4GXKA

R283k dna polymerase beta ternary complex with a templating 8og and incoming datp analog
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
326
structure length
316
Chain Sequence
b'TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title DNA polymerase minor groove interactions modulate mutagenic bypass of a templating 8-oxoguanine lesion.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 112
structure length 316
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4gxkA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4gxkA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4gxkA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4gxkA03
2A1JB 4ECUA 1MQ3A 4DL2A 8ICHA 5DB9A 4NM1A 9ICTA 3OJSA 4PHEA 4DSIA 4JWNA 3AUOA 5BOMA 2ALZA 1NKCA 4YXMA 4RUAA 5L1KA 5IIJA 8ICEA 3BQTA 4PHAA 4E8FA 8ICMA 1NKBA 4DFJA 4WC3A 1KFDA 2GWSA 5DEDA 3OVSA 4RPYA 2HHTA 5KFTA 1QLNA 4PH5A 1XSPA 4P4MA 2XY6A 7ICRA 1OU5A 4MEYA 1ZQDA 4B9SA 4PGQA 4KLJA 1T3NA 4KLUA 2KTQA 3HP6A 4QZDA 4RPXA 7ICEA 3C23A 3TFRA 4QWCA 1ZQTA 2R8GA 8ICNA 3LQCB 3RJEA 5J2CA 3PX4A 4QZBA 1U48A 2VANA 3HWTA 1JXEA 2C2DA 2HHXA 2KZ3A 4O0IA 3GQCA 2HHUA 1KNYA 3JPPA 4MEXA 3EWAA 2ISOA 3ZDCA 2HHWA 4NM2A 1DK2A 1BPEA 4FHYA 5DG7A 3EW9A 5KG4A 5J2IA 3JPRA 5DDYA 3WFRE 1ZQLA 1TFRA 5EWEA 4Q44A 4IR1A 3M9NB 3ZDAA 3AQMA 7ICUA 4O3SA 4NKTA 5KFQA 4KLFA 1JX4A 5TZVA 5KFNA 4GXJA 3LDAA 4KLLA 1VFGA 1V9PA 1MIWA 4DFKA 5KFSA 9ICPA 3RRHA 2DFLA 2M9NA 4PGXA 3LWLA 3HW8A 9ICUA 4E7XA 4AT7A 4ECSA 4DLEA 4EEYA 1TK5A 1U47A 1AROP 3FDSA 1SZPA 5KFGA 4YN4A 1UT5A 5J0OA 3KHRA 2IA6A 2R8KA 2C2EA 5DQIA 4JV2A 9ICWA 4GLXA 2ZUBA 4KITB 1BPXA 5HRLA 5DG8A 3ZD9A 2HVHA 5F9NA 3N97B 2ZHAA 5J0TA 5J2HA 4X5VA 1ZQEA 4J9OA 3C2MA 4YCXA 4RQ2A 3MDAA 5KFVA 5HNKA 1N48A 1TK0A 4B9TA 1RYSA 1WCLA 2J6UA 5HHIA 5J0UA 4Z6EA 3MGHA 1JXLA 2P66A 1XS9D 4DEZA 2UVRA 4P2HA 5J0RA 4F4ZA 4FO6A 5IIMA 2RDIA 4J9SA 3H4DA 1Z00B 2ASJA 1S77D 4ED8A 7ICIA 5KFZA 1RXWA 3QEBZ 1K1SA 4RQ4A 3BQ0A 3PX0A 1SL1A 3RJGA 4O9MA 1S97A 8ICQA 8ICGA 4R8UB 2DR9A 4P4PA 5DKWA 4TUSA 2R8HA 2BR0A 9ICQA 4HYKA 4EBEA 5F2VO 3G6XA 1NOMA 1TV9A 3E2EA 4I2CA 4F3OA 4QWEA 2PI4A 3OHAA 1QTMA 1KRPA 1KTQA 1ZQZA 4UAZA 5J0SA 1ZYQA 3M9OB 4LZGA 1KEJA 4QZFA 3GIMA 3UPQA 5HHHA 3HJ4A 4M6WA 5IIOA 4AT9A 2XO7A 3RBDA 1WOTA 5KG5A 4JV0A 4I2FA 4RQ0A 7ICHA 4WC4A 4QWDA 5DQGA 4Q43A 3RJJA 4E80A 1ZQXA 2OWOA 3AU2A 4PHPA 4GC7A 5CJ7A 1NK5A 1SKWA 1ZQRA 3HX0A 4Z6CA 5KT5A 3HT3A 3Q8RB 1QSSA 2PI5A 3JZ0A 4XRHA 4UD5A 4ED0A 3V7LA 1ZQGA 4I2EA 3MBYA 4ED1A 3TAQA 4CCHA 3TI0A 4QWBA 2BCRA 4M04A 4RWOA 5HP4A 2ZH3A 1LV5A 4O3NA 1S10A 4KLEA 4Q8FA 4J9NA 1ZETA 4C8NA 4FS2A 1S0MA 4G3IA 4RQ6A 4RT3A 2BCVA 4RU9A 5J2FA 4DFMA 3EPGA 1ZQUA 4WC1A 1NK9A 1LB2B 4O3RA 4O5EA 4X4TA 2ZJ5A 1YLQA 4NXZA 2W9BB 1NO5A 4ELTA 4RQ7A 2NRZA 4Q45A 4DOCA 2BCUA 9ICSA 4FHPA 5D49A 4BGDA 1UT8A 5J2KA 5KFDA 4MF2A 3RH5A 8ICBA 5HRDA 3ISDA 4R64A 1Q78A 2ZH6A 3H8SA 4MF8A 3KHLA 8ICTA 2ZUCA 2MUTB 1L5UA 4DL3A 3TARA 1BNPA 3HPOA 3TANA 4F93B 2W9AA 1KDHA 4ZH4A 3OUYB 2V4RA 4GXKA 4IG8A 4I2HA 1DGSA 4YXJA 5L1LA 4DSFA 1NK0A 3B0YA 1ZQIA 3SV3A 4I2IA 2J6SA 5KT2A 5DGBA 4J9KA 8ICRA 3H37A 2UVUA 1U9LA 4F5OA 1ZQOA 1ZQFA 1R89A 4YVZA 2V9WA 4DSKA 3AU6A 3UQ2A 3QEAZ 5KFIA 2H5XA 3M8RA 2AQ0A 1DK3A 3L9DA 1JIHA 1TVAA 7ICMA 5KFYA 3C2LA 4MFCA 2FMPA 2NRXA 2B21A 5KT3A 2RFFA 3C2KA 4KLSA 9ICNA 4UAWA 2IMWP 2AJQA 4F5QA 1NKEA 1IXRA 1SKSA 2JEFA 4RWNA 3PMLA 3AQKA 4IQTA 3MFIA 1BNOA 4F8RA 4DQPA 2O1PA 1NZPA 4WC0A 8ICVA 5C5JA 3RBEA 1PX5A 5BPCA 4EYIB 3SV4A 4UB1A 3RJIA 4O3QA 5J0YA 4ECYA 2UVVA 2P6RA 4BXOA 4ELUA 4QZEA 3AQLA 4IRKA 3IM1A 3PV8A 2ZJ8A 9ICAA 1MC8A 4YMNA 3TQ1A 4I2AA 2XY5A 1MSWD 1V4AA 1RXVA 3PW4A 2FLLA 1ZQYA 4FHXA 1ZQQA 4M0AA 4UAYA 4TQSA 3GIJA 2DPIA 4AT7B 3H4BA 2ATLA 3KHGA 9ICIA 4LZDA 1C7YA 3G6VA 1TKDA 4C8KA 5IIIA 2BE3A 2AGOA 5IILA 4K4GA 3RAXA 4F2RA 1U4BA 2ID1A 1BPBA 3K75D 5IINA 8ICIA 3QE9Y 3PR4A 3JPQA 3H39A 4BDPA 2JZBA 2BQRA 1A76A 5J0PA 3V6JA 4P4OA 3RJHA 5CP2A 4MFAA 2JEIA 4QWAA 4RQ5A 4UBCA 4EBCA 4WC2A 2ZH2A 4KLOA 1UA1A 4QZ8A 4X4RA 1TAQA 1X2IA 1XO1A 4PPXA 2ZH1A 4X4VA 3AQNA 2DR7A 3JPOA 5KFOA 4KTQA 4TQRA 4QW8A 3GV7B 1RYRA 1NK7A 3JYYA 4X4SA 3T5JA 3H8WA 3RH4A 4O5KA 5KT4A 4DWIA 4JWMA 7ICLA 1X9SA 2VA8A 4X4QA 1T4GA 1NK6A 2NRWA 3OSNA 4JV1A 7ICQA 3B0XA 8ICOA 5IIKA 7ICVA 3PVXA 4I28A 2BPGA 4NY8A 2C2RA 8ICFA 9ICBA 4YMMA 5HR9A 5J29A 1R8AA 5J2GA 4BWMA 5DB7A 3UXPA 2C28A 7ICNA 1UEUA 4M9HA 4TURA 3RR8A 4F91B 4M6WB 3Q8KA 1L3TA 1ZQKA 4AT9B 4DSLA 4O5CA 5KG6A 1ZQBA 4KLDA 2WTFA 4C8LA 1ZJMA 4DO9A 3C18A 5HMLA 1NK8A 3ZD8A 4DQSA 2HHSA 8ICWA 2W9MA 4UB4A 5KFHA 3ISBA 1U49A 9ICOA 1WCNA 8ICLA 1ZQSA 4R66A 4ECWA 1HUOA 2XGPA 4PGYA 2P6UA 1ZQPA 4EZ9A 2F1JA 4I2DA 4R65A 4EBDA 4M2YA 1XWLA 4F92B 1Q79A 2O5AA 4YFKA 4UQGA 4UB5A 3Q8MA 4IQVA 2J6TA 2UVWA 2XGQA 1U45A 9ICHA 4XA5A 4B9VA 3T5KA 2JEJA 1MIVA 5EWGA 3V6HA 4X0AA 3PX6A 4KN4A 8ICAA 2FPLA 3RB3A 1NJWA 2KZMA 1KFTA 1IM4A 4C8OA 4KLMA 5HMMA 3GDXA 3HIYA 3PY8A 1NJXA 4M47A 5KT7A 2DR5A 3PO5A 3NGDA 3V7JA 4DL7A 3PW5A 2MAXA 2W9CA 3RB6A 1PZNA 1T8EA 4QZGA 4I2JA 4FS1A 2IBKA 7ICFA 5F9LA 5J2AA 9ICCA 4F4YA 2ZUDA 1SL0A 3NYBA 5KFJA 3MDCA 3EPIA 3JPNA 3BQ1A 4J9MA 1S0OA 2PFPA 1D9FA 4LVSA 5HREA 8ICKA 3NTUA 3PW2A 2BCSA 4I27A 4YG2A 3C5GA 3QZ8A 2BCQA 1R8CA 1D8LA 2BHNA 4QZCA 1CUKA 5CHGA 3PMNA 3MGIA 4F5RA 2ASLA 1KLNA 2DRBA 2DR8A 1BPZA 5KFBA 4DS4A 4FH3A 5J0XA 2AGPA 4K4IA 2Q66A 4FBUA 5DQHA 3RB0A 4YR0A 4WCWA 1ZQNA 4ED2A 3H7IA 2F1HA 4WC7A 5KTQA 8ICYA 3N4MB 1XC9A 1JAJA 4FBTA 1TFYA 8ICUA 2W8KA 1EXNA 3RB4A 4KLQA 5KFXA 1Z3EB 9ICEA 3ISCA 5DDMA 4B9MA 1Y88A 4F2SA 5DB8A 3UQ0A 5DLFA 4EP7A 1TAUA 5J2EA 1XSLA 1S0NA 4RWQA 5CA7A 4YR3A 3RR7A 4UD4A 2ZH5A 2V4QA 8ICPA 7ICPA 3MR6A 2BQ3A 3IHQB 3OVAA 2ZHBA 3PR5B 5KFRA 5DBAA 9ICJA 2ZH4A 3Q8QB 4BXOB 2R8IA 5EOZA 5HRFA 3H3AA 4DF4A 4MFFA 4J9LA 2XC9A 4DSEA 4ELVA 2XCPA 2XCAA 3RJFA 3MFHA 4NLGA 2FMQA 4KLGA 1BPYA 3EYZA 5KFFA 3FYHA 5KG1A 2W9BA 5KG7A 3TFSA 2JEGA 4GXIA 2ZH7A 4F4WA 3V72A 1ZQJA 5DBBA 3LK9A 3SYZA 3OSPA 4TUQA 3OHBA 4NLZA 2MUTA 3C21A 1L3UA 2BKEA 2FPMA 2HVIA 1QSYA 3H38A 1ZQWA 1FA0A 3TAPA 5CB1A 3MR5A 2DVIA 2PFNA 3OUYA 2BGWA 1NJZA 4RZRA 4X4PA 3MR3A 4JK1A 4EYHB 2Y1IA 4IRDA 4DS5A 8ICZA 1S0VA 4ATBA 2JZBB 4RQ1A 3RH6A 4UB2A 3OJUA 5CWRA 2NRKA 3JPTA 1UA0A 4FHWA 4KLTA 3RRGA 2M2UA 4M5DA 1CEZA 4WBZA 1JQRA 4DSJA 4AT8A 4WC5A 1ZQVA 1S9FA 2A1JA 5EWFA 3H40A 3KHHA 3PW0A 4ECXA 1L3SA 4NLKA 2M2WA 4J9PA 3EZ5A 1UETA 2ZTCA 4YQWA 2DRAA 3MABA 2PFOA 3GV5B 3THVA 3ORYA 3RTVA 3PW7A 1S76D 4R63A 3UXOA 5KG2A 4YR2A 4WC6A 4DOAA 5DLGA 4X4NA 2AGQA 2F1IA 4DL5A 4M9GA 3GIKA 1ZQHA 5J0QA 7ICGA 1BGXT 2ZJAA 2IHMA 4X0BA 3WFQE 3MR2A 3WFPA 4RQ3A 4YP3A 3G6YA 2XY7A 2RDJA 5KFAA 2FMSA 4XQ8A 4ECZA 1ZQMA 4DQIA 5HRIA 3C66A 5KFCA 4DQQA 4QZIA 2FLNA 1HJPA 2W8LA 5KFPA 7ICSA 4F4KA 4DOBA 1ZQCA 5HRKA 2FLPA 4ECTA 3T5LA 7ICOA 4B9LA 4UBBA 2Q0ZX 5HRHA 1A77A 3ETLA 4KMUA 3Q8SB 9ICKA 1VJ7A 7ICJA 4EBJA 4DQRA 4B9UA 3UPSA 2ISPA 5J2DA 4DLGA 8ICCA 8ICJA 5DB6A 3LWMA 5HC9A 4KN7A 3ZDEA 2LYHA 2VA2A 1BPDA 2HHQA 1TFWA 3WFSC 3SI8A 3KTQA 1MQ2A 5J2JA 1T7PA 4J9RA 4DFPA 4ECQA 2DPJA 3BJYA 1TK8A 4QZAA 2VA3A 4KLHA 2PXIA 3M8SA 4EZ6A 4KLIA 4RT2A 3GILA 4K4HA 3BQ2A 4C8MA 5D46A 5KFEA 4DL6A 1QSLA 2AU0A 5DG9A 3QZ7A 2W9CB 2AQ4A 2HW3A 9ICLA 4FH5A 2NRTA 2KN7A 1SL2A 2KFZA 5KG3A 3OGUA 3K4GA 1F5AA 7ICKA 4ED6A 4QZHA 5DECA 2ZTDA 3PO4A 1JMSA 4DF8A 5KFWA 9ICMA 2Y1JA 4X4OA 4NLNA 4LT6A 1SKRA 3GIIA 5DGAA 1HUZA 1JN3A 4F50A 4IRCA 1Z00A 2BQUA 9ICRA 1H38A 4RNMA 2R8JA 4M9NA 5JUMA 4IQWA 8ICSA 4R8UA 9ICVA 4ECRA 3JPSA 8ICXA 1NJYA 4XUSA 1X9MA 3OV7A 2ZH8A 1ZJNA 2PFQA 1KSPA 7ICTA 2PBEA 3ZDDA 3OVBA 5BOLA 1UEVA 5J0WA 2BDPA 4RPZA 5D4BA 2BPFA 3ZDBA 4RQ8A 4M9JA 4F5PA 4M9LA 5CR0A 1BVSA 3H8JA 9ICXA 4S3NA 4I2GA 4BWJA 3C5FA 4RWPA 2HHVA 4WBYA 4TUPA 2ASDA 1XSNA 3WFOA 4Z6DA 1RPLA 5KFUA 4RNOA 1R8BA 4Q8EA 5KFLA 1COOA 4RUCA 2KZZA 4F5NA 3RJKA 4GC6A 4QZ9A 4O3PA 1KFSA 2ZTEA 4RNNA 5J2BA 4Z6FA 1D9DA 4UB3A 4QW9A 4I2BA 4B9NA 4ED7A 4IR9A 3HJ1A 3UXNA 5KFKA 4XQ7A 3SZ2A 1B22A 3PNCA 1D8YA 4E0DA 4NKUA 3C1ZA 4YD1A 1NK4A 1MIYA 4JUZA 2KFNA 4X4UA 4PHDA 1B43A 3Q8PB 2FPKA 2I9GA 5KG0A 5L1IA 5DBCA 2M2TA 2HHPA 2BPCA 1ZQAA 1L3VA 4YD2A 1RZTA 3M9MB 4I29A 4IQUA 4O3OA 5L1JA 3T3FA 3V6KA 2C22A 5KFMA 9ICFA 2NRVA 3GV8B 4EBKA 2I1QA 4ED3A 3C1YA 3RAQA 2IHNA 4YMOA 5HRBA 2ZH9A 4J9QA 2M2VA 1K1QA 2KP7A 3BDPA 4ATBB 1XU4A 3Q8LA 4DL4A 1N56A 1X9WA 9ICGA 4FHVA 5KT6A 5L9XA 4ECVA 4AT8B 1DOQA 3V7KA 5HRGA 3T5HA 4F4XA 3GFKB
chains in the Genus database with same CATH superfamily
2A1JB 1MQ3A 5DB9A 9ICTA 4NL9C 3PHZA 4YXMA 4RUAA 5IIJA 1KFDA 5DEDA 1QLNA 1L7OA 1ZQDA 2ZXIA 4PGQA 4KLJA 1T3NA 3HP6A 4QZDA 3C23A 1ZQTA 3LQCB 3RJEA 3PX4A 4Y2PA 1U48A 4O0IA 2HHUA 3JPPA 3ZDCA 4X4RA 4K97A 3EW9A 3SR6A 1ZQLA 2OHFA 4Q44A 4IR1A 3AQMA 3ZDAA 4O3SA 5KFQA 5KFNA 3LDAA 4KLLA 2FI1A 5KFSA 4PGXA 9ICUA 4K8VA 5KFGA 3KHRA 2C2EA 1L7NA 4GLXA 4KITB 2HN2A 5DG8A 2ZHAA 5F9NA 5FP0A 1YZ7A 3C2MA 4YCXA 4UW9A 5KFVA 1WCLA 2J6UA 2P66A 5J0RA 3H4DA 1S77D 4ED8A 3PX0A 1K5OA 4R8UB 5DKWA 2N1RA 1NOMA 4QIWF 2PI4A 3OHAA 1KRPA 5J0SA 1ZYQA 1KEJA 4QZFA 3GIMA 3HJ4A 5AI0A 4M6WA 4UASA 5IIOA 5KAIU 1FIQA 5KG5A 3QX7A 4JV0A 5DQGA 2KIWA 3SAHA 2E8NA 2PI5A 2Y9TA 1AQ6A 3V7LA 1ZQGA 1SV4A 2A3VA 4M04A 1S10A 4MHVA 4C8NA 4KM5A 2YN4A 3RFAA 1PK1B 5G5HA 3HJEA 1ZQUA 3PSPA 1NK9A 4AP9A 2ZJ5A 1YLQA 1ZD4A 4NXZA 4ELTA 2NRZA 3J81j 5D49A 2ZH6A 4MF2A 5HRDA 1URJA 5AIBA 2IUBA 2KSOB 2MUTB 1L5UA 2FJ6A 1O03A 3AL0B 3NS1A 1KW4A 4ZH4A 2V4RA 4IG8A 3A0HU 4DSFA 1WWVA 3SV3A 4J9KA 4PZOA 2ZIUB 4RQMA 2E8MA 4F5OA 4YVZA 4DSKA 3QEAZ 5KFIA 3M8RA 1DK3A 1TVAA 2K4EA 3BS7A 3WKCA 4RWNA 3MFIA 1J2MA 4EYIB 4BXOA 5AHXA 5J0YA 3E0FA 4OCZA 4IRKA 1MC8A 3TQ1A 4P0PA 1MSWD 5HR7A 1J97A 5AKKA 2DPIA 3GIJA 2KEYA 4LZDA 5EE0A 5D63A 2LI6A 2BE3A 3ICXA 2AGOA 3D2SA 4EELA 4K4GA 2ID1A 3K75D 3H39A 1X9XA 3NVWA 5J0PA 4MFAA 2JEIA 4QWAA 4UBCA 3TADA 5ALKA 3U26A 1TAQA 2BBHA 1X2IA 1ZXIA 2WB1F 4PPXA 3JPOA 3MGVA 2F8KA 3JYYA 3H8WA 4A8EA 4RQNA 2VA8A 5AKJA 4X4QA 3OSNA 3B0XA 5IIKA 7ICVA 3PVXA 3QUCA 1ZD5A 4YMMA 3WFSC 5J29A 3NRZA 3ONNA 5AM1A 1B4FA 1ZQKA 3I76A 4DSLA 4O5CA 5KG6A 1F44A 4C8LA 4DO9A 2JMGA 1UHUA 4WOYA 2W9MA 3ISBA 1S5LU 4C4TA 2XGPA 1KL9A 2P6UA 4GIBA 3NVOA 3I1YA 2O5AA 4IQVA 2B6GA 3T5KA 5EWGA 3PX6A 1ECWA 4Y2XA 5HMMA 3GDXA 1XNSA 5KT7A 2W3RA 2IBKA 2W9CA 1PZNA 4NWIA 3WKEA 2WB1C 2Y0SF 3KZXA 2ZXHA 3O0FA 3NTUA 4I27A 1Z4OA 4YG2A 2BCQA 2YMPA 3MGIA 1CUKA 2LKYA 5ALHA 5J0XA 2Q66A 4FBUA 3RB0A 4YR0A 4WCWA 1ZQNA 2F1HA 4WC7A 1XC9A 2W8KA 3DDHA 1EXNA 2YTUA 1Z3EB 2HBMA 5DDMA 5AK5A 1SXDA 2AXTU 3AMZA 1XSLA 3CP8A 3RR7A 4UD4A 3BQ7A 3OVAA 3SQIA 3PR5B 5AKIA 9ICJA 3Q8QB 2R8IA 5EOZA 3H3AA 4ELVA 5JU5A 2XCPA 4NLGA 2Y9UA 2FMQA 3EYZA 5B5EU 3D2QA 5KG1A 1J2NA 2G06A 2G5HB 2ZH7A 2EDUA 4F4WA 2Y0SC 5CHEA 3OHBA 2F77X 2MUTA 2WF5A 1L3UA 1QSYA 3H38A 1ZQWA 3K1ZA 5CB1A 2PFNA 4US8A 2BGWA 2IHOA 2Y1IA 2W43A 3VCBA 1S0VA 3RH6A 4UB2A 2ZIUA 4FHWA 4AT8A 3RRGA 3IP4B 1CEZA 3WK4A 4CDGA 1Q3VA 5EWFA 3IRUA 3PW0A 5EE1A 4J9PA 3EZ5A 2ZTCA 2DRAA 3KZIU 5KG2A 3MCRA 4WC6A 2DBYA 5D62A 4DOAA 5DLGA 2AGQA 4OD0A 2F1IA 7ICGA 2HOQA 1BGXT 2IHMA 3WFPA 4DQIA 2XY7A 2RDJA 3C66A 5HRIA 2F44A 2KHQA 2FLNA 7ICSA 4KX3A 2FLPA 2NV3A 3T5LA 1Q8KA 2ISPA 5J2DA 8ICCA 5HC9A 4KN7A 4O67A 3CW2C 3IG8A 1BPDA 3H0RB 1Z19A 3KTQA 2W54A 1T7PA 4Y2YA 4J9RA 4DFPA 3BJYA 3AQFA 1WG8A 4KLHA 2PXIA 3M8SA 4EZ6A 2KG5A 4RT2A 3BQ2A 4MKPA 3QU5A 3QZ7A 2HW3A 4FH5A 1WWUA 1SL2A 5KG3A 3OGUA 3K4GA 1F5AA 7ICKA 1UPHA 3UMCA 4QZHA 3PO4A 4X4OA 1SKRA 3GIIA 1HUZA 4OJ5A 4DCCA 1H38A 5JUMA 1PVPA 4ECRA 2HBJA 9ICVA 2HCFA 2WF8A 2E5SA 1RQNA 2ZH8A 2GLEA 3ZDDA 3OVBA 3QYPA 2I5HA 2BDPA 5D4BA 3H8JA 4ICAA 3WK6A 4I2GA 3C5FA 4RWPA 4WBYA 5AIAA 3NUQA 2ASDA 1XSNA 3WFOA 1OXJA 2LYBA 3RJKA 4GC6A 2YB1A 1KFSA 5G5GA 4Z6FA 4QW9A 4I2BA 4B9NA 2GAFD 5ALTA 4E0DA 4NXUA 4JUZA 2ZIVA 2KFNA 4UARA 4PHDA 3Q8PB 4C7YA 2FPKA 5KG0A 5CRXA 1YZ6A 2BPCA 1ZQAA 1GO3F 1SV0C 1RZTA 3M9MB 4O3OA 3V6KA 2C22A 5KFMA 4EBKA 5HRBA 1ZRMA 2LBOA 1K1QA 4DL4A 2WAQF 5KT6A 3AM9A 3RF9A 3C28A 2K60A 8ICHA 4DL2A 3AN1A 4DSIA 4JWNA 2ALZA 1NKCA 5L1KA 3BQTA 3OVSA 4RPYA 2BZFA 5KFTA 2H3FA 4P4MA 2XY6A 5ALMA 2B51A 5CFTA 4MEYA 2OCEA 4B9SA 1X66A 2LPEA 3F5EA 3TFRA 4QWCA 8ICNA 2XVTA 5AI9A 2VANA 1A6SA 2HHXA 2KZ3A 1KNYA 3EWAA 1DK2A 2HMXA 3JPRA 1TFRA 7ICUA 3M6ZA 2IOFA 4JLXA 2F2AB 1V9PA 2QB0A 2OM6A 4DFKA 1F5SA 4AT7A 2RP5A 3QU2A 4ECSA 4DLEA 4EEYA 3A0BU 1U47A 5CFUA 2JXJA 3R9KA 2K4PA 4YN4A 1UT5A 5J0OA 2E1EA 5DQIA 2ZUBA 1BPXA 5J0TA 4X5VA 4RQ2A 3PSTA 3MDAA 5HNKA 4C7ZA 1RYSA 1N5XA 3QUTA 1JXLA 5AI6A 3ALRA 4DEZA 4F4ZA 2KD1A 5IIMA 4J9SA 1Z00B 3BQ0A 4RQ4A 8ICQA 1PK3A 2BR0A 4FZLA 3E2EA 4F3OA 1KTQA 1ZQZA 4LZGA 3M9OB 2FE9A 3L3FX 5ALVA 4AT9A 2XO7A 1WOTA 4I2FA 3ZI4A 4JLZA 4WC4A 4QWDA 1ZQXA 2OWOA 3AU2A 1NK5A 5KT5A 4UD5A 5AKLA 5B3PA 4ED1A 2K8BB 4QNLA 3TAQA 4CCHA 3TI0A 4RWOA 2RHFA 4Q8FA 4J9NA 1ZETA 4FS2A 1S0MA 4C0ZA 1SZHA 1LB2B 4O5EA 2ZIXA 5ALRA 2W9BB 1NO5A 4Q45A 1V38A 2BCUA 9ICSA 4BGDA 5KFDA 1Q78A 3H8SA 8ICTA 4F93B 2W9AA 1DGSA 2KHVA 4YXJA 5ALWA 1NK0A 4KX5A 1ZQIA 2XIDA 5KT2A 4BX9C 5DGBA 3H37A 4NXXA 1LKYA 2R18A 1ZQOA 1R89A 1O08A 3AU6A 1JIHA 2K89A 5E79U 5KT3A 1ZQ1C 4UAWA 4F5QA 4C4SA 3SEIA 3PMLA 2O1PA 1NZPA 4WC0A 3NVYA 8ICVA 5C5JA 1N63A 3SV4A 3RJIA 4UB1A 4O3QA 5AKGA 2RQ5A 2F76X 3IM1A 3PV8A 9ICAA 4YMNA 4I2AA 1RXVA 3PW4A 4NXTA 5AI5A 2FCLA 4UAYA 2KV2A 3KHGA 2P35A 3G6VA 5IIIA 2A1AA 5IILA 2VJ4A 4F2RA 1BPBA 3D2NA 5IINA 3QE9Y 3PR4A 3JPQA 3TKAA 4FZMA 5L1MA 1RG6A 5CP2A 3RJHA 4EBCA 2ZH2A 1VDVA 3AQNA 1V97A 1NK7A 2CXYA 3L4PA 5KT4A 1X9SA 1NK6A 2NRWA 2ZIWB 4NY8A 2CN1A 8ICFA 3JZ0A 4WC5A 1UEUA 4BWMA 5DB7A 3QUQA 5TISU 7ICNA 4M9HA 3RR8A 4F91B 2NO4A 1ZQBA 3C18A 1ZJMA 5HMLA 3ZD8A 4DQSA 2HHSA 5ALEA 8ICWA 4UB4A 5KAFU 5ALXA 9ICOA 1WCNA 8ICLA 1ZQSA 1TE2A 4R66A 1HUOA 4PGYA 2F1JA 4R65A 1X6IA 4EBDA 1Q3UA 4USAA 4YFKA 4UQGA 2J6TA 2EZXA 4IS7A 9ICHA 2NO5A 4KN4A 8ICAA 4OAIZ 4C8OA 4KLMA 3PO5A 3NGDA 3V7JA 3M7DA 4DL7A 2PBEA 5ALIA 4F4YA 1SL0A 3GU3A 5KFJA 3MDCA 3NYBA 3BQ1A 2VJ5A 4LVSA 8ICKA 3PW2A 4P0QB 3C5GA 3QZ8A 2KKPA 1D8LA 2BHNA 2ASLA 2KE7A 4UB8U 1KLNA 2XICA 2LHTA 2AGPA 5ALYA 3ERCC 3N28A 1N2XA 5AM3A 4WH5A 8ICYA 3AEVA 4KLQA 4G9BA 4QIWC 3ISCA 5J2EA 5AM5A 1S0NA 5CA7A 5ALDA 3MR6A 5ALZA 2RRDA 2E3TA 5HRFA 4DF4A 4MFFA 2HDOA 3KKAA 3MFHA 2KIVA 4GFJA 1BPYA 2W9BA 3FYHA 5AM2A 3LK9A 3SYZA 2KNJA 4NLZA 3C21A 2JR5A 2W7PA 1Q46A 1FA0A 3TAPA 3LYSA 4RZRA 4OO1J 4X4PA 2CRXA 2LM4A 5HR6A 4IRDA 3BZKA 4OJ6A 4DS5A 4ATBA 2JZBB 4Y2VA 2JHDA 5EE3A 3JPTA 3I28A 4WBZA 4U6PA 4DSJA 4DFDA 2A1JA 3KHHA 4NLKA 2HBKA 4K9BA 2PFOA 2WF7A 3ORYA 3RTVA 1S76D 3MC1A 3AQEA 5H2FU 4X4NA 1PUZA 3PSIA 3WFQE 2W04A 3MR2A 4RQ3A 2HOIA 4HX0A 3UMGA 2W8LA 2E1FA 1ZQCA 4OJPA 4ECTA 4QJFB 7ICOA 4B9LA 2Q0ZX 3ETLA 5AK4A 1VJ7A 4EBJA 4B9UA 4OJLA 8ICJA 4KMOB 4Y2RA 2OYYA 1MQ2A 5C0YA 2DPJA 3CRXA 3D6JA 5AKHA 5D46A 5DG9A 2ODGA 2AQ4A 4NL9A 3OTQA 1JMSA 4DF8A 2Y1JA 4LT6A 2H3ZA 4CF3A 2R8JA 4R8UA 2DQNB 8ICXA 5EE9A 1X9MA 1ZJNA 7ICTA 5BOLA 4M9JA 4LEWA 5CR0A 1QH9A 1KKXA 9ICXA 4S3NA 2W55A 4BWJA 4TUPA 4Z6DA 3SMVA 3N7PD 5ALLA 2KZZA 1L6NA 4QZ9A 1D9DA 4IR9A 3UXNA 4NLCA 1B22A 2G5IB 3C1ZA 4YD1A 1NK4A 2L5YA 2W11A 2JV3A 1B43A 3M6KA 5DBCA 1PK1A 4P0QA 5ALOA 5KNIA 4YD2A 2Q4TA 4PJ0U 4I29A 9ICFA 3GV8B 2I1QA 4ED3A 3C1YA 3WK9A 2IHNA 2ZH9A 2DKXA 1VLBA 1Z4NA 3Q8LA 9ICGA 2KSOA 4F4XA 4F72A 4RQ0A 3GFKB 4ECUA 4NM1A 3AUOA 5BOMA 3HKZF 4EX6A 3H0MB 8ICEA 1RM6C 1NKBA 4K98A 3NVVA 1XSPA 1OU5A 7ICRA 4KLUA 2KTQA 4RPXA 2R8GA 4IC9A 3HWTA 2C2DA 4MEXA 2ISOA 4NM2A 2DF4B 5AM4A 3WFRE 1S8OA 5J2IA 5DDYA 3M9NB 4NKTA 4KLFA 1JX4A 1RQLA 1VFGA 9ICPA 2DFLA 2M9NA 3LWLA 4O6AA 3HW8A 1X42A 1AROP 1LVHA 1SZPA 4XJEA 2XI9A 4EX7A 3KFUF 2IA6A 2R8KA 1L8OA 4EEBA 1D8BA 3ZD9A 5J2HA 3QXGA 1DRGA 1ZQEA 4C80A 4B9TA 2G07A 1V4AA 4O69A 5J0UA 1PVQA 2UVRA 4P2HA 4FO6A 2RDIA 2ASJA 2YQEA 7ICIA 5KFZA 1RXWA 1K1SA 2IOHA 3RJGA 1S97A 2DR9A 4P4PA 4TUSA 5KL1B 3NKUA 9ICQA 4HYKA 4EBEA 3QU4A 5F2VO 4NXVA 2MSNA 5J8YC 4QWEA 1QTMA 5AKYA 4UAZA 2KVCA 3UPQA 4I0UA 7ICHA 3RJJA 4LJXA 4GC7A 3WKDA 3HRDD 4BUGA 3HX0A 4Z6CA 1QSSA 3Q8RB 4XRHA 3EUB2 3QU9A 4WQLA 4ED0A 2GA9D 2ES6A 4QWBA 1C20A 5HP4A 4O3NA 4KLEA 4G3IA 4RQ6A 4RT3A 2BCVA 4RU9A 2WHEA 5J2FA 3ER9B 4DFMA 3IN5A 2K4HA 4WC1A 3B9JA 4O3RA 4X4TA 3JCFA 2QARB 2LYAA 5ALNA 1UT8A 3ISDA 4R64A 4MF8A 1NZBA 2ZUCA 4DL3A 3TARA 4ACOA 3TANA 1KDHA 4U7CA 3OUYB 3KOOA 2QB1A 4I2HA 1N62A 2EZZA 5L1LA 1IG6A 4I2IA 2GH1A 2HBLA 1U9LA 2H3VA 2V9WA 2H5XA 2AQ0A 2EAOA 3HILA 7ICMA 4KB6A 3C2LA 4MFCA 2NRXA 4Y2TA 3C2KA 2IMWP 2AJQA 1VJ5A 1NKEA 2JEFA 3AQKA 4IQTA 5ALQA 4F8RA 3SAFA 2JH7A 3RBEA 5BPCA 2P6RA 7ICLA 4ECYA 4ELUA 3AQLA 1OW5A 2W03A 3VC8A 4M0AA 3KD3A 9ICIA 2ATLA 5AICA 1XO0A 1TKDA 1V85A 2CPRA 1WUDA 1WYGA 3RAXA 5CFSA 1U4BA 8ICIA 2BQRA 3V6JA 1ZRNA 2YB4A 4WC2A 2WAQC 4KLOA 1UA1A 1P7DA 5GTIU 4X4VA 4KTQA 5KFOA 3E58A 3GV7B 4X4SA 3T5JA 4JWMA 1T4GA 7ICQA 4I28A 9ICBA 4EV6A 5J2GA 5JRTA 3UXPA 2C28A 1NNLA 4M6WB 1L3TA 5AKZA 4KLDA 5GTHU 3ETRA 3S6JA 5KFHA 1U49A 1N5WA 3NVZA 3BZCA 2A19A 2MA1A 4I2DA 2WF6A 4M2YA 1XWLA 1MN8A 5AKEA 4UB5A 2XGQA 1U45A 4XA5A 1MIVA 4AYBF 3RB3A 1KFTA 2KZMA 1IM4A 3PY8A 1NJXA 2DR5A 1FEZA 2MAXA 4FE3A 3WK5A 1T8EA 7ICFA 2KICA 4I2JA 5F3XB 5F9LA 5J2AA 9ICCA 1CI4A 3SENA 3EPIA 3JPNA 1NI3A 1S0OA 2PFPA 3K1RB 2LM1A 1R8CA 2VKQA 4QZCA 2M0NA 2DR8A 1BPZA 4UAUA 4K4IA 4B6JA 1ZD3A 4ED2A 1M6YA 3H7IA 5JTIA 3TADC 3N4MB 1JAJA 2GO7A 5B66U 2D8CA 3KBBA 9ICEA 4UB6U 1Y88A 4F2SA 5DB8A 3UQ0A 4EP7A 1TAUA 2ZH5A 2BQ3A 1RDFA 5ALSA 2ZHBA 2ZG6A 5AM0A 4J03A 4BXOB 4AYBC 1KQQA 3K7DA 2H3QA 4J9LA 4KLGA 3NWIA 2JRZA 5KFFA 3TFSA 2JEGA 3LVWA 4NXWA 4GXIA 4PZNA 2GOLA 1ZQJA 5DBBA 2KOBA 2EWRA 3NRWA 2FPMA 3LVVA 2DGZA 3MR5A 2WF9A 3OUYA 3H8MA 4JK1A 1CRXA 1Z1VA 2NYVA 8ICZA 3UM9A 3OJUA 3H0LB 4M5DA 2M2UA 1JQRA 3OWGA 1ZQVA 1S9FA 1L3SA 1UETA 4ECXA 2M2WA 4YQWA 2DL0A 3UXOA 2F3NA 1DGJA 4YR2A 4F71A 4DL5A 4M9GA 5J0QA 4YP3A 3G6YA 4ECZA 5KFCA 4DQQA 3DEEA 1HJPA 5KFPA 4DOBA 5ALFA 3WKAA 2JGAA 7ICJA 3M1YA 4DQRA 3UPSA 1SV0A 4DLGA 5DB6A 2EQYA 2I6XA 3SI8A 5J2JA 4QZAA 4Y2QA 2VA3A 1RYUA 4KLIA 3GILA 4ZOHC 4K4HA 5KFEA 3SAGA 4DL6A 2AU0A 2W9CB 9ICLA 2KFZA 4HAIA 4ED6A 2ZTDA 9ICMA 5ALUA 4LEYA 1OUQA 5DGAA 2IOFK 1Z00A 1GPJA 4M9NA 2RLTA 1F0MA 3JPSA 3UMBA 1NJYA 4XUSA 3OV7A 3OPXA 3QU7A 5J0WA 4RPZA 4M9LA 4RQ8A 4F5PA 5ALGA 1BVSA 2QLTA 2HHVA 2D6FC 1RPLA 1R8BA 3EF2A 5KFLA 1COOA 4RUCA 4O3PA 4RNNA 5AKXA 4UB3A 4ED7A 3HJ1A 4XQ7A 5KFKA 3SZ2A 1D8YA 2YX8A 1ZOLA 4NLBA 2I9GA 2M2TA 2MRLA 2MU2A 4IQUA 5L1JA 2H3IA 4OAGA 4J9QA 4OAFA 2B4VA 3BDPA 2LMRA 1X9WA 5L9XA 2JH1A 4AT8B 1DOQA 2DUYA 2DWQA 5HRGA 3T5HA 5D61A 3OJSA 4PHEA 1JROA 2E8PA 1TAMA 4PHAA 4E8FA 8ICMA 2OH2A 4DFJA 4WC3A 2GWSA 2HHTA 4PH5A 1JUDA 3PSFA 7ICEA 3QNMA 2W7OA 3BS5B 5J2CA 4QZBA 2B56A 1JXEA 3GQCA 4FHYA 2HHWA 1BPEA 5DG7A 5KG4A 1SB3C 1L7PA 5EWEA 3WU2U 2EZYA 5TZVA 4GXJA 1MIWA 3RRHA 4E7XA 1TK5A 3FDSA 2BDUA 4JV2A 9ICWA 5HRLA 2HVHA 3N97B 4CF5A 3L5KA 4J9OA 1X40A 4FFDA 1N48A 1TK0A 8ICBA 1QQ5A 5HHIA 4Z6EA 3MGHA 1XS9D 4BJQA 2HI0A 1SWVA 3QEBZ 1SL1A 4O9MA 8ICGA 2O6KA 2R8HA 2OXOA 3G6XA 1TV9A 2ZIWA 4I2CA 2KJ8A 1UCVA 1SXEA 4JMUA 5HHHA 1N60A 5B3QA 3RBDA 4Q43A 4E80A 3C29A 4PHPA 5CJ7A 3N7RC 2QKQA 4CF4A 1SKWA 1ZQRA 2E8OA 2W3SA 3HT3A 2K4IA 2EAPA 4K99A 4I2EA 3MBYA 2BCRA 2ZH3A 3WK8A 1LV5A 2EANA 2ZIVB 3IV6A 1MA7A 3EPGA 3NASA 3ER8C 1SIJA 2YMMA 4RQ7A 4DOCA 4FHPA 5J2KA 3RH5A 3KHLA 3T79A 1BNPA 1B0XA 3HPOA 1IV8A 4GXKA 3FAHA 3B0YA 2J6SA 8ICRA 2UVUA 4UATA 1ZQFA 3UQ2A 4EGWA 3L9DA 5KFYA 4CRXA 1QQ7A 3TACB 2FMPA 2B21A 2RFFA 5AI8A 4KLSA 9ICNA 2AH5A 1IXRA 1SKSA 1FFUA 1BNOA 4DQPA 1ZD2P 2YMQA 1PX5A 4PL2A 2HN1A 2UVVA 2AHOB 4QZEA 1T94A 3FC4A 2ZJ8A 1X6JA 4EENA 2XY5A 2OEHA 1IIPA 2FLLA 1ZQYA 4FHXA 1ZQQA 2QB0B 2FDRA 4TQSA 4AT7B 3H4BA 1C7YA 5JTGA 4C8KA 2G0AA 4Y2SA 5AK3A 1YT3A 4BDPA 2JZBA 1A76A 4P4OA 4RQ5A 3ED5A 1QQ6A 4QZ8A 2EAMA 2ZH1A 1XO1A 2KK0A 2DR7A 4TQRA 4QW8A 1RYRA 1JI7A 3BS5A 3WKBA 3RH4A 4O5KA 4DWIA 1L7MA 3HKZC 4JV1A 1KN5A 8ICOA 2BPGA 5HR9A 2C2RA 1R8AA 4EEDA 3F2DA 2B0CA 4TURA 1JALA 4PL1A 3Q8KA 4AT9B 2WTFA 5AK6A 1NK8A 4WJ3B 4ECWA 2F8LA 4O68A 1ZQPA 4EZ9A 2WFAA 5AI4A 4F92B 1Q79A 4Y2JA 3Q8MA 1QCKA 2UVWA 1FFVA 2Z7JA 4B9VA 1JRPA 2JEJA 3F53A 3V6HA 4X0AA 2FPLA 1NJWA 1SWWA 3PZPA 3GZFA 3HIYA 2YY6A 2ZIXB 4M47A 4FZNA 3RB6A 3PW5A 4QZGA 4FS1A 5KL8B 2ZUDA 4J9MA 4EEKA 1D9FA 3CYMA 5HREA 3QUBA 2BCSA 5CHGA 3PMNA 4F5RA 2DRBA 2YMLA 4FH3A 5KFBA 4DS4A 2EH9A 5DQHA 3IG5A 2PMZF 5KTQA 1TFYA 1LKYB 4FBTA 8ICUA 3RB4A 5KFXA 4K9AA 2PKEA 4B9MA 5DLFA 3CK6A 4RWQA 4YR3A 1HIWA 2V4QA 1HEKA 8ICPA 7ICPA 3IHQB 5KFRA 2KJ9A 5DBAA 2G08A 2ZH4A 4DSEA 2XC9A 2KVSA 2XCAA 3RJFA 4FO1A 2KMDA 4NJ8A 5KG7A 4WQKA 3V72A 2KJ5A 3OSPA 4TUQA 2BKEA 5T14A 2HVIA 2DVIA 4C4RA 2BBJA 1NJZA 5ALPA 4CE6A 3MR3A 4EYHB 1KBUA 4UAVA 4RQ1A 5CWRA 2NRKA 1UA0A 4KLTA 2PMZC 4IL6U 4O3MA 3H40A 4OAHA 3MABA 4LEVA 3GV5B 3THVA 3PW7A 3SD7A 4CGZA 4R63A 2HSZA 3GIKA 1ZQHA 3DV9A 2ZJAA 4X0BA 2FMSA 5KFAA 4CNQA 4XQ8A 1ZQMA 2VIXA 4QZIA 4F4KA 3WK7A 5HRKA 4UBBA 5HRHA 1A77A 1T3QA 4KMUA 3Q8SB 4NV0A 9ICKA 2KKVA 3LWMA 3ZDEA 2LYHA 2VA2A 4OJOA 2HHQA 1TFWA 4ECQA 1TK8A 3KKAC 4C8MA 1PVRA 1QSLA 2NRTA 2KN7A 3F2BA 5DECA 5KFWA 1UQVA 5ALJA 4NLNA 2D3DA 1JN3A 4F50A 4IRCA 2BQUA 9ICRA 5K4LA 4RNMA 4IQWA 8ICSA 5A0LA 1L8LA 1COKA 3F5AA 1N61A 2PFQA 1KSPA 2DKZA 3F2CA 1UEVA 2BPFA 3ZDBA 4K96A 4Y2UA 3IDWA 2HOFA 2K8CB 3FM9A 3CNHA 5KFUA 4RNOA 4Q8EA 2G09A 4F5NA 1FO4A 2ZTEA 5J2BA 5CEHA 3PNCA 2ESEA 4NKUA 1MIYA 4X4UA 2K8AA 5L1IA 2HHPA 1ED1A 1L3VA 4US9A 1DXSA 3T3FA 4P0PB 3N7SC 2NRVA 2QARA 3RAQA 4YMOA 4JB3A 2M2VA 4LEZA 2KP7A 4ATBB 1XU4A 1N56A 4FHVA 1A0PA 1Z1BA 4ECVA 3V7KA 1SGGA 5J8YA 4N7RA
chains in the Genus database with same CATH topology
2A1JB 4ECUA 1MQ3A 4DL2A 8ICHA 5DB9A 4NM1A 9ICTA 3OJSA 4PHEA 4DSIA 4JWNA 3AUOA 5BOMA 2ALZA 1NKCA 4YXMA 4RUAA 5L1KA 5IIJA 8ICEA 3BQTA 4PHAA 4E8FA 8ICMA 1NKBA 4DFJA 4WC3A 1KFDA 2GWSA 5DEDA 3OVSA 4RPYA 2HHTA 5KFTA 1QLNA 4PH5A 1XSPA 4P4MA 2XY6A 7ICRA 1OU5A 4MEYA 1ZQDA 4B9SA 4PGQA 4KLJA 1T3NA 4KLUA 2KTQA 3HP6A 4QZDA 4RPXA 7ICEA 3C23A 3TFRA 4QWCA 1ZQTA 2R8GA 8ICNA 3LQCB 3RJEA 5J2CA 3PX4A 4QZBA 1U48A 2VANA 3HWTA 1JXEA 2C2DA 2HHXA 2KZ3A 4O0IA 3GQCA 2HHUA 1KNYA 3JPPA 4MEXA 3EWAA 2ISOA 3ZDCA 2HHWA 4NM2A 1DK2A 1BPEA 4FHYA 5DG7A 3EW9A 5KG4A 5J2IA 3JPRA 5DDYA 3WFRE 1ZQLA 1TFRA 5EWEA 4Q44A 4IR1A 3M9NB 3ZDAA 3AQMA 7ICUA 4O3SA 4NKTA 5KFQA 4KLFA 1JX4A 5TZVA 5KFNA 4GXJA 3LDAA 4KLLA 1VFGA 1V9PA 1MIWA 4DFKA 5KFSA 9ICPA 3RRHA 2DFLA 2M9NA 4PGXA 3LWLA 3HW8A 9ICUA 4E7XA 4AT7A 4ECSA 4DLEA 4EEYA 1TK5A 1U47A 1AROP 3FDSA 1SZPA 5KFGA 4YN4A 1UT5A 5J0OA 3KHRA 2IA6A 2R8KA 2C2EA 5DQIA 4JV2A 9ICWA 4GLXA 2ZUBA 4KITB 1BPXA 5HRLA 5DG8A 3ZD9A 2HVHA 5F9NA 3N97B 2ZHAA 5J0TA 5J2HA 4X5VA 1ZQEA 4J9OA 3C2MA 4YCXA 4RQ2A 3MDAA 5KFVA 5HNKA 1N48A 1TK0A 4B9TA 1RYSA 1WCLA 2J6UA 5HHIA 5J0UA 4Z6EA 3MGHA 1JXLA 2P66A 1XS9D 4DEZA 2UVRA 4P2HA 5J0RA 4F4ZA 4FO6A 5IIMA 2RDIA 4J9SA 3H4DA 1Z00B 2ASJA 1S77D 4ED8A 7ICIA 5KFZA 1RXWA 3QEBZ 1K1SA 4RQ4A 3BQ0A 3PX0A 1SL1A 3RJGA 4O9MA 1S97A 8ICQA 8ICGA 4R8UB 2DR9A 4P4PA 5DKWA 4TUSA 2R8HA 2BR0A 9ICQA 4HYKA 4EBEA 5F2VO 3G6XA 1NOMA 1TV9A 3E2EA 4I2CA 4F3OA 4QWEA 2PI4A 3OHAA 1QTMA 1KRPA 1KTQA 1ZQZA 4UAZA 5J0SA 1ZYQA 3M9OB 4LZGA 1KEJA 4QZFA 3GIMA 3UPQA 5HHHA 3HJ4A 4M6WA 5IIOA 4AT9A 2XO7A 3RBDA 1WOTA 5KG5A 4JV0A 4I2FA 4RQ0A 7ICHA 4WC4A 4QWDA 5DQGA 4Q43A 3RJJA 4E80A 1ZQXA 2OWOA 3AU2A 4PHPA 4GC7A 5CJ7A 1NK5A 1SKWA 1ZQRA 3HX0A 4Z6CA 5KT5A 3HT3A 3Q8RB 1QSSA 2PI5A 3JZ0A 4XRHA 4UD5A 4ED0A 3V7LA 1ZQGA 4I2EA 3MBYA 4ED1A 3TAQA 4CCHA 3TI0A 4QWBA 2BCRA 4M04A 4RWOA 5HP4A 2ZH3A 1LV5A 4O3NA 1S10A 4KLEA 4Q8FA 4J9NA 1ZETA 4C8NA 4FS2A 1S0MA 4G3IA 4RQ6A 4RT3A 2BCVA 4RU9A 5J2FA 4DFMA 3EPGA 1ZQUA 4WC1A 1NK9A 1LB2B 4O3RA 4O5EA 4X4TA 2ZJ5A 1YLQA 4NXZA 2W9BB 1NO5A 4ELTA 4RQ7A 2NRZA 4Q45A 4DOCA 2BCUA 9ICSA 4FHPA 5D49A 4BGDA 1UT8A 5J2KA 5KFDA 4MF2A 3RH5A 8ICBA 5HRDA 3ISDA 4R64A 1Q78A 2ZH6A 3H8SA 4MF8A 3KHLA 8ICTA 2ZUCA 2MUTB 1L5UA 4DL3A 3TARA 1BNPA 3HPOA 3TANA 4F93B 2W9AA 1KDHA 4ZH4A 3OUYB 2V4RA 4GXKA 4IG8A 4I2HA 1DGSA 4YXJA 5L1LA 4DSFA 1NK0A 3B0YA 1ZQIA 3SV3A 4I2IA 2J6SA 5KT2A 5DGBA 4J9KA 8ICRA 3H37A 2UVUA 1U9LA 4F5OA 1ZQOA 1ZQFA 1R89A 4YVZA 2V9WA 4DSKA 3AU6A 3UQ2A 3QEAZ 5KFIA 2H5XA 3M8RA 2AQ0A 1DK3A 3L9DA 1JIHA 1TVAA 7ICMA 5KFYA 3C2LA 4MFCA 2FMPA 2NRXA 2B21A 5KT3A 2RFFA 3C2KA 4KLSA 9ICNA 4UAWA 2IMWP 2AJQA 4F5QA 1NKEA 1IXRA 1SKSA 2JEFA 4RWNA 3PMLA 3AQKA 4IQTA 3MFIA 1BNOA 4F8RA 4DQPA 2O1PA 1NZPA 4WC0A 8ICVA 5C5JA 3RBEA 1PX5A 5BPCA 4EYIB 3SV4A 4UB1A 3RJIA 4O3QA 5J0YA 4ECYA 2UVVA 2P6RA 4BXOA 4ELUA 4QZEA 3AQLA 4IRKA 3IM1A 3PV8A 2ZJ8A 9ICAA 1MC8A 4YMNA 3TQ1A 4I2AA 2XY5A 1MSWD 1V4AA 1RXVA 3PW4A 2FLLA 1ZQYA 4FHXA 1ZQQA 4M0AA 4UAYA 4TQSA 3GIJA 2DPIA 4AT7B 3H4BA 2ATLA 3KHGA 9ICIA 4LZDA 1C7YA 3G6VA 1TKDA 4C8KA 5IIIA 2BE3A 2AGOA 5IILA 4K4GA 3RAXA 4F2RA 1U4BA 2ID1A 1BPBA 3K75D 5IINA 8ICIA 3QE9Y 3PR4A 3JPQA 3H39A 4BDPA 2JZBA 2BQRA 1A76A 5J0PA 3V6JA 4P4OA 3RJHA 5CP2A 4MFAA 2JEIA 4QWAA 4RQ5A 4UBCA 4EBCA 4WC2A 2ZH2A 4KLOA 1UA1A 4QZ8A 4X4RA 1TAQA 1X2IA 1XO1A 4PPXA 2ZH1A 4X4VA 3AQNA 2DR7A 3JPOA 5KFOA 4KTQA 4TQRA 4QW8A 3GV7B 1RYRA 1NK7A 3JYYA 4X4SA 3T5JA 3H8WA 3RH4A 4O5KA 5KT4A 4DWIA 4JWMA 7ICLA 1X9SA 2VA8A 4X4QA 1T4GA 1NK6A 2NRWA 3OSNA 4JV1A 7ICQA 3B0XA 8ICOA 5IIKA 7ICVA 3PVXA 4I28A 2BPGA 4NY8A 2C2RA 8ICFA 9ICBA 4YMMA 5HR9A 5J29A 1R8AA 5J2GA 4BWMA 5DB7A 3UXPA 2C28A 7ICNA 1UEUA 4M9HA 4TURA 3RR8A 4F91B 4M6WB 3Q8KA 1L3TA 1ZQKA 4AT9B 4DSLA 4O5CA 5KG6A 1ZQBA 4KLDA 2WTFA 4C8LA 1ZJMA 4DO9A 3C18A 5HMLA 1NK8A 3ZD8A 4DQSA 2HHSA 8ICWA 2W9MA 4UB4A 5KFHA 3ISBA 1U49A 9ICOA 1WCNA 8ICLA 1ZQSA 4R66A 4ECWA 1HUOA 2XGPA 4PGYA 2P6UA 1ZQPA 4EZ9A 2F1JA 4I2DA 4R65A 4EBDA 4M2YA 1XWLA 4F92B 1Q79A 2O5AA 4YFKA 4UQGA 4UB5A 3Q8MA 4IQVA 2J6TA 2UVWA 2XGQA 1U45A 9ICHA 4XA5A 4B9VA 3T5KA 2JEJA 1MIVA 5EWGA 3V6HA 4X0AA 3PX6A 4KN4A 8ICAA 2FPLA 3RB3A 1NJWA 2KZMA 1KFTA 1IM4A 4C8OA 4KLMA 5HMMA 3GDXA 3HIYA 3PY8A 1NJXA 4M47A 5KT7A 2DR5A 3PO5A 3NGDA 3V7JA 4DL7A 3PW5A 2MAXA 2W9CA 3RB6A 1PZNA 1T8EA 4QZGA 4I2JA 4FS1A 2IBKA 7ICFA 5F9LA 5J2AA 9ICCA 4F4YA 2ZUDA 1SL0A 3NYBA 5KFJA 3MDCA 3EPIA 3JPNA 3BQ1A 4J9MA 1S0OA 2PFPA 1D9FA 4LVSA 5HREA 8ICKA 3NTUA 3PW2A 2BCSA 4I27A 4YG2A 3C5GA 3QZ8A 2BCQA 1R8CA 1D8LA 2BHNA 4QZCA 1CUKA 5CHGA 3PMNA 3MGIA 4F5RA 2ASLA 1KLNA 2DRBA 2DR8A 1BPZA 5KFBA 4DS4A 4FH3A 5J0XA 2AGPA 4K4IA 2Q66A 4FBUA 5DQHA 3RB0A 4YR0A 4WCWA 1ZQNA 4ED2A 3H7IA 2F1HA 4WC7A 5KTQA 8ICYA 3N4MB 1XC9A 1JAJA 4FBTA 1TFYA 8ICUA 2W8KA 1EXNA 3RB4A 4KLQA 5KFXA 1Z3EB 9ICEA 3ISCA 5DDMA 4B9MA 1Y88A 4F2SA 5DB8A 3UQ0A 5DLFA 4EP7A 1TAUA 5J2EA 1XSLA 1S0NA 4RWQA 5CA7A 4YR3A 3RR7A 4UD4A 2ZH5A 2V4QA 8ICPA 7ICPA 3MR6A 2BQ3A 3IHQB 3OVAA 2ZHBA 3PR5B 5KFRA 5DBAA 9ICJA 2ZH4A 3Q8QB 4BXOB 2R8IA 5EOZA 5HRFA 3H3AA 4DF4A 4MFFA 4J9LA 2XC9A 4DSEA 4ELVA 2XCPA 2XCAA 3RJFA 3MFHA 4NLGA 2FMQA 4KLGA 1BPYA 3EYZA 5KFFA 3FYHA 5KG1A 2W9BA 5KG7A 3TFSA 2JEGA 4GXIA 2ZH7A 4F4WA 3V72A 1ZQJA 5DBBA 3LK9A 3SYZA 3OSPA 4TUQA 3OHBA 4NLZA 2MUTA 3C21A 1L3UA 2BKEA 2FPMA 2HVIA 1QSYA 3H38A 1ZQWA 1FA0A 3TAPA 5CB1A 3MR5A 2DVIA 2PFNA 3OUYA 2BGWA 1NJZA 4RZRA 4X4PA 3MR3A 4JK1A 4EYHB 2Y1IA 4IRDA 4DS5A 8ICZA 1S0VA 4ATBA 2JZBB 4RQ1A 3RH6A 4UB2A 3OJUA 5CWRA 2NRKA 3JPTA 1UA0A 4FHWA 4KLTA 3RRGA 2M2UA 4M5DA 1CEZA 4WBZA 1JQRA 4DSJA 4AT8A 4WC5A 1ZQVA 1S9FA 2A1JA 5EWFA 3H40A 3KHHA 3PW0A 4ECXA 1L3SA 4NLKA 2M2WA 4J9PA 3EZ5A 1UETA 2ZTCA 4YQWA 2DRAA 3MABA 2PFOA 3GV5B 3THVA 3ORYA 3RTVA 3PW7A 1S76D 4R63A 3UXOA 5KG2A 4YR2A 4WC6A 4DOAA 5DLGA 4X4NA 2AGQA 2F1IA 4DL5A 4M9GA 3GIKA 1ZQHA 5J0QA 7ICGA 1BGXT 2ZJAA 2IHMA 4X0BA 3WFQE 3MR2A 3WFPA 4RQ3A 4YP3A 3G6YA 2XY7A 2RDJA 5KFAA 2FMSA 4XQ8A 4ECZA 1ZQMA 4DQIA 5HRIA 3C66A 5KFCA 4DQQA 4QZIA 2FLNA 1HJPA 2W8LA 5KFPA 7ICSA 4F4KA 4DOBA 1ZQCA 5HRKA 2FLPA 4ECTA 3T5LA 7ICOA 4B9LA 4UBBA 2Q0ZX 5HRHA 1A77A 3ETLA 4KMUA 3Q8SB 9ICKA 1VJ7A 7ICJA 4EBJA 4DQRA 4B9UA 3UPSA 2ISPA 5J2DA 4DLGA 8ICCA 8ICJA 5DB6A 3LWMA 5HC9A 4KN7A 3ZDEA 2LYHA 2VA2A 1BPDA 2HHQA 1TFWA 3WFSC 3SI8A 3KTQA 1MQ2A 5J2JA 1T7PA 4J9RA 4DFPA 4ECQA 2DPJA 3BJYA 1TK8A 4QZAA 2VA3A 4KLHA 2PXIA 3M8SA 4EZ6A 4KLIA 4RT2A 3GILA 4K4HA 3BQ2A 4C8MA 5D46A 5KFEA 4DL6A 1QSLA 2AU0A 5DG9A 3QZ7A 2W9CB 2AQ4A 2HW3A 9ICLA 4FH5A 2NRTA 2KN7A 1SL2A 2KFZA 5KG3A 3OGUA 3K4GA 1F5AA 7ICKA 4ED6A 4QZHA 5DECA 2ZTDA 3PO4A 1JMSA 4DF8A 5KFWA 9ICMA 2Y1JA 4X4OA 4NLNA 4LT6A 1SKRA 3GIIA 5DGAA 1HUZA 1JN3A 4F50A 4IRCA 1Z00A 2BQUA 9ICRA 1H38A 4RNMA 2R8JA 4M9NA 5JUMA 4IQWA 8ICSA 4R8UA 9ICVA 4ECRA 3JPSA 8ICXA 1NJYA 4XUSA 1X9MA 3OV7A 2ZH8A 1ZJNA 2PFQA 1KSPA 7ICTA 2PBEA 3ZDDA 3OVBA 5BOLA 1UEVA 5J0WA 2BDPA 4RPZA 5D4BA 2BPFA 3ZDBA 4RQ8A 4M9JA 4F5PA 4M9LA 5CR0A 1BVSA 3H8JA 9ICXA 4S3NA 4I2GA 4BWJA 3C5FA 4RWPA 2HHVA 4WBYA 4TUPA 2ASDA 1XSNA 3WFOA 4Z6DA 1RPLA 5KFUA 4RNOA 1R8BA 4Q8EA 5KFLA 1COOA 4RUCA 2KZZA 4F5NA 3RJKA 4GC6A 4QZ9A 4O3PA 1KFSA 2ZTEA 4RNNA 5J2BA 4Z6FA 1D9DA 4UB3A 4QW9A 4I2BA 4B9NA 4ED7A 4IR9A 3HJ1A 3UXNA 5KFKA 4XQ7A 3SZ2A 1B22A 3PNCA 1D8YA 4E0DA 4NKUA 3C1ZA 4YD1A 1NK4A 1MIYA 4JUZA 2KFNA 4X4UA 4PHDA 1B43A 3Q8PB 2FPKA 2I9GA 5KG0A 5L1IA 5DBCA 2M2TA 2HHPA 2BPCA 1ZQAA 1L3VA 4YD2A 1RZTA 3M9MB 4I29A 4IQUA 4O3OA 5L1JA 3T3FA 3V6KA 2C22A 5KFMA 9ICFA 2NRVA 3GV8B 4EBKA 2I1QA 4ED3A 3C1YA 3RAQA 2IHNA 4YMOA 5HRBA 2ZH9A 4J9QA 2M2VA 1K1QA 2KP7A 3BDPA 4ATBB 1XU4A 3Q8LA 4DL4A 1N56A 1X9WA 9ICGA 4FHVA 5KT6A 5L9XA 4ECVA 4AT8B 1DOQA 3V7KA 5HRGA 3T5HA 4F4XA 3GFKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A1J B;  4ECU A;  1MQ3 A;  4DL2 A;  8ICH A;  5DB9 A;  4NM1 A;  9ICT A;  3OJS A;  4PHE A;  4DSI A;  4JWN A;  3AUO A;  5BOM A;  2ALZ A;  1NKC A;  4YXM A;  4RUA A;  5L1K A;  5IIJ A;  8ICE A;  3BQT A;  4PHA A;  4E8F A;  8ICM A;  1NKB A;  4DFJ A;  4WC3 A;  1KFD A;  2GWS A;  5DED A;  3OVS A;  4RPY A;  2HHT A;  5KFT A;  1QLN A;  4PH5 A;  1XSP A;  4P4M A;  2XY6 A;  7ICR A;  1OU5 A;  4MEY A;  1ZQD A;  4B9S A;  4PGQ A;  4KLJ A;  1T3N A;  4KLU A;  2KTQ A;  3HP6 A;  4QZD A;  4RPX A;  7ICE A;  3C23 A;  3TFR A;  4QWC A;  1ZQT A;  2R8G A;  8ICN A;  3LQC B;  3RJE A;  5J2C A;  3PX4 A;  4QZB A;  1U48 A;  2VAN A;  3HWT A;  1JXE A;  2C2D A;  2HHX A;  2KZ3 A;  4O0I A;  3GQC A;  2HHU A;  1KNY A;  3JPP A;  4MEX A;  3EWA A;  2ISO A;  3ZDC A;  2HHW A;  4NM2 A;  1DK2 A;  1BPE A;  4FHY A;  5DG7 A;  3EW9 A;  5KG4 A;  5J2I A;  3JPR A;  5DDY A;  3WFR E;  1ZQL A;  1TFR A;  5EWE A;  4Q44 A;  4IR1 A;  3M9N B;  3ZDA A;  3AQM A;  7ICU A;  4O3S A;  4NKT A;  5KFQ A;  4KLF A;  1JX4 A;  5TZV A;  5KFN A;  4GXJ A;  3LDA A;  4KLL A;  1VFG A;  1V9P A;  1MIW A;  4DFK A;  5KFS A;  9ICP A;  3RRH A;  2DFL A;  2M9N A;  4PGX A;  3LWL A;  3HW8 A;  9ICU A;  4E7X A;  4AT7 A;  4ECS A;  4DLE A;  4EEY A;  1TK5 A;  1U47 A;  1ARO P;  3FDS A;  1SZP A;  5KFG A;  4YN4 A;  1UT5 A;  5J0O A;  3KHR A;  2IA6 A;  2R8K A;  2C2E A;  5DQI A;  4JV2 A;  9ICW A;  4GLX A;  2ZUB A;  4KIT B;  1BPX A;  5HRL A;  5DG8 A;  3ZD9 A;  2HVH A;  5F9N A;  3N97 B;  2ZHA A;  5J0T A;  5J2H A;  4X5V A;  1ZQE A;  4J9O A;  3C2M A;  4YCX A;  4RQ2 A;  3MDA A;  5KFV A;  5HNK A;  1N48 A;  1TK0 A;  4B9T A;  1RYS A;  1WCL A;  2J6U A;  5HHI A;  5J0U A;  4Z6E A;  3MGH A;  1JXL A;  2P66 A;  1XS9 D;  4DEZ A;  2UVR A;  4P2H A;  5J0R A;  4F4Z A;  4FO6 A;  5IIM A;  2RDI A;  4J9S A;  3H4D A;  1Z00 B;  2ASJ A;  1S77 D;  4ED8 A;  7ICI A;  5KFZ A;  1RXW A;  3QEB Z;  1K1S A;  4RQ4 A;  3BQ0 A;  3PX0 A;  1SL1 A;  3RJG A;  4O9M A;  1S97 A;  8ICQ A;  8ICG A;  4R8U B;  2DR9 A;  4P4P A;  5DKW A;  4TUS A;  2R8H A;  2BR0 A;  9ICQ A;  4HYK A;  4EBE A;  5F2V O;  3G6X A;  1NOM A;  1TV9 A;  3E2E A;  4I2C A;  4F3O A;  4QWE A;  2PI4 A;  3OHA A;  1QTM A;  1KRP A;  1KTQ A;  1ZQZ A;  4UAZ A;  5J0S A;  1ZYQ A;  3M9O B;  4LZG A;  1KEJ A;  4QZF A;  3GIM A;  3UPQ A;  5HHH A;  3HJ4 A;  4M6W A;  5IIO A;  4AT9 A;  2XO7 A;  3RBD A;  1WOT A;  5KG5 A;  4JV0 A;  4I2F A;  4RQ0 A;  7ICH A;  4WC4 A;  4QWD A;  5DQG A;  4Q43 A;  3RJJ A;  4E80 A;  1ZQX A;  2OWO A;  3AU2 A;  4PHP A;  4GC7 A;  5CJ7 A;  1NK5 A;  1SKW A;  1ZQR A;  3HX0 A;  4Z6C A;  5KT5 A;  3HT3 A;  3Q8R B;  1QSS A;  2PI5 A;  3JZ0 A;  4XRH A;  4UD5 A;  4ED0 A;  3V7L A;  1ZQG A;  4I2E A;  3MBY A;  4ED1 A;  3TAQ A;  4CCH A;  3TI0 A;  4QWB A;  2BCR A;  4M04 A;  4RWO A;  5HP4 A;  2ZH3 A;  1LV5 A;  4O3N A;  1S10 A;  4KLE A;  4Q8F A;  4J9N A;  1ZET A;  4C8N A;  4FS2 A;  1S0M A;  4G3I A;  4RQ6 A;  4RT3 A;  2BCV A;  4RU9 A;  5J2F A;  4DFM A;  3EPG A;  1ZQU A;  4WC1 A;  1NK9 A;  1LB2 B;  4O3R A;  4O5E A;  4X4T A;  2ZJ5 A;  1YLQ A;  4NXZ A;  2W9B B;  1NO5 A;  4ELT A;  4RQ7 A;  2NRZ A;  4Q45 A;  4DOC A;  2BCU A;  9ICS A;  4FHP A;  5D49 A;  4BGD A;  1UT8 A;  5J2K A;  5KFD A;  4MF2 A;  3RH5 A;  8ICB A;  5HRD A;  3ISD A;  4R64 A;  1Q78 A;  2ZH6 A;  3H8S A;  4MF8 A;  3KHL A;  8ICT A;  2ZUC A;  2MUT B;  1L5U A;  4DL3 A;  3TAR A;  1BNP A;  3HPO A;  3TAN A;  4F93 B;  2W9A A;  1KDH A;  4ZH4 A;  3OUY B;  2V4R A;  4GXK A;  4IG8 A;  4I2H A;  1DGS A;  4YXJ A;  5L1L A;  4DSF A;  1NK0 A;  3B0Y A;  1ZQI A;  3SV3 A;  4I2I A;  2J6S A;  5KT2 A;  5DGB A;  4J9K A;  8ICR A;  3H37 A;  2UVU A;  1U9L A;  4F5O A;  1ZQO A;  1ZQF A;  1R89 A;  4YVZ A;  2V9W A;  4DSK A;  3AU6 A;  3UQ2 A;  3QEA Z;  5KFI A;  2H5X A;  3M8R A;  2AQ0 A;  1DK3 A;  3L9D A;  1JIH A;  1TVA A;  7ICM A;  5KFY A;  3C2L A;  4MFC A;  2FMP A;  2NRX A;  2B21 A;  5KT3 A;  2RFF A;  3C2K A;  4KLS A;  9ICN A;  4UAW A;  2IMW P;  2AJQ A;  4F5Q A;  1NKE A;  1IXR A;  1SKS A;  2JEF A;  4RWN A;  3PML A;  3AQK A;  4IQT A;  3MFI A;  1BNO A;  4F8R A;  4DQP A;  2O1P A;  1NZP A;  4WC0 A;  8ICV A;  5C5J A;  3RBE A;  1PX5 A;  5BPC A;  4EYI B;  3SV4 A;  4UB1 A;  3RJI A;  4O3Q A;  5J0Y A;  4ECY A;  2UVV A;  2P6R A;  4BXO A;  4ELU A;  4QZE A;  3AQL A;  4IRK A;  3IM1 A;  3PV8 A;  2ZJ8 A;  9ICA A;  1MC8 A;  4YMN A;  3TQ1 A;  4I2A A;  2XY5 A;  1MSW D;  1V4A A;  1RXV A;  3PW4 A;  2FLL A;  1ZQY A;  4FHX A;  1ZQQ A;  4M0A A;  4UAY A;  4TQS A;  3GIJ A;  2DPI A;  4AT7 B;  3H4B A;  2ATL A;  3KHG A;  9ICI A;  4LZD A;  1C7Y A;  3G6V A;  1TKD A;  4C8K A;  5III A;  2BE3 A;  2AGO A;  5IIL A;  4K4G A;  3RAX A;  4F2R A;  1U4B A;  2ID1 A;  1BPB A;  3K75 D;  5IIN A;  8ICI A;  3QE9 Y;  3PR4 A;  3JPQ A;  3H39 A;  4BDP A;  2JZB A;  2BQR A;  1A76 A;  5J0P A;  3V6J A;  4P4O A;  3RJH A;  5CP2 A;  4MFA A;  2JEI A;  4QWA A;  4RQ5 A;  4UBC A;  4EBC A;  4WC2 A;  2ZH2 A;  4KLO A;  1UA1 A;  4QZ8 A;  4X4R A;  1TAQ A;  1X2I A;  1XO1 A;  4PPX A;  2ZH1 A;  4X4V A;  3AQN A;  2DR7 A;  3JPO A;  5KFO A;  4KTQ A;  4TQR A;  4QW8 A;  3GV7 B;  1RYR A;  1NK7 A;  3JYY A;  4X4S A;  3T5J A;  3H8W A;  3RH4 A;  4O5K A;  5KT4 A;  4DWI A;  4JWM A;  7ICL A;  1X9S A;  2VA8 A;  4X4Q A;  1T4G A;  1NK6 A;  2NRW A;  3OSN A;  4JV1 A;  7ICQ A;  3B0X A;  8ICO A;  5IIK A;  7ICV A;  3PVX A;  4I28 A;  2BPG A;  4NY8 A;  2C2R A;  8ICF A;  9ICB A;  4YMM A;  5HR9 A;  5J29 A;  1R8A A;  5J2G A;  4BWM A;  5DB7 A;  3UXP A;  2C28 A;  7ICN A;  1UEU A;  4M9H A;  4TUR A;  3RR8 A;  4F91 B;  4M6W B;  3Q8K A;  1L3T A;  1ZQK A;  4AT9 B;  4DSL A;  4O5C A;  5KG6 A;  1ZQB A;  4KLD A;  2WTF A;  4C8L A;  1ZJM A;  4DO9 A;  3C18 A;  5HML A;  1NK8 A;  3ZD8 A;  4DQS A;  2HHS A;  8ICW A;  2W9M A;  4UB4 A;  5KFH A;  3ISB A;  1U49 A;  9ICO A;  1WCN A;  8ICL A;  1ZQS A;  4R66 A;  4ECW A;  1HUO A;  2XGP A;  4PGY A;  2P6U A;  1ZQP A;  4EZ9 A;  2F1J A;  4I2D A;  4R65 A;  4EBD A;  4M2Y A;  1XWL A;  4F92 B;  1Q79 A;  2O5A A;  4YFK A;  4UQG A;  4UB5 A;  3Q8M A;  4IQV A;  2J6T A;  2UVW A;  2XGQ A;  1U45 A;  9ICH A;  4XA5 A;  4B9V A;  3T5K A;  2JEJ A;  1MIV A;  5EWG A;  3V6H A;  4X0A A;  3PX6 A;  4KN4 A;  8ICA A;  2FPL A;  3RB3 A;  1NJW A;  2KZM A;  1KFT A;  1IM4 A;  4C8O A;  4KLM A;  5HMM A;  3GDX A;  3HIY A;  3PY8 A;  1NJX A;  4M47 A;  5KT7 A;  2DR5 A;  3PO5 A;  3NGD A;  3V7J A;  4DL7 A;  3PW5 A;  2MAX A;  2W9C A;  3RB6 A;  1PZN A;  1T8E A;  4QZG A;  4I2J A;  4FS1 A;  2IBK A;  7ICF A;  5F9L A;  5J2A A;  9ICC A;  4F4Y A;  2ZUD A;  1SL0 A;  3NYB A;  5KFJ A;  3MDC A;  3EPI A;  3JPN A;  3BQ1 A;  4J9M A;  1S0O A;  2PFP A;  1D9F A;  4LVS A;  5HRE A;  8ICK A;  3NTU A;  3PW2 A;  2BCS A;  4I27 A;  4YG2 A;  3C5G A;  3QZ8 A;  2BCQ A;  1R8C A;  1D8L A;  2BHN A;  4QZC A;  1CUK A;  5CHG A;  3PMN A;  3MGI A;  4F5R A;  2ASL A;  1KLN A;  2DRB A;  2DR8 A;  1BPZ A;  5KFB A;  4DS4 A;  4FH3 A;  5J0X A;  2AGP A;  4K4I A;  2Q66 A;  4FBU A;  5DQH A;  3RB0 A;  4YR0 A;  4WCW A;  1ZQN A;  4ED2 A;  3H7I A;  2F1H A;  4WC7 A;  5KTQ A;  8ICY A;  3N4M B;  1XC9 A;  1JAJ A;  4FBT A;  1TFY A;  8ICU A;  2W8K A;  1EXN A;  3RB4 A;  4KLQ A;  5KFX A;  1Z3E B;  9ICE A;  3ISC A;  5DDM A;  4B9M A;  1Y88 A;  4F2S A;  5DB8 A;  3UQ0 A;  5DLF A;  4EP7 A;  1TAU A;  5J2E A;  1XSL A;  1S0N A;  4RWQ A;  5CA7 A;  4YR3 A;  3RR7 A;  4UD4 A;  2ZH5 A;  2V4Q A;  8ICP A;  7ICP A;  3MR6 A;  2BQ3 A;  3IHQ B;  3OVA A;  2ZHB A;  3PR5 B;  5KFR A;  5DBA A;  9ICJ A;  2ZH4 A;  3Q8Q B;  4BXO B;  2R8I A;  5EOZ A;  5HRF A;  3H3A A;  4DF4 A;  4MFF A;  4J9L A;  2XC9 A;  4DSE A;  4ELV A;  2XCP A;  2XCA A;  3RJF A;  3MFH A;  4NLG A;  2FMQ A;  4KLG A;  1BPY A;  3EYZ A;  5KFF A;  3FYH A;  5KG1 A;  2W9B A;  5KG7 A;  3TFS A;  2JEG A;  4GXI A;  2ZH7 A;  4F4W A;  3V72 A;  1ZQJ A;  5DBB A;  3LK9 A;  3SYZ A;  3OSP A;  4TUQ A;  3OHB A;  4NLZ A;  2MUT A;  3C21 A;  1L3U A;  2BKE A;  2FPM A;  2HVI A;  1QSY A;  3H38 A;  1ZQW A;  1FA0 A;  3TAP A;  5CB1 A;  3MR5 A;  2DVI A;  2PFN A;  3OUY A;  2BGW A;  1NJZ A;  4RZR A;  4X4P A;  3MR3 A;  4JK1 A;  4EYH B;  2Y1I A;  4IRD A;  4DS5 A;  8ICZ A;  1S0V A;  4ATB A;  2JZB B;  4RQ1 A;  3RH6 A;  4UB2 A;  3OJU A;  5CWR A;  2NRK A;  3JPT A;  1UA0 A;  4FHW A;  4KLT A;  3RRG A;  2M2U A;  4M5D A;  1CEZ A;  4WBZ A;  1JQR A;  4DSJ A;  4AT8 A;  4WC5 A;  1ZQV A;  1S9F A;  2A1J A;  5EWF A;  3H40 A;  3KHH A;  3PW0 A;  4ECX A;  1L3S A;  4NLK A;  2M2W A;  4J9P A;  3EZ5 A;  1UET A;  2ZTC A;  4YQW A;  2DRA A;  3MAB A;  2PFO A;  3GV5 B;  3THV A;  3ORY A;  3RTV A;  3PW7 A;  1S76 D;  4R63 A;  3UXO A;  5KG2 A;  4YR2 A;  4WC6 A;  4DOA A;  5DLG A;  4X4N A;  2AGQ A;  2F1I A;  4DL5 A;  4M9G A;  3GIK A;  1ZQH A;  5J0Q A;  7ICG A;  1BGX T;  2ZJA A;  2IHM A;  4X0B A;  3WFQ E;  3MR2 A;  3WFP A;  4RQ3 A;  4YP3 A;  3G6Y A;  2XY7 A;  2RDJ A;  5KFA A;  2FMS A;  4XQ8 A;  4ECZ A;  1ZQM A;  4DQI A;  5HRI A;  3C66 A;  5KFC A;  4DQQ A;  4QZI A;  2FLN A;  1HJP A;  2W8L A;  5KFP A;  7ICS A;  4F4K A;  4DOB A;  1ZQC A;  5HRK A;  2FLP A;  4ECT A;  3T5L A;  7ICO A;  4B9L A;  4UBB A;  2Q0Z X;  5HRH A;  1A77 A;  3ETL A;  4KMU A;  3Q8S B;  9ICK A;  1VJ7 A;  7ICJ A;  4EBJ A;  4DQR A;  4B9U A;  3UPS A;  2ISP A;  5J2D A;  4DLG A;  8ICC A;  8ICJ A;  5DB6 A;  3LWM A;  5HC9 A;  4KN7 A;  3ZDE A;  2LYH A;  2VA2 A;  1BPD A;  2HHQ A;  1TFW A;  3WFS C;  3SI8 A;  3KTQ A;  1MQ2 A;  5J2J A;  1T7P A;  4J9R A;  4DFP A;  4ECQ A;  2DPJ A;  3BJY A;  1TK8 A;  4QZA A;  2VA3 A;  4KLH A;  2PXI A;  3M8S A;  4EZ6 A;  4KLI A;  4RT2 A;  3GIL A;  4K4H A;  3BQ2 A;  4C8M A;  5D46 A;  5KFE A;  4DL6 A;  1QSL A;  2AU0 A;  5DG9 A;  3QZ7 A;  2W9C B;  2AQ4 A;  2HW3 A;  9ICL A;  4FH5 A;  2NRT A;  2KN7 A;  1SL2 A;  2KFZ A;  5KG3 A;  3OGU A;  3K4G A;  1F5A A;  7ICK A;  4ED6 A;  4QZH A;  5DEC A;  2ZTD A;  3PO4 A;  1JMS A;  4DF8 A;  5KFW A;  9ICM A;  2Y1J A;  4X4O A;  4NLN A;  4LT6 A;  1SKR A;  3GII A;  5DGA A;  1HUZ A;  1JN3 A;  4F50 A;  4IRC A;  1Z00 A;  2BQU A;  9ICR A;  1H38 A;  4RNM A;  2R8J A;  4M9N A;  5JUM A;  4IQW A;  8ICS A;  4R8U A;  9ICV A;  4ECR A;  3JPS A;  8ICX A;  1NJY A;  4XUS A;  1X9M A;  3OV7 A;  2ZH8 A;  1ZJN A;  2PFQ A;  1KSP A;  7ICT A;  2PBE A;  3ZDD A;  3OVB A;  5BOL A;  1UEV A;  5J0W A;  2BDP A;  4RPZ A;  5D4B A;  2BPF A;  3ZDB A;  4RQ8 A;  4M9J A;  4F5P A;  4M9L A;  5CR0 A;  1BVS A;  3H8J A;  9ICX A;  4S3N A;  4I2G A;  4BWJ A;  3C5F A;  4RWP A;  2HHV A;  4WBY A;  4TUP A;  2ASD A;  1XSN A;  3WFO A;  4Z6D A;  1RPL A;  5KFU A;  4RNO A;  1R8B A;  4Q8E A;  5KFL A;  1COO A;  4RUC A;  2KZZ A;  4F5N A;  3RJK A;  4GC6 A;  4QZ9 A;  4O3P A;  1KFS A;  2ZTE A;  4RNN A;  5J2B A;  4Z6F A;  1D9D A;  4UB3 A;  4QW9 A;  4I2B A;  4B9N A;  4ED7 A;  4IR9 A;  3HJ1 A;  3UXN A;  5KFK A;  4XQ7 A;  3SZ2 A;  1B22 A;  3PNC A;  1D8Y A;  4E0D A;  4NKU A;  3C1Z A;  4YD1 A;  1NK4 A;  1MIY A;  4JUZ A;  2KFN A;  4X4U A;  4PHD A;  1B43 A;  3Q8P B;  2FPK A;  2I9G A;  5KG0 A;  5L1I A;  5DBC A;  2M2T A;  2HHP A;  2BPC A;  1ZQA A;  1L3V A;  4YD2 A;  1RZT A;  3M9M B;  4I29 A;  4IQU A;  4O3O A;  5L1J A;  3T3F A;  3V6K A;  2C22 A;  5KFM A;  9ICF A;  2NRV A;  3GV8 B;  4EBK A;  2I1Q A;  4ED3 A;  3C1Y A;  3RAQ A;  2IHN A;  4YMO A;  5HRB A;  2ZH9 A;  4J9Q A;  2M2V A;  1K1Q A;  2KP7 A;  3BDP A;  4ATB B;  1XU4 A;  3Q8L A;  4DL4 A;  1N56 A;  1X9W A;  9ICG A;  4FHV A;  5KT6 A;  5L9X A;  4ECV A;  4AT8 B;  1DOQ A;  3V7K A;  5HRG A;  3T5H A;  4F4X A;  3GFK B; 
#chains in the Genus database with same CATH topology
 2A1J B;  1MQ3 A;  5DB9 A;  9ICT A;  4NL9 C;  3PHZ A;  4YXM A;  4RUA A;  5IIJ A;  1KFD A;  5DED A;  1QLN A;  1L7O A;  1ZQD A;  2ZXI A;  4PGQ A;  4KLJ A;  1T3N A;  3HP6 A;  4QZD A;  3C23 A;  1ZQT A;  3LQC B;  3RJE A;  3PX4 A;  4Y2P A;  1U48 A;  4O0I A;  2HHU A;  3JPP A;  3ZDC A;  4X4R A;  4K97 A;  3EW9 A;  3SR6 A;  1ZQL A;  2OHF A;  4Q44 A;  4IR1 A;  3AQM A;  3ZDA A;  4O3S A;  5KFQ A;  5KFN A;  3LDA A;  4KLL A;  2FI1 A;  5KFS A;  4PGX A;  9ICU A;  4K8V A;  5KFG A;  3KHR A;  2C2E A;  1L7N A;  4GLX A;  4KIT B;  2HN2 A;  5DG8 A;  2ZHA A;  5F9N A;  5FP0 A;  1YZ7 A;  3C2M A;  4YCX A;  4UW9 A;  5KFV A;  1WCL A;  2J6U A;  2P66 A;  5J0R A;  3H4D A;  1S77 D;  4ED8 A;  3PX0 A;  1K5O A;  4R8U B;  5DKW A;  2N1R A;  1NOM A;  4QIW F;  2PI4 A;  3OHA A;  1KRP A;  5J0S A;  1ZYQ A;  1KEJ A;  4QZF A;  3GIM A;  3HJ4 A;  5AI0 A;  4M6W A;  4UAS A;  5IIO A;  5KAI U;  1FIQ A;  5KG5 A;  3QX7 A;  4JV0 A;  5DQG A;  2KIW A;  3SAH A;  2E8N A;  2PI5 A;  2Y9T A;  1AQ6 A;  3V7L A;  1ZQG A;  1SV4 A;  2A3V A;  4M04 A;  1S10 A;  4MHV A;  4C8N A;  4KM5 A;  2YN4 A;  3RFA A;  1PK1 B;  5G5H A;  3HJE A;  1ZQU A;  3PSP A;  1NK9 A;  4AP9 A;  2ZJ5 A;  1YLQ A;  1ZD4 A;  4NXZ A;  4ELT A;  2NRZ A;  3J81 j;  5D49 A;  2ZH6 A;  4MF2 A;  5HRD A;  1URJ A;  5AIB A;  2IUB A;  2KSO B;  2MUT B;  1L5U A;  2FJ6 A;  1O03 A;  3AL0 B;  3NS1 A;  1KW4 A;  4ZH4 A;  2V4R A;  4IG8 A;  3A0H U;  4DSF A;  1WWV A;  3SV3 A;  4J9K A;  4PZO A;  2ZIU B;  4RQM A;  2E8M A;  4F5O A;  4YVZ A;  4DSK A;  3QEA Z;  5KFI A;  3M8R A;  1DK3 A;  1TVA A;  2K4E A;  3BS7 A;  3WKC A;  4RWN A;  3MFI A;  1J2M A;  4EYI B;  4BXO A;  5AHX A;  5J0Y A;  3E0F A;  4OCZ A;  4IRK A;  1MC8 A;  3TQ1 A;  4P0P A;  1MSW D;  5HR7 A;  1J97 A;  5AKK A;  2DPI A;  3GIJ A;  2KEY A;  4LZD A;  5EE0 A;  5D63 A;  2LI6 A;  2BE3 A;  3ICX A;  2AGO A;  3D2S A;  4EEL A;  4K4G A;  2ID1 A;  3K75 D;  3H39 A;  1X9X A;  3NVW A;  5J0P A;  4MFA A;  2JEI A;  4QWA A;  4UBC A;  3TAD A;  5ALK A;  3U26 A;  1TAQ A;  2BBH A;  1X2I A;  1ZXI A;  2WB1 F;  4PPX A;  3JPO A;  3MGV A;  2F8K A;  3JYY A;  3H8W A;  4A8E A;  4RQN A;  2VA8 A;  5AKJ A;  4X4Q A;  3OSN A;  3B0X A;  5IIK A;  7ICV A;  3PVX A;  3QUC A;  1ZD5 A;  4YMM A;  3WFS C;  5J29 A;  3NRZ A;  3ONN A;  5AM1 A;  1B4F A;  1ZQK A;  3I76 A;  4DSL A;  4O5C A;  5KG6 A;  1F44 A;  4C8L A;  4DO9 A;  2JMG A;  1UHU A;  4WOY A;  2W9M A;  3ISB A;  1S5L U;  4C4T A;  2XGP A;  1KL9 A;  2P6U A;  4GIB A;  3NVO A;  3I1Y A;  2O5A A;  4IQV A;  2B6G A;  3T5K A;  5EWG A;  3PX6 A;  1ECW A;  4Y2X A;  5HMM A;  3GDX A;  1XNS A;  5KT7 A;  2W3R A;  2IBK A;  2W9C A;  1PZN A;  4NWI A;  3WKE A;  2WB1 C;  2Y0S F;  3KZX A;  2ZXH A;  3O0F A;  3NTU A;  4I27 A;  1Z4O A;  4YG2 A;  2BCQ A;  2YMP A;  3MGI A;  1CUK A;  2LKY A;  5ALH A;  5J0X A;  2Q66 A;  4FBU A;  3RB0 A;  4YR0 A;  4WCW A;  1ZQN A;  2F1H A;  4WC7 A;  1XC9 A;  2W8K A;  3DDH A;  1EXN A;  2YTU A;  1Z3E B;  2HBM A;  5DDM A;  5AK5 A;  1SXD A;  2AXT U;  3AMZ A;  1XSL A;  3CP8 A;  3RR7 A;  4UD4 A;  3BQ7 A;  3OVA A;  3SQI A;  3PR5 B;  5AKI A;  9ICJ A;  3Q8Q B;  2R8I A;  5EOZ A;  3H3A A;  4ELV A;  5JU5 A;  2XCP A;  4NLG A;  2Y9U A;  2FMQ A;  3EYZ A;  5B5E U;  3D2Q A;  5KG1 A;  1J2N A;  2G06 A;  2G5H B;  2ZH7 A;  2EDU A;  4F4W A;  2Y0S C;  5CHE A;  3OHB A;  2F77 X;  2MUT A;  2WF5 A;  1L3U A;  1QSY A;  3H38 A;  1ZQW A;  3K1Z A;  5CB1 A;  2PFN A;  4US8 A;  2BGW A;  2IHO A;  2Y1I A;  2W43 A;  3VCB A;  1S0V A;  3RH6 A;  4UB2 A;  2ZIU A;  4FHW A;  4AT8 A;  3RRG A;  3IP4 B;  1CEZ A;  3WK4 A;  4CDG A;  1Q3V A;  5EWF A;  3IRU A;  3PW0 A;  5EE1 A;  4J9P A;  3EZ5 A;  2ZTC A;  2DRA A;  3KZI U;  5KG2 A;  3MCR A;  4WC6 A;  2DBY A;  5D62 A;  4DOA A;  5DLG A;  2AGQ A;  4OD0 A;  2F1I A;  7ICG A;  2HOQ A;  1BGX T;  2IHM A;  3WFP A;  4DQI A;  2XY7 A;  2RDJ A;  3C66 A;  5HRI A;  2F44 A;  2KHQ A;  2FLN A;  7ICS A;  4KX3 A;  2FLP A;  2NV3 A;  3T5L A;  1Q8K A;  2ISP A;  5J2D A;  8ICC A;  5HC9 A;  4KN7 A;  4O67 A;  3CW2 C;  3IG8 A;  1BPD A;  3H0R B;  1Z19 A;  3KTQ A;  2W54 A;  1T7P A;  4Y2Y A;  4J9R A;  4DFP A;  3BJY A;  3AQF A;  1WG8 A;  4KLH A;  2PXI A;  3M8S A;  4EZ6 A;  2KG5 A;  4RT2 A;  3BQ2 A;  4MKP A;  3QU5 A;  3QZ7 A;  2HW3 A;  4FH5 A;  1WWU A;  1SL2 A;  5KG3 A;  3OGU A;  3K4G A;  1F5A A;  7ICK A;  1UPH A;  3UMC A;  4QZH A;  3PO4 A;  4X4O A;  1SKR A;  3GII A;  1HUZ A;  4OJ5 A;  4DCC A;  1H38 A;  5JUM A;  1PVP A;  4ECR A;  2HBJ A;  9ICV A;  2HCF A;  2WF8 A;  2E5S A;  1RQN A;  2ZH8 A;  2GLE A;  3ZDD A;  3OVB A;  3QYP A;  2I5H A;  2BDP A;  5D4B A;  3H8J A;  4ICA A;  3WK6 A;  4I2G A;  3C5F A;  4RWP A;  4WBY A;  5AIA A;  3NUQ A;  2ASD A;  1XSN A;  3WFO A;  1OXJ A;  2LYB A;  3RJK A;  4GC6 A;  2YB1 A;  1KFS A;  5G5G A;  4Z6F A;  4QW9 A;  4I2B A;  4B9N A;  2GAF D;  5ALT A;  4E0D A;  4NXU A;  4JUZ A;  2ZIV A;  2KFN A;  4UAR A;  4PHD A;  3Q8P B;  4C7Y A;  2FPK A;  5KG0 A;  5CRX A;  1YZ6 A;  2BPC A;  1ZQA A;  1GO3 F;  1SV0 C;  1RZT A;  3M9M B;  4O3O A;  3V6K A;  2C22 A;  5KFM A;  4EBK A;  5HRB A;  1ZRM A;  2LBO A;  1K1Q A;  4DL4 A;  2WAQ F;  5KT6 A;  3AM9 A;  3RF9 A;  3C28 A;  2K60 A;  8ICH A;  4DL2 A;  3AN1 A;  4DSI A;  4JWN A;  2ALZ A;  1NKC A;  5L1K A;  3BQT A;  3OVS A;  4RPY A;  2BZF A;  5KFT A;  2H3F A;  4P4M A;  2XY6 A;  5ALM A;  2B51 A;  5CFT A;  4MEY A;  2OCE A;  4B9S A;  1X66 A;  2LPE A;  3F5E A;  3TFR A;  4QWC A;  8ICN A;  2XVT A;  5AI9 A;  2VAN A;  1A6S A;  2HHX A;  2KZ3 A;  1KNY A;  3EWA A;  1DK2 A;  2HMX A;  3JPR A;  1TFR A;  7ICU A;  3M6Z A;  2IOF A;  4JLX A;  2F2A B;  1V9P A;  2QB0 A;  2OM6 A;  4DFK A;  1F5S A;  4AT7 A;  2RP5 A;  3QU2 A;  4ECS A;  4DLE A;  4EEY A;  3A0B U;  1U47 A;  5CFU A;  2JXJ A;  3R9K A;  2K4P A;  4YN4 A;  1UT5 A;  5J0O A;  2E1E A;  5DQI A;  2ZUB A;  1BPX A;  5J0T A;  4X5V A;  4RQ2 A;  3PST A;  3MDA A;  5HNK A;  4C7Z A;  1RYS A;  1N5X A;  3QUT A;  1JXL A;  5AI6 A;  3ALR A;  4DEZ A;  4F4Z A;  2KD1 A;  5IIM A;  4J9S A;  1Z00 B;  3BQ0 A;  4RQ4 A;  8ICQ A;  1PK3 A;  2BR0 A;  4FZL A;  3E2E A;  4F3O A;  1KTQ A;  1ZQZ A;  4LZG A;  3M9O B;  2FE9 A;  3L3F X;  5ALV A;  4AT9 A;  2XO7 A;  1WOT A;  4I2F A;  3ZI4 A;  4JLZ A;  4WC4 A;  4QWD A;  1ZQX A;  2OWO A;  3AU2 A;  1NK5 A;  5KT5 A;  4UD5 A;  5AKL A;  5B3P A;  4ED1 A;  2K8B B;  4QNL A;  3TAQ A;  4CCH A;  3TI0 A;  4RWO A;  2RHF A;  4Q8F A;  4J9N A;  1ZET A;  4FS2 A;  1S0M A;  4C0Z A;  1SZH A;  1LB2 B;  4O5E A;  2ZIX A;  5ALR A;  2W9B B;  1NO5 A;  4Q45 A;  1V38 A;  2BCU A;  9ICS A;  4BGD A;  5KFD A;  1Q78 A;  3H8S A;  8ICT A;  4F93 B;  2W9A A;  1DGS A;  2KHV A;  4YXJ A;  5ALW A;  1NK0 A;  4KX5 A;  1ZQI A;  2XID A;  5KT2 A;  4BX9 C;  5DGB A;  3H37 A;  4NXX A;  1LKY A;  2R18 A;  1ZQO A;  1R89 A;  1O08 A;  3AU6 A;  1JIH A;  2K89 A;  5E79 U;  5KT3 A;  1ZQ1 C;  4UAW A;  4F5Q A;  4C4S A;  3SEI A;  3PML A;  2O1P A;  1NZP A;  4WC0 A;  3NVY A;  8ICV A;  5C5J A;  1N63 A;  3SV4 A;  3RJI A;  4UB1 A;  4O3Q A;  5AKG A;  2RQ5 A;  2F76 X;  3IM1 A;  3PV8 A;  9ICA A;  4YMN A;  4I2A A;  1RXV A;  3PW4 A;  4NXT A;  5AI5 A;  2FCL A;  4UAY A;  2KV2 A;  3KHG A;  2P35 A;  3G6V A;  5III A;  2A1A A;  5IIL A;  2VJ4 A;  4F2R A;  1BPB A;  3D2N A;  5IIN A;  3QE9 Y;  3PR4 A;  3JPQ A;  3TKA A;  4FZM A;  5L1M A;  1RG6 A;  5CP2 A;  3RJH A;  4EBC A;  2ZH2 A;  1VDV A;  3AQN A;  1V97 A;  1NK7 A;  2CXY A;  3L4P A;  5KT4 A;  1X9S A;  1NK6 A;  2NRW A;  2ZIW B;  4NY8 A;  2CN1 A;  8ICF A;  3JZ0 A;  4WC5 A;  1UEU A;  4BWM A;  5DB7 A;  3QUQ A;  5TIS U;  7ICN A;  4M9H A;  3RR8 A;  4F91 B;  2NO4 A;  1ZQB A;  3C18 A;  1ZJM A;  5HML A;  3ZD8 A;  4DQS A;  2HHS A;  5ALE A;  8ICW A;  4UB4 A;  5KAF U;  5ALX A;  9ICO A;  1WCN A;  8ICL A;  1ZQS A;  1TE2 A;  4R66 A;  1HUO A;  4PGY A;  2F1J A;  4R65 A;  1X6I A;  4EBD A;  1Q3U A;  4USA A;  4YFK A;  4UQG A;  2J6T A;  2EZX A;  4IS7 A;  9ICH A;  2NO5 A;  4KN4 A;  8ICA A;  4OAI Z;  4C8O A;  4KLM A;  3PO5 A;  3NGD A;  3V7J A;  3M7D A;  4DL7 A;  2PBE A;  5ALI A;  4F4Y A;  1SL0 A;  3GU3 A;  5KFJ A;  3MDC A;  3NYB A;  3BQ1 A;  2VJ5 A;  4LVS A;  8ICK A;  3PW2 A;  4P0Q B;  3C5G A;  3QZ8 A;  2KKP A;  1D8L A;  2BHN A;  2ASL A;  2KE7 A;  4UB8 U;  1KLN A;  2XIC A;  2LHT A;  2AGP A;  5ALY A;  3ERC C;  3N28 A;  1N2X A;  5AM3 A;  4WH5 A;  8ICY A;  3AEV A;  4KLQ A;  4G9B A;  4QIW C;  3ISC A;  5J2E A;  5AM5 A;  1S0N A;  5CA7 A;  5ALD A;  3MR6 A;  5ALZ A;  2RRD A;  2E3T A;  5HRF A;  4DF4 A;  4MFF A;  2HDO A;  3KKA A;  3MFH A;  2KIV A;  4GFJ A;  1BPY A;  2W9B A;  3FYH A;  5AM2 A;  3LK9 A;  3SYZ A;  2KNJ A;  4NLZ A;  3C21 A;  2JR5 A;  2W7P A;  1Q46 A;  1FA0 A;  3TAP A;  3LYS A;  4RZR A;  4OO1 J;  4X4P A;  2CRX A;  2LM4 A;  5HR6 A;  4IRD A;  3BZK A;  4OJ6 A;  4DS5 A;  4ATB A;  2JZB B;  4Y2V A;  2JHD A;  5EE3 A;  3JPT A;  3I28 A;  4WBZ A;  4U6P A;  4DSJ A;  4DFD A;  2A1J A;  3KHH A;  4NLK A;  2HBK A;  4K9B A;  2PFO A;  2WF7 A;  3ORY A;  3RTV A;  1S76 D;  3MC1 A;  3AQE A;  5H2F U;  4X4N A;  1PUZ A;  3PSI A;  3WFQ E;  2W04 A;  3MR2 A;  4RQ3 A;  2HOI A;  4HX0 A;  3UMG A;  2W8L A;  2E1F A;  1ZQC A;  4OJP A;  4ECT A;  4QJF B;  7ICO A;  4B9L A;  2Q0Z X;  3ETL A;  5AK4 A;  1VJ7 A;  4EBJ A;  4B9U A;  4OJL A;  8ICJ A;  4KMO B;  4Y2R A;  2OYY A;  1MQ2 A;  5C0Y A;  2DPJ A;  3CRX A;  3D6J A;  5AKH A;  5D46 A;  5DG9 A;  2ODG A;  2AQ4 A;  4NL9 A;  3OTQ A;  1JMS A;  4DF8 A;  2Y1J A;  4LT6 A;  2H3Z A;  4CF3 A;  2R8J A;  4R8U A;  2DQN B;  8ICX A;  5EE9 A;  1X9M A;  1ZJN A;  7ICT A;  5BOL A;  4M9J A;  4LEW A;  5CR0 A;  1QH9 A;  1KKX A;  9ICX A;  4S3N A;  2W55 A;  4BWJ A;  4TUP A;  4Z6D A;  3SMV A;  3N7P D;  5ALL A;  2KZZ A;  1L6N A;  4QZ9 A;  1D9D A;  4IR9 A;  3UXN A;  4NLC A;  1B22 A;  2G5I B;  3C1Z A;  4YD1 A;  1NK4 A;  2L5Y A;  2W11 A;  2JV3 A;  1B43 A;  3M6K A;  5DBC A;  1PK1 A;  4P0Q A;  5ALO A;  5KNI A;  4YD2 A;  2Q4T A;  4PJ0 U;  4I29 A;  9ICF A;  3GV8 B;  2I1Q A;  4ED3 A;  3C1Y A;  3WK9 A;  2IHN A;  2ZH9 A;  2DKX A;  1VLB A;  1Z4N A;  3Q8L A;  9ICG A;  2KSO A;  4F4X A;  4F72 A;  4RQ0 A;  3GFK B;  4ECU A;  4NM1 A;  3AUO A;  5BOM A;  3HKZ F;  4EX6 A;  3H0M B;  8ICE A;  1RM6 C;  1NKB A;  4K98 A;  3NVV A;  1XSP A;  1OU5 A;  7ICR A;  4KLU A;  2KTQ A;  4RPX A;  2R8G A;  4IC9 A;  3HWT A;  2C2D A;  4MEX A;  2ISO A;  4NM2 A;  2DF4 B;  5AM4 A;  3WFR E;  1S8O A;  5J2I A;  5DDY A;  3M9N B;  4NKT A;  4KLF A;  1JX4 A;  1RQL A;  1VFG A;  9ICP A;  2DFL A;  2M9N A;  3LWL A;  4O6A A;  3HW8 A;  1X42 A;  1ARO P;  1LVH A;  1SZP A;  4XJE A;  2XI9 A;  4EX7 A;  3KFU F;  2IA6 A;  2R8K A;  1L8O A;  4EEB A;  1D8B A;  3ZD9 A;  5J2H A;  3QXG A;  1DRG A;  1ZQE A;  4C80 A;  4B9T A;  2G07 A;  1V4A A;  4O69 A;  5J0U A;  1PVQ A;  2UVR A;  4P2H A;  4FO6 A;  2RDI A;  2ASJ A;  2YQE A;  7ICI A;  5KFZ A;  1RXW A;  1K1S A;  2IOH A;  3RJG A;  1S97 A;  2DR9 A;  4P4P A;  4TUS A;  5KL1 B;  3NKU A;  9ICQ A;  4HYK A;  4EBE A;  3QU4 A;  5F2V O;  4NXV A;  2MSN A;  5J8Y C;  4QWE A;  1QTM A;  5AKY A;  4UAZ A;  2KVC A;  3UPQ A;  4I0U A;  7ICH A;  3RJJ A;  4LJX A;  4GC7 A;  3WKD A;  3HRD D;  4BUG A;  3HX0 A;  4Z6C A;  1QSS A;  3Q8R B;  4XRH A;  3EUB 2;  3QU9 A;  4WQL A;  4ED0 A;  2GA9 D;  2ES6 A;  4QWB A;  1C20 A;  5HP4 A;  4O3N A;  4KLE A;  4G3I A;  4RQ6 A;  4RT3 A;  2BCV A;  4RU9 A;  2WHE A;  5J2F A;  3ER9 B;  4DFM A;  3IN5 A;  2K4H A;  4WC1 A;  3B9J A;  4O3R A;  4X4T A;  3JCF A;  2QAR B;  2LYA A;  5ALN A;  1UT8 A;  3ISD A;  4R64 A;  4MF8 A;  1NZB A;  2ZUC A;  4DL3 A;  3TAR A;  4ACO A;  3TAN A;  1KDH A;  4U7C A;  3OUY B;  3KOO A;  2QB1 A;  4I2H A;  1N62 A;  2EZZ A;  5L1L A;  1IG6 A;  4I2I A;  2GH1 A;  2HBL A;  1U9L A;  2H3V A;  2V9W A;  2H5X A;  2AQ0 A;  2EAO A;  3HIL A;  7ICM A;  4KB6 A;  3C2L A;  4MFC A;  2NRX A;  4Y2T A;  3C2K A;  2IMW P;  2AJQ A;  1VJ5 A;  1NKE A;  2JEF A;  3AQK A;  4IQT A;  5ALQ A;  4F8R A;  3SAF A;  2JH7 A;  3RBE A;  5BPC A;  2P6R A;  7ICL A;  4ECY A;  4ELU A;  3AQL A;  1OW5 A;  2W03 A;  3VC8 A;  4M0A A;  3KD3 A;  9ICI A;  2ATL A;  5AIC A;  1XO0 A;  1TKD A;  1V85 A;  2CPR A;  1WUD A;  1WYG A;  3RAX A;  5CFS A;  1U4B A;  8ICI A;  2BQR A;  3V6J A;  1ZRN A;  2YB4 A;  4WC2 A;  2WAQ C;  4KLO A;  1UA1 A;  1P7D A;  5GTI U;  4X4V A;  4KTQ A;  5KFO A;  3E58 A;  3GV7 B;  4X4S A;  3T5J A;  4JWM A;  1T4G A;  7ICQ A;  4I28 A;  9ICB A;  4EV6 A;  5J2G A;  5JRT A;  3UXP A;  2C28 A;  1NNL A;  4M6W B;  1L3T A;  5AKZ A;  4KLD A;  5GTH U;  3ETR A;  3S6J A;  5KFH A;  1U49 A;  1N5W A;  3NVZ A;  3BZC A;  2A19 A;  2MA1 A;  4I2D A;  2WF6 A;  4M2Y A;  1XWL A;  1MN8 A;  5AKE A;  4UB5 A;  2XGQ A;  1U45 A;  4XA5 A;  1MIV A;  4AYB F;  3RB3 A;  1KFT A;  2KZM A;  1IM4 A;  3PY8 A;  1NJX A;  2DR5 A;  1FEZ A;  2MAX A;  4FE3 A;  3WK5 A;  1T8E A;  7ICF A;  2KIC A;  4I2J A;  5F3X B;  5F9L A;  5J2A A;  9ICC A;  1CI4 A;  3SEN A;  3EPI A;  3JPN A;  1NI3 A;  1S0O A;  2PFP A;  3K1R B;  2LM1 A;  1R8C A;  2VKQ A;  4QZC A;  2M0N A;  2DR8 A;  1BPZ A;  4UAU A;  4K4I A;  4B6J A;  1ZD3 A;  4ED2 A;  1M6Y A;  3H7I A;  5JTI A;  3TAD C;  3N4M B;  1JAJ A;  2GO7 A;  5B66 U;  2D8C A;  3KBB A;  9ICE A;  4UB6 U;  1Y88 A;  4F2S A;  5DB8 A;  3UQ0 A;  4EP7 A;  1TAU A;  2ZH5 A;  2BQ3 A;  1RDF A;  5ALS A;  2ZHB A;  2ZG6 A;  5AM0 A;  4J03 A;  4BXO B;  4AYB C;  1KQQ A;  3K7D A;  2H3Q A;  4J9L A;  4KLG A;  3NWI A;  2JRZ A;  5KFF A;  3TFS A;  2JEG A;  3LVW A;  4NXW A;  4GXI A;  4PZN A;  2GOL A;  1ZQJ A;  5DBB A;  2KOB A;  2EWR A;  3NRW A;  2FPM A;  3LVV A;  2DGZ A;  3MR5 A;  2WF9 A;  3OUY A;  3H8M A;  4JK1 A;  1CRX A;  1Z1V A;  2NYV A;  8ICZ A;  3UM9 A;  3OJU A;  3H0L B;  4M5D A;  2M2U A;  1JQR A;  3OWG A;  1ZQV A;  1S9F A;  1L3S A;  1UET A;  4ECX A;  2M2W A;  4YQW A;  2DL0 A;  3UXO A;  2F3N A;  1DGJ A;  4YR2 A;  4F71 A;  4DL5 A;  4M9G A;  5J0Q A;  4YP3 A;  3G6Y A;  4ECZ A;  5KFC A;  4DQQ A;  3DEE A;  1HJP A;  5KFP A;  4DOB A;  5ALF A;  3WKA A;  2JGA A;  7ICJ A;  3M1Y A;  4DQR A;  3UPS A;  1SV0 A;  4DLG A;  5DB6 A;  2EQY A;  2I6X A;  3SI8 A;  5J2J A;  4QZA A;  4Y2Q A;  2VA3 A;  1RYU A;  4KLI A;  3GIL A;  4ZOH C;  4K4H A;  5KFE A;  3SAG A;  4DL6 A;  2AU0 A;  2W9C B;  9ICL A;  2KFZ A;  4HAI A;  4ED6 A;  2ZTD A;  9ICM A;  5ALU A;  4LEY A;  1OUQ A;  5DGA A;  2IOF K;  1Z00 A;  1GPJ A;  4M9N A;  2RLT A;  1F0M A;  3JPS A;  3UMB A;  1NJY A;  4XUS A;  3OV7 A;  3OPX A;  3QU7 A;  5J0W A;  4RPZ A;  4M9L A;  4RQ8 A;  4F5P A;  5ALG A;  1BVS A;  2QLT A;  2HHV A;  2D6F C;  1RPL A;  1R8B A;  3EF2 A;  5KFL A;  1COO A;  4RUC A;  4O3P A;  4RNN A;  5AKX A;  4UB3 A;  4ED7 A;  3HJ1 A;  4XQ7 A;  5KFK A;  3SZ2 A;  1D8Y A;  2YX8 A;  1ZOL A;  4NLB A;  2I9G A;  2M2T A;  2MRL A;  2MU2 A;  4IQU A;  5L1J A;  2H3I A;  4OAG A;  4J9Q A;  4OAF A;  2B4V A;  3BDP A;  2LMR A;  1X9W A;  5L9X A;  2JH1 A;  4AT8 B;  1DOQ A;  2DUY A;  2DWQ A;  5HRG A;  3T5H A;  5D61 A;  3OJS A;  4PHE A;  1JRO A;  2E8P A;  1TAM A;  4PHA A;  4E8F A;  8ICM A;  2OH2 A;  4DFJ A;  4WC3 A;  2GWS A;  2HHT A;  4PH5 A;  1JUD A;  3PSF A;  7ICE A;  3QNM A;  2W7O A;  3BS5 B;  5J2C A;  4QZB A;  2B56 A;  1JXE A;  3GQC A;  4FHY A;  2HHW A;  1BPE A;  5DG7 A;  5KG4 A;  1SB3 C;  1L7P A;  5EWE A;  3WU2 U;  2EZY A;  5TZV A;  4GXJ A;  1MIW A;  3RRH A;  4E7X A;  1TK5 A;  3FDS A;  2BDU A;  4JV2 A;  9ICW A;  5HRL A;  2HVH A;  3N97 B;  4CF5 A;  3L5K A;  4J9O A;  1X40 A;  4FFD A;  1N48 A;  1TK0 A;  8ICB A;  1QQ5 A;  5HHI A;  4Z6E A;  3MGH A;  1XS9 D;  4BJQ A;  2HI0 A;  1SWV A;  3QEB Z;  1SL1 A;  4O9M A;  8ICG A;  2O6K A;  2R8H A;  2OXO A;  3G6X A;  1TV9 A;  2ZIW A;  4I2C A;  2KJ8 A;  1UCV A;  1SXE A;  4JMU A;  5HHH A;  1N60 A;  5B3Q A;  3RBD A;  4Q43 A;  4E80 A;  3C29 A;  4PHP A;  5CJ7 A;  3N7R C;  2QKQ A;  4CF4 A;  1SKW A;  1ZQR A;  2E8O A;  2W3S A;  3HT3 A;  2K4I A;  2EAP A;  4K99 A;  4I2E A;  3MBY A;  2BCR A;  2ZH3 A;  3WK8 A;  1LV5 A;  2EAN A;  2ZIV B;  3IV6 A;  1MA7 A;  3EPG A;  3NAS A;  3ER8 C;  1SIJ A;  2YMM A;  4RQ7 A;  4DOC A;  4FHP A;  5J2K A;  3RH5 A;  3KHL A;  3T79 A;  1BNP A;  1B0X A;  3HPO A;  1IV8 A;  4GXK A;  3FAH A;  3B0Y A;  2J6S A;  8ICR A;  2UVU A;  4UAT A;  1ZQF A;  3UQ2 A;  4EGW A;  3L9D A;  5KFY A;  4CRX A;  1QQ7 A;  3TAC B;  2FMP A;  2B21 A;  2RFF A;  5AI8 A;  4KLS A;  9ICN A;  2AH5 A;  1IXR A;  1SKS A;  1FFU A;  1BNO A;  4DQP A;  1ZD2 P;  2YMQ A;  1PX5 A;  4PL2 A;  2HN1 A;  2UVV A;  2AHO B;  4QZE A;  1T94 A;  3FC4 A;  2ZJ8 A;  1X6J A;  4EEN A;  2XY5 A;  2OEH A;  1IIP A;  2FLL A;  1ZQY A;  4FHX A;  1ZQQ A;  2QB0 B;  2FDR A;  4TQS A;  4AT7 B;  3H4B A;  1C7Y A;  5JTG A;  4C8K A;  2G0A A;  4Y2S A;  5AK3 A;  1YT3 A;  4BDP A;  2JZB A;  1A76 A;  4P4O A;  4RQ5 A;  3ED5 A;  1QQ6 A;  4QZ8 A;  2EAM A;  2ZH1 A;  1XO1 A;  2KK0 A;  2DR7 A;  4TQR A;  4QW8 A;  1RYR A;  1JI7 A;  3BS5 A;  3WKB A;  3RH4 A;  4O5K A;  4DWI A;  1L7M A;  3HKZ C;  4JV1 A;  1KN5 A;  8ICO A;  2BPG A;  5HR9 A;  2C2R A;  1R8A A;  4EED A;  3F2D A;  2B0C A;  4TUR A;  1JAL A;  4PL1 A;  3Q8K A;  4AT9 B;  2WTF A;  5AK6 A;  1NK8 A;  4WJ3 B;  4ECW A;  2F8L A;  4O68 A;  1ZQP A;  4EZ9 A;  2WFA A;  5AI4 A;  4F92 B;  1Q79 A;  4Y2J A;  3Q8M A;  1QCK A;  2UVW A;  1FFV A;  2Z7J A;  4B9V A;  1JRP A;  2JEJ A;  3F53 A;  3V6H A;  4X0A A;  2FPL A;  1NJW A;  1SWW A;  3PZP A;  3GZF A;  3HIY A;  2YY6 A;  2ZIX B;  4M47 A;  4FZN A;  3RB6 A;  3PW5 A;  4QZG A;  4FS1 A;  5KL8 B;  2ZUD A;  4J9M A;  4EEK A;  1D9F A;  3CYM A;  5HRE A;  3QUB A;  2BCS A;  5CHG A;  3PMN A;  4F5R A;  2DRB A;  2YML A;  4FH3 A;  5KFB A;  4DS4 A;  2EH9 A;  5DQH A;  3IG5 A;  2PMZ F;  5KTQ A;  1TFY A;  1LKY B;  4FBT A;  8ICU A;  3RB4 A;  5KFX A;  4K9A A;  2PKE A;  4B9M A;  5DLF A;  3CK6 A;  4RWQ A;  4YR3 A;  1HIW A;  2V4Q A;  1HEK A;  8ICP A;  7ICP A;  3IHQ B;  5KFR A;  2KJ9 A;  5DBA A;  2G08 A;  2ZH4 A;  4DSE A;  2XC9 A;  2KVS A;  2XCA A;  3RJF A;  4FO1 A;  2KMD A;  4NJ8 A;  5KG7 A;  4WQK A;  3V72 A;  2KJ5 A;  3OSP A;  4TUQ A;  2BKE A;  5T14 A;  2HVI A;  2DVI A;  4C4R A;  2BBJ A;  1NJZ A;  5ALP A;  4CE6 A;  3MR3 A;  4EYH B;  1KBU A;  4UAV A;  4RQ1 A;  5CWR A;  2NRK A;  1UA0 A;  4KLT A;  2PMZ C;  4IL6 U;  4O3M A;  3H40 A;  4OAH A;  3MAB A;  4LEV A;  3GV5 B;  3THV A;  3PW7 A;  3SD7 A;  4CGZ A;  4R63 A;  2HSZ A;  3GIK A;  1ZQH A;  3DV9 A;  2ZJA A;  4X0B A;  2FMS A;  5KFA A;  4CNQ A;  4XQ8 A;  1ZQM A;  2VIX A;  4QZI A;  4F4K A;  3WK7 A;  5HRK A;  4UBB A;  5HRH A;  1A77 A;  1T3Q A;  4KMU A;  3Q8S B;  4NV0 A;  9ICK A;  2KKV A;  3LWM A;  3ZDE A;  2LYH A;  2VA2 A;  4OJO A;  2HHQ A;  1TFW A;  4ECQ A;  1TK8 A;  3KKA C;  4C8M A;  1PVR A;  1QSL A;  2NRT A;  2KN7 A;  3F2B A;  5DEC A;  5KFW A;  1UQV A;  5ALJ A;  4NLN A;  2D3D A;  1JN3 A;  4F50 A;  4IRC A;  2BQU A;  9ICR A;  5K4L A;  4RNM A;  4IQW A;  8ICS A;  5A0L A;  1L8L A;  1COK A;  3F5A A;  1N61 A;  2PFQ A;  1KSP A;  2DKZ A;  3F2C A;  1UEV A;  2BPF A;  3ZDB A;  4K96 A;  4Y2U A;  3IDW A;  2HOF A;  2K8C B;  3FM9 A;  3CNH A;  5KFU A;  4RNO A;  4Q8E A;  2G09 A;  4F5N A;  1FO4 A;  2ZTE A;  5J2B A;  5CEH A;  3PNC A;  2ESE A;  4NKU A;  1MIY A;  4X4U A;  2K8A A;  5L1I A;  2HHP A;  1ED1 A;  1L3V A;  4US9 A;  1DXS A;  3T3F A;  4P0P B;  3N7S C;  2NRV A;  2QAR A;  3RAQ A;  4YMO A;  4JB3 A;  2M2V A;  4LEZ A;  2KP7 A;  4ATB B;  1XU4 A;  1N56 A;  4FHV A;  1A0P A;  1Z1B A;  4ECV A;  3V7K A;  1SGG A;  5J8Y A;  4N7R A; 
#chains in the Genus database with same CATH homology
 2A1J B;  4ECU A;  1MQ3 A;  4DL2 A;  8ICH A;  5DB9 A;  4NM1 A;  9ICT A;  3OJS A;  4PHE A;  4DSI A;  4JWN A;  3AUO A;  5BOM A;  2ALZ A;  1NKC A;  4YXM A;  4RUA A;  5L1K A;  5IIJ A;  8ICE A;  3BQT A;  4PHA A;  4E8F A;  8ICM A;  1NKB A;  4DFJ A;  4WC3 A;  1KFD A;  2GWS A;  5DED A;  3OVS A;  4RPY A;  2HHT A;  5KFT A;  1QLN A;  4PH5 A;  1XSP A;  4P4M A;  2XY6 A;  7ICR A;  1OU5 A;  4MEY A;  1ZQD A;  4B9S A;  4PGQ A;  4KLJ A;  1T3N A;  4KLU A;  2KTQ A;  3HP6 A;  4QZD A;  4RPX A;  7ICE A;  3C23 A;  3TFR A;  4QWC A;  1ZQT A;  2R8G A;  8ICN A;  3LQC B;  3RJE A;  5J2C A;  3PX4 A;  4QZB A;  1U48 A;  2VAN A;  3HWT A;  1JXE A;  2C2D A;  2HHX A;  2KZ3 A;  4O0I A;  3GQC A;  2HHU A;  1KNY A;  3JPP A;  4MEX A;  3EWA A;  2ISO A;  3ZDC A;  2HHW A;  4NM2 A;  1DK2 A;  1BPE A;  4FHY A;  5DG7 A;  3EW9 A;  5KG4 A;  5J2I A;  3JPR A;  5DDY A;  3WFR E;  1ZQL A;  1TFR A;  5EWE A;  4Q44 A;  4IR1 A;  3M9N B;  3ZDA A;  3AQM A;  7ICU A;  4O3S A;  4NKT A;  5KFQ A;  4KLF A;  1JX4 A;  5TZV A;  5KFN A;  4GXJ A;  3LDA A;  4KLL A;  1VFG A;  1V9P A;  1MIW A;  4DFK A;  5KFS A;  9ICP A;  3RRH A;  2DFL A;  2M9N A;  4PGX A;  3LWL A;  3HW8 A;  9ICU A;  4E7X A;  4AT7 A;  4ECS A;  4DLE A;  4EEY A;  1TK5 A;  1U47 A;  1ARO P;  3FDS A;  1SZP A;  5KFG A;  4YN4 A;  1UT5 A;  5J0O A;  3KHR A;  2IA6 A;  2R8K A;  2C2E A;  5DQI A;  4JV2 A;  9ICW A;  4GLX A;  2ZUB A;  4KIT B;  1BPX A;  5HRL A;  5DG8 A;  3ZD9 A;  2HVH A;  5F9N A;  3N97 B;  2ZHA A;  5J0T A;  5J2H A;  4X5V A;  1ZQE A;  4J9O A;  3C2M A;  4YCX A;  4RQ2 A;  3MDA A;  5KFV A;  5HNK A;  1N48 A;  1TK0 A;  4B9T A;  1RYS A;  1WCL A;  2J6U A;  5HHI A;  5J0U A;  4Z6E A;  3MGH A;  1JXL A;  2P66 A;  1XS9 D;  4DEZ A;  2UVR A;  4P2H A;  5J0R A;  4F4Z A;  4FO6 A;  5IIM A;  2RDI A;  4J9S A;  3H4D A;  1Z00 B;  2ASJ A;  1S77 D;  4ED8 A;  7ICI A;  5KFZ A;  1RXW A;  3QEB Z;  1K1S A;  4RQ4 A;  3BQ0 A;  3PX0 A;  1SL1 A;  3RJG A;  4O9M A;  1S97 A;  8ICQ A;  8ICG A;  4R8U B;  2DR9 A;  4P4P A;  5DKW A;  4TUS A;  2R8H A;  2BR0 A;  9ICQ A;  4HYK A;  4EBE A;  5F2V O;  3G6X A;  1NOM A;  1TV9 A;  3E2E A;  4I2C A;  4F3O A;  4QWE A;  2PI4 A;  3OHA A;  1QTM A;  1KRP A;  1KTQ A;  1ZQZ A;  4UAZ A;  5J0S A;  1ZYQ A;  3M9O B;  4LZG A;  1KEJ A;  4QZF A;  3GIM A;  3UPQ A;  5HHH A;  3HJ4 A;  4M6W A;  5IIO A;  4AT9 A;  2XO7 A;  3RBD A;  1WOT A;  5KG5 A;  4JV0 A;  4I2F A;  4RQ0 A;  7ICH A;  4WC4 A;  4QWD A;  5DQG A;  4Q43 A;  3RJJ A;  4E80 A;  1ZQX A;  2OWO A;  3AU2 A;  4PHP A;  4GC7 A;  5CJ7 A;  1NK5 A;  1SKW A;  1ZQR A;  3HX0 A;  4Z6C A;  5KT5 A;  3HT3 A;  3Q8R B;  1QSS A;  2PI5 A;  3JZ0 A;  4XRH A;  4UD5 A;  4ED0 A;  3V7L A;  1ZQG A;  4I2E A;  3MBY A;  4ED1 A;  3TAQ A;  4CCH A;  3TI0 A;  4QWB A;  2BCR A;  4M04 A;  4RWO A;  5HP4 A;  2ZH3 A;  1LV5 A;  4O3N A;  1S10 A;  4KLE A;  4Q8F A;  4J9N A;  1ZET A;  4C8N A;  4FS2 A;  1S0M A;  4G3I A;  4RQ6 A;  4RT3 A;  2BCV A;  4RU9 A;  5J2F A;  4DFM A;  3EPG A;  1ZQU A;  4WC1 A;  1NK9 A;  1LB2 B;  4O3R A;  4O5E A;  4X4T A;  2ZJ5 A;  1YLQ A;  4NXZ A;  2W9B B;  1NO5 A;  4ELT A;  4RQ7 A;  2NRZ A;  4Q45 A;  4DOC A;  2BCU A;  9ICS A;  4FHP A;  5D49 A;  4BGD A;  1UT8 A;  5J2K A;  5KFD A;  4MF2 A;  3RH5 A;  8ICB A;  5HRD A;  3ISD A;  4R64 A;  1Q78 A;  2ZH6 A;  3H8S A;  4MF8 A;  3KHL A;  8ICT A;  2ZUC A;  2MUT B;  1L5U A;  4DL3 A;  3TAR A;  1BNP A;  3HPO A;  3TAN A;  4F93 B;  2W9A A;  1KDH A;  4ZH4 A;  3OUY B;  2V4R A;  4GXK A;  4IG8 A;  4I2H A;  1DGS A;  4YXJ A;  5L1L A;  4DSF A;  1NK0 A;  3B0Y A;  1ZQI A;  3SV3 A;  4I2I A;  2J6S A;  5KT2 A;  5DGB A;  4J9K A;  8ICR A;  3H37 A;  2UVU A;  1U9L A;  4F5O A;  1ZQO A;  1ZQF A;  1R89 A;  4YVZ A;  2V9W A;  4DSK A;  3AU6 A;  3UQ2 A;  3QEA Z;  5KFI A;  2H5X A;  3M8R A;  2AQ0 A;  1DK3 A;  3L9D A;  1JIH A;  1TVA A;  7ICM A;  5KFY A;  3C2L A;  4MFC A;  2FMP A;  2NRX A;  2B21 A;  5KT3 A;  2RFF A;  3C2K A;  4KLS A;  9ICN A;  4UAW A;  2IMW P;  2AJQ A;  4F5Q A;  1NKE A;  1IXR A;  1SKS A;  2JEF A;  4RWN A;  3PML A;  3AQK A;  4IQT A;  3MFI A;  1BNO A;  4F8R A;  4DQP A;  2O1P A;  1NZP A;  4WC0 A;  8ICV A;  5C5J A;  3RBE A;  1PX5 A;  5BPC A;  4EYI B;  3SV4 A;  4UB1 A;  3RJI A;  4O3Q A;  5J0Y A;  4ECY A;  2UVV A;  2P6R A;  4BXO A;  4ELU A;  4QZE A;  3AQL A;  4IRK A;  3IM1 A;  3PV8 A;  2ZJ8 A;  9ICA A;  1MC8 A;  4YMN A;  3TQ1 A;  4I2A A;  2XY5 A;  1MSW D;  1V4A A;  1RXV A;  3PW4 A;  2FLL A;  1ZQY A;  4FHX A;  1ZQQ A;  4M0A A;  4UAY A;  4TQS A;  3GIJ A;  2DPI A;  4AT7 B;  3H4B A;  2ATL A;  3KHG A;  9ICI A;  4LZD A;  1C7Y A;  3G6V A;  1TKD A;  4C8K A;  5III A;  2BE3 A;  2AGO A;  5IIL A;  4K4G A;  3RAX A;  4F2R A;  1U4B A;  2ID1 A;  1BPB A;  3K75 D;  5IIN A;  8ICI A;  3QE9 Y;  3PR4 A;  3JPQ A;  3H39 A;  4BDP A;  2JZB A;  2BQR A;  1A76 A;  5J0P A;  3V6J A;  4P4O A;  3RJH A;  5CP2 A;  4MFA A;  2JEI A;  4QWA A;  4RQ5 A;  4UBC A;  4EBC A;  4WC2 A;  2ZH2 A;  4KLO A;  1UA1 A;  4QZ8 A;  4X4R A;  1TAQ A;  1X2I A;  1XO1 A;  4PPX A;  2ZH1 A;  4X4V A;  3AQN A;  2DR7 A;  3JPO A;  5KFO A;  4KTQ A;  4TQR A;  4QW8 A;  3GV7 B;  1RYR A;  1NK7 A;  3JYY A;  4X4S A;  3T5J A;  3H8W A;  3RH4 A;  4O5K A;  5KT4 A;  4DWI A;  4JWM A;  7ICL A;  1X9S A;  2VA8 A;  4X4Q A;  1T4G A;  1NK6 A;  2NRW A;  3OSN A;  4JV1 A;  7ICQ A;  3B0X A;  8ICO A;  5IIK A;  7ICV A;  3PVX A;  4I28 A;  2BPG A;  4NY8 A;  2C2R A;  8ICF A;  9ICB A;  4YMM A;  5HR9 A;  5J29 A;  1R8A A;  5J2G A;  4BWM A;  5DB7 A;  3UXP A;  2C28 A;  7ICN A;  1UEU A;  4M9H A;  4TUR A;  3RR8 A;  4F91 B;  4M6W B;  3Q8K A;  1L3T A;  1ZQK A;  4AT9 B;  4DSL A;  4O5C A;  5KG6 A;  1ZQB A;  4KLD A;  2WTF A;  4C8L A;  1ZJM A;  4DO9 A;  3C18 A;  5HML A;  1NK8 A;  3ZD8 A;  4DQS A;  2HHS A;  8ICW A;  2W9M A;  4UB4 A;  5KFH A;  3ISB A;  1U49 A;  9ICO A;  1WCN A;  8ICL A;  1ZQS A;  4R66 A;  4ECW A;  1HUO A;  2XGP A;  4PGY A;  2P6U A;  1ZQP A;  4EZ9 A;  2F1J A;  4I2D A;  4R65 A;  4EBD A;  4M2Y A;  1XWL A;  4F92 B;  1Q79 A;  2O5A A;  4YFK A;  4UQG A;  4UB5 A;  3Q8M A;  4IQV A;  2J6T A;  2UVW A;  2XGQ A;  1U45 A;  9ICH A;  4XA5 A;  4B9V A;  3T5K A;  2JEJ A;  1MIV A;  5EWG A;  3V6H A;  4X0A A;  3PX6 A;  4KN4 A;  8ICA A;  2FPL A;  3RB3 A;  1NJW A;  2KZM A;  1KFT A;  1IM4 A;  4C8O A;  4KLM A;  5HMM A;  3GDX A;  3HIY A;  3PY8 A;  1NJX A;  4M47 A;  5KT7 A;  2DR5 A;  3PO5 A;  3NGD A;  3V7J A;  4DL7 A;  3PW5 A;  2MAX A;  2W9C A;  3RB6 A;  1PZN A;  1T8E A;  4QZG A;  4I2J A;  4FS1 A;  2IBK A;  7ICF A;  5F9L A;  5J2A A;  9ICC A;  4F4Y A;  2ZUD A;  1SL0 A;  3NYB A;  5KFJ A;  3MDC A;  3EPI A;  3JPN A;  3BQ1 A;  4J9M A;  1S0O A;  2PFP A;  1D9F A;  4LVS A;  5HRE A;  8ICK A;  3NTU A;  3PW2 A;  2BCS A;  4I27 A;  4YG2 A;  3C5G A;  3QZ8 A;  2BCQ A;  1R8C A;  1D8L A;  2BHN A;  4QZC A;  1CUK A;  5CHG A;  3PMN A;  3MGI A;  4F5R A;  2ASL A;  1KLN A;  2DRB A;  2DR8 A;  1BPZ A;  5KFB A;  4DS4 A;  4FH3 A;  5J0X A;  2AGP A;  4K4I A;  2Q66 A;  4FBU A;  5DQH A;  3RB0 A;  4YR0 A;  4WCW A;  1ZQN A;  4ED2 A;  3H7I A;  2F1H A;  4WC7 A;  5KTQ A;  8ICY A;  3N4M B;  1XC9 A;  1JAJ A;  4FBT A;  1TFY A;  8ICU A;  2W8K A;  1EXN A;  3RB4 A;  4KLQ A;  5KFX A;  1Z3E B;  9ICE A;  3ISC A;  5DDM A;  4B9M A;  1Y88 A;  4F2S A;  5DB8 A;  3UQ0 A;  5DLF A;  4EP7 A;  1TAU A;  5J2E A;  1XSL A;  1S0N A;  4RWQ A;  5CA7 A;  4YR3 A;  3RR7 A;  4UD4 A;  2ZH5 A;  2V4Q A;  8ICP A;  7ICP A;  3MR6 A;  2BQ3 A;  3IHQ B;  3OVA A;  2ZHB A;  3PR5 B;  5KFR A;  5DBA A;  9ICJ A;  2ZH4 A;  3Q8Q B;  4BXO B;  2R8I A;  5EOZ A;  5HRF A;  3H3A A;  4DF4 A;  4MFF A;  4J9L A;  2XC9 A;  4DSE A;  4ELV A;  2XCP A;  2XCA A;  3RJF A;  3MFH A;  4NLG A;  2FMQ A;  4KLG A;  1BPY A;  3EYZ A;  5KFF A;  3FYH A;  5KG1 A;  2W9B A;  5KG7 A;  3TFS A;  2JEG A;  4GXI A;  2ZH7 A;  4F4W A;  3V72 A;  1ZQJ A;  5DBB A;  3LK9 A;  3SYZ A;  3OSP A;  4TUQ A;  3OHB A;  4NLZ A;  2MUT A;  3C21 A;  1L3U A;  2BKE A;  2FPM A;  2HVI A;  1QSY A;  3H38 A;  1ZQW A;  1FA0 A;  3TAP A;  5CB1 A;  3MR5 A;  2DVI A;  2PFN A;  3OUY A;  2BGW A;  1NJZ A;  4RZR A;  4X4P A;  3MR3 A;  4JK1 A;  4EYH B;  2Y1I A;  4IRD A;  4DS5 A;  8ICZ A;  1S0V A;  4ATB A;  2JZB B;  4RQ1 A;  3RH6 A;  4UB2 A;  3OJU A;  5CWR A;  2NRK A;  3JPT A;  1UA0 A;  4FHW A;  4KLT A;  3RRG A;  2M2U A;  4M5D A;  1CEZ A;  4WBZ A;  1JQR A;  4DSJ A;  4AT8 A;  4WC5 A;  1ZQV A;  1S9F A;  2A1J A;  5EWF A;  3H40 A;  3KHH A;  3PW0 A;  4ECX A;  1L3S A;  4NLK A;  2M2W A;  4J9P A;  3EZ5 A;  1UET A;  2ZTC A;  4YQW A;  2DRA A;  3MAB A;  2PFO A;  3GV5 B;  3THV A;  3ORY A;  3RTV A;  3PW7 A;  1S76 D;  4R63 A;  3UXO A;  5KG2 A;  4YR2 A;  4WC6 A;  4DOA A;  5DLG A;  4X4N A;  2AGQ A;  2F1I A;  4DL5 A;  4M9G A;  3GIK A;  1ZQH A;  5J0Q A;  7ICG A;  1BGX T;  2ZJA A;  2IHM A;  4X0B A;  3WFQ E;  3MR2 A;  3WFP A;  4RQ3 A;  4YP3 A;  3G6Y A;  2XY7 A;  2RDJ A;  5KFA A;  2FMS A;  4XQ8 A;  4ECZ A;  1ZQM A;  4DQI A;  5HRI A;  3C66 A;  5KFC A;  4DQQ A;  4QZI A;  2FLN A;  1HJP A;  2W8L A;  5KFP A;  7ICS A;  4F4K A;  4DOB A;  1ZQC A;  5HRK A;  2FLP A;  4ECT A;  3T5L A;  7ICO A;  4B9L A;  4UBB A;  2Q0Z X;  5HRH A;  1A77 A;  3ETL A;  4KMU A;  3Q8S B;  9ICK A;  1VJ7 A;  7ICJ A;  4EBJ A;  4DQR A;  4B9U A;  3UPS A;  2ISP A;  5J2D A;  4DLG A;  8ICC A;  8ICJ A;  5DB6 A;  3LWM A;  5HC9 A;  4KN7 A;  3ZDE A;  2LYH A;  2VA2 A;  1BPD A;  2HHQ A;  1TFW A;  3WFS C;  3SI8 A;  3KTQ A;  1MQ2 A;  5J2J A;  1T7P A;  4J9R A;  4DFP A;  4ECQ A;  2DPJ A;  3BJY A;  1TK8 A;  4QZA A;  2VA3 A;  4KLH A;  2PXI A;  3M8S A;  4EZ6 A;  4KLI A;  4RT2 A;  3GIL A;  4K4H A;  3BQ2 A;  4C8M A;  5D46 A;  5KFE A;  4DL6 A;  1QSL A;  2AU0 A;  5DG9 A;  3QZ7 A;  2W9C B;  2AQ4 A;  2HW3 A;  9ICL A;  4FH5 A;  2NRT A;  2KN7 A;  1SL2 A;  2KFZ A;  5KG3 A;  3OGU A;  3K4G A;  1F5A A;  7ICK A;  4ED6 A;  4QZH A;  5DEC A;  2ZTD A;  3PO4 A;  1JMS A;  4DF8 A;  5KFW A;  9ICM A;  2Y1J A;  4X4O A;  4NLN A;  4LT6 A;  1SKR A;  3GII A;  5DGA A;  1HUZ A;  1JN3 A;  4F50 A;  4IRC A;  1Z00 A;  2BQU A;  9ICR A;  1H38 A;  4RNM A;  2R8J A;  4M9N A;  5JUM A;  4IQW A;  8ICS A;  4R8U A;  9ICV A;  4ECR A;  3JPS A;  8ICX A;  1NJY A;  4XUS A;  1X9M A;  3OV7 A;  2ZH8 A;  1ZJN A;  2PFQ A;  1KSP A;  7ICT A;  2PBE A;  3ZDD A;  3OVB A;  5BOL A;  1UEV A;  5J0W A;  2BDP A;  4RPZ A;  5D4B A;  2BPF A;  3ZDB A;  4RQ8 A;  4M9J A;  4F5P A;  4M9L A;  5CR0 A;  1BVS A;  3H8J A;  9ICX A;  4S3N A;  4I2G A;  4BWJ A;  3C5F A;  4RWP A;  2HHV A;  4WBY A;  4TUP A;  2ASD A;  1XSN A;  3WFO A;  4Z6D A;  1RPL A;  5KFU A;  4RNO A;  1R8B A;  4Q8E A;  5KFL A;  1COO A;  4RUC A;  2KZZ A;  4F5N A;  3RJK A;  4GC6 A;  4QZ9 A;  4O3P A;  1KFS A;  2ZTE A;  4RNN A;  5J2B A;  4Z6F A;  1D9D A;  4UB3 A;  4QW9 A;  4I2B A;  4B9N A;  4ED7 A;  4IR9 A;  3HJ1 A;  3UXN A;  5KFK A;  4XQ7 A;  3SZ2 A;  1B22 A;  3PNC A;  1D8Y A;  4E0D A;  4NKU A;  3C1Z A;  4YD1 A;  1NK4 A;  1MIY A;  4JUZ A;  2KFN A;  4X4U A;  4PHD A;  1B43 A;  3Q8P B;  2FPK A;  2I9G A;  5KG0 A;  5L1I A;  5DBC A;  2M2T A;  2HHP A;  2BPC A;  1ZQA A;  1L3V A;  4YD2 A;  1RZT A;  3M9M B;  4I29 A;  4IQU A;  4O3O A;  5L1J A;  3T3F A;  3V6K A;  2C22 A;  5KFM A;  9ICF A;  2NRV A;  3GV8 B;  4EBK A;  2I1Q A;  4ED3 A;  3C1Y A;  3RAQ A;  2IHN A;  4YMO A;  5HRB A;  2ZH9 A;  4J9Q A;  2M2V A;  1K1Q A;  2KP7 A;  3BDP A;  4ATB B;  1XU4 A;  3Q8L A;  4DL4 A;  1N56 A;  1X9W A;  9ICG A;  4FHV A;  5KT6 A;  5L9X A;  4ECV A;  4AT8 B;  1DOQ A;  3V7K A;  5HRG A;  3T5H A;  4F4X A;  3GFK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...