4NY8A

Dna polymerase beta with o6mg in the template base opposite to incoming non-hydrolyzable ctp with manganese in the active site
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
323
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 108
structure length 323
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ny8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ny8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ny8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ny8A03
4RQ1A 2ZH5A 8ICZA 1SL2A 2BKEA 2BCSA 3FYHA 4DEZA 4MFCA 3ZD8A 5KG2A 2XY5A 3RTVA 1XWLA 3SV3A 2HW3A 2NRWA 1TAQA 4ECTA 1LB2B 5HC9A 4IR9A 2UVVA 4O0IA 1ZQUA 5KFGA 2ID1A 1JXEA 3SYZA 3RJKA 1ZQMA 2DR5A 4ED2A 4C8MA 2JEJA 3H7IA 2KTQA 4EBJA 5DG9A 5IIMA 1UT5A 2W9BA 3PO5A 3KTQA 9ICPA 3RAXA 1B43A 2AU0A 1ZQTA 8ICXA 3WFPA 3M9NB 2KFNA 9ICRA 5KFYA 3HWTA 4I27A 3ZDEA 3TFSA 1TKDA 5J0UA 1D8YA 4MF8A 4FHXA 4JV1A 4X0AA 1D9FA 3PW4A 4DL6A 4M9JA 1NOMA 4QWBA 2PFNA 4I2GA 4KLHA 5HRGA 2B21A 3HIYA 3EZ5A 4KLIA 9ICBA 4B9LA 4TURA 3TQ1A 1ZQLA 2P6UA 4RQ5A 2W9CB 3HPOA 3TAQA 3B0XA 4ELTA 1UA1A 5HRBA 5KG3A 2PBEA 4JK1A 4YP3A 8ICJA 4KN4A 3GV7B 1UETA 4RQ3A 1R89A 5KFLA 2FPLA 4I2DA 2FPKA 3PR5B 3AQNA 4IRCA 1IXRA 4IRKA 5CP2A 3K75D 8ICWA 4PGYA 1DOQA 5DB9A 4YQWA 3MGIA 3V6KA 4TUSA 1R8BA 8ICIA 3UQ0A 2ATLA 1XS9D 1QSLA 4J9RA 4DQPA 3SI8A 1BPXA 3RB0A 2KZ3A 4G3IA 4RUAA 3GIIA 3C5FA 4YN4A 1KRPA 4RQ8A 4F2SA 5DG7A 2BPCA 4X4NA 7ICIA 3RB4A 4YMNA 4YG2A 3LWMA 1NJWA 3PR4A 4NLZA 4IQTA 4TQRA 1CEZA 1XU4A 3UXNA 1HUZA 4M9LA 5DLGA 4BXOA 1ZQPA 4F5PA 5KFIA 4RQ7A 4RQ0A 7ICJA 1NKCA 1BPYA 1BPBA 4XRHA 2ASLA 1TFRA 5J2IA 4KTQA 1MC8A 7ICMA 1L3TA 1JX4A 3KHGA 4DQRA 1T3NA 8ICSA 9ICVA 5KT3A 4PGXA 3G6YA 5KFCA 2AQ0A 1WCNA 4ECXA 4DSEA 5HP4A 4DOAA 3PVXA 3MABA 3MFIA 4F5QA 1U47A 2ZH8A 4P4MA 1JIHA 8ICLA 5BOLA 5IILA 5DGAA 2AQ4A 1Z00A 2R8IA 4Q8EA 5KT6A 2XC9A 3ZDAA 4YXMA 5KG4A 3OJUA 3RRGA 4ED6A 3QEBZ 2RDIA 4DWIA 2ZH3A 5D46A 5KG0A 4R65A 4R64A 4DOBA 3V6JA 4X4SA 4YMOA 2DR8A 4DL3A 3FDSA 1IM4A 3MR2A 4BGDA 5D4BA 4KLFA 4DL2A 5J2CA 2O5AA 5BPCA 4KLEA 1ZQSA 1XC9A 4AT7B 3EPGA 2DPIA 4WBZA 2KFZA 4ECRA 2VANA 1A77A 5DDMA 3LQCB 3GDXA 3N4MB 2IHNA 4M47A 1SKWA 8ICEA 2ISPA 3WFOA 1TAUA 9ICGA 5HR9A 2ZUBA 9ICAA 1Z00B 1ZQXA 5HNKA 4RNOA 1VFGA 1SZPA 4X4RA 4MEYA 4PHAA 2BR0A 1T8EA 3JPTA 2VA3A 4KLQA 4KLSA 4KLTA 1COOA 7ICSA 8ICBA 2BQUA 4WC7A 4F4ZA 4X4TA 3GILA 3HT3A 3SZ2A 9ICQA 3H8JA 1ZQJA 7ICNA 1S76D 2ZH6A 3GQCA 5EOZA 4F4KA 3PW0A 1NK7A 1NK0A 5J2HA 4ECYA 1XSNA 4RQ2A 1QSYA 4M9GA 3BDPA 2HHVA 2KN7A 9ICLA 1QLNA 3RB3A 4O3OA 1X9SA 2XGQA 4C8NA 4I2HA 4RWNA 4B9SA 2NRVA 4J9LA 2AGOA 4RQ4A 4XA5A 4QZGA 4FO6A 5KFMA 1ZQRA 3G6XA 4DSKA 5HHHA 4O3SA 2KZZA 4X4PA 8ICPA 4FBUA 7ICLA 2XY6A 2DR7A 4KLOA 2Y1JA 1ZQAA 2FMPA 4UB5A 3ORYA 3ISCA 5KFXA 5DEDA 1X2IA 4Z6CA 5J2FA 1ZQNA 1L3UA 2ZUDA 3MR3A 2JEGA 1KEJA 3Q8LA 9ICNA 4DL5A 4RWOA 4I2IA 4J9MA 4F5RA 3NGDA 5BOMA 4YMMA 3H39A 4R8UB 1U49A 1BPDA 4RPZA 1U4BA 9ICJA 4GLXA 2IMWP 5EWGA 3ZD9A 4FBTA 4X4UA 1XSLA 2ZH7A 1DGSA 4Z6FA 8ICVA 1U45A 3TI0A 1R8CA 2H5XA 3L9DA 4B9NA 4MF2A 4KLJA 4GC6A 2IA6A 4F3OA 4QZAA 3RJHA 5DQGA 2Q66A 4BWJA 4QZ8A 4M2YA 1S0VA 3M8RA 3HW8A 3ZDCA 1TFWA 3KHRA 4RUCA 1MIYA 2J6TA 5KT4A 1ZQKA 4Z6EA 9ICUA 4J9SA 3LK9A 1TVAA 4I2EA 4X0BA 5KFEA 9ICKA 5KG6A 1NJYA 1JN3A 2RDJA 4Q45A 3TFRA 4FHVA 4IR1A 4Z6DA 3ZDDA 4O9MA 1R8AA 5DBCA 3Q8PB 1K1SA 5IIIA 4UAYA 4CCHA 3BQTA 5IIJA 2ALZA 5JUMA 1JXLA 2HHWA 2ZH4A 4C8LA 4WC3A 4YR0A 4P4PA 3RJFA 4FH3A 5J0SA 3H38A 2MAXA 5J2KA 1ZYQA 2KZMA 4UBCA 4LZGA 3H3AA 4LT6A 2HVHA 3H37A 3G6VA 4EBDA 2BPFA 8ICTA 2M2TA 3T5LA 3AU2A 5L9XA 5KFDA 2JZBB 1TK0A 2BCQA 3BQ0A 3QZ7A 3GIJA 4M9HA 1BVSA 5HRKA 5HREA 2ZJ8A 2HHSA 3MDAA 2BHNA 1K1QA 1ZQBA 4ECUA 1B22A 4YR2A 4RNMA 2F1IA 5J2AA 4PHEA 5J0OA 2W9BB 2BDPA 2AJQA 3IM1A 4YD2A 9ICXA 3GFKB 5KFZA 4O3QA 5J2DA 2V4QA 4GXJA 2FLPA 3RRHA 4I28A 4Q8FA 4M04A 8ICAA 4WC4A 4TQSA 4S3NA 4XQ7A 1U9LA 4QZFA 4TUPA 1HUOA 3ETLA 5F9LA 4Q44A 4DO9A 1MQ2A 2FLNA 2A1JA 2ZTDA 3MR5A 4FHPA 4HYKA 3HJ1A 4WC6A 1NK4A 4F50A 4R8UA 3OVSA 3BQ1A 3OV7A 3PMLA 3T5KA 9ICTA 5KFVA 1F5AA 2LYHA 2ZTEA 3AUOA 2BCUA 5HRFA 4RPXA 4YVZA 5KFKA 3TAPA 4GC7A 1BPZA 1ZQQA 1NKEA 1ZQGA 3C21A 1VJ7A 4EBKA 5J29A 4NKUA 4J9NA 4PH5A 3UXOA 1KFDA 4DL4A 4J9KA 1UA0A 4KLGA 2ASDA 4R63A 2ZJAA 5F9NA 4KN7A 4E8FA 2ZH2A 3OGUA 4DSJA 5KFAA 4IQUA 4PHPA 9ICHA 5HRHA 3JYYA 4B9UA 5J0XA 2WTFA 4F4WA 3QE9Y 4RWPA 4XQ8A 3UPQA 1SKRA 3B0YA 4ECZA 2ZTCA 4UBBA 1RPLA 3RJJA 4E0DA 3C5GA 1NK6A 1WOTA 5CJ7A 1X9WA 3K4GA 2O1PA 4EYIB 1MIWA 7ICVA 8ICQA 4UB3A 4RQ6A 3OJSA 2MUTA 3MDCA 4ED1A 1S10A 2BE3A 2ASJA 4KITB 3HJ4A 1DK3A 4NM2A 2W9MA 4IRDA 2FLLA 4AT8A 3GIKA 4ED8A 1XSPA 4IQVA 1NO5A 2R8HA 4ED0A 4X4OA 4UAWA 4BWMA 5KFTA 2NRZA 3H8SA 4GXKA 7ICRA 1EXNA 2F1JA 2ZH1A 1YLQA 2C2EA 4O5KA 2ZUCA 4X5VA 3ISBA 1ZJMA 7ICHA 3KHLA 2XY7A 5IIOA 4ATBB 5KFWA 2UVUA 3OSNA 3JZ0A 4ATBA 4QWAA 2OWOA 2HVIA 3MGHA 2HHPA 3AQLA 1XO1A 2C28A 1T7PA 3PY8A 4K4HA 1V4AA 3WFSC 5J0PA 1TFYA 5J0RA 4DQSA 1CUKA 1JMSA 4KLLA 2HHUA 3OUYA 2A1JB 1UEVA 4AT8B 2FMSA 4NKTA 4Q43A 2PFPA 2PFQA 4DFMA 3RH4A 5DLFA 4DQIA 2M9NA 2ZHBA 1BPEA 1KTQA 1KLNA 2C22A 2BGWA 3V7LA 2C2RA 3OHBA 3BJYA 3PW2A 4RZRA 3RR8A 4ELUA 3RAQA 1KDHA 5L1JA 4NY8A 1C7YA 2ZJ5A 4QW8A 5CA7A 4M5DA 5KFSA 2FPMA 5KFRA 4RU9A 2P6RA 3OSPA 4RPYA 4KMUA 4O3PA 3JPPA 2JEFA 4P2HA 3C2LA 1D9DA 1TV9A 1PX5A 1ZQDA 2NRKA 2DPJA 1UT8A 5J2EA 4F4XA 4EZ9A 4EP7A 4DF4A 1BGXT 1V9PA 2DR9A 3C1ZA 1U48A 1RZTA 5DBAA 2M2WA 5CHGA 5CWRA 2UVRA 2W8LA 4EBCA 3N97B 8ICUA 3TANA 4K4GA 1BNPA 4DS4A 1L3VA 4DSFA 7ICGA 3RBDA 8ICCA 3JPOA 4F8RA 3RJEA 1ZETA 4JV2A 4YD1A 4E80A 5KFBA 4KLDA 2HHTA 5DB6A 1NK9A 4PPXA 3Q8RB 3AQKA 1NZPA 1NK5A 1KSPA 1FA0A 4C8OA 5HRIA 4NLGA 3T5HA 1Q79A 3GIMA 1ZQWA 4MEXA 4BDPA 2PFOA 4M9NA 2XO7A 3OUYB 2PXIA 3JPQA 1T4GA 3E2EA 4QZBA 1S9FA 4I2AA 1ZQFA 4UQGA 4DQQA 5KG1A 2BQ3A 1ZQEA 5J0TA 3ZDBA 2KP7A 5KFNA 5HRLA 8ICNA 4DS5A 3IHQB 1ZQIA 2Y1IA 4C8KA 4JWNA 3NTUA 2NRXA 3OHAA 2W9CA 4ED3A 1ZQCA 3RH5A 9ICIA 4RWQA 3NYBA 1D8LA 9ICCA 3AU6A 5CR0A 4IQWA 4XUSA 4MFAA 3H40A 3PW5A 3GV8B 4WC5A 3JPNA 3LWLA 3RBEA 4YFKA 5KFOA 2V4RA 3PO4A 3MBYA 4LVSA 4MFFA 2VA2A 8ICKA 4DF8A 4K4IA 4FS1A 4X4VA 5IINA 4B9MA 5DGBA 1BNOA 3V72A 1L3SA 4WC2A 1ZQZA 4I2FA 4AT9B 1S97A 5KFQA 2Q0ZX 4YR3A 5L1IA 3PW7A 3THVA 2BQRA 1X9MA 1TK5A 1ZQHA 4I2JA 4AT9A 3MFHA 3PX6A 5KT7A 4YCXA 3Q8SB 5KTQA 1MQ3A 2DFLA 4TUQA 4UD5A 2PI5A 2AGPA 3PV8A 1SL0A 5HHIA 9ICOA 4QWCA 3RB6A 4JWMA 4RT3A 4UB2A 4QW9A 4WCWA 1S0NA 3RJIA 2C2DA 7ICFA 3M9MB 4PHDA 3MR6A 1MIVA 5TZVA 2DRAA 4EZ6A 2VA8A 2F1HA 4QZEA 2I1QA 3M9OB 4O5EA 8ICHA 3OVAA 4I29A 4DLGA 3JPSA 4JV0A 3PMNA 4BXOB 2R8GA 4DLEA 5L1KA 4F92B 3PX0A 2IHMA 4M0AA 1KFSA 5DQHA 4F91B 5L1LA 4P4OA 4J9PA 3GV5B 4WBYA 5DG8A 3Q8QB 3H4DA 7ICPA 1DK2A 2R8JA 7ICQA 4B9TA 3Q8MA 1ZJNA 4AT7A 4I2CA 2XCPA 9ICWA 5DECA 2HHXA 5KG7A 4J9QA 3LDAA 1QTMA 9ICEA 5DKWA 4YXJA 4QZCA 4KLUA 5DBBA 1SL1A 5EWFA 8ICFA 7ICKA 2ZHAA 3JPRA 1RYRA 4KLMA 9ICSA 5J2JA 4DSIA 2HHQA 4DFPA 3KHHA 2I9GA 3AQMA 4R66A 5J0QA 4DL7A 5DDYA 4UB1A 2IBKA 4ELVA 1Q78A 4QZIA 1NKBA 5KFJA 1ZQOA 1JAJA 5F2VO 4ZH4A 8ICMA 4DFKA 2DVIA 3C2KA 4O3NA 4F5OA 5KFFA 2BCVA 2XGPA 4NXZA 2J6UA 2P66A 3WFQE 5DB8A 4O3RA 4WC0A 4IG8A 1LV5A 1NK8A 3PNCA 4J9OA 5DB7A 2JEIA 9ICFA 4ECQA 2BPGA 4WC1A 1HJPA 3EYZA 4ECVA 1ZQVA 2R8KA 8ICOA 3T5JA 1JQRA 5KT2A 2M2VA 1ZQYA 3TARA 4UD4A 4E7XA 2ZH9A 4UB4A 2V9WA 2MUTB 5HMLA 2M2UA 1UEUA 8ICYA 3UQ2A 2FMQA 2W9AA 4QWEA 3PX4A 4GXIA 1A76A 3UXPA 1NJZA 3T3FA 5J2BA 3QEAZ 4I2BA 9ICMA 4RNNA 1S0OA 1KFTA 4LZDA 4PGQA 3C18A 2W8KA 3C23A 4QZDA 5KFUA 3HX0A 1RYSA 1OU5A 5KG5A 3V7JA 4QZHA 2DRBA 8ICRA 2UVWA 4EBEA 4UAZA 7ICOA 2XCAA 3EWAA 4ECWA 3H8WA 4FHWA 4EYHB 5J0YA 1L5UA 5KT5A 1N48A 5HRDA 1S77D 3RJGA 4X4QA 4F2RA 4NLKA 5DQIA 3QZ8A 3HP6A 3Q8KA 2PI4A 4O5CA 7ICTA 1KNYA 3C66A 5HMMA 1PZNA 5J0WA 3M8SA 1SKSA 2BCRA 3EPIA 4M6WA 4B9VA 3V7KA 1RXWA 2ISOA 1WCLA 1NJXA 3SV4A 1QSSA 4M6WB 1Y88A 3C1YA 3UPSA 4RT2A 2NRTA 1N56A 2JZBA 1S0MA 3EW9A 4F4YA 3V6HA 1TK8A 1RXVA 2RFFA 4FH5A 3RH6A 4EEYA 3RR7A 4JUZA 5IIKA 3BQ2A 4ECSA 4QZ9A 4DSLA 1MSWD 7ICEA 4FHYA 3C2MA 1AROP 4FS2A 4NM1A 3OVBA 4QWDA 5CB1A 5D49A 5C5JA 5EWEA 4NLNA 4DOCA 3WFRE 7ICUA 4DFJA 2GWSA 1H38A 5KFHA 4ED7A 5KFPA 3ISDA 2AGQA 4F93B 8ICGA 1Z3EB 2J6SA 3H4BA 4F5NA 5J2GA
chains in the Genus database with same CATH superfamily
8ICZA 2BKEA 1N62A 4MFCA 1SZHA 3RTVA 2EAMA 1WYGA 5AHXA 1X66A 2DR5A 3RJKA 1ZQMA 3F53A 2HOIA 4EBJA 3WK6A 1B43A 2AXTU 3HWTA 4LEVA 1FFUA 5J0UA 4MF8A 4FHXA 3PW4A 4DL6A 4QWBA 2PFNA 2JH7A 2WF7A 4KLHA 4TURA 3HPOA 5KG3A 4JK1A 1UETA 3GV7B 1R89A 3AQNA 2QB1A 4CF3A 3K75D 5DB9A 5JTGA 3RB0A 3DEEA 4B6JA 4UW9A 2G5IB 2QLTA 7ICIA 3KKAA 4NLZA 4C80A 2ZG6A 3UXNA 4M9LA 4F5PA 1YZ7A 7ICJA 4F72A 1T3NA 9ICVA 1YZ6A 4DSEA 5HP4A 1ZD5A 3MABA 4WOYA 2Y9UA 3NRZA 1JIHA 4Q8EA 2RDIA 5D46A 3CW2C 5KG0A 4R64A 4DOBA 3MR2A 3WKEA 1LKYB 1ZQSA 2PMZC 2OEHA 1A77A 5ALTA 3GDXA 3N4MB 3JCFA 1SKWA 1Z00B 5HNKA 3F2BA 4MEYA 9ICEA 3LYSA 1COOA 8ICBA 2BQUA 2E8MA 3UMBA 3GILA 3HT3A 2EAOA 2KHQA 3PW0A 1NK7A 1QSYA 4M9GA 1RG6A 3BDPA 1QQ5A 4I2HA 2NRVA 4J9LA 2ES6A 4EEKA 5KFMA 1ZQRA 3G6XA 4DSKA 2F2AB 3I28A 4LEZA 3MGVA 2XY6A 4KLOA 1LVHA 3PHZA 2CPRA 1KN5A 3ORYA 2VIXA 5KFXA 2WF5A 2WB1F 2ZUDA 3MR3A 2JEGA 4WJ3B 1C20A 4P0QA 4I2IA 3NGDA 3M6ZA 1U4BA 3WKDA 3ZD9A 2GOLA 2YMQA 8ICVA 4QIWC 3IRUA 4U7CA 2H5XA 3WK5A 3ER8C 4MF2A 4GC6A 4F3OA 4QZAA 2Q66A 3E0FA 2EZYA 4BWJA 4QZ8A 1S0VA 3M8RA 2KVCA 2JMGA 1QCKA 4CNQA 1B0XA 1Z4OA 3SENA 4J9SA 4X0BA 3H0MB 9ICKA 2DWQA 5KG6A 3AL0B 1X6JA 5AM4A 5DBCA 4OJLA 5ALQA 4CCHA 1JXLA 2HHWA 3U26A 1ZD2P 2ZH4A 3RJFA 5J0SA 4OO1J 2WHEA 4MHVA 2KZMA 4UBCA 4EV6A 3NRWA 1L7NA 5KFDA 2JZBB 2YY6A 1TK0A 3BQ0A 3QZ7A 3GIJA 5HRKA 3RFAA 5HREA 3MDAA 1ZQBA 4RNMA 2F1IA 5AKGA 2A1AA 2ZIXA 5KFZA 1QH9A 2FI1A 8ICAA 5FP0A 3QUTA 5ALWA 1U9LA 4TUPA 1HUOA 3ETLA 2ZIUB 2A1JA 2ZTDA 1XNSA 4O68A 1QQ7A 3OV7A 3T5KA 9ICTA 2BCUA 5HRFA 3TAPA 5E79U 4GC7A 1BPZA 1VJ7A 2A19A 4NKUA 4J9NA 4PH5A 3F2CA 1IIPA 4J9KA 4Y2JA 2ZH2A 1O08A 5AM5A 3OGUA 4PHPA 3JYYA 5J0XA 2WTFA 1L7MA 2JH1A 5CFSA 1SKRA 4ECZA 4UBBA 3RJJA 5CJ7A 1X9WA 3LVWA 1S10A 3E58A 4NXWA 4NM2A 2W9MA 4RQMA 4IQVA 1NNLA 2DL0A 1YLQA 2C2EA 1T94A 2EAPA 3ISBA 2XY7A 4EX6A 2W54A 5KFWA 3SAFA 3OSNA 4ATBA 1L8OA 2D3DA 2OWOA 4K4HA 4CF4A 4EEBA 2FE9A 4DCCA 4Q43A 4DFMA 2D8CA 1KLNA 2C22A 3OHBA 3PW2A 1B4FA 4XJEA 4P0PB 1D8BA 3A0HU 3QU4A 5KFRA 4P2HA 1PK1A 2YB1A 1UT8A 4EZ9A 1RDFA 4BUGA 1V9PA 2ZIVB 5DBAA 5CHGA 5CWRA 2UVRA 2W8LA 4EBCA 3AMZA 4DS4A 1L3VA 7ICGA 1V97A 4F8RA 4YD1A 3SEIA 5KFBA 3HRDD 2IOHA 2IHOA 1KSPA 1M6YA 3ETRA 4NLGA 2KNJA 3OPXA 3WK8A 3T5HA 3GIMA 2PFOA 2HN2A 4QZBA 2W04A 4UQGA 4DQQA 2KICA 3IDWA 1ZQIA 4C8KA 4JLXA 2W9CA 1ZQCA 3RH5A 2KK0A 4RWQA 3AU6A 4UAVA 4MFAA 4OJ6A 2BBJA 3JPNA 3LWLA 3NWIA 4MFFA 2VA2A 2AH5A 4K4IA 4X4VA 4B9MA 2Q0ZX 3THVA 2V9WA 5L1IA 3MFHA 1F5SA 4LJXA 4A8EA 3Q8SB 4TUQA 4UD5A 2PI5A 4WQKA 4UB2A 4QW9A 3BZCA 3M9MB 1MIVA 2ESEA 4BXOB 2WB1C 5ALDA 4EEDA 3KKAC 2BBHA 4P4OA 1X40A 5DG8A 3Q8QB 1JRPA 7ICPA 2W3RA 4B9TA 1SIJA 2HHXA 5AKLA 5DKWA 5DBBA 5EWFA 3C28A 1RYRA 4KLMA 3N28A 4UB8U 3KBBA 4C7ZA 2KV2A 1JAJA 2G08A 4DFKA 2P66A 4O3RA 2JEIA 2LMRA 3EYZA 1ZQVA 2H3QA 8ICOA 3T5JA 2M2VA 4UB4A 3UQ2A 4QWEA 3PX4A 3T3FA 5J2BA 1KFTA 3HX0A 1FEZA 5KG5A 3V7JA 4QZHA 2HN1A 8ICRA 7ICOA 2G07A 4UAZA 4FHWA 3SD7A 3RJGA 3HJEA 2BDUA 1PUZA 3QZ8A 2LHTA 4O5CA 3OTQA 5F3XB 7ICTA 2OHFA 1SKSA 3EPIA 4M6WA 3V7KA 4EENA 1Y88A 4GIBA 3BZKA 4IS7A 1GPJA 3NYBA 2JZBA 4FH5A 3RR7A 4JUZA 2H3IA 4DSLA 3C2MA 1AROP 4NM1A 3ONNA 1Q3UA 5CB1A 5C5JA 7ICUA 3L3FX 4ED7A 8ICGA 1Z3EB 5ALJA 3KD3A 2OM6A 3S6JA 2PKEA 4C4SA 3QU5A 1TAQA 5AM2A 2UVVA 4O0IA 1ZRNA 1ZXIA 2KTQA 1UT5A 3PO5A 9ICPA 2AU0A 2FCLA 8ICXA 3WFPA 2KIWA 2EH9A 2KFNA 9ICRA 4NXUA 3ZDEA 3TFSA 1TKDA 4JV1A 2Y0SC 1D9FA 2B21A 3EZ5A 5D62A 1ZQLA 4RQ5A 2W9CB 4KB6A 2PBEA 5HRBA 1YT3A 3EF2A 4KX5A 1MN8A 4YP3A 1PVQA 4RQ3A 2DGZA 4Y2XA 4PZOA 2FPLA 3PR5B 2R18A 4Y2SA 1IG6A 1DOQA 3MGIA 8ICIA 5ALIA 1QSLA 4J9RA 1RQNA 4YN4A 5DG7A 5G5HA 2OH2A 1Z1BA 5AKXA 1CI4A 1CEZA 4K96A 4RQNA 4Y2TA 4BXOA 3B9JA 5KFIA 4RQ7A 5HR7A 2F77X 1NKCA 1BPYA 5J2IA 1MC8A 1LKYA 1L3TA 1JX4A 1HEKA 8ICSA 3G6YA 4PGXA 4ECXA 5KFCA 2LPEA 3PVXA 1U47A 2LYBA 8ICLA 5BOLA 1Z00A 2XC9A 4YXMA 5KG4A 3DDHA 4Y2YA 3QEBZ 5G5GA 4X4SA 3FDSA 4DL2A 2O5AA 2DPIA 4WBZA 5DDMA 3LQCB 2IHNA 2ISPA 3WFOA 9ICAA 1VFGA 4HAIA 4JLZA 2K4HA 4PHAA 1K5OA 3JPTA 5ALGA 5AM1A 4X4TA 2WFAA 4FE3A 3SZ2A 3H8JA 1ZQJA 2ZH6A 5EOZA 5AKKA 1NK0A 2HHVA 1R8CA 1XSNA 3IG8A 1OUQA 1A6SA 2VJ5A 4RWNA 4RQ4A 2EDUA 2W11A 2BZFA 1SV4A 1X6IA 4O3SA 4FBUA 2YMMA 2FDRA 2DR7A 1ZQAA 2YTUA 4UB5A 3TKAA 2ZIWA 1ZQNA 5JRTA 4DL5A 5BOMA 3H39A 3BS5B 1U49A 4RPZA 2IMWP 2WF6A 5ALRA 1QQ6A 4Z6FA 3TI0A 5C0YA 3L9DA 2IA6A 3HW8A 3NS1A 3WKBA 4RUCA 1TVAA 4I2EA 2F8LA 2EQYA 4O9MA 1R8AA 1K1SA 5IIIA 2B56A 2ALZA 4C8LA 1Q8KA 3SQIA 2MAXA 5J2KA 1ZYQA 3H3AA 4LT6A 2HVHA 3G6VA 3BS7A 2BPFA 4NL9A 2H3FA 3QU2A 2XIDA 1RM6C 2BHNA 1K1QA 3TADC 4WH5A 3KOOA 2BDPA 4YD2A 3GFKB 4GXJA 5J2DA 4I28A 1SWVA 2WF8A 3RRHA 4WC4A 4S3NA 2KVSA 3I1YA 3GZFA 5F9LA 3RF9A 4FHPA 1NK4A 4R8UA 3OVSA 2OCEA 1F5AA 2LYHA 5KFKA 4HX0A 2RLTA 1NKEA 1SB3C 4UASA 2ZJAA 4E8FA 4KN7A 9ICHA 4F4WA 3QE9Y 4XQ8A 3N7PD 1WOTA 4ACOA 2O1PA 1MIWA 1VLBA 8ICQA 4ED1A 3KFUF 3ALRA 2ASJA 3HILA 4NL9C 3HJ4A 1DK3A 2YQEA 5AKZA 4ED8A 1JI7A 2R8HA 4ED0A 4X4OA 4NLCA 4UAWA 5KFTA 2LI6A 4GXKA 2KJ5A 2ZH1A 4UB6U 4O5KA 3KHLA 4ATBB 5IIOA 3O0FA 2NO5A 2HHPA 3AQLA 2C28A 1T7PA 3PY8A 1TFYA 1JMSA 2B0CA 3OUYA 1UEVA 4NKTA 2NO4A 1SXDA 2PFQA 2ZHBA 3H0RB 1BPEA 3RR8A 4ELUA 2WF9A 4RZRA 3RAQA 5L1JA 1C7YA 4K99A 4M5DA 5KFSA 2FPMA 2P6RA 2H3ZA 3OSPA 4KMUA 4O3PA 1T3QA 3OWGA 5J2EA 4O69A 4EP7A 2DR9A 3C1ZA 2M2WA 1URJA 3PSIA 3NKUA 1UQVA 3JPOA 5KL8B 3AQEA 1ZETA 4E80A 4KLDA 1NK9A 3AQKA 1FA0A 5J8YC 1IV8A 2XO7A 2PXIA 4I2AA 1S9FA 2ODGA 1Z4NA 5KG1A 1ZQEA 5J0TA 5HRLA 1FIQA 2Y1IA 4JWNA 3OHAA 2AHOB 3PSTA 9ICCA 4XUSA 3H40A 3PW5A 2F8KA 5KFOA 1ZQZA 4I2FA 2DF4B 2F3NA 2BQRA 1ZQHA 4I2JA 3PX6A 5KT7A 5B3PA 1RQLA 1MQ3A 2DFLA 2AGPA 1CRXA 3RB6A 1S0NA 3RJIA 2C2DA 4PHDA 3MR6A 5TZVA 3C29A 4QZEA 4I29A 3PMNA 3K7DA 2DUYA 4DLEA 1AQ6A 2L5YA 5DQHA 4F91B 5L1LA 4J9PA 3GV5B 3H4DA 3K1ZA 1DK2A 4DFDA 2R8JA 2M0NA 1ZJNA 9ICWA 5DECA 1TE2A 5KG7A 2QKQA 4KLUA 4YXJA 4Y2RA 2K4IA 1SL1A 2ZHAA 4OJ5A 2HHQA 3FM9A 2N1RA 3KHHA 3VC8A 1V38A 2W55A 4UB1A 1N5XA 4O3NA 4F5OA 2J6UA 5DB8A 4WC0A 4IG8A 4BX9C 2K8AA 3ICXA 4UD4A 5KT2A 1ZQYA 3TARA 4ICAA 5HMLA 2FMQA 2HOFA 2D6FC 1NJZA 3QEAZ 1FFVA 4LZDA 2W8KA 5AKJA 3C23A 1MA7A 1OU5A 3NVWA 2JRZA 2XCAA 1Z19A 1NZBA 3NVZA 4EYHB 5J0YA 3IV6A 2G09A 4F2RA 4NLKA 5DQIA 2K8BB 3Q8KA 5HMMA 5ALKA 5J0WA 3M8SA 2ISOA 2HBJA 1NJXA 3SV4A 1QSSA 1PVRA 3C1YA 1N56A 4K9AA 3EW9A 3UMCA 1TK8A 1RXVA 4ECSA 4O6AA 4FHYA 5D49A 4G9BA 2GWSA 5KFPA 2AGQA 3QNMA 2HHSA 4F5NA 4RQ1A 2ZH5A 1SL2A 2HDOA 5KG2A 5ALLA 1XWLA 1L8LA 2HW3A 4EELA 2KD1A 5KNIA 4ECTA 2ID1A 4AP9A 3SYZA 3NVOA 4C8MA 3H7IA 1N61A 1P7DA 5DG9A 5IIMA 3RAXA 1ZQTA 3M9NB 3AN1A 5AI0A 1D8YA 4O67A 1FO4A 4X0AA 3EUB2 4M9JA 3AQFA 2MRLA 3HIYA 4KMOB 2P6UA 4OAFA 3TAQA 4ELTA 8ICJA 4KN4A 5EE0A 2FPKA 5AI8A 5EE9A 5CP2A 4OJOA 4YQWA 1R8BA 3H0LB 3UQ0A 2ATLA 1XS9D 3SI8A 1BPXA 4IL6U 1L7PA 2ZXIA 1S8OA 2MA1A 5B66U 3KZIU 1KRPA 1WWVA 4YMNA 4K97A 4YG2A 3LWMA 4TQRA 1XU4A 1HUZA 4PL1A 1ZQPA 4XRHA 1TFRA 2ZIVA 4KTQA 4DQRA 4C4TA 4P0QB 5KT3A 1ED1A 4N7RA 3MFIA 4F5QA 4K98A 2ZH8A 5IILA 2Z7JA 3ZDAA 3RRGA 4ED6A 4CGZA 1KQQA 2ZH3A 2KJ8A 2YX8A 1ECWA 3V6JA 2YB4A 2DR8A 5D4BA 4KLFA 3D2NA 5KAFU 4KLEA 3DV9A 4ECRA 2OYYA 2VANA 1JUDA 8ICEA 1TAUA 9ICGA 2XI9A 5T14A 2W3SA 1SZPA 4X4RA 2W7OA 1T8EA 2VA3A 2GLEA 4WC7A 1O03A 7ICNA 8ICKA 5J2HA 4RQ2A 9ICLA 1N63A 4C8NA 5CFUA 2K8CB 5HR6A 4NXTA 2AGOA 4XA5A 2XICA 1XO0A 2KZZA 7ICLA 2Y1JA 2FMPA 3ISCA 4Z6CA 5J2FA 1GO3F 1KEJA 3Q8LA 9ICNA 4J9MA 4F5RA 4YMMA 4FBTA 4X4UA 1XSLA 2KIVA 2ZH7A 1DGSA 2JHDA 1PVPA 1U45A 4B9NA 4KLJA 5AM3A 5DQGA 1RYUA 1TFWA 1JALA 4M2YA 2I6XA 4C4RA 5KT4A 1ZQKA 1X42A 4Z6EA 2KKVA 9ICUA 4UAUA 4Y2VA 3LK9A 1KW4A 1JN3A 2RHFA 4FHVA 3BQ7A 4UARA 3Q8PB 3BQTA 5IIJA 5JUMA 3MCRA 5D63A 3QYPA 3AM9A 4ZOHC 3H38A 1KKXA 4LZGA 3H37A 8ICTA 2M2TA 3T5LA 1BVSA 5AK5A 2ZJ8A 4ECUA 4YR2A 5CHEA 5JU5A 5J0OA 2W9BB 3M1YA 4FFDA 4Q8FA 1Z1VA 4CRXA 4TQSA 3F2DA 2O6KA 4QZFA 2FLNA 1MQ2A 2JV3A 3MR5A 4QIWF 4HYKA 4WQLA 4WC6A 4CF5A 3BQ1A 2LM1A 5KFVA 2VJ4A 5B5EU 1SV0A 1J2MA 5AM0A 3C21A 4EBKA 5J29A 5AI9A 1KFDA 1UA0A 4KLGA 2ASDA 4R63A 1OW5A 5F9NA 4DSJA 4IQUA 4EGWA 3IP4B 2P35A 2GH1A 4B9UA 4RWPA 2KOBA 2NYVA 3B0YA 2ZTCA 1RPLA 3FAHA 4E0DA 1N5WA 1NK6A 1Q46A 2H3VA 4EYIB 7ICVA 2GA9D 4UB3A 4RQ6A 3OJSA 3MDCA 3QUQA 1PK1B 4KX3A 4IRDA 2FLLA 1XSPA 2NV3A 1EXNA 3NUQA 1SGGA 1PK3A 7ICHA 3JZ0A 5B3QA 3WFSC 4DQSA 1CUKA 4IC9A 2HHUA 2A1JB 4AT8B 1DGJA 2PFPA 3RH4A 5DLFA 1KTQA 2BGWA 1ZRMA 3V7LA 4NY8A 3CYMA 5CA7A 4RU9A 4RPYA 3C2LA 4C7YA 5L1MA 1PX5A 2GAFD 1RZTA 1U48A 3KZXA 8ICUA 3F5EA 1BNPA 2K89A 4K4GA 4OAHA 4DSFA 2HI0A 3RBDA 4NV0A 1A0PA 2HHTA 4OD0A 5DB6A 4PPXA 1NK5A 4K9BA 4C8OA 1Q79A 1ZQWA 4MEXA 3J81j 4M9NA 3JPQA 1T4GA 3E2EA 3L4PA 4LEYA 1ZQFA 3ZDBA 2KP7A 8ICNA 4DS5A 3IHQB 5ALNA 1F44A 1D8LA 1J2NA 4OAGA 2A3VA 3ER9B 4IQWA 4FZNA 3GV8B 4WC5A 3RBEA 4LVSA 3TACB 2V4RA 2HSZA 4FO1A 3NVYA 4FS1A 1BNOA 5ALOA 5DGBA 1L3SA 5ALVA 2W43A 5CEHA 1X9MA 2CRXA 4AT9A 3FC4A 3SAGA 1UHUA 1ZOLA 3CK6A 3PV8A 1SL0A 5HHIA 1VJ5A 4RT3A 4J03A 2VA8A 2YMLA 5AKIA 3OVAA 3JPSA 5J8YA 2KE7A 2G5HB 5L1KA 4M0AA 3WU2U 3ZI4A 3T79A 5AI6A 7ICQA 4I2CA 2XCPA 3LDAA 1QTMA 4C0ZA 3SMVA 2EWRA 3JPRA 9ICSA 4FZMA 2E5SA 4DSIA 4USAA 3AQMA 1V85A 4DL7A 5J0QA 2LYAA 2IBKA 4K8VA 1Q78A 5KFJA 1ZQOA 5F2VO 4ZH4A 3CRXA 8ICMA 2DVIA 3QU9A 3ED5A 4NXZA 2XGPA 5ALYA 4US8A 3PNCA 9ICFA 2BPGA 5CRXA 3NVVA 4ECVA 5ALHA 4E7XA 2ZH9A 1UEUA 8ICYA 5CFTA 4GXIA 1A76A 3UXPA 4I2BA 9ICMA 2KSOB 3C18A 5KFUA 1RYSA 2DRBA 2UVWA 4EBEA 3EWAA 3H8WA 1S5LU 4X4QA 2ZIXB 2I5HA 3HP6A 3I76A 3C66A 4NXXA 2E1FA 3TADA 3R9KA 1WCLA 1KBUA 4RT2A 2NRTA 5AKEA 1S0MA 2KMDA 2B6GA 4O3MA 5IIKA 3OVBA 3M7DA 5ALFA 4QWDA 4DOCA 3WFRE 4DFJA 1H38A 1SWWA 5KFHA 3ISDA 4F93B 2BCRA 2W03A 2J6SA 3WK7A 2GO7A 1V4AA 3V6HA 5J2GA 2BCSA 3FYHA 4DEZA 3ZD8A 2XY5A 2KJ9A 3SV3A 2NRWA 1LB2B 5KL1B 5HC9A 4IR9A 1ZQUA 5KFGA 1JXEA 3H8MA 4ED2A 2IOFA 2JEJA 2F44A 2W9BA 3KTQA 1Q3VA 2E1EA 1DRGA 5KFYA 4I27A 1N60A 2RP5A 4NXVA 1NOMA 4I2GA 2EZZA 2K4EA 5HRGA 4EX7A 4KLIA 9ICBA 4B9LA 3TQ1A 3AEVA 2RRDA 5AK3A 3B0XA 1UA1A 4BJQA 4OAIZ 5KFLA 4I2DA 4IRCA 1IXRA 4IRKA 8ICWA 4PGYA 3V6KA 4TUSA 2W7PA 2CN1A 4AYBF 4DQPA 2KZ3A 1L7OA 3CP8A 4G3IA 4RUAA 3GIIA 4P0PA 4OJPA 3C5FA 2LM4A 2QARB 4RQ8A 5ALMA 2BPCA 4F2SA 4X4NA 3RB4A 1NJWA 3PR4A 4IQTA 4QJFB 5A0LA 5DLGA 1WWUA 4RQ0A 1BPBA 2ASLA 2B4VA 7ICMA 3KHGA 2HCFA 3D6JA 2AQ0A 1WCNA 4DOAA 4P4MA 3IG5A 5AIAA 2AQ4A 5DGAA 3QUBA 2R8IA 5KT6A 3WK4A 5EE1A 3QU7A 3OJUA 4DWIA 4R65A 2ZIWB 3QX7A 4YMOA 4DL3A 1IM4A 4BGDA 3F5AA 5AK6A 5J2CA 5BPCA 1XC9A 4AT7B 1NI3A 3EPGA 2KFZA 5GTIU 4M47A 5HR9A 2ZUBA 2KHVA 1ZQXA 4RNOA 1F0MA 3NASA 2BR0A 4KLQA 4KLTA 4KLSA 7ICSA 4F4ZA 2KEYA 9ICQA 1S76D 3GQCA 4F4KA 9ICOA 3D2SA 4ECYA 2KN7A 1QLNA 3RB3A 4O3OA 1X9SA 2XGQA 4I0UA 4B9SA 2WAQC 5D61A 4QZGA 4FO6A 5HHHA 4X4PA 8ICPA 2HBLA 5DEDA 1X2IA 3GU3A 4Y2PA 3PSPA 1L3UA 4RWOA 4R8UB 1BPDA 9ICJA 4GLXA 2F76X 2YMPA 5EWGA 4US9A 2KKPA 2DKZA 3RJHA 4GFJA 3ZDCA 3KHRA 1MIYA 2J6TA 2ZXHA 2DKXA 4PZNA 3L5KA 5KFEA 1NJYA 2RDJA 4NLBA 4Q45A 3TFRA 4IR1A 4Z6DA 4CDGA 3ZDDA 3M6KA 4UAYA 5ALEA 1JROA 4WC3A 4YR0A 4P4PA 4FH3A 2E8OA 1ZD4A 4EBDA 3AU2A 5L9XA 2BCQA 2DBYA 5AKHA 4M9HA 5H2FU 1WG8A 2CXYA 1B22A 5J2AA 3SAHA 4PHEA 2AJQA 3IM1A 9ICXA 4O3QA 2V4QA 2FLPA 3N7SC 4M04A 4XQ7A 3K1RB 4Q44A 4DO9A 3HJ1A 2ZIUA 4F50A 3BS5A 3PMLA 2HBMA 2ZTEA 3AUOA 4RPXA 2HMXA 2QARA 2QB0B 4YVZA 5EE3A 1ZQQA 2Q4TA 2E3TA 1ZQGA 4CE6A 2IUBA 3UXOA 5AK4A 2EANA 5AIBA 4DL4A 5KFAA 2E8PA 5HRHA 5JTIA 3UPQA 3C5GA 3K4GA 3UMGA 2B51A 1KL9A 2MUTA 2BE3A 5K4LA 4KITB 3MC1A 4OCZA 4U6PA 4AT8A 3GIKA 1NO5A 3CNHA 4BWMA 2NRZA 3H8SA 7ICRA 2F1JA 4F71A 2ZUCA 4X5VA 1ZJMA 2HBKA 4JB3A 2UVUA 2Y9TA 4QWAA 4KM5A 2HVIA 3MGHA 1XO1A 5J0PA 2JR5A 4AYBC 5J0RA 2MU2A 4KLLA 2FMSA 4DQIA 2M9NA 2JGAA 2C2RA 3BJYA 4Y2QA 1KDHA 3N7RC 2ZJ5A 3WK9A 4QW8A 2K4PA 3JPPA 2JEFA 2K60A 1D9DA 1TV9A 1ZQDA 2NRKA 2DPJA 4F4XA 4DF4A 1BGXT 2WAQF 5TISU 2FJ6A 3N97B 5ALXA 4JMUA 5ALPA 2VKQA 3TANA 3HKZC 8ICCA 3RJEA 4JV2A 4NWIA 3Q8RB 1ZD3A 5AI5A 1NZPA 3D2QA 5KAIU 5HRIA 1UPHA 4BDPA 3OUYB 2BQ3A 2G0AA 5KFNA 3NTUA 2NRXA 4ED3A 9ICIA 2PMZF 5CR0A 1SV0C 4YFKA 3VCBA 3PO4A 3MBYA 4DF8A 3A0BU 5IINA 4WC2A 3V72A 4AT9B 1S97A 5KFQA 1DXSA 4YR3A 3PW7A 1TK5A 1TAMA 4YCXA 5KTQA 1SXEA 4QWCA 4JWMA 4WCWA 3LVVA 7ICFA 2DRAA 1UCVA 4EZ6A 2F1HA 3M9OB 2I1QA 4PL2A 4O5EA 8ICHA 4DLGA 3HKZF 4JV0A 5AICA 2R8GA 5ALUA 1X9XA 3PX0A 5GTHU 4F92B 2IHMA 1KFSA 3QXGA 3IN5A 4WBYA 2XVTA 2OXOA 3Q8MA 1J97A 4AT7A 3WKCA 4J9QA 2QB0A 3QUCA 4QZCA 8ICFA 5AKYA 7ICKA 5J2JA 3PSFA 4DFPA 2I9GA 1HIWA 4R66A 4ELVA 2KSOA 2RQ5A 5DDYA 2KG5A 4MKPA 4QZIA 1NKBA 3C2KA 5KFFA 2BCVA 5ALSA 1COKA 3WFQE 2LBOA 1L6NA 1LV5A 1NK8A 4J9OA 5DB7A 4ECQA 4WC1A 4QNLA 1WUDA 1HJPA 1JQRA 2R8KA 2MSNA 3PZPA 4UATA 2MUTB 2LKYA 2M2UA 4Y2UA 2W9AA 4NJ8A 1VDVA 3UM9A 2YN4A 4RNNA 1S0OA 4PGQA 4QZDA 4ECWA 5HRDA 1L5UA 5KT5A 1N48A 3WKAA 1S77D 2HOQA 2EZXA 2DQNB 2PI4A 1KNYA 1PZNA 1OXJA 5AI4A 3ERCC 4FZLA 2IOFK 1N2XA 2Y0SF 4B9VA 1RXWA 1ZQ1C 4M6WB 3UPSA 4LEWA 3SR6A 2RFFA 4F4YA 3RH6A 4EEYA 3BQ2A 4QZ9A 4PJ0U 1MSWD 7ICEA 2JXJA 4FS2A 2G06A 4NLNA 5EWEA 2E8NA 5ALZA 3H4BA
chains in the Genus database with same CATH topology
4RQ1A 2ZH5A 8ICZA 1SL2A 2BKEA 2BCSA 3FYHA 4DEZA 4MFCA 3ZD8A 5KG2A 2XY5A 3RTVA 1XWLA 3SV3A 2HW3A 2NRWA 1TAQA 4ECTA 1LB2B 5HC9A 4IR9A 2UVVA 4O0IA 1ZQUA 5KFGA 2ID1A 1JXEA 3SYZA 3RJKA 1ZQMA 2DR5A 4ED2A 4C8MA 2JEJA 3H7IA 2KTQA 4EBJA 5DG9A 5IIMA 1UT5A 2W9BA 3PO5A 3KTQA 9ICPA 3RAXA 1B43A 2AU0A 1ZQTA 8ICXA 3WFPA 3M9NB 2KFNA 9ICRA 5KFYA 3HWTA 4I27A 3ZDEA 3TFSA 1TKDA 5J0UA 1D8YA 4MF8A 4FHXA 4JV1A 4X0AA 1D9FA 3PW4A 4DL6A 4M9JA 1NOMA 4QWBA 2PFNA 4I2GA 4KLHA 5HRGA 2B21A 3HIYA 3EZ5A 4KLIA 9ICBA 4B9LA 4TURA 3TQ1A 1ZQLA 2P6UA 4RQ5A 2W9CB 3HPOA 3TAQA 3B0XA 4ELTA 1UA1A 5HRBA 5KG3A 2PBEA 4JK1A 4YP3A 8ICJA 4KN4A 3GV7B 1UETA 4RQ3A 1R89A 5KFLA 2FPLA 4I2DA 2FPKA 3PR5B 3AQNA 4IRCA 1IXRA 4IRKA 5CP2A 3K75D 8ICWA 4PGYA 1DOQA 5DB9A 4YQWA 3MGIA 3V6KA 4TUSA 1R8BA 8ICIA 3UQ0A 2ATLA 1XS9D 1QSLA 4J9RA 4DQPA 3SI8A 1BPXA 3RB0A 2KZ3A 4G3IA 4RUAA 3GIIA 3C5FA 4YN4A 1KRPA 4RQ8A 4F2SA 5DG7A 2BPCA 4X4NA 7ICIA 3RB4A 4YMNA 4YG2A 3LWMA 1NJWA 3PR4A 4NLZA 4IQTA 4TQRA 1CEZA 1XU4A 3UXNA 1HUZA 4M9LA 5DLGA 4BXOA 1ZQPA 4F5PA 5KFIA 4RQ7A 4RQ0A 7ICJA 1NKCA 1BPYA 1BPBA 4XRHA 2ASLA 1TFRA 5J2IA 4KTQA 1MC8A 7ICMA 1L3TA 1JX4A 3KHGA 4DQRA 1T3NA 8ICSA 9ICVA 5KT3A 4PGXA 3G6YA 5KFCA 2AQ0A 1WCNA 4ECXA 4DSEA 5HP4A 4DOAA 3PVXA 3MABA 3MFIA 4F5QA 1U47A 2ZH8A 4P4MA 1JIHA 8ICLA 5BOLA 5IILA 5DGAA 2AQ4A 1Z00A 2R8IA 4Q8EA 5KT6A 2XC9A 3ZDAA 4YXMA 5KG4A 3OJUA 3RRGA 4ED6A 3QEBZ 2RDIA 4DWIA 2ZH3A 5D46A 5KG0A 4R65A 4R64A 4DOBA 3V6JA 4X4SA 4YMOA 2DR8A 4DL3A 3FDSA 1IM4A 3MR2A 4BGDA 5D4BA 4KLFA 4DL2A 5J2CA 2O5AA 5BPCA 4KLEA 1ZQSA 1XC9A 4AT7B 3EPGA 2DPIA 4WBZA 2KFZA 4ECRA 2VANA 1A77A 5DDMA 3LQCB 3GDXA 3N4MB 2IHNA 4M47A 1SKWA 8ICEA 2ISPA 3WFOA 1TAUA 9ICGA 5HR9A 2ZUBA 9ICAA 1Z00B 1ZQXA 5HNKA 4RNOA 1VFGA 1SZPA 4X4RA 4MEYA 4PHAA 2BR0A 1T8EA 3JPTA 2VA3A 4KLQA 4KLSA 4KLTA 1COOA 7ICSA 8ICBA 2BQUA 4WC7A 4F4ZA 4X4TA 3GILA 3HT3A 3SZ2A 9ICQA 3H8JA 1ZQJA 7ICNA 1S76D 2ZH6A 3GQCA 5EOZA 4F4KA 3PW0A 1NK7A 1NK0A 5J2HA 4ECYA 1XSNA 4RQ2A 1QSYA 4M9GA 3BDPA 2HHVA 2KN7A 9ICLA 1QLNA 3RB3A 4O3OA 1X9SA 2XGQA 4C8NA 4I2HA 4RWNA 4B9SA 2NRVA 4J9LA 2AGOA 4RQ4A 4XA5A 4QZGA 4FO6A 5KFMA 1ZQRA 3G6XA 4DSKA 5HHHA 4O3SA 2KZZA 4X4PA 8ICPA 4FBUA 7ICLA 2XY6A 2DR7A 4KLOA 2Y1JA 1ZQAA 2FMPA 4UB5A 3ORYA 3ISCA 5KFXA 5DEDA 1X2IA 4Z6CA 5J2FA 1ZQNA 1L3UA 2ZUDA 3MR3A 2JEGA 1KEJA 3Q8LA 9ICNA 4DL5A 4RWOA 4I2IA 4J9MA 4F5RA 3NGDA 5BOMA 4YMMA 3H39A 4R8UB 1U49A 1BPDA 4RPZA 1U4BA 9ICJA 4GLXA 2IMWP 5EWGA 3ZD9A 4FBTA 4X4UA 1XSLA 2ZH7A 1DGSA 4Z6FA 8ICVA 1U45A 3TI0A 1R8CA 2H5XA 3L9DA 4B9NA 4MF2A 4KLJA 4GC6A 2IA6A 4F3OA 4QZAA 3RJHA 5DQGA 2Q66A 4BWJA 4QZ8A 4M2YA 1S0VA 3M8RA 3HW8A 3ZDCA 1TFWA 3KHRA 4RUCA 1MIYA 2J6TA 5KT4A 1ZQKA 4Z6EA 9ICUA 4J9SA 3LK9A 1TVAA 4I2EA 4X0BA 5KFEA 9ICKA 5KG6A 1NJYA 1JN3A 2RDJA 4Q45A 3TFRA 4FHVA 4IR1A 4Z6DA 3ZDDA 4O9MA 1R8AA 5DBCA 3Q8PB 1K1SA 5IIIA 4UAYA 4CCHA 3BQTA 5IIJA 2ALZA 5JUMA 1JXLA 2HHWA 2ZH4A 4C8LA 4WC3A 4YR0A 4P4PA 3RJFA 4FH3A 5J0SA 3H38A 2MAXA 5J2KA 1ZYQA 2KZMA 4UBCA 4LZGA 3H3AA 4LT6A 2HVHA 3H37A 3G6VA 4EBDA 2BPFA 8ICTA 2M2TA 3T5LA 3AU2A 5L9XA 5KFDA 2JZBB 1TK0A 2BCQA 3BQ0A 3QZ7A 3GIJA 4M9HA 1BVSA 5HRKA 5HREA 2ZJ8A 2HHSA 3MDAA 2BHNA 1K1QA 1ZQBA 4ECUA 1B22A 4YR2A 4RNMA 2F1IA 5J2AA 4PHEA 5J0OA 2W9BB 2BDPA 2AJQA 3IM1A 4YD2A 9ICXA 3GFKB 5KFZA 4O3QA 5J2DA 2V4QA 4GXJA 2FLPA 3RRHA 4I28A 4Q8FA 4M04A 8ICAA 4WC4A 4TQSA 4S3NA 4XQ7A 1U9LA 4QZFA 4TUPA 1HUOA 3ETLA 5F9LA 4Q44A 4DO9A 1MQ2A 2FLNA 2A1JA 2ZTDA 3MR5A 4FHPA 4HYKA 3HJ1A 4WC6A 1NK4A 4F50A 4R8UA 3OVSA 3BQ1A 3OV7A 3PMLA 3T5KA 9ICTA 5KFVA 1F5AA 2LYHA 2ZTEA 3AUOA 2BCUA 5HRFA 4RPXA 4YVZA 5KFKA 3TAPA 4GC7A 1BPZA 1ZQQA 1NKEA 1ZQGA 3C21A 1VJ7A 4EBKA 5J29A 4NKUA 4J9NA 4PH5A 3UXOA 1KFDA 4DL4A 4J9KA 1UA0A 4KLGA 2ASDA 4R63A 2ZJAA 5F9NA 4KN7A 4E8FA 2ZH2A 3OGUA 4DSJA 5KFAA 4IQUA 4PHPA 9ICHA 5HRHA 3JYYA 4B9UA 5J0XA 2WTFA 4F4WA 3QE9Y 4RWPA 4XQ8A 3UPQA 1SKRA 3B0YA 4ECZA 2ZTCA 4UBBA 1RPLA 3RJJA 4E0DA 3C5GA 1NK6A 1WOTA 5CJ7A 1X9WA 3K4GA 2O1PA 4EYIB 1MIWA 7ICVA 8ICQA 4UB3A 4RQ6A 3OJSA 2MUTA 3MDCA 4ED1A 1S10A 2BE3A 2ASJA 4KITB 3HJ4A 1DK3A 4NM2A 2W9MA 4IRDA 2FLLA 4AT8A 3GIKA 4ED8A 1XSPA 4IQVA 1NO5A 2R8HA 4ED0A 4X4OA 4UAWA 4BWMA 5KFTA 2NRZA 3H8SA 4GXKA 7ICRA 1EXNA 2F1JA 2ZH1A 1YLQA 2C2EA 4O5KA 2ZUCA 4X5VA 3ISBA 1ZJMA 7ICHA 3KHLA 2XY7A 5IIOA 4ATBB 5KFWA 2UVUA 3OSNA 3JZ0A 4ATBA 4QWAA 2OWOA 2HVIA 3MGHA 2HHPA 3AQLA 1XO1A 2C28A 1T7PA 3PY8A 4K4HA 1V4AA 3WFSC 5J0PA 1TFYA 5J0RA 4DQSA 1CUKA 1JMSA 4KLLA 2HHUA 3OUYA 2A1JB 1UEVA 4AT8B 2FMSA 4NKTA 4Q43A 2PFPA 2PFQA 4DFMA 3RH4A 5DLFA 4DQIA 2M9NA 2ZHBA 1BPEA 1KTQA 1KLNA 2C22A 2BGWA 3V7LA 2C2RA 3OHBA 3BJYA 3PW2A 4RZRA 3RR8A 4ELUA 3RAQA 1KDHA 5L1JA 4NY8A 1C7YA 2ZJ5A 4QW8A 5CA7A 4M5DA 5KFSA 2FPMA 5KFRA 4RU9A 2P6RA 3OSPA 4RPYA 4KMUA 4O3PA 3JPPA 2JEFA 4P2HA 3C2LA 1D9DA 1TV9A 1PX5A 1ZQDA 2NRKA 2DPJA 1UT8A 5J2EA 4F4XA 4EZ9A 4EP7A 4DF4A 1BGXT 1V9PA 2DR9A 3C1ZA 1U48A 1RZTA 5DBAA 2M2WA 5CHGA 5CWRA 2UVRA 2W8LA 4EBCA 3N97B 8ICUA 3TANA 4K4GA 1BNPA 4DS4A 1L3VA 4DSFA 7ICGA 3RBDA 8ICCA 3JPOA 4F8RA 3RJEA 1ZETA 4JV2A 4YD1A 4E80A 5KFBA 4KLDA 2HHTA 5DB6A 1NK9A 4PPXA 3Q8RB 3AQKA 1NZPA 1NK5A 1KSPA 1FA0A 4C8OA 5HRIA 4NLGA 3T5HA 1Q79A 3GIMA 1ZQWA 4MEXA 4BDPA 2PFOA 4M9NA 2XO7A 3OUYB 2PXIA 3JPQA 1T4GA 3E2EA 4QZBA 1S9FA 4I2AA 1ZQFA 4UQGA 4DQQA 5KG1A 2BQ3A 1ZQEA 5J0TA 3ZDBA 2KP7A 5KFNA 5HRLA 8ICNA 4DS5A 3IHQB 1ZQIA 2Y1IA 4C8KA 4JWNA 3NTUA 2NRXA 3OHAA 2W9CA 4ED3A 1ZQCA 3RH5A 9ICIA 4RWQA 3NYBA 1D8LA 9ICCA 3AU6A 5CR0A 4IQWA 4XUSA 4MFAA 3H40A 3PW5A 3GV8B 4WC5A 3JPNA 3LWLA 3RBEA 4YFKA 5KFOA 2V4RA 3PO4A 3MBYA 4LVSA 4MFFA 2VA2A 8ICKA 4DF8A 4K4IA 4FS1A 4X4VA 5IINA 4B9MA 5DGBA 1BNOA 3V72A 1L3SA 4WC2A 1ZQZA 4I2FA 4AT9B 1S97A 5KFQA 2Q0ZX 4YR3A 5L1IA 3PW7A 3THVA 2BQRA 1X9MA 1TK5A 1ZQHA 4I2JA 4AT9A 3MFHA 3PX6A 5KT7A 4YCXA 3Q8SB 5KTQA 1MQ3A 2DFLA 4TUQA 4UD5A 2PI5A 2AGPA 3PV8A 1SL0A 5HHIA 9ICOA 4QWCA 3RB6A 4JWMA 4RT3A 4UB2A 4QW9A 4WCWA 1S0NA 3RJIA 2C2DA 7ICFA 3M9MB 4PHDA 3MR6A 1MIVA 5TZVA 2DRAA 4EZ6A 2VA8A 2F1HA 4QZEA 2I1QA 3M9OB 4O5EA 8ICHA 3OVAA 4I29A 4DLGA 3JPSA 4JV0A 3PMNA 4BXOB 2R8GA 4DLEA 5L1KA 4F92B 3PX0A 2IHMA 4M0AA 1KFSA 5DQHA 4F91B 5L1LA 4P4OA 4J9PA 3GV5B 4WBYA 5DG8A 3Q8QB 3H4DA 7ICPA 1DK2A 2R8JA 7ICQA 4B9TA 3Q8MA 1ZJNA 4AT7A 4I2CA 2XCPA 9ICWA 5DECA 2HHXA 5KG7A 4J9QA 3LDAA 1QTMA 9ICEA 5DKWA 4YXJA 4QZCA 4KLUA 5DBBA 1SL1A 5EWFA 8ICFA 7ICKA 2ZHAA 3JPRA 1RYRA 4KLMA 9ICSA 5J2JA 4DSIA 2HHQA 4DFPA 3KHHA 2I9GA 3AQMA 4R66A 5J0QA 4DL7A 5DDYA 4UB1A 2IBKA 4ELVA 1Q78A 4QZIA 1NKBA 5KFJA 1ZQOA 1JAJA 5F2VO 4ZH4A 8ICMA 4DFKA 2DVIA 3C2KA 4O3NA 4F5OA 5KFFA 2BCVA 2XGPA 4NXZA 2J6UA 2P66A 3WFQE 5DB8A 4O3RA 4WC0A 4IG8A 1LV5A 1NK8A 3PNCA 4J9OA 5DB7A 2JEIA 9ICFA 4ECQA 2BPGA 4WC1A 1HJPA 3EYZA 4ECVA 1ZQVA 2R8KA 8ICOA 3T5JA 1JQRA 5KT2A 2M2VA 1ZQYA 3TARA 4UD4A 4E7XA 2ZH9A 4UB4A 2V9WA 2MUTB 5HMLA 2M2UA 1UEUA 8ICYA 3UQ2A 2FMQA 2W9AA 4QWEA 3PX4A 4GXIA 1A76A 3UXPA 1NJZA 3T3FA 5J2BA 3QEAZ 4I2BA 9ICMA 4RNNA 1S0OA 1KFTA 4LZDA 4PGQA 3C18A 2W8KA 3C23A 4QZDA 5KFUA 3HX0A 1RYSA 1OU5A 5KG5A 3V7JA 4QZHA 2DRBA 8ICRA 2UVWA 4EBEA 4UAZA 7ICOA 2XCAA 3EWAA 4ECWA 3H8WA 4FHWA 4EYHB 5J0YA 1L5UA 5KT5A 1N48A 5HRDA 1S77D 3RJGA 4X4QA 4F2RA 4NLKA 5DQIA 3QZ8A 3HP6A 3Q8KA 2PI4A 4O5CA 7ICTA 1KNYA 3C66A 5HMMA 1PZNA 5J0WA 3M8SA 1SKSA 2BCRA 3EPIA 4M6WA 4B9VA 3V7KA 1RXWA 2ISOA 1WCLA 1NJXA 3SV4A 1QSSA 4M6WB 1Y88A 3C1YA 3UPSA 4RT2A 2NRTA 1N56A 2JZBA 1S0MA 3EW9A 4F4YA 3V6HA 1TK8A 1RXVA 2RFFA 4FH5A 3RH6A 4EEYA 3RR7A 4JUZA 5IIKA 3BQ2A 4ECSA 4QZ9A 4DSLA 1MSWD 7ICEA 4FHYA 3C2MA 1AROP 4FS2A 4NM1A 3OVBA 4QWDA 5CB1A 5D49A 5C5JA 5EWEA 4NLNA 4DOCA 3WFRE 7ICUA 4DFJA 2GWSA 1H38A 5KFHA 4ED7A 5KFPA 3ISDA 2AGQA 4F93B 8ICGA 1Z3EB 2J6SA 3H4BA 4F5NA 5J2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ1 A;  2ZH5 A;  8ICZ A;  1SL2 A;  2BKE A;  2BCS A;  3FYH A;  4DEZ A;  4MFC A;  3ZD8 A;  5KG2 A;  2XY5 A;  3RTV A;  1XWL A;  3SV3 A;  2HW3 A;  2NRW A;  1TAQ A;  4ECT A;  1LB2 B;  5HC9 A;  4IR9 A;  2UVV A;  4O0I A;  1ZQU A;  5KFG A;  2ID1 A;  1JXE A;  3SYZ A;  3RJK A;  1ZQM A;  2DR5 A;  4ED2 A;  4C8M A;  2JEJ A;  3H7I A;  2KTQ A;  4EBJ A;  5DG9 A;  5IIM A;  1UT5 A;  2W9B A;  3PO5 A;  3KTQ A;  9ICP A;  3RAX A;  1B43 A;  2AU0 A;  1ZQT A;  8ICX A;  3WFP A;  3M9N B;  2KFN A;  9ICR A;  5KFY A;  3HWT A;  4I27 A;  3ZDE A;  3TFS A;  1TKD A;  5J0U A;  1D8Y A;  4MF8 A;  4FHX A;  4JV1 A;  4X0A A;  1D9F A;  3PW4 A;  4DL6 A;  4M9J A;  1NOM A;  4QWB A;  2PFN A;  4I2G A;  4KLH A;  5HRG A;  2B21 A;  3HIY A;  3EZ5 A;  4KLI A;  9ICB A;  4B9L A;  4TUR A;  3TQ1 A;  1ZQL A;  2P6U A;  4RQ5 A;  2W9C B;  3HPO A;  3TAQ A;  3B0X A;  4ELT A;  1UA1 A;  5HRB A;  5KG3 A;  2PBE A;  4JK1 A;  4YP3 A;  8ICJ A;  4KN4 A;  3GV7 B;  1UET A;  4RQ3 A;  1R89 A;  5KFL A;  2FPL A;  4I2D A;  2FPK A;  3PR5 B;  3AQN A;  4IRC A;  1IXR A;  4IRK A;  5CP2 A;  3K75 D;  8ICW A;  4PGY A;  1DOQ A;  5DB9 A;  4YQW A;  3MGI A;  3V6K A;  4TUS A;  1R8B A;  8ICI A;  3UQ0 A;  2ATL A;  1XS9 D;  1QSL A;  4J9R A;  4DQP A;  3SI8 A;  1BPX A;  3RB0 A;  2KZ3 A;  4G3I A;  4RUA A;  3GII A;  3C5F A;  4YN4 A;  1KRP A;  4RQ8 A;  4F2S A;  5DG7 A;  2BPC A;  4X4N A;  7ICI A;  3RB4 A;  4YMN A;  4YG2 A;  3LWM A;  1NJW A;  3PR4 A;  4NLZ A;  4IQT A;  4TQR A;  1CEZ A;  1XU4 A;  3UXN A;  1HUZ A;  4M9L A;  5DLG A;  4BXO A;  1ZQP A;  4F5P A;  5KFI A;  4RQ7 A;  4RQ0 A;  7ICJ A;  1NKC A;  1BPY A;  1BPB A;  4XRH A;  2ASL A;  1TFR A;  5J2I A;  4KTQ A;  1MC8 A;  7ICM A;  1L3T A;  1JX4 A;  3KHG A;  4DQR A;  1T3N A;  8ICS A;  9ICV A;  5KT3 A;  4PGX A;  3G6Y A;  5KFC A;  2AQ0 A;  1WCN A;  4ECX A;  4DSE A;  5HP4 A;  4DOA A;  3PVX A;  3MAB A;  3MFI A;  4F5Q A;  1U47 A;  2ZH8 A;  4P4M A;  1JIH A;  8ICL A;  5BOL A;  5IIL A;  5DGA A;  2AQ4 A;  1Z00 A;  2R8I A;  4Q8E A;  5KT6 A;  2XC9 A;  3ZDA A;  4YXM A;  5KG4 A;  3OJU A;  3RRG A;  4ED6 A;  3QEB Z;  2RDI A;  4DWI A;  2ZH3 A;  5D46 A;  5KG0 A;  4R65 A;  4R64 A;  4DOB A;  3V6J A;  4X4S A;  4YMO A;  2DR8 A;  4DL3 A;  3FDS A;  1IM4 A;  3MR2 A;  4BGD A;  5D4B A;  4KLF A;  4DL2 A;  5J2C A;  2O5A A;  5BPC A;  4KLE A;  1ZQS A;  1XC9 A;  4AT7 B;  3EPG A;  2DPI A;  4WBZ A;  2KFZ A;  4ECR A;  2VAN A;  1A77 A;  5DDM A;  3LQC B;  3GDX A;  3N4M B;  2IHN A;  4M47 A;  1SKW A;  8ICE A;  2ISP A;  3WFO A;  1TAU A;  9ICG A;  5HR9 A;  2ZUB A;  9ICA A;  1Z00 B;  1ZQX A;  5HNK A;  4RNO A;  1VFG A;  1SZP A;  4X4R A;  4MEY A;  4PHA A;  2BR0 A;  1T8E A;  3JPT A;  2VA3 A;  4KLQ A;  4KLS A;  4KLT A;  1COO A;  7ICS A;  8ICB A;  2BQU A;  4WC7 A;  4F4Z A;  4X4T A;  3GIL A;  3HT3 A;  3SZ2 A;  9ICQ A;  3H8J A;  1ZQJ A;  7ICN A;  1S76 D;  2ZH6 A;  3GQC A;  5EOZ A;  4F4K A;  3PW0 A;  1NK7 A;  1NK0 A;  5J2H A;  4ECY A;  1XSN A;  4RQ2 A;  1QSY A;  4M9G A;  3BDP A;  2HHV A;  2KN7 A;  9ICL A;  1QLN A;  3RB3 A;  4O3O A;  1X9S A;  2XGQ A;  4C8N A;  4I2H A;  4RWN A;  4B9S A;  2NRV A;  4J9L A;  2AGO A;  4RQ4 A;  4XA5 A;  4QZG A;  4FO6 A;  5KFM A;  1ZQR A;  3G6X A;  4DSK A;  5HHH A;  4O3S A;  2KZZ A;  4X4P A;  8ICP A;  4FBU A;  7ICL A;  2XY6 A;  2DR7 A;  4KLO A;  2Y1J A;  1ZQA A;  2FMP A;  4UB5 A;  3ORY A;  3ISC A;  5KFX A;  5DED A;  1X2I A;  4Z6C A;  5J2F A;  1ZQN A;  1L3U A;  2ZUD A;  3MR3 A;  2JEG A;  1KEJ A;  3Q8L A;  9ICN A;  4DL5 A;  4RWO A;  4I2I A;  4J9M A;  4F5R A;  3NGD A;  5BOM A;  4YMM A;  3H39 A;  4R8U B;  1U49 A;  1BPD A;  4RPZ A;  1U4B A;  9ICJ A;  4GLX A;  2IMW P;  5EWG A;  3ZD9 A;  4FBT A;  4X4U A;  1XSL A;  2ZH7 A;  1DGS A;  4Z6F A;  8ICV A;  1U45 A;  3TI0 A;  1R8C A;  2H5X A;  3L9D A;  4B9N A;  4MF2 A;  4KLJ A;  4GC6 A;  2IA6 A;  4F3O A;  4QZA A;  3RJH A;  5DQG A;  2Q66 A;  4BWJ A;  4QZ8 A;  4M2Y A;  1S0V A;  3M8R A;  3HW8 A;  3ZDC A;  1TFW A;  3KHR A;  4RUC A;  1MIY A;  2J6T A;  5KT4 A;  1ZQK A;  4Z6E A;  9ICU A;  4J9S A;  3LK9 A;  1TVA A;  4I2E A;  4X0B A;  5KFE A;  9ICK A;  5KG6 A;  1NJY A;  1JN3 A;  2RDJ A;  4Q45 A;  3TFR A;  4FHV A;  4IR1 A;  4Z6D A;  3ZDD A;  4O9M A;  1R8A A;  5DBC A;  3Q8P B;  1K1S A;  5III A;  4UAY A;  4CCH A;  3BQT A;  5IIJ A;  2ALZ A;  5JUM A;  1JXL A;  2HHW A;  2ZH4 A;  4C8L A;  4WC3 A;  4YR0 A;  4P4P A;  3RJF A;  4FH3 A;  5J0S A;  3H38 A;  2MAX A;  5J2K A;  1ZYQ A;  2KZM A;  4UBC A;  4LZG A;  3H3A A;  4LT6 A;  2HVH A;  3H37 A;  3G6V A;  4EBD A;  2BPF A;  8ICT A;  2M2T A;  3T5L A;  3AU2 A;  5L9X A;  5KFD A;  2JZB B;  1TK0 A;  2BCQ A;  3BQ0 A;  3QZ7 A;  3GIJ A;  4M9H A;  1BVS A;  5HRK A;  5HRE A;  2ZJ8 A;  2HHS A;  3MDA A;  2BHN A;  1K1Q A;  1ZQB A;  4ECU A;  1B22 A;  4YR2 A;  4RNM A;  2F1I A;  5J2A A;  4PHE A;  5J0O A;  2W9B B;  2BDP A;  2AJQ A;  3IM1 A;  4YD2 A;  9ICX A;  3GFK B;  5KFZ A;  4O3Q A;  5J2D A;  2V4Q A;  4GXJ A;  2FLP A;  3RRH A;  4I28 A;  4Q8F A;  4M04 A;  8ICA A;  4WC4 A;  4TQS A;  4S3N A;  4XQ7 A;  1U9L A;  4QZF A;  4TUP A;  1HUO A;  3ETL A;  5F9L A;  4Q44 A;  4DO9 A;  1MQ2 A;  2FLN A;  2A1J A;  2ZTD A;  3MR5 A;  4FHP A;  4HYK A;  3HJ1 A;  4WC6 A;  1NK4 A;  4F50 A;  4R8U A;  3OVS A;  3BQ1 A;  3OV7 A;  3PML A;  3T5K A;  9ICT A;  5KFV A;  1F5A A;  2LYH A;  2ZTE A;  3AUO A;  2BCU A;  5HRF A;  4RPX A;  4YVZ A;  5KFK A;  3TAP A;  4GC7 A;  1BPZ A;  1ZQQ A;  1NKE A;  1ZQG A;  3C21 A;  1VJ7 A;  4EBK A;  5J29 A;  4NKU A;  4J9N A;  4PH5 A;  3UXO A;  1KFD A;  4DL4 A;  4J9K A;  1UA0 A;  4KLG A;  2ASD A;  4R63 A;  2ZJA A;  5F9N A;  4KN7 A;  4E8F A;  2ZH2 A;  3OGU A;  4DSJ A;  5KFA A;  4IQU A;  4PHP A;  9ICH A;  5HRH A;  3JYY A;  4B9U A;  5J0X A;  2WTF A;  4F4W A;  3QE9 Y;  4RWP A;  4XQ8 A;  3UPQ A;  1SKR A;  3B0Y A;  4ECZ A;  2ZTC A;  4UBB A;  1RPL A;  3RJJ A;  4E0D A;  3C5G A;  1NK6 A;  1WOT A;  5CJ7 A;  1X9W A;  3K4G A;  2O1P A;  4EYI B;  1MIW A;  7ICV A;  8ICQ A;  4UB3 A;  4RQ6 A;  3OJS A;  2MUT A;  3MDC A;  4ED1 A;  1S10 A;  2BE3 A;  2ASJ A;  4KIT B;  3HJ4 A;  1DK3 A;  4NM2 A;  2W9M A;  4IRD A;  2FLL A;  4AT8 A;  3GIK A;  4ED8 A;  1XSP A;  4IQV A;  1NO5 A;  2R8H A;  4ED0 A;  4X4O A;  4UAW A;  4BWM A;  5KFT A;  2NRZ A;  3H8S A;  4GXK A;  7ICR A;  1EXN A;  2F1J A;  2ZH1 A;  1YLQ A;  2C2E A;  4O5K A;  2ZUC A;  4X5V A;  3ISB A;  1ZJM A;  7ICH A;  3KHL A;  2XY7 A;  5IIO A;  4ATB B;  5KFW A;  2UVU A;  3OSN A;  3JZ0 A;  4ATB A;  4QWA A;  2OWO A;  2HVI A;  3MGH A;  2HHP A;  3AQL A;  1XO1 A;  2C28 A;  1T7P A;  3PY8 A;  4K4H A;  1V4A A;  3WFS C;  5J0P A;  1TFY A;  5J0R A;  4DQS A;  1CUK A;  1JMS A;  4KLL A;  2HHU A;  3OUY A;  2A1J B;  1UEV A;  4AT8 B;  2FMS A;  4NKT A;  4Q43 A;  2PFP A;  2PFQ A;  4DFM A;  3RH4 A;  5DLF A;  4DQI A;  2M9N A;  2ZHB A;  1BPE A;  1KTQ A;  1KLN A;  2C22 A;  2BGW A;  3V7L A;  2C2R A;  3OHB A;  3BJY A;  3PW2 A;  4RZR A;  3RR8 A;  4ELU A;  3RAQ A;  1KDH A;  5L1J A;  4NY8 A;  1C7Y A;  2ZJ5 A;  4QW8 A;  5CA7 A;  4M5D A;  5KFS A;  2FPM A;  5KFR A;  4RU9 A;  2P6R A;  3OSP A;  4RPY A;  4KMU A;  4O3P A;  3JPP A;  2JEF A;  4P2H A;  3C2L A;  1D9D A;  1TV9 A;  1PX5 A;  1ZQD A;  2NRK A;  2DPJ A;  1UT8 A;  5J2E A;  4F4X A;  4EZ9 A;  4EP7 A;  4DF4 A;  1BGX T;  1V9P A;  2DR9 A;  3C1Z A;  1U48 A;  1RZT A;  5DBA A;  2M2W A;  5CHG A;  5CWR A;  2UVR A;  2W8L A;  4EBC A;  3N97 B;  8ICU A;  3TAN A;  4K4G A;  1BNP A;  4DS4 A;  1L3V A;  4DSF A;  7ICG A;  3RBD A;  8ICC A;  3JPO A;  4F8R A;  3RJE A;  1ZET A;  4JV2 A;  4YD1 A;  4E80 A;  5KFB A;  4KLD A;  2HHT A;  5DB6 A;  1NK9 A;  4PPX A;  3Q8R B;  3AQK A;  1NZP A;  1NK5 A;  1KSP A;  1FA0 A;  4C8O A;  5HRI A;  4NLG A;  3T5H A;  1Q79 A;  3GIM A;  1ZQW A;  4MEX A;  4BDP A;  2PFO A;  4M9N A;  2XO7 A;  3OUY B;  2PXI A;  3JPQ A;  1T4G A;  3E2E A;  4QZB A;  1S9F A;  4I2A A;  1ZQF A;  4UQG A;  4DQQ A;  5KG1 A;  2BQ3 A;  1ZQE A;  5J0T A;  3ZDB A;  2KP7 A;  5KFN A;  5HRL A;  8ICN A;  4DS5 A;  3IHQ B;  1ZQI A;  2Y1I A;  4C8K A;  4JWN A;  3NTU A;  2NRX A;  3OHA A;  2W9C A;  4ED3 A;  1ZQC A;  3RH5 A;  9ICI A;  4RWQ A;  3NYB A;  1D8L A;  9ICC A;  3AU6 A;  5CR0 A;  4IQW A;  4XUS A;  4MFA A;  3H40 A;  3PW5 A;  3GV8 B;  4WC5 A;  3JPN A;  3LWL A;  3RBE A;  4YFK A;  5KFO A;  2V4R A;  3PO4 A;  3MBY A;  4LVS A;  4MFF A;  2VA2 A;  8ICK A;  4DF8 A;  4K4I A;  4FS1 A;  4X4V A;  5IIN A;  4B9M A;  5DGB A;  1BNO A;  3V72 A;  1L3S A;  4WC2 A;  1ZQZ A;  4I2F A;  4AT9 B;  1S97 A;  5KFQ A;  2Q0Z X;  4YR3 A;  5L1I A;  3PW7 A;  3THV A;  2BQR A;  1X9M A;  1TK5 A;  1ZQH A;  4I2J A;  4AT9 A;  3MFH A;  3PX6 A;  5KT7 A;  4YCX A;  3Q8S B;  5KTQ A;  1MQ3 A;  2DFL A;  4TUQ A;  4UD5 A;  2PI5 A;  2AGP A;  3PV8 A;  1SL0 A;  5HHI A;  9ICO A;  4QWC A;  3RB6 A;  4JWM A;  4RT3 A;  4UB2 A;  4QW9 A;  4WCW A;  1S0N A;  3RJI A;  2C2D A;  7ICF A;  3M9M B;  4PHD A;  3MR6 A;  1MIV A;  5TZV A;  2DRA A;  4EZ6 A;  2VA8 A;  2F1H A;  4QZE A;  2I1Q A;  3M9O B;  4O5E A;  8ICH A;  3OVA A;  4I29 A;  4DLG A;  3JPS A;  4JV0 A;  3PMN A;  4BXO B;  2R8G A;  4DLE A;  5L1K A;  4F92 B;  3PX0 A;  2IHM A;  4M0A A;  1KFS A;  5DQH A;  4F91 B;  5L1L A;  4P4O A;  4J9P A;  3GV5 B;  4WBY A;  5DG8 A;  3Q8Q B;  3H4D A;  7ICP A;  1DK2 A;  2R8J A;  7ICQ A;  4B9T A;  3Q8M A;  1ZJN A;  4AT7 A;  4I2C A;  2XCP A;  9ICW A;  5DEC A;  2HHX A;  5KG7 A;  4J9Q A;  3LDA A;  1QTM A;  9ICE A;  5DKW A;  4YXJ A;  4QZC A;  4KLU A;  5DBB A;  1SL1 A;  5EWF A;  8ICF A;  7ICK A;  2ZHA A;  3JPR A;  1RYR A;  4KLM A;  9ICS A;  5J2J A;  4DSI A;  2HHQ A;  4DFP A;  3KHH A;  2I9G A;  3AQM A;  4R66 A;  5J0Q A;  4DL7 A;  5DDY A;  4UB1 A;  2IBK A;  4ELV A;  1Q78 A;  4QZI A;  1NKB A;  5KFJ A;  1ZQO A;  1JAJ A;  5F2V O;  4ZH4 A;  8ICM A;  4DFK A;  2DVI A;  3C2K A;  4O3N A;  4F5O A;  5KFF A;  2BCV A;  2XGP A;  4NXZ A;  2J6U A;  2P66 A;  3WFQ E;  5DB8 A;  4O3R A;  4WC0 A;  4IG8 A;  1LV5 A;  1NK8 A;  3PNC A;  4J9O A;  5DB7 A;  2JEI A;  9ICF A;  4ECQ A;  2BPG A;  4WC1 A;  1HJP A;  3EYZ A;  4ECV A;  1ZQV A;  2R8K A;  8ICO A;  3T5J A;  1JQR A;  5KT2 A;  2M2V A;  1ZQY A;  3TAR A;  4UD4 A;  4E7X A;  2ZH9 A;  4UB4 A;  2V9W A;  2MUT B;  5HML A;  2M2U A;  1UEU A;  8ICY A;  3UQ2 A;  2FMQ A;  2W9A A;  4QWE A;  3PX4 A;  4GXI A;  1A76 A;  3UXP A;  1NJZ A;  3T3F A;  5J2B A;  3QEA Z;  4I2B A;  9ICM A;  4RNN A;  1S0O A;  1KFT A;  4LZD A;  4PGQ A;  3C18 A;  2W8K A;  3C23 A;  4QZD A;  5KFU A;  3HX0 A;  1RYS A;  1OU5 A;  5KG5 A;  3V7J A;  4QZH A;  2DRB A;  8ICR A;  2UVW A;  4EBE A;  4UAZ A;  7ICO A;  2XCA A;  3EWA A;  4ECW A;  3H8W A;  4FHW A;  4EYH B;  5J0Y A;  1L5U A;  5KT5 A;  1N48 A;  5HRD A;  1S77 D;  3RJG A;  4X4Q A;  4F2R A;  4NLK A;  5DQI A;  3QZ8 A;  3HP6 A;  3Q8K A;  2PI4 A;  4O5C A;  7ICT A;  1KNY A;  3C66 A;  5HMM A;  1PZN A;  5J0W A;  3M8S A;  1SKS A;  2BCR A;  3EPI A;  4M6W A;  4B9V A;  3V7K A;  1RXW A;  2ISO A;  1WCL A;  1NJX A;  3SV4 A;  1QSS A;  4M6W B;  1Y88 A;  3C1Y A;  3UPS A;  4RT2 A;  2NRT A;  1N56 A;  2JZB A;  1S0M A;  3EW9 A;  4F4Y A;  3V6H A;  1TK8 A;  1RXV A;  2RFF A;  4FH5 A;  3RH6 A;  4EEY A;  3RR7 A;  4JUZ A;  5IIK A;  3BQ2 A;  4ECS A;  4QZ9 A;  4DSL A;  1MSW D;  7ICE A;  4FHY A;  3C2M A;  1ARO P;  4FS2 A;  4NM1 A;  3OVB A;  4QWD A;  5CB1 A;  5D49 A;  5C5J A;  5EWE A;  4NLN A;  4DOC A;  3WFR E;  7ICU A;  4DFJ A;  2GWS A;  1H38 A;  5KFH A;  4ED7 A;  5KFP A;  3ISD A;  2AGQ A;  4F93 B;  8ICG A;  1Z3E B;  2J6S A;  3H4B A;  4F5N A;  5J2G A; 
#chains in the Genus database with same CATH topology
 8ICZ A;  2BKE A;  1N62 A;  4MFC A;  1SZH A;  3RTV A;  2EAM A;  1WYG A;  5AHX A;  1X66 A;  2DR5 A;  3RJK A;  1ZQM A;  3F53 A;  2HOI A;  4EBJ A;  3WK6 A;  1B43 A;  2AXT U;  3HWT A;  4LEV A;  1FFU A;  5J0U A;  4MF8 A;  4FHX A;  3PW4 A;  4DL6 A;  4QWB A;  2PFN A;  2JH7 A;  2WF7 A;  4KLH A;  4TUR A;  3HPO A;  5KG3 A;  4JK1 A;  1UET A;  3GV7 B;  1R89 A;  3AQN A;  2QB1 A;  4CF3 A;  3K75 D;  5DB9 A;  5JTG A;  3RB0 A;  3DEE A;  4B6J A;  4UW9 A;  2G5I B;  2QLT A;  7ICI A;  3KKA A;  4NLZ A;  4C80 A;  2ZG6 A;  3UXN A;  4M9L A;  4F5P A;  1YZ7 A;  7ICJ A;  4F72 A;  1T3N A;  9ICV A;  1YZ6 A;  4DSE A;  5HP4 A;  1ZD5 A;  3MAB A;  4WOY A;  2Y9U A;  3NRZ A;  1JIH A;  4Q8E A;  2RDI A;  5D46 A;  3CW2 C;  5KG0 A;  4R64 A;  4DOB A;  3MR2 A;  3WKE A;  1LKY B;  1ZQS A;  2PMZ C;  2OEH A;  1A77 A;  5ALT A;  3GDX A;  3N4M B;  3JCF A;  1SKW A;  1Z00 B;  5HNK A;  3F2B A;  4MEY A;  9ICE A;  3LYS A;  1COO A;  8ICB A;  2BQU A;  2E8M A;  3UMB A;  3GIL A;  3HT3 A;  2EAO A;  2KHQ A;  3PW0 A;  1NK7 A;  1QSY A;  4M9G A;  1RG6 A;  3BDP A;  1QQ5 A;  4I2H A;  2NRV A;  4J9L A;  2ES6 A;  4EEK A;  5KFM A;  1ZQR A;  3G6X A;  4DSK A;  2F2A B;  3I28 A;  4LEZ A;  3MGV A;  2XY6 A;  4KLO A;  1LVH A;  3PHZ A;  2CPR A;  1KN5 A;  3ORY A;  2VIX A;  5KFX A;  2WF5 A;  2WB1 F;  2ZUD A;  3MR3 A;  2JEG A;  4WJ3 B;  1C20 A;  4P0Q A;  4I2I A;  3NGD A;  3M6Z A;  1U4B A;  3WKD A;  3ZD9 A;  2GOL A;  2YMQ A;  8ICV A;  4QIW C;  3IRU A;  4U7C A;  2H5X A;  3WK5 A;  3ER8 C;  4MF2 A;  4GC6 A;  4F3O A;  4QZA A;  2Q66 A;  3E0F A;  2EZY A;  4BWJ A;  4QZ8 A;  1S0V A;  3M8R A;  2KVC A;  2JMG A;  1QCK A;  4CNQ A;  1B0X A;  1Z4O A;  3SEN A;  4J9S A;  4X0B A;  3H0M B;  9ICK A;  2DWQ A;  5KG6 A;  3AL0 B;  1X6J A;  5AM4 A;  5DBC A;  4OJL A;  5ALQ A;  4CCH A;  1JXL A;  2HHW A;  3U26 A;  1ZD2 P;  2ZH4 A;  3RJF A;  5J0S A;  4OO1 J;  2WHE A;  4MHV A;  2KZM A;  4UBC A;  4EV6 A;  3NRW A;  1L7N A;  5KFD A;  2JZB B;  2YY6 A;  1TK0 A;  3BQ0 A;  3QZ7 A;  3GIJ A;  5HRK A;  3RFA A;  5HRE A;  3MDA A;  1ZQB A;  4RNM A;  2F1I A;  5AKG A;  2A1A A;  2ZIX A;  5KFZ A;  1QH9 A;  2FI1 A;  8ICA A;  5FP0 A;  3QUT A;  5ALW A;  1U9L A;  4TUP A;  1HUO A;  3ETL A;  2ZIU B;  2A1J A;  2ZTD A;  1XNS A;  4O68 A;  1QQ7 A;  3OV7 A;  3T5K A;  9ICT A;  2BCU A;  5HRF A;  3TAP A;  5E79 U;  4GC7 A;  1BPZ A;  1VJ7 A;  2A19 A;  4NKU A;  4J9N A;  4PH5 A;  3F2C A;  1IIP A;  4J9K A;  4Y2J A;  2ZH2 A;  1O08 A;  5AM5 A;  3OGU A;  4PHP A;  3JYY A;  5J0X A;  2WTF A;  1L7M A;  2JH1 A;  5CFS A;  1SKR A;  4ECZ A;  4UBB A;  3RJJ A;  5CJ7 A;  1X9W A;  3LVW A;  1S10 A;  3E58 A;  4NXW A;  4NM2 A;  2W9M A;  4RQM A;  4IQV A;  1NNL A;  2DL0 A;  1YLQ A;  2C2E A;  1T94 A;  2EAP A;  3ISB A;  2XY7 A;  4EX6 A;  2W54 A;  5KFW A;  3SAF A;  3OSN A;  4ATB A;  1L8O A;  2D3D A;  2OWO A;  4K4H A;  4CF4 A;  4EEB A;  2FE9 A;  4DCC A;  4Q43 A;  4DFM A;  2D8C A;  1KLN A;  2C22 A;  3OHB A;  3PW2 A;  1B4F A;  4XJE A;  4P0P B;  1D8B A;  3A0H U;  3QU4 A;  5KFR A;  4P2H A;  1PK1 A;  2YB1 A;  1UT8 A;  4EZ9 A;  1RDF A;  4BUG A;  1V9P A;  2ZIV B;  5DBA A;  5CHG A;  5CWR A;  2UVR A;  2W8L A;  4EBC A;  3AMZ A;  4DS4 A;  1L3V A;  7ICG A;  1V97 A;  4F8R A;  4YD1 A;  3SEI A;  5KFB A;  3HRD D;  2IOH A;  2IHO A;  1KSP A;  1M6Y A;  3ETR A;  4NLG A;  2KNJ A;  3OPX A;  3WK8 A;  3T5H A;  3GIM A;  2PFO A;  2HN2 A;  4QZB A;  2W04 A;  4UQG A;  4DQQ A;  2KIC A;  3IDW A;  1ZQI A;  4C8K A;  4JLX A;  2W9C A;  1ZQC A;  3RH5 A;  2KK0 A;  4RWQ A;  3AU6 A;  4UAV A;  4MFA A;  4OJ6 A;  2BBJ A;  3JPN A;  3LWL A;  3NWI A;  4MFF A;  2VA2 A;  2AH5 A;  4K4I A;  4X4V A;  4B9M A;  2Q0Z X;  3THV A;  2V9W A;  5L1I A;  3MFH A;  1F5S A;  4LJX A;  4A8E A;  3Q8S B;  4TUQ A;  4UD5 A;  2PI5 A;  4WQK A;  4UB2 A;  4QW9 A;  3BZC A;  3M9M B;  1MIV A;  2ESE A;  4BXO B;  2WB1 C;  5ALD A;  4EED A;  3KKA C;  2BBH A;  4P4O A;  1X40 A;  5DG8 A;  3Q8Q B;  1JRP A;  7ICP A;  2W3R A;  4B9T A;  1SIJ A;  2HHX A;  5AKL A;  5DKW A;  5DBB A;  5EWF A;  3C28 A;  1RYR A;  4KLM A;  3N28 A;  4UB8 U;  3KBB A;  4C7Z A;  2KV2 A;  1JAJ A;  2G08 A;  4DFK A;  2P66 A;  4O3R A;  2JEI A;  2LMR A;  3EYZ A;  1ZQV A;  2H3Q A;  8ICO A;  3T5J A;  2M2V A;  4UB4 A;  3UQ2 A;  4QWE A;  3PX4 A;  3T3F A;  5J2B A;  1KFT A;  3HX0 A;  1FEZ A;  5KG5 A;  3V7J A;  4QZH A;  2HN1 A;  8ICR A;  7ICO A;  2G07 A;  4UAZ A;  4FHW A;  3SD7 A;  3RJG A;  3HJE A;  2BDU A;  1PUZ A;  3QZ8 A;  2LHT A;  4O5C A;  3OTQ A;  5F3X B;  7ICT A;  2OHF A;  1SKS A;  3EPI A;  4M6W A;  3V7K A;  4EEN A;  1Y88 A;  4GIB A;  3BZK A;  4IS7 A;  1GPJ A;  3NYB A;  2JZB A;  4FH5 A;  3RR7 A;  4JUZ A;  2H3I A;  4DSL A;  3C2M A;  1ARO P;  4NM1 A;  3ONN A;  1Q3U A;  5CB1 A;  5C5J A;  7ICU A;  3L3F X;  4ED7 A;  8ICG A;  1Z3E B;  5ALJ A;  3KD3 A;  2OM6 A;  3S6J A;  2PKE A;  4C4S A;  3QU5 A;  1TAQ A;  5AM2 A;  2UVV A;  4O0I A;  1ZRN A;  1ZXI A;  2KTQ A;  1UT5 A;  3PO5 A;  9ICP A;  2AU0 A;  2FCL A;  8ICX A;  3WFP A;  2KIW A;  2EH9 A;  2KFN A;  9ICR A;  4NXU A;  3ZDE A;  3TFS A;  1TKD A;  4JV1 A;  2Y0S C;  1D9F A;  2B21 A;  3EZ5 A;  5D62 A;  1ZQL A;  4RQ5 A;  2W9C B;  4KB6 A;  2PBE A;  5HRB A;  1YT3 A;  3EF2 A;  4KX5 A;  1MN8 A;  4YP3 A;  1PVQ A;  4RQ3 A;  2DGZ A;  4Y2X A;  4PZO A;  2FPL A;  3PR5 B;  2R18 A;  4Y2S A;  1IG6 A;  1DOQ A;  3MGI A;  8ICI A;  5ALI A;  1QSL A;  4J9R A;  1RQN A;  4YN4 A;  5DG7 A;  5G5H A;  2OH2 A;  1Z1B A;  5AKX A;  1CI4 A;  1CEZ A;  4K96 A;  4RQN A;  4Y2T A;  4BXO A;  3B9J A;  5KFI A;  4RQ7 A;  5HR7 A;  2F77 X;  1NKC A;  1BPY A;  5J2I A;  1MC8 A;  1LKY A;  1L3T A;  1JX4 A;  1HEK A;  8ICS A;  3G6Y A;  4PGX A;  4ECX A;  5KFC A;  2LPE A;  3PVX A;  1U47 A;  2LYB A;  8ICL A;  5BOL A;  1Z00 A;  2XC9 A;  4YXM A;  5KG4 A;  3DDH A;  4Y2Y A;  3QEB Z;  5G5G A;  4X4S A;  3FDS A;  4DL2 A;  2O5A A;  2DPI A;  4WBZ A;  5DDM A;  3LQC B;  2IHN A;  2ISP A;  3WFO A;  9ICA A;  1VFG A;  4HAI A;  4JLZ A;  2K4H A;  4PHA A;  1K5O A;  3JPT A;  5ALG A;  5AM1 A;  4X4T A;  2WFA A;  4FE3 A;  3SZ2 A;  3H8J A;  1ZQJ A;  2ZH6 A;  5EOZ A;  5AKK A;  1NK0 A;  2HHV A;  1R8C A;  1XSN A;  3IG8 A;  1OUQ A;  1A6S A;  2VJ5 A;  4RWN A;  4RQ4 A;  2EDU A;  2W11 A;  2BZF A;  1SV4 A;  1X6I A;  4O3S A;  4FBU A;  2YMM A;  2FDR A;  2DR7 A;  1ZQA A;  2YTU A;  4UB5 A;  3TKA A;  2ZIW A;  1ZQN A;  5JRT A;  4DL5 A;  5BOM A;  3H39 A;  3BS5 B;  1U49 A;  4RPZ A;  2IMW P;  2WF6 A;  5ALR A;  1QQ6 A;  4Z6F A;  3TI0 A;  5C0Y A;  3L9D A;  2IA6 A;  3HW8 A;  3NS1 A;  3WKB A;  4RUC A;  1TVA A;  4I2E A;  2F8L A;  2EQY A;  4O9M A;  1R8A A;  1K1S A;  5III A;  2B56 A;  2ALZ A;  4C8L A;  1Q8K A;  3SQI A;  2MAX A;  5J2K A;  1ZYQ A;  3H3A A;  4LT6 A;  2HVH A;  3G6V A;  3BS7 A;  2BPF A;  4NL9 A;  2H3F A;  3QU2 A;  2XID A;  1RM6 C;  2BHN A;  1K1Q A;  3TAD C;  4WH5 A;  3KOO A;  2BDP A;  4YD2 A;  3GFK B;  4GXJ A;  5J2D A;  4I28 A;  1SWV A;  2WF8 A;  3RRH A;  4WC4 A;  4S3N A;  2KVS A;  3I1Y A;  3GZF A;  5F9L A;  3RF9 A;  4FHP A;  1NK4 A;  4R8U A;  3OVS A;  2OCE A;  1F5A A;  2LYH A;  5KFK A;  4HX0 A;  2RLT A;  1NKE A;  1SB3 C;  4UAS A;  2ZJA A;  4E8F A;  4KN7 A;  9ICH A;  4F4W A;  3QE9 Y;  4XQ8 A;  3N7P D;  1WOT A;  4ACO A;  2O1P A;  1MIW A;  1VLB A;  8ICQ A;  4ED1 A;  3KFU F;  3ALR A;  2ASJ A;  3HIL A;  4NL9 C;  3HJ4 A;  1DK3 A;  2YQE A;  5AKZ A;  4ED8 A;  1JI7 A;  2R8H A;  4ED0 A;  4X4O A;  4NLC A;  4UAW A;  5KFT A;  2LI6 A;  4GXK A;  2KJ5 A;  2ZH1 A;  4UB6 U;  4O5K A;  3KHL A;  4ATB B;  5IIO A;  3O0F A;  2NO5 A;  2HHP A;  3AQL A;  2C28 A;  1T7P A;  3PY8 A;  1TFY A;  1JMS A;  2B0C A;  3OUY A;  1UEV A;  4NKT A;  2NO4 A;  1SXD A;  2PFQ A;  2ZHB A;  3H0R B;  1BPE A;  3RR8 A;  4ELU A;  2WF9 A;  4RZR A;  3RAQ A;  5L1J A;  1C7Y A;  4K99 A;  4M5D A;  5KFS A;  2FPM A;  2P6R A;  2H3Z A;  3OSP A;  4KMU A;  4O3P A;  1T3Q A;  3OWG A;  5J2E A;  4O69 A;  4EP7 A;  2DR9 A;  3C1Z A;  2M2W A;  1URJ A;  3PSI A;  3NKU A;  1UQV A;  3JPO A;  5KL8 B;  3AQE A;  1ZET A;  4E80 A;  4KLD A;  1NK9 A;  3AQK A;  1FA0 A;  5J8Y C;  1IV8 A;  2XO7 A;  2PXI A;  4I2A A;  1S9F A;  2ODG A;  1Z4N A;  5KG1 A;  1ZQE A;  5J0T A;  5HRL A;  1FIQ A;  2Y1I A;  4JWN A;  3OHA A;  2AHO B;  3PST A;  9ICC A;  4XUS A;  3H40 A;  3PW5 A;  2F8K A;  5KFO A;  1ZQZ A;  4I2F A;  2DF4 B;  2F3N A;  2BQR A;  1ZQH A;  4I2J A;  3PX6 A;  5KT7 A;  5B3P A;  1RQL A;  1MQ3 A;  2DFL A;  2AGP A;  1CRX A;  3RB6 A;  1S0N A;  3RJI A;  2C2D A;  4PHD A;  3MR6 A;  5TZV A;  3C29 A;  4QZE A;  4I29 A;  3PMN A;  3K7D A;  2DUY A;  4DLE A;  1AQ6 A;  2L5Y A;  5DQH A;  4F91 B;  5L1L A;  4J9P A;  3GV5 B;  3H4D A;  3K1Z A;  1DK2 A;  4DFD A;  2R8J A;  2M0N A;  1ZJN A;  9ICW A;  5DEC A;  1TE2 A;  5KG7 A;  2QKQ A;  4KLU A;  4YXJ A;  4Y2R A;  2K4I A;  1SL1 A;  2ZHA A;  4OJ5 A;  2HHQ A;  3FM9 A;  2N1R A;  3KHH A;  3VC8 A;  1V38 A;  2W55 A;  4UB1 A;  1N5X A;  4O3N A;  4F5O A;  2J6U A;  5DB8 A;  4WC0 A;  4IG8 A;  4BX9 C;  2K8A A;  3ICX A;  4UD4 A;  5KT2 A;  1ZQY A;  3TAR A;  4ICA A;  5HML A;  2FMQ A;  2HOF A;  2D6F C;  1NJZ A;  3QEA Z;  1FFV A;  4LZD A;  2W8K A;  5AKJ A;  3C23 A;  1MA7 A;  1OU5 A;  3NVW A;  2JRZ A;  2XCA A;  1Z19 A;  1NZB A;  3NVZ A;  4EYH B;  5J0Y A;  3IV6 A;  2G09 A;  4F2R A;  4NLK A;  5DQI A;  2K8B B;  3Q8K A;  5HMM A;  5ALK A;  5J0W A;  3M8S A;  2ISO A;  2HBJ A;  1NJX A;  3SV4 A;  1QSS A;  1PVR A;  3C1Y A;  1N56 A;  4K9A A;  3EW9 A;  3UMC A;  1TK8 A;  1RXV A;  4ECS A;  4O6A A;  4FHY A;  5D49 A;  4G9B A;  2GWS A;  5KFP A;  2AGQ A;  3QNM A;  2HHS A;  4F5N A;  4RQ1 A;  2ZH5 A;  1SL2 A;  2HDO A;  5KG2 A;  5ALL A;  1XWL A;  1L8L A;  2HW3 A;  4EEL A;  2KD1 A;  5KNI A;  4ECT A;  2ID1 A;  4AP9 A;  3SYZ A;  3NVO A;  4C8M A;  3H7I A;  1N61 A;  1P7D A;  5DG9 A;  5IIM A;  3RAX A;  1ZQT A;  3M9N B;  3AN1 A;  5AI0 A;  1D8Y A;  4O67 A;  1FO4 A;  4X0A A;  3EUB 2;  4M9J A;  3AQF A;  2MRL A;  3HIY A;  4KMO B;  2P6U A;  4OAF A;  3TAQ A;  4ELT A;  8ICJ A;  4KN4 A;  5EE0 A;  2FPK A;  5AI8 A;  5EE9 A;  5CP2 A;  4OJO A;  4YQW A;  1R8B A;  3H0L B;  3UQ0 A;  2ATL A;  1XS9 D;  3SI8 A;  1BPX A;  4IL6 U;  1L7P A;  2ZXI A;  1S8O A;  2MA1 A;  5B66 U;  3KZI U;  1KRP A;  1WWV A;  4YMN A;  4K97 A;  4YG2 A;  3LWM A;  4TQR A;  1XU4 A;  1HUZ A;  4PL1 A;  1ZQP A;  4XRH A;  1TFR A;  2ZIV A;  4KTQ A;  4DQR A;  4C4T A;  4P0Q B;  5KT3 A;  1ED1 A;  4N7R A;  3MFI A;  4F5Q A;  4K98 A;  2ZH8 A;  5IIL A;  2Z7J A;  3ZDA A;  3RRG A;  4ED6 A;  4CGZ A;  1KQQ A;  2ZH3 A;  2KJ8 A;  2YX8 A;  1ECW A;  3V6J A;  2YB4 A;  2DR8 A;  5D4B A;  4KLF A;  3D2N A;  5KAF U;  4KLE A;  3DV9 A;  4ECR A;  2OYY A;  2VAN A;  1JUD A;  8ICE A;  1TAU A;  9ICG A;  2XI9 A;  5T14 A;  2W3S A;  1SZP A;  4X4R A;  2W7O A;  1T8E A;  2VA3 A;  2GLE A;  4WC7 A;  1O03 A;  7ICN A;  8ICK A;  5J2H A;  4RQ2 A;  9ICL A;  1N63 A;  4C8N A;  5CFU A;  2K8C B;  5HR6 A;  4NXT A;  2AGO A;  4XA5 A;  2XIC A;  1XO0 A;  2KZZ A;  7ICL A;  2Y1J A;  2FMP A;  3ISC A;  4Z6C A;  5J2F A;  1GO3 F;  1KEJ A;  3Q8L A;  9ICN A;  4J9M A;  4F5R A;  4YMM A;  4FBT A;  4X4U A;  1XSL A;  2KIV A;  2ZH7 A;  1DGS A;  2JHD A;  1PVP A;  1U45 A;  4B9N A;  4KLJ A;  5AM3 A;  5DQG A;  1RYU A;  1TFW A;  1JAL A;  4M2Y A;  2I6X A;  4C4R A;  5KT4 A;  1ZQK A;  1X42 A;  4Z6E A;  2KKV A;  9ICU A;  4UAU A;  4Y2V A;  3LK9 A;  1KW4 A;  1JN3 A;  2RHF A;  4FHV A;  3BQ7 A;  4UAR A;  3Q8P B;  3BQT A;  5IIJ A;  5JUM A;  3MCR A;  5D63 A;  3QYP A;  3AM9 A;  4ZOH C;  3H38 A;  1KKX A;  4LZG A;  3H37 A;  8ICT A;  2M2T A;  3T5L A;  1BVS A;  5AK5 A;  2ZJ8 A;  4ECU A;  4YR2 A;  5CHE A;  5JU5 A;  5J0O A;  2W9B B;  3M1Y A;  4FFD A;  4Q8F A;  1Z1V A;  4CRX A;  4TQS A;  3F2D A;  2O6K A;  4QZF A;  2FLN A;  1MQ2 A;  2JV3 A;  3MR5 A;  4QIW F;  4HYK A;  4WQL A;  4WC6 A;  4CF5 A;  3BQ1 A;  2LM1 A;  5KFV A;  2VJ4 A;  5B5E U;  1SV0 A;  1J2M A;  5AM0 A;  3C21 A;  4EBK A;  5J29 A;  5AI9 A;  1KFD A;  1UA0 A;  4KLG A;  2ASD A;  4R63 A;  1OW5 A;  5F9N A;  4DSJ A;  4IQU A;  4EGW A;  3IP4 B;  2P35 A;  2GH1 A;  4B9U A;  4RWP A;  2KOB A;  2NYV A;  3B0Y A;  2ZTC A;  1RPL A;  3FAH A;  4E0D A;  1N5W A;  1NK6 A;  1Q46 A;  2H3V A;  4EYI B;  7ICV A;  2GA9 D;  4UB3 A;  4RQ6 A;  3OJS A;  3MDC A;  3QUQ A;  1PK1 B;  4KX3 A;  4IRD A;  2FLL A;  1XSP A;  2NV3 A;  1EXN A;  3NUQ A;  1SGG A;  1PK3 A;  7ICH A;  3JZ0 A;  5B3Q A;  3WFS C;  4DQS A;  1CUK A;  4IC9 A;  2HHU A;  2A1J B;  4AT8 B;  1DGJ A;  2PFP A;  3RH4 A;  5DLF A;  1KTQ A;  2BGW A;  1ZRM A;  3V7L A;  4NY8 A;  3CYM A;  5CA7 A;  4RU9 A;  4RPY A;  3C2L A;  4C7Y A;  5L1M A;  1PX5 A;  2GAF D;  1RZT A;  1U48 A;  3KZX A;  8ICU A;  3F5E A;  1BNP A;  2K89 A;  4K4G A;  4OAH A;  4DSF A;  2HI0 A;  3RBD A;  4NV0 A;  1A0P A;  2HHT A;  4OD0 A;  5DB6 A;  4PPX A;  1NK5 A;  4K9B A;  4C8O A;  1Q79 A;  1ZQW A;  4MEX A;  3J81 j;  4M9N A;  3JPQ A;  1T4G A;  3E2E A;  3L4P A;  4LEY A;  1ZQF A;  3ZDB A;  2KP7 A;  8ICN A;  4DS5 A;  3IHQ B;  5ALN A;  1F44 A;  1D8L A;  1J2N A;  4OAG A;  2A3V A;  3ER9 B;  4IQW A;  4FZN A;  3GV8 B;  4WC5 A;  3RBE A;  4LVS A;  3TAC B;  2V4R A;  2HSZ A;  4FO1 A;  3NVY A;  4FS1 A;  1BNO A;  5ALO A;  5DGB A;  1L3S A;  5ALV A;  2W43 A;  5CEH A;  1X9M A;  2CRX A;  4AT9 A;  3FC4 A;  3SAG A;  1UHU A;  1ZOL A;  3CK6 A;  3PV8 A;  1SL0 A;  5HHI A;  1VJ5 A;  4RT3 A;  4J03 A;  2VA8 A;  2YML A;  5AKI A;  3OVA A;  3JPS A;  5J8Y A;  2KE7 A;  2G5H B;  5L1K A;  4M0A A;  3WU2 U;  3ZI4 A;  3T79 A;  5AI6 A;  7ICQ A;  4I2C A;  2XCP A;  3LDA A;  1QTM A;  4C0Z A;  3SMV A;  2EWR A;  3JPR A;  9ICS A;  4FZM A;  2E5S A;  4DSI A;  4USA A;  3AQM A;  1V85 A;  4DL7 A;  5J0Q A;  2LYA A;  2IBK A;  4K8V A;  1Q78 A;  5KFJ A;  1ZQO A;  5F2V O;  4ZH4 A;  3CRX A;  8ICM A;  2DVI A;  3QU9 A;  3ED5 A;  4NXZ A;  2XGP A;  5ALY A;  4US8 A;  3PNC A;  9ICF A;  2BPG A;  5CRX A;  3NVV A;  4ECV A;  5ALH A;  4E7X A;  2ZH9 A;  1UEU A;  8ICY A;  5CFT A;  4GXI A;  1A76 A;  3UXP A;  4I2B A;  9ICM A;  2KSO B;  3C18 A;  5KFU A;  1RYS A;  2DRB A;  2UVW A;  4EBE A;  3EWA A;  3H8W A;  1S5L U;  4X4Q A;  2ZIX B;  2I5H A;  3HP6 A;  3I76 A;  3C66 A;  4NXX A;  2E1F A;  3TAD A;  3R9K A;  1WCL A;  1KBU A;  4RT2 A;  2NRT A;  5AKE A;  1S0M A;  2KMD A;  2B6G A;  4O3M A;  5IIK A;  3OVB A;  3M7D A;  5ALF A;  4QWD A;  4DOC A;  3WFR E;  4DFJ A;  1H38 A;  1SWW A;  5KFH A;  3ISD A;  4F93 B;  2BCR A;  2W03 A;  2J6S A;  3WK7 A;  2GO7 A;  1V4A A;  3V6H A;  5J2G A;  2BCS A;  3FYH A;  4DEZ A;  3ZD8 A;  2XY5 A;  2KJ9 A;  3SV3 A;  2NRW A;  1LB2 B;  5KL1 B;  5HC9 A;  4IR9 A;  1ZQU A;  5KFG A;  1JXE A;  3H8M A;  4ED2 A;  2IOF A;  2JEJ A;  2F44 A;  2W9B A;  3KTQ A;  1Q3V A;  2E1E A;  1DRG A;  5KFY A;  4I27 A;  1N60 A;  2RP5 A;  4NXV A;  1NOM A;  4I2G A;  2EZZ A;  2K4E A;  5HRG A;  4EX7 A;  4KLI A;  9ICB A;  4B9L A;  3TQ1 A;  3AEV A;  2RRD A;  5AK3 A;  3B0X A;  1UA1 A;  4BJQ A;  4OAI Z;  5KFL A;  4I2D A;  4IRC A;  1IXR A;  4IRK A;  8ICW A;  4PGY A;  3V6K A;  4TUS A;  2W7P A;  2CN1 A;  4AYB F;  4DQP A;  2KZ3 A;  1L7O A;  3CP8 A;  4G3I A;  4RUA A;  3GII A;  4P0P A;  4OJP A;  3C5F A;  2LM4 A;  2QAR B;  4RQ8 A;  5ALM A;  2BPC A;  4F2S A;  4X4N A;  3RB4 A;  1NJW A;  3PR4 A;  4IQT A;  4QJF B;  5A0L A;  5DLG A;  1WWU A;  4RQ0 A;  1BPB A;  2ASL A;  2B4V A;  7ICM A;  3KHG A;  2HCF A;  3D6J A;  2AQ0 A;  1WCN A;  4DOA A;  4P4M A;  3IG5 A;  5AIA A;  2AQ4 A;  5DGA A;  3QUB A;  2R8I A;  5KT6 A;  3WK4 A;  5EE1 A;  3QU7 A;  3OJU A;  4DWI A;  4R65 A;  2ZIW B;  3QX7 A;  4YMO A;  4DL3 A;  1IM4 A;  4BGD A;  3F5A A;  5AK6 A;  5J2C A;  5BPC A;  1XC9 A;  4AT7 B;  1NI3 A;  3EPG A;  2KFZ A;  5GTI U;  4M47 A;  5HR9 A;  2ZUB A;  2KHV A;  1ZQX A;  4RNO A;  1F0M A;  3NAS A;  2BR0 A;  4KLQ A;  4KLT A;  4KLS A;  7ICS A;  4F4Z A;  2KEY A;  9ICQ A;  1S76 D;  3GQC A;  4F4K A;  9ICO A;  3D2S A;  4ECY A;  2KN7 A;  1QLN A;  3RB3 A;  4O3O A;  1X9S A;  2XGQ A;  4I0U A;  4B9S A;  2WAQ C;  5D61 A;  4QZG A;  4FO6 A;  5HHH A;  4X4P A;  8ICP A;  2HBL A;  5DED A;  1X2I A;  3GU3 A;  4Y2P A;  3PSP A;  1L3U A;  4RWO A;  4R8U B;  1BPD A;  9ICJ A;  4GLX A;  2F76 X;  2YMP A;  5EWG A;  4US9 A;  2KKP A;  2DKZ A;  3RJH A;  4GFJ A;  3ZDC A;  3KHR A;  1MIY A;  2J6T A;  2ZXH A;  2DKX A;  4PZN A;  3L5K A;  5KFE A;  1NJY A;  2RDJ A;  4NLB A;  4Q45 A;  3TFR A;  4IR1 A;  4Z6D A;  4CDG A;  3ZDD A;  3M6K A;  4UAY A;  5ALE A;  1JRO A;  4WC3 A;  4YR0 A;  4P4P A;  4FH3 A;  2E8O A;  1ZD4 A;  4EBD A;  3AU2 A;  5L9X A;  2BCQ A;  2DBY A;  5AKH A;  4M9H A;  5H2F U;  1WG8 A;  2CXY A;  1B22 A;  5J2A A;  3SAH A;  4PHE A;  2AJQ A;  3IM1 A;  9ICX A;  4O3Q A;  2V4Q A;  2FLP A;  3N7S C;  4M04 A;  4XQ7 A;  3K1R B;  4Q44 A;  4DO9 A;  3HJ1 A;  2ZIU A;  4F50 A;  3BS5 A;  3PML A;  2HBM A;  2ZTE A;  3AUO A;  4RPX A;  2HMX A;  2QAR A;  2QB0 B;  4YVZ A;  5EE3 A;  1ZQQ A;  2Q4T A;  2E3T A;  1ZQG A;  4CE6 A;  2IUB A;  3UXO A;  5AK4 A;  2EAN A;  5AIB A;  4DL4 A;  5KFA A;  2E8P A;  5HRH A;  5JTI A;  3UPQ A;  3C5G A;  3K4G A;  3UMG A;  2B51 A;  1KL9 A;  2MUT A;  2BE3 A;  5K4L A;  4KIT B;  3MC1 A;  4OCZ A;  4U6P A;  4AT8 A;  3GIK A;  1NO5 A;  3CNH A;  4BWM A;  2NRZ A;  3H8S A;  7ICR A;  2F1J A;  4F71 A;  2ZUC A;  4X5V A;  1ZJM A;  2HBK A;  4JB3 A;  2UVU A;  2Y9T A;  4QWA A;  4KM5 A;  2HVI A;  3MGH A;  1XO1 A;  5J0P A;  2JR5 A;  4AYB C;  5J0R A;  2MU2 A;  4KLL A;  2FMS A;  4DQI A;  2M9N A;  2JGA A;  2C2R A;  3BJY A;  4Y2Q A;  1KDH A;  3N7R C;  2ZJ5 A;  3WK9 A;  4QW8 A;  2K4P A;  3JPP A;  2JEF A;  2K60 A;  1D9D A;  1TV9 A;  1ZQD A;  2NRK A;  2DPJ A;  4F4X A;  4DF4 A;  1BGX T;  2WAQ F;  5TIS U;  2FJ6 A;  3N97 B;  5ALX A;  4JMU A;  5ALP A;  2VKQ A;  3TAN A;  3HKZ C;  8ICC A;  3RJE A;  4JV2 A;  4NWI A;  3Q8R B;  1ZD3 A;  5AI5 A;  1NZP A;  3D2Q A;  5KAI U;  5HRI A;  1UPH A;  4BDP A;  3OUY B;  2BQ3 A;  2G0A A;  5KFN A;  3NTU A;  2NRX A;  4ED3 A;  9ICI A;  2PMZ F;  5CR0 A;  1SV0 C;  4YFK A;  3VCB A;  3PO4 A;  3MBY A;  4DF8 A;  3A0B U;  5IIN A;  4WC2 A;  3V72 A;  4AT9 B;  1S97 A;  5KFQ A;  1DXS A;  4YR3 A;  3PW7 A;  1TK5 A;  1TAM A;  4YCX A;  5KTQ A;  1SXE A;  4QWC A;  4JWM A;  4WCW A;  3LVV A;  7ICF A;  2DRA A;  1UCV A;  4EZ6 A;  2F1H A;  3M9O B;  2I1Q A;  4PL2 A;  4O5E A;  8ICH A;  4DLG A;  3HKZ F;  4JV0 A;  5AIC A;  2R8G A;  5ALU A;  1X9X A;  3PX0 A;  5GTH U;  4F92 B;  2IHM A;  1KFS A;  3QXG A;  3IN5 A;  4WBY A;  2XVT A;  2OXO A;  3Q8M A;  1J97 A;  4AT7 A;  3WKC A;  4J9Q A;  2QB0 A;  3QUC A;  4QZC A;  8ICF A;  5AKY A;  7ICK A;  5J2J A;  3PSF A;  4DFP A;  2I9G A;  1HIW A;  4R66 A;  4ELV A;  2KSO A;  2RQ5 A;  5DDY A;  2KG5 A;  4MKP A;  4QZI A;  1NKB A;  3C2K A;  5KFF A;  2BCV A;  5ALS A;  1COK A;  3WFQ E;  2LBO A;  1L6N A;  1LV5 A;  1NK8 A;  4J9O A;  5DB7 A;  4ECQ A;  4WC1 A;  4QNL A;  1WUD A;  1HJP A;  1JQR A;  2R8K A;  2MSN A;  3PZP A;  4UAT A;  2MUT B;  2LKY A;  2M2U A;  4Y2U A;  2W9A A;  4NJ8 A;  1VDV A;  3UM9 A;  2YN4 A;  4RNN A;  1S0O A;  4PGQ A;  4QZD A;  4ECW A;  5HRD A;  1L5U A;  5KT5 A;  1N48 A;  3WKA A;  1S77 D;  2HOQ A;  2EZX A;  2DQN B;  2PI4 A;  1KNY A;  1PZN A;  1OXJ A;  5AI4 A;  3ERC C;  4FZL A;  2IOF K;  1N2X A;  2Y0S F;  4B9V A;  1RXW A;  1ZQ1 C;  4M6W B;  3UPS A;  4LEW A;  3SR6 A;  2RFF A;  4F4Y A;  3RH6 A;  4EEY A;  3BQ2 A;  4QZ9 A;  4PJ0 U;  1MSW D;  7ICE A;  2JXJ A;  4FS2 A;  2G06 A;  4NLN A;  5EWE A;  2E8N A;  5ALZ A;  3H4B A; 
#chains in the Genus database with same CATH homology
 4RQ1 A;  2ZH5 A;  8ICZ A;  1SL2 A;  2BKE A;  2BCS A;  3FYH A;  4DEZ A;  4MFC A;  3ZD8 A;  5KG2 A;  2XY5 A;  3RTV A;  1XWL A;  3SV3 A;  2HW3 A;  2NRW A;  1TAQ A;  4ECT A;  1LB2 B;  5HC9 A;  4IR9 A;  2UVV A;  4O0I A;  1ZQU A;  5KFG A;  2ID1 A;  1JXE A;  3SYZ A;  3RJK A;  1ZQM A;  2DR5 A;  4ED2 A;  4C8M A;  2JEJ A;  3H7I A;  2KTQ A;  4EBJ A;  5DG9 A;  5IIM A;  1UT5 A;  2W9B A;  3PO5 A;  3KTQ A;  9ICP A;  3RAX A;  1B43 A;  2AU0 A;  1ZQT A;  8ICX A;  3WFP A;  3M9N B;  2KFN A;  9ICR A;  5KFY A;  3HWT A;  4I27 A;  3ZDE A;  3TFS A;  1TKD A;  5J0U A;  1D8Y A;  4MF8 A;  4FHX A;  4JV1 A;  4X0A A;  1D9F A;  3PW4 A;  4DL6 A;  4M9J A;  1NOM A;  4QWB A;  2PFN A;  4I2G A;  4KLH A;  5HRG A;  2B21 A;  3HIY A;  3EZ5 A;  4KLI A;  9ICB A;  4B9L A;  4TUR A;  3TQ1 A;  1ZQL A;  2P6U A;  4RQ5 A;  2W9C B;  3HPO A;  3TAQ A;  3B0X A;  4ELT A;  1UA1 A;  5HRB A;  5KG3 A;  2PBE A;  4JK1 A;  4YP3 A;  8ICJ A;  4KN4 A;  3GV7 B;  1UET A;  4RQ3 A;  1R89 A;  5KFL A;  2FPL A;  4I2D A;  2FPK A;  3PR5 B;  3AQN A;  4IRC A;  1IXR A;  4IRK A;  5CP2 A;  3K75 D;  8ICW A;  4PGY A;  1DOQ A;  5DB9 A;  4YQW A;  3MGI A;  3V6K A;  4TUS A;  1R8B A;  8ICI A;  3UQ0 A;  2ATL A;  1XS9 D;  1QSL A;  4J9R A;  4DQP A;  3SI8 A;  1BPX A;  3RB0 A;  2KZ3 A;  4G3I A;  4RUA A;  3GII A;  3C5F A;  4YN4 A;  1KRP A;  4RQ8 A;  4F2S A;  5DG7 A;  2BPC A;  4X4N A;  7ICI A;  3RB4 A;  4YMN A;  4YG2 A;  3LWM A;  1NJW A;  3PR4 A;  4NLZ A;  4IQT A;  4TQR A;  1CEZ A;  1XU4 A;  3UXN A;  1HUZ A;  4M9L A;  5DLG A;  4BXO A;  1ZQP A;  4F5P A;  5KFI A;  4RQ7 A;  4RQ0 A;  7ICJ A;  1NKC A;  1BPY A;  1BPB A;  4XRH A;  2ASL A;  1TFR A;  5J2I A;  4KTQ A;  1MC8 A;  7ICM A;  1L3T A;  1JX4 A;  3KHG A;  4DQR A;  1T3N A;  8ICS A;  9ICV A;  5KT3 A;  4PGX A;  3G6Y A;  5KFC A;  2AQ0 A;  1WCN A;  4ECX A;  4DSE A;  5HP4 A;  4DOA A;  3PVX A;  3MAB A;  3MFI A;  4F5Q A;  1U47 A;  2ZH8 A;  4P4M A;  1JIH A;  8ICL A;  5BOL A;  5IIL A;  5DGA A;  2AQ4 A;  1Z00 A;  2R8I A;  4Q8E A;  5KT6 A;  2XC9 A;  3ZDA A;  4YXM A;  5KG4 A;  3OJU A;  3RRG A;  4ED6 A;  3QEB Z;  2RDI A;  4DWI A;  2ZH3 A;  5D46 A;  5KG0 A;  4R65 A;  4R64 A;  4DOB A;  3V6J A;  4X4S A;  4YMO A;  2DR8 A;  4DL3 A;  3FDS A;  1IM4 A;  3MR2 A;  4BGD A;  5D4B A;  4KLF A;  4DL2 A;  5J2C A;  2O5A A;  5BPC A;  4KLE A;  1ZQS A;  1XC9 A;  4AT7 B;  3EPG A;  2DPI A;  4WBZ A;  2KFZ A;  4ECR A;  2VAN A;  1A77 A;  5DDM A;  3LQC B;  3GDX A;  3N4M B;  2IHN A;  4M47 A;  1SKW A;  8ICE A;  2ISP A;  3WFO A;  1TAU A;  9ICG A;  5HR9 A;  2ZUB A;  9ICA A;  1Z00 B;  1ZQX A;  5HNK A;  4RNO A;  1VFG A;  1SZP A;  4X4R A;  4MEY A;  4PHA A;  2BR0 A;  1T8E A;  3JPT A;  2VA3 A;  4KLQ A;  4KLS A;  4KLT A;  1COO A;  7ICS A;  8ICB A;  2BQU A;  4WC7 A;  4F4Z A;  4X4T A;  3GIL A;  3HT3 A;  3SZ2 A;  9ICQ A;  3H8J A;  1ZQJ A;  7ICN A;  1S76 D;  2ZH6 A;  3GQC A;  5EOZ A;  4F4K A;  3PW0 A;  1NK7 A;  1NK0 A;  5J2H A;  4ECY A;  1XSN A;  4RQ2 A;  1QSY A;  4M9G A;  3BDP A;  2HHV A;  2KN7 A;  9ICL A;  1QLN A;  3RB3 A;  4O3O A;  1X9S A;  2XGQ A;  4C8N A;  4I2H A;  4RWN A;  4B9S A;  2NRV A;  4J9L A;  2AGO A;  4RQ4 A;  4XA5 A;  4QZG A;  4FO6 A;  5KFM A;  1ZQR A;  3G6X A;  4DSK A;  5HHH A;  4O3S A;  2KZZ A;  4X4P A;  8ICP A;  4FBU A;  7ICL A;  2XY6 A;  2DR7 A;  4KLO A;  2Y1J A;  1ZQA A;  2FMP A;  4UB5 A;  3ORY A;  3ISC A;  5KFX A;  5DED A;  1X2I A;  4Z6C A;  5J2F A;  1ZQN A;  1L3U A;  2ZUD A;  3MR3 A;  2JEG A;  1KEJ A;  3Q8L A;  9ICN A;  4DL5 A;  4RWO A;  4I2I A;  4J9M A;  4F5R A;  3NGD A;  5BOM A;  4YMM A;  3H39 A;  4R8U B;  1U49 A;  1BPD A;  4RPZ A;  1U4B A;  9ICJ A;  4GLX A;  2IMW P;  5EWG A;  3ZD9 A;  4FBT A;  4X4U A;  1XSL A;  2ZH7 A;  1DGS A;  4Z6F A;  8ICV A;  1U45 A;  3TI0 A;  1R8C A;  2H5X A;  3L9D A;  4B9N A;  4MF2 A;  4KLJ A;  4GC6 A;  2IA6 A;  4F3O A;  4QZA A;  3RJH A;  5DQG A;  2Q66 A;  4BWJ A;  4QZ8 A;  4M2Y A;  1S0V A;  3M8R A;  3HW8 A;  3ZDC A;  1TFW A;  3KHR A;  4RUC A;  1MIY A;  2J6T A;  5KT4 A;  1ZQK A;  4Z6E A;  9ICU A;  4J9S A;  3LK9 A;  1TVA A;  4I2E A;  4X0B A;  5KFE A;  9ICK A;  5KG6 A;  1NJY A;  1JN3 A;  2RDJ A;  4Q45 A;  3TFR A;  4FHV A;  4IR1 A;  4Z6D A;  3ZDD A;  4O9M A;  1R8A A;  5DBC A;  3Q8P B;  1K1S A;  5III A;  4UAY A;  4CCH A;  3BQT A;  5IIJ A;  2ALZ A;  5JUM A;  1JXL A;  2HHW A;  2ZH4 A;  4C8L A;  4WC3 A;  4YR0 A;  4P4P A;  3RJF A;  4FH3 A;  5J0S A;  3H38 A;  2MAX A;  5J2K A;  1ZYQ A;  2KZM A;  4UBC A;  4LZG A;  3H3A A;  4LT6 A;  2HVH A;  3H37 A;  3G6V A;  4EBD A;  2BPF A;  8ICT A;  2M2T A;  3T5L A;  3AU2 A;  5L9X A;  5KFD A;  2JZB B;  1TK0 A;  2BCQ A;  3BQ0 A;  3QZ7 A;  3GIJ A;  4M9H A;  1BVS A;  5HRK A;  5HRE A;  2ZJ8 A;  2HHS A;  3MDA A;  2BHN A;  1K1Q A;  1ZQB A;  4ECU A;  1B22 A;  4YR2 A;  4RNM A;  2F1I A;  5J2A A;  4PHE A;  5J0O A;  2W9B B;  2BDP A;  2AJQ A;  3IM1 A;  4YD2 A;  9ICX A;  3GFK B;  5KFZ A;  4O3Q A;  5J2D A;  2V4Q A;  4GXJ A;  2FLP A;  3RRH A;  4I28 A;  4Q8F A;  4M04 A;  8ICA A;  4WC4 A;  4TQS A;  4S3N A;  4XQ7 A;  1U9L A;  4QZF A;  4TUP A;  1HUO A;  3ETL A;  5F9L A;  4Q44 A;  4DO9 A;  1MQ2 A;  2FLN A;  2A1J A;  2ZTD A;  3MR5 A;  4FHP A;  4HYK A;  3HJ1 A;  4WC6 A;  1NK4 A;  4F50 A;  4R8U A;  3OVS A;  3BQ1 A;  3OV7 A;  3PML A;  3T5K A;  9ICT A;  5KFV A;  1F5A A;  2LYH A;  2ZTE A;  3AUO A;  2BCU A;  5HRF A;  4RPX A;  4YVZ A;  5KFK A;  3TAP A;  4GC7 A;  1BPZ A;  1ZQQ A;  1NKE A;  1ZQG A;  3C21 A;  1VJ7 A;  4EBK A;  5J29 A;  4NKU A;  4J9N A;  4PH5 A;  3UXO A;  1KFD A;  4DL4 A;  4J9K A;  1UA0 A;  4KLG A;  2ASD A;  4R63 A;  2ZJA A;  5F9N A;  4KN7 A;  4E8F A;  2ZH2 A;  3OGU A;  4DSJ A;  5KFA A;  4IQU A;  4PHP A;  9ICH A;  5HRH A;  3JYY A;  4B9U A;  5J0X A;  2WTF A;  4F4W A;  3QE9 Y;  4RWP A;  4XQ8 A;  3UPQ A;  1SKR A;  3B0Y A;  4ECZ A;  2ZTC A;  4UBB A;  1RPL A;  3RJJ A;  4E0D A;  3C5G A;  1NK6 A;  1WOT A;  5CJ7 A;  1X9W A;  3K4G A;  2O1P A;  4EYI B;  1MIW A;  7ICV A;  8ICQ A;  4UB3 A;  4RQ6 A;  3OJS A;  2MUT A;  3MDC A;  4ED1 A;  1S10 A;  2BE3 A;  2ASJ A;  4KIT B;  3HJ4 A;  1DK3 A;  4NM2 A;  2W9M A;  4IRD A;  2FLL A;  4AT8 A;  3GIK A;  4ED8 A;  1XSP A;  4IQV A;  1NO5 A;  2R8H A;  4ED0 A;  4X4O A;  4UAW A;  4BWM A;  5KFT A;  2NRZ A;  3H8S A;  4GXK A;  7ICR A;  1EXN A;  2F1J A;  2ZH1 A;  1YLQ A;  2C2E A;  4O5K A;  2ZUC A;  4X5V A;  3ISB A;  1ZJM A;  7ICH A;  3KHL A;  2XY7 A;  5IIO A;  4ATB B;  5KFW A;  2UVU A;  3OSN A;  3JZ0 A;  4ATB A;  4QWA A;  2OWO A;  2HVI A;  3MGH A;  2HHP A;  3AQL A;  1XO1 A;  2C28 A;  1T7P A;  3PY8 A;  4K4H A;  1V4A A;  3WFS C;  5J0P A;  1TFY A;  5J0R A;  4DQS A;  1CUK A;  1JMS A;  4KLL A;  2HHU A;  3OUY A;  2A1J B;  1UEV A;  4AT8 B;  2FMS A;  4NKT A;  4Q43 A;  2PFP A;  2PFQ A;  4DFM A;  3RH4 A;  5DLF A;  4DQI A;  2M9N A;  2ZHB A;  1BPE A;  1KTQ A;  1KLN A;  2C22 A;  2BGW A;  3V7L A;  2C2R A;  3OHB A;  3BJY A;  3PW2 A;  4RZR A;  3RR8 A;  4ELU A;  3RAQ A;  1KDH A;  5L1J A;  4NY8 A;  1C7Y A;  2ZJ5 A;  4QW8 A;  5CA7 A;  4M5D A;  5KFS A;  2FPM A;  5KFR A;  4RU9 A;  2P6R A;  3OSP A;  4RPY A;  4KMU A;  4O3P A;  3JPP A;  2JEF A;  4P2H A;  3C2L A;  1D9D A;  1TV9 A;  1PX5 A;  1ZQD A;  2NRK A;  2DPJ A;  1UT8 A;  5J2E A;  4F4X A;  4EZ9 A;  4EP7 A;  4DF4 A;  1BGX T;  1V9P A;  2DR9 A;  3C1Z A;  1U48 A;  1RZT A;  5DBA A;  2M2W A;  5CHG A;  5CWR A;  2UVR A;  2W8L A;  4EBC A;  3N97 B;  8ICU A;  3TAN A;  4K4G A;  1BNP A;  4DS4 A;  1L3V A;  4DSF A;  7ICG A;  3RBD A;  8ICC A;  3JPO A;  4F8R A;  3RJE A;  1ZET A;  4JV2 A;  4YD1 A;  4E80 A;  5KFB A;  4KLD A;  2HHT A;  5DB6 A;  1NK9 A;  4PPX A;  3Q8R B;  3AQK A;  1NZP A;  1NK5 A;  1KSP A;  1FA0 A;  4C8O A;  5HRI A;  4NLG A;  3T5H A;  1Q79 A;  3GIM A;  1ZQW A;  4MEX A;  4BDP A;  2PFO A;  4M9N A;  2XO7 A;  3OUY B;  2PXI A;  3JPQ A;  1T4G A;  3E2E A;  4QZB A;  1S9F A;  4I2A A;  1ZQF A;  4UQG A;  4DQQ A;  5KG1 A;  2BQ3 A;  1ZQE A;  5J0T A;  3ZDB A;  2KP7 A;  5KFN A;  5HRL A;  8ICN A;  4DS5 A;  3IHQ B;  1ZQI A;  2Y1I A;  4C8K A;  4JWN A;  3NTU A;  2NRX A;  3OHA A;  2W9C A;  4ED3 A;  1ZQC A;  3RH5 A;  9ICI A;  4RWQ A;  3NYB A;  1D8L A;  9ICC A;  3AU6 A;  5CR0 A;  4IQW A;  4XUS A;  4MFA A;  3H40 A;  3PW5 A;  3GV8 B;  4WC5 A;  3JPN A;  3LWL A;  3RBE A;  4YFK A;  5KFO A;  2V4R A;  3PO4 A;  3MBY A;  4LVS A;  4MFF A;  2VA2 A;  8ICK A;  4DF8 A;  4K4I A;  4FS1 A;  4X4V A;  5IIN A;  4B9M A;  5DGB A;  1BNO A;  3V72 A;  1L3S A;  4WC2 A;  1ZQZ A;  4I2F A;  4AT9 B;  1S97 A;  5KFQ A;  2Q0Z X;  4YR3 A;  5L1I A;  3PW7 A;  3THV A;  2BQR A;  1X9M A;  1TK5 A;  1ZQH A;  4I2J A;  4AT9 A;  3MFH A;  3PX6 A;  5KT7 A;  4YCX A;  3Q8S B;  5KTQ A;  1MQ3 A;  2DFL A;  4TUQ A;  4UD5 A;  2PI5 A;  2AGP A;  3PV8 A;  1SL0 A;  5HHI A;  9ICO A;  4QWC A;  3RB6 A;  4JWM A;  4RT3 A;  4UB2 A;  4QW9 A;  4WCW A;  1S0N A;  3RJI A;  2C2D A;  7ICF A;  3M9M B;  4PHD A;  3MR6 A;  1MIV A;  5TZV A;  2DRA A;  4EZ6 A;  2VA8 A;  2F1H A;  4QZE A;  2I1Q A;  3M9O B;  4O5E A;  8ICH A;  3OVA A;  4I29 A;  4DLG A;  3JPS A;  4JV0 A;  3PMN A;  4BXO B;  2R8G A;  4DLE A;  5L1K A;  4F92 B;  3PX0 A;  2IHM A;  4M0A A;  1KFS A;  5DQH A;  4F91 B;  5L1L A;  4P4O A;  4J9P A;  3GV5 B;  4WBY A;  5DG8 A;  3Q8Q B;  3H4D A;  7ICP A;  1DK2 A;  2R8J A;  7ICQ A;  4B9T A;  3Q8M A;  1ZJN A;  4AT7 A;  4I2C A;  2XCP A;  9ICW A;  5DEC A;  2HHX A;  5KG7 A;  4J9Q A;  3LDA A;  1QTM A;  9ICE A;  5DKW A;  4YXJ A;  4QZC A;  4KLU A;  5DBB A;  1SL1 A;  5EWF A;  8ICF A;  7ICK A;  2ZHA A;  3JPR A;  1RYR A;  4KLM A;  9ICS A;  5J2J A;  4DSI A;  2HHQ A;  4DFP A;  3KHH A;  2I9G A;  3AQM A;  4R66 A;  5J0Q A;  4DL7 A;  5DDY A;  4UB1 A;  2IBK A;  4ELV A;  1Q78 A;  4QZI A;  1NKB A;  5KFJ A;  1ZQO A;  1JAJ A;  5F2V O;  4ZH4 A;  8ICM A;  4DFK A;  2DVI A;  3C2K A;  4O3N A;  4F5O A;  5KFF A;  2BCV A;  2XGP A;  4NXZ A;  2J6U A;  2P66 A;  3WFQ E;  5DB8 A;  4O3R A;  4WC0 A;  4IG8 A;  1LV5 A;  1NK8 A;  3PNC A;  4J9O A;  5DB7 A;  2JEI A;  9ICF A;  4ECQ A;  2BPG A;  4WC1 A;  1HJP A;  3EYZ A;  4ECV A;  1ZQV A;  2R8K A;  8ICO A;  3T5J A;  1JQR A;  5KT2 A;  2M2V A;  1ZQY A;  3TAR A;  4UD4 A;  4E7X A;  2ZH9 A;  4UB4 A;  2V9W A;  2MUT B;  5HML A;  2M2U A;  1UEU A;  8ICY A;  3UQ2 A;  2FMQ A;  2W9A A;  4QWE A;  3PX4 A;  4GXI A;  1A76 A;  3UXP A;  1NJZ A;  3T3F A;  5J2B A;  3QEA Z;  4I2B A;  9ICM A;  4RNN A;  1S0O A;  1KFT A;  4LZD A;  4PGQ A;  3C18 A;  2W8K A;  3C23 A;  4QZD A;  5KFU A;  3HX0 A;  1RYS A;  1OU5 A;  5KG5 A;  3V7J A;  4QZH A;  2DRB A;  8ICR A;  2UVW A;  4EBE A;  4UAZ A;  7ICO A;  2XCA A;  3EWA A;  4ECW A;  3H8W A;  4FHW A;  4EYH B;  5J0Y A;  1L5U A;  5KT5 A;  1N48 A;  5HRD A;  1S77 D;  3RJG A;  4X4Q A;  4F2R A;  4NLK A;  5DQI A;  3QZ8 A;  3HP6 A;  3Q8K A;  2PI4 A;  4O5C A;  7ICT A;  1KNY A;  3C66 A;  5HMM A;  1PZN A;  5J0W A;  3M8S A;  1SKS A;  2BCR A;  3EPI A;  4M6W A;  4B9V A;  3V7K A;  1RXW A;  2ISO A;  1WCL A;  1NJX A;  3SV4 A;  1QSS A;  4M6W B;  1Y88 A;  3C1Y A;  3UPS A;  4RT2 A;  2NRT A;  1N56 A;  2JZB A;  1S0M A;  3EW9 A;  4F4Y A;  3V6H A;  1TK8 A;  1RXV A;  2RFF A;  4FH5 A;  3RH6 A;  4EEY A;  3RR7 A;  4JUZ A;  5IIK A;  3BQ2 A;  4ECS A;  4QZ9 A;  4DSL A;  1MSW D;  7ICE A;  4FHY A;  3C2M A;  1ARO P;  4FS2 A;  4NM1 A;  3OVB A;  4QWD A;  5CB1 A;  5D49 A;  5C5J A;  5EWE A;  4NLN A;  4DOC A;  3WFR E;  7ICU A;  4DFJ A;  2GWS A;  1H38 A;  5KFH A;  4ED7 A;  5KFP A;  3ISD A;  2AGQ A;  4F93 B;  8ICG A;  1Z3E B;  2J6S A;  3H4B A;  4F5N A;  5J2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...