5J0TA

Binary complex crystal structure of dna polymerase beta with g:a mismatch at the primer terminus
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
330
structure length
327
Chain Sequence
b'APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 109
structure length 327
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0tA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0tA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0tA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0tA03
4J9SA 4RPYA 4UB1A 1N56A 5DB9A 3H4DA 1SZPA 4XA5A 2FMSA 2HVIA 4UD4A 5KG7A 9ICPA 1HUOA 2C28A 3RBEA 1NK7A 1VFGA 2KFZA 7ICGA 3V7JA 4M04A 5J0RA 3EPGA 4I2CA 4DQIA 1YLQA 5KG1A 4I2AA 2XCAA 2FLPA 3MABA 5HREA 4F93B 4LZDA 3GFKB 5JUMA 4RNOA 5HNKA 1WCLA 1U48A 4DSIA 7ICSA 8ICQA 5KFYA 5CWRA 5DB7A 3KHHA 5KFIA 4QZCA 1F5AA 3AU2A 4C8MA 2ASJA 3H38A 1ZQBA 4O5EA 3KHLA 4AT9A 5KFVA 4KLOA 4I2JA 4MEXA 4DOAA 4EBCA 7ICLA 3T5KA 4KLEA 3V6HA 1XU4A 2OWOA 4YR0A 1MC8A 3QEBZ 1D9DA 4KLHA 4ECVA 5C5JA 4F5QA 3BQTA 3PX0A 1S0MA 4F91B 4KLJA 2M2UA 4QW8A 3Q8SB 4NKTA 4C8LA 2KFNA 1K1QA 2ZTEA 4AT8B 3RAXA 2ZUDA 4J9LA 4BWJA 3C21A 3TFSA 3MDAA 1JMSA 2FPMA 3AU6A 1TK5A 1S0OA 1ZQOA 5KFPA 4I2HA 4O0IA 2M2TA 2O1PA 4FHVA 2XO7A 5HMMA 1L3UA 1ZQIA 5D46A 1UA0A 3OHBA 7ICRA 5DBBA 3RH4A 4QWDA 3SI8A 4BWMA 1FA0A 4WCWA 2ZUBA 3B0YA 1TK8A 5HRKA 4I29A 5EWGA 4RQ2A 3OVSA 5J0TA 4KN4A 3OSPA 1BPXA 5KG4A 4PHAA 2ZJ8A 4AT7B 1ZQVA 3RB4A 4QZFA 1HUZA 1NK6A 3BDPA 4C8KA 1R89A 3N4MB 2R8IA 1ZQAA 4I27A 4F50A 8ICRA 1U9LA 2NRWA 9ICVA 4KN7A 1TFYA 3OV7A 5KT3A 5J0YA 4PPXA 3H37A 4WC3A 3PO4A 4FS2A 5IINA 2NRVA 1ZQPA 3RTVA 4DFPA 1LV5A 4ED7A 4NY8A 2AQ0A 5KT4A 4BXOA 2NRKA 4J9PA 2BHNA 2MUTB 4TQSA 5DDYA 3MR6A 4YP3A 4J9RA 4FS1A 9ICXA 3C66A 4QWAA 4DO9A 2AGOA 4MFAA 1BPZA 5J0XA 5J0WA 5DBAA 2PFOA 5F9LA 4X4RA 1T7PA 2DPIA 4F2RA 4ECTA 2ASDA 7ICIA 2H5XA 8ICGA 4YG2A 3OUYA 3SZ2A 4X4TA 2VA8A 3BJYA 4R66A 4GXJA 1NJZA 1UEUA 1BGXT 1MSWD 7ICTA 8ICVA 1L3TA 2ATLA 4O3QA 5KFWA 1ZQNA 1TAUA 9ICTA 3PVXA 3TQ1A 2ZH6A 3JPNA 3GIMA 3OVBA 3M8SA 2V4RA 3RB6A 7ICJA 4ZH4A 4IRCA 2JEIA 3AQNA 3JPSA 3UXNA 4RWNA 4ECYA 4IR9A 2HHUA 4M2YA 1KEJA 3MR3A 1NK5A 4YCXA 4QWBA 4RQ3A 5DQHA 4GC6A 4R65A 3PW4A 4DQPA 4F2SA 4ATBA 4X4SA 4RU9A 3BQ1A 4DSKA 4UB3A 4JWMA 4GLXA 2A1JA 4QW9A 4KLIA 1B22A 1T4GA 3Q8MA 4RQ5A 9ICQA 5HRBA 2M2WA 1BPYA 5KFUA 3KTQA 4X0AA 2IBKA 4I2GA 4O5CA 3C5GA 8ICSA 2JZBA 3OJSA 5KFQA 5DBCA 1X9WA 3TANA 4ED0A 8ICBA 1XWLA 1X9SA 2F1HA 3H8WA 2JEGA 4R8UA 1UT8A 3V7KA 2FPLA 3ZDDA 4PH5A 1IM4A 5J2EA 2ID1A 1SL1A 1TFRA 5KFBA 8ICEA 4K4IA 4O9MA 2Q66A 3OSNA 4NLGA 2IHMA 3FYHA 4EEYA 1ZETA 1AROP 5KFJA 3L9DA 1S10A 1ZQWA 3HWTA 4TUSA 4UAWA 3V6KA 4Q45A 4UB5A 1KDHA 2UVUA 2W9BA 4J9QA 4Z6FA 4RQ1A 4DS5A 1T3NA 2GWSA 1PX5A 2HHPA 5CP2A 4M9JA 1KTQA 1NKCA 3SV3A 4DOCA 8ICXA 5KTQA 1Z00B 8ICPA 4GXKA 1RYRA 3JYYA 2W9MA 1KFSA 1MQ3A 1JN3A 4M9NA 4LT6A 8ICFA 5L9XA 4Q8FA 1ZQTA 3RRHA 3HX0A 3WFQE 4MF2A 4X4QA 2ZHBA 4M9GA 5EWEA 4I2IA 5IIKA 2IA6A 3QE9Y 4TUPA 1H38A 4B9LA 2KZ3A 4KLGA 3AQKA 1PZNA 4IRKA 3PMLA 3HT3A 3C18A 3V6JA 2KP7A 5DB8A 3ZD8A 5DDMA 5J2CA 3BQ0A 2XY7A 1ZJNA 5KFKA 2I9GA 4E0DA 8ICAA 1UETA 5DB6A 4EYHB 3EYZA 4GC7A 3LK9A 4X5VA 9ICWA 5HRDA 4M0AA 8ICWA 1XC9A 1MQ2A 3NTUA 7ICKA 1CUKA 4J9KA 3PV8A 5HR9A 4PGXA 3MGIA 4FBUA 2M9NA 4FHXA 1N48A 4RPXA 4BDPA 4DQSA 1BNPA 3ETLA 3H40A 2DRAA 1Z3EB 3ISBA 3H8JA 4ECZA 4DWIA 3RJHA 2R8JA 5J2HA 3AUOA 2BDPA 1KRPA 3UPSA 4UAZA 1A77A 1XSPA 1VJ7A 3RJJA 7ICHA 2ZH7A 4RQ4A 3Q8RB 1NJYA 2FLNA 4KLUA 5F9NA 4Z6DA 1BPBA 3GILA 3OUYB 2P66A 9ICRA 4RT2A 4QWEA 2HHQA 1D8LA 2FPKA 4RWQA 5BOMA 3JPRA 1SKWA 4EBKA 4YQWA 1MIVA 4E80A 4P4MA 1L3VA 1QSSA 5HRIA 2IMWP 2BPFA 3H39A 3JZ0A 2ZTCA 4I2DA 1KSPA 5J2JA 2IHNA 4RWPA 9ICKA 4QZHA 4TUQA 2VA3A 5KFNA 5J2GA 4M6WA 1TV9A 4JUZA 4IRDA 2A1JB 5J2KA 5L1KA 4JK1A 3EPIA 1RZTA 4YN4A 3PX4A 1NO5A 3UXOA 2ZJ5A 3V72A 1RXVA 3SV4A 2P6RA 1S76D 2W9CA 4DFKA 1BPDA 5KFEA 4JWNA 2Y1IA 2BKEA 2NRTA 4O3SA 1QLNA 1SKSA 2JZBB 1TK0A 9ICHA 5IIJA 3K75D 4RUCA 1ZQEA 3Q8QB 2PFNA 4F4XA 4WC7A 3AQLA 2AJQA 4UAYA 4DLGA 2ZH3A 5KG5A 2KZMA 4RUAA 3PR5B 3C1ZA 1BVSA 4UB2A 2ZH9A 1ZQUA 3FDSA 3ZDCA 4KLDA 3PO5A 1DK2A 2O5AA 4DFJA 2ZH5A 3M9OB 3T5HA 2ZH2A 1NJWA 4JV1A 1Y88A 2P6UA 4P4PA 2NRXA 1OU5A 4ELVA 5DG8A 4PGYA 4YD2A 5CA7A 3GV8B 3MBYA 2W9BB 1DK3A 8ICNA 8ICTA 3AQMA 2XC9A 5L1LA 8ICKA 3PMNA 2C22A 4FBTA 4TURA 3GIJA 5L1IA 2VANA 1SKRA 5EOZA 5DG9A 1QTMA 4RQ7A 4GXIA 3E2EA 2R8HA 3UQ0A 1MIYA 2DVIA 1ZQCA 1KNYA 2ISPA 2KN7A 4DQQA 3PY8A 5KFMA 3C5FA 2BCVA 4CCHA 5KFFA 3RJFA 3PX6A 4O3NA 4YR2A 3ISCA 4P2HA 2DR8A 4YMOA 2WTFA 1ZQGA 7ICUA 2BE3A 4DL5A 4XUSA 1RXWA 2F1IA 3HW8A 1X2IA 4C8NA 2W9AA 5HHIA 3GV5B 4RQ8A 4DOBA 5J29A 2ZUCA 5KFGA 3HPOA 4ED2A 5DKWA 5HRLA 3RRGA 4F4WA 1NKBA 1R8AA 2AU0A 9ICFA 4X4PA 1DOQA 4QZIA 3OGUA 4J9MA 1R8BA 4M9HA 4RWOA 2XGPA 8ICJA 3NGDA 5KFCA 1ZQQA 3RR7A 3QEAZ 2AGQA 5J2AA 2BQRA 4WBZA 3IM1A 5J2IA 9ICNA 3B0XA 4I2BA 5DLGA 3C2KA 1LB2B 4NKUA 4B9MA 1X9MA 4AT9B 3OVAA 4DL7A 4FHYA 1KFDA 4KLMA 2V4QA 4MFCA 1NK0A 3T5JA 2XGQA 4AT7A 5DQIA 4K4GA 2UVWA 5IIMA 4KLQA 4Q8EA 1NZPA 1HJPA 3H7IA 2BPGA 3TARA 1SL0A 5KFXA 4ED6A 4ELTA 3H8SA 2RDIA 1ZJMA 2RFFA 2HHTA 8ICLA 4QWCA 4F8RA 9ICSA 4WBYA 1S9FA 2UVVA 3HJ4A 5HRFA 4NLNA 8ICIA 2W8LA 3UXPA 4XQ7A 4I28A 1ZYQA 4ED8A 2FMQA 3WFRE 8ICMA 4C8OA 3RB3A 3LWMA 4S3NA 1TFWA 5J2DA 3EW9A 4IQUA 3GQCA 1ZQLA 3RR8A 2AGPA 2XY5A 4I2EA 4KLSA 4KLTA 2M2VA 3Q8KA 5CB1A 1JXEA 5BPCA 4EBJA 3IHQB 2XCPA 4QZDA 5DLFA 3QZ7A 3PW5A 3RB0A 5IILA 2W8KA 3LWLA 1UT5A 3RH5A 3MR5A 9ICBA 5KG3A 4UB4A 4YFKA 2F1JA 4Z6EA 5DG7A 5KT7A 2HHSA 2ZH8A 4X4UA 4X4NA 4O3OA 4MFFA 2ISOA 3V7LA 2I1QA 3OJUA 2DFLA 1T8EA 2HHVA 1DGSA 4DSLA 3RBDA 4TQRA 4ECSA 8ICHA 3GDXA 5KG0A 2PFQA 2JEJA 2PBEA 3TAPA 4ECQA 3GIIA 1TVAA 1JXLA 1ZQDA 3RJEA 7ICNA 4BXOB 7ICPA 4EZ9A 2C2EA 4F5OA 3UPQA 4F92B 1L5UA 8ICUA 2BR0A 4YXMA 3HP6A 1NK4A 3WFSC 5KFSA 1ZQRA 2ZTDA 4ECWA 3GIKA 4HYKA 5HP4A 1TAQA 1U45A 4QZ9A 5KFDA 4QZ8A 1RYSA 1XSNA 4DSJA 1SL2A 4KTQA 2HVHA 1A76A 1WOTA 5BOLA 2BCSA 2LYHA 4RNMA 4FHWA 3ORYA 2C2RA 4DSEA 1V4AA 3PNCA 4F4YA 4FH3A 2ZH4A 4DLEA 7ICMA 2R8KA 4NM2A 5CR0A 1ZQHA 1S97A 4EZ6A 4E7XA 2Y1JA 1L3SA 9ICUA 4P4OA 3G6YA 4DL3A 3TI0A 2J6SA 9ICAA 3H3AA 9ICOA 2BQUA 5TZVA 2B21A 9ICEA 4RNNA 2PI4A 8ICCA 5IIIA 1R8CA 5J0OA 3HIYA 4ATBB 1Q78A 5KFAA 3ZDAA 4RPZA 3M8RA 2MAXA 3M9MB 4ECUA 3ZD9A 4DL4A 4B9TA 2NRZA 3ISDA 3OHAA 3RJIA 1EXNA 4YMNA 3Q8PB 2DPJA 2FMPA 4B9SA 1V9PA 4YMMA 4KITB 5KT5A 3RH6A 3WFOA 4UQGA 1ZQYA 9ICCA 4FH5A 2V9WA 4NLZA 3C2MA 5J2FA 1IXRA 4ECRA 5KFTA 2J6TA 2PFPA 4NM1A 2HHWA 1Z00A 2J6UA 3MFIA 1ZQZA 4R8UB 2BCRA 1COOA 4NLKA 4DF8A 4M9LA 2ZHAA 4F5NA 4IR1A 5CJ7A 2XY6A 1U4BA 9ICJA 4QZGA 5D4BA 5DECA 5F2VO 2PXIA 2UVRA 4YXJA 4X0BA 3WFPA 4LZGA 4DS4A 1MIWA 9ICGA 3RJGA 3JPPA 3PW2A 4KMUA 1QSLA 2HHXA 3TAQA 3MDCA 4I2FA 1JIHA 3EZ5A 4RQ6A 2RDJA 8ICZA 5KFHA 4E8FA 2DR5A 3ZDEA 4WC6A 2BGWA 9ICLA 2DR7A 5J0SA 1ZQSA 1NJXA 2DR9A 2C2DA 1NK8A 3ZDBA 4DL2A 1U47A 9ICMA 1S77D 1C7YA 4IQVA 5CHGA 1ZQMA 4JV2A 4M47A 3THVA 5HRHA 8ICYA 4DL6A 4RZRA 4UD5A 2KTQA 1NKEA 2ZH1A 4ELUA 4O5KA 4ED3A 3MFHA 5KT6A 4G3IA 3JPOA 4RT3A 4EBDA 1XS9D 4R64A 5HMLA 4PHEA 1U49A 2HW3A 1NK9A 3LQCB 9ICIA 4EBEA 4WC4A 3BQ2A 1JAJA 4UBCA 4QZEA 5L1JA 4J9OA 2BCQA 4WC2A 3G6VA 3PW7A 1WCNA 4JV0A 2AQ4A 4PHDA 2VA2A 5HRGA 3RAQA 2FLLA 2JEFA 4YD1A 2BQ3A 2KZZA 2Q0ZX 4J9NA 4RQ0A 4DSFA 5KFZA 5DQGA 4B9VA 1BPEA 4AT8A 3T5LA 5HHHA 1CEZA 3KHGA 3GV7B 4YR3A 1JX4A 1S0NA 4X4VA 2ZJAA 2DRBA 1D9FA 4FO6A 1K1SA 1ZQXA 4F4ZA 3JPTA 4PHPA 2ASLA 4XQ8A 1JQRA 2ALZA 1QSYA 3QZ8A 4ED1A 3JPQA 1KFTA 4EYIB 7ICOA 4DQRA 4M5DA 5KG6A 4XRHA 3PR4A 2R8GA 1Q79A 3C2LA 3MGHA 4QZBA 5DEDA 3EWAA 1BNOA 4F4KA 1NOMA 2BPCA 4FHPA 5J0UA 4KLFA 4X4OA 2PI5A 7ICEA 3SYZA 7ICVA 4WC5A 3MR2A 5KFRA 1RPLA 4UBBA 5KT2A 3N97B 4Q43A 5D49A 1XSLA 4F3OA 4B9UA 1XO1A 3KHRA 1D8YA 3K4GA 4BGDA 3TFRA 2BCUA 8ICOA 3HJ1A 4EP7A 5HC9A 4YVZA 4F5PA 5J0QA 4NXZA 3UQ2A 5DGBA 4K4HA 5IIOA 4IQTA 4O3PA 5J2BA 3C1YA 5DGAA 4M6WB 2MUTA 3LDAA 4R63A 4MEYA 4KLLA 5KFOA 3NYBA 3C23A 1B43A 3G6XA 4B9NA 4ECXA 2W9CB 3RJKA 7ICQA 4WC0A 4QZAA 1KLNA 4IQWA 3H4BA 1UA1A 4MF8A 5J0PA 1TKDA 3T3FA 3PW0A 3M9NB 1ZQJA 5KG2A 5EWFA 4PGQA 4WC1A 4DEZA 1S0VA 4Z6CA 4IG8A 7ICFA 3Q8LA 1ZQKA 5KFLA 4F5RA 1ZQFA 4O3RA 4DFMA 4LVSA 4DF4A 1UEVA 4Q44A
chains in the Genus database with same CATH superfamily
4UB1A 5DB9A 2HVIA 1NK7A 2KFZA 1SV0C 2HI0A 4I2CA 2CXYA 3FM9A 2FLPA 3MABA 3QUCA 4LZDA 1WCLA 4DSIA 3KHHA 4A8EA 1ECWA 3AU2A 1ZQBA 1SB3C 4O5EA 2ZIWB 4EBCA 4K99A 7ICLA 2HBKA 2A3VA 2NYVA 1XU4A 2OWOA 1AQ6A 2WF9A 5C5JA 4ECVA 3OVSA 2M2UA 4QW8A 4J9LA 4BWJA 4I2HA 4NLBA 4O0IA 5D46A 3RH4A 4QWDA 5AKXA 3B0YA 1TK8A 5KG4A 5ALRA 4AT7B 5B3PA 5ALTA 4QZFA 2BDUA 3BDPA 4OJLA 1Q3UA 1IIPA 1ED1A 3N7SC 2E3TA 3OV7A 5KT3A 4AYBC 4OAGA 3NVWA 4OJ5A 5AIAA 4FS2A 4DFPA 1LV5A 4NY8A 2NRKA 2XIDA 4J9PA 4J9RA 5ALHA 3PSTA 4DO9A 1BPZA 5J0WA 2PFOA 4F2RA 2ASDA 8ICGA 3OUYA 2ZIVB 4GXJA 4BJQA 7ICTA 1DRGA 3JPNA 2V4RA 2JV3A 3UXNA 4RWNA 5AICA 2G5HB 4DQPA 2A1JA 4QW9A 3IN5A 1SXDA 5B5EU 4FZMA 2JZBA 4LEWA 3A0BU 5DBCA 4PZNA 4UAUA 2DUYA 1X9SA 3H0MB 2F1HA 4R8UA 2FPLA 5A0LA 4PH5A 4UARA 5H2FU 4O9MA 2G5IB 5KFJA 1ZQWA 2RQ5A 3V6KA 1KDHA 2FE9A 4RQ1A 1N5WA 4XJEA 8ICXA 1Z00B 4M9NA 1J97A 8ICFA 2EQYA 3D2QA 3OTQA 2IA6A 2EH9A 2K4IA 2KZ3A 4KLGA 2RRDA 4IRKA 5DB8A 4I0UA 5AKHA 2XY7A 8ICAA 3AL0B 5DB6A 4X5VA 1B4FA 5HRDA 1X66A 8ICWA 1RDFA 3PV8A 4CE6A 2HDOA 1YT3A 5HR9A 4FHXA 1N48A 1SXEA 1BNPA 3H40A 3PSFA 4CF3A 4QJFB 4Y2VA 4RQ4A 1FFVA 4Y2JA 2FLNA 5F9NA 3GILA 4RT2A 2KJ9A 2FPKA 4YQWA 1K5OA 4WOYA 1UCVA 5AKKA 4FE3A 3ER9B 3SAHA 1KW4A 1KSPA 2HSZA 2IHNA 4BX9C 3WK9A 1TV9A 1X42A 4IRDA 2KKPA 3PX4A 3LYSA 3UXOA 1RXVA 3SV4A 1S76D 5ALKA 2BKEA 4MHVA 1GO3F 1TK0A 9ICHA 3K75D 3Q8QB 2AJQA 5F3XB 2KZMA 3PR5B 1BVSA 1ZQUA 2HBMA 2WFAA 2ZH5A 1Q46A 2EZXA 1NJWA 1Y88A 2H3ZA 1VDVA 4EEDA 1DK3A 8ICNA 4NXTA 3AQMA 5L1LA 3IG5A 3GIJA 3J81j 1MIYA 1VJ5A 3M1YA 3C5FA 4O3NA 1T94A 2WTFA 2ZIWA 4BUGA 1JROA 1TE2A 4XUSA 2F1IA 3HW8A 1X2IA 4OAFA 3WKBA 5J29A 4K9BA 4KX5A 1QQ6A 3HPOA 5DKWA 3RRGA 2EANA 4IC9A 9ICFA 5AKIA 1DOQA 3OGUA 4J9MA 4RWOA 2EAPA 3RFAA 8ICJA 5AKZA 3M6ZA 2VKQA 3IM1A 3C2KA 3OPXA 4KLMA 1DGJA 3KKAA 3WK8A 3T5JA 3E0FA 4AT7A 2W7PA 1SL0A 4ED6A 2RFFA 4F8RA 4WBYA 1JUDA 5AKEA 5HRFA 4XQ7A 4I28A 4ED8A 3WFRE 3LWMA 3EW9A 5J2DA 2M2VA 3RR8A 4EELA 4EBJA 4C4SA 2MSNA 1SWVA 2HHSA 5KT7A 5L1MA 4X4NA 4O3OA 2ZIVA 2HHVA 1LKYB 5KG0A 3TAPA 4ECQA 1JXLA 1ZQDA 3KD3A 1L5UA 5ALNA 1NK4A 5KFSA 1TAQA 3DV9A 4C7ZA 1U45A 3ER8C 1XSNA 1A76A 1WOTA 2K4HA 1L8OA 3HILA 2BCSA 3ORYA 1V4AA 3HKZC 4DLEA 2R8KA 2B4VA 1S97A 2GOLA 4DL3A 1OXJA 3SR6A 4DCCA 1R8CA 2PI4A 2EZZA 3ZDAA 4RPZA 2F3NA 3M9MB 2NRZA 2FMPA 4PZOA 4WC6A 3Q8PB 2ZIUB 5KT5A 5AI8A 1S8OA 2YB4A 5AM5A 3C2MA 5KNIA 1IXRA 4ECRA 5KFTA 2J6TA 1Z00A 4DF8A 2HN2A 4F5NA 4IR1A 2XY6A 1U4BA 9ICJA 4QZGA 2YQEA 4LZGA 1MIWA 4K8VA 9ICGA 3RJGA 3JPPA 5D62A 4KMUA 3EZ5A 2RDJA 4E8FA 2BGWA 2CN1A 2DR9A 2C2DA 1NK8A 1U47A 1S77D 1C7YA 5KL1B 5CHGA 3TADC 2ZH1A 1NKEA 4MKPA 2DKXA 1FIQA 4G3IA 1PK1B 4WC4A 2BCQA 3IP4B 1WCNA 2VA2A 2JEFA 4YD1A 3M6KA 2BQ3A 4DSFA 2KG5A 5KFZA 5HHHA 3WK5A 5JTGA 4YR3A 2WAQF 1D9FA 4GFJA 4F4ZA 4PHPA 4XQ8A 1JQRA 2K8AA 4ED1A 3KOOA 2MA1A 7ICOA 1L7PA 2EZYA 1WWVA 4FO1A 2R8GA 1Q79A 2K89A 4NXWA 2O6KA 4FHPA 2DBYA 4WC5A 3SYZA 4UBBA 4WH5A 1XSLA 4F3OA 4B9UA 3K4GA 4BGDA 5HC9A 4NXZA 5IIOA 4IQTA 5DGAA 2FJ6A 4MEYA 4KLLA 2YMQA 3C28A 1X40A 4B9NA 4ECXA 5ALUA 2W9CB 1KLNA 2KV2A 3H4BA 2G0AA 1D8BA 1ZQJA 5KG2A 4DEZA 4HAIA 4Z6CA 1XO0A 3I76A 1UEVA 4Q44A 4J9SA 4RPYA 3NASA 1N56A 2FMSA 3V7JA 3EPGA 4DQIA 1MN8A 5KG1A 4I2AA 1YLQA 4F93B 3GFKB 2LKYA 5JUMA 1ZD2P 2JH1A 4EX7A 4RNOA 2H3IA 5CWRA 5DB7A 2ASJA 4C8MA 4JLZA 5KFVA 1WG8A 1IG6A 1X9XA 5CFSA 3QX7A 3QEBZ 1D9DA 2WF5A 4F5QA 4NKTA 2KFNA 1K1QA 1UHUA 4Y2XA 4AT8B 3RAXA 5ALFA 3E58A 2FPMA 3MDAA 3AU6A 4CF5A 5HMMA 2W43A 7ICRA 2HMXA 1FA0A 4WCWA 2G06A 4I29A 4RQ2A 3OSPA 3WKEA 1ZQVA 3WK6A 2IOFK 1HUZA 1NK6A 2DQNB 3BZCA 4C8KA 1N63A 3KBBA 4F50A 3MGVA 1U9LA 2NRWA 4PPXA 3RTVA 1LKYA 2MRLA 2MUTB 3R9KA 4TQSA 4YP3A 4FS1A 5ALLA 2KJ8A 4QWAA 4MFAA 2LBOA 3F2CA 4X4RA 2YN4A 5F9LA 2AXTU 1T7PA 1N5XA 2LYBA 4AYBF 4X4TA 3BJYA 1LVHA 2ATLA 4O3QA 1TAUA 3PVXA 3M8SA 3SAFA 7ICJA 3AQNA 2JEIA 1ZRNA 2HHUA 2NO4A 1NK5A 2HBLA 4F72A 4RQ3A 5DQHA 3PW4A 4RU9A 4KLIA 4GLXA 2ES6A 4UATA 1Z1VA 5HRBA 2M2WA 1BPYA 3KTQA 5KFQA 1X9WA 2YB1A 4EEBA 3V7KA 1TFRA 5KFBA 2Q66A 1V97A 4NLGA 2LM1A 1KKXA 3L9DA 1ZQ1C 3F53A 2UVUA 4DS5A 4Z6FA 2HHPA 2FDRA 4UB8U 3SV3A 4DOCA 3CRXA 4KM5A 5FP0A 4GXKA 3JYYA 2W9MA 4EGWA 2JH7A 2QKQA 3HX0A 2ZHBA 3L5KA 5IIKA 1PK1A 4B9LA 2DKZA 3AQKA 3F5EA 4FZNA 3PMLA 3HT3A 3C18A 2JGAA 3MCRA 5EE9A 3ZD8A 5DDMA 4E0DA 3BQ0A 1UETA 1O08A 5ALPA 4EYHB 3I28A 2PKEA 2ZIXB 4NLCA 4OJ6A 3NTUA 2G07A 1Z1BA 4PGXA 2M9NA 4Y2SA 3H8JA 3SEIA 4DWIA 2A1AA 5J2HA 3UPSA 1A77A 3F5AA 1XSPA 1VJ7A 4U7CA 2LPEA 4KLUA 1BPBA 2KICA 4OCZA 2A19A 1D8LA 4AP9A 5BOMA 2IOHA 4E80A 1QSSA 2IMWP 1A0PA 4K97A 1ZD4A 2ZG6A 2F8KA 4RWPA 3FAHA 4QZHA 1Z19A 2YX8A 2VA3A 5KFNA 2OM6A 4ACOA 5J2KA 2YMMA 3EPIA 1NO5A 5AKLA 2KOBA 2W9CA 4DFKA 4JWNA 3QUTA 5AK5A 5KFEA 4CF4A 1QLNA 2PFNA 3AEVA 3HJEA 2LM4A 2DGZA 1QQ7A 5JRTA 4UB2A 3FDSA 3ZDCA 3M9OB 2W7OA 1OU5A 4ELVA 5DG8A 3MBYA 2W9BB 5HR6A 3HRDD 1TAMA 8ICTA 2C22A 2GA9D 2VANA 1SKRA 1PK3A 1QTMA 5EE0A 2R8HA 1KNYA 2ESEA 4DQQA 2ISPA 3PY8A 9ICPA 2BCVA 3PX6A 2DR8A 1V85A 4Y2YA 1ZQGA 3UMBA 2BE3A 3A0HU 4DL5A 1RXWA 4DOBA 2W9AA 5ALGA 5KFGA 2XVTA 4F4WA 5KFCA 2K4PA 9ICNA 4NKUA 4B9MA 1X9MA 4CRXA 1KFDA 2V4QA 2BBHA 2QB0A 5DQIA 4O67A 4Q8EA 5IIMA 3H7IA 3VC8A 2M0NA 3QU2A 2RDIA 2HHTA 9ICSA 2KEYA 8ICIA 2W8LA 1ZYQA 2FMQA 8ICMA 3RB3A 4I2EA 4IQUA 1ZQLA 2AGPA 4KLSA 5AI4A 4RQNA 3PW5A 3RH5A 5KG3A 3PZPA 4YFKA 2F1JA 4Z6EA 4X4UA 4MFFA 3OJUA 1T8EA 4RQMA 3RBDA 2PBEA 5TISU 2JEJA 3GIIA 5EE3A 2HBJA 3UPQA 2BR0A 2GAFD 1ZQRA 2I5HA 4QZ9A 1RYSA 4O68A 3IRUA 5AM3A 2GLEA 2LYHA 2ZH4A 3PNCA 4U6PA 3S6JA 4Y2QA 4E7XA 3G6YA 3TI0A 5TZVA 4P0PA 4RNNA 5IIIA 1Q78A 3M8RA 4G9BA 1F0MA 2MAXA 1HIWA 4DL4A 3ZD9A 9ICWA 3NWIA 4YMMA 4KITB 5ALJA 3HKZF 9ICCA 3QXGA 2HHWA 3DDHA 4NLKA 4M9LA 4QIWC 4OAHA 5DECA 2K8CB 2UVRA 1A6SA 1QH9A 1PVQA 2HHXA 1WUDA 2DR5A 9ICLA 2WB1C 3ZDBA 2K60A 1ZQMA 4JV2A 2YY6A 2KTQA 4ELUA 4ED3A 3MFHA 4WQLA 2KE7A 4PHEA 1JAJA 1SV0A 3T79A 4P0QB 4JV0A 3I1YA 2AQ4A 4PHDA 4C4TA 3AN1A 2KZZA 1BPEA 3T5LA 1L7NA 2KD1A 3AM9A 2ZJAA 1K1SA 3QU4A 4FFDA 2W04A 4M5DA 2B51A 3L3FX 4XRHA 5AI6A 4QZBA 1BNOA 1KL9A 4X4OA 2PI5A 2AHOB 1RPLA 4LEYA 2HOIA 3CP8A 2KHVA 1QQ5A 3NVVA 2BZFA 4EP7A 1D8YA 4OD0A 8ICOA 2KIVA 4F5PA 3UQ2A 4K4HA 1UPHA 4O3PA 4GIBA 4M6WB 2F77X 3LDAA 4ZOHC 3C23A 3G6XA 7ICQA 3D6JA 4WC0A 4IQWA 3PW0A 3M9NB 4PGQA 4UB6U 4IG8A 3Q8LA 3O0FA 1ZQKA 4F5RA 1ZQFA 4Y2RA 2JR5A 5KG7A 1HUOA 2LI6A 3RBEA 7ICGA 5J0RA 3TACB 2NV3A 2YMPA 3QU7A 5HREA 3WU2U 1U48A 7ICSA 8ICQA 5D61A 5KFYA 1SZHA 1NZBA 5KFIA 4QZCA 1F5AA 5J8YC 3H38A 3H0LB 3PSPA 4NXVA 4MEXA 4DOAA 2KIWA 3T5KA 3V6HA 1IV8A 3QUBA 3LVVA 1MC8A 3BQ7A 2ZXHA 4KLHA 5HRIA 3BQTA 3Q8SB 4C8LA 3F2DA 2ZUDA 3TFSA 1TK5A 4FHVA 3WKDA 1L3UA 5ALVA 1UA0A 5AKYA 5HRKA 3D2SA 1SGGA 1BPXA 4PHAA 2ZJ8A 2KJ5A 3RB4A 1R89A 3N4MB 3JCFA 4I27A 1Z4OA 9ICVA 1TFYA 1GPJA 5J0YA 3PO4A 1ZQPA 2NRVA 2AQ0A 2BHNA 3CK6A 5DDYA 4NV0A 2AGOA 2WHEA 5J0XA 5DBAA 4PL1A 7ICIA 4ECTA 4YG2A 2VA8A 4R66A 1NJZA 1BGXT 1MSWD 8ICVA 1L3TA 4LJXA 3TQ1A 3OVBA 3GIMA 4OAIZ 2HN1A 5K4LA 4IRCA 4LEVA 1FFUA 3JPSA 4ECYA 4IR9A 4Y2TA 2W3SA 4F2SA 2HOQA 5ALZA 4X4SA 3ICXA 4DSKA 1J2NA 3ED5A 4X0AA 2IBKA 4O5CA 3C5GA 8ICSA 3OJSA 4ED0A 8ICBA 2KHQA 3NRWA 3H8WA 2JEGA 3ZDDA 1RQNA 5J2EA 1SL1A 2QARB 4K4IA 3OSNA 2E5SA 1AROP 2F8LA 2WF7A 3HWTA 4UAWA 4UB5A 2OCEA 4J9QA 1PX5A 3K1RB 5CP2A 4M9JA 1KTQA 1NKCA 5KTQA 1RYRA 5GTHU 1MQ3A 2IUBA 3WK7A 5L9XA 4Q8FA 1ZQTA 1SWWA 5B66U 3RRHA 3KFUF 4CGZA 3B9JA 4MF2A 4M9GA 3EF2A 4I2IA 5AK6A 2E1FA 3QE9Y 4TUPA 1PZNA 3V6JA 2KP7A 4P0QA 5J2CA 4N7RA 2F76X 5KFKA 2I9GA 2PMZC 3EYZA 4GC7A 3LK9A 3IV6A 4J9KA 1YZ6A 4FBUA 4BDPA 4DQSA 3ETLA 1Z3EB 3ISBA 3RJHA 3AUOA 5D63A 3RJJA 2AH5A 2ZH7A 3QU9A 2D3DA 3OUYB 2P66A 2DL0A 4EBKA 4O3MA 4P4MA 1L3VA 5CRXA 1FO4A 3F2BA 3H39A 2GO7A 2EAOA 2ZTCA 4I2DA 3CYMA 5J2JA 2CPRA 2W03A 2GH1A 4M6WA 4JUZA 2A1JB 5L1KA 4JK1A 4NJ8A 1RZTA 4YN4A 3V72A 2P6RA 2NRTA 2JZBB 2I6XA 4RUCA 1ZQEA 1PUZA 4F4XA 3AQLA 4DLGA 2ZH3A 3ZI4A 4LEZA 2ZH9A 4KLDA 1DK2A 3T5HA 2ZH2A 4QNLA 2P6UA 3NVYA 4PGYA 4US8A 5CA7A 2D8CA 8ICKA 4FBTA 1ZD3A 4TURA 4GXIA 3E2EA 3BS5B 1R8AA 4CCHA 5KFFA 4WQKA 3ISCA 4ELTA 2E8PA 4C8NA 5HHIA 4RQ8A 2LMRA 1T3QA 5HRLA 3UMGA 2AU0A 4X4PA 4QZIA 4FZLA 4M9HA 2W3RA 2ZIUA 1ZQQA 3RR7A 4NL9C 2AGQA 5J2AA 2BQRA 4AT9B 3OVAA 4B6JA 2XI9A 4MFCA 1NK0A 2XGQA 2QB1A 4K4GA 2UVWA 1HJPA 2BPGA 3M7DA 3TARA 5KFXA 3H8SA 1ZJMA 3NUQA 8ICLA 4QWCA 1S9FA 2UVVA 3HJ4A 1WYGA 4NLNA 3UXPA 5AI9A 4J03A 1RYUA 1ZRMA 4S3NA 3GQCA 3Q8KA 1JXEA 3IHQB 4NXUA 5DLFA 5IILA 4JB3A 2W8KA 3MR5A 9ICBA 4C4RA 3ONNA 5ALDA 4UB4A 5DG7A 1VLBA 4UASA 2ISOA 3V7LA 5AM2A 1KQQA 2DFLA 3TADA 1DGSA 2P35A 2ZXIA 2PFQA 1TVAA 3RJEA 7ICNA 4US9A 4BXOB 2RLTA 4EZ9A 2C2EA 7ICPA 1Q8KA 4F5OA 4O6AA 4F92B 4YXMA 3HP6A 1RQLA 3WFSC 5HP4A 4EENA 1Z4NA 1SL2A 5AK3A 4RNMA 4FHWA 1Q3VA 4DSEA 4FH3A 2E8NA 5CR0A 1ZQHA 4EZ6A 2Y0SC 2Y1JA 1L3SA 9ICUA 4P4OA 9ICAA 2BQUA 9ICEA 8ICCA 3KKAC 2QARA 4ATBB 3HIYA 1N61A 5HR7A 3RJIA 3ISDA 1NI3A 3RH6A 4UQGA 1ZQYA 4NLZA 5J2FA 2W54A 1OUQA 2PFPA 2Y9UA 3MFIA 1ZQZA 1COOA 2ZHAA 4OJOA 5F2VO 5D4BA 4YXJA 4X0BA 4DS4A 3NS1A 1QSLA 4WJ3B 3MDCA 4IS7A 4I2FA 5G5GA 1JIHA 4RQ6A 8ICZA 4NWIA 5KFHA 3ZDEA 4EEKA 3H0RB 1NJXA 3DEEA 1L8LA 9ICMA 4Y2UA 2H3QA 3QYPA 3THVA 1NNLA 4QIWF 3QNMA 5KL8B 4EX6A 1SV4A 5KT6A 3JPOA 3OWGA 4EBDA 1XS9D 5HMLA 2HW3A 1NK9A 9ICIA 1V38A 4J9OA 4EV6A 2WB1F 4WC2A 4C80A 3G6VA 3PW7A 2FLLA 2IHOA 4RQ0A 3NKUA 4AT8A 5DQGA 4B9VA 2KSOB 2XICA 4KB6A 1ZQXA 1QSYA 3QZ8A 1URJA 2VJ5A 3JPQA 4EYIB 4DQRA 5JU5A 3AQFA 2WF6A 3MGHA 5DEDA 3EWAA 2BPCA 3GU3A 3MR2A 5KFRA 3C29A 3N97B 4Q43A 5D49A 1COKA 3HJ1A 1XO1A 3KHRA 3TFRA 1ZXIA 4YVZA 1S5LU 3CNHA 3BZKA 2MUTA 2KK0A 4R63A 3NYBA 3AQEA 3RJKA 4K96A 1ZD5A 2W55A 1UA1A 4JLXA 1J2MA 4MF8A 1XNSA 4KX3A 4WC1A 5EWFA 1S0VA 2FCLA 2B6GA 3BS5A 4O3RA 3AMZA 4UD4A 3H4DA 1SZPA 4XA5A 5AI0A 2LHTA 2C28A 1X6IA 1VFGA 4M04A 3EUB2 2XCAA 2EWRA 2YMLA 5HNKA 2JXJA 3PSIA 2L5YA 3KHLA 1C20A 4AT9A 4KLOA 2WF8A 4I2JA 5T14A 4KLEA 4YR0A 1PVRA 3PX0A 1S0MA 4KLJA 4F91B 2ZTEA 2F44A 2W11A 2B0CA 3C21A 1JMSA 1S0OA 1ZQOA 2M2TA 4NL9A 5KFPA 2O1PA 2XO7A 1ZQIA 2RHFA 2KNJA 3OHBA 5DBBA 3SI8A 4BWMA 3NVZA 2ZUBA 5EWGA 5J0TA 4KN4A 3TKAA 1L6NA 4O69A 3SMVA 2R8IA 1ZQAA 8ICRA 4KN7A 2ZIXA 2BBJA 3H37A 4WC3A 5IINA 4ED7A 3GZFA 5KT4A 4BXOA 9ICXA 3MR6A 3C66A 5KAFU 3PHZA 3IDWA 3WK4A 5ALIA 4C7YA 1X6JA 5ALSA 2DPIA 2H5XA 3SZ2A 2RP5A 1UEUA 5CEHA 5ALMA 1ZQNA 5KFWA 2ZH6A 9ICTA 3RB6A 4ZH4A 2N1RA 4PL2A 5AKGA 1M6YA 5CFTA 4M2YA 1KEJA 3MR3A 4YCXA 3SD7A 4QWBA 2G08A 4GC6A 4R65A 4ATBA 3BQ1A 4UB3A 4JWMA 1O03A 2R18A 1B22A 1T4GA 3Q8MA 4RQ5A 9ICQA 5KFUA 4I2GA 3TANA 1XWLA 2IOFA 4Y2PA 1WWUA 1UT8A 5AM1A 2EAMA 1P7DA 1IM4A 2ID1A 2G09A 3ALRA 8ICEA 1OW5A 2IHMA 3FYHA 4EEYA 5AKJA 1ZETA 1S10A 2K4EA 4TUSA 4F71A 1JRPA 4Q45A 2W9BA 2GWSA 1T3NA 8ICPA 4OJPA 1KFSA 1JN3A 4LT6A 3WFQE 3FC4A 4X4QA 5EWEA 1H38A 5G5HA 2JHDA 1ZJNA 2EDUA 3KZXA 4M0AA 1YZ7A 1XC9A 1MQ2A 7ICKA 1CUKA 1JALA 2OYYA 2KSOA 1JI7A 3MGIA 4RPXA 1FEZA 3D2NA 2DRAA 4ECZA 2R8JA 2KKVA 2BDPA 1KRPA 4UAZA 7ICHA 2PMZF 3UM9A 3Q8RB 1NJYA 4Z6DA 3BS7A 2KVSA 2KMDA 9ICRA 4QWEA 2HHQA 4RWQA 4K98A 3JPRA 1SKWA 1MIVA 3IG8A 2HOFA 3NRZA 2BPFA 3JZ0A 2Q4TA 2H3FA 5CFUA 9ICKA 4TUQA 3K1ZA 4JMUA 5EE1A 5KAIU 5J2GA 2ZJ5A 1UQVA 3L4PA 5GTIU 1BPDA 5AI5A 2F2AB 2Y1IA 4O3SA 1SKSA 5IIJA 4WC7A 4IL6U 4UAYA 1SIJA 5KG5A 4RUAA 3C1ZA 4UW9A 3PO5A 2O5AA 4DFJA 4C0ZA 4JV1A 4P4PA 2NRXA 2MU2A 4YD2A 3GV8B 2XC9A 5ALYA 3PMNA 5L1IA 5EOZA 5DG9A 4RQ7A 3UQ0A 2DVIA 1ZQCA 4UAVA 2KN7A 4OO1J 5KFMA 4ICAA 3RJFA 4P2HA 4YR2A 4YMOA 4HX0A 1B0XA 7ICUA 3QUQA 3GV5B 2ZUCA 3RF9A 4ED2A 1L7OA 1NKBA 3K7DA 2H3VA 1R8BA 2XGPA 3NGDA 2VJ4A 3QEAZ 2OH2A 4WBZA 5J2IA 3B0XA 4I2BA 5DLGA 1LB2B 3N28A 4DL7A 4FHYA 5AHXA 1CRXA 2OEHA 2JRZA 5B3QA 1NZPA 4KLQA 2ODGA 3KZIU 1F44A 3N7RC 1DXSA 3VCBA 5E79U 4C8OA 1TFWA 4KLTA 2XY5A 1RM6C 4USAA 5CB1A 5BPCA 2XCPA 4QZDA 3RB0A 3QZ7A 3LWLA 1UT5A 2I1QA 2DF4B 4DSLA 4TQRA 4ECSA 8ICHA 5ALXA 1QCKA 1ZOLA 3GDXA 3UMCA 3ERCC 2K8BB 1N2XA 1N62A 1RG6A 8ICUA 2ZTDA 4ECWA 2LYAA 3GIKA 4HYKA 3QU5A 2VIXA 5KFDA 4QZ8A 4DSJA 3SENA 4KTQA 5ALQA 5ALWA 2HVHA 4CDGA 5BOLA 2OXOA 2C2RA 4F4YA 2OHFA 7ICMA 4NM2A 3MC1A 3H3AA 2J6SA 2QLTA 3U26A 9ICOA 2B21A 3SQIA 5J0OA 2CRXA 2B56A 5KFAA 5CHEA 3LVWA 4ECUA 4B9TA 2DPJA 3OHAA 1EXNA 4YMNA 4B9SA 3WFOA 2ZH8A 1V9PA 2D6FC 4NXXA 4FH5A 2V9WA 4KMOB 4NM1A 2Y0SF 2J6UA 2DWQA 2BCRA 4R8UB 3WKCA 5CJ7A 2PXIA 5AIBA 3WFPA 3ETRA 3PW2A 2QB0B 3WKAA 3TAQA 4DFDA 1L7MA 2DR7A 5J0SA 5JTIA 1ZQSA 5ALEA 1HEKA 1KN5A 4DL2A 4IQVA 4M47A 3N7PD 5AM4A 5HRHA 8ICYA 4DL6A 4PJ0U 4RZRA 4UD5A 3SAGA 4O5KA 2WAQC 5ALOA 1KBUA 4RT3A 1F5SA 1PVPA 4R64A 3NVOA 1U49A 3LQCB 4EBEA 4CNQA 3BQ2A 4UBCA 4QZEA 5L1JA 2YTUA 5HRGA 3RAQA 2JMGA 2Q0ZX 4J9NA 1CEZA 3KHGA 3GV7B 2Z7JA 1JX4A 1S0NA 4X4VA 2DRBA 4FO6A 2HCFA 5J8YA 3JPTA 2ASLA 2ALZA 1KFTA 5KG6A 3PR4A 1CI4A 3C2LA 3H8MA 4F4KA 1NOMA 2E1EA 5J0UA 5AM0A 4KLFA 7ICEA 7ICVA 5KT2A 2Y9TA 2BCUA 5J0QA 5DGBA 4P0PB 4K9AA 2FI1A 5J2BA 3C1YA 5KFOA 5C0YA 1B43A 2NO5A 2E8OA 3CW2C 1MA7A 4QZAA 1TKDA 5J0PA 3T3FA 2E8MA 7ICFA 5KFLA 5AK4A 2KVCA 1N60A 4DFMA 4LVSA 4DF4A
chains in the Genus database with same CATH topology
4J9SA 4RPYA 4UB1A 1N56A 5DB9A 3H4DA 1SZPA 4XA5A 2FMSA 2HVIA 4UD4A 5KG7A 9ICPA 1HUOA 2C28A 3RBEA 1NK7A 1VFGA 2KFZA 7ICGA 3V7JA 4M04A 5J0RA 3EPGA 4I2CA 4DQIA 1YLQA 5KG1A 4I2AA 2XCAA 2FLPA 3MABA 5HREA 4F93B 4LZDA 3GFKB 5JUMA 4RNOA 5HNKA 1WCLA 1U48A 4DSIA 7ICSA 8ICQA 5KFYA 5CWRA 5DB7A 3KHHA 5KFIA 4QZCA 1F5AA 3AU2A 4C8MA 2ASJA 3H38A 1ZQBA 4O5EA 3KHLA 4AT9A 5KFVA 4KLOA 4I2JA 4MEXA 4DOAA 4EBCA 7ICLA 3T5KA 4KLEA 3V6HA 1XU4A 2OWOA 4YR0A 1MC8A 3QEBZ 1D9DA 4KLHA 4ECVA 5C5JA 4F5QA 3BQTA 3PX0A 1S0MA 4F91B 4KLJA 2M2UA 4QW8A 3Q8SB 4NKTA 4C8LA 2KFNA 1K1QA 2ZTEA 4AT8B 3RAXA 2ZUDA 4J9LA 4BWJA 3C21A 3TFSA 3MDAA 1JMSA 2FPMA 3AU6A 1TK5A 1S0OA 1ZQOA 5KFPA 4I2HA 4O0IA 2M2TA 2O1PA 4FHVA 2XO7A 5HMMA 1L3UA 1ZQIA 5D46A 1UA0A 3OHBA 7ICRA 5DBBA 3RH4A 4QWDA 3SI8A 4BWMA 1FA0A 4WCWA 2ZUBA 3B0YA 1TK8A 5HRKA 4I29A 5EWGA 4RQ2A 3OVSA 5J0TA 4KN4A 3OSPA 1BPXA 5KG4A 4PHAA 2ZJ8A 4AT7B 1ZQVA 3RB4A 4QZFA 1HUZA 1NK6A 3BDPA 4C8KA 1R89A 3N4MB 2R8IA 1ZQAA 4I27A 4F50A 8ICRA 1U9LA 2NRWA 9ICVA 4KN7A 1TFYA 3OV7A 5KT3A 5J0YA 4PPXA 3H37A 4WC3A 3PO4A 4FS2A 5IINA 2NRVA 1ZQPA 3RTVA 4DFPA 1LV5A 4ED7A 4NY8A 2AQ0A 5KT4A 4BXOA 2NRKA 4J9PA 2BHNA 2MUTB 4TQSA 5DDYA 3MR6A 4YP3A 4J9RA 4FS1A 9ICXA 3C66A 4QWAA 4DO9A 2AGOA 4MFAA 1BPZA 5J0XA 5J0WA 5DBAA 2PFOA 5F9LA 4X4RA 1T7PA 2DPIA 4F2RA 4ECTA 2ASDA 7ICIA 2H5XA 8ICGA 4YG2A 3OUYA 3SZ2A 4X4TA 2VA8A 3BJYA 4R66A 4GXJA 1NJZA 1UEUA 1BGXT 1MSWD 7ICTA 8ICVA 1L3TA 2ATLA 4O3QA 5KFWA 1ZQNA 1TAUA 9ICTA 3PVXA 3TQ1A 2ZH6A 3JPNA 3GIMA 3OVBA 3M8SA 2V4RA 3RB6A 7ICJA 4ZH4A 4IRCA 2JEIA 3AQNA 3JPSA 3UXNA 4RWNA 4ECYA 4IR9A 2HHUA 4M2YA 1KEJA 3MR3A 1NK5A 4YCXA 4QWBA 4RQ3A 5DQHA 4GC6A 4R65A 3PW4A 4DQPA 4F2SA 4ATBA 4X4SA 4RU9A 3BQ1A 4DSKA 4UB3A 4JWMA 4GLXA 2A1JA 4QW9A 4KLIA 1B22A 1T4GA 3Q8MA 4RQ5A 9ICQA 5HRBA 2M2WA 1BPYA 5KFUA 3KTQA 4X0AA 2IBKA 4I2GA 4O5CA 3C5GA 8ICSA 2JZBA 3OJSA 5KFQA 5DBCA 1X9WA 3TANA 4ED0A 8ICBA 1XWLA 1X9SA 2F1HA 3H8WA 2JEGA 4R8UA 1UT8A 3V7KA 2FPLA 3ZDDA 4PH5A 1IM4A 5J2EA 2ID1A 1SL1A 1TFRA 5KFBA 8ICEA 4K4IA 4O9MA 2Q66A 3OSNA 4NLGA 2IHMA 3FYHA 4EEYA 1ZETA 1AROP 5KFJA 3L9DA 1S10A 1ZQWA 3HWTA 4TUSA 4UAWA 3V6KA 4Q45A 4UB5A 1KDHA 2UVUA 2W9BA 4J9QA 4Z6FA 4RQ1A 4DS5A 1T3NA 2GWSA 1PX5A 2HHPA 5CP2A 4M9JA 1KTQA 1NKCA 3SV3A 4DOCA 8ICXA 5KTQA 1Z00B 8ICPA 4GXKA 1RYRA 3JYYA 2W9MA 1KFSA 1MQ3A 1JN3A 4M9NA 4LT6A 8ICFA 5L9XA 4Q8FA 1ZQTA 3RRHA 3HX0A 3WFQE 4MF2A 4X4QA 2ZHBA 4M9GA 5EWEA 4I2IA 5IIKA 2IA6A 3QE9Y 4TUPA 1H38A 4B9LA 2KZ3A 4KLGA 3AQKA 1PZNA 4IRKA 3PMLA 3HT3A 3C18A 3V6JA 2KP7A 5DB8A 3ZD8A 5DDMA 5J2CA 3BQ0A 2XY7A 1ZJNA 5KFKA 2I9GA 4E0DA 8ICAA 1UETA 5DB6A 4EYHB 3EYZA 4GC7A 3LK9A 4X5VA 9ICWA 5HRDA 4M0AA 8ICWA 1XC9A 1MQ2A 3NTUA 7ICKA 1CUKA 4J9KA 3PV8A 5HR9A 4PGXA 3MGIA 4FBUA 2M9NA 4FHXA 1N48A 4RPXA 4BDPA 4DQSA 1BNPA 3ETLA 3H40A 2DRAA 1Z3EB 3ISBA 3H8JA 4ECZA 4DWIA 3RJHA 2R8JA 5J2HA 3AUOA 2BDPA 1KRPA 3UPSA 4UAZA 1A77A 1XSPA 1VJ7A 3RJJA 7ICHA 2ZH7A 4RQ4A 3Q8RB 1NJYA 2FLNA 4KLUA 5F9NA 4Z6DA 1BPBA 3GILA 3OUYB 2P66A 9ICRA 4RT2A 4QWEA 2HHQA 1D8LA 2FPKA 4RWQA 5BOMA 3JPRA 1SKWA 4EBKA 4YQWA 1MIVA 4E80A 4P4MA 1L3VA 1QSSA 5HRIA 2IMWP 2BPFA 3H39A 3JZ0A 2ZTCA 4I2DA 1KSPA 5J2JA 2IHNA 4RWPA 9ICKA 4QZHA 4TUQA 2VA3A 5KFNA 5J2GA 4M6WA 1TV9A 4JUZA 4IRDA 2A1JB 5J2KA 5L1KA 4JK1A 3EPIA 1RZTA 4YN4A 3PX4A 1NO5A 3UXOA 2ZJ5A 3V72A 1RXVA 3SV4A 2P6RA 1S76D 2W9CA 4DFKA 1BPDA 5KFEA 4JWNA 2Y1IA 2BKEA 2NRTA 4O3SA 1QLNA 1SKSA 2JZBB 1TK0A 9ICHA 5IIJA 3K75D 4RUCA 1ZQEA 3Q8QB 2PFNA 4F4XA 4WC7A 3AQLA 2AJQA 4UAYA 4DLGA 2ZH3A 5KG5A 2KZMA 4RUAA 3PR5B 3C1ZA 1BVSA 4UB2A 2ZH9A 1ZQUA 3FDSA 3ZDCA 4KLDA 3PO5A 1DK2A 2O5AA 4DFJA 2ZH5A 3M9OB 3T5HA 2ZH2A 1NJWA 4JV1A 1Y88A 2P6UA 4P4PA 2NRXA 1OU5A 4ELVA 5DG8A 4PGYA 4YD2A 5CA7A 3GV8B 3MBYA 2W9BB 1DK3A 8ICNA 8ICTA 3AQMA 2XC9A 5L1LA 8ICKA 3PMNA 2C22A 4FBTA 4TURA 3GIJA 5L1IA 2VANA 1SKRA 5EOZA 5DG9A 1QTMA 4RQ7A 4GXIA 3E2EA 2R8HA 3UQ0A 1MIYA 2DVIA 1ZQCA 1KNYA 2ISPA 2KN7A 4DQQA 3PY8A 5KFMA 3C5FA 2BCVA 4CCHA 5KFFA 3RJFA 3PX6A 4O3NA 4YR2A 3ISCA 4P2HA 2DR8A 4YMOA 2WTFA 1ZQGA 7ICUA 2BE3A 4DL5A 4XUSA 1RXWA 2F1IA 3HW8A 1X2IA 4C8NA 2W9AA 5HHIA 3GV5B 4RQ8A 4DOBA 5J29A 2ZUCA 5KFGA 3HPOA 4ED2A 5DKWA 5HRLA 3RRGA 4F4WA 1NKBA 1R8AA 2AU0A 9ICFA 4X4PA 1DOQA 4QZIA 3OGUA 4J9MA 1R8BA 4M9HA 4RWOA 2XGPA 8ICJA 3NGDA 5KFCA 1ZQQA 3RR7A 3QEAZ 2AGQA 5J2AA 2BQRA 4WBZA 3IM1A 5J2IA 9ICNA 3B0XA 4I2BA 5DLGA 3C2KA 1LB2B 4NKUA 4B9MA 1X9MA 4AT9B 3OVAA 4DL7A 4FHYA 1KFDA 4KLMA 2V4QA 4MFCA 1NK0A 3T5JA 2XGQA 4AT7A 5DQIA 4K4GA 2UVWA 5IIMA 4KLQA 4Q8EA 1NZPA 1HJPA 3H7IA 2BPGA 3TARA 1SL0A 5KFXA 4ED6A 4ELTA 3H8SA 2RDIA 1ZJMA 2RFFA 2HHTA 8ICLA 4QWCA 4F8RA 9ICSA 4WBYA 1S9FA 2UVVA 3HJ4A 5HRFA 4NLNA 8ICIA 2W8LA 3UXPA 4XQ7A 4I28A 1ZYQA 4ED8A 2FMQA 3WFRE 8ICMA 4C8OA 3RB3A 3LWMA 4S3NA 1TFWA 5J2DA 3EW9A 4IQUA 3GQCA 1ZQLA 3RR8A 2AGPA 2XY5A 4I2EA 4KLSA 4KLTA 2M2VA 3Q8KA 5CB1A 1JXEA 5BPCA 4EBJA 3IHQB 2XCPA 4QZDA 5DLFA 3QZ7A 3PW5A 3RB0A 5IILA 2W8KA 3LWLA 1UT5A 3RH5A 3MR5A 9ICBA 5KG3A 4UB4A 4YFKA 2F1JA 4Z6EA 5DG7A 5KT7A 2HHSA 2ZH8A 4X4UA 4X4NA 4O3OA 4MFFA 2ISOA 3V7LA 2I1QA 3OJUA 2DFLA 1T8EA 2HHVA 1DGSA 4DSLA 3RBDA 4TQRA 4ECSA 8ICHA 3GDXA 5KG0A 2PFQA 2JEJA 2PBEA 3TAPA 4ECQA 3GIIA 1TVAA 1JXLA 1ZQDA 3RJEA 7ICNA 4BXOB 7ICPA 4EZ9A 2C2EA 4F5OA 3UPQA 4F92B 1L5UA 8ICUA 2BR0A 4YXMA 3HP6A 1NK4A 3WFSC 5KFSA 1ZQRA 2ZTDA 4ECWA 3GIKA 4HYKA 5HP4A 1TAQA 1U45A 4QZ9A 5KFDA 4QZ8A 1RYSA 1XSNA 4DSJA 1SL2A 4KTQA 2HVHA 1A76A 1WOTA 5BOLA 2BCSA 2LYHA 4RNMA 4FHWA 3ORYA 2C2RA 4DSEA 1V4AA 3PNCA 4F4YA 4FH3A 2ZH4A 4DLEA 7ICMA 2R8KA 4NM2A 5CR0A 1ZQHA 1S97A 4EZ6A 4E7XA 2Y1JA 1L3SA 9ICUA 4P4OA 3G6YA 4DL3A 3TI0A 2J6SA 9ICAA 3H3AA 9ICOA 2BQUA 5TZVA 2B21A 9ICEA 4RNNA 2PI4A 8ICCA 5IIIA 1R8CA 5J0OA 3HIYA 4ATBB 1Q78A 5KFAA 3ZDAA 4RPZA 3M8RA 2MAXA 3M9MB 4ECUA 3ZD9A 4DL4A 4B9TA 2NRZA 3ISDA 3OHAA 3RJIA 1EXNA 4YMNA 3Q8PB 2DPJA 2FMPA 4B9SA 1V9PA 4YMMA 4KITB 5KT5A 3RH6A 3WFOA 4UQGA 1ZQYA 9ICCA 4FH5A 2V9WA 4NLZA 3C2MA 5J2FA 1IXRA 4ECRA 5KFTA 2J6TA 2PFPA 4NM1A 2HHWA 1Z00A 2J6UA 3MFIA 1ZQZA 4R8UB 2BCRA 1COOA 4NLKA 4DF8A 4M9LA 2ZHAA 4F5NA 4IR1A 5CJ7A 2XY6A 1U4BA 9ICJA 4QZGA 5D4BA 5DECA 5F2VO 2PXIA 2UVRA 4YXJA 4X0BA 3WFPA 4LZGA 4DS4A 1MIWA 9ICGA 3RJGA 3JPPA 3PW2A 4KMUA 1QSLA 2HHXA 3TAQA 3MDCA 4I2FA 1JIHA 3EZ5A 4RQ6A 2RDJA 8ICZA 5KFHA 4E8FA 2DR5A 3ZDEA 4WC6A 2BGWA 9ICLA 2DR7A 5J0SA 1ZQSA 1NJXA 2DR9A 2C2DA 1NK8A 3ZDBA 4DL2A 1U47A 9ICMA 1S77D 1C7YA 4IQVA 5CHGA 1ZQMA 4JV2A 4M47A 3THVA 5HRHA 8ICYA 4DL6A 4RZRA 4UD5A 2KTQA 1NKEA 2ZH1A 4ELUA 4O5KA 4ED3A 3MFHA 5KT6A 4G3IA 3JPOA 4RT3A 4EBDA 1XS9D 4R64A 5HMLA 4PHEA 1U49A 2HW3A 1NK9A 3LQCB 9ICIA 4EBEA 4WC4A 3BQ2A 1JAJA 4UBCA 4QZEA 5L1JA 4J9OA 2BCQA 4WC2A 3G6VA 3PW7A 1WCNA 4JV0A 2AQ4A 4PHDA 2VA2A 5HRGA 3RAQA 2FLLA 2JEFA 4YD1A 2BQ3A 2KZZA 2Q0ZX 4J9NA 4RQ0A 4DSFA 5KFZA 5DQGA 4B9VA 1BPEA 4AT8A 3T5LA 5HHHA 1CEZA 3KHGA 3GV7B 4YR3A 1JX4A 1S0NA 4X4VA 2ZJAA 2DRBA 1D9FA 4FO6A 1K1SA 1ZQXA 4F4ZA 3JPTA 4PHPA 2ASLA 4XQ8A 1JQRA 2ALZA 1QSYA 3QZ8A 4ED1A 3JPQA 1KFTA 4EYIB 7ICOA 4DQRA 4M5DA 5KG6A 4XRHA 3PR4A 2R8GA 1Q79A 3C2LA 3MGHA 4QZBA 5DEDA 3EWAA 1BNOA 4F4KA 1NOMA 2BPCA 4FHPA 5J0UA 4KLFA 4X4OA 2PI5A 7ICEA 3SYZA 7ICVA 4WC5A 3MR2A 5KFRA 1RPLA 4UBBA 5KT2A 3N97B 4Q43A 5D49A 1XSLA 4F3OA 4B9UA 1XO1A 3KHRA 1D8YA 3K4GA 4BGDA 3TFRA 2BCUA 8ICOA 3HJ1A 4EP7A 5HC9A 4YVZA 4F5PA 5J0QA 4NXZA 3UQ2A 5DGBA 4K4HA 5IIOA 4IQTA 4O3PA 5J2BA 3C1YA 5DGAA 4M6WB 2MUTA 3LDAA 4R63A 4MEYA 4KLLA 5KFOA 3NYBA 3C23A 1B43A 3G6XA 4B9NA 4ECXA 2W9CB 3RJKA 7ICQA 4WC0A 4QZAA 1KLNA 4IQWA 3H4BA 1UA1A 4MF8A 5J0PA 1TKDA 3T3FA 3PW0A 3M9NB 1ZQJA 5KG2A 5EWFA 4PGQA 4WC1A 4DEZA 1S0VA 4Z6CA 4IG8A 7ICFA 3Q8LA 1ZQKA 5KFLA 4F5RA 1ZQFA 4O3RA 4DFMA 4LVSA 4DF4A 1UEVA 4Q44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J9S A;  4RPY A;  4UB1 A;  1N56 A;  5DB9 A;  3H4D A;  1SZP A;  4XA5 A;  2FMS A;  2HVI A;  4UD4 A;  5KG7 A;  9ICP A;  1HUO A;  2C28 A;  3RBE A;  1NK7 A;  1VFG A;  2KFZ A;  7ICG A;  3V7J A;  4M04 A;  5J0R A;  3EPG A;  4I2C A;  4DQI A;  1YLQ A;  5KG1 A;  4I2A A;  2XCA A;  2FLP A;  3MAB A;  5HRE A;  4F93 B;  4LZD A;  3GFK B;  5JUM A;  4RNO A;  5HNK A;  1WCL A;  1U48 A;  4DSI A;  7ICS A;  8ICQ A;  5KFY A;  5CWR A;  5DB7 A;  3KHH A;  5KFI A;  4QZC A;  1F5A A;  3AU2 A;  4C8M A;  2ASJ A;  3H38 A;  1ZQB A;  4O5E A;  3KHL A;  4AT9 A;  5KFV A;  4KLO A;  4I2J A;  4MEX A;  4DOA A;  4EBC A;  7ICL A;  3T5K A;  4KLE A;  3V6H A;  1XU4 A;  2OWO A;  4YR0 A;  1MC8 A;  3QEB Z;  1D9D A;  4KLH A;  4ECV A;  5C5J A;  4F5Q A;  3BQT A;  3PX0 A;  1S0M A;  4F91 B;  4KLJ A;  2M2U A;  4QW8 A;  3Q8S B;  4NKT A;  4C8L A;  2KFN A;  1K1Q A;  2ZTE A;  4AT8 B;  3RAX A;  2ZUD A;  4J9L A;  4BWJ A;  3C21 A;  3TFS A;  3MDA A;  1JMS A;  2FPM A;  3AU6 A;  1TK5 A;  1S0O A;  1ZQO A;  5KFP A;  4I2H A;  4O0I A;  2M2T A;  2O1P A;  4FHV A;  2XO7 A;  5HMM A;  1L3U A;  1ZQI A;  5D46 A;  1UA0 A;  3OHB A;  7ICR A;  5DBB A;  3RH4 A;  4QWD A;  3SI8 A;  4BWM A;  1FA0 A;  4WCW A;  2ZUB A;  3B0Y A;  1TK8 A;  5HRK A;  4I29 A;  5EWG A;  4RQ2 A;  3OVS A;  5J0T A;  4KN4 A;  3OSP A;  1BPX A;  5KG4 A;  4PHA A;  2ZJ8 A;  4AT7 B;  1ZQV A;  3RB4 A;  4QZF A;  1HUZ A;  1NK6 A;  3BDP A;  4C8K A;  1R89 A;  3N4M B;  2R8I A;  1ZQA A;  4I27 A;  4F50 A;  8ICR A;  1U9L A;  2NRW A;  9ICV A;  4KN7 A;  1TFY A;  3OV7 A;  5KT3 A;  5J0Y A;  4PPX A;  3H37 A;  4WC3 A;  3PO4 A;  4FS2 A;  5IIN A;  2NRV A;  1ZQP A;  3RTV A;  4DFP A;  1LV5 A;  4ED7 A;  4NY8 A;  2AQ0 A;  5KT4 A;  4BXO A;  2NRK A;  4J9P A;  2BHN A;  2MUT B;  4TQS A;  5DDY A;  3MR6 A;  4YP3 A;  4J9R A;  4FS1 A;  9ICX A;  3C66 A;  4QWA A;  4DO9 A;  2AGO A;  4MFA A;  1BPZ A;  5J0X A;  5J0W A;  5DBA A;  2PFO A;  5F9L A;  4X4R A;  1T7P A;  2DPI A;  4F2R A;  4ECT A;  2ASD A;  7ICI A;  2H5X A;  8ICG A;  4YG2 A;  3OUY A;  3SZ2 A;  4X4T A;  2VA8 A;  3BJY A;  4R66 A;  4GXJ A;  1NJZ A;  1UEU A;  1BGX T;  1MSW D;  7ICT A;  8ICV A;  1L3T A;  2ATL A;  4O3Q A;  5KFW A;  1ZQN A;  1TAU A;  9ICT A;  3PVX A;  3TQ1 A;  2ZH6 A;  3JPN A;  3GIM A;  3OVB A;  3M8S A;  2V4R A;  3RB6 A;  7ICJ A;  4ZH4 A;  4IRC A;  2JEI A;  3AQN A;  3JPS A;  3UXN A;  4RWN A;  4ECY A;  4IR9 A;  2HHU A;  4M2Y A;  1KEJ A;  3MR3 A;  1NK5 A;  4YCX A;  4QWB A;  4RQ3 A;  5DQH A;  4GC6 A;  4R65 A;  3PW4 A;  4DQP A;  4F2S A;  4ATB A;  4X4S A;  4RU9 A;  3BQ1 A;  4DSK A;  4UB3 A;  4JWM A;  4GLX A;  2A1J A;  4QW9 A;  4KLI A;  1B22 A;  1T4G A;  3Q8M A;  4RQ5 A;  9ICQ A;  5HRB A;  2M2W A;  1BPY A;  5KFU A;  3KTQ A;  4X0A A;  2IBK A;  4I2G A;  4O5C A;  3C5G A;  8ICS A;  2JZB A;  3OJS A;  5KFQ A;  5DBC A;  1X9W A;  3TAN A;  4ED0 A;  8ICB A;  1XWL A;  1X9S A;  2F1H A;  3H8W A;  2JEG A;  4R8U A;  1UT8 A;  3V7K A;  2FPL A;  3ZDD A;  4PH5 A;  1IM4 A;  5J2E A;  2ID1 A;  1SL1 A;  1TFR A;  5KFB A;  8ICE A;  4K4I A;  4O9M A;  2Q66 A;  3OSN A;  4NLG A;  2IHM A;  3FYH A;  4EEY A;  1ZET A;  1ARO P;  5KFJ A;  3L9D A;  1S10 A;  1ZQW A;  3HWT A;  4TUS A;  4UAW A;  3V6K A;  4Q45 A;  4UB5 A;  1KDH A;  2UVU A;  2W9B A;  4J9Q A;  4Z6F A;  4RQ1 A;  4DS5 A;  1T3N A;  2GWS A;  1PX5 A;  2HHP A;  5CP2 A;  4M9J A;  1KTQ A;  1NKC A;  3SV3 A;  4DOC A;  8ICX A;  5KTQ A;  1Z00 B;  8ICP A;  4GXK A;  1RYR A;  3JYY A;  2W9M A;  1KFS A;  1MQ3 A;  1JN3 A;  4M9N A;  4LT6 A;  8ICF A;  5L9X A;  4Q8F A;  1ZQT A;  3RRH A;  3HX0 A;  3WFQ E;  4MF2 A;  4X4Q A;  2ZHB A;  4M9G A;  5EWE A;  4I2I A;  5IIK A;  2IA6 A;  3QE9 Y;  4TUP A;  1H38 A;  4B9L A;  2KZ3 A;  4KLG A;  3AQK A;  1PZN A;  4IRK A;  3PML A;  3HT3 A;  3C18 A;  3V6J A;  2KP7 A;  5DB8 A;  3ZD8 A;  5DDM A;  5J2C A;  3BQ0 A;  2XY7 A;  1ZJN A;  5KFK A;  2I9G A;  4E0D A;  8ICA A;  1UET A;  5DB6 A;  4EYH B;  3EYZ A;  4GC7 A;  3LK9 A;  4X5V A;  9ICW A;  5HRD A;  4M0A A;  8ICW A;  1XC9 A;  1MQ2 A;  3NTU A;  7ICK A;  1CUK A;  4J9K A;  3PV8 A;  5HR9 A;  4PGX A;  3MGI A;  4FBU A;  2M9N A;  4FHX A;  1N48 A;  4RPX A;  4BDP A;  4DQS A;  1BNP A;  3ETL A;  3H40 A;  2DRA A;  1Z3E B;  3ISB A;  3H8J A;  4ECZ A;  4DWI A;  3RJH A;  2R8J A;  5J2H A;  3AUO A;  2BDP A;  1KRP A;  3UPS A;  4UAZ A;  1A77 A;  1XSP A;  1VJ7 A;  3RJJ A;  7ICH A;  2ZH7 A;  4RQ4 A;  3Q8R B;  1NJY A;  2FLN A;  4KLU A;  5F9N A;  4Z6D A;  1BPB A;  3GIL A;  3OUY B;  2P66 A;  9ICR A;  4RT2 A;  4QWE A;  2HHQ A;  1D8L A;  2FPK A;  4RWQ A;  5BOM A;  3JPR A;  1SKW A;  4EBK A;  4YQW A;  1MIV A;  4E80 A;  4P4M A;  1L3V A;  1QSS A;  5HRI A;  2IMW P;  2BPF A;  3H39 A;  3JZ0 A;  2ZTC A;  4I2D A;  1KSP A;  5J2J A;  2IHN A;  4RWP A;  9ICK A;  4QZH A;  4TUQ A;  2VA3 A;  5KFN A;  5J2G A;  4M6W A;  1TV9 A;  4JUZ A;  4IRD A;  2A1J B;  5J2K A;  5L1K A;  4JK1 A;  3EPI A;  1RZT A;  4YN4 A;  3PX4 A;  1NO5 A;  3UXO A;  2ZJ5 A;  3V72 A;  1RXV A;  3SV4 A;  2P6R A;  1S76 D;  2W9C A;  4DFK A;  1BPD A;  5KFE A;  4JWN A;  2Y1I A;  2BKE A;  2NRT A;  4O3S A;  1QLN A;  1SKS A;  2JZB B;  1TK0 A;  9ICH A;  5IIJ A;  3K75 D;  4RUC A;  1ZQE A;  3Q8Q B;  2PFN A;  4F4X A;  4WC7 A;  3AQL A;  2AJQ A;  4UAY A;  4DLG A;  2ZH3 A;  5KG5 A;  2KZM A;  4RUA A;  3PR5 B;  3C1Z A;  1BVS A;  4UB2 A;  2ZH9 A;  1ZQU A;  3FDS A;  3ZDC A;  4KLD A;  3PO5 A;  1DK2 A;  2O5A A;  4DFJ A;  2ZH5 A;  3M9O B;  3T5H A;  2ZH2 A;  1NJW A;  4JV1 A;  1Y88 A;  2P6U A;  4P4P A;  2NRX A;  1OU5 A;  4ELV A;  5DG8 A;  4PGY A;  4YD2 A;  5CA7 A;  3GV8 B;  3MBY A;  2W9B B;  1DK3 A;  8ICN A;  8ICT A;  3AQM A;  2XC9 A;  5L1L A;  8ICK A;  3PMN A;  2C22 A;  4FBT A;  4TUR A;  3GIJ A;  5L1I A;  2VAN A;  1SKR A;  5EOZ A;  5DG9 A;  1QTM A;  4RQ7 A;  4GXI A;  3E2E A;  2R8H A;  3UQ0 A;  1MIY A;  2DVI A;  1ZQC A;  1KNY A;  2ISP A;  2KN7 A;  4DQQ A;  3PY8 A;  5KFM A;  3C5F A;  2BCV A;  4CCH A;  5KFF A;  3RJF A;  3PX6 A;  4O3N A;  4YR2 A;  3ISC A;  4P2H A;  2DR8 A;  4YMO A;  2WTF A;  1ZQG A;  7ICU A;  2BE3 A;  4DL5 A;  4XUS A;  1RXW A;  2F1I A;  3HW8 A;  1X2I A;  4C8N A;  2W9A A;  5HHI A;  3GV5 B;  4RQ8 A;  4DOB A;  5J29 A;  2ZUC A;  5KFG A;  3HPO A;  4ED2 A;  5DKW A;  5HRL A;  3RRG A;  4F4W A;  1NKB A;  1R8A A;  2AU0 A;  9ICF A;  4X4P A;  1DOQ A;  4QZI A;  3OGU A;  4J9M A;  1R8B A;  4M9H A;  4RWO A;  2XGP A;  8ICJ A;  3NGD A;  5KFC A;  1ZQQ A;  3RR7 A;  3QEA Z;  2AGQ A;  5J2A A;  2BQR A;  4WBZ A;  3IM1 A;  5J2I A;  9ICN A;  3B0X A;  4I2B A;  5DLG A;  3C2K A;  1LB2 B;  4NKU A;  4B9M A;  1X9M A;  4AT9 B;  3OVA A;  4DL7 A;  4FHY A;  1KFD A;  4KLM A;  2V4Q A;  4MFC A;  1NK0 A;  3T5J A;  2XGQ A;  4AT7 A;  5DQI A;  4K4G A;  2UVW A;  5IIM A;  4KLQ A;  4Q8E A;  1NZP A;  1HJP A;  3H7I A;  2BPG A;  3TAR A;  1SL0 A;  5KFX A;  4ED6 A;  4ELT A;  3H8S A;  2RDI A;  1ZJM A;  2RFF A;  2HHT A;  8ICL A;  4QWC A;  4F8R A;  9ICS A;  4WBY A;  1S9F A;  2UVV A;  3HJ4 A;  5HRF A;  4NLN A;  8ICI A;  2W8L A;  3UXP A;  4XQ7 A;  4I28 A;  1ZYQ A;  4ED8 A;  2FMQ A;  3WFR E;  8ICM A;  4C8O A;  3RB3 A;  3LWM A;  4S3N A;  1TFW A;  5J2D A;  3EW9 A;  4IQU A;  3GQC A;  1ZQL A;  3RR8 A;  2AGP A;  2XY5 A;  4I2E A;  4KLS A;  4KLT A;  2M2V A;  3Q8K A;  5CB1 A;  1JXE A;  5BPC A;  4EBJ A;  3IHQ B;  2XCP A;  4QZD A;  5DLF A;  3QZ7 A;  3PW5 A;  3RB0 A;  5IIL A;  2W8K A;  3LWL A;  1UT5 A;  3RH5 A;  3MR5 A;  9ICB A;  5KG3 A;  4UB4 A;  4YFK A;  2F1J A;  4Z6E A;  5DG7 A;  5KT7 A;  2HHS A;  2ZH8 A;  4X4U A;  4X4N A;  4O3O A;  4MFF A;  2ISO A;  3V7L A;  2I1Q A;  3OJU A;  2DFL A;  1T8E A;  2HHV A;  1DGS A;  4DSL A;  3RBD A;  4TQR A;  4ECS A;  8ICH A;  3GDX A;  5KG0 A;  2PFQ A;  2JEJ A;  2PBE A;  3TAP A;  4ECQ A;  3GII A;  1TVA A;  1JXL A;  1ZQD A;  3RJE A;  7ICN A;  4BXO B;  7ICP A;  4EZ9 A;  2C2E A;  4F5O A;  3UPQ A;  4F92 B;  1L5U A;  8ICU A;  2BR0 A;  4YXM A;  3HP6 A;  1NK4 A;  3WFS C;  5KFS A;  1ZQR A;  2ZTD A;  4ECW A;  3GIK A;  4HYK A;  5HP4 A;  1TAQ A;  1U45 A;  4QZ9 A;  5KFD A;  4QZ8 A;  1RYS A;  1XSN A;  4DSJ A;  1SL2 A;  4KTQ A;  2HVH A;  1A76 A;  1WOT A;  5BOL A;  2BCS A;  2LYH A;  4RNM A;  4FHW A;  3ORY A;  2C2R A;  4DSE A;  1V4A A;  3PNC A;  4F4Y A;  4FH3 A;  2ZH4 A;  4DLE A;  7ICM A;  2R8K A;  4NM2 A;  5CR0 A;  1ZQH A;  1S97 A;  4EZ6 A;  4E7X A;  2Y1J A;  1L3S A;  9ICU A;  4P4O A;  3G6Y A;  4DL3 A;  3TI0 A;  2J6S A;  9ICA A;  3H3A A;  9ICO A;  2BQU A;  5TZV A;  2B21 A;  9ICE A;  4RNN A;  2PI4 A;  8ICC A;  5III A;  1R8C A;  5J0O A;  3HIY A;  4ATB B;  1Q78 A;  5KFA A;  3ZDA A;  4RPZ A;  3M8R A;  2MAX A;  3M9M B;  4ECU A;  3ZD9 A;  4DL4 A;  4B9T A;  2NRZ A;  3ISD A;  3OHA A;  3RJI A;  1EXN A;  4YMN A;  3Q8P B;  2DPJ A;  2FMP A;  4B9S A;  1V9P A;  4YMM A;  4KIT B;  5KT5 A;  3RH6 A;  3WFO A;  4UQG A;  1ZQY A;  9ICC A;  4FH5 A;  2V9W A;  4NLZ A;  3C2M A;  5J2F A;  1IXR A;  4ECR A;  5KFT A;  2J6T A;  2PFP A;  4NM1 A;  2HHW A;  1Z00 A;  2J6U A;  3MFI A;  1ZQZ A;  4R8U B;  2BCR A;  1COO A;  4NLK A;  4DF8 A;  4M9L A;  2ZHA A;  4F5N A;  4IR1 A;  5CJ7 A;  2XY6 A;  1U4B A;  9ICJ A;  4QZG A;  5D4B A;  5DEC A;  5F2V O;  2PXI A;  2UVR A;  4YXJ A;  4X0B A;  3WFP A;  4LZG A;  4DS4 A;  1MIW A;  9ICG A;  3RJG A;  3JPP A;  3PW2 A;  4KMU A;  1QSL A;  2HHX A;  3TAQ A;  3MDC A;  4I2F A;  1JIH A;  3EZ5 A;  4RQ6 A;  2RDJ A;  8ICZ A;  5KFH A;  4E8F A;  2DR5 A;  3ZDE A;  4WC6 A;  2BGW A;  9ICL A;  2DR7 A;  5J0S A;  1ZQS A;  1NJX A;  2DR9 A;  2C2D A;  1NK8 A;  3ZDB A;  4DL2 A;  1U47 A;  9ICM A;  1S77 D;  1C7Y A;  4IQV A;  5CHG A;  1ZQM A;  4JV2 A;  4M47 A;  3THV A;  5HRH A;  8ICY A;  4DL6 A;  4RZR A;  4UD5 A;  2KTQ A;  1NKE A;  2ZH1 A;  4ELU A;  4O5K A;  4ED3 A;  3MFH A;  5KT6 A;  4G3I A;  3JPO A;  4RT3 A;  4EBD A;  1XS9 D;  4R64 A;  5HML A;  4PHE A;  1U49 A;  2HW3 A;  1NK9 A;  3LQC B;  9ICI A;  4EBE A;  4WC4 A;  3BQ2 A;  1JAJ A;  4UBC A;  4QZE A;  5L1J A;  4J9O A;  2BCQ A;  4WC2 A;  3G6V A;  3PW7 A;  1WCN A;  4JV0 A;  2AQ4 A;  4PHD A;  2VA2 A;  5HRG A;  3RAQ A;  2FLL A;  2JEF A;  4YD1 A;  2BQ3 A;  2KZZ A;  2Q0Z X;  4J9N A;  4RQ0 A;  4DSF A;  5KFZ A;  5DQG A;  4B9V A;  1BPE A;  4AT8 A;  3T5L A;  5HHH A;  1CEZ A;  3KHG A;  3GV7 B;  4YR3 A;  1JX4 A;  1S0N A;  4X4V A;  2ZJA A;  2DRB A;  1D9F A;  4FO6 A;  1K1S A;  1ZQX A;  4F4Z A;  3JPT A;  4PHP A;  2ASL A;  4XQ8 A;  1JQR A;  2ALZ A;  1QSY A;  3QZ8 A;  4ED1 A;  3JPQ A;  1KFT A;  4EYI B;  7ICO A;  4DQR A;  4M5D A;  5KG6 A;  4XRH A;  3PR4 A;  2R8G A;  1Q79 A;  3C2L A;  3MGH A;  4QZB A;  5DED A;  3EWA A;  1BNO A;  4F4K A;  1NOM A;  2BPC A;  4FHP A;  5J0U A;  4KLF A;  4X4O A;  2PI5 A;  7ICE A;  3SYZ A;  7ICV A;  4WC5 A;  3MR2 A;  5KFR A;  1RPL A;  4UBB A;  5KT2 A;  3N97 B;  4Q43 A;  5D49 A;  1XSL A;  4F3O A;  4B9U A;  1XO1 A;  3KHR A;  1D8Y A;  3K4G A;  4BGD A;  3TFR A;  2BCU A;  8ICO A;  3HJ1 A;  4EP7 A;  5HC9 A;  4YVZ A;  4F5P A;  5J0Q A;  4NXZ A;  3UQ2 A;  5DGB A;  4K4H A;  5IIO A;  4IQT A;  4O3P A;  5J2B A;  3C1Y A;  5DGA A;  4M6W B;  2MUT A;  3LDA A;  4R63 A;  4MEY A;  4KLL A;  5KFO A;  3NYB A;  3C23 A;  1B43 A;  3G6X A;  4B9N A;  4ECX A;  2W9C B;  3RJK A;  7ICQ A;  4WC0 A;  4QZA A;  1KLN A;  4IQW A;  3H4B A;  1UA1 A;  4MF8 A;  5J0P A;  1TKD A;  3T3F A;  3PW0 A;  3M9N B;  1ZQJ A;  5KG2 A;  5EWF A;  4PGQ A;  4WC1 A;  4DEZ A;  1S0V A;  4Z6C A;  4IG8 A;  7ICF A;  3Q8L A;  1ZQK A;  5KFL A;  4F5R A;  1ZQF A;  4O3R A;  4DFM A;  4LVS A;  4DF4 A;  1UEV A;  4Q44 A; 
#chains in the Genus database with same CATH topology
 4UB1 A;  5DB9 A;  2HVI A;  1NK7 A;  2KFZ A;  1SV0 C;  2HI0 A;  4I2C A;  2CXY A;  3FM9 A;  2FLP A;  3MAB A;  3QUC A;  4LZD A;  1WCL A;  4DSI A;  3KHH A;  4A8E A;  1ECW A;  3AU2 A;  1ZQB A;  1SB3 C;  4O5E A;  2ZIW B;  4EBC A;  4K99 A;  7ICL A;  2HBK A;  2A3V A;  2NYV A;  1XU4 A;  2OWO A;  1AQ6 A;  2WF9 A;  5C5J A;  4ECV A;  3OVS A;  2M2U A;  4QW8 A;  4J9L A;  4BWJ A;  4I2H A;  4NLB A;  4O0I A;  5D46 A;  3RH4 A;  4QWD A;  5AKX A;  3B0Y A;  1TK8 A;  5KG4 A;  5ALR A;  4AT7 B;  5B3P A;  5ALT A;  4QZF A;  2BDU A;  3BDP A;  4OJL A;  1Q3U A;  1IIP A;  1ED1 A;  3N7S C;  2E3T A;  3OV7 A;  5KT3 A;  4AYB C;  4OAG A;  3NVW A;  4OJ5 A;  5AIA A;  4FS2 A;  4DFP A;  1LV5 A;  4NY8 A;  2NRK A;  2XID A;  4J9P A;  4J9R A;  5ALH A;  3PST A;  4DO9 A;  1BPZ A;  5J0W A;  2PFO A;  4F2R A;  2ASD A;  8ICG A;  3OUY A;  2ZIV B;  4GXJ A;  4BJQ A;  7ICT A;  1DRG A;  3JPN A;  2V4R A;  2JV3 A;  3UXN A;  4RWN A;  5AIC A;  2G5H B;  4DQP A;  2A1J A;  4QW9 A;  3IN5 A;  1SXD A;  5B5E U;  4FZM A;  2JZB A;  4LEW A;  3A0B U;  5DBC A;  4PZN A;  4UAU A;  2DUY A;  1X9S A;  3H0M B;  2F1H A;  4R8U A;  2FPL A;  5A0L A;  4PH5 A;  4UAR A;  5H2F U;  4O9M A;  2G5I B;  5KFJ A;  1ZQW A;  2RQ5 A;  3V6K A;  1KDH A;  2FE9 A;  4RQ1 A;  1N5W A;  4XJE A;  8ICX A;  1Z00 B;  4M9N A;  1J97 A;  8ICF A;  2EQY A;  3D2Q A;  3OTQ A;  2IA6 A;  2EH9 A;  2K4I A;  2KZ3 A;  4KLG A;  2RRD A;  4IRK A;  5DB8 A;  4I0U A;  5AKH A;  2XY7 A;  8ICA A;  3AL0 B;  5DB6 A;  4X5V A;  1B4F A;  5HRD A;  1X66 A;  8ICW A;  1RDF A;  3PV8 A;  4CE6 A;  2HDO A;  1YT3 A;  5HR9 A;  4FHX A;  1N48 A;  1SXE A;  1BNP A;  3H40 A;  3PSF A;  4CF3 A;  4QJF B;  4Y2V A;  4RQ4 A;  1FFV A;  4Y2J A;  2FLN A;  5F9N A;  3GIL A;  4RT2 A;  2KJ9 A;  2FPK A;  4YQW A;  1K5O A;  4WOY A;  1UCV A;  5AKK A;  4FE3 A;  3ER9 B;  3SAH A;  1KW4 A;  1KSP A;  2HSZ A;  2IHN A;  4BX9 C;  3WK9 A;  1TV9 A;  1X42 A;  4IRD A;  2KKP A;  3PX4 A;  3LYS A;  3UXO A;  1RXV A;  3SV4 A;  1S76 D;  5ALK A;  2BKE A;  4MHV A;  1GO3 F;  1TK0 A;  9ICH A;  3K75 D;  3Q8Q B;  2AJQ A;  5F3X B;  2KZM A;  3PR5 B;  1BVS A;  1ZQU A;  2HBM A;  2WFA A;  2ZH5 A;  1Q46 A;  2EZX A;  1NJW A;  1Y88 A;  2H3Z A;  1VDV A;  4EED A;  1DK3 A;  8ICN A;  4NXT A;  3AQM A;  5L1L A;  3IG5 A;  3GIJ A;  3J81 j;  1MIY A;  1VJ5 A;  3M1Y A;  3C5F A;  4O3N A;  1T94 A;  2WTF A;  2ZIW A;  4BUG A;  1JRO A;  1TE2 A;  4XUS A;  2F1I A;  3HW8 A;  1X2I A;  4OAF A;  3WKB A;  5J29 A;  4K9B A;  4KX5 A;  1QQ6 A;  3HPO A;  5DKW A;  3RRG A;  2EAN A;  4IC9 A;  9ICF A;  5AKI A;  1DOQ A;  3OGU A;  4J9M A;  4RWO A;  2EAP A;  3RFA A;  8ICJ A;  5AKZ A;  3M6Z A;  2VKQ A;  3IM1 A;  3C2K A;  3OPX A;  4KLM A;  1DGJ A;  3KKA A;  3WK8 A;  3T5J A;  3E0F A;  4AT7 A;  2W7P A;  1SL0 A;  4ED6 A;  2RFF A;  4F8R A;  4WBY A;  1JUD A;  5AKE A;  5HRF A;  4XQ7 A;  4I28 A;  4ED8 A;  3WFR E;  3LWM A;  3EW9 A;  5J2D A;  2M2V A;  3RR8 A;  4EEL A;  4EBJ A;  4C4S A;  2MSN A;  1SWV A;  2HHS A;  5KT7 A;  5L1M A;  4X4N A;  4O3O A;  2ZIV A;  2HHV A;  1LKY B;  5KG0 A;  3TAP A;  4ECQ A;  1JXL A;  1ZQD A;  3KD3 A;  1L5U A;  5ALN A;  1NK4 A;  5KFS A;  1TAQ A;  3DV9 A;  4C7Z A;  1U45 A;  3ER8 C;  1XSN A;  1A76 A;  1WOT A;  2K4H A;  1L8O A;  3HIL A;  2BCS A;  3ORY A;  1V4A A;  3HKZ C;  4DLE A;  2R8K A;  2B4V A;  1S97 A;  2GOL A;  4DL3 A;  1OXJ A;  3SR6 A;  4DCC A;  1R8C A;  2PI4 A;  2EZZ A;  3ZDA A;  4RPZ A;  2F3N A;  3M9M B;  2NRZ A;  2FMP A;  4PZO A;  4WC6 A;  3Q8P B;  2ZIU B;  5KT5 A;  5AI8 A;  1S8O A;  2YB4 A;  5AM5 A;  3C2M A;  5KNI A;  1IXR A;  4ECR A;  5KFT A;  2J6T A;  1Z00 A;  4DF8 A;  2HN2 A;  4F5N A;  4IR1 A;  2XY6 A;  1U4B A;  9ICJ A;  4QZG A;  2YQE A;  4LZG A;  1MIW A;  4K8V A;  9ICG A;  3RJG A;  3JPP A;  5D62 A;  4KMU A;  3EZ5 A;  2RDJ A;  4E8F A;  2BGW A;  2CN1 A;  2DR9 A;  2C2D A;  1NK8 A;  1U47 A;  1S77 D;  1C7Y A;  5KL1 B;  5CHG A;  3TAD C;  2ZH1 A;  1NKE A;  4MKP A;  2DKX A;  1FIQ A;  4G3I A;  1PK1 B;  4WC4 A;  2BCQ A;  3IP4 B;  1WCN A;  2VA2 A;  2JEF A;  4YD1 A;  3M6K A;  2BQ3 A;  4DSF A;  2KG5 A;  5KFZ A;  5HHH A;  3WK5 A;  5JTG A;  4YR3 A;  2WAQ F;  1D9F A;  4GFJ A;  4F4Z A;  4PHP A;  4XQ8 A;  1JQR A;  2K8A A;  4ED1 A;  3KOO A;  2MA1 A;  7ICO A;  1L7P A;  2EZY A;  1WWV A;  4FO1 A;  2R8G A;  1Q79 A;  2K89 A;  4NXW A;  2O6K A;  4FHP A;  2DBY A;  4WC5 A;  3SYZ A;  4UBB A;  4WH5 A;  1XSL A;  4F3O A;  4B9U A;  3K4G A;  4BGD A;  5HC9 A;  4NXZ A;  5IIO A;  4IQT A;  5DGA A;  2FJ6 A;  4MEY A;  4KLL A;  2YMQ A;  3C28 A;  1X40 A;  4B9N A;  4ECX A;  5ALU A;  2W9C B;  1KLN A;  2KV2 A;  3H4B A;  2G0A A;  1D8B A;  1ZQJ A;  5KG2 A;  4DEZ A;  4HAI A;  4Z6C A;  1XO0 A;  3I76 A;  1UEV A;  4Q44 A;  4J9S A;  4RPY A;  3NAS A;  1N56 A;  2FMS A;  3V7J A;  3EPG A;  4DQI A;  1MN8 A;  5KG1 A;  4I2A A;  1YLQ A;  4F93 B;  3GFK B;  2LKY A;  5JUM A;  1ZD2 P;  2JH1 A;  4EX7 A;  4RNO A;  2H3I A;  5CWR A;  5DB7 A;  2ASJ A;  4C8M A;  4JLZ A;  5KFV A;  1WG8 A;  1IG6 A;  1X9X A;  5CFS A;  3QX7 A;  3QEB Z;  1D9D A;  2WF5 A;  4F5Q A;  4NKT A;  2KFN A;  1K1Q A;  1UHU A;  4Y2X A;  4AT8 B;  3RAX A;  5ALF A;  3E58 A;  2FPM A;  3MDA A;  3AU6 A;  4CF5 A;  5HMM A;  2W43 A;  7ICR A;  2HMX A;  1FA0 A;  4WCW A;  2G06 A;  4I29 A;  4RQ2 A;  3OSP A;  3WKE A;  1ZQV A;  3WK6 A;  2IOF K;  1HUZ A;  1NK6 A;  2DQN B;  3BZC A;  4C8K A;  1N63 A;  3KBB A;  4F50 A;  3MGV A;  1U9L A;  2NRW A;  4PPX A;  3RTV A;  1LKY A;  2MRL A;  2MUT B;  3R9K A;  4TQS A;  4YP3 A;  4FS1 A;  5ALL A;  2KJ8 A;  4QWA A;  4MFA A;  2LBO A;  3F2C A;  4X4R A;  2YN4 A;  5F9L A;  2AXT U;  1T7P A;  1N5X A;  2LYB A;  4AYB F;  4X4T A;  3BJY A;  1LVH A;  2ATL A;  4O3Q A;  1TAU A;  3PVX A;  3M8S A;  3SAF A;  7ICJ A;  3AQN A;  2JEI A;  1ZRN A;  2HHU A;  2NO4 A;  1NK5 A;  2HBL A;  4F72 A;  4RQ3 A;  5DQH A;  3PW4 A;  4RU9 A;  4KLI A;  4GLX A;  2ES6 A;  4UAT A;  1Z1V A;  5HRB A;  2M2W A;  1BPY A;  3KTQ A;  5KFQ A;  1X9W A;  2YB1 A;  4EEB A;  3V7K A;  1TFR A;  5KFB A;  2Q66 A;  1V97 A;  4NLG A;  2LM1 A;  1KKX A;  3L9D A;  1ZQ1 C;  3F53 A;  2UVU A;  4DS5 A;  4Z6F A;  2HHP A;  2FDR A;  4UB8 U;  3SV3 A;  4DOC A;  3CRX A;  4KM5 A;  5FP0 A;  4GXK A;  3JYY A;  2W9M A;  4EGW A;  2JH7 A;  2QKQ A;  3HX0 A;  2ZHB A;  3L5K A;  5IIK A;  1PK1 A;  4B9L A;  2DKZ A;  3AQK A;  3F5E A;  4FZN A;  3PML A;  3HT3 A;  3C18 A;  2JGA A;  3MCR A;  5EE9 A;  3ZD8 A;  5DDM A;  4E0D A;  3BQ0 A;  1UET A;  1O08 A;  5ALP A;  4EYH B;  3I28 A;  2PKE A;  2ZIX B;  4NLC A;  4OJ6 A;  3NTU A;  2G07 A;  1Z1B A;  4PGX A;  2M9N A;  4Y2S A;  3H8J A;  3SEI A;  4DWI A;  2A1A A;  5J2H A;  3UPS A;  1A77 A;  3F5A A;  1XSP A;  1VJ7 A;  4U7C A;  2LPE A;  4KLU A;  1BPB A;  2KIC A;  4OCZ A;  2A19 A;  1D8L A;  4AP9 A;  5BOM A;  2IOH A;  4E80 A;  1QSS A;  2IMW P;  1A0P A;  4K97 A;  1ZD4 A;  2ZG6 A;  2F8K A;  4RWP A;  3FAH A;  4QZH A;  1Z19 A;  2YX8 A;  2VA3 A;  5KFN A;  2OM6 A;  4ACO A;  5J2K A;  2YMM A;  3EPI A;  1NO5 A;  5AKL A;  2KOB A;  2W9C A;  4DFK A;  4JWN A;  3QUT A;  5AK5 A;  5KFE A;  4CF4 A;  1QLN A;  2PFN A;  3AEV A;  3HJE A;  2LM4 A;  2DGZ A;  1QQ7 A;  5JRT A;  4UB2 A;  3FDS A;  3ZDC A;  3M9O B;  2W7O A;  1OU5 A;  4ELV A;  5DG8 A;  3MBY A;  2W9B B;  5HR6 A;  3HRD D;  1TAM A;  8ICT A;  2C22 A;  2GA9 D;  2VAN A;  1SKR A;  1PK3 A;  1QTM A;  5EE0 A;  2R8H A;  1KNY A;  2ESE A;  4DQQ A;  2ISP A;  3PY8 A;  9ICP A;  2BCV A;  3PX6 A;  2DR8 A;  1V85 A;  4Y2Y A;  1ZQG A;  3UMB A;  2BE3 A;  3A0H U;  4DL5 A;  1RXW A;  4DOB A;  2W9A A;  5ALG A;  5KFG A;  2XVT A;  4F4W A;  5KFC A;  2K4P A;  9ICN A;  4NKU A;  4B9M A;  1X9M A;  4CRX A;  1KFD A;  2V4Q A;  2BBH A;  2QB0 A;  5DQI A;  4O67 A;  4Q8E A;  5IIM A;  3H7I A;  3VC8 A;  2M0N A;  3QU2 A;  2RDI A;  2HHT A;  9ICS A;  2KEY A;  8ICI A;  2W8L A;  1ZYQ A;  2FMQ A;  8ICM A;  3RB3 A;  4I2E A;  4IQU A;  1ZQL A;  2AGP A;  4KLS A;  5AI4 A;  4RQN A;  3PW5 A;  3RH5 A;  5KG3 A;  3PZP A;  4YFK A;  2F1J A;  4Z6E A;  4X4U A;  4MFF A;  3OJU A;  1T8E A;  4RQM A;  3RBD A;  2PBE A;  5TIS U;  2JEJ A;  3GII A;  5EE3 A;  2HBJ A;  3UPQ A;  2BR0 A;  2GAF D;  1ZQR A;  2I5H A;  4QZ9 A;  1RYS A;  4O68 A;  3IRU A;  5AM3 A;  2GLE A;  2LYH A;  2ZH4 A;  3PNC A;  4U6P A;  3S6J A;  4Y2Q A;  4E7X A;  3G6Y A;  3TI0 A;  5TZV A;  4P0P A;  4RNN A;  5III A;  1Q78 A;  3M8R A;  4G9B A;  1F0M A;  2MAX A;  1HIW A;  4DL4 A;  3ZD9 A;  9ICW A;  3NWI A;  4YMM A;  4KIT B;  5ALJ A;  3HKZ F;  9ICC A;  3QXG A;  2HHW A;  3DDH A;  4NLK A;  4M9L A;  4QIW C;  4OAH A;  5DEC A;  2K8C B;  2UVR A;  1A6S A;  1QH9 A;  1PVQ A;  2HHX A;  1WUD A;  2DR5 A;  9ICL A;  2WB1 C;  3ZDB A;  2K60 A;  1ZQM A;  4JV2 A;  2YY6 A;  2KTQ A;  4ELU A;  4ED3 A;  3MFH A;  4WQL A;  2KE7 A;  4PHE A;  1JAJ A;  1SV0 A;  3T79 A;  4P0Q B;  4JV0 A;  3I1Y A;  2AQ4 A;  4PHD A;  4C4T A;  3AN1 A;  2KZZ A;  1BPE A;  3T5L A;  1L7N A;  2KD1 A;  3AM9 A;  2ZJA A;  1K1S A;  3QU4 A;  4FFD A;  2W04 A;  4M5D A;  2B51 A;  3L3F X;  4XRH A;  5AI6 A;  4QZB A;  1BNO A;  1KL9 A;  4X4O A;  2PI5 A;  2AHO B;  1RPL A;  4LEY A;  2HOI A;  3CP8 A;  2KHV A;  1QQ5 A;  3NVV A;  2BZF A;  4EP7 A;  1D8Y A;  4OD0 A;  8ICO A;  2KIV A;  4F5P A;  3UQ2 A;  4K4H A;  1UPH A;  4O3P A;  4GIB A;  4M6W B;  2F77 X;  3LDA A;  4ZOH C;  3C23 A;  3G6X A;  7ICQ A;  3D6J A;  4WC0 A;  4IQW A;  3PW0 A;  3M9N B;  4PGQ A;  4UB6 U;  4IG8 A;  3Q8L A;  3O0F A;  1ZQK A;  4F5R A;  1ZQF A;  4Y2R A;  2JR5 A;  5KG7 A;  1HUO A;  2LI6 A;  3RBE A;  7ICG A;  5J0R A;  3TAC B;  2NV3 A;  2YMP A;  3QU7 A;  5HRE A;  3WU2 U;  1U48 A;  7ICS A;  8ICQ A;  5D61 A;  5KFY A;  1SZH A;  1NZB A;  5KFI A;  4QZC A;  1F5A A;  5J8Y C;  3H38 A;  3H0L B;  3PSP A;  4NXV A;  4MEX A;  4DOA A;  2KIW A;  3T5K A;  3V6H A;  1IV8 A;  3QUB A;  3LVV A;  1MC8 A;  3BQ7 A;  2ZXH A;  4KLH A;  5HRI A;  3BQT A;  3Q8S B;  4C8L A;  3F2D A;  2ZUD A;  3TFS A;  1TK5 A;  4FHV A;  3WKD A;  1L3U A;  5ALV A;  1UA0 A;  5AKY A;  5HRK A;  3D2S A;  1SGG A;  1BPX A;  4PHA A;  2ZJ8 A;  2KJ5 A;  3RB4 A;  1R89 A;  3N4M B;  3JCF A;  4I27 A;  1Z4O A;  9ICV A;  1TFY A;  1GPJ A;  5J0Y A;  3PO4 A;  1ZQP A;  2NRV A;  2AQ0 A;  2BHN A;  3CK6 A;  5DDY A;  4NV0 A;  2AGO A;  2WHE A;  5J0X A;  5DBA A;  4PL1 A;  7ICI A;  4ECT A;  4YG2 A;  2VA8 A;  4R66 A;  1NJZ A;  1BGX T;  1MSW D;  8ICV A;  1L3T A;  4LJX A;  3TQ1 A;  3OVB A;  3GIM A;  4OAI Z;  2HN1 A;  5K4L A;  4IRC A;  4LEV A;  1FFU A;  3JPS A;  4ECY A;  4IR9 A;  4Y2T A;  2W3S A;  4F2S A;  2HOQ A;  5ALZ A;  4X4S A;  3ICX A;  4DSK A;  1J2N A;  3ED5 A;  4X0A A;  2IBK A;  4O5C A;  3C5G A;  8ICS A;  3OJS A;  4ED0 A;  8ICB A;  2KHQ A;  3NRW A;  3H8W A;  2JEG A;  3ZDD A;  1RQN A;  5J2E A;  1SL1 A;  2QAR B;  4K4I A;  3OSN A;  2E5S A;  1ARO P;  2F8L A;  2WF7 A;  3HWT A;  4UAW A;  4UB5 A;  2OCE A;  4J9Q A;  1PX5 A;  3K1R B;  5CP2 A;  4M9J A;  1KTQ A;  1NKC A;  5KTQ A;  1RYR A;  5GTH U;  1MQ3 A;  2IUB A;  3WK7 A;  5L9X A;  4Q8F A;  1ZQT A;  1SWW A;  5B66 U;  3RRH A;  3KFU F;  4CGZ A;  3B9J A;  4MF2 A;  4M9G A;  3EF2 A;  4I2I A;  5AK6 A;  2E1F A;  3QE9 Y;  4TUP A;  1PZN A;  3V6J A;  2KP7 A;  4P0Q A;  5J2C A;  4N7R A;  2F76 X;  5KFK A;  2I9G A;  2PMZ C;  3EYZ A;  4GC7 A;  3LK9 A;  3IV6 A;  4J9K A;  1YZ6 A;  4FBU A;  4BDP A;  4DQS A;  3ETL A;  1Z3E B;  3ISB A;  3RJH A;  3AUO A;  5D63 A;  3RJJ A;  2AH5 A;  2ZH7 A;  3QU9 A;  2D3D A;  3OUY B;  2P66 A;  2DL0 A;  4EBK A;  4O3M A;  4P4M A;  1L3V A;  5CRX A;  1FO4 A;  3F2B A;  3H39 A;  2GO7 A;  2EAO A;  2ZTC A;  4I2D A;  3CYM A;  5J2J A;  2CPR A;  2W03 A;  2GH1 A;  4M6W A;  4JUZ A;  2A1J B;  5L1K A;  4JK1 A;  4NJ8 A;  1RZT A;  4YN4 A;  3V72 A;  2P6R A;  2NRT A;  2JZB B;  2I6X A;  4RUC A;  1ZQE A;  1PUZ A;  4F4X A;  3AQL A;  4DLG A;  2ZH3 A;  3ZI4 A;  4LEZ A;  2ZH9 A;  4KLD A;  1DK2 A;  3T5H A;  2ZH2 A;  4QNL A;  2P6U A;  3NVY A;  4PGY A;  4US8 A;  5CA7 A;  2D8C A;  8ICK A;  4FBT A;  1ZD3 A;  4TUR A;  4GXI A;  3E2E A;  3BS5 B;  1R8A A;  4CCH A;  5KFF A;  4WQK A;  3ISC A;  4ELT A;  2E8P A;  4C8N A;  5HHI A;  4RQ8 A;  2LMR A;  1T3Q A;  5HRL A;  3UMG A;  2AU0 A;  4X4P A;  4QZI A;  4FZL A;  4M9H A;  2W3R A;  2ZIU A;  1ZQQ A;  3RR7 A;  4NL9 C;  2AGQ A;  5J2A A;  2BQR A;  4AT9 B;  3OVA A;  4B6J A;  2XI9 A;  4MFC A;  1NK0 A;  2XGQ A;  2QB1 A;  4K4G A;  2UVW A;  1HJP A;  2BPG A;  3M7D A;  3TAR A;  5KFX A;  3H8S A;  1ZJM A;  3NUQ A;  8ICL A;  4QWC A;  1S9F A;  2UVV A;  3HJ4 A;  1WYG A;  4NLN A;  3UXP A;  5AI9 A;  4J03 A;  1RYU A;  1ZRM A;  4S3N A;  3GQC A;  3Q8K A;  1JXE A;  3IHQ B;  4NXU A;  5DLF A;  5IIL A;  4JB3 A;  2W8K A;  3MR5 A;  9ICB A;  4C4R A;  3ONN A;  5ALD A;  4UB4 A;  5DG7 A;  1VLB A;  4UAS A;  2ISO A;  3V7L A;  5AM2 A;  1KQQ A;  2DFL A;  3TAD A;  1DGS A;  2P35 A;  2ZXI A;  2PFQ A;  1TVA A;  3RJE A;  7ICN A;  4US9 A;  4BXO B;  2RLT A;  4EZ9 A;  2C2E A;  7ICP A;  1Q8K A;  4F5O A;  4O6A A;  4F92 B;  4YXM A;  3HP6 A;  1RQL A;  3WFS C;  5HP4 A;  4EEN A;  1Z4N A;  1SL2 A;  5AK3 A;  4RNM A;  4FHW A;  1Q3V A;  4DSE A;  4FH3 A;  2E8N A;  5CR0 A;  1ZQH A;  4EZ6 A;  2Y0S C;  2Y1J A;  1L3S A;  9ICU A;  4P4O A;  9ICA A;  2BQU A;  9ICE A;  8ICC A;  3KKA C;  2QAR A;  4ATB B;  3HIY A;  1N61 A;  5HR7 A;  3RJI A;  3ISD A;  1NI3 A;  3RH6 A;  4UQG A;  1ZQY A;  4NLZ A;  5J2F A;  2W54 A;  1OUQ A;  2PFP A;  2Y9U A;  3MFI A;  1ZQZ A;  1COO A;  2ZHA A;  4OJO A;  5F2V O;  5D4B A;  4YXJ A;  4X0B A;  4DS4 A;  3NS1 A;  1QSL A;  4WJ3 B;  3MDC A;  4IS7 A;  4I2F A;  5G5G A;  1JIH A;  4RQ6 A;  8ICZ A;  4NWI A;  5KFH A;  3ZDE A;  4EEK A;  3H0R B;  1NJX A;  3DEE A;  1L8L A;  9ICM A;  4Y2U A;  2H3Q A;  3QYP A;  3THV A;  1NNL A;  4QIW F;  3QNM A;  5KL8 B;  4EX6 A;  1SV4 A;  5KT6 A;  3JPO A;  3OWG A;  4EBD A;  1XS9 D;  5HML A;  2HW3 A;  1NK9 A;  9ICI A;  1V38 A;  4J9O A;  4EV6 A;  2WB1 F;  4WC2 A;  4C80 A;  3G6V A;  3PW7 A;  2FLL A;  2IHO A;  4RQ0 A;  3NKU A;  4AT8 A;  5DQG A;  4B9V A;  2KSO B;  2XIC A;  4KB6 A;  1ZQX A;  1QSY A;  3QZ8 A;  1URJ A;  2VJ5 A;  3JPQ A;  4EYI B;  4DQR A;  5JU5 A;  3AQF A;  2WF6 A;  3MGH A;  5DED A;  3EWA A;  2BPC A;  3GU3 A;  3MR2 A;  5KFR A;  3C29 A;  3N97 B;  4Q43 A;  5D49 A;  1COK A;  3HJ1 A;  1XO1 A;  3KHR A;  3TFR A;  1ZXI A;  4YVZ A;  1S5L U;  3CNH A;  3BZK A;  2MUT A;  2KK0 A;  4R63 A;  3NYB A;  3AQE A;  3RJK A;  4K96 A;  1ZD5 A;  2W55 A;  1UA1 A;  4JLX A;  1J2M A;  4MF8 A;  1XNS A;  4KX3 A;  4WC1 A;  5EWF A;  1S0V A;  2FCL A;  2B6G A;  3BS5 A;  4O3R A;  3AMZ A;  4UD4 A;  3H4D A;  1SZP A;  4XA5 A;  5AI0 A;  2LHT A;  2C28 A;  1X6I A;  1VFG A;  4M04 A;  3EUB 2;  2XCA A;  2EWR A;  2YML A;  5HNK A;  2JXJ A;  3PSI A;  2L5Y A;  3KHL A;  1C20 A;  4AT9 A;  4KLO A;  2WF8 A;  4I2J A;  5T14 A;  4KLE A;  4YR0 A;  1PVR A;  3PX0 A;  1S0M A;  4KLJ A;  4F91 B;  2ZTE A;  2F44 A;  2W11 A;  2B0C A;  3C21 A;  1JMS A;  1S0O A;  1ZQO A;  2M2T A;  4NL9 A;  5KFP A;  2O1P A;  2XO7 A;  1ZQI A;  2RHF A;  2KNJ A;  3OHB A;  5DBB A;  3SI8 A;  4BWM A;  3NVZ A;  2ZUB A;  5EWG A;  5J0T A;  4KN4 A;  3TKA A;  1L6N A;  4O69 A;  3SMV A;  2R8I A;  1ZQA A;  8ICR A;  4KN7 A;  2ZIX A;  2BBJ A;  3H37 A;  4WC3 A;  5IIN A;  4ED7 A;  3GZF A;  5KT4 A;  4BXO A;  9ICX A;  3MR6 A;  3C66 A;  5KAF U;  3PHZ A;  3IDW A;  3WK4 A;  5ALI A;  4C7Y A;  1X6J A;  5ALS A;  2DPI A;  2H5X A;  3SZ2 A;  2RP5 A;  1UEU A;  5CEH A;  5ALM A;  1ZQN A;  5KFW A;  2ZH6 A;  9ICT A;  3RB6 A;  4ZH4 A;  2N1R A;  4PL2 A;  5AKG A;  1M6Y A;  5CFT A;  4M2Y A;  1KEJ A;  3MR3 A;  4YCX A;  3SD7 A;  4QWB A;  2G08 A;  4GC6 A;  4R65 A;  4ATB A;  3BQ1 A;  4UB3 A;  4JWM A;  1O03 A;  2R18 A;  1B22 A;  1T4G A;  3Q8M A;  4RQ5 A;  9ICQ A;  5KFU A;  4I2G A;  3TAN A;  1XWL A;  2IOF A;  4Y2P A;  1WWU A;  1UT8 A;  5AM1 A;  2EAM A;  1P7D A;  1IM4 A;  2ID1 A;  2G09 A;  3ALR A;  8ICE A;  1OW5 A;  2IHM A;  3FYH A;  4EEY A;  5AKJ A;  1ZET A;  1S10 A;  2K4E A;  4TUS A;  4F71 A;  1JRP A;  4Q45 A;  2W9B A;  2GWS A;  1T3N A;  8ICP A;  4OJP A;  1KFS A;  1JN3 A;  4LT6 A;  3WFQ E;  3FC4 A;  4X4Q A;  5EWE A;  1H38 A;  5G5H A;  2JHD A;  1ZJN A;  2EDU A;  3KZX A;  4M0A A;  1YZ7 A;  1XC9 A;  1MQ2 A;  7ICK A;  1CUK A;  1JAL A;  2OYY A;  2KSO A;  1JI7 A;  3MGI A;  4RPX A;  1FEZ A;  3D2N A;  2DRA A;  4ECZ A;  2R8J A;  2KKV A;  2BDP A;  1KRP A;  4UAZ A;  7ICH A;  2PMZ F;  3UM9 A;  3Q8R B;  1NJY A;  4Z6D A;  3BS7 A;  2KVS A;  2KMD A;  9ICR A;  4QWE A;  2HHQ A;  4RWQ A;  4K98 A;  3JPR A;  1SKW A;  1MIV A;  3IG8 A;  2HOF A;  3NRZ A;  2BPF A;  3JZ0 A;  2Q4T A;  2H3F A;  5CFU A;  9ICK A;  4TUQ A;  3K1Z A;  4JMU A;  5EE1 A;  5KAI U;  5J2G A;  2ZJ5 A;  1UQV A;  3L4P A;  5GTI U;  1BPD A;  5AI5 A;  2F2A B;  2Y1I A;  4O3S A;  1SKS A;  5IIJ A;  4WC7 A;  4IL6 U;  4UAY A;  1SIJ A;  5KG5 A;  4RUA A;  3C1Z A;  4UW9 A;  3PO5 A;  2O5A A;  4DFJ A;  4C0Z A;  4JV1 A;  4P4P A;  2NRX A;  2MU2 A;  4YD2 A;  3GV8 B;  2XC9 A;  5ALY A;  3PMN A;  5L1I A;  5EOZ A;  5DG9 A;  4RQ7 A;  3UQ0 A;  2DVI A;  1ZQC A;  4UAV A;  2KN7 A;  4OO1 J;  5KFM A;  4ICA A;  3RJF A;  4P2H A;  4YR2 A;  4YMO A;  4HX0 A;  1B0X A;  7ICU A;  3QUQ A;  3GV5 B;  2ZUC A;  3RF9 A;  4ED2 A;  1L7O A;  1NKB A;  3K7D A;  2H3V A;  1R8B A;  2XGP A;  3NGD A;  2VJ4 A;  3QEA Z;  2OH2 A;  4WBZ A;  5J2I A;  3B0X A;  4I2B A;  5DLG A;  1LB2 B;  3N28 A;  4DL7 A;  4FHY A;  5AHX A;  1CRX A;  2OEH A;  2JRZ A;  5B3Q A;  1NZP A;  4KLQ A;  2ODG A;  3KZI U;  1F44 A;  3N7R C;  1DXS A;  3VCB A;  5E79 U;  4C8O A;  1TFW A;  4KLT A;  2XY5 A;  1RM6 C;  4USA A;  5CB1 A;  5BPC A;  2XCP A;  4QZD A;  3RB0 A;  3QZ7 A;  3LWL A;  1UT5 A;  2I1Q A;  2DF4 B;  4DSL A;  4TQR A;  4ECS A;  8ICH A;  5ALX A;  1QCK A;  1ZOL A;  3GDX A;  3UMC A;  3ERC C;  2K8B B;  1N2X A;  1N62 A;  1RG6 A;  8ICU A;  2ZTD A;  4ECW A;  2LYA A;  3GIK A;  4HYK A;  3QU5 A;  2VIX A;  5KFD A;  4QZ8 A;  4DSJ A;  3SEN A;  4KTQ A;  5ALQ A;  5ALW A;  2HVH A;  4CDG A;  5BOL A;  2OXO A;  2C2R A;  4F4Y A;  2OHF A;  7ICM A;  4NM2 A;  3MC1 A;  3H3A A;  2J6S A;  2QLT A;  3U26 A;  9ICO A;  2B21 A;  3SQI A;  5J0O A;  2CRX A;  2B56 A;  5KFA A;  5CHE A;  3LVW A;  4ECU A;  4B9T A;  2DPJ A;  3OHA A;  1EXN A;  4YMN A;  4B9S A;  3WFO A;  2ZH8 A;  1V9P A;  2D6F C;  4NXX A;  4FH5 A;  2V9W A;  4KMO B;  4NM1 A;  2Y0S F;  2J6U A;  2DWQ A;  2BCR A;  4R8U B;  3WKC A;  5CJ7 A;  2PXI A;  5AIB A;  3WFP A;  3ETR A;  3PW2 A;  2QB0 B;  3WKA A;  3TAQ A;  4DFD A;  1L7M A;  2DR7 A;  5J0S A;  5JTI A;  1ZQS A;  5ALE A;  1HEK A;  1KN5 A;  4DL2 A;  4IQV A;  4M47 A;  3N7P D;  5AM4 A;  5HRH A;  8ICY A;  4DL6 A;  4PJ0 U;  4RZR A;  4UD5 A;  3SAG A;  4O5K A;  2WAQ C;  5ALO A;  1KBU A;  4RT3 A;  1F5S A;  1PVP A;  4R64 A;  3NVO A;  1U49 A;  3LQC B;  4EBE A;  4CNQ A;  3BQ2 A;  4UBC A;  4QZE A;  5L1J A;  2YTU A;  5HRG A;  3RAQ A;  2JMG A;  2Q0Z X;  4J9N A;  1CEZ A;  3KHG A;  3GV7 B;  2Z7J A;  1JX4 A;  1S0N A;  4X4V A;  2DRB A;  4FO6 A;  2HCF A;  5J8Y A;  3JPT A;  2ASL A;  2ALZ A;  1KFT A;  5KG6 A;  3PR4 A;  1CI4 A;  3C2L A;  3H8M A;  4F4K A;  1NOM A;  2E1E A;  5J0U A;  5AM0 A;  4KLF A;  7ICE A;  7ICV A;  5KT2 A;  2Y9T A;  2BCU A;  5J0Q A;  5DGB A;  4P0P B;  4K9A A;  2FI1 A;  5J2B A;  3C1Y A;  5KFO A;  5C0Y A;  1B43 A;  2NO5 A;  2E8O A;  3CW2 C;  1MA7 A;  4QZA A;  1TKD A;  5J0P A;  3T3F A;  2E8M A;  7ICF A;  5KFL A;  5AK4 A;  2KVC A;  1N60 A;  4DFM A;  4LVS A;  4DF4 A; 
#chains in the Genus database with same CATH homology
 4J9S A;  4RPY A;  4UB1 A;  1N56 A;  5DB9 A;  3H4D A;  1SZP A;  4XA5 A;  2FMS A;  2HVI A;  4UD4 A;  5KG7 A;  9ICP A;  1HUO A;  2C28 A;  3RBE A;  1NK7 A;  1VFG A;  2KFZ A;  7ICG A;  3V7J A;  4M04 A;  5J0R A;  3EPG A;  4I2C A;  4DQI A;  1YLQ A;  5KG1 A;  4I2A A;  2XCA A;  2FLP A;  3MAB A;  5HRE A;  4F93 B;  4LZD A;  3GFK B;  5JUM A;  4RNO A;  5HNK A;  1WCL A;  1U48 A;  4DSI A;  7ICS A;  8ICQ A;  5KFY A;  5CWR A;  5DB7 A;  3KHH A;  5KFI A;  4QZC A;  1F5A A;  3AU2 A;  4C8M A;  2ASJ A;  3H38 A;  1ZQB A;  4O5E A;  3KHL A;  4AT9 A;  5KFV A;  4KLO A;  4I2J A;  4MEX A;  4DOA A;  4EBC A;  7ICL A;  3T5K A;  4KLE A;  3V6H A;  1XU4 A;  2OWO A;  4YR0 A;  1MC8 A;  3QEB Z;  1D9D A;  4KLH A;  4ECV A;  5C5J A;  4F5Q A;  3BQT A;  3PX0 A;  1S0M A;  4F91 B;  4KLJ A;  2M2U A;  4QW8 A;  3Q8S B;  4NKT A;  4C8L A;  2KFN A;  1K1Q A;  2ZTE A;  4AT8 B;  3RAX A;  2ZUD A;  4J9L A;  4BWJ A;  3C21 A;  3TFS A;  3MDA A;  1JMS A;  2FPM A;  3AU6 A;  1TK5 A;  1S0O A;  1ZQO A;  5KFP A;  4I2H A;  4O0I A;  2M2T A;  2O1P A;  4FHV A;  2XO7 A;  5HMM A;  1L3U A;  1ZQI A;  5D46 A;  1UA0 A;  3OHB A;  7ICR A;  5DBB A;  3RH4 A;  4QWD A;  3SI8 A;  4BWM A;  1FA0 A;  4WCW A;  2ZUB A;  3B0Y A;  1TK8 A;  5HRK A;  4I29 A;  5EWG A;  4RQ2 A;  3OVS A;  5J0T A;  4KN4 A;  3OSP A;  1BPX A;  5KG4 A;  4PHA A;  2ZJ8 A;  4AT7 B;  1ZQV A;  3RB4 A;  4QZF A;  1HUZ A;  1NK6 A;  3BDP A;  4C8K A;  1R89 A;  3N4M B;  2R8I A;  1ZQA A;  4I27 A;  4F50 A;  8ICR A;  1U9L A;  2NRW A;  9ICV A;  4KN7 A;  1TFY A;  3OV7 A;  5KT3 A;  5J0Y A;  4PPX A;  3H37 A;  4WC3 A;  3PO4 A;  4FS2 A;  5IIN A;  2NRV A;  1ZQP A;  3RTV A;  4DFP A;  1LV5 A;  4ED7 A;  4NY8 A;  2AQ0 A;  5KT4 A;  4BXO A;  2NRK A;  4J9P A;  2BHN A;  2MUT B;  4TQS A;  5DDY A;  3MR6 A;  4YP3 A;  4J9R A;  4FS1 A;  9ICX A;  3C66 A;  4QWA A;  4DO9 A;  2AGO A;  4MFA A;  1BPZ A;  5J0X A;  5J0W A;  5DBA A;  2PFO A;  5F9L A;  4X4R A;  1T7P A;  2DPI A;  4F2R A;  4ECT A;  2ASD A;  7ICI A;  2H5X A;  8ICG A;  4YG2 A;  3OUY A;  3SZ2 A;  4X4T A;  2VA8 A;  3BJY A;  4R66 A;  4GXJ A;  1NJZ A;  1UEU A;  1BGX T;  1MSW D;  7ICT A;  8ICV A;  1L3T A;  2ATL A;  4O3Q A;  5KFW A;  1ZQN A;  1TAU A;  9ICT A;  3PVX A;  3TQ1 A;  2ZH6 A;  3JPN A;  3GIM A;  3OVB A;  3M8S A;  2V4R A;  3RB6 A;  7ICJ A;  4ZH4 A;  4IRC A;  2JEI A;  3AQN A;  3JPS A;  3UXN A;  4RWN A;  4ECY A;  4IR9 A;  2HHU A;  4M2Y A;  1KEJ A;  3MR3 A;  1NK5 A;  4YCX A;  4QWB A;  4RQ3 A;  5DQH A;  4GC6 A;  4R65 A;  3PW4 A;  4DQP A;  4F2S A;  4ATB A;  4X4S A;  4RU9 A;  3BQ1 A;  4DSK A;  4UB3 A;  4JWM A;  4GLX A;  2A1J A;  4QW9 A;  4KLI A;  1B22 A;  1T4G A;  3Q8M A;  4RQ5 A;  9ICQ A;  5HRB A;  2M2W A;  1BPY A;  5KFU A;  3KTQ A;  4X0A A;  2IBK A;  4I2G A;  4O5C A;  3C5G A;  8ICS A;  2JZB A;  3OJS A;  5KFQ A;  5DBC A;  1X9W A;  3TAN A;  4ED0 A;  8ICB A;  1XWL A;  1X9S A;  2F1H A;  3H8W A;  2JEG A;  4R8U A;  1UT8 A;  3V7K A;  2FPL A;  3ZDD A;  4PH5 A;  1IM4 A;  5J2E A;  2ID1 A;  1SL1 A;  1TFR A;  5KFB A;  8ICE A;  4K4I A;  4O9M A;  2Q66 A;  3OSN A;  4NLG A;  2IHM A;  3FYH A;  4EEY A;  1ZET A;  1ARO P;  5KFJ A;  3L9D A;  1S10 A;  1ZQW A;  3HWT A;  4TUS A;  4UAW A;  3V6K A;  4Q45 A;  4UB5 A;  1KDH A;  2UVU A;  2W9B A;  4J9Q A;  4Z6F A;  4RQ1 A;  4DS5 A;  1T3N A;  2GWS A;  1PX5 A;  2HHP A;  5CP2 A;  4M9J A;  1KTQ A;  1NKC A;  3SV3 A;  4DOC A;  8ICX A;  5KTQ A;  1Z00 B;  8ICP A;  4GXK A;  1RYR A;  3JYY A;  2W9M A;  1KFS A;  1MQ3 A;  1JN3 A;  4M9N A;  4LT6 A;  8ICF A;  5L9X A;  4Q8F A;  1ZQT A;  3RRH A;  3HX0 A;  3WFQ E;  4MF2 A;  4X4Q A;  2ZHB A;  4M9G A;  5EWE A;  4I2I A;  5IIK A;  2IA6 A;  3QE9 Y;  4TUP A;  1H38 A;  4B9L A;  2KZ3 A;  4KLG A;  3AQK A;  1PZN A;  4IRK A;  3PML A;  3HT3 A;  3C18 A;  3V6J A;  2KP7 A;  5DB8 A;  3ZD8 A;  5DDM A;  5J2C A;  3BQ0 A;  2XY7 A;  1ZJN A;  5KFK A;  2I9G A;  4E0D A;  8ICA A;  1UET A;  5DB6 A;  4EYH B;  3EYZ A;  4GC7 A;  3LK9 A;  4X5V A;  9ICW A;  5HRD A;  4M0A A;  8ICW A;  1XC9 A;  1MQ2 A;  3NTU A;  7ICK A;  1CUK A;  4J9K A;  3PV8 A;  5HR9 A;  4PGX A;  3MGI A;  4FBU A;  2M9N A;  4FHX A;  1N48 A;  4RPX A;  4BDP A;  4DQS A;  1BNP A;  3ETL A;  3H40 A;  2DRA A;  1Z3E B;  3ISB A;  3H8J A;  4ECZ A;  4DWI A;  3RJH A;  2R8J A;  5J2H A;  3AUO A;  2BDP A;  1KRP A;  3UPS A;  4UAZ A;  1A77 A;  1XSP A;  1VJ7 A;  3RJJ A;  7ICH A;  2ZH7 A;  4RQ4 A;  3Q8R B;  1NJY A;  2FLN A;  4KLU A;  5F9N A;  4Z6D A;  1BPB A;  3GIL A;  3OUY B;  2P66 A;  9ICR A;  4RT2 A;  4QWE A;  2HHQ A;  1D8L A;  2FPK A;  4RWQ A;  5BOM A;  3JPR A;  1SKW A;  4EBK A;  4YQW A;  1MIV A;  4E80 A;  4P4M A;  1L3V A;  1QSS A;  5HRI A;  2IMW P;  2BPF A;  3H39 A;  3JZ0 A;  2ZTC A;  4I2D A;  1KSP A;  5J2J A;  2IHN A;  4RWP A;  9ICK A;  4QZH A;  4TUQ A;  2VA3 A;  5KFN A;  5J2G A;  4M6W A;  1TV9 A;  4JUZ A;  4IRD A;  2A1J B;  5J2K A;  5L1K A;  4JK1 A;  3EPI A;  1RZT A;  4YN4 A;  3PX4 A;  1NO5 A;  3UXO A;  2ZJ5 A;  3V72 A;  1RXV A;  3SV4 A;  2P6R A;  1S76 D;  2W9C A;  4DFK A;  1BPD A;  5KFE A;  4JWN A;  2Y1I A;  2BKE A;  2NRT A;  4O3S A;  1QLN A;  1SKS A;  2JZB B;  1TK0 A;  9ICH A;  5IIJ A;  3K75 D;  4RUC A;  1ZQE A;  3Q8Q B;  2PFN A;  4F4X A;  4WC7 A;  3AQL A;  2AJQ A;  4UAY A;  4DLG A;  2ZH3 A;  5KG5 A;  2KZM A;  4RUA A;  3PR5 B;  3C1Z A;  1BVS A;  4UB2 A;  2ZH9 A;  1ZQU A;  3FDS A;  3ZDC A;  4KLD A;  3PO5 A;  1DK2 A;  2O5A A;  4DFJ A;  2ZH5 A;  3M9O B;  3T5H A;  2ZH2 A;  1NJW A;  4JV1 A;  1Y88 A;  2P6U A;  4P4P A;  2NRX A;  1OU5 A;  4ELV A;  5DG8 A;  4PGY A;  4YD2 A;  5CA7 A;  3GV8 B;  3MBY A;  2W9B B;  1DK3 A;  8ICN A;  8ICT A;  3AQM A;  2XC9 A;  5L1L A;  8ICK A;  3PMN A;  2C22 A;  4FBT A;  4TUR A;  3GIJ A;  5L1I A;  2VAN A;  1SKR A;  5EOZ A;  5DG9 A;  1QTM A;  4RQ7 A;  4GXI A;  3E2E A;  2R8H A;  3UQ0 A;  1MIY A;  2DVI A;  1ZQC A;  1KNY A;  2ISP A;  2KN7 A;  4DQQ A;  3PY8 A;  5KFM A;  3C5F A;  2BCV A;  4CCH A;  5KFF A;  3RJF A;  3PX6 A;  4O3N A;  4YR2 A;  3ISC A;  4P2H A;  2DR8 A;  4YMO A;  2WTF A;  1ZQG A;  7ICU A;  2BE3 A;  4DL5 A;  4XUS A;  1RXW A;  2F1I A;  3HW8 A;  1X2I A;  4C8N A;  2W9A A;  5HHI A;  3GV5 B;  4RQ8 A;  4DOB A;  5J29 A;  2ZUC A;  5KFG A;  3HPO A;  4ED2 A;  5DKW A;  5HRL A;  3RRG A;  4F4W A;  1NKB A;  1R8A A;  2AU0 A;  9ICF A;  4X4P A;  1DOQ A;  4QZI A;  3OGU A;  4J9M A;  1R8B A;  4M9H A;  4RWO A;  2XGP A;  8ICJ A;  3NGD A;  5KFC A;  1ZQQ A;  3RR7 A;  3QEA Z;  2AGQ A;  5J2A A;  2BQR A;  4WBZ A;  3IM1 A;  5J2I A;  9ICN A;  3B0X A;  4I2B A;  5DLG A;  3C2K A;  1LB2 B;  4NKU A;  4B9M A;  1X9M A;  4AT9 B;  3OVA A;  4DL7 A;  4FHY A;  1KFD A;  4KLM A;  2V4Q A;  4MFC A;  1NK0 A;  3T5J A;  2XGQ A;  4AT7 A;  5DQI A;  4K4G A;  2UVW A;  5IIM A;  4KLQ A;  4Q8E A;  1NZP A;  1HJP A;  3H7I A;  2BPG A;  3TAR A;  1SL0 A;  5KFX A;  4ED6 A;  4ELT A;  3H8S A;  2RDI A;  1ZJM A;  2RFF A;  2HHT A;  8ICL A;  4QWC A;  4F8R A;  9ICS A;  4WBY A;  1S9F A;  2UVV A;  3HJ4 A;  5HRF A;  4NLN A;  8ICI A;  2W8L A;  3UXP A;  4XQ7 A;  4I28 A;  1ZYQ A;  4ED8 A;  2FMQ A;  3WFR E;  8ICM A;  4C8O A;  3RB3 A;  3LWM A;  4S3N A;  1TFW A;  5J2D A;  3EW9 A;  4IQU A;  3GQC A;  1ZQL A;  3RR8 A;  2AGP A;  2XY5 A;  4I2E A;  4KLS A;  4KLT A;  2M2V A;  3Q8K A;  5CB1 A;  1JXE A;  5BPC A;  4EBJ A;  3IHQ B;  2XCP A;  4QZD A;  5DLF A;  3QZ7 A;  3PW5 A;  3RB0 A;  5IIL A;  2W8K A;  3LWL A;  1UT5 A;  3RH5 A;  3MR5 A;  9ICB A;  5KG3 A;  4UB4 A;  4YFK A;  2F1J A;  4Z6E A;  5DG7 A;  5KT7 A;  2HHS A;  2ZH8 A;  4X4U A;  4X4N A;  4O3O A;  4MFF A;  2ISO A;  3V7L A;  2I1Q A;  3OJU A;  2DFL A;  1T8E A;  2HHV A;  1DGS A;  4DSL A;  3RBD A;  4TQR A;  4ECS A;  8ICH A;  3GDX A;  5KG0 A;  2PFQ A;  2JEJ A;  2PBE A;  3TAP A;  4ECQ A;  3GII A;  1TVA A;  1JXL A;  1ZQD A;  3RJE A;  7ICN A;  4BXO B;  7ICP A;  4EZ9 A;  2C2E A;  4F5O A;  3UPQ A;  4F92 B;  1L5U A;  8ICU A;  2BR0 A;  4YXM A;  3HP6 A;  1NK4 A;  3WFS C;  5KFS A;  1ZQR A;  2ZTD A;  4ECW A;  3GIK A;  4HYK A;  5HP4 A;  1TAQ A;  1U45 A;  4QZ9 A;  5KFD A;  4QZ8 A;  1RYS A;  1XSN A;  4DSJ A;  1SL2 A;  4KTQ A;  2HVH A;  1A76 A;  1WOT A;  5BOL A;  2BCS A;  2LYH A;  4RNM A;  4FHW A;  3ORY A;  2C2R A;  4DSE A;  1V4A A;  3PNC A;  4F4Y A;  4FH3 A;  2ZH4 A;  4DLE A;  7ICM A;  2R8K A;  4NM2 A;  5CR0 A;  1ZQH A;  1S97 A;  4EZ6 A;  4E7X A;  2Y1J A;  1L3S A;  9ICU A;  4P4O A;  3G6Y A;  4DL3 A;  3TI0 A;  2J6S A;  9ICA A;  3H3A A;  9ICO A;  2BQU A;  5TZV A;  2B21 A;  9ICE A;  4RNN A;  2PI4 A;  8ICC A;  5III A;  1R8C A;  5J0O A;  3HIY A;  4ATB B;  1Q78 A;  5KFA A;  3ZDA A;  4RPZ A;  3M8R A;  2MAX A;  3M9M B;  4ECU A;  3ZD9 A;  4DL4 A;  4B9T A;  2NRZ A;  3ISD A;  3OHA A;  3RJI A;  1EXN A;  4YMN A;  3Q8P B;  2DPJ A;  2FMP A;  4B9S A;  1V9P A;  4YMM A;  4KIT B;  5KT5 A;  3RH6 A;  3WFO A;  4UQG A;  1ZQY A;  9ICC A;  4FH5 A;  2V9W A;  4NLZ A;  3C2M A;  5J2F A;  1IXR A;  4ECR A;  5KFT A;  2J6T A;  2PFP A;  4NM1 A;  2HHW A;  1Z00 A;  2J6U A;  3MFI A;  1ZQZ A;  4R8U B;  2BCR A;  1COO A;  4NLK A;  4DF8 A;  4M9L A;  2ZHA A;  4F5N A;  4IR1 A;  5CJ7 A;  2XY6 A;  1U4B A;  9ICJ A;  4QZG A;  5D4B A;  5DEC A;  5F2V O;  2PXI A;  2UVR A;  4YXJ A;  4X0B A;  3WFP A;  4LZG A;  4DS4 A;  1MIW A;  9ICG A;  3RJG A;  3JPP A;  3PW2 A;  4KMU A;  1QSL A;  2HHX A;  3TAQ A;  3MDC A;  4I2F A;  1JIH A;  3EZ5 A;  4RQ6 A;  2RDJ A;  8ICZ A;  5KFH A;  4E8F A;  2DR5 A;  3ZDE A;  4WC6 A;  2BGW A;  9ICL A;  2DR7 A;  5J0S A;  1ZQS A;  1NJX A;  2DR9 A;  2C2D A;  1NK8 A;  3ZDB A;  4DL2 A;  1U47 A;  9ICM A;  1S77 D;  1C7Y A;  4IQV A;  5CHG A;  1ZQM A;  4JV2 A;  4M47 A;  3THV A;  5HRH A;  8ICY A;  4DL6 A;  4RZR A;  4UD5 A;  2KTQ A;  1NKE A;  2ZH1 A;  4ELU A;  4O5K A;  4ED3 A;  3MFH A;  5KT6 A;  4G3I A;  3JPO A;  4RT3 A;  4EBD A;  1XS9 D;  4R64 A;  5HML A;  4PHE A;  1U49 A;  2HW3 A;  1NK9 A;  3LQC B;  9ICI A;  4EBE A;  4WC4 A;  3BQ2 A;  1JAJ A;  4UBC A;  4QZE A;  5L1J A;  4J9O A;  2BCQ A;  4WC2 A;  3G6V A;  3PW7 A;  1WCN A;  4JV0 A;  2AQ4 A;  4PHD A;  2VA2 A;  5HRG A;  3RAQ A;  2FLL A;  2JEF A;  4YD1 A;  2BQ3 A;  2KZZ A;  2Q0Z X;  4J9N A;  4RQ0 A;  4DSF A;  5KFZ A;  5DQG A;  4B9V A;  1BPE A;  4AT8 A;  3T5L A;  5HHH A;  1CEZ A;  3KHG A;  3GV7 B;  4YR3 A;  1JX4 A;  1S0N A;  4X4V A;  2ZJA A;  2DRB A;  1D9F A;  4FO6 A;  1K1S A;  1ZQX A;  4F4Z A;  3JPT A;  4PHP A;  2ASL A;  4XQ8 A;  1JQR A;  2ALZ A;  1QSY A;  3QZ8 A;  4ED1 A;  3JPQ A;  1KFT A;  4EYI B;  7ICO A;  4DQR A;  4M5D A;  5KG6 A;  4XRH A;  3PR4 A;  2R8G A;  1Q79 A;  3C2L A;  3MGH A;  4QZB A;  5DED A;  3EWA A;  1BNO A;  4F4K A;  1NOM A;  2BPC A;  4FHP A;  5J0U A;  4KLF A;  4X4O A;  2PI5 A;  7ICE A;  3SYZ A;  7ICV A;  4WC5 A;  3MR2 A;  5KFR A;  1RPL A;  4UBB A;  5KT2 A;  3N97 B;  4Q43 A;  5D49 A;  1XSL A;  4F3O A;  4B9U A;  1XO1 A;  3KHR A;  1D8Y A;  3K4G A;  4BGD A;  3TFR A;  2BCU A;  8ICO A;  3HJ1 A;  4EP7 A;  5HC9 A;  4YVZ A;  4F5P A;  5J0Q A;  4NXZ A;  3UQ2 A;  5DGB A;  4K4H A;  5IIO A;  4IQT A;  4O3P A;  5J2B A;  3C1Y A;  5DGA A;  4M6W B;  2MUT A;  3LDA A;  4R63 A;  4MEY A;  4KLL A;  5KFO A;  3NYB A;  3C23 A;  1B43 A;  3G6X A;  4B9N A;  4ECX A;  2W9C B;  3RJK A;  7ICQ A;  4WC0 A;  4QZA A;  1KLN A;  4IQW A;  3H4B A;  1UA1 A;  4MF8 A;  5J0P A;  1TKD A;  3T3F A;  3PW0 A;  3M9N B;  1ZQJ A;  5KG2 A;  5EWF A;  4PGQ A;  4WC1 A;  4DEZ A;  1S0V A;  4Z6C A;  4IG8 A;  7ICF A;  3Q8L A;  1ZQK A;  5KFL A;  4F5R A;  1ZQF A;  4O3R A;  4DFM A;  4LVS A;  4DF4 A;  1UEV A;  4Q44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...