4X0AA

Structure of trna-processing enzyme complex 6
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 112
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4x0aA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4x0aA01
3ISDA 4RQ4A 2DRBA 9ICPA 4X4TA 5HC9A 5CP2A 4RPYA 3MGIA 4M2YA 2BPFA 1MQ2A 1ZQQA 3ISBA 3V7JA 1ZQNA 4KLMA 5DDYA 5CB1A 1ZQHA 3C5GA 4TUQA 1ZQKA 5HREA 3B0YA 1BPYA 4UB1A 5J0PA 4P4MA 1KDHA 3AQKA 5HRIA 3AU2A 4I29A 2O1PA 4P4PA 4M9NA 4TUSA 4QZIA 4O5CA 9ICQA 9ICKA 4IQWA 4PPXA 5BOMA 4M5DA 1ZQCA 1TV9A 9ICNA 4PH5A 1Q78A 4MF2A 4E80A 2BCVA 8ICGA 9ICGA 7ICUA 2RFFA 3L9DA 5J0SA 4O5EA 3ISCA 4RT2A 4LVSA 5DB6A 3OVSA 3WFRE 2M2TA 1XSLA 4TURA 4X4UA 4R63A 4I2GA 1BPDA 3OGUA 4M0AA 4Z6FA 1MIYA 3C2KA 4DOAA 4DOCA 4K4IA 3AUOA 3OUYB 4QZHA 2ZH1A 8ICCA 4I2HA 9ICMA 4M9HA 4RQ2A 4X4VA 5D4BA 4FH5A 1R89A 2PXIA 3HJ4A 4QZ9A 4AT9B 1HUZA 9ICXA 3H38A 2M2WA 1BPZA 3UXNA 3HWTA 1ZQGA 4XQ7A 4WC2A 3RJJA 4YN4A 2DVIA 5CA7A 5CHGA 4DOBA 3JZ0A 7ICGA 4RQ6A 5J2CA 4QZDA 3WFPA 4K4GA 3MDCA 2DR8A 2FMQA 7ICPA 4JWMA 3OVBA 3WFOA 4KLTA 3RJGA 1NOMA 4AT9A 4UB2A 1ZQJA 2ZH2A 4UAZA 1R8BA 1JQRA 7ICRA 5IIKA 4FHPA 2VANA 4PGQA 3JPQA 8ICSA 2IHMA 8ICWA 3TFSA 3V7LA 5HRKA 3C2MA 2DRAA 5DKWA 4UD5A 5J2FA 9ICOA 4X4PA 2BCRA 5J2BA 4I2BA 8ICAA 4WBZA 5BPCA 4XA5A 7ICTA 5J2HA 3RH5A 4WC1A 4QZEA 3C2LA 5CJ7A 4FHXA 2PFOA 5J2EA 8ICHA 5J0QA 9ICJA 1ZQRA 2HHPA 9ICHA 9ICIA 5J2JA 4AT8A 4IG8A 2ZH3A 4QZCA 1UETA 5DBAA 3AU6A 3C66A 3RJEA 4M04A 2ID1A 5J0XA 4TUPA 1PX5A 1HUOA 4GXJA 1WOTA 4I2CA 4X4NA 2NRKA 2BPCA 5DB8A 2ZH7A 4X4OA 2DR9A 3RH4A 4UBBA 4F5RA 5J2IA 3NYBA 9ICRA 8ICRA 3JPTA 1MQ3A 5DB7A 5J2GA 4UB3A 5J0RA 4UB5A 5HR9A 1ZQMA 9ICVA 1JN3A 4PHAA 4EP7A 2ZH6A 1ZQDA 4M9JA 4RPZA 2DR5A 4F5PA 3HJ1A 4IQVA 4KLEA 3AQMA 4EBJA 4KLFA 2I9GA 4EBKA 4XQ8A 5J0OA 3HX0A 5BOLA 3C18A 3UQ0A 4JWNA 4E8FA 4YMOA 4RWNA 8ICUA 4IQUA 2BE3A 1ZQEA 4RQ3A 4QZGA 7ICNA 5J2KA 3JPRA 1ZQAA 3WFQE 4YD2A 4FHWA 5J2DA 8ICLA 3RJKA 7ICFA 4F5NA 4I2JA 2Q66A 4NM1A 7ICVA 4Z6DA 4F5OA 4Z6EA 8ICMA 5J0TA 1ZQOA 2BCSA 1BPBA 3OUYA 3UPSA 4NY8A 4X4RA 9ICBA 8ICNA 4DO9A 3RJHA 8ICOA 4KLLA 4QZAA 1MIWA 1ZQBA 4NLNA 5EOZA 1ZQZA 4QZBA 4M47A 9ICCA 1OU5A 1R8CA 3OV7A 1ZJMA 4WC0A 2O5AA 4UAWA 4NLZA 4O9MA 1ZQWA 4WC7A 3MGHA 3JPSA 1XSNA 3RJIA 4PGYA 4KLSA 3HW8A 4I2IA 5IIIA 4NKUA 4X0BA 3UPQA 1KEJA 4KLJA 1TFYA 3UXOA 4WCWA 1V4AA 5CWRA 8ICTA 4NXZA 9ICUA 4FO6A 4WC3A 4FH3A 4I2DA 3C5FA 1ZQVA 2W9MA 1ZJNA 4I2FA 4RWOA 4WC5A 4I27A 2ZH4A 3H39A 2PFNA 4M9LA 3LK9A 9ICEA 4RPXA 1TFWA 5HRHA 4R64A 3PNCA 5D46A 8ICYA 3PMNA 3H37A 4GXKA 3AQLA 5HRBA 1ZQXA 3JPOA 1ZQIA 4R66A 2BCQA 2ZHBA 3WFSC 2FMSA 2ISPA 1XSPA 1JMSA 1ZQTA 1FA0A 3RJFA 4KLGA 4WC6A 4P2HA 4KLQA 5HHIA 4UB4A 4UAYA 4LZGA 3H3AA 4XUSA 3HIYA 3LQCB 1JAJA 1RZTA 4QZFA 4UD4A 4FHVA 1UEUA 3V7KA 5DBBA 4RWQA 4UBCA 1BPXA 1YLQA 2ZH5A 4X0AA 1VFGA 7ICJA 5IIOA 9ICSA 1R8AA 8ICZA 4S3NA 4IQTA 5HHHA 4E7XA 2ZH8A 5J29A 3JPNA 4M9GA 8ICPA 4O5KA 2PFPA 2ZH9A 7ICMA 3UXPA 4LZDA 1ZQUA 9ICWA 1Q79A 3TFRA 1RPLA 4WC4A 4NLKA 4PHDA 5TZVA 7ICKA 2BPGA 4XRHA 2PBEA 4F5QA 2DR7A 1KNYA 8ICXA 1NO5A 8ICIA 4MFFA 5HRGA 3K75D 9ICFA 5J0WA 5DECA 4YMMA 4RQ1A 2P66A 4LT6A 2ISOA 3RH6A 5IILA 5J0UA 4P4OA 3MBYA 4YD1A 4RQ7A 5D49A 5HRFA 4I2EA 1BPEA 5J0YA 1ZQYA 4KLUA 3B0XA 4FHYA 4KLIA 2M2VA 1VJ7A 5CR0A 5DB9A 4MFAA 1MIVA 8ICEA 4NKTA 2PFQA 5IIJA 4MF8A 8ICQA 1UEVA 4GXIA 2M2UA 8ICFA 4Z6CA 3OVAA 8ICVA 4RQ0A 4RQ8A 4PGXA 2ZHAA 4R65A 8ICKA 5DBCA 4PHPA 4YMNA 3JYYA 7ICQA 3PMLA 4AT7B 1ZQFA 5HRDA 3JPPA 5F2VO 4KLOA 5J2AA 4PHEA 1ZQLA 5DEDA 4NM2A 1F5AA 4ATBB 2GWSA 4I2AA 3UQ2A 4KLDA 2FMPA 3AQNA 7ICOA 4RT3A 7ICSA 4RWPA 7ICEA 3GDXA 4K4HA 5HRLA 5IINA 9ICLA 3V72A 7ICIA 4AT8B 4WBYA 4QZ8A 4YCXA 4AT7A 3MDAA 1ZQSA 4RQ5A 4X4SA 2BCUA 9ICAA 4MFCA 5IIMA 4I28A 4X4QA 1ZQPA 4ATBA 8ICJA 1TVAA 4KLHA 5DDMA 7ICHA 8ICBA 4X5VA 9ICTA 7ICLA
chains in the Genus database with same CATH superfamily
3ISDA 4RQ4A 5D63A 2DRBA 9ICPA 4X4TA 5HC9A 2BBHA 5CP2A 4RPYA 3MGIA 4M2YA 2BPFA 1MQ2A 1ZQQA 3ISBA 3V7JA 1ZQNA 4NXXA 4KLMA 4K9AA 5DDYA 5CB1A 1ZQHA 3C5GA 4TUQA 1ZQKA 5HREA 3B0YA 1BPYA 4UB1A 5J0PA 4P4MA 1KDHA 3AQKA 5HRIA 3AU2A 4I29A 4JLXA 2O1PA 4P4PA 4M9NA 4TUSA 4QZIA 4O5CA 9ICQA 9ICKA 4IQWA 4PPXA 5BOMA 4M5DA 1ZQCA 1TV9A 9ICNA 4PH5A 1Q78A 4MF2A 4E80A 2BCVA 8ICGA 4KM5A 9ICGA 4JLZA 7ICUA 2RFFA 3L9DA 5J0SA 4O5EA 3ISCA 4RT2A 4LVSA 5DB6A 3OVSA 3WFRE 2M2TA 1XSLA 4TURA 4X4UA 4R63A 4I2GA 1BPDA 3OGUA 4M0AA 4Z6FA 1MIYA 4LEYA 3C2KA 4DOAA 4DOCA 5CFTA 3AUOA 4K4IA 3OUYB 4QZHA 2ZH1A 8ICCA 4I2HA 9ICMA 4M9HA 4RQ2A 2HN2A 4X4VA 5D4BA 4FH5A 1R89A 2PXIA 3HJ4A 4QZ9A 4AT9B 1HUZA 9ICXA 4NXUA 3H38A 2M2WA 1BPZA 3UXNA 3HWTA 1ZQGA 4XQ7A 4WC2A 3RJJA 4YN4A 2DVIA 5CA7A 5CHGA 4DOBA 3JZ0A 7ICGA 4RQ6A 5J2CA 4QZDA 3WFPA 4K4GA 4WOYA 3MDCA 2DR8A 2FMQA 7ICPA 4O6AA 4JWMA 3OVBA 4O69A 3WFOA 4KLTA 3RJGA 1NOMA 4AT9A 2HN1A 4UB2A 1ZQJA 2ZH2A 4UAZA 1R8BA 1JQRA 7ICRA 5IIKA 4EV6A 4FHPA 2VANA 4PGQA 3JPQA 8ICSA 2IHMA 8ICWA 3OWGA 3TFSA 3V7LA 5HRKA 3C2MA 2DRAA 5DKWA 4UD5A 5J2FA 9ICOA 4X4PA 2BCRA 5J2BA 5B3PA 4OAGA 4I2BA 8ICAA 4WBZA 3EF2A 5BPCA 4XA5A 7ICTA 5J2HA 4K8VA 3RH5A 4WC1A 4QZEA 3C2LA 4K96A 5CJ7A 4FHXA 2PFOA 5J2EA 8ICHA 5J0QA 9ICJA 1ZQRA 2HHPA 9ICHA 9ICIA 5J2JA 4AT8A 4IG8A 4MKPA 2ZH3A 4QZCA 1UETA 5DBAA 3AU6A 3C66A 3RJEA 4M04A 2ID1A 5J0XA 4TUPA 1PX5A 1HUOA 4O68A 4GXJA 1WOTA 4I2CA 4X4NA 2NRKA 2BPCA 5DB8A 2ZH7A 4X4OA 3JCFA 2DR9A 3RH4A 4UBBA 4F5RA 5J2IA 3NYBA 9ICRA 8ICRA 3JPTA 1MQ3A 5DB7A 4FO1A 5J2GA 4UB3A 5J0RA 5CFUA 4UB5A 5HR9A 1ZQMA 9ICVA 1JN3A 4PHAA 4EP7A 2GAFD 2ZH6A 1ZQDA 4M9JA 4RPZA 2DR5A 4F5PA 3HJ1A 4IQVA 4KLEA 3AQMA 4EBJA 4KLFA 2I9GA 4EBKA 4XQ8A 5J0OA 3HX0A 5BOLA 3C18A 2B56A 3UQ0A 4NXVA 4JWNA 4E8FA 5B3QA 4YMOA 4EEDA 4RWNA 4K98A 4WH5A 8ICUA 4IQUA 2BE3A 4OAIZ 1ZQEA 1GPJA 4WQLA 3PHZA 4RQ3A 4QZGA 7ICNA 5J2KA 3JPRA 1ZQAA 3WFQE 4YD2A 4FHWA 5J2DA 8ICLA 3RJKA 7ICFA 4F5NA 4I2JA 2Q66A 4NM1A 7ICVA 4Z6DA 5D61A 5CFSA 4F5OA 4Z6EA 8ICMA 5J0TA 1ZQOA 2BCSA 1BPBA 3OUYA 3UPSA 4NY8A 4X4RA 4LEVA 8ICNA 9ICBA 4DO9A 3RJHA 8ICOA 4KLLA 4QZAA 1MIWA 1ZQBA 3ERCC 4NLNA 5EOZA 1ZQZA 4QZBA 4M47A 2B4VA 9ICCA 1OU5A 1R8CA 3OV7A 1ZJMA 4WC0A 2O5AA 4UAWA 4NLZA 4O9MA 1ZQWA 4WC7A 3MGHA 3JPSA 1XSNA 4K9BA 3RJIA 4PGYA 4KLSA 3HW8A 4I2IA 5IIIA 4NKUA 4X0BA 3UPQA 1KEJA 4KLJA 1TFYA 3UXOA 4WCWA 1V4AA 5CWRA 8ICTA 4NXZA 9ICUA 4FO6A 4OAHA 4WC3A 4FH3A 4I2DA 3C5FA 1ZQVA 2W9MA 1ZJNA 4I2FA 2B51A 4RWOA 4WC5A 4I27A 3CK6A 2ZH4A 3H39A 2PFNA 4O67A 4M9LA 3K7DA 3NVOA 3LK9A 9ICEA 4RPXA 1TFWA 5HRHA 4R64A 3PNCA 5D46A 8ICYA 3PMNA 3H37A 2FCLA 4GXKA 3AQLA 5HRBA 1ZQXA 3JPOA 1ZQIA 4R66A 2BCQA 4EGWA 2ZHBA 3WFSC 2FMSA 2ISPA 1XSPA 4K99A 1JMSA 3NWIA 1ZQTA 1FA0A 3RJFA 2GA9D 4KLGA 4WC6A 4P2HA 4KLQA 5HHIA 4UB4A 4UAYA 4LZGA 3H3AA 4XUSA 3HIYA 3LQCB 1JAJA 1RZTA 4NXTA 4QZFA 4UD4A 4FHVA 1UEUA 3V7KA 5DBBA 4RWQA 4OAFA 4UBCA 3NKUA 1BPXA 1YLQA 2ZH5A 4X0AA 1VFGA 4LEZA 7ICJA 5IIOA 9ICSA 1R8AA 8ICZA 4S3NA 4IQTA 5HHHA 4E7XA 2ZH8A 5J29A 3JPNA 4M9GA 8ICPA 4O5KA 3ER9B 2PFPA 2ZH9A 2BBJA 7ICMA 3UXPA 4LZDA 1ZQUA 9ICWA 4K97A 1Q79A 3TFRA 1RPLA 4WC4A 4NLKA 4PHDA 5TZVA 7ICKA 2BPGA 5CHEA 4XRHA 2EWRA 2PBEA 4F5QA 2DR7A 1KNYA 8ICXA 1NO5A 8ICIA 4MFFA 5HRGA 3K75D 9ICFA 5J0WA 5DECA 4YMMA 4RQ1A 2P66A 4LT6A 2ISOA 4I0UA 3RH6A 5IILA 3MCRA 5J0UA 4P4OA 3MBYA 4YD1A 4RQ7A 5D49A 5HRFA 4I2EA 1BPEA 5J0YA 1ZQYA 4LEWA 4KLUA 3B0XA 4FHYA 4KLIA 2M2VA 1VJ7A 5CR0A 4NXWA 5DB9A 1MIVA 4EEBA 4MFAA 8ICEA 4NKTA 2PFQA 5IIJA 4MF8A 8ICQA 1UEVA 4GXIA 3ER8C 2M2UA 8ICFA 4Z6CA 3OVAA 8ICVA 4RQ0A 2IHOA 4RQ8A 4PGXA 4XJEA 4R65A 2ZHAA 8ICKA 5DBCA 4PHPA 4YMNA 3JYYA 7ICQA 3PMLA 4AT7B 1ZQFA 4WQKA 5D62A 5HRDA 3JPPA 5F2VO 4KLOA 5J2AA 4PHEA 1ZQLA 5DEDA 4NM2A 1F5AA 4ATBB 2GWSA 4I2AA 3UQ2A 4KLDA 2FMPA 3AQNA 7ICOA 4RT3A 7ICSA 4RWPA 7ICEA 3GDXA 4K4HA 5HRLA 5IINA 9ICLA 3V72A 7ICIA 4AT8B 4WBYA 4QZ8A 4YCXA 4AT7A 3MDAA 1ZQSA 4RQ5A 4X4SA 2BCUA 9ICAA 4MFCA 2IUBA 4HX0A 5IIMA 4I28A 4N7RA 4X4QA 1ZQPA 4ATBA 8ICJA 1TVAA 4KLHA 5DDMA 7ICHA 8ICBA 4X5VA 9ICTA 5JTGA 4KB6A 7ICLA
chains in the Genus database with same CATH topology
3ISDA 4RQ4A 2DRBA 9ICPA 4X4TA 5HC9A 5CP2A 4RPYA 3MGIA 4M2YA 2BPFA 1MQ2A 1ZQQA 3ISBA 3V7JA 1ZQNA 4KLMA 5DDYA 5CB1A 1ZQHA 3C5GA 4TUQA 1ZQKA 5HREA 3B0YA 1BPYA 4UB1A 5J0PA 4P4MA 1KDHA 3AQKA 5HRIA 3AU2A 4I29A 2O1PA 4P4PA 4M9NA 4TUSA 4QZIA 4O5CA 9ICQA 9ICKA 4IQWA 4PPXA 5BOMA 4M5DA 1ZQCA 1TV9A 9ICNA 4PH5A 1Q78A 4MF2A 4E80A 2BCVA 8ICGA 9ICGA 7ICUA 2RFFA 3L9DA 5J0SA 4O5EA 3ISCA 4RT2A 4LVSA 5DB6A 3OVSA 3WFRE 2M2TA 1XSLA 4TURA 4X4UA 4R63A 4I2GA 1BPDA 3OGUA 4M0AA 4Z6FA 1MIYA 3C2KA 4DOAA 4DOCA 4K4IA 3AUOA 3OUYB 4QZHA 2ZH1A 8ICCA 4I2HA 9ICMA 4M9HA 4RQ2A 4X4VA 5D4BA 4FH5A 1R89A 2PXIA 3HJ4A 4QZ9A 4AT9B 1HUZA 9ICXA 3H38A 2M2WA 1BPZA 3UXNA 3HWTA 1ZQGA 4XQ7A 4WC2A 3RJJA 4YN4A 2DVIA 5CA7A 5CHGA 4DOBA 3JZ0A 7ICGA 4RQ6A 5J2CA 4QZDA 3WFPA 4K4GA 3MDCA 2DR8A 2FMQA 7ICPA 4JWMA 3OVBA 3WFOA 4KLTA 3RJGA 1NOMA 4AT9A 4UB2A 1ZQJA 2ZH2A 4UAZA 1R8BA 1JQRA 7ICRA 5IIKA 4FHPA 2VANA 4PGQA 3JPQA 8ICSA 2IHMA 8ICWA 3TFSA 3V7LA 5HRKA 3C2MA 2DRAA 5DKWA 4UD5A 5J2FA 9ICOA 4X4PA 2BCRA 5J2BA 4I2BA 8ICAA 4WBZA 5BPCA 4XA5A 7ICTA 5J2HA 3RH5A 4WC1A 4QZEA 3C2LA 5CJ7A 4FHXA 2PFOA 5J2EA 8ICHA 5J0QA 9ICJA 1ZQRA 2HHPA 9ICHA 9ICIA 5J2JA 4AT8A 4IG8A 2ZH3A 4QZCA 1UETA 5DBAA 3AU6A 3C66A 3RJEA 4M04A 2ID1A 5J0XA 4TUPA 1PX5A 1HUOA 4GXJA 1WOTA 4I2CA 4X4NA 2NRKA 2BPCA 5DB8A 2ZH7A 4X4OA 2DR9A 3RH4A 4UBBA 4F5RA 5J2IA 3NYBA 9ICRA 8ICRA 3JPTA 1MQ3A 5DB7A 5J2GA 4UB3A 5J0RA 4UB5A 5HR9A 1ZQMA 9ICVA 1JN3A 4PHAA 4EP7A 2ZH6A 1ZQDA 4M9JA 4RPZA 2DR5A 4F5PA 3HJ1A 4IQVA 4KLEA 3AQMA 4EBJA 4KLFA 2I9GA 4EBKA 4XQ8A 5J0OA 3HX0A 5BOLA 3C18A 3UQ0A 4JWNA 4E8FA 4YMOA 4RWNA 8ICUA 4IQUA 2BE3A 1ZQEA 4RQ3A 4QZGA 7ICNA 5J2KA 3JPRA 1ZQAA 3WFQE 4YD2A 4FHWA 5J2DA 8ICLA 3RJKA 7ICFA 4F5NA 4I2JA 2Q66A 4NM1A 7ICVA 4Z6DA 4F5OA 4Z6EA 8ICMA 5J0TA 1ZQOA 2BCSA 1BPBA 3OUYA 3UPSA 4NY8A 4X4RA 9ICBA 8ICNA 4DO9A 3RJHA 8ICOA 4KLLA 4QZAA 1MIWA 1ZQBA 4NLNA 5EOZA 1ZQZA 4QZBA 4M47A 9ICCA 1OU5A 1R8CA 3OV7A 1ZJMA 4WC0A 2O5AA 4UAWA 4NLZA 4O9MA 1ZQWA 4WC7A 3MGHA 3JPSA 1XSNA 3RJIA 4PGYA 4KLSA 3HW8A 4I2IA 5IIIA 4NKUA 4X0BA 3UPQA 1KEJA 4KLJA 1TFYA 3UXOA 4WCWA 1V4AA 5CWRA 8ICTA 4NXZA 9ICUA 4FO6A 4WC3A 4FH3A 4I2DA 3C5FA 1ZQVA 2W9MA 1ZJNA 4I2FA 4RWOA 4WC5A 4I27A 2ZH4A 3H39A 2PFNA 4M9LA 3LK9A 9ICEA 4RPXA 1TFWA 5HRHA 4R64A 3PNCA 5D46A 8ICYA 3PMNA 3H37A 4GXKA 3AQLA 5HRBA 1ZQXA 3JPOA 1ZQIA 4R66A 2BCQA 2ZHBA 3WFSC 2FMSA 2ISPA 1XSPA 1JMSA 1ZQTA 1FA0A 3RJFA 4KLGA 4WC6A 4P2HA 4KLQA 5HHIA 4UB4A 4UAYA 4LZGA 3H3AA 4XUSA 3HIYA 3LQCB 1JAJA 1RZTA 4QZFA 4UD4A 4FHVA 1UEUA 3V7KA 5DBBA 4RWQA 4UBCA 1BPXA 1YLQA 2ZH5A 4X0AA 1VFGA 7ICJA 5IIOA 9ICSA 1R8AA 8ICZA 4S3NA 4IQTA 5HHHA 4E7XA 2ZH8A 5J29A 3JPNA 4M9GA 8ICPA 4O5KA 2PFPA 2ZH9A 7ICMA 3UXPA 4LZDA 1ZQUA 9ICWA 1Q79A 3TFRA 1RPLA 4WC4A 4NLKA 4PHDA 5TZVA 7ICKA 2BPGA 4XRHA 2PBEA 4F5QA 2DR7A 1KNYA 8ICXA 1NO5A 8ICIA 4MFFA 5HRGA 3K75D 9ICFA 5J0WA 5DECA 4YMMA 4RQ1A 2P66A 4LT6A 2ISOA 3RH6A 5IILA 5J0UA 4P4OA 3MBYA 4YD1A 4RQ7A 5D49A 5HRFA 4I2EA 1BPEA 5J0YA 1ZQYA 4KLUA 3B0XA 4FHYA 4KLIA 2M2VA 1VJ7A 5CR0A 5DB9A 4MFAA 1MIVA 8ICEA 4NKTA 2PFQA 5IIJA 4MF8A 8ICQA 1UEVA 4GXIA 2M2UA 8ICFA 4Z6CA 3OVAA 8ICVA 4RQ0A 4RQ8A 4PGXA 2ZHAA 4R65A 8ICKA 5DBCA 4PHPA 4YMNA 3JYYA 7ICQA 3PMLA 4AT7B 1ZQFA 5HRDA 3JPPA 5F2VO 4KLOA 5J2AA 4PHEA 1ZQLA 5DEDA 4NM2A 1F5AA 4ATBB 2GWSA 4I2AA 3UQ2A 4KLDA 2FMPA 3AQNA 7ICOA 4RT3A 7ICSA 4RWPA 7ICEA 3GDXA 4K4HA 5HRLA 5IINA 9ICLA 3V72A 7ICIA 4AT8B 4WBYA 4QZ8A 4YCXA 4AT7A 3MDAA 1ZQSA 4RQ5A 4X4SA 2BCUA 9ICAA 4MFCA 5IIMA 4I28A 4X4QA 1ZQPA 4ATBA 8ICJA 1TVAA 4KLHA 5DDMA 7ICHA 8ICBA 4X5VA 9ICTA 7ICLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISD A;  4RQ4 A;  2DRB A;  9ICP A;  4X4T A;  5HC9 A;  5CP2 A;  4RPY A;  3MGI A;  4M2Y A;  2BPF A;  1MQ2 A;  1ZQQ A;  3ISB A;  3V7J A;  1ZQN A;  4KLM A;  5DDY A;  5CB1 A;  1ZQH A;  3C5G A;  4TUQ A;  1ZQK A;  5HRE A;  3B0Y A;  1BPY A;  4UB1 A;  5J0P A;  4P4M A;  1KDH A;  3AQK A;  5HRI A;  3AU2 A;  4I29 A;  2O1P A;  4P4P A;  4M9N A;  4TUS A;  4QZI A;  4O5C A;  9ICQ A;  9ICK A;  4IQW A;  4PPX A;  5BOM A;  4M5D A;  1ZQC A;  1TV9 A;  9ICN A;  4PH5 A;  1Q78 A;  4MF2 A;  4E80 A;  2BCV A;  8ICG A;  9ICG A;  7ICU A;  2RFF A;  3L9D A;  5J0S A;  4O5E A;  3ISC A;  4RT2 A;  4LVS A;  5DB6 A;  3OVS A;  3WFR E;  2M2T A;  1XSL A;  4TUR A;  4X4U A;  4R63 A;  4I2G A;  1BPD A;  3OGU A;  4M0A A;  4Z6F A;  1MIY A;  3C2K A;  4DOA A;  4DOC A;  4K4I A;  3AUO A;  3OUY B;  4QZH A;  2ZH1 A;  8ICC A;  4I2H A;  9ICM A;  4M9H A;  4RQ2 A;  4X4V A;  5D4B A;  4FH5 A;  1R89 A;  2PXI A;  3HJ4 A;  4QZ9 A;  4AT9 B;  1HUZ A;  9ICX A;  3H38 A;  2M2W A;  1BPZ A;  3UXN A;  3HWT A;  1ZQG A;  4XQ7 A;  4WC2 A;  3RJJ A;  4YN4 A;  2DVI A;  5CA7 A;  5CHG A;  4DOB A;  3JZ0 A;  7ICG A;  4RQ6 A;  5J2C A;  4QZD A;  3WFP A;  4K4G A;  3MDC A;  2DR8 A;  2FMQ A;  7ICP A;  4JWM A;  3OVB A;  3WFO A;  4KLT A;  3RJG A;  1NOM A;  4AT9 A;  4UB2 A;  1ZQJ A;  2ZH2 A;  4UAZ A;  1R8B A;  1JQR A;  7ICR A;  5IIK A;  4FHP A;  2VAN A;  4PGQ A;  3JPQ A;  8ICS A;  2IHM A;  8ICW A;  3TFS A;  3V7L A;  5HRK A;  3C2M A;  2DRA A;  5DKW A;  4UD5 A;  5J2F A;  9ICO A;  4X4P A;  2BCR A;  5J2B A;  4I2B A;  8ICA A;  4WBZ A;  5BPC A;  4XA5 A;  7ICT A;  5J2H A;  3RH5 A;  4WC1 A;  4QZE A;  3C2L A;  5CJ7 A;  4FHX A;  2PFO A;  5J2E A;  8ICH A;  5J0Q A;  9ICJ A;  1ZQR A;  2HHP A;  9ICH A;  9ICI A;  5J2J A;  4AT8 A;  4IG8 A;  2ZH3 A;  4QZC A;  1UET A;  5DBA A;  3AU6 A;  3C66 A;  3RJE A;  4M04 A;  2ID1 A;  5J0X A;  4TUP A;  1PX5 A;  1HUO A;  4GXJ A;  1WOT A;  4I2C A;  4X4N A;  2NRK A;  2BPC A;  5DB8 A;  2ZH7 A;  4X4O A;  2DR9 A;  3RH4 A;  4UBB A;  4F5R A;  5J2I A;  3NYB A;  9ICR A;  8ICR A;  3JPT A;  1MQ3 A;  5DB7 A;  5J2G A;  4UB3 A;  5J0R A;  4UB5 A;  5HR9 A;  1ZQM A;  9ICV A;  1JN3 A;  4PHA A;  4EP7 A;  2ZH6 A;  1ZQD A;  4M9J A;  4RPZ A;  2DR5 A;  4F5P A;  3HJ1 A;  4IQV A;  4KLE A;  3AQM A;  4EBJ A;  4KLF A;  2I9G A;  4EBK A;  4XQ8 A;  5J0O A;  3HX0 A;  5BOL A;  3C18 A;  3UQ0 A;  4JWN A;  4E8F A;  4YMO A;  4RWN A;  8ICU A;  4IQU A;  2BE3 A;  1ZQE A;  4RQ3 A;  4QZG A;  7ICN A;  5J2K A;  3JPR A;  1ZQA A;  3WFQ E;  4YD2 A;  4FHW A;  5J2D A;  8ICL A;  3RJK A;  7ICF A;  4F5N A;  4I2J A;  2Q66 A;  4NM1 A;  7ICV A;  4Z6D A;  4F5O A;  4Z6E A;  8ICM A;  5J0T A;  1ZQO A;  2BCS A;  1BPB A;  3OUY A;  3UPS A;  4NY8 A;  4X4R A;  9ICB A;  8ICN A;  4DO9 A;  3RJH A;  8ICO A;  4KLL A;  4QZA A;  1MIW A;  1ZQB A;  4NLN A;  5EOZ A;  1ZQZ A;  4QZB A;  4M47 A;  9ICC A;  1OU5 A;  1R8C A;  3OV7 A;  1ZJM A;  4WC0 A;  2O5A A;  4UAW A;  4NLZ A;  4O9M A;  1ZQW A;  4WC7 A;  3MGH A;  3JPS A;  1XSN A;  3RJI A;  4PGY A;  4KLS A;  3HW8 A;  4I2I A;  5III A;  4NKU A;  4X0B A;  3UPQ A;  1KEJ A;  4KLJ A;  1TFY A;  3UXO A;  4WCW A;  1V4A A;  5CWR A;  8ICT A;  4NXZ A;  9ICU A;  4FO6 A;  4WC3 A;  4FH3 A;  4I2D A;  3C5F A;  1ZQV A;  2W9M A;  1ZJN A;  4I2F A;  4RWO A;  4WC5 A;  4I27 A;  2ZH4 A;  3H39 A;  2PFN A;  4M9L A;  3LK9 A;  9ICE A;  4RPX A;  1TFW A;  5HRH A;  4R64 A;  3PNC A;  5D46 A;  8ICY A;  3PMN A;  3H37 A;  4GXK A;  3AQL A;  5HRB A;  1ZQX A;  3JPO A;  1ZQI A;  4R66 A;  2BCQ A;  2ZHB A;  3WFS C;  2FMS A;  2ISP A;  1XSP A;  1JMS A;  1ZQT A;  1FA0 A;  3RJF A;  4KLG A;  4WC6 A;  4P2H A;  4KLQ A;  5HHI A;  4UB4 A;  4UAY A;  4LZG A;  3H3A A;  4XUS A;  3HIY A;  3LQC B;  1JAJ A;  1RZT A;  4QZF A;  4UD4 A;  4FHV A;  1UEU A;  3V7K A;  5DBB A;  4RWQ A;  4UBC A;  1BPX A;  1YLQ A;  2ZH5 A;  4X0A A;  1VFG A;  7ICJ A;  5IIO A;  9ICS A;  1R8A A;  8ICZ A;  4S3N A;  4IQT A;  5HHH A;  4E7X A;  2ZH8 A;  5J29 A;  3JPN A;  4M9G A;  8ICP A;  4O5K A;  2PFP A;  2ZH9 A;  7ICM A;  3UXP A;  4LZD A;  1ZQU A;  9ICW A;  1Q79 A;  3TFR A;  1RPL A;  4WC4 A;  4NLK A;  4PHD A;  5TZV A;  7ICK A;  2BPG A;  4XRH A;  2PBE A;  4F5Q A;  2DR7 A;  1KNY A;  8ICX A;  1NO5 A;  8ICI A;  4MFF A;  5HRG A;  3K75 D;  9ICF A;  5J0W A;  5DEC A;  4YMM A;  4RQ1 A;  2P66 A;  4LT6 A;  2ISO A;  3RH6 A;  5IIL A;  5J0U A;  4P4O A;  3MBY A;  4YD1 A;  4RQ7 A;  5D49 A;  5HRF A;  4I2E A;  1BPE A;  5J0Y A;  1ZQY A;  4KLU A;  3B0X A;  4FHY A;  4KLI A;  2M2V A;  1VJ7 A;  5CR0 A;  5DB9 A;  4MFA A;  1MIV A;  8ICE A;  4NKT A;  2PFQ A;  5IIJ A;  4MF8 A;  8ICQ A;  1UEV A;  4GXI A;  2M2U A;  8ICF A;  4Z6C A;  3OVA A;  8ICV A;  4RQ0 A;  4RQ8 A;  4PGX A;  2ZHA A;  4R65 A;  8ICK A;  5DBC A;  4PHP A;  4YMN A;  3JYY A;  7ICQ A;  3PML A;  4AT7 B;  1ZQF A;  5HRD A;  3JPP A;  5F2V O;  4KLO A;  5J2A A;  4PHE A;  1ZQL A;  5DED A;  4NM2 A;  1F5A A;  4ATB B;  2GWS A;  4I2A A;  3UQ2 A;  4KLD A;  2FMP A;  3AQN A;  7ICO A;  4RT3 A;  7ICS A;  4RWP A;  7ICE A;  3GDX A;  4K4H A;  5HRL A;  5IIN A;  9ICL A;  3V72 A;  7ICI A;  4AT8 B;  4WBY A;  4QZ8 A;  4YCX A;  4AT7 A;  3MDA A;  1ZQS A;  4RQ5 A;  4X4S A;  2BCU A;  9ICA A;  4MFC A;  5IIM A;  4I28 A;  4X4Q A;  1ZQP A;  4ATB A;  8ICJ A;  1TVA A;  4KLH A;  5DDM A;  7ICH A;  8ICB A;  4X5V A;  9ICT A;  7ICL A; 
#chains in the Genus database with same CATH topology
 3ISD A;  4RQ4 A;  5D63 A;  2DRB A;  9ICP A;  4X4T A;  5HC9 A;  2BBH A;  5CP2 A;  4RPY A;  3MGI A;  4M2Y A;  2BPF A;  1MQ2 A;  1ZQQ A;  3ISB A;  3V7J A;  1ZQN A;  4NXX A;  4KLM A;  4K9A A;  5DDY A;  5CB1 A;  1ZQH A;  3C5G A;  4TUQ A;  1ZQK A;  5HRE A;  3B0Y A;  1BPY A;  4UB1 A;  5J0P A;  4P4M A;  1KDH A;  3AQK A;  5HRI A;  3AU2 A;  4I29 A;  4JLX A;  2O1P A;  4P4P A;  4M9N A;  4TUS A;  4QZI A;  4O5C A;  9ICQ A;  9ICK A;  4IQW A;  4PPX A;  5BOM A;  4M5D A;  1ZQC A;  1TV9 A;  9ICN A;  4PH5 A;  1Q78 A;  4MF2 A;  4E80 A;  2BCV A;  8ICG A;  4KM5 A;  9ICG A;  4JLZ A;  7ICU A;  2RFF A;  3L9D A;  5J0S A;  4O5E A;  3ISC A;  4RT2 A;  4LVS A;  5DB6 A;  3OVS A;  3WFR E;  2M2T A;  1XSL A;  4TUR A;  4X4U A;  4R63 A;  4I2G A;  1BPD A;  3OGU A;  4M0A A;  4Z6F A;  1MIY A;  4LEY A;  3C2K A;  4DOA A;  4DOC A;  5CFT A;  3AUO A;  4K4I A;  3OUY B;  4QZH A;  2ZH1 A;  8ICC A;  4I2H A;  9ICM A;  4M9H A;  4RQ2 A;  2HN2 A;  4X4V A;  5D4B A;  4FH5 A;  1R89 A;  2PXI A;  3HJ4 A;  4QZ9 A;  4AT9 B;  1HUZ A;  9ICX A;  4NXU A;  3H38 A;  2M2W A;  1BPZ A;  3UXN A;  3HWT A;  1ZQG A;  4XQ7 A;  4WC2 A;  3RJJ A;  4YN4 A;  2DVI A;  5CA7 A;  5CHG A;  4DOB A;  3JZ0 A;  7ICG A;  4RQ6 A;  5J2C A;  4QZD A;  3WFP A;  4K4G A;  4WOY A;  3MDC A;  2DR8 A;  2FMQ A;  7ICP A;  4O6A A;  4JWM A;  3OVB A;  4O69 A;  3WFO A;  4KLT A;  3RJG A;  1NOM A;  4AT9 A;  2HN1 A;  4UB2 A;  1ZQJ A;  2ZH2 A;  4UAZ A;  1R8B A;  1JQR A;  7ICR A;  5IIK A;  4EV6 A;  4FHP A;  2VAN A;  4PGQ A;  3JPQ A;  8ICS A;  2IHM A;  8ICW A;  3OWG A;  3TFS A;  3V7L A;  5HRK A;  3C2M A;  2DRA A;  5DKW A;  4UD5 A;  5J2F A;  9ICO A;  4X4P A;  2BCR A;  5J2B A;  5B3P A;  4OAG A;  4I2B A;  8ICA A;  4WBZ A;  3EF2 A;  5BPC A;  4XA5 A;  7ICT A;  5J2H A;  4K8V A;  3RH5 A;  4WC1 A;  4QZE A;  3C2L A;  4K96 A;  5CJ7 A;  4FHX A;  2PFO A;  5J2E A;  8ICH A;  5J0Q A;  9ICJ A;  1ZQR A;  2HHP A;  9ICH A;  9ICI A;  5J2J A;  4AT8 A;  4IG8 A;  4MKP A;  2ZH3 A;  4QZC A;  1UET A;  5DBA A;  3AU6 A;  3C66 A;  3RJE A;  4M04 A;  2ID1 A;  5J0X A;  4TUP A;  1PX5 A;  1HUO A;  4O68 A;  4GXJ A;  1WOT A;  4I2C A;  4X4N A;  2NRK A;  2BPC A;  5DB8 A;  2ZH7 A;  4X4O A;  3JCF A;  2DR9 A;  3RH4 A;  4UBB A;  4F5R A;  5J2I A;  3NYB A;  9ICR A;  8ICR A;  3JPT A;  1MQ3 A;  5DB7 A;  4FO1 A;  5J2G A;  4UB3 A;  5J0R A;  5CFU A;  4UB5 A;  5HR9 A;  1ZQM A;  9ICV A;  1JN3 A;  4PHA A;  4EP7 A;  2GAF D;  2ZH6 A;  1ZQD A;  4M9J A;  4RPZ A;  2DR5 A;  4F5P A;  3HJ1 A;  4IQV A;  4KLE A;  3AQM A;  4EBJ A;  4KLF A;  2I9G A;  4EBK A;  4XQ8 A;  5J0O A;  3HX0 A;  5BOL A;  3C18 A;  2B56 A;  3UQ0 A;  4NXV A;  4JWN A;  4E8F A;  5B3Q A;  4YMO A;  4EED A;  4RWN A;  4K98 A;  4WH5 A;  8ICU A;  4IQU A;  2BE3 A;  4OAI Z;  1ZQE A;  1GPJ A;  4WQL A;  3PHZ A;  4RQ3 A;  4QZG A;  7ICN A;  5J2K A;  3JPR A;  1ZQA A;  3WFQ E;  4YD2 A;  4FHW A;  5J2D A;  8ICL A;  3RJK A;  7ICF A;  4F5N A;  4I2J A;  2Q66 A;  4NM1 A;  7ICV A;  4Z6D A;  5D61 A;  5CFS A;  4F5O A;  4Z6E A;  8ICM A;  5J0T A;  1ZQO A;  2BCS A;  1BPB A;  3OUY A;  3UPS A;  4NY8 A;  4X4R A;  4LEV A;  8ICN A;  9ICB A;  4DO9 A;  3RJH A;  8ICO A;  4KLL A;  4QZA A;  1MIW A;  1ZQB A;  3ERC C;  4NLN A;  5EOZ A;  1ZQZ A;  4QZB A;  4M47 A;  2B4V A;  9ICC A;  1OU5 A;  1R8C A;  3OV7 A;  1ZJM A;  4WC0 A;  2O5A A;  4UAW A;  4NLZ A;  4O9M A;  1ZQW A;  4WC7 A;  3MGH A;  3JPS A;  1XSN A;  4K9B A;  3RJI A;  4PGY A;  4KLS A;  3HW8 A;  4I2I A;  5III A;  4NKU A;  4X0B A;  3UPQ A;  1KEJ A;  4KLJ A;  1TFY A;  3UXO A;  4WCW A;  1V4A A;  5CWR A;  8ICT A;  4NXZ A;  9ICU A;  4FO6 A;  4OAH A;  4WC3 A;  4FH3 A;  4I2D A;  3C5F A;  1ZQV A;  2W9M A;  1ZJN A;  4I2F A;  2B51 A;  4RWO A;  4WC5 A;  4I27 A;  3CK6 A;  2ZH4 A;  3H39 A;  2PFN A;  4O67 A;  4M9L A;  3K7D A;  3NVO A;  3LK9 A;  9ICE A;  4RPX A;  1TFW A;  5HRH A;  4R64 A;  3PNC A;  5D46 A;  8ICY A;  3PMN A;  3H37 A;  2FCL A;  4GXK A;  3AQL A;  5HRB A;  1ZQX A;  3JPO A;  1ZQI A;  4R66 A;  2BCQ A;  4EGW A;  2ZHB A;  3WFS C;  2FMS A;  2ISP A;  1XSP A;  4K99 A;  1JMS A;  3NWI A;  1ZQT A;  1FA0 A;  3RJF A;  2GA9 D;  4KLG A;  4WC6 A;  4P2H A;  4KLQ A;  5HHI A;  4UB4 A;  4UAY A;  4LZG A;  3H3A A;  4XUS A;  3HIY A;  3LQC B;  1JAJ A;  1RZT A;  4NXT A;  4QZF A;  4UD4 A;  4FHV A;  1UEU A;  3V7K A;  5DBB A;  4RWQ A;  4OAF A;  4UBC A;  3NKU A;  1BPX A;  1YLQ A;  2ZH5 A;  4X0A A;  1VFG A;  4LEZ A;  7ICJ A;  5IIO A;  9ICS A;  1R8A A;  8ICZ A;  4S3N A;  4IQT A;  5HHH A;  4E7X A;  2ZH8 A;  5J29 A;  3JPN A;  4M9G A;  8ICP A;  4O5K A;  3ER9 B;  2PFP A;  2ZH9 A;  2BBJ A;  7ICM A;  3UXP A;  4LZD A;  1ZQU A;  9ICW A;  4K97 A;  1Q79 A;  3TFR A;  1RPL A;  4WC4 A;  4NLK A;  4PHD A;  5TZV A;  7ICK A;  2BPG A;  5CHE A;  4XRH A;  2EWR A;  2PBE A;  4F5Q A;  2DR7 A;  1KNY A;  8ICX A;  1NO5 A;  8ICI A;  4MFF A;  5HRG A;  3K75 D;  9ICF A;  5J0W A;  5DEC A;  4YMM A;  4RQ1 A;  2P66 A;  4LT6 A;  2ISO A;  4I0U A;  3RH6 A;  5IIL A;  3MCR A;  5J0U A;  4P4O A;  3MBY A;  4YD1 A;  4RQ7 A;  5D49 A;  5HRF A;  4I2E A;  1BPE A;  5J0Y A;  1ZQY A;  4LEW A;  4KLU A;  3B0X A;  4FHY A;  4KLI A;  2M2V A;  1VJ7 A;  5CR0 A;  4NXW A;  5DB9 A;  1MIV A;  4EEB A;  4MFA A;  8ICE A;  4NKT A;  2PFQ A;  5IIJ A;  4MF8 A;  8ICQ A;  1UEV A;  4GXI A;  3ER8 C;  2M2U A;  8ICF A;  4Z6C A;  3OVA A;  8ICV A;  4RQ0 A;  2IHO A;  4RQ8 A;  4PGX A;  4XJE A;  4R65 A;  2ZHA A;  8ICK A;  5DBC A;  4PHP A;  4YMN A;  3JYY A;  7ICQ A;  3PML A;  4AT7 B;  1ZQF A;  4WQK A;  5D62 A;  5HRD A;  3JPP A;  5F2V O;  4KLO A;  5J2A A;  4PHE A;  1ZQL A;  5DED A;  4NM2 A;  1F5A A;  4ATB B;  2GWS A;  4I2A A;  3UQ2 A;  4KLD A;  2FMP A;  3AQN A;  7ICO A;  4RT3 A;  7ICS A;  4RWP A;  7ICE A;  3GDX A;  4K4H A;  5HRL A;  5IIN A;  9ICL A;  3V72 A;  7ICI A;  4AT8 B;  4WBY A;  4QZ8 A;  4YCX A;  4AT7 A;  3MDA A;  1ZQS A;  4RQ5 A;  4X4S A;  2BCU A;  9ICA A;  4MFC A;  2IUB A;  4HX0 A;  5IIM A;  4I28 A;  4N7R A;  4X4Q A;  1ZQP A;  4ATB A;  8ICJ A;  1TVA A;  4KLH A;  5DDM A;  7ICH A;  8ICB A;  4X5V A;  9ICT A;  5JTG A;  4KB6 A;  7ICL A; 
#chains in the Genus database with same CATH homology
 3ISD A;  4RQ4 A;  2DRB A;  9ICP A;  4X4T A;  5HC9 A;  5CP2 A;  4RPY A;  3MGI A;  4M2Y A;  2BPF A;  1MQ2 A;  1ZQQ A;  3ISB A;  3V7J A;  1ZQN A;  4KLM A;  5DDY A;  5CB1 A;  1ZQH A;  3C5G A;  4TUQ A;  1ZQK A;  5HRE A;  3B0Y A;  1BPY A;  4UB1 A;  5J0P A;  4P4M A;  1KDH A;  3AQK A;  5HRI A;  3AU2 A;  4I29 A;  2O1P A;  4P4P A;  4M9N A;  4TUS A;  4QZI A;  4O5C A;  9ICQ A;  9ICK A;  4IQW A;  4PPX A;  5BOM A;  4M5D A;  1ZQC A;  1TV9 A;  9ICN A;  4PH5 A;  1Q78 A;  4MF2 A;  4E80 A;  2BCV A;  8ICG A;  9ICG A;  7ICU A;  2RFF A;  3L9D A;  5J0S A;  4O5E A;  3ISC A;  4RT2 A;  4LVS A;  5DB6 A;  3OVS A;  3WFR E;  2M2T A;  1XSL A;  4TUR A;  4X4U A;  4R63 A;  4I2G A;  1BPD A;  3OGU A;  4M0A A;  4Z6F A;  1MIY A;  3C2K A;  4DOA A;  4DOC A;  4K4I A;  3AUO A;  3OUY B;  4QZH A;  2ZH1 A;  8ICC A;  4I2H A;  9ICM A;  4M9H A;  4RQ2 A;  4X4V A;  5D4B A;  4FH5 A;  1R89 A;  2PXI A;  3HJ4 A;  4QZ9 A;  4AT9 B;  1HUZ A;  9ICX A;  3H38 A;  2M2W A;  1BPZ A;  3UXN A;  3HWT A;  1ZQG A;  4XQ7 A;  4WC2 A;  3RJJ A;  4YN4 A;  2DVI A;  5CA7 A;  5CHG A;  4DOB A;  3JZ0 A;  7ICG A;  4RQ6 A;  5J2C A;  4QZD A;  3WFP A;  4K4G A;  3MDC A;  2DR8 A;  2FMQ A;  7ICP A;  4JWM A;  3OVB A;  3WFO A;  4KLT A;  3RJG A;  1NOM A;  4AT9 A;  4UB2 A;  1ZQJ A;  2ZH2 A;  4UAZ A;  1R8B A;  1JQR A;  7ICR A;  5IIK A;  4FHP A;  2VAN A;  4PGQ A;  3JPQ A;  8ICS A;  2IHM A;  8ICW A;  3TFS A;  3V7L A;  5HRK A;  3C2M A;  2DRA A;  5DKW A;  4UD5 A;  5J2F A;  9ICO A;  4X4P A;  2BCR A;  5J2B A;  4I2B A;  8ICA A;  4WBZ A;  5BPC A;  4XA5 A;  7ICT A;  5J2H A;  3RH5 A;  4WC1 A;  4QZE A;  3C2L A;  5CJ7 A;  4FHX A;  2PFO A;  5J2E A;  8ICH A;  5J0Q A;  9ICJ A;  1ZQR A;  2HHP A;  9ICH A;  9ICI A;  5J2J A;  4AT8 A;  4IG8 A;  2ZH3 A;  4QZC A;  1UET A;  5DBA A;  3AU6 A;  3C66 A;  3RJE A;  4M04 A;  2ID1 A;  5J0X A;  4TUP A;  1PX5 A;  1HUO A;  4GXJ A;  1WOT A;  4I2C A;  4X4N A;  2NRK A;  2BPC A;  5DB8 A;  2ZH7 A;  4X4O A;  2DR9 A;  3RH4 A;  4UBB A;  4F5R A;  5J2I A;  3NYB A;  9ICR A;  8ICR A;  3JPT A;  1MQ3 A;  5DB7 A;  5J2G A;  4UB3 A;  5J0R A;  4UB5 A;  5HR9 A;  1ZQM A;  9ICV A;  1JN3 A;  4PHA A;  4EP7 A;  2ZH6 A;  1ZQD A;  4M9J A;  4RPZ A;  2DR5 A;  4F5P A;  3HJ1 A;  4IQV A;  4KLE A;  3AQM A;  4EBJ A;  4KLF A;  2I9G A;  4EBK A;  4XQ8 A;  5J0O A;  3HX0 A;  5BOL A;  3C18 A;  3UQ0 A;  4JWN A;  4E8F A;  4YMO A;  4RWN A;  8ICU A;  4IQU A;  2BE3 A;  1ZQE A;  4RQ3 A;  4QZG A;  7ICN A;  5J2K A;  3JPR A;  1ZQA A;  3WFQ E;  4YD2 A;  4FHW A;  5J2D A;  8ICL A;  3RJK A;  7ICF A;  4F5N A;  4I2J A;  2Q66 A;  4NM1 A;  7ICV A;  4Z6D A;  4F5O A;  4Z6E A;  8ICM A;  5J0T A;  1ZQO A;  2BCS A;  1BPB A;  3OUY A;  3UPS A;  4NY8 A;  4X4R A;  9ICB A;  8ICN A;  4DO9 A;  3RJH A;  8ICO A;  4KLL A;  4QZA A;  1MIW A;  1ZQB A;  4NLN A;  5EOZ A;  1ZQZ A;  4QZB A;  4M47 A;  9ICC A;  1OU5 A;  1R8C A;  3OV7 A;  1ZJM A;  4WC0 A;  2O5A A;  4UAW A;  4NLZ A;  4O9M A;  1ZQW A;  4WC7 A;  3MGH A;  3JPS A;  1XSN A;  3RJI A;  4PGY A;  4KLS A;  3HW8 A;  4I2I A;  5III A;  4NKU A;  4X0B A;  3UPQ A;  1KEJ A;  4KLJ A;  1TFY A;  3UXO A;  4WCW A;  1V4A A;  5CWR A;  8ICT A;  4NXZ A;  9ICU A;  4FO6 A;  4WC3 A;  4FH3 A;  4I2D A;  3C5F A;  1ZQV A;  2W9M A;  1ZJN A;  4I2F A;  4RWO A;  4WC5 A;  4I27 A;  2ZH4 A;  3H39 A;  2PFN A;  4M9L A;  3LK9 A;  9ICE A;  4RPX A;  1TFW A;  5HRH A;  4R64 A;  3PNC A;  5D46 A;  8ICY A;  3PMN A;  3H37 A;  4GXK A;  3AQL A;  5HRB A;  1ZQX A;  3JPO A;  1ZQI A;  4R66 A;  2BCQ A;  2ZHB A;  3WFS C;  2FMS A;  2ISP A;  1XSP A;  1JMS A;  1ZQT A;  1FA0 A;  3RJF A;  4KLG A;  4WC6 A;  4P2H A;  4KLQ A;  5HHI A;  4UB4 A;  4UAY A;  4LZG A;  3H3A A;  4XUS A;  3HIY A;  3LQC B;  1JAJ A;  1RZT A;  4QZF A;  4UD4 A;  4FHV A;  1UEU A;  3V7K A;  5DBB A;  4RWQ A;  4UBC A;  1BPX A;  1YLQ A;  2ZH5 A;  4X0A A;  1VFG A;  7ICJ A;  5IIO A;  9ICS A;  1R8A A;  8ICZ A;  4S3N A;  4IQT A;  5HHH A;  4E7X A;  2ZH8 A;  5J29 A;  3JPN A;  4M9G A;  8ICP A;  4O5K A;  2PFP A;  2ZH9 A;  7ICM A;  3UXP A;  4LZD A;  1ZQU A;  9ICW A;  1Q79 A;  3TFR A;  1RPL A;  4WC4 A;  4NLK A;  4PHD A;  5TZV A;  7ICK A;  2BPG A;  4XRH A;  2PBE A;  4F5Q A;  2DR7 A;  1KNY A;  8ICX A;  1NO5 A;  8ICI A;  4MFF A;  5HRG A;  3K75 D;  9ICF A;  5J0W A;  5DEC A;  4YMM A;  4RQ1 A;  2P66 A;  4LT6 A;  2ISO A;  3RH6 A;  5IIL A;  5J0U A;  4P4O A;  3MBY A;  4YD1 A;  4RQ7 A;  5D49 A;  5HRF A;  4I2E A;  1BPE A;  5J0Y A;  1ZQY A;  4KLU A;  3B0X A;  4FHY A;  4KLI A;  2M2V A;  1VJ7 A;  5CR0 A;  5DB9 A;  4MFA A;  1MIV A;  8ICE A;  4NKT A;  2PFQ A;  5IIJ A;  4MF8 A;  8ICQ A;  1UEV A;  4GXI A;  2M2U A;  8ICF A;  4Z6C A;  3OVA A;  8ICV A;  4RQ0 A;  4RQ8 A;  4PGX A;  2ZHA A;  4R65 A;  8ICK A;  5DBC A;  4PHP A;  4YMN A;  3JYY A;  7ICQ A;  3PML A;  4AT7 B;  1ZQF A;  5HRD A;  3JPP A;  5F2V O;  4KLO A;  5J2A A;  4PHE A;  1ZQL A;  5DED A;  4NM2 A;  1F5A A;  4ATB B;  2GWS A;  4I2A A;  3UQ2 A;  4KLD A;  2FMP A;  3AQN A;  7ICO A;  4RT3 A;  7ICS A;  4RWP A;  7ICE A;  3GDX A;  4K4H A;  5HRL A;  5IIN A;  9ICL A;  3V72 A;  7ICI A;  4AT8 B;  4WBY A;  4QZ8 A;  4YCX A;  4AT7 A;  3MDA A;  1ZQS A;  4RQ5 A;  4X4S A;  2BCU A;  9ICA A;  4MFC A;  5IIM A;  4I28 A;  4X4Q A;  1ZQP A;  4ATB A;  8ICJ A;  1TVA A;  4KLH A;  5DDM A;  7ICH A;  8ICB A;  4X5V A;  9ICT A;  7ICL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...