5CFTA

Crystal structure of ant(2")-ia in complex with ampcpp and gentamicin c1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
DTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside Nucleotidyltransferase (2")-Ia
publication title Structural Analysis of the Tobramycin and Gentamicin Clinical Resistome Reveals Limitations for Next-generation Aminoglycoside Design.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/antibiotic
total genus 60
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cftA00
2FCLA 4FO1A 4WQLA 4WQKA 4HX0A 5CFSA 2EWRA 4XJEA 5CFTA 5CFUA 4WH5A
chains in the Genus database with same CATH superfamily
5J2GA 4UBBA 4WC5A 8ICHA 3NKUA 3JPOA 2GA9D 4XRHA 2DR8A 3RJKA 1FA0A 3JCFA 7ICSA 2ZH2A 4XJEA 4MFFA 4NLKA 9ICFA 4TUQA 4X4UA 4UAWA 2ZH9A 3JPSA 4I2IA 4KLDA 7ICNA 4TUPA 2O1PA 5J2KA 4KLLA 2B4VA 7ICLA 4KLSA 4RWQA 5B3QA 3JPQA 4K98A 5CFTA 5D61A 4X4PA 4AT7A 3NYBA 4X4QA 2ZHAA 4PH5A 1ZQZA 3UQ2A 5HRBA 1ZQQA 5HR9A 3WFPA 1BPZA 3MDCA 3HIYA 4K9AA 9ICNA 1ZQMA 5J2DA 2EWRA 5B3PA 4R65A 4QZEA 2PXIA 4X4SA 9ICOA 4TURA 1BPBA 7ICGA 3HJ4A 1ZQTA 2BCVA 4UB4A 4LZDA 5HC9A 3WFSC 1HUZA 4NXTA 3RH4A 1MQ3A 2ZH1A 1ZQDA 4KB6A 4NM2A 4X0AA 1BPDA 4EGWA 3OVBA 1JAJA 4QZCA 5DBCA 5HRLA 4UB3A 4YMOA 1WOTA 2BCUA 1BPEA 4IG8A 4WQLA 4F5PA 3AQLA 1MIYA 3AQMA 4I27A 5HRFA 4UBCA 3PMLA 7ICTA 5IIJA 1KNYA 8ICNA 5CB1A 1ZQNA 2B51A 4X0BA 5IIMA 1ZJNA 8ICIA 4XUSA 7ICFA 1ZJMA 2DRAA 4WQKA 2HN1A 4DOAA 4UD4A 3LQCB 4FO6A 1RZTA 4KLHA 2BPGA 4N7RA 5CR0A 1RPLA 4Z6DA 8ICYA 4LEZA 3JPRA 2HN2A 3H38A 4O67A 3RH6A 4K4HA 2BPCA 4FH3A 2FMQA 1R8CA 2ISOA 3MGIA 1Q78A 3K7DA 8ICAA 7ICQA 2M2TA 4WC7A 2M2VA 5DBBA 5J29A 4RQ8A 3CK6A 3HX0A 4GXIA 3H37A 3MDAA 1VJ7A 4QZFA 4AT8A 4WH5A 4K9BA 4K4GA 1ZQOA 8ICEA 9ICJA 1UEVA 4JLZA 1R8BA 4WC3A 4Z6EA 4QZBA 4X4RA 4EP7A 1BPYA 4DOCA 8ICGA 2O5AA 4IQWA 1XSNA 1XSLA 4TUSA 5BPCA 1ZQEA 8ICXA 5DB6A 4RQ5A 4WBYA 4FHVA 5J0SA 4PHDA 2M2WA 2IUBA 5J0RA 2PFQA 4PPXA 4KLFA 8ICTA 4M9GA 7ICKA 4YMNA 4I2JA 3TFSA 4FHPA 9ICTA 4EV6A 8ICUA 4OAHA 4NKTA 4I2EA 2BBJA 3AUOA 4YMMA 9ICXA 4RPZA 3AU2A 3UXNA 4E7XA 5DB8A 4NKUA 4PGQA 3ERCC 2PBEA 4LEVA 4QZIA 4X4NA 4EEDA 5BOMA 9ICIA 4PGYA 4I0UA 4OAIZ 4RT2A 3ISDA 1ZQJA 3H3AA 1GPJA 3OUYA 2BCQA 4QZGA 1MIWA 2FMPA 3H39A 1YLQA 3V72A 1JQRA 1TVAA 9ICKA 5D4BA 8ICJA 3WFOA 3L9DA 3K75D 3PHZA 4K97A 3RJIA 4NM1A 4X4VA 4O68A 1ZQYA 7ICHA 4MKPA 4K8VA 4WCWA 2ZHBA 1ZQHA 2DR7A 9ICWA 5D46A 1ZQIA 5J0TA 4I2CA 3OVSA 3ISCA 4WBZA 4QZDA 3HWTA 3OVAA 5D49A 9ICPA 3RJEA 4M04A 4UB5A 3ER8C 1ZQBA 1KEJA 1ZQCA 4PHAA 3OV7A 9ICAA 4QZHA 5TZVA 3WFQE 2HHPA 4FO1A 8ICOA 3EF2A 4KLQA 4JLXA 7ICIA 4RT3A 4RQ0A 4MF8A 4AT9A 2DVIA 5IIKA 2GAFD 4RQ2A 5DKWA 5J2HA 3PMNA 3UPQA 4RWPA 2ZH3A 5J0PA 3UXOA 4ATBA 2M2UA 4PGXA 8ICZA 1UETA 4AT8B 5HHIA 4XQ7A 4RPXA 3JPPA 1ZQVA 4NLNA 4RWOA 2ID1A 1ZQKA 5CFUA 4NXZA 3TFRA 2PFNA 4K99A 4I2HA 5J2CA 3AQNA 2FCLA 5HHHA 3PNCA 4KLEA 4F5QA 4LEWA 2BCRA 5IIOA 4O5CA 5J2FA 4LZGA 4KLMA 5IIIA 8ICQA 2IHOA 1KDHA 1TFYA 3WFRE 4OAFA 4M0AA 4R64A 9ICHA 5J2AA 9ICSA 1F5AA 4M9LA 4WC1A 4JWMA 4XA5A 4KM5A 5J0UA 8ICLA 4K96A 8ICWA 3C5GA 4RWNA 4OAGA 1ZQAA 2PFPA 1NOMA 4MFCA 3HJ1A 2RFFA 4WC4A 1ZQUA 5D63A 4NXWA 8ICKA 4I29A 3GDXA 2BBHA 5J0YA 5JTGA 3OGUA 4NY8A 8ICPA 1ZQLA 4P4PA 3LK9A 2FMSA 4LEYA 5J2JA 5DECA 4IQVA 3C2LA 5EOZA 4UAYA 3OUYB 2ZH8A 4M9JA 4AT7B 1PX5A 4WC0A 3MCRA 5HRHA 9ICQA 3AQKA 3JYYA 4LVSA 1Q79A 7ICUA 3B0XA 1V4AA 8ICFA 3NVOA 2ISPA 5HRKA 4X4TA 5IINA 5CA7A 1MQ2A 9ICRA 3RJHA 2Q66A 3ISBA 4WC2A 1ZQGA 5DB9A 3MGHA 9ICLA 3UXPA 5D62A 4KLTA 4I2FA 3AU6A 5J0XA 1VFGA 7ICPA 3C18A 4Z6FA 4RQ3A 3RJGA 4KLJA 2BPFA 9ICVA 4R66A 5J0QA 5DEDA 5F2VO 4EEBA 4FHXA 5J2IA 3RH5A 4YCXA 7ICEA 4WOYA 4AT9B 3NWIA 3ER9B 3HW8A 5IILA 4E8FA 4I28A 1ZQRA 4YN4A 4NXXA 4F5RA 4ATBB 1UEUA 5J0WA 2B56A 9ICBA 4E80A 2BE3A 4PHEA 1XSPA 1TV9A 2DRBA 3UPSA 5HREA 4UAZA 4RQ1A 4O69A 3JPTA 4NXUA 2NRKA 8ICSA 4I2DA 5HRGA 5J0OA 3MBYA 7ICVA 4NLZA 1JN3A 4KLGA 3RJFA 4PHPA 4S3NA 4Z6CA 4MFAA 4P2HA 7ICJA 9ICUA 4I2BA 4O6AA 4NXVA 2GWSA 2VANA 2BCSA 1HUOA 4QZAA 4F5NA 2DR5A 4F5OA 1JMSA 8ICVA 8ICRA 1ZQWA 8ICMA 4O5KA 5CWRA 4UD5A 2ZH7A 3C66A 4WC6A 1ZQPA 2DR9A 5J2BA 7ICRA 9ICGA 4FH5A 4P4OA 4QZ9A 4UB2A 8ICBA 3B0YA 3OWGA 4JWNA 3C2KA 4O5EA 4IQTA 4I2GA 4M5DA 9ICCA 8ICCA 4KLIA 4RPYA 7ICOA 5BOLA 3V7JA 1TFWA 1OU5A 4EBKA 5HRDA 1ZQSA 4MF2A 2IHMA 4I2AA 4LT6A 4M47A 4UB1A 3C2MA 5J2EA 5CHGA 9ICEA 1R89A 3V7LA 9ICMA 5DDYA 4YD1A 3JZ0A 2ZH6A 4XQ8A 2W9MA 5DB7A 5CFSA 4X5VA 4FHYA 3V7KA 4R63A 5CP2A 4RQ7A 4KLUA 3JPNA 5HRIA 2ZH4A 1MIVA 4HX0A 4M9HA 1ZQXA 2ZH5A 4P4MA 1BPXA 4FHWA 4K4IA 4M9NA 1R8AA 4EBJA 3UQ0A 4X4OA 3C5FA 4KLOA 4RQ4A 4QZ8A 7ICMA 1ZQFA 5DBAA 4RQ6A 3RJJA 4GXKA 4DO9A 4DOBA 5CHEA 1NO5A 4GXJA 2PFOA 4YD2A 4O9MA 4IQUA 5DDMA 2I9GA 4M2YA 2P66A 5CJ7A
chains in the Genus database with same CATH topology
5D62A 4WQKA 4NXTA 4HX0A 3NKUA 2B56A 2GA9D 4JLZA 4OAHA 4KB6A 4KM5A 5CFUA 3MCRA 4K96A 4N7RA 4FO1A 4O69A 3PHZA 4K97A 4NXUA 4OAGA 3EF2A 4LEZA 4O68A 4XJEA 4JLXA 4O67A 4MKPA 4K99A 4K8VA 4K9AA 2FCLA 4WQLA 3K7DA 4NXWA 4LEVA 5D63A 3ERCC 2GAFD 2EWRA 5B3PA 4WOYA 4LEWA 3ER9B 4OAIZ 2B4VA 5CFSA 3OWGA 5B3QA 4K98A 4NXXA 5CHEA 4O6AA 4NXVA 4LEYA 5CFTA 2IHOA 1GPJA 2B51A 5D61A 4OAFA 4WH5A 4K9BA 3ER8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCL A;  4FO1 A;  4WQL A;  4WQK A;  4HX0 A;  5CFS A;  2EWR A;  4XJE A;  5CFT A;  5CFU A;  4WH5 A; 
#chains in the Genus database with same CATH topology
 5J2G A;  4UBB A;  4WC5 A;  8ICH A;  3NKU A;  3JPO A;  2GA9 D;  4XRH A;  2DR8 A;  3RJK A;  1FA0 A;  3JCF A;  7ICS A;  2ZH2 A;  4XJE A;  4MFF A;  4NLK A;  9ICF A;  4TUQ A;  4X4U A;  4UAW A;  2ZH9 A;  3JPS A;  4I2I A;  4KLD A;  7ICN A;  4TUP A;  2O1P A;  5J2K A;  4KLL A;  2B4V A;  7ICL A;  4KLS A;  4RWQ A;  5B3Q A;  3JPQ A;  4K98 A;  5CFT A;  5D61 A;  4X4P A;  4AT7 A;  3NYB A;  4X4Q A;  2ZHA A;  4PH5 A;  1ZQZ A;  3UQ2 A;  5HRB A;  1ZQQ A;  5HR9 A;  3WFP A;  1BPZ A;  3MDC A;  3HIY A;  4K9A A;  9ICN A;  1ZQM A;  5J2D A;  2EWR A;  5B3P A;  4R65 A;  4QZE A;  2PXI A;  4X4S A;  9ICO A;  4TUR A;  1BPB A;  7ICG A;  3HJ4 A;  1ZQT A;  2BCV A;  4UB4 A;  4LZD A;  5HC9 A;  3WFS C;  1HUZ A;  4NXT A;  3RH4 A;  1MQ3 A;  2ZH1 A;  1ZQD A;  4KB6 A;  4NM2 A;  4X0A A;  1BPD A;  4EGW A;  3OVB A;  1JAJ A;  4QZC A;  5DBC A;  5HRL A;  4UB3 A;  4YMO A;  1WOT A;  2BCU A;  1BPE A;  4IG8 A;  4WQL A;  4F5P A;  3AQL A;  1MIY A;  3AQM A;  4I27 A;  5HRF A;  4UBC A;  3PML A;  7ICT A;  5IIJ A;  1KNY A;  8ICN A;  5CB1 A;  1ZQN A;  2B51 A;  4X0B A;  5IIM A;  1ZJN A;  8ICI A;  4XUS A;  7ICF A;  1ZJM A;  2DRA A;  4WQK A;  2HN1 A;  4DOA A;  4UD4 A;  3LQC B;  4FO6 A;  1RZT A;  4KLH A;  2BPG A;  4N7R A;  5CR0 A;  1RPL A;  4Z6D A;  8ICY A;  4LEZ A;  3JPR A;  2HN2 A;  3H38 A;  4O67 A;  3RH6 A;  4K4H A;  2BPC A;  4FH3 A;  2FMQ A;  1R8C A;  2ISO A;  3MGI A;  1Q78 A;  3K7D A;  8ICA A;  7ICQ A;  2M2T A;  4WC7 A;  2M2V A;  5DBB A;  5J29 A;  4RQ8 A;  3CK6 A;  3HX0 A;  4GXI A;  3H37 A;  3MDA A;  1VJ7 A;  4QZF A;  4AT8 A;  4WH5 A;  4K9B A;  4K4G A;  1ZQO A;  8ICE A;  9ICJ A;  1UEV A;  4JLZ A;  1R8B A;  4WC3 A;  4Z6E A;  4QZB A;  4X4R A;  4EP7 A;  1BPY A;  4DOC A;  8ICG A;  2O5A A;  4IQW A;  1XSN A;  1XSL A;  4TUS A;  5BPC A;  1ZQE A;  8ICX A;  5DB6 A;  4RQ5 A;  4WBY A;  4FHV A;  5J0S A;  4PHD A;  2M2W A;  2IUB A;  5J0R A;  2PFQ A;  4PPX A;  4KLF A;  8ICT A;  4M9G A;  7ICK A;  4YMN A;  4I2J A;  3TFS A;  4FHP A;  9ICT A;  4EV6 A;  8ICU A;  4OAH A;  4NKT A;  4I2E A;  2BBJ A;  3AUO A;  4YMM A;  9ICX A;  4RPZ A;  3AU2 A;  3UXN A;  4E7X A;  5DB8 A;  4NKU A;  4PGQ A;  3ERC C;  2PBE A;  4LEV A;  4QZI A;  4X4N A;  4EED A;  5BOM A;  9ICI A;  4PGY A;  4I0U A;  4OAI Z;  4RT2 A;  3ISD A;  1ZQJ A;  3H3A A;  1GPJ A;  3OUY A;  2BCQ A;  4QZG A;  1MIW A;  2FMP A;  3H39 A;  1YLQ A;  3V72 A;  1JQR A;  1TVA A;  9ICK A;  5D4B A;  8ICJ A;  3WFO A;  3L9D A;  3K75 D;  3PHZ A;  4K97 A;  3RJI A;  4NM1 A;  4X4V A;  4O68 A;  1ZQY A;  7ICH A;  4MKP A;  4K8V A;  4WCW A;  2ZHB A;  1ZQH A;  2DR7 A;  9ICW A;  5D46 A;  1ZQI A;  5J0T A;  4I2C A;  3OVS A;  3ISC A;  4WBZ A;  4QZD A;  3HWT A;  3OVA A;  5D49 A;  9ICP A;  3RJE A;  4M04 A;  4UB5 A;  3ER8 C;  1ZQB A;  1KEJ A;  1ZQC A;  4PHA A;  3OV7 A;  9ICA A;  4QZH A;  5TZV A;  3WFQ E;  2HHP A;  4FO1 A;  8ICO A;  3EF2 A;  4KLQ A;  4JLX A;  7ICI A;  4RT3 A;  4RQ0 A;  4MF8 A;  4AT9 A;  2DVI A;  5IIK A;  2GAF D;  4RQ2 A;  5DKW A;  5J2H A;  3PMN A;  3UPQ A;  4RWP A;  2ZH3 A;  5J0P A;  3UXO A;  4ATB A;  2M2U A;  4PGX A;  8ICZ A;  1UET A;  4AT8 B;  5HHI A;  4XQ7 A;  4RPX A;  3JPP A;  1ZQV A;  4NLN A;  4RWO A;  2ID1 A;  1ZQK A;  5CFU A;  4NXZ A;  3TFR A;  2PFN A;  4K99 A;  4I2H A;  5J2C A;  3AQN A;  2FCL A;  5HHH A;  3PNC A;  4KLE A;  4F5Q A;  4LEW A;  2BCR A;  5IIO A;  4O5C A;  5J2F A;  4LZG A;  4KLM A;  5III A;  8ICQ A;  2IHO A;  1KDH A;  1TFY A;  3WFR E;  4OAF A;  4M0A A;  4R64 A;  9ICH A;  5J2A A;  9ICS A;  1F5A A;  4M9L A;  4WC1 A;  4JWM A;  4XA5 A;  4KM5 A;  5J0U A;  8ICL A;  4K96 A;  8ICW A;  3C5G A;  4RWN A;  4OAG A;  1ZQA A;  2PFP A;  1NOM A;  4MFC A;  3HJ1 A;  2RFF A;  4WC4 A;  1ZQU A;  5D63 A;  4NXW A;  8ICK A;  4I29 A;  3GDX A;  2BBH A;  5J0Y A;  5JTG A;  3OGU A;  4NY8 A;  8ICP A;  1ZQL A;  4P4P A;  3LK9 A;  2FMS A;  4LEY A;  5J2J A;  5DEC A;  4IQV A;  3C2L A;  5EOZ A;  4UAY A;  3OUY B;  2ZH8 A;  4M9J A;  4AT7 B;  1PX5 A;  4WC0 A;  3MCR A;  5HRH A;  9ICQ A;  3AQK A;  3JYY A;  4LVS A;  1Q79 A;  7ICU A;  3B0X A;  1V4A A;  8ICF A;  3NVO A;  2ISP A;  5HRK A;  4X4T A;  5IIN A;  5CA7 A;  1MQ2 A;  9ICR A;  3RJH A;  2Q66 A;  3ISB A;  4WC2 A;  1ZQG A;  5DB9 A;  3MGH A;  9ICL A;  3UXP A;  5D62 A;  4KLT A;  4I2F A;  3AU6 A;  5J0X A;  1VFG A;  7ICP A;  3C18 A;  4Z6F A;  4RQ3 A;  3RJG A;  4KLJ A;  2BPF A;  9ICV A;  4R66 A;  5J0Q A;  5DED A;  5F2V O;  4EEB A;  4FHX A;  5J2I A;  3RH5 A;  4YCX A;  7ICE A;  4WOY A;  4AT9 B;  3NWI A;  3ER9 B;  3HW8 A;  5IIL A;  4E8F A;  4I28 A;  1ZQR A;  4YN4 A;  4NXX A;  4F5R A;  4ATB B;  1UEU A;  5J0W A;  2B56 A;  9ICB A;  4E80 A;  2BE3 A;  4PHE A;  1XSP A;  1TV9 A;  2DRB A;  3UPS A;  5HRE A;  4UAZ A;  4RQ1 A;  4O69 A;  3JPT A;  4NXU A;  2NRK A;  8ICS A;  4I2D A;  5HRG A;  5J0O A;  3MBY A;  7ICV A;  4NLZ A;  1JN3 A;  4KLG A;  3RJF A;  4PHP A;  4S3N A;  4Z6C A;  4MFA A;  4P2H A;  7ICJ A;  9ICU A;  4I2B A;  4O6A A;  4NXV A;  2GWS A;  2VAN A;  2BCS A;  1HUO A;  4QZA A;  4F5N A;  2DR5 A;  4F5O A;  1JMS A;  8ICV A;  8ICR A;  1ZQW A;  8ICM A;  4O5K A;  5CWR A;  4UD5 A;  2ZH7 A;  3C66 A;  4WC6 A;  1ZQP A;  2DR9 A;  5J2B A;  7ICR A;  9ICG A;  4FH5 A;  4P4O A;  4QZ9 A;  4UB2 A;  8ICB A;  3B0Y A;  3OWG A;  4JWN A;  3C2K A;  4O5E A;  4IQT A;  4I2G A;  4M5D A;  9ICC A;  8ICC A;  4KLI A;  4RPY A;  7ICO A;  5BOL A;  3V7J A;  1TFW A;  1OU5 A;  4EBK A;  5HRD A;  1ZQS A;  4MF2 A;  2IHM A;  4I2A A;  4LT6 A;  4M47 A;  4UB1 A;  3C2M A;  5J2E A;  5CHG A;  9ICE A;  1R89 A;  3V7L A;  9ICM A;  5DDY A;  4YD1 A;  3JZ0 A;  2ZH6 A;  4XQ8 A;  2W9M A;  5DB7 A;  5CFS A;  4X5V A;  4FHY A;  3V7K A;  4R63 A;  5CP2 A;  4RQ7 A;  4KLU A;  3JPN A;  5HRI A;  2ZH4 A;  1MIV A;  4HX0 A;  4M9H A;  1ZQX A;  2ZH5 A;  4P4M A;  1BPX A;  4FHW A;  4K4I A;  4M9N A;  1R8A A;  4EBJ A;  3UQ0 A;  4X4O A;  3C5F A;  4KLO A;  4RQ4 A;  4QZ8 A;  7ICM A;  1ZQF A;  5DBA A;  4RQ6 A;  3RJJ A;  4GXK A;  4DO9 A;  4DOB A;  5CHE A;  1NO5 A;  4GXJ A;  2PFO A;  4YD2 A;  4O9M A;  4IQU A;  5DDM A;  2I9G A;  4M2Y A;  2P66 A;  5CJ7 A; 
#chains in the Genus database with same CATH homology
 5D62 A;  4WQK A;  4NXT A;  4HX0 A;  3NKU A;  2B56 A;  2GA9 D;  4JLZ A;  4OAH A;  4KB6 A;  4KM5 A;  5CFU A;  3MCR A;  4K96 A;  4N7R A;  4FO1 A;  4O69 A;  3PHZ A;  4K97 A;  4NXU A;  4OAG A;  3EF2 A;  4LEZ A;  4O68 A;  4XJE A;  4JLX A;  4O67 A;  4MKP A;  4K99 A;  4K8V A;  4K9A A;  2FCL A;  4WQL A;  3K7D A;  4NXW A;  4LEV A;  5D63 A;  3ERC C;  2GAF D;  2EWR A;  5B3P A;  4WOY A;  4LEW A;  3ER9 B;  4OAI Z;  2B4V A;  5CFS A;  3OWG A;  5B3Q A;  4K98 A;  4NXX A;  5CHE A;  4O6A A;  4NXV A;  4LEY A;  5CFT A;  2IHO A;  1GPJ A;  2B51 A;  5D61 A;  4OAF A;  4WH5 A;  4K9B A;  3ER8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...