4X0AA

Structure of trna-processing enzyme complex 6
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 112
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4x0aA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4x0aA01
4NKTA 5DEDA 7ICKA 4FHVA 4WC6A 2ZHAA 4PGXA 1ZQTA 5J2AA 3V7KA 3JPQA 3NYBA 8ICIA 4R66A 4IQTA 1NO5A 2PBEA 4X4OA 1MQ3A 4QZ8A 8ICNA 3AQKA 9ICOA 1JN3A 4O5EA 4KLUA 1ZQVA 4WCWA 4RWNA 3JPNA 9ICJA 3RJEA 3H39A 3C18A 5J0YA 4QZGA 3WFOA 5J2HA 4RWPA 5HRLA 4RWOA 1BPEA 1RPLA 9ICAA 4AT7B 4E80A 2ZHBA 4AT8A 4GXKA 1JQRA 2ZH6A 7ICSA 5D49A 3WFSC 3HIYA 8ICZA 4M9HA 2DR5A 4I28A 4FH5A 3RJHA 4XA5A 8ICHA 5F2VO 1MQ2A 4KLIA 4PH5A 4TUSA 2GWSA 4PHEA 2BE3A 1ZQWA 4YN4A 3B0YA 4X4NA 3OUYA 5HR9A 9ICGA 4QZBA 4S3NA 4Z6EA 5HRIA 3AU2A 4M2YA 5IIIA 3AQLA 4JWMA 4UAYA 1ZQNA 4O5CA 2M2WA 1TV9A 7ICNA 1XSLA 3AU6A 5HRGA 9ICNA 4YCXA 4O9MA 3MBYA 4M04A 2DR9A 4DO9A 3AUOA 8ICJA 1ZQSA 3JZ0A 2Q66A 1ZQBA 1KDHA 5J2CA 4Z6DA 4RT2A 2ISOA 4F5RA 5DB7A 4RQ0A 4MFAA 1ZQOA 2BPGA 8ICPA 4WC1A 4AT7A 3JPRA 4I27A 5CP2A 4X4SA 4X4RA 4M9GA 9ICTA 1ZQQA 1VJ7A 4QZFA 3JPTA 5DECA 1MIVA 4RQ8A 3TFSA 3C5GA 1ZQGA 4UD5A 4P4PA 5HRBA 1TFWA 2ZH7A 4TUQA 4QZCA 3RJFA 8ICSA 9ICWA 2BCVA 4X4TA 2BPCA 4YMMA 1ZQPA 1ZQIA 4X4QA 4K4GA 4P4MA 3OUYB 8ICBA 2BCUA 4I2GA 4ATBA 5IIJA 4F5QA 4QZAA 3L9DA 4QZEA 4LVSA 4YMNA 4QZDA 3C2LA 2PXIA 1BPDA 4FH3A 4UBBA 2DVIA 4RPZA 5DDYA 3ISCA 3HX0A 9ICCA 3GDXA 1MIWA 4YMOA 3H38A 4WC0A 1BPBA 4I2FA 2O1PA 1ZQZA 5IINA 5J0XA 9ICHA 4NM2A 5J2BA 2BCSA 3V7LA 4NLNA 1FA0A 2FMQA 3RJKA 4KLFA 2FMSA 4F5PA 3JPPA 3UXOA 2ISPA 3UQ0A 9ICEA 5HHHA 4DOCA 3HJ4A 5J0UA 1ZQAA 8ICMA 2PFOA 1Q78A 4Z6FA 1VFGA 9ICSA 1ZJMA 1ZQFA 3UXNA 3UPQA 4M0AA 5CJ7A 4RQ7A 4RQ5A 2NRKA 4KLHA 7ICUA 9ICRA 2I9GA 5J2KA 4KLSA 1NOMA 4R64A 5DKWA 4XQ7A 4NKUA 5J0RA 2DR8A 2ZH8A 4PHPA 4I2AA 4RQ3A 2BCRA 2M2UA 7ICHA 3MGIA 4PGYA 1JAJA 7ICOA 4WC7A 7ICTA 1WOTA 3JYYA 5HRHA 4E7XA 4KLEA 8ICRA 4X4UA 1YLQA 2O5AA 4ATBB 4Z6CA 3LQCB 3TFRA 5CB1A 1ZQCA 2ZH2A 4FHPA 5BPCA 4KLJA 4I2DA 2PFQA 4M9NA 9ICFA 1R8BA 1R89A 9ICMA 3H37A 1ZQLA 1BPYA 2M2VA 3C2MA 4EBKA 4M9JA 7ICJA 1XSPA 3PMLA 1BPZA 4P4OA 5J2GA 5HHIA 3V72A 1KNYA 5J0WA 1OU5A 1ZQJA 4UD4A 4LZGA 3HJ1A 4AT9B 5J0PA 4I2IA 1ZQKA 8ICYA 5BOMA 2W9MA 4KLMA 4XUSA 4RQ6A 8ICEA 2FMPA 4QZIA 5IILA 2ZH5A 4JWNA 3C5FA 4NM1A 5DB9A 1RZTA 4M5DA 1ZQUA 3WFQE 4I2CA 8ICVA 7ICGA 8ICGA 4M9LA 4F5NA 2IHMA 4FHYA 3LK9A 2BCQA 3OGUA 4X0AA 4IQWA 4UB4A 1ZQXA 1JMSA 4WC3A 4UB5A 3RJGA 2VANA 4UB2A 1TVAA 9ICQA 4TUPA 5BOLA 1ZQMA 3PNCA 1ZQDA 4KLTA 8ICQA 5J2JA 5J2DA 3RH4A 4X4VA 4NLZA 3MGHA 2DRAA 5J0OA 3RH6A 1PX5A 5IIKA 4E8FA 4MFFA 7ICLA 3H3AA 4WBZA 1TFYA 4WC2A 5DBAA 4WBYA 1UEVA 1ZQHA 5CR0A 4X4PA 1BPXA 5HRFA 4KLQA 8ICTA 3UXPA 1UETA 5EOZA 9ICLA 4AT9A 1V4AA 1ZQRA 3V7JA 3RJJA 5CWRA 5J0TA 5HRKA 3MDCA 4RWQA 4UAWA 3WFPA 4QZ9A 1Q79A 2P66A 3WFRE 4NY8A 4GXIA 5CHGA 5HC9A 1F5AA 8ICFA 9ICPA 4NXZA 3JPSA 4MF8A 8ICLA 2BPFA 7ICRA 9ICIA 4LZDA 5DBCA 1HUZA 4MFCA 3OV7A 1KEJA 2ZH9A 4X5VA 3OVBA 1HUOA 4PHAA 3PMNA 2PFPA 4X0BA 4FHXA 4IQUA 4IG8A 3OVAA 5TZVA 4UB3A 2PFNA 5J29A 2ZH3A 3AQMA 1UEUA 4FO6A 3OVSA 4NLKA 9ICVA 4XQ8A 1ZJNA 4YD1A 3RJIA 4MF2A 7ICIA 3RH5A 8ICKA 4DOAA 4PPXA 5J0QA 4F5OA 5J2EA 4RQ2A 1XSNA 7ICPA 2ID1A 4XRHA 8ICCA 5J0SA 3JPOA 5CA7A 4KLGA 5IIMA 4RPXA 4EBJA 3UQ2A 4I2BA 4KLDA 4O5KA 4P2HA 9ICKA 4IQVA 3HWTA 1MIYA 3K75D 4WC4A 4LT6A 4K4IA 5J2FA 1ZQYA 3UPSA 4I2EA 3C66A 5DDMA 4UAZA 4RPYA 4UBCA 3AQNA 5HRDA 2ZH4A 4R65A 9ICXA 3B0XA 4TURA 9ICUA 5HREA 7ICFA 7ICQA 3ISBA 5D46A 4YD2A 9ICBA 4QZHA 4I2JA 7ICEA 2ZH1A 5DB8A 1R8CA 2DR7A 4RQ4A 3C2KA 1R8AA 4I29A 3ISDA 4AT8B 5D4BA 4KLLA 2DRBA 8ICWA 4DOBA 4K4HA 3HW8A 4KLOA 4WC5A 8ICUA 4RQ1A 4R63A 4RT3A 5DBBA 8ICXA 8ICAA 5IIOA 5DB6A 8ICOA 2M2TA 2HHPA 4M47A 3MDAA 2RFFA 7ICMA 4UB1A 5J2IA 7ICVA 4EP7A 1ZQEA 4FHWA 4PHDA 4GXJA 4I2HA 4PGQA
chains in the Genus database with same CATH superfamily
2EWRA 4NKTA 5DEDA 7ICKA 4FHVA 5D61A 4WC6A 2ZHAA 4PGXA 1ZQTA 4NXWA 5J2AA 3V7KA 3JPQA 4K8VA 3NYBA 8ICIA 4R66A 4IQTA 1NO5A 2PBEA 4X4OA 1MQ3A 4QZ8A 8ICNA 3AQKA 9ICOA 1JN3A 4O5EA 4KLUA 1ZQVA 4WCWA 4RWNA 3JPNA 9ICJA 3RJEA 3H39A 4K99A 5CFSA 3C18A 4WQLA 5J0YA 2IUBA 4QZGA 4NXXA 3WFOA 5J2HA 4RWPA 5HRLA 4RWOA 1BPEA 1RPLA 9ICAA 4AT7B 4E80A 2ZHBA 4AT8A 4GXKA 1JQRA 2ZH6A 7ICSA 4OAFA 5D49A 3WFSC 3HIYA 4O68A 8ICZA 4M9HA 2DR5A 4I28A 4FH5A 3RJHA 4XA5A 8ICHA 5F2VO 1MQ2A 4KLIA 3PHZA 4PH5A 4TUSA 2GWSA 4PHEA 2BE3A 1ZQWA 4YN4A 3B0YA 4OAHA 3OUYA 5HR9A 4X4NA 4QZBA 9ICGA 3CK6A 4S3NA 4Z6EA 5HRIA 3AU2A 4M2YA 5IIIA 3AQLA 4JWMA 4UAYA 1ZQNA 4O5CA 2M2WA 1TV9A 7ICNA 1XSLA 3AU6A 5HRGA 9ICNA 4YCXA 4O9MA 4LEWA 3MBYA 4M04A 2HN2A 2DR9A 4DO9A 3AUOA 8ICJA 1ZQSA 3JZ0A 2Q66A 1ZQBA 1KDHA 5J2CA 4Z6DA 4RT2A 2ISOA 4F5RA 5DB7A 4RQ0A 4MFAA 1ZQOA 2BPGA 8ICPA 4WC1A 4KM5A 4AT7A 3JPRA 4I27A 5CP2A 4X4SA 3K7DA 4X4RA 4M9GA 9ICTA 1ZQQA 1VJ7A 4QZFA 3JPTA 4WQKA 5DECA 3ER9B 1MIVA 4RQ8A 3TFSA 3C5GA 4JLZA 1ZQGA 4UD5A 4P4PA 5HRBA 1TFWA 2ZH7A 4TUQA 4QZCA 3RJFA 8ICSA 9ICWA 2BCVA 4X4TA 2BPCA 4K97A 4YMMA 1ZQPA 1ZQIA 4X4QA 4K4GA 4P4MA 3OUYB 8ICBA 2BCUA 4I2GA 4ATBA 5IIJA 4F5QA 4QZAA 3L9DA 4QZEA 4LVSA 4YMNA 4EEBA 4QZDA 3C2LA 2PXIA 1BPDA 4FH3A 4O6AA 4UBBA 5D63A 2DVIA 4RPZA 5DDYA 3ISCA 3HX0A 9ICCA 3GDXA 1MIWA 4YMOA 3H38A 4WC0A 1BPBA 4I2FA 2O1PA 1GPJA 1ZQZA 5IINA 5J0XA 9ICHA 4NM2A 5J2BA 2BCSA 3V7LA 4NLNA 1FA0A 2FMQA 3RJKA 4KLFA 5CHEA 2FMSA 4F5PA 3UXOA 3JPPA 2ISPA 3UQ0A 9ICEA 5HHHA 4DOCA 3HJ4A 5J0UA 3NVOA 1ZQAA 4O69A 8ICMA 2PFOA 1Q78A 4Z6FA 1VFGA 9ICSA 1ZJMA 1ZQFA 3UXNA 3UPQA 4M0AA 5CJ7A 4RQ7A 4RQ5A 2GAFD 2NRKA 4KLHA 4OAGA 7ICUA 9ICRA 2I9GA 5J2KA 4KLSA 1NOMA 4R64A 5DKWA 4XQ7A 2IHOA 4I0UA 5J0RA 2DR8A 4NKUA 2ZH8A 4PHPA 4I2AA 4RQ3A 2BCRA 2M2UA 5B3QA 7ICHA 4OAIZ 4EEDA 3MGIA 4FO1A 4PGYA 1JAJA 7ICOA 4WC7A 7ICTA 1WOTA 3JYYA 4MKPA 5HRHA 4E7XA 4KLEA 8ICRA 4X4UA 1YLQA 2O5AA 4ATBB 4WOYA 4Z6CA 3LQCB 3TFRA 5CB1A 4K9AA 1ZQCA 2ZH2A 4FHPA 3EF2A 5BPCA 4KLJA 4I2DA 2PFQA 4M9NA 9ICFA 1R8BA 1R89A 9ICMA 3H37A 1ZQLA 1BPYA 4O67A 2M2VA 3C2MA 4EBKA 4M9JA 7ICJA 1XSPA 3PMLA 4NXUA 1BPZA 4N7RA 4P4OA 5J2GA 5HHIA 3V72A 1KNYA 5J0WA 1OU5A 1ZQJA 4UD4A 4KB6A 4LZGA 3HJ1A 4AT9B 5J0PA 4I2IA 1ZQKA 2B4VA 8ICYA 5BOMA 2W9MA 4KLMA 4XUSA 4RQ6A 8ICEA 5CFTA 2FMPA 4QZIA 5IILA 2ZH5A 4JWNA 3C5FA 4NM1A 5DB9A 1RZTA 4M5DA 4LEVA 1ZQUA 3WFQE 4I2CA 4NXTA 8ICVA 7ICGA 8ICGA 4M9LA 4F5NA 2IHMA 4FHYA 4WH5A 3LK9A 2BCQA 3OGUA 4X0AA 4IQWA 4UB4A 1ZQXA 1JMSA 4WC3A 4UB5A 3RJGA 4LEYA 2VANA 4UB2A 1TVAA 9ICQA 4TUPA 5BOLA 1ZQMA 3PNCA 1ZQDA 4KLTA 8ICQA 5J2JA 5J2DA 4XJEA 3RH4A 4X4VA 4NLZA 3MGHA 2DRAA 5J0OA 3RH6A 1PX5A 5IIKA 4E8FA 4MFFA 7ICLA 3H3AA 4WBZA 1TFYA 4WC2A 3NKUA 5DBAA 4WBYA 1UEVA 1ZQHA 5CR0A 4X4PA 1BPXA 5HRFA 4KLQA 8ICTA 3UXPA 1UETA 5EOZA 9ICLA 4AT9A 1V4AA 1ZQRA 3V7JA 3RJJA 5CWRA 5J0TA 5HRKA 3JCFA 3MDCA 4EGWA 4RWQA 2BBJA 4UAWA 4K96A 3WFPA 4QZ9A 3ER8C 1Q79A 5CFUA 2P66A 3WFRE 4NY8A 2GA9D 4GXIA 5CHGA 5HC9A 1F5AA 8ICFA 9ICPA 4NXZA 4K98A 3JPSA 3NWIA 4MF8A 8ICLA 2BPFA 7ICRA 9ICIA 4LZDA 5DBCA 1HUZA 4MFCA 3OV7A 1KEJA 2ZH9A 4X5VA 3OVBA 2B51A 1HUOA 4PHAA 3PMNA 2PFPA 4X0BA 4FHXA 4HX0A 4IQUA 4JLXA 4IG8A 3OVAA 5TZVA 4UB3A 2PFNA 5J29A 2BBHA 2ZH3A 3AQMA 1UEUA 4FO6A 3OVSA 4NLKA 9ICVA 4LEZA 4XQ8A 1ZJNA 5D62A 4YD1A 3RJIA 4MF2A 7ICIA 3RH5A 8ICKA 3MCRA 4DOAA 4PPXA 5J0QA 4F5OA 5J2EA 4RQ2A 1XSNA 7ICPA 2ID1A 4XRHA 8ICCA 5J0SA 3JPOA 5CA7A 4KLGA 5IIMA 4RPXA 4EBJA 3UQ2A 4I2BA 4KLDA 4EV6A 4O5KA 4P2HA 9ICKA 4IQVA 3HWTA 1MIYA 3K75D 4WC4A 4K9BA 4LT6A 4K4IA 5J2FA 1ZQYA 3UPSA 4I2EA 3C66A 5DDMA 4UAZA 4RPYA 4UBCA 3AQNA 5HRDA 2ZH4A 4R65A 9ICXA 2B56A 3B0XA 4TURA 9ICUA 5HREA 7ICFA 7ICQA 3ISBA 3ERCC 5D46A 2HN1A 4YD2A 9ICBA 5B3PA 4QZHA 4I2JA 7ICEA 2ZH1A 5DB8A 1R8CA 2DR7A 4RQ4A 3C2KA 1R8AA 4I29A 3ISDA 4NXVA 4AT8B 5D4BA 3OWGA 4KLLA 2DRBA 8ICWA 4DOBA 4K4HA 3HW8A 2FCLA 4KLOA 4WC5A 8ICUA 4RQ1A 4R63A 4RT3A 5DBBA 8ICXA 8ICAA 5JTGA 5IIOA 5DB6A 8ICOA 2M2TA 2HHPA 4M47A 3MDAA 2RFFA 7ICMA 4UB1A 5J2IA 7ICVA 4EP7A 1ZQEA 4FHWA 4PHDA 4GXJA 4I2HA 4PGQA
chains in the Genus database with same CATH topology
4NKTA 5DEDA 7ICKA 4FHVA 4WC6A 2ZHAA 4PGXA 1ZQTA 5J2AA 3V7KA 3JPQA 3NYBA 8ICIA 4R66A 4IQTA 1NO5A 2PBEA 4X4OA 1MQ3A 4QZ8A 8ICNA 3AQKA 9ICOA 1JN3A 4O5EA 4KLUA 1ZQVA 4WCWA 4RWNA 3JPNA 9ICJA 3RJEA 3H39A 3C18A 5J0YA 4QZGA 3WFOA 5J2HA 4RWPA 5HRLA 4RWOA 1BPEA 1RPLA 9ICAA 4AT7B 4E80A 2ZHBA 4AT8A 4GXKA 1JQRA 2ZH6A 7ICSA 5D49A 3WFSC 3HIYA 8ICZA 4M9HA 2DR5A 4I28A 4FH5A 3RJHA 4XA5A 8ICHA 5F2VO 1MQ2A 4KLIA 4PH5A 4TUSA 2GWSA 4PHEA 2BE3A 1ZQWA 4YN4A 3B0YA 4X4NA 3OUYA 5HR9A 9ICGA 4QZBA 4S3NA 4Z6EA 5HRIA 3AU2A 4M2YA 5IIIA 3AQLA 4JWMA 4UAYA 1ZQNA 4O5CA 2M2WA 1TV9A 7ICNA 1XSLA 3AU6A 5HRGA 9ICNA 4YCXA 4O9MA 3MBYA 4M04A 2DR9A 4DO9A 3AUOA 8ICJA 1ZQSA 3JZ0A 2Q66A 1ZQBA 1KDHA 5J2CA 4Z6DA 4RT2A 2ISOA 4F5RA 5DB7A 4RQ0A 4MFAA 1ZQOA 2BPGA 8ICPA 4WC1A 4AT7A 3JPRA 4I27A 5CP2A 4X4SA 4X4RA 4M9GA 9ICTA 1ZQQA 1VJ7A 4QZFA 3JPTA 5DECA 1MIVA 4RQ8A 3TFSA 3C5GA 1ZQGA 4UD5A 4P4PA 5HRBA 1TFWA 2ZH7A 4TUQA 4QZCA 3RJFA 8ICSA 9ICWA 2BCVA 4X4TA 2BPCA 4YMMA 1ZQPA 1ZQIA 4X4QA 4K4GA 4P4MA 3OUYB 8ICBA 2BCUA 4I2GA 4ATBA 5IIJA 4F5QA 4QZAA 3L9DA 4QZEA 4LVSA 4YMNA 4QZDA 3C2LA 2PXIA 1BPDA 4FH3A 4UBBA 2DVIA 4RPZA 5DDYA 3ISCA 3HX0A 9ICCA 3GDXA 1MIWA 4YMOA 3H38A 4WC0A 1BPBA 4I2FA 2O1PA 1ZQZA 5IINA 5J0XA 9ICHA 4NM2A 5J2BA 2BCSA 3V7LA 4NLNA 1FA0A 2FMQA 3RJKA 4KLFA 2FMSA 4F5PA 3JPPA 3UXOA 2ISPA 3UQ0A 9ICEA 5HHHA 4DOCA 3HJ4A 5J0UA 1ZQAA 8ICMA 2PFOA 1Q78A 4Z6FA 1VFGA 9ICSA 1ZJMA 1ZQFA 3UXNA 3UPQA 4M0AA 5CJ7A 4RQ7A 4RQ5A 2NRKA 4KLHA 7ICUA 9ICRA 2I9GA 5J2KA 4KLSA 1NOMA 4R64A 5DKWA 4XQ7A 4NKUA 5J0RA 2DR8A 2ZH8A 4PHPA 4I2AA 4RQ3A 2BCRA 2M2UA 7ICHA 3MGIA 4PGYA 1JAJA 7ICOA 4WC7A 7ICTA 1WOTA 3JYYA 5HRHA 4E7XA 4KLEA 8ICRA 4X4UA 1YLQA 2O5AA 4ATBB 4Z6CA 3LQCB 3TFRA 5CB1A 1ZQCA 2ZH2A 4FHPA 5BPCA 4KLJA 4I2DA 2PFQA 4M9NA 9ICFA 1R8BA 1R89A 9ICMA 3H37A 1ZQLA 1BPYA 2M2VA 3C2MA 4EBKA 4M9JA 7ICJA 1XSPA 3PMLA 1BPZA 4P4OA 5J2GA 5HHIA 3V72A 1KNYA 5J0WA 1OU5A 1ZQJA 4UD4A 4LZGA 3HJ1A 4AT9B 5J0PA 4I2IA 1ZQKA 8ICYA 5BOMA 2W9MA 4KLMA 4XUSA 4RQ6A 8ICEA 2FMPA 4QZIA 5IILA 2ZH5A 4JWNA 3C5FA 4NM1A 5DB9A 1RZTA 4M5DA 1ZQUA 3WFQE 4I2CA 8ICVA 7ICGA 8ICGA 4M9LA 4F5NA 2IHMA 4FHYA 3LK9A 2BCQA 3OGUA 4X0AA 4IQWA 4UB4A 1ZQXA 1JMSA 4WC3A 4UB5A 3RJGA 2VANA 4UB2A 1TVAA 9ICQA 4TUPA 5BOLA 1ZQMA 3PNCA 1ZQDA 4KLTA 8ICQA 5J2JA 5J2DA 3RH4A 4X4VA 4NLZA 3MGHA 2DRAA 5J0OA 3RH6A 1PX5A 5IIKA 4E8FA 4MFFA 7ICLA 3H3AA 4WBZA 1TFYA 4WC2A 5DBAA 4WBYA 1UEVA 1ZQHA 5CR0A 4X4PA 1BPXA 5HRFA 4KLQA 8ICTA 3UXPA 1UETA 5EOZA 9ICLA 4AT9A 1V4AA 1ZQRA 3V7JA 3RJJA 5CWRA 5J0TA 5HRKA 3MDCA 4RWQA 4UAWA 3WFPA 4QZ9A 1Q79A 2P66A 3WFRE 4NY8A 4GXIA 5CHGA 5HC9A 1F5AA 8ICFA 9ICPA 4NXZA 3JPSA 4MF8A 8ICLA 2BPFA 7ICRA 9ICIA 4LZDA 5DBCA 1HUZA 4MFCA 3OV7A 1KEJA 2ZH9A 4X5VA 3OVBA 1HUOA 4PHAA 3PMNA 2PFPA 4X0BA 4FHXA 4IQUA 4IG8A 3OVAA 5TZVA 4UB3A 2PFNA 5J29A 2ZH3A 3AQMA 1UEUA 4FO6A 3OVSA 4NLKA 9ICVA 4XQ8A 1ZJNA 4YD1A 3RJIA 4MF2A 7ICIA 3RH5A 8ICKA 4DOAA 4PPXA 5J0QA 4F5OA 5J2EA 4RQ2A 1XSNA 7ICPA 2ID1A 4XRHA 8ICCA 5J0SA 3JPOA 5CA7A 4KLGA 5IIMA 4RPXA 4EBJA 3UQ2A 4I2BA 4KLDA 4O5KA 4P2HA 9ICKA 4IQVA 3HWTA 1MIYA 3K75D 4WC4A 4LT6A 4K4IA 5J2FA 1ZQYA 3UPSA 4I2EA 3C66A 5DDMA 4UAZA 4RPYA 4UBCA 3AQNA 5HRDA 2ZH4A 4R65A 9ICXA 3B0XA 4TURA 9ICUA 5HREA 7ICFA 7ICQA 3ISBA 5D46A 4YD2A 9ICBA 4QZHA 4I2JA 7ICEA 2ZH1A 5DB8A 1R8CA 2DR7A 4RQ4A 3C2KA 1R8AA 4I29A 3ISDA 4AT8B 5D4BA 4KLLA 2DRBA 8ICWA 4DOBA 4K4HA 3HW8A 4KLOA 4WC5A 8ICUA 4RQ1A 4R63A 4RT3A 5DBBA 8ICXA 8ICAA 5IIOA 5DB6A 8ICOA 2M2TA 2HHPA 4M47A 3MDAA 2RFFA 7ICMA 4UB1A 5J2IA 7ICVA 4EP7A 1ZQEA 4FHWA 4PHDA 4GXJA 4I2HA 4PGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKT A;  5DED A;  7ICK A;  4FHV A;  4WC6 A;  2ZHA A;  4PGX A;  1ZQT A;  5J2A A;  3V7K A;  3JPQ A;  3NYB A;  8ICI A;  4R66 A;  4IQT A;  1NO5 A;  2PBE A;  4X4O A;  1MQ3 A;  4QZ8 A;  8ICN A;  3AQK A;  9ICO A;  1JN3 A;  4O5E A;  4KLU A;  1ZQV A;  4WCW A;  4RWN A;  3JPN A;  9ICJ A;  3RJE A;  3H39 A;  3C18 A;  5J0Y A;  4QZG A;  3WFO A;  5J2H A;  4RWP A;  5HRL A;  4RWO A;  1BPE A;  1RPL A;  9ICA A;  4AT7 B;  4E80 A;  2ZHB A;  4AT8 A;  4GXK A;  1JQR A;  2ZH6 A;  7ICS A;  5D49 A;  3WFS C;  3HIY A;  8ICZ A;  4M9H A;  2DR5 A;  4I28 A;  4FH5 A;  3RJH A;  4XA5 A;  8ICH A;  5F2V O;  1MQ2 A;  4KLI A;  4PH5 A;  4TUS A;  2GWS A;  4PHE A;  2BE3 A;  1ZQW A;  4YN4 A;  3B0Y A;  4X4N A;  3OUY A;  5HR9 A;  9ICG A;  4QZB A;  4S3N A;  4Z6E A;  5HRI A;  3AU2 A;  4M2Y A;  5III A;  3AQL A;  4JWM A;  4UAY A;  1ZQN A;  4O5C A;  2M2W A;  1TV9 A;  7ICN A;  1XSL A;  3AU6 A;  5HRG A;  9ICN A;  4YCX A;  4O9M A;  3MBY A;  4M04 A;  2DR9 A;  4DO9 A;  3AUO A;  8ICJ A;  1ZQS A;  3JZ0 A;  2Q66 A;  1ZQB A;  1KDH A;  5J2C A;  4Z6D A;  4RT2 A;  2ISO A;  4F5R A;  5DB7 A;  4RQ0 A;  4MFA A;  1ZQO A;  2BPG A;  8ICP A;  4WC1 A;  4AT7 A;  3JPR A;  4I27 A;  5CP2 A;  4X4S A;  4X4R A;  4M9G A;  9ICT A;  1ZQQ A;  1VJ7 A;  4QZF A;  3JPT A;  5DEC A;  1MIV A;  4RQ8 A;  3TFS A;  3C5G A;  1ZQG A;  4UD5 A;  4P4P A;  5HRB A;  1TFW A;  2ZH7 A;  4TUQ A;  4QZC A;  3RJF A;  8ICS A;  9ICW A;  2BCV A;  4X4T A;  2BPC A;  4YMM A;  1ZQP A;  1ZQI A;  4X4Q A;  4K4G A;  4P4M A;  3OUY B;  8ICB A;  2BCU A;  4I2G A;  4ATB A;  5IIJ A;  4F5Q A;  4QZA A;  3L9D A;  4QZE A;  4LVS A;  4YMN A;  4QZD A;  3C2L A;  2PXI A;  1BPD A;  4FH3 A;  4UBB A;  2DVI A;  4RPZ A;  5DDY A;  3ISC A;  3HX0 A;  9ICC A;  3GDX A;  1MIW A;  4YMO A;  3H38 A;  4WC0 A;  1BPB A;  4I2F A;  2O1P A;  1ZQZ A;  5IIN A;  5J0X A;  9ICH A;  4NM2 A;  5J2B A;  2BCS A;  3V7L A;  4NLN A;  1FA0 A;  2FMQ A;  3RJK A;  4KLF A;  2FMS A;  4F5P A;  3JPP A;  3UXO A;  2ISP A;  3UQ0 A;  9ICE A;  5HHH A;  4DOC A;  3HJ4 A;  5J0U A;  1ZQA A;  8ICM A;  2PFO A;  1Q78 A;  4Z6F A;  1VFG A;  9ICS A;  1ZJM A;  1ZQF A;  3UXN A;  3UPQ A;  4M0A A;  5CJ7 A;  4RQ7 A;  4RQ5 A;  2NRK A;  4KLH A;  7ICU A;  9ICR A;  2I9G A;  5J2K A;  4KLS A;  1NOM A;  4R64 A;  5DKW A;  4XQ7 A;  4NKU A;  5J0R A;  2DR8 A;  2ZH8 A;  4PHP A;  4I2A A;  4RQ3 A;  2BCR A;  2M2U A;  7ICH A;  3MGI A;  4PGY A;  1JAJ A;  7ICO A;  4WC7 A;  7ICT A;  1WOT A;  3JYY A;  5HRH A;  4E7X A;  4KLE A;  8ICR A;  4X4U A;  1YLQ A;  2O5A A;  4ATB B;  4Z6C A;  3LQC B;  3TFR A;  5CB1 A;  1ZQC A;  2ZH2 A;  4FHP A;  5BPC A;  4KLJ A;  4I2D A;  2PFQ A;  4M9N A;  9ICF A;  1R8B A;  1R89 A;  9ICM A;  3H37 A;  1ZQL A;  1BPY A;  2M2V A;  3C2M A;  4EBK A;  4M9J A;  7ICJ A;  1XSP A;  3PML A;  1BPZ A;  4P4O A;  5J2G A;  5HHI A;  3V72 A;  1KNY A;  5J0W A;  1OU5 A;  1ZQJ A;  4UD4 A;  4LZG A;  3HJ1 A;  4AT9 B;  5J0P A;  4I2I A;  1ZQK A;  8ICY A;  5BOM A;  2W9M A;  4KLM A;  4XUS A;  4RQ6 A;  8ICE A;  2FMP A;  4QZI A;  5IIL A;  2ZH5 A;  4JWN A;  3C5F A;  4NM1 A;  5DB9 A;  1RZT A;  4M5D A;  1ZQU A;  3WFQ E;  4I2C A;  8ICV A;  7ICG A;  8ICG A;  4M9L A;  4F5N A;  2IHM A;  4FHY A;  3LK9 A;  2BCQ A;  3OGU A;  4X0A A;  4IQW A;  4UB4 A;  1ZQX A;  1JMS A;  4WC3 A;  4UB5 A;  3RJG A;  2VAN A;  4UB2 A;  1TVA A;  9ICQ A;  4TUP A;  5BOL A;  1ZQM A;  3PNC A;  1ZQD A;  4KLT A;  8ICQ A;  5J2J A;  5J2D A;  3RH4 A;  4X4V A;  4NLZ A;  3MGH A;  2DRA A;  5J0O A;  3RH6 A;  1PX5 A;  5IIK A;  4E8F A;  4MFF A;  7ICL A;  3H3A A;  4WBZ A;  1TFY A;  4WC2 A;  5DBA A;  4WBY A;  1UEV A;  1ZQH A;  5CR0 A;  4X4P A;  1BPX A;  5HRF A;  4KLQ A;  8ICT A;  3UXP A;  1UET A;  5EOZ A;  9ICL A;  4AT9 A;  1V4A A;  1ZQR A;  3V7J A;  3RJJ A;  5CWR A;  5J0T A;  5HRK A;  3MDC A;  4RWQ A;  4UAW A;  3WFP A;  4QZ9 A;  1Q79 A;  2P66 A;  3WFR E;  4NY8 A;  4GXI A;  5CHG A;  5HC9 A;  1F5A A;  8ICF A;  9ICP A;  4NXZ A;  3JPS A;  4MF8 A;  8ICL A;  2BPF A;  7ICR A;  9ICI A;  4LZD A;  5DBC A;  1HUZ A;  4MFC A;  3OV7 A;  1KEJ A;  2ZH9 A;  4X5V A;  3OVB A;  1HUO A;  4PHA A;  3PMN A;  2PFP A;  4X0B A;  4FHX A;  4IQU A;  4IG8 A;  3OVA A;  5TZV A;  4UB3 A;  2PFN A;  5J29 A;  2ZH3 A;  3AQM A;  1UEU A;  4FO6 A;  3OVS A;  4NLK A;  9ICV A;  4XQ8 A;  1ZJN A;  4YD1 A;  3RJI A;  4MF2 A;  7ICI A;  3RH5 A;  8ICK A;  4DOA A;  4PPX A;  5J0Q A;  4F5O A;  5J2E A;  4RQ2 A;  1XSN A;  7ICP A;  2ID1 A;  4XRH A;  8ICC A;  5J0S A;  3JPO A;  5CA7 A;  4KLG A;  5IIM A;  4RPX A;  4EBJ A;  3UQ2 A;  4I2B A;  4KLD A;  4O5K A;  4P2H A;  9ICK A;  4IQV A;  3HWT A;  1MIY A;  3K75 D;  4WC4 A;  4LT6 A;  4K4I A;  5J2F A;  1ZQY A;  3UPS A;  4I2E A;  3C66 A;  5DDM A;  4UAZ A;  4RPY A;  4UBC A;  3AQN A;  5HRD A;  2ZH4 A;  4R65 A;  9ICX A;  3B0X A;  4TUR A;  9ICU A;  5HRE A;  7ICF A;  7ICQ A;  3ISB A;  5D46 A;  4YD2 A;  9ICB A;  4QZH A;  4I2J A;  7ICE A;  2ZH1 A;  5DB8 A;  1R8C A;  2DR7 A;  4RQ4 A;  3C2K A;  1R8A A;  4I29 A;  3ISD A;  4AT8 B;  5D4B A;  4KLL A;  2DRB A;  8ICW A;  4DOB A;  4K4H A;  3HW8 A;  4KLO A;  4WC5 A;  8ICU A;  4RQ1 A;  4R63 A;  4RT3 A;  5DBB A;  8ICX A;  8ICA A;  5IIO A;  5DB6 A;  8ICO A;  2M2T A;  2HHP A;  4M47 A;  3MDA A;  2RFF A;  7ICM A;  4UB1 A;  5J2I A;  7ICV A;  4EP7 A;  1ZQE A;  4FHW A;  4PHD A;  4GXJ A;  4I2H A;  4PGQ A; 
#chains in the Genus database with same CATH topology
 2EWR A;  4NKT A;  5DED A;  7ICK A;  4FHV A;  5D61 A;  4WC6 A;  2ZHA A;  4PGX A;  1ZQT A;  4NXW A;  5J2A A;  3V7K A;  3JPQ A;  4K8V A;  3NYB A;  8ICI A;  4R66 A;  4IQT A;  1NO5 A;  2PBE A;  4X4O A;  1MQ3 A;  4QZ8 A;  8ICN A;  3AQK A;  9ICO A;  1JN3 A;  4O5E A;  4KLU A;  1ZQV A;  4WCW A;  4RWN A;  3JPN A;  9ICJ A;  3RJE A;  3H39 A;  4K99 A;  5CFS A;  3C18 A;  4WQL A;  5J0Y A;  2IUB A;  4QZG A;  4NXX A;  3WFO A;  5J2H A;  4RWP A;  5HRL A;  4RWO A;  1BPE A;  1RPL A;  9ICA A;  4AT7 B;  4E80 A;  2ZHB A;  4AT8 A;  4GXK A;  1JQR A;  2ZH6 A;  7ICS A;  4OAF A;  5D49 A;  3WFS C;  3HIY A;  4O68 A;  8ICZ A;  4M9H A;  2DR5 A;  4I28 A;  4FH5 A;  3RJH A;  4XA5 A;  8ICH A;  5F2V O;  1MQ2 A;  4KLI A;  3PHZ A;  4PH5 A;  4TUS A;  2GWS A;  4PHE A;  2BE3 A;  1ZQW A;  4YN4 A;  3B0Y A;  4OAH A;  3OUY A;  5HR9 A;  4X4N A;  4QZB A;  9ICG A;  3CK6 A;  4S3N A;  4Z6E A;  5HRI A;  3AU2 A;  4M2Y A;  5III A;  3AQL A;  4JWM A;  4UAY A;  1ZQN A;  4O5C A;  2M2W A;  1TV9 A;  7ICN A;  1XSL A;  3AU6 A;  5HRG A;  9ICN A;  4YCX A;  4O9M A;  4LEW A;  3MBY A;  4M04 A;  2HN2 A;  2DR9 A;  4DO9 A;  3AUO A;  8ICJ A;  1ZQS A;  3JZ0 A;  2Q66 A;  1ZQB A;  1KDH A;  5J2C A;  4Z6D A;  4RT2 A;  2ISO A;  4F5R A;  5DB7 A;  4RQ0 A;  4MFA A;  1ZQO A;  2BPG A;  8ICP A;  4WC1 A;  4KM5 A;  4AT7 A;  3JPR A;  4I27 A;  5CP2 A;  4X4S A;  3K7D A;  4X4R A;  4M9G A;  9ICT A;  1ZQQ A;  1VJ7 A;  4QZF A;  3JPT A;  4WQK A;  5DEC A;  3ER9 B;  1MIV A;  4RQ8 A;  3TFS A;  3C5G A;  4JLZ A;  1ZQG A;  4UD5 A;  4P4P A;  5HRB A;  1TFW A;  2ZH7 A;  4TUQ A;  4QZC A;  3RJF A;  8ICS A;  9ICW A;  2BCV A;  4X4T A;  2BPC A;  4K97 A;  4YMM A;  1ZQP A;  1ZQI A;  4X4Q A;  4K4G A;  4P4M A;  3OUY B;  8ICB A;  2BCU A;  4I2G A;  4ATB A;  5IIJ A;  4F5Q A;  4QZA A;  3L9D A;  4QZE A;  4LVS A;  4YMN A;  4EEB A;  4QZD A;  3C2L A;  2PXI A;  1BPD A;  4FH3 A;  4O6A A;  4UBB A;  5D63 A;  2DVI A;  4RPZ A;  5DDY A;  3ISC A;  3HX0 A;  9ICC A;  3GDX A;  1MIW A;  4YMO A;  3H38 A;  4WC0 A;  1BPB A;  4I2F A;  2O1P A;  1GPJ A;  1ZQZ A;  5IIN A;  5J0X A;  9ICH A;  4NM2 A;  5J2B A;  2BCS A;  3V7L A;  4NLN A;  1FA0 A;  2FMQ A;  3RJK A;  4KLF A;  5CHE A;  2FMS A;  4F5P A;  3UXO A;  3JPP A;  2ISP A;  3UQ0 A;  9ICE A;  5HHH A;  4DOC A;  3HJ4 A;  5J0U A;  3NVO A;  1ZQA A;  4O69 A;  8ICM A;  2PFO A;  1Q78 A;  4Z6F A;  1VFG A;  9ICS A;  1ZJM A;  1ZQF A;  3UXN A;  3UPQ A;  4M0A A;  5CJ7 A;  4RQ7 A;  4RQ5 A;  2GAF D;  2NRK A;  4KLH A;  4OAG A;  7ICU A;  9ICR A;  2I9G A;  5J2K A;  4KLS A;  1NOM A;  4R64 A;  5DKW A;  4XQ7 A;  2IHO A;  4I0U A;  5J0R A;  2DR8 A;  4NKU A;  2ZH8 A;  4PHP A;  4I2A A;  4RQ3 A;  2BCR A;  2M2U A;  5B3Q A;  7ICH A;  4OAI Z;  4EED A;  3MGI A;  4FO1 A;  4PGY A;  1JAJ A;  7ICO A;  4WC7 A;  7ICT A;  1WOT A;  3JYY A;  4MKP A;  5HRH A;  4E7X A;  4KLE A;  8ICR A;  4X4U A;  1YLQ A;  2O5A A;  4ATB B;  4WOY A;  4Z6C A;  3LQC B;  3TFR A;  5CB1 A;  4K9A A;  1ZQC A;  2ZH2 A;  4FHP A;  3EF2 A;  5BPC A;  4KLJ A;  4I2D A;  2PFQ A;  4M9N A;  9ICF A;  1R8B A;  1R89 A;  9ICM A;  3H37 A;  1ZQL A;  1BPY A;  4O67 A;  2M2V A;  3C2M A;  4EBK A;  4M9J A;  7ICJ A;  1XSP A;  3PML A;  4NXU A;  1BPZ A;  4N7R A;  4P4O A;  5J2G A;  5HHI A;  3V72 A;  1KNY A;  5J0W A;  1OU5 A;  1ZQJ A;  4UD4 A;  4KB6 A;  4LZG A;  3HJ1 A;  4AT9 B;  5J0P A;  4I2I A;  1ZQK A;  2B4V A;  8ICY A;  5BOM A;  2W9M A;  4KLM A;  4XUS A;  4RQ6 A;  8ICE A;  5CFT A;  2FMP A;  4QZI A;  5IIL A;  2ZH5 A;  4JWN A;  3C5F A;  4NM1 A;  5DB9 A;  1RZT A;  4M5D A;  4LEV A;  1ZQU A;  3WFQ E;  4I2C A;  4NXT A;  8ICV A;  7ICG A;  8ICG A;  4M9L A;  4F5N A;  2IHM A;  4FHY A;  4WH5 A;  3LK9 A;  2BCQ A;  3OGU A;  4X0A A;  4IQW A;  4UB4 A;  1ZQX A;  1JMS A;  4WC3 A;  4UB5 A;  3RJG A;  4LEY A;  2VAN A;  4UB2 A;  1TVA A;  9ICQ A;  4TUP A;  5BOL A;  1ZQM A;  3PNC A;  1ZQD A;  4KLT A;  8ICQ A;  5J2J A;  5J2D A;  4XJE A;  3RH4 A;  4X4V A;  4NLZ A;  3MGH A;  2DRA A;  5J0O A;  3RH6 A;  1PX5 A;  5IIK A;  4E8F A;  4MFF A;  7ICL A;  3H3A A;  4WBZ A;  1TFY A;  4WC2 A;  3NKU A;  5DBA A;  4WBY A;  1UEV A;  1ZQH A;  5CR0 A;  4X4P A;  1BPX A;  5HRF A;  4KLQ A;  8ICT A;  3UXP A;  1UET A;  5EOZ A;  9ICL A;  4AT9 A;  1V4A A;  1ZQR A;  3V7J A;  3RJJ A;  5CWR A;  5J0T A;  5HRK A;  3JCF A;  3MDC A;  4EGW A;  4RWQ A;  2BBJ A;  4UAW A;  4K96 A;  3WFP A;  4QZ9 A;  3ER8 C;  1Q79 A;  5CFU A;  2P66 A;  3WFR E;  4NY8 A;  2GA9 D;  4GXI A;  5CHG A;  5HC9 A;  1F5A A;  8ICF A;  9ICP A;  4NXZ A;  4K98 A;  3JPS A;  3NWI A;  4MF8 A;  8ICL A;  2BPF A;  7ICR A;  9ICI A;  4LZD A;  5DBC A;  1HUZ A;  4MFC A;  3OV7 A;  1KEJ A;  2ZH9 A;  4X5V A;  3OVB A;  2B51 A;  1HUO A;  4PHA A;  3PMN A;  2PFP A;  4X0B A;  4FHX A;  4HX0 A;  4IQU A;  4JLX A;  4IG8 A;  3OVA A;  5TZV A;  4UB3 A;  2PFN A;  5J29 A;  2BBH A;  2ZH3 A;  3AQM A;  1UEU A;  4FO6 A;  3OVS A;  4NLK A;  9ICV A;  4LEZ A;  4XQ8 A;  1ZJN A;  5D62 A;  4YD1 A;  3RJI A;  4MF2 A;  7ICI A;  3RH5 A;  8ICK A;  3MCR A;  4DOA A;  4PPX A;  5J0Q A;  4F5O A;  5J2E A;  4RQ2 A;  1XSN A;  7ICP A;  2ID1 A;  4XRH A;  8ICC A;  5J0S A;  3JPO A;  5CA7 A;  4KLG A;  5IIM A;  4RPX A;  4EBJ A;  3UQ2 A;  4I2B A;  4KLD A;  4EV6 A;  4O5K A;  4P2H A;  9ICK A;  4IQV A;  3HWT A;  1MIY A;  3K75 D;  4WC4 A;  4K9B A;  4LT6 A;  4K4I A;  5J2F A;  1ZQY A;  3UPS A;  4I2E A;  3C66 A;  5DDM A;  4UAZ A;  4RPY A;  4UBC A;  3AQN A;  5HRD A;  2ZH4 A;  4R65 A;  9ICX A;  2B56 A;  3B0X A;  4TUR A;  9ICU A;  5HRE A;  7ICF A;  7ICQ A;  3ISB A;  3ERC C;  5D46 A;  2HN1 A;  4YD2 A;  9ICB A;  5B3P A;  4QZH A;  4I2J A;  7ICE A;  2ZH1 A;  5DB8 A;  1R8C A;  2DR7 A;  4RQ4 A;  3C2K A;  1R8A A;  4I29 A;  3ISD A;  4NXV A;  4AT8 B;  5D4B A;  3OWG A;  4KLL A;  2DRB A;  8ICW A;  4DOB A;  4K4H A;  3HW8 A;  2FCL A;  4KLO A;  4WC5 A;  8ICU A;  4RQ1 A;  4R63 A;  4RT3 A;  5DBB A;  8ICX A;  8ICA A;  5JTG A;  5IIO A;  5DB6 A;  8ICO A;  2M2T A;  2HHP A;  4M47 A;  3MDA A;  2RFF A;  7ICM A;  4UB1 A;  5J2I A;  7ICV A;  4EP7 A;  1ZQE A;  4FHW A;  4PHD A;  4GXJ A;  4I2H A;  4PGQ A; 
#chains in the Genus database with same CATH homology
 4NKT A;  5DED A;  7ICK A;  4FHV A;  4WC6 A;  2ZHA A;  4PGX A;  1ZQT A;  5J2A A;  3V7K A;  3JPQ A;  3NYB A;  8ICI A;  4R66 A;  4IQT A;  1NO5 A;  2PBE A;  4X4O A;  1MQ3 A;  4QZ8 A;  8ICN A;  3AQK A;  9ICO A;  1JN3 A;  4O5E A;  4KLU A;  1ZQV A;  4WCW A;  4RWN A;  3JPN A;  9ICJ A;  3RJE A;  3H39 A;  3C18 A;  5J0Y A;  4QZG A;  3WFO A;  5J2H A;  4RWP A;  5HRL A;  4RWO A;  1BPE A;  1RPL A;  9ICA A;  4AT7 B;  4E80 A;  2ZHB A;  4AT8 A;  4GXK A;  1JQR A;  2ZH6 A;  7ICS A;  5D49 A;  3WFS C;  3HIY A;  8ICZ A;  4M9H A;  2DR5 A;  4I28 A;  4FH5 A;  3RJH A;  4XA5 A;  8ICH A;  5F2V O;  1MQ2 A;  4KLI A;  4PH5 A;  4TUS A;  2GWS A;  4PHE A;  2BE3 A;  1ZQW A;  4YN4 A;  3B0Y A;  4X4N A;  3OUY A;  5HR9 A;  9ICG A;  4QZB A;  4S3N A;  4Z6E A;  5HRI A;  3AU2 A;  4M2Y A;  5III A;  3AQL A;  4JWM A;  4UAY A;  1ZQN A;  4O5C A;  2M2W A;  1TV9 A;  7ICN A;  1XSL A;  3AU6 A;  5HRG A;  9ICN A;  4YCX A;  4O9M A;  3MBY A;  4M04 A;  2DR9 A;  4DO9 A;  3AUO A;  8ICJ A;  1ZQS A;  3JZ0 A;  2Q66 A;  1ZQB A;  1KDH A;  5J2C A;  4Z6D A;  4RT2 A;  2ISO A;  4F5R A;  5DB7 A;  4RQ0 A;  4MFA A;  1ZQO A;  2BPG A;  8ICP A;  4WC1 A;  4AT7 A;  3JPR A;  4I27 A;  5CP2 A;  4X4S A;  4X4R A;  4M9G A;  9ICT A;  1ZQQ A;  1VJ7 A;  4QZF A;  3JPT A;  5DEC A;  1MIV A;  4RQ8 A;  3TFS A;  3C5G A;  1ZQG A;  4UD5 A;  4P4P A;  5HRB A;  1TFW A;  2ZH7 A;  4TUQ A;  4QZC A;  3RJF A;  8ICS A;  9ICW A;  2BCV A;  4X4T A;  2BPC A;  4YMM A;  1ZQP A;  1ZQI A;  4X4Q A;  4K4G A;  4P4M A;  3OUY B;  8ICB A;  2BCU A;  4I2G A;  4ATB A;  5IIJ A;  4F5Q A;  4QZA A;  3L9D A;  4QZE A;  4LVS A;  4YMN A;  4QZD A;  3C2L A;  2PXI A;  1BPD A;  4FH3 A;  4UBB A;  2DVI A;  4RPZ A;  5DDY A;  3ISC A;  3HX0 A;  9ICC A;  3GDX A;  1MIW A;  4YMO A;  3H38 A;  4WC0 A;  1BPB A;  4I2F A;  2O1P A;  1ZQZ A;  5IIN A;  5J0X A;  9ICH A;  4NM2 A;  5J2B A;  2BCS A;  3V7L A;  4NLN A;  1FA0 A;  2FMQ A;  3RJK A;  4KLF A;  2FMS A;  4F5P A;  3JPP A;  3UXO A;  2ISP A;  3UQ0 A;  9ICE A;  5HHH A;  4DOC A;  3HJ4 A;  5J0U A;  1ZQA A;  8ICM A;  2PFO A;  1Q78 A;  4Z6F A;  1VFG A;  9ICS A;  1ZJM A;  1ZQF A;  3UXN A;  3UPQ A;  4M0A A;  5CJ7 A;  4RQ7 A;  4RQ5 A;  2NRK A;  4KLH A;  7ICU A;  9ICR A;  2I9G A;  5J2K A;  4KLS A;  1NOM A;  4R64 A;  5DKW A;  4XQ7 A;  4NKU A;  5J0R A;  2DR8 A;  2ZH8 A;  4PHP A;  4I2A A;  4RQ3 A;  2BCR A;  2M2U A;  7ICH A;  3MGI A;  4PGY A;  1JAJ A;  7ICO A;  4WC7 A;  7ICT A;  1WOT A;  3JYY A;  5HRH A;  4E7X A;  4KLE A;  8ICR A;  4X4U A;  1YLQ A;  2O5A A;  4ATB B;  4Z6C A;  3LQC B;  3TFR A;  5CB1 A;  1ZQC A;  2ZH2 A;  4FHP A;  5BPC A;  4KLJ A;  4I2D A;  2PFQ A;  4M9N A;  9ICF A;  1R8B A;  1R89 A;  9ICM A;  3H37 A;  1ZQL A;  1BPY A;  2M2V A;  3C2M A;  4EBK A;  4M9J A;  7ICJ A;  1XSP A;  3PML A;  1BPZ A;  4P4O A;  5J2G A;  5HHI A;  3V72 A;  1KNY A;  5J0W A;  1OU5 A;  1ZQJ A;  4UD4 A;  4LZG A;  3HJ1 A;  4AT9 B;  5J0P A;  4I2I A;  1ZQK A;  8ICY A;  5BOM A;  2W9M A;  4KLM A;  4XUS A;  4RQ6 A;  8ICE A;  2FMP A;  4QZI A;  5IIL A;  2ZH5 A;  4JWN A;  3C5F A;  4NM1 A;  5DB9 A;  1RZT A;  4M5D A;  1ZQU A;  3WFQ E;  4I2C A;  8ICV A;  7ICG A;  8ICG A;  4M9L A;  4F5N A;  2IHM A;  4FHY A;  3LK9 A;  2BCQ A;  3OGU A;  4X0A A;  4IQW A;  4UB4 A;  1ZQX A;  1JMS A;  4WC3 A;  4UB5 A;  3RJG A;  2VAN A;  4UB2 A;  1TVA A;  9ICQ A;  4TUP A;  5BOL A;  1ZQM A;  3PNC A;  1ZQD A;  4KLT A;  8ICQ A;  5J2J A;  5J2D A;  3RH4 A;  4X4V A;  4NLZ A;  3MGH A;  2DRA A;  5J0O A;  3RH6 A;  1PX5 A;  5IIK A;  4E8F A;  4MFF A;  7ICL A;  3H3A A;  4WBZ A;  1TFY A;  4WC2 A;  5DBA A;  4WBY A;  1UEV A;  1ZQH A;  5CR0 A;  4X4P A;  1BPX A;  5HRF A;  4KLQ A;  8ICT A;  3UXP A;  1UET A;  5EOZ A;  9ICL A;  4AT9 A;  1V4A A;  1ZQR A;  3V7J A;  3RJJ A;  5CWR A;  5J0T A;  5HRK A;  3MDC A;  4RWQ A;  4UAW A;  3WFP A;  4QZ9 A;  1Q79 A;  2P66 A;  3WFR E;  4NY8 A;  4GXI A;  5CHG A;  5HC9 A;  1F5A A;  8ICF A;  9ICP A;  4NXZ A;  3JPS A;  4MF8 A;  8ICL A;  2BPF A;  7ICR A;  9ICI A;  4LZD A;  5DBC A;  1HUZ A;  4MFC A;  3OV7 A;  1KEJ A;  2ZH9 A;  4X5V A;  3OVB A;  1HUO A;  4PHA A;  3PMN A;  2PFP A;  4X0B A;  4FHX A;  4IQU A;  4IG8 A;  3OVA A;  5TZV A;  4UB3 A;  2PFN A;  5J29 A;  2ZH3 A;  3AQM A;  1UEU A;  4FO6 A;  3OVS A;  4NLK A;  9ICV A;  4XQ8 A;  1ZJN A;  4YD1 A;  3RJI A;  4MF2 A;  7ICI A;  3RH5 A;  8ICK A;  4DOA A;  4PPX A;  5J0Q A;  4F5O A;  5J2E A;  4RQ2 A;  1XSN A;  7ICP A;  2ID1 A;  4XRH A;  8ICC A;  5J0S A;  3JPO A;  5CA7 A;  4KLG A;  5IIM A;  4RPX A;  4EBJ A;  3UQ2 A;  4I2B A;  4KLD A;  4O5K A;  4P2H A;  9ICK A;  4IQV A;  3HWT A;  1MIY A;  3K75 D;  4WC4 A;  4LT6 A;  4K4I A;  5J2F A;  1ZQY A;  3UPS A;  4I2E A;  3C66 A;  5DDM A;  4UAZ A;  4RPY A;  4UBC A;  3AQN A;  5HRD A;  2ZH4 A;  4R65 A;  9ICX A;  3B0X A;  4TUR A;  9ICU A;  5HRE A;  7ICF A;  7ICQ A;  3ISB A;  5D46 A;  4YD2 A;  9ICB A;  4QZH A;  4I2J A;  7ICE A;  2ZH1 A;  5DB8 A;  1R8C A;  2DR7 A;  4RQ4 A;  3C2K A;  1R8A A;  4I29 A;  3ISD A;  4AT8 B;  5D4B A;  4KLL A;  2DRB A;  8ICW A;  4DOB A;  4K4H A;  3HW8 A;  4KLO A;  4WC5 A;  8ICU A;  4RQ1 A;  4R63 A;  4RT3 A;  5DBB A;  8ICX A;  8ICA A;  5IIO A;  5DB6 A;  8ICO A;  2M2T A;  2HHP A;  4M47 A;  3MDA A;  2RFF A;  7ICM A;  4UB1 A;  5J2I A;  7ICV A;  4EP7 A;  1ZQE A;  4FHW A;  4PHD A;  4GXJ A;  4I2H A;  4PGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...