHY A;  3ETL A;  4UBB A;  4R64 A;  2Q66 A;  3G6Y A;  4ATB A;  2R8J A;  4J9M A;  1ZQI A;  3C2M A;  3QZ8 A;  4ED0 A;  1UA1 A;  4KLQ A;  4RWP A;  4J9N A;  2XGP A;  2ZTC A;  3MR6 A;  1QSY A;  3JPR A;  3MR5 A;  3OVA A;  3GFK B;  4NLK A;  5IIJ A;  5J2D A;  5BOM A;  2C2D A;  5KT6 A;  1RZT A;  1K1Q A;  2JEG A;  1MIW A;  4E8F A;  5KT3 A;  5L1I A;  3N97 B;  4ECW A;  3GDX A;  2V9W A;  2DVI A;  1BVS A;  4ECR A;  4F92 B;  2C28 A;  2F1J A;  4YVZ A;  3JPS A;  8ICX A;  4K4H A;  5KFQ A;  4UB3 A;  2W9A A;  4MEY A;  2JEF A;  2M2U A;  3SI8 A;  4EBD A;  8ICI A;  4DF8 A;  3OHB A;  1ZQQ A;  4J9K A;  1ZQW A;  5J0S A;  4FBU A;  1BPE A;  7ICU A;  3WFQ E;  3OSN A;  8ICM A;  3H8S A;  3NTU A;  4NY8 A;  4PHP A;  4RUC A;  4P4P A;  2W9B B;  3ZDD A;  1B43 A;  1ZQK A;  2XC9 A;  4UB4 A;  4S3N A;  4X4S A;  5KFJ A;  4KLO A;  3WFS C;  5DB8 A;  2Q0Z X;  4X5V A;  3RTV A;  7ICG A;  2C2R A;  5KFG A;  5KFI A;  4F4W A;  3UQ0 A;  1L3U A;  4EBK A;  5HHI A;  4LT6 A;  1T3N A;  1WCN A;  5IIN A;  3ISB A;  5EWE A;  3T5K A;  5DGA A;  1NJX A;  1TFW A;  4DL6 A;  9ICA A;  4RU9 A;  3Q8Q B;  3GIK A;  1XO1 A;  5KT7 A;  3AQK A;  5KFK A;  3RAQ A;  1SKS A;  2JEI A;  4QZH A;  4J9O A;  4P4O A;  2ZTE A;  1ZJN A;  2W9C B;  4M47 A;  7ICV A;  3AU2 A;  4F4K A;  4O5E A;  4UD5 A;  4X4O A;  3HP6 A;  2PFP A;  3RJI A;  3OVS A;  1ZQP A;  2BPF A;  3RB6 A;  3TAQ A;  2ZJ5 A;  8ICL A;  4WC5 A;  1JQR A;  4IRC A;  3Q8M A;  2LYH A;  4M9H A;  4I2B A;  2HHQ A;  2M2T A;  4DQP A;  1X9S A;  3V6K A;  1KSP A;  5KG1 A;  4IRD A;  2KN7 A;  2GWS A;  1DK3 A;  1U45 A;  2BHN A;  4DS4 A;  5KG5 A;  1L3V A;  1T4G A;  4AT7 B;  5HMM A;  2KZ3 A;  3EW9 A;  4GXK A;  4DSK A;  4I2H A;  7ICO A;  1ZQM A;  3QEA Z;  5HRL A;  3UXO A;  1MIY A;  5KFS A;  5C5J A;  2UVU A;  5KFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...