4NY8A

Dna polymerase beta with o6mg in the template base opposite to incoming non-hydrolyzable ctp with manganese in the active site
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
325
structure length
323
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 108
structure length 323
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ny8A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ny8A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ny8A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ny8A03
2HHUA 4F5QA 1TAQA 4MFAA 4F4YA 3QEAZ 4DSLA 1UEVA 2ASLA 1WCNA 8ICQA 2H5XA 3PW5A 9ICIA 4X4VA 5KFIA 3T5LA 1ZQMA 1ZQHA 3TFSA 5L1JA 4QWEA 4KN7A 4Z6FA 3ZDDA 4M2YA 5DGBA 4DOAA 1SKWA 1DOQA 2HHSA 4IG8A 4O3PA 3H4BA 2BCVA 4WBZA 4E80A 3TFRA 4UB5A 5IILA 2W9CA 1KRPA 4RWOA 4QZGA 2NRZA 3GV5B 1TVAA 9ICBA 3SV3A 4FHPA 3OSNA 3V6JA 4M47A 4PHDA 5CB1A 4YMNA 4EYIB 5KFHA 2WTFA 2ZUCA 4PHAA 4UB3A 4TURA 4NLNA 3C23A 3HT3A 4UB2A 1JQRA 2ZTDA 3MDAA 4CCHA 3WFSC 3PW7A 5HC9A 1ZQKA 1ZQJA 2ZUDA 8ICHA 4WBYA 5J0TA 3N97B 3C5GA 4ECTA 5KFBA 2VA2A 3OVSA 3GV7B 1CUKA 4I29A 5D46A 3H38A 2Q66A 4WC4A 2UVWA 2W8LA 1ZQPA 2ZHBA 5IIKA 3RH5A 4KLTA 1DK3A 5JUMA 4XUSA 4X4RA 3LWMA 4F91B 4ELUA 1BPEA 3HW8A 5KFZA 5KFTA 2F1HA 1BVSA 4RQ2A 4F5RA 3Q8KA 4IQWA 3JPOA 5KFQA 4YN4A 4J9RA 4BXOB 4IQUA 4KLQA 1UT8A 5HRIA 8ICNA 4UD4A 3UXPA 3RRHA 1BPZA 4RPZA 4X4OA 3KHLA 3V72A 5KG2A 9ICMA 3LDAA 1NKBA 1LV5A 4Q44A 3G6XA 2UVRA 4RWNA 3C2LA 2HVHA 1C7YA 5J2JA 2KN7A 2KFZA 5KG3A 3AQNA 1TFRA 2AQ0A 2LYHA 2NRWA 3MFIA 4ELVA 4UBCA 4F5OA 3M9OB 4J9NA 7ICKA 4UD5A 4WC2A 4UBBA 4X0AA 5DB7A 4ECUA 4GXIA 5KT4A 5DDMA 1S77D 2M9NA 5KFFA 4WC3A 3C1ZA 1XSNA 4C8OA 4UB4A 2FPLA 5HMMA 1NK4A 4JV1A 2O5AA 1NKEA 3L9DA 2A1JB 3UPQA 4X4UA 4K4HA 5HRGA 4I2DA 1X9MA 4RUCA 3RJFA 5DB6A 2BPFA 5DQHA 4RQ4A 3H4DA 4DSKA 4QZIA 8ICIA 1B22A 4DFKA 2XY5A 5KFPA 2PI5A 4F4ZA 7ICOA 3LWLA 1RYSA 4QZ9A 5DLGA 4GXJA 4UAZA 2HHPA 4AT9B 4M9LA 2FPMA 3Q8RB 4QWAA 8ICLA 5KFAA 4DL6A 1SL0A 2ZH1A 3BQ1A 5HRLA 3V6HA 3PO4A 1ZJNA 4M9GA 4ED0A 2I9GA 3Q8SB 3AQKA 8ICKA 9ICWA 2GWSA 3C1YA 1XWLA 3SZ2A 9ICEA 3GFKB 4TQSA 3Q8QB 2W9CB 2P6UA 4P4MA 4I2CA 4M9NA 2F1JA 3JPNA 3ISCA 3H39A 1RXWA 3SYZA 4BWMA 2HW3A 4LVSA 2DR7A 4YMMA 1R89A 4Q8FA 4RPXA 4O9MA 2FLPA 2AJQA 2ID1A 3GIMA 4FHVA 4TUPA 1N48A 2DR9A 1ZETA 3RJKA 4NKUA 4PGXA 4RQ8A 2XCPA 1TV9A 4DL7A 5BPCA 4YD1A 4PHEA 2ZH9A 4GLXA 1L3TA 1JMSA 8ICEA 1ZQAA 4ED1A 2M2VA 4KLLA 2BE3A 3WFRE 2ZTEA 4KMUA 1S0MA 4WC6A 3AU2A 1V9PA 3IHQB 4C8NA 5DB9A 3HWTA 2Y1JA 4X4TA 1QSYA 1DGSA 3GILA 1ZQFA 2HHXA 2AGPA 7ICTA 1ZQVA 4DO9A 3RJJA 4DQSA 2IHNA 4DS4A 4WCWA 4QW8A 4YXJA 3Q8MA 9ICPA 4KLDA 2ZJ5A 3K4GA 2XGQA 4RU9A 3OSPA 3PVXA 1NJXA 4M9JA 2BCUA 1BPBA 1T7PA 4KN4A 5L1IA 1ZQCA 4TUSA 3AU6A 2A1JA 4BXOA 4DSJA 4Z6EA 4LT6A 1D9DA 9ICHA 1HJPA 2XGPA 4R8UA 2MAXA 4R65A 3G6VA 1S0NA 2BCQA 1S9FA 1NK8A 4KTQA 1YLQA 5KT3A 2ALZA 1MIWA 4ECRA 3N4MB 1ZQIA 4B9UA 4KLIA 5HRKA 4JUZA 1ZQZA 1BGXT 4BWJA 1NKCA 7ICNA 2ZH2A 3KHRA 2HHQA 2VA8A 3IM1A 4AT9A 2DFLA 4IQTA 4FH3A 1A77A 4K4GA 1RXVA 3E2EA 1NZPA 4FHYA 4S3NA 1D8LA 4ATBA 2UVUA 5EOZA 3QZ8A 1KNYA 1F5AA 4I2IA 5KFVA 3HX0A 4E8FA 3NYBA 5KT6A 3RBDA 4FS1A 5EWGA 1RYRA 1ZJMA 3MGHA 1L3VA 3C5FA 4DFMA 4KLHA 1WOTA 3H3AA 4AT8B 4YMOA 1KFSA 2FLLA 5BOMA 4O0IA 4M0AA 2ZUBA 4RNNA 1XSLA 2R8GA 2O1PA 3C18A 3TAPA 4RQ3A 1X9WA 1B43A 4QZFA 1S10A 1T8EA 4KLFA 4I2AA 4NY8A 4BGDA 3TARA 4XRHA 1D9FA 9ICTA 4UQGA 1U49A 1QTMA 4NKTA 5KFXA 3MR3A 5CP2A 4RNMA 2J6UA 3EPIA 1BPYA 5J0WA 4RQ5A 1X9SA 4B9NA 4RWPA 5CA7A 3JPPA 3MDCA 5J2BA 9ICNA 4GXKA 5DKWA 1QSLA 4B9MA 2HHVA 1UEUA 2IHMA 1JN3A 3Q8LA 4C8MA 3PW0A 4B9SA 3M9NB 4YP3A 3GIJA 4K4IA 2ZH5A 3UXNA 5HRDA 4FH5A 1QLNA 2JEFA 1SZPA 4DLEA 4DF8A 5DGAA 1K1QA 1TFWA 4MF8A 7ICMA 2RDIA 4YD2A 3RJHA 4RQ1A 4P2HA 2DVIA 4B9VA 1L5UA 4MEYA 4UAWA 1IM4A 4WC7A 4KLOA 2W8KA 8ICRA 3EW9A 7ICQA 8ICFA 4TUQA 1D8YA 4KITB 7ICGA 1TKDA 1NK9A 8ICMA 4KLUA 3H8JA 9ICKA 1KTQA 5KG7A 3NGDA 2P66A 4NLZA 4Q8EA 4F4WA 2DR5A 5L1LA 4O5KA 5KFCA 1RZTA 4FO6A 5KT7A 4PHPA 9ICJA 1IXRA 3HIYA 4I2FA 3PMNA 3QEBZ 2V4QA 5KFEA 1KSPA 4J9SA 4ECWA 4RQ6A 1U45A 3MGIA 3T5HA 9ICFA 4DOBA 2ZTCA 4F92B 3H8SA 4R8UB 2ZH3A 3PR5B 3JPRA 5KFJA 2P6RA 4AT7B 4I27A 4RT2A 4IRCA 4FHXA 5KFOA 5DG9A 5TZVA 2XY7A 3QE9Y 2XCAA 1TK5A 2PFPA 2BGWA 4DF4A 2ISPA 4X4NA 5KFRA 5DBAA 3ISDA 3PV8A 5DBBA 4EBEA 4ECZA 5J2AA 5D49A 3RB3A 5KFSA 3RAXA 4MEXA 2FMQA 5BOLA 4J9LA 4FHWA 2Y1IA 3NTUA 4F4XA 5DQGA 5KG6A 5HR9A 1U47A 4QWCA 3ISBA 4JV2A 4RWQA 4ZH4A 4ATBB 2JZBB 1RPLA 2BCRA 4C8LA 8ICTA 4Q43A 4DSFA 2OWOA 5J2HA 3V7KA 7ICVA 3G6YA 2BQUA 3H7IA 4YR3A 2IBKA 9ICXA 2KZ3A 2M2WA 3ZD8A 3OGUA 4LZDA 2BDPA 4QWDA 4M5DA 9ICCA 4HYKA 3TAQA 1ZQEA 3T5KA 5CR0A 2BKEA 3PR4A 1SKRA 4DS5A 3EWAA 9ICQA 2W9AA 5KFKA 4QZAA 3BJYA 2BR0A 4DEZA 1Z3EB 1S0OA 1ZQGA 2FMPA 4EZ9A 4I28A 2HHWA 8ICOA 4XQ8A 4Z6DA 1KFTA 4FS2A 3JYYA 4M6WA 3TI0A 5L1KA 3KTQA 9ICGA 2V9WA 4I2HA 4YR0A 2BQ3A 4EEYA 4GC7A 3ZDBA 8ICCA 3RJEA 4F50A 3H8WA 3GIKA 1HUZA 3B0YA 4IR9A 4ECQA 2ATLA 3SV4A 2PFOA 1LB2B 4LZGA 5F9LA 8ICXA 5KG5A 2C2EA 3TANA 4F5NA 5J2DA 1JAJA 1KDHA 5HREA 3M9MB 4QW9A 3HJ1A 1X2IA 4QWBA 3GQCA 4DL4A 9ICLA 3V7JA 4ELTA 7ICEA 2BHNA 5HRHA 4O3OA 3UXOA 4EP7A 4EBCA 4DL3A 7ICPA 1BPXA 5DLFA 2MUTA 1ZQRA 8ICVA 1L3UA 8ICZA 2BPGA 3RTVA 4MFFA 4RUAA 2HVIA 1TAUA 2PBEA 4KLSA 5KFGA 1SL1A 2NRXA 1L3SA 4F2RA 2NRKA 1ZQYA 4FBTA 8ICSA 1NK0A 5J2KA 5HNKA 3RB0A 5KG4A 2UVVA 5J2GA 4C8KA 4IRKA 4O3RA 4AT7A 2PFQA 3WFPA 4J9MA 3EYZA 2R8HA 4ED2A 1ZQOA 3PO5A 4PPXA 1OU5A 4B9LA 2ISOA 2XO7A 5DEDA 2J6TA 5KG1A 3MR6A 3HPOA 2XY6A 2BCSA 1S0VA 7ICRA 1NO5A 9ICUA 3H37A 4X4PA 4KLJA 1JXEA 1MQ2A 3M8SA 1ZQNA 4PH5A 4QZEA 3RH6A 4YG2A 5HHIA 3OJUA 2JZBA 4YCXA 2NRTA 4RZRA 7ICJA 4E7XA 2W9BB 2R8KA 1MSWD 5EWEA 5J0XA 5J2IA 4YXMA 2KP7A 4RQ7A 2FPKA 4IQVA 4X0BA 4RQ0A 3V7LA 4JWNA 3PX4A 4O3NA 4F5PA 4X4SA 4NLGA 3AUOA 3BQ0A 3ZDCA 2B21A 2KZZA 2KTQA 3RB6A 3LK9A 3HP6A 2NRVA 5J2EA 3MFHA 4EBDA 1XU4A 3ZD9A 3MBYA 1UA1A 2FLNA 3K75D 5KFNA 5HRFA 4IR1A 5KFUA 4ECYA 4EBKA 2JEJA 1R8CA 3UQ0A 4ED7A 3SI8A 1COOA 5HMLA 1NK7A 4BDPA 7ICSA 2M2UA 4WC1A 5DDYA 5J2FA 3KHGA 3LQCB 1R8AA 2DRBA 4XA5A 4QZBA 2R8IA 1QSSA 4F3OA 4ED8A 8ICPA 1MC8A 1VJ7A 2W9MA 5DBCA 3C2MA 5KTQA 3RH4A 3ETLA 4JV0A 2PFNA 3OUYA 4JK1A 4M6WB 1NJWA 4YFKA 4DL2A 2AQ4A 3EZ5A 2DPJA 2BPCA 2PXIA 2V4RA 1KFDA 3BQTA 1ZQTA 4I2BA 4KLMA 3OJSA 8ICAA 2RFFA 1T4GA 5J0RA 3RAQA 9ICOA 3T5JA 3C21A 4PGQA 4P4OA 4E0DA 2ZH7A 5J0YA 4B9TA 4X5VA 1Q79A 4ED3A 1JX4A 1Z00B 3RJGA 4G3IA 3OVAA 3ZDAA 2AGOA 3OVBA 3PX6A 4DQPA 7ICFA 4O3SA 5IIIA 3MR5A 1SL2A 2MUTB 5F9NA 3PNCA 4MFCA 3M8RA 1K1SA 1XO1A 9ICRA 2BQRA 8ICYA 5CJ7A 7ICHA 9ICSA 5DECA 3RJIA 3WFOA 3JPQA 1KLNA 2VA3A 2W9BA 3KHHA 1Q78A 1R8BA 5IIJA 5J0UA 4YR2A 4J9KA 7ICUA 8ICGA 1FA0A 5IIOA 4EYHB 4R66A 1ZQWA 2FMSA 4Q45A 1NJZA 4QZ8A 4R64A 3GDXA 5KFMA 3C2KA 3TQ1A 1N56A 1A76A 2AU0A 1JXLA 4NLKA 4NXZA 2J6SA 4EZ6A 4I2JA 2C28A 4IRDA 3AQLA 4EBJA 1AROP 2ZH8A 4ECXA 5DQIA 1ZQDA 3QZ7A 4O5EA 4YVZA 5EWFA 4KLGA 3B0XA 4PGYA 1S97A 4F4KA 4ECVA 4FBUA 4DSEA 1UT5A 2AGQA 3JZ0A 4WC5A 9ICVA 2ZJAA 2C22A 1MQ3A 4KLEA 2ZHAA 1XSPA 1TFYA 3RRGA 3BQ2A 4J9PA 4RT3A 5HP4A 5DG8A 4J9QA 3THVA 5HHHA 5C5JA 4I2EA 2KFNA 1ZQUA 2XC9A 4DL5A 4DQRA 1U9LA 2C2DA 1MIVA 4DQIA 4QZCA 3RB4A 3Q8PB 2JEIA 4AT8A 1Y88A 3UQ2A 4M04A 2ZH4A 8ICUA 3H40A 4DOCA 3T3FA 4DFPA 8ICBA 5DG7A 1PX5A 2Q0ZX 5KT2A 1JIHA 4P4PA 4DWIA 5F2VO 2I1QA 2IA6A 1T3NA 2IMWP 4RPYA 3ZDEA 1U4BA 5IINA 1ZQLA 1ZQXA 1NJYA 3MR2A 2DRAA 5KFWA 1WCLA 1KEJA 3MABA 1PZNA 1UETA 1CEZA 4X4QA 4UB1A 5KT5A 4DSIA 9ICAA 3OUYB 4NM1A 3JPSA 4MF2A 1Z00A 3GIIA 3FDSA 4QZDA 8ICWA 5HRBA 1NK5A 4RNOA 2C2RA 1XS9D 4O3QA 3RBEA 3JPTA 3GV8B 2RDJA 2DPIA 3PW2A 1U48A 5D4BA 5J2CA 4DFJA 5KFLA 1EXNA 5KFDA 5J0PA 4R63A 2JEGA 4UAYA 1DK2A 3FYHA 3OV7A 4YQWA 4DLGA 1H38A 2PI4A 4ECSA 8ICJA 3ORYA 3V6KA 1HUOA 2ZH6A 4F8RA 3C66A 2HHTA 7ICIA 1ZQBA 5KG0A 3RR8A 3WFQE 2F1IA 5CWRA 4J9OA 3PW4A 4O5CA 1SKSA 4JWMA 2ZJ8A 3OHAA 3BDPA 1BNOA 3HJ4A 4WC0A 3UPSA 3RR7A 1UA0A 1BNPA 2DR8A 5KFYA 3PY8A 5J0SA 1V4AA 1MIYA 5J29A 1ZQQA 5L9XA 4I2GA 4Z6CA 4NM2A 1BPDA 1NK6A 4TQRA 3PMLA 5CHGA 2M2TA 4F93B 5DB8A 2VANA 4XQ7A 1TK0A 1XC9A 2ASJA 4F2SA 1ZYQA 5IIMA 3PX0A 4GC6A 5J0OA 5J0QA 1ZQSA 7ICLA 4DQQA 2R8JA 1NOMA 2KZMA 1VFGA 3EPGA 1S76D 3OHBA 3AQMA 4ED6A 1TK8A 2ASDA 4M9HA 4QZHA
chains in the Genus database with same CATH superfamily
2HHUA 4F4YA 1TAQA 4DSLA 1UEVA 4X4VA 3TFSA 2JH7A 1JALA 3ZDDA 4QWEA 5ALSA 1SKWA 2G5IB 4WBZA 2BCVA 5IILA 1Q3UA 2W9CA 3AMZA 3GV5B 1TVAA 2XICA 3ER8C 3OSNA 3V6JA 5CB1A 5KFHA 2WTFA 1ZD2P 1JQRA 4CCHA 2NO4A 3CK6A 5HC9A 3N97B 1JUDA 2GAFD 5ALJA 2Q66A 3I1YA 3RH5A 2H3QA 4KLTA 1DK3A 3NS1A 4X4RA 4F91B 2E1FA 3Q8KA 2G09A 5KFQA 4UD4A 5TISU 4RPZA 4X4OA 3KHLA 9ICMA 1NKBA 1LV5A 3G6XA 2HVHA 5J2JA 4G9BA 5AKZA 2LYHA 2NRWA 4UBCA 4F5OA 3M9OB 4J9NA 5AKJA 4UD5A 4X0AA 5DB7A 2IOFA 5DDMA 2IHOA 1S77D 2D6FC 3C1ZA 4C8OA 5HMMA 3DV9A 1SV0C 2HOFA 4BJQA 4K4HA 4I2DA 4RUCA 3C28A 2Q4TA 4RQ4A 2BPFA 4DSKA 8ICIA 1B22A 5KFPA 3NRZA 1RYSA 4QZ9A 4GXJA 3K1ZA 4UAZA 4M9LA 4P0PB 4QWAA 2ODGA 4DL6A 4OJPA 1NNLA 1SL0A 2CN1A 3PO4A 4C7ZA 3VC8A 4TQSA 4P4MA 3ISCA 1N62A 1Z4OA 2OEHA 2HW3A 2JRZA 4RPXA 2FLPA 3WKDA 4TUPA 1ZETA 4RQ8A 1TV9A 3CNHA 4ED1A 1PK1A 2KNJA 3WFRE 1WWVA 1B4FA 7ICTA 4DQSA 2K8CB 4IL6U 9ICPA 1YZ7A 2W11A 4Y2RA 4NXVA 4M9JA 8ICHA 5F3XB 1NJXA 2IOFK 5L1IA 3A0HU 1D9DA 2LYBA 4R8UA 1S0NA 3B9JA 5KT3A 3NVYA 4B9UA 1LKYB 1ZQZA 2JH1A 1S5LU 3KHRA 2DFLA 5ALOA 3NUQA 1ZQ1C 4K4GA 1Q46A 4EEKA 2UVUA 4ATBA 3QZ8A 2Y9TA 2HBKA 4I2IA 4KB6A 4E8FA 2Y0SF 4UATA 3MGHA 1L3VA 4DFMA 1WOTA 3NVOA 2LMRA 3M6KA 1KFSA 2ZUBA 3C18A 3TAPA 4O68A 2ZIXB 4KLFA 2DF4B 1QTMA 4NKTA 3NASA 3FC4A 3MR3A 2J6UA 4NXUA 2Y0SC 3JPPA 9ICNA 2NV3A 5DKWA 1ZD3A 1HIWA 3BZKA 3M9NB 4YP3A 3GIJA 1RM6C 4K4IA 1QLNA 1SZPA 2QARB 4DLEA 4DF8A 2KJ5A 3OPXA 4RQ1A 4P2HA 2GH1A 2W8KA 2KVSA 4TUQA 1D8YA 1VDVA 2G08A 8ICMA 1QCKA 3H8JA 9ICKA 4F4WA 5L1LA 4QIWF 5AI9A 3HIYA 3QEBZ 2KG5A 1KSPA 4ECWA 9ICFA 4F92B 3H8SA 5KFJA 4RT2A 2QKQA 5DG9A 5C0YA 3QE9Y 2W04A 3VCBA 4DF4A 4P0QB 2W43A 3ISDA 4EBEA 4MEXA 4ECZA 2YB1A 3RAXA 2FMQA 5BOLA 4FHWA 1PUZA 3NTUA 5KG6A 5HR7A 3LVWA 3SAFA 3ISBA 3QU5A 4C8LA 2OWOA 5J2HA 3G6YA 2BQUA 4YR3A 2IBKA 5KAIU 4US9A 4UW9A 3TAQA 1SXDA 4ICAA 1ZQEA 3T5KA 1SKRA 2BKEA 9ICQA 1Z3EB 2LKYA 2VJ4A 4EZ9A 2ZH9A 4XQ8A 4Z6DA 1URJA 4OO1J 5CHEA 2KD1A 4GC7A 1WUDA 2EAOA 8ICCA 5EE9A 3RF9A 4IR9A 2ZIVA 2PFOA 3D2SA 5K4LA 2C2EA 2YB4A 5J2DA 4XJEA 4DL4A 9ICLA 2W3SA 2BHNA 4O3OA 4EP7A 5DLFA 2QB0A 2BPGA 3RTVA 4MFFA 1TAUA 5AM3A 4KLSA 2ES6A 2H3IA 1QH9A 1NK0A 3RB0A 5KG4A 4IRKA 4O3RA 2PFQA 4J9MA 2K4PA 3EYZA 4ED2A 4PPXA 2ISOA 5DEDA 1IG6A 3H37A 2BCSA 2XY6A 1S0VA 7ICRA 1NO5A 9ICUA 2CPRA 4KLJA 3F53A 2JZBA 4RZRA 1RDFA 5J0XA 5J2IA 2F8KA 4IQVA 4X0BA 2WFAA 4O3NA 4F5PA 2B4VA 1ZRMA 4EBDA 1N63A 1WG8A 5KFNA 4C4RA 1R8CA 3UQ0A 3KHGA 5KL1B 3C2MA 5KTQA 1MA7A 4DL2A 2AQ4A 1X6IA 3NVWA 3BQTA 4KLMA 3OJSA 8ICAA 3T5JA 3C21A 1X66A 4P4OA 4E0DA 4B9TA 2HI0A 1Q79A 1JX4A 1Z00B 3N7RC 4UB6U 3KFUF 4MFCA 5F9NA 1K1SA 9ICRA 2BQRA 5DECA 2W9BA 3KHHA 2DGZA 4J9KA 3HKZF 3GZFA 4EYHB 4K96A 1ZQWA 2FMSA 3GDXA 2AU0A 4WQKA 4NLKA 3M1YA 4ECXA 1S97A 2AGQA 2ZJAA 2KKPA 1MQ3A 3CW2C 1TFYA 3BQ2A 5HP4A 1R8BA 5DG8A 5C5JA 2KFNA 3HKZC 4DL5A 4DQRA 1MIVA 3A0BU 2JEIA 4F71A 3Q8PB 1KKXA 2K60A 4K99A 4DWIA 5F2VO 4NLCA 4CRXA 3L3FX 5IINA 1ZQLA 1NJYA 5ALNA 1CEZA 3OUYB 3JPSA 4HAIA 4CF3A 3GIIA 4LJXA 4QZDA 2JR5A 2WHEA 2WF9A 1XS9D 5KNIA 2RDJA 5AM4A 3PW2A 4BXOA 2JHDA 1DK2A 2YMPA 4DFJA 2JEGA 4UAYA 2LI6A 5ALLA 5AK4A 4F8RA 3C66A 2HHTA 1ZQBA 5AI8A 5KG0A 4U7CA 5CWRA 1GO3F 3RR7A 1SWVA 5J0SA 5J29A 1ZQQA 3GU3A 5L9XA 4Z6CA 4I2GA 1ZXIA 1IIPA 3PMLA 4F2SA 1ZYQA 5ALEA 7ICLA 2R8JA 2KZMA 1OW5A 2EZYA 4BX9C 4QZHA 4FHPA 4UAUA 4LEZA 3L5KA 2OCEA 2ASLA 8ICQA 2H5XA 4JLZA 5AI0A 3LVVA 4RQNA 5ALHA 4KN7A 4Z6FA 2KE7A 1DOQA 5AICA 4E80A 4RWOA 1KRPA 3SEIA 4QZGA 1J2MA 3SV3A 4M47A 4PHDA 4YMNA 5D62A 2IOHA 4PHAA 4OJ5A 4UB3A 4TURA 3HT3A 4KM5A 2ZTDA 3MDAA 3WFSC 2KICA 1ZQKA 3OVSA 5KFBA 4I29A 2JMGA 5JUMA 4ELUA 1BPEA 5KFTA 1TE2A 5AM5A 4IQWA 2EH9A 2RRDA 1S8OA 1BPZA 2AH5A 2MA1A 3V72A 2G06A 1C7YA 2KN7A 3HRDD 2KV2A 3AQNA 1TFRA 2VKQA 2HN2A 4ECUA 5H2FU 1T3QA 3C29A 3L9DA 2EZXA 5B5EU 3UPQA 4X4UA 1X9XA 2NYVA 1X9MA 5DB6A 3H4DA 4QZIA 1DXSA 2YMLA 4F4ZA 3K7DA 5DLGA 3TADC 2HHPA 2DKZA 3Q8RB 2WF6A 8ICLA 1L7PA 4CF4A 2ZH1A 3IG5A 4M9GA 2EAPA 8ICKA 9ICWA 5ALDA 2GWSA 1XWLA 3SZ2A 3GFKB 4M9NA 2F1JA 1RXWA 3SYZA 3N7PD 1R89A 4Q8FA 4C4TA 3QYPA 3GIMA 2W7OA 3RJKA 4NKUA 1KL9A 4PGXA 2XCPA 4US8A 4DL7A 4YD1A 1S0MA 4CF5A 4O67A 5DB9A 3HWTA 3GILA 1ZQFA 4FFDA 1IV8A 3O0FA 3JCFA 4OJLA 2YX8A 4KLDA 3K4GA 2BCUA 3IDWA 2B6GA 1ZQCA 4TUSA 3AU6A 2A1JA 4DSJA 9ICHA 1HJPA 2XGPA 2MAXA 4R65A 5J8YA 5AK5A 2YMMA 2BCQA 3N28A 4KTQA 2ALZA 1MIWA 1ZQIA 2F76X 4JUZA 3WKAA 1BGXT 4BWJA 3WK9A 3IM1A 4IQTA 4ACOA 3E2EA 1KNYA 1F5AA 1LVHA 3BS7A 3KBBA 2CXYA 4FS1A 4PJ0U 3H3AA 1ZJMA 3C5FA 4YMOA 2I5HA 4RNNA 1WWUA 4WQLA 3ONNA 5ALRA 4XRHA 1DGJA 9ICTA 5ALYA 1U49A 3EPIA 1RYUA 5J0WA 4GIBA 4Y2PA 3BS5A 1Z1VA 2IHMA 4B9SA 3UXNA 4FH5A 3L4PA 2YMQA 5AK3A 1JROA 2E8OA 5ALGA 5DGAA 7ICMA 2LPEA 2RDIA 3WK6A 5AI5A 1L5UA 4MEYA 1IM4A 2KK0A 2ZIVB 8ICRA 3EW9A 8ICFA 2HDOA 2XVTA 1RG6A 5KG7A 2P66A 4NLZA 4O5KA 1L7NA 5KFCA 4FO6A 1RZTA 4QNLA 4PHPA 1IXRA 1MN8A 4I2FA 4NXTA 4I0UA 2DUYA 2ZTCA 2HMXA 4NJ8A 4I27A 5KFOA 5TZVA 2XY7A 4AT8A 2XCAA 4X4NA 3PV8A 5J2AA 5D49A 4J9LA 2Y1IA 5DQGA 3SMVA 5HR9A 4UASA 1U47A 4JV2A 3IP4B 2JZBB 2RFFA 8ICTA 4DSFA 9ICXA 2KZ3A 1FFVA 2M2WA 3ZD8A 2BDPA 2KMDA 2W9AA 1S0OA 2HHWA 1UPHA 8ICOA 1KFTA 4LEVA 4NV0A 1V85A 9ICGA 4F50A 3GIKA 1HUZA 3QUQA 5HREA 3M9MB 4QW9A 3HJ1A 4ELTA 1D8BA 4EEBA 4DL3A 1BPXA 2YTUA 8ICVA 1L3UA 2HVIA 5KFGA 1L3SA 2NRXA 4F2RA 5ALTA 8ICSA 2W03A 4AT7A 1V38A 4Y2VA 3WFPA 1QQ6A 4OAHA 4FE3A 5AIBA 3HPOA 4X4PA 2RQ5A 1MQ2A 3M8SA 1ZQNA 4O6AA 3RH6A 5HHIA 2NRTA 2K4HA 1OUQA 2W9BB 5EWEA 3PX4A 2FCLA 3RB6A 3KKAC 2NRVA 5J2EA 3MFHA 2OM6A 3MBYA 1UA1A 4IR1A 4EBKA 4NWIA 4ED7A 1NK7A 4WC1A 5DDYA 3LQCB 2WF8A 8ICPA 3MGVA 4ED8A 2W9MA 3RH4A 3ETLA 1A6SA 2PFNA 4M6WB 4YFKA 4FZMA 2PXIA 2EANA 3IRUA 3RAQA 2FJ6A 5HR6A 3I76A 3FAHA 3OVAA 3ZDAA 2AGOA 3OVBA 3PX6A 4DQPA 1SL2A 2MUTB 2OYYA 5EE0A 1HEKA 8ICYA 9ICSA 3WK5A 3RJIA 3JPQA 3WK7A 7ICUA 8ICGA 1COKA 4Q45A 4QZ8A 2ZIWB 1N56A 1JXLA 3AQFA 2C28A 4EBJA 3OTQA 2ZH8A 3QZ7A 4KLGA 4F4KA 4QIWC 3UMBA 1UT5A 3JZ0A 1T94A 9ICVA 4JLXA 2W3RA 1XSPA 1UHUA 4J9PA 3THVA 5G5HA 2C2DA 4QZCA 2L5YA 1Y88A 3D2NA 4Y2YA 2ZH4A 4EENA 8ICBA 1TAMA 1U4BA 1ZQXA 3SD7A 1UETA 4UB1A 2BBHA 5KT5A 4NM1A 3QXGA 3R9KA 4OCZA 1K5OA 4RNOA 4O3QA 3IG8A 1U48A 5D4BA 2W7PA 3FYHA 3D6JA 4YQWA 2HCFA 4DLGA 1H38A 4EV6A 4ECSA 8ICJA 5AK6A 1XO0A 7ICIA 3PW4A 3HJ4A 3BDPA 4WC0A 3UPSA 5ALZA 3KD3A 2DR8A 3PY8A 1V4AA 5ALXA 1MIYA 1BPDA 1NK6A 3AL0B 5J8YC 5CHGA 2RHFA 4F93B 3ED5A 1ZQSA 1N2XA 3EPGA 4ED6A 3ALRA 3KZIU 2ASDA 1TK8A 4NLBA 4F5QA 1WCNA 1J97A 2DBYA 1KBUA 5KFIA 3T5LA 2KSOA 1ZQMA 1ZQHA 2D8CA 2OH2A 5L1JA 4M2YA 5T14A 4DOAA 3H0LB 3TFRA 5GTHU 4HX0A 9ICBA 1VLBA 4O3MA 2F3NA 2AHOB 4EYIB 2ZUCA 4NLNA 3C23A 4UB2A 2HN1A 1ZQJA 4WBYA 5J0TA 3C5GA 2VA2A 5D46A 5D63A 1NI3A 4UARA 2UVWA 1ZQPA 2Y9UA 5IIKA 3SENA 3HW8A 5B66U 4OAGA 2EZZA 3JPOA 4KLQA 4IQUA 1UT8A 5HRIA 8ICNA 3RRHA 5KG2A 3KZXA 3M7DA 2MU2A 2FE9A 2LBOA 5ALPA 4ELVA 5AKHA 4CDGA 3E0FA 4WC2A 5KT4A 2R18A 1XSNA 2O5AA 1NK4A 2FPLA 1NKEA 2A1JB 5CFUA 1FIQA 3RJFA 2XIDA 3F2CA 4DFKA 1XNSA 2PI5A 7ICOA 1SIJA 2ZIXA 2FPMA 5KFAA 1ZJNA 2OXOA 4ED0A 3DDHA 2BDUA 4K98A 9ICEA 2W9CB 2P6UA 3H39A 4LVSA 5ALKA 4U6PA 2B51A 4O9MA 2E8PA 4FHVA 1N48A 2DR9A 1Q3VA 5BPCA 4PHEA 4K8VA 1L3TA 1ZQAA 2BE3A 3PZPA 1PVQA 2ZTEA 4KMUA 4WC6A 1V9PA 1DGSA 2HHXA 3BS5B 4DO9A 2EDUA 4WCWA 4Y2QA 3Q8MA 2W54A 4C0ZA 2CRXA 2ZJ5A 5AKIA 2XGQA 4RU9A 3OSPA 3PVXA 2JXJA 1T7PA 4LT6A 3AEVA 3G6VA 3ICXA 1NK8A 1NKCA 4UB8U 2HHQA 3CRXA 4AT9A 1FFUA 1X40A 1A77A 1RXVA 1NZPA 2B56A 5EOZA 2ZXIA 5KFVA 5KT6A 1CI4A 5EWGA 3WFQE 4KLHA 4AT8B 2WF7A 2M0NA 5BOMA 4O0IA 2FLLA 4N7RA 2R8GA 4RQ3A 1X9WA 1B43A 4QZFA 1S10A 1T8EA 1UQVA 2HOIA 4NY8A 1Z4NA 2F8LA 5AM1A 4UQGA 4Y2SA 4LEYA 5KFXA 4WJ3B 4RNMA 2F77X 2KEYA 4JB3A 1BPYA 4RQ5A 3PSIA 1X9SA 4B9NA 5CA7A 4RWPA 4GXKA 4B9MA 2HHVA 1JN3A 3Q8LA 1L7OA 4C8MA 3PW0A 3QU2A 5AKXA 3I28A 4Y2UA 3J81j 2JEFA 1TFWA 1K1QA 2G5HB 4MF8A 4YD2A 2DVIA 2E5SA 1PK1B 2FDRA 4B9VA 4UAWA 4WC7A 3QUTA 5JRTA 4KITB 7ICGA 1TKDA 1NK9A 4KLUA 1KTQA 3NGDA 2IUBA 4Q8EA 2DR5A 9ICJA 4CNQA 3S6JA 2V4QA 4K9BA 4J9SA 1U45A 3TACB 3MGIA 3T5HA 4DOBA 2ZH3A 2I6XA 4R8UB 3PR5B 2P6RA 4AT7B 4IRCA 2PFPA 5KFRA 4F4XA 5AHXA 4RWQA 4C4SA 4ZH4A 4ATBB 1X42A 4Q43A 3V7KA 7ICVA 3OGUA 4QWDA 9ICCA 4HYKA 2KJ9A 3CYMA 3EWAA 2BR0A 4QZAA 3BJYA 1ZQGA 4DEZA 3EUB2 4I28A 3WU2U 3TI0A 5L1KA 5JTIA 1JI7A 2V9WA 4I2HA 4YR0A 4EEYA 4FZNA 2NO5A 3AQLA 2ATLA 4LZGA 3SV4A 3TANA 3DEEA 4F5NA 5B3QA 1JAJA 2FI1A 1X2IA 4QWBA 5AM0A 7ICEA 5HRHA 3PSPA 1ZQRA 5G5GA 8ICZA 2O6KA 1N60A 2PBEA 4B6JA 5AKKA 5GTIU 4C8KA 1SZHA 2ZIUA 5ALIA 5EE3A 4CE6A 2XO7A 2J6TA 4IS7A 5KG1A 1SV4A 1JXEA 4PH5A 4K97A 4QZEA 4YG2A 2WB1F 4YCXA 3IV6A 4RQ7A 4NXXA 3V7LA 5L1MA 3AUOA 3ZI4A 2B21A 2KHVA 5ALWA 2F2AB 3LK9A 4EGWA 3HP6A 1XU4A 3ZD9A 3F5AA 5HRFA 2JEJA 2WB1C 1COOA 5HMLA 4BDPA 7ICSA 2DRBA 4KX3A 4XA5A 1VJ7A 2LYAA 1MC8A 4PZNA 3ER9B 2KVCA 4JV0A 3OUYA 1NJWA 3SQIA 4FZLA 2JGAA 3M6ZA 3WK4A 3ETRA 3H8MA 5ALUA 1T4GA 5J0RA 4PGQA 2RP5A 3BZCA 5J0YA 5ALVA 4ED3A 4G3IA 3RJGA 4BUGA 4OAFA 1SWWA 1A0PA 2QB0B 3PNCA 3M8RA 1XO1A 5CJ7A 7ICHA 1KW4A 1KLNA 2VA3A 5IIJA 4YR2A 1FA0A 1P7DA 4R66A 5AKGA 1NJZA 2EQYA 2E8NA 5CFSA 4R64A 5KFMA 2DWQA 4IRDA 4EZ6A 4I2JA 1ZQDA 4YVZA 3B0XA 4PGYA 4ECVA 4DSEA 4KLEA 3RRGA 4RT3A 4I2EA 4DCCA 1U9LA 3UQ2A 4M04A 3KOOA 8ICUA 1RQLA 1AQ6A 4DFPA 3T3FA 2KSOB 5KT2A 1JIHA 4P4PA 2I1QA 1T3NA 4RPYA 3WKEA 1UCVA 3MR2A 5KFWA 1WCLA 1KEJA 3MABA 2KHQA 4NL9A 1N5XA 4DSIA 9ICAA 3PSFA 4MF2A 2ZG6A 3FDSA 1YT3A 8ICWA 1NK5A 2C2RA 3RBEA 3JPTA 3GV8B 2DPIA 5J2CA 1EXNA 3OV7A 2K4IA 2PI4A 1YZ6A 3ORYA 1HUOA 5D61A 2ZH6A 3E58A 1M6YA 4J9OA 3D2QA 1SKSA 4JWMA 2K8BB 2ZJ8A 2QLTA 1UA0A 4MKPA 4KX5A 4NM2A 4TQRA 3SAHA 2VANA 5DB8A 1TK0A 4XQ7A 2DKXA 2ASJA 3QU4A 4GC6A 5J0QA 3AQMA 1S76D 3OHBA 4M9HA 4OAIZ 4MFAA 3QEAZ 2P35A 3PW5A 9ICIA 5CFTA 2KKVA 3ERCC 5DGBA 3QU9A 4IG8A 2HHSA 4O3PA 3H4BA 4UB5A 2LHTA 2AXTU 2NRZA 4IC9A 4Y2TA 4AYBF 4AP9A 3AN1A 2N1RA 1WYGA 3PW7A 2ZUDA 3HJEA 4ECTA 3GV7B 4QJFB 1CUKA 3H38A 4WC4A 2W8LA 2ZHBA 3HILA 4FO1A 4XUSA 3LWMA 5KFZA 2F1HA 1BVSA 4RQ2A 4AYBC 4F5RA 4YN4A 4J9RA 4BXOB 3NVZA 3UXPA 3LDAA 4RWNA 4Q44A 2UVRA 3C2LA 2KFZA 1J2NA 5KG3A 3PSTA 2AQ0A 1V97A 3MFIA 4PL2A 7ICKA 4UBBA 1ZD5A 3QU7A 2VJ5A 4GXIA 2LM1A 2M9NA 5KFFA 4WC3A 4JV1A 3QNMA 4UB4A 4EX6A 5HRGA 2XI9A 5DQHA 2XY5A 3LWLA 1L8LA 2QB1A 4AT9B 2YQEA 3T79A 1Z1BA 3BQ1A 2G0AA 5HRLA 3V6HA 3TADA 2I9GA 3Q8SB 3AQKA 3C1YA 3Q8QB 4I2CA 4PL1A 3JPNA 4BWMA 2DR7A 4YMMA 2E8MA 1OXJA 1SGGA 2AJQA 2GOLA 2ID1A 4EX7A 2ZXHA 4OJOA 3BQ7A 2MSNA 5AKYA 4GLXA 1JMSA 1SXEA 8ICEA 5AIAA 2M2VA 4KLLA 4WOYA 3AU2A 2H3ZA 3IHQB 4C8NA 5AKEA 2Y1JA 4X4TA 1QSYA 2AGPA 1ZQVA 1SB3C 3RJJA 4DFDA 2IHNA 3F2DA 4DS4A 4QW8A 4YXJA 3K1RB 2KOBA 2GA9D 3WK8A 1BPBA 4KN4A 4Z6EA 4O69A 5CRXA 1S9FA 3UMCA 1YLQA 4ECRA 3N4MB 4KLIA 5HRKA 7ICNA 2ZH2A 2YN4A 2RLTA 1L7MA 2VA8A 3UM9A 4FH3A 1QQ7A 4P0PA 2DL0A 5EE1A 4FHYA 4S3NA 1D8LA 3HX0A 3U26A 3NYBA 1O08A 3RBDA 1RYRA 2BBJA 4M0AA 2O1PA 1XSLA 3NWIA 1QQ5A 4I2AA 4BGDA 3TARA 1D9FA 4A8EA 3WKBA 5CP2A 1PVPA 2W55A 5JU5A 1ZOLA 5AI4A 3MDCA 5J2BA 2HBMA 2LM4A 1QSLA 1UEUA 2ZH5A 5HRDA 2HBJA 5A0LA 4PZOA 1FO4A 3RJHA 1PK3A 4KLOA 7ICQA 5CEHA 1VJ5A 2H3FA 1LKYA 4C7YA 4ZOHC 4EEDA 1CRXA 5ALFA 5KT7A 3QUCA 2JV3A 3PMNA 5KFEA 4GFJA 4RQ6A 1L8OA 2E3TA 3JPRA 1Z19A 4FHXA 1TK5A 2ZIUB 1SV0A 2BGWA 2ISPA 5DBAA 4FBUA 5DBBA 1N61A 2EWRA 3RB3A 3TKAA 5KFSA 3SAGA 4QWCA 1RPLA 2BCRA 4C80A 4Y2XA 3H7IA 4LZDA 3NKUA 4M5DA 3H0MB 5CR0A 3PR4A 4DS5A 5KFKA 2K8AA 2FMPA 1ED1A 3JYYA 4FS2A 2HBLA 4M6WA 3QX7A 4LEWA 2D3DA 2QARA 3KTQA 2BQ3A 3ZDBA 3RJEA 3H8WA 4NL9C 1NZBA 3B0YA 3SR6A 4ECQA 4UAVA 8ICXA 1LB2B 5F9LA 5KG5A 4KMOB 5E79U 2PKEA 1KDHA 5KL8B 3LYSA 3GQCA 2K4EA 3V7JA 4MHVA 3UXOA 4EBCA 5ALQA 7ICPA 2MUTA 4K9AA 4RUAA 4RQMA 2G07A 1SL1A 2NRKA 1Q8KA 1ZQYA 2Z7JA 2GO7A 4FBTA 1PVRA 1X6JA 5J2KA 5HNKA 2UVVA 5J2GA 5KAFU 2GLEA 2R8HA 1ZQOA 3PO5A 1OU5A 4P0QA 4B9LA 3F5EA 2ZIWA 1ECWA 3MR6A 1JRPA 4J03A 3OJUA 7ICJA 4OD0A 1L6NA 4E7XA 2R8KA 1MSWD 3EF2A 2KP7A 4YXMA 2FPKA 4RQ0A 4JWNA 4X4SA 4NLGA 1F0MA 3BQ0A 3ZDCA 2KZZA 2KTQA 2HOQA 2F44A 2FLNA 3K75D 2A3VA 5KFUA 4ECYA 1N5WA 4OJ6A 3KKAA 2HSZA 3SI8A 2M2UA 2VIXA 5JTGA 5J2FA 1R8AA 4QZBA 2R8IA 1QSSA 4F3OA 5B3PA 2H3VA 5DBCA 4JK1A 3F2BA 3EZ5A 2DPJA 2BPCA 2PMZF 2V4RA 1KFDA 1ZQTA 4I2BA 1ZRNA 9ICOA 2ESEA 2ZH7A 3MCRA 2K89A 4X5VA 4WH5A 7ICFA 4O3SA 5IIIA 3MR5A 1FEZA 2A19A 3WKCA 3QUBA 5AM2A 4NXWA 3WFOA 1Q78A 2PMZC 2WF5A 5J0UA 4Y2JA 2YY6A 5IIOA 5AI6A 3PHZA 1F5SA 3C2KA 3TQ1A 1A76A 1KQQA 4NXZA 2J6SA 4EELA 2KIVA 1AROP 3N7SC 3IN5A 2EAMA 5AKLA 5DQIA 4O5EA 5EWFA 3AM9A 2MRLA 4WC5A 2C22A 2ZHAA 3H0RB 1B0XA 2DQNB 4J9QA 1F44A 5HHHA 2B0CA 1ZQUA 2XC9A 2E1EA 4CGZA 1O03A 3OWGA 4DQIA 3RB4A 2WAQF 4USAA 3UMGA 3H40A 4DOCA 1ZD4A 5DG7A 1PX5A 2Q0ZX 1RQNA 2IA6A 5FP0A 2IMWP 1KN5A 3ZDEA 3CP8A 1C20A 4JMUA 2DRAA 3FM9A 1PZNA 4X4QA 1Z00A 3NVVA 2A1AA 5HRBA 2KJ8A 2WAQC 3AQEA 4F72A 3RFAA 5KFLA 5KFDA 2KIWA 5J0PA 4R63A 1DRGA 3V6KA 3RR8A 2F1IA 4O5CA 1BNOA 5ALMA 3OHAA 2BZFA 1GPJA 1BNPA 5KFYA 2OHFA 2M2TA 1XC9A 3MC1A 5IIMA 3PX0A 5J0OA 4DQQA 1NOMA 3NRWA 1VFGA
chains in the Genus database with same CATH topology
2HHUA 4F5QA 1TAQA 4MFAA 4F4YA 3QEAZ 4DSLA 1UEVA 2ASLA 1WCNA 8ICQA 2H5XA 3PW5A 9ICIA 4X4VA 5KFIA 3T5LA 1ZQMA 1ZQHA 3TFSA 5L1JA 4QWEA 4KN7A 4Z6FA 3ZDDA 4M2YA 5DGBA 4DOAA 1SKWA 1DOQA 2HHSA 4IG8A 4O3PA 3H4BA 2BCVA 4WBZA 4E80A 3TFRA 4UB5A 5IILA 2W9CA 1KRPA 4RWOA 4QZGA 2NRZA 3GV5B 1TVAA 9ICBA 3SV3A 4FHPA 3OSNA 3V6JA 4M47A 4PHDA 5CB1A 4YMNA 4EYIB 5KFHA 2WTFA 2ZUCA 4PHAA 4UB3A 4TURA 4NLNA 3C23A 3HT3A 4UB2A 1JQRA 2ZTDA 3MDAA 4CCHA 3WFSC 3PW7A 5HC9A 1ZQKA 1ZQJA 2ZUDA 8ICHA 4WBYA 5J0TA 3N97B 3C5GA 4ECTA 5KFBA 2VA2A 3OVSA 3GV7B 1CUKA 4I29A 5D46A 3H38A 2Q66A 4WC4A 2UVWA 2W8LA 1ZQPA 2ZHBA 5IIKA 3RH5A 4KLTA 1DK3A 5JUMA 4XUSA 4X4RA 3LWMA 4F91B 4ELUA 1BPEA 3HW8A 5KFZA 5KFTA 2F1HA 1BVSA 4RQ2A 4F5RA 3Q8KA 4IQWA 3JPOA 5KFQA 4YN4A 4J9RA 4BXOB 4IQUA 4KLQA 1UT8A 5HRIA 8ICNA 4UD4A 3UXPA 3RRHA 1BPZA 4RPZA 4X4OA 3KHLA 3V72A 5KG2A 9ICMA 3LDAA 1NKBA 1LV5A 4Q44A 3G6XA 2UVRA 4RWNA 3C2LA 2HVHA 1C7YA 5J2JA 2KN7A 2KFZA 5KG3A 3AQNA 1TFRA 2AQ0A 2LYHA 2NRWA 3MFIA 4ELVA 4UBCA 4F5OA 3M9OB 4J9NA 7ICKA 4UD5A 4WC2A 4UBBA 4X0AA 5DB7A 4ECUA 4GXIA 5KT4A 5DDMA 1S77D 2M9NA 5KFFA 4WC3A 3C1ZA 1XSNA 4C8OA 4UB4A 2FPLA 5HMMA 1NK4A 4JV1A 2O5AA 1NKEA 3L9DA 2A1JB 3UPQA 4X4UA 4K4HA 5HRGA 4I2DA 1X9MA 4RUCA 3RJFA 5DB6A 2BPFA 5DQHA 4RQ4A 3H4DA 4DSKA 4QZIA 8ICIA 1B22A 4DFKA 2XY5A 5KFPA 2PI5A 4F4ZA 7ICOA 3LWLA 1RYSA 4QZ9A 5DLGA 4GXJA 4UAZA 2HHPA 4AT9B 4M9LA 2FPMA 3Q8RB 4QWAA 8ICLA 5KFAA 4DL6A 1SL0A 2ZH1A 3BQ1A 5HRLA 3V6HA 3PO4A 1ZJNA 4M9GA 4ED0A 2I9GA 3Q8SB 3AQKA 8ICKA 9ICWA 2GWSA 3C1YA 1XWLA 3SZ2A 9ICEA 3GFKB 4TQSA 3Q8QB 2W9CB 2P6UA 4P4MA 4I2CA 4M9NA 2F1JA 3JPNA 3ISCA 3H39A 1RXWA 3SYZA 4BWMA 2HW3A 4LVSA 2DR7A 4YMMA 1R89A 4Q8FA 4RPXA 4O9MA 2FLPA 2AJQA 2ID1A 3GIMA 4FHVA 4TUPA 1N48A 2DR9A 1ZETA 3RJKA 4NKUA 4PGXA 4RQ8A 2XCPA 1TV9A 4DL7A 5BPCA 4YD1A 4PHEA 2ZH9A 4GLXA 1L3TA 1JMSA 8ICEA 1ZQAA 4ED1A 2M2VA 4KLLA 2BE3A 3WFRE 2ZTEA 4KMUA 1S0MA 4WC6A 3AU2A 1V9PA 3IHQB 4C8NA 5DB9A 3HWTA 2Y1JA 4X4TA 1QSYA 1DGSA 3GILA 1ZQFA 2HHXA 2AGPA 7ICTA 1ZQVA 4DO9A 3RJJA 4DQSA 2IHNA 4DS4A 4WCWA 4QW8A 4YXJA 3Q8MA 9ICPA 4KLDA 2ZJ5A 3K4GA 2XGQA 4RU9A 3OSPA 3PVXA 1NJXA 4M9JA 2BCUA 1BPBA 1T7PA 4KN4A 5L1IA 1ZQCA 4TUSA 3AU6A 2A1JA 4BXOA 4DSJA 4Z6EA 4LT6A 1D9DA 9ICHA 1HJPA 2XGPA 4R8UA 2MAXA 4R65A 3G6VA 1S0NA 2BCQA 1S9FA 1NK8A 4KTQA 1YLQA 5KT3A 2ALZA 1MIWA 4ECRA 3N4MB 1ZQIA 4B9UA 4KLIA 5HRKA 4JUZA 1ZQZA 1BGXT 4BWJA 1NKCA 7ICNA 2ZH2A 3KHRA 2HHQA 2VA8A 3IM1A 4AT9A 2DFLA 4IQTA 4FH3A 1A77A 4K4GA 1RXVA 3E2EA 1NZPA 4FHYA 4S3NA 1D8LA 4ATBA 2UVUA 5EOZA 3QZ8A 1KNYA 1F5AA 4I2IA 5KFVA 3HX0A 4E8FA 3NYBA 5KT6A 3RBDA 4FS1A 5EWGA 1RYRA 1ZJMA 3MGHA 1L3VA 3C5FA 4DFMA 4KLHA 1WOTA 3H3AA 4AT8B 4YMOA 1KFSA 2FLLA 5BOMA 4O0IA 4M0AA 2ZUBA 4RNNA 1XSLA 2R8GA 2O1PA 3C18A 3TAPA 4RQ3A 1X9WA 1B43A 4QZFA 1S10A 1T8EA 4KLFA 4I2AA 4NY8A 4BGDA 3TARA 4XRHA 1D9FA 9ICTA 4UQGA 1U49A 1QTMA 4NKTA 5KFXA 3MR3A 5CP2A 4RNMA 2J6UA 3EPIA 1BPYA 5J0WA 4RQ5A 1X9SA 4B9NA 4RWPA 5CA7A 3JPPA 3MDCA 5J2BA 9ICNA 4GXKA 5DKWA 1QSLA 4B9MA 2HHVA 1UEUA 2IHMA 1JN3A 3Q8LA 4C8MA 3PW0A 4B9SA 3M9NB 4YP3A 3GIJA 4K4IA 2ZH5A 3UXNA 5HRDA 4FH5A 1QLNA 2JEFA 1SZPA 4DLEA 4DF8A 5DGAA 1K1QA 1TFWA 4MF8A 7ICMA 2RDIA 4YD2A 3RJHA 4RQ1A 4P2HA 2DVIA 4B9VA 1L5UA 4MEYA 4UAWA 1IM4A 4WC7A 4KLOA 2W8KA 8ICRA 3EW9A 7ICQA 8ICFA 4TUQA 1D8YA 4KITB 7ICGA 1TKDA 1NK9A 8ICMA 4KLUA 3H8JA 9ICKA 1KTQA 5KG7A 3NGDA 2P66A 4NLZA 4Q8EA 4F4WA 2DR5A 5L1LA 4O5KA 5KFCA 1RZTA 4FO6A 5KT7A 4PHPA 9ICJA 1IXRA 3HIYA 4I2FA 3PMNA 3QEBZ 2V4QA 5KFEA 1KSPA 4J9SA 4ECWA 4RQ6A 1U45A 3MGIA 3T5HA 9ICFA 4DOBA 2ZTCA 4F92B 3H8SA 4R8UB 2ZH3A 3PR5B 3JPRA 5KFJA 2P6RA 4AT7B 4I27A 4RT2A 4IRCA 4FHXA 5KFOA 5DG9A 5TZVA 2XY7A 3QE9Y 2XCAA 1TK5A 2PFPA 2BGWA 4DF4A 2ISPA 4X4NA 5KFRA 5DBAA 3ISDA 3PV8A 5DBBA 4EBEA 4ECZA 5J2AA 5D49A 3RB3A 5KFSA 3RAXA 4MEXA 2FMQA 5BOLA 4J9LA 4FHWA 2Y1IA 3NTUA 4F4XA 5DQGA 5KG6A 5HR9A 1U47A 4QWCA 3ISBA 4JV2A 4RWQA 4ZH4A 4ATBB 2JZBB 1RPLA 2BCRA 4C8LA 8ICTA 4Q43A 4DSFA 2OWOA 5J2HA 3V7KA 7ICVA 3G6YA 2BQUA 3H7IA 4YR3A 2IBKA 9ICXA 2KZ3A 2M2WA 3ZD8A 3OGUA 4LZDA 2BDPA 4QWDA 4M5DA 9ICCA 4HYKA 3TAQA 1ZQEA 3T5KA 5CR0A 2BKEA 3PR4A 1SKRA 4DS5A 3EWAA 9ICQA 2W9AA 5KFKA 4QZAA 3BJYA 2BR0A 4DEZA 1Z3EB 1S0OA 1ZQGA 2FMPA 4EZ9A 4I28A 2HHWA 8ICOA 4XQ8A 4Z6DA 1KFTA 4FS2A 3JYYA 4M6WA 3TI0A 5L1KA 3KTQA 9ICGA 2V9WA 4I2HA 4YR0A 2BQ3A 4EEYA 4GC7A 3ZDBA 8ICCA 3RJEA 4F50A 3H8WA 3GIKA 1HUZA 3B0YA 4IR9A 4ECQA 2ATLA 3SV4A 2PFOA 1LB2B 4LZGA 5F9LA 8ICXA 5KG5A 2C2EA 3TANA 4F5NA 5J2DA 1JAJA 1KDHA 5HREA 3M9MB 4QW9A 3HJ1A 1X2IA 4QWBA 3GQCA 4DL4A 9ICLA 3V7JA 4ELTA 7ICEA 2BHNA 5HRHA 4O3OA 3UXOA 4EP7A 4EBCA 4DL3A 7ICPA 1BPXA 5DLFA 2MUTA 1ZQRA 8ICVA 1L3UA 8ICZA 2BPGA 3RTVA 4MFFA 4RUAA 2HVIA 1TAUA 2PBEA 4KLSA 5KFGA 1SL1A 2NRXA 1L3SA 4F2RA 2NRKA 1ZQYA 4FBTA 8ICSA 1NK0A 5J2KA 5HNKA 3RB0A 5KG4A 2UVVA 5J2GA 4C8KA 4IRKA 4O3RA 4AT7A 2PFQA 3WFPA 4J9MA 3EYZA 2R8HA 4ED2A 1ZQOA 3PO5A 4PPXA 1OU5A 4B9LA 2ISOA 2XO7A 5DEDA 2J6TA 5KG1A 3MR6A 3HPOA 2XY6A 2BCSA 1S0VA 7ICRA 1NO5A 9ICUA 3H37A 4X4PA 4KLJA 1JXEA 1MQ2A 3M8SA 1ZQNA 4PH5A 4QZEA 3RH6A 4YG2A 5HHIA 3OJUA 2JZBA 4YCXA 2NRTA 4RZRA 7ICJA 4E7XA 2W9BB 2R8KA 1MSWD 5EWEA 5J0XA 5J2IA 4YXMA 2KP7A 4RQ7A 2FPKA 4IQVA 4X0BA 4RQ0A 3V7LA 4JWNA 3PX4A 4O3NA 4F5PA 4X4SA 4NLGA 3AUOA 3BQ0A 3ZDCA 2B21A 2KZZA 2KTQA 3RB6A 3LK9A 3HP6A 2NRVA 5J2EA 3MFHA 4EBDA 1XU4A 3ZD9A 3MBYA 1UA1A 2FLNA 3K75D 5KFNA 5HRFA 4IR1A 5KFUA 4ECYA 4EBKA 2JEJA 1R8CA 3UQ0A 4ED7A 3SI8A 1COOA 5HMLA 1NK7A 4BDPA 7ICSA 2M2UA 4WC1A 5DDYA 5J2FA 3KHGA 3LQCB 1R8AA 2DRBA 4XA5A 4QZBA 2R8IA 1QSSA 4F3OA 4ED8A 8ICPA 1MC8A 1VJ7A 2W9MA 5DBCA 3C2MA 5KTQA 3RH4A 3ETLA 4JV0A 2PFNA 3OUYA 4JK1A 4M6WB 1NJWA 4YFKA 4DL2A 2AQ4A 3EZ5A 2DPJA 2BPCA 2PXIA 2V4RA 1KFDA 3BQTA 1ZQTA 4I2BA 4KLMA 3OJSA 8ICAA 2RFFA 1T4GA 5J0RA 3RAQA 9ICOA 3T5JA 3C21A 4PGQA 4P4OA 4E0DA 2ZH7A 5J0YA 4B9TA 4X5VA 1Q79A 4ED3A 1JX4A 1Z00B 3RJGA 4G3IA 3OVAA 3ZDAA 2AGOA 3OVBA 3PX6A 4DQPA 7ICFA 4O3SA 5IIIA 3MR5A 1SL2A 2MUTB 5F9NA 3PNCA 4MFCA 3M8RA 1K1SA 1XO1A 9ICRA 2BQRA 8ICYA 5CJ7A 7ICHA 9ICSA 5DECA 3RJIA 3WFOA 3JPQA 1KLNA 2VA3A 2W9BA 3KHHA 1Q78A 1R8BA 5IIJA 5J0UA 4YR2A 4J9KA 7ICUA 8ICGA 1FA0A 5IIOA 4EYHB 4R66A 1ZQWA 2FMSA 4Q45A 1NJZA 4QZ8A 4R64A 3GDXA 5KFMA 3C2KA 3TQ1A 1N56A 1A76A 2AU0A 1JXLA 4NLKA 4NXZA 2J6SA 4EZ6A 4I2JA 2C28A 4IRDA 3AQLA 4EBJA 1AROP 2ZH8A 4ECXA 5DQIA 1ZQDA 3QZ7A 4O5EA 4YVZA 5EWFA 4KLGA 3B0XA 4PGYA 1S97A 4F4KA 4ECVA 4FBUA 4DSEA 1UT5A 2AGQA 3JZ0A 4WC5A 9ICVA 2ZJAA 2C22A 1MQ3A 4KLEA 2ZHAA 1XSPA 1TFYA 3RRGA 3BQ2A 4J9PA 4RT3A 5HP4A 5DG8A 4J9QA 3THVA 5HHHA 5C5JA 4I2EA 2KFNA 1ZQUA 2XC9A 4DL5A 4DQRA 1U9LA 2C2DA 1MIVA 4DQIA 4QZCA 3RB4A 3Q8PB 2JEIA 4AT8A 1Y88A 3UQ2A 4M04A 2ZH4A 8ICUA 3H40A 4DOCA 3T3FA 4DFPA 8ICBA 5DG7A 1PX5A 2Q0ZX 5KT2A 1JIHA 4P4PA 4DWIA 5F2VO 2I1QA 2IA6A 1T3NA 2IMWP 4RPYA 3ZDEA 1U4BA 5IINA 1ZQLA 1ZQXA 1NJYA 3MR2A 2DRAA 5KFWA 1WCLA 1KEJA 3MABA 1PZNA 1UETA 1CEZA 4X4QA 4UB1A 5KT5A 4DSIA 9ICAA 3OUYB 4NM1A 3JPSA 4MF2A 1Z00A 3GIIA 3FDSA 4QZDA 8ICWA 5HRBA 1NK5A 4RNOA 2C2RA 1XS9D 4O3QA 3RBEA 3JPTA 3GV8B 2RDJA 2DPIA 3PW2A 1U48A 5D4BA 5J2CA 4DFJA 5KFLA 1EXNA 5KFDA 5J0PA 4R63A 2JEGA 4UAYA 1DK2A 3FYHA 3OV7A 4YQWA 4DLGA 1H38A 2PI4A 4ECSA 8ICJA 3ORYA 3V6KA 1HUOA 2ZH6A 4F8RA 3C66A 2HHTA 7ICIA 1ZQBA 5KG0A 3RR8A 3WFQE 2F1IA 5CWRA 4J9OA 3PW4A 4O5CA 1SKSA 4JWMA 2ZJ8A 3OHAA 3BDPA 1BNOA 3HJ4A 4WC0A 3UPSA 3RR7A 1UA0A 1BNPA 2DR8A 5KFYA 3PY8A 5J0SA 1V4AA 1MIYA 5J29A 1ZQQA 5L9XA 4I2GA 4Z6CA 4NM2A 1BPDA 1NK6A 4TQRA 3PMLA 5CHGA 2M2TA 4F93B 5DB8A 2VANA 4XQ7A 1TK0A 1XC9A 2ASJA 4F2SA 1ZYQA 5IIMA 3PX0A 4GC6A 5J0OA 5J0QA 1ZQSA 7ICLA 4DQQA 2R8JA 1NOMA 2KZMA 1VFGA 3EPGA 1S76D 3OHBA 3AQMA 4ED6A 1TK8A 2ASDA 4M9HA 4QZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHU A;  4F5Q A;  1TAQ A;  4MFA A;  4F4Y A;  3QEA Z;  4DSL A;  1UEV A;  2ASL A;  1WCN A;  8ICQ A;  2H5X A;  3PW5 A;  9ICI A;  4X4V A;  5KFI A;  3T5L A;  1ZQM A;  1ZQH A;  3TFS A;  5L1J A;  4QWE A;  4KN7 A;  4Z6F A;  3ZDD A;  4M2Y A;  5DGB A;  4DOA A;  1SKW A;  1DOQ A;  2HHS A;  4IG8 A;  4O3P A;  3H4B A;  2BCV A;  4WBZ A;  4E80 A;  3TFR A;  4UB5 A;  5IIL A;  2W9C A;  1KRP A;  4RWO A;  4QZG A;  2NRZ A;  3GV5 B;  1TVA A;  9ICB A;  3SV3 A;  4FHP A;  3OSN A;  3V6J A;  4M47 A;  4PHD A;  5CB1 A;  4YMN A;  4EYI B;  5KFH A;  2WTF A;  2ZUC A;  4PHA A;  4UB3 A;  4TUR A;  4NLN A;  3C23 A;  3HT3 A;  4UB2 A;  1JQR A;  2ZTD A;  3MDA A;  4CCH A;  3WFS C;  3PW7 A;  5HC9 A;  1ZQK A;  1ZQJ A;  2ZUD A;  8ICH A;  4WBY A;  5J0T A;  3N97 B;  3C5G A;  4ECT A;  5KFB A;  2VA2 A;  3OVS A;  3GV7 B;  1CUK A;  4I29 A;  5D46 A;  3H38 A;  2Q66 A;  4WC4 A;  2UVW A;  2W8L A;  1ZQP A;  2ZHB A;  5IIK A;  3RH5 A;  4KLT A;  1DK3 A;  5JUM A;  4XUS A;  4X4R A;  3LWM A;  4F91 B;  4ELU A;  1BPE A;  3HW8 A;  5KFZ A;  5KFT A;  2F1H A;  1BVS A;  4RQ2 A;  4F5R A;  3Q8K A;  4IQW A;  3JPO A;  5KFQ A;  4YN4 A;  4J9R A;  4BXO B;  4IQU A;  4KLQ A;  1UT8 A;  5HRI A;  8ICN A;  4UD4 A;  3UXP A;  3RRH A;  1BPZ A;  4RPZ A;  4X4O A;  3KHL A;  3V72 A;  5KG2 A;  9ICM A;  3LDA A;  1NKB A;  1LV5 A;  4Q44 A;  3G6X A;  2UVR A;  4RWN A;  3C2L A;  2HVH A;  1C7Y A;  5J2J A;  2KN7 A;  2KFZ A;  5KG3 A;  3AQN A;  1TFR A;  2AQ0 A;  2LYH A;  2NRW A;  3MFI A;  4ELV A;  4UBC A;  4F5O A;  3M9O B;  4J9N A;  7ICK A;  4UD5 A;  4WC2 A;  4UBB A;  4X0A A;  5DB7 A;  4ECU A;  4GXI A;  5KT4 A;  5DDM A;  1S77 D;  2M9N A;  5KFF A;  4WC3 A;  3C1Z A;  1XSN A;  4C8O A;  4UB4 A;  2FPL A;  5HMM A;  1NK4 A;  4JV1 A;  2O5A A;  1NKE A;  3L9D A;  2A1J B;  3UPQ A;  4X4U A;  4K4H A;  5HRG A;  4I2D A;  1X9M A;  4RUC A;  3RJF A;  5DB6 A;  2BPF A;  5DQH A;  4RQ4 A;  3H4D A;  4DSK A;  4QZI A;  8ICI A;  1B22 A;  4DFK A;  2XY5 A;  5KFP A;  2PI5 A;  4F4Z A;  7ICO A;  3LWL A;  1RYS A;  4QZ9 A;  5DLG A;  4GXJ A;  4UAZ A;  2HHP A;  4AT9 B;  4M9L A;  2FPM A;  3Q8R B;  4QWA A;  8ICL A;  5KFA A;  4DL6 A;  1SL0 A;  2ZH1 A;  3BQ1 A;  5HRL A;  3V6H A;  3PO4 A;  1ZJN A;  4M9G A;  4ED0 A;  2I9G A;  3Q8S B;  3AQK A;  8ICK A;  9ICW A;  2GWS A;  3C1Y A;  1XWL A;  3SZ2 A;  9ICE A;  3GFK B;  4TQS A;  3Q8Q B;  2W9C B;  2P6U A;  4P4M A;  4I2C A;  4M9N A;  2F1J A;  3JPN A;  3ISC A;  3H39 A;  1RXW A;  3SYZ A;  4BWM A;  2HW3 A;  4LVS A;  2DR7 A;  4YMM A;  1R89 A;  4Q8F A;  4RPX A;  4O9M A;  2FLP A;  2AJQ A;  2ID1 A;  3GIM A;  4FHV A;  4TUP A;  1N48 A;  2DR9 A;  1ZET A;  3RJK A;  4NKU A;  4PGX A;  4RQ8 A;  2XCP A;  1TV9 A;  4DL7 A;  5BPC A;  4YD1 A;  4PHE A;  2ZH9 A;  4GLX A;  1L3T A;  1JMS A;  8ICE A;  1ZQA A;  4ED1 A;  2M2V A;  4KLL A;  2BE3 A;  3WFR E;  2ZTE A;  4KMU A;  1S0M A;  4WC6 A;  3AU2 A;  1V9P A;  3IHQ B;  4C8N A;  5DB9 A;  3HWT A;  2Y1J A;  4X4T A;  1QSY A;  1DGS A;  3GIL A;  1ZQF A;  2HHX A;  2AGP A;  7ICT A;  1ZQV A;  4DO9 A;  3RJJ A;  4DQS A;  2IHN A;  4DS4 A;  4WCW A;  4QW8 A;  4YXJ A;  3Q8M A;  9ICP A;  4KLD A;  2ZJ5 A;  3K4G A;  2XGQ A;  4RU9 A;  3OSP A;  3PVX A;  1NJX A;  4M9J A;  2BCU A;  1BPB A;  1T7P A;  4KN4 A;  5L1I A;  1ZQC A;  4TUS A;  3AU6 A;  2A1J A;  4BXO A;  4DSJ A;  4Z6E A;  4LT6 A;  1D9D A;  9ICH A;  1HJP A;  2XGP A;  4R8U A;  2MAX A;  4R65 A;  3G6V A;  1S0N A;  2BCQ A;  1S9F A;  1NK8 A;  4KTQ A;  1YLQ A;  5KT3 A;  2ALZ A;  1MIW A;  4ECR A;  3N4M B;  1ZQI A;  4B9U A;  4KLI A;  5HRK A;  4JUZ A;  1ZQZ A;  1BGX T;  4BWJ A;  1NKC A;  7ICN A;  2ZH2 A;  3KHR A;  2HHQ A;  2VA8 A;  3IM1 A;  4AT9 A;  2DFL A;  4IQT A;  4FH3 A;  1A77 A;  4K4G A;  1RXV A;  3E2E A;  1NZP A;  4FHY A;  4S3N A;  1D8L A;  4ATB A;  2UVU A;  5EOZ A;  3QZ8 A;  1KNY A;  1F5A A;  4I2I A;  5KFV A;  3HX0 A;  4E8F A;  3NYB A;  5KT6 A;  3RBD A;  4FS1 A;  5EWG A;  1RYR A;  1ZJM A;  3MGH A;  1L3V A;  3C5F A;  4DFM A;  4KLH A;  1WOT A;  3H3A A;  4AT8 B;  4YMO A;  1KFS A;  2FLL A;  5BOM A;  4O0I A;  4M0A A;  2ZUB A;  4RNN A;  1XSL A;  2R8G A;  2O1P A;  3C18 A;  3TAP A;  4RQ3 A;  1X9W A;  1B43 A;  4QZF A;  1S10 A;  1T8E A;  4KLF A;  4I2A A;  4NY8 A;  4BGD A;  3TAR A;  4XRH A;  1D9F A;  9ICT A;  4UQG A;  1U49 A;  1QTM A;  4NKT A;  5KFX A;  3MR3 A;  5CP2 A;  4RNM A;  2J6U A;  3EPI A;  1BPY A;  5J0W A;  4RQ5 A;  1X9S A;  4B9N A;  4RWP A;  5CA7 A;  3JPP A;  3MDC A;  5J2B A;  9ICN A;  4GXK A;  5DKW A;  1QSL A;  4B9M A;  2HHV A;  1UEU A;  2IHM A;  1JN3 A;  3Q8L A;  4C8M A;  3PW0 A;  4B9S A;  3M9N B;  4YP3 A;  3GIJ A;  4K4I A;  2ZH5 A;  3UXN A;  5HRD A;  4FH5 A;  1QLN A;  2JEF A;  1SZP A;  4DLE A;  4DF8 A;  5DGA A;  1K1Q A;  1TFW A;  4MF8 A;  7ICM A;  2RDI A;  4YD2 A;  3RJH A;  4RQ1 A;  4P2H A;  2DVI A;  4B9V A;  1L5U A;  4MEY A;  4UAW A;  1IM4 A;  4WC7 A;  4KLO A;  2W8K A;  8ICR A;  3EW9 A;  7ICQ A;  8ICF A;  4TUQ A;  1D8Y A;  4KIT B;  7ICG A;  1TKD A;  1NK9 A;  8ICM A;  4KLU A;  3H8J A;  9ICK A;  1KTQ A;  5KG7 A;  3NGD A;  2P66 A;  4NLZ A;  4Q8E A;  4F4W A;  2DR5 A;  5L1L A;  4O5K A;  5KFC A;  1RZT A;  4FO6 A;  5KT7 A;  4PHP A;  9ICJ A;  1IXR A;  3HIY A;  4I2F A;  3PMN A;  3QEB Z;  2V4Q A;  5KFE A;  1KSP A;  4J9S A;  4ECW A;  4RQ6 A;  1U45 A;  3MGI A;  3T5H A;  9ICF A;  4DOB A;  2ZTC A;  4F92 B;  3H8S A;  4R8U B;  2ZH3 A;  3PR5 B;  3JPR A;  5KFJ A;  2P6R A;  4AT7 B;  4I27 A;  4RT2 A;  4IRC A;  4FHX A;  5KFO A;  5DG9 A;  5TZV A;  2XY7 A;  3QE9 Y;  2XCA A;  1TK5 A;  2PFP A;  2BGW A;  4DF4 A;  2ISP A;  4X4N A;  5KFR A;  5DBA A;  3ISD A;  3PV8 A;  5DBB A;  4EBE A;  4ECZ A;  5J2A A;  5D49 A;  3RB3 A;  5KFS A;  3RAX A;  4MEX A;  2FMQ A;  5BOL A;  4J9L A;  4FHW A;  2Y1I A;  3NTU A;  4F4X A;  5DQG A;  5KG6 A;  5HR9 A;  1U47 A;  4QWC A;  3ISB A;  4JV2 A;  4RWQ A;  4ZH4 A;  4ATB B;  2JZB B;  1RPL A;  2BCR A;  4C8L A;  8ICT A;  4Q43 A;  4DSF A;  2OWO A;  5J2H A;  3V7K A;  7ICV A;  3G6Y A;  2BQU A;  3H7I A;  4YR3 A;  2IBK A;  9ICX A;  2KZ3 A;  2M2W A;  3ZD8 A;  3OGU A;  4LZD A;  2BDP A;  4QWD A;  4M5D A;  9ICC A;  4HYK A;  3TAQ A;  1ZQE A;  3T5K A;  5CR0 A;  2BKE A;  3PR4 A;  1SKR A;  4DS5 A;  3EWA A;  9ICQ A;  2W9A A;  5KFK A;  4QZA A;  3BJY A;  2BR0 A;  4DEZ A;  1Z3E B;  1S0O A;  1ZQG A;  2FMP A;  4EZ9 A;  4I28 A;  2HHW A;  8ICO A;  4XQ8 A;  4Z6D A;  1KFT A;  4FS2 A;  3JYY A;  4M6W A;  3TI0 A;  5L1K A;  3KTQ A;  9ICG A;  2V9W A;  4I2H A;  4YR0 A;  2BQ3 A;  4EEY A;  4GC7 A;  3ZDB A;  8ICC A;  3RJE A;  4F50 A;  3H8W A;  3GIK A;  1HUZ A;  3B0Y A;  4IR9 A;  4ECQ A;  2ATL A;  3SV4 A;  2PFO A;  1LB2 B;  4LZG A;  5F9L A;  8ICX A;  5KG5 A;  2C2E A;  3TAN A;  4F5N A;  5J2D A;  1JAJ A;  1KDH A;  5HRE A;  3M9M B;  4QW9 A;  3HJ1 A;  1X2I A;  4QWB A;  3GQC A;  4DL4 A;  9ICL A;  3V7J A;  4ELT A;  7ICE A;  2BHN A;  5HRH A;  4O3O A;  3UXO A;  4EP7 A;  4EBC A;  4DL3 A;  7ICP A;  1BPX A;  5DLF A;  2MUT A;  1ZQR A;  8ICV A;  1L3U A;  8ICZ A;  2BPG A;  3RTV A;  4MFF A;  4RUA A;  2HVI A;  1TAU A;  2PBE A;  4KLS A;  5KFG A;  1SL1 A;  2NRX A;  1L3S A;  4F2R A;  2NRK A;  1ZQY A;  4FBT A;  8ICS A;  1NK0 A;  5J2K A;  5HNK A;  3RB0 A;  5KG4 A;  2UVV A;  5J2G A;  4C8K A;  4IRK A;  4O3R A;  4AT7 A;  2PFQ A;  3WFP A;  4J9M A;  3EYZ A;  2R8H A;  4ED2 A;  1ZQO A;  3PO5 A;  4PPX A;  1OU5 A;  4B9L A;  2ISO A;  2XO7 A;  5DED A;  2J6T A;  5KG1 A;  3MR6 A;  3HPO A;  2XY6 A;  2BCS A;  1S0V A;  7ICR A;  1NO5 A;  9ICU A;  3H37 A;  4X4P A;  4KLJ A;  1JXE A;  1MQ2 A;  3M8S A;  1ZQN A;  4PH5 A;  4QZE A;  3RH6 A;  4YG2 A;  5HHI A;  3OJU A;  2JZB A;  4YCX A;  2NRT A;  4RZR A;  7ICJ A;  4E7X A;  2W9B B;  2R8K A;  1MSW D;  5EWE A;  5J0X A;  5J2I A;  4YXM A;  2KP7 A;  4RQ7 A;  2FPK A;  4IQV A;  4X0B A;  4RQ0 A;  3V7L A;  4JWN A;  3PX4 A;  4O3N A;  4F5P A;  4X4S A;  4NLG A;  3AUO A;  3BQ0 A;  3ZDC A;  2B21 A;  2KZZ A;  2KTQ A;  3RB6 A;  3LK9 A;  3HP6 A;  2NRV A;  5J2E A;  3MFH A;  4EBD A;  1XU4 A;  3ZD9 A;  3MBY A;  1UA1 A;  2FLN A;  3K75 D;  5KFN A;  5HRF A;  4IR1 A;  5KFU A;  4ECY A;  4EBK A;  2JEJ A;  1R8C A;  3UQ0 A;  4ED7 A;  3SI8 A;  1COO A;  5HML A;  1NK7 A;  4BDP A;  7ICS A;  2M2U A;  4WC1 A;  5DDY A;  5J2F A;  3KHG A;  3LQC B;  1R8A A;  2DRB A;  4XA5 A;  4QZB A;  2R8I A;  1QSS A;  4F3O A;  4ED8 A;  8ICP A;  1MC8 A;  1VJ7 A;  2W9M A;  5DBC A;  3C2M A;  5KTQ A;  3RH4 A;  3ETL A;  4JV0 A;  2PFN A;  3OUY A;  4JK1 A;  4M6W B;  1NJW A;  4YFK A;  4DL2 A;  2AQ4 A;  3EZ5 A;  2DPJ A;  2BPC A;  2PXI A;  2V4R A;  1KFD A;  3BQT A;  1ZQT A;  4I2B A;  4KLM A;  3OJS A;  8ICA A;  2RFF A;  1T4G A;  5J0R A;  3RAQ A;  9ICO A;  3T5J A;  3C21 A;  4PGQ A;  4P4O A;  4E0D A;  2ZH7 A;  5J0Y A;  4B9T A;  4X5V A;  1Q79 A;  4ED3 A;  1JX4 A;  1Z00 B;  3RJG A;  4G3I A;  3OVA A;  3ZDA A;  2AGO A;  3OVB A;  3PX6 A;  4DQP A;  7ICF A;  4O3S A;  5III A;  3MR5 A;  1SL2 A;  2MUT B;  5F9N A;  3PNC A;  4MFC A;  3M8R A;  1K1S A;  1XO1 A;  9ICR A;  2BQR A;  8ICY A;  5CJ7 A;  7ICH A;  9ICS A;  5DEC A;  3RJI A;  3WFO A;  3JPQ A;  1KLN A;  2VA3 A;  2W9B A;  3KHH A;  1Q78 A;  1R8B A;  5IIJ A;  5J0U A;  4YR2 A;  4J9K A;  7ICU A;  8ICG A;  1FA0 A;  5IIO A;  4EYH B;  4R66 A;  1ZQW A;  2FMS A;  4Q45 A;  1NJZ A;  4QZ8 A;  4R64 A;  3GDX A;  5KFM A;  3C2K A;  3TQ1 A;  1N56 A;  1A76 A;  2AU0 A;  1JXL A;  4NLK A;  4NXZ A;  2J6S A;  4EZ6 A;  4I2J A;  2C28 A;  4IRD A;  3AQL A;  4EBJ A;  1ARO P;  2ZH8 A;  4ECX A;  5DQI A;  1ZQD A;  3QZ7 A;  4O5E A;  4YVZ A;  5EWF A;  4KLG A;  3B0X A;  4PGY A;  1S97 A;  4F4K A;  4ECV A;  4FBU A;  4DSE A;  1UT5 A;  2AGQ A;  3JZ0 A;  4WC5 A;  9ICV A;  2ZJA A;  2C22 A;  1MQ3 A;  4KLE A;  2ZHA A;  1XSP A;  1TFY A;  3RRG A;  3BQ2 A;  4J9P A;  4RT3 A;  5HP4 A;  5DG8 A;  4J9Q A;  3THV A;  5HHH A;  5C5J A;  4I2E A;  2KFN A;  1ZQU A;  2XC9 A;  4DL5 A;  4DQR A;  1U9L A;  2C2D A;  1MIV A;  4DQI A;  4QZC A;  3RB4 A;  3Q8P B;  2JEI A;  4AT8 A;  1Y88 A;  3UQ2 A;  4M04 A;  2ZH4 A;  8ICU A;  3H40 A;  4DOC A;  3T3F A;  4DFP A;  8ICB A;  5DG7 A;  1PX5 A;  2Q0Z X;  5KT2 A;  1JIH A;  4P4P A;  4DWI A;  5F2V O;  2I1Q A;  2IA6 A;  1T3N A;  2IMW P;  4RPY A;  3ZDE A;  1U4B A;  5IIN A;  1ZQL A;  1ZQX A;  1NJY A;  3MR2 A;  2DRA A;  5KFW A;  1WCL A;  1KEJ A;  3MAB A;  1PZN A;  1UET A;  1CEZ A;  4X4Q A;  4UB1 A;  5KT5 A;  4DSI A;  9ICA A;  3OUY B;  4NM1 A;  3JPS A;  4MF2 A;  1Z00 A;  3GII A;  3FDS A;  4QZD A;  8ICW A;  5HRB A;  1NK5 A;  4RNO A;  2C2R A;  1XS9 D;  4O3Q A;  3RBE A;  3JPT A;  3GV8 B;  2RDJ A;  2DPI A;  3PW2 A;  1U48 A;  5D4B A;  5J2C A;  4DFJ A;  5KFL A;  1EXN A;  5KFD A;  5J0P A;  4R63 A;  2JEG A;  4UAY A;  1DK2 A;  3FYH A;  3OV7 A;  4YQW A;  4DLG A;  1H38 A;  2PI4 A;  4ECS A;  8ICJ A;  3ORY A;  3V6K A;  1HUO A;  2ZH6 A;  4F8R A;  3C66 A;  2HHT A;  7ICI A;  1ZQB A;  5KG0 A;  3RR8 A;  3WFQ E;  2F1I A;  5CWR A;  4J9O A;  3PW4 A;  4O5C A;  1SKS A;  4JWM A;  2ZJ8 A;  3OHA A;  3BDP A;  1BNO A;  3HJ4 A;  4WC0 A;  3UPS A;  3RR7 A;  1UA0 A;  1BNP A;  2DR8 A;  5KFY A;  3PY8 A;  5J0S A;  1V4A A;  1MIY A;  5J29 A;  1ZQQ A;  5L9X A;  4I2G A;  4Z6C A;  4NM2 A;  1BPD A;  1NK6 A;  4TQR A;  3PML A;  5CHG A;  2M2T A;  4F93 B;  5DB8 A;  2VAN A;  4XQ7 A;  1TK0 A;  1XC9 A;  2ASJ A;  4F2S A;  1ZYQ A;  5IIM A;  3PX0 A;  4GC6 A;  5J0O A;  5J0Q A;  1ZQS A;  7ICL A;  4DQQ A;  2R8J A;  1NOM A;  2KZM A;  1VFG A;  3EPG A;  1S76 D;  3OHB A;  3AQM A;  4ED6 A;  1TK8 A;  2ASD A;  4M9H A;  4QZH A; 
#chains in the Genus database with same CATH topology
 2HHU A;  4F4Y A;  1TAQ A;  4DSL A;  1UEV A;  4X4V A;  3TFS A;  2JH7 A;  1JAL A;  3ZDD A;  4QWE A;  5ALS A;  1SKW A;  2G5I B;  4WBZ A;  2BCV A;  5IIL A;  1Q3U A;  2W9C A;  3AMZ A;  3GV5 B;  1TVA A;  2XIC A;  3ER8 C;  3OSN A;  3V6J A;  5CB1 A;  5KFH A;  2WTF A;  1ZD2 P;  1JQR A;  4CCH A;  2NO4 A;  3CK6 A;  5HC9 A;  3N97 B;  1JUD A;  2GAF D;  5ALJ A;  2Q66 A;  3I1Y A;  3RH5 A;  2H3Q A;  4KLT A;  1DK3 A;  3NS1 A;  4X4R A;  4F91 B;  2E1F A;  3Q8K A;  2G09 A;  5KFQ A;  4UD4 A;  5TIS U;  4RPZ A;  4X4O A;  3KHL A;  9ICM A;  1NKB A;  1LV5 A;  3G6X A;  2HVH A;  5J2J A;  4G9B A;  5AKZ A;  2LYH A;  2NRW A;  4UBC A;  4F5O A;  3M9O B;  4J9N A;  5AKJ A;  4UD5 A;  4X0A A;  5DB7 A;  2IOF A;  5DDM A;  2IHO A;  1S77 D;  2D6F C;  3C1Z A;  4C8O A;  5HMM A;  3DV9 A;  1SV0 C;  2HOF A;  4BJQ A;  4K4H A;  4I2D A;  4RUC A;  3C28 A;  2Q4T A;  4RQ4 A;  2BPF A;  4DSK A;  8ICI A;  1B22 A;  5KFP A;  3NRZ A;  1RYS A;  4QZ9 A;  4GXJ A;  3K1Z A;  4UAZ A;  4M9L A;  4P0P B;  4QWA A;  2ODG A;  4DL6 A;  4OJP A;  1NNL A;  1SL0 A;  2CN1 A;  3PO4 A;  4C7Z A;  3VC8 A;  4TQS A;  4P4M A;  3ISC A;  1N62 A;  1Z4O A;  2OEH A;  2HW3 A;  2JRZ A;  4RPX A;  2FLP A;  3WKD A;  4TUP A;  1ZET A;  4RQ8 A;  1TV9 A;  3CNH A;  4ED1 A;  1PK1 A;  2KNJ A;  3WFR E;  1WWV A;  1B4F A;  7ICT A;  4DQS A;  2K8C B;  4IL6 U;  9ICP A;  1YZ7 A;  2W11 A;  4Y2R A;  4NXV A;  4M9J A;  8ICH A;  5F3X B;  1NJX A;  2IOF K;  5L1I A;  3A0H U;  1D9D A;  2LYB A;  4R8U A;  1S0N A;  3B9J A;  5KT3 A;  3NVY A;  4B9U A;  1LKY B;  1ZQZ A;  2JH1 A;  1S5L U;  3KHR A;  2DFL A;  5ALO A;  3NUQ A;  1ZQ1 C;  4K4G A;  1Q46 A;  4EEK A;  2UVU A;  4ATB A;  3QZ8 A;  2Y9T A;  2HBK A;  4I2I A;  4KB6 A;  4E8F A;  2Y0S F;  4UAT A;  3MGH A;  1L3V A;  4DFM A;  1WOT A;  3NVO A;  2LMR A;  3M6K A;  1KFS A;  2ZUB A;  3C18 A;  3TAP A;  4O68 A;  2ZIX B;  4KLF A;  2DF4 B;  1QTM A;  4NKT A;  3NAS A;  3FC4 A;  3MR3 A;  2J6U A;  4NXU A;  2Y0S C;  3JPP A;  9ICN A;  2NV3 A;  5DKW A;  1ZD3 A;  1HIW A;  3BZK A;  3M9N B;  4YP3 A;  3GIJ A;  1RM6 C;  4K4I A;  1QLN A;  1SZP A;  2QAR B;  4DLE A;  4DF8 A;  2KJ5 A;  3OPX A;  4RQ1 A;  4P2H A;  2GH1 A;  2W8K A;  2KVS A;  4TUQ A;  1D8Y A;  1VDV A;  2G08 A;  8ICM A;  1QCK A;  3H8J A;  9ICK A;  4F4W A;  5L1L A;  4QIW F;  5AI9 A;  3HIY A;  3QEB Z;  2KG5 A;  1KSP A;  4ECW A;  9ICF A;  4F92 B;  3H8S A;  5KFJ A;  4RT2 A;  2QKQ A;  5DG9 A;  5C0Y A;  3QE9 Y;  2W04 A;  3VCB A;  4DF4 A;  4P0Q B;  2W43 A;  3ISD A;  4EBE A;  4MEX A;  4ECZ A;  2YB1 A;  3RAX A;  2FMQ A;  5BOL A;  4FHW A;  1PUZ A;  3NTU A;  5KG6 A;  5HR7 A;  3LVW A;  3SAF A;  3ISB A;  3QU5 A;  4C8L A;  2OWO A;  5J2H A;  3G6Y A;  2BQU A;  4YR3 A;  2IBK A;  5KAI U;  4US9 A;  4UW9 A;  3TAQ A;  1SXD A;  4ICA A;  1ZQE A;  3T5K A;  1SKR A;  2BKE A;  9ICQ A;  1Z3E B;  2LKY A;  2VJ4 A;  4EZ9 A;  2ZH9 A;  4XQ8 A;  4Z6D A;  1URJ A;  4OO1 J;  5CHE A;  2KD1 A;  4GC7 A;  1WUD A;  2EAO A;  8ICC A;  5EE9 A;  3RF9 A;  4IR9 A;  2ZIV A;  2PFO A;  3D2S A;  5K4L A;  2C2E A;  2YB4 A;  5J2D A;  4XJE A;  4DL4 A;  9ICL A;  2W3S A;  2BHN A;  4O3O A;  4EP7 A;  5DLF A;  2QB0 A;  2BPG A;  3RTV A;  4MFF A;  1TAU A;  5AM3 A;  4KLS A;  2ES6 A;  2H3I A;  1QH9 A;  1NK0 A;  3RB0 A;  5KG4 A;  4IRK A;  4O3R A;  2PFQ A;  4J9M A;  2K4P A;  3EYZ A;  4ED2 A;  4PPX A;  2ISO A;  5DED A;  1IG6 A;  3H37 A;  2BCS A;  2XY6 A;  1S0V A;  7ICR A;  1NO5 A;  9ICU A;  2CPR A;  4KLJ A;  3F53 A;  2JZB A;  4RZR A;  1RDF A;  5J0X A;  5J2I A;  2F8K A;  4IQV A;  4X0B A;  2WFA A;  4O3N A;  4F5P A;  2B4V A;  1ZRM A;  4EBD A;  1N63 A;  1WG8 A;  5KFN A;  4C4R A;  1R8C A;  3UQ0 A;  3KHG A;  5KL1 B;  3C2M A;  5KTQ A;  1MA7 A;  4DL2 A;  2AQ4 A;  1X6I A;  3NVW A;  3BQT A;  4KLM A;  3OJS A;  8ICA A;  3T5J A;  3C21 A;  1X66 A;  4P4O A;  4E0D A;  4B9T A;  2HI0 A;  1Q79 A;  1JX4 A;  1Z00 B;  3N7R C;  4UB6 U;  3KFU F;  4MFC A;  5F9N A;  1K1S A;  9ICR A;  2BQR A;  5DEC A;  2W9B A;  3KHH A;  2DGZ A;  4J9K A;  3HKZ F;  3GZF A;  4EYH B;  4K96 A;  1ZQW A;  2FMS A;  3GDX A;  2AU0 A;  4WQK A;  4NLK A;  3M1Y A;  4ECX A;  1S97 A;  2AGQ A;  2ZJA A;  2KKP A;  1MQ3 A;  3CW2 C;  1TFY A;  3BQ2 A;  5HP4 A;  1R8B A;  5DG8 A;  5C5J A;  2KFN A;  3HKZ C;  4DL5 A;  4DQR A;  1MIV A;  3A0B U;  2JEI A;  4F71 A;  3Q8P B;  1KKX A;  2K60 A;  4K99 A;  4DWI A;  5F2V O;  4NLC A;  4CRX A;  3L3F X;  5IIN A;  1ZQL A;  1NJY A;  5ALN A;  1CEZ A;  3OUY B;  3JPS A;  4HAI A;  4CF3 A;  3GII A;  4LJX A;  4QZD A;  2JR5 A;  2WHE A;  2WF9 A;  1XS9 D;  5KNI A;  2RDJ A;  5AM4 A;  3PW2 A;  4BXO A;  2JHD A;  1DK2 A;  2YMP A;  4DFJ A;  2JEG A;  4UAY A;  2LI6 A;  5ALL A;  5AK4 A;  4F8R A;  3C66 A;  2HHT A;  1ZQB A;  5AI8 A;  5KG0 A;  4U7C A;  5CWR A;  1GO3 F;  3RR7 A;  1SWV A;  5J0S A;  5J29 A;  1ZQQ A;  3GU3 A;  5L9X A;  4Z6C A;  4I2G A;  1ZXI A;  1IIP A;  3PML A;  4F2S A;  1ZYQ A;  5ALE A;  7ICL A;  2R8J A;  2KZM A;  1OW5 A;  2EZY A;  4BX9 C;  4QZH A;  4FHP A;  4UAU A;  4LEZ A;  3L5K A;  2OCE A;  2ASL A;  8ICQ A;  2H5X A;  4JLZ A;  5AI0 A;  3LVV A;  4RQN A;  5ALH A;  4KN7 A;  4Z6F A;  2KE7 A;  1DOQ A;  5AIC A;  4E80 A;  4RWO A;  1KRP A;  3SEI A;  4QZG A;  1J2M A;  3SV3 A;  4M47 A;  4PHD A;  4YMN A;  5D62 A;  2IOH A;  4PHA A;  4OJ5 A;  4UB3 A;  4TUR A;  3HT3 A;  4KM5 A;  2ZTD A;  3MDA A;  3WFS C;  2KIC A;  1ZQK A;  3OVS A;  5KFB A;  4I29 A;  2JMG A;  5JUM A;  4ELU A;  1BPE A;  5KFT A;  1TE2 A;  5AM5 A;  4IQW A;  2EH9 A;  2RRD A;  1S8O A;  1BPZ A;  2AH5 A;  2MA1 A;  3V72 A;  2G06 A;  1C7Y A;  2KN7 A;  3HRD D;  2KV2 A;  3AQN A;  1TFR A;  2VKQ A;  2HN2 A;  4ECU A;  5H2F U;  1T3Q A;  3C29 A;  3L9D A;  2EZX A;  5B5E U;  3UPQ A;  4X4U A;  1X9X A;  2NYV A;  1X9M A;  5DB6 A;  3H4D A;  4QZI A;  1DXS A;  2YML A;  4F4Z A;  3K7D A;  5DLG A;  3TAD C;  2HHP A;  2DKZ A;  3Q8R B;  2WF6 A;  8ICL A;  1L7P A;  4CF4 A;  2ZH1 A;  3IG5 A;  4M9G A;  2EAP A;  8ICK A;  9ICW A;  5ALD A;  2GWS A;  1XWL A;  3SZ2 A;  3GFK B;  4M9N A;  2F1J A;  1RXW A;  3SYZ A;  3N7P D;  1R89 A;  4Q8F A;  4C4T A;  3QYP A;  3GIM A;  2W7O A;  3RJK A;  4NKU A;  1KL9 A;  4PGX A;  2XCP A;  4US8 A;  4DL7 A;  4YD1 A;  1S0M A;  4CF5 A;  4O67 A;  5DB9 A;  3HWT A;  3GIL A;  1ZQF A;  4FFD A;  1IV8 A;  3O0F A;  3JCF A;  4OJL A;  2YX8 A;  4KLD A;  3K4G A;  2BCU A;  3IDW A;  2B6G A;  1ZQC A;  4TUS A;  3AU6 A;  2A1J A;  4DSJ A;  9ICH A;  1HJP A;  2XGP A;  2MAX A;  4R65 A;  5J8Y A;  5AK5 A;  2YMM A;  2BCQ A;  3N28 A;  4KTQ A;  2ALZ A;  1MIW A;  1ZQI A;  2F76 X;  4JUZ A;  3WKA A;  1BGX T;  4BWJ A;  3WK9 A;  3IM1 A;  4IQT A;  4ACO A;  3E2E A;  1KNY A;  1F5A A;  1LVH A;  3BS7 A;  3KBB A;  2CXY A;  4FS1 A;  4PJ0 U;  3H3A A;  1ZJM A;  3C5F A;  4YMO A;  2I5H A;  4RNN A;  1WWU A;  4WQL A;  3ONN A;  5ALR A;  4XRH A;  1DGJ A;  9ICT A;  5ALY A;  1U49 A;  3EPI A;  1RYU A;  5J0W A;  4GIB A;  4Y2P A;  3BS5 A;  1Z1V A;  2IHM A;  4B9S A;  3UXN A;  4FH5 A;  3L4P A;  2YMQ A;  5AK3 A;  1JRO A;  2E8O A;  5ALG A;  5DGA A;  7ICM A;  2LPE A;  2RDI A;  3WK6 A;  5AI5 A;  1L5U A;  4MEY A;  1IM4 A;  2KK0 A;  2ZIV B;  8ICR A;  3EW9 A;  8ICF A;  2HDO A;  2XVT A;  1RG6 A;  5KG7 A;  2P66 A;  4NLZ A;  4O5K A;  1L7N A;  5KFC A;  4FO6 A;  1RZT A;  4QNL A;  4PHP A;  1IXR A;  1MN8 A;  4I2F A;  4NXT A;  4I0U A;  2DUY A;  2ZTC A;  2HMX A;  4NJ8 A;  4I27 A;  5KFO A;  5TZV A;  2XY7 A;  4AT8 A;  2XCA A;  4X4N A;  3PV8 A;  5J2A A;  5D49 A;  4J9L A;  2Y1I A;  5DQG A;  3SMV A;  5HR9 A;  4UAS A;  1U47 A;  4JV2 A;  3IP4 B;  2JZB B;  2RFF A;  8ICT A;  4DSF A;  9ICX A;  2KZ3 A;  1FFV A;  2M2W A;  3ZD8 A;  2BDP A;  2KMD A;  2W9A A;  1S0O A;  2HHW A;  1UPH A;  8ICO A;  1KFT A;  4LEV A;  4NV0 A;  1V85 A;  9ICG A;  4F50 A;  3GIK A;  1HUZ A;  3QUQ A;  5HRE A;  3M9M B;  4QW9 A;  3HJ1 A;  4ELT A;  1D8B A;  4EEB A;  4DL3 A;  1BPX A;  2YTU A;  8ICV A;  1L3U A;  2HVI A;  5KFG A;  1L3S A;  2NRX A;  4F2R A;  5ALT A;  8ICS A;  2W03 A;  4AT7 A;  1V38 A;  4Y2V A;  3WFP A;  1QQ6 A;  4OAH A;  4FE3 A;  5AIB A;  3HPO A;  4X4P A;  2RQ5 A;  1MQ2 A;  3M8S A;  1ZQN A;  4O6A A;  3RH6 A;  5HHI A;  2NRT A;  2K4H A;  1OUQ A;  2W9B B;  5EWE A;  3PX4 A;  2FCL A;  3RB6 A;  3KKA C;  2NRV A;  5J2E A;  3MFH A;  2OM6 A;  3MBY A;  1UA1 A;  4IR1 A;  4EBK A;  4NWI A;  4ED7 A;  1NK7 A;  4WC1 A;  5DDY A;  3LQC B;  2WF8 A;  8ICP A;  3MGV A;  4ED8 A;  2W9M A;  3RH4 A;  3ETL A;  1A6S A;  2PFN A;  4M6W B;  4YFK A;  4FZM A;  2PXI A;  2EAN A;  3IRU A;  3RAQ A;  2FJ6 A;  5HR6 A;  3I76 A;  3FAH A;  3OVA A;  3ZDA A;  2AGO A;  3OVB A;  3PX6 A;  4DQP A;  1SL2 A;  2MUT B;  2OYY A;  5EE0 A;  1HEK A;  8ICY A;  9ICS A;  3WK5 A;  3RJI A;  3JPQ A;  3WK7 A;  7ICU A;  8ICG A;  1COK A;  4Q45 A;  4QZ8 A;  2ZIW B;  1N56 A;  1JXL A;  3AQF A;  2C28 A;  4EBJ A;  3OTQ A;  2ZH8 A;  3QZ7 A;  4KLG A;  4F4K A;  4QIW C;  3UMB A;  1UT5 A;  3JZ0 A;  1T94 A;  9ICV A;  4JLX A;  2W3R A;  1XSP A;  1UHU A;  4J9P A;  3THV A;  5G5H A;  2C2D A;  4QZC A;  2L5Y A;  1Y88 A;  3D2N A;  4Y2Y A;  2ZH4 A;  4EEN A;  8ICB A;  1TAM A;  1U4B A;  1ZQX A;  3SD7 A;  1UET A;  4UB1 A;  2BBH A;  5KT5 A;  4NM1 A;  3QXG A;  3R9K A;  4OCZ A;  1K5O A;  4RNO A;  4O3Q A;  3IG8 A;  1U48 A;  5D4B A;  2W7P A;  3FYH A;  3D6J A;  4YQW A;  2HCF A;  4DLG A;  1H38 A;  4EV6 A;  4ECS A;  8ICJ A;  5AK6 A;  1XO0 A;  7ICI A;  3PW4 A;  3HJ4 A;  3BDP A;  4WC0 A;  3UPS A;  5ALZ A;  3KD3 A;  2DR8 A;  3PY8 A;  1V4A A;  5ALX A;  1MIY A;  1BPD A;  1NK6 A;  3AL0 B;  5J8Y C;  5CHG A;  2RHF A;  4F93 B;  3ED5 A;  1ZQS A;  1N2X A;  3EPG A;  4ED6 A;  3ALR A;  3KZI U;  2ASD A;  1TK8 A;  4NLB A;  4F5Q A;  1WCN A;  1J97 A;  2DBY A;  1KBU A;  5KFI A;  3T5L A;  2KSO A;  1ZQM A;  1ZQH A;  2D8C A;  2OH2 A;  5L1J A;  4M2Y A;  5T14 A;  4DOA A;  3H0L B;  3TFR A;  5GTH U;  4HX0 A;  9ICB A;  1VLB A;  4O3M A;  2F3N A;  2AHO B;  4EYI B;  2ZUC A;  4NLN A;  3C23 A;  4UB2 A;  2HN1 A;  1ZQJ A;  4WBY A;  5J0T A;  3C5G A;  2VA2 A;  5D46 A;  5D63 A;  1NI3 A;  4UAR A;  2UVW A;  1ZQP A;  2Y9U A;  5IIK A;  3SEN A;  3HW8 A;  5B66 U;  4OAG A;  2EZZ A;  3JPO A;  4KLQ A;  4IQU A;  1UT8 A;  5HRI A;  8ICN A;  3RRH A;  5KG2 A;  3KZX A;  3M7D A;  2MU2 A;  2FE9 A;  2LBO A;  5ALP A;  4ELV A;  5AKH A;  4CDG A;  3E0F A;  4WC2 A;  5KT4 A;  2R18 A;  1XSN A;  2O5A A;  1NK4 A;  2FPL A;  1NKE A;  2A1J B;  5CFU A;  1FIQ A;  3RJF A;  2XID A;  3F2C A;  4DFK A;  1XNS A;  2PI5 A;  7ICO A;  1SIJ A;  2ZIX A;  2FPM A;  5KFA A;  1ZJN A;  2OXO A;  4ED0 A;  3DDH A;  2BDU A;  4K98 A;  9ICE A;  2W9C B;  2P6U A;  3H39 A;  4LVS A;  5ALK A;  4U6P A;  2B51 A;  4O9M A;  2E8P A;  4FHV A;  1N48 A;  2DR9 A;  1Q3V A;  5BPC A;  4PHE A;  4K8V A;  1L3T A;  1ZQA A;  2BE3 A;  3PZP A;  1PVQ A;  2ZTE A;  4KMU A;  4WC6 A;  1V9P A;  1DGS A;  2HHX A;  3BS5 B;  4DO9 A;  2EDU A;  4WCW A;  4Y2Q A;  3Q8M A;  2W54 A;  4C0Z A;  2CRX A;  2ZJ5 A;  5AKI A;  2XGQ A;  4RU9 A;  3OSP A;  3PVX A;  2JXJ A;  1T7P A;  4LT6 A;  3AEV A;  3G6V A;  3ICX A;  1NK8 A;  1NKC A;  4UB8 U;  2HHQ A;  3CRX A;  4AT9 A;  1FFU A;  1X40 A;  1A77 A;  1RXV A;  1NZP A;  2B56 A;  5EOZ A;  2ZXI A;  5KFV A;  5KT6 A;  1CI4 A;  5EWG A;  3WFQ E;  4KLH A;  4AT8 B;  2WF7 A;  2M0N A;  5BOM A;  4O0I A;  2FLL A;  4N7R A;  2R8G A;  4RQ3 A;  1X9W A;  1B43 A;  4QZF A;  1S10 A;  1T8E A;  1UQV A;  2HOI A;  4NY8 A;  1Z4N A;  2F8L A;  5AM1 A;  4UQG A;  4Y2S A;  4LEY A;  5KFX A;  4WJ3 B;  4RNM A;  2F77 X;  2KEY A;  4JB3 A;  1BPY A;  4RQ5 A;  3PSI A;  1X9S A;  4B9N A;  5CA7 A;  4RWP A;  4GXK A;  4B9M A;  2HHV A;  1JN3 A;  3Q8L A;  1L7O A;  4C8M A;  3PW0 A;  3QU2 A;  5AKX A;  3I28 A;  4Y2U A;  3J81 j;  2JEF A;  1TFW A;  1K1Q A;  2G5H B;  4MF8 A;  4YD2 A;  2DVI A;  2E5S A;  1PK1 B;  2FDR A;  4B9V A;  4UAW A;  4WC7 A;  3QUT A;  5JRT A;  4KIT B;  7ICG A;  1TKD A;  1NK9 A;  4KLU A;  1KTQ A;  3NGD A;  2IUB A;  4Q8E A;  2DR5 A;  9ICJ A;  4CNQ A;  3S6J A;  2V4Q A;  4K9B A;  4J9S A;  1U45 A;  3TAC B;  3MGI A;  3T5H A;  4DOB A;  2ZH3 A;  2I6X A;  4R8U B;  3PR5 B;  2P6R A;  4AT7 B;  4IRC A;  2PFP A;  5KFR A;  4F4X A;  5AHX A;  4RWQ A;  4C4S A;  4ZH4 A;  4ATB B;  1X42 A;  4Q43 A;  3V7K A;  7ICV A;  3OGU A;  4QWD A;  9ICC A;  4HYK A;  2KJ9 A;  3CYM A;  3EWA A;  2BR0 A;  4QZA A;  3BJY A;  1ZQG A;  4DEZ A;  3EUB 2;  4I28 A;  3WU2 U;  3TI0 A;  5L1K A;  5JTI A;  1JI7 A;  2V9W A;  4I2H A;  4YR0 A;  4EEY A;  4FZN A;  2NO5 A;  3AQL A;  2ATL A;  4LZG A;  3SV4 A;  3TAN A;  3DEE A;  4F5N A;  5B3Q A;  1JAJ A;  2FI1 A;  1X2I A;  4QWB A;  5AM0 A;  7ICE A;  5HRH A;  3PSP A;  1ZQR A;  5G5G A;  8ICZ A;  2O6K A;  1N60 A;  2PBE A;  4B6J A;  5AKK A;  5GTI U;  4C8K A;  1SZH A;  2ZIU A;  5ALI A;  5EE3 A;  4CE6 A;  2XO7 A;  2J6T A;  4IS7 A;  5KG1 A;  1SV4 A;  1JXE A;  4PH5 A;  4K97 A;  4QZE A;  4YG2 A;  2WB1 F;  4YCX A;  3IV6 A;  4RQ7 A;  4NXX A;  3V7L A;  5L1M A;  3AUO A;  3ZI4 A;  2B21 A;  2KHV A;  5ALW A;  2F2A B;  3LK9 A;  4EGW A;  3HP6 A;  1XU4 A;  3ZD9 A;  3F5A A;  5HRF A;  2JEJ A;  2WB1 C;  1COO A;  5HML A;  4BDP A;  7ICS A;  2DRB A;  4KX3 A;  4XA5 A;  1VJ7 A;  2LYA A;  1MC8 A;  4PZN A;  3ER9 B;  2KVC A;  4JV0 A;  3OUY A;  1NJW A;  3SQI A;  4FZL A;  2JGA A;  3M6Z A;  3WK4 A;  3ETR A;  3H8M A;  5ALU A;  1T4G A;  5J0R A;  4PGQ A;  2RP5 A;  3BZC A;  5J0Y A;  5ALV A;  4ED3 A;  4G3I A;  3RJG A;  4BUG A;  4OAF A;  1SWW A;  1A0P A;  2QB0 B;  3PNC A;  3M8R A;  1XO1 A;  5CJ7 A;  7ICH A;  1KW4 A;  1KLN A;  2VA3 A;  5IIJ A;  4YR2 A;  1FA0 A;  1P7D A;  4R66 A;  5AKG A;  1NJZ A;  2EQY A;  2E8N A;  5CFS A;  4R64 A;  5KFM A;  2DWQ A;  4IRD A;  4EZ6 A;  4I2J A;  1ZQD A;  4YVZ A;  3B0X A;  4PGY A;  4ECV A;  4DSE A;  4KLE A;  3RRG A;  4RT3 A;  4I2E A;  4DCC A;  1U9L A;  3UQ2 A;  4M04 A;  3KOO A;  8ICU A;  1RQL A;  1AQ6 A;  4DFP A;  3T3F A;  2KSO B;  5KT2 A;  1JIH A;  4P4P A;  2I1Q A;  1T3N A;  4RPY A;  3WKE A;  1UCV A;  3MR2 A;  5KFW A;  1WCL A;  1KEJ A;  3MAB A;  2KHQ A;  4NL9 A;  1N5X A;  4DSI A;  9ICA A;  3PSF A;  4MF2 A;  2ZG6 A;  3FDS A;  1YT3 A;  8ICW A;  1NK5 A;  2C2R A;  3RBE A;  3JPT A;  3GV8 B;  2DPI A;  5J2C A;  1EXN A;  3OV7 A;  2K4I A;  2PI4 A;  1YZ6 A;  3ORY A;  1HUO A;  5D61 A;  2ZH6 A;  3E58 A;  1M6Y A;  4J9O A;  3D2Q A;  1SKS A;  4JWM A;  2K8B B;  2ZJ8 A;  2QLT A;  1UA0 A;  4MKP A;  4KX5 A;  4NM2 A;  4TQR A;  3SAH A;  2VAN A;  5DB8 A;  1TK0 A;  4XQ7 A;  2DKX A;  2ASJ A;  3QU4 A;  4GC6 A;  5J0Q A;  3AQM A;  1S76 D;  3OHB A;  4M9H A;  4OAI Z;  4MFA A;  3QEA Z;  2P35 A;  3PW5 A;  9ICI A;  5CFT A;  2KKV A;  3ERC C;  5DGB A;  3QU9 A;  4IG8 A;  2HHS A;  4O3P A;  3H4B A;  4UB5 A;  2LHT A;  2AXT U;  2NRZ A;  4IC9 A;  4Y2T A;  4AYB F;  4AP9 A;  3AN1 A;  2N1R A;  1WYG A;  3PW7 A;  2ZUD A;  3HJE A;  4ECT A;  3GV7 B;  4QJF B;  1CUK A;  3H38 A;  4WC4 A;  2W8L A;  2ZHB A;  3HIL A;  4FO1 A;  4XUS A;  3LWM A;  5KFZ A;  2F1H A;  1BVS A;  4RQ2 A;  4AYB C;  4F5R A;  4YN4 A;  4J9R A;  4BXO B;  3NVZ A;  3UXP A;  3LDA A;  4RWN A;  4Q44 A;  2UVR A;  3C2L A;  2KFZ A;  1J2N A;  5KG3 A;  3PST A;  2AQ0 A;  1V97 A;  3MFI A;  4PL2 A;  7ICK A;  4UBB A;  1ZD5 A;  3QU7 A;  2VJ5 A;  4GXI A;  2LM1 A;  2M9N A;  5KFF A;  4WC3 A;  4JV1 A;  3QNM A;  4UB4 A;  4EX6 A;  5HRG A;  2XI9 A;  5DQH A;  2XY5 A;  3LWL A;  1L8L A;  2QB1 A;  4AT9 B;  2YQE A;  3T79 A;  1Z1B A;  3BQ1 A;  2G0A A;  5HRL A;  3V6H A;  3TAD A;  2I9G A;  3Q8S B;  3AQK A;  3C1Y A;  3Q8Q B;  4I2C A;  4PL1 A;  3JPN A;  4BWM A;  2DR7 A;  4YMM A;  2E8M A;  1OXJ A;  1SGG A;  2AJQ A;  2GOL A;  2ID1 A;  4EX7 A;  2ZXH A;  4OJO A;  3BQ7 A;  2MSN A;  5AKY A;  4GLX A;  1JMS A;  1SXE A;  8ICE A;  5AIA A;  2M2V A;  4KLL A;  4WOY A;  3AU2 A;  2H3Z A;  3IHQ B;  4C8N A;  5AKE A;  2Y1J A;  4X4T A;  1QSY A;  2AGP A;  1ZQV A;  1SB3 C;  3RJJ A;  4DFD A;  2IHN A;  3F2D A;  4DS4 A;  4QW8 A;  4YXJ A;  3K1R B;  2KOB A;  2GA9 D;  3WK8 A;  1BPB A;  4KN4 A;  4Z6E A;  4O69 A;  5CRX A;  1S9F A;  3UMC A;  1YLQ A;  4ECR A;  3N4M B;  4KLI A;  5HRK A;  7ICN A;  2ZH2 A;  2YN4 A;  2RLT A;  1L7M A;  2VA8 A;  3UM9 A;  4FH3 A;  1QQ7 A;  4P0P A;  2DL0 A;  5EE1 A;  4FHY A;  4S3N A;  1D8L A;  3HX0 A;  3U26 A;  3NYB A;  1O08 A;  3RBD A;  1RYR A;  2BBJ A;  4M0A A;  2O1P A;  1XSL A;  3NWI A;  1QQ5 A;  4I2A A;  4BGD A;  3TAR A;  1D9F A;  4A8E A;  3WKB A;  5CP2 A;  1PVP A;  2W55 A;  5JU5 A;  1ZOL A;  5AI4 A;  3MDC A;  5J2B A;  2HBM A;  2LM4 A;  1QSL A;  1UEU A;  2ZH5 A;  5HRD A;  2HBJ A;  5A0L A;  4PZO A;  1FO4 A;  3RJH A;  1PK3 A;  4KLO A;  7ICQ A;  5CEH A;  1VJ5 A;  2H3F A;  1LKY A;  4C7Y A;  4ZOH C;  4EED A;  1CRX A;  5ALF A;  5KT7 A;  3QUC A;  2JV3 A;  3PMN A;  5KFE A;  4GFJ A;  4RQ6 A;  1L8O A;  2E3T A;  3JPR A;  1Z19 A;  4FHX A;  1TK5 A;  2ZIU B;  1SV0 A;  2BGW A;  2ISP A;  5DBA A;  4FBU A;  5DBB A;  1N61 A;  2EWR A;  3RB3 A;  3TKA A;  5KFS A;  3SAG A;  4QWC A;  1RPL A;  2BCR A;  4C80 A;  4Y2X A;  3H7I A;  4LZD A;  3NKU A;  4M5D A;  3H0M B;  5CR0 A;  3PR4 A;  4DS5 A;  5KFK A;  2K8A A;  2FMP A;  1ED1 A;  3JYY A;  4FS2 A;  2HBL A;  4M6W A;  3QX7 A;  4LEW A;  2D3D A;  2QAR A;  3KTQ A;  2BQ3 A;  3ZDB A;  3RJE A;  3H8W A;  4NL9 C;  1NZB A;  3B0Y A;  3SR6 A;  4ECQ A;  4UAV A;  8ICX A;  1LB2 B;  5F9L A;  5KG5 A;  4KMO B;  5E79 U;  2PKE A;  1KDH A;  5KL8 B;  3LYS A;  3GQC A;  2K4E A;  3V7J A;  4MHV A;  3UXO A;  4EBC A;  5ALQ A;  7ICP A;  2MUT A;  4K9A A;  4RUA A;  4RQM A;  2G07 A;  1SL1 A;  2NRK A;  1Q8K A;  1ZQY A;  2Z7J A;  2GO7 A;  4FBT A;  1PVR A;  1X6J A;  5J2K A;  5HNK A;  2UVV A;  5J2G A;  5KAF U;  2GLE A;  2R8H A;  1ZQO A;  3PO5 A;  1OU5 A;  4P0Q A;  4B9L A;  3F5E A;  2ZIW A;  1ECW A;  3MR6 A;  1JRP A;  4J03 A;  3OJU A;  7ICJ A;  4OD0 A;  1L6N A;  4E7X A;  2R8K A;  1MSW D;  3EF2 A;  2KP7 A;  4YXM A;  2FPK A;  4RQ0 A;  4JWN A;  4X4S A;  4NLG A;  1F0M A;  3BQ0 A;  3ZDC A;  2KZZ A;  2KTQ A;  2HOQ A;  2F44 A;  2FLN A;  3K75 D;  2A3V A;  5KFU A;  4ECY A;  1N5W A;  4OJ6 A;  3KKA A;  2HSZ A;  3SI8 A;  2M2U A;  2VIX A;  5JTG A;  5J2F A;  1R8A A;  4QZB A;  2R8I A;  1QSS A;  4F3O A;  5B3P A;  2H3V A;  5DBC A;  4JK1 A;  3F2B A;  3EZ5 A;  2DPJ A;  2BPC A;  2PMZ F;  2V4R A;  1KFD A;  1ZQT A;  4I2B A;  1ZRN A;  9ICO A;  2ESE A;  2ZH7 A;  3MCR A;  2K89 A;  4X5V A;  4WH5 A;  7ICF A;  4O3S A;  5III A;  3MR5 A;  1FEZ A;  2A19 A;  3WKC A;  3QUB A;  5AM2 A;  4NXW A;  3WFO A;  1Q78 A;  2PMZ C;  2WF5 A;  5J0U A;  4Y2J A;  2YY6 A;  5IIO A;  5AI6 A;  3PHZ A;  1F5S A;  3C2K A;  3TQ1 A;  1A76 A;  1KQQ A;  4NXZ A;  2J6S A;  4EEL A;  2KIV A;  1ARO P;  3N7S C;  3IN5 A;  2EAM A;  5AKL A;  5DQI A;  4O5E A;  5EWF A;  3AM9 A;  2MRL A;  4WC5 A;  2C22 A;  2ZHA A;  3H0R B;  1B0X A;  2DQN B;  4J9Q A;  1F44 A;  5HHH A;  2B0C A;  1ZQU A;  2XC9 A;  2E1E A;  4CGZ A;  1O03 A;  3OWG A;  4DQI A;  3RB4 A;  2WAQ F;  4USA A;  3UMG A;  3H40 A;  4DOC A;  1ZD4 A;  5DG7 A;  1PX5 A;  2Q0Z X;  1RQN A;  2IA6 A;  5FP0 A;  2IMW P;  1KN5 A;  3ZDE A;  3CP8 A;  1C20 A;  4JMU A;  2DRA A;  3FM9 A;  1PZN A;  4X4Q A;  1Z00 A;  3NVV A;  2A1A A;  5HRB A;  2KJ8 A;  2WAQ C;  3AQE A;  4F72 A;  3RFA A;  5KFL A;  5KFD A;  2KIW A;  5J0P A;  4R63 A;  1DRG A;  3V6K A;  3RR8 A;  2F1I A;  4O5C A;  1BNO A;  5ALM A;  3OHA A;  2BZF A;  1GPJ A;  1BNP A;  5KFY A;  2OHF A;  2M2T A;  1XC9 A;  3MC1 A;  5IIM A;  3PX0 A;  5J0O A;  4DQQ A;  1NOM A;  3NRW A;  1VFG A; 
#chains in the Genus database with same CATH homology
 2HHU A;  4F5Q A;  1TAQ A;  4MFA A;  4F4Y A;  3QEA Z;  4DSL A;  1UEV A;  2ASL A;  1WCN A;  8ICQ A;  2H5X A;  3PW5 A;  9ICI A;  4X4V A;  5KFI A;  3T5L A;  1ZQM A;  1ZQH A;  3TFS A;  5L1J A;  4QWE A;  4KN7 A;  4Z6F A;  3ZDD A;  4M2Y A;  5DGB A;  4DOA A;  1SKW A;  1DOQ A;  2HHS A;  4IG8 A;  4O3P A;  3H4B A;  2BCV A;  4WBZ A;  4E80 A;  3TFR A;  4UB5 A;  5IIL A;  2W9C A;  1KRP A;  4RWO A;  4QZG A;  2NRZ A;  3GV5 B;  1TVA A;  9ICB A;  3SV3 A;  4FHP A;  3OSN A;  3V6J A;  4M47 A;  4PHD A;  5CB1 A;  4YMN A;  4EYI B;  5KFH A;  2WTF A;  2ZUC A;  4PHA A;  4UB3 A;  4TUR A;  4NLN A;  3C23 A;  3HT3 A;  4UB2 A;  1JQR A;  2ZTD A;  3MDA A;  4CCH A;  3WFS C;  3PW7 A;  5HC9 A;  1ZQK A;  1ZQJ A;  2ZUD A;  8ICH A;  4WBY A;  5J0T A;  3N97 B;  3C5G A;  4ECT A;  5KFB A;  2VA2 A;  3OVS A;  3GV7 B;  1CUK A;  4I29 A;  5D46 A;  3H38 A;  2Q66 A;  4WC4 A;  2UVW A;  2W8L A;  1ZQP A;  2ZHB A;  5IIK A;  3RH5 A;  4KLT A;  1DK3 A;  5JUM A;  4XUS A;  4X4R A;  3LWM A;  4F91 B;  4ELU A;  1BPE A;  3HW8 A;  5KFZ A;  5KFT A;  2F1H A;  1BVS A;  4RQ2 A;  4F5R A;  3Q8K A;  4IQW A;  3JPO A;  5KFQ A;  4YN4 A;  4J9R A;  4BXO B;  4IQU A;  4KLQ A;  1UT8 A;  5HRI A;  8ICN A;  4UD4 A;  3UXP A;  3RRH A;  1BPZ A;  4RPZ A;  4X4O A;  3KHL A;  3V72 A;  5KG2 A;  9ICM A;  3LDA A;  1NKB A;  1LV5 A;  4Q44 A;  3G6X A;  2UVR A;  4RWN A;  3C2L A;  2HVH A;  1C7Y A;  5J2J A;  2KN7 A;  2KFZ A;  5KG3 A;  3AQN A;  1TFR A;  2AQ0 A;  2LYH A;  2NRW A;  3MFI A;  4ELV A;  4UBC A;  4F5O A;  3M9O B;  4J9N A;  7ICK A;  4UD5 A;  4WC2 A;  4UBB A;  4X0A A;  5DB7 A;  4ECU A;  4GXI A;  5KT4 A;  5DDM A;  1S77 D;  2M9N A;  5KFF A;  4WC3 A;  3C1Z A;  1XSN A;  4C8O A;  4UB4 A;  2FPL A;  5HMM A;  1NK4 A;  4JV1 A;  2O5A A;  1NKE A;  3L9D A;  2A1J B;  3UPQ A;  4X4U A;  4K4H A;  5HRG A;  4I2D A;  1X9M A;  4RUC A;  3RJF A;  5DB6 A;  2BPF A;  5DQH A;  4RQ4 A;  3H4D A;  4DSK A;  4QZI A;  8ICI A;  1B22 A;  4DFK A;  2XY5 A;  5KFP A;  2PI5 A;  4F4Z A;  7ICO A;  3LWL A;  1RYS A;  4QZ9 A;  5DLG A;  4GXJ A;  4UAZ A;  2HHP A;  4AT9 B;  4M9L A;  2FPM A;  3Q8R B;  4QWA A;  8ICL A;  5KFA A;  4DL6 A;  1SL0 A;  2ZH1 A;  3BQ1 A;  5HRL A;  3V6H A;  3PO4 A;  1ZJN A;  4M9G A;  4ED0 A;  2I9G A;  3Q8S B;  3AQK A;  8ICK A;  9ICW A;  2GWS A;  3C1Y A;  1XWL A;  3SZ2 A;  9ICE A;  3GFK B;  4TQS A;  3Q8Q B;  2W9C B;  2P6U A;  4P4M A;  4I2C A;  4M9N A;  2F1J A;  3JPN A;  3ISC A;  3H39 A;  1RXW A;  3SYZ A;  4BWM A;  2HW3 A;  4LVS A;  2DR7 A;  4YMM A;  1R89 A;  4Q8F A;  4RPX A;  4O9M A;  2FLP A;  2AJQ A;  2ID1 A;  3GIM A;  4FHV A;  4TUP A;  1N48 A;  2DR9 A;  1ZET A;  3RJK A;  4NKU A;  4PGX A;  4RQ8 A;  2XCP A;  1TV9 A;  4DL7 A;  5BPC A;  4YD1 A;  4PHE A;  2ZH9 A;  4GLX A;  1L3T A;  1JMS A;  8ICE A;  1ZQA A;  4ED1 A;  2M2V A;  4KLL A;  2BE3 A;  3WFR E;  2ZTE A;  4KMU A;  1S0M A;  4WC6 A;  3AU2 A;  1V9P A;  3IHQ B;  4C8N A;  5DB9 A;  3HWT A;  2Y1J A;  4X4T A;  1QSY A;  1DGS A;  3GIL A;  1ZQF A;  2HHX A;  2AGP A;  7ICT A;  1ZQV A;  4DO9 A;  3RJJ A;  4DQS A;  2IHN A;  4DS4 A;  4WCW A;  4QW8 A;  4YXJ A;  3Q8M A;  9ICP A;  4KLD A;  2ZJ5 A;  3K4G A;  2XGQ A;  4RU9 A;  3OSP A;  3PVX A;  1NJX A;  4M9J A;  2BCU A;  1BPB A;  1T7P A;  4KN4 A;  5L1I A;  1ZQC A;  4TUS A;  3AU6 A;  2A1J A;  4BXO A;  4DSJ A;  4Z6E A;  4LT6 A;  1D9D A;  9ICH A;  1HJP A;  2XGP A;  4R8U A;  2MAX A;  4R65 A;  3G6V A;  1S0N A;  2BCQ A;  1S9F A;  1NK8 A;  4KTQ A;  1YLQ A;  5KT3 A;  2ALZ A;  1MIW A;  4ECR A;  3N4M B;  1ZQI A;  4B9U A;  4KLI A;  5HRK A;  4JUZ A;  1ZQZ A;  1BGX T;  4BWJ A;  1NKC A;  7ICN A;  2ZH2 A;  3KHR A;  2HHQ A;  2VA8 A;  3IM1 A;  4AT9 A;  2DFL A;  4IQT A;  4FH3 A;  1A77 A;  4K4G A;  1RXV A;  3E2E A;  1NZP A;  4FHY A;  4S3N A;  1D8L A;  4ATB A;  2UVU A;  5EOZ A;  3QZ8 A;  1KNY A;  1F5A A;  4I2I A;  5KFV A;  3HX0 A;  4E8F A;  3NYB A;  5KT6 A;  3RBD A;  4FS1 A;  5EWG A;  1RYR A;  1ZJM A;  3MGH A;  1L3V A;  3C5F A;  4DFM A;  4KLH A;  1WOT A;  3H3A A;  4AT8 B;  4YMO A;  1KFS A;  2FLL A;  5BOM A;  4O0I A;  4M0A A;  2ZUB A;  4RNN A;  1XSL A;  2R8G A;  2O1P A;  3C18 A;  3TAP A;  4RQ3 A;  1X9W A;  1B43 A;  4QZF A;  1S10 A;  1T8E A;  4KLF A;  4I2A A;  4NY8 A;  4BGD A;  3TAR A;  4XRH A;  1D9F A;  9ICT A;  4UQG A;  1U49 A;  1QTM A;  4NKT A;  5KFX A;  3MR3 A;  5CP2 A;  4RNM A;  2J6U A;  3EPI A;  1BPY A;  5J0W A;  4RQ5 A;  1X9S A;  4B9N A;  4RWP A;  5CA7 A;  3JPP A;  3MDC A;  5J2B A;  9ICN A;  4GXK A;  5DKW A;  1QSL A;  4B9M A;  2HHV A;  1UEU A;  2IHM A;  1JN3 A;  3Q8L A;  4C8M A;  3PW0 A;  4B9S A;  3M9N B;  4YP3 A;  3GIJ A;  4K4I A;  2ZH5 A;  3UXN A;  5HRD A;  4FH5 A;  1QLN A;  2JEF A;  1SZP A;  4DLE A;  4DF8 A;  5DGA A;  1K1Q A;  1TFW A;  4MF8 A;  7ICM A;  2RDI A;  4YD2 A;  3RJH A;  4RQ1 A;  4P2H A;  2DVI A;  4B9V A;  1L5U A;  4MEY A;  4UAW A;  1IM4 A;  4WC7 A;  4KLO A;  2W8K A;  8ICR A;  3EW9 A;  7ICQ A;  8ICF A;  4TUQ A;  1D8Y A;  4KIT B;  7ICG A;  1TKD A;  1NK9 A;  8ICM A;  4KLU A;  3H8J A;  9ICK A;  1KTQ A;  5KG7 A;  3NGD A;  2P66 A;  4NLZ A;  4Q8E A;  4F4W A;  2DR5 A;  5L1L A;  4O5K A;  5KFC A;  1RZT A;  4FO6 A;  5KT7 A;  4PHP A;  9ICJ A;  1IXR A;  3HIY A;  4I2F A;  3PMN A;  3QEB Z;  2V4Q A;  5KFE A;  1KSP A;  4J9S A;  4ECW A;  4RQ6 A;  1U45 A;  3MGI A;  3T5H A;  9ICF A;  4DOB A;  2ZTC A;  4F92 B;  3H8S A;  4R8U B;  2ZH3 A;  3PR5 B;  3JPR A;  5KFJ A;  2P6R A;  4AT7 B;  4I27 A;  4RT2 A;  4IRC A;  4FHX A;  5KFO A;  5DG9 A;  5TZV A;  2XY7 A;  3QE9 Y;  2XCA A;  1TK5 A;  2PFP A;  2BGW A;  4DF4 A;  2ISP A;  4X4N A;  5KFR A;  5DBA A;  3ISD A;  3PV8 A;  5DBB A;  4EBE A;  4ECZ A;  5J2A A;  5D49 A;  3RB3 A;  5KFS A;  3RAX A;  4MEX A;  2FMQ A;  5BOL A;  4J9L A;  4FHW A;  2Y1I A;  3NTU A;  4F4X A;  5DQG A;  5KG6 A;  5HR9 A;  1U47 A;  4QWC A;  3ISB A;  4JV2 A;  4RWQ A;  4ZH4 A;  4ATB B;  2JZB B;  1RPL A;  2BCR A;  4C8L A;  8ICT A;  4Q43 A;  4DSF A;  2OWO A;  5J2H A;  3V7K A;  7ICV A;  3G6Y A;  2BQU A;  3H7I A;  4YR3 A;  2IBK A;  9ICX A;  2KZ3 A;  2M2W A;  3ZD8 A;  3OGU A;  4LZD A;  2BDP A;  4QWD A;  4M5D A;  9ICC A;  4HYK A;  3TAQ A;  1ZQE A;  3T5K A;  5CR0 A;  2BKE A;  3PR4 A;  1SKR A;  4DS5 A;  3EWA A;  9ICQ A;  2W9A A;  5KFK A;  4QZA A;  3BJY A;  2BR0 A;  4DEZ A;  1Z3E B;  1S0O A;  1ZQG A;  2FMP A;  4EZ9 A;  4I28 A;  2HHW A;  8ICO A;  4XQ8 A;  4Z6D A;  1KFT A;  4FS2 A;  3JYY A;  4M6W A;  3TI0 A;  5L1K A;  3KTQ A;  9ICG A;  2V9W A;  4I2H A;  4YR0 A;  2BQ3 A;  4EEY A;  4GC7 A;  3ZDB A;  8ICC A;  3RJE A;  4F50 A;  3H8W A;  3GIK A;  1HUZ A;  3B0Y A;  4IR9 A;  4ECQ A;  2ATL A;  3SV4 A;  2PFO A;  1LB2 B;  4LZG A;  5F9L A;  8ICX A;  5KG5 A;  2C2E A;  3TAN A;  4F5N A;  5J2D A;  1JAJ A;  1KDH A;  5HRE A;  3M9M B;  4QW9 A;  3HJ1 A;  1X2I A;  4QWB A;  3GQC A;  4DL4 A;  9ICL A;  3V7J A;  4ELT A;  7ICE A;  2BHN A;  5HRH A;  4O3O A;  3UXO A;  4EP7 A;  4EBC A;  4DL3 A;  7ICP A;  1BPX A;  5DLF A;  2MUT A;  1ZQR A;  8ICV A;  1L3U A;  8ICZ A;  2BPG A;  3RTV A;  4MFF A;  4RUA A;  2HVI A;  1TAU A;  2PBE A;  4KLS A;  5KFG A;  1SL1 A;  2NRX A;  1L3S A;  4F2R A;  2NRK A;  1ZQY A;  4FBT A;  8ICS A;  1NK0 A;  5J2K A;  5HNK A;  3RB0 A;  5KG4 A;  2UVV A;  5J2G A;  4C8K A;  4IRK A;  4O3R A;  4AT7 A;  2PFQ A;  3WFP A;  4J9M A;  3EYZ A;  2R8H A;  4ED2 A;  1ZQO A;  3PO5 A;  4PPX A;  1OU5 A;  4B9L A;  2ISO A;  2XO7 A;  5DED A;  2J6T A;  5KG1 A;  3MR6 A;  3HPO A;  2XY6 A;  2BCS A;  1S0V A;  7ICR A;  1NO5 A;  9ICU A;  3H37 A;  4X4P A;  4KLJ A;  1JXE A;  1MQ2 A;  3M8S A;  1ZQN A;  4PH5 A;  4QZE A;  3RH6 A;  4YG2 A;  5HHI A;  3OJU A;  2JZB A;  4YCX A;  2NRT A;  4RZR A;  7ICJ A;  4E7X A;  2W9B B;  2R8K A;  1MSW D;  5EWE A;  5J0X A;  5J2I A;  4YXM A;  2KP7 A;  4RQ7 A;  2FPK A;  4IQV A;  4X0B A;  4RQ0 A;  3V7L A;  4JWN A;  3PX4 A;  4O3N A;  4F5P A;  4X4S A;  4NLG A;  3AUO A;  3BQ0 A;  3ZDC A;  2B21 A;  2KZZ A;  2KTQ A;  3RB6 A;  3LK9 A;  3HP6 A;  2NRV A;  5J2E A;  3MFH A;  4EBD A;  1XU4 A;  3ZD9 A;  3MBY A;  1UA1 A;  2FLN A;  3K75 D;  5KFN A;  5HRF A;  4IR1 A;  5KFU A;  4ECY A;  4EBK A;  2JEJ A;  1R8C A;  3UQ0 A;  4ED7 A;  3SI8 A;  1COO A;  5HML A;  1NK7 A;  4BDP A;  7ICS A;  2M2U A;  4WC1 A;  5DDY A;  5J2F A;  3KHG A;  3LQC B;  1R8A A;  2DRB A;  4XA5 A;  4QZB A;  2R8I A;  1QSS A;  4F3O A;  4ED8 A;  8ICP A;  1MC8 A;  1VJ7 A;  2W9M A;  5DBC A;  3C2M A;  5KTQ A;  3RH4 A;  3ETL A;  4JV0 A;  2PFN A;  3OUY A;  4JK1 A;  4M6W B;  1NJW A;  4YFK A;  4DL2 A;  2AQ4 A;  3EZ5 A;  2DPJ A;  2BPC A;  2PXI A;  2V4R A;  1KFD A;  3BQT A;  1ZQT A;  4I2B A;  4KLM A;  3OJS A;  8ICA A;  2RFF A;  1T4G A;  5J0R A;  3RAQ A;  9ICO A;  3T5J A;  3C21 A;  4PGQ A;  4P4O A;  4E0D A;  2ZH7 A;  5J0Y A;  4B9T A;  4X5V A;  1Q79 A;  4ED3 A;  1JX4 A;  1Z00 B;  3RJG A;  4G3I A;  3OVA A;  3ZDA A;  2AGO A;  3OVB A;  3PX6 A;  4DQP A;  7ICF A;  4O3S A;  5III A;  3MR5 A;  1SL2 A;  2MUT B;  5F9N A;  3PNC A;  4MFC A;  3M8R A;  1K1S A;  1XO1 A;  9ICR A;  2BQR A;  8ICY A;  5CJ7 A;  7ICH A;  9ICS A;  5DEC A;  3RJI A;  3WFO A;  3JPQ A;  1KLN A;  2VA3 A;  2W9B A;  3KHH A;  1Q78 A;  1R8B A;  5IIJ A;  5J0U A;  4YR2 A;  4J9K A;  7ICU A;  8ICG A;  1FA0 A;  5IIO A;  4EYH B;  4R66 A;  1ZQW A;  2FMS A;  4Q45 A;  1NJZ A;  4QZ8 A;  4R64 A;  3GDX A;  5KFM A;  3C2K A;  3TQ1 A;  1N56 A;  1A76 A;  2AU0 A;  1JXL A;  4NLK A;  4NXZ A;  2J6S A;  4EZ6 A;  4I2J A;  2C28 A;  4IRD A;  3AQL A;  4EBJ A;  1ARO P;  2ZH8 A;  4ECX A;  5DQI A;  1ZQD A;  3QZ7 A;  4O5E A;  4YVZ A;  5EWF A;  4KLG A;  3B0X A;  4PGY A;  1S97 A;  4F4K A;  4ECV A;  4FBU A;  4DSE A;  1UT5 A;  2AGQ A;  3JZ0 A;  4WC5 A;  9ICV A;  2ZJA A;  2C22 A;  1MQ3 A;  4KLE A;  2ZHA A;  1XSP A;  1TFY A;  3RRG A;  3BQ2 A;  4J9P A;  4RT3 A;  5HP4 A;  5DG8 A;  4J9Q A;  3THV A;  5HHH A;  5C5J A;  4I2E A;  2KFN A;  1ZQU A;  2XC9 A;  4DL5 A;  4DQR A;  1U9L A;  2C2D A;  1MIV A;  4DQI A;  4QZC A;  3RB4 A;  3Q8P B;  2JEI A;  4AT8 A;  1Y88 A;  3UQ2 A;  4M04 A;  2ZH4 A;  8ICU A;  3H40 A;  4DOC A;  3T3F A;  4DFP A;  8ICB A;  5DG7 A;  1PX5 A;  2Q0Z X;  5KT2 A;  1JIH A;  4P4P A;  4DWI A;  5F2V O;  2I1Q A;  2IA6 A;  1T3N A;  2IMW P;  4RPY A;  3ZDE A;  1U4B A;  5IIN A;  1ZQL A;  1ZQX A;  1NJY A;  3MR2 A;  2DRA A;  5KFW A;  1WCL A;  1KEJ A;  3MAB A;  1PZN A;  1UET A;  1CEZ A;  4X4Q A;  4UB1 A;  5KT5 A;  4DSI A;  9ICA A;  3OUY B;  4NM1 A;  3JPS A;  4MF2 A;  1Z00 A;  3GII A;  3FDS A;  4QZD A;  8ICW A;  5HRB A;  1NK5 A;  4RNO A;  2C2R A;  1XS9 D;  4O3Q A;  3RBE A;  3JPT A;  3GV8 B;  2RDJ A;  2DPI A;  3PW2 A;  1U48 A;  5D4B A;  5J2C A;  4DFJ A;  5KFL A;  1EXN A;  5KFD A;  5J0P A;  4R63 A;  2JEG A;  4UAY A;  1DK2 A;  3FYH A;  3OV7 A;  4YQW A;  4DLG A;  1H38 A;  2PI4 A;  4ECS A;  8ICJ A;  3ORY A;  3V6K A;  1HUO A;  2ZH6 A;  4F8R A;  3C66 A;  2HHT A;  7ICI A;  1ZQB A;  5KG0 A;  3RR8 A;  3WFQ E;  2F1I A;  5CWR A;  4J9O A;  3PW4 A;  4O5C A;  1SKS A;  4JWM A;  2ZJ8 A;  3OHA A;  3BDP A;  1BNO A;  3HJ4 A;  4WC0 A;  3UPS A;  3RR7 A;  1UA0 A;  1BNP A;  2DR8 A;  5KFY A;  3PY8 A;  5J0S A;  1V4A A;  1MIY A;  5J29 A;  1ZQQ A;  5L9X A;  4I2G A;  4Z6C A;  4NM2 A;  1BPD A;  1NK6 A;  4TQR A;  3PML A;  5CHG A;  2M2T A;  4F93 B;  5DB8 A;  2VAN A;  4XQ7 A;  1TK0 A;  1XC9 A;  2ASJ A;  4F2S A;  1ZYQ A;  5IIM A;  3PX0 A;  4GC6 A;  5J0O A;  5J0Q A;  1ZQS A;  7ICL A;  4DQQ A;  2R8J A;  1NOM A;  2KZM A;  1VFG A;  3EPG A;  1S76 D;  3OHB A;  3AQM A;  4ED6 A;  1TK8 A;  2ASD A;  4M9H A;  4QZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...