5J0TA

Binary complex crystal structure of dna polymerase beta with g:a mismatch at the primer terminus
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
330
structure length
327
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 327
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0tA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0tA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0tA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0tA03
1NK8A 3MR6A 1HUOA 4JV2A 1BVSA 4IR1A 1ZQGA 2FPKA 3ZDEA 2XY5A 1NO5A 4EZ9A 1ZQAA 3NTUA 5KFBA 3ZDAA 4MFFA 5KG5A 3QE9Y 1R8CA 1RYRA 1XU4A 3G6XA 3L9DA 8ICFA 5HRKA 3SI8A 2J6TA 5KFQA 1SL2A 1TAQA 2GWSA 4RQ4A 2ZH3A 1TFYA 4J9MA 2HW3A 5KFDA 1ZJNA 4M0AA 3KHGA 4DFKA 3HIYA 3PW2A 5HRLA 4ATBB 3ZD9A 4DL5A 4FO6A 9ICRA 2AQ0A 5L1LA 3QEBZ 2BPFA 4FBUA 4J9OA 2AU0A 7ICSA 4WC2A 5DG7A 7ICFA 1WCLA 1SKRA 1MQ3A 3RJHA 3GIMA 4WBYA 2F1JA 5KT7A 5DGBA 4F4ZA 4NLKA 1ZQZA 5KFRA 4ECYA 2PFOA 5J29A 1TAUA 2ZUBA 4EBKA 1MIVA 2JEGA 4NLNA 3RBEA 1BNOA 2VA3A 4M9JA 4YD2A 5IINA 3LK9A 5HRIA 2DR7A 1KNYA 3PR4A 4BXOA 4DSLA 4DOCA 3UPSA 9ICVA 4YVZA 3RAXA 5KFIA 2BDPA 4F4XA 5CR0A 5KT2A 2ASLA 7ICLA 1ZQKA 2FMSA 5KG6A 4ELVA 1D9FA 4FS1A 2ZJAA 5JUMA 2Y1IA 2KP7A 3AQLA 5KFHA 1ZQXA 3EPGA 4J9QA 1K1SA 3OUYB 3FDSA 2BCVA 4C8OA 4UB4A 8ICYA 5BPCA 4KLQA 4Z6CA 4RQ3A 1S10A 2W8KA 1S97A 4RPXA 3ETLA 3KHLA 4YMOA 1XO1A 3H4BA 4EBEA 3T5LA 5DLFA 5DG9A 2XCAA 1SL1A 4RWOA 4I2DA 5EWFA 1X2IA 4RQ2A 2R8IA 4DF4A 2FLPA 5KG1A 4MFAA 3RJJA 2IBKA 4O5EA 2P66A 4WC4A 5HRBA 1ZQVA 4KN7A 5EWEA 3AU6A 2R8GA 5HR9A 4ECVA 4Q43A 3HW8A 4J9PA 4B9TA 4M2YA 1D8YA 5IIIA 3UXPA 5CP2A 3WFOA 3K4GA 2RDIA 2FMPA 8ICGA 5DECA 4O3RA 4Z6EA 3Q8MA 3GDXA 2AGOA 4F5OA 7ICEA 3HPOA 4GLXA 2FLNA 4DQSA 4WBZA 3RH6A 3V7LA 4R8UB 4EYIB 2HHWA 4IRDA 1F5AA 2AGPA 8ICJA 1ZQYA 2FPLA 4C8KA 9ICXA 1ZQHA 2O5AA 3WFSC 4J9SA 2BQUA 1D9DA 3LQCB 4M5DA 1ZQDA 4DWIA 2ZJ5A 1KFDA 4RPZA 3PW4A 3KHHA 1D8LA 4KLMA 1Y88A 2XO7A 4ED2A 2ID1A 2A1JB 4M47A 2JZBB 1ZQPA 3JZ0A 1S9FA 1JXEA 2W9AA 3V6JA 4KTQA 4MEYA 4Q44A 4O0IA 3JPOA 4QWAA 3V7JA 4F5NA 1NK4A 3BDPA 4QZBA 2I1QA 4F5QA 4PHPA 9ICTA 4AT9B 2LYHA 3PX6A 2PFNA 7ICJA 4XQ8A 7ICRA 7ICOA 3G6YA 3TFRA 1ZYQA 4QZGA 2C28A 4ECSA 5TZVA 4I2BA 2DR5A 4IQVA 5L9XA 4KLLA 1EXNA 4DQIA 4WC5A 5IIKA 5DBBA 4PGXA 4J9RA 3PW0A 4FBTA 4X4QA 5KT6A 4NKTA 2DPJA 2JEJA 5CA7A 2HHQA 1YLQA 1ZQWA 4EBJA 1S0OA 4X4UA 2DRBA 5KFSA 4E80A 4DOAA 3MABA 3RAQA 1TK5A 1TFRA 4J9NA 1JQRA 4X0BA 4PGQA 2P6UA 4E8FA 3MGHA 4KLJA 4J9KA 7ICHA 1KEJA 4DL7A 4B9UA 2DR9A 3RJEA 3BJYA 7ICVA 4FHXA 4B9NA 2C22A 2BGWA 1C7YA 2ZJ8A 5IIJA 4UBCA 3JPTA 4DS4A 4I2AA 4LVSA 4GXJA 3C21A 1A77A 4ECTA 3OV7A 3RBDA 4UAYA 3TANA 4M04A 5HC9A 4DSEA 3H8JA 5J2GA 9ICLA 4F93B 2UVWA 3JPNA 4BWJA 1Z00A 4NXZA 4ECUA 3N4MB 1B43A 9ICMA 4KLIA 3THVA 2ISPA 4JV0A 3MBYA 4TURA 3OJSA 2W9BA 5J2EA 3V7KA 4F4YA 4RQ0A 2J6SA 4C8LA 1CUKA 5BOLA 4EBCA 3RB0A 4KN4A 1NJZA 1Z3EB 3V6HA 4K4HA 4PGYA 1PX5A 1S0NA 4M9GA 3UXOA 5KG7A 3M9OB 4IQTA 4RT2A 5J0SA 2KFNA 2ZUDA 4X4OA 4KLDA 1ZQJA 1ZQIA 5KFLA 2BCRA 4B9LA 4NLGA 1MSWD 4O5KA 4DL3A 4B9MA 2ZH9A 8ICOA 1X9SA 5KT3A 3PV8A 2DPIA 1KLNA 5KFYA 4YD1A 3OHAA 1X9WA 1ZQLA 4O3NA 2ZTEA 3UQ2A 8ICHA 9ICHA 2ZHBA 4X0AA 4NM2A 5CWRA 1JX4A 9ICOA 2MUTA 4R65A 3GILA 3GV7B 4PHEA 7ICGA 8ICNA 9ICBA 5KG3A 1ZETA 4KLUA 1N48A 1UETA 4S3NA 4UB2A 4GC7A 5DQHA 4YQWA 4GXKA 4ECQA 4R66A 4AT7A 1TFWA 4LZDA 2I9GA 1AROP 4DEZA 4GC6A 3JPPA 3T3FA 5HMMA 3AQMA 4RWQA 4RNNA 5KTQA 3UXNA 4GXIA 5D49A 3H40A 2HHPA 3AUOA 4FHWA 1NK7A 4AT8B 4ECWA 4KMUA 2DFLA 3EYZA 4ED0A 8ICEA 2ZH8A 2XC9A 1H38A 1SL0A 4DLEA 4JWNA 9ICFA 1B22A 4FH3A 9ICUA 5D46A 3T5KA 9ICAA 3OVBA 2BR0A 1U45A 1R8BA 5BOMA 4RT3A 3EPIA 3GQCA 1BPZA 3C5GA 1NJWA 3MR5A 4DO9A 2IHMA 4X4TA 2NRXA 2BHNA 4F91B 2ZH4A 3ZD8A 4TUSA 2BQ3A 2HHVA 3IM1A 4QW8A 5KFGA 5J2FA 4RQ8A 1IXRA 9ICJA 3LDAA 5KT4A 1ZQSA 3AQNA 4F2SA 5DB7A 4TQSA 1K1QA 3OSNA 3BQ1A 4DLGA 8ICKA 1WOTA 2RFFA 2DRAA 4DQQA 2DVIA 5DDYA 3LWLA 1QSSA 2NRWA 2C2DA 1U48A 4JWMA 5DKWA 3PVXA 8ICPA 3MFHA 3PX4A 4ATBA 3HT3A 1ZQTA 1UA0A 3H8SA 1ZQMA 3SV4A 2Y1JA 2IHNA 1U47A 4QWEA 5J0QA 2RDJA 4RNMA 2HHTA 9ICEA 8ICZA 4M6WB 4ED7A 4JUZA 2PFQA 4J9LA 2PXIA 4DOBA 2AJQA 5EWGA 4TUPA 4QZFA 2W9CB 4EBDA 4CCHA 3RJKA 9ICIA 4O3OA 5CB1A 5DGAA 2ZTCA 1BPXA 7ICTA 4UQGA 4I2JA 2ATLA 5J2IA 3JPQA 1JIHA 4RQ1A 3MDAA 2V4RA 1NKCA 4RZRA 2NRTA 8ICXA 3MR3A 3SYZA 4F2RA 5HHHA 3AU2A 1DK2A 3BQTA 3JPRA 2OWOA 3JPSA 3OUYA 9ICKA 5DDMA 3V72A 4KLHA 4YXMA 4R63A 7ICQA 3NYBA 2XGPA 3T5JA 4F4KA 3ISCA 3MDCA 3OVSA 2VA8A 1HJPA 3PMLA 5HRDA 3RRHA 1TK0A 4DSIA 4O9MA 2HHSA 4F92B 3KHRA 4Q8FA 4RQ6A 4ED3A 1ZQBA 3B0YA 5L1KA 1NK0A 5J0RA 7ICMA 3OVAA 5IIMA 3M8SA 4MF8A 1A76A 4YXJA 4YP3A 4UAZA 4YMMA 3QZ8A 2KN7A 3MR2A 4DSFA 3QEAZ 1ZQCA 2FPMA 4O5CA 4KLFA 7ICUA 3H3AA 5J2BA 5KFUA 2AGQA 1U49A 1S0MA 4O3PA 5J0WA 3TI0A 3PO5A 4ELUA 1SZPA 2KTQA 4KLTA 5HRHA 4QZ8A 3OJUA 1RZTA 3PW7A 4IRKA 5KFKA 5KFPA 4RPYA 4R8UA 1XS9D 1SKWA 4DSJA 3HJ4A 5HREA 2ZTDA 3GV5B 7ICNA 2H5XA 2BCUA 2F1HA 4IRCA 3TQ1A 1L3SA 3RB4A 5KG2A 2P6RA 2MAXA 3Q8LA 5KFWA 5J2HA 3WFPA 4JK1A 2W8LA 3H37A 4Z6FA 3MGIA 2M2VA 4QZDA 1NKBA 8ICIA 2UVVA 1XC9A 3NGDA 5KFTA 2W9MA 5C5JA 4QZIA 2BCSA 9ICCA 3ISBA 2ZH2A 4X4VA 2A1JA 2JZBA 3N97B 3ORYA 2XY6A 4PH5A 5J2CA 3OSPA 1UA1A 3Q8QB 4NY8A 3RTVA 2ASDA 9ICSA 1R8AA 4IQWA 4WC0A 4I2CA 1L3TA 4G3IA 2M2UA 1ZJMA 5KFNA 3OGUA 4AT9A 4X4RA 3SZ2A 1NJYA 3H8WA 4B9SA 1L5UA 1NK9A 8ICVA 4F4WA 3GIKA 5DLGA 1BNPA 2UVUA 1DK3A 5KT5A 3IHQB 5D4BA 4M9LA 1S0VA 1S77D 2VA2A 8ICQA 1DGSA 2ASJA 1TK8A 8ICLA 4MEXA 1UEUA 4WC3A 3E2EA 5KFCA 4TQRA 1XSLA 1ZQFA 3ISDA 3RB6A 1TV9A 2PI5A 3RRGA 9ICNA 2NRVA 2IA6A 4DQPA 2ZH7A 5IILA 4F8RA 1ZQOA 3HWTA 1KSPA 4Z6DA 2KZZA 4DFMA 4QZAA 1XWLA 4DL6A 1QTMA 4UB3A 4F5PA 4I2EA 4ED6A 3H39A 1NOMA 3G6VA 2XGQA 4FHVA 4EZ6A 3EWAA 4EEYA 1L3VA 4DFPA 4YR2A 4ED1A 4Q45A 2ZUCA 4XUSA 3EZ5A 4FS2A 2C2RA 5CJ7A 1XSPA 4Q8EA 8ICWA 4M9NA 5DQGA 5HRFA 4P2HA 4P4MA 1COOA 1UT5A 5CHGA 2FMQA 1UEVA 4I29A 4IR9A 4YMNA 8ICCA 1NK6A 4FHPA 3KTQA 4KLOA 2M2WA 5J0PA 4RQ5A 5J2AA 2M9NA 1T4GA 3HP6A 3TARA 4NLZA 3ZDBA 3OHBA 1NKEA 1BPBA 5F2VO 4KITB 1BGXT 3PY8A 3PR5B 4XRHA 5L1IA 4DQRA 4DFJA 3TAPA 5DEDA 1R89A 3H7IA 5HMLA 1TVAA 1QSLA 5L1JA 4YR0A 4YN4A 3Q8SB 2BPGA 2HHUA 2HVHA 4ECZA 5KG4A 4BDPA 1U4BA 3Q8KA 5IIOA 1ZQQA 2BCQA 1BPDA 4K4GA 4DSKA 3H38A 4PHDA 4UD4A 1KTQA 1U9LA 4BGDA 4RUAA 1S76D 4E7XA 7ICPA 1HUZA 1Q78A 4ECXA 4JV1A 2KZMA 1KFSA 4PPXA 4QWCA 2R8JA 4QZCA 1JN3A 4X4PA 3C18A 8ICSA 5KFXA 4I27A 2UVRA 4NM1A 5DBCA 8ICAA 5KFMA 1MQ2A 4RWPA 4KLSA 2V4QA 1DOQA 3RH5A 4M9HA 2ISOA 5DBAA 4C8NA 3M8RA 1KFTA 1ZQRA 4QZEA 4IQUA 4RUCA 2JEFA 1SKSA 4DL2A 5DQIA 4KLGA 1ZQEA 1MIWA 1JXLA 4B9VA 4FHYA 4WC7A 5KG0A 4RQ7A 2FLLA 1KRPA 5EOZA 4BWMA 1MIYA 4MFCA 4AT8A 1Q79A 2XY7A 2VANA 4I2HA 1VFGA 1RXWA 4K4IA 2M2TA 1TKDA 4UAWA 3TFSA 2O1PA 4UD5A 5DB6A 5J0XA 5J2JA 3BQ2A 8ICBA 9ICWA 4X4SA 3B0XA 2ZH6A 4O3QA 1NK5A 3HJ1A 2Q66A 4IG8A 4RU9A 1X9MA 4P4OA 5J2DA 3M9MB 3C2KA 3C66A 3RJIA 2HHXA 1UT8A 4ELTA 5HHIA 3Q8RB 5DB8A 1QLNA 1V9PA 5HRGA 1T8EA 5KFOA 1RYSA 2R8HA 4HYKA 5F9NA 1IM4A 4KLEA 5J0OA 4F5RA 2IMWP 3HX0A 2XCPA 2ALZA 3PO4A 3GIJA 4XQ7A 2DR8A 3GV8B 4MF2A 2B21A 3Q8PB 7ICKA 4I2IA 2AQ4A 2KFZA 3SV3A 1Z00B 5KFFA 1ZQUA 5J0UA 3C23A 5J2KA 4RNOA 4R64A 3BQ0A 4QZHA 2V9WA 4QZ9A 3ZDCA 4YFKA 2KZ3A 3PMNA 1JAJA 2W9BB 5DB9A 2PFPA 1T3NA 3TAQA 3UPQA 1KDHA 2R8KA 4UB5A 3WFRE 4NKUA 4F50A 2BPCA 1MC8A 2F1IA 4DF8A 4WCWA 5F9LA 5J0TA 3RR7A 1V4AA 4EYHB 4F3OA 5HP4A 4I2GA 4M6WA 5HNKA 4WC6A 1NJXA 3RR8A 1CEZA 4YCXA 2ZHAA 2W9CA 2PI4A 4XA5A 1VJ7A 2Q0ZX 4ED8A 4P4PA 3QZ7A 4ECRA 3RJFA 2PBEA 3AQKA 1WCNA 3H4DA 1RPLA 5KFEA 3C2MA 9ICGA 3JYYA 4WC1A 3GFKB 5KFVA 4FH5A 1NZPA 2BQRA 1JMSA 4QWDA 3T5HA 2ZH1A 1XSNA 1RXVA 3M9NB 2MUTB 3GIIA 9ICQA 3EW9A 4TUQA 2BKEA 1N56A 1LB2B 3K75D 4PHAA 3MFIA 4I28A 3UQ0A 3PNCA 2NRKA 4DL4A 1T7PA 3PX0A 4EP7A 2HVIA 4AT7B 4UBBA 4X5VA 5KFAA 8ICMA 3C1ZA 5KFZA 4UB1A 2JEIA 1LV5A 2J6UA 3RJGA 1L3UA 5J0YA 3FYHA 1BPYA 1OU5A 5DG8A 4ZH4A 4QWBA 4QW9A 3V6KA 3PW5A 2NRZA 3C5FA 4BXOB 4O3SA 9ICPA 7ICIA 4RWNA 1ZQNA 4E0DA 2ZH5A 4LZGA 3C2LA 3RH4A 8ICTA 3C1YA 1BPEA 3RB3A 2C2EA 4LT6A 2BE3A 3LWMA 8ICRA 4X4NA 1FA0A 2WTFA 3ZDDA 8ICUA 3WFQE 1PZNA 4DS5A 5KFJA 4I2FA 4YR3A 1QSYA 4C8MA 4YG2A
chains in the Genus database with same CATH superfamily
1NK8A 4WOYA 3TACB 5AKHA 3PSIA 1NO5A 3NTUA 4NXXA 1RYRA 3L9DA 3SI8A 5KFQA 1SL2A 2RLTA 4HX0A 3KHGA 4DFKA 2NYVA 4ATBB 4DL5A 4ACOA 4WC2A 1LKYA 1WCLA 1SKRA 3RJHA 2F1JA 2HBMA 5J8YA 2PFOA 2JEGA 4NLNA 3RBEA 1T94A 4YD2A 5IINA 4BXOA 4YVZA 2E3TA 7ICLA 4F4XA 5CR0A 3QYPA 5KT2A 3BS5B 2WHEA 5G5GA 5KG6A 1O03A 3DEEA 2BBHA 2L5YA 3FDSA 3F5AA 4Z6CA 4Y2JA 3ETLA 4YMOA 4DF4A 4C4RA 3RJJA 5ALVA 5EWEA 3AU6A 2GO7A 5HR9A 4J9PA 1NNLA 5IIIA 1QH9A 3WFOA 5AI0A 8ICGA 2AGOA 2E8OA 3RH6A 5ALDA 4IRDA 1F5AA 5C0YA 8ICJA 2FPLA 4J9SA 3LQCB 1ZQDA 4DWIA 1KFDA 4KLMA 3JZ0A 3D2QA 4J03A 5H2FU 2FDRA 4MEYA 4Q44A 2A19A 3V7JA 3BDPA 1ECWA 2I1QA 3NUQA 2LYHA 2N1RA 7ICJA 3TFRA 4NWIA 3K7DA 1N2XA 5TZVA 4I2BA 5AK6A 4DQIA 5DBBA 4J9RA 4FBTA 3EF2A 5KT6A 2HHQA 2A1AA 1S0OA 4X4UA 1L7NA 5KFSA 2QLTA 4KLJA 4DL7A 4B9UA 5T14A 4FHXA 4UARA 1C7YA 2ZJ8A 4UBCA 2YN4A 3OV7A 2KKPA 4DSEA 1M6YA 4F93B 4FZMA 2UVWA 3JPNA 4BWJA 1B0XA 3WK5A 9ICMA 3NWIA 1XNSA 3THVA 2W9BA 5J2EA 4RQ0A 2G5HB 4EBCA 3RB0A 4C4TA 1Z3EB 3V6HA 5J0SA 3T79A 3QXGA 2BCRA 3LVWA 3DV9A 4B9LA 2ZH9A 5KT3A 2DPIA 5KFYA 4YD1A 3OHAA 3GZFA 3UQ2A 9ICHA 5EE9A 4X0AA 2MUTA 4Y2RA 3GILA 4PHEA 3HKZF 9ICBA 2H3FA 4KLUA 4B6JA 1UETA 4UB2A 4GC7A 4AT7A 4GXKA 4ECQA 4R66A 1KN5A 2I9GA 5CEHA 4GC6A 3JPPA 2KHQA 4FE3A 5KTQA 5D49A 3H40A 1CRXA 4FHWA 2IOFK 8ICEA 5AI9A 2XC9A 1H38A 4C0ZA 1MA7A 4JWNA 2OM6A 3NKUA 2VIXA 3T5KA 2Y0SC 1U45A 2JV3A 1BPZA 3AQEA 2JGAA 1NJWA 3MR5A 3ZD8A 2HHVA 5J2FA 9ICJA 3M1YA 5KT4A 5DB7A 4TQSA 2DRAA 2DVIA 3LWLA 5AI8A 2NRWA 2C2DA 1U48A 2DL0A 8ICPA 4O3MA 3M6KA 1ZQMA 1F5SA 3OWGA 4QWEA 5J0QA 2RDJA 2PXIA 4DOBA 1QQ7A 9ICIA 3QU5A 2ZTCA 5AM1A 4UQGA 4I2JA 4NLCA 2BBJA 5J2IA 4EEDA 4RQ1A 2V4RA 2NRTA 3VCBA 1RM6C 3AU2A 9ICKA 2XI9A 4KLHA 3ISCA 1HJPA 3RRHA 2HHSA 4F92B 1NK0A 5J0RA 4DCCA 4MF8A 1A76A 4YXJA 4DSFA 4UAZA 4YMMA 3QEAZ 5AHXA 2E8MA 2FPMA 1ZD2P 4O3PA 5J0WA 1SZPA 2YTUA 3OJUA 5KFKA 4FZLA 5KFPA 4RPYA 1XS9D 1SKWA 3HJ4A 2AH5A 2XICA 7ICNA 4PL1A 2BCUA 4IRCA 2W3SA 4BJQA 3TQ1A 2P6RA 3BQ7A 3Q8LA 4LEVA 2W8LA 3MGIA 2UVVA 4Y2TA 5KFTA 2BCSA 1PK1A 2G06A 2JH7A 2XY6A 5J2CA 2HOQA 4I2CA 3OGUA 4AT9A 4X4RA 3SZ2A 8ICVA 4G9BA 5DLGA 5ALOA 1S77D 3IHQB 5G5HA 2OCEA 1DGSA 4K99A 2ASJA 1TK8A 3E2EA 3C28A 1CI4A 2BDUA 4MHVA 1S8OA 3IRUA 5ALTA 2NRVA 4Y2SA 3MGVA 2PI5A 5IILA 4Z6DA 4QNLA 2KZZA 1JUDA 4ED6A 1NOMA 4FHVA 2DQNB 1L3VA 2KIWA 2W7PA 4I0UA 5CJ7A 1UT5A 1UEVA 1LVHA 5GTIU 3TADA 5J0PA 3TARA 5F2VO 4Y2XA 2WAQC 1BPBA 3AL0B 4KITB 3QU7A 3IP4B 5DEDA 2W43A 5HMLA 1TVAA 2QKQA 5L1JA 2HHUA 2WF8A 1BPDA 4K4GA 1U9LA 4RUAA 2LYBA 4EELA 5TISU 2UVRA 8ICAA 1MQ2A 1DOQA 1L7PA 4QZEA 2JEFA 4KLGA 1ZQEA 4NXUA 4WC7A 2FLLA 1COKA 4I2HA 1VFGA 1RXWA 4UB6U 5ALIA 5J2JA 8ICBA 2Q66A 4O3QA 4RU9A 3WKCA 5HR7A 3M9MB 3C66A 2HHXA 1URJA 5DB8A 2R8HA 5F9NA 3DDHA 3CYMA 2IMWP 3HX0A 3GIJA 2ZIVA 1SV0A 4NXWA 2CN1A 4RNOA 4R64A 3BQ0A 3ZDCA 2W9BB 5AKEA 2PFPA 3TAQA 3UPQA 4NKUA 4EEBA 5ALKA 4F50A 1V4AA 4RQMA 4EYHB 5HNKA 2ZHAA 2W9CA 4FO1A 5ALSA 2E5SA 3RJFA 1RPLA 3GU3A 5KFEA 4U6PA 4WC1A 3GFKB 2ZIUB 2BQRA 1JMSA 4NLBA 3SAFA 5AIBA 2MUTB 2GOLA 4TUQA 3SQIA 2DGZA 4PHAA 4I28A 1T7PA 4ICAA 3IDWA 4JLXA 4AT7B 1IV8A 4X5VA 5HR6A 8ICMA 3MC1A 3WKAA 2JEIA 4PZOA 2KVCA 4OAFA 4EV6A 3V6KA 3PW5A 2KJ9A 4RWNA 7ICIA 1SB3C 3C2LA 8ICTA 2Y0SF 4F71A 2BE3A 2ODGA 4KX3A 2WTFA 2Z7JA 3ZDDA 3WKEA 1RG6A 4UB8U 5KFJA 2F44A 4AP9A 3MR6A 1HUOA 1BVSA 1ED1A 4IR1A 2KHVA 5KFBA 4C7YA 2NO5A 5KG5A 3QE9Y 4MFFA 1N5WA 1XU4A 8ICFA 2KNJA 4RQ4A 2WF9A 1ZJNA 3HIYA 1V38A 3ZD9A 9ICRA 2DBYA 2AQ0A 1WYGA 5L1LA 7ICFA 3N7PD 4F4ZA 4NLKA 4WQLA 4ECYA 2ZUBA 1BNOA 4IS7A 2DR7A 5AKXA 2MSNA 3PR4A 2KIVA 4DSLA 3N28A 4NL9C 1D9FA 1GO3F 1ZQXA 3EPGA 4EGWA 4KLQA 1S10A 4CGZA 3HKZC 4RPXA 3NRWA 3H4BA 3KD3A 3T5LA 5DLFA 1ZXIA 4RWOA 5DG9A 4I2DA 5EWFA 1X2IA 2LM4A 2FLPA 5KG1A 4MFAA 2IBKA 2EQYA 2P66A 4WC4A 4OAHA 5K4LA 4M2YA 1D8YA 5CP2A 2KE7A 3HPOA 4DQSA 3L3FX 3V7LA 4EYIB 1TE2A 2AGPA 1ZQYA 3AMZA 4C8KA 1JI7A 4M5DA 4LEWA 2ZJ5A 3WKDA 4RPZA 1D8LA 4M47A 1PK1B 1JXEA 2W9AA 2KJ5A 4QZBA 4AT9B 2IUBA 2YMLA 7ICRA 7ICOA 3WK6A 2B56A 4IQVA 1EXNA 5ALWA 3IG5A 5IIKA 2JEJA 1YLQA 2Y9UA 1ZQWA 4EBJA 1JRPA 1TFRA 1FO4A 4J9NA 4X0BA 5KL8B 5ALGA 5AICA 2P6UA 1YT3A 7ICHA 1KEJA 2DR9A 3SAGA 7ICVA 3ZI4A 2C22A 2BGWA 4LVSA 4I2AA 4GXJA 3C21A 1A77A 5KAIU 4ECTA 4UAYA 5HC9A 3HJEA 5J2GA 2BZFA 4ECUA 2LM1A 2WAQF 3J81j 2KMDA 2LBOA 3MBYA 3TKAA 3OJSA 4C8LA 2EDUA 1CUKA 3QNMA 1N60A 2E8NA 4M9GA 3UXOA 5KG7A 4RT2A 2F76X 4QIWC 4NLGA 3E0FA 1MSWD 4DL3A 4B9MA 2DF4B 5ALJA 3AM9A 4OJ5A 5ALNA 2ZHBA 3GV7B 7ICGA 5KG3A 3CRXA 1ZETA 2DKXA 5EE3A 1TFWA 4LZDA 4O67A 4DEZA 3T3FA 5HMMA 2EANA 3F2BA 2DWQA 3UXNA 2HHPA 4AYBC 1NK7A 4KMUA 5ALFA 1SL0A 4DLEA 1FIQA 1B22A 5D46A 5KNIA 1R8BA 5BOMA 4RT3A 1IG6A 2NRXA 4F91B 4TUSA 3IM1A 4QW8A 5KFGA 4RQ8A 3N7RC 3LDAA 2ZIVB 2I5HA 3OSNA 4DLGA 1WOTA 2RFFA 2O6KA 2B51A 1GPJA 1S5LU 1QSSA 4JWMA 5AKIA 5DKWA 3PVXA 3H0MB 9ICEA 4RNMA 2HHTA 5AK4A 2LHTA 4J9LA 3KKAA 5EWGA 4TUPA 4QZFA 2W9CB 2ZG6A 1SGGA 3UM9A 5CB1A 1ZQ1C 1VJ5A 3IG8A 4BUGA 1JIHA 8ICXA 1OW5A 4F2RA 3SYZA 1DK2A 2OWOA 3JPRA 3IV6A 3V72A 4YXMA 3NYBA 3KZXA 4FFDA 5HRDA 2EAOA 4Q8FA 2EH9A 5L1KA 3EUB2 2GA9D 2F2AB 3MR2A 3QUTA 7ICUA 5CHEA 2FCLA 5J2BA 2AGQA 1S0MA 4CNQA 4KM5A 4ELUA 2KICA 3BZKA 2ES6A 2KK0A 2HBLA 4R8UA 5HREA 4CRXA 3GV5B 2H5XA 1L3SA 3WFPA 5KFWA 2LI6A 4JK1A 4Z6FA 2IOFA 1NKBA 8ICIA 3O0FA 5C5JA 4QZIA 2JZBA 3NRZA 2DKZA 4PH5A 1UA1A 4WC0A 3C29A 1R8AA 4IQWA 4G3IA 1SZHA 1L5UA 1NK9A 3NVVA 4EENA 4CF5A 1FEZA 3WK7A 1N62A 5AKGA 2UVUA 1DK3A 1C20A 1PK3A 2VA2A 4P0PB 4UAVA 4Y2QA 5AM0A 4MEXA 1XSLA 1TV9A 1N5XA 2ZH7A 1DXSA 2YMPA 2KV2A 2EAMA 1ZQOA 1K5OA 2JH1A 3RF9A 2XVTA 4DFMA 2YMQA 1QTMA 4F72A 4UB3A 1Q46A 1SV4A 1X40A 2AXTU 1J2NA 3H8MA 3EWAA 2W54A 4DFPA 4Q45A 4XUSA 1XSPA 8ICWA 4Q8EA 4M9NA 5DQGA 2E1FA 1COOA 2FMQA 3ER8C 4IR9A 2A3VA 8ICCA 1NK6A 1PUZA 4KLOA 2M2WA 4RQ5A 5J2AA 3ERCC 4NLZA 3ZDBA 2CPRA 4DFJA 3ETRA 2F77X 4ECZA 4BDPA 1U4BA 2BCQA 4CF4A 4DSKA 1YZ7A 5A0LA 4PHDA 1J97A 3H38A 1WG8A 1S76D 1HUZA 4QWCA 4X4PA 1JN3A 5DBCA 5AM2A 5FP0A 1Q3VA 2LMRA 4IQUA 1SKSA 5DQIA 4FHYA 4RQ7A 4AT8A 3HRDD 3UMBA 1TKDA 2M2TA 3D6JA 5DB6A 4X4SA 9ICWA 1Z19A 4IG8A 1X9XA 3RJIA 3L5KA 1UT8A 4ELTA 1V9PA 5HRGA 1RYSA 4HYKA 1D8BA 1IM4A 1VLBA 2XCPA 2ALZA 4XQ7A 2DR8A 3Q8PB 7ICKA 4I2IA 4GIBA 2KFZA 3SV3A 1JALA 5KFFA 4QZHA 4ZOHC 4YFKA 3PMNA 1XO0A 5ALYA 1T3NA 1FFUA 4UATA 3F5EA 4QIWF 1L8LA 1CEZA 2GLEA 4XA5A 4P4PA 3QZ7A 4ECRA 2PBEA 4CF3A 3M7DA 3QUQA 3JYYA 1VDVA 3T5HA 1XSNA 3SR6A 3GIIA 3EW9A 1LKYB 3K75D 3MFIA 3UQ0A 3PNCA 3PX0A 2HVIA 1WWUA 4UBBA 3AQFA 4AYBF 3L4PA 3C1ZA 4UB1A 1LV5A 1L3UA 3K1RB 4ZH4A 4QWBA 4BXOB 2NRZA 3C5FA 4WJ3B 3RH4A 4LT6A 8ICRA 1FA0A 3WFQE 2EAPA 4KLSA 2K4EA 4JV2A 5AM3A 2CRXA 2QB0A 1PVPA 1ZQGA 2FPKA 2H3ZA 3AEVA 1R8CA 5AKZA 3N7SC 4OAGA 2J6TA 1TAQA 1YZ6A 5AM5A 1TFYA 4J9MA 2HW3A 5KFDA 3PW2A 2KEYA 4FO6A 4FBUA 2BPFA 4J9OA 2HMXA 4NV0A 5DG7A 3GIMA 2K4PA 4WBYA 1UQVA 2FE9A 5DGBA 1TAMA 1ZQZA 5KFRA 3F53A 4EBKA 1MIVA 2VA3A 3LK9A 2KVSA 2G09A 3RAXA 5KFIA 1ZQKA 2FMSA 4FS1A 2ZJAA 5JUMA 3AQLA 5KFHA 5D61A 4A8EA 2HI0A 1V97A 2BCVA 4RQ3A 1S97A 5B5EU 4EBEA 1SL1A 2XCAA 4IL6U 5JTGA 2XIDA 2NV3A 3KFUF 4KN7A 2R8GA 4B9TA 5EE0A 5D63A 3I76A 3K4GA 2FMPA 2KJ8A 4O3RA 4GLXA 2FLNA 4R8UB 4JMUA 3BS7A 4JB3A 9ICXA 1ZQHA 1OXJA 2O5AA 3WFSC 3QU2A 2BQUA 1D9DA 4KMOB 1KL9A 2B4VA 3I1YA 4JLZA 2WF5A 3KHHA 1Y88A 1OUQA 4ED2A 2ID1A 2JZBB 1ZQPA 1S9FA 4KTQA 4OJ6A 3JPOA 1NK4A 4F5NA 9ICTA 4PHPA 2YB4A 3PX6A 3HILA 5JRTA 1ZYQA 4ECSA 1DGJA 4WC5A 5AKKA 4PGXA 3PW0A 4X4QA 1UHUA 1ZD5A 1V85A 2DRBA 3LYSA 1JQRA 2F8KA 4PGQA 2FJ6A 4EX6A 3BJYA 4B9NA 2H3VA 2R18A 5IIJA 3JPTA 4M04A 9ICLA 1B43A 4KLIA 4JV0A 5ALEA 3V7KA 2J6SA 4KN4A 4KB6A 4K4HA 1PX5A 4OCZA 3M9OB 4IQTA 5KFLA 4O5KA 4Y2VA 8ICOA 4C7ZA 3PV8A 1ZQLA 1JX4A 2YB1A 4S3NA 1N48A 5ALUA 4YQWA 2LKYA 1Q8KA 3AQMA 4RWQA 4RNNA 4GXIA 5J8YC 2GH1A 4AT8B 4OO1J 3EYZA 4ED0A 2ZH8A 4FH3A 9ICAA 3OVBA 2ZIXA 3QU4A 3GQCA 3C5GA 2AHOB 2IHMA 4DO9A 3H0RB 2ZH4A 2W7OA 2OEHA 4USAA 3D2NA 4F2SA 3BQ1A 8ICKA 1RDFA 4EEKA 3ED5A 3MFHA 3H0LB 1Z4OA 3HT3A 1ZQTA 1UA0A 3H8SA 3F2CA 4OJPA 8ICZA 3WK4A 2PFQA 4CCHA 3RJKA 4O3OA 3PSTA 1BPXA 7ICTA 2W11A 4OJOA 2ATLA 1UCVA 4UAUA 4XJEA 3MDAA 1NZBA 1NKCA 4RZRA 3MR3A 1RQLA 3OUYA 3JPSA 5DDMA 4R63A 3T5JA 2HOIA 2VA8A 1KKXA 1TK0A 4O9MA 2P35A 4RQ6A 2ESEA 1ZRNA 2MRLA 3OVAA 3M8SA 2KN7A 4YP3A 4O5CA 4KLFA 3H3AA 5KFUA 3PO5A 3D2SA 4KLTA 5HRHA 4QZ8A 1N63A 2YMMA 1QQ5A 4DSJA 2Q4TA 2LPEA 3RB4A 5KG2A 2M2VA 4QZDA 1ZD4A 9ICCA 2W9MA 2K4IA 3S6JA 4X4VA 3ISBA 5ALHA 2A1JA 2W03A 9ICSA 4NY8A 3Q8QB 3RTVA 4RQNA 2HBKA 1L3TA 1ZJMA 3ONNA 1NJYA 3H8WA 1T3QA 4F4WA 1BNPA 8ICLA 1UEUA 4WC3A 1HEKA 5KFCA 1ZQFA 9ICNA 2IA6A 4F8RA 1SXEA 1F0MA 1QCKA 4QZAA 1XWLA 4DL6A 4EZ6A 4EEYA 2MA1A 3EZ5A 4LEYA 5HRFA 4P2HA 3PHZA 4P4MA 4K9BA 3U26A 5CHGA 5ALXA 4YMNA 1SWWA 2HDOA 5CFUA 1T4GA 5AK5A 3OHBA 1NKEA 3PY8A 3PR5B 5L1IA 3TAPA 3OTQA 1P7DA 2WF6A 1QSLA 4NL9A 2BPGA 4YN4A 2HVHA 5KG4A 1ZQQA 2KSOA 5JU5A 1KTQA 3WU2U 7ICPA 4JV1A 1KFSA 2R8JA 3C18A 5KFXA 5ALZA 4RWPA 5KFMA 2V4QA 2ZIWA 3RH5A 4M9HA 2ISOA 1L7MA 4C8NA 2HN1A 4RUCA 5E79U 1MIWA 2OHFA 1MIYA 1KRPA 5AKLA 4BWMA 2XY7A 2B0CA 4O68A 2O1PA 3IN5A 1SXDA 3BQ2A 2CXYA 4Y2PA 1NK5A 2WF7A 3C2KA 5HHIA 3Q8RB 1QLNA 5KFOA 4KLEA 5J0OA 3PO4A 5JTIA 3GV8B 4MF2A 2B21A 5J0UA 2K60A 4C4SA 1X6JA 3M6ZA 1JAJA 2YY6A 2R8KA 1Z4NA 2BPCA 4DF8A 3NVZA 4WCWA 5F9LA 2K4HA 5HP4A 4WC6A 4M6WA 1NJXA 3RR8A 4YCXA 4K9AA 1VJ7A 4U7CA 4ED8A 9ICGA 5KFVA 2PKEA 1NZPA 2ZH1A 4QWDA 4KX5A 1RXVA 2PMZC 2BKEA 4LJXA 1LB2B 5F3XB 4OJLA 4DL4A 3NS1A 5KFAA 3AN1A 2EZYA 3RJGA 4US9A 1Q3UA 2JMGA 5J0YA 1BPYA 2G08A 5DG8A 4QW9A 4O3SA 4IC9A 4Y2UA 1ZQNA 2IHOA 1L6NA 1BPEA 3RB3A 3LWMA 3NASA 8ICUA 4DS5A 5L1MA 4YR3A 4C8MA 4YG2A 2ZIXB 3SD7A 4C80A 3ZDEA 2XY5A 2QB1A 4EZ9A 1ZQAA 3VC8A 3ZDAA 3G6XA 5HRKA 5AK3A 2GWSA 2ZIUA 2ZH3A 4M0AA 5HRLA 7ICSA 1HIWA 3QEBZ 2AU0A 1MQ3A 3ICXA 5AI5A 1N61A 1SIJA 5KT7A 4P0QA 3TADC 1TAUA 5J29A 2KKVA 1IIPA 4M9JA 5HRIA 1KNYA 3UMCA 1DRGA 4DOCA 3QUBA 1PVRA 9ICVA 3UPSA 2BDPA 2ASLA 4ELVA 3MCRA 2Y1IA 2RQ5A 2HCFA 2VKQA 4PZNA 3I28A 4J9QA 1K1SA 3OUYB 4C8OA 1ZD3A 4UB4A 8ICYA 5BPCA 2W8KA 2ZXIA 4OD0A 2WB1C 3KHLA 1XO1A 4RQ2A 1FFVA 2R8IA 4O5EA 2RRDA 4CDGA 2W55A 5HRBA 4WQKA 1ZQVA 4ECVA 4Q43A 3HW8A 5GTHU 1MN8A 3UXPA 2RDIA 1A0PA 5DECA 2E1EA 4Z6EA 3Q8MA 3GDXA 4F5OA 7ICEA 4WBZA 2HHWA 2JHDA 4US8A 4FZNA 3PW4A 2XO7A 2JXJA 4NJ8A 2A1JB 3QU9A 5EE1A 1SV0C 3WK9A 3V6JA 1X6IA 4O0IA 1X66A 4QWAA 4F5QA 2PFNA 4XQ8A 3G6YA 3CNHA 4QZGA 2C28A 3ER9B 2DR5A 2HSZA 5L9XA 2IOHA 4NXTA 4KLLA 5B3PA 5AI4A 2Y9TA 1KBUA 4NKTA 2DPJA 2W04A 1ZOLA 5B66U 5CA7A 4PL2A 2GAFD 4UASA 4E80A 4BX9C 4DOAA 3MABA 3RAQA 1TK5A 4K8VA 3CK6A 4E8FA 3MGHA 1JROA 4J9KA 3RJEA 2EZZA 5CRXA 4DS4A 2QARA 3RBDA 3TANA 3H8JA 2G5IB 3NVOA 4OAIZ 1Z00A 4NXZA 2W3RA 3N4MB 2EZXA 2ISPA 4TURA 4F4YA 3A0HU 5BOLA 3OPXA 1NJZA 1AQ6A 4PGYA 1S0NA 1Z1VA 2KFNA 2ZUDA 4X4OA 4KLDA 1ZQJA 1ZQIA 5CFSA 5KAFU 1KLNA 4GFJA 1X9WA 2KSOB 4O3NA 2ZTEA 5ALRA 4DFDA 8ICHA 2KG5A 4NM2A 5CWRA 9ICOA 4R65A 8ICNA 5AI6A 1RYUA 1WUDA 5DQHA 2YQEA 3CP8A 2ZIWB 1AROP 5CFTA 3KBBA 2K8BB 3AUOA 3WKBA 3R9KA 4ECWA 1A6SA 2E8PA 4K97A 2DFLA 3SMVA 2F8LA 9ICFA 9ICUA 4NXVA 2BR0A 3EPIA 4X4TA 1L8OA 2BHNA 2BQ3A 4Y2YA 1IXRA 3K1ZA 2OXOA 1ZQSA 2OYYA 1K1QA 4DQQA 5DDYA 3E58A 4ATBA 3PX4A 3F2DA 4UW9A 3SV4A 2Y1JA 2IHNA 1U47A 4WH5A 1X42A 4M6WB 4ED7A 4JUZA 2AJQA 1PVQA 4EBDA 1NI3A 5DGAA 4N7RA 2PMZF 5AIAA 3BS5A 3JPQA 3PZPA 4EX7A 5HHHA 1B4FA 3BQTA 7ICQA 2H3QA 2XGPA 2VJ4A 4F4KA 5KL1B 3MDCA 3OVSA 3PMLA 2DUYA 4DSIA 3KHRA 4ED3A 1ZQBA 3B0YA 5AKJA 7ICMA 5IIMA 3QZ8A 1ZQCA 1U49A 3TI0A 2KTQA 3FM9A 1RZTA 3PW7A 4IRKA 2JR5A 2ZTDA 3NVWA 2F1HA 3QUCA 3PSFA 2MAXA 5J2HA 3H37A 3RFAA 2K8CB 1XC9A 3NGDA 2ZH2A 3N97B 5AKYA 3ORYA 3AQNA 3OSPA 2ASDA 2ZXHA 2M2UA 2K89A 5KFNA 3QX7A 2HN2A 1J2MA 4B9SA 4P0QB 1SWVA 2F3NA 3GIKA 5KT5A 5D4BA 4M9LA 1S0VA 8ICQA 4TQRA 3ISDA 3RB6A 3RRGA 4DQPA 3HWTA 2WB1F 5ALMA 1WWVA 1KSPA 3SENA 4F5PA 4I2EA 3H39A 5AM4A 3G6VA 2XGQA 4YR2A 4ED1A 2ZUCA 4FS2A 2D8CA 2C2RA 2HBJA 2LYAA 4I29A 4FHPA 3KTQA 5ALQA 3HP6A 2M9NA 1BGXT 4XRHA 4DQRA 5ALLA 1R89A 3H7IA 5ALPA 2MU2A 4YR0A 3Q8SB 3FC4A 3Q8KA 2EWRA 4P0PA 5IIOA 4K96A 4UD4A 1ZRMA 4BGDA 4E7XA 2RP5A 1Q78A 3PSPA 4ECXA 2OH2A 1QQ6A 2KZMA 4PPXA 4QZCA 8ICSA 4I27A 4NM1A 2RHFA 4O6AA 4MKPA 1KFTA 5DBAA 3M8RA 1ZQRA 4DL2A 2M0NA 1JXLA 3KKAC 4B9VA 5KG0A 5EOZA 4MFCA 1Q79A 1F44A 2VANA 4K4IA 4UAWA 3TFSA 4UD5A 5J0XA 2ZH6A 3B0XA 3HJ1A 1X9MA 3JCFA 4P4OA 5J2DA 2JRZA 3NVYA 2KD1A 1T8EA 3B9JA 2QARB 3KOOA 3SEIA 2YX8A 2AQ4A 3CW2C 3A0BU 2KP7A 1Z00B 1X9SA 1ZQUA 3C23A 1KW4A 5J2KA 2V9WA 1O08A 4QZ9A 2KZ3A 2KOBA 5DB9A 1KDHA 3WFRE 4UB5A 2F1IA 1MC8A 4K98A 1RQNA 4HAIA 5J0TA 3RR7A 4F3OA 4I2GA 2QB0B 2FI1A 2PI4A 2Q0ZX 3AQKA 1WCNA 3H4DA 3SAHA 2NO4A 4CE6A 1Z1BA 1UPHA 3C2MA 4PJ0U 4FH5A 2K8AA 2G0AA 3WK8A 3M9NB 3LVVA 2G07A 2WFAA 2I6XA 9ICQA 5B3QA 1N56A 2B6GA 3FAHA 3BZCA 2NRKA 3UMGA 5D62A 4EP7A 4QJFB 2D6FC 4O69A 5KFZA 2J6UA 4LEZA 3FYHA 1OU5A 9ICPA 3ALRA 4E0DA 2ZH5A 4LZGA 3C1YA 3KZIU 1KQQA 2C2EA 2D3DA 2H3IA 1L7OA 4X4NA 1PZNA 2HOFA 4I2FA 4F5RA 1QSYA 2VJ5A
chains in the Genus database with same CATH topology
1NK8A 3MR6A 1HUOA 4JV2A 1BVSA 4IR1A 1ZQGA 2FPKA 3ZDEA 2XY5A 1NO5A 4EZ9A 1ZQAA 3NTUA 5KFBA 3ZDAA 4MFFA 5KG5A 3QE9Y 1R8CA 1RYRA 1XU4A 3G6XA 3L9DA 8ICFA 5HRKA 3SI8A 2J6TA 5KFQA 1SL2A 1TAQA 2GWSA 4RQ4A 2ZH3A 1TFYA 4J9MA 2HW3A 5KFDA 1ZJNA 4M0AA 3KHGA 4DFKA 3HIYA 3PW2A 5HRLA 4ATBB 3ZD9A 4DL5A 4FO6A 9ICRA 2AQ0A 5L1LA 3QEBZ 2BPFA 4FBUA 4J9OA 2AU0A 7ICSA 4WC2A 5DG7A 7ICFA 1WCLA 1SKRA 1MQ3A 3RJHA 3GIMA 4WBYA 2F1JA 5KT7A 5DGBA 4F4ZA 4NLKA 1ZQZA 5KFRA 4ECYA 2PFOA 5J29A 1TAUA 2ZUBA 4EBKA 1MIVA 2JEGA 4NLNA 3RBEA 1BNOA 2VA3A 4M9JA 4YD2A 5IINA 3LK9A 5HRIA 2DR7A 1KNYA 3PR4A 4BXOA 4DSLA 4DOCA 3UPSA 9ICVA 4YVZA 3RAXA 5KFIA 2BDPA 4F4XA 5CR0A 5KT2A 2ASLA 7ICLA 1ZQKA 2FMSA 5KG6A 4ELVA 1D9FA 4FS1A 2ZJAA 5JUMA 2Y1IA 2KP7A 3AQLA 5KFHA 1ZQXA 3EPGA 4J9QA 1K1SA 3OUYB 3FDSA 2BCVA 4C8OA 4UB4A 8ICYA 5BPCA 4KLQA 4Z6CA 4RQ3A 1S10A 2W8KA 1S97A 4RPXA 3ETLA 3KHLA 4YMOA 1XO1A 3H4BA 4EBEA 3T5LA 5DLFA 5DG9A 2XCAA 1SL1A 4RWOA 4I2DA 5EWFA 1X2IA 4RQ2A 2R8IA 4DF4A 2FLPA 5KG1A 4MFAA 3RJJA 2IBKA 4O5EA 2P66A 4WC4A 5HRBA 1ZQVA 4KN7A 5EWEA 3AU6A 2R8GA 5HR9A 4ECVA 4Q43A 3HW8A 4J9PA 4B9TA 4M2YA 1D8YA 5IIIA 3UXPA 5CP2A 3WFOA 3K4GA 2RDIA 2FMPA 8ICGA 5DECA 4O3RA 4Z6EA 3Q8MA 3GDXA 2AGOA 4F5OA 7ICEA 3HPOA 4GLXA 2FLNA 4DQSA 4WBZA 3RH6A 3V7LA 4R8UB 4EYIB 2HHWA 4IRDA 1F5AA 2AGPA 8ICJA 1ZQYA 2FPLA 4C8KA 9ICXA 1ZQHA 2O5AA 3WFSC 4J9SA 2BQUA 1D9DA 3LQCB 4M5DA 1ZQDA 4DWIA 2ZJ5A 1KFDA 4RPZA 3PW4A 3KHHA 1D8LA 4KLMA 1Y88A 2XO7A 4ED2A 2ID1A 2A1JB 4M47A 2JZBB 1ZQPA 3JZ0A 1S9FA 1JXEA 2W9AA 3V6JA 4KTQA 4MEYA 4Q44A 4O0IA 3JPOA 4QWAA 3V7JA 4F5NA 1NK4A 3BDPA 4QZBA 2I1QA 4F5QA 4PHPA 9ICTA 4AT9B 2LYHA 3PX6A 2PFNA 7ICJA 4XQ8A 7ICRA 7ICOA 3G6YA 3TFRA 1ZYQA 4QZGA 2C28A 4ECSA 5TZVA 4I2BA 2DR5A 4IQVA 5L9XA 4KLLA 1EXNA 4DQIA 4WC5A 5IIKA 5DBBA 4PGXA 4J9RA 3PW0A 4FBTA 4X4QA 5KT6A 4NKTA 2DPJA 2JEJA 5CA7A 2HHQA 1YLQA 1ZQWA 4EBJA 1S0OA 4X4UA 2DRBA 5KFSA 4E80A 4DOAA 3MABA 3RAQA 1TK5A 1TFRA 4J9NA 1JQRA 4X0BA 4PGQA 2P6UA 4E8FA 3MGHA 4KLJA 4J9KA 7ICHA 1KEJA 4DL7A 4B9UA 2DR9A 3RJEA 3BJYA 7ICVA 4FHXA 4B9NA 2C22A 2BGWA 1C7YA 2ZJ8A 5IIJA 4UBCA 3JPTA 4DS4A 4I2AA 4LVSA 4GXJA 3C21A 1A77A 4ECTA 3OV7A 3RBDA 4UAYA 3TANA 4M04A 5HC9A 4DSEA 3H8JA 5J2GA 9ICLA 4F93B 2UVWA 3JPNA 4BWJA 1Z00A 4NXZA 4ECUA 3N4MB 1B43A 9ICMA 4KLIA 3THVA 2ISPA 4JV0A 3MBYA 4TURA 3OJSA 2W9BA 5J2EA 3V7KA 4F4YA 4RQ0A 2J6SA 4C8LA 1CUKA 5BOLA 4EBCA 3RB0A 4KN4A 1NJZA 1Z3EB 3V6HA 4K4HA 4PGYA 1PX5A 1S0NA 4M9GA 3UXOA 5KG7A 3M9OB 4IQTA 4RT2A 5J0SA 2KFNA 2ZUDA 4X4OA 4KLDA 1ZQJA 1ZQIA 5KFLA 2BCRA 4B9LA 4NLGA 1MSWD 4O5KA 4DL3A 4B9MA 2ZH9A 8ICOA 1X9SA 5KT3A 3PV8A 2DPIA 1KLNA 5KFYA 4YD1A 3OHAA 1X9WA 1ZQLA 4O3NA 2ZTEA 3UQ2A 8ICHA 9ICHA 2ZHBA 4X0AA 4NM2A 5CWRA 1JX4A 9ICOA 2MUTA 4R65A 3GILA 3GV7B 4PHEA 7ICGA 8ICNA 9ICBA 5KG3A 1ZETA 4KLUA 1N48A 1UETA 4S3NA 4UB2A 4GC7A 5DQHA 4YQWA 4GXKA 4ECQA 4R66A 4AT7A 1TFWA 4LZDA 2I9GA 1AROP 4DEZA 4GC6A 3JPPA 3T3FA 5HMMA 3AQMA 4RWQA 4RNNA 5KTQA 3UXNA 4GXIA 5D49A 3H40A 2HHPA 3AUOA 4FHWA 1NK7A 4AT8B 4ECWA 4KMUA 2DFLA 3EYZA 4ED0A 8ICEA 2ZH8A 2XC9A 1H38A 1SL0A 4DLEA 4JWNA 9ICFA 1B22A 4FH3A 9ICUA 5D46A 3T5KA 9ICAA 3OVBA 2BR0A 1U45A 1R8BA 5BOMA 4RT3A 3EPIA 3GQCA 1BPZA 3C5GA 1NJWA 3MR5A 4DO9A 2IHMA 4X4TA 2NRXA 2BHNA 4F91B 2ZH4A 3ZD8A 4TUSA 2BQ3A 2HHVA 3IM1A 4QW8A 5KFGA 5J2FA 4RQ8A 1IXRA 9ICJA 3LDAA 5KT4A 1ZQSA 3AQNA 4F2SA 5DB7A 4TQSA 1K1QA 3OSNA 3BQ1A 4DLGA 8ICKA 1WOTA 2RFFA 2DRAA 4DQQA 2DVIA 5DDYA 3LWLA 1QSSA 2NRWA 2C2DA 1U48A 4JWMA 5DKWA 3PVXA 8ICPA 3MFHA 3PX4A 4ATBA 3HT3A 1ZQTA 1UA0A 3H8SA 1ZQMA 3SV4A 2Y1JA 2IHNA 1U47A 4QWEA 5J0QA 2RDJA 4RNMA 2HHTA 9ICEA 8ICZA 4M6WB 4ED7A 4JUZA 2PFQA 4J9LA 2PXIA 4DOBA 2AJQA 5EWGA 4TUPA 4QZFA 2W9CB 4EBDA 4CCHA 3RJKA 9ICIA 4O3OA 5CB1A 5DGAA 2ZTCA 1BPXA 7ICTA 4UQGA 4I2JA 2ATLA 5J2IA 3JPQA 1JIHA 4RQ1A 3MDAA 2V4RA 1NKCA 4RZRA 2NRTA 8ICXA 3MR3A 3SYZA 4F2RA 5HHHA 3AU2A 1DK2A 3BQTA 3JPRA 2OWOA 3JPSA 3OUYA 9ICKA 5DDMA 3V72A 4KLHA 4YXMA 4R63A 7ICQA 3NYBA 2XGPA 3T5JA 4F4KA 3ISCA 3MDCA 3OVSA 2VA8A 1HJPA 3PMLA 5HRDA 3RRHA 1TK0A 4DSIA 4O9MA 2HHSA 4F92B 3KHRA 4Q8FA 4RQ6A 4ED3A 1ZQBA 3B0YA 5L1KA 1NK0A 5J0RA 7ICMA 3OVAA 5IIMA 3M8SA 4MF8A 1A76A 4YXJA 4YP3A 4UAZA 4YMMA 3QZ8A 2KN7A 3MR2A 4DSFA 3QEAZ 1ZQCA 2FPMA 4O5CA 4KLFA 7ICUA 3H3AA 5J2BA 5KFUA 2AGQA 1U49A 1S0MA 4O3PA 5J0WA 3TI0A 3PO5A 4ELUA 1SZPA 2KTQA 4KLTA 5HRHA 4QZ8A 3OJUA 1RZTA 3PW7A 4IRKA 5KFKA 5KFPA 4RPYA 4R8UA 1XS9D 1SKWA 4DSJA 3HJ4A 5HREA 2ZTDA 3GV5B 7ICNA 2H5XA 2BCUA 2F1HA 4IRCA 3TQ1A 1L3SA 3RB4A 5KG2A 2P6RA 2MAXA 3Q8LA 5KFWA 5J2HA 3WFPA 4JK1A 2W8LA 3H37A 4Z6FA 3MGIA 2M2VA 4QZDA 1NKBA 8ICIA 2UVVA 1XC9A 3NGDA 5KFTA 2W9MA 5C5JA 4QZIA 2BCSA 9ICCA 3ISBA 2ZH2A 4X4VA 2A1JA 2JZBA 3N97B 3ORYA 2XY6A 4PH5A 5J2CA 3OSPA 1UA1A 3Q8QB 4NY8A 3RTVA 2ASDA 9ICSA 1R8AA 4IQWA 4WC0A 4I2CA 1L3TA 4G3IA 2M2UA 1ZJMA 5KFNA 3OGUA 4AT9A 4X4RA 3SZ2A 1NJYA 3H8WA 4B9SA 1L5UA 1NK9A 8ICVA 4F4WA 3GIKA 5DLGA 1BNPA 2UVUA 1DK3A 5KT5A 3IHQB 5D4BA 4M9LA 1S0VA 1S77D 2VA2A 8ICQA 1DGSA 2ASJA 1TK8A 8ICLA 4MEXA 1UEUA 4WC3A 3E2EA 5KFCA 4TQRA 1XSLA 1ZQFA 3ISDA 3RB6A 1TV9A 2PI5A 3RRGA 9ICNA 2NRVA 2IA6A 4DQPA 2ZH7A 5IILA 4F8RA 1ZQOA 3HWTA 1KSPA 4Z6DA 2KZZA 4DFMA 4QZAA 1XWLA 4DL6A 1QTMA 4UB3A 4F5PA 4I2EA 4ED6A 3H39A 1NOMA 3G6VA 2XGQA 4FHVA 4EZ6A 3EWAA 4EEYA 1L3VA 4DFPA 4YR2A 4ED1A 4Q45A 2ZUCA 4XUSA 3EZ5A 4FS2A 2C2RA 5CJ7A 1XSPA 4Q8EA 8ICWA 4M9NA 5DQGA 5HRFA 4P2HA 4P4MA 1COOA 1UT5A 5CHGA 2FMQA 1UEVA 4I29A 4IR9A 4YMNA 8ICCA 1NK6A 4FHPA 3KTQA 4KLOA 2M2WA 5J0PA 4RQ5A 5J2AA 2M9NA 1T4GA 3HP6A 3TARA 4NLZA 3ZDBA 3OHBA 1NKEA 1BPBA 5F2VO 4KITB 1BGXT 3PY8A 3PR5B 4XRHA 5L1IA 4DQRA 4DFJA 3TAPA 5DEDA 1R89A 3H7IA 5HMLA 1TVAA 1QSLA 5L1JA 4YR0A 4YN4A 3Q8SB 2BPGA 2HHUA 2HVHA 4ECZA 5KG4A 4BDPA 1U4BA 3Q8KA 5IIOA 1ZQQA 2BCQA 1BPDA 4K4GA 4DSKA 3H38A 4PHDA 4UD4A 1KTQA 1U9LA 4BGDA 4RUAA 1S76D 4E7XA 7ICPA 1HUZA 1Q78A 4ECXA 4JV1A 2KZMA 1KFSA 4PPXA 4QWCA 2R8JA 4QZCA 1JN3A 4X4PA 3C18A 8ICSA 5KFXA 4I27A 2UVRA 4NM1A 5DBCA 8ICAA 5KFMA 1MQ2A 4RWPA 4KLSA 2V4QA 1DOQA 3RH5A 4M9HA 2ISOA 5DBAA 4C8NA 3M8RA 1KFTA 1ZQRA 4QZEA 4IQUA 4RUCA 2JEFA 1SKSA 4DL2A 5DQIA 4KLGA 1ZQEA 1MIWA 1JXLA 4B9VA 4FHYA 4WC7A 5KG0A 4RQ7A 2FLLA 1KRPA 5EOZA 4BWMA 1MIYA 4MFCA 4AT8A 1Q79A 2XY7A 2VANA 4I2HA 1VFGA 1RXWA 4K4IA 2M2TA 1TKDA 4UAWA 3TFSA 2O1PA 4UD5A 5DB6A 5J0XA 5J2JA 3BQ2A 8ICBA 9ICWA 4X4SA 3B0XA 2ZH6A 4O3QA 1NK5A 3HJ1A 2Q66A 4IG8A 4RU9A 1X9MA 4P4OA 5J2DA 3M9MB 3C2KA 3C66A 3RJIA 2HHXA 1UT8A 4ELTA 5HHIA 3Q8RB 5DB8A 1QLNA 1V9PA 5HRGA 1T8EA 5KFOA 1RYSA 2R8HA 4HYKA 5F9NA 1IM4A 4KLEA 5J0OA 4F5RA 2IMWP 3HX0A 2XCPA 2ALZA 3PO4A 3GIJA 4XQ7A 2DR8A 3GV8B 4MF2A 2B21A 3Q8PB 7ICKA 4I2IA 2AQ4A 2KFZA 3SV3A 1Z00B 5KFFA 1ZQUA 5J0UA 3C23A 5J2KA 4RNOA 4R64A 3BQ0A 4QZHA 2V9WA 4QZ9A 3ZDCA 4YFKA 2KZ3A 3PMNA 1JAJA 2W9BB 5DB9A 2PFPA 1T3NA 3TAQA 3UPQA 1KDHA 2R8KA 4UB5A 3WFRE 4NKUA 4F50A 2BPCA 1MC8A 2F1IA 4DF8A 4WCWA 5F9LA 5J0TA 3RR7A 1V4AA 4EYHB 4F3OA 5HP4A 4I2GA 4M6WA 5HNKA 4WC6A 1NJXA 3RR8A 1CEZA 4YCXA 2ZHAA 2W9CA 2PI4A 4XA5A 1VJ7A 2Q0ZX 4ED8A 4P4PA 3QZ7A 4ECRA 3RJFA 2PBEA 3AQKA 1WCNA 3H4DA 1RPLA 5KFEA 3C2MA 9ICGA 3JYYA 4WC1A 3GFKB 5KFVA 4FH5A 1NZPA 2BQRA 1JMSA 4QWDA 3T5HA 2ZH1A 1XSNA 1RXVA 3M9NB 2MUTB 3GIIA 9ICQA 3EW9A 4TUQA 2BKEA 1N56A 1LB2B 3K75D 4PHAA 3MFIA 4I28A 3UQ0A 3PNCA 2NRKA 4DL4A 1T7PA 3PX0A 4EP7A 2HVIA 4AT7B 4UBBA 4X5VA 5KFAA 8ICMA 3C1ZA 5KFZA 4UB1A 2JEIA 1LV5A 2J6UA 3RJGA 1L3UA 5J0YA 3FYHA 1BPYA 1OU5A 5DG8A 4ZH4A 4QWBA 4QW9A 3V6KA 3PW5A 2NRZA 3C5FA 4BXOB 4O3SA 9ICPA 7ICIA 4RWNA 1ZQNA 4E0DA 2ZH5A 4LZGA 3C2LA 3RH4A 8ICTA 3C1YA 1BPEA 3RB3A 2C2EA 4LT6A 2BE3A 3LWMA 8ICRA 4X4NA 1FA0A 2WTFA 3ZDDA 8ICUA 3WFQE 1PZNA 4DS5A 5KFJA 4I2FA 4YR3A 1QSYA 4C8MA 4YG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NK8 A;  3MR6 A;  1HUO A;  4JV2 A;  1BVS A;  4IR1 A;  1ZQG A;  2FPK A;  3ZDE A;  2XY5 A;  1NO5 A;  4EZ9 A;  1ZQA A;  3NTU A;  5KFB A;  3ZDA A;  4MFF A;  5KG5 A;  3QE9 Y;  1R8C A;  1RYR A;  1XU4 A;  3G6X A;  3L9D A;  8ICF A;  5HRK A;  3SI8 A;  2J6T A;  5KFQ A;  1SL2 A;  1TAQ A;  2GWS A;  4RQ4 A;  2ZH3 A;  1TFY A;  4J9M A;  2HW3 A;  5KFD A;  1ZJN A;  4M0A A;  3KHG A;  4DFK A;  3HIY A;  3PW2 A;  5HRL A;  4ATB B;  3ZD9 A;  4DL5 A;  4FO6 A;  9ICR A;  2AQ0 A;  5L1L A;  3QEB Z;  2BPF A;  4FBU A;  4J9O A;  2AU0 A;  7ICS A;  4WC2 A;  5DG7 A;  7ICF A;  1WCL A;  1SKR A;  1MQ3 A;  3RJH A;  3GIM A;  4WBY A;  2F1J A;  5KT7 A;  5DGB A;  4F4Z A;  4NLK A;  1ZQZ A;  5KFR A;  4ECY A;  2PFO A;  5J29 A;  1TAU A;  2ZUB A;  4EBK A;  1MIV A;  2JEG A;  4NLN A;  3RBE A;  1BNO A;  2VA3 A;  4M9J A;  4YD2 A;  5IIN A;  3LK9 A;  5HRI A;  2DR7 A;  1KNY A;  3PR4 A;  4BXO A;  4DSL A;  4DOC A;  3UPS A;  9ICV A;  4YVZ A;  3RAX A;  5KFI A;  2BDP A;  4F4X A;  5CR0 A;  5KT2 A;  2ASL A;  7ICL A;  1ZQK A;  2FMS A;  5KG6 A;  4ELV A;  1D9F A;  4FS1 A;  2ZJA A;  5JUM A;  2Y1I A;  2KP7 A;  3AQL A;  5KFH A;  1ZQX A;  3EPG A;  4J9Q A;  1K1S A;  3OUY B;  3FDS A;  2BCV A;  4C8O A;  4UB4 A;  8ICY A;  5BPC A;  4KLQ A;  4Z6C A;  4RQ3 A;  1S10 A;  2W8K A;  1S97 A;  4RPX A;  3ETL A;  3KHL A;  4YMO A;  1XO1 A;  3H4B A;  4EBE A;  3T5L A;  5DLF A;  5DG9 A;  2XCA A;  1SL1 A;  4RWO A;  4I2D A;  5EWF A;  1X2I A;  4RQ2 A;  2R8I A;  4DF4 A;  2FLP A;  5KG1 A;  4MFA A;  3RJJ A;  2IBK A;  4O5E A;  2P66 A;  4WC4 A;  5HRB A;  1ZQV A;  4KN7 A;  5EWE A;  3AU6 A;  2R8G A;  5HR9 A;  4ECV A;  4Q43 A;  3HW8 A;  4J9P A;  4B9T A;  4M2Y A;  1D8Y A;  5III A;  3UXP A;  5CP2 A;  3WFO A;  3K4G A;  2RDI A;  2FMP A;  8ICG A;  5DEC A;  4O3R A;  4Z6E A;  3Q8M A;  3GDX A;  2AGO A;  4F5O A;  7ICE A;  3HPO A;  4GLX A;  2FLN A;  4DQS A;  4WBZ A;  3RH6 A;  3V7L A;  4R8U B;  4EYI B;  2HHW A;  4IRD A;  1F5A A;  2AGP A;  8ICJ A;  1ZQY A;  2FPL A;  4C8K A;  9ICX A;  1ZQH A;  2O5A A;  3WFS C;  4J9S A;  2BQU A;  1D9D A;  3LQC B;  4M5D A;  1ZQD A;  4DWI A;  2ZJ5 A;  1KFD A;  4RPZ A;  3PW4 A;  3KHH A;  1D8L A;  4KLM A;  1Y88 A;  2XO7 A;  4ED2 A;  2ID1 A;  2A1J B;  4M47 A;  2JZB B;  1ZQP A;  3JZ0 A;  1S9F A;  1JXE A;  2W9A A;  3V6J A;  4KTQ A;  4MEY A;  4Q44 A;  4O0I A;  3JPO A;  4QWA A;  3V7J A;  4F5N A;  1NK4 A;  3BDP A;  4QZB A;  2I1Q A;  4F5Q A;  4PHP A;  9ICT A;  4AT9 B;  2LYH A;  3PX6 A;  2PFN A;  7ICJ A;  4XQ8 A;  7ICR A;  7ICO A;  3G6Y A;  3TFR A;  1ZYQ A;  4QZG A;  2C28 A;  4ECS A;  5TZV A;  4I2B A;  2DR5 A;  4IQV A;  5L9X A;  4KLL A;  1EXN A;  4DQI A;  4WC5 A;  5IIK A;  5DBB A;  4PGX A;  4J9R A;  3PW0 A;  4FBT A;  4X4Q A;  5KT6 A;  4NKT A;  2DPJ A;  2JEJ A;  5CA7 A;  2HHQ A;  1YLQ A;  1ZQW A;  4EBJ A;  1S0O A;  4X4U A;  2DRB A;  5KFS A;  4E80 A;  4DOA A;  3MAB A;  3RAQ A;  1TK5 A;  1TFR A;  4J9N A;  1JQR A;  4X0B A;  4PGQ A;  2P6U A;  4E8F A;  3MGH A;  4KLJ A;  4J9K A;  7ICH A;  1KEJ A;  4DL7 A;  4B9U A;  2DR9 A;  3RJE A;  3BJY A;  7ICV A;  4FHX A;  4B9N A;  2C22 A;  2BGW A;  1C7Y A;  2ZJ8 A;  5IIJ A;  4UBC A;  3JPT A;  4DS4 A;  4I2A A;  4LVS A;  4GXJ A;  3C21 A;  1A77 A;  4ECT A;  3OV7 A;  3RBD A;  4UAY A;  3TAN A;  4M04 A;  5HC9 A;  4DSE A;  3H8J A;  5J2G A;  9ICL A;  4F93 B;  2UVW A;  3JPN A;  4BWJ A;  1Z00 A;  4NXZ A;  4ECU A;  3N4M B;  1B43 A;  9ICM A;  4KLI A;  3THV A;  2ISP A;  4JV0 A;  3MBY A;  4TUR A;  3OJS A;  2W9B A;  5J2E A;  3V7K A;  4F4Y A;  4RQ0 A;  2J6S A;  4C8L A;  1CUK A;  5BOL A;  4EBC A;  3RB0 A;  4KN4 A;  1NJZ A;  1Z3E B;  3V6H A;  4K4H A;  4PGY A;  1PX5 A;  1S0N A;  4M9G A;  3UXO A;  5KG7 A;  3M9O B;  4IQT A;  4RT2 A;  5J0S A;  2KFN A;  2ZUD A;  4X4O A;  4KLD A;  1ZQJ A;  1ZQI A;  5KFL A;  2BCR A;  4B9L A;  4NLG A;  1MSW D;  4O5K A;  4DL3 A;  4B9M A;  2ZH9 A;  8ICO A;  1X9S A;  5KT3 A;  3PV8 A;  2DPI A;  1KLN A;  5KFY A;  4YD1 A;  3OHA A;  1X9W A;  1ZQL A;  4O3N A;  2ZTE A;  3UQ2 A;  8ICH A;  9ICH A;  2ZHB A;  4X0A A;  4NM2 A;  5CWR A;  1JX4 A;  9ICO A;  2MUT A;  4R65 A;  3GIL A;  3GV7 B;  4PHE A;  7ICG A;  8ICN A;  9ICB A;  5KG3 A;  1ZET A;  4KLU A;  1N48 A;  1UET A;  4S3N A;  4UB2 A;  4GC7 A;  5DQH A;  4YQW A;  4GXK A;  4ECQ A;  4R66 A;  4AT7 A;  1TFW A;  4LZD A;  2I9G A;  1ARO P;  4DEZ A;  4GC6 A;  3JPP A;  3T3F A;  5HMM A;  3AQM A;  4RWQ A;  4RNN A;  5KTQ A;  3UXN A;  4GXI A;  5D49 A;  3H40 A;  2HHP A;  3AUO A;  4FHW A;  1NK7 A;  4AT8 B;  4ECW A;  4KMU A;  2DFL A;  3EYZ A;  4ED0 A;  8ICE A;  2ZH8 A;  2XC9 A;  1H38 A;  1SL0 A;  4DLE A;  4JWN A;  9ICF A;  1B22 A;  4FH3 A;  9ICU A;  5D46 A;  3T5K A;  9ICA A;  3OVB A;  2BR0 A;  1U45 A;  1R8B A;  5BOM A;  4RT3 A;  3EPI A;  3GQC A;  1BPZ A;  3C5G A;  1NJW A;  3MR5 A;  4DO9 A;  2IHM A;  4X4T A;  2NRX A;  2BHN A;  4F91 B;  2ZH4 A;  3ZD8 A;  4TUS A;  2BQ3 A;  2HHV A;  3IM1 A;  4QW8 A;  5KFG A;  5J2F A;  4RQ8 A;  1IXR A;  9ICJ A;  3LDA A;  5KT4 A;  1ZQS A;  3AQN A;  4F2S A;  5DB7 A;  4TQS A;  1K1Q A;  3OSN A;  3BQ1 A;  4DLG A;  8ICK A;  1WOT A;  2RFF A;  2DRA A;  4DQQ A;  2DVI A;  5DDY A;  3LWL A;  1QSS A;  2NRW A;  2C2D A;  1U48 A;  4JWM A;  5DKW A;  3PVX A;  8ICP A;  3MFH A;  3PX4 A;  4ATB A;  3HT3 A;  1ZQT A;  1UA0 A;  3H8S A;  1ZQM A;  3SV4 A;  2Y1J A;  2IHN A;  1U47 A;  4QWE A;  5J0Q A;  2RDJ A;  4RNM A;  2HHT A;  9ICE A;  8ICZ A;  4M6W B;  4ED7 A;  4JUZ A;  2PFQ A;  4J9L A;  2PXI A;  4DOB A;  2AJQ A;  5EWG A;  4TUP A;  4QZF A;  2W9C B;  4EBD A;  4CCH A;  3RJK A;  9ICI A;  4O3O A;  5CB1 A;  5DGA A;  2ZTC A;  1BPX A;  7ICT A;  4UQG A;  4I2J A;  2ATL A;  5J2I A;  3JPQ A;  1JIH A;  4RQ1 A;  3MDA A;  2V4R A;  1NKC A;  4RZR A;  2NRT A;  8ICX A;  3MR3 A;  3SYZ A;  4F2R A;  5HHH A;  3AU2 A;  1DK2 A;  3BQT A;  3JPR A;  2OWO A;  3JPS A;  3OUY A;  9ICK A;  5DDM A;  3V72 A;  4KLH A;  4YXM A;  4R63 A;  7ICQ A;  3NYB A;  2XGP A;  3T5J A;  4F4K A;  3ISC A;  3MDC A;  3OVS A;  2VA8 A;  1HJP A;  3PML A;  5HRD A;  3RRH A;  1TK0 A;  4DSI A;  4O9M A;  2HHS A;  4F92 B;  3KHR A;  4Q8F A;  4RQ6 A;  4ED3 A;  1ZQB A;  3B0Y A;  5L1K A;  1NK0 A;  5J0R A;  7ICM A;  3OVA A;  5IIM A;  3M8S A;  4MF8 A;  1A76 A;  4YXJ A;  4YP3 A;  4UAZ A;  4YMM A;  3QZ8 A;  2KN7 A;  3MR2 A;  4DSF A;  3QEA Z;  1ZQC A;  2FPM A;  4O5C A;  4KLF A;  7ICU A;  3H3A A;  5J2B A;  5KFU A;  2AGQ A;  1U49 A;  1S0M A;  4O3P A;  5J0W A;  3TI0 A;  3PO5 A;  4ELU A;  1SZP A;  2KTQ A;  4KLT A;  5HRH A;  4QZ8 A;  3OJU A;  1RZT A;  3PW7 A;  4IRK A;  5KFK A;  5KFP A;  4RPY A;  4R8U A;  1XS9 D;  1SKW A;  4DSJ A;  3HJ4 A;  5HRE A;  2ZTD A;  3GV5 B;  7ICN A;  2H5X A;  2BCU A;  2F1H A;  4IRC A;  3TQ1 A;  1L3S A;  3RB4 A;  5KG2 A;  2P6R A;  2MAX A;  3Q8L A;  5KFW A;  5J2H A;  3WFP A;  4JK1 A;  2W8L A;  3H37 A;  4Z6F A;  3MGI A;  2M2V A;  4QZD A;  1NKB A;  8ICI A;  2UVV A;  1XC9 A;  3NGD A;  5KFT A;  2W9M A;  5C5J A;  4QZI A;  2BCS A;  9ICC A;  3ISB A;  2ZH2 A;  4X4V A;  2A1J A;  2JZB A;  3N97 B;  3ORY A;  2XY6 A;  4PH5 A;  5J2C A;  3OSP A;  1UA1 A;  3Q8Q B;  4NY8 A;  3RTV A;  2ASD A;  9ICS A;  1R8A A;  4IQW A;  4WC0 A;  4I2C A;  1L3T A;  4G3I A;  2M2U A;  1ZJM A;  5KFN A;  3OGU A;  4AT9 A;  4X4R A;  3SZ2 A;  1NJY A;  3H8W A;  4B9S A;  1L5U A;  1NK9 A;  8ICV A;  4F4W A;  3GIK A;  5DLG A;  1BNP A;  2UVU A;  1DK3 A;  5KT5 A;  3IHQ B;  5D4B A;  4M9L A;  1S0V A;  1S77 D;  2VA2 A;  8ICQ A;  1DGS A;  2ASJ A;  1TK8 A;  8ICL A;  4MEX A;  1UEU A;  4WC3 A;  3E2E A;  5KFC A;  4TQR A;  1XSL A;  1ZQF A;  3ISD A;  3RB6 A;  1TV9 A;  2PI5 A;  3RRG A;  9ICN A;  2NRV A;  2IA6 A;  4DQP A;  2ZH7 A;  5IIL A;  4F8R A;  1ZQO A;  3HWT A;  1KSP A;  4Z6D A;  2KZZ A;  4DFM A;  4QZA A;  1XWL A;  4DL6 A;  1QTM A;  4UB3 A;  4F5P A;  4I2E A;  4ED6 A;  3H39 A;  1NOM A;  3G6V A;  2XGQ A;  4FHV A;  4EZ6 A;  3EWA A;  4EEY A;  1L3V A;  4DFP A;  4YR2 A;  4ED1 A;  4Q45 A;  2ZUC A;  4XUS A;  3EZ5 A;  4FS2 A;  2C2R A;  5CJ7 A;  1XSP A;  4Q8E A;  8ICW A;  4M9N A;  5DQG A;  5HRF A;  4P2H A;  4P4M A;  1COO A;  1UT5 A;  5CHG A;  2FMQ A;  1UEV A;  4I29 A;  4IR9 A;  4YMN A;  8ICC A;  1NK6 A;  4FHP A;  3KTQ A;  4KLO A;  2M2W A;  5J0P A;  4RQ5 A;  5J2A A;  2M9N A;  1T4G A;  3HP6 A;  3TAR A;  4NLZ A;  3ZDB A;  3OHB A;  1NKE A;  1BPB A;  5F2V O;  4KIT B;  1BGX T;  3PY8 A;  3PR5 B;  4XRH A;  5L1I A;  4DQR A;  4DFJ A;  3TAP A;  5DED A;  1R89 A;  3H7I A;  5HML A;  1TVA A;  1QSL A;  5L1J A;  4YR0 A;  4YN4 A;  3Q8S B;  2BPG A;  2HHU A;  2HVH A;  4ECZ A;  5KG4 A;  4BDP A;  1U4B A;  3Q8K A;  5IIO A;  1ZQQ A;  2BCQ A;  1BPD A;  4K4G A;  4DSK A;  3H38 A;  4PHD A;  4UD4 A;  1KTQ A;  1U9L A;  4BGD A;  4RUA A;  1S76 D;  4E7X A;  7ICP A;  1HUZ A;  1Q78 A;  4ECX A;  4JV1 A;  2KZM A;  1KFS A;  4PPX A;  4QWC A;  2R8J A;  4QZC A;  1JN3 A;  4X4P A;  3C18 A;  8ICS A;  5KFX A;  4I27 A;  2UVR A;  4NM1 A;  5DBC A;  8ICA A;  5KFM A;  1MQ2 A;  4RWP A;  4KLS A;  2V4Q A;  1DOQ A;  3RH5 A;  4M9H A;  2ISO A;  5DBA A;  4C8N A;  3M8R A;  1KFT A;  1ZQR A;  4QZE A;  4IQU A;  4RUC A;  2JEF A;  1SKS A;  4DL2 A;  5DQI A;  4KLG A;  1ZQE A;  1MIW A;  1JXL A;  4B9V A;  4FHY A;  4WC7 A;  5KG0 A;  4RQ7 A;  2FLL A;  1KRP A;  5EOZ A;  4BWM A;  1MIY A;  4MFC A;  4AT8 A;  1Q79 A;  2XY7 A;  2VAN A;  4I2H A;  1VFG A;  1RXW A;  4K4I A;  2M2T A;  1TKD A;  4UAW A;  3TFS A;  2O1P A;  4UD5 A;  5DB6 A;  5J0X A;  5J2J A;  3BQ2 A;  8ICB A;  9ICW A;  4X4S A;  3B0X A;  2ZH6 A;  4O3Q A;  1NK5 A;  3HJ1 A;  2Q66 A;  4IG8 A;  4RU9 A;  1X9M A;  4P4O A;  5J2D A;  3M9M B;  3C2K A;  3C66 A;  3RJI A;  2HHX A;  1UT8 A;  4ELT A;  5HHI A;  3Q8R B;  5DB8 A;  1QLN A;  1V9P A;  5HRG A;  1T8E A;  5KFO A;  1RYS A;  2R8H A;  4HYK A;  5F9N A;  1IM4 A;  4KLE A;  5J0O A;  4F5R A;  2IMW P;  3HX0 A;  2XCP A;  2ALZ A;  3PO4 A;  3GIJ A;  4XQ7 A;  2DR8 A;  3GV8 B;  4MF2 A;  2B21 A;  3Q8P B;  7ICK A;  4I2I A;  2AQ4 A;  2KFZ A;  3SV3 A;  1Z00 B;  5KFF A;  1ZQU A;  5J0U A;  3C23 A;  5J2K A;  4RNO A;  4R64 A;  3BQ0 A;  4QZH A;  2V9W A;  4QZ9 A;  3ZDC A;  4YFK A;  2KZ3 A;  3PMN A;  1JAJ A;  2W9B B;  5DB9 A;  2PFP A;  1T3N A;  3TAQ A;  3UPQ A;  1KDH A;  2R8K A;  4UB5 A;  3WFR E;  4NKU A;  4F50 A;  2BPC A;  1MC8 A;  2F1I A;  4DF8 A;  4WCW A;  5F9L A;  5J0T A;  3RR7 A;  1V4A A;  4EYH B;  4F3O A;  5HP4 A;  4I2G A;  4M6W A;  5HNK A;  4WC6 A;  1NJX A;  3RR8 A;  1CEZ A;  4YCX A;  2ZHA A;  2W9C A;  2PI4 A;  4XA5 A;  1VJ7 A;  2Q0Z X;  4ED8 A;  4P4P A;  3QZ7 A;  4ECR A;  3RJF A;  2PBE A;  3AQK A;  1WCN A;  3H4D A;  1RPL A;  5KFE A;  3C2M A;  9ICG A;  3JYY A;  4WC1 A;  3GFK B;  5KFV A;  4FH5 A;  1NZP A;  2BQR A;  1JMS A;  4QWD A;  3T5H A;  2ZH1 A;  1XSN A;  1RXV A;  3M9N B;  2MUT B;  3GII A;  9ICQ A;  3EW9 A;  4TUQ A;  2BKE A;  1N56 A;  1LB2 B;  3K75 D;  4PHA A;  3MFI A;  4I28 A;  3UQ0 A;  3PNC A;  2NRK A;  4DL4 A;  1T7P A;  3PX0 A;  4EP7 A;  2HVI A;  4AT7 B;  4UBB A;  4X5V A;  5KFA A;  8ICM A;  3C1Z A;  5KFZ A;  4UB1 A;  2JEI A;  1LV5 A;  2J6U A;  3RJG A;  1L3U A;  5J0Y A;  3FYH A;  1BPY A;  1OU5 A;  5DG8 A;  4ZH4 A;  4QWB A;  4QW9 A;  3V6K A;  3PW5 A;  2NRZ A;  3C5F A;  4BXO B;  4O3S A;  9ICP A;  7ICI A;  4RWN A;  1ZQN A;  4E0D A;  2ZH5 A;  4LZG A;  3C2L A;  3RH4 A;  8ICT A;  3C1Y A;  1BPE A;  3RB3 A;  2C2E A;  4LT6 A;  2BE3 A;  3LWM A;  8ICR A;  4X4N A;  1FA0 A;  2WTF A;  3ZDD A;  8ICU A;  3WFQ E;  1PZN A;  4DS5 A;  5KFJ A;  4I2F A;  4YR3 A;  1QSY A;  4C8M A;  4YG2 A; 
#chains in the Genus database with same CATH topology
 1NK8 A;  4WOY A;  3TAC B;  5AKH A;  3PSI A;  1NO5 A;  3NTU A;  4NXX A;  1RYR A;  3L9D A;  3SI8 A;  5KFQ A;  1SL2 A;  2RLT A;  4HX0 A;  3KHG A;  4DFK A;  2NYV A;  4ATB B;  4DL5 A;  4ACO A;  4WC2 A;  1LKY A;  1WCL A;  1SKR A;  3RJH A;  2F1J A;  2HBM A;  5J8Y A;  2PFO A;  2JEG A;  4NLN A;  3RBE A;  1T94 A;  4YD2 A;  5IIN A;  4BXO A;  4YVZ A;  2E3T A;  7ICL A;  4F4X A;  5CR0 A;  3QYP A;  5KT2 A;  3BS5 B;  2WHE A;  5G5G A;  5KG6 A;  1O03 A;  3DEE A;  2BBH A;  2L5Y A;  3FDS A;  3F5A A;  4Z6C A;  4Y2J A;  3ETL A;  4YMO A;  4DF4 A;  4C4R A;  3RJJ A;  5ALV A;  5EWE A;  3AU6 A;  2GO7 A;  5HR9 A;  4J9P A;  1NNL A;  5III A;  1QH9 A;  3WFO A;  5AI0 A;  8ICG A;  2AGO A;  2E8O A;  3RH6 A;  5ALD A;  4IRD A;  1F5A A;  5C0Y A;  8ICJ A;  2FPL A;  4J9S A;  3LQC B;  1ZQD A;  4DWI A;  1KFD A;  4KLM A;  3JZ0 A;  3D2Q A;  4J03 A;  5H2F U;  2FDR A;  4MEY A;  4Q44 A;  2A19 A;  3V7J A;  3BDP A;  1ECW A;  2I1Q A;  3NUQ A;  2LYH A;  2N1R A;  7ICJ A;  3TFR A;  4NWI A;  3K7D A;  1N2X A;  5TZV A;  4I2B A;  5AK6 A;  4DQI A;  5DBB A;  4J9R A;  4FBT A;  3EF2 A;  5KT6 A;  2HHQ A;  2A1A A;  1S0O A;  4X4U A;  1L7N A;  5KFS A;  2QLT A;  4KLJ A;  4DL7 A;  4B9U A;  5T14 A;  4FHX A;  4UAR A;  1C7Y A;  2ZJ8 A;  4UBC A;  2YN4 A;  3OV7 A;  2KKP A;  4DSE A;  1M6Y A;  4F93 B;  4FZM A;  2UVW A;  3JPN A;  4BWJ A;  1B0X A;  3WK5 A;  9ICM A;  3NWI A;  1XNS A;  3THV A;  2W9B A;  5J2E A;  4RQ0 A;  2G5H B;  4EBC A;  3RB0 A;  4C4T A;  1Z3E B;  3V6H A;  5J0S A;  3T79 A;  3QXG A;  2BCR A;  3LVW A;  3DV9 A;  4B9L A;  2ZH9 A;  5KT3 A;  2DPI A;  5KFY A;  4YD1 A;  3OHA A;  3GZF A;  3UQ2 A;  9ICH A;  5EE9 A;  4X0A A;  2MUT A;  4Y2R A;  3GIL A;  4PHE A;  3HKZ F;  9ICB A;  2H3F A;  4KLU A;  4B6J A;  1UET A;  4UB2 A;  4GC7 A;  4AT7 A;  4GXK A;  4ECQ A;  4R66 A;  1KN5 A;  2I9G A;  5CEH A;  4GC6 A;  3JPP A;  2KHQ A;  4FE3 A;  5KTQ A;  5D49 A;  3H40 A;  1CRX A;  4FHW A;  2IOF K;  8ICE A;  5AI9 A;  2XC9 A;  1H38 A;  4C0Z A;  1MA7 A;  4JWN A;  2OM6 A;  3NKU A;  2VIX A;  3T5K A;  2Y0S C;  1U45 A;  2JV3 A;  1BPZ A;  3AQE A;  2JGA A;  1NJW A;  3MR5 A;  3ZD8 A;  2HHV A;  5J2F A;  9ICJ A;  3M1Y A;  5KT4 A;  5DB7 A;  4TQS A;  2DRA A;  2DVI A;  3LWL A;  5AI8 A;  2NRW A;  2C2D A;  1U48 A;  2DL0 A;  8ICP A;  4O3M A;  3M6K A;  1ZQM A;  1F5S A;  3OWG A;  4QWE A;  5J0Q A;  2RDJ A;  2PXI A;  4DOB A;  1QQ7 A;  9ICI A;  3QU5 A;  2ZTC A;  5AM1 A;  4UQG A;  4I2J A;  4NLC A;  2BBJ A;  5J2I A;  4EED A;  4RQ1 A;  2V4R A;  2NRT A;  3VCB A;  1RM6 C;  3AU2 A;  9ICK A;  2XI9 A;  4KLH A;  3ISC A;  1HJP A;  3RRH A;  2HHS A;  4F92 B;  1NK0 A;  5J0R A;  4DCC A;  4MF8 A;  1A76 A;  4YXJ A;  4DSF A;  4UAZ A;  4YMM A;  3QEA Z;  5AHX A;  2E8M A;  2FPM A;  1ZD2 P;  4O3P A;  5J0W A;  1SZP A;  2YTU A;  3OJU A;  5KFK A;  4FZL A;  5KFP A;  4RPY A;  1XS9 D;  1SKW A;  3HJ4 A;  2AH5 A;  2XIC A;  7ICN A;  4PL1 A;  2BCU A;  4IRC A;  2W3S A;  4BJQ A;  3TQ1 A;  2P6R A;  3BQ7 A;  3Q8L A;  4LEV A;  2W8L A;  3MGI A;  2UVV A;  4Y2T A;  5KFT A;  2BCS A;  1PK1 A;  2G06 A;  2JH7 A;  2XY6 A;  5J2C A;  2HOQ A;  4I2C A;  3OGU A;  4AT9 A;  4X4R A;  3SZ2 A;  8ICV A;  4G9B A;  5DLG A;  5ALO A;  1S77 D;  3IHQ B;  5G5H A;  2OCE A;  1DGS A;  4K99 A;  2ASJ A;  1TK8 A;  3E2E A;  3C28 A;  1CI4 A;  2BDU A;  4MHV A;  1S8O A;  3IRU A;  5ALT A;  2NRV A;  4Y2S A;  3MGV A;  2PI5 A;  5IIL A;  4Z6D A;  4QNL A;  2KZZ A;  1JUD A;  4ED6 A;  1NOM A;  4FHV A;  2DQN B;  1L3V A;  2KIW A;  2W7P A;  4I0U A;  5CJ7 A;  1UT5 A;  1UEV A;  1LVH A;  5GTI U;  3TAD A;  5J0P A;  3TAR A;  5F2V O;  4Y2X A;  2WAQ C;  1BPB A;  3AL0 B;  4KIT B;  3QU7 A;  3IP4 B;  5DED A;  2W43 A;  5HML A;  1TVA A;  2QKQ A;  5L1J A;  2HHU A;  2WF8 A;  1BPD A;  4K4G A;  1U9L A;  4RUA A;  2LYB A;  4EEL A;  5TIS U;  2UVR A;  8ICA A;  1MQ2 A;  1DOQ A;  1L7P A;  4QZE A;  2JEF A;  4KLG A;  1ZQE A;  4NXU A;  4WC7 A;  2FLL A;  1COK A;  4I2H A;  1VFG A;  1RXW A;  4UB6 U;  5ALI A;  5J2J A;  8ICB A;  2Q66 A;  4O3Q A;  4RU9 A;  3WKC A;  5HR7 A;  3M9M B;  3C66 A;  2HHX A;  1URJ A;  5DB8 A;  2R8H A;  5F9N A;  3DDH A;  3CYM A;  2IMW P;  3HX0 A;  3GIJ A;  2ZIV A;  1SV0 A;  4NXW A;  2CN1 A;  4RNO A;  4R64 A;  3BQ0 A;  3ZDC A;  2W9B B;  5AKE A;  2PFP A;  3TAQ A;  3UPQ A;  4NKU A;  4EEB A;  5ALK A;  4F50 A;  1V4A A;  4RQM A;  4EYH B;  5HNK A;  2ZHA A;  2W9C A;  4FO1 A;  5ALS A;  2E5S A;  3RJF A;  1RPL A;  3GU3 A;  5KFE A;  4U6P A;  4WC1 A;  3GFK B;  2ZIU B;  2BQR A;  1JMS A;  4NLB A;  3SAF A;  5AIB A;  2MUT B;  2GOL A;  4TUQ A;  3SQI A;  2DGZ A;  4PHA A;  4I28 A;  1T7P A;  4ICA A;  3IDW A;  4JLX A;  4AT7 B;  1IV8 A;  4X5V A;  5HR6 A;  8ICM A;  3MC1 A;  3WKA A;  2JEI A;  4PZO A;  2KVC A;  4OAF A;  4EV6 A;  3V6K A;  3PW5 A;  2KJ9 A;  4RWN A;  7ICI A;  1SB3 C;  3C2L A;  8ICT A;  2Y0S F;  4F71 A;  2BE3 A;  2ODG A;  4KX3 A;  2WTF A;  2Z7J A;  3ZDD A;  3WKE A;  1RG6 A;  4UB8 U;  5KFJ A;  2F44 A;  4AP9 A;  3MR6 A;  1HUO A;  1BVS A;  1ED1 A;  4IR1 A;  2KHV A;  5KFB A;  4C7Y A;  2NO5 A;  5KG5 A;  3QE9 Y;  4MFF A;  1N5W A;  1XU4 A;  8ICF A;  2KNJ A;  4RQ4 A;  2WF9 A;  1ZJN A;  3HIY A;  1V38 A;  3ZD9 A;  9ICR A;  2DBY A;  2AQ0 A;  1WYG A;  5L1L A;  7ICF A;  3N7P D;  4F4Z A;  4NLK A;  4WQL A;  4ECY A;  2ZUB A;  1BNO A;  4IS7 A;  2DR7 A;  5AKX A;  2MSN A;  3PR4 A;  2KIV A;  4DSL A;  3N28 A;  4NL9 C;  1D9F A;  1GO3 F;  1ZQX A;  3EPG A;  4EGW A;  4KLQ A;  1S10 A;  4CGZ A;  3HKZ C;  4RPX A;  3NRW A;  3H4B A;  3KD3 A;  3T5L A;  5DLF A;  1ZXI A;  4RWO A;  5DG9 A;  4I2D A;  5EWF A;  1X2I A;  2LM4 A;  2FLP A;  5KG1 A;  4MFA A;  2IBK A;  2EQY A;  2P66 A;  4WC4 A;  4OAH A;  5K4L A;  4M2Y A;  1D8Y A;  5CP2 A;  2KE7 A;  3HPO A;  4DQS A;  3L3F X;  3V7L A;  4EYI B;  1TE2 A;  2AGP A;  1ZQY A;  3AMZ A;  4C8K A;  1JI7 A;  4M5D A;  4LEW A;  2ZJ5 A;  3WKD A;  4RPZ A;  1D8L A;  4M47 A;  1PK1 B;  1JXE A;  2W9A A;  2KJ5 A;  4QZB A;  4AT9 B;  2IUB A;  2YML A;  7ICR A;  7ICO A;  3WK6 A;  2B56 A;  4IQV A;  1EXN A;  5ALW A;  3IG5 A;  5IIK A;  2JEJ A;  1YLQ A;  2Y9U A;  1ZQW A;  4EBJ A;  1JRP A;  1TFR A;  1FO4 A;  4J9N A;  4X0B A;  5KL8 B;  5ALG A;  5AIC A;  2P6U A;  1YT3 A;  7ICH A;  1KEJ A;  2DR9 A;  3SAG A;  7ICV A;  3ZI4 A;  2C22 A;  2BGW A;  4LVS A;  4I2A A;  4GXJ A;  3C21 A;  1A77 A;  5KAI U;  4ECT A;  4UAY A;  5HC9 A;  3HJE A;  5J2G A;  2BZF A;  4ECU A;  2LM1 A;  2WAQ F;  3J81 j;  2KMD A;  2LBO A;  3MBY A;  3TKA A;  3OJS A;  4C8L A;  2EDU A;  1CUK A;  3QNM A;  1N60 A;  2E8N A;  4M9G A;  3UXO A;  5KG7 A;  4RT2 A;  2F76 X;  4QIW C;  4NLG A;  3E0F A;  1MSW D;  4DL3 A;  4B9M A;  2DF4 B;  5ALJ A;  3AM9 A;  4OJ5 A;  5ALN A;  2ZHB A;  3GV7 B;  7ICG A;  5KG3 A;  3CRX A;  1ZET A;  2DKX A;  5EE3 A;  1TFW A;  4LZD A;  4O67 A;  4DEZ A;  3T3F A;  5HMM A;  2EAN A;  3F2B A;  2DWQ A;  3UXN A;  2HHP A;  4AYB C;  1NK7 A;  4KMU A;  5ALF A;  1SL0 A;  4DLE A;  1FIQ A;  1B22 A;  5D46 A;  5KNI A;  1R8B A;  5BOM A;  4RT3 A;  1IG6 A;  2NRX A;  4F91 B;  4TUS A;  3IM1 A;  4QW8 A;  5KFG A;  4RQ8 A;  3N7R C;  3LDA A;  2ZIV B;  2I5H A;  3OSN A;  4DLG A;  1WOT A;  2RFF A;  2O6K A;  2B51 A;  1GPJ A;  1S5L U;  1QSS A;  4JWM A;  5AKI A;  5DKW A;  3PVX A;  3H0M B;  9ICE A;  4RNM A;  2HHT A;  5AK4 A;  2LHT A;  4J9L A;  3KKA A;  5EWG A;  4TUP A;  4QZF A;  2W9C B;  2ZG6 A;  1SGG A;  3UM9 A;  5CB1 A;  1ZQ1 C;  1VJ5 A;  3IG8 A;  4BUG A;  1JIH A;  8ICX A;  1OW5 A;  4F2R A;  3SYZ A;  1DK2 A;  2OWO A;  3JPR A;  3IV6 A;  3V72 A;  4YXM A;  3NYB A;  3KZX A;  4FFD A;  5HRD A;  2EAO A;  4Q8F A;  2EH9 A;  5L1K A;  3EUB 2;  2GA9 D;  2F2A B;  3MR2 A;  3QUT A;  7ICU A;  5CHE A;  2FCL A;  5J2B A;  2AGQ A;  1S0M A;  4CNQ A;  4KM5 A;  4ELU A;  2KIC A;  3BZK A;  2ES6 A;  2KK0 A;  2HBL A;  4R8U A;  5HRE A;  4CRX A;  3GV5 B;  2H5X A;  1L3S A;  3WFP A;  5KFW A;  2LI6 A;  4JK1 A;  4Z6F A;  2IOF A;  1NKB A;  8ICI A;  3O0F A;  5C5J A;  4QZI A;  2JZB A;  3NRZ A;  2DKZ A;  4PH5 A;  1UA1 A;  4WC0 A;  3C29 A;  1R8A A;  4IQW A;  4G3I A;  1SZH A;  1L5U A;  1NK9 A;  3NVV A;  4EEN A;  4CF5 A;  1FEZ A;  3WK7 A;  1N62 A;  5AKG A;  2UVU A;  1DK3 A;  1C20 A;  1PK3 A;  2VA2 A;  4P0P B;  4UAV A;  4Y2Q A;  5AM0 A;  4MEX A;  1XSL A;  1TV9 A;  1N5X A;  2ZH7 A;  1DXS A;  2YMP A;  2KV2 A;  2EAM A;  1ZQO A;  1K5O A;  2JH1 A;  3RF9 A;  2XVT A;  4DFM A;  2YMQ A;  1QTM A;  4F72 A;  4UB3 A;  1Q46 A;  1SV4 A;  1X40 A;  2AXT U;  1J2N A;  3H8M A;  3EWA A;  2W54 A;  4DFP A;  4Q45 A;  4XUS A;  1XSP A;  8ICW A;  4Q8E A;  4M9N A;  5DQG A;  2E1F A;  1COO A;  2FMQ A;  3ER8 C;  4IR9 A;  2A3V A;  8ICC A;  1NK6 A;  1PUZ A;  4KLO A;  2M2W A;  4RQ5 A;  5J2A A;  3ERC C;  4NLZ A;  3ZDB A;  2CPR A;  4DFJ A;  3ETR A;  2F77 X;  4ECZ A;  4BDP A;  1U4B A;  2BCQ A;  4CF4 A;  4DSK A;  1YZ7 A;  5A0L A;  4PHD A;  1J97 A;  3H38 A;  1WG8 A;  1S76 D;  1HUZ A;  4QWC A;  4X4P A;  1JN3 A;  5DBC A;  5AM2 A;  5FP0 A;  1Q3V A;  2LMR A;  4IQU A;  1SKS A;  5DQI A;  4FHY A;  4RQ7 A;  4AT8 A;  3HRD D;  3UMB A;  1TKD A;  2M2T A;  3D6J A;  5DB6 A;  4X4S A;  9ICW A;  1Z19 A;  4IG8 A;  1X9X A;  3RJI A;  3L5K A;  1UT8 A;  4ELT A;  1V9P A;  5HRG A;  1RYS A;  4HYK A;  1D8B A;  1IM4 A;  1VLB A;  2XCP A;  2ALZ A;  4XQ7 A;  2DR8 A;  3Q8P B;  7ICK A;  4I2I A;  4GIB A;  2KFZ A;  3SV3 A;  1JAL A;  5KFF A;  4QZH A;  4ZOH C;  4YFK A;  3PMN A;  1XO0 A;  5ALY A;  1T3N A;  1FFU A;  4UAT A;  3F5E A;  4QIW F;  1L8L A;  1CEZ A;  2GLE A;  4XA5 A;  4P4P A;  3QZ7 A;  4ECR A;  2PBE A;  4CF3 A;  3M7D A;  3QUQ A;  3JYY A;  1VDV A;  3T5H A;  1XSN A;  3SR6 A;  3GII A;  3EW9 A;  1LKY B;  3K75 D;  3MFI A;  3UQ0 A;  3PNC A;  3PX0 A;  2HVI A;  1WWU A;  4UBB A;  3AQF A;  4AYB F;  3L4P A;  3C1Z A;  4UB1 A;  1LV5 A;  1L3U A;  3K1R B;  4ZH4 A;  4QWB A;  4BXO B;  2NRZ A;  3C5F A;  4WJ3 B;  3RH4 A;  4LT6 A;  8ICR A;  1FA0 A;  3WFQ E;  2EAP A;  4KLS A;  2K4E A;  4JV2 A;  5AM3 A;  2CRX A;  2QB0 A;  1PVP A;  1ZQG A;  2FPK A;  2H3Z A;  3AEV A;  1R8C A;  5AKZ A;  3N7S C;  4OAG A;  2J6T A;  1TAQ A;  1YZ6 A;  5AM5 A;  1TFY A;  4J9M A;  2HW3 A;  5KFD A;  3PW2 A;  2KEY A;  4FO6 A;  4FBU A;  2BPF A;  4J9O A;  2HMX A;  4NV0 A;  5DG7 A;  3GIM A;  2K4P A;  4WBY A;  1UQV A;  2FE9 A;  5DGB A;  1TAM A;  1ZQZ A;  5KFR A;  3F53 A;  4EBK A;  1MIV A;  2VA3 A;  3LK9 A;  2KVS A;  2G09 A;  3RAX A;  5KFI A;  1ZQK A;  2FMS A;  4FS1 A;  2ZJA A;  5JUM A;  3AQL A;  5KFH A;  5D61 A;  4A8E A;  2HI0 A;  1V97 A;  2BCV A;  4RQ3 A;  1S97 A;  5B5E U;  4EBE A;  1SL1 A;  2XCA A;  4IL6 U;  5JTG A;  2XID A;  2NV3 A;  3KFU F;  4KN7 A;  2R8G A;  4B9T A;  5EE0 A;  5D63 A;  3I76 A;  3K4G A;  2FMP A;  2KJ8 A;  4O3R A;  4GLX A;  2FLN A;  4R8U B;  4JMU A;  3BS7 A;  4JB3 A;  9ICX A;  1ZQH A;  1OXJ A;  2O5A A;  3WFS C;  3QU2 A;  2BQU A;  1D9D A;  4KMO B;  1KL9 A;  2B4V A;  3I1Y A;  4JLZ A;  2WF5 A;  3KHH A;  1Y88 A;  1OUQ A;  4ED2 A;  2ID1 A;  2JZB B;  1ZQP A;  1S9F A;  4KTQ A;  4OJ6 A;  3JPO A;  1NK4 A;  4F5N A;  9ICT A;  4PHP A;  2YB4 A;  3PX6 A;  3HIL A;  5JRT A;  1ZYQ A;  4ECS A;  1DGJ A;  4WC5 A;  5AKK A;  4PGX A;  3PW0 A;  4X4Q A;  1UHU A;  1ZD5 A;  1V85 A;  2DRB A;  3LYS A;  1JQR A;  2F8K A;  4PGQ A;  2FJ6 A;  4EX6 A;  3BJY A;  4B9N A;  2H3V A;  2R18 A;  5IIJ A;  3JPT A;  4M04 A;  9ICL A;  1B43 A;  4KLI A;  4JV0 A;  5ALE A;  3V7K A;  2J6S A;  4KN4 A;  4KB6 A;  4K4H A;  1PX5 A;  4OCZ A;  3M9O B;  4IQT A;  5KFL A;  4O5K A;  4Y2V A;  8ICO A;  4C7Z A;  3PV8 A;  1ZQL A;  1JX4 A;  2YB1 A;  4S3N A;  1N48 A;  5ALU A;  4YQW A;  2LKY A;  1Q8K A;  3AQM A;  4RWQ A;  4RNN A;  4GXI A;  5J8Y C;  2GH1 A;  4AT8 B;  4OO1 J;  3EYZ A;  4ED0 A;  2ZH8 A;  4FH3 A;  9ICA A;  3OVB A;  2ZIX A;  3QU4 A;  3GQC A;  3C5G A;  2AHO B;  2IHM A;  4DO9 A;  3H0R B;  2ZH4 A;  2W7O A;  2OEH A;  4USA A;  3D2N A;  4F2S A;  3BQ1 A;  8ICK A;  1RDF A;  4EEK A;  3ED5 A;  3MFH A;  3H0L B;  1Z4O A;  3HT3 A;  1ZQT A;  1UA0 A;  3H8S A;  3F2C A;  4OJP A;  8ICZ A;  3WK4 A;  2PFQ A;  4CCH A;  3RJK A;  4O3O A;  3PST A;  1BPX A;  7ICT A;  2W11 A;  4OJO A;  2ATL A;  1UCV A;  4UAU A;  4XJE A;  3MDA A;  1NZB A;  1NKC A;  4RZR A;  3MR3 A;  1RQL A;  3OUY A;  3JPS A;  5DDM A;  4R63 A;  3T5J A;  2HOI A;  2VA8 A;  1KKX A;  1TK0 A;  4O9M A;  2P35 A;  4RQ6 A;  2ESE A;  1ZRN A;  2MRL A;  3OVA A;  3M8S A;  2KN7 A;  4YP3 A;  4O5C A;  4KLF A;  3H3A A;  5KFU A;  3PO5 A;  3D2S A;  4KLT A;  5HRH A;  4QZ8 A;  1N63 A;  2YMM A;  1QQ5 A;  4DSJ A;  2Q4T A;  2LPE A;  3RB4 A;  5KG2 A;  2M2V A;  4QZD A;  1ZD4 A;  9ICC A;  2W9M A;  2K4I A;  3S6J A;  4X4V A;  3ISB A;  5ALH A;  2A1J A;  2W03 A;  9ICS A;  4NY8 A;  3Q8Q B;  3RTV A;  4RQN A;  2HBK A;  1L3T A;  1ZJM A;  3ONN A;  1NJY A;  3H8W A;  1T3Q A;  4F4W A;  1BNP A;  8ICL A;  1UEU A;  4WC3 A;  1HEK A;  5KFC A;  1ZQF A;  9ICN A;  2IA6 A;  4F8R A;  1SXE A;  1F0M A;  1QCK A;  4QZA A;  1XWL A;  4DL6 A;  4EZ6 A;  4EEY A;  2MA1 A;  3EZ5 A;  4LEY A;  5HRF A;  4P2H A;  3PHZ A;  4P4M A;  4K9B A;  3U26 A;  5CHG A;  5ALX A;  4YMN A;  1SWW A;  2HDO A;  5CFU A;  1T4G A;  5AK5 A;  3OHB A;  1NKE A;  3PY8 A;  3PR5 B;  5L1I A;  3TAP A;  3OTQ A;  1P7D A;  2WF6 A;  1QSL A;  4NL9 A;  2BPG A;  4YN4 A;  2HVH A;  5KG4 A;  1ZQQ A;  2KSO A;  5JU5 A;  1KTQ A;  3WU2 U;  7ICP A;  4JV1 A;  1KFS A;  2R8J A;  3C18 A;  5KFX A;  5ALZ A;  4RWP A;  5KFM A;  2V4Q A;  2ZIW A;  3RH5 A;  4M9H A;  2ISO A;  1L7M A;  4C8N A;  2HN1 A;  4RUC A;  5E79 U;  1MIW A;  2OHF A;  1MIY A;  1KRP A;  5AKL A;  4BWM A;  2XY7 A;  2B0C A;  4O68 A;  2O1P A;  3IN5 A;  1SXD A;  3BQ2 A;  2CXY A;  4Y2P A;  1NK5 A;  2WF7 A;  3C2K A;  5HHI A;  3Q8R B;  1QLN A;  5KFO A;  4KLE A;  5J0O A;  3PO4 A;  5JTI A;  3GV8 B;  4MF2 A;  2B21 A;  5J0U A;  2K60 A;  4C4S A;  1X6J A;  3M6Z A;  1JAJ A;  2YY6 A;  2R8K A;  1Z4N A;  2BPC A;  4DF8 A;  3NVZ A;  4WCW A;  5F9L A;  2K4H A;  5HP4 A;  4WC6 A;  4M6W A;  1NJX A;  3RR8 A;  4YCX A;  4K9A A;  1VJ7 A;  4U7C A;  4ED8 A;  9ICG A;  5KFV A;  2PKE A;  1NZP A;  2ZH1 A;  4QWD A;  4KX5 A;  1RXV A;  2PMZ C;  2BKE A;  4LJX A;  1LB2 B;  5F3X B;  4OJL A;  4DL4 A;  3NS1 A;  5KFA A;  3AN1 A;  2EZY A;  3RJG A;  4US9 A;  1Q3U A;  2JMG A;  5J0Y A;  1BPY A;  2G08 A;  5DG8 A;  4QW9 A;  4O3S A;  4IC9 A;  4Y2U A;  1ZQN A;  2IHO A;  1L6N A;  1BPE A;  3RB3 A;  3LWM A;  3NAS A;  8ICU A;  4DS5 A;  5L1M A;  4YR3 A;  4C8M A;  4YG2 A;  2ZIX B;  3SD7 A;  4C80 A;  3ZDE A;  2XY5 A;  2QB1 A;  4EZ9 A;  1ZQA A;  3VC8 A;  3ZDA A;  3G6X A;  5HRK A;  5AK3 A;  2GWS A;  2ZIU A;  2ZH3 A;  4M0A A;  5HRL A;  7ICS A;  1HIW A;  3QEB Z;  2AU0 A;  1MQ3 A;  3ICX A;  5AI5 A;  1N61 A;  1SIJ A;  5KT7 A;  4P0Q A;  3TAD C;  1TAU A;  5J29 A;  2KKV A;  1IIP A;  4M9J A;  5HRI A;  1KNY A;  3UMC A;  1DRG A;  4DOC A;  3QUB A;  1PVR A;  9ICV A;  3UPS A;  2BDP A;  2ASL A;  4ELV A;  3MCR A;  2Y1I A;  2RQ5 A;  2HCF A;  2VKQ A;  4PZN A;  3I28 A;  4J9Q A;  1K1S A;  3OUY B;  4C8O A;  1ZD3 A;  4UB4 A;  8ICY A;  5BPC A;  2W8K A;  2ZXI A;  4OD0 A;  2WB1 C;  3KHL A;  1XO1 A;  4RQ2 A;  1FFV A;  2R8I A;  4O5E A;  2RRD A;  4CDG A;  2W55 A;  5HRB A;  4WQK A;  1ZQV A;  4ECV A;  4Q43 A;  3HW8 A;  5GTH U;  1MN8 A;  3UXP A;  2RDI A;  1A0P A;  5DEC A;  2E1E A;  4Z6E A;  3Q8M A;  3GDX A;  4F5O A;  7ICE A;  4WBZ A;  2HHW A;  2JHD A;  4US8 A;  4FZN A;  3PW4 A;  2XO7 A;  2JXJ A;  4NJ8 A;  2A1J B;  3QU9 A;  5EE1 A;  1SV0 C;  3WK9 A;  3V6J A;  1X6I A;  4O0I A;  1X66 A;  4QWA A;  4F5Q A;  2PFN A;  4XQ8 A;  3G6Y A;  3CNH A;  4QZG A;  2C28 A;  3ER9 B;  2DR5 A;  2HSZ A;  5L9X A;  2IOH A;  4NXT A;  4KLL A;  5B3P A;  5AI4 A;  2Y9T A;  1KBU A;  4NKT A;  2DPJ A;  2W04 A;  1ZOL A;  5B66 U;  5CA7 A;  4PL2 A;  2GAF D;  4UAS A;  4E80 A;  4BX9 C;  4DOA A;  3MAB A;  3RAQ A;  1TK5 A;  4K8V A;  3CK6 A;  4E8F A;  3MGH A;  1JRO A;  4J9K A;  3RJE A;  2EZZ A;  5CRX A;  4DS4 A;  2QAR A;  3RBD A;  3TAN A;  3H8J A;  2G5I B;  3NVO A;  4OAI Z;  1Z00 A;  4NXZ A;  2W3R A;  3N4M B;  2EZX A;  2ISP A;  4TUR A;  4F4Y A;  3A0H U;  5BOL A;  3OPX A;  1NJZ A;  1AQ6 A;  4PGY A;  1S0N A;  1Z1V A;  2KFN A;  2ZUD A;  4X4O A;  4KLD A;  1ZQJ A;  1ZQI A;  5CFS A;  5KAF U;  1KLN A;  4GFJ A;  1X9W A;  2KSO B;  4O3N A;  2ZTE A;  5ALR A;  4DFD A;  8ICH A;  2KG5 A;  4NM2 A;  5CWR A;  9ICO A;  4R65 A;  8ICN A;  5AI6 A;  1RYU A;  1WUD A;  5DQH A;  2YQE A;  3CP8 A;  2ZIW B;  1ARO P;  5CFT A;  3KBB A;  2K8B B;  3AUO A;  3WKB A;  3R9K A;  4ECW A;  1A6S A;  2E8P A;  4K97 A;  2DFL A;  3SMV A;  2F8L A;  9ICF A;  9ICU A;  4NXV A;  2BR0 A;  3EPI A;  4X4T A;  1L8O A;  2BHN A;  2BQ3 A;  4Y2Y A;  1IXR A;  3K1Z A;  2OXO A;  1ZQS A;  2OYY A;  1K1Q A;  4DQQ A;  5DDY A;  3E58 A;  4ATB A;  3PX4 A;  3F2D A;  4UW9 A;  3SV4 A;  2Y1J A;  2IHN A;  1U47 A;  4WH5 A;  1X42 A;  4M6W B;  4ED7 A;  4JUZ A;  2AJQ A;  1PVQ A;  4EBD A;  1NI3 A;  5DGA A;  4N7R A;  2PMZ F;  5AIA A;  3BS5 A;  3JPQ A;  3PZP A;  4EX7 A;  5HHH A;  1B4F A;  3BQT A;  7ICQ A;  2H3Q A;  2XGP A;  2VJ4 A;  4F4K A;  5KL1 B;  3MDC A;  3OVS A;  3PML A;  2DUY A;  4DSI A;  3KHR A;  4ED3 A;  1ZQB A;  3B0Y A;  5AKJ A;  7ICM A;  5IIM A;  3QZ8 A;  1ZQC A;  1U49 A;  3TI0 A;  2KTQ A;  3FM9 A;  1RZT A;  3PW7 A;  4IRK A;  2JR5 A;  2ZTD A;  3NVW A;  2F1H A;  3QUC A;  3PSF A;  2MAX A;  5J2H A;  3H37 A;  3RFA A;  2K8C B;  1XC9 A;  3NGD A;  2ZH2 A;  3N97 B;  5AKY A;  3ORY A;  3AQN A;  3OSP A;  2ASD A;  2ZXH A;  2M2U A;  2K89 A;  5KFN A;  3QX7 A;  2HN2 A;  1J2M A;  4B9S A;  4P0Q B;  1SWV A;  2F3N A;  3GIK A;  5KT5 A;  5D4B A;  4M9L A;  1S0V A;  8ICQ A;  4TQR A;  3ISD A;  3RB6 A;  3RRG A;  4DQP A;  3HWT A;  2WB1 F;  5ALM A;  1WWV A;  1KSP A;  3SEN A;  4F5P A;  4I2E A;  3H39 A;  5AM4 A;  3G6V A;  2XGQ A;  4YR2 A;  4ED1 A;  2ZUC A;  4FS2 A;  2D8C A;  2C2R A;  2HBJ A;  2LYA A;  4I29 A;  4FHP A;  3KTQ A;  5ALQ A;  3HP6 A;  2M9N A;  1BGX T;  4XRH A;  4DQR A;  5ALL A;  1R89 A;  3H7I A;  5ALP A;  2MU2 A;  4YR0 A;  3Q8S B;  3FC4 A;  3Q8K A;  2EWR A;  4P0P A;  5IIO A;  4K96 A;  4UD4 A;  1ZRM A;  4BGD A;  4E7X A;  2RP5 A;  1Q78 A;  3PSP A;  4ECX A;  2OH2 A;  1QQ6 A;  2KZM A;  4PPX A;  4QZC A;  8ICS A;  4I27 A;  4NM1 A;  2RHF A;  4O6A A;  4MKP A;  1KFT A;  5DBA A;  3M8R A;  1ZQR A;  4DL2 A;  2M0N A;  1JXL A;  3KKA C;  4B9V A;  5KG0 A;  5EOZ A;  4MFC A;  1Q79 A;  1F44 A;  2VAN A;  4K4I A;  4UAW A;  3TFS A;  4UD5 A;  5J0X A;  2ZH6 A;  3B0X A;  3HJ1 A;  1X9M A;  3JCF A;  4P4O A;  5J2D A;  2JRZ A;  3NVY A;  2KD1 A;  1T8E A;  3B9J A;  2QAR B;  3KOO A;  3SEI A;  2YX8 A;  2AQ4 A;  3CW2 C;  3A0B U;  2KP7 A;  1Z00 B;  1X9S A;  1ZQU A;  3C23 A;  1KW4 A;  5J2K A;  2V9W A;  1O08 A;  4QZ9 A;  2KZ3 A;  2KOB A;  5DB9 A;  1KDH A;  3WFR E;  4UB5 A;  2F1I A;  1MC8 A;  4K98 A;  1RQN A;  4HAI A;  5J0T A;  3RR7 A;  4F3O A;  4I2G A;  2QB0 B;  2FI1 A;  2PI4 A;  2Q0Z X;  3AQK A;  1WCN A;  3H4D A;  3SAH A;  2NO4 A;  4CE6 A;  1Z1B A;  1UPH A;  3C2M A;  4PJ0 U;  4FH5 A;  2K8A A;  2G0A A;  3WK8 A;  3M9N B;  3LVV A;  2G07 A;  2WFA A;  2I6X A;  9ICQ A;  5B3Q A;  1N56 A;  2B6G A;  3FAH A;  3BZC A;  2NRK A;  3UMG A;  5D62 A;  4EP7 A;  4QJF B;  2D6F C;  4O69 A;  5KFZ A;  2J6U A;  4LEZ A;  3FYH A;  1OU5 A;  9ICP A;  3ALR A;  4E0D A;  2ZH5 A;  4LZG A;  3C1Y A;  3KZI U;  1KQQ A;  2C2E A;  2D3D A;  2H3I A;  1L7O A;  4X4N A;  1PZN A;  2HOF A;  4I2F A;  4F5R A;  1QSY A;  2VJ5 A; 
#chains in the Genus database with same CATH homology
 1NK8 A;  3MR6 A;  1HUO A;  4JV2 A;  1BVS A;  4IR1 A;  1ZQG A;  2FPK A;  3ZDE A;  2XY5 A;  1NO5 A;  4EZ9 A;  1ZQA A;  3NTU A;  5KFB A;  3ZDA A;  4MFF A;  5KG5 A;  3QE9 Y;  1R8C A;  1RYR A;  1XU4 A;  3G6X A;  3L9D A;  8ICF A;  5HRK A;  3SI8 A;  2J6T A;  5KFQ A;  1SL2 A;  1TAQ A;  2GWS A;  4RQ4 A;  2ZH3 A;  1TFY A;  4J9M A;  2HW3 A;  5KFD A;  1ZJN A;  4M0A A;  3KHG A;  4DFK A;  3HIY A;  3PW2 A;  5HRL A;  4ATB B;  3ZD9 A;  4DL5 A;  4FO6 A;  9ICR A;  2AQ0 A;  5L1L A;  3QEB Z;  2BPF A;  4FBU A;  4J9O A;  2AU0 A;  7ICS A;  4WC2 A;  5DG7 A;  7ICF A;  1WCL A;  1SKR A;  1MQ3 A;  3RJH A;  3GIM A;  4WBY A;  2F1J A;  5KT7 A;  5DGB A;  4F4Z A;  4NLK A;  1ZQZ A;  5KFR A;  4ECY A;  2PFO A;  5J29 A;  1TAU A;  2ZUB A;  4EBK A;  1MIV A;  2JEG A;  4NLN A;  3RBE A;  1BNO A;  2VA3 A;  4M9J A;  4YD2 A;  5IIN A;  3LK9 A;  5HRI A;  2DR7 A;  1KNY A;  3PR4 A;  4BXO A;  4DSL A;  4DOC A;  3UPS A;  9ICV A;  4YVZ A;  3RAX A;  5KFI A;  2BDP A;  4F4X A;  5CR0 A;  5KT2 A;  2ASL A;  7ICL A;  1ZQK A;  2FMS A;  5KG6 A;  4ELV A;  1D9F A;  4FS1 A;  2ZJA A;  5JUM A;  2Y1I A;  2KP7 A;  3AQL A;  5KFH A;  1ZQX A;  3EPG A;  4J9Q A;  1K1S A;  3OUY B;  3FDS A;  2BCV A;  4C8O A;  4UB4 A;  8ICY A;  5BPC A;  4KLQ A;  4Z6C A;  4RQ3 A;  1S10 A;  2W8K A;  1S97 A;  4RPX A;  3ETL A;  3KHL A;  4YMO A;  1XO1 A;  3H4B A;  4EBE A;  3T5L A;  5DLF A;  5DG9 A;  2XCA A;  1SL1 A;  4RWO A;  4I2D A;  5EWF A;  1X2I A;  4RQ2 A;  2R8I A;  4DF4 A;  2FLP A;  5KG1 A;  4MFA A;  3RJJ A;  2IBK A;  4O5E A;  2P66 A;  4WC4 A;  5HRB A;  1ZQV A;  4KN7 A;  5EWE A;  3AU6 A;  2R8G A;  5HR9 A;  4ECV A;  4Q43 A;  3HW8 A;  4J9P A;  4B9T A;  4M2Y A;  1D8Y A;  5III A;  3UXP A;  5CP2 A;  3WFO A;  3K4G A;  2RDI A;  2FMP A;  8ICG A;  5DEC A;  4O3R A;  4Z6E A;  3Q8M A;  3GDX A;  2AGO A;  4F5O A;  7ICE A;  3HPO A;  4GLX A;  2FLN A;  4DQS A;  4WBZ A;  3RH6 A;  3V7L A;  4R8U B;  4EYI B;  2HHW A;  4IRD A;  1F5A A;  2AGP A;  8ICJ A;  1ZQY A;  2FPL A;  4C8K A;  9ICX A;  1ZQH A;  2O5A A;  3WFS C;  4J9S A;  2BQU A;  1D9D A;  3LQC B;  4M5D A;  1ZQD A;  4DWI A;  2ZJ5 A;  1KFD A;  4RPZ A;  3PW4 A;  3KHH A;  1D8L A;  4KLM A;  1Y88 A;  2XO7 A;  4ED2 A;  2ID1 A;  2A1J B;  4M47 A;  2JZB B;  1ZQP A;  3JZ0 A;  1S9F A;  1JXE A;  2W9A A;  3V6J A;  4KTQ A;  4MEY A;  4Q44 A;  4O0I A;  3JPO A;  4QWA A;  3V7J A;  4F5N A;  1NK4 A;  3BDP A;  4QZB A;  2I1Q A;  4F5Q A;  4PHP A;  9ICT A;  4AT9 B;  2LYH A;  3PX6 A;  2PFN A;  7ICJ A;  4XQ8 A;  7ICR A;  7ICO A;  3G6Y A;  3TFR A;  1ZYQ A;  4QZG A;  2C28 A;  4ECS A;  5TZV A;  4I2B A;  2DR5 A;  4IQV A;  5L9X A;  4KLL A;  1EXN A;  4DQI A;  4WC5 A;  5IIK A;  5DBB A;  4PGX A;  4J9R A;  3PW0 A;  4FBT A;  4X4Q A;  5KT6 A;  4NKT A;  2DPJ A;  2JEJ A;  5CA7 A;  2HHQ A;  1YLQ A;  1ZQW A;  4EBJ A;  1S0O A;  4X4U A;  2DRB A;  5KFS A;  4E80 A;  4DOA A;  3MAB A;  3RAQ A;  1TK5 A;  1TFR A;  4J9N A;  1JQR A;  4X0B A;  4PGQ A;  2P6U A;  4E8F A;  3MGH A;  4KLJ A;  4J9K A;  7ICH A;  1KEJ A;  4DL7 A;  4B9U A;  2DR9 A;  3RJE A;  3BJY A;  7ICV A;  4FHX A;  4B9N A;  2C22 A;  2BGW A;  1C7Y A;  2ZJ8 A;  5IIJ A;  4UBC A;  3JPT A;  4DS4 A;  4I2A A;  4LVS A;  4GXJ A;  3C21 A;  1A77 A;  4ECT A;  3OV7 A;  3RBD A;  4UAY A;  3TAN A;  4M04 A;  5HC9 A;  4DSE A;  3H8J A;  5J2G A;  9ICL A;  4F93 B;  2UVW A;  3JPN A;  4BWJ A;  1Z00 A;  4NXZ A;  4ECU A;  3N4M B;  1B43 A;  9ICM A;  4KLI A;  3THV A;  2ISP A;  4JV0 A;  3MBY A;  4TUR A;  3OJS A;  2W9B A;  5J2E A;  3V7K A;  4F4Y A;  4RQ0 A;  2J6S A;  4C8L A;  1CUK A;  5BOL A;  4EBC A;  3RB0 A;  4KN4 A;  1NJZ A;  1Z3E B;  3V6H A;  4K4H A;  4PGY A;  1PX5 A;  1S0N A;  4M9G A;  3UXO A;  5KG7 A;  3M9O B;  4IQT A;  4RT2 A;  5J0S A;  2KFN A;  2ZUD A;  4X4O A;  4KLD A;  1ZQJ A;  1ZQI A;  5KFL A;  2BCR A;  4B9L A;  4NLG A;  1MSW D;  4O5K A;  4DL3 A;  4B9M A;  2ZH9 A;  8ICO A;  1X9S A;  5KT3 A;  3PV8 A;  2DPI A;  1KLN A;  5KFY A;  4YD1 A;  3OHA A;  1X9W A;  1ZQL A;  4O3N A;  2ZTE A;  3UQ2 A;  8ICH A;  9ICH A;  2ZHB A;  4X0A A;  4NM2 A;  5CWR A;  1JX4 A;  9ICO A;  2MUT A;  4R65 A;  3GIL A;  3GV7 B;  4PHE A;  7ICG A;  8ICN A;  9ICB A;  5KG3 A;  1ZET A;  4KLU A;  1N48 A;  1UET A;  4S3N A;  4UB2 A;  4GC7 A;  5DQH A;  4YQW A;  4GXK A;  4ECQ A;  4R66 A;  4AT7 A;  1TFW A;  4LZD A;  2I9G A;  1ARO P;  4DEZ A;  4GC6 A;  3JPP A;  3T3F A;  5HMM A;  3AQM A;  4RWQ A;  4RNN A;  5KTQ A;  3UXN A;  4GXI A;  5D49 A;  3H40 A;  2HHP A;  3AUO A;  4FHW A;  1NK7 A;  4AT8 B;  4ECW A;  4KMU A;  2DFL A;  3EYZ A;  4ED0 A;  8ICE A;  2ZH8 A;  2XC9 A;  1H38 A;  1SL0 A;  4DLE A;  4JWN A;  9ICF A;  1B22 A;  4FH3 A;  9ICU A;  5D46 A;  3T5K A;  9ICA A;  3OVB A;  2BR0 A;  1U45 A;  1R8B A;  5BOM A;  4RT3 A;  3EPI A;  3GQC A;  1BPZ A;  3C5G A;  1NJW A;  3MR5 A;  4DO9 A;  2IHM A;  4X4T A;  2NRX A;  2BHN A;  4F91 B;  2ZH4 A;  3ZD8 A;  4TUS A;  2BQ3 A;  2HHV A;  3IM1 A;  4QW8 A;  5KFG A;  5J2F A;  4RQ8 A;  1IXR A;  9ICJ A;  3LDA A;  5KT4 A;  1ZQS A;  3AQN A;  4F2S A;  5DB7 A;  4TQS A;  1K1Q A;  3OSN A;  3BQ1 A;  4DLG A;  8ICK A;  1WOT A;  2RFF A;  2DRA A;  4DQQ A;  2DVI A;  5DDY A;  3LWL A;  1QSS A;  2NRW A;  2C2D A;  1U48 A;  4JWM A;  5DKW A;  3PVX A;  8ICP A;  3MFH A;  3PX4 A;  4ATB A;  3HT3 A;  1ZQT A;  1UA0 A;  3H8S A;  1ZQM A;  3SV4 A;  2Y1J A;  2IHN A;  1U47 A;  4QWE A;  5J0Q A;  2RDJ A;  4RNM A;  2HHT A;  9ICE A;  8ICZ A;  4M6W B;  4ED7 A;  4JUZ A;  2PFQ A;  4J9L A;  2PXI A;  4DOB A;  2AJQ A;  5EWG A;  4TUP A;  4QZF A;  2W9C B;  4EBD A;  4CCH A;  3RJK A;  9ICI A;  4O3O A;  5CB1 A;  5DGA A;  2ZTC A;  1BPX A;  7ICT A;  4UQG A;  4I2J A;  2ATL A;  5J2I A;  3JPQ A;  1JIH A;  4RQ1 A;  3MDA A;  2V4R A;  1NKC A;  4RZR A;  2NRT A;  8ICX A;  3MR3 A;  3SYZ A;  4F2R A;  5HHH A;  3AU2 A;  1DK2 A;  3BQT A;  3JPR A;  2OWO A;  3JPS A;  3OUY A;  9ICK A;  5DDM A;  3V72 A;  4KLH A;  4YXM A;  4R63 A;  7ICQ A;  3NYB A;  2XGP A;  3T5J A;  4F4K A;  3ISC A;  3MDC A;  3OVS A;  2VA8 A;  1HJP A;  3PML A;  5HRD A;  3RRH A;  1TK0 A;  4DSI A;  4O9M A;  2HHS A;  4F92 B;  3KHR A;  4Q8F A;  4RQ6 A;  4ED3 A;  1ZQB A;  3B0Y A;  5L1K A;  1NK0 A;  5J0R A;  7ICM A;  3OVA A;  5IIM A;  3M8S A;  4MF8 A;  1A76 A;  4YXJ A;  4YP3 A;  4UAZ A;  4YMM A;  3QZ8 A;  2KN7 A;  3MR2 A;  4DSF A;  3QEA Z;  1ZQC A;  2FPM A;  4O5C A;  4KLF A;  7ICU A;  3H3A A;  5J2B A;  5KFU A;  2AGQ A;  1U49 A;  1S0M A;  4O3P A;  5J0W A;  3TI0 A;  3PO5 A;  4ELU A;  1SZP A;  2KTQ A;  4KLT A;  5HRH A;  4QZ8 A;  3OJU A;  1RZT A;  3PW7 A;  4IRK A;  5KFK A;  5KFP A;  4RPY A;  4R8U A;  1XS9 D;  1SKW A;  4DSJ A;  3HJ4 A;  5HRE A;  2ZTD A;  3GV5 B;  7ICN A;  2H5X A;  2BCU A;  2F1H A;  4IRC A;  3TQ1 A;  1L3S A;  3RB4 A;  5KG2 A;  2P6R A;  2MAX A;  3Q8L A;  5KFW A;  5J2H A;  3WFP A;  4JK1 A;  2W8L A;  3H37 A;  4Z6F A;  3MGI A;  2M2V A;  4QZD A;  1NKB A;  8ICI A;  2UVV A;  1XC9 A;  3NGD A;  5KFT A;  2W9M A;  5C5J A;  4QZI A;  2BCS A;  9ICC A;  3ISB A;  2ZH2 A;  4X4V A;  2A1J A;  2JZB A;  3N97 B;  3ORY A;  2XY6 A;  4PH5 A;  5J2C A;  3OSP A;  1UA1 A;  3Q8Q B;  4NY8 A;  3RTV A;  2ASD A;  9ICS A;  1R8A A;  4IQW A;  4WC0 A;  4I2C A;  1L3T A;  4G3I A;  2M2U A;  1ZJM A;  5KFN A;  3OGU A;  4AT9 A;  4X4R A;  3SZ2 A;  1NJY A;  3H8W A;  4B9S A;  1L5U A;  1NK9 A;  8ICV A;  4F4W A;  3GIK A;  5DLG A;  1BNP A;  2UVU A;  1DK3 A;  5KT5 A;  3IHQ B;  5D4B A;  4M9L A;  1S0V A;  1S77 D;  2VA2 A;  8ICQ A;  1DGS A;  2ASJ A;  1TK8 A;  8ICL A;  4MEX A;  1UEU A;  4WC3 A;  3E2E A;  5KFC A;  4TQR A;  1XSL A;  1ZQF A;  3ISD A;  3RB6 A;  1TV9 A;  2PI5 A;  3RRG A;  9ICN A;  2NRV A;  2IA6 A;  4DQP A;  2ZH7 A;  5IIL A;  4F8R A;  1ZQO A;  3HWT A;  1KSP A;  4Z6D A;  2KZZ A;  4DFM A;  4QZA A;  1XWL A;  4DL6 A;  1QTM A;  4UB3 A;  4F5P A;  4I2E A;  4ED6 A;  3H39 A;  1NOM A;  3G6V A;  2XGQ A;  4FHV A;  4EZ6 A;  3EWA A;  4EEY A;  1L3V A;  4DFP A;  4YR2 A;  4ED1 A;  4Q45 A;  2ZUC A;  4XUS A;  3EZ5 A;  4FS2 A;  2C2R A;  5CJ7 A;  1XSP A;  4Q8E A;  8ICW A;  4M9N A;  5DQG A;  5HRF A;  4P2H A;  4P4M A;  1COO A;  1UT5 A;  5CHG A;  2FMQ A;  1UEV A;  4I29 A;  4IR9 A;  4YMN A;  8ICC A;  1NK6 A;  4FHP A;  3KTQ A;  4KLO A;  2M2W A;  5J0P A;  4RQ5 A;  5J2A A;  2M9N A;  1T4G A;  3HP6 A;  3TAR A;  4NLZ A;  3ZDB A;  3OHB A;  1NKE A;  1BPB A;  5F2V O;  4KIT B;  1BGX T;  3PY8 A;  3PR5 B;  4XRH A;  5L1I A;  4DQR A;  4DFJ A;  3TAP A;  5DED A;  1R89 A;  3H7I A;  5HML A;  1TVA A;  1QSL A;  5L1J A;  4YR0 A;  4YN4 A;  3Q8S B;  2BPG A;  2HHU A;  2HVH A;  4ECZ A;  5KG4 A;  4BDP A;  1U4B A;  3Q8K A;  5IIO A;  1ZQQ A;  2BCQ A;  1BPD A;  4K4G A;  4DSK A;  3H38 A;  4PHD A;  4UD4 A;  1KTQ A;  1U9L A;  4BGD A;  4RUA A;  1S76 D;  4E7X A;  7ICP A;  1HUZ A;  1Q78 A;  4ECX A;  4JV1 A;  2KZM A;  1KFS A;  4PPX A;  4QWC A;  2R8J A;  4QZC A;  1JN3 A;  4X4P A;  3C18 A;  8ICS A;  5KFX A;  4I27 A;  2UVR A;  4NM1 A;  5DBC A;  8ICA A;  5KFM A;  1MQ2 A;  4RWP A;  4KLS A;  2V4Q A;  1DOQ A;  3RH5 A;  4M9H A;  2ISO A;  5DBA A;  4C8N A;  3M8R A;  1KFT A;  1ZQR A;  4QZE A;  4IQU A;  4RUC A;  2JEF A;  1SKS A;  4DL2 A;  5DQI A;  4KLG A;  1ZQE A;  1MIW A;  1JXL A;  4B9V A;  4FHY A;  4WC7 A;  5KG0 A;  4RQ7 A;  2FLL A;  1KRP A;  5EOZ A;  4BWM A;  1MIY A;  4MFC A;  4AT8 A;  1Q79 A;  2XY7 A;  2VAN A;  4I2H A;  1VFG A;  1RXW A;  4K4I A;  2M2T A;  1TKD A;  4UAW A;  3TFS A;  2O1P A;  4UD5 A;  5DB6 A;  5J0X A;  5J2J A;  3BQ2 A;  8ICB A;  9ICW A;  4X4S A;  3B0X A;  2ZH6 A;  4O3Q A;  1NK5 A;  3HJ1 A;  2Q66 A;  4IG8 A;  4RU9 A;  1X9M A;  4P4O A;  5J2D A;  3M9M B;  3C2K A;  3C66 A;  3RJI A;  2HHX A;  1UT8 A;  4ELT A;  5HHI A;  3Q8R B;  5DB8 A;  1QLN A;  1V9P A;  5HRG A;  1T8E A;  5KFO A;  1RYS A;  2R8H A;  4HYK A;  5F9N A;  1IM4 A;  4KLE A;  5J0O A;  4F5R A;  2IMW P;  3HX0 A;  2XCP A;  2ALZ A;  3PO4 A;  3GIJ A;  4XQ7 A;  2DR8 A;  3GV8 B;  4MF2 A;  2B21 A;  3Q8P B;  7ICK A;  4I2I A;  2AQ4 A;  2KFZ A;  3SV3 A;  1Z00 B;  5KFF A;  1ZQU A;  5J0U A;  3C23 A;  5J2K A;  4RNO A;  4R64 A;  3BQ0 A;  4QZH A;  2V9W A;  4QZ9 A;  3ZDC A;  4YFK A;  2KZ3 A;  3PMN A;  1JAJ A;  2W9B B;  5DB9 A;  2PFP A;  1T3N A;  3TAQ A;  3UPQ A;  1KDH A;  2R8K A;  4UB5 A;  3WFR E;  4NKU A;  4F50 A;  2BPC A;  1MC8 A;  2F1I A;  4DF8 A;  4WCW A;  5F9L A;  5J0T A;  3RR7 A;  1V4A A;  4EYH B;  4F3O A;  5HP4 A;  4I2G A;  4M6W A;  5HNK A;  4WC6 A;  1NJX A;  3RR8 A;  1CEZ A;  4YCX A;  2ZHA A;  2W9C A;  2PI4 A;  4XA5 A;  1VJ7 A;  2Q0Z X;  4ED8 A;  4P4P A;  3QZ7 A;  4ECR A;  3RJF A;  2PBE A;  3AQK A;  1WCN A;  3H4D A;  1RPL A;  5KFE A;  3C2M A;  9ICG A;  3JYY A;  4WC1 A;  3GFK B;  5KFV A;  4FH5 A;  1NZP A;  2BQR A;  1JMS A;  4QWD A;  3T5H A;  2ZH1 A;  1XSN A;  1RXV A;  3M9N B;  2MUT B;  3GII A;  9ICQ A;  3EW9 A;  4TUQ A;  2BKE A;  1N56 A;  1LB2 B;  3K75 D;  4PHA A;  3MFI A;  4I28 A;  3UQ0 A;  3PNC A;  2NRK A;  4DL4 A;  1T7P A;  3PX0 A;  4EP7 A;  2HVI A;  4AT7 B;  4UBB A;  4X5V A;  5KFA A;  8ICM A;  3C1Z A;  5KFZ A;  4UB1 A;  2JEI A;  1LV5 A;  2J6U A;  3RJG A;  1L3U A;  5J0Y A;  3FYH A;  1BPY A;  1OU5 A;  5DG8 A;  4ZH4 A;  4QWB A;  4QW9 A;  3V6K A;  3PW5 A;  2NRZ A;  3C5F A;  4BXO B;  4O3S A;  9ICP A;  7ICI A;  4RWN A;  1ZQN A;  4E0D A;  2ZH5 A;  4LZG A;  3C2L A;  3RH4 A;  8ICT A;  3C1Y A;  1BPE A;  3RB3 A;  2C2E A;  4LT6 A;  2BE3 A;  3LWM A;  8ICR A;  4X4N A;  1FA0 A;  2WTF A;  3ZDD A;  8ICU A;  3WFQ E;  1PZN A;  4DS5 A;  5KFJ A;  4I2F A;  4YR3 A;  1QSY A;  4C8M A;  4YG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...