4NY8A

Dna polymerase beta with o6mg in the template base opposite to incoming non-hydrolyzable ctp with manganese in the active site
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
323
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 323
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ny8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ny8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ny8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ny8A03
3V6HA 2LYHA 4K4IA 3C23A 2IA6A 5KTQA 3WFRE 1L3TA 4JUZA 2HHUA 2KP7A 5EOZA 2R8JA 4RQ5A 4F4KA 1U45A 4I2EA 4G3IA 3RRGA 2BE3A 8ICTA 4UB4A 1NJZA 4YMOA 4Q44A 3Q8LA 4RWPA 3GFKB 5KFRA 3Q8RB 4YN4A 1BNOA 2BPCA 4RWOA 5KG0A 1B22A 3QZ8A 4DQQA 2HHQA 4F8RA 5KFYA 4QZIA 5KG4A 9ICNA 8ICQA 3C66A 4RPXA 4J9QA 4DFKA 3QEBZ 1NK4A 3WFSC 4WC5A 4ECVA 4DWIA 1DK3A 3TAPA 2BPGA 1S10A 4DLEA 3QE9Y 2H5XA 5KFMA 4UD4A 1S77D 4MEXA 4RUAA 2O1PA 3AQMA 3ZDBA 3UPQA 1BVSA 4RT3A 4M9JA 4RNNA 4RT2A 1NJYA 3OUYB 3OHBA 5KT7A 2W9AA 1ZQLA 5J2KA 4F4ZA 1ZQTA 5KT5A 5DB8A 3KTQA 4KLQA 7ICQA 1IM4A 8ICHA 4QWCA 2ZH2A 4R63A 4C8NA 2FPMA 4UAZA 1S0MA 5HRFA 2B21A 1R8AA 5HMLA 1BPXA 4JV1A 5DQHA 8ICKA 3LWLA 5KFLA 4Q8FA 2C2DA 3GIIA 1ZQDA 3HJ1A 3C2MA 2IHMA 3RJJA 1RYRA 2Y1IA 2HVHA 4FH3A 3WFPA 4BXOB 3OJUA 2BCUA 3GV8B 3GQCA 4X0BA 4DSJA 1D8LA 4YVZA 4YCXA 2V4QA 3ZDDA 9ICQA 4BWMA 2JZBA 3ISBA 4NM1A 5C5JA 2V9WA 3JZ0A 4KLFA 3LQCB 1ZQMA 4E7XA 1ZJMA 4F50A 8ICBA 3TARA 1ZQZA 2HW3A 4Z6DA 2FPLA 2M2WA 3H7IA 5L1IA 4F4YA 3RBDA 1S0VA 5DBAA 2XCAA 1ZQFA 2RDIA 8ICMA 2NRVA 3RB0A 5J0UA 1ZQBA 4E0DA 2HHWA 4YR3A 1Z3EB 4B9UA 4MEYA 1D9FA 1HUZA 2MUTA 4TQRA 2J6TA 5CHGA 3UPSA 2GWSA 3KHRA 4KTQA 1XS9D 5DEDA 2ZUDA 4RPZA 3PV8A 4O5EA 1ZQPA 3RR7A 4YMMA 3JPQA 9ICPA 4Z6FA 5J2EA 2IMWP 3GV5B 2ZH9A 4QWAA 1TVAA 8ICPA 1QLNA 1ZQNA 7ICIA 1N56A 3AU2A 4LZDA 3EWAA 3PW7A 2RDJA 4J9MA 4ELUA 2ZHBA 4PGQA 3OSNA 2DRAA 4QZAA 1U49A 4PHDA 4R65A 2JEFA 1T7PA 1ZQEA 4NLZA 9ICWA 1MIYA 3K75D 1RXVA 2P66A 7ICGA 1DGSA 9ICBA 4I2BA 4DOAA 2DR7A 4DLGA 2C2RA 2XY6A 3G6YA 3PX4A 4EP7A 1Z00B 3C1ZA 3C5GA 4IQVA 4F92B 4ED3A 8ICXA 2KFNA 8ICGA 1KDHA 4YR2A 4YQWA 3FYHA 5KFZA 1ZQIA 3V6JA 1D9DA 2M2UA 5CR0A 3OJSA 8ICLA 4TURA 3GV7B 4QWDA 5J2BA 3HX0A 1K1QA 4F5OA 4S3NA 3PY8A 4YR0A 5J2HA 7ICJA 2P6UA 1OU5A 2JZBB 4QZCA 4GC7A 4RU9A 3SYZA 4RQ3A 5DQGA 1SL2A 4ELVA 8ICFA 4DFPA 8ICWA 4YMNA 4FS2A 3RBEA 4M9GA 2ZH7A 4GXKA 9ICMA 2ZHAA 5CJ7A 1WCLA 1ZETA 1NJXA 1NK0A 3IHQB 4KITB 3HWTA 3T5LA 3TAQA 5J0SA 4J9SA 4B9NA 3MR6A 1C7YA 4X4QA 3V7KA 3PNCA 1ZQCA 1ZQOA 1AROP 7ICMA 2ZH8A 4UB2A 1F5AA 4B9LA 4YD1A 4EBJA 4NXZA 3LK9A 4DQPA 2NRWA 5J2IA 1X9WA 2AQ0A 4P4PA 1SZPA 1FA0A 3MFHA 4X4SA 2BQRA 8ICIA 3BQ1A 4FS1A 4AT8B 5HRHA 8ICZA 2W9MA 4NM2A 1NK9A 1KFDA 4O3QA 3Q8PB 3OUYA 4DEZA 3UQ2A 1SL1A 5L1KA 4JWMA 5KFGA 1ZQJA 5J2DA 4RUCA 1XSLA 2OWOA 3T3FA 8ICSA 5DECA 4X4UA 4XRHA 4KLSA 4RQ7A 1DOQA 5IILA 5KFBA 4UB5A 8ICAA 1VJ7A 4FHVA 3C2LA 4RQ1A 1ZQWA 4YG2A 4RNMA 1T8EA 4IQUA 4QZGA 2ZTCA 3TFRA 4R66A 3PW5A 5J0YA 4X4VA 4K4HA 1NZPA 3MGHA 4P2HA 4KLDA 1TFYA 3ZD8A 5J0OA 3BQTA 5JUMA 1ZQQA 2R8KA 4CCHA 4WC3A 3EPIA 4BXOA 5KG6A 4I2IA 5EWGA 3MABA 3JPRA 5KFHA 2XY7A 2ISOA 4KLOA 5DG8A 1NOMA 2XY5A 1UA1A 2ZUCA 2W8KA 2UVUA 3WFQE 2XO7A 4UB3A 2XGQA 2R8HA 2ASLA 3SI8A 2PFPA 3V6KA 1L3VA 3V7LA 4ECXA 7ICFA 4NKTA 1KRPA 2M9NA 2UVVA 1S0NA 3FDSA 4TUSA 2KN7A 3Q8KA 1A76A 5J0QA 3UXOA 4IRCA 1NKCA 4IRDA 9ICIA 5J2AA 9ICOA 4XQ7A 1XSNA 4UD5A 4DF8A 4O5CA 8ICCA 5KFEA 4KLEA 5KFPA 4FBUA 2Q66A 3UXPA 5KFNA 3ZDCA 5HREA 2NRKA 3MGIA 3H37A 1KTQA 4WBZA 4DL4A 1MIVA 2O5AA 4DL3A 3ISCA 4DL5A 4NLNA 3UQ0A 1SKSA 2ZH3A 1S76D 3PW0A 2BR0A 1TFRA 1XO1A 3T5HA 4P4OA 3MR3A 4I2GA 3AUOA 2ASJA 3PO5A 4RZRA 1U9LA 3GIJA 3LWMA 2AGOA 1NJWA 5KT4A 1R8CA 3H38A 4YFKA 4Z6CA 3IM1A 4Q45A 3EYZA 1RXWA 4BWJA 5HRKA 2IHNA 3MBYA 3HW8A 5BOMA 1Z00A 3MR5A 5KFQA 3AQNA 1D8YA 3GIMA 1TAQA 3H4BA 3PO4A 5L1JA 3THVA 5HRGA 1ZQRA 2BCQA 1NK8A 2VANA 4QWEA 2VA3A 2BGWA 4J9OA 1KEJA 2J6UA 1COOA 4C8MA 3C18A 4FHYA 4UAYA 1CEZA 3B0YA 4QW8A 9ICEA 4XUSA 3OVSA 4DL6A 3HP6A 2ALZA 4NLGA 9ICXA 3OV7A 5KG7A 4ED7A 5KFCA 4DL7A 4O9MA 5J0PA 2KZ3A 1V4AA 2J6SA 4UAWA 5J29A 2XGPA 7ICHA 2F1JA 3SV4A 1SKWA 4QZEA 3M8SA 2P6RA 2M2TA 4QWBA 4RQ8A 2UVWA 4FH5A 2AGQA 2M2VA 9ICCA 3KHLA 4FHWA 3BJYA 1UETA 2BCRA 5J0TA 4I2AA 4DQRA 1U48A 1B43A 2R8IA 4AT8A 4J9KA 4TQSA 3HIYA 4MFFA 4KLUA 4DS4A 5TZVA 3H40A 1ZYQA 1SL0A 1WCNA 5CB1A 3RB6A 4AT7B 4F5RA 1NKEA 2IBKA 3H8JA 3MR2A 3MDAA 5KFOA 4ED6A 4IR9A 4X4RA 1EXNA 7ICTA 5IIOA 3ORYA 5KFDA 4FHXA 2HHTA 3G6XA 8ICEA 3PR4A 7ICPA 5DB9A 5BPCA 2MAXA 4WC0A 4WBYA 4X5VA 5KFIA 4HYKA 2DFLA 4KMUA 2DR5A 4M47A 4DSEA 9ICKA 9ICVA 4BDPA 4C8KA 2ZTEA 5J0RA 4O3SA 5HMMA 3C5FA 1K1SA 4KLIA 4B9MA 2DR9A 4R64A 2HVIA 4KLHA 1T3NA 1XU4A 4O3NA 4I27A 1PZNA 3QEAZ 1NK7A 2PI4A 4LT6A 4FHPA 3H8SA 4BGDA 3RJGA 3RJHA 4B9VA 4F3OA 4X4PA 4MF2A 7ICUA 4KN4A 3BQ0A 1LV5A 5J2CA 4F93B 4F5QA 4ED0A 7ICKA 4PHEA 5HP4A 1KLNA 3NGDA 1L5UA 5HR9A 1QSYA 4F2SA 5HRLA 1MQ3A 2XCPA 4I29A 3ZD9A 3SZ2A 3HT3A 1S0OA 2ID1A 1BPZA 5DLGA 2R8GA 2ZJ5A 1MQ2A 1R89A 4WC2A 3PW4A 2FMPA 3M9MB 9ICFA 4NLKA 2ZTDA 1JX4A 3RTVA 1JXLA 4M6WB 5J2FA 3EPGA 1BPBA 4UB1A 2BQUA 2KFZA 1BNPA 5KG1A 4QW9A 4J9RA 4B9TA 8ICNA 1S97A 1TFWA 1NKBA 5F9LA 3JPOA 4AT9B 4ED8A 4QZ8A 4QZDA 3Q8QB 4M9HA 2I9GA 3H3AA 2HHPA 7ICNA 1S9FA 2C22A 4MF8A 4RQ6A 5L1LA 1MC8A 3PR5B 3RRHA 2PFNA 4NY8A 5F2VO 4ECUA 4ECWA 4I2DA 1MSWD 3PX0A 3GIKA 5KFSA 5KT2A 3JPNA 4KN7A 3GDXA 5KFUA 5HNKA 2FPKA 1TV9A 2BDPA 9ICTA 1BPDA 2ZH6A 4EBCA 4JV0A 4PH5A 4IRKA 3C1YA 2I1QA 4Q43A 2ASDA 3JPTA 2BHNA 4DS5A 3PMLA 9ICAA 4WCWA 3RH6A 4ECRA 2XC9A 1X9SA 2F1HA 3MDCA 5KFKA 1QSLA 3RAXA 1JQRA 2JEJA 1KFTA 5J2JA 4DOBA 5KT6A 4MFAA 4M2YA 2W9CB 4EZ9A 4RNOA 4IQTA 2W9BB 3AQKA 5HRDA 7ICOA 3M9NB 4KLTA 2RFFA 4O3PA 2BQ3A 2DRBA 9ICRA 5KFTA 8ICYA 4X4TA 4YD2A 3TI0A 3OVBA 1IXRA 4P4MA 5D46A 2FLLA 3RJEA 4RQ0A 4KLLA 4KLMA 4X4NA 2PBEA 1UT5A 4M5DA 5EWEA 2ZH4A 3ZDEA 4PGXA 4DOCA 4IR1A 2PFQA 4AT7A 3JYYA 4LVSA 3EZ5A 5DG9A 2AQ4A 5L9XA 3RH5A 4J9NA 4EBEA 1U4BA 1ZQGA 1T4GA 1DK2A 4F5PA 3WFOA 1TK8A 1BPYA 1KFSA 5HRBA 5DLFA 4EZ6A 1JIHA 5KG2A 4GXJA 4GXIA 4ECQA 4M9NA 4ATBA 3KHHA 3LDAA 3PW2A 4X4OA 5J0XA 7ICVA 1U47A 4DSIA 5DQIA 3HJ4A 4J9PA 2UVRA 5CA7A 3EW9A 3RH4A 1N48A 3M8RA 1RYSA 2A1JA 4RQ2A 4JWNA 4F5NA 4LZGA 2KZMA 2ZH1A 5DBCA 3JPPA 5KFJA 4M0AA 2ZUBA 3PMNA 2NRXA 4ECSA 8ICOA 4IG8A 3KHGA 4I2HA 3JPSA 2FLPA 4DSLA 5DBBA 4UQGA 4R8UB 4YXMA 3Q8SB 2BCVA 4C8LA 1NO5A 3K4GA 1JN3A 4RWQA 5DKWA 5DGBA 4UBBA 4NKUA 1ZQAA 3RB4A 4ECZA 1KSPA 4FO6A 4M9LA 3NYBA 5KT3A 3PVXA 3C21A 2ATLA 1RZTA 3RR8A 4E80A 1MIWA 2NRZA 8ICJA 1UEUA 5HC9A 4DQIA 1X2IA 4QZHA 2Y1JA 1ZJNA 4EYIB 4EEYA 2C2EA 4PHPA 5HHIA 3MFIA 4Q8EA 2V4RA 1HUOA 2F1IA 4I2JA 5J2GA 1SKRA 7ICEA 3Q8MA 4X0AA 3UXNA 4M6WA 3QZ7A 4DSKA 1ZQXA 1X9MA 5IIKA 5HHHA 4PGYA 4AT9A 1Y88A 5CP2A 4MFCA 5IIMA 4WC4A 1V9PA 2VA8A 1NK5A 2NRTA 1NK6A 3NTUA 4IQWA 1R8BA 1QSSA 2ISPA 3E2EA 2Q0ZX 4ZH4A 4GLXA 4M04A 4I2FA 4YP3A 2WTFA 4ATBB 5HRIA 4JK1A 2BKEA 5DGAA 5IIIA 3M9OB 4PHAA 4RQ4A 3OHAA 1ZQKA 1KNYA 1L3SA 5CWRA 3T5JA 4Z6EA 1UA0A 5KG3A 4TUQA 1LB2B 2KZZA 5KFXA 1RPLA 1ZQUA 2JEIA 2A1JB 2DVIA 4EBKA 4DFMA 5F9NA 4EBDA 4XA5A 3RJFA 7ICRA 3RB3A 1ZQHA 8ICVA 9ICGA 3L9DA 1QTMA 4DO9A 1TK0A 1JMSA 4PPXA 4RWNA 2AGPA 4QZFA 2C28A 2DPIA 1JXEA 5KFVA 4I28A 2BPFA 1A77A 5KFWA 5DDYA 2W9CA 1ZQSA 2JEGA 3V7JA 1Q79A 4DF4A 1XWLA 2W9BA 3H8WA 9ICHA 4TUPA 2PI5A 4O3RA 9ICLA 3RAQA 3AQLA 4WC6A 1YLQA 3OVAA 5EWFA 1TAUA 3OGUA 4F4XA 4C8OA 2HHSA 3H39A 5KFAA 4JV2A 4WC7A 3N4MB 4DSFA 7ICLA 1BPEA 4ED2A 2PFOA 3HPOA 2VA2A 5IIJA 4GC6A 1Q78A 2W8LA 4K4GA 3TANA 5J0WA 5IINA 1H38A 3C2KA 1TK5A 4KLJA 1UEVA 3BQ2A 4E8FA 3V72A 5DB7A 4O0IA 2KTQA 9ICSA 4O3OA 1WOTA 4F91B 4DQSA 1ZQVA 3GILA 5KG5A 4DFJA 2FMQA 3H4DA 3T5KA 5D4BA 2FLNA 4B9SA 4FBTA 9ICUA 2ZJAA 3TQ1A 1VFGA 3ISDA 3RJKA 4J9LA 1JAJA 4RPYA 3ETLA 1UT8A 2MUTB 4ECTA 4ECYA 3RJIA 2AU0A 1XC9A 1TKDA 4KLGA 2AJQA 5DDMA 4YXJA 2FMSA 2ZJ8A 3G6VA 3PX6A 2HHVA 4EYHB 4WC1A 3ZDAA 4QZBA 5DG7A 3BDPA 4UBCA 1L3UA 4XQ8A 5BOLA 3OSPA 3B0XA 4F2RA 1XSPA 1BGXT 1HJPA 4ED1A 4R8UA 1CUKA 2DPJA 2PXIA 4QZ9A 3TFSA 4O5KA 9ICJA 4DL2A 5D49A 3N97B 2BCSA 7ICSA 3SV3A 4ELTA 4F4WA 2DR8A 1ZQYA 4I2CA 3AU6A 5DB6A 2HHXA 8ICUA 1PX5A 2ZH5A 5KFFA 8ICRA
chains in the Genus database with same CATH superfamily
4K4IA 5KTQA 1L3TA 3KKAC 2FE9A 2B4VA 2R8JA 4F4KA 1U45A 2BE3A 3M6KA 3NUQA 1WG8A 3D2QA 4QNLA 3GFKB 1B22A 5AM5A 4DQQA 9ICNA 1X42A 8ICQA 3QEBZ 4J9QA 3WFSC 1QQ5A 4UD4A 3AMZA 1S77D 2GO7A 2W3RA 2MRLA 4RT2A 3OHBA 4F4ZA 5AI0A 7ICQA 8ICHA 4QWCA 4Y2JA 1R8AA 2EWRA 5DQHA 8ICKA 3LWLA 2ES6A 1N62A 2DQNB 2FJ6A 2Y1IA 1ZRNA 4Y2RA 3WFPA 3OJUA 2E8MA 3GV8B 3GQCA 2BCUA 2HOQA 4DSJA 2V4QA 1QH9A 4BWMA 2JZBA 4ICAA 3LQCB 2EAPA 1ZQMA 2HW3A 4Z6DA 2M2WA 3H7IA 1S0VA 5DBAA 2XCAA 3TADC 2HHWA 3BS5B 1XS9D 2ZUDA 3WKDA 2WF8A 4O5EA 2NO4A 4YMMA 3JPQA 5J2EA 2ZH9A 2CPRA 1QLNA 3AU2A 3EWAA 4ELUA 4PGQA 1V38A 1Q3UA 9ICWA 4DCCA 1ZQEA 2P66A 1RXVA 1ZD5A 4I2BA 2DR7A 3F2DA 3G6YA 4MHVA 1Z00B 3C1ZA 2YMQA 4F92B 4YR2A 1ZD2P 3V6JA 5ALKA 2M2UA 1FFVA 4TURA 4F5OA 2P6UA 4RU9A 4IS7A 5DQGA 2RLTA 8ICWA 4YMNA 3D2SA 2WB1F 1NJXA 1NK0A 3IHQB 3T5LA 4J9SA 1ZQCA 3F5EA 2KIVA 1ZQOA 1S5LU 4XJEA 2DKZA 1FA0A 4X4SA 4C7ZA 3BQ1A 3L4PA 2W9MA 1NK9A 4DFDA 1SL1A 1XSLA 2E8NA 3T3FA 2QB0B 4KLSA 4NL9A 4C7YA 2EANA 4RQ1A 1ZQWA 3D6JA 3TFRA 4X4VA 1V85A 4P2HA 1TFYA 5J0OA 1DRGA 2BDUA 2DGZA 4WC3A 3JPRA 1Z19A 4LEWA 2ZUCA 4UB3A 3UMCA 2ASLA 3SI8A 2PFPA 3V6KA 4OO1J 3ERCC 4NKTA 2UVVA 3FDSA 2EAMA 4TUSA 2KN7A 5J0QA 3UXOA 9ICIA 2HN1A 8ICCA 2NRKA 3KKAA 3QYPA 4WBZA 4DL4A 4WQLA 2MA1A 3AEVA 3ISCA 4PL2A 1S76D 2BR0A 1B4FA 4JMUA 4Y2PA 3LWMA 3A0BU 4Z6CA 2ZXIA 5BOMA 5KFQA 1D8YA 3PO4A 4UB6U 2NO5A 2BCQA 1KEJA 2J6UA 4BX9C 2MSNA 3B0YA 4QW8A 3OVSA 4EEKA 3OV7A 1Z1BA 2YN4A 1P7DA 5KG7A 4ED7A 2KZ3A 3DDHA 5J29A 2DBYA 3SV4A 1SKWA 4QWBA 1MN8A 1Z1VA 5J0TA 2ODGA 1U48A 4J9KA 1XNSA 4MFFA 1ZYQA 2W43A 3DEEA 7ICTA 3T79A 2Y0SC 5KFDA 1N61A 3M7DA 3TADA 4HYKA 5ALRA 4KMUA 5AICA 4BDPA 5AKKA 1K1SA 2F3NA 3PSTA 2DR9A 1XU4A 4O3NA 2PI4A 1YT3A 4FHPA 3RJHA 3IRUA 4X4PA 3SAHA 2CN1A 1FFUA 4CRXA 3KFUF 1LV5A 1KW4A 1NI3A 1KLNA 1O03A 3EF2A 4F2SA 5HRLA 4US9A 3ZD9A 3SZ2A 2K4EA 3HT3A 2VIXA 1MQ2A 3PW4A 5AKEA 5ALHA 1JXLA 5J2FA 2JHDA 4UB1A 1WWUA 2BQUA 1BNPA 5AKJA 4I0UA 4B9TA 4AT9B 3JPOA 4ED8A 4QZDA 4M9HA 4MF8A 3PR5B 1HIWA 2ZIVB 2YX8A 3OTQA 3JPNA 5KFUA 4FZNA 2BDPA 4JV0A 4LEYA 3KZXA 3C1YA 2JXJA 4Q43A 3A0HU 5AK4A 3PMLA 4ECRA 5JU5A 2XC9A 1JQRA 3QU7A 5KT6A 2YMMA 2RP5A 2W9CB 4EZ9A 4IQTA 1PVQA 3AQKA 3M9NB 2DRBA 4N7RA 8ICYA 5D46A 4KLLA 3NKUA 2PBEA 1QCKA 1UT5A 4DOCA 4IR1A 4AT7A 3JYYA 3EZ5A 5DG9A 1U4BA 5HRBA 5DLFA 4GXJA 4GXIA 4ATBA 4M9NA 3SD7A 3PW2A 1COKA 2KV2A 5CA7A 3EW9A 5ALOA 1RYSA 1SB3C 2KZMA 5KFJA 4IG8A 2NRXA 8ICOA 3KHGA 4DSLA 2ZXHA 5AI8A 2BCVA 3UMGA 4NXVA 3K4GA 4RWQA 5DKWA 3RB4A 4M9LA 5EE3A 3ER9B 2WAQF 2WB1C 1RZTA 3RR8A 2Q4TA 1SV0C 5HC9A 4DQIA 2Y1JA 4Q8EA 1HUOA 4M6WA 4UATA 4LEVA 3HKZC 2FI1A 4PGYA 2KG5A 1T3QA 2KE7A 1NK5A 2K4PA 1QSSA 2ISPA 2PKEA 1KBUA 1OW5A 1KNYA 1L3SA 4Z6EA 2H3FA 2KSOB 1RPLA 1ZQUA 2DVIA 5F9NA 1SXEA 5T14A 3RB3A 5TISU 1QTMA 4PPXA 4RWNA 4WH5A 5KFVA 4I28A 1A77A 5KFWA 4P0PA 2ZIXB 1FO4A 1XWLA 4DF4A 9ICHA 4NXWA 1HEKA 2PI5A 3FAHA 1YLQA 1TAUA 3OGUA 4US8A 3WU2U 3HJEA 4WC7A 3N4MB 4DSFA 7ICLA 2PFOA 4GC6A 2W8LA 5J0WA 1TK5A 3CYMA 4O0IA 2HBMA 5JRTA 9ICSA 4F91B 3GILA 4DFJA 5KG5A 2FMQA 2FLNA 3T5KA 5D4BA 2ZJAA 3TQ1A 2E3TA 3RJKA 3ETLA 1UT8A 4KLGA 2AU0A 1SWVA 2ZJ8A 3LVWA 3G6VA 4QZBA 3NS1A 5BOLA 3OSPA 5ALXA 5AKGA 2EH9A 1HJPA 1X40A 2DPJA 1CUKA 2PXIA 5ALUA 3CNHA 4DL2A 2KHVA 2KKVA 2D6FC 3IG8A 4F4WA 4Y2XA 2HMXA 2XIDA 1UPHA 8ICRA 3V6HA 2IA6A 2KMDA 2HHUA 5EOZA 4RQ5A 4O68A 1Z4OA 4YMOA 1OXJA 3Q8LA 3H0RB 4C4TA 2EQYA 1BNOA 2BPCA 5KG0A 3QZ8A 3IN5A 1N60A 5EE9A 5KG4A 4WOYA 2LBOA 1NK4A 5AI5A 3WK6A 4WC5A 1DK3A 4ECVA 2BBHA 2KICA 4KX5A 2H5XA 4RUAA 3I1YA 2O1PA 3ZDBA 5AK5A 1L7PA 1BVSA 4GIBA 3UPQA 4EGWA 2W9AA 1FIQA 3KTQA 5DB8A 1J2NA 1IM4A 2OH2A 4UAZA 5HRFA 2F8LA 2B21A 1FEZA 3K1ZA 3E58A 3GIIA 3C2MA 2IHMA 3RJJA 2ZIWA 1RYRA 4BXOB 2E1EA 1D8LA 4YVZA 4YCXA 3ZDDA 9ICQA 4NM1A 3JZ0A 4KLFA 4F50A 8ICBA 2W11A 1RYUA 2FPLA 2LI6A 3OPXA 7ICPA 5AHXA 3WK8A 2RDIA 3F2BA 1SV0A 4B9UA 1D9FA 1HUZA 2J6TA 3UPSA 1QQ7A 3LYSA 3KHRA 2GAFD 4O3MA 1ZQPA 2BBJA 2ZG6A 8ICPA 1N56A 2ZHBA 3PW7A 2RDJA 4QZAA 2W7OA 1T7PA 4NLZA 3K75D 1DGSA 9ICBA 4DOAA 4KX3A 5AKXA 3CRXA 2E8OA 4F71A 3C5GA 1LVHA 5KFZA 1ZQIA 3OJSA 4QWDA 5J2BA 5AM2A 4OAFA 4YR0A 5J2HA 1GPJA 4GC7A 3I28A 2JV3A 4FS2A 2ZH7A 4M9GA 4GXKA 5ALWA 5CJ7A 1WCLA 1ZETA 2QB1A 4KITB 4NLBA 4JLZA 2ZH8A 2XICA 3NRZA 4AYBC 3ICXA 4YD1A 1SZHA 3LK9A 2NRWA 5J2IA 1X9WA 4B9LA 3IP4B 3MFHA 4NM2A 2Y0SF 3Q8PB 4O3QA 3OUYA 3NVYA 2YTUA 4DEZA 1GO3F 5L1KA 1ZQJA 4G9BA 3QU2A 4X4UA 8ICSA 4XRHA 4RQ7A 4K97A 3H0MB 1ZRMA 4RNMA 2ZTCA 2WAQC 4R66A 4P0QA 3ZD8A 4CCHA 2R8KA 4I2IA 3MABA 5KFHA 2ZIUA 5DG8A 4WQKA 1UA1A 2NV3A 1PVRA 4O6AA 2WF5A 3QU5A 5ALPA 2R8HA 3WFQE 3Q8KA 1A76A 1NKCA 1XSNA 4DF8A 2Q66A 5KFPA 5G5GA 3MGIA 3H37A 1L7MA 4Y2YA 1B0XA 4NXTA 2O5AA 3UQ0A 4IL6U 1SKSA 1TFRA 3T5HA 5AIAA 2FDRA 2DKXA 1A6SA 3AUOA 3GIJA 1ZXIA 3IM1A 2YQEA 3MR5A 3AQNA 4NLCA 3H4BA 3MGVA 5HRGA 2VA3A 1NK8A 4QWEA 2BGWA 4AP9A 1N2XA 1COOA 4C8MA 3C18A 4FHYA 9ICEA 2W3SA 2G09A 2KKPA 9ICXA 2Y9TA 5AI4A 1V4AA 4IC9A 5J0PA 1A0PA 2F1JA 4O67A 2M2VA 2JH1A 2KOBA 3WKAA 2BCRA 4DQRA 2KK0A 4AT8A 3HIYA 5TZVA 3H40A 5ALVA 4F5RA 3MR2A 3TKAA 5KFOA 2CXYA 3QNMA 1EXNA 5IIOA 3ORYA 2Z7JA 4FHXA 3G6XA 8ICEA 4WJ3B 5E79U 3PR4A 2KEYA 2MAXA 4WC0A 4WBYA 2AHOB 2R18A 3KD3A 5AI9A 2DR5A 4DSEA 4Y2VA 4O3SA 2ZTEA 5J0RA 5HMMA 5CFTA 3NVOA 2HVIA 1T3NA 4I27A 3SAGA 4FZMA 1URJA 3RJGA 4B9VA 2GA9D 4MF2A 5J2CA 4F93B 4ED0A 4X4QA 2QKQA 4PHEA 5HP4A 4CF5A 7ICKA 3MCRA 5HR9A 1QSYA 1MQ3A 1S0OA 1BPZA 2ZJ5A 3PHZA 3HKZF 2FMPA 4NLKA 2ZTDA 5KNIA 1BPBA 4OJPA 1RDFA 5AM1A 4J9RA 1S97A 1TFWA 5L1LA 3RRHA 3PZPA 4NY8A 4ECUA 3PX0A 3GIKA 5KT2A 4KN7A 3GDXA 2F44A 1ZD3A 9ICTA 4PH5A 4J03A 5AKLA 2ASDA 4DS5A 4WCWA 1F0MA 3MDCA 1QSLA 2JEJA 1KFTA 4M2YA 5HR7A 3UM9A 1D8BA 2W9BB 2K8AA 1QQ6A 2D3DA 4X4TA 4P4MA 2HI0A 5HR6A 4X4NA 4M5DA 5KL8B 4QJFB 3RH5A 4OAGA 1BPYA 2FCLA 1JIHA 4X4OA 2B0CA 3HJ4A 1CRXA 1N48A 1LKYA 5DBCA 3JPPA 1WYGA 4ECSA 5DBBA 4UQGA 2QARA 4YXMA 2GOLA 4C8LA 4LJXA 3AN1A 1NO5A 4UBBA 5DGBA 4NKUA 4Y2UA 2VJ5A 3SENA 2KJ9A 3SR6A 5KT3A 3C21A 4E80A 2NRZA 3KZIU 4LZGA 1X2IA 4EEYA 2C2EA 4PHPA 4KMOB 2F1IA 4I2JA 2LYBA 2B6GA 7ICEA 4X0AA 1L8OA 1Y88A 3PSFA 5CP2A 4MFCA 3ONNA 4IQWA 1PK1A 1R8BA 2XI9A 4ZH4A 4GLXA 2WTFA 5DGAA 5ALEA 4PHAA 1ZQKA 3OHAA 1WWVA 5KG3A 2KZZA 1SXDA 3RJFA 1L7NA 1ZQHA 2EZZA 9ICGA 4DO9A 1TK0A 3J81j 1JMSA 3RF9A 4QZFA 2HOIA 1ZD4A 9ICLA 3RAQA 2H3ZA 3AQLA 4WC6A 2HHSA 3H39A 1BPEA 3K7DA 1Q78A 3TANA 4KLJA 2JR5A 3C2KA 5AKZA 1N5WA 4O3OA 4CGZA 3H4DA 9ICUA 2IOHA 1JAJA 2HDOA 1XC9A 3RJIA 2AJQA 2LMRA 2FMSA 2K4HA 4OJLA 4WC1A 5DG7A 3BDPA 4UBCA 1L3UA 4F2RA 4Y2SA 1XSPA 3DV9A 4F72A 4R8UA 1KL9A 4ED1A 2KHQA 3WKEA 3N97B 2BCSA 4PZOA 1ZQYA 4I2CA 3AU6A 2ZH5A 2LYHA 3WFRE 2H3VA 2KP7A 4I2EA 4G3IA 3RRGA 8ICTA 5AM3A 1NJZA 4Q44A 2E5SA 5KFRA 5B5EU 3Q8RB 4YN4A 3QU9A 4QZIA 1L6NA 4AYBF 4DFKA 4DWIA 4CF3A 4K9AA 3TAPA 2BPGA 4DLEA 3QE9Y 4JB3A 4MEXA 2YY6A 3QUQA 5JTIA 3H8MA 4RNNA 5ALDA 5KT7A 5J2KA 1ZQTA 5C0YA 2ZH2A 4C8NA 1S0MA 1BPXA 5ALNA 5KFLA 5GTIU 5ALIA 3HJ1A 5KAFU 5D63A 5AKHA 3BQ7A 5AKIA 3H0LB 2K4IA 5B66U 2L5YA 3ISBA 2V9WA 1J2MA 1UQVA 2QLTA 2N1RA 3FC4A 1ECWA 5L1IA 4F4YA 8ICMA 1PUZA 4U7CA 1RG6A 5J0UA 4EV6A 5ALQA 2MUTA 5AM0A 2GWSA 5KL1B 4KTQA 4RPZA 2OHFA 4Z6FA 2IMWP 4QWAA 1TVAA 7ICIA 4LZDA 2LM4A 1MIYA 2G08A 7ICGA 4DLGA 2C2RA 2XY6A 2CRXA 3PX4A 4EP7A 4ED3A 5F2VO 4IQVA 3GU3A 2KFNA 8ICGA 2F2AB 1YZ6A 3FYHA 1D9DA 5CR0A 8ICLA 1SV4A 7ICJA 1OU5A 1SL2A 4DFPA 9ICMA 3NVVA 3TAQA 5J0SA 3MR6A 3V7KA 5GTHU 1AROP 4NXZA 4P4PA 3C28A 3SMVA 2H3IA 2DL0A 2BQRA 4FS1A 2WHEA 5HRHA 2DUYA 3FM9A 1KFDA 2YB1A 2KNJA 4JWMA 5KFGA 5ALSA 4U6PA 4RUCA 5DECA 1RQLA 2Y9UA 4FHVA 5IILA 5KFBA 4OJOA 3B9JA 4YG2A 1VLBA 3ALRA 3PW5A 5J0YA 4K4HA 4KLDA 1ZQQA 5JUMA 5KG6A 5EWGA 3CW2C 2XY7A 2ISOA 2XY5A 3NWIA 2W8KA 1KQQA 2UVUA 2XO7A 1X66A 1L3VA 3V7LA 7ICFA 2M9NA 1T94A 1S0NA 4IRCA 3SQIA 2H3QA 4IRDA 4FZLA 4XQ7A 9ICOA 2OM6A 3BS5A 4FBUA 5KFNA 5HREA 5F3XB 1DGJA 3CP8A 4KM5A 4DL5A 4NLNA 1DXSA 5AI6A 3PW0A 5G5HA 4P4OA 5ALMA 5ALLA 2ASJA 3BZCA 3PO5A 2YMLA 3H38A 5KT4A 4BWJA 5HRKA 2IHNA 3MBYA 3HW8A 1Z00A 4EEDA 3K1RB 4FFDA 1TAQA 2G5HB 2W7PA 5L1JA 3THVA 1ZQRA 4J9OA 4JLXA 4UAYA 2HCFA 4XUSA 4DL6A 4USAA 2ALZA 4NLGA 1MA7A 5KFCA 3QUTA 7ICHA 3M8SA 2NYVA 2UVWA 4FH5A 3NASA 4C4SA 1IIPA 4FHWA 1UETA 1VJ5A 5L1MA 4I2AA 2R8IA 4KLUA 3QU4A 3RB6A 4AT7B 3AM9A 1NKEA 2IBKA 4ED6A 4X4RA 1O08A 2AH5A 2I6XA 2HBKA 4Y2QA 1UCVA 2QB0A 4UB8U 5DB9A 5BPCA 3NVWA 2G07A 5KFIA 3ZI4A 4PL1A 4C8KA 3O0FA 1PZNA 3H8SA 4BGDA 4F3OA 4KN4A 3BQ0A 4F5QA 1L5UA 2XCPA 4I29A 5DLGA 5EE0A 3NRWA 1JX4A 4M6WB 2KFZA 3EPGA 2A1AA 3N7PD 3MC1A 5F9LA 3R9KA 2OXOA 2I9GA 3H3AA 2HHPA 1S9FA 2C22A 2LHTA 1MC8A 4EENA 4ECWA 4I2DA 4CNQA 1MSWD 2LPEA 5KFSA 4BJQA 2WF7A 1AQ6A 2FPKA 2ZH6A 3WK4A 4EBCA 4NV0A 4LEZA 2BHNA 3QUCA 1X9SA 4OAHA 2F1HA 4NXUA 5KFKA 3RAXA 4DOBA 4K96A 4P0PB 4CDGA 4O69A 4RNOA 5HRDA 2LM1A 5KFTA 4YD2A 3TI0A 1IXRA 2W03A 2JH7A 2MU2A 4KLMA 5EWEA 3ZDEA 4PGXA 4EX7A 3VCBA 5D61A 2PFQA 4LVSA 2EAOA 1F44A 2EZXA 2AQ4A 1DK2A 1ZQGA 1T4GA 4F5PA 3IDWA 1KFSA 5KG2A 4ECQA 3LDAA 4UW9A 3IV6A 7ICVA 4DSIA 2UVRA 2JMGA 2VJ4A 2HBLA 3RH4A 3L3FX 4F5NA 4JWNA 2ZH1A 2YMPA 3N7RC 3PMNA 2EDUA 4ZOHC 4I2HA 3JPSA 2FLPA 4HAIA 3Q8SB 1JN3A 1TAMA 1ZQAA 1SIJA 2IOFK 3NYBA 3ER8C 4FO6A 3KBBA 3PVXA 2ATLA 8ICJA 1UEUA 3CK6A 4QZHA 1IV8A 2V4RA 3F2CA 1RQNA 1IG6A 1PK3A 1SKRA 2OYYA 3UXNA 3QZ7A 4DSKA 2WFAA 1ZQXA 1X9MA 1NZBA 2XVTA 4OAIZ 4AT9A 4WC4A 4PZNA 2NRTA 1NK6A 3SAFA 3E2EA 4OJ6A 4M04A 2K8CB 5ALZA 2ZIVA 2DWQA 4B6JA 4YP3A 5HRIA 2BKEA 5IIIA 3M9OB 5CWRA 3T5JA 1UA0A 2K89A 1Q3VA 2A1JB 4EBKA 4OCZA 2KJ8A 4EBDA 4XA5A 7ICRA 8ICVA 2B56A 2C28A 2DPIA 1JXEA 2W9CA 4BUGA 3H8WA 4O3RA 2ZIWB 4K8VA 3OVAA 4CE6A 1X9XA 3OWGA 1YZ7A 4F4XA 5KFAA 4JV2A 3KOOA 3HPOA 1ZOLA 4K4GA 1C20A 5IINA 1UEVA 4E8FA 1WOTA 5ALJA 4B9SA 4NWIA 4J9LA 4ECYA 4ECTA 1TKDA 5AK3A 2P35A 4PJ0U 2HHVA 4EYHB 3ZDAA 1UHUA 4XQ8A 3B0XA 5CRXA 1L8LA 4QZ9A 5D49A 7ICSA 2D8CA 3WKBA 4ELTA 2DR8A 2HHXA 5DB6A 1PX5A 5AKYA 5KAIU 5K4LA 2RRDA 4A8EA 3C23A 4JUZA 4KB6A 4UB4A 1XO0A 4RWPA 4RWOA 3U26A 2HHQA 3L5KA 4F8RA 5KFYA 2WF9A 1L7OA 4K9BA 3C66A 4RPXA 2ESEA 1TE2A 1S10A 3WK9A 2KSOA 5KFMA 2G06A 1Q46A 2E1FA 2EZYA 3AQMA 4RQNA 4RT3A 1X6JA 4M9JA 1NJYA 3OUYB 4QIWF 1ZQLA 4KLQA 5D62A 5KT5A 4GFJA 5AM4A 4R63A 2FPMA 5HMLA 4JV1A 4Q8FA 2C2DA 5ALYA 1ZQDA 1CI4A 2ZIXA 3SEIA 2IUBA 4UASA 4P0QB 1M6YA 2HVHA 4FH3A 2PMZC 4X0BA 4ACOA 4NJ8A 2ZIUB 5C5JA 1J97A 1ZJMA 3TARA 1ZQZA 4K98A 5ALFA 3RBDA 1ZQFA 2IHOA 2NRVA 3RB0A 1ZQBA 4E0DA 4YR3A 1NNLA 1Z3EB 4MEYA 5AK6A 4TQRA 4EELA 5ALGA 5CHGA 5DEDA 3PV8A 3RR7A 9ICPA 3M1YA 1JUDA 3GV5B 2HOFA 3BS7A 4C0ZA 1ZQNA 4J9MA 2DRAA 3OSNA 1U49A 2JEFA 4PHDA 4R65A 2IOFA 1VDVA 8ICXA 1KDHA 4YQWA 3D2NA 2A19A 3HX0A 3GV7B 4S3NA 1K1QA 2RQ5A 3ETRA 1F5AA 2JZBB 4QZCA 3SYZA 4ELVA 8ICFA 4RQ3A 4MKPA 4E7XA 2ZH3A 2W54A 3RBEA 2YB4A 2RHFA 2ZHAA 3HWTA 3PSPA 4B9NA 1C7YA 3PNCA 7ICMA 4UB2A 4DQPA 2AQ0A 1SZPA 1V97A 8ICIA 4AT8B 5B3QA 4FO1A 5EE1A 8ICZA 3AQFA 4C4RA 3UQ2A 4UAUA 1X6IA 5J2DA 2OWOA 1DOQA 8ICAA 4UB5A 1VJ7A 3C2LA 1T8EA 4IQUA 4QZGA 5CHEA 1NZPA 3MGHA 3BQTA 3QUBA 3EPIA 2M0NA 4BXOA 4OJ5A 2KVSA 4KLOA 1NOMA 2XGQA 1SGGA 4NXXA 4EBJA 4ECXA 1KRPA 5J2AA 4UD5A 4O5CA 5KFEA 4KLEA 3UXPA 3ZDCA 5B3PA 1KTQA 1MIVA 2OEHA 4DL3A 4UAVA 2F76X 1XO1A 3MR3A 3HRDD 4I2GA 4RZRA 1U9LA 2AGOA 1NJWA 1R8CA 4YFKA 4Q45A 3EYZA 1RXWA 2B51A 2E8PA 1F5SA 3AL0B 2AXTU 3GIMA 1JROA 3NVZA 3GZFA 2VANA 3F5AA 1CEZA 3HP6A 3QXGA 4DL7A 4O9MA 2J6SA 4UAWA 2XGPA 4QZEA 2P6RA 4K99A 4RQ8A 2JRZA 2AGQA 9ICCA 4FE3A 3KHLA 3BJYA 2HN2A 1B43A 4TQSA 4OD0A 4DS4A 1SL0A 1WCNA 5CB1A 1S8OA 2I5HA 4IR9A 1ED1A 3H8JA 3MDAA 2HHTA 3AQEA 4EX6A 1OUQA 3RFAA 1SWWA 4X5VA 1K5OA 2DFLA 3F53A 2LKYA 3C29A 1LKYB 4M47A 9ICKA 9ICVA 3EUB2 3C5FA 4KLIA 4B9MA 4R64A 4KLHA 3QEAZ 2QARB 5FP0A 1NK7A 4LT6A 3N28A 2KJ5A 2GH1A 5JTGA 7ICUA 3OVBA 1RM6C 3NGDA 4HX0A 2F77X 2ID1A 2O6KA 2R8GA 1R89A 4WC2A 3M9MB 9ICFA 3RTVA 2JGAA 2KD1A 2M2TA 5KG1A 4QW9A 8ICNA 1NKBA 4QZ8A 3Q8QB 7ICNA 1PK1B 2W04A 4QIWC 5J8YC 4RQ6A 2PFNA 4CF4A 2KIWA 5HNKA 1TV9A 1BPDA 2F8KA 4IRKA 2I1QA 3JPTA 5CFUA 1Q8KA 9ICAA 2OCEA 3RH6A 2W55A 5J2JA 4MFAA 2A3VA 3LVVA 2DF4B 4UARA 7ICOA 3IG5A 2G5IB 4KLTA 2RFFA 4O3PA 2BQ3A 9ICRA 2FLLA 3RJEA 2BZFA 4RQ0A 2G0AA 2ZH4A 4Y2TA 5L9XA 4J9NA 4EBEA 3WFOA 1TK8A 4EZ6A 3UMBA 3WK7A 3KHHA 5J0XA 1U47A 5DQIA 4J9PA 4EEBA 1WUDA 3M8RA 2A1JA 4RQ2A 2GLEA 5CFSA 1JI7A 4M0AA 1KKXA 2HBJA 1N63A 2ZUBA 5A0LA 4R8UB 2HSZA 2WF6A 2K60A 4ECZA 1KSPA 1MIWA 1ZJNA 4EYIB 5HHIA 3MFIA 3S6JA 3QX7A 5J2GA 3Q8MA 4RQMA 3E0FA 5IIKA 5HHHA 1JALA 3N7SC 5IIMA 1V9PA 2VA8A 3NTUA 2Q0ZX 3I76A 5AIBA 4I2FA 4ATBB 4JK1A 4RQ4A 2KVCA 3PSIA 4TUQA 1LB2B 5KFXA 2JEIA 4DFMA 3WKCA 1PVPA 1N5XA 3L9DA 2AGPA 2K8BB 3M6ZA 3WK5A 2BPFA 3HILA 5DDYA 1ZQSA 2JEGA 3V7JA 1Q79A 2W9BA 4TUPA 2PMZF 3JCFA 5EWFA 1JRPA 4C8OA 1KN5A 4ED2A 2VA2A 5IIJA 1H38A 3BQ2A 3BZKA 3V72A 5DB7A 2KTQA 4DQSA 1ZQVA 5ALTA 4FBTA 1Z4NA 1VFGA 4NL9C 3ISDA 4RPYA 3PY8A 2MUTB 2LYAA 3VC8A 5DDMA 4YXJA 3PX6A 3TACB 1ZQ1C 1BGXT 5H2FU 3TFSA 4O5KA 9ICJA 5J8YA 3SV3A 5CEHA 3ED5A 4C80A 8ICUA 5KFFA 2VKQA
chains in the Genus database with same CATH topology
3V6HA 2LYHA 4K4IA 3C23A 2IA6A 5KTQA 3WFRE 1L3TA 4JUZA 2HHUA 2KP7A 5EOZA 2R8JA 4RQ5A 4F4KA 1U45A 4I2EA 4G3IA 3RRGA 2BE3A 8ICTA 4UB4A 1NJZA 4YMOA 4Q44A 3Q8LA 4RWPA 3GFKB 5KFRA 3Q8RB 4YN4A 1BNOA 2BPCA 4RWOA 5KG0A 1B22A 3QZ8A 4DQQA 2HHQA 4F8RA 5KFYA 4QZIA 5KG4A 9ICNA 8ICQA 3C66A 4RPXA 4J9QA 4DFKA 3QEBZ 1NK4A 3WFSC 4WC5A 4ECVA 4DWIA 1DK3A 3TAPA 2BPGA 1S10A 4DLEA 3QE9Y 2H5XA 5KFMA 4UD4A 1S77D 4MEXA 4RUAA 2O1PA 3AQMA 3ZDBA 3UPQA 1BVSA 4RT3A 4M9JA 4RNNA 4RT2A 1NJYA 3OUYB 3OHBA 5KT7A 2W9AA 1ZQLA 5J2KA 4F4ZA 1ZQTA 5KT5A 5DB8A 3KTQA 4KLQA 7ICQA 1IM4A 8ICHA 4QWCA 2ZH2A 4R63A 4C8NA 2FPMA 4UAZA 1S0MA 5HRFA 2B21A 1R8AA 5HMLA 1BPXA 4JV1A 5DQHA 8ICKA 3LWLA 5KFLA 4Q8FA 2C2DA 3GIIA 1ZQDA 3HJ1A 3C2MA 2IHMA 3RJJA 1RYRA 2Y1IA 2HVHA 4FH3A 3WFPA 4BXOB 3OJUA 2BCUA 3GV8B 3GQCA 4X0BA 4DSJA 1D8LA 4YVZA 4YCXA 2V4QA 3ZDDA 9ICQA 4BWMA 2JZBA 3ISBA 4NM1A 5C5JA 2V9WA 3JZ0A 4KLFA 3LQCB 1ZQMA 4E7XA 1ZJMA 4F50A 8ICBA 3TARA 1ZQZA 2HW3A 4Z6DA 2FPLA 2M2WA 3H7IA 5L1IA 4F4YA 3RBDA 1S0VA 5DBAA 2XCAA 1ZQFA 2RDIA 8ICMA 2NRVA 3RB0A 5J0UA 1ZQBA 4E0DA 2HHWA 4YR3A 1Z3EB 4B9UA 4MEYA 1D9FA 1HUZA 2MUTA 4TQRA 2J6TA 5CHGA 3UPSA 2GWSA 3KHRA 4KTQA 1XS9D 5DEDA 2ZUDA 4RPZA 3PV8A 4O5EA 1ZQPA 3RR7A 4YMMA 3JPQA 9ICPA 4Z6FA 5J2EA 2IMWP 3GV5B 2ZH9A 4QWAA 1TVAA 8ICPA 1QLNA 1ZQNA 7ICIA 1N56A 3AU2A 4LZDA 3EWAA 3PW7A 2RDJA 4J9MA 4ELUA 2ZHBA 4PGQA 3OSNA 2DRAA 4QZAA 1U49A 4PHDA 4R65A 2JEFA 1T7PA 1ZQEA 4NLZA 9ICWA 1MIYA 3K75D 1RXVA 2P66A 7ICGA 1DGSA 9ICBA 4I2BA 4DOAA 2DR7A 4DLGA 2C2RA 2XY6A 3G6YA 3PX4A 4EP7A 1Z00B 3C1ZA 3C5GA 4IQVA 4F92B 4ED3A 8ICXA 2KFNA 8ICGA 1KDHA 4YR2A 4YQWA 3FYHA 5KFZA 1ZQIA 3V6JA 1D9DA 2M2UA 5CR0A 3OJSA 8ICLA 4TURA 3GV7B 4QWDA 5J2BA 3HX0A 1K1QA 4F5OA 4S3NA 3PY8A 4YR0A 5J2HA 7ICJA 2P6UA 1OU5A 2JZBB 4QZCA 4GC7A 4RU9A 3SYZA 4RQ3A 5DQGA 1SL2A 4ELVA 8ICFA 4DFPA 8ICWA 4YMNA 4FS2A 3RBEA 4M9GA 2ZH7A 4GXKA 9ICMA 2ZHAA 5CJ7A 1WCLA 1ZETA 1NJXA 1NK0A 3IHQB 4KITB 3HWTA 3T5LA 3TAQA 5J0SA 4J9SA 4B9NA 3MR6A 1C7YA 4X4QA 3V7KA 3PNCA 1ZQCA 1ZQOA 1AROP 7ICMA 2ZH8A 4UB2A 1F5AA 4B9LA 4YD1A 4EBJA 4NXZA 3LK9A 4DQPA 2NRWA 5J2IA 1X9WA 2AQ0A 4P4PA 1SZPA 1FA0A 3MFHA 4X4SA 2BQRA 8ICIA 3BQ1A 4FS1A 4AT8B 5HRHA 8ICZA 2W9MA 4NM2A 1NK9A 1KFDA 4O3QA 3Q8PB 3OUYA 4DEZA 3UQ2A 1SL1A 5L1KA 4JWMA 5KFGA 1ZQJA 5J2DA 4RUCA 1XSLA 2OWOA 3T3FA 8ICSA 5DECA 4X4UA 4XRHA 4KLSA 4RQ7A 1DOQA 5IILA 5KFBA 4UB5A 8ICAA 1VJ7A 4FHVA 3C2LA 4RQ1A 1ZQWA 4YG2A 4RNMA 1T8EA 4IQUA 4QZGA 2ZTCA 3TFRA 4R66A 3PW5A 5J0YA 4X4VA 4K4HA 1NZPA 3MGHA 4P2HA 4KLDA 1TFYA 3ZD8A 5J0OA 3BQTA 5JUMA 1ZQQA 2R8KA 4CCHA 4WC3A 3EPIA 4BXOA 5KG6A 4I2IA 5EWGA 3MABA 3JPRA 5KFHA 2XY7A 2ISOA 4KLOA 5DG8A 1NOMA 2XY5A 1UA1A 2ZUCA 2W8KA 2UVUA 3WFQE 2XO7A 4UB3A 2XGQA 2R8HA 2ASLA 3SI8A 2PFPA 3V6KA 1L3VA 3V7LA 4ECXA 7ICFA 4NKTA 1KRPA 2M9NA 2UVVA 1S0NA 3FDSA 4TUSA 2KN7A 3Q8KA 1A76A 5J0QA 3UXOA 4IRCA 1NKCA 4IRDA 9ICIA 5J2AA 9ICOA 4XQ7A 1XSNA 4UD5A 4DF8A 4O5CA 8ICCA 5KFEA 4KLEA 5KFPA 4FBUA 2Q66A 3UXPA 5KFNA 3ZDCA 5HREA 2NRKA 3MGIA 3H37A 1KTQA 4WBZA 4DL4A 1MIVA 2O5AA 4DL3A 3ISCA 4DL5A 4NLNA 3UQ0A 1SKSA 2ZH3A 1S76D 3PW0A 2BR0A 1TFRA 1XO1A 3T5HA 4P4OA 3MR3A 4I2GA 3AUOA 2ASJA 3PO5A 4RZRA 1U9LA 3GIJA 3LWMA 2AGOA 1NJWA 5KT4A 1R8CA 3H38A 4YFKA 4Z6CA 3IM1A 4Q45A 3EYZA 1RXWA 4BWJA 5HRKA 2IHNA 3MBYA 3HW8A 5BOMA 1Z00A 3MR5A 5KFQA 3AQNA 1D8YA 3GIMA 1TAQA 3H4BA 3PO4A 5L1JA 3THVA 5HRGA 1ZQRA 2BCQA 1NK8A 2VANA 4QWEA 2VA3A 2BGWA 4J9OA 1KEJA 2J6UA 1COOA 4C8MA 3C18A 4FHYA 4UAYA 1CEZA 3B0YA 4QW8A 9ICEA 4XUSA 3OVSA 4DL6A 3HP6A 2ALZA 4NLGA 9ICXA 3OV7A 5KG7A 4ED7A 5KFCA 4DL7A 4O9MA 5J0PA 2KZ3A 1V4AA 2J6SA 4UAWA 5J29A 2XGPA 7ICHA 2F1JA 3SV4A 1SKWA 4QZEA 3M8SA 2P6RA 2M2TA 4QWBA 4RQ8A 2UVWA 4FH5A 2AGQA 2M2VA 9ICCA 3KHLA 4FHWA 3BJYA 1UETA 2BCRA 5J0TA 4I2AA 4DQRA 1U48A 1B43A 2R8IA 4AT8A 4J9KA 4TQSA 3HIYA 4MFFA 4KLUA 4DS4A 5TZVA 3H40A 1ZYQA 1SL0A 1WCNA 5CB1A 3RB6A 4AT7B 4F5RA 1NKEA 2IBKA 3H8JA 3MR2A 3MDAA 5KFOA 4ED6A 4IR9A 4X4RA 1EXNA 7ICTA 5IIOA 3ORYA 5KFDA 4FHXA 2HHTA 3G6XA 8ICEA 3PR4A 7ICPA 5DB9A 5BPCA 2MAXA 4WC0A 4WBYA 4X5VA 5KFIA 4HYKA 2DFLA 4KMUA 2DR5A 4M47A 4DSEA 9ICKA 9ICVA 4BDPA 4C8KA 2ZTEA 5J0RA 4O3SA 5HMMA 3C5FA 1K1SA 4KLIA 4B9MA 2DR9A 4R64A 2HVIA 4KLHA 1T3NA 1XU4A 4O3NA 4I27A 1PZNA 3QEAZ 1NK7A 2PI4A 4LT6A 4FHPA 3H8SA 4BGDA 3RJGA 3RJHA 4B9VA 4F3OA 4X4PA 4MF2A 7ICUA 4KN4A 3BQ0A 1LV5A 5J2CA 4F93B 4F5QA 4ED0A 7ICKA 4PHEA 5HP4A 1KLNA 3NGDA 1L5UA 5HR9A 1QSYA 4F2SA 5HRLA 1MQ3A 2XCPA 4I29A 3ZD9A 3SZ2A 3HT3A 1S0OA 2ID1A 1BPZA 5DLGA 2R8GA 2ZJ5A 1MQ2A 1R89A 4WC2A 3PW4A 2FMPA 3M9MB 9ICFA 4NLKA 2ZTDA 1JX4A 3RTVA 1JXLA 4M6WB 5J2FA 3EPGA 1BPBA 4UB1A 2BQUA 2KFZA 1BNPA 5KG1A 4QW9A 4J9RA 4B9TA 8ICNA 1S97A 1TFWA 1NKBA 5F9LA 3JPOA 4AT9B 4ED8A 4QZ8A 4QZDA 3Q8QB 4M9HA 2I9GA 3H3AA 2HHPA 7ICNA 1S9FA 2C22A 4MF8A 4RQ6A 5L1LA 1MC8A 3PR5B 3RRHA 2PFNA 4NY8A 5F2VO 4ECUA 4ECWA 4I2DA 1MSWD 3PX0A 3GIKA 5KFSA 5KT2A 3JPNA 4KN7A 3GDXA 5KFUA 5HNKA 2FPKA 1TV9A 2BDPA 9ICTA 1BPDA 2ZH6A 4EBCA 4JV0A 4PH5A 4IRKA 3C1YA 2I1QA 4Q43A 2ASDA 3JPTA 2BHNA 4DS5A 3PMLA 9ICAA 4WCWA 3RH6A 4ECRA 2XC9A 1X9SA 2F1HA 3MDCA 5KFKA 1QSLA 3RAXA 1JQRA 2JEJA 1KFTA 5J2JA 4DOBA 5KT6A 4MFAA 4M2YA 2W9CB 4EZ9A 4RNOA 4IQTA 2W9BB 3AQKA 5HRDA 7ICOA 3M9NB 4KLTA 2RFFA 4O3PA 2BQ3A 2DRBA 9ICRA 5KFTA 8ICYA 4X4TA 4YD2A 3TI0A 3OVBA 1IXRA 4P4MA 5D46A 2FLLA 3RJEA 4RQ0A 4KLLA 4KLMA 4X4NA 2PBEA 1UT5A 4M5DA 5EWEA 2ZH4A 3ZDEA 4PGXA 4DOCA 4IR1A 2PFQA 4AT7A 3JYYA 4LVSA 3EZ5A 5DG9A 2AQ4A 5L9XA 3RH5A 4J9NA 4EBEA 1U4BA 1ZQGA 1T4GA 1DK2A 4F5PA 3WFOA 1TK8A 1BPYA 1KFSA 5HRBA 5DLFA 4EZ6A 1JIHA 5KG2A 4GXJA 4GXIA 4ECQA 4M9NA 4ATBA 3KHHA 3LDAA 3PW2A 4X4OA 5J0XA 7ICVA 1U47A 4DSIA 5DQIA 3HJ4A 4J9PA 2UVRA 5CA7A 3EW9A 3RH4A 1N48A 3M8RA 1RYSA 2A1JA 4RQ2A 4JWNA 4F5NA 4LZGA 2KZMA 2ZH1A 5DBCA 3JPPA 5KFJA 4M0AA 2ZUBA 3PMNA 2NRXA 4ECSA 8ICOA 4IG8A 3KHGA 4I2HA 3JPSA 2FLPA 4DSLA 5DBBA 4UQGA 4R8UB 4YXMA 3Q8SB 2BCVA 4C8LA 1NO5A 3K4GA 1JN3A 4RWQA 5DKWA 5DGBA 4UBBA 4NKUA 1ZQAA 3RB4A 4ECZA 1KSPA 4FO6A 4M9LA 3NYBA 5KT3A 3PVXA 3C21A 2ATLA 1RZTA 3RR8A 4E80A 1MIWA 2NRZA 8ICJA 1UEUA 5HC9A 4DQIA 1X2IA 4QZHA 2Y1JA 1ZJNA 4EYIB 4EEYA 2C2EA 4PHPA 5HHIA 3MFIA 4Q8EA 2V4RA 1HUOA 2F1IA 4I2JA 5J2GA 1SKRA 7ICEA 3Q8MA 4X0AA 3UXNA 4M6WA 3QZ7A 4DSKA 1ZQXA 1X9MA 5IIKA 5HHHA 4PGYA 4AT9A 1Y88A 5CP2A 4MFCA 5IIMA 4WC4A 1V9PA 2VA8A 1NK5A 2NRTA 1NK6A 3NTUA 4IQWA 1R8BA 1QSSA 2ISPA 3E2EA 2Q0ZX 4ZH4A 4GLXA 4M04A 4I2FA 4YP3A 2WTFA 4ATBB 5HRIA 4JK1A 2BKEA 5DGAA 5IIIA 3M9OB 4PHAA 4RQ4A 3OHAA 1ZQKA 1KNYA 1L3SA 5CWRA 3T5JA 4Z6EA 1UA0A 5KG3A 4TUQA 1LB2B 2KZZA 5KFXA 1RPLA 1ZQUA 2JEIA 2A1JB 2DVIA 4EBKA 4DFMA 5F9NA 4EBDA 4XA5A 3RJFA 7ICRA 3RB3A 1ZQHA 8ICVA 9ICGA 3L9DA 1QTMA 4DO9A 1TK0A 1JMSA 4PPXA 4RWNA 2AGPA 4QZFA 2C28A 2DPIA 1JXEA 5KFVA 4I28A 2BPFA 1A77A 5KFWA 5DDYA 2W9CA 1ZQSA 2JEGA 3V7JA 1Q79A 4DF4A 1XWLA 2W9BA 3H8WA 9ICHA 4TUPA 2PI5A 4O3RA 9ICLA 3RAQA 3AQLA 4WC6A 1YLQA 3OVAA 5EWFA 1TAUA 3OGUA 4F4XA 4C8OA 2HHSA 3H39A 5KFAA 4JV2A 4WC7A 3N4MB 4DSFA 7ICLA 1BPEA 4ED2A 2PFOA 3HPOA 2VA2A 5IIJA 4GC6A 1Q78A 2W8LA 4K4GA 3TANA 5J0WA 5IINA 1H38A 3C2KA 1TK5A 4KLJA 1UEVA 3BQ2A 4E8FA 3V72A 5DB7A 4O0IA 2KTQA 9ICSA 4O3OA 1WOTA 4F91B 4DQSA 1ZQVA 3GILA 5KG5A 4DFJA 2FMQA 3H4DA 3T5KA 5D4BA 2FLNA 4B9SA 4FBTA 9ICUA 2ZJAA 3TQ1A 1VFGA 3ISDA 3RJKA 4J9LA 1JAJA 4RPYA 3ETLA 1UT8A 2MUTB 4ECTA 4ECYA 3RJIA 2AU0A 1XC9A 1TKDA 4KLGA 2AJQA 5DDMA 4YXJA 2FMSA 2ZJ8A 3G6VA 3PX6A 2HHVA 4EYHB 4WC1A 3ZDAA 4QZBA 5DG7A 3BDPA 4UBCA 1L3UA 4XQ8A 5BOLA 3OSPA 3B0XA 4F2RA 1XSPA 1BGXT 1HJPA 4ED1A 4R8UA 1CUKA 2DPJA 2PXIA 4QZ9A 3TFSA 4O5KA 9ICJA 4DL2A 5D49A 3N97B 2BCSA 7ICSA 3SV3A 4ELTA 4F4WA 2DR8A 1ZQYA 4I2CA 3AU6A 5DB6A 2HHXA 8ICUA 1PX5A 2ZH5A 5KFFA 8ICRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6H A;  2LYH A;  4K4I A;  3C23 A;  2IA6 A;  5KTQ A;  3WFR E;  1L3T A;  4JUZ A;  2HHU A;  2KP7 A;  5EOZ A;  2R8J A;  4RQ5 A;  4F4K A;  1U45 A;  4I2E A;  4G3I A;  3RRG A;  2BE3 A;  8ICT A;  4UB4 A;  1NJZ A;  4YMO A;  4Q44 A;  3Q8L A;  4RWP A;  3GFK B;  5KFR A;  3Q8R B;  4YN4 A;  1BNO A;  2BPC A;  4RWO A;  5KG0 A;  1B22 A;  3QZ8 A;  4DQQ A;  2HHQ A;  4F8R A;  5KFY A;  4QZI A;  5KG4 A;  9ICN A;  8ICQ A;  3C66 A;  4RPX A;  4J9Q A;  4DFK A;  3QEB Z;  1NK4 A;  3WFS C;  4WC5 A;  4ECV A;  4DWI A;  1DK3 A;  3TAP A;  2BPG A;  1S10 A;  4DLE A;  3QE9 Y;  2H5X A;  5KFM A;  4UD4 A;  1S77 D;  4MEX A;  4RUA A;  2O1P A;  3AQM A;  3ZDB A;  3UPQ A;  1BVS A;  4RT3 A;  4M9J A;  4RNN A;  4RT2 A;  1NJY A;  3OUY B;  3OHB A;  5KT7 A;  2W9A A;  1ZQL A;  5J2K A;  4F4Z A;  1ZQT A;  5KT5 A;  5DB8 A;  3KTQ A;  4KLQ A;  7ICQ A;  1IM4 A;  8ICH A;  4QWC A;  2ZH2 A;  4R63 A;  4C8N A;  2FPM A;  4UAZ A;  1S0M A;  5HRF A;  2B21 A;  1R8A A;  5HML A;  1BPX A;  4JV1 A;  5DQH A;  8ICK A;  3LWL A;  5KFL A;  4Q8F A;  2C2D A;  3GII A;  1ZQD A;  3HJ1 A;  3C2M A;  2IHM A;  3RJJ A;  1RYR A;  2Y1I A;  2HVH A;  4FH3 A;  3WFP A;  4BXO B;  3OJU A;  2BCU A;  3GV8 B;  3GQC A;  4X0B A;  4DSJ A;  1D8L A;  4YVZ A;  4YCX A;  2V4Q A;  3ZDD A;  9ICQ A;  4BWM A;  2JZB A;  3ISB A;  4NM1 A;  5C5J A;  2V9W A;  3JZ0 A;  4KLF A;  3LQC B;  1ZQM A;  4E7X A;  1ZJM A;  4F50 A;  8ICB A;  3TAR A;  1ZQZ A;  2HW3 A;  4Z6D A;  2FPL A;  2M2W A;  3H7I A;  5L1I A;  4F4Y A;  3RBD A;  1S0V A;  5DBA A;  2XCA A;  1ZQF A;  2RDI A;  8ICM A;  2NRV A;  3RB0 A;  5J0U A;  1ZQB A;  4E0D A;  2HHW A;  4YR3 A;  1Z3E B;  4B9U A;  4MEY A;  1D9F A;  1HUZ A;  2MUT A;  4TQR A;  2J6T A;  5CHG A;  3UPS A;  2GWS A;  3KHR A;  4KTQ A;  1XS9 D;  5DED A;  2ZUD A;  4RPZ A;  3PV8 A;  4O5E A;  1ZQP A;  3RR7 A;  4YMM A;  3JPQ A;  9ICP A;  4Z6F A;  5J2E A;  2IMW P;  3GV5 B;  2ZH9 A;  4QWA A;  1TVA A;  8ICP A;  1QLN A;  1ZQN A;  7ICI A;  1N56 A;  3AU2 A;  4LZD A;  3EWA A;  3PW7 A;  2RDJ A;  4J9M A;  4ELU A;  2ZHB A;  4PGQ A;  3OSN A;  2DRA A;  4QZA A;  1U49 A;  4PHD A;  4R65 A;  2JEF A;  1T7P A;  1ZQE A;  4NLZ A;  9ICW A;  1MIY A;  3K75 D;  1RXV A;  2P66 A;  7ICG A;  1DGS A;  9ICB A;  4I2B A;  4DOA A;  2DR7 A;  4DLG A;  2C2R A;  2XY6 A;  3G6Y A;  3PX4 A;  4EP7 A;  1Z00 B;  3C1Z A;  3C5G A;  4IQV A;  4F92 B;  4ED3 A;  8ICX A;  2KFN A;  8ICG A;  1KDH A;  4YR2 A;  4YQW A;  3FYH A;  5KFZ A;  1ZQI A;  3V6J A;  1D9D A;  2M2U A;  5CR0 A;  3OJS A;  8ICL A;  4TUR A;  3GV7 B;  4QWD A;  5J2B A;  3HX0 A;  1K1Q A;  4F5O A;  4S3N A;  3PY8 A;  4YR0 A;  5J2H A;  7ICJ A;  2P6U A;  1OU5 A;  2JZB B;  4QZC A;  4GC7 A;  4RU9 A;  3SYZ A;  4RQ3 A;  5DQG A;  1SL2 A;  4ELV A;  8ICF A;  4DFP A;  8ICW A;  4YMN A;  4FS2 A;  3RBE A;  4M9G A;  2ZH7 A;  4GXK A;  9ICM A;  2ZHA A;  5CJ7 A;  1WCL A;  1ZET A;  1NJX A;  1NK0 A;  3IHQ B;  4KIT B;  3HWT A;  3T5L A;  3TAQ A;  5J0S A;  4J9S A;  4B9N A;  3MR6 A;  1C7Y A;  4X4Q A;  3V7K A;  3PNC A;  1ZQC A;  1ZQO A;  1ARO P;  7ICM A;  2ZH8 A;  4UB2 A;  1F5A A;  4B9L A;  4YD1 A;  4EBJ A;  4NXZ A;  3LK9 A;  4DQP A;  2NRW A;  5J2I A;  1X9W A;  2AQ0 A;  4P4P A;  1SZP A;  1FA0 A;  3MFH A;  4X4S A;  2BQR A;  8ICI A;  3BQ1 A;  4FS1 A;  4AT8 B;  5HRH A;  8ICZ A;  2W9M A;  4NM2 A;  1NK9 A;  1KFD A;  4O3Q A;  3Q8P B;  3OUY A;  4DEZ A;  3UQ2 A;  1SL1 A;  5L1K A;  4JWM A;  5KFG A;  1ZQJ A;  5J2D A;  4RUC A;  1XSL A;  2OWO A;  3T3F A;  8ICS A;  5DEC A;  4X4U A;  4XRH A;  4KLS A;  4RQ7 A;  1DOQ A;  5IIL A;  5KFB A;  4UB5 A;  8ICA A;  1VJ7 A;  4FHV A;  3C2L A;  4RQ1 A;  1ZQW A;  4YG2 A;  4RNM A;  1T8E A;  4IQU A;  4QZG A;  2ZTC A;  3TFR A;  4R66 A;  3PW5 A;  5J0Y A;  4X4V A;  4K4H A;  1NZP A;  3MGH A;  4P2H A;  4KLD A;  1TFY A;  3ZD8 A;  5J0O A;  3BQT A;  5JUM A;  1ZQQ A;  2R8K A;  4CCH A;  4WC3 A;  3EPI A;  4BXO A;  5KG6 A;  4I2I A;  5EWG A;  3MAB A;  3JPR A;  5KFH A;  2XY7 A;  2ISO A;  4KLO A;  5DG8 A;  1NOM A;  2XY5 A;  1UA1 A;  2ZUC A;  2W8K A;  2UVU A;  3WFQ E;  2XO7 A;  4UB3 A;  2XGQ A;  2R8H A;  2ASL A;  3SI8 A;  2PFP A;  3V6K A;  1L3V A;  3V7L A;  4ECX A;  7ICF A;  4NKT A;  1KRP A;  2M9N A;  2UVV A;  1S0N A;  3FDS A;  4TUS A;  2KN7 A;  3Q8K A;  1A76 A;  5J0Q A;  3UXO A;  4IRC A;  1NKC A;  4IRD A;  9ICI A;  5J2A A;  9ICO A;  4XQ7 A;  1XSN A;  4UD5 A;  4DF8 A;  4O5C A;  8ICC A;  5KFE A;  4KLE A;  5KFP A;  4FBU A;  2Q66 A;  3UXP A;  5KFN A;  3ZDC A;  5HRE A;  2NRK A;  3MGI A;  3H37 A;  1KTQ A;  4WBZ A;  4DL4 A;  1MIV A;  2O5A A;  4DL3 A;  3ISC A;  4DL5 A;  4NLN A;  3UQ0 A;  1SKS A;  2ZH3 A;  1S76 D;  3PW0 A;  2BR0 A;  1TFR A;  1XO1 A;  3T5H A;  4P4O A;  3MR3 A;  4I2G A;  3AUO A;  2ASJ A;  3PO5 A;  4RZR A;  1U9L A;  3GIJ A;  3LWM A;  2AGO A;  1NJW A;  5KT4 A;  1R8C A;  3H38 A;  4YFK A;  4Z6C A;  3IM1 A;  4Q45 A;  3EYZ A;  1RXW A;  4BWJ A;  5HRK A;  2IHN A;  3MBY A;  3HW8 A;  5BOM A;  1Z00 A;  3MR5 A;  5KFQ A;  3AQN A;  1D8Y A;  3GIM A;  1TAQ A;  3H4B A;  3PO4 A;  5L1J A;  3THV A;  5HRG A;  1ZQR A;  2BCQ A;  1NK8 A;  2VAN A;  4QWE A;  2VA3 A;  2BGW A;  4J9O A;  1KEJ A;  2J6U A;  1COO A;  4C8M A;  3C18 A;  4FHY A;  4UAY A;  1CEZ A;  3B0Y A;  4QW8 A;  9ICE A;  4XUS A;  3OVS A;  4DL6 A;  3HP6 A;  2ALZ A;  4NLG A;  9ICX A;  3OV7 A;  5KG7 A;  4ED7 A;  5KFC A;  4DL7 A;  4O9M A;  5J0P A;  2KZ3 A;  1V4A A;  2J6S A;  4UAW A;  5J29 A;  2XGP A;  7ICH A;  2F1J A;  3SV4 A;  1SKW A;  4QZE A;  3M8S A;  2P6R A;  2M2T A;  4QWB A;  4RQ8 A;  2UVW A;  4FH5 A;  2AGQ A;  2M2V A;  9ICC A;  3KHL A;  4FHW A;  3BJY A;  1UET A;  2BCR A;  5J0T A;  4I2A A;  4DQR A;  1U48 A;  1B43 A;  2R8I A;  4AT8 A;  4J9K A;  4TQS A;  3HIY A;  4MFF A;  4KLU A;  4DS4 A;  5TZV A;  3H40 A;  1ZYQ A;  1SL0 A;  1WCN A;  5CB1 A;  3RB6 A;  4AT7 B;  4F5R A;  1NKE A;  2IBK A;  3H8J A;  3MR2 A;  3MDA A;  5KFO A;  4ED6 A;  4IR9 A;  4X4R A;  1EXN A;  7ICT A;  5IIO A;  3ORY A;  5KFD A;  4FHX A;  2HHT A;  3G6X A;  8ICE A;  3PR4 A;  7ICP A;  5DB9 A;  5BPC A;  2MAX A;  4WC0 A;  4WBY A;  4X5V A;  5KFI A;  4HYK A;  2DFL A;  4KMU A;  2DR5 A;  4M47 A;  4DSE A;  9ICK A;  9ICV A;  4BDP A;  4C8K A;  2ZTE A;  5J0R A;  4O3S A;  5HMM A;  3C5F A;  1K1S A;  4KLI A;  4B9M A;  2DR9 A;  4R64 A;  2HVI A;  4KLH A;  1T3N A;  1XU4 A;  4O3N A;  4I27 A;  1PZN A;  3QEA Z;  1NK7 A;  2PI4 A;  4LT6 A;  4FHP A;  3H8S A;  4BGD A;  3RJG A;  3RJH A;  4B9V A;  4F3O A;  4X4P A;  4MF2 A;  7ICU A;  4KN4 A;  3BQ0 A;  1LV5 A;  5J2C A;  4F93 B;  4F5Q A;  4ED0 A;  7ICK A;  4PHE A;  5HP4 A;  1KLN A;  3NGD A;  1L5U A;  5HR9 A;  1QSY A;  4F2S A;  5HRL A;  1MQ3 A;  2XCP A;  4I29 A;  3ZD9 A;  3SZ2 A;  3HT3 A;  1S0O A;  2ID1 A;  1BPZ A;  5DLG A;  2R8G A;  2ZJ5 A;  1MQ2 A;  1R89 A;  4WC2 A;  3PW4 A;  2FMP A;  3M9M B;  9ICF A;  4NLK A;  2ZTD A;  1JX4 A;  3RTV A;  1JXL A;  4M6W B;  5J2F A;  3EPG A;  1BPB A;  4UB1 A;  2BQU A;  2KFZ A;  1BNP A;  5KG1 A;  4QW9 A;  4J9R A;  4B9T A;  8ICN A;  1S97 A;  1TFW A;  1NKB A;  5F9L A;  3JPO A;  4AT9 B;  4ED8 A;  4QZ8 A;  4QZD A;  3Q8Q B;  4M9H A;  2I9G A;  3H3A A;  2HHP A;  7ICN A;  1S9F A;  2C22 A;  4MF8 A;  4RQ6 A;  5L1L A;  1MC8 A;  3PR5 B;  3RRH A;  2PFN A;  4NY8 A;  5F2V O;  4ECU A;  4ECW A;  4I2D A;  1MSW D;  3PX0 A;  3GIK A;  5KFS A;  5KT2 A;  3JPN A;  4KN7 A;  3GDX A;  5KFU A;  5HNK A;  2FPK A;  1TV9 A;  2BDP A;  9ICT A;  1BPD A;  2ZH6 A;  4EBC A;  4JV0 A;  4PH5 A;  4IRK A;  3C1Y A;  2I1Q A;  4Q43 A;  2ASD A;  3JPT A;  2BHN A;  4DS5 A;  3PML A;  9ICA A;  4WCW A;  3RH6 A;  4ECR A;  2XC9 A;  1X9S A;  2F1H A;  3MDC A;  5KFK A;  1QSL A;  3RAX A;  1JQR A;  2JEJ A;  1KFT A;  5J2J A;  4DOB A;  5KT6 A;  4MFA A;  4M2Y A;  2W9C B;  4EZ9 A;  4RNO A;  4IQT A;  2W9B B;  3AQK A;  5HRD A;  7ICO A;  3M9N B;  4KLT A;  2RFF A;  4O3P A;  2BQ3 A;  2DRB A;  9ICR A;  5KFT A;  8ICY A;  4X4T A;  4YD2 A;  3TI0 A;  3OVB A;  1IXR A;  4P4M A;  5D46 A;  2FLL A;  3RJE A;  4RQ0 A;  4KLL A;  4KLM A;  4X4N A;  2PBE A;  1UT5 A;  4M5D A;  5EWE A;  2ZH4 A;  3ZDE A;  4PGX A;  4DOC A;  4IR1 A;  2PFQ A;  4AT7 A;  3JYY A;  4LVS A;  3EZ5 A;  5DG9 A;  2AQ4 A;  5L9X A;  3RH5 A;  4J9N A;  4EBE A;  1U4B A;  1ZQG A;  1T4G A;  1DK2 A;  4F5P A;  3WFO A;  1TK8 A;  1BPY A;  1KFS A;  5HRB A;  5DLF A;  4EZ6 A;  1JIH A;  5KG2 A;  4GXJ A;  4GXI A;  4ECQ A;  4M9N A;  4ATB A;  3KHH A;  3LDA A;  3PW2 A;  4X4O A;  5J0X A;  7ICV A;  1U47 A;  4DSI A;  5DQI A;  3HJ4 A;  4J9P A;  2UVR A;  5CA7 A;  3EW9 A;  3RH4 A;  1N48 A;  3M8R A;  1RYS A;  2A1J A;  4RQ2 A;  4JWN A;  4F5N A;  4LZG A;  2KZM A;  2ZH1 A;  5DBC A;  3JPP A;  5KFJ A;  4M0A A;  2ZUB A;  3PMN A;  2NRX A;  4ECS A;  8ICO A;  4IG8 A;  3KHG A;  4I2H A;  3JPS A;  2FLP A;  4DSL A;  5DBB A;  4UQG A;  4R8U B;  4YXM A;  3Q8S B;  2BCV A;  4C8L A;  1NO5 A;  3K4G A;  1JN3 A;  4RWQ A;  5DKW A;  5DGB A;  4UBB A;  4NKU A;  1ZQA A;  3RB4 A;  4ECZ A;  1KSP A;  4FO6 A;  4M9L A;  3NYB A;  5KT3 A;  3PVX A;  3C21 A;  2ATL A;  1RZT A;  3RR8 A;  4E80 A;  1MIW A;  2NRZ A;  8ICJ A;  1UEU A;  5HC9 A;  4DQI A;  1X2I A;  4QZH A;  2Y1J A;  1ZJN A;  4EYI B;  4EEY A;  2C2E A;  4PHP A;  5HHI A;  3MFI A;  4Q8E A;  2V4R A;  1HUO A;  2F1I A;  4I2J A;  5J2G A;  1SKR A;  7ICE A;  3Q8M A;  4X0A A;  3UXN A;  4M6W A;  3QZ7 A;  4DSK A;  1ZQX A;  1X9M A;  5IIK A;  5HHH A;  4PGY A;  4AT9 A;  1Y88 A;  5CP2 A;  4MFC A;  5IIM A;  4WC4 A;  1V9P A;  2VA8 A;  1NK5 A;  2NRT A;  1NK6 A;  3NTU A;  4IQW A;  1R8B A;  1QSS A;  2ISP A;  3E2E A;  2Q0Z X;  4ZH4 A;  4GLX A;  4M04 A;  4I2F A;  4YP3 A;  2WTF A;  4ATB B;  5HRI A;  4JK1 A;  2BKE A;  5DGA A;  5III A;  3M9O B;  4PHA A;  4RQ4 A;  3OHA A;  1ZQK A;  1KNY A;  1L3S A;  5CWR A;  3T5J A;  4Z6E A;  1UA0 A;  5KG3 A;  4TUQ A;  1LB2 B;  2KZZ A;  5KFX A;  1RPL A;  1ZQU A;  2JEI A;  2A1J B;  2DVI A;  4EBK A;  4DFM A;  5F9N A;  4EBD A;  4XA5 A;  3RJF A;  7ICR A;  3RB3 A;  1ZQH A;  8ICV A;  9ICG A;  3L9D A;  1QTM A;  4DO9 A;  1TK0 A;  1JMS A;  4PPX A;  4RWN A;  2AGP A;  4QZF A;  2C28 A;  2DPI A;  1JXE A;  5KFV A;  4I28 A;  2BPF A;  1A77 A;  5KFW A;  5DDY A;  2W9C A;  1ZQS A;  2JEG A;  3V7J A;  1Q79 A;  4DF4 A;  1XWL A;  2W9B A;  3H8W A;  9ICH A;  4TUP A;  2PI5 A;  4O3R A;  9ICL A;  3RAQ A;  3AQL A;  4WC6 A;  1YLQ A;  3OVA A;  5EWF A;  1TAU A;  3OGU A;  4F4X A;  4C8O A;  2HHS A;  3H39 A;  5KFA A;  4JV2 A;  4WC7 A;  3N4M B;  4DSF A;  7ICL A;  1BPE A;  4ED2 A;  2PFO A;  3HPO A;  2VA2 A;  5IIJ A;  4GC6 A;  1Q78 A;  2W8L A;  4K4G A;  3TAN A;  5J0W A;  5IIN A;  1H38 A;  3C2K A;  1TK5 A;  4KLJ A;  1UEV A;  3BQ2 A;  4E8F A;  3V72 A;  5DB7 A;  4O0I A;  2KTQ A;  9ICS A;  4O3O A;  1WOT A;  4F91 B;  4DQS A;  1ZQV A;  3GIL A;  5KG5 A;  4DFJ A;  2FMQ A;  3H4D A;  3T5K A;  5D4B A;  2FLN A;  4B9S A;  4FBT A;  9ICU A;  2ZJA A;  3TQ1 A;  1VFG A;  3ISD A;  3RJK A;  4J9L A;  1JAJ A;  4RPY A;  3ETL A;  1UT8 A;  2MUT B;  4ECT A;  4ECY A;  3RJI A;  2AU0 A;  1XC9 A;  1TKD A;  4KLG A;  2AJQ A;  5DDM A;  4YXJ A;  2FMS A;  2ZJ8 A;  3G6V A;  3PX6 A;  2HHV A;  4EYH B;  4WC1 A;  3ZDA A;  4QZB A;  5DG7 A;  3BDP A;  4UBC A;  1L3U A;  4XQ8 A;  5BOL A;  3OSP A;  3B0X A;  4F2R A;  1XSP A;  1BGX T;  1HJP A;  4ED1 A;  4R8U A;  1CUK A;  2DPJ A;  2PXI A;  4QZ9 A;  3TFS A;  4O5K A;  9ICJ A;  4DL2 A;  5D49 A;  3N97 B;  2BCS A;  7ICS A;  3SV3 A;  4ELT A;  4F4W A;  2DR8 A;  1ZQY A;  4I2C A;  3AU6 A;  5DB6 A;  2HHX A;  8ICU A;  1PX5 A;  2ZH5 A;  5KFF A;  8ICR A; 
#chains in the Genus database with same CATH topology
 4K4I A;  5KTQ A;  1L3T A;  3KKA C;  2FE9 A;  2B4V A;  2R8J A;  4F4K A;  1U45 A;  2BE3 A;  3M6K A;  3NUQ A;  1WG8 A;  3D2Q A;  4QNL A;  3GFK B;  1B22 A;  5AM5 A;  4DQQ A;  9ICN A;  1X42 A;  8ICQ A;  3QEB Z;  4J9Q A;  3WFS C;  1QQ5 A;  4UD4 A;  3AMZ A;  1S77 D;  2GO7 A;  2W3R A;  2MRL A;  4RT2 A;  3OHB A;  4F4Z A;  5AI0 A;  7ICQ A;  8ICH A;  4QWC A;  4Y2J A;  1R8A A;  2EWR A;  5DQH A;  8ICK A;  3LWL A;  2ES6 A;  1N62 A;  2DQN B;  2FJ6 A;  2Y1I A;  1ZRN A;  4Y2R A;  3WFP A;  3OJU A;  2E8M A;  3GV8 B;  3GQC A;  2BCU A;  2HOQ A;  4DSJ A;  2V4Q A;  1QH9 A;  4BWM A;  2JZB A;  4ICA A;  3LQC B;  2EAP A;  1ZQM A;  2HW3 A;  4Z6D A;  2M2W A;  3H7I A;  1S0V A;  5DBA A;  2XCA A;  3TAD C;  2HHW A;  3BS5 B;  1XS9 D;  2ZUD A;  3WKD A;  2WF8 A;  4O5E A;  2NO4 A;  4YMM A;  3JPQ A;  5J2E A;  2ZH9 A;  2CPR A;  1QLN A;  3AU2 A;  3EWA A;  4ELU A;  4PGQ A;  1V38 A;  1Q3U A;  9ICW A;  4DCC A;  1ZQE A;  2P66 A;  1RXV A;  1ZD5 A;  4I2B A;  2DR7 A;  3F2D A;  3G6Y A;  4MHV A;  1Z00 B;  3C1Z A;  2YMQ A;  4F92 B;  4YR2 A;  1ZD2 P;  3V6J A;  5ALK A;  2M2U A;  1FFV A;  4TUR A;  4F5O A;  2P6U A;  4RU9 A;  4IS7 A;  5DQG A;  2RLT A;  8ICW A;  4YMN A;  3D2S A;  2WB1 F;  1NJX A;  1NK0 A;  3IHQ B;  3T5L A;  4J9S A;  1ZQC A;  3F5E A;  2KIV A;  1ZQO A;  1S5L U;  4XJE A;  2DKZ A;  1FA0 A;  4X4S A;  4C7Z A;  3BQ1 A;  3L4P A;  2W9M A;  1NK9 A;  4DFD A;  1SL1 A;  1XSL A;  2E8N A;  3T3F A;  2QB0 B;  4KLS A;  4NL9 A;  4C7Y A;  2EAN A;  4RQ1 A;  1ZQW A;  3D6J A;  3TFR A;  4X4V A;  1V85 A;  4P2H A;  1TFY A;  5J0O A;  1DRG A;  2BDU A;  2DGZ A;  4WC3 A;  3JPR A;  1Z19 A;  4LEW A;  2ZUC A;  4UB3 A;  3UMC A;  2ASL A;  3SI8 A;  2PFP A;  3V6K A;  4OO1 J;  3ERC C;  4NKT A;  2UVV A;  3FDS A;  2EAM A;  4TUS A;  2KN7 A;  5J0Q A;  3UXO A;  9ICI A;  2HN1 A;  8ICC A;  2NRK A;  3KKA A;  3QYP A;  4WBZ A;  4DL4 A;  4WQL A;  2MA1 A;  3AEV A;  3ISC A;  4PL2 A;  1S76 D;  2BR0 A;  1B4F A;  4JMU A;  4Y2P A;  3LWM A;  3A0B U;  4Z6C A;  2ZXI A;  5BOM A;  5KFQ A;  1D8Y A;  3PO4 A;  4UB6 U;  2NO5 A;  2BCQ A;  1KEJ A;  2J6U A;  4BX9 C;  2MSN A;  3B0Y A;  4QW8 A;  3OVS A;  4EEK A;  3OV7 A;  1Z1B A;  2YN4 A;  1P7D A;  5KG7 A;  4ED7 A;  2KZ3 A;  3DDH A;  5J29 A;  2DBY A;  3SV4 A;  1SKW A;  4QWB A;  1MN8 A;  1Z1V A;  5J0T A;  2ODG A;  1U48 A;  4J9K A;  1XNS A;  4MFF A;  1ZYQ A;  2W43 A;  3DEE A;  7ICT A;  3T79 A;  2Y0S C;  5KFD A;  1N61 A;  3M7D A;  3TAD A;  4HYK A;  5ALR A;  4KMU A;  5AIC A;  4BDP A;  5AKK A;  1K1S A;  2F3N A;  3PST A;  2DR9 A;  1XU4 A;  4O3N A;  2PI4 A;  1YT3 A;  4FHP A;  3RJH A;  3IRU A;  4X4P A;  3SAH A;  2CN1 A;  1FFU A;  4CRX A;  3KFU F;  1LV5 A;  1KW4 A;  1NI3 A;  1KLN A;  1O03 A;  3EF2 A;  4F2S A;  5HRL A;  4US9 A;  3ZD9 A;  3SZ2 A;  2K4E A;  3HT3 A;  2VIX A;  1MQ2 A;  3PW4 A;  5AKE A;  5ALH A;  1JXL A;  5J2F A;  2JHD A;  4UB1 A;  1WWU A;  2BQU A;  1BNP A;  5AKJ A;  4I0U A;  4B9T A;  4AT9 B;  3JPO A;  4ED8 A;  4QZD A;  4M9H A;  4MF8 A;  3PR5 B;  1HIW A;  2ZIV B;  2YX8 A;  3OTQ A;  3JPN A;  5KFU A;  4FZN A;  2BDP A;  4JV0 A;  4LEY A;  3KZX A;  3C1Y A;  2JXJ A;  4Q43 A;  3A0H U;  5AK4 A;  3PML A;  4ECR A;  5JU5 A;  2XC9 A;  1JQR A;  3QU7 A;  5KT6 A;  2YMM A;  2RP5 A;  2W9C B;  4EZ9 A;  4IQT A;  1PVQ A;  3AQK A;  3M9N B;  2DRB A;  4N7R A;  8ICY A;  5D46 A;  4KLL A;  3NKU A;  2PBE A;  1QCK A;  1UT5 A;  4DOC A;  4IR1 A;  4AT7 A;  3JYY A;  3EZ5 A;  5DG9 A;  1U4B A;  5HRB A;  5DLF A;  4GXJ A;  4GXI A;  4ATB A;  4M9N A;  3SD7 A;  3PW2 A;  1COK A;  2KV2 A;  5CA7 A;  3EW9 A;  5ALO A;  1RYS A;  1SB3 C;  2KZM A;  5KFJ A;  4IG8 A;  2NRX A;  8ICO A;  3KHG A;  4DSL A;  2ZXH A;  5AI8 A;  2BCV A;  3UMG A;  4NXV A;  3K4G A;  4RWQ A;  5DKW A;  3RB4 A;  4M9L A;  5EE3 A;  3ER9 B;  2WAQ F;  2WB1 C;  1RZT A;  3RR8 A;  2Q4T A;  1SV0 C;  5HC9 A;  4DQI A;  2Y1J A;  4Q8E A;  1HUO A;  4M6W A;  4UAT A;  4LEV A;  3HKZ C;  2FI1 A;  4PGY A;  2KG5 A;  1T3Q A;  2KE7 A;  1NK5 A;  2K4P A;  1QSS A;  2ISP A;  2PKE A;  1KBU A;  1OW5 A;  1KNY A;  1L3S A;  4Z6E A;  2H3F A;  2KSO B;  1RPL A;  1ZQU A;  2DVI A;  5F9N A;  1SXE A;  5T14 A;  3RB3 A;  5TIS U;  1QTM A;  4PPX A;  4RWN A;  4WH5 A;  5KFV A;  4I28 A;  1A77 A;  5KFW A;  4P0P A;  2ZIX B;  1FO4 A;  1XWL A;  4DF4 A;  9ICH A;  4NXW A;  1HEK A;  2PI5 A;  3FAH A;  1YLQ A;  1TAU A;  3OGU A;  4US8 A;  3WU2 U;  3HJE A;  4WC7 A;  3N4M B;  4DSF A;  7ICL A;  2PFO A;  4GC6 A;  2W8L A;  5J0W A;  1TK5 A;  3CYM A;  4O0I A;  2HBM A;  5JRT A;  9ICS A;  4F91 B;  3GIL A;  4DFJ A;  5KG5 A;  2FMQ A;  2FLN A;  3T5K A;  5D4B A;  2ZJA A;  3TQ1 A;  2E3T A;  3RJK A;  3ETL A;  1UT8 A;  4KLG A;  2AU0 A;  1SWV A;  2ZJ8 A;  3LVW A;  3G6V A;  4QZB A;  3NS1 A;  5BOL A;  3OSP A;  5ALX A;  5AKG A;  2EH9 A;  1HJP A;  1X40 A;  2DPJ A;  1CUK A;  2PXI A;  5ALU A;  3CNH A;  4DL2 A;  2KHV A;  2KKV A;  2D6F C;  3IG8 A;  4F4W A;  4Y2X A;  2HMX A;  2XID A;  1UPH A;  8ICR A;  3V6H A;  2IA6 A;  2KMD A;  2HHU A;  5EOZ A;  4RQ5 A;  4O68 A;  1Z4O A;  4YMO A;  1OXJ A;  3Q8L A;  3H0R B;  4C4T A;  2EQY A;  1BNO A;  2BPC A;  5KG0 A;  3QZ8 A;  3IN5 A;  1N60 A;  5EE9 A;  5KG4 A;  4WOY A;  2LBO A;  1NK4 A;  5AI5 A;  3WK6 A;  4WC5 A;  1DK3 A;  4ECV A;  2BBH A;  2KIC A;  4KX5 A;  2H5X A;  4RUA A;  3I1Y A;  2O1P A;  3ZDB A;  5AK5 A;  1L7P A;  1BVS A;  4GIB A;  3UPQ A;  4EGW A;  2W9A A;  1FIQ A;  3KTQ A;  5DB8 A;  1J2N A;  1IM4 A;  2OH2 A;  4UAZ A;  5HRF A;  2F8L A;  2B21 A;  1FEZ A;  3K1Z A;  3E58 A;  3GII A;  3C2M A;  2IHM A;  3RJJ A;  2ZIW A;  1RYR A;  4BXO B;  2E1E A;  1D8L A;  4YVZ A;  4YCX A;  3ZDD A;  9ICQ A;  4NM1 A;  3JZ0 A;  4KLF A;  4F50 A;  8ICB A;  2W11 A;  1RYU A;  2FPL A;  2LI6 A;  3OPX A;  7ICP A;  5AHX A;  3WK8 A;  2RDI A;  3F2B A;  1SV0 A;  4B9U A;  1D9F A;  1HUZ A;  2J6T A;  3UPS A;  1QQ7 A;  3LYS A;  3KHR A;  2GAF D;  4O3M A;  1ZQP A;  2BBJ A;  2ZG6 A;  8ICP A;  1N56 A;  2ZHB A;  3PW7 A;  2RDJ A;  4QZA A;  2W7O A;  1T7P A;  4NLZ A;  3K75 D;  1DGS A;  9ICB A;  4DOA A;  4KX3 A;  5AKX A;  3CRX A;  2E8O A;  4F71 A;  3C5G A;  1LVH A;  5KFZ A;  1ZQI A;  3OJS A;  4QWD A;  5J2B A;  5AM2 A;  4OAF A;  4YR0 A;  5J2H A;  1GPJ A;  4GC7 A;  3I28 A;  2JV3 A;  4FS2 A;  2ZH7 A;  4M9G A;  4GXK A;  5ALW A;  5CJ7 A;  1WCL A;  1ZET A;  2QB1 A;  4KIT B;  4NLB A;  4JLZ A;  2ZH8 A;  2XIC A;  3NRZ A;  4AYB C;  3ICX A;  4YD1 A;  1SZH A;  3LK9 A;  2NRW A;  5J2I A;  1X9W A;  4B9L A;  3IP4 B;  3MFH A;  4NM2 A;  2Y0S F;  3Q8P B;  4O3Q A;  3OUY A;  3NVY A;  2YTU A;  4DEZ A;  1GO3 F;  5L1K A;  1ZQJ A;  4G9B A;  3QU2 A;  4X4U A;  8ICS A;  4XRH A;  4RQ7 A;  4K97 A;  3H0M B;  1ZRM A;  4RNM A;  2ZTC A;  2WAQ C;  4R66 A;  4P0Q A;  3ZD8 A;  4CCH A;  2R8K A;  4I2I A;  3MAB A;  5KFH A;  2ZIU A;  5DG8 A;  4WQK A;  1UA1 A;  2NV3 A;  1PVR A;  4O6A A;  2WF5 A;  3QU5 A;  5ALP A;  2R8H A;  3WFQ E;  3Q8K A;  1A76 A;  1NKC A;  1XSN A;  4DF8 A;  2Q66 A;  5KFP A;  5G5G A;  3MGI A;  3H37 A;  1L7M A;  4Y2Y A;  1B0X A;  4NXT A;  2O5A A;  3UQ0 A;  4IL6 U;  1SKS A;  1TFR A;  3T5H A;  5AIA A;  2FDR A;  2DKX A;  1A6S A;  3AUO A;  3GIJ A;  1ZXI A;  3IM1 A;  2YQE A;  3MR5 A;  3AQN A;  4NLC A;  3H4B A;  3MGV A;  5HRG A;  2VA3 A;  1NK8 A;  4QWE A;  2BGW A;  4AP9 A;  1N2X A;  1COO A;  4C8M A;  3C18 A;  4FHY A;  9ICE A;  2W3S A;  2G09 A;  2KKP A;  9ICX A;  2Y9T A;  5AI4 A;  1V4A A;  4IC9 A;  5J0P A;  1A0P A;  2F1J A;  4O67 A;  2M2V A;  2JH1 A;  2KOB A;  3WKA A;  2BCR A;  4DQR A;  2KK0 A;  4AT8 A;  3HIY A;  5TZV A;  3H40 A;  5ALV A;  4F5R A;  3MR2 A;  3TKA A;  5KFO A;  2CXY A;  3QNM A;  1EXN A;  5IIO A;  3ORY A;  2Z7J A;  4FHX A;  3G6X A;  8ICE A;  4WJ3 B;  5E79 U;  3PR4 A;  2KEY A;  2MAX A;  4WC0 A;  4WBY A;  2AHO B;  2R18 A;  3KD3 A;  5AI9 A;  2DR5 A;  4DSE A;  4Y2V A;  4O3S A;  2ZTE A;  5J0R A;  5HMM A;  5CFT A;  3NVO A;  2HVI A;  1T3N A;  4I27 A;  3SAG A;  4FZM A;  1URJ A;  3RJG A;  4B9V A;  2GA9 D;  4MF2 A;  5J2C A;  4F93 B;  4ED0 A;  4X4Q A;  2QKQ A;  4PHE A;  5HP4 A;  4CF5 A;  7ICK A;  3MCR A;  5HR9 A;  1QSY A;  1MQ3 A;  1S0O A;  1BPZ A;  2ZJ5 A;  3PHZ A;  3HKZ F;  2FMP A;  4NLK A;  2ZTD A;  5KNI A;  1BPB A;  4OJP A;  1RDF A;  5AM1 A;  4J9R A;  1S97 A;  1TFW A;  5L1L A;  3RRH A;  3PZP A;  4NY8 A;  4ECU A;  3PX0 A;  3GIK A;  5KT2 A;  4KN7 A;  3GDX A;  2F44 A;  1ZD3 A;  9ICT A;  4PH5 A;  4J03 A;  5AKL A;  2ASD A;  4DS5 A;  4WCW A;  1F0M A;  3MDC A;  1QSL A;  2JEJ A;  1KFT A;  4M2Y A;  5HR7 A;  3UM9 A;  1D8B A;  2W9B B;  2K8A A;  1QQ6 A;  2D3D A;  4X4T A;  4P4M A;  2HI0 A;  5HR6 A;  4X4N A;  4M5D A;  5KL8 B;  4QJF B;  3RH5 A;  4OAG A;  1BPY A;  2FCL A;  1JIH A;  4X4O A;  2B0C A;  3HJ4 A;  1CRX A;  1N48 A;  1LKY A;  5DBC A;  3JPP A;  1WYG A;  4ECS A;  5DBB A;  4UQG A;  2QAR A;  4YXM A;  2GOL A;  4C8L A;  4LJX A;  3AN1 A;  1NO5 A;  4UBB A;  5DGB A;  4NKU A;  4Y2U A;  2VJ5 A;  3SEN A;  2KJ9 A;  3SR6 A;  5KT3 A;  3C21 A;  4E80 A;  2NRZ A;  3KZI U;  4LZG A;  1X2I A;  4EEY A;  2C2E A;  4PHP A;  4KMO B;  2F1I A;  4I2J A;  2LYB A;  2B6G A;  7ICE A;  4X0A A;  1L8O A;  1Y88 A;  3PSF A;  5CP2 A;  4MFC A;  3ONN A;  4IQW A;  1PK1 A;  1R8B A;  2XI9 A;  4ZH4 A;  4GLX A;  2WTF A;  5DGA A;  5ALE A;  4PHA A;  1ZQK A;  3OHA A;  1WWV A;  5KG3 A;  2KZZ A;  1SXD A;  3RJF A;  1L7N A;  1ZQH A;  2EZZ A;  9ICG A;  4DO9 A;  1TK0 A;  3J81 j;  1JMS A;  3RF9 A;  4QZF A;  2HOI A;  1ZD4 A;  9ICL A;  3RAQ A;  2H3Z A;  3AQL A;  4WC6 A;  2HHS A;  3H39 A;  1BPE A;  3K7D A;  1Q78 A;  3TAN A;  4KLJ A;  2JR5 A;  3C2K A;  5AKZ A;  1N5W A;  4O3O A;  4CGZ A;  3H4D A;  9ICU A;  2IOH A;  1JAJ A;  2HDO A;  1XC9 A;  3RJI A;  2AJQ A;  2LMR A;  2FMS A;  2K4H A;  4OJL A;  4WC1 A;  5DG7 A;  3BDP A;  4UBC A;  1L3U A;  4F2R A;  4Y2S A;  1XSP A;  3DV9 A;  4F72 A;  4R8U A;  1KL9 A;  4ED1 A;  2KHQ A;  3WKE A;  3N97 B;  2BCS A;  4PZO A;  1ZQY A;  4I2C A;  3AU6 A;  2ZH5 A;  2LYH A;  3WFR E;  2H3V A;  2KP7 A;  4I2E A;  4G3I A;  3RRG A;  8ICT A;  5AM3 A;  1NJZ A;  4Q44 A;  2E5S A;  5KFR A;  5B5E U;  3Q8R B;  4YN4 A;  3QU9 A;  4QZI A;  1L6N A;  4AYB F;  4DFK A;  4DWI A;  4CF3 A;  4K9A A;  3TAP A;  2BPG A;  4DLE A;  3QE9 Y;  4JB3 A;  4MEX A;  2YY6 A;  3QUQ A;  5JTI A;  3H8M A;  4RNN A;  5ALD A;  5KT7 A;  5J2K A;  1ZQT A;  5C0Y A;  2ZH2 A;  4C8N A;  1S0M A;  1BPX A;  5ALN A;  5KFL A;  5GTI U;  5ALI A;  3HJ1 A;  5KAF U;  5D63 A;  5AKH A;  3BQ7 A;  5AKI A;  3H0L B;  2K4I A;  5B66 U;  2L5Y A;  3ISB A;  2V9W A;  1J2M A;  1UQV A;  2QLT A;  2N1R A;  3FC4 A;  1ECW A;  5L1I A;  4F4Y A;  8ICM A;  1PUZ A;  4U7C A;  1RG6 A;  5J0U A;  4EV6 A;  5ALQ A;  2MUT A;  5AM0 A;  2GWS A;  5KL1 B;  4KTQ A;  4RPZ A;  2OHF A;  4Z6F A;  2IMW P;  4QWA A;  1TVA A;  7ICI A;  4LZD A;  2LM4 A;  1MIY A;  2G08 A;  7ICG A;  4DLG A;  2C2R A;  2XY6 A;  2CRX A;  3PX4 A;  4EP7 A;  4ED3 A;  5F2V O;  4IQV A;  3GU3 A;  2KFN A;  8ICG A;  2F2A B;  1YZ6 A;  3FYH A;  1D9D A;  5CR0 A;  8ICL A;  1SV4 A;  7ICJ A;  1OU5 A;  1SL2 A;  4DFP A;  9ICM A;  3NVV A;  3TAQ A;  5J0S A;  3MR6 A;  3V7K A;  5GTH U;  1ARO P;  4NXZ A;  4P4P A;  3C28 A;  3SMV A;  2H3I A;  2DL0 A;  2BQR A;  4FS1 A;  2WHE A;  5HRH A;  2DUY A;  3FM9 A;  1KFD A;  2YB1 A;  2KNJ A;  4JWM A;  5KFG A;  5ALS A;  4U6P A;  4RUC A;  5DEC A;  1RQL A;  2Y9U A;  4FHV A;  5IIL A;  5KFB A;  4OJO A;  3B9J A;  4YG2 A;  1VLB A;  3ALR A;  3PW5 A;  5J0Y A;  4K4H A;  4KLD A;  1ZQQ A;  5JUM A;  5KG6 A;  5EWG A;  3CW2 C;  2XY7 A;  2ISO A;  2XY5 A;  3NWI A;  2W8K A;  1KQQ A;  2UVU A;  2XO7 A;  1X66 A;  1L3V A;  3V7L A;  7ICF A;  2M9N A;  1T94 A;  1S0N A;  4IRC A;  3SQI A;  2H3Q A;  4IRD A;  4FZL A;  4XQ7 A;  9ICO A;  2OM6 A;  3BS5 A;  4FBU A;  5KFN A;  5HRE A;  5F3X B;  1DGJ A;  3CP8 A;  4KM5 A;  4DL5 A;  4NLN A;  1DXS A;  5AI6 A;  3PW0 A;  5G5H A;  4P4O A;  5ALM A;  5ALL A;  2ASJ A;  3BZC A;  3PO5 A;  2YML A;  3H38 A;  5KT4 A;  4BWJ A;  5HRK A;  2IHN A;  3MBY A;  3HW8 A;  1Z00 A;  4EED A;  3K1R B;  4FFD A;  1TAQ A;  2G5H B;  2W7P A;  5L1J A;  3THV A;  1ZQR A;  4J9O A;  4JLX A;  4UAY A;  2HCF A;  4XUS A;  4DL6 A;  4USA A;  2ALZ A;  4NLG A;  1MA7 A;  5KFC A;  3QUT A;  7ICH A;  3M8S A;  2NYV A;  2UVW A;  4FH5 A;  3NAS A;  4C4S A;  1IIP A;  4FHW A;  1UET A;  1VJ5 A;  5L1M A;  4I2A A;  2R8I A;  4KLU A;  3QU4 A;  3RB6 A;  4AT7 B;  3AM9 A;  1NKE A;  2IBK A;  4ED6 A;  4X4R A;  1O08 A;  2AH5 A;  2I6X A;  2HBK A;  4Y2Q A;  1UCV A;  2QB0 A;  4UB8 U;  5DB9 A;  5BPC A;  3NVW A;  2G07 A;  5KFI A;  3ZI4 A;  4PL1 A;  4C8K A;  3O0F A;  1PZN A;  3H8S A;  4BGD A;  4F3O A;  4KN4 A;  3BQ0 A;  4F5Q A;  1L5U A;  2XCP A;  4I29 A;  5DLG A;  5EE0 A;  3NRW A;  1JX4 A;  4M6W B;  2KFZ A;  3EPG A;  2A1A A;  3N7P D;  3MC1 A;  5F9L A;  3R9K A;  2OXO A;  2I9G A;  3H3A A;  2HHP A;  1S9F A;  2C22 A;  2LHT A;  1MC8 A;  4EEN A;  4ECW A;  4I2D A;  4CNQ A;  1MSW D;  2LPE A;  5KFS A;  4BJQ A;  2WF7 A;  1AQ6 A;  2FPK A;  2ZH6 A;  3WK4 A;  4EBC A;  4NV0 A;  4LEZ A;  2BHN A;  3QUC A;  1X9S A;  4OAH A;  2F1H A;  4NXU A;  5KFK A;  3RAX A;  4DOB A;  4K96 A;  4P0P B;  4CDG A;  4O69 A;  4RNO A;  5HRD A;  2LM1 A;  5KFT A;  4YD2 A;  3TI0 A;  1IXR A;  2W03 A;  2JH7 A;  2MU2 A;  4KLM A;  5EWE A;  3ZDE A;  4PGX A;  4EX7 A;  3VCB A;  5D61 A;  2PFQ A;  4LVS A;  2EAO A;  1F44 A;  2EZX A;  2AQ4 A;  1DK2 A;  1ZQG A;  1T4G A;  4F5P A;  3IDW A;  1KFS A;  5KG2 A;  4ECQ A;  3LDA A;  4UW9 A;  3IV6 A;  7ICV A;  4DSI A;  2UVR A;  2JMG A;  2VJ4 A;  2HBL A;  3RH4 A;  3L3F X;  4F5N A;  4JWN A;  2ZH1 A;  2YMP A;  3N7R C;  3PMN A;  2EDU A;  4ZOH C;  4I2H A;  3JPS A;  2FLP A;  4HAI A;  3Q8S B;  1JN3 A;  1TAM A;  1ZQA A;  1SIJ A;  2IOF K;  3NYB A;  3ER8 C;  4FO6 A;  3KBB A;  3PVX A;  2ATL A;  8ICJ A;  1UEU A;  3CK6 A;  4QZH A;  1IV8 A;  2V4R A;  3F2C A;  1RQN A;  1IG6 A;  1PK3 A;  1SKR A;  2OYY A;  3UXN A;  3QZ7 A;  4DSK A;  2WFA A;  1ZQX A;  1X9M A;  1NZB A;  2XVT A;  4OAI Z;  4AT9 A;  4WC4 A;  4PZN A;  2NRT A;  1NK6 A;  3SAF A;  3E2E A;  4OJ6 A;  4M04 A;  2K8C B;  5ALZ A;  2ZIV A;  2DWQ A;  4B6J A;  4YP3 A;  5HRI A;  2BKE A;  5III A;  3M9O B;  5CWR A;  3T5J A;  1UA0 A;  2K89 A;  1Q3V A;  2A1J B;  4EBK A;  4OCZ A;  2KJ8 A;  4EBD A;  4XA5 A;  7ICR A;  8ICV A;  2B56 A;  2C28 A;  2DPI A;  1JXE A;  2W9C A;  4BUG A;  3H8W A;  4O3R A;  2ZIW B;  4K8V A;  3OVA A;  4CE6 A;  1X9X A;  3OWG A;  1YZ7 A;  4F4X A;  5KFA A;  4JV2 A;  3KOO A;  3HPO A;  1ZOL A;  4K4G A;  1C20 A;  5IIN A;  1UEV A;  4E8F A;  1WOT A;  5ALJ A;  4B9S A;  4NWI A;  4J9L A;  4ECY A;  4ECT A;  1TKD A;  5AK3 A;  2P35 A;  4PJ0 U;  2HHV A;  4EYH B;  3ZDA A;  1UHU A;  4XQ8 A;  3B0X A;  5CRX A;  1L8L A;  4QZ9 A;  5D49 A;  7ICS A;  2D8C A;  3WKB A;  4ELT A;  2DR8 A;  2HHX A;  5DB6 A;  1PX5 A;  5AKY A;  5KAI U;  5K4L A;  2RRD A;  4A8E A;  3C23 A;  4JUZ A;  4KB6 A;  4UB4 A;  1XO0 A;  4RWP A;  4RWO A;  3U26 A;  2HHQ A;  3L5K A;  4F8R A;  5KFY A;  2WF9 A;  1L7O A;  4K9B A;  3C66 A;  4RPX A;  2ESE A;  1TE2 A;  1S10 A;  3WK9 A;  2KSO A;  5KFM A;  2G06 A;  1Q46 A;  2E1F A;  2EZY A;  3AQM A;  4RQN A;  4RT3 A;  1X6J A;  4M9J A;  1NJY A;  3OUY B;  4QIW F;  1ZQL A;  4KLQ A;  5D62 A;  5KT5 A;  4GFJ A;  5AM4 A;  4R63 A;  2FPM A;  5HML A;  4JV1 A;  4Q8F A;  2C2D A;  5ALY A;  1ZQD A;  1CI4 A;  2ZIX A;  3SEI A;  2IUB A;  4UAS A;  4P0Q B;  1M6Y A;  2HVH A;  4FH3 A;  2PMZ C;  4X0B A;  4ACO A;  4NJ8 A;  2ZIU B;  5C5J A;  1J97 A;  1ZJM A;  3TAR A;  1ZQZ A;  4K98 A;  5ALF A;  3RBD A;  1ZQF A;  2IHO A;  2NRV A;  3RB0 A;  1ZQB A;  4E0D A;  4YR3 A;  1NNL A;  1Z3E B;  4MEY A;  5AK6 A;  4TQR A;  4EEL A;  5ALG A;  5CHG A;  5DED A;  3PV8 A;  3RR7 A;  9ICP A;  3M1Y A;  1JUD A;  3GV5 B;  2HOF A;  3BS7 A;  4C0Z A;  1ZQN A;  4J9M A;  2DRA A;  3OSN A;  1U49 A;  2JEF A;  4PHD A;  4R65 A;  2IOF A;  1VDV A;  8ICX A;  1KDH A;  4YQW A;  3D2N A;  2A19 A;  3HX0 A;  3GV7 B;  4S3N A;  1K1Q A;  2RQ5 A;  3ETR A;  1F5A A;  2JZB B;  4QZC A;  3SYZ A;  4ELV A;  8ICF A;  4RQ3 A;  4MKP A;  4E7X A;  2ZH3 A;  2W54 A;  3RBE A;  2YB4 A;  2RHF A;  2ZHA A;  3HWT A;  3PSP A;  4B9N A;  1C7Y A;  3PNC A;  7ICM A;  4UB2 A;  4DQP A;  2AQ0 A;  1SZP A;  1V97 A;  8ICI A;  4AT8 B;  5B3Q A;  4FO1 A;  5EE1 A;  8ICZ A;  3AQF A;  4C4R A;  3UQ2 A;  4UAU A;  1X6I A;  5J2D A;  2OWO A;  1DOQ A;  8ICA A;  4UB5 A;  1VJ7 A;  3C2L A;  1T8E A;  4IQU A;  4QZG A;  5CHE A;  1NZP A;  3MGH A;  3BQT A;  3QUB A;  3EPI A;  2M0N A;  4BXO A;  4OJ5 A;  2KVS A;  4KLO A;  1NOM A;  2XGQ A;  1SGG A;  4NXX A;  4EBJ A;  4ECX A;  1KRP A;  5J2A A;  4UD5 A;  4O5C A;  5KFE A;  4KLE A;  3UXP A;  3ZDC A;  5B3P A;  1KTQ A;  1MIV A;  2OEH A;  4DL3 A;  4UAV A;  2F76 X;  1XO1 A;  3MR3 A;  3HRD D;  4I2G A;  4RZR A;  1U9L A;  2AGO A;  1NJW A;  1R8C A;  4YFK A;  4Q45 A;  3EYZ A;  1RXW A;  2B51 A;  2E8P A;  1F5S A;  3AL0 B;  2AXT U;  3GIM A;  1JRO A;  3NVZ A;  3GZF A;  2VAN A;  3F5A A;  1CEZ A;  3HP6 A;  3QXG A;  4DL7 A;  4O9M A;  2J6S A;  4UAW A;  2XGP A;  4QZE A;  2P6R A;  4K99 A;  4RQ8 A;  2JRZ A;  2AGQ A;  9ICC A;  4FE3 A;  3KHL A;  3BJY A;  2HN2 A;  1B43 A;  4TQS A;  4OD0 A;  4DS4 A;  1SL0 A;  1WCN A;  5CB1 A;  1S8O A;  2I5H A;  4IR9 A;  1ED1 A;  3H8J A;  3MDA A;  2HHT A;  3AQE A;  4EX6 A;  1OUQ A;  3RFA A;  1SWW A;  4X5V A;  1K5O A;  2DFL A;  3F53 A;  2LKY A;  3C29 A;  1LKY B;  4M47 A;  9ICK A;  9ICV A;  3EUB 2;  3C5F A;  4KLI A;  4B9M A;  4R64 A;  4KLH A;  3QEA Z;  2QAR B;  5FP0 A;  1NK7 A;  4LT6 A;  3N28 A;  2KJ5 A;  2GH1 A;  5JTG A;  7ICU A;  3OVB A;  1RM6 C;  3NGD A;  4HX0 A;  2F77 X;  2ID1 A;  2O6K A;  2R8G A;  1R89 A;  4WC2 A;  3M9M B;  9ICF A;  3RTV A;  2JGA A;  2KD1 A;  2M2T A;  5KG1 A;  4QW9 A;  8ICN A;  1NKB A;  4QZ8 A;  3Q8Q B;  7ICN A;  1PK1 B;  2W04 A;  4QIW C;  5J8Y C;  4RQ6 A;  2PFN A;  4CF4 A;  2KIW A;  5HNK A;  1TV9 A;  1BPD A;  2F8K A;  4IRK A;  2I1Q A;  3JPT A;  5CFU A;  1Q8K A;  9ICA A;  2OCE A;  3RH6 A;  2W55 A;  5J2J A;  4MFA A;  2A3V A;  3LVV A;  2DF4 B;  4UAR A;  7ICO A;  3IG5 A;  2G5I B;  4KLT A;  2RFF A;  4O3P A;  2BQ3 A;  9ICR A;  2FLL A;  3RJE A;  2BZF A;  4RQ0 A;  2G0A A;  2ZH4 A;  4Y2T A;  5L9X A;  4J9N A;  4EBE A;  3WFO A;  1TK8 A;  4EZ6 A;  3UMB A;  3WK7 A;  3KHH A;  5J0X A;  1U47 A;  5DQI A;  4J9P A;  4EEB A;  1WUD A;  3M8R A;  2A1J A;  4RQ2 A;  2GLE A;  5CFS A;  1JI7 A;  4M0A A;  1KKX A;  2HBJ A;  1N63 A;  2ZUB A;  5A0L A;  4R8U B;  2HSZ A;  2WF6 A;  2K60 A;  4ECZ A;  1KSP A;  1MIW A;  1ZJN A;  4EYI B;  5HHI A;  3MFI A;  3S6J A;  3QX7 A;  5J2G A;  3Q8M A;  4RQM A;  3E0F A;  5IIK A;  5HHH A;  1JAL A;  3N7S C;  5IIM A;  1V9P A;  2VA8 A;  3NTU A;  2Q0Z X;  3I76 A;  5AIB A;  4I2F A;  4ATB B;  4JK1 A;  4RQ4 A;  2KVC A;  3PSI A;  4TUQ A;  1LB2 B;  5KFX A;  2JEI A;  4DFM A;  3WKC A;  1PVP A;  1N5X A;  3L9D A;  2AGP A;  2K8B B;  3M6Z A;  3WK5 A;  2BPF A;  3HIL A;  5DDY A;  1ZQS A;  2JEG A;  3V7J A;  1Q79 A;  2W9B A;  4TUP A;  2PMZ F;  3JCF A;  5EWF A;  1JRP A;  4C8O A;  1KN5 A;  4ED2 A;  2VA2 A;  5IIJ A;  1H38 A;  3BQ2 A;  3BZK A;  3V72 A;  5DB7 A;  2KTQ A;  4DQS A;  1ZQV A;  5ALT A;  4FBT A;  1Z4N A;  1VFG A;  4NL9 C;  3ISD A;  4RPY A;  3PY8 A;  2MUT B;  2LYA A;  3VC8 A;  5DDM A;  4YXJ A;  3PX6 A;  3TAC B;  1ZQ1 C;  1BGX T;  5H2F U;  3TFS A;  4O5K A;  9ICJ A;  5J8Y A;  3SV3 A;  5CEH A;  3ED5 A;  4C80 A;  8ICU A;  5KFF A;  2VKQ A; 
#chains in the Genus database with same CATH homology
 3V6H A;  2LYH A;  4K4I A;  3C23 A;  2IA6 A;  5KTQ A;  3WFR E;  1L3T A;  4JUZ A;  2HHU A;  2KP7 A;  5EOZ A;  2R8J A;  4RQ5 A;  4F4K A;  1U45 A;  4I2E A;  4G3I A;  3RRG A;  2BE3 A;  8ICT A;  4UB4 A;  1NJZ A;  4YMO A;  4Q44 A;  3Q8L A;  4RWP A;  3GFK B;  5KFR A;  3Q8R B;  4YN4 A;  1BNO A;  2BPC A;  4RWO A;  5KG0 A;  1B22 A;  3QZ8 A;  4DQQ A;  2HHQ A;  4F8R A;  5KFY A;  4QZI A;  5KG4 A;  9ICN A;  8ICQ A;  3C66 A;  4RPX A;  4J9Q A;  4DFK A;  3QEB Z;  1NK4 A;  3WFS C;  4WC5 A;  4ECV A;  4DWI A;  1DK3 A;  3TAP A;  2BPG A;  1S10 A;  4DLE A;  3QE9 Y;  2H5X A;  5KFM A;  4UD4 A;  1S77 D;  4MEX A;  4RUA A;  2O1P A;  3AQM A;  3ZDB A;  3UPQ A;  1BVS A;  4RT3 A;  4M9J A;  4RNN A;  4RT2 A;  1NJY A;  3OUY B;  3OHB A;  5KT7 A;  2W9A A;  1ZQL A;  5J2K A;  4F4Z A;  1ZQT A;  5KT5 A;  5DB8 A;  3KTQ A;  4KLQ A;  7ICQ A;  1IM4 A;  8ICH A;  4QWC A;  2ZH2 A;  4R63 A;  4C8N A;  2FPM A;  4UAZ A;  1S0M A;  5HRF A;  2B21 A;  1R8A A;  5HML A;  1BPX A;  4JV1 A;  5DQH A;  8ICK A;  3LWL A;  5KFL A;  4Q8F A;  2C2D A;  3GII A;  1ZQD A;  3HJ1 A;  3C2M A;  2IHM A;  3RJJ A;  1RYR A;  2Y1I A;  2HVH A;  4FH3 A;  3WFP A;  4BXO B;  3OJU A;  2BCU A;  3GV8 B;  3GQC A;  4X0B A;  4DSJ A;  1D8L A;  4YVZ A;  4YCX A;  2V4Q A;  3ZDD A;  9ICQ A;  4BWM A;  2JZB A;  3ISB A;  4NM1 A;  5C5J A;  2V9W A;  3JZ0 A;  4KLF A;  3LQC B;  1ZQM A;  4E7X A;  1ZJM A;  4F50 A;  8ICB A;  3TAR A;  1ZQZ A;  2HW3 A;  4Z6D A;  2FPL A;  2M2W A;  3H7I A;  5L1I A;  4F4Y A;  3RBD A;  1S0V A;  5DBA A;  2XCA A;  1ZQF A;  2RDI A;  8ICM A;  2NRV A;  3RB0 A;  5J0U A;  1ZQB A;  4E0D A;  2HHW A;  4YR3 A;  1Z3E B;  4B9U A;  4MEY A;  1D9F A;  1HUZ A;  2MUT A;  4TQR A;  2J6T A;  5CHG A;  3UPS A;  2GWS A;  3KHR A;  4KTQ A;  1XS9 D;  5DED A;  2ZUD A;  4RPZ A;  3PV8 A;  4O5E A;  1ZQP A;  3RR7 A;  4YMM A;  3JPQ A;  9ICP A;  4Z6F A;  5J2E A;  2IMW P;  3GV5 B;  2ZH9 A;  4QWA A;  1TVA A;  8ICP A;  1QLN A;  1ZQN A;  7ICI A;  1N56 A;  3AU2 A;  4LZD A;  3EWA A;  3PW7 A;  2RDJ A;  4J9M A;  4ELU A;  2ZHB A;  4PGQ A;  3OSN A;  2DRA A;  4QZA A;  1U49 A;  4PHD A;  4R65 A;  2JEF A;  1T7P A;  1ZQE A;  4NLZ A;  9ICW A;  1MIY A;  3K75 D;  1RXV A;  2P66 A;  7ICG A;  1DGS A;  9ICB A;  4I2B A;  4DOA A;  2DR7 A;  4DLG A;  2C2R A;  2XY6 A;  3G6Y A;  3PX4 A;  4EP7 A;  1Z00 B;  3C1Z A;  3C5G A;  4IQV A;  4F92 B;  4ED3 A;  8ICX A;  2KFN A;  8ICG A;  1KDH A;  4YR2 A;  4YQW A;  3FYH A;  5KFZ A;  1ZQI A;  3V6J A;  1D9D A;  2M2U A;  5CR0 A;  3OJS A;  8ICL A;  4TUR A;  3GV7 B;  4QWD A;  5J2B A;  3HX0 A;  1K1Q A;  4F5O A;  4S3N A;  3PY8 A;  4YR0 A;  5J2H A;  7ICJ A;  2P6U A;  1OU5 A;  2JZB B;  4QZC A;  4GC7 A;  4RU9 A;  3SYZ A;  4RQ3 A;  5DQG A;  1SL2 A;  4ELV A;  8ICF A;  4DFP A;  8ICW A;  4YMN A;  4FS2 A;  3RBE A;  4M9G A;  2ZH7 A;  4GXK A;  9ICM A;  2ZHA A;  5CJ7 A;  1WCL A;  1ZET A;  1NJX A;  1NK0 A;  3IHQ B;  4KIT B;  3HWT A;  3T5L A;  3TAQ A;  5J0S A;  4J9S A;  4B9N A;  3MR6 A;  1C7Y A;  4X4Q A;  3V7K A;  3PNC A;  1ZQC A;  1ZQO A;  1ARO P;  7ICM A;  2ZH8 A;  4UB2 A;  1F5A A;  4B9L A;  4YD1 A;  4EBJ A;  4NXZ A;  3LK9 A;  4DQP A;  2NRW A;  5J2I A;  1X9W A;  2AQ0 A;  4P4P A;  1SZP A;  1FA0 A;  3MFH A;  4X4S A;  2BQR A;  8ICI A;  3BQ1 A;  4FS1 A;  4AT8 B;  5HRH A;  8ICZ A;  2W9M A;  4NM2 A;  1NK9 A;  1KFD A;  4O3Q A;  3Q8P B;  3OUY A;  4DEZ A;  3UQ2 A;  1SL1 A;  5L1K A;  4JWM A;  5KFG A;  1ZQJ A;  5J2D A;  4RUC A;  1XSL A;  2OWO A;  3T3F A;  8ICS A;  5DEC A;  4X4U A;  4XRH A;  4KLS A;  4RQ7 A;  1DOQ A;  5IIL A;  5KFB A;  4UB5 A;  8ICA A;  1VJ7 A;  4FHV A;  3C2L A;  4RQ1 A;  1ZQW A;  4YG2 A;  4RNM A;  1T8E A;  4IQU A;  4QZG A;  2ZTC A;  3TFR A;  4R66 A;  3PW5 A;  5J0Y A;  4X4V A;  4K4H A;  1NZP A;  3MGH A;  4P2H A;  4KLD A;  1TFY A;  3ZD8 A;  5J0O A;  3BQT A;  5JUM A;  1ZQQ A;  2R8K A;  4CCH A;  4WC3 A;  3EPI A;  4BXO A;  5KG6 A;  4I2I A;  5EWG A;  3MAB A;  3JPR A;  5KFH A;  2XY7 A;  2ISO A;  4KLO A;  5DG8 A;  1NOM A;  2XY5 A;  1UA1 A;  2ZUC A;  2W8K A;  2UVU A;  3WFQ E;  2XO7 A;  4UB3 A;  2XGQ A;  2R8H A;  2ASL A;  3SI8 A;  2PFP A;  3V6K A;  1L3V A;  3V7L A;  4ECX A;  7ICF A;  4NKT A;  1KRP A;  2M9N A;  2UVV A;  1S0N A;  3FDS A;  4TUS A;  2KN7 A;  3Q8K A;  1A76 A;  5J0Q A;  3UXO A;  4IRC A;  1NKC A;  4IRD A;  9ICI A;  5J2A A;  9ICO A;  4XQ7 A;  1XSN A;  4UD5 A;  4DF8 A;  4O5C A;  8ICC A;  5KFE A;  4KLE A;  5KFP A;  4FBU A;  2Q66 A;  3UXP A;  5KFN A;  3ZDC A;  5HRE A;  2NRK A;  3MGI A;  3H37 A;  1KTQ A;  4WBZ A;  4DL4 A;  1MIV A;  2O5A A;  4DL3 A;  3ISC A;  4DL5 A;  4NLN A;  3UQ0 A;  1SKS A;  2ZH3 A;  1S76 D;  3PW0 A;  2BR0 A;  1TFR A;  1XO1 A;  3T5H A;  4P4O A;  3MR3 A;  4I2G A;  3AUO A;  2ASJ A;  3PO5 A;  4RZR A;  1U9L A;  3GIJ A;  3LWM A;  2AGO A;  1NJW A;  5KT4 A;  1R8C A;  3H38 A;  4YFK A;  4Z6C A;  3IM1 A;  4Q45 A;  3EYZ A;  1RXW A;  4BWJ A;  5HRK A;  2IHN A;  3MBY A;  3HW8 A;  5BOM A;  1Z00 A;  3MR5 A;  5KFQ A;  3AQN A;  1D8Y A;  3GIM A;  1TAQ A;  3H4B A;  3PO4 A;  5L1J A;  3THV A;  5HRG A;  1ZQR A;  2BCQ A;  1NK8 A;  2VAN A;  4QWE A;  2VA3 A;  2BGW A;  4J9O A;  1KEJ A;  2J6U A;  1COO A;  4C8M A;  3C18 A;  4FHY A;  4UAY A;  1CEZ A;  3B0Y A;  4QW8 A;  9ICE A;  4XUS A;  3OVS A;  4DL6 A;  3HP6 A;  2ALZ A;  4NLG A;  9ICX A;  3OV7 A;  5KG7 A;  4ED7 A;  5KFC A;  4DL7 A;  4O9M A;  5J0P A;  2KZ3 A;  1V4A A;  2J6S A;  4UAW A;  5J29 A;  2XGP A;  7ICH A;  2F1J A;  3SV4 A;  1SKW A;  4QZE A;  3M8S A;  2P6R A;  2M2T A;  4QWB A;  4RQ8 A;  2UVW A;  4FH5 A;  2AGQ A;  2M2V A;  9ICC A;  3KHL A;  4FHW A;  3BJY A;  1UET A;  2BCR A;  5J0T A;  4I2A A;  4DQR A;  1U48 A;  1B43 A;  2R8I A;  4AT8 A;  4J9K A;  4TQS A;  3HIY A;  4MFF A;  4KLU A;  4DS4 A;  5TZV A;  3H40 A;  1ZYQ A;  1SL0 A;  1WCN A;  5CB1 A;  3RB6 A;  4AT7 B;  4F5R A;  1NKE A;  2IBK A;  3H8J A;  3MR2 A;  3MDA A;  5KFO A;  4ED6 A;  4IR9 A;  4X4R A;  1EXN A;  7ICT A;  5IIO A;  3ORY A;  5KFD A;  4FHX A;  2HHT A;  3G6X A;  8ICE A;  3PR4 A;  7ICP A;  5DB9 A;  5BPC A;  2MAX A;  4WC0 A;  4WBY A;  4X5V A;  5KFI A;  4HYK A;  2DFL A;  4KMU A;  2DR5 A;  4M47 A;  4DSE A;  9ICK A;  9ICV A;  4BDP A;  4C8K A;  2ZTE A;  5J0R A;  4O3S A;  5HMM A;  3C5F A;  1K1S A;  4KLI A;  4B9M A;  2DR9 A;  4R64 A;  2HVI A;  4KLH A;  1T3N A;  1XU4 A;  4O3N A;  4I27 A;  1PZN A;  3QEA Z;  1NK7 A;  2PI4 A;  4LT6 A;  4FHP A;  3H8S A;  4BGD A;  3RJG A;  3RJH A;  4B9V A;  4F3O A;  4X4P A;  4MF2 A;  7ICU A;  4KN4 A;  3BQ0 A;  1LV5 A;  5J2C A;  4F93 B;  4F5Q A;  4ED0 A;  7ICK A;  4PHE A;  5HP4 A;  1KLN A;  3NGD A;  1L5U A;  5HR9 A;  1QSY A;  4F2S A;  5HRL A;  1MQ3 A;  2XCP A;  4I29 A;  3ZD9 A;  3SZ2 A;  3HT3 A;  1S0O A;  2ID1 A;  1BPZ A;  5DLG A;  2R8G A;  2ZJ5 A;  1MQ2 A;  1R89 A;  4WC2 A;  3PW4 A;  2FMP A;  3M9M B;  9ICF A;  4NLK A;  2ZTD A;  1JX4 A;  3RTV A;  1JXL A;  4M6W B;  5J2F A;  3EPG A;  1BPB A;  4UB1 A;  2BQU A;  2KFZ A;  1BNP A;  5KG1 A;  4QW9 A;  4J9R A;  4B9T A;  8ICN A;  1S97 A;  1TFW A;  1NKB A;  5F9L A;  3JPO A;  4AT9 B;  4ED8 A;  4QZ8 A;  4QZD A;  3Q8Q B;  4M9H A;  2I9G A;  3H3A A;  2HHP A;  7ICN A;  1S9F A;  2C22 A;  4MF8 A;  4RQ6 A;  5L1L A;  1MC8 A;  3PR5 B;  3RRH A;  2PFN A;  4NY8 A;  5F2V O;  4ECU A;  4ECW A;  4I2D A;  1MSW D;  3PX0 A;  3GIK A;  5KFS A;  5KT2 A;  3JPN A;  4KN7 A;  3GDX A;  5KFU A;  5HNK A;  2FPK A;  1TV9 A;  2BDP A;  9ICT A;  1BPD A;  2ZH6 A;  4EBC A;  4JV0 A;  4PH5 A;  4IRK A;  3C1Y A;  2I1Q A;  4Q43 A;  2ASD A;  3JPT A;  2BHN A;  4DS5 A;  3PML A;  9ICA A;  4WCW A;  3RH6 A;  4ECR A;  2XC9 A;  1X9S A;  2F1H A;  3MDC A;  5KFK A;  1QSL A;  3RAX A;  1JQR A;  2JEJ A;  1KFT A;  5J2J A;  4DOB A;  5KT6 A;  4MFA A;  4M2Y A;  2W9C B;  4EZ9 A;  4RNO A;  4IQT A;  2W9B B;  3AQK A;  5HRD A;  7ICO A;  3M9N B;  4KLT A;  2RFF A;  4O3P A;  2BQ3 A;  2DRB A;  9ICR A;  5KFT A;  8ICY A;  4X4T A;  4YD2 A;  3TI0 A;  3OVB A;  1IXR A;  4P4M A;  5D46 A;  2FLL A;  3RJE A;  4RQ0 A;  4KLL A;  4KLM A;  4X4N A;  2PBE A;  1UT5 A;  4M5D A;  5EWE A;  2ZH4 A;  3ZDE A;  4PGX A;  4DOC A;  4IR1 A;  2PFQ A;  4AT7 A;  3JYY A;  4LVS A;  3EZ5 A;  5DG9 A;  2AQ4 A;  5L9X A;  3RH5 A;  4J9N A;  4EBE A;  1U4B A;  1ZQG A;  1T4G A;  1DK2 A;  4F5P A;  3WFO A;  1TK8 A;  1BPY A;  1KFS A;  5HRB A;  5DLF A;  4EZ6 A;  1JIH A;  5KG2 A;  4GXJ A;  4GXI A;  4ECQ A;  4M9N A;  4ATB A;  3KHH A;  3LDA A;  3PW2 A;  4X4O A;  5J0X A;  7ICV A;  1U47 A;  4DSI A;  5DQI A;  3HJ4 A;  4J9P A;  2UVR A;  5CA7 A;  3EW9 A;  3RH4 A;  1N48 A;  3M8R A;  1RYS A;  2A1J A;  4RQ2 A;  4JWN A;  4F5N A;  4LZG A;  2KZM A;  2ZH1 A;  5DBC A;  3JPP A;  5KFJ A;  4M0A A;  2ZUB A;  3PMN A;  2NRX A;  4ECS A;  8ICO A;  4IG8 A;  3KHG A;  4I2H A;  3JPS A;  2FLP A;  4DSL A;  5DBB A;  4UQG A;  4R8U B;  4YXM A;  3Q8S B;  2BCV A;  4C8L A;  1NO5 A;  3K4G A;  1JN3 A;  4RWQ A;  5DKW A;  5DGB A;  4UBB A;  4NKU A;  1ZQA A;  3RB4 A;  4ECZ A;  1KSP A;  4FO6 A;  4M9L A;  3NYB A;  5KT3 A;  3PVX A;  3C21 A;  2ATL A;  1RZT A;  3RR8 A;  4E80 A;  1MIW A;  2NRZ A;  8ICJ A;  1UEU A;  5HC9 A;  4DQI A;  1X2I A;  4QZH A;  2Y1J A;  1ZJN A;  4EYI B;  4EEY A;  2C2E A;  4PHP A;  5HHI A;  3MFI A;  4Q8E A;  2V4R A;  1HUO A;  2F1I A;  4I2J A;  5J2G A;  1SKR A;  7ICE A;  3Q8M A;  4X0A A;  3UXN A;  4M6W A;  3QZ7 A;  4DSK A;  1ZQX A;  1X9M A;  5IIK A;  5HHH A;  4PGY A;  4AT9 A;  1Y88 A;  5CP2 A;  4MFC A;  5IIM A;  4WC4 A;  1V9P A;  2VA8 A;  1NK5 A;  2NRT A;  1NK6 A;  3NTU A;  4IQW A;  1R8B A;  1QSS A;  2ISP A;  3E2E A;  2Q0Z X;  4ZH4 A;  4GLX A;  4M04 A;  4I2F A;  4YP3 A;  2WTF A;  4ATB B;  5HRI A;  4JK1 A;  2BKE A;  5DGA A;  5III A;  3M9O B;  4PHA A;  4RQ4 A;  3OHA A;  1ZQK A;  1KNY A;  1L3S A;  5CWR A;  3T5J A;  4Z6E A;  1UA0 A;  5KG3 A;  4TUQ A;  1LB2 B;  2KZZ A;  5KFX A;  1RPL A;  1ZQU A;  2JEI A;  2A1J B;  2DVI A;  4EBK A;  4DFM A;  5F9N A;  4EBD A;  4XA5 A;  3RJF A;  7ICR A;  3RB3 A;  1ZQH A;  8ICV A;  9ICG A;  3L9D A;  1QTM A;  4DO9 A;  1TK0 A;  1JMS A;  4PPX A;  4RWN A;  2AGP A;  4QZF A;  2C28 A;  2DPI A;  1JXE A;  5KFV A;  4I28 A;  2BPF A;  1A77 A;  5KFW A;  5DDY A;  2W9C A;  1ZQS A;  2JEG A;  3V7J A;  1Q79 A;  4DF4 A;  1XWL A;  2W9B A;  3H8W A;  9ICH A;  4TUP A;  2PI5 A;  4O3R A;  9ICL A;  3RAQ A;  3AQL A;  4WC6 A;  1YLQ A;  3OVA A;  5EWF A;  1TAU A;  3OGU A;  4F4X A;  4C8O A;  2HHS A;  3H39 A;  5KFA A;  4JV2 A;  4WC7 A;  3N4M B;  4DSF A;  7ICL A;  1BPE A;  4ED2 A;  2PFO A;  3HPO A;  2VA2 A;  5IIJ A;  4GC6 A;  1Q78 A;  2W8L A;  4K4G A;  3TAN A;  5J0W A;  5IIN A;  1H38 A;  3C2K A;  1TK5 A;  4KLJ A;  1UEV A;  3BQ2 A;  4E8F A;  3V72 A;  5DB7 A;  4O0I A;  2KTQ A;  9ICS A;  4O3O A;  1WOT A;  4F91 B;  4DQS A;  1ZQV A;  3GIL A;  5KG5 A;  4DFJ A;  2FMQ A;  3H4D A;  3T5K A;  5D4B A;  2FLN A;  4B9S A;  4FBT A;  9ICU A;  2ZJA A;  3TQ1 A;  1VFG A;  3ISD A;  3RJK A;  4J9L A;  1JAJ A;  4RPY A;  3ETL A;  1UT8 A;  2MUT B;  4ECT A;  4ECY A;  3RJI A;  2AU0 A;  1XC9 A;  1TKD A;  4KLG A;  2AJQ A;  5DDM A;  4YXJ A;  2FMS A;  2ZJ8 A;  3G6V A;  3PX6 A;  2HHV A;  4EYH B;  4WC1 A;  3ZDA A;  4QZB A;  5DG7 A;  3BDP A;  4UBC A;  1L3U A;  4XQ8 A;  5BOL A;  3OSP A;  3B0X A;  4F2R A;  1XSP A;  1BGX T;  1HJP A;  4ED1 A;  4R8U A;  1CUK A;  2DPJ A;  2PXI A;  4QZ9 A;  3TFS A;  4O5K A;  9ICJ A;  4DL2 A;  5D49 A;  3N97 B;  2BCS A;  7ICS A;  3SV3 A;  4ELT A;  4F4W A;  2DR8 A;  1ZQY A;  4I2C A;  3AU6 A;  5DB6 A;  2HHX A;  8ICU A;  1PX5 A;  2ZH5 A;  5KFF A;  8ICR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...