4GXKA

R283k dna polymerase beta ternary complex with a templating 8og and incoming datp analog
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
326
structure length
316
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title DNA polymerase minor groove interactions modulate mutagenic bypass of a templating 8-oxoguanine lesion.
pubmed doi rcsb
source organism Homo sapiens
total genus 112
structure length 316
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4gxkA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4gxkA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4gxkA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4gxkA03
4QZFA 1X9WA 1KFSA 3ZDBA 5D4BA 5KFAA 4KLSA 3M9NB 8ICMA 1T3NA 1KFTA 1SL1A 4QW9A 4IR9A 3JPSA 4WBYA 4X4TA 1V9PA 3ORYA 3C23A 2DPJA 4AT8B 3PO5A 1U47A 2I1QA 4R63A 7ICEA 9ICFA 4KLJA 7ICRA 1UA1A 2ZJAA 4RUAA 1KRPA 2KFZA 5KG5A 2PFOA 1ZETA 5J0RA 4AT9B 1BPBA 8ICAA 9ICLA 2O5AA 3PX0A 3NYBA 4XQ7A 2AQ0A 4RWNA 2BPGA 5KFKA 8ICTA 4RQ4A 2RFFA 2J6SA 3H40A 4DFPA 1RPLA 7ICIA 2M2WA 4AT8A 2O1PA 4DSLA 4YG2A 5CA7A 2V4RA 4K4HA 1A77A 3OVAA 1NJZA 4WC4A 3T5JA 3M9OB 3AU6A 7ICNA 1CUKA 4NXZA 4YMOA 4FO6A 1D9DA 4R8UB 4IRKA 1UT5A 3MDCA 3RJIA 3SI8A 3RJEA 3IHQB 4NLNA 2JZBB 9ICRA 1SKRA 3OJUA 2NRVA 1D9FA 2ASJA 1X2IA 3GV8B 3C5FA 4EZ6A 3RBDA 4UB2A 1ZQFA 3T5LA 4F2RA 3LQCB 2XC9A 4J9PA 2IMWP 5DECA 3HPOA 3C2LA 2Q0ZX 5L1LA 3RAXA 4UAZA 1TFRA 4RPYA 4R8UA 1JN3A 1DK2A 1Z3EB 2M2VA 2JZBA 2C22A 4X4OA 3H38A 4PHAA 1ZQXA 1ZQNA 5J2FA 4PGXA 3IM1A 4EBJA 3HW8A 3V7LA 3OSPA 5KFCA 3OHAA 4UAWA 1TK5A 4M0AA 3OHBA 3AQNA 4E0DA 3V6HA 4UB5A 4O5CA 4YR2A 4RQ7A 2BPFA 2AJQA 3UQ2A 4J9OA 3MBYA 2C28A 4J9SA 1LB2B 1HUOA 1S76D 5CR0A 5IINA 3HIYA 2R8GA 1CEZA 4O3QA 3H8WA 9ICTA 3RH6A 2IHNA 1K1QA 4RQ8A 4PHEA 3OVSA 2NRTA 4KLQA 8ICOA 5KFNA 4MF8A 1ZQQA 4BXOB 4J9KA 5J0TA 4ED2A 2ZHAA 1MIYA 2ZH1A 4K4GA 1JIHA 9ICPA 5KFQA 5DBBA 4YR0A 5L1KA 1ZJMA 3N4MB 4QWAA 2BGWA 1BPYA 1ZQMA 8ICXA 3ZDDA 2ZHBA 4P4MA 2ZH9A 4DQSA 3RB0A 1D8LA 4RQ6A 4C8LA 3ISDA 1ZQEA 4BWMA 5L1JA 5L1IA 5F2VO 1COOA 2JEIA 5EWFA 4B9TA 4BXOA 2AGPA 4DL2A 4NLGA 3RR8A 1NK7A 1UEVA 3OV7A 3UXNA 4PGYA 3RTVA 8ICWA 4PHPA 9ICOA 1HJPA 4KN7A 3RJJA 8ICFA 3MDAA 5HMMA 3MFHA 1QSYA 1R8AA 2ZTEA 4RNMA 1BVSA 4I2FA 1TKDA 2FPKA 9ICKA 2AGOA 4Z6CA 3TFSA 4ECRA 4CCHA 9ICWA 5KFVA 1EXNA 2BQUA 3BQ2A 2NRXA 4F4KA 1MQ3A 1S0VA 1SL0A 4WC3A 1BNPA 1ZQKA 5KTQA 9ICAA 1TV9A 1TK0A 3TAPA 3Q8QB 2ZJ8A 3N97B 4F5OA 5KG0A 5IIMA 2F1JA 4S3NA 2VANA 1KEJA 3M8RA 1S9FA 3GV5B 1SL2A 4F3OA 3ETLA 1UETA 5KFFA 4F5RA 5HP4A 2JEGA 3H8SA 5KFYA 4O9MA 2W9BB 3BQ0A 4DL5A 5KFGA 4QZCA 4RNOA 4PGQA 4O3NA 2BDPA 3KHLA 3WFRE 2ASDA 4ZH4A 5HMLA 5J2CA 1QTMA 4IG8A 4PHDA 2JEFA 5KG2A 3Q8MA 1NZPA 4RWPA 1MIVA 3UXOA 3PW2A 4WC1A 4MF2A 2BCQA 7ICUA 5HRHA 2KZMA 3RB4A 4JV2A 2R8HA 3KHRA 3PW5A 1JMSA 8ICJA 9ICUA 2W9BA 3PX4A 4MFCA 4QZEA 2ISOA 3PR5B 4YCXA 4KLUA 4X4SA 1U9LA 4M6WB 4O3OA 7ICSA 5KFBA 2W8LA 4ELVA 4EYHB 4GXJA 1N56A 3HJ1A 4GXKA 2BCRA 3OUYB 5IIOA 4GC6A 1T4GA 4DL6A 1RZTA 3JPNA 3HX0A 3RR7A 3EPGA 4RPZA 4HYKA 4AT7B 1VJ7A 2DR7A 5DBAA 3BJYA 3RB3A 4J9QA 1SKWA 2DPIA 3Q8KA 4M6WA 4X4PA 8ICRA 4RWOA 1S0MA 2FLPA 2PI5A 4I28A 5DQHA 2XO7A 1XO1A 3THVA 2ISPA 2PFQA 4RWQA 3B0XA 2ID1A 3OUYA 4NM2A 3NTUA 5F9LA 2DR5A 4ED6A 7ICOA 4AT7A 5J2DA 4YD1A 4PPXA 4WC0A 2V9WA 4DSFA 4I2DA 3PMNA 8ICHA 3C5GA 2AU0A 2DVIA 3LWMA 4ED7A 2KP7A 9ICGA 4Q45A 5KT2A 4DQRA 4NY8A 1UEUA 5EOZA 5DGBA 2PFNA 1KFDA 2V4QA 4GC7A 1NKBA 2BCUA 4TQRA 1RYSA 7ICLA 3JZ0A 2DR8A 3EYZA 2Q66A 4LT6A 5KG7A 5HREA 5DB9A 4EBCA 4DFMA 3WFQE 4O3RA 5CHGA 4AT9A 3JPTA 4DQPA 8ICCA 3FDSA 4EBDA 4ECSA 4WC5A 1ZQOA 8ICPA 5JUMA 5KFLA 5KFEA 1JXLA 1N48A 4B9NA 5L9XA 1XU4A 4TQSA 1ZQPA 1WCLA 5CP2A 4QZ9A 3SV4A 2C2DA 3EW9A 2BQ3A 1UA0A 4Q43A 2BCSA 5D46A 3WFPA 4I27A 1U49A 7ICJA 5J2KA 5DB8A 5J2AA 3ZD8A 4QZIA 2PXIA 4M9NA 3C21A 1A76A 5IIKA 5KFXA 3PY8A 1U4BA 1KSPA 2HVHA 3H3AA 3H4BA 4DL3A 2BKEA 5KFMA 3GIMA 2KFNA 4DWIA 4F93B 2HHXA 4BDPA 2HHUA 7ICQA 2DRBA 8ICQA 3PV8A 5HRFA 3C2MA 1NK5A 1RXVA 4ECWA 5HNKA 1U45A 3RJHA 1K1SA 2FPLA 1MIWA 5KFSA 3PW0A 2BR0A 1L3SA 4LVSA 3ZDCA 9ICCA 4GXIA 4ECZA 5DLGA 1B22A 2C2RA 3E2EA 5KT4A 4ED0A 3BDPA 4RQ0A 8ICLA 1NJWA 1ZJNA 4UD5A 4B9MA 4DQIA 3H4DA 4KLHA 5KG6A 4QWEA 1BPEA 9ICIA 4LZDA 4RNNA 4J9RA 5KG1A 2HHWA 4DL7A 5CWRA 3QZ7A 3TQ1A 3GDXA 5DLFA 4NKUA 1NOMA 4ECTA 5J0YA 2Y1IA 5HR9A 3ZDAA 1L3TA 4RQ1A 3PNCA 5EWEA 3ZDEA 3G6XA 3V7KA 4FS1A 2NRWA 4ED3A 3RH5A 4C8KA 1R89A 1L3VA 2P6RA 3GILA 3T5KA 1BPXA 3AQKA 3EWAA 5CJ7A 1DOQA 3Q8LA 1XC9A 1KDHA 4KN4A 5HHHA 2BCVA 3C2KA 1XSLA 2VA2A 4RQ2A 4IRCA 3ZD9A 1PX5A 3QZ8A 3M8SA 4M2YA 1MQ2A 4M47A 3NGDA 5KT3A 5J0QA 9ICNA 1JAJA 4FH5A 4DQQA 4EBEA 3SV3A 4RU9A 4E7XA 9ICVA 4DSKA 4G3IA 3FYHA 4IRDA 1DK3A 4ECUA 3PX6A 3WFOA 4ELTA 4KLIA 2XGPA 1TFWA 3V72A 4RT3A 2DFLA 5J2EA 1NK0A 1ZQAA 4FHVA 5DDYA 4C8OA 3OVBA 4FHXA 1ZQRA 3OJSA 4RUCA 7ICGA 1RXWA 4J9MA 2W9MA 4IQVA 4R64A 2XY5A 1S0OA 1ZQJA 2P66A 4I2IA 4DSJA 1ZQCA 4I2CA 4ATBB 2MAXA 4DFKA 4PH5A 4C8NA 1L3UA 5HRDA 1ZQHA 1Y88A 3HJ4A 3Q8RB 5KFUA 1HUZA 4KLEA 3AU2A 2F1IA 2UVRA 2HHVA 1ZQVA 1MSWD 5BOLA 5J0WA 3ISCA 4B9LA 3H39A 7ICTA 4DO9A 3RRHA 2XCPA 4Z6EA 4NLZA 4YFKA 1ZQGA 3H8JA 3OGUA 3RH4A 9ICHA 4WC6A 2ZUDA 2PFPA 2DRAA 4R66A 5EWGA 4KMUA 4TUPA 4RPXA 4QWDA 1TAQA 5J2BA 4DS4A 1NK6A 5J2IA 1TK8A 4IR1A 4X4RA 8ICYA 5DBCA 1NJXA 2BHNA 5DGAA 1PZNA 3SYZA 5DB7A 4B9VA 4X5VA 4LZGA 3M9MB 2IA6A 4O5KA 5D49A 4F4XA 4I2JA 3MFIA 3G6VA 2FLNA 2PBEA 4JV1A 3SZ2A 1ZQWA 4BWJA 1S0NA 5DG8A 1WOTA 3PVXA 3EPIA 2JEJA 3AQMA 3RJGA 4F50A 4UQGA 4MFFA 5KFWA 4MEXA 2ATLA 1ZQSA 2ZH6A 2ZH3A 1X9SA 9ICEA 1QSLA 2ZH4A 4X4NA 1TFYA 3GFKB 4F5NA 1SKSA 3KHHA 4F5QA 1U48A 2RDJA 1NK8A 4QZAA 4YD2A 4UB1A 2C2EA 1C7YA 4KLMA 3JPPA 3AQLA 4MFAA 4YVZA 2ZJ5A 2UVVA 4NM1A 4QWBA 4F4WA 4M9GA 3UPSA 5KFTA 1LV5A 1ZQBA 4M9LA 2VA8A 5DQGA 4XA5A 1BPZA 2FMPA 4UD4A 2R8JA 5J2GA 4TUQA 4B9SA 1ZQLA 9ICJA 5DDMA 3JPOA 3LWLA 2XY7A 3H37A 2IHMA 4IQUA 4YXMA 2KZ3A 3WFSC 2BQRA 2HVIA 4I2EA 4E8FA 5J2HA 4UBBA 4FS2A 4DLEA 3AUOA 2GWSA 2UVWA 1ZQTA 3HWTA 4ELUA 8ICUA 4FHYA 4EYIB 2B21A 3UQ0A 3TAQA 4KLOA 2MUTB 8ICEA 4YP3A 1RYRA 4X0AA 1NKCA 1NKEA 3MGIA 5IIJA 1ZQZA 3V6JA 2I9GA 1ZYQA 4M04A 4O5EA 4FHWA 1AROP 3GIIA 5DQIA 4YR3A 9ICBA 3L9DA 4DSIA 2KTQA 1DGSA 4F4ZA 4DOBA 4WBZA 4UAYA 8ICKA 1Q79A 4QZDA 1BGXT 3UXPA 3TFRA 4M9HA 3K4GA 5KG4A 2MUTA 2H5XA 1H38A 5BPCA 4DF8A 2Y1JA 4O3SA 2KN7A 3MR2A 4I2AA 4DLGA 4DS5A 5IIIA 3KHGA 4C8MA 1KLNA 3JPRA 4J9NA 4IQTA 2XCAA 4NLKA 4JWNA 7ICHA 4KITB 4F91B 2XGQA 5DG7A 3QE9Y 3LK9A 3RRGA 4KLTA 3BQTA 3MGHA 2ZUBA 2W9AA 4GLXA 2M2TA 4EP7A 4R65A 7ICPA 3JPQA 2AQ4A 8ICBA 2IBKA 5J0OA 1KTQA 2HHSA 4Z6DA 5HRIA 4QZGA 1ZQIA 4JWMA 4UBCA 4Z6FA 2ZH7A 3UPQA 3PW4A 8ICSA 1TVAA 4KLGA 3RAQA 4DF4A 1NO5A 4YN4A 2FLLA 3MR5A 4YQWA 3RJKA 4Q44A 3KTQA 1QLNA 1OU5A 8ICNA 1R8BA 4ECXA 2XY6A 3OSNA 7ICVA 1XWLA 3PO4A 1TAUA 4M5DA 2BE3A 3MABA 4KLFA 4B9UA 4FH3A 1S77D 3TANA 5KFZA 4I29A 1QSSA 4F5PA 4DSEA 3BQ1A 3RJFA 4X0BA 4X4QA 2M9NA 4RT2A 4DOAA 8ICGA 2NRZA 1ZQDA 5KFRA 4UB3A 2J6TA 3TI0A 4Q8FA 1JXEA 3PR4A 5KFIA 3T5HA 1ZQYA 5HRBA 2M2UA 5CB1A 4XUSA 1NK9A 5KG3A 9ICXA 4UB4A 1B43A 4XQ8A 8ICZA 4WC2A 2UVUA 1WCNA 1R8CA 1BPDA 2LYHA 5J0PA 4QWCA 2ASLA 1ZQUA 4I2HA 1NK4A 3C1ZA 7ICKA 4X4VA 1IM4A 4WC7A 4P4PA 3HP6A 4X4UA 5HRGA 2R8IA 5KT5A 7ICFA 3TARA 5KFDA 4Q8EA 2ZH2A 3GV7B 7ICMA 2NRKA 4XRHA 4WCWA 4RQ5A 3T3FA 3K75D 2J6UA 1JQRA 5DKWA 5BOMA 4RQ3A 5C5JA 5J2JA 4ECYA 5J0SA 5KT7A 4QZ8A 1S97A 2W8KA 4F8RA 4YXJA 5DEDA 1SZPA 5KFHA 4ECVA 3C18A 8ICIA 4F92B 5HRLA 2HHQA 5HRKA 5DB6A 1V4AA 1L5UA 4QW8A 5J0UA 2R8KA 9ICMA 4O3PA 2HW3A 3QEAZ 5KFJA 3MR3A 4ATBA 4TUSA 3PW7A 2RDIA 4ED8A 3H7IA 5J0XA 3GIJA 1FA0A 2PI4A 5HHIA 4MEYA 4DEZA 9ICQA 1IXRA 3PMLA 5IILA 4FHPA 3LDAA 2ZH8A 2A1JB 4RZRA 4P2HA 2BPCA 1D8YA 4E80A 1NJYA 2ZTDA 4YMNA 5F9NA 3Q8PB 4KTQA 1F5AA 3Q8SB 3HT3A 4ECQA 1KNYA 1T8EA 2HHPA 4EBKA 1JX4A 4QZHA 1XSPA 4JK1A 5KT6A 4FBUA 4JV0A 4DFJA 4M9JA 4BGDA 1X9MA 5KFPA 3RB6A 2F1HA 4YMMA 3C66A 2OWOA 2A1JA 3B0YA 4O0IA 4EZ9A 9ICSA 3JYYA 5KFOA 5HC9A 2AGQA 2ZH5A 3V7JA 3ISBA 2P6UA 3GIKA 4JUZA 4J9LA 2FPMA 4ED1A 4K4IA 1MC8A 5DG9A 2W9CB 1UT8A 4EEYA 1XS9D 4FBTA 4F4YA 4KLDA 2ZUCA 4KLLA 1YLQA 5TZVA 2ALZA 1Q78A 2FMQA 3GQCA 1Z00B 1T7PA 4NKTA 3QEBZ 3MR6A 4DOCA 2FMSA 4I2GA 4F2SA 4TURA 3G6YA 2ZTCA 4DL4A 4I2BA 8ICVA 2W9CA 5J29A 1VFGA 3EZ5A 2VA3A 4QZBA 2KZZA 1BNOA 4P4OA 1XSNA 1Z00A 4IQWA 3C1YA 2WTFA 3V6KA 3RBEA 2DR9A 1S10A 2HHTA
chains in the Genus database with same CATH superfamily
4QZFA 1X9WA 4CRXA 4KLSA 4IR9A 3JPSA 2R18A 3PO5A 1PVPA 1RG6A 4K99A 3F2DA 2ZJAA 1KRPA 2PFOA 8ICAA 4RWNA 3M6KA 4FO1A 7ICIA 4YG2A 2V4RA 5ALNA 4K96A 4NLNA 3RJIA 3SI8A 4WC7A 3IHQB 2NRVA 1X2IA 2D8CA 5ALLA 4EZ6A 4F2RA 1ZQFA 4K8VA 3T5LA 3HPOA 2H3FA 1TFRA 4RPYA 1JN3A 2C22A 4LEYA 4US8A 3H38A 3F2BA 3IM1A 2WB1F 1ED1A 1YT3A 5KFCA 3AQNA 3V6HA 4ZOHC 4YR2A 1S76D 4KB6A 5IINA 1C20A 3RH6A 1Z1VA 3NRZA 4J9KA 5J0TA 4OAGA 2BGWA 1RYUA 8ICXA 1ZQMA 4O69A 2ZH9A 3RB0A 4RQ6A 3ISDA 5L1JA 1SB3C 2XVTA 5EWFA 4B9TA 2AGPA 5AHXA 1NK7A 3RJJA 8ICFA 1QSYA 1TKDA 2FPKA 3TFSA 4ECRA 1EXNA 3PHZA 1BNPA 1FIQA 3BZKA 4F5OA 2MRLA 3KBBA 4U7CA 4S3NA 2VANA 1SL2A 1S9FA 1UETA 3H8SA 5KFYA 3LVVA 2W9BB 4DL5A 5KFGA 4IG8A 4UARA 5AI0A 4PHDA 1NZPA 4JLZA 4WC1A 4CF5A 1FFUA 3RB4A 2R8HA 4HAIA 2W9BA 1Q3UA 2HOFA 4MFCA 4QZEA 1COKA 2ISOA 5ALYA 1IIPA 3A0HU 2LHTA 5ALSA 3I76A 1U9LA 4O3MA 1SV0A 4F71A 1N56A 3KKAC 4GXKA 3OUYB 3JPNA 3RR7A 4KMOB 1KKXA 2RLTA 1JUDA 2K8BB 3BJYA 1VDVA 2DPIA 2B4VA 3Q8KA 8ICRA 4RWOA 1S0MA 4I28A 3TACB 1VJ5A 4RWQA 5H2FU 3B0XA 3OUYA 3KZIU 4DSFA 1AQ6A 3AM9A 2Y0SC 3LWMA 9ICGA 3QUBA 1SXEA 5EOZA 1B0XA 1J2MA 1L8OA 2BCUA 1NKBA 2XIDA 5F3XB 3WKDA 2DGZA 2Q66A 5KG7A 1SWVA 4DQPA 5JUMA 1JXLA 5L9XA 2JV3A 1WCLA 5CP2A 3SV4A 2KV2A 5D46A 4I27A 2Q4TA 2PXIA 1U4BA 4DL3A 5AKEA 2KFNA 2HHXA 2HHUA 3N28A 3QU2A 3PV8A 1RXVA 2YMPA 5HNKA 2DF4B 2K4IA 3ZDCA 2ES6A 2C2RA 2ZIUB 3NVYA 2JH7A 4RQ0A 3JCFA 3H4DA 1BPEA 2KJ9A 4LZDA 4J9RA 5CWRA 5DLFA 3QX7A 1PX5A 5EWEA 3ZDEA 1R89A 4C8KA 1QQ6A 3RH5A 4ED3A 4PZNA 1L3VA 1BPXA 3AQKA 3EWAA 1KDHA 9ICSA 5HRFA 1XSLA 3ZD9A 3QZ8A 2G09A 1JAJA 2E8MA 2EAMA 3M6ZA 2OM6A 2DFLA 5J2EA 5CFUA 2LM1A 7ICGA 1L7MA 4J9MA 4ATBB 4ICAA 1L3UA 1ZQHA 4KLEA 3QNMA 1MSWD 5J0WA 3H39A 2ZXHA 3R9KA 2F8KA 5AM0A 2XCPA 2KKVA 9ICHA 2YB1A 1NK6A 4X4RA 5J2IA 2I5HA 2JR5A 1PZNA 2IA6A 4I2JA 4OD0A 4FFDA 1WOTA 5D61A 2K8AA 1RQNA 2B6GA 1N5WA 5KFWA 2ZH6A 1ZD2P 3NWIA 1QSLA 1TFYA 3WKBA 3GFKB 4F5QA 2RDJA 4KLMA 3JPPA 4MFAA 4NM1A 4QWBA 1KQQA 4M9GA 1LV5A 4NXUA 1V97A 4UD4A 2WF6A 5ALXA 5CFTA 4TUQA 2WF7A 3SEIA 3H37A 2L5YA 2EWRA 3WFSC 4CF4A 4I2EA 1A6SA 3A0BU 3WK4A 5JU5A 1Q8KA 4ELUA 4EYIB 4KLOA 4EEKA 1RYRA 1NKEA 3MGIA 2I9GA 1ZQZA 4O5EA 3HILA 1AROP 3SQIA 2BZFA 4OAFA 4DOBA 3K4GA 3PSFA 5IIIA 1CI4A 4C8MA 4IQTA 2XCAA 2E1EA 4KLTA 1IG6A 3RRGA 3BQTA 2W9AA 2KE7A 2EQYA 5ALEA 7ICPA 1D8BA 2F44A 4Z6FA 2ZH7A 3UPQA 3PW4A 4EELA 1RQLA 4AYBC 4F72A 2FLLA 3RJKA 4ECXA 2XY6A 3CNHA 2RQ5A 7ICVA 1XWLA 4PJ0U 4M5DA 2G06A 1ZXIA 5AM5A 1QH9A 3QYPA 3TANA 2ZIVB 1S77D 1QSSA 3BQ1A 2ESEA 3RJFA 2M9NA 8ICGA 5KFRA 3TI0A 1JXEA 1URJA 2M0NA 4NJ8A 1ZQYA 2M2UA 5CB1A 3NVOA 4UB4A 4XQ8A 8ICZA 2ZIVA 2LYHA 4X4UA 2R8IA 7ICFA 2KK0A 5KFDA 3GV7B 3TADC 4RQ5A 3T3FA 2J6UA 4OAIZ 5KFHA 3ICXA 4O68A 4F92B 5HRKA 5DB6A 5HR7A 4ED8A 1SWWA 3H7IA 3LDAA 2NV3A 4P2HA 4E80A 3Q8PB 2HBLA 1SXDA 3I28A 4ECQA 3TKAA 2HHPA 1ZD4A 1XSPA 4FBUA 4EENA 4JV0A 2BDUA 4EEDA 1L7NA 3C66A 4OJLA 4O0IA 3C28A 4WQLA 2W04A 2ZIXB 4FBTA 5C0YA 2K4HA 2KIWA 5G5HA 4ACOA 4C4TA 4Y2RA 4NKTA 4DOCA 4KM5A 3ER8C 2ZIXA 3J81j 2ZTCA 2QB1A 4QZBA 1BNOA 2WTFA 3ZDBA 2KHVA 5KFAA 3CP8A 3KZXA 1KFTA 3H0RB 1SL1A 1XNSA 1U47A 7ICEA 9ICFA 2YY6A 1UA1A 2KFZA 4Y2UA 1ZETA 2W54A 5J0RA 1BPBA 4AT9B 1JALA 5ALOA 1WYGA 4DFPA 1RPLA 2M2WA 3EF2A 4DSLA 3OVAA 4NWIA 1NJZA 4WC4A 3T5JA 3AU6A 4C4RA 3NVZA 4YMOA 5J8YA 4FO6A 1D9DA 5ALMA 3MDCA 2FDRA 4EEBA 4KX3A 1SKRA 1D9FA 2ASJA 4FZLA 3LQCB 4PZOA 5DECA 3SMVA 1DK2A 4Y2JA 2M2VA 2PMZF 4EBJA 3OSPA 3V7LA 3OHAA 4UAWA 4E0DA 4UB5A 2NYVA 3MBYA 4J9SA 5CR0A 3GZFA 2R8GA 3D2SA 5AI5A 3H8WA 2IHNA 4KLQA 5KFNA 1MIYA 2ZH1A 1VLBA 1ZJMA 4QWAA 2ZHBA 3WK5A 4P4MA 1S5LU 2JMGA 1ZQEA 5L1IA 1SGGA 4OJOA 3UXNA 1WUDA 1F44A 4PHPA 9ICOA 4KN7A 1ZOLA 1SV4A 2YMMA 9ICKA 2D6FC 2AGOA 5ALZA 4NLBA 3SAGA 3BQ2A 4F4KA 1MQ3A 3D2NA 1S0VA 3S6JA 1TV9A 3TAPA 3Q8QB 2F1JA 1KEJA 3IDWA 3QXGA 3GV5B 3ETLA 4F5RA 5HP4A 2JEGA 5B3QA 1X40A 4PGQA 4O3NA 2ASDA 1QTMA 4PL1A 2KIVA 3Q8MA 4MF2A 5HRHA 2KZMA 5FP0A 4JV2A 3NASA 3KHRA 8ICJA 9ICUA 4NL9A 2GH1A 2CN1A 4X4SA 1RDFA 4BJQA 4O3OA 2W8LA 1DGJA 1V38A 4GXJA 2NO5A 4GC6A 3UMCA 1VJ7A 2K4PA 5DBAA 1SKWA 2FLPA 3MC1A 2XO7A 5ALQA 2NO4A 1QQ5A 1Z1BA 4ED6A 7ICOA 2VJ4A 3WKAA 4PPXA 1HIWA 4I2DA 3SAHA 2WAQC 3C5GA 2DVIA 1X6IA 4DQRA 1O08A 5DGBA 2V4QA 4GC7A 4TQRA 3JZ0A 3EYZA 3VC8A 5HREA 5ALGA 5DB9A 4EBCA 4Y2TA 5CHGA 5JTIA 3FDSA 1ZQOA 4B9NA 1N48A 4TQSA 4QZ9A 4Q43A 3NRWA 4C80A 4EV6A 7ICJA 1ECWA 4QZIA 4RQNA 4WH5A 3QU9A 1A76A 5IIKA 3PY8A 1KSPA 3H4BA 2BKEA 5KFMA 3GIMA 3SR6A 2DRBA 2FPLA 4LVSA 4WJ3B 4GXIA 5DLGA 5CHEA 3E2EA 5KT4A 4ED0A 8ICLA 1NJWA 2HOIA 4DQIA 1ZD5A 4RNNA 5KG1A 3GDXA 4NKUA 2ZG6A 3ZI4A 4ECTA 5J0YA 5HR9A 3L3FX 4RQ1A 1GPJA 3G6XA 3T5KA 3Q8LA 1L7PA 5HHHA 1MQ2A 4FH5A 3NGDA 3SV3A 3OPXA 4RU9A 1K5OA 3UMGA 4G3IA 2B51A 3UM9A 2E3TA 4IRDA 4UAVA 4ELTA 4KLIA 1X42A 1T94A 1NK0A 1ZQAA 5DDYA 4C8OA 3OVBA 4FHXA 1ZQRA 5CFSA 1RXWA 2OCEA 2W11A 2W9MA 2XY5A 1ZQJA 2P66A 1ZQCA 3FC4A 4NXXA 2I6XA 4DCCA 1TAMA 3AU2A 2F1IA 4K97A 4A8EA 3ISCA 4B9LA 2HBMA 3BS5B 3E0FA 4NLZA 3RH4A 4R66A 4TUPA 4QWDA 4OAHA 4DS4A 2YMQA 2QB0B 5DBCA 2BHNA 3SYZA 3M9MB 3MFIA 3BS5A 2W7OA 5KAFU 4BWJA 1S0NA 3WK9A 2JEJA 5ALIA 2DWQA 3RJGA 2KICA 4F50A 4UQGA 1ZQSA 2QB0A 2ATLA 5AK5A 2G5HB 4OCZA 1NK8A 2UVVA 4YVZA 3IN5A 4F4WA 3UPSA 5DQGA 5J2GA 2JGAA 5ALRA 3SD7A 3JPOA 2XY7A 2A3VA 2ZIWB 4YXMA 2HVIA 5GTIU 4JMUA 5J2HA 4UBBA 4FS2A 1ZQTA 5AICA 1Z19A 1N63A 2ZIWA 1ZYQA 3VCBA 4YR3A 5T14A 4DSIA 1DGSA 2YMLA 4UAYA 8ICKA 1L6NA 3IG5A 5BPCA 2Y1JA 2KN7A 4U6PA 3MR2A 4I2AA 5E79U 3KHGA 7ICHA 3WK7A 3WU2U 4JWNA 4F91B 2XGQA 5AKJA 3MGHA 4EP7A 4R65A 2P35A 3JPQA 3MGVA 2IBKA 2G0AA 5J0OA 4JWMA 5HR6A 4KLGA 3RAQA 4DF4A 5AM4A 3F5EA 3MR5A 1R8BA 4Q44A 3KTQA 1Z4NA 1ZRNA 3OSNA 3PO4A 2WFAA 4FH3A 4B9UA 5KFZA 4F5PA 3AEVA 4X4QA 4DOAA 2NRZA 4P0QB 2G07A 2ZIUA 3PR4A 4NXWA 4IS7A 9ICXA 1B43A 4WC2A 1R8CA 5AKKA 1S8OA 3FAHA 5JRTA 4P0QA 4J03A 5HRGA 2BBJA 1L7OA 5KT5A 2KNJA 2ZH2A 2NRKA 2QLTA 4WCWA 2ODGA 5AI9A 1JQRA 4RQ3A 5C5JA 5J2JA 1KBUA 4JLXA 4QZ8A 3WK6A 4ECVA 3RF9A 5HRLA 2HHQA 5AK3A 2E8OA 5G5GA 5J0UA 2R8KA 1OXJA 3K7DA 5AIAA 1PK3A 4ATBA 2K89A 4BX9C 3D2QA 3PW7A 1FA0A 5HHIA 4UB6U 1IXRA 4WOYA 3GU3A 2QARB 4RZRA 2AH5A 2N1RA 5F9NA 1F5AA 3HT3A 2LYAA 1KNYA 2OEHA 4CF3A 5KT6A 4C7ZA 2QARA 5KFPA 2D3DA 4YMMA 3JYYA 3B0YA 3V7JA 3ISBA 2P6UA 5D62A 3GIKA 4J9LA 4K4IA 1MC8A 2W03A 4F4YA 2ZUCA 2LI6A 2FMQA 2LBOA 2FMSA 4I2GA 3G6YA 8ICVA 5J29A 1VFGA 4C0ZA 4K9BA 2KZZA 1XSNA 2GO7A 2IHOA 3E58A 2DR9A 1KFSA 8ICMA 5CRXA 4QW9A 4WBYA 1V9PA 3ORYA 2DPJA 2I1QA 7ICRA 1Q46A 4RUAA 5KG5A 3NYBA 4XQ7A 2AQ0A 3QUQA 4UB8U 2RFFA 3HKZC 1N5XA 4K4HA 2W7PA 5ALFA 3ER9B 3M9OB 1CUKA 4NXZA 4IRKA 1UT5A 3RJEA 1F0MA 2HN1A 4UB2A 2XC9A 2IMWP 3WKCA 2IOFK 1Z3EB 5J2FA 1TK5A 4M0AA 1B4FA 4O5CA 4RQ7A 2BPFA 3UQ2A 4J9OA 2C28A 1LB2B 3SENA 1ZD3A 1CEZA 3CW2C 4RQ8A 2HBJA 2NRTA 3CRXA 4MF8A 3NVVA 1ZQQA 4ED2A 9ICPA 2UVRA 5DBBA 3N4MB 1BPYA 3ZDDA 4DQSA 4C8LA 5F2VO 4K9AA 2JEIA 5ALUA 4NLGA 3RR8A 3OV7A 3RTVA 5J8YC 5ALVA 1HJPA 1XO0A 4Y2SA 2ZTEA 4I2FA 2HSZA 2BQUA 2FE9A 1UQVA 3HJEA 5AM3A 2JRZA 3WKEA 1SL0A 1ZQKA 1LKYB 5KTQA 9ICAA 1TK0A 3LYSA 2ZJ8A 3N97B 5KG0A 5IIMA 4EX7A 4F3OA 3ETRA 2EZXA 5KFFA 4NXVA 1LKYA 4O9MA 5AIBA 4QZCA 4RNOA 3WFRE 2JEFA 5KG2A 4RWPA 1ZQ1C 1OUQA 7ICUA 1FFVA 2DUYA 3PX4A 3C29A 4YCXA 3K1ZA 4FZNA 5AKGA 4M6WB 2KG5A 4EYHB 3HJ1A 1QCKA 3EUB2 5IIOA 1RZTA 4DL6A 3EPGA 4RPZA 4HYKA 4AT7B 2DR7A 3RB3A 4M6WA 4NV0A 2ISPA 1XO1A 3THVA 2PFQA 1PUZA 3NTUA 4LEZA 5F9LA 2DR5A 4AT7A 5J2DA 3PSIA 4WC0A 3ERCC 3UMBA 8ICHA 1M6YA 2KP7A 4Q45A 5KT2A 4NY8A 1UEUA 2W3SA 2PFNA 1KFDA 1J2NA 1JRPA 4LT6A 3HRDD 4IC9A 2WAQF 4DFMA 2ZXIA 4AT9A 3JPTA 2HN2A 2EZZA 2YX8A 4EBDA 4NL9C 1PVQA 8ICPA 5KFLA 5KFEA 3D6JA 1XU4A 2BQ3A 1UA0A 3F2CA 1U49A 4CDGA 5DB8A 5J2AA 3ZD8A 3TADA 3C21A 5KFXA 2LYBA 2HVHA 4DWIA 3O0FA 4F93B 1NK5A 4ECWA 1U45A 1MA7A 2W55A 3KD3A 3PW0A 2BR0A 1L3SA 9ICCA 2Z7JA 4ECZA 3BDPA 3IG8A 4UD5A 3PSPA 4B9MA 9ICIA 4KLHA 5AI8A 3WK8A 3QZ7A 3TQ1A 4AP9A 1NOMA 1Z4OA 4BDPA 3V7KA 2NRWA 2WF5A 2P6RA 5B66U 1DOQA 1DRGA 4KN4A 2BCVA 2VA2A 4RQ2A 1P7DA 5KT3A 5J0QA 4WQKA 4DQQA 4EBEA 5AM1A 4DSKA 9ICVA 3N7PD 4ECUA 2XGPA 3V72A 1N62A 4Y2YA 3F5AA 7ICMA 4IQVA 1S0OA 1RM6C 4I2IA 4DSJA 4DFKA 3I1YA 4C8NA 4PH5A 4FZMA 4OJPA 4UW9A 4NXTA 1Y88A 4CE6A 3Q8RB 1HUZA 3N7RC 2HHVA 2HOQA 3RRHA 1ZQGA 3DEEA 3OGUA 2H3VA 2ZUDA 2PFPA 3N7SC 1TAQA 5J2BA 1TK8A 2HMXA 5B3PA 5KL8B 1NJXA 5DGAA 4O5KA 2KVSA 4X5VA 4B9VA 9ICTA 2PBEA 3G6VA 4JV1A 3SZ2A 4MHVA 3AQMA 2KEYA 1N60A 4MFFA 4FE3A 2ZH3A 1X9SA 9ICEA 2ZH4A 4F5NA 4GIBA 1SKSA 3KHHA 4YD2A 4UB1A 2ZJ5A 3QU7A 4M9LA 3BS7A 5ALWA 9ICJA 3LWLA 5EE3A 1FO4A 4IQUA 4OJ6A 5B5EU 2OXOA 4CNQA 2OHFA 1ZRMA 4DLEA 3AUOA 2GWSA 2UVWA 8ICUA 3UQ0A 2B21A 3TAQA 4X0AA 4M04A 4FHWA 3GIIA 2Y0SF 9ICBA 3H0MB 2XI9A 2VJ5A 4B6JA 2KD1A 4F4ZA 2LMRA 2GA9D 4O67A 2KVCA 3TFRA 5KG4A 3H0LB 4DLGA 4DS5A 1SV0C 3JPRA 3QE9Y 3LK9A 2Y9TA 4GLXA 3ALRA 8ICBA 2CPRA 1ZQIA 4UBCA 1NNLA 3KOOA 1TVAA 2PMZC 4YN4A 2KJ5A 1QLNA 1X6JA 3MABA 2QKQA 4KLFA 4I29A 2F3NA 1ZQDA 2J6TA 4Q8FA 2EAPA 5KFIA 4N7RA 4G9BA 3ED5A 3H8MA 2GLEA 4XUSA 1NK9A 2UVUA 1BPDA 4QWCA 4I2HA 5GTHU 4X4VA 1IM4A 2EZYA 2K8CB 4P4PA 3HP6A 4C4SA 3TARA 4Q8EA 1LVHA 1KL9A 5DKWA 5BOMA 4ECYA 5J0SA 3M7DA 4Y2XA 2W8KA 4YXJA 3C18A 5AKYA 3IP4B 1L5UA 2EDUA 4QIWC 1GO3F 2AXTU 4DFDA 4O3PA 2RDIA 5J0XA 2PI4A 4LEWA 4MEYA 9ICQA 3PMLA 1X9XA 1JROA 2K60A 1D8YA 1NJYA 4YMNA 2E8NA 3Q8SB 1MN8A 1JX4A 4QZHA 4DFJA 4M9JA 4BGDA 1HEKA 3RB6A 2F1HA 4EZ9A 2ZH5A 2W43A 5ALDA 4JUZA 2FPMA 4ED1A 4EEYA 2BBHA 4KLDA 5TZVA 2ALZA 1Q78A 3DV9A 3GQCA 2H3QA 1T7PA 2Y9UA 4PL2A 4F2SA 3QUTA 4I2BA 4DL4A 3L5KA 5ALHA 2LKYA 4P4OA 3C1YA 2IOHA 5ALTA 3V6KA 5AKZA 2JHDA 4UATA 5D4BA 1A0PA 3M9NB 1T3NA 4X4TA 4UASA 4AT8B 3C23A 2IOFA 4R63A 4KLJA 4EGWA 9ICLA 2O5AA 3PX0A 2XICA 2BPGA 5ALJA 5KFKA 5EE0A 8ICTA 4RQ4A 2J6SA 3H40A 4AT8A 2O1PA 5CA7A 1A77A 1WWVA 7ICNA 5K4LA 4R8UB 9ICRA 2JZBB 3OJUA 3HKZF 2WB1C 3GV8B 3C5FA 3RBDA 2KHQA 1WWUA 3M1YA 4QJFB 4J9PA 1SIJA 5ALPA 2Q0ZX 2VIXA 3C2LA 5L1LA 4UAZA 3RAXA 4R8UA 2JZBA 1NI3A 4AYBF 4X4OA 2HDOA 4PHAA 1ZQXA 1ZQNA 4PGXA 3HW8A 3T79A 2LPEA 3OHBA 2PKEA 2AJQA 1HUOA 3HIYA 3DDHA 4O3QA 1K1QA 3OVSA 4PHEA 8ICOA 2ZHAA 4BXOB 4K4GA 1JIHA 1FEZA 3B9JA 5KFQA 4YR0A 5L1KA 1PVRA 4IR1A 3NKUA 3NS1A 1D8LA 2H3IA 4BWMA 1COOA 4BXOA 4DL2A 1UEVA 1N2XA 4C7YA 4PGYA 8ICWA 3KKAA 3MDAA 5HMMA 3MFHA 1R8AA 4RNMA 1BVSA 4Z6CA 3L4PA 4CCHA 5KFVA 9ICWA 4QNLA 3QU5A 2NRXA 4WC3A 4BUGA 4US9A 2A1AA 3NVWA 4HX0A 1F5SA 2OYYA 2G5IB 3M8RA 3BQ0A 5TISU 2BDPA 3KHLA 4ZH4A 5HMLA 5L1MA 2DBYA 5J2CA 3IV6A 1MIVA 3UXOA 3PW2A 2BCQA 2EANA 1O03A 1T3QA 3PW5A 1JMSA 1L8LA 2YB4A 2DKXA 3AQEA 3PR5B 4KLUA 2JXJA 1YZ6A 4GFJA 7ICSA 5KFBA 4ELVA 2BCRA 2HBKA 4Y2VA 1T4GA 3FM9A 3HX0A 2B0CA 2KOBA 4J9QA 4X4PA 2PI5A 2DKZA 5DQHA 4UAUA 2ID1A 4NM2A 3CK6A 4YD1A 3QU4A 2HI0A 4O6AA 2V9WA 3PMNA 2KKPA 2AU0A 2LM4A 4ED7A 4Y2QA 3ONNA 2EAOA 2DL0A 2YQEA 2HCFA 1RYSA 7ICLA 2DR8A 5EE9A 2JH1A 5KL1B 1QQ7A 3WFQE 4O3RA 8ICCA 4WC5A 4ECSA 2RP5A 2FJ6A 5ALKA 1ZQPA 2C2DA 3WFPA 3EW9A 2EH9A 2BCSA 2H3ZA 4IL6U 5J2KA 4M9NA 1SZHA 2A19A 3H3AA 7ICQA 8ICQA 3CYMA 3C2MA 1CRXA 2VKQA 3RJHA 1K1SA 1MIWA 4OO1J 5KFSA 5AK4A 2AHOB 1Q3VA 1B22A 2KMDA 1UCVA 1ZJNA 4LJXA 4KX5A 1NZBA 5KG6A 4QWEA 2HHWA 2E5SA 4DL7A 3OWGA 4USAA 2Y1IA 2WF8A 5AKHA 3ZDAA 1L3TA 3PNCA 3RFAA 4FS1A 1PK1B 3GILA 2WF9A 5JTGA 5CJ7A 1XC9A 4IRCA 3C2KA 3M8SA 4M2YA 4M47A 9ICNA 3MCRA 4E7XA 3FYHA 1PK1A 1DK3A 3AN1A 3PX6A 1WG8A 3WFOA 1TFWA 1J97A 4RT3A 3F53A 4FHVA 3OJSA 4RUCA 3K1RB 4Y2PA 4R64A 4I2CA 2MAXA 2FCLA 5HRDA 5EE1A 1KN5A 3HJ4A 5KFUA 4I0UA 1ZQVA 5BOLA 3OTQA 7ICTA 3IRUA 4DO9A 4Z6EA 2GOLA 4YFKA 3H8JA 2OH2A 4WC6A 2DRAA 5EWGA 4KMUA 4RPXA 2F2AB 2K4EA 3AMZA 8ICYA 4MKPA 4LZGA 5DB7A 2F76X 5D49A 4F4XA 2FLNA 3KFUF 2YN4A 1ZQWA 5DG8A 3PVXA 3EPIA 2G08A 4MEXA 1YZ7A 4X4NA 2W3RA 1U48A 5AKLA 4QZAA 2C2EA 1C7YA 3AQLA 3BZCA 5AK6A 5KFTA 1JI7A 1ZQBA 2VA8A 4XA5A 1BPZA 2FMPA 2R8JA 5KAIU 4B9SA 1ZQLA 2IUBA 5DDMA 5KNIA 1DXSA 2IHMA 2KZ3A 2BQRA 2CRXA 4E8FA 2DQNB 3NUQA 2FI1A 2E8PA 3HWTA 2RHFA 5AM2A 4FHYA 2MUTB 1IV8A 2RRDA 4YP3A 8ICEA 1NKCA 4JB3A 5IIJA 3V6JA 5DQIA 5A0LA 2B56A 3L9DA 5AKIA 2KTQA 4WBZA 1Q79A 4QZDA 1BGXT 3UXPA 4M9HA 2MUTA 2H5XA 2WHEA 4DF8A 1H38A 4O3SA 1OW5A 1KLNA 4J9NA 4NLKA 2GAFD 4KITB 3QUCA 5DG7A 2ZUBA 2M2TA 2AQ4A 5HRIA 2HHSA 1KTQA 2MSNA 4Z6DA 4QZGA 8ICSA 3AL0B 1NO5A 4YQWA 1OU5A 4EX6A 8ICNA 1TAUA 2MU2A 4NLCA 2BE3A 4X0BA 4DSEA 4RT2A 1UHUA 4UB3A 5CEHA 3T5HA 5AI6A 5HRBA 1TE2A 2CXYA 3U26A 5KG3A 4OJ5A 2F8LA 1WCNA 7ICKA 5J0PA 1KW4A 2ASLA 1ZQUA 1N61A 2KSOB 3C1ZA 1NK4A 4K98A 4RQMA 4XJEA 4XRHA 5AKXA 2MA1A 3SAFA 3AQFA 3PZPA 3K75D 2KSOA 5KT7A 1S97A 4F8RA 5DEDA 1SZPA 3BQ7A 8ICIA 2O6KA 1V4AA 4QW8A 9ICMA 3LVWA 2HW3A 3QEAZ 5KFJA 3MR3A 4TUSA 3GIJA 4DEZA 5IILA 4FHPA 4QIWF 2A1JB 2ZH8A 2BPCA 2F77X 2ZTDA 4KTQA 2KJ8A 1T8EA 4EBKA 4JK1A 1X9MA 1X66A 4CGZA 2OWOA 2A1JA 5HC9A 5KFOA 2YTUA 2AGQA 4P0PB 4LEVA 5DG9A 2W9CB 1XS9D 1UT8A 4KLLA 1YLQA 1Z00B 2E1FA 1UPHA 3QEBZ 3MR6A 5D63A 4P0PA 4TURA 5AI4A 2W9CA 3PSTA 3EZ5A 2VA3A 4IQWA 1Z00A 1V85A 3RBEA 1S10A 2HHTA
chains in the Genus database with same CATH topology
4QZFA 1X9WA 1KFSA 3ZDBA 5D4BA 5KFAA 4KLSA 3M9NB 8ICMA 1T3NA 1KFTA 1SL1A 4QW9A 4IR9A 3JPSA 4WBYA 4X4TA 1V9PA 3ORYA 3C23A 2DPJA 4AT8B 3PO5A 1U47A 2I1QA 4R63A 7ICEA 9ICFA 4KLJA 7ICRA 1UA1A 2ZJAA 4RUAA 1KRPA 2KFZA 5KG5A 2PFOA 1ZETA 5J0RA 4AT9B 1BPBA 8ICAA 9ICLA 2O5AA 3PX0A 3NYBA 4XQ7A 2AQ0A 4RWNA 2BPGA 5KFKA 8ICTA 4RQ4A 2RFFA 2J6SA 3H40A 4DFPA 1RPLA 7ICIA 2M2WA 4AT8A 2O1PA 4DSLA 4YG2A 5CA7A 2V4RA 4K4HA 1A77A 3OVAA 1NJZA 4WC4A 3T5JA 3M9OB 3AU6A 7ICNA 1CUKA 4NXZA 4YMOA 4FO6A 1D9DA 4R8UB 4IRKA 1UT5A 3MDCA 3RJIA 3SI8A 3RJEA 3IHQB 4NLNA 2JZBB 9ICRA 1SKRA 3OJUA 2NRVA 1D9FA 2ASJA 1X2IA 3GV8B 3C5FA 4EZ6A 3RBDA 4UB2A 1ZQFA 3T5LA 4F2RA 3LQCB 2XC9A 4J9PA 2IMWP 5DECA 3HPOA 3C2LA 2Q0ZX 5L1LA 3RAXA 4UAZA 1TFRA 4RPYA 4R8UA 1JN3A 1DK2A 1Z3EB 2M2VA 2JZBA 2C22A 4X4OA 3H38A 4PHAA 1ZQXA 1ZQNA 5J2FA 4PGXA 3IM1A 4EBJA 3HW8A 3V7LA 3OSPA 5KFCA 3OHAA 4UAWA 1TK5A 4M0AA 3OHBA 3AQNA 4E0DA 3V6HA 4UB5A 4O5CA 4YR2A 4RQ7A 2BPFA 2AJQA 3UQ2A 4J9OA 3MBYA 2C28A 4J9SA 1LB2B 1HUOA 1S76D 5CR0A 5IINA 3HIYA 2R8GA 1CEZA 4O3QA 3H8WA 9ICTA 3RH6A 2IHNA 1K1QA 4RQ8A 4PHEA 3OVSA 2NRTA 4KLQA 8ICOA 5KFNA 4MF8A 1ZQQA 4BXOB 4J9KA 5J0TA 4ED2A 2ZHAA 1MIYA 2ZH1A 4K4GA 1JIHA 9ICPA 5KFQA 5DBBA 4YR0A 5L1KA 1ZJMA 3N4MB 4QWAA 2BGWA 1BPYA 1ZQMA 8ICXA 3ZDDA 2ZHBA 4P4MA 2ZH9A 4DQSA 3RB0A 1D8LA 4RQ6A 4C8LA 3ISDA 1ZQEA 4BWMA 5L1JA 5L1IA 5F2VO 1COOA 2JEIA 5EWFA 4B9TA 4BXOA 2AGPA 4DL2A 4NLGA 3RR8A 1NK7A 1UEVA 3OV7A 3UXNA 4PGYA 3RTVA 8ICWA 4PHPA 9ICOA 1HJPA 4KN7A 3RJJA 8ICFA 3MDAA 5HMMA 3MFHA 1QSYA 1R8AA 2ZTEA 4RNMA 1BVSA 4I2FA 1TKDA 2FPKA 9ICKA 2AGOA 4Z6CA 3TFSA 4ECRA 4CCHA 9ICWA 5KFVA 1EXNA 2BQUA 3BQ2A 2NRXA 4F4KA 1MQ3A 1S0VA 1SL0A 4WC3A 1BNPA 1ZQKA 5KTQA 9ICAA 1TV9A 1TK0A 3TAPA 3Q8QB 2ZJ8A 3N97B 4F5OA 5KG0A 5IIMA 2F1JA 4S3NA 2VANA 1KEJA 3M8RA 1S9FA 3GV5B 1SL2A 4F3OA 3ETLA 1UETA 5KFFA 4F5RA 5HP4A 2JEGA 3H8SA 5KFYA 4O9MA 2W9BB 3BQ0A 4DL5A 5KFGA 4QZCA 4RNOA 4PGQA 4O3NA 2BDPA 3KHLA 3WFRE 2ASDA 4ZH4A 5HMLA 5J2CA 1QTMA 4IG8A 4PHDA 2JEFA 5KG2A 3Q8MA 1NZPA 4RWPA 1MIVA 3UXOA 3PW2A 4WC1A 4MF2A 2BCQA 7ICUA 5HRHA 2KZMA 3RB4A 4JV2A 2R8HA 3KHRA 3PW5A 1JMSA 8ICJA 9ICUA 2W9BA 3PX4A 4MFCA 4QZEA 2ISOA 3PR5B 4YCXA 4KLUA 4X4SA 1U9LA 4M6WB 4O3OA 7ICSA 5KFBA 2W8LA 4ELVA 4EYHB 4GXJA 1N56A 3HJ1A 4GXKA 2BCRA 3OUYB 5IIOA 4GC6A 1T4GA 4DL6A 1RZTA 3JPNA 3HX0A 3RR7A 3EPGA 4RPZA 4HYKA 4AT7B 1VJ7A 2DR7A 5DBAA 3BJYA 3RB3A 4J9QA 1SKWA 2DPIA 3Q8KA 4M6WA 4X4PA 8ICRA 4RWOA 1S0MA 2FLPA 2PI5A 4I28A 5DQHA 2XO7A 1XO1A 3THVA 2ISPA 2PFQA 4RWQA 3B0XA 2ID1A 3OUYA 4NM2A 3NTUA 5F9LA 2DR5A 4ED6A 7ICOA 4AT7A 5J2DA 4YD1A 4PPXA 4WC0A 2V9WA 4DSFA 4I2DA 3PMNA 8ICHA 3C5GA 2AU0A 2DVIA 3LWMA 4ED7A 2KP7A 9ICGA 4Q45A 5KT2A 4DQRA 4NY8A 1UEUA 5EOZA 5DGBA 2PFNA 1KFDA 2V4QA 4GC7A 1NKBA 2BCUA 4TQRA 1RYSA 7ICLA 3JZ0A 2DR8A 3EYZA 2Q66A 4LT6A 5KG7A 5HREA 5DB9A 4EBCA 4DFMA 3WFQE 4O3RA 5CHGA 4AT9A 3JPTA 4DQPA 8ICCA 3FDSA 4EBDA 4ECSA 4WC5A 1ZQOA 8ICPA 5JUMA 5KFLA 5KFEA 1JXLA 1N48A 4B9NA 5L9XA 1XU4A 4TQSA 1ZQPA 1WCLA 5CP2A 4QZ9A 3SV4A 2C2DA 3EW9A 2BQ3A 1UA0A 4Q43A 2BCSA 5D46A 3WFPA 4I27A 1U49A 7ICJA 5J2KA 5DB8A 5J2AA 3ZD8A 4QZIA 2PXIA 4M9NA 3C21A 1A76A 5IIKA 5KFXA 3PY8A 1U4BA 1KSPA 2HVHA 3H3AA 3H4BA 4DL3A 2BKEA 5KFMA 3GIMA 2KFNA 4DWIA 4F93B 2HHXA 4BDPA 2HHUA 7ICQA 2DRBA 8ICQA 3PV8A 5HRFA 3C2MA 1NK5A 1RXVA 4ECWA 5HNKA 1U45A 3RJHA 1K1SA 2FPLA 1MIWA 5KFSA 3PW0A 2BR0A 1L3SA 4LVSA 3ZDCA 9ICCA 4GXIA 4ECZA 5DLGA 1B22A 2C2RA 3E2EA 5KT4A 4ED0A 3BDPA 4RQ0A 8ICLA 1NJWA 1ZJNA 4UD5A 4B9MA 4DQIA 3H4DA 4KLHA 5KG6A 4QWEA 1BPEA 9ICIA 4LZDA 4RNNA 4J9RA 5KG1A 2HHWA 4DL7A 5CWRA 3QZ7A 3TQ1A 3GDXA 5DLFA 4NKUA 1NOMA 4ECTA 5J0YA 2Y1IA 5HR9A 3ZDAA 1L3TA 4RQ1A 3PNCA 5EWEA 3ZDEA 3G6XA 3V7KA 4FS1A 2NRWA 4ED3A 3RH5A 4C8KA 1R89A 1L3VA 2P6RA 3GILA 3T5KA 1BPXA 3AQKA 3EWAA 5CJ7A 1DOQA 3Q8LA 1XC9A 1KDHA 4KN4A 5HHHA 2BCVA 3C2KA 1XSLA 2VA2A 4RQ2A 4IRCA 3ZD9A 1PX5A 3QZ8A 3M8SA 4M2YA 1MQ2A 4M47A 3NGDA 5KT3A 5J0QA 9ICNA 1JAJA 4FH5A 4DQQA 4EBEA 3SV3A 4RU9A 4E7XA 9ICVA 4DSKA 4G3IA 3FYHA 4IRDA 1DK3A 4ECUA 3PX6A 3WFOA 4ELTA 4KLIA 2XGPA 1TFWA 3V72A 4RT3A 2DFLA 5J2EA 1NK0A 1ZQAA 4FHVA 5DDYA 4C8OA 3OVBA 4FHXA 1ZQRA 3OJSA 4RUCA 7ICGA 1RXWA 4J9MA 2W9MA 4IQVA 4R64A 2XY5A 1S0OA 1ZQJA 2P66A 4I2IA 4DSJA 1ZQCA 4I2CA 4ATBB 2MAXA 4DFKA 4PH5A 4C8NA 1L3UA 5HRDA 1ZQHA 1Y88A 3HJ4A 3Q8RB 5KFUA 1HUZA 4KLEA 3AU2A 2F1IA 2UVRA 2HHVA 1ZQVA 1MSWD 5BOLA 5J0WA 3ISCA 4B9LA 3H39A 7ICTA 4DO9A 3RRHA 2XCPA 4Z6EA 4NLZA 4YFKA 1ZQGA 3H8JA 3OGUA 3RH4A 9ICHA 4WC6A 2ZUDA 2PFPA 2DRAA 4R66A 5EWGA 4KMUA 4TUPA 4RPXA 4QWDA 1TAQA 5J2BA 4DS4A 1NK6A 5J2IA 1TK8A 4IR1A 4X4RA 8ICYA 5DBCA 1NJXA 2BHNA 5DGAA 1PZNA 3SYZA 5DB7A 4B9VA 4X5VA 4LZGA 3M9MB 2IA6A 4O5KA 5D49A 4F4XA 4I2JA 3MFIA 3G6VA 2FLNA 2PBEA 4JV1A 3SZ2A 1ZQWA 4BWJA 1S0NA 5DG8A 1WOTA 3PVXA 3EPIA 2JEJA 3AQMA 3RJGA 4F50A 4UQGA 4MFFA 5KFWA 4MEXA 2ATLA 1ZQSA 2ZH6A 2ZH3A 1X9SA 9ICEA 1QSLA 2ZH4A 4X4NA 1TFYA 3GFKB 4F5NA 1SKSA 3KHHA 4F5QA 1U48A 2RDJA 1NK8A 4QZAA 4YD2A 4UB1A 2C2EA 1C7YA 4KLMA 3JPPA 3AQLA 4MFAA 4YVZA 2ZJ5A 2UVVA 4NM1A 4QWBA 4F4WA 4M9GA 3UPSA 5KFTA 1LV5A 1ZQBA 4M9LA 2VA8A 5DQGA 4XA5A 1BPZA 2FMPA 4UD4A 2R8JA 5J2GA 4TUQA 4B9SA 1ZQLA 9ICJA 5DDMA 3JPOA 3LWLA 2XY7A 3H37A 2IHMA 4IQUA 4YXMA 2KZ3A 3WFSC 2BQRA 2HVIA 4I2EA 4E8FA 5J2HA 4UBBA 4FS2A 4DLEA 3AUOA 2GWSA 2UVWA 1ZQTA 3HWTA 4ELUA 8ICUA 4FHYA 4EYIB 2B21A 3UQ0A 3TAQA 4KLOA 2MUTB 8ICEA 4YP3A 1RYRA 4X0AA 1NKCA 1NKEA 3MGIA 5IIJA 1ZQZA 3V6JA 2I9GA 1ZYQA 4M04A 4O5EA 4FHWA 1AROP 3GIIA 5DQIA 4YR3A 9ICBA 3L9DA 4DSIA 2KTQA 1DGSA 4F4ZA 4DOBA 4WBZA 4UAYA 8ICKA 1Q79A 4QZDA 1BGXT 3UXPA 3TFRA 4M9HA 3K4GA 5KG4A 2MUTA 2H5XA 1H38A 5BPCA 4DF8A 2Y1JA 4O3SA 2KN7A 3MR2A 4I2AA 4DLGA 4DS5A 5IIIA 3KHGA 4C8MA 1KLNA 3JPRA 4J9NA 4IQTA 2XCAA 4NLKA 4JWNA 7ICHA 4KITB 4F91B 2XGQA 5DG7A 3QE9Y 3LK9A 3RRGA 4KLTA 3BQTA 3MGHA 2ZUBA 2W9AA 4GLXA 2M2TA 4EP7A 4R65A 7ICPA 3JPQA 2AQ4A 8ICBA 2IBKA 5J0OA 1KTQA 2HHSA 4Z6DA 5HRIA 4QZGA 1ZQIA 4JWMA 4UBCA 4Z6FA 2ZH7A 3UPQA 3PW4A 8ICSA 1TVAA 4KLGA 3RAQA 4DF4A 1NO5A 4YN4A 2FLLA 3MR5A 4YQWA 3RJKA 4Q44A 3KTQA 1QLNA 1OU5A 8ICNA 1R8BA 4ECXA 2XY6A 3OSNA 7ICVA 1XWLA 3PO4A 1TAUA 4M5DA 2BE3A 3MABA 4KLFA 4B9UA 4FH3A 1S77D 3TANA 5KFZA 4I29A 1QSSA 4F5PA 4DSEA 3BQ1A 3RJFA 4X0BA 4X4QA 2M9NA 4RT2A 4DOAA 8ICGA 2NRZA 1ZQDA 5KFRA 4UB3A 2J6TA 3TI0A 4Q8FA 1JXEA 3PR4A 5KFIA 3T5HA 1ZQYA 5HRBA 2M2UA 5CB1A 4XUSA 1NK9A 5KG3A 9ICXA 4UB4A 1B43A 4XQ8A 8ICZA 4WC2A 2UVUA 1WCNA 1R8CA 1BPDA 2LYHA 5J0PA 4QWCA 2ASLA 1ZQUA 4I2HA 1NK4A 3C1ZA 7ICKA 4X4VA 1IM4A 4WC7A 4P4PA 3HP6A 4X4UA 5HRGA 2R8IA 5KT5A 7ICFA 3TARA 5KFDA 4Q8EA 2ZH2A 3GV7B 7ICMA 2NRKA 4XRHA 4WCWA 4RQ5A 3T3FA 3K75D 2J6UA 1JQRA 5DKWA 5BOMA 4RQ3A 5C5JA 5J2JA 4ECYA 5J0SA 5KT7A 4QZ8A 1S97A 2W8KA 4F8RA 4YXJA 5DEDA 1SZPA 5KFHA 4ECVA 3C18A 8ICIA 4F92B 5HRLA 2HHQA 5HRKA 5DB6A 1V4AA 1L5UA 4QW8A 5J0UA 2R8KA 9ICMA 4O3PA 2HW3A 3QEAZ 5KFJA 3MR3A 4ATBA 4TUSA 3PW7A 2RDIA 4ED8A 3H7IA 5J0XA 3GIJA 1FA0A 2PI4A 5HHIA 4MEYA 4DEZA 9ICQA 1IXRA 3PMLA 5IILA 4FHPA 3LDAA 2ZH8A 2A1JB 4RZRA 4P2HA 2BPCA 1D8YA 4E80A 1NJYA 2ZTDA 4YMNA 5F9NA 3Q8PB 4KTQA 1F5AA 3Q8SB 3HT3A 4ECQA 1KNYA 1T8EA 2HHPA 4EBKA 1JX4A 4QZHA 1XSPA 4JK1A 5KT6A 4FBUA 4JV0A 4DFJA 4M9JA 4BGDA 1X9MA 5KFPA 3RB6A 2F1HA 4YMMA 3C66A 2OWOA 2A1JA 3B0YA 4O0IA 4EZ9A 9ICSA 3JYYA 5KFOA 5HC9A 2AGQA 2ZH5A 3V7JA 3ISBA 2P6UA 3GIKA 4JUZA 4J9LA 2FPMA 4ED1A 4K4IA 1MC8A 5DG9A 2W9CB 1UT8A 4EEYA 1XS9D 4FBTA 4F4YA 4KLDA 2ZUCA 4KLLA 1YLQA 5TZVA 2ALZA 1Q78A 2FMQA 3GQCA 1Z00B 1T7PA 4NKTA 3QEBZ 3MR6A 4DOCA 2FMSA 4I2GA 4F2SA 4TURA 3G6YA 2ZTCA 4DL4A 4I2BA 8ICVA 2W9CA 5J29A 1VFGA 3EZ5A 2VA3A 4QZBA 2KZZA 1BNOA 4P4OA 1XSNA 1Z00A 4IQWA 3C1YA 2WTFA 3V6KA 3RBEA 2DR9A 1S10A 2HHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZF A;  1X9W A;  1KFS A;  3ZDB A;  5D4B A;  5KFA A;  4KLS A;  3M9N B;  8ICM A;  1T3N A;  1KFT A;  1SL1 A;  4QW9 A;  4IR9 A;  3JPS A;  4WBY A;  4X4T A;  1V9P A;  3ORY A;  3C23 A;  2DPJ A;  4AT8 B;  3PO5 A;  1U47 A;  2I1Q A;  4R63 A;  7ICE A;  9ICF A;  4KLJ A;  7ICR A;  1UA1 A;  2ZJA A;  4RUA A;  1KRP A;  2KFZ A;  5KG5 A;  2PFO A;  1ZET A;  5J0R A;  4AT9 B;  1BPB A;  8ICA A;  9ICL A;  2O5A A;  3PX0 A;  3NYB A;  4XQ7 A;  2AQ0 A;  4RWN A;  2BPG A;  5KFK A;  8ICT A;  4RQ4 A;  2RFF A;  2J6S A;  3H40 A;  4DFP A;  1RPL A;  7ICI A;  2M2W A;  4AT8 A;  2O1P A;  4DSL A;  4YG2 A;  5CA7 A;  2V4R A;  4K4H A;  1A77 A;  3OVA A;  1NJZ A;  4WC4 A;  3T5J A;  3M9O B;  3AU6 A;  7ICN A;  1CUK A;  4NXZ A;  4YMO A;  4FO6 A;  1D9D A;  4R8U B;  4IRK A;  1UT5 A;  3MDC A;  3RJI A;  3SI8 A;  3RJE A;  3IHQ B;  4NLN A;  2JZB B;  9ICR A;  1SKR A;  3OJU A;  2NRV A;  1D9F A;  2ASJ A;  1X2I A;  3GV8 B;  3C5F A;  4EZ6 A;  3RBD A;  4UB2 A;  1ZQF A;  3T5L A;  4F2R A;  3LQC B;  2XC9 A;  4J9P A;  2IMW P;  5DEC A;  3HPO A;  3C2L A;  2Q0Z X;  5L1L A;  3RAX A;  4UAZ A;  1TFR A;  4RPY A;  4R8U A;  1JN3 A;  1DK2 A;  1Z3E B;  2M2V A;  2JZB A;  2C22 A;  4X4O A;  3H38 A;  4PHA A;  1ZQX A;  1ZQN A;  5J2F A;  4PGX A;  3IM1 A;  4EBJ A;  3HW8 A;  3V7L A;  3OSP A;  5KFC A;  3OHA A;  4UAW A;  1TK5 A;  4M0A A;  3OHB A;  3AQN A;  4E0D A;  3V6H A;  4UB5 A;  4O5C A;  4YR2 A;  4RQ7 A;  2BPF A;  2AJQ A;  3UQ2 A;  4J9O A;  3MBY A;  2C28 A;  4J9S A;  1LB2 B;  1HUO A;  1S76 D;  5CR0 A;  5IIN A;  3HIY A;  2R8G A;  1CEZ A;  4O3Q A;  3H8W A;  9ICT A;  3RH6 A;  2IHN A;  1K1Q A;  4RQ8 A;  4PHE A;  3OVS A;  2NRT A;  4KLQ A;  8ICO A;  5KFN A;  4MF8 A;  1ZQQ A;  4BXO B;  4J9K A;  5J0T A;  4ED2 A;  2ZHA A;  1MIY A;  2ZH1 A;  4K4G A;  1JIH A;  9ICP A;  5KFQ A;  5DBB A;  4YR0 A;  5L1K A;  1ZJM A;  3N4M B;  4QWA A;  2BGW A;  1BPY A;  1ZQM A;  8ICX A;  3ZDD A;  2ZHB A;  4P4M A;  2ZH9 A;  4DQS A;  3RB0 A;  1D8L A;  4RQ6 A;  4C8L A;  3ISD A;  1ZQE A;  4BWM A;  5L1J A;  5L1I A;  5F2V O;  1COO A;  2JEI A;  5EWF A;  4B9T A;  4BXO A;  2AGP A;  4DL2 A;  4NLG A;  3RR8 A;  1NK7 A;  1UEV A;  3OV7 A;  3UXN A;  4PGY A;  3RTV A;  8ICW A;  4PHP A;  9ICO A;  1HJP A;  4KN7 A;  3RJJ A;  8ICF A;  3MDA A;  5HMM A;  3MFH A;  1QSY A;  1R8A A;  2ZTE A;  4RNM A;  1BVS A;  4I2F A;  1TKD A;  2FPK A;  9ICK A;  2AGO A;  4Z6C A;  3TFS A;  4ECR A;  4CCH A;  9ICW A;  5KFV A;  1EXN A;  2BQU A;  3BQ2 A;  2NRX A;  4F4K A;  1MQ3 A;  1S0V A;  1SL0 A;  4WC3 A;  1BNP A;  1ZQK A;  5KTQ A;  9ICA A;  1TV9 A;  1TK0 A;  3TAP A;  3Q8Q B;  2ZJ8 A;  3N97 B;  4F5O A;  5KG0 A;  5IIM A;  2F1J A;  4S3N A;  2VAN A;  1KEJ A;  3M8R A;  1S9F A;  3GV5 B;  1SL2 A;  4F3O A;  3ETL A;  1UET A;  5KFF A;  4F5R A;  5HP4 A;  2JEG A;  3H8S A;  5KFY A;  4O9M A;  2W9B B;  3BQ0 A;  4DL5 A;  5KFG A;  4QZC A;  4RNO A;  4PGQ A;  4O3N A;  2BDP A;  3KHL A;  3WFR E;  2ASD A;  4ZH4 A;  5HML A;  5J2C A;  1QTM A;  4IG8 A;  4PHD A;  2JEF A;  5KG2 A;  3Q8M A;  1NZP A;  4RWP A;  1MIV A;  3UXO A;  3PW2 A;  4WC1 A;  4MF2 A;  2BCQ A;  7ICU A;  5HRH A;  2KZM A;  3RB4 A;  4JV2 A;  2R8H A;  3KHR A;  3PW5 A;  1JMS A;  8ICJ A;  9ICU A;  2W9B A;  3PX4 A;  4MFC A;  4QZE A;  2ISO A;  3PR5 B;  4YCX A;  4KLU A;  4X4S A;  1U9L A;  4M6W B;  4O3O A;  7ICS A;  5KFB A;  2W8L A;  4ELV A;  4EYH B;  4GXJ A;  1N56 A;  3HJ1 A;  4GXK A;  2BCR A;  3OUY B;  5IIO A;  4GC6 A;  1T4G A;  4DL6 A;  1RZT A;  3JPN A;  3HX0 A;  3RR7 A;  3EPG A;  4RPZ A;  4HYK A;  4AT7 B;  1VJ7 A;  2DR7 A;  5DBA A;  3BJY A;  3RB3 A;  4J9Q A;  1SKW A;  2DPI A;  3Q8K A;  4M6W A;  4X4P A;  8ICR A;  4RWO A;  1S0M A;  2FLP A;  2PI5 A;  4I28 A;  5DQH A;  2XO7 A;  1XO1 A;  3THV A;  2ISP A;  2PFQ A;  4RWQ A;  3B0X A;  2ID1 A;  3OUY A;  4NM2 A;  3NTU A;  5F9L A;  2DR5 A;  4ED6 A;  7ICO A;  4AT7 A;  5J2D A;  4YD1 A;  4PPX A;  4WC0 A;  2V9W A;  4DSF A;  4I2D A;  3PMN A;  8ICH A;  3C5G A;  2AU0 A;  2DVI A;  3LWM A;  4ED7 A;  2KP7 A;  9ICG A;  4Q45 A;  5KT2 A;  4DQR A;  4NY8 A;  1UEU A;  5EOZ A;  5DGB A;  2PFN A;  1KFD A;  2V4Q A;  4GC7 A;  1NKB A;  2BCU A;  4TQR A;  1RYS A;  7ICL A;  3JZ0 A;  2DR8 A;  3EYZ A;  2Q66 A;  4LT6 A;  5KG7 A;  5HRE A;  5DB9 A;  4EBC A;  4DFM A;  3WFQ E;  4O3R A;  5CHG A;  4AT9 A;  3JPT A;  4DQP A;  8ICC A;  3FDS A;  4EBD A;  4ECS A;  4WC5 A;  1ZQO A;  8ICP A;  5JUM A;  5KFL A;  5KFE A;  1JXL A;  1N48 A;  4B9N A;  5L9X A;  1XU4 A;  4TQS A;  1ZQP A;  1WCL A;  5CP2 A;  4QZ9 A;  3SV4 A;  2C2D A;  3EW9 A;  2BQ3 A;  1UA0 A;  4Q43 A;  2BCS A;  5D46 A;  3WFP A;  4I27 A;  1U49 A;  7ICJ A;  5J2K A;  5DB8 A;  5J2A A;  3ZD8 A;  4QZI A;  2PXI A;  4M9N A;  3C21 A;  1A76 A;  5IIK A;  5KFX A;  3PY8 A;  1U4B A;  1KSP A;  2HVH A;  3H3A A;  3H4B A;  4DL3 A;  2BKE A;  5KFM A;  3GIM A;  2KFN A;  4DWI A;  4F93 B;  2HHX A;  4BDP A;  2HHU A;  7ICQ A;  2DRB A;  8ICQ A;  3PV8 A;  5HRF A;  3C2M A;  1NK5 A;  1RXV A;  4ECW A;  5HNK A;  1U45 A;  3RJH A;  1K1S A;  2FPL A;  1MIW A;  5KFS A;  3PW0 A;  2BR0 A;  1L3S A;  4LVS A;  3ZDC A;  9ICC A;  4GXI A;  4ECZ A;  5DLG A;  1B22 A;  2C2R A;  3E2E A;  5KT4 A;  4ED0 A;  3BDP A;  4RQ0 A;  8ICL A;  1NJW A;  1ZJN A;  4UD5 A;  4B9M A;  4DQI A;  3H4D A;  4KLH A;  5KG6 A;  4QWE A;  1BPE A;  9ICI A;  4LZD A;  4RNN A;  4J9R A;  5KG1 A;  2HHW A;  4DL7 A;  5CWR A;  3QZ7 A;  3TQ1 A;  3GDX A;  5DLF A;  4NKU A;  1NOM A;  4ECT A;  5J0Y A;  2Y1I A;  5HR9 A;  3ZDA A;  1L3T A;  4RQ1 A;  3PNC A;  5EWE A;  3ZDE A;  3G6X A;  3V7K A;  4FS1 A;  2NRW A;  4ED3 A;  3RH5 A;  4C8K A;  1R89 A;  1L3V A;  2P6R A;  3GIL A;  3T5K A;  1BPX A;  3AQK A;  3EWA A;  5CJ7 A;  1DOQ A;  3Q8L A;  1XC9 A;  1KDH A;  4KN4 A;  5HHH A;  2BCV A;  3C2K A;  1XSL A;  2VA2 A;  4RQ2 A;  4IRC A;  3ZD9 A;  1PX5 A;  3QZ8 A;  3M8S A;  4M2Y A;  1MQ2 A;  4M47 A;  3NGD A;  5KT3 A;  5J0Q A;  9ICN A;  1JAJ A;  4FH5 A;  4DQQ A;  4EBE A;  3SV3 A;  4RU9 A;  4E7X A;  9ICV A;  4DSK A;  4G3I A;  3FYH A;  4IRD A;  1DK3 A;  4ECU A;  3PX6 A;  3WFO A;  4ELT A;  4KLI A;  2XGP A;  1TFW A;  3V72 A;  4RT3 A;  2DFL A;  5J2E A;  1NK0 A;  1ZQA A;  4FHV A;  5DDY A;  4C8O A;  3OVB A;  4FHX A;  1ZQR A;  3OJS A;  4RUC A;  7ICG A;  1RXW A;  4J9M A;  2W9M A;  4IQV A;  4R64 A;  2XY5 A;  1S0O A;  1ZQJ A;  2P66 A;  4I2I A;  4DSJ A;  1ZQC A;  4I2C A;  4ATB B;  2MAX A;  4DFK A;  4PH5 A;  4C8N A;  1L3U A;  5HRD A;  1ZQH A;  1Y88 A;  3HJ4 A;  3Q8R B;  5KFU A;  1HUZ A;  4KLE A;  3AU2 A;  2F1I A;  2UVR A;  2HHV A;  1ZQV A;  1MSW D;  5BOL A;  5J0W A;  3ISC A;  4B9L A;  3H39 A;  7ICT A;  4DO9 A;  3RRH A;  2XCP A;  4Z6E A;  4NLZ A;  4YFK A;  1ZQG A;  3H8J A;  3OGU A;  3RH4 A;  9ICH A;  4WC6 A;  2ZUD A;  2PFP A;  2DRA A;  4R66 A;  5EWG A;  4KMU A;  4TUP A;  4RPX A;  4QWD A;  1TAQ A;  5J2B A;  4DS4 A;  1NK6 A;  5J2I A;  1TK8 A;  4IR1 A;  4X4R A;  8ICY A;  5DBC A;  1NJX A;  2BHN A;  5DGA A;  1PZN A;  3SYZ A;  5DB7 A;  4B9V A;  4X5V A;  4LZG A;  3M9M B;  2IA6 A;  4O5K A;  5D49 A;  4F4X A;  4I2J A;  3MFI A;  3G6V A;  2FLN A;  2PBE A;  4JV1 A;  3SZ2 A;  1ZQW A;  4BWJ A;  1S0N A;  5DG8 A;  1WOT A;  3PVX A;  3EPI A;  2JEJ A;  3AQM A;  3RJG A;  4F50 A;  4UQG A;  4MFF A;  5KFW A;  4MEX A;  2ATL A;  1ZQS A;  2ZH6 A;  2ZH3 A;  1X9S A;  9ICE A;  1QSL A;  2ZH4 A;  4X4N A;  1TFY A;  3GFK B;  4F5N A;  1SKS A;  3KHH A;  4F5Q A;  1U48 A;  2RDJ A;  1NK8 A;  4QZA A;  4YD2 A;  4UB1 A;  2C2E A;  1C7Y A;  4KLM A;  3JPP A;  3AQL A;  4MFA A;  4YVZ A;  2ZJ5 A;  2UVV A;  4NM1 A;  4QWB A;  4F4W A;  4M9G A;  3UPS A;  5KFT A;  1LV5 A;  1ZQB A;  4M9L A;  2VA8 A;  5DQG A;  4XA5 A;  1BPZ A;  2FMP A;  4UD4 A;  2R8J A;  5J2G A;  4TUQ A;  4B9S A;  1ZQL A;  9ICJ A;  5DDM A;  3JPO A;  3LWL A;  2XY7 A;  3H37 A;  2IHM A;  4IQU A;  4YXM A;  2KZ3 A;  3WFS C;  2BQR A;  2HVI A;  4I2E A;  4E8F A;  5J2H A;  4UBB A;  4FS2 A;  4DLE A;  3AUO A;  2GWS A;  2UVW A;  1ZQT A;  3HWT A;  4ELU A;  8ICU A;  4FHY A;  4EYI B;  2B21 A;  3UQ0 A;  3TAQ A;  4KLO A;  2MUT B;  8ICE A;  4YP3 A;  1RYR A;  4X0A A;  1NKC A;  1NKE A;  3MGI A;  5IIJ A;  1ZQZ A;  3V6J A;  2I9G A;  1ZYQ A;  4M04 A;  4O5E A;  4FHW A;  1ARO P;  3GII A;  5DQI A;  4YR3 A;  9ICB A;  3L9D A;  4DSI A;  2KTQ A;  1DGS A;  4F4Z A;  4DOB A;  4WBZ A;  4UAY A;  8ICK A;  1Q79 A;  4QZD A;  1BGX T;  3UXP A;  3TFR A;  4M9H A;  3K4G A;  5KG4 A;  2MUT A;  2H5X A;  1H38 A;  5BPC A;  4DF8 A;  2Y1J A;  4O3S A;  2KN7 A;  3MR2 A;  4I2A A;  4DLG A;  4DS5 A;  5III A;  3KHG A;  4C8M A;  1KLN A;  3JPR A;  4J9N A;  4IQT A;  2XCA A;  4NLK A;  4JWN A;  7ICH A;  4KIT B;  4F91 B;  2XGQ A;  5DG7 A;  3QE9 Y;  3LK9 A;  3RRG A;  4KLT A;  3BQT A;  3MGH A;  2ZUB A;  2W9A A;  4GLX A;  2M2T A;  4EP7 A;  4R65 A;  7ICP A;  3JPQ A;  2AQ4 A;  8ICB A;  2IBK A;  5J0O A;  1KTQ A;  2HHS A;  4Z6D A;  5HRI A;  4QZG A;  1ZQI A;  4JWM A;  4UBC A;  4Z6F A;  2ZH7 A;  3UPQ A;  3PW4 A;  8ICS A;  1TVA A;  4KLG A;  3RAQ A;  4DF4 A;  1NO5 A;  4YN4 A;  2FLL A;  3MR5 A;  4YQW A;  3RJK A;  4Q44 A;  3KTQ A;  1QLN A;  1OU5 A;  8ICN A;  1R8B A;  4ECX A;  2XY6 A;  3OSN A;  7ICV A;  1XWL A;  3PO4 A;  1TAU A;  4M5D A;  2BE3 A;  3MAB A;  4KLF A;  4B9U A;  4FH3 A;  1S77 D;  3TAN A;  5KFZ A;  4I29 A;  1QSS A;  4F5P A;  4DSE A;  3BQ1 A;  3RJF A;  4X0B A;  4X4Q A;  2M9N A;  4RT2 A;  4DOA A;  8ICG A;  2NRZ A;  1ZQD A;  5KFR A;  4UB3 A;  2J6T A;  3TI0 A;  4Q8F A;  1JXE A;  3PR4 A;  5KFI A;  3T5H A;  1ZQY A;  5HRB A;  2M2U A;  5CB1 A;  4XUS A;  1NK9 A;  5KG3 A;  9ICX A;  4UB4 A;  1B43 A;  4XQ8 A;  8ICZ A;  4WC2 A;  2UVU A;  1WCN A;  1R8C A;  1BPD A;  2LYH A;  5J0P A;  4QWC A;  2ASL A;  1ZQU A;  4I2H A;  1NK4 A;  3C1Z A;  7ICK A;  4X4V A;  1IM4 A;  4WC7 A;  4P4P A;  3HP6 A;  4X4U A;  5HRG A;  2R8I A;  5KT5 A;  7ICF A;  3TAR A;  5KFD A;  4Q8E A;  2ZH2 A;  3GV7 B;  7ICM A;  2NRK A;  4XRH A;  4WCW A;  4RQ5 A;  3T3F A;  3K75 D;  2J6U A;  1JQR A;  5DKW A;  5BOM A;  4RQ3 A;  5C5J A;  5J2J A;  4ECY A;  5J0S A;  5KT7 A;  4QZ8 A;  1S97 A;  2W8K A;  4F8R A;  4YXJ A;  5DED A;  1SZP A;  5KFH A;  4ECV A;  3C18 A;  8ICI A;  4F92 B;  5HRL A;  2HHQ A;  5HRK A;  5DB6 A;  1V4A A;  1L5U A;  4QW8 A;  5J0U A;  2R8K A;  9ICM A;  4O3P A;  2HW3 A;  3QEA Z;  5KFJ A;  3MR3 A;  4ATB A;  4TUS A;  3PW7 A;  2RDI A;  4ED8 A;  3H7I A;  5J0X A;  3GIJ A;  1FA0 A;  2PI4 A;  5HHI A;  4MEY A;  4DEZ A;  9ICQ A;  1IXR A;  3PML A;  5IIL A;  4FHP A;  3LDA A;  2ZH8 A;  2A1J B;  4RZR A;  4P2H A;  2BPC A;  1D8Y A;  4E80 A;  1NJY A;  2ZTD A;  4YMN A;  5F9N A;  3Q8P B;  4KTQ A;  1F5A A;  3Q8S B;  3HT3 A;  4ECQ A;  1KNY A;  1T8E A;  2HHP A;  4EBK A;  1JX4 A;  4QZH A;  1XSP A;  4JK1 A;  5KT6 A;  4FBU A;  4JV0 A;  4DFJ A;  4M9J A;  4BGD A;  1X9M A;  5KFP A;  3RB6 A;  2F1H A;  4YMM A;  3C66 A;  2OWO A;  2A1J A;  3B0Y A;  4O0I A;  4EZ9 A;  9ICS A;  3JYY A;  5KFO A;  5HC9 A;  2AGQ A;  2ZH5 A;  3V7J A;  3ISB A;  2P6U A;  3GIK A;  4JUZ A;  4J9L A;  2FPM A;  4ED1 A;  4K4I A;  1MC8 A;  5DG9 A;  2W9C B;  1UT8 A;  4EEY A;  1XS9 D;  4FBT A;  4F4Y A;  4KLD A;  2ZUC A;  4KLL A;  1YLQ A;  5TZV A;  2ALZ A;  1Q78 A;  2FMQ A;  3GQC A;  1Z00 B;  1T7P A;  4NKT A;  3QEB Z;  3MR6 A;  4DOC A;  2FMS A;  4I2G A;  4F2S A;  4TUR A;  3G6Y A;  2ZTC A;  4DL4 A;  4I2B A;  8ICV A;  2W9C A;  5J29 A;  1VFG A;  3EZ5 A;  2VA3 A;  4QZB A;  2KZZ A;  1BNO A;  4P4O A;  1XSN A;  1Z00 A;  4IQW A;  3C1Y A;  2WTF A;  3V6K A;  3RBE A;  2DR9 A;  1S10 A;  2HHT A; 
#chains in the Genus database with same CATH topology
 4QZF A;  1X9W A;  4CRX A;  4KLS A;  4IR9 A;  3JPS A;  2R18 A;  3PO5 A;  1PVP A;  1RG6 A;  4K99 A;  3F2D A;  2ZJA A;  1KRP A;  2PFO A;  8ICA A;  4RWN A;  3M6K A;  4FO1 A;  7ICI A;  4YG2 A;  2V4R A;  5ALN A;  4K96 A;  4NLN A;  3RJI A;  3SI8 A;  4WC7 A;  3IHQ B;  2NRV A;  1X2I A;  2D8C A;  5ALL A;  4EZ6 A;  4F2R A;  1ZQF A;  4K8V A;  3T5L A;  3HPO A;  2H3F A;  1TFR A;  4RPY A;  1JN3 A;  2C22 A;  4LEY A;  4US8 A;  3H38 A;  3F2B A;  3IM1 A;  2WB1 F;  1ED1 A;  1YT3 A;  5KFC A;  3AQN A;  3V6H A;  4ZOH C;  4YR2 A;  1S76 D;  4KB6 A;  5IIN A;  1C20 A;  3RH6 A;  1Z1V A;  3NRZ A;  4J9K A;  5J0T A;  4OAG A;  2BGW A;  1RYU A;  8ICX A;  1ZQM A;  4O69 A;  2ZH9 A;  3RB0 A;  4RQ6 A;  3ISD A;  5L1J A;  1SB3 C;  2XVT A;  5EWF A;  4B9T A;  2AGP A;  5AHX A;  1NK7 A;  3RJJ A;  8ICF A;  1QSY A;  1TKD A;  2FPK A;  3TFS A;  4ECR A;  1EXN A;  3PHZ A;  1BNP A;  1FIQ A;  3BZK A;  4F5O A;  2MRL A;  3KBB A;  4U7C A;  4S3N A;  2VAN A;  1SL2 A;  1S9F A;  1UET A;  3H8S A;  5KFY A;  3LVV A;  2W9B B;  4DL5 A;  5KFG A;  4IG8 A;  4UAR A;  5AI0 A;  4PHD A;  1NZP A;  4JLZ A;  4WC1 A;  4CF5 A;  1FFU A;  3RB4 A;  2R8H A;  4HAI A;  2W9B A;  1Q3U A;  2HOF A;  4MFC A;  4QZE A;  1COK A;  2ISO A;  5ALY A;  1IIP A;  3A0H U;  2LHT A;  5ALS A;  3I76 A;  1U9L A;  4O3M A;  1SV0 A;  4F71 A;  1N56 A;  3KKA C;  4GXK A;  3OUY B;  3JPN A;  3RR7 A;  4KMO B;  1KKX A;  2RLT A;  1JUD A;  2K8B B;  3BJY A;  1VDV A;  2DPI A;  2B4V A;  3Q8K A;  8ICR A;  4RWO A;  1S0M A;  4I28 A;  3TAC B;  1VJ5 A;  4RWQ A;  5H2F U;  3B0X A;  3OUY A;  3KZI U;  4DSF A;  1AQ6 A;  3AM9 A;  2Y0S C;  3LWM A;  9ICG A;  3QUB A;  1SXE A;  5EOZ A;  1B0X A;  1J2M A;  1L8O A;  2BCU A;  1NKB A;  2XID A;  5F3X B;  3WKD A;  2DGZ A;  2Q66 A;  5KG7 A;  1SWV A;  4DQP A;  5JUM A;  1JXL A;  5L9X A;  2JV3 A;  1WCL A;  5CP2 A;  3SV4 A;  2KV2 A;  5D46 A;  4I27 A;  2Q4T A;  2PXI A;  1U4B A;  4DL3 A;  5AKE A;  2KFN A;  2HHX A;  2HHU A;  3N28 A;  3QU2 A;  3PV8 A;  1RXV A;  2YMP A;  5HNK A;  2DF4 B;  2K4I A;  3ZDC A;  2ES6 A;  2C2R A;  2ZIU B;  3NVY A;  2JH7 A;  4RQ0 A;  3JCF A;  3H4D A;  1BPE A;  2KJ9 A;  4LZD A;  4J9R A;  5CWR A;  5DLF A;  3QX7 A;  1PX5 A;  5EWE A;  3ZDE A;  1R89 A;  4C8K A;  1QQ6 A;  3RH5 A;  4ED3 A;  4PZN A;  1L3V A;  1BPX A;  3AQK A;  3EWA A;  1KDH A;  9ICS A;  5HRF A;  1XSL A;  3ZD9 A;  3QZ8 A;  2G09 A;  1JAJ A;  2E8M A;  2EAM A;  3M6Z A;  2OM6 A;  2DFL A;  5J2E A;  5CFU A;  2LM1 A;  7ICG A;  1L7M A;  4J9M A;  4ATB B;  4ICA A;  1L3U A;  1ZQH A;  4KLE A;  3QNM A;  1MSW D;  5J0W A;  3H39 A;  2ZXH A;  3R9K A;  2F8K A;  5AM0 A;  2XCP A;  2KKV A;  9ICH A;  2YB1 A;  1NK6 A;  4X4R A;  5J2I A;  2I5H A;  2JR5 A;  1PZN A;  2IA6 A;  4I2J A;  4OD0 A;  4FFD A;  1WOT A;  5D61 A;  2K8A A;  1RQN A;  2B6G A;  1N5W A;  5KFW A;  2ZH6 A;  1ZD2 P;  3NWI A;  1QSL A;  1TFY A;  3WKB A;  3GFK B;  4F5Q A;  2RDJ A;  4KLM A;  3JPP A;  4MFA A;  4NM1 A;  4QWB A;  1KQQ A;  4M9G A;  1LV5 A;  4NXU A;  1V97 A;  4UD4 A;  2WF6 A;  5ALX A;  5CFT A;  4TUQ A;  2WF7 A;  3SEI A;  3H37 A;  2L5Y A;  2EWR A;  3WFS C;  4CF4 A;  4I2E A;  1A6S A;  3A0B U;  3WK4 A;  5JU5 A;  1Q8K A;  4ELU A;  4EYI B;  4KLO A;  4EEK A;  1RYR A;  1NKE A;  3MGI A;  2I9G A;  1ZQZ A;  4O5E A;  3HIL A;  1ARO P;  3SQI A;  2BZF A;  4OAF A;  4DOB A;  3K4G A;  3PSF A;  5III A;  1CI4 A;  4C8M A;  4IQT A;  2XCA A;  2E1E A;  4KLT A;  1IG6 A;  3RRG A;  3BQT A;  2W9A A;  2KE7 A;  2EQY A;  5ALE A;  7ICP A;  1D8B A;  2F44 A;  4Z6F A;  2ZH7 A;  3UPQ A;  3PW4 A;  4EEL A;  1RQL A;  4AYB C;  4F72 A;  2FLL A;  3RJK A;  4ECX A;  2XY6 A;  3CNH A;  2RQ5 A;  7ICV A;  1XWL A;  4PJ0 U;  4M5D A;  2G06 A;  1ZXI A;  5AM5 A;  1QH9 A;  3QYP A;  3TAN A;  2ZIV B;  1S77 D;  1QSS A;  3BQ1 A;  2ESE A;  3RJF A;  2M9N A;  8ICG A;  5KFR A;  3TI0 A;  1JXE A;  1URJ A;  2M0N A;  4NJ8 A;  1ZQY A;  2M2U A;  5CB1 A;  3NVO A;  4UB4 A;  4XQ8 A;  8ICZ A;  2ZIV A;  2LYH A;  4X4U A;  2R8I A;  7ICF A;  2KK0 A;  5KFD A;  3GV7 B;  3TAD C;  4RQ5 A;  3T3F A;  2J6U A;  4OAI Z;  5KFH A;  3ICX A;  4O68 A;  4F92 B;  5HRK A;  5DB6 A;  5HR7 A;  4ED8 A;  1SWW A;  3H7I A;  3LDA A;  2NV3 A;  4P2H A;  4E80 A;  3Q8P B;  2HBL A;  1SXD A;  3I28 A;  4ECQ A;  3TKA A;  2HHP A;  1ZD4 A;  1XSP A;  4FBU A;  4EEN A;  4JV0 A;  2BDU A;  4EED A;  1L7N A;  3C66 A;  4OJL A;  4O0I A;  3C28 A;  4WQL A;  2W04 A;  2ZIX B;  4FBT A;  5C0Y A;  2K4H A;  2KIW A;  5G5H A;  4ACO A;  4C4T A;  4Y2R A;  4NKT A;  4DOC A;  4KM5 A;  3ER8 C;  2ZIX A;  3J81 j;  2ZTC A;  2QB1 A;  4QZB A;  1BNO A;  2WTF A;  3ZDB A;  2KHV A;  5KFA A;  3CP8 A;  3KZX A;  1KFT A;  3H0R B;  1SL1 A;  1XNS A;  1U47 A;  7ICE A;  9ICF A;  2YY6 A;  1UA1 A;  2KFZ A;  4Y2U A;  1ZET A;  2W54 A;  5J0R A;  1BPB A;  4AT9 B;  1JAL A;  5ALO A;  1WYG A;  4DFP A;  1RPL A;  2M2W A;  3EF2 A;  4DSL A;  3OVA A;  4NWI A;  1NJZ A;  4WC4 A;  3T5J A;  3AU6 A;  4C4R A;  3NVZ A;  4YMO A;  5J8Y A;  4FO6 A;  1D9D A;  5ALM A;  3MDC A;  2FDR A;  4EEB A;  4KX3 A;  1SKR A;  1D9F A;  2ASJ A;  4FZL A;  3LQC B;  4PZO A;  5DEC A;  3SMV A;  1DK2 A;  4Y2J A;  2M2V A;  2PMZ F;  4EBJ A;  3OSP A;  3V7L A;  3OHA A;  4UAW A;  4E0D A;  4UB5 A;  2NYV A;  3MBY A;  4J9S A;  5CR0 A;  3GZF A;  2R8G A;  3D2S A;  5AI5 A;  3H8W A;  2IHN A;  4KLQ A;  5KFN A;  1MIY A;  2ZH1 A;  1VLB A;  1ZJM A;  4QWA A;  2ZHB A;  3WK5 A;  4P4M A;  1S5L U;  2JMG A;  1ZQE A;  5L1I A;  1SGG A;  4OJO A;  3UXN A;  1WUD A;  1F44 A;  4PHP A;  9ICO A;  4KN7 A;  1ZOL A;  1SV4 A;  2YMM A;  9ICK A;  2D6F C;  2AGO A;  5ALZ A;  4NLB A;  3SAG A;  3BQ2 A;  4F4K A;  1MQ3 A;  3D2N A;  1S0V A;  3S6J A;  1TV9 A;  3TAP A;  3Q8Q B;  2F1J A;  1KEJ A;  3IDW A;  3QXG A;  3GV5 B;  3ETL A;  4F5R A;  5HP4 A;  2JEG A;  5B3Q A;  1X40 A;  4PGQ A;  4O3N A;  2ASD A;  1QTM A;  4PL1 A;  2KIV A;  3Q8M A;  4MF2 A;  5HRH A;  2KZM A;  5FP0 A;  4JV2 A;  3NAS A;  3KHR A;  8ICJ A;  9ICU A;  4NL9 A;  2GH1 A;  2CN1 A;  4X4S A;  1RDF A;  4BJQ A;  4O3O A;  2W8L A;  1DGJ A;  1V38 A;  4GXJ A;  2NO5 A;  4GC6 A;  3UMC A;  1VJ7 A;  2K4P A;  5DBA A;  1SKW A;  2FLP A;  3MC1 A;  2XO7 A;  5ALQ A;  2NO4 A;  1QQ5 A;  1Z1B A;  4ED6 A;  7ICO A;  2VJ4 A;  3WKA A;  4PPX A;  1HIW A;  4I2D A;  3SAH A;  2WAQ C;  3C5G A;  2DVI A;  1X6I A;  4DQR A;  1O08 A;  5DGB A;  2V4Q A;  4GC7 A;  4TQR A;  3JZ0 A;  3EYZ A;  3VC8 A;  5HRE A;  5ALG A;  5DB9 A;  4EBC A;  4Y2T A;  5CHG A;  5JTI A;  3FDS A;  1ZQO A;  4B9N A;  1N48 A;  4TQS A;  4QZ9 A;  4Q43 A;  3NRW A;  4C80 A;  4EV6 A;  7ICJ A;  1ECW A;  4QZI A;  4RQN A;  4WH5 A;  3QU9 A;  1A76 A;  5IIK A;  3PY8 A;  1KSP A;  3H4B A;  2BKE A;  5KFM A;  3GIM A;  3SR6 A;  2DRB A;  2FPL A;  4LVS A;  4WJ3 B;  4GXI A;  5DLG A;  5CHE A;  3E2E A;  5KT4 A;  4ED0 A;  8ICL A;  1NJW A;  2HOI A;  4DQI A;  1ZD5 A;  4RNN A;  5KG1 A;  3GDX A;  4NKU A;  2ZG6 A;  3ZI4 A;  4ECT A;  5J0Y A;  5HR9 A;  3L3F X;  4RQ1 A;  1GPJ A;  3G6X A;  3T5K A;  3Q8L A;  1L7P A;  5HHH A;  1MQ2 A;  4FH5 A;  3NGD A;  3SV3 A;  3OPX A;  4RU9 A;  1K5O A;  3UMG A;  4G3I A;  2B51 A;  3UM9 A;  2E3T A;  4IRD A;  4UAV A;  4ELT A;  4KLI A;  1X42 A;  1T94 A;  1NK0 A;  1ZQA A;  5DDY A;  4C8O A;  3OVB A;  4FHX A;  1ZQR A;  5CFS A;  1RXW A;  2OCE A;  2W11 A;  2W9M A;  2XY5 A;  1ZQJ A;  2P66 A;  1ZQC A;  3FC4 A;  4NXX A;  2I6X A;  4DCC A;  1TAM A;  3AU2 A;  2F1I A;  4K97 A;  4A8E A;  3ISC A;  4B9L A;  2HBM A;  3BS5 B;  3E0F A;  4NLZ A;  3RH4 A;  4R66 A;  4TUP A;  4QWD A;  4OAH A;  4DS4 A;  2YMQ A;  2QB0 B;  5DBC A;  2BHN A;  3SYZ A;  3M9M B;  3MFI A;  3BS5 A;  2W7O A;  5KAF U;  4BWJ A;  1S0N A;  3WK9 A;  2JEJ A;  5ALI A;  2DWQ A;  3RJG A;  2KIC A;  4F50 A;  4UQG A;  1ZQS A;  2QB0 A;  2ATL A;  5AK5 A;  2G5H B;  4OCZ A;  1NK8 A;  2UVV A;  4YVZ A;  3IN5 A;  4F4W A;  3UPS A;  5DQG A;  5J2G A;  2JGA A;  5ALR A;  3SD7 A;  3JPO A;  2XY7 A;  2A3V A;  2ZIW B;  4YXM A;  2HVI A;  5GTI U;  4JMU A;  5J2H A;  4UBB A;  4FS2 A;  1ZQT A;  5AIC A;  1Z19 A;  1N63 A;  2ZIW A;  1ZYQ A;  3VCB A;  4YR3 A;  5T14 A;  4DSI A;  1DGS A;  2YML A;  4UAY A;  8ICK A;  1L6N A;  3IG5 A;  5BPC A;  2Y1J A;  2KN7 A;  4U6P A;  3MR2 A;  4I2A A;  5E79 U;  3KHG A;  7ICH A;  3WK7 A;  3WU2 U;  4JWN A;  4F91 B;  2XGQ A;  5AKJ A;  3MGH A;  4EP7 A;  4R65 A;  2P35 A;  3JPQ A;  3MGV A;  2IBK A;  2G0A A;  5J0O A;  4JWM A;  5HR6 A;  4KLG A;  3RAQ A;  4DF4 A;  5AM4 A;  3F5E A;  3MR5 A;  1R8B A;  4Q44 A;  3KTQ A;  1Z4N A;  1ZRN A;  3OSN A;  3PO4 A;  2WFA A;  4FH3 A;  4B9U A;  5KFZ A;  4F5P A;  3AEV A;  4X4Q A;  4DOA A;  2NRZ A;  4P0Q B;  2G07 A;  2ZIU A;  3PR4 A;  4NXW A;  4IS7 A;  9ICX A;  1B43 A;  4WC2 A;  1R8C A;  5AKK A;  1S8O A;  3FAH A;  5JRT A;  4P0Q A;  4J03 A;  5HRG A;  2BBJ A;  1L7O A;  5KT5 A;  2KNJ A;  2ZH2 A;  2NRK A;  2QLT A;  4WCW A;  2ODG A;  5AI9 A;  1JQR A;  4RQ3 A;  5C5J A;  5J2J A;  1KBU A;  4JLX A;  4QZ8 A;  3WK6 A;  4ECV A;  3RF9 A;  5HRL A;  2HHQ A;  5AK3 A;  2E8O A;  5G5G A;  5J0U A;  2R8K A;  1OXJ A;  3K7D A;  5AIA A;  1PK3 A;  4ATB A;  2K89 A;  4BX9 C;  3D2Q A;  3PW7 A;  1FA0 A;  5HHI A;  4UB6 U;  1IXR A;  4WOY A;  3GU3 A;  2QAR B;  4RZR A;  2AH5 A;  2N1R A;  5F9N A;  1F5A A;  3HT3 A;  2LYA A;  1KNY A;  2OEH A;  4CF3 A;  5KT6 A;  4C7Z A;  2QAR A;  5KFP A;  2D3D A;  4YMM A;  3JYY A;  3B0Y A;  3V7J A;  3ISB A;  2P6U A;  5D62 A;  3GIK A;  4J9L A;  4K4I A;  1MC8 A;  2W03 A;  4F4Y A;  2ZUC A;  2LI6 A;  2FMQ A;  2LBO A;  2FMS A;  4I2G A;  3G6Y A;  8ICV A;  5J29 A;  1VFG A;  4C0Z A;  4K9B A;  2KZZ A;  1XSN A;  2GO7 A;  2IHO A;  3E58 A;  2DR9 A;  1KFS A;  8ICM A;  5CRX A;  4QW9 A;  4WBY A;  1V9P A;  3ORY A;  2DPJ A;  2I1Q A;  7ICR A;  1Q46 A;  4RUA A;  5KG5 A;  3NYB A;  4XQ7 A;  2AQ0 A;  3QUQ A;  4UB8 U;  2RFF A;  3HKZ C;  1N5X A;  4K4H A;  2W7P A;  5ALF A;  3ER9 B;  3M9O B;  1CUK A;  4NXZ A;  4IRK A;  1UT5 A;  3RJE A;  1F0M A;  2HN1 A;  4UB2 A;  2XC9 A;  2IMW P;  3WKC A;  2IOF K;  1Z3E B;  5J2F A;  1TK5 A;  4M0A A;  1B4F A;  4O5C A;  4RQ7 A;  2BPF A;  3UQ2 A;  4J9O A;  2C28 A;  1LB2 B;  3SEN A;  1ZD3 A;  1CEZ A;  3CW2 C;  4RQ8 A;  2HBJ A;  2NRT A;  3CRX A;  4MF8 A;  3NVV A;  1ZQQ A;  4ED2 A;  9ICP A;  2UVR A;  5DBB A;  3N4M B;  1BPY A;  3ZDD A;  4DQS A;  4C8L A;  5F2V O;  4K9A A;  2JEI A;  5ALU A;  4NLG A;  3RR8 A;  3OV7 A;  3RTV A;  5J8Y C;  5ALV A;  1HJP A;  1XO0 A;  4Y2S A;  2ZTE A;  4I2F A;  2HSZ A;  2BQU A;  2FE9 A;  1UQV A;  3HJE A;  5AM3 A;  2JRZ A;  3WKE A;  1SL0 A;  1ZQK A;  1LKY B;  5KTQ A;  9ICA A;  1TK0 A;  3LYS A;  2ZJ8 A;  3N97 B;  5KG0 A;  5IIM A;  4EX7 A;  4F3O A;  3ETR A;  2EZX A;  5KFF A;  4NXV A;  1LKY A;  4O9M A;  5AIB A;  4QZC A;  4RNO A;  3WFR E;  2JEF A;  5KG2 A;  4RWP A;  1ZQ1 C;  1OUQ A;  7ICU A;  1FFV A;  2DUY A;  3PX4 A;  3C29 A;  4YCX A;  3K1Z A;  4FZN A;  5AKG A;  4M6W B;  2KG5 A;  4EYH B;  3HJ1 A;  1QCK A;  3EUB 2;  5IIO A;  1RZT A;  4DL6 A;  3EPG A;  4RPZ A;  4HYK A;  4AT7 B;  2DR7 A;  3RB3 A;  4M6W A;  4NV0 A;  2ISP A;  1XO1 A;  3THV A;  2PFQ A;  1PUZ A;  3NTU A;  4LEZ A;  5F9L A;  2DR5 A;  4AT7 A;  5J2D A;  3PSI A;  4WC0 A;  3ERC C;  3UMB A;  8ICH A;  1M6Y A;  2KP7 A;  4Q45 A;  5KT2 A;  4NY8 A;  1UEU A;  2W3S A;  2PFN A;  1KFD A;  1J2N A;  1JRP A;  4LT6 A;  3HRD D;  4IC9 A;  2WAQ F;  4DFM A;  2ZXI A;  4AT9 A;  3JPT A;  2HN2 A;  2EZZ A;  2YX8 A;  4EBD A;  4NL9 C;  1PVQ A;  8ICP A;  5KFL A;  5KFE A;  3D6J A;  1XU4 A;  2BQ3 A;  1UA0 A;  3F2C A;  1U49 A;  4CDG A;  5DB8 A;  5J2A A;  3ZD8 A;  3TAD A;  3C21 A;  5KFX A;  2LYB A;  2HVH A;  4DWI A;  3O0F A;  4F93 B;  1NK5 A;  4ECW A;  1U45 A;  1MA7 A;  2W55 A;  3KD3 A;  3PW0 A;  2BR0 A;  1L3S A;  9ICC A;  2Z7J A;  4ECZ A;  3BDP A;  3IG8 A;  4UD5 A;  3PSP A;  4B9M A;  9ICI A;  4KLH A;  5AI8 A;  3WK8 A;  3QZ7 A;  3TQ1 A;  4AP9 A;  1NOM A;  1Z4O A;  4BDP A;  3V7K A;  2NRW A;  2WF5 A;  2P6R A;  5B66 U;  1DOQ A;  1DRG A;  4KN4 A;  2BCV A;  2VA2 A;  4RQ2 A;  1P7D A;  5KT3 A;  5J0Q A;  4WQK A;  4DQQ A;  4EBE A;  5AM1 A;  4DSK A;  9ICV A;  3N7P D;  4ECU A;  2XGP A;  3V72 A;  1N62 A;  4Y2Y A;  3F5A A;  7ICM A;  4IQV A;  1S0O A;  1RM6 C;  4I2I A;  4DSJ A;  4DFK A;  3I1Y A;  4C8N A;  4PH5 A;  4FZM A;  4OJP A;  4UW9 A;  4NXT A;  1Y88 A;  4CE6 A;  3Q8R B;  1HUZ A;  3N7R C;  2HHV A;  2HOQ A;  3RRH A;  1ZQG A;  3DEE A;  3OGU A;  2H3V A;  2ZUD A;  2PFP A;  3N7S C;  1TAQ A;  5J2B A;  1TK8 A;  2HMX A;  5B3P A;  5KL8 B;  1NJX A;  5DGA A;  4O5K A;  2KVS A;  4X5V A;  4B9V A;  9ICT A;  2PBE A;  3G6V A;  4JV1 A;  3SZ2 A;  4MHV A;  3AQM A;  2KEY A;  1N60 A;  4MFF A;  4FE3 A;  2ZH3 A;  1X9S A;  9ICE A;  2ZH4 A;  4F5N A;  4GIB A;  1SKS A;  3KHH A;  4YD2 A;  4UB1 A;  2ZJ5 A;  3QU7 A;  4M9L A;  3BS7 A;  5ALW A;  9ICJ A;  3LWL A;  5EE3 A;  1FO4 A;  4IQU A;  4OJ6 A;  5B5E U;  2OXO A;  4CNQ A;  2OHF A;  1ZRM A;  4DLE A;  3AUO A;  2GWS A;  2UVW A;  8ICU A;  3UQ0 A;  2B21 A;  3TAQ A;  4X0A A;  4M04 A;  4FHW A;  3GII A;  2Y0S F;  9ICB A;  3H0M B;  2XI9 A;  2VJ5 A;  4B6J A;  2KD1 A;  4F4Z A;  2LMR A;  2GA9 D;  4O67 A;  2KVC A;  3TFR A;  5KG4 A;  3H0L B;  4DLG A;  4DS5 A;  1SV0 C;  3JPR A;  3QE9 Y;  3LK9 A;  2Y9T A;  4GLX A;  3ALR A;  8ICB A;  2CPR A;  1ZQI A;  4UBC A;  1NNL A;  3KOO A;  1TVA A;  2PMZ C;  4YN4 A;  2KJ5 A;  1QLN A;  1X6J A;  3MAB A;  2QKQ A;  4KLF A;  4I29 A;  2F3N A;  1ZQD A;  2J6T A;  4Q8F A;  2EAP A;  5KFI A;  4N7R A;  4G9B A;  3ED5 A;  3H8M A;  2GLE A;  4XUS A;  1NK9 A;  2UVU A;  1BPD A;  4QWC A;  4I2H A;  5GTH U;  4X4V A;  1IM4 A;  2EZY A;  2K8C B;  4P4P A;  3HP6 A;  4C4S A;  3TAR A;  4Q8E A;  1LVH A;  1KL9 A;  5DKW A;  5BOM A;  4ECY A;  5J0S A;  3M7D A;  4Y2X A;  2W8K A;  4YXJ A;  3C18 A;  5AKY A;  3IP4 B;  1L5U A;  2EDU A;  4QIW C;  1GO3 F;  2AXT U;  4DFD A;  4O3P A;  2RDI A;  5J0X A;  2PI4 A;  4LEW A;  4MEY A;  9ICQ A;  3PML A;  1X9X A;  1JRO A;  2K60 A;  1D8Y A;  1NJY A;  4YMN A;  2E8N A;  3Q8S B;  1MN8 A;  1JX4 A;  4QZH A;  4DFJ A;  4M9J A;  4BGD A;  1HEK A;  3RB6 A;  2F1H A;  4EZ9 A;  2ZH5 A;  2W43 A;  5ALD A;  4JUZ A;  2FPM A;  4ED1 A;  4EEY A;  2BBH A;  4KLD A;  5TZV A;  2ALZ A;  1Q78 A;  3DV9 A;  3GQC A;  2H3Q A;  1T7P A;  2Y9U A;  4PL2 A;  4F2S A;  3QUT A;  4I2B A;  4DL4 A;  3L5K A;  5ALH A;  2LKY A;  4P4O A;  3C1Y A;  2IOH A;  5ALT A;  3V6K A;  5AKZ A;  2JHD A;  4UAT A;  5D4B A;  1A0P A;  3M9N B;  1T3N A;  4X4T A;  4UAS A;  4AT8 B;  3C23 A;  2IOF A;  4R63 A;  4KLJ A;  4EGW A;  9ICL A;  2O5A A;  3PX0 A;  2XIC A;  2BPG A;  5ALJ A;  5KFK A;  5EE0 A;  8ICT A;  4RQ4 A;  2J6S A;  3H40 A;  4AT8 A;  2O1P A;  5CA7 A;  1A77 A;  1WWV A;  7ICN A;  5K4L A;  4R8U B;  9ICR A;  2JZB B;  3OJU A;  3HKZ F;  2WB1 C;  3GV8 B;  3C5F A;  3RBD A;  2KHQ A;  1WWU A;  3M1Y A;  4QJF B;  4J9P A;  1SIJ A;  5ALP A;  2Q0Z X;  2VIX A;  3C2L A;  5L1L A;  4UAZ A;  3RAX A;  4R8U A;  2JZB A;  1NI3 A;  4AYB F;  4X4O A;  2HDO A;  4PHA A;  1ZQX A;  1ZQN A;  4PGX A;  3HW8 A;  3T79 A;  2LPE A;  3OHB A;  2PKE A;  2AJQ A;  1HUO A;  3HIY A;  3DDH A;  4O3Q A;  1K1Q A;  3OVS A;  4PHE A;  8ICO A;  2ZHA A;  4BXO B;  4K4G A;  1JIH A;  1FEZ A;  3B9J A;  5KFQ A;  4YR0 A;  5L1K A;  1PVR A;  4IR1 A;  3NKU A;  3NS1 A;  1D8L A;  2H3I A;  4BWM A;  1COO A;  4BXO A;  4DL2 A;  1UEV A;  1N2X A;  4C7Y A;  4PGY A;  8ICW A;  3KKA A;  3MDA A;  5HMM A;  3MFH A;  1R8A A;  4RNM A;  1BVS A;  4Z6C A;  3L4P A;  4CCH A;  5KFV A;  9ICW A;  4QNL A;  3QU5 A;  2NRX A;  4WC3 A;  4BUG A;  4US9 A;  2A1A A;  3NVW A;  4HX0 A;  1F5S A;  2OYY A;  2G5I B;  3M8R A;  3BQ0 A;  5TIS U;  2BDP A;  3KHL A;  4ZH4 A;  5HML A;  5L1M A;  2DBY A;  5J2C A;  3IV6 A;  1MIV A;  3UXO A;  3PW2 A;  2BCQ A;  2EAN A;  1O03 A;  1T3Q A;  3PW5 A;  1JMS A;  1L8L A;  2YB4 A;  2DKX A;  3AQE A;  3PR5 B;  4KLU A;  2JXJ A;  1YZ6 A;  4GFJ A;  7ICS A;  5KFB A;  4ELV A;  2BCR A;  2HBK A;  4Y2V A;  1T4G A;  3FM9 A;  3HX0 A;  2B0C A;  2KOB A;  4J9Q A;  4X4P A;  2PI5 A;  2DKZ A;  5DQH A;  4UAU A;  2ID1 A;  4NM2 A;  3CK6 A;  4YD1 A;  3QU4 A;  2HI0 A;  4O6A A;  2V9W A;  3PMN A;  2KKP A;  2AU0 A;  2LM4 A;  4ED7 A;  4Y2Q A;  3ONN A;  2EAO A;  2DL0 A;  2YQE A;  2HCF A;  1RYS A;  7ICL A;  2DR8 A;  5EE9 A;  2JH1 A;  5KL1 B;  1QQ7 A;  3WFQ E;  4O3R A;  8ICC A;  4WC5 A;  4ECS A;  2RP5 A;  2FJ6 A;  5ALK A;  1ZQP A;  2C2D A;  3WFP A;  3EW9 A;  2EH9 A;  2BCS A;  2H3Z A;  4IL6 U;  5J2K A;  4M9N A;  1SZH A;  2A19 A;  3H3A A;  7ICQ A;  8ICQ A;  3CYM A;  3C2M A;  1CRX A;  2VKQ A;  3RJH A;  1K1S A;  1MIW A;  4OO1 J;  5KFS A;  5AK4 A;  2AHO B;  1Q3V A;  1B22 A;  2KMD A;  1UCV A;  1ZJN A;  4LJX A;  4KX5 A;  1NZB A;  5KG6 A;  4QWE A;  2HHW A;  2E5S A;  4DL7 A;  3OWG A;  4USA A;  2Y1I A;  2WF8 A;  5AKH A;  3ZDA A;  1L3T A;  3PNC A;  3RFA A;  4FS1 A;  1PK1 B;  3GIL A;  2WF9 A;  5JTG A;  5CJ7 A;  1XC9 A;  4IRC A;  3C2K A;  3M8S A;  4M2Y A;  4M47 A;  9ICN A;  3MCR A;  4E7X A;  3FYH A;  1PK1 A;  1DK3 A;  3AN1 A;  3PX6 A;  1WG8 A;  3WFO A;  1TFW A;  1J97 A;  4RT3 A;  3F53 A;  4FHV A;  3OJS A;  4RUC A;  3K1R B;  4Y2P A;  4R64 A;  4I2C A;  2MAX A;  2FCL A;  5HRD A;  5EE1 A;  1KN5 A;  3HJ4 A;  5KFU A;  4I0U A;  1ZQV A;  5BOL A;  3OTQ A;  7ICT A;  3IRU A;  4DO9 A;  4Z6E A;  2GOL A;  4YFK A;  3H8J A;  2OH2 A;  4WC6 A;  2DRA A;  5EWG A;  4KMU A;  4RPX A;  2F2A B;  2K4E A;  3AMZ A;  8ICY A;  4MKP A;  4LZG A;  5DB7 A;  2F76 X;  5D49 A;  4F4X A;  2FLN A;  3KFU F;  2YN4 A;  1ZQW A;  5DG8 A;  3PVX A;  3EPI A;  2G08 A;  4MEX A;  1YZ7 A;  4X4N A;  2W3R A;  1U48 A;  5AKL A;  4QZA A;  2C2E A;  1C7Y A;  3AQL A;  3BZC A;  5AK6 A;  5KFT A;  1JI7 A;  1ZQB A;  2VA8 A;  4XA5 A;  1BPZ A;  2FMP A;  2R8J A;  5KAI U;  4B9S A;  1ZQL A;  2IUB A;  5DDM A;  5KNI A;  1DXS A;  2IHM A;  2KZ3 A;  2BQR A;  2CRX A;  4E8F A;  2DQN B;  3NUQ A;  2FI1 A;  2E8P A;  3HWT A;  2RHF A;  5AM2 A;  4FHY A;  2MUT B;  1IV8 A;  2RRD A;  4YP3 A;  8ICE A;  1NKC A;  4JB3 A;  5IIJ A;  3V6J A;  5DQI A;  5A0L A;  2B56 A;  3L9D A;  5AKI A;  2KTQ A;  4WBZ A;  1Q79 A;  4QZD A;  1BGX T;  3UXP A;  4M9H A;  2MUT A;  2H5X A;  2WHE A;  4DF8 A;  1H38 A;  4O3S A;  1OW5 A;  1KLN A;  4J9N A;  4NLK A;  2GAF D;  4KIT B;  3QUC A;  5DG7 A;  2ZUB A;  2M2T A;  2AQ4 A;  5HRI A;  2HHS A;  1KTQ A;  2MSN A;  4Z6D A;  4QZG A;  8ICS A;  3AL0 B;  1NO5 A;  4YQW A;  1OU5 A;  4EX6 A;  8ICN A;  1TAU A;  2MU2 A;  4NLC A;  2BE3 A;  4X0B A;  4DSE A;  4RT2 A;  1UHU A;  4UB3 A;  5CEH A;  3T5H A;  5AI6 A;  5HRB A;  1TE2 A;  2CXY A;  3U26 A;  5KG3 A;  4OJ5 A;  2F8L A;  1WCN A;  7ICK A;  5J0P A;  1KW4 A;  2ASL A;  1ZQU A;  1N61 A;  2KSO B;  3C1Z A;  1NK4 A;  4K98 A;  4RQM A;  4XJE A;  4XRH A;  5AKX A;  2MA1 A;  3SAF A;  3AQF A;  3PZP A;  3K75 D;  2KSO A;  5KT7 A;  1S97 A;  4F8R A;  5DED A;  1SZP A;  3BQ7 A;  8ICI A;  2O6K A;  1V4A A;  4QW8 A;  9ICM A;  3LVW A;  2HW3 A;  3QEA Z;  5KFJ A;  3MR3 A;  4TUS A;  3GIJ A;  4DEZ A;  5IIL A;  4FHP A;  4QIW F;  2A1J B;  2ZH8 A;  2BPC A;  2F77 X;  2ZTD A;  4KTQ A;  2KJ8 A;  1T8E A;  4EBK A;  4JK1 A;  1X9M A;  1X66 A;  4CGZ A;  2OWO A;  2A1J A;  5HC9 A;  5KFO A;  2YTU A;  2AGQ A;  4P0P B;  4LEV A;  5DG9 A;  2W9C B;  1XS9 D;  1UT8 A;  4KLL A;  1YLQ A;  1Z00 B;  2E1F A;  1UPH A;  3QEB Z;  3MR6 A;  5D63 A;  4P0P A;  4TUR A;  5AI4 A;  2W9C A;  3PST A;  3EZ5 A;  2VA3 A;  4IQW A;  1Z00 A;  1V85 A;  3RBE A;  1S10 A;  2HHT A; 
#chains in the Genus database with same CATH homology
 4QZF A;  1X9W A;  1KFS A;  3ZDB A;  5D4B A;  5KFA A;  4KLS A;  3M9N B;  8ICM A;  1T3N A;  1KFT A;  1SL1 A;  4QW9 A;  4IR9 A;  3JPS A;  4WBY A;  4X4T A;  1V9P A;  3ORY A;  3C23 A;  2DPJ A;  4AT8 B;  3PO5 A;  1U47 A;  2I1Q A;  4R63 A;  7ICE A;  9ICF A;  4KLJ A;  7ICR A;  1UA1 A;  2ZJA A;  4RUA A;  1KRP A;  2KFZ A;  5KG5 A;  2PFO A;  1ZET A;  5J0R A;  4AT9 B;  1BPB A;  8ICA A;  9ICL A;  2O5A A;  3PX0 A;  3NYB A;  4XQ7 A;  2AQ0 A;  4RWN A;  2BPG A;  5KFK A;  8ICT A;  4RQ4 A;  2RFF A;  2J6S A;  3H40 A;  4DFP A;  1RPL A;  7ICI A;  2M2W A;  4AT8 A;  2O1P A;  4DSL A;  4YG2 A;  5CA7 A;  2V4R A;  4K4H A;  1A77 A;  3OVA A;  1NJZ A;  4WC4 A;  3T5J A;  3M9O B;  3AU6 A;  7ICN A;  1CUK A;  4NXZ A;  4YMO A;  4FO6 A;  1D9D A;  4R8U B;  4IRK A;  1UT5 A;  3MDC A;  3RJI A;  3SI8 A;  3RJE A;  3IHQ B;  4NLN A;  2JZB B;  9ICR A;  1SKR A;  3OJU A;  2NRV A;  1D9F A;  2ASJ A;  1X2I A;  3GV8 B;  3C5F A;  4EZ6 A;  3RBD A;  4UB2 A;  1ZQF A;  3T5L A;  4F2R A;  3LQC B;  2XC9 A;  4J9P A;  2IMW P;  5DEC A;  3HPO A;  3C2L A;  2Q0Z X;  5L1L A;  3RAX A;  4UAZ A;  1TFR A;  4RPY A;  4R8U A;  1JN3 A;  1DK2 A;  1Z3E B;  2M2V A;  2JZB A;  2C22 A;  4X4O A;  3H38 A;  4PHA A;  1ZQX A;  1ZQN A;  5J2F A;  4PGX A;  3IM1 A;  4EBJ A;  3HW8 A;  3V7L A;  3OSP A;  5KFC A;  3OHA A;  4UAW A;  1TK5 A;  4M0A A;  3OHB A;  3AQN A;  4E0D A;  3V6H A;  4UB5 A;  4O5C A;  4YR2 A;  4RQ7 A;  2BPF A;  2AJQ A;  3UQ2 A;  4J9O A;  3MBY A;  2C28 A;  4J9S A;  1LB2 B;  1HUO A;  1S76 D;  5CR0 A;  5IIN A;  3HIY A;  2R8G A;  1CEZ A;  4O3Q A;  3H8W A;  9ICT A;  3RH6 A;  2IHN A;  1K1Q A;  4RQ8 A;  4PHE A;  3OVS A;  2NRT A;  4KLQ A;  8ICO A;  5KFN A;  4MF8 A;  1ZQQ A;  4BXO B;  4J9K A;  5J0T A;  4ED2 A;  2ZHA A;  1MIY A;  2ZH1 A;  4K4G A;  1JIH A;  9ICP A;  5KFQ A;  5DBB A;  4YR0 A;  5L1K A;  1ZJM A;  3N4M B;  4QWA A;  2BGW A;  1BPY A;  1ZQM A;  8ICX A;  3ZDD A;  2ZHB A;  4P4M A;  2ZH9 A;  4DQS A;  3RB0 A;  1D8L A;  4RQ6 A;  4C8L A;  3ISD A;  1ZQE A;  4BWM A;  5L1J A;  5L1I A;  5F2V O;  1COO A;  2JEI A;  5EWF A;  4B9T A;  4BXO A;  2AGP A;  4DL2 A;  4NLG A;  3RR8 A;  1NK7 A;  1UEV A;  3OV7 A;  3UXN A;  4PGY A;  3RTV A;  8ICW A;  4PHP A;  9ICO A;  1HJP A;  4KN7 A;  3RJJ A;  8ICF A;  3MDA A;  5HMM A;  3MFH A;  1QSY A;  1R8A A;  2ZTE A;  4RNM A;  1BVS A;  4I2F A;  1TKD A;  2FPK A;  9ICK A;  2AGO A;  4Z6C A;  3TFS A;  4ECR A;  4CCH A;  9ICW A;  5KFV A;  1EXN A;  2BQU A;  3BQ2 A;  2NRX A;  4F4K A;  1MQ3 A;  1S0V A;  1SL0 A;  4WC3 A;  1BNP A;  1ZQK A;  5KTQ A;  9ICA A;  1TV9 A;  1TK0 A;  3TAP A;  3Q8Q B;  2ZJ8 A;  3N97 B;  4F5O A;  5KG0 A;  5IIM A;  2F1J A;  4S3N A;  2VAN A;  1KEJ A;  3M8R A;  1S9F A;  3GV5 B;  1SL2 A;  4F3O A;  3ETL A;  1UET A;  5KFF A;  4F5R A;  5HP4 A;  2JEG A;  3H8S A;  5KFY A;  4O9M A;  2W9B B;  3BQ0 A;  4DL5 A;  5KFG A;  4QZC A;  4RNO A;  4PGQ A;  4O3N A;  2BDP A;  3KHL A;  3WFR E;  2ASD A;  4ZH4 A;  5HML A;  5J2C A;  1QTM A;  4IG8 A;  4PHD A;  2JEF A;  5KG2 A;  3Q8M A;  1NZP A;  4RWP A;  1MIV A;  3UXO A;  3PW2 A;  4WC1 A;  4MF2 A;  2BCQ A;  7ICU A;  5HRH A;  2KZM A;  3RB4 A;  4JV2 A;  2R8H A;  3KHR A;  3PW5 A;  1JMS A;  8ICJ A;  9ICU A;  2W9B A;  3PX4 A;  4MFC A;  4QZE A;  2ISO A;  3PR5 B;  4YCX A;  4KLU A;  4X4S A;  1U9L A;  4M6W B;  4O3O A;  7ICS A;  5KFB A;  2W8L A;  4ELV A;  4EYH B;  4GXJ A;  1N56 A;  3HJ1 A;  4GXK A;  2BCR A;  3OUY B;  5IIO A;  4GC6 A;  1T4G A;  4DL6 A;  1RZT A;  3JPN A;  3HX0 A;  3RR7 A;  3EPG A;  4RPZ A;  4HYK A;  4AT7 B;  1VJ7 A;  2DR7 A;  5DBA A;  3BJY A;  3RB3 A;  4J9Q A;  1SKW A;  2DPI A;  3Q8K A;  4M6W A;  4X4P A;  8ICR A;  4RWO A;  1S0M A;  2FLP A;  2PI5 A;  4I28 A;  5DQH A;  2XO7 A;  1XO1 A;  3THV A;  2ISP A;  2PFQ A;  4RWQ A;  3B0X A;  2ID1 A;  3OUY A;  4NM2 A;  3NTU A;  5F9L A;  2DR5 A;  4ED6 A;  7ICO A;  4AT7 A;  5J2D A;  4YD1 A;  4PPX A;  4WC0 A;  2V9W A;  4DSF A;  4I2D A;  3PMN A;  8ICH A;  3C5G A;  2AU0 A;  2DVI A;  3LWM A;  4ED7 A;  2KP7 A;  9ICG A;  4Q45 A;  5KT2 A;  4DQR A;  4NY8 A;  1UEU A;  5EOZ A;  5DGB A;  2PFN A;  1KFD A;  2V4Q A;  4GC7 A;  1NKB A;  2BCU A;  4TQR A;  1RYS A;  7ICL A;  3JZ0 A;  2DR8 A;  3EYZ A;  2Q66 A;  4LT6 A;  5KG7 A;  5HRE A;  5DB9 A;  4EBC A;  4DFM A;  3WFQ E;  4O3R A;  5CHG A;  4AT9 A;  3JPT A;  4DQP A;  8ICC A;  3FDS A;  4EBD A;  4ECS A;  4WC5 A;  1ZQO A;  8ICP A;  5JUM A;  5KFL A;  5KFE A;  1JXL A;  1N48 A;  4B9N A;  5L9X A;  1XU4 A;  4TQS A;  1ZQP A;  1WCL A;  5CP2 A;  4QZ9 A;  3SV4 A;  2C2D A;  3EW9 A;  2BQ3 A;  1UA0 A;  4Q43 A;  2BCS A;  5D46 A;  3WFP A;  4I27 A;  1U49 A;  7ICJ A;  5J2K A;  5DB8 A;  5J2A A;  3ZD8 A;  4QZI A;  2PXI A;  4M9N A;  3C21 A;  1A76 A;  5IIK A;  5KFX A;  3PY8 A;  1U4B A;  1KSP A;  2HVH A;  3H3A A;  3H4B A;  4DL3 A;  2BKE A;  5KFM A;  3GIM A;  2KFN A;  4DWI A;  4F93 B;  2HHX A;  4BDP A;  2HHU A;  7ICQ A;  2DRB A;  8ICQ A;  3PV8 A;  5HRF A;  3C2M A;  1NK5 A;  1RXV A;  4ECW A;  5HNK A;  1U45 A;  3RJH A;  1K1S A;  2FPL A;  1MIW A;  5KFS A;  3PW0 A;  2BR0 A;  1L3S A;  4LVS A;  3ZDC A;  9ICC A;  4GXI A;  4ECZ A;  5DLG A;  1B22 A;  2C2R A;  3E2E A;  5KT4 A;  4ED0 A;  3BDP A;  4RQ0 A;  8ICL A;  1NJW A;  1ZJN A;  4UD5 A;  4B9M A;  4DQI A;  3H4D A;  4KLH A;  5KG6 A;  4QWE A;  1BPE A;  9ICI A;  4LZD A;  4RNN A;  4J9R A;  5KG1 A;  2HHW A;  4DL7 A;  5CWR A;  3QZ7 A;  3TQ1 A;  3GDX A;  5DLF A;  4NKU A;  1NOM A;  4ECT A;  5J0Y A;  2Y1I A;  5HR9 A;  3ZDA A;  1L3T A;  4RQ1 A;  3PNC A;  5EWE A;  3ZDE A;  3G6X A;  3V7K A;  4FS1 A;  2NRW A;  4ED3 A;  3RH5 A;  4C8K A;  1R89 A;  1L3V A;  2P6R A;  3GIL A;  3T5K A;  1BPX A;  3AQK A;  3EWA A;  5CJ7 A;  1DOQ A;  3Q8L A;  1XC9 A;  1KDH A;  4KN4 A;  5HHH A;  2BCV A;  3C2K A;  1XSL A;  2VA2 A;  4RQ2 A;  4IRC A;  3ZD9 A;  1PX5 A;  3QZ8 A;  3M8S A;  4M2Y A;  1MQ2 A;  4M47 A;  3NGD A;  5KT3 A;  5J0Q A;  9ICN A;  1JAJ A;  4FH5 A;  4DQQ A;  4EBE A;  3SV3 A;  4RU9 A;  4E7X A;  9ICV A;  4DSK A;  4G3I A;  3FYH A;  4IRD A;  1DK3 A;  4ECU A;  3PX6 A;  3WFO A;  4ELT A;  4KLI A;  2XGP A;  1TFW A;  3V72 A;  4RT3 A;  2DFL A;  5J2E A;  1NK0 A;  1ZQA A;  4FHV A;  5DDY A;  4C8O A;  3OVB A;  4FHX A;  1ZQR A;  3OJS A;  4RUC A;  7ICG A;  1RXW A;  4J9M A;  2W9M A;  4IQV A;  4R64 A;  2XY5 A;  1S0O A;  1ZQJ A;  2P66 A;  4I2I A;  4DSJ A;  1ZQC A;  4I2C A;  4ATB B;  2MAX A;  4DFK A;  4PH5 A;  4C8N A;  1L3U A;  5HRD A;  1ZQH A;  1Y88 A;  3HJ4 A;  3Q8R B;  5KFU A;  1HUZ A;  4KLE A;  3AU2 A;  2F1I A;  2UVR A;  2HHV A;  1ZQV A;  1MSW D;  5BOL A;  5J0W A;  3ISC A;  4B9L A;  3H39 A;  7ICT A;  4DO9 A;  3RRH A;  2XCP A;  4Z6E A;  4NLZ A;  4YFK A;  1ZQG A;  3H8J A;  3OGU A;  3RH4 A;  9ICH A;  4WC6 A;  2ZUD A;  2PFP A;  2DRA A;  4R66 A;  5EWG A;  4KMU A;  4TUP A;  4RPX A;  4QWD A;  1TAQ A;  5J2B A;  4DS4 A;  1NK6 A;  5J2I A;  1TK8 A;  4IR1 A;  4X4R A;  8ICY A;  5DBC A;  1NJX A;  2BHN A;  5DGA A;  1PZN A;  3SYZ A;  5DB7 A;  4B9V A;  4X5V A;  4LZG A;  3M9M B;  2IA6 A;  4O5K A;  5D49 A;  4F4X A;  4I2J A;  3MFI A;  3G6V A;  2FLN A;  2PBE A;  4JV1 A;  3SZ2 A;  1ZQW A;  4BWJ A;  1S0N A;  5DG8 A;  1WOT A;  3PVX A;  3EPI A;  2JEJ A;  3AQM A;  3RJG A;  4F50 A;  4UQG A;  4MFF A;  5KFW A;  4MEX A;  2ATL A;  1ZQS A;  2ZH6 A;  2ZH3 A;  1X9S A;  9ICE A;  1QSL A;  2ZH4 A;  4X4N A;  1TFY A;  3GFK B;  4F5N A;  1SKS A;  3KHH A;  4F5Q A;  1U48 A;  2RDJ A;  1NK8 A;  4QZA A;  4YD2 A;  4UB1 A;  2C2E A;  1C7Y A;  4KLM A;  3JPP A;  3AQL A;  4MFA A;  4YVZ A;  2ZJ5 A;  2UVV A;  4NM1 A;  4QWB A;  4F4W A;  4M9G A;  3UPS A;  5KFT A;  1LV5 A;  1ZQB A;  4M9L A;  2VA8 A;  5DQG A;  4XA5 A;  1BPZ A;  2FMP A;  4UD4 A;  2R8J A;  5J2G A;  4TUQ A;  4B9S A;  1ZQL A;  9ICJ A;  5DDM A;  3JPO A;  3LWL A;  2XY7 A;  3H37 A;  2IHM A;  4IQU A;  4YXM A;  2KZ3 A;  3WFS C;  2BQR A;  2HVI A;  4I2E A;  4E8F A;  5J2H A;  4UBB A;  4FS2 A;  4DLE A;  3AUO A;  2GWS A;  2UVW A;  1ZQT A;  3HWT A;  4ELU A;  8ICU A;  4FHY A;  4EYI B;  2B21 A;  3UQ0 A;  3TAQ A;  4KLO A;  2MUT B;  8ICE A;  4YP3 A;  1RYR A;  4X0A A;  1NKC A;  1NKE A;  3MGI A;  5IIJ A;  1ZQZ A;  3V6J A;  2I9G A;  1ZYQ A;  4M04 A;  4O5E A;  4FHW A;  1ARO P;  3GII A;  5DQI A;  4YR3 A;  9ICB A;  3L9D A;  4DSI A;  2KTQ A;  1DGS A;  4F4Z A;  4DOB A;  4WBZ A;  4UAY A;  8ICK A;  1Q79 A;  4QZD A;  1BGX T;  3UXP A;  3TFR A;  4M9H A;  3K4G A;  5KG4 A;  2MUT A;  2H5X A;  1H38 A;  5BPC A;  4DF8 A;  2Y1J A;  4O3S A;  2KN7 A;  3MR2 A;  4I2A A;  4DLG A;  4DS5 A;  5III A;  3KHG A;  4C8M A;  1KLN A;  3JPR A;  4J9N A;  4IQT A;  2XCA A;  4NLK A;  4JWN A;  7ICH A;  4KIT B;  4F91 B;  2XGQ A;  5DG7 A;  3QE9 Y;  3LK9 A;  3RRG A;  4KLT A;  3BQT A;  3MGH A;  2ZUB A;  2W9A A;  4GLX A;  2M2T A;  4EP7 A;  4R65 A;  7ICP A;  3JPQ A;  2AQ4 A;  8ICB A;  2IBK A;  5J0O A;  1KTQ A;  2HHS A;  4Z6D A;  5HRI A;  4QZG A;  1ZQI A;  4JWM A;  4UBC A;  4Z6F A;  2ZH7 A;  3UPQ A;  3PW4 A;  8ICS A;  1TVA A;  4KLG A;  3RAQ A;  4DF4 A;  1NO5 A;  4YN4 A;  2FLL A;  3MR5 A;  4YQW A;  3RJK A;  4Q44 A;  3KTQ A;  1QLN A;  1OU5 A;  8ICN A;  1R8B A;  4ECX A;  2XY6 A;  3OSN A;  7ICV A;  1XWL A;  3PO4 A;  1TAU A;  4M5D A;  2BE3 A;  3MAB A;  4KLF A;  4B9U A;  4FH3 A;  1S77 D;  3TAN A;  5KFZ A;  4I29 A;  1QSS A;  4F5P A;  4DSE A;  3BQ1 A;  3RJF A;  4X0B A;  4X4Q A;  2M9N A;  4RT2 A;  4DOA A;  8ICG A;  2NRZ A;  1ZQD A;  5KFR A;  4UB3 A;  2J6T A;  3TI0 A;  4Q8F A;  1JXE A;  3PR4 A;  5KFI A;  3T5H A;  1ZQY A;  5HRB A;  2M2U A;  5CB1 A;  4XUS A;  1NK9 A;  5KG3 A;  9ICX A;  4UB4 A;  1B43 A;  4XQ8 A;  8ICZ A;  4WC2 A;  2UVU A;  1WCN A;  1R8C A;  1BPD A;  2LYH A;  5J0P A;  4QWC A;  2ASL A;  1ZQU A;  4I2H A;  1NK4 A;  3C1Z A;  7ICK A;  4X4V A;  1IM4 A;  4WC7 A;  4P4P A;  3HP6 A;  4X4U A;  5HRG A;  2R8I A;  5KT5 A;  7ICF A;  3TAR A;  5KFD A;  4Q8E A;  2ZH2 A;  3GV7 B;  7ICM A;  2NRK A;  4XRH A;  4WCW A;  4RQ5 A;  3T3F A;  3K75 D;  2J6U A;  1JQR A;  5DKW A;  5BOM A;  4RQ3 A;  5C5J A;  5J2J A;  4ECY A;  5J0S A;  5KT7 A;  4QZ8 A;  1S97 A;  2W8K A;  4F8R A;  4YXJ A;  5DED A;  1SZP A;  5KFH A;  4ECV A;  3C18 A;  8ICI A;  4F92 B;  5HRL A;  2HHQ A;  5HRK A;  5DB6 A;  1V4A A;  1L5U A;  4QW8 A;  5J0U A;  2R8K A;  9ICM A;  4O3P A;  2HW3 A;  3QEA Z;  5KFJ A;  3MR3 A;  4ATB A;  4TUS A;  3PW7 A;  2RDI A;  4ED8 A;  3H7I A;  5J0X A;  3GIJ A;  1FA0 A;  2PI4 A;  5HHI A;  4MEY A;  4DEZ A;  9ICQ A;  1IXR A;  3PML A;  5IIL A;  4FHP A;  3LDA A;  2ZH8 A;  2A1J B;  4RZR A;  4P2H A;  2BPC A;  1D8Y A;  4E80 A;  1NJY A;  2ZTD A;  4YMN A;  5F9N A;  3Q8P B;  4KTQ A;  1F5A A;  3Q8S B;  3HT3 A;  4ECQ A;  1KNY A;  1T8E A;  2HHP A;  4EBK A;  1JX4 A;  4QZH A;  1XSP A;  4JK1 A;  5KT6 A;  4FBU A;  4JV0 A;  4DFJ A;  4M9J A;  4BGD A;  1X9M A;  5KFP A;  3RB6 A;  2F1H A;  4YMM A;  3C66 A;  2OWO A;  2A1J A;  3B0Y A;  4O0I A;  4EZ9 A;  9ICS A;  3JYY A;  5KFO A;  5HC9 A;  2AGQ A;  2ZH5 A;  3V7J A;  3ISB A;  2P6U A;  3GIK A;  4JUZ A;  4J9L A;  2FPM A;  4ED1 A;  4K4I A;  1MC8 A;  5DG9 A;  2W9C B;  1UT8 A;  4EEY A;  1XS9 D;  4FBT A;  4F4Y A;  4KLD A;  2ZUC A;  4KLL A;  1YLQ A;  5TZV A;  2ALZ A;  1Q78 A;  2FMQ A;  3GQC A;  1Z00 B;  1T7P A;  4NKT A;  3QEB Z;  3MR6 A;  4DOC A;  2FMS A;  4I2G A;  4F2S A;  4TUR A;  3G6Y A;  2ZTC A;  4DL4 A;  4I2B A;  8ICV A;  2W9C A;  5J29 A;  1VFG A;  3EZ5 A;  2VA3 A;  4QZB A;  2KZZ A;  1BNO A;  4P4O A;  1XSN A;  1Z00 A;  4IQW A;  3C1Y A;  2WTF A;  3V6K A;  3RBE A;  2DR9 A;  1S10 A;  2HHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...