4NY8A

Dna polymerase beta with o6mg in the template base opposite to incoming non-hydrolyzable ctp with manganese in the active site
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
323
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 108
structure length 323
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ny8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ny8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ny8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ny8A03
3NGDA 3LDAA 3UQ2A 1QSYA 2A1JA 3GDXA 3C23A 4J9MA 4O9MA 1V9PA 1ZQPA 7ICOA 4ATBA 2MUTB 1T3NA 4UAZA 4F8RA 3EZ5A 2XCPA 3KHRA 3PW7A 5J0RA 1ZJMA 4EZ6A 3WFQE 2W8KA 1KFDA 3Q8SB 7ICPA 4Z6FA 3H4BA 4O3OA 4TURA 5KFLA 1K1QA 1JX4A 4DSKA 2IHMA 2HHWA 8ICKA 3RB3A 3NTUA 1SKWA 4TUPA 1SL0A 3QZ7A 4DS4A 4I2IA 4MEYA 4UB1A 2V4RA 3C2LA 4KLJA 3RJGA 9ICGA 3HX0A 4EBKA 3OVAA 2R8IA 3OJSA 3EPGA 3BQ2A 4KLHA 4WC5A 4WC4A 4KLIA 3NYBA 1ZQSA 7ICRA 3OSPA 4YMMA 2ZH3A 1Z00B 5BPCA 1U49A 5KFNA 3ISBA 4F4XA 3QEBZ 8ICEA 1ZQUA 7ICVA 2IA6A 3H3AA 5KG4A 9ICTA 5J0QA 2PFNA 3BDPA 3PW2A 1YLQA 4RUCA 5KT6A 4O0IA 2FMPA 3ETLA 4UD4A 3AUOA 3ZDBA 4Q8FA 9ICJA 1UT8A 4QWCA 4F4KA 2ALZA 4XUSA 1H38A 4O3PA 9ICHA 2FPMA 3QE9Y 3UPQA 3V7KA 2ISOA 5EOZA 5KFPA 3Q8RB 3RRHA 4YFKA 1T4GA 5KFVA 5HRIA 1D8LA 2ZTEA 2GWSA 2NRZA 2F1IA 1B22A 1ZQXA 3HJ1A 4C8OA 4FBTA 2RDIA 1BNPA 1TFYA 4B9VA 4R64A 5CR0A 4J9RA 4M6WB 4F5NA 3PW5A 3RJEA 9ICLA 4RWQA 1BVSA 1NKBA 2W9CA 2BKEA 2FPKA 3G6VA 1D8YA 3UQ0A 4ECZA 2JEGA 3PO4A 5KG2A 1UT5A 4RQ6A 5CJ7A 4YR0A 4X4QA 3OVSA 4PHDA 2OWOA 1S97A 4PPXA 1JXEA 5KT3A 2AJQA 3H38A 1JAJA 4QWBA 2ZHAA 4YG2A 9ICCA 3OVBA 4R63A 5D49A 1BPXA 5J2GA 4DL2A 1NK7A 1ZQNA 3EYZA 1ZQKA 4BDPA 3C2KA 4J9KA 4DFMA 1R8BA 4DSFA 4Q44A 4RZRA 3GV8B 4AT9B 3M9OB 8ICMA 3MR3A 1R8CA 4MF2A 4X4SA 4UBCA 4F2RA 2XY7A 1ZETA 2KN7A 4WC0A 3RJFA 4I28A 4Q8EA 3ZDEA 5HNKA 2P6RA 8ICLA 2R8KA 4AT7A 2J6TA 4F4ZA 2W9MA 9ICIA 2AQ0A 1ZQEA 4DEZA 5J0TA 2UVUA 1MSWD 4JK1A 1DGSA 3RBDA 1MIVA 3TAQA 1U9LA 4R65A 4NM2A 4QWAA 4EBCA 8ICXA 5BOLA 2HHTA 1JQRA 1K1SA 4F5PA 2BQ3A 3TAPA 2JEJA 3ZDCA 5KFKA 1UA0A 4FHVA 4YP3A 2HHSA 4ECWA 4PHPA 1ZQRA 2BCSA 1Q79A 5HRDA 5EWFA 1ZQAA 5C5JA 3LK9A 2FLNA 4DQIA 1RXWA 5F9NA 4DL7A 3PY8A 5CWRA 4M9LA 2RDJA 5EWEA 9ICVA 4QWDA 4ECTA 4CCHA 2Y1IA 2Q0ZX 3OJUA 4FS1A 4KLEA 2BE3A 3SYZA 2XO7A 3GIJA 3RB0A 3RRGA 3HT3A 1Q78A 4E7XA 4WC6A 2BCRA 1MIYA 4YMOA 2ZH1A 4KMUA 8ICBA 2O1PA 1Z3EB 4QZ8A 1X9WA 2M2UA 5DG7A 2O5AA 5KFYA 3LWLA 4AT8A 5D46A 2ZH8A 4X4VA 4MEXA 3HPOA 1S0VA 4FH5A 1XC9A 5KFXA 4P4PA 2ZH9A 1XO1A 1XSLA 2P66A 2V9WA 3ORYA 5DLGA 3PW0A 3Q8LA 8ICSA 3H39A 9ICBA 3G6YA 2XY6A 4FHWA 1UEVA 4FS2A 4KLFA 4ED3A 1TVAA 3KTQA 4NY8A 4DOCA 4ED7A 3B0YA 4RQ4A 3BQ1A 3T3FA 1ZQTA 4O5CA 4S3NA 4ED0A 2BPFA 3T5KA 4F93B 1MQ3A 2IMWP 4JV1A 3TQ1A 4J9OA 1WCLA 3RJKA 5F2VO 3ISDA 1HUOA 4KLUA 4J9LA 1QTMA 1DK2A 2NRWA 1BPZA 4JUZA 3MR5A 1TAUA 1FA0A 3MDCA 1KLNA 4WCWA 1ZQWA 4IG8A 4TUQA 3MDAA 3GV7B 2ASDA 5L1JA 4IQUA 5DQGA 2PFQA 5J0XA 4JWMA 4NLGA 1MC8A 3HIYA 4WC1A 1S0MA 5KFBA 9ICPA 4DO9A 2R8JA 1D9FA 8ICOA 4QW8A 4I2BA 2FMSA 1L3VA 1NKEA 1SZPA 3N4MB 3ZDDA 4YD1A 4F5QA 1KSPA 1COOA 3PR4A 8ICJA 4C8LA 3WFSC 3RH4A 4KLQA 3C5FA 2M2WA 4IRCA 4O5EA 4MFFA 4IR1A 1U48A 3RTVA 4DSEA 5KFSA 4WC2A 1KRPA 9ICUA 4LT6A 1NJXA 2FLPA 4BXOB 9ICKA 2DR7A 1ZJNA 4F4YA 1S0NA 3H37A 5DB7A 2DR5A 5HRFA 3TFSA 1WCNA 3H8WA 5J2HA 1TV9A 4B9NA 1NO5A 4I2CA 4TQSA 1SKRA 4RQ3A 1L3SA 2W8LA 8ICVA 2HHPA 3RH5A 5KFUA 4DOBA 4F3OA 4X4RA 1A76A 5J0SA 4J9QA 2KZ3A 5HMLA 3PMNA 3OSNA 1XS9D 4YR3A 2HHQA 8ICYA 3UXOA 2ASJA 4B9MA 5IIJA 5HHHA 2AQ4A 1NK4A 7ICJA 5KFFA 4UD5A 5IIIA 3PX4A 7ICQA 5KG5A 4I2EA 5HRBA 4IQVA 4DQRA 3RJIA 1L5UA 2PFPA 1QLNA 2ZH2A 4UQGA 4LVSA 2ZUBA 5KTQA 1RYRA 3GV5B 4RNNA 7ICGA 5KT2A 5J2KA 4GXIA 5J2AA 5KG1A 3MR2A 4YVZA 2KFZA 3C18A 1MQ2A 3TI0A 2NRXA 2JZBB 5J2BA 1RZTA 4NM1A 4ZH4A 4M5DA 1PZNA 5J0UA 1X9MA 3AQMA 2HHUA 5HRGA 4UB4A 2BCUA 4Z6DA 3OGUA 4PGQA 4NLNA 1TKDA 1SKSA 4QZAA 1S9FA 4C8MA 9ICAA 2MUTA 2W9BB 3H4DA 4RNMA 4DL4A 1ZQFA 3THVA 8ICQA 1CUKA 5HMMA 3ISCA 2AGOA 4KN7A 1KFSA 3PVXA 4EYIB 5DLFA 4E80A 5IIOA 1TK0A 4KLDA 3RAXA 2BQRA 4P2HA 3RJJA 3V72A 1XWLA 4DFJA 1HJPA 3UPSA 1AROP 5HRKA 2UVRA 5DDMA 4RWNA 3SI8A 4F91B 3MGIA 4KLTA 4X4OA 5HREA 1ZQIA 4DFKA 3OUYB 2DRAA 4ED2A 1L3TA 1L3UA 1DK3A 1MIWA 8ICAA 3AQKA 3C5GA 1ZYQA 1T7PA 2ZH5A 4LZGA 5L1IA 3ZD8A 2ATLA 4MFCA 4O5KA 8ICNA 1Z00A 4WBYA 4J9NA 3N97B 4M47A 4O3RA 1RPLA 4R8UB 1ZQOA 2C2EA 3EWAA 1ZQMA 1BPEA 2IHNA 5DGBA 2ID1A 5DB6A 3PR5B 4EZ9A 4GC6A 2BDPA 1DOQA 4YXMA 1BGXT 3KHGA 2NRVA 5KFOA 4K4HA 2UVVA 7ICTA 1NK0A 2ZUCA 7ICLA 4DF8A 3UXNA 4ECXA 2ZJAA 4F4WA 2BPGA 2BCVA 4DSLA 2HHVA 3HW8A 4RQ8A 3GIKA 2A1JB 5D4BA 4F5RA 4ECYA 4E0DA 5IIMA 1ZQQA 2BCQA 4ATBB 5KG3A 3PW4A 3K4GA 3QZ8A 3Q8PB 3V6KA 3TANA 1NJWA 2JEFA 2FMQA 1ZQBA 3H8JA 2ISPA 4YQWA 8ICRA 5KFRA 4F92B 4RT2A 4RPXA 5DGAA 3RJHA 7ICMA 1BNOA 3EPIA 4WC7A 4QZEA 5DG9A 1QSSA 4NKUA 3H8SA 4M6WA 5CB1A 5IINA 4DQQA 3T5HA 5KFJA 9ICSA 3JZ0A 9ICNA 5KFAA 4RWOA 1VFGA 3JPSA 4DSJA 4X4NA 1XU4A 2Q66A 4UB5A 4EBEA 2JEIA 3QEAZ 4YN4A 1XSPA 4O3SA 3FYHA 4NLKA 4EBJA 4X0AA 5L9XA 1WOTA 2P6UA 8ICHA 1NKCA 4RNOA 4NKTA 3V6HA 1ZQLA 2BHNA 1ZQCA 2I1QA 8ICTA 1NK9A 3RR7A 3L9DA 5EWGA 4I2HA 1BPDA 1NK6A 1F5AA 2VA8A 5KFEA 4PHAA 4X4PA 2XGPA 3JPRA 3GIIA 4M0AA 1R89A 4X4UA 1NJYA 4AT9A 4RU9A 4QZFA 3MGHA 3T5LA 4E8FA 2H5XA 3Q8MA 4MFAA 4FHXA 3C21A 1ZQGA 3M9NB 4FBUA 4JV2A 3GFKB 1IM4A 1IXRA 7ICIA 1NK8A 2V4QA 1UETA 4BWJA 4I29A 4Z6CA 4RT3A 4M2YA 8ICPA 1JIHA 5KFHA 4UB2A 2IBKA 1C7YA 4M9GA 4X0BA 5KG0A 4RPYA 3PNCA 3TARA 5JUMA 4ELTA 4F2SA 3PV8A 1ZQHA 2ZTCA 4XQ7A 5J0WA 3AU6A 1N56A 4DQPA 3MFHA 4KLMA 5J2DA 3OHBA 4R66A 1KEJA 2KFNA 9ICXA 2XGQA 5J2CA 2W9CB 3KHLA 2ZJ8A 4DFPA 1U4BA 5HRLA 2AU0A 1S10A 2DR9A 1UEUA 4I2GA 1A77A 3ZD9A 4RUAA 2XY5A 4KTQA 4HYKA 2PBEA 2MAXA 4QZBA 4JV0A 3AU2A 3SV4A 4PGYA 4B9SA 3H7IA 4ECSA 4EBDA 4DLGA 4PGXA 1EXNA 4DF4A 1V4AA 4JWNA 1TFWA 1JN3A 2ZJ5A 5KFCA 2ZH7A 4LZDA 5HP4A 4QZHA 2PI5A 4IR9A 5DBCA 3AQNA 2ZH6A 4M9HA 5DECA 3LWMA 1Y88A 5F9LA 2W9AA 4KLOA 4QW9A 4RWPA 1NZPA 5HRHA 3MR6A 2NRTA 3SV3A 2HVHA 3JPQA 3MBYA 4C8KA 2Y1JA 5L1KA 4I2DA 4YR2A 4GXKA 4K4GA 4AT7B 4QZGA 1ZQZA 2M2TA 5KT7A 4J9SA 4BGDA 4UBBA 5DKWA 2BQUA 1UA1A 1ZQJA 2VA3A 8ICUA 1BPYA 2LYHA 1S77D 5DQIA 4RQ1A 1U47A 1T8EA 5KFQA 1BPBA 5KT4A 4PHEA 3M8SA 4F50A 4GLXA 3V6JA 9ICRA 2ZHBA 4UAWA 4IQWA 3Q8KA 4KITB 4QZIA 5L1LA 2HVIA 9ICOA 4KN4A 2BR0A 4UAYA 4GC7A 2ZTDA 2BGWA 2R8HA 1XSNA 4GXJA 2VA2A 3IM1A 9ICFA 7ICKA 1NJZA 3C2MA 4QWEA 4M04A 3WFRE 2BPCA 3B0XA 4FHPA 3C66A 2AGPA 5J0YA 4ED1A 3OV7A 4ELUA 4ED8A 2I9GA 2VANA 4XRHA 1LV5A 4ED6A 5DQHA 2KP7A 4RQ2A 3BQTA 3G6XA 5KFDA 2HW3A 2ZH4A 5KFGA 5HHIA 2DPIA 5TZVA 4IRKA 2KTQA 5CHGA 4Q43A 4M9JA 7ICSA 1S76D 4FHYA 4AT8B 1RYSA 2FLLA 7ICNA 7ICHA 3HP6A 7ICFA 4M9NA 4TUSA 3GIMA 4ECUA 1U45A 4PH5A 4C8NA 5IIKA 1TAQA 4DQSA 3PO5A 4BXOA 4DSIA 4EEYA 5DEDA 2KZZA 5KFIA 4YXJA 2R8GA 5IILA 8ICCA 3MABA 4X5VA 1ZQYA 4Q45A 3T5JA 2C2RA 2M2VA 5KT5A 4J9PA 2PFOA 4X4TA 4I2FA 2M9NA 5DG8A 1KNYA 3SZ2A 1CEZA 3JPPA 4QZDA 4I2AA 9ICEA 4YCXA 1R8AA 4ECRA 3JYYA 4QZ9A 9ICWA 4O3QA 4YMNA 3Q8QB 1NK5A 2ASLA 3UXPA 3PMLA 1ZQDA 3JPOA 1D9DA 3OHAA 2AGQA 4DL6A 1SL2A 5KFWA 3C1YA 8ICFA 3RH6A 8ICZA 4QZCA 4DL5A 4XQ8A 8ICWA 3WFOA 1RXVA 4Z6EA 3M8RA 1X9SA 4RQ0A 1TK5A 3M9MB 4DWIA 4IRDA 3LQCB 1OU5A 5HC9A 1ZQVA 3TFRA 5KG7A 3RBEA 2C2DA 4B9UA 4ELVA 7ICUA 2F1HA 4K4IA 8ICGA 5J29A 4O3NA 1TFRA 2JZBA 4XA5A 5J2FA 1HUZA 4IQTA 5KFMA 5CA7A 3GQCA 5DDYA 2C22A 1N48A 2HHXA 3E2EA 4NXZA 9ICQA 8ICIA 4ECQA 2J6UA 5HR9A 1NOMA 4RPZA 2NRKA 2ZUDA 3FDSA 1X2IA 4DOAA 1KFTA 2FPLA 7ICEA 4RQ7A 4EYHB 4KLGA 2W9BA 1B43A 2DPJA 4NLZA 1VJ7A 5J2EA 2DFLA 2XCAA 2C28A 3WFPA 3GILA 3BQ0A 4MF8A 2WTFA 3C1ZA 3PX0A 1LB2B 4EP7A 3BJYA 1KTQA 1TK8A 4UB3A 1KDHA 1JXLA 2F1JA 1SL1A 2B21A 5CP2A 4KLSA 3RB4A 4B9TA 3RAQA 4P4MA 5KFTA 4I2JA 3ZDAA 3H40A 5DB9A 3OUYA 3K75D 3JPNA 2PXIA 2PI4A 1PX5A 2DRBA 4I27A 4FH3A 4F5OA 4BWMA 5DB8A 5DBAA 5J0OA 4WC3A 5BOMA 4FO6A 5J0PA 3RR8A 3PX6A 4YD2A 9ICMA 4DLEA 4B9LA 2KZMA 3AQLA 2UVWA 3V7LA 4WBZA 2DR8A 5KG6A 4RQ5A 2RFFA 5DBBA 4R8UA 4P4OA 3HWTA 4DL3A 4TQRA 3V7JA 2XC9A 3RB6A 2J6SA 4G3IA 5KFZA 1JMSA 5J2IA 4DS5A 1QSLA 1S0OA 3EW9A 3IHQB 3KHHA 3MFIA 4KLLA 3JPTA 2DVIA 5J2JA 3HJ4A 4ECVA
chains in the Genus database with same CATH superfamily
3NGDA 1QSYA 3GDXA 4O9MA 3C23A 3QU9A 4J9MA 4UAZA 4CRXA 3PW7A 5J0RA 1CRXA 2W8KA 1KFDA 2ZIXB 3Q8SB 1TE2A 4O3OA 4TURA 3H0LB 1JX4A 3NTUA 1SL0A 4I2IA 4UB1A 2V4RA 4KLJA 3OVAA 5JRTA 4EBKA 3HX0A 2R8IA 3NKUA 3CNHA 3OJSA 5AI6A 5KL1B 4NLCA 2ZH3A 1PVRA 3KKAA 1U49A 8ICEA 2HBKA 3BZKA 9ICTA 3ZDBA 3F2DA 1H38A 3L5KA 3V7KA 5AKXA 2OHFA 1FO4A 2JRZA 2K4HA 5HRIA 4PZOA 1ZD4A 1B22A 1SWWA 5ALWA 5AKGA 1TFYA 1DXSA 5CR0A 4F5NA 4LEVA 9ICLA 5AK6A 4OO1J 3K7DA 2YY6A 4PPXA 1YZ7A 3H38A 1ZQ1C 1BPXA 1SXEA 5J2GA 4Y2TA 1NK7A 2VJ5A 2K4PA 3C2KA 2XICA 3UMBA 4DFMA 2GAFD 2FDRA 3MR3A 2OH2A 2XY7A 3DDHA 4WC0A 3I1YA 1MN8A 4I28A 3ZDEA 2Y9UA 1ZQEA 4DEZA 4JK1A 1DGSA 1V85A 3RBDA 5ALZA 3AQFA 4WH5A 4QWAA 5AM5A 4FHVA 2BCSA 2I5HA 5ALYA 3A0HU 1ZQAA 5H2FU 4DQIA 5F9NA 3PY8A 2RDJA 1KL9A 2QB0A 4A8EA 4ECTA 3OJUA 1ZD5A 2XO7A 3GIJA 3KD3A 3CP8A 5KAFU 1F5SA 4FE3A 5AIBA 1X9XA 3LWLA 5ALPA 2EWRA 4FH5A 1XC9A 1L7PA 5KFXA 4IC9A 2V9WA 8ICSA 5DLGA 2W55A 2XY6A 4O6AA 4FS2A 4KLFA 4FZMA 4ED3A 1SV4A 4DOCA 4WC3A 3B0YA 3F5AA 2QLTA 4ZOHC 3BQ1A 1ZQTA 4BUGA 3F53A 5FP0A 1XO0A 5AI9A 3ISDA 1XNSA 1DK2A 1BPZA 3MR5A 3LVVA 3MDCA 1KLNA 4IG8A 4TUQA 5ALOA 3GV7B 2ASDA 5L1JA 5J0XA 1MC8A 2XVTA 1UPHA 4WC1A 1S0MA 1QCKA 3WK7A 2FMSA 2KG5A 1COOA 1JROA 1VLBA 3C5FA 4O5EA 1WWVA 1U48A 2W7OA 3RTVA 2B6GA 4NXUA 1F44A 1KRPA 3M1YA 3SAHA 2LBOA 4CF3A 1S0NA 2A19A 4AYBC 2DR5A 5HRFA 3B9JA 4LJXA 1TV9A 4B9NA 4RQ3A 3RH5A 5KFUA 4DOBA 3PMNA 1XS9D 5G5GA 3UXOA 2ASJA 5HHHA 1NK4A 7ICJA 3F5EA 5KG5A 4I2EA 4P0PA 2W3SA 3KOOA 2LYBA 1IV8A 2ZUBA 1J2MA 5KTQA 4LVSA 1RYRA 3PSFA 5J2AA 3WKAA 4NM1A 4ZH4A 2KMDA 4M5DA 1WUDA 2HHUA 5HRGA 1SKSA 4QZAA 4C8MA 5JU5A 3THVA 4CF4A 2WB1F 2AGOA 3PVXA 5DLFA 3QU7A 1TK0A 3RAXA 4KLDA 5AK4A 3RJJA 2ZIWB 3QU5A 3UPSA 2H3VA 4CF5A 4K96A 4X4OA 3OUYB 4KLTA 1L7NA 2ZH5A 8ICAA 3C5GA 1T7PA 4LZGA 5ALGA 2K8AA 3IG5A 3CK6A 3N97B 2W03A 5AHXA 2C2EA 4PL2A 1BPEA 4EZ9A 5CFTA 5KFOA 4K4HA 3UXNA 4ECXA 1X40A 3GIKA 1S5LU 4E0DA 5IIMA 1HIWA 3TANA 3V6KA 1NJWA 3H8JA 9ICSA 8ICRA 2IHOA 4RPXA 2JGAA 2KEYA 1QSSA 5ALMA 4M6WA 3JZ0A 9ICNA 1XU4A 3NVZA 4EBEA 4EBJA 1N63A 1WOTA 8ICHA 1ZQLA 1ZQCA 3PZPA 8ICTA 5EE3A 3NUQA 4I2HA 1BPDA 4QIWC 5ALRA 5KFEA 5ALIA 2WF6A 2DKXA 1UHUA 4LEYA 3MGHA 4QZFA 4E8FA 4LEWA 4JV2A 7ICIA 2CPRA 3ER8C 3WKBA 4BWJA 4I29A 2XI9A 4Z6CA 8ICPA 4X0BA 2IBKA 3TARA 4C0ZA 4F2SA 4DQPA 3MFHA 3OHBA 4R66A 2KVSA 2KFNA 2G5HB 4NXVA 3KHLA 2GH1A 2ES6A 5EE0A 2ZJ8A 2PMZF 1U4BA 5HRLA 2AU0A 1UEUA 4QZBA 3AU2A 3SV4A 2NO4A 4ECSA 4DLGA 4PGXA 1EXNA 2W3RA 4JWNA 1TFWA 2ZH7A 2PI5A 3JCFA 1Y88A 1NZPA 2F2AB 1KN5A 3JPQA 1NI3A 2E8OA 4CDGA 4GXKA 2M2TA 3HILA 4BGDA 4UBBA 2ZH6A 2YMQA 1S77D 2Z7JA 2D3DA 5KFQA 1BPBA 3PSIA 4UAWA 4IQWA 3Q8KA 5ALJA 5L1LA 2HVIA 2BGWA 5AKYA 2NYVA 5T14A 3IM1A 3WFRE 4M04A 2HDOA 2BPCA 4FHPA 3ONNA 3H8MA 2DUYA 2HBMA 5GTIU 4ED8A 2VANA 3IDWA 4XRHA 4RQ2A 2E1EA 2ZH4A 3CW2C 5CHGA 1S76D 2FLLA 2LM1A 4ECUA 1ZRNA 2NV3A 3MABA 3T5JA 2OCEA 4X4TA 5KT5A 2M9NA 2G08A 1CEZA 4OAIZ 3WK4A 3JYYA 9ICWA 4O3QA 1ZQDA 3UXPA 3PMLA 1V38A 4EEKA 8ICFA 3C1YA 3MCRA 4DL5A 2FJ6A 4KM5A 1RXVA 5ALSA 3M8RA 1X9SA 4Y2RA 4RQ0A 3DV9A 1TK5A 4B9UA 4U6PA 4ELVA 5AM0A 2F1HA 4CE6A 1TFRA 4XA5A 5J2FA 3BS5A 4IQTA 5CA7A 5AI8A 2HHXA 5HR9A 5AKZA 4RPZA 4US8A 2NRKA 1SV0C 4PJ0U 4RQ7A 1ECWA 2DPJA 5J2EA 2KK0A 1PVPA 3QNMA 1KTQA 4XJEA 1JXLA 3F2BA 4B9TA 5KFTA 3M6KA 2Y0SC 3K75D 5BOMA 2B56A 4P0PB 3PX6A 9ICMA 2RRDA 4NWIA 4WBZA 4RQ5A 1N2XA 4P4OA 2W11A 4DL3A 3V7JA 2XC9A 3RB6A 4DFDA 2EH9A 3HJ4A 4ECVA 3UQ2A 2A1JA 3AM9A 1V9PA 7ICOA 1T3NA 3L3FX 3ALRA 3EZ5A 3KKAC 3KHRA 3SMVA 4EZ6A 3WFQE 5F3XB 1X42A 7ICPA 4DSKA 5KFLA 3RB3A 1SKWA 4TUPA 3QZ7A 3MGVA 2YTUA 3RJGA 3OPXA 3SEIA 1V97A 1ZQSA 1Z1BA 4YMMA 4F4XA 1ZQUA 3HJEA 7ICVA 5KG4A 5J0QA 3BDPA 1YLQA 2FMPA 9ICJA 4Q8FA 1UT8A 1FFUA 1WWUA 2ALZA 4O3PA 9ICHA 3QE9Y 5JTGA 5EOZA 5KFPA 4EEDA 1D8LA 2ZTEA 2KJ9A 1OW5A 2NRZA 1YZ6A 1ZQXA 3AMZA 3HJ1A 2RDIA 1JALA 4M6WB 4CNQA 3RJEA 4Q8EA 3UQ0A 4ECZA 2JEGA 3PO4A 5KG2A 1UT5A 2LMRA 3OVSA 1X66A 4PHDA 1JAJA 4QWBA 2ZHAA 9ICCA 3BS7A 2G06A 4R63A 4DL2A 5G5HA 1R8BA 4DSFA 4Q44A 4RZRA 1ZETA 1O08A 2R8KA 4F4ZA 1N5XA 2RP5A 1MIVA 4F72A 3TAQA 2LYAA 5AK5A 1JQRA 2GO7A 4F5PA 2BQ3A 3TAPA 3PHZA 2JEJA 3ZDCA 4YP3A 4ECWA 4PHPA 1ZQRA 2KOBA 3ED5A 5C5JA 2BDUA 3H0MB 9ICVA 2IOFK 2Y1IA 2LI6A 1Q78A 2PKEA 3RB0A 4WC6A 3HT3A 2ZXHA 3FM9A 2BCRA 1MIYA 4GIBA 2O1PA 2M2UA 2O5AA 2ZH8A 3QU2A 4UB6U 3Q8LA 3PW0A 2FCLA 4FHWA 3PSPA 1UEVA 4NY8A 3KTQA 3T3FA 4RQ4A 4O5CA 2G07A 4UB8U 4J9OA 4RQMA 5J8YA 3RJKA 4J9LA 4OJPA 2NRWA 4NLGA 2PFQA 3HIYA 2L5YA 9ICPA 2R8JA 4IL6U 8ICOA 3O0FA 1NKEA 3ZDDA 4YD1A 3QUCA 3RH4A 1AQ6A 2W7PA 4EX6A 2M2WA 4MFFA 4UASA 4DSEA 2H3QA 3N28A 4WC2A 9ICKA 4JLXA 1RDFA 2YB1A 4F4YA 2K8CB 3H37A 4CGZA 3NVYA 2GLEA 3H8WA 5J2HA 4TQSA 2W8LA 4F3OA 3LVWA 4X4RA 5J0SA 2KZ3A 2HHQA 4YR3A 4WQKA 5KFFA 5HRBA 2KNJA 3RJIA 1QLNA 2K8BB 4GXIA 5KG1A 3MR2A 1SIJA 2NRXA 5J2BA 1N62A 3BS5B 5J0UA 1S9FA 5B5EU 1ZQFA 4RNMA 2MSNA 2E8MA 1FIQA 5IIOA 2ZIUA 1SZHA 2WF8A 3V72A 4DFJA 4C80A 1L3TA 1PK1A 1D8BA 1ZYQA 2MA1A 5AKKA 1SXDA 3ZD8A 4MFCA 2CRXA 4WBYA 2A1AA 3EWAA 1ZQMA 1F0MA 4EENA 3EUB2 2BDPA 1DOQA 1CI4A 1BGXT 4AYBF 2YN4A 2KSOA 2ZJAA 4F4WA 2BCVA 4N7RA 2A1JB 5D4BA 4F5RA 1ZQQA 2BCQA 4NLBA 3PW4A 4KB6A 1Z19A 2JEFA 4YQWA 3RJHA 7ICMA 4EELA 4WC7A 4NKUA 3TADA 5IINA 4DQQA 1VFGA 3JPSA 4DSJA 4X4NA 4US9A 2JEIA 2JH1A 4X0AA 5AICA 5L9XA 2P6UA 3WU2U 4K9AA 4NL9C 1F5AA 3UMGA 2KIVA 3ICXA 2XGPA 5AIAA 4OD0A 4RU9A 3T5LA 4FHXA 1IIPA 3M9NB 4FBUA 3GFKB 1IM4A 4RT3A 2E5SA 4ELTA 3ETRA 2ZTCA 3C29A 1QQ5A 1RQLA 5J2DA 4Y2JA 9ICXA 4Y2YA 2XGQA 4DFPA 3ZD9A 5CFSA 3VCBA 2ESEA 5C0YA 4HX0A 3NVWA 2YMMA 4PGYA 3R9KA 5AK3A 2JMGA 2ZJ5A 5KFCA 5HP4A 4QZHA 4M9HA 3LWMA 3L4PA 4KLOA 4QW9A 4RWPA 1GO3F 2OXOA 4C8KA 4QZGA 5KT7A 4J9SA 3M7DA 5EE9A 1ZQJA 2VA3A 2DVIA 4JMUA 4RQ1A 1T8EA 5ALEA 5AM4A 5KT4A 4F50A 4Y2UA 9ICRA 1N5WA 4QZIA 4QIWF 4UAYA 2ZTDA 1XSNA 2VA2A 4O67A 7ICKA 3IP4B 2O6KA 3B0XA 2JH7A 1KQQA 4ELUA 2H3IA 4ED6A 2KP7A 5DQHA 3BQTA 3G6XA 5HHIA 4IRKA 3N7SC 2E1FA 4M9JA 4FHYA 1RYSA 3NVOA 4PH5A 3PO5A 4DSIA 4DQSA 5AM1A 5KFIA 5AI4A 2R8GA 5KL8B 5IILA 2DF4B 3UM9A 1KNYA 4NXWA 3JPPA 4I2AA 3SAGA 4QZ9A 2F3NA 3Q8QB 2OYYA 2W04A 3GU3A 2AGQA 8ICZA 3WFOA 4EEBA 4DWIA 5HC9A 3BZCA 3TFRA 2C2DA 2W43A 8ICGA 4EV6A 2EZXA 2XIDA 5J29A 1HUZA 5KFMA 2C22A 2ZUDA 1X2IA 1KFTA 7ICEA 4NLZA 1K5OA 2DFLA 4UW9A 3PX0A 3C1ZA 4UB3A 2F1JA 1SL1A 2B21A 3RB4A 2AHOB 3RAQA 4I2JA 3H40A 1T3QA 1N61A 3JPNA 1PX5A 2KHQA 4F5OA 5DB8A 4FO6A 5J0PA 5GTHU 3U26A 4O3MA 4DLEA 4B9LA 5KG6A 2RFFA 5DBBA 4R8UA 3HWTA 4TQRA 1NZBA 1QSLA 2ZH2A 4G9BA 1ZQPA 3K1RB 4F8RA 3GZFA 1ZJMA 4Z6FA 2DBYA 1B4FA 3H4BA 2ZIUB 4K99A 4LEZA 1A0PA 3HKZF 4MEYA 5L1MA 2FE9A 3EPGA 4KLHA 1PK1B 2Q4TA 4KLIA 3NYBA 2N1RA 3OSPA 5BPCA 3ISBA 1ZD2P 3QEBZ 2PFNA 1Z4OA 3PW2A 3D2QA 4RUCA 5KT6A 5B3QA 2KSOB 2FPMA 3WKDA 3M6ZA 3Q8RB 2QB0B 2Y0SF 4C8OA 4FBTA 1BNPA 4R64A 3PW5A 4RWQA 1BVSA 1NKBA 1A6SA 2W9CA 2FPKA 3G6VA 1D8YA 2K60A 5AKHA 3WKEA 4RQ6A 5CJ7A 1QQ7A 4YR0A 4X4QA 2F77X 1S97A 2QKQA 1JXEA 3NRZA 5KT3A 2YMPA 4YG2A 2ZIXA 1ZQNA 1M6YA 1ZQKA 4BDPA 4J9KA 2KVCA 1L6NA 4KX5A 3GV8B 4MF2A 4F2RA 3RJFA 5HNKA 8ICLA 2J6TA 2HBJA 9ICIA 2AQ0A 5J0TA 3HKZC 4NM2A 3CYMA 2HHTA 1K1SA 2G0AA 5ALDA 2ZG6A 1UA0A 3IG8A 3D2NA 1Q79A 1RXWA 2H3ZA 4DL7A 5CWRA 1Q8KA 4QWDA 4CCHA 4KLEA 2Q0ZX 2BE3A 4E7XA 1ZD3A 3IV6A 4YMOA 2ZH1A 2RQ5A 5DG7A 2KIWA 4JLZA 4AT8A 5D46A 4X4VA 2LM4A 4MEXA 4P4PA 1XO1A 2P66A 3ORYA 3H39A 2GOLA 2Y9TA 3G6YA 1TVAA 2BPFA 3T5KA 1MQ3A 2IMWP 3TQ1A 5F2VO 1HUOA 4KLUA 2OEHA 2LKYA 1ZQWA 1Z4NA 4JWMA 2EDUA 3KZXA 3QUTA 4Y2QA 4DO9A 1D9FA 2EANA 3NS1A 3WK6A 4F5QA 1X6JA 5AKEA 8ICJA 4C8LA 3E0FA 3LYSA 4UARA 2W54A 1YT3A 2FLPA 3RFAA 1ZJNA 2WF7A 2WF9A 3OTQA 4FZLA 5DB7A 2IOFA 2OM6A 1WCNA 4I2CA 1L3SA 1UQVA 3T79A 1O03A 4J9QA 3OSNA 1L7OA 2AQ4A 4UD5A 5IIIA 1Z1VA 3PX4A 3RF9A 3VC8A 2KD1A 4RNNA 7ICGA 1SB3C 2KFZA 4USAA 2F44A 3MC1A 2BCUA 1HEKA 3QUBA 4OCZA 4Z6DA 3OGUA 4PGQA 1FEZA 2MUTA 3H4DA 5HMMA 5ALLA 3ISCA 4KN7A 1KFSA 4EYIB 3ZI4A 4J03A 2KV2A 2F8KA 1XWLA 5HRKA 3MGIA 5HREA 1ZQIA 1L3UA 1MIWA 5L1IA 4O5KA 1Z00A 4J9NA 3NWIA 4IS7A 4R8UB 4K8VA 2WAQC 2ID1A 4GC6A 2EQYA 3TADC 7ICTA 1NK0A 2JV3A 2ZUCA 4DF8A 2BPGA 4U7CA 3HW8A 4RQ8A 5AKJA 4ECYA 5KG3A 3CRXA 5CFUA 3QZ8A 2FMQA 3KBBA 4F92B 4RT2A 1BNOA 5D63A 4QZEA 3BQ7A 3T5HA 5KFAA 4NXXA 4NLKA 3EF2A 5AI0A 4NKTA 1NKCA 4RNOA 3AL0B 1Q46A 2BHNA 2I1QA 4BX9C 3L9DA 4FFDA 3K1ZA 1NK6A 2VA8A 4PHAA 4X4PA 3GIIA 4M0AA 4X4UA 1NJYA 4AT9A 2H5XA 3Q8MA 2D8CA 3C21A 1ZQGA 3KZIU 1NK8A 4O69A 4M2YA 5KFHA 1C7YA 3PNCA 5JUMA 3QYPA 3PV8A 1ZQHA 3OWGA 1IG6A 1N56A 4XQ7A 1JI7A 2EZYA 4KLMA 1KEJA 2W9CB 4K98A 4ICAA 1S10A 5AM3A 2DR9A 4I2GA 1A77A 4RUAA 2XY5A 2HOFA 4HYKA 1COKA 1C20A 1QQ6A 4JV0A 5JTIA 5B66U 3AEVA 1NNLA 1ED1A 2DWQA 1V4AA 1JN3A 1L8LA 4LZDA 3S6JA 4IR9A 5CEHA 5AM2A 3AQNA 5DECA 4Y2VA 2W9AA 5F9LA 2B4VA 4OAGA 5B3PA 5HRHA 3SV3A 2HVHA 5L1KA 4ACOA 2BQUA 8ICUA 5DKWA 3WK5A 1BPYA 5DQIA 2JXJA 3M8SA 4GLXA 9ICOA 4KN4A 2BR0A 4I0UA 3TKAA 9ICFA 4C4TA 4QWEA 3C2MA 1FFVA 3C66A 1L7MA 4ED1A 3OV7A 2I9GA 1LV5A 3QUQA 2KKVA 5KFGA 5A0LA 2DPIA 5TZVA 2KTQA 4Q43A 7ICSA 4AT8B 7ICNA 7ICHA 3HP6A 7ICFA 4TUSA 3GIMA 1U45A 1B0XA 4BXOA 2R18A 4EEYA 5DEDA 2KZZA 3N7RC 2C2RA 2M2VA 1QH9A 4J9PA 2PFOA 2E3TA 2DQNB 3SZ2A 1TAMA 9ICEA 4AP9A 4YCXA 4YMNA 1NK5A 2AH5A 2HI0A 2ASLA 1D9DA 2EAMA 1PUZA 3OHAA 3RH6A 4QZCA 4Z6EA 2ODGA 3M9MB 4IRDA 2GA9D 2JZBA 2P6RA 1N48A 3AN1A 3GQCA 1Q3UA 2CXYA 3E2EA 4NXZA 9ICQA 8ICIA 4ECQA 2J6UA 2P35A 1NOMA 1LVHA 4DOAA 3FDSA 2IOHA 3H0RB 2W9BA 1VJ7A 2XCAA 2C28A 2ZXIA 3GILA 3WFPA 4MF8A 2WTFA 1KDHA 4KLSA 5CP2A 1J2NA 4P4MA 3ZDAA 2NO5A 1WG8A 2DRBA 4I27A 4FH3A 5J0OA 1OXJA 4YD2A 4P0QA 1URJA 2DR8A 1SWVA 2JHDA 5KFZA 4DS5A 5J2IA 1S0OA 3EW9A 3IHQB 3WK9A 3MFIA 5J2JA 2HOQA 4QJFB 2KE7A 3LDAA 4ATBA 2MUTB 5ALVA 2XCPA 3WK8A 2HHWA 8ICKA 1K1QA 2IHMA 2BBHA 4DCCA 2VJ4A 3IRUA 4KX3A 3C2LA 4DS4A 1ZXIA 3BQ2A 4Y2SA 4WC5A 4WC4A 3D2SA 1KBUA 1SGGA 7ICRA 1Z00B 2KHVA 5KFNA 2IA6A 3H3AA 4OJ5A 2I6XA 4O0IA 1VJ5A 2KICA 3ETLA 3SAFA 4UD4A 3AUOA 4QWCA 4F4KA 4XUSA 5D62A 3UPQA 2ISOA 3RRHA 4YFKA 1T4GA 5KFVA 3QX7A 2GWSA 2F1IA 2YX8A 2E8NA 4B9VA 5TISU 4C7ZA 2K4EA 4J9RA 3RRGA 2BKEA 3DEEA 2ZIVA 1L8OA 2MU2A 2OWOA 2AJQA 2HBLA 3OVBA 5D49A 4JB3A 4MHVA 3EYZA 5AI5A 2CN1A 1UCVA 3QXGA 3M9OB 4AT9B 8ICMA 4X4SA 4UBCA 2KN7A 2QARA 4AT7A 2W9MA 1MSWD 2QB1A 2UVUA 3SD7A 1U9LA 4R65A 2WHEA 3UMCA 4EBCA 4GFJA 5BOLA 8ICXA 5KFKA 1JRPA 2HHSA 5HRDA 5EWFA 3LK9A 5KAIU 2FLNA 4M9LA 5EWEA 2G09A 4Y2XA 4FS1A 4OJLA 3SYZA 4KMUA 8ICBA 1Z3EB 4QZ8A 1X9WA 3D6JA 1MA7A 5KFYA 3I28A 3J81j 1ZRMA 1T94A 3F2CA 3HPOA 1S0VA 2ZH9A 1XSLA 9ICBA 9ICGA 2VIXA 4ED7A 4S3NA 4ED0A 4F93B 4JV1A 1WCLA 5KNIA 1QTMA 4JUZA 2WB1C 1TAUA 1FA0A 4WCWA 3MDAA 3ERCC 4IQUA 5DQGA 4NL9A 5KFBA 1OUQA 4QW8A 4WOYA 4I2BA 1L3VA 4OAFA 1SZPA 2WFAA 3N4MB 1KSPA 3PR4A 2JR5A 4C4RA 4KLQA 4IRCA 4IR1A 5ALQA 4PZNA 5ALHA 1Q3VA 5KFSA 2E8PA 1DGJA 9ICUA 4LT6A 1NJXA 4C4SA 4BXOB 2DR7A 1PVQA 3FAHA 3TFSA 2LPEA 1NO5A 1SKRA 4HAIA 8ICVA 2HHPA 1A76A 5HMLA 8ICYA 4B9MA 1GPJA 5IIJA 1RG6A 7ICQA 2HCFA 4IQVA 4DQRA 2PFPA 1L5UA 4UQGA 3GV5B 5KT2A 5J2KA 5AKIA 4YVZA 3C18A 1MQ2A 3TI0A 2JZBB 1RZTA 1PZNA 1X9MA 3N7PD 3AQMA 4UB4A 2AXTU 1LKYA 4NLNA 3QU4A 1TKDA 9ICAA 5E79U 4NXTA 2W9BB 4DL4A 8ICQA 4Y2PA 1CUKA 5ALUA 1KW4A 5K4LA 2YB4A 4E80A 4P2HA 2BQRA 1HJPA 1AROP 2UVRA 5DDMA 4RWNA 2H3FA 4F91B 3SI8A 4DFKA 3SQIA 2DRAA 4ED2A 1DK3A 3HRDD 3AQKA 4F71A 2FI1A 4EX7A 2ATLA 8ICNA 5ALKA 4P0QB 4M47A 4O3RA 1RPLA 1ZQOA 2IHNA 5DGBA 5DB6A 2KJ8A 2PMZC 3PR5B 2A3VA 4YXMA 3KHGA 2NRVA 2UVVA 5HR6A 7ICLA 4DSLA 2HHVA 4PL1A 3WFSC 4ATBB 3K4GA 3Q8PB 2KKPA 1X6IA 1ZQBA 2ISPA 1R8CA 5KFRA 4O68A 5DGAA 3EPIA 2EAOA 5DG9A 5J8YC 3H8SA 5CB1A 4RWOA 5KFJA 3ER9B 1KKXA 2Q66A 4UB5A 3QEAZ 4YN4A 1XSPA 4O3SA 3FYHA 1P7DA 4FZNA 3V6HA 1NK9A 3RR7A 5EWGA 3JPRA 4UAVA 2RHFA 1DRGA 1R89A 4MFAA 4C7YA 4WQLA 1IXRA 1ZOLA 2V4QA 1UETA 1RYUA 3E58A 1JIHA 4NV0A 4UB2A 4M9GA 4EGWA 5KG0A 4RPYA 4NJ8A 2F76X 2IUBA 3PSTA 5EE1A 4K9BA 5J0WA 2YQEA 3AU6A 5D61A 5ALNA 2BBJA 5ALXA 2WF5A 5J2CA 2WAQF 2ZIVB 2K89A 4KTQA 2PBEA 4MKPA 2MAXA 4B9SA 2DGZA 3H7IA 4EBDA 4DF4A 5ALTA 2RLTA 2DKZA 2MRLA 3NASA 4UAUA 5DBCA 5ALFA 2LHTA 2B0CA 2HMXA 3MR6A 2NRTA 2QARB 3MBYA 2Y1JA 5CHEA 4I2DA 4OAHA 4YR2A 3C28A 4K4GA 4AT7B 2HN1A 1ZQZA 1UA1A 4QNLA 2KJ5A 5AKLA 2LYHA 3FC4A 1VDVA 1U47A 2ZHBA 4PHEA 3V6JA 4K97A 1RQNA 4KITB 4GC7A 2EZZA 2BZFA 2R8HA 4GXJA 2K4IA 1NJZA 2AGPA 5J0YA 2M0NA 3IN5A 2HW3A 5KFDA 2HN2A 4M9NA 1WYGA 4C8NA 5IIKA 1TAQA 3SR6A 4WJ3B 4FO1A 2DL0A 4YXJA 8ICCA 1S8OA 3SENA 4X5VA 1ZQYA 4Q45A 1N60A 2YMLA 4KMOB 4I2FA 5DG8A 4QZDA 2D6FC 1R8AA 4ECRA 3TACB 3JPOA 4DL6A 1SL2A 5KFWA 8ICWA 4XQ8A 3LQCB 1OU5A 1ZQVA 3RBEA 5KG7A 7ICUA 1JUDA 4K4IA 2VKQA 3AQEA 4OJ6A 4BJQA 5CRXA 4O3NA 3I76A 2HOIA 5DDYA 2F8LA 2EAPA 1PK3A 1RM6C 2FPLA 4EYHB 4KLGA 1B43A 3BQ0A 1LB2B 4UATA 4EP7A 4RQNA 3BJYA 1TK8A 2B51A 2ZIWA 1J97A 3WKCA 5DB9A 3OUYA 2PXIA 2PI4A 1SV0A 4BWMA 5DBAA 3NVVA 3RR8A 2KZMA 5HR7A 2UVWA 3AQLA 3V7LA 3KFUF 2HSZA 2G5IB 2J6SA 4G3IA 3NRWA 1JMSA 4OJOA 4B6JA 3KHHA 4KLLA 3JPTA 1LKYB 3A0BU
chains in the Genus database with same CATH topology
3NGDA 3LDAA 3UQ2A 1QSYA 2A1JA 3GDXA 3C23A 4J9MA 4O9MA 1V9PA 1ZQPA 7ICOA 4ATBA 2MUTB 1T3NA 4UAZA 4F8RA 3EZ5A 2XCPA 3KHRA 3PW7A 5J0RA 1ZJMA 4EZ6A 3WFQE 2W8KA 1KFDA 3Q8SB 7ICPA 4Z6FA 3H4BA 4O3OA 4TURA 5KFLA 1K1QA 1JX4A 4DSKA 2IHMA 2HHWA 8ICKA 3RB3A 3NTUA 1SKWA 4TUPA 1SL0A 3QZ7A 4DS4A 4I2IA 4MEYA 4UB1A 2V4RA 3C2LA 4KLJA 3RJGA 9ICGA 3HX0A 4EBKA 3OVAA 2R8IA 3OJSA 3EPGA 3BQ2A 4KLHA 4WC5A 4WC4A 4KLIA 3NYBA 1ZQSA 7ICRA 3OSPA 4YMMA 2ZH3A 1Z00B 5BPCA 1U49A 5KFNA 3ISBA 4F4XA 3QEBZ 8ICEA 1ZQUA 7ICVA 2IA6A 3H3AA 5KG4A 9ICTA 5J0QA 2PFNA 3BDPA 3PW2A 1YLQA 4RUCA 5KT6A 4O0IA 2FMPA 3ETLA 4UD4A 3AUOA 3ZDBA 4Q8FA 9ICJA 1UT8A 4QWCA 4F4KA 2ALZA 4XUSA 1H38A 4O3PA 9ICHA 2FPMA 3QE9Y 3UPQA 3V7KA 2ISOA 5EOZA 5KFPA 3Q8RB 3RRHA 4YFKA 1T4GA 5KFVA 5HRIA 1D8LA 2ZTEA 2GWSA 2NRZA 2F1IA 1B22A 1ZQXA 3HJ1A 4C8OA 4FBTA 2RDIA 1BNPA 1TFYA 4B9VA 4R64A 5CR0A 4J9RA 4M6WB 4F5NA 3PW5A 3RJEA 9ICLA 4RWQA 1BVSA 1NKBA 2W9CA 2BKEA 2FPKA 3G6VA 1D8YA 3UQ0A 4ECZA 2JEGA 3PO4A 5KG2A 1UT5A 4RQ6A 5CJ7A 4YR0A 4X4QA 3OVSA 4PHDA 2OWOA 1S97A 4PPXA 1JXEA 5KT3A 2AJQA 3H38A 1JAJA 4QWBA 2ZHAA 4YG2A 9ICCA 3OVBA 4R63A 5D49A 1BPXA 5J2GA 4DL2A 1NK7A 1ZQNA 3EYZA 1ZQKA 4BDPA 3C2KA 4J9KA 4DFMA 1R8BA 4DSFA 4Q44A 4RZRA 3GV8B 4AT9B 3M9OB 8ICMA 3MR3A 1R8CA 4MF2A 4X4SA 4UBCA 4F2RA 2XY7A 1ZETA 2KN7A 4WC0A 3RJFA 4I28A 4Q8EA 3ZDEA 5HNKA 2P6RA 8ICLA 2R8KA 4AT7A 2J6TA 4F4ZA 2W9MA 9ICIA 2AQ0A 1ZQEA 4DEZA 5J0TA 2UVUA 1MSWD 4JK1A 1DGSA 3RBDA 1MIVA 3TAQA 1U9LA 4R65A 4NM2A 4QWAA 4EBCA 8ICXA 5BOLA 2HHTA 1JQRA 1K1SA 4F5PA 2BQ3A 3TAPA 2JEJA 3ZDCA 5KFKA 1UA0A 4FHVA 4YP3A 2HHSA 4ECWA 4PHPA 1ZQRA 2BCSA 1Q79A 5HRDA 5EWFA 1ZQAA 5C5JA 3LK9A 2FLNA 4DQIA 1RXWA 5F9NA 4DL7A 3PY8A 5CWRA 4M9LA 2RDJA 5EWEA 9ICVA 4QWDA 4ECTA 4CCHA 2Y1IA 2Q0ZX 3OJUA 4FS1A 4KLEA 2BE3A 3SYZA 2XO7A 3GIJA 3RB0A 3RRGA 3HT3A 1Q78A 4E7XA 4WC6A 2BCRA 1MIYA 4YMOA 2ZH1A 4KMUA 8ICBA 2O1PA 1Z3EB 4QZ8A 1X9WA 2M2UA 5DG7A 2O5AA 5KFYA 3LWLA 4AT8A 5D46A 2ZH8A 4X4VA 4MEXA 3HPOA 1S0VA 4FH5A 1XC9A 5KFXA 4P4PA 2ZH9A 1XO1A 1XSLA 2P66A 2V9WA 3ORYA 5DLGA 3PW0A 3Q8LA 8ICSA 3H39A 9ICBA 3G6YA 2XY6A 4FHWA 1UEVA 4FS2A 4KLFA 4ED3A 1TVAA 3KTQA 4NY8A 4DOCA 4ED7A 3B0YA 4RQ4A 3BQ1A 3T3FA 1ZQTA 4O5CA 4S3NA 4ED0A 2BPFA 3T5KA 4F93B 1MQ3A 2IMWP 4JV1A 3TQ1A 4J9OA 1WCLA 3RJKA 5F2VO 3ISDA 1HUOA 4KLUA 4J9LA 1QTMA 1DK2A 2NRWA 1BPZA 4JUZA 3MR5A 1TAUA 1FA0A 3MDCA 1KLNA 4WCWA 1ZQWA 4IG8A 4TUQA 3MDAA 3GV7B 2ASDA 5L1JA 4IQUA 5DQGA 2PFQA 5J0XA 4JWMA 4NLGA 1MC8A 3HIYA 4WC1A 1S0MA 5KFBA 9ICPA 4DO9A 2R8JA 1D9FA 8ICOA 4QW8A 4I2BA 2FMSA 1L3VA 1NKEA 1SZPA 3N4MB 3ZDDA 4YD1A 4F5QA 1KSPA 1COOA 3PR4A 8ICJA 4C8LA 3WFSC 3RH4A 4KLQA 3C5FA 2M2WA 4IRCA 4O5EA 4MFFA 4IR1A 1U48A 3RTVA 4DSEA 5KFSA 4WC2A 1KRPA 9ICUA 4LT6A 1NJXA 2FLPA 4BXOB 9ICKA 2DR7A 1ZJNA 4F4YA 1S0NA 3H37A 5DB7A 2DR5A 5HRFA 3TFSA 1WCNA 3H8WA 5J2HA 1TV9A 4B9NA 1NO5A 4I2CA 4TQSA 1SKRA 4RQ3A 1L3SA 2W8LA 8ICVA 2HHPA 3RH5A 5KFUA 4DOBA 4F3OA 4X4RA 1A76A 5J0SA 4J9QA 2KZ3A 5HMLA 3PMNA 3OSNA 1XS9D 4YR3A 2HHQA 8ICYA 3UXOA 2ASJA 4B9MA 5IIJA 5HHHA 2AQ4A 1NK4A 7ICJA 5KFFA 4UD5A 5IIIA 3PX4A 7ICQA 5KG5A 4I2EA 5HRBA 4IQVA 4DQRA 3RJIA 1L5UA 2PFPA 1QLNA 2ZH2A 4UQGA 4LVSA 2ZUBA 5KTQA 1RYRA 3GV5B 4RNNA 7ICGA 5KT2A 5J2KA 4GXIA 5J2AA 5KG1A 3MR2A 4YVZA 2KFZA 3C18A 1MQ2A 3TI0A 2NRXA 2JZBB 5J2BA 1RZTA 4NM1A 4ZH4A 4M5DA 1PZNA 5J0UA 1X9MA 3AQMA 2HHUA 5HRGA 4UB4A 2BCUA 4Z6DA 3OGUA 4PGQA 4NLNA 1TKDA 1SKSA 4QZAA 1S9FA 4C8MA 9ICAA 2MUTA 2W9BB 3H4DA 4RNMA 4DL4A 1ZQFA 3THVA 8ICQA 1CUKA 5HMMA 3ISCA 2AGOA 4KN7A 1KFSA 3PVXA 4EYIB 5DLFA 4E80A 5IIOA 1TK0A 4KLDA 3RAXA 2BQRA 4P2HA 3RJJA 3V72A 1XWLA 4DFJA 1HJPA 3UPSA 1AROP 5HRKA 2UVRA 5DDMA 4RWNA 3SI8A 4F91B 3MGIA 4KLTA 4X4OA 5HREA 1ZQIA 4DFKA 3OUYB 2DRAA 4ED2A 1L3TA 1L3UA 1DK3A 1MIWA 8ICAA 3AQKA 3C5GA 1ZYQA 1T7PA 2ZH5A 4LZGA 5L1IA 3ZD8A 2ATLA 4MFCA 4O5KA 8ICNA 1Z00A 4WBYA 4J9NA 3N97B 4M47A 4O3RA 1RPLA 4R8UB 1ZQOA 2C2EA 3EWAA 1ZQMA 1BPEA 2IHNA 5DGBA 2ID1A 5DB6A 3PR5B 4EZ9A 4GC6A 2BDPA 1DOQA 4YXMA 1BGXT 3KHGA 2NRVA 5KFOA 4K4HA 2UVVA 7ICTA 1NK0A 2ZUCA 7ICLA 4DF8A 3UXNA 4ECXA 2ZJAA 4F4WA 2BPGA 2BCVA 4DSLA 2HHVA 3HW8A 4RQ8A 3GIKA 2A1JB 5D4BA 4F5RA 4ECYA 4E0DA 5IIMA 1ZQQA 2BCQA 4ATBB 5KG3A 3PW4A 3K4GA 3QZ8A 3Q8PB 3V6KA 3TANA 1NJWA 2JEFA 2FMQA 1ZQBA 3H8JA 2ISPA 4YQWA 8ICRA 5KFRA 4F92B 4RT2A 4RPXA 5DGAA 3RJHA 7ICMA 1BNOA 3EPIA 4WC7A 4QZEA 5DG9A 1QSSA 4NKUA 3H8SA 4M6WA 5CB1A 5IINA 4DQQA 3T5HA 5KFJA 9ICSA 3JZ0A 9ICNA 5KFAA 4RWOA 1VFGA 3JPSA 4DSJA 4X4NA 1XU4A 2Q66A 4UB5A 4EBEA 2JEIA 3QEAZ 4YN4A 1XSPA 4O3SA 3FYHA 4NLKA 4EBJA 4X0AA 5L9XA 1WOTA 2P6UA 8ICHA 1NKCA 4RNOA 4NKTA 3V6HA 1ZQLA 2BHNA 1ZQCA 2I1QA 8ICTA 1NK9A 3RR7A 3L9DA 5EWGA 4I2HA 1BPDA 1NK6A 1F5AA 2VA8A 5KFEA 4PHAA 4X4PA 2XGPA 3JPRA 3GIIA 4M0AA 1R89A 4X4UA 1NJYA 4AT9A 4RU9A 4QZFA 3MGHA 3T5LA 4E8FA 2H5XA 3Q8MA 4MFAA 4FHXA 3C21A 1ZQGA 3M9NB 4FBUA 4JV2A 3GFKB 1IM4A 1IXRA 7ICIA 1NK8A 2V4QA 1UETA 4BWJA 4I29A 4Z6CA 4RT3A 4M2YA 8ICPA 1JIHA 5KFHA 4UB2A 2IBKA 1C7YA 4M9GA 4X0BA 5KG0A 4RPYA 3PNCA 3TARA 5JUMA 4ELTA 4F2SA 3PV8A 1ZQHA 2ZTCA 4XQ7A 5J0WA 3AU6A 1N56A 4DQPA 3MFHA 4KLMA 5J2DA 3OHBA 4R66A 1KEJA 2KFNA 9ICXA 2XGQA 5J2CA 2W9CB 3KHLA 2ZJ8A 4DFPA 1U4BA 5HRLA 2AU0A 1S10A 2DR9A 1UEUA 4I2GA 1A77A 3ZD9A 4RUAA 2XY5A 4KTQA 4HYKA 2PBEA 2MAXA 4QZBA 4JV0A 3AU2A 3SV4A 4PGYA 4B9SA 3H7IA 4ECSA 4EBDA 4DLGA 4PGXA 1EXNA 4DF4A 1V4AA 4JWNA 1TFWA 1JN3A 2ZJ5A 5KFCA 2ZH7A 4LZDA 5HP4A 4QZHA 2PI5A 4IR9A 5DBCA 3AQNA 2ZH6A 4M9HA 5DECA 3LWMA 1Y88A 5F9LA 2W9AA 4KLOA 4QW9A 4RWPA 1NZPA 5HRHA 3MR6A 2NRTA 3SV3A 2HVHA 3JPQA 3MBYA 4C8KA 2Y1JA 5L1KA 4I2DA 4YR2A 4GXKA 4K4GA 4AT7B 4QZGA 1ZQZA 2M2TA 5KT7A 4J9SA 4BGDA 4UBBA 5DKWA 2BQUA 1UA1A 1ZQJA 2VA3A 8ICUA 1BPYA 2LYHA 1S77D 5DQIA 4RQ1A 1U47A 1T8EA 5KFQA 1BPBA 5KT4A 4PHEA 3M8SA 4F50A 4GLXA 3V6JA 9ICRA 2ZHBA 4UAWA 4IQWA 3Q8KA 4KITB 4QZIA 5L1LA 2HVIA 9ICOA 4KN4A 2BR0A 4UAYA 4GC7A 2ZTDA 2BGWA 2R8HA 1XSNA 4GXJA 2VA2A 3IM1A 9ICFA 7ICKA 1NJZA 3C2MA 4QWEA 4M04A 3WFRE 2BPCA 3B0XA 4FHPA 3C66A 2AGPA 5J0YA 4ED1A 3OV7A 4ELUA 4ED8A 2I9GA 2VANA 4XRHA 1LV5A 4ED6A 5DQHA 2KP7A 4RQ2A 3BQTA 3G6XA 5KFDA 2HW3A 2ZH4A 5KFGA 5HHIA 2DPIA 5TZVA 4IRKA 2KTQA 5CHGA 4Q43A 4M9JA 7ICSA 1S76D 4FHYA 4AT8B 1RYSA 2FLLA 7ICNA 7ICHA 3HP6A 7ICFA 4M9NA 4TUSA 3GIMA 4ECUA 1U45A 4PH5A 4C8NA 5IIKA 1TAQA 4DQSA 3PO5A 4BXOA 4DSIA 4EEYA 5DEDA 2KZZA 5KFIA 4YXJA 2R8GA 5IILA 8ICCA 3MABA 4X5VA 1ZQYA 4Q45A 3T5JA 2C2RA 2M2VA 5KT5A 4J9PA 2PFOA 4X4TA 4I2FA 2M9NA 5DG8A 1KNYA 3SZ2A 1CEZA 3JPPA 4QZDA 4I2AA 9ICEA 4YCXA 1R8AA 4ECRA 3JYYA 4QZ9A 9ICWA 4O3QA 4YMNA 3Q8QB 1NK5A 2ASLA 3UXPA 3PMLA 1ZQDA 3JPOA 1D9DA 3OHAA 2AGQA 4DL6A 1SL2A 5KFWA 3C1YA 8ICFA 3RH6A 8ICZA 4QZCA 4DL5A 4XQ8A 8ICWA 3WFOA 1RXVA 4Z6EA 3M8RA 1X9SA 4RQ0A 1TK5A 3M9MB 4DWIA 4IRDA 3LQCB 1OU5A 5HC9A 1ZQVA 3TFRA 5KG7A 3RBEA 2C2DA 4B9UA 4ELVA 7ICUA 2F1HA 4K4IA 8ICGA 5J29A 4O3NA 1TFRA 2JZBA 4XA5A 5J2FA 1HUZA 4IQTA 5KFMA 5CA7A 3GQCA 5DDYA 2C22A 1N48A 2HHXA 3E2EA 4NXZA 9ICQA 8ICIA 4ECQA 2J6UA 5HR9A 1NOMA 4RPZA 2NRKA 2ZUDA 3FDSA 1X2IA 4DOAA 1KFTA 2FPLA 7ICEA 4RQ7A 4EYHB 4KLGA 2W9BA 1B43A 2DPJA 4NLZA 1VJ7A 5J2EA 2DFLA 2XCAA 2C28A 3WFPA 3GILA 3BQ0A 4MF8A 2WTFA 3C1ZA 3PX0A 1LB2B 4EP7A 3BJYA 1KTQA 1TK8A 4UB3A 1KDHA 1JXLA 2F1JA 1SL1A 2B21A 5CP2A 4KLSA 3RB4A 4B9TA 3RAQA 4P4MA 5KFTA 4I2JA 3ZDAA 3H40A 5DB9A 3OUYA 3K75D 3JPNA 2PXIA 2PI4A 1PX5A 2DRBA 4I27A 4FH3A 4F5OA 4BWMA 5DB8A 5DBAA 5J0OA 4WC3A 5BOMA 4FO6A 5J0PA 3RR8A 3PX6A 4YD2A 9ICMA 4DLEA 4B9LA 2KZMA 3AQLA 2UVWA 3V7LA 4WBZA 2DR8A 5KG6A 4RQ5A 2RFFA 5DBBA 4R8UA 4P4OA 3HWTA 4DL3A 4TQRA 3V7JA 2XC9A 3RB6A 2J6SA 4G3IA 5KFZA 1JMSA 5J2IA 4DS5A 1QSLA 1S0OA 3EW9A 3IHQB 3KHHA 3MFIA 4KLLA 3JPTA 2DVIA 5J2JA 3HJ4A 4ECVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGD A;  3LDA A;  3UQ2 A;  1QSY A;  2A1J A;  3GDX A;  3C23 A;  4J9M A;  4O9M A;  1V9P A;  1ZQP A;  7ICO A;  4ATB A;  2MUT B;  1T3N A;  4UAZ A;  4F8R A;  3EZ5 A;  2XCP A;  3KHR A;  3PW7 A;  5J0R A;  1ZJM A;  4EZ6 A;  3WFQ E;  2W8K A;  1KFD A;  3Q8S B;  7ICP A;  4Z6F A;  3H4B A;  4O3O A;  4TUR A;  5KFL A;  1K1Q A;  1JX4 A;  4DSK A;  2IHM A;  2HHW A;  8ICK A;  3RB3 A;  3NTU A;  1SKW A;  4TUP A;  1SL0 A;  3QZ7 A;  4DS4 A;  4I2I A;  4MEY A;  4UB1 A;  2V4R A;  3C2L A;  4KLJ A;  3RJG A;  9ICG A;  3HX0 A;  4EBK A;  3OVA A;  2R8I A;  3OJS A;  3EPG A;  3BQ2 A;  4KLH A;  4WC5 A;  4WC4 A;  4KLI A;  3NYB A;  1ZQS A;  7ICR A;  3OSP A;  4YMM A;  2ZH3 A;  1Z00 B;  5BPC A;  1U49 A;  5KFN A;  3ISB A;  4F4X A;  3QEB Z;  8ICE A;  1ZQU A;  7ICV A;  2IA6 A;  3H3A A;  5KG4 A;  9ICT A;  5J0Q A;  2PFN A;  3BDP A;  3PW2 A;  1YLQ A;  4RUC A;  5KT6 A;  4O0I A;  2FMP A;  3ETL A;  4UD4 A;  3AUO A;  3ZDB A;  4Q8F A;  9ICJ A;  1UT8 A;  4QWC A;  4F4K A;  2ALZ A;  4XUS A;  1H38 A;  4O3P A;  9ICH A;  2FPM A;  3QE9 Y;  3UPQ A;  3V7K A;  2ISO A;  5EOZ A;  5KFP A;  3Q8R B;  3RRH A;  4YFK A;  1T4G A;  5KFV A;  5HRI A;  1D8L A;  2ZTE A;  2GWS A;  2NRZ A;  2F1I A;  1B22 A;  1ZQX A;  3HJ1 A;  4C8O A;  4FBT A;  2RDI A;  1BNP A;  1TFY A;  4B9V A;  4R64 A;  5CR0 A;  4J9R A;  4M6W B;  4F5N A;  3PW5 A;  3RJE A;  9ICL A;  4RWQ A;  1BVS A;  1NKB A;  2W9C A;  2BKE A;  2FPK A;  3G6V A;  1D8Y A;  3UQ0 A;  4ECZ A;  2JEG A;  3PO4 A;  5KG2 A;  1UT5 A;  4RQ6 A;  5CJ7 A;  4YR0 A;  4X4Q A;  3OVS A;  4PHD A;  2OWO A;  1S97 A;  4PPX A;  1JXE A;  5KT3 A;  2AJQ A;  3H38 A;  1JAJ A;  4QWB A;  2ZHA A;  4YG2 A;  9ICC A;  3OVB A;  4R63 A;  5D49 A;  1BPX A;  5J2G A;  4DL2 A;  1NK7 A;  1ZQN A;  3EYZ A;  1ZQK A;  4BDP A;  3C2K A;  4J9K A;  4DFM A;  1R8B A;  4DSF A;  4Q44 A;  4RZR A;  3GV8 B;  4AT9 B;  3M9O B;  8ICM A;  3MR3 A;  1R8C A;  4MF2 A;  4X4S A;  4UBC A;  4F2R A;  2XY7 A;  1ZET A;  2KN7 A;  4WC0 A;  3RJF A;  4I28 A;  4Q8E A;  3ZDE A;  5HNK A;  2P6R A;  8ICL A;  2R8K A;  4AT7 A;  2J6T A;  4F4Z A;  2W9M A;  9ICI A;  2AQ0 A;  1ZQE A;  4DEZ A;  5J0T A;  2UVU A;  1MSW D;  4JK1 A;  1DGS A;  3RBD A;  1MIV A;  3TAQ A;  1U9L A;  4R65 A;  4NM2 A;  4QWA A;  4EBC A;  8ICX A;  5BOL A;  2HHT A;  1JQR A;  1K1S A;  4F5P A;  2BQ3 A;  3TAP A;  2JEJ A;  3ZDC A;  5KFK A;  1UA0 A;  4FHV A;  4YP3 A;  2HHS A;  4ECW A;  4PHP A;  1ZQR A;  2BCS A;  1Q79 A;  5HRD A;  5EWF A;  1ZQA A;  5C5J A;  3LK9 A;  2FLN A;  4DQI A;  1RXW A;  5F9N A;  4DL7 A;  3PY8 A;  5CWR A;  4M9L A;  2RDJ A;  5EWE A;  9ICV A;  4QWD A;  4ECT A;  4CCH A;  2Y1I A;  2Q0Z X;  3OJU A;  4FS1 A;  4KLE A;  2BE3 A;  3SYZ A;  2XO7 A;  3GIJ A;  3RB0 A;  3RRG A;  3HT3 A;  1Q78 A;  4E7X A;  4WC6 A;  2BCR A;  1MIY A;  4YMO A;  2ZH1 A;  4KMU A;  8ICB A;  2O1P A;  1Z3E B;  4QZ8 A;  1X9W A;  2M2U A;  5DG7 A;  2O5A A;  5KFY A;  3LWL A;  4AT8 A;  5D46 A;  2ZH8 A;  4X4V A;  4MEX A;  3HPO A;  1S0V A;  4FH5 A;  1XC9 A;  5KFX A;  4P4P A;  2ZH9 A;  1XO1 A;  1XSL A;  2P66 A;  2V9W A;  3ORY A;  5DLG A;  3PW0 A;  3Q8L A;  8ICS A;  3H39 A;  9ICB A;  3G6Y A;  2XY6 A;  4FHW A;  1UEV A;  4FS2 A;  4KLF A;  4ED3 A;  1TVA A;  3KTQ A;  4NY8 A;  4DOC A;  4ED7 A;  3B0Y A;  4RQ4 A;  3BQ1 A;  3T3F A;  1ZQT A;  4O5C A;  4S3N A;  4ED0 A;  2BPF A;  3T5K A;  4F93 B;  1MQ3 A;  2IMW P;  4JV1 A;  3TQ1 A;  4J9O A;  1WCL A;  3RJK A;  5F2V O;  3ISD A;  1HUO A;  4KLU A;  4J9L A;  1QTM A;  1DK2 A;  2NRW A;  1BPZ A;  4JUZ A;  3MR5 A;  1TAU A;  1FA0 A;  3MDC A;  1KLN A;  4WCW A;  1ZQW A;  4IG8 A;  4TUQ A;  3MDA A;  3GV7 B;  2ASD A;  5L1J A;  4IQU A;  5DQG A;  2PFQ A;  5J0X A;  4JWM A;  4NLG A;  1MC8 A;  3HIY A;  4WC1 A;  1S0M A;  5KFB A;  9ICP A;  4DO9 A;  2R8J A;  1D9F A;  8ICO A;  4QW8 A;  4I2B A;  2FMS A;  1L3V A;  1NKE A;  1SZP A;  3N4M B;  3ZDD A;  4YD1 A;  4F5Q A;  1KSP A;  1COO A;  3PR4 A;  8ICJ A;  4C8L A;  3WFS C;  3RH4 A;  4KLQ A;  3C5F A;  2M2W A;  4IRC A;  4O5E A;  4MFF A;  4IR1 A;  1U48 A;  3RTV A;  4DSE A;  5KFS A;  4WC2 A;  1KRP A;  9ICU A;  4LT6 A;  1NJX A;  2FLP A;  4BXO B;  9ICK A;  2DR7 A;  1ZJN A;  4F4Y A;  1S0N A;  3H37 A;  5DB7 A;  2DR5 A;  5HRF A;  3TFS A;  1WCN A;  3H8W A;  5J2H A;  1TV9 A;  4B9N A;  1NO5 A;  4I2C A;  4TQS A;  1SKR A;  4RQ3 A;  1L3S A;  2W8L A;  8ICV A;  2HHP A;  3RH5 A;  5KFU A;  4DOB A;  4F3O A;  4X4R A;  1A76 A;  5J0S A;  4J9Q A;  2KZ3 A;  5HML A;  3PMN A;  3OSN A;  1XS9 D;  4YR3 A;  2HHQ A;  8ICY A;  3UXO A;  2ASJ A;  4B9M A;  5IIJ A;  5HHH A;  2AQ4 A;  1NK4 A;  7ICJ A;  5KFF A;  4UD5 A;  5III A;  3PX4 A;  7ICQ A;  5KG5 A;  4I2E A;  5HRB A;  4IQV A;  4DQR A;  3RJI A;  1L5U A;  2PFP A;  1QLN A;  2ZH2 A;  4UQG A;  4LVS A;  2ZUB A;  5KTQ A;  1RYR A;  3GV5 B;  4RNN A;  7ICG A;  5KT2 A;  5J2K A;  4GXI A;  5J2A A;  5KG1 A;  3MR2 A;  4YVZ A;  2KFZ A;  3C18 A;  1MQ2 A;  3TI0 A;  2NRX A;  2JZB B;  5J2B A;  1RZT A;  4NM1 A;  4ZH4 A;  4M5D A;  1PZN A;  5J0U A;  1X9M A;  3AQM A;  2HHU A;  5HRG A;  4UB4 A;  2BCU A;  4Z6D A;  3OGU A;  4PGQ A;  4NLN A;  1TKD A;  1SKS A;  4QZA A;  1S9F A;  4C8M A;  9ICA A;  2MUT A;  2W9B B;  3H4D A;  4RNM A;  4DL4 A;  1ZQF A;  3THV A;  8ICQ A;  1CUK A;  5HMM A;  3ISC A;  2AGO A;  4KN7 A;  1KFS A;  3PVX A;  4EYI B;  5DLF A;  4E80 A;  5IIO A;  1TK0 A;  4KLD A;  3RAX A;  2BQR A;  4P2H A;  3RJJ A;  3V72 A;  1XWL A;  4DFJ A;  1HJP A;  3UPS A;  1ARO P;  5HRK A;  2UVR A;  5DDM A;  4RWN A;  3SI8 A;  4F91 B;  3MGI A;  4KLT A;  4X4O A;  5HRE A;  1ZQI A;  4DFK A;  3OUY B;  2DRA A;  4ED2 A;  1L3T A;  1L3U A;  1DK3 A;  1MIW A;  8ICA A;  3AQK A;  3C5G A;  1ZYQ A;  1T7P A;  2ZH5 A;  4LZG A;  5L1I A;  3ZD8 A;  2ATL A;  4MFC A;  4O5K A;  8ICN A;  1Z00 A;  4WBY A;  4J9N A;  3N97 B;  4M47 A;  4O3R A;  1RPL A;  4R8U B;  1ZQO A;  2C2E A;  3EWA A;  1ZQM A;  1BPE A;  2IHN A;  5DGB A;  2ID1 A;  5DB6 A;  3PR5 B;  4EZ9 A;  4GC6 A;  2BDP A;  1DOQ A;  4YXM A;  1BGX T;  3KHG A;  2NRV A;  5KFO A;  4K4H A;  2UVV A;  7ICT A;  1NK0 A;  2ZUC A;  7ICL A;  4DF8 A;  3UXN A;  4ECX A;  2ZJA A;  4F4W A;  2BPG A;  2BCV A;  4DSL A;  2HHV A;  3HW8 A;  4RQ8 A;  3GIK A;  2A1J B;  5D4B A;  4F5R A;  4ECY A;  4E0D A;  5IIM A;  1ZQQ A;  2BCQ A;  4ATB B;  5KG3 A;  3PW4 A;  3K4G A;  3QZ8 A;  3Q8P B;  3V6K A;  3TAN A;  1NJW A;  2JEF A;  2FMQ A;  1ZQB A;  3H8J A;  2ISP A;  4YQW A;  8ICR A;  5KFR A;  4F92 B;  4RT2 A;  4RPX A;  5DGA A;  3RJH A;  7ICM A;  1BNO A;  3EPI A;  4WC7 A;  4QZE A;  5DG9 A;  1QSS A;  4NKU A;  3H8S A;  4M6W A;  5CB1 A;  5IIN A;  4DQQ A;  3T5H A;  5KFJ A;  9ICS A;  3JZ0 A;  9ICN A;  5KFA A;  4RWO A;  1VFG A;  3JPS A;  4DSJ A;  4X4N A;  1XU4 A;  2Q66 A;  4UB5 A;  4EBE A;  2JEI A;  3QEA Z;  4YN4 A;  1XSP A;  4O3S A;  3FYH A;  4NLK A;  4EBJ A;  4X0A A;  5L9X A;  1WOT A;  2P6U A;  8ICH A;  1NKC A;  4RNO A;  4NKT A;  3V6H A;  1ZQL A;  2BHN A;  1ZQC A;  2I1Q A;  8ICT A;  1NK9 A;  3RR7 A;  3L9D A;  5EWG A;  4I2H A;  1BPD A;  1NK6 A;  1F5A A;  2VA8 A;  5KFE A;  4PHA A;  4X4P A;  2XGP A;  3JPR A;  3GII A;  4M0A A;  1R89 A;  4X4U A;  1NJY A;  4AT9 A;  4RU9 A;  4QZF A;  3MGH A;  3T5L A;  4E8F A;  2H5X A;  3Q8M A;  4MFA A;  4FHX A;  3C21 A;  1ZQG A;  3M9N B;  4FBU A;  4JV2 A;  3GFK B;  1IM4 A;  1IXR A;  7ICI A;  1NK8 A;  2V4Q A;  1UET A;  4BWJ A;  4I29 A;  4Z6C A;  4RT3 A;  4M2Y A;  8ICP A;  1JIH A;  5KFH A;  4UB2 A;  2IBK A;  1C7Y A;  4M9G A;  4X0B A;  5KG0 A;  4RPY A;  3PNC A;  3TAR A;  5JUM A;  4ELT A;  4F2S A;  3PV8 A;  1ZQH A;  2ZTC A;  4XQ7 A;  5J0W A;  3AU6 A;  1N56 A;  4DQP A;  3MFH A;  4KLM A;  5J2D A;  3OHB A;  4R66 A;  1KEJ A;  2KFN A;  9ICX A;  2XGQ A;  5J2C A;  2W9C B;  3KHL A;  2ZJ8 A;  4DFP A;  1U4B A;  5HRL A;  2AU0 A;  1S10 A;  2DR9 A;  1UEU A;  4I2G A;  1A77 A;  3ZD9 A;  4RUA A;  2XY5 A;  4KTQ A;  4HYK A;  2PBE A;  2MAX A;  4QZB A;  4JV0 A;  3AU2 A;  3SV4 A;  4PGY A;  4B9S A;  3H7I A;  4ECS A;  4EBD A;  4DLG A;  4PGX A;  1EXN A;  4DF4 A;  1V4A A;  4JWN A;  1TFW A;  1JN3 A;  2ZJ5 A;  5KFC A;  2ZH7 A;  4LZD A;  5HP4 A;  4QZH A;  2PI5 A;  4IR9 A;  5DBC A;  3AQN A;  2ZH6 A;  4M9H A;  5DEC A;  3LWM A;  1Y88 A;  5F9L A;  2W9A A;  4KLO A;  4QW9 A;  4RWP A;  1NZP A;  5HRH A;  3MR6 A;  2NRT A;  3SV3 A;  2HVH A;  3JPQ A;  3MBY A;  4C8K A;  2Y1J A;  5L1K A;  4I2D A;  4YR2 A;  4GXK A;  4K4G A;  4AT7 B;  4QZG A;  1ZQZ A;  2M2T A;  5KT7 A;  4J9S A;  4BGD A;  4UBB A;  5DKW A;  2BQU A;  1UA1 A;  1ZQJ A;  2VA3 A;  8ICU A;  1BPY A;  2LYH A;  1S77 D;  5DQI A;  4RQ1 A;  1U47 A;  1T8E A;  5KFQ A;  1BPB A;  5KT4 A;  4PHE A;  3M8S A;  4F50 A;  4GLX A;  3V6J A;  9ICR A;  2ZHB A;  4UAW A;  4IQW A;  3Q8K A;  4KIT B;  4QZI A;  5L1L A;  2HVI A;  9ICO A;  4KN4 A;  2BR0 A;  4UAY A;  4GC7 A;  2ZTD A;  2BGW A;  2R8H A;  1XSN A;  4GXJ A;  2VA2 A;  3IM1 A;  9ICF A;  7ICK A;  1NJZ A;  3C2M A;  4QWE A;  4M04 A;  3WFR E;  2BPC A;  3B0X A;  4FHP A;  3C66 A;  2AGP A;  5J0Y A;  4ED1 A;  3OV7 A;  4ELU A;  4ED8 A;  2I9G A;  2VAN A;  4XRH A;  1LV5 A;  4ED6 A;  5DQH A;  2KP7 A;  4RQ2 A;  3BQT A;  3G6X A;  5KFD A;  2HW3 A;  2ZH4 A;  5KFG A;  5HHI A;  2DPI A;  5TZV A;  4IRK A;  2KTQ A;  5CHG A;  4Q43 A;  4M9J A;  7ICS A;  1S76 D;  4FHY A;  4AT8 B;  1RYS A;  2FLL A;  7ICN A;  7ICH A;  3HP6 A;  7ICF A;  4M9N A;  4TUS A;  3GIM A;  4ECU A;  1U45 A;  4PH5 A;  4C8N A;  5IIK A;  1TAQ A;  4DQS A;  3PO5 A;  4BXO A;  4DSI A;  4EEY A;  5DED A;  2KZZ A;  5KFI A;  4YXJ A;  2R8G A;  5IIL A;  8ICC A;  3MAB A;  4X5V A;  1ZQY A;  4Q45 A;  3T5J A;  2C2R A;  2M2V A;  5KT5 A;  4J9P A;  2PFO A;  4X4T A;  4I2F A;  2M9N A;  5DG8 A;  1KNY A;  3SZ2 A;  1CEZ A;  3JPP A;  4QZD A;  4I2A A;  9ICE A;  4YCX A;  1R8A A;  4ECR A;  3JYY A;  4QZ9 A;  9ICW A;  4O3Q A;  4YMN A;  3Q8Q B;  1NK5 A;  2ASL A;  3UXP A;  3PML A;  1ZQD A;  3JPO A;  1D9D A;  3OHA A;  2AGQ A;  4DL6 A;  1SL2 A;  5KFW A;  3C1Y A;  8ICF A;  3RH6 A;  8ICZ A;  4QZC A;  4DL5 A;  4XQ8 A;  8ICW A;  3WFO A;  1RXV A;  4Z6E A;  3M8R A;  1X9S A;  4RQ0 A;  1TK5 A;  3M9M B;  4DWI A;  4IRD A;  3LQC B;  1OU5 A;  5HC9 A;  1ZQV A;  3TFR A;  5KG7 A;  3RBE A;  2C2D A;  4B9U A;  4ELV A;  7ICU A;  2F1H A;  4K4I A;  8ICG A;  5J29 A;  4O3N A;  1TFR A;  2JZB A;  4XA5 A;  5J2F A;  1HUZ A;  4IQT A;  5KFM A;  5CA7 A;  3GQC A;  5DDY A;  2C22 A;  1N48 A;  2HHX A;  3E2E A;  4NXZ A;  9ICQ A;  8ICI A;  4ECQ A;  2J6U A;  5HR9 A;  1NOM A;  4RPZ A;  2NRK A;  2ZUD A;  3FDS A;  1X2I A;  4DOA A;  1KFT A;  2FPL A;  7ICE A;  4RQ7 A;  4EYH B;  4KLG A;  2W9B A;  1B43 A;  2DPJ A;  4NLZ A;  1VJ7 A;  5J2E A;  2DFL A;  2XCA A;  2C28 A;  3WFP A;  3GIL A;  3BQ0 A;  4MF8 A;  2WTF A;  3C1Z A;  3PX0 A;  1LB2 B;  4EP7 A;  3BJY A;  1KTQ A;  1TK8 A;  4UB3 A;  1KDH A;  1JXL A;  2F1J A;  1SL1 A;  2B21 A;  5CP2 A;  4KLS A;  3RB4 A;  4B9T A;  3RAQ A;  4P4M A;  5KFT A;  4I2J A;  3ZDA A;  3H40 A;  5DB9 A;  3OUY A;  3K75 D;  3JPN A;  2PXI A;  2PI4 A;  1PX5 A;  2DRB A;  4I27 A;  4FH3 A;  4F5O A;  4BWM A;  5DB8 A;  5DBA A;  5J0O A;  4WC3 A;  5BOM A;  4FO6 A;  5J0P A;  3RR8 A;  3PX6 A;  4YD2 A;  9ICM A;  4DLE A;  4B9L A;  2KZM A;  3AQL A;  2UVW A;  3V7L A;  4WBZ A;  2DR8 A;  5KG6 A;  4RQ5 A;  2RFF A;  5DBB A;  4R8U A;  4P4O A;  3HWT A;  4DL3 A;  4TQR A;  3V7J A;  2XC9 A;  3RB6 A;  2J6S A;  4G3I A;  5KFZ A;  1JMS A;  5J2I A;  4DS5 A;  1QSL A;  1S0O A;  3EW9 A;  3IHQ B;  3KHH A;  3MFI A;  4KLL A;  3JPT A;  2DVI A;  5J2J A;  3HJ4 A;  4ECV A; 
#chains in the Genus database with same CATH topology
 3NGD A;  1QSY A;  3GDX A;  4O9M A;  3C23 A;  3QU9 A;  4J9M A;  4UAZ A;  4CRX A;  3PW7 A;  5J0R A;  1CRX A;  2W8K A;  1KFD A;  2ZIX B;  3Q8S B;  1TE2 A;  4O3O A;  4TUR A;  3H0L B;  1JX4 A;  3NTU A;  1SL0 A;  4I2I A;  4UB1 A;  2V4R A;  4KLJ A;  3OVA A;  5JRT A;  4EBK A;  3HX0 A;  2R8I A;  3NKU A;  3CNH A;  3OJS A;  5AI6 A;  5KL1 B;  4NLC A;  2ZH3 A;  1PVR A;  3KKA A;  1U49 A;  8ICE A;  2HBK A;  3BZK A;  9ICT A;  3ZDB A;  3F2D A;  1H38 A;  3L5K A;  3V7K A;  5AKX A;  2OHF A;  1FO4 A;  2JRZ A;  2K4H A;  5HRI A;  4PZO A;  1ZD4 A;  1B22 A;  1SWW A;  5ALW A;  5AKG A;  1TFY A;  1DXS A;  5CR0 A;  4F5N A;  4LEV A;  9ICL A;  5AK6 A;  4OO1 J;  3K7D A;  2YY6 A;  4PPX A;  1YZ7 A;  3H38 A;  1ZQ1 C;  1BPX A;  1SXE A;  5J2G A;  4Y2T A;  1NK7 A;  2VJ5 A;  2K4P A;  3C2K A;  2XIC A;  3UMB A;  4DFM A;  2GAF D;  2FDR A;  3MR3 A;  2OH2 A;  2XY7 A;  3DDH A;  4WC0 A;  3I1Y A;  1MN8 A;  4I28 A;  3ZDE A;  2Y9U A;  1ZQE A;  4DEZ A;  4JK1 A;  1DGS A;  1V85 A;  3RBD A;  5ALZ A;  3AQF A;  4WH5 A;  4QWA A;  5AM5 A;  4FHV A;  2BCS A;  2I5H A;  5ALY A;  3A0H U;  1ZQA A;  5H2F U;  4DQI A;  5F9N A;  3PY8 A;  2RDJ A;  1KL9 A;  2QB0 A;  4A8E A;  4ECT A;  3OJU A;  1ZD5 A;  2XO7 A;  3GIJ A;  3KD3 A;  3CP8 A;  5KAF U;  1F5S A;  4FE3 A;  5AIB A;  1X9X A;  3LWL A;  5ALP A;  2EWR A;  4FH5 A;  1XC9 A;  1L7P A;  5KFX A;  4IC9 A;  2V9W A;  8ICS A;  5DLG A;  2W55 A;  2XY6 A;  4O6A A;  4FS2 A;  4KLF A;  4FZM A;  4ED3 A;  1SV4 A;  4DOC A;  4WC3 A;  3B0Y A;  3F5A A;  2QLT A;  4ZOH C;  3BQ1 A;  1ZQT A;  4BUG A;  3F53 A;  5FP0 A;  1XO0 A;  5AI9 A;  3ISD A;  1XNS A;  1DK2 A;  1BPZ A;  3MR5 A;  3LVV A;  3MDC A;  1KLN A;  4IG8 A;  4TUQ A;  5ALO A;  3GV7 B;  2ASD A;  5L1J A;  5J0X A;  1MC8 A;  2XVT A;  1UPH A;  4WC1 A;  1S0M A;  1QCK A;  3WK7 A;  2FMS A;  2KG5 A;  1COO A;  1JRO A;  1VLB A;  3C5F A;  4O5E A;  1WWV A;  1U48 A;  2W7O A;  3RTV A;  2B6G A;  4NXU A;  1F44 A;  1KRP A;  3M1Y A;  3SAH A;  2LBO A;  4CF3 A;  1S0N A;  2A19 A;  4AYB C;  2DR5 A;  5HRF A;  3B9J A;  4LJX A;  1TV9 A;  4B9N A;  4RQ3 A;  3RH5 A;  5KFU A;  4DOB A;  3PMN A;  1XS9 D;  5G5G A;  3UXO A;  2ASJ A;  5HHH A;  1NK4 A;  7ICJ A;  3F5E A;  5KG5 A;  4I2E A;  4P0P A;  2W3S A;  3KOO A;  2LYB A;  1IV8 A;  2ZUB A;  1J2M A;  5KTQ A;  4LVS A;  1RYR A;  3PSF A;  5J2A A;  3WKA A;  4NM1 A;  4ZH4 A;  2KMD A;  4M5D A;  1WUD A;  2HHU A;  5HRG A;  1SKS A;  4QZA A;  4C8M A;  5JU5 A;  3THV A;  4CF4 A;  2WB1 F;  2AGO A;  3PVX A;  5DLF A;  3QU7 A;  1TK0 A;  3RAX A;  4KLD A;  5AK4 A;  3RJJ A;  2ZIW B;  3QU5 A;  3UPS A;  2H3V A;  4CF5 A;  4K96 A;  4X4O A;  3OUY B;  4KLT A;  1L7N A;  2ZH5 A;  8ICA A;  3C5G A;  1T7P A;  4LZG A;  5ALG A;  2K8A A;  3IG5 A;  3CK6 A;  3N97 B;  2W03 A;  5AHX A;  2C2E A;  4PL2 A;  1BPE A;  4EZ9 A;  5CFT A;  5KFO A;  4K4H A;  3UXN A;  4ECX A;  1X40 A;  3GIK A;  1S5L U;  4E0D A;  5IIM A;  1HIW A;  3TAN A;  3V6K A;  1NJW A;  3H8J A;  9ICS A;  8ICR A;  2IHO A;  4RPX A;  2JGA A;  2KEY A;  1QSS A;  5ALM A;  4M6W A;  3JZ0 A;  9ICN A;  1XU4 A;  3NVZ A;  4EBE A;  4EBJ A;  1N63 A;  1WOT A;  8ICH A;  1ZQL A;  1ZQC A;  3PZP A;  8ICT A;  5EE3 A;  3NUQ A;  4I2H A;  1BPD A;  4QIW C;  5ALR A;  5KFE A;  5ALI A;  2WF6 A;  2DKX A;  1UHU A;  4LEY A;  3MGH A;  4QZF A;  4E8F A;  4LEW A;  4JV2 A;  7ICI A;  2CPR A;  3ER8 C;  3WKB A;  4BWJ A;  4I29 A;  2XI9 A;  4Z6C A;  8ICP A;  4X0B A;  2IBK A;  3TAR A;  4C0Z A;  4F2S A;  4DQP A;  3MFH A;  3OHB A;  4R66 A;  2KVS A;  2KFN A;  2G5H B;  4NXV A;  3KHL A;  2GH1 A;  2ES6 A;  5EE0 A;  2ZJ8 A;  2PMZ F;  1U4B A;  5HRL A;  2AU0 A;  1UEU A;  4QZB A;  3AU2 A;  3SV4 A;  2NO4 A;  4ECS A;  4DLG A;  4PGX A;  1EXN A;  2W3R A;  4JWN A;  1TFW A;  2ZH7 A;  2PI5 A;  3JCF A;  1Y88 A;  1NZP A;  2F2A B;  1KN5 A;  3JPQ A;  1NI3 A;  2E8O A;  4CDG A;  4GXK A;  2M2T A;  3HIL A;  4BGD A;  4UBB A;  2ZH6 A;  2YMQ A;  1S77 D;  2Z7J A;  2D3D A;  5KFQ A;  1BPB A;  3PSI A;  4UAW A;  4IQW A;  3Q8K A;  5ALJ A;  5L1L A;  2HVI A;  2BGW A;  5AKY A;  2NYV A;  5T14 A;  3IM1 A;  3WFR E;  4M04 A;  2HDO A;  2BPC A;  4FHP A;  3ONN A;  3H8M A;  2DUY A;  2HBM A;  5GTI U;  4ED8 A;  2VAN A;  3IDW A;  4XRH A;  4RQ2 A;  2E1E A;  2ZH4 A;  3CW2 C;  5CHG A;  1S76 D;  2FLL A;  2LM1 A;  4ECU A;  1ZRN A;  2NV3 A;  3MAB A;  3T5J A;  2OCE A;  4X4T A;  5KT5 A;  2M9N A;  2G08 A;  1CEZ A;  4OAI Z;  3WK4 A;  3JYY A;  9ICW A;  4O3Q A;  1ZQD A;  3UXP A;  3PML A;  1V38 A;  4EEK A;  8ICF A;  3C1Y A;  3MCR A;  4DL5 A;  2FJ6 A;  4KM5 A;  1RXV A;  5ALS A;  3M8R A;  1X9S A;  4Y2R A;  4RQ0 A;  3DV9 A;  1TK5 A;  4B9U A;  4U6P A;  4ELV A;  5AM0 A;  2F1H A;  4CE6 A;  1TFR A;  4XA5 A;  5J2F A;  3BS5 A;  4IQT A;  5CA7 A;  5AI8 A;  2HHX A;  5HR9 A;  5AKZ A;  4RPZ A;  4US8 A;  2NRK A;  1SV0 C;  4PJ0 U;  4RQ7 A;  1ECW A;  2DPJ A;  5J2E A;  2KK0 A;  1PVP A;  3QNM A;  1KTQ A;  4XJE A;  1JXL A;  3F2B A;  4B9T A;  5KFT A;  3M6K A;  2Y0S C;  3K75 D;  5BOM A;  2B56 A;  4P0P B;  3PX6 A;  9ICM A;  2RRD A;  4NWI A;  4WBZ A;  4RQ5 A;  1N2X A;  4P4O A;  2W11 A;  4DL3 A;  3V7J A;  2XC9 A;  3RB6 A;  4DFD A;  2EH9 A;  3HJ4 A;  4ECV A;  3UQ2 A;  2A1J A;  3AM9 A;  1V9P A;  7ICO A;  1T3N A;  3L3F X;  3ALR A;  3EZ5 A;  3KKA C;  3KHR A;  3SMV A;  4EZ6 A;  3WFQ E;  5F3X B;  1X42 A;  7ICP A;  4DSK A;  5KFL A;  3RB3 A;  1SKW A;  4TUP A;  3QZ7 A;  3MGV A;  2YTU A;  3RJG A;  3OPX A;  3SEI A;  1V97 A;  1ZQS A;  1Z1B A;  4YMM A;  4F4X A;  1ZQU A;  3HJE A;  7ICV A;  5KG4 A;  5J0Q A;  3BDP A;  1YLQ A;  2FMP A;  9ICJ A;  4Q8F A;  1UT8 A;  1FFU A;  1WWU A;  2ALZ A;  4O3P A;  9ICH A;  3QE9 Y;  5JTG A;  5EOZ A;  5KFP A;  4EED A;  1D8L A;  2ZTE A;  2KJ9 A;  1OW5 A;  2NRZ A;  1YZ6 A;  1ZQX A;  3AMZ A;  3HJ1 A;  2RDI A;  1JAL A;  4M6W B;  4CNQ A;  3RJE A;  4Q8E A;  3UQ0 A;  4ECZ A;  2JEG A;  3PO4 A;  5KG2 A;  1UT5 A;  2LMR A;  3OVS A;  1X66 A;  4PHD A;  1JAJ A;  4QWB A;  2ZHA A;  9ICC A;  3BS7 A;  2G06 A;  4R63 A;  4DL2 A;  5G5H A;  1R8B A;  4DSF A;  4Q44 A;  4RZR A;  1ZET A;  1O08 A;  2R8K A;  4F4Z A;  1N5X A;  2RP5 A;  1MIV A;  4F72 A;  3TAQ A;  2LYA A;  5AK5 A;  1JQR A;  2GO7 A;  4F5P A;  2BQ3 A;  3TAP A;  3PHZ A;  2JEJ A;  3ZDC A;  4YP3 A;  4ECW A;  4PHP A;  1ZQR A;  2KOB A;  3ED5 A;  5C5J A;  2BDU A;  3H0M B;  9ICV A;  2IOF K;  2Y1I A;  2LI6 A;  1Q78 A;  2PKE A;  3RB0 A;  4WC6 A;  3HT3 A;  2ZXH A;  3FM9 A;  2BCR A;  1MIY A;  4GIB A;  2O1P A;  2M2U A;  2O5A A;  2ZH8 A;  3QU2 A;  4UB6 U;  3Q8L A;  3PW0 A;  2FCL A;  4FHW A;  3PSP A;  1UEV A;  4NY8 A;  3KTQ A;  3T3F A;  4RQ4 A;  4O5C A;  2G07 A;  4UB8 U;  4J9O A;  4RQM A;  5J8Y A;  3RJK A;  4J9L A;  4OJP A;  2NRW A;  4NLG A;  2PFQ A;  3HIY A;  2L5Y A;  9ICP A;  2R8J A;  4IL6 U;  8ICO A;  3O0F A;  1NKE A;  3ZDD A;  4YD1 A;  3QUC A;  3RH4 A;  1AQ6 A;  2W7P A;  4EX6 A;  2M2W A;  4MFF A;  4UAS A;  4DSE A;  2H3Q A;  3N28 A;  4WC2 A;  9ICK A;  4JLX A;  1RDF A;  2YB1 A;  4F4Y A;  2K8C B;  3H37 A;  4CGZ A;  3NVY A;  2GLE A;  3H8W A;  5J2H A;  4TQS A;  2W8L A;  4F3O A;  3LVW A;  4X4R A;  5J0S A;  2KZ3 A;  2HHQ A;  4YR3 A;  4WQK A;  5KFF A;  5HRB A;  2KNJ A;  3RJI A;  1QLN A;  2K8B B;  4GXI A;  5KG1 A;  3MR2 A;  1SIJ A;  2NRX A;  5J2B A;  1N62 A;  3BS5 B;  5J0U A;  1S9F A;  5B5E U;  1ZQF A;  4RNM A;  2MSN A;  2E8M A;  1FIQ A;  5IIO A;  2ZIU A;  1SZH A;  2WF8 A;  3V72 A;  4DFJ A;  4C80 A;  1L3T A;  1PK1 A;  1D8B A;  1ZYQ A;  2MA1 A;  5AKK A;  1SXD A;  3ZD8 A;  4MFC A;  2CRX A;  4WBY A;  2A1A A;  3EWA A;  1ZQM A;  1F0M A;  4EEN A;  3EUB 2;  2BDP A;  1DOQ A;  1CI4 A;  1BGX T;  4AYB F;  2YN4 A;  2KSO A;  2ZJA A;  4F4W A;  2BCV A;  4N7R A;  2A1J B;  5D4B A;  4F5R A;  1ZQQ A;  2BCQ A;  4NLB A;  3PW4 A;  4KB6 A;  1Z19 A;  2JEF A;  4YQW A;  3RJH A;  7ICM A;  4EEL A;  4WC7 A;  4NKU A;  3TAD A;  5IIN A;  4DQQ A;  1VFG A;  3JPS A;  4DSJ A;  4X4N A;  4US9 A;  2JEI A;  2JH1 A;  4X0A A;  5AIC A;  5L9X A;  2P6U A;  3WU2 U;  4K9A A;  4NL9 C;  1F5A A;  3UMG A;  2KIV A;  3ICX A;  2XGP A;  5AIA A;  4OD0 A;  4RU9 A;  3T5L A;  4FHX A;  1IIP A;  3M9N B;  4FBU A;  3GFK B;  1IM4 A;  4RT3 A;  2E5S A;  4ELT A;  3ETR A;  2ZTC A;  3C29 A;  1QQ5 A;  1RQL A;  5J2D A;  4Y2J A;  9ICX A;  4Y2Y A;  2XGQ A;  4DFP A;  3ZD9 A;  5CFS A;  3VCB A;  2ESE A;  5C0Y A;  4HX0 A;  3NVW A;  2YMM A;  4PGY A;  3R9K A;  5AK3 A;  2JMG A;  2ZJ5 A;  5KFC A;  5HP4 A;  4QZH A;  4M9H A;  3LWM A;  3L4P A;  4KLO A;  4QW9 A;  4RWP A;  1GO3 F;  2OXO A;  4C8K A;  4QZG A;  5KT7 A;  4J9S A;  3M7D A;  5EE9 A;  1ZQJ A;  2VA3 A;  2DVI A;  4JMU A;  4RQ1 A;  1T8E A;  5ALE A;  5AM4 A;  5KT4 A;  4F50 A;  4Y2U A;  9ICR A;  1N5W A;  4QZI A;  4QIW F;  4UAY A;  2ZTD A;  1XSN A;  2VA2 A;  4O67 A;  7ICK A;  3IP4 B;  2O6K A;  3B0X A;  2JH7 A;  1KQQ A;  4ELU A;  2H3I A;  4ED6 A;  2KP7 A;  5DQH A;  3BQT A;  3G6X A;  5HHI A;  4IRK A;  3N7S C;  2E1F A;  4M9J A;  4FHY A;  1RYS A;  3NVO A;  4PH5 A;  3PO5 A;  4DSI A;  4DQS A;  5AM1 A;  5KFI A;  5AI4 A;  2R8G A;  5KL8 B;  5IIL A;  2DF4 B;  3UM9 A;  1KNY A;  4NXW A;  3JPP A;  4I2A A;  3SAG A;  4QZ9 A;  2F3N A;  3Q8Q B;  2OYY A;  2W04 A;  3GU3 A;  2AGQ A;  8ICZ A;  3WFO A;  4EEB A;  4DWI A;  5HC9 A;  3BZC A;  3TFR A;  2C2D A;  2W43 A;  8ICG A;  4EV6 A;  2EZX A;  2XID A;  5J29 A;  1HUZ A;  5KFM A;  2C22 A;  2ZUD A;  1X2I A;  1KFT A;  7ICE A;  4NLZ A;  1K5O A;  2DFL A;  4UW9 A;  3PX0 A;  3C1Z A;  4UB3 A;  2F1J A;  1SL1 A;  2B21 A;  3RB4 A;  2AHO B;  3RAQ A;  4I2J A;  3H40 A;  1T3Q A;  1N61 A;  3JPN A;  1PX5 A;  2KHQ A;  4F5O A;  5DB8 A;  4FO6 A;  5J0P A;  5GTH U;  3U26 A;  4O3M A;  4DLE A;  4B9L A;  5KG6 A;  2RFF A;  5DBB A;  4R8U A;  3HWT A;  4TQR A;  1NZB A;  1QSL A;  2ZH2 A;  4G9B A;  1ZQP A;  3K1R B;  4F8R A;  3GZF A;  1ZJM A;  4Z6F A;  2DBY A;  1B4F A;  3H4B A;  2ZIU B;  4K99 A;  4LEZ A;  1A0P A;  3HKZ F;  4MEY A;  5L1M A;  2FE9 A;  3EPG A;  4KLH A;  1PK1 B;  2Q4T A;  4KLI A;  3NYB A;  2N1R A;  3OSP A;  5BPC A;  3ISB A;  1ZD2 P;  3QEB Z;  2PFN A;  1Z4O A;  3PW2 A;  3D2Q A;  4RUC A;  5KT6 A;  5B3Q A;  2KSO B;  2FPM A;  3WKD A;  3M6Z A;  3Q8R B;  2QB0 B;  2Y0S F;  4C8O A;  4FBT A;  1BNP A;  4R64 A;  3PW5 A;  4RWQ A;  1BVS A;  1NKB A;  1A6S A;  2W9C A;  2FPK A;  3G6V A;  1D8Y A;  2K60 A;  5AKH A;  3WKE A;  4RQ6 A;  5CJ7 A;  1QQ7 A;  4YR0 A;  4X4Q A;  2F77 X;  1S97 A;  2QKQ A;  1JXE A;  3NRZ A;  5KT3 A;  2YMP A;  4YG2 A;  2ZIX A;  1ZQN A;  1M6Y A;  1ZQK A;  4BDP A;  4J9K A;  2KVC A;  1L6N A;  4KX5 A;  3GV8 B;  4MF2 A;  4F2R A;  3RJF A;  5HNK A;  8ICL A;  2J6T A;  2HBJ A;  9ICI A;  2AQ0 A;  5J0T A;  3HKZ C;  4NM2 A;  3CYM A;  2HHT A;  1K1S A;  2G0A A;  5ALD A;  2ZG6 A;  1UA0 A;  3IG8 A;  3D2N A;  1Q79 A;  1RXW A;  2H3Z A;  4DL7 A;  5CWR A;  1Q8K A;  4QWD A;  4CCH A;  4KLE A;  2Q0Z X;  2BE3 A;  4E7X A;  1ZD3 A;  3IV6 A;  4YMO A;  2ZH1 A;  2RQ5 A;  5DG7 A;  2KIW A;  4JLZ A;  4AT8 A;  5D46 A;  4X4V A;  2LM4 A;  4MEX A;  4P4P A;  1XO1 A;  2P66 A;  3ORY A;  3H39 A;  2GOL A;  2Y9T A;  3G6Y A;  1TVA A;  2BPF A;  3T5K A;  1MQ3 A;  2IMW P;  3TQ1 A;  5F2V O;  1HUO A;  4KLU A;  2OEH A;  2LKY A;  1ZQW A;  1Z4N A;  4JWM A;  2EDU A;  3KZX A;  3QUT A;  4Y2Q A;  4DO9 A;  1D9F A;  2EAN A;  3NS1 A;  3WK6 A;  4F5Q A;  1X6J A;  5AKE A;  8ICJ A;  4C8L A;  3E0F A;  3LYS A;  4UAR A;  2W54 A;  1YT3 A;  2FLP A;  3RFA A;  1ZJN A;  2WF7 A;  2WF9 A;  3OTQ A;  4FZL A;  5DB7 A;  2IOF A;  2OM6 A;  1WCN A;  4I2C A;  1L3S A;  1UQV A;  3T79 A;  1O03 A;  4J9Q A;  3OSN A;  1L7O A;  2AQ4 A;  4UD5 A;  5III A;  1Z1V A;  3PX4 A;  3RF9 A;  3VC8 A;  2KD1 A;  4RNN A;  7ICG A;  1SB3 C;  2KFZ A;  4USA A;  2F44 A;  3MC1 A;  2BCU A;  1HEK A;  3QUB A;  4OCZ A;  4Z6D A;  3OGU A;  4PGQ A;  1FEZ A;  2MUT A;  3H4D A;  5HMM A;  5ALL A;  3ISC A;  4KN7 A;  1KFS A;  4EYI B;  3ZI4 A;  4J03 A;  2KV2 A;  2F8K A;  1XWL A;  5HRK A;  3MGI A;  5HRE A;  1ZQI A;  1L3U A;  1MIW A;  5L1I A;  4O5K A;  1Z00 A;  4J9N A;  3NWI A;  4IS7 A;  4R8U B;  4K8V A;  2WAQ C;  2ID1 A;  4GC6 A;  2EQY A;  3TAD C;  7ICT A;  1NK0 A;  2JV3 A;  2ZUC A;  4DF8 A;  2BPG A;  4U7C A;  3HW8 A;  4RQ8 A;  5AKJ A;  4ECY A;  5KG3 A;  3CRX A;  5CFU A;  3QZ8 A;  2FMQ A;  3KBB A;  4F92 B;  4RT2 A;  1BNO A;  5D63 A;  4QZE A;  3BQ7 A;  3T5H A;  5KFA A;  4NXX A;  4NLK A;  3EF2 A;  5AI0 A;  4NKT A;  1NKC A;  4RNO A;  3AL0 B;  1Q46 A;  2BHN A;  2I1Q A;  4BX9 C;  3L9D A;  4FFD A;  3K1Z A;  1NK6 A;  2VA8 A;  4PHA A;  4X4P A;  3GII A;  4M0A A;  4X4U A;  1NJY A;  4AT9 A;  2H5X A;  3Q8M A;  2D8C A;  3C21 A;  1ZQG A;  3KZI U;  1NK8 A;  4O69 A;  4M2Y A;  5KFH A;  1C7Y A;  3PNC A;  5JUM A;  3QYP A;  3PV8 A;  1ZQH A;  3OWG A;  1IG6 A;  1N56 A;  4XQ7 A;  1JI7 A;  2EZY A;  4KLM A;  1KEJ A;  2W9C B;  4K98 A;  4ICA A;  1S10 A;  5AM3 A;  2DR9 A;  4I2G A;  1A77 A;  4RUA A;  2XY5 A;  2HOF A;  4HYK A;  1COK A;  1C20 A;  1QQ6 A;  4JV0 A;  5JTI A;  5B66 U;  3AEV A;  1NNL A;  1ED1 A;  2DWQ A;  1V4A A;  1JN3 A;  1L8L A;  4LZD A;  3S6J A;  4IR9 A;  5CEH A;  5AM2 A;  3AQN A;  5DEC A;  4Y2V A;  2W9A A;  5F9L A;  2B4V A;  4OAG A;  5B3P A;  5HRH A;  3SV3 A;  2HVH A;  5L1K A;  4ACO A;  2BQU A;  8ICU A;  5DKW A;  3WK5 A;  1BPY A;  5DQI A;  2JXJ A;  3M8S A;  4GLX A;  9ICO A;  4KN4 A;  2BR0 A;  4I0U A;  3TKA A;  9ICF A;  4C4T A;  4QWE A;  3C2M A;  1FFV A;  3C66 A;  1L7M A;  4ED1 A;  3OV7 A;  2I9G A;  1LV5 A;  3QUQ A;  2KKV A;  5KFG A;  5A0L A;  2DPI A;  5TZV A;  2KTQ A;  4Q43 A;  7ICS A;  4AT8 B;  7ICN A;  7ICH A;  3HP6 A;  7ICF A;  4TUS A;  3GIM A;  1U45 A;  1B0X A;  4BXO A;  2R18 A;  4EEY A;  5DED A;  2KZZ A;  3N7R C;  2C2R A;  2M2V A;  1QH9 A;  4J9P A;  2PFO A;  2E3T A;  2DQN B;  3SZ2 A;  1TAM A;  9ICE A;  4AP9 A;  4YCX A;  4YMN A;  1NK5 A;  2AH5 A;  2HI0 A;  2ASL A;  1D9D A;  2EAM A;  1PUZ A;  3OHA A;  3RH6 A;  4QZC A;  4Z6E A;  2ODG A;  3M9M B;  4IRD A;  2GA9 D;  2JZB A;  2P6R A;  1N48 A;  3AN1 A;  3GQC A;  1Q3U A;  2CXY A;  3E2E A;  4NXZ A;  9ICQ A;  8ICI A;  4ECQ A;  2J6U A;  2P35 A;  1NOM A;  1LVH A;  4DOA A;  3FDS A;  2IOH A;  3H0R B;  2W9B A;  1VJ7 A;  2XCA A;  2C28 A;  2ZXI A;  3GIL A;  3WFP A;  4MF8 A;  2WTF A;  1KDH A;  4KLS A;  5CP2 A;  1J2N A;  4P4M A;  3ZDA A;  2NO5 A;  1WG8 A;  2DRB A;  4I27 A;  4FH3 A;  5J0O A;  1OXJ A;  4YD2 A;  4P0Q A;  1URJ A;  2DR8 A;  1SWV A;  2JHD A;  5KFZ A;  4DS5 A;  5J2I A;  1S0O A;  3EW9 A;  3IHQ B;  3WK9 A;  3MFI A;  5J2J A;  2HOQ A;  4QJF B;  2KE7 A;  3LDA A;  4ATB A;  2MUT B;  5ALV A;  2XCP A;  3WK8 A;  2HHW A;  8ICK A;  1K1Q A;  2IHM A;  2BBH A;  4DCC A;  2VJ4 A;  3IRU A;  4KX3 A;  3C2L A;  4DS4 A;  1ZXI A;  3BQ2 A;  4Y2S A;  4WC5 A;  4WC4 A;  3D2S A;  1KBU A;  1SGG A;  7ICR A;  1Z00 B;  2KHV A;  5KFN A;  2IA6 A;  3H3A A;  4OJ5 A;  2I6X A;  4O0I A;  1VJ5 A;  2KIC A;  3ETL A;  3SAF A;  4UD4 A;  3AUO A;  4QWC A;  4F4K A;  4XUS A;  5D62 A;  3UPQ A;  2ISO A;  3RRH A;  4YFK A;  1T4G A;  5KFV A;  3QX7 A;  2GWS A;  2F1I A;  2YX8 A;  2E8N A;  4B9V A;  5TIS U;  4C7Z A;  2K4E A;  4J9R A;  3RRG A;  2BKE A;  3DEE A;  2ZIV A;  1L8O A;  2MU2 A;  2OWO A;  2AJQ A;  2HBL A;  3OVB A;  5D49 A;  4JB3 A;  4MHV A;  3EYZ A;  5AI5 A;  2CN1 A;  1UCV A;  3QXG A;  3M9O B;  4AT9 B;  8ICM A;  4X4S A;  4UBC A;  2KN7 A;  2QAR A;  4AT7 A;  2W9M A;  1MSW D;  2QB1 A;  2UVU A;  3SD7 A;  1U9L A;  4R65 A;  2WHE A;  3UMC A;  4EBC A;  4GFJ A;  5BOL A;  8ICX A;  5KFK A;  1JRP A;  2HHS A;  5HRD A;  5EWF A;  3LK9 A;  5KAI U;  2FLN A;  4M9L A;  5EWE A;  2G09 A;  4Y2X A;  4FS1 A;  4OJL A;  3SYZ A;  4KMU A;  8ICB A;  1Z3E B;  4QZ8 A;  1X9W A;  3D6J A;  1MA7 A;  5KFY A;  3I28 A;  3J81 j;  1ZRM A;  1T94 A;  3F2C A;  3HPO A;  1S0V A;  2ZH9 A;  1XSL A;  9ICB A;  9ICG A;  2VIX A;  4ED7 A;  4S3N A;  4ED0 A;  4F93 B;  4JV1 A;  1WCL A;  5KNI A;  1QTM A;  4JUZ A;  2WB1 C;  1TAU A;  1FA0 A;  4WCW A;  3MDA A;  3ERC C;  4IQU A;  5DQG A;  4NL9 A;  5KFB A;  1OUQ A;  4QW8 A;  4WOY A;  4I2B A;  1L3V A;  4OAF A;  1SZP A;  2WFA A;  3N4M B;  1KSP A;  3PR4 A;  2JR5 A;  4C4R A;  4KLQ A;  4IRC A;  4IR1 A;  5ALQ A;  4PZN A;  5ALH A;  1Q3V A;  5KFS A;  2E8P A;  1DGJ A;  9ICU A;  4LT6 A;  1NJX A;  4C4S A;  4BXO B;  2DR7 A;  1PVQ A;  3FAH A;  3TFS A;  2LPE A;  1NO5 A;  1SKR A;  4HAI A;  8ICV A;  2HHP A;  1A76 A;  5HML A;  8ICY A;  4B9M A;  1GPJ A;  5IIJ A;  1RG6 A;  7ICQ A;  2HCF A;  4IQV A;  4DQR A;  2PFP A;  1L5U A;  4UQG A;  3GV5 B;  5KT2 A;  5J2K A;  5AKI A;  4YVZ A;  3C18 A;  1MQ2 A;  3TI0 A;  2JZB B;  1RZT A;  1PZN A;  1X9M A;  3N7P D;  3AQM A;  4UB4 A;  2AXT U;  1LKY A;  4NLN A;  3QU4 A;  1TKD A;  9ICA A;  5E79 U;  4NXT A;  2W9B B;  4DL4 A;  8ICQ A;  4Y2P A;  1CUK A;  5ALU A;  1KW4 A;  5K4L A;  2YB4 A;  4E80 A;  4P2H A;  2BQR A;  1HJP A;  1ARO P;  2UVR A;  5DDM A;  4RWN A;  2H3F A;  4F91 B;  3SI8 A;  4DFK A;  3SQI A;  2DRA A;  4ED2 A;  1DK3 A;  3HRD D;  3AQK A;  4F71 A;  2FI1 A;  4EX7 A;  2ATL A;  8ICN A;  5ALK A;  4P0Q B;  4M47 A;  4O3R A;  1RPL A;  1ZQO A;  2IHN A;  5DGB A;  5DB6 A;  2KJ8 A;  2PMZ C;  3PR5 B;  2A3V A;  4YXM A;  3KHG A;  2NRV A;  2UVV A;  5HR6 A;  7ICL A;  4DSL A;  2HHV A;  4PL1 A;  3WFS C;  4ATB B;  3K4G A;  3Q8P B;  2KKP A;  1X6I A;  1ZQB A;  2ISP A;  1R8C A;  5KFR A;  4O68 A;  5DGA A;  3EPI A;  2EAO A;  5DG9 A;  5J8Y C;  3H8S A;  5CB1 A;  4RWO A;  5KFJ A;  3ER9 B;  1KKX A;  2Q66 A;  4UB5 A;  3QEA Z;  4YN4 A;  1XSP A;  4O3S A;  3FYH A;  1P7D A;  4FZN A;  3V6H A;  1NK9 A;  3RR7 A;  5EWG A;  3JPR A;  4UAV A;  2RHF A;  1DRG A;  1R89 A;  4MFA A;  4C7Y A;  4WQL A;  1IXR A;  1ZOL A;  2V4Q A;  1UET A;  1RYU A;  3E58 A;  1JIH A;  4NV0 A;  4UB2 A;  4M9G A;  4EGW A;  5KG0 A;  4RPY A;  4NJ8 A;  2F76 X;  2IUB A;  3PST A;  5EE1 A;  4K9B A;  5J0W A;  2YQE A;  3AU6 A;  5D61 A;  5ALN A;  2BBJ A;  5ALX A;  2WF5 A;  5J2C A;  2WAQ F;  2ZIV B;  2K89 A;  4KTQ A;  2PBE A;  4MKP A;  2MAX A;  4B9S A;  2DGZ A;  3H7I A;  4EBD A;  4DF4 A;  5ALT A;  2RLT A;  2DKZ A;  2MRL A;  3NAS A;  4UAU A;  5DBC A;  5ALF A;  2LHT A;  2B0C A;  2HMX A;  3MR6 A;  2NRT A;  2QAR B;  3MBY A;  2Y1J A;  5CHE A;  4I2D A;  4OAH A;  4YR2 A;  3C28 A;  4K4G A;  4AT7 B;  2HN1 A;  1ZQZ A;  1UA1 A;  4QNL A;  2KJ5 A;  5AKL A;  2LYH A;  3FC4 A;  1VDV A;  1U47 A;  2ZHB A;  4PHE A;  3V6J A;  4K97 A;  1RQN A;  4KIT B;  4GC7 A;  2EZZ A;  2BZF A;  2R8H A;  4GXJ A;  2K4I A;  1NJZ A;  2AGP A;  5J0Y A;  2M0N A;  3IN5 A;  2HW3 A;  5KFD A;  2HN2 A;  4M9N A;  1WYG A;  4C8N A;  5IIK A;  1TAQ A;  3SR6 A;  4WJ3 B;  4FO1 A;  2DL0 A;  4YXJ A;  8ICC A;  1S8O A;  3SEN A;  4X5V A;  1ZQY A;  4Q45 A;  1N60 A;  2YML A;  4KMO B;  4I2F A;  5DG8 A;  4QZD A;  2D6F C;  1R8A A;  4ECR A;  3TAC B;  3JPO A;  4DL6 A;  1SL2 A;  5KFW A;  8ICW A;  4XQ8 A;  3LQC B;  1OU5 A;  1ZQV A;  3RBE A;  5KG7 A;  7ICU A;  1JUD A;  4K4I A;  2VKQ A;  3AQE A;  4OJ6 A;  4BJQ A;  5CRX A;  4O3N A;  3I76 A;  2HOI A;  5DDY A;  2F8L A;  2EAP A;  1PK3 A;  1RM6 C;  2FPL A;  4EYH B;  4KLG A;  1B43 A;  3BQ0 A;  1LB2 B;  4UAT A;  4EP7 A;  4RQN A;  3BJY A;  1TK8 A;  2B51 A;  2ZIW A;  1J97 A;  3WKC A;  5DB9 A;  3OUY A;  2PXI A;  2PI4 A;  1SV0 A;  4BWM A;  5DBA A;  3NVV A;  3RR8 A;  2KZM A;  5HR7 A;  2UVW A;  3AQL A;  3V7L A;  3KFU F;  2HSZ A;  2G5I B;  2J6S A;  4G3I A;  3NRW A;  1JMS A;  4OJO A;  4B6J A;  3KHH A;  4KLL A;  3JPT A;  1LKY B;  3A0B U; 
#chains in the Genus database with same CATH homology
 3NGD A;  3LDA A;  3UQ2 A;  1QSY A;  2A1J A;  3GDX A;  3C23 A;  4J9M A;  4O9M A;  1V9P A;  1ZQP A;  7ICO A;  4ATB A;  2MUT B;  1T3N A;  4UAZ A;  4F8R A;  3EZ5 A;  2XCP A;  3KHR A;  3PW7 A;  5J0R A;  1ZJM A;  4EZ6 A;  3WFQ E;  2W8K A;  1KFD A;  3Q8S B;  7ICP A;  4Z6F A;  3H4B A;  4O3O A;  4TUR A;  5KFL A;  1K1Q A;  1JX4 A;  4DSK A;  2IHM A;  2HHW A;  8ICK A;  3RB3 A;  3NTU A;  1SKW A;  4TUP A;  1SL0 A;  3QZ7 A;  4DS4 A;  4I2I A;  4MEY A;  4UB1 A;  2V4R A;  3C2L A;  4KLJ A;  3RJG A;  9ICG A;  3HX0 A;  4EBK A;  3OVA A;  2R8I A;  3OJS A;  3EPG A;  3BQ2 A;  4KLH A;  4WC5 A;  4WC4 A;  4KLI A;  3NYB A;  1ZQS A;  7ICR A;  3OSP A;  4YMM A;  2ZH3 A;  1Z00 B;  5BPC A;  1U49 A;  5KFN A;  3ISB A;  4F4X A;  3QEB Z;  8ICE A;  1ZQU A;  7ICV A;  2IA6 A;  3H3A A;  5KG4 A;  9ICT A;  5J0Q A;  2PFN A;  3BDP A;  3PW2 A;  1YLQ A;  4RUC A;  5KT6 A;  4O0I A;  2FMP A;  3ETL A;  4UD4 A;  3AUO A;  3ZDB A;  4Q8F A;  9ICJ A;  1UT8 A;  4QWC A;  4F4K A;  2ALZ A;  4XUS A;  1H38 A;  4O3P A;  9ICH A;  2FPM A;  3QE9 Y;  3UPQ A;  3V7K A;  2ISO A;  5EOZ A;  5KFP A;  3Q8R B;  3RRH A;  4YFK A;  1T4G A;  5KFV A;  5HRI A;  1D8L A;  2ZTE A;  2GWS A;  2NRZ A;  2F1I A;  1B22 A;  1ZQX A;  3HJ1 A;  4C8O A;  4FBT A;  2RDI A;  1BNP A;  1TFY A;  4B9V A;  4R64 A;  5CR0 A;  4J9R A;  4M6W B;  4F5N A;  3PW5 A;  3RJE A;  9ICL A;  4RWQ A;  1BVS A;  1NKB A;  2W9C A;  2BKE A;  2FPK A;  3G6V A;  1D8Y A;  3UQ0 A;  4ECZ A;  2JEG A;  3PO4 A;  5KG2 A;  1UT5 A;  4RQ6 A;  5CJ7 A;  4YR0 A;  4X4Q A;  3OVS A;  4PHD A;  2OWO A;  1S97 A;  4PPX A;  1JXE A;  5KT3 A;  2AJQ A;  3H38 A;  1JAJ A;  4QWB A;  2ZHA A;  4YG2 A;  9ICC A;  3OVB A;  4R63 A;  5D49 A;  1BPX A;  5J2G A;  4DL2 A;  1NK7 A;  1ZQN A;  3EYZ A;  1ZQK A;  4BDP A;  3C2K A;  4J9K A;  4DFM A;  1R8B A;  4DSF A;  4Q44 A;  4RZR A;  3GV8 B;  4AT9 B;  3M9O B;  8ICM A;  3MR3 A;  1R8C A;  4MF2 A;  4X4S A;  4UBC A;  4F2R A;  2XY7 A;  1ZET A;  2KN7 A;  4WC0 A;  3RJF A;  4I28 A;  4Q8E A;  3ZDE A;  5HNK A;  2P6R A;  8ICL A;  2R8K A;  4AT7 A;  2J6T A;  4F4Z A;  2W9M A;  9ICI A;  2AQ0 A;  1ZQE A;  4DEZ A;  5J0T A;  2UVU A;  1MSW D;  4JK1 A;  1DGS A;  3RBD A;  1MIV A;  3TAQ A;  1U9L A;  4R65 A;  4NM2 A;  4QWA A;  4EBC A;  8ICX A;  5BOL A;  2HHT A;  1JQR A;  1K1S A;  4F5P A;  2BQ3 A;  3TAP A;  2JEJ A;  3ZDC A;  5KFK A;  1UA0 A;  4FHV A;  4YP3 A;  2HHS A;  4ECW A;  4PHP A;  1ZQR A;  2BCS A;  1Q79 A;  5HRD A;  5EWF A;  1ZQA A;  5C5J A;  3LK9 A;  2FLN A;  4DQI A;  1RXW A;  5F9N A;  4DL7 A;  3PY8 A;  5CWR A;  4M9L A;  2RDJ A;  5EWE A;  9ICV A;  4QWD A;  4ECT A;  4CCH A;  2Y1I A;  2Q0Z X;  3OJU A;  4FS1 A;  4KLE A;  2BE3 A;  3SYZ A;  2XO7 A;  3GIJ A;  3RB0 A;  3RRG A;  3HT3 A;  1Q78 A;  4E7X A;  4WC6 A;  2BCR A;  1MIY A;  4YMO A;  2ZH1 A;  4KMU A;  8ICB A;  2O1P A;  1Z3E B;  4QZ8 A;  1X9W A;  2M2U A;  5DG7 A;  2O5A A;  5KFY A;  3LWL A;  4AT8 A;  5D46 A;  2ZH8 A;  4X4V A;  4MEX A;  3HPO A;  1S0V A;  4FH5 A;  1XC9 A;  5KFX A;  4P4P A;  2ZH9 A;  1XO1 A;  1XSL A;  2P66 A;  2V9W A;  3ORY A;  5DLG A;  3PW0 A;  3Q8L A;  8ICS A;  3H39 A;  9ICB A;  3G6Y A;  2XY6 A;  4FHW A;  1UEV A;  4FS2 A;  4KLF A;  4ED3 A;  1TVA A;  3KTQ A;  4NY8 A;  4DOC A;  4ED7 A;  3B0Y A;  4RQ4 A;  3BQ1 A;  3T3F A;  1ZQT A;  4O5C A;  4S3N A;  4ED0 A;  2BPF A;  3T5K A;  4F93 B;  1MQ3 A;  2IMW P;  4JV1 A;  3TQ1 A;  4J9O A;  1WCL A;  3RJK A;  5F2V O;  3ISD A;  1HUO A;  4KLU A;  4J9L A;  1QTM A;  1DK2 A;  2NRW A;  1BPZ A;  4JUZ A;  3MR5 A;  1TAU A;  1FA0 A;  3MDC A;  1KLN A;  4WCW A;  1ZQW A;  4IG8 A;  4TUQ A;  3MDA A;  3GV7 B;  2ASD A;  5L1J A;  4IQU A;  5DQG A;  2PFQ A;  5J0X A;  4JWM A;  4NLG A;  1MC8 A;  3HIY A;  4WC1 A;  1S0M A;  5KFB A;  9ICP A;  4DO9 A;  2R8J A;  1D9F A;  8ICO A;  4QW8 A;  4I2B A;  2FMS A;  1L3V A;  1NKE A;  1SZP A;  3N4M B;  3ZDD A;  4YD1 A;  4F5Q A;  1KSP A;  1COO A;  3PR4 A;  8ICJ A;  4C8L A;  3WFS C;  3RH4 A;  4KLQ A;  3C5F A;  2M2W A;  4IRC A;  4O5E A;  4MFF A;  4IR1 A;  1U48 A;  3RTV A;  4DSE A;  5KFS A;  4WC2 A;  1KRP A;  9ICU A;  4LT6 A;  1NJX A;  2FLP A;  4BXO B;  9ICK A;  2DR7 A;  1ZJN A;  4F4Y A;  1S0N A;  3H37 A;  5DB7 A;  2DR5 A;  5HRF A;  3TFS A;  1WCN A;  3H8W A;  5J2H A;  1TV9 A;  4B9N A;  1NO5 A;  4I2C A;  4TQS A;  1SKR A;  4RQ3 A;  1L3S A;  2W8L A;  8ICV A;  2HHP A;  3RH5 A;  5KFU A;  4DOB A;  4F3O A;  4X4R A;  1A76 A;  5J0S A;  4J9Q A;  2KZ3 A;  5HML A;  3PMN A;  3OSN A;  1XS9 D;  4YR3 A;  2HHQ A;  8ICY A;  3UXO A;  2ASJ A;  4B9M A;  5IIJ A;  5HHH A;  2AQ4 A;  1NK4 A;  7ICJ A;  5KFF A;  4UD5 A;  5III A;  3PX4 A;  7ICQ A;  5KG5 A;  4I2E A;  5HRB A;  4IQV A;  4DQR A;  3RJI A;  1L5U A;  2PFP A;  1QLN A;  2ZH2 A;  4UQG A;  4LVS A;  2ZUB A;  5KTQ A;  1RYR A;  3GV5 B;  4RNN A;  7ICG A;  5KT2 A;  5J2K A;  4GXI A;  5J2A A;  5KG1 A;  3MR2 A;  4YVZ A;  2KFZ A;  3C18 A;  1MQ2 A;  3TI0 A;  2NRX A;  2JZB B;  5J2B A;  1RZT A;  4NM1 A;  4ZH4 A;  4M5D A;  1PZN A;  5J0U A;  1X9M A;  3AQM A;  2HHU A;  5HRG A;  4UB4 A;  2BCU A;  4Z6D A;  3OGU A;  4PGQ A;  4NLN A;  1TKD A;  1SKS A;  4QZA A;  1S9F A;  4C8M A;  9ICA A;  2MUT A;  2W9B B;  3H4D A;  4RNM A;  4DL4 A;  1ZQF A;  3THV A;  8ICQ A;  1CUK A;  5HMM A;  3ISC A;  2AGO A;  4KN7 A;  1KFS A;  3PVX A;  4EYI B;  5DLF A;  4E80 A;  5IIO A;  1TK0 A;  4KLD A;  3RAX A;  2BQR A;  4P2H A;  3RJJ A;  3V72 A;  1XWL A;  4DFJ A;  1HJP A;  3UPS A;  1ARO P;  5HRK A;  2UVR A;  5DDM A;  4RWN A;  3SI8 A;  4F91 B;  3MGI A;  4KLT A;  4X4O A;  5HRE A;  1ZQI A;  4DFK A;  3OUY B;  2DRA A;  4ED2 A;  1L3T A;  1L3U A;  1DK3 A;  1MIW A;  8ICA A;  3AQK A;  3C5G A;  1ZYQ A;  1T7P A;  2ZH5 A;  4LZG A;  5L1I A;  3ZD8 A;  2ATL A;  4MFC A;  4O5K A;  8ICN A;  1Z00 A;  4WBY A;  4J9N A;  3N97 B;  4M47 A;  4O3R A;  1RPL A;  4R8U B;  1ZQO A;  2C2E A;  3EWA A;  1ZQM A;  1BPE A;  2IHN A;  5DGB A;  2ID1 A;  5DB6 A;  3PR5 B;  4EZ9 A;  4GC6 A;  2BDP A;  1DOQ A;  4YXM A;  1BGX T;  3KHG A;  2NRV A;  5KFO A;  4K4H A;  2UVV A;  7ICT A;  1NK0 A;  2ZUC A;  7ICL A;  4DF8 A;  3UXN A;  4ECX A;  2ZJA A;  4F4W A;  2BPG A;  2BCV A;  4DSL A;  2HHV A;  3HW8 A;  4RQ8 A;  3GIK A;  2A1J B;  5D4B A;  4F5R A;  4ECY A;  4E0D A;  5IIM A;  1ZQQ A;  2BCQ A;  4ATB B;  5KG3 A;  3PW4 A;  3K4G A;  3QZ8 A;  3Q8P B;  3V6K A;  3TAN A;  1NJW A;  2JEF A;  2FMQ A;  1ZQB A;  3H8J A;  2ISP A;  4YQW A;  8ICR A;  5KFR A;  4F92 B;  4RT2 A;  4RPX A;  5DGA A;  3RJH A;  7ICM A;  1BNO A;  3EPI A;  4WC7 A;  4QZE A;  5DG9 A;  1QSS A;  4NKU A;  3H8S A;  4M6W A;  5CB1 A;  5IIN A;  4DQQ A;  3T5H A;  5KFJ A;  9ICS A;  3JZ0 A;  9ICN A;  5KFA A;  4RWO A;  1VFG A;  3JPS A;  4DSJ A;  4X4N A;  1XU4 A;  2Q66 A;  4UB5 A;  4EBE A;  2JEI A;  3QEA Z;  4YN4 A;  1XSP A;  4O3S A;  3FYH A;  4NLK A;  4EBJ A;  4X0A A;  5L9X A;  1WOT A;  2P6U A;  8ICH A;  1NKC A;  4RNO A;  4NKT A;  3V6H A;  1ZQL A;  2BHN A;  1ZQC A;  2I1Q A;  8ICT A;  1NK9 A;  3RR7 A;  3L9D A;  5EWG A;  4I2H A;  1BPD A;  1NK6 A;  1F5A A;  2VA8 A;  5KFE A;  4PHA A;  4X4P A;  2XGP A;  3JPR A;  3GII A;  4M0A A;  1R89 A;  4X4U A;  1NJY A;  4AT9 A;  4RU9 A;  4QZF A;  3MGH A;  3T5L A;  4E8F A;  2H5X A;  3Q8M A;  4MFA A;  4FHX A;  3C21 A;  1ZQG A;  3M9N B;  4FBU A;  4JV2 A;  3GFK B;  1IM4 A;  1IXR A;  7ICI A;  1NK8 A;  2V4Q A;  1UET A;  4BWJ A;  4I29 A;  4Z6C A;  4RT3 A;  4M2Y A;  8ICP A;  1JIH A;  5KFH A;  4UB2 A;  2IBK A;  1C7Y A;  4M9G A;  4X0B A;  5KG0 A;  4RPY A;  3PNC A;  3TAR A;  5JUM A;  4ELT A;  4F2S A;  3PV8 A;  1ZQH A;  2ZTC A;  4XQ7 A;  5J0W A;  3AU6 A;  1N56 A;  4DQP A;  3MFH A;  4KLM A;  5J2D A;  3OHB A;  4R66 A;  1KEJ A;  2KFN A;  9ICX A;  2XGQ A;  5J2C A;  2W9C B;  3KHL A;  2ZJ8 A;  4DFP A;  1U4B A;  5HRL A;  2AU0 A;  1S10 A;  2DR9 A;  1UEU A;  4I2G A;  1A77 A;  3ZD9 A;  4RUA A;  2XY5 A;  4KTQ A;  4HYK A;  2PBE A;  2MAX A;  4QZB A;  4JV0 A;  3AU2 A;  3SV4 A;  4PGY A;  4B9S A;  3H7I A;  4ECS A;  4EBD A;  4DLG A;  4PGX A;  1EXN A;  4DF4 A;  1V4A A;  4JWN A;  1TFW A;  1JN3 A;  2ZJ5 A;  5KFC A;  2ZH7 A;  4LZD A;  5HP4 A;  4QZH A;  2PI5 A;  4IR9 A;  5DBC A;  3AQN A;  2ZH6 A;  4M9H A;  5DEC A;  3LWM A;  1Y88 A;  5F9L A;  2W9A A;  4KLO A;  4QW9 A;  4RWP A;  1NZP A;  5HRH A;  3MR6 A;  2NRT A;  3SV3 A;  2HVH A;  3JPQ A;  3MBY A;  4C8K A;  2Y1J A;  5L1K A;  4I2D A;  4YR2 A;  4GXK A;  4K4G A;  4AT7 B;  4QZG A;  1ZQZ A;  2M2T A;  5KT7 A;  4J9S A;  4BGD A;  4UBB A;  5DKW A;  2BQU A;  1UA1 A;  1ZQJ A;  2VA3 A;  8ICU A;  1BPY A;  2LYH A;  1S77 D;  5DQI A;  4RQ1 A;  1U47 A;  1T8E A;  5KFQ A;  1BPB A;  5KT4 A;  4PHE A;  3M8S A;  4F50 A;  4GLX A;  3V6J A;  9ICR A;  2ZHB A;  4UAW A;  4IQW A;  3Q8K A;  4KIT B;  4QZI A;  5L1L A;  2HVI A;  9ICO A;  4KN4 A;  2BR0 A;  4UAY A;  4GC7 A;  2ZTD A;  2BGW A;  2R8H A;  1XSN A;  4GXJ A;  2VA2 A;  3IM1 A;  9ICF A;  7ICK A;  1NJZ A;  3C2M A;  4QWE A;  4M04 A;  3WFR E;  2BPC A;  3B0X A;  4FHP A;  3C66 A;  2AGP A;  5J0Y A;  4ED1 A;  3OV7 A;  4ELU A;  4ED8 A;  2I9G A;  2VAN A;  4XRH A;  1LV5 A;  4ED6 A;  5DQH A;  2KP7 A;  4RQ2 A;  3BQT A;  3G6X A;  5KFD A;  2HW3 A;  2ZH4 A;  5KFG A;  5HHI A;  2DPI A;  5TZV A;  4IRK A;  2KTQ A;  5CHG A;  4Q43 A;  4M9J A;  7ICS A;  1S76 D;  4FHY A;  4AT8 B;  1RYS A;  2FLL A;  7ICN A;  7ICH A;  3HP6 A;  7ICF A;  4M9N A;  4TUS A;  3GIM A;  4ECU A;  1U45 A;  4PH5 A;  4C8N A;  5IIK A;  1TAQ A;  4DQS A;  3PO5 A;  4BXO A;  4DSI A;  4EEY A;  5DED A;  2KZZ A;  5KFI A;  4YXJ A;  2R8G A;  5IIL A;  8ICC A;  3MAB A;  4X5V A;  1ZQY A;  4Q45 A;  3T5J A;  2C2R A;  2M2V A;  5KT5 A;  4J9P A;  2PFO A;  4X4T A;  4I2F A;  2M9N A;  5DG8 A;  1KNY A;  3SZ2 A;  1CEZ A;  3JPP A;  4QZD A;  4I2A A;  9ICE A;  4YCX A;  1R8A A;  4ECR A;  3JYY A;  4QZ9 A;  9ICW A;  4O3Q A;  4YMN A;  3Q8Q B;  1NK5 A;  2ASL A;  3UXP A;  3PML A;  1ZQD A;  3JPO A;  1D9D A;  3OHA A;  2AGQ A;  4DL6 A;  1SL2 A;  5KFW A;  3C1Y A;  8ICF A;  3RH6 A;  8ICZ A;  4QZC A;  4DL5 A;  4XQ8 A;  8ICW A;  3WFO A;  1RXV A;  4Z6E A;  3M8R A;  1X9S A;  4RQ0 A;  1TK5 A;  3M9M B;  4DWI A;  4IRD A;  3LQC B;  1OU5 A;  5HC9 A;  1ZQV A;  3TFR A;  5KG7 A;  3RBE A;  2C2D A;  4B9U A;  4ELV A;  7ICU A;  2F1H A;  4K4I A;  8ICG A;  5J29 A;  4O3N A;  1TFR A;  2JZB A;  4XA5 A;  5J2F A;  1HUZ A;  4IQT A;  5KFM A;  5CA7 A;  3GQC A;  5DDY A;  2C22 A;  1N48 A;  2HHX A;  3E2E A;  4NXZ A;  9ICQ A;  8ICI A;  4ECQ A;  2J6U A;  5HR9 A;  1NOM A;  4RPZ A;  2NRK A;  2ZUD A;  3FDS A;  1X2I A;  4DOA A;  1KFT A;  2FPL A;  7ICE A;  4RQ7 A;  4EYH B;  4KLG A;  2W9B A;  1B43 A;  2DPJ A;  4NLZ A;  1VJ7 A;  5J2E A;  2DFL A;  2XCA A;  2C28 A;  3WFP A;  3GIL A;  3BQ0 A;  4MF8 A;  2WTF A;  3C1Z A;  3PX0 A;  1LB2 B;  4EP7 A;  3BJY A;  1KTQ A;  1TK8 A;  4UB3 A;  1KDH A;  1JXL A;  2F1J A;  1SL1 A;  2B21 A;  5CP2 A;  4KLS A;  3RB4 A;  4B9T A;  3RAQ A;  4P4M A;  5KFT A;  4I2J A;  3ZDA A;  3H40 A;  5DB9 A;  3OUY A;  3K75 D;  3JPN A;  2PXI A;  2PI4 A;  1PX5 A;  2DRB A;  4I27 A;  4FH3 A;  4F5O A;  4BWM A;  5DB8 A;  5DBA A;  5J0O A;  4WC3 A;  5BOM A;  4FO6 A;  5J0P A;  3RR8 A;  3PX6 A;  4YD2 A;  9ICM A;  4DLE A;  4B9L A;  2KZM A;  3AQL A;  2UVW A;  3V7L A;  4WBZ A;  2DR8 A;  5KG6 A;  4RQ5 A;  2RFF A;  5DBB A;  4R8U A;  4P4O A;  3HWT A;  4DL3 A;  4TQR A;  3V7J A;  2XC9 A;  3RB6 A;  2J6S A;  4G3I A;  5KFZ A;  1JMS A;  5J2I A;  4DS5 A;  1QSL A;  1S0O A;  3EW9 A;  3IHQ B;  3KHH A;  3MFI A;  4KLL A;  3JPT A;  2DVI A;  5J2J A;  3HJ4 A;  4ECV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...