5J0TA

Binary complex crystal structure of dna polymerase beta with g:a mismatch at the primer terminus
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
330
structure length
327
Chain Sequence
APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 109
structure length 327
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0tA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0tA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0tA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0tA03
4JWNA 1SKRA 1ZQFA 1BNOA 3RBDA 3MR5A 1F5AA 3GQCA 3NYBA 1XSLA 5KFEA 3N4MB 4I2HA 4KLSA 1TFRA 3AQMA 5J0SA 4BWJA 1NK5A 9ICGA 5DBAA 1C7YA 1S76D 3V6KA 2ZUDA 3RR8A 4MFCA 8ICEA 2C28A 4QWCA 5L1LA 8ICKA 4KN7A 5KFFA 3MBYA 2C2DA 7ICEA 3EW9A 1SKWA 3OUYB 1TFYA 1Q78A 4QZCA 4F92B 2PXIA 2P6UA 3SI8A 2UVUA 1X9SA 4R65A 4RQ4A 4F4YA 3PW2A 4RNOA 4X4TA 2B21A 1PX5A 1UA1A 4ECTA 4O3RA 4F3OA 1NK4A 4ED8A 7ICNA 3WFQE 5HMLA 4J9OA 3C18A 3OHBA 5KT7A 2BCRA 4RWPA 3G6XA 4ECZA 2DR8A 5KG2A 3K75D 2PFOA 5DGBA 1BNPA 4EBKA 4X4RA 1JQRA 1L3SA 3C5GA 1T8EA 5KFAA 1ZQKA 2J6TA 3UPSA 8ICNA 3PW5A 7ICGA 4UB1A 1IM4A 5HHHA 4WC7A 4UD5A 2Y1JA 4B9SA 1QSLA 3MDAA 4X4QA 3BDPA 2IHNA 1BGXT 2HVIA 2ZH5A 3WFSC 4RUCA 1ZQYA 2ZTEA 2C22A 4DSKA 1ZQAA 2V9WA 4XUSA 3PR5B 2HW3A 2ZH9A 1V9PA 4DOBA 4C8OA 4RNNA 4NY8A 3EZ5A 3QEBZ 4EP7A 5IILA 3G6YA 2AU0A 3QE9Y 4YD2A 4AT7B 2MUTA 3EWAA 4M0AA 3QZ8A 5HP4A 2XO7A 1KFSA 1Z00A 1ZQSA 1UT8A 3E2EA 5CA7A 4BGDA 1JAJA 5IIOA 1Z00B 3MABA 4YN4A 3HX0A 3RRHA 4F4KA 5DQIA 3C5FA 4NLZA 2A1JA 2XCPA 2HVHA 2BR0A 4XRHA 4RQ8A 3HW8A 4ED3A 3M8RA 1KFTA 5J2BA 5BPCA 4DOCA 1TAQA 4I2JA 4IQVA 4I28A 5DG9A 2BDPA 3RJHA 5HREA 1TK5A 1RXWA 4M5DA 2BGWA 1NKBA 3ORYA 7ICRA 3T5JA 5J0OA 2DPJA 1NK0A 7ICJA 3LWLA 5HHIA 2XY7A 7ICTA 4DL5A 3K4GA 2ZJAA 5CP2A 4GC7A 2ZH6A 5J2JA 8ICTA 7ICPA 2J6UA 2ZJ8A 1S10A 3RJKA 1ZQEA 3PW7A 2ISOA 4RQ7A 9ICCA 1X9MA 1NJXA 4ED0A 3HPOA 4EBCA 4I2EA 5IINA 3V7LA 5J0WA 3RTVA 3C2KA 4IRCA 9ICVA 4X4SA 4PPXA 4WC0A 3EPIA 1ZQOA 4J9QA 9ICXA 5BOLA 3OSNA 3AUOA 1HJPA 2RDIA 5KG4A 4GXKA 4ECSA 2F1JA 4O3SA 4WC3A 4DEZA 4ECXA 2W9MA 1R8CA 2ASDA 9ICIA 9ICEA 2DVIA 3RRGA 1NZPA 3MFIA 3RBEA 4B9LA 5KG6A 2R8IA 1U45A 4KTQA 2BPFA 4M47A 5HRGA 1WOTA 1KDHA 4I2DA 4DQRA 1K1QA 3ETLA 2RDJA 3V7KA 5DKWA 4RNMA 3PMNA 4QZ8A 1RPLA 4TURA 1NOMA 1ZQXA 4PHAA 3RJIA 7ICMA 1SL1A 2M2UA 8ICIA 1HUZA 3NGDA 4ELUA 8ICXA 3V6HA 1WCNA 2ZH7A 1JIHA 5KFJA 3JPPA 3RAXA 5IIIA 4ECUA 1T3NA 4F5OA 4NLKA 5DQHA 3Q8LA 4WC5A 4DLGA 2NRZA 5DDYA 5JUMA 4Q43A 4PGYA 1XSPA 1S97A 5KFLA 1MQ2A 4B9VA 2F1IA 2H5XA 3M9MB 3ISDA 3BQ2A 8ICQA 8ICZA 4UB4A 2BCVA 1BPEA 3ZDDA 3GIKA 2MUTB 4KLFA 4TUPA 9ICRA 3MGIA 1D8LA 4ECQA 3ZDBA 4HYKA 1D8YA 2BQUA 4DQIA 4QZHA 1JXLA 1XWLA 5KFYA 2AGQA 2UVRA 2ZHAA 1UT5A 5KG7A 9ICAA 1B22A 4E8FA 3ZD8A 5DB9A 2FMSA 1TV9A 3OVAA 3ZD9A 4IQUA 4IR9A 1S0VA 1L5UA 1QSSA 4MEXA 4BXOB 3JPTA 4YP3A 1N56A 8ICYA 7ICOA 1Q79A 2Q0ZX 4JK1A 3GFKB 5CWRA 4GXIA 3T3FA 3N97B 3GIIA 3H4BA 4M9JA 2JZBB 1LB2B 8ICPA 1X2IA 3UXNA 5KFTA 2BKEA 2XCAA 4F5PA 3AQKA 5D4BA 3ZDAA 4E0DA 4EBDA 5DG7A 5IIKA 5J2CA 4DSIA 5HR9A 3H8WA 2ZH4A 3BQ0A 4P4PA 4RUAA 2UVVA 4GC6A 3T5HA 4M2YA 1NKCA 4KLIA 4FHYA 5KTQA 3AQLA 3Q8PB 4FBTA 2I1QA 5KFMA 4BWMA 5KFKA 3M9OB 2JEFA 4M9LA 1DOQA 4DL3A 5DGAA 2FLNA 1SZPA 5DBCA 3GILA 4DF8A 1ZQMA 5J2GA 4KITB 4ELTA 3Q8RB 8ICOA 4QZFA 5KFSA 1DK3A 1RXVA 9ICWA 9ICNA 4X4PA 2DRBA 3LK9A 3OGUA 5J2KA 3TQ1A 5C5JA 3PX0A 3ISCA 4M04A 2HHWA 4O9MA 2ATLA 2BCQA 4IQWA 3B0YA 9ICHA 4EBJA 1A76A 2ZTDA 2FLLA 3RH6A 8ICWA 3BJYA 4DOAA 5DG8A 4LZDA 2BCSA 4TQSA 4O3QA 2IMWP 4F93B 4M9NA 3PR4A 1NK7A 2HHXA 5L9XA 3KHRA 1X9WA 3H3AA 2ZJ5A 3QZ7A 3MDCA 4EYIB 1MC8A 1U49A 2KZ3A 5KFBA 4QZBA 7ICLA 5CJ7A 4QZGA 4F8RA 5KG3A 3PX4A 4RPZA 3EPGA 3AQNA 3UXOA 3V72A 3RH5A 1U4BA 4Q8FA 1ZJMA 4DL4A 4CCHA 4MEYA 3BQ1A 4AT8A 4PHPA 1L3TA 2FPMA 5DQGA 4ED2A 4X4NA 5HRDA 4YMNA 3GDXA 2NRTA 4RQ6A 1U47A 4C8NA 1Y88A 3TFRA 2HHVA 3Q8MA 4RWNA 3GIJA 2PI4A 4O0IA 1NJZA 4E7XA 1KEJA 1TK0A 4RZRA 2ZH1A 3MGHA 4DSFA 2I9GA 4K4HA 1ZQBA 4G3IA 4R66A 3RJJA 4RPXA 4Q45A 4EBEA 5HC9A 5J0XA 3HJ4A 2FPKA 4X0BA 2HHTA 5KT4A 4RWQA 2OWOA 2W9BB 2M2TA 5KT3A 3RH4A 4R64A 3GV8B 4XQ8A 4RU9A 4FH5A 4Z6DA 5KT2A 3GV5B 4FS1A 2P6RA 4F2RA 4ZH4A 3ISBA 4DQPA 5DB7A 4MFAA 4DSJA 4KLQA 1S0NA 3L9DA 4B9MA 2NRXA 2HHPA 4DFMA 4QZ9A 3TAQA 1TAUA 2NRVA 5KFQA 5KT6A 1XSNA 4ATBA 3PW0A 5HRKA 4FHVA 2KFZA 1BPXA 4Q44A 4YR2A 2V4QA 2JZBA 4DFKA 1ZYQA 5KFCA 4YR0A 1CEZA 1EXNA 5KT5A 5DBBA 2KZMA 4R63A 1TKDA 4M9HA 9ICOA 4YXJA 2DFLA 2FMQA 4DQSA 4YR3A 2KZZA 4X4VA 3MR2A 1ZQZA 4TUQA 1AROP 3LWMA 4JV0A 4P4MA 1ZQLA 2M2VA 1KFDA 4I2IA 8ICCA 5J2AA 2DRAA 1T4GA 2ZUBA 4RT2A 2BPGA 2DPIA 1ZETA 2ISPA 1ZQQA 4RT3A 5J0TA 3JPQA 1VFGA 5DDMA 8ICJA 2JEIA 4LVSA 1S9FA 4QW8A 5DLGA 3WFRE 1NKEA 3JPSA 2R8KA 4C8MA 4YFKA 2XY5A 4F5QA 5TZVA 1B43A 1BPDA 2BE3A 1QTMA 3C66A 4NKUA 4DL7A 1R8AA 1RYSA 2ALZA 1NJYA 4DS4A 2BHNA 2AGOA 4O3NA 3OSPA 2O5AA 4C8LA 2R8JA 4QWBA 3JPRA 5D49A 1ZQDA 3H8JA 3IM1A 5IIJA 3HP6A 4ELVA 5F2VO 3PX6A 4Z6CA 4X4OA 3PW4A 2PFPA 4WCWA 1TFWA 5HRBA 2LYHA 4QZIA 8ICGA 3JYYA 3ZDEA 2AQ0A 5KFZA 4FO6A 5J2DA 4WC6A 4DLEA 2W8LA 4QZEA 9ICLA 4FH3A 4XQ7A 1R89A 3TANA 4KLEA 4XA5A 4ED7A 5IIMA 3PV8A 4M6WB 4FHWA 3M9NB 2JEJA 3NTUA 5J0QA 3WFPA 3C1ZA 5L1JA 4GXJA 1ZQRA 1SL0A 3RAQA 4FS2A 4EZ6A 3PNCA 4J9MA 3UPQA 1KNYA 1MIVA 1MIYA 1YLQA 1IXRA 7ICSA 4IQTA 4MF2A 3C1YA 5EWFA 3SV4A 4EEYA 2FLPA 5EWEA 1OU5A 5CHGA 5HNKA 1ZQUA 2BQ3A 4KLMA 1KRPA 4UAYA 4B9TA 1MIWA 3LDAA 4DSEA 2AGPA 5L1IA 4PHEA 2DR5A 9ICJA 4KLOA 4IG8A 4WC1A 1XS9D 3OUYA 5KFIA 2HHSA 2IHMA 4KN4A 7ICUA 2KN7A 1K1SA 3RB4A 3H7IA 4YMMA 2ID1A 3QEAZ 4KMUA 2IA6A 4UB3A 3IHQB 4DF4A 4DFPA 2ASLA 1S0MA 2PI5A 4NM1A 4RQ1A 5KG5A 3Q8SB 5EOZA 4RWOA 1WCLA 4EZ9A 4YG2A 2ZH2A 1DGSA 4QWAA 5DLFA 1LV5A 1L3VA 3RB0A 1ZQJA 2HHQA 4WBZA 5DEDA 4B9NA 4RQ0A 3TARA 1UETA 4B9UA 9ICTA 4AT9B 4E80A 4NKTA 3GV7B 3HT3A 4X0AA 3PMLA 1ZQWA 4I2FA 3KHGA 3Q8KA 3T5LA 3UQ2A 4LZGA 2MAXA 5D46A 4P4OA 3THVA 1BVSA 4J9PA 4O5EA 4PGXA 4YVZA 4QZDA 1QLNA 1V4AA 3UQ0A 2VA2A 1HUOA 4FBUA 4MF8A 4DSLA 4IRDA 4IRKA 4Q8EA 1VJ7A 5J0RA 3B0XA 2WTFA 4KLGA 4ECVA 1NK9A 4KLHA 1ZQVA 5HRFA 3ZDCA 8ICUA 8ICVA 2JEGA 5KFUA 4F5RA 1A77A 4F2SA 2BQRA 2Y1IA 4DL6A 2F1HA 1N48A 4MFFA 8ICFA 3Q8QB 3C2MA 4RQ2A 7ICVA 3JZ0A 2RFFA 1JX4A 2KTQA 1R8BA 4F4ZA 4NLNA 2J6SA 4JV2A 4Z6EA 7ICKA 4ECWA 3AU6A 2FPLA 4Z6FA 3H40A 3H4DA 4F4WA 4LT6A 2Q66A 4KLDA 3OVSA 5J0YA 3SYZA 4PHDA 5HRIA 2PBEA 3EYZA 5J2IA 1RZTA 5KFPA 4UAWA 5KFRA 5HRLA 1JXEA 5F9NA 2W9CB 4F50A 1KLNA 5F9LA 4TUSA 3TI0A 3M8SA 2HHUA 1JN3A 2P66A 4DL2A 1S0OA 3C2LA 9ICFA 1TVAA 8ICHA 2V4RA 2W9CA 8ICBA 1FA0A 4QWDA 1CUKA 2C2EA 3RJGA 2O1PA 3JPOA 4O3PA 2C2RA 3H38A 3H8SA 4YD1A 1COOA 5KFOA 8ICMA 2ZH3A 4KLUA 3H39A 1ZQPA 4F5NA 2DR9A 3KHLA 2XGPA 4PGQA 1JMSA 4DWIA 9ICQA 3WFOA 2PFQA 8ICLA 2UVWA 5KG1A 5J2EA 9ICMA 3BQTA 4ED1A 1NK6A 4ECRA 2ASJA 2M9NA 1ZQCA 4KLJA 3HIYA 4TQRA 1KTQA 2R8HA 1RYRA 4AT7A 4WC4A 4J9NA 4DFJA 3LQCB 4S3NA 5CB1A 4UB2A 5DB8A 2DR7A 4P2HA 3MFHA 2W9BA 4RQ3A 4NM2A 4O3OA 4JWMA 9ICSA 2ZH8A 2ZUCA 4GLXA 4J9RA 3RR7A 4BXOA 4NXZA 4J9LA 2A1JB 8ICAA 4X5VA 1UEVA 1ZQIA 4KLLA 1XO1A 5J0PA 1XU4A 3MR3A 2W9AA 4YCXA 3UXPA 2PFNA 2IBKA 4DS5A 5EWGA 4PH5A 4ECYA 5KFWA 1SKSA 9ICBA 1U9LA 4I27A 4YMOA 3KTQA 3OJUA 4M9GA 2BPCA 5L1KA 7ICHA 4NLGA 2VA8A 4J9SA 9ICKA 3TFSA 5DB6A 5BOMA 2VA3A 5CR0A 8ICSA 4X4UA 3OHAA 2R8GA 3RJFA 1NK8A 5KFVA 1KSPA 3SZ2A 3JPNA 1PZNA 2XGQA 1BPBA 3RJEA 4F4XA 5HRHA 1MSWD 1L3UA 3OVBA 1NJWA 3C23A 1MQ3A 2VANA 5J2HA 2AQ4A 1U48A 4I2BA 3RB6A 4C8KA 3V7JA 8ICRA 4M6WA 2M2WA 1XC9A 5KFXA 1TK8A 2W8KA 2GWSA 4AT8B 4RPYA 5HMMA 4ED6A 2XY6A 1UA0A 5KFNA 3PY8A 2ZTCA 4YQWA 2AJQA 1UEUA 5J29A 3OJSA 2BCUA 1BPZA 4DO9A 4UBBA 3HJ1A 1D9FA 4FHXA 4R8UA 4QZAA 3MR6A 3V6JA 4O5CA 4F91B 1ZQNA 9ICUA 4UD4A 4YXMA 5KFGA 3HWTA 4UBCA 4I2GA 4R8UB 4UQGA 4FHPA 4JV1A 9ICPA 3GIMA 1SL2A 4WC2A 4UB5A 4RQ5A 1BPYA 3T5KA 3PO4A 7ICQA 2KP7A 1ZQGA 1QSYA 5KFHA 3TAPA 1ZJNA 1Z3EB 1T7PA 4O5KA 4JUZA 3H37A 5J0UA 3KHHA 4K4IA 4I2CA 3G6VA 2KFNA 1DK2A 4UAZA 5J2FA 4QWEA 1ZQTA 2NRWA 4I2AA 3SV3A 4K4GA 1NO5A 5KG0A 2XC9A 3PO5A 3C21A 3OV7A 4QW9A 5KFDA 3AU2A 7ICFA 4IR1A 3FYHA 5DECA 4J9KA 7ICIA 4ATBB 1H38A 4BDPA 1D9DA 2FMPA 3FDSA 3RB3A 3PVXA 4WBYA 4I29A 4KLTA 2ZHBA 1S77D 1ZQHA 2NRKA 4AT9A 4EYHB 4DQQA
chains in the Genus database with same CATH superfamily
1V38A 2ES6A 1ZQFA 3AQMA 2VIXA 4BWJA 5JRTA 4UB8U 4OJPA 4KM5A 4KN7A 3MBYA 2C2DA 1TFYA 3SI8A 2UVUA 3IV6A 4R65A 5AM0A 5ALGA 3WK5A 1PX5A 3F2BA 2Q4TA 1DRGA 3WFQE 3OHBA 2DR8A 1BNPA 1JQRA 3C5GA 2G5IB 1RG6A 3PW5A 7ICGA 3B9JA 5HHHA 5ALXA 1QSLA 4CF3A 4DSKA 1ZQAA 2IHOA 5AKYA 3PR5B 2ZH9A 4C8OA 4NY8A 3EZ5A 3QEBZ 5IILA 3I28A 3G6YA 1C20A 4EX6A 4YD2A 3QZ8A 1KFSA 2QARA 3PSTA 3K1ZA 1Z00B 3RRHA 4EEDA 4I2JA 4I28A 2LYAA 1Z1BA 3RJHA 1TK5A 2BGWA 1NKBA 3ORYA 5J0OA 2DPJA 3H8MA 5HHIA 3M6KA 4U7CA 2BBJA 3HPOA 5D61A 3V7LA 3RTVA 1ED1A 5ALJA 4X4SA 2B4VA 3EPIA 1ZQOA 4J9QA 3AUOA 2RDIA 5KG4A 4ECSA 2F1JA 4O3SA 2DVIA 1Q8KA 2NO5A 5HRGA 5KG6A 2R8IA 2G08A 1WOTA 1WYGA 5AKIA 2GH1A 2HOIA 3QU9A 4AT8B 1RPLA 2W11A 1NOMA 5AM5A 2OHFA 3NGDA 3VCBA 1WCNA 2ZH7A 1JIHA 1SB3C 3JPPA 3QUBA 3RAXA 5IIIA 4NLKA 4LEZA 5ALLA 4DLGA 2NRZA 5DDYA 5JUMA 5KFLA 3BQ2A 4TUPA 1D8YA 1LKYB 1D8BA 1F0MA 2WB1C 3ZD8A 5DB9A 3OVAA 4IQUA 3JPTA 4YP3A 8ICYA 7ICOA 4K9AA 2Q0ZX 3T3FA 4M9JA 3H4BA 2JZBB 4FZMA 4F5PA 3H8WA 2DKZA 5ALSA 4RUAA 2UVVA 3T5HA 3Q8PB 5KFMA 1HIWA 4CE6A 2JEFA 4DL3A 2YN4A 5DBCA 8ICOA 4ELTA 2H3IA 3NKUA 3PSPA 3PX0A 2HHWA 2BCQA 4IQWA 2KK0A 3BJYA 5DG8A 2BCSA 1KW4A 4TQSA 2IMWP 3C29A 4K96A 3PR4A 5L9XA 1X9WA 7ICLA 5GTHU 5KG3A 2ODGA 3UMCA 4Q8FA 1ZJMA 4MEYA 4Y2QA 2E1EA 4KX5A 3GDXA 4C8NA 1Y88A 3TFRA 4KB6A 3Q8MA 2PI4A 2OCEA 1NJZA 1TK0A 2ZH1A 4DSFA 2I9GA 1ZQBA 4RPXA 2WAQC 3E0FA 5J0XA 5HC9A 4X0BA 2HHTA 3QYPA 2W9BB 5ALRA 2F3NA 3GV5B 2P6RA 4ZH4A 4MFAA 2L5YA 3L9DA 2HHPA 4QZ9A 1T3QA 2EANA 3PW0A 1N60A 4P0QB 5HRKA 2NV3A 3UMGA 1BPXA 3WKCA 2V4QA 1ZYQA 5AI6A 1NI3A 1B4FA 1CEZA 1EXNA 2NYVA 3NRWA 2EAOA 3M6ZA 2GLEA 1TKDA 9ICOA 4UAVA 1ZQLA 3LWMA 1Q46A 4P4MA 8ICCA 1T4GA 2KJ9A 2ZUBA 1N61A 2DPIA 1ZETA 1ZQQA 4RT3A 3L4PA 3CK6A 3JPQA 3AEVA 2RHFA 4QW8A 5DLGA 1S9FA 3WFRE 1NKEA 2XY5A 4F5QA 2BE3A 1QTMA 4NKUA 3H0LB 4OJOA 2WF9A 2QARB 4WH5A 1SV4A 5D49A 1ZQDA 5ALTA 2PMZF 2KMDA 5F2VO 3PX6A 4Z6CA 2PFPA 2WFAA 4USAA 4FO6A 5KFZA 5J2DA 2ZIUB 3TANA 4CF4A 4UAUA 5AIBA 2DQNB 4NXTA 5J0QA 4GXJA 2QKQA 3D2QA 4EZ6A 4J9MA 2OXOA 3RF9A 1YLQA 1IXRA 3WK7A 7ICSA 3HILA 2HCFA 1ZQUA 4OCZA 3UM9A 3OWGA 2BZFA 1L8OA 3OUYA 4YMMA 1PK1A 2ID1A 4KMUA 2IA6A 1S0MA 2PI5A 1L8LA 2DKXA 5EOZA 4RWOA 2ZH2A 4QWAA 5DLFA 4WBZA 1L3VA 2HHQA 4AT9B 1UETA 4WC5A 4E80A 3PMLA 4I2FA 4LZGA 3KHGA 3UQ2A 4O5EA 2MAXA 2YQEA 4P4OA 1BVSA 1V4AA 4YVZA 4QZDA 3UQ0A 4FBUA 3ED5A 1HUOA 4MF8A 2YMMA 5KAIU 1VDVA 8ICUA 2AH5A 4F5RA 4EX7A 4DL6A 4ACOA 1QCKA 2GO7A 2RFFA 2Y0SC 4F71A 3AQFA 2OH2A 4NLNA 3CYMA 4JV2A 4LT6A 2Q66A 3AU6A 4F4WA 2KV2A 4KLDA 2P35A 5J2IA 1RZTA 1OW5A 5KFRA 4F50A 5F9LA 4QIWF 3M8SA 1JN3A 1N5WA 2A1AA 2KOBA 3U26A 2P66A 8ICHA 3JPOA 3H8SA 5KFOA 1COOA 1ZQPA 4F5NA 3KHLA 5ALPA 4DWIA 9ICQA 2HBMA 2PKEA 1NK6A 1QQ5A 2M9NA 1KTQA 4NXVA 5CB1A 1SXEA 3MFHA 4NM2A 5HR6A 1Q3VA 4BXOA 4J9LA 3I76A 8ICAA 3E58A 4YCXA 2IBKA 5EWGA 2ZIVA 3IDWA 1TAMA 4PL2A 1U9LA 1K5OA 3KTQA 3OJUA 1J2MA 2BPCA 2YB1A 5DB6A 2VA3A 8ICSA 2R8GA 3ICXA 5ALQA 1NK8A 5KFVA 2FDRA 3SZ2A 2FCLA 4XJEA 3WK4A 2KIVA 3ETRA 5AIAA 4I2BA 2AQ4A 4C8KA 4EGWA 2XY6A 3PY8A 2ZTCA 3F5AA 1BPZA 4DO9A 4UBBA 2KJ8A 3MR6A 2WF8A 1ZD4A 2JH1A 4B6JA 5KFGA 4JV1A 4J03A 2FI1A 4WC2A 3T5KA 2KSOA 7ICQA 1ZQGA 3TAPA 1ZJNA 3K7DA 3KHHA 4K4IA 4I2CA 3G6VA 1ZQTA 5J2FA 2OYYA 4K4GA 3C21A 4QW9A 3FYHA 4ATBB 4LEWA 4BDPA 3IRUA 3RB3A 4WBYA 4I29A 3R9KA 1ZQHA 4EYHB 4JWNA 3RBDA 1F5AA 3NYBA 1XSLA 5KFEA 2F2AB 4KLSA 2EZZA 3N28A 3V6KA 3RR8A 3NUQA 5L1LA 3EW9A 1Q78A 2PXIA 2XICA 1X9SA 3PW2A 4RQ4A 4F4YA 1PK3A 2B21A 4CGZA 4ECTA 7ICNA 1NK4A 5HMLA 4J9OA 3C18A 2LM4A 4C80A 2BCRA 3EF2A 3G6XA 4RWPA 3K75D 2KJ5A 1L3SA 8ICNA 4UB1A 3QUCA 2Y1JA 4B9SA 1COKA 2KVSA 1JRPA 4X4QA 3BDPA 1BGXT 1MA7A 5J8YA 2HBLA 2C22A 2HW3A 4DOBA 4A8EA 4O3MA 2AU0A 2R18A 3EWAA 1SWWA 2XO7A 1Z00A 1UT8A 4BGDA 3HX0A 3TADC 3TADA 4US9A 1KFTA 2LYBA 3N7RC 2BDUA 4DOCA 5DG9A 2BDPA 5HREA 1UCVA 4WJ3B 7ICRA 4DCCA 1SZHA 7ICTA 4EEBA 2K89A 2W3SA 8ICTA 7ICPA 2J6UA 1S10A 3RJKA 1X66A 4RQ7A 9ICCA 1NJXA 5IINA 1WG8A 2ZIWA 2KD1A 5G5HA 4P0QA 4BX9C 5CHEA 4FO1A 3SAHA 3C2KA 4WQKA 4IRCA 9ICVA 4PPXA 3OSNA 4NLCA 4KMOB 1N63A 1N62A 5L1MA 2ASDA 9ICEA 3RRGA 1NZPA 4B9LA 3RBEA 4KTQA 1U45A 1KDHA 4DQRA 3PMNA 3UPSA 3RJIA 2I5HA 3N7PD 2M2UA 4OJ6A 1HUZA 4G9BA 1F5SA 5KFJA 4ECUA 1T3NA 2YMQA 2A19A 1S97A 5B3PA 3TKAA 2H5XA 3ISDA 4EELA 3UMBA 3ZDDA 3GIKA 4KLFA 1GPJA 1D8LA 1J2NA 2H3ZA 2VKQA 4HYKA 2ZHAA 1UT5A 9ICAA 1B22A 4E8FA 1ECWA 3ZD9A 4IR9A 1T94A 2AHOB 2CN1A 5DEDA 5CWRA 8ICPA 3BZCA 5F3XB 3GIIA 1X2IA 3UXNA 5KFTA 2BKEA 2XCAA 1SV0C 3ZDAA 4E0DA 4P0PB 2WF6A 5HR9A 3SR6A 4P4PA 1VJ5A 4GC6A 4FHYA 4KLIA 5KTQA 2O6KA 5KFKA 4M9LA 4WCWA 1DOQA 2KKPA 4DF8A 1ZQMA 5J2GA 4KITB 1FIQA 5KFSA 9ICWA 3LK9A 3AN1A 5J2KA 4M04A 4GFJA 4O9MA 3GZFA 3B0YA 1A76A 2FLLA 3RH6A 1TE2A 8ICWA 3NRZA 2G06A 4O3QA 2YMPA 4M9NA 4N7RA 5B5EU 2HHXA 3MDCA 1L7PA 4EYIB 1U49A 5KFBA 3HKZF 3EPGA 3UXOA 3V72A 2KE7A 4C4TA 3BQ1A 3D2SA 2FPMA 1ZRNA 3LYSA 1S5LU 2NRTA 1U47A 2HHVA 4UW9A 3GIJA 4US8A 2G09A 3C28A 3MGHA 5H2FU 1IIPA 4Y2RA 2DWQA 3HJ4A 5EE1A 5KT4A 2M2TA 4QNLA 4R64A 3GV8B 2JMGA 4Z6DA 4F2RA 3ISBA 4NXWA 4DSJA 1S0NA 4DFMA 3PSFA 5KFQA 5KT6A 5KFCA 4YR0A 1UHUA 5ALYA 4DQSA 4YR3A 2M2VA 4TUQA 2DRAA 4RT2A 5ALIA 1MN8A 3DDHA 2W7OA 8ICJA 4YFKA 2XVTA 3F2CA 4DL7A 1RYSA 3CW2C 1L7NA 3FM9A 4O3NA 4Y2SA 3KZXA 2F76X 3H8JA 3IM1A 1WWUA 1TFWA 5HRBA 2AQ0A 1CI4A 4FH3A 1R89A 4ED7A 5IIMA 1JUDA 3M9NB 2JEJA 2G0AA 3WFPA 3RAQA 1MIYA 3PNCA 3UPQA 4MF2A 3C1YA 5EWFA 2ZIXB 2LKYA 5T14A 5HNKA 1ZD3A 1MIWA 4PZNA 5L1IA 2DR5A 9ICJA 4IG8A 1XS9D 3KFUF 3D6JA 7ICUA 1L7MA 1K1SA 3MGVA 3H7IA 4OAGA 3QEAZ 4DF4A 4DFPA 2ASLA 4RQ1A 4EZ9A 1LV5A 1ZQJA 3RB0A 4B9NA 3TARA 4X0AA 2JHDA 1ZQWA 3T5LA 3THVA 4PGXA 2VA2A 4IRDA 4DSLA 5HRFA 5ALMA 5AKLA 2Y1IA 1N48A 5AK4A 8ICFA 3WKEA 3C2MA 3JZ0A 1JX4A 3L3FX 2IOFA 2RQ5A 3H4DA 1FFVA 1UQVA 4UAWA 5F9NA 3QUQA 2YB4A 3C2LA 9ICFA 1TVAA 1FA0A 2W9CA 4O3PA 3NVOA 4YD1A 4KLUA 2DR9A 4PGQA 5CFUA 2FJ6A 4ED1A 4ECRA 1SGGA 1ZQCA 5ALVA 3HIYA 1RYRA 3BQ7A 4DFJA 4P2HA 2W9BA 2ZH8A 4O3OA 2ZUCA 1JROA 2G07A 4NXZA 2IOHA 2KICA 4OD0A 5J0PA 2ZIVB 1XU4A 3MR3A 2W9AA 2PFNA 2AXTU 4PH5A 4ECYA 2F8LA 4PL1A 9ICBA 4I27A 4Y2YA 2VA8A 4J9SA 3TFSA 4X4UA 2ESEA 3OHAA 3CP8A 2WF7A 1BPBA 5KL1B 1L3UA 1MQ3A 8ICRA 1Q3UA 4WC3A 3RB6A 3V7JA 2M2WA 1SIJA 2JH7A 1TK8A 5AI4A 5EE9A 1UA0A 3ER8C 5J29A 2Z7JA 2BCUA 2HOFA 4QZAA 1M6YA 4O5CA 1ZQNA 2WAQF 4LEYA 5K4LA 4R8UB 4UQGA 4FHPA 5CFTA 1SL2A 3CNHA 3L5KA 3PO4A 1PVRA 2KP7A 2WF5A 3H37A 1YZ7A 3WKAA 2EAMA 2XI9A 1CRXA 3SV3A 5B66U 3PO5A 1Z4NA 3OPXA 4IR1A 7ICIA 2FMPA 4KLTA 2ZHBA 4EV6A 1S77D 4JLXA 3PZPA 4DQQA 1SKRA 1BNOA 3MR5A 3GU3A 4I2HA 3N4MB 3QXGA 1TFRA 1KN5A 5J0SA 9ICGA 1NK5A 2GAFD 5DBAA 2F44A 1S76D 4MFCA 2ZUDA 8ICKA 2C28A 4QWCA 5C0YA 3OUYB 3MC1A 7ICEA 1SKWA 2HN1A 4F92B 5ALNA 5CEHA 4RNOA 4X4TA 4F3OA 4ED8A 5ALDA 3J81j 4C4SA 4ECZA 5KG2A 2H3VA 5DGBA 4KX3A 4X4RA 3M1YA 5KFAA 1ZQKA 1S8OA 4WC7A 4K9BA 3MDAA 2IHNA 2IOFK 2ZH5A 3WFSC 4RUCA 1ZQYA 2ZTEA 5B3QA 2V9WA 1JALA 5ALUA 1V9PA 4RNNA 5AI5A 2KHQA 3IN5A 3QE9Y 2E3TA 1ZQ1C 1ZQSA 5AKJA 4NJ8A 2CRXA 3MABA 1PUZA 4YN4A 4F4KA 4NLZA 2WHEA 2A1JA 4HAIA 2HVHA 2W3RA 2BR0A 4RQ8A 4ED3A 3KOOA 4BUGA 5AK5A 3M8RA 3HW8A 5J2BA 5BPCA 4M5DA 3T5JA 2XY7A 4K8VA 4DL5A 3K4GA 2ZH6A 4GC7A 5J2JA 3NVVA 2ZJ8A 1ZQEA 3PW7A 4U6PA 2ZIWB 3N7SC 3WKDA 4ED0A 4EBCA 4HX0A 4WC0A 2QB0A 2Y0SF 3D2NA 1HJPA 4GXKA 4CDGA 1JI7A 1R8CA 9ICIA 3H0RB 3MFIA 2BPFA 2B6GA 3ETLA 3V7KA 2K4HA 3QU5A 5DKWA 2RDJA 4RNMA 4O69A 1ZQXA 4PHAA 3ONNA 4AYBC 2LMRA 3V6HA 4F5OA 5DQHA 3Q8LA 3K1RB 4Q43A 4B9VA 4PGYA 1MQ2A 2RRDA 5AKGA 5EE0A 3NWIA 2LM1A 1BPEA 2MUTB 4ECQA 2K8BB 4DQIA 2BQUA 1JXLA 2F8KA 2EZYA 5KFYA 3T79A 5KAFU 1TV9A 2DBYA 2KSOB 1S0VA 1QSSA 4MEXA 4BXOB 3QU7A 1N56A 3N97B 3GFKB 4UARA 4GXIA 3AQKA 1QH9A 1LB2B 4K97A 5D4BA 2ZH4A 3WU2U 4DSIA 5IIKA 5J2CA 3BQ0A 4OJ5A 4M2YA 1NKCA 4JMUA 3OTQA 4CNQA 3AQLA 1IV8A 2I1QA 4BWMA 3M9OB 1SZPA 3GILA 3IP4B 1V85A 4O6AA 2K4EA 2OM6A 2DRBA 9ICNA 1OUQA 3OGUA 3TQ1A 5C5JA 3ISCA 3AQEA 4EBJA 2E8PA 5KNIA 2ZTDA 4OAHA 3QNMA 1DXSA 1WWVA 4F93B 2GA9D 1NK7A 3QZ7A 1MC8A 5JU5A 4QZBA 5CJ7A 4QZGA 4F8RA 3PX4A 3AQNA 1U4BA 4EENA 2DL0A 4CCHA 3BS5A 1NNLA 5DQGA 4RQ6A 4RWNA 4E7XA 1KEJA 4RZRA 3RJJA 5A0LA 4Q45A 4EBEA 2FPKA 2OWOA 4XQ8A 5KT2A 2W54A 4FS1A 4DQPA 5DB7A 4KLQA 2NRXA 4JLZA 2NRVA 3BS7A 1P7DA 4FHVA 2KFZA 4Q44A 4DFKA 1RQNA 5KT5A 4UATA 3SQIA 5ALKA 2KZMA 4YXJA 2DFLA 3CRXA 3MR2A 1ZQZA 3JCFA 1A0PA 1AROP 4JV0A 1KFDA 1PK1B 5D62A 3IG8A 2ISPA 1Z19A 1QQ7A 5DDMA 2JEIA 2R8KA 2Y9TA 3NS1A 5TZVA 1B43A 1BPDA 2K4IA 3BZKA 3C66A 4Y2XA 2ALZA 5ALHA 2BHNA 4LEVA 3OSPA 2O5AA 4C8LA 2R8JA 3JPRA 3HP6A 4ELVA 5AK3A 4C7ZA 2LYHA 4QZIA 4CRXA 3JYYA 4QJFB 3A0BU 4DLEA 4QZEA 9ICLA 4XQ7A 4KLEA 4XA5A 2PMZC 3QX7A 3C1ZA 4FZLA 5L1JA 1ZQRA 1SL0A 2MA1A 1MIVA 1KNYA 4IQTA 4C0ZA 3SV4A 4BJQA 2FLPA 2QLTA 2BQ3A 4KLMA 1KRPA 4UAYA 1NZBA 4PHEA 3AL0B 5KFIA 3RB4A 4IC9A 4Y2TA 1WUDA 3DV9A 4NM1A 3I1YA 5KG5A 3Q8SB 1WCLA 5FP0A 1O03A 5CRXA 4B9UA 5KL8B 4NKTA 3GV7B 1RDFA 3HT3A 3Q8KA 5D46A 2E5SA 4IRKA 4Q8EA 5J0RA 3B0XA 3WK8A 4ECVA 4KLHA 3ZDCA 2JEGA 2HMXA 5KFUA 1A77A 2KNJA 4F2SA 2F1HA 4Y2UA 5AM2A 3Q8QB 2VJ4A 4RQ2A 7ICVA 4F4ZA 4QIWC 2D6FC 3H40A 3OVSA 5J0YA 3SYZA 2W55A 4PHDA 5HRIA 3EYZA 3ALRA 5KFPA 2W9CB 1KLNA 3TI0A 4TUSA 2HHUA 2B51A 1S0OA 4NXXA 2H3QA 1SV0A 4Y2VA 1X9XA 3ZI4A 1V97A 8ICBA 1CUKA 2JXJA 4FFDA 1HEKA 3H38A 2HSZA 8ICMA 3H39A 2XGPA 3WFOA 1JMSA 1X40A 3FC4A 2PFQA 8ICLA 2M0NA 2UVWA 2ASJA 1J97A 2R8HA 2CPRA 1URJA 2N1RA 2JR5A 3LQCB 4S3NA 4UB2A 5DB8A 2MRLA 4JWMA 5ALZA 1RYUA 4GLXA 5ALFA 1X42A 2A1JB 2ZXHA 4X5VA 2YMLA 4NV0A 4ZOHC 2YTUA 5AICA 4WOYA 4DS5A 1X6IA 1N5XA 5KFWA 1SKSA 4NLBA 7ICHA 4UB6U 5BOMA 4O68A 1KSPA 1PZNA 2EDUA 5HRHA 4WQLA 1MSWD 3OVBA 4F72A 1IG6A 3C23A 5ALOA 1YZ6A 4M6WA 2GWSA 4RPYA 5HMMA 4YQWA 2B0CA 3F5EA 4FHXA 4R8UA 3V6JA 4F91B 3HWTA 1OXJA 5AK6A 9ICPA 5AKEA 2EZXA 3LVVA 3GIMA 4UB5A 4RQ5A 2W04A 3HRDD 2YX8A 3KD3A 1QSYA 5KFHA 1Z3EB 4O5KA 1QQ6A 5J0UA 2KFNA 4QWEA 2NRWA 1NO5A 2ZG6A 5KG0A 2JRZA 3AU2A 5KFDA 7ICFA 1VLBA 5DECA 5EE3A 2LHTA 3PVXA 2NRKA 1RM6C 3IG5A 5AKHA 3GQCA 2F77X 1C7YA 8ICEA 4WC6A 1YT3A 5KFFA 4QZCA 2P6UA 5ALEA 2DUYA 1UA1A 5AI0A 4O3RA 2Y9UA 5KT7A 2E8OA 3ERCC 2PFOA 4EBKA 4NL9A 1T8EA 2J6TA 1IM4A 4UD5A 2DGZA 2KIWA 1RQLA 2HVIA 4OAIZ 1N2XA 4K99A 4XUSA 1PVQA 2KEYA 4EP7A 5AM4A 5ALWA 5CFSA 4AT7B 2MUTA 4M0AA 5HP4A 1F44A 3E2EA 5CA7A 4NWIA 1JAJA 5IIOA 2W7PA 5DQIA 3C5FA 2XCPA 1SWVA 4FE3A 4XRHA 4CF5A 2K4PA 1TAQA 4IQVA 4UASA 1RXWA 2HBKA 7ICJA 1NK0A 4I0UA 2K8AA 3LWLA 3QU2A 2ZJAA 5CP2A 1KQQA 1ZRMA 2ISOA 1X9MA 3PSIA 3KBBA 4I2EA 4EEKA 2E8NA 5J0WA 4OAFA 2ZXIA 2EH9A 9ICXA 5BOLA 2HI0A 4DEZA 4ECXA 2EAPA 2W9MA 4PZOA 1X6JA 4X4NA 4M47A 5AI8A 4I2DA 1K1QA 9ICHA 4QZ8A 4TURA 3BS5B 7ICMA 1KL9A 1SL1A 8ICIA 4ELUA 2GOLA 8ICXA 1L6NA 2CXYA 1ZXIA 2JV3A 1XSPA 2F1IA 3M9MB 8ICQA 8ICZA 2LBOA 4UB4A 2BCVA 3F53A 9ICRA 3MGIA 3ZDBA 4QZHA 4AP9A 1XWLA 2AGQA 2UVRA 5AM1A 5KG7A 2KKVA 2FMSA 4MKPA 2I6XA 1L5UA 1KKXA 1Q79A 4JK1A 1OU5A 3ER9B 3PHZA 4EBDA 5DG7A 3SD7A 4FBTA 5DGAA 3M7DA 2FLNA 2KVCA 3Q8RB 4QZFA 1DK3A 1RXVA 4X4PA 3AMZA 3QU4A 2ATLA 2LI6A 3QUTA 2NO4A 4DOAA 4LZDA 4Y2PA 3SENA 1XO0A 2RLTA 3KHRA 3H3AA 1AQ6A 2ZJ5A 4FZNA 2KZ3A 3DEEA 2OEHA 3SEIA 4IL6U 4RPZA 3LVWA 4PJ0U 1GO3F 3FAHA 3RH5A 4DL4A 4AT8A 4PHPA 1L3TA 4ED2A 3AM9A 5HRDA 4YMNA 2MSNA 4O0IA 2QB1A 5TISU 4K4HA 4G3IA 4R66A 2HBJA 3NVYA 3O0FA 4RWQA 5KT3A 3RH4A 4RU9A 2KG5A 1PVPA 5GTIU 4FH5A 4P0PA 5AKXA 4B9MA 1TAUA 3TAQA 4ATBA 2ZIXA 1XSNA 1XNSA 5JTGA 4YR2A 2JZBA 5DBBA 2LPEA 4R63A 4M9HA 2FE9A 2FMQA 3SAGA 2KZZA 4X4VA 3VC8A 4LJXA 4I2IA 5AKZA 5J2AA 1ZD2P 2BPGA 4RQMA 5J0TA 1VFGA 4LVSA 5AKKA 2BBHA 5E79U 3JPSA 4C8MA 3MCRA 2HOQA 1R8AA 1L7OA 1NJYA 4DS4A 2AGOA 1FEZA 3KZIU 1O08A 2QB0B 4QWBA 2B56A 5IIJA 4X4OA 3PW4A 4ICAA 8ICGA 3ZDEA 2W8LA 4NXUA 4JB3A 3PV8A 4M6WB 4FHWA 2W43A 3NTUA 3WKBA 2ZIUA 3RFAA 4FS2A 2XIDA 5AM3A 4EEYA 5EWEA 5CHGA 1Z4OA 4B9TA 3LDAA 4DSEA 2AGPA 5AHXA 4KLOA 4WC1A 2HHSA 2DF4B 2IHMA 4KN4A 5G5GA 2KN7A 4K98A 3TACB 4UB3A 3IHQB 5HR7A 4YG2A 1DGSA 2VJ5A 2HN2A 4RQ0A 1FFUA 9ICTA 4Y2JA 4J9PA 1QLNA 4C7YA 1VJ7A 2WTFA 4KLGA 1NK9A 1ZQVA 8ICVA 2BQRA 1SXDA 4AYBF 3HJEA 4MFFA 3SAFA 2KTQA 1R8BA 2J6SA 7ICKA 4Z6EA 4ECWA 2FPLA 4Z6FA 2D3DA 4NL9C 2EWRA 2G5HB 2PBEA 2IUBA 5HRLA 1JXEA 1FO4A 4MHVA 4DL2A 2V4RA 2EQYA 2WB1F 4QWDA 2C2EA 3RJGA 2O1PA 2K60A 2K8CB 2C2RA 2KHVA 2ZH3A 3H0MB 2H3FA 3S6JA 5KG1A 5J2EA 9ICMA 3BQTA 4OO1J 4RQNA 4KLJA 4TQRA 2E1FA 4AT7A 4WC4A 4J9NA 2DR7A 2JGAA 4RQ3A 9ICSA 1KBUA 4J9RA 3RR7A 1UEVA 4OJLA 1ZQIA 4KLLA 1XO1A 3UXPA 1ZOLA 3WK6A 2D8CA 1UPHA 2W03A 4YMOA 4M9GA 1LVHA 5L1KA 1DGJA 3SMVA 4NLGA 9ICKA 3WK9A 2YY6A 5CR0A 3RJFA 2RP5A 1Z1VA 3JPNA 3NASA 2XGQA 3F2DA 3RJEA 4F4XA 1NJWA 2MU2A 2VANA 5J2HA 1U48A 1XC9A 5KFXA 4IS7A 2E8MA 2W8KA 1A6SA 4ED6A 1UEUA 2AJQA 5KFNA 4C4RA 3OJSA 3EUB2 2A3VA 3HJ1A 1D9FA 5JTIA 9ICUA 3NVWA 4UD4A 1B0XA 4YXMA 4UBCA 4I2GA 3A0HU 3HKZC 3KKAA 3KKAC 1BPYA 2HDOA 4DFDA 1T7PA 4JUZA 5J8YC 1DK2A 4UAZA 4I2AA 3OV7A 1LKYA 2XC9A 4GIBA 5D63A 4J9KA 1H38A 1D9DA 3FDSA 1ZD5A 5AI9A 4AT9A 4O67A 3NVZA
chains in the Genus database with same CATH topology
4JWNA 1SKRA 1ZQFA 1BNOA 3RBDA 3MR5A 1F5AA 3GQCA 3NYBA 1XSLA 5KFEA 3N4MB 4I2HA 4KLSA 1TFRA 3AQMA 5J0SA 4BWJA 1NK5A 9ICGA 5DBAA 1C7YA 1S76D 3V6KA 2ZUDA 3RR8A 4MFCA 8ICEA 2C28A 4QWCA 5L1LA 8ICKA 4KN7A 5KFFA 3MBYA 2C2DA 7ICEA 3EW9A 1SKWA 3OUYB 1TFYA 1Q78A 4QZCA 4F92B 2PXIA 2P6UA 3SI8A 2UVUA 1X9SA 4R65A 4RQ4A 4F4YA 3PW2A 4RNOA 4X4TA 2B21A 1PX5A 1UA1A 4ECTA 4O3RA 4F3OA 1NK4A 4ED8A 7ICNA 3WFQE 5HMLA 4J9OA 3C18A 3OHBA 5KT7A 2BCRA 4RWPA 3G6XA 4ECZA 2DR8A 5KG2A 3K75D 2PFOA 5DGBA 1BNPA 4EBKA 4X4RA 1JQRA 1L3SA 3C5GA 1T8EA 5KFAA 1ZQKA 2J6TA 3UPSA 8ICNA 3PW5A 7ICGA 4UB1A 1IM4A 5HHHA 4WC7A 4UD5A 2Y1JA 4B9SA 1QSLA 3MDAA 4X4QA 3BDPA 2IHNA 1BGXT 2HVIA 2ZH5A 3WFSC 4RUCA 1ZQYA 2ZTEA 2C22A 4DSKA 1ZQAA 2V9WA 4XUSA 3PR5B 2HW3A 2ZH9A 1V9PA 4DOBA 4C8OA 4RNNA 4NY8A 3EZ5A 3QEBZ 4EP7A 5IILA 3G6YA 2AU0A 3QE9Y 4YD2A 4AT7B 2MUTA 3EWAA 4M0AA 3QZ8A 5HP4A 2XO7A 1KFSA 1Z00A 1ZQSA 1UT8A 3E2EA 5CA7A 4BGDA 1JAJA 5IIOA 1Z00B 3MABA 4YN4A 3HX0A 3RRHA 4F4KA 5DQIA 3C5FA 4NLZA 2A1JA 2XCPA 2HVHA 2BR0A 4XRHA 4RQ8A 3HW8A 4ED3A 3M8RA 1KFTA 5J2BA 5BPCA 4DOCA 1TAQA 4I2JA 4IQVA 4I28A 5DG9A 2BDPA 3RJHA 5HREA 1TK5A 1RXWA 4M5DA 2BGWA 1NKBA 3ORYA 7ICRA 3T5JA 5J0OA 2DPJA 1NK0A 7ICJA 3LWLA 5HHIA 2XY7A 7ICTA 4DL5A 3K4GA 2ZJAA 5CP2A 4GC7A 2ZH6A 5J2JA 8ICTA 7ICPA 2J6UA 2ZJ8A 1S10A 3RJKA 1ZQEA 3PW7A 2ISOA 4RQ7A 9ICCA 1X9MA 1NJXA 4ED0A 3HPOA 4EBCA 4I2EA 5IINA 3V7LA 5J0WA 3RTVA 3C2KA 4IRCA 9ICVA 4X4SA 4PPXA 4WC0A 3EPIA 1ZQOA 4J9QA 9ICXA 5BOLA 3OSNA 3AUOA 1HJPA 2RDIA 5KG4A 4GXKA 4ECSA 2F1JA 4O3SA 4WC3A 4DEZA 4ECXA 2W9MA 1R8CA 2ASDA 9ICIA 9ICEA 2DVIA 3RRGA 1NZPA 3MFIA 3RBEA 4B9LA 5KG6A 2R8IA 1U45A 4KTQA 2BPFA 4M47A 5HRGA 1WOTA 1KDHA 4I2DA 4DQRA 1K1QA 3ETLA 2RDJA 3V7KA 5DKWA 4RNMA 3PMNA 4QZ8A 1RPLA 4TURA 1NOMA 1ZQXA 4PHAA 3RJIA 7ICMA 1SL1A 2M2UA 8ICIA 1HUZA 3NGDA 4ELUA 8ICXA 3V6HA 1WCNA 2ZH7A 1JIHA 5KFJA 3JPPA 3RAXA 5IIIA 4ECUA 1T3NA 4F5OA 4NLKA 5DQHA 3Q8LA 4WC5A 4DLGA 2NRZA 5DDYA 5JUMA 4Q43A 4PGYA 1XSPA 1S97A 5KFLA 1MQ2A 4B9VA 2F1IA 2H5XA 3M9MB 3ISDA 3BQ2A 8ICQA 8ICZA 4UB4A 2BCVA 1BPEA 3ZDDA 3GIKA 2MUTB 4KLFA 4TUPA 9ICRA 3MGIA 1D8LA 4ECQA 3ZDBA 4HYKA 1D8YA 2BQUA 4DQIA 4QZHA 1JXLA 1XWLA 5KFYA 2AGQA 2UVRA 2ZHAA 1UT5A 5KG7A 9ICAA 1B22A 4E8FA 3ZD8A 5DB9A 2FMSA 1TV9A 3OVAA 3ZD9A 4IQUA 4IR9A 1S0VA 1L5UA 1QSSA 4MEXA 4BXOB 3JPTA 4YP3A 1N56A 8ICYA 7ICOA 1Q79A 2Q0ZX 4JK1A 3GFKB 5CWRA 4GXIA 3T3FA 3N97B 3GIIA 3H4BA 4M9JA 2JZBB 1LB2B 8ICPA 1X2IA 3UXNA 5KFTA 2BKEA 2XCAA 4F5PA 3AQKA 5D4BA 3ZDAA 4E0DA 4EBDA 5DG7A 5IIKA 5J2CA 4DSIA 5HR9A 3H8WA 2ZH4A 3BQ0A 4P4PA 4RUAA 2UVVA 4GC6A 3T5HA 4M2YA 1NKCA 4KLIA 4FHYA 5KTQA 3AQLA 3Q8PB 4FBTA 2I1QA 5KFMA 4BWMA 5KFKA 3M9OB 2JEFA 4M9LA 1DOQA 4DL3A 5DGAA 2FLNA 1SZPA 5DBCA 3GILA 4DF8A 1ZQMA 5J2GA 4KITB 4ELTA 3Q8RB 8ICOA 4QZFA 5KFSA 1DK3A 1RXVA 9ICWA 9ICNA 4X4PA 2DRBA 3LK9A 3OGUA 5J2KA 3TQ1A 5C5JA 3PX0A 3ISCA 4M04A 2HHWA 4O9MA 2ATLA 2BCQA 4IQWA 3B0YA 9ICHA 4EBJA 1A76A 2ZTDA 2FLLA 3RH6A 8ICWA 3BJYA 4DOAA 5DG8A 4LZDA 2BCSA 4TQSA 4O3QA 2IMWP 4F93B 4M9NA 3PR4A 1NK7A 2HHXA 5L9XA 3KHRA 1X9WA 3H3AA 2ZJ5A 3QZ7A 3MDCA 4EYIB 1MC8A 1U49A 2KZ3A 5KFBA 4QZBA 7ICLA 5CJ7A 4QZGA 4F8RA 5KG3A 3PX4A 4RPZA 3EPGA 3AQNA 3UXOA 3V72A 3RH5A 1U4BA 4Q8FA 1ZJMA 4DL4A 4CCHA 4MEYA 3BQ1A 4AT8A 4PHPA 1L3TA 2FPMA 5DQGA 4ED2A 4X4NA 5HRDA 4YMNA 3GDXA 2NRTA 4RQ6A 1U47A 4C8NA 1Y88A 3TFRA 2HHVA 3Q8MA 4RWNA 3GIJA 2PI4A 4O0IA 1NJZA 4E7XA 1KEJA 1TK0A 4RZRA 2ZH1A 3MGHA 4DSFA 2I9GA 4K4HA 1ZQBA 4G3IA 4R66A 3RJJA 4RPXA 4Q45A 4EBEA 5HC9A 5J0XA 3HJ4A 2FPKA 4X0BA 2HHTA 5KT4A 4RWQA 2OWOA 2W9BB 2M2TA 5KT3A 3RH4A 4R64A 3GV8B 4XQ8A 4RU9A 4FH5A 4Z6DA 5KT2A 3GV5B 4FS1A 2P6RA 4F2RA 4ZH4A 3ISBA 4DQPA 5DB7A 4MFAA 4DSJA 4KLQA 1S0NA 3L9DA 4B9MA 2NRXA 2HHPA 4DFMA 4QZ9A 3TAQA 1TAUA 2NRVA 5KFQA 5KT6A 1XSNA 4ATBA 3PW0A 5HRKA 4FHVA 2KFZA 1BPXA 4Q44A 4YR2A 2V4QA 2JZBA 4DFKA 1ZYQA 5KFCA 4YR0A 1CEZA 1EXNA 5KT5A 5DBBA 2KZMA 4R63A 1TKDA 4M9HA 9ICOA 4YXJA 2DFLA 2FMQA 4DQSA 4YR3A 2KZZA 4X4VA 3MR2A 1ZQZA 4TUQA 1AROP 3LWMA 4JV0A 4P4MA 1ZQLA 2M2VA 1KFDA 4I2IA 8ICCA 5J2AA 2DRAA 1T4GA 2ZUBA 4RT2A 2BPGA 2DPIA 1ZETA 2ISPA 1ZQQA 4RT3A 5J0TA 3JPQA 1VFGA 5DDMA 8ICJA 2JEIA 4LVSA 1S9FA 4QW8A 5DLGA 3WFRE 1NKEA 3JPSA 2R8KA 4C8MA 4YFKA 2XY5A 4F5QA 5TZVA 1B43A 1BPDA 2BE3A 1QTMA 3C66A 4NKUA 4DL7A 1R8AA 1RYSA 2ALZA 1NJYA 4DS4A 2BHNA 2AGOA 4O3NA 3OSPA 2O5AA 4C8LA 2R8JA 4QWBA 3JPRA 5D49A 1ZQDA 3H8JA 3IM1A 5IIJA 3HP6A 4ELVA 5F2VO 3PX6A 4Z6CA 4X4OA 3PW4A 2PFPA 4WCWA 1TFWA 5HRBA 2LYHA 4QZIA 8ICGA 3JYYA 3ZDEA 2AQ0A 5KFZA 4FO6A 5J2DA 4WC6A 4DLEA 2W8LA 4QZEA 9ICLA 4FH3A 4XQ7A 1R89A 3TANA 4KLEA 4XA5A 4ED7A 5IIMA 3PV8A 4M6WB 4FHWA 3M9NB 2JEJA 3NTUA 5J0QA 3WFPA 3C1ZA 5L1JA 4GXJA 1ZQRA 1SL0A 3RAQA 4FS2A 4EZ6A 3PNCA 4J9MA 3UPQA 1KNYA 1MIVA 1MIYA 1YLQA 1IXRA 7ICSA 4IQTA 4MF2A 3C1YA 5EWFA 3SV4A 4EEYA 2FLPA 5EWEA 1OU5A 5CHGA 5HNKA 1ZQUA 2BQ3A 4KLMA 1KRPA 4UAYA 4B9TA 1MIWA 3LDAA 4DSEA 2AGPA 5L1IA 4PHEA 2DR5A 9ICJA 4KLOA 4IG8A 4WC1A 1XS9D 3OUYA 5KFIA 2HHSA 2IHMA 4KN4A 7ICUA 2KN7A 1K1SA 3RB4A 3H7IA 4YMMA 2ID1A 3QEAZ 4KMUA 2IA6A 4UB3A 3IHQB 4DF4A 4DFPA 2ASLA 1S0MA 2PI5A 4NM1A 4RQ1A 5KG5A 3Q8SB 5EOZA 4RWOA 1WCLA 4EZ9A 4YG2A 2ZH2A 1DGSA 4QWAA 5DLFA 1LV5A 1L3VA 3RB0A 1ZQJA 2HHQA 4WBZA 5DEDA 4B9NA 4RQ0A 3TARA 1UETA 4B9UA 9ICTA 4AT9B 4E80A 4NKTA 3GV7B 3HT3A 4X0AA 3PMLA 1ZQWA 4I2FA 3KHGA 3Q8KA 3T5LA 3UQ2A 4LZGA 2MAXA 5D46A 4P4OA 3THVA 1BVSA 4J9PA 4O5EA 4PGXA 4YVZA 4QZDA 1QLNA 1V4AA 3UQ0A 2VA2A 1HUOA 4FBUA 4MF8A 4DSLA 4IRDA 4IRKA 4Q8EA 1VJ7A 5J0RA 3B0XA 2WTFA 4KLGA 4ECVA 1NK9A 4KLHA 1ZQVA 5HRFA 3ZDCA 8ICUA 8ICVA 2JEGA 5KFUA 4F5RA 1A77A 4F2SA 2BQRA 2Y1IA 4DL6A 2F1HA 1N48A 4MFFA 8ICFA 3Q8QB 3C2MA 4RQ2A 7ICVA 3JZ0A 2RFFA 1JX4A 2KTQA 1R8BA 4F4ZA 4NLNA 2J6SA 4JV2A 4Z6EA 7ICKA 4ECWA 3AU6A 2FPLA 4Z6FA 3H40A 3H4DA 4F4WA 4LT6A 2Q66A 4KLDA 3OVSA 5J0YA 3SYZA 4PHDA 5HRIA 2PBEA 3EYZA 5J2IA 1RZTA 5KFPA 4UAWA 5KFRA 5HRLA 1JXEA 5F9NA 2W9CB 4F50A 1KLNA 5F9LA 4TUSA 3TI0A 3M8SA 2HHUA 1JN3A 2P66A 4DL2A 1S0OA 3C2LA 9ICFA 1TVAA 8ICHA 2V4RA 2W9CA 8ICBA 1FA0A 4QWDA 1CUKA 2C2EA 3RJGA 2O1PA 3JPOA 4O3PA 2C2RA 3H38A 3H8SA 4YD1A 1COOA 5KFOA 8ICMA 2ZH3A 4KLUA 3H39A 1ZQPA 4F5NA 2DR9A 3KHLA 2XGPA 4PGQA 1JMSA 4DWIA 9ICQA 3WFOA 2PFQA 8ICLA 2UVWA 5KG1A 5J2EA 9ICMA 3BQTA 4ED1A 1NK6A 4ECRA 2ASJA 2M9NA 1ZQCA 4KLJA 3HIYA 4TQRA 1KTQA 2R8HA 1RYRA 4AT7A 4WC4A 4J9NA 4DFJA 3LQCB 4S3NA 5CB1A 4UB2A 5DB8A 2DR7A 4P2HA 3MFHA 2W9BA 4RQ3A 4NM2A 4O3OA 4JWMA 9ICSA 2ZH8A 2ZUCA 4GLXA 4J9RA 3RR7A 4BXOA 4NXZA 4J9LA 2A1JB 8ICAA 4X5VA 1UEVA 1ZQIA 4KLLA 1XO1A 5J0PA 1XU4A 3MR3A 2W9AA 4YCXA 3UXPA 2PFNA 2IBKA 4DS5A 5EWGA 4PH5A 4ECYA 5KFWA 1SKSA 9ICBA 1U9LA 4I27A 4YMOA 3KTQA 3OJUA 4M9GA 2BPCA 5L1KA 7ICHA 4NLGA 2VA8A 4J9SA 9ICKA 3TFSA 5DB6A 5BOMA 2VA3A 5CR0A 8ICSA 4X4UA 3OHAA 2R8GA 3RJFA 1NK8A 5KFVA 1KSPA 3SZ2A 3JPNA 1PZNA 2XGQA 1BPBA 3RJEA 4F4XA 5HRHA 1MSWD 1L3UA 3OVBA 1NJWA 3C23A 1MQ3A 2VANA 5J2HA 2AQ4A 1U48A 4I2BA 3RB6A 4C8KA 3V7JA 8ICRA 4M6WA 2M2WA 1XC9A 5KFXA 1TK8A 2W8KA 2GWSA 4AT8B 4RPYA 5HMMA 4ED6A 2XY6A 1UA0A 5KFNA 3PY8A 2ZTCA 4YQWA 2AJQA 1UEUA 5J29A 3OJSA 2BCUA 1BPZA 4DO9A 4UBBA 3HJ1A 1D9FA 4FHXA 4R8UA 4QZAA 3MR6A 3V6JA 4O5CA 4F91B 1ZQNA 9ICUA 4UD4A 4YXMA 5KFGA 3HWTA 4UBCA 4I2GA 4R8UB 4UQGA 4FHPA 4JV1A 9ICPA 3GIMA 1SL2A 4WC2A 4UB5A 4RQ5A 1BPYA 3T5KA 3PO4A 7ICQA 2KP7A 1ZQGA 1QSYA 5KFHA 3TAPA 1ZJNA 1Z3EB 1T7PA 4O5KA 4JUZA 3H37A 5J0UA 3KHHA 4K4IA 4I2CA 3G6VA 2KFNA 1DK2A 4UAZA 5J2FA 4QWEA 1ZQTA 2NRWA 4I2AA 3SV3A 4K4GA 1NO5A 5KG0A 2XC9A 3PO5A 3C21A 3OV7A 4QW9A 5KFDA 3AU2A 7ICFA 4IR1A 3FYHA 5DECA 4J9KA 7ICIA 4ATBB 1H38A 4BDPA 1D9DA 2FMPA 3FDSA 3RB3A 3PVXA 4WBYA 4I29A 4KLTA 2ZHBA 1S77D 1ZQHA 2NRKA 4AT9A 4EYHB 4DQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JWN A;  1SKR A;  1ZQF A;  1BNO A;  3RBD A;  3MR5 A;  1F5A A;  3GQC A;  3NYB A;  1XSL A;  5KFE A;  3N4M B;  4I2H A;  4KLS A;  1TFR A;  3AQM A;  5J0S A;  4BWJ A;  1NK5 A;  9ICG A;  5DBA A;  1C7Y A;  1S76 D;  3V6K A;  2ZUD A;  3RR8 A;  4MFC A;  8ICE A;  2C28 A;  4QWC A;  5L1L A;  8ICK A;  4KN7 A;  5KFF A;  3MBY A;  2C2D A;  7ICE A;  3EW9 A;  1SKW A;  3OUY B;  1TFY A;  1Q78 A;  4QZC A;  4F92 B;  2PXI A;  2P6U A;  3SI8 A;  2UVU A;  1X9S A;  4R65 A;  4RQ4 A;  4F4Y A;  3PW2 A;  4RNO A;  4X4T A;  2B21 A;  1PX5 A;  1UA1 A;  4ECT A;  4O3R A;  4F3O A;  1NK4 A;  4ED8 A;  7ICN A;  3WFQ E;  5HML A;  4J9O A;  3C18 A;  3OHB A;  5KT7 A;  2BCR A;  4RWP A;  3G6X A;  4ECZ A;  2DR8 A;  5KG2 A;  3K75 D;  2PFO A;  5DGB A;  1BNP A;  4EBK A;  4X4R A;  1JQR A;  1L3S A;  3C5G A;  1T8E A;  5KFA A;  1ZQK A;  2J6T A;  3UPS A;  8ICN A;  3PW5 A;  7ICG A;  4UB1 A;  1IM4 A;  5HHH A;  4WC7 A;  4UD5 A;  2Y1J A;  4B9S A;  1QSL A;  3MDA A;  4X4Q A;  3BDP A;  2IHN A;  1BGX T;  2HVI A;  2ZH5 A;  3WFS C;  4RUC A;  1ZQY A;  2ZTE A;  2C22 A;  4DSK A;  1ZQA A;  2V9W A;  4XUS A;  3PR5 B;  2HW3 A;  2ZH9 A;  1V9P A;  4DOB A;  4C8O A;  4RNN A;  4NY8 A;  3EZ5 A;  3QEB Z;  4EP7 A;  5IIL A;  3G6Y A;  2AU0 A;  3QE9 Y;  4YD2 A;  4AT7 B;  2MUT A;  3EWA A;  4M0A A;  3QZ8 A;  5HP4 A;  2XO7 A;  1KFS A;  1Z00 A;  1ZQS A;  1UT8 A;  3E2E A;  5CA7 A;  4BGD A;  1JAJ A;  5IIO A;  1Z00 B;  3MAB A;  4YN4 A;  3HX0 A;  3RRH A;  4F4K A;  5DQI A;  3C5F A;  4NLZ A;  2A1J A;  2XCP A;  2HVH A;  2BR0 A;  4XRH A;  4RQ8 A;  3HW8 A;  4ED3 A;  3M8R A;  1KFT A;  5J2B A;  5BPC A;  4DOC A;  1TAQ A;  4I2J A;  4IQV A;  4I28 A;  5DG9 A;  2BDP A;  3RJH A;  5HRE A;  1TK5 A;  1RXW A;  4M5D A;  2BGW A;  1NKB A;  3ORY A;  7ICR A;  3T5J A;  5J0O A;  2DPJ A;  1NK0 A;  7ICJ A;  3LWL A;  5HHI A;  2XY7 A;  7ICT A;  4DL5 A;  3K4G A;  2ZJA A;  5CP2 A;  4GC7 A;  2ZH6 A;  5J2J A;  8ICT A;  7ICP A;  2J6U A;  2ZJ8 A;  1S10 A;  3RJK A;  1ZQE A;  3PW7 A;  2ISO A;  4RQ7 A;  9ICC A;  1X9M A;  1NJX A;  4ED0 A;  3HPO A;  4EBC A;  4I2E A;  5IIN A;  3V7L A;  5J0W A;  3RTV A;  3C2K A;  4IRC A;  9ICV A;  4X4S A;  4PPX A;  4WC0 A;  3EPI A;  1ZQO A;  4J9Q A;  9ICX A;  5BOL A;  3OSN A;  3AUO A;  1HJP A;  2RDI A;  5KG4 A;  4GXK A;  4ECS A;  2F1J A;  4O3S A;  4WC3 A;  4DEZ A;  4ECX A;  2W9M A;  1R8C A;  2ASD A;  9ICI A;  9ICE A;  2DVI A;  3RRG A;  1NZP A;  3MFI A;  3RBE A;  4B9L A;  5KG6 A;  2R8I A;  1U45 A;  4KTQ A;  2BPF A;  4M47 A;  5HRG A;  1WOT A;  1KDH A;  4I2D A;  4DQR A;  1K1Q A;  3ETL A;  2RDJ A;  3V7K A;  5DKW A;  4RNM A;  3PMN A;  4QZ8 A;  1RPL A;  4TUR A;  1NOM A;  1ZQX A;  4PHA A;  3RJI A;  7ICM A;  1SL1 A;  2M2U A;  8ICI A;  1HUZ A;  3NGD A;  4ELU A;  8ICX A;  3V6H A;  1WCN A;  2ZH7 A;  1JIH A;  5KFJ A;  3JPP A;  3RAX A;  5III A;  4ECU A;  1T3N A;  4F5O A;  4NLK A;  5DQH A;  3Q8L A;  4WC5 A;  4DLG A;  2NRZ A;  5DDY A;  5JUM A;  4Q43 A;  4PGY A;  1XSP A;  1S97 A;  5KFL A;  1MQ2 A;  4B9V A;  2F1I A;  2H5X A;  3M9M B;  3ISD A;  3BQ2 A;  8ICQ A;  8ICZ A;  4UB4 A;  2BCV A;  1BPE A;  3ZDD A;  3GIK A;  2MUT B;  4KLF A;  4TUP A;  9ICR A;  3MGI A;  1D8L A;  4ECQ A;  3ZDB A;  4HYK A;  1D8Y A;  2BQU A;  4DQI A;  4QZH A;  1JXL A;  1XWL A;  5KFY A;  2AGQ A;  2UVR A;  2ZHA A;  1UT5 A;  5KG7 A;  9ICA A;  1B22 A;  4E8F A;  3ZD8 A;  5DB9 A;  2FMS A;  1TV9 A;  3OVA A;  3ZD9 A;  4IQU A;  4IR9 A;  1S0V A;  1L5U A;  1QSS A;  4MEX A;  4BXO B;  3JPT A;  4YP3 A;  1N56 A;  8ICY A;  7ICO A;  1Q79 A;  2Q0Z X;  4JK1 A;  3GFK B;  5CWR A;  4GXI A;  3T3F A;  3N97 B;  3GII A;  3H4B A;  4M9J A;  2JZB B;  1LB2 B;  8ICP A;  1X2I A;  3UXN A;  5KFT A;  2BKE A;  2XCA A;  4F5P A;  3AQK A;  5D4B A;  3ZDA A;  4E0D A;  4EBD A;  5DG7 A;  5IIK A;  5J2C A;  4DSI A;  5HR9 A;  3H8W A;  2ZH4 A;  3BQ0 A;  4P4P A;  4RUA A;  2UVV A;  4GC6 A;  3T5H A;  4M2Y A;  1NKC A;  4KLI A;  4FHY A;  5KTQ A;  3AQL A;  3Q8P B;  4FBT A;  2I1Q A;  5KFM A;  4BWM A;  5KFK A;  3M9O B;  2JEF A;  4M9L A;  1DOQ A;  4DL3 A;  5DGA A;  2FLN A;  1SZP A;  5DBC A;  3GIL A;  4DF8 A;  1ZQM A;  5J2G A;  4KIT B;  4ELT A;  3Q8R B;  8ICO A;  4QZF A;  5KFS A;  1DK3 A;  1RXV A;  9ICW A;  9ICN A;  4X4P A;  2DRB A;  3LK9 A;  3OGU A;  5J2K A;  3TQ1 A;  5C5J A;  3PX0 A;  3ISC A;  4M04 A;  2HHW A;  4O9M A;  2ATL A;  2BCQ A;  4IQW A;  3B0Y A;  9ICH A;  4EBJ A;  1A76 A;  2ZTD A;  2FLL A;  3RH6 A;  8ICW A;  3BJY A;  4DOA A;  5DG8 A;  4LZD A;  2BCS A;  4TQS A;  4O3Q A;  2IMW P;  4F93 B;  4M9N A;  3PR4 A;  1NK7 A;  2HHX A;  5L9X A;  3KHR A;  1X9W A;  3H3A A;  2ZJ5 A;  3QZ7 A;  3MDC A;  4EYI B;  1MC8 A;  1U49 A;  2KZ3 A;  5KFB A;  4QZB A;  7ICL A;  5CJ7 A;  4QZG A;  4F8R A;  5KG3 A;  3PX4 A;  4RPZ A;  3EPG A;  3AQN A;  3UXO A;  3V72 A;  3RH5 A;  1U4B A;  4Q8F A;  1ZJM A;  4DL4 A;  4CCH A;  4MEY A;  3BQ1 A;  4AT8 A;  4PHP A;  1L3T A;  2FPM A;  5DQG A;  4ED2 A;  4X4N A;  5HRD A;  4YMN A;  3GDX A;  2NRT A;  4RQ6 A;  1U47 A;  4C8N A;  1Y88 A;  3TFR A;  2HHV A;  3Q8M A;  4RWN A;  3GIJ A;  2PI4 A;  4O0I A;  1NJZ A;  4E7X A;  1KEJ A;  1TK0 A;  4RZR A;  2ZH1 A;  3MGH A;  4DSF A;  2I9G A;  4K4H A;  1ZQB A;  4G3I A;  4R66 A;  3RJJ A;  4RPX A;  4Q45 A;  4EBE A;  5HC9 A;  5J0X A;  3HJ4 A;  2FPK A;  4X0B A;  2HHT A;  5KT4 A;  4RWQ A;  2OWO A;  2W9B B;  2M2T A;  5KT3 A;  3RH4 A;  4R64 A;  3GV8 B;  4XQ8 A;  4RU9 A;  4FH5 A;  4Z6D A;  5KT2 A;  3GV5 B;  4FS1 A;  2P6R A;  4F2R A;  4ZH4 A;  3ISB A;  4DQP A;  5DB7 A;  4MFA A;  4DSJ A;  4KLQ A;  1S0N A;  3L9D A;  4B9M A;  2NRX A;  2HHP A;  4DFM A;  4QZ9 A;  3TAQ A;  1TAU A;  2NRV A;  5KFQ A;  5KT6 A;  1XSN A;  4ATB A;  3PW0 A;  5HRK A;  4FHV A;  2KFZ A;  1BPX A;  4Q44 A;  4YR2 A;  2V4Q A;  2JZB A;  4DFK A;  1ZYQ A;  5KFC A;  4YR0 A;  1CEZ A;  1EXN A;  5KT5 A;  5DBB A;  2KZM A;  4R63 A;  1TKD A;  4M9H A;  9ICO A;  4YXJ A;  2DFL A;  2FMQ A;  4DQS A;  4YR3 A;  2KZZ A;  4X4V A;  3MR2 A;  1ZQZ A;  4TUQ A;  1ARO P;  3LWM A;  4JV0 A;  4P4M A;  1ZQL A;  2M2V A;  1KFD A;  4I2I A;  8ICC A;  5J2A A;  2DRA A;  1T4G A;  2ZUB A;  4RT2 A;  2BPG A;  2DPI A;  1ZET A;  2ISP A;  1ZQQ A;  4RT3 A;  5J0T A;  3JPQ A;  1VFG A;  5DDM A;  8ICJ A;  2JEI A;  4LVS A;  1S9F A;  4QW8 A;  5DLG A;  3WFR E;  1NKE A;  3JPS A;  2R8K A;  4C8M A;  4YFK A;  2XY5 A;  4F5Q A;  5TZV A;  1B43 A;  1BPD A;  2BE3 A;  1QTM A;  3C66 A;  4NKU A;  4DL7 A;  1R8A A;  1RYS A;  2ALZ A;  1NJY A;  4DS4 A;  2BHN A;  2AGO A;  4O3N A;  3OSP A;  2O5A A;  4C8L A;  2R8J A;  4QWB A;  3JPR A;  5D49 A;  1ZQD A;  3H8J A;  3IM1 A;  5IIJ A;  3HP6 A;  4ELV A;  5F2V O;  3PX6 A;  4Z6C A;  4X4O A;  3PW4 A;  2PFP A;  4WCW A;  1TFW A;  5HRB A;  2LYH A;  4QZI A;  8ICG A;  3JYY A;  3ZDE A;  2AQ0 A;  5KFZ A;  4FO6 A;  5J2D A;  4WC6 A;  4DLE A;  2W8L A;  4QZE A;  9ICL A;  4FH3 A;  4XQ7 A;  1R89 A;  3TAN A;  4KLE A;  4XA5 A;  4ED7 A;  5IIM A;  3PV8 A;  4M6W B;  4FHW A;  3M9N B;  2JEJ A;  3NTU A;  5J0Q A;  3WFP A;  3C1Z A;  5L1J A;  4GXJ A;  1ZQR A;  1SL0 A;  3RAQ A;  4FS2 A;  4EZ6 A;  3PNC A;  4J9M A;  3UPQ A;  1KNY A;  1MIV A;  1MIY A;  1YLQ A;  1IXR A;  7ICS A;  4IQT A;  4MF2 A;  3C1Y A;  5EWF A;  3SV4 A;  4EEY A;  2FLP A;  5EWE A;  1OU5 A;  5CHG A;  5HNK A;  1ZQU A;  2BQ3 A;  4KLM A;  1KRP A;  4UAY A;  4B9T A;  1MIW A;  3LDA A;  4DSE A;  2AGP A;  5L1I A;  4PHE A;  2DR5 A;  9ICJ A;  4KLO A;  4IG8 A;  4WC1 A;  1XS9 D;  3OUY A;  5KFI A;  2HHS A;  2IHM A;  4KN4 A;  7ICU A;  2KN7 A;  1K1S A;  3RB4 A;  3H7I A;  4YMM A;  2ID1 A;  3QEA Z;  4KMU A;  2IA6 A;  4UB3 A;  3IHQ B;  4DF4 A;  4DFP A;  2ASL A;  1S0M A;  2PI5 A;  4NM1 A;  4RQ1 A;  5KG5 A;  3Q8S B;  5EOZ A;  4RWO A;  1WCL A;  4EZ9 A;  4YG2 A;  2ZH2 A;  1DGS A;  4QWA A;  5DLF A;  1LV5 A;  1L3V A;  3RB0 A;  1ZQJ A;  2HHQ A;  4WBZ A;  5DED A;  4B9N A;  4RQ0 A;  3TAR A;  1UET A;  4B9U A;  9ICT A;  4AT9 B;  4E80 A;  4NKT A;  3GV7 B;  3HT3 A;  4X0A A;  3PML A;  1ZQW A;  4I2F A;  3KHG A;  3Q8K A;  3T5L A;  3UQ2 A;  4LZG A;  2MAX A;  5D46 A;  4P4O A;  3THV A;  1BVS A;  4J9P A;  4O5E A;  4PGX A;  4YVZ A;  4QZD A;  1QLN A;  1V4A A;  3UQ0 A;  2VA2 A;  1HUO A;  4FBU A;  4MF8 A;  4DSL A;  4IRD A;  4IRK A;  4Q8E A;  1VJ7 A;  5J0R A;  3B0X A;  2WTF A;  4KLG A;  4ECV A;  1NK9 A;  4KLH A;  1ZQV A;  5HRF A;  3ZDC A;  8ICU A;  8ICV A;  2JEG A;  5KFU A;  4F5R A;  1A77 A;  4F2S A;  2BQR A;  2Y1I A;  4DL6 A;  2F1H A;  1N48 A;  4MFF A;  8ICF A;  3Q8Q B;  3C2M A;  4RQ2 A;  7ICV A;  3JZ0 A;  2RFF A;  1JX4 A;  2KTQ A;  1R8B A;  4F4Z A;  4NLN A;  2J6S A;  4JV2 A;  4Z6E A;  7ICK A;  4ECW A;  3AU6 A;  2FPL A;  4Z6F A;  3H40 A;  3H4D A;  4F4W A;  4LT6 A;  2Q66 A;  4KLD A;  3OVS A;  5J0Y A;  3SYZ A;  4PHD A;  5HRI A;  2PBE A;  3EYZ A;  5J2I A;  1RZT A;  5KFP A;  4UAW A;  5KFR A;  5HRL A;  1JXE A;  5F9N A;  2W9C B;  4F50 A;  1KLN A;  5F9L A;  4TUS A;  3TI0 A;  3M8S A;  2HHU A;  1JN3 A;  2P66 A;  4DL2 A;  1S0O A;  3C2L A;  9ICF A;  1TVA A;  8ICH A;  2V4R A;  2W9C A;  8ICB A;  1FA0 A;  4QWD A;  1CUK A;  2C2E A;  3RJG A;  2O1P A;  3JPO A;  4O3P A;  2C2R A;  3H38 A;  3H8S A;  4YD1 A;  1COO A;  5KFO A;  8ICM A;  2ZH3 A;  4KLU A;  3H39 A;  1ZQP A;  4F5N A;  2DR9 A;  3KHL A;  2XGP A;  4PGQ A;  1JMS A;  4DWI A;  9ICQ A;  3WFO A;  2PFQ A;  8ICL A;  2UVW A;  5KG1 A;  5J2E A;  9ICM A;  3BQT A;  4ED1 A;  1NK6 A;  4ECR A;  2ASJ A;  2M9N A;  1ZQC A;  4KLJ A;  3HIY A;  4TQR A;  1KTQ A;  2R8H A;  1RYR A;  4AT7 A;  4WC4 A;  4J9N A;  4DFJ A;  3LQC B;  4S3N A;  5CB1 A;  4UB2 A;  5DB8 A;  2DR7 A;  4P2H A;  3MFH A;  2W9B A;  4RQ3 A;  4NM2 A;  4O3O A;  4JWM A;  9ICS A;  2ZH8 A;  2ZUC A;  4GLX A;  4J9R A;  3RR7 A;  4BXO A;  4NXZ A;  4J9L A;  2A1J B;  8ICA A;  4X5V A;  1UEV A;  1ZQI A;  4KLL A;  1XO1 A;  5J0P A;  1XU4 A;  3MR3 A;  2W9A A;  4YCX A;  3UXP A;  2PFN A;  2IBK A;  4DS5 A;  5EWG A;  4PH5 A;  4ECY A;  5KFW A;  1SKS A;  9ICB A;  1U9L A;  4I27 A;  4YMO A;  3KTQ A;  3OJU A;  4M9G A;  2BPC A;  5L1K A;  7ICH A;  4NLG A;  2VA8 A;  4J9S A;  9ICK A;  3TFS A;  5DB6 A;  5BOM A;  2VA3 A;  5CR0 A;  8ICS A;  4X4U A;  3OHA A;  2R8G A;  3RJF A;  1NK8 A;  5KFV A;  1KSP A;  3SZ2 A;  3JPN A;  1PZN A;  2XGQ A;  1BPB A;  3RJE A;  4F4X A;  5HRH A;  1MSW D;  1L3U A;  3OVB A;  1NJW A;  3C23 A;  1MQ3 A;  2VAN A;  5J2H A;  2AQ4 A;  1U48 A;  4I2B A;  3RB6 A;  4C8K A;  3V7J A;  8ICR A;  4M6W A;  2M2W A;  1XC9 A;  5KFX A;  1TK8 A;  2W8K A;  2GWS A;  4AT8 B;  4RPY A;  5HMM A;  4ED6 A;  2XY6 A;  1UA0 A;  5KFN A;  3PY8 A;  2ZTC A;  4YQW A;  2AJQ A;  1UEU A;  5J29 A;  3OJS A;  2BCU A;  1BPZ A;  4DO9 A;  4UBB A;  3HJ1 A;  1D9F A;  4FHX A;  4R8U A;  4QZA A;  3MR6 A;  3V6J A;  4O5C A;  4F91 B;  1ZQN A;  9ICU A;  4UD4 A;  4YXM A;  5KFG A;  3HWT A;  4UBC A;  4I2G A;  4R8U B;  4UQG A;  4FHP A;  4JV1 A;  9ICP A;  3GIM A;  1SL2 A;  4WC2 A;  4UB5 A;  4RQ5 A;  1BPY A;  3T5K A;  3PO4 A;  7ICQ A;  2KP7 A;  1ZQG A;  1QSY A;  5KFH A;  3TAP A;  1ZJN A;  1Z3E B;  1T7P A;  4O5K A;  4JUZ A;  3H37 A;  5J0U A;  3KHH A;  4K4I A;  4I2C A;  3G6V A;  2KFN A;  1DK2 A;  4UAZ A;  5J2F A;  4QWE A;  1ZQT A;  2NRW A;  4I2A A;  3SV3 A;  4K4G A;  1NO5 A;  5KG0 A;  2XC9 A;  3PO5 A;  3C21 A;  3OV7 A;  4QW9 A;  5KFD A;  3AU2 A;  7ICF A;  4IR1 A;  3FYH A;  5DEC A;  4J9K A;  7ICI A;  4ATB B;  1H38 A;  4BDP A;  1D9D A;  2FMP A;  3FDS A;  3RB3 A;  3PVX A;  4WBY A;  4I29 A;  4KLT A;  2ZHB A;  1S77 D;  1ZQH A;  2NRK A;  4AT9 A;  4EYH B;  4DQQ A; 
#chains in the Genus database with same CATH topology
 1V38 A;  2ES6 A;  1ZQF A;  3AQM A;  2VIX A;  4BWJ A;  5JRT A;  4UB8 U;  4OJP A;  4KM5 A;  4KN7 A;  3MBY A;  2C2D A;  1TFY A;  3SI8 A;  2UVU A;  3IV6 A;  4R65 A;  5AM0 A;  5ALG A;  3WK5 A;  1PX5 A;  3F2B A;  2Q4T A;  1DRG A;  3WFQ E;  3OHB A;  2DR8 A;  1BNP A;  1JQR A;  3C5G A;  2G5I B;  1RG6 A;  3PW5 A;  7ICG A;  3B9J A;  5HHH A;  5ALX A;  1QSL A;  4CF3 A;  4DSK A;  1ZQA A;  2IHO A;  5AKY A;  3PR5 B;  2ZH9 A;  4C8O A;  4NY8 A;  3EZ5 A;  3QEB Z;  5IIL A;  3I28 A;  3G6Y A;  1C20 A;  4EX6 A;  4YD2 A;  3QZ8 A;  1KFS A;  2QAR A;  3PST A;  3K1Z A;  1Z00 B;  3RRH A;  4EED A;  4I2J A;  4I28 A;  2LYA A;  1Z1B A;  3RJH A;  1TK5 A;  2BGW A;  1NKB A;  3ORY A;  5J0O A;  2DPJ A;  3H8M A;  5HHI A;  3M6K A;  4U7C A;  2BBJ A;  3HPO A;  5D61 A;  3V7L A;  3RTV A;  1ED1 A;  5ALJ A;  4X4S A;  2B4V A;  3EPI A;  1ZQO A;  4J9Q A;  3AUO A;  2RDI A;  5KG4 A;  4ECS A;  2F1J A;  4O3S A;  2DVI A;  1Q8K A;  2NO5 A;  5HRG A;  5KG6 A;  2R8I A;  2G08 A;  1WOT A;  1WYG A;  5AKI A;  2GH1 A;  2HOI A;  3QU9 A;  4AT8 B;  1RPL A;  2W11 A;  1NOM A;  5AM5 A;  2OHF A;  3NGD A;  3VCB A;  1WCN A;  2ZH7 A;  1JIH A;  1SB3 C;  3JPP A;  3QUB A;  3RAX A;  5III A;  4NLK A;  4LEZ A;  5ALL A;  4DLG A;  2NRZ A;  5DDY A;  5JUM A;  5KFL A;  3BQ2 A;  4TUP A;  1D8Y A;  1LKY B;  1D8B A;  1F0M A;  2WB1 C;  3ZD8 A;  5DB9 A;  3OVA A;  4IQU A;  3JPT A;  4YP3 A;  8ICY A;  7ICO A;  4K9A A;  2Q0Z X;  3T3F A;  4M9J A;  3H4B A;  2JZB B;  4FZM A;  4F5P A;  3H8W A;  2DKZ A;  5ALS A;  4RUA A;  2UVV A;  3T5H A;  3Q8P B;  5KFM A;  1HIW A;  4CE6 A;  2JEF A;  4DL3 A;  2YN4 A;  5DBC A;  8ICO A;  4ELT A;  2H3I A;  3NKU A;  3PSP A;  3PX0 A;  2HHW A;  2BCQ A;  4IQW A;  2KK0 A;  3BJY A;  5DG8 A;  2BCS A;  1KW4 A;  4TQS A;  2IMW P;  3C29 A;  4K96 A;  3PR4 A;  5L9X A;  1X9W A;  7ICL A;  5GTH U;  5KG3 A;  2ODG A;  3UMC A;  4Q8F A;  1ZJM A;  4MEY A;  4Y2Q A;  2E1E A;  4KX5 A;  3GDX A;  4C8N A;  1Y88 A;  3TFR A;  4KB6 A;  3Q8M A;  2PI4 A;  2OCE A;  1NJZ A;  1TK0 A;  2ZH1 A;  4DSF A;  2I9G A;  1ZQB A;  4RPX A;  2WAQ C;  3E0F A;  5J0X A;  5HC9 A;  4X0B A;  2HHT A;  3QYP A;  2W9B B;  5ALR A;  2F3N A;  3GV5 B;  2P6R A;  4ZH4 A;  4MFA A;  2L5Y A;  3L9D A;  2HHP A;  4QZ9 A;  1T3Q A;  2EAN A;  3PW0 A;  1N60 A;  4P0Q B;  5HRK A;  2NV3 A;  3UMG A;  1BPX A;  3WKC A;  2V4Q A;  1ZYQ A;  5AI6 A;  1NI3 A;  1B4F A;  1CEZ A;  1EXN A;  2NYV A;  3NRW A;  2EAO A;  3M6Z A;  2GLE A;  1TKD A;  9ICO A;  4UAV A;  1ZQL A;  3LWM A;  1Q46 A;  4P4M A;  8ICC A;  1T4G A;  2KJ9 A;  2ZUB A;  1N61 A;  2DPI A;  1ZET A;  1ZQQ A;  4RT3 A;  3L4P A;  3CK6 A;  3JPQ A;  3AEV A;  2RHF A;  4QW8 A;  5DLG A;  1S9F A;  3WFR E;  1NKE A;  2XY5 A;  4F5Q A;  2BE3 A;  1QTM A;  4NKU A;  3H0L B;  4OJO A;  2WF9 A;  2QAR B;  4WH5 A;  1SV4 A;  5D49 A;  1ZQD A;  5ALT A;  2PMZ F;  2KMD A;  5F2V O;  3PX6 A;  4Z6C A;  2PFP A;  2WFA A;  4USA A;  4FO6 A;  5KFZ A;  5J2D A;  2ZIU B;  3TAN A;  4CF4 A;  4UAU A;  5AIB A;  2DQN B;  4NXT A;  5J0Q A;  4GXJ A;  2QKQ A;  3D2Q A;  4EZ6 A;  4J9M A;  2OXO A;  3RF9 A;  1YLQ A;  1IXR A;  3WK7 A;  7ICS A;  3HIL A;  2HCF A;  1ZQU A;  4OCZ A;  3UM9 A;  3OWG A;  2BZF A;  1L8O A;  3OUY A;  4YMM A;  1PK1 A;  2ID1 A;  4KMU A;  2IA6 A;  1S0M A;  2PI5 A;  1L8L A;  2DKX A;  5EOZ A;  4RWO A;  2ZH2 A;  4QWA A;  5DLF A;  4WBZ A;  1L3V A;  2HHQ A;  4AT9 B;  1UET A;  4WC5 A;  4E80 A;  3PML A;  4I2F A;  4LZG A;  3KHG A;  3UQ2 A;  4O5E A;  2MAX A;  2YQE A;  4P4O A;  1BVS A;  1V4A A;  4YVZ A;  4QZD A;  3UQ0 A;  4FBU A;  3ED5 A;  1HUO A;  4MF8 A;  2YMM A;  5KAI U;  1VDV A;  8ICU A;  2AH5 A;  4F5R A;  4EX7 A;  4DL6 A;  4ACO A;  1QCK A;  2GO7 A;  2RFF A;  2Y0S C;  4F71 A;  3AQF A;  2OH2 A;  4NLN A;  3CYM A;  4JV2 A;  4LT6 A;  2Q66 A;  3AU6 A;  4F4W A;  2KV2 A;  4KLD A;  2P35 A;  5J2I A;  1RZT A;  1OW5 A;  5KFR A;  4F50 A;  5F9L A;  4QIW F;  3M8S A;  1JN3 A;  1N5W A;  2A1A A;  2KOB A;  3U26 A;  2P66 A;  8ICH A;  3JPO A;  3H8S A;  5KFO A;  1COO A;  1ZQP A;  4F5N A;  3KHL A;  5ALP A;  4DWI A;  9ICQ A;  2HBM A;  2PKE A;  1NK6 A;  1QQ5 A;  2M9N A;  1KTQ A;  4NXV A;  5CB1 A;  1SXE A;  3MFH A;  4NM2 A;  5HR6 A;  1Q3V A;  4BXO A;  4J9L A;  3I76 A;  8ICA A;  3E58 A;  4YCX A;  2IBK A;  5EWG A;  2ZIV A;  3IDW A;  1TAM A;  4PL2 A;  1U9L A;  1K5O A;  3KTQ A;  3OJU A;  1J2M A;  2BPC A;  2YB1 A;  5DB6 A;  2VA3 A;  8ICS A;  2R8G A;  3ICX A;  5ALQ A;  1NK8 A;  5KFV A;  2FDR A;  3SZ2 A;  2FCL A;  4XJE A;  3WK4 A;  2KIV A;  3ETR A;  5AIA A;  4I2B A;  2AQ4 A;  4C8K A;  4EGW A;  2XY6 A;  3PY8 A;  2ZTC A;  3F5A A;  1BPZ A;  4DO9 A;  4UBB A;  2KJ8 A;  3MR6 A;  2WF8 A;  1ZD4 A;  2JH1 A;  4B6J A;  5KFG A;  4JV1 A;  4J03 A;  2FI1 A;  4WC2 A;  3T5K A;  2KSO A;  7ICQ A;  1ZQG A;  3TAP A;  1ZJN A;  3K7D A;  3KHH A;  4K4I A;  4I2C A;  3G6V A;  1ZQT A;  5J2F A;  2OYY A;  4K4G A;  3C21 A;  4QW9 A;  3FYH A;  4ATB B;  4LEW A;  4BDP A;  3IRU A;  3RB3 A;  4WBY A;  4I29 A;  3R9K A;  1ZQH A;  4EYH B;  4JWN A;  3RBD A;  1F5A A;  3NYB A;  1XSL A;  5KFE A;  2F2A B;  4KLS A;  2EZZ A;  3N28 A;  3V6K A;  3RR8 A;  3NUQ A;  5L1L A;  3EW9 A;  1Q78 A;  2PXI A;  2XIC A;  1X9S A;  3PW2 A;  4RQ4 A;  4F4Y A;  1PK3 A;  2B21 A;  4CGZ A;  4ECT A;  7ICN A;  1NK4 A;  5HML A;  4J9O A;  3C18 A;  2LM4 A;  4C80 A;  2BCR A;  3EF2 A;  3G6X A;  4RWP A;  3K75 D;  2KJ5 A;  1L3S A;  8ICN A;  4UB1 A;  3QUC A;  2Y1J A;  4B9S A;  1COK A;  2KVS A;  1JRP A;  4X4Q A;  3BDP A;  1BGX T;  1MA7 A;  5J8Y A;  2HBL A;  2C22 A;  2HW3 A;  4DOB A;  4A8E A;  4O3M A;  2AU0 A;  2R18 A;  3EWA A;  1SWW A;  2XO7 A;  1Z00 A;  1UT8 A;  4BGD A;  3HX0 A;  3TAD C;  3TAD A;  4US9 A;  1KFT A;  2LYB A;  3N7R C;  2BDU A;  4DOC A;  5DG9 A;  2BDP A;  5HRE A;  1UCV A;  4WJ3 B;  7ICR A;  4DCC A;  1SZH A;  7ICT A;  4EEB A;  2K89 A;  2W3S A;  8ICT A;  7ICP A;  2J6U A;  1S10 A;  3RJK A;  1X66 A;  4RQ7 A;  9ICC A;  1NJX A;  5IIN A;  1WG8 A;  2ZIW A;  2KD1 A;  5G5H A;  4P0Q A;  4BX9 C;  5CHE A;  4FO1 A;  3SAH A;  3C2K A;  4WQK A;  4IRC A;  9ICV A;  4PPX A;  3OSN A;  4NLC A;  4KMO B;  1N63 A;  1N62 A;  5L1M A;  2ASD A;  9ICE A;  3RRG A;  1NZP A;  4B9L A;  3RBE A;  4KTQ A;  1U45 A;  1KDH A;  4DQR A;  3PMN A;  3UPS A;  3RJI A;  2I5H A;  3N7P D;  2M2U A;  4OJ6 A;  1HUZ A;  4G9B A;  1F5S A;  5KFJ A;  4ECU A;  1T3N A;  2YMQ A;  2A19 A;  1S97 A;  5B3P A;  3TKA A;  2H5X A;  3ISD A;  4EEL A;  3UMB A;  3ZDD A;  3GIK A;  4KLF A;  1GPJ A;  1D8L A;  1J2N A;  2H3Z A;  2VKQ A;  4HYK A;  2ZHA A;  1UT5 A;  9ICA A;  1B22 A;  4E8F A;  1ECW A;  3ZD9 A;  4IR9 A;  1T94 A;  2AHO B;  2CN1 A;  5DED A;  5CWR A;  8ICP A;  3BZC A;  5F3X B;  3GII A;  1X2I A;  3UXN A;  5KFT A;  2BKE A;  2XCA A;  1SV0 C;  3ZDA A;  4E0D A;  4P0P B;  2WF6 A;  5HR9 A;  3SR6 A;  4P4P A;  1VJ5 A;  4GC6 A;  4FHY A;  4KLI A;  5KTQ A;  2O6K A;  5KFK A;  4M9L A;  4WCW A;  1DOQ A;  2KKP A;  4DF8 A;  1ZQM A;  5J2G A;  4KIT B;  1FIQ A;  5KFS A;  9ICW A;  3LK9 A;  3AN1 A;  5J2K A;  4M04 A;  4GFJ A;  4O9M A;  3GZF A;  3B0Y A;  1A76 A;  2FLL A;  3RH6 A;  1TE2 A;  8ICW A;  3NRZ A;  2G06 A;  4O3Q A;  2YMP A;  4M9N A;  4N7R A;  5B5E U;  2HHX A;  3MDC A;  1L7P A;  4EYI B;  1U49 A;  5KFB A;  3HKZ F;  3EPG A;  3UXO A;  3V72 A;  2KE7 A;  4C4T A;  3BQ1 A;  3D2S A;  2FPM A;  1ZRN A;  3LYS A;  1S5L U;  2NRT A;  1U47 A;  2HHV A;  4UW9 A;  3GIJ A;  4US8 A;  2G09 A;  3C28 A;  3MGH A;  5H2F U;  1IIP A;  4Y2R A;  2DWQ A;  3HJ4 A;  5EE1 A;  5KT4 A;  2M2T A;  4QNL A;  4R64 A;  3GV8 B;  2JMG A;  4Z6D A;  4F2R A;  3ISB A;  4NXW A;  4DSJ A;  1S0N A;  4DFM A;  3PSF A;  5KFQ A;  5KT6 A;  5KFC A;  4YR0 A;  1UHU A;  5ALY A;  4DQS A;  4YR3 A;  2M2V A;  4TUQ A;  2DRA A;  4RT2 A;  5ALI A;  1MN8 A;  3DDH A;  2W7O A;  8ICJ A;  4YFK A;  2XVT A;  3F2C A;  4DL7 A;  1RYS A;  3CW2 C;  1L7N A;  3FM9 A;  4O3N A;  4Y2S A;  3KZX A;  2F76 X;  3H8J A;  3IM1 A;  1WWU A;  1TFW A;  5HRB A;  2AQ0 A;  1CI4 A;  4FH3 A;  1R89 A;  4ED7 A;  5IIM A;  1JUD A;  3M9N B;  2JEJ A;  2G0A A;  3WFP A;  3RAQ A;  1MIY A;  3PNC A;  3UPQ A;  4MF2 A;  3C1Y A;  5EWF A;  2ZIX B;  2LKY A;  5T14 A;  5HNK A;  1ZD3 A;  1MIW A;  4PZN A;  5L1I A;  2DR5 A;  9ICJ A;  4IG8 A;  1XS9 D;  3KFU F;  3D6J A;  7ICU A;  1L7M A;  1K1S A;  3MGV A;  3H7I A;  4OAG A;  3QEA Z;  4DF4 A;  4DFP A;  2ASL A;  4RQ1 A;  4EZ9 A;  1LV5 A;  1ZQJ A;  3RB0 A;  4B9N A;  3TAR A;  4X0A A;  2JHD A;  1ZQW A;  3T5L A;  3THV A;  4PGX A;  2VA2 A;  4IRD A;  4DSL A;  5HRF A;  5ALM A;  5AKL A;  2Y1I A;  1N48 A;  5AK4 A;  8ICF A;  3WKE A;  3C2M A;  3JZ0 A;  1JX4 A;  3L3F X;  2IOF A;  2RQ5 A;  3H4D A;  1FFV A;  1UQV A;  4UAW A;  5F9N A;  3QUQ A;  2YB4 A;  3C2L A;  9ICF A;  1TVA A;  1FA0 A;  2W9C A;  4O3P A;  3NVO A;  4YD1 A;  4KLU A;  2DR9 A;  4PGQ A;  5CFU A;  2FJ6 A;  4ED1 A;  4ECR A;  1SGG A;  1ZQC A;  5ALV A;  3HIY A;  1RYR A;  3BQ7 A;  4DFJ A;  4P2H A;  2W9B A;  2ZH8 A;  4O3O A;  2ZUC A;  1JRO A;  2G07 A;  4NXZ A;  2IOH A;  2KIC A;  4OD0 A;  5J0P A;  2ZIV B;  1XU4 A;  3MR3 A;  2W9A A;  2PFN A;  2AXT U;  4PH5 A;  4ECY A;  2F8L A;  4PL1 A;  9ICB A;  4I27 A;  4Y2Y A;  2VA8 A;  4J9S A;  3TFS A;  4X4U A;  2ESE A;  3OHA A;  3CP8 A;  2WF7 A;  1BPB A;  5KL1 B;  1L3U A;  1MQ3 A;  8ICR A;  1Q3U A;  4WC3 A;  3RB6 A;  3V7J A;  2M2W A;  1SIJ A;  2JH7 A;  1TK8 A;  5AI4 A;  5EE9 A;  1UA0 A;  3ER8 C;  5J29 A;  2Z7J A;  2BCU A;  2HOF A;  4QZA A;  1M6Y A;  4O5C A;  1ZQN A;  2WAQ F;  4LEY A;  5K4L A;  4R8U B;  4UQG A;  4FHP A;  5CFT A;  1SL2 A;  3CNH A;  3L5K A;  3PO4 A;  1PVR A;  2KP7 A;  2WF5 A;  3H37 A;  1YZ7 A;  3WKA A;  2EAM A;  2XI9 A;  1CRX A;  3SV3 A;  5B66 U;  3PO5 A;  1Z4N A;  3OPX A;  4IR1 A;  7ICI A;  2FMP A;  4KLT A;  2ZHB A;  4EV6 A;  1S77 D;  4JLX A;  3PZP A;  4DQQ A;  1SKR A;  1BNO A;  3MR5 A;  3GU3 A;  4I2H A;  3N4M B;  3QXG A;  1TFR A;  1KN5 A;  5J0S A;  9ICG A;  1NK5 A;  2GAF D;  5DBA A;  2F44 A;  1S76 D;  4MFC A;  2ZUD A;  8ICK A;  2C28 A;  4QWC A;  5C0Y A;  3OUY B;  3MC1 A;  7ICE A;  1SKW A;  2HN1 A;  4F92 B;  5ALN A;  5CEH A;  4RNO A;  4X4T A;  4F3O A;  4ED8 A;  5ALD A;  3J81 j;  4C4S A;  4ECZ A;  5KG2 A;  2H3V A;  5DGB A;  4KX3 A;  4X4R A;  3M1Y A;  5KFA A;  1ZQK A;  1S8O A;  4WC7 A;  4K9B A;  3MDA A;  2IHN A;  2IOF K;  2ZH5 A;  3WFS C;  4RUC A;  1ZQY A;  2ZTE A;  5B3Q A;  2V9W A;  1JAL A;  5ALU A;  1V9P A;  4RNN A;  5AI5 A;  2KHQ A;  3IN5 A;  3QE9 Y;  2E3T A;  1ZQ1 C;  1ZQS A;  5AKJ A;  4NJ8 A;  2CRX A;  3MAB A;  1PUZ A;  4YN4 A;  4F4K A;  4NLZ A;  2WHE A;  2A1J A;  4HAI A;  2HVH A;  2W3R A;  2BR0 A;  4RQ8 A;  4ED3 A;  3KOO A;  4BUG A;  5AK5 A;  3M8R A;  3HW8 A;  5J2B A;  5BPC A;  4M5D A;  3T5J A;  2XY7 A;  4K8V A;  4DL5 A;  3K4G A;  2ZH6 A;  4GC7 A;  5J2J A;  3NVV A;  2ZJ8 A;  1ZQE A;  3PW7 A;  4U6P A;  2ZIW B;  3N7S C;  3WKD A;  4ED0 A;  4EBC A;  4HX0 A;  4WC0 A;  2QB0 A;  2Y0S F;  3D2N A;  1HJP A;  4GXK A;  4CDG A;  1JI7 A;  1R8C A;  9ICI A;  3H0R B;  3MFI A;  2BPF A;  2B6G A;  3ETL A;  3V7K A;  2K4H A;  3QU5 A;  5DKW A;  2RDJ A;  4RNM A;  4O69 A;  1ZQX A;  4PHA A;  3ONN A;  4AYB C;  2LMR A;  3V6H A;  4F5O A;  5DQH A;  3Q8L A;  3K1R B;  4Q43 A;  4B9V A;  4PGY A;  1MQ2 A;  2RRD A;  5AKG A;  5EE0 A;  3NWI A;  2LM1 A;  1BPE A;  2MUT B;  4ECQ A;  2K8B B;  4DQI A;  2BQU A;  1JXL A;  2F8K A;  2EZY A;  5KFY A;  3T79 A;  5KAF U;  1TV9 A;  2DBY A;  2KSO B;  1S0V A;  1QSS A;  4MEX A;  4BXO B;  3QU7 A;  1N56 A;  3N97 B;  3GFK B;  4UAR A;  4GXI A;  3AQK A;  1QH9 A;  1LB2 B;  4K97 A;  5D4B A;  2ZH4 A;  3WU2 U;  4DSI A;  5IIK A;  5J2C A;  3BQ0 A;  4OJ5 A;  4M2Y A;  1NKC A;  4JMU A;  3OTQ A;  4CNQ A;  3AQL A;  1IV8 A;  2I1Q A;  4BWM A;  3M9O B;  1SZP A;  3GIL A;  3IP4 B;  1V85 A;  4O6A A;  2K4E A;  2OM6 A;  2DRB A;  9ICN A;  1OUQ A;  3OGU A;  3TQ1 A;  5C5J A;  3ISC A;  3AQE A;  4EBJ A;  2E8P A;  5KNI A;  2ZTD A;  4OAH A;  3QNM A;  1DXS A;  1WWV A;  4F93 B;  2GA9 D;  1NK7 A;  3QZ7 A;  1MC8 A;  5JU5 A;  4QZB A;  5CJ7 A;  4QZG A;  4F8R A;  3PX4 A;  3AQN A;  1U4B A;  4EEN A;  2DL0 A;  4CCH A;  3BS5 A;  1NNL A;  5DQG A;  4RQ6 A;  4RWN A;  4E7X A;  1KEJ A;  4RZR A;  3RJJ A;  5A0L A;  4Q45 A;  4EBE A;  2FPK A;  2OWO A;  4XQ8 A;  5KT2 A;  2W54 A;  4FS1 A;  4DQP A;  5DB7 A;  4KLQ A;  2NRX A;  4JLZ A;  2NRV A;  3BS7 A;  1P7D A;  4FHV A;  2KFZ A;  4Q44 A;  4DFK A;  1RQN A;  5KT5 A;  4UAT A;  3SQI A;  5ALK A;  2KZM A;  4YXJ A;  2DFL A;  3CRX A;  3MR2 A;  1ZQZ A;  3JCF A;  1A0P A;  1ARO P;  4JV0 A;  1KFD A;  1PK1 B;  5D62 A;  3IG8 A;  2ISP A;  1Z19 A;  1QQ7 A;  5DDM A;  2JEI A;  2R8K A;  2Y9T A;  3NS1 A;  5TZV A;  1B43 A;  1BPD A;  2K4I A;  3BZK A;  3C66 A;  4Y2X A;  2ALZ A;  5ALH A;  2BHN A;  4LEV A;  3OSP A;  2O5A A;  4C8L A;  2R8J A;  3JPR A;  3HP6 A;  4ELV A;  5AK3 A;  4C7Z A;  2LYH A;  4QZI A;  4CRX A;  3JYY A;  4QJF B;  3A0B U;  4DLE A;  4QZE A;  9ICL A;  4XQ7 A;  4KLE A;  4XA5 A;  2PMZ C;  3QX7 A;  3C1Z A;  4FZL A;  5L1J A;  1ZQR A;  1SL0 A;  2MA1 A;  1MIV A;  1KNY A;  4IQT A;  4C0Z A;  3SV4 A;  4BJQ A;  2FLP A;  2QLT A;  2BQ3 A;  4KLM A;  1KRP A;  4UAY A;  1NZB A;  4PHE A;  3AL0 B;  5KFI A;  3RB4 A;  4IC9 A;  4Y2T A;  1WUD A;  3DV9 A;  4NM1 A;  3I1Y A;  5KG5 A;  3Q8S B;  1WCL A;  5FP0 A;  1O03 A;  5CRX A;  4B9U A;  5KL8 B;  4NKT A;  3GV7 B;  1RDF A;  3HT3 A;  3Q8K A;  5D46 A;  2E5S A;  4IRK A;  4Q8E A;  5J0R A;  3B0X A;  3WK8 A;  4ECV A;  4KLH A;  3ZDC A;  2JEG A;  2HMX A;  5KFU A;  1A77 A;  2KNJ A;  4F2S A;  2F1H A;  4Y2U A;  5AM2 A;  3Q8Q B;  2VJ4 A;  4RQ2 A;  7ICV A;  4F4Z A;  4QIW C;  2D6F C;  3H40 A;  3OVS A;  5J0Y A;  3SYZ A;  2W55 A;  4PHD A;  5HRI A;  3EYZ A;  3ALR A;  5KFP A;  2W9C B;  1KLN A;  3TI0 A;  4TUS A;  2HHU A;  2B51 A;  1S0O A;  4NXX A;  2H3Q A;  1SV0 A;  4Y2V A;  1X9X A;  3ZI4 A;  1V97 A;  8ICB A;  1CUK A;  2JXJ A;  4FFD A;  1HEK A;  3H38 A;  2HSZ A;  8ICM A;  3H39 A;  2XGP A;  3WFO A;  1JMS A;  1X40 A;  3FC4 A;  2PFQ A;  8ICL A;  2M0N A;  2UVW A;  2ASJ A;  1J97 A;  2R8H A;  2CPR A;  1URJ A;  2N1R A;  2JR5 A;  3LQC B;  4S3N A;  4UB2 A;  5DB8 A;  2MRL A;  4JWM A;  5ALZ A;  1RYU A;  4GLX A;  5ALF A;  1X42 A;  2A1J B;  2ZXH A;  4X5V A;  2YML A;  4NV0 A;  4ZOH C;  2YTU A;  5AIC A;  4WOY A;  4DS5 A;  1X6I A;  1N5X A;  5KFW A;  1SKS A;  4NLB A;  7ICH A;  4UB6 U;  5BOM A;  4O68 A;  1KSP A;  1PZN A;  2EDU A;  5HRH A;  4WQL A;  1MSW D;  3OVB A;  4F72 A;  1IG6 A;  3C23 A;  5ALO A;  1YZ6 A;  4M6W A;  2GWS A;  4RPY A;  5HMM A;  4YQW A;  2B0C A;  3F5E A;  4FHX A;  4R8U A;  3V6J A;  4F91 B;  3HWT A;  1OXJ A;  5AK6 A;  9ICP A;  5AKE A;  2EZX A;  3LVV A;  3GIM A;  4UB5 A;  4RQ5 A;  2W04 A;  3HRD D;  2YX8 A;  3KD3 A;  1QSY A;  5KFH A;  1Z3E B;  4O5K A;  1QQ6 A;  5J0U A;  2KFN A;  4QWE A;  2NRW A;  1NO5 A;  2ZG6 A;  5KG0 A;  2JRZ A;  3AU2 A;  5KFD A;  7ICF A;  1VLB A;  5DEC A;  5EE3 A;  2LHT A;  3PVX A;  2NRK A;  1RM6 C;  3IG5 A;  5AKH A;  3GQC A;  2F77 X;  1C7Y A;  8ICE A;  4WC6 A;  1YT3 A;  5KFF A;  4QZC A;  2P6U A;  5ALE A;  2DUY A;  1UA1 A;  5AI0 A;  4O3R A;  2Y9U A;  5KT7 A;  2E8O A;  3ERC C;  2PFO A;  4EBK A;  4NL9 A;  1T8E A;  2J6T A;  1IM4 A;  4UD5 A;  2DGZ A;  2KIW A;  1RQL A;  2HVI A;  4OAI Z;  1N2X A;  4K99 A;  4XUS A;  1PVQ A;  2KEY A;  4EP7 A;  5AM4 A;  5ALW A;  5CFS A;  4AT7 B;  2MUT A;  4M0A A;  5HP4 A;  1F44 A;  3E2E A;  5CA7 A;  4NWI A;  1JAJ A;  5IIO A;  2W7P A;  5DQI A;  3C5F A;  2XCP A;  1SWV A;  4FE3 A;  4XRH A;  4CF5 A;  2K4P A;  1TAQ A;  4IQV A;  4UAS A;  1RXW A;  2HBK A;  7ICJ A;  1NK0 A;  4I0U A;  2K8A A;  3LWL A;  3QU2 A;  2ZJA A;  5CP2 A;  1KQQ A;  1ZRM A;  2ISO A;  1X9M A;  3PSI A;  3KBB A;  4I2E A;  4EEK A;  2E8N A;  5J0W A;  4OAF A;  2ZXI A;  2EH9 A;  9ICX A;  5BOL A;  2HI0 A;  4DEZ A;  4ECX A;  2EAP A;  2W9M A;  4PZO A;  1X6J A;  4X4N A;  4M47 A;  5AI8 A;  4I2D A;  1K1Q A;  9ICH A;  4QZ8 A;  4TUR A;  3BS5 B;  7ICM A;  1KL9 A;  1SL1 A;  8ICI A;  4ELU A;  2GOL A;  8ICX A;  1L6N A;  2CXY A;  1ZXI A;  2JV3 A;  1XSP A;  2F1I A;  3M9M B;  8ICQ A;  8ICZ A;  2LBO A;  4UB4 A;  2BCV A;  3F53 A;  9ICR A;  3MGI A;  3ZDB A;  4QZH A;  4AP9 A;  1XWL A;  2AGQ A;  2UVR A;  5AM1 A;  5KG7 A;  2KKV A;  2FMS A;  4MKP A;  2I6X A;  1L5U A;  1KKX A;  1Q79 A;  4JK1 A;  1OU5 A;  3ER9 B;  3PHZ A;  4EBD A;  5DG7 A;  3SD7 A;  4FBT A;  5DGA A;  3M7D A;  2FLN A;  2KVC A;  3Q8R B;  4QZF A;  1DK3 A;  1RXV A;  4X4P A;  3AMZ A;  3QU4 A;  2ATL A;  2LI6 A;  3QUT A;  2NO4 A;  4DOA A;  4LZD A;  4Y2P A;  3SEN A;  1XO0 A;  2RLT A;  3KHR A;  3H3A A;  1AQ6 A;  2ZJ5 A;  4FZN A;  2KZ3 A;  3DEE A;  2OEH A;  3SEI A;  4IL6 U;  4RPZ A;  3LVW A;  4PJ0 U;  1GO3 F;  3FAH A;  3RH5 A;  4DL4 A;  4AT8 A;  4PHP A;  1L3T A;  4ED2 A;  3AM9 A;  5HRD A;  4YMN A;  2MSN A;  4O0I A;  2QB1 A;  5TIS U;  4K4H A;  4G3I A;  4R66 A;  2HBJ A;  3NVY A;  3O0F A;  4RWQ A;  5KT3 A;  3RH4 A;  4RU9 A;  2KG5 A;  1PVP A;  5GTI U;  4FH5 A;  4P0P A;  5AKX A;  4B9M A;  1TAU A;  3TAQ A;  4ATB A;  2ZIX A;  1XSN A;  1XNS A;  5JTG A;  4YR2 A;  2JZB A;  5DBB A;  2LPE A;  4R63 A;  4M9H A;  2FE9 A;  2FMQ A;  3SAG A;  2KZZ A;  4X4V A;  3VC8 A;  4LJX A;  4I2I A;  5AKZ A;  5J2A A;  1ZD2 P;  2BPG A;  4RQM A;  5J0T A;  1VFG A;  4LVS A;  5AKK A;  2BBH A;  5E79 U;  3JPS A;  4C8M A;  3MCR A;  2HOQ A;  1R8A A;  1L7O A;  1NJY A;  4DS4 A;  2AGO A;  1FEZ A;  3KZI U;  1O08 A;  2QB0 B;  4QWB A;  2B56 A;  5IIJ A;  4X4O A;  3PW4 A;  4ICA A;  8ICG A;  3ZDE A;  2W8L A;  4NXU A;  4JB3 A;  3PV8 A;  4M6W B;  4FHW A;  2W43 A;  3NTU A;  3WKB A;  2ZIU A;  3RFA A;  4FS2 A;  2XID A;  5AM3 A;  4EEY A;  5EWE A;  5CHG A;  1Z4O A;  4B9T A;  3LDA A;  4DSE A;  2AGP A;  5AHX A;  4KLO A;  4WC1 A;  2HHS A;  2DF4 B;  2IHM A;  4KN4 A;  5G5G A;  2KN7 A;  4K98 A;  3TAC B;  4UB3 A;  3IHQ B;  5HR7 A;  4YG2 A;  1DGS A;  2VJ5 A;  2HN2 A;  4RQ0 A;  1FFU A;  9ICT A;  4Y2J A;  4J9P A;  1QLN A;  4C7Y A;  1VJ7 A;  2WTF A;  4KLG A;  1NK9 A;  1ZQV A;  8ICV A;  2BQR A;  1SXD A;  4AYB F;  3HJE A;  4MFF A;  3SAF A;  2KTQ A;  1R8B A;  2J6S A;  7ICK A;  4Z6E A;  4ECW A;  2FPL A;  4Z6F A;  2D3D A;  4NL9 C;  2EWR A;  2G5H B;  2PBE A;  2IUB A;  5HRL A;  1JXE A;  1FO4 A;  4MHV A;  4DL2 A;  2V4R A;  2EQY A;  2WB1 F;  4QWD A;  2C2E A;  3RJG A;  2O1P A;  2K60 A;  2K8C B;  2C2R A;  2KHV A;  2ZH3 A;  3H0M B;  2H3F A;  3S6J A;  5KG1 A;  5J2E A;  9ICM A;  3BQT A;  4OO1 J;  4RQN A;  4KLJ A;  4TQR A;  2E1F A;  4AT7 A;  4WC4 A;  4J9N A;  2DR7 A;  2JGA A;  4RQ3 A;  9ICS A;  1KBU A;  4J9R A;  3RR7 A;  1UEV A;  4OJL A;  1ZQI A;  4KLL A;  1XO1 A;  3UXP A;  1ZOL A;  3WK6 A;  2D8C A;  1UPH A;  2W03 A;  4YMO A;  4M9G A;  1LVH A;  5L1K A;  1DGJ A;  3SMV A;  4NLG A;  9ICK A;  3WK9 A;  2YY6 A;  5CR0 A;  3RJF A;  2RP5 A;  1Z1V A;  3JPN A;  3NAS A;  2XGQ A;  3F2D A;  3RJE A;  4F4X A;  1NJW A;  2MU2 A;  2VAN A;  5J2H A;  1U48 A;  1XC9 A;  5KFX A;  4IS7 A;  2E8M A;  2W8K A;  1A6S A;  4ED6 A;  1UEU A;  2AJQ A;  5KFN A;  4C4R A;  3OJS A;  3EUB 2;  2A3V A;  3HJ1 A;  1D9F A;  5JTI A;  9ICU A;  3NVW A;  4UD4 A;  1B0X A;  4YXM A;  4UBC A;  4I2G A;  3A0H U;  3HKZ C;  3KKA A;  3KKA C;  1BPY A;  2HDO A;  4DFD A;  1T7P A;  4JUZ A;  5J8Y C;  1DK2 A;  4UAZ A;  4I2A A;  3OV7 A;  1LKY A;  2XC9 A;  4GIB A;  5D63 A;  4J9K A;  1H38 A;  1D9D A;  3FDS A;  1ZD5 A;  5AI9 A;  4AT9 A;  4O67 A;  3NVZ A; 
#chains in the Genus database with same CATH homology
 4JWN A;  1SKR A;  1ZQF A;  1BNO A;  3RBD A;  3MR5 A;  1F5A A;  3GQC A;  3NYB A;  1XSL A;  5KFE A;  3N4M B;  4I2H A;  4KLS A;  1TFR A;  3AQM A;  5J0S A;  4BWJ A;  1NK5 A;  9ICG A;  5DBA A;  1C7Y A;  1S76 D;  3V6K A;  2ZUD A;  3RR8 A;  4MFC A;  8ICE A;  2C28 A;  4QWC A;  5L1L A;  8ICK A;  4KN7 A;  5KFF A;  3MBY A;  2C2D A;  7ICE A;  3EW9 A;  1SKW A;  3OUY B;  1TFY A;  1Q78 A;  4QZC A;  4F92 B;  2PXI A;  2P6U A;  3SI8 A;  2UVU A;  1X9S A;  4R65 A;  4RQ4 A;  4F4Y A;  3PW2 A;  4RNO A;  4X4T A;  2B21 A;  1PX5 A;  1UA1 A;  4ECT A;  4O3R A;  4F3O A;  1NK4 A;  4ED8 A;  7ICN A;  3WFQ E;  5HML A;  4J9O A;  3C18 A;  3OHB A;  5KT7 A;  2BCR A;  4RWP A;  3G6X A;  4ECZ A;  2DR8 A;  5KG2 A;  3K75 D;  2PFO A;  5DGB A;  1BNP A;  4EBK A;  4X4R A;  1JQR A;  1L3S A;  3C5G A;  1T8E A;  5KFA A;  1ZQK A;  2J6T A;  3UPS A;  8ICN A;  3PW5 A;  7ICG A;  4UB1 A;  1IM4 A;  5HHH A;  4WC7 A;  4UD5 A;  2Y1J A;  4B9S A;  1QSL A;  3MDA A;  4X4Q A;  3BDP A;  2IHN A;  1BGX T;  2HVI A;  2ZH5 A;  3WFS C;  4RUC A;  1ZQY A;  2ZTE A;  2C22 A;  4DSK A;  1ZQA A;  2V9W A;  4XUS A;  3PR5 B;  2HW3 A;  2ZH9 A;  1V9P A;  4DOB A;  4C8O A;  4RNN A;  4NY8 A;  3EZ5 A;  3QEB Z;  4EP7 A;  5IIL A;  3G6Y A;  2AU0 A;  3QE9 Y;  4YD2 A;  4AT7 B;  2MUT A;  3EWA A;  4M0A A;  3QZ8 A;  5HP4 A;  2XO7 A;  1KFS A;  1Z00 A;  1ZQS A;  1UT8 A;  3E2E A;  5CA7 A;  4BGD A;  1JAJ A;  5IIO A;  1Z00 B;  3MAB A;  4YN4 A;  3HX0 A;  3RRH A;  4F4K A;  5DQI A;  3C5F A;  4NLZ A;  2A1J A;  2XCP A;  2HVH A;  2BR0 A;  4XRH A;  4RQ8 A;  3HW8 A;  4ED3 A;  3M8R A;  1KFT A;  5J2B A;  5BPC A;  4DOC A;  1TAQ A;  4I2J A;  4IQV A;  4I28 A;  5DG9 A;  2BDP A;  3RJH A;  5HRE A;  1TK5 A;  1RXW A;  4M5D A;  2BGW A;  1NKB A;  3ORY A;  7ICR A;  3T5J A;  5J0O A;  2DPJ A;  1NK0 A;  7ICJ A;  3LWL A;  5HHI A;  2XY7 A;  7ICT A;  4DL5 A;  3K4G A;  2ZJA A;  5CP2 A;  4GC7 A;  2ZH6 A;  5J2J A;  8ICT A;  7ICP A;  2J6U A;  2ZJ8 A;  1S10 A;  3RJK A;  1ZQE A;  3PW7 A;  2ISO A;  4RQ7 A;  9ICC A;  1X9M A;  1NJX A;  4ED0 A;  3HPO A;  4EBC A;  4I2E A;  5IIN A;  3V7L A;  5J0W A;  3RTV A;  3C2K A;  4IRC A;  9ICV A;  4X4S A;  4PPX A;  4WC0 A;  3EPI A;  1ZQO A;  4J9Q A;  9ICX A;  5BOL A;  3OSN A;  3AUO A;  1HJP A;  2RDI A;  5KG4 A;  4GXK A;  4ECS A;  2F1J A;  4O3S A;  4WC3 A;  4DEZ A;  4ECX A;  2W9M A;  1R8C A;  2ASD A;  9ICI A;  9ICE A;  2DVI A;  3RRG A;  1NZP A;  3MFI A;  3RBE A;  4B9L A;  5KG6 A;  2R8I A;  1U45 A;  4KTQ A;  2BPF A;  4M47 A;  5HRG A;  1WOT A;  1KDH A;  4I2D A;  4DQR A;  1K1Q A;  3ETL A;  2RDJ A;  3V7K A;  5DKW A;  4RNM A;  3PMN A;  4QZ8 A;  1RPL A;  4TUR A;  1NOM A;  1ZQX A;  4PHA A;  3RJI A;  7ICM A;  1SL1 A;  2M2U A;  8ICI A;  1HUZ A;  3NGD A;  4ELU A;  8ICX A;  3V6H A;  1WCN A;  2ZH7 A;  1JIH A;  5KFJ A;  3JPP A;  3RAX A;  5III A;  4ECU A;  1T3N A;  4F5O A;  4NLK A;  5DQH A;  3Q8L A;  4WC5 A;  4DLG A;  2NRZ A;  5DDY A;  5JUM A;  4Q43 A;  4PGY A;  1XSP A;  1S97 A;  5KFL A;  1MQ2 A;  4B9V A;  2F1I A;  2H5X A;  3M9M B;  3ISD A;  3BQ2 A;  8ICQ A;  8ICZ A;  4UB4 A;  2BCV A;  1BPE A;  3ZDD A;  3GIK A;  2MUT B;  4KLF A;  4TUP A;  9ICR A;  3MGI A;  1D8L A;  4ECQ A;  3ZDB A;  4HYK A;  1D8Y A;  2BQU A;  4DQI A;  4QZH A;  1JXL A;  1XWL A;  5KFY A;  2AGQ A;  2UVR A;  2ZHA A;  1UT5 A;  5KG7 A;  9ICA A;  1B22 A;  4E8F A;  3ZD8 A;  5DB9 A;  2FMS A;  1TV9 A;  3OVA A;  3ZD9 A;  4IQU A;  4IR9 A;  1S0V A;  1L5U A;  1QSS A;  4MEX A;  4BXO B;  3JPT A;  4YP3 A;  1N56 A;  8ICY A;  7ICO A;  1Q79 A;  2Q0Z X;  4JK1 A;  3GFK B;  5CWR A;  4GXI A;  3T3F A;  3N97 B;  3GII A;  3H4B A;  4M9J A;  2JZB B;  1LB2 B;  8ICP A;  1X2I A;  3UXN A;  5KFT A;  2BKE A;  2XCA A;  4F5P A;  3AQK A;  5D4B A;  3ZDA A;  4E0D A;  4EBD A;  5DG7 A;  5IIK A;  5J2C A;  4DSI A;  5HR9 A;  3H8W A;  2ZH4 A;  3BQ0 A;  4P4P A;  4RUA A;  2UVV A;  4GC6 A;  3T5H A;  4M2Y A;  1NKC A;  4KLI A;  4FHY A;  5KTQ A;  3AQL A;  3Q8P B;  4FBT A;  2I1Q A;  5KFM A;  4BWM A;  5KFK A;  3M9O B;  2JEF A;  4M9L A;  1DOQ A;  4DL3 A;  5DGA A;  2FLN A;  1SZP A;  5DBC A;  3GIL A;  4DF8 A;  1ZQM A;  5J2G A;  4KIT B;  4ELT A;  3Q8R B;  8ICO A;  4QZF A;  5KFS A;  1DK3 A;  1RXV A;  9ICW A;  9ICN A;  4X4P A;  2DRB A;  3LK9 A;  3OGU A;  5J2K A;  3TQ1 A;  5C5J A;  3PX0 A;  3ISC A;  4M04 A;  2HHW A;  4O9M A;  2ATL A;  2BCQ A;  4IQW A;  3B0Y A;  9ICH A;  4EBJ A;  1A76 A;  2ZTD A;  2FLL A;  3RH6 A;  8ICW A;  3BJY A;  4DOA A;  5DG8 A;  4LZD A;  2BCS A;  4TQS A;  4O3Q A;  2IMW P;  4F93 B;  4M9N A;  3PR4 A;  1NK7 A;  2HHX A;  5L9X A;  3KHR A;  1X9W A;  3H3A A;  2ZJ5 A;  3QZ7 A;  3MDC A;  4EYI B;  1MC8 A;  1U49 A;  2KZ3 A;  5KFB A;  4QZB A;  7ICL A;  5CJ7 A;  4QZG A;  4F8R A;  5KG3 A;  3PX4 A;  4RPZ A;  3EPG A;  3AQN A;  3UXO A;  3V72 A;  3RH5 A;  1U4B A;  4Q8F A;  1ZJM A;  4DL4 A;  4CCH A;  4MEY A;  3BQ1 A;  4AT8 A;  4PHP A;  1L3T A;  2FPM A;  5DQG A;  4ED2 A;  4X4N A;  5HRD A;  4YMN A;  3GDX A;  2NRT A;  4RQ6 A;  1U47 A;  4C8N A;  1Y88 A;  3TFR A;  2HHV A;  3Q8M A;  4RWN A;  3GIJ A;  2PI4 A;  4O0I A;  1NJZ A;  4E7X A;  1KEJ A;  1TK0 A;  4RZR A;  2ZH1 A;  3MGH A;  4DSF A;  2I9G A;  4K4H A;  1ZQB A;  4G3I A;  4R66 A;  3RJJ A;  4RPX A;  4Q45 A;  4EBE A;  5HC9 A;  5J0X A;  3HJ4 A;  2FPK A;  4X0B A;  2HHT A;  5KT4 A;  4RWQ A;  2OWO A;  2W9B B;  2M2T A;  5KT3 A;  3RH4 A;  4R64 A;  3GV8 B;  4XQ8 A;  4RU9 A;  4FH5 A;  4Z6D A;  5KT2 A;  3GV5 B;  4FS1 A;  2P6R A;  4F2R A;  4ZH4 A;  3ISB A;  4DQP A;  5DB7 A;  4MFA A;  4DSJ A;  4KLQ A;  1S0N A;  3L9D A;  4B9M A;  2NRX A;  2HHP A;  4DFM A;  4QZ9 A;  3TAQ A;  1TAU A;  2NRV A;  5KFQ A;  5KT6 A;  1XSN A;  4ATB A;  3PW0 A;  5HRK A;  4FHV A;  2KFZ A;  1BPX A;  4Q44 A;  4YR2 A;  2V4Q A;  2JZB A;  4DFK A;  1ZYQ A;  5KFC A;  4YR0 A;  1CEZ A;  1EXN A;  5KT5 A;  5DBB A;  2KZM A;  4R63 A;  1TKD A;  4M9H A;  9ICO A;  4YXJ A;  2DFL A;  2FMQ A;  4DQS A;  4YR3 A;  2KZZ A;  4X4V A;  3MR2 A;  1ZQZ A;  4TUQ A;  1ARO P;  3LWM A;  4JV0 A;  4P4M A;  1ZQL A;  2M2V A;  1KFD A;  4I2I A;  8ICC A;  5J2A A;  2DRA A;  1T4G A;  2ZUB A;  4RT2 A;  2BPG A;  2DPI A;  1ZET A;  2ISP A;  1ZQQ A;  4RT3 A;  5J0T A;  3JPQ A;  1VFG A;  5DDM A;  8ICJ A;  2JEI A;  4LVS A;  1S9F A;  4QW8 A;  5DLG A;  3WFR E;  1NKE A;  3JPS A;  2R8K A;  4C8M A;  4YFK A;  2XY5 A;  4F5Q A;  5TZV A;  1B43 A;  1BPD A;  2BE3 A;  1QTM A;  3C66 A;  4NKU A;  4DL7 A;  1R8A A;  1RYS A;  2ALZ A;  1NJY A;  4DS4 A;  2BHN A;  2AGO A;  4O3N A;  3OSP A;  2O5A A;  4C8L A;  2R8J A;  4QWB A;  3JPR A;  5D49 A;  1ZQD A;  3H8J A;  3IM1 A;  5IIJ A;  3HP6 A;  4ELV A;  5F2V O;  3PX6 A;  4Z6C A;  4X4O A;  3PW4 A;  2PFP A;  4WCW A;  1TFW A;  5HRB A;  2LYH A;  4QZI A;  8ICG A;  3JYY A;  3ZDE A;  2AQ0 A;  5KFZ A;  4FO6 A;  5J2D A;  4WC6 A;  4DLE A;  2W8L A;  4QZE A;  9ICL A;  4FH3 A;  4XQ7 A;  1R89 A;  3TAN A;  4KLE A;  4XA5 A;  4ED7 A;  5IIM A;  3PV8 A;  4M6W B;  4FHW A;  3M9N B;  2JEJ A;  3NTU A;  5J0Q A;  3WFP A;  3C1Z A;  5L1J A;  4GXJ A;  1ZQR A;  1SL0 A;  3RAQ A;  4FS2 A;  4EZ6 A;  3PNC A;  4J9M A;  3UPQ A;  1KNY A;  1MIV A;  1MIY A;  1YLQ A;  1IXR A;  7ICS A;  4IQT A;  4MF2 A;  3C1Y A;  5EWF A;  3SV4 A;  4EEY A;  2FLP A;  5EWE A;  1OU5 A;  5CHG A;  5HNK A;  1ZQU A;  2BQ3 A;  4KLM A;  1KRP A;  4UAY A;  4B9T A;  1MIW A;  3LDA A;  4DSE A;  2AGP A;  5L1I A;  4PHE A;  2DR5 A;  9ICJ A;  4KLO A;  4IG8 A;  4WC1 A;  1XS9 D;  3OUY A;  5KFI A;  2HHS A;  2IHM A;  4KN4 A;  7ICU A;  2KN7 A;  1K1S A;  3RB4 A;  3H7I A;  4YMM A;  2ID1 A;  3QEA Z;  4KMU A;  2IA6 A;  4UB3 A;  3IHQ B;  4DF4 A;  4DFP A;  2ASL A;  1S0M A;  2PI5 A;  4NM1 A;  4RQ1 A;  5KG5 A;  3Q8S B;  5EOZ A;  4RWO A;  1WCL A;  4EZ9 A;  4YG2 A;  2ZH2 A;  1DGS A;  4QWA A;  5DLF A;  1LV5 A;  1L3V A;  3RB0 A;  1ZQJ A;  2HHQ A;  4WBZ A;  5DED A;  4B9N A;  4RQ0 A;  3TAR A;  1UET A;  4B9U A;  9ICT A;  4AT9 B;  4E80 A;  4NKT A;  3GV7 B;  3HT3 A;  4X0A A;  3PML A;  1ZQW A;  4I2F A;  3KHG A;  3Q8K A;  3T5L A;  3UQ2 A;  4LZG A;  2MAX A;  5D46 A;  4P4O A;  3THV A;  1BVS A;  4J9P A;  4O5E A;  4PGX A;  4YVZ A;  4QZD A;  1QLN A;  1V4A A;  3UQ0 A;  2VA2 A;  1HUO A;  4FBU A;  4MF8 A;  4DSL A;  4IRD A;  4IRK A;  4Q8E A;  1VJ7 A;  5J0R A;  3B0X A;  2WTF A;  4KLG A;  4ECV A;  1NK9 A;  4KLH A;  1ZQV A;  5HRF A;  3ZDC A;  8ICU A;  8ICV A;  2JEG A;  5KFU A;  4F5R A;  1A77 A;  4F2S A;  2BQR A;  2Y1I A;  4DL6 A;  2F1H A;  1N48 A;  4MFF A;  8ICF A;  3Q8Q B;  3C2M A;  4RQ2 A;  7ICV A;  3JZ0 A;  2RFF A;  1JX4 A;  2KTQ A;  1R8B A;  4F4Z A;  4NLN A;  2J6S A;  4JV2 A;  4Z6E A;  7ICK A;  4ECW A;  3AU6 A;  2FPL A;  4Z6F A;  3H40 A;  3H4D A;  4F4W A;  4LT6 A;  2Q66 A;  4KLD A;  3OVS A;  5J0Y A;  3SYZ A;  4PHD A;  5HRI A;  2PBE A;  3EYZ A;  5J2I A;  1RZT A;  5KFP A;  4UAW A;  5KFR A;  5HRL A;  1JXE A;  5F9N A;  2W9C B;  4F50 A;  1KLN A;  5F9L A;  4TUS A;  3TI0 A;  3M8S A;  2HHU A;  1JN3 A;  2P66 A;  4DL2 A;  1S0O A;  3C2L A;  9ICF A;  1TVA A;  8ICH A;  2V4R A;  2W9C A;  8ICB A;  1FA0 A;  4QWD A;  1CUK A;  2C2E A;  3RJG A;  2O1P A;  3JPO A;  4O3P A;  2C2R A;  3H38 A;  3H8S A;  4YD1 A;  1COO A;  5KFO A;  8ICM A;  2ZH3 A;  4KLU A;  3H39 A;  1ZQP A;  4F5N A;  2DR9 A;  3KHL A;  2XGP A;  4PGQ A;  1JMS A;  4DWI A;  9ICQ A;  3WFO A;  2PFQ A;  8ICL A;  2UVW A;  5KG1 A;  5J2E A;  9ICM A;  3BQT A;  4ED1 A;  1NK6 A;  4ECR A;  2ASJ A;  2M9N A;  1ZQC A;  4KLJ A;  3HIY A;  4TQR A;  1KTQ A;  2R8H A;  1RYR A;  4AT7 A;  4WC4 A;  4J9N A;  4DFJ A;  3LQC B;  4S3N A;  5CB1 A;  4UB2 A;  5DB8 A;  2DR7 A;  4P2H A;  3MFH A;  2W9B A;  4RQ3 A;  4NM2 A;  4O3O A;  4JWM A;  9ICS A;  2ZH8 A;  2ZUC A;  4GLX A;  4J9R A;  3RR7 A;  4BXO A;  4NXZ A;  4J9L A;  2A1J B;  8ICA A;  4X5V A;  1UEV A;  1ZQI A;  4KLL A;  1XO1 A;  5J0P A;  1XU4 A;  3MR3 A;  2W9A A;  4YCX A;  3UXP A;  2PFN A;  2IBK A;  4DS5 A;  5EWG A;  4PH5 A;  4ECY A;  5KFW A;  1SKS A;  9ICB A;  1U9L A;  4I27 A;  4YMO A;  3KTQ A;  3OJU A;  4M9G A;  2BPC A;  5L1K A;  7ICH A;  4NLG A;  2VA8 A;  4J9S A;  9ICK A;  3TFS A;  5DB6 A;  5BOM A;  2VA3 A;  5CR0 A;  8ICS A;  4X4U A;  3OHA A;  2R8G A;  3RJF A;  1NK8 A;  5KFV A;  1KSP A;  3SZ2 A;  3JPN A;  1PZN A;  2XGQ A;  1BPB A;  3RJE A;  4F4X A;  5HRH A;  1MSW D;  1L3U A;  3OVB A;  1NJW A;  3C23 A;  1MQ3 A;  2VAN A;  5J2H A;  2AQ4 A;  1U48 A;  4I2B A;  3RB6 A;  4C8K A;  3V7J A;  8ICR A;  4M6W A;  2M2W A;  1XC9 A;  5KFX A;  1TK8 A;  2W8K A;  2GWS A;  4AT8 B;  4RPY A;  5HMM A;  4ED6 A;  2XY6 A;  1UA0 A;  5KFN A;  3PY8 A;  2ZTC A;  4YQW A;  2AJQ A;  1UEU A;  5J29 A;  3OJS A;  2BCU A;  1BPZ A;  4DO9 A;  4UBB A;  3HJ1 A;  1D9F A;  4FHX A;  4R8U A;  4QZA A;  3MR6 A;  3V6J A;  4O5C A;  4F91 B;  1ZQN A;  9ICU A;  4UD4 A;  4YXM A;  5KFG A;  3HWT A;  4UBC A;  4I2G A;  4R8U B;  4UQG A;  4FHP A;  4JV1 A;  9ICP A;  3GIM A;  1SL2 A;  4WC2 A;  4UB5 A;  4RQ5 A;  1BPY A;  3T5K A;  3PO4 A;  7ICQ A;  2KP7 A;  1ZQG A;  1QSY A;  5KFH A;  3TAP A;  1ZJN A;  1Z3E B;  1T7P A;  4O5K A;  4JUZ A;  3H37 A;  5J0U A;  3KHH A;  4K4I A;  4I2C A;  3G6V A;  2KFN A;  1DK2 A;  4UAZ A;  5J2F A;  4QWE A;  1ZQT A;  2NRW A;  4I2A A;  3SV3 A;  4K4G A;  1NO5 A;  5KG0 A;  2XC9 A;  3PO5 A;  3C21 A;  3OV7 A;  4QW9 A;  5KFD A;  3AU2 A;  7ICF A;  4IR1 A;  3FYH A;  5DEC A;  4J9K A;  7ICI A;  4ATB B;  1H38 A;  4BDP A;  1D9D A;  2FMP A;  3FDS A;  3RB3 A;  3PVX A;  4WBY A;  4I29 A;  4KLT A;  2ZHB A;  1S77 D;  1ZQH A;  2NRK A;  4AT9 A;  4EYH B;  4DQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...