5J0TA

Binary complex crystal structure of dna polymerase beta with g:a mismatch at the primer terminus
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
330
structure length
327
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 109
structure length 327
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0tA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0tA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0tA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0tA03
4Q8FA 4QWDA 1ZQCA 4ATBA 3HP6A 2ASDA 4YCXA 1BPDA 1ZQMA 2VA3A 4RPZA 4DQQA 4Z6EA 3ORYA 5KFPA 3AQNA 4J9KA 5L1KA 4QZGA 4RQ6A 3RAXA 7ICFA 5DB9A 5TZVA 3C2LA 4F4YA 4IRCA 1XSNA 5HRHA 4DL4A 4DSKA 1ZQXA 5KFFA 8ICPA 1NKBA 2AU0A 3ZDCA 4AT7B 1JXLA 5HRKA 5DGBA 5HMLA 1NK4A 4NM2A 4O3PA 1NK7A 1L3VA 5J2KA 4QZHA 4DF8A 4IRDA 4DQRA 4YVZA 4M04A 2HHWA 2JEJA 9ICGA 1X9WA 1ZQJA 3AQMA 3M8RA 4KLOA 3PW5A 4TQRA 4B9LA 1S77D 4F3OA 3Q8MA 3SV3A 3T5HA 4X0BA 3HJ4A 4UD4A 3UXPA 4DL3A 4KLTA 1A77A 5J0SA 4RNOA 3PMLA 2M2VA 5DLGA 4J9MA 3GFKB 2J6UA 3V72A 3OVBA 5KFNA 9ICOA 2NRXA 4B9NA 2DR9A 4FS2A 3OUYA 2Q0ZX 3UPSA 4F4KA 4IQUA 1LV5A 2JEGA 8ICFA 4KLUA 4P4PA 4F2SA 5J0YA 4P4MA 5DB8A 4ECUA 3RRHA 2ZJ5A 2BR0A 8ICBA 4P4OA 5DB6A 3BQ1A 4G3IA 4O5EA 4Q45A 2Y1JA 3HX0A 4IQVA 2MUTA 2PI4A 2O1PA 2DR8A 4RZRA 1XU4A 2FPKA 1F5AA 4UB5A 2VANA 5J29A 2FLPA 4DFPA 4ED6A 5HRBA 3MR6A 4JK1A 4UB3A 3JPRA 1NJYA 4RWPA 2C2DA 2AQ0A 1Z00A 4UAZA 2Y1IA 1T4GA 3RBDA 4ELVA 1NO5A 1XSLA 2ZH1A 3H40A 3RJEA 4JUZA 3KHGA 3ZDDA 4EYHB 4WC4A 5KFJA 1SKRA 3N4MB 2BKEA 2ZH2A 1QLNA 2ATLA 5KT7A 3V6KA 4Z6CA 1Q79A 5KFDA 4FHXA 3C23A 4QWBA 3V7LA 4EBCA 2DR7A 5J2HA 3TANA 3GDXA 4I2EA 3H8WA 3UPQA 3H39A 5KFBA 1EXNA 4DOBA 4GXJA 1BPEA 2BGWA 1X9SA 7ICEA 4DSIA 4WC1A 4ED3A 1NK0A 2ZH6A 4MFFA 3WFPA 2WTFA 3PMNA 1KFDA 4AT9B 5HRFA 3TARA 4X0AA 2ZH5A 3RB3A 2NRWA 2ZJ8A 2IA6A 4F5OA 3PO4A 2AGQA 5EWFA 5KFIA 4R65A 2F1HA 4FBUA 4NLKA 3C2KA 4BGDA 9ICWA 2ZUCA 4Q44A 4RPYA 2RFFA 1KFTA 4S3NA 2ZUDA 4FH5A 1R8CA 3BQTA 4X4OA 4WC7A 4RPXA 3RR8A 9ICRA 1DOQA 1MIWA 3GIIA 4IR1A 1DGSA 2KTQA 5DQIA 4GXKA 4LT6A 3M9NB 1QTMA 3K75D 4O0IA 4CCHA 4O3SA 4I2BA 1IXRA 3OJSA 4PGXA 4F5QA 7ICMA 2IBKA 8ICLA 4PGYA 4B9MA 7ICSA 4Q43A 2UVVA 3RJFA 1OU5A 2XO7A 9ICTA 5BOMA 4QZAA 5J0OA 1QSSA 1N48A 3PX4A 2BHNA 2F1IA 3ETLA 2R8IA 4LZGA 5HRDA 4DSFA 5HMMA 4M47A 9ICNA 5IIMA 1TFYA 4AT8B 3SYZA 4J9RA 4BXOB 4B9TA 4I2FA 4FHVA 1KTQA 2ZUBA 3T3FA 3ISBA 5CP2A 1XS9D 4QZ9A 4RQ0A 2C2EA 4X4PA 3ISDA 3C2MA 4F5NA 4NY8A 3FYHA 4KN7A 3UXNA 3SV4A 4UAYA 2XGQA 4I27A 5HREA 1FA0A 2W9CB 4RU9A 2W9BB 1WOTA 2HHPA 3V6JA 3RJHA 2MUTB 4MFCA 8ICIA 1ZQHA 2C2RA 1KRPA 9ICIA 3B0YA 1UA1A 1TKDA 5KG1A 5CWRA 5L1IA 4PHEA 9ICMA 8ICMA 5KFXA 3T5JA 4I2AA 2HHSA 2ZH4A 3ZD8A 5IILA 1NZPA 3G6YA 2JEIA 4YR0A 4K4HA 4PPXA 5EWEA 4ED2A 1BNOA 3ISCA 5HRIA 1UEVA 3MFIA 5HP4A 3RR7A 2DRAA 3M8SA 8ICNA 2ZTEA 3GILA 4X4NA 3T5KA 5DB7A 5EOZA 2BCRA 3AQLA 4KMUA 3JPOA 5L9XA 1U4BA 5DECA 4AT9A 1XO1A 4M5DA 2JZBB 4DL2A 4DOCA 4DOAA 4J9NA 4PHAA 5DG7A 1JN3A 1PX5A 4M9NA 4EBKA 3B0XA 4YG2A 5DG8A 3FDSA 3THVA 3RH5A 1JXEA 1D9DA 1ZQBA 3EPIA 4I2HA 4JWMA 4KLHA 4KLQA 4RWNA 4PHPA 4XUSA 4UB2A 4YFKA 3QE9Y 4O3RA 9ICLA 5J2JA 3KHLA 4X4SA 2O5AA 3HT3A 2DR5A 1T3NA 5J2EA 3JPQA 4O9MA 4GLXA 1UEUA 4DLGA 1D8YA 4F2RA 5IIKA 3LK9A 3MR5A 1K1QA 2ZTCA 4F5PA 1D9FA 1V9PA 1ZQGA 2W8LA 3WFRE 4KN4A 5DLFA 2DPJA 2M2WA 5KFMA 1U9LA 4IR9A 4YXJA 4WCWA 5DKWA 4WBZA 1ZQFA 4QZEA 2XCPA 4DFKA 1K1SA 2C22A 4AT8A 1SKSA 4BXOA 3H4BA 1QSYA 2KZMA 8ICXA 2BCSA 4X4RA 1N56A 1ZQEA 2PFPA 3PR4A 5J2BA 4RT2A 1ZYQA 2NRZA 5F9NA 1S97A 1D8LA 4RT3A 4DSEA 1ZQKA 1ZQYA 4Z6FA 4DSJA 1TV9A 3L9DA 2RDIA 2DFLA 4R64A 5KG6A 4C8MA 1SKWA 2W9CA 2W9BA 1BGXT 3QZ8A 2W8KA 2AQ4A 5BPCA 3M9MB 1BPYA 1ZQRA 2HHQA 1XWLA 1WCNA 3GIMA 3PR5B 3OSPA 2ZJAA 2BCQA 3AQKA 7ICGA 8ICTA 4PH5A 1JX4A 5KG5A 1ZQPA 2VA2A 1UETA 4E80A 4F4WA 2PFNA 3PW2A 2FMSA 4MF2A 3RB4A 5DG9A 5J2DA 4F92B 4QZFA 4QWAA 4J9SA 4EEYA 3MR3A 4DL7A 4RUCA 4KLGA 1CUKA 7ICPA 2M2UA 2DRBA 1DK3A 2ZH3A 3MFHA 3RJGA 5J2IA 2HW3A 3MR2A 5HRGA 4ZH4A 1ZQZA 5KFZA 3OHBA 1MQ3A 5D49A 3JZ0A 4NLNA 4B9VA 8ICCA 3HW8A 1TFWA 4B9UA 5DGAA 4F50A 1ZJMA 2JZBA 5KFQA 5IIIA 1TK8A 4RWQA 4O3QA 2HHVA 5KFRA 3NTUA 4J9PA 3EPGA 2IHNA 4KLSA 9ICUA 4EP7A 8ICAA 1SL2A 3IM1A 4KTQA 1ZQQA 5BOLA 1COOA 1U49A 4YMOA 3NYBA 3ZDBA 4I28A 3PVXA 1MSWD 2ASJA 5CHGA 1ZJNA 1CEZA 2P66A 4KLLA 1TVAA 4YR2A 3H8SA 2FPLA 7ICJA 5KFVA 3WFOA 4EBJA 4X4VA 5HR9A 5D46A 3GV5B 1ZQSA 3HPOA 4LZDA 8ICJA 2UVUA 4M9HA 1BVSA 1ZQUA 3PV8A 1X9MA 4EZ6A 3Q8SB 2XC9A 1ZQOA 2UVWA 3PO5A 1V4AA 2J6SA 1PZNA 2BPGA 4NKUA 4WBYA 4FS1A 4XRHA 3OHAA 3G6VA 5KFUA 3OGUA 3H4DA 4ECYA 2HHXA 4UD5A 5J0RA 1NJWA 1X2IA 1BPXA 4DFMA 1T7PA 4NKTA 4PHDA 1U45A 2H5XA 1R89A 3UQ0A 2J6TA 1NKEA 2ID1A 4YMMA 1HJPA 1TFRA 3HIYA 4MF8A 2NRVA 3EYZA 1AROP 3RJKA 3H38A 4Z6DA 5KFKA 1T8EA 3LDAA 2PFQA 3C5FA 4RWOA 3Q8QB 2PXIA 5DDYA 4FO6A 4I29A 9ICCA 3C1ZA 5J0XA 4IG8A 3RJIA 4UQGA 3EW9A 1A76A 3SI8A 7ICUA 5F9LA 3PY8A 2ZHBA 4DLEA 3PW7A 7ICVA 4MFAA 4GXIA 4YD2A 5J2AA 4ECRA 3QEBZ 2HHTA 4WC2A 2KP7A 4R66A 1BNPA 3KHRA 9ICBA 3RAQA 2ISPA 4M0AA 1SZPA 5KFGA 1RZTA 4KLFA 7ICTA 9ICSA 5CB1A 5HHHA 3NGDA 7ICQA 4ECTA 3KTQA 1YLQA 4I2DA 4BWMA 3C1YA 4ECXA 2NRKA 3GQCA 2HVHA 5IIOA 4UBCA 2V4RA 4EZ9A 4IQWA 5EWGA 4RQ5A 1U47A 1NKCA 3PX0A 4O3NA 5D4BA 3MABA 3H7IA 3TFRA 1ZQWA 3HWTA 4MEXA 3H37A 4I2IA 2PI5A 4MEYA 4ED7A 2XY5A 1RYRA 2KZZA 5DBBA 1ZQIA 3E2EA 9ICJA 1Y88A 4XQ7A 4QZ8A 2BE3A 2IHMA 3TFSA 5HNKA 5DQGA 8ICEA 4E0DA 5KT3A 8ICSA 4QWEA 1KEJA 4KLEA 4IQTA 1RXVA 4NXZA 1NK9A 2W9MA 3Q8PB 4FHWA 3TI0A 1Q78A 5KG3A 4RQ8A 2ISOA 2KZ3A 5KFEA 3ZDEA 5L1JA 2BPFA 3Q8LA 2FMQA 4DS4A 3TAQA 2BDPA 2ALZA 4TUSA 3V6HA 2XCAA 4F5RA 9ICXA 3AUOA 3SZ2A 7ICLA 4FH3A 1NK5A 5KFSA 4RQ3A 4HYKA 5CA7A 2W9AA 1ZQAA 3HJ1A 1S9FA 4ECVA 4C8KA 3GIJA 3OV7A 4DQSA 3JPTA 3M9OB 2R8JA 2XY6A 1UT5A 1S0NA 1MIVA 1UT8A 4RQ1A 4X4TA 2ZH8A 2ZH7A 3WFQE 2AGOA 4QZIA 1L3UA 4KLJA 3RJJA 4EBDA 5J2GA 1SL0A 4ED8A 4O3OA 4RNMA 3AU6A 8ICWA 4F91B 1ZQLA 3RTVA 4NLGA 9ICQA 4XQ8A 4I2JA 1HUOA 4J9OA 2HVIA 4QZBA 4M6WA 3QZ7A 4YN4A 5J0WA 2GWSA 4DQPA 5KT4A 2M2TA 4E8FA 4YR3A 3BDPA 4NM1A 3LQCB 3EWAA 2V9WA 1RPLA 4F4XA 2F1JA 3G6XA 5IIJA 2PBEA 5J0TA 1VFGA 2XGPA 1XSPA 4QZCA 5J0QA 1C7YA 9ICPA 2KN7A 4NLZA 2RDJA 1S0VA 1TAUA 1S10A 4X4UA 3C5GA 1B22A 4DF4A 2R8HA 2I9GA 4TUQA 3V7KA 5KFLA 1NK8A 1JQRA 3C21A 5DDMA 4DS5A 3BJYA 3JPSA 3Q8KA 2DVIA 8ICGA 5IINA 4ED1A 4DL6A 3LWLA 2Q66A 2A1JA 1ZQNA 3OSNA 5KT5A 4EYIB 3PNCA 3RRGA 1S0OA 7ICKA 1MC8A 3C66A 3RB0A 4DFJA 1WCLA 4M9GA 4RNNA 4RQ2A 2B21A 3Q8RB 1ZQVA 3GV8B 3H3AA 7ICOA 1NK6A 4R8UB 5KT6A 2KFZA 9ICKA 1KNYA 1R8BA 4B9SA 3RH6A 5KG4A 1BPZA 1JAJA 4KLDA 1LB2B 3N97B 2FPMA 4ECZA 4M9LA 1S76D 3MGHA 2AJQA 2XY7A 4TURA 5CJ7A 5KFAA 4PGQA 3MBYA 4UB4A 3GIKA 9ICVA 1ZETA 5KFOA 5C5JA 1Z3EB 5JUMA 5KT2A 2ZH9A 5KTQA 1KLNA 9ICAA 7ICIA 4DEZA 5KG2A 1JIHA 2NRTA 3T5LA 2UVRA 3OVSA 4M2YA 2BQUA 4BDPA 1IM4A 8ICRA 2R8GA 3H8JA 4JV2A 5J0PA 1NOMA 2MAXA 3PW0A 8ICYA 4YP3A 3BQ2A 3TQ1A 4DWIA 3EZ5A 2P6RA 1MIYA 4EBEA 1L3SA 4C8NA 5CR0A 5J2CA 4ECSA 3RBEA 4DL5A 4JV1A 4O5KA 4ATBB 5DQHA 4AT7A 2HHUA 4RQ7A 5L1LA 2BQRA 2C28A 1TK0A 3MDCA 1TAQA 4DO9A 4C8LA 3BQ0A 1QSLA 4JWNA 3OVAA 4ECWA 1L5UA 2M9NA 5J2FA 2ASLA 8ICZA 5DBCA 4UAWA 4M6WB 4BWJA 3PX6A 3AU2A 1RXWA 4LVSA 4KLMA 9ICEA 3C18A 3WFSC 8ICHA 4FHPA 1B43A 4F8RA 8ICOA 4WC5A 2R8KA 5DEDA 9ICFA 4F4ZA 4QWCA 4QW8A 3PW4A 3JYYA 8ICKA 4K4GA 1BPBA 5HC9A 2FLLA 2BQ3A 2I1QA 4TQSA 2KFNA 8ICVA 3JPPA 4WC3A 3UXOA 1KSPA 5KFTA 4ELUA 2FLNA 1L3TA 4RUAA 4UB1A 4ECQA 1DK2A 7ICNA 4GC6A 2P6UA 4JV0A 3LWMA 4KITB 1KFSA 4I2GA 3TAPA 3RH4A 1KDHA 4R63A 5KFWA 2JEFA 2BPCA 4IRKA 4R8UA 1ZQTA 5KG7A 4J9QA 5J0UA 4KLIA 4WC0A 2A1JB 3V7JA 5F2VO 4FBTA 2LYHA 4TUPA 4GC7A 2OWOA 2BCVA 2ZTDA 5DBAA 3OJUA 8ICQA 5HRLA 4ELTA 3IHQB 2PFOA 8ICUA 3OUYB 4UBBA 1RYSA 3GV7B 1VJ7A 2ZHAA 4X4QA 4QZDA 4C8OA 4DQIA 4O5CA 1R8AA 2IMWP 3RB6A 4YMNA 1H38A 4M9JA 7ICRA 4J9LA 1MQ2A 5KG0A 1NJXA 4YQWA 4ED0A 4F93B 1S0MA 1ZQDA 3JPNA 1XC9A 1U48A 3KHHA 5KFCA 4QW9A 4YD1A 3MDAA 1NJZA 2FMPA 4K4IA 3ZD9A 3ZDAA 9ICHA 1SL1A 4X5VA 4YXMA 2DPIA 4E7XA 3QEAZ 4P2HA 3MGIA 4DSLA 4XA5A 1HUZA 4I2CA 1Z00B 2BCUA 2VA8A 4WC6A 4Q8EA 3UQ2A 5KFHA 4FHYA 3K4GA 4RQ4A 2V4QA 7ICHA 5HHIA 1TK5A 1JMSA 5KFYA 1UA0A 2AGPA
chains in the Genus database with same CATH superfamily
4QWDA 3E58A 4J9KA 5AHXA 2WF7A 3WK4A 4IRCA 1XSNA 5HRHA 4DL4A 5HMLA 1NK4A 4O3PA 2MA1A 4YVZA 4M04A 2HHWA 3AQMA 3PW5A 4TQRA 3N7PD 4P0QB 3UXPA 4DL3A 3C29A 4KLTA 1A77A 2M2VA 3OVBA 3NVVA 3I1YA 9ICOA 2HBLA 2DL0A 4MKPA 4IQUA 2CN1A 2JEGA 2ZIUB 4Y2RA 5CFSA 4U7CA 2K8CB 4P4PA 5J0YA 8ICYA 3RRHA 3ETRA 4P4OA 4O5EA 3HX0A 2DR8A 2O1PA 3F2BA 4UB5A 5J29A 4ED6A 1FIQA 4UB3A 3JPRA 4WJ3B 3ERCC 1NJYA 2C2DA 2LM4A 3RBDA 4ELVA 1NO5A 3H40A 4JUZA 4EYHB 4WQKA 5AM0A 1QLNA 3V6KA 1Q79A 5KFDA 5AKLA 3H39A 1EXNA 4DOBA 1PK1A 1X9SA 2WHEA 1NK0A 1HIWA 2ZH6A 3RF9A 1KFDA 5HRFA 3RB3A 3PO4A 4R65A 4FBUA 2YMLA 1Z4OA 2DQNB 5AK3A 2LI6A 1ZQ1C 4WH5A 3GIIA 1DGSA 4GXKA 4LT6A 1SB3C 3M9NB 1QTMA 7ICMA 4PGYA 4B9MA 7ICSA 2UVVA 4JLZA 1OU5A 1N62A 2BHNA 2R8IA 4DSFA 9ICNA 1TFYA 5IIMA 2RQ5A 3TADC 4AT8B 4I2FA 3HJEA 2K8BB 3R9KA 3ISBA 2H3QA 1XS9D 4X4PA 4KN7A 2Q4TA 1QQ6A 5HREA 4I27A 4P0PB 2HHPA 1KRPA 1TKDA 5KFXA 5IILA 3G6YA 5HRIA 5EWEA 2YMMA 3F2CA 3MFIA 5HP4A 3M8SA 4AYBC 4Y2TA 2KG5A 3N7SC 2E8NA 3AQLA 5DECA 5L9XA 4AT9A 2JZBB 4DL2A 2HBKA 4J9NA 5DG7A 4O3MA 5AICA 3KZIU 1PK1B 1SV0C 4YG2A 5DG8A 3RH5A 1JXEA 4JWMA 4RWNA 3A0BU 1QQ7A 4PHPA 3PSTA 5J2JA 3HT3A 1T3NA 5C0YA 4RQMA 2DGZA 4KX5A 5J2EA 4UAUA 3LK9A 2ZTCA 2G08A 4KN4A 1PUZA 4G9BA 1U9LA 5KFMA 4YXJA 4OJPA 4QNLA 4F72A 4BXOA 1YZ7A 1QSYA 8ICXA 3PR4A 4RT2A 4DSEA 1ZQYA 4DSJA 3SMVA 2DFLA 1BGXT 3QZ8A 3M9MB 3PR5B 5KG5A 3PW2A 2GOLA 5J2DA 4F92B 4ICAA 4QWAA 4EEYA 7ICPA 3MR3A 1CUKA 2DRBA 2ZH3A 2HW3A 3MR2A 3KD3A 5HRGA 4FE3A 3OHBA 1SIJA 3HKZF 8ICCA 1IIPA 1ZJMA 1TK8A 4RWQA 4O3QA 3F5AA 1FFUA 2W7OA 2IHNA 4Y2PA 4EP7A 8ICAA 1SL2A 1COOA 2KJ9A 2EH9A 2P66A 2FPLA 1B4FA 2KJ8A 4PL2A 4X4VA 4BJQA 3GV5B 3HPOA 4LZDA 1URJA 2UVUA 4M9HA 3WU2U 4EZ6A 3Q8SB 4EX6A 1PVPA 3G6VA 3OGUA 2HHXA 4K97A 2HN1A 3UQ0A 2ID1A 3DV9A 4MF8A 3RJKA 3H38A 4NXTA 1UHUA 5KFKA 2B6GA 3Q8QB 2K4IA 4FO6A 1SXEA 4US8A 1YZ6A 2YX8A 3PY8A 3PW7A 4GIBA 2ZIWB 5KAIU 5CFTA 5CB1A 7ICQA 4ECTA 3AQFA 3C1YA 1N5WA 5ALQA 2V4RA 1U47A 1NKCA 2F3NA 1ZQWA 4I2IA 2PI5A 2H3FA 2XY5A 1RYRA 2DBYA 4JB3A 2KZZA 4AP9A 5DBBA 4CE6A 1YT3A 9ICJA 4EELA 2IHMA 1X40A 4E0DA 1RDFA 1KEJA 2PKEA 4NXZA 2W9MA 1N63A 2OXOA 2BPFA 5FP0A 2FMQA 4DS4A 4CF5A 2BDPA 2ALZA 9ICXA 3SZ2A 2FJ6A 3LYSA 5KFSA 5CA7A 2DUYA 3JPTA 2XY6A 3NRZA 3WFQE 4RQ1A 1WYGA 2YMPA 4O3OA 8ICWA 4F91B 4XQ8A 1HUOA 2L5YA 2HVIA 2ZIVA 5J0WA 2GWSA 4E8FA 5KT4A 2QB0B 3LQCB 4ZOHC 3IV6A 3VC8A 5H2FU 2R8HA 4OO1J 3V7KA 2H3VA 4O69A 8ICGA 1ZQNA 4OAGA 2HBJA 2JV3A 3ICXA 1VJ5A 3RB0A 2GA9D 3Q8RB 1ZQVA 3GV8B 5KT6A 2KFZA 5GTIU 2B4VA 3QX7A 4C4RA 1BPZA 4KLDA 4K9AA 2FPMA 4ECZA 5ALNA 3MGHA 2OCEA 2YN4A 2KD1A 2XY7A 2RP5A 2ES6A 3QUQA 2E3TA 4CNQA 5C5JA 4IL6U 9ICAA 1JIHA 3UMBA 3OVSA 4M2YA 3KFUF 2E8OA 4XJEA 4BDPA 2KVSA 2AXTU 2Y0SC 5CR0A 4ATBB 5DQHA 3SAGA 5L1LA 1TAQA 4DO9A 4C8LA 3KKAA 8ICZA 9ICEA 3AU2A 4HX0A 3C18A 1PVRA 5AI9A 4WC5A 5DEDA 5EE0A 9ICFA 3PW4A 3JYYA 8ICKA 2FLLA 1CI4A 2LYBA 2KFNA 4DFDA 3JPPA 1KSPA 4J03A 4ELUA 2FLNA 1L3TA 2P6UA 3LWMA 1KFSA 3TAPA 4NWIA 1KDHA 2BPCA 1ZQTA 5ALWA 5J0UA 4KLIA 4WC0A 5F2VO 4FBTA 3IHQB 1Q46A 3OUYB 3WK9A 1SV4A 4DQIA 2IMWP 3RB6A 3H8MA 1H38A 4WQLA 4QIWC 4ED0A 4F93B 2NYVA 2FDRA 3ZD9A 1HEKA 2LKYA 4YXMA 2DPIA 4E7XA 4I2CA 1Z00B 4WC6A 4FHYA 5KFHA 4OJLA 2HDOA 3QYPA 2ASDA 4YCXA 1BPDA 4AYBF 2LBOA 5KFPA 1WUDA 1NNLA 4F4YA 5KFFA 1Q3UA 3ZDCA 2AU0A 3WK7A 2QARA 4DQRA 5ALFA 2JEJA 1S77D 3Q8MA 5JU5A 5HR6A 5J0SA 3PMLA 3V72A 4NV0A 4KM5A 2NRXA 5ALGA 3PZPA 1LV5A 5AM1A 2HOFA 5J8YA 4F2SA 4HAIA 1X6IA 5DB6A 3BQ1A 2Y1JA 2PI4A 1XU4A 2FPKA 1F5AA 2RRDA 2KSOA 2VANA 3D2NA 2FLPA 4Y2YA 3EUB2 2BBJA 3L3FX 2W03A 2AQ0A 2Y1IA 3KHGA 2OH2A 2ZIXA 4WC4A 2HMXA 5KFJA 3N4MB 4Z6CA 4QWBA 4EBCA 3TANA 4I2EA 3UPQA 4F71A 2BGWA 1BPEA 4DSIA 2O6KA 3QNMA 4MFFA 1ZRNA 1LVHA 2WTFA 2NRWA 2AGQA 5JTIA 4UARA 2F1HA 4OJOA 5AKYA 4BGDA 9ICWA 4CF4A 2GAFD 2WB1C 4Q44A 1KFTA 4FH5A 1R8CA 3BQTA 4WC7A 4P0QA 4RPXA 3RR8A 1DOQA 1MIWA 1X66A 2QARB 2JHDA 4Q43A 2ZIUA 3RJFA 5CEHA 2F1IA 3ETLA 4LZGA 5HRDA 4M47A 4QZ9A 4RQ0A 3C2MA 3UXNA 1FA0A 3E0FA 4RU9A 4NLBA 3RJHA 4FFDA 8ICIA 1ZQHA 2KSOB 3B0YA 5ALHA 2A3VA 3NVOA 4PHEA 3QU9A 1QCKA 2HHSA 2EWRA 4YR0A 4PPXA 4NLCA 3ISCA 1L7NA 8ICNA 2ZTEA 2BCRA 4M5DA 4DOCA 4DOAA 1PX5A 1QQ5A 3M7DA 5CFUA 3FDSA 3NVYA 3THVA 4KLHA 4K98A 1IV8A 4X4SA 2DR5A 4EEDA 2FI1A 2G5HB 4F2RA 1K1QA 4F5PA 3WFRE 1VLBA 5ALZA 1ZQFA 2B51A 4DFKA 1F44A 4AT8A 2BCSA 2HBMA 1ZQEA 2PFPA 3AQEA 1ZQKA 5F9NA 1RQLA 3BS5B 4UATA 3L9DA 4R64A 1D9FA 4I28A 1SKWA 1ZQRA 1BPYA 5ALOA 2AQ4A 4P0PA 3SEIA 3TADA 3AL0B 3CK6A 2ZJAA 1UETA 1JX4A 2VA2A 2PFNA 1M6YA 2FCLA 2HI0A 3RB4A 4KMOB 5DG9A 4J9SA 1D8BA 4RUCA 1F0MA 3RJGA 5J2IA 1K5OA 1MQ3A 5D49A 3HW8A 2KEYA 3SAHA 2JZBA 5KFQA 2K8AA 2W11A 2KHQA 9ICUA 4NL9C 3I28A 3AEVA 1U49A 4YMOA 3ZDBA 3PVXA 1FFVA 2ASJA 4O68A 5AKEA 1TVAA 1OUQA 3WFOA 2N1RA 5HR9A 4KX3A 5G5HA 2KKVA 8ICJA 1SV0A 4EGWA 2EDUA 1BVSA 1X9MA 1COKA 2HN2A 2KIVA 1ZQOA 2F76X 2UVWA 1V4AA 2KKPA 2E8MA 4NXUA 1PK3A 4XRHA 5KFUA 2K4PA 5J0RA 1X2IA 1BPXA 4DFMA 4NKTA 1U45A 2H5XA 2Y0SF 2QLTA 1TFRA 2NRVA 1AROP 5ALSA 4Z6DA 1T8EA 3LDAA 5ALIA 2PXIA 2ZXHA 5J0XA 4IG8A 3RJIA 4UQGA 3EW9A 1L7MA 4YD2A 5J2AA 4ECRA 3QEBZ 4WC2A 1BNPA 3KHRA 4M0AA 3A0HU 2YB1A 4KLFA 5HHHA 3NGDA 4CDGA 1SWWA 3KTQA 1YLQA 4BWMA 3GQCA 4UBCA 4EZ9A 3J81j 4O3NA 3MABA 4MEYA 4ED7A 5ALPA 1Q3VA 1ZQIA 3E2EA 2BE3A 1AQ6A 4KLEA 1OW5A 4FHWA 1XNSA 3NKUA 3ZDEA 4QIWF 2W55A 4TUSA 2XCAA 4KB6A 7ICLA 4FH3A 1C20A 4U6PA 1SXDA 1S9FA 4ECVA 4C8KA 3OV7A 5CHEA 3M9OB 2R8JA 2ZH7A 1UT5A 1MIVA 2ZH8A 2E8PA 4KLJA 4QZIA 4ED8A 4RNMA 2HOIA 1ZQLA 4I2JA 1N60A 4J9OA 2WFAA 4QZBA 2M2TA 3EWAA 1RPLA 4F4XA 2F1JA 9ICPA 1C7YA 3IN5A 2ZIWA 4EEBA 4X4UA 3UMGA 2EANA 4FZNA 5AIAA 1NK8A 3C21A 1ECWA 5DDMA 4DS5A 1MA7A 2Q66A 2A1JA 4EYIB 3CYMA 2IHOA 1MC8A 3C66A 4M9GA 4EX7A 4DFJA 2B21A 3H3AA 7ICOA 1NK6A 4R8UB 2Z7JA 4B9SA 4IC9A 5KG4A 3QUTA 4EV6A 4M9LA 1S76D 2AJQA 5KFAA 4Y2QA 1OXJA 3D2SA 4QJFB 5ALLA 9ICVA 3CRXA 1ZETA 5KT2A 2ZH9A 5KG2A 2UVRA 2BQUA 3H8JA 3TQ1A 5AM4A 2P6RA 1MIYA 4EBEA 2QB0A 1L3SA 4ECSA 5J2CA 3RBEA 4AT7A 1UCVA 2C28A 3ED5A 2F8LA 3BQ0A 4JWNA 1L5UA 2M9NA 2ASLA 2YQEA 1N61A 2NO5A 3OPXA 8ICHA 5AIBA 8ICOA 4F4ZA 3MC1A 2WB1F 2FE9A 2NO4A 2LYAA 8ICVA 4Y2JA 3UXOA 1S5LU 3PHZA 4ECQA 4KITB 3RH4A 1LKYB 2JEFA 5KFWA 3WK8A 5D63A 2A1JB 5ALMA 1X6JA 2ZTDA 5DBAA 8ICQA 2WF8A 2JR5A 2H3ZA 3GV7B 1VJ7A 3IRUA 2IOHA 4YMNA 4M9JA 2BZFA 1T3QA 4YQWA 3JPNA 3MDAA 2YMQA 4QW9A 2FMPA 1NJZA 9ICHA 3QEAZ 4P2HA 3OTQA 2BCUA 2VA8A 3UQ2A 5ALYA 2ODGA 5D61A 4Q8FA 5F3XB 2KMDA 4ATBA 2F77X 1QH9A 1ZQMA 2VA3A 3HRDD 4DQQA 3ER9B 4QZGA 4RQ6A 3RAXA 7ICFA 1RQNA 5KAFU 4DSKA 2D8CA 4AT7B 5HRKA 5DGBA 4NM2A 1Z1VA 2A19A 1NK7A 5J2KA 4DF8A 5B66U 1X9WA 3PSFA 4KLOA 2EZXA 4F3OA 3SV3A 5AKZA 3HJ4A 4UD4A 2OM6A 4B6JA 4FZLA 5DLGA 2JXJA 3GFKB 5ALVA 4J9MA 3SENA 2DR9A 3OUYA 2Q0ZX 4EEKA 3UPSA 8ICFA 2G07A 5DB8A 4ECUA 2ZJ5A 2BR0A 5AKXA 4Q45A 3WKAA 4C7ZA 4RZRA 2KOBA 4DFPA 5HRBA 3MR6A 3L4PA 5JTGA 4RWPA 2W3SA 1Z00A 4UAZA 3MCRA 1T4GA 2ZH1A 1XSLA 5EE1A 1SKRA 2ZH2A 2ATLA 3V7LA 3GDXA 5KFBA 4GXJA 3ZI4A 7ICEA 3O0FA 4O6AA 3BZKA 4ED3A 5AI8A 3WK6A 3TARA 1MN8A 2ZJ8A 4F5OA 5EWFA 3C2KA 3T79A 3AM9A 4RPYA 4S3NA 3SD7A 2F2AB 1X9XA 2M0NA 3F5EA 3TACB 3RFAA 4IR1A 5DQIA 4O3SA 3HIYA 4I2BA 8ICLA 1ZD3A 4PGXA 2P35A 3CNHA 5BOMA 4QZAA 5J0OA 1N48A 1KW4A 4FZMA 4OD0A 3PX4A 3WKBA 3SYZA 4B9TA 4FHVA 2ZUBA 2E5SA 2W7PA 2WF5A 2C2EA 3ISDA 4F5NA 4NY8A 3SV4A 5AI4A 2XGQA 2K89A 2W9CB 2W9BB 1WOTA 3V6JA 2DKXA 2G0AA 5ALXA 3T5JA 4I2AA 4K4HA 4ED2A 1BNOA 3M6KA 3M6ZA 2LPEA 5DB7A 3JPOA 3K1RB 3IG5A 1XO1A 5EE3A 4PHAA 4US9A 4M9NA 3B0XA 3SAFA 4KLQA 1D9DA 1KN5A 3EPIA 1ZQBA 4I2HA 4XUSA 4UB2A 3QE9Y 4O3RA 3KHLA 2O5AA 5B5EU 4O9MA 4GLXA 1UEUA 2EZYA 1V9PA 3GZFA 4C7YA 1FO4A 2W8LA 5DLFA 2DPJA 2M2WA 3M1YA 4UASA 5ALDA 2HCFA 4WBZA 4QZEA 2XCPA 1K1SA 2C22A 2KZMA 4JMUA 2QB1A 1N56A 4X4RA 5J2BA 2NRZA 1D8LA 4RT3A 5B3PA 1TV9A 2NV3A 5KG6A 2W8KA 5BPCA 2OYYA 1XWLA 3NWIA 3GIMA 2CRXA 3AQKA 4C4SA 4PH5A 4E80A 4F4WA 3NASA 2FMSA 2KHVA 5AKIA 2F44A 3MFHA 1ZD4A 5T14A 1ZQZA 5KFZA 1TFWA 4NLNA 4B9VA 4B9UA 3QU2A 5DGAA 2HHVA 4J9PA 3EPGA 4KLSA 4KTQA 3IM1A 1ZQQA 5AM5A 4K99A 3AMZA 3NVZA 1ZJNA 3H8SA 7ICJA 5KFVA 3C28A 2D3DA 2KVCA 2DWQA 2XC9A 1ZD2P 2W43A 2IUBA 5AM2A 2BPGA 4NKUA 4FS1A 3OHAA 3H4DA 1T7PA 3U26A 1O03A 1NKEA 1HJPA 3BS5A 3EYZA 3IG8A 2JRZA 2PFQA 3SR6A 4I29A 2CPRA 1V38A 4LEZA 1J97A 1A76A 3SI8A 7ICUA 2JGAA 2ZHBA 4C0ZA 4MFAA 2HHTA 2KP7A 4R66A 3DDHA 2B0CA 5AKGA 2ISPA 4NJ8A 5KFGA 2MU2A 2VKQA 1JRPA 4I2DA 2WF9A 4ECXA 2NRKA 2HVHA 1RG6A 5D4BA 4MEXA 3H7IA 5AK5A 3HWTA 3TFRA 4NXXA 4MHVA 5DQGA 5KT3A 4QWEA 3IP4B 4IQTA 1RXVA 1V97A 2YTUA 4NXVA 2ISOA 2KZ3A 4LJXA 4NL9A 1KQQA 1RM6C 2PMZC 4K8VA 4PJ0U 3V6HA 3AUOA 2XIDA 2ZG6A 1NK5A 4HYKA 1ZOLA 4RQ3A 3H0MB 4C4TA 3NRWA 1A0PA 4DQSA 3JCFA 1S0NA 4X4TA 1UT8A 2WAQC 5CRXA 3HILA 5J2GA 1SL0A 3AU6A 4M6WA 3QZ7A 1DGJA 4YN4A 4DQPA 2H3IA 3BDPA 4NM1A 2V9WA 5J0TA 1XSPA 5J0QA 2KN7A 4NLZA 2RDJA 1S0VA 1J2NA 3TKAA 1B22A 2I9GA 5KFLA 2JMGA 1JQRA 3BJYA 3JPSA 3Q8KA 2DVIA 5GTHU 5IINA 1RYUA 4ED1A 4DL6A 5TISU 1WWUA 1S0OA 4LEVA 2OEHA 3QUBA 4RQ2A 4OAHA 2I5HA 2DKZA 9ICKA 1KNYA 1R8BA 3RH6A 5KNIA 1JAJA 2EQYA 1LB2B 5E79U 3WKEA 4Y2UA 4PGQA 4UB4A 3I76A 3GIKA 5JUMA 1Z3EB 2QKQA 5AI5A 4UB6U 5KTQA 1KLNA 4DEZA 2VJ4A 8ICRA 1IM4A 1L7PA 2MAXA 3PW0A 4Y2XA 4YP3A 3BQ2A 3EZ5A 4DL5A 2E1FA 2BQRA 5ALKA 3OVAA 3NVWA 1QSLA 3ER8C 4M6WB 4BWJA 3PX6A 4KLMA 3LVWA 2F8KA 3WFSC 4FHPA 1B43A 4F8RA 5ALTA 4QW8A 4K4GA 1BPBA 2ZXIA 5HC9A 5KFTA 3ALRA 4RUAA 1TE2A 3B9JA 2W3RA 1SZHA 2KV2A 4JV0A 4I2GA 1Q8KA 1KKXA 4IRKA 4R63A 4R8UA 3DEEA 3UM9A 5ALUA 3BQ7A 3V7JA 2LYHA 4TUPA 2XICA 4GC7A 2BCVA 2OWOA 4PZNA 8ICUA 3FC4A 2K4HA 4UBBA 1RYSA 4O5CA 1R8AA 2YY6A 7ICRA 1S0MA 2KE7A 5EE9A 3KHHA 4YD1A 4EENA 4FO1A 2K60A 3MGIA 3IDWA 4XA5A 1HUZA 2GO7A 1JUDA 4UB8U 2EAOA 3K4GA 4RQ4A 2V4QA 5HHIA 3D2QA 1TK5A 5KFYA 5L1MA 1ZQCA 3HP6A 5AI0A 1F5SA 4RPZA 3KZXA 4Z6EA 3ORYA 1ZD5A 3AQNA 5L1KA 1ZXIA 5TZVA 5DB9A 3C2LA 1A6SA 3NUQA 1ZQXA 8ICPA 1NKBA 1KBUA 1FEZA 1JXLA 5ALRA 1Z1BA 2KICA 3VCBA 4QZHA 1L3VA 4IRDA 9ICGA 1ZQJA 1ZRMA 3M8RA 4B9LA 3T5HA 4X0BA 2Y9TA 1LKYA 3BZCA 3QU7A 4RNOA 4K96A 2J6UA 1ED1A 5KFNA 4B9NA 4FS2A 5AM3A 4F4KA 4PL1A 4KLUA 3KOOA 5B3QA 4P4MA 4WOYA 8ICBA 2WF6A 4JLXA 2KJ5A 4G3IA 4IQVA 2MUTA 4JK1A 1WG8A 4UAVA 2XI9A 2GH1A 3RJEA 3ZDDA 4RQNA 2BKEA 2LM1A 3F53A 5KT7A 4FHXA 3C23A 1Z4NA 2DR7A 5J2HA 3H8WA 2XVTA 1JALA 4WC1A 3WFPA 1WWVA 5ALJA 3PMNA 4AT9B 4X0AA 2ZH5A 2KNJA 2IA6A 3F2DA 5KFIA 4NLKA 2ZUCA 2RFFA 2ZUDA 4X4OA 4GFJA 9ICRA 2KTQA 5KL1B 4ACOA 1GO3F 4CCHA 3K75D 4O0IA 1IXRA 3OJSA 4F5QA 2IBKA 2XO7A 9ICTA 1QSSA 5HMMA 4J9RA 4BXOB 4OAIZ 1KTQA 3T3FA 1NI3A 5CP2A 5AKKA 1N5XA 3KBBA 3FYHA 4UAYA 2Y9UA 2MUTB 5HR7A 4MFCA 2C2RA 9ICIA 1JROA 1UA1A 5KG1A 5CWRA 5L1IA 3EF2A 3H0LB 9ICMA 8ICMA 4LEWA 2ZH4A 3ZD8A 1NZPA 2JEIA 1UEVA 1SWVA 3RR7A 2DRAA 3GILA 4X4NA 3T5KA 5EOZA 4KMUA 1U4BA 5AK6A 1JN3A 4EBKA 2BDUA 1PVQA 1X42A 4YFKA 9ICLA 2PMZF 3N28A 3JPQA 5KL8B 1N2XA 4DLGA 1D8YA 2GLEA 2G09A 5IIKA 3MR5A 4BUGA 4O67A 1ZQGA 3FAHA 4IR9A 4WCWA 5DKWA 2EAMA 2WAQF 2LHTA 1SKSA 3H4BA 2MRLA 3OWGA 4USAA 5K4LA 1KL9A 3ONNA 1B0XA 1ZYQA 1S97A 4Z6FA 2RDIA 4C8MA 2W9CA 2W9BA 2HHQA 1S8OA 4CRXA 1WCNA 3OSPA 2BCQA 7ICGA 8ICTA 1ZQPA 2K4EA 2VIXA 1TAMA 4MF2A 4QZFA 4KLGA 4DL7A 2M2UA 3SQIA 2B56A 2JH1A 1DK3A 1L7OA 1T94A 2JH7A 4ZH4A 3JZ0A 4F50A 5AK4A 5IIIA 5KFRA 3NTUA 2W04A 5A0LA 3GU3A 5BOLA 2YB4A 3NYBA 1XO0A 3K1ZA 1MSWD 5CHGA 1CEZA 3QUCA 4KLLA 4YR2A 4EBJA 3AN1A 5D46A 1ZQSA 1UPHA 1ZQUA 3PV8A 3MGVA 2G06A 3L5KA 3PO5A 2J6SA 1IG6A 1PZNA 1V85A 4WBYA 4ECYA 4UD5A 1NJWA 4OJ5A 4PHDA 1R89A 2J6TA 4YMMA 5ALEA 5JRTA 4RWOA 3QU4A 3C5FA 4K9BA 5DDYA 9ICCA 2ZIVB 3C1ZA 4PZOA 5F9LA 3WKDA 4DLEA 7ICVA 4CGZA 4GXIA 3LVVA 9ICBA 3RAQA 1SZPA 1RZTA 7ICTA 9ICSA 2G5IB 1SGGA 1GPJA 3CP8A 5IIOA 2IOFA 4IQWA 5EWGA 4RQ5A 4I0UA 3PX0A 2W54A 3H37A 4UW9A 2CXYA 4C80A 3WKCA 3H0RB 1Y88A 4XQ7A 4QZ8A 8ICEA 3TFSA 5HNKA 8ICSA 1NK9A 3Q8PB 3TI0A 1Q78A 2KIWA 5KG3A 4RQ8A 5L1JA 5KFEA 3QXGA 3Q8LA 3TAQA 4F5RA 1P7DA 3HJ1A 2E1EA 2W9AA 1ZQAA 2IOFK 3GIJA 1J2MA 2AGOA 2KK0A 1Z19A 1L3UA 3RJJA 2HOQA 4EBDA 5AKJA 4NLGA 3RTVA 3KKAC 9ICQA 5AI6A 3FM9A 4YR3A 2VJ5A 4OAFA 2LMRA 2RLTA 2PBEA 3G6XA 5IIJA 1VFGA 2XGPA 4QZCA 5AKHA 1TAUA 1S10A 3C5GA 4DF4A 4TUQA 4LEYA 2EAPA 1VDVA 3LWLA 3OSNA 5KT5A 3PNCA 3RRGA 7ICKA 3HKZC 3WK5A 1WCLA 4RNNA 3QU5A 1L6NA 3BS7A 4Y2SA 3N97B 2AH5A 3PSIA 2DF4B 4NXWA 4TURA 2I6XA 5CJ7A 2RHFA 2HSZA 3PSPA 3MBYA 5KFOA 1CRXA 7ICIA 2NRTA 3T5LA 2R8GA 4JV2A 5J0PA 1NOMA 4DWIA 1DXSA 2R18A 4OCZA 3UMCA 4C8NA 4O5KA 4JV1A 4IS7A 2HHUA 4RQ7A 3N7RC 1TK0A 5D62A 2AHOB 3MDCA 4ECWA 5J2FA 1L8LA 5DBCA 5G5GA 4UAWA 4LVSA 1RXWA 2ESEA 4Y2VA 2R8KA 4QWCA 3NS1A 2MSNA 2BQ3A 2I1QA 4TQSA 3S6JA 4WC3A 3CW2C 4UB1A 1DK2A 4A8EA 7ICNA 4GC6A 5J8YC 4CF3A 1DRGA 5KG7A 1JI7A 4J9QA 2EZZA 3OJUA 5HRLA 4ELTA 4DCCA 2PFOA 2OHFA 2ZHAA 1UQVA 4QZDA 4C8OA 4X4QA 1NZBA 4J9LA 1MQ2A 5KG0A 1NJXA 1ZQDA 1XC9A 3K7DA 1U48A 3D6JA 1L8OA 2A1AA 5KFCA 4OJ6A 4K4IA 2D6FC 3ZDAA 1SL1A 1O08A 4X5VA 4DSLA 4N7RA 4Q8EA 4BX9C 7ICHA 2BBHA 1JMSA 2ZIXB 1UA0A 2AGPA
chains in the Genus database with same CATH topology
4Q8FA 4QWDA 1ZQCA 4ATBA 3HP6A 2ASDA 4YCXA 1BPDA 1ZQMA 2VA3A 4RPZA 4DQQA 4Z6EA 3ORYA 5KFPA 3AQNA 4J9KA 5L1KA 4QZGA 4RQ6A 3RAXA 7ICFA 5DB9A 5TZVA 3C2LA 4F4YA 4IRCA 1XSNA 5HRHA 4DL4A 4DSKA 1ZQXA 5KFFA 8ICPA 1NKBA 2AU0A 3ZDCA 4AT7B 1JXLA 5HRKA 5DGBA 5HMLA 1NK4A 4NM2A 4O3PA 1NK7A 1L3VA 5J2KA 4QZHA 4DF8A 4IRDA 4DQRA 4YVZA 4M04A 2HHWA 2JEJA 9ICGA 1X9WA 1ZQJA 3AQMA 3M8RA 4KLOA 3PW5A 4TQRA 4B9LA 1S77D 4F3OA 3Q8MA 3SV3A 3T5HA 4X0BA 3HJ4A 4UD4A 3UXPA 4DL3A 4KLTA 1A77A 5J0SA 4RNOA 3PMLA 2M2VA 5DLGA 4J9MA 3GFKB 2J6UA 3V72A 3OVBA 5KFNA 9ICOA 2NRXA 4B9NA 2DR9A 4FS2A 3OUYA 2Q0ZX 3UPSA 4F4KA 4IQUA 1LV5A 2JEGA 8ICFA 4KLUA 4P4PA 4F2SA 5J0YA 4P4MA 5DB8A 4ECUA 3RRHA 2ZJ5A 2BR0A 8ICBA 4P4OA 5DB6A 3BQ1A 4G3IA 4O5EA 4Q45A 2Y1JA 3HX0A 4IQVA 2MUTA 2PI4A 2O1PA 2DR8A 4RZRA 1XU4A 2FPKA 1F5AA 4UB5A 2VANA 5J29A 2FLPA 4DFPA 4ED6A 5HRBA 3MR6A 4JK1A 4UB3A 3JPRA 1NJYA 4RWPA 2C2DA 2AQ0A 1Z00A 4UAZA 2Y1IA 1T4GA 3RBDA 4ELVA 1NO5A 1XSLA 2ZH1A 3H40A 3RJEA 4JUZA 3KHGA 3ZDDA 4EYHB 4WC4A 5KFJA 1SKRA 3N4MB 2BKEA 2ZH2A 1QLNA 2ATLA 5KT7A 3V6KA 4Z6CA 1Q79A 5KFDA 4FHXA 3C23A 4QWBA 3V7LA 4EBCA 2DR7A 5J2HA 3TANA 3GDXA 4I2EA 3H8WA 3UPQA 3H39A 5KFBA 1EXNA 4DOBA 4GXJA 1BPEA 2BGWA 1X9SA 7ICEA 4DSIA 4WC1A 4ED3A 1NK0A 2ZH6A 4MFFA 3WFPA 2WTFA 3PMNA 1KFDA 4AT9B 5HRFA 3TARA 4X0AA 2ZH5A 3RB3A 2NRWA 2ZJ8A 2IA6A 4F5OA 3PO4A 2AGQA 5EWFA 5KFIA 4R65A 2F1HA 4FBUA 4NLKA 3C2KA 4BGDA 9ICWA 2ZUCA 4Q44A 4RPYA 2RFFA 1KFTA 4S3NA 2ZUDA 4FH5A 1R8CA 3BQTA 4X4OA 4WC7A 4RPXA 3RR8A 9ICRA 1DOQA 1MIWA 3GIIA 4IR1A 1DGSA 2KTQA 5DQIA 4GXKA 4LT6A 3M9NB 1QTMA 3K75D 4O0IA 4CCHA 4O3SA 4I2BA 1IXRA 3OJSA 4PGXA 4F5QA 7ICMA 2IBKA 8ICLA 4PGYA 4B9MA 7ICSA 4Q43A 2UVVA 3RJFA 1OU5A 2XO7A 9ICTA 5BOMA 4QZAA 5J0OA 1QSSA 1N48A 3PX4A 2BHNA 2F1IA 3ETLA 2R8IA 4LZGA 5HRDA 4DSFA 5HMMA 4M47A 9ICNA 5IIMA 1TFYA 4AT8B 3SYZA 4J9RA 4BXOB 4B9TA 4I2FA 4FHVA 1KTQA 2ZUBA 3T3FA 3ISBA 5CP2A 1XS9D 4QZ9A 4RQ0A 2C2EA 4X4PA 3ISDA 3C2MA 4F5NA 4NY8A 3FYHA 4KN7A 3UXNA 3SV4A 4UAYA 2XGQA 4I27A 5HREA 1FA0A 2W9CB 4RU9A 2W9BB 1WOTA 2HHPA 3V6JA 3RJHA 2MUTB 4MFCA 8ICIA 1ZQHA 2C2RA 1KRPA 9ICIA 3B0YA 1UA1A 1TKDA 5KG1A 5CWRA 5L1IA 4PHEA 9ICMA 8ICMA 5KFXA 3T5JA 4I2AA 2HHSA 2ZH4A 3ZD8A 5IILA 1NZPA 3G6YA 2JEIA 4YR0A 4K4HA 4PPXA 5EWEA 4ED2A 1BNOA 3ISCA 5HRIA 1UEVA 3MFIA 5HP4A 3RR7A 2DRAA 3M8SA 8ICNA 2ZTEA 3GILA 4X4NA 3T5KA 5DB7A 5EOZA 2BCRA 3AQLA 4KMUA 3JPOA 5L9XA 1U4BA 5DECA 4AT9A 1XO1A 4M5DA 2JZBB 4DL2A 4DOCA 4DOAA 4J9NA 4PHAA 5DG7A 1JN3A 1PX5A 4M9NA 4EBKA 3B0XA 4YG2A 5DG8A 3FDSA 3THVA 3RH5A 1JXEA 1D9DA 1ZQBA 3EPIA 4I2HA 4JWMA 4KLHA 4KLQA 4RWNA 4PHPA 4XUSA 4UB2A 4YFKA 3QE9Y 4O3RA 9ICLA 5J2JA 3KHLA 4X4SA 2O5AA 3HT3A 2DR5A 1T3NA 5J2EA 3JPQA 4O9MA 4GLXA 1UEUA 4DLGA 1D8YA 4F2RA 5IIKA 3LK9A 3MR5A 1K1QA 2ZTCA 4F5PA 1D9FA 1V9PA 1ZQGA 2W8LA 3WFRE 4KN4A 5DLFA 2DPJA 2M2WA 5KFMA 1U9LA 4IR9A 4YXJA 4WCWA 5DKWA 4WBZA 1ZQFA 4QZEA 2XCPA 4DFKA 1K1SA 2C22A 4AT8A 1SKSA 4BXOA 3H4BA 1QSYA 2KZMA 8ICXA 2BCSA 4X4RA 1N56A 1ZQEA 2PFPA 3PR4A 5J2BA 4RT2A 1ZYQA 2NRZA 5F9NA 1S97A 1D8LA 4RT3A 4DSEA 1ZQKA 1ZQYA 4Z6FA 4DSJA 1TV9A 3L9DA 2RDIA 2DFLA 4R64A 5KG6A 4C8MA 1SKWA 2W9CA 2W9BA 1BGXT 3QZ8A 2W8KA 2AQ4A 5BPCA 3M9MB 1BPYA 1ZQRA 2HHQA 1XWLA 1WCNA 3GIMA 3PR5B 3OSPA 2ZJAA 2BCQA 3AQKA 7ICGA 8ICTA 4PH5A 1JX4A 5KG5A 1ZQPA 2VA2A 1UETA 4E80A 4F4WA 2PFNA 3PW2A 2FMSA 4MF2A 3RB4A 5DG9A 5J2DA 4F92B 4QZFA 4QWAA 4J9SA 4EEYA 3MR3A 4DL7A 4RUCA 4KLGA 1CUKA 7ICPA 2M2UA 2DRBA 1DK3A 2ZH3A 3MFHA 3RJGA 5J2IA 2HW3A 3MR2A 5HRGA 4ZH4A 1ZQZA 5KFZA 3OHBA 1MQ3A 5D49A 3JZ0A 4NLNA 4B9VA 8ICCA 3HW8A 1TFWA 4B9UA 5DGAA 4F50A 1ZJMA 2JZBA 5KFQA 5IIIA 1TK8A 4RWQA 4O3QA 2HHVA 5KFRA 3NTUA 4J9PA 3EPGA 2IHNA 4KLSA 9ICUA 4EP7A 8ICAA 1SL2A 3IM1A 4KTQA 1ZQQA 5BOLA 1COOA 1U49A 4YMOA 3NYBA 3ZDBA 4I28A 3PVXA 1MSWD 2ASJA 5CHGA 1ZJNA 1CEZA 2P66A 4KLLA 1TVAA 4YR2A 3H8SA 2FPLA 7ICJA 5KFVA 3WFOA 4EBJA 4X4VA 5HR9A 5D46A 3GV5B 1ZQSA 3HPOA 4LZDA 8ICJA 2UVUA 4M9HA 1BVSA 1ZQUA 3PV8A 1X9MA 4EZ6A 3Q8SB 2XC9A 1ZQOA 2UVWA 3PO5A 1V4AA 2J6SA 1PZNA 2BPGA 4NKUA 4WBYA 4FS1A 4XRHA 3OHAA 3G6VA 5KFUA 3OGUA 3H4DA 4ECYA 2HHXA 4UD5A 5J0RA 1NJWA 1X2IA 1BPXA 4DFMA 1T7PA 4NKTA 4PHDA 1U45A 2H5XA 1R89A 3UQ0A 2J6TA 1NKEA 2ID1A 4YMMA 1HJPA 1TFRA 3HIYA 4MF8A 2NRVA 3EYZA 1AROP 3RJKA 3H38A 4Z6DA 5KFKA 1T8EA 3LDAA 2PFQA 3C5FA 4RWOA 3Q8QB 2PXIA 5DDYA 4FO6A 4I29A 9ICCA 3C1ZA 5J0XA 4IG8A 3RJIA 4UQGA 3EW9A 1A76A 3SI8A 7ICUA 5F9LA 3PY8A 2ZHBA 4DLEA 3PW7A 7ICVA 4MFAA 4GXIA 4YD2A 5J2AA 4ECRA 3QEBZ 2HHTA 4WC2A 2KP7A 4R66A 1BNPA 3KHRA 9ICBA 3RAQA 2ISPA 4M0AA 1SZPA 5KFGA 1RZTA 4KLFA 7ICTA 9ICSA 5CB1A 5HHHA 3NGDA 7ICQA 4ECTA 3KTQA 1YLQA 4I2DA 4BWMA 3C1YA 4ECXA 2NRKA 3GQCA 2HVHA 5IIOA 4UBCA 2V4RA 4EZ9A 4IQWA 5EWGA 4RQ5A 1U47A 1NKCA 3PX0A 4O3NA 5D4BA 3MABA 3H7IA 3TFRA 1ZQWA 3HWTA 4MEXA 3H37A 4I2IA 2PI5A 4MEYA 4ED7A 2XY5A 1RYRA 2KZZA 5DBBA 1ZQIA 3E2EA 9ICJA 1Y88A 4XQ7A 4QZ8A 2BE3A 2IHMA 3TFSA 5HNKA 5DQGA 8ICEA 4E0DA 5KT3A 8ICSA 4QWEA 1KEJA 4KLEA 4IQTA 1RXVA 4NXZA 1NK9A 2W9MA 3Q8PB 4FHWA 3TI0A 1Q78A 5KG3A 4RQ8A 2ISOA 2KZ3A 5KFEA 3ZDEA 5L1JA 2BPFA 3Q8LA 2FMQA 4DS4A 3TAQA 2BDPA 2ALZA 4TUSA 3V6HA 2XCAA 4F5RA 9ICXA 3AUOA 3SZ2A 7ICLA 4FH3A 1NK5A 5KFSA 4RQ3A 4HYKA 5CA7A 2W9AA 1ZQAA 3HJ1A 1S9FA 4ECVA 4C8KA 3GIJA 3OV7A 4DQSA 3JPTA 3M9OB 2R8JA 2XY6A 1UT5A 1S0NA 1MIVA 1UT8A 4RQ1A 4X4TA 2ZH8A 2ZH7A 3WFQE 2AGOA 4QZIA 1L3UA 4KLJA 3RJJA 4EBDA 5J2GA 1SL0A 4ED8A 4O3OA 4RNMA 3AU6A 8ICWA 4F91B 1ZQLA 3RTVA 4NLGA 9ICQA 4XQ8A 4I2JA 1HUOA 4J9OA 2HVIA 4QZBA 4M6WA 3QZ7A 4YN4A 5J0WA 2GWSA 4DQPA 5KT4A 2M2TA 4E8FA 4YR3A 3BDPA 4NM1A 3LQCB 3EWAA 2V9WA 1RPLA 4F4XA 2F1JA 3G6XA 5IIJA 2PBEA 5J0TA 1VFGA 2XGPA 1XSPA 4QZCA 5J0QA 1C7YA 9ICPA 2KN7A 4NLZA 2RDJA 1S0VA 1TAUA 1S10A 4X4UA 3C5GA 1B22A 4DF4A 2R8HA 2I9GA 4TUQA 3V7KA 5KFLA 1NK8A 1JQRA 3C21A 5DDMA 4DS5A 3BJYA 3JPSA 3Q8KA 2DVIA 8ICGA 5IINA 4ED1A 4DL6A 3LWLA 2Q66A 2A1JA 1ZQNA 3OSNA 5KT5A 4EYIB 3PNCA 3RRGA 1S0OA 7ICKA 1MC8A 3C66A 3RB0A 4DFJA 1WCLA 4M9GA 4RNNA 4RQ2A 2B21A 3Q8RB 1ZQVA 3GV8B 3H3AA 7ICOA 1NK6A 4R8UB 5KT6A 2KFZA 9ICKA 1KNYA 1R8BA 4B9SA 3RH6A 5KG4A 1BPZA 1JAJA 4KLDA 1LB2B 3N97B 2FPMA 4ECZA 4M9LA 1S76D 3MGHA 2AJQA 2XY7A 4TURA 5CJ7A 5KFAA 4PGQA 3MBYA 4UB4A 3GIKA 9ICVA 1ZETA 5KFOA 5C5JA 1Z3EB 5JUMA 5KT2A 2ZH9A 5KTQA 1KLNA 9ICAA 7ICIA 4DEZA 5KG2A 1JIHA 2NRTA 3T5LA 2UVRA 3OVSA 4M2YA 2BQUA 4BDPA 1IM4A 8ICRA 2R8GA 3H8JA 4JV2A 5J0PA 1NOMA 2MAXA 3PW0A 8ICYA 4YP3A 3BQ2A 3TQ1A 4DWIA 3EZ5A 2P6RA 1MIYA 4EBEA 1L3SA 4C8NA 5CR0A 5J2CA 4ECSA 3RBEA 4DL5A 4JV1A 4O5KA 4ATBB 5DQHA 4AT7A 2HHUA 4RQ7A 5L1LA 2BQRA 2C28A 1TK0A 3MDCA 1TAQA 4DO9A 4C8LA 3BQ0A 1QSLA 4JWNA 3OVAA 4ECWA 1L5UA 2M9NA 5J2FA 2ASLA 8ICZA 5DBCA 4UAWA 4M6WB 4BWJA 3PX6A 3AU2A 1RXWA 4LVSA 4KLMA 9ICEA 3C18A 3WFSC 8ICHA 4FHPA 1B43A 4F8RA 8ICOA 4WC5A 2R8KA 5DEDA 9ICFA 4F4ZA 4QWCA 4QW8A 3PW4A 3JYYA 8ICKA 4K4GA 1BPBA 5HC9A 2FLLA 2BQ3A 2I1QA 4TQSA 2KFNA 8ICVA 3JPPA 4WC3A 3UXOA 1KSPA 5KFTA 4ELUA 2FLNA 1L3TA 4RUAA 4UB1A 4ECQA 1DK2A 7ICNA 4GC6A 2P6UA 4JV0A 3LWMA 4KITB 1KFSA 4I2GA 3TAPA 3RH4A 1KDHA 4R63A 5KFWA 2JEFA 2BPCA 4IRKA 4R8UA 1ZQTA 5KG7A 4J9QA 5J0UA 4KLIA 4WC0A 2A1JB 3V7JA 5F2VO 4FBTA 2LYHA 4TUPA 4GC7A 2OWOA 2BCVA 2ZTDA 5DBAA 3OJUA 8ICQA 5HRLA 4ELTA 3IHQB 2PFOA 8ICUA 3OUYB 4UBBA 1RYSA 3GV7B 1VJ7A 2ZHAA 4X4QA 4QZDA 4C8OA 4DQIA 4O5CA 1R8AA 2IMWP 3RB6A 4YMNA 1H38A 4M9JA 7ICRA 4J9LA 1MQ2A 5KG0A 1NJXA 4YQWA 4ED0A 4F93B 1S0MA 1ZQDA 3JPNA 1XC9A 1U48A 3KHHA 5KFCA 4QW9A 4YD1A 3MDAA 1NJZA 2FMPA 4K4IA 3ZD9A 3ZDAA 9ICHA 1SL1A 4X5VA 4YXMA 2DPIA 4E7XA 3QEAZ 4P2HA 3MGIA 4DSLA 4XA5A 1HUZA 4I2CA 1Z00B 2BCUA 2VA8A 4WC6A 4Q8EA 3UQ2A 5KFHA 4FHYA 3K4GA 4RQ4A 2V4QA 7ICHA 5HHIA 1TK5A 1JMSA 5KFYA 1UA0A 2AGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q8F A;  4QWD A;  1ZQC A;  4ATB A;  3HP6 A;  2ASD A;  4YCX A;  1BPD A;  1ZQM A;  2VA3 A;  4RPZ A;  4DQQ A;  4Z6E A;  3ORY A;  5KFP A;  3AQN A;  4J9K A;  5L1K A;  4QZG A;  4RQ6 A;  3RAX A;  7ICF A;  5DB9 A;  5TZV A;  3C2L A;  4F4Y A;  4IRC A;  1XSN A;  5HRH A;  4DL4 A;  4DSK A;  1ZQX A;  5KFF A;  8ICP A;  1NKB A;  2AU0 A;  3ZDC A;  4AT7 B;  1JXL A;  5HRK A;  5DGB A;  5HML A;  1NK4 A;  4NM2 A;  4O3P A;  1NK7 A;  1L3V A;  5J2K A;  4QZH A;  4DF8 A;  4IRD A;  4DQR A;  4YVZ A;  4M04 A;  2HHW A;  2JEJ A;  9ICG A;  1X9W A;  1ZQJ A;  3AQM A;  3M8R A;  4KLO A;  3PW5 A;  4TQR A;  4B9L A;  1S77 D;  4F3O A;  3Q8M A;  3SV3 A;  3T5H A;  4X0B A;  3HJ4 A;  4UD4 A;  3UXP A;  4DL3 A;  4KLT A;  1A77 A;  5J0S A;  4RNO A;  3PML A;  2M2V A;  5DLG A;  4J9M A;  3GFK B;  2J6U A;  3V72 A;  3OVB A;  5KFN A;  9ICO A;  2NRX A;  4B9N A;  2DR9 A;  4FS2 A;  3OUY A;  2Q0Z X;  3UPS A;  4F4K A;  4IQU A;  1LV5 A;  2JEG A;  8ICF A;  4KLU A;  4P4P A;  4F2S A;  5J0Y A;  4P4M A;  5DB8 A;  4ECU A;  3RRH A;  2ZJ5 A;  2BR0 A;  8ICB A;  4P4O A;  5DB6 A;  3BQ1 A;  4G3I A;  4O5E A;  4Q45 A;  2Y1J A;  3HX0 A;  4IQV A;  2MUT A;  2PI4 A;  2O1P A;  2DR8 A;  4RZR A;  1XU4 A;  2FPK A;  1F5A A;  4UB5 A;  2VAN A;  5J29 A;  2FLP A;  4DFP A;  4ED6 A;  5HRB A;  3MR6 A;  4JK1 A;  4UB3 A;  3JPR A;  1NJY A;  4RWP A;  2C2D A;  2AQ0 A;  1Z00 A;  4UAZ A;  2Y1I A;  1T4G A;  3RBD A;  4ELV A;  1NO5 A;  1XSL A;  2ZH1 A;  3H40 A;  3RJE A;  4JUZ A;  3KHG A;  3ZDD A;  4EYH B;  4WC4 A;  5KFJ A;  1SKR A;  3N4M B;  2BKE A;  2ZH2 A;  1QLN A;  2ATL A;  5KT7 A;  3V6K A;  4Z6C A;  1Q79 A;  5KFD A;  4FHX A;  3C23 A;  4QWB A;  3V7L A;  4EBC A;  2DR7 A;  5J2H A;  3TAN A;  3GDX A;  4I2E A;  3H8W A;  3UPQ A;  3H39 A;  5KFB A;  1EXN A;  4DOB A;  4GXJ A;  1BPE A;  2BGW A;  1X9S A;  7ICE A;  4DSI A;  4WC1 A;  4ED3 A;  1NK0 A;  2ZH6 A;  4MFF A;  3WFP A;  2WTF A;  3PMN A;  1KFD A;  4AT9 B;  5HRF A;  3TAR A;  4X0A A;  2ZH5 A;  3RB3 A;  2NRW A;  2ZJ8 A;  2IA6 A;  4F5O A;  3PO4 A;  2AGQ A;  5EWF A;  5KFI A;  4R65 A;  2F1H A;  4FBU A;  4NLK A;  3C2K A;  4BGD A;  9ICW A;  2ZUC A;  4Q44 A;  4RPY A;  2RFF A;  1KFT A;  4S3N A;  2ZUD A;  4FH5 A;  1R8C A;  3BQT A;  4X4O A;  4WC7 A;  4RPX A;  3RR8 A;  9ICR A;  1DOQ A;  1MIW A;  3GII A;  4IR1 A;  1DGS A;  2KTQ A;  5DQI A;  4GXK A;  4LT6 A;  3M9N B;  1QTM A;  3K75 D;  4O0I A;  4CCH A;  4O3S A;  4I2B A;  1IXR A;  3OJS A;  4PGX A;  4F5Q A;  7ICM A;  2IBK A;  8ICL A;  4PGY A;  4B9M A;  7ICS A;  4Q43 A;  2UVV A;  3RJF A;  1OU5 A;  2XO7 A;  9ICT A;  5BOM A;  4QZA A;  5J0O A;  1QSS A;  1N48 A;  3PX4 A;  2BHN A;  2F1I A;  3ETL A;  2R8I A;  4LZG A;  5HRD A;  4DSF A;  5HMM A;  4M47 A;  9ICN A;  5IIM A;  1TFY A;  4AT8 B;  3SYZ A;  4J9R A;  4BXO B;  4B9T A;  4I2F A;  4FHV A;  1KTQ A;  2ZUB A;  3T3F A;  3ISB A;  5CP2 A;  1XS9 D;  4QZ9 A;  4RQ0 A;  2C2E A;  4X4P A;  3ISD A;  3C2M A;  4F5N A;  4NY8 A;  3FYH A;  4KN7 A;  3UXN A;  3SV4 A;  4UAY A;  2XGQ A;  4I27 A;  5HRE A;  1FA0 A;  2W9C B;  4RU9 A;  2W9B B;  1WOT A;  2HHP A;  3V6J A;  3RJH A;  2MUT B;  4MFC A;  8ICI A;  1ZQH A;  2C2R A;  1KRP A;  9ICI A;  3B0Y A;  1UA1 A;  1TKD A;  5KG1 A;  5CWR A;  5L1I A;  4PHE A;  9ICM A;  8ICM A;  5KFX A;  3T5J A;  4I2A A;  2HHS A;  2ZH4 A;  3ZD8 A;  5IIL A;  1NZP A;  3G6Y A;  2JEI A;  4YR0 A;  4K4H A;  4PPX A;  5EWE A;  4ED2 A;  1BNO A;  3ISC A;  5HRI A;  1UEV A;  3MFI A;  5HP4 A;  3RR7 A;  2DRA A;  3M8S A;  8ICN A;  2ZTE A;  3GIL A;  4X4N A;  3T5K A;  5DB7 A;  5EOZ A;  2BCR A;  3AQL A;  4KMU A;  3JPO A;  5L9X A;  1U4B A;  5DEC A;  4AT9 A;  1XO1 A;  4M5D A;  2JZB B;  4DL2 A;  4DOC A;  4DOA A;  4J9N A;  4PHA A;  5DG7 A;  1JN3 A;  1PX5 A;  4M9N A;  4EBK A;  3B0X A;  4YG2 A;  5DG8 A;  3FDS A;  3THV A;  3RH5 A;  1JXE A;  1D9D A;  1ZQB A;  3EPI A;  4I2H A;  4JWM A;  4KLH A;  4KLQ A;  4RWN A;  4PHP A;  4XUS A;  4UB2 A;  4YFK A;  3QE9 Y;  4O3R A;  9ICL A;  5J2J A;  3KHL A;  4X4S A;  2O5A A;  3HT3 A;  2DR5 A;  1T3N A;  5J2E A;  3JPQ A;  4O9M A;  4GLX A;  1UEU A;  4DLG A;  1D8Y A;  4F2R A;  5IIK A;  3LK9 A;  3MR5 A;  1K1Q A;  2ZTC A;  4F5P A;  1D9F A;  1V9P A;  1ZQG A;  2W8L A;  3WFR E;  4KN4 A;  5DLF A;  2DPJ A;  2M2W A;  5KFM A;  1U9L A;  4IR9 A;  4YXJ A;  4WCW A;  5DKW A;  4WBZ A;  1ZQF A;  4QZE A;  2XCP A;  4DFK A;  1K1S A;  2C22 A;  4AT8 A;  1SKS A;  4BXO A;  3H4B A;  1QSY A;  2KZM A;  8ICX A;  2BCS A;  4X4R A;  1N56 A;  1ZQE A;  2PFP A;  3PR4 A;  5J2B A;  4RT2 A;  1ZYQ A;  2NRZ A;  5F9N A;  1S97 A;  1D8L A;  4RT3 A;  4DSE A;  1ZQK A;  1ZQY A;  4Z6F A;  4DSJ A;  1TV9 A;  3L9D A;  2RDI A;  2DFL A;  4R64 A;  5KG6 A;  4C8M A;  1SKW A;  2W9C A;  2W9B A;  1BGX T;  3QZ8 A;  2W8K A;  2AQ4 A;  5BPC A;  3M9M B;  1BPY A;  1ZQR A;  2HHQ A;  1XWL A;  1WCN A;  3GIM A;  3PR5 B;  3OSP A;  2ZJA A;  2BCQ A;  3AQK A;  7ICG A;  8ICT A;  4PH5 A;  1JX4 A;  5KG5 A;  1ZQP A;  2VA2 A;  1UET A;  4E80 A;  4F4W A;  2PFN A;  3PW2 A;  2FMS A;  4MF2 A;  3RB4 A;  5DG9 A;  5J2D A;  4F92 B;  4QZF A;  4QWA A;  4J9S A;  4EEY A;  3MR3 A;  4DL7 A;  4RUC A;  4KLG A;  1CUK A;  7ICP A;  2M2U A;  2DRB A;  1DK3 A;  2ZH3 A;  3MFH A;  3RJG A;  5J2I A;  2HW3 A;  3MR2 A;  5HRG A;  4ZH4 A;  1ZQZ A;  5KFZ A;  3OHB A;  1MQ3 A;  5D49 A;  3JZ0 A;  4NLN A;  4B9V A;  8ICC A;  3HW8 A;  1TFW A;  4B9U A;  5DGA A;  4F50 A;  1ZJM A;  2JZB A;  5KFQ A;  5III A;  1TK8 A;  4RWQ A;  4O3Q A;  2HHV A;  5KFR A;  3NTU A;  4J9P A;  3EPG A;  2IHN A;  4KLS A;  9ICU A;  4EP7 A;  8ICA A;  1SL2 A;  3IM1 A;  4KTQ A;  1ZQQ A;  5BOL A;  1COO A;  1U49 A;  4YMO A;  3NYB A;  3ZDB A;  4I28 A;  3PVX A;  1MSW D;  2ASJ A;  5CHG A;  1ZJN A;  1CEZ A;  2P66 A;  4KLL A;  1TVA A;  4YR2 A;  3H8S A;  2FPL A;  7ICJ A;  5KFV A;  3WFO A;  4EBJ A;  4X4V A;  5HR9 A;  5D46 A;  3GV5 B;  1ZQS A;  3HPO A;  4LZD A;  8ICJ A;  2UVU A;  4M9H A;  1BVS A;  1ZQU A;  3PV8 A;  1X9M A;  4EZ6 A;  3Q8S B;  2XC9 A;  1ZQO A;  2UVW A;  3PO5 A;  1V4A A;  2J6S A;  1PZN A;  2BPG A;  4NKU A;  4WBY A;  4FS1 A;  4XRH A;  3OHA A;  3G6V A;  5KFU A;  3OGU A;  3H4D A;  4ECY A;  2HHX A;  4UD5 A;  5J0R A;  1NJW A;  1X2I A;  1BPX A;  4DFM A;  1T7P A;  4NKT A;  4PHD A;  1U45 A;  2H5X A;  1R89 A;  3UQ0 A;  2J6T A;  1NKE A;  2ID1 A;  4YMM A;  1HJP A;  1TFR A;  3HIY A;  4MF8 A;  2NRV A;  3EYZ A;  1ARO P;  3RJK A;  3H38 A;  4Z6D A;  5KFK A;  1T8E A;  3LDA A;  2PFQ A;  3C5F A;  4RWO A;  3Q8Q B;  2PXI A;  5DDY A;  4FO6 A;  4I29 A;  9ICC A;  3C1Z A;  5J0X A;  4IG8 A;  3RJI A;  4UQG A;  3EW9 A;  1A76 A;  3SI8 A;  7ICU A;  5F9L A;  3PY8 A;  2ZHB A;  4DLE A;  3PW7 A;  7ICV A;  4MFA A;  4GXI A;  4YD2 A;  5J2A A;  4ECR A;  3QEB Z;  2HHT A;  4WC2 A;  2KP7 A;  4R66 A;  1BNP A;  3KHR A;  9ICB A;  3RAQ A;  2ISP A;  4M0A A;  1SZP A;  5KFG A;  1RZT A;  4KLF A;  7ICT A;  9ICS A;  5CB1 A;  5HHH A;  3NGD A;  7ICQ A;  4ECT A;  3KTQ A;  1YLQ A;  4I2D A;  4BWM A;  3C1Y A;  4ECX A;  2NRK A;  3GQC A;  2HVH A;  5IIO A;  4UBC A;  2V4R A;  4EZ9 A;  4IQW A;  5EWG A;  4RQ5 A;  1U47 A;  1NKC A;  3PX0 A;  4O3N A;  5D4B A;  3MAB A;  3H7I A;  3TFR A;  1ZQW A;  3HWT A;  4MEX A;  3H37 A;  4I2I A;  2PI5 A;  4MEY A;  4ED7 A;  2XY5 A;  1RYR A;  2KZZ A;  5DBB A;  1ZQI A;  3E2E A;  9ICJ A;  1Y88 A;  4XQ7 A;  4QZ8 A;  2BE3 A;  2IHM A;  3TFS A;  5HNK A;  5DQG A;  8ICE A;  4E0D A;  5KT3 A;  8ICS A;  4QWE A;  1KEJ A;  4KLE A;  4IQT A;  1RXV A;  4NXZ A;  1NK9 A;  2W9M A;  3Q8P B;  4FHW A;  3TI0 A;  1Q78 A;  5KG3 A;  4RQ8 A;  2ISO A;  2KZ3 A;  5KFE A;  3ZDE A;  5L1J A;  2BPF A;  3Q8L A;  2FMQ A;  4DS4 A;  3TAQ A;  2BDP A;  2ALZ A;  4TUS A;  3V6H A;  2XCA A;  4F5R A;  9ICX A;  3AUO A;  3SZ2 A;  7ICL A;  4FH3 A;  1NK5 A;  5KFS A;  4RQ3 A;  4HYK A;  5CA7 A;  2W9A A;  1ZQA A;  3HJ1 A;  1S9F A;  4ECV A;  4C8K A;  3GIJ A;  3OV7 A;  4DQS A;  3JPT A;  3M9O B;  2R8J A;  2XY6 A;  1UT5 A;  1S0N A;  1MIV A;  1UT8 A;  4RQ1 A;  4X4T A;  2ZH8 A;  2ZH7 A;  3WFQ E;  2AGO A;  4QZI A;  1L3U A;  4KLJ A;  3RJJ A;  4EBD A;  5J2G A;  1SL0 A;  4ED8 A;  4O3O A;  4RNM A;  3AU6 A;  8ICW A;  4F91 B;  1ZQL A;  3RTV A;  4NLG A;  9ICQ A;  4XQ8 A;  4I2J A;  1HUO A;  4J9O A;  2HVI A;  4QZB A;  4M6W A;  3QZ7 A;  4YN4 A;  5J0W A;  2GWS A;  4DQP A;  5KT4 A;  2M2T A;  4E8F A;  4YR3 A;  3BDP A;  4NM1 A;  3LQC B;  3EWA A;  2V9W A;  1RPL A;  4F4X A;  2F1J A;  3G6X A;  5IIJ A;  2PBE A;  5J0T A;  1VFG A;  2XGP A;  1XSP A;  4QZC A;  5J0Q A;  1C7Y A;  9ICP A;  2KN7 A;  4NLZ A;  2RDJ A;  1S0V A;  1TAU A;  1S10 A;  4X4U A;  3C5G A;  1B22 A;  4DF4 A;  2R8H A;  2I9G A;  4TUQ A;  3V7K A;  5KFL A;  1NK8 A;  1JQR A;  3C21 A;  5DDM A;  4DS5 A;  3BJY A;  3JPS A;  3Q8K A;  2DVI A;  8ICG A;  5IIN A;  4ED1 A;  4DL6 A;  3LWL A;  2Q66 A;  2A1J A;  1ZQN A;  3OSN A;  5KT5 A;  4EYI B;  3PNC A;  3RRG A;  1S0O A;  7ICK A;  1MC8 A;  3C66 A;  3RB0 A;  4DFJ A;  1WCL A;  4M9G A;  4RNN A;  4RQ2 A;  2B21 A;  3Q8R B;  1ZQV A;  3GV8 B;  3H3A A;  7ICO A;  1NK6 A;  4R8U B;  5KT6 A;  2KFZ A;  9ICK A;  1KNY A;  1R8B A;  4B9S A;  3RH6 A;  5KG4 A;  1BPZ A;  1JAJ A;  4KLD A;  1LB2 B;  3N97 B;  2FPM A;  4ECZ A;  4M9L A;  1S76 D;  3MGH A;  2AJQ A;  2XY7 A;  4TUR A;  5CJ7 A;  5KFA A;  4PGQ A;  3MBY A;  4UB4 A;  3GIK A;  9ICV A;  1ZET A;  5KFO A;  5C5J A;  1Z3E B;  5JUM A;  5KT2 A;  2ZH9 A;  5KTQ A;  1KLN A;  9ICA A;  7ICI A;  4DEZ A;  5KG2 A;  1JIH A;  2NRT A;  3T5L A;  2UVR A;  3OVS A;  4M2Y A;  2BQU A;  4BDP A;  1IM4 A;  8ICR A;  2R8G A;  3H8J A;  4JV2 A;  5J0P A;  1NOM A;  2MAX A;  3PW0 A;  8ICY A;  4YP3 A;  3BQ2 A;  3TQ1 A;  4DWI A;  3EZ5 A;  2P6R A;  1MIY A;  4EBE A;  1L3S A;  4C8N A;  5CR0 A;  5J2C A;  4ECS A;  3RBE A;  4DL5 A;  4JV1 A;  4O5K A;  4ATB B;  5DQH A;  4AT7 A;  2HHU A;  4RQ7 A;  5L1L A;  2BQR A;  2C28 A;  1TK0 A;  3MDC A;  1TAQ A;  4DO9 A;  4C8L A;  3BQ0 A;  1QSL A;  4JWN A;  3OVA A;  4ECW A;  1L5U A;  2M9N A;  5J2F A;  2ASL A;  8ICZ A;  5DBC A;  4UAW A;  4M6W B;  4BWJ A;  3PX6 A;  3AU2 A;  1RXW A;  4LVS A;  4KLM A;  9ICE A;  3C18 A;  3WFS C;  8ICH A;  4FHP A;  1B43 A;  4F8R A;  8ICO A;  4WC5 A;  2R8K A;  5DED A;  9ICF A;  4F4Z A;  4QWC A;  4QW8 A;  3PW4 A;  3JYY A;  8ICK A;  4K4G A;  1BPB A;  5HC9 A;  2FLL A;  2BQ3 A;  2I1Q A;  4TQS A;  2KFN A;  8ICV A;  3JPP A;  4WC3 A;  3UXO A;  1KSP A;  5KFT A;  4ELU A;  2FLN A;  1L3T A;  4RUA A;  4UB1 A;  4ECQ A;  1DK2 A;  7ICN A;  4GC6 A;  2P6U A;  4JV0 A;  3LWM A;  4KIT B;  1KFS A;  4I2G A;  3TAP A;  3RH4 A;  1KDH A;  4R63 A;  5KFW A;  2JEF A;  2BPC A;  4IRK A;  4R8U A;  1ZQT A;  5KG7 A;  4J9Q A;  5J0U A;  4KLI A;  4WC0 A;  2A1J B;  3V7J A;  5F2V O;  4FBT A;  2LYH A;  4TUP A;  4GC7 A;  2OWO A;  2BCV A;  2ZTD A;  5DBA A;  3OJU A;  8ICQ A;  5HRL A;  4ELT A;  3IHQ B;  2PFO A;  8ICU A;  3OUY B;  4UBB A;  1RYS A;  3GV7 B;  1VJ7 A;  2ZHA A;  4X4Q A;  4QZD A;  4C8O A;  4DQI A;  4O5C A;  1R8A A;  2IMW P;  3RB6 A;  4YMN A;  1H38 A;  4M9J A;  7ICR A;  4J9L A;  1MQ2 A;  5KG0 A;  1NJX A;  4YQW A;  4ED0 A;  4F93 B;  1S0M A;  1ZQD A;  3JPN A;  1XC9 A;  1U48 A;  3KHH A;  5KFC A;  4QW9 A;  4YD1 A;  3MDA A;  1NJZ A;  2FMP A;  4K4I A;  3ZD9 A;  3ZDA A;  9ICH A;  1SL1 A;  4X5V A;  4YXM A;  2DPI A;  4E7X A;  3QEA Z;  4P2H A;  3MGI A;  4DSL A;  4XA5 A;  1HUZ A;  4I2C A;  1Z00 B;  2BCU A;  2VA8 A;  4WC6 A;  4Q8E A;  3UQ2 A;  5KFH A;  4FHY A;  3K4G A;  4RQ4 A;  2V4Q A;  7ICH A;  5HHI A;  1TK5 A;  1JMS A;  5KFY A;  1UA0 A;  2AGP A; 
#chains in the Genus database with same CATH topology
 4QWD A;  3E58 A;  4J9K A;  5AHX A;  2WF7 A;  3WK4 A;  4IRC A;  1XSN A;  5HRH A;  4DL4 A;  5HML A;  1NK4 A;  4O3P A;  2MA1 A;  4YVZ A;  4M04 A;  2HHW A;  3AQM A;  3PW5 A;  4TQR A;  3N7P D;  4P0Q B;  3UXP A;  4DL3 A;  3C29 A;  4KLT A;  1A77 A;  2M2V A;  3OVB A;  3NVV A;  3I1Y A;  9ICO A;  2HBL A;  2DL0 A;  4MKP A;  4IQU A;  2CN1 A;  2JEG A;  2ZIU B;  4Y2R A;  5CFS A;  4U7C A;  2K8C B;  4P4P A;  5J0Y A;  8ICY A;  3RRH A;  3ETR A;  4P4O A;  4O5E A;  3HX0 A;  2DR8 A;  2O1P A;  3F2B A;  4UB5 A;  5J29 A;  4ED6 A;  1FIQ A;  4UB3 A;  3JPR A;  4WJ3 B;  3ERC C;  1NJY A;  2C2D A;  2LM4 A;  3RBD A;  4ELV A;  1NO5 A;  3H40 A;  4JUZ A;  4EYH B;  4WQK A;  5AM0 A;  1QLN A;  3V6K A;  1Q79 A;  5KFD A;  5AKL A;  3H39 A;  1EXN A;  4DOB A;  1PK1 A;  1X9S A;  2WHE A;  1NK0 A;  1HIW A;  2ZH6 A;  3RF9 A;  1KFD A;  5HRF A;  3RB3 A;  3PO4 A;  4R65 A;  4FBU A;  2YML A;  1Z4O A;  2DQN B;  5AK3 A;  2LI6 A;  1ZQ1 C;  4WH5 A;  3GII A;  1DGS A;  4GXK A;  4LT6 A;  1SB3 C;  3M9N B;  1QTM A;  7ICM A;  4PGY A;  4B9M A;  7ICS A;  2UVV A;  4JLZ A;  1OU5 A;  1N62 A;  2BHN A;  2R8I A;  4DSF A;  9ICN A;  1TFY A;  5IIM A;  2RQ5 A;  3TAD C;  4AT8 B;  4I2F A;  3HJE A;  2K8B B;  3R9K A;  3ISB A;  2H3Q A;  1XS9 D;  4X4P A;  4KN7 A;  2Q4T A;  1QQ6 A;  5HRE A;  4I27 A;  4P0P B;  2HHP A;  1KRP A;  1TKD A;  5KFX A;  5IIL A;  3G6Y A;  5HRI A;  5EWE A;  2YMM A;  3F2C A;  3MFI A;  5HP4 A;  3M8S A;  4AYB C;  4Y2T A;  2KG5 A;  3N7S C;  2E8N A;  3AQL A;  5DEC A;  5L9X A;  4AT9 A;  2JZB B;  4DL2 A;  2HBK A;  4J9N A;  5DG7 A;  4O3M A;  5AIC A;  3KZI U;  1PK1 B;  1SV0 C;  4YG2 A;  5DG8 A;  3RH5 A;  1JXE A;  4JWM A;  4RWN A;  3A0B U;  1QQ7 A;  4PHP A;  3PST A;  5J2J A;  3HT3 A;  1T3N A;  5C0Y A;  4RQM A;  2DGZ A;  4KX5 A;  5J2E A;  4UAU A;  3LK9 A;  2ZTC A;  2G08 A;  4KN4 A;  1PUZ A;  4G9B A;  1U9L A;  5KFM A;  4YXJ A;  4OJP A;  4QNL A;  4F72 A;  4BXO A;  1YZ7 A;  1QSY A;  8ICX A;  3PR4 A;  4RT2 A;  4DSE A;  1ZQY A;  4DSJ A;  3SMV A;  2DFL A;  1BGX T;  3QZ8 A;  3M9M B;  3PR5 B;  5KG5 A;  3PW2 A;  2GOL A;  5J2D A;  4F92 B;  4ICA A;  4QWA A;  4EEY A;  7ICP A;  3MR3 A;  1CUK A;  2DRB A;  2ZH3 A;  2HW3 A;  3MR2 A;  3KD3 A;  5HRG A;  4FE3 A;  3OHB A;  1SIJ A;  3HKZ F;  8ICC A;  1IIP A;  1ZJM A;  1TK8 A;  4RWQ A;  4O3Q A;  3F5A A;  1FFU A;  2W7O A;  2IHN A;  4Y2P A;  4EP7 A;  8ICA A;  1SL2 A;  1COO A;  2KJ9 A;  2EH9 A;  2P66 A;  2FPL A;  1B4F A;  2KJ8 A;  4PL2 A;  4X4V A;  4BJQ A;  3GV5 B;  3HPO A;  4LZD A;  1URJ A;  2UVU A;  4M9H A;  3WU2 U;  4EZ6 A;  3Q8S B;  4EX6 A;  1PVP A;  3G6V A;  3OGU A;  2HHX A;  4K97 A;  2HN1 A;  3UQ0 A;  2ID1 A;  3DV9 A;  4MF8 A;  3RJK A;  3H38 A;  4NXT A;  1UHU A;  5KFK A;  2B6G A;  3Q8Q B;  2K4I A;  4FO6 A;  1SXE A;  4US8 A;  1YZ6 A;  2YX8 A;  3PY8 A;  3PW7 A;  4GIB A;  2ZIW B;  5KAI U;  5CFT A;  5CB1 A;  7ICQ A;  4ECT A;  3AQF A;  3C1Y A;  1N5W A;  5ALQ A;  2V4R A;  1U47 A;  1NKC A;  2F3N A;  1ZQW A;  4I2I A;  2PI5 A;  2H3F A;  2XY5 A;  1RYR A;  2DBY A;  4JB3 A;  2KZZ A;  4AP9 A;  5DBB A;  4CE6 A;  1YT3 A;  9ICJ A;  4EEL A;  2IHM A;  1X40 A;  4E0D A;  1RDF A;  1KEJ A;  2PKE A;  4NXZ A;  2W9M A;  1N63 A;  2OXO A;  2BPF A;  5FP0 A;  2FMQ A;  4DS4 A;  4CF5 A;  2BDP A;  2ALZ A;  9ICX A;  3SZ2 A;  2FJ6 A;  3LYS A;  5KFS A;  5CA7 A;  2DUY A;  3JPT A;  2XY6 A;  3NRZ A;  3WFQ E;  4RQ1 A;  1WYG A;  2YMP A;  4O3O A;  8ICW A;  4F91 B;  4XQ8 A;  1HUO A;  2L5Y A;  2HVI A;  2ZIV A;  5J0W A;  2GWS A;  4E8F A;  5KT4 A;  2QB0 B;  3LQC B;  4ZOH C;  3IV6 A;  3VC8 A;  5H2F U;  2R8H A;  4OO1 J;  3V7K A;  2H3V A;  4O69 A;  8ICG A;  1ZQN A;  4OAG A;  2HBJ A;  2JV3 A;  3ICX A;  1VJ5 A;  3RB0 A;  2GA9 D;  3Q8R B;  1ZQV A;  3GV8 B;  5KT6 A;  2KFZ A;  5GTI U;  2B4V A;  3QX7 A;  4C4R A;  1BPZ A;  4KLD A;  4K9A A;  2FPM A;  4ECZ A;  5ALN A;  3MGH A;  2OCE A;  2YN4 A;  2KD1 A;  2XY7 A;  2RP5 A;  2ES6 A;  3QUQ A;  2E3T A;  4CNQ A;  5C5J A;  4IL6 U;  9ICA A;  1JIH A;  3UMB A;  3OVS A;  4M2Y A;  3KFU F;  2E8O A;  4XJE A;  4BDP A;  2KVS A;  2AXT U;  2Y0S C;  5CR0 A;  4ATB B;  5DQH A;  3SAG A;  5L1L A;  1TAQ A;  4DO9 A;  4C8L A;  3KKA A;  8ICZ A;  9ICE A;  3AU2 A;  4HX0 A;  3C18 A;  1PVR A;  5AI9 A;  4WC5 A;  5DED A;  5EE0 A;  9ICF A;  3PW4 A;  3JYY A;  8ICK A;  2FLL A;  1CI4 A;  2LYB A;  2KFN A;  4DFD A;  3JPP A;  1KSP A;  4J03 A;  4ELU A;  2FLN A;  1L3T A;  2P6U A;  3LWM A;  1KFS A;  3TAP A;  4NWI A;  1KDH A;  2BPC A;  1ZQT A;  5ALW A;  5J0U A;  4KLI A;  4WC0 A;  5F2V O;  4FBT A;  3IHQ B;  1Q46 A;  3OUY B;  3WK9 A;  1SV4 A;  4DQI A;  2IMW P;  3RB6 A;  3H8M A;  1H38 A;  4WQL A;  4QIW C;  4ED0 A;  4F93 B;  2NYV A;  2FDR A;  3ZD9 A;  1HEK A;  2LKY A;  4YXM A;  2DPI A;  4E7X A;  4I2C A;  1Z00 B;  4WC6 A;  4FHY A;  5KFH A;  4OJL A;  2HDO A;  3QYP A;  2ASD A;  4YCX A;  1BPD A;  4AYB F;  2LBO A;  5KFP A;  1WUD A;  1NNL A;  4F4Y A;  5KFF A;  1Q3U A;  3ZDC A;  2AU0 A;  3WK7 A;  2QAR A;  4DQR A;  5ALF A;  2JEJ A;  1S77 D;  3Q8M A;  5JU5 A;  5HR6 A;  5J0S A;  3PML A;  3V72 A;  4NV0 A;  4KM5 A;  2NRX A;  5ALG A;  3PZP A;  1LV5 A;  5AM1 A;  2HOF A;  5J8Y A;  4F2S A;  4HAI A;  1X6I A;  5DB6 A;  3BQ1 A;  2Y1J A;  2PI4 A;  1XU4 A;  2FPK A;  1F5A A;  2RRD A;  2KSO A;  2VAN A;  3D2N A;  2FLP A;  4Y2Y A;  3EUB 2;  2BBJ A;  3L3F X;  2W03 A;  2AQ0 A;  2Y1I A;  3KHG A;  2OH2 A;  2ZIX A;  4WC4 A;  2HMX A;  5KFJ A;  3N4M B;  4Z6C A;  4QWB A;  4EBC A;  3TAN A;  4I2E A;  3UPQ A;  4F71 A;  2BGW A;  1BPE A;  4DSI A;  2O6K A;  3QNM A;  4MFF A;  1ZRN A;  1LVH A;  2WTF A;  2NRW A;  2AGQ A;  5JTI A;  4UAR A;  2F1H A;  4OJO A;  5AKY A;  4BGD A;  9ICW A;  4CF4 A;  2GAF D;  2WB1 C;  4Q44 A;  1KFT A;  4FH5 A;  1R8C A;  3BQT A;  4WC7 A;  4P0Q A;  4RPX A;  3RR8 A;  1DOQ A;  1MIW A;  1X66 A;  2QAR B;  2JHD A;  4Q43 A;  2ZIU A;  3RJF A;  5CEH A;  2F1I A;  3ETL A;  4LZG A;  5HRD A;  4M47 A;  4QZ9 A;  4RQ0 A;  3C2M A;  3UXN A;  1FA0 A;  3E0F A;  4RU9 A;  4NLB A;  3RJH A;  4FFD A;  8ICI A;  1ZQH A;  2KSO B;  3B0Y A;  5ALH A;  2A3V A;  3NVO A;  4PHE A;  3QU9 A;  1QCK A;  2HHS A;  2EWR A;  4YR0 A;  4PPX A;  4NLC A;  3ISC A;  1L7N A;  8ICN A;  2ZTE A;  2BCR A;  4M5D A;  4DOC A;  4DOA A;  1PX5 A;  1QQ5 A;  3M7D A;  5CFU A;  3FDS A;  3NVY A;  3THV A;  4KLH A;  4K98 A;  1IV8 A;  4X4S A;  2DR5 A;  4EED A;  2FI1 A;  2G5H B;  4F2R A;  1K1Q A;  4F5P A;  3WFR E;  1VLB A;  5ALZ A;  1ZQF A;  2B51 A;  4DFK A;  1F44 A;  4AT8 A;  2BCS A;  2HBM A;  1ZQE A;  2PFP A;  3AQE A;  1ZQK A;  5F9N A;  1RQL A;  3BS5 B;  4UAT A;  3L9D A;  4R64 A;  1D9F A;  4I28 A;  1SKW A;  1ZQR A;  1BPY A;  5ALO A;  2AQ4 A;  4P0P A;  3SEI A;  3TAD A;  3AL0 B;  3CK6 A;  2ZJA A;  1UET A;  1JX4 A;  2VA2 A;  2PFN A;  1M6Y A;  2FCL A;  2HI0 A;  3RB4 A;  4KMO B;  5DG9 A;  4J9S A;  1D8B A;  4RUC A;  1F0M A;  3RJG A;  5J2I A;  1K5O A;  1MQ3 A;  5D49 A;  3HW8 A;  2KEY A;  3SAH A;  2JZB A;  5KFQ A;  2K8A A;  2W11 A;  2KHQ A;  9ICU A;  4NL9 C;  3I28 A;  3AEV A;  1U49 A;  4YMO A;  3ZDB A;  3PVX A;  1FFV A;  2ASJ A;  4O68 A;  5AKE A;  1TVA A;  1OUQ A;  3WFO A;  2N1R A;  5HR9 A;  4KX3 A;  5G5H A;  2KKV A;  8ICJ A;  1SV0 A;  4EGW A;  2EDU A;  1BVS A;  1X9M A;  1COK A;  2HN2 A;  2KIV A;  1ZQO A;  2F76 X;  2UVW A;  1V4A A;  2KKP A;  2E8M A;  4NXU A;  1PK3 A;  4XRH A;  5KFU A;  2K4P A;  5J0R A;  1X2I A;  1BPX A;  4DFM A;  4NKT A;  1U45 A;  2H5X A;  2Y0S F;  2QLT A;  1TFR A;  2NRV A;  1ARO P;  5ALS A;  4Z6D A;  1T8E A;  3LDA A;  5ALI A;  2PXI A;  2ZXH A;  5J0X A;  4IG8 A;  3RJI A;  4UQG A;  3EW9 A;  1L7M A;  4YD2 A;  5J2A A;  4ECR A;  3QEB Z;  4WC2 A;  1BNP A;  3KHR A;  4M0A A;  3A0H U;  2YB1 A;  4KLF A;  5HHH A;  3NGD A;  4CDG A;  1SWW A;  3KTQ A;  1YLQ A;  4BWM A;  3GQC A;  4UBC A;  4EZ9 A;  3J81 j;  4O3N A;  3MAB A;  4MEY A;  4ED7 A;  5ALP A;  1Q3V A;  1ZQI A;  3E2E A;  2BE3 A;  1AQ6 A;  4KLE A;  1OW5 A;  4FHW A;  1XNS A;  3NKU A;  3ZDE A;  4QIW F;  2W55 A;  4TUS A;  2XCA A;  4KB6 A;  7ICL A;  4FH3 A;  1C20 A;  4U6P A;  1SXD A;  1S9F A;  4ECV A;  4C8K A;  3OV7 A;  5CHE A;  3M9O B;  2R8J A;  2ZH7 A;  1UT5 A;  1MIV A;  2ZH8 A;  2E8P A;  4KLJ A;  4QZI A;  4ED8 A;  4RNM A;  2HOI A;  1ZQL A;  4I2J A;  1N60 A;  4J9O A;  2WFA A;  4QZB A;  2M2T A;  3EWA A;  1RPL A;  4F4X A;  2F1J A;  9ICP A;  1C7Y A;  3IN5 A;  2ZIW A;  4EEB A;  4X4U A;  3UMG A;  2EAN A;  4FZN A;  5AIA A;  1NK8 A;  3C21 A;  1ECW A;  5DDM A;  4DS5 A;  1MA7 A;  2Q66 A;  2A1J A;  4EYI B;  3CYM A;  2IHO A;  1MC8 A;  3C66 A;  4M9G A;  4EX7 A;  4DFJ A;  2B21 A;  3H3A A;  7ICO A;  1NK6 A;  4R8U B;  2Z7J A;  4B9S A;  4IC9 A;  5KG4 A;  3QUT A;  4EV6 A;  4M9L A;  1S76 D;  2AJQ A;  5KFA A;  4Y2Q A;  1OXJ A;  3D2S A;  4QJF B;  5ALL A;  9ICV A;  3CRX A;  1ZET A;  5KT2 A;  2ZH9 A;  5KG2 A;  2UVR A;  2BQU A;  3H8J A;  3TQ1 A;  5AM4 A;  2P6R A;  1MIY A;  4EBE A;  2QB0 A;  1L3S A;  4ECS A;  5J2C A;  3RBE A;  4AT7 A;  1UCV A;  2C28 A;  3ED5 A;  2F8L A;  3BQ0 A;  4JWN A;  1L5U A;  2M9N A;  2ASL A;  2YQE A;  1N61 A;  2NO5 A;  3OPX A;  8ICH A;  5AIB A;  8ICO A;  4F4Z A;  3MC1 A;  2WB1 F;  2FE9 A;  2NO4 A;  2LYA A;  8ICV A;  4Y2J A;  3UXO A;  1S5L U;  3PHZ A;  4ECQ A;  4KIT B;  3RH4 A;  1LKY B;  2JEF A;  5KFW A;  3WK8 A;  5D63 A;  2A1J B;  5ALM A;  1X6J A;  2ZTD A;  5DBA A;  8ICQ A;  2WF8 A;  2JR5 A;  2H3Z A;  3GV7 B;  1VJ7 A;  3IRU A;  2IOH A;  4YMN A;  4M9J A;  2BZF A;  1T3Q A;  4YQW A;  3JPN A;  3MDA A;  2YMQ A;  4QW9 A;  2FMP A;  1NJZ A;  9ICH A;  3QEA Z;  4P2H A;  3OTQ A;  2BCU A;  2VA8 A;  3UQ2 A;  5ALY A;  2ODG A;  5D61 A;  4Q8F A;  5F3X B;  2KMD A;  4ATB A;  2F77 X;  1QH9 A;  1ZQM A;  2VA3 A;  3HRD D;  4DQQ A;  3ER9 B;  4QZG A;  4RQ6 A;  3RAX A;  7ICF A;  1RQN A;  5KAF U;  4DSK A;  2D8C A;  4AT7 B;  5HRK A;  5DGB A;  4NM2 A;  1Z1V A;  2A19 A;  1NK7 A;  5J2K A;  4DF8 A;  5B66 U;  1X9W A;  3PSF A;  4KLO A;  2EZX A;  4F3O A;  3SV3 A;  5AKZ A;  3HJ4 A;  4UD4 A;  2OM6 A;  4B6J A;  4FZL A;  5DLG A;  2JXJ A;  3GFK B;  5ALV A;  4J9M A;  3SEN A;  2DR9 A;  3OUY A;  2Q0Z X;  4EEK A;  3UPS A;  8ICF A;  2G07 A;  5DB8 A;  4ECU A;  2ZJ5 A;  2BR0 A;  5AKX A;  4Q45 A;  3WKA A;  4C7Z A;  4RZR A;  2KOB A;  4DFP A;  5HRB A;  3MR6 A;  3L4P A;  5JTG A;  4RWP A;  2W3S A;  1Z00 A;  4UAZ A;  3MCR A;  1T4G A;  2ZH1 A;  1XSL A;  5EE1 A;  1SKR A;  2ZH2 A;  2ATL A;  3V7L A;  3GDX A;  5KFB A;  4GXJ A;  3ZI4 A;  7ICE A;  3O0F A;  4O6A A;  3BZK A;  4ED3 A;  5AI8 A;  3WK6 A;  3TAR A;  1MN8 A;  2ZJ8 A;  4F5O A;  5EWF A;  3C2K A;  3T79 A;  3AM9 A;  4RPY A;  4S3N A;  3SD7 A;  2F2A B;  1X9X A;  2M0N A;  3F5E A;  3TAC B;  3RFA A;  4IR1 A;  5DQI A;  4O3S A;  3HIY A;  4I2B A;  8ICL A;  1ZD3 A;  4PGX A;  2P35 A;  3CNH A;  5BOM A;  4QZA A;  5J0O A;  1N48 A;  1KW4 A;  4FZM A;  4OD0 A;  3PX4 A;  3WKB A;  3SYZ A;  4B9T A;  4FHV A;  2ZUB A;  2E5S A;  2W7P A;  2WF5 A;  2C2E A;  3ISD A;  4F5N A;  4NY8 A;  3SV4 A;  5AI4 A;  2XGQ A;  2K89 A;  2W9C B;  2W9B B;  1WOT A;  3V6J A;  2DKX A;  2G0A A;  5ALX A;  3T5J A;  4I2A A;  4K4H A;  4ED2 A;  1BNO A;  3M6K A;  3M6Z A;  2LPE A;  5DB7 A;  3JPO A;  3K1R B;  3IG5 A;  1XO1 A;  5EE3 A;  4PHA A;  4US9 A;  4M9N A;  3B0X A;  3SAF A;  4KLQ A;  1D9D A;  1KN5 A;  3EPI A;  1ZQB A;  4I2H A;  4XUS A;  4UB2 A;  3QE9 Y;  4O3R A;  3KHL A;  2O5A A;  5B5E U;  4O9M A;  4GLX A;  1UEU A;  2EZY A;  1V9P A;  3GZF A;  4C7Y A;  1FO4 A;  2W8L A;  5DLF A;  2DPJ A;  2M2W A;  3M1Y A;  4UAS A;  5ALD A;  2HCF A;  4WBZ A;  4QZE A;  2XCP A;  1K1S A;  2C22 A;  2KZM A;  4JMU A;  2QB1 A;  1N56 A;  4X4R A;  5J2B A;  2NRZ A;  1D8L A;  4RT3 A;  5B3P A;  1TV9 A;  2NV3 A;  5KG6 A;  2W8K A;  5BPC A;  2OYY A;  1XWL A;  3NWI A;  3GIM A;  2CRX A;  3AQK A;  4C4S A;  4PH5 A;  4E80 A;  4F4W A;  3NAS A;  2FMS A;  2KHV A;  5AKI A;  2F44 A;  3MFH A;  1ZD4 A;  5T14 A;  1ZQZ A;  5KFZ A;  1TFW A;  4NLN A;  4B9V A;  4B9U A;  3QU2 A;  5DGA A;  2HHV A;  4J9P A;  3EPG A;  4KLS A;  4KTQ A;  3IM1 A;  1ZQQ A;  5AM5 A;  4K99 A;  3AMZ A;  3NVZ A;  1ZJN A;  3H8S A;  7ICJ A;  5KFV A;  3C28 A;  2D3D A;  2KVC A;  2DWQ A;  2XC9 A;  1ZD2 P;  2W43 A;  2IUB A;  5AM2 A;  2BPG A;  4NKU A;  4FS1 A;  3OHA A;  3H4D A;  1T7P A;  3U26 A;  1O03 A;  1NKE A;  1HJP A;  3BS5 A;  3EYZ A;  3IG8 A;  2JRZ A;  2PFQ A;  3SR6 A;  4I29 A;  2CPR A;  1V38 A;  4LEZ A;  1J97 A;  1A76 A;  3SI8 A;  7ICU A;  2JGA A;  2ZHB A;  4C0Z A;  4MFA A;  2HHT A;  2KP7 A;  4R66 A;  3DDH A;  2B0C A;  5AKG A;  2ISP A;  4NJ8 A;  5KFG A;  2MU2 A;  2VKQ A;  1JRP A;  4I2D A;  2WF9 A;  4ECX A;  2NRK A;  2HVH A;  1RG6 A;  5D4B A;  4MEX A;  3H7I A;  5AK5 A;  3HWT A;  3TFR A;  4NXX A;  4MHV A;  5DQG A;  5KT3 A;  4QWE A;  3IP4 B;  4IQT A;  1RXV A;  1V97 A;  2YTU A;  4NXV A;  2ISO A;  2KZ3 A;  4LJX A;  4NL9 A;  1KQQ A;  1RM6 C;  2PMZ C;  4K8V A;  4PJ0 U;  3V6H A;  3AUO A;  2XID A;  2ZG6 A;  1NK5 A;  4HYK A;  1ZOL A;  4RQ3 A;  3H0M B;  4C4T A;  3NRW A;  1A0P A;  4DQS A;  3JCF A;  1S0N A;  4X4T A;  1UT8 A;  2WAQ C;  5CRX A;  3HIL A;  5J2G A;  1SL0 A;  3AU6 A;  4M6W A;  3QZ7 A;  1DGJ A;  4YN4 A;  4DQP A;  2H3I A;  3BDP A;  4NM1 A;  2V9W A;  5J0T A;  1XSP A;  5J0Q A;  2KN7 A;  4NLZ A;  2RDJ A;  1S0V A;  1J2N A;  3TKA A;  1B22 A;  2I9G A;  5KFL A;  2JMG A;  1JQR A;  3BJY A;  3JPS A;  3Q8K A;  2DVI A;  5GTH U;  5IIN A;  1RYU A;  4ED1 A;  4DL6 A;  5TIS U;  1WWU A;  1S0O A;  4LEV A;  2OEH A;  3QUB A;  4RQ2 A;  4OAH A;  2I5H A;  2DKZ A;  9ICK A;  1KNY A;  1R8B A;  3RH6 A;  5KNI A;  1JAJ A;  2EQY A;  1LB2 B;  5E79 U;  3WKE A;  4Y2U A;  4PGQ A;  4UB4 A;  3I76 A;  3GIK A;  5JUM A;  1Z3E B;  2QKQ A;  5AI5 A;  4UB6 U;  5KTQ A;  1KLN A;  4DEZ A;  2VJ4 A;  8ICR A;  1IM4 A;  1L7P A;  2MAX A;  3PW0 A;  4Y2X A;  4YP3 A;  3BQ2 A;  3EZ5 A;  4DL5 A;  2E1F A;  2BQR A;  5ALK A;  3OVA A;  3NVW A;  1QSL A;  3ER8 C;  4M6W B;  4BWJ A;  3PX6 A;  4KLM A;  3LVW A;  2F8K A;  3WFS C;  4FHP A;  1B43 A;  4F8R A;  5ALT A;  4QW8 A;  4K4G A;  1BPB A;  2ZXI A;  5HC9 A;  5KFT A;  3ALR A;  4RUA A;  1TE2 A;  3B9J A;  2W3R A;  1SZH A;  2KV2 A;  4JV0 A;  4I2G A;  1Q8K A;  1KKX A;  4IRK A;  4R63 A;  4R8U A;  3DEE A;  3UM9 A;  5ALU A;  3BQ7 A;  3V7J A;  2LYH A;  4TUP A;  2XIC A;  4GC7 A;  2BCV A;  2OWO A;  4PZN A;  8ICU A;  3FC4 A;  2K4H A;  4UBB A;  1RYS A;  4O5C A;  1R8A A;  2YY6 A;  7ICR A;  1S0M A;  2KE7 A;  5EE9 A;  3KHH A;  4YD1 A;  4EEN A;  4FO1 A;  2K60 A;  3MGI A;  3IDW A;  4XA5 A;  1HUZ A;  2GO7 A;  1JUD A;  4UB8 U;  2EAO A;  3K4G A;  4RQ4 A;  2V4Q A;  5HHI A;  3D2Q A;  1TK5 A;  5KFY A;  5L1M A;  1ZQC A;  3HP6 A;  5AI0 A;  1F5S A;  4RPZ A;  3KZX A;  4Z6E A;  3ORY A;  1ZD5 A;  3AQN A;  5L1K A;  1ZXI A;  5TZV A;  5DB9 A;  3C2L A;  1A6S A;  3NUQ A;  1ZQX A;  8ICP A;  1NKB A;  1KBU A;  1FEZ A;  1JXL A;  5ALR A;  1Z1B A;  2KIC A;  3VCB A;  4QZH A;  1L3V A;  4IRD A;  9ICG A;  1ZQJ A;  1ZRM A;  3M8R A;  4B9L A;  3T5H A;  4X0B A;  2Y9T A;  1LKY A;  3BZC A;  3QU7 A;  4RNO A;  4K96 A;  2J6U A;  1ED1 A;  5KFN A;  4B9N A;  4FS2 A;  5AM3 A;  4F4K A;  4PL1 A;  4KLU A;  3KOO A;  5B3Q A;  4P4M A;  4WOY A;  8ICB A;  2WF6 A;  4JLX A;  2KJ5 A;  4G3I A;  4IQV A;  2MUT A;  4JK1 A;  1WG8 A;  4UAV A;  2XI9 A;  2GH1 A;  3RJE A;  3ZDD A;  4RQN A;  2BKE A;  2LM1 A;  3F53 A;  5KT7 A;  4FHX A;  3C23 A;  1Z4N A;  2DR7 A;  5J2H A;  3H8W A;  2XVT A;  1JAL A;  4WC1 A;  3WFP A;  1WWV A;  5ALJ A;  3PMN A;  4AT9 B;  4X0A A;  2ZH5 A;  2KNJ A;  2IA6 A;  3F2D A;  5KFI A;  4NLK A;  2ZUC A;  2RFF A;  2ZUD A;  4X4O A;  4GFJ A;  9ICR A;  2KTQ A;  5KL1 B;  4ACO A;  1GO3 F;  4CCH A;  3K75 D;  4O0I A;  1IXR A;  3OJS A;  4F5Q A;  2IBK A;  2XO7 A;  9ICT A;  1QSS A;  5HMM A;  4J9R A;  4BXO B;  4OAI Z;  1KTQ A;  3T3F A;  1NI3 A;  5CP2 A;  5AKK A;  1N5X A;  3KBB A;  3FYH A;  4UAY A;  2Y9U A;  2MUT B;  5HR7 A;  4MFC A;  2C2R A;  9ICI A;  1JRO A;  1UA1 A;  5KG1 A;  5CWR A;  5L1I A;  3EF2 A;  3H0L B;  9ICM A;  8ICM A;  4LEW A;  2ZH4 A;  3ZD8 A;  1NZP A;  2JEI A;  1UEV A;  1SWV A;  3RR7 A;  2DRA A;  3GIL A;  4X4N A;  3T5K A;  5EOZ A;  4KMU A;  1U4B A;  5AK6 A;  1JN3 A;  4EBK A;  2BDU A;  1PVQ A;  1X42 A;  4YFK A;  9ICL A;  2PMZ F;  3N28 A;  3JPQ A;  5KL8 B;  1N2X A;  4DLG A;  1D8Y A;  2GLE A;  2G09 A;  5IIK A;  3MR5 A;  4BUG A;  4O67 A;  1ZQG A;  3FAH A;  4IR9 A;  4WCW A;  5DKW A;  2EAM A;  2WAQ F;  2LHT A;  1SKS A;  3H4B A;  2MRL A;  3OWG A;  4USA A;  5K4L A;  1KL9 A;  3ONN A;  1B0X A;  1ZYQ A;  1S97 A;  4Z6F A;  2RDI A;  4C8M A;  2W9C A;  2W9B A;  2HHQ A;  1S8O A;  4CRX A;  1WCN A;  3OSP A;  2BCQ A;  7ICG A;  8ICT A;  1ZQP A;  2K4E A;  2VIX A;  1TAM A;  4MF2 A;  4QZF A;  4KLG A;  4DL7 A;  2M2U A;  3SQI A;  2B56 A;  2JH1 A;  1DK3 A;  1L7O A;  1T94 A;  2JH7 A;  4ZH4 A;  3JZ0 A;  4F50 A;  5AK4 A;  5III A;  5KFR A;  3NTU A;  2W04 A;  5A0L A;  3GU3 A;  5BOL A;  2YB4 A;  3NYB A;  1XO0 A;  3K1Z A;  1MSW D;  5CHG A;  1CEZ A;  3QUC A;  4KLL A;  4YR2 A;  4EBJ A;  3AN1 A;  5D46 A;  1ZQS A;  1UPH A;  1ZQU A;  3PV8 A;  3MGV A;  2G06 A;  3L5K A;  3PO5 A;  2J6S A;  1IG6 A;  1PZN A;  1V85 A;  4WBY A;  4ECY A;  4UD5 A;  1NJW A;  4OJ5 A;  4PHD A;  1R89 A;  2J6T A;  4YMM A;  5ALE A;  5JRT A;  4RWO A;  3QU4 A;  3C5F A;  4K9B A;  5DDY A;  9ICC A;  2ZIV B;  3C1Z A;  4PZO A;  5F9L A;  3WKD A;  4DLE A;  7ICV A;  4CGZ A;  4GXI A;  3LVV A;  9ICB A;  3RAQ A;  1SZP A;  1RZT A;  7ICT A;  9ICS A;  2G5I B;  1SGG A;  1GPJ A;  3CP8 A;  5IIO A;  2IOF A;  4IQW A;  5EWG A;  4RQ5 A;  4I0U A;  3PX0 A;  2W54 A;  3H37 A;  4UW9 A;  2CXY A;  4C80 A;  3WKC A;  3H0R B;  1Y88 A;  4XQ7 A;  4QZ8 A;  8ICE A;  3TFS A;  5HNK A;  8ICS A;  1NK9 A;  3Q8P B;  3TI0 A;  1Q78 A;  2KIW A;  5KG3 A;  4RQ8 A;  5L1J A;  5KFE A;  3QXG A;  3Q8L A;  3TAQ A;  4F5R A;  1P7D A;  3HJ1 A;  2E1E A;  2W9A A;  1ZQA A;  2IOF K;  3GIJ A;  1J2M A;  2AGO A;  2KK0 A;  1Z19 A;  1L3U A;  3RJJ A;  2HOQ A;  4EBD A;  5AKJ A;  4NLG A;  3RTV A;  3KKA C;  9ICQ A;  5AI6 A;  3FM9 A;  4YR3 A;  2VJ5 A;  4OAF A;  2LMR A;  2RLT A;  2PBE A;  3G6X A;  5IIJ A;  1VFG A;  2XGP A;  4QZC A;  5AKH A;  1TAU A;  1S10 A;  3C5G A;  4DF4 A;  4TUQ A;  4LEY A;  2EAP A;  1VDV A;  3LWL A;  3OSN A;  5KT5 A;  3PNC A;  3RRG A;  7ICK A;  3HKZ C;  3WK5 A;  1WCL A;  4RNN A;  3QU5 A;  1L6N A;  3BS7 A;  4Y2S A;  3N97 B;  2AH5 A;  3PSI A;  2DF4 B;  4NXW A;  4TUR A;  2I6X A;  5CJ7 A;  2RHF A;  2HSZ A;  3PSP A;  3MBY A;  5KFO A;  1CRX A;  7ICI A;  2NRT A;  3T5L A;  2R8G A;  4JV2 A;  5J0P A;  1NOM A;  4DWI A;  1DXS A;  2R18 A;  4OCZ A;  3UMC A;  4C8N A;  4O5K A;  4JV1 A;  4IS7 A;  2HHU A;  4RQ7 A;  3N7R C;  1TK0 A;  5D62 A;  2AHO B;  3MDC A;  4ECW A;  5J2F A;  1L8L A;  5DBC A;  5G5G A;  4UAW A;  4LVS A;  1RXW A;  2ESE A;  4Y2V A;  2R8K A;  4QWC A;  3NS1 A;  2MSN A;  2BQ3 A;  2I1Q A;  4TQS A;  3S6J A;  4WC3 A;  3CW2 C;  4UB1 A;  1DK2 A;  4A8E A;  7ICN A;  4GC6 A;  5J8Y C;  4CF3 A;  1DRG A;  5KG7 A;  1JI7 A;  4J9Q A;  2EZZ A;  3OJU A;  5HRL A;  4ELT A;  4DCC A;  2PFO A;  2OHF A;  2ZHA A;  1UQV A;  4QZD A;  4C8O A;  4X4Q A;  1NZB A;  4J9L A;  1MQ2 A;  5KG0 A;  1NJX A;  1ZQD A;  1XC9 A;  3K7D A;  1U48 A;  3D6J A;  1L8O A;  2A1A A;  5KFC A;  4OJ6 A;  4K4I A;  2D6F C;  3ZDA A;  1SL1 A;  1O08 A;  4X5V A;  4DSL A;  4N7R A;  4Q8E A;  4BX9 C;  7ICH A;  2BBH A;  1JMS A;  2ZIX B;  1UA0 A;  2AGP A; 
#chains in the Genus database with same CATH homology
 4Q8F A;  4QWD A;  1ZQC A;  4ATB A;  3HP6 A;  2ASD A;  4YCX A;  1BPD A;  1ZQM A;  2VA3 A;  4RPZ A;  4DQQ A;  4Z6E A;  3ORY A;  5KFP A;  3AQN A;  4J9K A;  5L1K A;  4QZG A;  4RQ6 A;  3RAX A;  7ICF A;  5DB9 A;  5TZV A;  3C2L A;  4F4Y A;  4IRC A;  1XSN A;  5HRH A;  4DL4 A;  4DSK A;  1ZQX A;  5KFF A;  8ICP A;  1NKB A;  2AU0 A;  3ZDC A;  4AT7 B;  1JXL A;  5HRK A;  5DGB A;  5HML A;  1NK4 A;  4NM2 A;  4O3P A;  1NK7 A;  1L3V A;  5J2K A;  4QZH A;  4DF8 A;  4IRD A;  4DQR A;  4YVZ A;  4M04 A;  2HHW A;  2JEJ A;  9ICG A;  1X9W A;  1ZQJ A;  3AQM A;  3M8R A;  4KLO A;  3PW5 A;  4TQR A;  4B9L A;  1S77 D;  4F3O A;  3Q8M A;  3SV3 A;  3T5H A;  4X0B A;  3HJ4 A;  4UD4 A;  3UXP A;  4DL3 A;  4KLT A;  1A77 A;  5J0S A;  4RNO A;  3PML A;  2M2V A;  5DLG A;  4J9M A;  3GFK B;  2J6U A;  3V72 A;  3OVB A;  5KFN A;  9ICO A;  2NRX A;  4B9N A;  2DR9 A;  4FS2 A;  3OUY A;  2Q0Z X;  3UPS A;  4F4K A;  4IQU A;  1LV5 A;  2JEG A;  8ICF A;  4KLU A;  4P4P A;  4F2S A;  5J0Y A;  4P4M A;  5DB8 A;  4ECU A;  3RRH A;  2ZJ5 A;  2BR0 A;  8ICB A;  4P4O A;  5DB6 A;  3BQ1 A;  4G3I A;  4O5E A;  4Q45 A;  2Y1J A;  3HX0 A;  4IQV A;  2MUT A;  2PI4 A;  2O1P A;  2DR8 A;  4RZR A;  1XU4 A;  2FPK A;  1F5A A;  4UB5 A;  2VAN A;  5J29 A;  2FLP A;  4DFP A;  4ED6 A;  5HRB A;  3MR6 A;  4JK1 A;  4UB3 A;  3JPR A;  1NJY A;  4RWP A;  2C2D A;  2AQ0 A;  1Z00 A;  4UAZ A;  2Y1I A;  1T4G A;  3RBD A;  4ELV A;  1NO5 A;  1XSL A;  2ZH1 A;  3H40 A;  3RJE A;  4JUZ A;  3KHG A;  3ZDD A;  4EYH B;  4WC4 A;  5KFJ A;  1SKR A;  3N4M B;  2BKE A;  2ZH2 A;  1QLN A;  2ATL A;  5KT7 A;  3V6K A;  4Z6C A;  1Q79 A;  5KFD A;  4FHX A;  3C23 A;  4QWB A;  3V7L A;  4EBC A;  2DR7 A;  5J2H A;  3TAN A;  3GDX A;  4I2E A;  3H8W A;  3UPQ A;  3H39 A;  5KFB A;  1EXN A;  4DOB A;  4GXJ A;  1BPE A;  2BGW A;  1X9S A;  7ICE A;  4DSI A;  4WC1 A;  4ED3 A;  1NK0 A;  2ZH6 A;  4MFF A;  3WFP A;  2WTF A;  3PMN A;  1KFD A;  4AT9 B;  5HRF A;  3TAR A;  4X0A A;  2ZH5 A;  3RB3 A;  2NRW A;  2ZJ8 A;  2IA6 A;  4F5O A;  3PO4 A;  2AGQ A;  5EWF A;  5KFI A;  4R65 A;  2F1H A;  4FBU A;  4NLK A;  3C2K A;  4BGD A;  9ICW A;  2ZUC A;  4Q44 A;  4RPY A;  2RFF A;  1KFT A;  4S3N A;  2ZUD A;  4FH5 A;  1R8C A;  3BQT A;  4X4O A;  4WC7 A;  4RPX A;  3RR8 A;  9ICR A;  1DOQ A;  1MIW A;  3GII A;  4IR1 A;  1DGS A;  2KTQ A;  5DQI A;  4GXK A;  4LT6 A;  3M9N B;  1QTM A;  3K75 D;  4O0I A;  4CCH A;  4O3S A;  4I2B A;  1IXR A;  3OJS A;  4PGX A;  4F5Q A;  7ICM A;  2IBK A;  8ICL A;  4PGY A;  4B9M A;  7ICS A;  4Q43 A;  2UVV A;  3RJF A;  1OU5 A;  2XO7 A;  9ICT A;  5BOM A;  4QZA A;  5J0O A;  1QSS A;  1N48 A;  3PX4 A;  2BHN A;  2F1I A;  3ETL A;  2R8I A;  4LZG A;  5HRD A;  4DSF A;  5HMM A;  4M47 A;  9ICN A;  5IIM A;  1TFY A;  4AT8 B;  3SYZ A;  4J9R A;  4BXO B;  4B9T A;  4I2F A;  4FHV A;  1KTQ A;  2ZUB A;  3T3F A;  3ISB A;  5CP2 A;  1XS9 D;  4QZ9 A;  4RQ0 A;  2C2E A;  4X4P A;  3ISD A;  3C2M A;  4F5N A;  4NY8 A;  3FYH A;  4KN7 A;  3UXN A;  3SV4 A;  4UAY A;  2XGQ A;  4I27 A;  5HRE A;  1FA0 A;  2W9C B;  4RU9 A;  2W9B B;  1WOT A;  2HHP A;  3V6J A;  3RJH A;  2MUT B;  4MFC A;  8ICI A;  1ZQH A;  2C2R A;  1KRP A;  9ICI A;  3B0Y A;  1UA1 A;  1TKD A;  5KG1 A;  5CWR A;  5L1I A;  4PHE A;  9ICM A;  8ICM A;  5KFX A;  3T5J A;  4I2A A;  2HHS A;  2ZH4 A;  3ZD8 A;  5IIL A;  1NZP A;  3G6Y A;  2JEI A;  4YR0 A;  4K4H A;  4PPX A;  5EWE A;  4ED2 A;  1BNO A;  3ISC A;  5HRI A;  1UEV A;  3MFI A;  5HP4 A;  3RR7 A;  2DRA A;  3M8S A;  8ICN A;  2ZTE A;  3GIL A;  4X4N A;  3T5K A;  5DB7 A;  5EOZ A;  2BCR A;  3AQL A;  4KMU A;  3JPO A;  5L9X A;  1U4B A;  5DEC A;  4AT9 A;  1XO1 A;  4M5D A;  2JZB B;  4DL2 A;  4DOC A;  4DOA A;  4J9N A;  4PHA A;  5DG7 A;  1JN3 A;  1PX5 A;  4M9N A;  4EBK A;  3B0X A;  4YG2 A;  5DG8 A;  3FDS A;  3THV A;  3RH5 A;  1JXE A;  1D9D A;  1ZQB A;  3EPI A;  4I2H A;  4JWM A;  4KLH A;  4KLQ A;  4RWN A;  4PHP A;  4XUS A;  4UB2 A;  4YFK A;  3QE9 Y;  4O3R A;  9ICL A;  5J2J A;  3KHL A;  4X4S A;  2O5A A;  3HT3 A;  2DR5 A;  1T3N A;  5J2E A;  3JPQ A;  4O9M A;  4GLX A;  1UEU A;  4DLG A;  1D8Y A;  4F2R A;  5IIK A;  3LK9 A;  3MR5 A;  1K1Q A;  2ZTC A;  4F5P A;  1D9F A;  1V9P A;  1ZQG A;  2W8L A;  3WFR E;  4KN4 A;  5DLF A;  2DPJ A;  2M2W A;  5KFM A;  1U9L A;  4IR9 A;  4YXJ A;  4WCW A;  5DKW A;  4WBZ A;  1ZQF A;  4QZE A;  2XCP A;  4DFK A;  1K1S A;  2C22 A;  4AT8 A;  1SKS A;  4BXO A;  3H4B A;  1QSY A;  2KZM A;  8ICX A;  2BCS A;  4X4R A;  1N56 A;  1ZQE A;  2PFP A;  3PR4 A;  5J2B A;  4RT2 A;  1ZYQ A;  2NRZ A;  5F9N A;  1S97 A;  1D8L A;  4RT3 A;  4DSE A;  1ZQK A;  1ZQY A;  4Z6F A;  4DSJ A;  1TV9 A;  3L9D A;  2RDI A;  2DFL A;  4R64 A;  5KG6 A;  4C8M A;  1SKW A;  2W9C A;  2W9B A;  1BGX T;  3QZ8 A;  2W8K A;  2AQ4 A;  5BPC A;  3M9M B;  1BPY A;  1ZQR A;  2HHQ A;  1XWL A;  1WCN A;  3GIM A;  3PR5 B;  3OSP A;  2ZJA A;  2BCQ A;  3AQK A;  7ICG A;  8ICT A;  4PH5 A;  1JX4 A;  5KG5 A;  1ZQP A;  2VA2 A;  1UET A;  4E80 A;  4F4W A;  2PFN A;  3PW2 A;  2FMS A;  4MF2 A;  3RB4 A;  5DG9 A;  5J2D A;  4F92 B;  4QZF A;  4QWA A;  4J9S A;  4EEY A;  3MR3 A;  4DL7 A;  4RUC A;  4KLG A;  1CUK A;  7ICP A;  2M2U A;  2DRB A;  1DK3 A;  2ZH3 A;  3MFH A;  3RJG A;  5J2I A;  2HW3 A;  3MR2 A;  5HRG A;  4ZH4 A;  1ZQZ A;  5KFZ A;  3OHB A;  1MQ3 A;  5D49 A;  3JZ0 A;  4NLN A;  4B9V A;  8ICC A;  3HW8 A;  1TFW A;  4B9U A;  5DGA A;  4F50 A;  1ZJM A;  2JZB A;  5KFQ A;  5III A;  1TK8 A;  4RWQ A;  4O3Q A;  2HHV A;  5KFR A;  3NTU A;  4J9P A;  3EPG A;  2IHN A;  4KLS A;  9ICU A;  4EP7 A;  8ICA A;  1SL2 A;  3IM1 A;  4KTQ A;  1ZQQ A;  5BOL A;  1COO A;  1U49 A;  4YMO A;  3NYB A;  3ZDB A;  4I28 A;  3PVX A;  1MSW D;  2ASJ A;  5CHG A;  1ZJN A;  1CEZ A;  2P66 A;  4KLL A;  1TVA A;  4YR2 A;  3H8S A;  2FPL A;  7ICJ A;  5KFV A;  3WFO A;  4EBJ A;  4X4V A;  5HR9 A;  5D46 A;  3GV5 B;  1ZQS A;  3HPO A;  4LZD A;  8ICJ A;  2UVU A;  4M9H A;  1BVS A;  1ZQU A;  3PV8 A;  1X9M A;  4EZ6 A;  3Q8S B;  2XC9 A;  1ZQO A;  2UVW A;  3PO5 A;  1V4A A;  2J6S A;  1PZN A;  2BPG A;  4NKU A;  4WBY A;  4FS1 A;  4XRH A;  3OHA A;  3G6V A;  5KFU A;  3OGU A;  3H4D A;  4ECY A;  2HHX A;  4UD5 A;  5J0R A;  1NJW A;  1X2I A;  1BPX A;  4DFM A;  1T7P A;  4NKT A;  4PHD A;  1U45 A;  2H5X A;  1R89 A;  3UQ0 A;  2J6T A;  1NKE A;  2ID1 A;  4YMM A;  1HJP A;  1TFR A;  3HIY A;  4MF8 A;  2NRV A;  3EYZ A;  1ARO P;  3RJK A;  3H38 A;  4Z6D A;  5KFK A;  1T8E A;  3LDA A;  2PFQ A;  3C5F A;  4RWO A;  3Q8Q B;  2PXI A;  5DDY A;  4FO6 A;  4I29 A;  9ICC A;  3C1Z A;  5J0X A;  4IG8 A;  3RJI A;  4UQG A;  3EW9 A;  1A76 A;  3SI8 A;  7ICU A;  5F9L A;  3PY8 A;  2ZHB A;  4DLE A;  3PW7 A;  7ICV A;  4MFA A;  4GXI A;  4YD2 A;  5J2A A;  4ECR A;  3QEB Z;  2HHT A;  4WC2 A;  2KP7 A;  4R66 A;  1BNP A;  3KHR A;  9ICB A;  3RAQ A;  2ISP A;  4M0A A;  1SZP A;  5KFG A;  1RZT A;  4KLF A;  7ICT A;  9ICS A;  5CB1 A;  5HHH A;  3NGD A;  7ICQ A;  4ECT A;  3KTQ A;  1YLQ A;  4I2D A;  4BWM A;  3C1Y A;  4ECX A;  2NRK A;  3GQC A;  2HVH A;  5IIO A;  4UBC A;  2V4R A;  4EZ9 A;  4IQW A;  5EWG A;  4RQ5 A;  1U47 A;  1NKC A;  3PX0 A;  4O3N A;  5D4B A;  3MAB A;  3H7I A;  3TFR A;  1ZQW A;  3HWT A;  4MEX A;  3H37 A;  4I2I A;  2PI5 A;  4MEY A;  4ED7 A;  2XY5 A;  1RYR A;  2KZZ A;  5DBB A;  1ZQI A;  3E2E A;  9ICJ A;  1Y88 A;  4XQ7 A;  4QZ8 A;  2BE3 A;  2IHM A;  3TFS A;  5HNK A;  5DQG A;  8ICE A;  4E0D A;  5KT3 A;  8ICS A;  4QWE A;  1KEJ A;  4KLE A;  4IQT A;  1RXV A;  4NXZ A;  1NK9 A;  2W9M A;  3Q8P B;  4FHW A;  3TI0 A;  1Q78 A;  5KG3 A;  4RQ8 A;  2ISO A;  2KZ3 A;  5KFE A;  3ZDE A;  5L1J A;  2BPF A;  3Q8L A;  2FMQ A;  4DS4 A;  3TAQ A;  2BDP A;  2ALZ A;  4TUS A;  3V6H A;  2XCA A;  4F5R A;  9ICX A;  3AUO A;  3SZ2 A;  7ICL A;  4FH3 A;  1NK5 A;  5KFS A;  4RQ3 A;  4HYK A;  5CA7 A;  2W9A A;  1ZQA A;  3HJ1 A;  1S9F A;  4ECV A;  4C8K A;  3GIJ A;  3OV7 A;  4DQS A;  3JPT A;  3M9O B;  2R8J A;  2XY6 A;  1UT5 A;  1S0N A;  1MIV A;  1UT8 A;  4RQ1 A;  4X4T A;  2ZH8 A;  2ZH7 A;  3WFQ E;  2AGO A;  4QZI A;  1L3U A;  4KLJ A;  3RJJ A;  4EBD A;  5J2G A;  1SL0 A;  4ED8 A;  4O3O A;  4RNM A;  3AU6 A;  8ICW A;  4F91 B;  1ZQL A;  3RTV A;  4NLG A;  9ICQ A;  4XQ8 A;  4I2J A;  1HUO A;  4J9O A;  2HVI A;  4QZB A;  4M6W A;  3QZ7 A;  4YN4 A;  5J0W A;  2GWS A;  4DQP A;  5KT4 A;  2M2T A;  4E8F A;  4YR3 A;  3BDP A;  4NM1 A;  3LQC B;  3EWA A;  2V9W A;  1RPL A;  4F4X A;  2F1J A;  3G6X A;  5IIJ A;  2PBE A;  5J0T A;  1VFG A;  2XGP A;  1XSP A;  4QZC A;  5J0Q A;  1C7Y A;  9ICP A;  2KN7 A;  4NLZ A;  2RDJ A;  1S0V A;  1TAU A;  1S10 A;  4X4U A;  3C5G A;  1B22 A;  4DF4 A;  2R8H A;  2I9G A;  4TUQ A;  3V7K A;  5KFL A;  1NK8 A;  1JQR A;  3C21 A;  5DDM A;  4DS5 A;  3BJY A;  3JPS A;  3Q8K A;  2DVI A;  8ICG A;  5IIN A;  4ED1 A;  4DL6 A;  3LWL A;  2Q66 A;  2A1J A;  1ZQN A;  3OSN A;  5KT5 A;  4EYI B;  3PNC A;  3RRG A;  1S0O A;  7ICK A;  1MC8 A;  3C66 A;  3RB0 A;  4DFJ A;  1WCL A;  4M9G A;  4RNN A;  4RQ2 A;  2B21 A;  3Q8R B;  1ZQV A;  3GV8 B;  3H3A A;  7ICO A;  1NK6 A;  4R8U B;  5KT6 A;  2KFZ A;  9ICK A;  1KNY A;  1R8B A;  4B9S A;  3RH6 A;  5KG4 A;  1BPZ A;  1JAJ A;  4KLD A;  1LB2 B;  3N97 B;  2FPM A;  4ECZ A;  4M9L A;  1S76 D;  3MGH A;  2AJQ A;  2XY7 A;  4TUR A;  5CJ7 A;  5KFA A;  4PGQ A;  3MBY A;  4UB4 A;  3GIK A;  9ICV A;  1ZET A;  5KFO A;  5C5J A;  1Z3E B;  5JUM A;  5KT2 A;  2ZH9 A;  5KTQ A;  1KLN A;  9ICA A;  7ICI A;  4DEZ A;  5KG2 A;  1JIH A;  2NRT A;  3T5L A;  2UVR A;  3OVS A;  4M2Y A;  2BQU A;  4BDP A;  1IM4 A;  8ICR A;  2R8G A;  3H8J A;  4JV2 A;  5J0P A;  1NOM A;  2MAX A;  3PW0 A;  8ICY A;  4YP3 A;  3BQ2 A;  3TQ1 A;  4DWI A;  3EZ5 A;  2P6R A;  1MIY A;  4EBE A;  1L3S A;  4C8N A;  5CR0 A;  5J2C A;  4ECS A;  3RBE A;  4DL5 A;  4JV1 A;  4O5K A;  4ATB B;  5DQH A;  4AT7 A;  2HHU A;  4RQ7 A;  5L1L A;  2BQR A;  2C28 A;  1TK0 A;  3MDC A;  1TAQ A;  4DO9 A;  4C8L A;  3BQ0 A;  1QSL A;  4JWN A;  3OVA A;  4ECW A;  1L5U A;  2M9N A;  5J2F A;  2ASL A;  8ICZ A;  5DBC A;  4UAW A;  4M6W B;  4BWJ A;  3PX6 A;  3AU2 A;  1RXW A;  4LVS A;  4KLM A;  9ICE A;  3C18 A;  3WFS C;  8ICH A;  4FHP A;  1B43 A;  4F8R A;  8ICO A;  4WC5 A;  2R8K A;  5DED A;  9ICF A;  4F4Z A;  4QWC A;  4QW8 A;  3PW4 A;  3JYY A;  8ICK A;  4K4G A;  1BPB A;  5HC9 A;  2FLL A;  2BQ3 A;  2I1Q A;  4TQS A;  2KFN A;  8ICV A;  3JPP A;  4WC3 A;  3UXO A;  1KSP A;  5KFT A;  4ELU A;  2FLN A;  1L3T A;  4RUA A;  4UB1 A;  4ECQ A;  1DK2 A;  7ICN A;  4GC6 A;  2P6U A;  4JV0 A;  3LWM A;  4KIT B;  1KFS A;  4I2G A;  3TAP A;  3RH4 A;  1KDH A;  4R63 A;  5KFW A;  2JEF A;  2BPC A;  4IRK A;  4R8U A;  1ZQT A;  5KG7 A;  4J9Q A;  5J0U A;  4KLI A;  4WC0 A;  2A1J B;  3V7J A;  5F2V O;  4FBT A;  2LYH A;  4TUP A;  4GC7 A;  2OWO A;  2BCV A;  2ZTD A;  5DBA A;  3OJU A;  8ICQ A;  5HRL A;  4ELT A;  3IHQ B;  2PFO A;  8ICU A;  3OUY B;  4UBB A;  1RYS A;  3GV7 B;  1VJ7 A;  2ZHA A;  4X4Q A;  4QZD A;  4C8O A;  4DQI A;  4O5C A;  1R8A A;  2IMW P;  3RB6 A;  4YMN A;  1H38 A;  4M9J A;  7ICR A;  4J9L A;  1MQ2 A;  5KG0 A;  1NJX A;  4YQW A;  4ED0 A;  4F93 B;  1S0M A;  1ZQD A;  3JPN A;  1XC9 A;  1U48 A;  3KHH A;  5KFC A;  4QW9 A;  4YD1 A;  3MDA A;  1NJZ A;  2FMP A;  4K4I A;  3ZD9 A;  3ZDA A;  9ICH A;  1SL1 A;  4X5V A;  4YXM A;  2DPI A;  4E7X A;  3QEA Z;  4P2H A;  3MGI A;  4DSL A;  4XA5 A;  1HUZ A;  4I2C A;  1Z00 B;  2BCU A;  2VA8 A;  4WC6 A;  4Q8E A;  3UQ2 A;  5KFH A;  4FHY A;  3K4G A;  4RQ4 A;  2V4Q A;  7ICH A;  5HHI A;  1TK5 A;  1JMS A;  5KFY A;  1UA0 A;  2AGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...