4X0AA

Structure of trna-processing enzyme complex 6
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
381
structure length
367
Chain Sequence
b'MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 112
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4x0aA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4x0aA01
4O5KA 2ZH7A 3AQKA 1BPXA 4I2DA 3HJ1A 4WC1A 8ICIA 5HRKA 3OVBA 9ICLA 5DBAA 3C5GA 5IINA 4KLQA 3MDCA 4AT8B 1ZQMA 4UAYA 5J2HA 4F5OA 1HUZA 4X4QA 4QZIA 4Z6CA 4IQTA 4I2FA 4QZCA 4RT2A 3LK9A 1BPYA 4JWNA 4LT6A 5F2VO 2O5AA 9ICHA 1MIYA 4RQ7A 3AQMA 2M2WA 8ICEA 4EP7A 9ICXA 4FH5A 4UB5A 8ICAA 4QZ8A 8ICVA 4LVSA 4QZFA 1JQRA 4KLHA 2ID1A 3V7LA 1ZQUA 4RQ8A 4NLZA 3HIYA 1VJ7A 3C66A 1ZQGA 4KLTA 5IIMA 1ZQSA 7ICOA 4XRHA 1ZQFA 4R65A 4UBCA 4KLMA 1R8BA 3MBYA 5HRHA 3UQ0A 4O9MA 4M9NA 3JPSA 3C2LA 4MFCA 4P4OA 4K4IA 9ICUA 5CR0A 3HWTA 5J2GA 4KLFA 3JYYA 9ICFA 9ICOA 4AT8A 4M0AA 3B0YA 5HRBA 1XSLA 5J0UA 4NY8A 1R8CA 4YCXA 4IQUA 3WFQE 3MGHA 4ATBB 3AUOA 1ZQQA 4RQ3A 5J0QA 1TFWA 4M9HA 5HRGA 4Z6EA 4YD2A 4RPXA 2ZH1A 1BPEA 4QZBA 5DDMA 9ICKA 1ZQBA 3V72A 4DOBA 3HX0A 2M2VA 3C5FA 8ICBA 1MIWA 5D49A 4X4NA 3RH4A 4I28A 5J0OA 3MGIA 5D4BA 4YN4A 4TURA 1ZQYA 1NO5A 3ISCA 4EBJA 2NRKA 8ICTA 1V4AA 2HHPA 4AT9A 4RQ0A 8ICUA 4I2GA 5J2KA 1PX5A 5DB7A 2O1PA 4QZAA 3WFOA 4X4OA 4E7XA 3RJFA 5DECA 5J0XA 2ZHAA 5J0YA 3HW8A 2ZHBA 4WC5A 1ZQHA 3OVSA 8ICLA 2IHMA 9ICWA 4PGXA 2ZH3A 4WC7A 2PFNA 7ICMA 4NM1A 2DRBA 4QZGA 3JPOA 4I2AA 4ATBA 2BPGA 4IG8A 2PFOA 2BE3A 4DOCA 9ICJA 1XSNA 2ISOA 4M5DA 4FHYA 3HJ4A 4NKUA 1JN3A 1WOTA 1VFGA 3UPQA 4RQ6A 1Q78A 1TVAA 4E8FA 2VANA 4QZDA 1NOMA 3NYBA 4KLGA 2ZH9A 3PNCA 2ZH2A 5CB1A 5J0WA 2BPFA 3H39A 3UQ2A 5J0SA 1ZJMA 8ICPA 1MQ2A 2DRAA 4FHXA 8ICNA 5J29A 2ISPA 2I9GA 7ICVA 9ICEA 3RJHA 2FMQA 4FO6A 4I2HA 7ICNA 1TFYA 4AT9B 3PMLA 3C18A 1ZQKA 5IIKA 4UBBA 1ZQNA 7ICSA 4KLIA 5HRFA 7ICPA 1Q79A 4YMMA 4JWMA 5IILA 4X4TA 7ICRA 4XQ8A 5BOMA 1ZQVA 4RQ2A 5HC9A 1UEVA 2DVIA 7ICGA 3JZ0A 5HRLA 4Z6DA 7ICLA 5CWRA 3JPTA 4DO9A 4UAWA 4PHAA 3UPSA 4WBYA 3RJIA 7ICQA 4PGQA 7ICIA 3MDAA 2ZH4A 5DKWA 5J2IA 4PHEA 4I2BA 9ICVA 5HHHA 2PFPA 1ZQDA 2DR5A 8ICKA 3AQNA 1BPZA 2W9MA 1ZQZA 5IIIA 1TV9A 4I2JA 3LQCB 4MFFA 1OU5A 4NXZA 1ZQLA 4PGYA 1JAJA 5J2FA 4WC2A 4NM2A 5J2CA 4X4VA 1ZQAA 4F5PA 2BPCA 3H37A 4F5QA 2BCVA 9ICAA 4RWOA 2ZH8A 3TFRA 1ZJNA 4M04A 4RWPA 4S3NA 1ZQOA 3AQLA 4P4MA 3V7JA 2FMPA 4RWQA 4M47A 3RJJA 4Z6FA 4I2IA 4QZHA 4UB3A 3C2KA 4AT7B 9ICCA 3AU6A 5TZVA 4KLEA 8ICMA 2BCRA 4FHPA 3WFRE 8ICCA 1ZQRA 5DDYA 5CP2A 5DEDA 9ICSA 4PHPA 1ZQJA 4M9GA 4I27A 8ICGA 1ZQWA 4XQ7A 3JPRA 2Q66A 7ICFA 5J0RA 3OUYB 4UB4A 4X4SA 1BPBA 4X5VA 1UETA 4GXKA 5DB9A 3TFSA 5HRIA 4TUSA 8ICRA 4WCWA 5J2BA 8ICOA 4GXJA 4WC4A 3GDXA 5J2EA 1ZQIA 4UD4A 4M2YA 5J2JA 4M9JA 4KLUA 1XSPA 9ICPA 3PMNA 4IQWA 4FHWA 4RPZA 4I2CA 5HHIA 1F5AA 4O5EA 2BCSA 3WFSC 1RPLA 4RPYA 4RQ4A 5DBCA 3WFPA 4UAZA 8ICHA 4XA5A 3RJGA 5DBBA 4DOAA 1R89A 1ZQEA 4QZ9A 4MF8A 4PHDA 2PBEA 7ICKA 4GXIA 3RH6A 4X4UA 4AT7A 4WC0A 9ICTA 4RQ5A 1FA0A 2M2UA 7ICEA 4MFAA 3L9DA 9ICRA 5HREA 4E80A 4LZGA 2FMSA 2BCUA 9ICQA 4KLOA 4PH5A 5J2AA 2ZH5A 4YD1A 3H38A 1ZQCA 1ZQTA 4RT3A 3OUYA 4KLSA 4F5NA 2ZH6A 7ICTA 5J0TA 1ZQXA 4P4PA 5J0PA 4PPXA 5CJ7A 5CHGA 4I2EA 1UEUA 5DB8A 1KDHA 3UXPA 2M2TA 4F5RA 5EOZA 4O5CA 5BOLA 3V7KA 1MIVA 4EBKA 4K4HA 4P2HA 4FHVA 5IIOA 5DB6A 8ICQA 4KLLA 4K4GA 4FH3A 1MQ3A 4UB2A 4R66A 4I29A 3OVAA 4UB1A 5IIJA 8ICZA 3ISDA 9ICBA 3RH5A 8ICYA 4MF2A 1YLQA 5HR9A 4XUSA 3ISBA 3H3AA 4X0AA 3JPQA 4WC3A 3UXNA 9ICMA 4YMNA 3C2MA 4R64A 2DR9A 8ICSA 4UD5A 4M9LA 1BPDA 3OV7A 9ICIA 4X4PA 3OGUA 1ZQPA 2DR7A 7ICUA 4NLKA 9ICGA 7ICHA 3UXOA 3RJKA 4LZDA 1KEJA 1KNYA 4TUPA 4RWNA 1R8AA 2DR8A 4TUQA 4X0BA 4NKTA 4YMOA 8ICJA 4KLJA 4IQVA 4WBZA 4WC6A 3K75D 2RFFA 2P66A 3JPPA 1RZTA 9ICNA 5BPCA 3RJEA 5HRDA 4QZEA 3AU2A 2GWSA 4NLNA 4X4RA 8ICWA 4R63A 2BCQA 8ICXA 4RQ1A 2PXIA 1HUOA 1JMSA 3JPNA 3B0XA 2PFQA 5CA7A 5J2DA 8ICFA 7ICJA 5D46A 4KLDA
chains in the Genus database with same CATH superfamily
4O5KA 2ZH7A 3AQKA 1BPXA 4I2DA 2EWRA 3HJ1A 4WC1A 2GAFD 8ICIA 5HRKA 3OVBA 9ICLA 5DBAA 3C5GA 5IINA 4KLQA 4I0UA 3MDCA 4AT8B 1ZQMA 4UAYA 5J2HA 4F5OA 1HUZA 4X4QA 4QZIA 4Z6CA 4IQTA 3NVOA 4I2FA 4QZCA 4RT2A 3LK9A 1BPYA 5D62A 4JWNA 4LT6A 5F2VO 2O5AA 9ICHA 1MIYA 4RQ7A 3AQMA 4WOYA 2M2WA 8ICEA 4EP7A 9ICXA 4FH5A 4UB5A 8ICAA 4QZ8A 8ICVA 4LVSA 4QZFA 1JQRA 4KLHA 2ID1A 3V7LA 1ZQUA 4RQ8A 4NLZA 3HIYA 3NKUA 1VJ7A 3C66A 1ZQGA 4HX0A 4KLTA 5IIMA 4OAGA 1ZQSA 7ICOA 3ERCC 4LEVA 4XRHA 5B3PA 1ZQFA 4R65A 4UBCA 4KLMA 1R8BA 3MBYA 5HRHA 3UQ0A 4O9MA 4M9NA 3JPSA 3C2LA 4MFCA 4K9AA 4P4OA 4K4IA 9ICUA 5CR0A 3HWTA 5J2GA 4KLFA 3JYYA 4WQKA 4NXXA 9ICFA 9ICOA 4AT8A 4M0AA 3B0YA 5HRBA 1XSLA 4FO1A 5J0UA 4NY8A 4MKPA 1R8CA 4YCXA 4IQUA 4OAIZ 3WFQE 3EF2A 3MGHA 5CFTA 4ATBB 3AUOA 1ZQQA 4RQ3A 5J0QA 1TFWA 4M9HA 5HRGA 4Z6EA 4YD2A 4RPXA 2ZH1A 1BPEA 4QZBA 5DDMA 4JLZA 9ICKA 1ZQBA 3V72A 4DOBA 3HX0A 2M2VA 3C5FA 8ICBA 1MIWA 5D49A 4X4NA 3JCFA 3RH4A 4I28A 5J0OA 3MGIA 5D4BA 4YN4A 4TURA 1ZQYA 4K97A 1NO5A 3ISCA 4EBJA 2NRKA 8ICTA 1V4AA 2HHPA 4AT9A 4RQ0A 8ICUA 4I2GA 5J2KA 1PX5A 5DB7A 2O1PA 4QZAA 3MCRA 3WFOA 4X4OA 4E7XA 3RJFA 5DECA 5J0XA 2ZHAA 5J0YA 3HW8A 2ZHBA 4WC5A 3NWIA 1ZQHA 3OVSA 8ICLA 2IHMA 9ICWA 4PGXA 2ZH3A 4WC7A 2PFNA 4K8VA 7ICMA 4NM1A 2DRBA 4QZGA 3JPOA 4I2AA 4ATBA 2BPGA 4IG8A 2PFOA 2BE3A 4DOCA 9ICJA 1XSNA 2ISOA 2B51A 4M5DA 4FHYA 3HJ4A 4NKUA 5CFUA 1JN3A 1WOTA 1VFGA 3UPQA 4RQ6A 1Q78A 1TVAA 4E8FA 2VANA 4NXWA 4QZDA 1NOMA 3NYBA 4KLGA 2ZH9A 3PNCA 2ZH2A 5CB1A 5J0WA 2BPFA 3H39A 3UQ2A 5J0SA 1ZJMA 8ICPA 1MQ2A 2DRAA 3ER9B 4FHXA 1GPJA 8ICNA 5J29A 2ISPA 2I9GA 7ICVA 9ICEA 3RJHA 2FMQA 4EEBA 4FO6A 4I2HA 7ICNA 1TFYA 4LEZA 4AT9B 3PMLA 3C18A 4NXVA 1ZQKA 5IIKA 4UBBA 4O6AA 2IUBA 1ZQNA 7ICSA 4KLIA 5HRFA 7ICPA 1Q79A 4YMMA 4JWMA 5IILA 4JLXA 4X4TA 3CK6A 7ICRA 4KM5A 5BOMA 4XQ8A 1ZQVA 4RQ2A 5HC9A 4K96A 5B3QA 1UEVA 2FCLA 2DVIA 7ICGA 3JZ0A 5D63A 5HRLA 4Z6DA 7ICLA 5JTGA 5CWRA 3JPTA 4K99A 4DO9A 4UAWA 4PHAA 3UPSA 4WBYA 3RJIA 7ICQA 4WH5A 4PGQA 5CHEA 7ICIA 3MDAA 2ZH4A 5DKWA 5J2IA 4PHEA 4I2BA 9ICVA 5HHHA 2PFPA 4O67A 1ZQDA 2DR5A 8ICKA 3AQNA 1BPZA 2W9MA 1ZQZA 5IIIA 1TV9A 4I2JA 3LQCB 4MFFA 1OU5A 4NXZA 1ZQLA 4PGYA 1JAJA 5J2FA 4WC2A 4NM2A 5J2CA 4X4VA 1ZQAA 4F5PA 2BPCA 3H37A 4F5QA 2BCVA 9ICAA 4RWOA 2ZH8A 3TFRA 2BBJA 1ZJNA 4M04A 4RWPA 4S3NA 1ZQOA 3AQLA 4P4MA 3V7JA 2FMPA 4RWQA 4M47A 3RJJA 4K98A 2HN2A 4Z6FA 4I2IA 4QZHA 4UB3A 5CFSA 4AT7B 3C2KA 9ICCA 3AU6A 5TZVA 4K9BA 4KLEA 8ICMA 2BCRA 4FHPA 3WFRE 8ICCA 1ZQRA 4EEDA 5DDYA 5CP2A 5DEDA 9ICSA 4PHPA 1ZQJA 4M9GA 4I27A 8ICGA 1ZQWA 4XQ7A 3OWGA 3JPRA 2Q66A 7ICFA 5J0RA 3OUYB 4UB4A 4X4SA 1BPBA 4XJEA 4X5VA 1UETA 4GXKA 5DB9A 3TFSA 5HRIA 4TUSA 8ICRA 4WCWA 5J2BA 2GA9D 8ICOA 4GXJA 4WC4A 3GDXA 5J2EA 1ZQIA 4UD4A 4M2YA 4LEWA 5J2JA 4M9JA 4KLUA 3ER8C 2BBHA 1XSPA 9ICPA 3PMNA 4IQWA 4OAHA 4FHWA 4RPZA 4I2CA 5HHIA 1F5AA 4O5EA 2BCSA 3WFSC 1RPLA 4RPYA 4RQ4A 5DBCA 3WFPA 4UAZA 8ICHA 4WQLA 4XA5A 3RJGA 5DBBA 4DOAA 4OAFA 2B56A 1R89A 1ZQEA 4QZ9A 4MF8A 4PHDA 2PBEA 4LEYA 7ICKA 4GXIA 3RH6A 4X4UA 4AT7A 4WC0A 9ICTA 4RQ5A 1FA0A 4KB6A 2M2UA 7ICEA 4MFAA 3L9DA 4NXTA 9ICRA 5HREA 4E80A 4LZGA 2FMSA 4EV6A 2BCUA 9ICQA 4KLOA 4PH5A 5J2AA 2ZH5A 4YD1A 3H38A 1ZQCA 1ZQTA 4RT3A 3PHZA 3OUYA 4KLSA 4F5NA 2ZH6A 7ICTA 5J0TA 1ZQXA 4P4PA 5J0PA 4EGWA 4PPXA 4O68A 5CJ7A 5CHGA 4I2EA 1UEUA 5DB8A 1KDHA 3UXPA 2M2TA 4F5RA 5EOZA 4O5CA 5BOLA 3V7KA 1MIVA 4EBKA 4K4HA 4P2HA 4FHVA 5IIOA 5DB6A 8ICQA 4KLLA 4K4GA 4NXUA 2IHOA 4FH3A 1MQ3A 4UB2A 4R66A 4I29A 2B4VA 3OVAA 4UB1A 5IIJA 8ICZA 3ISDA 9ICBA 3RH5A 8ICYA 4MF2A 1YLQA 5HR9A 4XUSA 3ISBA 2HN1A 4O69A 3H3AA 4X0AA 4N7RA 3JPQA 4WC3A 3UXNA 9ICMA 4YMNA 3C2MA 4R64A 2DR9A 8ICSA 4UD5A 4M9LA 1BPDA 3OV7A 9ICIA 4X4PA 3OGUA 1ZQPA 2DR7A 7ICUA 4NLKA 9ICGA 7ICHA 3UXOA 3RJKA 4LZDA 1KEJA 1KNYA 4TUPA 4RWNA 1R8AA 2DR8A 4TUQA 4X0BA 4NKTA 4YMOA 8ICJA 4KLJA 4IQVA 4WBZA 4WC6A 3K75D 2RFFA 2P66A 3K7DA 5D61A 3JPPA 1RZTA 9ICNA 5BPCA 3RJEA 5HRDA 4QZEA 3AU2A 2GWSA 4NLNA 4X4RA 8ICWA 4R63A 2BCQA 8ICXA 4RQ1A 2PXIA 1HUOA 1JMSA 3JPNA 3B0XA 2PFQA 5CA7A 5J2DA 8ICFA 7ICJA 5D46A 4KLDA
chains in the Genus database with same CATH topology
4O5KA 2ZH7A 3AQKA 1BPXA 4I2DA 3HJ1A 4WC1A 8ICIA 5HRKA 3OVBA 9ICLA 5DBAA 3C5GA 5IINA 4KLQA 3MDCA 4AT8B 1ZQMA 4UAYA 5J2HA 4F5OA 1HUZA 4X4QA 4QZIA 4Z6CA 4IQTA 4I2FA 4QZCA 4RT2A 3LK9A 1BPYA 4JWNA 4LT6A 5F2VO 2O5AA 9ICHA 1MIYA 4RQ7A 3AQMA 2M2WA 8ICEA 4EP7A 9ICXA 4FH5A 4UB5A 8ICAA 4QZ8A 8ICVA 4LVSA 4QZFA 1JQRA 4KLHA 2ID1A 3V7LA 1ZQUA 4RQ8A 4NLZA 3HIYA 1VJ7A 3C66A 1ZQGA 4KLTA 5IIMA 1ZQSA 7ICOA 4XRHA 1ZQFA 4R65A 4UBCA 4KLMA 1R8BA 3MBYA 5HRHA 3UQ0A 4O9MA 4M9NA 3JPSA 3C2LA 4MFCA 4P4OA 4K4IA 9ICUA 5CR0A 3HWTA 5J2GA 4KLFA 3JYYA 9ICFA 9ICOA 4AT8A 4M0AA 3B0YA 5HRBA 1XSLA 5J0UA 4NY8A 1R8CA 4YCXA 4IQUA 3WFQE 3MGHA 4ATBB 3AUOA 1ZQQA 4RQ3A 5J0QA 1TFWA 4M9HA 5HRGA 4Z6EA 4YD2A 4RPXA 2ZH1A 1BPEA 4QZBA 5DDMA 9ICKA 1ZQBA 3V72A 4DOBA 3HX0A 2M2VA 3C5FA 8ICBA 1MIWA 5D49A 4X4NA 3RH4A 4I28A 5J0OA 3MGIA 5D4BA 4YN4A 4TURA 1ZQYA 1NO5A 3ISCA 4EBJA 2NRKA 8ICTA 1V4AA 2HHPA 4AT9A 4RQ0A 8ICUA 4I2GA 5J2KA 1PX5A 5DB7A 2O1PA 4QZAA 3WFOA 4X4OA 4E7XA 3RJFA 5DECA 5J0XA 2ZHAA 5J0YA 3HW8A 2ZHBA 4WC5A 1ZQHA 3OVSA 8ICLA 2IHMA 9ICWA 4PGXA 2ZH3A 4WC7A 2PFNA 7ICMA 4NM1A 2DRBA 4QZGA 3JPOA 4I2AA 4ATBA 2BPGA 4IG8A 2PFOA 2BE3A 4DOCA 9ICJA 1XSNA 2ISOA 4M5DA 4FHYA 3HJ4A 4NKUA 1JN3A 1WOTA 1VFGA 3UPQA 4RQ6A 1Q78A 1TVAA 4E8FA 2VANA 4QZDA 1NOMA 3NYBA 4KLGA 2ZH9A 3PNCA 2ZH2A 5CB1A 5J0WA 2BPFA 3H39A 3UQ2A 5J0SA 1ZJMA 8ICPA 1MQ2A 2DRAA 4FHXA 8ICNA 5J29A 2ISPA 2I9GA 7ICVA 9ICEA 3RJHA 2FMQA 4FO6A 4I2HA 7ICNA 1TFYA 4AT9B 3PMLA 3C18A 1ZQKA 5IIKA 4UBBA 1ZQNA 7ICSA 4KLIA 5HRFA 7ICPA 1Q79A 4YMMA 4JWMA 5IILA 4X4TA 7ICRA 4XQ8A 5BOMA 1ZQVA 4RQ2A 5HC9A 1UEVA 2DVIA 7ICGA 3JZ0A 5HRLA 4Z6DA 7ICLA 5CWRA 3JPTA 4DO9A 4UAWA 4PHAA 3UPSA 4WBYA 3RJIA 7ICQA 4PGQA 7ICIA 3MDAA 2ZH4A 5DKWA 5J2IA 4PHEA 4I2BA 9ICVA 5HHHA 2PFPA 1ZQDA 2DR5A 8ICKA 3AQNA 1BPZA 2W9MA 1ZQZA 5IIIA 1TV9A 4I2JA 3LQCB 4MFFA 1OU5A 4NXZA 1ZQLA 4PGYA 1JAJA 5J2FA 4WC2A 4NM2A 5J2CA 4X4VA 1ZQAA 4F5PA 2BPCA 3H37A 4F5QA 2BCVA 9ICAA 4RWOA 2ZH8A 3TFRA 1ZJNA 4M04A 4RWPA 4S3NA 1ZQOA 3AQLA 4P4MA 3V7JA 2FMPA 4RWQA 4M47A 3RJJA 4Z6FA 4I2IA 4QZHA 4UB3A 3C2KA 4AT7B 9ICCA 3AU6A 5TZVA 4KLEA 8ICMA 2BCRA 4FHPA 3WFRE 8ICCA 1ZQRA 5DDYA 5CP2A 5DEDA 9ICSA 4PHPA 1ZQJA 4M9GA 4I27A 8ICGA 1ZQWA 4XQ7A 3JPRA 2Q66A 7ICFA 5J0RA 3OUYB 4UB4A 4X4SA 1BPBA 4X5VA 1UETA 4GXKA 5DB9A 3TFSA 5HRIA 4TUSA 8ICRA 4WCWA 5J2BA 8ICOA 4GXJA 4WC4A 3GDXA 5J2EA 1ZQIA 4UD4A 4M2YA 5J2JA 4M9JA 4KLUA 1XSPA 9ICPA 3PMNA 4IQWA 4FHWA 4RPZA 4I2CA 5HHIA 1F5AA 4O5EA 2BCSA 3WFSC 1RPLA 4RPYA 4RQ4A 5DBCA 3WFPA 4UAZA 8ICHA 4XA5A 3RJGA 5DBBA 4DOAA 1R89A 1ZQEA 4QZ9A 4MF8A 4PHDA 2PBEA 7ICKA 4GXIA 3RH6A 4X4UA 4AT7A 4WC0A 9ICTA 4RQ5A 1FA0A 2M2UA 7ICEA 4MFAA 3L9DA 9ICRA 5HREA 4E80A 4LZGA 2FMSA 2BCUA 9ICQA 4KLOA 4PH5A 5J2AA 2ZH5A 4YD1A 3H38A 1ZQCA 1ZQTA 4RT3A 3OUYA 4KLSA 4F5NA 2ZH6A 7ICTA 5J0TA 1ZQXA 4P4PA 5J0PA 4PPXA 5CJ7A 5CHGA 4I2EA 1UEUA 5DB8A 1KDHA 3UXPA 2M2TA 4F5RA 5EOZA 4O5CA 5BOLA 3V7KA 1MIVA 4EBKA 4K4HA 4P2HA 4FHVA 5IIOA 5DB6A 8ICQA 4KLLA 4K4GA 4FH3A 1MQ3A 4UB2A 4R66A 4I29A 3OVAA 4UB1A 5IIJA 8ICZA 3ISDA 9ICBA 3RH5A 8ICYA 4MF2A 1YLQA 5HR9A 4XUSA 3ISBA 3H3AA 4X0AA 3JPQA 4WC3A 3UXNA 9ICMA 4YMNA 3C2MA 4R64A 2DR9A 8ICSA 4UD5A 4M9LA 1BPDA 3OV7A 9ICIA 4X4PA 3OGUA 1ZQPA 2DR7A 7ICUA 4NLKA 9ICGA 7ICHA 3UXOA 3RJKA 4LZDA 1KEJA 1KNYA 4TUPA 4RWNA 1R8AA 2DR8A 4TUQA 4X0BA 4NKTA 4YMOA 8ICJA 4KLJA 4IQVA 4WBZA 4WC6A 3K75D 2RFFA 2P66A 3JPPA 1RZTA 9ICNA 5BPCA 3RJEA 5HRDA 4QZEA 3AU2A 2GWSA 4NLNA 4X4RA 8ICWA 4R63A 2BCQA 8ICXA 4RQ1A 2PXIA 1HUOA 1JMSA 3JPNA 3B0XA 2PFQA 5CA7A 5J2DA 8ICFA 7ICJA 5D46A 4KLDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O5K A;  2ZH7 A;  3AQK A;  1BPX A;  4I2D A;  3HJ1 A;  4WC1 A;  8ICI A;  5HRK A;  3OVB A;  9ICL A;  5DBA A;  3C5G A;  5IIN A;  4KLQ A;  3MDC A;  4AT8 B;  1ZQM A;  4UAY A;  5J2H A;  4F5O A;  1HUZ A;  4X4Q A;  4QZI A;  4Z6C A;  4IQT A;  4I2F A;  4QZC A;  4RT2 A;  3LK9 A;  1BPY A;  4JWN A;  4LT6 A;  5F2V O;  2O5A A;  9ICH A;  1MIY A;  4RQ7 A;  3AQM A;  2M2W A;  8ICE A;  4EP7 A;  9ICX A;  4FH5 A;  4UB5 A;  8ICA A;  4QZ8 A;  8ICV A;  4LVS A;  4QZF A;  1JQR A;  4KLH A;  2ID1 A;  3V7L A;  1ZQU A;  4RQ8 A;  4NLZ A;  3HIY A;  1VJ7 A;  3C66 A;  1ZQG A;  4KLT A;  5IIM A;  1ZQS A;  7ICO A;  4XRH A;  1ZQF A;  4R65 A;  4UBC A;  4KLM A;  1R8B A;  3MBY A;  5HRH A;  3UQ0 A;  4O9M A;  4M9N A;  3JPS A;  3C2L A;  4MFC A;  4P4O A;  4K4I A;  9ICU A;  5CR0 A;  3HWT A;  5J2G A;  4KLF A;  3JYY A;  9ICF A;  9ICO A;  4AT8 A;  4M0A A;  3B0Y A;  5HRB A;  1XSL A;  5J0U A;  4NY8 A;  1R8C A;  4YCX A;  4IQU A;  3WFQ E;  3MGH A;  4ATB B;  3AUO A;  1ZQQ A;  4RQ3 A;  5J0Q A;  1TFW A;  4M9H A;  5HRG A;  4Z6E A;  4YD2 A;  4RPX A;  2ZH1 A;  1BPE A;  4QZB A;  5DDM A;  9ICK A;  1ZQB A;  3V72 A;  4DOB A;  3HX0 A;  2M2V A;  3C5F A;  8ICB A;  1MIW A;  5D49 A;  4X4N A;  3RH4 A;  4I28 A;  5J0O A;  3MGI A;  5D4B A;  4YN4 A;  4TUR A;  1ZQY A;  1NO5 A;  3ISC A;  4EBJ A;  2NRK A;  8ICT A;  1V4A A;  2HHP A;  4AT9 A;  4RQ0 A;  8ICU A;  4I2G A;  5J2K A;  1PX5 A;  5DB7 A;  2O1P A;  4QZA A;  3WFO A;  4X4O A;  4E7X A;  3RJF A;  5DEC A;  5J0X A;  2ZHA A;  5J0Y A;  3HW8 A;  2ZHB A;  4WC5 A;  1ZQH A;  3OVS A;  8ICL A;  2IHM A;  9ICW A;  4PGX A;  2ZH3 A;  4WC7 A;  2PFN A;  7ICM A;  4NM1 A;  2DRB A;  4QZG A;  3JPO A;  4I2A A;  4ATB A;  2BPG A;  4IG8 A;  2PFO A;  2BE3 A;  4DOC A;  9ICJ A;  1XSN A;  2ISO A;  4M5D A;  4FHY A;  3HJ4 A;  4NKU A;  1JN3 A;  1WOT A;  1VFG A;  3UPQ A;  4RQ6 A;  1Q78 A;  1TVA A;  4E8F A;  2VAN A;  4QZD A;  1NOM A;  3NYB A;  4KLG A;  2ZH9 A;  3PNC A;  2ZH2 A;  5CB1 A;  5J0W A;  2BPF A;  3H39 A;  3UQ2 A;  5J0S A;  1ZJM A;  8ICP A;  1MQ2 A;  2DRA A;  4FHX A;  8ICN A;  5J29 A;  2ISP A;  2I9G A;  7ICV A;  9ICE A;  3RJH A;  2FMQ A;  4FO6 A;  4I2H A;  7ICN A;  1TFY A;  4AT9 B;  3PML A;  3C18 A;  1ZQK A;  5IIK A;  4UBB A;  1ZQN A;  7ICS A;  4KLI A;  5HRF A;  7ICP A;  1Q79 A;  4YMM A;  4JWM A;  5IIL A;  4X4T A;  7ICR A;  4XQ8 A;  5BOM A;  1ZQV A;  4RQ2 A;  5HC9 A;  1UEV A;  2DVI A;  7ICG A;  3JZ0 A;  5HRL A;  4Z6D A;  7ICL A;  5CWR A;  3JPT A;  4DO9 A;  4UAW A;  4PHA A;  3UPS A;  4WBY A;  3RJI A;  7ICQ A;  4PGQ A;  7ICI A;  3MDA A;  2ZH4 A;  5DKW A;  5J2I A;  4PHE A;  4I2B A;  9ICV A;  5HHH A;  2PFP A;  1ZQD A;  2DR5 A;  8ICK A;  3AQN A;  1BPZ A;  2W9M A;  1ZQZ A;  5III A;  1TV9 A;  4I2J A;  3LQC B;  4MFF A;  1OU5 A;  4NXZ A;  1ZQL A;  4PGY A;  1JAJ A;  5J2F A;  4WC2 A;  4NM2 A;  5J2C A;  4X4V A;  1ZQA A;  4F5P A;  2BPC A;  3H37 A;  4F5Q A;  2BCV A;  9ICA A;  4RWO A;  2ZH8 A;  3TFR A;  1ZJN A;  4M04 A;  4RWP A;  4S3N A;  1ZQO A;  3AQL A;  4P4M A;  3V7J A;  2FMP A;  4RWQ A;  4M47 A;  3RJJ A;  4Z6F A;  4I2I A;  4QZH A;  4UB3 A;  3C2K A;  4AT7 B;  9ICC A;  3AU6 A;  5TZV A;  4KLE A;  8ICM A;  2BCR A;  4FHP A;  3WFR E;  8ICC A;  1ZQR A;  5DDY A;  5CP2 A;  5DED A;  9ICS A;  4PHP A;  1ZQJ A;  4M9G A;  4I27 A;  8ICG A;  1ZQW A;  4XQ7 A;  3JPR A;  2Q66 A;  7ICF A;  5J0R A;  3OUY B;  4UB4 A;  4X4S A;  1BPB A;  4X5V A;  1UET A;  4GXK A;  5DB9 A;  3TFS A;  5HRI A;  4TUS A;  8ICR A;  4WCW A;  5J2B A;  8ICO A;  4GXJ A;  4WC4 A;  3GDX A;  5J2E A;  1ZQI A;  4UD4 A;  4M2Y A;  5J2J A;  4M9J A;  4KLU A;  1XSP A;  9ICP A;  3PMN A;  4IQW A;  4FHW A;  4RPZ A;  4I2C A;  5HHI A;  1F5A A;  4O5E A;  2BCS A;  3WFS C;  1RPL A;  4RPY A;  4RQ4 A;  5DBC A;  3WFP A;  4UAZ A;  8ICH A;  4XA5 A;  3RJG A;  5DBB A;  4DOA A;  1R89 A;  1ZQE A;  4QZ9 A;  4MF8 A;  4PHD A;  2PBE A;  7ICK A;  4GXI A;  3RH6 A;  4X4U A;  4AT7 A;  4WC0 A;  9ICT A;  4RQ5 A;  1FA0 A;  2M2U A;  7ICE A;  4MFA A;  3L9D A;  9ICR A;  5HRE A;  4E80 A;  4LZG A;  2FMS A;  2BCU A;  9ICQ A;  4KLO A;  4PH5 A;  5J2A A;  2ZH5 A;  4YD1 A;  3H38 A;  1ZQC A;  1ZQT A;  4RT3 A;  3OUY A;  4KLS A;  4F5N A;  2ZH6 A;  7ICT A;  5J0T A;  1ZQX A;  4P4P A;  5J0P A;  4PPX A;  5CJ7 A;  5CHG A;  4I2E A;  1UEU A;  5DB8 A;  1KDH A;  3UXP A;  2M2T A;  4F5R A;  5EOZ A;  4O5C A;  5BOL A;  3V7K A;  1MIV A;  4EBK A;  4K4H A;  4P2H A;  4FHV A;  5IIO A;  5DB6 A;  8ICQ A;  4KLL A;  4K4G A;  4FH3 A;  1MQ3 A;  4UB2 A;  4R66 A;  4I29 A;  3OVA A;  4UB1 A;  5IIJ A;  8ICZ A;  3ISD A;  9ICB A;  3RH5 A;  8ICY A;  4MF2 A;  1YLQ A;  5HR9 A;  4XUS A;  3ISB A;  3H3A A;  4X0A A;  3JPQ A;  4WC3 A;  3UXN A;  9ICM A;  4YMN A;  3C2M A;  4R64 A;  2DR9 A;  8ICS A;  4UD5 A;  4M9L A;  1BPD A;  3OV7 A;  9ICI A;  4X4P A;  3OGU A;  1ZQP A;  2DR7 A;  7ICU A;  4NLK A;  9ICG A;  7ICH A;  3UXO A;  3RJK A;  4LZD A;  1KEJ A;  1KNY A;  4TUP A;  4RWN A;  1R8A A;  2DR8 A;  4TUQ A;  4X0B A;  4NKT A;  4YMO A;  8ICJ A;  4KLJ A;  4IQV A;  4WBZ A;  4WC6 A;  3K75 D;  2RFF A;  2P66 A;  3JPP A;  1RZT A;  9ICN A;  5BPC A;  3RJE A;  5HRD A;  4QZE A;  3AU2 A;  2GWS A;  4NLN A;  4X4R A;  8ICW A;  4R63 A;  2BCQ A;  8ICX A;  4RQ1 A;  2PXI A;  1HUO A;  1JMS A;  3JPN A;  3B0X A;  2PFQ A;  5CA7 A;  5J2D A;  8ICF A;  7ICJ A;  5D46 A;  4KLD A; 
#chains in the Genus database with same CATH topology
 4O5K A;  2ZH7 A;  3AQK A;  1BPX A;  4I2D A;  2EWR A;  3HJ1 A;  4WC1 A;  2GAF D;  8ICI A;  5HRK A;  3OVB A;  9ICL A;  5DBA A;  3C5G A;  5IIN A;  4KLQ A;  4I0U A;  3MDC A;  4AT8 B;  1ZQM A;  4UAY A;  5J2H A;  4F5O A;  1HUZ A;  4X4Q A;  4QZI A;  4Z6C A;  4IQT A;  3NVO A;  4I2F A;  4QZC A;  4RT2 A;  3LK9 A;  1BPY A;  5D62 A;  4JWN A;  4LT6 A;  5F2V O;  2O5A A;  9ICH A;  1MIY A;  4RQ7 A;  3AQM A;  4WOY A;  2M2W A;  8ICE A;  4EP7 A;  9ICX A;  4FH5 A;  4UB5 A;  8ICA A;  4QZ8 A;  8ICV A;  4LVS A;  4QZF A;  1JQR A;  4KLH A;  2ID1 A;  3V7L A;  1ZQU A;  4RQ8 A;  4NLZ A;  3HIY A;  3NKU A;  1VJ7 A;  3C66 A;  1ZQG A;  4HX0 A;  4KLT A;  5IIM A;  4OAG A;  1ZQS A;  7ICO A;  3ERC C;  4LEV A;  4XRH A;  5B3P A;  1ZQF A;  4R65 A;  4UBC A;  4KLM A;  1R8B A;  3MBY A;  5HRH A;  3UQ0 A;  4O9M A;  4M9N A;  3JPS A;  3C2L A;  4MFC A;  4K9A A;  4P4O A;  4K4I A;  9ICU A;  5CR0 A;  3HWT A;  5J2G A;  4KLF A;  3JYY A;  4WQK A;  4NXX A;  9ICF A;  9ICO A;  4AT8 A;  4M0A A;  3B0Y A;  5HRB A;  1XSL A;  4FO1 A;  5J0U A;  4NY8 A;  4MKP A;  1R8C A;  4YCX A;  4IQU A;  4OAI Z;  3WFQ E;  3EF2 A;  3MGH A;  5CFT A;  4ATB B;  3AUO A;  1ZQQ A;  4RQ3 A;  5J0Q A;  1TFW A;  4M9H A;  5HRG A;  4Z6E A;  4YD2 A;  4RPX A;  2ZH1 A;  1BPE A;  4QZB A;  5DDM A;  4JLZ A;  9ICK A;  1ZQB A;  3V72 A;  4DOB A;  3HX0 A;  2M2V A;  3C5F A;  8ICB A;  1MIW A;  5D49 A;  4X4N A;  3JCF A;  3RH4 A;  4I28 A;  5J0O A;  3MGI A;  5D4B A;  4YN4 A;  4TUR A;  1ZQY A;  4K97 A;  1NO5 A;  3ISC A;  4EBJ A;  2NRK A;  8ICT A;  1V4A A;  2HHP A;  4AT9 A;  4RQ0 A;  8ICU A;  4I2G A;  5J2K A;  1PX5 A;  5DB7 A;  2O1P A;  4QZA A;  3MCR A;  3WFO A;  4X4O A;  4E7X A;  3RJF A;  5DEC A;  5J0X A;  2ZHA A;  5J0Y A;  3HW8 A;  2ZHB A;  4WC5 A;  3NWI A;  1ZQH A;  3OVS A;  8ICL A;  2IHM A;  9ICW A;  4PGX A;  2ZH3 A;  4WC7 A;  2PFN A;  4K8V A;  7ICM A;  4NM1 A;  2DRB A;  4QZG A;  3JPO A;  4I2A A;  4ATB A;  2BPG A;  4IG8 A;  2PFO A;  2BE3 A;  4DOC A;  9ICJ A;  1XSN A;  2ISO A;  2B51 A;  4M5D A;  4FHY A;  3HJ4 A;  4NKU A;  5CFU A;  1JN3 A;  1WOT A;  1VFG A;  3UPQ A;  4RQ6 A;  1Q78 A;  1TVA A;  4E8F A;  2VAN A;  4NXW A;  4QZD A;  1NOM A;  3NYB A;  4KLG A;  2ZH9 A;  3PNC A;  2ZH2 A;  5CB1 A;  5J0W A;  2BPF A;  3H39 A;  3UQ2 A;  5J0S A;  1ZJM A;  8ICP A;  1MQ2 A;  2DRA A;  3ER9 B;  4FHX A;  1GPJ A;  8ICN A;  5J29 A;  2ISP A;  2I9G A;  7ICV A;  9ICE A;  3RJH A;  2FMQ A;  4EEB A;  4FO6 A;  4I2H A;  7ICN A;  1TFY A;  4LEZ A;  4AT9 B;  3PML A;  3C18 A;  4NXV A;  1ZQK A;  5IIK A;  4UBB A;  4O6A A;  2IUB A;  1ZQN A;  7ICS A;  4KLI A;  5HRF A;  7ICP A;  1Q79 A;  4YMM A;  4JWM A;  5IIL A;  4JLX A;  4X4T A;  3CK6 A;  7ICR A;  4KM5 A;  5BOM A;  4XQ8 A;  1ZQV A;  4RQ2 A;  5HC9 A;  4K96 A;  5B3Q A;  1UEV A;  2FCL A;  2DVI A;  7ICG A;  3JZ0 A;  5D63 A;  5HRL A;  4Z6D A;  7ICL A;  5JTG A;  5CWR A;  3JPT A;  4K99 A;  4DO9 A;  4UAW A;  4PHA A;  3UPS A;  4WBY A;  3RJI A;  7ICQ A;  4WH5 A;  4PGQ A;  5CHE A;  7ICI A;  3MDA A;  2ZH4 A;  5DKW A;  5J2I A;  4PHE A;  4I2B A;  9ICV A;  5HHH A;  2PFP A;  4O67 A;  1ZQD A;  2DR5 A;  8ICK A;  3AQN A;  1BPZ A;  2W9M A;  1ZQZ A;  5III A;  1TV9 A;  4I2J A;  3LQC B;  4MFF A;  1OU5 A;  4NXZ A;  1ZQL A;  4PGY A;  1JAJ A;  5J2F A;  4WC2 A;  4NM2 A;  5J2C A;  4X4V A;  1ZQA A;  4F5P A;  2BPC A;  3H37 A;  4F5Q A;  2BCV A;  9ICA A;  4RWO A;  2ZH8 A;  3TFR A;  2BBJ A;  1ZJN A;  4M04 A;  4RWP A;  4S3N A;  1ZQO A;  3AQL A;  4P4M A;  3V7J A;  2FMP A;  4RWQ A;  4M47 A;  3RJJ A;  4K98 A;  2HN2 A;  4Z6F A;  4I2I A;  4QZH A;  4UB3 A;  5CFS A;  4AT7 B;  3C2K A;  9ICC A;  3AU6 A;  5TZV A;  4K9B A;  4KLE A;  8ICM A;  2BCR A;  4FHP A;  3WFR E;  8ICC A;  1ZQR A;  4EED A;  5DDY A;  5CP2 A;  5DED A;  9ICS A;  4PHP A;  1ZQJ A;  4M9G A;  4I27 A;  8ICG A;  1ZQW A;  4XQ7 A;  3OWG A;  3JPR A;  2Q66 A;  7ICF A;  5J0R A;  3OUY B;  4UB4 A;  4X4S A;  1BPB A;  4XJE A;  4X5V A;  1UET A;  4GXK A;  5DB9 A;  3TFS A;  5HRI A;  4TUS A;  8ICR A;  4WCW A;  5J2B A;  2GA9 D;  8ICO A;  4GXJ A;  4WC4 A;  3GDX A;  5J2E A;  1ZQI A;  4UD4 A;  4M2Y A;  4LEW A;  5J2J A;  4M9J A;  4KLU A;  3ER8 C;  2BBH A;  1XSP A;  9ICP A;  3PMN A;  4IQW A;  4OAH A;  4FHW A;  4RPZ A;  4I2C A;  5HHI A;  1F5A A;  4O5E A;  2BCS A;  3WFS C;  1RPL A;  4RPY A;  4RQ4 A;  5DBC A;  3WFP A;  4UAZ A;  8ICH A;  4WQL A;  4XA5 A;  3RJG A;  5DBB A;  4DOA A;  4OAF A;  2B56 A;  1R89 A;  1ZQE A;  4QZ9 A;  4MF8 A;  4PHD A;  2PBE A;  4LEY A;  7ICK A;  4GXI A;  3RH6 A;  4X4U A;  4AT7 A;  4WC0 A;  9ICT A;  4RQ5 A;  1FA0 A;  4KB6 A;  2M2U A;  7ICE A;  4MFA A;  3L9D A;  4NXT A;  9ICR A;  5HRE A;  4E80 A;  4LZG A;  2FMS A;  4EV6 A;  2BCU A;  9ICQ A;  4KLO A;  4PH5 A;  5J2A A;  2ZH5 A;  4YD1 A;  3H38 A;  1ZQC A;  1ZQT A;  4RT3 A;  3PHZ A;  3OUY A;  4KLS A;  4F5N A;  2ZH6 A;  7ICT A;  5J0T A;  1ZQX A;  4P4P A;  5J0P A;  4EGW A;  4PPX A;  4O68 A;  5CJ7 A;  5CHG A;  4I2E A;  1UEU A;  5DB8 A;  1KDH A;  3UXP A;  2M2T A;  4F5R A;  5EOZ A;  4O5C A;  5BOL A;  3V7K A;  1MIV A;  4EBK A;  4K4H A;  4P2H A;  4FHV A;  5IIO A;  5DB6 A;  8ICQ A;  4KLL A;  4K4G A;  4NXU A;  2IHO A;  4FH3 A;  1MQ3 A;  4UB2 A;  4R66 A;  4I29 A;  2B4V A;  3OVA A;  4UB1 A;  5IIJ A;  8ICZ A;  3ISD A;  9ICB A;  3RH5 A;  8ICY A;  4MF2 A;  1YLQ A;  5HR9 A;  4XUS A;  3ISB A;  2HN1 A;  4O69 A;  3H3A A;  4X0A A;  4N7R A;  3JPQ A;  4WC3 A;  3UXN A;  9ICM A;  4YMN A;  3C2M A;  4R64 A;  2DR9 A;  8ICS A;  4UD5 A;  4M9L A;  1BPD A;  3OV7 A;  9ICI A;  4X4P A;  3OGU A;  1ZQP A;  2DR7 A;  7ICU A;  4NLK A;  9ICG A;  7ICH A;  3UXO A;  3RJK A;  4LZD A;  1KEJ A;  1KNY A;  4TUP A;  4RWN A;  1R8A A;  2DR8 A;  4TUQ A;  4X0B A;  4NKT A;  4YMO A;  8ICJ A;  4KLJ A;  4IQV A;  4WBZ A;  4WC6 A;  3K75 D;  2RFF A;  2P66 A;  3K7D A;  5D61 A;  3JPP A;  1RZT A;  9ICN A;  5BPC A;  3RJE A;  5HRD A;  4QZE A;  3AU2 A;  2GWS A;  4NLN A;  4X4R A;  8ICW A;  4R63 A;  2BCQ A;  8ICX A;  4RQ1 A;  2PXI A;  1HUO A;  1JMS A;  3JPN A;  3B0X A;  2PFQ A;  5CA7 A;  5J2D A;  8ICF A;  7ICJ A;  5D46 A;  4KLD A; 
#chains in the Genus database with same CATH homology
 4O5K A;  2ZH7 A;  3AQK A;  1BPX A;  4I2D A;  3HJ1 A;  4WC1 A;  8ICI A;  5HRK A;  3OVB A;  9ICL A;  5DBA A;  3C5G A;  5IIN A;  4KLQ A;  3MDC A;  4AT8 B;  1ZQM A;  4UAY A;  5J2H A;  4F5O A;  1HUZ A;  4X4Q A;  4QZI A;  4Z6C A;  4IQT A;  4I2F A;  4QZC A;  4RT2 A;  3LK9 A;  1BPY A;  4JWN A;  4LT6 A;  5F2V O;  2O5A A;  9ICH A;  1MIY A;  4RQ7 A;  3AQM A;  2M2W A;  8ICE A;  4EP7 A;  9ICX A;  4FH5 A;  4UB5 A;  8ICA A;  4QZ8 A;  8ICV A;  4LVS A;  4QZF A;  1JQR A;  4KLH A;  2ID1 A;  3V7L A;  1ZQU A;  4RQ8 A;  4NLZ A;  3HIY A;  1VJ7 A;  3C66 A;  1ZQG A;  4KLT A;  5IIM A;  1ZQS A;  7ICO A;  4XRH A;  1ZQF A;  4R65 A;  4UBC A;  4KLM A;  1R8B A;  3MBY A;  5HRH A;  3UQ0 A;  4O9M A;  4M9N A;  3JPS A;  3C2L A;  4MFC A;  4P4O A;  4K4I A;  9ICU A;  5CR0 A;  3HWT A;  5J2G A;  4KLF A;  3JYY A;  9ICF A;  9ICO A;  4AT8 A;  4M0A A;  3B0Y A;  5HRB A;  1XSL A;  5J0U A;  4NY8 A;  1R8C A;  4YCX A;  4IQU A;  3WFQ E;  3MGH A;  4ATB B;  3AUO A;  1ZQQ A;  4RQ3 A;  5J0Q A;  1TFW A;  4M9H A;  5HRG A;  4Z6E A;  4YD2 A;  4RPX A;  2ZH1 A;  1BPE A;  4QZB A;  5DDM A;  9ICK A;  1ZQB A;  3V72 A;  4DOB A;  3HX0 A;  2M2V A;  3C5F A;  8ICB A;  1MIW A;  5D49 A;  4X4N A;  3RH4 A;  4I28 A;  5J0O A;  3MGI A;  5D4B A;  4YN4 A;  4TUR A;  1ZQY A;  1NO5 A;  3ISC A;  4EBJ A;  2NRK A;  8ICT A;  1V4A A;  2HHP A;  4AT9 A;  4RQ0 A;  8ICU A;  4I2G A;  5J2K A;  1PX5 A;  5DB7 A;  2O1P A;  4QZA A;  3WFO A;  4X4O A;  4E7X A;  3RJF A;  5DEC A;  5J0X A;  2ZHA A;  5J0Y A;  3HW8 A;  2ZHB A;  4WC5 A;  1ZQH A;  3OVS A;  8ICL A;  2IHM A;  9ICW A;  4PGX A;  2ZH3 A;  4WC7 A;  2PFN A;  7ICM A;  4NM1 A;  2DRB A;  4QZG A;  3JPO A;  4I2A A;  4ATB A;  2BPG A;  4IG8 A;  2PFO A;  2BE3 A;  4DOC A;  9ICJ A;  1XSN A;  2ISO A;  4M5D A;  4FHY A;  3HJ4 A;  4NKU A;  1JN3 A;  1WOT A;  1VFG A;  3UPQ A;  4RQ6 A;  1Q78 A;  1TVA A;  4E8F A;  2VAN A;  4QZD A;  1NOM A;  3NYB A;  4KLG A;  2ZH9 A;  3PNC A;  2ZH2 A;  5CB1 A;  5J0W A;  2BPF A;  3H39 A;  3UQ2 A;  5J0S A;  1ZJM A;  8ICP A;  1MQ2 A;  2DRA A;  4FHX A;  8ICN A;  5J29 A;  2ISP A;  2I9G A;  7ICV A;  9ICE A;  3RJH A;  2FMQ A;  4FO6 A;  4I2H A;  7ICN A;  1TFY A;  4AT9 B;  3PML A;  3C18 A;  1ZQK A;  5IIK A;  4UBB A;  1ZQN A;  7ICS A;  4KLI A;  5HRF A;  7ICP A;  1Q79 A;  4YMM A;  4JWM A;  5IIL A;  4X4T A;  7ICR A;  4XQ8 A;  5BOM A;  1ZQV A;  4RQ2 A;  5HC9 A;  1UEV A;  2DVI A;  7ICG A;  3JZ0 A;  5HRL A;  4Z6D A;  7ICL A;  5CWR A;  3JPT A;  4DO9 A;  4UAW A;  4PHA A;  3UPS A;  4WBY A;  3RJI A;  7ICQ A;  4PGQ A;  7ICI A;  3MDA A;  2ZH4 A;  5DKW A;  5J2I A;  4PHE A;  4I2B A;  9ICV A;  5HHH A;  2PFP A;  1ZQD A;  2DR5 A;  8ICK A;  3AQN A;  1BPZ A;  2W9M A;  1ZQZ A;  5III A;  1TV9 A;  4I2J A;  3LQC B;  4MFF A;  1OU5 A;  4NXZ A;  1ZQL A;  4PGY A;  1JAJ A;  5J2F A;  4WC2 A;  4NM2 A;  5J2C A;  4X4V A;  1ZQA A;  4F5P A;  2BPC A;  3H37 A;  4F5Q A;  2BCV A;  9ICA A;  4RWO A;  2ZH8 A;  3TFR A;  1ZJN A;  4M04 A;  4RWP A;  4S3N A;  1ZQO A;  3AQL A;  4P4M A;  3V7J A;  2FMP A;  4RWQ A;  4M47 A;  3RJJ A;  4Z6F A;  4I2I A;  4QZH A;  4UB3 A;  3C2K A;  4AT7 B;  9ICC A;  3AU6 A;  5TZV A;  4KLE A;  8ICM A;  2BCR A;  4FHP A;  3WFR E;  8ICC A;  1ZQR A;  5DDY A;  5CP2 A;  5DED A;  9ICS A;  4PHP A;  1ZQJ A;  4M9G A;  4I27 A;  8ICG A;  1ZQW A;  4XQ7 A;  3JPR A;  2Q66 A;  7ICF A;  5J0R A;  3OUY B;  4UB4 A;  4X4S A;  1BPB A;  4X5V A;  1UET A;  4GXK A;  5DB9 A;  3TFS A;  5HRI A;  4TUS A;  8ICR A;  4WCW A;  5J2B A;  8ICO A;  4GXJ A;  4WC4 A;  3GDX A;  5J2E A;  1ZQI A;  4UD4 A;  4M2Y A;  5J2J A;  4M9J A;  4KLU A;  1XSP A;  9ICP A;  3PMN A;  4IQW A;  4FHW A;  4RPZ A;  4I2C A;  5HHI A;  1F5A A;  4O5E A;  2BCS A;  3WFS C;  1RPL A;  4RPY A;  4RQ4 A;  5DBC A;  3WFP A;  4UAZ A;  8ICH A;  4XA5 A;  3RJG A;  5DBB A;  4DOA A;  1R89 A;  1ZQE A;  4QZ9 A;  4MF8 A;  4PHD A;  2PBE A;  7ICK A;  4GXI A;  3RH6 A;  4X4U A;  4AT7 A;  4WC0 A;  9ICT A;  4RQ5 A;  1FA0 A;  2M2U A;  7ICE A;  4MFA A;  3L9D A;  9ICR A;  5HRE A;  4E80 A;  4LZG A;  2FMS A;  2BCU A;  9ICQ A;  4KLO A;  4PH5 A;  5J2A A;  2ZH5 A;  4YD1 A;  3H38 A;  1ZQC A;  1ZQT A;  4RT3 A;  3OUY A;  4KLS A;  4F5N A;  2ZH6 A;  7ICT A;  5J0T A;  1ZQX A;  4P4P A;  5J0P A;  4PPX A;  5CJ7 A;  5CHG A;  4I2E A;  1UEU A;  5DB8 A;  1KDH A;  3UXP A;  2M2T A;  4F5R A;  5EOZ A;  4O5C A;  5BOL A;  3V7K A;  1MIV A;  4EBK A;  4K4H A;  4P2H A;  4FHV A;  5IIO A;  5DB6 A;  8ICQ A;  4KLL A;  4K4G A;  4FH3 A;  1MQ3 A;  4UB2 A;  4R66 A;  4I29 A;  3OVA A;  4UB1 A;  5IIJ A;  8ICZ A;  3ISD A;  9ICB A;  3RH5 A;  8ICY A;  4MF2 A;  1YLQ A;  5HR9 A;  4XUS A;  3ISB A;  3H3A A;  4X0A A;  3JPQ A;  4WC3 A;  3UXN A;  9ICM A;  4YMN A;  3C2M A;  4R64 A;  2DR9 A;  8ICS A;  4UD5 A;  4M9L A;  1BPD A;  3OV7 A;  9ICI A;  4X4P A;  3OGU A;  1ZQP A;  2DR7 A;  7ICU A;  4NLK A;  9ICG A;  7ICH A;  3UXO A;  3RJK A;  4LZD A;  1KEJ A;  1KNY A;  4TUP A;  4RWN A;  1R8A A;  2DR8 A;  4TUQ A;  4X0B A;  4NKT A;  4YMO A;  8ICJ A;  4KLJ A;  4IQV A;  4WBZ A;  4WC6 A;  3K75 D;  2RFF A;  2P66 A;  3JPP A;  1RZT A;  9ICN A;  5BPC A;  3RJE A;  5HRD A;  4QZE A;  3AU2 A;  2GWS A;  4NLN A;  4X4R A;  8ICW A;  4R63 A;  2BCQ A;  8ICX A;  4RQ1 A;  2PXI A;  1HUO A;  1JMS A;  3JPN A;  3B0X A;  2PFQ A;  5CA7 A;  5J2D A;  8ICF A;  7ICJ A;  5D46 A;  4KLD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...