5CFTA

Crystal structure of ant(2")-ia in complex with ampcpp and gentamicin c1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
DTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside Nucleotidyltransferase (2")-Ia
publication title Structural Analysis of the Tobramycin and Gentamicin Clinical Resistome Reveals Limitations for Next-generation Aminoglycoside Design.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase/antibiotic
total genus 60
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cftA00
4XJEA 5CFSA 4FO1A 5CFUA 2EWRA 4HX0A 5CFTA 4WQKA 4WQLA 2FCLA 4WH5A
chains in the Genus database with same CATH superfamily
3TFRA 4UB2A 1ZQBA 3V7LA 5J2EA 5HRLA 9ICLA 2PFPA 4WC6A 4EP7A 3K75D 2ZHBA 4PHAA 9ICFA 4UB4A 8ICXA 2BBHA 3MGHA 4KLDA 1WOTA 3RJIA 3JPRA 4EV6A 1KDHA 1ZQYA 4X4TA 2BCQA 4N7RA 4DOAA 5D4BA 8ICKA 4YCXA 4QZDA 8ICAA 1UEVA 4R66A 1HUOA 3TFSA 5IINA 2DR7A 4X4RA 9ICOA 8ICQA 4TUPA 1ZJMA 3OVBA 8ICCA 2DVIA 2PFOA 2RFFA 4FHVA 4OAIZ 4RT3A 5F2VO 4EBKA 4RWOA 9ICMA 9ICVA 5DB6A 7ICRA 3UPQA 5J0YA 2ZH5A 3ER8C 4Z6DA 1JN3A 3WFRE 1R8AA 2BCUA 4NXUA 1ZQNA 4UAZA 8ICOA 3LQCB 4K9BA 1MIWA 4F5OA 9ICIA 9ICUA 5J0PA 5D49A 3ISCA 5J2GA 9ICJA 2BE3A 3HJ4A 4O68A 5HRKA 4KLFA 3LK9A 3WFQE 9ICRA 4IG8A 5J0XA 1ZQZA 4KLJA 7ICIA 2PXIA 1ZQUA 2O5AA 8ICJA 5IIKA 4K96A 4K4GA 8ICMA 4PPXA 4I2CA 1PX5A 2IHOA 4YN4A 4DOBA 8ICTA 4KLHA 4X5VA 7ICUA 1GPJA 4NXTA 8ICFA 3OVSA 3C2LA 4M9NA 5IIOA 4WC7A 4KLTA 4OAHA 1ZQKA 1ZQHA 7ICQA 3JPOA 3B0YA 5DDYA 4K9AA 5J2JA 3JPSA 5DB8A 9ICXA 1TFYA 4FH5A 1TFWA 2ISOA 1ZQMA 4I2GA 4RPYA 4F5RA 7ICEA 4LEYA 2B51A 1Q79A 4I2IA 1ZQWA 3V72A 4I27A 3V7JA 4NY8A 4TUQA 3RJJA 4PGQA 4Z6EA 3NVOA 4NXZA 5CB1A 4PGXA 7ICTA 4OAFA 2BCSA 1ZQDA 4O9MA 1NO5A 7ICOA 3HIYA 4UD5A 4QZGA 3AUOA 9ICGA 9ICCA 3RJGA 4X0BA 4M47A 4LEZA 4AT8B 4YD1A 9ICWA 4RWPA 4RQ1A 3MGIA 2NRKA 4R64A 4XUSA 1R8BA 4KLLA 4I29A 1YLQA 3PHZA 2IUBA 5DKWA 1RPLA 4FHPA 4GXIA 4PHPA 3UXPA 4MF2A 3RH5A 4YMMA 8ICPA 7ICJA 4RQ4A 4UD4A 4TUSA 3WFPA 3OUYA 4KLUA 5IIJA 4ATBA 4JWMA 9ICHA 3RH4A 4RWNA 5J2AA 4WOYA 8ICZA 4AT9B 2DR9A 4XQ8A 1ZQTA 2ZH1A 4NLZA 4O69A 5IIIA 5DBBA 3RJEA 2BBJA 8ICUA 3WFOA 3HW8A 2DR5A 1Q78A 4IQWA 4LZGA 7ICGA 4M9HA 2ZH4A 4QZIA 1VFGA 1MQ3A 3CK6A 1ZQLA 1ZQOA 1BPYA 2ZH7A 4I2BA 4JLXA 1XSPA 1ZQFA 5DEDA 4WCWA 7ICNA 1ZQSA 4I2AA 4S3NA 1MQ2A 2FMPA 7ICKA 7ICSA 4TURA 4PHEA 1KEJA 8ICNA 4YMOA 3UPSA 4WBYA 4RQ3A 3RH6A 1ZQIA 2EWRA 2ISPA 2ZHAA 2PFQA 5HRFA 4IQVA 2M2VA 4UBCA 3JPNA 4UB3A 3C66A 4KM5A 8ICEA 4YD2A 4M9LA 2FMQA 4QZCA 4NXXA 3HWTA 4LEWA 3ISDA 4P4PA 4E7XA 3MDAA 5D46A 4UBBA 4UAYA 2ID1A 5J0RA 4I28A 9ICNA 1JQRA 4I2DA 1NOMA 3UQ0A 3UXOA 4FO1A 4LEVA 2HN1A 4EEBA 5J2CA 2DR8A 5HC9A 2FMSA 2Q66A 4DOCA 4O5CA 5CHEA 4Z6CA 2BPCA 7ICHA 3UXNA 1XSLA 5B3QA 5J0SA 1ZQAA 4K4HA 4KLSA 1OU5A 3GDXA 4AT7B 3AQMA 4RPZA 3EF2A 3AQLA 4LVSA 2M2WA 4F5QA 5BPCA 4NXVA 4IQTA 1ZQVA 4QZEA 4GXJA 3H37A 5J0UA 3AU6A 4NM2A 5HR9A 5CHGA 8ICYA 2HHPA 1UEUA 5J0OA 3OGUA 7ICPA 7ICLA 4X4UA 3PMNA 8ICHA 3JZ0A 1ZQEA 4QZFA 4HX0A 4QZHA 4LZDA 8ICVA 5CFSA 4XQ7A 5JTGA 4X4QA 1V4AA 3RJHA 4FO6A 4QZ9A 4KLMA 3JPQA 4NLKA 2B4VA 1TV9A 1ZQGA 4M5DA 1ZQPA 1BPEA 4EBJA 5B3PA 4M0AA 1ZQRA 1VJ7A 5DBCA 4KB6A 8ICBA 3B0XA 4DO9A 4UB1A 2W9MA 9ICTA 4RQ7A 3JYYA 4QZ8A 5HRDA 5CJ7A 5J2DA 1RZTA 4FHXA 2M2TA 5TZVA 4MFAA 4NLNA 3H38A 1HUZA 1BPBA 4NM1A 3OVAA 9ICSA 4E8FA 1BPDA 3MCRA 4LT6A 1R89A 3WFSC 3H39A 1F5AA 4F5NA 8ICSA 5CFUA 4RQ2A 4UB5A 4KLIA 3ER9B 4RPXA 5J2FA 4NKTA 1MIVA 1ZQQA 4X4VA 5CP2A 5IILA 2O1PA 4WQKA 4O5EA 4QZAA 5HRGA 2ZH8A 4I2EA 5D63A 4E80A 1ZQJA 1UETA 4WC0A 2BCRA 5CA7A 4M2YA 4FHYA 5HHIA 4O5KA 3AQNA 5HREA 4WC5A 2B56A 3PNCA 3JPPA 8ICLA 4PH5A 4RWQA 5J0WA 4WC3A 4GXKA 5J0QA 4NXWA 5IIMA 4P4OA 2PFNA 5BOLA 3NKUA 3NWIA 5J2IA 4MF8A 5HRIA 4P2HA 4RQ0A 4PGYA 4WH5A 4MFFA 3OWGA 4O6AA 4F5PA 4I2JA 2BPGA 2P66A 4NKUA 4Z6FA 4QZBA 4XA5A 4R65A 3C2MA 4I2HA 2ZH9A 4K98A 3C18A 1KNYA 5DB7A 9ICQA 5J2KA 2ZH6A 3L9DA 8ICRA 4AT8A 4WC1A 3OV7A 4WC2A 3AU2A 4I2FA 4M9GA 5DB9A 4PHDA 1ZJNA 7ICMA 4M04A 8ICGA 4I0UA 3RJFA 3RJKA 1ZQCA 2GWSA 4XJEA 4P4MA 5DECA 2DRAA 4RQ8A 4EGWA 7ICVA 9ICPA 3HJ1A 4KLEA 4UAWA 4FH3A 1BPZA 2BPFA 1MIYA 4RQ5A 3V7KA 4K99A 1R8CA 3MBYA 3C5FA 4MKPA 4EEDA 5D61A 3C5GA 8ICIA 4AT9A 3PMLA 3OUYB 4ATBB 5J2BA 3K7DA 4X4PA 4X4SA 3MDCA 9ICAA 5CFTA 3JPTA 4WQLA 4KLQA 5J29A 4XRHA 3C2KA 4WC4A 5EOZA 2I9GA 9ICKA 4K4IA 3JCFA 4MFCA 1ZQXA 7ICFA 4K8VA 4X4NA 4WBZA 5HHHA 3UQ2A 2VANA 5CWRA 9ICEA 5HRBA 4X0AA 2ZH2A 3AQKA 4R63A 2GAFD 1TVAA 2PBEA 4YMNA 4KLGA 5J2HA 3HX0A 2HN2A 4KLOA 4RQ6A 2ZH3A 4IQUA 1JAJA 4M9JA 4O67A 4JWNA 1BPXA 3H3AA 5J0TA 4RT2A 4K97A 1FA0A 3ISBA 2IHMA 5D62A 5DDMA 8ICWA 3ERCC 9ICBA 4OAGA 2M2UA 5CR0A 5HRHA 2FCLA 2GA9D 4FHWA 1JMSA 2BCVA 4X4OA 5BOMA 5DBAA 1XSNA 2DRBA 4JLZA 3NYBA 4AT7A
chains in the Genus database with same CATH topology
3OWGA 4OAHA 4XJEA 4OAFA 4O67A 4O69A 5D63A 4O6AA 5B3QA 4KM5A 4HX0A 4K9AA 4OAIZ 4K8VA 3EF2A 3PHZA 4K97A 4NXXA 4LEWA 5CFSA 5D62A 4K98A 3ERCC 4NXVA 4OAGA 3MCRA 3ER8C 2B4VA 4N7RA 2FCLA 4K99A 4K96A 2GA9D 4NXUA 4JLXA 4K9BA 4FO1A 4LEVA 2B56A 5CFUA 2GAFD 4MKPA 4LEYA 3ER9B 5D61A 2IHOA 4LEZA 2B51A 5B3PA 4NXWA 4WOYA 3K7DA 4O68A 3NKUA 4KB6A 2EWRA 5CHEA 1GPJA 5CFTA 4WQKA 4WQLA 4NXTA 4JLZA 4WH5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XJE A;  5CFS A;  4FO1 A;  5CFU A;  2EWR A;  4HX0 A;  5CFT A;  4WQK A;  4WQL A;  2FCL A;  4WH5 A; 
#chains in the Genus database with same CATH topology
 3TFR A;  4UB2 A;  1ZQB A;  3V7L A;  5J2E A;  5HRL A;  9ICL A;  2PFP A;  4WC6 A;  4EP7 A;  3K75 D;  2ZHB A;  4PHA A;  9ICF A;  4UB4 A;  8ICX A;  2BBH A;  3MGH A;  4KLD A;  1WOT A;  3RJI A;  3JPR A;  4EV6 A;  1KDH A;  1ZQY A;  4X4T A;  2BCQ A;  4N7R A;  4DOA A;  5D4B A;  8ICK A;  4YCX A;  4QZD A;  8ICA A;  1UEV A;  4R66 A;  1HUO A;  3TFS A;  5IIN A;  2DR7 A;  4X4R A;  9ICO A;  8ICQ A;  4TUP A;  1ZJM A;  3OVB A;  8ICC A;  2DVI A;  2PFO A;  2RFF A;  4FHV A;  4OAI Z;  4RT3 A;  5F2V O;  4EBK A;  4RWO A;  9ICM A;  9ICV A;  5DB6 A;  7ICR A;  3UPQ A;  5J0Y A;  2ZH5 A;  3ER8 C;  4Z6D A;  1JN3 A;  3WFR E;  1R8A A;  2BCU A;  4NXU A;  1ZQN A;  4UAZ A;  8ICO A;  3LQC B;  4K9B A;  1MIW A;  4F5O A;  9ICI A;  9ICU A;  5J0P A;  5D49 A;  3ISC A;  5J2G A;  9ICJ A;  2BE3 A;  3HJ4 A;  4O68 A;  5HRK A;  4KLF A;  3LK9 A;  3WFQ E;  9ICR A;  4IG8 A;  5J0X A;  1ZQZ A;  4KLJ A;  7ICI A;  2PXI A;  1ZQU A;  2O5A A;  8ICJ A;  5IIK A;  4K96 A;  4K4G A;  8ICM A;  4PPX A;  4I2C A;  1PX5 A;  2IHO A;  4YN4 A;  4DOB A;  8ICT A;  4KLH A;  4X5V A;  7ICU A;  1GPJ A;  4NXT A;  8ICF A;  3OVS A;  3C2L A;  4M9N A;  5IIO A;  4WC7 A;  4KLT A;  4OAH A;  1ZQK A;  1ZQH A;  7ICQ A;  3JPO A;  3B0Y A;  5DDY A;  4K9A A;  5J2J A;  3JPS A;  5DB8 A;  9ICX A;  1TFY A;  4FH5 A;  1TFW A;  2ISO A;  1ZQM A;  4I2G A;  4RPY A;  4F5R A;  7ICE A;  4LEY A;  2B51 A;  1Q79 A;  4I2I A;  1ZQW A;  3V72 A;  4I27 A;  3V7J A;  4NY8 A;  4TUQ A;  3RJJ A;  4PGQ A;  4Z6E A;  3NVO A;  4NXZ A;  5CB1 A;  4PGX A;  7ICT A;  4OAF A;  2BCS A;  1ZQD A;  4O9M A;  1NO5 A;  7ICO A;  3HIY A;  4UD5 A;  4QZG A;  3AUO A;  9ICG A;  9ICC A;  3RJG A;  4X0B A;  4M47 A;  4LEZ A;  4AT8 B;  4YD1 A;  9ICW A;  4RWP A;  4RQ1 A;  3MGI A;  2NRK A;  4R64 A;  4XUS A;  1R8B A;  4KLL A;  4I29 A;  1YLQ A;  3PHZ A;  2IUB A;  5DKW A;  1RPL A;  4FHP A;  4GXI A;  4PHP A;  3UXP A;  4MF2 A;  3RH5 A;  4YMM A;  8ICP A;  7ICJ A;  4RQ4 A;  4UD4 A;  4TUS A;  3WFP A;  3OUY A;  4KLU A;  5IIJ A;  4ATB A;  4JWM A;  9ICH A;  3RH4 A;  4RWN A;  5J2A A;  4WOY A;  8ICZ A;  4AT9 B;  2DR9 A;  4XQ8 A;  1ZQT A;  2ZH1 A;  4NLZ A;  4O69 A;  5III A;  5DBB A;  3RJE A;  2BBJ A;  8ICU A;  3WFO A;  3HW8 A;  2DR5 A;  1Q78 A;  4IQW A;  4LZG A;  7ICG A;  4M9H A;  2ZH4 A;  4QZI A;  1VFG A;  1MQ3 A;  3CK6 A;  1ZQL A;  1ZQO A;  1BPY A;  2ZH7 A;  4I2B A;  4JLX A;  1XSP A;  1ZQF A;  5DED A;  4WCW A;  7ICN A;  1ZQS A;  4I2A A;  4S3N A;  1MQ2 A;  2FMP A;  7ICK A;  7ICS A;  4TUR A;  4PHE A;  1KEJ A;  8ICN A;  4YMO A;  3UPS A;  4WBY A;  4RQ3 A;  3RH6 A;  1ZQI A;  2EWR A;  2ISP A;  2ZHA A;  2PFQ A;  5HRF A;  4IQV A;  2M2V A;  4UBC A;  3JPN A;  4UB3 A;  3C66 A;  4KM5 A;  8ICE A;  4YD2 A;  4M9L A;  2FMQ A;  4QZC A;  4NXX A;  3HWT A;  4LEW A;  3ISD A;  4P4P A;  4E7X A;  3MDA A;  5D46 A;  4UBB A;  4UAY A;  2ID1 A;  5J0R A;  4I28 A;  9ICN A;  1JQR A;  4I2D A;  1NOM A;  3UQ0 A;  3UXO A;  4FO1 A;  4LEV A;  2HN1 A;  4EEB A;  5J2C A;  2DR8 A;  5HC9 A;  2FMS A;  2Q66 A;  4DOC A;  4O5C A;  5CHE A;  4Z6C A;  2BPC A;  7ICH A;  3UXN A;  1XSL A;  5B3Q A;  5J0S A;  1ZQA A;  4K4H A;  4KLS A;  1OU5 A;  3GDX A;  4AT7 B;  3AQM A;  4RPZ A;  3EF2 A;  3AQL A;  4LVS A;  2M2W A;  4F5Q A;  5BPC A;  4NXV A;  4IQT A;  1ZQV A;  4QZE A;  4GXJ A;  3H37 A;  5J0U A;  3AU6 A;  4NM2 A;  5HR9 A;  5CHG A;  8ICY A;  2HHP A;  1UEU A;  5J0O A;  3OGU A;  7ICP A;  7ICL A;  4X4U A;  3PMN A;  8ICH A;  3JZ0 A;  1ZQE A;  4QZF A;  4HX0 A;  4QZH A;  4LZD A;  8ICV A;  5CFS A;  4XQ7 A;  5JTG A;  4X4Q A;  1V4A A;  3RJH A;  4FO6 A;  4QZ9 A;  4KLM A;  3JPQ A;  4NLK A;  2B4V A;  1TV9 A;  1ZQG A;  4M5D A;  1ZQP A;  1BPE A;  4EBJ A;  5B3P A;  4M0A A;  1ZQR A;  1VJ7 A;  5DBC A;  4KB6 A;  8ICB A;  3B0X A;  4DO9 A;  4UB1 A;  2W9M A;  9ICT A;  4RQ7 A;  3JYY A;  4QZ8 A;  5HRD A;  5CJ7 A;  5J2D A;  1RZT A;  4FHX A;  2M2T A;  5TZV A;  4MFA A;  4NLN A;  3H38 A;  1HUZ A;  1BPB A;  4NM1 A;  3OVA A;  9ICS A;  4E8F A;  1BPD A;  3MCR A;  4LT6 A;  1R89 A;  3WFS C;  3H39 A;  1F5A A;  4F5N A;  8ICS A;  5CFU A;  4RQ2 A;  4UB5 A;  4KLI A;  3ER9 B;  4RPX A;  5J2F A;  4NKT A;  1MIV A;  1ZQQ A;  4X4V A;  5CP2 A;  5IIL A;  2O1P A;  4WQK A;  4O5E A;  4QZA A;  5HRG A;  2ZH8 A;  4I2E A;  5D63 A;  4E80 A;  1ZQJ A;  1UET A;  4WC0 A;  2BCR A;  5CA7 A;  4M2Y A;  4FHY A;  5HHI A;  4O5K A;  3AQN A;  5HRE A;  4WC5 A;  2B56 A;  3PNC A;  3JPP A;  8ICL A;  4PH5 A;  4RWQ A;  5J0W A;  4WC3 A;  4GXK A;  5J0Q A;  4NXW A;  5IIM A;  4P4O A;  2PFN A;  5BOL A;  3NKU A;  3NWI A;  5J2I A;  4MF8 A;  5HRI A;  4P2H A;  4RQ0 A;  4PGY A;  4WH5 A;  4MFF A;  3OWG A;  4O6A A;  4F5P A;  4I2J A;  2BPG A;  2P66 A;  4NKU A;  4Z6F A;  4QZB A;  4XA5 A;  4R65 A;  3C2M A;  4I2H A;  2ZH9 A;  4K98 A;  3C18 A;  1KNY A;  5DB7 A;  9ICQ A;  5J2K A;  2ZH6 A;  3L9D A;  8ICR A;  4AT8 A;  4WC1 A;  3OV7 A;  4WC2 A;  3AU2 A;  4I2F A;  4M9G A;  5DB9 A;  4PHD A;  1ZJN A;  7ICM A;  4M04 A;  8ICG A;  4I0U A;  3RJF A;  3RJK A;  1ZQC A;  2GWS A;  4XJE A;  4P4M A;  5DEC A;  2DRA A;  4RQ8 A;  4EGW A;  7ICV A;  9ICP A;  3HJ1 A;  4KLE A;  4UAW A;  4FH3 A;  1BPZ A;  2BPF A;  1MIY A;  4RQ5 A;  3V7K A;  4K99 A;  1R8C A;  3MBY A;  3C5F A;  4MKP A;  4EED A;  5D61 A;  3C5G A;  8ICI A;  4AT9 A;  3PML A;  3OUY B;  4ATB B;  5J2B A;  3K7D A;  4X4P A;  4X4S A;  3MDC A;  9ICA A;  5CFT A;  3JPT A;  4WQL A;  4KLQ A;  5J29 A;  4XRH A;  3C2K A;  4WC4 A;  5EOZ A;  2I9G A;  9ICK A;  4K4I A;  3JCF A;  4MFC A;  1ZQX A;  7ICF A;  4K8V A;  4X4N A;  4WBZ A;  5HHH A;  3UQ2 A;  2VAN A;  5CWR A;  9ICE A;  5HRB A;  4X0A A;  2ZH2 A;  3AQK A;  4R63 A;  2GAF D;  1TVA A;  2PBE A;  4YMN A;  4KLG A;  5J2H A;  3HX0 A;  2HN2 A;  4KLO A;  4RQ6 A;  2ZH3 A;  4IQU A;  1JAJ A;  4M9J A;  4O67 A;  4JWN A;  1BPX A;  3H3A A;  5J0T A;  4RT2 A;  4K97 A;  1FA0 A;  3ISB A;  2IHM A;  5D62 A;  5DDM A;  8ICW A;  3ERC C;  9ICB A;  4OAG A;  2M2U A;  5CR0 A;  5HRH A;  2FCL A;  2GA9 D;  4FHW A;  1JMS A;  2BCV A;  4X4O A;  5BOM A;  5DBA A;  1XSN A;  2DRB A;  4JLZ A;  3NYB A;  4AT7 A; 
#chains in the Genus database with same CATH homology
 3OWG A;  4OAH A;  4XJE A;  4OAF A;  4O67 A;  4O69 A;  5D63 A;  4O6A A;  5B3Q A;  4KM5 A;  4HX0 A;  4K9A A;  4OAI Z;  4K8V A;  3EF2 A;  3PHZ A;  4K97 A;  4NXX A;  4LEW A;  5CFS A;  5D62 A;  4K98 A;  3ERC C;  4NXV A;  4OAG A;  3MCR A;  3ER8 C;  2B4V A;  4N7R A;  2FCL A;  4K99 A;  4K96 A;  2GA9 D;  4NXU A;  4JLX A;  4K9B A;  4FO1 A;  4LEV A;  2B56 A;  5CFU A;  2GAF D;  4MKP A;  4LEY A;  3ER9 B;  5D61 A;  2IHO A;  4LEZ A;  2B51 A;  5B3P A;  4NXW A;  4WOY A;  3K7D A;  4O68 A;  3NKU A;  4KB6 A;  2EWR A;  5CHE A;  1GPJ A;  5CFT A;  4WQK A;  4WQL A;  4NXT A;  4JLZ A;  4WH5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...