4X0AA

Structure of trna-processing enzyme complex 6
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
molecule keywords Poly A polymerase
total genus 112
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4x0aA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4x0aA01
5J2BA 9ICXA 5D46A 2ZHAA 3JZ0A 4R66A 4P4MA 3HX0A 5J29A 2ID1A 2O5AA 4NXZA 3PMNA 4E80A 4FHYA 4WC7A 4R65A 4YMMA 4NM1A 4X4PA 3C2LA 1ZQIA 4K4HA 8ICOA 4KLIA 1KEJA 4X4SA 2PXIA 5J2DA 3WFSC 2ZH3A 4DO9A 4UAWA 4M9NA 1XSLA 9ICSA 9ICIA 5F2VO 8ICFA 3AUOA 4I2IA 1JQRA 5HRIA 8ICWA 5IIJA 5DDMA 9ICVA 4FH3A 3WFQE 4UB3A 2ZH8A 4UD5A 7ICTA 4KLMA 5DB6A 9ICBA 1R8BA 4YCXA 1ZQLA 3H3AA 5J0SA 3PMLA 2VANA 1R89A 4RQ3A 2PBEA 5DDYA 3C66A 3H38A 4TUSA 8ICZA 1ZQGA 5BOLA 4RQ6A 8ICPA 2ZH4A 5CR0A 5CJ7A 5J0XA 4KLJA 4UB2A 4M9HA 3AQLA 4X0AA 4F5PA 3UQ0A 3V7KA 4UB5A 8ICRA 8ICKA 4X4UA 2I9GA 2DR7A 4DOCA 2BPCA 5EOZA 2M2UA 9ICEA 4PHDA 4AT9B 1BPZA 2M2VA 4QZEA 4DOBA 9ICQA 2ISPA 1ZQMA 4KLSA 4FHVA 5HREA 4I2HA 4KLFA 1ZQHA 4KLTA 4O5KA 4X4OA 4F5OA 1XSPA 4RT2A 1NOMA 1BPXA 5J0PA 5DB9A 2FMQA 5J0WA 9ICTA 5HRBA 8ICCA 1UEVA 5J2AA 1ZQFA 5IIKA 8ICVA 3C2MA 3OGUA 3WFOA 4EBKA 8ICTA 4X4VA 2FMPA 4I2GA 4QZGA 2M2WA 2NRKA 4PGQA 5J2FA 1ZQTA 4M5DA 4UAZA 5CHGA 3OV7A 1V4AA 5J0OA 9ICAA 8ICEA 7ICRA 4UB1A 4M2YA 4XQ8A 1RPLA 4LZDA 4X0BA 4KLDA 2PFQA 1MIVA 4YMOA 5CP2A 4QZHA 2DR8A 1TFYA 4QZAA 1HUZA 7ICOA 3AU6A 4P2HA 2PFOA 4RWPA 8ICQA 2BCSA 4R64A 4QZIA 2BCQA 4I2JA 2W9MA 1ZQVA 4GXIA 9ICHA 1Q78A 3JPRA 4RWOA 1ZQRA 5D49A 5HRKA 3K75D 5J0TA 5HRDA 4RWNA 1MQ3A 4IG8A 3UPSA 4RWQA 3UPQA 5J2JA 3WFPA 3L9DA 5DEDA 2ZH5A 2DVIA 4M47A 4Z6CA 4KLOA 2P66A 4RT3A 4RQ8A 4F5QA 5D4BA 7ICJA 3C2KA 1XSNA 4NLZA 4PHPA 3RJFA 4E8FA 4WBYA 3RH6A 1ZQWA 7ICIA 9ICJA 1ZQAA 1VJ7A 3V72A 4NY8A 4WC2A 4Z6FA 4EP7A 4WC5A 4RQ7A 3B0YA 2DRBA 1ZQZA 4S3NA 4QZFA 3HW8A 3TFRA 3AQKA 1MIYA 8ICBA 3H37A 4QZBA 2BCRA 3UXOA 1KDHA 4AT8B 5J0YA 4NLNA 9ICUA 4RPYA 1NO5A 4K4IA 4LT6A 3LQCB 1WOTA 4FO6A 1HUOA 4PHAA 3JPSA 8ICIA 4RQ1A 2BCUA 9ICFA 2ZH7A 4KLGA 3RJIA 4FHXA 4UB4A 7ICQA 5HC9A 7ICGA 1YLQA 8ICXA 3TFSA 4RQ0A 4JWNA 4YN4A 4QZ8A 1VFGA 4FHWA 3GDXA 4MFAA 1RZTA 4KLUA 1ZQQA 4YD1A 4O9MA 3RH5A 3OUYA 4PHEA 4M9JA 4O5EA 3OVBA 8ICYA 7ICUA 4XRHA 4I2FA 3MDAA 5CWRA 1BPYA 4KLEA 3RH4A 2BPFA 1ZQBA 4TUPA 5HRHA 5IINA 1ZQYA 1JN3A 1ZQUA 4PPXA 5HR9A 3RJGA 5J2CA 1BPBA 4NKTA 3RJKA 4F5NA 7ICFA 5DBAA 4GXKA 3HWTA 4NM2A 4IQVA 8ICSA 2ZH6A 9ICKA 1UETA 4KLQA 4PGYA 1Q79A 1FA0A 2HHPA 1ZQJA 4F5RA 3AQNA 4AT7B 7ICHA 3NYBA 3V7LA 1ZQPA 5IILA 5HHIA 4LVSA 4KLHA 1ZQEA 4WBZA 2IHMA 7ICNA 3C5GA 4ATBA 5IIIA 9ICMA 2DR5A 3AQMA 4I2AA 4AT9A 4E7XA 5BPCA 2ZH9A 3RJEA 7ICMA 7ICPA 5J2GA 3OVSA 4I2EA 1BPDA 8ICNA 4TUQA 9ICWA 2ZH2A 9ICOA 5J0UA 3RJHA 1OU5A 3ISCA 3C18A 4XUSA 2BCVA 4PH5A 4P4OA 3H39A 4WC3A 4YMNA 5TZVA 5HRGA 2DRAA 1F5AA 1R8CA 4Z6DA 4TURA 8ICHA 8ICAA 5IIOA 4M04A 2M2TA 2PFPA 4I2DA 1KNYA 3C5FA 1ZQSA 3B0XA 9ICPA 1ZJMA 3UXPA 7ICSA 4XQ7A 4RPXA 3JPNA 4M9GA 5HHHA 4RQ2A 3PNCA 2DR9A 1ZJNA 9ICLA 4IQUA 3MDCA 4PGXA 3ISBA 4ATBB 5DECA 4QZ9A 4JWMA 4UD4A 4O5CA 5CA7A 3MBYA 7ICKA 5CB1A 1R8AA 4I27A 4X4RA 3HJ4A 4P4PA 3RJJA 4GXJA 3OUYB 4K4GA 3JPOA 1ZQKA 4WC4A 4MFFA 5J2HA 1UEUA 1ZQDA 5DB7A 9ICRA 3JYYA 3AU2A 4UAYA 7ICLA 4X4TA 1JAJA 3OVAA 4WC0A 3JPQA 4I2CA 3JPTA 8ICLA 5J2IA 4X5VA 4IQWA 8ICMA 4I29A 8ICUA 2FMSA 2ISOA 1BPEA 1ZQXA 3HIYA 5DKWA 3WFRE 1JMSA 4RQ5A 5HRFA 2ZHBA 4MF2A 3HJ1A 2Q66A 1ZQCA 5J2EA 2RFFA 5J0QA 2GWSA 4AT7A 1MQ2A 8ICJA 7ICEA 4NKUA 1TV9A 5DBCA 3LK9A 5DB8A 4FH5A 4WCWA 4QZDA 4M0AA 4AT8A 4LZGA 9ICNA 1PX5A 4R63A 5HRLA 4MF8A 1TVAA 4NLKA 4UBBA 3MGIA 3ISDA 4RPZA 1MIWA 3MGHA 1TFWA 4YD2A 8ICGA 4X4NA 4MFCA 7ICVA 3UQ2A 4Z6EA 2BPGA 4RQ4A 3UXNA 4WC1A 5IIMA 3V7JA 1ZQOA 5J0RA 4I28A 4X4QA 4WC6A 9ICCA 4IQTA 2BE3A 3JPPA 4QZCA 4I2BA 4EBJA 5DBBA 5BOMA 1ZQNA 2O1PA 4FHPA 2ZH1A 4KLLA 2PFNA 4UBCA 4XA5A 9ICGA 4DOAA 4M9LA 5J2KA
chains in the Genus database with same CATH superfamily
4EGWA 5J2BA 9ICXA 5D46A 2ZHAA 5CHEA 3JZ0A 4R66A 4P4MA 3HX0A 5J29A 2ID1A 2O5AA 3PHZA 4NXZA 4E80A 4FHYA 4WC7A 3PMNA 4R65A 4YMMA 4NM1A 4X4PA 3C2LA 1ZQIA 4K4HA 8ICOA 4KLIA 1KEJA 4X4SA 2PXIA 5J2DA 3WFSC 2ZH3A 4DO9A 4UAWA 4M9NA 1XSLA 3ER8C 9ICSA 5F2VO 9ICIA 8ICFA 3AUOA 4FO1A 4I2IA 1JQRA 5HRIA 8ICWA 5IIJA 5DDMA 9ICVA 4LEYA 4FH3A 3WFQE 4UB3A 2ZH8A 4UD5A 2IHOA 7ICTA 4KLMA 5DB6A 9ICBA 1R8BA 4YCXA 1ZQLA 3H3AA 5J0SA 3PMLA 2VANA 1R89A 4O68A 2PBEA 5DDYA 3C66A 3H38A 4RQ3A 4TUSA 8ICZA 1ZQGA 4RQ6A 5BOLA 8ICPA 2ZH4A 5CR0A 5CJ7A 5J0XA 4KLJA 4UB2A 4M9HA 3AQLA 4X0AA 3NWIA 4F5PA 2FCLA 3UQ0A 3V7KA 4UB5A 8ICRA 4K98A 5B3PA 8ICKA 4X4UA 2I9GA 2DR7A 4DOCA 2BPCA 5EOZA 2M2UA 9ICEA 4PHDA 4AT9B 4EEBA 2M2VA 1BPZA 4QZEA 4DOBA 9ICQA 2ISPA 1ZQMA 4KLSA 4FHVA 2B56A 4K9AA 5HREA 4I2HA 4KLFA 1ZQHA 4KLTA 4O5KA 4X4OA 4F5OA 1XSPA 4RT2A 1NOMA 4O6AA 1BPXA 5J0PA 5DB9A 2FMQA 5J0WA 9ICTA 5HRBA 4NXTA 8ICCA 1UEVA 4O69A 5J2AA 1ZQFA 5IIKA 8ICVA 3C2MA 4KB6A 3OGUA 3WFOA 4NXXA 4EBKA 4K97A 8ICTA 4X4VA 2FMPA 4I2GA 4QZGA 2M2WA 2NRKA 4PGQA 4N7RA 5J2FA 1ZQTA 4M5DA 4UAZA 5CHGA 5D61A 3OV7A 1V4AA 5J0OA 9ICAA 8ICEA 7ICRA 4UB1A 4M2YA 4XQ8A 1RPLA 4LZDA 4X0BA 4KLDA 2PFQA 4I0UA 3EF2A 1MIVA 4YMOA 5CP2A 4QZHA 2DR8A 1TFYA 4QZAA 1HUZA 7ICOA 3AU6A 4P2HA 2PFOA 4RWPA 8ICQA 2BCSA 4R64A 4QZIA 2BCQA 4I2JA 2W9MA 1ZQVA 2HN1A 4GXIA 9ICHA 1Q78A 3JPRA 4RWOA 1ZQRA 5D49A 5HRKA 3K75D 5J0TA 5HRDA 4RWNA 1MQ3A 4IG8A 3UPSA 4RWQA 3UPQA 5J2JA 3WFPA 5CFTA 4K8VA 5B3QA 3L9DA 5DEDA 2ZH5A 2DVIA 4M47A 4Z6CA 4K96A 4KLOA 2P66A 4RT3A 4RQ8A 4F5QA 5D4BA 7ICJA 3C2KA 2HN2A 3CK6A 1XSNA 4NLZA 4PHPA 3RJFA 4EEDA 4E8FA 4WBYA 3RH6A 1ZQWA 7ICIA 9ICJA 1ZQAA 1VJ7A 3V72A 4NY8A 4WC2A 4OAHA 4Z6FA 4EP7A 4LEVA 4WC5A 4RQ7A 3B0YA 2DRBA 1ZQZA 4S3NA 4QZFA 3HW8A 3TFRA 3AQKA 1MIYA 5CFUA 8ICBA 3H37A 4QZBA 2BCRA 3UXOA 1KDHA 4AT8B 5J0YA 4NLNA 9ICUA 5CFSA 4RPYA 4NXUA 1NO5A 4K4IA 4LT6A 3LQCB 1WOTA 4FO6A 1HUOA 4PHAA 3JPSA 8ICIA 4RQ1A 2BCUA 9ICFA 2ZH7A 4KLGA 3RJIA 4FHXA 4UB4A 7ICQA 5HC9A 4K9BA 7ICGA 1YLQA 3MCRA 8ICXA 4JLXA 3TFSA 4JLZA 4RQ0A 4JWNA 4YN4A 4NXWA 4QZ8A 1VFGA 4FHWA 3GDXA 4MFAA 1RZTA 4KLUA 1ZQQA 4YD1A 4XJEA 4O9MA 3RH5A 3OUYA 4PHEA 4M9JA 4O67A 4O5EA 3OVBA 8ICYA 7ICUA 3NKUA 4XRHA 4I2FA 3MDAA 5CWRA 1BPYA 4KLEA 3K7DA 3RH4A 2BPFA 1ZQBA 4TUPA 5HRHA 5IINA 1ZQYA 1JN3A 1ZQUA 4PPXA 5HR9A 4WOYA 5J2CA 3RJGA 2GAFD 1BPBA 4NKTA 3RJKA 4F5NA 7ICFA 5DBAA 4GXKA 3HWTA 4NM2A 4WH5A 4IQVA 8ICSA 2ZH6A 9ICKA 1UETA 4KLQA 4PGYA 1Q79A 1FA0A 2HHPA 1ZQJA 4F5RA 3AQNA 4AT7B 7ICHA 3NYBA 3V7LA 1ZQPA 5IILA 5HHIA 4LVSA 4KLHA 1ZQEA 4WBZA 2GA9D 2IHMA 7ICNA 3C5GA 4MKPA 4ATBA 4OAIZ 2EWRA 5IIIA 9ICMA 2DR5A 3AQMA 4I2AA 4AT9A 4E7XA 5BPCA 4NXVA 2ZH9A 3RJEA 7ICMA 7ICPA 4WQKA 5J2GA 3OVSA 4I2EA 1BPDA 8ICNA 4TUQA 9ICWA 2ZH2A 9ICOA 4K99A 5J0UA 3RJHA 1OU5A 3ISCA 3C18A 5D63A 4OAFA 4XUSA 2BCVA 4PH5A 4P4OA 3H39A 4WC3A 4YMNA 5TZVA 5HRGA 2DRAA 1F5AA 1R8CA 4Z6DA 4TURA 8ICHA 8ICAA 5IIOA 4M04A 2M2TA 2PFPA 4I2DA 1KNYA 3C5FA 4KM5A 1ZQSA 3B0XA 9ICPA 1ZJMA 3UXPA 7ICSA 4XQ7A 4RPXA 3JPNA 4M9GA 5HHHA 2BBHA 4RQ2A 3PNCA 2DR9A 1ZJNA 9ICLA 4IQUA 3MDCA 4PGXA 1GPJA 3ISBA 4OAGA 5D62A 4ATBB 5DECA 4QZ9A 4JWMA 4LEWA 4UD4A 4O5CA 5CA7A 3MBYA 7ICKA 5CB1A 1R8AA 4I27A 4X4RA 3HJ4A 4P4PA 3RJJA 4GXJA 3OUYB 4K4GA 3JPOA 1ZQKA 4WC4A 4MFFA 5J2HA 1UEUA 1ZQDA 5DB7A 9ICRA 4LEZA 2IUBA 3JYYA 3AU2A 4UAYA 7ICLA 4X4TA 1JAJA 4WQLA 3OVAA 4HX0A 4WC0A 2B4VA 3JPQA 4I2CA 3JPTA 8ICLA 5J2IA 4X5VA 4IQWA 3ER9B 3OWGA 4I29A 8ICMA 8ICUA 2FMSA 2ISOA 3ERCC 1BPEA 1ZQXA 3HIYA 5DKWA 3WFRE 1JMSA 4RQ5A 5HRFA 2ZHBA 4MF2A 3HJ1A 2Q66A 1ZQCA 5J2EA 2RFFA 5J0QA 2GWSA 4AT7A 1MQ2A 8ICJA 7ICEA 4NKUA 1TV9A 5DBCA 3LK9A 5DB8A 4FH5A 4WCWA 4QZDA 4M0AA 2BBJA 4AT8A 4LZGA 9ICNA 4R63A 1PX5A 5HRLA 4MF8A 1TVAA 3NVOA 4NLKA 4UBBA 3MGIA 3ISDA 4RPZA 1MIWA 3MGHA 1TFWA 4EV6A 4YD2A 8ICGA 2B51A 4X4NA 4MFCA 7ICVA 3UQ2A 4Z6EA 2BPGA 4RQ4A 3UXNA 4WC1A 5IIMA 3V7JA 1ZQOA 5J0RA 5JTGA 4I28A 4X4QA 4WC6A 9ICCA 3JCFA 4IQTA 2BE3A 3JPPA 4QZCA 4I2BA 4EBJA 5DBBA 5BOMA 1ZQNA 2O1PA 4FHPA 2ZH1A 4KLLA 2PFNA 4UBCA 4XA5A 9ICGA 4DOAA 4M9LA 5J2KA
chains in the Genus database with same CATH topology
5J2BA 9ICXA 5D46A 2ZHAA 3JZ0A 4R66A 4P4MA 3HX0A 5J29A 2ID1A 2O5AA 4NXZA 3PMNA 4E80A 4FHYA 4WC7A 4R65A 4YMMA 4NM1A 4X4PA 3C2LA 1ZQIA 4K4HA 8ICOA 4KLIA 1KEJA 4X4SA 2PXIA 5J2DA 3WFSC 2ZH3A 4DO9A 4UAWA 4M9NA 1XSLA 9ICSA 9ICIA 5F2VO 8ICFA 3AUOA 4I2IA 1JQRA 5HRIA 8ICWA 5IIJA 5DDMA 9ICVA 4FH3A 3WFQE 4UB3A 2ZH8A 4UD5A 7ICTA 4KLMA 5DB6A 9ICBA 1R8BA 4YCXA 1ZQLA 3H3AA 5J0SA 3PMLA 2VANA 1R89A 4RQ3A 2PBEA 5DDYA 3C66A 3H38A 4TUSA 8ICZA 1ZQGA 5BOLA 4RQ6A 8ICPA 2ZH4A 5CR0A 5CJ7A 5J0XA 4KLJA 4UB2A 4M9HA 3AQLA 4X0AA 4F5PA 3UQ0A 3V7KA 4UB5A 8ICRA 8ICKA 4X4UA 2I9GA 2DR7A 4DOCA 2BPCA 5EOZA 2M2UA 9ICEA 4PHDA 4AT9B 1BPZA 2M2VA 4QZEA 4DOBA 9ICQA 2ISPA 1ZQMA 4KLSA 4FHVA 5HREA 4I2HA 4KLFA 1ZQHA 4KLTA 4O5KA 4X4OA 4F5OA 1XSPA 4RT2A 1NOMA 1BPXA 5J0PA 5DB9A 2FMQA 5J0WA 9ICTA 5HRBA 8ICCA 1UEVA 5J2AA 1ZQFA 5IIKA 8ICVA 3C2MA 3OGUA 3WFOA 4EBKA 8ICTA 4X4VA 2FMPA 4I2GA 4QZGA 2M2WA 2NRKA 4PGQA 5J2FA 1ZQTA 4M5DA 4UAZA 5CHGA 3OV7A 1V4AA 5J0OA 9ICAA 8ICEA 7ICRA 4UB1A 4M2YA 4XQ8A 1RPLA 4LZDA 4X0BA 4KLDA 2PFQA 1MIVA 4YMOA 5CP2A 4QZHA 2DR8A 1TFYA 4QZAA 1HUZA 7ICOA 3AU6A 4P2HA 2PFOA 4RWPA 8ICQA 2BCSA 4R64A 4QZIA 2BCQA 4I2JA 2W9MA 1ZQVA 4GXIA 9ICHA 1Q78A 3JPRA 4RWOA 1ZQRA 5D49A 5HRKA 3K75D 5J0TA 5HRDA 4RWNA 1MQ3A 4IG8A 3UPSA 4RWQA 3UPQA 5J2JA 3WFPA 3L9DA 5DEDA 2ZH5A 2DVIA 4M47A 4Z6CA 4KLOA 2P66A 4RT3A 4RQ8A 4F5QA 5D4BA 7ICJA 3C2KA 1XSNA 4NLZA 4PHPA 3RJFA 4E8FA 4WBYA 3RH6A 1ZQWA 7ICIA 9ICJA 1ZQAA 1VJ7A 3V72A 4NY8A 4WC2A 4Z6FA 4EP7A 4WC5A 4RQ7A 3B0YA 2DRBA 1ZQZA 4S3NA 4QZFA 3HW8A 3TFRA 3AQKA 1MIYA 8ICBA 3H37A 4QZBA 2BCRA 3UXOA 1KDHA 4AT8B 5J0YA 4NLNA 9ICUA 4RPYA 1NO5A 4K4IA 4LT6A 3LQCB 1WOTA 4FO6A 1HUOA 4PHAA 3JPSA 8ICIA 4RQ1A 2BCUA 9ICFA 2ZH7A 4KLGA 3RJIA 4FHXA 4UB4A 7ICQA 5HC9A 7ICGA 1YLQA 8ICXA 3TFSA 4RQ0A 4JWNA 4YN4A 4QZ8A 1VFGA 4FHWA 3GDXA 4MFAA 1RZTA 4KLUA 1ZQQA 4YD1A 4O9MA 3RH5A 3OUYA 4PHEA 4M9JA 4O5EA 3OVBA 8ICYA 7ICUA 4XRHA 4I2FA 3MDAA 5CWRA 1BPYA 4KLEA 3RH4A 2BPFA 1ZQBA 4TUPA 5HRHA 5IINA 1ZQYA 1JN3A 1ZQUA 4PPXA 5HR9A 3RJGA 5J2CA 1BPBA 4NKTA 3RJKA 4F5NA 7ICFA 5DBAA 4GXKA 3HWTA 4NM2A 4IQVA 8ICSA 2ZH6A 9ICKA 1UETA 4KLQA 4PGYA 1Q79A 1FA0A 2HHPA 1ZQJA 4F5RA 3AQNA 4AT7B 7ICHA 3NYBA 3V7LA 1ZQPA 5IILA 5HHIA 4LVSA 4KLHA 1ZQEA 4WBZA 2IHMA 7ICNA 3C5GA 4ATBA 5IIIA 9ICMA 2DR5A 3AQMA 4I2AA 4AT9A 4E7XA 5BPCA 2ZH9A 3RJEA 7ICMA 7ICPA 5J2GA 3OVSA 4I2EA 1BPDA 8ICNA 4TUQA 9ICWA 2ZH2A 9ICOA 5J0UA 3RJHA 1OU5A 3ISCA 3C18A 4XUSA 2BCVA 4PH5A 4P4OA 3H39A 4WC3A 4YMNA 5TZVA 5HRGA 2DRAA 1F5AA 1R8CA 4Z6DA 4TURA 8ICHA 8ICAA 5IIOA 4M04A 2M2TA 2PFPA 4I2DA 1KNYA 3C5FA 1ZQSA 3B0XA 9ICPA 1ZJMA 3UXPA 7ICSA 4XQ7A 4RPXA 3JPNA 4M9GA 5HHHA 4RQ2A 3PNCA 2DR9A 1ZJNA 9ICLA 4IQUA 3MDCA 4PGXA 3ISBA 4ATBB 5DECA 4QZ9A 4JWMA 4UD4A 4O5CA 5CA7A 3MBYA 7ICKA 5CB1A 1R8AA 4I27A 4X4RA 3HJ4A 4P4PA 3RJJA 4GXJA 3OUYB 4K4GA 3JPOA 1ZQKA 4WC4A 4MFFA 5J2HA 1UEUA 1ZQDA 5DB7A 9ICRA 3JYYA 3AU2A 4UAYA 7ICLA 4X4TA 1JAJA 3OVAA 4WC0A 3JPQA 4I2CA 3JPTA 8ICLA 5J2IA 4X5VA 4IQWA 8ICMA 4I29A 8ICUA 2FMSA 2ISOA 1BPEA 1ZQXA 3HIYA 5DKWA 3WFRE 1JMSA 4RQ5A 5HRFA 2ZHBA 4MF2A 3HJ1A 2Q66A 1ZQCA 5J2EA 2RFFA 5J0QA 2GWSA 4AT7A 1MQ2A 8ICJA 7ICEA 4NKUA 1TV9A 5DBCA 3LK9A 5DB8A 4FH5A 4WCWA 4QZDA 4M0AA 4AT8A 4LZGA 9ICNA 1PX5A 4R63A 5HRLA 4MF8A 1TVAA 4NLKA 4UBBA 3MGIA 3ISDA 4RPZA 1MIWA 3MGHA 1TFWA 4YD2A 8ICGA 4X4NA 4MFCA 7ICVA 3UQ2A 4Z6EA 2BPGA 4RQ4A 3UXNA 4WC1A 5IIMA 3V7JA 1ZQOA 5J0RA 4I28A 4X4QA 4WC6A 9ICCA 4IQTA 2BE3A 3JPPA 4QZCA 4I2BA 4EBJA 5DBBA 5BOMA 1ZQNA 2O1PA 4FHPA 2ZH1A 4KLLA 2PFNA 4UBCA 4XA5A 9ICGA 4DOAA 4M9LA 5J2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2B A;  9ICX A;  5D46 A;  2ZHA A;  3JZ0 A;  4R66 A;  4P4M A;  3HX0 A;  5J29 A;  2ID1 A;  2O5A A;  4NXZ A;  3PMN A;  4E80 A;  4FHY A;  4WC7 A;  4R65 A;  4YMM A;  4NM1 A;  4X4P A;  3C2L A;  1ZQI A;  4K4H A;  8ICO A;  4KLI A;  1KEJ A;  4X4S A;  2PXI A;  5J2D A;  3WFS C;  2ZH3 A;  4DO9 A;  4UAW A;  4M9N A;  1XSL A;  9ICS A;  9ICI A;  5F2V O;  8ICF A;  3AUO A;  4I2I A;  1JQR A;  5HRI A;  8ICW A;  5IIJ A;  5DDM A;  9ICV A;  4FH3 A;  3WFQ E;  4UB3 A;  2ZH8 A;  4UD5 A;  7ICT A;  4KLM A;  5DB6 A;  9ICB A;  1R8B A;  4YCX A;  1ZQL A;  3H3A A;  5J0S A;  3PML A;  2VAN A;  1R89 A;  4RQ3 A;  2PBE A;  5DDY A;  3C66 A;  3H38 A;  4TUS A;  8ICZ A;  1ZQG A;  5BOL A;  4RQ6 A;  8ICP A;  2ZH4 A;  5CR0 A;  5CJ7 A;  5J0X A;  4KLJ A;  4UB2 A;  4M9H A;  3AQL A;  4X0A A;  4F5P A;  3UQ0 A;  3V7K A;  4UB5 A;  8ICR A;  8ICK A;  4X4U A;  2I9G A;  2DR7 A;  4DOC A;  2BPC A;  5EOZ A;  2M2U A;  9ICE A;  4PHD A;  4AT9 B;  1BPZ A;  2M2V A;  4QZE A;  4DOB A;  9ICQ A;  2ISP A;  1ZQM A;  4KLS A;  4FHV A;  5HRE A;  4I2H A;  4KLF A;  1ZQH A;  4KLT A;  4O5K A;  4X4O A;  4F5O A;  1XSP A;  4RT2 A;  1NOM A;  1BPX A;  5J0P A;  5DB9 A;  2FMQ A;  5J0W A;  9ICT A;  5HRB A;  8ICC A;  1UEV A;  5J2A A;  1ZQF A;  5IIK A;  8ICV A;  3C2M A;  3OGU A;  3WFO A;  4EBK A;  8ICT A;  4X4V A;  2FMP A;  4I2G A;  4QZG A;  2M2W A;  2NRK A;  4PGQ A;  5J2F A;  1ZQT A;  4M5D A;  4UAZ A;  5CHG A;  3OV7 A;  1V4A A;  5J0O A;  9ICA A;  8ICE A;  7ICR A;  4UB1 A;  4M2Y A;  4XQ8 A;  1RPL A;  4LZD A;  4X0B A;  4KLD A;  2PFQ A;  1MIV A;  4YMO A;  5CP2 A;  4QZH A;  2DR8 A;  1TFY A;  4QZA A;  1HUZ A;  7ICO A;  3AU6 A;  4P2H A;  2PFO A;  4RWP A;  8ICQ A;  2BCS A;  4R64 A;  4QZI A;  2BCQ A;  4I2J A;  2W9M A;  1ZQV A;  4GXI A;  9ICH A;  1Q78 A;  3JPR A;  4RWO A;  1ZQR A;  5D49 A;  5HRK A;  3K75 D;  5J0T A;  5HRD A;  4RWN A;  1MQ3 A;  4IG8 A;  3UPS A;  4RWQ A;  3UPQ A;  5J2J A;  3WFP A;  3L9D A;  5DED A;  2ZH5 A;  2DVI A;  4M47 A;  4Z6C A;  4KLO A;  2P66 A;  4RT3 A;  4RQ8 A;  4F5Q A;  5D4B A;  7ICJ A;  3C2K A;  1XSN A;  4NLZ A;  4PHP A;  3RJF A;  4E8F A;  4WBY A;  3RH6 A;  1ZQW A;  7ICI A;  9ICJ A;  1ZQA A;  1VJ7 A;  3V72 A;  4NY8 A;  4WC2 A;  4Z6F A;  4EP7 A;  4WC5 A;  4RQ7 A;  3B0Y A;  2DRB A;  1ZQZ A;  4S3N A;  4QZF A;  3HW8 A;  3TFR A;  3AQK A;  1MIY A;  8ICB A;  3H37 A;  4QZB A;  2BCR A;  3UXO A;  1KDH A;  4AT8 B;  5J0Y A;  4NLN A;  9ICU A;  4RPY A;  1NO5 A;  4K4I A;  4LT6 A;  3LQC B;  1WOT A;  4FO6 A;  1HUO A;  4PHA A;  3JPS A;  8ICI A;  4RQ1 A;  2BCU A;  9ICF A;  2ZH7 A;  4KLG A;  3RJI A;  4FHX A;  4UB4 A;  7ICQ A;  5HC9 A;  7ICG A;  1YLQ A;  8ICX A;  3TFS A;  4RQ0 A;  4JWN A;  4YN4 A;  4QZ8 A;  1VFG A;  4FHW A;  3GDX A;  4MFA A;  1RZT A;  4KLU A;  1ZQQ A;  4YD1 A;  4O9M A;  3RH5 A;  3OUY A;  4PHE A;  4M9J A;  4O5E A;  3OVB A;  8ICY A;  7ICU A;  4XRH A;  4I2F A;  3MDA A;  5CWR A;  1BPY A;  4KLE A;  3RH4 A;  2BPF A;  1ZQB A;  4TUP A;  5HRH A;  5IIN A;  1ZQY A;  1JN3 A;  1ZQU A;  4PPX A;  5HR9 A;  3RJG A;  5J2C A;  1BPB A;  4NKT A;  3RJK A;  4F5N A;  7ICF A;  5DBA A;  4GXK A;  3HWT A;  4NM2 A;  4IQV A;  8ICS A;  2ZH6 A;  9ICK A;  1UET A;  4KLQ A;  4PGY A;  1Q79 A;  1FA0 A;  2HHP A;  1ZQJ A;  4F5R A;  3AQN A;  4AT7 B;  7ICH A;  3NYB A;  3V7L A;  1ZQP A;  5IIL A;  5HHI A;  4LVS A;  4KLH A;  1ZQE A;  4WBZ A;  2IHM A;  7ICN A;  3C5G A;  4ATB A;  5III A;  9ICM A;  2DR5 A;  3AQM A;  4I2A A;  4AT9 A;  4E7X A;  5BPC A;  2ZH9 A;  3RJE A;  7ICM A;  7ICP A;  5J2G A;  3OVS A;  4I2E A;  1BPD A;  8ICN A;  4TUQ A;  9ICW A;  2ZH2 A;  9ICO A;  5J0U A;  3RJH A;  1OU5 A;  3ISC A;  3C18 A;  4XUS A;  2BCV A;  4PH5 A;  4P4O A;  3H39 A;  4WC3 A;  4YMN A;  5TZV A;  5HRG A;  2DRA A;  1F5A A;  1R8C A;  4Z6D A;  4TUR A;  8ICH A;  8ICA A;  5IIO A;  4M04 A;  2M2T A;  2PFP A;  4I2D A;  1KNY A;  3C5F A;  1ZQS A;  3B0X A;  9ICP A;  1ZJM A;  3UXP A;  7ICS A;  4XQ7 A;  4RPX A;  3JPN A;  4M9G A;  5HHH A;  4RQ2 A;  3PNC A;  2DR9 A;  1ZJN A;  9ICL A;  4IQU A;  3MDC A;  4PGX A;  3ISB A;  4ATB B;  5DEC A;  4QZ9 A;  4JWM A;  4UD4 A;  4O5C A;  5CA7 A;  3MBY A;  7ICK A;  5CB1 A;  1R8A A;  4I27 A;  4X4R A;  3HJ4 A;  4P4P A;  3RJJ A;  4GXJ A;  3OUY B;  4K4G A;  3JPO A;  1ZQK A;  4WC4 A;  4MFF A;  5J2H A;  1UEU A;  1ZQD A;  5DB7 A;  9ICR A;  3JYY A;  3AU2 A;  4UAY A;  7ICL A;  4X4T A;  1JAJ A;  3OVA A;  4WC0 A;  3JPQ A;  4I2C A;  3JPT A;  8ICL A;  5J2I A;  4X5V A;  4IQW A;  8ICM A;  4I29 A;  8ICU A;  2FMS A;  2ISO A;  1BPE A;  1ZQX A;  3HIY A;  5DKW A;  3WFR E;  1JMS A;  4RQ5 A;  5HRF A;  2ZHB A;  4MF2 A;  3HJ1 A;  2Q66 A;  1ZQC A;  5J2E A;  2RFF A;  5J0Q A;  2GWS A;  4AT7 A;  1MQ2 A;  8ICJ A;  7ICE A;  4NKU A;  1TV9 A;  5DBC A;  3LK9 A;  5DB8 A;  4FH5 A;  4WCW A;  4QZD A;  4M0A A;  4AT8 A;  4LZG A;  9ICN A;  1PX5 A;  4R63 A;  5HRL A;  4MF8 A;  1TVA A;  4NLK A;  4UBB A;  3MGI A;  3ISD A;  4RPZ A;  1MIW A;  3MGH A;  1TFW A;  4YD2 A;  8ICG A;  4X4N A;  4MFC A;  7ICV A;  3UQ2 A;  4Z6E A;  2BPG A;  4RQ4 A;  3UXN A;  4WC1 A;  5IIM A;  3V7J A;  1ZQO A;  5J0R A;  4I28 A;  4X4Q A;  4WC6 A;  9ICC A;  4IQT A;  2BE3 A;  3JPP A;  4QZC A;  4I2B A;  4EBJ A;  5DBB A;  5BOM A;  1ZQN A;  2O1P A;  4FHP A;  2ZH1 A;  4KLL A;  2PFN A;  4UBC A;  4XA5 A;  9ICG A;  4DOA A;  4M9L A;  5J2K A; 
#chains in the Genus database with same CATH topology
 4EGW A;  5J2B A;  9ICX A;  5D46 A;  2ZHA A;  5CHE A;  3JZ0 A;  4R66 A;  4P4M A;  3HX0 A;  5J29 A;  2ID1 A;  2O5A A;  3PHZ A;  4NXZ A;  4E80 A;  4FHY A;  4WC7 A;  3PMN A;  4R65 A;  4YMM A;  4NM1 A;  4X4P A;  3C2L A;  1ZQI A;  4K4H A;  8ICO A;  4KLI A;  1KEJ A;  4X4S A;  2PXI A;  5J2D A;  3WFS C;  2ZH3 A;  4DO9 A;  4UAW A;  4M9N A;  1XSL A;  3ER8 C;  9ICS A;  5F2V O;  9ICI A;  8ICF A;  3AUO A;  4FO1 A;  4I2I A;  1JQR A;  5HRI A;  8ICW A;  5IIJ A;  5DDM A;  9ICV A;  4LEY A;  4FH3 A;  3WFQ E;  4UB3 A;  2ZH8 A;  4UD5 A;  2IHO A;  7ICT A;  4KLM A;  5DB6 A;  9ICB A;  1R8B A;  4YCX A;  1ZQL A;  3H3A A;  5J0S A;  3PML A;  2VAN A;  1R89 A;  4O68 A;  2PBE A;  5DDY A;  3C66 A;  3H38 A;  4RQ3 A;  4TUS A;  8ICZ A;  1ZQG A;  4RQ6 A;  5BOL A;  8ICP A;  2ZH4 A;  5CR0 A;  5CJ7 A;  5J0X A;  4KLJ A;  4UB2 A;  4M9H A;  3AQL A;  4X0A A;  3NWI A;  4F5P A;  2FCL A;  3UQ0 A;  3V7K A;  4UB5 A;  8ICR A;  4K98 A;  5B3P A;  8ICK A;  4X4U A;  2I9G A;  2DR7 A;  4DOC A;  2BPC A;  5EOZ A;  2M2U A;  9ICE A;  4PHD A;  4AT9 B;  4EEB A;  2M2V A;  1BPZ A;  4QZE A;  4DOB A;  9ICQ A;  2ISP A;  1ZQM A;  4KLS A;  4FHV A;  2B56 A;  4K9A A;  5HRE A;  4I2H A;  4KLF A;  1ZQH A;  4KLT A;  4O5K A;  4X4O A;  4F5O A;  1XSP A;  4RT2 A;  1NOM A;  4O6A A;  1BPX A;  5J0P A;  5DB9 A;  2FMQ A;  5J0W A;  9ICT A;  5HRB A;  4NXT A;  8ICC A;  1UEV A;  4O69 A;  5J2A A;  1ZQF A;  5IIK A;  8ICV A;  3C2M A;  4KB6 A;  3OGU A;  3WFO A;  4NXX A;  4EBK A;  4K97 A;  8ICT A;  4X4V A;  2FMP A;  4I2G A;  4QZG A;  2M2W A;  2NRK A;  4PGQ A;  4N7R A;  5J2F A;  1ZQT A;  4M5D A;  4UAZ A;  5CHG A;  5D61 A;  3OV7 A;  1V4A A;  5J0O A;  9ICA A;  8ICE A;  7ICR A;  4UB1 A;  4M2Y A;  4XQ8 A;  1RPL A;  4LZD A;  4X0B A;  4KLD A;  2PFQ A;  4I0U A;  3EF2 A;  1MIV A;  4YMO A;  5CP2 A;  4QZH A;  2DR8 A;  1TFY A;  4QZA A;  1HUZ A;  7ICO A;  3AU6 A;  4P2H A;  2PFO A;  4RWP A;  8ICQ A;  2BCS A;  4R64 A;  4QZI A;  2BCQ A;  4I2J A;  2W9M A;  1ZQV A;  2HN1 A;  4GXI A;  9ICH A;  1Q78 A;  3JPR A;  4RWO A;  1ZQR A;  5D49 A;  5HRK A;  3K75 D;  5J0T A;  5HRD A;  4RWN A;  1MQ3 A;  4IG8 A;  3UPS A;  4RWQ A;  3UPQ A;  5J2J A;  3WFP A;  5CFT A;  4K8V A;  5B3Q A;  3L9D A;  5DED A;  2ZH5 A;  2DVI A;  4M47 A;  4Z6C A;  4K96 A;  4KLO A;  2P66 A;  4RT3 A;  4RQ8 A;  4F5Q A;  5D4B A;  7ICJ A;  3C2K A;  2HN2 A;  3CK6 A;  1XSN A;  4NLZ A;  4PHP A;  3RJF A;  4EED A;  4E8F A;  4WBY A;  3RH6 A;  1ZQW A;  7ICI A;  9ICJ A;  1ZQA A;  1VJ7 A;  3V72 A;  4NY8 A;  4WC2 A;  4OAH A;  4Z6F A;  4EP7 A;  4LEV A;  4WC5 A;  4RQ7 A;  3B0Y A;  2DRB A;  1ZQZ A;  4S3N A;  4QZF A;  3HW8 A;  3TFR A;  3AQK A;  1MIY A;  5CFU A;  8ICB A;  3H37 A;  4QZB A;  2BCR A;  3UXO A;  1KDH A;  4AT8 B;  5J0Y A;  4NLN A;  9ICU A;  5CFS A;  4RPY A;  4NXU A;  1NO5 A;  4K4I A;  4LT6 A;  3LQC B;  1WOT A;  4FO6 A;  1HUO A;  4PHA A;  3JPS A;  8ICI A;  4RQ1 A;  2BCU A;  9ICF A;  2ZH7 A;  4KLG A;  3RJI A;  4FHX A;  4UB4 A;  7ICQ A;  5HC9 A;  4K9B A;  7ICG A;  1YLQ A;  3MCR A;  8ICX A;  4JLX A;  3TFS A;  4JLZ A;  4RQ0 A;  4JWN A;  4YN4 A;  4NXW A;  4QZ8 A;  1VFG A;  4FHW A;  3GDX A;  4MFA A;  1RZT A;  4KLU A;  1ZQQ A;  4YD1 A;  4XJE A;  4O9M A;  3RH5 A;  3OUY A;  4PHE A;  4M9J A;  4O67 A;  4O5E A;  3OVB A;  8ICY A;  7ICU A;  3NKU A;  4XRH A;  4I2F A;  3MDA A;  5CWR A;  1BPY A;  4KLE A;  3K7D A;  3RH4 A;  2BPF A;  1ZQB A;  4TUP A;  5HRH A;  5IIN A;  1ZQY A;  1JN3 A;  1ZQU A;  4PPX A;  5HR9 A;  4WOY A;  5J2C A;  3RJG A;  2GAF D;  1BPB A;  4NKT A;  3RJK A;  4F5N A;  7ICF A;  5DBA A;  4GXK A;  3HWT A;  4NM2 A;  4WH5 A;  4IQV A;  8ICS A;  2ZH6 A;  9ICK A;  1UET A;  4KLQ A;  4PGY A;  1Q79 A;  1FA0 A;  2HHP A;  1ZQJ A;  4F5R A;  3AQN A;  4AT7 B;  7ICH A;  3NYB A;  3V7L A;  1ZQP A;  5IIL A;  5HHI A;  4LVS A;  4KLH A;  1ZQE A;  4WBZ A;  2GA9 D;  2IHM A;  7ICN A;  3C5G A;  4MKP A;  4ATB A;  4OAI Z;  2EWR A;  5III A;  9ICM A;  2DR5 A;  3AQM A;  4I2A A;  4AT9 A;  4E7X A;  5BPC A;  4NXV A;  2ZH9 A;  3RJE A;  7ICM A;  7ICP A;  4WQK A;  5J2G A;  3OVS A;  4I2E A;  1BPD A;  8ICN A;  4TUQ A;  9ICW A;  2ZH2 A;  9ICO A;  4K99 A;  5J0U A;  3RJH A;  1OU5 A;  3ISC A;  3C18 A;  5D63 A;  4OAF A;  4XUS A;  2BCV A;  4PH5 A;  4P4O A;  3H39 A;  4WC3 A;  4YMN A;  5TZV A;  5HRG A;  2DRA A;  1F5A A;  1R8C A;  4Z6D A;  4TUR A;  8ICH A;  8ICA A;  5IIO A;  4M04 A;  2M2T A;  2PFP A;  4I2D A;  1KNY A;  3C5F A;  4KM5 A;  1ZQS A;  3B0X A;  9ICP A;  1ZJM A;  3UXP A;  7ICS A;  4XQ7 A;  4RPX A;  3JPN A;  4M9G A;  5HHH A;  2BBH A;  4RQ2 A;  3PNC A;  2DR9 A;  1ZJN A;  9ICL A;  4IQU A;  3MDC A;  4PGX A;  1GPJ A;  3ISB A;  4OAG A;  5D62 A;  4ATB B;  5DEC A;  4QZ9 A;  4JWM A;  4LEW A;  4UD4 A;  4O5C A;  5CA7 A;  3MBY A;  7ICK A;  5CB1 A;  1R8A A;  4I27 A;  4X4R A;  3HJ4 A;  4P4P A;  3RJJ A;  4GXJ A;  3OUY B;  4K4G A;  3JPO A;  1ZQK A;  4WC4 A;  4MFF A;  5J2H A;  1UEU A;  1ZQD A;  5DB7 A;  9ICR A;  4LEZ A;  2IUB A;  3JYY A;  3AU2 A;  4UAY A;  7ICL A;  4X4T A;  1JAJ A;  4WQL A;  3OVA A;  4HX0 A;  4WC0 A;  2B4V A;  3JPQ A;  4I2C A;  3JPT A;  8ICL A;  5J2I A;  4X5V A;  4IQW A;  3ER9 B;  3OWG A;  4I29 A;  8ICM A;  8ICU A;  2FMS A;  2ISO A;  3ERC C;  1BPE A;  1ZQX A;  3HIY A;  5DKW A;  3WFR E;  1JMS A;  4RQ5 A;  5HRF A;  2ZHB A;  4MF2 A;  3HJ1 A;  2Q66 A;  1ZQC A;  5J2E A;  2RFF A;  5J0Q A;  2GWS A;  4AT7 A;  1MQ2 A;  8ICJ A;  7ICE A;  4NKU A;  1TV9 A;  5DBC A;  3LK9 A;  5DB8 A;  4FH5 A;  4WCW A;  4QZD A;  4M0A A;  2BBJ A;  4AT8 A;  4LZG A;  9ICN A;  4R63 A;  1PX5 A;  5HRL A;  4MF8 A;  1TVA A;  3NVO A;  4NLK A;  4UBB A;  3MGI A;  3ISD A;  4RPZ A;  1MIW A;  3MGH A;  1TFW A;  4EV6 A;  4YD2 A;  8ICG A;  2B51 A;  4X4N A;  4MFC A;  7ICV A;  3UQ2 A;  4Z6E A;  2BPG A;  4RQ4 A;  3UXN A;  4WC1 A;  5IIM A;  3V7J A;  1ZQO A;  5J0R A;  5JTG A;  4I28 A;  4X4Q A;  4WC6 A;  9ICC A;  3JCF A;  4IQT A;  2BE3 A;  3JPP A;  4QZC A;  4I2B A;  4EBJ A;  5DBB A;  5BOM A;  1ZQN A;  2O1P A;  4FHP A;  2ZH1 A;  4KLL A;  2PFN A;  4UBC A;  4XA5 A;  9ICG A;  4DOA A;  4M9L A;  5J2K A; 
#chains in the Genus database with same CATH homology
 5J2B A;  9ICX A;  5D46 A;  2ZHA A;  3JZ0 A;  4R66 A;  4P4M A;  3HX0 A;  5J29 A;  2ID1 A;  2O5A A;  4NXZ A;  3PMN A;  4E80 A;  4FHY A;  4WC7 A;  4R65 A;  4YMM A;  4NM1 A;  4X4P A;  3C2L A;  1ZQI A;  4K4H A;  8ICO A;  4KLI A;  1KEJ A;  4X4S A;  2PXI A;  5J2D A;  3WFS C;  2ZH3 A;  4DO9 A;  4UAW A;  4M9N A;  1XSL A;  9ICS A;  9ICI A;  5F2V O;  8ICF A;  3AUO A;  4I2I A;  1JQR A;  5HRI A;  8ICW A;  5IIJ A;  5DDM A;  9ICV A;  4FH3 A;  3WFQ E;  4UB3 A;  2ZH8 A;  4UD5 A;  7ICT A;  4KLM A;  5DB6 A;  9ICB A;  1R8B A;  4YCX A;  1ZQL A;  3H3A A;  5J0S A;  3PML A;  2VAN A;  1R89 A;  4RQ3 A;  2PBE A;  5DDY A;  3C66 A;  3H38 A;  4TUS A;  8ICZ A;  1ZQG A;  5BOL A;  4RQ6 A;  8ICP A;  2ZH4 A;  5CR0 A;  5CJ7 A;  5J0X A;  4KLJ A;  4UB2 A;  4M9H A;  3AQL A;  4X0A A;  4F5P A;  3UQ0 A;  3V7K A;  4UB5 A;  8ICR A;  8ICK A;  4X4U A;  2I9G A;  2DR7 A;  4DOC A;  2BPC A;  5EOZ A;  2M2U A;  9ICE A;  4PHD A;  4AT9 B;  1BPZ A;  2M2V A;  4QZE A;  4DOB A;  9ICQ A;  2ISP A;  1ZQM A;  4KLS A;  4FHV A;  5HRE A;  4I2H A;  4KLF A;  1ZQH A;  4KLT A;  4O5K A;  4X4O A;  4F5O A;  1XSP A;  4RT2 A;  1NOM A;  1BPX A;  5J0P A;  5DB9 A;  2FMQ A;  5J0W A;  9ICT A;  5HRB A;  8ICC A;  1UEV A;  5J2A A;  1ZQF A;  5IIK A;  8ICV A;  3C2M A;  3OGU A;  3WFO A;  4EBK A;  8ICT A;  4X4V A;  2FMP A;  4I2G A;  4QZG A;  2M2W A;  2NRK A;  4PGQ A;  5J2F A;  1ZQT A;  4M5D A;  4UAZ A;  5CHG A;  3OV7 A;  1V4A A;  5J0O A;  9ICA A;  8ICE A;  7ICR A;  4UB1 A;  4M2Y A;  4XQ8 A;  1RPL A;  4LZD A;  4X0B A;  4KLD A;  2PFQ A;  1MIV A;  4YMO A;  5CP2 A;  4QZH A;  2DR8 A;  1TFY A;  4QZA A;  1HUZ A;  7ICO A;  3AU6 A;  4P2H A;  2PFO A;  4RWP A;  8ICQ A;  2BCS A;  4R64 A;  4QZI A;  2BCQ A;  4I2J A;  2W9M A;  1ZQV A;  4GXI A;  9ICH A;  1Q78 A;  3JPR A;  4RWO A;  1ZQR A;  5D49 A;  5HRK A;  3K75 D;  5J0T A;  5HRD A;  4RWN A;  1MQ3 A;  4IG8 A;  3UPS A;  4RWQ A;  3UPQ A;  5J2J A;  3WFP A;  3L9D A;  5DED A;  2ZH5 A;  2DVI A;  4M47 A;  4Z6C A;  4KLO A;  2P66 A;  4RT3 A;  4RQ8 A;  4F5Q A;  5D4B A;  7ICJ A;  3C2K A;  1XSN A;  4NLZ A;  4PHP A;  3RJF A;  4E8F A;  4WBY A;  3RH6 A;  1ZQW A;  7ICI A;  9ICJ A;  1ZQA A;  1VJ7 A;  3V72 A;  4NY8 A;  4WC2 A;  4Z6F A;  4EP7 A;  4WC5 A;  4RQ7 A;  3B0Y A;  2DRB A;  1ZQZ A;  4S3N A;  4QZF A;  3HW8 A;  3TFR A;  3AQK A;  1MIY A;  8ICB A;  3H37 A;  4QZB A;  2BCR A;  3UXO A;  1KDH A;  4AT8 B;  5J0Y A;  4NLN A;  9ICU A;  4RPY A;  1NO5 A;  4K4I A;  4LT6 A;  3LQC B;  1WOT A;  4FO6 A;  1HUO A;  4PHA A;  3JPS A;  8ICI A;  4RQ1 A;  2BCU A;  9ICF A;  2ZH7 A;  4KLG A;  3RJI A;  4FHX A;  4UB4 A;  7ICQ A;  5HC9 A;  7ICG A;  1YLQ A;  8ICX A;  3TFS A;  4RQ0 A;  4JWN A;  4YN4 A;  4QZ8 A;  1VFG A;  4FHW A;  3GDX A;  4MFA A;  1RZT A;  4KLU A;  1ZQQ A;  4YD1 A;  4O9M A;  3RH5 A;  3OUY A;  4PHE A;  4M9J A;  4O5E A;  3OVB A;  8ICY A;  7ICU A;  4XRH A;  4I2F A;  3MDA A;  5CWR A;  1BPY A;  4KLE A;  3RH4 A;  2BPF A;  1ZQB A;  4TUP A;  5HRH A;  5IIN A;  1ZQY A;  1JN3 A;  1ZQU A;  4PPX A;  5HR9 A;  3RJG A;  5J2C A;  1BPB A;  4NKT A;  3RJK A;  4F5N A;  7ICF A;  5DBA A;  4GXK A;  3HWT A;  4NM2 A;  4IQV A;  8ICS A;  2ZH6 A;  9ICK A;  1UET A;  4KLQ A;  4PGY A;  1Q79 A;  1FA0 A;  2HHP A;  1ZQJ A;  4F5R A;  3AQN A;  4AT7 B;  7ICH A;  3NYB A;  3V7L A;  1ZQP A;  5IIL A;  5HHI A;  4LVS A;  4KLH A;  1ZQE A;  4WBZ A;  2IHM A;  7ICN A;  3C5G A;  4ATB A;  5III A;  9ICM A;  2DR5 A;  3AQM A;  4I2A A;  4AT9 A;  4E7X A;  5BPC A;  2ZH9 A;  3RJE A;  7ICM A;  7ICP A;  5J2G A;  3OVS A;  4I2E A;  1BPD A;  8ICN A;  4TUQ A;  9ICW A;  2ZH2 A;  9ICO A;  5J0U A;  3RJH A;  1OU5 A;  3ISC A;  3C18 A;  4XUS A;  2BCV A;  4PH5 A;  4P4O A;  3H39 A;  4WC3 A;  4YMN A;  5TZV A;  5HRG A;  2DRA A;  1F5A A;  1R8C A;  4Z6D A;  4TUR A;  8ICH A;  8ICA A;  5IIO A;  4M04 A;  2M2T A;  2PFP A;  4I2D A;  1KNY A;  3C5F A;  1ZQS A;  3B0X A;  9ICP A;  1ZJM A;  3UXP A;  7ICS A;  4XQ7 A;  4RPX A;  3JPN A;  4M9G A;  5HHH A;  4RQ2 A;  3PNC A;  2DR9 A;  1ZJN A;  9ICL A;  4IQU A;  3MDC A;  4PGX A;  3ISB A;  4ATB B;  5DEC A;  4QZ9 A;  4JWM A;  4UD4 A;  4O5C A;  5CA7 A;  3MBY A;  7ICK A;  5CB1 A;  1R8A A;  4I27 A;  4X4R A;  3HJ4 A;  4P4P A;  3RJJ A;  4GXJ A;  3OUY B;  4K4G A;  3JPO A;  1ZQK A;  4WC4 A;  4MFF A;  5J2H A;  1UEU A;  1ZQD A;  5DB7 A;  9ICR A;  3JYY A;  3AU2 A;  4UAY A;  7ICL A;  4X4T A;  1JAJ A;  3OVA A;  4WC0 A;  3JPQ A;  4I2C A;  3JPT A;  8ICL A;  5J2I A;  4X5V A;  4IQW A;  8ICM A;  4I29 A;  8ICU A;  2FMS A;  2ISO A;  1BPE A;  1ZQX A;  3HIY A;  5DKW A;  3WFR E;  1JMS A;  4RQ5 A;  5HRF A;  2ZHB A;  4MF2 A;  3HJ1 A;  2Q66 A;  1ZQC A;  5J2E A;  2RFF A;  5J0Q A;  2GWS A;  4AT7 A;  1MQ2 A;  8ICJ A;  7ICE A;  4NKU A;  1TV9 A;  5DBC A;  3LK9 A;  5DB8 A;  4FH5 A;  4WCW A;  4QZD A;  4M0A A;  4AT8 A;  4LZG A;  9ICN A;  1PX5 A;  4R63 A;  5HRL A;  4MF8 A;  1TVA A;  4NLK A;  4UBB A;  3MGI A;  3ISD A;  4RPZ A;  1MIW A;  3MGH A;  1TFW A;  4YD2 A;  8ICG A;  4X4N A;  4MFC A;  7ICV A;  3UQ2 A;  4Z6E A;  2BPG A;  4RQ4 A;  3UXN A;  4WC1 A;  5IIM A;  3V7J A;  1ZQO A;  5J0R A;  4I28 A;  4X4Q A;  4WC6 A;  9ICC A;  4IQT A;  2BE3 A;  3JPP A;  4QZC A;  4I2B A;  4EBJ A;  5DBB A;  5BOM A;  1ZQN A;  2O1P A;  4FHP A;  2ZH1 A;  4KLL A;  2PFN A;  4UBC A;  4XA5 A;  9ICG A;  4DOA A;  4M9L A;  5J2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...