2IHOA

Crystal structure of moa, a lectin from the mushroom marasmius oreades in complex with the trisaccharide gal(1,3)gal(1,4)glcnac
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lectin
publication title Crystal structure of the marasmius oreades mushroom lectin in complex with a xenotransplantation epitope.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Sugar binding protein
total genus 87
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ihoA01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ihoA02
1V6WA 2MC2A 1G9BA 1ISYA 1QQLA 4ZA3B 1HCDA 4QALA 3BA4A 4DENA 3S8KA 3D7WB 1NZKA 3ZC9A 1XZZA 3Q7XA 2FFVA 2P39A 4D0TA 1MC9A 3NBDA 3H6RB 3B9UA 5DUYA 2DS0A 1FV2A 1EYLA 3LLPA 3H6QA 5F8YA 4JPZA 1IHKA 1NUNA 5FNXA 1WBCA 3TC2A 5JMCA 1G82A 2VLCA 3LTQA 3AH1A 4DCKC 3CRGA 3UD9A 4I4YA 4LO1C 4I0YA 4ZOTA 3A23A 1GGPB 3WINC 2RQ9A 3BADA 2Y9WC 2DRYA 3WO3A 1BFCA 1D0HA 4QD2C 2FDBM 1DLLA 1DJSB 3A22A 2E4MC 3FJCA 1IT0A 3HOMA 4G6MA 1XHBA 4L4HA 4D8HA 3BB2A 2F2FC 2K8RA 2LIQA 31BIA 3AKHA 3NJ5A 1TP0A 5I1BA 3VSZA 1BFFA 1R8NA 3RMXA 4X3AA 1JQZA 4P0JA 3QYDA 1RMLA 4GOYA 1AVAC 4IY8A 1P63A 4I4OA 4JKQA 3N7LA 3V0AA 3O49A 5F90A 4I4SA 1ONKB 1F31A 1Z2VA 3AKFA 1BA7A 2QYIB 1BASA 4HJJA 1RZOB 1EV2A 2AQZA 4GAIA 4EKXB 1BARA 5BXRA 3ZXDA 4I4UA 1WD3A 4EB2B 4I7IA 3I29B 1JT3A 2NP0A 1Z0HA 2ET2A 2RG9B 2AAIB 4HR6C 3Q7WA 3IM7A 1SR4A 4LO3C 4ZBVB 1UPSA 4ISRA 1EPWA 2MIBA 1JY0A 5G00A 1T9FA 4KEJA 5BQUC 3FFZA 5JLVA 2D23A 2D7IA 4JKXB 2XOAA 2VSEA 4LO2C 4IZXA 4Z8SB 1JT4A 3BRDA 4LO8B 2Z48A 4KC3A 1ITBA 4JP0A 3W9TA 3HN1A 1IRAX 1R8OA 1V6VA 5FNWA 4LO0C 2BFHA 3CA5A 4GP0A 4QC4A 3N0KA 3FJKA 1WBAA 3R4UA 4G1RA 2Z49A 3N7MA 3FJBA 1TOOA 1KNMA 7I1BA 2D43A 4OUJA 9ILBA 1Q1UA 3CA1A 3AJ5A 2D44A 3HSMA 4EFQA 3BAHA 3BA5A 3IAGC 1JT7A 5EC5A 2Q9XA 1ISWA 3FUOA 3AJ6A 1CE7B 1PWAA 3O4AA 4P0LA 1BLDA 1SZ6B 2WBCA 3S8JA 2P23A 4G6JA 2Y9FA 4ISQA 3HALA 3ZX7A 3OJMA 1FV3A 1TFMB 2BEBA 5DSSB 4J2KA 2R9KB 3JRRA 1K5UA 2X2TA 4LO1A 1E0OA 3WINA 2AXMA 4IZEA 4F83A 4J23B 3P6IA 1J0SA 2E4MA 1I1EA 3A21A 2HWAA 1JLYA 3FGMA 1PC8B 2F2FA 4I96A 3AH4A 3I2XA 3MPPG 2D20A 3BAUA 1HCEA 3AZWA 4QO3A 1WD4A 3O3QA 1S0EA 5DZUA 3C9ZA 1AXMA 4EEEB 4ZGRB 1PUUB 1FWVA 3EF2A 2ZQOA 4KEIA 1HWPB 3FJDA 3NBCA 3IIRA 4ZFYB 3ZC8A 1TIEA 2NM1A 4H9WA 3T8SA 3V0BB 1AVXB 5D63A 2NZ9A 3VWCA 5BP5C 4X38A 2I1BA 3POKA 3I2AA 4LO3A 4JAWA 4JQ0A 3RMYA 1IILA 1S0DA 4XKIA 21BIA 1G9DA 5EG6C 1I1BA 4OEFA 3FJHA 5BXTA 5BQUA 2RSTA 3O4CA 3BA7A 2NVHA 4FGFA 2LIEA 3IM6A 2VSAA 3PMEA 4J2YA 3CU1B 3BX1C 3H6RA 3O4OA 5DVHA 1S0CA 2FFUA 2AFGA 4LO2A 4XFTA 1W3GA 1RG8A 3JUTA 3WO2A 2D22A 4II0A 1FMMS 4QKRA 4LO0A 3F62B 1TWEA 6I1BA 5D62A 5GAQA 3UD7A 3VUOA 4ZFUB 2ESUA 3K1XA 2ZQNA 1FN0A 2HZ9A 1S0GA 2Y9GA 1RY7A 4X39A 4J2SA 2IHOA 4A7YA 4I37A 3VEQA 3FJIA 2WRYA 3AKGA 3PUBA 3F1RA 1JTCA 3NBNA 3BRGC 3VSFA 4I2SA 1L2HA 3OJVA 3RSJA 3BRFA 2NTDA 1ISXA 1II4A 2KI4A 1HKNA 1G9CA 3VT2A 4A7KA 1YBIA 4PC4A 3N7JA 2F8XC 2BEAA 2K43A 3CA4A 4GP3A 3BAOA 5BXSA 1CVSA 41BIA 3FJ9A 3O5WB 1ABRB 1YYNA 3V0AB 3CAHA 4Z9WB 2Y9XE 1DZCA 1HWNB 2NYYA 2K4AB 4I4XA 3BTAA 3RTJB 4WBCA 2GO2A 1FWUA 3PHZA 4IYBA 2FGFA 5FZUA 3WA1A 5B2HA 1DQGA 4OWLA 2VXTI 1VCLA 1BFGA 4FVVA 3UD8A 2UUSA 4I8MA 1TWMA 3FJ8A 1A8DA 2M49A 1M16A 1XG6A 3FJEA 2YUGA 3P53A 2KH2A 3WMVA 3HMYA 2MLLB 3FJJA 1XYFA 3H6SE 1IRPA 1S0LA 2D24A 3MALA 3ZXGA 1Z4SA 4P6AA 1DFQA 3BAVA 5FZYA 1N4KA 4GAFA 8I1BA 2IWTB 4DEPA 4ZFWB 3AH2A 1G9AA 2L5XA 3FUQA 2ERMA 1M2TB 4OEEA 4I4QA 4I1BA 3AZVA 2HWMA 3OGFA 1ISVA 4USPA 4LO7B 4JRAA 4G9NA 4I4VA 5EHAA 2X2SA 4OWJA 4Q9PA 5BP5A 3OBRA 5FZZA 1PUMB 3CA6A 3P6JA 1AVUA 5F8SA 1HWMB 1Q03A 1S0BA 1S0FA 3E8LC 3N7KA 3OGGA 4J2XA 1QQKA 1AFCA 2KKIA 4R6UB 2VXRA 3WO4A 4I4PA 3O44A 1ISZA 4H04A 5D61A 3VT0A 2J3PA 2QN4A 3QR5A 3FJAA 1HIBA 1YF8B 4KBBA 4IONA 2Q3NB 3UJ4A 1DZDA 5E24E 3CRIA 3CA0A 1DQOA 1V6UA 1IJTA 3AKIA 4XFSA 1JT5A 3NBEA 4I3NA 4XFUA 1BLAA 3HBWA 5F8WA 3UDAA 4OWKA 4EFRA 4I4RA 5BVPI 4ZKTB 1W3AA 5HPZA 4CJMA 1V6XA 1TTUA 4QBCA 4L4IA 3CA3A 1EVTA 4ZLBB 3UJ0A 1YTOA 2FO1A 4A7ZA 1ILR1 2D7RA 4IY9A 3V79C 1T4QA 3PG0A 4QD2B 4X37A 2D1ZA 3OJ2A 5BOWA 3O4DA 4EFPA 3A07A 3WMUA 1HWOB 3BAGA 1SR4C 3IM5A 1Q04A 1BFBA 3CRHA 1AVWB 3SNVA 4AN7B 3VT1A 4IQPA 1K5VA 5BXPA 1QXMA 4AN6A 1FGAA 4F34A 4USOA 4OW4A 4Q9GA 1DIWA 1OQLB 3Q7YA 3CQAA 2GZBA 4TLPA 2VU9A 1YXWA 4GOVA 4YOLA 3R4SA 1FQ9A 2DREA 2ZR1B 2KLLA 4I6IA 1AF9A 2DRZA 3V0BA 3BAQA 4LO7C 3OBTA 1IOBA 3O4BA 2KI6B 4QBVA 1JLXA 4P0KA 3KMVA 1W3FA 4ENDA 3FJFA 3ILAA 4OEGA 4Q91A 4G9MA 1MD6A 4QKSA 1DFCA 1PZZA 2HW9A 3RTIB 1FMZA 4HA2A 4IHZA 2VUAA 4KEKA 4D0ZA 4I1EA
chains in the Genus database with same CATH superfamily
3JPPA 4DENA 9ICQA 4MF8A 4N7RA 3ZC9A 2VANA 5D46A 2BCUA 5J2AA 3B9UA 5DUYA 4XRHA 1EYLA 3LLPA 5B3PA 5FNXA 1G82A 4DOCA 4KLUA 2VLCA 3LTQA 4R65A 4KLDA 4I2GA 3JPQA 5DECA 2BCVA 1DJSB 2E4MC 3FJCA 1IT0A 4G6MA 4QZDA 7ICUA 4Z6EA 5I1BA 3RMXA 1ZQOA 3QYDA 1RMLA 4IY8A 4UAZA 1P63A 4AT8B 4K8VA 3OUYA 4I4OA 3O49A 5F90A 4I4SA 3AKFA 1EV2A 4GAIA 1ZQWA 3ZXDA 4IQVA 3I29B 1Z0HA 4YMMA 1XSPA 5IILA 1ZQKA 4FH5A 1R8BA 4X4PA 4Z6DA 4QZIA 2D23A 3WFSC 4OAGA 2ISOA 1ITBA 4JP0A 4RQ5A 4R63A 3CA5A 1BPDA 4UB4A 4UY4A 5J0XA 5CP2A 9ILBA 3CA1A 3AJ5A 5J2HA 2I9GA 2Q9XA 1TFYA 1ISWA 4F5PA 9ICCA 7ICIA 1PWAA 1BLDA 5HRGA 1SZ6B 3S8JA 2Y9FA 3ZX7A 4ATBB 4NLNA 3JPRA 1TFMB 4J2KA 3JPOA 1K5UA 1ZQMA 2X2TA 2FMSA 4IZEA 4QZ8A 3PMLA 4RT2A 4Z6FA 3WFQE 4RQ7A 2O5AA 4QO3A 4AT9A 3AUOA 4QZAA 1S0EA 3C9ZA 4EEEB 4RWQA 1PUUB 5DEDA 2ZQOA 4KEIA 1HWPB 3IIRA 4H9WA 3V0BB 1TV9A 2I1BA 4KLEA 3AU6A 4X4NA 4NLKA 4JAWA 21BIA 1G9DA 4M47A 3NWIA 4FGFA 3PMEA 4J2YA 4I2IA 5DVHA 7ICFA 1W3GA 3LK9A 4II0A 7ICNA 4IQWA 3H3AA 5GAQA 3UD7A 3VUOA 5DBAA 4KLOA 2ESUA 2BCQA 2PFOA 9ICJA 2HZ9A 1S0GA 2Y9GA 4X39A 2IHOA 4RQ0A 2PXIA 3NBNA 3BRGC 3VSFA 4I2SA 1L2HA 7ICOA 2NTDA 8ICBA 1II4A 8ICAA 3H38A 3ISDA 2ZH5A 1JN3A 2RFFA 1YBIA 4FHYA 2F8XC 5J2FA 5BXSA 4UD4A 4Z9WB 3OVAA 1DZCA 2K4AB 4IYBA 9ICNA 3WA1A 1ZQBA 1BFGA 2PBEA 4FVVA 3UD8A 3ER9B 4XQ7A 2M49A 3P53A 2KH2A 4PHEA 4WH5A 1S0LA 2D24A 4MZGB 1DFQA 7ICPA 4YD2A 5FZYA 1N4KA 4GAFA 5IIIA 4X0AA 4RQ8A 2ID1A 4MF2A 1ISVA 4JRAA 4G9NA 9ICWA 4OWJA 5BP5A 4WC2A 4TUSA 1AVUA 8ICOA 4K4IA 3E8LC 4J2XA 2VXRA 3WO4A 3O44A 3NVOA 4PGQA 1MQ3A 4FHPA 4GXIA 8ICJA 4RQ1A 3CRIA 1V6UA 4EFRA 4I4RA 4S3NA 1W3AA 5HPZA 1TTUA 3RH5A 4ZLBB 1ILR1 4KLGA 4I27A 1ZQIA 4OAHA 4I2JA 3OJ2A 4EFPA 3HJ1A 3WMUA 1SR4C 5J0TA 5D49A 5J0OA 3TFRA 4F34A 7ICEA 1FGAA 1OQLB 4K4HA 2GZBA 9ICPA 4E8FA 3RH4A 2DREA 2KLLA 2DRZA 3BAQA 1JLXA 1UEVA 1UEUA 1MD6A 8ICZA 4HA2A 4KEKA 2HN1A 4FO6A 3K75D 3JPSA 3BA4A 5J0SA 3D7WB 1NO5A 4P2HA 1XZZA 4D0TA 1BPXA 3NBDA 1BPZA 4RPZA 5F8YA 1NUNA 3TC2A 5IIOA 5DB9A 4LEVA 3UD9A 2BCSA 1GGPB 3WINC 2RQ9A 3BADA 2Y9WC 3WO3A 5CFSA 3HIYA 2FDBM 4K97A 3HOMA 4D8HA 4I2AA 2F2FC 2K8RA 31BIA 3AKHA 1TP0A 4M9HA 1R8NA 3UQ0A 4GOYA 7ICHA 4EEBA 4TUPA 5HR9A 1ONKB 1Z2VA 2QYIB 4Z6CA 2AQZA 4EKXB 4LZDA 5BXRA 4I4UA 5JTGA 2RG9B 4MKPA 2AAIB 3Q7WA 3IM7A 4LO3C 4ZBVB 1OU5A 7ICQA 2MIBA 1T9FA 5BQUC 2XOAA 4I0UA 4IZXA 4Z8SB 4KC3A 4EV6A 1IRAX 4QZFA 1R8OA 1ZQCA 4NXXA 4LO0C 2BFHA 3WFRE 3FJKA 1WBAA 3N7MA 8ICNA 4WQLA 3HSMA 4EFQA 4M9JA 3BA5A 1ZQLA 3FUOA 2WBCA 2P23A 4NXWA 7ICTA 8ICMA 2W9MA 4QZEA 4M04A 2PFNA 5HHHA 3UQ2A 5CFTA 2E4MA 1I1EA 4PHDA 3WFPA 2HWAA 8ICHA 1ZQEA 4MFFA 3L9DA 3K7DA 1PC8B 3AH4A 3JPTA 3MPPG 3UPQA 4KB6A 5IIJA 8ICUA 9ICMA 2M2UA 1ZQSA 9ICLA 4X4VA 9ICBA 1TIEA 2NM1A 5J0WA 3RJGA 5D63A 2BPFA 3VWCA 3POKA 5CWRA 4JQ0A 8ICSA 1IILA 3V7JA 1I1BA 4OEFA 4UB5A 2RSTA 3LQCB 3O4CA 3BA7A 5J2DA 3IM6A 3HJ4A 1RG8A 2EWRA 4QKRA 3F62B 6I1BA 4F5QA 5DB6A 4ZFUB 5DBCA 3K1XA 4M9NA 1ZQZA 4WBZA 1RY7A 4I37A 3VEQA 4X4UA 2BBHA 2ZH1A 3AKGA 4WC3A 3PUBA 1JTCA 9ICRA 1R8AA 4NXUA 3OJVA 7ICLA 4NLZA 4AT8A 2KI4A 1HKNA 4A7KA 4I29A 4UBCA 2M2TA 3N7JA 1ZQYA 5HRLA 2K43A 3CA4A 1YYNA 4RWPA 3V0AB 4EBKA 2NYYA 3AQLA 3BTAA 4WBCA 1FWUA 9ICUA 5TZVA 4NY8A 1DQGA 4OWLA 2UUSA 1TWMA 2B51A 4P4PA 4DOAA 7ICMA 3FJJA 4UBBA 4JLXA 3OVSA 1Z4SA 4RQ6A 4P6AA 4GXJA 2IWTB 3FUQA 1M2TB 4YMOA 3JZ0A 1VJ7A 3AZVA 3OGFA 4LO7B 4I4VA 2X2SA 3PNCA 3OBRA 5FZZA 9ICIA 3P6JA 2IUBA 1HWMB 1S0BA 5BPCA 1S0FA 2Q66A 4I4PA 4NM1A 4H04A 2QN4A 3QR5A 2O1PA 3FJAA 4K96A 4KBBA 4ATBA 4DO9A 3UJ4A 5E24E 1DQOA 1IJTA 3AKIA 1ZQJA 4XFSA 1JT5A 5DKWA 4I3NA 4TUQA 4UB1A 3H39A 4OWKA 4ZKTB 1MIYA 7ICKA 1V6XA 4QBCA 5HHIA 7ICRA 8ICIA 4X4RA 1EVTA 2FO1A 4IY9A 2B56A 1Q78A 3C2MA 4QD2B 2DR8A 4WC5A 2D1ZA 4P4MA 3A07A 5HRKA 1HWOB 4UAWA 5HRHA 2ZH7A 4UAYA 3SNVA 4AN7B 9ICXA 1QXMA 4AN6A 4O5CA 4OW4A 1DIWA 3Q7YA 3CQAA 3R4SA 4X0BA 1FQ9A 2NRKA 1AF9A 3V0BA 4LO7C 3OBTA 4QBVA 4P0KA 4AT7B 1W3FA 4ENDA 3HW8A 2BBJA 1DFCA 4WC0A 2VUAA 2BE3A 4NXZA 4DOBA 2ZH9A 7ICSA 4WOYA 1QQLA 4ZA3B 3RJHA 1HCDA 3OGUA 1TVAA 2FFVA 4RPXA 1MC9A 9ICTA 3H6RB 1FV2A 3H6QA 1IHKA 5JMCA 4DCKC 7ICGA 4I4YA 4LO1C 3A23A 4EP7A 2DRYA 3RJKA 4QD2C 1V4AA 8ICRA 3A22A 1HUOA 4L4HA 3BB2A 3RH6A 2LIQA 3NJ5A 5J2KA 3VSZA 1BFFA 4X3AA 4P0JA 1ZQTA 2GA9D 4JKQA 1MIWA 2FMPA 4KLQA 4JWMA 1R89A 1BA7A 3NYBA 2M2VA 1ZQVA 4HJJA 1RZOB 2B4VA 4LVSA 2DRBA 1WD3A 4I7IA 2NP0A 4HR6C 3RJIA 1SR4A 4FHVA 1BPBA 1EPWA 8ICFA 1JY0A 5G00A 3AQKA 4KEJA 9ICFA 3FFZA 2BPCA 5JLVA 1ZQQA 5DB7A 4NXTA 2VSEA 5J2JA 4LEWA 4LO2C 3RJFA 2BPGA 1JT4A 5EOZA 4LO8B 5HREA 3W9TA 8ICLA 4M9GA 4P4OA 1V6VA 5FNWA 1XSLA 3N0KA 5J2EA 3R4UA 3FJBA 4KLTA 2PFQA 7I1BA 2D43A 3UXNA 3UXPA 3GDXA 5CB1A 1JT7A 4F5RA 3H37A 7ICJA 4P0LA 4KLIA 4FHWA 3V72A 4G6JA 5J2GA 4PPXA 4ISQA 3HALA 3OJMA 5CHEA 4WC1A 1FV3A 4O5EA 3JRRA 3C66A 4KLHA 1E0OA 3WINA 1KEJA 4F83A 3P6IA 1J0SA 2FMQA 8ICYA 2F2FA 4I96A 3BAUA 1YLQA 1HCEA 3AZWA 5IINA 4ZGRB 3EF2A 8ICQA 4K4GA 4NM2A 3NBCA 3T8SA 3B0XA 2NZ9A 4X38A 3MGHA 4UB3A 4XUSA 3I2AA 4LO3A 4PHAA 4FH3A 1S0DA 4M2YA 4XKIA 5EG6C 2ZH8A 3FJHA 5BQUA 2NVHA 2LIEA 1FA0A 4X5VA 2AFGA 3JUTA 4KLFA 5CFUA 4RT3A 3WO2A 9ICHA 2DRAA 2DVIA 4LO0A 4LT6A 2ZH6A 5D62A 4XJEA 4I2BA 9ICVA 1ZQGA 2WRYA 5D4BA 1ZQPA 3F1RA 1MQ2A 3RSJA 2GAFD 5J0RA 1G9CA 3VT2A 3MGIA 4PC4A 2BEAA 3BAOA 41BIA 3OUYB 3O5WB 4QZBA 3CAHA 1GPJA 4I2HA 2GO2A 1TFWA 5B2HA 2VXTI 1VCLA 4I8MA 1XG6A 3WMVA 8ICKA 2MLLB 4I2FA 1XYFA 1IRPA 3MALA 3ZXGA 3BAVA 4DEPA 4ZFWB 1G9AA 2L5XA 4OEEA 4I1BA 2HWMA 4USPA 1ZQAA 3CA6A 3C5FA 2P66A 4I2CA 1Q03A 4RPYA 3N7KA 2HN2A 1QQKA 1AFCA 3JYYA 4R6UB 1ISZA 5D61A 3VT0A 1ZQUA 1HIBA 3C2LA 7ICVA 5F2VO 4IONA 4X4OA 2Q3NB 1BLAA 3HBWA 4OAFA 4WBYA 5BVPI 3ISCA 4CJMA 2PFPA 5J2CA 4WCWA 4HX0A 1YTOA 1PX5A 4RWOA 4A7ZA 2D7RA 1T4QA 5J0PA 3HX0A 4X37A 5BOWA 3O4DA 3BAGA 5CR0A 3IM5A 4O9MA 2ISPA 3C5GA 4EBJA 4IQPA 4USOA 4Q9GA 4AT9B 4O67A 2VU9A 4GOVA 4YOLA 8ICCA 3OWGA 3FJFA 5J0YA 4F5NA 4OEGA 1JQRA 4UB2A 1PZZA 3RTIB 4KLMA 3AQMA 4QZ9A 4I1EA 1V6WA 2MC2A 1G9BA 1ISYA 1BPEA 4QZCA 4QALA 4MZFB 3S8KA 1NZKA 4PH5A 3Q7XA 5J29A 2P39A 5J2IA 4WC7A 3RJJA 2DS0A 1RPLA 4JPZA 4E80A 3AQNA 4K9BA 1WBCA 5DB8A 2GWSA 3AH1A 3CRGA 1R8CA 4KLLA 4I0YA 4ZOTA 4IG8A 3MCRA 1BFCA 1D0HA 4LZGA 5BOMA 1DLLA 4YD1A 1XHBA 2BCRA 5CHGA 1ZQFA 3RJEA 4PHPA 9ICKA 4I2EA 1JQZA 1AVAC 3ER8C 3N7LA 2NS2A 3V0AA 1ZQDA 5IIKA 1F31A 3MDAA 1BASA 5IIMA 1BARA 4RQ2A 1F5AA 4EB2B 1NOMA 1JT3A 4R64A 2ET2A 1JAJA 8ICXA 4F5OA 1UPSA 4ISRA 4O5KA 4K98A 1RZTA 2D7IA 4JKXB 4KLJA 5DBBA 3BRDA 2Z48A 3HN1A 1ZQNA 4M0AA 4GP0A 4QC4A 4G1RA 3WFOA 2Z49A 1TOOA 4QZHA 1KNMA 4OUJA 1Q1UA 2D44A 5HRFA 3C2KA 4WQKA 3BAHA 4X4SA 3IAGC 3JPNA 5EC5A 3JCFA 3AJ6A 1CE7B 3O4AA 8ICPA 1VFGA 4KM5A 2BEBA 5DSSB 4GXKA 2R9KB 4IQTA 4LO1A 4MFAA 2AXMA 4J23B 4PGXA 8ICTA 3A21A 4I2DA 3MDCA 1JLYA 3FGMA 4O68A 1ZQHA 3I2XA 4O6AA 4WC6A 9ICEA 4EEDA 2D20A 2ZHAA 5BOLA 8ICWA 1WD4A 8ICEA 3PMNA 3O3QA 5DZUA 1AXMA 1FWVA 1HUZA 3FJDA 5B3QA 4AT7A 3ISBA 3B0YA 4ZFYB 3ZC8A 1AVXB 4NKUA 3NKUA 5BP5C 4R66A 5J0UA 3AU2A 3RMYA 4M5DA 1WOTA 2DR7A 5BXTA 2DR5A 2VSAA 4H75A 3CU1B 3BX1C 3H6RA 3O4OA 4E7XA 1S0CA 2FFUA 4LO2A 4XFTA 5HRDA 4TURA 4JWNA 2ZH3A 5HC9A 1KDHA 2D22A 4PGYA 1FMMS 4LEYA 1TWEA 1ZQXA 1JMSA 2ZQNA 1FN0A 1ZJMA 9ICGA 4J2SA 5DDYA 4A7YA 3FJIA 4NXVA 4I28A 3BRFA 3C18A 3ERCC 4RQ3A 1ISXA 4X4TA 1ZJNA 4MFCA 3CK6A 4YN4A 5HRBA 4M9LA 4GP3A 3V7KA 1CVSA 3FJ9A 1ABRB 4FHXA 1XSNA 2Y9XE 4EGWA 1ZQRA 1HWNB 4K9AA 4I4XA 3RTJB 3PHZA 5FZUA 2FGFA 5HRIA 4XA5A 4OAIZ 5J2BA 8ICGA 9ICSA 3FJ8A 1A8DA 1M16A 3TFSA 3FJEA 2YUGA 9ICAA 3HMYA 3H6SE 1Q79A 4KLSA 8I1BA 4LEZA 3AH2A 3OVBA 2ERMA 4I4QA 4K99A 8ICVA 4JLZA 5J0QA 5EHAA 4Q9PA 1PUMB 2FCLA 2ZH4A 4YCXA 2DR9A 5F8SA 4IQUA 3OGGA 4YMNA 2KKIA 4O69A 3V7LA 4UD5A 4XQ8A 9ICOA 2J3PA 1YF8B 3UXOA 3HWTA 1DZDA 3CA0A 1BPYA 3NBEA 4XFUA 5F8WA 3UDAA 2IHMA 4L4IA 5CA7A 3UPSA 1UETA 4WC4A 3MBYA 4QZGA 4MZHA 1KNYA 3CA3A 2ZHBA 4X4QA 3UJ0A 3V79C 3PG0A 4RWNA 1Q04A 1BFBA 3CRHA 1AVWB 5DDMA 3OV7A 3VT1A 5BXPA 1K5VA 4TLPA 1YXWA 5CJ7A 2M2WA 2ZR1B 4I6IA 4NKTA 1IOBA 3O4BA 2KI6B 4RQ4A 3KMVA 3ILAA 4Q91A 2HHPA 4G9MA 4QKSA 2HW9A 1FMZA 4IHZA 2ZH2A 4FO1A 4D0ZA 1MIVA
chains in the Genus database with same CATH topology
1V6WA 2MC2A 1G9BA 1ISYA 4WOYA 1QQLA 4ZA3B 1HCDA 4QALA 3BA4A 4MZFB 4DENA 3S8KA 3D7WB 4N7RA 1NZKA 3ZC9A 1XZZA 3Q7XA 2FFVA 2P39A 4D0TA 1MC9A 3NBDA 3H6RB 3B9UA 5DUYA 2DS0A 1FV2A 1EYLA 3LLPA 3H6QA 5F8YA 5B3PA 4JPZA 1IHKA 1NUNA 5FNXA 4K9BA 1WBCA 3TC2A 5JMCA 4LEVA 1G82A 2VLCA 3LTQA 3AH1A 4DCKC 3CRGA 3UD9A 4I4YA 4LO1C 4I0YA 4ZOTA 3A23A 3MCRA 1GGPB 3WINC 2RQ9A 3BADA 2Y9WC 2DRYA 3WO3A 1BFCA 1D0HA 4QD2C 5CFSA 2FDBM 1DLLA 1DJSB 3A22A 2E4MC 3FJCA 1IT0A 3HOMA 4G6MA 4K97A 1XHBA 4L4HA 4D8HA 3BB2A 2F2FC 2K8RA 2LIQA 31BIA 3AKHA 3NJ5A 1TP0A 5I1BA 3VSZA 1BFFA 1R8NA 3RMXA 4X3AA 1JQZA 4P0JA 3QYDA 1RMLA 4GOYA 1AVAC 4IY8A 1P63A 3ER8C 2GA9D 4K8VA 4I4OA 4JKQA 3N7LA 2NS2A 3V0AA 3O49A 5F90A 4I4SA 1ONKB 1F31A 1Z2VA 3AKFA 1BA7A 2QYIB 1BASA 4HJJA 1RZOB 1EV2A 2AQZA 4GAIA 4EKXB 2B4VA 1BARA 5BXRA 3ZXDA 4I4UA 1WD3A 4EB2B 4I7IA 3I29B 1JT3A 2NP0A 1Z0HA 2ET2A 2RG9B 4MKPA 2AAIB 4HR6C 3Q7WA 3IM7A 1SR4A 4LO3C 4ZBVB 1UPSA 4ISRA 1EPWA 2MIBA 1JY0A 5G00A 1T9FA 4KEJA 5BQUC 3FFZA 5JLVA 4K98A 2D23A 2D7IA 4JKXB 4OAGA 2XOAA 2VSEA 4NXTA 4LEWA 4LO2C 4IZXA 4Z8SB 1JT4A 3BRDA 4LO8B 2Z48A 4KC3A 1ITBA 4JP0A 3W9TA 3HN1A 1IRAX 1R8OA 1V6VA 5FNWA 4LO0C 4NXXA 2BFHA 3CA5A 4GP0A 4QC4A 3N0KA 3FJKA 1WBAA 3R4UA 4G1RA 2Z49A 3N7MA 3FJBA 1TOOA 4UY4A 1KNMA 7I1BA 2D43A 4OUJA 9ILBA 4WQLA 1Q1UA 3CA1A 3AJ5A 2D44A 3HSMA 4EFQA 4WQKA 3BAHA 3BA5A 3IAGC 1JT7A 5EC5A 2Q9XA 1ISWA 3FUOA 3AJ6A 1CE7B 1PWAA 3O4AA 4P0LA 1BLDA 1SZ6B 2WBCA 3S8JA 2P23A 4G6JA 4NXWA 2Y9FA 4ISQA 3HALA 3ZX7A 4KM5A 3OJMA 5CHEA 1FV3A 1TFMB 2BEBA 5DSSB 4J2KA 2R9KB 3JRRA 1K5UA 2X2TA 4LO1A 1E0OA 3WINA 2AXMA 4IZEA 4F83A 4J23B 3P6IA 1J0SA 5CFTA 2E4MA 1I1EA 3A21A 2HWAA 1JLYA 3FGMA 1PC8B 2F2FA 3K7DA 4I96A 3AH4A 4O68A 3I2XA 4O6AA 3MPPG 2D20A 3BAUA 1HCEA 3AZWA 4QO3A 1WD4A 4KB6A 3O3QA 1S0EA 5DZUA 3C9ZA 1AXMA 4EEEB 4ZGRB 1PUUB 1FWVA 3EF2A 2ZQOA 4KEIA 1HWPB 3FJDA 5B3QA 3NBCA 3IIRA 4ZFYB 3ZC8A 1TIEA 2NM1A 4H9WA 3T8SA 3V0BB 1AVXB 5D63A 3NKUA 2NZ9A 3VWCA 5BP5C 4X38A 2I1BA 3POKA 3I2AA 4LO3A 4JAWA 4JQ0A 3RMYA 1IILA 1S0DA 4XKIA 21BIA 1G9DA 5EG6C 1I1BA 4OEFA 3FJHA 5BXTA 5BQUA 2RSTA 3O4CA 3BA7A 2NVHA 4FGFA 2LIEA 3IM6A 2VSAA 4H75A 3PMEA 4J2YA 3CU1B 3BX1C 3H6RA 3O4OA 5DVHA 1S0CA 2FFUA 2AFGA 4LO2A 4XFTA 1W3GA 1RG8A 3JUTA 2EWRA 5CFUA 3WO2A 2D22A 4II0A 1FMMS 4QKRA 4LEYA 4LO0A 3F62B 1TWEA 6I1BA 5D62A 5GAQA 3UD7A 3VUOA 4ZFUB 2ESUA 3K1XA 2ZQNA 1FN0A 4XJEA 2HZ9A 1S0GA 2Y9GA 1RY7A 4X39A 4J2SA 2IHOA 4A7YA 4I37A 3VEQA 3FJIA 2WRYA 4NXVA 3AKGA 3PUBA 3F1RA 1JTCA 3NBNA 3BRGC 3VSFA 4I2SA 1L2HA 3OJVA 3RSJA 3BRFA 4NXUA 3ERCC 2NTDA 2GAFD 1ISXA 1II4A 2KI4A 1HKNA 1G9CA 3VT2A 4A7KA 1YBIA 4PC4A 3N7JA 2F8XC 2BEAA 2K43A 3CA4A 4GP3A 3BAOA 5BXSA 1CVSA 41BIA 3FJ9A 3O5WB 1ABRB 1YYNA 3V0AB 3CAHA 4Z9WB 2Y9XE 1GPJA 1DZCA 1HWNB 2NYYA 2K4AB 4K9AA 4I4XA 3BTAA 3RTJB 4WBCA 2GO2A 1FWUA 3PHZA 4IYBA 2FGFA 5FZUA 3WA1A 5B2HA 1DQGA 4OWLA 2VXTI 4OAIZ 1VCLA 1BFGA 4FVVA 3UD8A 2UUSA 4I8MA 3ER9B 1TWMA 2B51A 3FJ8A 1A8DA 2M49A 1M16A 1XG6A 3FJEA 2YUGA 3P53A 2KH2A 3WMVA 3HMYA 4WH5A 2MLLB 3FJJA 1XYFA 3H6SE 1IRPA 1S0LA 2D24A 3MALA 4MZGB 4JLXA 3ZXGA 1Z4SA 4P6AA 1DFQA 3BAVA 5FZYA 1N4KA 4GAFA 8I1BA 2IWTB 4LEZA 4DEPA 4ZFWB 3AH2A 1G9AA 2L5XA 3FUQA 2ERMA 1M2TB 4OEEA 4I4QA 4I1BA 4K99A 3AZVA 2HWMA 3OGFA 1ISVA 4USPA 4JLZA 4LO7B 4JRAA 4G9NA 4I4VA 5EHAA 2X2SA 4OWJA 4Q9PA 5BP5A 3OBRA 5FZZA 1PUMB 3CA6A 2FCLA 3P6JA 1AVUA 5F8SA 1HWMB 1Q03A 1S0BA 1S0FA 3E8LC 3N7KA 3OGGA 4J2XA 1QQKA 1AFCA 2KKIA 4R6UB 4O69A 2VXRA 3WO4A 4I4PA 3O44A 1ISZA 4H04A 5D61A 3VT0A 2J3PA 2QN4A 3QR5A 3FJAA 1HIBA 4K96A 1YF8B 4KBBA 4IONA 2Q3NB 3UJ4A 1DZDA 5E24E 3CRIA 3CA0A 1DQOA 1V6UA 1IJTA 3AKIA 4XFSA 1JT5A 3NBEA 4I3NA 4XFUA 1BLAA 3HBWA 4OAFA 5F8WA 3UDAA 4OWKA 4EFRA 4I4RA 5BVPI 4ZKTB 1W3AA 5HPZA 4CJMA 1V6XA 1TTUA 4QBCA 4L4IA 4HX0A 4MZHA 3CA3A 1EVTA 4ZLBB 3UJ0A 1YTOA 2FO1A 4A7ZA 1ILR1 2D7RA 4IY9A 2B56A 3V79C 1T4QA 4OAHA 3PG0A 4QD2B 4X37A 2D1ZA 3OJ2A 5BOWA 3O4DA 4EFPA 3A07A 3WMUA 1HWOB 3BAGA 1SR4C 3IM5A 1Q04A 1BFBA 3CRHA 1AVWB 3SNVA 4AN7B 3VT1A 4IQPA 1K5VA 5BXPA 1QXMA 4AN6A 1FGAA 4F34A 4USOA 4OW4A 4Q9GA 1DIWA 1OQLB 3Q7YA 3CQAA 2GZBA 4TLPA 4O67A 2VU9A 1YXWA 4GOVA 4YOLA 3R4SA 1FQ9A 2DREA 2ZR1B 2KLLA 4I6IA 1AF9A 2DRZA 3V0BA 3BAQA 4LO7C 3OBTA 3OWGA 1IOBA 3O4BA 2KI6B 4QBVA 1JLXA 4P0KA 3KMVA 1W3FA 4ENDA 3FJFA 3ILAA 4OEGA 4Q91A 4G9MA 1MD6A 4QKSA 1DFCA 1PZZA 2HW9A 3RTIB 1FMZA 4HA2A 4IHZA 2VUAA 4FO1A 4KEKA 4D0ZA 4I1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V6W A;  2MC2 A;  1G9B A;  1ISY A;  1QQL A;  4ZA3 B;  1HCD A;  4QAL A;  3BA4 A;  4DEN A;  3S8K A;  3D7W B;  1NZK A;  3ZC9 A;  1XZZ A;  3Q7X A;  2FFV A;  2P39 A;  4D0T A;  1MC9 A;  3NBD A;  3H6R B;  3B9U A;  5DUY A;  2DS0 A;  1FV2 A;  1EYL A;  3LLP A;  3H6Q A;  5F8Y A;  4JPZ A;  1IHK A;  1NUN A;  5FNX A;  1WBC A;  3TC2 A;  5JMC A;  1G82 A;  2VLC A;  3LTQ A;  3AH1 A;  4DCK C;  3CRG A;  3UD9 A;  4I4Y A;  4LO1 C;  4I0Y A;  4ZOT A;  3A23 A;  1GGP B;  3WIN C;  2RQ9 A;  3BAD A;  2Y9W C;  2DRY A;  3WO3 A;  1BFC A;  1D0H A;  4QD2 C;  2FDB M;  1DLL A;  1DJS B;  3A22 A;  2E4M C;  3FJC A;  1IT0 A;  3HOM A;  4G6M A;  1XHB A;  4L4H A;  4D8H A;  3BB2 A;  2F2F C;  2K8R A;  2LIQ A;  31BI A;  3AKH A;  3NJ5 A;  1TP0 A;  5I1B A;  3VSZ A;  1BFF A;  1R8N A;  3RMX A;  4X3A A;  1JQZ A;  4P0J A;  3QYD A;  1RML A;  4GOY A;  1AVA C;  4IY8 A;  1P63 A;  4I4O A;  4JKQ A;  3N7L A;  3V0A A;  3O49 A;  5F90 A;  4I4S A;  1ONK B;  1F31 A;  1Z2V A;  3AKF A;  1BA7 A;  2QYI B;  1BAS A;  4HJJ A;  1RZO B;  1EV2 A;  2AQZ A;  4GAI A;  4EKX B;  1BAR A;  5BXR A;  3ZXD A;  4I4U A;  1WD3 A;  4EB2 B;  4I7I A;  3I29 B;  1JT3 A;  2NP0 A;  1Z0H A;  2ET2 A;  2RG9 B;  2AAI B;  4HR6 C;  3Q7W A;  3IM7 A;  1SR4 A;  4LO3 C;  4ZBV B;  1UPS A;  4ISR A;  1EPW A;  2MIB A;  1JY0 A;  5G00 A;  1T9F A;  4KEJ A;  5BQU C;  3FFZ A;  5JLV A;  2D23 A;  2D7I A;  4JKX B;  2XOA A;  2VSE A;  4LO2 C;  4IZX A;  4Z8S B;  1JT4 A;  3BRD A;  4LO8 B;  2Z48 A;  4KC3 A;  1ITB A;  4JP0 A;  3W9T A;  3HN1 A;  1IRA X;  1R8O A;  1V6V A;  5FNW A;  4LO0 C;  2BFH A;  3CA5 A;  4GP0 A;  4QC4 A;  3N0K A;  3FJK A;  1WBA A;  3R4U A;  4G1R A;  2Z49 A;  3N7M A;  3FJB A;  1TOO A;  1KNM A;  7I1B A;  2D43 A;  4OUJ A;  9ILB A;  1Q1U A;  3CA1 A;  3AJ5 A;  2D44 A;  3HSM A;  4EFQ A;  3BAH A;  3BA5 A;  3IAG C;  1JT7 A;  5EC5 A;  2Q9X A;  1ISW A;  3FUO A;  3AJ6 A;  1CE7 B;  1PWA A;  3O4A A;  4P0L A;  1BLD A;  1SZ6 B;  2WBC A;  3S8J A;  2P23 A;  4G6J A;  2Y9F A;  4ISQ A;  3HAL A;  3ZX7 A;  3OJM A;  1FV3 A;  1TFM B;  2BEB A;  5DSS B;  4J2K A;  2R9K B;  3JRR A;  1K5U A;  2X2T A;  4LO1 A;  1E0O A;  3WIN A;  2AXM A;  4IZE A;  4F83 A;  4J23 B;  3P6I A;  1J0S A;  2E4M A;  1I1E A;  3A21 A;  2HWA A;  1JLY A;  3FGM A;  1PC8 B;  2F2F A;  4I96 A;  3AH4 A;  3I2X A;  3MPP G;  2D20 A;  3BAU A;  1HCE A;  3AZW A;  4QO3 A;  1WD4 A;  3O3Q A;  1S0E A;  5DZU A;  3C9Z A;  1AXM A;  4EEE B;  4ZGR B;  1PUU B;  1FWV A;  3EF2 A;  2ZQO A;  4KEI A;  1HWP B;  3FJD A;  3NBC A;  3IIR A;  4ZFY B;  3ZC8 A;  1TIE A;  2NM1 A;  4H9W A;  3T8S A;  3V0B B;  1AVX B;  5D63 A;  2NZ9 A;  3VWC A;  5BP5 C;  4X38 A;  2I1B A;  3POK A;  3I2A A;  4LO3 A;  4JAW A;  4JQ0 A;  3RMY A;  1IIL A;  1S0D A;  4XKI A;  21BI A;  1G9D A;  5EG6 C;  1I1B A;  4OEF A;  3FJH A;  5BXT A;  5BQU A;  2RST A;  3O4C A;  3BA7 A;  2NVH A;  4FGF A;  2LIE A;  3IM6 A;  2VSA A;  3PME A;  4J2Y A;  3CU1 B;  3BX1 C;  3H6R A;  3O4O A;  5DVH A;  1S0C A;  2FFU A;  2AFG A;  4LO2 A;  4XFT A;  1W3G A;  1RG8 A;  3JUT A;  3WO2 A;  2D22 A;  4II0 A;  1FMM S;  4QKR A;  4LO0 A;  3F62 B;  1TWE A;  6I1B A;  5D62 A;  5GAQ A;  3UD7 A;  3VUO A;  4ZFU B;  2ESU A;  3K1X A;  2ZQN A;  1FN0 A;  2HZ9 A;  1S0G A;  2Y9G A;  1RY7 A;  4X39 A;  4J2S A;  2IHO A;  4A7Y A;  4I37 A;  3VEQ A;  3FJI A;  2WRY A;  3AKG A;  3PUB A;  3F1R A;  1JTC A;  3NBN A;  3BRG C;  3VSF A;  4I2S A;  1L2H A;  3OJV A;  3RSJ A;  3BRF A;  2NTD A;  1ISX A;  1II4 A;  2KI4 A;  1HKN A;  1G9C A;  3VT2 A;  4A7K A;  1YBI A;  4PC4 A;  3N7J A;  2F8X C;  2BEA A;  2K43 A;  3CA4 A;  4GP3 A;  3BAO A;  5BXS A;  1CVS A;  41BI A;  3FJ9 A;  3O5W B;  1ABR B;  1YYN A;  3V0A B;  3CAH A;  4Z9W B;  2Y9X E;  1DZC A;  1HWN B;  2NYY A;  2K4A B;  4I4X A;  3BTA A;  3RTJ B;  4WBC A;  2GO2 A;  1FWU A;  3PHZ A;  4IYB A;  2FGF A;  5FZU A;  3WA1 A;  5B2H A;  1DQG A;  4OWL A;  2VXT I;  1VCL A;  1BFG A;  4FVV A;  3UD8 A;  2UUS A;  4I8M A;  1TWM A;  3FJ8 A;  1A8D A;  2M49 A;  1M16 A;  1XG6 A;  3FJE A;  2YUG A;  3P53 A;  2KH2 A;  3WMV A;  3HMY A;  2MLL B;  3FJJ A;  1XYF A;  3H6S E;  1IRP A;  1S0L A;  2D24 A;  3MAL A;  3ZXG A;  1Z4S A;  4P6A A;  1DFQ A;  3BAV A;  5FZY A;  1N4K A;  4GAF A;  8I1B A;  2IWT B;  4DEP A;  4ZFW B;  3AH2 A;  1G9A A;  2L5X A;  3FUQ A;  2ERM A;  1M2T B;  4OEE A;  4I4Q A;  4I1B A;  3AZV A;  2HWM A;  3OGF A;  1ISV A;  4USP A;  4LO7 B;  4JRA A;  4G9N A;  4I4V A;  5EHA A;  2X2S A;  4OWJ A;  4Q9P A;  5BP5 A;  3OBR A;  5FZZ A;  1PUM B;  3CA6 A;  3P6J A;  1AVU A;  5F8S A;  1HWM B;  1Q03 A;  1S0B A;  1S0F A;  3E8L C;  3N7K A;  3OGG A;  4J2X A;  1QQK A;  1AFC A;  2KKI A;  4R6U B;  2VXR A;  3WO4 A;  4I4P A;  3O44 A;  1ISZ A;  4H04 A;  5D61 A;  3VT0 A;  2J3P A;  2QN4 A;  3QR5 A;  3FJA A;  1HIB A;  1YF8 B;  4KBB A;  4ION A;  2Q3N B;  3UJ4 A;  1DZD A;  5E24 E;  3CRI A;  3CA0 A;  1DQO A;  1V6U A;  1IJT A;  3AKI A;  4XFS A;  1JT5 A;  3NBE A;  4I3N A;  4XFU A;  1BLA A;  3HBW A;  5F8W A;  3UDA A;  4OWK A;  4EFR A;  4I4R A;  5BVP I;  4ZKT B;  1W3A A;  5HPZ A;  4CJM A;  1V6X A;  1TTU A;  4QBC A;  4L4I A;  3CA3 A;  1EVT A;  4ZLB B;  3UJ0 A;  1YTO A;  2FO1 A;  4A7Z A;  1ILR 1;  2D7R A;  4IY9 A;  3V79 C;  1T4Q A;  3PG0 A;  4QD2 B;  4X37 A;  2D1Z A;  3OJ2 A;  5BOW A;  3O4D A;  4EFP A;  3A07 A;  3WMU A;  1HWO B;  3BAG A;  1SR4 C;  3IM5 A;  1Q04 A;  1BFB A;  3CRH A;  1AVW B;  3SNV A;  4AN7 B;  3VT1 A;  4IQP A;  1K5V A;  5BXP A;  1QXM A;  4AN6 A;  1FGA A;  4F34 A;  4USO A;  4OW4 A;  4Q9G A;  1DIW A;  1OQL B;  3Q7Y A;  3CQA A;  2GZB A;  4TLP A;  2VU9 A;  1YXW A;  4GOV A;  4YOL A;  3R4S A;  1FQ9 A;  2DRE A;  2ZR1 B;  2KLL A;  4I6I A;  1AF9 A;  2DRZ A;  3V0B A;  3BAQ A;  4LO7 C;  3OBT A;  1IOB A;  3O4B A;  2KI6 B;  4QBV A;  1JLX A;  4P0K A;  3KMV A;  1W3F A;  4END A;  3FJF A;  3ILA A;  4OEG A;  4Q91 A;  4G9M A;  1MD6 A;  4QKS A;  1DFC A;  1PZZ A;  2HW9 A;  3RTI B;  1FMZ A;  4HA2 A;  4IHZ A;  2VUA A;  4KEK A;  4D0Z A;  4I1E A; 
#chains in the Genus database with same CATH topology
 3JPP A;  4DEN A;  9ICQ A;  4MF8 A;  4N7R A;  3ZC9 A;  2VAN A;  5D46 A;  2BCU A;  5J2A A;  3B9U A;  5DUY A;  4XRH A;  1EYL A;  3LLP A;  5B3P A;  5FNX A;  1G82 A;  4DOC A;  4KLU A;  2VLC A;  3LTQ A;  4R65 A;  4KLD A;  4I2G A;  3JPQ A;  5DEC A;  2BCV A;  1DJS B;  2E4M C;  3FJC A;  1IT0 A;  4G6M A;  4QZD A;  7ICU A;  4Z6E A;  5I1B A;  3RMX A;  1ZQO A;  3QYD A;  1RML A;  4IY8 A;  4UAZ A;  1P63 A;  4AT8 B;  4K8V A;  3OUY A;  4I4O A;  3O49 A;  5F90 A;  4I4S A;  3AKF A;  1EV2 A;  4GAI A;  1ZQW A;  3ZXD A;  4IQV A;  3I29 B;  1Z0H A;  4YMM A;  1XSP A;  5IIL A;  1ZQK A;  4FH5 A;  1R8B A;  4X4P A;  4Z6D A;  4QZI A;  2D23 A;  3WFS C;  4OAG A;  2ISO A;  1ITB A;  4JP0 A;  4RQ5 A;  4R63 A;  3CA5 A;  1BPD A;  4UB4 A;  4UY4 A;  5J0X A;  5CP2 A;  9ILB A;  3CA1 A;  3AJ5 A;  5J2H A;  2I9G A;  2Q9X A;  1TFY A;  1ISW A;  4F5P A;  9ICC A;  7ICI A;  1PWA A;  1BLD A;  5HRG A;  1SZ6 B;  3S8J A;  2Y9F A;  3ZX7 A;  4ATB B;  4NLN A;  3JPR A;  1TFM B;  4J2K A;  3JPO A;  1K5U A;  1ZQM A;  2X2T A;  2FMS A;  4IZE A;  4QZ8 A;  3PML A;  4RT2 A;  4Z6F A;  3WFQ E;  4RQ7 A;  2O5A A;  4QO3 A;  4AT9 A;  3AUO A;  4QZA A;  1S0E A;  3C9Z A;  4EEE B;  4RWQ A;  1PUU B;  5DED A;  2ZQO A;  4KEI A;  1HWP B;  3IIR A;  4H9W A;  3V0B B;  1TV9 A;  2I1B A;  4KLE A;  3AU6 A;  4X4N A;  4NLK A;  4JAW A;  21BI A;  1G9D A;  4M47 A;  3NWI A;  4FGF A;  3PME A;  4J2Y A;  4I2I A;  5DVH A;  7ICF A;  1W3G A;  3LK9 A;  4II0 A;  7ICN A;  4IQW A;  3H3A A;  5GAQ A;  3UD7 A;  3VUO A;  5DBA A;  4KLO A;  2ESU A;  2BCQ A;  2PFO A;  9ICJ A;  2HZ9 A;  1S0G A;  2Y9G A;  4X39 A;  2IHO A;  4RQ0 A;  2PXI A;  3NBN A;  3BRG C;  3VSF A;  4I2S A;  1L2H A;  7ICO A;  2NTD A;  8ICB A;  1II4 A;  8ICA A;  3H38 A;  3ISD A;  2ZH5 A;  1JN3 A;  2RFF A;  1YBI A;  4FHY A;  2F8X C;  5J2F A;  5BXS A;  4UD4 A;  4Z9W B;  3OVA A;  1DZC A;  2K4A B;  4IYB A;  9ICN A;  3WA1 A;  1ZQB A;  1BFG A;  2PBE A;  4FVV A;  3UD8 A;  3ER9 B;  4XQ7 A;  2M49 A;  3P53 A;  2KH2 A;  4PHE A;  4WH5 A;  1S0L A;  2D24 A;  4MZG B;  1DFQ A;  7ICP A;  4YD2 A;  5FZY A;  1N4K A;  4GAF A;  5III A;  4X0A A;  4RQ8 A;  2ID1 A;  4MF2 A;  1ISV A;  4JRA A;  4G9N A;  9ICW A;  4OWJ A;  5BP5 A;  4WC2 A;  4TUS A;  1AVU A;  8ICO A;  4K4I A;  3E8L C;  4J2X A;  2VXR A;  3WO4 A;  3O44 A;  3NVO A;  4PGQ A;  1MQ3 A;  4FHP A;  4GXI A;  8ICJ A;  4RQ1 A;  3CRI A;  1V6U A;  4EFR A;  4I4R A;  4S3N A;  1W3A A;  5HPZ A;  1TTU A;  3RH5 A;  4ZLB B;  1ILR 1;  4KLG A;  4I27 A;  1ZQI A;  4OAH A;  4I2J A;  3OJ2 A;  4EFP A;  3HJ1 A;  3WMU A;  1SR4 C;  5J0T A;  5D49 A;  5J0O A;  3TFR A;  4F34 A;  7ICE A;  1FGA A;  1OQL B;  4K4H A;  2GZB A;  9ICP A;  4E8F A;  3RH4 A;  2DRE A;  2KLL A;  2DRZ A;  3BAQ A;  1JLX A;  1UEV A;  1UEU A;  1MD6 A;  8ICZ A;  4HA2 A;  4KEK A;  2HN1 A;  4FO6 A;  3K75 D;  3JPS A;  3BA4 A;  5J0S A;  3D7W B;  1NO5 A;  4P2H A;  1XZZ A;  4D0T A;  1BPX A;  3NBD A;  1BPZ A;  4RPZ A;  5F8Y A;  1NUN A;  3TC2 A;  5IIO A;  5DB9 A;  4LEV A;  3UD9 A;  2BCS A;  1GGP B;  3WIN C;  2RQ9 A;  3BAD A;  2Y9W C;  3WO3 A;  5CFS A;  3HIY A;  2FDB M;  4K97 A;  3HOM A;  4D8H A;  4I2A A;  2F2F C;  2K8R A;  31BI A;  3AKH A;  1TP0 A;  4M9H A;  1R8N A;  3UQ0 A;  4GOY A;  7ICH A;  4EEB A;  4TUP A;  5HR9 A;  1ONK B;  1Z2V A;  2QYI B;  4Z6C A;  2AQZ A;  4EKX B;  4LZD A;  5BXR A;  4I4U A;  5JTG A;  2RG9 B;  4MKP A;  2AAI B;  3Q7W A;  3IM7 A;  4LO3 C;  4ZBV B;  1OU5 A;  7ICQ A;  2MIB A;  1T9F A;  5BQU C;  2XOA A;  4I0U A;  4IZX A;  4Z8S B;  4KC3 A;  4EV6 A;  1IRA X;  4QZF A;  1R8O A;  1ZQC A;  4NXX A;  4LO0 C;  2BFH A;  3WFR E;  3FJK A;  1WBA A;  3N7M A;  8ICN A;  4WQL A;  3HSM A;  4EFQ A;  4M9J A;  3BA5 A;  1ZQL A;  3FUO A;  2WBC A;  2P23 A;  4NXW A;  7ICT A;  8ICM A;  2W9M A;  4QZE A;  4M04 A;  2PFN A;  5HHH A;  3UQ2 A;  5CFT A;  2E4M A;  1I1E A;  4PHD A;  3WFP A;  2HWA A;  8ICH A;  1ZQE A;  4MFF A;  3L9D A;  3K7D A;  1PC8 B;  3AH4 A;  3JPT A;  3MPP G;  3UPQ A;  4KB6 A;  5IIJ A;  8ICU A;  9ICM A;  2M2U A;  1ZQS A;  9ICL A;  4X4V A;  9ICB A;  1TIE A;  2NM1 A;  5J0W A;  3RJG A;  5D63 A;  2BPF A;  3VWC A;  3POK A;  5CWR A;  4JQ0 A;  8ICS A;  1IIL A;  3V7J A;  1I1B A;  4OEF A;  4UB5 A;  2RST A;  3LQC B;  3O4C A;  3BA7 A;  5J2D A;  3IM6 A;  3HJ4 A;  1RG8 A;  2EWR A;  4QKR A;  3F62 B;  6I1B A;  4F5Q A;  5DB6 A;  4ZFU B;  5DBC A;  3K1X A;  4M9N A;  1ZQZ A;  4WBZ A;  1RY7 A;  4I37 A;  3VEQ A;  4X4U A;  2BBH A;  2ZH1 A;  3AKG A;  4WC3 A;  3PUB A;  1JTC A;  9ICR A;  1R8A A;  4NXU A;  3OJV A;  7ICL A;  4NLZ A;  4AT8 A;  2KI4 A;  1HKN A;  4A7K A;  4I29 A;  4UBC A;  2M2T A;  3N7J A;  1ZQY A;  5HRL A;  2K43 A;  3CA4 A;  1YYN A;  4RWP A;  3V0A B;  4EBK A;  2NYY A;  3AQL A;  3BTA A;  4WBC A;  1FWU A;  9ICU A;  5TZV A;  4NY8 A;  1DQG A;  4OWL A;  2UUS A;  1TWM A;  2B51 A;  4P4P A;  4DOA A;  7ICM A;  3FJJ A;  4UBB A;  4JLX A;  3OVS A;  1Z4S A;  4RQ6 A;  4P6A A;  4GXJ A;  2IWT B;  3FUQ A;  1M2T B;  4YMO A;  3JZ0 A;  1VJ7 A;  3AZV A;  3OGF A;  4LO7 B;  4I4V A;  2X2S A;  3PNC A;  3OBR A;  5FZZ A;  9ICI A;  3P6J A;  2IUB A;  1HWM B;  1S0B A;  5BPC A;  1S0F A;  2Q66 A;  4I4P A;  4NM1 A;  4H04 A;  2QN4 A;  3QR5 A;  2O1P A;  3FJA A;  4K96 A;  4KBB A;  4ATB A;  4DO9 A;  3UJ4 A;  5E24 E;  1DQO A;  1IJT A;  3AKI A;  1ZQJ A;  4XFS A;  1JT5 A;  5DKW A;  4I3N A;  4TUQ A;  4UB1 A;  3H39 A;  4OWK A;  4ZKT B;  1MIY A;  7ICK A;  1V6X A;  4QBC A;  5HHI A;  7ICR A;  8ICI A;  4X4R A;  1EVT A;  2FO1 A;  4IY9 A;  2B56 A;  1Q78 A;  3C2M A;  4QD2 B;  2DR8 A;  4WC5 A;  2D1Z A;  4P4M A;  3A07 A;  5HRK A;  1HWO B;  4UAW A;  5HRH A;  2ZH7 A;  4UAY A;  3SNV A;  4AN7 B;  9ICX A;  1QXM A;  4AN6 A;  4O5C A;  4OW4 A;  1DIW A;  3Q7Y A;  3CQA A;  3R4S A;  4X0B A;  1FQ9 A;  2NRK A;  1AF9 A;  3V0B A;  4LO7 C;  3OBT A;  4QBV A;  4P0K A;  4AT7 B;  1W3F A;  4END A;  3HW8 A;  2BBJ A;  1DFC A;  4WC0 A;  2VUA A;  2BE3 A;  4NXZ A;  4DOB A;  2ZH9 A;  7ICS A;  4WOY A;  1QQL A;  4ZA3 B;  3RJH A;  1HCD A;  3OGU A;  1TVA A;  2FFV A;  4RPX A;  1MC9 A;  9ICT A;  3H6R B;  1FV2 A;  3H6Q A;  1IHK A;  5JMC A;  4DCK C;  7ICG A;  4I4Y A;  4LO1 C;  3A23 A;  4EP7 A;  2DRY A;  3RJK A;  4QD2 C;  1V4A A;  8ICR A;  3A22 A;  1HUO A;  4L4H A;  3BB2 A;  3RH6 A;  2LIQ A;  3NJ5 A;  5J2K A;  3VSZ A;  1BFF A;  4X3A A;  4P0J A;  1ZQT A;  2GA9 D;  4JKQ A;  1MIW A;  2FMP A;  4KLQ A;  4JWM A;  1R89 A;  1BA7 A;  3NYB A;  2M2V A;  1ZQV A;  4HJJ A;  1RZO B;  2B4V A;  4LVS A;  2DRB A;  1WD3 A;  4I7I A;  2NP0 A;  4HR6 C;  3RJI A;  1SR4 A;  4FHV A;  1BPB A;  1EPW A;  8ICF A;  1JY0 A;  5G00 A;  3AQK A;  4KEJ A;  9ICF A;  3FFZ A;  2BPC A;  5JLV A;  1ZQQ A;  5DB7 A;  4NXT A;  2VSE A;  5J2J A;  4LEW A;  4LO2 C;  3RJF A;  2BPG A;  1JT4 A;  5EOZ A;  4LO8 B;  5HRE A;  3W9T A;  8ICL A;  4M9G A;  4P4O A;  1V6V A;  5FNW A;  1XSL A;  3N0K A;  5J2E A;  3R4U A;  3FJB A;  4KLT A;  2PFQ A;  7I1B A;  2D43 A;  3UXN A;  3UXP A;  3GDX A;  5CB1 A;  1JT7 A;  4F5R A;  3H37 A;  7ICJ A;  4P0L A;  4KLI A;  4FHW A;  3V72 A;  4G6J A;  5J2G A;  4PPX A;  4ISQ A;  3HAL A;  3OJM A;  5CHE A;  4WC1 A;  1FV3 A;  4O5E A;  3JRR A;  3C66 A;  4KLH A;  1E0O A;  3WIN A;  1KEJ A;  4F83 A;  3P6I A;  1J0S A;  2FMQ A;  8ICY A;  2F2F A;  4I96 A;  3BAU A;  1YLQ A;  1HCE A;  3AZW A;  5IIN A;  4ZGR B;  3EF2 A;  8ICQ A;  4K4G A;  4NM2 A;  3NBC A;  3T8S A;  3B0X A;  2NZ9 A;  4X38 A;  3MGH A;  4UB3 A;  4XUS A;  3I2A A;  4LO3 A;  4PHA A;  4FH3 A;  1S0D A;  4M2Y A;  4XKI A;  5EG6 C;  2ZH8 A;  3FJH A;  5BQU A;  2NVH A;  2LIE A;  1FA0 A;  4X5V A;  2AFG A;  3JUT A;  4KLF A;  5CFU A;  4RT3 A;  3WO2 A;  9ICH A;  2DRA A;  2DVI A;  4LO0 A;  4LT6 A;  2ZH6 A;  5D62 A;  4XJE A;  4I2B A;  9ICV A;  1ZQG A;  2WRY A;  5D4B A;  1ZQP A;  3F1R A;  1MQ2 A;  3RSJ A;  2GAF D;  5J0R A;  1G9C A;  3VT2 A;  3MGI A;  4PC4 A;  2BEA A;  3BAO A;  41BI A;  3OUY B;  3O5W B;  4QZB A;  3CAH A;  1GPJ A;  4I2H A;  2GO2 A;  1TFW A;  5B2H A;  2VXT I;  1VCL A;  4I8M A;  1XG6 A;  3WMV A;  8ICK A;  2MLL B;  4I2F A;  1XYF A;  1IRP A;  3MAL A;  3ZXG A;  3BAV A;  4DEP A;  4ZFW B;  1G9A A;  2L5X A;  4OEE A;  4I1B A;  2HWM A;  4USP A;  1ZQA A;  3CA6 A;  3C5F A;  2P66 A;  4I2C A;  1Q03 A;  4RPY A;  3N7K A;  2HN2 A;  1QQK A;  1AFC A;  3JYY A;  4R6U B;  1ISZ A;  5D61 A;  3VT0 A;  1ZQU A;  1HIB A;  3C2L A;  7ICV A;  5F2V O;  4ION A;  4X4O A;  2Q3N B;  1BLA A;  3HBW A;  4OAF A;  4WBY A;  5BVP I;  3ISC A;  4CJM A;  2PFP A;  5J2C A;  4WCW A;  4HX0 A;  1YTO A;  1PX5 A;  4RWO A;  4A7Z A;  2D7R A;  1T4Q A;  5J0P A;  3HX0 A;  4X37 A;  5BOW A;  3O4D A;  3BAG A;  5CR0 A;  3IM5 A;  4O9M A;  2ISP A;  3C5G A;  4EBJ A;  4IQP A;  4USO A;  4Q9G A;  4AT9 B;  4O67 A;  2VU9 A;  4GOV A;  4YOL A;  8ICC A;  3OWG A;  3FJF A;  5J0Y A;  4F5N A;  4OEG A;  1JQR A;  4UB2 A;  1PZZ A;  3RTI B;  4KLM A;  3AQM A;  4QZ9 A;  4I1E A;  1V6W A;  2MC2 A;  1G9B A;  1ISY A;  1BPE A;  4QZC A;  4QAL A;  4MZF B;  3S8K A;  1NZK A;  4PH5 A;  3Q7X A;  5J29 A;  2P39 A;  5J2I A;  4WC7 A;  3RJJ A;  2DS0 A;  1RPL A;  4JPZ A;  4E80 A;  3AQN A;  4K9B A;  1WBC A;  5DB8 A;  2GWS A;  3AH1 A;  3CRG A;  1R8C A;  4KLL A;  4I0Y A;  4ZOT A;  4IG8 A;  3MCR A;  1BFC A;  1D0H A;  4LZG A;  5BOM A;  1DLL A;  4YD1 A;  1XHB A;  2BCR A;  5CHG A;  1ZQF A;  3RJE A;  4PHP A;  9ICK A;  4I2E A;  1JQZ A;  1AVA C;  3ER8 C;  3N7L A;  2NS2 A;  3V0A A;  1ZQD A;  5IIK A;  1F31 A;  3MDA A;  1BAS A;  5IIM A;  1BAR A;  4RQ2 A;  1F5A A;  4EB2 B;  1NOM A;  1JT3 A;  4R64 A;  2ET2 A;  1JAJ A;  8ICX A;  4F5O A;  1UPS A;  4ISR A;  4O5K A;  4K98 A;  1RZT A;  2D7I A;  4JKX B;  4KLJ A;  5DBB A;  3BRD A;  2Z48 A;  3HN1 A;  1ZQN A;  4M0A A;  4GP0 A;  4QC4 A;  4G1R A;  3WFO A;  2Z49 A;  1TOO A;  4QZH A;  1KNM A;  4OUJ A;  1Q1U A;  2D44 A;  5HRF A;  3C2K A;  4WQK A;  3BAH A;  4X4S A;  3IAG C;  3JPN A;  5EC5 A;  3JCF A;  3AJ6 A;  1CE7 B;  3O4A A;  8ICP A;  1VFG A;  4KM5 A;  2BEB A;  5DSS B;  4GXK A;  2R9K B;  4IQT A;  4LO1 A;  4MFA A;  2AXM A;  4J23 B;  4PGX A;  8ICT A;  3A21 A;  4I2D A;  3MDC A;  1JLY A;  3FGM A;  4O68 A;  1ZQH A;  3I2X A;  4O6A A;  4WC6 A;  9ICE A;  4EED A;  2D20 A;  2ZHA A;  5BOL A;  8ICW A;  1WD4 A;  8ICE A;  3PMN A;  3O3Q A;  5DZU A;  1AXM A;  1FWV A;  1HUZ A;  3FJD A;  5B3Q A;  4AT7 A;  3ISB A;  3B0Y A;  4ZFY B;  3ZC8 A;  1AVX B;  4NKU A;  3NKU A;  5BP5 C;  4R66 A;  5J0U A;  3AU2 A;  3RMY A;  4M5D A;  1WOT A;  2DR7 A;  5BXT A;  2DR5 A;  2VSA A;  4H75 A;  3CU1 B;  3BX1 C;  3H6R A;  3O4O A;  4E7X A;  1S0C A;  2FFU A;  4LO2 A;  4XFT A;  5HRD A;  4TUR A;  4JWN A;  2ZH3 A;  5HC9 A;  1KDH A;  2D22 A;  4PGY A;  1FMM S;  4LEY A;  1TWE A;  1ZQX A;  1JMS A;  2ZQN A;  1FN0 A;  1ZJM A;  9ICG A;  4J2S A;  5DDY A;  4A7Y A;  3FJI A;  4NXV A;  4I28 A;  3BRF A;  3C18 A;  3ERC C;  4RQ3 A;  1ISX A;  4X4T A;  1ZJN A;  4MFC A;  3CK6 A;  4YN4 A;  5HRB A;  4M9L A;  4GP3 A;  3V7K A;  1CVS A;  3FJ9 A;  1ABR B;  4FHX A;  1XSN A;  2Y9X E;  4EGW A;  1ZQR A;  1HWN B;  4K9A A;  4I4X A;  3RTJ B;  3PHZ A;  5FZU A;  2FGF A;  5HRI A;  4XA5 A;  4OAI Z;  5J2B A;  8ICG A;  9ICS A;  3FJ8 A;  1A8D A;  1M16 A;  3TFS A;  3FJE A;  2YUG A;  9ICA A;  3HMY A;  3H6S E;  1Q79 A;  4KLS A;  8I1B A;  4LEZ A;  3AH2 A;  3OVB A;  2ERM A;  4I4Q A;  4K99 A;  8ICV A;  4JLZ A;  5J0Q A;  5EHA A;  4Q9P A;  1PUM B;  2FCL A;  2ZH4 A;  4YCX A;  2DR9 A;  5F8S A;  4IQU A;  3OGG A;  4YMN A;  2KKI A;  4O69 A;  3V7L A;  4UD5 A;  4XQ8 A;  9ICO A;  2J3P A;  1YF8 B;  3UXO A;  3HWT A;  1DZD A;  3CA0 A;  1BPY A;  3NBE A;  4XFU A;  5F8W A;  3UDA A;  2IHM A;  4L4I A;  5CA7 A;  3UPS A;  1UET A;  4WC4 A;  3MBY A;  4QZG A;  4MZH A;  1KNY A;  3CA3 A;  2ZHB A;  4X4Q A;  3UJ0 A;  3V79 C;  3PG0 A;  4RWN A;  1Q04 A;  1BFB A;  3CRH A;  1AVW B;  5DDM A;  3OV7 A;  3VT1 A;  5BXP A;  1K5V A;  4TLP A;  1YXW A;  5CJ7 A;  2M2W A;  2ZR1 B;  4I6I A;  4NKT A;  1IOB A;  3O4B A;  2KI6 B;  4RQ4 A;  3KMV A;  3ILA A;  4Q91 A;  2HHP A;  4G9M A;  4QKS A;  2HW9 A;  1FMZ A;  4IHZ A;  2ZH2 A;  4FO1 A;  4D0Z A;  1MIV A; 
#chains in the Genus database with same CATH homology
 1V6W A;  2MC2 A;  1G9B A;  1ISY A;  4WOY A;  1QQL A;  4ZA3 B;  1HCD A;  4QAL A;  3BA4 A;  4MZF B;  4DEN A;  3S8K A;  3D7W B;  4N7R A;  1NZK A;  3ZC9 A;  1XZZ A;  3Q7X A;  2FFV A;  2P39 A;  4D0T A;  1MC9 A;  3NBD A;  3H6R B;  3B9U A;  5DUY A;  2DS0 A;  1FV2 A;  1EYL A;  3LLP A;  3H6Q A;  5F8Y A;  5B3P A;  4JPZ A;  1IHK A;  1NUN A;  5FNX A;  4K9B A;  1WBC A;  3TC2 A;  5JMC A;  4LEV A;  1G82 A;  2VLC A;  3LTQ A;  3AH1 A;  4DCK C;  3CRG A;  3UD9 A;  4I4Y A;  4LO1 C;  4I0Y A;  4ZOT A;  3A23 A;  3MCR A;  1GGP B;  3WIN C;  2RQ9 A;  3BAD A;  2Y9W C;  2DRY A;  3WO3 A;  1BFC A;  1D0H A;  4QD2 C;  5CFS A;  2FDB M;  1DLL A;  1DJS B;  3A22 A;  2E4M C;  3FJC A;  1IT0 A;  3HOM A;  4G6M A;  4K97 A;  1XHB A;  4L4H A;  4D8H A;  3BB2 A;  2F2F C;  2K8R A;  2LIQ A;  31BI A;  3AKH A;  3NJ5 A;  1TP0 A;  5I1B A;  3VSZ A;  1BFF A;  1R8N A;  3RMX A;  4X3A A;  1JQZ A;  4P0J A;  3QYD A;  1RML A;  4GOY A;  1AVA C;  4IY8 A;  1P63 A;  3ER8 C;  2GA9 D;  4K8V A;  4I4O A;  4JKQ A;  3N7L A;  2NS2 A;  3V0A A;  3O49 A;  5F90 A;  4I4S A;  1ONK B;  1F31 A;  1Z2V A;  3AKF A;  1BA7 A;  2QYI B;  1BAS A;  4HJJ A;  1RZO B;  1EV2 A;  2AQZ A;  4GAI A;  4EKX B;  2B4V A;  1BAR A;  5BXR A;  3ZXD A;  4I4U A;  1WD3 A;  4EB2 B;  4I7I A;  3I29 B;  1JT3 A;  2NP0 A;  1Z0H A;  2ET2 A;  2RG9 B;  4MKP A;  2AAI B;  4HR6 C;  3Q7W A;  3IM7 A;  1SR4 A;  4LO3 C;  4ZBV B;  1UPS A;  4ISR A;  1EPW A;  2MIB A;  1JY0 A;  5G00 A;  1T9F A;  4KEJ A;  5BQU C;  3FFZ A;  5JLV A;  4K98 A;  2D23 A;  2D7I A;  4JKX B;  4OAG A;  2XOA A;  2VSE A;  4NXT A;  4LEW A;  4LO2 C;  4IZX A;  4Z8S B;  1JT4 A;  3BRD A;  4LO8 B;  2Z48 A;  4KC3 A;  1ITB A;  4JP0 A;  3W9T A;  3HN1 A;  1IRA X;  1R8O A;  1V6V A;  5FNW A;  4LO0 C;  4NXX A;  2BFH A;  3CA5 A;  4GP0 A;  4QC4 A;  3N0K A;  3FJK A;  1WBA A;  3R4U A;  4G1R A;  2Z49 A;  3N7M A;  3FJB A;  1TOO A;  4UY4 A;  1KNM A;  7I1B A;  2D43 A;  4OUJ A;  9ILB A;  4WQL A;  1Q1U A;  3CA1 A;  3AJ5 A;  2D44 A;  3HSM A;  4EFQ A;  4WQK A;  3BAH A;  3BA5 A;  3IAG C;  1JT7 A;  5EC5 A;  2Q9X A;  1ISW A;  3FUO A;  3AJ6 A;  1CE7 B;  1PWA A;  3O4A A;  4P0L A;  1BLD A;  1SZ6 B;  2WBC A;  3S8J A;  2P23 A;  4G6J A;  4NXW A;  2Y9F A;  4ISQ A;  3HAL A;  3ZX7 A;  4KM5 A;  3OJM A;  5CHE A;  1FV3 A;  1TFM B;  2BEB A;  5DSS B;  4J2K A;  2R9K B;  3JRR A;  1K5U A;  2X2T A;  4LO1 A;  1E0O A;  3WIN A;  2AXM A;  4IZE A;  4F83 A;  4J23 B;  3P6I A;  1J0S A;  5CFT A;  2E4M A;  1I1E A;  3A21 A;  2HWA A;  1JLY A;  3FGM A;  1PC8 B;  2F2F A;  3K7D A;  4I96 A;  3AH4 A;  4O68 A;  3I2X A;  4O6A A;  3MPP G;  2D20 A;  3BAU A;  1HCE A;  3AZW A;  4QO3 A;  1WD4 A;  4KB6 A;  3O3Q A;  1S0E A;  5DZU A;  3C9Z A;  1AXM A;  4EEE B;  4ZGR B;  1PUU B;  1FWV A;  3EF2 A;  2ZQO A;  4KEI A;  1HWP B;  3FJD A;  5B3Q A;  3NBC A;  3IIR A;  4ZFY B;  3ZC8 A;  1TIE A;  2NM1 A;  4H9W A;  3T8S A;  3V0B B;  1AVX B;  5D63 A;  3NKU A;  2NZ9 A;  3VWC A;  5BP5 C;  4X38 A;  2I1B A;  3POK A;  3I2A A;  4LO3 A;  4JAW A;  4JQ0 A;  3RMY A;  1IIL A;  1S0D A;  4XKI A;  21BI A;  1G9D A;  5EG6 C;  1I1B A;  4OEF A;  3FJH A;  5BXT A;  5BQU A;  2RST A;  3O4C A;  3BA7 A;  2NVH A;  4FGF A;  2LIE A;  3IM6 A;  2VSA A;  4H75 A;  3PME A;  4J2Y A;  3CU1 B;  3BX1 C;  3H6R A;  3O4O A;  5DVH A;  1S0C A;  2FFU A;  2AFG A;  4LO2 A;  4XFT A;  1W3G A;  1RG8 A;  3JUT A;  2EWR A;  5CFU A;  3WO2 A;  2D22 A;  4II0 A;  1FMM S;  4QKR A;  4LEY A;  4LO0 A;  3F62 B;  1TWE A;  6I1B A;  5D62 A;  5GAQ A;  3UD7 A;  3VUO A;  4ZFU B;  2ESU A;  3K1X A;  2ZQN A;  1FN0 A;  4XJE A;  2HZ9 A;  1S0G A;  2Y9G A;  1RY7 A;  4X39 A;  4J2S A;  2IHO A;  4A7Y A;  4I37 A;  3VEQ A;  3FJI A;  2WRY A;  4NXV A;  3AKG A;  3PUB A;  3F1R A;  1JTC A;  3NBN A;  3BRG C;  3VSF A;  4I2S A;  1L2H A;  3OJV A;  3RSJ A;  3BRF A;  4NXU A;  3ERC C;  2NTD A;  2GAF D;  1ISX A;  1II4 A;  2KI4 A;  1HKN A;  1G9C A;  3VT2 A;  4A7K A;  1YBI A;  4PC4 A;  3N7J A;  2F8X C;  2BEA A;  2K43 A;  3CA4 A;  4GP3 A;  3BAO A;  5BXS A;  1CVS A;  41BI A;  3FJ9 A;  3O5W B;  1ABR B;  1YYN A;  3V0A B;  3CAH A;  4Z9W B;  2Y9X E;  1GPJ A;  1DZC A;  1HWN B;  2NYY A;  2K4A B;  4K9A A;  4I4X A;  3BTA A;  3RTJ B;  4WBC A;  2GO2 A;  1FWU A;  3PHZ A;  4IYB A;  2FGF A;  5FZU A;  3WA1 A;  5B2H A;  1DQG A;  4OWL A;  2VXT I;  4OAI Z;  1VCL A;  1BFG A;  4FVV A;  3UD8 A;  2UUS A;  4I8M A;  3ER9 B;  1TWM A;  2B51 A;  3FJ8 A;  1A8D A;  2M49 A;  1M16 A;  1XG6 A;  3FJE A;  2YUG A;  3P53 A;  2KH2 A;  3WMV A;  3HMY A;  4WH5 A;  2MLL B;  3FJJ A;  1XYF A;  3H6S E;  1IRP A;  1S0L A;  2D24 A;  3MAL A;  4MZG B;  4JLX A;  3ZXG A;  1Z4S A;  4P6A A;  1DFQ A;  3BAV A;  5FZY A;  1N4K A;  4GAF A;  8I1B A;  2IWT B;  4LEZ A;  4DEP A;  4ZFW B;  3AH2 A;  1G9A A;  2L5X A;  3FUQ A;  2ERM A;  1M2T B;  4OEE A;  4I4Q A;  4I1B A;  4K99 A;  3AZV A;  2HWM A;  3OGF A;  1ISV A;  4USP A;  4JLZ A;  4LO7 B;  4JRA A;  4G9N A;  4I4V A;  5EHA A;  2X2S A;  4OWJ A;  4Q9P A;  5BP5 A;  3OBR A;  5FZZ A;  1PUM B;  3CA6 A;  2FCL A;  3P6J A;  1AVU A;  5F8S A;  1HWM B;  1Q03 A;  1S0B A;  1S0F A;  3E8L C;  3N7K A;  3OGG A;  4J2X A;  1QQK A;  1AFC A;  2KKI A;  4R6U B;  4O69 A;  2VXR A;  3WO4 A;  4I4P A;  3O44 A;  1ISZ A;  4H04 A;  5D61 A;  3VT0 A;  2J3P A;  2QN4 A;  3QR5 A;  3FJA A;  1HIB A;  4K96 A;  1YF8 B;  4KBB A;  4ION A;  2Q3N B;  3UJ4 A;  1DZD A;  5E24 E;  3CRI A;  3CA0 A;  1DQO A;  1V6U A;  1IJT A;  3AKI A;  4XFS A;  1JT5 A;  3NBE A;  4I3N A;  4XFU A;  1BLA A;  3HBW A;  4OAF A;  5F8W A;  3UDA A;  4OWK A;  4EFR A;  4I4R A;  5BVP I;  4ZKT B;  1W3A A;  5HPZ A;  4CJM A;  1V6X A;  1TTU A;  4QBC A;  4L4I A;  4HX0 A;  4MZH A;  3CA3 A;  1EVT A;  4ZLB B;  3UJ0 A;  1YTO A;  2FO1 A;  4A7Z A;  1ILR 1;  2D7R A;  4IY9 A;  2B56 A;  3V79 C;  1T4Q A;  4OAH A;  3PG0 A;  4QD2 B;  4X37 A;  2D1Z A;  3OJ2 A;  5BOW A;  3O4D A;  4EFP A;  3A07 A;  3WMU A;  1HWO B;  3BAG A;  1SR4 C;  3IM5 A;  1Q04 A;  1BFB A;  3CRH A;  1AVW B;  3SNV A;  4AN7 B;  3VT1 A;  4IQP A;  1K5V A;  5BXP A;  1QXM A;  4AN6 A;  1FGA A;  4F34 A;  4USO A;  4OW4 A;  4Q9G A;  1DIW A;  1OQL B;  3Q7Y A;  3CQA A;  2GZB A;  4TLP A;  4O67 A;  2VU9 A;  1YXW A;  4GOV A;  4YOL A;  3R4S A;  1FQ9 A;  2DRE A;  2ZR1 B;  2KLL A;  4I6I A;  1AF9 A;  2DRZ A;  3V0B A;  3BAQ A;  4LO7 C;  3OBT A;  3OWG A;  1IOB A;  3O4B A;  2KI6 B;  4QBV A;  1JLX A;  4P0K A;  3KMV A;  1W3F A;  4END A;  3FJF A;  3ILA A;  4OEG A;  4Q91 A;  4G9M A;  1MD6 A;  4QKS A;  1DFC A;  1PZZ A;  2HW9 A;  3RTI B;  1FMZ A;  4HA2 A;  4IHZ A;  2VUA A;  4FO1 A;  4KEK A;  4D0Z A;  4I1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...