4X0AA

Structure of trna-processing enzyme complex 6
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
molecule keywords Poly A polymerase
total genus 112
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4x0aA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4x0aA01
3HJ4A 8ICIA 7ICUA 1ZQHA 3HW8A 5J0WA 1ZQAA 2PFOA 5CHGA 3ISDA 4KLJA 4RPZA 5HRGA 1XSLA 8ICBA 7ICMA 4FHWA 4PGXA 9ICFA 4UBBA 4MF2A 3ISCA 3JPNA 4LVSA 4M2YA 8ICWA 4QZEA 4F5NA 1HUOA 4FHYA 4QZ9A 4PGQA 9ICQA 4YN4A 3WFOA 4QZ8A 5D46A 4E7XA 3MGIA 1YLQA 1MQ3A 4PHEA 3V7KA 5HRDA 4RQ6A 4UAZA 4NLKA 4AT8B 4ATBB 4KLOA 4YD1A 4PGYA 3OUYA 2DRAA 5DDMA 3TFSA 1ZQEA 4AT9B 5J2FA 8ICFA 1TFYA 1FA0A 3AQNA 3LK9A 4NLNA 5J0XA 2BE3A 1PX5A 4WBZA 3OV7A 4KLSA 4XQ8A 3B0YA 4P4MA 3JPQA 3L9DA 1BPXA 3OVAA 4RQ7A 4X4PA 3RH4A 3AU2A 5DDYA 2M2UA 1RZTA 4F5RA 4RQ2A 3UXOA 4TUQA 5HR9A 4UAYA 4M9LA 4WC2A 9ICAA 2BCRA 4I2HA 2ZH9A 4IG8A 4RPYA 4X4NA 1F5AA 4UD5A 2ID1A 1NO5A 2BCVA 4MFFA 1ZQDA 3UQ0A 7ICJA 4R65A 4UB5A 8ICMA 1MIWA 2ZH4A 1JMSA 4QZFA 4RQ5A 4O9MA 3H39A 3WFRE 4M9JA 3WFQE 4FHPA 4Z6DA 3V72A 8ICPA 4FHVA 7ICSA 5J2DA 1Q79A 9ICWA 2BCSA 4Z6CA 5J2IA 3JPSA 4I2BA 3GDXA 4DO9A 3NYBA 4PH5A 4I28A 1ZQRA 4RT3A 5DBBA 5IIIA 2BPGA 4I29A 1XSNA 2ZHAA 5BOLA 3K75D 2M2TA 3JPPA 4M9HA 4I2DA 4YMNA 4TUPA 9ICRA 8ICOA 7ICLA 4FHXA 3JPOA 4KLUA 2ISPA 5DB6A 5CB1A 4MFAA 5HRBA 3C5FA 1ZQNA 5J0QA 3RJIA 5D49A 4K4HA 4PHAA 9ICVA 3UXNA 4MF8A 2ZH6A 4GXKA 4X4QA 2DR7A 1MQ2A 2DVIA 4M9NA 4XQ7A 4RWNA 5HHHA 7ICOA 5HRIA 3HIYA 4IQVA 9ICSA 9ICIA 5HRHA 5CP2A 3ISBA 3WFPA 7ICEA 5D4BA 5J0SA 1ZQZA 4LT6A 4DOAA 4JWNA 7ICRA 2HHPA 4M04A 4I2IA 1ZQTA 1ZQYA 5HRLA 5DB9A 4I2AA 3LQCB 1ZQJA 8ICEA 2P66A 8ICCA 3TFRA 1VFGA 5BPCA 3AQKA 1ZQUA 1ZJMA 1VJ7A 5IIMA 2PFQA 4EP7A 4KLHA 9ICBA 4RT2A 7ICVA 1UEVA 4UB3A 5DB7A 1ZQOA 4RQ4A 3RJFA 1TVAA 4UBCA 4AT9A 1MIVA 4XRHA 3RH6A 4WC0A 1Q78A 4PPXA 4X4OA 1ZJNA 2PBEA 4QZHA 3H3AA 3V7LA 3JYYA 4RQ8A 7ICIA 1ZQVA 4KLFA 4YD2A 1ZQWA 8ICNA 5HRFA 4E8FA 4DOCA 1ZQBA 1WOTA 4KLTA 4X5VA 8ICQA 5IIKA 4LZDA 4WCWA 1ZQIA 4UD4A 4RPXA 4NXZA 2BPFA 3B0XA 7ICFA 4F5PA 2DR8A 2FMSA 4QZBA 3PMLA 4AT7A 5J2GA 3HJ1A 4IQUA 1BPBA 5J0UA 3OUYB 4I2GA 1XSPA 4KLDA 4KLQA 3WFSC 7ICKA 4I2JA 2ZH2A 4QZIA 4K4IA 9ICJA 2W9MA 2ZH5A 4RWQA 5J0YA 1ZQKA 2BCUA 5J2BA 5CR0A 5J0TA 3C66A 4FH3A 7ICQA 4WC7A 8ICKA 5J0PA 1R8CA 4M47A 4RQ1A 1JQRA 4R66A 4MFCA 8ICTA 3JPRA 3OVSA 1BPYA 1RPLA 3PMNA 9ICPA 4WC6A 4X4TA 3RJGA 2I9GA 1TFWA 7ICNA 9ICEA 1ZQFA 2NRKA 3V7JA 1ZQPA 4LZGA 4KLEA 1ZQQA 3RJKA 3C18A 4KLIA 5J2JA 2ZH1A 9ICMA 4NY8A 3RJHA 5CA7A 3JZ0A 5DBAA 4S3NA 3C2MA 4RQ0A 4QZDA 4O5CA 4KLGA 5F2VO 4X4RA 8ICAA 3AUOA 2BCQA 4AT7B 1ZQGA 3C5GA 1BPZA 4P4OA 4F5QA 5HHIA 5J2HA 3UQ2A 3MGHA 3AU6A 1V4AA 4E80A 8ICZA 4X0AA 9ICGA 5J29A 5CWRA 3C2LA 2DRBA 9ICTA 4R64A 4I27A 4I2EA 5J2AA 8ICJA 4EBKA 2PFPA 1KNYA 2DR9A 4UB1A 8ICSA 5IIJA 4K4GA 4YMOA 4PHDA 3C2KA 1NOMA 9ICXA 4NKTA 4NKUA 4F5OA 3MDAA 4RQ3A 1KDHA 3OGUA 8ICYA 4UB2A 3UPSA 9ICCA 2PFNA 5BOMA 4X4SA 3H37A 2FMQA 8ICLA 2ZH3A 3OVBA 4RWOA 3JPTA 4GXIA 5DECA 4O5KA 3HX0A 5DBCA 5IINA 5IILA 9ICLA 4I2CA 4KLLA 5HRKA 4QZCA 4M9GA 8ICVA 4RWPA 2M2WA 4I2FA 1HUZA 4WC3A 5J0RA 1BPEA 2RFFA 2PXIA 1BPDA 4PHPA 4UAWA 2FMPA 5HREA 8ICHA 9ICHA 4WC4A 8ICGA 1MIYA 4P4PA 7ICTA 3MDCA 1ZQCA 2Q66A 9ICKA 1ZQXA 4UB4A 5CJ7A 4M5DA 2O1PA 5HC9A 9ICUA 4XA5A 1JN3A 2ZH7A 1R8BA 4R63A 1OU5A 4Z6EA 5J2EA 4TUSA 2IHMA 4EBJA 5TZVA 5IIOA 1KEJA 1UEUA 4IQTA 4WC5A 4JWMA 5EOZA 1ZQSA 8ICXA 2ZHBA 5DB8A 1JAJA 2VANA 4O5EA 4QZAA 3RJEA 4NM2A 8ICRA 4AT8A 4NLZA 1R8AA 2DR5A 9ICNA 3MBYA 8ICUA 1R89A 9ICOA 4QZGA 1TV9A 3UPQA 4P2HA 4M0AA 4KLMA 3AQLA 1UETA 2M2VA 2ISOA 4YMMA 4X4VA 3HWTA 4ATBA 3H38A 2BPCA 4X0BA 4WC1A 3PNCA 4WBYA 4Z6FA 3RH5A 2O5AA 3RJJA 4NM1A 4DOBA 4X4UA 4FO6A 4YCXA 1ZQLA 1ZQMA 4IQWA 5DEDA 7ICHA 5J2CA 7ICGA 3AQMA 2ZH8A 4GXJA 4TURA 4FH5A 2GWSA 5J2KA 4XUSA 5DKWA 5J0OA 7ICPA 3UXPA
chains in the Genus database with same CATH superfamily
3HJ4A 8ICIA 5JTGA 7ICUA 1ZQHA 3HW8A 5J0WA 1ZQAA 2PFOA 5CHGA 3ISDA 4WH5A 4KLJA 4RPZA 5HRGA 1XSLA 8ICBA 7ICMA 4FHWA 4PGXA 9ICFA 4UBBA 4MF2A 3ISCA 3JPNA 4LEWA 4LVSA 4O68A 4M2YA 8ICWA 4QZEA 4F5NA 1HUOA 4FHYA 4O69A 4QZ9A 4K8VA 4PGQA 9ICQA 4YN4A 3WFOA 4QZ8A 5CFUA 5D46A 4E7XA 3MGIA 1YLQA 1MQ3A 3JCFA 4PHEA 3V7KA 5HRDA 4RQ6A 4UAZA 4NLKA 4FO1A 2B51A 4AT8B 4ATBB 4KLOA 4YD1A 4PGYA 3OUYA 2DRAA 5DDMA 3TFSA 1ZQEA 4AT9B 5J2FA 8ICFA 1TFYA 1FA0A 3AQNA 3K7DA 3LK9A 4NLNA 5J0XA 2BE3A 1PX5A 4WBZA 3OV7A 4KLSA 4XQ8A 3B0YA 4P4MA 3JPQA 3L9DA 1BPXA 3OVAA 4RQ7A 4X4PA 2B56A 4OAIZ 3RH4A 3AU2A 5DDYA 2M2UA 1RZTA 4F5RA 4RQ2A 3UXOA 4TUQA 5HR9A 4UAYA 4M9LA 4WC2A 9ICAA 2BCRA 4I2HA 2ZH9A 4IG8A 4RPYA 4X4NA 1F5AA 4UD5A 2ID1A 1NO5A 2BCVA 4MFFA 1ZQDA 3UQ0A 7ICJA 4R65A 4UB5A 8ICMA 1MIWA 2ZH4A 1JMSA 4QZFA 4RQ5A 4O9MA 3H39A 3WFRE 4M9JA 3WFQE 4FHPA 4Z6DA 3V72A 8ICPA 4FHVA 7ICSA 5J2DA 1Q79A 9ICWA 2BCSA 4Z6CA 5J2IA 3JPSA 4I2BA 3GDXA 3NYBA 4PH5A 4DO9A 4I28A 1ZQRA 4RT3A 5DBBA 5IIIA 2BPGA 4I29A 1XSNA 2ZHAA 5BOLA 3K75D 2M2TA 4LEVA 3JPPA 4M9HA 4I2DA 4YMNA 4TUPA 4K9AA 9ICRA 8ICOA 7ICLA 4FHXA 3JPOA 4KLUA 2ISPA 5DB6A 5CB1A 4MFAA 5HRBA 3C5FA 1ZQNA 5J0QA 3RJIA 5D49A 4K4HA 4PHAA 9ICVA 3UXNA 4MF8A 2ZH6A 4KB6A 4GXKA 4X4QA 2DR7A 1MQ2A 2DVIA 4M9NA 4XQ7A 2B4VA 4RWNA 5HHHA 7ICOA 5HRIA 5B3PA 4OAGA 3HIYA 4IQVA 9ICSA 9ICIA 5HRHA 3EF2A 5CP2A 3ISBA 3WFPA 7ICEA 5D4BA 5J0SA 1ZQZA 4LT6A 4DOAA 4JWNA 7ICRA 2HHPA 4WOYA 4EEBA 4M04A 4I2IA 1ZQTA 4MKPA 1ZQYA 5HRLA 5DB9A 4I2AA 4OAHA 3LQCB 1ZQJA 8ICEA 2P66A 8ICCA 3TFRA 1VFGA 5BPCA 3AQKA 1ZQUA 1ZJMA 1VJ7A 5IIMA 2PFQA 4EP7A 4KLHA 9ICBA 4RT2A 7ICVA 1UEVA 4UB3A 5DB7A 1ZQOA 4RQ4A 3RJFA 1TVAA 5CHEA 4UBCA 4AT9A 3OWGA 1MIVA 4XRHA 3RH6A 4WC0A 1Q78A 4PPXA 4X4OA 1ZJNA 2PBEA 4QZHA 3H3AA 3V7LA 3JYYA 1GPJA 4RQ8A 7ICIA 1ZQVA 4KLFA 4YD2A 2HN1A 1ZQWA 8ICNA 2IHOA 5HRFA 4E8FA 4DOCA 1ZQBA 1WOTA 4KLTA 4X5VA 8ICQA 5IIKA 4EEDA 4LZDA 4WCWA 1ZQIA 4UD4A 4RPXA 4NXZA 2BPFA 3B0XA 4O67A 7ICFA 4F5PA 5D62A 2DR8A 2FMSA 4QZBA 3PMLA 4AT7A 5J2GA 3HJ1A 4IQUA 1BPBA 5J0UA 3OUYB 4I2GA 1XSPA 4KLDA 4KLQA 3WFSC 7ICKA 4I2JA 2ZH2A 4QZIA 4K4IA 9ICJA 2W9MA 3NVOA 2ZH5A 4RWQA 5J0YA 1ZQKA 2BCUA 5J2BA 5CR0A 5J0TA 3C66A 4FH3A 7ICQA 4WC7A 8ICKA 5J0PA 1R8CA 4M47A 4RQ1A 4NXUA 1JQRA 4KM5A 4R66A 5D61A 4MFCA 8ICTA 3JPRA 4EV6A 3OVSA 1BPYA 1RPLA 2HN2A 4NXTA 3PMNA 9ICPA 4WC6A 5CFSA 4X4TA 3RJGA 2I9GA 1TFWA 7ICNA 4LEYA 9ICEA 1ZQFA 2NRKA 3V7JA 1ZQPA 4LZGA 4KLEA 1ZQQA 3RJKA 3C18A 4KLIA 5J2JA 2ZH1A 9ICMA 4NY8A 3RJHA 5CA7A 3JZ0A 5DBAA 4S3NA 3C2MA 4RQ0A 4QZDA 4O5CA 4KLGA 5F2VO 4X4RA 8ICAA 3ER9B 3AUOA 2BCQA 4AT7B 1ZQGA 3C5GA 1BPZA 4P4OA 4F5QA 5HHIA 5J2HA 3UQ2A 3MGHA 4O6AA 3AU6A 1V4AA 4E80A 8ICZA 4X0AA 9ICGA 5J29A 5CWRA 3C2LA 2DRBA 9ICTA 4R64A 4I27A 4I2EA 5J2AA 8ICJA 4EBKA 2PFPA 1KNYA 2DR9A 4UB1A 4N7RA 8ICSA 3ERCC 3MCRA 5IIJA 4K4GA 4NXXA 4HX0A 4YMOA 5B3QA 4PHDA 3C2KA 1NOMA 9ICXA 4K99A 4NKTA 4NKUA 4F5OA 3MDAA 4RQ3A 1KDHA 3OGUA 8ICYA 4UB2A 3ER8C 4K97A 3UPSA 4JLZA 9ICCA 2PFNA 5BOMA 4X4SA 4WQKA 2EWRA 3H37A 2FMQA 8ICLA 2ZH3A 3OVBA 4RWOA 3JPTA 4GXIA 5DECA 4O5KA 3HX0A 5DBCA 5IINA 5IILA 9ICLA 4I2CA 4KLLA 5HRKA 4QZCA 4M9GA 8ICVA 4RWPA 2M2WA 4I2FA 1HUZA 4WC3A 5J0RA 1BPEA 2RFFA 5D63A 2PXIA 3NWIA 3NKUA 1BPDA 4PHPA 4UAWA 2FMPA 4EGWA 5HREA 8ICHA 9ICHA 4WC4A 8ICGA 1MIYA 4P4PA 7ICTA 3MDCA 1ZQCA 2Q66A 9ICKA 1ZQXA 4UB4A 5CJ7A 4M5DA 2O1PA 5HC9A 9ICUA 4XA5A 4K96A 1JN3A 2ZH7A 2FCLA 2GA9D 1R8BA 4R63A 1OU5A 4Z6EA 5J2EA 4TUSA 2IHMA 4EBJA 5TZVA 5CFTA 1KEJA 1UEUA 5IIOA 3CK6A 4IQTA 4WC5A 2BBHA 4JWMA 3PHZA 5EOZA 1ZQSA 8ICXA 4I0UA 2ZHBA 5DB8A 1JAJA 2VANA 4O5EA 4QZAA 3RJEA 2BBJA 4NM2A 8ICRA 4AT8A 4LEZA 4NLZA 1R8AA 2DR5A 9ICNA 4JLXA 3MBYA 8ICUA 1R89A 9ICOA 4QZGA 1TV9A 4WQLA 3UPQA 4P2HA 4NXWA 4M0AA 4KLMA 2IUBA 3AQLA 1UETA 2M2VA 2ISOA 4YMMA 4X4VA 3HWTA 4ATBA 3H38A 2BPCA 4X0BA 4WC1A 3PNCA 4WBYA 4Z6FA 3RH5A 2O5AA 3RJJA 4NM1A 4OAFA 4DOBA 4X4UA 4FO6A 4NXVA 2GAFD 4YCXA 4K98A 4K9BA 1ZQLA 1ZQMA 4IQWA 5DEDA 7ICHA 5J2CA 7ICGA 3AQMA 2ZH8A 4GXJA 4XJEA 4TURA 4FH5A 2GWSA 5J2KA 4XUSA 5DKWA 5J0OA 7ICPA 3UXPA
chains in the Genus database with same CATH topology
3HJ4A 8ICIA 7ICUA 1ZQHA 3HW8A 5J0WA 1ZQAA 2PFOA 5CHGA 3ISDA 4KLJA 4RPZA 5HRGA 1XSLA 8ICBA 7ICMA 4FHWA 4PGXA 9ICFA 4UBBA 4MF2A 3ISCA 3JPNA 4LVSA 4M2YA 8ICWA 4QZEA 4F5NA 1HUOA 4FHYA 4QZ9A 4PGQA 9ICQA 4YN4A 3WFOA 4QZ8A 5D46A 4E7XA 3MGIA 1YLQA 1MQ3A 4PHEA 3V7KA 5HRDA 4RQ6A 4UAZA 4NLKA 4AT8B 4ATBB 4KLOA 4YD1A 4PGYA 3OUYA 2DRAA 5DDMA 3TFSA 1ZQEA 4AT9B 5J2FA 8ICFA 1TFYA 1FA0A 3AQNA 3LK9A 4NLNA 5J0XA 2BE3A 1PX5A 4WBZA 3OV7A 4KLSA 4XQ8A 3B0YA 4P4MA 3JPQA 3L9DA 1BPXA 3OVAA 4RQ7A 4X4PA 3RH4A 3AU2A 5DDYA 2M2UA 1RZTA 4F5RA 4RQ2A 3UXOA 4TUQA 5HR9A 4UAYA 4M9LA 4WC2A 9ICAA 2BCRA 4I2HA 2ZH9A 4IG8A 4RPYA 4X4NA 1F5AA 4UD5A 2ID1A 1NO5A 2BCVA 4MFFA 1ZQDA 3UQ0A 7ICJA 4R65A 4UB5A 8ICMA 1MIWA 2ZH4A 1JMSA 4QZFA 4RQ5A 4O9MA 3H39A 3WFRE 4M9JA 3WFQE 4FHPA 4Z6DA 3V72A 8ICPA 4FHVA 7ICSA 5J2DA 1Q79A 9ICWA 2BCSA 4Z6CA 5J2IA 3JPSA 4I2BA 3GDXA 4DO9A 3NYBA 4PH5A 4I28A 1ZQRA 4RT3A 5DBBA 5IIIA 2BPGA 4I29A 1XSNA 2ZHAA 5BOLA 3K75D 2M2TA 3JPPA 4M9HA 4I2DA 4YMNA 4TUPA 9ICRA 8ICOA 7ICLA 4FHXA 3JPOA 4KLUA 2ISPA 5DB6A 5CB1A 4MFAA 5HRBA 3C5FA 1ZQNA 5J0QA 3RJIA 5D49A 4K4HA 4PHAA 9ICVA 3UXNA 4MF8A 2ZH6A 4GXKA 4X4QA 2DR7A 1MQ2A 2DVIA 4M9NA 4XQ7A 4RWNA 5HHHA 7ICOA 5HRIA 3HIYA 4IQVA 9ICSA 9ICIA 5HRHA 5CP2A 3ISBA 3WFPA 7ICEA 5D4BA 5J0SA 1ZQZA 4LT6A 4DOAA 4JWNA 7ICRA 2HHPA 4M04A 4I2IA 1ZQTA 1ZQYA 5HRLA 5DB9A 4I2AA 3LQCB 1ZQJA 8ICEA 2P66A 8ICCA 3TFRA 1VFGA 5BPCA 3AQKA 1ZQUA 1ZJMA 1VJ7A 5IIMA 2PFQA 4EP7A 4KLHA 9ICBA 4RT2A 7ICVA 1UEVA 4UB3A 5DB7A 1ZQOA 4RQ4A 3RJFA 1TVAA 4UBCA 4AT9A 1MIVA 4XRHA 3RH6A 4WC0A 1Q78A 4PPXA 4X4OA 1ZJNA 2PBEA 4QZHA 3H3AA 3V7LA 3JYYA 4RQ8A 7ICIA 1ZQVA 4KLFA 4YD2A 1ZQWA 8ICNA 5HRFA 4E8FA 4DOCA 1ZQBA 1WOTA 4KLTA 4X5VA 8ICQA 5IIKA 4LZDA 4WCWA 1ZQIA 4UD4A 4RPXA 4NXZA 2BPFA 3B0XA 7ICFA 4F5PA 2DR8A 2FMSA 4QZBA 3PMLA 4AT7A 5J2GA 3HJ1A 4IQUA 1BPBA 5J0UA 3OUYB 4I2GA 1XSPA 4KLDA 4KLQA 3WFSC 7ICKA 4I2JA 2ZH2A 4QZIA 4K4IA 9ICJA 2W9MA 2ZH5A 4RWQA 5J0YA 1ZQKA 2BCUA 5J2BA 5CR0A 5J0TA 3C66A 4FH3A 7ICQA 4WC7A 8ICKA 5J0PA 1R8CA 4M47A 4RQ1A 1JQRA 4R66A 4MFCA 8ICTA 3JPRA 3OVSA 1BPYA 1RPLA 3PMNA 9ICPA 4WC6A 4X4TA 3RJGA 2I9GA 1TFWA 7ICNA 9ICEA 1ZQFA 2NRKA 3V7JA 1ZQPA 4LZGA 4KLEA 1ZQQA 3RJKA 3C18A 4KLIA 5J2JA 2ZH1A 9ICMA 4NY8A 3RJHA 5CA7A 3JZ0A 5DBAA 4S3NA 3C2MA 4RQ0A 4QZDA 4O5CA 4KLGA 5F2VO 4X4RA 8ICAA 3AUOA 2BCQA 4AT7B 1ZQGA 3C5GA 1BPZA 4P4OA 4F5QA 5HHIA 5J2HA 3UQ2A 3MGHA 3AU6A 1V4AA 4E80A 8ICZA 4X0AA 9ICGA 5J29A 5CWRA 3C2LA 2DRBA 9ICTA 4R64A 4I27A 4I2EA 5J2AA 8ICJA 4EBKA 2PFPA 1KNYA 2DR9A 4UB1A 8ICSA 5IIJA 4K4GA 4YMOA 4PHDA 3C2KA 1NOMA 9ICXA 4NKTA 4NKUA 4F5OA 3MDAA 4RQ3A 1KDHA 3OGUA 8ICYA 4UB2A 3UPSA 9ICCA 2PFNA 5BOMA 4X4SA 3H37A 2FMQA 8ICLA 2ZH3A 3OVBA 4RWOA 3JPTA 4GXIA 5DECA 4O5KA 3HX0A 5DBCA 5IINA 5IILA 9ICLA 4I2CA 4KLLA 5HRKA 4QZCA 4M9GA 8ICVA 4RWPA 2M2WA 4I2FA 1HUZA 4WC3A 5J0RA 1BPEA 2RFFA 2PXIA 1BPDA 4PHPA 4UAWA 2FMPA 5HREA 8ICHA 9ICHA 4WC4A 8ICGA 1MIYA 4P4PA 7ICTA 3MDCA 1ZQCA 2Q66A 9ICKA 1ZQXA 4UB4A 5CJ7A 4M5DA 2O1PA 5HC9A 9ICUA 4XA5A 1JN3A 2ZH7A 1R8BA 4R63A 1OU5A 4Z6EA 5J2EA 4TUSA 2IHMA 4EBJA 5TZVA 5IIOA 1KEJA 1UEUA 4IQTA 4WC5A 4JWMA 5EOZA 1ZQSA 8ICXA 2ZHBA 5DB8A 1JAJA 2VANA 4O5EA 4QZAA 3RJEA 4NM2A 8ICRA 4AT8A 4NLZA 1R8AA 2DR5A 9ICNA 3MBYA 8ICUA 1R89A 9ICOA 4QZGA 1TV9A 3UPQA 4P2HA 4M0AA 4KLMA 3AQLA 1UETA 2M2VA 2ISOA 4YMMA 4X4VA 3HWTA 4ATBA 3H38A 2BPCA 4X0BA 4WC1A 3PNCA 4WBYA 4Z6FA 3RH5A 2O5AA 3RJJA 4NM1A 4DOBA 4X4UA 4FO6A 4YCXA 1ZQLA 1ZQMA 4IQWA 5DEDA 7ICHA 5J2CA 7ICGA 3AQMA 2ZH8A 4GXJA 4TURA 4FH5A 2GWSA 5J2KA 4XUSA 5DKWA 5J0OA 7ICPA 3UXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJ4 A;  8ICI A;  7ICU A;  1ZQH A;  3HW8 A;  5J0W A;  1ZQA A;  2PFO A;  5CHG A;  3ISD A;  4KLJ A;  4RPZ A;  5HRG A;  1XSL A;  8ICB A;  7ICM A;  4FHW A;  4PGX A;  9ICF A;  4UBB A;  4MF2 A;  3ISC A;  3JPN A;  4LVS A;  4M2Y A;  8ICW A;  4QZE A;  4F5N A;  1HUO A;  4FHY A;  4QZ9 A;  4PGQ A;  9ICQ A;  4YN4 A;  3WFO A;  4QZ8 A;  5D46 A;  4E7X A;  3MGI A;  1YLQ A;  1MQ3 A;  4PHE A;  3V7K A;  5HRD A;  4RQ6 A;  4UAZ A;  4NLK A;  4AT8 B;  4ATB B;  4KLO A;  4YD1 A;  4PGY A;  3OUY A;  2DRA A;  5DDM A;  3TFS A;  1ZQE A;  4AT9 B;  5J2F A;  8ICF A;  1TFY A;  1FA0 A;  3AQN A;  3LK9 A;  4NLN A;  5J0X A;  2BE3 A;  1PX5 A;  4WBZ A;  3OV7 A;  4KLS A;  4XQ8 A;  3B0Y A;  4P4M A;  3JPQ A;  3L9D A;  1BPX A;  3OVA A;  4RQ7 A;  4X4P A;  3RH4 A;  3AU2 A;  5DDY A;  2M2U A;  1RZT A;  4F5R A;  4RQ2 A;  3UXO A;  4TUQ A;  5HR9 A;  4UAY A;  4M9L A;  4WC2 A;  9ICA A;  2BCR A;  4I2H A;  2ZH9 A;  4IG8 A;  4RPY A;  4X4N A;  1F5A A;  4UD5 A;  2ID1 A;  1NO5 A;  2BCV A;  4MFF A;  1ZQD A;  3UQ0 A;  7ICJ A;  4R65 A;  4UB5 A;  8ICM A;  1MIW A;  2ZH4 A;  1JMS A;  4QZF A;  4RQ5 A;  4O9M A;  3H39 A;  3WFR E;  4M9J A;  3WFQ E;  4FHP A;  4Z6D A;  3V72 A;  8ICP A;  4FHV A;  7ICS A;  5J2D A;  1Q79 A;  9ICW A;  2BCS A;  4Z6C A;  5J2I A;  3JPS A;  4I2B A;  3GDX A;  4DO9 A;  3NYB A;  4PH5 A;  4I28 A;  1ZQR A;  4RT3 A;  5DBB A;  5III A;  2BPG A;  4I29 A;  1XSN A;  2ZHA A;  5BOL A;  3K75 D;  2M2T A;  3JPP A;  4M9H A;  4I2D A;  4YMN A;  4TUP A;  9ICR A;  8ICO A;  7ICL A;  4FHX A;  3JPO A;  4KLU A;  2ISP A;  5DB6 A;  5CB1 A;  4MFA A;  5HRB A;  3C5F A;  1ZQN A;  5J0Q A;  3RJI A;  5D49 A;  4K4H A;  4PHA A;  9ICV A;  3UXN A;  4MF8 A;  2ZH6 A;  4GXK A;  4X4Q A;  2DR7 A;  1MQ2 A;  2DVI A;  4M9N A;  4XQ7 A;  4RWN A;  5HHH A;  7ICO A;  5HRI A;  3HIY A;  4IQV A;  9ICS A;  9ICI A;  5HRH A;  5CP2 A;  3ISB A;  3WFP A;  7ICE A;  5D4B A;  5J0S A;  1ZQZ A;  4LT6 A;  4DOA A;  4JWN A;  7ICR A;  2HHP A;  4M04 A;  4I2I A;  1ZQT A;  1ZQY A;  5HRL A;  5DB9 A;  4I2A A;  3LQC B;  1ZQJ A;  8ICE A;  2P66 A;  8ICC A;  3TFR A;  1VFG A;  5BPC A;  3AQK A;  1ZQU A;  1ZJM A;  1VJ7 A;  5IIM A;  2PFQ A;  4EP7 A;  4KLH A;  9ICB A;  4RT2 A;  7ICV A;  1UEV A;  4UB3 A;  5DB7 A;  1ZQO A;  4RQ4 A;  3RJF A;  1TVA A;  4UBC A;  4AT9 A;  1MIV A;  4XRH A;  3RH6 A;  4WC0 A;  1Q78 A;  4PPX A;  4X4O A;  1ZJN A;  2PBE A;  4QZH A;  3H3A A;  3V7L A;  3JYY A;  4RQ8 A;  7ICI A;  1ZQV A;  4KLF A;  4YD2 A;  1ZQW A;  8ICN A;  5HRF A;  4E8F A;  4DOC A;  1ZQB A;  1WOT A;  4KLT A;  4X5V A;  8ICQ A;  5IIK A;  4LZD A;  4WCW A;  1ZQI A;  4UD4 A;  4RPX A;  4NXZ A;  2BPF A;  3B0X A;  7ICF A;  4F5P A;  2DR8 A;  2FMS A;  4QZB A;  3PML A;  4AT7 A;  5J2G A;  3HJ1 A;  4IQU A;  1BPB A;  5J0U A;  3OUY B;  4I2G A;  1XSP A;  4KLD A;  4KLQ A;  3WFS C;  7ICK A;  4I2J A;  2ZH2 A;  4QZI A;  4K4I A;  9ICJ A;  2W9M A;  2ZH5 A;  4RWQ A;  5J0Y A;  1ZQK A;  2BCU A;  5J2B A;  5CR0 A;  5J0T A;  3C66 A;  4FH3 A;  7ICQ A;  4WC7 A;  8ICK A;  5J0P A;  1R8C A;  4M47 A;  4RQ1 A;  1JQR A;  4R66 A;  4MFC A;  8ICT A;  3JPR A;  3OVS A;  1BPY A;  1RPL A;  3PMN A;  9ICP A;  4WC6 A;  4X4T A;  3RJG A;  2I9G A;  1TFW A;  7ICN A;  9ICE A;  1ZQF A;  2NRK A;  3V7J A;  1ZQP A;  4LZG A;  4KLE A;  1ZQQ A;  3RJK A;  3C18 A;  4KLI A;  5J2J A;  2ZH1 A;  9ICM A;  4NY8 A;  3RJH A;  5CA7 A;  3JZ0 A;  5DBA A;  4S3N A;  3C2M A;  4RQ0 A;  4QZD A;  4O5C A;  4KLG A;  5F2V O;  4X4R A;  8ICA A;  3AUO A;  2BCQ A;  4AT7 B;  1ZQG A;  3C5G A;  1BPZ A;  4P4O A;  4F5Q A;  5HHI A;  5J2H A;  3UQ2 A;  3MGH A;  3AU6 A;  1V4A A;  4E80 A;  8ICZ A;  4X0A A;  9ICG A;  5J29 A;  5CWR A;  3C2L A;  2DRB A;  9ICT A;  4R64 A;  4I27 A;  4I2E A;  5J2A A;  8ICJ A;  4EBK A;  2PFP A;  1KNY A;  2DR9 A;  4UB1 A;  8ICS A;  5IIJ A;  4K4G A;  4YMO A;  4PHD A;  3C2K A;  1NOM A;  9ICX A;  4NKT A;  4NKU A;  4F5O A;  3MDA A;  4RQ3 A;  1KDH A;  3OGU A;  8ICY A;  4UB2 A;  3UPS A;  9ICC A;  2PFN A;  5BOM A;  4X4S A;  3H37 A;  2FMQ A;  8ICL A;  2ZH3 A;  3OVB A;  4RWO A;  3JPT A;  4GXI A;  5DEC A;  4O5K A;  3HX0 A;  5DBC A;  5IIN A;  5IIL A;  9ICL A;  4I2C A;  4KLL A;  5HRK A;  4QZC A;  4M9G A;  8ICV A;  4RWP A;  2M2W A;  4I2F A;  1HUZ A;  4WC3 A;  5J0R A;  1BPE A;  2RFF A;  2PXI A;  1BPD A;  4PHP A;  4UAW A;  2FMP A;  5HRE A;  8ICH A;  9ICH A;  4WC4 A;  8ICG A;  1MIY A;  4P4P A;  7ICT A;  3MDC A;  1ZQC A;  2Q66 A;  9ICK A;  1ZQX A;  4UB4 A;  5CJ7 A;  4M5D A;  2O1P A;  5HC9 A;  9ICU A;  4XA5 A;  1JN3 A;  2ZH7 A;  1R8B A;  4R63 A;  1OU5 A;  4Z6E A;  5J2E A;  4TUS A;  2IHM A;  4EBJ A;  5TZV A;  5IIO A;  1KEJ A;  1UEU A;  4IQT A;  4WC5 A;  4JWM A;  5EOZ A;  1ZQS A;  8ICX A;  2ZHB A;  5DB8 A;  1JAJ A;  2VAN A;  4O5E A;  4QZA A;  3RJE A;  4NM2 A;  8ICR A;  4AT8 A;  4NLZ A;  1R8A A;  2DR5 A;  9ICN A;  3MBY A;  8ICU A;  1R89 A;  9ICO A;  4QZG A;  1TV9 A;  3UPQ A;  4P2H A;  4M0A A;  4KLM A;  3AQL A;  1UET A;  2M2V A;  2ISO A;  4YMM A;  4X4V A;  3HWT A;  4ATB A;  3H38 A;  2BPC A;  4X0B A;  4WC1 A;  3PNC A;  4WBY A;  4Z6F A;  3RH5 A;  2O5A A;  3RJJ A;  4NM1 A;  4DOB A;  4X4U A;  4FO6 A;  4YCX A;  1ZQL A;  1ZQM A;  4IQW A;  5DED A;  7ICH A;  5J2C A;  7ICG A;  3AQM A;  2ZH8 A;  4GXJ A;  4TUR A;  4FH5 A;  2GWS A;  5J2K A;  4XUS A;  5DKW A;  5J0O A;  7ICP A;  3UXP A; 
#chains in the Genus database with same CATH topology
 3HJ4 A;  8ICI A;  5JTG A;  7ICU A;  1ZQH A;  3HW8 A;  5J0W A;  1ZQA A;  2PFO A;  5CHG A;  3ISD A;  4WH5 A;  4KLJ A;  4RPZ A;  5HRG A;  1XSL A;  8ICB A;  7ICM A;  4FHW A;  4PGX A;  9ICF A;  4UBB A;  4MF2 A;  3ISC A;  3JPN A;  4LEW A;  4LVS A;  4O68 A;  4M2Y A;  8ICW A;  4QZE A;  4F5N A;  1HUO A;  4FHY A;  4O69 A;  4QZ9 A;  4K8V A;  4PGQ A;  9ICQ A;  4YN4 A;  3WFO A;  4QZ8 A;  5CFU A;  5D46 A;  4E7X A;  3MGI A;  1YLQ A;  1MQ3 A;  3JCF A;  4PHE A;  3V7K A;  5HRD A;  4RQ6 A;  4UAZ A;  4NLK A;  4FO1 A;  2B51 A;  4AT8 B;  4ATB B;  4KLO A;  4YD1 A;  4PGY A;  3OUY A;  2DRA A;  5DDM A;  3TFS A;  1ZQE A;  4AT9 B;  5J2F A;  8ICF A;  1TFY A;  1FA0 A;  3AQN A;  3K7D A;  3LK9 A;  4NLN A;  5J0X A;  2BE3 A;  1PX5 A;  4WBZ A;  3OV7 A;  4KLS A;  4XQ8 A;  3B0Y A;  4P4M A;  3JPQ A;  3L9D A;  1BPX A;  3OVA A;  4RQ7 A;  4X4P A;  2B56 A;  4OAI Z;  3RH4 A;  3AU2 A;  5DDY A;  2M2U A;  1RZT A;  4F5R A;  4RQ2 A;  3UXO A;  4TUQ A;  5HR9 A;  4UAY A;  4M9L A;  4WC2 A;  9ICA A;  2BCR A;  4I2H A;  2ZH9 A;  4IG8 A;  4RPY A;  4X4N A;  1F5A A;  4UD5 A;  2ID1 A;  1NO5 A;  2BCV A;  4MFF A;  1ZQD A;  3UQ0 A;  7ICJ A;  4R65 A;  4UB5 A;  8ICM A;  1MIW A;  2ZH4 A;  1JMS A;  4QZF A;  4RQ5 A;  4O9M A;  3H39 A;  3WFR E;  4M9J A;  3WFQ E;  4FHP A;  4Z6D A;  3V72 A;  8ICP A;  4FHV A;  7ICS A;  5J2D A;  1Q79 A;  9ICW A;  2BCS A;  4Z6C A;  5J2I A;  3JPS A;  4I2B A;  3GDX A;  3NYB A;  4PH5 A;  4DO9 A;  4I28 A;  1ZQR A;  4RT3 A;  5DBB A;  5III A;  2BPG A;  4I29 A;  1XSN A;  2ZHA A;  5BOL A;  3K75 D;  2M2T A;  4LEV A;  3JPP A;  4M9H A;  4I2D A;  4YMN A;  4TUP A;  4K9A A;  9ICR A;  8ICO A;  7ICL A;  4FHX A;  3JPO A;  4KLU A;  2ISP A;  5DB6 A;  5CB1 A;  4MFA A;  5HRB A;  3C5F A;  1ZQN A;  5J0Q A;  3RJI A;  5D49 A;  4K4H A;  4PHA A;  9ICV A;  3UXN A;  4MF8 A;  2ZH6 A;  4KB6 A;  4GXK A;  4X4Q A;  2DR7 A;  1MQ2 A;  2DVI A;  4M9N A;  4XQ7 A;  2B4V A;  4RWN A;  5HHH A;  7ICO A;  5HRI A;  5B3P A;  4OAG A;  3HIY A;  4IQV A;  9ICS A;  9ICI A;  5HRH A;  3EF2 A;  5CP2 A;  3ISB A;  3WFP A;  7ICE A;  5D4B A;  5J0S A;  1ZQZ A;  4LT6 A;  4DOA A;  4JWN A;  7ICR A;  2HHP A;  4WOY A;  4EEB A;  4M04 A;  4I2I A;  1ZQT A;  4MKP A;  1ZQY A;  5HRL A;  5DB9 A;  4I2A A;  4OAH A;  3LQC B;  1ZQJ A;  8ICE A;  2P66 A;  8ICC A;  3TFR A;  1VFG A;  5BPC A;  3AQK A;  1ZQU A;  1ZJM A;  1VJ7 A;  5IIM A;  2PFQ A;  4EP7 A;  4KLH A;  9ICB A;  4RT2 A;  7ICV A;  1UEV A;  4UB3 A;  5DB7 A;  1ZQO A;  4RQ4 A;  3RJF A;  1TVA A;  5CHE A;  4UBC A;  4AT9 A;  3OWG A;  1MIV A;  4XRH A;  3RH6 A;  4WC0 A;  1Q78 A;  4PPX A;  4X4O A;  1ZJN A;  2PBE A;  4QZH A;  3H3A A;  3V7L A;  3JYY A;  1GPJ A;  4RQ8 A;  7ICI A;  1ZQV A;  4KLF A;  4YD2 A;  2HN1 A;  1ZQW A;  8ICN A;  2IHO A;  5HRF A;  4E8F A;  4DOC A;  1ZQB A;  1WOT A;  4KLT A;  4X5V A;  8ICQ A;  5IIK A;  4EED A;  4LZD A;  4WCW A;  1ZQI A;  4UD4 A;  4RPX A;  4NXZ A;  2BPF A;  3B0X A;  4O67 A;  7ICF A;  4F5P A;  5D62 A;  2DR8 A;  2FMS A;  4QZB A;  3PML A;  4AT7 A;  5J2G A;  3HJ1 A;  4IQU A;  1BPB A;  5J0U A;  3OUY B;  4I2G A;  1XSP A;  4KLD A;  4KLQ A;  3WFS C;  7ICK A;  4I2J A;  2ZH2 A;  4QZI A;  4K4I A;  9ICJ A;  2W9M A;  3NVO A;  2ZH5 A;  4RWQ A;  5J0Y A;  1ZQK A;  2BCU A;  5J2B A;  5CR0 A;  5J0T A;  3C66 A;  4FH3 A;  7ICQ A;  4WC7 A;  8ICK A;  5J0P A;  1R8C A;  4M47 A;  4RQ1 A;  4NXU A;  1JQR A;  4KM5 A;  4R66 A;  5D61 A;  4MFC A;  8ICT A;  3JPR A;  4EV6 A;  3OVS A;  1BPY A;  1RPL A;  2HN2 A;  4NXT A;  3PMN A;  9ICP A;  4WC6 A;  5CFS A;  4X4T A;  3RJG A;  2I9G A;  1TFW A;  7ICN A;  4LEY A;  9ICE A;  1ZQF A;  2NRK A;  3V7J A;  1ZQP A;  4LZG A;  4KLE A;  1ZQQ A;  3RJK A;  3C18 A;  4KLI A;  5J2J A;  2ZH1 A;  9ICM A;  4NY8 A;  3RJH A;  5CA7 A;  3JZ0 A;  5DBA A;  4S3N A;  3C2M A;  4RQ0 A;  4QZD A;  4O5C A;  4KLG A;  5F2V O;  4X4R A;  8ICA A;  3ER9 B;  3AUO A;  2BCQ A;  4AT7 B;  1ZQG A;  3C5G A;  1BPZ A;  4P4O A;  4F5Q A;  5HHI A;  5J2H A;  3UQ2 A;  3MGH A;  4O6A A;  3AU6 A;  1V4A A;  4E80 A;  8ICZ A;  4X0A A;  9ICG A;  5J29 A;  5CWR A;  3C2L A;  2DRB A;  9ICT A;  4R64 A;  4I27 A;  4I2E A;  5J2A A;  8ICJ A;  4EBK A;  2PFP A;  1KNY A;  2DR9 A;  4UB1 A;  4N7R A;  8ICS A;  3ERC C;  3MCR A;  5IIJ A;  4K4G A;  4NXX A;  4HX0 A;  4YMO A;  5B3Q A;  4PHD A;  3C2K A;  1NOM A;  9ICX A;  4K99 A;  4NKT A;  4NKU A;  4F5O A;  3MDA A;  4RQ3 A;  1KDH A;  3OGU A;  8ICY A;  4UB2 A;  3ER8 C;  4K97 A;  3UPS A;  4JLZ A;  9ICC A;  2PFN A;  5BOM A;  4X4S A;  4WQK A;  2EWR A;  3H37 A;  2FMQ A;  8ICL A;  2ZH3 A;  3OVB A;  4RWO A;  3JPT A;  4GXI A;  5DEC A;  4O5K A;  3HX0 A;  5DBC A;  5IIN A;  5IIL A;  9ICL A;  4I2C A;  4KLL A;  5HRK A;  4QZC A;  4M9G A;  8ICV A;  4RWP A;  2M2W A;  4I2F A;  1HUZ A;  4WC3 A;  5J0R A;  1BPE A;  2RFF A;  5D63 A;  2PXI A;  3NWI A;  3NKU A;  1BPD A;  4PHP A;  4UAW A;  2FMP A;  4EGW A;  5HRE A;  8ICH A;  9ICH A;  4WC4 A;  8ICG A;  1MIY A;  4P4P A;  7ICT A;  3MDC A;  1ZQC A;  2Q66 A;  9ICK A;  1ZQX A;  4UB4 A;  5CJ7 A;  4M5D A;  2O1P A;  5HC9 A;  9ICU A;  4XA5 A;  4K96 A;  1JN3 A;  2ZH7 A;  2FCL A;  2GA9 D;  1R8B A;  4R63 A;  1OU5 A;  4Z6E A;  5J2E A;  4TUS A;  2IHM A;  4EBJ A;  5TZV A;  5CFT A;  1KEJ A;  1UEU A;  5IIO A;  3CK6 A;  4IQT A;  4WC5 A;  2BBH A;  4JWM A;  3PHZ A;  5EOZ A;  1ZQS A;  8ICX A;  4I0U A;  2ZHB A;  5DB8 A;  1JAJ A;  2VAN A;  4O5E A;  4QZA A;  3RJE A;  2BBJ A;  4NM2 A;  8ICR A;  4AT8 A;  4LEZ A;  4NLZ A;  1R8A A;  2DR5 A;  9ICN A;  4JLX A;  3MBY A;  8ICU A;  1R89 A;  9ICO A;  4QZG A;  1TV9 A;  4WQL A;  3UPQ A;  4P2H A;  4NXW A;  4M0A A;  4KLM A;  2IUB A;  3AQL A;  1UET A;  2M2V A;  2ISO A;  4YMM A;  4X4V A;  3HWT A;  4ATB A;  3H38 A;  2BPC A;  4X0B A;  4WC1 A;  3PNC A;  4WBY A;  4Z6F A;  3RH5 A;  2O5A A;  3RJJ A;  4NM1 A;  4OAF A;  4DOB A;  4X4U A;  4FO6 A;  4NXV A;  2GAF D;  4YCX A;  4K98 A;  4K9B A;  1ZQL A;  1ZQM A;  4IQW A;  5DED A;  7ICH A;  5J2C A;  7ICG A;  3AQM A;  2ZH8 A;  4GXJ A;  4XJE A;  4TUR A;  4FH5 A;  2GWS A;  5J2K A;  4XUS A;  5DKW A;  5J0O A;  7ICP A;  3UXP A; 
#chains in the Genus database with same CATH homology
 3HJ4 A;  8ICI A;  7ICU A;  1ZQH A;  3HW8 A;  5J0W A;  1ZQA A;  2PFO A;  5CHG A;  3ISD A;  4KLJ A;  4RPZ A;  5HRG A;  1XSL A;  8ICB A;  7ICM A;  4FHW A;  4PGX A;  9ICF A;  4UBB A;  4MF2 A;  3ISC A;  3JPN A;  4LVS A;  4M2Y A;  8ICW A;  4QZE A;  4F5N A;  1HUO A;  4FHY A;  4QZ9 A;  4PGQ A;  9ICQ A;  4YN4 A;  3WFO A;  4QZ8 A;  5D46 A;  4E7X A;  3MGI A;  1YLQ A;  1MQ3 A;  4PHE A;  3V7K A;  5HRD A;  4RQ6 A;  4UAZ A;  4NLK A;  4AT8 B;  4ATB B;  4KLO A;  4YD1 A;  4PGY A;  3OUY A;  2DRA A;  5DDM A;  3TFS A;  1ZQE A;  4AT9 B;  5J2F A;  8ICF A;  1TFY A;  1FA0 A;  3AQN A;  3LK9 A;  4NLN A;  5J0X A;  2BE3 A;  1PX5 A;  4WBZ A;  3OV7 A;  4KLS A;  4XQ8 A;  3B0Y A;  4P4M A;  3JPQ A;  3L9D A;  1BPX A;  3OVA A;  4RQ7 A;  4X4P A;  3RH4 A;  3AU2 A;  5DDY A;  2M2U A;  1RZT A;  4F5R A;  4RQ2 A;  3UXO A;  4TUQ A;  5HR9 A;  4UAY A;  4M9L A;  4WC2 A;  9ICA A;  2BCR A;  4I2H A;  2ZH9 A;  4IG8 A;  4RPY A;  4X4N A;  1F5A A;  4UD5 A;  2ID1 A;  1NO5 A;  2BCV A;  4MFF A;  1ZQD A;  3UQ0 A;  7ICJ A;  4R65 A;  4UB5 A;  8ICM A;  1MIW A;  2ZH4 A;  1JMS A;  4QZF A;  4RQ5 A;  4O9M A;  3H39 A;  3WFR E;  4M9J A;  3WFQ E;  4FHP A;  4Z6D A;  3V72 A;  8ICP A;  4FHV A;  7ICS A;  5J2D A;  1Q79 A;  9ICW A;  2BCS A;  4Z6C A;  5J2I A;  3JPS A;  4I2B A;  3GDX A;  4DO9 A;  3NYB A;  4PH5 A;  4I28 A;  1ZQR A;  4RT3 A;  5DBB A;  5III A;  2BPG A;  4I29 A;  1XSN A;  2ZHA A;  5BOL A;  3K75 D;  2M2T A;  3JPP A;  4M9H A;  4I2D A;  4YMN A;  4TUP A;  9ICR A;  8ICO A;  7ICL A;  4FHX A;  3JPO A;  4KLU A;  2ISP A;  5DB6 A;  5CB1 A;  4MFA A;  5HRB A;  3C5F A;  1ZQN A;  5J0Q A;  3RJI A;  5D49 A;  4K4H A;  4PHA A;  9ICV A;  3UXN A;  4MF8 A;  2ZH6 A;  4GXK A;  4X4Q A;  2DR7 A;  1MQ2 A;  2DVI A;  4M9N A;  4XQ7 A;  4RWN A;  5HHH A;  7ICO A;  5HRI A;  3HIY A;  4IQV A;  9ICS A;  9ICI A;  5HRH A;  5CP2 A;  3ISB A;  3WFP A;  7ICE A;  5D4B A;  5J0S A;  1ZQZ A;  4LT6 A;  4DOA A;  4JWN A;  7ICR A;  2HHP A;  4M04 A;  4I2I A;  1ZQT A;  1ZQY A;  5HRL A;  5DB9 A;  4I2A A;  3LQC B;  1ZQJ A;  8ICE A;  2P66 A;  8ICC A;  3TFR A;  1VFG A;  5BPC A;  3AQK A;  1ZQU A;  1ZJM A;  1VJ7 A;  5IIM A;  2PFQ A;  4EP7 A;  4KLH A;  9ICB A;  4RT2 A;  7ICV A;  1UEV A;  4UB3 A;  5DB7 A;  1ZQO A;  4RQ4 A;  3RJF A;  1TVA A;  4UBC A;  4AT9 A;  1MIV A;  4XRH A;  3RH6 A;  4WC0 A;  1Q78 A;  4PPX A;  4X4O A;  1ZJN A;  2PBE A;  4QZH A;  3H3A A;  3V7L A;  3JYY A;  4RQ8 A;  7ICI A;  1ZQV A;  4KLF A;  4YD2 A;  1ZQW A;  8ICN A;  5HRF A;  4E8F A;  4DOC A;  1ZQB A;  1WOT A;  4KLT A;  4X5V A;  8ICQ A;  5IIK A;  4LZD A;  4WCW A;  1ZQI A;  4UD4 A;  4RPX A;  4NXZ A;  2BPF A;  3B0X A;  7ICF A;  4F5P A;  2DR8 A;  2FMS A;  4QZB A;  3PML A;  4AT7 A;  5J2G A;  3HJ1 A;  4IQU A;  1BPB A;  5J0U A;  3OUY B;  4I2G A;  1XSP A;  4KLD A;  4KLQ A;  3WFS C;  7ICK A;  4I2J A;  2ZH2 A;  4QZI A;  4K4I A;  9ICJ A;  2W9M A;  2ZH5 A;  4RWQ A;  5J0Y A;  1ZQK A;  2BCU A;  5J2B A;  5CR0 A;  5J0T A;  3C66 A;  4FH3 A;  7ICQ A;  4WC7 A;  8ICK A;  5J0P A;  1R8C A;  4M47 A;  4RQ1 A;  1JQR A;  4R66 A;  4MFC A;  8ICT A;  3JPR A;  3OVS A;  1BPY A;  1RPL A;  3PMN A;  9ICP A;  4WC6 A;  4X4T A;  3RJG A;  2I9G A;  1TFW A;  7ICN A;  9ICE A;  1ZQF A;  2NRK A;  3V7J A;  1ZQP A;  4LZG A;  4KLE A;  1ZQQ A;  3RJK A;  3C18 A;  4KLI A;  5J2J A;  2ZH1 A;  9ICM A;  4NY8 A;  3RJH A;  5CA7 A;  3JZ0 A;  5DBA A;  4S3N A;  3C2M A;  4RQ0 A;  4QZD A;  4O5C A;  4KLG A;  5F2V O;  4X4R A;  8ICA A;  3AUO A;  2BCQ A;  4AT7 B;  1ZQG A;  3C5G A;  1BPZ A;  4P4O A;  4F5Q A;  5HHI A;  5J2H A;  3UQ2 A;  3MGH A;  3AU6 A;  1V4A A;  4E80 A;  8ICZ A;  4X0A A;  9ICG A;  5J29 A;  5CWR A;  3C2L A;  2DRB A;  9ICT A;  4R64 A;  4I27 A;  4I2E A;  5J2A A;  8ICJ A;  4EBK A;  2PFP A;  1KNY A;  2DR9 A;  4UB1 A;  8ICS A;  5IIJ A;  4K4G A;  4YMO A;  4PHD A;  3C2K A;  1NOM A;  9ICX A;  4NKT A;  4NKU A;  4F5O A;  3MDA A;  4RQ3 A;  1KDH A;  3OGU A;  8ICY A;  4UB2 A;  3UPS A;  9ICC A;  2PFN A;  5BOM A;  4X4S A;  3H37 A;  2FMQ A;  8ICL A;  2ZH3 A;  3OVB A;  4RWO A;  3JPT A;  4GXI A;  5DEC A;  4O5K A;  3HX0 A;  5DBC A;  5IIN A;  5IIL A;  9ICL A;  4I2C A;  4KLL A;  5HRK A;  4QZC A;  4M9G A;  8ICV A;  4RWP A;  2M2W A;  4I2F A;  1HUZ A;  4WC3 A;  5J0R A;  1BPE A;  2RFF A;  2PXI A;  1BPD A;  4PHP A;  4UAW A;  2FMP A;  5HRE A;  8ICH A;  9ICH A;  4WC4 A;  8ICG A;  1MIY A;  4P4P A;  7ICT A;  3MDC A;  1ZQC A;  2Q66 A;  9ICK A;  1ZQX A;  4UB4 A;  5CJ7 A;  4M5D A;  2O1P A;  5HC9 A;  9ICU A;  4XA5 A;  1JN3 A;  2ZH7 A;  1R8B A;  4R63 A;  1OU5 A;  4Z6E A;  5J2E A;  4TUS A;  2IHM A;  4EBJ A;  5TZV A;  5IIO A;  1KEJ A;  1UEU A;  4IQT A;  4WC5 A;  4JWM A;  5EOZ A;  1ZQS A;  8ICX A;  2ZHB A;  5DB8 A;  1JAJ A;  2VAN A;  4O5E A;  4QZA A;  3RJE A;  4NM2 A;  8ICR A;  4AT8 A;  4NLZ A;  1R8A A;  2DR5 A;  9ICN A;  3MBY A;  8ICU A;  1R89 A;  9ICO A;  4QZG A;  1TV9 A;  3UPQ A;  4P2H A;  4M0A A;  4KLM A;  3AQL A;  1UET A;  2M2V A;  2ISO A;  4YMM A;  4X4V A;  3HWT A;  4ATB A;  3H38 A;  2BPC A;  4X0B A;  4WC1 A;  3PNC A;  4WBY A;  4Z6F A;  3RH5 A;  2O5A A;  3RJJ A;  4NM1 A;  4DOB A;  4X4U A;  4FO6 A;  4YCX A;  1ZQL A;  1ZQM A;  4IQW A;  5DED A;  7ICH A;  5J2C A;  7ICG A;  3AQM A;  2ZH8 A;  4GXJ A;  4TUR A;  4FH5 A;  2GWS A;  5J2K A;  4XUS A;  5DKW A;  5J0O A;  7ICP A;  3UXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...