2IHOA

Crystal structure of moa, a lectin from the mushroom marasmius oreades in complex with the trisaccharide gal(1,3)gal(1,4)glcnac
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
292
structure length
292
Chain Sequence
b'SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Crystal structure of the marasmius oreades mushroom lectin in complex with a xenotransplantation epitope.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Sugar binding protein
total genus 87
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ihoA01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ihoA02
5FZUA 1V6XA 2KLLA 3ILAA 3H6RB 2NP0A 3RTJB 4I4PA 3K1XA 4Q9GA 5BXRA 3BX1C 2E4MC 3CAHA 3AKIA 1AFCA 2AXMA 3FJDA 3O49A 3PMEA 1DFCA 1PUUB 4HJJA 3VWCA 3A07A 4DCKC 2D22A 2VLCA 3CRIA 3H6QA 4ZOTA 3AJ6A 2M49A 2VXRA 4I4YA 4QD2B 3CQAA 4H9WA 1A8DA 3FJFA 3BAUA 1ONKB 3OJ2A 4LO0A 2F2FC 3FJ9A 2IWTB 1F31A 3FFZA 5D62A 2D20A 2YUGA 2Z49A 3PHZA 2F8XC 4KEJA 1IILA 1IOBA 4ENDA 3RMYA 1BFGA 4F83A 1FN0A 2FFVA 2AAIB 4LO3C 1VCLA 2NYYA 1JT4A 2AQZA 3BRDA 4PC4A 2QN4A 3BAOA 4G6JA 2NTDA 4J23B 2HWMA 3E8LC 4L4IA 3FUQA 5EC5A 21BIA 1WBAA 3CA3A 2D7RA 2VXTI 1EPWA 1BARA 2ZR1B 4I4RA 4GP3A 1T9FA 2ERMA 1YXWA 4IZXA 1DZDA 1QQLA 1R8OA 3FUOA 1HWPB 4I8MA 4JKXB 3RTIB 3FJKA 1G82A 3B9UA 3MALA 2BEAA 2D7IA 4IONA 1Z4SA 3N0KA 3IM5A 1TOOA 1ITBA 5BXSA 4ISRA 3UJ0A 1RZOB 5HPZA 4I2SA 1FWUA 3S8KA 2Y9GA 3BAGA 1BFCA 1ISXA 3Q7WA 1PZZA 1L2HA 1FV3A 1CE7B 4D8HA 1JTCA 1SR4C 4JKQA 1G9DA 2RSTA 4HA2A 3N7MA 4WBCA 3VT2A 3FGMA 1WD4A 2K8RA 4TLPA 3O5WB 4G9NA 4IY8A 1NZKA 3O4DA 1XHBA 1Q1UA 3UD8A 3RSJA 2VSAA 1G9BA 5I1BA 1IT0A 5BQUC 3UDAA 5DSSB 3JUTA 4G6MA 2LIEA 3WINA 4I4UA 3H6SE 2Z48A 3NBEA 4QO3A 1KNMA 3P6JA 4I4XA 4IYBA 3WA1A 4II0A 3BAQA 1GGPB 3AKFA 4XFSA 1D0HA 1V6UA 3NJ5A 4F34A 2HWAA 1DIWA 3R4SA 4OEGA 1YBIA 3O3QA 4EFPA 4P0JA 1DJSB 4OWKA 4I4OA 2ZQNA 1HIBA 5BXTA 4P0KA 3P6IA 3V0BB 3WO4A 1I1BA 3OGFA 1FQ9A 3F1RA 4QC4A 4XKIA 2AFGA 2BEBA 1JY0A 1Q04A 4D0ZA 1J0SA 4KEIA 1YYNA 4X37A 1IJTA 2LIQA 4EFRA 1XZZA 4KEKA 3O4AA 4Q9PA 1R8NA 5JLVA 1SZ6B 4I0YA 2D44A 2P23A 3W9TA 5BP5A 2NZ9A 3NBCA 41BIA 1OQLB 3VEQA 2IHOA 4ZBVB 2NVHA 4LO1C 4JAWA 3H6RA 4OWJA 4JP0A 3ZX7A 4D0TA 5G00A 4ZLBB 1S0GA 5EG6C 3AH2A 2BFHA 3WO2A 4Z8SB 4P0LA 5DZUA 3C9ZA 3V0AB 4I4VA 1FV2A 5F8YA 1IRAX 3CRGA 1K5UA 3PG0A 4X3AA 3FJIA 1ISVA 4X39A 3HBWA 5FZYA 5FNXA 1V6VA 1JQZA 3CU1B 4KC3A 3RMXA 4P6AA 1W3GA 2QYIB 31BIA 3CA6A 3CA0A 1S0FA 1AVWB 2DS0A 1HCEA 3FJJA 1I1EA 3JRRA 1T4QA 5FZZA 3AZVA 1JLXA 3P53A 1ILR1 4QKRA 3I29B 5JMCA 4I4SA 1PWAA 4DEPA 4QBCA 1P63A 4J2XA 1AVXB 2L5XA 2MC2A 1DFQA 4OEFA 4LO2C 4USOA 4GAFA 3BAVA 3BA5A 2MLLB 3ZXDA 1MC9A 5BXPA 2Y9WC 2RQ9A 1Z0HA 2FO1A 2K4AB 4L4HA 2E4MA 1PUMB 4OWLA 3HALA 4JPZA 2GO2A 3IM7A 4CJMA 1ISZA 1XYFA 1FWVA 4IZEA 4LO7C 1AXMA 3HOMA 3OBTA 2D23A 6I1BA 1S0EA 3AKGA 3FJBA 1TWEA 2ET2A 4J2KA 1WBCA 2XOAA 2F2FA 1XG6A 3PUBA 3TC2A 4OUJA 1DLLA 3MPPG 4LO0C 3CA5A 1EYLA 4LO8B 1WD3A 3V79C 4I37A 1AVUA 1FMZA 4LO3A 1JT7A 2MIBA 1TTUA 4XFTA 3AH1A 4ZFUB 4I7IA 3VUOA 3NBNA 4IQPA 1MD6A 3LLPA 4DENA 1TFMB 4I3NA 1HWOB 3Q7YA 2ZQOA 2NM1A 2Y9FA 3WO3A 4I96A 4EB2B 4QD2C 1M16A 5BOWA 3ZC9A 1CVSA 4A7KA 3HSMA 3BB2A 3OJVA 4OW4A 2X2SA 3N7KA 1ISWA 4FGFA 1N4KA 5FNWA 3AZWA 4ZKTB 3A21A 1HCDA 4AN7B 4ZFYB 4LO7B 3ZXGA 3HMYA 5B2HA 4AN6A 3S8JA 3FJAA 3VT1A 5D61A 4I1EA 1EV2A 1S0LA 2WRYA 1ABRB 3CA1A 3UD9A 2R9KB 4ZFWB 3V0BA 1RMLA 3T8SA 3QYDA 8I1BA 1SR4A 3EF2A 1JT3A 4ISQA 2HZ9A 2D24A 4I6IA 4H04A 4YOLA 3N7JA 3BA7A 3D7WB 4R6UB 2D1ZA 3FJ8A 3IIRA 4G1RA 4QALA 4IY9A 3VT0A 4EKXB 7I1BA 3BRFA 4ZGRB 1G9AA 3VSFA 3O4OA 5BQUA 4JRAA 5F8WA 3OGGA 1S0DA 4USPA 1S0BA 1FGAA 9ILBA 1YF8B 2D43A 4HR6C 1ISYA 1HKNA 4I4QA 3WINC 3O44A 3FJEA 4GOVA 3CA4A 4KBBA 1II4A 3FJCA 3FJHA 5F90A 2KI6B 5F8SA 3IAGC 1JT5A 1W3FA 2K43A 1BFBA 5D63A 3V0AA 3AJ5A 3I2AA 1HWMB 1DQGA 2DRZA 3KMVA 3O4CA 4GAIA 2UUSA 2P39A 5DVHA 3UD7A 4OEEA 3WMVA 1DQOA 1IHKA 2KH2A 2FDBM 4QKSA 3ZC8A 1TP0A 5BVPI 1TWMA 4J2SA 2Y9XE 1HWNB 3O4BA 2Q3NB 3WMUA 4Z9WB 1EVTA 2J3PA 3LTQA 2DRYA 1E0OA 2Q9XA 1YTOA 4Q91A 1K5VA 4LO1A 1AVAC 5BP5C 3BA4A 3I2XA 2X2TA 3HN1A 1UPSA 4QBVA 1Q03A 3BRGC 1BLAA 3OJMA 2FGFA 3AH4A 3BAHA 4FVVA 3F62B 4J2YA 2DREA 3N7LA 3VSZA 4EEEB 1BASA 5GAQA 1V6WA 3A22A 4ZA3B 1JLYA 1W3AA 3IM6A 2FFUA 2RG9B 3QR5A 1TIEA 2GZBA 3R4UA 2VUAA 4IHZA 4XFUA 4EFQA 5EHAA 1BFFA 1NUNA 3AKHA 1Z2VA 3BADA 3NBDA 3BTAA 1PC8B 3SNVA 3A23A 1AF9A 2KI4A 2WBCA 2VU9A 2KKIA 3CRHA 4GP0A 1IRPA 2HW9A 1FMMS 4X38A 3Q7XA 1QQKA 1BLDA 3OBRA 1G9CA 1DZCA 4I1BA 3UJ4A 1QXMA 3POKA 1M2TB 1RG8A 1RY7A 4GOYA 4A7YA 5E24E 4A7ZA 4G9MA 2VSEA 4JQ0A 4LO2A 2ESUA 5DUYA 1BA7A 1S0CA 2I1BA
chains in the Genus database with same CATH superfamily
5FZUA 4GXIA 4JLZA 4M9NA 3RTJB 2W9MA 3K1XA 4I27A 3O49A 1AFCA 2AXMA 7ICRA 4TUQA 8ICOA 5DDYA 2M49A 4H9WA 2ISOA 1A8DA 3RJEA 2DRBA 3BAUA 3OJ2A 4LO0A 2IWTB 5D62A 1UETA 2D20A 2Z49A 3PHZA 1ZJMA 4UB4A 5DBCA 2NYYA 4RQ7A 7ICVA 4MFFA 1ZQOA 4NLNA 3BRDA 4PC4A 3K75D 2NTDA 4J23B 4L4IA 5EC5A 3C5GA 1EPWA 4GP3A 1YXWA 4JKXB 3RTIB 4I8MA 1ZQWA 3FJKA 3OVAA 2D7IA 4E80A 5BXSA 4ISRA 3RJJA 4I29A 1FWUA 3Q7WA 1PZZA 7ICUA 4NY8A 1JTCA 5D46A 1G9DA 1KDHA 2RSTA 4HA2A 3N7MA 5HRDA 3VT2A 3O5WB 4RPXA 1XHBA 4WC4A 5BQUC 3WINA 2Z48A 3NBEA 4QO3A 3WA1A 2O5AA 3BAQA 5DB8A 2BBJA 2Q66A 1D0HA 1ZQVA 4F34A 2HWAA 3PMLA 4EFPA 4P0JA 1ZQMA 4OWKA 5B3PA 2ZQNA 4P0KA 4X4OA 3MDAA 5HRHA 4RQ8A 3WFPA 3OGFA 5J0OA 2ZHBA 1FQ9A 2GAFD 1MQ2A 2BEBA 4WQKA 4RT3A 1YYNA 4MFCA 9ICPA 4KEKA 3O4AA 1R8NA 5IIKA 4I2CA 2D44A 1R8CA 5CFSA 2NZ9A 4H75A 41BIA 2EWRA 4ZBVB 4RQ2A 4I2GA 3WFSC 4R65A 4Z8SB 4P0LA 5DZUA 4QZHA 4I4VA 1ZQRA 3AUOA 3CRGA 4LEWA 4X39A 1JQZA 4KC3A 31BIA 3CA6A 1I1EA 5J29A 3JRRA 3AZVA 1JLXA 1JQRA 5JMCA 4EP7A 4R64A 1PWAA 1YLQA 1P63A 2L5XA 1ZQGA 1MIVA 7ICJA 9ICNA 1DFQA 4KLJA 4OEFA 4WC3A 2MLLB 2RQ9A 1Q78A 2FO1A 4UB1A 5HRKA 3OUYA 3IM7A 1BPBA 5J2GA 1ZQAA 3HOMA 3OBTA 5HR9A 4XRHA 1R8AA 3AQLA 2ZH6A 4OUJA 5CFTA 4LO0C 3CA5A 5HRGA 5HRFA 4I37A 2MIBA 4X0AA 5BPCA 3JPQA 3Q7YA 2NM1A 2Y9FA 4EB2B 8ICWA 1M16A 4WBYA 1JAJA 4OAHA 3BB2A 4WQLA 2X2SA 1HCDA 3H38A 5IINA 3UPSA 4FHXA 2WRYA 3V0BA 4RQ5A 1RMLA 3QYDA 1SR4A 3EF2A 4H04A 4YOLA 2HHPA 3N7JA 5IILA 3BA7A 2ZHAA 4R6UB 4KB6A 4UY4A 4G1RA 4ZGRB 2BE3A 3MDCA 3OGGA 4RQ6A 8ICXA 3LK9A 4AT9A 1S0BA 4XA5A 2D43A 1ISYA 3WINC 3O44A 4KBBA 4K98A 3FJCA 2KI6B 5F8SA 3TFSA 9ICQA 5D63A 4EBJA 4GAIA 4WC1A 3MBYA 4E8FA 1DQOA 8ICMA 2FDBM 2PBEA 2Y9XE 3O4BA 5J2CA 4WC6A 2Q3NB 5HREA 1E0OA 2ZH3A 3JPPA 3BA4A 3HN1A 3BRGC 1XSLA 2BCRA 2B56A 8ICCA 5J0QA 2M2VA 2DREA 3ER9B 4ZA3B 9ICBA 2RG9B 4XFUA 4UBBA 3AKHA 1Z2VA 3NBDA 4YMOA 2IUBA 4EBKA 1PC8B 4XQ7A 2KI4A 2WBCA 2VU9A 2NRKA 1IRPA 2HW9A 1QQKA 1G9CA 3MGHA 1QXMA 3POKA 4PGXA 4GOYA 4A7YA 4A7ZA 3HALA 2B4VA 1V6XA 3V72A 4AT8A 4I4PA 4Q9GA 5BXRA 3CAHA 3PMEA 1DFCA 1PUUB 3H6QA 3AJ6A 4I4YA 3C2LA 4IQUA 3NYBA 1HUZA 1ONKB 8ICBA 2RFFA 1BPXA 3FFZA 4RPYA 4GXKA 4KLFA 4ENDA 1VCLA 1JT4A 1UEUA 4G6JA 3E8LC 5J2FA 5BOLA 2ZR1B 3RJKA 4LZDA 4O5EA 4IZXA 1DZDA 1QQLA 1R89A 1HWPB 2BCSA 3OUYB 3N0KA 1ITBA 1PX5A 4ATBA 3S8KA 5HPZA 2BPCA 3BAGA 3RJHA 1FV3A 1BPYA 1SR4C 3ISDA 3RH5A 4WBCA 3V7LA 4O6AA 4IY8A 4QZBA 4MF8A 3RSJA 4OAFA 1IT0A 5J2BA 5DSSB 5CR0A 1ZQLA 3H6SE 5DB6A 4UAWA 3PMNA 1V6UA 7ICKA 4NM2A 4NM1A 1TVAA 7ICTA 4JWNA 3R4SA 5HC9A 1KEJA 8ICZA 1DJSB 5D49A 5EOZA 5BXTA 5CA7A 2BCVA 3V0BB 4R63A 3RJGA 1I1BA 3MGIA 2AFGA 8ICSA 4D0ZA 1J0SA 3ISCA 1ZQZA 5CWRA 1UEVA 4EFRA 2M2WA 4Q9PA 4I0YA 4LEYA 5J2DA 4AT9B 8ICYA 4OWJA 3H6RA 3CK6A 4WCWA 4ZLBB 5EG6C 3AH2A 2BFHA 3WO2A 3ERCC 4UD4A 1TFWA 4KLDA 4K99A 3PG0A 3H37A 4X3AA 1ISVA 3HBWA 5FNXA 9ICTA 3CA0A 1S0FA 1AVWB 1HCEA 3I29B 2M2UA 4YN4A 8ICGA 4QBCA 2M2TA 2MC2A 4GAFA 9ICHA 4KLOA 4IG8A 4QZDA 4MKPA 1Z0HA 4O9MA 2E4MA 4OWLA 3V7JA 7ICSA 2GO2A 4IQTA 4CJMA 1ISZA 4LO7C 4QZAA 4QZFA 4X4PA 4I2HA 1HUOA 1S0EA 4FHWA 5J0XA 2ET2A 2XOAA 3JZ0A 3HIYA 3PUBA 4FHVA 5CHEA 4WOYA 9ICGA 1EYLA 2VANA 1AVUA 4XFTA 3WFQE 4ZFUB 4K4GA 4IQPA 4K9AA 3WO3A 2ZQOA 4QD2C 3ZC9A 9ICAA 4A7KA 3HSMA 3OJVA 4AT8B 4LEZA 2ID1A 4FGFA 1XSPA 1N4KA 4ZKTB 3OV7A 4AN7B 4ZFYB 4LO7B 3HMYA 3MCRA 5B2HA 4EGWA 9ICFA 1F5AA 4I1EA 3CA1A 4ZFWB 5HRBA 1VJ7A 1JT3A 2D24A 2DR5A 2D1ZA 3FJ8A 3IIRA 4EKXB 4IY9A 3BRFA 1BPDA 3O4OA 5F8WA 4I2FA 4USPA 1FGAA 2ZH9A 1YF8B 4HR6C 4I4QA 4GOVA 3CA4A 2NS2A 1II4A 1RZTA 3FJHA 5F90A 3ER8C 3IAGC 1W3FA 5D4BA 3V0AA 1HWMB 3O4CA 1OU5A 2UUSA 4XJEA 5DVHA 5IIOA 8ICKA 3B0YA 4ATBB 4OEEA 3WMVA 4WC0A 9ICIA 4KLLA 1IHKA 2KH2A 3ZC8A 5BVPI 5J0UA 5IIJA 2ZH7A 4RQ1A 3WMUA 4I2DA 2J3PA 4UB2A 3LTQA 5HRIA 4Q91A 1K5VA 4LO1A 3ISBA 4RWNA 3I2XA 2BPGA 1BLAA 4AT7A 4RWPA 3BAHA 1V4AA 1ZQIA 4J2YA 4RWOA 3C66A 5GAQA 1V6WA 1W3AA 3QR5A 2GZBA 2VUAA 4IHZA 3C2KA 1BFFA 1NUNA 3OGUA 4MZGB 3BTAA 5HHHA 4PPXA 3A23A 3C5FA 4F5OA 4MZFB 4HX0A 2PFNA 4KLEA 4JQ0A 5J0WA 4LO2A 2ESUA 3ILAA 3H6RB 2NP0A 4OAIZ 2E4MC 3FJDA 3AKIA 2ZH8A 4DOCA 4E7XA 5J2EA 3C18A 3UXOA 3VWCA 4DCKC 2VLCA 4ZOTA 8ICFA 4MF2A 3FJ9A 1F31A 2YUGA 1IILA 1IOBA 3RMYA 1BFGA 4I2IA 2AAIB 4UAZA 4I2JA 2AQZA 2QN4A 4M0AA 2HWMA 4LVSA 3AU2A 21BIA 1WBAA 3CA3A 2VXTI 4QZIA 1NO5A 4YMMA 1BARA 3WFOA 4NXXA 1R8OA 3FUOA 4X4RA 4FH5A 8ICJA 5J0TA 3OVSA 4IQVA 3MALA 2BEAA 3K7DA 1Z4SA 3IM5A 3UJ0A 1RZOB 9ICVA 1BFCA 1L2HA 1CE7B 4D8HA 4PH5A 5DEDA 7ICEA 4KLHA 1ZQXA 1WD4A 2K8RA 4PHDA 4X4SA 3O4DA 1Q1UA 3UDAA 4WC5A 3JUTA 4G6MA 2BBHA 2LIEA 4I4UA 5DB9A 1KNYA 3P6JA 4I4XA 4IYBA 1GGPB 4M5DA 3H3AA 7ICLA 3NJ5A 1DIWA 4OAGA 5J2HA 4P4MA 4I4OA 4M9HA 4M9GA 1ZQJA 3P6IA 4O68A 4PHAA 2DR8A 4QC4A 4XKIA 4O5KA 1JY0A 1Q04A 7ICMA 4I2AA 5JLVA 2P23A 3W9TA 1ZQEA 3NBCA 5JTGA 2NVHA 4LO1C 3JPNA 4JAWA 1ZQFA 3ZX7A 4PHEA 3UXPA 4D0TA 5G00A 2IHMA 1S0GA 4GXJA 9ICSA 3C9ZA 3V0AB 5F8YA 1K5UA 5J0YA 4EEDA 5FZYA 2O1PA 2FMSA 7ICHA 3RMXA 2ZH1A 1W3GA 2QYIB 3FJJA 4F5NA 3P53A 3GDXA 4I4SA 4YD1A 4J2XA 3HX0A 4USOA 4LO2C 1FA0A 5DBAA 3WFRE 3ZXDA 1MC9A 5BXPA 2Y9WC 4MZHA 4X4TA 2K4AB 4L4HA 8ICLA 1PUMB 4FO6A 1XYFA 1FWVA 4JLXA 9ICOA 4J2KA 1WBCA 2F2FA 4PHPA 4R66A 5CFUA 3HJ4A 1DLLA 4K9BA 3MPPG 4LO8B 4QZ9A 3V79C 4LO3A 4RQ3A 4NXUA 1TTUA 9ICKA 1ZQHA 3VUOA 4JWMA 3OVBA 3LLPA 1TFMB 4I3NA 9ICLA 1HWOB 4I96A 4X4NA 5BOWA 2B51A 4EV6A 1CVSA 2FCLA 7ICPA 3N7KA 3JPRA 8ICUA 8ICPA 3ZXGA 4AN6A 1NOMA 2PFOA 3S8JA 3VT1A 4YMNA 9ICJA 1EV2A 2R9KB 9ICUA 3T8SA 4K96A 4M9LA 3UPQA 4QALA 7I1BA 4K4HA 8ICQA 1G9AA 4JRAA 4RQ4A 4WC2A 2BPFA 1HKNA 2FMQA 2GWSA 2HN2A 5DKWA 1JT5A 4WH5A 3JPSA 1BFBA 5F2VO 1DQGA 2DRZA 2P39A 4XUSA 3HJ1A 3JCFA 4QZCA 3UD7A 1BPZA 1VFGA 8ICHA 7ICIA 4J2SA 1HWNB 1ZJNA 2DRYA 1YTOA 1AVAC 1UPSA 3RJIA 2FMPA 4WC7A 3AH4A 5J0PA 3F62B 4UB3A 1JLYA 3IM6A 7ICQA 2FFUA 3R4UA 4YCXA 5EHAA 3JPOA 4NLZA 4F5RA 1FMMS 3Q7XA 1BLDA 3PNCA 1DZCA 4I1BA 3UJ4A 4UBCA 9ICEA 1RG8A 4F5QA 5J2AA 5DUYA 3HWTA 1BA7A 3B0XA 2KLLA 5DBBA 4YD2A 2DRAA 3BX1C 9ICMA 8ICNA 4X4VA 4HJJA 1ZQNA 3A07A 2D22A 3CRIA 3AQNA 2VXRA 4QD2B 3CQAA 3FJFA 8ICRA 2F2FC 4F5PA 2F8XC 5CHGA 4KEJA 4PGYA 4F83A 1FN0A 2FFVA 4LO3C 5DDMA 3BAOA 3FUQA 4P2HA 2D7RA 5CJ7A 2DR7A 4I4RA 8ICAA 1T9FA 2ERMA 4RPZA 5HRLA 4K8VA 1G82A 3B9UA 1ZQSA 4IONA 4XQ8A 4UAYA 1ZQQA 1TOOA 4UB5A 4RT2A 4QZGA 8ICEA 4NKTA 4I2SA 2Y9GA 1ISXA 5IIIA 4JKQA 4I0UA 3RH6A 5IIMA 4DO9A 3OWGA 3FGMA 3RJFA 4TLPA 4G9NA 5CB1A 1NZKA 1S0CA 1G9BA 3UD8A 2VSAA 5I1BA 3C2MA 2I1BA 4DOAA 1ZQCA 1KNMA 4II0A 2ZH2A 3AKFA 4XFSA 5BOMA 4EEBA 4OEGA 1ZQKA 1YBIA 3O3QA 2ISPA 4Z6EA 1HIBA 4RWQA 4I28A 2GA9D 1RPLA 4NXVA 7ICNA 3WO4A 4I2BA 3F1RA 3TFRA 4LEVA 4KEIA 4X37A 1IJTA 2LIQA 1XZZA 3RH4A 1R8BA 1SZ6B 4KLTA 5BP5A 4O69A 5TZVA 3LQCB 1OQLB 3VEQA 2IHOA 1GPJA 4FHPA 4KLIA 4JP0A 2PFQA 5J0RA 4KLMA 4NXTA 9ICWA 4KLSA 8ICTA 3HW8A 1FV2A 1IRAX 2DR9A 3FJIA 4S3NA 4MFAA 9ICCA 1V6VA 4TUPA 2ZH4A 3CU1B 4KLUA 4P6AA 4FHYA 2DS0A 1ZQBA 5FZZA 1T4QA 2PXIA 9ICXA 4Z6FA 1ILR1 4QKRA 1TV9A 4DEPA 1AVXB 1ZQUA 3BAVA 3BA5A 4NXZA 4K97A 4I2EA 3UXNA 4KLGA 4JPZA 5B3QA 4PGQA 4IZEA 1AXMA 2D23A 6I1BA 3L9DA 3AKGA 3FJBA 1TWEA 8ICVA 1XG6A 3UQ2A 3TC2A 4K4IA 4QZEA 5J2JA 1WD3A 4Z6DA 4IQWA 2BCQA 1FMZA 1JT7A 3AH1A 4X4UA 3AU6A 2HN1A 4I7IA 3NBNA 4WBZA 1MIYA 1MD6A 4DENA 1ZQDA 3JYYA 7ICGA 4OW4A 3V7KA 1MQ3A 1ISWA 5FNWA 3AZWA 4NLKA 3A21A 2P66A 4O5CA 9ICRA 4X0BA 3FJAA 5D61A 1S0LA 1ABRB 3UD9A 3AQKA 8I1BA 4ISQA 2HZ9A 1ZQYA 1ZQTA 4M47A 4I6IA 4LT6A 4M04A 3D7WB 3VT0A 4NXWA 3VSFA 4TUSA 5J2KA 5BQUA 4P4OA 5J0SA 4KM5A 5DECA 5J2IA 1S0DA 9ILBA 1JMSA 4X4QA 4KLQA 3FJEA 4NKUA 3H39A 2K43A 4X5VA 4LZGA 3AJ5A 4TURA 3I2AA 3KMVA 2ZH5A 1BPEA 4FH3A 2DVIA 1MIWA 4QKSA 4Z6CA 4AT7B 1TP0A 1ZQPA 2PFPA 1TWMA 5CP2A 2BCUA 1XSNA 4Z9WB 1EVTA 4M9JA 2Q9XA 5BP5C 4UD5A 4O67A 2X2TA 4QBVA 5DB7A 1Q03A 1WOTA 3OJMA 2FGFA 4FVVA 3UQ0A 4QZ8A 3N7LA 3VSZA 4EEEB 1BASA 3A22A 2I9GA 1TFYA 3NVOA 1TIEA 4RQ0A 7ICOA 4EFQA 3BADA 1JN3A 3SNVA 8ICIA 1AF9A 3CRHA 3JPTA 2KKIA 4M2YA 4GP0A 4X38A 3OBRA 4FO1A 5HHIA 4DOBA 1M2TB 1RY7A 5E24E 3NWIA 4G9MA 2VSEA 1Q79A 3AQMA 4N7RA 4P4PA 7ICFA 3NKUA
chains in the Genus database with same CATH topology
5FZUA 1V6XA 2KLLA 4JLZA 3ILAA 3H6RB 2NP0A 3RTJB 4I4PA 3K1XA 4Q9GA 4OAIZ 5BXRA 3BX1C 2E4MC 3CAHA 3AKIA 1AFCA 2AXMA 3FJDA 3O49A 3PMEA 1DFCA 1PUUB 4HJJA 3VWCA 3A07A 4DCKC 2D22A 2VLCA 3CRIA 3H6QA 4ZOTA 3AJ6A 2M49A 2VXRA 4I4YA 4QD2B 3CQAA 4H9WA 1A8DA 3FJFA 3BAUA 1ONKB 3OJ2A 4LO0A 2F2FC 3FJ9A 2IWTB 1F31A 3FFZA 5D62A 2D20A 2YUGA 2Z49A 3PHZA 2F8XC 4KEJA 1IILA 1IOBA 4ENDA 3RMYA 1BFGA 4F83A 1FN0A 2FFVA 2AAIB 4LO3C 1VCLA 2NYYA 1JT4A 2AQZA 3BRDA 4PC4A 2QN4A 3BAOA 4G6JA 2NTDA 4J23B 2HWMA 3E8LC 4L4IA 3FUQA 5EC5A 21BIA 1WBAA 3CA3A 2D7RA 2VXTI 1EPWA 1BARA 2ZR1B 4I4RA 4GP3A 1T9FA 2ERMA 4NXXA 1YXWA 4IZXA 1DZDA 1QQLA 1R8OA 3FUOA 1HWPB 4I8MA 4JKXB 3RTIB 3FJKA 4K8VA 1G82A 3B9UA 3MALA 2BEAA 3K7DA 2D7IA 4IONA 1Z4SA 3N0KA 3IM5A 1TOOA 1ITBA 5BXSA 4ISRA 3UJ0A 1RZOB 5HPZA 4I2SA 1FWUA 3S8KA 2Y9GA 3BAGA 1BFCA 1ISXA 3Q7WA 1PZZA 1L2HA 1FV3A 1CE7B 4D8HA 1JTCA 1SR4C 4JKQA 1G9DA 2RSTA 4HA2A 3N7MA 4WBCA 3VT2A 3OWGA 3FGMA 1WD4A 2K8RA 4TLPA 3O5WB 4G9NA 4IY8A 4O6AA 1NZKA 3O4DA 1XHBA 1Q1UA 3UD8A 3RSJA 2VSAA 1G9BA 4OAFA 5I1BA 1IT0A 5BQUC 3UDAA 5DSSB 3JUTA 4G6MA 2LIEA 3WINA 4I4UA 3H6SE 2Z48A 3NBEA 4QO3A 1KNMA 3P6JA 4I4XA 4IYBA 3WA1A 4II0A 3BAQA 1GGPB 3AKFA 4XFSA 1D0HA 1V6UA 3NJ5A 4F34A 2HWAA 1DIWA 3R4SA 4OEGA 1YBIA 4OAGA 3O3QA 4EFPA 4P0JA 1DJSB 4OWKA 4I4OA 5B3PA 2ZQNA 1HIBA 2GA9D 5BXTA 4P0KA 4NXVA 3P6IA 3V0BB 4O68A 3WO4A 1I1BA 3OGFA 1FQ9A 3F1RA 4QC4A 4XKIA 2AFGA 2GAFD 4LEVA 2BEBA 1JY0A 4WQKA 1Q04A 4D0ZA 1J0SA 4KEIA 1YYNA 4X37A 1IJTA 2LIQA 4EFRA 1XZZA 4KEKA 3O4AA 4Q9PA 1R8NA 5JLVA 1SZ6B 4I0YA 2D44A 2P23A 3W9TA 4LEYA 5BP5A 3NKUA 4O69A 5CFSA 2NZ9A 3NBCA 4H75A 41BIA 1OQLB 3VEQA 2IHOA 1GPJA 2EWRA 4ZBVB 2NVHA 4LO1C 4JAWA 3H6RA 4OWJA 4JP0A 3ZX7A 4D0TA 5G00A 4ZLBB 1S0GA 5EG6C 3AH2A 2BFHA 4NXTA 3WO2A 4Z8SB 4P0LA 3ERCC 5DZUA 3C9ZA 3V0AB 4I4VA 1FV2A 5F8YA 1IRAX 3CRGA 4LEWA 1K5UA 4K99A 3PG0A 4X3AA 3FJIA 1ISVA 4X39A 3HBWA 5FZYA 5FNXA 1V6VA 1JQZA 3CU1B 4KC3A 3RMXA 4P6AA 1W3GA 2QYIB 31BIA 3CA6A 3CA0A 1S0FA 1AVWB 2DS0A 1HCEA 3FJJA 1I1EA 3JRRA 1T4QA 5FZZA 3AZVA 1JLXA 3P53A 1ILR1 4QKRA 3I29B 5JMCA 4I4SA 1PWAA 4DEPA 4QBCA 1P63A 4J2XA 1AVXB 2L5XA 2MC2A 1DFQA 4OEFA 4LO2C 4USOA 4GAFA 3BAVA 3BA5A 2MLLB 3ZXDA 1MC9A 5BXPA 2Y9WC 2RQ9A 4MZHA 4MKPA 1Z0HA 2FO1A 2K4AB 4K97A 4L4HA 2E4MA 1PUMB 4OWLA 3HALA 4JPZA 5B3QA 2GO2A 3IM7A 4CJMA 1ISZA 1XYFA 1FWVA 4IZEA 4LO7C 1AXMA 4JLXA 3HOMA 3OBTA 2D23A 6I1BA 1S0EA 3AKGA 3FJBA 1TWEA 2ET2A 4J2KA 1WBCA 2XOAA 2F2FA 1XG6A 3PUBA 5CFUA 3TC2A 4OUJA 1DLLA 4K9BA 3MPPG 5CHEA 4WOYA 5CFTA 4LO0C 3CA5A 1EYLA 4LO8B 1WD3A 3V79C 4I37A 1AVUA 1FMZA 4LO3A 1JT7A 2MIBA 4NXUA 1TTUA 4XFTA 3AH1A 4ZFUB 4I7IA 3VUOA 3NBNA 4IQPA 1MD6A 3LLPA 4DENA 1TFMB 4I3NA 4K9AA 1HWOB 3Q7YA 2ZQOA 2NM1A 2Y9FA 3WO3A 4I96A 4EB2B 4QD2C 1M16A 5BOWA 3ZC9A 2B51A 1CVSA 4A7KA 3HSMA 4OAHA 3BB2A 3OJVA 2FCLA 4WQLA 4OW4A 2X2SA 4LEZA 3N7KA 1ISWA 4FGFA 1N4KA 5FNWA 3AZWA 4ZKTB 3A21A 1HCDA 4AN7B 4ZFYB 4LO7B 3ZXGA 3HMYA 3MCRA 5B2HA 4AN6A 3S8JA 3FJAA 3VT1A 5D61A 4I1EA 1EV2A 1S0LA 2WRYA 1ABRB 3CA1A 3UD9A 2R9KB 4ZFWB 3V0BA 1RMLA 3T8SA 3QYDA 8I1BA 1SR4A 3EF2A 1JT3A 4ISQA 2HZ9A 4K96A 2D24A 4I6IA 4H04A 4YOLA 3N7JA 3BA7A 3D7WB 4R6UB 4KB6A 2D1ZA 4UY4A 3FJ8A 3IIRA 4G1RA 4QALA 4IY9A 3VT0A 4EKXB 7I1BA 3BRFA 4ZGRB 4NXWA 1G9AA 3VSFA 3O4OA 5BQUA 4JRAA 5F8WA 3OGGA 4KM5A 1S0DA 4USPA 1S0BA 1FGAA 9ILBA 1YF8B 2D43A 4HR6C 1ISYA 1HKNA 4I4QA 3WINC 3O44A 3FJEA 4GOVA 3CA4A 2NS2A 4KBBA 4K98A 1II4A 3FJCA 3FJHA 5F90A 2KI6B 5F8SA 3ER8C 3IAGC 1JT5A 4WH5A 1W3FA 2K43A 1BFBA 5D63A 3V0AA 3AJ5A 3I2AA 1HWMB 1DQGA 2DRZA 3KMVA 3O4CA 4GAIA 2UUSA 2P39A 4XJEA 5DVHA 3UD7A 4OEEA 3WMVA 1DQOA 1IHKA 2KH2A 2FDBM 4QKSA 3ZC8A 1TP0A 5BVPI 1TWMA 4J2SA 2Y9XE 1HWNB 3O4BA 2Q3NB 3WMUA 4Z9WB 1EVTA 2J3PA 3LTQA 2DRYA 1E0OA 2Q9XA 1YTOA 4Q91A 1K5VA 4LO1A 1AVAC 5BP5C 3BA4A 3I2XA 4O67A 2X2TA 3HN1A 1UPSA 4QBVA 1Q03A 3BRGC 1BLAA 3OJMA 2FGFA 3AH4A 3BAHA 4FVVA 2B56A 3F62B 4J2YA 2DREA 3N7LA 3VSZA 4EEEB 3ER9B 1BASA 5GAQA 1V6WA 3A22A 4ZA3B 1JLYA 1W3AA 3IM6A 2FFUA 2RG9B 3QR5A 1TIEA 2GZBA 3R4UA 2VUAA 4IHZA 4XFUA 4EFQA 5EHAA 1BFFA 1NUNA 3AKHA 1Z2VA 3BADA 4MZGB 3NBDA 3BTAA 1PC8B 3SNVA 3A23A 1AF9A 2KI4A 2WBCA 2VU9A 2KKIA 3CRHA 4GP0A 1IRPA 2HW9A 1FMMS 4X38A 3Q7XA 1QQKA 1BLDA 3OBRA 4FO1A 1G9CA 1DZCA 4I1BA 4MZFB 1QXMA 3UJ4A 3POKA 4HX0A 1M2TB 1RG8A 1RY7A 4GOYA 4A7YA 5E24E 4A7ZA 4G9MA 2VSEA 4JQ0A 4LO2A 4N7RA 2ESUA 5DUYA 1BA7A 1S0CA 2I1BA 2B4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FZU A;  1V6X A;  2KLL A;  3ILA A;  3H6R B;  2NP0 A;  3RTJ B;  4I4P A;  3K1X A;  4Q9G A;  5BXR A;  3BX1 C;  2E4M C;  3CAH A;  3AKI A;  1AFC A;  2AXM A;  3FJD A;  3O49 A;  3PME A;  1DFC A;  1PUU B;  4HJJ A;  3VWC A;  3A07 A;  4DCK C;  2D22 A;  2VLC A;  3CRI A;  3H6Q A;  4ZOT A;  3AJ6 A;  2M49 A;  2VXR A;  4I4Y A;  4QD2 B;  3CQA A;  4H9W A;  1A8D A;  3FJF A;  3BAU A;  1ONK B;  3OJ2 A;  4LO0 A;  2F2F C;  3FJ9 A;  2IWT B;  1F31 A;  3FFZ A;  5D62 A;  2D20 A;  2YUG A;  2Z49 A;  3PHZ A;  2F8X C;  4KEJ A;  1IIL A;  1IOB A;  4END A;  3RMY A;  1BFG A;  4F83 A;  1FN0 A;  2FFV A;  2AAI B;  4LO3 C;  1VCL A;  2NYY A;  1JT4 A;  2AQZ A;  3BRD A;  4PC4 A;  2QN4 A;  3BAO A;  4G6J A;  2NTD A;  4J23 B;  2HWM A;  3E8L C;  4L4I A;  3FUQ A;  5EC5 A;  21BI A;  1WBA A;  3CA3 A;  2D7R A;  2VXT I;  1EPW A;  1BAR A;  2ZR1 B;  4I4R A;  4GP3 A;  1T9F A;  2ERM A;  1YXW A;  4IZX A;  1DZD A;  1QQL A;  1R8O A;  3FUO A;  1HWP B;  4I8M A;  4JKX B;  3RTI B;  3FJK A;  1G82 A;  3B9U A;  3MAL A;  2BEA A;  2D7I A;  4ION A;  1Z4S A;  3N0K A;  3IM5 A;  1TOO A;  1ITB A;  5BXS A;  4ISR A;  3UJ0 A;  1RZO B;  5HPZ A;  4I2S A;  1FWU A;  3S8K A;  2Y9G A;  3BAG A;  1BFC A;  1ISX A;  3Q7W A;  1PZZ A;  1L2H A;  1FV3 A;  1CE7 B;  4D8H A;  1JTC A;  1SR4 C;  4JKQ A;  1G9D A;  2RST A;  4HA2 A;  3N7M A;  4WBC A;  3VT2 A;  3FGM A;  1WD4 A;  2K8R A;  4TLP A;  3O5W B;  4G9N A;  4IY8 A;  1NZK A;  3O4D A;  1XHB A;  1Q1U A;  3UD8 A;  3RSJ A;  2VSA A;  1G9B A;  5I1B A;  1IT0 A;  5BQU C;  3UDA A;  5DSS B;  3JUT A;  4G6M A;  2LIE A;  3WIN A;  4I4U A;  3H6S E;  2Z48 A;  3NBE A;  4QO3 A;  1KNM A;  3P6J A;  4I4X A;  4IYB A;  3WA1 A;  4II0 A;  3BAQ A;  1GGP B;  3AKF A;  4XFS A;  1D0H A;  1V6U A;  3NJ5 A;  4F34 A;  2HWA A;  1DIW A;  3R4S A;  4OEG A;  1YBI A;  3O3Q A;  4EFP A;  4P0J A;  1DJS B;  4OWK A;  4I4O A;  2ZQN A;  1HIB A;  5BXT A;  4P0K A;  3P6I A;  3V0B B;  3WO4 A;  1I1B A;  3OGF A;  1FQ9 A;  3F1R A;  4QC4 A;  4XKI A;  2AFG A;  2BEB A;  1JY0 A;  1Q04 A;  4D0Z A;  1J0S A;  4KEI A;  1YYN A;  4X37 A;  1IJT A;  2LIQ A;  4EFR A;  1XZZ A;  4KEK A;  3O4A A;  4Q9P A;  1R8N A;  5JLV A;  1SZ6 B;  4I0Y A;  2D44 A;  2P23 A;  3W9T A;  5BP5 A;  2NZ9 A;  3NBC A;  41BI A;  1OQL B;  3VEQ A;  2IHO A;  4ZBV B;  2NVH A;  4LO1 C;  4JAW A;  3H6R A;  4OWJ A;  4JP0 A;  3ZX7 A;  4D0T A;  5G00 A;  4ZLB B;  1S0G A;  5EG6 C;  3AH2 A;  2BFH A;  3WO2 A;  4Z8S B;  4P0L A;  5DZU A;  3C9Z A;  3V0A B;  4I4V A;  1FV2 A;  5F8Y A;  1IRA X;  3CRG A;  1K5U A;  3PG0 A;  4X3A A;  3FJI A;  1ISV A;  4X39 A;  3HBW A;  5FZY A;  5FNX A;  1V6V A;  1JQZ A;  3CU1 B;  4KC3 A;  3RMX A;  4P6A A;  1W3G A;  2QYI B;  31BI A;  3CA6 A;  3CA0 A;  1S0F A;  1AVW B;  2DS0 A;  1HCE A;  3FJJ A;  1I1E A;  3JRR A;  1T4Q A;  5FZZ A;  3AZV A;  1JLX A;  3P53 A;  1ILR 1;  4QKR A;  3I29 B;  5JMC A;  4I4S A;  1PWA A;  4DEP A;  4QBC A;  1P63 A;  4J2X A;  1AVX B;  2L5X A;  2MC2 A;  1DFQ A;  4OEF A;  4LO2 C;  4USO A;  4GAF A;  3BAV A;  3BA5 A;  2MLL B;  3ZXD A;  1MC9 A;  5BXP A;  2Y9W C;  2RQ9 A;  1Z0H A;  2FO1 A;  2K4A B;  4L4H A;  2E4M A;  1PUM B;  4OWL A;  3HAL A;  4JPZ A;  2GO2 A;  3IM7 A;  4CJM A;  1ISZ A;  1XYF A;  1FWV A;  4IZE A;  4LO7 C;  1AXM A;  3HOM A;  3OBT A;  2D23 A;  6I1B A;  1S0E A;  3AKG A;  3FJB A;  1TWE A;  2ET2 A;  4J2K A;  1WBC A;  2XOA A;  2F2F A;  1XG6 A;  3PUB A;  3TC2 A;  4OUJ A;  1DLL A;  3MPP G;  4LO0 C;  3CA5 A;  1EYL A;  4LO8 B;  1WD3 A;  3V79 C;  4I37 A;  1AVU A;  1FMZ A;  4LO3 A;  1JT7 A;  2MIB A;  1TTU A;  4XFT A;  3AH1 A;  4ZFU B;  4I7I A;  3VUO A;  3NBN A;  4IQP A;  1MD6 A;  3LLP A;  4DEN A;  1TFM B;  4I3N A;  1HWO B;  3Q7Y A;  2ZQO A;  2NM1 A;  2Y9F A;  3WO3 A;  4I96 A;  4EB2 B;  4QD2 C;  1M16 A;  5BOW A;  3ZC9 A;  1CVS A;  4A7K A;  3HSM A;  3BB2 A;  3OJV A;  4OW4 A;  2X2S A;  3N7K A;  1ISW A;  4FGF A;  1N4K A;  5FNW A;  3AZW A;  4ZKT B;  3A21 A;  1HCD A;  4AN7 B;  4ZFY B;  4LO7 B;  3ZXG A;  3HMY A;  5B2H A;  4AN6 A;  3S8J A;  3FJA A;  3VT1 A;  5D61 A;  4I1E A;  1EV2 A;  1S0L A;  2WRY A;  1ABR B;  3CA1 A;  3UD9 A;  2R9K B;  4ZFW B;  3V0B A;  1RML A;  3T8S A;  3QYD A;  8I1B A;  1SR4 A;  3EF2 A;  1JT3 A;  4ISQ A;  2HZ9 A;  2D24 A;  4I6I A;  4H04 A;  4YOL A;  3N7J A;  3BA7 A;  3D7W B;  4R6U B;  2D1Z A;  3FJ8 A;  3IIR A;  4G1R A;  4QAL A;  4IY9 A;  3VT0 A;  4EKX B;  7I1B A;  3BRF A;  4ZGR B;  1G9A A;  3VSF A;  3O4O A;  5BQU A;  4JRA A;  5F8W A;  3OGG A;  1S0D A;  4USP A;  1S0B A;  1FGA A;  9ILB A;  1YF8 B;  2D43 A;  4HR6 C;  1ISY A;  1HKN A;  4I4Q A;  3WIN C;  3O44 A;  3FJE A;  4GOV A;  3CA4 A;  4KBB A;  1II4 A;  3FJC A;  3FJH A;  5F90 A;  2KI6 B;  5F8S A;  3IAG C;  1JT5 A;  1W3F A;  2K43 A;  1BFB A;  5D63 A;  3V0A A;  3AJ5 A;  3I2A A;  1HWM B;  1DQG A;  2DRZ A;  3KMV A;  3O4C A;  4GAI A;  2UUS A;  2P39 A;  5DVH A;  3UD7 A;  4OEE A;  3WMV A;  1DQO A;  1IHK A;  2KH2 A;  2FDB M;  4QKS A;  3ZC8 A;  1TP0 A;  5BVP I;  1TWM A;  4J2S A;  2Y9X E;  1HWN B;  3O4B A;  2Q3N B;  3WMU A;  4Z9W B;  1EVT A;  2J3P A;  3LTQ A;  2DRY A;  1E0O A;  2Q9X A;  1YTO A;  4Q91 A;  1K5V A;  4LO1 A;  1AVA C;  5BP5 C;  3BA4 A;  3I2X A;  2X2T A;  3HN1 A;  1UPS A;  4QBV A;  1Q03 A;  3BRG C;  1BLA A;  3OJM A;  2FGF A;  3AH4 A;  3BAH A;  4FVV A;  3F62 B;  4J2Y A;  2DRE A;  3N7L A;  3VSZ A;  4EEE B;  1BAS A;  5GAQ A;  1V6W A;  3A22 A;  4ZA3 B;  1JLY A;  1W3A A;  3IM6 A;  2FFU A;  2RG9 B;  3QR5 A;  1TIE A;  2GZB A;  3R4U A;  2VUA A;  4IHZ A;  4XFU A;  4EFQ A;  5EHA A;  1BFF A;  1NUN A;  3AKH A;  1Z2V A;  3BAD A;  3NBD A;  3BTA A;  1PC8 B;  3SNV A;  3A23 A;  1AF9 A;  2KI4 A;  2WBC A;  2VU9 A;  2KKI A;  3CRH A;  4GP0 A;  1IRP A;  2HW9 A;  1FMM S;  4X38 A;  3Q7X A;  1QQK A;  1BLD A;  3OBR A;  1G9C A;  1DZC A;  4I1B A;  3UJ4 A;  1QXM A;  3POK A;  1M2T B;  1RG8 A;  1RY7 A;  4GOY A;  4A7Y A;  5E24 E;  4A7Z A;  4G9M A;  2VSE A;  4JQ0 A;  4LO2 A;  2ESU A;  5DUY A;  1BA7 A;  1S0C A;  2I1B A; 
#chains in the Genus database with same CATH topology
 5FZU A;  4GXI A;  4JLZ A;  4M9N A;  3RTJ B;  2W9M A;  3K1X A;  4I27 A;  3O49 A;  1AFC A;  2AXM A;  7ICR A;  4TUQ A;  8ICO A;  5DDY A;  2M49 A;  4H9W A;  2ISO A;  1A8D A;  3RJE A;  2DRB A;  3BAU A;  3OJ2 A;  4LO0 A;  2IWT B;  5D62 A;  1UET A;  2D20 A;  2Z49 A;  3PHZ A;  1ZJM A;  4UB4 A;  5DBC A;  2NYY A;  4RQ7 A;  7ICV A;  4MFF A;  1ZQO A;  4NLN A;  3BRD A;  4PC4 A;  3K75 D;  2NTD A;  4J23 B;  4L4I A;  5EC5 A;  3C5G A;  1EPW A;  4GP3 A;  1YXW A;  4JKX B;  3RTI B;  4I8M A;  1ZQW A;  3FJK A;  3OVA A;  2D7I A;  4E80 A;  5BXS A;  4ISR A;  3RJJ A;  4I29 A;  1FWU A;  3Q7W A;  1PZZ A;  7ICU A;  4NY8 A;  1JTC A;  5D46 A;  1G9D A;  1KDH A;  2RST A;  4HA2 A;  3N7M A;  5HRD A;  3VT2 A;  3O5W B;  4RPX A;  1XHB A;  4WC4 A;  5BQU C;  3WIN A;  2Z48 A;  3NBE A;  4QO3 A;  3WA1 A;  2O5A A;  3BAQ A;  5DB8 A;  2BBJ A;  2Q66 A;  1D0H A;  1ZQV A;  4F34 A;  2HWA A;  3PML A;  4EFP A;  4P0J A;  1ZQM A;  4OWK A;  5B3P A;  2ZQN A;  4P0K A;  4X4O A;  3MDA A;  5HRH A;  4RQ8 A;  3WFP A;  3OGF A;  5J0O A;  2ZHB A;  1FQ9 A;  2GAF D;  1MQ2 A;  2BEB A;  4WQK A;  4RT3 A;  1YYN A;  4MFC A;  9ICP A;  4KEK A;  3O4A A;  1R8N A;  5IIK A;  4I2C A;  2D44 A;  1R8C A;  5CFS A;  2NZ9 A;  4H75 A;  41BI A;  2EWR A;  4ZBV B;  4RQ2 A;  4I2G A;  3WFS C;  4R65 A;  4Z8S B;  4P0L A;  5DZU A;  4QZH A;  4I4V A;  1ZQR A;  3AUO A;  3CRG A;  4LEW A;  4X39 A;  1JQZ A;  4KC3 A;  31BI A;  3CA6 A;  1I1E A;  5J29 A;  3JRR A;  3AZV A;  1JLX A;  1JQR A;  5JMC A;  4EP7 A;  4R64 A;  1PWA A;  1YLQ A;  1P63 A;  2L5X A;  1ZQG A;  1MIV A;  7ICJ A;  9ICN A;  1DFQ A;  4KLJ A;  4OEF A;  4WC3 A;  2MLL B;  2RQ9 A;  1Q78 A;  2FO1 A;  4UB1 A;  5HRK A;  3OUY A;  3IM7 A;  1BPB A;  5J2G A;  1ZQA A;  3HOM A;  3OBT A;  5HR9 A;  4XRH A;  1R8A A;  3AQL A;  2ZH6 A;  4OUJ A;  5CFT A;  4LO0 C;  3CA5 A;  5HRG A;  5HRF A;  4I37 A;  2MIB A;  4X0A A;  5BPC A;  3JPQ A;  3Q7Y A;  2NM1 A;  2Y9F A;  4EB2 B;  8ICW A;  1M16 A;  4WBY A;  1JAJ A;  4OAH A;  3BB2 A;  4WQL A;  2X2S A;  1HCD A;  3H38 A;  5IIN A;  3UPS A;  4FHX A;  2WRY A;  3V0B A;  4RQ5 A;  1RML A;  3QYD A;  1SR4 A;  3EF2 A;  4H04 A;  4YOL A;  2HHP A;  3N7J A;  5IIL A;  3BA7 A;  2ZHA A;  4R6U B;  4KB6 A;  4UY4 A;  4G1R A;  4ZGR B;  2BE3 A;  3MDC A;  3OGG A;  4RQ6 A;  8ICX A;  3LK9 A;  4AT9 A;  1S0B A;  4XA5 A;  2D43 A;  1ISY A;  3WIN C;  3O44 A;  4KBB A;  4K98 A;  3FJC A;  2KI6 B;  5F8S A;  3TFS A;  9ICQ A;  5D63 A;  4EBJ A;  4GAI A;  4WC1 A;  3MBY A;  4E8F A;  1DQO A;  8ICM A;  2FDB M;  2PBE A;  2Y9X E;  3O4B A;  5J2C A;  4WC6 A;  2Q3N B;  5HRE A;  1E0O A;  2ZH3 A;  3JPP A;  3BA4 A;  3HN1 A;  3BRG C;  1XSL A;  2BCR A;  2B56 A;  8ICC A;  5J0Q A;  2M2V A;  2DRE A;  3ER9 B;  4ZA3 B;  9ICB A;  2RG9 B;  4XFU A;  4UBB A;  3AKH A;  1Z2V A;  3NBD A;  4YMO A;  2IUB A;  4EBK A;  1PC8 B;  4XQ7 A;  2KI4 A;  2WBC A;  2VU9 A;  2NRK A;  1IRP A;  2HW9 A;  1QQK A;  1G9C A;  3MGH A;  1QXM A;  3POK A;  4PGX A;  4GOY A;  4A7Y A;  4A7Z A;  3HAL A;  2B4V A;  1V6X A;  3V72 A;  4AT8 A;  4I4P A;  4Q9G A;  5BXR A;  3CAH A;  3PME A;  1DFC A;  1PUU B;  3H6Q A;  3AJ6 A;  4I4Y A;  3C2L A;  4IQU A;  3NYB A;  1HUZ A;  1ONK B;  8ICB A;  2RFF A;  1BPX A;  3FFZ A;  4RPY A;  4GXK A;  4KLF A;  4END A;  1VCL A;  1JT4 A;  1UEU A;  4G6J A;  3E8L C;  5J2F A;  5BOL A;  2ZR1 B;  3RJK A;  4LZD A;  4O5E A;  4IZX A;  1DZD A;  1QQL A;  1R89 A;  1HWP B;  2BCS A;  3OUY B;  3N0K A;  1ITB A;  1PX5 A;  4ATB A;  3S8K A;  5HPZ A;  2BPC A;  3BAG A;  3RJH A;  1FV3 A;  1BPY A;  1SR4 C;  3ISD A;  3RH5 A;  4WBC A;  3V7L A;  4O6A A;  4IY8 A;  4QZB A;  4MF8 A;  3RSJ A;  4OAF A;  1IT0 A;  5J2B A;  5DSS B;  5CR0 A;  1ZQL A;  3H6S E;  5DB6 A;  4UAW A;  3PMN A;  1V6U A;  7ICK A;  4NM2 A;  4NM1 A;  1TVA A;  7ICT A;  4JWN A;  3R4S A;  5HC9 A;  1KEJ A;  8ICZ A;  1DJS B;  5D49 A;  5EOZ A;  5BXT A;  5CA7 A;  2BCV A;  3V0B B;  4R63 A;  3RJG A;  1I1B A;  3MGI A;  2AFG A;  8ICS A;  4D0Z A;  1J0S A;  3ISC A;  1ZQZ A;  5CWR A;  1UEV A;  4EFR A;  2M2W A;  4Q9P A;  4I0Y A;  4LEY A;  5J2D A;  4AT9 B;  8ICY A;  4OWJ A;  3H6R A;  3CK6 A;  4WCW A;  4ZLB B;  5EG6 C;  3AH2 A;  2BFH A;  3WO2 A;  3ERC C;  4UD4 A;  1TFW A;  4KLD A;  4K99 A;  3PG0 A;  3H37 A;  4X3A A;  1ISV A;  3HBW A;  5FNX A;  9ICT A;  3CA0 A;  1S0F A;  1AVW B;  1HCE A;  3I29 B;  2M2U A;  4YN4 A;  8ICG A;  4QBC A;  2M2T A;  2MC2 A;  4GAF A;  9ICH A;  4KLO A;  4IG8 A;  4QZD A;  4MKP A;  1Z0H A;  4O9M A;  2E4M A;  4OWL A;  3V7J A;  7ICS A;  2GO2 A;  4IQT A;  4CJM A;  1ISZ A;  4LO7 C;  4QZA A;  4QZF A;  4X4P A;  4I2H A;  1HUO A;  1S0E A;  4FHW A;  5J0X A;  2ET2 A;  2XOA A;  3JZ0 A;  3HIY A;  3PUB A;  4FHV A;  5CHE A;  4WOY A;  9ICG A;  1EYL A;  2VAN A;  1AVU A;  4XFT A;  3WFQ E;  4ZFU B;  4K4G A;  4IQP A;  4K9A A;  3WO3 A;  2ZQO A;  4QD2 C;  3ZC9 A;  9ICA A;  4A7K A;  3HSM A;  3OJV A;  4AT8 B;  4LEZ A;  2ID1 A;  4FGF A;  1XSP A;  1N4K A;  4ZKT B;  3OV7 A;  4AN7 B;  4ZFY B;  4LO7 B;  3HMY A;  3MCR A;  5B2H A;  4EGW A;  9ICF A;  1F5A A;  4I1E A;  3CA1 A;  4ZFW B;  5HRB A;  1VJ7 A;  1JT3 A;  2D24 A;  2DR5 A;  2D1Z A;  3FJ8 A;  3IIR A;  4EKX B;  4IY9 A;  3BRF A;  1BPD A;  3O4O A;  5F8W A;  4I2F A;  4USP A;  1FGA A;  2ZH9 A;  1YF8 B;  4HR6 C;  4I4Q A;  4GOV A;  3CA4 A;  2NS2 A;  1II4 A;  1RZT A;  3FJH A;  5F90 A;  3ER8 C;  3IAG C;  1W3F A;  5D4B A;  3V0A A;  1HWM B;  3O4C A;  1OU5 A;  2UUS A;  4XJE A;  5DVH A;  5IIO A;  8ICK A;  3B0Y A;  4ATB B;  4OEE A;  3WMV A;  4WC0 A;  9ICI A;  4KLL A;  1IHK A;  2KH2 A;  3ZC8 A;  5BVP I;  5J0U A;  5IIJ A;  2ZH7 A;  4RQ1 A;  3WMU A;  4I2D A;  2J3P A;  4UB2 A;  3LTQ A;  5HRI A;  4Q91 A;  1K5V A;  4LO1 A;  3ISB A;  4RWN A;  3I2X A;  2BPG A;  1BLA A;  4AT7 A;  4RWP A;  3BAH A;  1V4A A;  1ZQI A;  4J2Y A;  4RWO A;  3C66 A;  5GAQ A;  1V6W A;  1W3A A;  3QR5 A;  2GZB A;  2VUA A;  4IHZ A;  3C2K A;  1BFF A;  1NUN A;  3OGU A;  4MZG B;  3BTA A;  5HHH A;  4PPX A;  3A23 A;  3C5F A;  4F5O A;  4MZF B;  4HX0 A;  2PFN A;  4KLE A;  4JQ0 A;  5J0W A;  4LO2 A;  2ESU A;  3ILA A;  3H6R B;  2NP0 A;  4OAI Z;  2E4M C;  3FJD A;  3AKI A;  2ZH8 A;  4DOC A;  4E7X A;  5J2E A;  3C18 A;  3UXO A;  3VWC A;  4DCK C;  2VLC A;  4ZOT A;  8ICF A;  4MF2 A;  3FJ9 A;  1F31 A;  2YUG A;  1IIL A;  1IOB A;  3RMY A;  1BFG A;  4I2I A;  2AAI B;  4UAZ A;  4I2J A;  2AQZ A;  2QN4 A;  4M0A A;  2HWM A;  4LVS A;  3AU2 A;  21BI A;  1WBA A;  3CA3 A;  2VXT I;  4QZI A;  1NO5 A;  4YMM A;  1BAR A;  3WFO A;  4NXX A;  1R8O A;  3FUO A;  4X4R A;  4FH5 A;  8ICJ A;  5J0T A;  3OVS A;  4IQV A;  3MAL A;  2BEA A;  3K7D A;  1Z4S A;  3IM5 A;  3UJ0 A;  1RZO B;  9ICV A;  1BFC A;  1L2H A;  1CE7 B;  4D8H A;  4PH5 A;  5DED A;  7ICE A;  4KLH A;  1ZQX A;  1WD4 A;  2K8R A;  4PHD A;  4X4S A;  3O4D A;  1Q1U A;  3UDA A;  4WC5 A;  3JUT A;  4G6M A;  2BBH A;  2LIE A;  4I4U A;  5DB9 A;  1KNY A;  3P6J A;  4I4X A;  4IYB A;  1GGP B;  4M5D A;  3H3A A;  7ICL A;  3NJ5 A;  1DIW A;  4OAG A;  5J2H A;  4P4M A;  4I4O A;  4M9H A;  4M9G A;  1ZQJ A;  3P6I A;  4O68 A;  4PHA A;  2DR8 A;  4QC4 A;  4XKI A;  4O5K A;  1JY0 A;  1Q04 A;  7ICM A;  4I2A A;  5JLV A;  2P23 A;  3W9T A;  1ZQE A;  3NBC A;  5JTG A;  2NVH A;  4LO1 C;  3JPN A;  4JAW A;  1ZQF A;  3ZX7 A;  4PHE A;  3UXP A;  4D0T A;  5G00 A;  2IHM A;  1S0G A;  4GXJ A;  9ICS A;  3C9Z A;  3V0A B;  5F8Y A;  1K5U A;  5J0Y A;  4EED A;  5FZY A;  2O1P A;  2FMS A;  7ICH A;  3RMX A;  2ZH1 A;  1W3G A;  2QYI B;  3FJJ A;  4F5N A;  3P53 A;  3GDX A;  4I4S A;  4YD1 A;  4J2X A;  3HX0 A;  4USO A;  4LO2 C;  1FA0 A;  5DBA A;  3WFR E;  3ZXD A;  1MC9 A;  5BXP A;  2Y9W C;  4MZH A;  4X4T A;  2K4A B;  4L4H A;  8ICL A;  1PUM B;  4FO6 A;  1XYF A;  1FWV A;  4JLX A;  9ICO A;  4J2K A;  1WBC A;  2F2F A;  4PHP A;  4R66 A;  5CFU A;  3HJ4 A;  1DLL A;  4K9B A;  3MPP G;  4LO8 B;  4QZ9 A;  3V79 C;  4LO3 A;  4RQ3 A;  4NXU A;  1TTU A;  9ICK A;  1ZQH A;  3VUO A;  4JWM A;  3OVB A;  3LLP A;  1TFM B;  4I3N A;  9ICL A;  1HWO B;  4I96 A;  4X4N A;  5BOW A;  2B51 A;  4EV6 A;  1CVS A;  2FCL A;  7ICP A;  3N7K A;  3JPR A;  8ICU A;  8ICP A;  3ZXG A;  4AN6 A;  1NOM A;  2PFO A;  3S8J A;  3VT1 A;  4YMN A;  9ICJ A;  1EV2 A;  2R9K B;  9ICU A;  3T8S A;  4K96 A;  4M9L A;  3UPQ A;  4QAL A;  7I1B A;  4K4H A;  8ICQ A;  1G9A A;  4JRA A;  4RQ4 A;  4WC2 A;  2BPF A;  1HKN A;  2FMQ A;  2GWS A;  2HN2 A;  5DKW A;  1JT5 A;  4WH5 A;  3JPS A;  1BFB A;  5F2V O;  1DQG A;  2DRZ A;  2P39 A;  4XUS A;  3HJ1 A;  3JCF A;  4QZC A;  3UD7 A;  1BPZ A;  1VFG A;  8ICH A;  7ICI A;  4J2S A;  1HWN B;  1ZJN A;  2DRY A;  1YTO A;  1AVA C;  1UPS A;  3RJI A;  2FMP A;  4WC7 A;  3AH4 A;  5J0P A;  3F62 B;  4UB3 A;  1JLY A;  3IM6 A;  7ICQ A;  2FFU A;  3R4U A;  4YCX A;  5EHA A;  3JPO A;  4NLZ A;  4F5R A;  1FMM S;  3Q7X A;  1BLD A;  3PNC A;  1DZC A;  4I1B A;  3UJ4 A;  4UBC A;  9ICE A;  1RG8 A;  4F5Q A;  5J2A A;  5DUY A;  3HWT A;  1BA7 A;  3B0X A;  2KLL A;  5DBB A;  4YD2 A;  2DRA A;  3BX1 C;  9ICM A;  8ICN A;  4X4V A;  4HJJ A;  1ZQN A;  3A07 A;  2D22 A;  3CRI A;  3AQN A;  2VXR A;  4QD2 B;  3CQA A;  3FJF A;  8ICR A;  2F2F C;  4F5P A;  2F8X C;  5CHG A;  4KEJ A;  4PGY A;  4F83 A;  1FN0 A;  2FFV A;  4LO3 C;  5DDM A;  3BAO A;  3FUQ A;  4P2H A;  2D7R A;  5CJ7 A;  2DR7 A;  4I4R A;  8ICA A;  1T9F A;  2ERM A;  4RPZ A;  5HRL A;  4K8V A;  1G82 A;  3B9U A;  1ZQS A;  4ION A;  4XQ8 A;  4UAY A;  1ZQQ A;  1TOO A;  4UB5 A;  4RT2 A;  4QZG A;  8ICE A;  4NKT A;  4I2S A;  2Y9G A;  1ISX A;  5III A;  4JKQ A;  4I0U A;  3RH6 A;  5IIM A;  4DO9 A;  3OWG A;  3FGM A;  3RJF A;  4TLP A;  4G9N A;  5CB1 A;  1NZK A;  1S0C A;  1G9B A;  3UD8 A;  2VSA A;  5I1B A;  3C2M A;  2I1B A;  4DOA A;  1ZQC A;  1KNM A;  4II0 A;  2ZH2 A;  3AKF A;  4XFS A;  5BOM A;  4EEB A;  4OEG A;  1ZQK A;  1YBI A;  3O3Q A;  2ISP A;  4Z6E A;  1HIB A;  4RWQ A;  4I28 A;  2GA9 D;  1RPL A;  4NXV A;  7ICN A;  3WO4 A;  4I2B A;  3F1R A;  3TFR A;  4LEV A;  4KEI A;  4X37 A;  1IJT A;  2LIQ A;  1XZZ A;  3RH4 A;  1R8B A;  1SZ6 B;  4KLT A;  5BP5 A;  4O69 A;  5TZV A;  3LQC B;  1OQL B;  3VEQ A;  2IHO A;  1GPJ A;  4FHP A;  4KLI A;  4JP0 A;  2PFQ A;  5J0R A;  4KLM A;  4NXT A;  9ICW A;  4KLS A;  8ICT A;  3HW8 A;  1FV2 A;  1IRA X;  2DR9 A;  3FJI A;  4S3N A;  4MFA A;  9ICC A;  1V6V A;  4TUP A;  2ZH4 A;  3CU1 B;  4KLU A;  4P6A A;  4FHY A;  2DS0 A;  1ZQB A;  5FZZ A;  1T4Q A;  2PXI A;  9ICX A;  4Z6F A;  1ILR 1;  4QKR A;  1TV9 A;  4DEP A;  1AVX B;  1ZQU A;  3BAV A;  3BA5 A;  4NXZ A;  4K97 A;  4I2E A;  3UXN A;  4KLG A;  4JPZ A;  5B3Q A;  4PGQ A;  4IZE A;  1AXM A;  2D23 A;  6I1B A;  3L9D A;  3AKG A;  3FJB A;  1TWE A;  8ICV A;  1XG6 A;  3UQ2 A;  3TC2 A;  4K4I A;  4QZE A;  5J2J A;  1WD3 A;  4Z6D A;  4IQW A;  2BCQ A;  1FMZ A;  1JT7 A;  3AH1 A;  4X4U A;  3AU6 A;  2HN1 A;  4I7I A;  3NBN A;  4WBZ A;  1MIY A;  1MD6 A;  4DEN A;  1ZQD A;  3JYY A;  7ICG A;  4OW4 A;  3V7K A;  1MQ3 A;  1ISW A;  5FNW A;  3AZW A;  4NLK A;  3A21 A;  2P66 A;  4O5C A;  9ICR A;  4X0B A;  3FJA A;  5D61 A;  1S0L A;  1ABR B;  3UD9 A;  3AQK A;  8I1B A;  4ISQ A;  2HZ9 A;  1ZQY A;  1ZQT A;  4M47 A;  4I6I A;  4LT6 A;  4M04 A;  3D7W B;  3VT0 A;  4NXW A;  3VSF A;  4TUS A;  5J2K A;  5BQU A;  4P4O A;  5J0S A;  4KM5 A;  5DEC A;  5J2I A;  1S0D A;  9ILB A;  1JMS A;  4X4Q A;  4KLQ A;  3FJE A;  4NKU A;  3H39 A;  2K43 A;  4X5V A;  4LZG A;  3AJ5 A;  4TUR A;  3I2A A;  3KMV A;  2ZH5 A;  1BPE A;  4FH3 A;  2DVI A;  1MIW A;  4QKS A;  4Z6C A;  4AT7 B;  1TP0 A;  1ZQP A;  2PFP A;  1TWM A;  5CP2 A;  2BCU A;  1XSN A;  4Z9W B;  1EVT A;  4M9J A;  2Q9X A;  5BP5 C;  4UD5 A;  4O67 A;  2X2T A;  4QBV A;  5DB7 A;  1Q03 A;  1WOT A;  3OJM A;  2FGF A;  4FVV A;  3UQ0 A;  4QZ8 A;  3N7L A;  3VSZ A;  4EEE B;  1BAS A;  3A22 A;  2I9G A;  1TFY A;  3NVO A;  1TIE A;  4RQ0 A;  7ICO A;  4EFQ A;  3BAD A;  1JN3 A;  3SNV A;  8ICI A;  1AF9 A;  3CRH A;  3JPT A;  2KKI A;  4M2Y A;  4GP0 A;  4X38 A;  3OBR A;  4FO1 A;  5HHI A;  4DOB A;  1M2T B;  1RY7 A;  5E24 E;  3NWI A;  4G9M A;  2VSE A;  1Q79 A;  3AQM A;  4N7R A;  4P4P A;  7ICF A;  3NKU A; 
#chains in the Genus database with same CATH homology
 5FZU A;  1V6X A;  2KLL A;  4JLZ A;  3ILA A;  3H6R B;  2NP0 A;  3RTJ B;  4I4P A;  3K1X A;  4Q9G A;  4OAI Z;  5BXR A;  3BX1 C;  2E4M C;  3CAH A;  3AKI A;  1AFC A;  2AXM A;  3FJD A;  3O49 A;  3PME A;  1DFC A;  1PUU B;  4HJJ A;  3VWC A;  3A07 A;  4DCK C;  2D22 A;  2VLC A;  3CRI A;  3H6Q A;  4ZOT A;  3AJ6 A;  2M49 A;  2VXR A;  4I4Y A;  4QD2 B;  3CQA A;  4H9W A;  1A8D A;  3FJF A;  3BAU A;  1ONK B;  3OJ2 A;  4LO0 A;  2F2F C;  3FJ9 A;  2IWT B;  1F31 A;  3FFZ A;  5D62 A;  2D20 A;  2YUG A;  2Z49 A;  3PHZ A;  2F8X C;  4KEJ A;  1IIL A;  1IOB A;  4END A;  3RMY A;  1BFG A;  4F83 A;  1FN0 A;  2FFV A;  2AAI B;  4LO3 C;  1VCL A;  2NYY A;  1JT4 A;  2AQZ A;  3BRD A;  4PC4 A;  2QN4 A;  3BAO A;  4G6J A;  2NTD A;  4J23 B;  2HWM A;  3E8L C;  4L4I A;  3FUQ A;  5EC5 A;  21BI A;  1WBA A;  3CA3 A;  2D7R A;  2VXT I;  1EPW A;  1BAR A;  2ZR1 B;  4I4R A;  4GP3 A;  1T9F A;  2ERM A;  4NXX A;  1YXW A;  4IZX A;  1DZD A;  1QQL A;  1R8O A;  3FUO A;  1HWP B;  4I8M A;  4JKX B;  3RTI B;  3FJK A;  4K8V A;  1G82 A;  3B9U A;  3MAL A;  2BEA A;  3K7D A;  2D7I A;  4ION A;  1Z4S A;  3N0K A;  3IM5 A;  1TOO A;  1ITB A;  5BXS A;  4ISR A;  3UJ0 A;  1RZO B;  5HPZ A;  4I2S A;  1FWU A;  3S8K A;  2Y9G A;  3BAG A;  1BFC A;  1ISX A;  3Q7W A;  1PZZ A;  1L2H A;  1FV3 A;  1CE7 B;  4D8H A;  1JTC A;  1SR4 C;  4JKQ A;  1G9D A;  2RST A;  4HA2 A;  3N7M A;  4WBC A;  3VT2 A;  3OWG A;  3FGM A;  1WD4 A;  2K8R A;  4TLP A;  3O5W B;  4G9N A;  4IY8 A;  4O6A A;  1NZK A;  3O4D A;  1XHB A;  1Q1U A;  3UD8 A;  3RSJ A;  2VSA A;  1G9B A;  4OAF A;  5I1B A;  1IT0 A;  5BQU C;  3UDA A;  5DSS B;  3JUT A;  4G6M A;  2LIE A;  3WIN A;  4I4U A;  3H6S E;  2Z48 A;  3NBE A;  4QO3 A;  1KNM A;  3P6J A;  4I4X A;  4IYB A;  3WA1 A;  4II0 A;  3BAQ A;  1GGP B;  3AKF A;  4XFS A;  1D0H A;  1V6U A;  3NJ5 A;  4F34 A;  2HWA A;  1DIW A;  3R4S A;  4OEG A;  1YBI A;  4OAG A;  3O3Q A;  4EFP A;  4P0J A;  1DJS B;  4OWK A;  4I4O A;  5B3P A;  2ZQN A;  1HIB A;  2GA9 D;  5BXT A;  4P0K A;  4NXV A;  3P6I A;  3V0B B;  4O68 A;  3WO4 A;  1I1B A;  3OGF A;  1FQ9 A;  3F1R A;  4QC4 A;  4XKI A;  2AFG A;  2GAF D;  4LEV A;  2BEB A;  1JY0 A;  4WQK A;  1Q04 A;  4D0Z A;  1J0S A;  4KEI A;  1YYN A;  4X37 A;  1IJT A;  2LIQ A;  4EFR A;  1XZZ A;  4KEK A;  3O4A A;  4Q9P A;  1R8N A;  5JLV A;  1SZ6 B;  4I0Y A;  2D44 A;  2P23 A;  3W9T A;  4LEY A;  5BP5 A;  3NKU A;  4O69 A;  5CFS A;  2NZ9 A;  3NBC A;  4H75 A;  41BI A;  1OQL B;  3VEQ A;  2IHO A;  1GPJ A;  2EWR A;  4ZBV B;  2NVH A;  4LO1 C;  4JAW A;  3H6R A;  4OWJ A;  4JP0 A;  3ZX7 A;  4D0T A;  5G00 A;  4ZLB B;  1S0G A;  5EG6 C;  3AH2 A;  2BFH A;  4NXT A;  3WO2 A;  4Z8S B;  4P0L A;  3ERC C;  5DZU A;  3C9Z A;  3V0A B;  4I4V A;  1FV2 A;  5F8Y A;  1IRA X;  3CRG A;  4LEW A;  1K5U A;  4K99 A;  3PG0 A;  4X3A A;  3FJI A;  1ISV A;  4X39 A;  3HBW A;  5FZY A;  5FNX A;  1V6V A;  1JQZ A;  3CU1 B;  4KC3 A;  3RMX A;  4P6A A;  1W3G A;  2QYI B;  31BI A;  3CA6 A;  3CA0 A;  1S0F A;  1AVW B;  2DS0 A;  1HCE A;  3FJJ A;  1I1E A;  3JRR A;  1T4Q A;  5FZZ A;  3AZV A;  1JLX A;  3P53 A;  1ILR 1;  4QKR A;  3I29 B;  5JMC A;  4I4S A;  1PWA A;  4DEP A;  4QBC A;  1P63 A;  4J2X A;  1AVX B;  2L5X A;  2MC2 A;  1DFQ A;  4OEF A;  4LO2 C;  4USO A;  4GAF A;  3BAV A;  3BA5 A;  2MLL B;  3ZXD A;  1MC9 A;  5BXP A;  2Y9W C;  2RQ9 A;  4MZH A;  4MKP A;  1Z0H A;  2FO1 A;  2K4A B;  4K97 A;  4L4H A;  2E4M A;  1PUM B;  4OWL A;  3HAL A;  4JPZ A;  5B3Q A;  2GO2 A;  3IM7 A;  4CJM A;  1ISZ A;  1XYF A;  1FWV A;  4IZE A;  4LO7 C;  1AXM A;  4JLX A;  3HOM A;  3OBT A;  2D23 A;  6I1B A;  1S0E A;  3AKG A;  3FJB A;  1TWE A;  2ET2 A;  4J2K A;  1WBC A;  2XOA A;  2F2F A;  1XG6 A;  3PUB A;  5CFU A;  3TC2 A;  4OUJ A;  1DLL A;  4K9B A;  3MPP G;  5CHE A;  4WOY A;  5CFT A;  4LO0 C;  3CA5 A;  1EYL A;  4LO8 B;  1WD3 A;  3V79 C;  4I37 A;  1AVU A;  1FMZ A;  4LO3 A;  1JT7 A;  2MIB A;  4NXU A;  1TTU A;  4XFT A;  3AH1 A;  4ZFU B;  4I7I A;  3VUO A;  3NBN A;  4IQP A;  1MD6 A;  3LLP A;  4DEN A;  1TFM B;  4I3N A;  4K9A A;  1HWO B;  3Q7Y A;  2ZQO A;  2NM1 A;  2Y9F A;  3WO3 A;  4I96 A;  4EB2 B;  4QD2 C;  1M16 A;  5BOW A;  3ZC9 A;  2B51 A;  1CVS A;  4A7K A;  3HSM A;  4OAH A;  3BB2 A;  3OJV A;  2FCL A;  4WQL A;  4OW4 A;  2X2S A;  4LEZ A;  3N7K A;  1ISW A;  4FGF A;  1N4K A;  5FNW A;  3AZW A;  4ZKT B;  3A21 A;  1HCD A;  4AN7 B;  4ZFY B;  4LO7 B;  3ZXG A;  3HMY A;  3MCR A;  5B2H A;  4AN6 A;  3S8J A;  3FJA A;  3VT1 A;  5D61 A;  4I1E A;  1EV2 A;  1S0L A;  2WRY A;  1ABR B;  3CA1 A;  3UD9 A;  2R9K B;  4ZFW B;  3V0B A;  1RML A;  3T8S A;  3QYD A;  8I1B A;  1SR4 A;  3EF2 A;  1JT3 A;  4ISQ A;  2HZ9 A;  4K96 A;  2D24 A;  4I6I A;  4H04 A;  4YOL A;  3N7J A;  3BA7 A;  3D7W B;  4R6U B;  4KB6 A;  2D1Z A;  4UY4 A;  3FJ8 A;  3IIR A;  4G1R A;  4QAL A;  4IY9 A;  3VT0 A;  4EKX B;  7I1B A;  3BRF A;  4ZGR B;  4NXW A;  1G9A A;  3VSF A;  3O4O A;  5BQU A;  4JRA A;  5F8W A;  3OGG A;  4KM5 A;  1S0D A;  4USP A;  1S0B A;  1FGA A;  9ILB A;  1YF8 B;  2D43 A;  4HR6 C;  1ISY A;  1HKN A;  4I4Q A;  3WIN C;  3O44 A;  3FJE A;  4GOV A;  3CA4 A;  2NS2 A;  4KBB A;  4K98 A;  1II4 A;  3FJC A;  3FJH A;  5F90 A;  2KI6 B;  5F8S A;  3ER8 C;  3IAG C;  1JT5 A;  4WH5 A;  1W3F A;  2K43 A;  1BFB A;  5D63 A;  3V0A A;  3AJ5 A;  3I2A A;  1HWM B;  1DQG A;  2DRZ A;  3KMV A;  3O4C A;  4GAI A;  2UUS A;  2P39 A;  4XJE A;  5DVH A;  3UD7 A;  4OEE A;  3WMV A;  1DQO A;  1IHK A;  2KH2 A;  2FDB M;  4QKS A;  3ZC8 A;  1TP0 A;  5BVP I;  1TWM A;  4J2S A;  2Y9X E;  1HWN B;  3O4B A;  2Q3N B;  3WMU A;  4Z9W B;  1EVT A;  2J3P A;  3LTQ A;  2DRY A;  1E0O A;  2Q9X A;  1YTO A;  4Q91 A;  1K5V A;  4LO1 A;  1AVA C;  5BP5 C;  3BA4 A;  3I2X A;  4O67 A;  2X2T A;  3HN1 A;  1UPS A;  4QBV A;  1Q03 A;  3BRG C;  1BLA A;  3OJM A;  2FGF A;  3AH4 A;  3BAH A;  4FVV A;  2B56 A;  3F62 B;  4J2Y A;  2DRE A;  3N7L A;  3VSZ A;  4EEE B;  3ER9 B;  1BAS A;  5GAQ A;  1V6W A;  3A22 A;  4ZA3 B;  1JLY A;  1W3A A;  3IM6 A;  2FFU A;  2RG9 B;  3QR5 A;  1TIE A;  2GZB A;  3R4U A;  2VUA A;  4IHZ A;  4XFU A;  4EFQ A;  5EHA A;  1BFF A;  1NUN A;  3AKH A;  1Z2V A;  3BAD A;  4MZG B;  3NBD A;  3BTA A;  1PC8 B;  3SNV A;  3A23 A;  1AF9 A;  2KI4 A;  2WBC A;  2VU9 A;  2KKI A;  3CRH A;  4GP0 A;  1IRP A;  2HW9 A;  1FMM S;  4X38 A;  3Q7X A;  1QQK A;  1BLD A;  3OBR A;  4FO1 A;  1G9C A;  1DZC A;  4I1B A;  4MZF B;  1QXM A;  3UJ4 A;  3POK A;  4HX0 A;  1M2T B;  1RG8 A;  1RY7 A;  4GOY A;  4A7Y A;  5E24 E;  4A7Z A;  4G9M A;  2VSE A;  4JQ0 A;  4LO2 A;  4N7R A;  2ESU A;  5DUY A;  1BA7 A;  1S0C A;  2I1B A;  2B4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...