5J0TA

Binary complex crystal structure of dna polymerase beta with g:a mismatch at the primer terminus
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
330
structure length
327
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 109
structure length 327
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0tA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0tA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0tA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0tA03
2BCQA 4EYHB 3JPRA 1TVAA 1BPEA 1SL1A 3RB0A 2O1PA 1UEUA 1WOTA 1XSPA 2ALZA 1U4BA 1S10A 8ICUA 4E80A 5HMMA 4DSEA 3OVSA 4UQGA 4JWMA 1TFWA 3TAPA 7ICIA 8ICWA 4FS2A 9ICHA 5HHHA 3SI8A 4R66A 1TAQA 5KT7A 1ZQXA 4F5NA 7ICSA 2P66A 9ICXA 9ICLA 8ICJA 1MC8A 4GC7A 4PPXA 5KT6A 8ICFA 1NK9A 3K75D 7ICEA 2RDJA 5CA7A 4RU9A 4EBEA 1KEJA 4B9VA 9ICPA 4RWQA 4WC1A 3OSPA 2ZH3A 5J2GA 2W8LA 2HVIA 3H39A 4EBJA 1NK7A 4M9HA 4ECXA 7ICFA 5HRGA 1Q79A 4FHPA 3GDXA 4PHAA 4E8FA 1XO1A 4RT2A 2NRVA 5DB7A 7ICNA 3H8JA 5HRKA 4X4VA 2ZTEA 4PH5A 4EYIB 1NK0A 2J6UA 5BOMA 2XO7A 3AU6A 5DKWA 4F91B 5J2IA 1HUOA 4QWBA 1UA0A 3ZDDA 4NLKA 3LWLA 7ICKA 2M2WA 1R8AA 4M6WB 1AROP 4RNNA 4QZGA 4NM2A 3V6HA 3PY8A 2ZJAA 5TZVA 3OVAA 5J0RA 5KFOA 1NKEA 8ICEA 1UT5A 1ZQZA 1L5UA 2BPGA 1XU4A 4YVZA 2ASDA 1NK4A 5DG7A 4R64A 7ICPA 8ICQA 3HW8A 1PZNA 4KLUA 3TANA 2PI5A 4Q8FA 2XCAA 4KLEA 4WBZA 3LWMA 4I2JA 5J2EA 2H5XA 2AGQA 5HR9A 2AGPA 5DB8A 4F5RA 4M04A 1VJ7A 1DK3A 2HHQA 5DDYA 4M0AA 5J2HA 2ASLA 4EP7A 3RH6A 4RZRA 5EWFA 4F4KA 4R8UA 1PX5A 4J9OA 2BQRA 1A76A 5HRDA 8ICSA 3N4MB 2LYHA 2BCSA 1DOQA 4RQ3A 3HWTA 2NRXA 3FDSA 2PXIA 2AQ0A 2FPKA 5J0SA 4UBBA 4GXKA 1V9PA 4DS5A 2JEFA 3GIKA 2R8GA 3UQ2A 5HRFA 4KN7A 2HHPA 3MR5A 3PW7A 1MQ3A 4NM1A 3H38A 1K1SA 4TURA 1UA1A 4XRHA 1QTMA 4AT9B 2V4RA 3PR4A 4J9QA 4GC6A 4NKUA 9ICKA 5KFBA 5J0TA 2FLPA 3G6XA 4K4GA 2J6SA 4M47A 3RB3A 4F93B 4X4UA 4KITB 4ECWA 4WC3A 2BQ3A 8ICXA 5CB1A 9ICGA 1X9WA 3MR3A 3BQ1A 4DL7A 4BDPA 4UB3A 3BJYA 3SZ2A 9ICQA 5KG5A 1CUKA 1WCLA 8ICGA 4WC0A 5KFGA 1XSNA 1HUZA 4KLIA 1DK2A 4DFJA 1ZYQA 4KLOA 4LZDA 1SL0A 3NTUA 5HRLA 5KFAA 3TFSA 4M2YA 1JQRA 4XQ8A 4KTQA 1D8LA 1ZQPA 5KFVA 2UVVA 4O9MA 5J2JA 4DO9A 4RNOA 3MFHA 3QEBZ 3RB6A 4NLNA 9ICUA 4S3NA 5D46A 1DGSA 3Q8LA 3C1YA 4MFFA 3GIJA 4M5DA 1S0MA 2O5AA 4I29A 4QWCA 4O3NA 1L3TA 3PMLA 2C2EA 5DDMA 4YR2A 3B0YA 1S0OA 3Q8MA 5IIMA 3G6YA 3JPQA 2JZBB 2P6RA 5KG1A 2HHWA 7ICVA 3M9MB 3OHBA 4RWOA 4LZGA 2GWSA 2P6UA 1ZQUA 3NGDA 5J2KA 2I9GA 1ZQKA 4DL5A 3RR8A 1Q78A 4FBUA 1KTQA 3QZ8A 4DL3A 1U45A 3BQ2A 4ECSA 1MIYA 3GFKB 3EPGA 4DQPA 5DQHA 1BGXT 2NRTA 2NRWA 2ZTDA 4DS4A 3T3FA 4F5PA 5HP4A 3EWAA 4RQ0A 4IG8A 3PW0A 1L3SA 3C21A 3H4DA 1U48A 8ICAA 4NKTA 5DQGA 1VFGA 3Q8QB 4Q44A 3QEAZ 4ECRA 2KZZA 4E0DA 5HRBA 2ZH9A 2XGPA 8ICBA 4GLXA 3PNCA 4DOAA 4FS1A 4GXIA 2RDIA 2J6TA 2AQ4A 4RPZA 1WCNA 3PO5A 2UVWA 4F4YA 4WC5A 3IM1A 1NJWA 4RNMA 3JYYA 1LV5A 5CWRA 2FLNA 4ED1A 2DR8A 4ED2A 3UXOA 5KG6A 1XS9D 4YCXA 1NK6A 4TUSA 4NLGA 8ICCA 3C2KA 1ZQDA 4DSJA 1ZQOA 8ICPA 4RWNA 5DB6A 5DGAA 4ED8A 3C1ZA 5CHGA 1SKWA 1BPXA 2W9BA 4E7XA 5F9NA 2R8HA 2M2VA 4IQUA 3H8SA 4ECVA 3OSNA 4IRKA 3V72A 3SYZA 7ICJA 2DRBA 2JZBA 3WFRE 1H38A 9ICNA 3V7KA 4PHDA 5DLFA 3T5LA 5CJ7A 1QSLA 2IHNA 2UVRA 4AT8B 2Q66A 4MFCA 2BQUA 4WBYA 1ZQCA 2FMPA 5J2CA 2XY7A 2KZMA 5CP2A 4ED7A 2BCUA 3V6JA 1D9FA 4JK1A 4YN4A 5EWGA 5HRIA 1Z00B 3H40A 3HIYA 3UXNA 2DR9A 1EXNA 5L1IA 4DQQA 1S0VA 3TARA 2PI4A 4C8OA 2PBEA 4X5VA 4J9MA 4KMUA 4I2DA 3L9DA 4YMOA 2FMQA 5KFYA 4AT7A 3ETLA 4B9NA 4I2BA 4O3SA 2ZH5A 3BQTA 4RQ7A 3RJKA 4QZ8A 4XA5A 1F5AA 3ZDCA 3PR5B 4EBDA 1ZQQA 4C8LA 4PHEA 4P4PA 2V9WA 4F2SA 5KFEA 9ICWA 4TQRA 5DG9A 2VANA 5DECA 1MSWD 1ZQGA 1TV9A 3V7JA 3NYBA 2AGOA 4F4WA 4ZH4A 3RAQA 3GV5B 4B9MA 3JPTA 3RH4A 9ICTA 2BR0A 3C18A 4BWMA 2F1HA 3EZ5A 2DFLA 3OJUA 3KHLA 1ZETA 1D9DA 5EOZA 2UVUA 2BGWA 2A1JA 4QZHA 4RUAA 1TK5A 3RRGA 3AUOA 4DQIA 2M2UA 2ZH1A 2W9BB 3T5HA 4J9KA 4EBCA 4QZBA 7ICGA 2XY5A 3PO4A 3MR6A 3V7LA 3SV3A 2V4QA 3N97B 3OJSA 3OV7A 5BPCA 4YQWA 4Q45A 5KFDA 8ICTA 5KT4A 8ICZA 4ELTA 4X4QA 8ICLA 3EYZA 4K4HA 3PMNA 3OUYA 5KFMA 1UETA 4ED3A 4DQRA 4IR9A 4F4XA 1QLNA 1C7YA 2BKEA 4O3PA 4YXJA 4YR0A 1ZQAA 3HX0A 8ICKA 3JPPA 2VA3A 1KSPA 5KTQA 3PX4A 4FBTA 4Q8EA 3MFIA 5J2FA 3ZDBA 5IINA 5IIKA 4DSLA 3ZDEA 1BPZA 4I2HA 4DF8A 5D4BA 2ZH6A 1T3NA 2DRAA 2VA8A 4QW8A 5J0XA 4RQ6A 4DOBA 3C2LA 1U9LA 1ZQYA 2Y1IA 1NJZA 4JV2A 5DQIA 4IQTA 3T5JA 3ZD8A 5KT3A 4J9NA 1ZQLA 5KFUA 3HP6A 5J0UA 4QZFA 3RRHA 4O0IA 9ICVA 3RJFA 5DB9A 4ATBB 4MFAA 4ED6A 2BDPA 2KTQA 1YLQA 1QSYA 4G3IA 2AJQA 4ECYA 4IRCA 4WC6A 2M9NA 5KG7A 2B21A 4IQWA 2ZJ5A 2PFPA 3OGUA 2R8IA 4RQ5A 4K4IA 4JWNA 4F2RA 1RPLA 1JXLA 5F2VO 4J9PA 5J2DA 4RPXA 2MAXA 4ECZA 4J9LA 2R8KA 2ZH7A 1S77D 1IXRA 4AT8A 4F50A 5KFQA 2FMSA 4EZ6A 3ISBA 1KLNA 4RQ1A 2ISOA 4LT6A 2W8KA 4WCWA 4UB1A 3MDCA 4ELVA 4MF8A 2MUTA 2HHUA 1XWLA 4EBKA 4M9GA 2ZUDA 3M8SA 4QWEA 4R65A 1V4AA 3BQ0A 4ECUA 2XCPA 2W9CA 4DL6A 4KLJA 2BPCA 1TFRA 4YFKA 4Z6EA 2W9AA 4C8NA 2XY6A 3LQCB 1NK8A 4JV0A 3Q8KA 5HNKA 5BOLA 1HJPA 3C5GA 1ZQTA 2PFQA 4B9TA 4IR1A 5HREA 1MIWA 4FHVA 7ICOA 4YG2A 4M9JA 8ICIA 2C28A 5KFCA 4DFMA 3AQLA 3MR2A 4PGXA 4QWAA 3PW2A 1L3UA 8ICMA 3AQMA 5DLGA 4KLMA 1ZQEA 5IIJA 4KLTA 1S97A 2ATLA 1R89A 4YP3A 3GIIA 4FH3A 4KLHA 4FHWA 3WFPA 2DVIA 4PGQA 4C8KA 3TI0A 3RJEA 4O3QA 3H3AA 4PHPA 3RTVA 3UXPA 1MIVA 2ZH4A 5KFWA 7ICQA 1N48A 3ZDAA 2F1IA 4O5EA 2HHVA 3RJGA 9ICIA 3GV8B 4WC2A 2DR7A 4YMMA 1ZQBA 4KLDA 4MEXA 4X0AA 3SV4A 4Q43A 3KHHA 1KNYA 2M2TA 3UPQA 1NOMA 2ID1A 3PX0A 1JX4A 2BCVA 1NO5A 3MDAA 4ECTA 1NZPA 9ICFA 2W9MA 3RJJA 5KFSA 2IMWP 1JAJA 9ICRA 4UAWA 1NJYA 3PW5A 2BPFA 2IHMA 4I27A 2WTFA 3MGHA 2BHNA 4B9UA 2XC9A 1S0NA 1ZQJA 4DF4A 5J0YA 4KLGA 2KFZA 4UD5A 4YD2A 5D49A 1T4GA 3GV7B 1A77A 4DFKA 1TK0A 4UB2A 4R63A 2ZTCA 1JXEA 3GIMA 3M9OB 4J9SA 5J29A 1BPYA 7ICTA 8ICVA 4YMNA 3B0XA 4YD1A 4KLQA 3UPSA 3Q8RB 7ICRA 1RYRA 4P4MA 7ICMA 2JEJA 4RWPA 1BPBA 4UBCA 4ED0A 4FH5A 4DSIA 1JN3A 1Z00A 1XSLA 1X2IA 1U49A 4UB4A 2FPMA 4Z6CA 2DPIA 1T7PA 2DR5A 4QZ9A 2R8JA 4GXJA 5KG0A 4F92B 9ICJA 5DG8A 4J9RA 7ICUA 4XUSA 3C2MA 3M9NB 5KT2A 4RQ8A 3ISCA 3RJHA 3Q8SB 4F5OA 1LB2B 2I1QA 1ZQVA 2HHSA 4FHXA 8ICYA 4RUCA 2BE3A 4UB5A 5J0WA 2MUTB 4RQ4A 2ZH2A 1TAUA 2HHTA 3QE9Y 2Q0ZX 1B43A 5KFKA 4DWIA 9ICEA 2FLLA 3HJ4A 5F9LA 4QW9A 5C5JA 1ZJNA 4QZCA 2BCRA 4M6WA 1T8EA 4RT3A 5KG4A 3TFRA 1ZQHA 2C22A 5HHIA 3ISDA 2ZJ8A 3LDAA 3GQCA 3OVBA 2OWOA 1RXWA 1CEZA 3MGIA 1N56A 2RFFA 4DL4A 1ZQIA 4X4OA 4Z6FA 1SZPA 2ZUBA 2Y1JA 4I28A 5J0QA 4ECQA 1ZQNA 4BXOA 4BGDA 1NKCA 1U47A 2ISPA 1XC9A 9ICBA 1R8CA 4IRDA 3HPOA 5J2BA 4P4OA 4F5QA 3KHGA 3C5FA 8ICOA 1COOA 4KLFA 3AQNA 1S76D 4RPYA 5KFXA 1L3VA 4F8RA 1KFDA 4TUQA 5KFIA 4P2HA 4MEYA 3TAQA 1NKBA 3H8WA 5CR0A 4TQSA 4FO6A 3TQ1A 1UEVA 3RJIA 4WC4A 1UT8A 3IHQB 4I2GA 5KFTA 4M9LA 1K1QA 1B22A 1SL2A 4EEYA 5J0PA 5J2AA 3RBEA 1NJXA 4QZDA 4I2FA 4X4PA 3G6VA 1RXVA 3OUYB 3JPSA 5KT5A 1QSSA 3RB4A 3HT3A 4DQSA 3PX6A 4KLSA 4RQ2A 3UQ0A 4MF2A 4O5CA 4NLZA 1TKDA 9ICMA 1FA0A 1ZQMA 1X9MA 3H7IA 5IIOA 4C8MA 4XQ7A 4WC7A 4UD4A 3E2EA 2F1JA 3OHAA 1IM4A 1D8YA 3WFQE 3KHRA 3PW4A 2W9CB 3THVA 1TK8A 3C66A 4X4RA 3BDPA 2JEIA 1OU5A 4I2IA 2IBKA 5KFJA 2PFNA 1X9SA 4EZ9A 5DBCA 8ICRA 3WFSC 5L1KA 1ZJMA 1NK5A 5L1JA 2NRZA 4I2AA 5KFZA 3GILA 5HC9A 4X4TA 4F3OA 3PVXA 2HW3A 1Z3EB 3RH5A 4DLGA 4B9SA 4NXZA 4HYKA 3RR7A 2KZ3A 4DEZA 5DBAA 4DL2A 1KDHA 3RAXA 1KFSA 1BNPA 2ZHAA 9ICAA 2ASJA 5L1LA 5DGBA 4BWJA 1ZQSA 3FYHA 4YR3A 5KFFA 8ICNA 3LK9A 4BXOB 3K4GA 2ZHBA 4O3OA 4IQVA 2A1JB 4DSFA 1KRPA 4AT7B 1MQ2A 4KLLA 4QZIA 4UAZA 3QZ7A 2FPLA 3AQKA 3EPIA 4I2EA 2ZUCA 4AT9A 3JZ0A 3ZD9A 4DOCA 4ATBA 1S9FA 4TUPA 3WFOA 5IILA 3JPNA 5HRHA 2ZH8A 5KG3A 5L9XA 4UAYA 1JIHA 4QZEA 4QZAA 5EWEA 2DPJA 1SKSA 4JUZA 4Z6DA 9ICCA 8ICHA 2VA2A 5HMLA 1TFYA 5KFRA 5KFPA 4CCHA 5DEDA 2C2DA 4LVSA 3EW9A 1ZQFA 3H4BA 5DBBA 3C23A 4X4NA 3JPOA 5IIIA 1BVSA 5KFHA 1RYSA 5KFLA 5JUMA 2XGQA 5KFNA 4DSKA 5KG2A 2KN7A 4DLEA 2KP7A 4KN4A 4YXMA 4M9NA 1ZQRA 3M8RA 2PFOA 1JMSA 1ZQWA 2AU0A 4X0BA 4NY8A 4DFPA 4QWDA 3HJ1A 1RZTA 3KTQA 4FHYA 1Y88A 4F4ZA 4I2CA 3ORYA 4O5KA 9ICSA 1KFTA 1BNOA 1SKRA 3PV8A 4B9LA 4X4SA 2JEGA 7ICHA 7ICLA 2HHXA 2C2RA 3V6KA 4O3RA 3T5KA 2KFNA 1R8BA 3H37A 3Q8PB 3MABA 5J0OA 3MBYA 3RBDA 4ELUA 4PGYA 9ICOA 4JV1A 2HVHA 2NRKA 2IA6A 3AU2A 1BPDA 4R8UB
chains in the Genus database with same CATH superfamily
5JU5A 1TVAA 5AIBA 3RB0A 2O1PA 5AKZA 4E80A 4DSEA 4UQGA 3TAPA 4HAIA 5HHHA 7ICSA 5A0LA 3NVYA 4GC7A 8ICFA 4EBEA 5J8YA 3CW2C 5AM1A 2QB0B 1S5LU 3NVOA 4ECXA 4FHPA 3GDXA 4PHAA 1SWWA 4RT2A 5DB7A 2ZTEA 5J2IA 3ZDDA 3WK8A 4QZGA 4NM2A 3OVAA 1C20A 1ZQZA 3L5KA 1XU4A 1F0MA 5DG7A 7ICPA 4Y2PA 2PI5A 4M0AA 1WWUA 2ASLA 4CE6A 4EP7A 3O0FA 2BQRA 1V85A 3N4MB 4RQMA 1UPHA 3HWTA 2NRXA 1COKA 2AQ0A 4UBBA 2B6GA 1V9PA 2L5YA 4IL6U 4KX5A 2V4RA 4J9QA 2DGZA 5J0TA 3RB3A 4C4TA 4WC3A 2BQ3A 3LVVA 3MR3A 3BQ1A 1X42A 4LEZA 3FM9A 1ECWA 4EX7A 5AK5A 5KFAA 1IV8A 1JQRA 1D8LA 3AQFA 1UHUA 4DO9A 3QEBZ 4NLNA 4C7ZA 1AQ6A 4XJEA 4K9AA 2MRLA 4O3NA 1S0OA 4YR2A 5IIMA 3F2CA 4QIWC 3OHBA 1ZXIA 1ZQKA 2KJ9A 4FBUA 2FCLA 1MIYA 5DQHA 2NRTA 1NNLA 5B5EU 3I28A 3T3FA 3KZIU 1L3SA 4NKTA 4C0ZA 4DCCA 4Q44A 3QEAZ 4E0DA 1Z19A 4DOAA 4RPZA 2UVWA 1NJWA 3TACB 4RNMA 2DR8A 4NLGA 5ALVA 3C2KA 2K60A 8ICPA 4RWNA 4ED8A 3C1ZA 1NZBA 4PZNA 2R8HA 4IRKA 5ALXA 1H38A 3V7KA 5DLFA 2WF7A 1QSLA 5CJ7A 2UVRA 4WH5A 2BQUA 1ZQCA 5J2CA 4O68A 4ED7A 3V6JA 3AM9A 3WK6A 3TARA 2H3ZA 3ICXA 2FMQA 4B9NA 4O3SA 2F44A 2ZH5A 3PR5B 2EZYA 5DG9A 3IG5A 4ZH4A 5CFTA 4BWMA 2DFLA 5EOZA 2BGWA 2A1JA 3RRGA 5B3PA 4ZOHC 4DQIA 2ZH1A 4J9KA 1N61A 2LBOA 7ICGA 4IS7A 3PO4A 2V4QA 3OJSA 3HKZF 3PSFA 5KFDA 5KT4A 3PMNA 3OUYA 3RF9A 4ED3A 1MA7A 4IR9A 4O3PA 4YR0A 3BS7A 3HX0A 1SGGA 5KTQA 2EAMA 4Q8EA 2FJ6A 5IINA 1L7PA 3ZDEA 4BUGA 2VA8A 5J0XA 4EV6A 5DQIA 5HR6A 4ACOA 4J9NA 4FFDA 9ICVA 4ATBB 4ED6A 1QSYA 2AJQA 4K4IA 1VJ5A 4J9PA 4RPXA 4ECZA 1XNSA 1S77D 1IXRA 4AT8A 4F50A 1X40A 3ISBA 5E79U 1FEZA 2F8KA 2W8KA 4WCWA 4UB1A 3KKAA 2HHUA 2JRZA 4EBKA 3M8SA 2I5HA 2K4EA 4ECUA 3SR6A 4DL6A 3E58A 4EEKA 2BPCA 3S6JA 5BOLA 2PFQA 4B9TA 1FIQA 2C28A 5KFCA 3AQLA 4NXTA 3MR2A 3PW2A 5TISU 4BX9C 3F53A 1R89A 4YP3A 4FH3A 2EWRA 1OUQA 4O6AA 5KFWA 3DDHA 5AKLA 9ICIA 1SV0C 1ZQBA 4MEXA 3SV4A 4CF3A 1KNYA 3UPQA 3PX0A 3MDAA 2WB1F 2ZIVA 5AKIA 2IMWP 1JAJA 2KHQA 2XIDA 2BPFA 2WTFA 1RQLA 2G0AA 3QNMA 4B9UA 2H3VA 2ZIUB 4DF4A 4KLGA 4UD5A 3GV7B 4R63A 3LYSA 1JXEA 3QU7A 5GTHU 5CEHA 5J29A 1YT3A 4YMNA 4KLQA 4KM5A 5KL8B 3VCBA 7ICMA 1N5WA 5AKJA 5JTGA 3M6KA 1XSLA 1U49A 4UB4A 2FPMA 3CP8A 5AI4A 4F92B 4J9RA 2B4VA 1ZQVA 3M6ZA 2HHSA 2G08A 5ALFA 3AEVA 4RQ4A 3QE9Y 2Q0ZX 1B43A 1K5OA 4DWIA 9ICEA 2FLLA 3SAHA 5ALGA 1ZJNA 1T8EA 1ZQHA 2G06A 2OWOA 4OJOA 2RFFA 1ZQIA 4JMUA 1QQ7A 4NXXA 4X4OA 4N7RA 2IOFK 4I28A 5J0QA 1ZQNA 2O6KA 4BGDA 1NKCA 1XC9A 2N1RA 1R8CA 4IRDA 3HPOA 3QU5A 1COOA 4LJXA 2ZIXA 1L7NA 5KFIA 4P2HA 3ERCC 4UARA 1UEVA 3IHQB 5AI9A 1K1QA 1SL2A 5J2AA 1PVRA 4QZDA 4I2FA 3JPSA 3RB4A 4KLSA 2KSOA 1ZQMA 4XQ7A 4WC7A 5IIOA 4C8MA 2ZIUA 4UD4A 2CRXA 1WYGA 1D8YA 3IV6A 3WFQE 3THVA 5AM2A 1OU5A 1X6JA 4P0PA 5KFJA 2W11A 2PFNA 8ICRA 5L1JA 2ES6A 5D63A 2K89A 4B9SA 2ZHAA 2ASJA 4YR3A 4CDGA 2LM4A 1KRPA 2A1JB 2K4HA 1SZHA 4KLLA 4UAZA 3AQKA 3ZD9A 1S9FA 5HRHA 4C4RA 4UAYA 1JIHA 4QZAA 5EWEA 2KV2A 2W7OA 5KFPA 5DEDA 4OO1J 2GO7A 1L7OA 4ICAA 5IIIA 4YXMA 3NUQA 4X0BA 3BZKA 1JUDA 4QWDA 4OCZA 4F4ZA 4I2CA 9ICSA 1KFTA 2KJ5A 1KL9A 1RG6A 1TE2A 1R8BA 4O3RA 2KFNA 5ALPA 4PGYA 2NRKA 2HOQA 3N7PD 1T3QA 5KL1B 2IA6A 3AU2A 1BPDA 2BCQA 4EYHB 3JPRA 2CXYA 1BPEA 1SL1A 1SB3C 1S10A 1U4BA 2JGAA 2Z7JA 5HMMA 3OVSA 9ICHA 3SI8A 2ZIWA 4R66A 1TAQA 4F5NA 9ICXA 1MC8A 4PPXA 7ICEA 3SAFA 4RU9A 1Q3UA 4B9VA 9ICPA 4WOYA 2M0NA 2Y0SC 1Z4OA 1NK7A 3F2DA 1Q79A 4JLXA 2EANA 3H8JA 2XO7A 3AU6A 2MU2A 4F91B 1QQ6A 4QWBA 4M6WB 3PY8A 5J0RA 2B56A 2F2AB 1NK4A 5EE9A 2OM6A 3A0HU 3TANA 1ZOLA 2XCAA 4KLEA 3H0MB 2H5XA 5DB8A 3C28A 3RFAA 4RZRA 4F4KA 4NV0A 3KBBA 8ICSA 2LYHA 1GPJA 4U6PA 5AKHA 2E8PA 5F3XB 2FPKA 2ZIWB 3NVWA 2R8GA 3UQ2A 4CGZA 2HHPA 1K1SA 2PKEA 1UA1A 4NKUA 4GC6A 4B6JA 2CPRA 2J6SA 4KITB 3KZXA 9ICGA 8ICXA 1Q46A 4DL7A 4UB3A 4WC0A 4KLIA 2KOBA 2RP5A 4LZDA 2HBMA 1SL0A 4M2YA 4XQ8A 4KTQA 1ZQPA 2UVVA 5KFVA 2MSNA 2EAOA 4RNOA 3MFHA 9ICUA 4S3NA 3Q8LA 3C1YA 4QWCA 1L3TA 3B0YA 3G6YA 1VLBA 7ICVA 1ZQUA 2KHVA 1Q78A 3QZ8A 4ECSA 3QYPA 3EPGA 2E8NA 2ZTDA 2EZXA 4P0PB 4F5PA 2ODGA 3EWAA 4IG8A 2DKZA 3C21A 3H4DA 1U48A 8ICAA 1KQQA 5HRBA 2XGPA 4GLXA 3EUB2 1ZRMA 1V97A 4GXIA 2DUYA 2AQ4A 1WCNA 3PO5A 4PL2A 5AI8A 3JYYA 2FLNA 5KG6A 4YCXA 2A1AA 4TUSA 8ICCA 1ZQOA 5CHEA 5DB6A 1SKWA 5CHGA 4NXWA 2W9BA 4E7XA 4US9A 4IQUA 3H8SA 4ECVA 2JZBA 3IG8A 3WKCA 9ICNA 4NXUA 5J8YC 4OJ5A 5FP0A 5CP2A 4JK1A 5EWGA 5HRIA 3UXNA 2DR9A 1S0VA 4Y2YA 2PI4A 4O67A 3J81j 5HR7A 2E8OA 3L9DA 4GFJA 4YMOA 5KFYA 3ONNA 3BQTA 4RQ7A 2EAPA 1NI3A 4JB3A 3ZDCA 4P4PA 9ICWA 4TQRA 2VANA 2GA9D 3NYBA 5C0YA 2AGOA 4O3MA 4O69A 4F4WA 3RAQA 3GV5B 4EGWA 3JPTA 3RH4A 2QKQA 4UW9A 3C18A 3EZ5A 5KAFU 2ZXIA 2HCFA 3T5HA 2XY5A 3N97B 5BPCA 4X4QA 5K4LA 2YQEA 4DQRA 4MHVA 2BKEA 3JPPA 4LEYA 4OAIZ 1KSPA 4FBTA 5J2FA 5IIKA 4DF8A 2ZH6A 1T3NA 1QCKA 2Y1IA 1NJZA 1ZQYA 2F77X 5KT3A 3HP6A 5J0UA 4QZFA 3RRHA 4O0IA 1PVQA 5DB9A 3KFUF 2LYBA 3IDWA 3TADC 4IRCA 2M9NA 4IQWA 2ZJ5A 4RQ5A 1Q3VA 3ER9B 5J2DA 4EZ6A 2FMSA 4RQ1A 5ALHA 3MDCA 4MF8A 2WAQC 4QWEA 1RQNA 5ALYA 1N62A 1F5SA 4KLJA 2KD1A 2W9AA 3LQCB 2QARB 5AI0A 3C5GA 4FHVA 2YX8A 1SXEA 1B4FA 4AYBC 4PGXA 1L3UA 5ALTA 1ZQEA 1SIJA 1S97A 2W54A 2BBHA 3WFPA 2DVIA 4PGQA 4C8KA 3RJEA 1YZ7A 4O3QA 4PHPA 1MIVA 2ZH4A 2ZIVB 7ICQA 2YMQA 4WC2A 5ALOA 4KLDA 4X0AA 4Q43A 2ID1A 1JX4A 3RJJA 2RQ5A 2YB4A 1ZD4A 2E1EA 3QUTA 9ICRA 2IHMA 3NASA 2BHNA 2W43A 2KFZA 2KKVA 4YD2A 1A77A 2AHOB 1Z1VA 4J9SA 1L8OA 2DL0A 3B0XA 2JEJA 4RWPA 1BPBA 2KE7A 1N63A 2EH9A 2R8JA 3EF2A 7ICUA 3C2MA 3M9NB 3KOOA 1HIWA 3ISCA 3Q8SB 4F5OA 1LB2B 2I1QA 5D62A 2E1FA 3OTQA 5J0WA 1TAUA 5KFKA 3NS1A 5F9LA 4QW9A 5C5JA 4QZCA 2BCRA 3TFRA 2C22A 3D2SA 1M6YA 3GQCA 4EX6A 1CEZA 1N56A 4DL4A 4ECQA 2KKPA 3N28A 3KHGA 5KFXA 4F8RA 1KFDA 2EQYA 4MEYA 5ALSA 3TAQA 3WK4A 4FO6A 3H0LB 3TQ1A 5KFTA 1B22A 4EEYA 5J0PA 2K4PA 1LVHA 3RBEA 4X4PA 3B9JA 3OUYB 2IOHA 3HT3A 4DQSA 3PX6A 1FA0A 1X9MA 1N60A 1IM4A 3KHRA 3SQIA 1CI4A 4GIBA 1TK8A 3C66A 4EZ9A 1X9SA 4PJ0U 1ZJMA 5KFZA 4X4TA 3DV9A 5G5GA 4F3OA 2HW3A 1Z3EB 3RH5A 4DLGA 2KZ3A 5ALNA 1KDHA 4F72A 1BNPA 1QH9A 9ICAA 2Y0SF 5DGBA 3FYHA 8ICNA 4HX0A 3K4GA 1L6NA 3AL0B 2ZUCA 5GTIU 2IUBA 4Y2TA 3JZ0A 3QU4A 4ATBA 4TUPA 3WFOA 2ZH8A 4Y2UA 5KG3A 4NLCA 2QB1A 4Z6DA 3R9KA 9ICCA 4U7CA 2VA2A 5HMLA 1TFYA 5AK4A 2C2DA 3H4BA 4X4NA 3C23A 3JPOA 5KFLA 5D61A 2KN7A 1ZQRA 3M8RA 3HRDD 4LEVA 2LM1A 4NWIA 2BZFA 2KVSA 2G09A 4OJPA 3KTQA 2G07A 1Y88A 4FHYA 2BDUA 4O5KA 3ORYA 1SKRA 2K8BB 1N5XA 2HHXA 5J0OA 3MBYA 4ELUA 9ICOA 4WQLA 1WWVA 2KVCA 4K97A 1UEUA 1WOTA 1XSPA 2ALZA 3NVZA 1IIPA 2GH1A 2KG5A 1TFWA 8ICWA 5CFUA 2DWQA 2FDRA 2P66A 9ICLA 3OWGA 1RYUA 4CF4A 5KT6A 3K75D 2RDJA 5CA7A 1FO4A 4RWQA 2ZH3A 2HVIA 4M9HA 3UMCA 7ICFA 5HRGA 4K99A 2HBKA 1XO1A 3BQ7A 2NRVA 3L4PA 5HRKA 4PH5A 1NK0A 3H8MA 5BOMA 1KKXA 5AKEA 2K8AA 2PMZC 1UA0A 2M2WA 1R8AA 2KIVA 2HOFA 2ZJAA 5KFOA 1UT5A 2KIWA 1L5UA 2ASDA 8ICQA 2YB1A 3D2NA 4C7YA 4KLUA 1FFVA 3K1ZA 4I2JA 1DGJA 2AGQA 3WKAA 2AGPA 1PK1A 1VJ7A 2H3IA 1PX5A 5HRDA 5AM4A 2BCSA 1DOQA 3E0FA 2GAFD 2HMXA 4RQ3A 2IOFA 3FDSA 5J0SA 2JEFA 3GIKA 3WK9A 4KN7A 3MR5A 1MQ3A 3PSIA 4NM1A 4TURA 1QTMA 3PR4A 5H2FU 3WK5A 5KFBA 2FLPA 4K4GA 1J97A 2OH2A 4OD0A 4ECWA 5CB1A 4BDPA 4Y2JA 3BJYA 1TAMA 1CUKA 1WCLA 5KFGA 1XSNA 1HUZA 2KEYA 5HRLA 5J2JA 5EE1A 5D46A 4EELA 3UMBA 3U26A 1OXJA 2O5AA 3PMLA 2QB0A 2C2EA 2OCEA 4QIWF 5DDMA 5ALIA 2W3SA 2HHWA 3M9MB 4RWOA 2VJ4A 5AKYA 2GWSA 4LZGA 4DL5A 1KTQA 4FZMA 2KICA 3BQ2A 4DFDA 4G9BA 1JALA 4DS4A 4RQ0A 5AK6A 2A3VA 1VFGA 3Q8QB 1X6IA 5AI6A 4C80A 2OHFA 4F4YA 3IM1A 3QU2A 1LV5A 4MKPA 4ED1A 4ED2A 3MCRA 1XS9D 4DSJA 1GO3F 3C29A 3SAGA 2M2VA 3OSNA 1ZQ1C 1ZD3A 3V72A 2EDUA 2W3RA 3SYZA 7ICJA 2DRBA 2CN1A 4UB8U 2DKXA 3PSTA 4PHDA 4AT8B 4MFCA 4WBYA 2Y9UA 2KZMA 2XY7A 2BCUA 3H40A 1EXNA 5L1IA 4DQQA 2PBEA 2EZZA 4KMUA 4AT7A 1ZD2P 4I2BA 3RJKA 1F5AA 4QZ8A 1ZQQA 4PHEA 2P35A 4F2SA 4F71A 3AN1A 1V38A 2BR0A 1D9DA 1ZETA 1DXSA 2DBYA 5AICA 2UVUA 1PUZA 1TK5A 4QZHA 1VDVA 2M2UA 4EBCA 3MR6A 2RRDA 3SV3A 3OV7A 2A19A 8ICTA 8ICZA 4ELTA 3QXGA 8ICLA 3EYZA 4K4HA 1UETA 5AIAA 1QLNA 2HDOA 4YXJA 2LKYA 1ZQAA 5AHXA 3PX4A 5ALQA 3MFIA 3ZDBA 4DSLA 5D4BA 3WKDA 2DRAA 4RQ6A 3C2LA 4NXVA 2XI9A 4KMOB 2G5IB 2KNJA 5ALEA 3T5JA 2OXOA 1OW5A 3RJFA 4MFAA 2BDPA 4G3IA 4ECYA 4CNQA 3WKEA 5AM5A 5KG7A 4WC6A 3F2BA 4JWNA 4F2RA 1RPLA 5F2VO 4J9LA 5KFQA 3ETRA 3PSPA 1KLNA 4UB6U 2ISOA 1RM6C 2JH1A 4M9GA 2Y9TA 2GLEA 1V4AA 2KMDA 3BQ0A 2W9CA 4LEWA 1TFRA 4C8NA 3Q8KA 1HJPA 3QU9A 4KX3A 2W04A 4YG2A 4M9JA 4WQKA 8ICMA 5DLGA 5AK3A 1ZD5A 4UAVA 3GIIA 4KLHA 2RHFA 1KW4A 2NV3A 3TI0A 3UXPA 3ZDAA 2E3TA 4O5EA 2B51A 2DR7A 4YMMA 3KHHA 1NOMA 2BCVA 4ECTA 1NZPA 9ICFA 2HN1A 2HN2A 4P0QA 2E5SA 4I27A 3PW5A 3MGHA 2XC9A 1S0NA 4DFKA 5D49A 1T4GA 1MN8A 3NRZA 4UB2A 2ZTCA 3GIMA 3M9OB 1BPYA 1ED1A 2WF8A 8ICVA 4IC9A 4YD1A 2KJ8A 2OYYA 3Q8RB 7ICRA 2ZH7A 4P4MA 1Z1BA 3IRUA 4UBCA 4ED0A 4FH5A 1UQVA 1X2IA 3PZPA 1T7PA 2DR5A 3BZCA 4FE3A 4QZ9A 5KG0A 2XVTA 4USAA 5KT2A 2WFAA 1L7MA 4FHXA 3KD3A 2MUTB 2ZH2A 2HHTA 3HJ4A 1A0PA 1Z4NA 4K8VA 4M6WA 5KG4A 5HHIA 3ISDA 4K98A 4C4SA 1SV0A 4RQNA 1SZPA 2Y1JA 9ICBA 2ISPA 4P4OA 4AP9A 3NRWA 4RPYA 3N7SC 3SD7A 1L3VA 2KK0A 4TUQA 2F3NA 1SV4A 3H8WA 5CR0A 4TQSA 3RJIA 2ZXHA 1KBUA 4M9LA 2F76X 3TADA 1NJXA 3G6VA 2YTUA 3HKZC 1QSSA 1WUDA 3ALRA 4MF2A 4O5CA 4NLZA 1TKDA 9ICMA 3MC1A 2FE9A 3H7IA 2WF6A 2F1JA 3OHAA 3PW4A 4X4RA 2I6XA 5EE3A 3BDPA 2JEIA 4FZNA 5KAIU 2IBKA 3WFSC 5L1KA 1NK5A 4I2AA 2NRZA 3GILA 1X9XA 3PVXA 4NXZA 4HYKA 1O08A 4DEZA 5DBAA 4DL2A 1KFSA 3RAXA 1HEKA 4BWJA 1ZQSA 5KFFA 2ZHBA 4O3OA 4IQVA 4QZIA 3QZ7A 3IN5A 4P0QB 2FPLA 1SWVA 5AI5A 4DOCA 5AM3A 5IILA 4QZEA 1SKSA 1ZRNA 2H3FA 8ICHA 5KFRA 3MGVA 4Y2VA 3EW9A 4EEBA 4FZLA 1ZQFA 2K8CB 5DBBA 4Y2XA 2NO5A 1BVSA 2XGQA 5KFNA 3HJEA 5KG2A 4DLEA 2GOLA 4M9NA 2PFOA 1JMSA 4QJFB 4NY8A 3HJ1A 2W7PA 1X66A 3DEEA 3I76A 2JEGA 3ED5A 7ICHA 7ICLA 3V6KA 3T5KA 1J2NA 3QUCA 3MABA 3RBDA 2LPEA 4JV1A 1XO0A 4R8UB 2QARA 2H3QA 4JWMA 7ICIA 4FS2A 5AM0A 5KT7A 1ZQXA 3JCFA 8ICJA 2YMMA 1NK9A 5B3QA 2ZIXB 1KEJA 5ALZA 4WC1A 1WG8A 3OSPA 5J2GA 2W8LA 3H39A 4EBJA 1JRPA 3N7RC 4E8FA 7ICNA 2HSZA 4K9BA 4X4VA 2F8LA 2HI0A 4EYIB 2J6UA 1B0XA 5DKWA 3HILA 1HUOA 4NLKA 3LWLA 7ICKA 1AROP 4RNNA 1PVPA 4NJ8A 3V6HA 5TZVA 3WK7A 1NKEA 4OJLA 8ICEA 3NVVA 5G5HA 4YVZA 2BPGA 4R64A 4JLZA 3HW8A 4OAFA 1PZNA 3SEIA 1Q8KA 5ALDA 4Q8FA 4WBZA 3LWMA 5J2EA 5HR9A 2D6FC 4F5RA 4M04A 5ALUA 1DK3A 2HHQA 4PZOA 5DDYA 5J2HA 2LI6A 3RH6A 5EWFA 4R8UA 2NYVA 4J9OA 1A76A 2VJ5A 4NL9C 2PXIA 1PK3A 3CRXA 4GXKA 4DS5A 5EE0A 4UAUA 5HRFA 3PW7A 3H38A 4US8A 2IHOA 4XRHA 4AT9B 9ICKA 2WAQF 3FAHA 3G6XA 3AQEA 4M47A 4F93B 4X4UA 1X9WA 3SZ2A 9ICQA 5KG5A 8ICGA 4QNLA 3BS5B 1DK2A 4DFJA 1ZYQA 4KLOA 3NTUA 3TFSA 2LMRA 8ICUA 4O9MA 3RB6A 3AMZA 1DGSA 4MFFA 3WKBA 3GIJA 3BS5A 4M5DA 1S0MA 4I29A 3H0RB 3Q8MA 3JPQA 2JZBB 5KG1A 2P6UA 2JV3A 2E8MA 4Y2SA 5J2KA 3NGDA 2I9GA 3RR8A 4DL3A 1U45A 3GFKB 4DQPA 1BGXT 2NRWA 5HP4A 3PHZA 5T14A 3PW0A 3VC8A 5DQGA 5ALLA 4ECRA 2KZZA 2ZH9A 8ICBA 3PNCA 4FS1A 4UASA 1YZ6A 2RDIA 2J6TA 2AXTU 5ALRA 4WC5A 1LKYB 5CWRA 3UXOA 1NK6A 1ZQDA 4EEDA 4BJQA 3F5AA 5DGAA 1BPXA 2YY6A 5F9NA 3L3FX 2JHDA 1T94A 3WFRE 2Q66A 3T5LA 2IHNA 2NO4A 3WU2U 1IG6A 4OJ6A 2FMPA 1D9FA 4YN4A 1Z00B 3HIYA 2LYAA 4C8OA 4X5VA 4J9MA 4I2DA 4Y2QA 3ETLA 4K96A 1RDFA 3OPXA 3F5EA 4XA5A 2QLTA 3GZFA 4PL1A 1JI7A 4EBDA 4C8LA 2V9WA 5KFEA 5DECA 1D8BA 3KKAC 1MSWD 1ZQGA 1TV9A 3UMGA 3V7JA 3NWIA 2D3DA 4B9MA 4WJ3B 9ICTA 2F1HA 3OJUA 4OAGA 3KHLA 2HOIA 3CK6A 2Q4TA 5AKXA 4RUAA 3AUOA 3CNHA 1L8LA 2W9BB 4QZBA 2VIXA 2JR5A 3V7LA 4YQWA 3M7DA 4Q45A 2YMPA 3CYMA 1F44A 5KFMA 3K7DA 4F4XA 1C7YA 8ICKA 5JRTA 2VA3A 2AH5A 1BPZA 4I2HA 4QW8A 4DOBA 4JV2A 1U9LA 4IQTA 3ZD8A 1ZQLA 5KFUA 2RLTA 3T79A 2KTQA 1YLQA 2MA1A 3ER8C 2B21A 2PFPA 3OGUA 2R8IA 3A0BU 5ALJA 1JXLA 2R8KA 2MAXA 4KB6A 4LT6A 1QQ5A 4ELVA 2MUTA 3D2QA 1XWLA 2ZUDA 1PK1B 2WHEA 4R65A 4I0UA 2XCPA 4FO1A 2HBJA 4YFKA 4Z6EA 2XY6A 1NK8A 4JV0A 5HNKA 4J03A 1ZQTA 4IR1A 4AYBF 1MIWA 5HREA 2JH7A 2OEHA 7ICOA 8ICIA 4DFMA 1SXDA 5ALMA 4QWAA 3AQMA 4KLMA 5IIJA 4KLTA 1P7DA 1O03A 2ATLA 5JTIA 2DQNB 4FHWA 2LHTA 3LVWA 3H3AA 3RTVA 3FC4A 1N48A 2F1IA 2HHVA 3RJGA 3GV8B 1KN5A 3I1YA 2R18A 2M2TA 1NO5A 1S8OA 2W9MA 2K4IA 5KFSA 4UAWA 1NJYA 1ZQJA 3IP4B 3NKUA 5J0YA 1TK0A 4CF5A 7ICTA 3M1YA 2W03A 3UPSA 2BBJA 1RYRA 2W55A 2PMZF 3QX7A 4EENA 4DSIA 1JN3A 1Z00A 4Z6CA 1J2MA 2DPIA 4OAHA 2FI1A 4GXJA 9ICJA 1FFUA 5DG8A 4XUSA 5B66U 4RQ8A 2ZG6A 2DF4B 3RJHA 8ICYA 4RUCA 2BE3A 4UB5A 3SENA 2KSOB 4NLBA 2D8CA 4RT3A 1A6SA 5AKKA 2WF9A 2ZJ8A 3LDAA 3OVBA 1RXWA 2B0CA 3MGIA 2YN4A 4Z6FA 2ZUBA 1CRXA 5L1MA 5CRXA 4BXOA 5ALWA 1U47A 3TKAA 5J2BA 3AQNA 4F5QA 3C5FA 8ICOA 5CFSA 4KLFA 1S76D 4Y2RA 1NKBA 3ZI4A 4NL9A 5AKGA 2WB1C 4WC4A 1UT8A 4I2GA 1N2XA 4CRXA 1JROA 1RXVA 5KT5A 3SMVA 4RQ2A 3UQ0A 2HBLA 1UCVA 2G5HB 3E2EA 2W9CB 4I2IA 5DBCA 1LKYA 5ALKA 5HC9A 3RR7A 3D6JA 3UM9A 5L1LA 3LK9A 4UATA 4BXOB 4A8EA 4DSFA 4AT7B 1MQ2A 1DRGA 3QUQA 3EPIA 4I2EA 4AT9A 3JPNA 5L9XA 2DPJA 4JUZA 5KNIA 2XICA 2JXJA 4CCHA 2VKQA 4LVSA 1RYSA 5KFHA 5JUMA 4DSKA 2KP7A 3GU3A 4KN4A 2ESEA 2JMGA 1ZQWA 2AU0A 1URJA 4DFPA 1RZTA 1BNOA 2YMLA 3PV8A 4B9LA 4X4SA 3K1RB 2C2RA 3H37A 3Q8PB 2WF5A 2HVHA 3QUBA 2P6RA
chains in the Genus database with same CATH topology
2BCQA 4EYHB 3JPRA 1TVAA 1BPEA 1SL1A 3RB0A 2O1PA 1UEUA 1WOTA 1XSPA 2ALZA 1U4BA 1S10A 8ICUA 4E80A 5HMMA 4DSEA 3OVSA 4UQGA 4JWMA 1TFWA 3TAPA 7ICIA 8ICWA 4FS2A 9ICHA 5HHHA 3SI8A 4R66A 1TAQA 5KT7A 1ZQXA 4F5NA 7ICSA 2P66A 9ICXA 9ICLA 8ICJA 1MC8A 4GC7A 4PPXA 5KT6A 8ICFA 1NK9A 3K75D 7ICEA 2RDJA 5CA7A 4RU9A 4EBEA 1KEJA 4B9VA 9ICPA 4RWQA 4WC1A 3OSPA 2ZH3A 5J2GA 2W8LA 2HVIA 3H39A 4EBJA 1NK7A 4M9HA 4ECXA 7ICFA 5HRGA 1Q79A 4FHPA 3GDXA 4PHAA 4E8FA 1XO1A 4RT2A 2NRVA 5DB7A 7ICNA 3H8JA 5HRKA 4X4VA 2ZTEA 4PH5A 4EYIB 1NK0A 2J6UA 5BOMA 2XO7A 3AU6A 5DKWA 4F91B 5J2IA 1HUOA 4QWBA 1UA0A 3ZDDA 4NLKA 3LWLA 7ICKA 2M2WA 1R8AA 4M6WB 1AROP 4RNNA 4QZGA 4NM2A 3V6HA 3PY8A 2ZJAA 5TZVA 3OVAA 5J0RA 5KFOA 1NKEA 8ICEA 1UT5A 1ZQZA 1L5UA 2BPGA 1XU4A 4YVZA 2ASDA 1NK4A 5DG7A 4R64A 7ICPA 8ICQA 3HW8A 1PZNA 4KLUA 3TANA 2PI5A 4Q8FA 2XCAA 4KLEA 4WBZA 3LWMA 4I2JA 5J2EA 2H5XA 2AGQA 5HR9A 2AGPA 5DB8A 4F5RA 4M04A 1VJ7A 1DK3A 2HHQA 5DDYA 4M0AA 5J2HA 2ASLA 4EP7A 3RH6A 4RZRA 5EWFA 4F4KA 4R8UA 1PX5A 4J9OA 2BQRA 1A76A 5HRDA 8ICSA 3N4MB 2LYHA 2BCSA 1DOQA 4RQ3A 3HWTA 2NRXA 3FDSA 2PXIA 2AQ0A 2FPKA 5J0SA 4UBBA 4GXKA 1V9PA 4DS5A 2JEFA 3GIKA 2R8GA 3UQ2A 5HRFA 4KN7A 2HHPA 3MR5A 3PW7A 1MQ3A 4NM1A 3H38A 1K1SA 4TURA 1UA1A 4XRHA 1QTMA 4AT9B 2V4RA 3PR4A 4J9QA 4GC6A 4NKUA 9ICKA 5KFBA 5J0TA 2FLPA 3G6XA 4K4GA 2J6SA 4M47A 3RB3A 4F93B 4X4UA 4KITB 4ECWA 4WC3A 2BQ3A 8ICXA 5CB1A 9ICGA 1X9WA 3MR3A 3BQ1A 4DL7A 4BDPA 4UB3A 3BJYA 3SZ2A 9ICQA 5KG5A 1CUKA 1WCLA 8ICGA 4WC0A 5KFGA 1XSNA 1HUZA 4KLIA 1DK2A 4DFJA 1ZYQA 4KLOA 4LZDA 1SL0A 3NTUA 5HRLA 5KFAA 3TFSA 4M2YA 1JQRA 4XQ8A 4KTQA 1D8LA 1ZQPA 5KFVA 2UVVA 4O9MA 5J2JA 4DO9A 4RNOA 3MFHA 3QEBZ 3RB6A 4NLNA 9ICUA 4S3NA 5D46A 1DGSA 3Q8LA 3C1YA 4MFFA 3GIJA 4M5DA 1S0MA 2O5AA 4I29A 4QWCA 4O3NA 1L3TA 3PMLA 2C2EA 5DDMA 4YR2A 3B0YA 1S0OA 3Q8MA 5IIMA 3G6YA 3JPQA 2JZBB 2P6RA 5KG1A 2HHWA 7ICVA 3M9MB 3OHBA 4RWOA 4LZGA 2GWSA 2P6UA 1ZQUA 3NGDA 5J2KA 2I9GA 1ZQKA 4DL5A 3RR8A 1Q78A 4FBUA 1KTQA 3QZ8A 4DL3A 1U45A 3BQ2A 4ECSA 1MIYA 3GFKB 3EPGA 4DQPA 5DQHA 1BGXT 2NRTA 2NRWA 2ZTDA 4DS4A 3T3FA 4F5PA 5HP4A 3EWAA 4RQ0A 4IG8A 3PW0A 1L3SA 3C21A 3H4DA 1U48A 8ICAA 4NKTA 5DQGA 1VFGA 3Q8QB 4Q44A 3QEAZ 4ECRA 2KZZA 4E0DA 5HRBA 2ZH9A 2XGPA 8ICBA 4GLXA 3PNCA 4DOAA 4FS1A 4GXIA 2RDIA 2J6TA 2AQ4A 4RPZA 1WCNA 3PO5A 2UVWA 4F4YA 4WC5A 3IM1A 1NJWA 4RNMA 3JYYA 1LV5A 5CWRA 2FLNA 4ED1A 2DR8A 4ED2A 3UXOA 5KG6A 1XS9D 4YCXA 1NK6A 4TUSA 4NLGA 8ICCA 3C2KA 1ZQDA 4DSJA 1ZQOA 8ICPA 4RWNA 5DB6A 5DGAA 4ED8A 3C1ZA 5CHGA 1SKWA 1BPXA 2W9BA 4E7XA 5F9NA 2R8HA 2M2VA 4IQUA 3H8SA 4ECVA 3OSNA 4IRKA 3V72A 3SYZA 7ICJA 2DRBA 2JZBA 3WFRE 1H38A 9ICNA 3V7KA 4PHDA 5DLFA 3T5LA 5CJ7A 1QSLA 2IHNA 2UVRA 4AT8B 2Q66A 4MFCA 2BQUA 4WBYA 1ZQCA 2FMPA 5J2CA 2XY7A 2KZMA 5CP2A 4ED7A 2BCUA 3V6JA 1D9FA 4JK1A 4YN4A 5EWGA 5HRIA 1Z00B 3H40A 3HIYA 3UXNA 2DR9A 1EXNA 5L1IA 4DQQA 1S0VA 3TARA 2PI4A 4C8OA 2PBEA 4X5VA 4J9MA 4KMUA 4I2DA 3L9DA 4YMOA 2FMQA 5KFYA 4AT7A 3ETLA 4B9NA 4I2BA 4O3SA 2ZH5A 3BQTA 4RQ7A 3RJKA 4QZ8A 4XA5A 1F5AA 3ZDCA 3PR5B 4EBDA 1ZQQA 4C8LA 4PHEA 4P4PA 2V9WA 4F2SA 5KFEA 9ICWA 4TQRA 5DG9A 2VANA 5DECA 1MSWD 1ZQGA 1TV9A 3V7JA 3NYBA 2AGOA 4F4WA 4ZH4A 3RAQA 3GV5B 4B9MA 3JPTA 3RH4A 9ICTA 2BR0A 3C18A 4BWMA 2F1HA 3EZ5A 2DFLA 3OJUA 3KHLA 1ZETA 1D9DA 5EOZA 2UVUA 2BGWA 2A1JA 4QZHA 4RUAA 1TK5A 3RRGA 3AUOA 4DQIA 2M2UA 2ZH1A 2W9BB 3T5HA 4J9KA 4EBCA 4QZBA 7ICGA 2XY5A 3PO4A 3MR6A 3V7LA 3SV3A 2V4QA 3N97B 3OJSA 3OV7A 5BPCA 4YQWA 4Q45A 5KFDA 8ICTA 5KT4A 8ICZA 4ELTA 4X4QA 8ICLA 3EYZA 4K4HA 3PMNA 3OUYA 5KFMA 1UETA 4ED3A 4DQRA 4IR9A 4F4XA 1QLNA 1C7YA 2BKEA 4O3PA 4YXJA 4YR0A 1ZQAA 3HX0A 8ICKA 3JPPA 2VA3A 1KSPA 5KTQA 3PX4A 4FBTA 4Q8EA 3MFIA 5J2FA 3ZDBA 5IINA 5IIKA 4DSLA 3ZDEA 1BPZA 4I2HA 4DF8A 5D4BA 2ZH6A 1T3NA 2DRAA 2VA8A 4QW8A 5J0XA 4RQ6A 4DOBA 3C2LA 1U9LA 1ZQYA 2Y1IA 1NJZA 4JV2A 5DQIA 4IQTA 3T5JA 3ZD8A 5KT3A 4J9NA 1ZQLA 5KFUA 3HP6A 5J0UA 4QZFA 3RRHA 4O0IA 9ICVA 3RJFA 5DB9A 4ATBB 4MFAA 4ED6A 2BDPA 2KTQA 1YLQA 1QSYA 4G3IA 2AJQA 4ECYA 4IRCA 4WC6A 2M9NA 5KG7A 2B21A 4IQWA 2ZJ5A 2PFPA 3OGUA 2R8IA 4RQ5A 4K4IA 4JWNA 4F2RA 1RPLA 1JXLA 5F2VO 4J9PA 5J2DA 4RPXA 2MAXA 4ECZA 4J9LA 2R8KA 2ZH7A 1S77D 1IXRA 4AT8A 4F50A 5KFQA 2FMSA 4EZ6A 3ISBA 1KLNA 4RQ1A 2ISOA 4LT6A 2W8KA 4WCWA 4UB1A 3MDCA 4ELVA 4MF8A 2MUTA 2HHUA 1XWLA 4EBKA 4M9GA 2ZUDA 3M8SA 4QWEA 4R65A 1V4AA 3BQ0A 4ECUA 2XCPA 2W9CA 4DL6A 4KLJA 2BPCA 1TFRA 4YFKA 4Z6EA 2W9AA 4C8NA 2XY6A 3LQCB 1NK8A 4JV0A 3Q8KA 5HNKA 5BOLA 1HJPA 3C5GA 1ZQTA 2PFQA 4B9TA 4IR1A 5HREA 1MIWA 4FHVA 7ICOA 4YG2A 4M9JA 8ICIA 2C28A 5KFCA 4DFMA 3AQLA 3MR2A 4PGXA 4QWAA 3PW2A 1L3UA 8ICMA 3AQMA 5DLGA 4KLMA 1ZQEA 5IIJA 4KLTA 1S97A 2ATLA 1R89A 4YP3A 3GIIA 4FH3A 4KLHA 4FHWA 3WFPA 2DVIA 4PGQA 4C8KA 3TI0A 3RJEA 4O3QA 3H3AA 4PHPA 3RTVA 3UXPA 1MIVA 2ZH4A 5KFWA 7ICQA 1N48A 3ZDAA 2F1IA 4O5EA 2HHVA 3RJGA 9ICIA 3GV8B 4WC2A 2DR7A 4YMMA 1ZQBA 4KLDA 4MEXA 4X0AA 3SV4A 4Q43A 3KHHA 1KNYA 2M2TA 3UPQA 1NOMA 2ID1A 3PX0A 1JX4A 2BCVA 1NO5A 3MDAA 4ECTA 1NZPA 9ICFA 2W9MA 3RJJA 5KFSA 2IMWP 1JAJA 9ICRA 4UAWA 1NJYA 3PW5A 2BPFA 2IHMA 4I27A 2WTFA 3MGHA 2BHNA 4B9UA 2XC9A 1S0NA 1ZQJA 4DF4A 5J0YA 4KLGA 2KFZA 4UD5A 4YD2A 5D49A 1T4GA 3GV7B 1A77A 4DFKA 1TK0A 4UB2A 4R63A 2ZTCA 1JXEA 3GIMA 3M9OB 4J9SA 5J29A 1BPYA 7ICTA 8ICVA 4YMNA 3B0XA 4YD1A 4KLQA 3UPSA 3Q8RB 7ICRA 1RYRA 4P4MA 7ICMA 2JEJA 4RWPA 1BPBA 4UBCA 4ED0A 4FH5A 4DSIA 1JN3A 1Z00A 1XSLA 1X2IA 1U49A 4UB4A 2FPMA 4Z6CA 2DPIA 1T7PA 2DR5A 4QZ9A 2R8JA 4GXJA 5KG0A 4F92B 9ICJA 5DG8A 4J9RA 7ICUA 4XUSA 3C2MA 3M9NB 5KT2A 4RQ8A 3ISCA 3RJHA 3Q8SB 4F5OA 1LB2B 2I1QA 1ZQVA 2HHSA 4FHXA 8ICYA 4RUCA 2BE3A 4UB5A 5J0WA 2MUTB 4RQ4A 2ZH2A 1TAUA 2HHTA 3QE9Y 2Q0ZX 1B43A 5KFKA 4DWIA 9ICEA 2FLLA 3HJ4A 5F9LA 4QW9A 5C5JA 1ZJNA 4QZCA 2BCRA 4M6WA 1T8EA 4RT3A 5KG4A 3TFRA 1ZQHA 2C22A 5HHIA 3ISDA 2ZJ8A 3LDAA 3GQCA 3OVBA 2OWOA 1RXWA 1CEZA 3MGIA 1N56A 2RFFA 4DL4A 1ZQIA 4X4OA 4Z6FA 1SZPA 2ZUBA 2Y1JA 4I28A 5J0QA 4ECQA 1ZQNA 4BXOA 4BGDA 1NKCA 1U47A 2ISPA 1XC9A 9ICBA 1R8CA 4IRDA 3HPOA 5J2BA 4P4OA 4F5QA 3KHGA 3C5FA 8ICOA 1COOA 4KLFA 3AQNA 1S76D 4RPYA 5KFXA 1L3VA 4F8RA 1KFDA 4TUQA 5KFIA 4P2HA 4MEYA 3TAQA 1NKBA 3H8WA 5CR0A 4TQSA 4FO6A 3TQ1A 1UEVA 3RJIA 4WC4A 1UT8A 3IHQB 4I2GA 5KFTA 4M9LA 1K1QA 1B22A 1SL2A 4EEYA 5J0PA 5J2AA 3RBEA 1NJXA 4QZDA 4I2FA 4X4PA 3G6VA 1RXVA 3OUYB 3JPSA 5KT5A 1QSSA 3RB4A 3HT3A 4DQSA 3PX6A 4KLSA 4RQ2A 3UQ0A 4MF2A 4O5CA 4NLZA 1TKDA 9ICMA 1FA0A 1ZQMA 1X9MA 3H7IA 5IIOA 4C8MA 4XQ7A 4WC7A 4UD4A 3E2EA 2F1JA 3OHAA 1IM4A 1D8YA 3WFQE 3KHRA 3PW4A 2W9CB 3THVA 1TK8A 3C66A 4X4RA 3BDPA 2JEIA 1OU5A 4I2IA 2IBKA 5KFJA 2PFNA 1X9SA 4EZ9A 5DBCA 8ICRA 3WFSC 5L1KA 1ZJMA 1NK5A 5L1JA 2NRZA 4I2AA 5KFZA 3GILA 5HC9A 4X4TA 4F3OA 3PVXA 2HW3A 1Z3EB 3RH5A 4DLGA 4B9SA 4NXZA 4HYKA 3RR7A 2KZ3A 4DEZA 5DBAA 4DL2A 1KDHA 3RAXA 1KFSA 1BNPA 2ZHAA 9ICAA 2ASJA 5L1LA 5DGBA 4BWJA 1ZQSA 3FYHA 4YR3A 5KFFA 8ICNA 3LK9A 4BXOB 3K4GA 2ZHBA 4O3OA 4IQVA 2A1JB 4DSFA 1KRPA 4AT7B 1MQ2A 4KLLA 4QZIA 4UAZA 3QZ7A 2FPLA 3AQKA 3EPIA 4I2EA 2ZUCA 4AT9A 3JZ0A 3ZD9A 4DOCA 4ATBA 1S9FA 4TUPA 3WFOA 5IILA 3JPNA 5HRHA 2ZH8A 5KG3A 5L9XA 4UAYA 1JIHA 4QZEA 4QZAA 5EWEA 2DPJA 1SKSA 4JUZA 4Z6DA 9ICCA 8ICHA 2VA2A 5HMLA 1TFYA 5KFRA 5KFPA 4CCHA 5DEDA 2C2DA 4LVSA 3EW9A 1ZQFA 3H4BA 5DBBA 3C23A 4X4NA 3JPOA 5IIIA 1BVSA 5KFHA 1RYSA 5KFLA 5JUMA 2XGQA 5KFNA 4DSKA 5KG2A 2KN7A 4DLEA 2KP7A 4KN4A 4YXMA 4M9NA 1ZQRA 3M8RA 2PFOA 1JMSA 1ZQWA 2AU0A 4X0BA 4NY8A 4DFPA 4QWDA 3HJ1A 1RZTA 3KTQA 4FHYA 1Y88A 4F4ZA 4I2CA 3ORYA 4O5KA 9ICSA 1KFTA 1BNOA 1SKRA 3PV8A 4B9LA 4X4SA 2JEGA 7ICHA 7ICLA 2HHXA 2C2RA 3V6KA 4O3RA 3T5KA 2KFNA 1R8BA 3H37A 3Q8PB 3MABA 5J0OA 3MBYA 3RBDA 4ELUA 4PGYA 9ICOA 4JV1A 2HVHA 2NRKA 2IA6A 3AU2A 1BPDA 4R8UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCQ A;  4EYH B;  3JPR A;  1TVA A;  1BPE A;  1SL1 A;  3RB0 A;  2O1P A;  1UEU A;  1WOT A;  1XSP A;  2ALZ A;  1U4B A;  1S10 A;  8ICU A;  4E80 A;  5HMM A;  4DSE A;  3OVS A;  4UQG A;  4JWM A;  1TFW A;  3TAP A;  7ICI A;  8ICW A;  4FS2 A;  9ICH A;  5HHH A;  3SI8 A;  4R66 A;  1TAQ A;  5KT7 A;  1ZQX A;  4F5N A;  7ICS A;  2P66 A;  9ICX A;  9ICL A;  8ICJ A;  1MC8 A;  4GC7 A;  4PPX A;  5KT6 A;  8ICF A;  1NK9 A;  3K75 D;  7ICE A;  2RDJ A;  5CA7 A;  4RU9 A;  4EBE A;  1KEJ A;  4B9V A;  9ICP A;  4RWQ A;  4WC1 A;  3OSP A;  2ZH3 A;  5J2G A;  2W8L A;  2HVI A;  3H39 A;  4EBJ A;  1NK7 A;  4M9H A;  4ECX A;  7ICF A;  5HRG A;  1Q79 A;  4FHP A;  3GDX A;  4PHA A;  4E8F A;  1XO1 A;  4RT2 A;  2NRV A;  5DB7 A;  7ICN A;  3H8J A;  5HRK A;  4X4V A;  2ZTE A;  4PH5 A;  4EYI B;  1NK0 A;  2J6U A;  5BOM A;  2XO7 A;  3AU6 A;  5DKW A;  4F91 B;  5J2I A;  1HUO A;  4QWB A;  1UA0 A;  3ZDD A;  4NLK A;  3LWL A;  7ICK A;  2M2W A;  1R8A A;  4M6W B;  1ARO P;  4RNN A;  4QZG A;  4NM2 A;  3V6H A;  3PY8 A;  2ZJA A;  5TZV A;  3OVA A;  5J0R A;  5KFO A;  1NKE A;  8ICE A;  1UT5 A;  1ZQZ A;  1L5U A;  2BPG A;  1XU4 A;  4YVZ A;  2ASD A;  1NK4 A;  5DG7 A;  4R64 A;  7ICP A;  8ICQ A;  3HW8 A;  1PZN A;  4KLU A;  3TAN A;  2PI5 A;  4Q8F A;  2XCA A;  4KLE A;  4WBZ A;  3LWM A;  4I2J A;  5J2E A;  2H5X A;  2AGQ A;  5HR9 A;  2AGP A;  5DB8 A;  4F5R A;  4M04 A;  1VJ7 A;  1DK3 A;  2HHQ A;  5DDY A;  4M0A A;  5J2H A;  2ASL A;  4EP7 A;  3RH6 A;  4RZR A;  5EWF A;  4F4K A;  4R8U A;  1PX5 A;  4J9O A;  2BQR A;  1A76 A;  5HRD A;  8ICS A;  3N4M B;  2LYH A;  2BCS A;  1DOQ A;  4RQ3 A;  3HWT A;  2NRX A;  3FDS A;  2PXI A;  2AQ0 A;  2FPK A;  5J0S A;  4UBB A;  4GXK A;  1V9P A;  4DS5 A;  2JEF A;  3GIK A;  2R8G A;  3UQ2 A;  5HRF A;  4KN7 A;  2HHP A;  3MR5 A;  3PW7 A;  1MQ3 A;  4NM1 A;  3H38 A;  1K1S A;  4TUR A;  1UA1 A;  4XRH A;  1QTM A;  4AT9 B;  2V4R A;  3PR4 A;  4J9Q A;  4GC6 A;  4NKU A;  9ICK A;  5KFB A;  5J0T A;  2FLP A;  3G6X A;  4K4G A;  2J6S A;  4M47 A;  3RB3 A;  4F93 B;  4X4U A;  4KIT B;  4ECW A;  4WC3 A;  2BQ3 A;  8ICX A;  5CB1 A;  9ICG A;  1X9W A;  3MR3 A;  3BQ1 A;  4DL7 A;  4BDP A;  4UB3 A;  3BJY A;  3SZ2 A;  9ICQ A;  5KG5 A;  1CUK A;  1WCL A;  8ICG A;  4WC0 A;  5KFG A;  1XSN A;  1HUZ A;  4KLI A;  1DK2 A;  4DFJ A;  1ZYQ A;  4KLO A;  4LZD A;  1SL0 A;  3NTU A;  5HRL A;  5KFA A;  3TFS A;  4M2Y A;  1JQR A;  4XQ8 A;  4KTQ A;  1D8L A;  1ZQP A;  5KFV A;  2UVV A;  4O9M A;  5J2J A;  4DO9 A;  4RNO A;  3MFH A;  3QEB Z;  3RB6 A;  4NLN A;  9ICU A;  4S3N A;  5D46 A;  1DGS A;  3Q8L A;  3C1Y A;  4MFF A;  3GIJ A;  4M5D A;  1S0M A;  2O5A A;  4I29 A;  4QWC A;  4O3N A;  1L3T A;  3PML A;  2C2E A;  5DDM A;  4YR2 A;  3B0Y A;  1S0O A;  3Q8M A;  5IIM A;  3G6Y A;  3JPQ A;  2JZB B;  2P6R A;  5KG1 A;  2HHW A;  7ICV A;  3M9M B;  3OHB A;  4RWO A;  4LZG A;  2GWS A;  2P6U A;  1ZQU A;  3NGD A;  5J2K A;  2I9G A;  1ZQK A;  4DL5 A;  3RR8 A;  1Q78 A;  4FBU A;  1KTQ A;  3QZ8 A;  4DL3 A;  1U45 A;  3BQ2 A;  4ECS A;  1MIY A;  3GFK B;  3EPG A;  4DQP A;  5DQH A;  1BGX T;  2NRT A;  2NRW A;  2ZTD A;  4DS4 A;  3T3F A;  4F5P A;  5HP4 A;  3EWA A;  4RQ0 A;  4IG8 A;  3PW0 A;  1L3S A;  3C21 A;  3H4D A;  1U48 A;  8ICA A;  4NKT A;  5DQG A;  1VFG A;  3Q8Q B;  4Q44 A;  3QEA Z;  4ECR A;  2KZZ A;  4E0D A;  5HRB A;  2ZH9 A;  2XGP A;  8ICB A;  4GLX A;  3PNC A;  4DOA A;  4FS1 A;  4GXI A;  2RDI A;  2J6T A;  2AQ4 A;  4RPZ A;  1WCN A;  3PO5 A;  2UVW A;  4F4Y A;  4WC5 A;  3IM1 A;  1NJW A;  4RNM A;  3JYY A;  1LV5 A;  5CWR A;  2FLN A;  4ED1 A;  2DR8 A;  4ED2 A;  3UXO A;  5KG6 A;  1XS9 D;  4YCX A;  1NK6 A;  4TUS A;  4NLG A;  8ICC A;  3C2K A;  1ZQD A;  4DSJ A;  1ZQO A;  8ICP A;  4RWN A;  5DB6 A;  5DGA A;  4ED8 A;  3C1Z A;  5CHG A;  1SKW A;  1BPX A;  2W9B A;  4E7X A;  5F9N A;  2R8H A;  2M2V A;  4IQU A;  3H8S A;  4ECV A;  3OSN A;  4IRK A;  3V72 A;  3SYZ A;  7ICJ A;  2DRB A;  2JZB A;  3WFR E;  1H38 A;  9ICN A;  3V7K A;  4PHD A;  5DLF A;  3T5L A;  5CJ7 A;  1QSL A;  2IHN A;  2UVR A;  4AT8 B;  2Q66 A;  4MFC A;  2BQU A;  4WBY A;  1ZQC A;  2FMP A;  5J2C A;  2XY7 A;  2KZM A;  5CP2 A;  4ED7 A;  2BCU A;  3V6J A;  1D9F A;  4JK1 A;  4YN4 A;  5EWG A;  5HRI A;  1Z00 B;  3H40 A;  3HIY A;  3UXN A;  2DR9 A;  1EXN A;  5L1I A;  4DQQ A;  1S0V A;  3TAR A;  2PI4 A;  4C8O A;  2PBE A;  4X5V A;  4J9M A;  4KMU A;  4I2D A;  3L9D A;  4YMO A;  2FMQ A;  5KFY A;  4AT7 A;  3ETL A;  4B9N A;  4I2B A;  4O3S A;  2ZH5 A;  3BQT A;  4RQ7 A;  3RJK A;  4QZ8 A;  4XA5 A;  1F5A A;  3ZDC A;  3PR5 B;  4EBD A;  1ZQQ A;  4C8L A;  4PHE A;  4P4P A;  2V9W A;  4F2S A;  5KFE A;  9ICW A;  4TQR A;  5DG9 A;  2VAN A;  5DEC A;  1MSW D;  1ZQG A;  1TV9 A;  3V7J A;  3NYB A;  2AGO A;  4F4W A;  4ZH4 A;  3RAQ A;  3GV5 B;  4B9M A;  3JPT A;  3RH4 A;  9ICT A;  2BR0 A;  3C18 A;  4BWM A;  2F1H A;  3EZ5 A;  2DFL A;  3OJU A;  3KHL A;  1ZET A;  1D9D A;  5EOZ A;  2UVU A;  2BGW A;  2A1J A;  4QZH A;  4RUA A;  1TK5 A;  3RRG A;  3AUO A;  4DQI A;  2M2U A;  2ZH1 A;  2W9B B;  3T5H A;  4J9K A;  4EBC A;  4QZB A;  7ICG A;  2XY5 A;  3PO4 A;  3MR6 A;  3V7L A;  3SV3 A;  2V4Q A;  3N97 B;  3OJS A;  3OV7 A;  5BPC A;  4YQW A;  4Q45 A;  5KFD A;  8ICT A;  5KT4 A;  8ICZ A;  4ELT A;  4X4Q A;  8ICL A;  3EYZ A;  4K4H A;  3PMN A;  3OUY A;  5KFM A;  1UET A;  4ED3 A;  4DQR A;  4IR9 A;  4F4X A;  1QLN A;  1C7Y A;  2BKE A;  4O3P A;  4YXJ A;  4YR0 A;  1ZQA A;  3HX0 A;  8ICK A;  3JPP A;  2VA3 A;  1KSP A;  5KTQ A;  3PX4 A;  4FBT A;  4Q8E A;  3MFI A;  5J2F A;  3ZDB A;  5IIN A;  5IIK A;  4DSL A;  3ZDE A;  1BPZ A;  4I2H A;  4DF8 A;  5D4B A;  2ZH6 A;  1T3N A;  2DRA A;  2VA8 A;  4QW8 A;  5J0X A;  4RQ6 A;  4DOB A;  3C2L A;  1U9L A;  1ZQY A;  2Y1I A;  1NJZ A;  4JV2 A;  5DQI A;  4IQT A;  3T5J A;  3ZD8 A;  5KT3 A;  4J9N A;  1ZQL A;  5KFU A;  3HP6 A;  5J0U A;  4QZF A;  3RRH A;  4O0I A;  9ICV A;  3RJF A;  5DB9 A;  4ATB B;  4MFA A;  4ED6 A;  2BDP A;  2KTQ A;  1YLQ A;  1QSY A;  4G3I A;  2AJQ A;  4ECY A;  4IRC A;  4WC6 A;  2M9N A;  5KG7 A;  2B21 A;  4IQW A;  2ZJ5 A;  2PFP A;  3OGU A;  2R8I A;  4RQ5 A;  4K4I A;  4JWN A;  4F2R A;  1RPL A;  1JXL A;  5F2V O;  4J9P A;  5J2D A;  4RPX A;  2MAX A;  4ECZ A;  4J9L A;  2R8K A;  2ZH7 A;  1S77 D;  1IXR A;  4AT8 A;  4F50 A;  5KFQ A;  2FMS A;  4EZ6 A;  3ISB A;  1KLN A;  4RQ1 A;  2ISO A;  4LT6 A;  2W8K A;  4WCW A;  4UB1 A;  3MDC A;  4ELV A;  4MF8 A;  2MUT A;  2HHU A;  1XWL A;  4EBK A;  4M9G A;  2ZUD A;  3M8S A;  4QWE A;  4R65 A;  1V4A A;  3BQ0 A;  4ECU A;  2XCP A;  2W9C A;  4DL6 A;  4KLJ A;  2BPC A;  1TFR A;  4YFK A;  4Z6E A;  2W9A A;  4C8N A;  2XY6 A;  3LQC B;  1NK8 A;  4JV0 A;  3Q8K A;  5HNK A;  5BOL A;  1HJP A;  3C5G A;  1ZQT A;  2PFQ A;  4B9T A;  4IR1 A;  5HRE A;  1MIW A;  4FHV A;  7ICO A;  4YG2 A;  4M9J A;  8ICI A;  2C28 A;  5KFC A;  4DFM A;  3AQL A;  3MR2 A;  4PGX A;  4QWA A;  3PW2 A;  1L3U A;  8ICM A;  3AQM A;  5DLG A;  4KLM A;  1ZQE A;  5IIJ A;  4KLT A;  1S97 A;  2ATL A;  1R89 A;  4YP3 A;  3GII A;  4FH3 A;  4KLH A;  4FHW A;  3WFP A;  2DVI A;  4PGQ A;  4C8K A;  3TI0 A;  3RJE A;  4O3Q A;  3H3A A;  4PHP A;  3RTV A;  3UXP A;  1MIV A;  2ZH4 A;  5KFW A;  7ICQ A;  1N48 A;  3ZDA A;  2F1I A;  4O5E A;  2HHV A;  3RJG A;  9ICI A;  3GV8 B;  4WC2 A;  2DR7 A;  4YMM A;  1ZQB A;  4KLD A;  4MEX A;  4X0A A;  3SV4 A;  4Q43 A;  3KHH A;  1KNY A;  2M2T A;  3UPQ A;  1NOM A;  2ID1 A;  3PX0 A;  1JX4 A;  2BCV A;  1NO5 A;  3MDA A;  4ECT A;  1NZP A;  9ICF A;  2W9M A;  3RJJ A;  5KFS A;  2IMW P;  1JAJ A;  9ICR A;  4UAW A;  1NJY A;  3PW5 A;  2BPF A;  2IHM A;  4I27 A;  2WTF A;  3MGH A;  2BHN A;  4B9U A;  2XC9 A;  1S0N A;  1ZQJ A;  4DF4 A;  5J0Y A;  4KLG A;  2KFZ A;  4UD5 A;  4YD2 A;  5D49 A;  1T4G A;  3GV7 B;  1A77 A;  4DFK A;  1TK0 A;  4UB2 A;  4R63 A;  2ZTC A;  1JXE A;  3GIM A;  3M9O B;  4J9S A;  5J29 A;  1BPY A;  7ICT A;  8ICV A;  4YMN A;  3B0X A;  4YD1 A;  4KLQ A;  3UPS A;  3Q8R B;  7ICR A;  1RYR A;  4P4M A;  7ICM A;  2JEJ A;  4RWP A;  1BPB A;  4UBC A;  4ED0 A;  4FH5 A;  4DSI A;  1JN3 A;  1Z00 A;  1XSL A;  1X2I A;  1U49 A;  4UB4 A;  2FPM A;  4Z6C A;  2DPI A;  1T7P A;  2DR5 A;  4QZ9 A;  2R8J A;  4GXJ A;  5KG0 A;  4F92 B;  9ICJ A;  5DG8 A;  4J9R A;  7ICU A;  4XUS A;  3C2M A;  3M9N B;  5KT2 A;  4RQ8 A;  3ISC A;  3RJH A;  3Q8S B;  4F5O A;  1LB2 B;  2I1Q A;  1ZQV A;  2HHS A;  4FHX A;  8ICY A;  4RUC A;  2BE3 A;  4UB5 A;  5J0W A;  2MUT B;  4RQ4 A;  2ZH2 A;  1TAU A;  2HHT A;  3QE9 Y;  2Q0Z X;  1B43 A;  5KFK A;  4DWI A;  9ICE A;  2FLL A;  3HJ4 A;  5F9L A;  4QW9 A;  5C5J A;  1ZJN A;  4QZC A;  2BCR A;  4M6W A;  1T8E A;  4RT3 A;  5KG4 A;  3TFR A;  1ZQH A;  2C22 A;  5HHI A;  3ISD A;  2ZJ8 A;  3LDA A;  3GQC A;  3OVB A;  2OWO A;  1RXW A;  1CEZ A;  3MGI A;  1N56 A;  2RFF A;  4DL4 A;  1ZQI A;  4X4O A;  4Z6F A;  1SZP A;  2ZUB A;  2Y1J A;  4I28 A;  5J0Q A;  4ECQ A;  1ZQN A;  4BXO A;  4BGD A;  1NKC A;  1U47 A;  2ISP A;  1XC9 A;  9ICB A;  1R8C A;  4IRD A;  3HPO A;  5J2B A;  4P4O A;  4F5Q A;  3KHG A;  3C5F A;  8ICO A;  1COO A;  4KLF A;  3AQN A;  1S76 D;  4RPY A;  5KFX A;  1L3V A;  4F8R A;  1KFD A;  4TUQ A;  5KFI A;  4P2H A;  4MEY A;  3TAQ A;  1NKB A;  3H8W A;  5CR0 A;  4TQS A;  4FO6 A;  3TQ1 A;  1UEV A;  3RJI A;  4WC4 A;  1UT8 A;  3IHQ B;  4I2G A;  5KFT A;  4M9L A;  1K1Q A;  1B22 A;  1SL2 A;  4EEY A;  5J0P A;  5J2A A;  3RBE A;  1NJX A;  4QZD A;  4I2F A;  4X4P A;  3G6V A;  1RXV A;  3OUY B;  3JPS A;  5KT5 A;  1QSS A;  3RB4 A;  3HT3 A;  4DQS A;  3PX6 A;  4KLS A;  4RQ2 A;  3UQ0 A;  4MF2 A;  4O5C A;  4NLZ A;  1TKD A;  9ICM A;  1FA0 A;  1ZQM A;  1X9M A;  3H7I A;  5IIO A;  4C8M A;  4XQ7 A;  4WC7 A;  4UD4 A;  3E2E A;  2F1J A;  3OHA A;  1IM4 A;  1D8Y A;  3WFQ E;  3KHR A;  3PW4 A;  2W9C B;  3THV A;  1TK8 A;  3C66 A;  4X4R A;  3BDP A;  2JEI A;  1OU5 A;  4I2I A;  2IBK A;  5KFJ A;  2PFN A;  1X9S A;  4EZ9 A;  5DBC A;  8ICR A;  3WFS C;  5L1K A;  1ZJM A;  1NK5 A;  5L1J A;  2NRZ A;  4I2A A;  5KFZ A;  3GIL A;  5HC9 A;  4X4T A;  4F3O A;  3PVX A;  2HW3 A;  1Z3E B;  3RH5 A;  4DLG A;  4B9S A;  4NXZ A;  4HYK A;  3RR7 A;  2KZ3 A;  4DEZ A;  5DBA A;  4DL2 A;  1KDH A;  3RAX A;  1KFS A;  1BNP A;  2ZHA A;  9ICA A;  2ASJ A;  5L1L A;  5DGB A;  4BWJ A;  1ZQS A;  3FYH A;  4YR3 A;  5KFF A;  8ICN A;  3LK9 A;  4BXO B;  3K4G A;  2ZHB A;  4O3O A;  4IQV A;  2A1J B;  4DSF A;  1KRP A;  4AT7 B;  1MQ2 A;  4KLL A;  4QZI A;  4UAZ A;  3QZ7 A;  2FPL A;  3AQK A;  3EPI A;  4I2E A;  2ZUC A;  4AT9 A;  3JZ0 A;  3ZD9 A;  4DOC A;  4ATB A;  1S9F A;  4TUP A;  3WFO A;  5IIL A;  3JPN A;  5HRH A;  2ZH8 A;  5KG3 A;  5L9X A;  4UAY A;  1JIH A;  4QZE A;  4QZA A;  5EWE A;  2DPJ A;  1SKS A;  4JUZ A;  4Z6D A;  9ICC A;  8ICH A;  2VA2 A;  5HML A;  1TFY A;  5KFR A;  5KFP A;  4CCH A;  5DED A;  2C2D A;  4LVS A;  3EW9 A;  1ZQF A;  3H4B A;  5DBB A;  3C23 A;  4X4N A;  3JPO A;  5III A;  1BVS A;  5KFH A;  1RYS A;  5KFL A;  5JUM A;  2XGQ A;  5KFN A;  4DSK A;  5KG2 A;  2KN7 A;  4DLE A;  2KP7 A;  4KN4 A;  4YXM A;  4M9N A;  1ZQR A;  3M8R A;  2PFO A;  1JMS A;  1ZQW A;  2AU0 A;  4X0B A;  4NY8 A;  4DFP A;  4QWD A;  3HJ1 A;  1RZT A;  3KTQ A;  4FHY A;  1Y88 A;  4F4Z A;  4I2C A;  3ORY A;  4O5K A;  9ICS A;  1KFT A;  1BNO A;  1SKR A;  3PV8 A;  4B9L A;  4X4S A;  2JEG A;  7ICH A;  7ICL A;  2HHX A;  2C2R A;  3V6K A;  4O3R A;  3T5K A;  2KFN A;  1R8B A;  3H37 A;  3Q8P B;  3MAB A;  5J0O A;  3MBY A;  3RBD A;  4ELU A;  4PGY A;  9ICO A;  4JV1 A;  2HVH A;  2NRK A;  2IA6 A;  3AU2 A;  1BPD A;  4R8U B; 
#chains in the Genus database with same CATH topology
 5JU5 A;  1TVA A;  5AIB A;  3RB0 A;  2O1P A;  5AKZ A;  4E80 A;  4DSE A;  4UQG A;  3TAP A;  4HAI A;  5HHH A;  7ICS A;  5A0L A;  3NVY A;  4GC7 A;  8ICF A;  4EBE A;  5J8Y A;  3CW2 C;  5AM1 A;  2QB0 B;  1S5L U;  3NVO A;  4ECX A;  4FHP A;  3GDX A;  4PHA A;  1SWW A;  4RT2 A;  5DB7 A;  2ZTE A;  5J2I A;  3ZDD A;  3WK8 A;  4QZG A;  4NM2 A;  3OVA A;  1C20 A;  1ZQZ A;  3L5K A;  1XU4 A;  1F0M A;  5DG7 A;  7ICP A;  4Y2P A;  2PI5 A;  4M0A A;  1WWU A;  2ASL A;  4CE6 A;  4EP7 A;  3O0F A;  2BQR A;  1V85 A;  3N4M B;  4RQM A;  1UPH A;  3HWT A;  2NRX A;  1COK A;  2AQ0 A;  4UBB A;  2B6G A;  1V9P A;  2L5Y A;  4IL6 U;  4KX5 A;  2V4R A;  4J9Q A;  2DGZ A;  5J0T A;  3RB3 A;  4C4T A;  4WC3 A;  2BQ3 A;  3LVV A;  3MR3 A;  3BQ1 A;  1X42 A;  4LEZ A;  3FM9 A;  1ECW A;  4EX7 A;  5AK5 A;  5KFA A;  1IV8 A;  1JQR A;  1D8L A;  3AQF A;  1UHU A;  4DO9 A;  3QEB Z;  4NLN A;  4C7Z A;  1AQ6 A;  4XJE A;  4K9A A;  2MRL A;  4O3N A;  1S0O A;  4YR2 A;  5IIM A;  3F2C A;  4QIW C;  3OHB A;  1ZXI A;  1ZQK A;  2KJ9 A;  4FBU A;  2FCL A;  1MIY A;  5DQH A;  2NRT A;  1NNL A;  5B5E U;  3I28 A;  3T3F A;  3KZI U;  1L3S A;  4NKT A;  4C0Z A;  4DCC A;  4Q44 A;  3QEA Z;  4E0D A;  1Z19 A;  4DOA A;  4RPZ A;  2UVW A;  1NJW A;  3TAC B;  4RNM A;  2DR8 A;  4NLG A;  5ALV A;  3C2K A;  2K60 A;  8ICP A;  4RWN A;  4ED8 A;  3C1Z A;  1NZB A;  4PZN A;  2R8H A;  4IRK A;  5ALX A;  1H38 A;  3V7K A;  5DLF A;  2WF7 A;  1QSL A;  5CJ7 A;  2UVR A;  4WH5 A;  2BQU A;  1ZQC A;  5J2C A;  4O68 A;  4ED7 A;  3V6J A;  3AM9 A;  3WK6 A;  3TAR A;  2H3Z A;  3ICX A;  2FMQ A;  4B9N A;  4O3S A;  2F44 A;  2ZH5 A;  3PR5 B;  2EZY A;  5DG9 A;  3IG5 A;  4ZH4 A;  5CFT A;  4BWM A;  2DFL A;  5EOZ A;  2BGW A;  2A1J A;  3RRG A;  5B3P A;  4ZOH C;  4DQI A;  2ZH1 A;  4J9K A;  1N61 A;  2LBO A;  7ICG A;  4IS7 A;  3PO4 A;  2V4Q A;  3OJS A;  3HKZ F;  3PSF A;  5KFD A;  5KT4 A;  3PMN A;  3OUY A;  3RF9 A;  4ED3 A;  1MA7 A;  4IR9 A;  4O3P A;  4YR0 A;  3BS7 A;  3HX0 A;  1SGG A;  5KTQ A;  2EAM A;  4Q8E A;  2FJ6 A;  5IIN A;  1L7P A;  3ZDE A;  4BUG A;  2VA8 A;  5J0X A;  4EV6 A;  5DQI A;  5HR6 A;  4ACO A;  4J9N A;  4FFD A;  9ICV A;  4ATB B;  4ED6 A;  1QSY A;  2AJQ A;  4K4I A;  1VJ5 A;  4J9P A;  4RPX A;  4ECZ A;  1XNS A;  1S77 D;  1IXR A;  4AT8 A;  4F50 A;  1X40 A;  3ISB A;  5E79 U;  1FEZ A;  2F8K A;  2W8K A;  4WCW A;  4UB1 A;  3KKA A;  2HHU A;  2JRZ A;  4EBK A;  3M8S A;  2I5H A;  2K4E A;  4ECU A;  3SR6 A;  4DL6 A;  3E58 A;  4EEK A;  2BPC A;  3S6J A;  5BOL A;  2PFQ A;  4B9T A;  1FIQ A;  2C28 A;  5KFC A;  3AQL A;  4NXT A;  3MR2 A;  3PW2 A;  5TIS U;  4BX9 C;  3F53 A;  1R89 A;  4YP3 A;  4FH3 A;  2EWR A;  1OUQ A;  4O6A A;  5KFW A;  3DDH A;  5AKL A;  9ICI A;  1SV0 C;  1ZQB A;  4MEX A;  3SV4 A;  4CF3 A;  1KNY A;  3UPQ A;  3PX0 A;  3MDA A;  2WB1 F;  2ZIV A;  5AKI A;  2IMW P;  1JAJ A;  2KHQ A;  2XID A;  2BPF A;  2WTF A;  1RQL A;  2G0A A;  3QNM A;  4B9U A;  2H3V A;  2ZIU B;  4DF4 A;  4KLG A;  4UD5 A;  3GV7 B;  4R63 A;  3LYS A;  1JXE A;  3QU7 A;  5GTH U;  5CEH A;  5J29 A;  1YT3 A;  4YMN A;  4KLQ A;  4KM5 A;  5KL8 B;  3VCB A;  7ICM A;  1N5W A;  5AKJ A;  5JTG A;  3M6K A;  1XSL A;  1U49 A;  4UB4 A;  2FPM A;  3CP8 A;  5AI4 A;  4F92 B;  4J9R A;  2B4V A;  1ZQV A;  3M6Z A;  2HHS A;  2G08 A;  5ALF A;  3AEV A;  4RQ4 A;  3QE9 Y;  2Q0Z X;  1B43 A;  1K5O A;  4DWI A;  9ICE A;  2FLL A;  3SAH A;  5ALG A;  1ZJN A;  1T8E A;  1ZQH A;  2G06 A;  2OWO A;  4OJO A;  2RFF A;  1ZQI A;  4JMU A;  1QQ7 A;  4NXX A;  4X4O A;  4N7R A;  2IOF K;  4I28 A;  5J0Q A;  1ZQN A;  2O6K A;  4BGD A;  1NKC A;  1XC9 A;  2N1R A;  1R8C A;  4IRD A;  3HPO A;  3QU5 A;  1COO A;  4LJX A;  2ZIX A;  1L7N A;  5KFI A;  4P2H A;  3ERC C;  4UAR A;  1UEV A;  3IHQ B;  5AI9 A;  1K1Q A;  1SL2 A;  5J2A A;  1PVR A;  4QZD A;  4I2F A;  3JPS A;  3RB4 A;  4KLS A;  2KSO A;  1ZQM A;  4XQ7 A;  4WC7 A;  5IIO A;  4C8M A;  2ZIU A;  4UD4 A;  2CRX A;  1WYG A;  1D8Y A;  3IV6 A;  3WFQ E;  3THV A;  5AM2 A;  1OU5 A;  1X6J A;  4P0P A;  5KFJ A;  2W11 A;  2PFN A;  8ICR A;  5L1J A;  2ES6 A;  5D63 A;  2K89 A;  4B9S A;  2ZHA A;  2ASJ A;  4YR3 A;  4CDG A;  2LM4 A;  1KRP A;  2A1J B;  2K4H A;  1SZH A;  4KLL A;  4UAZ A;  3AQK A;  3ZD9 A;  1S9F A;  5HRH A;  4C4R A;  4UAY A;  1JIH A;  4QZA A;  5EWE A;  2KV2 A;  2W7O A;  5KFP A;  5DED A;  4OO1 J;  2GO7 A;  1L7O A;  4ICA A;  5III A;  4YXM A;  3NUQ A;  4X0B A;  3BZK A;  1JUD A;  4QWD A;  4OCZ A;  4F4Z A;  4I2C A;  9ICS A;  1KFT A;  2KJ5 A;  1KL9 A;  1RG6 A;  1TE2 A;  1R8B A;  4O3R A;  2KFN A;  5ALP A;  4PGY A;  2NRK A;  2HOQ A;  3N7P D;  1T3Q A;  5KL1 B;  2IA6 A;  3AU2 A;  1BPD A;  2BCQ A;  4EYH B;  3JPR A;  2CXY A;  1BPE A;  1SL1 A;  1SB3 C;  1S10 A;  1U4B A;  2JGA A;  2Z7J A;  5HMM A;  3OVS A;  9ICH A;  3SI8 A;  2ZIW A;  4R66 A;  1TAQ A;  4F5N A;  9ICX A;  1MC8 A;  4PPX A;  7ICE A;  3SAF A;  4RU9 A;  1Q3U A;  4B9V A;  9ICP A;  4WOY A;  2M0N A;  2Y0S C;  1Z4O A;  1NK7 A;  3F2D A;  1Q79 A;  4JLX A;  2EAN A;  3H8J A;  2XO7 A;  3AU6 A;  2MU2 A;  4F91 B;  1QQ6 A;  4QWB A;  4M6W B;  3PY8 A;  5J0R A;  2B56 A;  2F2A B;  1NK4 A;  5EE9 A;  2OM6 A;  3A0H U;  3TAN A;  1ZOL A;  2XCA A;  4KLE A;  3H0M B;  2H5X A;  5DB8 A;  3C28 A;  3RFA A;  4RZR A;  4F4K A;  4NV0 A;  3KBB A;  8ICS A;  2LYH A;  1GPJ A;  4U6P A;  5AKH A;  2E8P A;  5F3X B;  2FPK A;  2ZIW B;  3NVW A;  2R8G A;  3UQ2 A;  4CGZ A;  2HHP A;  1K1S A;  2PKE A;  1UA1 A;  4NKU A;  4GC6 A;  4B6J A;  2CPR A;  2J6S A;  4KIT B;  3KZX A;  9ICG A;  8ICX A;  1Q46 A;  4DL7 A;  4UB3 A;  4WC0 A;  4KLI A;  2KOB A;  2RP5 A;  4LZD A;  2HBM A;  1SL0 A;  4M2Y A;  4XQ8 A;  4KTQ A;  1ZQP A;  2UVV A;  5KFV A;  2MSN A;  2EAO A;  4RNO A;  3MFH A;  9ICU A;  4S3N A;  3Q8L A;  3C1Y A;  4QWC A;  1L3T A;  3B0Y A;  3G6Y A;  1VLB A;  7ICV A;  1ZQU A;  2KHV A;  1Q78 A;  3QZ8 A;  4ECS A;  3QYP A;  3EPG A;  2E8N A;  2ZTD A;  2EZX A;  4P0P B;  4F5P A;  2ODG A;  3EWA A;  4IG8 A;  2DKZ A;  3C21 A;  3H4D A;  1U48 A;  8ICA A;  1KQQ A;  5HRB A;  2XGP A;  4GLX A;  3EUB 2;  1ZRM A;  1V97 A;  4GXI A;  2DUY A;  2AQ4 A;  1WCN A;  3PO5 A;  4PL2 A;  5AI8 A;  3JYY A;  2FLN A;  5KG6 A;  4YCX A;  2A1A A;  4TUS A;  8ICC A;  1ZQO A;  5CHE A;  5DB6 A;  1SKW A;  5CHG A;  4NXW A;  2W9B A;  4E7X A;  4US9 A;  4IQU A;  3H8S A;  4ECV A;  2JZB A;  3IG8 A;  3WKC A;  9ICN A;  4NXU A;  5J8Y C;  4OJ5 A;  5FP0 A;  5CP2 A;  4JK1 A;  5EWG A;  5HRI A;  3UXN A;  2DR9 A;  1S0V A;  4Y2Y A;  2PI4 A;  4O67 A;  3J81 j;  5HR7 A;  2E8O A;  3L9D A;  4GFJ A;  4YMO A;  5KFY A;  3ONN A;  3BQT A;  4RQ7 A;  2EAP A;  1NI3 A;  4JB3 A;  3ZDC A;  4P4P A;  9ICW A;  4TQR A;  2VAN A;  2GA9 D;  3NYB A;  5C0Y A;  2AGO A;  4O3M A;  4O69 A;  4F4W A;  3RAQ A;  3GV5 B;  4EGW A;  3JPT A;  3RH4 A;  2QKQ A;  4UW9 A;  3C18 A;  3EZ5 A;  5KAF U;  2ZXI A;  2HCF A;  3T5H A;  2XY5 A;  3N97 B;  5BPC A;  4X4Q A;  5K4L A;  2YQE A;  4DQR A;  4MHV A;  2BKE A;  3JPP A;  4LEY A;  4OAI Z;  1KSP A;  4FBT A;  5J2F A;  5IIK A;  4DF8 A;  2ZH6 A;  1T3N A;  1QCK A;  2Y1I A;  1NJZ A;  1ZQY A;  2F77 X;  5KT3 A;  3HP6 A;  5J0U A;  4QZF A;  3RRH A;  4O0I A;  1PVQ A;  5DB9 A;  3KFU F;  2LYB A;  3IDW A;  3TAD C;  4IRC A;  2M9N A;  4IQW A;  2ZJ5 A;  4RQ5 A;  1Q3V A;  3ER9 B;  5J2D A;  4EZ6 A;  2FMS A;  4RQ1 A;  5ALH A;  3MDC A;  4MF8 A;  2WAQ C;  4QWE A;  1RQN A;  5ALY A;  1N62 A;  1F5S A;  4KLJ A;  2KD1 A;  2W9A A;  3LQC B;  2QAR B;  5AI0 A;  3C5G A;  4FHV A;  2YX8 A;  1SXE A;  1B4F A;  4AYB C;  4PGX A;  1L3U A;  5ALT A;  1ZQE A;  1SIJ A;  1S97 A;  2W54 A;  2BBH A;  3WFP A;  2DVI A;  4PGQ A;  4C8K A;  3RJE A;  1YZ7 A;  4O3Q A;  4PHP A;  1MIV A;  2ZH4 A;  2ZIV B;  7ICQ A;  2YMQ A;  4WC2 A;  5ALO A;  4KLD A;  4X0A A;  4Q43 A;  2ID1 A;  1JX4 A;  3RJJ A;  2RQ5 A;  2YB4 A;  1ZD4 A;  2E1E A;  3QUT A;  9ICR A;  2IHM A;  3NAS A;  2BHN A;  2W43 A;  2KFZ A;  2KKV A;  4YD2 A;  1A77 A;  2AHO B;  1Z1V A;  4J9S A;  1L8O A;  2DL0 A;  3B0X A;  2JEJ A;  4RWP A;  1BPB A;  2KE7 A;  1N63 A;  2EH9 A;  2R8J A;  3EF2 A;  7ICU A;  3C2M A;  3M9N B;  3KOO A;  1HIW A;  3ISC A;  3Q8S B;  4F5O A;  1LB2 B;  2I1Q A;  5D62 A;  2E1F A;  3OTQ A;  5J0W A;  1TAU A;  5KFK A;  3NS1 A;  5F9L A;  4QW9 A;  5C5J A;  4QZC A;  2BCR A;  3TFR A;  2C22 A;  3D2S A;  1M6Y A;  3GQC A;  4EX6 A;  1CEZ A;  1N56 A;  4DL4 A;  4ECQ A;  2KKP A;  3N28 A;  3KHG A;  5KFX A;  4F8R A;  1KFD A;  2EQY A;  4MEY A;  5ALS A;  3TAQ A;  3WK4 A;  4FO6 A;  3H0L B;  3TQ1 A;  5KFT A;  1B22 A;  4EEY A;  5J0P A;  2K4P A;  1LVH A;  3RBE A;  4X4P A;  3B9J A;  3OUY B;  2IOH A;  3HT3 A;  4DQS A;  3PX6 A;  1FA0 A;  1X9M A;  1N60 A;  1IM4 A;  3KHR A;  3SQI A;  1CI4 A;  4GIB A;  1TK8 A;  3C66 A;  4EZ9 A;  1X9S A;  4PJ0 U;  1ZJM A;  5KFZ A;  4X4T A;  3DV9 A;  5G5G A;  4F3O A;  2HW3 A;  1Z3E B;  3RH5 A;  4DLG A;  2KZ3 A;  5ALN A;  1KDH A;  4F72 A;  1BNP A;  1QH9 A;  9ICA A;  2Y0S F;  5DGB A;  3FYH A;  8ICN A;  4HX0 A;  3K4G A;  1L6N A;  3AL0 B;  2ZUC A;  5GTI U;  2IUB A;  4Y2T A;  3JZ0 A;  3QU4 A;  4ATB A;  4TUP A;  3WFO A;  2ZH8 A;  4Y2U A;  5KG3 A;  4NLC A;  2QB1 A;  4Z6D A;  3R9K A;  9ICC A;  4U7C A;  2VA2 A;  5HML A;  1TFY A;  5AK4 A;  2C2D A;  3H4B A;  4X4N A;  3C23 A;  3JPO A;  5KFL A;  5D61 A;  2KN7 A;  1ZQR A;  3M8R A;  3HRD D;  4LEV A;  2LM1 A;  4NWI A;  2BZF A;  2KVS A;  2G09 A;  4OJP A;  3KTQ A;  2G07 A;  1Y88 A;  4FHY A;  2BDU A;  4O5K A;  3ORY A;  1SKR A;  2K8B B;  1N5X A;  2HHX A;  5J0O A;  3MBY A;  4ELU A;  9ICO A;  4WQL A;  1WWV A;  2KVC A;  4K97 A;  1UEU A;  1WOT A;  1XSP A;  2ALZ A;  3NVZ A;  1IIP A;  2GH1 A;  2KG5 A;  1TFW A;  8ICW A;  5CFU A;  2DWQ A;  2FDR A;  2P66 A;  9ICL A;  3OWG A;  1RYU A;  4CF4 A;  5KT6 A;  3K75 D;  2RDJ A;  5CA7 A;  1FO4 A;  4RWQ A;  2ZH3 A;  2HVI A;  4M9H A;  3UMC A;  7ICF A;  5HRG A;  4K99 A;  2HBK A;  1XO1 A;  3BQ7 A;  2NRV A;  3L4P A;  5HRK A;  4PH5 A;  1NK0 A;  3H8M A;  5BOM A;  1KKX A;  5AKE A;  2K8A A;  2PMZ C;  1UA0 A;  2M2W A;  1R8A A;  2KIV A;  2HOF A;  2ZJA A;  5KFO A;  1UT5 A;  2KIW A;  1L5U A;  2ASD A;  8ICQ A;  2YB1 A;  3D2N A;  4C7Y A;  4KLU A;  1FFV A;  3K1Z A;  4I2J A;  1DGJ A;  2AGQ A;  3WKA A;  2AGP A;  1PK1 A;  1VJ7 A;  2H3I A;  1PX5 A;  5HRD A;  5AM4 A;  2BCS A;  1DOQ A;  3E0F A;  2GAF D;  2HMX A;  4RQ3 A;  2IOF A;  3FDS A;  5J0S A;  2JEF A;  3GIK A;  3WK9 A;  4KN7 A;  3MR5 A;  1MQ3 A;  3PSI A;  4NM1 A;  4TUR A;  1QTM A;  3PR4 A;  5H2F U;  3WK5 A;  5KFB A;  2FLP A;  4K4G A;  1J97 A;  2OH2 A;  4OD0 A;  4ECW A;  5CB1 A;  4BDP A;  4Y2J A;  3BJY A;  1TAM A;  1CUK A;  1WCL A;  5KFG A;  1XSN A;  1HUZ A;  2KEY A;  5HRL A;  5J2J A;  5EE1 A;  5D46 A;  4EEL A;  3UMB A;  3U26 A;  1OXJ A;  2O5A A;  3PML A;  2QB0 A;  2C2E A;  2OCE A;  4QIW F;  5DDM A;  5ALI A;  2W3S A;  2HHW A;  3M9M B;  4RWO A;  2VJ4 A;  5AKY A;  2GWS A;  4LZG A;  4DL5 A;  1KTQ A;  4FZM A;  2KIC A;  3BQ2 A;  4DFD A;  4G9B A;  1JAL A;  4DS4 A;  4RQ0 A;  5AK6 A;  2A3V A;  1VFG A;  3Q8Q B;  1X6I A;  5AI6 A;  4C80 A;  2OHF A;  4F4Y A;  3IM1 A;  3QU2 A;  1LV5 A;  4MKP A;  4ED1 A;  4ED2 A;  3MCR A;  1XS9 D;  4DSJ A;  1GO3 F;  3C29 A;  3SAG A;  2M2V A;  3OSN A;  1ZQ1 C;  1ZD3 A;  3V72 A;  2EDU A;  2W3R A;  3SYZ A;  7ICJ A;  2DRB A;  2CN1 A;  4UB8 U;  2DKX A;  3PST A;  4PHD A;  4AT8 B;  4MFC A;  4WBY A;  2Y9U A;  2KZM A;  2XY7 A;  2BCU A;  3H40 A;  1EXN A;  5L1I A;  4DQQ A;  2PBE A;  2EZZ A;  4KMU A;  4AT7 A;  1ZD2 P;  4I2B A;  3RJK A;  1F5A A;  4QZ8 A;  1ZQQ A;  4PHE A;  2P35 A;  4F2S A;  4F71 A;  3AN1 A;  1V38 A;  2BR0 A;  1D9D A;  1ZET A;  1DXS A;  2DBY A;  5AIC A;  2UVU A;  1PUZ A;  1TK5 A;  4QZH A;  1VDV A;  2M2U A;  4EBC A;  3MR6 A;  2RRD A;  3SV3 A;  3OV7 A;  2A19 A;  8ICT A;  8ICZ A;  4ELT A;  3QXG A;  8ICL A;  3EYZ A;  4K4H A;  1UET A;  5AIA A;  1QLN A;  2HDO A;  4YXJ A;  2LKY A;  1ZQA A;  5AHX A;  3PX4 A;  5ALQ A;  3MFI A;  3ZDB A;  4DSL A;  5D4B A;  3WKD A;  2DRA A;  4RQ6 A;  3C2L A;  4NXV A;  2XI9 A;  4KMO B;  2G5I B;  2KNJ A;  5ALE A;  3T5J A;  2OXO A;  1OW5 A;  3RJF A;  4MFA A;  2BDP A;  4G3I A;  4ECY A;  4CNQ A;  3WKE A;  5AM5 A;  5KG7 A;  4WC6 A;  3F2B A;  4JWN A;  4F2R A;  1RPL A;  5F2V O;  4J9L A;  5KFQ A;  3ETR A;  3PSP A;  1KLN A;  4UB6 U;  2ISO A;  1RM6 C;  2JH1 A;  4M9G A;  2Y9T A;  2GLE A;  1V4A A;  2KMD A;  3BQ0 A;  2W9C A;  4LEW A;  1TFR A;  4C8N A;  3Q8K A;  1HJP A;  3QU9 A;  4KX3 A;  2W04 A;  4YG2 A;  4M9J A;  4WQK A;  8ICM A;  5DLG A;  5AK3 A;  1ZD5 A;  4UAV A;  3GII A;  4KLH A;  2RHF A;  1KW4 A;  2NV3 A;  3TI0 A;  3UXP A;  3ZDA A;  2E3T A;  4O5E A;  2B51 A;  2DR7 A;  4YMM A;  3KHH A;  1NOM A;  2BCV A;  4ECT A;  1NZP A;  9ICF A;  2HN1 A;  2HN2 A;  4P0Q A;  2E5S A;  4I27 A;  3PW5 A;  3MGH A;  2XC9 A;  1S0N A;  4DFK A;  5D49 A;  1T4G A;  1MN8 A;  3NRZ A;  4UB2 A;  2ZTC A;  3GIM A;  3M9O B;  1BPY A;  1ED1 A;  2WF8 A;  8ICV A;  4IC9 A;  4YD1 A;  2KJ8 A;  2OYY A;  3Q8R B;  7ICR A;  2ZH7 A;  4P4M A;  1Z1B A;  3IRU A;  4UBC A;  4ED0 A;  4FH5 A;  1UQV A;  1X2I A;  3PZP A;  1T7P A;  2DR5 A;  3BZC A;  4FE3 A;  4QZ9 A;  5KG0 A;  2XVT A;  4USA A;  5KT2 A;  2WFA A;  1L7M A;  4FHX A;  3KD3 A;  2MUT B;  2ZH2 A;  2HHT A;  3HJ4 A;  1A0P A;  1Z4N A;  4K8V A;  4M6W A;  5KG4 A;  5HHI A;  3ISD A;  4K98 A;  4C4S A;  1SV0 A;  4RQN A;  1SZP A;  2Y1J A;  9ICB A;  2ISP A;  4P4O A;  4AP9 A;  3NRW A;  4RPY A;  3N7S C;  3SD7 A;  1L3V A;  2KK0 A;  4TUQ A;  2F3N A;  1SV4 A;  3H8W A;  5CR0 A;  4TQS A;  3RJI A;  2ZXH A;  1KBU A;  4M9L A;  2F76 X;  3TAD A;  1NJX A;  3G6V A;  2YTU A;  3HKZ C;  1QSS A;  1WUD A;  3ALR A;  4MF2 A;  4O5C A;  4NLZ A;  1TKD A;  9ICM A;  3MC1 A;  2FE9 A;  3H7I A;  2WF6 A;  2F1J A;  3OHA A;  3PW4 A;  4X4R A;  2I6X A;  5EE3 A;  3BDP A;  2JEI A;  4FZN A;  5KAI U;  2IBK A;  3WFS C;  5L1K A;  1NK5 A;  4I2A A;  2NRZ A;  3GIL A;  1X9X A;  3PVX A;  4NXZ A;  4HYK A;  1O08 A;  4DEZ A;  5DBA A;  4DL2 A;  1KFS A;  3RAX A;  1HEK A;  4BWJ A;  1ZQS A;  5KFF A;  2ZHB A;  4O3O A;  4IQV A;  4QZI A;  3QZ7 A;  3IN5 A;  4P0Q B;  2FPL A;  1SWV A;  5AI5 A;  4DOC A;  5AM3 A;  5IIL A;  4QZE A;  1SKS A;  1ZRN A;  2H3F A;  8ICH A;  5KFR A;  3MGV A;  4Y2V A;  3EW9 A;  4EEB A;  4FZL A;  1ZQF A;  2K8C B;  5DBB A;  4Y2X A;  2NO5 A;  1BVS A;  2XGQ A;  5KFN A;  3HJE A;  5KG2 A;  4DLE A;  2GOL A;  4M9N A;  2PFO A;  1JMS A;  4QJF B;  4NY8 A;  3HJ1 A;  2W7P A;  1X66 A;  3DEE A;  3I76 A;  2JEG A;  3ED5 A;  7ICH A;  7ICL A;  3V6K A;  3T5K A;  1J2N A;  3QUC A;  3MAB A;  3RBD A;  2LPE A;  4JV1 A;  1XO0 A;  4R8U B;  2QAR A;  2H3Q A;  4JWM A;  7ICI A;  4FS2 A;  5AM0 A;  5KT7 A;  1ZQX A;  3JCF A;  8ICJ A;  2YMM A;  1NK9 A;  5B3Q A;  2ZIX B;  1KEJ A;  5ALZ A;  4WC1 A;  1WG8 A;  3OSP A;  5J2G A;  2W8L A;  3H39 A;  4EBJ A;  1JRP A;  3N7R C;  4E8F A;  7ICN A;  2HSZ A;  4K9B A;  4X4V A;  2F8L A;  2HI0 A;  4EYI B;  2J6U A;  1B0X A;  5DKW A;  3HIL A;  1HUO A;  4NLK A;  3LWL A;  7ICK A;  1ARO P;  4RNN A;  1PVP A;  4NJ8 A;  3V6H A;  5TZV A;  3WK7 A;  1NKE A;  4OJL A;  8ICE A;  3NVV A;  5G5H A;  4YVZ A;  2BPG A;  4R64 A;  4JLZ A;  3HW8 A;  4OAF A;  1PZN A;  3SEI A;  1Q8K A;  5ALD A;  4Q8F A;  4WBZ A;  3LWM A;  5J2E A;  5HR9 A;  2D6F C;  4F5R A;  4M04 A;  5ALU A;  1DK3 A;  2HHQ A;  4PZO A;  5DDY A;  5J2H A;  2LI6 A;  3RH6 A;  5EWF A;  4R8U A;  2NYV A;  4J9O A;  1A76 A;  2VJ5 A;  4NL9 C;  2PXI A;  1PK3 A;  3CRX A;  4GXK A;  4DS5 A;  5EE0 A;  4UAU A;  5HRF A;  3PW7 A;  3H38 A;  4US8 A;  2IHO A;  4XRH A;  4AT9 B;  9ICK A;  2WAQ F;  3FAH A;  3G6X A;  3AQE A;  4M47 A;  4F93 B;  4X4U A;  1X9W A;  3SZ2 A;  9ICQ A;  5KG5 A;  8ICG A;  4QNL A;  3BS5 B;  1DK2 A;  4DFJ A;  1ZYQ A;  4KLO A;  3NTU A;  3TFS A;  2LMR A;  8ICU A;  4O9M A;  3RB6 A;  3AMZ A;  1DGS A;  4MFF A;  3WKB A;  3GIJ A;  3BS5 A;  4M5D A;  1S0M A;  4I29 A;  3H0R B;  3Q8M A;  3JPQ A;  2JZB B;  5KG1 A;  2P6U A;  2JV3 A;  2E8M A;  4Y2S A;  5J2K A;  3NGD A;  2I9G A;  3RR8 A;  4DL3 A;  1U45 A;  3GFK B;  4DQP A;  1BGX T;  2NRW A;  5HP4 A;  3PHZ A;  5T14 A;  3PW0 A;  3VC8 A;  5DQG A;  5ALL A;  4ECR A;  2KZZ A;  2ZH9 A;  8ICB A;  3PNC A;  4FS1 A;  4UAS A;  1YZ6 A;  2RDI A;  2J6T A;  2AXT U;  5ALR A;  4WC5 A;  1LKY B;  5CWR A;  3UXO A;  1NK6 A;  1ZQD A;  4EED A;  4BJQ A;  3F5A A;  5DGA A;  1BPX A;  2YY6 A;  5F9N A;  3L3F X;  2JHD A;  1T94 A;  3WFR E;  2Q66 A;  3T5L A;  2IHN A;  2NO4 A;  3WU2 U;  1IG6 A;  4OJ6 A;  2FMP A;  1D9F A;  4YN4 A;  1Z00 B;  3HIY A;  2LYA A;  4C8O A;  4X5V A;  4J9M A;  4I2D A;  4Y2Q A;  3ETL A;  4K96 A;  1RDF A;  3OPX A;  3F5E A;  4XA5 A;  2QLT A;  3GZF A;  4PL1 A;  1JI7 A;  4EBD A;  4C8L A;  2V9W A;  5KFE A;  5DEC A;  1D8B A;  3KKA C;  1MSW D;  1ZQG A;  1TV9 A;  3UMG A;  3V7J A;  3NWI A;  2D3D A;  4B9M A;  4WJ3 B;  9ICT A;  2F1H A;  3OJU A;  4OAG A;  3KHL A;  2HOI A;  3CK6 A;  2Q4T A;  5AKX A;  4RUA A;  3AUO A;  3CNH A;  1L8L A;  2W9B B;  4QZB A;  2VIX A;  2JR5 A;  3V7L A;  4YQW A;  3M7D A;  4Q45 A;  2YMP A;  3CYM A;  1F44 A;  5KFM A;  3K7D A;  4F4X A;  1C7Y A;  8ICK A;  5JRT A;  2VA3 A;  2AH5 A;  1BPZ A;  4I2H A;  4QW8 A;  4DOB A;  4JV2 A;  1U9L A;  4IQT A;  3ZD8 A;  1ZQL A;  5KFU A;  2RLT A;  3T79 A;  2KTQ A;  1YLQ A;  2MA1 A;  3ER8 C;  2B21 A;  2PFP A;  3OGU A;  2R8I A;  3A0B U;  5ALJ A;  1JXL A;  2R8K A;  2MAX A;  4KB6 A;  4LT6 A;  1QQ5 A;  4ELV A;  2MUT A;  3D2Q A;  1XWL A;  2ZUD A;  1PK1 B;  2WHE A;  4R65 A;  4I0U A;  2XCP A;  4FO1 A;  2HBJ A;  4YFK A;  4Z6E A;  2XY6 A;  1NK8 A;  4JV0 A;  5HNK A;  4J03 A;  1ZQT A;  4IR1 A;  4AYB F;  1MIW A;  5HRE A;  2JH7 A;  2OEH A;  7ICO A;  8ICI A;  4DFM A;  1SXD A;  5ALM A;  4QWA A;  3AQM A;  4KLM A;  5IIJ A;  4KLT A;  1P7D A;  1O03 A;  2ATL A;  5JTI A;  2DQN B;  4FHW A;  2LHT A;  3LVW A;  3H3A A;  3RTV A;  3FC4 A;  1N48 A;  2F1I A;  2HHV A;  3RJG A;  3GV8 B;  1KN5 A;  3I1Y A;  2R18 A;  2M2T A;  1NO5 A;  1S8O A;  2W9M A;  2K4I A;  5KFS A;  4UAW A;  1NJY A;  1ZQJ A;  3IP4 B;  3NKU A;  5J0Y A;  1TK0 A;  4CF5 A;  7ICT A;  3M1Y A;  2W03 A;  3UPS A;  2BBJ A;  1RYR A;  2W55 A;  2PMZ F;  3QX7 A;  4EEN A;  4DSI A;  1JN3 A;  1Z00 A;  4Z6C A;  1J2M A;  2DPI A;  4OAH A;  2FI1 A;  4GXJ A;  9ICJ A;  1FFU A;  5DG8 A;  4XUS A;  5B66 U;  4RQ8 A;  2ZG6 A;  2DF4 B;  3RJH A;  8ICY A;  4RUC A;  2BE3 A;  4UB5 A;  3SEN A;  2KSO B;  4NLB A;  2D8C A;  4RT3 A;  1A6S A;  5AKK A;  2WF9 A;  2ZJ8 A;  3LDA A;  3OVB A;  1RXW A;  2B0C A;  3MGI A;  2YN4 A;  4Z6F A;  2ZUB A;  1CRX A;  5L1M A;  5CRX A;  4BXO A;  5ALW A;  1U47 A;  3TKA A;  5J2B A;  3AQN A;  4F5Q A;  3C5F A;  8ICO A;  5CFS A;  4KLF A;  1S76 D;  4Y2R A;  1NKB A;  3ZI4 A;  4NL9 A;  5AKG A;  2WB1 C;  4WC4 A;  1UT8 A;  4I2G A;  1N2X A;  4CRX A;  1JRO A;  1RXV A;  5KT5 A;  3SMV A;  4RQ2 A;  3UQ0 A;  2HBL A;  1UCV A;  2G5H B;  3E2E A;  2W9C B;  4I2I A;  5DBC A;  1LKY A;  5ALK A;  5HC9 A;  3RR7 A;  3D6J A;  3UM9 A;  5L1L A;  3LK9 A;  4UAT A;  4BXO B;  4A8E A;  4DSF A;  4AT7 B;  1MQ2 A;  1DRG A;  3QUQ A;  3EPI A;  4I2E A;  4AT9 A;  3JPN A;  5L9X A;  2DPJ A;  4JUZ A;  5KNI A;  2XIC A;  2JXJ A;  4CCH A;  2VKQ A;  4LVS A;  1RYS A;  5KFH A;  5JUM A;  4DSK A;  2KP7 A;  3GU3 A;  4KN4 A;  2ESE A;  2JMG A;  1ZQW A;  2AU0 A;  1URJ A;  4DFP A;  1RZT A;  1BNO A;  2YML A;  3PV8 A;  4B9L A;  4X4S A;  3K1R B;  2C2R A;  3H37 A;  3Q8P B;  2WF5 A;  2HVH A;  3QUB A;  2P6R A; 
#chains in the Genus database with same CATH homology
 2BCQ A;  4EYH B;  3JPR A;  1TVA A;  1BPE A;  1SL1 A;  3RB0 A;  2O1P A;  1UEU A;  1WOT A;  1XSP A;  2ALZ A;  1U4B A;  1S10 A;  8ICU A;  4E80 A;  5HMM A;  4DSE A;  3OVS A;  4UQG A;  4JWM A;  1TFW A;  3TAP A;  7ICI A;  8ICW A;  4FS2 A;  9ICH A;  5HHH A;  3SI8 A;  4R66 A;  1TAQ A;  5KT7 A;  1ZQX A;  4F5N A;  7ICS A;  2P66 A;  9ICX A;  9ICL A;  8ICJ A;  1MC8 A;  4GC7 A;  4PPX A;  5KT6 A;  8ICF A;  1NK9 A;  3K75 D;  7ICE A;  2RDJ A;  5CA7 A;  4RU9 A;  4EBE A;  1KEJ A;  4B9V A;  9ICP A;  4RWQ A;  4WC1 A;  3OSP A;  2ZH3 A;  5J2G A;  2W8L A;  2HVI A;  3H39 A;  4EBJ A;  1NK7 A;  4M9H A;  4ECX A;  7ICF A;  5HRG A;  1Q79 A;  4FHP A;  3GDX A;  4PHA A;  4E8F A;  1XO1 A;  4RT2 A;  2NRV A;  5DB7 A;  7ICN A;  3H8J A;  5HRK A;  4X4V A;  2ZTE A;  4PH5 A;  4EYI B;  1NK0 A;  2J6U A;  5BOM A;  2XO7 A;  3AU6 A;  5DKW A;  4F91 B;  5J2I A;  1HUO A;  4QWB A;  1UA0 A;  3ZDD A;  4NLK A;  3LWL A;  7ICK A;  2M2W A;  1R8A A;  4M6W B;  1ARO P;  4RNN A;  4QZG A;  4NM2 A;  3V6H A;  3PY8 A;  2ZJA A;  5TZV A;  3OVA A;  5J0R A;  5KFO A;  1NKE A;  8ICE A;  1UT5 A;  1ZQZ A;  1L5U A;  2BPG A;  1XU4 A;  4YVZ A;  2ASD A;  1NK4 A;  5DG7 A;  4R64 A;  7ICP A;  8ICQ A;  3HW8 A;  1PZN A;  4KLU A;  3TAN A;  2PI5 A;  4Q8F A;  2XCA A;  4KLE A;  4WBZ A;  3LWM A;  4I2J A;  5J2E A;  2H5X A;  2AGQ A;  5HR9 A;  2AGP A;  5DB8 A;  4F5R A;  4M04 A;  1VJ7 A;  1DK3 A;  2HHQ A;  5DDY A;  4M0A A;  5J2H A;  2ASL A;  4EP7 A;  3RH6 A;  4RZR A;  5EWF A;  4F4K A;  4R8U A;  1PX5 A;  4J9O A;  2BQR A;  1A76 A;  5HRD A;  8ICS A;  3N4M B;  2LYH A;  2BCS A;  1DOQ A;  4RQ3 A;  3HWT A;  2NRX A;  3FDS A;  2PXI A;  2AQ0 A;  2FPK A;  5J0S A;  4UBB A;  4GXK A;  1V9P A;  4DS5 A;  2JEF A;  3GIK A;  2R8G A;  3UQ2 A;  5HRF A;  4KN7 A;  2HHP A;  3MR5 A;  3PW7 A;  1MQ3 A;  4NM1 A;  3H38 A;  1K1S A;  4TUR A;  1UA1 A;  4XRH A;  1QTM A;  4AT9 B;  2V4R A;  3PR4 A;  4J9Q A;  4GC6 A;  4NKU A;  9ICK A;  5KFB A;  5J0T A;  2FLP A;  3G6X A;  4K4G A;  2J6S A;  4M47 A;  3RB3 A;  4F93 B;  4X4U A;  4KIT B;  4ECW A;  4WC3 A;  2BQ3 A;  8ICX A;  5CB1 A;  9ICG A;  1X9W A;  3MR3 A;  3BQ1 A;  4DL7 A;  4BDP A;  4UB3 A;  3BJY A;  3SZ2 A;  9ICQ A;  5KG5 A;  1CUK A;  1WCL A;  8ICG A;  4WC0 A;  5KFG A;  1XSN A;  1HUZ A;  4KLI A;  1DK2 A;  4DFJ A;  1ZYQ A;  4KLO A;  4LZD A;  1SL0 A;  3NTU A;  5HRL A;  5KFA A;  3TFS A;  4M2Y A;  1JQR A;  4XQ8 A;  4KTQ A;  1D8L A;  1ZQP A;  5KFV A;  2UVV A;  4O9M A;  5J2J A;  4DO9 A;  4RNO A;  3MFH A;  3QEB Z;  3RB6 A;  4NLN A;  9ICU A;  4S3N A;  5D46 A;  1DGS A;  3Q8L A;  3C1Y A;  4MFF A;  3GIJ A;  4M5D A;  1S0M A;  2O5A A;  4I29 A;  4QWC A;  4O3N A;  1L3T A;  3PML A;  2C2E A;  5DDM A;  4YR2 A;  3B0Y A;  1S0O A;  3Q8M A;  5IIM A;  3G6Y A;  3JPQ A;  2JZB B;  2P6R A;  5KG1 A;  2HHW A;  7ICV A;  3M9M B;  3OHB A;  4RWO A;  4LZG A;  2GWS A;  2P6U A;  1ZQU A;  3NGD A;  5J2K A;  2I9G A;  1ZQK A;  4DL5 A;  3RR8 A;  1Q78 A;  4FBU A;  1KTQ A;  3QZ8 A;  4DL3 A;  1U45 A;  3BQ2 A;  4ECS A;  1MIY A;  3GFK B;  3EPG A;  4DQP A;  5DQH A;  1BGX T;  2NRT A;  2NRW A;  2ZTD A;  4DS4 A;  3T3F A;  4F5P A;  5HP4 A;  3EWA A;  4RQ0 A;  4IG8 A;  3PW0 A;  1L3S A;  3C21 A;  3H4D A;  1U48 A;  8ICA A;  4NKT A;  5DQG A;  1VFG A;  3Q8Q B;  4Q44 A;  3QEA Z;  4ECR A;  2KZZ A;  4E0D A;  5HRB A;  2ZH9 A;  2XGP A;  8ICB A;  4GLX A;  3PNC A;  4DOA A;  4FS1 A;  4GXI A;  2RDI A;  2J6T A;  2AQ4 A;  4RPZ A;  1WCN A;  3PO5 A;  2UVW A;  4F4Y A;  4WC5 A;  3IM1 A;  1NJW A;  4RNM A;  3JYY A;  1LV5 A;  5CWR A;  2FLN A;  4ED1 A;  2DR8 A;  4ED2 A;  3UXO A;  5KG6 A;  1XS9 D;  4YCX A;  1NK6 A;  4TUS A;  4NLG A;  8ICC A;  3C2K A;  1ZQD A;  4DSJ A;  1ZQO A;  8ICP A;  4RWN A;  5DB6 A;  5DGA A;  4ED8 A;  3C1Z A;  5CHG A;  1SKW A;  1BPX A;  2W9B A;  4E7X A;  5F9N A;  2R8H A;  2M2V A;  4IQU A;  3H8S A;  4ECV A;  3OSN A;  4IRK A;  3V72 A;  3SYZ A;  7ICJ A;  2DRB A;  2JZB A;  3WFR E;  1H38 A;  9ICN A;  3V7K A;  4PHD A;  5DLF A;  3T5L A;  5CJ7 A;  1QSL A;  2IHN A;  2UVR A;  4AT8 B;  2Q66 A;  4MFC A;  2BQU A;  4WBY A;  1ZQC A;  2FMP A;  5J2C A;  2XY7 A;  2KZM A;  5CP2 A;  4ED7 A;  2BCU A;  3V6J A;  1D9F A;  4JK1 A;  4YN4 A;  5EWG A;  5HRI A;  1Z00 B;  3H40 A;  3HIY A;  3UXN A;  2DR9 A;  1EXN A;  5L1I A;  4DQQ A;  1S0V A;  3TAR A;  2PI4 A;  4C8O A;  2PBE A;  4X5V A;  4J9M A;  4KMU A;  4I2D A;  3L9D A;  4YMO A;  2FMQ A;  5KFY A;  4AT7 A;  3ETL A;  4B9N A;  4I2B A;  4O3S A;  2ZH5 A;  3BQT A;  4RQ7 A;  3RJK A;  4QZ8 A;  4XA5 A;  1F5A A;  3ZDC A;  3PR5 B;  4EBD A;  1ZQQ A;  4C8L A;  4PHE A;  4P4P A;  2V9W A;  4F2S A;  5KFE A;  9ICW A;  4TQR A;  5DG9 A;  2VAN A;  5DEC A;  1MSW D;  1ZQG A;  1TV9 A;  3V7J A;  3NYB A;  2AGO A;  4F4W A;  4ZH4 A;  3RAQ A;  3GV5 B;  4B9M A;  3JPT A;  3RH4 A;  9ICT A;  2BR0 A;  3C18 A;  4BWM A;  2F1H A;  3EZ5 A;  2DFL A;  3OJU A;  3KHL A;  1ZET A;  1D9D A;  5EOZ A;  2UVU A;  2BGW A;  2A1J A;  4QZH A;  4RUA A;  1TK5 A;  3RRG A;  3AUO A;  4DQI A;  2M2U A;  2ZH1 A;  2W9B B;  3T5H A;  4J9K A;  4EBC A;  4QZB A;  7ICG A;  2XY5 A;  3PO4 A;  3MR6 A;  3V7L A;  3SV3 A;  2V4Q A;  3N97 B;  3OJS A;  3OV7 A;  5BPC A;  4YQW A;  4Q45 A;  5KFD A;  8ICT A;  5KT4 A;  8ICZ A;  4ELT A;  4X4Q A;  8ICL A;  3EYZ A;  4K4H A;  3PMN A;  3OUY A;  5KFM A;  1UET A;  4ED3 A;  4DQR A;  4IR9 A;  4F4X A;  1QLN A;  1C7Y A;  2BKE A;  4O3P A;  4YXJ A;  4YR0 A;  1ZQA A;  3HX0 A;  8ICK A;  3JPP A;  2VA3 A;  1KSP A;  5KTQ A;  3PX4 A;  4FBT A;  4Q8E A;  3MFI A;  5J2F A;  3ZDB A;  5IIN A;  5IIK A;  4DSL A;  3ZDE A;  1BPZ A;  4I2H A;  4DF8 A;  5D4B A;  2ZH6 A;  1T3N A;  2DRA A;  2VA8 A;  4QW8 A;  5J0X A;  4RQ6 A;  4DOB A;  3C2L A;  1U9L A;  1ZQY A;  2Y1I A;  1NJZ A;  4JV2 A;  5DQI A;  4IQT A;  3T5J A;  3ZD8 A;  5KT3 A;  4J9N A;  1ZQL A;  5KFU A;  3HP6 A;  5J0U A;  4QZF A;  3RRH A;  4O0I A;  9ICV A;  3RJF A;  5DB9 A;  4ATB B;  4MFA A;  4ED6 A;  2BDP A;  2KTQ A;  1YLQ A;  1QSY A;  4G3I A;  2AJQ A;  4ECY A;  4IRC A;  4WC6 A;  2M9N A;  5KG7 A;  2B21 A;  4IQW A;  2ZJ5 A;  2PFP A;  3OGU A;  2R8I A;  4RQ5 A;  4K4I A;  4JWN A;  4F2R A;  1RPL A;  1JXL A;  5F2V O;  4J9P A;  5J2D A;  4RPX A;  2MAX A;  4ECZ A;  4J9L A;  2R8K A;  2ZH7 A;  1S77 D;  1IXR A;  4AT8 A;  4F50 A;  5KFQ A;  2FMS A;  4EZ6 A;  3ISB A;  1KLN A;  4RQ1 A;  2ISO A;  4LT6 A;  2W8K A;  4WCW A;  4UB1 A;  3MDC A;  4ELV A;  4MF8 A;  2MUT A;  2HHU A;  1XWL A;  4EBK A;  4M9G A;  2ZUD A;  3M8S A;  4QWE A;  4R65 A;  1V4A A;  3BQ0 A;  4ECU A;  2XCP A;  2W9C A;  4DL6 A;  4KLJ A;  2BPC A;  1TFR A;  4YFK A;  4Z6E A;  2W9A A;  4C8N A;  2XY6 A;  3LQC B;  1NK8 A;  4JV0 A;  3Q8K A;  5HNK A;  5BOL A;  1HJP A;  3C5G A;  1ZQT A;  2PFQ A;  4B9T A;  4IR1 A;  5HRE A;  1MIW A;  4FHV A;  7ICO A;  4YG2 A;  4M9J A;  8ICI A;  2C28 A;  5KFC A;  4DFM A;  3AQL A;  3MR2 A;  4PGX A;  4QWA A;  3PW2 A;  1L3U A;  8ICM A;  3AQM A;  5DLG A;  4KLM A;  1ZQE A;  5IIJ A;  4KLT A;  1S97 A;  2ATL A;  1R89 A;  4YP3 A;  3GII A;  4FH3 A;  4KLH A;  4FHW A;  3WFP A;  2DVI A;  4PGQ A;  4C8K A;  3TI0 A;  3RJE A;  4O3Q A;  3H3A A;  4PHP A;  3RTV A;  3UXP A;  1MIV A;  2ZH4 A;  5KFW A;  7ICQ A;  1N48 A;  3ZDA A;  2F1I A;  4O5E A;  2HHV A;  3RJG A;  9ICI A;  3GV8 B;  4WC2 A;  2DR7 A;  4YMM A;  1ZQB A;  4KLD A;  4MEX A;  4X0A A;  3SV4 A;  4Q43 A;  3KHH A;  1KNY A;  2M2T A;  3UPQ A;  1NOM A;  2ID1 A;  3PX0 A;  1JX4 A;  2BCV A;  1NO5 A;  3MDA A;  4ECT A;  1NZP A;  9ICF A;  2W9M A;  3RJJ A;  5KFS A;  2IMW P;  1JAJ A;  9ICR A;  4UAW A;  1NJY A;  3PW5 A;  2BPF A;  2IHM A;  4I27 A;  2WTF A;  3MGH A;  2BHN A;  4B9U A;  2XC9 A;  1S0N A;  1ZQJ A;  4DF4 A;  5J0Y A;  4KLG A;  2KFZ A;  4UD5 A;  4YD2 A;  5D49 A;  1T4G A;  3GV7 B;  1A77 A;  4DFK A;  1TK0 A;  4UB2 A;  4R63 A;  2ZTC A;  1JXE A;  3GIM A;  3M9O B;  4J9S A;  5J29 A;  1BPY A;  7ICT A;  8ICV A;  4YMN A;  3B0X A;  4YD1 A;  4KLQ A;  3UPS A;  3Q8R B;  7ICR A;  1RYR A;  4P4M A;  7ICM A;  2JEJ A;  4RWP A;  1BPB A;  4UBC A;  4ED0 A;  4FH5 A;  4DSI A;  1JN3 A;  1Z00 A;  1XSL A;  1X2I A;  1U49 A;  4UB4 A;  2FPM A;  4Z6C A;  2DPI A;  1T7P A;  2DR5 A;  4QZ9 A;  2R8J A;  4GXJ A;  5KG0 A;  4F92 B;  9ICJ A;  5DG8 A;  4J9R A;  7ICU A;  4XUS A;  3C2M A;  3M9N B;  5KT2 A;  4RQ8 A;  3ISC A;  3RJH A;  3Q8S B;  4F5O A;  1LB2 B;  2I1Q A;  1ZQV A;  2HHS A;  4FHX A;  8ICY A;  4RUC A;  2BE3 A;  4UB5 A;  5J0W A;  2MUT B;  4RQ4 A;  2ZH2 A;  1TAU A;  2HHT A;  3QE9 Y;  2Q0Z X;  1B43 A;  5KFK A;  4DWI A;  9ICE A;  2FLL A;  3HJ4 A;  5F9L A;  4QW9 A;  5C5J A;  1ZJN A;  4QZC A;  2BCR A;  4M6W A;  1T8E A;  4RT3 A;  5KG4 A;  3TFR A;  1ZQH A;  2C22 A;  5HHI A;  3ISD A;  2ZJ8 A;  3LDA A;  3GQC A;  3OVB A;  2OWO A;  1RXW A;  1CEZ A;  3MGI A;  1N56 A;  2RFF A;  4DL4 A;  1ZQI A;  4X4O A;  4Z6F A;  1SZP A;  2ZUB A;  2Y1J A;  4I28 A;  5J0Q A;  4ECQ A;  1ZQN A;  4BXO A;  4BGD A;  1NKC A;  1U47 A;  2ISP A;  1XC9 A;  9ICB A;  1R8C A;  4IRD A;  3HPO A;  5J2B A;  4P4O A;  4F5Q A;  3KHG A;  3C5F A;  8ICO A;  1COO A;  4KLF A;  3AQN A;  1S76 D;  4RPY A;  5KFX A;  1L3V A;  4F8R A;  1KFD A;  4TUQ A;  5KFI A;  4P2H A;  4MEY A;  3TAQ A;  1NKB A;  3H8W A;  5CR0 A;  4TQS A;  4FO6 A;  3TQ1 A;  1UEV A;  3RJI A;  4WC4 A;  1UT8 A;  3IHQ B;  4I2G A;  5KFT A;  4M9L A;  1K1Q A;  1B22 A;  1SL2 A;  4EEY A;  5J0P A;  5J2A A;  3RBE A;  1NJX A;  4QZD A;  4I2F A;  4X4P A;  3G6V A;  1RXV A;  3OUY B;  3JPS A;  5KT5 A;  1QSS A;  3RB4 A;  3HT3 A;  4DQS A;  3PX6 A;  4KLS A;  4RQ2 A;  3UQ0 A;  4MF2 A;  4O5C A;  4NLZ A;  1TKD A;  9ICM A;  1FA0 A;  1ZQM A;  1X9M A;  3H7I A;  5IIO A;  4C8M A;  4XQ7 A;  4WC7 A;  4UD4 A;  3E2E A;  2F1J A;  3OHA A;  1IM4 A;  1D8Y A;  3WFQ E;  3KHR A;  3PW4 A;  2W9C B;  3THV A;  1TK8 A;  3C66 A;  4X4R A;  3BDP A;  2JEI A;  1OU5 A;  4I2I A;  2IBK A;  5KFJ A;  2PFN A;  1X9S A;  4EZ9 A;  5DBC A;  8ICR A;  3WFS C;  5L1K A;  1ZJM A;  1NK5 A;  5L1J A;  2NRZ A;  4I2A A;  5KFZ A;  3GIL A;  5HC9 A;  4X4T A;  4F3O A;  3PVX A;  2HW3 A;  1Z3E B;  3RH5 A;  4DLG A;  4B9S A;  4NXZ A;  4HYK A;  3RR7 A;  2KZ3 A;  4DEZ A;  5DBA A;  4DL2 A;  1KDH A;  3RAX A;  1KFS A;  1BNP A;  2ZHA A;  9ICA A;  2ASJ A;  5L1L A;  5DGB A;  4BWJ A;  1ZQS A;  3FYH A;  4YR3 A;  5KFF A;  8ICN A;  3LK9 A;  4BXO B;  3K4G A;  2ZHB A;  4O3O A;  4IQV A;  2A1J B;  4DSF A;  1KRP A;  4AT7 B;  1MQ2 A;  4KLL A;  4QZI A;  4UAZ A;  3QZ7 A;  2FPL A;  3AQK A;  3EPI A;  4I2E A;  2ZUC A;  4AT9 A;  3JZ0 A;  3ZD9 A;  4DOC A;  4ATB A;  1S9F A;  4TUP A;  3WFO A;  5IIL A;  3JPN A;  5HRH A;  2ZH8 A;  5KG3 A;  5L9X A;  4UAY A;  1JIH A;  4QZE A;  4QZA A;  5EWE A;  2DPJ A;  1SKS A;  4JUZ A;  4Z6D A;  9ICC A;  8ICH A;  2VA2 A;  5HML A;  1TFY A;  5KFR A;  5KFP A;  4CCH A;  5DED A;  2C2D A;  4LVS A;  3EW9 A;  1ZQF A;  3H4B A;  5DBB A;  3C23 A;  4X4N A;  3JPO A;  5III A;  1BVS A;  5KFH A;  1RYS A;  5KFL A;  5JUM A;  2XGQ A;  5KFN A;  4DSK A;  5KG2 A;  2KN7 A;  4DLE A;  2KP7 A;  4KN4 A;  4YXM A;  4M9N A;  1ZQR A;  3M8R A;  2PFO A;  1JMS A;  1ZQW A;  2AU0 A;  4X0B A;  4NY8 A;  4DFP A;  4QWD A;  3HJ1 A;  1RZT A;  3KTQ A;  4FHY A;  1Y88 A;  4F4Z A;  4I2C A;  3ORY A;  4O5K A;  9ICS A;  1KFT A;  1BNO A;  1SKR A;  3PV8 A;  4B9L A;  4X4S A;  2JEG A;  7ICH A;  7ICL A;  2HHX A;  2C2R A;  3V6K A;  4O3R A;  3T5K A;  2KFN A;  1R8B A;  3H37 A;  3Q8P B;  3MAB A;  5J0O A;  3MBY A;  3RBD A;  4ELU A;  4PGY A;  9ICO A;  4JV1 A;  2HVH A;  2NRK A;  2IA6 A;  3AU2 A;  1BPD A;  4R8U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...