5CFTA

Crystal structure of ant(2")-ia in complex with ampcpp and gentamicin c1
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
DTTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Aminoglycoside Nucleotidyltransferase (2")-Ia
publication title Structural Analysis of the Tobramycin and Gentamicin Clinical Resistome Reveals Limitations for Next-generation Aminoglycoside Design.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 60
structure length 175
sequence length 175
ec nomenclature
pdb deposition date 2015-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 5cftA00
5CFTA 5CFSA 2EWRA 2FCLA 4HX0A 4WH5A 4XJEA 4WQKA 4WQLA 5CFUA 4FO1A
chains in the Genus database with same CATH superfamily
4WC2A 4PGYA 3C2LA 4IG8A 3ISBA 8ICHA 1ZQHA 1F5AA 5J0YA 1TV9A 3WFRE 7ICFA 2FCLA 3JPRA 5HRLA 4JWNA 1BPDA 4N7RA 1MIWA 4KLDA 4M9NA 3NWIA 3C66A 1MIVA 4R64A 4P2HA 5J2EA 4M2YA 5CFUA 5J2HA 7ICHA 9ICAA 5HRHA 1ZQOA 2I9GA 4RWNA 5IIMA 4QZEA 4LZGA 4TUQA 5BPCA 5CP2A 1XSPA 2ID1A 3AQMA 7ICRA 1ZQVA 1ZQJA 2DR9A 5HHIA 4UB1A 5HREA 9ICHA 4UAZA 3V7KA 1ZJNA 3GDXA 1RZTA 2DRAA 5J0WA 4XQ7A 4RPYA 5IIIA 9ICCA 3RJJA 4UB2A 3RJKA 4EEBA 1YLQA 8ICTA 4O6AA 2ISPA 4M9HA 4IQWA 2DRBA 4LZDA 5D63A 1UEVA 8ICOA 4YMOA 5CFTA 4PGXA 4NKUA 4QZAA 2PXIA 4DOBA 2HN1A 1R89A 3LK9A 3JPQA 4NXTA 4FHWA 4Z6FA 1ZQQA 4KLMA 4I2EA 3RJIA 5HRGA 4R65A 5CJ7A 4WC7A 4EP7A 1Q78A 2FMQA 2RFFA 4EGWA 3WFQE 3CK6A 4X4RA 3JYYA 1TFYA 2ZH5A 9ICMA 2ZHBA 4RQ2A 1FA0A 4F5RA 1ZQSA 5IIKA 9ICRA 2ZH4A 2VANA 1KDHA 3NKUA 4I2HA 9ICXA 4RQ4A 2FMSA 1R8CA 4WQKA 1JMSA 4TURA 3RH6A 2BPCA 2PFOA 4QZCA 2ZHAA 1ZQWA 5J0UA 4UAYA 5DB9A 5HRBA 5J2CA 8ICLA 9ICKA 4XJEA 9ICIA 3NYBA 2GWSA 3AU6A 5F2VO 3V72A 3RH4A 5DDMA 4I2JA 8ICZA 1NO5A 2BCVA 3ERCC 4RQ3A 4OAHA 5CHGA 5DB6A 5J0TA 4NM1A 5CHEA 9ICBA 4K98A 2P66A 3ISDA 4YN4A 4IQTA 4JLXA 4WC6A 4PHEA 1ZQYA 2W9MA 4RT3A 2FMPA 5DECA 4XA5A 3OVAA 2PFNA 4E8FA 1ZQEA 5CFSA 4XQ8A 5BOMA 3K7DA 4QZFA 3RJHA 7ICKA 2ZH7A 4K99A 4MFFA 2BCUA 4X4SA 3RJFA 4LEZA 2BBJA 5J2FA 4X0AA 3HX0A 5J2AA 4E7XA 4LVSA 9ICTA 5HC9A 4EBKA 4KLUA 9ICFA 4LT6A 4O67A 4K9BA 4RQ8A 4GXIA 9ICOA 1ZQUA 3HW8A 4MF2A 4M5DA 4UD4A 5J0SA 4RQ1A 4I2IA 1HUOA 1MIYA 4IQUA 4AT9A 3UQ2A 5CB1A 1ZQPA 1ZQLA 5IINA 8ICFA 4X0BA 3PMLA 4PHAA 4NLNA 5D62A 1GPJA 4UBCA 3ISCA 5J2IA 1BPYA 4NXZA 4AT7A 5CWRA 3OVBA 5J2DA 5DBAA 9ICPA 4F5OA 4O68A 4M04A 4LEVA 2GAFD 7ICTA 4YD1A 5J2GA 9ICLA 2BCQA 2BBHA 2PBEA 5DB7A 4M9JA 2EWRA 5HRDA 3AU2A 4KLOA 3JPTA 3WFSC 4WOYA 4X4OA 4DOAA 3LQCB 4RQ7A 7ICSA 4KLLA 4I2DA 7ICVA 2DR8A 4NY8A 4UB3A 3UPQA 1HUZA 2B51A 7ICMA 1BPEA 4EBJA 4WCWA 3V7LA 5J0XA 4RPXA 5BOLA 5J2KA 1JAJA 1Q79A 2IUBA 4WC4A 4NLKA 7ICJA 4MFCA 4QZ8A 4KLFA 3RJGA 7ICQA 5CR0A 4I2BA 3JZ0A 7ICOA 4YMMA 1RPLA 5J29A 1ZQNA 4RQ6A 3UXOA 1BPBA 1ZQAA 4TUSA 3UPSA 3AQNA 3UXNA 8ICBA 2ZH9A 3HJ1A 2Q66A 5HHHA 5D49A 1ZQTA 3RJEA 1OU5A 4X4NA 8ICSA 4O69A 3MGIA 2M2WA 4AT8A 4GXJA 4ATBA 3OUYA 4JWMA 5J0RA 4NXWA 3WFPA 4K4IA 4QZBA 4X4QA 4AT9B 4RWOA 7ICGA 3HIYA 4K4GA 4FH3A 4KLTA 2O1PA 7ICLA 3JPPA 4RQ5A 3OWGA 1BPZA 4X4VA 4UB5A 4WC3A 5D61A 5IIJA 4FO1A 4AT7B 2ZH8A 4K8VA 8ICNA 4NKTA 1ZQMA 2BE3A 4JLZA 1ZQFA 4WBZA 1TFWA 4KLHA 4YMNA 5DEDA 5J0PA 3ER9B 4XUSA 3OV7A 4UB4A 4R66A 4I28A 3AUOA 1PX5A 1ZQIA 4RT2A 4UAWA 4QZGA 4K9AA 4PHPA 3PMNA 3H3AA 4IQVA 4XRHA 7ICNA 9ICSA 4KB6A 2B4VA 2BCSA 1XSLA 4UBBA 3MDAA 5IIOA 5HR9A 5DKWA 4X5VA 3L9DA 3C2MA 4X4UA 1ZQDA 4X4PA 4K96A 1ZQBA 3JPSA 5DBCA 4RWPA 3K75D 2ZH3A 4FH5A 5TZVA 3C2KA 1BPXA 2ZH1A 2PFQA 4KLSA 9ICUA 3UQ0A 5CA7A 2O5AA 4FHXA 1ZQRA 3EF2A 4NXXA 1KEJA 1ZJMA 3HJ4A 4WQLA 3TFRA 8ICVA 5J0QA 9ICVA 4DO9A 4P4MA 4MFAA 4NXUA 2B56A 2HHPA 5B3PA 4KLQA 4Z6EA 4AT8B 4ATBB 3OUYB 1ZQKA 8ICEA 1ZQZA 2NRKA 4I2AA 4F5PA 9ICJA 2PFPA 1MQ2A 3UXPA 5HRFA 3AQLA 8ICAA 3H37A 3PHZA 1VFGA 2M2TA 2HN2A 4KLGA 4I27A 4YCXA 5B3QA 4LEWA 4K4HA 1ZQCA 5J2BA 8ICWA 7ICIA 1UETA 4YD2A 1WOTA 4KM5A 4M0AA 8ICRA 2IHOA 4NXVA 4I29A 3B0YA 3MBYA 3WFOA 4I2FA 7ICEA 1MQ3A 4WC5A 4EEDA 4F5QA 4K97A 5DBBA 8ICYA 4TUPA 5J2JA 4I0UA 4WBYA 5DB8A 7ICUA 5D46A 4KLIA 3JPNA 2BPGA 8ICMA 8ICIA 7ICPA 8ICUA 1KNYA 1TVAA 8ICKA 5HRKA 4LEYA 3MCRA 3MDCA 4PHDA 4F5NA 4O5KA 4KLJA 4QZIA 4FO6A 1JQRA 8ICGA 4O5CA 2DR5A 5DDYA 4X4TA 4NLZA 3C18A 3ER8C 4MKPA 4OAGA 2M2UA 8ICJA 3TFSA 2BCRA 3V7JA 8ICQA 9ICEA 4FHYA 3MGHA 4PH5A 4I2CA 4S3NA 4DOCA 4RQ0A 4P4PA 9ICWA 2ISOA 4PPXA 4OAIZ 3HWTA 9ICGA 4P4OA 4WC1A 4RPZA 4NM2A 4UD5A 4M9LA 4FHPA 4PGQA 2DVIA 4HX0A 4OAFA 8ICCA 4WC0A 1ZQXA 3JPOA 3C5GA 5J0OA 4MF8A 3OVSA 3B0XA 4EV6A 5JTGA 8ICPA 2ZH2A 4QZDA 3H39A 3NVOA 2IHMA 1JN3A 4Z6DA 4Z6CA 4KLEA 4FHVA 3RH5A 3AQKA 5HRIA 3PNCA 3OGUA 8ICXA 3H38A 4O9MA 4QZHA 2BPFA 4O5EA 2DR7A 1UEUA 2GA9D 1VJ7A 5EOZA 5D4BA 1V4AA 1R8BA 4RWQA 3JCFA 1NOMA 4I2GA 5IILA 9ICNA 1ZQGA 4M9GA 2M2VA 4GXKA 4E80A 4QZ9A 4WH5A 4R63A 2ZH6A 4M47A 3C5FA 1XSNA 9ICQA 1R8AA
chains in the Genus database with same CATH topology
4K8VA 4LEYA 4O69A 5D61A 4NXUA 3MCRA 2B56A 5CHEA 4O67A 4JLZA 4KM5A 4O6AA 4K98A 4OAIZ 4O68A 2IHOA 4NXVA 5B3PA 5D63A 4JLXA 4LEVA 4K9BA 2GAFD 5CFTA 4NXWA 2FCLA 3NKUA 4N7RA 4K96A 4WQKA 3ER9B 2GA9D 5CFSA 2EWRA 4HX0A 4NXTA 4K97A 4MKPA 4OAFA 4OAGA 3ER8C 4XJEA 3K7DA 5CFUA 4K9AA 4WOYA 3OWGA 4K99A 3PHZA 3EF2A 4LEZA 4NXXA 1GPJA 5D62A 4WH5A 4KB6A 2B4VA 4WQLA 3ERCC 2B51A 5B3QA 4OAHA 4LEWA 4FO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFT A;  5CFS A;  2EWR A;  2FCL A;  4HX0 A;  4WH5 A;  4XJE A;  4WQK A;  4WQL A;  5CFU A;  4FO1 A; 
#chains in the Genus database with same CATH topology
 4WC2 A;  4PGY A;  3C2L A;  4IG8 A;  3ISB A;  8ICH A;  1ZQH A;  1F5A A;  5J0Y A;  1TV9 A;  3WFR E;  7ICF A;  2FCL A;  3JPR A;  5HRL A;  4JWN A;  1BPD A;  4N7R A;  1MIW A;  4KLD A;  4M9N A;  3NWI A;  3C66 A;  1MIV A;  4R64 A;  4P2H A;  5J2E A;  4M2Y A;  5CFU A;  5J2H A;  7ICH A;  9ICA A;  5HRH A;  1ZQO A;  2I9G A;  4RWN A;  5IIM A;  4QZE A;  4LZG A;  4TUQ A;  5BPC A;  5CP2 A;  1XSP A;  2ID1 A;  3AQM A;  7ICR A;  1ZQV A;  1ZQJ A;  2DR9 A;  5HHI A;  4UB1 A;  5HRE A;  9ICH A;  4UAZ A;  3V7K A;  1ZJN A;  3GDX A;  1RZT A;  2DRA A;  5J0W A;  4XQ7 A;  4RPY A;  5III A;  9ICC A;  3RJJ A;  4UB2 A;  3RJK A;  4EEB A;  1YLQ A;  8ICT A;  4O6A A;  2ISP A;  4M9H A;  4IQW A;  2DRB A;  4LZD A;  5D63 A;  1UEV A;  8ICO A;  4YMO A;  5CFT A;  4PGX A;  4NKU A;  4QZA A;  2PXI A;  4DOB A;  2HN1 A;  1R89 A;  3LK9 A;  3JPQ A;  4NXT A;  4FHW A;  4Z6F A;  1ZQQ A;  4KLM A;  4I2E A;  3RJI A;  5HRG A;  4R65 A;  5CJ7 A;  4WC7 A;  4EP7 A;  1Q78 A;  2FMQ A;  2RFF A;  4EGW A;  3WFQ E;  3CK6 A;  4X4R A;  3JYY A;  1TFY A;  2ZH5 A;  9ICM A;  2ZHB A;  4RQ2 A;  1FA0 A;  4F5R A;  1ZQS A;  5IIK A;  9ICR A;  2ZH4 A;  2VAN A;  1KDH A;  3NKU A;  4I2H A;  9ICX A;  4RQ4 A;  2FMS A;  1R8C A;  4WQK A;  1JMS A;  4TUR A;  3RH6 A;  2BPC A;  2PFO A;  4QZC A;  2ZHA A;  1ZQW A;  5J0U A;  4UAY A;  5DB9 A;  5HRB A;  5J2C A;  8ICL A;  9ICK A;  4XJE A;  9ICI A;  3NYB A;  2GWS A;  3AU6 A;  5F2V O;  3V72 A;  3RH4 A;  5DDM A;  4I2J A;  8ICZ A;  1NO5 A;  2BCV A;  3ERC C;  4RQ3 A;  4OAH A;  5CHG A;  5DB6 A;  5J0T A;  4NM1 A;  5CHE A;  9ICB A;  4K98 A;  2P66 A;  3ISD A;  4YN4 A;  4IQT A;  4JLX A;  4WC6 A;  4PHE A;  1ZQY A;  2W9M A;  4RT3 A;  2FMP A;  5DEC A;  4XA5 A;  3OVA A;  2PFN A;  4E8F A;  1ZQE A;  5CFS A;  4XQ8 A;  5BOM A;  3K7D A;  4QZF A;  3RJH A;  7ICK A;  2ZH7 A;  4K99 A;  4MFF A;  2BCU A;  4X4S A;  3RJF A;  4LEZ A;  2BBJ A;  5J2F A;  4X0A A;  3HX0 A;  5J2A A;  4E7X A;  4LVS A;  9ICT A;  5HC9 A;  4EBK A;  4KLU A;  9ICF A;  4LT6 A;  4O67 A;  4K9B A;  4RQ8 A;  4GXI A;  9ICO A;  1ZQU A;  3HW8 A;  4MF2 A;  4M5D A;  4UD4 A;  5J0S A;  4RQ1 A;  4I2I A;  1HUO A;  1MIY A;  4IQU A;  4AT9 A;  3UQ2 A;  5CB1 A;  1ZQP A;  1ZQL A;  5IIN A;  8ICF A;  4X0B A;  3PML A;  4PHA A;  4NLN A;  5D62 A;  1GPJ A;  4UBC A;  3ISC A;  5J2I A;  1BPY A;  4NXZ A;  4AT7 A;  5CWR A;  3OVB A;  5J2D A;  5DBA A;  9ICP A;  4F5O A;  4O68 A;  4M04 A;  4LEV A;  2GAF D;  7ICT A;  4YD1 A;  5J2G A;  9ICL A;  2BCQ A;  2BBH A;  2PBE A;  5DB7 A;  4M9J A;  2EWR A;  5HRD A;  3AU2 A;  4KLO A;  3JPT A;  3WFS C;  4WOY A;  4X4O A;  4DOA A;  3LQC B;  4RQ7 A;  7ICS A;  4KLL A;  4I2D A;  7ICV A;  2DR8 A;  4NY8 A;  4UB3 A;  3UPQ A;  1HUZ A;  2B51 A;  7ICM A;  1BPE A;  4EBJ A;  4WCW A;  3V7L A;  5J0X A;  4RPX A;  5BOL A;  5J2K A;  1JAJ A;  1Q79 A;  2IUB A;  4WC4 A;  4NLK A;  7ICJ A;  4MFC A;  4QZ8 A;  4KLF A;  3RJG A;  7ICQ A;  5CR0 A;  4I2B A;  3JZ0 A;  7ICO A;  4YMM A;  1RPL A;  5J29 A;  1ZQN A;  4RQ6 A;  3UXO A;  1BPB A;  1ZQA A;  4TUS A;  3UPS A;  3AQN A;  3UXN A;  8ICB A;  2ZH9 A;  3HJ1 A;  2Q66 A;  5HHH A;  5D49 A;  1ZQT A;  3RJE A;  1OU5 A;  4X4N A;  8ICS A;  4O69 A;  3MGI A;  2M2W A;  4AT8 A;  4GXJ A;  4ATB A;  3OUY A;  4JWM A;  5J0R A;  4NXW A;  3WFP A;  4K4I A;  4QZB A;  4X4Q A;  4AT9 B;  4RWO A;  7ICG A;  3HIY A;  4K4G A;  4FH3 A;  4KLT A;  2O1P A;  7ICL A;  3JPP A;  4RQ5 A;  3OWG A;  1BPZ A;  4X4V A;  4UB5 A;  4WC3 A;  5D61 A;  5IIJ A;  4FO1 A;  4AT7 B;  2ZH8 A;  4K8V A;  8ICN A;  4NKT A;  1ZQM A;  2BE3 A;  4JLZ A;  1ZQF A;  4WBZ A;  1TFW A;  4KLH A;  4YMN A;  5DED A;  5J0P A;  3ER9 B;  4XUS A;  3OV7 A;  4UB4 A;  4R66 A;  4I28 A;  3AUO A;  1PX5 A;  1ZQI A;  4RT2 A;  4UAW A;  4QZG A;  4K9A A;  4PHP A;  3PMN A;  3H3A A;  4IQV A;  4XRH A;  7ICN A;  9ICS A;  4KB6 A;  2B4V A;  2BCS A;  1XSL A;  4UBB A;  3MDA A;  5IIO A;  5HR9 A;  5DKW A;  4X5V A;  3L9D A;  3C2M A;  4X4U A;  1ZQD A;  4X4P A;  4K96 A;  1ZQB A;  3JPS A;  5DBC A;  4RWP A;  3K75 D;  2ZH3 A;  4FH5 A;  5TZV A;  3C2K A;  1BPX A;  2ZH1 A;  2PFQ A;  4KLS A;  9ICU A;  3UQ0 A;  5CA7 A;  2O5A A;  4FHX A;  1ZQR A;  3EF2 A;  4NXX A;  1KEJ A;  1ZJM A;  3HJ4 A;  4WQL A;  3TFR A;  8ICV A;  5J0Q A;  9ICV A;  4DO9 A;  4P4M A;  4MFA A;  4NXU A;  2B56 A;  2HHP A;  5B3P A;  4KLQ A;  4Z6E A;  4AT8 B;  4ATB B;  3OUY B;  1ZQK A;  8ICE A;  1ZQZ A;  2NRK A;  4I2A A;  4F5P A;  9ICJ A;  2PFP A;  1MQ2 A;  3UXP A;  5HRF A;  3AQL A;  8ICA A;  3H37 A;  3PHZ A;  1VFG A;  2M2T A;  2HN2 A;  4KLG A;  4I27 A;  4YCX A;  5B3Q A;  4LEW A;  4K4H A;  1ZQC A;  5J2B A;  8ICW A;  7ICI A;  1UET A;  4YD2 A;  1WOT A;  4KM5 A;  4M0A A;  8ICR A;  2IHO A;  4NXV A;  4I29 A;  3B0Y A;  3MBY A;  3WFO A;  4I2F A;  7ICE A;  1MQ3 A;  4WC5 A;  4EED A;  4F5Q A;  4K97 A;  5DBB A;  8ICY A;  4TUP A;  5J2J A;  4I0U A;  4WBY A;  5DB8 A;  7ICU A;  5D46 A;  4KLI A;  3JPN A;  2BPG A;  8ICM A;  8ICI A;  7ICP A;  8ICU A;  1KNY A;  1TVA A;  8ICK A;  5HRK A;  4LEY A;  3MCR A;  3MDC A;  4PHD A;  4F5N A;  4O5K A;  4KLJ A;  4QZI A;  4FO6 A;  1JQR A;  8ICG A;  4O5C A;  2DR5 A;  5DDY A;  4X4T A;  4NLZ A;  3C18 A;  3ER8 C;  4MKP A;  4OAG A;  2M2U A;  8ICJ A;  3TFS A;  2BCR A;  3V7J A;  8ICQ A;  9ICE A;  4FHY A;  3MGH A;  4PH5 A;  4I2C A;  4S3N A;  4DOC A;  4RQ0 A;  4P4P A;  9ICW A;  2ISO A;  4PPX A;  4OAI Z;  3HWT A;  9ICG A;  4P4O A;  4WC1 A;  4RPZ A;  4NM2 A;  4UD5 A;  4M9L A;  4FHP A;  4PGQ A;  2DVI A;  4HX0 A;  4OAF A;  8ICC A;  4WC0 A;  1ZQX A;  3JPO A;  3C5G A;  5J0O A;  4MF8 A;  3OVS A;  3B0X A;  4EV6 A;  5JTG A;  8ICP A;  2ZH2 A;  4QZD A;  3H39 A;  3NVO A;  2IHM A;  1JN3 A;  4Z6D A;  4Z6C A;  4KLE A;  4FHV A;  3RH5 A;  3AQK A;  5HRI A;  3PNC A;  3OGU A;  8ICX A;  3H38 A;  4O9M A;  4QZH A;  2BPF A;  4O5E A;  2DR7 A;  1UEU A;  2GA9 D;  1VJ7 A;  5EOZ A;  5D4B A;  1V4A A;  1R8B A;  4RWQ A;  3JCF A;  1NOM A;  4I2G A;  5IIL A;  9ICN A;  1ZQG A;  4M9G A;  2M2V A;  4GXK A;  4E80 A;  4QZ9 A;  4WH5 A;  4R63 A;  2ZH6 A;  4M47 A;  3C5F A;  1XSN A;  9ICQ A;  1R8A A; 
#chains in the Genus database with same CATH homology
 4K8V A;  4LEY A;  4O69 A;  5D61 A;  4NXU A;  3MCR A;  2B56 A;  5CHE A;  4O67 A;  4JLZ A;  4KM5 A;  4O6A A;  4K98 A;  4OAI Z;  4O68 A;  2IHO A;  4NXV A;  5B3P A;  5D63 A;  4JLX A;  4LEV A;  4K9B A;  2GAF D;  5CFT A;  4NXW A;  2FCL A;  3NKU A;  4N7R A;  4K96 A;  4WQK A;  3ER9 B;  2GA9 D;  5CFS A;  2EWR A;  4HX0 A;  4NXT A;  4K97 A;  4MKP A;  4OAF A;  4OAG A;  3ER8 C;  4XJE A;  3K7D A;  5CFU A;  4K9A A;  4WOY A;  3OWG A;  4K99 A;  3PHZ A;  3EF2 A;  4LEZ A;  4NXX A;  1GPJ A;  5D62 A;  4WH5 A;  4KB6 A;  2B4V A;  4WQL A;  3ERC C;  2B51 A;  5B3Q A;  4OAH A;  4LEW A;  4FO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...