4EEDA

Cora coiled-coil mutant under mg2+ presence
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
324
structure length
314
Chain Sequence
DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport
molecule keywords Magnesium transport protein CorA
total genus 98
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eedA01
2HN1A 3JCFA 4EGWA 2BBHA 2IUBA 2BBJA 3NVOA 3NWIA 4EV6A 3RKGA 3CK6A 4EEBA 5JTGA 4EEDA 2HN2A 4I0UA
chains in the Genus database with same CATH superfamily
5H6QB 1ZQAA 2CE7A 2NTXA 1LVKA 2A2FX 1Z8UA 3HKDE 2WDQA 2B4VA 2BCQA 3C18A 4K0UA 4UAWA 3K75D 1ZQHA 5AQVB 1ZQZA 4RQ5A 2CPTA 4YMNA 4HKAA 2BCUA 2VQET 2VKDA 2BBHA 4U2ZA 7ICRA 4LFBT 1UETA 3RQUA 5EK2A 4PGYA 4LEWA 2K48A 3QUJA 4FHPA 4PFPA 5JREA 2K24A 4LEVA 2W67A 3GN5B 3T1YT 5IILA 2MBGA 5BR8T 2NWBA 1B7TA 3EDUA 2C5JA 3UPQA 3ZKRA 2LEHA 3AE8A 2V26A 3RI5A 4B6XA 5HXCA 2M2TA 4NY8A 2A3DA 3LBXA 2WP9A 3N9OA 4IDPA 2J62A 2LM2A 3UFEA 5C8YE 1ZQFA 4IREA 4QXHB 5LHGB 4UF0A 1E7PA 4NXWA 2KNDA 4O2AE 1N36T 4PGQA 2M67A 3OV7A 3P8CD 2XAJB 3ZMZB 3QB5K 4ADZA 2P9BA 4A98A 2E9XC 4HFVA 3V7KA 4TWDA 4DOBA 2AXDS 2N2NA 3U78A 4YHJA 4WC4A 1HF8A 4CZZB 5DBBA 3C2LA 8ICWA 2Q9QC 4F5NA 4EEDA 3HR0A 4OFZA 4Z6FA 9ICOA 2ZHBA 2W2UA 3ZYKA 1G8XA 2V7MA 2X9YA 5HXRA 4RQ7A 9ICIA 5DECA 4QZGA 2KINB 2JMHA 5FP3A 8ICNA 2E8IA 4ZS2A 2ZH8A 5LHHB 3SWHA 3UQ4A 3NZPA 1BR4A 3UXNA 4C91A 4AIUA 4KI0F 4GXIA 4LF4T 1QSDA 4XA5A 1KDHA 9ICGA 4Z90A 1VRBA 4UVAB 3PUAA 4QZEA 2QGSA 2FBWA 2MAWA 3CQCB 2XQ9A 1BR0A 3HX0A 5F2VO 3MKDA 3TLSA 4E80A 8ICEA 1NEKA 3SOLA 4TN7B 2JJ9A 5DQWA 4X4UA 4L0RA 4MKPA 5HEOA 8ICXA 5HXHA 1D0XA 4RT2A 4QWNB 1XSPA 4C90A 5L3DB 3HIYA 3LBXB 2RP4A 2Y8DA 3AVRA 3JAEA 5DBCA 2BG9E 3AEAA 4EEBA 9ICHA 2CLYB 1KEYA 1ZV4X 2CCQA 4XBFB 2OV9A 1NOMA 5B3PA 2V6YA 2UUCT 1ZQEA 2ODUA 3ETUA 1CUNA 3QOFA 2BPCA 4LMKA 4L9IA 4GIWA 3KFWX 3UFGA 3RC8A 3NBXX 3JPNA 1KNRA 1OXZA 3KV9A 3ANWB 2DR9A 3K3OA 3OYXA 3AA6B 4WC7A 3MCRA 2BCVA 3C2MA 2XQ3A 2YK0A 3EABA 4WNKA 2VANA 4WBNE 2PFNA 3QC9A 2DRBA 1KFYA 4YJ3E 3K7DA 2NW7A 4YFSA 5DB9A 2BVLA 2RFFA 4P09A 3KV4A 4N7RA 4AT8B 4XUSA 3TLUA 4RQ6A 2CM0A 5J2UE 1J5ET 4FH3A 2P66A 5HRLA 1KNYA 5CGMA 3HI2A 2GK9A 2V7JA 2DNXA 3N5LA 4X62T 4H9NC 3RIAA 4KLDA 4ISSA 4F5OA 4Z8XA 4Z6CA 4AXPA 1UGOA 4CN1A 3LG7A 4QX7B 4UEMA 3RYCE 1NO5A 1W0AA 7ICGA 2WBLA 3WFSC 2YKSA 4X0AA 8ICTA 7ICKA 4IE4A 1IBKT 4AT9A 3ZT5A 4YTMA 3WFOA 4HFDA 2KZ7B 2XZEA 3CQXC 4O8SA 2V5CA 1JMSA 3JYYA 2ES0A 5HRHA 2ZLYA 3JCFA 1TFWA 1BR2A 2YINA 1SUMB 3O1HA 1DU2A 1SA0E 2C5IT 2MTQA 1N34T 3UXPA 4NKUA 5IIMA 4LF7T 7ICJA 5AQGB 2FMSA 4QZIA 4FO6A 4YSZA 3Q5WA 4X4PA 4FHWA 1MNEA 1OEDC 5CP2A 1LKXA 4Q25A 3EF2A 3N9PA 5D62A 5KXJA 4NIQA 1UURA 5LBQB 3E22E 2WQYA 5HC9A 1VFGA 3UQ2A 2CBJA 1IBLT 4YN4A 1M62A 3RRCA 4U7IA 2LSYA 3A7MA 4MFFA 2DLRA 4O4JE 2MOZA 4PNIA 5JDLA 5HRDA 4JLXA 3UUXB 4U7YA 4KLHA 4YMOA 2W0GA 5J2BA 4WBZA 5IHYA 2XQ7A 1ZQCA 5FL0A 3U3IA 2IHMA 3GDXA 4UB2A 3NRXA 4UIGA 2W61A 2M2VA 4G2AA 1KEJA 4LF6T 3N2KE 9ICRA 2DWGA 4M0AA 3OVSA 2ACXA 3V5UA 1WLXA 4DMWA 4I2AA 4U74A 3R6NA 1MMGA 2I59A 3LK42 4IQVA 3PUGA 9ICXA 1MIVA 2X66A 3AA1B 3HKCE 3RJJA 5BOMA 4X5VA 2JRKA 4AT9B 2EHOD 4H9PC 9ICAA 3RLFF 8ICUA 4O68A 4K8VA 4PHEA 3AE9A 4KB6A 3AXJA 4WQLA 3JPOA 1S35A 4MF8A 4ZZBA 2RPAA 3ETVA 3C50A 3FBLA 3C5GA 4JUYA 2W62A 4O9MA 3AE2A 4KLIA 5HRFA 3OPCA 2LE8A 2W63A 3OGUA 3AVSA 5ABGA 4HFHA 5CB4E 5J0UA 8ICHA 4U72A 4JBWF 4ZI3C 4MFCA 4AQGA 1SE7A 4QX8B 1BPEA 1GQEA 4I2IA 5L3FB 3X1DA 2ZMAA 3KBUA 4RQ1A 4UV9B 3FB2A 2PXIA 4YHHT 9ICPA 2D9DA 4RWOA 3PUYF 3MBYA 4KLOA 2VL0A 5FY1A 1HX8A 1D1AA 2L3LA 4WH5A 1N33T 2FJAA 2BKPA 3PU3A 2KWIB 3BQLA 5IUXA 4PHAA 2XQ4A 4UVCB 4AISA 2KXPB 1ZEEA 4M9HA 4RWNA 4ATBA 4X1IE 1WR0A 4H63V 2UXCT 4OAHA 3ZSTA 4PGXA 5DABA 5HREA 5D49A 1T98A 4JI3T 4TWFA 4IQTA 2V7KA 3G06A 4M04A 3AQMA 3OUYA 3NWIA 2M6IA 3TLTA 1VJ7A 4UD5A 5GONE 4TUSA 5DDYA 5HR9A 4LT6A 3KDSE 4RQ0A 4NXMT 4TWHA 5L3GB 5FKYA 4I4TE 5IIOA 4GXKA 4DR5T 4I2DA 2HPJA 2ZHAA 2LSIA 2V1DB 7ICIA 1R8CA 4TUPA 4WOYA 2VKJA 1PX5A 4B3MT 3FHNA 3P4QA 4B3RT 4KHPT 2VB6A 1O3XA 2W9MA 5D4BA 4TV8E 5LG4A 2ZH3A 4K4IA 4X65T 3ZJ2A 2AE9A 4PFOA 3RJHA 1ZQNA 7ICSA 3PU8A 3ZT7A 2BKNA 4ILUA 3RIUC 2UUAT 3H3AA 4GXJA 4P4PA 4DV2T 9ICEA 3JAFA 1R8IA 1XSLA 3HWTA 5HXEA 2X68A 2XM2A 1D0YA 3R84B 2LSJA 4AQFA 5J0YA 8ICQA 2WB5A 4F8HA 3W15B 2YDQA 3AAEB 1WCRA 4FI5A 1ZJNA 2XSAA 3V72A 2WZHA 3AEGA 5JTGA 5J2DA 3PUVF 4F5PA 5HCMA 2E9XD 1L0VA 2V6YB 3GA8A 4RPYA 2ODVA 4MFAA 2BS3A 4AKGA 3ZYLA 3C4WA 5HEUA 3AEDA 4O4HE 2ZM6T 3NRYA 1HX1B 3EDVA 4HWDA 4YTPA 4E8FA 2K3WA 7ICOA 3P4PA 7ICFA 2V7LA 2BKOA 5F5WA 3RQWA 1VCSA 3TKLB 3MGIA 3UUNA 1QLBA 4ZI2D 9ICMA 4AT7A 4P2HA 5CR0A 3MDCA 4RQ3A 4O4LE 4U2YA 2W4XA 2H7OA 4PAGA 4JI4T 2J1DG 1FA0A 4EGWA 4LF5T 1R8AA 2IC6A 4O69A 5J29A 4JEUB 4NXXA 4UB1A 2CBIA 2VVSA 3N9QA 2Z6EA 4X4SA 5FY0A 4UAYA 3AU6A 4L5GA 4JI7T 2CA5A 2L8KA 4JV5T 5HHHA 3JC6C 3CQGB 5J2EA 2X0HA 5HHIA 4R63A 2FJEA 3PUWF 4ILAA 2KWHA 1NWMX 8ICFA 4WQKA 5D46A 3PUQA 3GWHA 3DP7A 5F3JA 4IT4A 5DB8A 3QK6A 4KLLA 3SS1A 2CRBA 4NLNA 3F57A 1E2AA 4MBQA 4YMMA 1MIYA 2JPFA 4DBRA 2XQAA 5LXTE 4DUZT 2I0MA 2WY2A 5CFBA 3AE3A 4M9GA 5FVLA 4IE7A 3B5MA 4GYRA 3L8RA 2HN1A 4UAZA 4PK6A 2PFPA 5AQSB 4UF0B 1ZQYA 2ZM2A 3N9MA 3RYIE 4YSXA 4EZHA 2XAGB 1KK7A 2GAFD 1U5PA 5LP6E 4NKTA 4I2FA 4H9QC 2VVNA 3ZMUB 2NW8A 4HX0A 4YCXA 2YEVC 2IUBA 2OA5A 4EAHA 3C98B 4U31A 1XSNA 3CX8B 1JN3A 1MQ3A 5DBAA 4QZDA 3OKQA 2MPKA 2KLQA 5J0WA 4RWQA 4LZGA 3VR9A 4YLHA 1ZQLA 1MNDA 3J9X1 4U3CA 4EYYR 4MF2A 5CB1A 2Q9QA 4X5TA 4X0BA 3IEEA 3FXEB 4PHDA 4KX6A 1T8BA 4TNWA 4IDZA 4Z6DA 3B0YA 1YQ4A 3AEEA 9ICNA 4LFAT 1HR0T 2XASB 2W66A 4DR7T 2N1GA 4HWCA 3JADA 5J0OA 5FMNA 9ICWA 3FXDB 4CQIA 4P4MA 2BPGA 3N9LA 3PMLA 4IDNA 4V1Av 2C5KT 2IW5B 2YDSA 8ICVA 2QA7A 8ICSA 4RPXA 3F31A 3UXOA 2DR8A 1W09A 3PV0F 4LMJA 2JIWA 8ICCA 3EI0A 4P4OA 5ABHA 5BOLA 2WZIA 8ICGA 4JI0T 2XSBA 2UXXB 4YXDA 1N32T 3S4UA 3Q5XA 1RZTA 4DR3T 4K96A 5JDHA 1UX4A 1LVFA 3BQKA 2CXFA 3ZYMA 1JQRA 2M6BA 3ISDA 1GPJA 4XJEA 4IE5A 1T72A 4JI1T 5CJ7A 3KINB 3H38A 3ERCC 8ICJA 9ICJA 2LRKA 5LB7B 4HFCA 5HEHA 2FJDA 4DO9A 2GWSA 4R66A 4NUVA 5HEJA 5FNVE 2ZH1A 3CX7B 4IIJE 4TNVA 5HYAA 3O1IA 2LOPA 2WCAA 2VL8A 3LFMA 4WC1A 1Y01A 2RA1A 2JMKA 4WC6A 5J2IA 7ICEA 2X9WA 4KP3C 1YXRA 4EZ4A 4CI2B 3EVYA 3KV6A 3PE0A 5ETWA 4HGAA 3AA0B 3JPPA 5J1GA 1WOTA 5AQKB 3VKGA 4K98A 4DIDB 4M1PA 1BR1A 3RYHE 5LYJE 3B13A 4H9OC 1HS7A 4X4QA 3NYBA 2EWRA 3WFQE 1W0BA 4KHZF 9ICKA 5LGTB 1ZP0A 4LZDA 1WYCA 5AQJB 2V5DA 3P7IA 2YU1A 1ZQVA 4YD2A 1BPBA 4UBBA 2CLYC 5L4HA 2Y6XA 5CA7A 3Q2MA 3AA7B 2ZM8A 2B51A 2PFOA 2X9XA 3L09A 5J0SA 7ICQA 4FHVA 3OTOT 2GA9D 3PDYA 4IHJE 4ILCA 5J0PA 1JNRA 3KV5A 4HWHA 5LNKA 1J1JA 4KLQA 5LBMA 4X1YE 2MYSA 4OYKA 5LOVE 3FZFB 5AQTB 4GYSA 3C66A 5DKWA 4PW8A 2NRKA 4LFCT 2CXLA 3ZMSB 4CI3B 4QZ8A 3PUZF 5LMNT 5JRCB 5FXWA 3H37A 4EBKA 4PK4A 4ZXLA 3SRZA 2EHOC 4MALA 4DO0A 2NOXA 4UBCA 4H9SE 1YD8G 4JI8T 2UUBT 1ZQOA 9ICTA 3RPUA 5J2HA 5HXSA 4CN4A 7ICTA 3PHZA 4I29A 4TUQA 3L3PA 3RH5A 8ICIA 2J47A 3IF8B 1RPLA 3KVAA 3ZCIA 4DV4T 3O9XA 4I55E 3K8PC 8ICKA 1ZQXA 1HG5A 4X1KE 2DR5A 1BPZA 2H3RA 3ZN1B 3OVUA 4X4NA 5EK3A 5CFUA 1WRDA 2XQYA 4UR9A 4CXYA 1IZNB 5AQNB 4TX5A 3O4XE 3I9YA 3PMNA 3SFDA 2XHEB 3LK9A 4NXVA 2XQ6A 2XTLA 5AQMB 5J0XA 4WC2A 4I0UA 2QVAA 2IHOA 4AI6A 3MK7C 3MDAA 2X9HA 3IA3A 4QKNA 1ZQIA 4HWFA 9ICQA 2V6XA 1D1BA 3UPSA 3RX6A 4HE8A 8ICAA 4YY3T 5LHIB 2DVIA 1HG2A 3AE5A 2HPLA 2VK9A 4GK0E 4XAXB 4Z91A 4BJNA 3RJEA 2E9XA 1MQ2A 2CWOA 2JQQA 4ZS3A 5IINA 4JEHB 2HHPA 2B1EA 2CEAA 4ILBA 3QB5A 3MXZA 4PHPA 1ZQRA 4AKHA 4B3ST 4NM1A 4WW0A 3A8YC 3PTRB 3EUHA 3OJAA 3N9NA 3DJBA 2EHOB 4HFIA 4DOAA 5HCJA 2V7IA 2XAQB 5AQQB 4OHFA 2W00A 4ZI2C 4M9NA 3Q9DA 1HTJF 2BG9B 4J2CA 4ZEYA 2XJ7A 4UV8B 2BG9A 2IIUA 4DV7T 1XMOT 1CHUA 4TZ4C 3H39A 5J2CA 1ZQWA 4I2BA 4M47A 4KLMA 3OYZA 1BPDA 2LHRA 3IHRA 4OYJA 5HRGA 3AQKA 4HTEA 1AJ3A 3FZKB 4RT3A 5DJQC 5HWYA 4LEYA 2YU2A 3MA9A 2XPKA 3UU6A 4DVDA 5JDNA 2PG8A 2WU5A 3AU2A 4P0AA 3HW8A 4NLKA 4PH5A 2VASA 2UXNB 2PTFA 4XZCA 4GK5E 2BDEA 4WCWA 5HWXA 4A56A 2PBIA 3E08A 2PBEA 5AQLB 4KLSA 2FCLA 2KT9A 4RQ4A 2Q9QB 5M4YA 1HNWT 2HH7A 3ISCA 4DOCA 3RJKA 3RYFE 4IL9A 4UXNB 1XWMA 2LLYA 2VKOA 1Q78A 3TFRA 3T8OA 4M2YA 5JDQA 4WC0A 1ZQBA 1VCTA 3ER8C 3ONJA 4I50E 4LF9T 3L39A 1VOMA 5B3QA 1ZOYA 3LK3B 5FXZA 3FBZA 7ICUA 3ONLC 3NVOA 4RWPA 2VKHA 3BQIA 4YSYA 5LCYA 3ZLIA 1HUOA 2NP9A 5AQFB 4PJJA 4ZOLE 3RH3A 4DR1T 4OX9T 4UVBB 2QRXA 1ZQTA 5BPCA 4IQUA 4YJ2E 5LJMA 3WAJA 1ZQQA 3P4WA 4QZBA 4WYVA 3CIRA 3RC3A 1I6ZA 4UD4A 5AFUL 4EBJA 3FZLB 5L3CB 3ZEFB 5HRIA 3PNCA 2PFQA 3PJAA 2ISPA 2HN2A 4X4RA 5JRCA 5JQGE 2O5AA 2NW9A 4PJMA 5KX5E 5FY7A 4QZ9A 2LT3A 2OLTA 4IE6A 7ICNA 4UB3A 1YQ3A 4AKIA 4DBQA 5LJNA 4RQ8A 3K3QC 3KVBA 4JLEA 5C3JA 9ICCA 2VQFT 3LK2B 5EZYE 5CHGA 4HEAA 5FXXA 2BS4A 2XUEA 4HFEA 3AUOA 3FZMB 1EZ3A 1Y64B 1D1CA 2LSGA 3QNUA 3RIUA 3CK6A 4NXTA 2O1PA 1HNXT 3AAIA 3D0TA 3LSVA 3H3MA 1F5AA 2CMRA 5AQUB 3CVRA 3V7LA 2LHNA 4TUYE 3CWZB 4O67A 3I9WA 4KLEA 4MLKA 4I28A 2E2AA 2Q66A 3FZHB 1XDOA 1NAFA 4I2CA 2WM9A 4ZI7E 2ZH6A 3AE6A 4TURA 1WFDA 2BCRA 3EAMA 1FMWA 4EYUA 3GN5A 5CFTA 2ZM0A 5ABFB 4I2JA 2ZH2A 2YDRA 1M7KA 2NR4A 7ICPA 2X67A 4FO1A 3AQLA 4CXWA 3RGLA 5JDMA 1YW0A 1MMAA 2LRLA 4PJLA 3WFPA 1ZQGA 3HL6A 4DV5T 4QXBB 5CA0E 4I43B 5DEDA 2QYWA 4DV3T 2ID1A 2LJLA 4U33A 5CA1E 3I0QA 3CKDA 3PURA 4JI2T 4QZAA 5LGUB 2IAKA 3Q5DA 1HNZT 3KBTA 1FJGT 4ISTA 2BZBA 4LVSA 4R64A 2BG9C 4ZZCA 2WWUA 2C0SA 5EK4A 3UULA 2WU2A 1R8BA 1ZKEA 4KM5A 1NENA 1YLQA 4FH5A 3AEBA 5HEGA 5JR9B 2LOSA 4OK0A 3O1JA 4K99A 5ABEA 2K5BB 4ANJA 3PJAJ 5LGNB 2CWYA 2DCFA 3RIFA 1BPXA 1UEUA 1R89A 4QXCB 5DQVA 1ZQUA 2FJBA 1TV9A 4DV0T 3AXJB 3OVAA 4NUUA 2PJQA 1UUSA 4ZI3D 2D0UA 2E5LT 2UXBT 2DI4A 3ZMVB 3JPRA 4LMLA 3DTOA 4RPZA 3Q5EA 3P4SA 3AAAB 1OEDA 4K9AA 5JDFA 5AQHB 8ICZA 3OUYB 4LF8T 4QH1A 1Z0PA 4K9BA 3ONXA 5DDMA 4UB5A 4NM2A 2Q9QD 4O5KA 3ZC0A 3NKZA 5ABFA 2BS2A 4ATBB 5C2TA 1V9DA 4K97A 4P1NA 4F6RC 4MFRA 3VRBA 3WAKA 4I2GA 2ZH7A 5J2FA 4QZHA 4OAFA 4DR6T 2BCSA 3C4ZA 2DHRA 4RQ2A 5AQOB 3UTKA 2ZH9A 4JI6T 2DL1A 4EXTA 1JNZA 5J0TA 3AEFA 4NXUA 3HJ4A 3I1AA 4A5XA 1BPYA 1ZQDA 2LKHA 4KLUA 3JZ0A 1HUZA 3ISBA 4COFA 4I27A 3UUBA 2H89A 3VKHA 9ICSA 3E0ZA 3AE7A 2XY8B 4BJMA 3ZCJA 2G0UA 5ADXL 4F5QA 3WI3A 4O6AA 2DR7A 2UU9T 4X4TA 1OU5A 3C2KA 7ICMA 3RH4A 2IHR1 4PK5A 4KLJA 2BE3A 2FMQA 2JQ9A 3N2OA 5F8PA 2VWAA 1JAJA 1MMNA 5L2LA 4KLFA 3F2EA 5TZVA 4M9LA 4UB4A 4EV6A 5HRKA 5FL1A 4F5RA 4KLGA 3VHLA 1WR6A 4AT7B 1ZQPA 1X79A 2WSSV 1J5WA 4CI1B 4IDOA 3CMLA 2UXDT 3AE1A 2M2UA 1FIOA 4AT8A 5IYZE 2WDRA 5DB6A 4O2BE 4WC3A 4B3TT 4DR4T 4NLZA 1ZQSA 5L47A 2B76A 9ICVA 4I2HA 5AQIB 3TLVA 3N2GE 5LG3A 3UU8A 3NZQA 3HKEE 4HWIB 1UX5A 4X4VA 5A1LA 3HKBE 3AE4A 3ZC1A 2WS3A 4FHXA 2VURA 8ICMA 2X0YA 3LDQB 5L3EB 1G73A 2J4GA 4EOZB 2E9XB 4DUYT 4QH5A 3ZJ1A 4JLZA 1LRZA 1H7CA 2XQ5A 7ICHA 4OAGA 3ER9B 3ZPOA 4DV1T 4X66T 1FEWA 4K0KT 4GKKT 1XNRT 3MZKB 3OVBA 2I9GA 2YN6A 5AQRB 4KLTA 2A72A 4WBYA 1KNPA 2XM1A 1UEVA 2FUPA 5CWRA 2XQ8A 1OEDE 3A5XA 2LM9A 2X51A 2FMPA 4AQYT 4R65A 4PJNA 1X9BA 3C64A 1ZJMA 3V5SA 2LSKA 8ICRA 2DWKA 4JWMA 4H9RC 4M9JA 4BA9A 4QZFA 4LEZA 4X20E 1W9RA 3EHZA 1UCUA 1XDPA 5CHEA 5JR9C 4GKJT 4YD1A 3UU4A 2JQKA 7ICLA 4BAYB 4E7ZA 5LA6E 4HFBA 3V7JA 4WBOA 1SHZC 4AQFC 3VRAA 9ICLA 1U4QA 3B57A 2SPCA 4JYAT 2EHOA 3L9DA 5AQPB 8ICPA 4IDQA 4QH4A 5IWAT 4NXZA 2Y48B 7ICVA 5JVDE 1UK5A 3RKOA 4I2EA 2NTYA 3VR8A 2A9UA 4A97A 1XNQT 1FMVA 2BVMA 3UT5E 2LKGA 4CXXA 3NKUA 4XRHA 3OBVE 1ZQMA 3ANWA 1HFAA 2ISOA 1ZHCA 1Q79A 3C5FA 5FYMA 1XZYA 1E1HB 3I0OA 2H7VC 3RJFA 3UQ7A 5LMUT 4Z6EA 1HCIA 5D61A 3WFRE 4AKRB 3RH6A 3RF1A 3ZN0B 3HA4A 3HJ1A 3CX6B 2WAUA 4CN6A 5IIIA 1YKEB 3RRWA 3AQNA 2WWVA 1MMDA 4MHCA 2YOEA 4E7SA 3LJCA 5FXVA 3MACA 4S3NA 4NPPA 5FVKA 3JPTA 3UUMA 5L4EA 4DR2T 4M5DA 2ACZA 4O5CA 5J2KA 2KSRA 4QZCA 4EIWA 5E0OA 4O5EA 4WZXA 1OEDB 2PFVA 4X64T 4OAIZ 4N78D 5TAOA 3B0XA 3JC6D 3IBPA 2H88A 5HAXA 5BMVE 2CHNA 3TFSA 5IIKA 3OWGA 4FJOA 5J2JA 2L9QA 1IBMT 2I6HA 3JPQA 4K4GA 2F4VT 1QUUA 2KMFA 1KNZA 1US7B 4NXNT 4H63H 3M65A 3BK9A 4ZHQE 2N9DA 5D63A 5J2AA 3M3ZB 2XAFB 4JWNA 4JI5T 2HHHT 1TVAA 1V4AA 4FHYA 4EB6E 3ZMTB 3ZT6A 3JPSA 2ZH4A 2R6GF 3J7Yq 3P4RA 1MIWA 2D5UA 9ICFA 4QHOA 4ERRA 3ABVA 3T1HT 3VU7H 2XAHB 3K1SA 5J0QA 2IDOB 2WMNA 1IJ5A 1ZQJA 4YTNA 3RKGA 2JQHA 1OWAA 4YT0A 2CHOA 3RHWA 3PUSA 1YKHB 2ZH5A 3CPZA 4TV9E 4XQ8A 4WC5A 4AKLA 5EOZA 8ICLA 1KF6A 5CFSA 3PUXF 3UQ0A 4DNDA 1IJ6A 3SFEA 4IL4A 2D2SA 5HRBA 4E7XA 1I94T 5DB7A 5J2TE 4X4OA 3AECA 2BPFA 4DV6T 1D0ZA 2DRAA 2V8SV 4G63A 5J0ZA 4DMVA 3K3NA 3RJIA 4GOUA 3C51A 4P0BA 3TLWA 4EP7A 1ZQKA 4PPXA 4K4HA 4IG8A 2X0LB 9ICBA 1XMQT 1WYBA 4IGUA 3GMIA 5CJ5A 4HN9A 5L3BB 3P50A 3AB3B 2E5VA 5KDMC 8ICOA 4IE0A 4KUMB 4O4IE 1IAPA 2WMOA 3C4XA 4IQWA 4XQ7A 3RJGA 4KMCA 3MJXA 3MGHA 2IMLA 3UU3A 5KMGP 3ESLA 5JH7E 2M2WA 5IIJA 5H6RB 2BBJA 9ICUA 8ICYA 1S94A 8ICBA 2CXDA 3UU5A 4ASKA 5J2GA 5J0RA 5JDGA 4KBMB 3LQCB 2K9AA 4UELA 2B56A 2IC9A 2WDVA 1T7SA 2D0TA 3ZSSA 1TFYA 5JR9A
chains in the Genus database with same CATH topology
2HN1A 3JCFA 4EGWA 2BBHA 2IUBA 2BBJA 3NVOA 3NWIA 4EV6A 3RKGA 3CK6A 4EEBA 5JTGA 4EEDA 2HN2A 4I0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HN1 A;  3JCF A;  4EGW A;  2BBH A;  2IUB A;  2BBJ A;  3NVO A;  3NWI A;  4EV6 A;  3RKG A;  3CK6 A;  4EEB A;  5JTG A;  4EED A;  2HN2 A;  4I0U A; 
#chains in the Genus database with same CATH topology
 5H6Q B;  1ZQA A;  2CE7 A;  2NTX A;  1LVK A;  2A2F X;  1Z8U A;  3HKD E;  2WDQ A;  2B4V A;  2BCQ A;  3C18 A;  4K0U A;  4UAW A;  3K75 D;  1ZQH A;  5AQV B;  1ZQZ A;  4RQ5 A;  2CPT A;  4YMN A;  4HKA A;  2BCU A;  2VQE T;  2VKD A;  2BBH A;  4U2Z A;  7ICR A;  4LFB T;  1UET A;  3RQU A;  5EK2 A;  4PGY A;  4LEW A;  2K48 A;  3QUJ A;  4FHP A;  4PFP A;  5JRE A;  2K24 A;  4LEV A;  2W67 A;  3GN5 B;  3T1Y T;  5IIL A;  2MBG A;  5BR8 T;  2NWB A;  1B7T A;  3EDU A;  2C5J A;  3UPQ A;  3ZKR A;  2LEH A;  3AE8 A;  2V26 A;  3RI5 A;  4B6X A;  5HXC A;  2M2T A;  4NY8 A;  2A3D A;  3LBX A;  2WP9 A;  3N9O A;  4IDP A;  2J62 A;  2LM2 A;  3UFE A;  5C8Y E;  1ZQF A;  4IRE A;  4QXH B;  5LHG B;  4UF0 A;  1E7P A;  4NXW A;  2KND A;  4O2A E;  1N36 T;  4PGQ A;  2M67 A;  3OV7 A;  3P8C D;  2XAJ B;  3ZMZ B;  3QB5 K;  4ADZ A;  2P9B A;  4A98 A;  2E9X C;  4HFV A;  3V7K A;  4TWD A;  4DOB A;  2AXD S;  2N2N A;  3U78 A;  4YHJ A;  4WC4 A;  1HF8 A;  4CZZ B;  5DBB A;  3C2L A;  8ICW A;  2Q9Q C;  4F5N A;  4EED A;  3HR0 A;  4OFZ A;  4Z6F A;  9ICO A;  2ZHB A;  2W2U A;  3ZYK A;  1G8X A;  2V7M A;  2X9Y A;  5HXR A;  4RQ7 A;  9ICI A;  5DEC A;  4QZG A;  2KIN B;  2JMH A;  5FP3 A;  8ICN A;  2E8I A;  4ZS2 A;  2ZH8 A;  5LHH B;  3SWH A;  3UQ4 A;  3NZP A;  1BR4 A;  3UXN A;  4C91 A;  4AIU A;  4KI0 F;  4GXI A;  4LF4 T;  1QSD A;  4XA5 A;  1KDH A;  9ICG A;  4Z90 A;  1VRB A;  4UVA B;  3PUA A;  4QZE A;  2QGS A;  2FBW A;  2MAW A;  3CQC B;  2XQ9 A;  1BR0 A;  3HX0 A;  5F2V O;  3MKD A;  3TLS A;  4E80 A;  8ICE A;  1NEK A;  3SOL A;  4TN7 B;  2JJ9 A;  5DQW A;  4X4U A;  4L0R A;  4MKP A;  5HEO A;  8ICX A;  5HXH A;  1D0X A;  4RT2 A;  4QWN B;  1XSP A;  4C90 A;  5L3D B;  3HIY A;  3LBX B;  2RP4 A;  2Y8D A;  3AVR A;  3JAE A;  5DBC A;  2BG9 E;  3AEA A;  4EEB A;  9ICH A;  2CLY B;  1KEY A;  1ZV4 X;  2CCQ A;  4XBF B;  2OV9 A;  1NOM A;  5B3P A;  2V6Y A;  2UUC T;  1ZQE A;  2ODU A;  3ETU A;  1CUN A;  3QOF A;  2BPC A;  4LMK A;  4L9I A;  4GIW A;  3KFW X;  3UFG A;  3RC8 A;  3NBX X;  3JPN A;  1KNR A;  1OXZ A;  3KV9 A;  3ANW B;  2DR9 A;  3K3O A;  3OYX A;  3AA6 B;  4WC7 A;  3MCR A;  2BCV A;  3C2M A;  2XQ3 A;  2YK0 A;  3EAB A;  4WNK A;  2VAN A;  4WBN E;  2PFN A;  3QC9 A;  2DRB A;  1KFY A;  4YJ3 E;  3K7D A;  2NW7 A;  4YFS A;  5DB9 A;  2BVL A;  2RFF A;  4P09 A;  3KV4 A;  4N7R A;  4AT8 B;  4XUS A;  3TLU A;  4RQ6 A;  2CM0 A;  5J2U E;  1J5E T;  4FH3 A;  2P66 A;  5HRL A;  1KNY A;  5CGM A;  3HI2 A;  2GK9 A;  2V7J A;  2DNX A;  3N5L A;  4X62 T;  4H9N C;  3RIA A;  4KLD A;  4ISS A;  4F5O A;  4Z8X A;  4Z6C A;  4AXP A;  1UGO A;  4CN1 A;  3LG7 A;  4QX7 B;  4UEM A;  3RYC E;  1NO5 A;  1W0A A;  7ICG A;  2WBL A;  3WFS C;  2YKS A;  4X0A A;  8ICT A;  7ICK A;  4IE4 A;  1IBK T;  4AT9 A;  3ZT5 A;  4YTM A;  3WFO A;  4HFD A;  2KZ7 B;  2XZE A;  3CQX C;  4O8S A;  2V5C A;  1JMS A;  3JYY A;  2ES0 A;  5HRH A;  2ZLY A;  3JCF A;  1TFW A;  1BR2 A;  2YIN A;  1SUM B;  3O1H A;  1DU2 A;  1SA0 E;  2C5I T;  2MTQ A;  1N34 T;  3UXP A;  4NKU A;  5IIM A;  4LF7 T;  7ICJ A;  5AQG B;  2FMS A;  4QZI A;  4FO6 A;  4YSZ A;  3Q5W A;  4X4P A;  4FHW A;  1MNE A;  1OED C;  5CP2 A;  1LKX A;  4Q25 A;  3EF2 A;  3N9P A;  5D62 A;  5KXJ A;  4NIQ A;  1UUR A;  5LBQ B;  3E22 E;  2WQY A;  5HC9 A;  1VFG A;  3UQ2 A;  2CBJ A;  1IBL T;  4YN4 A;  1M62 A;  3RRC A;  4U7I A;  2LSY A;  3A7M A;  4MFF A;  2DLR A;  4O4J E;  2MOZ A;  4PNI A;  5JDL A;  5HRD A;  4JLX A;  3UUX B;  4U7Y A;  4KLH A;  4YMO A;  2W0G A;  5J2B A;  4WBZ A;  5IHY A;  2XQ7 A;  1ZQC A;  5FL0 A;  3U3I A;  2IHM A;  3GDX A;  4UB2 A;  3NRX A;  4UIG A;  2W61 A;  2M2V A;  4G2A A;  1KEJ A;  4LF6 T;  3N2K E;  9ICR A;  2DWG A;  4M0A A;  3OVS A;  2ACX A;  3V5U A;  1WLX A;  4DMW A;  4I2A A;  4U74 A;  3R6N A;  1MMG A;  2I59 A;  3LK4 2;  4IQV A;  3PUG A;  9ICX A;  1MIV A;  2X66 A;  3AA1 B;  3HKC E;  3RJJ A;  5BOM A;  4X5V A;  2JRK A;  4AT9 B;  2EHO D;  4H9P C;  9ICA A;  3RLF F;  8ICU A;  4O68 A;  4K8V A;  4PHE A;  3AE9 A;  4KB6 A;  3AXJ A;  4WQL A;  3JPO A;  1S35 A;  4MF8 A;  4ZZB A;  2RPA A;  3ETV A;  3C50 A;  3FBL A;  3C5G A;  4JUY A;  2W62 A;  4O9M A;  3AE2 A;  4KLI A;  5HRF A;  3OPC A;  2LE8 A;  2W63 A;  3OGU A;  3AVS A;  5ABG A;  4HFH A;  5CB4 E;  5J0U A;  8ICH A;  4U72 A;  4JBW F;  4ZI3 C;  4MFC A;  4AQG A;  1SE7 A;  4QX8 B;  1BPE A;  1GQE A;  4I2I A;  5L3F B;  3X1D A;  2ZMA A;  3KBU A;  4RQ1 A;  4UV9 B;  3FB2 A;  2PXI A;  4YHH T;  9ICP A;  2D9D A;  4RWO A;  3PUY F;  3MBY A;  4KLO A;  2VL0 A;  5FY1 A;  1HX8 A;  1D1A A;  2L3L A;  4WH5 A;  1N33 T;  2FJA A;  2BKP A;  3PU3 A;  2KWI B;  3BQL A;  5IUX A;  4PHA A;  2XQ4 A;  4UVC B;  4AIS A;  2KXP B;  1ZEE A;  4M9H A;  4RWN A;  4ATB A;  4X1I E;  1WR0 A;  4H63 V;  2UXC T;  4OAH A;  3ZST A;  4PGX A;  5DAB A;  5HRE A;  5D49 A;  1T98 A;  4JI3 T;  4TWF A;  4IQT A;  2V7K A;  3G06 A;  4M04 A;  3AQM A;  3OUY A;  3NWI A;  2M6I A;  3TLT A;  1VJ7 A;  4UD5 A;  5GON E;  4TUS A;  5DDY A;  5HR9 A;  4LT6 A;  3KDS E;  4RQ0 A;  4NXM T;  4TWH A;  5L3G B;  5FKY A;  4I4T E;  5IIO A;  4GXK A;  4DR5 T;  4I2D A;  2HPJ A;  2ZHA A;  2LSI A;  2V1D B;  7ICI A;  1R8C A;  4TUP A;  4WOY A;  2VKJ A;  1PX5 A;  4B3M T;  3FHN A;  3P4Q A;  4B3R T;  4KHP T;  2VB6 A;  1O3X A;  2W9M A;  5D4B A;  4TV8 E;  5LG4 A;  2ZH3 A;  4K4I A;  4X65 T;  3ZJ2 A;  2AE9 A;  4PFO A;  3RJH A;  1ZQN A;  7ICS A;  3PU8 A;  3ZT7 A;  2BKN A;  4ILU A;  3RIU C;  2UUA T;  3H3A A;  4GXJ A;  4P4P A;  4DV2 T;  9ICE A;  3JAF A;  1R8I A;  1XSL A;  3HWT A;  5HXE A;  2X68 A;  2XM2 A;  1D0Y A;  3R84 B;  2LSJ A;  4AQF A;  5J0Y A;  8ICQ A;  2WB5 A;  4F8H A;  3W15 B;  2YDQ A;  3AAE B;  1WCR A;  4FI5 A;  1ZJN A;  2XSA A;  3V72 A;  2WZH A;  3AEG A;  5JTG A;  5J2D A;  3PUV F;  4F5P A;  5HCM A;  2E9X D;  1L0V A;  2V6Y B;  3GA8 A;  4RPY A;  2ODV A;  4MFA A;  2BS3 A;  4AKG A;  3ZYL A;  3C4W A;  5HEU A;  3AED A;  4O4H E;  2ZM6 T;  3NRY A;  1HX1 B;  3EDV A;  4HWD A;  4YTP A;  4E8F A;  2K3W A;  7ICO A;  3P4P A;  7ICF A;  2V7L A;  2BKO A;  5F5W A;  3RQW A;  1VCS A;  3TKL B;  3MGI A;  3UUN A;  1QLB A;  4ZI2 D;  9ICM A;  4AT7 A;  4P2H A;  5CR0 A;  3MDC A;  4RQ3 A;  4O4L E;  4U2Y A;  2W4X A;  2H7O A;  4PAG A;  4JI4 T;  2J1D G;  1FA0 A;  4EGW A;  4LF5 T;  1R8A A;  2IC6 A;  4O69 A;  5J29 A;  4JEU B;  4NXX A;  4UB1 A;  2CBI A;  2VVS A;  3N9Q A;  2Z6E A;  4X4S A;  5FY0 A;  4UAY A;  3AU6 A;  4L5G A;  4JI7 T;  2CA5 A;  2L8K A;  4JV5 T;  5HHH A;  3JC6 C;  3CQG B;  5J2E A;  2X0H A;  5HHI A;  4R63 A;  2FJE A;  3PUW F;  4ILA A;  2KWH A;  1NWM X;  8ICF A;  4WQK A;  5D46 A;  3PUQ A;  3GWH A;  3DP7 A;  5F3J A;  4IT4 A;  5DB8 A;  3QK6 A;  4KLL A;  3SS1 A;  2CRB A;  4NLN A;  3F57 A;  1E2A A;  4MBQ A;  4YMM A;  1MIY A;  2JPF A;  4DBR A;  2XQA A;  5LXT E;  4DUZ T;  2I0M A;  2WY2 A;  5CFB A;  3AE3 A;  4M9G A;  5FVL A;  4IE7 A;  3B5M A;  4GYR A;  3L8R A;  2HN1 A;  4UAZ A;  4PK6 A;  2PFP A;  5AQS B;  4UF0 B;  1ZQY A;  2ZM2 A;  3N9M A;  3RYI E;  4YSX A;  4EZH A;  2XAG B;  1KK7 A;  2GAF D;  1U5P A;  5LP6 E;  4NKT A;  4I2F A;  4H9Q C;  2VVN A;  3ZMU B;  2NW8 A;  4HX0 A;  4YCX A;  2YEV C;  2IUB A;  2OA5 A;  4EAH A;  3C98 B;  4U31 A;  1XSN A;  3CX8 B;  1JN3 A;  1MQ3 A;  5DBA A;  4QZD A;  3OKQ A;  2MPK A;  2KLQ A;  5J0W A;  4RWQ A;  4LZG A;  3VR9 A;  4YLH A;  1ZQL A;  1MND A;  3J9X 1;  4U3C A;  4EYY R;  4MF2 A;  5CB1 A;  2Q9Q A;  4X5T A;  4X0B A;  3IEE A;  3FXE B;  4PHD A;  4KX6 A;  1T8B A;  4TNW A;  4IDZ A;  4Z6D A;  3B0Y A;  1YQ4 A;  3AEE A;  9ICN A;  4LFA T;  1HR0 T;  2XAS B;  2W66 A;  4DR7 T;  2N1G A;  4HWC A;  3JAD A;  5J0O A;  5FMN A;  9ICW A;  3FXD B;  4CQI A;  4P4M A;  2BPG A;  3N9L A;  3PML A;  4IDN A;  4V1A v;  2C5K T;  2IW5 B;  2YDS A;  8ICV A;  2QA7 A;  8ICS A;  4RPX A;  3F31 A;  3UXO A;  2DR8 A;  1W09 A;  3PV0 F;  4LMJ A;  2JIW A;  8ICC A;  3EI0 A;  4P4O A;  5ABH A;  5BOL A;  2WZI A;  8ICG A;  4JI0 T;  2XSB A;  2UXX B;  4YXD A;  1N32 T;  3S4U A;  3Q5X A;  1RZT A;  4DR3 T;  4K96 A;  5JDH A;  1UX4 A;  1LVF A;  3BQK A;  2CXF A;  3ZYM A;  1JQR A;  2M6B A;  3ISD A;  1GPJ A;  4XJE A;  4IE5 A;  1T72 A;  4JI1 T;  5CJ7 A;  3KIN B;  3H38 A;  3ERC C;  8ICJ A;  9ICJ A;  2LRK A;  5LB7 B;  4HFC A;  5HEH A;  2FJD A;  4DO9 A;  2GWS A;  4R66 A;  4NUV A;  5HEJ A;  5FNV E;  2ZH1 A;  3CX7 B;  4IIJ E;  4TNV A;  5HYA A;  3O1I A;  2LOP A;  2WCA A;  2VL8 A;  3LFM A;  4WC1 A;  1Y01 A;  2RA1 A;  2JMK A;  4WC6 A;  5J2I A;  7ICE A;  2X9W A;  4KP3 C;  1YXR A;  4EZ4 A;  4CI2 B;  3EVY A;  3KV6 A;  3PE0 A;  5ETW A;  4HGA A;  3AA0 B;  3JPP A;  5J1G A;  1WOT A;  5AQK B;  3VKG A;  4K98 A;  4DID B;  4M1P A;  1BR1 A;  3RYH E;  5LYJ E;  3B13 A;  4H9O C;  1HS7 A;  4X4Q A;  3NYB A;  2EWR A;  3WFQ E;  1W0B A;  4KHZ F;  9ICK A;  5LGT B;  1ZP0 A;  4LZD A;  1WYC A;  5AQJ B;  2V5D A;  3P7I A;  2YU1 A;  1ZQV A;  4YD2 A;  1BPB A;  4UBB A;  2CLY C;  5L4H A;  2Y6X A;  5CA7 A;  3Q2M A;  3AA7 B;  2ZM8 A;  2B51 A;  2PFO A;  2X9X A;  3L09 A;  5J0S A;  7ICQ A;  4FHV A;  3OTO T;  2GA9 D;  3PDY A;  4IHJ E;  4ILC A;  5J0P A;  1JNR A;  3KV5 A;  4HWH A;  5LNK A;  1J1J A;  4KLQ A;  5LBM A;  4X1Y E;  2MYS A;  4OYK A;  5LOV E;  3FZF B;  5AQT B;  4GYS A;  3C66 A;  5DKW A;  4PW8 A;  2NRK A;  4LFC T;  2CXL A;  3ZMS B;  4CI3 B;  4QZ8 A;  3PUZ F;  5LMN T;  5JRC B;  5FXW A;  3H37 A;  4EBK A;  4PK4 A;  4ZXL A;  3SRZ A;  2EHO C;  4MAL A;  4DO0 A;  2NOX A;  4UBC A;  4H9S E;  1YD8 G;  4JI8 T;  2UUB T;  1ZQO A;  9ICT A;  3RPU A;  5J2H A;  5HXS A;  4CN4 A;  7ICT A;  3PHZ A;  4I29 A;  4TUQ A;  3L3P A;  3RH5 A;  8ICI A;  2J47 A;  3IF8 B;  1RPL A;  3KVA A;  3ZCI A;  4DV4 T;  3O9X A;  4I55 E;  3K8P C;  8ICK A;  1ZQX A;  1HG5 A;  4X1K E;  2DR5 A;  1BPZ A;  2H3R A;  3ZN1 B;  3OVU A;  4X4N A;  5EK3 A;  5CFU A;  1WRD A;  2XQY A;  4UR9 A;  4CXY A;  1IZN B;  5AQN B;  4TX5 A;  3O4X E;  3I9Y A;  3PMN A;  3SFD A;  2XHE B;  3LK9 A;  4NXV A;  2XQ6 A;  2XTL A;  5AQM B;  5J0X A;  4WC2 A;  4I0U A;  2QVA A;  2IHO A;  4AI6 A;  3MK7 C;  3MDA A;  2X9H A;  3IA3 A;  4QKN A;  1ZQI A;  4HWF A;  9ICQ A;  2V6X A;  1D1B A;  3UPS A;  3RX6 A;  4HE8 A;  8ICA A;  4YY3 T;  5LHI B;  2DVI A;  1HG2 A;  3AE5 A;  2HPL A;  2VK9 A;  4GK0 E;  4XAX B;  4Z91 A;  4BJN A;  3RJE A;  2E9X A;  1MQ2 A;  2CWO A;  2JQQ A;  4ZS3 A;  5IIN A;  4JEH B;  2HHP A;  2B1E A;  2CEA A;  4ILB A;  3QB5 A;  3MXZ A;  4PHP A;  1ZQR A;  4AKH A;  4B3S T;  4NM1 A;  4WW0 A;  3A8Y C;  3PTR B;  3EUH A;  3OJA A;  3N9N A;  3DJB A;  2EHO B;  4HFI A;  4DOA A;  5HCJ A;  2V7I A;  2XAQ B;  5AQQ B;  4OHF A;  2W00 A;  4ZI2 C;  4M9N A;  3Q9D A;  1HTJ F;  2BG9 B;  4J2C A;  4ZEY A;  2XJ7 A;  4UV8 B;  2BG9 A;  2IIU A;  4DV7 T;  1XMO T;  1CHU A;  4TZ4 C;  3H39 A;  5J2C A;  1ZQW A;  4I2B A;  4M47 A;  4KLM A;  3OYZ A;  1BPD A;  2LHR A;  3IHR A;  4OYJ A;  5HRG A;  3AQK A;  4HTE A;  1AJ3 A;  3FZK B;  4RT3 A;  5DJQ C;  5HWY A;  4LEY A;  2YU2 A;  3MA9 A;  2XPK A;  3UU6 A;  4DVD A;  5JDN A;  2PG8 A;  2WU5 A;  3AU2 A;  4P0A A;  3HW8 A;  4NLK A;  4PH5 A;  2VAS A;  2UXN B;  2PTF A;  4XZC A;  4GK5 E;  2BDE A;  4WCW A;  5HWX A;  4A56 A;  2PBI A;  3E08 A;  2PBE A;  5AQL B;  4KLS A;  2FCL A;  2KT9 A;  4RQ4 A;  2Q9Q B;  5M4Y A;  1HNW T;  2HH7 A;  3ISC A;  4DOC A;  3RJK A;  3RYF E;  4IL9 A;  4UXN B;  1XWM A;  2LLY A;  2VKO A;  1Q78 A;  3TFR A;  3T8O A;  4M2Y A;  5JDQ A;  4WC0 A;  1ZQB A;  1VCT A;  3ER8 C;  3ONJ A;  4I50 E;  4LF9 T;  3L39 A;  1VOM A;  5B3Q A;  1ZOY A;  3LK3 B;  5FXZ A;  3FBZ A;  7ICU A;  3ONL C;  3NVO A;  4RWP A;  2VKH A;  3BQI A;  4YSY A;  5LCY A;  3ZLI A;  1HUO A;  2NP9 A;  5AQF B;  4PJJ A;  4ZOL E;  3RH3 A;  4DR1 T;  4OX9 T;  4UVB B;  2QRX A;  1ZQT A;  5BPC A;  4IQU A;  4YJ2 E;  5LJM A;  3WAJ A;  1ZQQ A;  3P4W A;  4QZB A;  4WYV A;  3CIR A;  3RC3 A;  1I6Z A;  4UD4 A;  5AFU L;  4EBJ A;  3FZL B;  5L3C B;  3ZEF B;  5HRI A;  3PNC A;  2PFQ A;  3PJA A;  2ISP A;  2HN2 A;  4X4R A;  5JRC A;  5JQG E;  2O5A A;  2NW9 A;  4PJM A;  5KX5 E;  5FY7 A;  4QZ9 A;  2LT3 A;  2OLT A;  4IE6 A;  7ICN A;  4UB3 A;  1YQ3 A;  4AKI A;  4DBQ A;  5LJN A;  4RQ8 A;  3K3Q C;  3KVB A;  4JLE A;  5C3J A;  9ICC A;  2VQF T;  3LK2 B;  5EZY E;  5CHG A;  4HEA A;  5FXX A;  2BS4 A;  2XUE A;  4HFE A;  3AUO A;  3FZM B;  1EZ3 A;  1Y64 B;  1D1C A;  2LSG A;  3QNU A;  3RIU A;  3CK6 A;  4NXT A;  2O1P A;  1HNX T;  3AAI A;  3D0T A;  3LSV A;  3H3M A;  1F5A A;  2CMR A;  5AQU B;  3CVR A;  3V7L A;  2LHN A;  4TUY E;  3CWZ B;  4O67 A;  3I9W A;  4KLE A;  4MLK A;  4I28 A;  2E2A A;  2Q66 A;  3FZH B;  1XDO A;  1NAF A;  4I2C A;  2WM9 A;  4ZI7 E;  2ZH6 A;  3AE6 A;  4TUR A;  1WFD A;  2BCR A;  3EAM A;  1FMW A;  4EYU A;  3GN5 A;  5CFT A;  2ZM0 A;  5ABF B;  4I2J A;  2ZH2 A;  2YDR A;  1M7K A;  2NR4 A;  7ICP A;  2X67 A;  4FO1 A;  3AQL A;  4CXW A;  3RGL A;  5JDM A;  1YW0 A;  1MMA A;  2LRL A;  4PJL A;  3WFP A;  1ZQG A;  3HL6 A;  4DV5 T;  4QXB B;  5CA0 E;  4I43 B;  5DED A;  2QYW A;  4DV3 T;  2ID1 A;  2LJL A;  4U33 A;  5CA1 E;  3I0Q A;  3CKD A;  3PUR A;  4JI2 T;  4QZA A;  5LGU B;  2IAK A;  3Q5D A;  1HNZ T;  3KBT A;  1FJG T;  4IST A;  2BZB A;  4LVS A;  4R64 A;  2BG9 C;  4ZZC A;  2WWU A;  2C0S A;  5EK4 A;  3UUL A;  2WU2 A;  1R8B A;  1ZKE A;  4KM5 A;  1NEN A;  1YLQ A;  4FH5 A;  3AEB A;  5HEG A;  5JR9 B;  2LOS A;  4OK0 A;  3O1J A;  4K99 A;  5ABE A;  2K5B B;  4ANJ A;  3PJA J;  5LGN B;  2CWY A;  2DCF A;  3RIF A;  1BPX A;  1UEU A;  1R89 A;  4QXC B;  5DQV A;  1ZQU A;  2FJB A;  1TV9 A;  4DV0 T;  3AXJ B;  3OVA A;  4NUU A;  2PJQ A;  1UUS A;  4ZI3 D;  2D0U A;  2E5L T;  2UXB T;  2DI4 A;  3ZMV B;  3JPR A;  4LML A;  3DTO A;  4RPZ A;  3Q5E A;  3P4S A;  3AAA B;  1OED A;  4K9A A;  5JDF A;  5AQH B;  8ICZ A;  3OUY B;  4LF8 T;  4QH1 A;  1Z0P A;  4K9B A;  3ONX A;  5DDM A;  4UB5 A;  4NM2 A;  2Q9Q D;  4O5K A;  3ZC0 A;  3NKZ A;  5ABF A;  2BS2 A;  4ATB B;  5C2T A;  1V9D A;  4K97 A;  4P1N A;  4F6R C;  4MFR A;  3VRB A;  3WAK A;  4I2G A;  2ZH7 A;  5J2F A;  4QZH A;  4OAF A;  4DR6 T;  2BCS A;  3C4Z A;  2DHR A;  4RQ2 A;  5AQO B;  3UTK A;  2ZH9 A;  4JI6 T;  2DL1 A;  4EXT A;  1JNZ A;  5J0T A;  3AEF A;  4NXU A;  3HJ4 A;  3I1A A;  4A5X A;  1BPY A;  1ZQD A;  2LKH A;  4KLU A;  3JZ0 A;  1HUZ A;  3ISB A;  4COF A;  4I27 A;  3UUB A;  2H89 A;  3VKH A;  9ICS A;  3E0Z A;  3AE7 A;  2XY8 B;  4BJM A;  3ZCJ A;  2G0U A;  5ADX L;  4F5Q A;  3WI3 A;  4O6A A;  2DR7 A;  2UU9 T;  4X4T A;  1OU5 A;  3C2K A;  7ICM A;  3RH4 A;  2IHR 1;  4PK5 A;  4KLJ A;  2BE3 A;  2FMQ A;  2JQ9 A;  3N2O A;  5F8P A;  2VWA A;  1JAJ A;  1MMN A;  5L2L A;  4KLF A;  3F2E A;  5TZV A;  4M9L A;  4UB4 A;  4EV6 A;  5HRK A;  5FL1 A;  4F5R A;  4KLG A;  3VHL A;  1WR6 A;  4AT7 B;  1ZQP A;  1X79 A;  2WSS V;  1J5W A;  4CI1 B;  4IDO A;  3CML A;  2UXD T;  3AE1 A;  2M2U A;  1FIO A;  4AT8 A;  5IYZ E;  2WDR A;  5DB6 A;  4O2B E;  4WC3 A;  4B3T T;  4DR4 T;  4NLZ A;  1ZQS A;  5L47 A;  2B76 A;  9ICV A;  4I2H A;  5AQI B;  3TLV A;  3N2G E;  5LG3 A;  3UU8 A;  3NZQ A;  3HKE E;  4HWI B;  1UX5 A;  4X4V A;  5A1L A;  3HKB E;  3AE4 A;  3ZC1 A;  2WS3 A;  4FHX A;  2VUR A;  8ICM A;  2X0Y A;  3LDQ B;  5L3E B;  1G73 A;  2J4G A;  4EOZ B;  2E9X B;  4DUY T;  4QH5 A;  3ZJ1 A;  4JLZ A;  1LRZ A;  1H7C A;  2XQ5 A;  7ICH A;  4OAG A;  3ER9 B;  3ZPO A;  4DV1 T;  4X66 T;  1FEW A;  4K0K T;  4GKK T;  1XNR T;  3MZK B;  3OVB A;  2I9G A;  2YN6 A;  5AQR B;  4KLT A;  2A72 A;  4WBY A;  1KNP A;  2XM1 A;  1UEV A;  2FUP A;  5CWR A;  2XQ8 A;  1OED E;  3A5X A;  2LM9 A;  2X51 A;  2FMP A;  4AQY T;  4R65 A;  4PJN A;  1X9B A;  3C64 A;  1ZJM A;  3V5S A;  2LSK A;  8ICR A;  2DWK A;  4JWM A;  4H9R C;  4M9J A;  4BA9 A;  4QZF A;  4LEZ A;  4X20 E;  1W9R A;  3EHZ A;  1UCU A;  1XDP A;  5CHE A;  5JR9 C;  4GKJ T;  4YD1 A;  3UU4 A;  2JQK A;  7ICL A;  4BAY B;  4E7Z A;  5LA6 E;  4HFB A;  3V7J A;  4WBO A;  1SHZ C;  4AQF C;  3VRA A;  9ICL A;  1U4Q A;  3B57 A;  2SPC A;  4JYA T;  2EHO A;  3L9D A;  5AQP B;  8ICP A;  4IDQ A;  4QH4 A;  5IWA T;  4NXZ A;  2Y48 B;  7ICV A;  5JVD E;  1UK5 A;  3RKO A;  4I2E A;  2NTY A;  3VR8 A;  2A9U A;  4A97 A;  1XNQ T;  1FMV A;  2BVM A;  3UT5 E;  2LKG A;  4CXX A;  3NKU A;  4XRH A;  3OBV E;  1ZQM A;  3ANW A;  1HFA A;  2ISO A;  1ZHC A;  1Q79 A;  3C5F A;  5FYM A;  1XZY A;  1E1H B;  3I0O A;  2H7V C;  3RJF A;  3UQ7 A;  5LMU T;  4Z6E A;  1HCI A;  5D61 A;  3WFR E;  4AKR B;  3RH6 A;  3RF1 A;  3ZN0 B;  3HA4 A;  3HJ1 A;  3CX6 B;  2WAU A;  4CN6 A;  5III A;  1YKE B;  3RRW A;  3AQN A;  2WWV A;  1MMD A;  4MHC A;  2YOE A;  4E7S A;  3LJC A;  5FXV A;  3MAC A;  4S3N A;  4NPP A;  5FVK A;  3JPT A;  3UUM A;  5L4E A;  4DR2 T;  4M5D A;  2ACZ A;  4O5C A;  5J2K A;  2KSR A;  4QZC A;  4EIW A;  5E0O A;  4O5E A;  4WZX A;  1OED B;  2PFV A;  4X64 T;  4OAI Z;  4N78 D;  5TAO A;  3B0X A;  3JC6 D;  3IBP A;  2H88 A;  5HAX A;  5BMV E;  2CHN A;  3TFS A;  5IIK A;  3OWG A;  4FJO A;  5J2J A;  2L9Q A;  1IBM T;  2I6H A;  3JPQ A;  4K4G A;  2F4V T;  1QUU A;  2KMF A;  1KNZ A;  1US7 B;  4NXN T;  4H63 H;  3M65 A;  3BK9 A;  4ZHQ E;  2N9D A;  5D63 A;  5J2A A;  3M3Z B;  2XAF B;  4JWN A;  4JI5 T;  2HHH T;  1TVA A;  1V4A A;  4FHY A;  4EB6 E;  3ZMT B;  3ZT6 A;  3JPS A;  2ZH4 A;  2R6G F;  3J7Y q;  3P4R A;  1MIW A;  2D5U A;  9ICF A;  4QHO A;  4ERR A;  3ABV A;  3T1H T;  3VU7 H;  2XAH B;  3K1S A;  5J0Q A;  2IDO B;  2WMN A;  1IJ5 A;  1ZQJ A;  4YTN A;  3RKG A;  2JQH A;  1OWA A;  4YT0 A;  2CHO A;  3RHW A;  3PUS A;  1YKH B;  2ZH5 A;  3CPZ A;  4TV9 E;  4XQ8 A;  4WC5 A;  4AKL A;  5EOZ A;  8ICL A;  1KF6 A;  5CFS A;  3PUX F;  3UQ0 A;  4DND A;  1IJ6 A;  3SFE A;  4IL4 A;  2D2S A;  5HRB A;  4E7X A;  1I94 T;  5DB7 A;  5J2T E;  4X4O A;  3AEC A;  2BPF A;  4DV6 T;  1D0Z A;  2DRA A;  2V8S V;  4G63 A;  5J0Z A;  4DMV A;  3K3N A;  3RJI A;  4GOU A;  3C51 A;  4P0B A;  3TLW A;  4EP7 A;  1ZQK A;  4PPX A;  4K4H A;  4IG8 A;  2X0L B;  9ICB A;  1XMQ T;  1WYB A;  4IGU A;  3GMI A;  5CJ5 A;  4HN9 A;  5L3B B;  3P50 A;  3AB3 B;  2E5V A;  5KDM C;  8ICO A;  4IE0 A;  4KUM B;  4O4I E;  1IAP A;  2WMO A;  3C4X A;  4IQW A;  4XQ7 A;  3RJG A;  4KMC A;  3MJX A;  3MGH A;  2IML A;  3UU3 A;  5KMG P;  3ESL A;  5JH7 E;  2M2W A;  5IIJ A;  5H6R B;  2BBJ A;  9ICU A;  8ICY A;  1S94 A;  8ICB A;  2CXD A;  3UU5 A;  4ASK A;  5J2G A;  5J0R A;  5JDG A;  4KBM B;  3LQC B;  2K9A A;  4UEL A;  2B56 A;  2IC9 A;  2WDV A;  1T7S A;  2D0T A;  3ZSS A;  1TFY A;  5JR9 A; 
#chains in the Genus database with same CATH homology
 2HN1 A;  3JCF A;  4EGW A;  2BBH A;  2IUB A;  2BBJ A;  3NVO A;  3NWI A;  4EV6 A;  3RKG A;  3CK6 A;  4EEB A;  5JTG A;  4EED A;  2HN2 A;  4I0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...