2IHOA

Crystal structure of moa, a lectin from the mushroom marasmius oreades in complex with the trisaccharide gal(1,3)gal(1,4)glcnac
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Lectin
publication title Crystal structure of the marasmius oreades mushroom lectin in complex with a xenotransplantation epitope.
pubmed doi rcsb
source organism Marasmius oreades
total genus 87
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ihoA01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ihoA02
4QO3A 2P39A 5DZUA 3P6JA 1S0GA 1JT3A 4LO0A 3FJJA 1RG8A 1SR4A 5DSSB 3A21A 3ZC9A 4Q91A 3KMVA 1I1BA 1UPSA 1DZDA 3IM5A 4I4SA 4A7YA 1NUNA 3AH1A 1RZOB 3FJEA 1BLDA 1KNMA 1Z4SA 1W3AA 4ENDA 4F83A 2J3PA 2Y9FA 2BFHA 1J0SA 3R4UA 5HPZA 1FQ9A 4USOA 3BRFA 2HZ9A 3A07A 3FUQA 2Y9WC 1BLAA 1L2HA 3K1XA 5JMCA 3AKHA 2D23A 2DS0A 3FUOA 1II4A 5EHAA 2NP0A 4TLPA 5FZUA 5BXTA 4JKXB 3IIRA 1ISXA 4ZFWB 4P0JA 3V0AB 1TP0A 1DLLA 1A8DA 21BIA 4I4YA 1AF9A 5BVPI 1FV3A 4I6IA 3CA6A 4OWJA 1V6VA 3AKFA 4L4IA 4OEFA 3N7MA 3LLPA 1FMMS 1YYNA 4I2SA 4OEGA 4EEEB 3BAQA 4ZBVB 4AN6A 1DQGA 4I3NA 1S0LA 3HN1A 1Q1UA 1FWVA 2ET2A 1Q04A 3FJDA 4LO8B 3O5WB 1AXMA 1R8NA 4Q9GA 5F8WA 1EVTA 1ISWA 3BTAA 4XFTA 5JLVA 1IT0A 1TTUA 3NBCA 4G1RA 1SZ6B 3H6RB 4KBBA 3HALA 1IJTA 3N7KA 2RQ9A 3Q7WA 1QQLA 2FFUA 3PMEA 4GAFA 4ZFYB 2VSEA 1S0BA 3FGMA 2FGFA 3Q7YA 3CRHA 4EFPA 1TIEA 1FN0A 3QR5A 1ISVA 3T8SA 4ZFUB 2NZ9A 1BA7A 2MLLB 3CA5A 4D8HA 2L5XA 1BASA 1CVSA 2KLLA 1DZCA 1ABRB 3JUTA 1G9AA 1FV2A 3VSZA 4D0TA 1PZZA 3BAUA 3NJ5A 4GAIA 1JT4A 2KKIA 1G9CA 1DJSB 4EFQA 1ISYA 5F8SA 4OUJA 4P0LA 3FJ8A 3V79C 5FNWA 4D0ZA 1JY0A 2D43A 1FWUA 3HOMA 4LO3C 1XHBA 3ZXGA 1S0CA 1V6XA 4ZA3B 2K8RA 4II0A 1AFCA 3TC2A 1Q03A 3FFZA 4LO1A 1YXWA 2DREA 1JTCA 3I2XA 3PG0A 3BB2A 8I1BA 1JT5A 4KEJA 3IAGC 4G9MA 5EG6C 3BX1C 7I1BA 3UDAA 4I4OA 2GZBA 2AAIB 3IM6A 3OBTA 5FNXA 3BAOA 4I8MA 4I1BA 3WO2A 3WMUA 4OWLA 3H6SE 5BXSA 4LO7C 1S0DA 2HWAA 5DVHA 4XKIA 4ZLBB 2Y9GA 2RSTA 3OGFA 1PUMB 3A23A 1CE7B 3S8KA 1OQLB 3E8LC 4IONA 4F34A 3OBRA 1D0HA 5BQUA 3VUOA 1K5UA 4LO7B 1AVWB 1XG6A 4PC4A 2KH2A 3N0KA 4EB2B 3PUBA 1K5VA 4GOVA 1WBAA 1HWNB 4H04A 2ESUA 4GP3A 4HR6C 4I7IA 4LO0C 1S0FA 3I29B 3BA4A 1ISZA 4X37A 1BFFA 3CA3A 3N7LA 4G6MA 1SR4C 1YF8B 3O4AA 2VSAA 3VSFA 3BAHA 4YOLA 1R8OA 2VUAA 1WBCA 9ILBA 3B9UA 2QN4A 5DUYA 3AH2A 4QKSA 4CJMA 4DCKC 1QXMA 3CQAA 4I4XA 4KC3A 4GP0A 4OEEA 1BARA 5EC5A 2LIQA 1EV2A 5G00A 2VU9A 4H9WA 5BP5A 1IRAX 2WRYA 3UD9A 4R6UB 5I1BA 3S8JA 4ISQA 1M16A 5D62A 2Q3NB 4KEIA 3P6IA 1IHKA 6I1BA 2ZQNA 3CRIA 4ZKTB 5E24E 1MC9A 3AJ6A 5D63A 1W3GA 2E4MC 2FO1A 4FGFA 1TWMA 2NTDA 2VXRA 2F2FA 1HWMB 3O3QA 4IZXA 3FJCA 1S0EA 3O4BA 1AVAC 4I4QA 2VXTI 1BFCA 3CA0A 2NM1A 3JRRA 1T4QA 1T9FA 1EYLA 2QYIB 1DIWA 1JQZA 2MC2A 3RMXA 4QBCA 3V0BA 3A22A 3CA1A 4JPZA 2YUGA 4P6AA 4LO2A 4QBVA 1HKNA 1G82A 3MALA 4ZOTA 1BFBA 2IWTB 4XFUA 2IHOA 4J2YA 1G9BA 4ISRA 1EPWA 4I96A 3VWCA 3RMYA 4J2XA 2DRZA 4JRAA 3OJMA 2D24A 3UD7A 3PHZA 3OJ2A 5GAQA 2KI4A 2KI6B 1AVXB 3C9ZA 3AH4A 2RG9B 2WBCA 3BA7A 3UJ0A 3VT0A 1V6UA 4EKXB 1BFGA 3AKIA 4A7ZA 3FJKA 4JQ0A 4DEPA 2BEBA 1TWEA 3IM7A 4FVVA 4GOYA 3F62B 3CA4A 3UJ4A 2P23A 4LO1C 3FJBA 3WINA 3H6QA 1G9DA 2D22A 4EFRA 3HMYA 2LIEA 3F1RA 1JLXA 4QC4A 4Z8SB 4Q9PA 3EF2A 5FZZA 4I4UA 4I4PA 4G6JA 3AJ5A 1YBIA 3FJ9A 4ZGRB 4QALA 3O4DA 2R9KB 1FMZA 3Q7XA 3D7WB 4JP0A 5FZYA 3RTJB 1TFMB 3BRDA 5D61A 2K43A 2NYYA 1I1EA 3BAVA 5B2HA 3R4SA 2FFVA 4IYBA 5BQUC 2UUSA 3N7JA 3BAGA 1F31A 1HCEA 4KEKA 2Q9XA 2D20A 2K4AB 2AQZA 3V0AA 1YTOA 3WO3A 1P63A 3AKGA 4QKRA 2Y9XE 2BEAA 4I0YA 4JAWA 1N4KA 1IRPA 3RTIB 1E0OA 2Z49A 3CRGA 3WMVA 2DRYA 4I37A 1XYFA 1IILA 3FJIA 2NVHA 1IOBA 1WD3A 4JKQA 4I4RA 3MPPG 4HA2A 3QYDA 2VLCA 2ZQOA 2GO2A 1RY7A 3H6RA 2HWMA 1NZKA 2F8XC 3O44A 4I1EA 3BADA 3FJHA 1AVUA 4IHZA 3AZWA 2D1ZA 2HW9A 1Z2VA 2X2SA 3FJAA 4WBCA 31BIA 3ILAA 3POKA 4IY8A 5BP5C 2Z48A 3LTQA 2E4MA 2ERMA 1QQKA 3VT1A 1DQOA 3WO4A 2D7RA 4OW4A 1V6WA 4HJJA 1GGPB 2X2TA 4I4VA 4G9NA 1DFQA 4J2SA 5BXRA 1PWAA 4X3AA 1HCDA 3ZXDA 4IZEA 3O4OA 3VT2A 1DFCA 2F2FC 1HIBA 3AZVA 4AN7B 2AFGA 2XOAA 3CU1B 4X38A 1RMLA 1WD4A 1ITBA 3P53A 5BOWA 5F8YA 4J2KA 4P0KA 1ILR1 4IQPA 3W9TA 1Z0HA 1JLYA 3BA5A 4LO3A 3ZC8A 3VEQA 4X39A 5F90A 2D7IA 4USPA 4LO2C 1M2TB 2M49A 1TOOA 3HSMA 3O4CA 1HWOB 3CAHA 3OJVA 1HWPB 2ZR1B 4A7KA 3NBEA 3V0BB 3BRGC 1FGAA 1MD6A 3NBNA 4OWKA 1W3FA 1XZZA 2AXMA 3O49A 3HBWA 4J23B 5BXPA 3RSJA 4IY9A 3WA1A 2FDBM 2MIBA 2I1BA 2D44A 4QD2C 3SNVA 4DENA 3I2AA 3OGGA 1ONKB 1PUUB 4L4HA 3NBDA 1JT7A 4Z9WB 3UD8A 3WINC 4XFSA 1VCLA 41BIA 4QD2B 3FJFA 3ZX7A 1PC8B
chains in the Genus database with same CATH superfamily
5CFTA 3HJ4A 1ZQYA 5TZVA 3P6JA 1S0GA 4LO0A 1MIWA 4A7YA 1NUNA 1J0SA 4F5NA 3R4UA 5J2AA 5HPZA 4PGYA 3FUQA 2D23A 3FUOA 8ICVA 3B0XA 1TFWA 3IIRA 4I2IA 4P0JA 1TP0A 1DLLA 1A8DA 1FV3A 4K8VA 8ICBA 3AKFA 3HX0A 2O1PA 3LLPA 4OEGA 4RWNA 4AN6A 1DQGA 2ET2A 1AXMA 1R8NA 1ISWA 4XFTA 2M2TA 4F5OA 4M9GA 2FMSA 1IJTA 2RQ9A 4GAFA 4ZFYB 2VSEA 4PH5A 3FGMA 4EFPA 1TIEA 1ZQMA 3QR5A 1ISVA 4LZDA 4WC6A 3NWIA 3WFPA 3CA5A 4X5VA 1CVSA 4KLSA 3C5FA 1G9CA 4MF8A 5HRHA 9ICTA 4P0LA 1XHBA 5CFUA 3HWTA 4LEZA 9ICBA 7I1BA 4KLQA 4I4OA 3BAOA 2ZHBA 4I8MA 4OAIZ 2HWAA 5DVHA 2M2VA 4PPXA 1ZQQA 1KDHA 1K5UA 1AVWB 3N0KA 3PUBA 4WOYA 2PBEA 1WBAA 4H04A 4UB4A 2ESUA 4GP3A 4HR6C 1ISZA 4X37A 3CA3A 3N7LA 4FHWA 2VSAA 9ILBA 2HHPA 3B9UA 2QN4A 4RT3A 7ICIA 3AH2A 2O5AA 3OUYB 4CJMA 3CQAA 4OEEA 9ICEA 5G00A 2I9GA 4TUSA 4H9WA 8ICKA 1IRAX 4R6UB 5I1BA 1M16A 4P4OA 4KEIA 2W9MA 4M47A 6I1BA 4ZKTB 1W3GA 2E4MC 3O3QA 2IHMA 4I4QA 5CR0A 3CA0A 4GXJA 3RH6A 3JZ0A 1DIWA 1MIYA 1VFGA 4P6AA 5IIIA 4LO2A 4QBVA 4ZOTA 4XA5A 4J2YA 3RJGA 1EPWA 3VWCA 2DRZA 8ICUA 4NLZA 1TFYA 2D24A 1TVAA 3PHZA 1PX5A 1UEVA 5DDMA 2B51A 1AVXB 3BA7A 3UJ0A 3PNCA 1BFGA 5J0XA 3UPSA 4GOYA 3UJ4A 4LO1C 9ICNA 5CWRA 3UPQA 3HMYA 5FZZA 1YBIA 1F5AA 4M9NA 4QALA 4KM5A 4I2HA 4FHPA 4X4SA 4UB5A 1TFMB 4EV6A 3OVBA 7ICMA 1BPDA 2DR5A 7ICGA 3BAVA 4K97A 2UUSA 2D20A 4UAZA 3V0AA 3C66A 7ICOA 1GPJA 4O5EA 5J2BA 4R65A 5CA7A 1MQ2A 3CRGA 5J2CA 2NVHA 1IOBA 3RJJA 1WD3A 4JKQA 3MPPG 2ISOA 4WQLA 3OGUA 2ZQOA 7ICKA 5IIMA 1RY7A 2F8XC 5IIKA 3BADA 4RWPA 3AZWA 2D1ZA 1ZQWA 1JQRA 3POKA 4OAGA 4IY8A 3ERCC 4RQ0A 3LTQA 3VT1A 2D7RA 1V6WA 4WC0A 4XQ7A 4X4VA 4F5QA 4LEYA 3RJEA 4I28A 3O4OA 3VT2A 3WFSC 1DFCA 4O6AA 1HIBA 4KLGA 1VJ7A 5IILA 3CU1B 1WD4A 9ICPA 1ILR1 3ZC8A 3VEQA 2D7IA 1M2TB 1TOOA 3HSMA 8ICRA 2ZR1B 8ICXA 4YMMA 4GXKA 1FGAA 1MD6A 4X0AA 9ICMA 3O49A 4RWQA 3WA1A 3PMLA 4FO6A 2FDBM 4Z6DA 4QD2C 4DENA 7ICRA 3C2MA 5J0OA 5DBAA 4Z9WB 3WINC 4XFSA 3JPTA 2ZH9A 4QO3A 7ICSA 1ZQLA 5DZUA 1JT3A 3FJJA 1RG8A 5DSSB 3ZC9A 1RZOB 3FJEA 3OVSA 4MF2A 3RJHA 1FQ9A 4USOA 3K1XA 2DS0A 4TUQA 2DRBA 2NP0A 4TLPA 4FH5A 8ICCA 4JWMA 4RPZA 5DB6A 3H38A 9ICRA 9ICFA 1ZJNA 4I6IA 1R8BA 1V6VA 3BAQA 4RQ1A 4ZBVB 1ZQRA 4X4UA 1S0LA 1Q1UA 1FWVA 3FJDA 5HHHA 1ZQEA 2FMPA 1IT0A 4ATBB 1TTUA 4OAFA 3H6RB 3HALA 1S0BA 4I2JA 4WC7A 1FN0A 5CFSA 3T8SA 4NY8A 2MLLB 2ISPA 4D8HA 2L5XA 1BASA 3JUTA 1G9AA 4QZ9A 3NJ5A 4N7RA 1JT4A 4AT9B 4EFQA 2FCLA 4LT6A 3V79C 1HUOA 5FNWA 1JY0A 2D43A 3MCRA 4RQ3A 1FWUA 1HUZA 1JN3A 4F5RA 1Q03A 3FFZA 4LO1A 1YXWA 3BB2A 8I1BA 8ICYA 3BX1C 3GDXA 9ICJA 3UDAA 2HN2A 3WFQE 2PFQA 4PHDA 1BPXA 9ICQA 3WMUA 4OWLA 2DR9A 2ZH1A 4LO7C 2Y9GA 4KLFA 2RSTA 3OGFA 1PUMB 1CE7B 3S8KA 3E8LC 4IONA 4F34A 4NM2A 1ZQTA 4UBCA 4R63A 4PC4A 4KB6A 4M9HA 4XJEA 4H75A 1HWNB 1TV9A 1R89A 1S0FA 3BA4A 8ICPA 4RQ5A 7ICEA 1SR4C 3VSFA 3ISDA 8ICTA 4YOLA 9ICWA 4QKSA 1NOMA 2M2UA 1R8AA 1ZQUA 1QXMA 1ZJMA 4GP0A 4TURA 5DB8A 2ZH4A 2WRYA 9ICHA 4I2DA 7ICQA 2P66A 3JPOA 3S8JA 2BCRA 3P6IA 4PGQA 5B3PA 2ZQNA 5E24E 3AJ6A 5D63A 4FGFA 1HWMB 4F5PA 1S0EA 2BCUA 1AVAC 1UEUA 2RFFA 4OAHA 2PXIA 4FHYA 1T4QA 4K9AA 1T9FA 1EYLA 8ICGA 3V0BA 1ZQKA 3CA1A 1HKNA 4X4TA 1G82A 4JLZA 2IWTB 4KLEA 4IQTA 4J2XA 4JRAA 2PFNA 9ICUA 3RH5A 3UQ2A 2PFOA 3OJ2A 4NM1A 2KI4A 4MZHA 1XSPA 4JWNA 1V6UA 3TFRA 4A7ZA 4M04A 9ICSA 2BEBA 1TWEA 3JYYA 3C5GA 3F62B 2P23A 3WINA 2D22A 5HRLA 3MDCA 4WC2A 5HR9A 3H3AA 2LIEA 4WCWA 3F1RA 4Z8SB 4I4UA 8ICOA 3OWGA 3O4DA 2R9KB 3Q7XA 3ER8C 3RTJB 3OVAA 3JPPA 5HRFA 3BRDA 5D61A 5B2HA 2FFVA 7ICVA 5J2FA 1HCEA 1XSLA 4IG8A 4KLLA 2AQZA 1P63A 3AKGA 4X4OA 4I0YA 4JAWA 1N4KA 4O67A 3RTIB 4QZDA 2DRYA 4K96A 3K75D 9ICGA 4HA2A 4RQ7A 3QYDA 3RH4A 2VLCA 5IIJA 4PGXA 2X2SA 3ILAA 4M9JA 2BE3A 5BP5C 2Z48A 4O68A 2ERMA 4QZIA 1GGPB 2X2TA 4I4VA 4E7XA 1PWAA 2NS2A 3ZXDA 8ICHA 3WFOA 4AN7B 5DEDA 4X38A 4K4IA 4XQ8A 1RMLA 5BOWA 5HHIA 5F8YA 4KLUA 4J2KA 4P0KA 3W9TA 4UD4A 8ICIA 3CK6A 4X39A 5F90A 5J0UA 4PHAA 2M49A 4RQ8A 1HWOB 4K98A 3CAHA 3MDAA 3JPRA 4QZAA 1V4AA 3BRGC 1W3FA 4WC1A 4UD5A 3RSJA 7ICUA 4YN4A 4YMNA 2MIBA 2I1BA 4KLJA 1ZQHA 3LK9A 3OGGA 2Q66A 1ONKB 3AQKA 1ZQNA 3NBDA 1JT7A 7ICFA 3ZX7A 1PC8B 2P39A 5HC9A 2ZH8A 4EEBA 5BOMA 3C2LA 1ZQBA 1SR4A 3A21A 1DZDA 4NKTA 3KMVA 1I1BA 1UPSA 3IM5A 4I4SA 5HRGA 2B4VA 1RPLA 1ZQPA 5CHEA 4K4HA 2J3PA 2Y9FA 1KEJA 2BFHA 4AT8A 3BRFA 2HZ9A 1BLAA 5JMCA 3AKHA 1II4A 1ZQXA 5FZUA 5HRDA 4QZCA 3V0AB 5HRBA 2NRKA 4I2BA 9ICOA 4I4YA 9ICAA 4L4IA 4OEFA 3N7MA 1FMMS 1YYNA 4I2AA 4LO8B 5F8WA 1EVTA 4FHVA 5DB7A 1KNYA 8ICZA 5JLVA 5DECA 3NBCA 4WC4A 4NLKA 3PMEA 2GA9D 1ZQSA 4O5CA 2ID1A 2FGFA 4KLIA 4UY4A 1FA0A 5J0SA 3NVOA 2BBJA 2BCQA 2NZ9A 3HJ1A 4AT7A 1BA7A 2KLLA 1ZQGA 1FV2A 3AQMA 3BAUA 4I27A 2KKIA 4K99A 1BPZA 5F8SA 4YMOA 4I2CA 4D0ZA 4O9MA 3HOMA 3JPQA 1S0CA 4ZA3B 3TC2A 4II0A 4AT7B 3AUOA 3PG0A 4KEJA 8ICAA 8ICWA 3WFRE 4LZGA 3OBTA 2ZH6A 5HRIA 4WH5A 4I1BA 4R66A 3WO2A 3H6SE 5BXSA 1S0DA 4XKIA 4ZLBB 5IIOA 1ZQAA 1OQLB 3OBRA 7ICHA 1D0HA 4RPYA 4KLTA 3RJKA 3VUOA 4UB2A 4HX0A 5BOLA 5JTGA 4EB2B 1NO5A 1BFFA 1YF8B 3O4AA 3BAHA 1R8OA 2VUAA 1WBCA 4NXZA 5DUYA 4KLHA 4DCKC 4YD1A 4I4XA 1BARA 1EV2A 4RQ2A 8ICLA 5BP5A 1JAJA 4ISQA 2Q3NB 4EP7A 2BPCA 1IHKA 4RQ6A 2FO1A 1TWMA 2VXRA 4IZXA 3FJCA 3AU2A 4M0AA 3O4BA 1ZQFA 8ICNA 1Q79A 2VXTI 2PFPA 2NM1A 4NXTA 8ICJA 1JQZA 5J2GA 2MC2A 3RMXA 4QBCA 4JPZA 2YUGA 4Z6EA 3MALA 1BFBA 2ZH7A 4XFUA 1G9BA 4I96A 1Q78A 3RMYA 3OJMA 3AU6A 3HW8A 3JPNA 8ICQA 3UD7A 5GAQA 3AH4A 2KI6B 2IUBA 3C9ZA 4EKXB 4JQ0A 4DEPA 2FMQA 4KLMA 4UBBA 9ICCA 3IM7A 2BPGA 4NXXA 3FJBA 1G9DA 4EFRA 1JLXA 4QC4A 3EF2A 4I4PA 4KLOA 3FJ9A 4JP0A 3ER9B 2K43A 1I1EA 4P4MA 5BQUC 3N7JA 3BAGA 5J2KA 2Q9XA 3AQNA 2BEAA 4WBYA 1IRPA 5J0RA 5J0QA 4WQKA 1E0OA 3MGIA 2Z49A 4I37A 3FJIA 4DOBA 3OV7A 5HRKA 3V7LA 2GO2A 2HWMA 5J0YA 3O44A 8ICMA 3FJHA 1AVUA 3NKUA 3FJAA 9ICKA 4WBCA 5D49A 1BPYA 4DOAA 4G9NA 4X0BA 4J2SA 3UQ0A 4UB3A 3MBYA 4X3AA 1HCDA 4UB1A 4TUPA 2F2FC 1UETA 4QZBA 4EBJA 4MFFA 2AFGA 3P53A 1ITBA 3UXOA 1Z0HA 1JLYA 4QZEA 1YLQA 2ZH2A 3O4CA 4I29A 2BCSA 4P2HA 3NBEA 3V0BB 4X4PA 3NBNA 1XZZA 2AXMA 3V7KA 3HBWA 4J23B 1ZQIA 5B3QA 2ZH5A 4LVSA 2GWSA 41BIA 4QD2B 3FJFA 4E8FA 4K9BA 4QZHA 5CP2A 5J2DA 3AQLA 4EBKA 4NLNA 4Q91A 5J2EA 3LQCB 4GXIA 4I0UA 3AH1A 3OUYA 1BLDA 1KNMA 1Z4SA 1W3AA 4ENDA 4F83A 4WC3A 4IQWA 3A07A 2Y9WC 1L2HA 2ZHAA 4WBZA 5HREA 5J2IA 5EHAA 2BCVA 5BXTA 4X4RA 4JKXB 1ISXA 4ZFWB 21BIA 1AF9A 5BVPI 3CA6A 4OWJA 5CB1A 4I2SA 4EEEB 5J2HA 4I3NA 3HN1A 2DVIA 4JLXA 1Q04A 3O5WB 4Q9GA 4DOCA 4UAWA 3BTAA 4IQVA 3TFSA 4MZFB 3V72A 2VANA 4G1RA 5CHGA 1SZ6B 4KBBA 4MFAA 3N7KA 3Q7WA 1QQLA 2FFUA 3Q7YA 3CRHA 4MKPA 4RPXA 4ZFUB 5EOZA 5CJ7A 1DZCA 1ABRB 1MIVA 3VSZA 4O5KA 4D0TA 1PZZA 4NKUA 4GAIA 1DJSB 4QZ8A 1ISYA 4XUSA 4OUJA 3FJ8A 5J29A 4LO3C 3ZXGA 1V6XA 2K8RA 1AFCA 8ICFA 2DREA 1JTCA 3I2XA 3IAGC 1JT5A 4G9MA 5EG6C 2GZBA 2AAIB 3IM6A 5FNXA 4Z6FA 3V7JA 5DKWA 7ICTA 2DR8A 4MZGB 4R64A 4FHXA 4EEDA 3A23A 2BBHA 5D46A 5BQUA 4YCXA 4UAYA 4LO7B 3C2KA 1XG6A 2KH2A 5J0WA 1K5VA 4GOVA 4E80A 4I7IA 4LO0C 3I29B 4G6MA 3RJFA 5DB9A 4RQ4A 5F2VO 7ICPA 4KC3A 9ICLA 5EC5A 4AT8B 2LIQA 4RWOA 2VU9A 5DDYA 3UD9A 5D62A 4FH3A 4PHPA 4X4NA 4K4GA 4WC5A 4FO1A 3CRIA 1MC9A 3PMNA 2NTDA 2F2FA 7ICLA 1BFCA 1MQ3A 3JRRA 2QYIB 5DBCA 1ZQOA 3A22A 2DRAA 8ICSA 9ICVA 2IHOA 4ISRA 5BPCA 3HIYA 4MFCA 3H39A 5J2JA 5IINA 4I2FA 5D4BA 4M5DA 2RG9B 2WBCA 3VT0A 3AKIA 3FJKA 9ICIA 4M9LA 4YD2A 4FVVA 3CA4A 2M2WA 3RJIA 3H6QA 9ICXA 3JCFA 4Q9PA 4G6JA 3AJ5A 1ZQJA 4ZGRB 3MGHA 1FMZA 3D7WB 3K7DA 5J0PA 5FZYA 1ZQVA 1RZTA 2HN1A 3H37A 2NYYA 3R4SA 3UXPA 4IYBA 1WOTA 4O69A 4Z6CA 1F31A 4KEKA 1BPBA 2K4AB 4RT2A 1YTOA 3WO3A 4QKRA 2Y9XE 4NXUA 3ISCA 3WMVA 1ZQZA 1ZQCA 2BPFA 3NYBA 1XYFA 4EGWA 1IILA 2GAFD 4I4RA 4LEWA 4ATBA 4P4PA 3H6RA 1NZKA 3ISBA 4I2EA 2EWRA 4I1EA 4IHZA 2HW9A 1Z2VA 4S3NA 8ICEA 31BIA 4QZGA 3JPSA 2E4MA 1ZQDA 1QQKA 2B56A 1DQOA 3WO4A 4OW4A 5J0TA 4HJJA 7ICJA 1DFQA 4M2YA 5BXRA 4AT9A 4IZEA 5DBBA 4I2GA 3AZVA 4X4QA 4KLDA 2XOAA 1XSNA 4IQPA 4LEVA 1JMSA 3BA5A 4LO3A 3C18A 4USPA 4LO2C 3OJVA 4NXVA 1HWPB 1R8CA 4XRHA 4NXWA 4A7KA 3L9DA 1OU5A 7ICNA 4OWKA 4DO9A 3B0YA 5BXPA 4IY9A 2D44A 4PHEA 3SNVA 3I2AA 2ZH3A 1PUUB 4L4HA 3UXNA 3UD8A 2DR7A 1VCLA 4IQUA 1BPEA 4QZFA
chains in the Genus database with same CATH topology
4QO3A 4K9BA 2P39A 5CFTA 5DZUA 3P6JA 1S0GA 1JT3A 4LO0A 3FJJA 1RG8A 1SR4A 5DSSB 3A21A 3ZC9A 4Q91A 3KMVA 1I1BA 1UPSA 1DZDA 3IM5A 4I4SA 4A7YA 1NUNA 3AH1A 1RZOB 2B4VA 3FJEA 1BLDA 1KNMA 5CHEA 1Z4SA 1W3AA 4ENDA 4F83A 2J3PA 2Y9FA 2BFHA 1J0SA 3R4UA 5HPZA 1FQ9A 4USOA 3BRFA 2HZ9A 3A07A 3FUQA 2Y9WC 1BLAA 1L2HA 3K1XA 5JMCA 3AKHA 2D23A 2DS0A 3FUOA 1II4A 5EHAA 2NP0A 4TLPA 5FZUA 5BXTA 4JKXB 3IIRA 1ISXA 4ZFWB 4P0JA 3V0AB 1TP0A 1DLLA 1A8DA 21BIA 4I4YA 1AF9A 5BVPI 1FV3A 4I6IA 3CA6A 4K8VA 4OWJA 1V6VA 3AKFA 4L4IA 4OEFA 3N7MA 3LLPA 1FMMS 1YYNA 4I2SA 4OEGA 4EEEB 3BAQA 4ZBVB 4AN6A 1DQGA 4I3NA 1S0LA 3HN1A 1Q1UA 1FWVA 2ET2A 1Q04A 3FJDA 4LO8B 4JLXA 3O5WB 1AXMA 1R8NA 4Q9GA 5F8WA 1EVTA 1ISWA 3BTAA 4XFTA 4MZFB 5JLVA 1IT0A 1TTUA 3NBCA 4G1RA 4OAFA 1SZ6B 3H6RB 4KBBA 3HALA 1IJTA 3N7KA 2RQ9A 3Q7WA 1QQLA 2FFUA 3PMEA 4GAFA 2GA9D 4ZFYB 2VSEA 1S0BA 3FGMA 2FGFA 3Q7YA 3CRHA 4EFPA 1TIEA 4MKPA 1FN0A 4UY4A 5CFSA 3QR5A 1ISVA 3T8SA 4ZFUB 2NZ9A 1BA7A 2MLLB 3CA5A 4D8HA 2L5XA 1BASA 1CVSA 2KLLA 1DZCA 1ABRB 3JUTA 1G9AA 1FV2A 3VSZA 4D0TA 1PZZA 3BAUA 3NJ5A 4N7RA 4GAIA 1JT4A 2KKIA 1G9CA 4K99A 1DJSB 4EFQA 2FCLA 1ISYA 5F8SA 4OUJA 4P0LA 3FJ8A 3V79C 5FNWA 4D0ZA 1JY0A 2D43A 3MCRA 1FWUA 3HOMA 4LO3C 1XHBA 5CFUA 3ZXGA 1S0CA 1V6XA 4ZA3B 2K8RA 4II0A 1AFCA 3TC2A 1Q03A 3FFZA 4LO1A 1YXWA 2DREA 1JTCA 3I2XA 3PG0A 3BB2A 8I1BA 1JT5A 4KEJA 3IAGC 4LEZA 4G9MA 5EG6C 3BX1C 7I1BA 3UDAA 4I4OA 2GZBA 2AAIB 3IM6A 3OBTA 5FNXA 3BAOA 4I8MA 4WH5A 4I1BA 4OAIZ 3WO2A 3WMUA 4OWLA 4MZGB 3H6SE 5BXSA 4LO7C 1S0DA 2HWAA 5DVHA 4XKIA 4ZLBB 2Y9GA 2RSTA 3OGFA 1PUMB 3A23A 1CE7B 3S8KA 1OQLB 3E8LC 4IONA 4F34A 3OBRA 1D0HA 5BQUA 3VUOA 1K5UA 4HX0A 4LO7B 1AVWB 1XG6A 4PC4A 2KH2A 3N0KA 4EB2B 4KB6A 3PUBA 4WOYA 1K5VA 4XJEA 4GOVA 4H75A 1WBAA 1HWNB 4H04A 2ESUA 4GP3A 4HR6C 4I7IA 4LO0C 1S0FA 3I29B 3BA4A 1ISZA 4X37A 1BFFA 3CA3A 3N7LA 4G6MA 1SR4C 1YF8B 3O4AA 2VSAA 3VSFA 3BAHA 4YOLA 1R8OA 2VUAA 1WBCA 9ILBA 3B9UA 2QN4A 5DUYA 3AH2A 4QKSA 4CJMA 4DCKC 1QXMA 3CQAA 4I4XA 4KC3A 4GP0A 4OEEA 1BARA 5EC5A 2LIQA 1EV2A 5G00A 2VU9A 4H9WA 5BP5A 1IRAX 2WRYA 3UD9A 4R6UB 5I1BA 3S8JA 4ISQA 1M16A 5D62A 2Q3NB 4KEIA 3P6IA 1IHKA 6I1BA 5B3PA 4FO1A 2ZQNA 3CRIA 4ZKTB 5E24E 1MC9A 3AJ6A 5D63A 1W3GA 2E4MC 2FO1A 4FGFA 1TWMA 2NTDA 2VXRA 2F2FA 1HWMB 3O3QA 4IZXA 3FJCA 1S0EA 3O4BA 1AVAC 4I4QA 2VXTI 1BFCA 4OAHA 3CA0A 2NM1A 3JRRA 1T4QA 4NXTA 4K9AA 1T9FA 1EYLA 2QYIB 1DIWA 1JQZA 2MC2A 3RMXA 4QBCA 3V0BA 3A22A 3CA1A 4JPZA 2YUGA 4P6AA 4LO2A 4QBVA 1HKNA 1G82A 4JLZA 3MALA 4ZOTA 1BFBA 2IWTB 4XFUA 2IHOA 4J2YA 1G9BA 4ISRA 1EPWA 4I96A 3VWCA 3RMYA 4J2XA 2DRZA 4JRAA 3OJMA 2D24A 3UD7A 3PHZA 3OJ2A 5GAQA 2KI4A 2KI6B 1AVXB 3C9ZA 3AH4A 2RG9B 2WBCA 3BA7A 4MZHA 3UJ0A 1V6UA 3VT0A 4EKXB 1BFGA 3AKIA 4A7ZA 3FJKA 4JQ0A 4DEPA 2BEBA 1TWEA 3IM7A 4FVVA 4GOYA 3F62B 3CA4A 3UJ4A 2P23A 4LO1C 4NXXA 3FJBA 3WINA 3H6QA 1G9DA 2D22A 4EFRA 3HMYA 2LIEA 3F1RA 1JLXA 4QC4A 4Z8SB 4Q9PA 3EF2A 5FZZA 4I4UA 4I4PA 4G6JA 3AJ5A 1YBIA 3FJ9A 4ZGRB 3OWGA 4QALA 3O4DA 4KM5A 2R9KB 1FMZA 3Q7XA 3D7WB 3K7DA 4JP0A 5FZYA 3RTJB 3ER8C 1TFMB 3BRDA 5D61A 3ER9B 2K43A 2NYYA 1I1EA 3BAVA 5B2HA 4K97A 3R4SA 2FFVA 4IYBA 5BQUC 2UUSA 3N7JA 4O69A 3BAGA 1F31A 1HCEA 4KEKA 2Q9XA 2D20A 2K4AB 2AQZA 3V0AA 1YTOA 3WO3A 1P63A 1GPJA 3AKGA 4QKRA 2Y9XE 4NXUA 2BEAA 4I0YA 4JAWA 1N4KA 1IRPA 4O67A 3RTIB 4WQKA 1E0OA 2Z49A 3CRGA 3WMVA 2DRYA 4I37A 1XYFA 1IILA 3FJIA 4K96A 2GAFD 2NVHA 1IOBA 2B51A 1WD3A 4JKQA 4I4RA 3MPPG 4HA2A 4LEWA 4WQLA 3QYDA 2VLCA 2ZQOA 2GO2A 1RY7A 3H6RA 2HWMA 1NZKA 2F8XC 3O44A 2EWRA 4I1EA 3BADA 3FJHA 1AVUA 4IHZA 3AZWA 2D1ZA 3NKUA 2HW9A 1Z2VA 2X2SA 3FJAA 4WBCA 31BIA 3ILAA 3POKA 4OAGA 4IY8A 3ERCC 5BP5C 2Z48A 3LTQA 4O68A 2E4MA 2ERMA 1QQKA 3VT1A 2B56A 1DQOA 3WO4A 2D7RA 4OW4A 1V6WA 4HJJA 1GGPB 2X2TA 4I4VA 4G9NA 1DFQA 4J2SA 5BXRA 4LEYA 1PWAA 2NS2A 4X3AA 1HCDA 3ZXDA 4IZEA 3O4OA 3VT2A 1DFCA 4O6AA 2F2FC 1HIBA 3AZVA 4AN7B 2AFGA 2XOAA 3CU1B 4X38A 1RMLA 1WD4A 1ITBA 3P53A 5BOWA 5F8YA 4J2KA 4P0KA 1ILR1 4IQPA 3W9TA 1Z0HA 1JLYA 3BA5A 4LO3A 4LEVA 3ZC8A 3VEQA 4X39A 5F90A 2D7IA 4USPA 4LO2C 1M2TB 2M49A 1TOOA 3HSMA 3O4CA 1HWOB 4K98A 3CAHA 3OJVA 4NXVA 1HWPB 2ZR1B 4NXWA 4A7KA 3NBEA 3V0BB 3BRGC 1FGAA 1MD6A 3NBNA 4OWKA 1W3FA 1XZZA 2AXMA 3O49A 3HBWA 4J23B 5BXPA 3RSJA 4IY9A 3WA1A 2FDBM 2MIBA 2I1BA 2D44A 4QD2C 3SNVA 4DENA 3I2AA 5B3QA 3OGGA 1ONKB 1PUUB 4L4HA 3NBDA 1JT7A 4Z9WB 3UD8A 3WINC 4XFSA 1VCLA 41BIA 4QD2B 3FJFA 3ZX7A 1PC8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QO3 A;  2P39 A;  5DZU A;  3P6J A;  1S0G A;  1JT3 A;  4LO0 A;  3FJJ A;  1RG8 A;  1SR4 A;  5DSS B;  3A21 A;  3ZC9 A;  4Q91 A;  3KMV A;  1I1B A;  1UPS A;  1DZD A;  3IM5 A;  4I4S A;  4A7Y A;  1NUN A;  3AH1 A;  1RZO B;  3FJE A;  1BLD A;  1KNM A;  1Z4S A;  1W3A A;  4END A;  4F83 A;  2J3P A;  2Y9F A;  2BFH A;  1J0S A;  3R4U A;  5HPZ A;  1FQ9 A;  4USO A;  3BRF A;  2HZ9 A;  3A07 A;  3FUQ A;  2Y9W C;  1BLA A;  1L2H A;  3K1X A;  5JMC A;  3AKH A;  2D23 A;  2DS0 A;  3FUO A;  1II4 A;  5EHA A;  2NP0 A;  4TLP A;  5FZU A;  5BXT A;  4JKX B;  3IIR A;  1ISX A;  4ZFW B;  4P0J A;  3V0A B;  1TP0 A;  1DLL A;  1A8D A;  21BI A;  4I4Y A;  1AF9 A;  5BVP I;  1FV3 A;  4I6I A;  3CA6 A;  4OWJ A;  1V6V A;  3AKF A;  4L4I A;  4OEF A;  3N7M A;  3LLP A;  1FMM S;  1YYN A;  4I2S A;  4OEG A;  4EEE B;  3BAQ A;  4ZBV B;  4AN6 A;  1DQG A;  4I3N A;  1S0L A;  3HN1 A;  1Q1U A;  1FWV A;  2ET2 A;  1Q04 A;  3FJD A;  4LO8 B;  3O5W B;  1AXM A;  1R8N A;  4Q9G A;  5F8W A;  1EVT A;  1ISW A;  3BTA A;  4XFT A;  5JLV A;  1IT0 A;  1TTU A;  3NBC A;  4G1R A;  1SZ6 B;  3H6R B;  4KBB A;  3HAL A;  1IJT A;  3N7K A;  2RQ9 A;  3Q7W A;  1QQL A;  2FFU A;  3PME A;  4GAF A;  4ZFY B;  2VSE A;  1S0B A;  3FGM A;  2FGF A;  3Q7Y A;  3CRH A;  4EFP A;  1TIE A;  1FN0 A;  3QR5 A;  1ISV A;  3T8S A;  4ZFU B;  2NZ9 A;  1BA7 A;  2MLL B;  3CA5 A;  4D8H A;  2L5X A;  1BAS A;  1CVS A;  2KLL A;  1DZC A;  1ABR B;  3JUT A;  1G9A A;  1FV2 A;  3VSZ A;  4D0T A;  1PZZ A;  3BAU A;  3NJ5 A;  4GAI A;  1JT4 A;  2KKI A;  1G9C A;  1DJS B;  4EFQ A;  1ISY A;  5F8S A;  4OUJ A;  4P0L A;  3FJ8 A;  3V79 C;  5FNW A;  4D0Z A;  1JY0 A;  2D43 A;  1FWU A;  3HOM A;  4LO3 C;  1XHB A;  3ZXG A;  1S0C A;  1V6X A;  4ZA3 B;  2K8R A;  4II0 A;  1AFC A;  3TC2 A;  1Q03 A;  3FFZ A;  4LO1 A;  1YXW A;  2DRE A;  1JTC A;  3I2X A;  3PG0 A;  3BB2 A;  8I1B A;  1JT5 A;  4KEJ A;  3IAG C;  4G9M A;  5EG6 C;  3BX1 C;  7I1B A;  3UDA A;  4I4O A;  2GZB A;  2AAI B;  3IM6 A;  3OBT A;  5FNX A;  3BAO A;  4I8M A;  4I1B A;  3WO2 A;  3WMU A;  4OWL A;  3H6S E;  5BXS A;  4LO7 C;  1S0D A;  2HWA A;  5DVH A;  4XKI A;  4ZLB B;  2Y9G A;  2RST A;  3OGF A;  1PUM B;  3A23 A;  1CE7 B;  3S8K A;  1OQL B;  3E8L C;  4ION A;  4F34 A;  3OBR A;  1D0H A;  5BQU A;  3VUO A;  1K5U A;  4LO7 B;  1AVW B;  1XG6 A;  4PC4 A;  2KH2 A;  3N0K A;  4EB2 B;  3PUB A;  1K5V A;  4GOV A;  1WBA A;  1HWN B;  4H04 A;  2ESU A;  4GP3 A;  4HR6 C;  4I7I A;  4LO0 C;  1S0F A;  3I29 B;  3BA4 A;  1ISZ A;  4X37 A;  1BFF A;  3CA3 A;  3N7L A;  4G6M A;  1SR4 C;  1YF8 B;  3O4A A;  2VSA A;  3VSF A;  3BAH A;  4YOL A;  1R8O A;  2VUA A;  1WBC A;  9ILB A;  3B9U A;  2QN4 A;  5DUY A;  3AH2 A;  4QKS A;  4CJM A;  4DCK C;  1QXM A;  3CQA A;  4I4X A;  4KC3 A;  4GP0 A;  4OEE A;  1BAR A;  5EC5 A;  2LIQ A;  1EV2 A;  5G00 A;  2VU9 A;  4H9W A;  5BP5 A;  1IRA X;  2WRY A;  3UD9 A;  4R6U B;  5I1B A;  3S8J A;  4ISQ A;  1M16 A;  5D62 A;  2Q3N B;  4KEI A;  3P6I A;  1IHK A;  6I1B A;  2ZQN A;  3CRI A;  4ZKT B;  5E24 E;  1MC9 A;  3AJ6 A;  5D63 A;  1W3G A;  2E4M C;  2FO1 A;  4FGF A;  1TWM A;  2NTD A;  2VXR A;  2F2F A;  1HWM B;  3O3Q A;  4IZX A;  3FJC A;  1S0E A;  3O4B A;  1AVA C;  4I4Q A;  2VXT I;  1BFC A;  3CA0 A;  2NM1 A;  3JRR A;  1T4Q A;  1T9F A;  1EYL A;  2QYI B;  1DIW A;  1JQZ A;  2MC2 A;  3RMX A;  4QBC A;  3V0B A;  3A22 A;  3CA1 A;  4JPZ A;  2YUG A;  4P6A A;  4LO2 A;  4QBV A;  1HKN A;  1G82 A;  3MAL A;  4ZOT A;  1BFB A;  2IWT B;  4XFU A;  2IHO A;  4J2Y A;  1G9B A;  4ISR A;  1EPW A;  4I96 A;  3VWC A;  3RMY A;  4J2X A;  2DRZ A;  4JRA A;  3OJM A;  2D24 A;  3UD7 A;  3PHZ A;  3OJ2 A;  5GAQ A;  2KI4 A;  2KI6 B;  1AVX B;  3C9Z A;  3AH4 A;  2RG9 B;  2WBC A;  3BA7 A;  3UJ0 A;  3VT0 A;  1V6U A;  4EKX B;  1BFG A;  3AKI A;  4A7Z A;  3FJK A;  4JQ0 A;  4DEP A;  2BEB A;  1TWE A;  3IM7 A;  4FVV A;  4GOY A;  3F62 B;  3CA4 A;  3UJ4 A;  2P23 A;  4LO1 C;  3FJB A;  3WIN A;  3H6Q A;  1G9D A;  2D22 A;  4EFR A;  3HMY A;  2LIE A;  3F1R A;  1JLX A;  4QC4 A;  4Z8S B;  4Q9P A;  3EF2 A;  5FZZ A;  4I4U A;  4I4P A;  4G6J A;  3AJ5 A;  1YBI A;  3FJ9 A;  4ZGR B;  4QAL A;  3O4D A;  2R9K B;  1FMZ A;  3Q7X A;  3D7W B;  4JP0 A;  5FZY A;  3RTJ B;  1TFM B;  3BRD A;  5D61 A;  2K43 A;  2NYY A;  1I1E A;  3BAV A;  5B2H A;  3R4S A;  2FFV A;  4IYB A;  5BQU C;  2UUS A;  3N7J A;  3BAG A;  1F31 A;  1HCE A;  4KEK A;  2Q9X A;  2D20 A;  2K4A B;  2AQZ A;  3V0A A;  1YTO A;  3WO3 A;  1P63 A;  3AKG A;  4QKR A;  2Y9X E;  2BEA A;  4I0Y A;  4JAW A;  1N4K A;  1IRP A;  3RTI B;  1E0O A;  2Z49 A;  3CRG A;  3WMV A;  2DRY A;  4I37 A;  1XYF A;  1IIL A;  3FJI A;  2NVH A;  1IOB A;  1WD3 A;  4JKQ A;  4I4R A;  3MPP G;  4HA2 A;  3QYD A;  2VLC A;  2ZQO A;  2GO2 A;  1RY7 A;  3H6R A;  2HWM A;  1NZK A;  2F8X C;  3O44 A;  4I1E A;  3BAD A;  3FJH A;  1AVU A;  4IHZ A;  3AZW A;  2D1Z A;  2HW9 A;  1Z2V A;  2X2S A;  3FJA A;  4WBC A;  31BI A;  3ILA A;  3POK A;  4IY8 A;  5BP5 C;  2Z48 A;  3LTQ A;  2E4M A;  2ERM A;  1QQK A;  3VT1 A;  1DQO A;  3WO4 A;  2D7R A;  4OW4 A;  1V6W A;  4HJJ A;  1GGP B;  2X2T A;  4I4V A;  4G9N A;  1DFQ A;  4J2S A;  5BXR A;  1PWA A;  4X3A A;  1HCD A;  3ZXD A;  4IZE A;  3O4O A;  3VT2 A;  1DFC A;  2F2F C;  1HIB A;  3AZV A;  4AN7 B;  2AFG A;  2XOA A;  3CU1 B;  4X38 A;  1RML A;  1WD4 A;  1ITB A;  3P53 A;  5BOW A;  5F8Y A;  4J2K A;  4P0K A;  1ILR 1;  4IQP A;  3W9T A;  1Z0H A;  1JLY A;  3BA5 A;  4LO3 A;  3ZC8 A;  3VEQ A;  4X39 A;  5F90 A;  2D7I A;  4USP A;  4LO2 C;  1M2T B;  2M49 A;  1TOO A;  3HSM A;  3O4C A;  1HWO B;  3CAH A;  3OJV A;  1HWP B;  2ZR1 B;  4A7K A;  3NBE A;  3V0B B;  3BRG C;  1FGA A;  1MD6 A;  3NBN A;  4OWK A;  1W3F A;  1XZZ A;  2AXM A;  3O49 A;  3HBW A;  4J23 B;  5BXP A;  3RSJ A;  4IY9 A;  3WA1 A;  2FDB M;  2MIB A;  2I1B A;  2D44 A;  4QD2 C;  3SNV A;  4DEN A;  3I2A A;  3OGG A;  1ONK B;  1PUU B;  4L4H A;  3NBD A;  1JT7 A;  4Z9W B;  3UD8 A;  3WIN C;  4XFS A;  1VCL A;  41BI A;  4QD2 B;  3FJF A;  3ZX7 A;  1PC8 B; 
#chains in the Genus database with same CATH topology
 5CFT A;  3HJ4 A;  1ZQY A;  5TZV A;  3P6J A;  1S0G A;  4LO0 A;  1MIW A;  4A7Y A;  1NUN A;  1J0S A;  4F5N A;  3R4U A;  5J2A A;  5HPZ A;  4PGY A;  3FUQ A;  2D23 A;  3FUO A;  8ICV A;  3B0X A;  1TFW A;  3IIR A;  4I2I A;  4P0J A;  1TP0 A;  1DLL A;  1A8D A;  1FV3 A;  4K8V A;  8ICB A;  3AKF A;  3HX0 A;  2O1P A;  3LLP A;  4OEG A;  4RWN A;  4AN6 A;  1DQG A;  2ET2 A;  1AXM A;  1R8N A;  1ISW A;  4XFT A;  2M2T A;  4F5O A;  4M9G A;  2FMS A;  1IJT A;  2RQ9 A;  4GAF A;  4ZFY B;  2VSE A;  4PH5 A;  3FGM A;  4EFP A;  1TIE A;  1ZQM A;  3QR5 A;  1ISV A;  4LZD A;  4WC6 A;  3NWI A;  3WFP A;  3CA5 A;  4X5V A;  1CVS A;  4KLS A;  3C5F A;  1G9C A;  4MF8 A;  5HRH A;  9ICT A;  4P0L A;  1XHB A;  5CFU A;  3HWT A;  4LEZ A;  9ICB A;  7I1B A;  4KLQ A;  4I4O A;  3BAO A;  2ZHB A;  4I8M A;  4OAI Z;  2HWA A;  5DVH A;  2M2V A;  4PPX A;  1ZQQ A;  1KDH A;  1K5U A;  1AVW B;  3N0K A;  3PUB A;  4WOY A;  2PBE A;  1WBA A;  4H04 A;  4UB4 A;  2ESU A;  4GP3 A;  4HR6 C;  1ISZ A;  4X37 A;  3CA3 A;  3N7L A;  4FHW A;  2VSA A;  9ILB A;  2HHP A;  3B9U A;  2QN4 A;  4RT3 A;  7ICI A;  3AH2 A;  2O5A A;  3OUY B;  4CJM A;  3CQA A;  4OEE A;  9ICE A;  5G00 A;  2I9G A;  4TUS A;  4H9W A;  8ICK A;  1IRA X;  4R6U B;  5I1B A;  1M16 A;  4P4O A;  4KEI A;  2W9M A;  4M47 A;  6I1B A;  4ZKT B;  1W3G A;  2E4M C;  3O3Q A;  2IHM A;  4I4Q A;  5CR0 A;  3CA0 A;  4GXJ A;  3RH6 A;  3JZ0 A;  1DIW A;  1MIY A;  1VFG A;  4P6A A;  5III A;  4LO2 A;  4QBV A;  4ZOT A;  4XA5 A;  4J2Y A;  3RJG A;  1EPW A;  3VWC A;  2DRZ A;  8ICU A;  4NLZ A;  1TFY A;  2D24 A;  1TVA A;  3PHZ A;  1PX5 A;  1UEV A;  5DDM A;  2B51 A;  1AVX B;  3BA7 A;  3UJ0 A;  3PNC A;  1BFG A;  5J0X A;  3UPS A;  4GOY A;  3UJ4 A;  4LO1 C;  9ICN A;  5CWR A;  3UPQ A;  3HMY A;  5FZZ A;  1YBI A;  1F5A A;  4M9N A;  4QAL A;  4KM5 A;  4I2H A;  4FHP A;  4X4S A;  4UB5 A;  1TFM B;  4EV6 A;  3OVB A;  7ICM A;  1BPD A;  2DR5 A;  7ICG A;  3BAV A;  4K97 A;  2UUS A;  2D20 A;  4UAZ A;  3V0A A;  3C66 A;  7ICO A;  1GPJ A;  4O5E A;  5J2B A;  4R65 A;  5CA7 A;  1MQ2 A;  3CRG A;  5J2C A;  2NVH A;  1IOB A;  3RJJ A;  1WD3 A;  4JKQ A;  3MPP G;  2ISO A;  4WQL A;  3OGU A;  2ZQO A;  7ICK A;  5IIM A;  1RY7 A;  2F8X C;  5IIK A;  3BAD A;  4RWP A;  3AZW A;  2D1Z A;  1ZQW A;  1JQR A;  3POK A;  4OAG A;  4IY8 A;  3ERC C;  4RQ0 A;  3LTQ A;  3VT1 A;  2D7R A;  1V6W A;  4WC0 A;  4XQ7 A;  4X4V A;  4F5Q A;  4LEY A;  3RJE A;  4I28 A;  3O4O A;  3VT2 A;  3WFS C;  1DFC A;  4O6A A;  1HIB A;  4KLG A;  1VJ7 A;  5IIL A;  3CU1 B;  1WD4 A;  9ICP A;  1ILR 1;  3ZC8 A;  3VEQ A;  2D7I A;  1M2T B;  1TOO A;  3HSM A;  8ICR A;  2ZR1 B;  8ICX A;  4YMM A;  4GXK A;  1FGA A;  1MD6 A;  4X0A A;  9ICM A;  3O49 A;  4RWQ A;  3WA1 A;  3PML A;  4FO6 A;  2FDB M;  4Z6D A;  4QD2 C;  4DEN A;  7ICR A;  3C2M A;  5J0O A;  5DBA A;  4Z9W B;  3WIN C;  4XFS A;  3JPT A;  2ZH9 A;  4QO3 A;  7ICS A;  1ZQL A;  5DZU A;  1JT3 A;  3FJJ A;  1RG8 A;  5DSS B;  3ZC9 A;  1RZO B;  3FJE A;  3OVS A;  4MF2 A;  3RJH A;  1FQ9 A;  4USO A;  3K1X A;  2DS0 A;  4TUQ A;  2DRB A;  2NP0 A;  4TLP A;  4FH5 A;  8ICC A;  4JWM A;  4RPZ A;  5DB6 A;  3H38 A;  9ICR A;  9ICF A;  1ZJN A;  4I6I A;  1R8B A;  1V6V A;  3BAQ A;  4RQ1 A;  4ZBV B;  1ZQR A;  4X4U A;  1S0L A;  1Q1U A;  1FWV A;  3FJD A;  5HHH A;  1ZQE A;  2FMP A;  1IT0 A;  4ATB B;  1TTU A;  4OAF A;  3H6R B;  3HAL A;  1S0B A;  4I2J A;  4WC7 A;  1FN0 A;  5CFS A;  3T8S A;  4NY8 A;  2MLL B;  2ISP A;  4D8H A;  2L5X A;  1BAS A;  3JUT A;  1G9A A;  4QZ9 A;  3NJ5 A;  4N7R A;  1JT4 A;  4AT9 B;  4EFQ A;  2FCL A;  4LT6 A;  3V79 C;  1HUO A;  5FNW A;  1JY0 A;  2D43 A;  3MCR A;  4RQ3 A;  1FWU A;  1HUZ A;  1JN3 A;  4F5R A;  1Q03 A;  3FFZ A;  4LO1 A;  1YXW A;  3BB2 A;  8I1B A;  8ICY A;  3BX1 C;  3GDX A;  9ICJ A;  3UDA A;  2HN2 A;  3WFQ E;  2PFQ A;  4PHD A;  1BPX A;  9ICQ A;  3WMU A;  4OWL A;  2DR9 A;  2ZH1 A;  4LO7 C;  2Y9G A;  4KLF A;  2RST A;  3OGF A;  1PUM B;  1CE7 B;  3S8K A;  3E8L C;  4ION A;  4F34 A;  4NM2 A;  1ZQT A;  4UBC A;  4R63 A;  4PC4 A;  4KB6 A;  4M9H A;  4XJE A;  4H75 A;  1HWN B;  1TV9 A;  1R89 A;  1S0F A;  3BA4 A;  8ICP A;  4RQ5 A;  7ICE A;  1SR4 C;  3VSF A;  3ISD A;  8ICT A;  4YOL A;  9ICW A;  4QKS A;  1NOM A;  2M2U A;  1R8A A;  1ZQU A;  1QXM A;  1ZJM A;  4GP0 A;  4TUR A;  5DB8 A;  2ZH4 A;  2WRY A;  9ICH A;  4I2D A;  7ICQ A;  2P66 A;  3JPO A;  3S8J A;  2BCR A;  3P6I A;  4PGQ A;  5B3P A;  2ZQN A;  5E24 E;  3AJ6 A;  5D63 A;  4FGF A;  1HWM B;  4F5P A;  1S0E A;  2BCU A;  1AVA C;  1UEU A;  2RFF A;  4OAH A;  2PXI A;  4FHY A;  1T4Q A;  4K9A A;  1T9F A;  1EYL A;  8ICG A;  3V0B A;  1ZQK A;  3CA1 A;  1HKN A;  4X4T A;  1G82 A;  4JLZ A;  2IWT B;  4KLE A;  4IQT A;  4J2X A;  4JRA A;  2PFN A;  9ICU A;  3RH5 A;  3UQ2 A;  2PFO A;  3OJ2 A;  4NM1 A;  2KI4 A;  4MZH A;  1XSP A;  4JWN A;  1V6U A;  3TFR A;  4A7Z A;  4M04 A;  9ICS A;  2BEB A;  1TWE A;  3JYY A;  3C5G A;  3F62 B;  2P23 A;  3WIN A;  2D22 A;  5HRL A;  3MDC A;  4WC2 A;  5HR9 A;  3H3A A;  2LIE A;  4WCW A;  3F1R A;  4Z8S B;  4I4U A;  8ICO A;  3OWG A;  3O4D A;  2R9K B;  3Q7X A;  3ER8 C;  3RTJ B;  3OVA A;  3JPP A;  5HRF A;  3BRD A;  5D61 A;  5B2H A;  2FFV A;  7ICV A;  5J2F A;  1HCE A;  1XSL A;  4IG8 A;  4KLL A;  2AQZ A;  1P63 A;  3AKG A;  4X4O A;  4I0Y A;  4JAW A;  1N4K A;  4O67 A;  3RTI B;  4QZD A;  2DRY A;  4K96 A;  3K75 D;  9ICG A;  4HA2 A;  4RQ7 A;  3QYD A;  3RH4 A;  2VLC A;  5IIJ A;  4PGX A;  2X2S A;  3ILA A;  4M9J A;  2BE3 A;  5BP5 C;  2Z48 A;  4O68 A;  2ERM A;  4QZI A;  1GGP B;  2X2T A;  4I4V A;  4E7X A;  1PWA A;  2NS2 A;  3ZXD A;  8ICH A;  3WFO A;  4AN7 B;  5DED A;  4X38 A;  4K4I A;  4XQ8 A;  1RML A;  5BOW A;  5HHI A;  5F8Y A;  4KLU A;  4J2K A;  4P0K A;  3W9T A;  4UD4 A;  8ICI A;  3CK6 A;  4X39 A;  5F90 A;  5J0U A;  4PHA A;  2M49 A;  4RQ8 A;  1HWO B;  4K98 A;  3CAH A;  3MDA A;  3JPR A;  4QZA A;  1V4A A;  3BRG C;  1W3F A;  4WC1 A;  4UD5 A;  3RSJ A;  7ICU A;  4YN4 A;  4YMN A;  2MIB A;  2I1B A;  4KLJ A;  1ZQH A;  3LK9 A;  3OGG A;  2Q66 A;  1ONK B;  3AQK A;  1ZQN A;  3NBD A;  1JT7 A;  7ICF A;  3ZX7 A;  1PC8 B;  2P39 A;  5HC9 A;  2ZH8 A;  4EEB A;  5BOM A;  3C2L A;  1ZQB A;  1SR4 A;  3A21 A;  1DZD A;  4NKT A;  3KMV A;  1I1B A;  1UPS A;  3IM5 A;  4I4S A;  5HRG A;  2B4V A;  1RPL A;  1ZQP A;  5CHE A;  4K4H A;  2J3P A;  2Y9F A;  1KEJ A;  2BFH A;  4AT8 A;  3BRF A;  2HZ9 A;  1BLA A;  5JMC A;  3AKH A;  1II4 A;  1ZQX A;  5FZU A;  5HRD A;  4QZC A;  3V0A B;  5HRB A;  2NRK A;  4I2B A;  9ICO A;  4I4Y A;  9ICA A;  4L4I A;  4OEF A;  3N7M A;  1FMM S;  1YYN A;  4I2A A;  4LO8 B;  5F8W A;  1EVT A;  4FHV A;  5DB7 A;  1KNY A;  8ICZ A;  5JLV A;  5DEC A;  3NBC A;  4WC4 A;  4NLK A;  3PME A;  2GA9 D;  1ZQS A;  4O5C A;  2ID1 A;  2FGF A;  4KLI A;  4UY4 A;  1FA0 A;  5J0S A;  3NVO A;  2BBJ A;  2BCQ A;  2NZ9 A;  3HJ1 A;  4AT7 A;  1BA7 A;  2KLL A;  1ZQG A;  1FV2 A;  3AQM A;  3BAU A;  4I27 A;  2KKI A;  4K99 A;  1BPZ A;  5F8S A;  4YMO A;  4I2C A;  4D0Z A;  4O9M A;  3HOM A;  3JPQ A;  1S0C A;  4ZA3 B;  3TC2 A;  4II0 A;  4AT7 B;  3AUO A;  3PG0 A;  4KEJ A;  8ICA A;  8ICW A;  3WFR E;  4LZG A;  3OBT A;  2ZH6 A;  5HRI A;  4WH5 A;  4I1B A;  4R66 A;  3WO2 A;  3H6S E;  5BXS A;  1S0D A;  4XKI A;  4ZLB B;  5IIO A;  1ZQA A;  1OQL B;  3OBR A;  7ICH A;  1D0H A;  4RPY A;  4KLT A;  3RJK A;  3VUO A;  4UB2 A;  4HX0 A;  5BOL A;  5JTG A;  4EB2 B;  1NO5 A;  1BFF A;  1YF8 B;  3O4A A;  3BAH A;  1R8O A;  2VUA A;  1WBC A;  4NXZ A;  5DUY A;  4KLH A;  4DCK C;  4YD1 A;  4I4X A;  1BAR A;  1EV2 A;  4RQ2 A;  8ICL A;  5BP5 A;  1JAJ A;  4ISQ A;  2Q3N B;  4EP7 A;  2BPC A;  1IHK A;  4RQ6 A;  2FO1 A;  1TWM A;  2VXR A;  4IZX A;  3FJC A;  3AU2 A;  4M0A A;  3O4B A;  1ZQF A;  8ICN A;  1Q79 A;  2VXT I;  2PFP A;  2NM1 A;  4NXT A;  8ICJ A;  1JQZ A;  5J2G A;  2MC2 A;  3RMX A;  4QBC A;  4JPZ A;  2YUG A;  4Z6E A;  3MAL A;  1BFB A;  2ZH7 A;  4XFU A;  1G9B A;  4I96 A;  1Q78 A;  3RMY A;  3OJM A;  3AU6 A;  3HW8 A;  3JPN A;  8ICQ A;  3UD7 A;  5GAQ A;  3AH4 A;  2KI6 B;  2IUB A;  3C9Z A;  4EKX B;  4JQ0 A;  4DEP A;  2FMQ A;  4KLM A;  4UBB A;  9ICC A;  3IM7 A;  2BPG A;  4NXX A;  3FJB A;  1G9D A;  4EFR A;  1JLX A;  4QC4 A;  3EF2 A;  4I4P A;  4KLO A;  3FJ9 A;  4JP0 A;  3ER9 B;  2K43 A;  1I1E A;  4P4M A;  5BQU C;  3N7J A;  3BAG A;  5J2K A;  2Q9X A;  3AQN A;  2BEA A;  4WBY A;  1IRP A;  5J0R A;  5J0Q A;  4WQK A;  1E0O A;  3MGI A;  2Z49 A;  4I37 A;  3FJI A;  4DOB A;  3OV7 A;  5HRK A;  3V7L A;  2GO2 A;  2HWM A;  5J0Y A;  3O44 A;  8ICM A;  3FJH A;  1AVU A;  3NKU A;  3FJA A;  9ICK A;  4WBC A;  5D49 A;  1BPY A;  4DOA A;  4G9N A;  4X0B A;  4J2S A;  3UQ0 A;  4UB3 A;  3MBY A;  4X3A A;  1HCD A;  4UB1 A;  4TUP A;  2F2F C;  1UET A;  4QZB A;  4EBJ A;  4MFF A;  2AFG A;  3P53 A;  1ITB A;  3UXO A;  1Z0H A;  1JLY A;  4QZE A;  1YLQ A;  2ZH2 A;  3O4C A;  4I29 A;  2BCS A;  4P2H A;  3NBE A;  3V0B B;  4X4P A;  3NBN A;  1XZZ A;  2AXM A;  3V7K A;  3HBW A;  4J23 B;  1ZQI A;  5B3Q A;  2ZH5 A;  4LVS A;  2GWS A;  41BI A;  4QD2 B;  3FJF A;  4E8F A;  4K9B A;  4QZH A;  5CP2 A;  5J2D A;  3AQL A;  4EBK A;  4NLN A;  4Q91 A;  5J2E A;  3LQC B;  4GXI A;  4I0U A;  3AH1 A;  3OUY A;  1BLD A;  1KNM A;  1Z4S A;  1W3A A;  4END A;  4F83 A;  4WC3 A;  4IQW A;  3A07 A;  2Y9W C;  1L2H A;  2ZHA A;  4WBZ A;  5HRE A;  5J2I A;  5EHA A;  2BCV A;  5BXT A;  4X4R A;  4JKX B;  1ISX A;  4ZFW B;  21BI A;  1AF9 A;  5BVP I;  3CA6 A;  4OWJ A;  5CB1 A;  4I2S A;  4EEE B;  5J2H A;  4I3N A;  3HN1 A;  2DVI A;  4JLX A;  1Q04 A;  3O5W B;  4Q9G A;  4DOC A;  4UAW A;  3BTA A;  4IQV A;  3TFS A;  4MZF B;  3V72 A;  2VAN A;  4G1R A;  5CHG A;  1SZ6 B;  4KBB A;  4MFA A;  3N7K A;  3Q7W A;  1QQL A;  2FFU A;  3Q7Y A;  3CRH A;  4MKP A;  4RPX A;  4ZFU B;  5EOZ A;  5CJ7 A;  1DZC A;  1ABR B;  1MIV A;  3VSZ A;  4O5K A;  4D0T A;  1PZZ A;  4NKU A;  4GAI A;  1DJS B;  4QZ8 A;  1ISY A;  4XUS A;  4OUJ A;  3FJ8 A;  5J29 A;  4LO3 C;  3ZXG A;  1V6X A;  2K8R A;  1AFC A;  8ICF A;  2DRE A;  1JTC A;  3I2X A;  3IAG C;  1JT5 A;  4G9M A;  5EG6 C;  2GZB A;  2AAI B;  3IM6 A;  5FNX A;  4Z6F A;  3V7J A;  5DKW A;  7ICT A;  2DR8 A;  4MZG B;  4R64 A;  4FHX A;  4EED A;  3A23 A;  2BBH A;  5D46 A;  5BQU A;  4YCX A;  4UAY A;  4LO7 B;  3C2K A;  1XG6 A;  2KH2 A;  5J0W A;  1K5V A;  4GOV A;  4E80 A;  4I7I A;  4LO0 C;  3I29 B;  4G6M A;  3RJF A;  5DB9 A;  4RQ4 A;  5F2V O;  7ICP A;  4KC3 A;  9ICL A;  5EC5 A;  4AT8 B;  2LIQ A;  4RWO A;  2VU9 A;  5DDY A;  3UD9 A;  5D62 A;  4FH3 A;  4PHP A;  4X4N A;  4K4G A;  4WC5 A;  4FO1 A;  3CRI A;  1MC9 A;  3PMN A;  2NTD A;  2F2F A;  7ICL A;  1BFC A;  1MQ3 A;  3JRR A;  2QYI B;  5DBC A;  1ZQO A;  3A22 A;  2DRA A;  8ICS A;  9ICV A;  2IHO A;  4ISR A;  5BPC A;  3HIY A;  4MFC A;  3H39 A;  5J2J A;  5IIN A;  4I2F A;  5D4B A;  4M5D A;  2RG9 B;  2WBC A;  3VT0 A;  3AKI A;  3FJK A;  9ICI A;  4M9L A;  4YD2 A;  4FVV A;  3CA4 A;  2M2W A;  3RJI A;  3H6Q A;  9ICX A;  3JCF A;  4Q9P A;  4G6J A;  3AJ5 A;  1ZQJ A;  4ZGR B;  3MGH A;  1FMZ A;  3D7W B;  3K7D A;  5J0P A;  5FZY A;  1ZQV A;  1RZT A;  2HN1 A;  3H37 A;  2NYY A;  3R4S A;  3UXP A;  4IYB A;  1WOT A;  4O69 A;  4Z6C A;  1F31 A;  4KEK A;  1BPB A;  2K4A B;  4RT2 A;  1YTO A;  3WO3 A;  4QKR A;  2Y9X E;  4NXU A;  3ISC A;  3WMV A;  1ZQZ A;  1ZQC A;  2BPF A;  3NYB A;  1XYF A;  4EGW A;  1IIL A;  2GAF D;  4I4R A;  4LEW A;  4ATB A;  4P4P A;  3H6R A;  1NZK A;  3ISB A;  4I2E A;  2EWR A;  4I1E A;  4IHZ A;  2HW9 A;  1Z2V A;  4S3N A;  8ICE A;  31BI A;  4QZG A;  3JPS A;  2E4M A;  1ZQD A;  1QQK A;  2B56 A;  1DQO A;  3WO4 A;  4OW4 A;  5J0T A;  4HJJ A;  7ICJ A;  1DFQ A;  4M2Y A;  5BXR A;  4AT9 A;  4IZE A;  5DBB A;  4I2G A;  3AZV A;  4X4Q A;  4KLD A;  2XOA A;  1XSN A;  4IQP A;  4LEV A;  1JMS A;  3BA5 A;  4LO3 A;  3C18 A;  4USP A;  4LO2 C;  3OJV A;  4NXV A;  1HWP B;  1R8C A;  4XRH A;  4NXW A;  4A7K A;  3L9D A;  1OU5 A;  7ICN A;  4OWK A;  4DO9 A;  3B0Y A;  5BXP A;  4IY9 A;  2D44 A;  4PHE A;  3SNV A;  3I2A A;  2ZH3 A;  1PUU B;  4L4H A;  3UXN A;  3UD8 A;  2DR7 A;  1VCL A;  4IQU A;  1BPE A;  4QZF A; 
#chains in the Genus database with same CATH homology
 4QO3 A;  4K9B A;  2P39 A;  5CFT A;  5DZU A;  3P6J A;  1S0G A;  1JT3 A;  4LO0 A;  3FJJ A;  1RG8 A;  1SR4 A;  5DSS B;  3A21 A;  3ZC9 A;  4Q91 A;  3KMV A;  1I1B A;  1UPS A;  1DZD A;  3IM5 A;  4I4S A;  4A7Y A;  1NUN A;  3AH1 A;  1RZO B;  2B4V A;  3FJE A;  1BLD A;  1KNM A;  5CHE A;  1Z4S A;  1W3A A;  4END A;  4F83 A;  2J3P A;  2Y9F A;  2BFH A;  1J0S A;  3R4U A;  5HPZ A;  1FQ9 A;  4USO A;  3BRF A;  2HZ9 A;  3A07 A;  3FUQ A;  2Y9W C;  1BLA A;  1L2H A;  3K1X A;  5JMC A;  3AKH A;  2D23 A;  2DS0 A;  3FUO A;  1II4 A;  5EHA A;  2NP0 A;  4TLP A;  5FZU A;  5BXT A;  4JKX B;  3IIR A;  1ISX A;  4ZFW B;  4P0J A;  3V0A B;  1TP0 A;  1DLL A;  1A8D A;  21BI A;  4I4Y A;  1AF9 A;  5BVP I;  1FV3 A;  4I6I A;  3CA6 A;  4K8V A;  4OWJ A;  1V6V A;  3AKF A;  4L4I A;  4OEF A;  3N7M A;  3LLP A;  1FMM S;  1YYN A;  4I2S A;  4OEG A;  4EEE B;  3BAQ A;  4ZBV B;  4AN6 A;  1DQG A;  4I3N A;  1S0L A;  3HN1 A;  1Q1U A;  1FWV A;  2ET2 A;  1Q04 A;  3FJD A;  4LO8 B;  4JLX A;  3O5W B;  1AXM A;  1R8N A;  4Q9G A;  5F8W A;  1EVT A;  1ISW A;  3BTA A;  4XFT A;  4MZF B;  5JLV A;  1IT0 A;  1TTU A;  3NBC A;  4G1R A;  4OAF A;  1SZ6 B;  3H6R B;  4KBB A;  3HAL A;  1IJT A;  3N7K A;  2RQ9 A;  3Q7W A;  1QQL A;  2FFU A;  3PME A;  4GAF A;  2GA9 D;  4ZFY B;  2VSE A;  1S0B A;  3FGM A;  2FGF A;  3Q7Y A;  3CRH A;  4EFP A;  1TIE A;  4MKP A;  1FN0 A;  4UY4 A;  5CFS A;  3QR5 A;  1ISV A;  3T8S A;  4ZFU B;  2NZ9 A;  1BA7 A;  2MLL B;  3CA5 A;  4D8H A;  2L5X A;  1BAS A;  1CVS A;  2KLL A;  1DZC A;  1ABR B;  3JUT A;  1G9A A;  1FV2 A;  3VSZ A;  4D0T A;  1PZZ A;  3BAU A;  3NJ5 A;  4N7R A;  4GAI A;  1JT4 A;  2KKI A;  1G9C A;  4K99 A;  1DJS B;  4EFQ A;  2FCL A;  1ISY A;  5F8S A;  4OUJ A;  4P0L A;  3FJ8 A;  3V79 C;  5FNW A;  4D0Z A;  1JY0 A;  2D43 A;  3MCR A;  1FWU A;  3HOM A;  4LO3 C;  1XHB A;  5CFU A;  3ZXG A;  1S0C A;  1V6X A;  4ZA3 B;  2K8R A;  4II0 A;  1AFC A;  3TC2 A;  1Q03 A;  3FFZ A;  4LO1 A;  1YXW A;  2DRE A;  1JTC A;  3I2X A;  3PG0 A;  3BB2 A;  8I1B A;  1JT5 A;  4KEJ A;  3IAG C;  4LEZ A;  4G9M A;  5EG6 C;  3BX1 C;  7I1B A;  3UDA A;  4I4O A;  2GZB A;  2AAI B;  3IM6 A;  3OBT A;  5FNX A;  3BAO A;  4I8M A;  4WH5 A;  4I1B A;  4OAI Z;  3WO2 A;  3WMU A;  4OWL A;  4MZG B;  3H6S E;  5BXS A;  4LO7 C;  1S0D A;  2HWA A;  5DVH A;  4XKI A;  4ZLB B;  2Y9G A;  2RST A;  3OGF A;  1PUM B;  3A23 A;  1CE7 B;  3S8K A;  1OQL B;  3E8L C;  4ION A;  4F34 A;  3OBR A;  1D0H A;  5BQU A;  3VUO A;  1K5U A;  4HX0 A;  4LO7 B;  1AVW B;  1XG6 A;  4PC4 A;  2KH2 A;  3N0K A;  4EB2 B;  4KB6 A;  3PUB A;  4WOY A;  1K5V A;  4XJE A;  4GOV A;  4H75 A;  1WBA A;  1HWN B;  4H04 A;  2ESU A;  4GP3 A;  4HR6 C;  4I7I A;  4LO0 C;  1S0F A;  3I29 B;  3BA4 A;  1ISZ A;  4X37 A;  1BFF A;  3CA3 A;  3N7L A;  4G6M A;  1SR4 C;  1YF8 B;  3O4A A;  2VSA A;  3VSF A;  3BAH A;  4YOL A;  1R8O A;  2VUA A;  1WBC A;  9ILB A;  3B9U A;  2QN4 A;  5DUY A;  3AH2 A;  4QKS A;  4CJM A;  4DCK C;  1QXM A;  3CQA A;  4I4X A;  4KC3 A;  4GP0 A;  4OEE A;  1BAR A;  5EC5 A;  2LIQ A;  1EV2 A;  5G00 A;  2VU9 A;  4H9W A;  5BP5 A;  1IRA X;  2WRY A;  3UD9 A;  4R6U B;  5I1B A;  3S8J A;  4ISQ A;  1M16 A;  5D62 A;  2Q3N B;  4KEI A;  3P6I A;  1IHK A;  6I1B A;  5B3P A;  4FO1 A;  2ZQN A;  3CRI A;  4ZKT B;  5E24 E;  1MC9 A;  3AJ6 A;  5D63 A;  1W3G A;  2E4M C;  2FO1 A;  4FGF A;  1TWM A;  2NTD A;  2VXR A;  2F2F A;  1HWM B;  3O3Q A;  4IZX A;  3FJC A;  1S0E A;  3O4B A;  1AVA C;  4I4Q A;  2VXT I;  1BFC A;  4OAH A;  3CA0 A;  2NM1 A;  3JRR A;  1T4Q A;  4NXT A;  4K9A A;  1T9F A;  1EYL A;  2QYI B;  1DIW A;  1JQZ A;  2MC2 A;  3RMX A;  4QBC A;  3V0B A;  3A22 A;  3CA1 A;  4JPZ A;  2YUG A;  4P6A A;  4LO2 A;  4QBV A;  1HKN A;  1G82 A;  4JLZ A;  3MAL A;  4ZOT A;  1BFB A;  2IWT B;  4XFU A;  2IHO A;  4J2Y A;  1G9B A;  4ISR A;  1EPW A;  4I96 A;  3VWC A;  3RMY A;  4J2X A;  2DRZ A;  4JRA A;  3OJM A;  2D24 A;  3UD7 A;  3PHZ A;  3OJ2 A;  5GAQ A;  2KI4 A;  2KI6 B;  1AVX B;  3C9Z A;  3AH4 A;  2RG9 B;  2WBC A;  3BA7 A;  4MZH A;  3UJ0 A;  1V6U A;  3VT0 A;  4EKX B;  1BFG A;  3AKI A;  4A7Z A;  3FJK A;  4JQ0 A;  4DEP A;  2BEB A;  1TWE A;  3IM7 A;  4FVV A;  4GOY A;  3F62 B;  3CA4 A;  3UJ4 A;  2P23 A;  4LO1 C;  4NXX A;  3FJB A;  3WIN A;  3H6Q A;  1G9D A;  2D22 A;  4EFR A;  3HMY A;  2LIE A;  3F1R A;  1JLX A;  4QC4 A;  4Z8S B;  4Q9P A;  3EF2 A;  5FZZ A;  4I4U A;  4I4P A;  4G6J A;  3AJ5 A;  1YBI A;  3FJ9 A;  4ZGR B;  3OWG A;  4QAL A;  3O4D A;  4KM5 A;  2R9K B;  1FMZ A;  3Q7X A;  3D7W B;  3K7D A;  4JP0 A;  5FZY A;  3RTJ B;  3ER8 C;  1TFM B;  3BRD A;  5D61 A;  3ER9 B;  2K43 A;  2NYY A;  1I1E A;  3BAV A;  5B2H A;  4K97 A;  3R4S A;  2FFV A;  4IYB A;  5BQU C;  2UUS A;  3N7J A;  4O69 A;  3BAG A;  1F31 A;  1HCE A;  4KEK A;  2Q9X A;  2D20 A;  2K4A B;  2AQZ A;  3V0A A;  1YTO A;  3WO3 A;  1P63 A;  1GPJ A;  3AKG A;  4QKR A;  2Y9X E;  4NXU A;  2BEA A;  4I0Y A;  4JAW A;  1N4K A;  1IRP A;  4O67 A;  3RTI B;  4WQK A;  1E0O A;  2Z49 A;  3CRG A;  3WMV A;  2DRY A;  4I37 A;  1XYF A;  1IIL A;  3FJI A;  4K96 A;  2GAF D;  2NVH A;  1IOB A;  2B51 A;  1WD3 A;  4JKQ A;  4I4R A;  3MPP G;  4HA2 A;  4LEW A;  4WQL A;  3QYD A;  2VLC A;  2ZQO A;  2GO2 A;  1RY7 A;  3H6R A;  2HWM A;  1NZK A;  2F8X C;  3O44 A;  2EWR A;  4I1E A;  3BAD A;  3FJH A;  1AVU A;  4IHZ A;  3AZW A;  2D1Z A;  3NKU A;  2HW9 A;  1Z2V A;  2X2S A;  3FJA A;  4WBC A;  31BI A;  3ILA A;  3POK A;  4OAG A;  4IY8 A;  3ERC C;  5BP5 C;  2Z48 A;  3LTQ A;  4O68 A;  2E4M A;  2ERM A;  1QQK A;  3VT1 A;  2B56 A;  1DQO A;  3WO4 A;  2D7R A;  4OW4 A;  1V6W A;  4HJJ A;  1GGP B;  2X2T A;  4I4V A;  4G9N A;  1DFQ A;  4J2S A;  5BXR A;  4LEY A;  1PWA A;  2NS2 A;  4X3A A;  1HCD A;  3ZXD A;  4IZE A;  3O4O A;  3VT2 A;  1DFC A;  4O6A A;  2F2F C;  1HIB A;  3AZV A;  4AN7 B;  2AFG A;  2XOA A;  3CU1 B;  4X38 A;  1RML A;  1WD4 A;  1ITB A;  3P53 A;  5BOW A;  5F8Y A;  4J2K A;  4P0K A;  1ILR 1;  4IQP A;  3W9T A;  1Z0H A;  1JLY A;  3BA5 A;  4LO3 A;  4LEV A;  3ZC8 A;  3VEQ A;  4X39 A;  5F90 A;  2D7I A;  4USP A;  4LO2 C;  1M2T B;  2M49 A;  1TOO A;  3HSM A;  3O4C A;  1HWO B;  4K98 A;  3CAH A;  3OJV A;  4NXV A;  1HWP B;  2ZR1 B;  4NXW A;  4A7K A;  3NBE A;  3V0B B;  3BRG C;  1FGA A;  1MD6 A;  3NBN A;  4OWK A;  1W3F A;  1XZZ A;  2AXM A;  3O49 A;  3HBW A;  4J23 B;  5BXP A;  3RSJ A;  4IY9 A;  3WA1 A;  2FDB M;  2MIB A;  2I1B A;  2D44 A;  4QD2 C;  3SNV A;  4DEN A;  3I2A A;  5B3Q A;  3OGG A;  1ONK B;  1PUU B;  4L4H A;  3NBD A;  1JT7 A;  4Z9W B;  3UD8 A;  3WIN C;  4XFS A;  1VCL A;  41BI A;  4QD2 B;  3FJF A;  3ZX7 A;  1PC8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...