4EEDA

Cora coiled-coil mutant under mg2+ presence
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
324
structure length
314
Chain Sequence
DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transport protein CorA
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport
total genus 98
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eedA01
2IUBA 3CK6A 2HN1A 3RKGA 4I0UA 4EGWA 3NVOA 2BBJA 4EV6A 4EEBA 2HN2A 3NWIA 4EEDA 5JTGA 2BBHA 3JCFA
chains in the Genus database with same CATH superfamily
3X1DA 4RT2A 2AE9A 2HPJA 2V6YA 2ISPA 2D9DA 5LGUB 4ISSA 9ICLA 1LRZA 4AT9A 2JQQA 3HL6A 2XTLA 1VRBA 3UULA 2G0UA 4B6XA 1BPBA 3EDVA 3ZYKA 4BJMA 1HG5A 3WFSC 3JC6D 4JI6T 4WH5A 4PJMA 3AE1A 3OUYA 1ZQNA 4RQ3A 1Y01A 5CFTA 4NUVA 2IMLA 4UF0B 4OAFA 4X20E 5HHIA 4JI8T 1VOMA 7ICJA 2X51A 2V26A 1W9RA 2LE8A 4GXKA 3VKHA 5KX5E 3OVAA 4M04A 4O69A 1YQ3A 4P4MA 3E08A 1HF8A 2WSSV 2J1DG 2CXLA 4PPXA 3ZMUB 5DB8A 4TZ4C 3V5SA 2A72A 2N2NA 9ICJA 3A8YC 4PJJA 2C5JA 4EAHA 2W2UA 3AA7B 1MIVA 4K4HA 5CGMA 4L0RA 4X4RA 2K24A 4OHFA 3Q5XA 5C2TA 1I94T 4NLNA 3RIAA 4I55E 2WZHA 1WCRA 2CLYB 5DQWA 5CHGA 3EUHA 3NZPA 1KEJA 3RJKA 5ABEA 4IDZA 2EWRA 4K99A 4I2JA 5LHIB 5JDHA 3OKQA 3JAFA 4PK6A 1YLQA 2ES0A 3OPCA 4IGUA 3PMLA 3C98B 2YDQA 2X9YA 2IUBA 2W00A 1E2AA 4Z6EA 3JADA 3H39A 2HPLA 2XM1A 5J0WA 4IQTA 4FI5A 4RWOA 2C5IT 4Z6FA 2ACZA 1N36T 3PUGA 5JVDE 5BMVE 4M9NA 1X9BA 4AIUA 4F5OA 4DNDA 5FY7A 4IHJE 2DVIA 3K7DA 5J2DA 3BK9A 4QZHA 4PJLA 3T8OA 2ZLYA 1JN3A 5L3CB 3NWIA 5JDFA 3ZLIA 4YTNA 4O2BE 3WFQE 2JRKA 4UAZA 1Z8UA 3PUWF 4NXMT 8ICNA 2IDOB 2WCAA 2YDRA 4JI4T 4TUQA 5HXCA 4YMOA 3JPPA 2Q66A 1QUUA 4X1KE 1ZQZA 3M65A 4LF7T 2K48A 4FHVA 3EF2A 4X0BA 1US7B 4NXXA 1JAJA 4DBQA 9ICOA 4EBKA 5J0OA 3AAAB 3TFRA 3HKEE 2VVSA 3EVYA 3N2KE 4DUZT 4KLOA 1ZQTA 2WDRA 9ICBA 2VL0A 3CX6B 5JRCB 2VKJA 2H3RA 3AEGA 4ZS3A 1NEKA 4Z91A 1S94A 3DTOA 7ICEA 1XZYA 2EHOA 4Z90A 3F2EA 4PHEA 5LG3A 4DUYT 4KLIA 1KEYA 1YKEB 2VKOA 3ZN0B 3K3OA 3C51A 3VRAA 2MYSA 2BVMA 3T1YT 7ICRA 3RJHA 4RQ1A 5J2JA 4AQYT 8ICTA 2CWYA 2IC9A 3PHZA 1UEUA 4QZBA 2PXIA 4Z6CA 3LK42 5LJNA 4ILUA 4YLHA 4FH3A 4UVCB 4L5GA 1EZ3A 2DRAA 3FZKB 4PK5A 5AQSB 2ODVA 4IREA 1DU2A 2A2FX 5IWAT 5CJ5A 3K3NA 4XJEA 1B7TA 3MK7C 4JI2T 3K1SA 3CKDA 1MMDA 2BKOA 3C4ZA 3HJ1A 3UPQA 2NOXA 4O4LE 1OEDB 3RC8A 4TUSA 4PGYA 2CBIA 4PAGA 3UUMA 1OEDE 5CA1E 3PUQA 5JDNA 5HRBA 4JI0T 5JR9B 4GIWA 4UF0A 2QYWA 1M7KA 5L4EA 5IIOA 3PE0A 4GKJT 2KNDA 2X0LB 3Q9DA 5HEGA 2P66A 1ZV4X 4PK4A 4WC2A 2ZM6T 2WDVA 7ICTA 3ZMTB 3ONLC 4ZZCA 3AE2A 2UUCT 4WCWA 3N2GE 2UUBT 1TVAA 2B4VA 3NKUA 1ZQMA 4X0AA 4GXJA 4QZDA 2ZH4A 4UVAB 1BPDA 4JLXA 3OVUA 5CHEA 3ZYMA 2QGSA 5KDMC 1MMAA 4KBMB 3ABVA 2WAUA 2DRBA 3SFDA 1WFDA 4Q25A 2H7VC 4GKKT 4LFBT 9ICPA 3Q5DA 4H9QC 4R65A 3TLTA 2C5KT 1U4QA 2XAGB 3FZLB 3ER8C 1JNRA 3C50A 4QZ8A 5CB4E 2XQ9A 3ZT6A 5L47A 5AQUB 5DBCA 4I2DA 5J1GA 2O5AA 3G06A 1OWAA 3P4RA 4C90A 4UVBB 3F31A 1FMVA 2B51A 4WBZA 1ZQJA 3ZMZB 1XSLA 5ABFB 5GONE 4UV8B 3JC6C 4O9MA 3JPNA 4YSYA 2CMRA 2V7LA 4HWHA 2ZH9A 1WYBA 4NM1A 3MA9A 3VKGA 4LZDA 2YK0A 1UX5A 3RYCE 5CFUA 4UB1A 2VB6A 2LKGA 2FMSA 4TX5A 9ICEA 2CHNA 3JZ0A 4YJ2E 2R6GF 4JEUB 2CHOA 1ZJMA 3HX0A 4FH5A 2LSIA 4ILCA 2QRXA 4IG8A 2FJEA 3C18A 5J0ZA 4JLZA 2DI4A 4LMKA 3RJFA 2VANA 3LFMA 2VK9A 5JRCA 3MXZA 4I2GA 3RHWA 2PFNA 3N9LA 3OV7A 3NKZA 5LP6E 1T7SA 4PGQA 2WZIA 2Q9QB 2BG9C 1HNXT 4X1IE 5C8YE 5HEJA 3H37A 4RQ6A 4P0BA 5AQOB 3Q5EA 2BS4A 3PJAJ 5DB6A 2SPCA 1IAPA 5J0TA 4YSXA 2PFOA 4A98A 9ICVA 8ICCA 4DR7T 4K9AA 5EK3A 4NY8A 1ZOYA 2X0YA 3EI0A 5J2EA 2FMQA 3ANWA 4HEAA 2NW8A 1TV9A 4QXCB 7ICNA 3ZJ1A 3GN5A 4ZI2D 2P9BA 1FEWA 3KDSE 2LSGA 4LF4T 4HKAA 5AQMB 3SRZA 4A5XA 1MIWA 2ZH1A 2NP9A 2WDQA 4LF9T 2ZM2A 1YQ4A 3KBTA 3AE3A 3S4UA 5C3JA 3FZMB 4YY3T 3LJCA 2VWAA 3PUVF 3PJAA 5CR0A 1F5AA 9ICFA 1XWMA 1XMQT 3PURA 4KMCA 2LLYA 1RPLA 4ZI7E 5CFBA 5HRIA 4YTPA 4MF8A 4QX7B 1LKXA 3V5UA 5IIKA 5JH7E 1WR0A 2JQHA 3ZKRA 5JREA 4JI5T 3FZHB 2BBJA 1VFGA 1D1AA 3CX8B 5AQVB 2LM2A 4PHDA 7ICSA 2HHPA 4E80A 4UIGA 3JPRA 5J2IA 2V7KA 4HWCA 5FVKA 4TUPA 4DV7T 4P1NA 4AKIA 5HYAA 5H6RB 3RYFE 5F2VO 2XQ6A 5CWRA 2XQ4A 4H63V 1NAFA 4KLGA 2Q9QD 1OXZA 5HWYA 4XZCA 9ICQA 3AEEA 2KWIB 1ZKEA 4BA9A 2V7MA 3GDXA 4HFDA 5HEOA 4DR1T 3LDQB 5FXVA 4U3CA 2CWOA 5AQFB 3PUYF 3AAIA 2XUEA 1ZQLA 4H9PC 3L9DA 5D61A 1UETA 5LMNT 2H7OA 3U3IA 1JMSA 3LK2B 4WBOA 2BPFA 2M6IA 5AQRB 4O5CA 4X64T 8ICIA 3ZSSA 5DB9A 2KSRA 1MNEA 2PBIA 2VQET 7ICGA 4M47A 2PFQA 2BDEA 3ZSTA 1ZHCA 1ZQWA 4RQ4A 3AEFA 3V7JA 5FY0A 3RYIE 4KI0F 4U33A 2YU1A 1UURA 4NXVA 2OLTA 4MKPA 3JPSA 5AQIB 3N9OA 4COFA 4IE7A 5AQKB 4R66A 4L9IA 3PDYA 3UPSA 3HKDE 5FKYA 4M5DA 4JWNA 4PH5A 4IDNA 2FMPA 4JWMA 4KLQA 3UUNA 1HX8A 5FYMA 5J2GA 2DWGA 2B76A 2I6HA 2L3LA 3EDUA 2ISOA 4U2ZA 3I1AA 2XZEA 3P7IA 4M2YA 3RYHE 4B3ST 5BOMA 1O3XA 5HRLA 3FBLA 3TLVA 4X4OA 3H38A 1X79A 7ICOA 2BCSA 5DKWA 3PU8A 3CQGB 4NPPA 3AE9A 5HHHA 4QH5A 1D1CA 4O8SA 5IIIA 5J0SA 3PUAA 5IUXA 5FL0A 4LFAT 8ICGA 5KXJA 4AKRB 5HR9A 4I2EA 3J7Yq 1GPJA 3RRCA 9ICRA 4X5TA 4UAWA 5DECA 4O68A 2A3DA 2DR8A 1IJ5A 5BR8T 2X9WA 1W0BA 5F8PA 1ZQBA 3NYBA 2D0TA 1ZQQA 3O9XA 4EB6E 4DO0A 3I9WA 1I6ZA 4QZAA 2GWSA 3RJJA 3RQWA 4HX0A 3N9PA 4B3MT 4WQKA 5IHYA 2XQ5A 1E7PA 2C0SA 4WC6A 3UU5A 3NRYA 2PFVA 2ZH7A 2E9XB 5CP2A 1M62A 4UELA 5J0UA 1ZEEA 3QB5A 3OBVE 5TZVA 4KHZF 3JPTA 3VHLA 5L3FB 3ISCA 1OEDC 8ICOA 2JIWA 1T8BA 5BPCA 2K3WA 4O2AE 4MALA 4YCXA 4O4IE 1ZQIA 2XQ8A 5JR9C 4X4QA 3SFEA 9ICKA 3ISBA 3PU3A 3OTOT 3ZPOA 2DR9A 1ZQEA 2UU9T 2IW5B 2K5BB 3HW8A 4FHXA 8ICQA 4WC7A 4DV0T 4EYYR 1J1JA 2KINB 4RT3A 3ZT7A 2D2SA 5HCJA 2NRKA 7ICPA 3H3MA 2E2AA 1NO5A 2X0HA 8ICYA 3BQKA 4E7SA 5F3JA 3NZQA 5ABGA 7ICLA 4UB4A 4FHPA 4KB6A 2DHRA 4OK0A 1JQRA 3LQCB 3FZFB 7ICFA 5E0OA 9ICSA 3OWGA 5FL1A 5JTGA 1BPXA 3DP7A 4HTEA 4DV1T 3P4PA 4ATBA 3B0XA 4TNVA 5ADXL 3AEAA 2H88A 5DBBA 5HRDA 8ICPA 2GK9A 4B3RT 2XY8B 2ZH3A 1Z0PA 4M9GA 4Z6DA 4LMLA 5DEDA 4FHYA 5CA0E 1HUOA 5AQGB 5LBMA 2NW9A 4IE4A 3PMNA 2LHNA 1H7CA 2FBWA 1KNZA 4LEYA 2BG9A 4ZI2C 2V5CA 4AT8A 5FP3A 3F57A 3LBXB 5L2LA 4O5EA 5DDMA 4AKHA 1HX1B 2XAQB 4DR2T 3VR8A 2JMHA 3RRWA 4LF6T 4JV5T 5ETWA 4K0KT 4A56A 1D1BA 4I2HA 3CIRA 4KP3C 4UEMA 5HRFA 1UCUA 4HWDA 4KLUA 3OGUA 1ZJNA 1MMNA 5LGTB 2WQYA 5DDYA 1T98A 4UB2A 3C5GA 4IDOA 5DJQC 4PHPA 2ZH5A 1G8XA 4ISTA 2FCLA 3N9MA 3MCRA 1UK5A 2WWUA 1FMWA 1WRDA 3Q5WA 5EK4A 3CPZA 2YDSA 2IAKA 3BQLA 4YMNA 3W15B 4HFCA 4DMVA 3ER9B 3MDAA 2J62A 4X4TA 4K96A 4UR9A 3RF1A 2BCUA 2M2WA 3AVRA 4KLSA 5J2KA 4NKTA 2Q9QC 5J0QA 3LK3B 4LT6A 4EZ4A 2M2UA 2RA1A 3TKLB 5FMNA 3RH4A 3UXNA 3EHZA 3UUXB 1LVKA 3Q2MA 4X4PA 1XSNA 3O4XE 4K9BA 3T1HT 1KK7A 2MAWA 3NBXX 1NWMX 5LJMA 3GWHA 4YT0A 2WU5A 2XAHB 4LEZA 5D62A 2YINA 4LEWA 5LOVE 3CQXC 4K98A 3JYYA 8ICWA 3B57A 1UUSA 1S35A 1ZQRA 2KLQA 2PFPA 4P4PA 4RQ5A 2E8IA 4R64A 3UU8A 1R8IA 5IINA 2NTYA 3ESLA 4DV2T 2I0MA 1HCIA 3EABA 4F5QA 4XBFB 7ICUA 1HS7A 2OA5A 3AA1B 4QZCA 4UAYA 4K4IA 3AE5A 4QX8B 4IDQA 4X1YE 3PUSA 4O6AA 3AA6B 3AQNA 1VCSA 3LSVA 1G73A 2VKDA 5LMUT 2ZM8A 2VQFT 4EEDA 1UGOA 3KV9A 5FY1A 4N78D 4E7XA 1Y64B 9ICNA 5AQPB 2UXCT 2WWVA 1ZQUA 2D5UA 5FXXA 4HWFA 3AXJB 1IBMT 4HFVA 4E7ZA 4KLDA 1OU5A 4NUUA 4UBBA 2V6YB 1AJ3A 3UQ0A 2PJQA 4XA5A 3AAEB 8ICMA 3N2OA 4ZXLA 3FBZA 4AT9B 1MIYA 4DIDB 3ZMVB 1XNRT 3RH6A 3QUJA 2LT3A 4NLKA 3C4WA 2ODUA 5CJ7A 5D49A 2LSYA 8ICXA 4JI3T 2FJAA 4NXTA 2B56A 2IC6A 1V9DA 1ZQDA 3CQCB 2CE7A 3OUYB 4I50E 2HHHT 2UUAT 4WYVA 2I9GA 2RPAA 4NXWA 4JBWF 2CCQA 4TWFA 3ZN1B 4OYKA 4I43B 3C4XA 2KMFA 1ZP0A 1V4AA 3ZJ2A 5J0YA 2LJLA 2XQYA 4QHOA 2UXXB 4XAXB 3PUZF 3WAJA 1BR0A 5D4BA 3UQ4A 5JDQA 3K75D 3MACA 5HAXA 4YHHT 2BCQA 3HKCE 1BPEA 1CHUA 2YN6A 1TFWA 5HRHA 4PGXA 5D46A 4BAYB 4LVSA 3V7LA 3AEDA 5FNVE 4KX6A 4I0UA 2IHMA 2B1EA 2PG8A 4RPXA 3C2KA 3KVBA 3P4SA 4UD4A 2UXNB 5LHHB 2MBGA 1OEDA 2MOZA 4EOZB 4AQFC 1ZQOA 4PNIA 1R8BA 5IIMA 3UU4A 3IEEA 5EZYE 3AA0B 3JCFA 4PFOA 2JMKA 4UB3A 1SUMB 4DBRA 2L8KA 2J4GA 4DVDA 2W66A 5JR9A 1HFAA 1SHZC 3OJAA 2W61A 1R8CA 5L3EB 2DR7A 2V5DA 5JDMA 4F8HA 3AE8A 3P8CD 1XNQT 8ICAA 2XAJB 3KV5A 3I0QA 2D0UA 3C66A 2XQ3A 5LHGB 8ICKA 2ID1A 5DABA 4I27A 3RKGA 4GXIA 4LFCT 3TFSA 3U78A 3JPOA 2HH7A 3RJGA 2BCVA 8ICFA 2BS3A 4P4OA 1UEVA 3VU7H 2MTQA 5F5WA 1ZQAA 4ADZA 2XAFB 3L09A 4S3NA 2Y8DA 2ZHAA 2WM9A 1D0YA 4N7RA 4FO1A 4HWIB 7ICMA 2IIUA 2E9XC 5D63A 3RGLA 3UFEA 1J5ET 3RI5A 4ZZBA 2X9HA 3WFRE 2O1PA 5HEUA 2WBLA 4H9OC 4WZXA 2BKPA 5LB7B 2XHEB 4ILAA 4WC4A 1ZQGA 2BE3A 4YSZA 3BQIA 7ICHA 2YU2A 5ABHA 1HG2A 4TNWA 3VRBA 1ZQCA 3MZKB 4P09A 2EHOB 3RJIA 3J9X1 4O5KA 4OX9T 5AQJB 3QC9A 5FVLA 4MFFA 5ABFA 5LG4A 3OYZA 3MKDA 2QA7A 8ICUA 4KLMA 1E1HB 4KUMB 4IE0A 5LYJE 1KNRA 4JYAT 1LVFA 2VKHA 5HXSA 2XASB 3KV4A 3MDCA 5BOLA 1XSPA 4P2HA 2WY2A 2Y6XA 8ICHA 3IBPA 1YW0A 5LCYA 3UT5E 1FIOA 4WNKA 4I2CA 1CUNA 4RPZA 3AUOA 2CBJA 4U72A 4B3TT 3QNUA 4OAHA 4WC5A 4RQ8A 2E5LT 4NLZA 4HFHA 4EV6A 2ACXA 1TFYA 3MJXA 2YKSA 8ICLA 4TN7B 3AQMA 5HEHA 4XRHA 1ZQSA 2V1DB 2VURA 4ZS2A 3TLSA 2W67A 1ZQFA 2LM9A 4WC3A 3LK9A 4K4GA 3B5MA 4WW0A 5LA6E 3L39A 4DR6T 3WFPA 2Q9QA 3IHRA 1QLBA 3ETUA 3IF8B 3TLUA 4I29A 5J2AA 4YTMA 4JLEA 3DJBA 2LRKA 2BCRA 4I2FA 3WFOA 4ERRA 4U7YA 4IE6A 1VJ7A 8ICJA 5M4YA 2LRLA 4CXXA 2CPTA 4AXPA 3RQUA 5HCMA 5CB1A 3I0OA 3RIFA 8ICBA 2NWBA 4V1Av 4ILBA 3UTKA 2EHOD 2W0GA 4H9SE 3ISDA 2XM2A 4RWQA 4TUYE 3ZCIA 4XUSA 4F5PA 3R84B 5J2UE 2ZH8A 3RH5A 2JQ9A 4YHJA 2YOEA 4FJOA 1ZQYA 1MQ2A 2WMOA 2V7JA 1J5WA 4WBYA 3AQKA 4PW8A 4DR3T 4QXHB 4IE5A 3R6NA 4C91A 4YMMA 2W63A 4TV9E 3RH3A 2DWKA 2X67A 9ICUA 2XQ7A 3O1HA 4ZHQE 7ICIA 1SA0E 5AQHB 3AE7A 2XPKA 4ANJA 3JPQA 2L9QA 5HREA 2OV9A 4FO6A 2KZ7B 2DL1A 4O4HE 4M9HA 4MLKA 1MNDA 3NVOA 4YFSA 2LSJA 1KFYA 5LGNB 4MFRA 1HNWT 1IBKT 5AQTB 3IA3A 1NOMA 3HJ4A 1WYCA 4I4TE 3RKOA 3D0TA 5JDLA 1JNZA 8ICEA 4M1PA 2RP4A 3B13A 3HR0A 3RX6A 2Y48B 4CI2B 4AKGA 4UD5A 3V72A 4U74A 3QOFA 1SE7A 2KT9A 2IHOA 4OYJA 3RIUC 4J2CA 4H9NC 2FJBA 4YD2A 2FJDA 1WLXA 4EGWA 3AQLA 4WC1A 4K8VA 3UQ7A 3ERCC 5CFSA 3O1JA 3WAKA 3B0YA 1IZNB 9ICAA 3HI2A 4F6RC 5KMGP 4ZI3D 4HFBA 2A9UA 2KXPB 4YJ3E 3PUXF 5J2TE 8ICZA 3C5FA 3L8RA 4DOBA 2E9XD 3AE6A 1ZQPA 4HE8A 3AECA 3GMIA 2X9XA 3N9NA 4M9LA 3QK6A 3GA8A 5FXZA 1R8AA 1HNZT 4EP7A 1ZQKA 5J2CA 4X4VA 4QZEA 9ICWA 4I2BA 4GYRA 3PNCA 1HR0T 4QKNA 1U5PA 4H63H 4HN9A 3O1IA 4NXNT 2LOPA 3HIYA 4NXZA 2XSAA 5J29A 4DV6T 2ZM0A 1W09A 3ZCJA 4EYUA 2J47A 3UQ2A 2CA5A 3NRXA 4QWNB 1KNYA 4KLHA 4EEBA 2CM0A 4IIJE 2BBHA 9ICGA 4IQUA 3RC3A 5CA7A 3MBYA 3JAEA 1BR4A 1WOTA 2CEAA 7ICVA 4HFIA 4CZZB 4JEHB 2ZMAA 3OYXA 3ANWB 2DNXA 2WS3A 4NKUA 3E22E 3ZEFB 2W4XA 5HRKA 1KNPA 3GN5B 5A1LA 4U2YA 4IQVA 4CN6A 4FHWA 5IYZE 2I59A 3UXOA 2XJ7A 4AISA 4AQFA 5LNKA 3P4QA 4GK0E 4GYSA 3QB5K 4WQLA 3AE4A 5HC9A 4WC0A 2LKHA 4CQIA 5AFUL 4IL4A 4LMJA 4AQGA 4CI3B 1RZTA 5HRGA 3ONXA 3OVBA 2K9AA 3K8PC 2DR5A 4KLTA 4IL9A 1T72A 4U31A 3ZYLA 2M2VA 5J2HA 1IJ6A 4YD1A 1QSDA 2BKNA 4QZFA 2Z6EA 2GAFD 1KDHA 4H9RC 1BPYA 4DR4T 4NXUA 2WMNA 1N32T 4K0UA 4HFEA 4QH4A 4MHCA 1N33T 4G63A 5LXTE 5B3PA 2CXDA 4TWDA 4EZHA 9ICHA 3KINB 4WOYA 2KWHA 4GOUA 1ZQHA 4A97A 4I28A 2PTFA 2CXFA 2E9XA 3UU3A 4QZ9A 5EK2A 5DBAA 3UU6A 9ICCA 4NM2A 2BZBA 3V7KA 3OVSA 3TLWA 1XMOT 3ZC1A 4KLEA 2LHRA 3ZT5A 2LOSA 4RQ0A 3AVSA 4TV8E 4YN4A 4X5VA 4LF8T 5L3BB 4KLFA 1GQEA 4XQ7A 2X68A 4CXWA 3CK6A 4OFZA 4MFCA 5J0PA 5J0RA 2W62A 4QZGA 1L0VA 4LF5T 2QVAA 4DR5T 3FXEB 4DV3T 9ICTA 4X62T 5L4HA 2CRBA 2ZHBA 5AQLB 2M67A 4JI1T 4EBJA 4UBCA 4MFAA 4XQ8A 4IT4A 3C64A 5JQGE 4KHPT 3PTRB 9ICIA 5HWXA 3LG7A 4R63A 2WU2A 4CN4A 4AT7B 4CXYA 4X4SA 3AB3B 4EIWA 4KLJA 2X66A 3AU2A 3I9YA 4GK5E 2ZH2A 1N34T 3HA4A 2LSKA 2VVNA 3CWZB 2YEVC 7ICKA 2JQKA 5IILA 4LZGA 4O67A 5J0XA 2BS2A 2N9DA 5AQNB 2AXDS 3KV6A 2DCFA 1FA0A 3K3QC 1UX4A 5FXWA 4Z8XA 4X66T 1BPZA 2BPGA 3N5LA 1KF6A 4G2AA 4JUYA 1R89A 4EXTA 5L3DB 2NR4A 1VCTA 2GA9D 4DOCA 4E8FA 2EHOC 3MGIA 3E0ZA 2M2TA 1FJGT 1MMGA 3FHNA 1D0XA 1WR6A 3LBXA 5B3QA 2V8SV 1W0AA 3UXPA 1Q79A 2W9MA 5LBQB 4M0AA 4TURA 4CN1A 2JPFA 4X4UA 2N1GA 5HXEA 4DV4T 2FUPA 4DO9A 1BR1A 8ICVA 3A5XA 3ZC0A 4OAGA 4RWNA 4RQ7A 5JDGA 4IQWA 4K97A 1HTJF 5J2BA 2HN1A 2F4VT 4IDPA 4NIQA 2JJ9A 4KM5A 4I2IA 2V7IA 3CMLA 3SS1A 5DB7A 2PBEA 1HUZA 1BR2A 2NW7A 4UB5A 2XSBA 3VR9A 4AI6A 3SWHA 3FXDB 1YD8G 4RWPA 1XDOA 3HKBE 3CVRA 1YKHB 1MQ3A 1ZQVA 2NTXA 2UXDT 4F5NA 4PFPA 4QH1A 5AQQB 2WB5A 1XDPA 1YXRA 3PV0F 4P0AA 1NENA 2E5VA 3CX7B 4QZIA 1ZQXA 9ICXA 2VASA 3P4WA 4JI7T 2UXBT 7ICQA 3ZMSB 2XQAA 3UUBA 4I2AA 4OAIZ 2V6XA 3UFGA 1PX5A 5DQVA 4RQ2A 4LEVA 5H6QB 3P50A 3KBUA 4UXNB 2MPKA 3C2LA 4ZI3C 4MBQA 4DV5T 3EAMA 3M3ZB 5HXRA 4O4JE 4ZEYA 3L3PA 4DOAA 3WI3A 2LEHA 4PJNA 4M9JA 8ICSA 5J2FA 5TAOA 3RIUA 2VL8A 2BVLA 2CLYC 2WP9A 9ICMA 3KFWX 4X65T 2RFFA 4ATBB 4UV9B 2IHR1 2HN2A 4YXDA 2ZH6A 4AKLA 3ETVA 3A7MA 3MGHA 4ASKA 4F5RA 3ONJA 2BPCA 4RPYA 4KLLA 3RLFF 2H89A 3RPUA 4MF2A 2M6BA 4U7IA 3N9QA 4BJNA 2DLRA 4HGAA 4QXBB 3AU6A 3FB2A 4PHAA 2BG9B 8ICRA 4AT8B 1IBLT 2BG9E 5HXHA 4DMWA 5L3GB 3SOLA 3H3AA 4X4NA 3AEBA 4TWHA 5IIJA 4WBNE 4AT7A 3KVAA 4CI1B 3HWTA 3RJEA 3C2MA 5EOZA 1Q78A 1D0ZA 3AXJA 4ZOLE
chains in the Genus database with same CATH topology
2IUBA 3CK6A 2HN1A 3RKGA 4I0UA 4EGWA 3NVOA 2BBJA 4EV6A 4EEBA 2HN2A 3NWIA 4EEDA 5JTGA 2BBHA 3JCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUB A;  3CK6 A;  2HN1 A;  3RKG A;  4I0U A;  4EGW A;  3NVO A;  2BBJ A;  4EV6 A;  4EEB A;  2HN2 A;  3NWI A;  4EED A;  5JTG A;  2BBH A;  3JCF A; 
#chains in the Genus database with same CATH topology
 3X1D A;  4RT2 A;  2AE9 A;  2HPJ A;  2V6Y A;  2ISP A;  2D9D A;  5LGU B;  4ISS A;  9ICL A;  1LRZ A;  4AT9 A;  2JQQ A;  3HL6 A;  2XTL A;  1VRB A;  3UUL A;  2G0U A;  4B6X A;  1BPB A;  3EDV A;  3ZYK A;  4BJM A;  1HG5 A;  3WFS C;  3JC6 D;  4JI6 T;  4WH5 A;  4PJM A;  3AE1 A;  3OUY A;  1ZQN A;  4RQ3 A;  1Y01 A;  5CFT A;  4NUV A;  2IML A;  4UF0 B;  4OAF A;  4X20 E;  5HHI A;  4JI8 T;  1VOM A;  7ICJ A;  2X51 A;  2V26 A;  1W9R A;  2LE8 A;  4GXK A;  3VKH A;  5KX5 E;  3OVA A;  4M04 A;  4O69 A;  1YQ3 A;  4P4M A;  3E08 A;  1HF8 A;  2WSS V;  2J1D G;  2CXL A;  4PPX A;  3ZMU B;  5DB8 A;  4TZ4 C;  3V5S A;  2A72 A;  2N2N A;  9ICJ A;  3A8Y C;  4PJJ A;  2C5J A;  4EAH A;  2W2U A;  3AA7 B;  1MIV A;  4K4H A;  5CGM A;  4L0R A;  4X4R A;  2K24 A;  4OHF A;  3Q5X A;  5C2T A;  1I94 T;  4NLN A;  3RIA A;  4I55 E;  2WZH A;  1WCR A;  2CLY B;  5DQW A;  5CHG A;  3EUH A;  3NZP A;  1KEJ A;  3RJK A;  5ABE A;  4IDZ A;  2EWR A;  4K99 A;  4I2J A;  5LHI B;  5JDH A;  3OKQ A;  3JAF A;  4PK6 A;  1YLQ A;  2ES0 A;  3OPC A;  4IGU A;  3PML A;  3C98 B;  2YDQ A;  2X9Y A;  2IUB A;  2W00 A;  1E2A A;  4Z6E A;  3JAD A;  3H39 A;  2HPL A;  2XM1 A;  5J0W A;  4IQT A;  4FI5 A;  4RWO A;  2C5I T;  4Z6F A;  2ACZ A;  1N36 T;  3PUG A;  5JVD E;  5BMV E;  4M9N A;  1X9B A;  4AIU A;  4F5O A;  4DND A;  5FY7 A;  4IHJ E;  2DVI A;  3K7D A;  5J2D A;  3BK9 A;  4QZH A;  4PJL A;  3T8O A;  2ZLY A;  1JN3 A;  5L3C B;  3NWI A;  5JDF A;  3ZLI A;  4YTN A;  4O2B E;  3WFQ E;  2JRK A;  4UAZ A;  1Z8U A;  3PUW F;  4NXM T;  8ICN A;  2IDO B;  2WCA A;  2YDR A;  4JI4 T;  4TUQ A;  5HXC A;  4YMO A;  3JPP A;  2Q66 A;  1QUU A;  4X1K E;  1ZQZ A;  3M65 A;  4LF7 T;  2K48 A;  4FHV A;  3EF2 A;  4X0B A;  1US7 B;  4NXX A;  1JAJ A;  4DBQ A;  9ICO A;  4EBK A;  5J0O A;  3AAA B;  3TFR A;  3HKE E;  2VVS A;  3EVY A;  3N2K E;  4DUZ T;  4KLO A;  1ZQT A;  2WDR A;  9ICB A;  2VL0 A;  3CX6 B;  5JRC B;  2VKJ A;  2H3R A;  3AEG A;  4ZS3 A;  1NEK A;  4Z91 A;  1S94 A;  3DTO A;  7ICE A;  1XZY A;  2EHO A;  4Z90 A;  3F2E A;  4PHE A;  5LG3 A;  4DUY T;  4KLI A;  1KEY A;  1YKE B;  2VKO A;  3ZN0 B;  3K3O A;  3C51 A;  3VRA A;  2MYS A;  2BVM A;  3T1Y T;  7ICR A;  3RJH A;  4RQ1 A;  5J2J A;  4AQY T;  8ICT A;  2CWY A;  2IC9 A;  3PHZ A;  1UEU A;  4QZB A;  2PXI A;  4Z6C A;  3LK4 2;  5LJN A;  4ILU A;  4YLH A;  4FH3 A;  4UVC B;  4L5G A;  1EZ3 A;  2DRA A;  3FZK B;  4PK5 A;  5AQS B;  2ODV A;  4IRE A;  1DU2 A;  2A2F X;  5IWA T;  5CJ5 A;  3K3N A;  4XJE A;  1B7T A;  3MK7 C;  4JI2 T;  3K1S A;  3CKD A;  1MMD A;  2BKO A;  3C4Z A;  3HJ1 A;  3UPQ A;  2NOX A;  4O4L E;  1OED B;  3RC8 A;  4TUS A;  4PGY A;  2CBI A;  4PAG A;  3UUM A;  1OED E;  5CA1 E;  3PUQ A;  5JDN A;  5HRB A;  4JI0 T;  5JR9 B;  4GIW A;  4UF0 A;  2QYW A;  1M7K A;  5L4E A;  5IIO A;  3PE0 A;  4GKJ T;  2KND A;  2X0L B;  3Q9D A;  5HEG A;  2P66 A;  1ZV4 X;  4PK4 A;  4WC2 A;  2ZM6 T;  2WDV A;  7ICT A;  3ZMT B;  3ONL C;  4ZZC A;  3AE2 A;  2UUC T;  4WCW A;  3N2G E;  2UUB T;  1TVA A;  2B4V A;  3NKU A;  1ZQM A;  4X0A A;  4GXJ A;  4QZD A;  2ZH4 A;  4UVA B;  1BPD A;  4JLX A;  3OVU A;  5CHE A;  3ZYM A;  2QGS A;  5KDM C;  1MMA A;  4KBM B;  3ABV A;  2WAU A;  2DRB A;  3SFD A;  1WFD A;  4Q25 A;  2H7V C;  4GKK T;  4LFB T;  9ICP A;  3Q5D A;  4H9Q C;  4R65 A;  3TLT A;  2C5K T;  1U4Q A;  2XAG B;  3FZL B;  3ER8 C;  1JNR A;  3C50 A;  4QZ8 A;  5CB4 E;  2XQ9 A;  3ZT6 A;  5L47 A;  5AQU B;  5DBC A;  4I2D A;  5J1G A;  2O5A A;  3G06 A;  1OWA A;  3P4R A;  4C90 A;  4UVB B;  3F31 A;  1FMV A;  2B51 A;  4WBZ A;  1ZQJ A;  3ZMZ B;  1XSL A;  5ABF B;  5GON E;  4UV8 B;  3JC6 C;  4O9M A;  3JPN A;  4YSY A;  2CMR A;  2V7L A;  4HWH A;  2ZH9 A;  1WYB A;  4NM1 A;  3MA9 A;  3VKG A;  4LZD A;  2YK0 A;  1UX5 A;  3RYC E;  5CFU A;  4UB1 A;  2VB6 A;  2LKG A;  2FMS A;  4TX5 A;  9ICE A;  2CHN A;  3JZ0 A;  4YJ2 E;  2R6G F;  4JEU B;  2CHO A;  1ZJM A;  3HX0 A;  4FH5 A;  2LSI A;  4ILC A;  2QRX A;  4IG8 A;  2FJE A;  3C18 A;  5J0Z A;  4JLZ A;  2DI4 A;  4LMK A;  3RJF A;  2VAN A;  3LFM A;  2VK9 A;  5JRC A;  3MXZ A;  4I2G A;  3RHW A;  2PFN A;  3N9L A;  3OV7 A;  3NKZ A;  5LP6 E;  1T7S A;  4PGQ A;  2WZI A;  2Q9Q B;  2BG9 C;  1HNX T;  4X1I E;  5C8Y E;  5HEJ A;  3H37 A;  4RQ6 A;  4P0B A;  5AQO B;  3Q5E A;  2BS4 A;  3PJA J;  5DB6 A;  2SPC A;  1IAP A;  5J0T A;  4YSX A;  2PFO A;  4A98 A;  9ICV A;  8ICC A;  4DR7 T;  4K9A A;  5EK3 A;  4NY8 A;  1ZOY A;  2X0Y A;  3EI0 A;  5J2E A;  2FMQ A;  3ANW A;  4HEA A;  2NW8 A;  1TV9 A;  4QXC B;  7ICN A;  3ZJ1 A;  3GN5 A;  4ZI2 D;  2P9B A;  1FEW A;  3KDS E;  2LSG A;  4LF4 T;  4HKA A;  5AQM B;  3SRZ A;  4A5X A;  1MIW A;  2ZH1 A;  2NP9 A;  2WDQ A;  4LF9 T;  2ZM2 A;  1YQ4 A;  3KBT A;  3AE3 A;  3S4U A;  5C3J A;  3FZM B;  4YY3 T;  3LJC A;  2VWA A;  3PUV F;  3PJA A;  5CR0 A;  1F5A A;  9ICF A;  1XWM A;  1XMQ T;  3PUR A;  4KMC A;  2LLY A;  1RPL A;  4ZI7 E;  5CFB A;  5HRI A;  4YTP A;  4MF8 A;  4QX7 B;  1LKX A;  3V5U A;  5IIK A;  5JH7 E;  1WR0 A;  2JQH A;  3ZKR A;  5JRE A;  4JI5 T;  3FZH B;  2BBJ A;  1VFG A;  1D1A A;  3CX8 B;  5AQV B;  2LM2 A;  4PHD A;  7ICS A;  2HHP A;  4E80 A;  4UIG A;  3JPR A;  5J2I A;  2V7K A;  4HWC A;  5FVK A;  4TUP A;  4DV7 T;  4P1N A;  4AKI A;  5HYA A;  5H6R B;  3RYF E;  5F2V O;  2XQ6 A;  5CWR A;  2XQ4 A;  4H63 V;  1NAF A;  4KLG A;  2Q9Q D;  1OXZ A;  5HWY A;  4XZC A;  9ICQ A;  3AEE A;  2KWI B;  1ZKE A;  4BA9 A;  2V7M A;  3GDX A;  4HFD A;  5HEO A;  4DR1 T;  3LDQ B;  5FXV A;  4U3C A;  2CWO A;  5AQF B;  3PUY F;  3AAI A;  2XUE A;  1ZQL A;  4H9P C;  3L9D A;  5D61 A;  1UET A;  5LMN T;  2H7O A;  3U3I A;  1JMS A;  3LK2 B;  4WBO A;  2BPF A;  2M6I A;  5AQR B;  4O5C A;  4X64 T;  8ICI A;  3ZSS A;  5DB9 A;  2KSR A;  1MNE A;  2PBI A;  2VQE T;  7ICG A;  4M47 A;  2PFQ A;  2BDE A;  3ZST A;  1ZHC A;  1ZQW A;  4RQ4 A;  3AEF A;  3V7J A;  5FY0 A;  3RYI E;  4KI0 F;  4U33 A;  2YU1 A;  1UUR A;  4NXV A;  2OLT A;  4MKP A;  3JPS A;  5AQI B;  3N9O A;  4COF A;  4IE7 A;  5AQK B;  4R66 A;  4L9I A;  3PDY A;  3UPS A;  3HKD E;  5FKY A;  4M5D A;  4JWN A;  4PH5 A;  4IDN A;  2FMP A;  4JWM A;  4KLQ A;  3UUN A;  1HX8 A;  5FYM A;  5J2G A;  2DWG A;  2B76 A;  2I6H A;  2L3L A;  3EDU A;  2ISO A;  4U2Z A;  3I1A A;  2XZE A;  3P7I A;  4M2Y A;  3RYH E;  4B3S T;  5BOM A;  1O3X A;  5HRL A;  3FBL A;  3TLV A;  4X4O A;  3H38 A;  1X79 A;  7ICO A;  2BCS A;  5DKW A;  3PU8 A;  3CQG B;  4NPP A;  3AE9 A;  5HHH A;  4QH5 A;  1D1C A;  4O8S A;  5III A;  5J0S A;  3PUA A;  5IUX A;  5FL0 A;  4LFA T;  8ICG A;  5KXJ A;  4AKR B;  5HR9 A;  4I2E A;  3J7Y q;  1GPJ A;  3RRC A;  9ICR A;  4X5T A;  4UAW A;  5DEC A;  4O68 A;  2A3D A;  2DR8 A;  1IJ5 A;  5BR8 T;  2X9W A;  1W0B A;  5F8P A;  1ZQB A;  3NYB A;  2D0T A;  1ZQQ A;  3O9X A;  4EB6 E;  4DO0 A;  3I9W A;  1I6Z A;  4QZA A;  2GWS A;  3RJJ A;  3RQW A;  4HX0 A;  3N9P A;  4B3M T;  4WQK A;  5IHY A;  2XQ5 A;  1E7P A;  2C0S A;  4WC6 A;  3UU5 A;  3NRY A;  2PFV A;  2ZH7 A;  2E9X B;  5CP2 A;  1M62 A;  4UEL A;  5J0U A;  1ZEE A;  3QB5 A;  3OBV E;  5TZV A;  4KHZ F;  3JPT A;  3VHL A;  5L3F B;  3ISC A;  1OED C;  8ICO A;  2JIW A;  1T8B A;  5BPC A;  2K3W A;  4O2A E;  4MAL A;  4YCX A;  4O4I E;  1ZQI A;  2XQ8 A;  5JR9 C;  4X4Q A;  3SFE A;  9ICK A;  3ISB A;  3PU3 A;  3OTO T;  3ZPO A;  2DR9 A;  1ZQE A;  2UU9 T;  2IW5 B;  2K5B B;  3HW8 A;  4FHX A;  8ICQ A;  4WC7 A;  4DV0 T;  4EYY R;  1J1J A;  2KIN B;  4RT3 A;  3ZT7 A;  2D2S A;  5HCJ A;  2NRK A;  7ICP A;  3H3M A;  2E2A A;  1NO5 A;  2X0H A;  8ICY A;  3BQK A;  4E7S A;  5F3J A;  3NZQ A;  5ABG A;  7ICL A;  4UB4 A;  4FHP A;  4KB6 A;  2DHR A;  4OK0 A;  1JQR A;  3LQC B;  3FZF B;  7ICF A;  5E0O A;  9ICS A;  3OWG A;  5FL1 A;  5JTG A;  1BPX A;  3DP7 A;  4HTE A;  4DV1 T;  3P4P A;  4ATB A;  3B0X A;  4TNV A;  5ADX L;  3AEA A;  2H88 A;  5DBB A;  5HRD A;  8ICP A;  2GK9 A;  4B3R T;  2XY8 B;  2ZH3 A;  1Z0P A;  4M9G A;  4Z6D A;  4LML A;  5DED A;  4FHY A;  5CA0 E;  1HUO A;  5AQG B;  5LBM A;  2NW9 A;  4IE4 A;  3PMN A;  2LHN A;  1H7C A;  2FBW A;  1KNZ A;  4LEY A;  2BG9 A;  4ZI2 C;  2V5C A;  4AT8 A;  5FP3 A;  3F57 A;  3LBX B;  5L2L A;  4O5E A;  5DDM A;  4AKH A;  1HX1 B;  2XAQ B;  4DR2 T;  3VR8 A;  2JMH A;  3RRW A;  4LF6 T;  4JV5 T;  5ETW A;  4K0K T;  4A56 A;  1D1B A;  4I2H A;  3CIR A;  4KP3 C;  4UEM A;  5HRF A;  1UCU A;  4HWD A;  4KLU A;  3OGU A;  1ZJN A;  1MMN A;  5LGT B;  2WQY A;  5DDY A;  1T98 A;  4UB2 A;  3C5G A;  4IDO A;  5DJQ C;  4PHP A;  2ZH5 A;  1G8X A;  4IST A;  2FCL A;  3N9M A;  3MCR A;  1UK5 A;  2WWU A;  1FMW A;  1WRD A;  3Q5W A;  5EK4 A;  3CPZ A;  2YDS A;  2IAK A;  3BQL A;  4YMN A;  3W15 B;  4HFC A;  4DMV A;  3ER9 B;  3MDA A;  2J62 A;  4X4T A;  4K96 A;  4UR9 A;  3RF1 A;  2BCU A;  2M2W A;  3AVR A;  4KLS A;  5J2K A;  4NKT A;  2Q9Q C;  5J0Q A;  3LK3 B;  4LT6 A;  4EZ4 A;  2M2U A;  2RA1 A;  3TKL B;  5FMN A;  3RH4 A;  3UXN A;  3EHZ A;  3UUX B;  1LVK A;  3Q2M A;  4X4P A;  1XSN A;  3O4X E;  4K9B A;  3T1H T;  1KK7 A;  2MAW A;  3NBX X;  1NWM X;  5LJM A;  3GWH A;  4YT0 A;  2WU5 A;  2XAH B;  4LEZ A;  5D62 A;  2YIN A;  4LEW A;  5LOV E;  3CQX C;  4K98 A;  3JYY A;  8ICW A;  3B57 A;  1UUS A;  1S35 A;  1ZQR A;  2KLQ A;  2PFP A;  4P4P A;  4RQ5 A;  2E8I A;  4R64 A;  3UU8 A;  1R8I A;  5IIN A;  2NTY A;  3ESL A;  4DV2 T;  2I0M A;  1HCI A;  3EAB A;  4F5Q A;  4XBF B;  7ICU A;  1HS7 A;  2OA5 A;  3AA1 B;  4QZC A;  4UAY A;  4K4I A;  3AE5 A;  4QX8 B;  4IDQ A;  4X1Y E;  3PUS A;  4O6A A;  3AA6 B;  3AQN A;  1VCS A;  3LSV A;  1G73 A;  2VKD A;  5LMU T;  2ZM8 A;  2VQF T;  4EED A;  1UGO A;  3KV9 A;  5FY1 A;  4N78 D;  4E7X A;  1Y64 B;  9ICN A;  5AQP B;  2UXC T;  2WWV A;  1ZQU A;  2D5U A;  5FXX A;  4HWF A;  3AXJ B;  1IBM T;  4HFV A;  4E7Z A;  4KLD A;  1OU5 A;  4NUU A;  4UBB A;  2V6Y B;  1AJ3 A;  3UQ0 A;  2PJQ A;  4XA5 A;  3AAE B;  8ICM A;  3N2O A;  4ZXL A;  3FBZ A;  4AT9 B;  1MIY A;  4DID B;  3ZMV B;  1XNR T;  3RH6 A;  3QUJ A;  2LT3 A;  4NLK A;  3C4W A;  2ODU A;  5CJ7 A;  5D49 A;  2LSY A;  8ICX A;  4JI3 T;  2FJA A;  4NXT A;  2B56 A;  2IC6 A;  1V9D A;  1ZQD A;  3CQC B;  2CE7 A;  3OUY B;  4I50 E;  2HHH T;  2UUA T;  4WYV A;  2I9G A;  2RPA A;  4NXW A;  4JBW F;  2CCQ A;  4TWF A;  3ZN1 B;  4OYK A;  4I43 B;  3C4X A;  2KMF A;  1ZP0 A;  1V4A A;  3ZJ2 A;  5J0Y A;  2LJL A;  2XQY A;  4QHO A;  2UXX B;  4XAX B;  3PUZ F;  3WAJ A;  1BR0 A;  5D4B A;  3UQ4 A;  5JDQ A;  3K75 D;  3MAC A;  5HAX A;  4YHH T;  2BCQ A;  3HKC E;  1BPE A;  1CHU A;  2YN6 A;  1TFW A;  5HRH A;  4PGX A;  5D46 A;  4BAY B;  4LVS A;  3V7L A;  3AED A;  5FNV E;  4KX6 A;  4I0U A;  2IHM A;  2B1E A;  2PG8 A;  4RPX A;  3C2K A;  3KVB A;  3P4S A;  4UD4 A;  2UXN B;  5LHH B;  2MBG A;  1OED A;  2MOZ A;  4EOZ B;  4AQF C;  1ZQO A;  4PNI A;  1R8B A;  5IIM A;  3UU4 A;  3IEE A;  5EZY E;  3AA0 B;  3JCF A;  4PFO A;  2JMK A;  4UB3 A;  1SUM B;  4DBR A;  2L8K A;  2J4G A;  4DVD A;  2W66 A;  5JR9 A;  1HFA A;  1SHZ C;  3OJA A;  2W61 A;  1R8C A;  5L3E B;  2DR7 A;  2V5D A;  5JDM A;  4F8H A;  3AE8 A;  3P8C D;  1XNQ T;  8ICA A;  2XAJ B;  3KV5 A;  3I0Q A;  2D0U A;  3C66 A;  2XQ3 A;  5LHG B;  8ICK A;  2ID1 A;  5DAB A;  4I27 A;  3RKG A;  4GXI A;  4LFC T;  3TFS A;  3U78 A;  3JPO A;  2HH7 A;  3RJG A;  2BCV A;  8ICF A;  2BS3 A;  4P4O A;  1UEV A;  3VU7 H;  2MTQ A;  5F5W A;  1ZQA A;  4ADZ A;  2XAF B;  3L09 A;  4S3N A;  2Y8D A;  2ZHA A;  2WM9 A;  1D0Y A;  4N7R A;  4FO1 A;  4HWI B;  7ICM A;  2IIU A;  2E9X C;  5D63 A;  3RGL A;  3UFE A;  1J5E T;  3RI5 A;  4ZZB A;  2X9H A;  3WFR E;  2O1P A;  5HEU A;  2WBL A;  4H9O C;  4WZX A;  2BKP A;  5LB7 B;  2XHE B;  4ILA A;  4WC4 A;  1ZQG A;  2BE3 A;  4YSZ A;  3BQI A;  7ICH A;  2YU2 A;  5ABH A;  1HG2 A;  4TNW A;  3VRB A;  1ZQC A;  3MZK B;  4P09 A;  2EHO B;  3RJI A;  3J9X 1;  4O5K A;  4OX9 T;  5AQJ B;  3QC9 A;  5FVL A;  4MFF A;  5ABF A;  5LG4 A;  3OYZ A;  3MKD A;  2QA7 A;  8ICU A;  4KLM A;  1E1H B;  4KUM B;  4IE0 A;  5LYJ E;  1KNR A;  4JYA T;  1LVF A;  2VKH A;  5HXS A;  2XAS B;  3KV4 A;  3MDC A;  5BOL A;  1XSP A;  4P2H A;  2WY2 A;  2Y6X A;  8ICH A;  3IBP A;  1YW0 A;  5LCY A;  3UT5 E;  1FIO A;  4WNK A;  4I2C A;  1CUN A;  4RPZ A;  3AUO A;  2CBJ A;  4U72 A;  4B3T T;  3QNU A;  4OAH A;  4WC5 A;  4RQ8 A;  2E5L T;  4NLZ A;  4HFH A;  4EV6 A;  2ACX A;  1TFY A;  3MJX A;  2YKS A;  8ICL A;  4TN7 B;  3AQM A;  5HEH A;  4XRH A;  1ZQS A;  2V1D B;  2VUR A;  4ZS2 A;  3TLS A;  2W67 A;  1ZQF A;  2LM9 A;  4WC3 A;  3LK9 A;  4K4G A;  3B5M A;  4WW0 A;  5LA6 E;  3L39 A;  4DR6 T;  3WFP A;  2Q9Q A;  3IHR A;  1QLB A;  3ETU A;  3IF8 B;  3TLU A;  4I29 A;  5J2A A;  4YTM A;  4JLE A;  3DJB A;  2LRK A;  2BCR A;  4I2F A;  3WFO A;  4ERR A;  4U7Y A;  4IE6 A;  1VJ7 A;  8ICJ A;  5M4Y A;  2LRL A;  4CXX A;  2CPT A;  4AXP A;  3RQU A;  5HCM A;  5CB1 A;  3I0O A;  3RIF A;  8ICB A;  2NWB A;  4V1A v;  4ILB A;  3UTK A;  2EHO D;  2W0G A;  4H9S E;  3ISD A;  2XM2 A;  4RWQ A;  4TUY E;  3ZCI A;  4XUS A;  4F5P A;  3R84 B;  5J2U E;  2ZH8 A;  3RH5 A;  2JQ9 A;  4YHJ A;  2YOE A;  4FJO A;  1ZQY A;  1MQ2 A;  2WMO A;  2V7J A;  1J5W A;  4WBY A;  3AQK A;  4PW8 A;  4DR3 T;  4QXH B;  4IE5 A;  3R6N A;  4C91 A;  4YMM A;  2W63 A;  4TV9 E;  3RH3 A;  2DWK A;  2X67 A;  9ICU A;  2XQ7 A;  3O1H A;  4ZHQ E;  7ICI A;  1SA0 E;  5AQH B;  3AE7 A;  2XPK A;  4ANJ A;  3JPQ A;  2L9Q A;  5HRE A;  2OV9 A;  4FO6 A;  2KZ7 B;  2DL1 A;  4O4H E;  4M9H A;  4MLK A;  1MND A;  3NVO A;  4YFS A;  2LSJ A;  1KFY A;  5LGN B;  4MFR A;  1HNW T;  1IBK T;  5AQT B;  3IA3 A;  1NOM A;  3HJ4 A;  1WYC A;  4I4T E;  3RKO A;  3D0T A;  5JDL A;  1JNZ A;  8ICE A;  4M1P A;  2RP4 A;  3B13 A;  3HR0 A;  3RX6 A;  2Y48 B;  4CI2 B;  4AKG A;  4UD5 A;  3V72 A;  4U74 A;  3QOF A;  1SE7 A;  2KT9 A;  2IHO A;  4OYJ A;  3RIU C;  4J2C A;  4H9N C;  2FJB A;  4YD2 A;  2FJD A;  1WLX A;  4EGW A;  3AQL A;  4WC1 A;  4K8V A;  3UQ7 A;  3ERC C;  5CFS A;  3O1J A;  3WAK A;  3B0Y A;  1IZN B;  9ICA A;  3HI2 A;  4F6R C;  5KMG P;  4ZI3 D;  4HFB A;  2A9U A;  2KXP B;  4YJ3 E;  3PUX F;  5J2T E;  8ICZ A;  3C5F A;  3L8R A;  4DOB A;  2E9X D;  3AE6 A;  1ZQP A;  4HE8 A;  3AEC A;  3GMI A;  2X9X A;  3N9N A;  4M9L A;  3QK6 A;  3GA8 A;  5FXZ A;  1R8A A;  1HNZ T;  4EP7 A;  1ZQK A;  5J2C A;  4X4V A;  4QZE A;  9ICW A;  4I2B A;  4GYR A;  3PNC A;  1HR0 T;  4QKN A;  1U5P A;  4H63 H;  4HN9 A;  3O1I A;  4NXN T;  2LOP A;  3HIY A;  4NXZ A;  2XSA A;  5J29 A;  4DV6 T;  2ZM0 A;  1W09 A;  3ZCJ A;  4EYU A;  2J47 A;  3UQ2 A;  2CA5 A;  3NRX A;  4QWN B;  1KNY A;  4KLH A;  4EEB A;  2CM0 A;  4IIJ E;  2BBH A;  9ICG A;  4IQU A;  3RC3 A;  5CA7 A;  3MBY A;  3JAE A;  1BR4 A;  1WOT A;  2CEA A;  7ICV A;  4HFI A;  4CZZ B;  4JEH B;  2ZMA A;  3OYX A;  3ANW B;  2DNX A;  2WS3 A;  4NKU A;  3E22 E;  3ZEF B;  2W4X A;  5HRK A;  1KNP A;  3GN5 B;  5A1L A;  4U2Y A;  4IQV A;  4CN6 A;  4FHW A;  5IYZ E;  2I59 A;  3UXO A;  2XJ7 A;  4AIS A;  4AQF A;  5LNK A;  3P4Q A;  4GK0 E;  4GYS A;  3QB5 K;  4WQL A;  3AE4 A;  5HC9 A;  4WC0 A;  2LKH A;  4CQI A;  5AFU L;  4IL4 A;  4LMJ A;  4AQG A;  4CI3 B;  1RZT A;  5HRG A;  3ONX A;  3OVB A;  2K9A A;  3K8P C;  2DR5 A;  4KLT A;  4IL9 A;  1T72 A;  4U31 A;  3ZYL A;  2M2V A;  5J2H A;  1IJ6 A;  4YD1 A;  1QSD A;  2BKN A;  4QZF A;  2Z6E A;  2GAF D;  1KDH A;  4H9R C;  1BPY A;  4DR4 T;  4NXU A;  2WMN A;  1N32 T;  4K0U A;  4HFE A;  4QH4 A;  4MHC A;  1N33 T;  4G63 A;  5LXT E;  5B3P A;  2CXD A;  4TWD A;  4EZH A;  9ICH A;  3KIN B;  4WOY A;  2KWH A;  4GOU A;  1ZQH A;  4A97 A;  4I28 A;  2PTF A;  2CXF A;  2E9X A;  3UU3 A;  4QZ9 A;  5EK2 A;  5DBA A;  3UU6 A;  9ICC A;  4NM2 A;  2BZB A;  3V7K A;  3OVS A;  3TLW A;  1XMO T;  3ZC1 A;  4KLE A;  2LHR A;  3ZT5 A;  2LOS A;  4RQ0 A;  3AVS A;  4TV8 E;  4YN4 A;  4X5V A;  4LF8 T;  5L3B B;  4KLF A;  1GQE A;  4XQ7 A;  2X68 A;  4CXW A;  3CK6 A;  4OFZ A;  4MFC A;  5J0P A;  5J0R A;  2W62 A;  4QZG A;  1L0V A;  4LF5 T;  2QVA A;  4DR5 T;  3FXE B;  4DV3 T;  9ICT A;  4X62 T;  5L4H A;  2CRB A;  2ZHB A;  5AQL B;  2M67 A;  4JI1 T;  4EBJ A;  4UBC A;  4MFA A;  4XQ8 A;  4IT4 A;  3C64 A;  5JQG E;  4KHP T;  3PTR B;  9ICI A;  5HWX A;  3LG7 A;  4R63 A;  2WU2 A;  4CN4 A;  4AT7 B;  4CXY A;  4X4S A;  3AB3 B;  4EIW A;  4KLJ A;  2X66 A;  3AU2 A;  3I9Y A;  4GK5 E;  2ZH2 A;  1N34 T;  3HA4 A;  2LSK A;  2VVN A;  3CWZ B;  2YEV C;  7ICK A;  2JQK A;  5IIL A;  4LZG A;  4O67 A;  5J0X A;  2BS2 A;  2N9D A;  5AQN B;  2AXD S;  3KV6 A;  2DCF A;  1FA0 A;  3K3Q C;  1UX4 A;  5FXW A;  4Z8X A;  4X66 T;  1BPZ A;  2BPG A;  3N5L A;  1KF6 A;  4G2A A;  4JUY A;  1R89 A;  4EXT A;  5L3D B;  2NR4 A;  1VCT A;  2GA9 D;  4DOC A;  4E8F A;  2EHO C;  3MGI A;  3E0Z A;  2M2T A;  1FJG T;  1MMG A;  3FHN A;  1D0X A;  1WR6 A;  3LBX A;  5B3Q A;  2V8S V;  1W0A A;  3UXP A;  1Q79 A;  2W9M A;  5LBQ B;  4M0A A;  4TUR A;  4CN1 A;  2JPF A;  4X4U A;  2N1G A;  5HXE A;  4DV4 T;  2FUP A;  4DO9 A;  1BR1 A;  8ICV A;  3A5X A;  3ZC0 A;  4OAG A;  4RWN A;  4RQ7 A;  5JDG A;  4IQW A;  4K97 A;  1HTJ F;  5J2B A;  2HN1 A;  2F4V T;  4IDP A;  4NIQ A;  2JJ9 A;  4KM5 A;  4I2I A;  2V7I A;  3CML A;  3SS1 A;  5DB7 A;  2PBE A;  1HUZ A;  1BR2 A;  2NW7 A;  4UB5 A;  2XSB A;  3VR9 A;  4AI6 A;  3SWH A;  3FXD B;  1YD8 G;  4RWP A;  1XDO A;  3HKB E;  3CVR A;  1YKH B;  1MQ3 A;  1ZQV A;  2NTX A;  2UXD T;  4F5N A;  4PFP A;  4QH1 A;  5AQQ B;  2WB5 A;  1XDP A;  1YXR A;  3PV0 F;  4P0A A;  1NEN A;  2E5V A;  3CX7 B;  4QZI A;  1ZQX A;  9ICX A;  2VAS A;  3P4W A;  4JI7 T;  2UXB T;  7ICQ A;  3ZMS B;  2XQA A;  3UUB A;  4I2A A;  4OAI Z;  2V6X A;  3UFG A;  1PX5 A;  5DQV A;  4RQ2 A;  4LEV A;  5H6Q B;  3P50 A;  3KBU A;  4UXN B;  2MPK A;  3C2L A;  4ZI3 C;  4MBQ A;  4DV5 T;  3EAM A;  3M3Z B;  5HXR A;  4O4J E;  4ZEY A;  3L3P A;  4DOA A;  3WI3 A;  2LEH A;  4PJN A;  4M9J A;  8ICS A;  5J2F A;  5TAO A;  3RIU A;  2VL8 A;  2BVL A;  2CLY C;  2WP9 A;  9ICM A;  3KFW X;  4X65 T;  2RFF A;  4ATB B;  4UV9 B;  2IHR 1;  2HN2 A;  4YXD A;  2ZH6 A;  4AKL A;  3ETV A;  3A7M A;  3MGH A;  4ASK A;  4F5R A;  3ONJ A;  2BPC A;  4RPY A;  4KLL A;  3RLF F;  2H89 A;  3RPU A;  4MF2 A;  2M6B A;  4U7I A;  3N9Q A;  4BJN A;  2DLR A;  4HGA A;  4QXB B;  3AU6 A;  3FB2 A;  4PHA A;  2BG9 B;  8ICR A;  4AT8 B;  1IBL T;  2BG9 E;  5HXH A;  4DMW A;  5L3G B;  3SOL A;  3H3A A;  4X4N A;  3AEB A;  4TWH A;  5IIJ A;  4WBN E;  4AT7 A;  3KVA A;  4CI1 B;  3HWT A;  3RJE A;  3C2M A;  5EOZ A;  1Q78 A;  1D0Z A;  3AXJ A;  4ZOL E; 
#chains in the Genus database with same CATH homology
 2IUB A;  3CK6 A;  2HN1 A;  3RKG A;  4I0U A;  4EGW A;  3NVO A;  2BBJ A;  4EV6 A;  4EEB A;  2HN2 A;  3NWI A;  4EED A;  5JTG A;  2BBH A;  3JCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...