5CFTA

Crystal structure of ant(2")-ia in complex with ampcpp and gentamicin c1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
b'DTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminoglycoside Nucleotidyltransferase (2")-Ia
molecule tags Transferase/antibiotic
source organism Pseudomonas aeruginosa
publication title Structural Analysis of the Tobramycin and Gentamicin Clinical Resistome Reveals Limitations for Next-generation Aminoglycoside Design.
pubmed doi rcsb
total genus 60
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cftA00
2EWRA 2FCLA 4WH5A 4FO1A 4WQKA 5CFSA 5CFUA 4HX0A 4XJEA 5CFTA 4WQLA
chains in the Genus database with same CATH superfamily
3UXNA 4P4MA 4K99A 1TV9A 1ZQPA 3ER9B 4YMOA 4EBKA 3HIYA 3RJKA 1UEVA 3B0XA 4M04A 5HRBA 1ZQGA 4FHXA 4NXTA 3CK6A 4WC2A 4F5OA 4EEBA 9ICUA 4K9BA 1WOTA 4Z6CA 4XQ8A 4AT9B 5BPCA 5J0SA 7ICHA 2BPGA 9ICCA 9ICEA 4NXZA 4M0AA 5DKWA 1BPDA 5IIKA 4QZBA 8ICYA 1ZQLA 1FA0A 5IILA 1VFGA 4KLJA 5CHGA 4WC5A 4I2JA 4RWQA 1RZTA 1BPZA 4XJEA 4YD2A 1R89A 4IQUA 8ICLA 3TFSA 2RFFA 2DRBA 9ICGA 4M9NA 2FMSA 5JTGA 4NXVA 4X4SA 2ZH3A 3TFRA 4M2YA 9ICIA 3NKUA 4YD1A 5HRDA 1BPEA 4WQLA 3MBYA 4PHPA 7ICSA 9ICJA 8ICAA 3L9DA 1ZQHA 4RQ4A 4I2HA 4O5KA 2PFNA 3AU6A 5IINA 1ZQAA 4F5RA 3H3AA 4UB5A 5HHHA 3PMNA 1ZQCA 4O9MA 4QZIA 4K4HA 9ICNA 3PHZA 4NY8A 4DOBA 4WOYA 2I9GA 9ICAA 4KLDA 4LEVA 3WFRE 4AT8B 1ZQMA 5J2DA 4MFCA 1ZQDA 7ICVA 4EBJA 4RT3A 4RQ8A 5TZVA 5D62A 4KLSA 2PFOA 8ICQA 5J2JA 4MF2A 4JLXA 4QZCA 4NLNA 4E80A 4I0UA 4I2CA 4EGWA 5HRIA 4K9AA 4DOCA 4K98A 2BCVA 7ICFA 4TURA 1PX5A 9ICRA 4WC0A 4Z6DA 3RH5A 8ICXA 4E8FA 3JPSA 3C2KA 5J2IA 4P4OA 4PHEA 3JPQA 1ZQJA 2GA9D 4KLHA 4UAWA 3H39A 4RPZA 4I2FA 1TFYA 5HREA 3RJEA 3JPPA 8ICOA 1NO5A 1TVAA 3OUYB 3JPTA 4RPYA 4EEDA 7ICMA 9ICMA 4QZAA 4KB6A 2HN2A 3LQCB 4UAYA 4X4UA 1JMSA 4QZ9A 5DEDA 1ZQSA 4XQ7A 4E7XA 5B3QA 2FCLA 2ZH1A 3JPRA 2P66A 5D46A 1JQRA 5HRLA 4I28A 4TUPA 7ICEA 2O5AA 3MGHA 5J2HA 4X4VA 4FO6A 4WC1A 4F5QA 1JAJA 4R66A 2ZH2A 4OAGA 2B56A 3MCRA 9ICOA 4UD5A 4PGXA 4FHWA 3MGIA 5B3PA 1HUOA 1MIYA 4K4IA 5CA7A 2PFPA 5CJ7A 3V72A 4WC4A 9ICBA 1ZQOA 1R8BA 4RQ6A 2GAFD 4KLLA 3JZ0A 5BOLA 5CFSA 5HR9A 3GDXA 4RWOA 4NXXA 2DRAA 7ICKA 4I2IA 4UAZA 3AUOA 3RJHA 1BPYA 3V7KA 2DR9A 4QZDA 3H38A 1MIWA 4PGYA 1ZQBA 3NYBA 4UBBA 1ZQRA 3B0YA 4LZGA 2BCSA 5IIOA 2B51A 7ICUA 4KLQA 1HUZA 4I2BA 7ICTA 8ICMA 2IHOA 4HX0A 5J0QA 5HRHA 4XA5A 3UPQA 4LZDA 4I29A 5J0RA 9ICKA 4F5PA 4WBZA 4O5EA 8ICPA 4O69A 2PFQA 8ICVA 5DBCA 8ICBA 3AQLA 3C66A 4K8VA 2IHMA 1BPXA 2HN1A 5F2VO 5J0UA 1MQ2A 4RQ5A 3AU2A 5D4BA 4GXIA 4P2HA 3HW8A 3UPSA 4X4TA 4NKUA 4LVSA 5J2AA 9ICLA 2BCQA 5IIJA 8ICGA 1ZJNA 4YMMA 3AQNA 3UQ0A 3HJ4A 4GXJA 5J2FA 5J0TA 3HWTA 3HX0A 4LEYA 4MFAA 2ZHAA 8ICTA 3JYYA 1UETA 4KLMA 4GXKA 3H37A 3OVSA 1ZQYA 3JPNA 3JCFA 1XSPA 4AT7A 4I2EA 3OV7A 4X4NA 5HHIA 4KLOA 3V7LA 4RT2A 1Q78A 4QZHA 1UEUA 3HJ1A 4ATBB 4DO9A 4KLGA 4I2DA 3C2LA 5J0PA 3C5GA 1ZQEA 2W9MA 4KLIA 4R63A 4KM5A 1GPJA 5HC9A 4Z6EA 8ICIA 4K97A 4FHVA 5CWRA 5D49A 4PHAA 1RPLA 2BBHA 4K96A 3WFSC 5J0XA 4NM2A 2DR7A 5BOMA 5CFUA 7ICPA 4KLTA 2Q66A 2ZH9A 4KLUA 4X0BA 3C2MA 4JWNA 4IQVA 3OWGA 4KLFA 5CB1A 2BCUA 8ICCA 5CFTA 3C5FA 5D63A 7ICRA 5DBAA 3C18A 8ICFA 3RJIA 4Z6FA 2ZH7A 5HRGA 4I27A 4RPXA 2IUBA 8ICSA 4XUSA 9ICHA 3ER8C 4RQ1A 4OAHA 8ICJA 9ICFA 5CP2A 4R64A 4M9GA 4EP7A 3JPOA 8ICWA 9ICTA 4NXUA 4RQ3A 2FMPA 4RQ0A 3ISDA 4YN4A 3MDAA 1ZQUA 4FH5A 4NKTA 4P4PA 3UXOA 4NM1A 7ICQA 9ICQA 4X0AA 4QZGA 4LT6A 5DECA 4YCXA 2ZH5A 4X4QA 4O68A 3NWIA 4R65A 3AQKA 1KEJA 2GWSA 2EWRA 3WFPA 5DB7A 2BPCA 4WBYA 4AT9A 3UXPA 1KDHA 3K7DA 3ISCA 7ICIA 4O6AA 5DDYA 4ATBA 4RQ2A 1JN3A 4IQTA 1BPBA 4UB4A 3RJJA 1OU5A 2DVIA 5J2BA 4M9JA 2DR8A 5J0YA 4PGQA 4O5CA 4K4GA 2PBEA 4NXWA 3PMLA 4EV6A 1Q79A 2M2VA 4FH3A 4WQKA 5CHEA 2ISPA 4WC6A 4UBCA 4M9LA 4UD4A 4RWNA 1XSLA 7ICLA 5IIIA 5J29A 1ZQIA 3WFQE 4MFFA 9ICPA 4M9HA 2HHPA 5J2KA 2ZHBA 2M2UA 4PHDA 3RH6A 2ZH4A 8ICHA 4S3NA 4PH5A 4OAFA 2BCRA 2M2WA 4WH5A 1ZQXA 4QZFA 4KLEA 7ICGA 2O1PA 4FHYA 4MKPA 1ZQQA 4X4PA 1XSNA 5J2CA 2ZH6A 4UB2A 2BE3A 9ICVA 4AT7B 8ICEA 1ZQTA 5J2GA 4N7RA 4XRHA 8ICRA 2ZH8A 4YMNA 4IQWA 3OGUA 2PXIA 4NLKA 1ZQVA 4PPXA 4TUQA 3MDCA 3OVAA 4RQ7A 3RJFA 7ICOA 1ZJMA 3ISBA 5HRKA 5IIMA 4NLZA 3AQMA 4WC7A 2BPFA 4JWMA 5DB6A 4M47A 4WC3A 9ICXA 2BBJA 2M2TA 1F5AA 8ICNA 9ICWA 1TFWA 3K75D 5J0OA 4MF8A 2NRKA 5J0WA 4M5DA 1YLQA 4FO1A 2ISOA 3ERCC 4LEWA 8ICZA 8ICUA 4O67A 4FHPA 3EF2A 4UB1A 3LK9A 1ZQNA 5J2EA 7ICJA 5DB9A 1MQ3A 4I2AA 1V4AA 3OUYA 2VANA 3RH4A 4IG8A 1R8AA 4QZ8A 4DOAA 2ID1A 5D61A 1MIVA 5CR0A 5DB8A 4WCWA 1ZQKA 1KNYA 3PNCA 5DDMA 3V7JA 1NOMA 3OVBA 4RWPA 3NVOA 1VJ7A 9ICSA 4LEZA 2FMQA 4UB3A 2B4VA 3WFOA 4OAIZ 4X4OA 3RJGA 1ZQFA 5HRFA 5EOZA 4X5VA 4I2GA 5DBBA 2DR5A 7ICNA 4TUSA 1ZQZA 4X4RA 3UQ2A 8ICKA 4QZEA 1R8CA 1ZQWA 4F5NA 4AT8A 4JLZA
chains in the Genus database with same CATH topology
2EWRA 3MCRA 4K96A 4K99A 4NXUA 2B51A 5B3PA 5CFUA 2B56A 4XJEA 3ER9B 3K7DA 3PHZA 5B3QA 3OWGA 4WOYA 4O6AA 2FCLA 4FO1A 2IHOA 4N7RA 2GA9D 3ERCC 4HX0A 4LEWA 4LEVA 5CFTA 5D63A 4LEZA 4NXTA 2GAFD 4NXVA 2B4VA 4O67A 4OAIZ 3EF2A 4OAFA 4K9BA 5CFSA 4WH5A 5D62A 3NKUA 4LEYA 4O68A 4NXXA 4WQLA 4KM5A 4MKPA 4O69A 1GPJA 4JLXA 4NXWA 3ER8C 4K97A 4WQKA 5CHEA 4KB6A 4OAHA 4K8VA 4K9AA 5D61A 4K98A 4OAGA 4JLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWR A;  2FCL A;  4WH5 A;  4FO1 A;  4WQK A;  5CFS A;  5CFU A;  4HX0 A;  4XJE A;  5CFT A;  4WQL A; 
#chains in the Genus database with same CATH topology
 3UXN A;  4P4M A;  4K99 A;  1TV9 A;  1ZQP A;  3ER9 B;  4YMO A;  4EBK A;  3HIY A;  3RJK A;  1UEV A;  3B0X A;  4M04 A;  5HRB A;  1ZQG A;  4FHX A;  4NXT A;  3CK6 A;  4WC2 A;  4F5O A;  4EEB A;  9ICU A;  4K9B A;  1WOT A;  4Z6C A;  4XQ8 A;  4AT9 B;  5BPC A;  5J0S A;  7ICH A;  2BPG A;  9ICC A;  9ICE A;  4NXZ A;  4M0A A;  5DKW A;  1BPD A;  5IIK A;  4QZB A;  8ICY A;  1ZQL A;  1FA0 A;  5IIL A;  1VFG A;  4KLJ A;  5CHG A;  4WC5 A;  4I2J A;  4RWQ A;  1RZT A;  1BPZ A;  4XJE A;  4YD2 A;  1R89 A;  4IQU A;  8ICL A;  3TFS A;  2RFF A;  2DRB A;  9ICG A;  4M9N A;  2FMS A;  5JTG A;  4NXV A;  4X4S A;  2ZH3 A;  3TFR A;  4M2Y A;  9ICI A;  3NKU A;  4YD1 A;  5HRD A;  1BPE A;  4WQL A;  3MBY A;  4PHP A;  7ICS A;  9ICJ A;  8ICA A;  3L9D A;  1ZQH A;  4RQ4 A;  4I2H A;  4O5K A;  2PFN A;  3AU6 A;  5IIN A;  1ZQA A;  4F5R A;  3H3A A;  4UB5 A;  5HHH A;  3PMN A;  1ZQC A;  4O9M A;  4QZI A;  4K4H A;  9ICN A;  3PHZ A;  4NY8 A;  4DOB A;  4WOY A;  2I9G A;  9ICA A;  4KLD A;  4LEV A;  3WFR E;  4AT8 B;  1ZQM A;  5J2D A;  4MFC A;  1ZQD A;  7ICV A;  4EBJ A;  4RT3 A;  4RQ8 A;  5TZV A;  5D62 A;  4KLS A;  2PFO A;  8ICQ A;  5J2J A;  4MF2 A;  4JLX A;  4QZC A;  4NLN A;  4E80 A;  4I0U A;  4I2C A;  4EGW A;  5HRI A;  4K9A A;  4DOC A;  4K98 A;  2BCV A;  7ICF A;  4TUR A;  1PX5 A;  9ICR A;  4WC0 A;  4Z6D A;  3RH5 A;  8ICX A;  4E8F A;  3JPS A;  3C2K A;  5J2I A;  4P4O A;  4PHE A;  3JPQ A;  1ZQJ A;  2GA9 D;  4KLH A;  4UAW A;  3H39 A;  4RPZ A;  4I2F A;  1TFY A;  5HRE A;  3RJE A;  3JPP A;  8ICO A;  1NO5 A;  1TVA A;  3OUY B;  3JPT A;  4RPY A;  4EED A;  7ICM A;  9ICM A;  4QZA A;  4KB6 A;  2HN2 A;  3LQC B;  4UAY A;  4X4U A;  1JMS A;  4QZ9 A;  5DED A;  1ZQS A;  4XQ7 A;  4E7X A;  5B3Q A;  2FCL A;  2ZH1 A;  3JPR A;  2P66 A;  5D46 A;  1JQR A;  5HRL A;  4I28 A;  4TUP A;  7ICE A;  2O5A A;  3MGH A;  5J2H A;  4X4V A;  4FO6 A;  4WC1 A;  4F5Q A;  1JAJ A;  4R66 A;  2ZH2 A;  4OAG A;  2B56 A;  3MCR A;  9ICO A;  4UD5 A;  4PGX A;  4FHW A;  3MGI A;  5B3P A;  1HUO A;  1MIY A;  4K4I A;  5CA7 A;  2PFP A;  5CJ7 A;  3V72 A;  4WC4 A;  9ICB A;  1ZQO A;  1R8B A;  4RQ6 A;  2GAF D;  4KLL A;  3JZ0 A;  5BOL A;  5CFS A;  5HR9 A;  3GDX A;  4RWO A;  4NXX A;  2DRA A;  7ICK A;  4I2I A;  4UAZ A;  3AUO A;  3RJH A;  1BPY A;  3V7K A;  2DR9 A;  4QZD A;  3H38 A;  1MIW A;  4PGY A;  1ZQB A;  3NYB A;  4UBB A;  1ZQR A;  3B0Y A;  4LZG A;  2BCS A;  5IIO A;  2B51 A;  7ICU A;  4KLQ A;  1HUZ A;  4I2B A;  7ICT A;  8ICM A;  2IHO A;  4HX0 A;  5J0Q A;  5HRH A;  4XA5 A;  3UPQ A;  4LZD A;  4I29 A;  5J0R A;  9ICK A;  4F5P A;  4WBZ A;  4O5E A;  8ICP A;  4O69 A;  2PFQ A;  8ICV A;  5DBC A;  8ICB A;  3AQL A;  3C66 A;  4K8V A;  2IHM A;  1BPX A;  2HN1 A;  5F2V O;  5J0U A;  1MQ2 A;  4RQ5 A;  3AU2 A;  5D4B A;  4GXI A;  4P2H A;  3HW8 A;  3UPS A;  4X4T A;  4NKU A;  4LVS A;  5J2A A;  9ICL A;  2BCQ A;  5IIJ A;  8ICG A;  1ZJN A;  4YMM A;  3AQN A;  3UQ0 A;  3HJ4 A;  4GXJ A;  5J2F A;  5J0T A;  3HWT A;  3HX0 A;  4LEY A;  4MFA A;  2ZHA A;  8ICT A;  3JYY A;  1UET A;  4KLM A;  4GXK A;  3H37 A;  3OVS A;  1ZQY A;  3JPN A;  3JCF A;  1XSP A;  4AT7 A;  4I2E A;  3OV7 A;  4X4N A;  5HHI A;  4KLO A;  3V7L A;  4RT2 A;  1Q78 A;  4QZH A;  1UEU A;  3HJ1 A;  4ATB B;  4DO9 A;  4KLG A;  4I2D A;  3C2L A;  5J0P A;  3C5G A;  1ZQE A;  2W9M A;  4KLI A;  4R63 A;  4KM5 A;  1GPJ A;  5HC9 A;  4Z6E A;  8ICI A;  4K97 A;  4FHV A;  5CWR A;  5D49 A;  4PHA A;  1RPL A;  2BBH A;  4K96 A;  3WFS C;  5J0X A;  4NM2 A;  2DR7 A;  5BOM A;  5CFU A;  7ICP A;  4KLT A;  2Q66 A;  2ZH9 A;  4KLU A;  4X0B A;  3C2M A;  4JWN A;  4IQV A;  3OWG A;  4KLF A;  5CB1 A;  2BCU A;  8ICC A;  5CFT A;  3C5F A;  5D63 A;  7ICR A;  5DBA A;  3C18 A;  8ICF A;  3RJI A;  4Z6F A;  2ZH7 A;  5HRG A;  4I27 A;  4RPX A;  2IUB A;  8ICS A;  4XUS A;  9ICH A;  3ER8 C;  4RQ1 A;  4OAH A;  8ICJ A;  9ICF A;  5CP2 A;  4R64 A;  4M9G A;  4EP7 A;  3JPO A;  8ICW A;  9ICT A;  4NXU A;  4RQ3 A;  2FMP A;  4RQ0 A;  3ISD A;  4YN4 A;  3MDA A;  1ZQU A;  4FH5 A;  4NKT A;  4P4P A;  3UXO A;  4NM1 A;  7ICQ A;  9ICQ A;  4X0A A;  4QZG A;  4LT6 A;  5DEC A;  4YCX A;  2ZH5 A;  4X4Q A;  4O68 A;  3NWI A;  4R65 A;  3AQK A;  1KEJ A;  2GWS A;  2EWR A;  3WFP A;  5DB7 A;  2BPC A;  4WBY A;  4AT9 A;  3UXP A;  1KDH A;  3K7D A;  3ISC A;  7ICI A;  4O6A A;  5DDY A;  4ATB A;  4RQ2 A;  1JN3 A;  4IQT A;  1BPB A;  4UB4 A;  3RJJ A;  1OU5 A;  2DVI A;  5J2B A;  4M9J A;  2DR8 A;  5J0Y A;  4PGQ A;  4O5C A;  4K4G A;  2PBE A;  4NXW A;  3PML A;  4EV6 A;  1Q79 A;  2M2V A;  4FH3 A;  4WQK A;  5CHE A;  2ISP A;  4WC6 A;  4UBC A;  4M9L A;  4UD4 A;  4RWN A;  1XSL A;  7ICL A;  5III A;  5J29 A;  1ZQI A;  3WFQ E;  4MFF A;  9ICP A;  4M9H A;  2HHP A;  5J2K A;  2ZHB A;  2M2U A;  4PHD A;  3RH6 A;  2ZH4 A;  8ICH A;  4S3N A;  4PH5 A;  4OAF A;  2BCR A;  2M2W A;  4WH5 A;  1ZQX A;  4QZF A;  4KLE A;  7ICG A;  2O1P A;  4FHY A;  4MKP A;  1ZQQ A;  4X4P A;  1XSN A;  5J2C A;  2ZH6 A;  4UB2 A;  2BE3 A;  9ICV A;  4AT7 B;  8ICE A;  1ZQT A;  5J2G A;  4N7R A;  4XRH A;  8ICR A;  2ZH8 A;  4YMN A;  4IQW A;  3OGU A;  2PXI A;  4NLK A;  1ZQV A;  4PPX A;  4TUQ A;  3MDC A;  3OVA A;  4RQ7 A;  3RJF A;  7ICO A;  1ZJM A;  3ISB A;  5HRK A;  5IIM A;  4NLZ A;  3AQM A;  4WC7 A;  2BPF A;  4JWM A;  5DB6 A;  4M47 A;  4WC3 A;  9ICX A;  2BBJ A;  2M2T A;  1F5A A;  8ICN A;  9ICW A;  1TFW A;  3K75 D;  5J0O A;  4MF8 A;  2NRK A;  5J0W A;  4M5D A;  1YLQ A;  4FO1 A;  2ISO A;  3ERC C;  4LEW A;  8ICZ A;  8ICU A;  4O67 A;  4FHP A;  3EF2 A;  4UB1 A;  3LK9 A;  1ZQN A;  5J2E A;  7ICJ A;  5DB9 A;  1MQ3 A;  4I2A A;  1V4A A;  3OUY A;  2VAN A;  3RH4 A;  4IG8 A;  1R8A A;  4QZ8 A;  4DOA A;  2ID1 A;  5D61 A;  1MIV A;  5CR0 A;  5DB8 A;  4WCW A;  1ZQK A;  1KNY A;  3PNC A;  5DDM A;  3V7J A;  1NOM A;  3OVB A;  4RWP A;  3NVO A;  1VJ7 A;  9ICS A;  4LEZ A;  2FMQ A;  4UB3 A;  2B4V A;  3WFO A;  4OAI Z;  4X4O A;  3RJG A;  1ZQF A;  5HRF A;  5EOZ A;  4X5V A;  4I2G A;  5DBB A;  2DR5 A;  7ICN A;  4TUS A;  1ZQZ A;  4X4R A;  3UQ2 A;  8ICK A;  4QZE A;  1R8C A;  1ZQW A;  4F5N A;  4AT8 A;  4JLZ A; 
#chains in the Genus database with same CATH homology
 2EWR A;  3MCR A;  4K96 A;  4K99 A;  4NXU A;  2B51 A;  5B3P A;  5CFU A;  2B56 A;  4XJE A;  3ER9 B;  3K7D A;  3PHZ A;  5B3Q A;  3OWG A;  4WOY A;  4O6A A;  2FCL A;  4FO1 A;  2IHO A;  4N7R A;  2GA9 D;  3ERC C;  4HX0 A;  4LEW A;  4LEV A;  5CFT A;  5D63 A;  4LEZ A;  4NXT A;  2GAF D;  4NXV A;  2B4V A;  4O67 A;  4OAI Z;  3EF2 A;  4OAF A;  4K9B A;  5CFS A;  4WH5 A;  5D62 A;  3NKU A;  4LEY A;  4O68 A;  4NXX A;  4WQL A;  4KM5 A;  4MKP A;  4O69 A;  1GPJ A;  4JLX A;  4NXW A;  3ER8 C;  4K97 A;  4WQK A;  5CHE A;  4KB6 A;  4OAH A;  4K8V A;  4K9A A;  5D61 A;  4K98 A;  4OAG A;  4JLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...