2IHOA

Crystal structure of moa, a lectin from the mushroom marasmius oreades in complex with the trisaccharide gal(1,3)gal(1,4)glcnac
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
292
structure length
292
Chain Sequence
SLRRGIYHIENAGVPSAIDLKDGSSSDGTPIVGWQFTPDTINWHQLWLAEPIPNVADTFTLCNLFSGTYMDLYNGSSEAGTAVNGWQGTAFTTNPHQLWTIKKSSDGTSYKIQNYGSKTFVDLVNGDSSDGAKIAGWTGTWDEGNPHQKWYFNRMSVSSAEAQAAIARNPHIHGTYRGYILDGEYLVLPNATFTQIWKDSGLPGSKWREQIYDCDDFAIAMKAAVGKWGADSWKANGFAIFCGVMLGVNKAGDAAHAYNFTLTKDHADIVFFEPQNGGYLNDIGYDSYMAFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the marasmius oreades mushroom lectin in complex with a xenotransplantation epitope.
pubmed doi rcsb
source organism Marasmius oreades
molecule tags Sugar binding protein
molecule keywords Lectin
total genus 87
structure length 292
sequence length 292
ec nomenclature
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
A PF18021 Agglutinin_C Agglutinin C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2ihoA01
3.30.460.70 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 2ihoA02
1TOOA 5EHAA 4P0JA 3AJ5A 1JT3A 3K1XA 3Q7XA 3O3QA 3A07A 5D62A 3CA4A 4LO7B 4HJJA 1FMZA 1Z0HA 4I2SA 2KI6B 3BAUA 4Z8SB 2RSTA 3WA1A 1G9DA 2QN4A 1ISYA 1PC8B 1XYFA 1TWEA 4P0LA 2MC2A 2I1BA 3Q7YA 5BP5C 2D1ZA 3BX1C 3N7JA 1G9AA 2KI4A 4JP0A 4LO7C 4KBBA 4EFQA 2FGFA 1A8DA 1BASA 2D44A 4GAFA 3OBRA 2L5XA 4D0ZA 4G6JA 3ZX7A 1KNMA 4GOYA 2ERMA 4IHZA 1BARA 1FV3A 3ZC9A 3FJAA 1W3FA 1K5VA 2AAIB 3FJDA 1P63A 3CRIA 3OJMA 3NBDA 3KMVA 4J2XA 4ZBVB 9ILBA 1W3GA 1V6XA 2HZ9A 2ESUA 1SR4C 5HPZA 4R6UB 1Q1UA 3CA6A 4L4HA 4EB2B 2K4AB 1FGAA 1ISXA 1BFGA 3EF2A 4IY8A 3WO2A 4DEPA 3BTAA 2Z49A 3O5WB 4JKXB 1QQKA 5F8SA 3HSMA 1Q03A 3N7KA 3P6IA 4GP0A 3OGGA 4FGFA 3FJHA 4LO2C 4EFPA 3VT1A 4HR6C 4F83A 1IT0A 3BAGA 3UJ4A 6I1BA 1G9BA 4LO8B 3LTQA 8I1BA 1DLLA 3AKGA 4J23B 1V6UA 1TTUA 3IM6A 2FDBM 2Q9XA 4I8MA 4X39A 2MIBA 4QD2B 1HKNA 5D61A 4X38A 4LO0A 2VXTI 1YF8B 5F8WA 1TP0A 3N0KA 1XHBA 1EVTA 1MD6A 5F90A 2GO2A 2D7RA 4KEIA 2Y9WC 3A23A 2Y9XE 4A7YA 2BEBA 3WMVA 1JT7A 3VWCA 3CA5A 4H9WA 4A7KA 2YUGA 4JPZA 4I4QA 4OW4A 5B2HA 4J2KA 2E4MC 2ZR1B 1DQOA 4I7IA 1S0GA 3CA1A 31BIA 3BRGC 1V6VA 2NTDA 3HALA 4EEEB 2D20A 5BVPI 1DZCA 1JQZA 3V0AA 4ZLBB 3BRDA 3POKA 3O4OA 4XFSA 1ISVA 3IAGC 3B9UA 2FFVA 4I4OA 4DENA 3MALA 2GZBA 2K43A 3O4BA 5GAQA 1DJSB 4XFTA 3BADA 2P39A 1CE7B 4L4IA 3NJ5A 2R9KB 2ET2A 4I4PA 1RY7A 1JT5A 5BXSA 3A21A 5D63A 3S8JA 4LO0C 4QBVA 3RSJA 1IRAX 4F34A 3I2AA 4Q91A 1I1BA 4I1EA 4II0A 1PUMB 2NVHA 1D0HA 2K8RA 3R4SA 1HWNB 4OEEA 4I4VA 2D7IA 3T8SA 1T9FA 4YOLA 3W9TA 5BQUA 3H6RB 1HCDA 3P53A 1W3AA 1FMMS 3O4CA 4LO1A 2J3PA 2Q3NB 1FWUA 3JRRA 1ILR1 1BLDA 3PUBA 4G9NA 4QBCA 3SNVA 1JLXA 4AN7B 1PZZA 2AXMA 4ISRA 1FWVA 1IILA 1Z4SA 3UD8A 3AZVA 1II4A 5BOWA 1ONKB 3A22A 3V0AB 3HN1A 4QKRA 3CQAA 3VT2A 1YXWA 3RMYA 1N4KA 4JAWA 2DREA 3BAHA 3AZWA 2P23A 3ILAA 5BXTA 5BXRA 2ZQNA 1JTCA 3ZXGA 1TWMA 4ZKTB 3CU1B 2KH2A 1RG8A 1UPSA 3N7MA 4IZEA 1VCLA 4XKIA 3BB2A 1IJTA 4G9MA 1YBIA 4IONA 2NM1A 3OBTA 4A7ZA 2QYIB 3FUQA 4JQ0A 3E8LC 2NYYA 3CRGA 3CAHA 3NBEA 3BAVA 1L2HA 4XFUA 1EPWA 3Q7WA 2NP0A 1XG6A 4I4UA 5FZYA 4X37A 4ZFUB 4IYBA 1M2TB 2D43A 4G1RA 4KEKA 3HBWA 41BIA 2Y9FA 3CRHA 4I3NA 1IHKA 1FQ9A 2FO1A 2IHOA 4DCKC 5FNWA 3UDAA 1RZOB 2RQ9A 2X2SA 3VSFA 2IWTB 3FJKA 1DFCA 3S8KA 5EC5A 2LIQA 5FZZA 3WINC 1S0FA 2DS0A 1M16A 2WBCA 2AQZA 5F8YA 1HCEA 1BA7A 4J2YA 4JRAA 1K5UA 1JY0A 1WBCA 1ISZA 2KKIA 1BFBA 4OEFA 3H6RA 1ISWA 3FJCA 7I1BA 2AFGA 3F1RA 3CA3A 4OEGA 2LIEA 3OJVA 2XOAA 4Q9GA 3BA5A 1R8NA 3H6SE 4OWKA 3O4AA 3WO3A 3AKHA 1AVXB 4WBCA 3LLPA 3N7LA 1BFFA 4QD2C 3ZXDA 5G00A 3IIRA 4LO3C 1AFCA 4GAIA 3I29B 1HWOB 4GP3A 1WD4A 3BA7A 2M49A 3IM7A 1AF9A 3WINA 2BEAA 3FGMA 2VXRA 3O4DA 1Z2VA 1GGPB 1NZKA 2RG9B 3RMXA 2FFUA 1NUNA 1ITBA 4I4YA 3OGFA 1S0LA 3PHZA 4OWLA 3FJIA 1E0OA 3UD9A 3AKIA 3FJBA 2UUSA 4I0YA 3HMYA 3BA4A 4I37A 1WBAA 3RTIB 5DSSB 1R8OA 3BAOA 4ZGRB 2D24A 4ISQA 4USOA 3NBNA 3AH4A 4LO1C 4QKSA 3JUTA 3WO4A 2VLCA 1BLAA 3WMUA 5FNXA 3AH2A 2F2FC 1HWMB 1PUUB 4H04A 1AVAC 3H6QA 2VSEA 1J0SA 2X2TA 5BXPA 4IQPA 5I1BA 2DRYA 4KEJA 3V0BA 1YYNA 2VSAA 4OUJA 4G6MA 4QO3A 1S0CA 2BFHA 3MPPG 4JKQA 4I96A 4I4XA 4KC3A 4CJMA 4X3AA 4EFRA 5JLVA 2HW9A 1S0DA 4ZA3B 4I4SA 1IRPA 2HWMA 3FFZA 3V79C 3BAQA 3V0BB 1EV2A 3CA0A 5DZUA 1SR4A 1QQLA 1SZ6B 2DRZA 4USPA 1FV2A 1DIWA 3TC2A 1MC9A 2KLLA 3AJ6A 1V6WA 1AVUA 4D0TA 1G82A 3VT0A 4ENDA 4I6IA 3AH1A 1S0EA 1ABRB 3QYDA 3FUOA 1DFQA 1OQLB 3C9ZA 21BIA 5DVHA 3F62B 1HIBA 4AN6A 3FJ9A 3UJ0A 3I2XA 5E24E 1CVSA 3FJJA 4QALA 5EG6C 4LO2A 3O44A 1JT4A 2E4MA 1RMLA 4TLPA 3BRFA 1DQGA 3NBCA 1PWAA 4Z9WB 2HWAA 4P6AA 1IOBA 2F2FA 2D23A 1JLYA 1F31A 3ZC8A 4P0KA 3QR5A 3FJEA 3AKFA 4I1BA 3VEQA 1I1EA 4EKXB 1G9CA 2Y9GA 4ZOTA 3FJFA 1TIEA 4Q9PA 5BQUC 4FVVA 4D8HA 2D22A 1AXMA 3UD7A 3PMEA 2Z48A 2VU9A 1WD3A 2NZ9A 3FJ8A 5JMCA 1TFMB 3IM5A 4PC4A 1BFCA 1AVWB 1EYLA 4J2SA 4ZFWB 3VUOA 2ZQOA 3OJ2A 5BP5A 4LO3A 2MLLB 1DZDA 4OWJA 1Q04A 2F8XC 3HOMA 1HWPB 1XZZA 2WRYA 3RTJB 4IY9A 4QC4A 4I4RA 4GOVA 1FN0A 1S0BA 5DUYA 1QXMA 3P6JA 4HA2A 1T4QA 3PG0A 3R4UA 3VSZA 3D7WB 3O49A 4ZFYB 1YTOA 2VUAA 5FZUA 4IZXA
chains in the Genus database with same CATH superfamily
1TOOA 5EHAA 2HHPA 2ID1A 4P0JA 3AJ5A 4YMNA 1JT3A 1MQ3A 3K1XA 4EP7A 3Q7XA 3O3QA 5J2AA 4KLOA 3A07A 5D62A 3CA4A 9ICUA 4LO7B 3UQ2A 4HJJA 1TVAA 1KDHA 1ZQSA 5BOMA 1FMZA 1Z0HA 4I2SA 3NVOA 3H37A 4TURA 2DR7A 4MF2A 1TFYA 2KI6B 1MIYA 1ZQPA 3BAUA 4P4MA 4Z8SB 2RSTA 3WA1A 1G9DA 2QN4A 1ISYA 1PC8B 4JLZA 4WBYA 4K4GA 1XYFA 1TWEA 4P0LA 5DDYA 3JPOA 2MC2A 2I1BA 3Q7YA 5BP5C 4DOCA 2D1ZA 2BPFA 3B0XA 1ZQQA 3BX1C 3N7JA 4FO6A 1G9AA 3C18A 5B3PA 3C5FA 2KI4A 4PHAA 4JP0A 5J2IA 3AUOA 1BPYA 4WQKA 4LO7C 4KBBA 4EFQA 2FGFA 4FH3A 3V7LA 1A8DA 1BASA 2D44A 4GAFA 3C2KA 3OBRA 2L5XA 4RQ0A 4D0ZA 4G6JA 3ZX7A 1UEVA 1KNMA 4GOYA 1RPLA 1BPDA 2ERMA 2NS2A 1BARA 1FV3A 4IHZA 3ZC9A 2FCLA 5HR9A 3FJAA 4E8FA 4UAWA 2ZH6A 5J2FA 9ICCA 1W3FA 1K5VA 4HX0A 2AAIB 3FJDA 4IQTA 1P63A 4NXTA 4YN4A 4PPXA 8ICBA 3CRIA 3OJMA 2FMQA 4QZHA 3NBDA 5DDMA 3KMVA 4J2XA 7ICEA 4ZBVB 9ILBA 9ICQA 1W3GA 1V6XA 1ZQHA 4FHPA 2ISPA 2HZ9A 2ESUA 1SR4C 4OAHA 4UB3A 5HPZA 4YMOA 4RQ8A 4PHDA 4R6UB 4JWMA 1Q1UA 3CA6A 4L4HA 4EB2B 3MDCA 2K4AB 4UY4A 9ICTA 1FGAA 1ISXA 1BFGA 2O1PA 5J0SA 3EF2A 4IY8A 3WO2A 4DEPA 3BTAA 4R63A 2Z49A 3O5WB 4JKXB 1NOMA 3NKUA 4NY8A 1QQKA 5F8SA 2PBEA 5HRBA 3AU2A 8ICFA 3LK9A 3HSMA 1Q03A 3N7KA 3P6IA 4GP0A 1NO5A 3OGGA 4FGFA 4X0AA 3HX0A 3FJHA 1ZQVA 1ZQBA 4KLSA 4LO2C 4EFPA 3VT1A 9ICOA 4HR6C 4F83A 4EGWA 1IT0A 3BAGA 3UJ4A 6I1BA 1G9BA 4LO8B 3LTQA 2B51A 4F5RA 8I1BA 1DLLA 4F5PA 3AKGA 3TFRA 8ICRA 4J23B 1V6UA 4AT9A 1TTUA 5DB6A 3IM6A 2FDBM 2ZH9A 2Q9XA 4I8MA 4X39A 2DRBA 2MIBA 4QD2B 1ZQZA 5F2VO 4RQ2A 8ICLA 4RWQA 1HKNA 5D61A 1BPXA 4X38A 4XJEA 3RJHA 3ERCC 4LO0A 2VXTI 1YF8B 2ZH4A 5F8WA 1TP0A 4RPYA 3N0KA 1XHBA 7ICIA 5HRFA 1EVTA 9ICNA 1MD6A 5F90A 2GO2A 2D7RA 4KEIA 2Y9WC 3A23A 2Y9XE 4MZFB 2BEBA 3WMVA 4A7YA 4WCWA 9ICAA 1JT7A 5HRGA 3VWCA 4X4NA 3CA5A 4FHYA 4O68A 4XRHA 4H9WA 4A7KA 2ZH7A 2YUGA 4NXZA 4X4OA 4M9JA 4AT8B 9ICMA 4JPZA 4R65A 1ZQFA 4O9MA 4I4QA 5J0PA 4OW4A 4I2IA 5B2HA 5IIKA 8ICTA 2W9MA 4J2KA 2E4MC 2ZR1B 4FHXA 1DQOA 4M0AA 3B0YA 4LEWA 4FO1A 4XUSA 4I7IA 4FH5A 1ZQMA 1S0GA 3CA1A 31BIA 3RJGA 2PXIA 3BRGC 3OWGA 5DECA 3MGHA 1V6VA 2NTDA 5CB1A 3ISDA 1ZQJA 3HALA 2IHMA 4EEEB 4YD2A 2ZH8A 2D20A 5BVPI 4PGXA 5J2HA 4M9NA 1BPBA 4K96A 4IQWA 3HIYA 1DZCA 1JQZA 5J0UA 1V4AA 1ZQOA 3RJFA 2BBHA 7ICKA 7ICQA 3V0AA 4ZLBB 3BRDA 4LEYA 7ICMA 3POKA 3O4OA 4XFSA 2VANA 1ISVA 4WC2A 8ICSA 4QZEA 3IAGC 1ZQUA 2BBJA 4TUPA 1WOTA 4DOAA 3B9UA 4K99A 2FFVA 4UD4A 4I4OA 4DENA 3WFOA 3TFSA 3MALA 4M9HA 3UQ0A 2GZBA 1KNYA 3V7JA 2K43A 1JQRA 9ICFA 3PMNA 3O4BA 1ZQYA 5GAQA 1TFWA 1DJSB 4XFTA 3BADA 4PGQA 4YMMA 2P39A 5J2DA 1CE7B 4L4IA 2HN1A 2ZH5A 2PFOA 1FA0A 9ICSA 4K8VA 4X4QA 2ZHAA 3NJ5A 1ZQWA 2R9KB 2ET2A 4I4PA 3OGUA 1RY7A 1JN3A 8ICWA 4IQUA 1JT5A 5BXSA 3A21A 5D63A 4AT7A 1ZJMA 7ICVA 4UB2A 3S8JA 3ISBA 4RPZA 4I2CA 4LO0C 4QBVA 3RSJA 1IRAX 4M2YA 4F34A 3I2AA 1UEUA 5CWRA 4Q91A 4F5OA 1I1BA 1RZTA 4WC6A 4X4VA 4I1EA 4UBCA 2M2WA 4E80A 4NXVA 4I27A 4II0A 4QZDA 1PUMB 2NVHA 1D0HA 2K8RA 3R4SA 1HWNB 4OEEA 4I4VA 2D7IA 4XQ8A 4WC7A 5HRLA 3T8SA 4LT6A 4UB5A 1T9FA 4YOLA 3CK6A 5IIJA 4EBKA 4RT3A 3W9TA 5BQUA 3H6RB 1HCDA 4AT7B 5TZVA 3P53A 4PHEA 1W3AA 2M2VA 1FMMS 3MGIA 3O4CA 4LO1A 3UXNA 4S3NA 2RFFA 4O69A 2J3PA 2Q3NB 8ICPA 4I2JA 3OUYB 4I0UA 1FWUA 3JRRA 4M9LA 4YD1A 3OV7A 1ZQGA 7ICFA 1ILR1 1BLDA 2PFNA 4KLIA 3PUBA 4G9NA 4QBCA 4XQ7A 3SNVA 1JLXA 4AN7B 9ICLA 1Q78A 4KLQA 1PZZA 9ICIA 2AXMA 4EBJA 4NM1A 4ISRA 9ICEA 3HJ1A 4QZBA 4DOBA 9ICKA 1FWVA 1IILA 1Z4SA 7ICRA 2PFPA 3UD8A 1YLQA 3AZVA 1BPZA 4WC4A 4RQ6A 5IILA 3JPRA 1II4A 5BOWA 4R66A 1ONKB 3A22A 3V0AB 5CP2A 5HREA 3HN1A 4I28A 4UAYA 4QKRA 3CQAA 3VT2A 5J29A 1YXWA 4WH5A 3RMYA 3AQNA 1N4KA 2BCUA 4JAWA 2DREA 4I2HA 2BE3A 1ZQCA 1HUZA 1MQ2A 3BAHA 3AZWA 4QZAA 2P23A 5HC9A 3ILAA 5J2KA 9ICXA 7ICJA 4MZHA 3OUYA 5BXTA 4KLJA 4X4SA 4M9GA 3JPTA 2Q66A 5BXRA 2ZQNA 1JTCA 3ZXGA 1TWMA 4ZKTB 4NXWA 3RJIA 3CU1B 2FMSA 2KH2A 3L9DA 1RG8A 5HHHA 1UPSA 3JPPA 4RQ3A 3N7MA 4IZEA 4P2HA 4QZ9A 1VCLA 4XKIA 3BB2A 1IJTA 4G9MA 1YBIA 4IONA 2ISOA 4XA5A 4MZGB 4X0BA 2NM1A 3OBTA 3K7DA 2HN2A 4A7ZA 1ZQIA 2QYIB 2P66A 3FUQA 4JQ0A 3E8LC 2NYYA 3CRGA 2ZH1A 3CAHA 3NBEA 4JWNA 4RT2A 3BAVA 4PH5A 1L2HA 4XFUA 1EPWA 3Q7WA 2NP0A 4O67A 1XG6A 4NM2A 4I4UA 5FZYA 5J0RA 4R64A 8ICKA 4X37A 4ZFUB 4GXJA 4UAZA 4IYBA 5CFUA 1M2TB 3UXOA 2D43A 4E7XA 4G1RA 4NKUA 4KEKA 8ICJA 4PHPA 3HBWA 4EEDA 1ZQDA 1BPEA 2GWSA 4UB4A 41BIA 2BPGA 4KLDA 2Y9FA 4Z6CA 4I2BA 3CRHA 2BCVA 4I3NA 1IHKA 2BCRA 3MBYA 4NKTA 4M04A 1FQ9A 4X4PA 4MFCA 2FO1A 3UPSA 5CR0A 2IHOA 4DCKC 1OU5A 3WFPA 4RQ4A 4NLZA 4KB6A 2DR8A 2IUBA 4ATBB 3H38A 3AQKA 4LZDA 4QZ8A 5FNWA 4DO9A 3UDAA 1RZOB 4RQ7A 2RQ9A 2X2SA 3VSFA 8ICAA 2IWTB 9ICWA 3FJKA 3K75D 1DFCA 3S8KA 3V72A 5EC5A 7ICNA 5HRKA 4RQ1A 5DB8A 2ZH2A 7ICSA 2LIQA 5FZZA 4FHVA 3WINC 1F5AA 5HRDA 1TV9A 1S0FA 1VFGA 4I2EA 2DS0A 3H3AA 4KM5A 4KLHA 1M16A 4NXXA 2WBCA 4TUQA 5DEDA 2AQZA 5F8YA 1HCEA 4KLEA 1BA7A 4OAIZ 7ICHA 4X4RA 4J2YA 2B56A 1PX5A 4JRAA 1K5UA 4N7RA 1JY0A 1WBCA 1ISZA 2KKIA 4X5VA 2DR9A 1BFBA 4OEFA 3H6RA 1ISWA 3FJCA 7I1BA 2AFGA 3F1RA 3CA3A 4OEGA 5CJ7A 2LIEA 5DB9A 4WC5A 3C2MA 3WFRE 3OJVA 4GXKA 2XOAA 3JZ0A 3H39A 2B4VA 4K4HA 4LEZA 4Q9GA 3BA5A 1R8NA 4LZGA 3H6SE 4OWKA 3O4AA 3PMLA 8ICCA 3WO3A 3AKHA 2O5AA 1AVXB 4WBCA 3LLPA 2PFQA 1ZQRA 3N7LA 1BFFA 4QD2C 3ZXDA 5G00A 3IIRA 4LO3C 7ICOA 1AFCA 4OAGA 4GAIA 3I29B 5HHIA 1HWOB 3AQLA 4GP3A 2DRAA 1WD4A 3BA7A 2M49A 5CHGA 3IM7A 1AF9A 3WINA 3JCFA 2BEAA 4EV6A 3FGMA 2VXRA 4QZGA 4LVSA 3O4DA 8ICZA 1Z2VA 5J2JA 2DVIA 1GGPB 4PGYA 1XSPA 3RJJA 5CFTA 3UPQA 3HJ4A 2FMPA 1NZKA 2RG9B 3RMXA 2FFUA 1NUNA 5CA7A 1ITBA 4I4YA 4X4TA 3OGFA 1S0LA 4K9BA 3PHZA 3ER8C 4OWLA 3FJIA 1E0OA 3UD9A 1R8CA 4I2FA 5DBBA 3WFSC 3AKIA 3FJBA 2UUSA 4I0YA 5DKWA 3HMYA 1R8BA 3ER9B 4O5EA 3BA4A 4I37A 4WOYA 5EOZA 1WBAA 3RTIB 1JAJA 5BPCA 5DSSB 2GAFD 1ZQKA 1R8OA 3BAOA 4ZGRB 2D24A 2BCQA 1Q79A 4ISQA 1ZQNA 5BOLA 4USOA 3NBNA 3AH4A 3UXPA 4LO1C 4QKSA 3JUTA 3WO4A 8ICEA 2VLCA 3PNCA 4IQVA 1BLAA 1XSNA 3WMUA 4RWOA 5FNXA 5JTGA 5CHEA 3HW8A 1HUOA 8ICXA 3AH2A 2F2FC 1HWMB 1PUUB 4H04A 3MCRA 4FHWA 4I2DA 4LEVA 4QZCA 3NWIA 4RWNA 1AVAC 1ZQAA 3H6QA 4KLGA 4MF8A 2VSEA 1J0SA 2I9GA 2X2TA 5BXPA 1JMSA 5J0YA 4TUSA 4IQPA 5I1BA 4NLKA 2DRYA 4KEJA 3V0BA 5D4BA 3RH4A 1YYNA 8ICUA 2VSAA 4NLNA 4OUJA 8ICHA 5CFSA 1ZQXA 4G6MA 4QO3A 1GPJA 1S0CA 4WQLA 3C66A 1UETA 4AT8A 2BFHA 3MPPG 4H75A 1ZQLA 4JKQA 5DBAA 4I96A 5DBCA 4I4XA 4KC3A 3C5GA 5B3QA 1XSLA 9ICVA 4CJMA 3GDXA 4WC0A 4X3AA 4EFRA 3HWTA 3JYYA 2DR5A 5JLVA 4K97A 3JPNA 2HW9A 7ICTA 1S0DA 4ZA3B 4Z6FA 4I4SA 1IRPA 4MKPA 2HWMA 4ATBA 9ICPA 3FFZA 7ICUA 3AQMA 3V79C 3BAQA 3V0BB 2M2TA 1EV2A 2NRKA 3CA0A 5DZUA 1SR4A 1QQLA 1SZ6B 2DRZA 4WC1A 4USPA 3OVAA 5DB7A 2ZHBA 1FV2A 1DIWA 3TC2A 4JLXA 1MC9A 2KLLA 3AJ6A 5J0WA 1V6WA 8ICNA 1AVUA 3OVSA 3OVBA 4D0TA 8ICVA 9ICRA 1G82A 4KLUA 3RH5A 3VT0A 1KEJA 4UBBA 1ZJNA 4ENDA 4I29A 4I6IA 3AH1A 1S0EA 1ABRB 3QYDA 9ICJA 3FUOA 1DFQA 1OQLB 3C9ZA 21BIA 4O5CA 5DVHA 3F62B 1HIBA 4AN6A 4OAFA 3RJKA 3FJ9A 3UJ0A 3I2XA 5E24E 1CVSA 3FJJA 4AT9B 4QALA 4F5NA 5EG6C 3RJEA 4I2AA 8ICOA 4O5KA 4MFFA 5D49A 5IIIA 4LO2A 3O44A 2M2UA 1JT4A 2E4MA 1RMLA 4TLPA 4Z6EA 5J2EA 3BRFA 4X4UA 8ICQA 1DQGA 3WFQE 1MIVA 9ICBA 3JPSA 3NBCA 1PWAA 4F5QA 4M5DA 4Z9WB 2HWAA 4KLTA 3C2LA 3ISCA 4P6AA 1IOBA 2F2FA 4WC3A 9ICHA 2D23A 1JLYA 5D46A 5HRHA 1F31A 5J0TA 2BCSA 3ZC8A 3NYBA 4P0KA 8ICGA 4GXIA 3QR5A 8ICIA 3FJEA 7ICLA 1R8AA 3AKFA 4I1BA 3VEQA 1I1EA 4EKXB 1G9CA 1VJ7A 4UB1A 2Y9GA 1MIWA 4ZOTA 3FJFA 1TIEA 4O6AA 4Q9PA 5BQUC 4FVVA 4D8HA 2D22A 5IIMA 1AXMA 3UD7A 4IG8A 4RQ5A 3PMEA 2Z48A 4EEBA 2VU9A 1WD3A 4QZFA 2NZ9A 5IIOA 2EWRA 4K9AA 3FJ8A 5JMCA 3JPQA 1TFMB 2ZH3A 4K98A 3IM5A 4PC4A 4NXUA 4P4OA 1BFCA 4RPXA 1ZQTA 9ICGA 5J0XA 4YCXA 5J2BA 1AVWB 3MDAA 1EYLA 7ICGA 4J2SA 4ZFWB 3VUOA 2ZQOA 3OJ2A 5BP5A 5J2CA 4LO3A 5HRIA 2MLLB 1DZDA 4OWJA 4KLFA 4KLLA 4I2GA 4UD5A 4QZIA 1Q04A 2F8XC 5J0OA 3HOMA 5J0QA 5IINA 1HWPB 7ICPA 1XZZA 4KLMA 2WRYA 4K4IA 3RTJB 8ICYA 4IY9A 4WBZA 4QC4A 4I4RA 4Z6DA 2BPCA 3V7KA 4GOVA 4RWPA 1FN0A 1S0BA 5DUYA 3AU6A 3LQCB 5J2GA 1QXMA 8ICMA 3P6JA 4HA2A 3RH6A 4M47A 1T4QA 3PG0A 3R4UA 3VSZA 3D7WB 3O49A 4ZFYB 1YTOA 2VUAA 1R89A 4P4PA 5FZUA 4MFAA 4IZXA 1ZQEA 2GA9D
chains in the Genus database with same CATH topology
1TOOA 5EHAA 4P0JA 3AJ5A 1JT3A 3K1XA 3Q7XA 3O3QA 3A07A 5D62A 3CA4A 4LO7B 4HJJA 1FMZA 1Z0HA 4I2SA 2KI6B 3BAUA 4Z8SB 2RSTA 3WA1A 1G9DA 2QN4A 1ISYA 1PC8B 4JLZA 1XYFA 1TWEA 4P0LA 2MC2A 2I1BA 3Q7YA 5BP5C 2D1ZA 3BX1C 3N7JA 1G9AA 5B3PA 2KI4A 4JP0A 4WQKA 4LO7C 4KBBA 4EFQA 2FGFA 1A8DA 1BASA 2D44A 4GAFA 3OBRA 2L5XA 4D0ZA 4G6JA 3ZX7A 1KNMA 4GOYA 2ERMA 2NS2A 1BARA 1FV3A 4IHZA 3ZC9A 2FCLA 3FJAA 1W3FA 1K5VA 4HX0A 2AAIB 3FJDA 4NXTA 1P63A 3CRIA 3OJMA 3NBDA 3KMVA 4J2XA 4ZBVB 9ILBA 1W3GA 1V6XA 2HZ9A 2ESUA 1SR4C 4OAHA 5HPZA 4R6UB 1Q1UA 3CA6A 4L4HA 4EB2B 2K4AB 4UY4A 1FGAA 1ISXA 1BFGA 3EF2A 4IY8A 3WO2A 4DEPA 3BTAA 2Z49A 3O5WB 4JKXB 3NKUA 1QQKA 5F8SA 3HSMA 1Q03A 3N7KA 3P6IA 4GP0A 3OGGA 4FGFA 3FJHA 4LO2C 4EFPA 3VT1A 4HR6C 4F83A 1IT0A 3BAGA 3UJ4A 6I1BA 1G9BA 4LO8B 3LTQA 2B51A 8I1BA 1DLLA 3AKGA 4J23B 1V6UA 1TTUA 3IM6A 2FDBM 2Q9XA 4I8MA 4X39A 2MIBA 4QD2B 1HKNA 5D61A 4X38A 4XJEA 4LO0A 2VXTI 1YF8B 5F8WA 1TP0A 3N0KA 1XHBA 1EVTA 1MD6A 5F90A 2GO2A 2D7RA 4KEIA 2Y9WC 3A23A 2Y9XE 4MZFB 2BEBA 3WMVA 4A7YA 1JT7A 3VWCA 3CA5A 4O68A 4H9WA 4A7KA 2YUGA 4JPZA 4I4QA 4OW4A 5B2HA 4J2KA 2E4MC 2ZR1B 1DQOA 4LEWA 4FO1A 4I7IA 1S0GA 3CA1A 31BIA 3BRGC 3OWGA 1V6VA 2NTDA 3HALA 4EEEB 2D20A 5BVPI 4K96A 1DZCA 1JQZA 3V0AA 4ZLBB 3BRDA 3POKA 3O4OA 4XFSA 1ISVA 3IAGC 3B9UA 4K99A 2FFVA 4I4OA 4DENA 3MALA 2GZBA 2K43A 3O4BA 5GAQA 1DJSB 4XFTA 3BADA 2P39A 1CE7B 4L4IA 4K8VA 3NJ5A 2R9KB 2ET2A 4I4PA 1RY7A 1JT5A 5BXSA 3A21A 5D63A 3S8JA 4LO0C 4QBVA 3RSJA 1IRAX 4F34A 3I2AA 4Q91A 1I1BA 4I1EA 4NXVA 4II0A 1PUMB 2NVHA 1D0HA 2K8RA 3R4SA 1HWNB 4OEEA 4I4VA 2D7IA 3T8SA 1T9FA 4YOLA 3W9TA 5BQUA 3H6RB 1HCDA 3P53A 1W3AA 1FMMS 3O4CA 4LO1A 4O69A 2J3PA 2Q3NB 1FWUA 3JRRA 1ILR1 1BLDA 3PUBA 4G9NA 4QBCA 3SNVA 1JLXA 4AN7B 1PZZA 2AXMA 4ISRA 1FWVA 1IILA 1Z4SA 3UD8A 3AZVA 4LEYA 1II4A 5BOWA 1ONKB 3A22A 3V0AB 3HN1A 4QKRA 3CQAA 3VT2A 1YXWA 4WH5A 3RMYA 1N4KA 4JAWA 2DREA 3BAHA 3AZWA 2P23A 3ILAA 4MZHA 5BXTA 5BXRA 2ZQNA 1JTCA 3ZXGA 1TWMA 4ZKTB 4NXWA 3CU1B 2KH2A 1RG8A 1UPSA 3N7MA 4IZEA 1VCLA 4XKIA 3BB2A 1IJTA 4G9MA 1YBIA 4IONA 4MZGB 2NM1A 3OBTA 3K7DA 4A7ZA 2QYIB 3FUQA 4JQ0A 3E8LC 2NYYA 3CRGA 3CAHA 3NBEA 3BAVA 1L2HA 4XFUA 1EPWA 3Q7WA 2NP0A 4O67A 1XG6A 4I4UA 5FZYA 4X37A 4ZFUB 4IYBA 5CFUA 1M2TB 2D43A 4G1RA 4KEKA 3HBWA 41BIA 2Y9FA 3CRHA 4I3NA 1IHKA 1FQ9A 2FO1A 2IHOA 4DCKC 4KB6A 5FNWA 3UDAA 1RZOB 2RQ9A 2X2SA 3VSFA 2IWTB 3FJKA 1DFCA 3S8KA 5EC5A 2LIQA 5FZZA 3WINC 1S0FA 2DS0A 4KM5A 1M16A 4NXXA 2WBCA 2AQZA 5F8YA 1HCEA 1BA7A 4OAIZ 4J2YA 2B56A 4JRAA 1K5UA 4N7RA 1JY0A 1WBCA 1ISZA 2KKIA 1BFBA 4OEFA 3H6RA 1ISWA 3FJCA 7I1BA 2AFGA 3F1RA 3CA3A 4OEGA 2LIEA 3ERCC 3OJVA 2XOAA 4LEZA 2B4VA 4Q9GA 3BA5A 1R8NA 3H6SE 4OWKA 3O4AA 3WO3A 3AKHA 1AVXB 4WBCA 3LLPA 3N7LA 1BFFA 4QD2C 3ZXDA 5G00A 3IIRA 4LO3C 1AFCA 4OAGA 4GAIA 3I29B 1HWOB 4GP3A 1WD4A 3BA7A 2M49A 3IM7A 1AF9A 3WINA 2BEAA 3FGMA 2VXRA 3O4DA 1Z2VA 1GGPB 5CFTA 1NZKA 2RG9B 3RMXA 2FFUA 1NUNA 1ITBA 4I4YA 3OGFA 1S0LA 4K9BA 3PHZA 3ER8C 4OWLA 3FJIA 1E0OA 3UD9A 3AKIA 3FJBA 2UUSA 4I0YA 3ER9B 3HMYA 3BA4A 4I37A 4WOYA 1WBAA 3RTIB 5DSSB 2GAFD 1R8OA 3BAOA 4ZGRB 2D24A 4ISQA 4USOA 3NBNA 3AH4A 4LO1C 4QKSA 3JUTA 3WO4A 2VLCA 1BLAA 3WMUA 5FNXA 5CHEA 3AH2A 2F2FC 1HWMB 1PUUB 4H04A 3MCRA 4LEVA 1AVAC 3H6QA 2VSEA 1J0SA 2X2TA 5BXPA 4IQPA 5I1BA 2DRYA 4KEJA 3V0BA 1YYNA 2VSAA 4OUJA 5CFSA 4G6MA 4QO3A 1GPJA 1S0CA 4WQLA 2BFHA 3MPPG 4H75A 4JKQA 4I96A 4I4XA 4KC3A 5B3QA 4CJMA 4X3AA 4EFRA 5JLVA 4K97A 2HW9A 1S0DA 4ZA3B 4I4SA 1IRPA 4MKPA 2HWMA 3FFZA 3V79C 3BAQA 3V0BB 1EV2A 3CA0A 5DZUA 1SR4A 1QQLA 1SZ6B 2DRZA 4USPA 1FV2A 1DIWA 3TC2A 4JLXA 1MC9A 2KLLA 3AJ6A 1V6WA 1AVUA 4D0TA 1G82A 3VT0A 4ENDA 4I6IA 3AH1A 1S0EA 1ABRB 3QYDA 3FUOA 1DFQA 1OQLB 3C9ZA 21BIA 5DVHA 3F62B 1HIBA 4AN6A 4OAFA 3FJ9A 3UJ0A 3I2XA 5E24E 1CVSA 3FJJA 4QALA 5EG6C 4LO2A 3O44A 1JT4A 2E4MA 1RMLA 4TLPA 3BRFA 1DQGA 3NBCA 1PWAA 4Z9WB 2HWAA 4P6AA 1IOBA 2F2FA 2D23A 1JLYA 1F31A 3ZC8A 4P0KA 3QR5A 3FJEA 3AKFA 4I1BA 3VEQA 1I1EA 4EKXB 1G9CA 2Y9GA 4ZOTA 3FJFA 1TIEA 4O6AA 4Q9PA 5BQUC 4FVVA 4D8HA 2D22A 1AXMA 3UD7A 3PMEA 2Z48A 2VU9A 1WD3A 2NZ9A 2EWRA 4K9AA 3FJ8A 5JMCA 1TFMB 4K98A 3IM5A 4PC4A 4NXUA 1BFCA 1AVWB 1EYLA 4J2SA 4ZFWB 3VUOA 2ZQOA 3OJ2A 5BP5A 4LO3A 2MLLB 1DZDA 4OWJA 1Q04A 2F8XC 3HOMA 1HWPB 1XZZA 2WRYA 3RTJB 4IY9A 4QC4A 4I4RA 4GOVA 1FN0A 1S0BA 5DUYA 1QXMA 3P6JA 4HA2A 1T4QA 3PG0A 3R4UA 3VSZA 3D7WB 3O49A 4ZFYB 1YTOA 2VUAA 5FZUA 4IZXA 2GA9D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOO A;  5EHA A;  4P0J A;  3AJ5 A;  1JT3 A;  3K1X A;  3Q7X A;  3O3Q A;  3A07 A;  5D62 A;  3CA4 A;  4LO7 B;  4HJJ A;  1FMZ A;  1Z0H A;  4I2S A;  2KI6 B;  3BAU A;  4Z8S B;  2RST A;  3WA1 A;  1G9D A;  2QN4 A;  1ISY A;  1PC8 B;  1XYF A;  1TWE A;  4P0L A;  2MC2 A;  2I1B A;  3Q7Y A;  5BP5 C;  2D1Z A;  3BX1 C;  3N7J A;  1G9A A;  2KI4 A;  4JP0 A;  4LO7 C;  4KBB A;  4EFQ A;  2FGF A;  1A8D A;  1BAS A;  2D44 A;  4GAF A;  3OBR A;  2L5X A;  4D0Z A;  4G6J A;  3ZX7 A;  1KNM A;  4GOY A;  2ERM A;  4IHZ A;  1BAR A;  1FV3 A;  3ZC9 A;  3FJA A;  1W3F A;  1K5V A;  2AAI B;  3FJD A;  1P63 A;  3CRI A;  3OJM A;  3NBD A;  3KMV A;  4J2X A;  4ZBV B;  9ILB A;  1W3G A;  1V6X A;  2HZ9 A;  2ESU A;  1SR4 C;  5HPZ A;  4R6U B;  1Q1U A;  3CA6 A;  4L4H A;  4EB2 B;  2K4A B;  1FGA A;  1ISX A;  1BFG A;  3EF2 A;  4IY8 A;  3WO2 A;  4DEP A;  3BTA A;  2Z49 A;  3O5W B;  4JKX B;  1QQK A;  5F8S A;  3HSM A;  1Q03 A;  3N7K A;  3P6I A;  4GP0 A;  3OGG A;  4FGF A;  3FJH A;  4LO2 C;  4EFP A;  3VT1 A;  4HR6 C;  4F83 A;  1IT0 A;  3BAG A;  3UJ4 A;  6I1B A;  1G9B A;  4LO8 B;  3LTQ A;  8I1B A;  1DLL A;  3AKG A;  4J23 B;  1V6U A;  1TTU A;  3IM6 A;  2FDB M;  2Q9X A;  4I8M A;  4X39 A;  2MIB A;  4QD2 B;  1HKN A;  5D61 A;  4X38 A;  4LO0 A;  2VXT I;  1YF8 B;  5F8W A;  1TP0 A;  3N0K A;  1XHB A;  1EVT A;  1MD6 A;  5F90 A;  2GO2 A;  2D7R A;  4KEI A;  2Y9W C;  3A23 A;  2Y9X E;  4A7Y A;  2BEB A;  3WMV A;  1JT7 A;  3VWC A;  3CA5 A;  4H9W A;  4A7K A;  2YUG A;  4JPZ A;  4I4Q A;  4OW4 A;  5B2H A;  4J2K A;  2E4M C;  2ZR1 B;  1DQO A;  4I7I A;  1S0G A;  3CA1 A;  31BI A;  3BRG C;  1V6V A;  2NTD A;  3HAL A;  4EEE B;  2D20 A;  5BVP I;  1DZC A;  1JQZ A;  3V0A A;  4ZLB B;  3BRD A;  3POK A;  3O4O A;  4XFS A;  1ISV A;  3IAG C;  3B9U A;  2FFV A;  4I4O A;  4DEN A;  3MAL A;  2GZB A;  2K43 A;  3O4B A;  5GAQ A;  1DJS B;  4XFT A;  3BAD A;  2P39 A;  1CE7 B;  4L4I A;  3NJ5 A;  2R9K B;  2ET2 A;  4I4P A;  1RY7 A;  1JT5 A;  5BXS A;  3A21 A;  5D63 A;  3S8J A;  4LO0 C;  4QBV A;  3RSJ A;  1IRA X;  4F34 A;  3I2A A;  4Q91 A;  1I1B A;  4I1E A;  4II0 A;  1PUM B;  2NVH A;  1D0H A;  2K8R A;  3R4S A;  1HWN B;  4OEE A;  4I4V A;  2D7I A;  3T8S A;  1T9F A;  4YOL A;  3W9T A;  5BQU A;  3H6R B;  1HCD A;  3P53 A;  1W3A A;  1FMM S;  3O4C A;  4LO1 A;  2J3P A;  2Q3N B;  1FWU A;  3JRR A;  1ILR 1;  1BLD A;  3PUB A;  4G9N A;  4QBC A;  3SNV A;  1JLX A;  4AN7 B;  1PZZ A;  2AXM A;  4ISR A;  1FWV A;  1IIL A;  1Z4S A;  3UD8 A;  3AZV A;  1II4 A;  5BOW A;  1ONK B;  3A22 A;  3V0A B;  3HN1 A;  4QKR A;  3CQA A;  3VT2 A;  1YXW A;  3RMY A;  1N4K A;  4JAW A;  2DRE A;  3BAH A;  3AZW A;  2P23 A;  3ILA A;  5BXT A;  5BXR A;  2ZQN A;  1JTC A;  3ZXG A;  1TWM A;  4ZKT B;  3CU1 B;  2KH2 A;  1RG8 A;  1UPS A;  3N7M A;  4IZE A;  1VCL A;  4XKI A;  3BB2 A;  1IJT A;  4G9M A;  1YBI A;  4ION A;  2NM1 A;  3OBT A;  4A7Z A;  2QYI B;  3FUQ A;  4JQ0 A;  3E8L C;  2NYY A;  3CRG A;  3CAH A;  3NBE A;  3BAV A;  1L2H A;  4XFU A;  1EPW A;  3Q7W A;  2NP0 A;  1XG6 A;  4I4U A;  5FZY A;  4X37 A;  4ZFU B;  4IYB A;  1M2T B;  2D43 A;  4G1R A;  4KEK A;  3HBW A;  41BI A;  2Y9F A;  3CRH A;  4I3N A;  1IHK A;  1FQ9 A;  2FO1 A;  2IHO A;  4DCK C;  5FNW A;  3UDA A;  1RZO B;  2RQ9 A;  2X2S A;  3VSF A;  2IWT B;  3FJK A;  1DFC A;  3S8K A;  5EC5 A;  2LIQ A;  5FZZ A;  3WIN C;  1S0F A;  2DS0 A;  1M16 A;  2WBC A;  2AQZ A;  5F8Y A;  1HCE A;  1BA7 A;  4J2Y A;  4JRA A;  1K5U A;  1JY0 A;  1WBC A;  1ISZ A;  2KKI A;  1BFB A;  4OEF A;  3H6R A;  1ISW A;  3FJC A;  7I1B A;  2AFG A;  3F1R A;  3CA3 A;  4OEG A;  2LIE A;  3OJV A;  2XOA A;  4Q9G A;  3BA5 A;  1R8N A;  3H6S E;  4OWK A;  3O4A A;  3WO3 A;  3AKH A;  1AVX B;  4WBC A;  3LLP A;  3N7L A;  1BFF A;  4QD2 C;  3ZXD A;  5G00 A;  3IIR A;  4LO3 C;  1AFC A;  4GAI A;  3I29 B;  1HWO B;  4GP3 A;  1WD4 A;  3BA7 A;  2M49 A;  3IM7 A;  1AF9 A;  3WIN A;  2BEA A;  3FGM A;  2VXR A;  3O4D A;  1Z2V A;  1GGP B;  1NZK A;  2RG9 B;  3RMX A;  2FFU A;  1NUN A;  1ITB A;  4I4Y A;  3OGF A;  1S0L A;  3PHZ A;  4OWL A;  3FJI A;  1E0O A;  3UD9 A;  3AKI A;  3FJB A;  2UUS A;  4I0Y A;  3HMY A;  3BA4 A;  4I37 A;  1WBA A;  3RTI B;  5DSS B;  1R8O A;  3BAO A;  4ZGR B;  2D24 A;  4ISQ A;  4USO A;  3NBN A;  3AH4 A;  4LO1 C;  4QKS A;  3JUT A;  3WO4 A;  2VLC A;  1BLA A;  3WMU A;  5FNX A;  3AH2 A;  2F2F C;  1HWM B;  1PUU B;  4H04 A;  1AVA C;  3H6Q A;  2VSE A;  1J0S A;  2X2T A;  5BXP A;  4IQP A;  5I1B A;  2DRY A;  4KEJ A;  3V0B A;  1YYN A;  2VSA A;  4OUJ A;  4G6M A;  4QO3 A;  1S0C A;  2BFH A;  3MPP G;  4JKQ A;  4I96 A;  4I4X A;  4KC3 A;  4CJM A;  4X3A A;  4EFR A;  5JLV A;  2HW9 A;  1S0D A;  4ZA3 B;  4I4S A;  1IRP A;  2HWM A;  3FFZ A;  3V79 C;  3BAQ A;  3V0B B;  1EV2 A;  3CA0 A;  5DZU A;  1SR4 A;  1QQL A;  1SZ6 B;  2DRZ A;  4USP A;  1FV2 A;  1DIW A;  3TC2 A;  1MC9 A;  2KLL A;  3AJ6 A;  1V6W A;  1AVU A;  4D0T A;  1G82 A;  3VT0 A;  4END A;  4I6I A;  3AH1 A;  1S0E A;  1ABR B;  3QYD A;  3FUO A;  1DFQ A;  1OQL B;  3C9Z A;  21BI A;  5DVH A;  3F62 B;  1HIB A;  4AN6 A;  3FJ9 A;  3UJ0 A;  3I2X A;  5E24 E;  1CVS A;  3FJJ A;  4QAL A;  5EG6 C;  4LO2 A;  3O44 A;  1JT4 A;  2E4M A;  1RML A;  4TLP A;  3BRF A;  1DQG A;  3NBC A;  1PWA A;  4Z9W B;  2HWA A;  4P6A A;  1IOB A;  2F2F A;  2D23 A;  1JLY A;  1F31 A;  3ZC8 A;  4P0K A;  3QR5 A;  3FJE A;  3AKF A;  4I1B A;  3VEQ A;  1I1E A;  4EKX B;  1G9C A;  2Y9G A;  4ZOT A;  3FJF A;  1TIE A;  4Q9P A;  5BQU C;  4FVV A;  4D8H A;  2D22 A;  1AXM A;  3UD7 A;  3PME A;  2Z48 A;  2VU9 A;  1WD3 A;  2NZ9 A;  3FJ8 A;  5JMC A;  1TFM B;  3IM5 A;  4PC4 A;  1BFC A;  1AVW B;  1EYL A;  4J2S A;  4ZFW B;  3VUO A;  2ZQO A;  3OJ2 A;  5BP5 A;  4LO3 A;  2MLL B;  1DZD A;  4OWJ A;  1Q04 A;  2F8X C;  3HOM A;  1HWP B;  1XZZ A;  2WRY A;  3RTJ B;  4IY9 A;  4QC4 A;  4I4R A;  4GOV A;  1FN0 A;  1S0B A;  5DUY A;  1QXM A;  3P6J A;  4HA2 A;  1T4Q A;  3PG0 A;  3R4U A;  3VSZ A;  3D7W B;  3O49 A;  4ZFY B;  1YTO A;  2VUA A;  5FZU A;  4IZX A; 
#chains in the Genus database with same CATH topology
 1TOO A;  5EHA A;  2HHP A;  2ID1 A;  4P0J A;  3AJ5 A;  4YMN A;  1JT3 A;  1MQ3 A;  3K1X A;  4EP7 A;  3Q7X A;  3O3Q A;  5J2A A;  4KLO A;  3A07 A;  5D62 A;  3CA4 A;  9ICU A;  4LO7 B;  3UQ2 A;  4HJJ A;  1TVA A;  1KDH A;  1ZQS A;  5BOM A;  1FMZ A;  1Z0H A;  4I2S A;  3NVO A;  3H37 A;  4TUR A;  2DR7 A;  4MF2 A;  1TFY A;  2KI6 B;  1MIY A;  1ZQP A;  3BAU A;  4P4M A;  4Z8S B;  2RST A;  3WA1 A;  1G9D A;  2QN4 A;  1ISY A;  1PC8 B;  4JLZ A;  4WBY A;  4K4G A;  1XYF A;  1TWE A;  4P0L A;  5DDY A;  3JPO A;  2MC2 A;  2I1B A;  3Q7Y A;  5BP5 C;  4DOC A;  2D1Z A;  2BPF A;  3B0X A;  1ZQQ A;  3BX1 C;  3N7J A;  4FO6 A;  1G9A A;  3C18 A;  5B3P A;  3C5F A;  2KI4 A;  4PHA A;  4JP0 A;  5J2I A;  3AUO A;  1BPY A;  4WQK A;  4LO7 C;  4KBB A;  4EFQ A;  2FGF A;  4FH3 A;  3V7L A;  1A8D A;  1BAS A;  2D44 A;  4GAF A;  3C2K A;  3OBR A;  2L5X A;  4RQ0 A;  4D0Z A;  4G6J A;  3ZX7 A;  1UEV A;  1KNM A;  4GOY A;  1RPL A;  1BPD A;  2ERM A;  2NS2 A;  1BAR A;  1FV3 A;  4IHZ A;  3ZC9 A;  2FCL A;  5HR9 A;  3FJA A;  4E8F A;  4UAW A;  2ZH6 A;  5J2F A;  9ICC A;  1W3F A;  1K5V A;  4HX0 A;  2AAI B;  3FJD A;  4IQT A;  1P63 A;  4NXT A;  4YN4 A;  4PPX A;  8ICB A;  3CRI A;  3OJM A;  2FMQ A;  4QZH A;  3NBD A;  5DDM A;  3KMV A;  4J2X A;  7ICE A;  4ZBV B;  9ILB A;  9ICQ A;  1W3G A;  1V6X A;  1ZQH A;  4FHP A;  2ISP A;  2HZ9 A;  2ESU A;  1SR4 C;  4OAH A;  4UB3 A;  5HPZ A;  4YMO A;  4RQ8 A;  4PHD A;  4R6U B;  4JWM A;  1Q1U A;  3CA6 A;  4L4H A;  4EB2 B;  3MDC A;  2K4A B;  4UY4 A;  9ICT A;  1FGA A;  1ISX A;  1BFG A;  2O1P A;  5J0S A;  3EF2 A;  4IY8 A;  3WO2 A;  4DEP A;  3BTA A;  4R63 A;  2Z49 A;  3O5W B;  4JKX B;  1NOM A;  3NKU A;  4NY8 A;  1QQK A;  5F8S A;  2PBE A;  5HRB A;  3AU2 A;  8ICF A;  3LK9 A;  3HSM A;  1Q03 A;  3N7K A;  3P6I A;  4GP0 A;  1NO5 A;  3OGG A;  4FGF A;  4X0A A;  3HX0 A;  3FJH A;  1ZQV A;  1ZQB A;  4KLS A;  4LO2 C;  4EFP A;  3VT1 A;  9ICO A;  4HR6 C;  4F83 A;  4EGW A;  1IT0 A;  3BAG A;  3UJ4 A;  6I1B A;  1G9B A;  4LO8 B;  3LTQ A;  2B51 A;  4F5R A;  8I1B A;  1DLL A;  4F5P A;  3AKG A;  3TFR A;  8ICR A;  4J23 B;  1V6U A;  4AT9 A;  1TTU A;  5DB6 A;  3IM6 A;  2FDB M;  2ZH9 A;  2Q9X A;  4I8M A;  4X39 A;  2DRB A;  2MIB A;  4QD2 B;  1ZQZ A;  5F2V O;  4RQ2 A;  8ICL A;  4RWQ A;  1HKN A;  5D61 A;  1BPX A;  4X38 A;  4XJE A;  3RJH A;  3ERC C;  4LO0 A;  2VXT I;  1YF8 B;  2ZH4 A;  5F8W A;  1TP0 A;  4RPY A;  3N0K A;  1XHB A;  7ICI A;  5HRF A;  1EVT A;  9ICN A;  1MD6 A;  5F90 A;  2GO2 A;  2D7R A;  4KEI A;  2Y9W C;  3A23 A;  2Y9X E;  4MZF B;  2BEB A;  3WMV A;  4A7Y A;  4WCW A;  9ICA A;  1JT7 A;  5HRG A;  3VWC A;  4X4N A;  3CA5 A;  4FHY A;  4O68 A;  4XRH A;  4H9W A;  4A7K A;  2ZH7 A;  2YUG A;  4NXZ A;  4X4O A;  4M9J A;  4AT8 B;  9ICM A;  4JPZ A;  4R65 A;  1ZQF A;  4O9M A;  4I4Q A;  5J0P A;  4OW4 A;  4I2I A;  5B2H A;  5IIK A;  8ICT A;  2W9M A;  4J2K A;  2E4M C;  2ZR1 B;  4FHX A;  1DQO A;  4M0A A;  3B0Y A;  4LEW A;  4FO1 A;  4XUS A;  4I7I A;  4FH5 A;  1ZQM A;  1S0G A;  3CA1 A;  31BI A;  3RJG A;  2PXI A;  3BRG C;  3OWG A;  5DEC A;  3MGH A;  1V6V A;  2NTD A;  5CB1 A;  3ISD A;  1ZQJ A;  3HAL A;  2IHM A;  4EEE B;  4YD2 A;  2ZH8 A;  2D20 A;  5BVP I;  4PGX A;  5J2H A;  4M9N A;  1BPB A;  4K96 A;  4IQW A;  3HIY A;  1DZC A;  1JQZ A;  5J0U A;  1V4A A;  1ZQO A;  3RJF A;  2BBH A;  7ICK A;  7ICQ A;  3V0A A;  4ZLB B;  3BRD A;  4LEY A;  7ICM A;  3POK A;  3O4O A;  4XFS A;  2VAN A;  1ISV A;  4WC2 A;  8ICS A;  4QZE A;  3IAG C;  1ZQU A;  2BBJ A;  4TUP A;  1WOT A;  4DOA A;  3B9U A;  4K99 A;  2FFV A;  4UD4 A;  4I4O A;  4DEN A;  3WFO A;  3TFS A;  3MAL A;  4M9H A;  3UQ0 A;  2GZB A;  1KNY A;  3V7J A;  2K43 A;  1JQR A;  9ICF A;  3PMN A;  3O4B A;  1ZQY A;  5GAQ A;  1TFW A;  1DJS B;  4XFT A;  3BAD A;  4PGQ A;  4YMM A;  2P39 A;  5J2D A;  1CE7 B;  4L4I A;  2HN1 A;  2ZH5 A;  2PFO A;  1FA0 A;  9ICS A;  4K8V A;  4X4Q A;  2ZHA A;  3NJ5 A;  1ZQW A;  2R9K B;  2ET2 A;  4I4P A;  3OGU A;  1RY7 A;  1JN3 A;  8ICW A;  4IQU A;  1JT5 A;  5BXS A;  3A21 A;  5D63 A;  4AT7 A;  1ZJM A;  7ICV A;  4UB2 A;  3S8J A;  3ISB A;  4RPZ A;  4I2C A;  4LO0 C;  4QBV A;  3RSJ A;  1IRA X;  4M2Y A;  4F34 A;  3I2A A;  1UEU A;  5CWR A;  4Q91 A;  4F5O A;  1I1B A;  1RZT A;  4WC6 A;  4X4V A;  4I1E A;  4UBC A;  2M2W A;  4E80 A;  4NXV A;  4I27 A;  4II0 A;  4QZD A;  1PUM B;  2NVH A;  1D0H A;  2K8R A;  3R4S A;  1HWN B;  4OEE A;  4I4V A;  2D7I A;  4XQ8 A;  4WC7 A;  5HRL A;  3T8S A;  4LT6 A;  4UB5 A;  1T9F A;  4YOL A;  3CK6 A;  5IIJ A;  4EBK A;  4RT3 A;  3W9T A;  5BQU A;  3H6R B;  1HCD A;  4AT7 B;  5TZV A;  3P53 A;  4PHE A;  1W3A A;  2M2V A;  1FMM S;  3MGI A;  3O4C A;  4LO1 A;  3UXN A;  4S3N A;  2RFF A;  4O69 A;  2J3P A;  2Q3N B;  8ICP A;  4I2J A;  3OUY B;  4I0U A;  1FWU A;  3JRR A;  4M9L A;  4YD1 A;  3OV7 A;  1ZQG A;  7ICF A;  1ILR 1;  1BLD A;  2PFN A;  4KLI A;  3PUB A;  4G9N A;  4QBC A;  4XQ7 A;  3SNV A;  1JLX A;  4AN7 B;  9ICL A;  1Q78 A;  4KLQ A;  1PZZ A;  9ICI A;  2AXM A;  4EBJ A;  4NM1 A;  4ISR A;  9ICE A;  3HJ1 A;  4QZB A;  4DOB A;  9ICK A;  1FWV A;  1IIL A;  1Z4S A;  7ICR A;  2PFP A;  3UD8 A;  1YLQ A;  3AZV A;  1BPZ A;  4WC4 A;  4RQ6 A;  5IIL A;  3JPR A;  1II4 A;  5BOW A;  4R66 A;  1ONK B;  3A22 A;  3V0A B;  5CP2 A;  5HRE A;  3HN1 A;  4I28 A;  4UAY A;  4QKR A;  3CQA A;  3VT2 A;  5J29 A;  1YXW A;  4WH5 A;  3RMY A;  3AQN A;  1N4K A;  2BCU A;  4JAW A;  2DRE A;  4I2H A;  2BE3 A;  1ZQC A;  1HUZ A;  1MQ2 A;  3BAH A;  3AZW A;  4QZA A;  2P23 A;  5HC9 A;  3ILA A;  5J2K A;  9ICX A;  7ICJ A;  4MZH A;  3OUY A;  5BXT A;  4KLJ A;  4X4S A;  4M9G A;  3JPT A;  2Q66 A;  5BXR A;  2ZQN A;  1JTC A;  3ZXG A;  1TWM A;  4ZKT B;  4NXW A;  3RJI A;  3CU1 B;  2FMS A;  2KH2 A;  3L9D A;  1RG8 A;  5HHH A;  1UPS A;  3JPP A;  4RQ3 A;  3N7M A;  4IZE A;  4P2H A;  4QZ9 A;  1VCL A;  4XKI A;  3BB2 A;  1IJT A;  4G9M A;  1YBI A;  4ION A;  2ISO A;  4XA5 A;  4MZG B;  4X0B A;  2NM1 A;  3OBT A;  3K7D A;  2HN2 A;  4A7Z A;  1ZQI A;  2QYI B;  2P66 A;  3FUQ A;  4JQ0 A;  3E8L C;  2NYY A;  3CRG A;  2ZH1 A;  3CAH A;  3NBE A;  4JWN A;  4RT2 A;  3BAV A;  4PH5 A;  1L2H A;  4XFU A;  1EPW A;  3Q7W A;  2NP0 A;  4O67 A;  1XG6 A;  4NM2 A;  4I4U A;  5FZY A;  5J0R A;  4R64 A;  8ICK A;  4X37 A;  4ZFU B;  4GXJ A;  4UAZ A;  4IYB A;  5CFU A;  1M2T B;  3UXO A;  2D43 A;  4E7X A;  4G1R A;  4NKU A;  4KEK A;  8ICJ A;  4PHP A;  3HBW A;  4EED A;  1ZQD A;  1BPE A;  2GWS A;  4UB4 A;  41BI A;  2BPG A;  4KLD A;  2Y9F A;  4Z6C A;  4I2B A;  3CRH A;  2BCV A;  4I3N A;  1IHK A;  2BCR A;  3MBY A;  4NKT A;  4M04 A;  1FQ9 A;  4X4P A;  4MFC A;  2FO1 A;  3UPS A;  5CR0 A;  2IHO A;  4DCK C;  1OU5 A;  3WFP A;  4RQ4 A;  4NLZ A;  4KB6 A;  2DR8 A;  2IUB A;  4ATB B;  3H38 A;  3AQK A;  4LZD A;  4QZ8 A;  5FNW A;  4DO9 A;  3UDA A;  1RZO B;  4RQ7 A;  2RQ9 A;  2X2S A;  3VSF A;  8ICA A;  2IWT B;  9ICW A;  3FJK A;  3K75 D;  1DFC A;  3S8K A;  3V72 A;  5EC5 A;  7ICN A;  5HRK A;  4RQ1 A;  5DB8 A;  2ZH2 A;  7ICS A;  2LIQ A;  5FZZ A;  4FHV A;  3WIN C;  1F5A A;  5HRD A;  1TV9 A;  1S0F A;  1VFG A;  4I2E A;  2DS0 A;  3H3A A;  4KM5 A;  4KLH A;  1M16 A;  4NXX A;  2WBC A;  4TUQ A;  5DED A;  2AQZ A;  5F8Y A;  1HCE A;  4KLE A;  1BA7 A;  4OAI Z;  7ICH A;  4X4R A;  4J2Y A;  2B56 A;  1PX5 A;  4JRA A;  1K5U A;  4N7R A;  1JY0 A;  1WBC A;  1ISZ A;  2KKI A;  4X5V A;  2DR9 A;  1BFB A;  4OEF A;  3H6R A;  1ISW A;  3FJC A;  7I1B A;  2AFG A;  3F1R A;  3CA3 A;  4OEG A;  5CJ7 A;  2LIE A;  5DB9 A;  4WC5 A;  3C2M A;  3WFR E;  3OJV A;  4GXK A;  2XOA A;  3JZ0 A;  3H39 A;  2B4V A;  4K4H A;  4LEZ A;  4Q9G A;  3BA5 A;  1R8N A;  4LZG A;  3H6S E;  4OWK A;  3O4A A;  3PML A;  8ICC A;  3WO3 A;  3AKH A;  2O5A A;  1AVX B;  4WBC A;  3LLP A;  2PFQ A;  1ZQR A;  3N7L A;  1BFF A;  4QD2 C;  3ZXD A;  5G00 A;  3IIR A;  4LO3 C;  7ICO A;  1AFC A;  4OAG A;  4GAI A;  3I29 B;  5HHI A;  1HWO B;  3AQL A;  4GP3 A;  2DRA A;  1WD4 A;  3BA7 A;  2M49 A;  5CHG A;  3IM7 A;  1AF9 A;  3WIN A;  3JCF A;  2BEA A;  4EV6 A;  3FGM A;  2VXR A;  4QZG A;  4LVS A;  3O4D A;  8ICZ A;  1Z2V A;  5J2J A;  2DVI A;  1GGP B;  4PGY A;  1XSP A;  3RJJ A;  5CFT A;  3UPQ A;  3HJ4 A;  2FMP A;  1NZK A;  2RG9 B;  3RMX A;  2FFU A;  1NUN A;  5CA7 A;  1ITB A;  4I4Y A;  4X4T A;  3OGF A;  1S0L A;  4K9B A;  3PHZ A;  3ER8 C;  4OWL A;  3FJI A;  1E0O A;  3UD9 A;  1R8C A;  4I2F A;  5DBB A;  3WFS C;  3AKI A;  3FJB A;  2UUS A;  4I0Y A;  5DKW A;  3HMY A;  1R8B A;  3ER9 B;  4O5E A;  3BA4 A;  4I37 A;  4WOY A;  5EOZ A;  1WBA A;  3RTI B;  1JAJ A;  5BPC A;  5DSS B;  2GAF D;  1ZQK A;  1R8O A;  3BAO A;  4ZGR B;  2D24 A;  2BCQ A;  1Q79 A;  4ISQ A;  1ZQN A;  5BOL A;  4USO A;  3NBN A;  3AH4 A;  3UXP A;  4LO1 C;  4QKS A;  3JUT A;  3WO4 A;  8ICE A;  2VLC A;  3PNC A;  4IQV A;  1BLA A;  1XSN A;  3WMU A;  4RWO A;  5FNX A;  5JTG A;  5CHE A;  3HW8 A;  1HUO A;  8ICX A;  3AH2 A;  2F2F C;  1HWM B;  1PUU B;  4H04 A;  3MCR A;  4FHW A;  4I2D A;  4LEV A;  4QZC A;  3NWI A;  4RWN A;  1AVA C;  1ZQA A;  3H6Q A;  4KLG A;  4MF8 A;  2VSE A;  1J0S A;  2I9G A;  2X2T A;  5BXP A;  1JMS A;  5J0Y A;  4TUS A;  4IQP A;  5I1B A;  4NLK A;  2DRY A;  4KEJ A;  3V0B A;  5D4B A;  3RH4 A;  1YYN A;  8ICU A;  2VSA A;  4NLN A;  4OUJ A;  8ICH A;  5CFS A;  1ZQX A;  4G6M A;  4QO3 A;  1GPJ A;  1S0C A;  4WQL A;  3C66 A;  1UET A;  4AT8 A;  2BFH A;  3MPP G;  4H75 A;  1ZQL A;  4JKQ A;  5DBA A;  4I96 A;  5DBC A;  4I4X A;  4KC3 A;  3C5G A;  5B3Q A;  1XSL A;  9ICV A;  4CJM A;  3GDX A;  4WC0 A;  4X3A A;  4EFR A;  3HWT A;  3JYY A;  2DR5 A;  5JLV A;  4K97 A;  3JPN A;  2HW9 A;  7ICT A;  1S0D A;  4ZA3 B;  4Z6F A;  4I4S A;  1IRP A;  4MKP A;  2HWM A;  4ATB A;  9ICP A;  3FFZ A;  7ICU A;  3AQM A;  3V79 C;  3BAQ A;  3V0B B;  2M2T A;  1EV2 A;  2NRK A;  3CA0 A;  5DZU A;  1SR4 A;  1QQL A;  1SZ6 B;  2DRZ A;  4WC1 A;  4USP A;  3OVA A;  5DB7 A;  2ZHB A;  1FV2 A;  1DIW A;  3TC2 A;  4JLX A;  1MC9 A;  2KLL A;  3AJ6 A;  5J0W A;  1V6W A;  8ICN A;  1AVU A;  3OVS A;  3OVB A;  4D0T A;  8ICV A;  9ICR A;  1G82 A;  4KLU A;  3RH5 A;  3VT0 A;  1KEJ A;  4UBB A;  1ZJN A;  4END A;  4I29 A;  4I6I A;  3AH1 A;  1S0E A;  1ABR B;  3QYD A;  9ICJ A;  3FUO A;  1DFQ A;  1OQL B;  3C9Z A;  21BI A;  4O5C A;  5DVH A;  3F62 B;  1HIB A;  4AN6 A;  4OAF A;  3RJK A;  3FJ9 A;  3UJ0 A;  3I2X A;  5E24 E;  1CVS A;  3FJJ A;  4AT9 B;  4QAL A;  4F5N A;  5EG6 C;  3RJE A;  4I2A A;  8ICO A;  4O5K A;  4MFF A;  5D49 A;  5III A;  4LO2 A;  3O44 A;  2M2U A;  1JT4 A;  2E4M A;  1RML A;  4TLP A;  4Z6E A;  5J2E A;  3BRF A;  4X4U A;  8ICQ A;  1DQG A;  3WFQ E;  1MIV A;  9ICB A;  3JPS A;  3NBC A;  1PWA A;  4F5Q A;  4M5D A;  4Z9W B;  2HWA A;  4KLT A;  3C2L A;  3ISC A;  4P6A A;  1IOB A;  2F2F A;  4WC3 A;  9ICH A;  2D23 A;  1JLY A;  5D46 A;  5HRH A;  1F31 A;  5J0T A;  2BCS A;  3ZC8 A;  3NYB A;  4P0K A;  8ICG A;  4GXI A;  3QR5 A;  8ICI A;  3FJE A;  7ICL A;  1R8A A;  3AKF A;  4I1B A;  3VEQ A;  1I1E A;  4EKX B;  1G9C A;  1VJ7 A;  4UB1 A;  2Y9G A;  1MIW A;  4ZOT A;  3FJF A;  1TIE A;  4O6A A;  4Q9P A;  5BQU C;  4FVV A;  4D8H A;  2D22 A;  5IIM A;  1AXM A;  3UD7 A;  4IG8 A;  4RQ5 A;  3PME A;  2Z48 A;  4EEB A;  2VU9 A;  1WD3 A;  4QZF A;  2NZ9 A;  5IIO A;  2EWR A;  4K9A A;  3FJ8 A;  5JMC A;  3JPQ A;  1TFM B;  2ZH3 A;  4K98 A;  3IM5 A;  4PC4 A;  4NXU A;  4P4O A;  1BFC A;  4RPX A;  1ZQT A;  9ICG A;  5J0X A;  4YCX A;  5J2B A;  1AVW B;  3MDA A;  1EYL A;  7ICG A;  4J2S A;  4ZFW B;  3VUO A;  2ZQO A;  3OJ2 A;  5BP5 A;  5J2C A;  4LO3 A;  5HRI A;  2MLL B;  1DZD A;  4OWJ A;  4KLF A;  4KLL A;  4I2G A;  4UD5 A;  4QZI A;  1Q04 A;  2F8X C;  5J0O A;  3HOM A;  5J0Q A;  5IIN A;  1HWP B;  7ICP A;  1XZZ A;  4KLM A;  2WRY A;  4K4I A;  3RTJ B;  8ICY A;  4IY9 A;  4WBZ A;  4QC4 A;  4I4R A;  4Z6D A;  2BPC A;  3V7K A;  4GOV A;  4RWP A;  1FN0 A;  1S0B A;  5DUY A;  3AU6 A;  3LQC B;  5J2G A;  1QXM A;  8ICM A;  3P6J A;  4HA2 A;  3RH6 A;  4M47 A;  1T4Q A;  3PG0 A;  3R4U A;  3VSZ A;  3D7W B;  3O49 A;  4ZFY B;  1YTO A;  2VUA A;  1R89 A;  4P4P A;  5FZU A;  4MFA A;  4IZX A;  1ZQE A;  2GA9 D; 
#chains in the Genus database with same CATH homology
 1TOO A;  5EHA A;  4P0J A;  3AJ5 A;  1JT3 A;  3K1X A;  3Q7X A;  3O3Q A;  3A07 A;  5D62 A;  3CA4 A;  4LO7 B;  4HJJ A;  1FMZ A;  1Z0H A;  4I2S A;  2KI6 B;  3BAU A;  4Z8S B;  2RST A;  3WA1 A;  1G9D A;  2QN4 A;  1ISY A;  1PC8 B;  4JLZ A;  1XYF A;  1TWE A;  4P0L A;  2MC2 A;  2I1B A;  3Q7Y A;  5BP5 C;  2D1Z A;  3BX1 C;  3N7J A;  1G9A A;  5B3P A;  2KI4 A;  4JP0 A;  4WQK A;  4LO7 C;  4KBB A;  4EFQ A;  2FGF A;  1A8D A;  1BAS A;  2D44 A;  4GAF A;  3OBR A;  2L5X A;  4D0Z A;  4G6J A;  3ZX7 A;  1KNM A;  4GOY A;  2ERM A;  2NS2 A;  1BAR A;  1FV3 A;  4IHZ A;  3ZC9 A;  2FCL A;  3FJA A;  1W3F A;  1K5V A;  4HX0 A;  2AAI B;  3FJD A;  4NXT A;  1P63 A;  3CRI A;  3OJM A;  3NBD A;  3KMV A;  4J2X A;  4ZBV B;  9ILB A;  1W3G A;  1V6X A;  2HZ9 A;  2ESU A;  1SR4 C;  4OAH A;  5HPZ A;  4R6U B;  1Q1U A;  3CA6 A;  4L4H A;  4EB2 B;  2K4A B;  4UY4 A;  1FGA A;  1ISX A;  1BFG A;  3EF2 A;  4IY8 A;  3WO2 A;  4DEP A;  3BTA A;  2Z49 A;  3O5W B;  4JKX B;  3NKU A;  1QQK A;  5F8S A;  3HSM A;  1Q03 A;  3N7K A;  3P6I A;  4GP0 A;  3OGG A;  4FGF A;  3FJH A;  4LO2 C;  4EFP A;  3VT1 A;  4HR6 C;  4F83 A;  1IT0 A;  3BAG A;  3UJ4 A;  6I1B A;  1G9B A;  4LO8 B;  3LTQ A;  2B51 A;  8I1B A;  1DLL A;  3AKG A;  4J23 B;  1V6U A;  1TTU A;  3IM6 A;  2FDB M;  2Q9X A;  4I8M A;  4X39 A;  2MIB A;  4QD2 B;  1HKN A;  5D61 A;  4X38 A;  4XJE A;  4LO0 A;  2VXT I;  1YF8 B;  5F8W A;  1TP0 A;  3N0K A;  1XHB A;  1EVT A;  1MD6 A;  5F90 A;  2GO2 A;  2D7R A;  4KEI A;  2Y9W C;  3A23 A;  2Y9X E;  4MZF B;  2BEB A;  3WMV A;  4A7Y A;  1JT7 A;  3VWC A;  3CA5 A;  4O68 A;  4H9W A;  4A7K A;  2YUG A;  4JPZ A;  4I4Q A;  4OW4 A;  5B2H A;  4J2K A;  2E4M C;  2ZR1 B;  1DQO A;  4LEW A;  4FO1 A;  4I7I A;  1S0G A;  3CA1 A;  31BI A;  3BRG C;  3OWG A;  1V6V A;  2NTD A;  3HAL A;  4EEE B;  2D20 A;  5BVP I;  4K96 A;  1DZC A;  1JQZ A;  3V0A A;  4ZLB B;  3BRD A;  3POK A;  3O4O A;  4XFS A;  1ISV A;  3IAG C;  3B9U A;  4K99 A;  2FFV A;  4I4O A;  4DEN A;  3MAL A;  2GZB A;  2K43 A;  3O4B A;  5GAQ A;  1DJS B;  4XFT A;  3BAD A;  2P39 A;  1CE7 B;  4L4I A;  4K8V A;  3NJ5 A;  2R9K B;  2ET2 A;  4I4P A;  1RY7 A;  1JT5 A;  5BXS A;  3A21 A;  5D63 A;  3S8J A;  4LO0 C;  4QBV A;  3RSJ A;  1IRA X;  4F34 A;  3I2A A;  4Q91 A;  1I1B A;  4I1E A;  4NXV A;  4II0 A;  1PUM B;  2NVH A;  1D0H A;  2K8R A;  3R4S A;  1HWN B;  4OEE A;  4I4V A;  2D7I A;  3T8S A;  1T9F A;  4YOL A;  3W9T A;  5BQU A;  3H6R B;  1HCD A;  3P53 A;  1W3A A;  1FMM S;  3O4C A;  4LO1 A;  4O69 A;  2J3P A;  2Q3N B;  1FWU A;  3JRR A;  1ILR 1;  1BLD A;  3PUB A;  4G9N A;  4QBC A;  3SNV A;  1JLX A;  4AN7 B;  1PZZ A;  2AXM A;  4ISR A;  1FWV A;  1IIL A;  1Z4S A;  3UD8 A;  3AZV A;  4LEY A;  1II4 A;  5BOW A;  1ONK B;  3A22 A;  3V0A B;  3HN1 A;  4QKR A;  3CQA A;  3VT2 A;  1YXW A;  4WH5 A;  3RMY A;  1N4K A;  4JAW A;  2DRE A;  3BAH A;  3AZW A;  2P23 A;  3ILA A;  4MZH A;  5BXT A;  5BXR A;  2ZQN A;  1JTC A;  3ZXG A;  1TWM A;  4ZKT B;  4NXW A;  3CU1 B;  2KH2 A;  1RG8 A;  1UPS A;  3N7M A;  4IZE A;  1VCL A;  4XKI A;  3BB2 A;  1IJT A;  4G9M A;  1YBI A;  4ION A;  4MZG B;  2NM1 A;  3OBT A;  3K7D A;  4A7Z A;  2QYI B;  3FUQ A;  4JQ0 A;  3E8L C;  2NYY A;  3CRG A;  3CAH A;  3NBE A;  3BAV A;  1L2H A;  4XFU A;  1EPW A;  3Q7W A;  2NP0 A;  4O67 A;  1XG6 A;  4I4U A;  5FZY A;  4X37 A;  4ZFU B;  4IYB A;  5CFU A;  1M2T B;  2D43 A;  4G1R A;  4KEK A;  3HBW A;  41BI A;  2Y9F A;  3CRH A;  4I3N A;  1IHK A;  1FQ9 A;  2FO1 A;  2IHO A;  4DCK C;  4KB6 A;  5FNW A;  3UDA A;  1RZO B;  2RQ9 A;  2X2S A;  3VSF A;  2IWT B;  3FJK A;  1DFC A;  3S8K A;  5EC5 A;  2LIQ A;  5FZZ A;  3WIN C;  1S0F A;  2DS0 A;  4KM5 A;  1M16 A;  4NXX A;  2WBC A;  2AQZ A;  5F8Y A;  1HCE A;  1BA7 A;  4OAI Z;  4J2Y A;  2B56 A;  4JRA A;  1K5U A;  4N7R A;  1JY0 A;  1WBC A;  1ISZ A;  2KKI A;  1BFB A;  4OEF A;  3H6R A;  1ISW A;  3FJC A;  7I1B A;  2AFG A;  3F1R A;  3CA3 A;  4OEG A;  2LIE A;  3ERC C;  3OJV A;  2XOA A;  4LEZ A;  2B4V A;  4Q9G A;  3BA5 A;  1R8N A;  3H6S E;  4OWK A;  3O4A A;  3WO3 A;  3AKH A;  1AVX B;  4WBC A;  3LLP A;  3N7L A;  1BFF A;  4QD2 C;  3ZXD A;  5G00 A;  3IIR A;  4LO3 C;  1AFC A;  4OAG A;  4GAI A;  3I29 B;  1HWO B;  4GP3 A;  1WD4 A;  3BA7 A;  2M49 A;  3IM7 A;  1AF9 A;  3WIN A;  2BEA A;  3FGM A;  2VXR A;  3O4D A;  1Z2V A;  1GGP B;  5CFT A;  1NZK A;  2RG9 B;  3RMX A;  2FFU A;  1NUN A;  1ITB A;  4I4Y A;  3OGF A;  1S0L A;  4K9B A;  3PHZ A;  3ER8 C;  4OWL A;  3FJI A;  1E0O A;  3UD9 A;  3AKI A;  3FJB A;  2UUS A;  4I0Y A;  3ER9 B;  3HMY A;  3BA4 A;  4I37 A;  4WOY A;  1WBA A;  3RTI B;  5DSS B;  2GAF D;  1R8O A;  3BAO A;  4ZGR B;  2D24 A;  4ISQ A;  4USO A;  3NBN A;  3AH4 A;  4LO1 C;  4QKS A;  3JUT A;  3WO4 A;  2VLC A;  1BLA A;  3WMU A;  5FNX A;  5CHE A;  3AH2 A;  2F2F C;  1HWM B;  1PUU B;  4H04 A;  3MCR A;  4LEV A;  1AVA C;  3H6Q A;  2VSE A;  1J0S A;  2X2T A;  5BXP A;  4IQP A;  5I1B A;  2DRY A;  4KEJ A;  3V0B A;  1YYN A;  2VSA A;  4OUJ A;  5CFS A;  4G6M A;  4QO3 A;  1GPJ A;  1S0C A;  4WQL A;  2BFH A;  3MPP G;  4H75 A;  4JKQ A;  4I96 A;  4I4X A;  4KC3 A;  5B3Q A;  4CJM A;  4X3A A;  4EFR A;  5JLV A;  4K97 A;  2HW9 A;  1S0D A;  4ZA3 B;  4I4S A;  1IRP A;  4MKP A;  2HWM A;  3FFZ A;  3V79 C;  3BAQ A;  3V0B B;  1EV2 A;  3CA0 A;  5DZU A;  1SR4 A;  1QQL A;  1SZ6 B;  2DRZ A;  4USP A;  1FV2 A;  1DIW A;  3TC2 A;  4JLX A;  1MC9 A;  2KLL A;  3AJ6 A;  1V6W A;  1AVU A;  4D0T A;  1G82 A;  3VT0 A;  4END A;  4I6I A;  3AH1 A;  1S0E A;  1ABR B;  3QYD A;  3FUO A;  1DFQ A;  1OQL B;  3C9Z A;  21BI A;  5DVH A;  3F62 B;  1HIB A;  4AN6 A;  4OAF A;  3FJ9 A;  3UJ0 A;  3I2X A;  5E24 E;  1CVS A;  3FJJ A;  4QAL A;  5EG6 C;  4LO2 A;  3O44 A;  1JT4 A;  2E4M A;  1RML A;  4TLP A;  3BRF A;  1DQG A;  3NBC A;  1PWA A;  4Z9W B;  2HWA A;  4P6A A;  1IOB A;  2F2F A;  2D23 A;  1JLY A;  1F31 A;  3ZC8 A;  4P0K A;  3QR5 A;  3FJE A;  3AKF A;  4I1B A;  3VEQ A;  1I1E A;  4EKX B;  1G9C A;  2Y9G A;  4ZOT A;  3FJF A;  1TIE A;  4O6A A;  4Q9P A;  5BQU C;  4FVV A;  4D8H A;  2D22 A;  1AXM A;  3UD7 A;  3PME A;  2Z48 A;  2VU9 A;  1WD3 A;  2NZ9 A;  2EWR A;  4K9A A;  3FJ8 A;  5JMC A;  1TFM B;  4K98 A;  3IM5 A;  4PC4 A;  4NXU A;  1BFC A;  1AVW B;  1EYL A;  4J2S A;  4ZFW B;  3VUO A;  2ZQO A;  3OJ2 A;  5BP5 A;  4LO3 A;  2MLL B;  1DZD A;  4OWJ A;  1Q04 A;  2F8X C;  3HOM A;  1HWP B;  1XZZ A;  2WRY A;  3RTJ B;  4IY9 A;  4QC4 A;  4I4R A;  4GOV A;  1FN0 A;  1S0B A;  5DUY A;  1QXM A;  3P6J A;  4HA2 A;  1T4Q A;  3PG0 A;  3R4U A;  3VSZ A;  3D7W B;  3O49 A;  4ZFY B;  1YTO A;  2VUA A;  5FZU A;  4IZX A;  2GA9 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...