5J0TA

Binary complex crystal structure of dna polymerase beta with g:a mismatch at the primer terminus
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
330
structure length
327
Chain Sequence
b'APQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
molecule tags Transferase/dna
source organism Homo sapiens
publication title Structures of DNA Polymerase Mispaired DNA Termini Transitioning to Pre-catalytic Complexes Support an Induced-Fit Fidelity Mechanism.
pubmed doi rcsb
total genus 109
structure length 327
sequence length 330
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2016-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5j0tA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5j0tA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5j0tA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5j0tA03
5J0TA 1X9SA 3JPQA 3KHGA 1SKRA 3RJKA 4NLGA 1SKSA 5DB9A 3HT3A 3AU2A 3N97B 1NK5A 3MR5A 7ICGA 1BPEA 4YD1A 2UVRA 1IXRA 4FS1A 4QW8A 4J9MA 4ECZA 4UAYA 5J2AA 3OSPA 2HHSA 1BPXA 3RJGA 2HHTA 5BPCA 4EBDA 5KT4A 5JUMA 5IINA 1QLNA 4YN4A 3ZDBA 5J0PA 5L1IA 4DFMA 4XQ8A 4PH5A 1TV9A 5KFEA 2DPIA 5KT6A 2PI5A 2HW3A 5F2VO 1DGSA 2KFZA 5KFHA 2UVWA 4O3NA 5KFVA 4B9SA 3T5JA 1KEJA 2ZTDA 4DSFA 2J6UA 5J2GA 3SI8A 3WFPA 2IHMA 1UETA 8ICSA 1U4BA 3M8SA 2FPKA 1ZQHA 1TK8A 3RR7A 4XQ7A 5DKWA 5J2KA 3M9MB 3C2LA 3JPPA 1XSNA 8ICFA 3HIYA 4YR3A 4HYKA 4YMOA 5KT7A 5HRBA 5EOZA 4IQUA 1TK5A 1K1QA 3IM1A 3PW7A 4DWIA 2DR8A 1U47A 4F5RA 2ASLA 4JK1A 5HHIA 1ZQNA 9ICNA 5DDMA 3HX0A 4DSLA 5HC9A 4TQSA 4G3IA 4RQ2A 2LYHA 4ECUA 1UEUA 3RAXA 3PY8A 1CEZA 5KFRA 4BDPA 4WC3A 5KT2A 2I9GA 2HVIA 1WOTA 3GILA 4KLIA 1IM4A 1D8LA 3ZD8A 2FLLA 4IQWA 2JEFA 1Z3EB 9ICGA 3HJ1A 5J2HA 3ZDEA 2ZH4A 4O5EA 1ZQCA 3KTQA 5IIMA 1ZQOA 7ICVA 5HR9A 2PFOA 4C8MA 4F4YA 1S9FA 4ED2A 1D8YA 2HHQA 5HREA 4F4WA 1TFYA 1ZQWA 4RPXA 3RJJA 4KLDA 2J6SA 1Y88A 1XS9D 5IIIA 4M9GA 4M9NA 1JIHA 4RQ0A 4I2CA 3QE9Y 4MFFA 3PX4A 1NK0A 4F92B 4I28A 2ZJ5A 3BJYA 1TKDA 4B9LA 4PGYA 5DEDA 3PX6A 5DBAA 4KLGA 4RT2A 5L1LA 4QZDA 1L3VA 3UXNA 5HP4A 4RQ7A 5J0WA 1SL0A 9ICAA 8ICWA 4DL5A 1JXLA 4YR2A 3C23A 5DLFA 3RB0A 7ICHA 4B9NA 4UD5A 4AT7A 3H3AA 3UXPA 2M2UA 5KFUA 4ELUA 3KHLA 3RB4A 5HRDA 4RZRA 3EYZA 2VA3A 3IHQB 3PMNA 4R8UB 2XCPA 2M2VA 4PHDA 2A1JB 4M9JA 1PZNA 3H39A 4DQSA 1ZQEA 9ICWA 2DR5A 4S3NA 4RQ6A 4DQIA 4KLSA 4C8KA 1ZQTA 3RH6A 4KTQA 3C2MA 4ECRA 4RWPA 1XSPA 1Z00B 3FYHA 1QSSA 4YVZA 2NRWA 5J0SA 3HP6A 3JPRA 2ZTEA 3G6YA 5KFJA 2RFFA 2KFNA 1NJYA 3OV7A 4KLMA 4FS2A 4DOBA 4BXOB 4ECWA 8ICJA 4JV0A 9ICIA 5HRLA 4WBYA 2F1HA 3PV8A 1A76A 2VA2A 2BKEA 4DL7A 1VJ7A 1U9LA 1UA0A 1LV5A 3MFIA 3RH4A 2DFLA 2PXIA 3MDCA 4NKTA 1ZQSA 7ICFA 5DG8A 2R8IA 3V6JA 5DQGA 4GXKA 3RR8A 1BNOA 1CUKA 4UAZA 7ICJA 1WCLA 3ZD9A 4RNNA 8ICAA 3NTUA 3NGDA 3BQ0A 5J0UA 3Q8MA 4ED1A 2BPFA 3B0YA 2ZUCA 3H4BA 5J2JA 3ETLA 5KT5A 4QZGA 2ZH2A 4TURA 3GIIA 2ZHAA 5KFNA 3QEAZ 2ASDA 2W9AA 4ZH4A 2IA6A 4K4HA 4YMNA 2DR7A 3C21A 2XGPA 4GC6A 3GV5B 2BQ3A 5F9LA 3HWTA 2PFPA 4O5KA 3OVBA 2BQUA 3MGIA 5CB1A 3H8JA 3BQ2A 3PW5A 4ECQA 3LQCB 1PX5A 2FLPA 5KFSA 3G6XA 4I2EA 4J9QA 3V7JA 3TFRA 2ZH1A 3PR5B 5CJ7A 5KFIA 3THVA 5EWEA 2C2DA 2Y1JA 2BPGA 8ICUA 3PW4A 3MBYA 4NM2A 4UB5A 1B22A 4O3QA 1OU5A 2DRAA 2VA8A 4I2JA 4IQVA 4F4KA 4Z6CA 4NLNA 2H5XA 4X4RA 4TUSA 2C2RA 4I2IA 3Q8RB 1MQ2A 3H4DA 5KG1A 5J0OA 3OGUA 3Q8QB 1D9FA 2KZZA 4GC7A 9ICPA 8ICCA 1RXVA 3RRGA 5HRFA 2P66A 3AQNA 3RBDA 4C8OA 1ZQUA 2ASJA 4M0AA 4RU9A 4XRHA 1U45A 9ICMA 4KITB 4KLTA 1F5AA 4PGQA 3QZ8A 2AU0A 1BNPA 5DLGA 4UD4A 4RUCA 4GXIA 1XSLA 4YXJA 2ISPA 2HHUA 3H40A 3RJIA 3TAPA 3ISDA 1T3NA 1RZTA 2ZUDA 1ZQDA 2ZJ8A 2AJQA 2A1JA 2XY7A 9ICFA 8ICPA 2BE3A 3AQMA 4DLEA 4ED0A 4F2RA 2V4QA 9ICJA 4FBTA 4RT3A 2MAXA 4MFAA 5IIJA 5BOMA 4DOAA 4YQWA 5KFLA 4DEZA 4F5PA 3GFKB 1SZPA 3TQ1A 3GV8B 1RYRA 8ICKA 2ZH7A 4UB3A 3V7KA 4KLFA 4NLKA 3C5FA 4F2SA 4M9LA 1MIYA 2ATLA 4KLHA 1ZQXA 3FDSA 4IR1A 4PGXA 8ICBA 3V7LA 2PFNA 1AROP 4I2AA 5BOLA 2NRVA 1NKBA 4RQ4A 1N56A 9ICOA 3E2EA 4QZEA 4K4GA 5KG4A 5J2EA 5D4BA 3UPSA 2RDIA 3RRHA 1U49A 4O3RA 2XC9A 2ZJAA 2AQ4A 7ICKA 1UEVA 1TFWA 3V72A 1JQRA 3TARA 2R8KA 4DQRA 5KFPA 5HRGA 4I2GA 3BQ1A 2J6TA 4KLUA 5KFAA 3OHAA 1ZJMA 1UA1A 5KT3A 4Q44A 2ZH9A 4BXOA 1JN3A 5L9XA 4ECXA 4O3OA 1T8EA 4QWAA 1S0OA 2KP7A 5DBBA 2Q66A 5KG5A 4DF8A 3PO5A 5J0YA 5J0XA 3T5HA 3T3FA 1R8BA 2DR9A 3Q8LA 3V6HA 1L5UA 4F5QA 4B9MA 2V9WA 1MIWA 4DO9A 4F4XA 3TAQA 1UT8A 4KLOA 3JPOA 5J2DA 4WC4A 4DFKA 3LWLA 4IG8A 1S0VA 1NKEA 4E80A 3H38A 4NM1A 4EEYA 9ICLA 3RJHA 2Y1IA 3ZDAA 2F1IA 3EWAA 4ELTA 4ELVA 4EBKA 2BDPA 2ID1A 4KN4A 5DB6A 3SYZA 4TQRA 4PHPA 4MF8A 2W8LA 8ICVA 4DQQA 5KFTA 4RWNA 3TI0A 1ZQGA 4YMMA 1QSYA 1JX4A 2ZUBA 1DOQA 5DBCA 4IR9A 5DB7A 1KLNA 4JWNA 2JZBB 8ICHA 3EPGA 1TVAA 1NK4A 4TUPA 4QZ8A 3JPTA 1NJWA 4LZGA 1ZQAA 2M2WA 3M8RA 2HVHA 2HHWA 4X4UA 1ZQQA 2B21A 2ZH8A 1TAQA 5IIKA 2Q0ZX 4RPZA 4F5NA 4GXJA 5F9NA 1H38A 4AT8B 3JPNA 4NXZA 1L3TA 4DOCA 4O0IA 5KFQA 3LK9A 4DF4A 3PX0A 4FHWA 2ZH6A 4M47A 3Q8SB 1V9PA 1ZQFA 4ECYA 3RH5A 9ICXA 1ZQBA 3Q8KA 4ED3A 4MF2A 2MUTA 2ISOA 2AQ0A 5TZVA 4RQ1A 2W9CB 3AUOA 8ICZA 8ICRA 1NO5A 3EW9A 1COOA 5DGBA 1XC9A 4TUQA 2P6RA 4QZ9A 4KLQA 3GIJA 5DDYA 4DS4A 9ICHA 8ICMA 1BVSA 3RJFA 1KFTA 5IIOA 4M6WB 2BCQA 4E8FA 3AQLA 2P6UA 2BQRA 4QZBA 1ZQYA 3GIMA 4F50A 3ORYA 1KFSA 1L3UA 4QWEA 4X5VA 1HUZA 2NRXA 4M9HA 2HHVA 2XCAA 3L9DA 4RNMA 3M9NB 9ICVA 4WC1A 5CHGA 3EPIA 2O1PA 4ATBA 9ICUA 2GWSA 7ICPA 4F91B 3C5GA 4DS5A 3T5LA 4FHYA 1KFDA 2M9NA 5J0QA 3JPSA 1NOMA 4MEYA 4J9SA 3PW0A 7ICLA 5C5JA 2IMWP 4EBEA 3WFOA 3PW2A 3GIKA 5CP2A 3H8WA 3SZ2A 3C1ZA 1ZQRA 4IRCA 3K4GA 3HW8A 2BHNA 3BQTA 5DG7A 1S77D 8ICOA 4J9OA 3RTVA 4QZAA 2V4RA 1HUOA 2BCRA 5J2IA 4UBBA 4FBUA 4ECVA 5KFGA 5CR0A 4DFJA 1S97A 2BCUA 4O9MA 2M2TA 5HNKA 4DL2A 7ICMA 4UB1A 5KTQA 4JUZA 4QZCA 1NK8A 1RYSA 4M04A 5HRIA 3H37A 3NYBA 4DL3A 3Q8PB 3RB3A 3JZ0A 4YP3A 4CCHA 3PR4A 5KG0A 8ICEA 5L1JA 1R8AA 4E7XA 5DQIA 1B43A 3C1YA 3MFHA 3G6VA 8ICQA 3LDAA 5DG9A 5KG6A 3B0XA 1BGXT 3MR6A 3MR3A 4DL4A 3RB6A 2FMQA 4DQPA 2JEIA 2KZMA 1DK2A 3MR2A 4M5DA 1X9MA 2ZH5A 1ZQZA 3OJUA 5KG2A 3KHRA 2C28A 5HMMA 2RDJA 8ICIA 9ICSA 1D9DA 1ZQKA 4P4OA 4MFCA 7ICEA 4XA5A 1T4GA 4F5OA 4FO6A 1NK7A 3JYYA 2ZH3A 4IRDA 1S0MA 4XUSA 2UVVA 3AQKA 1ZQLA 5HHHA 4AT7B 4Q8FA 4I29A 4RWOA 3OUYB 4WC5A 3GDXA 3H8SA 2C22A 4Z6DA 4R65A 2FPMA 4J9RA 3QEBZ 4I2HA 4WCWA 4LVSA 2HHXA 2O5AA 7ICUA 3OVAA 4RPYA 3RAQA 1K1SA 1C7YA 3QZ7A 3ISCA 1MQ3A 1QTMA 2PFQA 9ICRA 1TK0A 4WC7A 2UVUA 5KG7A 2W9CA 4RUAA 4KLJA 2MUTB 3EZ5A 4ECTA 3TFSA 1MSWD 5CA7A 1RPLA 5IILA 1ZQPA 5KG3A 3KHHA 4F8RA 4FH3A 3UQ0A 1TFRA 1ZYQA 4JV2A 1JXEA 2W9BA 4M2YA 1SKWA 2PI4A 1KDHA 1ZQMA 4DLGA 7ICOA 2FMSA 1NK9A 4X4PA 2ALZA 8ICLA 4J9KA 2AGQA 4Q45A 4I2FA 3RBEA 3WFQE 4K4IA 2JEGA 1Q79A 4KLLA 2BPCA 4PHAA 4ATBB 3N4MB 5KFDA 4Q8EA 1YLQA 4C8NA 1VFGA 4GLXA 4X4NA 2I1QA 2KZ3A 3OUYA 4I2DA 1NKCA 3C2KA 5DGAA 1DK3A 4EP7A 8ICTA 4EYIB 1MC8A 4M6WA 4R8UA 2FPLA 4FHPA 4O5CA 4DSKA 4LT6A 3OVSA 8ICXA 2W9MA 3OSNA 1R89A 3OJSA 3RJEA 2IBKA 3GQCA 4F3OA 1SL2A 3C18A 4QZHA 4B9UA 2FLNA 4RQ3A 4P2HA 4YFKA 1KSPA 1T7PA 4DL6A 5EWGA 5KFWA 2BCSA 2FMPA 2DPJA 3H7IA 4IRKA 4EBCA 4ED7A 3V6KA 4R66A 2R8GA 2BGWA 1XO1A 4WC0A 4P4MA 5J0RA 3WFSC 2BR0A 4QWBA 4YR0A 5CWRA 1S0NA 3SV3A 1NK6A 4J9PA 4PHEA 4R64A 4DSEA 5KFMA 1BPDA 3LWMA 1BPZA 1EXNA 4Q43A 5KFCA 4ED6A 2NRZA 2XO7A 4YD2A 4F93B 3SV4A 4DFPA 1ZQJA 2KTQA 9ICKA 1MIVA 1V4AA 4FHXA 4RWQA 2XGQA 4X0BA 2DRBA 2JZBA 3TANA 1L3SA 3C66A 3PO4A 4ECSA 3ISBA 5L1KA 4EZ9A 1KTQA 5KFBA 3MDAA 4I27A 4PPXA 4Z6EA 5J29A 2NRTA 3GV7B 3MGHA 4J9LA 4FHVA 4X0AA 1X2IA 4AT9A 4BWMA 4IQTA 4WC2A 1NJXA 5KFKA 7ICSA 3BDPA 1HJPA 4FH5A 1N48A 4QZFA 3T5KA 4KLEA 1FA0A 7ICRA 4WBZA 3MABA 4BGDA 5KFOA 1KRPA 4C8LA 4UAWA 1XU4A 1BPYA 1XWLA 3K75D 4B9TA 1BPBA 4KN7A 2JEJA 7ICNA 4I2BA 7ICTA 8ICGA 1NJZA 5EWFA 5J2FA 4JWMA 1U48A 1SL1A 3ZDDA 3UXOA 4EBJA 3UQ2A 2W8KA 4Z6FA 4B9VA 3HJ4A 1S10A 2R8HA 2C2EA 4YXMA 1A77A 4KMUA 4UB4A 1ZQIA 2F1JA 2AGPA 4E0DA 5KFZA 2ZTCA 4YCXA 4LZDA 2XY5A 4JV1A 5J2BA 9ICEA 4X4QA 4X4VA 4QWCA 2WTFA 4MEXA 2ZHBA 2NRKA 2W9BB 3PMLA 1ZJNA 2IHNA 1ZQVA 3AU6A 3ZDCA 4X4SA 1QSLA 1JMSA 4BWJA 3M9OB 2KN7A 4AT9B 2HHPA 3WFRE 4R63A 7ICIA 5DB8A 4AT8A 4YG2A 4O3PA 4UQGA 4QWDA 9ICCA 1NZPA 5DQHA 1S76D 1WCNA 2BCVA 3HPOA 5HRHA 9ICBA 5KFXA 5KFFA 1UT5A 4WC6A 4DSIA 2AGOA 1JAJA 4UBCA 4NKUA 8ICYA 4F4ZA 1RXWA 4NY8A 5HMLA 4QW9A 4P4PA 1Z00A 4O3SA 9ICTA 2VANA 4EZ6A 2R8JA 8ICNA 5HRKA 2DVIA 4ED8A 3PVXA 4UB2A 1KNYA 1R8CA 1ZETA 4QZIA 4X4TA 3OHBA 5D49A 2OWOA 4RQ8A 5DECA 4J9NA 5KFYA 4EYHB 4DSJA 1Q78A 2XY6A 1TAUA 5D46A 1LB2B 4RNOA 1X9WA 9ICQA 3PNCA 3UPQA 4NLZA 2PBEA 5J2CA 4RQ5A 7ICQA 4X4OA
chains in the Genus database with same CATH superfamily
5J0TA 3KHGA 3KZIU 2HBKA 3HT3A 5ALWA 5AKEA 2QKQA 4FS1A 4QW8A 1QQ6A 2HHSA 3RJGA 3NVYA 2EWRA 5JUMA 3ZI4A 4ICAA 1PX5A 5L1IA 1TV9A 5AKIA 2UVWA 3CYMA 5ALYA 4UAUA 2GA9D 3T5JA 3WFPA 3D6JA 2I5HA 2E3TA 1U4BA 2FPKA 4NL9A 4XQ7A 3C2LA 1N5WA 4YR3A 4YMOA 5KT7A 2EAOA 2KSOA 1K1QA 1TK5A 3PW7A 4DWIA 3H0MB 1U47A 4F5RA 3BS7A 3F2CA 4JK1A 5DDMA 1DGJA 3DDHA 4TQSA 1UEUA 3HJEA 2LPEA 5KFRA 2I9GA 4EELA 4UB8U 3GILA 4JLZA 1IM4A 1L7MA 2FLLA 4WQLA 3WK8A 3HJ1A 2A1AA 2DF4B 4O5EA 1ZQCA 5IIMA 4C8MA 1WWVA 2B51A 1TFYA 4F4WA 4RPXA 3ONNA 4M9NA 1JIHA 4RQ0A 3WKEA 3PX4A 3JCFA 3UXNA 1SL0A 2KIWA 3RB0A 2EZZA 4K9BA 5GTHU 3H3AA 3RB4A 4RZRA 3EYZA 2XCPA 1J97A 2M2VA 1X9XA 3H39A 5D62A 2HOFA 5ALHA 5CEHA 2Q4TA 1ZQTA 4AYBC 2RLTA 1JRPA 4YVZA 5ALRA 4O3MA 5KFJA 2RFFA 2WAQF 4PL2A 2RHFA 3HKZF 5AM2A 1VJ7A 1U9LA 1UA0A 3TADC 4NKTA 5DG8A 2KNJA 2R8IA 3BS5B 3NGDA 5J0UA 5JTGA 3B0YA 4BUGA 4QZGA 2ZH2A 3L5KA 1LKYB 4PJ0U 2W43A 2BQUA 5AM5A 3PW5A 3LQCB 1N62A 5AKZA 1WWUA 2FLPA 4I2EA 3QXGA 2NYVA 2ES6A 2Y1JA 3RFAA 8ICUA 4NLNA 4Z6CA 3H0LB 4X4RA 2DUYA 3Q8RB 3H4DA 5KG1A 3OGUA 3CK6A 1D9FA 1O08A 5HRFA 3AQNA 2KP7A 4M0AA 1F5AA 4RU9A 4KITB 3SMVA 5EE3A 1FFUA 5DLGA 2HI0A 2OCEA 5B3QA 3WKDA 1RZTA 2ZJ8A 4DLEA 4Y2TA 2OXOA 4RT3A 4DOAA 5BOMA 2RP5A 5KFLA 3PSIA 1X66A 1SZPA 8ICKA 4B6JA 4C4RA 4KLFA 4NLKA 2JMGA 2E8MA 4PGXA 2WF8A 2PFNA 1JALA 2NRVA 3WK5A 5BOLA 5D4BA 1U49A 2ZJAA 7ICKA 1UEVA 1FIQA 4DQRA 1ZJMA 1JN3A 3WKAA 1T8EA 5J0YA 3T3FA 3Q8LA 3I28A 1L5UA 2K8CB 1AQ6A 1D8BA 1MIWA 4Y2SA 3TAQA 3MCRA 5ALVA 3HILA 1J2NA 4WC4A 4UW9A 4IG8A 1S0VA 3OPXA 4K99A 4EEYA 9ICLA 3NRWA 3QU4A 2IHOA 4ELVA 2ID1A 3NASA 8ICVA 4RWNA 3TI0A 1QSYA 2ZUBA 5AKLA 1DOQA 1QQ7A 1A0PA 5DB7A 4TUPA 3NS1A 2IUBA 1ZQAA 2WB1F 3PSPA 3M8RA 2ZH8A 5IIKA 4GXJA 4KMOB 5F9NA 5ALEA 1VDVA 1L3TA 4DOCA 2NO4A 5ALIA 2DKZA 2KIVA 3SQIA 4ECYA 3RH5A 5ALFA 2MUTA 4OJ6A 2W9CB 8ICZA 2KJ5A 4QJFB 4EGWA 9ICHA 4UAVA 1KFTA 3SD7A 4Y2XA 2P6UA 3AQLA 4QZBA 4F50A 4OAIZ 2DRAA 2HHVA 4Y2QA 5AI8A 4X5VA 4M9HA 2NRXA 9ICVA 4WC1A 3EPIA 2O1PA 3IV6A 5AK3A 3C5GA 2M9NA 5AI4A 2KV2A 3WFOA 1L7PA 3GIKA 3K4GA 3L4PA 5ALGA 5DG7A 4J9OA 2V4RA 1HUOA 2BCRA 4EV6A 4ECVA 1DXSA 3BZKA 4DL2A 2OYYA 4UB1A 4JUZA 4QZCA 4FZMA 5HRIA 4CCHA 1XO0A 1R8AA 2WHEA 5DQIA 8ICQA 2PMZC 3G6VA 3LDAA 3AN1A 4LEYA 2ESEA 3RB6A 2KZMA 3MR3A 2RRDA 2FMQA 2G06A 3MR2A 1ZQZA 5KG2A 2RDJA 9ICSA 1ZQKA 4XA5A 4FO6A 3B9JA 1NI3A 1NK7A 3AQKA 1ZQLA 4UB6U 4Q8FA 4RWOA 3OUYB 1UPHA 4WCWA 4ACOA 2LKYA 4LVSA 2KSOB 4KM5A 5ALDA 1PVPA 7ICUA 3CP8A 3MGVA 3RAQA 1C7YA 2JR5A 5AIAA 4WC7A 5KG7A 2W9CA 4KLJA 3MC1A 1L6NA 2HN1A 5IILA 3KHHA 2IOHA 4NXXA 2W9BA 2PI4A 1KDHA 7ICOA 4X4PA 1NK9A 3KZXA 2G09A 3WKBA 4I2FA 1QQ5A 4K4IA 2E5SA 4GIBA 3NVOA 1YLQA 3NVZA 4C8NA 4GLXA 5E79U 1DK3A 5AKJA 1MC8A 2FPLA 4O5CA 3K7DA 3OVSA 5AIBA 3NVVA 1R89A 2NV3A 5CFUA 3OJSA 4FZLA 1N2XA 4QZHA 4P2HA 4DL6A 2A19A 2R8GA 1XO1A 4P4MA 3H0RB 1NK6A 5KNIA 3SV3A 8ICLA 2Y9TA 3LWMA 2QB1A 2WF6A 4Q43A 3T79A 2XO7A 1ZQJA 2KTQA 4FHXA 1VJ5A 4RWQA 4X0BA 2DRBA 2JZBA 3KOOA 2W55A 4I27A 4ECSA 4OO1J 3MGHA 4FE3A 7ICSA 4HAIA 2W7PA 1FA0A 1B4FA 7ICRA 1URJA 4BGDA 4B9TA 1BPBA 4I2BA 2D8CA 2DKXA 5J2FA 4JWMA 1SL1A 1J2MA 4EBJA 3UQ2A 1TAMA 2NO5A 4YXMA 5AK6A 1ZQIA 5KFZA 4X4VA 3WKCA 4JV1A 5J2BA 2F8LA 4X4QA 2WTFA 1OXJA 3J81j 5HR6A 5ALNA 2DQNB 3PMLA 1ZJNA 1ZQVA 1QSLA 3M9OB 4BWJA 4AT9B 2ZIWA 7ICIA 5DB8A 4UQGA 4QWDA 5ALTA 1PK1B 2E8PA 1UT5A 2JXJA 4UBCA 2DBYA 2ZIVA 4NY8A 4QW9A 1Z00A 9ICTA 2WF9A 5HRKA 2K8AA 3PVXA 4UB2A 1ZETA 4QZIA 2W54A 2OWOA 5KFYA 1TAUA 5CFSA 3JZ0A 2A3VA 4X4OA 1T94A 1MA7A 4WQKA 3JPQA 1SKSA 3AU2A 3N97B 1BPEA 4YD1A 3KBBA 2G5HB 5KT4A 1QLNA 4YN4A 2HSZA 1RG6A 5J0PA 4E8FA 4PH5A 4RWPA 3KD3A 5KT6A 5F2VO 2KFZA 4O3NA 5ALJA 1KEJA 4UATA 1GO3F 3IRUA 5J2KA 3M9MB 1XSNA 3HIYA 4HYKA 5HRBA 3IM1A 5HHIA 1ZQNA 4DSLA 5HC9A 2Y0SF 2LYHA 4WC3A 2HVIA 4CGZA 9ICGA 5J2HA 2ZH4A 3KTQA 4F4YA 4ED2A 4CF4A 3AQEA 3QUTA 4I2CA 1SZHA 1NK0A 5L1MA 5H2FU 2ZJ5A 3BJYA 5DEDA 3PX6A 5CRXA 2K60A 4RQ7A 5J0WA 8ICWA 4DL5A 3VCBA 3C23A 7ICHA 3UXPA 5HRDA 3IHQB 1Q3VA 2QB0B 2A1JB 3M6KA 1PZNA 4M9JA 1ZQEA 1LKYA 9ICWA 2GLEA 4DQIA 3C2MA 3N7PD 1JROA 4ECRA 1XSPA 1QSSA 5T14A 5J0SA 2ZXHA 2ZTEA 2E8NA 1NJYA 4KLMA 4Y2PA 8ICJA 1SB3C 4CRXA 4DL7A 2DFLA 3MDCA 1O03A 3ETRA 4O68A 3RR8A 4UAZA 1FO4A 3ZD9A 1ZQ1C 1N5XA 5AI9A 3A0BU 3H4BA 5J2JA 3ER8C 1Z1VA 3ETLA 4A8EA 4TURA 5KFNA 2YX8A 4K4HA 4YMNA 3C21A 4JMUA 2XGPA 2BQ3A 4NWIA 3KKAA 5CB1A 1Z19A 3H8JA 4ECQA 5G5GA 2QLTA 5KFSA 5KFIA 2C2DA 2FJ6A 2BPGA 5AKGA 3MBYA 3PW4A 1OU5A 4I2JA 4F4KA 2H5XA 5AKKA 1MQ2A 5C0YA 2ODGA 3F5AA 3Q8QB 2KZZA 3RRGA 1WOTA 2G5IB 2KD1A 4PGQA 1UHUA 4UD4A 1XSLA 2HHUA 2ZUDA 2E8OA 2WFAA 4F71A 2JV3A 2H3QA 3TKAA 4GFJA 3F53A 1X42A 1YZ7A 4DEZA 3GFKB 3TQ1A 3SEIA 3AL0B 3BQ7A 1X40A 1X6IA 4F2SA 2ATLA 2GAFD 3V7LA 4I2AA 4NLBA 1NKBA 4RQ4A 1N56A 3E2EA 1PK1A 4K4GA 2RDIA 2AQ4A 1TFWA 2R8KA 2YB4A 3BQ1A 2J6TA 3OHAA 1UA1A 2YMLA 2ZXIA 4QWAA 5KG5A 5AI0A 1KKXA 2V9WA 4F4XA 3ED5A 5B66U 3JPOA 1SWWA 2GH1A 4US9A 1NKEA 3QUBA 4NM1A 2BBHA 5AKXA 3CRXA 3M6ZA 4MF8A 4DCCA 4IR9A 1KLNA 2JZBB 3EPGA 4QZ8A 3JPTA 4LZGA 2HVHA 1PVRA 1ZQQA 4KX5A 2B21A 2KICA 3JPNA 4NXZA 5EE9A 4O0IA 3LK9A 4DF4A 9ICXA 4MF2A 1HIWA 2AQ0A 5AI6A 5TZVA 4RQ1A 1N60A 2YQEA 5DGBA 1HEKA 4TUQA 1XC9A 4DS4A 2XCAA 2JH7A 4RNMA 3M9NB 2YMPA 5CHGA 1NOMA 4EBEA 3BQTA 4UBBA 4K98A 1S5LU 2B6GA 7ICMA 3KKAC 4Y2VA 2MU2A 5ALLA 8ICEA 3PR4A 3MFHA 4K96A 5DG9A 2AHOB 3MR6A 4DL4A 2JEIA 1DK2A 5AK5A 1X9MA 3OJUA 5CFTA 3KHRA 2KMDA 5HMMA 8ICIA 2H3FA 1SV0C 1D9DA 1T4GA 2ZH3A 4IRDA 1S0MA 2KVSA 4J03A 1WG8A 3GDXA 1PUZA 3H8SA 4Z6DA 4J9RA 3QEBZ 1ECWA 2C22A 4I2HA 3ER9B 3S6JA 2O5AA 4QIWF 2MRLA 3F5EA 3AEVA 1K1SA 2PFQA 2UVUA 1P7DA 1SV4A 3TFSA 2WAQC 1MSWD 1RPLA 4FH3A 3UQ0A 2LBOA 1SKWA 4DLGA 2ALZA 5J8YC 4J9KA 1CI4A 2JHDA 3RF9A 3WFQE 2JEGA 1Q79A 4KLLA 2BPCA 4MHVA 4PHAA 5KFDA 1ZXIA 4I2DA 3H8MA 3C2KA 5DGAA 5ALUA 4EP7A 1V97A 3AQFA 5B5EU 4FHPA 4F3OA 3C18A 4YFKA 1T7PA 2BCSA 2DPJA 3WFSC 2BGWA 5J0RA 2KOBA 1S0NA 4YR0A 4O69A 5CWRA 4R64A 4DSEA 4DFDA 1BPDA 2YN4A 5ALPA 2ZIXB 2NRZA 3SV4A 4DFPA 5AK4A 5D61A 1L8LA 2QARB 3C66A 4Q8EA 5L1KA 4EZ9A 1KTQA 5KFBA 3GV7B 2KHVA 2NRTA 5J29A 4AP9A 1IG6A 1ZRMA 4WC2A 4IQTA 1V85A 1HJPA 4WBZA 4QZFA 3T5KA 4KLEA 1UCVA 4UAWA 1BPYA 7ICTA 1NJZA 4P0QB 1U48A 1F44A 5B3PA 1A77A 4KMUA 4UB4A 1RQNA 4E0DA 9ICEA 2XY5A 5KAIU 1KW4A 3CW2C 2BDUA 3AU6A 3ZDCA 1JMSA 2KN7A 1M6YA 4AT8A 2VIXA 5DQHA 3HPOA 4WC6A 1JAJA 4CF5A 1RXWA 2F8KA 2YY6A 4P4PA 4O3SA 2WF5A 2VANA 4EZ6A 2R8JA 5ALQA 1KNYA 1R8CA 3QUCA 5DECA 4RQ8A 2XY6A 4F72A 1X9WA 1ZD3A 9ICQA 1YT3A 4NLZA 2PBEA 4LEWA 1X6JA 1X9SA 3OTQA 1SKRA 5DB9A 1Z4NA 1NK5A 7ICGA 2UVRA 4J9MA 4C4SA 3OSPA 1BPXA 2HHTA 5BPCA 4EBDA 5IINA 3CNHA 3ZDBA 4K8VA 3NKUA 2ZIXA 4EX7A 4DFMA 5KFEA 2DPIA 2PI5A 5KFHA 5KFVA 4B9SA 2ZTDA 5J2GA 3SI8A 4NJ8A 2IHMA 4IC9A 5D63A 1TK8A 3JPPA 8ICFA 5EOZA 4IQUA 2ASLA 3GU3A 1DRGA 2XICA 4Y2YA 4RQ2A 2K4HA 3RAXA 3PY8A 4BDPA 3C29A 3LVWA 4BX9C 4KLIA 3ZD8A 4IQWA 2JEFA 1Z3EB 2IOFA 3M7DA 1ZQOA 4KLDA 1XS9D 5IIIA 3D2NA 2PKEA 4F92B 2AXTU 1TKDA 4B9LA 4PGYA 2W03A 5DBAA 4KLGA 4RT2A 5L1LA 4QZDA 2CPRA 1L3VA 5HP4A 2HOIA 1SIJA 4OJ5A 5K4LA 1JXLA 4P0QA 5DLFA 2EZYA 1Q46A 5KFUA 3KHLA 1SXEA 2E1FA 2VA3A 3ICXA 3SAGA 4DQSA 2DR5A 4RQ6A 4KLSA 3FYHA 2NRWA 3OWGA 2N1RA 2KFNA 3OV7A 4BXOB 4ECWA 4JV0A 9ICIA 3PV8A 2VA2A 1A76A 4FZNA 1LV5A 5FP0A 1ZQSA 4NXTA 4GXKA 3IN5A 1BNOA 1OW5A 7ICJA 1WCLA 4RNNA 8ICAA 3NTUA 3BQ0A 3Q8MA 1WYGA 4ED1A 2BPFA 2ZUCA 1KN5A 3GIIA 4NL9C 3WK9A 2W9AA 2DR7A 2PFPA 4GC6A 3GV5B 4O5KA 3HWTA 3MGIA 3BQ2A 2KJ8A 1YZ6A 4J9QA 3PR5B 5CJ7A 3THVA 2Z7JA 5EWEA 2XI9A 3WK7A 4NM2A 4UARA 5TISU 4UB5A 2VA8A 4IQVA 2F76X 4TUSA 4I2IA 1NNLA 4JLXA 5J0OA 2KKVA 2FE9A 4NLCA 3BZCA 4GC7A 9ICPA 8ICCA 1RXVA 2P66A 3RBDA 1ZQUA 2ASJA 9ICMA 1U45A 3H37A 1ZRNA 3QZ8A 2AU0A 4OAHA 2H3VA 3RJIA 3TAPA 1T3NA 3ISDA 1ZQDA 9ICFA 2BE3A 8ICPA 3AQMA 5G5HA 3QX7A 4YQWA 3ALRA 4F5PA 4N7RA 2ZH7A 3K1RB 2F44A 4UB3A 3C5FA 1B0XA 1N61A 4IS7A 4IR1A 4OCZA 4QZEA 2KE7A 3UPSA 4O3RA 2XC9A 5ALSA 3V72A 3TARA 2MSNA 2HBMA 4KLUA 4EEBA 2ZH9A 5KT3A 4Q44A 4BXOA 2BBJA 4ECXA 4O3OA 2EH9A 4OAGA 3UMGA 5DBBA 2Q66A 3PO5A 3T5HA 1R8BA 2DR9A 4P0PA 3IDWA 4F5QA 4B9MA 4KLOA 4NXWA 4IL6U 3A0HU 2VKQA 2L5YA 3ZDAA 2F1IA 3EWAA 4ELTA 4KN4A 3D2QA 3SYZA 1ZQGA 4YMMA 4KB6A 5DBCA 1NJWA 2HHWA 2P35A 4F5NA 4AT8B 4CE6A 3EF2A 5KFQA 2ZH6A 2BZFA 2EANA 5ALZA 3Q8SB 1V9PA 3O0FA 3Q8KA 2F77X 2ISOA 1KBUA 3AUOA 3LYSA 8ICRA 3EW9A 1COOA 2P6RA 4KLQA 3QU5A 4KX3A 3DV9A 3RJFA 2MA1A 5IIOA 4M6WB 2BCQA 2DWQA 2FCLA 1L3UA 2VJ5A 2GWSA 4USAA 4F91B 4DS5A 3T5LA 5J0QA 5CHEA 7ICLA 2IMWP 5CP2A 3H8WA 5KL8B 1ZQRA 2YTUA 8ICOA 4OAFA 3RTVA 4QZAA 5KFGA 4O9MA 4K97A 5AKYA 3N7SC 5HNKA 2ZIUB 4C0ZA 4DL3A 3Q8PB 3IG5A 3RB3A 4YP3A 1A6SA 3QNMA 5L1JA 4E7XA 1B43A 3SAHA 3SR6A 3B0XA 1BGXT 2RQ5A 2OEHA 4M5DA 2PMZF 4NXVA 5EE0A 1Z1BA 4P4OA 3JYYA 2UVVA 3UM9A 5HHHA 5GTIU 4I29A 4WC5A 3AM9A 2HBLA 1SXDA 2HN2A 2R18A 1RM6C 3ISCA 1MQ3A 9ICRA 4RUAA 1V38A 2MUTB 4U7CA 4PL1A 1ZQPA 4F8RA 5KG3A 1TFRA 1JXEA 5AM4A 4M2YA 1KL9A 4RQMA 3NUQA 3RBEA 2Y9UA 3N4MB 2E1EA 2I1QA 2F2AB 2KZ3A 2W11A 4EYIB 1L8OA 4M6WA 1JUDA 4LT6A 2KJ9A 3OSNA 3GZFA 3GQCA 5ALOA 2FLNA 4RQ3A 1MN8A 4IRKA 5EWGA 5KFWA 3H7IA 3BS5A 4EBCA 3V6KA 4R66A 4QWBA 1JI7A 5AM3A 5KFMA 1BPZA 5KFCA 1T3QA 4F93B 4YD2A 1MIVA 3TANA 1L3SA 3ISBA 3MDAA 4X0AA 3R9KA 3IG8A 1X2IA 2CRXA 2D3DA 4OJPA 1N48A 5KFOA 1KRPA 4C8LA 2LM1A 2JEJA 2HCFA 3ZDDA 2W8KA 4Z6FA 4EENA 4B9VA 2ZG6A 1CRXA 2H3ZA 2F1JA 4LZDA 4QNLA 4LEVA 4MEXA 2ZHBA 2W9BB 2YB1A 4X4SA 2HHPA 3TACB 1ZOLA 4R63A 4YG2A 5AICA 1S76D 9ICBA 5KFXA 3UMBA 5KFFA 4DSIA 8ICYA 5HMLA 1L7OA 1Q3UA 8ICNA 4ED8A 4O6AA 2KKPA 4X4TA 3OHBA 5D49A 2K4EA 4NV0A 2G08A 4J9NA 2LM4A 4DSJA 5D46A 1LB2B 3PNCA 3UPQA 4RQ5A 4NLGA 3RJKA 3PZPA 4P0PB 4OJOA 2KK0A 3MR5A 3QU9A 1IXRA 4ECZA 3HKZC 4UAYA 5J2AA 1RYUA 3WK4A 3I1YA 4XQ8A 2HW3A 1DGSA 1NZBA 3FM9A 3K1ZA 4DSFA 2J6UA 2LMRA 1UETA 8ICSA 3M8SA 1ZQHA 1LVHA 3RR7A 3QYPA 5ALXA 5DKWA 1PVQA 4C7YA 4HX0A 3F2DA 2Y0SC 5A0LA 2DR8A 1OUQA 2VJ4A 9ICNA 4MKPA 5JTIA 3HX0A 4G3IA 2YMMA 1XNSA 3WU2U 4ECUA 4RQNA 1CEZA 5KT2A 2ZIWB 1D8LA 3ZDEA 5HR9A 7ICVA 2HMXA 2PFOA 1S9FA 2HHQA 5HREA 1D8YA 1ZQWA 3RJJA 2J6SA 1Y88A 4M9GA 3QE9Y 4MFFA 4I28A 1S8OA 2AH5A 3QUQA 3PHZA 4WOYA 9ICAA 3IP4B 2HOQA 1KQQA 4CDGA 4YR2A 4UD5A 4B9NA 4AT7A 4CNQA 5JU5A 2M2UA 4ELUA 3M1YA 5ALKA 2GOLA 1TE2A 3PMNA 4R8UB 4PHDA 3EUB2 1ZD2P 4S3NA 1L7NA 4C8KA 4KTQA 3RH6A 2O6KA 1Z00B 3HP6A 3JPRA 2W7OA 2B56A 3G6YA 4FS2A 4DOBA 1Q8KA 5HRLA 4WBYA 2HBJA 4QIWC 2F1HA 2BKEA 3MFIA 3RH4A 2PXIA 7ICFA 3V6JA 5DQGA 1CUKA 4NXUA 5EE1A 2B0CA 5KT5A 4C7ZA 2IOFK 3SENA 2ZHAA 3QEAZ 4PZOA 2ASDA 4ZH4A 2IA6A 5F9LA 3C28A 3OVBA 2W3RA 1F5SA 2YMQA 3DEEA 3G6XA 3V7JA 3TFRA 2ZH1A 1SV0A 3PSTA 1B22A 1IV8A 4O3QA 3KFUF 3HRDD 2C2RA 1ZD5A 1PK3A 4C8OA 4XRHA 4KLTA 1BNPA 4RUCA 4GXIA 4G9BA 4YXJA 2ISPA 3H40A 2AJQA 2A1JA 2XY7A 1RDFA 4ED0A 3WK6A 4F2RA 2V4QA 9ICJA 4FBTA 2MAXA 4MFAA 5IIJA 4C80A 1RYRA 3GV8B 2JRZA 3V7KA 3N28A 4M9LA 1MIYA 4KLHA 1ZQXA 3D2SA 3FDSA 8ICBA 2K4IA 1AROP 3UMCA 9ICOA 4AYBF 5KG4A 5J2EA 3RRHA 1ZD4A 1ED1A 2M0NA 2EAPA 1JQRA 4LJXA 2KEYA 5KFPA 5HRGA 4I2GA 4JB3A 5KFAA 4EX6A 5L9XA 1S0OA 2W3SA 2HDOA 4DF8A 5J0XA 3FC4A 3V6HA 4BJQA 4DO9A 1UT8A 2EAMA 1VLBA 5J2DA 2OHFA 4DFKA 3LWLA 4E80A 4LEZA 3H38A 5JRTA 3RJHA 2Y1IA 2CXYA 1SGGA 4EEKA 2BDPA 4EBKA 2KHQA 5DB6A 4TQRA 1SWVA 5KAFU 4PHPA 2W8LA 4DQQA 5KFTA 1JX4A 2W04A 3NRZA 4JWNA 8ICHA 1IIPA 4US8A 1TVAA 1NK4A 2M2WA 4Y2RA 4X4UA 2QARA 1TAQA 2KG5A 2Q0ZX 4RPZA 1H38A 4FFDA 1Z4OA 4K9AA 2B4VA 1N63A 3PX0A 4FHWA 2LI6A 4M47A 1ZQFA 2LYBA 2XIDA 2K8BB 3LVVA 1ZQBA 4ED3A 4Y2UA 2H3IA 3L3FX 1NO5A 4XJEA 5AHXA 4QZ9A 3GIJA 5DDYA 8ICMA 1BVSA 2OH2A 1WUDA 2BQRA 1ZQYA 3GIMA 3ORYA 1KFSA 1HUZA 4QWEA 3I76A 3L9DA 4ATBA 9ICUA 7ICPA 4FHYA 2K4PA 3NVWA 1KFDA 3JPSA 4J9SA 3PW0A 4MEYA 1UQVA 5C5JA 3AMZA 3PW2A 2K89A 1K5OA 3SZ2A 4IRCA 3C1ZA 3HW8A 5AI5A 2BHNA 1S77D 4FBUA 5J2IA 3ERCC 2LHTA 5CR0A 4DFJA 1S97A 2BCUA 2M2TA 5KTQA 1NK8A 1RYSA 2CN1A 4M04A 3NYBA 5AM1A 1GPJA 4C4TA 5KG0A 2JH1A 2D6FC 3C1YA 2XVTA 2GO7A 2I6XA 4UASA 5KG6A 2DL0A 3U26A 4DQPA 2OM6A 3TADA 2ZH5A 2G07A 2C28A 1C20A 5F3XB 4MFCA 7ICEA 4F5OA 1RQLA 2LYAA 4XUSA 4AT7B 2F3NA 4R65A 2FPMA 4CF3A 4U6PA 2HHXA 3OVAA 4RPYA 1FEZA 3QZ7A 2ZIUA 1QTMA 1TK0A 3QU7A 1F0MA 4ECTA 3EZ5A 4OD0A 2DGZA 3N7RC 2WB1C 5CA7A 1ZYQA 4JV2A 3NWIA 5J8YA 1ZQMA 2FMSA 2AGQA 4Q45A 3FAHA 4OJLA 4ATBB 1VFGA 4X4NA 2FDRA 3OUYA 3E0FA 1NKCA 8ICTA 4R8UA 4DSKA 2EDUA 2W9MA 8ICXA 3RJEA 2EQYA 2IBKA 1SL2A 4PZNA 4B9UA 1KSPA 2FMPA 3E58A 4ED7A 4WC0A 2BR0A 4J9PA 4PHEA 1EXNA 4ED6A 2G0AA 1V4AA 3QU2A 2XGQA 1FFVA 3PO4A 9ICKA 4PPXA 4Z6EA 4J9LA 4FHVA 2WF7A 4AT9A 2KVCA 4BWMA 1NJXA 5KFKA 3SAFA 3BDPA 2QB0A 4FH5A 5KL1B 4I0UA 4WH5A 3MABA 1XU4A 1XWLA 3K75D 7ICNA 4KN7A 8ICGA 5EWFA 3UXOA 3HJ4A 1S10A 3VC8A 2R8HA 3PSFA 2C2EA 2ZIVB 2AGPA 5ALMA 2ZTCA 4YCXA 1COKA 4QWCA 4Y2JA 2NRKA 2EZXA 2IHNA 5HR7A 5AM0A 3WFRE 4O3PA 1NZPA 4WJ3B 9ICCA 1WCNA 2BCVA 5HRHA 4ZOHC 4EEDA 2AGOA 4NKUA 5AKHA 4F4ZA 2FI1A 3F2BA 2DVIA 4O67A 1QH9A 2JGAA 4EYHB 1Q78A 4FO1A 4RNOA 5J2CA 1QCKA 7ICQA
chains in the Genus database with same CATH topology
5J0TA 1X9SA 3JPQA 3KHGA 1SKRA 3RJKA 4NLGA 1SKSA 5DB9A 3HT3A 3AU2A 3N97B 1NK5A 3MR5A 7ICGA 1BPEA 4YD1A 2UVRA 1IXRA 4FS1A 4QW8A 4J9MA 4ECZA 4UAYA 5J2AA 3OSPA 2HHSA 1BPXA 3RJGA 2HHTA 5BPCA 4EBDA 5KT4A 5JUMA 5IINA 1QLNA 4YN4A 3ZDBA 5J0PA 5L1IA 4DFMA 4XQ8A 4PH5A 1TV9A 5KFEA 2DPIA 5KT6A 2PI5A 2HW3A 5F2VO 1DGSA 2KFZA 5KFHA 2UVWA 4O3NA 5KFVA 4B9SA 3T5JA 1KEJA 2ZTDA 4DSFA 2J6UA 5J2GA 3SI8A 3WFPA 2IHMA 1UETA 8ICSA 1U4BA 3M8SA 2FPKA 1ZQHA 1TK8A 3RR7A 4XQ7A 5DKWA 5J2KA 3M9MB 3C2LA 3JPPA 1XSNA 8ICFA 3HIYA 4YR3A 4HYKA 4YMOA 5KT7A 5HRBA 5EOZA 4IQUA 1TK5A 1K1QA 3IM1A 3PW7A 4DWIA 2DR8A 1U47A 4F5RA 2ASLA 4JK1A 5HHIA 1ZQNA 9ICNA 5DDMA 3HX0A 4DSLA 5HC9A 4TQSA 4G3IA 4RQ2A 2LYHA 4ECUA 1UEUA 3RAXA 3PY8A 1CEZA 5KFRA 4BDPA 4WC3A 5KT2A 2I9GA 2HVIA 1WOTA 3GILA 4KLIA 1IM4A 1D8LA 3ZD8A 2FLLA 4IQWA 2JEFA 1Z3EB 9ICGA 3HJ1A 5J2HA 3ZDEA 2ZH4A 4O5EA 1ZQCA 3KTQA 5IIMA 1ZQOA 7ICVA 5HR9A 2PFOA 4C8MA 4F4YA 1S9FA 4ED2A 1D8YA 2HHQA 5HREA 4F4WA 1TFYA 1ZQWA 4RPXA 3RJJA 4KLDA 2J6SA 1Y88A 1XS9D 5IIIA 4M9GA 4M9NA 1JIHA 4RQ0A 4I2CA 3QE9Y 4MFFA 3PX4A 1NK0A 4F92B 4I28A 2ZJ5A 3BJYA 1TKDA 4B9LA 4PGYA 5DEDA 3PX6A 5DBAA 4KLGA 4RT2A 5L1LA 4QZDA 1L3VA 3UXNA 5HP4A 4RQ7A 5J0WA 1SL0A 9ICAA 8ICWA 4DL5A 1JXLA 4YR2A 3C23A 5DLFA 3RB0A 7ICHA 4B9NA 4UD5A 4AT7A 3H3AA 3UXPA 2M2UA 5KFUA 4ELUA 3KHLA 3RB4A 5HRDA 4RZRA 3EYZA 2VA3A 3IHQB 3PMNA 4R8UB 2XCPA 2M2VA 4PHDA 2A1JB 4M9JA 1PZNA 3H39A 4DQSA 1ZQEA 9ICWA 2DR5A 4S3NA 4RQ6A 4DQIA 4KLSA 4C8KA 1ZQTA 3RH6A 4KTQA 3C2MA 4ECRA 4RWPA 1XSPA 1Z00B 3FYHA 1QSSA 4YVZA 2NRWA 5J0SA 3HP6A 3JPRA 2ZTEA 3G6YA 5KFJA 2RFFA 2KFNA 1NJYA 3OV7A 4KLMA 4FS2A 4DOBA 4BXOB 4ECWA 8ICJA 4JV0A 9ICIA 5HRLA 4WBYA 2F1HA 3PV8A 1A76A 2VA2A 2BKEA 4DL7A 1VJ7A 1U9LA 1UA0A 1LV5A 3MFIA 3RH4A 2DFLA 2PXIA 3MDCA 4NKTA 1ZQSA 7ICFA 5DG8A 2R8IA 3V6JA 5DQGA 4GXKA 3RR8A 1BNOA 1CUKA 4UAZA 7ICJA 1WCLA 3ZD9A 4RNNA 8ICAA 3NTUA 3NGDA 3BQ0A 5J0UA 3Q8MA 4ED1A 2BPFA 3B0YA 2ZUCA 3H4BA 5J2JA 3ETLA 5KT5A 4QZGA 2ZH2A 4TURA 3GIIA 2ZHAA 5KFNA 3QEAZ 2ASDA 2W9AA 4ZH4A 2IA6A 4K4HA 4YMNA 2DR7A 3C21A 2XGPA 4GC6A 3GV5B 2BQ3A 5F9LA 3HWTA 2PFPA 4O5KA 3OVBA 2BQUA 3MGIA 5CB1A 3H8JA 3BQ2A 3PW5A 4ECQA 3LQCB 1PX5A 2FLPA 5KFSA 3G6XA 4I2EA 4J9QA 3V7JA 3TFRA 2ZH1A 3PR5B 5CJ7A 5KFIA 3THVA 5EWEA 2C2DA 2Y1JA 2BPGA 8ICUA 3PW4A 3MBYA 4NM2A 4UB5A 1B22A 4O3QA 1OU5A 2DRAA 2VA8A 4I2JA 4IQVA 4F4KA 4Z6CA 4NLNA 2H5XA 4X4RA 4TUSA 2C2RA 4I2IA 3Q8RB 1MQ2A 3H4DA 5KG1A 5J0OA 3OGUA 3Q8QB 1D9FA 2KZZA 4GC7A 9ICPA 8ICCA 1RXVA 3RRGA 5HRFA 2P66A 3AQNA 3RBDA 4C8OA 1ZQUA 2ASJA 4M0AA 4RU9A 4XRHA 1U45A 9ICMA 4KITB 4KLTA 1F5AA 4PGQA 3QZ8A 2AU0A 1BNPA 5DLGA 4UD4A 4RUCA 4GXIA 1XSLA 4YXJA 2ISPA 2HHUA 3H40A 3RJIA 3TAPA 3ISDA 1T3NA 1RZTA 2ZUDA 1ZQDA 2ZJ8A 2AJQA 2A1JA 2XY7A 9ICFA 8ICPA 2BE3A 3AQMA 4DLEA 4ED0A 4F2RA 2V4QA 9ICJA 4FBTA 4RT3A 2MAXA 4MFAA 5IIJA 5BOMA 4DOAA 4YQWA 5KFLA 4DEZA 4F5PA 3GFKB 1SZPA 3TQ1A 3GV8B 1RYRA 8ICKA 2ZH7A 4UB3A 3V7KA 4KLFA 4NLKA 3C5FA 4F2SA 4M9LA 1MIYA 2ATLA 4KLHA 1ZQXA 3FDSA 4IR1A 4PGXA 8ICBA 3V7LA 2PFNA 1AROP 4I2AA 5BOLA 2NRVA 1NKBA 4RQ4A 1N56A 9ICOA 3E2EA 4QZEA 4K4GA 5KG4A 5J2EA 5D4BA 3UPSA 2RDIA 3RRHA 1U49A 4O3RA 2XC9A 2ZJAA 2AQ4A 7ICKA 1UEVA 1TFWA 3V72A 1JQRA 3TARA 2R8KA 4DQRA 5KFPA 5HRGA 4I2GA 3BQ1A 2J6TA 4KLUA 5KFAA 3OHAA 1ZJMA 1UA1A 5KT3A 4Q44A 2ZH9A 4BXOA 1JN3A 5L9XA 4ECXA 4O3OA 1T8EA 4QWAA 1S0OA 2KP7A 5DBBA 2Q66A 5KG5A 4DF8A 3PO5A 5J0YA 5J0XA 3T5HA 3T3FA 1R8BA 2DR9A 3Q8LA 3V6HA 1L5UA 4F5QA 4B9MA 2V9WA 1MIWA 4DO9A 4F4XA 3TAQA 1UT8A 4KLOA 3JPOA 5J2DA 4WC4A 4DFKA 3LWLA 4IG8A 1S0VA 1NKEA 4E80A 3H38A 4NM1A 4EEYA 9ICLA 3RJHA 2Y1IA 3ZDAA 2F1IA 3EWAA 4ELTA 4ELVA 4EBKA 2BDPA 2ID1A 4KN4A 5DB6A 3SYZA 4TQRA 4PHPA 4MF8A 2W8LA 8ICVA 4DQQA 5KFTA 4RWNA 3TI0A 1ZQGA 4YMMA 1QSYA 1JX4A 2ZUBA 1DOQA 5DBCA 4IR9A 5DB7A 1KLNA 4JWNA 2JZBB 8ICHA 3EPGA 1TVAA 1NK4A 4TUPA 4QZ8A 3JPTA 1NJWA 4LZGA 1ZQAA 2M2WA 3M8RA 2HVHA 2HHWA 4X4UA 1ZQQA 2B21A 2ZH8A 1TAQA 5IIKA 2Q0ZX 4RPZA 4F5NA 4GXJA 5F9NA 1H38A 4AT8B 3JPNA 4NXZA 1L3TA 4DOCA 4O0IA 5KFQA 3LK9A 4DF4A 3PX0A 4FHWA 2ZH6A 4M47A 3Q8SB 1V9PA 1ZQFA 4ECYA 3RH5A 9ICXA 1ZQBA 3Q8KA 4ED3A 4MF2A 2MUTA 2ISOA 2AQ0A 5TZVA 4RQ1A 2W9CB 3AUOA 8ICZA 8ICRA 1NO5A 3EW9A 1COOA 5DGBA 1XC9A 4TUQA 2P6RA 4QZ9A 4KLQA 3GIJA 5DDYA 4DS4A 9ICHA 8ICMA 1BVSA 3RJFA 1KFTA 5IIOA 4M6WB 2BCQA 4E8FA 3AQLA 2P6UA 2BQRA 4QZBA 1ZQYA 3GIMA 4F50A 3ORYA 1KFSA 1L3UA 4QWEA 4X5VA 1HUZA 2NRXA 4M9HA 2HHVA 2XCAA 3L9DA 4RNMA 3M9NB 9ICVA 4WC1A 5CHGA 3EPIA 2O1PA 4ATBA 9ICUA 2GWSA 7ICPA 4F91B 3C5GA 4DS5A 3T5LA 4FHYA 1KFDA 2M9NA 5J0QA 3JPSA 1NOMA 4MEYA 4J9SA 3PW0A 7ICLA 5C5JA 2IMWP 4EBEA 3WFOA 3PW2A 3GIKA 5CP2A 3H8WA 3SZ2A 3C1ZA 1ZQRA 4IRCA 3K4GA 3HW8A 2BHNA 3BQTA 5DG7A 1S77D 8ICOA 4J9OA 3RTVA 4QZAA 2V4RA 1HUOA 2BCRA 5J2IA 4UBBA 4FBUA 4ECVA 5KFGA 5CR0A 4DFJA 1S97A 2BCUA 4O9MA 2M2TA 5HNKA 4DL2A 7ICMA 4UB1A 5KTQA 4JUZA 4QZCA 1NK8A 1RYSA 4M04A 5HRIA 3H37A 3NYBA 4DL3A 3Q8PB 3RB3A 3JZ0A 4YP3A 4CCHA 3PR4A 5KG0A 8ICEA 5L1JA 1R8AA 4E7XA 5DQIA 1B43A 3C1YA 3MFHA 3G6VA 8ICQA 3LDAA 5DG9A 5KG6A 3B0XA 1BGXT 3MR6A 3MR3A 4DL4A 3RB6A 2FMQA 4DQPA 2JEIA 2KZMA 1DK2A 3MR2A 4M5DA 1X9MA 2ZH5A 1ZQZA 3OJUA 5KG2A 3KHRA 2C28A 5HMMA 2RDJA 8ICIA 9ICSA 1D9DA 1ZQKA 4P4OA 4MFCA 7ICEA 4XA5A 1T4GA 4F5OA 4FO6A 1NK7A 3JYYA 2ZH3A 4IRDA 1S0MA 4XUSA 2UVVA 3AQKA 1ZQLA 5HHHA 4AT7B 4Q8FA 4I29A 4RWOA 3OUYB 4WC5A 3GDXA 3H8SA 2C22A 4Z6DA 4R65A 2FPMA 4J9RA 3QEBZ 4I2HA 4WCWA 4LVSA 2HHXA 2O5AA 7ICUA 3OVAA 4RPYA 3RAQA 1K1SA 1C7YA 3QZ7A 3ISCA 1MQ3A 1QTMA 2PFQA 9ICRA 1TK0A 4WC7A 2UVUA 5KG7A 2W9CA 4RUAA 4KLJA 2MUTB 3EZ5A 4ECTA 3TFSA 1MSWD 5CA7A 1RPLA 5IILA 1ZQPA 5KG3A 3KHHA 4F8RA 4FH3A 3UQ0A 1TFRA 1ZYQA 4JV2A 1JXEA 2W9BA 4M2YA 1SKWA 2PI4A 1KDHA 1ZQMA 4DLGA 7ICOA 2FMSA 1NK9A 4X4PA 2ALZA 8ICLA 4J9KA 2AGQA 4Q45A 4I2FA 3RBEA 3WFQE 4K4IA 2JEGA 1Q79A 4KLLA 2BPCA 4PHAA 4ATBB 3N4MB 5KFDA 4Q8EA 1YLQA 4C8NA 1VFGA 4GLXA 4X4NA 2I1QA 2KZ3A 3OUYA 4I2DA 1NKCA 3C2KA 5DGAA 1DK3A 4EP7A 8ICTA 4EYIB 1MC8A 4M6WA 4R8UA 2FPLA 4FHPA 4O5CA 4DSKA 4LT6A 3OVSA 8ICXA 2W9MA 3OSNA 1R89A 3OJSA 3RJEA 2IBKA 3GQCA 4F3OA 1SL2A 3C18A 4QZHA 4B9UA 2FLNA 4RQ3A 4P2HA 4YFKA 1KSPA 1T7PA 4DL6A 5EWGA 5KFWA 2BCSA 2FMPA 2DPJA 3H7IA 4IRKA 4EBCA 4ED7A 3V6KA 4R66A 2R8GA 2BGWA 1XO1A 4WC0A 4P4MA 5J0RA 3WFSC 2BR0A 4QWBA 4YR0A 5CWRA 1S0NA 3SV3A 1NK6A 4J9PA 4PHEA 4R64A 4DSEA 5KFMA 1BPDA 3LWMA 1BPZA 1EXNA 4Q43A 5KFCA 4ED6A 2NRZA 2XO7A 4YD2A 4F93B 3SV4A 4DFPA 1ZQJA 2KTQA 9ICKA 1MIVA 1V4AA 4FHXA 4RWQA 2XGQA 4X0BA 2DRBA 2JZBA 3TANA 1L3SA 3C66A 3PO4A 4ECSA 3ISBA 5L1KA 4EZ9A 1KTQA 5KFBA 3MDAA 4I27A 4PPXA 4Z6EA 5J29A 2NRTA 3GV7B 3MGHA 4J9LA 4FHVA 4X0AA 1X2IA 4AT9A 4BWMA 4IQTA 4WC2A 1NJXA 5KFKA 7ICSA 3BDPA 1HJPA 4FH5A 1N48A 4QZFA 3T5KA 4KLEA 1FA0A 7ICRA 4WBZA 3MABA 4BGDA 5KFOA 1KRPA 4C8LA 4UAWA 1XU4A 1BPYA 1XWLA 3K75D 4B9TA 1BPBA 4KN7A 2JEJA 7ICNA 4I2BA 7ICTA 8ICGA 1NJZA 5EWFA 5J2FA 4JWMA 1U48A 1SL1A 3ZDDA 3UXOA 4EBJA 3UQ2A 2W8KA 4Z6FA 4B9VA 3HJ4A 1S10A 2R8HA 2C2EA 4YXMA 1A77A 4KMUA 4UB4A 1ZQIA 2F1JA 2AGPA 4E0DA 5KFZA 2ZTCA 4YCXA 4LZDA 2XY5A 4JV1A 5J2BA 9ICEA 4X4QA 4X4VA 4QWCA 2WTFA 4MEXA 2ZHBA 2NRKA 2W9BB 3PMLA 1ZJNA 2IHNA 1ZQVA 3AU6A 3ZDCA 4X4SA 1QSLA 1JMSA 4BWJA 3M9OB 2KN7A 4AT9B 2HHPA 3WFRE 4R63A 7ICIA 5DB8A 4AT8A 4YG2A 4O3PA 4UQGA 4QWDA 9ICCA 1NZPA 5DQHA 1S76D 1WCNA 2BCVA 3HPOA 5HRHA 9ICBA 5KFXA 5KFFA 1UT5A 4WC6A 4DSIA 2AGOA 1JAJA 4UBCA 4NKUA 8ICYA 4F4ZA 1RXWA 4NY8A 5HMLA 4QW9A 4P4PA 1Z00A 4O3SA 9ICTA 2VANA 4EZ6A 2R8JA 8ICNA 5HRKA 2DVIA 4ED8A 3PVXA 4UB2A 1KNYA 1R8CA 1ZETA 4QZIA 4X4TA 3OHBA 5D49A 2OWOA 4RQ8A 5DECA 4J9NA 5KFYA 4EYHB 4DSJA 1Q78A 2XY6A 1TAUA 5D46A 1LB2B 4RNOA 1X9WA 9ICQA 3PNCA 3UPQA 4NLZA 2PBEA 5J2CA 4RQ5A 7ICQA 4X4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J0T A;  1X9S A;  3JPQ A;  3KHG A;  1SKR A;  3RJK A;  4NLG A;  1SKS A;  5DB9 A;  3HT3 A;  3AU2 A;  3N97 B;  1NK5 A;  3MR5 A;  7ICG A;  1BPE A;  4YD1 A;  2UVR A;  1IXR A;  4FS1 A;  4QW8 A;  4J9M A;  4ECZ A;  4UAY A;  5J2A A;  3OSP A;  2HHS A;  1BPX A;  3RJG A;  2HHT A;  5BPC A;  4EBD A;  5KT4 A;  5JUM A;  5IIN A;  1QLN A;  4YN4 A;  3ZDB A;  5J0P A;  5L1I A;  4DFM A;  4XQ8 A;  4PH5 A;  1TV9 A;  5KFE A;  2DPI A;  5KT6 A;  2PI5 A;  2HW3 A;  5F2V O;  1DGS A;  2KFZ A;  5KFH A;  2UVW A;  4O3N A;  5KFV A;  4B9S A;  3T5J A;  1KEJ A;  2ZTD A;  4DSF A;  2J6U A;  5J2G A;  3SI8 A;  3WFP A;  2IHM A;  1UET A;  8ICS A;  1U4B A;  3M8S A;  2FPK A;  1ZQH A;  1TK8 A;  3RR7 A;  4XQ7 A;  5DKW A;  5J2K A;  3M9M B;  3C2L A;  3JPP A;  1XSN A;  8ICF A;  3HIY A;  4YR3 A;  4HYK A;  4YMO A;  5KT7 A;  5HRB A;  5EOZ A;  4IQU A;  1TK5 A;  1K1Q A;  3IM1 A;  3PW7 A;  4DWI A;  2DR8 A;  1U47 A;  4F5R A;  2ASL A;  4JK1 A;  5HHI A;  1ZQN A;  9ICN A;  5DDM A;  3HX0 A;  4DSL A;  5HC9 A;  4TQS A;  4G3I A;  4RQ2 A;  2LYH A;  4ECU A;  1UEU A;  3RAX A;  3PY8 A;  1CEZ A;  5KFR A;  4BDP A;  4WC3 A;  5KT2 A;  2I9G A;  2HVI A;  1WOT A;  3GIL A;  4KLI A;  1IM4 A;  1D8L A;  3ZD8 A;  2FLL A;  4IQW A;  2JEF A;  1Z3E B;  9ICG A;  3HJ1 A;  5J2H A;  3ZDE A;  2ZH4 A;  4O5E A;  1ZQC A;  3KTQ A;  5IIM A;  1ZQO A;  7ICV A;  5HR9 A;  2PFO A;  4C8M A;  4F4Y A;  1S9F A;  4ED2 A;  1D8Y A;  2HHQ A;  5HRE A;  4F4W A;  1TFY A;  1ZQW A;  4RPX A;  3RJJ A;  4KLD A;  2J6S A;  1Y88 A;  1XS9 D;  5III A;  4M9G A;  4M9N A;  1JIH A;  4RQ0 A;  4I2C A;  3QE9 Y;  4MFF A;  3PX4 A;  1NK0 A;  4F92 B;  4I28 A;  2ZJ5 A;  3BJY A;  1TKD A;  4B9L A;  4PGY A;  5DED A;  3PX6 A;  5DBA A;  4KLG A;  4RT2 A;  5L1L A;  4QZD A;  1L3V A;  3UXN A;  5HP4 A;  4RQ7 A;  5J0W A;  1SL0 A;  9ICA A;  8ICW A;  4DL5 A;  1JXL A;  4YR2 A;  3C23 A;  5DLF A;  3RB0 A;  7ICH A;  4B9N A;  4UD5 A;  4AT7 A;  3H3A A;  3UXP A;  2M2U A;  5KFU A;  4ELU A;  3KHL A;  3RB4 A;  5HRD A;  4RZR A;  3EYZ A;  2VA3 A;  3IHQ B;  3PMN A;  4R8U B;  2XCP A;  2M2V A;  4PHD A;  2A1J B;  4M9J A;  1PZN A;  3H39 A;  4DQS A;  1ZQE A;  9ICW A;  2DR5 A;  4S3N A;  4RQ6 A;  4DQI A;  4KLS A;  4C8K A;  1ZQT A;  3RH6 A;  4KTQ A;  3C2M A;  4ECR A;  4RWP A;  1XSP A;  1Z00 B;  3FYH A;  1QSS A;  4YVZ A;  2NRW A;  5J0S A;  3HP6 A;  3JPR A;  2ZTE A;  3G6Y A;  5KFJ A;  2RFF A;  2KFN A;  1NJY A;  3OV7 A;  4KLM A;  4FS2 A;  4DOB A;  4BXO B;  4ECW A;  8ICJ A;  4JV0 A;  9ICI A;  5HRL A;  4WBY A;  2F1H A;  3PV8 A;  1A76 A;  2VA2 A;  2BKE A;  4DL7 A;  1VJ7 A;  1U9L A;  1UA0 A;  1LV5 A;  3MFI A;  3RH4 A;  2DFL A;  2PXI A;  3MDC A;  4NKT A;  1ZQS A;  7ICF A;  5DG8 A;  2R8I A;  3V6J A;  5DQG A;  4GXK A;  3RR8 A;  1BNO A;  1CUK A;  4UAZ A;  7ICJ A;  1WCL A;  3ZD9 A;  4RNN A;  8ICA A;  3NTU A;  3NGD A;  3BQ0 A;  5J0U A;  3Q8M A;  4ED1 A;  2BPF A;  3B0Y A;  2ZUC A;  3H4B A;  5J2J A;  3ETL A;  5KT5 A;  4QZG A;  2ZH2 A;  4TUR A;  3GII A;  2ZHA A;  5KFN A;  3QEA Z;  2ASD A;  2W9A A;  4ZH4 A;  2IA6 A;  4K4H A;  4YMN A;  2DR7 A;  3C21 A;  2XGP A;  4GC6 A;  3GV5 B;  2BQ3 A;  5F9L A;  3HWT A;  2PFP A;  4O5K A;  3OVB A;  2BQU A;  3MGI A;  5CB1 A;  3H8J A;  3BQ2 A;  3PW5 A;  4ECQ A;  3LQC B;  1PX5 A;  2FLP A;  5KFS A;  3G6X A;  4I2E A;  4J9Q A;  3V7J A;  3TFR A;  2ZH1 A;  3PR5 B;  5CJ7 A;  5KFI A;  3THV A;  5EWE A;  2C2D A;  2Y1J A;  2BPG A;  8ICU A;  3PW4 A;  3MBY A;  4NM2 A;  4UB5 A;  1B22 A;  4O3Q A;  1OU5 A;  2DRA A;  2VA8 A;  4I2J A;  4IQV A;  4F4K A;  4Z6C A;  4NLN A;  2H5X A;  4X4R A;  4TUS A;  2C2R A;  4I2I A;  3Q8R B;  1MQ2 A;  3H4D A;  5KG1 A;  5J0O A;  3OGU A;  3Q8Q B;  1D9F A;  2KZZ A;  4GC7 A;  9ICP A;  8ICC A;  1RXV A;  3RRG A;  5HRF A;  2P66 A;  3AQN A;  3RBD A;  4C8O A;  1ZQU A;  2ASJ A;  4M0A A;  4RU9 A;  4XRH A;  1U45 A;  9ICM A;  4KIT B;  4KLT A;  1F5A A;  4PGQ A;  3QZ8 A;  2AU0 A;  1BNP A;  5DLG A;  4UD4 A;  4RUC A;  4GXI A;  1XSL A;  4YXJ A;  2ISP A;  2HHU A;  3H40 A;  3RJI A;  3TAP A;  3ISD A;  1T3N A;  1RZT A;  2ZUD A;  1ZQD A;  2ZJ8 A;  2AJQ A;  2A1J A;  2XY7 A;  9ICF A;  8ICP A;  2BE3 A;  3AQM A;  4DLE A;  4ED0 A;  4F2R A;  2V4Q A;  9ICJ A;  4FBT A;  4RT3 A;  2MAX A;  4MFA A;  5IIJ A;  5BOM A;  4DOA A;  4YQW A;  5KFL A;  4DEZ A;  4F5P A;  3GFK B;  1SZP A;  3TQ1 A;  3GV8 B;  1RYR A;  8ICK A;  2ZH7 A;  4UB3 A;  3V7K A;  4KLF A;  4NLK A;  3C5F A;  4F2S A;  4M9L A;  1MIY A;  2ATL A;  4KLH A;  1ZQX A;  3FDS A;  4IR1 A;  4PGX A;  8ICB A;  3V7L A;  2PFN A;  1ARO P;  4I2A A;  5BOL A;  2NRV A;  1NKB A;  4RQ4 A;  1N56 A;  9ICO A;  3E2E A;  4QZE A;  4K4G A;  5KG4 A;  5J2E A;  5D4B A;  3UPS A;  2RDI A;  3RRH A;  1U49 A;  4O3R A;  2XC9 A;  2ZJA A;  2AQ4 A;  7ICK A;  1UEV A;  1TFW A;  3V72 A;  1JQR A;  3TAR A;  2R8K A;  4DQR A;  5KFP A;  5HRG A;  4I2G A;  3BQ1 A;  2J6T A;  4KLU A;  5KFA A;  3OHA A;  1ZJM A;  1UA1 A;  5KT3 A;  4Q44 A;  2ZH9 A;  4BXO A;  1JN3 A;  5L9X A;  4ECX A;  4O3O A;  1T8E A;  4QWA A;  1S0O A;  2KP7 A;  5DBB A;  2Q66 A;  5KG5 A;  4DF8 A;  3PO5 A;  5J0Y A;  5J0X A;  3T5H A;  3T3F A;  1R8B A;  2DR9 A;  3Q8L A;  3V6H A;  1L5U A;  4F5Q A;  4B9M A;  2V9W A;  1MIW A;  4DO9 A;  4F4X A;  3TAQ A;  1UT8 A;  4KLO A;  3JPO A;  5J2D A;  4WC4 A;  4DFK A;  3LWL A;  4IG8 A;  1S0V A;  1NKE A;  4E80 A;  3H38 A;  4NM1 A;  4EEY A;  9ICL A;  3RJH A;  2Y1I A;  3ZDA A;  2F1I A;  3EWA A;  4ELT A;  4ELV A;  4EBK A;  2BDP A;  2ID1 A;  4KN4 A;  5DB6 A;  3SYZ A;  4TQR A;  4PHP A;  4MF8 A;  2W8L A;  8ICV A;  4DQQ A;  5KFT A;  4RWN A;  3TI0 A;  1ZQG A;  4YMM A;  1QSY A;  1JX4 A;  2ZUB A;  1DOQ A;  5DBC A;  4IR9 A;  5DB7 A;  1KLN A;  4JWN A;  2JZB B;  8ICH A;  3EPG A;  1TVA A;  1NK4 A;  4TUP A;  4QZ8 A;  3JPT A;  1NJW A;  4LZG A;  1ZQA A;  2M2W A;  3M8R A;  2HVH A;  2HHW A;  4X4U A;  1ZQQ A;  2B21 A;  2ZH8 A;  1TAQ A;  5IIK A;  2Q0Z X;  4RPZ A;  4F5N A;  4GXJ A;  5F9N A;  1H38 A;  4AT8 B;  3JPN A;  4NXZ A;  1L3T A;  4DOC A;  4O0I A;  5KFQ A;  3LK9 A;  4DF4 A;  3PX0 A;  4FHW A;  2ZH6 A;  4M47 A;  3Q8S B;  1V9P A;  1ZQF A;  4ECY A;  3RH5 A;  9ICX A;  1ZQB A;  3Q8K A;  4ED3 A;  4MF2 A;  2MUT A;  2ISO A;  2AQ0 A;  5TZV A;  4RQ1 A;  2W9C B;  3AUO A;  8ICZ A;  8ICR A;  1NO5 A;  3EW9 A;  1COO A;  5DGB A;  1XC9 A;  4TUQ A;  2P6R A;  4QZ9 A;  4KLQ A;  3GIJ A;  5DDY A;  4DS4 A;  9ICH A;  8ICM A;  1BVS A;  3RJF A;  1KFT A;  5IIO A;  4M6W B;  2BCQ A;  4E8F A;  3AQL A;  2P6U A;  2BQR A;  4QZB A;  1ZQY A;  3GIM A;  4F50 A;  3ORY A;  1KFS A;  1L3U A;  4QWE A;  4X5V A;  1HUZ A;  2NRX A;  4M9H A;  2HHV A;  2XCA A;  3L9D A;  4RNM A;  3M9N B;  9ICV A;  4WC1 A;  5CHG A;  3EPI A;  2O1P A;  4ATB A;  9ICU A;  2GWS A;  7ICP A;  4F91 B;  3C5G A;  4DS5 A;  3T5L A;  4FHY A;  1KFD A;  2M9N A;  5J0Q A;  3JPS A;  1NOM A;  4MEY A;  4J9S A;  3PW0 A;  7ICL A;  5C5J A;  2IMW P;  4EBE A;  3WFO A;  3PW2 A;  3GIK A;  5CP2 A;  3H8W A;  3SZ2 A;  3C1Z A;  1ZQR A;  4IRC A;  3K4G A;  3HW8 A;  2BHN A;  3BQT A;  5DG7 A;  1S77 D;  8ICO A;  4J9O A;  3RTV A;  4QZA A;  2V4R A;  1HUO A;  2BCR A;  5J2I A;  4UBB A;  4FBU A;  4ECV A;  5KFG A;  5CR0 A;  4DFJ A;  1S97 A;  2BCU A;  4O9M A;  2M2T A;  5HNK A;  4DL2 A;  7ICM A;  4UB1 A;  5KTQ A;  4JUZ A;  4QZC A;  1NK8 A;  1RYS A;  4M04 A;  5HRI A;  3H37 A;  3NYB A;  4DL3 A;  3Q8P B;  3RB3 A;  3JZ0 A;  4YP3 A;  4CCH A;  3PR4 A;  5KG0 A;  8ICE A;  5L1J A;  1R8A A;  4E7X A;  5DQI A;  1B43 A;  3C1Y A;  3MFH A;  3G6V A;  8ICQ A;  3LDA A;  5DG9 A;  5KG6 A;  3B0X A;  1BGX T;  3MR6 A;  3MR3 A;  4DL4 A;  3RB6 A;  2FMQ A;  4DQP A;  2JEI A;  2KZM A;  1DK2 A;  3MR2 A;  4M5D A;  1X9M A;  2ZH5 A;  1ZQZ A;  3OJU A;  5KG2 A;  3KHR A;  2C28 A;  5HMM A;  2RDJ A;  8ICI A;  9ICS A;  1D9D A;  1ZQK A;  4P4O A;  4MFC A;  7ICE A;  4XA5 A;  1T4G A;  4F5O A;  4FO6 A;  1NK7 A;  3JYY A;  2ZH3 A;  4IRD A;  1S0M A;  4XUS A;  2UVV A;  3AQK A;  1ZQL A;  5HHH A;  4AT7 B;  4Q8F A;  4I29 A;  4RWO A;  3OUY B;  4WC5 A;  3GDX A;  3H8S A;  2C22 A;  4Z6D A;  4R65 A;  2FPM A;  4J9R A;  3QEB Z;  4I2H A;  4WCW A;  4LVS A;  2HHX A;  2O5A A;  7ICU A;  3OVA A;  4RPY A;  3RAQ A;  1K1S A;  1C7Y A;  3QZ7 A;  3ISC A;  1MQ3 A;  1QTM A;  2PFQ A;  9ICR A;  1TK0 A;  4WC7 A;  2UVU A;  5KG7 A;  2W9C A;  4RUA A;  4KLJ A;  2MUT B;  3EZ5 A;  4ECT A;  3TFS A;  1MSW D;  5CA7 A;  1RPL A;  5IIL A;  1ZQP A;  5KG3 A;  3KHH A;  4F8R A;  4FH3 A;  3UQ0 A;  1TFR A;  1ZYQ A;  4JV2 A;  1JXE A;  2W9B A;  4M2Y A;  1SKW A;  2PI4 A;  1KDH A;  1ZQM A;  4DLG A;  7ICO A;  2FMS A;  1NK9 A;  4X4P A;  2ALZ A;  8ICL A;  4J9K A;  2AGQ A;  4Q45 A;  4I2F A;  3RBE A;  3WFQ E;  4K4I A;  2JEG A;  1Q79 A;  4KLL A;  2BPC A;  4PHA A;  4ATB B;  3N4M B;  5KFD A;  4Q8E A;  1YLQ A;  4C8N A;  1VFG A;  4GLX A;  4X4N A;  2I1Q A;  2KZ3 A;  3OUY A;  4I2D A;  1NKC A;  3C2K A;  5DGA A;  1DK3 A;  4EP7 A;  8ICT A;  4EYI B;  1MC8 A;  4M6W A;  4R8U A;  2FPL A;  4FHP A;  4O5C A;  4DSK A;  4LT6 A;  3OVS A;  8ICX A;  2W9M A;  3OSN A;  1R89 A;  3OJS A;  3RJE A;  2IBK A;  3GQC A;  4F3O A;  1SL2 A;  3C18 A;  4QZH A;  4B9U A;  2FLN A;  4RQ3 A;  4P2H A;  4YFK A;  1KSP A;  1T7P A;  4DL6 A;  5EWG A;  5KFW A;  2BCS A;  2FMP A;  2DPJ A;  3H7I A;  4IRK A;  4EBC A;  4ED7 A;  3V6K A;  4R66 A;  2R8G A;  2BGW A;  1XO1 A;  4WC0 A;  4P4M A;  5J0R A;  3WFS C;  2BR0 A;  4QWB A;  4YR0 A;  5CWR A;  1S0N A;  3SV3 A;  1NK6 A;  4J9P A;  4PHE A;  4R64 A;  4DSE A;  5KFM A;  1BPD A;  3LWM A;  1BPZ A;  1EXN A;  4Q43 A;  5KFC A;  4ED6 A;  2NRZ A;  2XO7 A;  4YD2 A;  4F93 B;  3SV4 A;  4DFP A;  1ZQJ A;  2KTQ A;  9ICK A;  1MIV A;  1V4A A;  4FHX A;  4RWQ A;  2XGQ A;  4X0B A;  2DRB A;  2JZB A;  3TAN A;  1L3S A;  3C66 A;  3PO4 A;  4ECS A;  3ISB A;  5L1K A;  4EZ9 A;  1KTQ A;  5KFB A;  3MDA A;  4I27 A;  4PPX A;  4Z6E A;  5J29 A;  2NRT A;  3GV7 B;  3MGH A;  4J9L A;  4FHV A;  4X0A A;  1X2I A;  4AT9 A;  4BWM A;  4IQT A;  4WC2 A;  1NJX A;  5KFK A;  7ICS A;  3BDP A;  1HJP A;  4FH5 A;  1N48 A;  4QZF A;  3T5K A;  4KLE A;  1FA0 A;  7ICR A;  4WBZ A;  3MAB A;  4BGD A;  5KFO A;  1KRP A;  4C8L A;  4UAW A;  1XU4 A;  1BPY A;  1XWL A;  3K75 D;  4B9T A;  1BPB A;  4KN7 A;  2JEJ A;  7ICN A;  4I2B A;  7ICT A;  8ICG A;  1NJZ A;  5EWF A;  5J2F A;  4JWM A;  1U48 A;  1SL1 A;  3ZDD A;  3UXO A;  4EBJ A;  3UQ2 A;  2W8K A;  4Z6F A;  4B9V A;  3HJ4 A;  1S10 A;  2R8H A;  2C2E A;  4YXM A;  1A77 A;  4KMU A;  4UB4 A;  1ZQI A;  2F1J A;  2AGP A;  4E0D A;  5KFZ A;  2ZTC A;  4YCX A;  4LZD A;  2XY5 A;  4JV1 A;  5J2B A;  9ICE A;  4X4Q A;  4X4V A;  4QWC A;  2WTF A;  4MEX A;  2ZHB A;  2NRK A;  2W9B B;  3PML A;  1ZJN A;  2IHN A;  1ZQV A;  3AU6 A;  3ZDC A;  4X4S A;  1QSL A;  1JMS A;  4BWJ A;  3M9O B;  2KN7 A;  4AT9 B;  2HHP A;  3WFR E;  4R63 A;  7ICI A;  5DB8 A;  4AT8 A;  4YG2 A;  4O3P A;  4UQG A;  4QWD A;  9ICC A;  1NZP A;  5DQH A;  1S76 D;  1WCN A;  2BCV A;  3HPO A;  5HRH A;  9ICB A;  5KFX A;  5KFF A;  1UT5 A;  4WC6 A;  4DSI A;  2AGO A;  1JAJ A;  4UBC A;  4NKU A;  8ICY A;  4F4Z A;  1RXW A;  4NY8 A;  5HML A;  4QW9 A;  4P4P A;  1Z00 A;  4O3S A;  9ICT A;  2VAN A;  4EZ6 A;  2R8J A;  8ICN A;  5HRK A;  2DVI A;  4ED8 A;  3PVX A;  4UB2 A;  1KNY A;  1R8C A;  1ZET A;  4QZI A;  4X4T A;  3OHB A;  5D49 A;  2OWO A;  4RQ8 A;  5DEC A;  4J9N A;  5KFY A;  4EYH B;  4DSJ A;  1Q78 A;  2XY6 A;  1TAU A;  5D46 A;  1LB2 B;  4RNO A;  1X9W A;  9ICQ A;  3PNC A;  3UPQ A;  4NLZ A;  2PBE A;  5J2C A;  4RQ5 A;  7ICQ A;  4X4O A; 
#chains in the Genus database with same CATH topology
 5J0T A;  3KHG A;  3KZI U;  2HBK A;  3HT3 A;  5ALW A;  5AKE A;  2QKQ A;  4FS1 A;  4QW8 A;  1QQ6 A;  2HHS A;  3RJG A;  3NVY A;  2EWR A;  5JUM A;  3ZI4 A;  4ICA A;  1PX5 A;  5L1I A;  1TV9 A;  5AKI A;  2UVW A;  3CYM A;  5ALY A;  4UAU A;  2GA9 D;  3T5J A;  3WFP A;  3D6J A;  2I5H A;  2E3T A;  1U4B A;  2FPK A;  4NL9 A;  4XQ7 A;  3C2L A;  1N5W A;  4YR3 A;  4YMO A;  5KT7 A;  2EAO A;  2KSO A;  1K1Q A;  1TK5 A;  3PW7 A;  4DWI A;  3H0M B;  1U47 A;  4F5R A;  3BS7 A;  3F2C A;  4JK1 A;  5DDM A;  1DGJ A;  3DDH A;  4TQS A;  1UEU A;  3HJE A;  2LPE A;  5KFR A;  2I9G A;  4EEL A;  4UB8 U;  3GIL A;  4JLZ A;  1IM4 A;  1L7M A;  2FLL A;  4WQL A;  3WK8 A;  3HJ1 A;  2A1A A;  2DF4 B;  4O5E A;  1ZQC A;  5IIM A;  4C8M A;  1WWV A;  2B51 A;  1TFY A;  4F4W A;  4RPX A;  3ONN A;  4M9N A;  1JIH A;  4RQ0 A;  3WKE A;  3PX4 A;  3JCF A;  3UXN A;  1SL0 A;  2KIW A;  3RB0 A;  2EZZ A;  4K9B A;  5GTH U;  3H3A A;  3RB4 A;  4RZR A;  3EYZ A;  2XCP A;  1J97 A;  2M2V A;  1X9X A;  3H39 A;  5D62 A;  2HOF A;  5ALH A;  5CEH A;  2Q4T A;  1ZQT A;  4AYB C;  2RLT A;  1JRP A;  4YVZ A;  5ALR A;  4O3M A;  5KFJ A;  2RFF A;  2WAQ F;  4PL2 A;  2RHF A;  3HKZ F;  5AM2 A;  1VJ7 A;  1U9L A;  1UA0 A;  3TAD C;  4NKT A;  5DG8 A;  2KNJ A;  2R8I A;  3BS5 B;  3NGD A;  5J0U A;  5JTG A;  3B0Y A;  4BUG A;  4QZG A;  2ZH2 A;  3L5K A;  1LKY B;  4PJ0 U;  2W43 A;  2BQU A;  5AM5 A;  3PW5 A;  3LQC B;  1N62 A;  5AKZ A;  1WWU A;  2FLP A;  4I2E A;  3QXG A;  2NYV A;  2ES6 A;  2Y1J A;  3RFA A;  8ICU A;  4NLN A;  4Z6C A;  3H0L B;  4X4R A;  2DUY A;  3Q8R B;  3H4D A;  5KG1 A;  3OGU A;  3CK6 A;  1D9F A;  1O08 A;  5HRF A;  3AQN A;  2KP7 A;  4M0A A;  1F5A A;  4RU9 A;  4KIT B;  3SMV A;  5EE3 A;  1FFU A;  5DLG A;  2HI0 A;  2OCE A;  5B3Q A;  3WKD A;  1RZT A;  2ZJ8 A;  4DLE A;  4Y2T A;  2OXO A;  4RT3 A;  4DOA A;  5BOM A;  2RP5 A;  5KFL A;  3PSI A;  1X66 A;  1SZP A;  8ICK A;  4B6J A;  4C4R A;  4KLF A;  4NLK A;  2JMG A;  2E8M A;  4PGX A;  2WF8 A;  2PFN A;  1JAL A;  2NRV A;  3WK5 A;  5BOL A;  5D4B A;  1U49 A;  2ZJA A;  7ICK A;  1UEV A;  1FIQ A;  4DQR A;  1ZJM A;  1JN3 A;  3WKA A;  1T8E A;  5J0Y A;  3T3F A;  3Q8L A;  3I28 A;  1L5U A;  2K8C B;  1AQ6 A;  1D8B A;  1MIW A;  4Y2S A;  3TAQ A;  3MCR A;  5ALV A;  3HIL A;  1J2N A;  4WC4 A;  4UW9 A;  4IG8 A;  1S0V A;  3OPX A;  4K99 A;  4EEY A;  9ICL A;  3NRW A;  3QU4 A;  2IHO A;  4ELV A;  2ID1 A;  3NAS A;  8ICV A;  4RWN A;  3TI0 A;  1QSY A;  2ZUB A;  5AKL A;  1DOQ A;  1QQ7 A;  1A0P A;  5DB7 A;  4TUP A;  3NS1 A;  2IUB A;  1ZQA A;  2WB1 F;  3PSP A;  3M8R A;  2ZH8 A;  5IIK A;  4GXJ A;  4KMO B;  5F9N A;  5ALE A;  1VDV A;  1L3T A;  4DOC A;  2NO4 A;  5ALI A;  2DKZ A;  2KIV A;  3SQI A;  4ECY A;  3RH5 A;  5ALF A;  2MUT A;  4OJ6 A;  2W9C B;  8ICZ A;  2KJ5 A;  4QJF B;  4EGW A;  9ICH A;  4UAV A;  1KFT A;  3SD7 A;  4Y2X A;  2P6U A;  3AQL A;  4QZB A;  4F50 A;  4OAI Z;  2DRA A;  2HHV A;  4Y2Q A;  5AI8 A;  4X5V A;  4M9H A;  2NRX A;  9ICV A;  4WC1 A;  3EPI A;  2O1P A;  3IV6 A;  5AK3 A;  3C5G A;  2M9N A;  5AI4 A;  2KV2 A;  3WFO A;  1L7P A;  3GIK A;  3K4G A;  3L4P A;  5ALG A;  5DG7 A;  4J9O A;  2V4R A;  1HUO A;  2BCR A;  4EV6 A;  4ECV A;  1DXS A;  3BZK A;  4DL2 A;  2OYY A;  4UB1 A;  4JUZ A;  4QZC A;  4FZM A;  5HRI A;  4CCH A;  1XO0 A;  1R8A A;  2WHE A;  5DQI A;  8ICQ A;  2PMZ C;  3G6V A;  3LDA A;  3AN1 A;  4LEY A;  2ESE A;  3RB6 A;  2KZM A;  3MR3 A;  2RRD A;  2FMQ A;  2G06 A;  3MR2 A;  1ZQZ A;  5KG2 A;  2RDJ A;  9ICS A;  1ZQK A;  4XA5 A;  4FO6 A;  3B9J A;  1NI3 A;  1NK7 A;  3AQK A;  1ZQL A;  4UB6 U;  4Q8F A;  4RWO A;  3OUY B;  1UPH A;  4WCW A;  4ACO A;  2LKY A;  4LVS A;  2KSO B;  4KM5 A;  5ALD A;  1PVP A;  7ICU A;  3CP8 A;  3MGV A;  3RAQ A;  1C7Y A;  2JR5 A;  5AIA A;  4WC7 A;  5KG7 A;  2W9C A;  4KLJ A;  3MC1 A;  1L6N A;  2HN1 A;  5IIL A;  3KHH A;  2IOH A;  4NXX A;  2W9B A;  2PI4 A;  1KDH A;  7ICO A;  4X4P A;  1NK9 A;  3KZX A;  2G09 A;  3WKB A;  4I2F A;  1QQ5 A;  4K4I A;  2E5S A;  4GIB A;  3NVO A;  1YLQ A;  3NVZ A;  4C8N A;  4GLX A;  5E79 U;  1DK3 A;  5AKJ A;  1MC8 A;  2FPL A;  4O5C A;  3K7D A;  3OVS A;  5AIB A;  3NVV A;  1R89 A;  2NV3 A;  5CFU A;  3OJS A;  4FZL A;  1N2X A;  4QZH A;  4P2H A;  4DL6 A;  2A19 A;  2R8G A;  1XO1 A;  4P4M A;  3H0R B;  1NK6 A;  5KNI A;  3SV3 A;  8ICL A;  2Y9T A;  3LWM A;  2QB1 A;  2WF6 A;  4Q43 A;  3T79 A;  2XO7 A;  1ZQJ A;  2KTQ A;  4FHX A;  1VJ5 A;  4RWQ A;  4X0B A;  2DRB A;  2JZB A;  3KOO A;  2W55 A;  4I27 A;  4ECS A;  4OO1 J;  3MGH A;  4FE3 A;  7ICS A;  4HAI A;  2W7P A;  1FA0 A;  1B4F A;  7ICR A;  1URJ A;  4BGD A;  4B9T A;  1BPB A;  4I2B A;  2D8C A;  2DKX A;  5J2F A;  4JWM A;  1SL1 A;  1J2M A;  4EBJ A;  3UQ2 A;  1TAM A;  2NO5 A;  4YXM A;  5AK6 A;  1ZQI A;  5KFZ A;  4X4V A;  3WKC A;  4JV1 A;  5J2B A;  2F8L A;  4X4Q A;  2WTF A;  1OXJ A;  3J81 j;  5HR6 A;  5ALN A;  2DQN B;  3PML A;  1ZJN A;  1ZQV A;  1QSL A;  3M9O B;  4BWJ A;  4AT9 B;  2ZIW A;  7ICI A;  5DB8 A;  4UQG A;  4QWD A;  5ALT A;  1PK1 B;  2E8P A;  1UT5 A;  2JXJ A;  4UBC A;  2DBY A;  2ZIV A;  4NY8 A;  4QW9 A;  1Z00 A;  9ICT A;  2WF9 A;  5HRK A;  2K8A A;  3PVX A;  4UB2 A;  1ZET A;  4QZI A;  2W54 A;  2OWO A;  5KFY A;  1TAU A;  5CFS A;  3JZ0 A;  2A3V A;  4X4O A;  1T94 A;  1MA7 A;  4WQK A;  3JPQ A;  1SKS A;  3AU2 A;  3N97 B;  1BPE A;  4YD1 A;  3KBB A;  2G5H B;  5KT4 A;  1QLN A;  4YN4 A;  2HSZ A;  1RG6 A;  5J0P A;  4E8F A;  4PH5 A;  4RWP A;  3KD3 A;  5KT6 A;  5F2V O;  2KFZ A;  4O3N A;  5ALJ A;  1KEJ A;  4UAT A;  1GO3 F;  3IRU A;  5J2K A;  3M9M B;  1XSN A;  3HIY A;  4HYK A;  5HRB A;  3IM1 A;  5HHI A;  1ZQN A;  4DSL A;  5HC9 A;  2Y0S F;  2LYH A;  4WC3 A;  2HVI A;  4CGZ A;  9ICG A;  5J2H A;  2ZH4 A;  3KTQ A;  4F4Y A;  4ED2 A;  4CF4 A;  3AQE A;  3QUT A;  4I2C A;  1SZH A;  1NK0 A;  5L1M A;  5H2F U;  2ZJ5 A;  3BJY A;  5DED A;  3PX6 A;  5CRX A;  2K60 A;  4RQ7 A;  5J0W A;  8ICW A;  4DL5 A;  3VCB A;  3C23 A;  7ICH A;  3UXP A;  5HRD A;  3IHQ B;  1Q3V A;  2QB0 B;  2A1J B;  3M6K A;  1PZN A;  4M9J A;  1ZQE A;  1LKY A;  9ICW A;  2GLE A;  4DQI A;  3C2M A;  3N7P D;  1JRO A;  4ECR A;  1XSP A;  1QSS A;  5T14 A;  5J0S A;  2ZXH A;  2ZTE A;  2E8N A;  1NJY A;  4KLM A;  4Y2P A;  8ICJ A;  1SB3 C;  4CRX A;  4DL7 A;  2DFL A;  3MDC A;  1O03 A;  3ETR A;  4O68 A;  3RR8 A;  4UAZ A;  1FO4 A;  3ZD9 A;  1ZQ1 C;  1N5X A;  5AI9 A;  3A0B U;  3H4B A;  5J2J A;  3ER8 C;  1Z1V A;  3ETL A;  4A8E A;  4TUR A;  5KFN A;  2YX8 A;  4K4H A;  4YMN A;  3C21 A;  4JMU A;  2XGP A;  2BQ3 A;  4NWI A;  3KKA A;  5CB1 A;  1Z19 A;  3H8J A;  4ECQ A;  5G5G A;  2QLT A;  5KFS A;  5KFI A;  2C2D A;  2FJ6 A;  2BPG A;  5AKG A;  3MBY A;  3PW4 A;  1OU5 A;  4I2J A;  4F4K A;  2H5X A;  5AKK A;  1MQ2 A;  5C0Y A;  2ODG A;  3F5A A;  3Q8Q B;  2KZZ A;  3RRG A;  1WOT A;  2G5I B;  2KD1 A;  4PGQ A;  1UHU A;  4UD4 A;  1XSL A;  2HHU A;  2ZUD A;  2E8O A;  2WFA A;  4F71 A;  2JV3 A;  2H3Q A;  3TKA A;  4GFJ A;  3F53 A;  1X42 A;  1YZ7 A;  4DEZ A;  3GFK B;  3TQ1 A;  3SEI A;  3AL0 B;  3BQ7 A;  1X40 A;  1X6I A;  4F2S A;  2ATL A;  2GAF D;  3V7L A;  4I2A A;  4NLB A;  1NKB A;  4RQ4 A;  1N56 A;  3E2E A;  1PK1 A;  4K4G A;  2RDI A;  2AQ4 A;  1TFW A;  2R8K A;  2YB4 A;  3BQ1 A;  2J6T A;  3OHA A;  1UA1 A;  2YML A;  2ZXI A;  4QWA A;  5KG5 A;  5AI0 A;  1KKX A;  2V9W A;  4F4X A;  3ED5 A;  5B66 U;  3JPO A;  1SWW A;  2GH1 A;  4US9 A;  1NKE A;  3QUB A;  4NM1 A;  2BBH A;  5AKX A;  3CRX A;  3M6Z A;  4MF8 A;  4DCC A;  4IR9 A;  1KLN A;  2JZB B;  3EPG A;  4QZ8 A;  3JPT A;  4LZG A;  2HVH A;  1PVR A;  1ZQQ A;  4KX5 A;  2B21 A;  2KIC A;  3JPN A;  4NXZ A;  5EE9 A;  4O0I A;  3LK9 A;  4DF4 A;  9ICX A;  4MF2 A;  1HIW A;  2AQ0 A;  5AI6 A;  5TZV A;  4RQ1 A;  1N60 A;  2YQE A;  5DGB A;  1HEK A;  4TUQ A;  1XC9 A;  4DS4 A;  2XCA A;  2JH7 A;  4RNM A;  3M9N B;  2YMP A;  5CHG A;  1NOM A;  4EBE A;  3BQT A;  4UBB A;  4K98 A;  1S5L U;  2B6G A;  7ICM A;  3KKA C;  4Y2V A;  2MU2 A;  5ALL A;  8ICE A;  3PR4 A;  3MFH A;  4K96 A;  5DG9 A;  2AHO B;  3MR6 A;  4DL4 A;  2JEI A;  1DK2 A;  5AK5 A;  1X9M A;  3OJU A;  5CFT A;  3KHR A;  2KMD A;  5HMM A;  8ICI A;  2H3F A;  1SV0 C;  1D9D A;  1T4G A;  2ZH3 A;  4IRD A;  1S0M A;  2KVS A;  4J03 A;  1WG8 A;  3GDX A;  1PUZ A;  3H8S A;  4Z6D A;  4J9R A;  3QEB Z;  1ECW A;  2C22 A;  4I2H A;  3ER9 B;  3S6J A;  2O5A A;  4QIW F;  2MRL A;  3F5E A;  3AEV A;  1K1S A;  2PFQ A;  2UVU A;  1P7D A;  1SV4 A;  3TFS A;  2WAQ C;  1MSW D;  1RPL A;  4FH3 A;  3UQ0 A;  2LBO A;  1SKW A;  4DLG A;  2ALZ A;  5J8Y C;  4J9K A;  1CI4 A;  2JHD A;  3RF9 A;  3WFQ E;  2JEG A;  1Q79 A;  4KLL A;  2BPC A;  4MHV A;  4PHA A;  5KFD A;  1ZXI A;  4I2D A;  3H8M A;  3C2K A;  5DGA A;  5ALU A;  4EP7 A;  1V97 A;  3AQF A;  5B5E U;  4FHP A;  4F3O A;  3C18 A;  4YFK A;  1T7P A;  2BCS A;  2DPJ A;  3WFS C;  2BGW A;  5J0R A;  2KOB A;  1S0N A;  4YR0 A;  4O69 A;  5CWR A;  4R64 A;  4DSE A;  4DFD A;  1BPD A;  2YN4 A;  5ALP A;  2ZIX B;  2NRZ A;  3SV4 A;  4DFP A;  5AK4 A;  5D61 A;  1L8L A;  2QAR B;  3C66 A;  4Q8E A;  5L1K A;  4EZ9 A;  1KTQ A;  5KFB A;  3GV7 B;  2KHV A;  2NRT A;  5J29 A;  4AP9 A;  1IG6 A;  1ZRM A;  4WC2 A;  4IQT A;  1V85 A;  1HJP A;  4WBZ A;  4QZF A;  3T5K A;  4KLE A;  1UCV A;  4UAW A;  1BPY A;  7ICT A;  1NJZ A;  4P0Q B;  1U48 A;  1F44 A;  5B3P A;  1A77 A;  4KMU A;  4UB4 A;  1RQN A;  4E0D A;  9ICE A;  2XY5 A;  5KAI U;  1KW4 A;  3CW2 C;  2BDU A;  3AU6 A;  3ZDC A;  1JMS A;  2KN7 A;  1M6Y A;  4AT8 A;  2VIX A;  5DQH A;  3HPO A;  4WC6 A;  1JAJ A;  4CF5 A;  1RXW A;  2F8K A;  2YY6 A;  4P4P A;  4O3S A;  2WF5 A;  2VAN A;  4EZ6 A;  2R8J A;  5ALQ A;  1KNY A;  1R8C A;  3QUC A;  5DEC A;  4RQ8 A;  2XY6 A;  4F72 A;  1X9W A;  1ZD3 A;  9ICQ A;  1YT3 A;  4NLZ A;  2PBE A;  4LEW A;  1X6J A;  1X9S A;  3OTQ A;  1SKR A;  5DB9 A;  1Z4N A;  1NK5 A;  7ICG A;  2UVR A;  4J9M A;  4C4S A;  3OSP A;  1BPX A;  2HHT A;  5BPC A;  4EBD A;  5IIN A;  3CNH A;  3ZDB A;  4K8V A;  3NKU A;  2ZIX A;  4EX7 A;  4DFM A;  5KFE A;  2DPI A;  2PI5 A;  5KFH A;  5KFV A;  4B9S A;  2ZTD A;  5J2G A;  3SI8 A;  4NJ8 A;  2IHM A;  4IC9 A;  5D63 A;  1TK8 A;  3JPP A;  8ICF A;  5EOZ A;  4IQU A;  2ASL A;  3GU3 A;  1DRG A;  2XIC A;  4Y2Y A;  4RQ2 A;  2K4H A;  3RAX A;  3PY8 A;  4BDP A;  3C29 A;  3LVW A;  4BX9 C;  4KLI A;  3ZD8 A;  4IQW A;  2JEF A;  1Z3E B;  2IOF A;  3M7D A;  1ZQO A;  4KLD A;  1XS9 D;  5III A;  3D2N A;  2PKE A;  4F92 B;  2AXT U;  1TKD A;  4B9L A;  4PGY A;  2W03 A;  5DBA A;  4KLG A;  4RT2 A;  5L1L A;  4QZD A;  2CPR A;  1L3V A;  5HP4 A;  2HOI A;  1SIJ A;  4OJ5 A;  5K4L A;  1JXL A;  4P0Q A;  5DLF A;  2EZY A;  1Q46 A;  5KFU A;  3KHL A;  1SXE A;  2E1F A;  2VA3 A;  3ICX A;  3SAG A;  4DQS A;  2DR5 A;  4RQ6 A;  4KLS A;  3FYH A;  2NRW A;  3OWG A;  2N1R A;  2KFN A;  3OV7 A;  4BXO B;  4ECW A;  4JV0 A;  9ICI A;  3PV8 A;  2VA2 A;  1A76 A;  4FZN A;  1LV5 A;  5FP0 A;  1ZQS A;  4NXT A;  4GXK A;  3IN5 A;  1BNO A;  1OW5 A;  7ICJ A;  1WCL A;  4RNN A;  8ICA A;  3NTU A;  3BQ0 A;  3Q8M A;  1WYG A;  4ED1 A;  2BPF A;  2ZUC A;  1KN5 A;  3GII A;  4NL9 C;  3WK9 A;  2W9A A;  2DR7 A;  2PFP A;  4GC6 A;  3GV5 B;  4O5K A;  3HWT A;  3MGI A;  3BQ2 A;  2KJ8 A;  1YZ6 A;  4J9Q A;  3PR5 B;  5CJ7 A;  3THV A;  2Z7J A;  5EWE A;  2XI9 A;  3WK7 A;  4NM2 A;  4UAR A;  5TIS U;  4UB5 A;  2VA8 A;  4IQV A;  2F76 X;  4TUS A;  4I2I A;  1NNL A;  4JLX A;  5J0O A;  2KKV A;  2FE9 A;  4NLC A;  3BZC A;  4GC7 A;  9ICP A;  8ICC A;  1RXV A;  2P66 A;  3RBD A;  1ZQU A;  2ASJ A;  9ICM A;  1U45 A;  3H37 A;  1ZRN A;  3QZ8 A;  2AU0 A;  4OAH A;  2H3V A;  3RJI A;  3TAP A;  1T3N A;  3ISD A;  1ZQD A;  9ICF A;  2BE3 A;  8ICP A;  3AQM A;  5G5H A;  3QX7 A;  4YQW A;  3ALR A;  4F5P A;  4N7R A;  2ZH7 A;  3K1R B;  2F44 A;  4UB3 A;  3C5F A;  1B0X A;  1N61 A;  4IS7 A;  4IR1 A;  4OCZ A;  4QZE A;  2KE7 A;  3UPS A;  4O3R A;  2XC9 A;  5ALS A;  3V72 A;  3TAR A;  2MSN A;  2HBM A;  4KLU A;  4EEB A;  2ZH9 A;  5KT3 A;  4Q44 A;  4BXO A;  2BBJ A;  4ECX A;  4O3O A;  2EH9 A;  4OAG A;  3UMG A;  5DBB A;  2Q66 A;  3PO5 A;  3T5H A;  1R8B A;  2DR9 A;  4P0P A;  3IDW A;  4F5Q A;  4B9M A;  4KLO A;  4NXW A;  4IL6 U;  3A0H U;  2VKQ A;  2L5Y A;  3ZDA A;  2F1I A;  3EWA A;  4ELT A;  4KN4 A;  3D2Q A;  3SYZ A;  1ZQG A;  4YMM A;  4KB6 A;  5DBC A;  1NJW A;  2HHW A;  2P35 A;  4F5N A;  4AT8 B;  4CE6 A;  3EF2 A;  5KFQ A;  2ZH6 A;  2BZF A;  2EAN A;  5ALZ A;  3Q8S B;  1V9P A;  3O0F A;  3Q8K A;  2F77 X;  2ISO A;  1KBU A;  3AUO A;  3LYS A;  8ICR A;  3EW9 A;  1COO A;  2P6R A;  4KLQ A;  3QU5 A;  4KX3 A;  3DV9 A;  3RJF A;  2MA1 A;  5IIO A;  4M6W B;  2BCQ A;  2DWQ A;  2FCL A;  1L3U A;  2VJ5 A;  2GWS A;  4USA A;  4F91 B;  4DS5 A;  3T5L A;  5J0Q A;  5CHE A;  7ICL A;  2IMW P;  5CP2 A;  3H8W A;  5KL8 B;  1ZQR A;  2YTU A;  8ICO A;  4OAF A;  3RTV A;  4QZA A;  5KFG A;  4O9M A;  4K97 A;  5AKY A;  3N7S C;  5HNK A;  2ZIU B;  4C0Z A;  4DL3 A;  3Q8P B;  3IG5 A;  3RB3 A;  4YP3 A;  1A6S A;  3QNM A;  5L1J A;  4E7X A;  1B43 A;  3SAH A;  3SR6 A;  3B0X A;  1BGX T;  2RQ5 A;  2OEH A;  4M5D A;  2PMZ F;  4NXV A;  5EE0 A;  1Z1B A;  4P4O A;  3JYY A;  2UVV A;  3UM9 A;  5HHH A;  5GTI U;  4I29 A;  4WC5 A;  3AM9 A;  2HBL A;  1SXD A;  2HN2 A;  2R18 A;  1RM6 C;  3ISC A;  1MQ3 A;  9ICR A;  4RUA A;  1V38 A;  2MUT B;  4U7C A;  4PL1 A;  1ZQP A;  4F8R A;  5KG3 A;  1TFR A;  1JXE A;  5AM4 A;  4M2Y A;  1KL9 A;  4RQM A;  3NUQ A;  3RBE A;  2Y9U A;  3N4M B;  2E1E A;  2I1Q A;  2F2A B;  2KZ3 A;  2W11 A;  4EYI B;  1L8O A;  4M6W A;  1JUD A;  4LT6 A;  2KJ9 A;  3OSN A;  3GZF A;  3GQC A;  5ALO A;  2FLN A;  4RQ3 A;  1MN8 A;  4IRK A;  5EWG A;  5KFW A;  3H7I A;  3BS5 A;  4EBC A;  3V6K A;  4R66 A;  4QWB A;  1JI7 A;  5AM3 A;  5KFM A;  1BPZ A;  5KFC A;  1T3Q A;  4F93 B;  4YD2 A;  1MIV A;  3TAN A;  1L3S A;  3ISB A;  3MDA A;  4X0A A;  3R9K A;  3IG8 A;  1X2I A;  2CRX A;  2D3D A;  4OJP A;  1N48 A;  5KFO A;  1KRP A;  4C8L A;  2LM1 A;  2JEJ A;  2HCF A;  3ZDD A;  2W8K A;  4Z6F A;  4EEN A;  4B9V A;  2ZG6 A;  1CRX A;  2H3Z A;  2F1J A;  4LZD A;  4QNL A;  4LEV A;  4MEX A;  2ZHB A;  2W9B B;  2YB1 A;  4X4S A;  2HHP A;  3TAC B;  1ZOL A;  4R63 A;  4YG2 A;  5AIC A;  1S76 D;  9ICB A;  5KFX A;  3UMB A;  5KFF A;  4DSI A;  8ICY A;  5HML A;  1L7O A;  1Q3U A;  8ICN A;  4ED8 A;  4O6A A;  2KKP A;  4X4T A;  3OHB A;  5D49 A;  2K4E A;  4NV0 A;  2G08 A;  4J9N A;  2LM4 A;  4DSJ A;  5D46 A;  1LB2 B;  3PNC A;  3UPQ A;  4RQ5 A;  4NLG A;  3RJK A;  3PZP A;  4P0P B;  4OJO A;  2KK0 A;  3MR5 A;  3QU9 A;  1IXR A;  4ECZ A;  3HKZ C;  4UAY A;  5J2A A;  1RYU A;  3WK4 A;  3I1Y A;  4XQ8 A;  2HW3 A;  1DGS A;  1NZB A;  3FM9 A;  3K1Z A;  4DSF A;  2J6U A;  2LMR A;  1UET A;  8ICS A;  3M8S A;  1ZQH A;  1LVH A;  3RR7 A;  3QYP A;  5ALX A;  5DKW A;  1PVQ A;  4C7Y A;  4HX0 A;  3F2D A;  2Y0S C;  5A0L A;  2DR8 A;  1OUQ A;  2VJ4 A;  9ICN A;  4MKP A;  5JTI A;  3HX0 A;  4G3I A;  2YMM A;  1XNS A;  3WU2 U;  4ECU A;  4RQN A;  1CEZ A;  5KT2 A;  2ZIW B;  1D8L A;  3ZDE A;  5HR9 A;  7ICV A;  2HMX A;  2PFO A;  1S9F A;  2HHQ A;  5HRE A;  1D8Y A;  1ZQW A;  3RJJ A;  2J6S A;  1Y88 A;  4M9G A;  3QE9 Y;  4MFF A;  4I28 A;  1S8O A;  2AH5 A;  3QUQ A;  3PHZ A;  4WOY A;  9ICA A;  3IP4 B;  2HOQ A;  1KQQ A;  4CDG A;  4YR2 A;  4UD5 A;  4B9N A;  4AT7 A;  4CNQ A;  5JU5 A;  2M2U A;  4ELU A;  3M1Y A;  5ALK A;  2GOL A;  1TE2 A;  3PMN A;  4R8U B;  4PHD A;  3EUB 2;  1ZD2 P;  4S3N A;  1L7N A;  4C8K A;  4KTQ A;  3RH6 A;  2O6K A;  1Z00 B;  3HP6 A;  3JPR A;  2W7O A;  2B56 A;  3G6Y A;  4FS2 A;  4DOB A;  1Q8K A;  5HRL A;  4WBY A;  2HBJ A;  4QIW C;  2F1H A;  2BKE A;  3MFI A;  3RH4 A;  2PXI A;  7ICF A;  3V6J A;  5DQG A;  1CUK A;  4NXU A;  5EE1 A;  2B0C A;  5KT5 A;  4C7Z A;  2IOF K;  3SEN A;  2ZHA A;  3QEA Z;  4PZO A;  2ASD A;  4ZH4 A;  2IA6 A;  5F9L A;  3C28 A;  3OVB A;  2W3R A;  1F5S A;  2YMQ A;  3DEE A;  3G6X A;  3V7J A;  3TFR A;  2ZH1 A;  1SV0 A;  3PST A;  1B22 A;  1IV8 A;  4O3Q A;  3KFU F;  3HRD D;  2C2R A;  1ZD5 A;  1PK3 A;  4C8O A;  4XRH A;  4KLT A;  1BNP A;  4RUC A;  4GXI A;  4G9B A;  4YXJ A;  2ISP A;  3H40 A;  2AJQ A;  2A1J A;  2XY7 A;  1RDF A;  4ED0 A;  3WK6 A;  4F2R A;  2V4Q A;  9ICJ A;  4FBT A;  2MAX A;  4MFA A;  5IIJ A;  4C80 A;  1RYR A;  3GV8 B;  2JRZ A;  3V7K A;  3N28 A;  4M9L A;  1MIY A;  4KLH A;  1ZQX A;  3D2S A;  3FDS A;  8ICB A;  2K4I A;  1ARO P;  3UMC A;  9ICO A;  4AYB F;  5KG4 A;  5J2E A;  3RRH A;  1ZD4 A;  1ED1 A;  2M0N A;  2EAP A;  1JQR A;  4LJX A;  2KEY A;  5KFP A;  5HRG A;  4I2G A;  4JB3 A;  5KFA A;  4EX6 A;  5L9X A;  1S0O A;  2W3S A;  2HDO A;  4DF8 A;  5J0X A;  3FC4 A;  3V6H A;  4BJQ A;  4DO9 A;  1UT8 A;  2EAM A;  1VLB A;  5J2D A;  2OHF A;  4DFK A;  3LWL A;  4E80 A;  4LEZ A;  3H38 A;  5JRT A;  3RJH A;  2Y1I A;  2CXY A;  1SGG A;  4EEK A;  2BDP A;  4EBK A;  2KHQ A;  5DB6 A;  4TQR A;  1SWV A;  5KAF U;  4PHP A;  2W8L A;  4DQQ A;  5KFT A;  1JX4 A;  2W04 A;  3NRZ A;  4JWN A;  8ICH A;  1IIP A;  4US8 A;  1TVA A;  1NK4 A;  2M2W A;  4Y2R A;  4X4U A;  2QAR A;  1TAQ A;  2KG5 A;  2Q0Z X;  4RPZ A;  1H38 A;  4FFD A;  1Z4O A;  4K9A A;  2B4V A;  1N63 A;  3PX0 A;  4FHW A;  2LI6 A;  4M47 A;  1ZQF A;  2LYB A;  2XID A;  2K8B B;  3LVV A;  1ZQB A;  4ED3 A;  4Y2U A;  2H3I A;  3L3F X;  1NO5 A;  4XJE A;  5AHX A;  4QZ9 A;  3GIJ A;  5DDY A;  8ICM A;  1BVS A;  2OH2 A;  1WUD A;  2BQR A;  1ZQY A;  3GIM A;  3ORY A;  1KFS A;  1HUZ A;  4QWE A;  3I76 A;  3L9D A;  4ATB A;  9ICU A;  7ICP A;  4FHY A;  2K4P A;  3NVW A;  1KFD A;  3JPS A;  4J9S A;  3PW0 A;  4MEY A;  1UQV A;  5C5J A;  3AMZ A;  3PW2 A;  2K89 A;  1K5O A;  3SZ2 A;  4IRC A;  3C1Z A;  3HW8 A;  5AI5 A;  2BHN A;  1S77 D;  4FBU A;  5J2I A;  3ERC C;  2LHT A;  5CR0 A;  4DFJ A;  1S97 A;  2BCU A;  2M2T A;  5KTQ A;  1NK8 A;  1RYS A;  2CN1 A;  4M04 A;  3NYB A;  5AM1 A;  1GPJ A;  4C4T A;  5KG0 A;  2JH1 A;  2D6F C;  3C1Y A;  2XVT A;  2GO7 A;  2I6X A;  4UAS A;  5KG6 A;  2DL0 A;  3U26 A;  4DQP A;  2OM6 A;  3TAD A;  2ZH5 A;  2G07 A;  2C28 A;  1C20 A;  5F3X B;  4MFC A;  7ICE A;  4F5O A;  1RQL A;  2LYA A;  4XUS A;  4AT7 B;  2F3N A;  4R65 A;  2FPM A;  4CF3 A;  4U6P A;  2HHX A;  3OVA A;  4RPY A;  1FEZ A;  3QZ7 A;  2ZIU A;  1QTM A;  1TK0 A;  3QU7 A;  1F0M A;  4ECT A;  3EZ5 A;  4OD0 A;  2DGZ A;  3N7R C;  2WB1 C;  5CA7 A;  1ZYQ A;  4JV2 A;  3NWI A;  5J8Y A;  1ZQM A;  2FMS A;  2AGQ A;  4Q45 A;  3FAH A;  4OJL A;  4ATB B;  1VFG A;  4X4N A;  2FDR A;  3OUY A;  3E0F A;  1NKC A;  8ICT A;  4R8U A;  4DSK A;  2EDU A;  2W9M A;  8ICX A;  3RJE A;  2EQY A;  2IBK A;  1SL2 A;  4PZN A;  4B9U A;  1KSP A;  2FMP A;  3E58 A;  4ED7 A;  4WC0 A;  2BR0 A;  4J9P A;  4PHE A;  1EXN A;  4ED6 A;  2G0A A;  1V4A A;  3QU2 A;  2XGQ A;  1FFV A;  3PO4 A;  9ICK A;  4PPX A;  4Z6E A;  4J9L A;  4FHV A;  2WF7 A;  4AT9 A;  2KVC A;  4BWM A;  1NJX A;  5KFK A;  3SAF A;  3BDP A;  2QB0 A;  4FH5 A;  5KL1 B;  4I0U A;  4WH5 A;  3MAB A;  1XU4 A;  1XWL A;  3K75 D;  7ICN A;  4KN7 A;  8ICG A;  5EWF A;  3UXO A;  3HJ4 A;  1S10 A;  3VC8 A;  2R8H A;  3PSF A;  2C2E A;  2ZIV B;  2AGP A;  5ALM A;  2ZTC A;  4YCX A;  1COK A;  4QWC A;  4Y2J A;  2NRK A;  2EZX A;  2IHN A;  5HR7 A;  5AM0 A;  3WFR E;  4O3P A;  1NZP A;  4WJ3 B;  9ICC A;  1WCN A;  2BCV A;  5HRH A;  4ZOH C;  4EED A;  2AGO A;  4NKU A;  5AKH A;  4F4Z A;  2FI1 A;  3F2B A;  2DVI A;  4O67 A;  1QH9 A;  2JGA A;  4EYH B;  1Q78 A;  4FO1 A;  4RNO A;  5J2C A;  1QCK A;  7ICQ A; 
#chains in the Genus database with same CATH homology
 5J0T A;  1X9S A;  3JPQ A;  3KHG A;  1SKR A;  3RJK A;  4NLG A;  1SKS A;  5DB9 A;  3HT3 A;  3AU2 A;  3N97 B;  1NK5 A;  3MR5 A;  7ICG A;  1BPE A;  4YD1 A;  2UVR A;  1IXR A;  4FS1 A;  4QW8 A;  4J9M A;  4ECZ A;  4UAY A;  5J2A A;  3OSP A;  2HHS A;  1BPX A;  3RJG A;  2HHT A;  5BPC A;  4EBD A;  5KT4 A;  5JUM A;  5IIN A;  1QLN A;  4YN4 A;  3ZDB A;  5J0P A;  5L1I A;  4DFM A;  4XQ8 A;  4PH5 A;  1TV9 A;  5KFE A;  2DPI A;  5KT6 A;  2PI5 A;  2HW3 A;  5F2V O;  1DGS A;  2KFZ A;  5KFH A;  2UVW A;  4O3N A;  5KFV A;  4B9S A;  3T5J A;  1KEJ A;  2ZTD A;  4DSF A;  2J6U A;  5J2G A;  3SI8 A;  3WFP A;  2IHM A;  1UET A;  8ICS A;  1U4B A;  3M8S A;  2FPK A;  1ZQH A;  1TK8 A;  3RR7 A;  4XQ7 A;  5DKW A;  5J2K A;  3M9M B;  3C2L A;  3JPP A;  1XSN A;  8ICF A;  3HIY A;  4YR3 A;  4HYK A;  4YMO A;  5KT7 A;  5HRB A;  5EOZ A;  4IQU A;  1TK5 A;  1K1Q A;  3IM1 A;  3PW7 A;  4DWI A;  2DR8 A;  1U47 A;  4F5R A;  2ASL A;  4JK1 A;  5HHI A;  1ZQN A;  9ICN A;  5DDM A;  3HX0 A;  4DSL A;  5HC9 A;  4TQS A;  4G3I A;  4RQ2 A;  2LYH A;  4ECU A;  1UEU A;  3RAX A;  3PY8 A;  1CEZ A;  5KFR A;  4BDP A;  4WC3 A;  5KT2 A;  2I9G A;  2HVI A;  1WOT A;  3GIL A;  4KLI A;  1IM4 A;  1D8L A;  3ZD8 A;  2FLL A;  4IQW A;  2JEF A;  1Z3E B;  9ICG A;  3HJ1 A;  5J2H A;  3ZDE A;  2ZH4 A;  4O5E A;  1ZQC A;  3KTQ A;  5IIM A;  1ZQO A;  7ICV A;  5HR9 A;  2PFO A;  4C8M A;  4F4Y A;  1S9F A;  4ED2 A;  1D8Y A;  2HHQ A;  5HRE A;  4F4W A;  1TFY A;  1ZQW A;  4RPX A;  3RJJ A;  4KLD A;  2J6S A;  1Y88 A;  1XS9 D;  5III A;  4M9G A;  4M9N A;  1JIH A;  4RQ0 A;  4I2C A;  3QE9 Y;  4MFF A;  3PX4 A;  1NK0 A;  4F92 B;  4I28 A;  2ZJ5 A;  3BJY A;  1TKD A;  4B9L A;  4PGY A;  5DED A;  3PX6 A;  5DBA A;  4KLG A;  4RT2 A;  5L1L A;  4QZD A;  1L3V A;  3UXN A;  5HP4 A;  4RQ7 A;  5J0W A;  1SL0 A;  9ICA A;  8ICW A;  4DL5 A;  1JXL A;  4YR2 A;  3C23 A;  5DLF A;  3RB0 A;  7ICH A;  4B9N A;  4UD5 A;  4AT7 A;  3H3A A;  3UXP A;  2M2U A;  5KFU A;  4ELU A;  3KHL A;  3RB4 A;  5HRD A;  4RZR A;  3EYZ A;  2VA3 A;  3IHQ B;  3PMN A;  4R8U B;  2XCP A;  2M2V A;  4PHD A;  2A1J B;  4M9J A;  1PZN A;  3H39 A;  4DQS A;  1ZQE A;  9ICW A;  2DR5 A;  4S3N A;  4RQ6 A;  4DQI A;  4KLS A;  4C8K A;  1ZQT A;  3RH6 A;  4KTQ A;  3C2M A;  4ECR A;  4RWP A;  1XSP A;  1Z00 B;  3FYH A;  1QSS A;  4YVZ A;  2NRW A;  5J0S A;  3HP6 A;  3JPR A;  2ZTE A;  3G6Y A;  5KFJ A;  2RFF A;  2KFN A;  1NJY A;  3OV7 A;  4KLM A;  4FS2 A;  4DOB A;  4BXO B;  4ECW A;  8ICJ A;  4JV0 A;  9ICI A;  5HRL A;  4WBY A;  2F1H A;  3PV8 A;  1A76 A;  2VA2 A;  2BKE A;  4DL7 A;  1VJ7 A;  1U9L A;  1UA0 A;  1LV5 A;  3MFI A;  3RH4 A;  2DFL A;  2PXI A;  3MDC A;  4NKT A;  1ZQS A;  7ICF A;  5DG8 A;  2R8I A;  3V6J A;  5DQG A;  4GXK A;  3RR8 A;  1BNO A;  1CUK A;  4UAZ A;  7ICJ A;  1WCL A;  3ZD9 A;  4RNN A;  8ICA A;  3NTU A;  3NGD A;  3BQ0 A;  5J0U A;  3Q8M A;  4ED1 A;  2BPF A;  3B0Y A;  2ZUC A;  3H4B A;  5J2J A;  3ETL A;  5KT5 A;  4QZG A;  2ZH2 A;  4TUR A;  3GII A;  2ZHA A;  5KFN A;  3QEA Z;  2ASD A;  2W9A A;  4ZH4 A;  2IA6 A;  4K4H A;  4YMN A;  2DR7 A;  3C21 A;  2XGP A;  4GC6 A;  3GV5 B;  2BQ3 A;  5F9L A;  3HWT A;  2PFP A;  4O5K A;  3OVB A;  2BQU A;  3MGI A;  5CB1 A;  3H8J A;  3BQ2 A;  3PW5 A;  4ECQ A;  3LQC B;  1PX5 A;  2FLP A;  5KFS A;  3G6X A;  4I2E A;  4J9Q A;  3V7J A;  3TFR A;  2ZH1 A;  3PR5 B;  5CJ7 A;  5KFI A;  3THV A;  5EWE A;  2C2D A;  2Y1J A;  2BPG A;  8ICU A;  3PW4 A;  3MBY A;  4NM2 A;  4UB5 A;  1B22 A;  4O3Q A;  1OU5 A;  2DRA A;  2VA8 A;  4I2J A;  4IQV A;  4F4K A;  4Z6C A;  4NLN A;  2H5X A;  4X4R A;  4TUS A;  2C2R A;  4I2I A;  3Q8R B;  1MQ2 A;  3H4D A;  5KG1 A;  5J0O A;  3OGU A;  3Q8Q B;  1D9F A;  2KZZ A;  4GC7 A;  9ICP A;  8ICC A;  1RXV A;  3RRG A;  5HRF A;  2P66 A;  3AQN A;  3RBD A;  4C8O A;  1ZQU A;  2ASJ A;  4M0A A;  4RU9 A;  4XRH A;  1U45 A;  9ICM A;  4KIT B;  4KLT A;  1F5A A;  4PGQ A;  3QZ8 A;  2AU0 A;  1BNP A;  5DLG A;  4UD4 A;  4RUC A;  4GXI A;  1XSL A;  4YXJ A;  2ISP A;  2HHU A;  3H40 A;  3RJI A;  3TAP A;  3ISD A;  1T3N A;  1RZT A;  2ZUD A;  1ZQD A;  2ZJ8 A;  2AJQ A;  2A1J A;  2XY7 A;  9ICF A;  8ICP A;  2BE3 A;  3AQM A;  4DLE A;  4ED0 A;  4F2R A;  2V4Q A;  9ICJ A;  4FBT A;  4RT3 A;  2MAX A;  4MFA A;  5IIJ A;  5BOM A;  4DOA A;  4YQW A;  5KFL A;  4DEZ A;  4F5P A;  3GFK B;  1SZP A;  3TQ1 A;  3GV8 B;  1RYR A;  8ICK A;  2ZH7 A;  4UB3 A;  3V7K A;  4KLF A;  4NLK A;  3C5F A;  4F2S A;  4M9L A;  1MIY A;  2ATL A;  4KLH A;  1ZQX A;  3FDS A;  4IR1 A;  4PGX A;  8ICB A;  3V7L A;  2PFN A;  1ARO P;  4I2A A;  5BOL A;  2NRV A;  1NKB A;  4RQ4 A;  1N56 A;  9ICO A;  3E2E A;  4QZE A;  4K4G A;  5KG4 A;  5J2E A;  5D4B A;  3UPS A;  2RDI A;  3RRH A;  1U49 A;  4O3R A;  2XC9 A;  2ZJA A;  2AQ4 A;  7ICK A;  1UEV A;  1TFW A;  3V72 A;  1JQR A;  3TAR A;  2R8K A;  4DQR A;  5KFP A;  5HRG A;  4I2G A;  3BQ1 A;  2J6T A;  4KLU A;  5KFA A;  3OHA A;  1ZJM A;  1UA1 A;  5KT3 A;  4Q44 A;  2ZH9 A;  4BXO A;  1JN3 A;  5L9X A;  4ECX A;  4O3O A;  1T8E A;  4QWA A;  1S0O A;  2KP7 A;  5DBB A;  2Q66 A;  5KG5 A;  4DF8 A;  3PO5 A;  5J0Y A;  5J0X A;  3T5H A;  3T3F A;  1R8B A;  2DR9 A;  3Q8L A;  3V6H A;  1L5U A;  4F5Q A;  4B9M A;  2V9W A;  1MIW A;  4DO9 A;  4F4X A;  3TAQ A;  1UT8 A;  4KLO A;  3JPO A;  5J2D A;  4WC4 A;  4DFK A;  3LWL A;  4IG8 A;  1S0V A;  1NKE A;  4E80 A;  3H38 A;  4NM1 A;  4EEY A;  9ICL A;  3RJH A;  2Y1I A;  3ZDA A;  2F1I A;  3EWA A;  4ELT A;  4ELV A;  4EBK A;  2BDP A;  2ID1 A;  4KN4 A;  5DB6 A;  3SYZ A;  4TQR A;  4PHP A;  4MF8 A;  2W8L A;  8ICV A;  4DQQ A;  5KFT A;  4RWN A;  3TI0 A;  1ZQG A;  4YMM A;  1QSY A;  1JX4 A;  2ZUB A;  1DOQ A;  5DBC A;  4IR9 A;  5DB7 A;  1KLN A;  4JWN A;  2JZB B;  8ICH A;  3EPG A;  1TVA A;  1NK4 A;  4TUP A;  4QZ8 A;  3JPT A;  1NJW A;  4LZG A;  1ZQA A;  2M2W A;  3M8R A;  2HVH A;  2HHW A;  4X4U A;  1ZQQ A;  2B21 A;  2ZH8 A;  1TAQ A;  5IIK A;  2Q0Z X;  4RPZ A;  4F5N A;  4GXJ A;  5F9N A;  1H38 A;  4AT8 B;  3JPN A;  4NXZ A;  1L3T A;  4DOC A;  4O0I A;  5KFQ A;  3LK9 A;  4DF4 A;  3PX0 A;  4FHW A;  2ZH6 A;  4M47 A;  3Q8S B;  1V9P A;  1ZQF A;  4ECY A;  3RH5 A;  9ICX A;  1ZQB A;  3Q8K A;  4ED3 A;  4MF2 A;  2MUT A;  2ISO A;  2AQ0 A;  5TZV A;  4RQ1 A;  2W9C B;  3AUO A;  8ICZ A;  8ICR A;  1NO5 A;  3EW9 A;  1COO A;  5DGB A;  1XC9 A;  4TUQ A;  2P6R A;  4QZ9 A;  4KLQ A;  3GIJ A;  5DDY A;  4DS4 A;  9ICH A;  8ICM A;  1BVS A;  3RJF A;  1KFT A;  5IIO A;  4M6W B;  2BCQ A;  4E8F A;  3AQL A;  2P6U A;  2BQR A;  4QZB A;  1ZQY A;  3GIM A;  4F50 A;  3ORY A;  1KFS A;  1L3U A;  4QWE A;  4X5V A;  1HUZ A;  2NRX A;  4M9H A;  2HHV A;  2XCA A;  3L9D A;  4RNM A;  3M9N B;  9ICV A;  4WC1 A;  5CHG A;  3EPI A;  2O1P A;  4ATB A;  9ICU A;  2GWS A;  7ICP A;  4F91 B;  3C5G A;  4DS5 A;  3T5L A;  4FHY A;  1KFD A;  2M9N A;  5J0Q A;  3JPS A;  1NOM A;  4MEY A;  4J9S A;  3PW0 A;  7ICL A;  5C5J A;  2IMW P;  4EBE A;  3WFO A;  3PW2 A;  3GIK A;  5CP2 A;  3H8W A;  3SZ2 A;  3C1Z A;  1ZQR A;  4IRC A;  3K4G A;  3HW8 A;  2BHN A;  3BQT A;  5DG7 A;  1S77 D;  8ICO A;  4J9O A;  3RTV A;  4QZA A;  2V4R A;  1HUO A;  2BCR A;  5J2I A;  4UBB A;  4FBU A;  4ECV A;  5KFG A;  5CR0 A;  4DFJ A;  1S97 A;  2BCU A;  4O9M A;  2M2T A;  5HNK A;  4DL2 A;  7ICM A;  4UB1 A;  5KTQ A;  4JUZ A;  4QZC A;  1NK8 A;  1RYS A;  4M04 A;  5HRI A;  3H37 A;  3NYB A;  4DL3 A;  3Q8P B;  3RB3 A;  3JZ0 A;  4YP3 A;  4CCH A;  3PR4 A;  5KG0 A;  8ICE A;  5L1J A;  1R8A A;  4E7X A;  5DQI A;  1B43 A;  3C1Y A;  3MFH A;  3G6V A;  8ICQ A;  3LDA A;  5DG9 A;  5KG6 A;  3B0X A;  1BGX T;  3MR6 A;  3MR3 A;  4DL4 A;  3RB6 A;  2FMQ A;  4DQP A;  2JEI A;  2KZM A;  1DK2 A;  3MR2 A;  4M5D A;  1X9M A;  2ZH5 A;  1ZQZ A;  3OJU A;  5KG2 A;  3KHR A;  2C28 A;  5HMM A;  2RDJ A;  8ICI A;  9ICS A;  1D9D A;  1ZQK A;  4P4O A;  4MFC A;  7ICE A;  4XA5 A;  1T4G A;  4F5O A;  4FO6 A;  1NK7 A;  3JYY A;  2ZH3 A;  4IRD A;  1S0M A;  4XUS A;  2UVV A;  3AQK A;  1ZQL A;  5HHH A;  4AT7 B;  4Q8F A;  4I29 A;  4RWO A;  3OUY B;  4WC5 A;  3GDX A;  3H8S A;  2C22 A;  4Z6D A;  4R65 A;  2FPM A;  4J9R A;  3QEB Z;  4I2H A;  4WCW A;  4LVS A;  2HHX A;  2O5A A;  7ICU A;  3OVA A;  4RPY A;  3RAQ A;  1K1S A;  1C7Y A;  3QZ7 A;  3ISC A;  1MQ3 A;  1QTM A;  2PFQ A;  9ICR A;  1TK0 A;  4WC7 A;  2UVU A;  5KG7 A;  2W9C A;  4RUA A;  4KLJ A;  2MUT B;  3EZ5 A;  4ECT A;  3TFS A;  1MSW D;  5CA7 A;  1RPL A;  5IIL A;  1ZQP A;  5KG3 A;  3KHH A;  4F8R A;  4FH3 A;  3UQ0 A;  1TFR A;  1ZYQ A;  4JV2 A;  1JXE A;  2W9B A;  4M2Y A;  1SKW A;  2PI4 A;  1KDH A;  1ZQM A;  4DLG A;  7ICO A;  2FMS A;  1NK9 A;  4X4P A;  2ALZ A;  8ICL A;  4J9K A;  2AGQ A;  4Q45 A;  4I2F A;  3RBE A;  3WFQ E;  4K4I A;  2JEG A;  1Q79 A;  4KLL A;  2BPC A;  4PHA A;  4ATB B;  3N4M B;  5KFD A;  4Q8E A;  1YLQ A;  4C8N A;  1VFG A;  4GLX A;  4X4N A;  2I1Q A;  2KZ3 A;  3OUY A;  4I2D A;  1NKC A;  3C2K A;  5DGA A;  1DK3 A;  4EP7 A;  8ICT A;  4EYI B;  1MC8 A;  4M6W A;  4R8U A;  2FPL A;  4FHP A;  4O5C A;  4DSK A;  4LT6 A;  3OVS A;  8ICX A;  2W9M A;  3OSN A;  1R89 A;  3OJS A;  3RJE A;  2IBK A;  3GQC A;  4F3O A;  1SL2 A;  3C18 A;  4QZH A;  4B9U A;  2FLN A;  4RQ3 A;  4P2H A;  4YFK A;  1KSP A;  1T7P A;  4DL6 A;  5EWG A;  5KFW A;  2BCS A;  2FMP A;  2DPJ A;  3H7I A;  4IRK A;  4EBC A;  4ED7 A;  3V6K A;  4R66 A;  2R8G A;  2BGW A;  1XO1 A;  4WC0 A;  4P4M A;  5J0R A;  3WFS C;  2BR0 A;  4QWB A;  4YR0 A;  5CWR A;  1S0N A;  3SV3 A;  1NK6 A;  4J9P A;  4PHE A;  4R64 A;  4DSE A;  5KFM A;  1BPD A;  3LWM A;  1BPZ A;  1EXN A;  4Q43 A;  5KFC A;  4ED6 A;  2NRZ A;  2XO7 A;  4YD2 A;  4F93 B;  3SV4 A;  4DFP A;  1ZQJ A;  2KTQ A;  9ICK A;  1MIV A;  1V4A A;  4FHX A;  4RWQ A;  2XGQ A;  4X0B A;  2DRB A;  2JZB A;  3TAN A;  1L3S A;  3C66 A;  3PO4 A;  4ECS A;  3ISB A;  5L1K A;  4EZ9 A;  1KTQ A;  5KFB A;  3MDA A;  4I27 A;  4PPX A;  4Z6E A;  5J29 A;  2NRT A;  3GV7 B;  3MGH A;  4J9L A;  4FHV A;  4X0A A;  1X2I A;  4AT9 A;  4BWM A;  4IQT A;  4WC2 A;  1NJX A;  5KFK A;  7ICS A;  3BDP A;  1HJP A;  4FH5 A;  1N48 A;  4QZF A;  3T5K A;  4KLE A;  1FA0 A;  7ICR A;  4WBZ A;  3MAB A;  4BGD A;  5KFO A;  1KRP A;  4C8L A;  4UAW A;  1XU4 A;  1BPY A;  1XWL A;  3K75 D;  4B9T A;  1BPB A;  4KN7 A;  2JEJ A;  7ICN A;  4I2B A;  7ICT A;  8ICG A;  1NJZ A;  5EWF A;  5J2F A;  4JWM A;  1U48 A;  1SL1 A;  3ZDD A;  3UXO A;  4EBJ A;  3UQ2 A;  2W8K A;  4Z6F A;  4B9V A;  3HJ4 A;  1S10 A;  2R8H A;  2C2E A;  4YXM A;  1A77 A;  4KMU A;  4UB4 A;  1ZQI A;  2F1J A;  2AGP A;  4E0D A;  5KFZ A;  2ZTC A;  4YCX A;  4LZD A;  2XY5 A;  4JV1 A;  5J2B A;  9ICE A;  4X4Q A;  4X4V A;  4QWC A;  2WTF A;  4MEX A;  2ZHB A;  2NRK A;  2W9B B;  3PML A;  1ZJN A;  2IHN A;  1ZQV A;  3AU6 A;  3ZDC A;  4X4S A;  1QSL A;  1JMS A;  4BWJ A;  3M9O B;  2KN7 A;  4AT9 B;  2HHP A;  3WFR E;  4R63 A;  7ICI A;  5DB8 A;  4AT8 A;  4YG2 A;  4O3P A;  4UQG A;  4QWD A;  9ICC A;  1NZP A;  5DQH A;  1S76 D;  1WCN A;  2BCV A;  3HPO A;  5HRH A;  9ICB A;  5KFX A;  5KFF A;  1UT5 A;  4WC6 A;  4DSI A;  2AGO A;  1JAJ A;  4UBC A;  4NKU A;  8ICY A;  4F4Z A;  1RXW A;  4NY8 A;  5HML A;  4QW9 A;  4P4P A;  1Z00 A;  4O3S A;  9ICT A;  2VAN A;  4EZ6 A;  2R8J A;  8ICN A;  5HRK A;  2DVI A;  4ED8 A;  3PVX A;  4UB2 A;  1KNY A;  1R8C A;  1ZET A;  4QZI A;  4X4T A;  3OHB A;  5D49 A;  2OWO A;  4RQ8 A;  5DEC A;  4J9N A;  5KFY A;  4EYH B;  4DSJ A;  1Q78 A;  2XY6 A;  1TAU A;  5D46 A;  1LB2 B;  4RNO A;  1X9W A;  9ICQ A;  3PNC A;  3UPQ A;  4NLZ A;  2PBE A;  5J2C A;  4RQ5 A;  7ICQ A;  4X4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...