5HRDA

The crystal structure of asfvpolx:dna2 binary complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
176
Chain Sequence
GGMLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta-like protein
publication title The crystal structure of Se-AsfvPolX(L52/163M mutant) in complex with 1nt-gap DNA1
rcsb
source organism African swine fever virus
total genus 47
structure length 176
sequence length 176
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5hrdA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5hrdA01
5IIKA 5J0OA 2ZH6A 3AU2A 9ICWA 1BPXA 9ICIA 4MFAA 5HRIA 4O5CA 2ID1A 4M9JA 2DR7A 1ZQOA 3OUYB 4X4PA 4PGYA 4UB3A 1MIVA 3RJKA 3V7LA 4UB4A 4I2HA 8ICKA 9ICEA 4MF8A 1HUZA 9ICLA 2DVIA 4KLJA 3AQNA 4WC6A 1MQ3A 5DB7A 3OV7A 4PHAA 4R64A 5BOLA 5J0YA 1OU5A 7ICMA 4M2YA 4O5KA 2DR9A 1NO5A 4I2AA 3AU6A 4F5QA 4RWQA 4WC3A 3RJJA 3AQKA 1JQRA 3C2MA 3HIYA 4TUQA 3K75D 4RWNA 1ZJNA 5F2VO 1ZQRA 4UAYA 5DECA 4AT7A 2P66A 3B0YA 4RWOA 3WFOA 1BPEA 1XSLA 4I2DA 3V7JA 4QZCA 2NRKA 4M0AA 4M9LA 1RZTA 3JYYA 4P4PA 1Q79A 4M47A 7ICUA 1JAJA 2Q66A 3TFSA 4WC2A 1TFYA 1ZQIA 3UPSA 3V72A 5HHHA 4WC1A 3RH5A 4XQ8A 1V4AA 1ZQUA 2DRBA 4IQWA 3RJFA 1ZJMA 9ICBA 2ZH8A 4PH5A 4WC0A 4DOBA 4IQVA 1JMSA 1ZQWA 1ZQEA 4EBJA 2ZHAA 1WOTA 2M2UA 4KLQA 2ISPA 4RQ2A 5J2BA 4RPYA 5DBCA 3V7KA 5D4BA 5HRKA 4TURA 3MDAA 4K4IA 2O5AA 5J0PA 9ICPA 2W9MA 3MBYA 2ZHBA 4M04A 2ZH9A 2BPGA 9ICJA 5TZVA 4M5DA 1XSPA 3AQLA 3C18A 4XRHA 4P4OA 3ISDA 1NOMA 2GWSA 9ICVA 5DBAA 5J0XA 1BPZA 5DEDA 4QZAA 1FA0A 4MFFA 4I2BA 1MIWA 5HR9A 1ZQBA 4MF2A 7ICTA 4WC7A 3JPNA 3C2LA 5HREA 5J2FA 1R89A 1ZQNA 1VFGA 4KLEA 4UD5A 3OVBA 3PMNA 4XUSA 3RJGA 4WBYA 4NM2A 9ICRA 4NM1A 7ICOA 3JPSA 5IINA 4X4OA 4KLUA 3AQMA 4F5NA 2DR8A 9ICCA 5DB9A 4UB1A 2PXIA 5J0RA 4PHPA 2HHPA 2PFQA 4PGXA 4AT9A 4QZEA 3JPQA 8ICWA 1ZQKA 3OGUA 5CA7A 1ZQPA 1BPYA 5CB1A 3H3AA 1ZQLA 2PFOA 4PPXA 8ICJA 4QZHA 2PFPA 4LVSA 8ICAA 3RJEA 7ICEA 3WFRE 3HX0A 3UXNA 3H39A 3PNCA 4DOCA 4Z6FA 8ICIA 4WC4A 4XQ7A 4KLOA 8ICGA 4IQUA 4YD2A 3GDXA 4I29A 4UD4A 8ICMA 4FHPA 2RFFA 2ZH4A 2BE3A 2M2VA 3HW8A 3UQ2A 5HRLA 4GXJA 3RH6A 7ICFA 1TVAA 1ZQTA 3C5GA 1ZQJA 8ICLA 5IIOA 2M2TA 5J2GA 1ZQAA 5J2DA 4PGQA 4WBZA 4NKTA 5HRGA 3B0XA 1TFWA 4X4VA 4LZDA 4R66A 1ZQMA 4KLIA 4M9HA 4QZGA 9ICMA 3AUOA 3RJHA 4AT7B 5J0SA 4P2HA 4QZIA 4I2CA 4IQTA 1KDHA 4XA5A 4GXIA 4QZFA 5IILA 8ICUA 5DB6A 7ICHA 3C5FA 1BPBA 4YN4A 5DB8A 4R63A 2ISOA 4QZDA 2BCRA 1F5AA 4UAWA 9ICSA 5BPCA 2ZH5A 5DDMA 4IG8A 3MGHA 4NXZA 4X4UA 4RWPA 1ZQXA 4EP7A 4QZ9A 4Z6CA 3ISBA 4F5OA 2ZH1A 4KLMA 4X0BA 4LZGA 4TUSA 4ATBA 9ICHA 1VJ7A 1ZQGA 4JWMA 4X4QA 2O1PA 7ICQA 4KLSA 3MDCA 2BCUA 3JPPA 7ICLA 3L9DA 4AT8A 5J0QA 5CHGA 1R8BA 1ZQYA 4KLLA 8ICNA 9ICNA 1KEJA 5HRHA 5CJ7A 4UBBA 1YLQA 2FMSA 5J0TA 4KLDA 4M9NA 4X4NA 4Z6EA 4F5PA 4KLTA 4X4SA 4UBCA 9ICKA 5HRDA 1ZQHA 9ICFA 4TUPA 1R8CA 4DO9A 8ICTA 3HWTA 3LK9A 1ZQCA 5HRFA 8ICQA 5DBBA 8ICPA 3RJIA 4M9GA 4RQ6A 1MQ2A 9ICXA 4RQ8A 1TV9A 4FHYA 4WC5A 4F5RA 4PHEA 5HC9A 4I27A 5IIMA 7ICVA 4UB5A 4RQ7A 3NYBA 4RPZA 4I2EA 5DKWA 4FHXA 4E7XA 3OUYA 5J2CA 9ICQA 4FH5A 4NLNA 3H38A 3C66A 4AT9B 2BPFA 4RQ1A 1UEUA 8ICHA 7ICJA 4RPXA 4RQ3A 4RQ4A 4I28A 7ICNA 2ZH7A 4YD1A 7ICSA 3JPRA 2ZH3A 3OVAA 4S3NA 4NKUA 5J2KA 4P4MA 4E8FA 9ICUA 7ICPA 8ICOA 4O5EA 5HRBA 3UPQA 2BCQA 3UXPA 4UB2A 2M2WA 5J2JA 8ICSA 8ICBA 1ZQZA 4I2IA 7ICRA 3PMLA 4FHWA 3LQCB 1UEVA 4YCXA 3OVSA 4KLFA 5J2AA 4FHVA 7ICGA 7ICIA 2IHMA 8ICZA 2FMQA 1KNYA 2PBEA 2I9GA 4K4HA 1ZQSA 2ZH2A 3RH4A 4JWNA 2BCVA 4RT2A 4NY8A 4WCWA 2BCSA 4PHDA 4FO6A 1XSNA 3WFQE 1BPDA 4X4RA 3ISCA 5IIJA 5CR0A 4QZ8A 2PFNA 9ICTA 4R65A 1R8AA 4MFCA 3WFSC 4GXKA 4LT6A 8ICXA 5CP2A 4RT3A 3JZ0A 4KLGA 5J2HA 3UQ0A 1Q78A 4E80A 8ICYA 5DDYA 4KLHA 5EOZA 4FH3A 9ICOA 4Z6DA 4ATBB 5J0UA 4YMOA 3TFRA 4UAZA 4I2GA 4AT8B 4YMNA 8ICEA 5IIIA 3JPOA 3H37A 1HUOA 1ZQQA 8ICVA 9ICGA 1RPLA 4O9MA 5J2EA 4RQ5A 1ZQDA 7ICKA 5J29A 3C2KA 9ICAA 1ZQVA 4QZBA 1ZQFA 4X4TA 1UETA 3UXOA 4RQ0A 4NLKA 5D49A 2BPCA 5BOMA 8ICFA 4I2FA 4DOAA 4NLZA 3JPTA 1MIYA 5J2IA 1JN3A 5D46A 3MGIA 4EBKA 4YMMA 4I2JA 2DR5A 4K4GA 4X0AA 8ICRA 3HJ4A 3HJ1A 5J0WA 8ICCA 5HHIA 4X5VA 1PX5A 2VANA 2DRAA 2FMPA 3WFPA 5CWRA
chains in the Genus database with same CATH superfamily
5IIKA 5J0OA 2ZH6A 3AU2A 9ICWA 1BPXA 9ICIA 4MFAA 5HRIA 4O5CA 2ID1A 4M9JA 2DR7A 1ZQOA 3OUYB 4X4PA 4PGYA 4UB3A 1MIVA 3RJKA 3V7LA 4UB4A 4I2HA 8ICKA 9ICEA 4MF8A 1HUZA 9ICLA 4JLXA 2DVIA 4OAIZ 5CFUA 4KLJA 3AQNA 4WC6A 1MQ3A 5B3QA 5DB7A 3OV7A 4PHAA 4R64A 2HN1A 4OAHA 5BOLA 5J0YA 1OU5A 7ICMA 4M2YA 4O5KA 2DR9A 1NO5A 4I2AA 3AU6A 2B51A 4WQKA 4F5QA 4RWQA 4K8VA 3RJJA 3AQKA 4WC3A 1JQRA 3C2MA 3HIYA 4TUQA 3K75D 4RWNA 1ZJNA 5F2VO 1ZQRA 4UAYA 5DECA 4AT7A 2P66A 3B0YA 4JLZA 4RWOA 3WFOA 1BPEA 1XSLA 4I2DA 3V7JA 4NXWA 4QZCA 2NRKA 4I0UA 4M0AA 4M9LA 1RZTA 3JYYA 4P4PA 1Q79A 3OWGA 4M47A 7ICUA 1JAJA 4WQLA 2Q66A 3TFSA 4WC2A 1TFYA 1ZQIA 3UPSA 3V72A 5HHHA 4WC1A 3RH5A 4XQ8A 1V4AA 1ZQUA 2DRBA 4IQWA 3RJFA 1ZJMA 9ICBA 2ZH8A 4PH5A 4WC0A 4DOBA 4IQVA 1JMSA 1ZQWA 1ZQEA 4EBJA 3K7DA 2ZHAA 1WOTA 2M2UA 4KLQA 2ISPA 4RQ2A 2FCLA 5J2BA 4RPYA 5DBCA 3V7KA 5D4BA 5HRKA 4TURA 4O6AA 3MDAA 4K4IA 2O5AA 5J0PA 9ICPA 4EEBA 2W9MA 3MBYA 2ZHBA 4M04A 2ZH9A 2BPGA 9ICJA 5TZVA 4M5DA 1XSPA 3AQLA 3C18A 4XRHA 5CHEA 4P4OA 3ISDA 1NOMA 2GWSA 9ICVA 5D62A 5DBAA 5J0XA 1BPZA 5DEDA 4EEDA 4QZAA 1FA0A 4MFFA 4I2BA 1MIWA 5HR9A 4O67A 1ZQBA 4MF2A 7ICTA 4WC7A 3JPNA 3C2LA 5HREA 4HX0A 5J2FA 1R89A 1ZQNA 1VFGA 4KLEA 4UD5A 3OVBA 3PMNA 4XUSA 3RJGA 2EWRA 4WBYA 4NM2A 9ICRA 4NM1A 7ICOA 4K96A 3JPSA 5IINA 4X4OA 4KLUA 3AQMA 4F5NA 2DR8A 9ICCA 4XJEA 5DB9A 4UB1A 2PXIA 5J0RA 4PHPA 2HHPA 2PFQA 4PGXA 4AT9A 4QZEA 3JPQA 8ICWA 1ZQKA 3OGUA 5CA7A 1ZQPA 1BPYA 5CB1A 4LEYA 3H3AA 1ZQLA 2PFOA 4PPXA 8ICJA 4QZHA 2PFPA 4LVSA 8ICAA 3RJEA 7ICEA 3WFRE 3HX0A 3UXNA 3H39A 3PNCA 4DOCA 4Z6FA 8ICIA 4WC4A 4XQ7A 3NVOA 4KLOA 8ICGA 4IQUA 4N7RA 4YD2A 3GDXA 4I29A 4UD4A 8ICMA 4FHPA 2RFFA 2ZH4A 2BE3A 2M2VA 3HW8A 3UQ2A 5HRLA 4GXJA 3RH6A 7ICFA 1TVAA 1ZQTA 3C5GA 1ZQJA 8ICLA 5IIOA 2M2TA 5J2GA 1ZQAA 5J2DA 4PGQA 4WBZA 4NKTA 5HRGA 3B0XA 1TFWA 4X4VA 4LZDA 4R66A 1ZQMA 4KLIA 4M9HA 2IHOA 4QZGA 9ICMA 3NWIA 3AUOA 3RJHA 4AT7B 5J0SA 2BBJA 4P2HA 4QZIA 4I2CA 4KM5A 4IQTA 1KDHA 4XA5A 4GXIA 4QZFA 5IILA 8ICUA 5DB6A 7ICHA 3C5FA 5D61A 1BPBA 4YN4A 5DB8A 4R63A 2ISOA 4QZDA 2BCRA 1F5AA 4UAWA 9ICSA 5BPCA 2ZH5A 5DDMA 4IG8A 3MGHA 4NXZA 4X4UA 4RWPA 1ZQXA 3JCFA 4QZ9A 4EP7A 4Z6CA 3ISBA 4F5OA 2ZH1A 4LEVA 4KLMA 4X0BA 4LZGA 3ERCC 4TUSA 4ATBA 9ICHA 1VJ7A 1ZQGA 4JWMA 4X4QA 2O1PA 7ICQA 4KLSA 3MDCA 2BCUA 3JPPA 7ICLA 3L9DA 4FO1A 4LEWA 4AT8A 5J0QA 5CHGA 1R8BA 1ZQYA 4KLLA 8ICNA 2GA9D 9ICNA 1KEJA 5HRHA 4WH5A 5CJ7A 4UBBA 1YLQA 2FMSA 4K99A 4LEZA 5J0TA 4KLDA 4M9NA 4X4NA 4Z6EA 4F5PA 4KLTA 4X4SA 4UBCA 5B3PA 9ICKA 5HRDA 1ZQHA 9ICFA 4TUPA 1R8CA 4DO9A 8ICTA 3HWTA 3LK9A 1ZQCA 5HRFA 4K9BA 8ICQA 5DBBA 8ICPA 2GAFD 3RJIA 4M9GA 4RQ6A 1MQ2A 9ICXA 4RQ8A 1TV9A 4FHYA 4WC5A 4F5RA 4PHEA 5HC9A 4I27A 5IIMA 7ICVA 4KB6A 4UB5A 4RQ7A 3NYBA 4RPZA 4NXUA 4NXTA 4I2EA 5DKWA 4EV6A 4FHXA 4E7XA 3OUYA 5J2CA 3EF2A 9ICQA 4FH5A 3MCRA 4NLNA 3H38A 3C66A 4AT9B 2BPFA 4RQ1A 1UEUA 8ICHA 4NXVA 7ICJA 4RPXA 4RQ3A 4RQ4A 4I28A 7ICNA 2ZH7A 4YD1A 7ICSA 3JPRA 2ZH3A 4EGWA 3OVAA 4S3NA 4NKUA 5J2KA 4P4MA 4E8FA 9ICUA 7ICPA 8ICOA 4O5EA 5HRBA 3UPQA 2BCQA 3UXPA 4UB2A 2M2WA 5J2JA 8ICSA 8ICBA 1ZQZA 4I2IA 7ICRA 3PMLA 4FHWA 5CFTA 2B4VA 3LQCB 1UEVA 3NKUA 4YCXA 3OVSA 4KLFA 5J2AA 4OAFA 4FHVA 7ICGA 7ICIA 2IHMA 8ICZA 2FMQA 1KNYA 4OAGA 2PBEA 3ER8C 2I9GA 2HN2A 4K4HA 3ER9B 1ZQSA 2ZH2A 3RH4A 4JWNA 2BCVA 2BBHA 4RT2A 4NY8A 4WCWA 2BCSA 4PHDA 4FO6A 1XSNA 3WFQE 1BPDA 4X4RA 3ISCA 5IIJA 5CR0A 4QZ8A 2PFNA 2B56A 9ICTA 4R65A 1R8AA 4MFCA 3WFSC 4GXKA 4LT6A 8ICXA 3CK6A 5CP2A 4RT3A 3JZ0A 4KLGA 5J2HA 3UQ0A 1Q78A 4E80A 8ICYA 5DDYA 4KLHA 5EOZA 4FH3A 9ICOA 4Z6DA 4ATBB 5J0UA 4YMOA 4K97A 3TFRA 4UAZA 4I2GA 4AT8B 4K9AA 4YMNA 8ICEA 5IIIA 3JPOA 3H37A 1HUOA 1ZQQA 3PHZA 8ICVA 5JTGA 5CFSA 9ICGA 1RPLA 4O9MA 5J2EA 5D63A 4RQ5A 4K98A 1ZQDA 7ICKA 5J29A 3C2KA 9ICAA 4O69A 1ZQVA 4QZBA 1ZQFA 4X4TA 1UETA 3UXOA 4RQ0A 4NLKA 2IUBA 5D49A 4NXXA 2BPCA 5BOMA 8ICFA 4I2FA 4DOAA 4NLZA 3JPTA 1MIYA 5J2IA 1JN3A 5D46A 4MKPA 3MGIA 4EBKA 4YMMA 4WOYA 4I2JA 2DR5A 1GPJA 4K4GA 4X0AA 8ICRA 3HJ4A 3HJ1A 5J0WA 8ICCA 5HHIA 4X5VA 1PX5A 4O68A 2VANA 2DRAA 2FMPA 3WFPA 5CWRA
chains in the Genus database with same CATH topology
5IIKA 5J0OA 2ZH6A 3AU2A 9ICWA 1BPXA 9ICIA 4MFAA 5HRIA 4O5CA 2ID1A 4M9JA 2DR7A 1ZQOA 3OUYB 4X4PA 4PGYA 4UB3A 1MIVA 3RJKA 3V7LA 4UB4A 4I2HA 8ICKA 9ICEA 4MF8A 1HUZA 9ICLA 2DVIA 4KLJA 3AQNA 4WC6A 1MQ3A 5DB7A 3OV7A 4PHAA 4R64A 5BOLA 5J0YA 1OU5A 7ICMA 4M2YA 4O5KA 2DR9A 1NO5A 4I2AA 3AU6A 4F5QA 4RWQA 4WC3A 3RJJA 3AQKA 1JQRA 3C2MA 3HIYA 4TUQA 3K75D 4RWNA 1ZJNA 5F2VO 1ZQRA 4UAYA 5DECA 4AT7A 2P66A 3B0YA 4RWOA 3WFOA 1BPEA 1XSLA 4I2DA 3V7JA 4QZCA 2NRKA 4M0AA 4M9LA 1RZTA 3JYYA 4P4PA 1Q79A 4M47A 7ICUA 1JAJA 2Q66A 3TFSA 4WC2A 1TFYA 1ZQIA 3UPSA 3V72A 5HHHA 4WC1A 3RH5A 4XQ8A 1V4AA 1ZQUA 2DRBA 4IQWA 3RJFA 1ZJMA 9ICBA 2ZH8A 4PH5A 4WC0A 4DOBA 4IQVA 1JMSA 1ZQWA 1ZQEA 4EBJA 2ZHAA 1WOTA 2M2UA 4KLQA 2ISPA 4RQ2A 5J2BA 4RPYA 5DBCA 3V7KA 5D4BA 5HRKA 4TURA 3MDAA 4K4IA 2O5AA 5J0PA 9ICPA 2W9MA 3MBYA 2ZHBA 4M04A 2ZH9A 2BPGA 9ICJA 5TZVA 4M5DA 1XSPA 3AQLA 3C18A 4XRHA 4P4OA 3ISDA 1NOMA 2GWSA 9ICVA 5DBAA 5J0XA 1BPZA 5DEDA 4QZAA 1FA0A 4MFFA 4I2BA 1MIWA 5HR9A 1ZQBA 4MF2A 7ICTA 4WC7A 3JPNA 3C2LA 5HREA 5J2FA 1R89A 1ZQNA 1VFGA 4KLEA 4UD5A 3OVBA 3PMNA 4XUSA 3RJGA 4WBYA 4NM2A 9ICRA 4NM1A 7ICOA 3JPSA 5IINA 4X4OA 4KLUA 3AQMA 4F5NA 2DR8A 9ICCA 5DB9A 4UB1A 2PXIA 5J0RA 4PHPA 2HHPA 2PFQA 4PGXA 4AT9A 4QZEA 3JPQA 8ICWA 1ZQKA 3OGUA 5CA7A 1ZQPA 1BPYA 5CB1A 3H3AA 1ZQLA 2PFOA 4PPXA 8ICJA 4QZHA 2PFPA 4LVSA 8ICAA 3RJEA 7ICEA 3WFRE 3HX0A 3UXNA 3H39A 3PNCA 4DOCA 4Z6FA 8ICIA 4WC4A 4XQ7A 4KLOA 8ICGA 4IQUA 4YD2A 3GDXA 4I29A 4UD4A 8ICMA 4FHPA 2RFFA 2ZH4A 2BE3A 2M2VA 3HW8A 3UQ2A 5HRLA 4GXJA 3RH6A 7ICFA 1TVAA 1ZQTA 3C5GA 1ZQJA 8ICLA 5IIOA 2M2TA 5J2GA 1ZQAA 5J2DA 4PGQA 4WBZA 4NKTA 5HRGA 3B0XA 1TFWA 4X4VA 4LZDA 4R66A 1ZQMA 4KLIA 4M9HA 4QZGA 9ICMA 3AUOA 3RJHA 4AT7B 5J0SA 4P2HA 4QZIA 4I2CA 4IQTA 1KDHA 4XA5A 4GXIA 4QZFA 5IILA 8ICUA 5DB6A 7ICHA 3C5FA 1BPBA 4YN4A 5DB8A 4R63A 2ISOA 4QZDA 2BCRA 1F5AA 4UAWA 9ICSA 5BPCA 2ZH5A 5DDMA 4IG8A 3MGHA 4NXZA 4X4UA 4RWPA 1ZQXA 4EP7A 4QZ9A 4Z6CA 3ISBA 4F5OA 2ZH1A 4KLMA 4X0BA 4LZGA 4TUSA 4ATBA 9ICHA 1VJ7A 1ZQGA 4JWMA 4X4QA 2O1PA 7ICQA 4KLSA 3MDCA 2BCUA 3JPPA 7ICLA 3L9DA 4AT8A 5J0QA 5CHGA 1R8BA 1ZQYA 4KLLA 8ICNA 9ICNA 1KEJA 5HRHA 5CJ7A 4UBBA 1YLQA 2FMSA 5J0TA 4KLDA 4M9NA 4X4NA 4Z6EA 4F5PA 4KLTA 4X4SA 4UBCA 9ICKA 5HRDA 1ZQHA 9ICFA 4TUPA 1R8CA 4DO9A 8ICTA 3HWTA 3LK9A 1ZQCA 5HRFA 8ICQA 5DBBA 8ICPA 3RJIA 4M9GA 4RQ6A 1MQ2A 9ICXA 4RQ8A 1TV9A 4FHYA 4WC5A 4F5RA 4PHEA 5HC9A 4I27A 5IIMA 7ICVA 4UB5A 4RQ7A 3NYBA 4RPZA 4I2EA 5DKWA 4FHXA 4E7XA 3OUYA 5J2CA 9ICQA 4FH5A 4NLNA 3H38A 3C66A 4AT9B 2BPFA 4RQ1A 1UEUA 8ICHA 7ICJA 4RPXA 4RQ3A 4RQ4A 4I28A 7ICNA 2ZH7A 4YD1A 7ICSA 3JPRA 2ZH3A 3OVAA 4S3NA 4NKUA 5J2KA 4P4MA 4E8FA 9ICUA 7ICPA 8ICOA 4O5EA 5HRBA 3UPQA 2BCQA 3UXPA 4UB2A 2M2WA 5J2JA 8ICSA 8ICBA 1ZQZA 4I2IA 7ICRA 3PMLA 4FHWA 3LQCB 1UEVA 4YCXA 3OVSA 4KLFA 5J2AA 4FHVA 7ICGA 7ICIA 2IHMA 8ICZA 2FMQA 1KNYA 2PBEA 2I9GA 4K4HA 1ZQSA 2ZH2A 3RH4A 4JWNA 2BCVA 4RT2A 4NY8A 4WCWA 2BCSA 4PHDA 4FO6A 1XSNA 3WFQE 1BPDA 4X4RA 3ISCA 5IIJA 5CR0A 4QZ8A 2PFNA 9ICTA 4R65A 1R8AA 4MFCA 3WFSC 4GXKA 4LT6A 8ICXA 5CP2A 4RT3A 3JZ0A 4KLGA 5J2HA 3UQ0A 1Q78A 4E80A 8ICYA 5DDYA 4KLHA 5EOZA 4FH3A 9ICOA 4Z6DA 4ATBB 5J0UA 4YMOA 3TFRA 4UAZA 4I2GA 4AT8B 4YMNA 8ICEA 5IIIA 3JPOA 3H37A 1HUOA 1ZQQA 8ICVA 9ICGA 1RPLA 4O9MA 5J2EA 4RQ5A 1ZQDA 7ICKA 5J29A 3C2KA 9ICAA 1ZQVA 4QZBA 1ZQFA 4X4TA 1UETA 3UXOA 4RQ0A 4NLKA 5D49A 2BPCA 5BOMA 8ICFA 4I2FA 4DOAA 4NLZA 3JPTA 1MIYA 5J2IA 1JN3A 5D46A 3MGIA 4EBKA 4YMMA 4I2JA 2DR5A 4K4GA 4X0AA 8ICRA 3HJ4A 3HJ1A 5J0WA 8ICCA 5HHIA 4X5VA 1PX5A 2VANA 2DRAA 2FMPA 3WFPA 5CWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IIK A;  5J0O A;  2ZH6 A;  3AU2 A;  9ICW A;  1BPX A;  9ICI A;  4MFA A;  5HRI A;  4O5C A;  2ID1 A;  4M9J A;  2DR7 A;  1ZQO A;  3OUY B;  4X4P A;  4PGY A;  4UB3 A;  1MIV A;  3RJK A;  3V7L A;  4UB4 A;  4I2H A;  8ICK A;  9ICE A;  4MF8 A;  1HUZ A;  9ICL A;  2DVI A;  4KLJ A;  3AQN A;  4WC6 A;  1MQ3 A;  5DB7 A;  3OV7 A;  4PHA A;  4R64 A;  5BOL A;  5J0Y A;  1OU5 A;  7ICM A;  4M2Y A;  4O5K A;  2DR9 A;  1NO5 A;  4I2A A;  3AU6 A;  4F5Q A;  4RWQ A;  4WC3 A;  3RJJ A;  3AQK A;  1JQR A;  3C2M A;  3HIY A;  4TUQ A;  3K75 D;  4RWN A;  1ZJN A;  5F2V O;  1ZQR A;  4UAY A;  5DEC A;  4AT7 A;  2P66 A;  3B0Y A;  4RWO A;  3WFO A;  1BPE A;  1XSL A;  4I2D A;  3V7J A;  4QZC A;  2NRK A;  4M0A A;  4M9L A;  1RZT A;  3JYY A;  4P4P A;  1Q79 A;  4M47 A;  7ICU A;  1JAJ A;  2Q66 A;  3TFS A;  4WC2 A;  1TFY A;  1ZQI A;  3UPS A;  3V72 A;  5HHH A;  4WC1 A;  3RH5 A;  4XQ8 A;  1V4A A;  1ZQU A;  2DRB A;  4IQW A;  3RJF A;  1ZJM A;  9ICB A;  2ZH8 A;  4PH5 A;  4WC0 A;  4DOB A;  4IQV A;  1JMS A;  1ZQW A;  1ZQE A;  4EBJ A;  2ZHA A;  1WOT A;  2M2U A;  4KLQ A;  2ISP A;  4RQ2 A;  5J2B A;  4RPY A;  5DBC A;  3V7K A;  5D4B A;  5HRK A;  4TUR A;  3MDA A;  4K4I A;  2O5A A;  5J0P A;  9ICP A;  2W9M A;  3MBY A;  2ZHB A;  4M04 A;  2ZH9 A;  2BPG A;  9ICJ A;  5TZV A;  4M5D A;  1XSP A;  3AQL A;  3C18 A;  4XRH A;  4P4O A;  3ISD A;  1NOM A;  2GWS A;  9ICV A;  5DBA A;  5J0X A;  1BPZ A;  5DED A;  4QZA A;  1FA0 A;  4MFF A;  4I2B A;  1MIW A;  5HR9 A;  1ZQB A;  4MF2 A;  7ICT A;  4WC7 A;  3JPN A;  3C2L A;  5HRE A;  5J2F A;  1R89 A;  1ZQN A;  1VFG A;  4KLE A;  4UD5 A;  3OVB A;  3PMN A;  4XUS A;  3RJG A;  4WBY A;  4NM2 A;  9ICR A;  4NM1 A;  7ICO A;  3JPS A;  5IIN A;  4X4O A;  4KLU A;  3AQM A;  4F5N A;  2DR8 A;  9ICC A;  5DB9 A;  4UB1 A;  2PXI A;  5J0R A;  4PHP A;  2HHP A;  2PFQ A;  4PGX A;  4AT9 A;  4QZE A;  3JPQ A;  8ICW A;  1ZQK A;  3OGU A;  5CA7 A;  1ZQP A;  1BPY A;  5CB1 A;  3H3A A;  1ZQL A;  2PFO A;  4PPX A;  8ICJ A;  4QZH A;  2PFP A;  4LVS A;  8ICA A;  3RJE A;  7ICE A;  3WFR E;  3HX0 A;  3UXN A;  3H39 A;  3PNC A;  4DOC A;  4Z6F A;  8ICI A;  4WC4 A;  4XQ7 A;  4KLO A;  8ICG A;  4IQU A;  4YD2 A;  3GDX A;  4I29 A;  4UD4 A;  8ICM A;  4FHP A;  2RFF A;  2ZH4 A;  2BE3 A;  2M2V A;  3HW8 A;  3UQ2 A;  5HRL A;  4GXJ A;  3RH6 A;  7ICF A;  1TVA A;  1ZQT A;  3C5G A;  1ZQJ A;  8ICL A;  5IIO A;  2M2T A;  5J2G A;  1ZQA A;  5J2D A;  4PGQ A;  4WBZ A;  4NKT A;  5HRG A;  3B0X A;  1TFW A;  4X4V A;  4LZD A;  4R66 A;  1ZQM A;  4KLI A;  4M9H A;  4QZG A;  9ICM A;  3AUO A;  3RJH A;  4AT7 B;  5J0S A;  4P2H A;  4QZI A;  4I2C A;  4IQT A;  1KDH A;  4XA5 A;  4GXI A;  4QZF A;  5IIL A;  8ICU A;  5DB6 A;  7ICH A;  3C5F A;  1BPB A;  4YN4 A;  5DB8 A;  4R63 A;  2ISO A;  4QZD A;  2BCR A;  1F5A A;  4UAW A;  9ICS A;  5BPC A;  2ZH5 A;  5DDM A;  4IG8 A;  3MGH A;  4NXZ A;  4X4U A;  4RWP A;  1ZQX A;  4EP7 A;  4QZ9 A;  4Z6C A;  3ISB A;  4F5O A;  2ZH1 A;  4KLM A;  4X0B A;  4LZG A;  4TUS A;  4ATB A;  9ICH A;  1VJ7 A;  1ZQG A;  4JWM A;  4X4Q A;  2O1P A;  7ICQ A;  4KLS A;  3MDC A;  2BCU A;  3JPP A;  7ICL A;  3L9D A;  4AT8 A;  5J0Q A;  5CHG A;  1R8B A;  1ZQY A;  4KLL A;  8ICN A;  9ICN A;  1KEJ A;  5HRH A;  5CJ7 A;  4UBB A;  1YLQ A;  2FMS A;  5J0T A;  4KLD A;  4M9N A;  4X4N A;  4Z6E A;  4F5P A;  4KLT A;  4X4S A;  4UBC A;  9ICK A;  5HRD A;  1ZQH A;  9ICF A;  4TUP A;  1R8C A;  4DO9 A;  8ICT A;  3HWT A;  3LK9 A;  1ZQC A;  5HRF A;  8ICQ A;  5DBB A;  8ICP A;  3RJI A;  4M9G A;  4RQ6 A;  1MQ2 A;  9ICX A;  4RQ8 A;  1TV9 A;  4FHY A;  4WC5 A;  4F5R A;  4PHE A;  5HC9 A;  4I27 A;  5IIM A;  7ICV A;  4UB5 A;  4RQ7 A;  3NYB A;  4RPZ A;  4I2E A;  5DKW A;  4FHX A;  4E7X A;  3OUY A;  5J2C A;  9ICQ A;  4FH5 A;  4NLN A;  3H38 A;  3C66 A;  4AT9 B;  2BPF A;  4RQ1 A;  1UEU A;  8ICH A;  7ICJ A;  4RPX A;  4RQ3 A;  4RQ4 A;  4I28 A;  7ICN A;  2ZH7 A;  4YD1 A;  7ICS A;  3JPR A;  2ZH3 A;  3OVA A;  4S3N A;  4NKU A;  5J2K A;  4P4M A;  4E8F A;  9ICU A;  7ICP A;  8ICO A;  4O5E A;  5HRB A;  3UPQ A;  2BCQ A;  3UXP A;  4UB2 A;  2M2W A;  5J2J A;  8ICS A;  8ICB A;  1ZQZ A;  4I2I A;  7ICR A;  3PML A;  4FHW A;  3LQC B;  1UEV A;  4YCX A;  3OVS A;  4KLF A;  5J2A A;  4FHV A;  7ICG A;  7ICI A;  2IHM A;  8ICZ A;  2FMQ A;  1KNY A;  2PBE A;  2I9G A;  4K4H A;  1ZQS A;  2ZH2 A;  3RH4 A;  4JWN A;  2BCV A;  4RT2 A;  4NY8 A;  4WCW A;  2BCS A;  4PHD A;  4FO6 A;  1XSN A;  3WFQ E;  1BPD A;  4X4R A;  3ISC A;  5IIJ A;  5CR0 A;  4QZ8 A;  2PFN A;  9ICT A;  4R65 A;  1R8A A;  4MFC A;  3WFS C;  4GXK A;  4LT6 A;  8ICX A;  5CP2 A;  4RT3 A;  3JZ0 A;  4KLG A;  5J2H A;  3UQ0 A;  1Q78 A;  4E80 A;  8ICY A;  5DDY A;  4KLH A;  5EOZ A;  4FH3 A;  9ICO A;  4Z6D A;  4ATB B;  5J0U A;  4YMO A;  3TFR A;  4UAZ A;  4I2G A;  4AT8 B;  4YMN A;  8ICE A;  5III A;  3JPO A;  3H37 A;  1HUO A;  1ZQQ A;  8ICV A;  9ICG A;  1RPL A;  4O9M A;  5J2E A;  4RQ5 A;  1ZQD A;  7ICK A;  5J29 A;  3C2K A;  9ICA A;  1ZQV A;  4QZB A;  1ZQF A;  4X4T A;  1UET A;  3UXO A;  4RQ0 A;  4NLK A;  5D49 A;  2BPC A;  5BOM A;  8ICF A;  4I2F A;  4DOA A;  4NLZ A;  3JPT A;  1MIY A;  5J2I A;  1JN3 A;  5D46 A;  3MGI A;  4EBK A;  4YMM A;  4I2J A;  2DR5 A;  4K4G A;  4X0A A;  8ICR A;  3HJ4 A;  3HJ1 A;  5J0W A;  8ICC A;  5HHI A;  4X5V A;  1PX5 A;  2VAN A;  2DRA A;  2FMP A;  3WFP A;  5CWR A; 
#chains in the Genus database with same CATH topology
 5IIK A;  5J0O A;  2ZH6 A;  3AU2 A;  9ICW A;  1BPX A;  9ICI A;  4MFA A;  5HRI A;  4O5C A;  2ID1 A;  4M9J A;  2DR7 A;  1ZQO A;  3OUY B;  4X4P A;  4PGY A;  4UB3 A;  1MIV A;  3RJK A;  3V7L A;  4UB4 A;  4I2H A;  8ICK A;  9ICE A;  4MF8 A;  1HUZ A;  9ICL A;  4JLX A;  2DVI A;  4OAI Z;  5CFU A;  4KLJ A;  3AQN A;  4WC6 A;  1MQ3 A;  5B3Q A;  5DB7 A;  3OV7 A;  4PHA A;  4R64 A;  2HN1 A;  4OAH A;  5BOL A;  5J0Y A;  1OU5 A;  7ICM A;  4M2Y A;  4O5K A;  2DR9 A;  1NO5 A;  4I2A A;  3AU6 A;  2B51 A;  4WQK A;  4F5Q A;  4RWQ A;  4K8V A;  3RJJ A;  3AQK A;  4WC3 A;  1JQR A;  3C2M A;  3HIY A;  4TUQ A;  3K75 D;  4RWN A;  1ZJN A;  5F2V O;  1ZQR A;  4UAY A;  5DEC A;  4AT7 A;  2P66 A;  3B0Y A;  4JLZ A;  4RWO A;  3WFO A;  1BPE A;  1XSL A;  4I2D A;  3V7J A;  4NXW A;  4QZC A;  2NRK A;  4I0U A;  4M0A A;  4M9L A;  1RZT A;  3JYY A;  4P4P A;  1Q79 A;  3OWG A;  4M47 A;  7ICU A;  1JAJ A;  4WQL A;  2Q66 A;  3TFS A;  4WC2 A;  1TFY A;  1ZQI A;  3UPS A;  3V72 A;  5HHH A;  4WC1 A;  3RH5 A;  4XQ8 A;  1V4A A;  1ZQU A;  2DRB A;  4IQW A;  3RJF A;  1ZJM A;  9ICB A;  2ZH8 A;  4PH5 A;  4WC0 A;  4DOB A;  4IQV A;  1JMS A;  1ZQW A;  1ZQE A;  4EBJ A;  3K7D A;  2ZHA A;  1WOT A;  2M2U A;  4KLQ A;  2ISP A;  4RQ2 A;  2FCL A;  5J2B A;  4RPY A;  5DBC A;  3V7K A;  5D4B A;  5HRK A;  4TUR A;  4O6A A;  3MDA A;  4K4I A;  2O5A A;  5J0P A;  9ICP A;  4EEB A;  2W9M A;  3MBY A;  2ZHB A;  4M04 A;  2ZH9 A;  2BPG A;  9ICJ A;  5TZV A;  4M5D A;  1XSP A;  3AQL A;  3C18 A;  4XRH A;  5CHE A;  4P4O A;  3ISD A;  1NOM A;  2GWS A;  9ICV A;  5D62 A;  5DBA A;  5J0X A;  1BPZ A;  5DED A;  4EED A;  4QZA A;  1FA0 A;  4MFF A;  4I2B A;  1MIW A;  5HR9 A;  4O67 A;  1ZQB A;  4MF2 A;  7ICT A;  4WC7 A;  3JPN A;  3C2L A;  5HRE A;  4HX0 A;  5J2F A;  1R89 A;  1ZQN A;  1VFG A;  4KLE A;  4UD5 A;  3OVB A;  3PMN A;  4XUS A;  3RJG A;  2EWR A;  4WBY A;  4NM2 A;  9ICR A;  4NM1 A;  7ICO A;  4K96 A;  3JPS A;  5IIN A;  4X4O A;  4KLU A;  3AQM A;  4F5N A;  2DR8 A;  9ICC A;  4XJE A;  5DB9 A;  4UB1 A;  2PXI A;  5J0R A;  4PHP A;  2HHP A;  2PFQ A;  4PGX A;  4AT9 A;  4QZE A;  3JPQ A;  8ICW A;  1ZQK A;  3OGU A;  5CA7 A;  1ZQP A;  1BPY A;  5CB1 A;  4LEY A;  3H3A A;  1ZQL A;  2PFO A;  4PPX A;  8ICJ A;  4QZH A;  2PFP A;  4LVS A;  8ICA A;  3RJE A;  7ICE A;  3WFR E;  3HX0 A;  3UXN A;  3H39 A;  3PNC A;  4DOC A;  4Z6F A;  8ICI A;  4WC4 A;  4XQ7 A;  3NVO A;  4KLO A;  8ICG A;  4IQU A;  4N7R A;  4YD2 A;  3GDX A;  4I29 A;  4UD4 A;  8ICM A;  4FHP A;  2RFF A;  2ZH4 A;  2BE3 A;  2M2V A;  3HW8 A;  3UQ2 A;  5HRL A;  4GXJ A;  3RH6 A;  7ICF A;  1TVA A;  1ZQT A;  3C5G A;  1ZQJ A;  8ICL A;  5IIO A;  2M2T A;  5J2G A;  1ZQA A;  5J2D A;  4PGQ A;  4WBZ A;  4NKT A;  5HRG A;  3B0X A;  1TFW A;  4X4V A;  4LZD A;  4R66 A;  1ZQM A;  4KLI A;  4M9H A;  2IHO A;  4QZG A;  9ICM A;  3NWI A;  3AUO A;  3RJH A;  4AT7 B;  5J0S A;  2BBJ A;  4P2H A;  4QZI A;  4I2C A;  4KM5 A;  4IQT A;  1KDH A;  4XA5 A;  4GXI A;  4QZF A;  5IIL A;  8ICU A;  5DB6 A;  7ICH A;  3C5F A;  5D61 A;  1BPB A;  4YN4 A;  5DB8 A;  4R63 A;  2ISO A;  4QZD A;  2BCR A;  1F5A A;  4UAW A;  9ICS A;  5BPC A;  2ZH5 A;  5DDM A;  4IG8 A;  3MGH A;  4NXZ A;  4X4U A;  4RWP A;  1ZQX A;  3JCF A;  4QZ9 A;  4EP7 A;  4Z6C A;  3ISB A;  4F5O A;  2ZH1 A;  4LEV A;  4KLM A;  4X0B A;  4LZG A;  3ERC C;  4TUS A;  4ATB A;  9ICH A;  1VJ7 A;  1ZQG A;  4JWM A;  4X4Q A;  2O1P A;  7ICQ A;  4KLS A;  3MDC A;  2BCU A;  3JPP A;  7ICL A;  3L9D A;  4FO1 A;  4LEW A;  4AT8 A;  5J0Q A;  5CHG A;  1R8B A;  1ZQY A;  4KLL A;  8ICN A;  2GA9 D;  9ICN A;  1KEJ A;  5HRH A;  4WH5 A;  5CJ7 A;  4UBB A;  1YLQ A;  2FMS A;  4K99 A;  4LEZ A;  5J0T A;  4KLD A;  4M9N A;  4X4N A;  4Z6E A;  4F5P A;  4KLT A;  4X4S A;  4UBC A;  5B3P A;  9ICK A;  5HRD A;  1ZQH A;  9ICF A;  4TUP A;  1R8C A;  4DO9 A;  8ICT A;  3HWT A;  3LK9 A;  1ZQC A;  5HRF A;  4K9B A;  8ICQ A;  5DBB A;  8ICP A;  2GAF D;  3RJI A;  4M9G A;  4RQ6 A;  1MQ2 A;  9ICX A;  4RQ8 A;  1TV9 A;  4FHY A;  4WC5 A;  4F5R A;  4PHE A;  5HC9 A;  4I27 A;  5IIM A;  7ICV A;  4KB6 A;  4UB5 A;  4RQ7 A;  3NYB A;  4RPZ A;  4NXU A;  4NXT A;  4I2E A;  5DKW A;  4EV6 A;  4FHX A;  4E7X A;  3OUY A;  5J2C A;  3EF2 A;  9ICQ A;  4FH5 A;  3MCR A;  4NLN A;  3H38 A;  3C66 A;  4AT9 B;  2BPF A;  4RQ1 A;  1UEU A;  8ICH A;  4NXV A;  7ICJ A;  4RPX A;  4RQ3 A;  4RQ4 A;  4I28 A;  7ICN A;  2ZH7 A;  4YD1 A;  7ICS A;  3JPR A;  2ZH3 A;  4EGW A;  3OVA A;  4S3N A;  4NKU A;  5J2K A;  4P4M A;  4E8F A;  9ICU A;  7ICP A;  8ICO A;  4O5E A;  5HRB A;  3UPQ A;  2BCQ A;  3UXP A;  4UB2 A;  2M2W A;  5J2J A;  8ICS A;  8ICB A;  1ZQZ A;  4I2I A;  7ICR A;  3PML A;  4FHW A;  5CFT A;  2B4V A;  3LQC B;  1UEV A;  3NKU A;  4YCX A;  3OVS A;  4KLF A;  5J2A A;  4OAF A;  4FHV A;  7ICG A;  7ICI A;  2IHM A;  8ICZ A;  2FMQ A;  1KNY A;  4OAG A;  2PBE A;  3ER8 C;  2I9G A;  2HN2 A;  4K4H A;  3ER9 B;  1ZQS A;  2ZH2 A;  3RH4 A;  4JWN A;  2BCV A;  2BBH A;  4RT2 A;  4NY8 A;  4WCW A;  2BCS A;  4PHD A;  4FO6 A;  1XSN A;  3WFQ E;  1BPD A;  4X4R A;  3ISC A;  5IIJ A;  5CR0 A;  4QZ8 A;  2PFN A;  2B56 A;  9ICT A;  4R65 A;  1R8A A;  4MFC A;  3WFS C;  4GXK A;  4LT6 A;  8ICX A;  3CK6 A;  5CP2 A;  4RT3 A;  3JZ0 A;  4KLG A;  5J2H A;  3UQ0 A;  1Q78 A;  4E80 A;  8ICY A;  5DDY A;  4KLH A;  5EOZ A;  4FH3 A;  9ICO A;  4Z6D A;  4ATB B;  5J0U A;  4YMO A;  4K97 A;  3TFR A;  4UAZ A;  4I2G A;  4AT8 B;  4K9A A;  4YMN A;  8ICE A;  5III A;  3JPO A;  3H37 A;  1HUO A;  1ZQQ A;  3PHZ A;  8ICV A;  5JTG A;  5CFS A;  9ICG A;  1RPL A;  4O9M A;  5J2E A;  5D63 A;  4RQ5 A;  4K98 A;  1ZQD A;  7ICK A;  5J29 A;  3C2K A;  9ICA A;  4O69 A;  1ZQV A;  4QZB A;  1ZQF A;  4X4T A;  1UET A;  3UXO A;  4RQ0 A;  4NLK A;  2IUB A;  5D49 A;  4NXX A;  2BPC A;  5BOM A;  8ICF A;  4I2F A;  4DOA A;  4NLZ A;  3JPT A;  1MIY A;  5J2I A;  1JN3 A;  5D46 A;  4MKP A;  3MGI A;  4EBK A;  4YMM A;  4WOY A;  4I2J A;  2DR5 A;  1GPJ A;  4K4G A;  4X0A A;  8ICR A;  3HJ4 A;  3HJ1 A;  5J0W A;  8ICC A;  5HHI A;  4X5V A;  1PX5 A;  4O68 A;  2VAN A;  2DRA A;  2FMP A;  3WFP A;  5CWR A; 
#chains in the Genus database with same CATH homology
 5IIK A;  5J0O A;  2ZH6 A;  3AU2 A;  9ICW A;  1BPX A;  9ICI A;  4MFA A;  5HRI A;  4O5C A;  2ID1 A;  4M9J A;  2DR7 A;  1ZQO A;  3OUY B;  4X4P A;  4PGY A;  4UB3 A;  1MIV A;  3RJK A;  3V7L A;  4UB4 A;  4I2H A;  8ICK A;  9ICE A;  4MF8 A;  1HUZ A;  9ICL A;  2DVI A;  4KLJ A;  3AQN A;  4WC6 A;  1MQ3 A;  5DB7 A;  3OV7 A;  4PHA A;  4R64 A;  5BOL A;  5J0Y A;  1OU5 A;  7ICM A;  4M2Y A;  4O5K A;  2DR9 A;  1NO5 A;  4I2A A;  3AU6 A;  4F5Q A;  4RWQ A;  4WC3 A;  3RJJ A;  3AQK A;  1JQR A;  3C2M A;  3HIY A;  4TUQ A;  3K75 D;  4RWN A;  1ZJN A;  5F2V O;  1ZQR A;  4UAY A;  5DEC A;  4AT7 A;  2P66 A;  3B0Y A;  4RWO A;  3WFO A;  1BPE A;  1XSL A;  4I2D A;  3V7J A;  4QZC A;  2NRK A;  4M0A A;  4M9L A;  1RZT A;  3JYY A;  4P4P A;  1Q79 A;  4M47 A;  7ICU A;  1JAJ A;  2Q66 A;  3TFS A;  4WC2 A;  1TFY A;  1ZQI A;  3UPS A;  3V72 A;  5HHH A;  4WC1 A;  3RH5 A;  4XQ8 A;  1V4A A;  1ZQU A;  2DRB A;  4IQW A;  3RJF A;  1ZJM A;  9ICB A;  2ZH8 A;  4PH5 A;  4WC0 A;  4DOB A;  4IQV A;  1JMS A;  1ZQW A;  1ZQE A;  4EBJ A;  2ZHA A;  1WOT A;  2M2U A;  4KLQ A;  2ISP A;  4RQ2 A;  5J2B A;  4RPY A;  5DBC A;  3V7K A;  5D4B A;  5HRK A;  4TUR A;  3MDA A;  4K4I A;  2O5A A;  5J0P A;  9ICP A;  2W9M A;  3MBY A;  2ZHB A;  4M04 A;  2ZH9 A;  2BPG A;  9ICJ A;  5TZV A;  4M5D A;  1XSP A;  3AQL A;  3C18 A;  4XRH A;  4P4O A;  3ISD A;  1NOM A;  2GWS A;  9ICV A;  5DBA A;  5J0X A;  1BPZ A;  5DED A;  4QZA A;  1FA0 A;  4MFF A;  4I2B A;  1MIW A;  5HR9 A;  1ZQB A;  4MF2 A;  7ICT A;  4WC7 A;  3JPN A;  3C2L A;  5HRE A;  5J2F A;  1R89 A;  1ZQN A;  1VFG A;  4KLE A;  4UD5 A;  3OVB A;  3PMN A;  4XUS A;  3RJG A;  4WBY A;  4NM2 A;  9ICR A;  4NM1 A;  7ICO A;  3JPS A;  5IIN A;  4X4O A;  4KLU A;  3AQM A;  4F5N A;  2DR8 A;  9ICC A;  5DB9 A;  4UB1 A;  2PXI A;  5J0R A;  4PHP A;  2HHP A;  2PFQ A;  4PGX A;  4AT9 A;  4QZE A;  3JPQ A;  8ICW A;  1ZQK A;  3OGU A;  5CA7 A;  1ZQP A;  1BPY A;  5CB1 A;  3H3A A;  1ZQL A;  2PFO A;  4PPX A;  8ICJ A;  4QZH A;  2PFP A;  4LVS A;  8ICA A;  3RJE A;  7ICE A;  3WFR E;  3HX0 A;  3UXN A;  3H39 A;  3PNC A;  4DOC A;  4Z6F A;  8ICI A;  4WC4 A;  4XQ7 A;  4KLO A;  8ICG A;  4IQU A;  4YD2 A;  3GDX A;  4I29 A;  4UD4 A;  8ICM A;  4FHP A;  2RFF A;  2ZH4 A;  2BE3 A;  2M2V A;  3HW8 A;  3UQ2 A;  5HRL A;  4GXJ A;  3RH6 A;  7ICF A;  1TVA A;  1ZQT A;  3C5G A;  1ZQJ A;  8ICL A;  5IIO A;  2M2T A;  5J2G A;  1ZQA A;  5J2D A;  4PGQ A;  4WBZ A;  4NKT A;  5HRG A;  3B0X A;  1TFW A;  4X4V A;  4LZD A;  4R66 A;  1ZQM A;  4KLI A;  4M9H A;  4QZG A;  9ICM A;  3AUO A;  3RJH A;  4AT7 B;  5J0S A;  4P2H A;  4QZI A;  4I2C A;  4IQT A;  1KDH A;  4XA5 A;  4GXI A;  4QZF A;  5IIL A;  8ICU A;  5DB6 A;  7ICH A;  3C5F A;  1BPB A;  4YN4 A;  5DB8 A;  4R63 A;  2ISO A;  4QZD A;  2BCR A;  1F5A A;  4UAW A;  9ICS A;  5BPC A;  2ZH5 A;  5DDM A;  4IG8 A;  3MGH A;  4NXZ A;  4X4U A;  4RWP A;  1ZQX A;  4EP7 A;  4QZ9 A;  4Z6C A;  3ISB A;  4F5O A;  2ZH1 A;  4KLM A;  4X0B A;  4LZG A;  4TUS A;  4ATB A;  9ICH A;  1VJ7 A;  1ZQG A;  4JWM A;  4X4Q A;  2O1P A;  7ICQ A;  4KLS A;  3MDC A;  2BCU A;  3JPP A;  7ICL A;  3L9D A;  4AT8 A;  5J0Q A;  5CHG A;  1R8B A;  1ZQY A;  4KLL A;  8ICN A;  9ICN A;  1KEJ A;  5HRH A;  5CJ7 A;  4UBB A;  1YLQ A;  2FMS A;  5J0T A;  4KLD A;  4M9N A;  4X4N A;  4Z6E A;  4F5P A;  4KLT A;  4X4S A;  4UBC A;  9ICK A;  5HRD A;  1ZQH A;  9ICF A;  4TUP A;  1R8C A;  4DO9 A;  8ICT A;  3HWT A;  3LK9 A;  1ZQC A;  5HRF A;  8ICQ A;  5DBB A;  8ICP A;  3RJI A;  4M9G A;  4RQ6 A;  1MQ2 A;  9ICX A;  4RQ8 A;  1TV9 A;  4FHY A;  4WC5 A;  4F5R A;  4PHE A;  5HC9 A;  4I27 A;  5IIM A;  7ICV A;  4UB5 A;  4RQ7 A;  3NYB A;  4RPZ A;  4I2E A;  5DKW A;  4FHX A;  4E7X A;  3OUY A;  5J2C A;  9ICQ A;  4FH5 A;  4NLN A;  3H38 A;  3C66 A;  4AT9 B;  2BPF A;  4RQ1 A;  1UEU A;  8ICH A;  7ICJ A;  4RPX A;  4RQ3 A;  4RQ4 A;  4I28 A;  7ICN A;  2ZH7 A;  4YD1 A;  7ICS A;  3JPR A;  2ZH3 A;  3OVA A;  4S3N A;  4NKU A;  5J2K A;  4P4M A;  4E8F A;  9ICU A;  7ICP A;  8ICO A;  4O5E A;  5HRB A;  3UPQ A;  2BCQ A;  3UXP A;  4UB2 A;  2M2W A;  5J2J A;  8ICS A;  8ICB A;  1ZQZ A;  4I2I A;  7ICR A;  3PML A;  4FHW A;  3LQC B;  1UEV A;  4YCX A;  3OVS A;  4KLF A;  5J2A A;  4FHV A;  7ICG A;  7ICI A;  2IHM A;  8ICZ A;  2FMQ A;  1KNY A;  2PBE A;  2I9G A;  4K4H A;  1ZQS A;  2ZH2 A;  3RH4 A;  4JWN A;  2BCV A;  4RT2 A;  4NY8 A;  4WCW A;  2BCS A;  4PHD A;  4FO6 A;  1XSN A;  3WFQ E;  1BPD A;  4X4R A;  3ISC A;  5IIJ A;  5CR0 A;  4QZ8 A;  2PFN A;  9ICT A;  4R65 A;  1R8A A;  4MFC A;  3WFS C;  4GXK A;  4LT6 A;  8ICX A;  5CP2 A;  4RT3 A;  3JZ0 A;  4KLG A;  5J2H A;  3UQ0 A;  1Q78 A;  4E80 A;  8ICY A;  5DDY A;  4KLH A;  5EOZ A;  4FH3 A;  9ICO A;  4Z6D A;  4ATB B;  5J0U A;  4YMO A;  3TFR A;  4UAZ A;  4I2G A;  4AT8 B;  4YMN A;  8ICE A;  5III A;  3JPO A;  3H37 A;  1HUO A;  1ZQQ A;  8ICV A;  9ICG A;  1RPL A;  4O9M A;  5J2E A;  4RQ5 A;  1ZQD A;  7ICK A;  5J29 A;  3C2K A;  9ICA A;  1ZQV A;  4QZB A;  1ZQF A;  4X4T A;  1UET A;  3UXO A;  4RQ0 A;  4NLK A;  5D49 A;  2BPC A;  5BOM A;  8ICF A;  4I2F A;  4DOA A;  4NLZ A;  3JPT A;  1MIY A;  5J2I A;  1JN3 A;  5D46 A;  3MGI A;  4EBK A;  4YMM A;  4I2J A;  2DR5 A;  4K4G A;  4X0A A;  8ICR A;  3HJ4 A;  3HJ1 A;  5J0W A;  8ICC A;  5HHI A;  4X5V A;  1PX5 A;  2VAN A;  2DRA A;  2FMP A;  3WFP A;  5CWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...