5CFTA

Crystal structure of ant(2")-ia in complex with ampcpp and gentamicin c1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
DTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Tobramycin and Gentamicin Clinical Resistome Reveals Limitations for Next-generation Aminoglycoside Design.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/antibiotic
molecule keywords Aminoglycoside Nucleotidyltransferase (2")-Ia
total genus 60
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cftA00
4XJEA 4HX0A 5CFSA 4WH5A 5CFTA 2EWRA 4WQKA 2FCLA 4FO1A 5CFUA 4WQLA
chains in the Genus database with same CATH superfamily
5J29A 4DOBA 3RJGA 4RQ0A 5F2VO 2IHMA 3AU6A 4K98A 4X4QA 1MIVA 5HRHA 5IILA 4FHPA 4UB2A 9ICOA 2BCQA 1ZQUA 4UAWA 5CB1A 5HC9A 1BPDA 1NOMA 2BCUA 4JLXA 3RH5A 4F5OA 9ICGA 4KLUA 3PMLA 4UB5A 2IUBA 2I9GA 3GDXA 2RFFA 1MIWA 4KLTA 3AQNA 1BPYA 2BCVA 2BCRA 4LEWA 5CFUA 3AUOA 4WC1A 9ICPA 7ICSA 1BPBA 5J2DA 4PHAA 3OUYA 4I2CA 5J2BA 4NLNA 5CWRA 4UBBA 8ICXA 5DBAA 5CR0A 8ICSA 4FH5A 4QZDA 3H38A 5DB8A 5DB6A 2BPFA 8ICAA 5J0YA 4WC5A 4TUPA 5J0UA 4KLOA 8ICYA 2BE3A 4KLSA 4F5RA 9ICAA 4Z6DA 4EP7A 3MGIA 3HW8A 8ICZA 8ICUA 4IQWA 5DBBA 4K96A 1UEVA 8ICCA 3L9DA 4RT2A 4WC7A 1TV9A 4E80A 4RWQA 4RQ6A 5J2EA 4RQ1A 1ZQQA 7ICLA 2M2WA 4YN4A 4WC3A 1ZQJA 4HX0A 1ZQSA 3OWGA 4O6AA 3WFRE 3AU2A 5DDMA 4NY8A 4KLGA 4XA5A 5IIOA 4RQ3A 4KLMA 2DRAA 2GAFD 3UPQA 5BOMA 4X4SA 3PNCA 5J2IA 3B0YA 4AT8A 4EBKA 3WFSC 1R8BA 2P66A 1ZQBA 5J0RA 4WQLA 4X4OA 8ICOA 5HREA 5IIKA 4K99A 4YMNA 2ISPA 4P2HA 3OVSA 4EEDA 4M04A 3C2LA 4R63A 5DECA 5CHEA 5IIMA 4NLZA 9ICFA 2O1PA 3RJHA 3K7DA 2FCLA 2DR5A 4UB1A 4M9JA 2ZH6A 4I27A 1HUZA 1TVAA 8ICTA 4LT6A 1VJ7A 4M9NA 4I2FA 7ICGA 4DOCA 3JPPA 4KLJA 1Q78A 4X4TA 1KEJA 4NXZA 3C2MA 3RJIA 2FMQA 5DEDA 4Z6FA 2BPGA 2DVIA 9ICHA 4K97A 2B51A 4IQVA 5CJ7A 4R66A 1HUOA 4FHVA 2GA9D 5J0SA 4FO6A 3JPRA 1VFGA 2ZH8A 4P4PA 4GXJA 1JN3A 4NLKA 3JPSA 2DR7A 4EV6A 5D62A 3ER8C 4X4NA 5CA7A 4AT9A 3UXPA 3AQKA 4LVSA 4MKPA 5B3QA 5J0WA 1ZQRA 2BBJA 2B4VA 4NXTA 4F5PA 3V7JA 1UETA 3MDCA 1ZQTA 4M9GA 4M47A 3HX0A 1WOTA 7ICNA 3LK9A 4RPYA 4PGYA 1TFWA 4NKUA 5J2GA 2O5AA 1ZQWA 3RJEA 4XUSA 7ICVA 3ISBA 4I2IA 3HJ4A 1ZQAA 4NM2A 1JQRA 4X0BA 3RH6A 4Z6EA 2ID1A 3JCFA 7ICHA 4PPXA 1ZQGA 2ZHBA 2ZH5A 4F5NA 4UB4A 1BPEA 1R89A 8ICBA 3OVBA 3RJFA 5J0QA 7ICQA 4RQ4A 7ICEA 9ICBA 2BBHA 5HRIA 4I28A 1JMSA 2ZH2A 4I2DA 4M9LA 1XSLA 4P4MA 5CHGA 4WBZA 4WOYA 4EBJA 4I2EA 4LEYA 4MF2A 3C5FA 3NYBA 1Q79A 5DB9A 4K4IA 2ZH9A 4F5QA 3V7LA 5HRFA 2PFOA 9ICJA 1UEUA 4YMOA 7ICUA 1BPZA 4RWNA 4S3NA 9ICEA 3AQMA 4QZEA 4E7XA 4K9AA 8ICNA 5DB7A 2M2VA 3MGHA 8ICFA 4AT7A 3MDAA 4M0AA 9ICNA 5CFTA 4AT8B 1XSPA 5HR9A 3V7KA 3CK6A 4KLEA 8ICWA 3EF2A 8ICEA 5IIIA 4X4VA 4YCXA 5D46A 5J0PA 3JZ0A 2HN2A 4QZCA 3JPQA 3UQ0A 1ZQPA 4N7RA 4QZ8A 4QZ9A 1F5AA 5D61A 4RWOA 2ZH7A 4R64A 3OUYB 3HIYA 3UXOA 1JAJA 5HHHA 3MBYA 3MCRA 5HRDA 2PFNA 4NKTA 4KLFA 3NWIA 3JYYA 4FHXA 5EOZA 4PHPA 8ICVA 1MQ2A 9ICMA 9ICSA 4O69A 4PGXA 2ZH3A 3UQ2A 7ICTA 4RPZA 3OGUA 2M2UA 9ICQA 4WC2A 4X4PA 2BCSA 1V4AA 4R65A 4PHDA 4QZAA 2DR9A 4QZHA 1ZQVA 4PH5A 4K4HA 4M2YA 5JTGA 4M9HA 4X0AA 5J2JA 1ZQEA 4WH5A 4YD2A 3H3AA 4UD4A 5HRKA 4JWMA 4M5DA 4EGWA 2ZH4A 4O68A 4AT7B 1ZQFA 4TURA 3JPOA 1FA0A 1ZQCA 4LEZA 9ICIA 8ICIA 4K8VA 4O5CA 4KB6A 4E8FA 5J2AA 2FMPA 5HRGA 1KDHA 4GXIA 9ICVA 8ICKA 3OV7A 3WFOA 1ZJMA 5D4BA 3AQLA 4LEVA 3HWTA 4UAYA 3PMNA 1ZQLA 4TUSA 4Z6CA 4JLZA 4I29A 4WC0A 4GXKA 3C5GA 3ER9B 4I2HA 4XQ8A 4RQ5A 8ICGA 4EEBA 2IHOA 2EWRA 5J2CA 4OAGA 3RH4A 1ZQKA 4K4GA 2VANA 4XQ7A 9ICTA 5BPCA 3RJJA 5J0OA 2ISOA 7ICPA 1PX5A 1RZTA 4WC6A 7ICJA 8ICLA 4IG8A 7ICKA 2B56A 1ZQMA 1ZQHA 2PXIA 4JWNA 5TZVA 1BPXA 2DR8A 4QZGA 5IINA 4AT9B 4OAIZ 4X4UA 4OAHA 2PFPA 3WFPA 5J2FA 4MFFA 4MFAA 1TFYA 4RPXA 4OAFA 3ISDA 5D49A 4X5VA 4I2GA 4NM1A 1ZQDA 3NKUA 5J2HA 4TUQA 4RQ7A 3JPTA 4UAZA 3UXNA 4YD1A 4KM5A 4NXXA 1ZQXA 4FHYA 8ICQA 4WQKA 4RWPA 7ICMA 1ZJNA 5B3PA 3HJ1A 4K9BA 4NXUA 3ISCA 3C18A 2PBEA 3B0XA 4ATBB 2HHPA 5J0XA 7ICFA 2BPCA 7ICRA 9ICRA 4I2AA 4KLLA 1RPLA 1KNYA 1ZQYA 3PHZA 8ICMA 1ZQIA 4QZIA 2PFQA 1OU5A 5D63A 1ZQNA 4O9MA 4KLIA 4O5EA 4I2BA 4LZDA 2ZH1A 2HN1A 1ZQZA 5CFSA 2M2TA 4IQUA 7ICOA 5J0TA 5DDYA 5DKWA 4QZBA 3V72A 4XJEA 2ZHAA 4WC4A 1R8AA 4KLQA 3OVAA 4I2JA 1YLQA 4WBYA 3H39A 5BOLA 7ICIA 4DOAA 2GWSA 5J2KA 4RQ2A 4DO9A 8ICJA 2Q66A 5HRLA 4PGQA 4KLDA 1GPJA 4UD5A 5DBCA 3RJKA 1R8CA 1NO5A 5CP2A 3NVOA 4X4RA 9ICXA 9ICLA 4NXVA 4UB3A 1MQ3A 4UBCA 3TFRA 4RQ8A 3ERCC 4PHEA 2FMSA 2DRBA 5HHIA 4LZGA 5IIJA 3H37A 4MFCA 8ICRA 3K75D 5HRBA 8ICHA 4MF8A 2W9MA 4NXWA 9ICCA 8ICPA 4KLHA 4I0UA 4WCWA 9ICUA 3UPSA 4FH3A 4XRHA 3WFQE 4QZFA 4ATBA 4P4OA 9ICKA 3LQCB 4FO1A 3JPNA 4YMMA 4O67A 4IQTA 4RT3A 1ZQOA 1MIYA 4FHWA 2NRKA 3C2KA 3C66A 4O5KA 1XSNA 3TFSA 9ICWA
chains in the Genus database with same CATH topology
4XJEA 4OAHA 4K96A 3ER9B 4LEZA 4K8VA 4KB6A 4NXWA 4N7RA 2IHOA 4WQLA 4OAFA 4K98A 4O68A 3PHZA 5D61A 2EWRA 4K99A 4OAIZ 4K97A 4OAGA 2B51A 3NKUA 3MCRA 2GA9D 4K9AA 4JLXA 1GPJA 4HX0A 3OWGA 5CHEA 4O6AA 3K7DA 4NXUA 5D63A 2FCLA 4FO1A 4LEVA 4KM5A 4NXXA 4LEWA 5D62A 3ER8C 4O67A 4NXVA 2B56A 4WH5A 5CFSA 4MKPA 5CFTA 4WQKA 5B3QA 4O69A 2GAFD 4LEYA 5B3PA 4WOYA 4JLZA 4K9BA 2B4VA 5CFUA 3ERCC 4NXTA 3EF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJE A;  4HX0 A;  5CFS A;  4WH5 A;  5CFT A;  2EWR A;  4WQK A;  2FCL A;  4FO1 A;  5CFU A;  4WQL A; 
#chains in the Genus database with same CATH topology
 5J29 A;  4DOB A;  3RJG A;  4RQ0 A;  5F2V O;  2IHM A;  3AU6 A;  4K98 A;  4X4Q A;  1MIV A;  5HRH A;  5IIL A;  4FHP A;  4UB2 A;  9ICO A;  2BCQ A;  1ZQU A;  4UAW A;  5CB1 A;  5HC9 A;  1BPD A;  1NOM A;  2BCU A;  4JLX A;  3RH5 A;  4F5O A;  9ICG A;  4KLU A;  3PML A;  4UB5 A;  2IUB A;  2I9G A;  3GDX A;  2RFF A;  1MIW A;  4KLT A;  3AQN A;  1BPY A;  2BCV A;  2BCR A;  4LEW A;  5CFU A;  3AUO A;  4WC1 A;  9ICP A;  7ICS A;  1BPB A;  5J2D A;  4PHA A;  3OUY A;  4I2C A;  5J2B A;  4NLN A;  5CWR A;  4UBB A;  8ICX A;  5DBA A;  5CR0 A;  8ICS A;  4FH5 A;  4QZD A;  3H38 A;  5DB8 A;  5DB6 A;  2BPF A;  8ICA A;  5J0Y A;  4WC5 A;  4TUP A;  5J0U A;  4KLO A;  8ICY A;  2BE3 A;  4KLS A;  4F5R A;  9ICA A;  4Z6D A;  4EP7 A;  3MGI A;  3HW8 A;  8ICZ A;  8ICU A;  4IQW A;  5DBB A;  4K96 A;  1UEV A;  8ICC A;  3L9D A;  4RT2 A;  4WC7 A;  1TV9 A;  4E80 A;  4RWQ A;  4RQ6 A;  5J2E A;  4RQ1 A;  1ZQQ A;  7ICL A;  2M2W A;  4YN4 A;  4WC3 A;  1ZQJ A;  4HX0 A;  1ZQS A;  3OWG A;  4O6A A;  3WFR E;  3AU2 A;  5DDM A;  4NY8 A;  4KLG A;  4XA5 A;  5IIO A;  4RQ3 A;  4KLM A;  2DRA A;  2GAF D;  3UPQ A;  5BOM A;  4X4S A;  3PNC A;  5J2I A;  3B0Y A;  4AT8 A;  4EBK A;  3WFS C;  1R8B A;  2P66 A;  1ZQB A;  5J0R A;  4WQL A;  4X4O A;  8ICO A;  5HRE A;  5IIK A;  4K99 A;  4YMN A;  2ISP A;  4P2H A;  3OVS A;  4EED A;  4M04 A;  3C2L A;  4R63 A;  5DEC A;  5CHE A;  5IIM A;  4NLZ A;  9ICF A;  2O1P A;  3RJH A;  3K7D A;  2FCL A;  2DR5 A;  4UB1 A;  4M9J A;  2ZH6 A;  4I27 A;  1HUZ A;  1TVA A;  8ICT A;  4LT6 A;  1VJ7 A;  4M9N A;  4I2F A;  7ICG A;  4DOC A;  3JPP A;  4KLJ A;  1Q78 A;  4X4T A;  1KEJ A;  4NXZ A;  3C2M A;  3RJI A;  2FMQ A;  5DED A;  4Z6F A;  2BPG A;  2DVI A;  9ICH A;  4K97 A;  2B51 A;  4IQV A;  5CJ7 A;  4R66 A;  1HUO A;  4FHV A;  2GA9 D;  5J0S A;  4FO6 A;  3JPR A;  1VFG A;  2ZH8 A;  4P4P A;  4GXJ A;  1JN3 A;  4NLK A;  3JPS A;  2DR7 A;  4EV6 A;  5D62 A;  3ER8 C;  4X4N A;  5CA7 A;  4AT9 A;  3UXP A;  3AQK A;  4LVS A;  4MKP A;  5B3Q A;  5J0W A;  1ZQR A;  2BBJ A;  2B4V A;  4NXT A;  4F5P A;  3V7J A;  1UET A;  3MDC A;  1ZQT A;  4M9G A;  4M47 A;  3HX0 A;  1WOT A;  7ICN A;  3LK9 A;  4RPY A;  4PGY A;  1TFW A;  4NKU A;  5J2G A;  2O5A A;  1ZQW A;  3RJE A;  4XUS A;  7ICV A;  3ISB A;  4I2I A;  3HJ4 A;  1ZQA A;  4NM2 A;  1JQR A;  4X0B A;  3RH6 A;  4Z6E A;  2ID1 A;  3JCF A;  7ICH A;  4PPX A;  1ZQG A;  2ZHB A;  2ZH5 A;  4F5N A;  4UB4 A;  1BPE A;  1R89 A;  8ICB A;  3OVB A;  3RJF A;  5J0Q A;  7ICQ A;  4RQ4 A;  7ICE A;  9ICB A;  2BBH A;  5HRI A;  4I28 A;  1JMS A;  2ZH2 A;  4I2D A;  4M9L A;  1XSL A;  4P4M A;  5CHG A;  4WBZ A;  4WOY A;  4EBJ A;  4I2E A;  4LEY A;  4MF2 A;  3C5F A;  3NYB A;  1Q79 A;  5DB9 A;  4K4I A;  2ZH9 A;  4F5Q A;  3V7L A;  5HRF A;  2PFO A;  9ICJ A;  1UEU A;  4YMO A;  7ICU A;  1BPZ A;  4RWN A;  4S3N A;  9ICE A;  3AQM A;  4QZE A;  4E7X A;  4K9A A;  8ICN A;  5DB7 A;  2M2V A;  3MGH A;  8ICF A;  4AT7 A;  3MDA A;  4M0A A;  9ICN A;  5CFT A;  4AT8 B;  1XSP A;  5HR9 A;  3V7K A;  3CK6 A;  4KLE A;  8ICW A;  3EF2 A;  8ICE A;  5III A;  4X4V A;  4YCX A;  5D46 A;  5J0P A;  3JZ0 A;  2HN2 A;  4QZC A;  3JPQ A;  3UQ0 A;  1ZQP A;  4N7R A;  4QZ8 A;  4QZ9 A;  1F5A A;  5D61 A;  4RWO A;  2ZH7 A;  4R64 A;  3OUY B;  3HIY A;  3UXO A;  1JAJ A;  5HHH A;  3MBY A;  3MCR A;  5HRD A;  2PFN A;  4NKT A;  4KLF A;  3NWI A;  3JYY A;  4FHX A;  5EOZ A;  4PHP A;  8ICV A;  1MQ2 A;  9ICM A;  9ICS A;  4O69 A;  4PGX A;  2ZH3 A;  3UQ2 A;  7ICT A;  4RPZ A;  3OGU A;  2M2U A;  9ICQ A;  4WC2 A;  4X4P A;  2BCS A;  1V4A A;  4R65 A;  4PHD A;  4QZA A;  2DR9 A;  4QZH A;  1ZQV A;  4PH5 A;  4K4H A;  4M2Y A;  5JTG A;  4M9H A;  4X0A A;  5J2J A;  1ZQE A;  4WH5 A;  4YD2 A;  3H3A A;  4UD4 A;  5HRK A;  4JWM A;  4M5D A;  4EGW A;  2ZH4 A;  4O68 A;  4AT7 B;  1ZQF A;  4TUR A;  3JPO A;  1FA0 A;  1ZQC A;  4LEZ A;  9ICI A;  8ICI A;  4K8V A;  4O5C A;  4KB6 A;  4E8F A;  5J2A A;  2FMP A;  5HRG A;  1KDH A;  4GXI A;  9ICV A;  8ICK A;  3OV7 A;  3WFO A;  1ZJM A;  5D4B A;  3AQL A;  4LEV A;  3HWT A;  4UAY A;  3PMN A;  1ZQL A;  4TUS A;  4Z6C A;  4JLZ A;  4I29 A;  4WC0 A;  4GXK A;  3C5G A;  3ER9 B;  4I2H A;  4XQ8 A;  4RQ5 A;  8ICG A;  4EEB A;  2IHO A;  2EWR A;  5J2C A;  4OAG A;  3RH4 A;  1ZQK A;  4K4G A;  2VAN A;  4XQ7 A;  9ICT A;  5BPC A;  3RJJ A;  5J0O A;  2ISO A;  7ICP A;  1PX5 A;  1RZT A;  4WC6 A;  7ICJ A;  8ICL A;  4IG8 A;  7ICK A;  2B56 A;  1ZQM A;  1ZQH A;  2PXI A;  4JWN A;  5TZV A;  1BPX A;  2DR8 A;  4QZG A;  5IIN A;  4AT9 B;  4OAI Z;  4X4U A;  4OAH A;  2PFP A;  3WFP A;  5J2F A;  4MFF A;  4MFA A;  1TFY A;  4RPX A;  4OAF A;  3ISD A;  5D49 A;  4X5V A;  4I2G A;  4NM1 A;  1ZQD A;  3NKU A;  5J2H A;  4TUQ A;  4RQ7 A;  3JPT A;  4UAZ A;  3UXN A;  4YD1 A;  4KM5 A;  4NXX A;  1ZQX A;  4FHY A;  8ICQ A;  4WQK A;  4RWP A;  7ICM A;  1ZJN A;  5B3P A;  3HJ1 A;  4K9B A;  4NXU A;  3ISC A;  3C18 A;  2PBE A;  3B0X A;  4ATB B;  2HHP A;  5J0X A;  7ICF A;  2BPC A;  7ICR A;  9ICR A;  4I2A A;  4KLL A;  1RPL A;  1KNY A;  1ZQY A;  3PHZ A;  8ICM A;  1ZQI A;  4QZI A;  2PFQ A;  1OU5 A;  5D63 A;  1ZQN A;  4O9M A;  4KLI A;  4O5E A;  4I2B A;  4LZD A;  2ZH1 A;  2HN1 A;  1ZQZ A;  5CFS A;  2M2T A;  4IQU A;  7ICO A;  5J0T A;  5DDY A;  5DKW A;  4QZB A;  3V72 A;  4XJE A;  2ZHA A;  4WC4 A;  1R8A A;  4KLQ A;  3OVA A;  4I2J A;  1YLQ A;  4WBY A;  3H39 A;  5BOL A;  7ICI A;  4DOA A;  2GWS A;  5J2K A;  4RQ2 A;  4DO9 A;  8ICJ A;  2Q66 A;  5HRL A;  4PGQ A;  4KLD A;  1GPJ A;  4UD5 A;  5DBC A;  3RJK A;  1R8C A;  1NO5 A;  5CP2 A;  3NVO A;  4X4R A;  9ICX A;  9ICL A;  4NXV A;  4UB3 A;  1MQ3 A;  4UBC A;  3TFR A;  4RQ8 A;  3ERC C;  4PHE A;  2FMS A;  2DRB A;  5HHI A;  4LZG A;  5IIJ A;  3H37 A;  4MFC A;  8ICR A;  3K75 D;  5HRB A;  8ICH A;  4MF8 A;  2W9M A;  4NXW A;  9ICC A;  8ICP A;  4KLH A;  4I0U A;  4WCW A;  9ICU A;  3UPS A;  4FH3 A;  4XRH A;  3WFQ E;  4QZF A;  4ATB A;  4P4O A;  9ICK A;  3LQC B;  4FO1 A;  3JPN A;  4YMM A;  4O67 A;  4IQT A;  4RT3 A;  1ZQO A;  1MIY A;  4FHW A;  2NRK A;  3C2K A;  3C66 A;  4O5K A;  1XSN A;  3TFS A;  9ICW A; 
#chains in the Genus database with same CATH homology
 4XJE A;  4OAH A;  4K96 A;  3ER9 B;  4LEZ A;  4K8V A;  4KB6 A;  4NXW A;  4N7R A;  2IHO A;  4WQL A;  4OAF A;  4K98 A;  4O68 A;  3PHZ A;  5D61 A;  2EWR A;  4K99 A;  4OAI Z;  4K97 A;  4OAG A;  2B51 A;  3NKU A;  3MCR A;  2GA9 D;  4K9A A;  4JLX A;  1GPJ A;  4HX0 A;  3OWG A;  5CHE A;  4O6A A;  3K7D A;  4NXU A;  5D63 A;  2FCL A;  4FO1 A;  4LEV A;  4KM5 A;  4NXX A;  4LEW A;  5D62 A;  3ER8 C;  4O67 A;  4NXV A;  2B56 A;  4WH5 A;  5CFS A;  4MKP A;  5CFT A;  4WQK A;  5B3Q A;  4O69 A;  2GAF D;  4LEY A;  5B3P A;  4WOY A;  4JLZ A;  4K9B A;  2B4V A;  5CFU A;  3ERC C;  4NXT A;  3EF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...