4NY8A

Dna polymerase beta with o6mg in the template base opposite to incoming non-hydrolyzable ctp with manganese in the active site
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
323
Chain Sequence
b'LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 108
structure length 323
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ny8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ny8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ny8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ny8A03
1L3UA 2NRWA 2FMPA 4IQTA 2C2RA 1NZPA 4F8RA 3HX0A 7ICLA 1ZQBA 2J6TA 4J9LA 4YN4A 5KT5A 4YD2A 4M6WA 4DFKA 9ICSA 5KFAA 8ICEA 1Z3EB 4ED6A 4QZCA 4RPYA 2PFPA 2F1JA 3HWTA 4EBCA 4WC2A 3MGIA 4KLJA 3BQTA 1R8CA 4WC7A 3FDSA 5KT2A 1H38A 4F4YA 5TZVA 1RYSA 3PMNA 4LZGA 4QZFA 2IA6A 4QZBA 3ORYA 3AQMA 2ALZA 4ATBA 1ZQNA 3LQCB 3H38A 3QEBZ 2H5XA 1Y88A 1ZQUA 4I2IA 4EZ9A 5J2JA 4NLZA 5J0UA 1R8AA 4YVZA 4F5NA 5KT4A 3RR8A 8ICYA 3TANA 1D9FA 5KFHA 5KFPA 4UAZA 4ECRA 5IIMA 5BOMA 2AGQA 3ZDCA 4F5PA 4RWQA 4ECZA 2ZUBA 1BNOA 2JEGA 4NLGA 4KLFA 2FLPA 3OGUA 1BPXA 1ZQPA 5IIOA 4DOBA 3GV5B 5KFRA 2R8JA 5J0XA 1NK9A 8ICRA 4RQ4A 3PX4A 4FH3A 3KHLA 9ICBA 4JK1A 1MIYA 4J9PA 4O3SA 3MDAA 1S0NA 1JXLA 4M9GA 3EW9A 1MIVA 3ISCA 3EZ5A 4LT6A 1EXNA 3RJIA 2VANA 4DL7A 9ICJA 4YMMA 1NJWA 4FHVA 3ZD8A 3C2MA 4EBEA 5J2CA 1SL2A 3IHQB 5DG8A 4GXJA 2C22A 3SZ2A 1RXWA 4LVSA 4ED1A 1X9SA 2PFNA 1S76D 1UA1A 4I2FA 1D8YA 5DEDA 1L3TA 4PHDA 4AT8A 5CHGA 1QSLA 3EYZA 1BGXT 5KFSA 2JZBA 4DFMA 3KTQA 4ELUA 2HHVA 1FA0A 2DR7A 5KFMA 4BDPA 2KFNA 1A76A 2LYHA 2RDJA 4X4RA 2IBKA 4IRCA 3E2EA 1COOA 2DPIA 4ECSA 5J2EA 1K1SA 4B9MA 4KLOA 3Q8PB 1RYRA 4R65A 4O5CA 9ICFA 5EOZA 4J9KA 3RB3A 2W8KA 2J6UA 9ICWA 4G3IA 3JZ0A 5EWEA 1TVAA 1XSNA 3Q8RB 3OSNA 3H40A 4J9SA 4LZDA 2KZZA 8ICXA 2RFFA 8ICMA 4FH5A 3G6YA 8ICQA 2ZJ5A 4QW8A 5KFBA 3GQCA 2DVIA 4B9SA 4O3RA 4FHWA 4I2GA 7ICRA 2C2EA 8ICIA 4NM2A 5DBCA 4RT2A 3RBEA 5KFTA 2HW3A 1NJYA 4AT7A 4FBTA 3RJFA 2AQ0A 2ASLA 5J2GA 4J9OA 4QZDA 5L1KA 4MEXA 5DQGA 4HYKA 4DO9A 1NK6A 3RRGA 4QZHA 1T8EA 5HRKA 7ICQA 3AU2A 3AQKA 5DG9A 2IMWP 1C7YA 4E7XA 5IINA 3TQ1A 5HRFA 4RWPA 3V7KA 3T5HA 3ETLA 4F2RA 4Z6FA 4RQ2A 4ED8A 1HUOA 2ZH5A 9ICOA 2BQRA 1U45A 4IRDA 4BXOA 1KTQA 4UB3A 4C8KA 3C66A 4MFAA 3T5KA 5CA7A 2ATLA 5CJ7A 4MFFA 4DWIA 4TUQA 4JWMA 4Z6EA 4I2AA 4KLLA 5L9XA 4TQRA 2BCQA 4O3QA 4MFCA 3BDPA 1NK5A 5JUMA 3IM1A 3GFKB 2ZH8A 4GC6A 4TURA 3HJ1A 1D8LA 3PW0A 7ICIA 1OU5A 1KEJA 1WOTA 1XC9A 4WC3A 2BR0A 3WFOA 1LB2B 5DKWA 3T5JA 1KSPA 3PV8A 4F50A 4KTQA 4NXZA 1X9MA 9ICKA 1V9PA 3L9DA 5KFOA 3G6VA 4B9LA 4NKTA 5D46A 4RWOA 1NOMA 2P6RA 3PW5A 1MC8A 4QZ9A 4IR9A 2KTQA 5L1JA 3RAQA 1MIWA 3PW4A 4C8LA 4KMUA 4EP7A 4ECVA 4KITB 4M6WB 1DOQA 1ZJMA 1ZQIA 4DOCA 2KZMA 1S9FA 1KNYA 2M9NA 5J2FA 2PI4A 3RJHA 1S0MA 4TUPA 3H8JA 3Q8SB 3M8RA 3PW2A 3M9MB 4JWNA 3AU6A 3OSPA 4I2BA 8ICKA 2O5AA 4DLEA 3NYBA 3B0XA 5DQHA 2ZH7A 2GWSA 3KHGA 4TQSA 2M2UA 2R8HA 3Q8KA 4X4SA 1ZQLA 2ZH3A 3H4DA 4KLEA 2ZUDA 2C28A 4KLDA 2UVVA 3OUYA 5J0SA 2FMSA 9ICHA 3PR5B 4F3OA 2DRAA 3AQLA 5KFVA 3QZ8A 1NJXA 3WFQE 3ZDDA 2F1IA 3QE9Y 4EBJA 4P4OA 3OHAA 2HVHA 5KG3A 2BDPA 2Q0ZX 2HHWA 2HHUA 3MR6A 9ICQA 5HMLA 4RQ3A 4M0AA 2FPKA 2ZH6A 4O3OA 4B9VA 4DS4A 3OVSA 3HP6A 1ZQXA 4QWEA 4RNOA 3OJUA 3BJYA 2R8KA 4M04A 8ICNA 3H39A 2BCUA 4I2DA 4RT3A 1CUKA 1ZQMA 2HHPA 1Z00B 5DB8A 1ZQYA 3UXNA 4YR0A 1U9LA 2M2VA 5DLGA 1K1QA 4PGXA 4ED3A 2AGOA 8ICLA 3BQ1A 5J2KA 4DL2A 4I2JA 3LDAA 8ICHA 4YMNA 3TAPA 1UEUA 2BPCA 3LWMA 1ZQCA 5DECA 4I29A 7ICJA 1X9WA 4Q45A 2W9AA 4AT8B 4S3NA 2JZBB 3RRHA 2JEFA 3JPRA 9ICLA 5DQIA 2BCRA 2XGPA 3PW7A 4C8MA 4WC5A 4I27A 9ICNA 5DDMA 4F91B 1TFWA 3C2KA 5KFLA 2Y1IA 4M2YA 4RWNA 5KFDA 1T3NA 1YLQA 3EPIA 1QSSA 3C18A 2KN7A 3PO4A 4F4XA 1LV5A 1ZQQA 5KT7A 2AJQA 5F9NA 4DL6A 1XWLA 2VA3A 4YG2A 1Z00A 4EBDA 5DGBA 3H37A 4UB5A 5HC9A 4PPXA 4WC1A 4YQWA 3RH5A 1N56A 1ZQFA 3SI8A 4DSIA 2ZJAA 5KFUA 1SL1A 2KP7A 1KRPA 3RR7A 3BQ0A 3N4MB 2ID1A 2VA8A 5KFIA 2BPFA 3C21A 4AT7B 5L1IA 2ZH1A 7ICVA 1BPDA 4RZRA 2P66A 3H8SA 2ZH9A 3M9NB 2OWOA 3OHBA 8ICBA 2C2DA 5DB7A 1XO1A 4ECUA 8ICCA 1ZETA 4DQIA 4IQWA 5HRLA 3WFRE 4ELTA 2PBEA 4F93B 3QZ7A 1S0VA 4DOAA 1JX4A 3H3AA 4ECYA 2ZH4A 5CP2A 4FHXA 3ISBA 4QZ8A 4UB1A 4BXOB 5L1LA 1ZQEA 4MF8A 4KN4A 4O3NA 1PZNA 3JPSA 4EZ6A 4BWMA 2V9WA 4X4QA 4Q8FA 1T7PA 1S0OA 4O5KA 4O0IA 2B21A 5HRBA 5J0WA 4RQ5A 2VA2A 1IM4A 5HMMA 3RJKA 3Q8QB 5KT3A 4K4HA 5KG4A 4UAYA 3GIMA 3T3FA 4KLTA 5DB6A 2F1HA 5HHHA 4X5VA 2UVWA 4KN7A 4E80A 3NGDA 4E0DA 5IIJA 3ISDA 3OVAA 4O3PA 2HHTA 2ZJ8A 8ICJA 1JN3A 4DSLA 8ICZA 3TI0A 4KLSA 1XSPA 1T4GA 4FBUA 4M9LA 4NLNA 4UB4A 4O9MA 4X4NA 4BGDA 4RQ8A 4M9HA 4DSJA 2XY6A 4FHPA 1TKDA 2DR9A 4QZGA 8ICPA 4DSKA 4DSEA 1IXRA 2BGWA 2PXIA 2M2TA 4RUCA 2ISOA 2UVRA 1NKBA 5KFYA 4PHAA 5J2AA 1ZQHA 3ZDBA 4RPXA 2XCPA 5J2HA 4AT9A 4GLXA 2IHNA 3WFPA 3M9OB 3OUYB 4QZEA 4ZH4A 1ZQSA 4P4PA 4NKUA 1X2IA 2BKEA 4IQVA 1U48A 3K4GA 4RUAA 1S77D 4YD1A 1ZQOA 9ICCA 1TK5A 1ZQJA 1ZQKA 4EEYA 4KLHA 5J0OA 3MGHA 4KLMA 5HNKA 2BQ3A 4FHYA 4YR3A 4ED2A 2PI5A 5HR9A 3RB4A 2NRTA 1JMSA 3K75D 4DQSA 4RPZA 3RJEA 9ICRA 4R64A 1ZQZA 4FS2A 2ZTEA 1ZQDA 4IR1A 5CWRA 4RQ6A 4F5QA 4R63A 5HRGA 5HRIA 3H7IA 3RAXA 2XY5A 3PO5A 3SV3A 4QZAA 1L5UA 1V4AA 3ZDEA 3ZDAA 3V6JA 4J9RA 4X0BA 3RJJA 4R66A 1QLNA 5F2VO 3HW8A 5KG6A 4XQ8A 5KFGA 3HT3A 4YP3A 2W9BA 1N48A 9ICUA 4GXIA 2ZTCA 4RQ7A 3T5LA 3MR2A 8ICGA 4QW9A 3JPPA 5J2DA 3LK9A 5CB1A 3LWLA 3V72A 3Q8LA 4XA5A 4F4WA 4FO6A 2XGQA 3TFSA 5J0TA 3B0YA 2ASJA 1L3SA 4KLUA 7ICOA 3AQNA 5KFJA 4EYHB 1SKRA 3HIYA 4M9NA 2DPJA 4K4GA 2NRXA 4NLKA 4F92B 4NY8A 2KFZA 4R8UB 3MBYA 1MSWD 3H4BA 4DFPA 2MUTA 9ICMA 1BPZA 1U49A 1F5AA 1NO5A 1UEVA 4ED0A 5J2BA 4X4PA 7ICKA 1TFYA 1ZQTA 2ISPA 3PVXA 4MF2A 2BCSA 4QWCA 9ICGA 1HJPA 4P4MA 2WTFA 4ECXA 2R8GA 3WFSC 3KHHA 1B43A 2DR8A 4UAWA 1U4BA 4Z6CA 2AGPA 1JAJA 4Q44A 2XCAA 3UPSA 2W9MA 3C5FA 1Q78A 4F5OA 1QTMA 5DLFA 1TV9A 2PFQA 4DQPA 1D9DA 1XSLA 9ICAA 2FPMA 4M47A 1NK7A 4RQ1A 3GIIA 1SKSA 4ECTA 4DQQA 9ICXA 1Q79A 4QWAA 5KFZA 5C5JA 5HRDA 4YXMA 4RU9A 1KLNA 2P6UA 2FLNA 4WC6A 1NKCA 3TFRA 5KG5A 3RTVA 1ZYQA 1NK4A 5DB9A 3TARA 5KT6A 1XS9D 8ICFA 4O5EA 4DF4A 1KFSA 3HPOA 1B22A 4DF8A 3KHRA 7ICFA 4R8UA 3OJSA 1ZJNA 2V4QA 5J0QA 1BPEA 4TUSA 4DL5A 1SZPA 5BOLA 3EPGA 4UB2A 1JQRA 1R89A 3OV7A 1KDHA 1ZQRA 4YXJA 1MQ3A 5DGAA 3GV7B 2ZUCA 4CCHA 4B9NA 4NM1A 4DL4A 4GXKA 3C1YA 5KFEA 4Q43A 5EWGA 3NTUA 4C8NA 3PR4A 4DLGA 3RB6A 1U47A 3JYYA 4F5RA 3MABA 4UD5A 1WCLA 2RDIA 4PGQA 2PFOA 2HHSA 2A1JB 5DBBA 5F9LA 3MR5A 2ZTDA 3V7JA 4PHEA 4B9UA 4RQ0A 1NK8A 4KLIA 2JEIA 5D4BA 5KFWA 4MEYA 2XO7A 2FLLA 4UBCA 3PX6A 2JEJA 3FYHA 4X0AA 2BE3A 5J0PA 8ICWA 1UT5A 3GDXA 1ZQGA 2ZHAA 1NJZA 4UD4A 1RXVA 1UETA 1S10A 2NRZA 2UVUA 7ICSA 4KLGA 5HREA 1XU4A 4EYIB 5J2IA 4ELVA 5KFQA 4WC0A 4IRKA 1RPLA 3C1ZA 5KG1A 1SKWA 3C23A 4AT9B 2I1QA 3C5GA 7ICNA 9ICVA 3OVBA 3PY8A 4M9JA 3EWAA 1BNPA 1KFDA 2W9CB 4JV2A 4I28A 2NRVA 1BPBA 5DG7A 3ZD9A 3SYZA 4X4TA 1HUZA 4I2EA 1L3VA 4RNNA 4B9TA 3PMLA 5EWFA 3BQ2A 2A1JA 4X4OA 2Y1JA 1DK2A 4WC4A 4JUZA 3RH4A 1R8BA 8ICSA 1ZQAA 3QEAZ 1JXEA 3UXOA 4Q8EA 2HVIA 4WCWA 1DGSA 2XC9A 4YMOA 4F4ZA 4PH5A 3MFIA 9ICPA 1AROP 9ICIA 4X4VA 5IIIA 1RZTA 1BVSA 2Q66A 3Q8MA 2HHQA 4JV1A 2V4RA 2IHMA 8ICOA 2ASDA 5KG7A 4ECWA 3UPQA 3RB0A 3V6KA 5HHIA 1JIHA 1TK8A 4YR2A 1WCNA 3V6HA 8ICVA 3C2LA 5IIKA 4E8FA 4FS1A 2W9BB 4P2HA 2O1PA 3THVA 5CR0A 4YCXA 8ICAA 2W9CA 5HP4A 4DFJA 5D49A 1S97A 4QZIA 3JPOA 2I9GA 5KFXA 4QWBA 1PX5A 5BPCA 1NKEA 4J9MA 4UBBA 2FMQA 1TFRA 4I2HA 2DR5A 4C8OA 2DFLA 3GIJA 5J29A 4RNMA 1BPYA 4F4KA 7ICMA 3N97B 2XY7A 1KFTA 2MUTB 3JPQA 5KFNA 3UQ2A 1QSYA 4UQGA 1CEZA 4X4UA 4YFKA 2BQUA 1TK0A 5DBAA 2HHXA 4IG8A 4JV0A 4ECQA 4F2SA 1SL0A 4K4IA 4GC7A 3UQ0A 1VJ7A 3AUOA 2BCVA 1A77A 4Z6DA 7ICPA 4DL3A 3GV8B 5KFFA 3MFHA 3TAQA 3V7LA 1MQ2A 4PHPA 3MDCA 2M2WA 4DS5A 2ZH2A 4DEZA 1VFGA 2FPLA 5DDYA 2R8IA 4I2CA 7ICEA 5IILA 3PX0A 4J9NA 5KFCA 2AU0A 3UXPA 4WBYA 3RJGA 5J0YA 4XQ7A 3RH6A 3MR3A 1UA0A 2ZHBA 1DK3A 4KLQA 8ICTA 9ICEA 3GIKA 3RBDA 2AQ4A 3SV4A 7ICUA 8ICUA 4J9QA 4M5DA 7ICHA 4XUSA 9ICTA 5KTQA 4BWJA 2BPGA 7ICTA 4EBKA 3H8WA 5HRHA 1ZQWA 4QWDA 1TAQA 1TAUA 4WBZA 3HJ4A 1NK0A 3PNCA 4IQUA 4PGYA 4DSFA 3JPNA 7ICGA 4ATBB 5KG2A 2J6SA 2KZ3A 4ED7A 4XRHA 3JPTA 2BHNA 5KFKA 5KG0A 1ZQVA 1UT8A 5J0RA 3GILA 4DQRA 3M8SA 2W8LA 2DRBA 3G6XA 2MAXA 2NRKA
chains in the Genus database with same CATH superfamily
2NRWA 2FMPA 2F8KA 1N5XA 2Y9UA 4J9LA 1N61A 4M6WA 4ED6A 2PFPA 2YN4A 3HWTA 2AHOB 4EBCA 3MGIA 2HBLA 3IDWA 1RYSA 4QZBA 3AQMA 5ALIA 4ATBA 2H5XA 1S5LU 4I2IA 3T79A 3RR8A 3A0HU 4UAZA 4ECRA 1T94A 4F5PA 4NLGA 3WK7A 3IV6A 1BPXA 5IIOA 2KEYA 4PL2A 2FDRA 4FFDA 5KFRA 2HMXA 2R8JA 3PX4A 2DQNB 2ZIXA 4JK1A 4O3SA 1JXLA 5K4LA 3ISCA 1SL2A 5DG8A 2B4VA 1S76D 3PSTA 2EAPA 1L3TA 4EGWA 4AT8A 4IG8A 1QSLA 4DFMA 4UASA 2N1RA 2RDJA 2JMGA 4X4RA 2DWQA 4F72A 3E2EA 3I1YA 1VJ5A 2RHFA 3RB3A 2HOQA 4G3IA 3H40A 8ICXA 3SMVA 4FH5A 8ICQA 5KFBA 4O3RA 1V97A 4LEWA 8ICIA 3RBEA 4RT2A 4Y2UA 2H3FA 4FBTA 4KX5A 2AQ0A 5AK4A 3RJFA 4MEXA 5DQGA 4MHVA 1IIPA 7ICQA 2B56A 2EDUA 1C7YA 3TQ1A 2Y0SC 2YMLA 1HUOA 4ED8A 2ZH5A 2BQRA 4Y2YA 1U45A 1KTQA 4C8KA 4MFAA 4MFFA 4JWMA 2BCQA 4TQRA 4MFCA 4O3QA 4KMOB 3IM1A 4GC6A 7ICIA 1OU5A 2EWRA 1KEJA 2KSOA 5DKWA 3L9DA 3G6VA 3QNMA 4B9LA 5D46A 4NXXA 3D6JA 4IR9A 5L1JA 1XNSA 1DOQA 2KZMA 1S9FA 4K97A 1KNYA 2M9NA 5J2FA 1S0MA 1Z19A 8ICKA 4I2BA 4UATA 2ZIWB 3NYBA 4O6AA 2GWSA 3KHGA 1UHUA 2YB4A 2M2UA 4X4SA 2UVVA 5J0SA 3WFQE 4OAHA 3ZDDA 2KHQA 3BZCA 4P4OA 3OHAA 3PSIA 2BDPA 4RQ3A 1N60A 4B9VA 5ALYA 4QWEA 3OJUA 3AMZA 8ICNA 3H39A 1ZQMA 2HHPA 5DB8A 1ZQYA 4YR0A 5DLGA 4PGXA 4A8EA 4KX3A 5J2KA 8ICHA 3LDAA 3QYPA 3FC4A 7ICJA 2JZBB 3KOOA 3RRHA 5DQIA 2BCRA 2XGPA 3B9JA 2F77X 4C8MA 4WC5A 9ICNA 5DDMA 4F91B 1TFWA 3E58A 4RWNA 2LYBA 4WH5A 1PVQA 4F4XA 2YY6A 4DL6A 1S8OA 2VA3A 2FI1A 4CF3A 3BS5B 2ZJAA 1SL1A 2K4HA 4EBJA 3BQ0A 4OAIZ 5L1IA 2ZH9A 7ICVA 2E5SA 5ALDA 1COKA 8ICBA 8ICCA 5HRLA 3KZXA 3WK8A 5C0YA 5AI0A 2ZH4A 5CP2A 2W3SA 1OW5A 4O3NA 5ALLA 4US8A 4BWMA 4X4QA 3QUTA 5EE0A 4O0IA 4RQ5A 2GA9D 5DB6A 2F1HA 3AL0B 3HJEA 4CF4A 5IIJA 4O67A 2HHTA 1IV8A 2LMRA 1J2NA 3TI0A 4KLSA 1T4GA 4RQMA 2JGAA 4UB4A 4BGDA 1PUZA 4DSKA 1IXRA 2KJ5A 5KFYA 4PHAA 1ZQHA 3WK5A 4GLXA 3WFPA 3M9OB 4BJQA 1ECWA 3EF2A 2IOHA 1ZQSA 4IQVA 1ZQKA 3ICXA 5HNKA 5AKJA 2PI5A 5HR9A 1FIQA 2NRTA 3K75D 4RPZA 9ICRA 3NVYA 2ZTEA 4IR1A 4RQ6A 5HRIA 4R63A 2XY5A 4UAUA 4QZAA 3V6JA 4X0BA 3AEVA 2RQ5A 4YP3A 1N48A 4RQ7A 3T5LA 3MR2A 8ICGA 4QW9A 2WF5A 2ASJA 4FO6A 1L3SA 5J0TA 2WHEA 5KFJA 4IC9A 3HIYA 2DPJA 4K4GA 2NRXA 2LYAA 1SV0C 3SAHA 4ED0A 5J2BA 4P4MA 3KHHA 4LEYA 2K89A 3C5FA 1Q78A 1TV9A 2BBJA 5KFZA 5C5JA 4YXMA 4RU9A 2P6UA 2FLNA 5CFTA 1NKCA 4WC6A 3RTVA 3TARA 4O5EA 3HPOA 2KE7A 2V4QA 5J0QA 4PZNA 1JQRA 3EPGA 1R89A 1ZQRA 3O0FA 4YXJA 2KIWA 2ZUCA 1V38A 4GXKA 4G9BA 2QKQA 4Q43A 3MABA 1WCLA 4PGQA 3V7JA 3MR5A 1AQ6A 4RQ0A 3M6KA 5AK5A 5ALPA 2JEJA 2BE3A 3GDXA 4NLBA 1ZQGA 4UD4A 7ICSA 1CRXA 1XU4A 5KFQA 3C1ZA 2YX8A 1FFVA 7ICNA 3OVBA 1BNPA 4JV2A 4K9BA 2Z7JA 1BPBA 5DG7A 3SYZA 4I2EA 4B9TA 5EWFA 4EEBA 1Z1BA 4WCWA 1DGSA 4YMOA 2RP5A 4FZMA 3GU3A 4X4VA 5AM2A 2WFAA 3Q8MA 4JV1A 1HIWA 4US9A 1X6JA 5KG7A 3HKZC 4E8FA 4P2HA 3THVA 5CR0A 2QB0A 2DF4B 5D49A 3PSPA 3JPOA 4QWBA 2K8AA 4J9MA 4QIWC 2DFLA 4RNMA 1BPYA 1KFTA 1CEZA 4X4UA 3K1ZA 4YFKA 2BQUA 1JALA 5DBAA 4F2SA 3UQ0A 5AHXA 2LKYA 2BCVA 7ICPA 4DL3A 1QQ7A 2Y0SF 2XICA 4PHPA 3L5KA 4DS5A 4I2CA 7ICEA 4J9NA 1WWUA 4WBYA 3ZI4A 5J0YA 4XQ7A 2W55A 4C4TA 3M1YA 4K98A 2MU2A 8ICUA 9ICTA 5KTQA 5HRHA 4QWDA 3PNCA 4IQUA 3WKEA 4DSFA 2FCLA 4ATBB 1LKYA 5GTHU 2BHNA 5KFKA 4OAGA 1UT8A 3ALRA 4DQRA 2YQEA 2EQYA 2NRKA 1WWVA 4IQTA 1URJA 4YN4A 5KT5A 1Z3EB 3I76A 2H3ZA 3BQTA 3F53A 3FDSA 5KT2A 5TZVA 5JU5A 1ZQNA 1ZQUA 5FP0A 5J2JA 5J0UA 2KK0A 5B5EU 2HOFA 5IIMA 4ECZA 1BNOA 2E1FA 4KLFA 3GV5B 2D8CA 5J0XA 4FH3A 4OJ6A 4J9PA 1S0NA 1EXNA 4DL7A 9ICJA 2DKZA 1NJWA 5CFUA 2EZYA 4GXJA 3SZ2A 2PFNA 2W7PA 1QQ6A 1ZD2P 5CHGA 2E8PA 3EYZA 1BGXT 1FA0A 4ELUA 4CGZA 4BDPA 2KFNA 2LYHA 1X6IA 4O69A 5AM3A 1CI4A 2A1AA 2RLTA 1COOA 5J2EA 4B9MA 3KKAC 3Q8PB 1MN8A 4O5CA 9ICFA 5EOZA 2J6UA 3DEEA 2W8KA 1TVAA 3DDHA 3OSNA 3LVVA 5ALSA 3BZKA 3TKAA 3G6YA 4QW8A 5AKGA 3H0LB 3NS1A 7ICRA 1UQVA 2ZIUB 4NXUA 1NJYA 4NLCA 4AT7A 5J2GA 5L1KA 4NXWA 4LJXA 1NK6A 1J97A 4QZHA 1DRGA 3TACB 5HRKA 4E7XA 2IMWP 5IINA 5HRFA 2L5YA 4RWPA 3IG5A 4QNLA 4F2RA 3CP8A 4BXOA 4UB3A 4LEZA 2E1EA 4DWIA 4TUQA 2G5IB 4Z6EA 4I2AA 5L9XA 4P0PA 3BDPA 5JUMA 3HJ1A 1WOTA 1N2XA 4PL1A 3AQFA 2PMZC 1LB2B 4KTQA 3PV8A 2WAQC 1V9PA 1VLBA 4NKTA 4RWOA 1NOMA 2KTQA 4QZ9A 1Z4OA 4EP7A 1F5SA 4KMUA 4ECVA 5JTGA 3OTQA 4DOCA 3H8JA 3M8RA 2D3DA 4JWNA 3AU6A 3OSPA 4DLEA 3B0XA 5DQHA 2ZH7A 4FZNA 1IG6A 3Q8KA 1ZQLA 4KLEA 2G07A 2GLEA 3UM9A 2F1IA 4EX6A 2HHUA 9ICQA 1FEZA 4RNOA 3BJYA 4M04A 2G09A 2BCUA 4RT3A 2KHVA 3UXNA 2M2VA 1K1QA 3QUBA 2WB1C 1Q3UA 3BQ1A 2A3VA 4I2JA 1UEUA 4YMNA 3LWMA 1ZQCA 4I29A 4S3NA 3JPRA 3PW7A 1JI7A 3C2KA 5KFLA 2Y1IA 4M2YA 2B51A 5KFDA 1T3NA 3EPIA 3C18A 3IN5A 2KICA 2DBYA 1GO3F 1XWLA 4YG2A 1Z00A 4EBDA 1Z1VA 5HC9A 4PPXA 4WC1A 3SI8A 2KP7A 1KRPA 2ZH1A 2VA8A 5KFIA 4CDGA 2XIDA 2P66A 4WJ3B 1RQLA 5DB7A 4ECUA 1ZETA 3WFRE 5ALTA 1S0VA 2MA1A 5AIBA 3H3AA 4ECYA 1ZD3A 3NWIA 1PZNA 1SV0A 4EZ6A 4Q8FA 2LM1A 5HRBA 2VA2A 2K4EA 1IM4A 5HMMA 3RJKA 2GH1A 5KT3A 2E3TA 3GIMA 4KLTA 2EH9A 5HHHA 1JRPA 2UVWA 4MKPA 3NGDA 5HR6A 3ISDA 4PZOA 1JN3A 4DSLA 3S6JA 4NLNA 2YTUA 4U7CA 4M9HA 4DSJA 2CPRA 4DSEA 1UPHA 5J2AA 4AT9A 2IUBA 4EENA 1X66A 1OUQA 4I0UA 3QU9A 3BS7A 4RUAA 1TAMA 4P0QB 3HKZF 2NO4A 2HBKA 3AM9A 4EEYA 5J0OA 2VIXA 3SAGA 2EANA 1WUDA 3WKDA 4FS2A 1ZQDA 4QIWF 2OHFA 3SV3A 1V4AA 3GZFA 3ZDAA 2K8BB 4R66A 4XQ8A 5KFGA 3HT3A 5TISU 9ICUA 2ZTCA 3N7SC 2G0AA 3LK9A 4XA5A 4F4WA 2IOFA 2WF8A 2OM6A 5AKYA 4F92B 3MBYA 4DFPA 2MUTA 9ICMA 5KAIU 1BPZA 1U49A 1D8BA 1F5AA 1NO5A 1UEVA 2HN2A 7ICKA 1TFYA 3PVXA 2BCSA 1HJPA 2F3NA 4Z6CA 2AGPA 1N5WA 2Q4TA 4FE3A 2XCAA 1QTMA 1D9DA 9ICAA 4C4SA 4M47A 4FZLA 1SKSA 4DQQA 9ICXA 1O08A 2HSZA 3TFRA 4KB6A 4C4RA 1KFSA 2JV3A 4DF8A 3KHRA 3WU2U 7ICFA 4R8UA 1ZJNA 4TUSA 4DL5A 3F2BA 4UB2A 1KDHA 1MQ3A 3GV7B 4B9NA 1SIJA 4C8NA 3JYYA 3RB6A 4DCCA 2D6FC 4UD5A 2RDIA 8ICMA 4KLIA 1QQ5A 2ODGA 5KFWA 5CHEA 2XO7A 3PX6A 8ICWA 4U6PA 4J03A 1ZRNA 1NJZA 1UETA 1S10A 1SB3C 5HREA 1UCVA 2E8OA 4ELVA 5AKIA 4WQLA 3C23A 3C5GA 3KBBA 5EE3A 3PY8A 2QB0B 2W43A 2LBOA 1L3VA 3BQ2A 4X4OA 3ERCC 1DK2A 1R8BA 3QEAZ 1JXEA 2KMDA 1XO0A 2XC9A 4F4ZA 3MFIA 9ICPA 1QCKA 2Q66A 2HHQA 2V4RA 8ICOA 2ASDA 3SAFA 4ECWA 3UPQA 4EV6A 1JIHA 4YR2A 1WCNA 5IIKA 4EX7A 1QH9A 4NWIA 5ALRA 2W9BB 2O1PA 1A6SA 2W9CA 5HP4A 4Y2VA 4DFJA 1S97A 2I9GA 5KFXA 4DFDA 5BPCA 3MGVA 1NKEA 4I2HA 4UBBA 4C8OA 5J29A 5B3QA 4F4KA 4Y2RA 3UQ2A 5KFNA 5ALVA 2HCFA 2HHXA 3WK9A 3PHZA 3M7DA 3GV8B 5KFFA 1MQ2A 4DEZA 1VFGA 2FPLA 5DDYA 2QB1A 2AU0A 2F44A 3RJGA 1L8OA 2ZHBA 3R9KA 5J8YC 2DKXA 3UMGA 4KLQA 3CYMA 3RBDA 2AQ4A 3WKCA 3UMBA 4M5DA 7ICHA 4XUSA 2PMZF 4BWJA 7ICTA 1TAUA 3HJ4A 1SV4A 5D62A 1TE2A 2WAQF 7ICGA 2VJ4A 2J6SA 3KKAA 5ALXA 2KZ3A 4ED7A 1JROA 5CFSA 1L7OA 3GILA 3M8SA 3QU5A 2DRBA 3G6XA 2MAXA 1L3UA 1M6YA 2C2RA 1ED1A 4F8RA 5EE1A 7ICLA 4YD2A 4DFKA 5KFAA 8ICEA 3ER9B 1PVRA 4KLJA 2Y9TA 2ZIWA 3ONNA 4F4YA 4QZFA 1SWVA 2ALZA 3LQCB 3QEBZ 4Y2XA 2KG5A 1R8AA 3CNHA 3TANA 4C7ZA 5KFHA 2AGQA 1ZXIA 1SZHA 5B66U 2ZUBA 1O03A 3OGUA 2WB1F 3N7PD 2K4PA 2YMPA 1MIYA 4EEKA 4M9GA 3EW9A 4LT6A 3EZ5A 5ALJA 2VANA 4ACOA 4FHVA 3ZD8A 3IHQB 2M0NA 1ZOLA 2JXJA 2C22A 4LVSA 1UA1A 5HRGA 2HHVA 2HI0A 2JZBA 5KFSA 3I28A 4BX9C 1A76A 4K9AA 4KLOA 1GPJA 9ICWA 4P0PB 3Q8RB 4J9SA 4LZDA 2RFFA 2LI6A 1FO4A 2ZJ5A 3BS5A 2K8CB 2DVIA 4Y2JA 4NM2A 5DBCA 2HW3A 5ALZA 1Q3VA 4IRKA 2ASLA 4J9OA 3J81j 3RFAA 3RRGA 3NVZA 1P7DA 3AQKA 2QARA 3SEIA 2H3QA 2VJ5A 3VCBA 4UB6U 2ZIVA 4RQ2A 3C29A 9ICOA 3C66A 3T5KA 1RM6C 5CA7A 2I5HA 4KLLA 1NK5A 1NNLA 5ALOA 3GFKB 2ZH8A 4TURA 1D8LA 3PW0A 1XC9A 2BR0A 3WFOA 1C20A 3T5JA 4F50A 2VKQA 2EAOA 1Q8KA 1MIWA 2P6RA 3PW4A 4C8LA 3D2SA 1N63A 4M6WB 4KITB 4WQKA 2PI4A 1L7PA 3RJHA 4TUPA 2AH5A 3Q8SB 3M9MB 2O5AA 2DGZA 3U26A 4TQSA 5EE9A 3RF9A 3OUYA 4KLDA 4Y2SA 2FMSA 3A0BU 3PR5B 2DRAA 2ZXHA 3BQ7A 2HVHA 5KG3A 2Q0ZX 4CF5A 3NVVA 3MR6A 5HMLA 2ZH6A 4DS4A 3HP6A 2R8KA 4PJ0U 2OH2A 2W54A 2ZIXB 4I2DA 1CUKA 3LVWA 1Z00B 1J2MA 5ALWA 1U9LA 5T14A 5ALHA 4ED3A 2AGOA 5DECA 2BPCA 2F76X 2HOIA 4AT8B 4CE6A 4Q45A 1X9WA 2KKPA 4UAVA 9ICLA 1A0PA 1DGJA 2ES6A 3K1RB 1YLQA 2W3RA 3F5EA 1LV5A 5F9NA 3KD3A 5AKXA 5AI5A 5D61A 5AKHA 5DGBA 3RH5A 1N56A 1ZQFA 2EZXA 1WG8A 2ID1A 3L4PA 2BPFA 3C21A 2KNJA 3QUCA 4RZRA 2KJ8A 3OHBA 5AIAA 4BUGA 1XO1A 2G06A 4IQWA 4ELTA 2PBEA 4F93B 3QZ7A 4DOAA 5E79U 2CN1A 4QZ8A 5L1LA 3K7DA 3JPSA 4JB3A 3WK6A 1S0OA 2B21A 4NV0A 2KSOB 2ZXIA 3Q8QB 3DV9A 3T3FA 3SENA 2LHTA 2FJ6A 3FAHA 4JMUA 4GFJA 4CNQA 4CRXA 8ICJA 5ALNA 1XSPA 4FBUA 3QUQA 2NO5A 2JR5A 2ZG6A 4FHPA 4QZGA 8ICPA 2PXIA 4USAA 2M2TA 4RUCA 2ISOA 3H37A 1ZQ1C 4RPXA 2XCPA 5J2HA 4QZEA 4OAFA 2BKEA 4F71A 1YZ7A 2QLTA 1KKXA 9ICCA 3D2QA 1TK5A 2A19A 4FO1A 4NJ8A 4KM5A 5CEHA 5CWRA 4B6JA 5ALEA 3H7IA 5AM0A 3PO5A 4NXTA 3ZDEA 2H3VA 5F2VO 1QLNA 3HW8A 5G5HA 5KG6A 4GXIA 3Q8LA 3V72A 5CB1A 2E8NA 2P35A 2AXTU 7ICOA 3AQNA 3B0YA 4KLUA 5AK6A 2DL0A 4EYHB 1SKRA 4M9NA 2JRZA 4NY8A 1KW4A 2KFZA 4R8UB 1MSWD 3H0MB 5ALUA 3H4BA 1X42A 1ZQTA 3QU2A 2ISPA 4QWCA 2WF9A 2WTFA 2R8GA 1B43A 1U4BA 4JLZA 5F3XB 3UPSA 3MC1A 4F5OA 4OJ5A 5AICA 4DQPA 1XSLA 2FPMA 4RQ1A 3GIIA 4UB8U 3C28A 4C7YA 3H8MA 1ZYQA 1NK4A 1XS9D 2KKVA 5KT6A 4Y2PA 4DF4A 4K96A 1B22A 4O3MA 2WF6A 2HBJA 3OJSA 2DR8A 5BOLA 2B6GA 3N7RC 4OJLA 4NM1A 4DL4A 3C1YA 5KFEA 5EWGA 4DLGA 3LYSA 2PFOA 2HHSA 5DBBA 5F9LA 4B9UA 2JEIA 1NK8A 2FLLA 3QU7A 4UBCA 4X0AA 3FYHA 3F5AA 3NKUA 1RXVA 3IG8A 5J8YA 2NRZA 4KLGA 4ZOHC 4EYIB 5J2IA 4WC0A 4Y2QA 1RPLA 5AKLA 4NXVA 3KZIU 9ICVA 2XVTA 4N7RA 3EWAA 1KFDA 2W9CB 4I28A 2NRVA 1YZ6A 3ZD9A 2G08A 3QXGA 2A1JA 2Y1JA 4JUZA 3RH4A 2CRXA 3UXOA 5AK3A 1AROP 9ICIA 5IIIA 1Z4NA 1L7NA 2W11A 3HILA 3RB0A 3D2NA 1TK8A 3C2LA 1L6NA 4YCXA 5AI4A 8ICAA 1KQQA 2HBMA 2YMQA 1PX5A 4OJOA 2WF7A 7ICMA 3F2DA 2XY7A 3JPQA 1QSYA 3IP4B 1LVHA 4AYBC 1SL0A 4K4IA 1VJ7A 3AUOA 1A77A 4Z6DA 2H3IA 1KBUA 3MFHA 2M2WA 3MDCA 5AKKA 2R8IA 5AI9A 1RDFA 2ZIUA 5IILA 5KFCA 3UXPA 2BBHA 3RH6A 3MR3A 1DK3A 3M6ZA 5AM5A 3SV4A 4J9QA 2BPGA 4EBKA 3H8WA 1TAQA 4PGYA 5KG2A 3JPTA 4GIBA 2W8LA 1PK1A 5GTIU 1FFUA 4NL9C 2I6XA 1NZPA 3HX0A 1ZQBA 1RQNA 2J6TA 9ICSA 5AI6A 3TADC 4QZCA 3JCFA 4RPYA 2F1JA 4WC2A 1R8CA 1B4FA 4WC7A 1H38A 4LZGA 4NKUA 5A0LA 3PMNA 2IA6A 3ORYA 3H38A 4EZ9A 1Y88A 4OD0A 4NLZA 4WOYA 4YVZA 2BDUA 4F5NA 5KT4A 8ICYA 1D9FA 4OJPA 5KFPA 5BOMA 3ZDCA 4RWQA 5CRXA 2JEGA 2FLPA 1ZQPA 2KV2A 4DOBA 3CW2C 2OXOA 1NK9A 8ICRA 4RQ4A 3KHLA 9ICBA 3MDAA 1MIVA 2DUYA 3RJIA 4YMMA 3NASA 1OXJA 3C2MA 4EBEA 5J2CA 1RXWA 4ED1A 1X9SA 1X9XA 4I2FA 1D8YA 5AKEA 5DEDA 4PHDA 2DR7A 3KTQA 4K99A 2QARB 5KFMA 4C0ZA 2IBKA 2ZIVB 4IRCA 2KVSA 3H0RB 1T3QA 2DPIA 4ECSA 1K1SA 1RYRA 4R65A 4J9KA 5EWEA 1XSNA 2KZZA 2JH1A 1SWWA 3GQCA 4B9SA 4FHWA 4I2GA 2C2EA 1DXSA 5B3PA 2JH7A 5KFTA 1N62A 4QZDA 3OWGA 3ETRA 4HYKA 4DO9A 1T8EA 3AU2A 5DG9A 3V7KA 3T5HA 3ETLA 4Z6FA 4IRDA 3WKBA 3EUB2 2ATLA 5CJ7A 4EELA 1LKYB 2MSNA 4HX0A 3IRUA 3OUYB 4WC3A 1KSPA 4NXZA 1X9MA 9ICKA 5KFOA 4JLXA 3JZ0A 3PW5A 1MC8A 4HAIA 3RAQA 5KNIA 1RYUA 4UARA 1ZJMA 1ZQIA 3SD7A 3KFUF 2KJ9A 3PW2A 2NYVA 2OYYA 2R8HA 2ZH3A 3H4DA 2ZUDA 2C28A 9ICHA 4F3OA 3NVWA 3AQLA 5KFVA 3QZ8A 4P0QA 1NJXA 3QE9Y 1HEKA 1ZRMA 2HHWA 2EZZA 5JTIA 4M0AA 2FPKA 1F44A 4O3OA 3OVSA 1ZQXA 5ALQA 1SGGA 3CRXA 8ICLA 4DL2A 3TAPA 1X40A 2KD1A 2GAFD 2MRLA 2W9AA 1YT3A 4I27A 2IOFK 1QSSA 2KN7A 4K8VA 3PO4A 2OCEA 5HR7A 1ZQQA 4EEDA 5KT7A 2AJQA 3NVOA 2W7OA 3WK4A 3NUQA 4UB5A 4YQWA 4DSIA 2G5HB 5KFUA 4IS7A 2PKEA 5D63A 1WYGA 3RR7A 3N4MB 4AT7B 1BPDA 3H8SA 3M9NB 2OWOA 2C2DA 5AI8A 4DQIA 2W04A 1JX4A 2JHDA 4FHXA 3ISBA 4UB1A 4BXOB 1ZQEA 4MF8A 1F0MA 4KN4A 2CXYA 2V9WA 1VDVA 1T7PA 4O5KA 2HN1A 5J0WA 2KIVA 4K4HA 3UMCA 5KG4A 4UAYA 4X5VA 3AN1A 4KN7A 4AP9A 4E80A 1RG6A 4E0DA 4O3PA 2ZJ8A 8ICZA 4M9LA 5KL8B 2K60A 4O9MA 4X4NA 5L1MA 4RQ8A 2DR9A 2XY6A 3ER8C 1TKDA 2BGWA 2UVRA 1NKBA 3ZDBA 2IHNA 5ALKA 4ZH4A 5ALGA 4P4PA 1X2IA 1U48A 2W03A 2O6KA 3K4GA 3QU4A 1S77D 4YD1A 3SR6A 1ZQOA 2LPEA 1ZQJA 1L7MA 5ALFA 4KLHA 3MGHA 4KLMA 2BQ3A 4FHYA 4YR3A 4ED2A 3RB4A 1JMSA 4DQSA 3RJEA 4R64A 1ZQZA 4F5QA 3RAXA 1L5UA 4J9RA 1NI3A 2K4IA 3RJJA 3PZPA 2W9BA 1PVPA 4AYBF 3JPPA 5J2DA 3ED5A 3LWLA 2JEFA 3TFSA 2YMMA 3OVAA 2XGQA 2ZHAA 5AKZA 5ALMA 4NLKA 5H2FU 2NV3A 4X4PA 4MF2A 9ICGA 4ECXA 2ESEA 3WFSC 4RQNA 4UAWA 1JAJA 2GOLA 4Q44A 4O68A 2W9MA 2BZFA 5DLFA 1ZD5A 2PFQA 5G5GA 1NK7A 3HRDD 3F2CA 4ECTA 1Q79A 4QWAA 5HRDA 1MA7A 4OO1J 1KLNA 5AM4A 1NZBA 5KG5A 5DB9A 8ICFA 4OCZA 4XJEA 1BPEA 3OV7A 1SZPA 5DGAA 2R18A 2HDOA 4IL6U 4CCHA 2F8LA 1PK3A 3NTUA 2F2AB 3PR4A 1U47A 4F5RA 2A1JB 2ZTDA 4PHEA 4UW9A 5D4BA 1SXEA 4MEYA 2OEHA 5J0PA 1UT5A 3L3FX 3WKAA 2FE9A 2UVUA 2KVCA 3VC8A 3E0FA 1Q46A 5KG1A 2EAMA 1SKWA 4AT9B 2I1QA 5JRTA 3N28A 2XI9A 4M9JA 4X4TA 1HUZA 4RNNA 1SXDA 3PMLA 4LEVA 3NRWA 4WC4A 3QX7A 3SQIA 8ICSA 3AQEA 1ZQAA 4Q8EA 2HVIA 2KOBA 4NL9A 4PH5A 1K5OA 1RZTA 1BVSA 2YB1A 4Y2TA 2IHMA 3V6KA 3TADA 2LM4A 5HHIA 2B0CA 3V6HA 8ICVA 4FS1A 1L8LA 4QZIA 1KN5A 2FMQA 1TFRA 4C80A 2DR5A 3FM9A 2GO7A 3GIJA 3N97B 2MUTB 4UQGA 5AM1A 1V85A 1TK0A 4JV0A 4ECQA 1ZD4A 2E8MA 4GC7A 2IHOA 5KL1B 3PSFA 1JUDA 3CK6A 5KAFU 3TAQA 3OPXA 3V7LA 3NRZA 1PK1B 2ZH2A 4QJFB 3PX0A 3MCRA 1KL9A 1UA0A 4ICAA 8ICTA 2RRDA 9ICEA 3GIKA 7ICUA 1ZQWA 4WBZA 1NK0A 3JPNA 4XRHA 1B0XA 5KG0A 1ZQVA 5J0RA
chains in the Genus database with same CATH topology
1L3UA 2NRWA 2FMPA 4IQTA 2C2RA 1NZPA 4F8RA 3HX0A 7ICLA 1ZQBA 2J6TA 4J9LA 4YN4A 5KT5A 4YD2A 4M6WA 4DFKA 9ICSA 5KFAA 8ICEA 1Z3EB 4ED6A 4QZCA 4RPYA 2PFPA 2F1JA 3HWTA 4EBCA 4WC2A 3MGIA 4KLJA 3BQTA 1R8CA 4WC7A 3FDSA 5KT2A 1H38A 4F4YA 5TZVA 1RYSA 3PMNA 4LZGA 4QZFA 2IA6A 4QZBA 3ORYA 3AQMA 2ALZA 4ATBA 1ZQNA 3LQCB 3H38A 3QEBZ 2H5XA 1Y88A 1ZQUA 4I2IA 4EZ9A 5J2JA 4NLZA 5J0UA 1R8AA 4YVZA 4F5NA 5KT4A 3RR8A 8ICYA 3TANA 1D9FA 5KFHA 5KFPA 4UAZA 4ECRA 5IIMA 5BOMA 2AGQA 3ZDCA 4F5PA 4RWQA 4ECZA 2ZUBA 1BNOA 2JEGA 4NLGA 4KLFA 2FLPA 3OGUA 1BPXA 1ZQPA 5IIOA 4DOBA 3GV5B 5KFRA 2R8JA 5J0XA 1NK9A 8ICRA 4RQ4A 3PX4A 4FH3A 3KHLA 9ICBA 4JK1A 1MIYA 4J9PA 4O3SA 3MDAA 1S0NA 1JXLA 4M9GA 3EW9A 1MIVA 3ISCA 3EZ5A 4LT6A 1EXNA 3RJIA 2VANA 4DL7A 9ICJA 4YMMA 1NJWA 4FHVA 3ZD8A 3C2MA 4EBEA 5J2CA 1SL2A 3IHQB 5DG8A 4GXJA 2C22A 3SZ2A 1RXWA 4LVSA 4ED1A 1X9SA 2PFNA 1S76D 1UA1A 4I2FA 1D8YA 5DEDA 1L3TA 4PHDA 4AT8A 5CHGA 1QSLA 3EYZA 1BGXT 5KFSA 2JZBA 4DFMA 3KTQA 4ELUA 2HHVA 1FA0A 2DR7A 5KFMA 4BDPA 2KFNA 1A76A 2LYHA 2RDJA 4X4RA 2IBKA 4IRCA 3E2EA 1COOA 2DPIA 4ECSA 5J2EA 1K1SA 4B9MA 4KLOA 3Q8PB 1RYRA 4R65A 4O5CA 9ICFA 5EOZA 4J9KA 3RB3A 2W8KA 2J6UA 9ICWA 4G3IA 3JZ0A 5EWEA 1TVAA 1XSNA 3Q8RB 3OSNA 3H40A 4J9SA 4LZDA 2KZZA 8ICXA 2RFFA 8ICMA 4FH5A 3G6YA 8ICQA 2ZJ5A 4QW8A 5KFBA 3GQCA 2DVIA 4B9SA 4O3RA 4FHWA 4I2GA 7ICRA 2C2EA 8ICIA 4NM2A 5DBCA 4RT2A 3RBEA 5KFTA 2HW3A 1NJYA 4AT7A 4FBTA 3RJFA 2AQ0A 2ASLA 5J2GA 4J9OA 4QZDA 5L1KA 4MEXA 5DQGA 4HYKA 4DO9A 1NK6A 3RRGA 4QZHA 1T8EA 5HRKA 7ICQA 3AU2A 3AQKA 5DG9A 2IMWP 1C7YA 4E7XA 5IINA 3TQ1A 5HRFA 4RWPA 3V7KA 3T5HA 3ETLA 4F2RA 4Z6FA 4RQ2A 4ED8A 1HUOA 2ZH5A 9ICOA 2BQRA 1U45A 4IRDA 4BXOA 1KTQA 4UB3A 4C8KA 3C66A 4MFAA 3T5KA 5CA7A 2ATLA 5CJ7A 4MFFA 4DWIA 4TUQA 4JWMA 4Z6EA 4I2AA 4KLLA 5L9XA 4TQRA 2BCQA 4O3QA 4MFCA 3BDPA 1NK5A 5JUMA 3IM1A 3GFKB 2ZH8A 4GC6A 4TURA 3HJ1A 1D8LA 3PW0A 7ICIA 1OU5A 1KEJA 1WOTA 1XC9A 4WC3A 2BR0A 3WFOA 1LB2B 5DKWA 3T5JA 1KSPA 3PV8A 4F50A 4KTQA 4NXZA 1X9MA 9ICKA 1V9PA 3L9DA 5KFOA 3G6VA 4B9LA 4NKTA 5D46A 4RWOA 1NOMA 2P6RA 3PW5A 1MC8A 4QZ9A 4IR9A 2KTQA 5L1JA 3RAQA 1MIWA 3PW4A 4C8LA 4KMUA 4EP7A 4ECVA 4KITB 4M6WB 1DOQA 1ZJMA 1ZQIA 4DOCA 2KZMA 1S9FA 1KNYA 2M9NA 5J2FA 2PI4A 3RJHA 1S0MA 4TUPA 3H8JA 3Q8SB 3M8RA 3PW2A 3M9MB 4JWNA 3AU6A 3OSPA 4I2BA 8ICKA 2O5AA 4DLEA 3NYBA 3B0XA 5DQHA 2ZH7A 2GWSA 3KHGA 4TQSA 2M2UA 2R8HA 3Q8KA 4X4SA 1ZQLA 2ZH3A 3H4DA 4KLEA 2ZUDA 2C28A 4KLDA 2UVVA 3OUYA 5J0SA 2FMSA 9ICHA 3PR5B 4F3OA 2DRAA 3AQLA 5KFVA 3QZ8A 1NJXA 3WFQE 3ZDDA 2F1IA 3QE9Y 4EBJA 4P4OA 3OHAA 2HVHA 5KG3A 2BDPA 2Q0ZX 2HHWA 2HHUA 3MR6A 9ICQA 5HMLA 4RQ3A 4M0AA 2FPKA 2ZH6A 4O3OA 4B9VA 4DS4A 3OVSA 3HP6A 1ZQXA 4QWEA 4RNOA 3OJUA 3BJYA 2R8KA 4M04A 8ICNA 3H39A 2BCUA 4I2DA 4RT3A 1CUKA 1ZQMA 2HHPA 1Z00B 5DB8A 1ZQYA 3UXNA 4YR0A 1U9LA 2M2VA 5DLGA 1K1QA 4PGXA 4ED3A 2AGOA 8ICLA 3BQ1A 5J2KA 4DL2A 4I2JA 3LDAA 8ICHA 4YMNA 3TAPA 1UEUA 2BPCA 3LWMA 1ZQCA 5DECA 4I29A 7ICJA 1X9WA 4Q45A 2W9AA 4AT8B 4S3NA 2JZBB 3RRHA 2JEFA 3JPRA 9ICLA 5DQIA 2BCRA 2XGPA 3PW7A 4C8MA 4WC5A 4I27A 9ICNA 5DDMA 4F91B 1TFWA 3C2KA 5KFLA 2Y1IA 4M2YA 4RWNA 5KFDA 1T3NA 1YLQA 3EPIA 1QSSA 3C18A 2KN7A 3PO4A 4F4XA 1LV5A 1ZQQA 5KT7A 2AJQA 5F9NA 4DL6A 1XWLA 2VA3A 4YG2A 1Z00A 4EBDA 5DGBA 3H37A 4UB5A 5HC9A 4PPXA 4WC1A 4YQWA 3RH5A 1N56A 1ZQFA 3SI8A 4DSIA 2ZJAA 5KFUA 1SL1A 2KP7A 1KRPA 3RR7A 3BQ0A 3N4MB 2ID1A 2VA8A 5KFIA 2BPFA 3C21A 4AT7B 5L1IA 2ZH1A 7ICVA 1BPDA 4RZRA 2P66A 3H8SA 2ZH9A 3M9NB 2OWOA 3OHBA 8ICBA 2C2DA 5DB7A 1XO1A 4ECUA 8ICCA 1ZETA 4DQIA 4IQWA 5HRLA 3WFRE 4ELTA 2PBEA 4F93B 3QZ7A 1S0VA 4DOAA 1JX4A 3H3AA 4ECYA 2ZH4A 5CP2A 4FHXA 3ISBA 4QZ8A 4UB1A 4BXOB 5L1LA 1ZQEA 4MF8A 4KN4A 4O3NA 1PZNA 3JPSA 4EZ6A 4BWMA 2V9WA 4X4QA 4Q8FA 1T7PA 1S0OA 4O5KA 4O0IA 2B21A 5HRBA 5J0WA 4RQ5A 2VA2A 1IM4A 5HMMA 3RJKA 3Q8QB 5KT3A 4K4HA 5KG4A 4UAYA 3GIMA 3T3FA 4KLTA 5DB6A 2F1HA 5HHHA 4X5VA 2UVWA 4KN7A 4E80A 3NGDA 4E0DA 5IIJA 3ISDA 3OVAA 4O3PA 2HHTA 2ZJ8A 8ICJA 1JN3A 4DSLA 8ICZA 3TI0A 4KLSA 1XSPA 1T4GA 4FBUA 4M9LA 4NLNA 4UB4A 4O9MA 4X4NA 4BGDA 4RQ8A 4M9HA 4DSJA 2XY6A 4FHPA 1TKDA 2DR9A 4QZGA 8ICPA 4DSKA 4DSEA 1IXRA 2BGWA 2PXIA 2M2TA 4RUCA 2ISOA 2UVRA 1NKBA 5KFYA 4PHAA 5J2AA 1ZQHA 3ZDBA 4RPXA 2XCPA 5J2HA 4AT9A 4GLXA 2IHNA 3WFPA 3M9OB 3OUYB 4QZEA 4ZH4A 1ZQSA 4P4PA 4NKUA 1X2IA 2BKEA 4IQVA 1U48A 3K4GA 4RUAA 1S77D 4YD1A 1ZQOA 9ICCA 1TK5A 1ZQJA 1ZQKA 4EEYA 4KLHA 5J0OA 3MGHA 4KLMA 5HNKA 2BQ3A 4FHYA 4YR3A 4ED2A 2PI5A 5HR9A 3RB4A 2NRTA 1JMSA 3K75D 4DQSA 4RPZA 3RJEA 9ICRA 4R64A 1ZQZA 4FS2A 2ZTEA 1ZQDA 4IR1A 5CWRA 4RQ6A 4F5QA 4R63A 5HRGA 5HRIA 3H7IA 3RAXA 2XY5A 3PO5A 3SV3A 4QZAA 1L5UA 1V4AA 3ZDEA 3ZDAA 3V6JA 4J9RA 4X0BA 3RJJA 4R66A 1QLNA 5F2VO 3HW8A 5KG6A 4XQ8A 5KFGA 3HT3A 4YP3A 2W9BA 1N48A 9ICUA 4GXIA 2ZTCA 4RQ7A 3T5LA 3MR2A 8ICGA 4QW9A 3JPPA 5J2DA 3LK9A 5CB1A 3LWLA 3V72A 3Q8LA 4XA5A 4F4WA 4FO6A 2XGQA 3TFSA 5J0TA 3B0YA 2ASJA 1L3SA 4KLUA 7ICOA 3AQNA 5KFJA 4EYHB 1SKRA 3HIYA 4M9NA 2DPJA 4K4GA 2NRXA 4NLKA 4F92B 4NY8A 2KFZA 4R8UB 3MBYA 1MSWD 3H4BA 4DFPA 2MUTA 9ICMA 1BPZA 1U49A 1F5AA 1NO5A 1UEVA 4ED0A 5J2BA 4X4PA 7ICKA 1TFYA 1ZQTA 2ISPA 3PVXA 4MF2A 2BCSA 4QWCA 9ICGA 1HJPA 4P4MA 2WTFA 4ECXA 2R8GA 3WFSC 3KHHA 1B43A 2DR8A 4UAWA 1U4BA 4Z6CA 2AGPA 1JAJA 4Q44A 2XCAA 3UPSA 2W9MA 3C5FA 1Q78A 4F5OA 1QTMA 5DLFA 1TV9A 2PFQA 4DQPA 1D9DA 1XSLA 9ICAA 2FPMA 4M47A 1NK7A 4RQ1A 3GIIA 1SKSA 4ECTA 4DQQA 9ICXA 1Q79A 4QWAA 5KFZA 5C5JA 5HRDA 4YXMA 4RU9A 1KLNA 2P6UA 2FLNA 4WC6A 1NKCA 3TFRA 5KG5A 3RTVA 1ZYQA 1NK4A 5DB9A 3TARA 5KT6A 1XS9D 8ICFA 4O5EA 4DF4A 1KFSA 3HPOA 1B22A 4DF8A 3KHRA 7ICFA 4R8UA 3OJSA 1ZJNA 2V4QA 5J0QA 1BPEA 4TUSA 4DL5A 1SZPA 5BOLA 3EPGA 4UB2A 1JQRA 1R89A 3OV7A 1KDHA 1ZQRA 4YXJA 1MQ3A 5DGAA 3GV7B 2ZUCA 4CCHA 4B9NA 4NM1A 4DL4A 4GXKA 3C1YA 5KFEA 4Q43A 5EWGA 3NTUA 4C8NA 3PR4A 4DLGA 3RB6A 1U47A 3JYYA 4F5RA 3MABA 4UD5A 1WCLA 2RDIA 4PGQA 2PFOA 2HHSA 2A1JB 5DBBA 5F9LA 3MR5A 2ZTDA 3V7JA 4PHEA 4B9UA 4RQ0A 1NK8A 4KLIA 2JEIA 5D4BA 5KFWA 4MEYA 2XO7A 2FLLA 4UBCA 3PX6A 2JEJA 3FYHA 4X0AA 2BE3A 5J0PA 8ICWA 1UT5A 3GDXA 1ZQGA 2ZHAA 1NJZA 4UD4A 1RXVA 1UETA 1S10A 2NRZA 2UVUA 7ICSA 4KLGA 5HREA 1XU4A 4EYIB 5J2IA 4ELVA 5KFQA 4WC0A 4IRKA 1RPLA 3C1ZA 5KG1A 1SKWA 3C23A 4AT9B 2I1QA 3C5GA 7ICNA 9ICVA 3OVBA 3PY8A 4M9JA 3EWAA 1BNPA 1KFDA 2W9CB 4JV2A 4I28A 2NRVA 1BPBA 5DG7A 3ZD9A 3SYZA 4X4TA 1HUZA 4I2EA 1L3VA 4RNNA 4B9TA 3PMLA 5EWFA 3BQ2A 2A1JA 4X4OA 2Y1JA 1DK2A 4WC4A 4JUZA 3RH4A 1R8BA 8ICSA 1ZQAA 3QEAZ 1JXEA 3UXOA 4Q8EA 2HVIA 4WCWA 1DGSA 2XC9A 4YMOA 4F4ZA 4PH5A 3MFIA 9ICPA 1AROP 9ICIA 4X4VA 5IIIA 1RZTA 1BVSA 2Q66A 3Q8MA 2HHQA 4JV1A 2V4RA 2IHMA 8ICOA 2ASDA 5KG7A 4ECWA 3UPQA 3RB0A 3V6KA 5HHIA 1JIHA 1TK8A 4YR2A 1WCNA 3V6HA 8ICVA 3C2LA 5IIKA 4E8FA 4FS1A 2W9BB 4P2HA 2O1PA 3THVA 5CR0A 4YCXA 8ICAA 2W9CA 5HP4A 4DFJA 5D49A 1S97A 4QZIA 3JPOA 2I9GA 5KFXA 4QWBA 1PX5A 5BPCA 1NKEA 4J9MA 4UBBA 2FMQA 1TFRA 4I2HA 2DR5A 4C8OA 2DFLA 3GIJA 5J29A 4RNMA 1BPYA 4F4KA 7ICMA 3N97B 2XY7A 1KFTA 2MUTB 3JPQA 5KFNA 3UQ2A 1QSYA 4UQGA 1CEZA 4X4UA 4YFKA 2BQUA 1TK0A 5DBAA 2HHXA 4IG8A 4JV0A 4ECQA 4F2SA 1SL0A 4K4IA 4GC7A 3UQ0A 1VJ7A 3AUOA 2BCVA 1A77A 4Z6DA 7ICPA 4DL3A 3GV8B 5KFFA 3MFHA 3TAQA 3V7LA 1MQ2A 4PHPA 3MDCA 2M2WA 4DS5A 2ZH2A 4DEZA 1VFGA 2FPLA 5DDYA 2R8IA 4I2CA 7ICEA 5IILA 3PX0A 4J9NA 5KFCA 2AU0A 3UXPA 4WBYA 3RJGA 5J0YA 4XQ7A 3RH6A 3MR3A 1UA0A 2ZHBA 1DK3A 4KLQA 8ICTA 9ICEA 3GIKA 3RBDA 2AQ4A 3SV4A 7ICUA 8ICUA 4J9QA 4M5DA 7ICHA 4XUSA 9ICTA 5KTQA 4BWJA 2BPGA 7ICTA 4EBKA 3H8WA 5HRHA 1ZQWA 4QWDA 1TAQA 1TAUA 4WBZA 3HJ4A 1NK0A 3PNCA 4IQUA 4PGYA 4DSFA 3JPNA 7ICGA 4ATBB 5KG2A 2J6SA 2KZ3A 4ED7A 4XRHA 3JPTA 2BHNA 5KFKA 5KG0A 1ZQVA 1UT8A 5J0RA 3GILA 4DQRA 3M8SA 2W8LA 2DRBA 3G6XA 2MAXA 2NRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L3U A;  2NRW A;  2FMP A;  4IQT A;  2C2R A;  1NZP A;  4F8R A;  3HX0 A;  7ICL A;  1ZQB A;  2J6T A;  4J9L A;  4YN4 A;  5KT5 A;  4YD2 A;  4M6W A;  4DFK A;  9ICS A;  5KFA A;  8ICE A;  1Z3E B;  4ED6 A;  4QZC A;  4RPY A;  2PFP A;  2F1J A;  3HWT A;  4EBC A;  4WC2 A;  3MGI A;  4KLJ A;  3BQT A;  1R8C A;  4WC7 A;  3FDS A;  5KT2 A;  1H38 A;  4F4Y A;  5TZV A;  1RYS A;  3PMN A;  4LZG A;  4QZF A;  2IA6 A;  4QZB A;  3ORY A;  3AQM A;  2ALZ A;  4ATB A;  1ZQN A;  3LQC B;  3H38 A;  3QEB Z;  2H5X A;  1Y88 A;  1ZQU A;  4I2I A;  4EZ9 A;  5J2J A;  4NLZ A;  5J0U A;  1R8A A;  4YVZ A;  4F5N A;  5KT4 A;  3RR8 A;  8ICY A;  3TAN A;  1D9F A;  5KFH A;  5KFP A;  4UAZ A;  4ECR A;  5IIM A;  5BOM A;  2AGQ A;  3ZDC A;  4F5P A;  4RWQ A;  4ECZ A;  2ZUB A;  1BNO A;  2JEG A;  4NLG A;  4KLF A;  2FLP A;  3OGU A;  1BPX A;  1ZQP A;  5IIO A;  4DOB A;  3GV5 B;  5KFR A;  2R8J A;  5J0X A;  1NK9 A;  8ICR A;  4RQ4 A;  3PX4 A;  4FH3 A;  3KHL A;  9ICB A;  4JK1 A;  1MIY A;  4J9P A;  4O3S A;  3MDA A;  1S0N A;  1JXL A;  4M9G A;  3EW9 A;  1MIV A;  3ISC A;  3EZ5 A;  4LT6 A;  1EXN A;  3RJI A;  2VAN A;  4DL7 A;  9ICJ A;  4YMM A;  1NJW A;  4FHV A;  3ZD8 A;  3C2M A;  4EBE A;  5J2C A;  1SL2 A;  3IHQ B;  5DG8 A;  4GXJ A;  2C22 A;  3SZ2 A;  1RXW A;  4LVS A;  4ED1 A;  1X9S A;  2PFN A;  1S76 D;  1UA1 A;  4I2F A;  1D8Y A;  5DED A;  1L3T A;  4PHD A;  4AT8 A;  5CHG A;  1QSL A;  3EYZ A;  1BGX T;  5KFS A;  2JZB A;  4DFM A;  3KTQ A;  4ELU A;  2HHV A;  1FA0 A;  2DR7 A;  5KFM A;  4BDP A;  2KFN A;  1A76 A;  2LYH A;  2RDJ A;  4X4R A;  2IBK A;  4IRC A;  3E2E A;  1COO A;  2DPI A;  4ECS A;  5J2E A;  1K1S A;  4B9M A;  4KLO A;  3Q8P B;  1RYR A;  4R65 A;  4O5C A;  9ICF A;  5EOZ A;  4J9K A;  3RB3 A;  2W8K A;  2J6U A;  9ICW A;  4G3I A;  3JZ0 A;  5EWE A;  1TVA A;  1XSN A;  3Q8R B;  3OSN A;  3H40 A;  4J9S A;  4LZD A;  2KZZ A;  8ICX A;  2RFF A;  8ICM A;  4FH5 A;  3G6Y A;  8ICQ A;  2ZJ5 A;  4QW8 A;  5KFB A;  3GQC A;  2DVI A;  4B9S A;  4O3R A;  4FHW A;  4I2G A;  7ICR A;  2C2E A;  8ICI A;  4NM2 A;  5DBC A;  4RT2 A;  3RBE A;  5KFT A;  2HW3 A;  1NJY A;  4AT7 A;  4FBT A;  3RJF A;  2AQ0 A;  2ASL A;  5J2G A;  4J9O A;  4QZD A;  5L1K A;  4MEX A;  5DQG A;  4HYK A;  4DO9 A;  1NK6 A;  3RRG A;  4QZH A;  1T8E A;  5HRK A;  7ICQ A;  3AU2 A;  3AQK A;  5DG9 A;  2IMW P;  1C7Y A;  4E7X A;  5IIN A;  3TQ1 A;  5HRF A;  4RWP A;  3V7K A;  3T5H A;  3ETL A;  4F2R A;  4Z6F A;  4RQ2 A;  4ED8 A;  1HUO A;  2ZH5 A;  9ICO A;  2BQR A;  1U45 A;  4IRD A;  4BXO A;  1KTQ A;  4UB3 A;  4C8K A;  3C66 A;  4MFA A;  3T5K A;  5CA7 A;  2ATL A;  5CJ7 A;  4MFF A;  4DWI A;  4TUQ A;  4JWM A;  4Z6E A;  4I2A A;  4KLL A;  5L9X A;  4TQR A;  2BCQ A;  4O3Q A;  4MFC A;  3BDP A;  1NK5 A;  5JUM A;  3IM1 A;  3GFK B;  2ZH8 A;  4GC6 A;  4TUR A;  3HJ1 A;  1D8L A;  3PW0 A;  7ICI A;  1OU5 A;  1KEJ A;  1WOT A;  1XC9 A;  4WC3 A;  2BR0 A;  3WFO A;  1LB2 B;  5DKW A;  3T5J A;  1KSP A;  3PV8 A;  4F50 A;  4KTQ A;  4NXZ A;  1X9M A;  9ICK A;  1V9P A;  3L9D A;  5KFO A;  3G6V A;  4B9L A;  4NKT A;  5D46 A;  4RWO A;  1NOM A;  2P6R A;  3PW5 A;  1MC8 A;  4QZ9 A;  4IR9 A;  2KTQ A;  5L1J A;  3RAQ A;  1MIW A;  3PW4 A;  4C8L A;  4KMU A;  4EP7 A;  4ECV A;  4KIT B;  4M6W B;  1DOQ A;  1ZJM A;  1ZQI A;  4DOC A;  2KZM A;  1S9F A;  1KNY A;  2M9N A;  5J2F A;  2PI4 A;  3RJH A;  1S0M A;  4TUP A;  3H8J A;  3Q8S B;  3M8R A;  3PW2 A;  3M9M B;  4JWN A;  3AU6 A;  3OSP A;  4I2B A;  8ICK A;  2O5A A;  4DLE A;  3NYB A;  3B0X A;  5DQH A;  2ZH7 A;  2GWS A;  3KHG A;  4TQS A;  2M2U A;  2R8H A;  3Q8K A;  4X4S A;  1ZQL A;  2ZH3 A;  3H4D A;  4KLE A;  2ZUD A;  2C28 A;  4KLD A;  2UVV A;  3OUY A;  5J0S A;  2FMS A;  9ICH A;  3PR5 B;  4F3O A;  2DRA A;  3AQL A;  5KFV A;  3QZ8 A;  1NJX A;  3WFQ E;  3ZDD A;  2F1I A;  3QE9 Y;  4EBJ A;  4P4O A;  3OHA A;  2HVH A;  5KG3 A;  2BDP A;  2Q0Z X;  2HHW A;  2HHU A;  3MR6 A;  9ICQ A;  5HML A;  4RQ3 A;  4M0A A;  2FPK A;  2ZH6 A;  4O3O A;  4B9V A;  4DS4 A;  3OVS A;  3HP6 A;  1ZQX A;  4QWE A;  4RNO A;  3OJU A;  3BJY A;  2R8K A;  4M04 A;  8ICN A;  3H39 A;  2BCU A;  4I2D A;  4RT3 A;  1CUK A;  1ZQM A;  2HHP A;  1Z00 B;  5DB8 A;  1ZQY A;  3UXN A;  4YR0 A;  1U9L A;  2M2V A;  5DLG A;  1K1Q A;  4PGX A;  4ED3 A;  2AGO A;  8ICL A;  3BQ1 A;  5J2K A;  4DL2 A;  4I2J A;  3LDA A;  8ICH A;  4YMN A;  3TAP A;  1UEU A;  2BPC A;  3LWM A;  1ZQC A;  5DEC A;  4I29 A;  7ICJ A;  1X9W A;  4Q45 A;  2W9A A;  4AT8 B;  4S3N A;  2JZB B;  3RRH A;  2JEF A;  3JPR A;  9ICL A;  5DQI A;  2BCR A;  2XGP A;  3PW7 A;  4C8M A;  4WC5 A;  4I27 A;  9ICN A;  5DDM A;  4F91 B;  1TFW A;  3C2K A;  5KFL A;  2Y1I A;  4M2Y A;  4RWN A;  5KFD A;  1T3N A;  1YLQ A;  3EPI A;  1QSS A;  3C18 A;  2KN7 A;  3PO4 A;  4F4X A;  1LV5 A;  1ZQQ A;  5KT7 A;  2AJQ A;  5F9N A;  4DL6 A;  1XWL A;  2VA3 A;  4YG2 A;  1Z00 A;  4EBD A;  5DGB A;  3H37 A;  4UB5 A;  5HC9 A;  4PPX A;  4WC1 A;  4YQW A;  3RH5 A;  1N56 A;  1ZQF A;  3SI8 A;  4DSI A;  2ZJA A;  5KFU A;  1SL1 A;  2KP7 A;  1KRP A;  3RR7 A;  3BQ0 A;  3N4M B;  2ID1 A;  2VA8 A;  5KFI A;  2BPF A;  3C21 A;  4AT7 B;  5L1I A;  2ZH1 A;  7ICV A;  1BPD A;  4RZR A;  2P66 A;  3H8S A;  2ZH9 A;  3M9N B;  2OWO A;  3OHB A;  8ICB A;  2C2D A;  5DB7 A;  1XO1 A;  4ECU A;  8ICC A;  1ZET A;  4DQI A;  4IQW A;  5HRL A;  3WFR E;  4ELT A;  2PBE A;  4F93 B;  3QZ7 A;  1S0V A;  4DOA A;  1JX4 A;  3H3A A;  4ECY A;  2ZH4 A;  5CP2 A;  4FHX A;  3ISB A;  4QZ8 A;  4UB1 A;  4BXO B;  5L1L A;  1ZQE A;  4MF8 A;  4KN4 A;  4O3N A;  1PZN A;  3JPS A;  4EZ6 A;  4BWM A;  2V9W A;  4X4Q A;  4Q8F A;  1T7P A;  1S0O A;  4O5K A;  4O0I A;  2B21 A;  5HRB A;  5J0W A;  4RQ5 A;  2VA2 A;  1IM4 A;  5HMM A;  3RJK A;  3Q8Q B;  5KT3 A;  4K4H A;  5KG4 A;  4UAY A;  3GIM A;  3T3F A;  4KLT A;  5DB6 A;  2F1H A;  5HHH A;  4X5V A;  2UVW A;  4KN7 A;  4E80 A;  3NGD A;  4E0D A;  5IIJ A;  3ISD A;  3OVA A;  4O3P A;  2HHT A;  2ZJ8 A;  8ICJ A;  1JN3 A;  4DSL A;  8ICZ A;  3TI0 A;  4KLS A;  1XSP A;  1T4G A;  4FBU A;  4M9L A;  4NLN A;  4UB4 A;  4O9M A;  4X4N A;  4BGD A;  4RQ8 A;  4M9H A;  4DSJ A;  2XY6 A;  4FHP A;  1TKD A;  2DR9 A;  4QZG A;  8ICP A;  4DSK A;  4DSE A;  1IXR A;  2BGW A;  2PXI A;  2M2T A;  4RUC A;  2ISO A;  2UVR A;  1NKB A;  5KFY A;  4PHA A;  5J2A A;  1ZQH A;  3ZDB A;  4RPX A;  2XCP A;  5J2H A;  4AT9 A;  4GLX A;  2IHN A;  3WFP A;  3M9O B;  3OUY B;  4QZE A;  4ZH4 A;  1ZQS A;  4P4P A;  4NKU A;  1X2I A;  2BKE A;  4IQV A;  1U48 A;  3K4G A;  4RUA A;  1S77 D;  4YD1 A;  1ZQO A;  9ICC A;  1TK5 A;  1ZQJ A;  1ZQK A;  4EEY A;  4KLH A;  5J0O A;  3MGH A;  4KLM A;  5HNK A;  2BQ3 A;  4FHY A;  4YR3 A;  4ED2 A;  2PI5 A;  5HR9 A;  3RB4 A;  2NRT A;  1JMS A;  3K75 D;  4DQS A;  4RPZ A;  3RJE A;  9ICR A;  4R64 A;  1ZQZ A;  4FS2 A;  2ZTE A;  1ZQD A;  4IR1 A;  5CWR A;  4RQ6 A;  4F5Q A;  4R63 A;  5HRG A;  5HRI A;  3H7I A;  3RAX A;  2XY5 A;  3PO5 A;  3SV3 A;  4QZA A;  1L5U A;  1V4A A;  3ZDE A;  3ZDA A;  3V6J A;  4J9R A;  4X0B A;  3RJJ A;  4R66 A;  1QLN A;  5F2V O;  3HW8 A;  5KG6 A;  4XQ8 A;  5KFG A;  3HT3 A;  4YP3 A;  2W9B A;  1N48 A;  9ICU A;  4GXI A;  2ZTC A;  4RQ7 A;  3T5L A;  3MR2 A;  8ICG A;  4QW9 A;  3JPP A;  5J2D A;  3LK9 A;  5CB1 A;  3LWL A;  3V72 A;  3Q8L A;  4XA5 A;  4F4W A;  4FO6 A;  2XGQ A;  3TFS A;  5J0T A;  3B0Y A;  2ASJ A;  1L3S A;  4KLU A;  7ICO A;  3AQN A;  5KFJ A;  4EYH B;  1SKR A;  3HIY A;  4M9N A;  2DPJ A;  4K4G A;  2NRX A;  4NLK A;  4F92 B;  4NY8 A;  2KFZ A;  4R8U B;  3MBY A;  1MSW D;  3H4B A;  4DFP A;  2MUT A;  9ICM A;  1BPZ A;  1U49 A;  1F5A A;  1NO5 A;  1UEV A;  4ED0 A;  5J2B A;  4X4P A;  7ICK A;  1TFY A;  1ZQT A;  2ISP A;  3PVX A;  4MF2 A;  2BCS A;  4QWC A;  9ICG A;  1HJP A;  4P4M A;  2WTF A;  4ECX A;  2R8G A;  3WFS C;  3KHH A;  1B43 A;  2DR8 A;  4UAW A;  1U4B A;  4Z6C A;  2AGP A;  1JAJ A;  4Q44 A;  2XCA A;  3UPS A;  2W9M A;  3C5F A;  1Q78 A;  4F5O A;  1QTM A;  5DLF A;  1TV9 A;  2PFQ A;  4DQP A;  1D9D A;  1XSL A;  9ICA A;  2FPM A;  4M47 A;  1NK7 A;  4RQ1 A;  3GII A;  1SKS A;  4ECT A;  4DQQ A;  9ICX A;  1Q79 A;  4QWA A;  5KFZ A;  5C5J A;  5HRD A;  4YXM A;  4RU9 A;  1KLN A;  2P6U A;  2FLN A;  4WC6 A;  1NKC A;  3TFR A;  5KG5 A;  3RTV A;  1ZYQ A;  1NK4 A;  5DB9 A;  3TAR A;  5KT6 A;  1XS9 D;  8ICF A;  4O5E A;  4DF4 A;  1KFS A;  3HPO A;  1B22 A;  4DF8 A;  3KHR A;  7ICF A;  4R8U A;  3OJS A;  1ZJN A;  2V4Q A;  5J0Q A;  1BPE A;  4TUS A;  4DL5 A;  1SZP A;  5BOL A;  3EPG A;  4UB2 A;  1JQR A;  1R89 A;  3OV7 A;  1KDH A;  1ZQR A;  4YXJ A;  1MQ3 A;  5DGA A;  3GV7 B;  2ZUC A;  4CCH A;  4B9N A;  4NM1 A;  4DL4 A;  4GXK A;  3C1Y A;  5KFE A;  4Q43 A;  5EWG A;  3NTU A;  4C8N A;  3PR4 A;  4DLG A;  3RB6 A;  1U47 A;  3JYY A;  4F5R A;  3MAB A;  4UD5 A;  1WCL A;  2RDI A;  4PGQ A;  2PFO A;  2HHS A;  2A1J B;  5DBB A;  5F9L A;  3MR5 A;  2ZTD A;  3V7J A;  4PHE A;  4B9U A;  4RQ0 A;  1NK8 A;  4KLI A;  2JEI A;  5D4B A;  5KFW A;  4MEY A;  2XO7 A;  2FLL A;  4UBC A;  3PX6 A;  2JEJ A;  3FYH A;  4X0A A;  2BE3 A;  5J0P A;  8ICW A;  1UT5 A;  3GDX A;  1ZQG A;  2ZHA A;  1NJZ A;  4UD4 A;  1RXV A;  1UET A;  1S10 A;  2NRZ A;  2UVU A;  7ICS A;  4KLG A;  5HRE A;  1XU4 A;  4EYI B;  5J2I A;  4ELV A;  5KFQ A;  4WC0 A;  4IRK A;  1RPL A;  3C1Z A;  5KG1 A;  1SKW A;  3C23 A;  4AT9 B;  2I1Q A;  3C5G A;  7ICN A;  9ICV A;  3OVB A;  3PY8 A;  4M9J A;  3EWA A;  1BNP A;  1KFD A;  2W9C B;  4JV2 A;  4I28 A;  2NRV A;  1BPB A;  5DG7 A;  3ZD9 A;  3SYZ A;  4X4T A;  1HUZ A;  4I2E A;  1L3V A;  4RNN A;  4B9T A;  3PML A;  5EWF A;  3BQ2 A;  2A1J A;  4X4O A;  2Y1J A;  1DK2 A;  4WC4 A;  4JUZ A;  3RH4 A;  1R8B A;  8ICS A;  1ZQA A;  3QEA Z;  1JXE A;  3UXO A;  4Q8E A;  2HVI A;  4WCW A;  1DGS A;  2XC9 A;  4YMO A;  4F4Z A;  4PH5 A;  3MFI A;  9ICP A;  1ARO P;  9ICI A;  4X4V A;  5III A;  1RZT A;  1BVS A;  2Q66 A;  3Q8M A;  2HHQ A;  4JV1 A;  2V4R A;  2IHM A;  8ICO A;  2ASD A;  5KG7 A;  4ECW A;  3UPQ A;  3RB0 A;  3V6K A;  5HHI A;  1JIH A;  1TK8 A;  4YR2 A;  1WCN A;  3V6H A;  8ICV A;  3C2L A;  5IIK A;  4E8F A;  4FS1 A;  2W9B B;  4P2H A;  2O1P A;  3THV A;  5CR0 A;  4YCX A;  8ICA A;  2W9C A;  5HP4 A;  4DFJ A;  5D49 A;  1S97 A;  4QZI A;  3JPO A;  2I9G A;  5KFX A;  4QWB A;  1PX5 A;  5BPC A;  1NKE A;  4J9M A;  4UBB A;  2FMQ A;  1TFR A;  4I2H A;  2DR5 A;  4C8O A;  2DFL A;  3GIJ A;  5J29 A;  4RNM A;  1BPY A;  4F4K A;  7ICM A;  3N97 B;  2XY7 A;  1KFT A;  2MUT B;  3JPQ A;  5KFN A;  3UQ2 A;  1QSY A;  4UQG A;  1CEZ A;  4X4U A;  4YFK A;  2BQU A;  1TK0 A;  5DBA A;  2HHX A;  4IG8 A;  4JV0 A;  4ECQ A;  4F2S A;  1SL0 A;  4K4I A;  4GC7 A;  3UQ0 A;  1VJ7 A;  3AUO A;  2BCV A;  1A77 A;  4Z6D A;  7ICP A;  4DL3 A;  3GV8 B;  5KFF A;  3MFH A;  3TAQ A;  3V7L A;  1MQ2 A;  4PHP A;  3MDC A;  2M2W A;  4DS5 A;  2ZH2 A;  4DEZ A;  1VFG A;  2FPL A;  5DDY A;  2R8I A;  4I2C A;  7ICE A;  5IIL A;  3PX0 A;  4J9N A;  5KFC A;  2AU0 A;  3UXP A;  4WBY A;  3RJG A;  5J0Y A;  4XQ7 A;  3RH6 A;  3MR3 A;  1UA0 A;  2ZHB A;  1DK3 A;  4KLQ A;  8ICT A;  9ICE A;  3GIK A;  3RBD A;  2AQ4 A;  3SV4 A;  7ICU A;  8ICU A;  4J9Q A;  4M5D A;  7ICH A;  4XUS A;  9ICT A;  5KTQ A;  4BWJ A;  2BPG A;  7ICT A;  4EBK A;  3H8W A;  5HRH A;  1ZQW A;  4QWD A;  1TAQ A;  1TAU A;  4WBZ A;  3HJ4 A;  1NK0 A;  3PNC A;  4IQU A;  4PGY A;  4DSF A;  3JPN A;  7ICG A;  4ATB B;  5KG2 A;  2J6S A;  2KZ3 A;  4ED7 A;  4XRH A;  3JPT A;  2BHN A;  5KFK A;  5KG0 A;  1ZQV A;  1UT8 A;  5J0R A;  3GIL A;  4DQR A;  3M8S A;  2W8L A;  2DRB A;  3G6X A;  2MAX A;  2NRK A; 
#chains in the Genus database with same CATH topology
 2NRW A;  2FMP A;  2F8K A;  1N5X A;  2Y9U A;  4J9L A;  1N61 A;  4M6W A;  4ED6 A;  2PFP A;  2YN4 A;  3HWT A;  2AHO B;  4EBC A;  3MGI A;  2HBL A;  3IDW A;  1RYS A;  4QZB A;  3AQM A;  5ALI A;  4ATB A;  2H5X A;  1S5L U;  4I2I A;  3T79 A;  3RR8 A;  3A0H U;  4UAZ A;  4ECR A;  1T94 A;  4F5P A;  4NLG A;  3WK7 A;  3IV6 A;  1BPX A;  5IIO A;  2KEY A;  4PL2 A;  2FDR A;  4FFD A;  5KFR A;  2HMX A;  2R8J A;  3PX4 A;  2DQN B;  2ZIX A;  4JK1 A;  4O3S A;  1JXL A;  5K4L A;  3ISC A;  1SL2 A;  5DG8 A;  2B4V A;  1S76 D;  3PST A;  2EAP A;  1L3T A;  4EGW A;  4AT8 A;  4IG8 A;  1QSL A;  4DFM A;  4UAS A;  2N1R A;  2RDJ A;  2JMG A;  4X4R A;  2DWQ A;  4F72 A;  3E2E A;  3I1Y A;  1VJ5 A;  2RHF A;  3RB3 A;  2HOQ A;  4G3I A;  3H40 A;  8ICX A;  3SMV A;  4FH5 A;  8ICQ A;  5KFB A;  4O3R A;  1V97 A;  4LEW A;  8ICI A;  3RBE A;  4RT2 A;  4Y2U A;  2H3F A;  4FBT A;  4KX5 A;  2AQ0 A;  5AK4 A;  3RJF A;  4MEX A;  5DQG A;  4MHV A;  1IIP A;  7ICQ A;  2B56 A;  2EDU A;  1C7Y A;  3TQ1 A;  2Y0S C;  2YML A;  1HUO A;  4ED8 A;  2ZH5 A;  2BQR A;  4Y2Y A;  1U45 A;  1KTQ A;  4C8K A;  4MFA A;  4MFF A;  4JWM A;  2BCQ A;  4TQR A;  4MFC A;  4O3Q A;  4KMO B;  3IM1 A;  4GC6 A;  7ICI A;  1OU5 A;  2EWR A;  1KEJ A;  2KSO A;  5DKW A;  3L9D A;  3G6V A;  3QNM A;  4B9L A;  5D46 A;  4NXX A;  3D6J A;  4IR9 A;  5L1J A;  1XNS A;  1DOQ A;  2KZM A;  1S9F A;  4K97 A;  1KNY A;  2M9N A;  5J2F A;  1S0M A;  1Z19 A;  8ICK A;  4I2B A;  4UAT A;  2ZIW B;  3NYB A;  4O6A A;  2GWS A;  3KHG A;  1UHU A;  2YB4 A;  2M2U A;  4X4S A;  2UVV A;  5J0S A;  3WFQ E;  4OAH A;  3ZDD A;  2KHQ A;  3BZC A;  4P4O A;  3OHA A;  3PSI A;  2BDP A;  4RQ3 A;  1N60 A;  4B9V A;  5ALY A;  4QWE A;  3OJU A;  3AMZ A;  8ICN A;  3H39 A;  1ZQM A;  2HHP A;  5DB8 A;  1ZQY A;  4YR0 A;  5DLG A;  4PGX A;  4A8E A;  4KX3 A;  5J2K A;  8ICH A;  3LDA A;  3QYP A;  3FC4 A;  7ICJ A;  2JZB B;  3KOO A;  3RRH A;  5DQI A;  2BCR A;  2XGP A;  3B9J A;  2F77 X;  4C8M A;  4WC5 A;  9ICN A;  5DDM A;  4F91 B;  1TFW A;  3E58 A;  4RWN A;  2LYB A;  4WH5 A;  1PVQ A;  4F4X A;  2YY6 A;  4DL6 A;  1S8O A;  2VA3 A;  2FI1 A;  4CF3 A;  3BS5 B;  2ZJA A;  1SL1 A;  2K4H A;  4EBJ A;  3BQ0 A;  4OAI Z;  5L1I A;  2ZH9 A;  7ICV A;  2E5S A;  5ALD A;  1COK A;  8ICB A;  8ICC A;  5HRL A;  3KZX A;  3WK8 A;  5C0Y A;  5AI0 A;  2ZH4 A;  5CP2 A;  2W3S A;  1OW5 A;  4O3N A;  5ALL A;  4US8 A;  4BWM A;  4X4Q A;  3QUT A;  5EE0 A;  4O0I A;  4RQ5 A;  2GA9 D;  5DB6 A;  2F1H A;  3AL0 B;  3HJE A;  4CF4 A;  5IIJ A;  4O67 A;  2HHT A;  1IV8 A;  2LMR A;  1J2N A;  3TI0 A;  4KLS A;  1T4G A;  4RQM A;  2JGA A;  4UB4 A;  4BGD A;  1PUZ A;  4DSK A;  1IXR A;  2KJ5 A;  5KFY A;  4PHA A;  1ZQH A;  3WK5 A;  4GLX A;  3WFP A;  3M9O B;  4BJQ A;  1ECW A;  3EF2 A;  2IOH A;  1ZQS A;  4IQV A;  1ZQK A;  3ICX A;  5HNK A;  5AKJ A;  2PI5 A;  5HR9 A;  1FIQ A;  2NRT A;  3K75 D;  4RPZ A;  9ICR A;  3NVY A;  2ZTE A;  4IR1 A;  4RQ6 A;  5HRI A;  4R63 A;  2XY5 A;  4UAU A;  4QZA A;  3V6J A;  4X0B A;  3AEV A;  2RQ5 A;  4YP3 A;  1N48 A;  4RQ7 A;  3T5L A;  3MR2 A;  8ICG A;  4QW9 A;  2WF5 A;  2ASJ A;  4FO6 A;  1L3S A;  5J0T A;  2WHE A;  5KFJ A;  4IC9 A;  3HIY A;  2DPJ A;  4K4G A;  2NRX A;  2LYA A;  1SV0 C;  3SAH A;  4ED0 A;  5J2B A;  4P4M A;  3KHH A;  4LEY A;  2K89 A;  3C5F A;  1Q78 A;  1TV9 A;  2BBJ A;  5KFZ A;  5C5J A;  4YXM A;  4RU9 A;  2P6U A;  2FLN A;  5CFT A;  1NKC A;  4WC6 A;  3RTV A;  3TAR A;  4O5E A;  3HPO A;  2KE7 A;  2V4Q A;  5J0Q A;  4PZN A;  1JQR A;  3EPG A;  1R89 A;  1ZQR A;  3O0F A;  4YXJ A;  2KIW A;  2ZUC A;  1V38 A;  4GXK A;  4G9B A;  2QKQ A;  4Q43 A;  3MAB A;  1WCL A;  4PGQ A;  3V7J A;  3MR5 A;  1AQ6 A;  4RQ0 A;  3M6K A;  5AK5 A;  5ALP A;  2JEJ A;  2BE3 A;  3GDX A;  4NLB A;  1ZQG A;  4UD4 A;  7ICS A;  1CRX A;  1XU4 A;  5KFQ A;  3C1Z A;  2YX8 A;  1FFV A;  7ICN A;  3OVB A;  1BNP A;  4JV2 A;  4K9B A;  2Z7J A;  1BPB A;  5DG7 A;  3SYZ A;  4I2E A;  4B9T A;  5EWF A;  4EEB A;  1Z1B A;  4WCW A;  1DGS A;  4YMO A;  2RP5 A;  4FZM A;  3GU3 A;  4X4V A;  5AM2 A;  2WFA A;  3Q8M A;  4JV1 A;  1HIW A;  4US9 A;  1X6J A;  5KG7 A;  3HKZ C;  4E8F A;  4P2H A;  3THV A;  5CR0 A;  2QB0 A;  2DF4 B;  5D49 A;  3PSP A;  3JPO A;  4QWB A;  2K8A A;  4J9M A;  4QIW C;  2DFL A;  4RNM A;  1BPY A;  1KFT A;  1CEZ A;  4X4U A;  3K1Z A;  4YFK A;  2BQU A;  1JAL A;  5DBA A;  4F2S A;  3UQ0 A;  5AHX A;  2LKY A;  2BCV A;  7ICP A;  4DL3 A;  1QQ7 A;  2Y0S F;  2XIC A;  4PHP A;  3L5K A;  4DS5 A;  4I2C A;  7ICE A;  4J9N A;  1WWU A;  4WBY A;  3ZI4 A;  5J0Y A;  4XQ7 A;  2W55 A;  4C4T A;  3M1Y A;  4K98 A;  2MU2 A;  8ICU A;  9ICT A;  5KTQ A;  5HRH A;  4QWD A;  3PNC A;  4IQU A;  3WKE A;  4DSF A;  2FCL A;  4ATB B;  1LKY A;  5GTH U;  2BHN A;  5KFK A;  4OAG A;  1UT8 A;  3ALR A;  4DQR A;  2YQE A;  2EQY A;  2NRK A;  1WWV A;  4IQT A;  1URJ A;  4YN4 A;  5KT5 A;  1Z3E B;  3I76 A;  2H3Z A;  3BQT A;  3F53 A;  3FDS A;  5KT2 A;  5TZV A;  5JU5 A;  1ZQN A;  1ZQU A;  5FP0 A;  5J2J A;  5J0U A;  2KK0 A;  5B5E U;  2HOF A;  5IIM A;  4ECZ A;  1BNO A;  2E1F A;  4KLF A;  3GV5 B;  2D8C A;  5J0X A;  4FH3 A;  4OJ6 A;  4J9P A;  1S0N A;  1EXN A;  4DL7 A;  9ICJ A;  2DKZ A;  1NJW A;  5CFU A;  2EZY A;  4GXJ A;  3SZ2 A;  2PFN A;  2W7P A;  1QQ6 A;  1ZD2 P;  5CHG A;  2E8P A;  3EYZ A;  1BGX T;  1FA0 A;  4ELU A;  4CGZ A;  4BDP A;  2KFN A;  2LYH A;  1X6I A;  4O69 A;  5AM3 A;  1CI4 A;  2A1A A;  2RLT A;  1COO A;  5J2E A;  4B9M A;  3KKA C;  3Q8P B;  1MN8 A;  4O5C A;  9ICF A;  5EOZ A;  2J6U A;  3DEE A;  2W8K A;  1TVA A;  3DDH A;  3OSN A;  3LVV A;  5ALS A;  3BZK A;  3TKA A;  3G6Y A;  4QW8 A;  5AKG A;  3H0L B;  3NS1 A;  7ICR A;  1UQV A;  2ZIU B;  4NXU A;  1NJY A;  4NLC A;  4AT7 A;  5J2G A;  5L1K A;  4NXW A;  4LJX A;  1NK6 A;  1J97 A;  4QZH A;  1DRG A;  3TAC B;  5HRK A;  4E7X A;  2IMW P;  5IIN A;  5HRF A;  2L5Y A;  4RWP A;  3IG5 A;  4QNL A;  4F2R A;  3CP8 A;  4BXO A;  4UB3 A;  4LEZ A;  2E1E A;  4DWI A;  4TUQ A;  2G5I B;  4Z6E A;  4I2A A;  5L9X A;  4P0P A;  3BDP A;  5JUM A;  3HJ1 A;  1WOT A;  1N2X A;  4PL1 A;  3AQF A;  2PMZ C;  1LB2 B;  4KTQ A;  3PV8 A;  2WAQ C;  1V9P A;  1VLB A;  4NKT A;  4RWO A;  1NOM A;  2KTQ A;  4QZ9 A;  1Z4O A;  4EP7 A;  1F5S A;  4KMU A;  4ECV A;  5JTG A;  3OTQ A;  4DOC A;  3H8J A;  3M8R A;  2D3D A;  4JWN A;  3AU6 A;  3OSP A;  4DLE A;  3B0X A;  5DQH A;  2ZH7 A;  4FZN A;  1IG6 A;  3Q8K A;  1ZQL A;  4KLE A;  2G07 A;  2GLE A;  3UM9 A;  2F1I A;  4EX6 A;  2HHU A;  9ICQ A;  1FEZ A;  4RNO A;  3BJY A;  4M04 A;  2G09 A;  2BCU A;  4RT3 A;  2KHV A;  3UXN A;  2M2V A;  1K1Q A;  3QUB A;  2WB1 C;  1Q3U A;  3BQ1 A;  2A3V A;  4I2J A;  1UEU A;  4YMN A;  3LWM A;  1ZQC A;  4I29 A;  4S3N A;  3JPR A;  3PW7 A;  1JI7 A;  3C2K A;  5KFL A;  2Y1I A;  4M2Y A;  2B51 A;  5KFD A;  1T3N A;  3EPI A;  3C18 A;  3IN5 A;  2KIC A;  2DBY A;  1GO3 F;  1XWL A;  4YG2 A;  1Z00 A;  4EBD A;  1Z1V A;  5HC9 A;  4PPX A;  4WC1 A;  3SI8 A;  2KP7 A;  1KRP A;  2ZH1 A;  2VA8 A;  5KFI A;  4CDG A;  2XID A;  2P66 A;  4WJ3 B;  1RQL A;  5DB7 A;  4ECU A;  1ZET A;  3WFR E;  5ALT A;  1S0V A;  2MA1 A;  5AIB A;  3H3A A;  4ECY A;  1ZD3 A;  3NWI A;  1PZN A;  1SV0 A;  4EZ6 A;  4Q8F A;  2LM1 A;  5HRB A;  2VA2 A;  2K4E A;  1IM4 A;  5HMM A;  3RJK A;  2GH1 A;  5KT3 A;  2E3T A;  3GIM A;  4KLT A;  2EH9 A;  5HHH A;  1JRP A;  2UVW A;  4MKP A;  3NGD A;  5HR6 A;  3ISD A;  4PZO A;  1JN3 A;  4DSL A;  3S6J A;  4NLN A;  2YTU A;  4U7C A;  4M9H A;  4DSJ A;  2CPR A;  4DSE A;  1UPH A;  5J2A A;  4AT9 A;  2IUB A;  4EEN A;  1X66 A;  1OUQ A;  4I0U A;  3QU9 A;  3BS7 A;  4RUA A;  1TAM A;  4P0Q B;  3HKZ F;  2NO4 A;  2HBK A;  3AM9 A;  4EEY A;  5J0O A;  2VIX A;  3SAG A;  2EAN A;  1WUD A;  3WKD A;  4FS2 A;  1ZQD A;  4QIW F;  2OHF A;  3SV3 A;  1V4A A;  3GZF A;  3ZDA A;  2K8B B;  4R66 A;  4XQ8 A;  5KFG A;  3HT3 A;  5TIS U;  9ICU A;  2ZTC A;  3N7S C;  2G0A A;  3LK9 A;  4XA5 A;  4F4W A;  2IOF A;  2WF8 A;  2OM6 A;  5AKY A;  4F92 B;  3MBY A;  4DFP A;  2MUT A;  9ICM A;  5KAI U;  1BPZ A;  1U49 A;  1D8B A;  1F5A A;  1NO5 A;  1UEV A;  2HN2 A;  7ICK A;  1TFY A;  3PVX A;  2BCS A;  1HJP A;  2F3N A;  4Z6C A;  2AGP A;  1N5W A;  2Q4T A;  4FE3 A;  2XCA A;  1QTM A;  1D9D A;  9ICA A;  4C4S A;  4M47 A;  4FZL A;  1SKS A;  4DQQ A;  9ICX A;  1O08 A;  2HSZ A;  3TFR A;  4KB6 A;  4C4R A;  1KFS A;  2JV3 A;  4DF8 A;  3KHR A;  3WU2 U;  7ICF A;  4R8U A;  1ZJN A;  4TUS A;  4DL5 A;  3F2B A;  4UB2 A;  1KDH A;  1MQ3 A;  3GV7 B;  4B9N A;  1SIJ A;  4C8N A;  3JYY A;  3RB6 A;  4DCC A;  2D6F C;  4UD5 A;  2RDI A;  8ICM A;  4KLI A;  1QQ5 A;  2ODG A;  5KFW A;  5CHE A;  2XO7 A;  3PX6 A;  8ICW A;  4U6P A;  4J03 A;  1ZRN A;  1NJZ A;  1UET A;  1S10 A;  1SB3 C;  5HRE A;  1UCV A;  2E8O A;  4ELV A;  5AKI A;  4WQL A;  3C23 A;  3C5G A;  3KBB A;  5EE3 A;  3PY8 A;  2QB0 B;  2W43 A;  2LBO A;  1L3V A;  3BQ2 A;  4X4O A;  3ERC C;  1DK2 A;  1R8B A;  3QEA Z;  1JXE A;  2KMD A;  1XO0 A;  2XC9 A;  4F4Z A;  3MFI A;  9ICP A;  1QCK A;  2Q66 A;  2HHQ A;  2V4R A;  8ICO A;  2ASD A;  3SAF A;  4ECW A;  3UPQ A;  4EV6 A;  1JIH A;  4YR2 A;  1WCN A;  5IIK A;  4EX7 A;  1QH9 A;  4NWI A;  5ALR A;  2W9B B;  2O1P A;  1A6S A;  2W9C A;  5HP4 A;  4Y2V A;  4DFJ A;  1S97 A;  2I9G A;  5KFX A;  4DFD A;  5BPC A;  3MGV A;  1NKE A;  4I2H A;  4UBB A;  4C8O A;  5J29 A;  5B3Q A;  4F4K A;  4Y2R A;  3UQ2 A;  5KFN A;  5ALV A;  2HCF A;  2HHX A;  3WK9 A;  3PHZ A;  3M7D A;  3GV8 B;  5KFF A;  1MQ2 A;  4DEZ A;  1VFG A;  2FPL A;  5DDY A;  2QB1 A;  2AU0 A;  2F44 A;  3RJG A;  1L8O A;  2ZHB A;  3R9K A;  5J8Y C;  2DKX A;  3UMG A;  4KLQ A;  3CYM A;  3RBD A;  2AQ4 A;  3WKC A;  3UMB A;  4M5D A;  7ICH A;  4XUS A;  2PMZ F;  4BWJ A;  7ICT A;  1TAU A;  3HJ4 A;  1SV4 A;  5D62 A;  1TE2 A;  2WAQ F;  7ICG A;  2VJ4 A;  2J6S A;  3KKA A;  5ALX A;  2KZ3 A;  4ED7 A;  1JRO A;  5CFS A;  1L7O A;  3GIL A;  3M8S A;  3QU5 A;  2DRB A;  3G6X A;  2MAX A;  1L3U A;  1M6Y A;  2C2R A;  1ED1 A;  4F8R A;  5EE1 A;  7ICL A;  4YD2 A;  4DFK A;  5KFA A;  8ICE A;  3ER9 B;  1PVR A;  4KLJ A;  2Y9T A;  2ZIW A;  3ONN A;  4F4Y A;  4QZF A;  1SWV A;  2ALZ A;  3LQC B;  3QEB Z;  4Y2X A;  2KG5 A;  1R8A A;  3CNH A;  3TAN A;  4C7Z A;  5KFH A;  2AGQ A;  1ZXI A;  1SZH A;  5B66 U;  2ZUB A;  1O03 A;  3OGU A;  2WB1 F;  3N7P D;  2K4P A;  2YMP A;  1MIY A;  4EEK A;  4M9G A;  3EW9 A;  4LT6 A;  3EZ5 A;  5ALJ A;  2VAN A;  4ACO A;  4FHV A;  3ZD8 A;  3IHQ B;  2M0N A;  1ZOL A;  2JXJ A;  2C22 A;  4LVS A;  1UA1 A;  5HRG A;  2HHV A;  2HI0 A;  2JZB A;  5KFS A;  3I28 A;  4BX9 C;  1A76 A;  4K9A A;  4KLO A;  1GPJ A;  9ICW A;  4P0P B;  3Q8R B;  4J9S A;  4LZD A;  2RFF A;  2LI6 A;  1FO4 A;  2ZJ5 A;  3BS5 A;  2K8C B;  2DVI A;  4Y2J A;  4NM2 A;  5DBC A;  2HW3 A;  5ALZ A;  1Q3V A;  4IRK A;  2ASL A;  4J9O A;  3J81 j;  3RFA A;  3RRG A;  3NVZ A;  1P7D A;  3AQK A;  2QAR A;  3SEI A;  2H3Q A;  2VJ5 A;  3VCB A;  4UB6 U;  2ZIV A;  4RQ2 A;  3C29 A;  9ICO A;  3C66 A;  3T5K A;  1RM6 C;  5CA7 A;  2I5H A;  4KLL A;  1NK5 A;  1NNL A;  5ALO A;  3GFK B;  2ZH8 A;  4TUR A;  1D8L A;  3PW0 A;  1XC9 A;  2BR0 A;  3WFO A;  1C20 A;  3T5J A;  4F50 A;  2VKQ A;  2EAO A;  1Q8K A;  1MIW A;  2P6R A;  3PW4 A;  4C8L A;  3D2S A;  1N63 A;  4M6W B;  4KIT B;  4WQK A;  2PI4 A;  1L7P A;  3RJH A;  4TUP A;  2AH5 A;  3Q8S B;  3M9M B;  2O5A A;  2DGZ A;  3U26 A;  4TQS A;  5EE9 A;  3RF9 A;  3OUY A;  4KLD A;  4Y2S A;  2FMS A;  3A0B U;  3PR5 B;  2DRA A;  2ZXH A;  3BQ7 A;  2HVH A;  5KG3 A;  2Q0Z X;  4CF5 A;  3NVV A;  3MR6 A;  5HML A;  2ZH6 A;  4DS4 A;  3HP6 A;  2R8K A;  4PJ0 U;  2OH2 A;  2W54 A;  2ZIX B;  4I2D A;  1CUK A;  3LVW A;  1Z00 B;  1J2M A;  5ALW A;  1U9L A;  5T14 A;  5ALH A;  4ED3 A;  2AGO A;  5DEC A;  2BPC A;  2F76 X;  2HOI A;  4AT8 B;  4CE6 A;  4Q45 A;  1X9W A;  2KKP A;  4UAV A;  9ICL A;  1A0P A;  1DGJ A;  2ES6 A;  3K1R B;  1YLQ A;  2W3R A;  3F5E A;  1LV5 A;  5F9N A;  3KD3 A;  5AKX A;  5AI5 A;  5D61 A;  5AKH A;  5DGB A;  3RH5 A;  1N56 A;  1ZQF A;  2EZX A;  1WG8 A;  2ID1 A;  3L4P A;  2BPF A;  3C21 A;  2KNJ A;  3QUC A;  4RZR A;  2KJ8 A;  3OHB A;  5AIA A;  4BUG A;  1XO1 A;  2G06 A;  4IQW A;  4ELT A;  2PBE A;  4F93 B;  3QZ7 A;  4DOA A;  5E79 U;  2CN1 A;  4QZ8 A;  5L1L A;  3K7D A;  3JPS A;  4JB3 A;  3WK6 A;  1S0O A;  2B21 A;  4NV0 A;  2KSO B;  2ZXI A;  3Q8Q B;  3DV9 A;  3T3F A;  3SEN A;  2LHT A;  2FJ6 A;  3FAH A;  4JMU A;  4GFJ A;  4CNQ A;  4CRX A;  8ICJ A;  5ALN A;  1XSP A;  4FBU A;  3QUQ A;  2NO5 A;  2JR5 A;  2ZG6 A;  4FHP A;  4QZG A;  8ICP A;  2PXI A;  4USA A;  2M2T A;  4RUC A;  2ISO A;  3H37 A;  1ZQ1 C;  4RPX A;  2XCP A;  5J2H A;  4QZE A;  4OAF A;  2BKE A;  4F71 A;  1YZ7 A;  2QLT A;  1KKX A;  9ICC A;  3D2Q A;  1TK5 A;  2A19 A;  4FO1 A;  4NJ8 A;  4KM5 A;  5CEH A;  5CWR A;  4B6J A;  5ALE A;  3H7I A;  5AM0 A;  3PO5 A;  4NXT A;  3ZDE A;  2H3V A;  5F2V O;  1QLN A;  3HW8 A;  5G5H A;  5KG6 A;  4GXI A;  3Q8L A;  3V72 A;  5CB1 A;  2E8N A;  2P35 A;  2AXT U;  7ICO A;  3AQN A;  3B0Y A;  4KLU A;  5AK6 A;  2DL0 A;  4EYH B;  1SKR A;  4M9N A;  2JRZ A;  4NY8 A;  1KW4 A;  2KFZ A;  4R8U B;  1MSW D;  3H0M B;  5ALU A;  3H4B A;  1X42 A;  1ZQT A;  3QU2 A;  2ISP A;  4QWC A;  2WF9 A;  2WTF A;  2R8G A;  1B43 A;  1U4B A;  4JLZ A;  5F3X B;  3UPS A;  3MC1 A;  4F5O A;  4OJ5 A;  5AIC A;  4DQP A;  1XSL A;  2FPM A;  4RQ1 A;  3GII A;  4UB8 U;  3C28 A;  4C7Y A;  3H8M A;  1ZYQ A;  1NK4 A;  1XS9 D;  2KKV A;  5KT6 A;  4Y2P A;  4DF4 A;  4K96 A;  1B22 A;  4O3M A;  2WF6 A;  2HBJ A;  3OJS A;  2DR8 A;  5BOL A;  2B6G A;  3N7R C;  4OJL A;  4NM1 A;  4DL4 A;  3C1Y A;  5KFE A;  5EWG A;  4DLG A;  3LYS A;  2PFO A;  2HHS A;  5DBB A;  5F9L A;  4B9U A;  2JEI A;  1NK8 A;  2FLL A;  3QU7 A;  4UBC A;  4X0A A;  3FYH A;  3F5A A;  3NKU A;  1RXV A;  3IG8 A;  5J8Y A;  2NRZ A;  4KLG A;  4ZOH C;  4EYI B;  5J2I A;  4WC0 A;  4Y2Q A;  1RPL A;  5AKL A;  4NXV A;  3KZI U;  9ICV A;  2XVT A;  4N7R A;  3EWA A;  1KFD A;  2W9C B;  4I28 A;  2NRV A;  1YZ6 A;  3ZD9 A;  2G08 A;  3QXG A;  2A1J A;  2Y1J A;  4JUZ A;  3RH4 A;  2CRX A;  3UXO A;  5AK3 A;  1ARO P;  9ICI A;  5III A;  1Z4N A;  1L7N A;  2W11 A;  3HIL A;  3RB0 A;  3D2N A;  1TK8 A;  3C2L A;  1L6N A;  4YCX A;  5AI4 A;  8ICA A;  1KQQ A;  2HBM A;  2YMQ A;  1PX5 A;  4OJO A;  2WF7 A;  7ICM A;  3F2D A;  2XY7 A;  3JPQ A;  1QSY A;  3IP4 B;  1LVH A;  4AYB C;  1SL0 A;  4K4I A;  1VJ7 A;  3AUO A;  1A77 A;  4Z6D A;  2H3I A;  1KBU A;  3MFH A;  2M2W A;  3MDC A;  5AKK A;  2R8I A;  5AI9 A;  1RDF A;  2ZIU A;  5IIL A;  5KFC A;  3UXP A;  2BBH A;  3RH6 A;  3MR3 A;  1DK3 A;  3M6Z A;  5AM5 A;  3SV4 A;  4J9Q A;  2BPG A;  4EBK A;  3H8W A;  1TAQ A;  4PGY A;  5KG2 A;  3JPT A;  4GIB A;  2W8L A;  1PK1 A;  5GTI U;  1FFU A;  4NL9 C;  2I6X A;  1NZP A;  3HX0 A;  1ZQB A;  1RQN A;  2J6T A;  9ICS A;  5AI6 A;  3TAD C;  4QZC A;  3JCF A;  4RPY A;  2F1J A;  4WC2 A;  1R8C A;  1B4F A;  4WC7 A;  1H38 A;  4LZG A;  4NKU A;  5A0L A;  3PMN A;  2IA6 A;  3ORY A;  3H38 A;  4EZ9 A;  1Y88 A;  4OD0 A;  4NLZ A;  4WOY A;  4YVZ A;  2BDU A;  4F5N A;  5KT4 A;  8ICY A;  1D9F A;  4OJP A;  5KFP A;  5BOM A;  3ZDC A;  4RWQ A;  5CRX A;  2JEG A;  2FLP A;  1ZQP A;  2KV2 A;  4DOB A;  3CW2 C;  2OXO A;  1NK9 A;  8ICR A;  4RQ4 A;  3KHL A;  9ICB A;  3MDA A;  1MIV A;  2DUY A;  3RJI A;  4YMM A;  3NAS A;  1OXJ A;  3C2M A;  4EBE A;  5J2C A;  1RXW A;  4ED1 A;  1X9S A;  1X9X A;  4I2F A;  1D8Y A;  5AKE A;  5DED A;  4PHD A;  2DR7 A;  3KTQ A;  4K99 A;  2QAR B;  5KFM A;  4C0Z A;  2IBK A;  2ZIV B;  4IRC A;  2KVS A;  3H0R B;  1T3Q A;  2DPI A;  4ECS A;  1K1S A;  1RYR A;  4R65 A;  4J9K A;  5EWE A;  1XSN A;  2KZZ A;  2JH1 A;  1SWW A;  3GQC A;  4B9S A;  4FHW A;  4I2G A;  2C2E A;  1DXS A;  5B3P A;  2JH7 A;  5KFT A;  1N62 A;  4QZD A;  3OWG A;  3ETR A;  4HYK A;  4DO9 A;  1T8E A;  3AU2 A;  5DG9 A;  3V7K A;  3T5H A;  3ETL A;  4Z6F A;  4IRD A;  3WKB A;  3EUB 2;  2ATL A;  5CJ7 A;  4EEL A;  1LKY B;  2MSN A;  4HX0 A;  3IRU A;  3OUY B;  4WC3 A;  1KSP A;  4NXZ A;  1X9M A;  9ICK A;  5KFO A;  4JLX A;  3JZ0 A;  3PW5 A;  1MC8 A;  4HAI A;  3RAQ A;  5KNI A;  1RYU A;  4UAR A;  1ZJM A;  1ZQI A;  3SD7 A;  3KFU F;  2KJ9 A;  3PW2 A;  2NYV A;  2OYY A;  2R8H A;  2ZH3 A;  3H4D A;  2ZUD A;  2C28 A;  9ICH A;  4F3O A;  3NVW A;  3AQL A;  5KFV A;  3QZ8 A;  4P0Q A;  1NJX A;  3QE9 Y;  1HEK A;  1ZRM A;  2HHW A;  2EZZ A;  5JTI A;  4M0A A;  2FPK A;  1F44 A;  4O3O A;  3OVS A;  1ZQX A;  5ALQ A;  1SGG A;  3CRX A;  8ICL A;  4DL2 A;  3TAP A;  1X40 A;  2KD1 A;  2GAF D;  2MRL A;  2W9A A;  1YT3 A;  4I27 A;  2IOF K;  1QSS A;  2KN7 A;  4K8V A;  3PO4 A;  2OCE A;  5HR7 A;  1ZQQ A;  4EED A;  5KT7 A;  2AJQ A;  3NVO A;  2W7O A;  3WK4 A;  3NUQ A;  4UB5 A;  4YQW A;  4DSI A;  2G5H B;  5KFU A;  4IS7 A;  2PKE A;  5D63 A;  1WYG A;  3RR7 A;  3N4M B;  4AT7 B;  1BPD A;  3H8S A;  3M9N B;  2OWO A;  2C2D A;  5AI8 A;  4DQI A;  2W04 A;  1JX4 A;  2JHD A;  4FHX A;  3ISB A;  4UB1 A;  4BXO B;  1ZQE A;  4MF8 A;  1F0M A;  4KN4 A;  2CXY A;  2V9W A;  1VDV A;  1T7P A;  4O5K A;  2HN1 A;  5J0W A;  2KIV A;  4K4H A;  3UMC A;  5KG4 A;  4UAY A;  4X5V A;  3AN1 A;  4KN7 A;  4AP9 A;  4E80 A;  1RG6 A;  4E0D A;  4O3P A;  2ZJ8 A;  8ICZ A;  4M9L A;  5KL8 B;  2K60 A;  4O9M A;  4X4N A;  5L1M A;  4RQ8 A;  2DR9 A;  2XY6 A;  3ER8 C;  1TKD A;  2BGW A;  2UVR A;  1NKB A;  3ZDB A;  2IHN A;  5ALK A;  4ZH4 A;  5ALG A;  4P4P A;  1X2I A;  1U48 A;  2W03 A;  2O6K A;  3K4G A;  3QU4 A;  1S77 D;  4YD1 A;  3SR6 A;  1ZQO A;  2LPE A;  1ZQJ A;  1L7M A;  5ALF A;  4KLH A;  3MGH A;  4KLM A;  2BQ3 A;  4FHY A;  4YR3 A;  4ED2 A;  3RB4 A;  1JMS A;  4DQS A;  3RJE A;  4R64 A;  1ZQZ A;  4F5Q A;  3RAX A;  1L5U A;  4J9R A;  1NI3 A;  2K4I A;  3RJJ A;  3PZP A;  2W9B A;  1PVP A;  4AYB F;  3JPP A;  5J2D A;  3ED5 A;  3LWL A;  2JEF A;  3TFS A;  2YMM A;  3OVA A;  2XGQ A;  2ZHA A;  5AKZ A;  5ALM A;  4NLK A;  5H2F U;  2NV3 A;  4X4P A;  4MF2 A;  9ICG A;  4ECX A;  2ESE A;  3WFS C;  4RQN A;  4UAW A;  1JAJ A;  2GOL A;  4Q44 A;  4O68 A;  2W9M A;  2BZF A;  5DLF A;  1ZD5 A;  2PFQ A;  5G5G A;  1NK7 A;  3HRD D;  3F2C A;  4ECT A;  1Q79 A;  4QWA A;  5HRD A;  1MA7 A;  4OO1 J;  1KLN A;  5AM4 A;  1NZB A;  5KG5 A;  5DB9 A;  8ICF A;  4OCZ A;  4XJE A;  1BPE A;  3OV7 A;  1SZP A;  5DGA A;  2R18 A;  2HDO A;  4IL6 U;  4CCH A;  2F8L A;  1PK3 A;  3NTU A;  2F2A B;  3PR4 A;  1U47 A;  4F5R A;  2A1J B;  2ZTD A;  4PHE A;  4UW9 A;  5D4B A;  1SXE A;  4MEY A;  2OEH A;  5J0P A;  1UT5 A;  3L3F X;  3WKA A;  2FE9 A;  2UVU A;  2KVC A;  3VC8 A;  3E0F A;  1Q46 A;  5KG1 A;  2EAM A;  1SKW A;  4AT9 B;  2I1Q A;  5JRT A;  3N28 A;  2XI9 A;  4M9J A;  4X4T A;  1HUZ A;  4RNN A;  1SXD A;  3PML A;  4LEV A;  3NRW A;  4WC4 A;  3QX7 A;  3SQI A;  8ICS A;  3AQE A;  1ZQA A;  4Q8E A;  2HVI A;  2KOB A;  4NL9 A;  4PH5 A;  1K5O A;  1RZT A;  1BVS A;  2YB1 A;  4Y2T A;  2IHM A;  3V6K A;  3TAD A;  2LM4 A;  5HHI A;  2B0C A;  3V6H A;  8ICV A;  4FS1 A;  1L8L A;  4QZI A;  1KN5 A;  2FMQ A;  1TFR A;  4C80 A;  2DR5 A;  3FM9 A;  2GO7 A;  3GIJ A;  3N97 B;  2MUT B;  4UQG A;  5AM1 A;  1V85 A;  1TK0 A;  4JV0 A;  4ECQ A;  1ZD4 A;  2E8M A;  4GC7 A;  2IHO A;  5KL1 B;  3PSF A;  1JUD A;  3CK6 A;  5KAF U;  3TAQ A;  3OPX A;  3V7L A;  3NRZ A;  1PK1 B;  2ZH2 A;  4QJF B;  3PX0 A;  3MCR A;  1KL9 A;  1UA0 A;  4ICA A;  8ICT A;  2RRD A;  9ICE A;  3GIK A;  7ICU A;  1ZQW A;  4WBZ A;  1NK0 A;  3JPN A;  4XRH A;  1B0X A;  5KG0 A;  1ZQV A;  5J0R A; 
#chains in the Genus database with same CATH homology
 1L3U A;  2NRW A;  2FMP A;  4IQT A;  2C2R A;  1NZP A;  4F8R A;  3HX0 A;  7ICL A;  1ZQB A;  2J6T A;  4J9L A;  4YN4 A;  5KT5 A;  4YD2 A;  4M6W A;  4DFK A;  9ICS A;  5KFA A;  8ICE A;  1Z3E B;  4ED6 A;  4QZC A;  4RPY A;  2PFP A;  2F1J A;  3HWT A;  4EBC A;  4WC2 A;  3MGI A;  4KLJ A;  3BQT A;  1R8C A;  4WC7 A;  3FDS A;  5KT2 A;  1H38 A;  4F4Y A;  5TZV A;  1RYS A;  3PMN A;  4LZG A;  4QZF A;  2IA6 A;  4QZB A;  3ORY A;  3AQM A;  2ALZ A;  4ATB A;  1ZQN A;  3LQC B;  3H38 A;  3QEB Z;  2H5X A;  1Y88 A;  1ZQU A;  4I2I A;  4EZ9 A;  5J2J A;  4NLZ A;  5J0U A;  1R8A A;  4YVZ A;  4F5N A;  5KT4 A;  3RR8 A;  8ICY A;  3TAN A;  1D9F A;  5KFH A;  5KFP A;  4UAZ A;  4ECR A;  5IIM A;  5BOM A;  2AGQ A;  3ZDC A;  4F5P A;  4RWQ A;  4ECZ A;  2ZUB A;  1BNO A;  2JEG A;  4NLG A;  4KLF A;  2FLP A;  3OGU A;  1BPX A;  1ZQP A;  5IIO A;  4DOB A;  3GV5 B;  5KFR A;  2R8J A;  5J0X A;  1NK9 A;  8ICR A;  4RQ4 A;  3PX4 A;  4FH3 A;  3KHL A;  9ICB A;  4JK1 A;  1MIY A;  4J9P A;  4O3S A;  3MDA A;  1S0N A;  1JXL A;  4M9G A;  3EW9 A;  1MIV A;  3ISC A;  3EZ5 A;  4LT6 A;  1EXN A;  3RJI A;  2VAN A;  4DL7 A;  9ICJ A;  4YMM A;  1NJW A;  4FHV A;  3ZD8 A;  3C2M A;  4EBE A;  5J2C A;  1SL2 A;  3IHQ B;  5DG8 A;  4GXJ A;  2C22 A;  3SZ2 A;  1RXW A;  4LVS A;  4ED1 A;  1X9S A;  2PFN A;  1S76 D;  1UA1 A;  4I2F A;  1D8Y A;  5DED A;  1L3T A;  4PHD A;  4AT8 A;  5CHG A;  1QSL A;  3EYZ A;  1BGX T;  5KFS A;  2JZB A;  4DFM A;  3KTQ A;  4ELU A;  2HHV A;  1FA0 A;  2DR7 A;  5KFM A;  4BDP A;  2KFN A;  1A76 A;  2LYH A;  2RDJ A;  4X4R A;  2IBK A;  4IRC A;  3E2E A;  1COO A;  2DPI A;  4ECS A;  5J2E A;  1K1S A;  4B9M A;  4KLO A;  3Q8P B;  1RYR A;  4R65 A;  4O5C A;  9ICF A;  5EOZ A;  4J9K A;  3RB3 A;  2W8K A;  2J6U A;  9ICW A;  4G3I A;  3JZ0 A;  5EWE A;  1TVA A;  1XSN A;  3Q8R B;  3OSN A;  3H40 A;  4J9S A;  4LZD A;  2KZZ A;  8ICX A;  2RFF A;  8ICM A;  4FH5 A;  3G6Y A;  8ICQ A;  2ZJ5 A;  4QW8 A;  5KFB A;  3GQC A;  2DVI A;  4B9S A;  4O3R A;  4FHW A;  4I2G A;  7ICR A;  2C2E A;  8ICI A;  4NM2 A;  5DBC A;  4RT2 A;  3RBE A;  5KFT A;  2HW3 A;  1NJY A;  4AT7 A;  4FBT A;  3RJF A;  2AQ0 A;  2ASL A;  5J2G A;  4J9O A;  4QZD A;  5L1K A;  4MEX A;  5DQG A;  4HYK A;  4DO9 A;  1NK6 A;  3RRG A;  4QZH A;  1T8E A;  5HRK A;  7ICQ A;  3AU2 A;  3AQK A;  5DG9 A;  2IMW P;  1C7Y A;  4E7X A;  5IIN A;  3TQ1 A;  5HRF A;  4RWP A;  3V7K A;  3T5H A;  3ETL A;  4F2R A;  4Z6F A;  4RQ2 A;  4ED8 A;  1HUO A;  2ZH5 A;  9ICO A;  2BQR A;  1U45 A;  4IRD A;  4BXO A;  1KTQ A;  4UB3 A;  4C8K A;  3C66 A;  4MFA A;  3T5K A;  5CA7 A;  2ATL A;  5CJ7 A;  4MFF A;  4DWI A;  4TUQ A;  4JWM A;  4Z6E A;  4I2A A;  4KLL A;  5L9X A;  4TQR A;  2BCQ A;  4O3Q A;  4MFC A;  3BDP A;  1NK5 A;  5JUM A;  3IM1 A;  3GFK B;  2ZH8 A;  4GC6 A;  4TUR A;  3HJ1 A;  1D8L A;  3PW0 A;  7ICI A;  1OU5 A;  1KEJ A;  1WOT A;  1XC9 A;  4WC3 A;  2BR0 A;  3WFO A;  1LB2 B;  5DKW A;  3T5J A;  1KSP A;  3PV8 A;  4F50 A;  4KTQ A;  4NXZ A;  1X9M A;  9ICK A;  1V9P A;  3L9D A;  5KFO A;  3G6V A;  4B9L A;  4NKT A;  5D46 A;  4RWO A;  1NOM A;  2P6R A;  3PW5 A;  1MC8 A;  4QZ9 A;  4IR9 A;  2KTQ A;  5L1J A;  3RAQ A;  1MIW A;  3PW4 A;  4C8L A;  4KMU A;  4EP7 A;  4ECV A;  4KIT B;  4M6W B;  1DOQ A;  1ZJM A;  1ZQI A;  4DOC A;  2KZM A;  1S9F A;  1KNY A;  2M9N A;  5J2F A;  2PI4 A;  3RJH A;  1S0M A;  4TUP A;  3H8J A;  3Q8S B;  3M8R A;  3PW2 A;  3M9M B;  4JWN A;  3AU6 A;  3OSP A;  4I2B A;  8ICK A;  2O5A A;  4DLE A;  3NYB A;  3B0X A;  5DQH A;  2ZH7 A;  2GWS A;  3KHG A;  4TQS A;  2M2U A;  2R8H A;  3Q8K A;  4X4S A;  1ZQL A;  2ZH3 A;  3H4D A;  4KLE A;  2ZUD A;  2C28 A;  4KLD A;  2UVV A;  3OUY A;  5J0S A;  2FMS A;  9ICH A;  3PR5 B;  4F3O A;  2DRA A;  3AQL A;  5KFV A;  3QZ8 A;  1NJX A;  3WFQ E;  3ZDD A;  2F1I A;  3QE9 Y;  4EBJ A;  4P4O A;  3OHA A;  2HVH A;  5KG3 A;  2BDP A;  2Q0Z X;  2HHW A;  2HHU A;  3MR6 A;  9ICQ A;  5HML A;  4RQ3 A;  4M0A A;  2FPK A;  2ZH6 A;  4O3O A;  4B9V A;  4DS4 A;  3OVS A;  3HP6 A;  1ZQX A;  4QWE A;  4RNO A;  3OJU A;  3BJY A;  2R8K A;  4M04 A;  8ICN A;  3H39 A;  2BCU A;  4I2D A;  4RT3 A;  1CUK A;  1ZQM A;  2HHP A;  1Z00 B;  5DB8 A;  1ZQY A;  3UXN A;  4YR0 A;  1U9L A;  2M2V A;  5DLG A;  1K1Q A;  4PGX A;  4ED3 A;  2AGO A;  8ICL A;  3BQ1 A;  5J2K A;  4DL2 A;  4I2J A;  3LDA A;  8ICH A;  4YMN A;  3TAP A;  1UEU A;  2BPC A;  3LWM A;  1ZQC A;  5DEC A;  4I29 A;  7ICJ A;  1X9W A;  4Q45 A;  2W9A A;  4AT8 B;  4S3N A;  2JZB B;  3RRH A;  2JEF A;  3JPR A;  9ICL A;  5DQI A;  2BCR A;  2XGP A;  3PW7 A;  4C8M A;  4WC5 A;  4I27 A;  9ICN A;  5DDM A;  4F91 B;  1TFW A;  3C2K A;  5KFL A;  2Y1I A;  4M2Y A;  4RWN A;  5KFD A;  1T3N A;  1YLQ A;  3EPI A;  1QSS A;  3C18 A;  2KN7 A;  3PO4 A;  4F4X A;  1LV5 A;  1ZQQ A;  5KT7 A;  2AJQ A;  5F9N A;  4DL6 A;  1XWL A;  2VA3 A;  4YG2 A;  1Z00 A;  4EBD A;  5DGB A;  3H37 A;  4UB5 A;  5HC9 A;  4PPX A;  4WC1 A;  4YQW A;  3RH5 A;  1N56 A;  1ZQF A;  3SI8 A;  4DSI A;  2ZJA A;  5KFU A;  1SL1 A;  2KP7 A;  1KRP A;  3RR7 A;  3BQ0 A;  3N4M B;  2ID1 A;  2VA8 A;  5KFI A;  2BPF A;  3C21 A;  4AT7 B;  5L1I A;  2ZH1 A;  7ICV A;  1BPD A;  4RZR A;  2P66 A;  3H8S A;  2ZH9 A;  3M9N B;  2OWO A;  3OHB A;  8ICB A;  2C2D A;  5DB7 A;  1XO1 A;  4ECU A;  8ICC A;  1ZET A;  4DQI A;  4IQW A;  5HRL A;  3WFR E;  4ELT A;  2PBE A;  4F93 B;  3QZ7 A;  1S0V A;  4DOA A;  1JX4 A;  3H3A A;  4ECY A;  2ZH4 A;  5CP2 A;  4FHX A;  3ISB A;  4QZ8 A;  4UB1 A;  4BXO B;  5L1L A;  1ZQE A;  4MF8 A;  4KN4 A;  4O3N A;  1PZN A;  3JPS A;  4EZ6 A;  4BWM A;  2V9W A;  4X4Q A;  4Q8F A;  1T7P A;  1S0O A;  4O5K A;  4O0I A;  2B21 A;  5HRB A;  5J0W A;  4RQ5 A;  2VA2 A;  1IM4 A;  5HMM A;  3RJK A;  3Q8Q B;  5KT3 A;  4K4H A;  5KG4 A;  4UAY A;  3GIM A;  3T3F A;  4KLT A;  5DB6 A;  2F1H A;  5HHH A;  4X5V A;  2UVW A;  4KN7 A;  4E80 A;  3NGD A;  4E0D A;  5IIJ A;  3ISD A;  3OVA A;  4O3P A;  2HHT A;  2ZJ8 A;  8ICJ A;  1JN3 A;  4DSL A;  8ICZ A;  3TI0 A;  4KLS A;  1XSP A;  1T4G A;  4FBU A;  4M9L A;  4NLN A;  4UB4 A;  4O9M A;  4X4N A;  4BGD A;  4RQ8 A;  4M9H A;  4DSJ A;  2XY6 A;  4FHP A;  1TKD A;  2DR9 A;  4QZG A;  8ICP A;  4DSK A;  4DSE A;  1IXR A;  2BGW A;  2PXI A;  2M2T A;  4RUC A;  2ISO A;  2UVR A;  1NKB A;  5KFY A;  4PHA A;  5J2A A;  1ZQH A;  3ZDB A;  4RPX A;  2XCP A;  5J2H A;  4AT9 A;  4GLX A;  2IHN A;  3WFP A;  3M9O B;  3OUY B;  4QZE A;  4ZH4 A;  1ZQS A;  4P4P A;  4NKU A;  1X2I A;  2BKE A;  4IQV A;  1U48 A;  3K4G A;  4RUA A;  1S77 D;  4YD1 A;  1ZQO A;  9ICC A;  1TK5 A;  1ZQJ A;  1ZQK A;  4EEY A;  4KLH A;  5J0O A;  3MGH A;  4KLM A;  5HNK A;  2BQ3 A;  4FHY A;  4YR3 A;  4ED2 A;  2PI5 A;  5HR9 A;  3RB4 A;  2NRT A;  1JMS A;  3K75 D;  4DQS A;  4RPZ A;  3RJE A;  9ICR A;  4R64 A;  1ZQZ A;  4FS2 A;  2ZTE A;  1ZQD A;  4IR1 A;  5CWR A;  4RQ6 A;  4F5Q A;  4R63 A;  5HRG A;  5HRI A;  3H7I A;  3RAX A;  2XY5 A;  3PO5 A;  3SV3 A;  4QZA A;  1L5U A;  1V4A A;  3ZDE A;  3ZDA A;  3V6J A;  4J9R A;  4X0B A;  3RJJ A;  4R66 A;  1QLN A;  5F2V O;  3HW8 A;  5KG6 A;  4XQ8 A;  5KFG A;  3HT3 A;  4YP3 A;  2W9B A;  1N48 A;  9ICU A;  4GXI A;  2ZTC A;  4RQ7 A;  3T5L A;  3MR2 A;  8ICG A;  4QW9 A;  3JPP A;  5J2D A;  3LK9 A;  5CB1 A;  3LWL A;  3V72 A;  3Q8L A;  4XA5 A;  4F4W A;  4FO6 A;  2XGQ A;  3TFS A;  5J0T A;  3B0Y A;  2ASJ A;  1L3S A;  4KLU A;  7ICO A;  3AQN A;  5KFJ A;  4EYH B;  1SKR A;  3HIY A;  4M9N A;  2DPJ A;  4K4G A;  2NRX A;  4NLK A;  4F92 B;  4NY8 A;  2KFZ A;  4R8U B;  3MBY A;  1MSW D;  3H4B A;  4DFP A;  2MUT A;  9ICM A;  1BPZ A;  1U49 A;  1F5A A;  1NO5 A;  1UEV A;  4ED0 A;  5J2B A;  4X4P A;  7ICK A;  1TFY A;  1ZQT A;  2ISP A;  3PVX A;  4MF2 A;  2BCS A;  4QWC A;  9ICG A;  1HJP A;  4P4M A;  2WTF A;  4ECX A;  2R8G A;  3WFS C;  3KHH A;  1B43 A;  2DR8 A;  4UAW A;  1U4B A;  4Z6C A;  2AGP A;  1JAJ A;  4Q44 A;  2XCA A;  3UPS A;  2W9M A;  3C5F A;  1Q78 A;  4F5O A;  1QTM A;  5DLF A;  1TV9 A;  2PFQ A;  4DQP A;  1D9D A;  1XSL A;  9ICA A;  2FPM A;  4M47 A;  1NK7 A;  4RQ1 A;  3GII A;  1SKS A;  4ECT A;  4DQQ A;  9ICX A;  1Q79 A;  4QWA A;  5KFZ A;  5C5J A;  5HRD A;  4YXM A;  4RU9 A;  1KLN A;  2P6U A;  2FLN A;  4WC6 A;  1NKC A;  3TFR A;  5KG5 A;  3RTV A;  1ZYQ A;  1NK4 A;  5DB9 A;  3TAR A;  5KT6 A;  1XS9 D;  8ICF A;  4O5E A;  4DF4 A;  1KFS A;  3HPO A;  1B22 A;  4DF8 A;  3KHR A;  7ICF A;  4R8U A;  3OJS A;  1ZJN A;  2V4Q A;  5J0Q A;  1BPE A;  4TUS A;  4DL5 A;  1SZP A;  5BOL A;  3EPG A;  4UB2 A;  1JQR A;  1R89 A;  3OV7 A;  1KDH A;  1ZQR A;  4YXJ A;  1MQ3 A;  5DGA A;  3GV7 B;  2ZUC A;  4CCH A;  4B9N A;  4NM1 A;  4DL4 A;  4GXK A;  3C1Y A;  5KFE A;  4Q43 A;  5EWG A;  3NTU A;  4C8N A;  3PR4 A;  4DLG A;  3RB6 A;  1U47 A;  3JYY A;  4F5R A;  3MAB A;  4UD5 A;  1WCL A;  2RDI A;  4PGQ A;  2PFO A;  2HHS A;  2A1J B;  5DBB A;  5F9L A;  3MR5 A;  2ZTD A;  3V7J A;  4PHE A;  4B9U A;  4RQ0 A;  1NK8 A;  4KLI A;  2JEI A;  5D4B A;  5KFW A;  4MEY A;  2XO7 A;  2FLL A;  4UBC A;  3PX6 A;  2JEJ A;  3FYH A;  4X0A A;  2BE3 A;  5J0P A;  8ICW A;  1UT5 A;  3GDX A;  1ZQG A;  2ZHA A;  1NJZ A;  4UD4 A;  1RXV A;  1UET A;  1S10 A;  2NRZ A;  2UVU A;  7ICS A;  4KLG A;  5HRE A;  1XU4 A;  4EYI B;  5J2I A;  4ELV A;  5KFQ A;  4WC0 A;  4IRK A;  1RPL A;  3C1Z A;  5KG1 A;  1SKW A;  3C23 A;  4AT9 B;  2I1Q A;  3C5G A;  7ICN A;  9ICV A;  3OVB A;  3PY8 A;  4M9J A;  3EWA A;  1BNP A;  1KFD A;  2W9C B;  4JV2 A;  4I28 A;  2NRV A;  1BPB A;  5DG7 A;  3ZD9 A;  3SYZ A;  4X4T A;  1HUZ A;  4I2E A;  1L3V A;  4RNN A;  4B9T A;  3PML A;  5EWF A;  3BQ2 A;  2A1J A;  4X4O A;  2Y1J A;  1DK2 A;  4WC4 A;  4JUZ A;  3RH4 A;  1R8B A;  8ICS A;  1ZQA A;  3QEA Z;  1JXE A;  3UXO A;  4Q8E A;  2HVI A;  4WCW A;  1DGS A;  2XC9 A;  4YMO A;  4F4Z A;  4PH5 A;  3MFI A;  9ICP A;  1ARO P;  9ICI A;  4X4V A;  5III A;  1RZT A;  1BVS A;  2Q66 A;  3Q8M A;  2HHQ A;  4JV1 A;  2V4R A;  2IHM A;  8ICO A;  2ASD A;  5KG7 A;  4ECW A;  3UPQ A;  3RB0 A;  3V6K A;  5HHI A;  1JIH A;  1TK8 A;  4YR2 A;  1WCN A;  3V6H A;  8ICV A;  3C2L A;  5IIK A;  4E8F A;  4FS1 A;  2W9B B;  4P2H A;  2O1P A;  3THV A;  5CR0 A;  4YCX A;  8ICA A;  2W9C A;  5HP4 A;  4DFJ A;  5D49 A;  1S97 A;  4QZI A;  3JPO A;  2I9G A;  5KFX A;  4QWB A;  1PX5 A;  5BPC A;  1NKE A;  4J9M A;  4UBB A;  2FMQ A;  1TFR A;  4I2H A;  2DR5 A;  4C8O A;  2DFL A;  3GIJ A;  5J29 A;  4RNM A;  1BPY A;  4F4K A;  7ICM A;  3N97 B;  2XY7 A;  1KFT A;  2MUT B;  3JPQ A;  5KFN A;  3UQ2 A;  1QSY A;  4UQG A;  1CEZ A;  4X4U A;  4YFK A;  2BQU A;  1TK0 A;  5DBA A;  2HHX A;  4IG8 A;  4JV0 A;  4ECQ A;  4F2S A;  1SL0 A;  4K4I A;  4GC7 A;  3UQ0 A;  1VJ7 A;  3AUO A;  2BCV A;  1A77 A;  4Z6D A;  7ICP A;  4DL3 A;  3GV8 B;  5KFF A;  3MFH A;  3TAQ A;  3V7L A;  1MQ2 A;  4PHP A;  3MDC A;  2M2W A;  4DS5 A;  2ZH2 A;  4DEZ A;  1VFG A;  2FPL A;  5DDY A;  2R8I A;  4I2C A;  7ICE A;  5IIL A;  3PX0 A;  4J9N A;  5KFC A;  2AU0 A;  3UXP A;  4WBY A;  3RJG A;  5J0Y A;  4XQ7 A;  3RH6 A;  3MR3 A;  1UA0 A;  2ZHB A;  1DK3 A;  4KLQ A;  8ICT A;  9ICE A;  3GIK A;  3RBD A;  2AQ4 A;  3SV4 A;  7ICU A;  8ICU A;  4J9Q A;  4M5D A;  7ICH A;  4XUS A;  9ICT A;  5KTQ A;  4BWJ A;  2BPG A;  7ICT A;  4EBK A;  3H8W A;  5HRH A;  1ZQW A;  4QWD A;  1TAQ A;  1TAU A;  4WBZ A;  3HJ4 A;  1NK0 A;  3PNC A;  4IQU A;  4PGY A;  4DSF A;  3JPN A;  7ICG A;  4ATB B;  5KG2 A;  2J6S A;  2KZ3 A;  4ED7 A;  4XRH A;  3JPT A;  2BHN A;  5KFK A;  5KG0 A;  1ZQV A;  1UT8 A;  5J0R A;  3GIL A;  4DQR A;  3M8S A;  2W8L A;  2DRB A;  3G6X A;  2MAX A;  2NRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...