4GXKA

R283k dna polymerase beta ternary complex with a templating 8og and incoming datp analog
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
326
structure length
316
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DNA polymerase minor groove interactions modulate mutagenic bypass of a templating 8-oxoguanine lesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 112
structure length 316
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4gxkA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4gxkA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4gxkA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4gxkA03
2ZTCA 5DGBA 4CCHA 4WC3A 5KG1A 4EYHB 3UXPA 1XSLA 4AT8B 2Q66A 3TI0A 5CWRA 3C5FA 3C1YA 2XGPA 2I1QA 4K4GA 3HW8A 2IHNA 4J9MA 1BPDA 4PHPA 4QZBA 2UVRA 4FBUA 3N4MB 5DB9A 5J2CA 9ICQA 2MUTA 4S3NA 9ICPA 3JPOA 1T4GA 4PHDA 2NRVA 5J0WA 4F50A 1MC8A 5HMLA 2JZBA 8ICKA 4TUQA 4FHXA 3C18A 2HHUA 3ISCA 8ICTA 5DB8A 4AT9B 4ECZA 2P66A 1TAUA 1ZQFA 2BCQA 4I2BA 2FMPA 2P6RA 4LZGA 4I28A 4ELUA 7ICUA 4KLTA 4X0BA 3RAXA 8ICLA 3WFQE 1C7YA 1NK9A 2ZH2A 5KFAA 3UPQA 3OGUA 4DFPA 4I2FA 4JWNA 2ZH7A 3RB4A 2BCSA 4F5QA 4DQIA 2DRAA 2BPGA 4AT8A 3ZD8A 2AQ0A 3MDCA 4F2RA 7ICEA 3PW0A 4WC4A 4MEYA 9ICWA 3Q8KA 4P4MA 1ZQPA 1OU5A 2ZUBA 4IQTA 5J0OA 5KG5A 2DPIA 1COOA 2F1JA 2W8KA 4WC1A 1HUOA 1BPZA 3PX6A 4B9LA 2DR9A 1FA0A 4ED3A 4KLGA 5IINA 1S77D 9ICGA 4M04A 5KFZA 5DBCA 1WCNA 2ASDA 5HRFA 2ZHAA 1A77A 2BCRA 1A76A 5KFKA 2FMSA 4B9UA 3HJ4A 3JPSA 1DGSA 4I2HA 1UETA 5DG8A 2NRTA 4I2CA 1DK3A 2UVWA 2JEJA 2BQUA 1KEJA 5F9LA 3WFPA 5KG7A 4UB2A 2BR0A 2A1JA 1BPXA 5BOLA 2AU0A 1NZPA 4MFFA 1WOTA 2VA8A 4IQUA 2V4RA 4IR9A 1JIHA 1TV9A 4M9GA 5KFBA 2NRWA 4R8UA 4J9LA 5HRHA 1R8CA 4KLIA 5HREA 5D49A 4RNMA 4KLHA 1KFSA 3RH4A 8ICZA 4X4OA 4E7XA 3EW9A 5D4BA 5DBAA 2HHXA 3HIYA 5DB6A 4EBKA 3AQMA 3NYBA 3PMNA 5HNKA 2V4QA 4RQ2A 8ICHA 4J9SA 8ICMA 4WBYA 3OHBA 2BGWA 4DFMA 2XCAA 5C5JA 4MF2A 1CEZA 4UBCA 5CB1A 3UQ2A 1L3VA 4B9VA 2BPCA 3PMLA 5HRGA 2BHNA 1S0NA 1ZQOA 3V7KA 1MIWA 3ZD9A 3FDSA 3RJEA 1R89A 3GQCA 5IIOA 1S97A 4PH5A 4PGYA 1XWLA 3JPNA 5KFNA 4UB5A 5J2IA 3PR5B 1TK0A 4F4WA 1N56A 4O3NA 3SYZA 3G6XA 5KG0A 5CJ7A 3OJUA 2A1JB 2W8LA 1LV5A 3PO4A 2FLLA 4JV2A 3FYHA 4Z6FA 1Q78A 4PHAA 1BPEA 5IILA 7ICKA 4I27A 1Q79A 4R8UB 3BQ0A 1NK5A 3KHLA 2ISOA 4MFCA 4LT6A 3EPIA 2ID1A 2JZBB 4FS1A 4QZ9A 4RQ0A 2FMQA 4XQ7A 4X4VA 4RQ8A 3MGIA 3KTQA 1S0VA 3LQCB 5J0SA 1NK4A 4UAYA 3LWLA 2W9BB 4F5PA 9ICAA 9ICJA 4O3PA 4RNNA 4GXKA 4GLXA 5J0TA 3KHGA 5IIIA 5EOZA 4KN4A 3MGHA 1H38A 4ECSA 1U48A 4O3QA 2ALZA 1NK0A 4I2GA 4YR2A 2C22A 4EP7A 3OV7A 4FHPA 2W9CA 1QSLA 5KT4A 4LZDA 2VANA 5KT5A 9ICTA 1U4BA 4ZH4A 1QLNA 9ICSA 4KLDA 4BXOA 4QZCA 3Q8QB 5BPCA 2MAXA 4FHVA 4X4PA 3OUYA 4RWOA 4MF8A 2ZH6A 8ICIA 3MABA 5KG3A 5KFOA 1D8LA 1BVSA 4IRCA 3OVBA 7ICLA 1ZQRA 1RPLA 3BQ1A 2DR5A 4RUAA 4BWJA 3IHQB 4PGXA 4ECYA 4DQRA 1XSNA 1ZQBA 2FLNA 2DR8A 2RDIA 1MQ2A 2ZH8A 4ED6A 1ZQVA 5DDMA 4YD2A 2R8IA 4DS4A 2RFFA 4RWPA 7ICHA 7ICNA 5EWGA 4ECTA 1ZYQA 3ZDDA 4DQPA 7ICRA 3H8SA 4EZ6A 4IRDA 4QZ8A 4F5NA 5DG7A 4O5CA 1RXVA 8ICJA 3ORYA 1NKEA 4ECUA 4RT2A 4Z6EA 4RQ4A 3NGDA 3Q8LA 1NJYA 4TQRA 2PXIA 2HHVA 4B9TA 2M2WA 4YXMA 3RBDA 3GIIA 1RYRA 9ICOA 4KMUA 4I2IA 2KP7A 1L3TA 3N97B 3IM1A 1TK5A 4QZFA 4EBDA 3BDPA 2DR7A 2PI4A 5KFMA 1UA1A 2ISPA 1X9WA 3H8WA 1D9DA 3BQTA 2PFPA 4QWBA 2ZH1A 4F4XA 4YMOA 4DL6A 3TARA 4DOAA 4DOCA 4ECWA 2P6UA 2DPJA 1WCLA 3C2MA 9ICIA 2W9BA 1EXNA 4J9NA 4DL5A 4WC0A 5J0UA 4X5VA 2FPKA 4O3OA 1ZQWA 3HT3A 4P2HA 4JUZA 2HHPA 4TQSA 4DSKA 1L3UA 4GXIA 4DLGA 1MIVA 4WC2A 4YP3A 4ECXA 2KZMA 3H37A 4ED7A 3PV8A 5DLGA 1NK8A 1NKBA 4O9MA 1U49A 4XQ8A 3AQNA 4NKTA 2FPLA 4ATBA 3M8SA 3QZ7A 4DL2A 5KFIA 1ZQMA 4JK1A 4FBTA 4ECRA 1D8YA 2BKEA 5KT7A 5KFTA 4UD5A 2HVIA 2PFOA 3H40A 1KRPA 5EWFA 3C23A 3EYZA 4DSFA 4E80A 3GV7B 1ZQLA 1KDHA 4RQ6A 2BCUA 4DFKA 2AJQA 8ICFA 4YQWA 4DF4A 1S76D 3RJJA 4GXJA 3OVAA 5J2AA 4M47A 1SKSA 4BDPA 4UAZA 2BPFA 2ZH3A 7ICOA 3PX0A 3C21A 4B9MA 1Z3EB 4ED2A 3QE9Y 2JEGA 3OSNA 1ZQYA 3RR7A 5KG2A 1TKDA 1ZQAA 4PPXA 1BNOA 2PBEA 4F91B 4R64A 5L1LA 4EYIB 2ZHBA 3JPRA 4AT9A 4IQVA 4YCXA 5CP2A 1IXRA 5CHGA 8ICQA 1XO1A 2XY5A 2FLPA 2J6UA 2BE3A 4XUSA 5KFFA 3WFSC 4YN4A 3PVXA 4RQ5A 2PI5A 2ZTEA 3JYYA 5DBBA 1ZQTA 4Q8EA 3SV4A 5KFVA 4KLLA 4DO9A 1SL1A 5KFYA 3Q8RB 4YXJA 1X2IA 5KFWA 3V72A 1S10A 4LVSA 9ICKA 4KLOA 1AROP 1MIYA 4FH5A 4DS5A 1TFWA 3EWAA 1ZQGA 4QWCA 4DSJA 4F3OA 4YMNA 5KFEA 2AGOA 2ZJ8A 2BQ3A 2MUTB 1VFGA 1L3SA 2ZH9A 2IBKA 4O5EA 2H5XA 4RZRA 4I29A 2ZH5A 2LYHA 3H8JA 5KG4A 4E8FA 2IA6A 5HRDA 4KN7A 3H4DA 4FS2A 3OJSA 7ICTA 4KLEA 1U47A 4RQ1A 4UAWA 2XGQA 1KFDA 2XY7A 4DOBA 2Y1IA 4UQGA 5DGAA 7ICJA 5KFLA 1B43A 8ICYA 8ICPA 5HR9A 4WCWA 4IG8A 1TAQA 3GV5B 1XC9A 1SL0A 4E0DA 4KLFA 2RDJA 5DB7A 2I9GA 9ICVA 3H3AA 1ZQSA 3EPGA 4YR3A 3TAQA 3EZ5A 4YFKA 5DDYA 3JPTA 2ZTDA 2J6SA 5KFQA 5J0RA 2HVHA 1PX5A 3ISBA 3TAPA 1LB2B 3OHAA 4J9PA 5JUMA 3T5LA 5DG9A 2M2TA 3OVSA 1ZQZA 5KFCA 9ICFA 2V9WA 9ICBA 5IIKA 4JV1A 4M5DA 4QZAA 3BQ2A 2W9MA 4M6WB 5KFXA 4PGQA 2UVVA 4C8OA 1JMSA 3PO5A 3PX4A 1DK2A 1TFRA 3MBYA 4DL4A 5J0PA 1ZQKA 3RJKA 4IR1A 3M9MB 4M9JA 3RB3A 3E2EA 3H4BA 4YR0A 3B0XA 1S9FA 4JWMA 4BXOB 2XCPA 4WC6A 4F92B 4IQWA 3QEBZ 7ICGA 4O5KA 3H38A 1NJZA 5KFSA 3GIJA 2F1HA 3MR3A 2BDPA 1XSPA 1QSSA 2DRBA 3GDXA 1SL2A 4F8RA 4F4YA 1ZQNA 3BJYA 3V6HA 4ELVA 5J2BA 2UVUA 5KFUA 5J2HA 2C2EA 2VA2A 2XY6A 1DOQA 3PW4A 5HMMA 4Z6CA 4EBEA 1S0OA 1BNPA 4NXZA 4F2SA 5HRIA 5HHHA 9ICEA 4O3SA 3H39A 5KT2A 4R66A 3RAQA 2XC9A 3C2LA 4R65A 5KFHA 4DWIA 9ICRA 8ICWA 5J2GA 4I2DA 3HX0A 2KZZA 3KHRA 4J9RA 3SZ2A 2O5AA 5DQIA 3H7IA 1XU4A 4MFAA 1HUZA 1QTMA 3JPPA 4RPXA 1IM4A 4ATBB 1UEUA 4TUSA 1CUKA 4F93B 7ICPA 1BGXT 4UB3A 3C66A 4WBZA 5HHIA 4RNOA 3GIMA 4WC7A 1QSYA 3TFRA 4XRHA 4FO6A 4I2AA 5DQHA 4G3IA 4EZ9A 3L9DA 2OWOA 2ZJ5A 4M0AA 1NOMA 4JV0A 5KG6A 3ETLA 2WTFA 4M9LA 3AU2A 4YD1A 4XA5A 1TK8A 4C8KA 5KT6A 4RU9A 1V9PA 2VA3A 4DL3A 4MEXA 3ZDAA 4YG2A 5TZVA 4RPYA 5L1KA 4DF8A 4J9QA 4UD4A 3RTVA 4X4RA 4YVZA 8ICOA 4AT7A 4KLMA 4UBBA 4K4IA 3KHHA 2HHSA 8ICUA 4X4TA 2ASLA 2C2RA 4C8LA 9ICXA 1JXLA 4RPZA 2HHWA 2M2UA 5IIMA 2KTQA 3PNCA 4DL7A 1JQRA 2M2VA 5L1JA 3Q8MA 1ZQDA 2PFQA 3WFRE 2KFZA 2XO7A 3HWTA 2AQ4A 4DEZA 3JPQA 4GC6A 1N48A 1D9FA 5F2VO 1TFYA 2C28A 3MR6A 2ZUCA 3K4GA 3RR8A 1JX4A 1RYSA 3TFSA 4DSLA 4TUPA 4ED1A 4O0IA 3Q8PB 3M9OB 2Y1JA 4B9SA 4QWAA 4K4HA 1Z00A 1SKRA 4C8NA 2W9CB 4PHEA 3RBEA 9ICNA 3MDAA 2B21A 3HP6A 5J0XA 3V7JA 4DLEA 3OUYB 2ATLA 3RRHA 1BPBA 3MFHA 4IRKA 5HRBA 4DFJA 2HHQA 1MQ3A 5HRLA 5L1IA 4FH3A 5KFGA 2BQRA 4KLQA 1JN3A 2HW3A 1K1SA 3T3FA 3K75D 1ZQHA 1ZQCA 8ICAA 1KTQA 4RT3A 3QZ8A 1TVAA 8ICEA 4I2EA 4QWEA 7ICQA 4KLUA 5J29A 3JZ0A 3WFOA 5J2DA 4RWQA 5DEDA 3C2KA 1NK6A 1U9LA 1Z00B 3GFKB 3OSPA 4O3RA 4QZDA 1RXWA 4NY8A 8ICGA 8ICSA 1KFTA 4J9KA 1SKWA 2KFNA 1ZJNA 2O1PA 4QZIA 4F4ZA 3THVA 8ICCA 3AU6A 3TQ1A 1VJ7A 7ICSA 3QEAZ 4KLJA 1UEVA 1V4AA 4C8MA 2M9NA 4X0AA 5IIJA 2JEFA 3SI8A 3RB6A 2ASJA 1L5UA 3PY8A 3HJ1A 3C5GA 3T5HA 7ICIA 1PZNA 4QZHA 4M9NA 3GV8B 3HPOA 2DFLA 4DQSA 4DSEA 4ED0A 4TURA 1NK7A 3TANA 1KLNA 1R8AA 1T8EA 1NJWA 5J0YA 3V6JA 1UT8A 1KSPA 2R8KA 2R8GA 5KFJA 3MR5A 1RZTA 1NKCA 2GWSA 3RJFA 2DVIA 4QWDA 4AT7B 2ZUDA 2KN7A 4KITB 3UQ0A 4ECVA 4FHWA 5DKWA 1ZQQA 3ZDBA 3AQKA 4NKUA 1S0MA 2W9AA 5CR0A 4Q44A 4UB4A 4M9HA 1T3NA 5DQGA 4NLNA 8ICNA 5DLFA 3RB0A 3G6VA 4X4QA 3M9NB 4KLSA 3SV3A 2NRXA 3LDAA 1NO5A 8ICXA 4UB1A 2C2DA 1ZQIA 9ICMA 7ICVA 3MR2A 5CA7A 3GIKA 4NM2A 1ZQJA 3RJHA 3AQLA 2ZH4A 4Q43A 3V7LA 3LK9A 9ICLA 1ZJMA 9ICHA 5HP4A 4QW8A 5KFPA 2NRKA 3ZDCA 5HRKA 3UXOA 5KFDA 3RJIA 3PW2A 4KTQA 4B9NA 1Y88A 2NRZA 2FPMA 3Q8SB 4RUCA 2AGPA 2BCVA 2PFNA 3RJGA 3T5KA 2J6TA 5DECA 1ZQXA 2IHMA 4GC7A 5F9NA 5J2JA 4R63A 4X4UA 1HJPA 4YMMA 3MFIA 3C1ZA 4NM1A 7ICFA 1JAJA 3UXNA 4BWMA 3ZDEA 4Q8FA 1R8BA 2AGQA 8ICRA 4ECQA 2ZJAA 5KT3A 4F4KA 3UPSA 3RH5A 5KFRA 5J0QA 9ICUA 5EWEA 3M8RA 2JEIA 4P4OA 3PW5A 4WC5A 4BGDA 4X4SA 1UA0A 5KTQA 1BPYA 4RQ3A 4QZEA 1F5AA 3GILA 3NTUA 5BOMA 4ED8A 4EEYA 3PW7A 1U45A 4M2YA 4J9OA 4F5RA 1ZQEA 5J2FA 4EBCA 3V6KA 1XS9D 4NLZA 8ICBA 8ICVA 1K1QA 4X4NA 4FHYA 1X9SA 4M6WA 5L9XA 3G6YA 4ELTA 3LWMA 1B22A 4RQ7A 4NLGA 4F5OA 1KNYA 3RH6A 4DSIA 2IMWP 1YLQA 4EBJA 2KZ3A 3PR4A 2HHTA 4I2JA 1UT5A 5D46A 2R8JA 2Q0ZX 7ICMA 1MSWD 1NJXA 5J2KA 3ISDA 3T5JA 3AUOA 4RWNA 5J2EA 4P4PA 5HC9A 2F1IA 1ZQUA 3B0YA 4Z6DA 4HYKA 4QZGA 1X9MA 1T7PA 9ICCA 2R8HA 3RRGA 4NLKA 1JXEA 4QW9A 4DQQA 4Q45A 1SZPA 1ZETA
chains in the Genus database with same CATH superfamily
2WF9A 2DQNB 1XSLA 2Q66A 4Y2XA 5CWRA 3C5FA 3MGVA 4PHPA 2LM1A 9ICQA 2MUTA 5ALFA 1T4GA 1SWVA 2CRXA 3C18A 4AT9B 2LHTA 2BCQA 2FMPA 2P6RA 4I28A 2D6FC 3WFQE 2ZH2A 5KFAA 2KOBA 5AIAA 2YMLA 3B9JA 4OJ6A 4F2RA 3KOOA 4WC4A 1OU5A 5J0OA 4CDGA 5T14A 2EAOA 3VCBA 2OEHA 5HR7A 5EE9A 5DBCA 5HRFA 2FMSA 1N60A 1WWUA 4C7ZA 5ALPA 2JEJA 5F9LA 3FM9A 2BR0A 3WK8A 2V4RA 1N2XA 1JIHA 4KLIA 5HREA 1ZXIA 4MHVA 3RH4A 8ICZA 4E7XA 3EW9A 3HIYA 3NYBA 3QUQA 3M6ZA 4FZNA 3PMNA 4RQ2A 2QB0A 3OHBA 1CEZA 3UQ2A 4B9VA 2BPCA 3PMLA 2BZFA 1ZQOA 3ZD9A 3RJEA 1O08A 1R89A 4BJQA 1PVPA 1XWLA 3HILA 4UB5A 1TK0A 2K4IA 5KG0A 5CJ7A 1DXSA 3PO4A 2FLLA 4JV2A 4Z6FA 1Q78A 2R18A 3BQ0A 3KHLA 2ISOA 2EDUA 4XQ7A 2FMQA 4QZ9A 5JTIA 4RQ0A 4X4VA 2YMPA 2F77X 9ICAA 3A0BU 1JALA 3LWLA 4GXKA 2B0CA 4GLXA 5J0TA 3KHGA 5IIIA 5EOZA 1M6YA 4YR2A 9ICTA 4BXOA 4QZCA 4X4PA 3OUYA 1VLBA 1BVSA 4CF4A 2DR5A 5ALIA 4RUAA 1P7DA 4PGXA 4ECYA 3NWIA 2HN2A 1L7NA 3GZFA 2GLEA 5HR6A 1ZQVA 5AI6A 2YMQA 2A3VA 7ICHA 5EWGA 1X42A 2AXTU 4IRDA 4QZ8A 5DG7A 8ICJA 1RXVA 2DL0A 3ORYA 4PJ0U 4ECUA 2E8PA 4RT2A 3Q8LA 4TQRA 2M2WA 3RBDA 1RYRA 3ED5A 3IM1A 2WB1F 1TK5A 3BDPA 5KFMA 4NXWA 2ISPA 1ZOLA 4F4XA 3TARA 4DOCA 4ECWA 2DPJA 1FIQA 1WCLA 4J9NA 1EXNA 4IL6U 5J0UA 4X5VA 1ZQWA 4JUZA 4TQSA 2Y0SF 4GXIA 5B3PA 3QYPA 2F76X 5DLGA 1U49A 2JV3A 1ZQMA 4FBTA 1SV0A 2HMXA 3H40A 4E80A 3GV7B 1KDHA 2BCUA 2AJQA 8ICFA 1S76D 2GOLA 5CFSA 5J2AA 4JLXA 7ICOA 4LJXA 3IP4B 2BDUA 2JEGA 3OSNA 4CNQA 1QQ7A 2QB0B 2ZG6A 3O0FA 4F91B 5L1LA 1N62A 4YCXA 8ICQA 2ODGA 2FLPA 4XUSA 3JYYA 2KE7A 1ZQTA 3SV4A 4KLLA 4NV0A 1L8OA 5KFYA 9ICKA 1B0XA 3F2DA 4QNLA 1TFWA 2K89A 4DS5A 4YMNA 1L3SA 2ZH9A 2ZH5A 2YB1A 2IA6A 3BQ7A 4WQKA 3OJSA 2XGQA 1KFDA 5ALRA 1K5OA 8ICPA 1XC9A 2QKQA 2K8BB 2I9GA 4NL9A 4YR3A 3JPTA 5J0RA 2HVHA 2KSOA 1LB2B 1PK1B 3T5LA 5JUMA 3F5EA 2M2TA 5KFCA 9ICBA 5IIKA 5A0LA 4PGQA 4C8OA 2JMGA 1DK2A 3MBYA 3RJKA 5J0PA 3E2EA 3M9MB 3RB3A 4YR0A 2KJ5A 3B0XA 4OD0A 4WC6A 4F92B 4IQWA 2B51A 5AKJA 1L7PA 1NJZA 3CNHA 3GIJA 2K4HA 2F1HA 2KKVA 5KFSA 3QU4A 3MR3A 1QSSA 2N1RA 1ZQNA 1SB3C 5KFUA 2VA2A 1DOQA 3PW4A 4NXZA 5HRIA 4FO1A 3H39A 4O3SA 1OW5A 5KT2A 4R65A 2D8CA 5KFHA 4I2DA 3HX0A 2QARA 1FEZA 2QB1A 2DUYA 5DQIA 3H7IA 4MFAA 3JPPA 2YQEA 1CUKA 5HHIA 1UQVA 5KAIU 5DQHA 2RQ5A 4G3IA 2OWOA 2MSNA 2ZJ5A 4M0AA 4JV0A 2WTFA 1TK8A 4RU9A 1V9PA 3ZDAA 4J9QA 2DKZA 3RTVA 2XI9A 2EQYA 3HJEA 2VIXA 2F2AB 4C8LA 5ALNA 4U6PA 2FCLA 5L1JA 2ZXHA 2WF6A 3WFRE 3DEEA 3JPQA 1N48A 1D9FA 4ED1A 4UB8U 4CGZA 3F53A 5AM2A 3RBEA 4C8NA 4QJFB 2B21A 5J0XA 3V7JA 2CXYA 3OUYB 4JMUA 5HRBA 5HRLA 4GFJA 5L1IA 5H2FU 1JN3A 3CK6A 1ZQHA 3T3FA 1ZQCA 8ICEA 4QWEA 1Z00B 3OSPA 8ICSA 1KFTA 1SKWA 2KFNA 4QZIA 3OWGA 8ICCA 4X0AA 5IIJA 3RB6A 3PY8A 1RQLA 4M9NA 4QZHA 2HOIA 2EZXA 2K4PA 4IS7A 5J0YA 2R8KA 1RZTA 2GWSA 1URJA 3SAFA 2ZUDA 3UQ0A 3CP8A 4UB4A 8ICNA 3RB0A 1SGGA 1L6NA 3M9NB 2RLTA 3RJHA 2FDRA 4CE6A 1WWVA 5KFDA 2FPMA 2BCVA 4RUCA 2PFNA 1KBUA 3E58A 5J2JA 4EEDA 4X4UA 2E8NA 4NM1A 3C1ZA 2HBJA 4BWMA 3ZDEA 1R8BA 8ICRA 2XVTA 2ZJAA 1X6IA 3UPSA 2KV2A 4AYBF 5AKGA 3M8RA 2JEIA 4BGDA 4NXXA 4RQ3A 5BOMA 2KJ9A 4M2YA 4J9OA 5G5HA 4C7YA 4EBCA 4X4NA 1X9SA 5L9XA 3LWMA 4EBJA 3PR4A 2W04A 2HHTA 1T3QA 2Q0ZX 2JH7A 3L3FX 5GTHU 4CF5A 3AUOA 4RWNA 2Y9UA 5HC9A 2F1IA 1ZQUA 2IOHA 4NLKA 5D62A 4DQQA 4Q45A 5EE3A 2KICA 1ZETA 5KG1A 3UXPA 1X66A 3KBBA 3WKBA 3TI0A 3NVVA 3C1YA 2I1QA 3HW8A 4J9MA 4QZBA 3WKCA 4KB6A 4S3NA 1X6JA 1D8BA 5AI5A 1YT3A 1MC8A 5HMLA 2JZBA 8ICKA 4O67A 8ICTA 4ECZA 2P66A 1TAUA 3NVYA 4ELUA 3K1ZA 1VJ5A 1SWWA 4Y2QA 8ICLA 1NK9A 4DFPA 3UPQA 2OM6A 3E0FA 5ALOA 1LKYB 5D63A 3WK4A 3I28A 4DQIA 2W3SA 5ALJA 3MDCA 3ERCC 4MEYA 5AKZA 3WK7A 3Q8KA 2DPIA 4IQTA 5CFTA 5KG5A 4WC1A 1COOA 1GO3F 1HUOA 4B9LA 2DR9A 1FA0A 5EE0A 9ICGA 5KFZA 2ZHAA 4B9UA 3HJ4A 5KFKA 3JPSA 4I2HA 2NRTA 4U7CA 5KG7A 2ZIWA 1BPXA 3M1YA 1WOTA 1TV9A 2MU2A 3IRUA 3H8MA 4NWIA 1PVRA 4KLHA 1J2NA 3MC1A 8ICHA 4WBYA 4JB3A 4DFMA 4UBCA 5CB1A 1L3VA 5HRGA 1T94A 2BHNA 2KNJA 2ZIUB 2DKXA 1S97A 2MA1A 4O69A 4O3NA 1ZQ1C 2G08A 2IUBA 3OJUA 3QUTA 2A1JB 3D6JA 1NZBA 2L5YA 4EGWA 3FYHA 2GAFD 3HKZF 4PHAA 4I27A 2LPEA 2BBHA 1NK5A 1JI7A 1PK1A 1NK4A 4UAYA 3MGHA 1FO4A 1U48A 2C22A 4O6AA 4OJ5A 2JGAA 3PSTA 2W9CA 4LZDA 5KT5A 4OJLA 1J2MA 4FHVA 2MAXA 1Z1VA 2DWQA 3MABA 5KG3A 5KFOA 4IRCA 1ZQRA 1ZD2P 3BQ1A 2DR8A 4ICAA 1XSNA 2KJ8A 1MQ2A 2ZH8A 3QU5A 2HCFA 2RHFA 4RWPA 4ECTA 4DQPA 4C80A 7ICRA 4NXUA 4F5NA 5AI4A 1NJYA 4DCCA 4B9TA 5L1MA 4KMUA 4UAUA 1L3TA 4EBDA 2DR7A 1X9WA 1SZHA 3PSIA 2O6KA 1WYGA 3C2MA 9ICIA 2W9BA 3IDWA 4O3OA 3HT3A 4P2HA 2HHPA 1L3UA 4WC2A 4YP3A 4ECXA 1NK8A 4NKTA 2FPLA 3M8SA 2JHDA 4ECRA 2OHFA 1KRPA 5JTGA 3EYZA 1B4FA 1ZQLA 4LEZA 4Y2YA 3RJJA 2E5SA 2NYVA 4BDPA 4OJPA 5G5GA 4UAZA 2ZH3A 3PX0A 3C21A 4B9MA 2NO5A 1Z3EB 3QE9Y 2KEYA 4OAHA 3ONNA 5KG2A 1BNOA 2ESEA 1TKDA 4PPXA 4PL2A 3ER8C 4OO1J 3JPRA 4AT9A 1FFVA 4IQVA 2HBMA 2G5IB 1IXRA 3KFUF 2J6UA 2XY5A 3PVXA 1OUQA 2PI5A 2LI6A 3Q8RB 5KFWA 4FH5A 4KLOA 1MIYA 3NVZA 1ZQGA 2KVCA 4DSJA 1VFGA 2PKEA 5HRDA 1S8OA 4KN7A 3H4DA 3BZCA 1U47A 4RQ1A 5AI0A 3N7PD 4UAWA 7ICJA 4UQGA 1TAQA 1ZD3A 3F5AA 4FE3A 3R9KA 1ZQSA 2WB1C 3EPGA 3EZ5A 3WKDA 4WJ3B 3ISBA 4K8VA 4J9PA 3OVSA 5AI8A 2W9MA 4M6WB 5KFXA 2UVVA 3PO5A 3LVWA 1ZQKA 4M9JA 4B6JA 4BXOB 3H38A 2NV3A 4K97A 3WU2U 1SL2A 2EH9A 4F8RA 2KD1A 3BJYA 3F2BA 5J2BA 2UVUA 4F71A 1MN8A 2XY6A 5AKHA 5HHHA 4R66A 2XC9A 3C2LA 5J2GA 4J9RA 4HX0A 3HRDD 1XU4A 3QUBA 4RPXA 2F8LA 4C4SA 1BGXT 4UB3A 3BZKA 1AQ6A 3GIMA 3TFRA 5C0YA 3UMGA 1ZD4A 1NOMA 3AU2A 4LEVA 2K4EA 3OPXA 3SMVA 5TZVA 3L4PA 4UD4A 4UATA 8ICOA 4AT7A 4BUGA 4KLMA 4OAIZ 4K4IA 8ICUA 3NRWA 4X4TA 4Y2TA 2C2RA 4RPZA 3PNCA 2KFZA 2AQ4A 4DEZA 4GC6A 3K4GA 3RR8A 1RYSA 3TFSA 4P0PA 4TUPA 3M9OB 5EE1A 1SKRA 3LYSA 5AKYA 4MKPA 2W9CB 4AP9A 3MDAA 3HP6A 5AICA 3MFHA 4EEBA 4IRKA 4DFJA 3NRZA 1A0PA 1MA7A 2BQRA 3K75D 4K99A 1L7OA 2KKPA 8ICAA 3QZ8A 1TVAA 4I2EA 7ICQA 3NS1A 4RWQA 4IC9A 1NK6A 2ZIXA 4QZDA 8ICGA 4NY8A 2OXOA 2O1PA 1ZJNA 2W55A 3PSFA 2JEFA 3SI8A 7ICIA 1PZNA 3GV8B 4DQSA 5TISU 4A8EA 1NK7A 3TANA 1R8AA 2EANA 1UT8A 1KSPA 1NKCA 5CRXA 4AT7B 1QH9A 4NKUA 3H0RB 3AQKA 5CR0A 4M9HA 2EAMA 3G6VA 4X4QA 2Q4TA 5ALWA 2NRXA 3QUCA 8ICXA 9ICMA 7ICVA 1V85A 3IG8A 3MR2A 5CA7A 2ZH4A 4NM2A 4NJ8A 3AQLA 3LK9A 1ZJMA 9ICHA 4QW8A 5B3QA 5KFPA 4B9NA 4QIWF 2AGPA 2CPRA 2J6TA 5F9NA 4R63A 4YMMA 1JAJA 4PL1A 4ECQA 2XIDA 3N7SC 1COKA 2BBJA 5EWEA 4X4SA 3PW5A 4WC5A 5KTQA 5JRTA 4QZEA 1RG6A 3NTUA 3GILA 4EEYA 3V6KA 8ICBA 5AI9A 1CI4A 3RFAA 4FHYA 4M6WA 2LKYA 1B22A 2IOFK 4DSIA 4NLCA 4I2JA 5D46A 2W43A 7ICMA 1CRXA 2YB4A 5J2EA 4Z6DA 1X9MA 1T7PA 2R8HA 4QW9A 4LZGA 2ZTCA 5DGBA 3F2CA 4CCHA 4WC3A 4EYHB 3PSPA 1PK3A 3I1YA 3IV6A 4K4GA 4FBUA 1BPDA 3SQIA 9ICPA 3JPOA 4F50A 4PHDA 4FHXA 4TUQA 5DB8A 2HDOA 1C20A 1ZQFA 7ICUA 4KLTA 4O68A 1Q46A 3RAXA 5AK6A 2VKQA 2K60A 2ZH7A 2YN4A 4F5QA 4AT8A 5ALZA 3ZD8A 7ICEA 4UASA 4EELA 1ZQPA 2W8KA 3ZI4A 3PX6A 5AK5A 4FFDA 5IINA 1S77D 1WCNA 1A77A 2BCRA 1A76A 4ACOA 4O3MA 5KL1B 1UETA 5DG8A 1DK3A 4EX6A 2UVWA 2BQUA 1KEJA 3GU3A 5B66U 2AU0A 4MFFA 2VA8A 3SAHA 4J9LA 2NRWA 1N63A 5D49A 2GO7A 4X4OA 4UARA 2HHXA 5AM4A 5DB6A 5HNKA 2V4QA 4J9SA 4KX5A 4MF2A 2LM4A 5C5JA 3V7KA 3UM9A 3SR6A 3FDSA 5IIOA 2H3QA 4PH5A 3JPNA 3JCFA 5J2IA 3PR5B 1N56A 3SYZA 3G6XA 2FJ6A 1Z1BA 2KHVA 1LV5A 5JU5A 5IILA 1Q79A 4LT6A 3NVWA 4MFCA 4FS1A 3MGIA 2DGZA 3KTQA 1S0VA 3LQCB 2W9BB 4F5PA 4K98A 4RNNA 1H38A 4O3QA 2ALZA 1NK0A 4I2GA 4EP7A 4FHPA 5KT4A 4US8A 2VANA 1U4BA 4ZH4A 5AKIA 1QLNA 5ALSA 2ZH6A 2HOFA 1KKXA 1L8LA 3OVBA 1RPLA 4BWJA 2H3VA 4YD2A 4DS4A 2RFFA 2G07A 7ICNA 3ZDDA 4O5CA 2JXJA 1NKEA 4C0ZA 4Z6EA 4RQ4A 3NGDA 3C29A 2PXIA 2HHVA 4YXMA 9ICOA 2XICA 3NVOA 2G5HB 3N97B 1TE2A 4QZFA 1QQ5A 1UA1A 4Y2SA 3H8WA 1KQQA 2PFPA 2WAQF 4DOAA 1LVHA 1Q3VA 2CN1A 4C4RA 2P6UA 1F44A 5AM0A 2FPKA 1DRGA 1MIVA 4OAFA 1NKBA 5J8YA 4ATBA 2B4VA 4GIBA 3AQFA 4DL2A 3QZ7A 2ZIWB 5KFIA 4JK1A 5KL8B 4UAVA 1D8YA 1DGJA 4RQ6A 4DFKA 2JH1A 3ALRA 4DF4A 3HKZC 3OVAA 1SKSA 2YY6A 5F3XB 4ED2A 1RQNA 4PZOA 1ZQYA 3DV9A 4J03A 2PBEA 4R64A 5CP2A 5CHGA 1SXDA 1XO1A 3C28A 2BE3A 2KSOB 5KFFA 3WFSC 5AM3A 4RQ5A 2ZTEA 3KKAC 5DBBA 2Z7JA 4UD5A 2JR5A 1SL1A 2EZZA 1S10A 4OAGA 1AROP 2WHEA 3EWAA 1O03A 4NLBA 2ZIVA 4F3OA 5KFEA 2AGOA 2BQ3A 2ZJ8A 3AEVA 2IBKA 2HOQA 2H5XA 4RZRA 1V97A 2E8OA 4I29A 5KG4A 4FS2A 4DOBA 2Y1IA 5HR9A 1B43A 4IG8A 3GV5B 1SL0A 4E0DA 9ICVA 3TAQA 5DDYA 2J6SA 1PX5A 3TAPA 1UCVA 5DG9A 4JLZA 4JV1A 3WK5A 3OTQA 1TFRA 4DL4A 4IR1A 1Z4NA 2XCPA 1RDFA 7ICGA 4O5KA 1RYUA 3AQEA 2BDPA 2DRBA 1S0OA 3I76A 5HMMA 4Z6CA 4OCZA 1JUDA 2KG5A 1FFUA 2ZXIA 2KZZA 3KHRA 3SZ2A 1HUZA 3UMBA 1QTMA 4Y2UA 3QXGA 4ATBB 1A6SA 7ICPA 1F0MA 4WC7A 4XRHA 4EZ9A 3L9DA 4I0UA 3ETLA 4YD1A 2OH2A 5AK4A 4C8KA 2VA3A 4DL3A 2F44A 4MEXA 2WFAA 1Q8KA 5L1KA 4DF8A 4UBBA 2HHSA 1JXLA 2M2UA 5IIMA 4DL7A 2FE9A 2HN1A 4F72A 5AIBA 2PFQA 4LEWA 3VC8A 2VJ4A 4K9BA 2C28A 2ZUCA 5FP0A 1JX4A 4DSLA 4O0IA 3Q8PB 4B9SA 3AM9A 1Z00A 4AYBC 9ICNA 4PHEA 1IV8A 1F5SA 4DLEA 3RRHA 2VJ5A 2E1FA 5K4LA 2HHQA 1MQ3A 4FH3A 5KFGA 2HW3A 1L7MA 2A19A 2MRLA 3SAGA 1KTQA 4RT3A 5J29A 3JZ0A 3WFOA 1N5XA 5J2DA 5DEDA 4O3RA 4F4ZA 1VJ7A 4EV6A 1UEVA 1V4AA 4C8MA 2M9NA 2EWRA 3ICXA 2A1AA 3HJ1A 1UPHA 3T5HA 3IN5A 3HPOA 4DSEA 4NL9C 4TURA 1JROA 1KLNA 1T8EA 1NJWA 3WKAA 1J97A 5KFJA 3MR5A 3RJFA 4QWDA 2KN7A 4CF3A 4FHWA 2HBKA 3TADC 1ZQQA 5AM1A 2W9AA 4Q44A 2EAPA 1T3NA 5DLFA 3BS5A 3EF2A 3SV3A 3LDAA 1NO5A 4UB1A 2C2DA 1ZQIA 2WF5A 3V7LA 9ICLA 2IHOA 3IG5A 2NRKA 3ZDCA 5HRKA 2NRZA 2QARB 1WUDA 3RJGA 5ALYA 5DECA 1SXEA 2IHMA 5ALLA 1X40A 3MFIA 3M6KA 5KFRA 5J0QA 9ICUA 2P35A 1BPYA 3PW7A 2M0NA 4ED8A 2ES6A 1ZQEA 5J2FA 1JRPA 1X9XA 1XS9D 8ICVA 4G9BA 1K1QA 4Y2RA 2ZIXB 2F8KA 3G6YA 4ELTA 4NLGA 4F5OA 2IMWP 1YLQA 2KZ3A 4K96A 3H0MB 4DFDA 1MSWD 3EUB2 4EEKA 1NJXA 4USAA 2RP5A 3T5JA 2W3RA 1OXJA 5AKKA 3B0YA 4HYKA 5CHEA 3RRGA 5D61A 1ZQDA 2R8GA 2IOFA 1Z19A 3KKAA 5KAFU 4AT8B 2EZYA 2XGPA 2KHQA 2IHNA 2UVRA 3WKEA 3N4MB 5DB9A 5J2CA 2NRVA 5J0WA 1IIPA 2HHUA 2DBYA 3ISCA 2B6GA 4I2BA 3N28A 4X0BA 5ALHA 5CEHA 1C7YA 5E79U 4I2FA 3OGUA 4JWNA 3RB4A 2BCSA 2F3NA 2DRAA 2BPGA 2AQ0A 3PW0A 2H3FA 9ICWA 4P4MA 2ZUBA 2F1JA 5ALKA 1BPZA 2HSZA 2LYAA 4ED3A 4KLGA 1IG6A 4M04A 2ASDA 2KIWA 1N5WA 1DGSA 1GPJA 4I2CA 3H0LB 3WFPA 4UB2A 2A1JA 1NI3A 5BOLA 1NZPA 3S6JA 4IQUA 4IR9A 3TACB 4M9GA 5HRHA 5KFBA 4R8UA 1R8CA 2QLTA 2JRZA 4RNMA 1KFSA 2D3DA 5D4BA 5DBAA 4EBKA 3AQMA 4OJOA 5ALQA 1HIWA 1UHUA 8ICMA 2BGWA 2XCAA 3FC4A 4KX3A 1S0NA 1MIWA 4CRXA 4UW9A 3GQCA 4PGYA 3KD3A 5KFNA 2W7OA 2G09A 4F4WA 2W8LA 4K9AA 2LMRA 1BPEA 7ICKA 1VDVA 4R8UB 5GTIU 3EPIA 2ID1A 2JZBB 4RQ8A 1QCKA 5J0SA 9ICJA 4O3PA 4KN4A 4ECSA 2WF8A 2HI0A 3OV7A 3PZPA 4ZOHC 1QSLA 2OCEA 4LEYA 1V38A 9ICSA 4KLDA 4WQLA 2LYBA 3Q8QB 5BPCA 4RWOA 4MF8A 8ICIA 3WK9A 1D8LA 4FZMA 3SENA 5KNIA 7ICLA 1NNLA 3IHQB 4DQRA 1ZQBA 2FLNA 1Q3UA 4KM5A 2RDIA 1XNSA 2FI1A 4ED6A 5DDMA 2R8IA 1ZYQA 3H8SA 4EZ6A 1KN5A 4EENA 5ALGA 3PHZA 3GIIA 5CFUA 2KP7A 4I2IA 1YZ6A 2PI4A 3MCRA 2KIVA 3ER9B 1D9DA 3BQTA 2ZH1A 4QWBA 4YMOA 4DL6A 3AL0B 4WC0A 4DL5A 3UMCA 2ZIVB 4P0PB 1SIJA 1ZRNA 2GA9D 4DSKA 1ED1A 4DLGA 2KZMA 3H37A 4ED7A 3PV8A 2H3IA 3M7DA 4O9MA 4XQ8A 3AQNA 1KL9A 3BS5B 2BKEA 5KT7A 5KFTA 2HVIA 2PFOA 3CW2C 5ALEA 5EWFA 3C23A 4C4TA 4DSFA 3NASA 3AN1A 4YQWA 4GXJA 4RQNA 4M47A 3J81j 3T79A 3AMZA 2AH5A 2BPFA 1S5LU 2W7PA 3L5KA 3RR7A 1N61A 1ZQAA 4EYIB 3CRXA 1ZRMA 2ZHBA 5AKLA 5AM5A 2WF7A 4YN4A 2K8AA 1HEKA 4N7RA 2W11A 1PVQA 4Q8EA 5KFVA 4DO9A 4LVSA 4YXJA 1X2IA 3V72A 2YX8A 4QWCA 1XO0A 2MUTB 4O5EA 2LYHA 4BX9C 3H8JA 4E8FA 4WOYA 7ICTA 4KLEA 2XY7A 5DGAA 8ICYA 5KFLA 4WCWA 4KLFA 1ZD5A 2RDJA 5DB7A 3H3AA 3DDHA 4YFKA 2ZTDA 5KFQA 2LBOA 3OHAA 2WAQC 3K7DA 2G0AA 1ZQZA 9ICFA 2V9WA 2ZIUA 4M5DA 3CYMA 4QZAA 3BQ2A 4FZLA 4EX7A 2Y0SC 1JMSA 3PX4A 2YTUA 3H4BA 1S9FA 5ALMA 4JWMA 2K8CB 3QEBZ 2OYYA 4KMOB 1XSPA 2NO4A 3TKAA 3GDXA 4F4YA 2E3TA 3V6HA 4ELVA 5J2HA 2C2EA 3D2NA 4EBEA 1BNPA 4F2SA 9ICEA 3RAQA 4DWIA 9ICRA 8ICWA 2O5AA 2PMZF 5ALTA 4Y2JA 1IM4A 1UEUA 3A0HU 4TUSA 4F93B 3FAHA 3C66A 4WBZA 4RNOA 1QSYA 4FO6A 4I2AA 2KVSA 3D2QA 5KG6A 4M9LA 1WG8A 4XA5A 5KT6A 1Z4OA 4YG2A 1LKYA 4RPYA 2KK0A 4X4RA 4YVZA 3WK6A 3KHHA 2ASLA 9ICXA 2HHWA 3QU7A 2KTQA 4QIWC 1JQRA 2M2VA 3Q8MA 1SV4A 3NKUA 2XO7A 3HWTA 5ALUA 5F2VO 1TFYA 3MR6A 5AKXA 5AHXA 2Y1JA 4Y2VA 4QWAA 4K4HA 4Y2PA 4RQMA 4PZNA 3LVVA 1PUZA 1YZ7A 2ATLA 4P0QA 1BPBA 4WH5A 5AK3A 4XJEA 4KLQA 4P0QB 1K1SA 4HAIA 4KLUA 3C2KA 1U9LA 3GFKB 1ECWA 1RXWA 2W54A 2B56A 4J9KA 3QU9A 3THVA 2I6XA 3KZXA 3AU6A 3TQ1A 7ICSA 3QEAZ 4KLJA 2W03A 3N7RC 2ASJA 1L5UA 3C5GA 3NUQA 3SEIA 2PMZC 2DFLA 4ED0A 2RRDA 5ALXA 3V6JA 4NXTA 2HBLA 4US9A 2DVIA 3RF9A 1TAMA 2AHOB 4KITB 4ECVA 5DKWA 3ZDBA 1S0MA 1SV0C 3QNMA 5DQGA 4NLNA 4KLSA 5B5EU 3QX7A 5AKEA 3GIKA 1ZQJA 5ALDA 4Q43A 3D2SA 2Y9TA 5HP4A 3BS7A 2H3ZA 1QQ6A 4NXVA 3UXOA 3RJIA 3PW2A 4KTQA 2KMDA 1Y88A 3Q8SB 3T5KA 3KZIU 1ZQXA 4GC7A 3ETRA 1HJPA 2E1EA 7ICFA 3UXNA 4Q8FA 2AGQA 5KT3A 4F4KA 3RH5A 2DF4B 2YMMA 4P4OA 5ALVA 2G06A 1UA0A 1F5AA 4UB6U 3QU2A 1U45A 3TADA 4F5RA 4NLZA 2E8MA 3K1RB 5J8YC 3U26A 4RQ7A 1KNYA 3RH6A 1KW4A 1UT5A 2R8JA 3SD7A 5J2KA 3ISDA 4P4PA 2I5HA 4QZGA 9ICCA 2GH1A 1RM6C 1JXEA 1SZPA
chains in the Genus database with same CATH topology
2ZTCA 5DGBA 4CCHA 4WC3A 5KG1A 4EYHB 3UXPA 1XSLA 4AT8B 2Q66A 3TI0A 5CWRA 3C5FA 3C1YA 2XGPA 2I1QA 4K4GA 3HW8A 2IHNA 4J9MA 1BPDA 4PHPA 4QZBA 2UVRA 4FBUA 3N4MB 5DB9A 5J2CA 9ICQA 2MUTA 4S3NA 9ICPA 3JPOA 1T4GA 4PHDA 2NRVA 5J0WA 4F50A 1MC8A 5HMLA 2JZBA 8ICKA 4TUQA 4FHXA 3C18A 2HHUA 3ISCA 8ICTA 5DB8A 4AT9B 4ECZA 2P66A 1TAUA 1ZQFA 2BCQA 4I2BA 2FMPA 2P6RA 4LZGA 4I28A 4ELUA 7ICUA 4KLTA 4X0BA 3RAXA 8ICLA 3WFQE 1C7YA 1NK9A 2ZH2A 5KFAA 3UPQA 3OGUA 4DFPA 4I2FA 4JWNA 2ZH7A 3RB4A 2BCSA 4F5QA 4DQIA 2DRAA 2BPGA 4AT8A 3ZD8A 2AQ0A 3MDCA 4F2RA 7ICEA 3PW0A 4WC4A 4MEYA 9ICWA 3Q8KA 4P4MA 1ZQPA 1OU5A 2ZUBA 4IQTA 5J0OA 5KG5A 2DPIA 1COOA 2F1JA 2W8KA 4WC1A 1HUOA 1BPZA 3PX6A 4B9LA 2DR9A 1FA0A 4ED3A 4KLGA 5IINA 1S77D 9ICGA 4M04A 5KFZA 5DBCA 1WCNA 2ASDA 5HRFA 2ZHAA 1A77A 2BCRA 1A76A 5KFKA 2FMSA 4B9UA 3HJ4A 3JPSA 1DGSA 4I2HA 1UETA 5DG8A 2NRTA 4I2CA 1DK3A 2UVWA 2JEJA 2BQUA 1KEJA 5F9LA 3WFPA 5KG7A 4UB2A 2BR0A 2A1JA 1BPXA 5BOLA 2AU0A 1NZPA 4MFFA 1WOTA 2VA8A 4IQUA 2V4RA 4IR9A 1JIHA 1TV9A 4M9GA 5KFBA 2NRWA 4R8UA 4J9LA 5HRHA 1R8CA 4KLIA 5HREA 5D49A 4RNMA 4KLHA 1KFSA 3RH4A 8ICZA 4X4OA 4E7XA 3EW9A 5D4BA 5DBAA 2HHXA 3HIYA 5DB6A 4EBKA 3AQMA 3NYBA 3PMNA 5HNKA 2V4QA 4RQ2A 8ICHA 4J9SA 8ICMA 4WBYA 3OHBA 2BGWA 4DFMA 2XCAA 5C5JA 4MF2A 1CEZA 4UBCA 5CB1A 3UQ2A 1L3VA 4B9VA 2BPCA 3PMLA 5HRGA 2BHNA 1S0NA 1ZQOA 3V7KA 1MIWA 3ZD9A 3FDSA 3RJEA 1R89A 3GQCA 5IIOA 1S97A 4PH5A 4PGYA 1XWLA 3JPNA 5KFNA 4UB5A 5J2IA 3PR5B 1TK0A 4F4WA 1N56A 4O3NA 3SYZA 3G6XA 5KG0A 5CJ7A 3OJUA 2A1JB 2W8LA 1LV5A 3PO4A 2FLLA 4JV2A 3FYHA 4Z6FA 1Q78A 4PHAA 1BPEA 5IILA 7ICKA 4I27A 1Q79A 4R8UB 3BQ0A 1NK5A 3KHLA 2ISOA 4MFCA 4LT6A 3EPIA 2ID1A 2JZBB 4FS1A 4QZ9A 4RQ0A 2FMQA 4XQ7A 4X4VA 4RQ8A 3MGIA 3KTQA 1S0VA 3LQCB 5J0SA 1NK4A 4UAYA 3LWLA 2W9BB 4F5PA 9ICAA 9ICJA 4O3PA 4RNNA 4GXKA 4GLXA 5J0TA 3KHGA 5IIIA 5EOZA 4KN4A 3MGHA 1H38A 4ECSA 1U48A 4O3QA 2ALZA 1NK0A 4I2GA 4YR2A 2C22A 4EP7A 3OV7A 4FHPA 2W9CA 1QSLA 5KT4A 4LZDA 2VANA 5KT5A 9ICTA 1U4BA 4ZH4A 1QLNA 9ICSA 4KLDA 4BXOA 4QZCA 3Q8QB 5BPCA 2MAXA 4FHVA 4X4PA 3OUYA 4RWOA 4MF8A 2ZH6A 8ICIA 3MABA 5KG3A 5KFOA 1D8LA 1BVSA 4IRCA 3OVBA 7ICLA 1ZQRA 1RPLA 3BQ1A 2DR5A 4RUAA 4BWJA 3IHQB 4PGXA 4ECYA 4DQRA 1XSNA 1ZQBA 2FLNA 2DR8A 2RDIA 1MQ2A 2ZH8A 4ED6A 1ZQVA 5DDMA 4YD2A 2R8IA 4DS4A 2RFFA 4RWPA 7ICHA 7ICNA 5EWGA 4ECTA 1ZYQA 3ZDDA 4DQPA 7ICRA 3H8SA 4EZ6A 4IRDA 4QZ8A 4F5NA 5DG7A 4O5CA 1RXVA 8ICJA 3ORYA 1NKEA 4ECUA 4RT2A 4Z6EA 4RQ4A 3NGDA 3Q8LA 1NJYA 4TQRA 2PXIA 2HHVA 4B9TA 2M2WA 4YXMA 3RBDA 3GIIA 1RYRA 9ICOA 4KMUA 4I2IA 2KP7A 1L3TA 3N97B 3IM1A 1TK5A 4QZFA 4EBDA 3BDPA 2DR7A 2PI4A 5KFMA 1UA1A 2ISPA 1X9WA 3H8WA 1D9DA 3BQTA 2PFPA 4QWBA 2ZH1A 4F4XA 4YMOA 4DL6A 3TARA 4DOAA 4DOCA 4ECWA 2P6UA 2DPJA 1WCLA 3C2MA 9ICIA 2W9BA 1EXNA 4J9NA 4DL5A 4WC0A 5J0UA 4X5VA 2FPKA 4O3OA 1ZQWA 3HT3A 4P2HA 4JUZA 2HHPA 4TQSA 4DSKA 1L3UA 4GXIA 4DLGA 1MIVA 4WC2A 4YP3A 4ECXA 2KZMA 3H37A 4ED7A 3PV8A 5DLGA 1NK8A 1NKBA 4O9MA 1U49A 4XQ8A 3AQNA 4NKTA 2FPLA 4ATBA 3M8SA 3QZ7A 4DL2A 5KFIA 1ZQMA 4JK1A 4FBTA 4ECRA 1D8YA 2BKEA 5KT7A 5KFTA 4UD5A 2HVIA 2PFOA 3H40A 1KRPA 5EWFA 3C23A 3EYZA 4DSFA 4E80A 3GV7B 1ZQLA 1KDHA 4RQ6A 2BCUA 4DFKA 2AJQA 8ICFA 4YQWA 4DF4A 1S76D 3RJJA 4GXJA 3OVAA 5J2AA 4M47A 1SKSA 4BDPA 4UAZA 2BPFA 2ZH3A 7ICOA 3PX0A 3C21A 4B9MA 1Z3EB 4ED2A 3QE9Y 2JEGA 3OSNA 1ZQYA 3RR7A 5KG2A 1TKDA 1ZQAA 4PPXA 1BNOA 2PBEA 4F91B 4R64A 5L1LA 4EYIB 2ZHBA 3JPRA 4AT9A 4IQVA 4YCXA 5CP2A 1IXRA 5CHGA 8ICQA 1XO1A 2XY5A 2FLPA 2J6UA 2BE3A 4XUSA 5KFFA 3WFSC 4YN4A 3PVXA 4RQ5A 2PI5A 2ZTEA 3JYYA 5DBBA 1ZQTA 4Q8EA 3SV4A 5KFVA 4KLLA 4DO9A 1SL1A 5KFYA 3Q8RB 4YXJA 1X2IA 5KFWA 3V72A 1S10A 4LVSA 9ICKA 4KLOA 1AROP 1MIYA 4FH5A 4DS5A 1TFWA 3EWAA 1ZQGA 4QWCA 4DSJA 4F3OA 4YMNA 5KFEA 2AGOA 2ZJ8A 2BQ3A 2MUTB 1VFGA 1L3SA 2ZH9A 2IBKA 4O5EA 2H5XA 4RZRA 4I29A 2ZH5A 2LYHA 3H8JA 5KG4A 4E8FA 2IA6A 5HRDA 4KN7A 3H4DA 4FS2A 3OJSA 7ICTA 4KLEA 1U47A 4RQ1A 4UAWA 2XGQA 1KFDA 2XY7A 4DOBA 2Y1IA 4UQGA 5DGAA 7ICJA 5KFLA 1B43A 8ICYA 8ICPA 5HR9A 4WCWA 4IG8A 1TAQA 3GV5B 1XC9A 1SL0A 4E0DA 4KLFA 2RDJA 5DB7A 2I9GA 9ICVA 3H3AA 1ZQSA 3EPGA 4YR3A 3TAQA 3EZ5A 4YFKA 5DDYA 3JPTA 2ZTDA 2J6SA 5KFQA 5J0RA 2HVHA 1PX5A 3ISBA 3TAPA 1LB2B 3OHAA 4J9PA 5JUMA 3T5LA 5DG9A 2M2TA 3OVSA 1ZQZA 5KFCA 9ICFA 2V9WA 9ICBA 5IIKA 4JV1A 4M5DA 4QZAA 3BQ2A 2W9MA 4M6WB 5KFXA 4PGQA 2UVVA 4C8OA 1JMSA 3PO5A 3PX4A 1DK2A 1TFRA 3MBYA 4DL4A 5J0PA 1ZQKA 3RJKA 4IR1A 3M9MB 4M9JA 3RB3A 3E2EA 3H4BA 4YR0A 3B0XA 1S9FA 4JWMA 4BXOB 2XCPA 4WC6A 4F92B 4IQWA 3QEBZ 7ICGA 4O5KA 3H38A 1NJZA 5KFSA 3GIJA 2F1HA 3MR3A 2BDPA 1XSPA 1QSSA 2DRBA 3GDXA 1SL2A 4F8RA 4F4YA 1ZQNA 3BJYA 3V6HA 4ELVA 5J2BA 2UVUA 5KFUA 5J2HA 2C2EA 2VA2A 2XY6A 1DOQA 3PW4A 5HMMA 4Z6CA 4EBEA 1S0OA 1BNPA 4NXZA 4F2SA 5HRIA 5HHHA 9ICEA 4O3SA 3H39A 5KT2A 4R66A 3RAQA 2XC9A 3C2LA 4R65A 5KFHA 4DWIA 9ICRA 8ICWA 5J2GA 4I2DA 3HX0A 2KZZA 3KHRA 4J9RA 3SZ2A 2O5AA 5DQIA 3H7IA 1XU4A 4MFAA 1HUZA 1QTMA 3JPPA 4RPXA 1IM4A 4ATBB 1UEUA 4TUSA 1CUKA 4F93B 7ICPA 1BGXT 4UB3A 3C66A 4WBZA 5HHIA 4RNOA 3GIMA 4WC7A 1QSYA 3TFRA 4XRHA 4FO6A 4I2AA 5DQHA 4G3IA 4EZ9A 3L9DA 2OWOA 2ZJ5A 4M0AA 1NOMA 4JV0A 5KG6A 3ETLA 2WTFA 4M9LA 3AU2A 4YD1A 4XA5A 1TK8A 4C8KA 5KT6A 4RU9A 1V9PA 2VA3A 4DL3A 4MEXA 3ZDAA 4YG2A 5TZVA 4RPYA 5L1KA 4DF8A 4J9QA 4UD4A 3RTVA 4X4RA 4YVZA 8ICOA 4AT7A 4KLMA 4UBBA 4K4IA 3KHHA 2HHSA 8ICUA 4X4TA 2ASLA 2C2RA 4C8LA 9ICXA 1JXLA 4RPZA 2HHWA 2M2UA 5IIMA 2KTQA 3PNCA 4DL7A 1JQRA 2M2VA 5L1JA 3Q8MA 1ZQDA 2PFQA 3WFRE 2KFZA 2XO7A 3HWTA 2AQ4A 4DEZA 3JPQA 4GC6A 1N48A 1D9FA 5F2VO 1TFYA 2C28A 3MR6A 2ZUCA 3K4GA 3RR8A 1JX4A 1RYSA 3TFSA 4DSLA 4TUPA 4ED1A 4O0IA 3Q8PB 3M9OB 2Y1JA 4B9SA 4QWAA 4K4HA 1Z00A 1SKRA 4C8NA 2W9CB 4PHEA 3RBEA 9ICNA 3MDAA 2B21A 3HP6A 5J0XA 3V7JA 4DLEA 3OUYB 2ATLA 3RRHA 1BPBA 3MFHA 4IRKA 5HRBA 4DFJA 2HHQA 1MQ3A 5HRLA 5L1IA 4FH3A 5KFGA 2BQRA 4KLQA 1JN3A 2HW3A 1K1SA 3T3FA 3K75D 1ZQHA 1ZQCA 8ICAA 1KTQA 4RT3A 3QZ8A 1TVAA 8ICEA 4I2EA 4QWEA 7ICQA 4KLUA 5J29A 3JZ0A 3WFOA 5J2DA 4RWQA 5DEDA 3C2KA 1NK6A 1U9LA 1Z00B 3GFKB 3OSPA 4O3RA 4QZDA 1RXWA 4NY8A 8ICGA 8ICSA 1KFTA 4J9KA 1SKWA 2KFNA 1ZJNA 2O1PA 4QZIA 4F4ZA 3THVA 8ICCA 3AU6A 3TQ1A 1VJ7A 7ICSA 3QEAZ 4KLJA 1UEVA 1V4AA 4C8MA 2M9NA 4X0AA 5IIJA 2JEFA 3SI8A 3RB6A 2ASJA 1L5UA 3PY8A 3HJ1A 3C5GA 3T5HA 7ICIA 1PZNA 4QZHA 4M9NA 3GV8B 3HPOA 2DFLA 4DQSA 4DSEA 4ED0A 4TURA 1NK7A 3TANA 1KLNA 1R8AA 1T8EA 1NJWA 5J0YA 3V6JA 1UT8A 1KSPA 2R8KA 2R8GA 5KFJA 3MR5A 1RZTA 1NKCA 2GWSA 3RJFA 2DVIA 4QWDA 4AT7B 2ZUDA 2KN7A 4KITB 3UQ0A 4ECVA 4FHWA 5DKWA 1ZQQA 3ZDBA 3AQKA 4NKUA 1S0MA 2W9AA 5CR0A 4Q44A 4UB4A 4M9HA 1T3NA 5DQGA 4NLNA 8ICNA 5DLFA 3RB0A 3G6VA 4X4QA 3M9NB 4KLSA 3SV3A 2NRXA 3LDAA 1NO5A 8ICXA 4UB1A 2C2DA 1ZQIA 9ICMA 7ICVA 3MR2A 5CA7A 3GIKA 4NM2A 1ZQJA 3RJHA 3AQLA 2ZH4A 4Q43A 3V7LA 3LK9A 9ICLA 1ZJMA 9ICHA 5HP4A 4QW8A 5KFPA 2NRKA 3ZDCA 5HRKA 3UXOA 5KFDA 3RJIA 3PW2A 4KTQA 4B9NA 1Y88A 2NRZA 2FPMA 3Q8SB 4RUCA 2AGPA 2BCVA 2PFNA 3RJGA 3T5KA 2J6TA 5DECA 1ZQXA 2IHMA 4GC7A 5F9NA 5J2JA 4R63A 4X4UA 1HJPA 4YMMA 3MFIA 3C1ZA 4NM1A 7ICFA 1JAJA 3UXNA 4BWMA 3ZDEA 4Q8FA 1R8BA 2AGQA 8ICRA 4ECQA 2ZJAA 5KT3A 4F4KA 3UPSA 3RH5A 5KFRA 5J0QA 9ICUA 5EWEA 3M8RA 2JEIA 4P4OA 3PW5A 4WC5A 4BGDA 4X4SA 1UA0A 5KTQA 1BPYA 4RQ3A 4QZEA 1F5AA 3GILA 3NTUA 5BOMA 4ED8A 4EEYA 3PW7A 1U45A 4M2YA 4J9OA 4F5RA 1ZQEA 5J2FA 4EBCA 3V6KA 1XS9D 4NLZA 8ICBA 8ICVA 1K1QA 4X4NA 4FHYA 1X9SA 4M6WA 5L9XA 3G6YA 4ELTA 3LWMA 1B22A 4RQ7A 4NLGA 4F5OA 1KNYA 3RH6A 4DSIA 2IMWP 1YLQA 4EBJA 2KZ3A 3PR4A 2HHTA 4I2JA 1UT5A 5D46A 2R8JA 2Q0ZX 7ICMA 1MSWD 1NJXA 5J2KA 3ISDA 3T5JA 3AUOA 4RWNA 5J2EA 4P4PA 5HC9A 2F1IA 1ZQUA 3B0YA 4Z6DA 4HYKA 4QZGA 1X9MA 1T7PA 9ICCA 2R8HA 3RRGA 4NLKA 1JXEA 4QW9A 4DQQA 4Q45A 1SZPA 1ZETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTC A;  5DGB A;  4CCH A;  4WC3 A;  5KG1 A;  4EYH B;  3UXP A;  1XSL A;  4AT8 B;  2Q66 A;  3TI0 A;  5CWR A;  3C5F A;  3C1Y A;  2XGP A;  2I1Q A;  4K4G A;  3HW8 A;  2IHN A;  4J9M A;  1BPD A;  4PHP A;  4QZB A;  2UVR A;  4FBU A;  3N4M B;  5DB9 A;  5J2C A;  9ICQ A;  2MUT A;  4S3N A;  9ICP A;  3JPO A;  1T4G A;  4PHD A;  2NRV A;  5J0W A;  4F50 A;  1MC8 A;  5HML A;  2JZB A;  8ICK A;  4TUQ A;  4FHX A;  3C18 A;  2HHU A;  3ISC A;  8ICT A;  5DB8 A;  4AT9 B;  4ECZ A;  2P66 A;  1TAU A;  1ZQF A;  2BCQ A;  4I2B A;  2FMP A;  2P6R A;  4LZG A;  4I28 A;  4ELU A;  7ICU A;  4KLT A;  4X0B A;  3RAX A;  8ICL A;  3WFQ E;  1C7Y A;  1NK9 A;  2ZH2 A;  5KFA A;  3UPQ A;  3OGU A;  4DFP A;  4I2F A;  4JWN A;  2ZH7 A;  3RB4 A;  2BCS A;  4F5Q A;  4DQI A;  2DRA A;  2BPG A;  4AT8 A;  3ZD8 A;  2AQ0 A;  3MDC A;  4F2R A;  7ICE A;  3PW0 A;  4WC4 A;  4MEY A;  9ICW A;  3Q8K A;  4P4M A;  1ZQP A;  1OU5 A;  2ZUB A;  4IQT A;  5J0O A;  5KG5 A;  2DPI A;  1COO A;  2F1J A;  2W8K A;  4WC1 A;  1HUO A;  1BPZ A;  3PX6 A;  4B9L A;  2DR9 A;  1FA0 A;  4ED3 A;  4KLG A;  5IIN A;  1S77 D;  9ICG A;  4M04 A;  5KFZ A;  5DBC A;  1WCN A;  2ASD A;  5HRF A;  2ZHA A;  1A77 A;  2BCR A;  1A76 A;  5KFK A;  2FMS A;  4B9U A;  3HJ4 A;  3JPS A;  1DGS A;  4I2H A;  1UET A;  5DG8 A;  2NRT A;  4I2C A;  1DK3 A;  2UVW A;  2JEJ A;  2BQU A;  1KEJ A;  5F9L A;  3WFP A;  5KG7 A;  4UB2 A;  2BR0 A;  2A1J A;  1BPX A;  5BOL A;  2AU0 A;  1NZP A;  4MFF A;  1WOT A;  2VA8 A;  4IQU A;  2V4R A;  4IR9 A;  1JIH A;  1TV9 A;  4M9G A;  5KFB A;  2NRW A;  4R8U A;  4J9L A;  5HRH A;  1R8C A;  4KLI A;  5HRE A;  5D49 A;  4RNM A;  4KLH A;  1KFS A;  3RH4 A;  8ICZ A;  4X4O A;  4E7X A;  3EW9 A;  5D4B A;  5DBA A;  2HHX A;  3HIY A;  5DB6 A;  4EBK A;  3AQM A;  3NYB A;  3PMN A;  5HNK A;  2V4Q A;  4RQ2 A;  8ICH A;  4J9S A;  8ICM A;  4WBY A;  3OHB A;  2BGW A;  4DFM A;  2XCA A;  5C5J A;  4MF2 A;  1CEZ A;  4UBC A;  5CB1 A;  3UQ2 A;  1L3V A;  4B9V A;  2BPC A;  3PML A;  5HRG A;  2BHN A;  1S0N A;  1ZQO A;  3V7K A;  1MIW A;  3ZD9 A;  3FDS A;  3RJE A;  1R89 A;  3GQC A;  5IIO A;  1S97 A;  4PH5 A;  4PGY A;  1XWL A;  3JPN A;  5KFN A;  4UB5 A;  5J2I A;  3PR5 B;  1TK0 A;  4F4W A;  1N56 A;  4O3N A;  3SYZ A;  3G6X A;  5KG0 A;  5CJ7 A;  3OJU A;  2A1J B;  2W8L A;  1LV5 A;  3PO4 A;  2FLL A;  4JV2 A;  3FYH A;  4Z6F A;  1Q78 A;  4PHA A;  1BPE A;  5IIL A;  7ICK A;  4I27 A;  1Q79 A;  4R8U B;  3BQ0 A;  1NK5 A;  3KHL A;  2ISO A;  4MFC A;  4LT6 A;  3EPI A;  2ID1 A;  2JZB B;  4FS1 A;  4QZ9 A;  4RQ0 A;  2FMQ A;  4XQ7 A;  4X4V A;  4RQ8 A;  3MGI A;  3KTQ A;  1S0V A;  3LQC B;  5J0S A;  1NK4 A;  4UAY A;  3LWL A;  2W9B B;  4F5P A;  9ICA A;  9ICJ A;  4O3P A;  4RNN A;  4GXK A;  4GLX A;  5J0T A;  3KHG A;  5III A;  5EOZ A;  4KN4 A;  3MGH A;  1H38 A;  4ECS A;  1U48 A;  4O3Q A;  2ALZ A;  1NK0 A;  4I2G A;  4YR2 A;  2C22 A;  4EP7 A;  3OV7 A;  4FHP A;  2W9C A;  1QSL A;  5KT4 A;  4LZD A;  2VAN A;  5KT5 A;  9ICT A;  1U4B A;  4ZH4 A;  1QLN A;  9ICS A;  4KLD A;  4BXO A;  4QZC A;  3Q8Q B;  5BPC A;  2MAX A;  4FHV A;  4X4P A;  3OUY A;  4RWO A;  4MF8 A;  2ZH6 A;  8ICI A;  3MAB A;  5KG3 A;  5KFO A;  1D8L A;  1BVS A;  4IRC A;  3OVB A;  7ICL A;  1ZQR A;  1RPL A;  3BQ1 A;  2DR5 A;  4RUA A;  4BWJ A;  3IHQ B;  4PGX A;  4ECY A;  4DQR A;  1XSN A;  1ZQB A;  2FLN A;  2DR8 A;  2RDI A;  1MQ2 A;  2ZH8 A;  4ED6 A;  1ZQV A;  5DDM A;  4YD2 A;  2R8I A;  4DS4 A;  2RFF A;  4RWP A;  7ICH A;  7ICN A;  5EWG A;  4ECT A;  1ZYQ A;  3ZDD A;  4DQP A;  7ICR A;  3H8S A;  4EZ6 A;  4IRD A;  4QZ8 A;  4F5N A;  5DG7 A;  4O5C A;  1RXV A;  8ICJ A;  3ORY A;  1NKE A;  4ECU A;  4RT2 A;  4Z6E A;  4RQ4 A;  3NGD A;  3Q8L A;  1NJY A;  4TQR A;  2PXI A;  2HHV A;  4B9T A;  2M2W A;  4YXM A;  3RBD A;  3GII A;  1RYR A;  9ICO A;  4KMU A;  4I2I A;  2KP7 A;  1L3T A;  3N97 B;  3IM1 A;  1TK5 A;  4QZF A;  4EBD A;  3BDP A;  2DR7 A;  2PI4 A;  5KFM A;  1UA1 A;  2ISP A;  1X9W A;  3H8W A;  1D9D A;  3BQT A;  2PFP A;  4QWB A;  2ZH1 A;  4F4X A;  4YMO A;  4DL6 A;  3TAR A;  4DOA A;  4DOC A;  4ECW A;  2P6U A;  2DPJ A;  1WCL A;  3C2M A;  9ICI A;  2W9B A;  1EXN A;  4J9N A;  4DL5 A;  4WC0 A;  5J0U A;  4X5V A;  2FPK A;  4O3O A;  1ZQW A;  3HT3 A;  4P2H A;  4JUZ A;  2HHP A;  4TQS A;  4DSK A;  1L3U A;  4GXI A;  4DLG A;  1MIV A;  4WC2 A;  4YP3 A;  4ECX A;  2KZM A;  3H37 A;  4ED7 A;  3PV8 A;  5DLG A;  1NK8 A;  1NKB A;  4O9M A;  1U49 A;  4XQ8 A;  3AQN A;  4NKT A;  2FPL A;  4ATB A;  3M8S A;  3QZ7 A;  4DL2 A;  5KFI A;  1ZQM A;  4JK1 A;  4FBT A;  4ECR A;  1D8Y A;  2BKE A;  5KT7 A;  5KFT A;  4UD5 A;  2HVI A;  2PFO A;  3H40 A;  1KRP A;  5EWF A;  3C23 A;  3EYZ A;  4DSF A;  4E80 A;  3GV7 B;  1ZQL A;  1KDH A;  4RQ6 A;  2BCU A;  4DFK A;  2AJQ A;  8ICF A;  4YQW A;  4DF4 A;  1S76 D;  3RJJ A;  4GXJ A;  3OVA A;  5J2A A;  4M47 A;  1SKS A;  4BDP A;  4UAZ A;  2BPF A;  2ZH3 A;  7ICO A;  3PX0 A;  3C21 A;  4B9M A;  1Z3E B;  4ED2 A;  3QE9 Y;  2JEG A;  3OSN A;  1ZQY A;  3RR7 A;  5KG2 A;  1TKD A;  1ZQA A;  4PPX A;  1BNO A;  2PBE A;  4F91 B;  4R64 A;  5L1L A;  4EYI B;  2ZHB A;  3JPR A;  4AT9 A;  4IQV A;  4YCX A;  5CP2 A;  1IXR A;  5CHG A;  8ICQ A;  1XO1 A;  2XY5 A;  2FLP A;  2J6U A;  2BE3 A;  4XUS A;  5KFF A;  3WFS C;  4YN4 A;  3PVX A;  4RQ5 A;  2PI5 A;  2ZTE A;  3JYY A;  5DBB A;  1ZQT A;  4Q8E A;  3SV4 A;  5KFV A;  4KLL A;  4DO9 A;  1SL1 A;  5KFY A;  3Q8R B;  4YXJ A;  1X2I A;  5KFW A;  3V72 A;  1S10 A;  4LVS A;  9ICK A;  4KLO A;  1ARO P;  1MIY A;  4FH5 A;  4DS5 A;  1TFW A;  3EWA A;  1ZQG A;  4QWC A;  4DSJ A;  4F3O A;  4YMN A;  5KFE A;  2AGO A;  2ZJ8 A;  2BQ3 A;  2MUT B;  1VFG A;  1L3S A;  2ZH9 A;  2IBK A;  4O5E A;  2H5X A;  4RZR A;  4I29 A;  2ZH5 A;  2LYH A;  3H8J A;  5KG4 A;  4E8F A;  2IA6 A;  5HRD A;  4KN7 A;  3H4D A;  4FS2 A;  3OJS A;  7ICT A;  4KLE A;  1U47 A;  4RQ1 A;  4UAW A;  2XGQ A;  1KFD A;  2XY7 A;  4DOB A;  2Y1I A;  4UQG A;  5DGA A;  7ICJ A;  5KFL A;  1B43 A;  8ICY A;  8ICP A;  5HR9 A;  4WCW A;  4IG8 A;  1TAQ A;  3GV5 B;  1XC9 A;  1SL0 A;  4E0D A;  4KLF A;  2RDJ A;  5DB7 A;  2I9G A;  9ICV A;  3H3A A;  1ZQS A;  3EPG A;  4YR3 A;  3TAQ A;  3EZ5 A;  4YFK A;  5DDY A;  3JPT A;  2ZTD A;  2J6S A;  5KFQ A;  5J0R A;  2HVH A;  1PX5 A;  3ISB A;  3TAP A;  1LB2 B;  3OHA A;  4J9P A;  5JUM A;  3T5L A;  5DG9 A;  2M2T A;  3OVS A;  1ZQZ A;  5KFC A;  9ICF A;  2V9W A;  9ICB A;  5IIK A;  4JV1 A;  4M5D A;  4QZA A;  3BQ2 A;  2W9M A;  4M6W B;  5KFX A;  4PGQ A;  2UVV A;  4C8O A;  1JMS A;  3PO5 A;  3PX4 A;  1DK2 A;  1TFR A;  3MBY A;  4DL4 A;  5J0P A;  1ZQK A;  3RJK A;  4IR1 A;  3M9M B;  4M9J A;  3RB3 A;  3E2E A;  3H4B A;  4YR0 A;  3B0X A;  1S9F A;  4JWM A;  4BXO B;  2XCP A;  4WC6 A;  4F92 B;  4IQW A;  3QEB Z;  7ICG A;  4O5K A;  3H38 A;  1NJZ A;  5KFS A;  3GIJ A;  2F1H A;  3MR3 A;  2BDP A;  1XSP A;  1QSS A;  2DRB A;  3GDX A;  1SL2 A;  4F8R A;  4F4Y A;  1ZQN A;  3BJY A;  3V6H A;  4ELV A;  5J2B A;  2UVU A;  5KFU A;  5J2H A;  2C2E A;  2VA2 A;  2XY6 A;  1DOQ A;  3PW4 A;  5HMM A;  4Z6C A;  4EBE A;  1S0O A;  1BNP A;  4NXZ A;  4F2S A;  5HRI A;  5HHH A;  9ICE A;  4O3S A;  3H39 A;  5KT2 A;  4R66 A;  3RAQ A;  2XC9 A;  3C2L A;  4R65 A;  5KFH A;  4DWI A;  9ICR A;  8ICW A;  5J2G A;  4I2D A;  3HX0 A;  2KZZ A;  3KHR A;  4J9R A;  3SZ2 A;  2O5A A;  5DQI A;  3H7I A;  1XU4 A;  4MFA A;  1HUZ A;  1QTM A;  3JPP A;  4RPX A;  1IM4 A;  4ATB B;  1UEU A;  4TUS A;  1CUK A;  4F93 B;  7ICP A;  1BGX T;  4UB3 A;  3C66 A;  4WBZ A;  5HHI A;  4RNO A;  3GIM A;  4WC7 A;  1QSY A;  3TFR A;  4XRH A;  4FO6 A;  4I2A A;  5DQH A;  4G3I A;  4EZ9 A;  3L9D A;  2OWO A;  2ZJ5 A;  4M0A A;  1NOM A;  4JV0 A;  5KG6 A;  3ETL A;  2WTF A;  4M9L A;  3AU2 A;  4YD1 A;  4XA5 A;  1TK8 A;  4C8K A;  5KT6 A;  4RU9 A;  1V9P A;  2VA3 A;  4DL3 A;  4MEX A;  3ZDA A;  4YG2 A;  5TZV A;  4RPY A;  5L1K A;  4DF8 A;  4J9Q A;  4UD4 A;  3RTV A;  4X4R A;  4YVZ A;  8ICO A;  4AT7 A;  4KLM A;  4UBB A;  4K4I A;  3KHH A;  2HHS A;  8ICU A;  4X4T A;  2ASL A;  2C2R A;  4C8L A;  9ICX A;  1JXL A;  4RPZ A;  2HHW A;  2M2U A;  5IIM A;  2KTQ A;  3PNC A;  4DL7 A;  1JQR A;  2M2V A;  5L1J A;  3Q8M A;  1ZQD A;  2PFQ A;  3WFR E;  2KFZ A;  2XO7 A;  3HWT A;  2AQ4 A;  4DEZ A;  3JPQ A;  4GC6 A;  1N48 A;  1D9F A;  5F2V O;  1TFY A;  2C28 A;  3MR6 A;  2ZUC A;  3K4G A;  3RR8 A;  1JX4 A;  1RYS A;  3TFS A;  4DSL A;  4TUP A;  4ED1 A;  4O0I A;  3Q8P B;  3M9O B;  2Y1J A;  4B9S A;  4QWA A;  4K4H A;  1Z00 A;  1SKR A;  4C8N A;  2W9C B;  4PHE A;  3RBE A;  9ICN A;  3MDA A;  2B21 A;  3HP6 A;  5J0X A;  3V7J A;  4DLE A;  3OUY B;  2ATL A;  3RRH A;  1BPB A;  3MFH A;  4IRK A;  5HRB A;  4DFJ A;  2HHQ A;  1MQ3 A;  5HRL A;  5L1I A;  4FH3 A;  5KFG A;  2BQR A;  4KLQ A;  1JN3 A;  2HW3 A;  1K1S A;  3T3F A;  3K75 D;  1ZQH A;  1ZQC A;  8ICA A;  1KTQ A;  4RT3 A;  3QZ8 A;  1TVA A;  8ICE A;  4I2E A;  4QWE A;  7ICQ A;  4KLU A;  5J29 A;  3JZ0 A;  3WFO A;  5J2D A;  4RWQ A;  5DED A;  3C2K A;  1NK6 A;  1U9L A;  1Z00 B;  3GFK B;  3OSP A;  4O3R A;  4QZD A;  1RXW A;  4NY8 A;  8ICG A;  8ICS A;  1KFT A;  4J9K A;  1SKW A;  2KFN A;  1ZJN A;  2O1P A;  4QZI A;  4F4Z A;  3THV A;  8ICC A;  3AU6 A;  3TQ1 A;  1VJ7 A;  7ICS A;  3QEA Z;  4KLJ A;  1UEV A;  1V4A A;  4C8M A;  2M9N A;  4X0A A;  5IIJ A;  2JEF A;  3SI8 A;  3RB6 A;  2ASJ A;  1L5U A;  3PY8 A;  3HJ1 A;  3C5G A;  3T5H A;  7ICI A;  1PZN A;  4QZH A;  4M9N A;  3GV8 B;  3HPO A;  2DFL A;  4DQS A;  4DSE A;  4ED0 A;  4TUR A;  1NK7 A;  3TAN A;  1KLN A;  1R8A A;  1T8E A;  1NJW A;  5J0Y A;  3V6J A;  1UT8 A;  1KSP A;  2R8K A;  2R8G A;  5KFJ A;  3MR5 A;  1RZT A;  1NKC A;  2GWS A;  3RJF A;  2DVI A;  4QWD A;  4AT7 B;  2ZUD A;  2KN7 A;  4KIT B;  3UQ0 A;  4ECV A;  4FHW A;  5DKW A;  1ZQQ A;  3ZDB A;  3AQK A;  4NKU A;  1S0M A;  2W9A A;  5CR0 A;  4Q44 A;  4UB4 A;  4M9H A;  1T3N A;  5DQG A;  4NLN A;  8ICN A;  5DLF A;  3RB0 A;  3G6V A;  4X4Q A;  3M9N B;  4KLS A;  3SV3 A;  2NRX A;  3LDA A;  1NO5 A;  8ICX A;  4UB1 A;  2C2D A;  1ZQI A;  9ICM A;  7ICV A;  3MR2 A;  5CA7 A;  3GIK A;  4NM2 A;  1ZQJ A;  3RJH A;  3AQL A;  2ZH4 A;  4Q43 A;  3V7L A;  3LK9 A;  9ICL A;  1ZJM A;  9ICH A;  5HP4 A;  4QW8 A;  5KFP A;  2NRK A;  3ZDC A;  5HRK A;  3UXO A;  5KFD A;  3RJI A;  3PW2 A;  4KTQ A;  4B9N A;  1Y88 A;  2NRZ A;  2FPM A;  3Q8S B;  4RUC A;  2AGP A;  2BCV A;  2PFN A;  3RJG A;  3T5K A;  2J6T A;  5DEC A;  1ZQX A;  2IHM A;  4GC7 A;  5F9N A;  5J2J A;  4R63 A;  4X4U A;  1HJP A;  4YMM A;  3MFI A;  3C1Z A;  4NM1 A;  7ICF A;  1JAJ A;  3UXN A;  4BWM A;  3ZDE A;  4Q8F A;  1R8B A;  2AGQ A;  8ICR A;  4ECQ A;  2ZJA A;  5KT3 A;  4F4K A;  3UPS A;  3RH5 A;  5KFR A;  5J0Q A;  9ICU A;  5EWE A;  3M8R A;  2JEI A;  4P4O A;  3PW5 A;  4WC5 A;  4BGD A;  4X4S A;  1UA0 A;  5KTQ A;  1BPY A;  4RQ3 A;  4QZE A;  1F5A A;  3GIL A;  3NTU A;  5BOM A;  4ED8 A;  4EEY A;  3PW7 A;  1U45 A;  4M2Y A;  4J9O A;  4F5R A;  1ZQE A;  5J2F A;  4EBC A;  3V6K A;  1XS9 D;  4NLZ A;  8ICB A;  8ICV A;  1K1Q A;  4X4N A;  4FHY A;  1X9S A;  4M6W A;  5L9X A;  3G6Y A;  4ELT A;  3LWM A;  1B22 A;  4RQ7 A;  4NLG A;  4F5O A;  1KNY A;  3RH6 A;  4DSI A;  2IMW P;  1YLQ A;  4EBJ A;  2KZ3 A;  3PR4 A;  2HHT A;  4I2J A;  1UT5 A;  5D46 A;  2R8J A;  2Q0Z X;  7ICM A;  1MSW D;  1NJX A;  5J2K A;  3ISD A;  3T5J A;  3AUO A;  4RWN A;  5J2E A;  4P4P A;  5HC9 A;  2F1I A;  1ZQU A;  3B0Y A;  4Z6D A;  4HYK A;  4QZG A;  1X9M A;  1T7P A;  9ICC A;  2R8H A;  3RRG A;  4NLK A;  1JXE A;  4QW9 A;  4DQQ A;  4Q45 A;  1SZP A;  1ZET A; 
#chains in the Genus database with same CATH topology
 2WF9 A;  2DQN B;  1XSL A;  2Q66 A;  4Y2X A;  5CWR A;  3C5F A;  3MGV A;  4PHP A;  2LM1 A;  9ICQ A;  2MUT A;  5ALF A;  1T4G A;  1SWV A;  2CRX A;  3C18 A;  4AT9 B;  2LHT A;  2BCQ A;  2FMP A;  2P6R A;  4I28 A;  2D6F C;  3WFQ E;  2ZH2 A;  5KFA A;  2KOB A;  5AIA A;  2YML A;  3B9J A;  4OJ6 A;  4F2R A;  3KOO A;  4WC4 A;  1OU5 A;  5J0O A;  4CDG A;  5T14 A;  2EAO A;  3VCB A;  2OEH A;  5HR7 A;  5EE9 A;  5DBC A;  5HRF A;  2FMS A;  1N60 A;  1WWU A;  4C7Z A;  5ALP A;  2JEJ A;  5F9L A;  3FM9 A;  2BR0 A;  3WK8 A;  2V4R A;  1N2X A;  1JIH A;  4KLI A;  5HRE A;  1ZXI A;  4MHV A;  3RH4 A;  8ICZ A;  4E7X A;  3EW9 A;  3HIY A;  3NYB A;  3QUQ A;  3M6Z A;  4FZN A;  3PMN A;  4RQ2 A;  2QB0 A;  3OHB A;  1CEZ A;  3UQ2 A;  4B9V A;  2BPC A;  3PML A;  2BZF A;  1ZQO A;  3ZD9 A;  3RJE A;  1O08 A;  1R89 A;  4BJQ A;  1PVP A;  1XWL A;  3HIL A;  4UB5 A;  1TK0 A;  2K4I A;  5KG0 A;  5CJ7 A;  1DXS A;  3PO4 A;  2FLL A;  4JV2 A;  4Z6F A;  1Q78 A;  2R18 A;  3BQ0 A;  3KHL A;  2ISO A;  2EDU A;  4XQ7 A;  2FMQ A;  4QZ9 A;  5JTI A;  4RQ0 A;  4X4V A;  2YMP A;  2F77 X;  9ICA A;  3A0B U;  1JAL A;  3LWL A;  4GXK A;  2B0C A;  4GLX A;  5J0T A;  3KHG A;  5III A;  5EOZ A;  1M6Y A;  4YR2 A;  9ICT A;  4BXO A;  4QZC A;  4X4P A;  3OUY A;  1VLB A;  1BVS A;  4CF4 A;  2DR5 A;  5ALI A;  4RUA A;  1P7D A;  4PGX A;  4ECY A;  3NWI A;  2HN2 A;  1L7N A;  3GZF A;  2GLE A;  5HR6 A;  1ZQV A;  5AI6 A;  2YMQ A;  2A3V A;  7ICH A;  5EWG A;  1X42 A;  2AXT U;  4IRD A;  4QZ8 A;  5DG7 A;  8ICJ A;  1RXV A;  2DL0 A;  3ORY A;  4PJ0 U;  4ECU A;  2E8P A;  4RT2 A;  3Q8L A;  4TQR A;  2M2W A;  3RBD A;  1RYR A;  3ED5 A;  3IM1 A;  2WB1 F;  1TK5 A;  3BDP A;  5KFM A;  4NXW A;  2ISP A;  1ZOL A;  4F4X A;  3TAR A;  4DOC A;  4ECW A;  2DPJ A;  1FIQ A;  1WCL A;  4J9N A;  1EXN A;  4IL6 U;  5J0U A;  4X5V A;  1ZQW A;  4JUZ A;  4TQS A;  2Y0S F;  4GXI A;  5B3P A;  3QYP A;  2F76 X;  5DLG A;  1U49 A;  2JV3 A;  1ZQM A;  4FBT A;  1SV0 A;  2HMX A;  3H40 A;  4E80 A;  3GV7 B;  1KDH A;  2BCU A;  2AJQ A;  8ICF A;  1S76 D;  2GOL A;  5CFS A;  5J2A A;  4JLX A;  7ICO A;  4LJX A;  3IP4 B;  2BDU A;  2JEG A;  3OSN A;  4CNQ A;  1QQ7 A;  2QB0 B;  2ZG6 A;  3O0F A;  4F91 B;  5L1L A;  1N62 A;  4YCX A;  8ICQ A;  2ODG A;  2FLP A;  4XUS A;  3JYY A;  2KE7 A;  1ZQT A;  3SV4 A;  4KLL A;  4NV0 A;  1L8O A;  5KFY A;  9ICK A;  1B0X A;  3F2D A;  4QNL A;  1TFW A;  2K89 A;  4DS5 A;  4YMN A;  1L3S A;  2ZH9 A;  2ZH5 A;  2YB1 A;  2IA6 A;  3BQ7 A;  4WQK A;  3OJS A;  2XGQ A;  1KFD A;  5ALR A;  1K5O A;  8ICP A;  1XC9 A;  2QKQ A;  2K8B B;  2I9G A;  4NL9 A;  4YR3 A;  3JPT A;  5J0R A;  2HVH A;  2KSO A;  1LB2 B;  1PK1 B;  3T5L A;  5JUM A;  3F5E A;  2M2T A;  5KFC A;  9ICB A;  5IIK A;  5A0L A;  4PGQ A;  4C8O A;  2JMG A;  1DK2 A;  3MBY A;  3RJK A;  5J0P A;  3E2E A;  3M9M B;  3RB3 A;  4YR0 A;  2KJ5 A;  3B0X A;  4OD0 A;  4WC6 A;  4F92 B;  4IQW A;  2B51 A;  5AKJ A;  1L7P A;  1NJZ A;  3CNH A;  3GIJ A;  2K4H A;  2F1H A;  2KKV A;  5KFS A;  3QU4 A;  3MR3 A;  1QSS A;  2N1R A;  1ZQN A;  1SB3 C;  5KFU A;  2VA2 A;  1DOQ A;  3PW4 A;  4NXZ A;  5HRI A;  4FO1 A;  3H39 A;  4O3S A;  1OW5 A;  5KT2 A;  4R65 A;  2D8C A;  5KFH A;  4I2D A;  3HX0 A;  2QAR A;  1FEZ A;  2QB1 A;  2DUY A;  5DQI A;  3H7I A;  4MFA A;  3JPP A;  2YQE A;  1CUK A;  5HHI A;  1UQV A;  5KAI U;  5DQH A;  2RQ5 A;  4G3I A;  2OWO A;  2MSN A;  2ZJ5 A;  4M0A A;  4JV0 A;  2WTF A;  1TK8 A;  4RU9 A;  1V9P A;  3ZDA A;  4J9Q A;  2DKZ A;  3RTV A;  2XI9 A;  2EQY A;  3HJE A;  2VIX A;  2F2A B;  4C8L A;  5ALN A;  4U6P A;  2FCL A;  5L1J A;  2ZXH A;  2WF6 A;  3WFR E;  3DEE A;  3JPQ A;  1N48 A;  1D9F A;  4ED1 A;  4UB8 U;  4CGZ A;  3F53 A;  5AM2 A;  3RBE A;  4C8N A;  4QJF B;  2B21 A;  5J0X A;  3V7J A;  2CXY A;  3OUY B;  4JMU A;  5HRB A;  5HRL A;  4GFJ A;  5L1I A;  5H2F U;  1JN3 A;  3CK6 A;  1ZQH A;  3T3F A;  1ZQC A;  8ICE A;  4QWE A;  1Z00 B;  3OSP A;  8ICS A;  1KFT A;  1SKW A;  2KFN A;  4QZI A;  3OWG A;  8ICC A;  4X0A A;  5IIJ A;  3RB6 A;  3PY8 A;  1RQL A;  4M9N A;  4QZH A;  2HOI A;  2EZX A;  2K4P A;  4IS7 A;  5J0Y A;  2R8K A;  1RZT A;  2GWS A;  1URJ A;  3SAF A;  2ZUD A;  3UQ0 A;  3CP8 A;  4UB4 A;  8ICN A;  3RB0 A;  1SGG A;  1L6N A;  3M9N B;  2RLT A;  3RJH A;  2FDR A;  4CE6 A;  1WWV A;  5KFD A;  2FPM A;  2BCV A;  4RUC A;  2PFN A;  1KBU A;  3E58 A;  5J2J A;  4EED A;  4X4U A;  2E8N A;  4NM1 A;  3C1Z A;  2HBJ A;  4BWM A;  3ZDE A;  1R8B A;  8ICR A;  2XVT A;  2ZJA A;  1X6I A;  3UPS A;  2KV2 A;  4AYB F;  5AKG A;  3M8R A;  2JEI A;  4BGD A;  4NXX A;  4RQ3 A;  5BOM A;  2KJ9 A;  4M2Y A;  4J9O A;  5G5H A;  4C7Y A;  4EBC A;  4X4N A;  1X9S A;  5L9X A;  3LWM A;  4EBJ A;  3PR4 A;  2W04 A;  2HHT A;  1T3Q A;  2Q0Z X;  2JH7 A;  3L3F X;  5GTH U;  4CF5 A;  3AUO A;  4RWN A;  2Y9U A;  5HC9 A;  2F1I A;  1ZQU A;  2IOH A;  4NLK A;  5D62 A;  4DQQ A;  4Q45 A;  5EE3 A;  2KIC A;  1ZET A;  5KG1 A;  3UXP A;  1X66 A;  3KBB A;  3WKB A;  3TI0 A;  3NVV A;  3C1Y A;  2I1Q A;  3HW8 A;  4J9M A;  4QZB A;  3WKC A;  4KB6 A;  4S3N A;  1X6J A;  1D8B A;  5AI5 A;  1YT3 A;  1MC8 A;  5HML A;  2JZB A;  8ICK A;  4O67 A;  8ICT A;  4ECZ A;  2P66 A;  1TAU A;  3NVY A;  4ELU A;  3K1Z A;  1VJ5 A;  1SWW A;  4Y2Q A;  8ICL A;  1NK9 A;  4DFP A;  3UPQ A;  2OM6 A;  3E0F A;  5ALO A;  1LKY B;  5D63 A;  3WK4 A;  3I28 A;  4DQI A;  2W3S A;  5ALJ A;  3MDC A;  3ERC C;  4MEY A;  5AKZ A;  3WK7 A;  3Q8K A;  2DPI A;  4IQT A;  5CFT A;  5KG5 A;  4WC1 A;  1COO A;  1GO3 F;  1HUO A;  4B9L A;  2DR9 A;  1FA0 A;  5EE0 A;  9ICG A;  5KFZ A;  2ZHA A;  4B9U A;  3HJ4 A;  5KFK A;  3JPS A;  4I2H A;  2NRT A;  4U7C A;  5KG7 A;  2ZIW A;  1BPX A;  3M1Y A;  1WOT A;  1TV9 A;  2MU2 A;  3IRU A;  3H8M A;  4NWI A;  1PVR A;  4KLH A;  1J2N A;  3MC1 A;  8ICH A;  4WBY A;  4JB3 A;  4DFM A;  4UBC A;  5CB1 A;  1L3V A;  5HRG A;  1T94 A;  2BHN A;  2KNJ A;  2ZIU B;  2DKX A;  1S97 A;  2MA1 A;  4O69 A;  4O3N A;  1ZQ1 C;  2G08 A;  2IUB A;  3OJU A;  3QUT A;  2A1J B;  3D6J A;  1NZB A;  2L5Y A;  4EGW A;  3FYH A;  2GAF D;  3HKZ F;  4PHA A;  4I27 A;  2LPE A;  2BBH A;  1NK5 A;  1JI7 A;  1PK1 A;  1NK4 A;  4UAY A;  3MGH A;  1FO4 A;  1U48 A;  2C22 A;  4O6A A;  4OJ5 A;  2JGA A;  3PST A;  2W9C A;  4LZD A;  5KT5 A;  4OJL A;  1J2M A;  4FHV A;  2MAX A;  1Z1V A;  2DWQ A;  3MAB A;  5KG3 A;  5KFO A;  4IRC A;  1ZQR A;  1ZD2 P;  3BQ1 A;  2DR8 A;  4ICA A;  1XSN A;  2KJ8 A;  1MQ2 A;  2ZH8 A;  3QU5 A;  2HCF A;  2RHF A;  4RWP A;  4ECT A;  4DQP A;  4C80 A;  7ICR A;  4NXU A;  4F5N A;  5AI4 A;  1NJY A;  4DCC A;  4B9T A;  5L1M A;  4KMU A;  4UAU A;  1L3T A;  4EBD A;  2DR7 A;  1X9W A;  1SZH A;  3PSI A;  2O6K A;  1WYG A;  3C2M A;  9ICI A;  2W9B A;  3IDW A;  4O3O A;  3HT3 A;  4P2H A;  2HHP A;  1L3U A;  4WC2 A;  4YP3 A;  4ECX A;  1NK8 A;  4NKT A;  2FPL A;  3M8S A;  2JHD A;  4ECR A;  2OHF A;  1KRP A;  5JTG A;  3EYZ A;  1B4F A;  1ZQL A;  4LEZ A;  4Y2Y A;  3RJJ A;  2E5S A;  2NYV A;  4BDP A;  4OJP A;  5G5G A;  4UAZ A;  2ZH3 A;  3PX0 A;  3C21 A;  4B9M A;  2NO5 A;  1Z3E B;  3QE9 Y;  2KEY A;  4OAH A;  3ONN A;  5KG2 A;  1BNO A;  2ESE A;  1TKD A;  4PPX A;  4PL2 A;  3ER8 C;  4OO1 J;  3JPR A;  4AT9 A;  1FFV A;  4IQV A;  2HBM A;  2G5I B;  1IXR A;  3KFU F;  2J6U A;  2XY5 A;  3PVX A;  1OUQ A;  2PI5 A;  2LI6 A;  3Q8R B;  5KFW A;  4FH5 A;  4KLO A;  1MIY A;  3NVZ A;  1ZQG A;  2KVC A;  4DSJ A;  1VFG A;  2PKE A;  5HRD A;  1S8O A;  4KN7 A;  3H4D A;  3BZC A;  1U47 A;  4RQ1 A;  5AI0 A;  3N7P D;  4UAW A;  7ICJ A;  4UQG A;  1TAQ A;  1ZD3 A;  3F5A A;  4FE3 A;  3R9K A;  1ZQS A;  2WB1 C;  3EPG A;  3EZ5 A;  3WKD A;  4WJ3 B;  3ISB A;  4K8V A;  4J9P A;  3OVS A;  5AI8 A;  2W9M A;  4M6W B;  5KFX A;  2UVV A;  3PO5 A;  3LVW A;  1ZQK A;  4M9J A;  4B6J A;  4BXO B;  3H38 A;  2NV3 A;  4K97 A;  3WU2 U;  1SL2 A;  2EH9 A;  4F8R A;  2KD1 A;  3BJY A;  3F2B A;  5J2B A;  2UVU A;  4F71 A;  1MN8 A;  2XY6 A;  5AKH A;  5HHH A;  4R66 A;  2XC9 A;  3C2L A;  5J2G A;  4J9R A;  4HX0 A;  3HRD D;  1XU4 A;  3QUB A;  4RPX A;  2F8L A;  4C4S A;  1BGX T;  4UB3 A;  3BZK A;  1AQ6 A;  3GIM A;  3TFR A;  5C0Y A;  3UMG A;  1ZD4 A;  1NOM A;  3AU2 A;  4LEV A;  2K4E A;  3OPX A;  3SMV A;  5TZV A;  3L4P A;  4UD4 A;  4UAT A;  8ICO A;  4AT7 A;  4BUG A;  4KLM A;  4OAI Z;  4K4I A;  8ICU A;  3NRW A;  4X4T A;  4Y2T A;  2C2R A;  4RPZ A;  3PNC A;  2KFZ A;  2AQ4 A;  4DEZ A;  4GC6 A;  3K4G A;  3RR8 A;  1RYS A;  3TFS A;  4P0P A;  4TUP A;  3M9O B;  5EE1 A;  1SKR A;  3LYS A;  5AKY A;  4MKP A;  2W9C B;  4AP9 A;  3MDA A;  3HP6 A;  5AIC A;  3MFH A;  4EEB A;  4IRK A;  4DFJ A;  3NRZ A;  1A0P A;  1MA7 A;  2BQR A;  3K75 D;  4K99 A;  1L7O A;  2KKP A;  8ICA A;  3QZ8 A;  1TVA A;  4I2E A;  7ICQ A;  3NS1 A;  4RWQ A;  4IC9 A;  1NK6 A;  2ZIX A;  4QZD A;  8ICG A;  4NY8 A;  2OXO A;  2O1P A;  1ZJN A;  2W55 A;  3PSF A;  2JEF A;  3SI8 A;  7ICI A;  1PZN A;  3GV8 B;  4DQS A;  5TIS U;  4A8E A;  1NK7 A;  3TAN A;  1R8A A;  2EAN A;  1UT8 A;  1KSP A;  1NKC A;  5CRX A;  4AT7 B;  1QH9 A;  4NKU A;  3H0R B;  3AQK A;  5CR0 A;  4M9H A;  2EAM A;  3G6V A;  4X4Q A;  2Q4T A;  5ALW A;  2NRX A;  3QUC A;  8ICX A;  9ICM A;  7ICV A;  1V85 A;  3IG8 A;  3MR2 A;  5CA7 A;  2ZH4 A;  4NM2 A;  4NJ8 A;  3AQL A;  3LK9 A;  1ZJM A;  9ICH A;  4QW8 A;  5B3Q A;  5KFP A;  4B9N A;  4QIW F;  2AGP A;  2CPR A;  2J6T A;  5F9N A;  4R63 A;  4YMM A;  1JAJ A;  4PL1 A;  4ECQ A;  2XID A;  3N7S C;  1COK A;  2BBJ A;  5EWE A;  4X4S A;  3PW5 A;  4WC5 A;  5KTQ A;  5JRT A;  4QZE A;  1RG6 A;  3NTU A;  3GIL A;  4EEY A;  3V6K A;  8ICB A;  5AI9 A;  1CI4 A;  3RFA A;  4FHY A;  4M6W A;  2LKY A;  1B22 A;  2IOF K;  4DSI A;  4NLC A;  4I2J A;  5D46 A;  2W43 A;  7ICM A;  1CRX A;  2YB4 A;  5J2E A;  4Z6D A;  1X9M A;  1T7P A;  2R8H A;  4QW9 A;  4LZG A;  2ZTC A;  5DGB A;  3F2C A;  4CCH A;  4WC3 A;  4EYH B;  3PSP A;  1PK3 A;  3I1Y A;  3IV6 A;  4K4G A;  4FBU A;  1BPD A;  3SQI A;  9ICP A;  3JPO A;  4F50 A;  4PHD A;  4FHX A;  4TUQ A;  5DB8 A;  2HDO A;  1C20 A;  1ZQF A;  7ICU A;  4KLT A;  4O68 A;  1Q46 A;  3RAX A;  5AK6 A;  2VKQ A;  2K60 A;  2ZH7 A;  2YN4 A;  4F5Q A;  4AT8 A;  5ALZ A;  3ZD8 A;  7ICE A;  4UAS A;  4EEL A;  1ZQP A;  2W8K A;  3ZI4 A;  3PX6 A;  5AK5 A;  4FFD A;  5IIN A;  1S77 D;  1WCN A;  1A77 A;  2BCR A;  1A76 A;  4ACO A;  4O3M A;  5KL1 B;  1UET A;  5DG8 A;  1DK3 A;  4EX6 A;  2UVW A;  2BQU A;  1KEJ A;  3GU3 A;  5B66 U;  2AU0 A;  4MFF A;  2VA8 A;  3SAH A;  4J9L A;  2NRW A;  1N63 A;  5D49 A;  2GO7 A;  4X4O A;  4UAR A;  2HHX A;  5AM4 A;  5DB6 A;  5HNK A;  2V4Q A;  4J9S A;  4KX5 A;  4MF2 A;  2LM4 A;  5C5J A;  3V7K A;  3UM9 A;  3SR6 A;  3FDS A;  5IIO A;  2H3Q A;  4PH5 A;  3JPN A;  3JCF A;  5J2I A;  3PR5 B;  1N56 A;  3SYZ A;  3G6X A;  2FJ6 A;  1Z1B A;  2KHV A;  1LV5 A;  5JU5 A;  5IIL A;  1Q79 A;  4LT6 A;  3NVW A;  4MFC A;  4FS1 A;  3MGI A;  2DGZ A;  3KTQ A;  1S0V A;  3LQC B;  2W9B B;  4F5P A;  4K98 A;  4RNN A;  1H38 A;  4O3Q A;  2ALZ A;  1NK0 A;  4I2G A;  4EP7 A;  4FHP A;  5KT4 A;  4US8 A;  2VAN A;  1U4B A;  4ZH4 A;  5AKI A;  1QLN A;  5ALS A;  2ZH6 A;  2HOF A;  1KKX A;  1L8L A;  3OVB A;  1RPL A;  4BWJ A;  2H3V A;  4YD2 A;  4DS4 A;  2RFF A;  2G07 A;  7ICN A;  3ZDD A;  4O5C A;  2JXJ A;  1NKE A;  4C0Z A;  4Z6E A;  4RQ4 A;  3NGD A;  3C29 A;  2PXI A;  2HHV A;  4YXM A;  9ICO A;  2XIC A;  3NVO A;  2G5H B;  3N97 B;  1TE2 A;  4QZF A;  1QQ5 A;  1UA1 A;  4Y2S A;  3H8W A;  1KQQ A;  2PFP A;  2WAQ F;  4DOA A;  1LVH A;  1Q3V A;  2CN1 A;  4C4R A;  2P6U A;  1F44 A;  5AM0 A;  2FPK A;  1DRG A;  1MIV A;  4OAF A;  1NKB A;  5J8Y A;  4ATB A;  2B4V A;  4GIB A;  3AQF A;  4DL2 A;  3QZ7 A;  2ZIW B;  5KFI A;  4JK1 A;  5KL8 B;  4UAV A;  1D8Y A;  1DGJ A;  4RQ6 A;  4DFK A;  2JH1 A;  3ALR A;  4DF4 A;  3HKZ C;  3OVA A;  1SKS A;  2YY6 A;  5F3X B;  4ED2 A;  1RQN A;  4PZO A;  1ZQY A;  3DV9 A;  4J03 A;  2PBE A;  4R64 A;  5CP2 A;  5CHG A;  1SXD A;  1XO1 A;  3C28 A;  2BE3 A;  2KSO B;  5KFF A;  3WFS C;  5AM3 A;  4RQ5 A;  2ZTE A;  3KKA C;  5DBB A;  2Z7J A;  4UD5 A;  2JR5 A;  1SL1 A;  2EZZ A;  1S10 A;  4OAG A;  1ARO P;  2WHE A;  3EWA A;  1O03 A;  4NLB A;  2ZIV A;  4F3O A;  5KFE A;  2AGO A;  2BQ3 A;  2ZJ8 A;  3AEV A;  2IBK A;  2HOQ A;  2H5X A;  4RZR A;  1V97 A;  2E8O A;  4I29 A;  5KG4 A;  4FS2 A;  4DOB A;  2Y1I A;  5HR9 A;  1B43 A;  4IG8 A;  3GV5 B;  1SL0 A;  4E0D A;  9ICV A;  3TAQ A;  5DDY A;  2J6S A;  1PX5 A;  3TAP A;  1UCV A;  5DG9 A;  4JLZ A;  4JV1 A;  3WK5 A;  3OTQ A;  1TFR A;  4DL4 A;  4IR1 A;  1Z4N A;  2XCP A;  1RDF A;  7ICG A;  4O5K A;  1RYU A;  3AQE A;  2BDP A;  2DRB A;  1S0O A;  3I76 A;  5HMM A;  4Z6C A;  4OCZ A;  1JUD A;  2KG5 A;  1FFU A;  2ZXI A;  2KZZ A;  3KHR A;  3SZ2 A;  1HUZ A;  3UMB A;  1QTM A;  4Y2U A;  3QXG A;  4ATB B;  1A6S A;  7ICP A;  1F0M A;  4WC7 A;  4XRH A;  4EZ9 A;  3L9D A;  4I0U A;  3ETL A;  4YD1 A;  2OH2 A;  5AK4 A;  4C8K A;  2VA3 A;  4DL3 A;  2F44 A;  4MEX A;  2WFA A;  1Q8K A;  5L1K A;  4DF8 A;  4UBB A;  2HHS A;  1JXL A;  2M2U A;  5IIM A;  4DL7 A;  2FE9 A;  2HN1 A;  4F72 A;  5AIB A;  2PFQ A;  4LEW A;  3VC8 A;  2VJ4 A;  4K9B A;  2C28 A;  2ZUC A;  5FP0 A;  1JX4 A;  4DSL A;  4O0I A;  3Q8P B;  4B9S A;  3AM9 A;  1Z00 A;  4AYB C;  9ICN A;  4PHE A;  1IV8 A;  1F5S A;  4DLE A;  3RRH A;  2VJ5 A;  2E1F A;  5K4L A;  2HHQ A;  1MQ3 A;  4FH3 A;  5KFG A;  2HW3 A;  1L7M A;  2A19 A;  2MRL A;  3SAG A;  1KTQ A;  4RT3 A;  5J29 A;  3JZ0 A;  3WFO A;  1N5X A;  5J2D A;  5DED A;  4O3R A;  4F4Z A;  1VJ7 A;  4EV6 A;  1UEV A;  1V4A A;  4C8M A;  2M9N A;  2EWR A;  3ICX A;  2A1A A;  3HJ1 A;  1UPH A;  3T5H A;  3IN5 A;  3HPO A;  4DSE A;  4NL9 C;  4TUR A;  1JRO A;  1KLN A;  1T8E A;  1NJW A;  3WKA A;  1J97 A;  5KFJ A;  3MR5 A;  3RJF A;  4QWD A;  2KN7 A;  4CF3 A;  4FHW A;  2HBK A;  3TAD C;  1ZQQ A;  5AM1 A;  2W9A A;  4Q44 A;  2EAP A;  1T3N A;  5DLF A;  3BS5 A;  3EF2 A;  3SV3 A;  3LDA A;  1NO5 A;  4UB1 A;  2C2D A;  1ZQI A;  2WF5 A;  3V7L A;  9ICL A;  2IHO A;  3IG5 A;  2NRK A;  3ZDC A;  5HRK A;  2NRZ A;  2QAR B;  1WUD A;  3RJG A;  5ALY A;  5DEC A;  1SXE A;  2IHM A;  5ALL A;  1X40 A;  3MFI A;  3M6K A;  5KFR A;  5J0Q A;  9ICU A;  2P35 A;  1BPY A;  3PW7 A;  2M0N A;  4ED8 A;  2ES6 A;  1ZQE A;  5J2F A;  1JRP A;  1X9X A;  1XS9 D;  8ICV A;  4G9B A;  1K1Q A;  4Y2R A;  2ZIX B;  2F8K A;  3G6Y A;  4ELT A;  4NLG A;  4F5O A;  2IMW P;  1YLQ A;  2KZ3 A;  4K96 A;  3H0M B;  4DFD A;  1MSW D;  3EUB 2;  4EEK A;  1NJX A;  4USA A;  2RP5 A;  3T5J A;  2W3R A;  1OXJ A;  5AKK A;  3B0Y A;  4HYK A;  5CHE A;  3RRG A;  5D61 A;  1ZQD A;  2R8G A;  2IOF A;  1Z19 A;  3KKA A;  5KAF U;  4AT8 B;  2EZY A;  2XGP A;  2KHQ A;  2IHN A;  2UVR A;  3WKE A;  3N4M B;  5DB9 A;  5J2C A;  2NRV A;  5J0W A;  1IIP A;  2HHU A;  2DBY A;  3ISC A;  2B6G A;  4I2B A;  3N28 A;  4X0B A;  5ALH A;  5CEH A;  1C7Y A;  5E79 U;  4I2F A;  3OGU A;  4JWN A;  3RB4 A;  2BCS A;  2F3N A;  2DRA A;  2BPG A;  2AQ0 A;  3PW0 A;  2H3F A;  9ICW A;  4P4M A;  2ZUB A;  2F1J A;  5ALK A;  1BPZ A;  2HSZ A;  2LYA A;  4ED3 A;  4KLG A;  1IG6 A;  4M04 A;  2ASD A;  2KIW A;  1N5W A;  1DGS A;  1GPJ A;  4I2C A;  3H0L B;  3WFP A;  4UB2 A;  2A1J A;  1NI3 A;  5BOL A;  1NZP A;  3S6J A;  4IQU A;  4IR9 A;  3TAC B;  4M9G A;  5HRH A;  5KFB A;  4R8U A;  1R8C A;  2QLT A;  2JRZ A;  4RNM A;  1KFS A;  2D3D A;  5D4B A;  5DBA A;  4EBK A;  3AQM A;  4OJO A;  5ALQ A;  1HIW A;  1UHU A;  8ICM A;  2BGW A;  2XCA A;  3FC4 A;  4KX3 A;  1S0N A;  1MIW A;  4CRX A;  4UW9 A;  3GQC A;  4PGY A;  3KD3 A;  5KFN A;  2W7O A;  2G09 A;  4F4W A;  2W8L A;  4K9A A;  2LMR A;  1BPE A;  7ICK A;  1VDV A;  4R8U B;  5GTI U;  3EPI A;  2ID1 A;  2JZB B;  4RQ8 A;  1QCK A;  5J0S A;  9ICJ A;  4O3P A;  4KN4 A;  4ECS A;  2WF8 A;  2HI0 A;  3OV7 A;  3PZP A;  4ZOH C;  1QSL A;  2OCE A;  4LEY A;  1V38 A;  9ICS A;  4KLD A;  4WQL A;  2LYB A;  3Q8Q B;  5BPC A;  4RWO A;  4MF8 A;  8ICI A;  3WK9 A;  1D8L A;  4FZM A;  3SEN A;  5KNI A;  7ICL A;  1NNL A;  3IHQ B;  4DQR A;  1ZQB A;  2FLN A;  1Q3U A;  4KM5 A;  2RDI A;  1XNS A;  2FI1 A;  4ED6 A;  5DDM A;  2R8I A;  1ZYQ A;  3H8S A;  4EZ6 A;  1KN5 A;  4EEN A;  5ALG A;  3PHZ A;  3GII A;  5CFU A;  2KP7 A;  4I2I A;  1YZ6 A;  2PI4 A;  3MCR A;  2KIV A;  3ER9 B;  1D9D A;  3BQT A;  2ZH1 A;  4QWB A;  4YMO A;  4DL6 A;  3AL0 B;  4WC0 A;  4DL5 A;  3UMC A;  2ZIV B;  4P0P B;  1SIJ A;  1ZRN A;  2GA9 D;  4DSK A;  1ED1 A;  4DLG A;  2KZM A;  3H37 A;  4ED7 A;  3PV8 A;  2H3I A;  3M7D A;  4O9M A;  4XQ8 A;  3AQN A;  1KL9 A;  3BS5 B;  2BKE A;  5KT7 A;  5KFT A;  2HVI A;  2PFO A;  3CW2 C;  5ALE A;  5EWF A;  3C23 A;  4C4T A;  4DSF A;  3NAS A;  3AN1 A;  4YQW A;  4GXJ A;  4RQN A;  4M47 A;  3J81 j;  3T79 A;  3AMZ A;  2AH5 A;  2BPF A;  1S5L U;  2W7P A;  3L5K A;  3RR7 A;  1N61 A;  1ZQA A;  4EYI B;  3CRX A;  1ZRM A;  2ZHB A;  5AKL A;  5AM5 A;  2WF7 A;  4YN4 A;  2K8A A;  1HEK A;  4N7R A;  2W11 A;  1PVQ A;  4Q8E A;  5KFV A;  4DO9 A;  4LVS A;  4YXJ A;  1X2I A;  3V72 A;  2YX8 A;  4QWC A;  1XO0 A;  2MUT B;  4O5E A;  2LYH A;  4BX9 C;  3H8J A;  4E8F A;  4WOY A;  7ICT A;  4KLE A;  2XY7 A;  5DGA A;  8ICY A;  5KFL A;  4WCW A;  4KLF A;  1ZD5 A;  2RDJ A;  5DB7 A;  3H3A A;  3DDH A;  4YFK A;  2ZTD A;  5KFQ A;  2LBO A;  3OHA A;  2WAQ C;  3K7D A;  2G0A A;  1ZQZ A;  9ICF A;  2V9W A;  2ZIU A;  4M5D A;  3CYM A;  4QZA A;  3BQ2 A;  4FZL A;  4EX7 A;  2Y0S C;  1JMS A;  3PX4 A;  2YTU A;  3H4B A;  1S9F A;  5ALM A;  4JWM A;  2K8C B;  3QEB Z;  2OYY A;  4KMO B;  1XSP A;  2NO4 A;  3TKA A;  3GDX A;  4F4Y A;  2E3T A;  3V6H A;  4ELV A;  5J2H A;  2C2E A;  3D2N A;  4EBE A;  1BNP A;  4F2S A;  9ICE A;  3RAQ A;  4DWI A;  9ICR A;  8ICW A;  2O5A A;  2PMZ F;  5ALT A;  4Y2J A;  1IM4 A;  1UEU A;  3A0H U;  4TUS A;  4F93 B;  3FAH A;  3C66 A;  4WBZ A;  4RNO A;  1QSY A;  4FO6 A;  4I2A A;  2KVS A;  3D2Q A;  5KG6 A;  4M9L A;  1WG8 A;  4XA5 A;  5KT6 A;  1Z4O A;  4YG2 A;  1LKY A;  4RPY A;  2KK0 A;  4X4R A;  4YVZ A;  3WK6 A;  3KHH A;  2ASL A;  9ICX A;  2HHW A;  3QU7 A;  2KTQ A;  4QIW C;  1JQR A;  2M2V A;  3Q8M A;  1SV4 A;  3NKU A;  2XO7 A;  3HWT A;  5ALU A;  5F2V O;  1TFY A;  3MR6 A;  5AKX A;  5AHX A;  2Y1J A;  4Y2V A;  4QWA A;  4K4H A;  4Y2P A;  4RQM A;  4PZN A;  3LVV A;  1PUZ A;  1YZ7 A;  2ATL A;  4P0Q A;  1BPB A;  4WH5 A;  5AK3 A;  4XJE A;  4KLQ A;  4P0Q B;  1K1S A;  4HAI A;  4KLU A;  3C2K A;  1U9L A;  3GFK B;  1ECW A;  1RXW A;  2W54 A;  2B56 A;  4J9K A;  3QU9 A;  3THV A;  2I6X A;  3KZX A;  3AU6 A;  3TQ1 A;  7ICS A;  3QEA Z;  4KLJ A;  2W03 A;  3N7R C;  2ASJ A;  1L5U A;  3C5G A;  3NUQ A;  3SEI A;  2PMZ C;  2DFL A;  4ED0 A;  2RRD A;  5ALX A;  3V6J A;  4NXT A;  2HBL A;  4US9 A;  2DVI A;  3RF9 A;  1TAM A;  2AHO B;  4KIT B;  4ECV A;  5DKW A;  3ZDB A;  1S0M A;  1SV0 C;  3QNM A;  5DQG A;  4NLN A;  4KLS A;  5B5E U;  3QX7 A;  5AKE A;  3GIK A;  1ZQJ A;  5ALD A;  4Q43 A;  3D2S A;  2Y9T A;  5HP4 A;  3BS7 A;  2H3Z A;  1QQ6 A;  4NXV A;  3UXO A;  3RJI A;  3PW2 A;  4KTQ A;  2KMD A;  1Y88 A;  3Q8S B;  3T5K A;  3KZI U;  1ZQX A;  4GC7 A;  3ETR A;  1HJP A;  2E1E A;  7ICF A;  3UXN A;  4Q8F A;  2AGQ A;  5KT3 A;  4F4K A;  3RH5 A;  2DF4 B;  2YMM A;  4P4O A;  5ALV A;  2G06 A;  1UA0 A;  1F5A A;  4UB6 U;  3QU2 A;  1U45 A;  3TAD A;  4F5R A;  4NLZ A;  2E8M A;  3K1R B;  5J8Y C;  3U26 A;  4RQ7 A;  1KNY A;  3RH6 A;  1KW4 A;  1UT5 A;  2R8J A;  3SD7 A;  5J2K A;  3ISD A;  4P4P A;  2I5H A;  4QZG A;  9ICC A;  2GH1 A;  1RM6 C;  1JXE A;  1SZP A; 
#chains in the Genus database with same CATH homology
 2ZTC A;  5DGB A;  4CCH A;  4WC3 A;  5KG1 A;  4EYH B;  3UXP A;  1XSL A;  4AT8 B;  2Q66 A;  3TI0 A;  5CWR A;  3C5F A;  3C1Y A;  2XGP A;  2I1Q A;  4K4G A;  3HW8 A;  2IHN A;  4J9M A;  1BPD A;  4PHP A;  4QZB A;  2UVR A;  4FBU A;  3N4M B;  5DB9 A;  5J2C A;  9ICQ A;  2MUT A;  4S3N A;  9ICP A;  3JPO A;  1T4G A;  4PHD A;  2NRV A;  5J0W A;  4F50 A;  1MC8 A;  5HML A;  2JZB A;  8ICK A;  4TUQ A;  4FHX A;  3C18 A;  2HHU A;  3ISC A;  8ICT A;  5DB8 A;  4AT9 B;  4ECZ A;  2P66 A;  1TAU A;  1ZQF A;  2BCQ A;  4I2B A;  2FMP A;  2P6R A;  4LZG A;  4I28 A;  4ELU A;  7ICU A;  4KLT A;  4X0B A;  3RAX A;  8ICL A;  3WFQ E;  1C7Y A;  1NK9 A;  2ZH2 A;  5KFA A;  3UPQ A;  3OGU A;  4DFP A;  4I2F A;  4JWN A;  2ZH7 A;  3RB4 A;  2BCS A;  4F5Q A;  4DQI A;  2DRA A;  2BPG A;  4AT8 A;  3ZD8 A;  2AQ0 A;  3MDC A;  4F2R A;  7ICE A;  3PW0 A;  4WC4 A;  4MEY A;  9ICW A;  3Q8K A;  4P4M A;  1ZQP A;  1OU5 A;  2ZUB A;  4IQT A;  5J0O A;  5KG5 A;  2DPI A;  1COO A;  2F1J A;  2W8K A;  4WC1 A;  1HUO A;  1BPZ A;  3PX6 A;  4B9L A;  2DR9 A;  1FA0 A;  4ED3 A;  4KLG A;  5IIN A;  1S77 D;  9ICG A;  4M04 A;  5KFZ A;  5DBC A;  1WCN A;  2ASD A;  5HRF A;  2ZHA A;  1A77 A;  2BCR A;  1A76 A;  5KFK A;  2FMS A;  4B9U A;  3HJ4 A;  3JPS A;  1DGS A;  4I2H A;  1UET A;  5DG8 A;  2NRT A;  4I2C A;  1DK3 A;  2UVW A;  2JEJ A;  2BQU A;  1KEJ A;  5F9L A;  3WFP A;  5KG7 A;  4UB2 A;  2BR0 A;  2A1J A;  1BPX A;  5BOL A;  2AU0 A;  1NZP A;  4MFF A;  1WOT A;  2VA8 A;  4IQU A;  2V4R A;  4IR9 A;  1JIH A;  1TV9 A;  4M9G A;  5KFB A;  2NRW A;  4R8U A;  4J9L A;  5HRH A;  1R8C A;  4KLI A;  5HRE A;  5D49 A;  4RNM A;  4KLH A;  1KFS A;  3RH4 A;  8ICZ A;  4X4O A;  4E7X A;  3EW9 A;  5D4B A;  5DBA A;  2HHX A;  3HIY A;  5DB6 A;  4EBK A;  3AQM A;  3NYB A;  3PMN A;  5HNK A;  2V4Q A;  4RQ2 A;  8ICH A;  4J9S A;  8ICM A;  4WBY A;  3OHB A;  2BGW A;  4DFM A;  2XCA A;  5C5J A;  4MF2 A;  1CEZ A;  4UBC A;  5CB1 A;  3UQ2 A;  1L3V A;  4B9V A;  2BPC A;  3PML A;  5HRG A;  2BHN A;  1S0N A;  1ZQO A;  3V7K A;  1MIW A;  3ZD9 A;  3FDS A;  3RJE A;  1R89 A;  3GQC A;  5IIO A;  1S97 A;  4PH5 A;  4PGY A;  1XWL A;  3JPN A;  5KFN A;  4UB5 A;  5J2I A;  3PR5 B;  1TK0 A;  4F4W A;  1N56 A;  4O3N A;  3SYZ A;  3G6X A;  5KG0 A;  5CJ7 A;  3OJU A;  2A1J B;  2W8L A;  1LV5 A;  3PO4 A;  2FLL A;  4JV2 A;  3FYH A;  4Z6F A;  1Q78 A;  4PHA A;  1BPE A;  5IIL A;  7ICK A;  4I27 A;  1Q79 A;  4R8U B;  3BQ0 A;  1NK5 A;  3KHL A;  2ISO A;  4MFC A;  4LT6 A;  3EPI A;  2ID1 A;  2JZB B;  4FS1 A;  4QZ9 A;  4RQ0 A;  2FMQ A;  4XQ7 A;  4X4V A;  4RQ8 A;  3MGI A;  3KTQ A;  1S0V A;  3LQC B;  5J0S A;  1NK4 A;  4UAY A;  3LWL A;  2W9B B;  4F5P A;  9ICA A;  9ICJ A;  4O3P A;  4RNN A;  4GXK A;  4GLX A;  5J0T A;  3KHG A;  5III A;  5EOZ A;  4KN4 A;  3MGH A;  1H38 A;  4ECS A;  1U48 A;  4O3Q A;  2ALZ A;  1NK0 A;  4I2G A;  4YR2 A;  2C22 A;  4EP7 A;  3OV7 A;  4FHP A;  2W9C A;  1QSL A;  5KT4 A;  4LZD A;  2VAN A;  5KT5 A;  9ICT A;  1U4B A;  4ZH4 A;  1QLN A;  9ICS A;  4KLD A;  4BXO A;  4QZC A;  3Q8Q B;  5BPC A;  2MAX A;  4FHV A;  4X4P A;  3OUY A;  4RWO A;  4MF8 A;  2ZH6 A;  8ICI A;  3MAB A;  5KG3 A;  5KFO A;  1D8L A;  1BVS A;  4IRC A;  3OVB A;  7ICL A;  1ZQR A;  1RPL A;  3BQ1 A;  2DR5 A;  4RUA A;  4BWJ A;  3IHQ B;  4PGX A;  4ECY A;  4DQR A;  1XSN A;  1ZQB A;  2FLN A;  2DR8 A;  2RDI A;  1MQ2 A;  2ZH8 A;  4ED6 A;  1ZQV A;  5DDM A;  4YD2 A;  2R8I A;  4DS4 A;  2RFF A;  4RWP A;  7ICH A;  7ICN A;  5EWG A;  4ECT A;  1ZYQ A;  3ZDD A;  4DQP A;  7ICR A;  3H8S A;  4EZ6 A;  4IRD A;  4QZ8 A;  4F5N A;  5DG7 A;  4O5C A;  1RXV A;  8ICJ A;  3ORY A;  1NKE A;  4ECU A;  4RT2 A;  4Z6E A;  4RQ4 A;  3NGD A;  3Q8L A;  1NJY A;  4TQR A;  2PXI A;  2HHV A;  4B9T A;  2M2W A;  4YXM A;  3RBD A;  3GII A;  1RYR A;  9ICO A;  4KMU A;  4I2I A;  2KP7 A;  1L3T A;  3N97 B;  3IM1 A;  1TK5 A;  4QZF A;  4EBD A;  3BDP A;  2DR7 A;  2PI4 A;  5KFM A;  1UA1 A;  2ISP A;  1X9W A;  3H8W A;  1D9D A;  3BQT A;  2PFP A;  4QWB A;  2ZH1 A;  4F4X A;  4YMO A;  4DL6 A;  3TAR A;  4DOA A;  4DOC A;  4ECW A;  2P6U A;  2DPJ A;  1WCL A;  3C2M A;  9ICI A;  2W9B A;  1EXN A;  4J9N A;  4DL5 A;  4WC0 A;  5J0U A;  4X5V A;  2FPK A;  4O3O A;  1ZQW A;  3HT3 A;  4P2H A;  4JUZ A;  2HHP A;  4TQS A;  4DSK A;  1L3U A;  4GXI A;  4DLG A;  1MIV A;  4WC2 A;  4YP3 A;  4ECX A;  2KZM A;  3H37 A;  4ED7 A;  3PV8 A;  5DLG A;  1NK8 A;  1NKB A;  4O9M A;  1U49 A;  4XQ8 A;  3AQN A;  4NKT A;  2FPL A;  4ATB A;  3M8S A;  3QZ7 A;  4DL2 A;  5KFI A;  1ZQM A;  4JK1 A;  4FBT A;  4ECR A;  1D8Y A;  2BKE A;  5KT7 A;  5KFT A;  4UD5 A;  2HVI A;  2PFO A;  3H40 A;  1KRP A;  5EWF A;  3C23 A;  3EYZ A;  4DSF A;  4E80 A;  3GV7 B;  1ZQL A;  1KDH A;  4RQ6 A;  2BCU A;  4DFK A;  2AJQ A;  8ICF A;  4YQW A;  4DF4 A;  1S76 D;  3RJJ A;  4GXJ A;  3OVA A;  5J2A A;  4M47 A;  1SKS A;  4BDP A;  4UAZ A;  2BPF A;  2ZH3 A;  7ICO A;  3PX0 A;  3C21 A;  4B9M A;  1Z3E B;  4ED2 A;  3QE9 Y;  2JEG A;  3OSN A;  1ZQY A;  3RR7 A;  5KG2 A;  1TKD A;  1ZQA A;  4PPX A;  1BNO A;  2PBE A;  4F91 B;  4R64 A;  5L1L A;  4EYI B;  2ZHB A;  3JPR A;  4AT9 A;  4IQV A;  4YCX A;  5CP2 A;  1IXR A;  5CHG A;  8ICQ A;  1XO1 A;  2XY5 A;  2FLP A;  2J6U A;  2BE3 A;  4XUS A;  5KFF A;  3WFS C;  4YN4 A;  3PVX A;  4RQ5 A;  2PI5 A;  2ZTE A;  3JYY A;  5DBB A;  1ZQT A;  4Q8E A;  3SV4 A;  5KFV A;  4KLL A;  4DO9 A;  1SL1 A;  5KFY A;  3Q8R B;  4YXJ A;  1X2I A;  5KFW A;  3V72 A;  1S10 A;  4LVS A;  9ICK A;  4KLO A;  1ARO P;  1MIY A;  4FH5 A;  4DS5 A;  1TFW A;  3EWA A;  1ZQG A;  4QWC A;  4DSJ A;  4F3O A;  4YMN A;  5KFE A;  2AGO A;  2ZJ8 A;  2BQ3 A;  2MUT B;  1VFG A;  1L3S A;  2ZH9 A;  2IBK A;  4O5E A;  2H5X A;  4RZR A;  4I29 A;  2ZH5 A;  2LYH A;  3H8J A;  5KG4 A;  4E8F A;  2IA6 A;  5HRD A;  4KN7 A;  3H4D A;  4FS2 A;  3OJS A;  7ICT A;  4KLE A;  1U47 A;  4RQ1 A;  4UAW A;  2XGQ A;  1KFD A;  2XY7 A;  4DOB A;  2Y1I A;  4UQG A;  5DGA A;  7ICJ A;  5KFL A;  1B43 A;  8ICY A;  8ICP A;  5HR9 A;  4WCW A;  4IG8 A;  1TAQ A;  3GV5 B;  1XC9 A;  1SL0 A;  4E0D A;  4KLF A;  2RDJ A;  5DB7 A;  2I9G A;  9ICV A;  3H3A A;  1ZQS A;  3EPG A;  4YR3 A;  3TAQ A;  3EZ5 A;  4YFK A;  5DDY A;  3JPT A;  2ZTD A;  2J6S A;  5KFQ A;  5J0R A;  2HVH A;  1PX5 A;  3ISB A;  3TAP A;  1LB2 B;  3OHA A;  4J9P A;  5JUM A;  3T5L A;  5DG9 A;  2M2T A;  3OVS A;  1ZQZ A;  5KFC A;  9ICF A;  2V9W A;  9ICB A;  5IIK A;  4JV1 A;  4M5D A;  4QZA A;  3BQ2 A;  2W9M A;  4M6W B;  5KFX A;  4PGQ A;  2UVV A;  4C8O A;  1JMS A;  3PO5 A;  3PX4 A;  1DK2 A;  1TFR A;  3MBY A;  4DL4 A;  5J0P A;  1ZQK A;  3RJK A;  4IR1 A;  3M9M B;  4M9J A;  3RB3 A;  3E2E A;  3H4B A;  4YR0 A;  3B0X A;  1S9F A;  4JWM A;  4BXO B;  2XCP A;  4WC6 A;  4F92 B;  4IQW A;  3QEB Z;  7ICG A;  4O5K A;  3H38 A;  1NJZ A;  5KFS A;  3GIJ A;  2F1H A;  3MR3 A;  2BDP A;  1XSP A;  1QSS A;  2DRB A;  3GDX A;  1SL2 A;  4F8R A;  4F4Y A;  1ZQN A;  3BJY A;  3V6H A;  4ELV A;  5J2B A;  2UVU A;  5KFU A;  5J2H A;  2C2E A;  2VA2 A;  2XY6 A;  1DOQ A;  3PW4 A;  5HMM A;  4Z6C A;  4EBE A;  1S0O A;  1BNP A;  4NXZ A;  4F2S A;  5HRI A;  5HHH A;  9ICE A;  4O3S A;  3H39 A;  5KT2 A;  4R66 A;  3RAQ A;  2XC9 A;  3C2L A;  4R65 A;  5KFH A;  4DWI A;  9ICR A;  8ICW A;  5J2G A;  4I2D A;  3HX0 A;  2KZZ A;  3KHR A;  4J9R A;  3SZ2 A;  2O5A A;  5DQI A;  3H7I A;  1XU4 A;  4MFA A;  1HUZ A;  1QTM A;  3JPP A;  4RPX A;  1IM4 A;  4ATB B;  1UEU A;  4TUS A;  1CUK A;  4F93 B;  7ICP A;  1BGX T;  4UB3 A;  3C66 A;  4WBZ A;  5HHI A;  4RNO A;  3GIM A;  4WC7 A;  1QSY A;  3TFR A;  4XRH A;  4FO6 A;  4I2A A;  5DQH A;  4G3I A;  4EZ9 A;  3L9D A;  2OWO A;  2ZJ5 A;  4M0A A;  1NOM A;  4JV0 A;  5KG6 A;  3ETL A;  2WTF A;  4M9L A;  3AU2 A;  4YD1 A;  4XA5 A;  1TK8 A;  4C8K A;  5KT6 A;  4RU9 A;  1V9P A;  2VA3 A;  4DL3 A;  4MEX A;  3ZDA A;  4YG2 A;  5TZV A;  4RPY A;  5L1K A;  4DF8 A;  4J9Q A;  4UD4 A;  3RTV A;  4X4R A;  4YVZ A;  8ICO A;  4AT7 A;  4KLM A;  4UBB A;  4K4I A;  3KHH A;  2HHS A;  8ICU A;  4X4T A;  2ASL A;  2C2R A;  4C8L A;  9ICX A;  1JXL A;  4RPZ A;  2HHW A;  2M2U A;  5IIM A;  2KTQ A;  3PNC A;  4DL7 A;  1JQR A;  2M2V A;  5L1J A;  3Q8M A;  1ZQD A;  2PFQ A;  3WFR E;  2KFZ A;  2XO7 A;  3HWT A;  2AQ4 A;  4DEZ A;  3JPQ A;  4GC6 A;  1N48 A;  1D9F A;  5F2V O;  1TFY A;  2C28 A;  3MR6 A;  2ZUC A;  3K4G A;  3RR8 A;  1JX4 A;  1RYS A;  3TFS A;  4DSL A;  4TUP A;  4ED1 A;  4O0I A;  3Q8P B;  3M9O B;  2Y1J A;  4B9S A;  4QWA A;  4K4H A;  1Z00 A;  1SKR A;  4C8N A;  2W9C B;  4PHE A;  3RBE A;  9ICN A;  3MDA A;  2B21 A;  3HP6 A;  5J0X A;  3V7J A;  4DLE A;  3OUY B;  2ATL A;  3RRH A;  1BPB A;  3MFH A;  4IRK A;  5HRB A;  4DFJ A;  2HHQ A;  1MQ3 A;  5HRL A;  5L1I A;  4FH3 A;  5KFG A;  2BQR A;  4KLQ A;  1JN3 A;  2HW3 A;  1K1S A;  3T3F A;  3K75 D;  1ZQH A;  1ZQC A;  8ICA A;  1KTQ A;  4RT3 A;  3QZ8 A;  1TVA A;  8ICE A;  4I2E A;  4QWE A;  7ICQ A;  4KLU A;  5J29 A;  3JZ0 A;  3WFO A;  5J2D A;  4RWQ A;  5DED A;  3C2K A;  1NK6 A;  1U9L A;  1Z00 B;  3GFK B;  3OSP A;  4O3R A;  4QZD A;  1RXW A;  4NY8 A;  8ICG A;  8ICS A;  1KFT A;  4J9K A;  1SKW A;  2KFN A;  1ZJN A;  2O1P A;  4QZI A;  4F4Z A;  3THV A;  8ICC A;  3AU6 A;  3TQ1 A;  1VJ7 A;  7ICS A;  3QEA Z;  4KLJ A;  1UEV A;  1V4A A;  4C8M A;  2M9N A;  4X0A A;  5IIJ A;  2JEF A;  3SI8 A;  3RB6 A;  2ASJ A;  1L5U A;  3PY8 A;  3HJ1 A;  3C5G A;  3T5H A;  7ICI A;  1PZN A;  4QZH A;  4M9N A;  3GV8 B;  3HPO A;  2DFL A;  4DQS A;  4DSE A;  4ED0 A;  4TUR A;  1NK7 A;  3TAN A;  1KLN A;  1R8A A;  1T8E A;  1NJW A;  5J0Y A;  3V6J A;  1UT8 A;  1KSP A;  2R8K A;  2R8G A;  5KFJ A;  3MR5 A;  1RZT A;  1NKC A;  2GWS A;  3RJF A;  2DVI A;  4QWD A;  4AT7 B;  2ZUD A;  2KN7 A;  4KIT B;  3UQ0 A;  4ECV A;  4FHW A;  5DKW A;  1ZQQ A;  3ZDB A;  3AQK A;  4NKU A;  1S0M A;  2W9A A;  5CR0 A;  4Q44 A;  4UB4 A;  4M9H A;  1T3N A;  5DQG A;  4NLN A;  8ICN A;  5DLF A;  3RB0 A;  3G6V A;  4X4Q A;  3M9N B;  4KLS A;  3SV3 A;  2NRX A;  3LDA A;  1NO5 A;  8ICX A;  4UB1 A;  2C2D A;  1ZQI A;  9ICM A;  7ICV A;  3MR2 A;  5CA7 A;  3GIK A;  4NM2 A;  1ZQJ A;  3RJH A;  3AQL A;  2ZH4 A;  4Q43 A;  3V7L A;  3LK9 A;  9ICL A;  1ZJM A;  9ICH A;  5HP4 A;  4QW8 A;  5KFP A;  2NRK A;  3ZDC A;  5HRK A;  3UXO A;  5KFD A;  3RJI A;  3PW2 A;  4KTQ A;  4B9N A;  1Y88 A;  2NRZ A;  2FPM A;  3Q8S B;  4RUC A;  2AGP A;  2BCV A;  2PFN A;  3RJG A;  3T5K A;  2J6T A;  5DEC A;  1ZQX A;  2IHM A;  4GC7 A;  5F9N A;  5J2J A;  4R63 A;  4X4U A;  1HJP A;  4YMM A;  3MFI A;  3C1Z A;  4NM1 A;  7ICF A;  1JAJ A;  3UXN A;  4BWM A;  3ZDE A;  4Q8F A;  1R8B A;  2AGQ A;  8ICR A;  4ECQ A;  2ZJA A;  5KT3 A;  4F4K A;  3UPS A;  3RH5 A;  5KFR A;  5J0Q A;  9ICU A;  5EWE A;  3M8R A;  2JEI A;  4P4O A;  3PW5 A;  4WC5 A;  4BGD A;  4X4S A;  1UA0 A;  5KTQ A;  1BPY A;  4RQ3 A;  4QZE A;  1F5A A;  3GIL A;  3NTU A;  5BOM A;  4ED8 A;  4EEY A;  3PW7 A;  1U45 A;  4M2Y A;  4J9O A;  4F5R A;  1ZQE A;  5J2F A;  4EBC A;  3V6K A;  1XS9 D;  4NLZ A;  8ICB A;  8ICV A;  1K1Q A;  4X4N A;  4FHY A;  1X9S A;  4M6W A;  5L9X A;  3G6Y A;  4ELT A;  3LWM A;  1B22 A;  4RQ7 A;  4NLG A;  4F5O A;  1KNY A;  3RH6 A;  4DSI A;  2IMW P;  1YLQ A;  4EBJ A;  2KZ3 A;  3PR4 A;  2HHT A;  4I2J A;  1UT5 A;  5D46 A;  2R8J A;  2Q0Z X;  7ICM A;  1MSW D;  1NJX A;  5J2K A;  3ISD A;  3T5J A;  3AUO A;  4RWN A;  5J2E A;  4P4P A;  5HC9 A;  2F1I A;  1ZQU A;  3B0Y A;  4Z6D A;  4HYK A;  4QZG A;  1X9M A;  1T7P A;  9ICC A;  2R8H A;  3RRG A;  4NLK A;  1JXE A;  4QW9 A;  4DQQ A;  4Q45 A;  1SZP A;  1ZET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...