4EEDA

Cora coiled-coil mutant under mg2+ presence
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
324
structure length
314
Chain Sequence
DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transport protein CorA
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport
total genus 98
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eedA01
2BBHA 2IUBA 4EEBA 2BBJA 2HN1A 5JTGA 3CK6A 4EV6A 3NVOA 4EGWA 3RKGA 4EEDA 2HN2A 4I0UA 3JCFA 3NWIA
chains in the Genus database with same CATH superfamily
3AEGA 4WC7A 2D0UA 2Q9QC 4UV8B 2BS4A 1IBMT 4AXPA 4X5VA 4MLKA 4ATBA 5HCMA 5AQUB 1ZQMA 4R65A 5FY7A 1MMNA 3E08A 3NKZA 4CZZB 1OEDB 3RF1A 3RRCA 4CXXA 3I0OA 5HHIA 4JI6T 5LA6E 3N9OA 4I2IA 4JI5T 4ZZBA 4HEAA 1BPYA 2JQ9A 2XZEA 1HCIA 1ZV4X 3VKGA 2PFVA 2W63A 2FJEA 3UU3A 4YTMA 4JI1T 5DBBA 3WFPA 3C5GA 2VWAA 1XSLA 3EABA 4UAYA 4IE4A 9ICMA 4XA5A 2YDRA 4UELA 1VFGA 3HL6A 5FXWA 1N34T 4UBBA 3ISBA 4IHJE 2XQ4A 3C5FA 1WLXA 3RH6A 3JPOA 4O4IE 3JPRA 4OYJA 4RQ5A 4QX8B 3NWIA 1ZEEA 8ICHA 3WFOA 2X67A 3RJFA 4IQTA 3JZ0A 4GK5E 4KLSA 5JR9C 4UVAB 1KEJA 2BDEA 1YW0A 2UUBT 7ICHA 3JPQA 2V5CA 5J0UA 2YINA 3AE7A 1XSNA 2V26A 3K3QC 4DV4T 1JNRA 4XZCA 3AQMA 3KINB 5TAOA 4KLHA 4IDPA 2ODUA 5DB7A 3TLUA 4I2HA 4DOCA 3KBTA 3FZKB 5KXJA 2HPJA 4PH5A 3VR8A 1ZQSA 4X5TA 5HEGA 3PUXF 3PUZF 1UEVA 1T8BA 3OUYA 4I2AA 1ZQGA 2HPLA 4KHPT 3KDSE 1BPEA 3T1HT 1U5PA 5FXZA 1YKEB 3P4QA 4EIWA 4B3TT 3K8PC 3OBVE 1X9BA 2LM2A 3FXDB 4QZEA 1NO5A 2JMHA 2CEAA 8ICEA 3ZYMA 4HFHA 4RQ1A 3RJGA 4JYAT 2XQ7A 4IDQA 4HN9A 5AQGB 2IHOA 3U78A 5AQOB 2OLTA 4P4PA 4X4SA 2KWHA 3CQCB 4L9IA 8ICRA 5CB4E 3HWTA 2A9UA 3AE2A 4X66T 3JYYA 1HTJF 2WY2A 4N78D 2HHHT 2H88A 3J7Yq 3UU4A 4EZ4A 3ETVA 5HWXA 4H9QC 4UEMA 5AQSB 1I94T 1BR0A 4ZS3A 4OAGA 2BZBA 5IIOA 1NAFA 1XDPA 4YHJA 3OKQA 2DL1A 4ERRA 2BCVA 2WBLA 4UB3A 9ICRA 4B3MT 4IE6A 3UUNA 9ICQA 1BR1A 1HX1B 4K97A 2XASB 5H6RB 2EHOD 2NW9A 4IQVA 2PFQA 3KV5A 3PE0A 4F5RA 4UVCB 4WNKA 2W00A 3N9QA 4BAYB 5L3EB 5HAXA 2VKHA 3RQWA 1ZQIA 4QWNB 2V7IA 9ICOA 2K3WA 4HFBA 4NIQA 3PU3A 4TWFA 1UK5A 3K1SA 5LOVE 5EZYE 5JREA 5CR0A 4PGYA 1WCRA 4KLFA 1R8BA 4YFSA 5HEJA 3AA0B 2BG9C 3M3ZB 8ICYA 5HEOA 1MNEA 3L8RA 2WS3A 4GXIA 4I28A 4IL4A 5HXEA 2RA1A 3JPPA 1W9RA 3GA8A 3QC9A 1LKXA 2QRXA 2XJ7A 3IF8B 4H63V 3C64A 4NXZA 7ICFA 1XMOT 2BG9B 1ZOYA 5A1LA 4F5QA 4RT2A 4G63A 3RJJA 4KLIA 3UUXB 3AE6A 2L8KA 3CPZA 3L09A 3ABVA 4HFIA 8ICIA 3VU7H 3HKDE 3NVOA 4YT0A 3TFSA 2W9MA 1OWAA 4K0UA 5J0PA 1HG2A 4U74A 4AT8A 3PUYF 2Q9QA 4NKTA 5HRGA 2H7OA 3RYCE 7ICEA 4O68A 5CB1A 2LKGA 3CK6A 2QVAA 4FHYA 5IIIA 5B3PA 3AEBA 1F5AA 3AQLA 3OGUA 3LK42 2LJLA 3AXJA 4B3ST 3OVSA 4DOBA 4I2BA 4WH5A 3J9X1 5F3JA 4X4RA 2B76A 2HN2A 2Y8DA 1ZQEA 3Q2MA 3AU2A 4DIDB 3V5SA 1ZKEA 4TX5A 2BBJA 3HJ4A 3KVAA 4IDNA 1G73A 2YKSA 4K8VA 4WW0A 4A97A 3I9WA 3CWZB 1VCTA 4H63H 2XQ6A 4QKNA 2CLYB 4BA9A 4U7IA 5L3BB 3TLSA 3ERCC 5J29A 3AUOA 1O3XA 5J2UE 7ICLA 4JBWF 2KXPB 3JADA 4IE0A 4ATBB 5JR9A 4NXVA 2CHNA 1HFAA 2BCRA 2LE8A 5E0OA 7ICMA 5JDGA 2UXCT 4ISTA 5BR8T 3O1IA 7ICVA 8ICPA 1NEKA 2KSRA 4IQUA 3A8YC 1CUNA 3TKLB 3W15B 3EUHA 2DR8A 4EEBA 2CXDA 4IL9A 5LBMA 4A56A 1ZQUA 3N5LA 5J2TE 2BG9E 5ETWA 5AQMB 3ISDA 3F57A 1YQ3A 2ZH4A 4UB5A 2N1GA 2VVSA 2BCUA 1HNWT 4EYYR 2X9WA 5J2BA 3K3OA 7ICSA 4DUZT 3FHNA 9ICBA 3V5UA 2LSIA 3H37A 2N2NA 2VQFT 2I59A 2PXIA 5FNVE 3UXPA 2M2UA 2PG8A 5AQQB 4MKPA 4EXTA 4TV8E 1IAPA 4H9OC 4YHHT 5CFSA 1XDOA 4NLKA 4EGWA 4GKJT 4IT4A 2ZH5A 3LFMA 8ICKA 9ICIA 2DRBA 4RWOA 4CI2B 1TFYA 5L3CB 3MACA 1ZQYA 3QK6A 3R84B 3SWHA 5EOZA 4NPPA 2LLYA 3QNUA 1YLQA 1ZQWA 8ICUA 3DP7A 2QGSA 3OUYB 4WBZA 4H9SE 7ICJA 3AE1A 3IHRA 2BPCA 2DWKA 4O5EA 2E9XC 4M47A 5L4EA 2ZLYA 1ZQZA 3B57A 3B0XA 1SUMB 8ICSA 4HE8A 3RGLA 4CXWA 3ZT5A 4MFFA 5TZVA 3PMLA 3SFEA 4RPZA 4CI3B 1HNZT 1T7SA 2UUAT 3IEEA 2WP9A 1ZP0A 2I6HA 4IE5A 1WFDA 4O8SA 5J2AA 5L47A 2MBGA 4K4IA 4O4HE 3C4ZA 4M2YA 4EZHA 2ES0A 1R8CA 3RIAA 4B6XA 4PK6A 1IBKT 4TUSA 1FMWA 2DR5A 4QXCB 3RH3A 3BK9A 4DV5T 5HRBA 4Z6DA 4R66A 3EHZA 3ZMVB 1CHUA 4Z8XA 4ZI2D 1VJ7A 8ICMA 4IIJE 5JDHA 1XZYA 1E1HB 3QOFA 5LMNT 3BQKA 4EP7A 4P4MA 4HWHA 4RWPA 3UUMA 3HKEE 4QZIA 5HXCA 2O1PA 9ICCA 3UU8A 4JI7T 4LFCT 2LRKA 8ICAA 9ICUA 1DU2A 5ABGA 4GIWA 1YD8G 5KMGP 1SA0E 3ETUA 4LF9T 5J2HA 5DBCA 4QZGA 4HWCA 2XQ3A 2WDRA 4EAHA 2OA5A 2Y48B 5HRHA 4M0AA 3T1YT 3ZYKA 3NKUA 4CXYA 2H7VC 5KX5E 4AIUA 3CX7B 4KLDA 5J1GA 4WOYA 5B3QA 3RIFA 2W4XA 4X4NA 4ZHQE 1UUSA 2IMLA 3NZPA 1TFWA 4COFA 4AKIA 2VVNA 4DR5T 2UXDT 4KM5A 3B5MA 5FMNA 3P4RA 2ZH6A 2IAKA 4N7RA 4WQLA 8ICZA 3A5XA 3ONXA 1R8IA 5L3FB 4I27A 3DJBA 5ABHA 5J0ZA 4S3NA 5AQVB 2LSKA 2XQYA 3RPUA 4LFAT 3OVBA 2J62A 4FJOA 4P1NA 2NTYA 3PUSA 1KDHA 2NW7A 3UULA 5J2JA 4FH5A 2XAGB 2KT9A 4WCWA 9ICSA 2V5DA 5CWRA 3SFDA 4LT6A 4TUQA 1IBLT 4C90A 3O1JA 4CQIA 9ICJA 5IIKA 3AE3A 3JAFA 9ICTA 5IUXA 2CBJA 3O9XA 2K24A 3UXNA 4YCXA 4IDOA 4KLGA 2LSGA 4I2DA 4E7ZA 4MBQA 1S35A 2W0GA 4RQ4A 5IIJA 2BPFA 4M1PA 2BBHA 3AEAA 4AT8B 1N32T 4P0BA 4K4GA 5LGUB 4X1IE 4RWQA 4RQ0A 2Q9QB 4ZZCA 2W67A 2GWSA 5HRFA 8ICLA 8ICFA 4KBMB 3RIUC 4TURA 1MMGA 3ZKRA 3RYIE 2WAUA 4ILCA 4X65T 4X62T 3ONJA 1ZQRA 1ZQOA 3AEEA 5HR9A 7ICRA 4JI3T 2BVMA 3AAAB 3U3IA 4QHOA 3VHLA 2ZH1A 2VANA 4QZCA 3RH5A 4QXHB 3JC6D 3AXJB 3LG7A 1BPDA 1QUUA 3Q9DA 5JDLA 2X9XA 2FMQA 5HCJA 5LHHB 1UGOA 5AQLB 4F6RC 3CQXC 5HHHA 2V1DB 3H38A 2ID1A 5LHGB 5JH7E 3QUJA 1V4AA 4WZXA 1WR6A 2QYWA 4PHAA 2CCQA 3CIRA 2UXNB 3UQ0A 1ZQDA 4X4VA 2D5UA 4WBOA 4UVBB 4U31A 4Z6EA 4KUMB 1ZQHA 2KWIB 3GN5A 2A72A 5ABFA 5BPCA 5JR9B 2W66A 4K9BA 4HFVA 3EVYA 5JDFA 3ZT7A 4PGQA 1EZ3A 4AQFC 3LK3B 4RQ3A 4HFEA 4V1Av 3ZMZB 3N9MA 4PW8A 2LEHA 4I29A 5LCYA 3TFRA 2WWUA 1Y64B 5HXSA 8ICJA 3LK2B 3PU8A 3KV9A 2XM1A 1ZQQA 3NRYA 4DMVA 4DR2T 5C3JA 1YXRA 2VKJA 4QZFA 2WWVA 4H9PC 2LHRA 3IA3A 3OTOT 3N2OA 3AE5A 3C18A 5JQGE 7ICPA 2E9XA 2R6GF 5FKYA 2WSSV 4M5DA 1ZQBA 3NBXX 4MFRA 1NENA 4MFCA 1X79A 3KV6A 2NTXA 4JI8T 2KNDA 3ZN1B 2LRLA 2AE9A 5GONE 3RC8A 4PHPA 1XWMA 2YN6A 1D0XA 2HH7A 4NM1A 2ZH8A 1HNXT 1MNDA 3Q5DA 1W09A 3EAMA 5D46A 4QZAA 2WQYA 4RT3A 4TWDA 2XM2A 2J47A 5CA1E 4FHVA 2Z6EA 2VKDA 1HUOA 2XSAA 4TUYE 5F5WA 5L2LA 4WC1A 5LXTE 5LGTB 1MQ3A 4HFCA 4QX7B 3AECA 1VOMA 4NUUA 4YD2A 4L0RA 1GPJA 2FJBA 4X20E 3P4WA 4KLJA 3ONLC 3PHZA 2XAFB 2JIWA 2WM9A 4HWIB 2FMSA 4XQ7A 4YSZA 4U2ZA 4QZHA 3C4XA 2PFNA 3AA1B 4YD1A 4UB4A 1JQRA 2KINB 4YTNA 1MMDA 3O1HA 2J4GA 5LYJE 4NKUA 4MALA 4I43B 4MFAA 4TN7B 1KNZA 5AQIB 5J2KA 3VRBA 4LEVA 1ZJNA 7ICOA 4OFZA 4PHDA 1HS7A 3F2EA 2LHNA 3PNCA 8ICCA 5EK3A 1JAJA 4KLEA 2NOXA 2M6BA 3D0TA 4DR1T 5AQRB 3OVUA 3OV7A 3UTKA 2CA5A 4LMLA 4O5KA 4HWDA 3K3NA 5FL1A 3NZQA 7ICNA 4JI4T 5DQVA 3C2KA 2UXBT 2LM9A 4M9NA 2EHOC 4K9AA 4JEHB 2PJQA 3FZFB 5BOLA 4F5NA 2DWGA 5J0WA 4QZDA 3UQ7A 5JRCA 5HEHA 2VQET 3AAEB 3FXEB 3O4XE 4ZXLA 1XMQT 3LQCB 2XQAA 1KNPA 4TNVA 3ER9B 3AAIA 3ZCIA 4JWMA 3SS1A 3QB5A 3ZT6A 2KZ7B 4DVDA 1KNRA 2BS2A 3RIUA 1D0YA 2CRBA 2L3LA 4XQ8A 1IJ6A 2NRKA 1ZHCA 5HXRA 3RLFF 2H3RA 5J2DA 4RPXA 4OAHA 3P4PA 3RX6A 1US7B 2DR7A 1J5WA 2I9GA 2DLRA 4HGAA 2DNXA 3AB3B 4H9RC 4UR9A 5J2FA 2MYSA 4O69A 3UU6A 1D1CA 3ISCA 5HC9A 3MKDA 3CQGB 2UXXB 3SOLA 4RWNA 3DTOA 1D1BA 3LJCA 3ZCJA 3HKCE 2YOEA 4X0BA 4U7YA 4K98A 2D2SA 4Z6FA 4AKRB 4YMNA 4YN4A 3UQ2A 2X0YA 2XQ9A 2P66A 1UEUA 2Q66A 2JQHA 2XAHB 2DR9A 3PTRB 1N33T 5F2VO 5FVLA 1W0BA 1Z0PA 2BS3A 4X4TA 4PJJA 3AEFA 9ICKA 4O2AE 4B3RT 5CA7A 4FO6A 4AQFA 4IE7A 3RHWA 8ICGA 1JNZA 3ZEFB 2CE7A 2V6XA 4OK0A 4A5XA 3WAKA 4I2EA 1ZQNA 2VB6A 4P4OA 2M2TA 1KF6A 2PBEA 3FB2A 3ZSTA 3VRAA 4GOUA 4OHFA 4X4PA 4Z90A 2IHMA 8ICXA 9ICLA 2P9BA 8ICVA 4PGXA 4NXNT 5HREA 1ZQFA 2CWYA 2IUBA 3P7IA 3RJKA 5L3GB 4TNWA 4DR3T 3KFWX 2M2WA 3GN5B 4ILAA 1LVFA 5HYAA 1M62A 3C50A 7ICGA 4RQ7A 4NY8A 5ABFB 1J5ET 2BKNA 1UCUA 5DEDA 3MDCA 2CMRA 5EK2A 2BE3A 9ICAA 4PAGA 3V7KA 4YJ3E 4O4LE 2C5JA 9ICFA 4M9LA 3ZC1A 2GAFD 4XUSA 4UV9B 4LZGA 3PUAA 3BQLA 2V7JA 2B4VA 3NYBA 2XY8B 5IYZE 3PDYA 3ZSSA 4NUVA 2WU5A 2ZH9A 4UB1A 3OYZA 2V7KA 1WOTA 2RFFA 2ZH7A 4EEDA 3ZN0B 2CM0A 4LF6T 1FIOA 1RPLA 2JPFA 3EDVA 4HTEA 4KX6A 2E9XB 3LBXA 5LP6E 5ADXL 4JLEA 2BPGA 4X64T 2CHOA 3MJXA 4WBYA 4PJMA 4LEWA 2XAQB 9ICEA 4NXWA 3UU5A 1VRBA 4DR7T 1JMSA 3C2LA 2ISPA 5J2EA 2D9DA 3PMNA 5L3DB 4LMJA 3FZLB 1S94A 4KLTA 3CX8B 2JJ9A 4OX9T 7ICIA 2V6YA 3RI5A 4ZI3D 5D49A 2YK0A 3RRWA 3UPQA 2NW8A 2GK9A 2WZIA 1IZNB 4BJMA 4ZEYA 4C91A 1Z8UA 3ANWB 1KNYA 4LF4T 2X66A 3MDAA 4DBRA 3MA9A 4KLUA 5EK4A 4YSXA 1AJ3A 4I2CA 4F8HA 3GWHA 9ICXA 4TV9E 4F5PA 5DJQC 4DO0A 3T8OA 3JPNA 5AQPB 3WAJA 3ZMTB 4AQYT 3HI2A 2JQKA 1LVKA 3PUQA 2C5IT 2RPAA 4KHZF 4DV7T 4IREA 2LKHA 2Q9QD 4M04A 4YMMA 3MK7C 2PTFA 3PURA 1U4QA 4O9MA 3KBUA 5LNKA 3UFGA 4QH4A 2EHOA 3RH4A 4Z6CA 2KMFA 3AE4A 3AQKA 4PK4A 5JVDE 4QZBA 2WCAA 4JLXA 1HG5A 4TUPA 3QB5K 5AQJB 5CHEA 5IILA 4ZI7E 2E5VA 5LG4A 4K4HA 4O67A 8ICWA 1Y01A 1FA0A 1QSDA 4ZI2C 1Q79A 5J0RA 2IC9A 1YQ4A 4WBNE 4X1KE 4EV6A 3RQUA 2CXFA 1WR0A 4ILUA 5DDYA 5DQWA 5AQHB 4YXDA 4NXUA 4GKKT 4KLMA 5AQTB 3OVAA 3H3MA 5LBQB 2GA9D 1NOMA 4RQ2A 3RJHA 5DB6A 2FCLA 1H7CA 4JEUB 3LDQB 4E80A 1TV9A 3V7JA 3ZYLA 5J2GA 4HKAA 4AISA 4DO9A 1ZQKA 2ZM2A 1ZQVA 5JRCB 2BCSA 1OEDC 3OYXA 2B56A 4ISSA 3K7DA 1KK7A 2X9YA 1FMVA 5LB7B 2CXLA 3MGIA 2DI4A 3H39A 4A98A 1XNQT 2B1EA 2BVLA 4U72A 4NLZA 4QZ8A 1R89A 1L0VA 3C98B 3KV4A 4X0AA 5LGNB 3TLVA 2FUPA 3VR9A 4HWFA 5CFTA 1G8XA 2ZH2A 5FP3A 9ICWA 9ICHA 3ZPOA 5IWAT 4EYUA 4ZS2A 4P0AA 3AE8A 5HRIA 4YY3T 4F5OA 4YLHA 1XNRT 2X68A 3MZKB 5JTGA 2HN1A 3UXOA 2O5AA 4DR4T 4RQ6A 1N36T 4JV5T 2JRKA 3GMIA 2PBIA 4LF8T 4DNDA 3ER8C 4UD5A 2DCFA 4X1YE 3I9YA 4KMCA 4M9JA 5C2TA 2VKOA 2CPTA 4GYSA 4OAIZ 4OAFA 3NRXA 2NR4A 5DB8A 4NXTA 3Q5XA 1RZTA 2ODVA 3PJAA 2WMNA 4DV6T 2BKOA 2WDQA 3B13A 4I4TE 5IIMA 2I0MA 2WB5A 4PNIA 4NLNA 5J0XA 4MF8A 5DECA 4UF0A 4LMKA 4KLQA 4X4UA 3FZMB 2ZM6T 4JI2T 1BR2A 4I55E 7ICKA 4AT7A 3H3AA 2HHPA 3ESLA 4MHCA 5AQNB 5HRDA 3JC6C 8ICQA 3HX0A 2UUCT 4ILBA 2UU9T 2MAWA 2XAJB 1ZQPA 4KLLA 5D4BA 4NXMT 1LRZA 4I50E 3N9PA 4LF5T 1HUZA 2XUEA 2VL8A 5J0OA 2YDSA 4K96A 4UAWA 4WC4A 3EF2A 4IDZA 4O5CA 5KDMC 4IG8A 1UURA 4XJEA 1SHZC 4DV0T 4QH1A 3WI3A 5BMVE 1V9DA 3ANWA 2LT3A 3PV0F 4Q25A 1BPZA 1M7KA 3OWGA 4QXBB 1OEDE 2IIUA 4U3CA 3JPSA 2WZHA 4J2CA 3AVRA 5J2IA 2PFOA 1Q78A 4GK0E 1KFYA 3B0YA 1NWMX 4FHPA 2W62A 5CGMA 4DV2T 3ZMSB 5CFUA 3HKBE 3PJAJ 3CMLA 2QA7A 3LBXB 8ICTA 5J0SA 4M9GA 3ZMUB 4EB6E 8ICBA 9ICVA 1TVAA 5D62A 5DDMA 4FI5A 2C5KT 3LSVA 5FYMA 2ZMAA 4K99A 2VL0A 9ICPA 3TLWA 1IJ5A 3PUGA 2BCQA 3IBPA 1FJGT 1E7PA 4LEZA 4P09A 2V6YB 5HXHA 4UBCA 4XAXB 1ZQXA 4ASKA 4RPYA 3AA6B 4PFPA 3F31A 4FHXA 3RYHE 2NWBA 4WQKA 2Y6XA 3P50A 4E7SA 4PPXA 2ACXA 1ZJMA 2SPCA 4LFBT 3ZC0A 1ZQLA 1W0AA 3PUVF 2CBIA 1BR4A 2FJAA 4EBJA 5JDNA 4WC5A 3RJEA 2VASA 3UT5E 2VURA 1XSPA 1D0ZA 2EWRA 4PHEA 3L9DA 3L39A 4TZ4C 7ICUA 2EHOB 3FBLA 3RC3A 4CN6A 4MF2A 2YU1A 3MGHA 3S4UA 3MCRA 2A3DA 1OEDA 2ACZA 4GYRA 3R6NA 4EBKA 5DBAA 2D0TA 2PFPA 5J0TA 3Q5EA 4AKHA 4AT9B 3L3PA 1R8AA 3RKGA 2MTQA 4JWNA 1T98A 4I2JA 5C8YE 5IHYA 4DBQA 3ZLIA 3M65A 4IGUA 4AQGA 2ZM8A 4O4JE 5F8PA 3WFQE 3RKOA 3V7LA 3I1AA 2K5BB 2W2UA 4UD4A 1BPBA 4LF7T 4AI6A 2AXDS 1HR0T 5AFUL 2A2FX 4I2FA 2M67A 5FY0A 2MPKA 2CLYC 3AU6A 2FJDA 4LZDA 4KP3C 1WYBA 4PJNA 4KLOA 4DV1T 4UAZA 2LSYA 4WC6A 2CWOA 5CHGA 5HRKA 4FH3A 3WFRE 2XSBA 4O2BE 4OYKA 4O6AA 4FO1A 4BJNA 1ZQTA 4X4OA 2ISOA 1T72A 4XBFB 4DOAA 4UIGA 3HR0A 3RYFE 2V8SV 3GDXA 4YTPA 4JI0T 3N2GE 3P4SA 2IC6A 4KB6A 2LOPA 4P2HA 3HIYA 1D1AA 4WC0A 5HEUA 2ZHAA 3UUBA 3A7MA 2DHRA 2X0HA 5M4YA 4XRHA 2ZHBA 2N9DA 1JN3A 2XQ5A 3TLTA 2XPKA 5FL0A 2E9XD 4PFOA 2ZH3A 2YU2A 4TWHA 5FY1A 3BQIA 4ZOLE 2JQQA 4GXKA 1WRDA 2G0UA 3UQ4A 2IW5B 1B7TA 1MIWA 5D63A 2K48A 3ZJ1A 4WC3A 4X4QA 1WYCA 2M6IA 3X1DA 4L5GA 4PJLA 4H9NC 2L9QA 4M9HA 5LHIB 5ABEA 5H6QB 4I2GA 2XQ8A 2LOSA 5DKWA 4UB2A 3LK9A 1FEWA 3AA7B 4U33A 1ZQAA 2WMOA 3C51A 4QH5A 4YSYA 5AQFB 3P8CD 3SRZA 2X9HA 1MMAA 4ADZA 5LG3A 1BPXA 9ICNA 2MOZA 5J0QA 2J1DG 9ICGA 2V7LA 1KEYA 4LEYA 2FBWA 3KVBA 1MIYA 4UF0B 2WDVA 4G2AA 5L4HA 3FBZA 1QLBA 5HRLA 5FVKA 5FXXA 4I0UA 5CJ5A 3EI0A 8ICNA 2KLQA 4AT7B 2XHEB 2E8IA 4EOZB 1HF8A 3E22E 2E5LT 4AKGA 3E0ZA 7ICQA 4YMOA 2VK9A 5J0YA 4QZ9A 3N2KE 1OU5A 3OPCA 4RQ8A 2YDQA 5CA0E 2X0LB 2X51A 3HA4A 4FHWA 5CP2A 4ANJA 5BOMA 5IINA 4R63A 1MQ2A 1MIVA 5LJMA 4DMWA 2YEVC 3AVSA 3FZHB 4CI1B 5JDMA 3UPSA 1E2AA 1I6ZA 5JDQA 4E7XA 3EDUA 3JPTA 3Q5WA 3I0QA 1ZQCA 4CN4A 3PUWF 3C4WA 1ZQJA 2BKPA 3VKHA 3K75D 2M2VA 3CX6B 4DR6T 4IQWA 2NP9A 4YJ2E 5LMUT 4WC2A 4JUYA 4Z91A 4U2YA 2C0SA 2WU2A 4K0KT 2BG9A 4DUYT 3AE9A 3C66A 4PK5A 2IDOB 4NM2A 4HFDA 3CKDA 7ICTA 4R64A 5DB9A 8ICOA 5J2CA 5DABA 3MBYA 5CFBA 3HJ1A 4E8FA 3V72A 4HX0A 1OXZA 3C2MA 4LVSA 3G06A 5LJNA 2B51A 2FMPA 1UETA 3UFEA 2JMKA 2F4VT 2RP4A 3OJAA 2LSJA 4AKLA 3JAEA 3WFSC 3AQNA 2OV9A 3CVRA 4AT9A 1SE7A 1VCSA 5AQKB 3ZJ2A 1UX4A 2XTLA 2E2AA 4ZI3C 4WYVA 4GXJA 2DRAA 5HWYA 2K9AA 1GQEA 3MXZA 4NXXA 5D61A 4JLZA 3JCFA 3N9NA 5FXVA 3AEDA 1UX5A 4CN1A 1J1JA 2IHR1 2ZM0A 4DV3T 4UXNB 3HW8A 4KI0F 3N9LA 1PX5A 2H89A 2V7MA 5CJ7A 1HX8A 1YKHB 3RJIA 2DVIA 2W61A
chains in the Genus database with same CATH topology
2BBHA 2IUBA 4EEBA 2BBJA 2HN1A 5JTGA 3CK6A 4EV6A 3NVOA 4EGWA 3RKGA 4EEDA 2HN2A 4I0UA 3JCFA 3NWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBH A;  2IUB A;  4EEB A;  2BBJ A;  2HN1 A;  5JTG A;  3CK6 A;  4EV6 A;  3NVO A;  4EGW A;  3RKG A;  4EED A;  2HN2 A;  4I0U A;  3JCF A;  3NWI A; 
#chains in the Genus database with same CATH topology
 3AEG A;  4WC7 A;  2D0U A;  2Q9Q C;  4UV8 B;  2BS4 A;  1IBM T;  4AXP A;  4X5V A;  4MLK A;  4ATB A;  5HCM A;  5AQU B;  1ZQM A;  4R65 A;  5FY7 A;  1MMN A;  3E08 A;  3NKZ A;  4CZZ B;  1OED B;  3RF1 A;  3RRC A;  4CXX A;  3I0O A;  5HHI A;  4JI6 T;  5LA6 E;  3N9O A;  4I2I A;  4JI5 T;  4ZZB A;  4HEA A;  1BPY A;  2JQ9 A;  2XZE A;  1HCI A;  1ZV4 X;  3VKG A;  2PFV A;  2W63 A;  2FJE A;  3UU3 A;  4YTM A;  4JI1 T;  5DBB A;  3WFP A;  3C5G A;  2VWA A;  1XSL A;  3EAB A;  4UAY A;  4IE4 A;  9ICM A;  4XA5 A;  2YDR A;  4UEL A;  1VFG A;  3HL6 A;  5FXW A;  1N34 T;  4UBB A;  3ISB A;  4IHJ E;  2XQ4 A;  3C5F A;  1WLX A;  3RH6 A;  3JPO A;  4O4I E;  3JPR A;  4OYJ A;  4RQ5 A;  4QX8 B;  3NWI A;  1ZEE A;  8ICH A;  3WFO A;  2X67 A;  3RJF A;  4IQT A;  3JZ0 A;  4GK5 E;  4KLS A;  5JR9 C;  4UVA B;  1KEJ A;  2BDE A;  1YW0 A;  2UUB T;  7ICH A;  3JPQ A;  2V5C A;  5J0U A;  2YIN A;  3AE7 A;  1XSN A;  2V26 A;  3K3Q C;  4DV4 T;  1JNR A;  4XZC A;  3AQM A;  3KIN B;  5TAO A;  4KLH A;  4IDP A;  2ODU A;  5DB7 A;  3TLU A;  4I2H A;  4DOC A;  3KBT A;  3FZK B;  5KXJ A;  2HPJ A;  4PH5 A;  3VR8 A;  1ZQS A;  4X5T A;  5HEG A;  3PUX F;  3PUZ F;  1UEV A;  1T8B A;  3OUY A;  4I2A A;  1ZQG A;  2HPL A;  4KHP T;  3KDS E;  1BPE A;  3T1H T;  1U5P A;  5FXZ A;  1YKE B;  3P4Q A;  4EIW A;  4B3T T;  3K8P C;  3OBV E;  1X9B A;  2LM2 A;  3FXD B;  4QZE A;  1NO5 A;  2JMH A;  2CEA A;  8ICE A;  3ZYM A;  4HFH A;  4RQ1 A;  3RJG A;  4JYA T;  2XQ7 A;  4IDQ A;  4HN9 A;  5AQG B;  2IHO A;  3U78 A;  5AQO B;  2OLT A;  4P4P A;  4X4S A;  2KWH A;  3CQC B;  4L9I A;  8ICR A;  5CB4 E;  3HWT A;  2A9U A;  3AE2 A;  4X66 T;  3JYY A;  1HTJ F;  2WY2 A;  4N78 D;  2HHH T;  2H88 A;  3J7Y q;  3UU4 A;  4EZ4 A;  3ETV A;  5HWX A;  4H9Q C;  4UEM A;  5AQS B;  1I94 T;  1BR0 A;  4ZS3 A;  4OAG A;  2BZB A;  5IIO A;  1NAF A;  1XDP A;  4YHJ A;  3OKQ A;  2DL1 A;  4ERR A;  2BCV A;  2WBL A;  4UB3 A;  9ICR A;  4B3M T;  4IE6 A;  3UUN A;  9ICQ A;  1BR1 A;  1HX1 B;  4K97 A;  2XAS B;  5H6R B;  2EHO D;  2NW9 A;  4IQV A;  2PFQ A;  3KV5 A;  3PE0 A;  4F5R A;  4UVC B;  4WNK A;  2W00 A;  3N9Q A;  4BAY B;  5L3E B;  5HAX A;  2VKH A;  3RQW A;  1ZQI A;  4QWN B;  2V7I A;  9ICO A;  2K3W A;  4HFB A;  4NIQ A;  3PU3 A;  4TWF A;  1UK5 A;  3K1S A;  5LOV E;  5EZY E;  5JRE A;  5CR0 A;  4PGY A;  1WCR A;  4KLF A;  1R8B A;  4YFS A;  5HEJ A;  3AA0 B;  2BG9 C;  3M3Z B;  8ICY A;  5HEO A;  1MNE A;  3L8R A;  2WS3 A;  4GXI A;  4I28 A;  4IL4 A;  5HXE A;  2RA1 A;  3JPP A;  1W9R A;  3GA8 A;  3QC9 A;  1LKX A;  2QRX A;  2XJ7 A;  3IF8 B;  4H63 V;  3C64 A;  4NXZ A;  7ICF A;  1XMO T;  2BG9 B;  1ZOY A;  5A1L A;  4F5Q A;  4RT2 A;  4G63 A;  3RJJ A;  4KLI A;  3UUX B;  3AE6 A;  2L8K A;  3CPZ A;  3L09 A;  3ABV A;  4HFI A;  8ICI A;  3VU7 H;  3HKD E;  3NVO A;  4YT0 A;  3TFS A;  2W9M A;  1OWA A;  4K0U A;  5J0P A;  1HG2 A;  4U74 A;  4AT8 A;  3PUY F;  2Q9Q A;  4NKT A;  5HRG A;  2H7O A;  3RYC E;  7ICE A;  4O68 A;  5CB1 A;  2LKG A;  3CK6 A;  2QVA A;  4FHY A;  5III A;  5B3P A;  3AEB A;  1F5A A;  3AQL A;  3OGU A;  3LK4 2;  2LJL A;  3AXJ A;  4B3S T;  3OVS A;  4DOB A;  4I2B A;  4WH5 A;  3J9X 1;  5F3J A;  4X4R A;  2B76 A;  2HN2 A;  2Y8D A;  1ZQE A;  3Q2M A;  3AU2 A;  4DID B;  3V5S A;  1ZKE A;  4TX5 A;  2BBJ A;  3HJ4 A;  3KVA A;  4IDN A;  1G73 A;  2YKS A;  4K8V A;  4WW0 A;  4A97 A;  3I9W A;  3CWZ B;  1VCT A;  4H63 H;  2XQ6 A;  4QKN A;  2CLY B;  4BA9 A;  4U7I A;  5L3B B;  3TLS A;  3ERC C;  5J29 A;  3AUO A;  1O3X A;  5J2U E;  7ICL A;  4JBW F;  2KXP B;  3JAD A;  4IE0 A;  4ATB B;  5JR9 A;  4NXV A;  2CHN A;  1HFA A;  2BCR A;  2LE8 A;  5E0O A;  7ICM A;  5JDG A;  2UXC T;  4IST A;  5BR8 T;  3O1I A;  7ICV A;  8ICP A;  1NEK A;  2KSR A;  4IQU A;  3A8Y C;  1CUN A;  3TKL B;  3W15 B;  3EUH A;  2DR8 A;  4EEB A;  2CXD A;  4IL9 A;  5LBM A;  4A56 A;  1ZQU A;  3N5L A;  5J2T E;  2BG9 E;  5ETW A;  5AQM B;  3ISD A;  3F57 A;  1YQ3 A;  2ZH4 A;  4UB5 A;  2N1G A;  2VVS A;  2BCU A;  1HNW T;  4EYY R;  2X9W A;  5J2B A;  3K3O A;  7ICS A;  4DUZ T;  3FHN A;  9ICB A;  3V5U A;  2LSI A;  3H37 A;  2N2N A;  2VQF T;  2I59 A;  2PXI A;  5FNV E;  3UXP A;  2M2U A;  2PG8 A;  5AQQ B;  4MKP A;  4EXT A;  4TV8 E;  1IAP A;  4H9O C;  4YHH T;  5CFS A;  1XDO A;  4NLK A;  4EGW A;  4GKJ T;  4IT4 A;  2ZH5 A;  3LFM A;  8ICK A;  9ICI A;  2DRB A;  4RWO A;  4CI2 B;  1TFY A;  5L3C B;  3MAC A;  1ZQY A;  3QK6 A;  3R84 B;  3SWH A;  5EOZ A;  4NPP A;  2LLY A;  3QNU A;  1YLQ A;  1ZQW A;  8ICU A;  3DP7 A;  2QGS A;  3OUY B;  4WBZ A;  4H9S E;  7ICJ A;  3AE1 A;  3IHR A;  2BPC A;  2DWK A;  4O5E A;  2E9X C;  4M47 A;  5L4E A;  2ZLY A;  1ZQZ A;  3B57 A;  3B0X A;  1SUM B;  8ICS A;  4HE8 A;  3RGL A;  4CXW A;  3ZT5 A;  4MFF A;  5TZV A;  3PML A;  3SFE A;  4RPZ A;  4CI3 B;  1HNZ T;  1T7S A;  2UUA T;  3IEE A;  2WP9 A;  1ZP0 A;  2I6H A;  4IE5 A;  1WFD A;  4O8S A;  5J2A A;  5L47 A;  2MBG A;  4K4I A;  4O4H E;  3C4Z A;  4M2Y A;  4EZH A;  2ES0 A;  1R8C A;  3RIA A;  4B6X A;  4PK6 A;  1IBK T;  4TUS A;  1FMW A;  2DR5 A;  4QXC B;  3RH3 A;  3BK9 A;  4DV5 T;  5HRB A;  4Z6D A;  4R66 A;  3EHZ A;  3ZMV B;  1CHU A;  4Z8X A;  4ZI2 D;  1VJ7 A;  8ICM A;  4IIJ E;  5JDH A;  1XZY A;  1E1H B;  3QOF A;  5LMN T;  3BQK A;  4EP7 A;  4P4M A;  4HWH A;  4RWP A;  3UUM A;  3HKE E;  4QZI A;  5HXC A;  2O1P A;  9ICC A;  3UU8 A;  4JI7 T;  4LFC T;  2LRK A;  8ICA A;  9ICU A;  1DU2 A;  5ABG A;  4GIW A;  1YD8 G;  5KMG P;  1SA0 E;  3ETU A;  4LF9 T;  5J2H A;  5DBC A;  4QZG A;  4HWC A;  2XQ3 A;  2WDR A;  4EAH A;  2OA5 A;  2Y48 B;  5HRH A;  4M0A A;  3T1Y T;  3ZYK A;  3NKU A;  4CXY A;  2H7V C;  5KX5 E;  4AIU A;  3CX7 B;  4KLD A;  5J1G A;  4WOY A;  5B3Q A;  3RIF A;  2W4X A;  4X4N A;  4ZHQ E;  1UUS A;  2IML A;  3NZP A;  1TFW A;  4COF A;  4AKI A;  2VVN A;  4DR5 T;  2UXD T;  4KM5 A;  3B5M A;  5FMN A;  3P4R A;  2ZH6 A;  2IAK A;  4N7R A;  4WQL A;  8ICZ A;  3A5X A;  3ONX A;  1R8I A;  5L3F B;  4I27 A;  3DJB A;  5ABH A;  5J0Z A;  4S3N A;  5AQV B;  2LSK A;  2XQY A;  3RPU A;  4LFA T;  3OVB A;  2J62 A;  4FJO A;  4P1N A;  2NTY A;  3PUS A;  1KDH A;  2NW7 A;  3UUL A;  5J2J A;  4FH5 A;  2XAG B;  2KT9 A;  4WCW A;  9ICS A;  2V5D A;  5CWR A;  3SFD A;  4LT6 A;  4TUQ A;  1IBL T;  4C90 A;  3O1J A;  4CQI A;  9ICJ A;  5IIK A;  3AE3 A;  3JAF A;  9ICT A;  5IUX A;  2CBJ A;  3O9X A;  2K24 A;  3UXN A;  4YCX A;  4IDO A;  4KLG A;  2LSG A;  4I2D A;  4E7Z A;  4MBQ A;  1S35 A;  2W0G A;  4RQ4 A;  5IIJ A;  2BPF A;  4M1P A;  2BBH A;  3AEA A;  4AT8 B;  1N32 T;  4P0B A;  4K4G A;  5LGU B;  4X1I E;  4RWQ A;  4RQ0 A;  2Q9Q B;  4ZZC A;  2W67 A;  2GWS A;  5HRF A;  8ICL A;  8ICF A;  4KBM B;  3RIU C;  4TUR A;  1MMG A;  3ZKR A;  3RYI E;  2WAU A;  4ILC A;  4X65 T;  4X62 T;  3ONJ A;  1ZQR A;  1ZQO A;  3AEE A;  5HR9 A;  7ICR A;  4JI3 T;  2BVM A;  3AAA B;  3U3I A;  4QHO A;  3VHL A;  2ZH1 A;  2VAN A;  4QZC A;  3RH5 A;  4QXH B;  3JC6 D;  3AXJ B;  3LG7 A;  1BPD A;  1QUU A;  3Q9D A;  5JDL A;  2X9X A;  2FMQ A;  5HCJ A;  5LHH B;  1UGO A;  5AQL B;  4F6R C;  3CQX C;  5HHH A;  2V1D B;  3H38 A;  2ID1 A;  5LHG B;  5JH7 E;  3QUJ A;  1V4A A;  4WZX A;  1WR6 A;  2QYW A;  4PHA A;  2CCQ A;  3CIR A;  2UXN B;  3UQ0 A;  1ZQD A;  4X4V A;  2D5U A;  4WBO A;  4UVB B;  4U31 A;  4Z6E A;  4KUM B;  1ZQH A;  2KWI B;  3GN5 A;  2A72 A;  5ABF A;  5BPC A;  5JR9 B;  2W66 A;  4K9B A;  4HFV A;  3EVY A;  5JDF A;  3ZT7 A;  4PGQ A;  1EZ3 A;  4AQF C;  3LK3 B;  4RQ3 A;  4HFE A;  4V1A v;  3ZMZ B;  3N9M A;  4PW8 A;  2LEH A;  4I29 A;  5LCY A;  3TFR A;  2WWU A;  1Y64 B;  5HXS A;  8ICJ A;  3LK2 B;  3PU8 A;  3KV9 A;  2XM1 A;  1ZQQ A;  3NRY A;  4DMV A;  4DR2 T;  5C3J A;  1YXR A;  2VKJ A;  4QZF A;  2WWV A;  4H9P C;  2LHR A;  3IA3 A;  3OTO T;  3N2O A;  3AE5 A;  3C18 A;  5JQG E;  7ICP A;  2E9X A;  2R6G F;  5FKY A;  2WSS V;  4M5D A;  1ZQB A;  3NBX X;  4MFR A;  1NEN A;  4MFC A;  1X79 A;  3KV6 A;  2NTX A;  4JI8 T;  2KND A;  3ZN1 B;  2LRL A;  2AE9 A;  5GON E;  3RC8 A;  4PHP A;  1XWM A;  2YN6 A;  1D0X A;  2HH7 A;  4NM1 A;  2ZH8 A;  1HNX T;  1MND A;  3Q5D A;  1W09 A;  3EAM A;  5D46 A;  4QZA A;  2WQY A;  4RT3 A;  4TWD A;  2XM2 A;  2J47 A;  5CA1 E;  4FHV A;  2Z6E A;  2VKD A;  1HUO A;  2XSA A;  4TUY E;  5F5W A;  5L2L A;  4WC1 A;  5LXT E;  5LGT B;  1MQ3 A;  4HFC A;  4QX7 B;  3AEC A;  1VOM A;  4NUU A;  4YD2 A;  4L0R A;  1GPJ A;  2FJB A;  4X20 E;  3P4W A;  4KLJ A;  3ONL C;  3PHZ A;  2XAF B;  2JIW A;  2WM9 A;  4HWI B;  2FMS A;  4XQ7 A;  4YSZ A;  4U2Z A;  4QZH A;  3C4X A;  2PFN A;  3AA1 B;  4YD1 A;  4UB4 A;  1JQR A;  2KIN B;  4YTN A;  1MMD A;  3O1H A;  2J4G A;  5LYJ E;  4NKU A;  4MAL A;  4I43 B;  4MFA A;  4TN7 B;  1KNZ A;  5AQI B;  5J2K A;  3VRB A;  4LEV A;  1ZJN A;  7ICO A;  4OFZ A;  4PHD A;  1HS7 A;  3F2E A;  2LHN A;  3PNC A;  8ICC A;  5EK3 A;  1JAJ A;  4KLE A;  2NOX A;  2M6B A;  3D0T A;  4DR1 T;  5AQR B;  3OVU A;  3OV7 A;  3UTK A;  2CA5 A;  4LML A;  4O5K A;  4HWD A;  3K3N A;  5FL1 A;  3NZQ A;  7ICN A;  4JI4 T;  5DQV A;  3C2K A;  2UXB T;  2LM9 A;  4M9N A;  2EHO C;  4K9A A;  4JEH B;  2PJQ A;  3FZF B;  5BOL A;  4F5N A;  2DWG A;  5J0W A;  4QZD A;  3UQ7 A;  5JRC A;  5HEH A;  2VQE T;  3AAE B;  3FXE B;  3O4X E;  4ZXL A;  1XMQ T;  3LQC B;  2XQA A;  1KNP A;  4TNV A;  3ER9 B;  3AAI A;  3ZCI A;  4JWM A;  3SS1 A;  3QB5 A;  3ZT6 A;  2KZ7 B;  4DVD A;  1KNR A;  2BS2 A;  3RIU A;  1D0Y A;  2CRB A;  2L3L A;  4XQ8 A;  1IJ6 A;  2NRK A;  1ZHC A;  5HXR A;  3RLF F;  2H3R A;  5J2D A;  4RPX A;  4OAH A;  3P4P A;  3RX6 A;  1US7 B;  2DR7 A;  1J5W A;  2I9G A;  2DLR A;  4HGA A;  2DNX A;  3AB3 B;  4H9R C;  4UR9 A;  5J2F A;  2MYS A;  4O69 A;  3UU6 A;  1D1C A;  3ISC A;  5HC9 A;  3MKD A;  3CQG B;  2UXX B;  3SOL A;  4RWN A;  3DTO A;  1D1B A;  3LJC A;  3ZCJ A;  3HKC E;  2YOE A;  4X0B A;  4U7Y A;  4K98 A;  2D2S A;  4Z6F A;  4AKR B;  4YMN A;  4YN4 A;  3UQ2 A;  2X0Y A;  2XQ9 A;  2P66 A;  1UEU A;  2Q66 A;  2JQH A;  2XAH B;  2DR9 A;  3PTR B;  1N33 T;  5F2V O;  5FVL A;  1W0B A;  1Z0P A;  2BS3 A;  4X4T A;  4PJJ A;  3AEF A;  9ICK A;  4O2A E;  4B3R T;  5CA7 A;  4FO6 A;  4AQF A;  4IE7 A;  3RHW A;  8ICG A;  1JNZ A;  3ZEF B;  2CE7 A;  2V6X A;  4OK0 A;  4A5X A;  3WAK A;  4I2E A;  1ZQN A;  2VB6 A;  4P4O A;  2M2T A;  1KF6 A;  2PBE A;  3FB2 A;  3ZST A;  3VRA A;  4GOU A;  4OHF A;  4X4P A;  4Z90 A;  2IHM A;  8ICX A;  9ICL A;  2P9B A;  8ICV A;  4PGX A;  4NXN T;  5HRE A;  1ZQF A;  2CWY A;  2IUB A;  3P7I A;  3RJK A;  5L3G B;  4TNW A;  4DR3 T;  3KFW X;  2M2W A;  3GN5 B;  4ILA A;  1LVF A;  5HYA A;  1M62 A;  3C50 A;  7ICG A;  4RQ7 A;  4NY8 A;  5ABF B;  1J5E T;  2BKN A;  1UCU A;  5DED A;  3MDC A;  2CMR A;  5EK2 A;  2BE3 A;  9ICA A;  4PAG A;  3V7K A;  4YJ3 E;  4O4L E;  2C5J A;  9ICF A;  4M9L A;  3ZC1 A;  2GAF D;  4XUS A;  4UV9 B;  4LZG A;  3PUA A;  3BQL A;  2V7J A;  2B4V A;  3NYB A;  2XY8 B;  5IYZ E;  3PDY A;  3ZSS A;  4NUV A;  2WU5 A;  2ZH9 A;  4UB1 A;  3OYZ A;  2V7K A;  1WOT A;  2RFF A;  2ZH7 A;  4EED A;  3ZN0 B;  2CM0 A;  4LF6 T;  1FIO A;  1RPL A;  2JPF A;  3EDV A;  4HTE A;  4KX6 A;  2E9X B;  3LBX A;  5LP6 E;  5ADX L;  4JLE A;  2BPG A;  4X64 T;  2CHO A;  3MJX A;  4WBY A;  4PJM A;  4LEW A;  2XAQ B;  9ICE A;  4NXW A;  3UU5 A;  1VRB A;  4DR7 T;  1JMS A;  3C2L A;  2ISP A;  5J2E A;  2D9D A;  3PMN A;  5L3D B;  4LMJ A;  3FZL B;  1S94 A;  4KLT A;  3CX8 B;  2JJ9 A;  4OX9 T;  7ICI A;  2V6Y A;  3RI5 A;  4ZI3 D;  5D49 A;  2YK0 A;  3RRW A;  3UPQ A;  2NW8 A;  2GK9 A;  2WZI A;  1IZN B;  4BJM A;  4ZEY A;  4C91 A;  1Z8U A;  3ANW B;  1KNY A;  4LF4 T;  2X66 A;  3MDA A;  4DBR A;  3MA9 A;  4KLU A;  5EK4 A;  4YSX A;  1AJ3 A;  4I2C A;  4F8H A;  3GWH A;  9ICX A;  4TV9 E;  4F5P A;  5DJQ C;  4DO0 A;  3T8O A;  3JPN A;  5AQP B;  3WAJ A;  3ZMT B;  4AQY T;  3HI2 A;  2JQK A;  1LVK A;  3PUQ A;  2C5I T;  2RPA A;  4KHZ F;  4DV7 T;  4IRE A;  2LKH A;  2Q9Q D;  4M04 A;  4YMM A;  3MK7 C;  2PTF A;  3PUR A;  1U4Q A;  4O9M A;  3KBU A;  5LNK A;  3UFG A;  4QH4 A;  2EHO A;  3RH4 A;  4Z6C A;  2KMF A;  3AE4 A;  3AQK A;  4PK4 A;  5JVD E;  4QZB A;  2WCA A;  4JLX A;  1HG5 A;  4TUP A;  3QB5 K;  5AQJ B;  5CHE A;  5IIL A;  4ZI7 E;  2E5V A;  5LG4 A;  4K4H A;  4O67 A;  8ICW A;  1Y01 A;  1FA0 A;  1QSD A;  4ZI2 C;  1Q79 A;  5J0R A;  2IC9 A;  1YQ4 A;  4WBN E;  4X1K E;  4EV6 A;  3RQU A;  2CXF A;  1WR0 A;  4ILU A;  5DDY A;  5DQW A;  5AQH B;  4YXD A;  4NXU A;  4GKK T;  4KLM A;  5AQT B;  3OVA A;  3H3M A;  5LBQ B;  2GA9 D;  1NOM A;  4RQ2 A;  3RJH A;  5DB6 A;  2FCL A;  1H7C A;  4JEU B;  3LDQ B;  4E80 A;  1TV9 A;  3V7J A;  3ZYL A;  5J2G A;  4HKA A;  4AIS A;  4DO9 A;  1ZQK A;  2ZM2 A;  1ZQV A;  5JRC B;  2BCS A;  1OED C;  3OYX A;  2B56 A;  4ISS A;  3K7D A;  1KK7 A;  2X9Y A;  1FMV A;  5LB7 B;  2CXL A;  3MGI A;  2DI4 A;  3H39 A;  4A98 A;  1XNQ T;  2B1E A;  2BVL A;  4U72 A;  4NLZ A;  4QZ8 A;  1R89 A;  1L0V A;  3C98 B;  3KV4 A;  4X0A A;  5LGN B;  3TLV A;  2FUP A;  3VR9 A;  4HWF A;  5CFT A;  1G8X A;  2ZH2 A;  5FP3 A;  9ICW A;  9ICH A;  3ZPO A;  5IWA T;  4EYU A;  4ZS2 A;  4P0A A;  3AE8 A;  5HRI A;  4YY3 T;  4F5O A;  4YLH A;  1XNR T;  2X68 A;  3MZK B;  5JTG A;  2HN1 A;  3UXO A;  2O5A A;  4DR4 T;  4RQ6 A;  1N36 T;  4JV5 T;  2JRK A;  3GMI A;  2PBI A;  4LF8 T;  4DND A;  3ER8 C;  4UD5 A;  2DCF A;  4X1Y E;  3I9Y A;  4KMC A;  4M9J A;  5C2T A;  2VKO A;  2CPT A;  4GYS A;  4OAI Z;  4OAF A;  3NRX A;  2NR4 A;  5DB8 A;  4NXT A;  3Q5X A;  1RZT A;  2ODV A;  3PJA A;  2WMN A;  4DV6 T;  2BKO A;  2WDQ A;  3B13 A;  4I4T E;  5IIM A;  2I0M A;  2WB5 A;  4PNI A;  4NLN A;  5J0X A;  4MF8 A;  5DEC A;  4UF0 A;  4LMK A;  4KLQ A;  4X4U A;  3FZM B;  2ZM6 T;  4JI2 T;  1BR2 A;  4I55 E;  7ICK A;  4AT7 A;  3H3A A;  2HHP A;  3ESL A;  4MHC A;  5AQN B;  5HRD A;  3JC6 C;  8ICQ A;  3HX0 A;  2UUC T;  4ILB A;  2UU9 T;  2MAW A;  2XAJ B;  1ZQP A;  4KLL A;  5D4B A;  4NXM T;  1LRZ A;  4I50 E;  3N9P A;  4LF5 T;  1HUZ A;  2XUE A;  2VL8 A;  5J0O A;  2YDS A;  4K96 A;  4UAW A;  4WC4 A;  3EF2 A;  4IDZ A;  4O5C A;  5KDM C;  4IG8 A;  1UUR A;  4XJE A;  1SHZ C;  4DV0 T;  4QH1 A;  3WI3 A;  5BMV E;  1V9D A;  3ANW A;  2LT3 A;  3PV0 F;  4Q25 A;  1BPZ A;  1M7K A;  3OWG A;  4QXB B;  1OED E;  2IIU A;  4U3C A;  3JPS A;  2WZH A;  4J2C A;  3AVR A;  5J2I A;  2PFO A;  1Q78 A;  4GK0 E;  1KFY A;  3B0Y A;  1NWM X;  4FHP A;  2W62 A;  5CGM A;  4DV2 T;  3ZMS B;  5CFU A;  3HKB E;  3PJA J;  3CML A;  2QA7 A;  3LBX B;  8ICT A;  5J0S A;  4M9G A;  3ZMU B;  4EB6 E;  8ICB A;  9ICV A;  1TVA A;  5D62 A;  5DDM A;  4FI5 A;  2C5K T;  3LSV A;  5FYM A;  2ZMA A;  4K99 A;  2VL0 A;  9ICP A;  3TLW A;  1IJ5 A;  3PUG A;  2BCQ A;  3IBP A;  1FJG T;  1E7P A;  4LEZ A;  4P09 A;  2V6Y B;  5HXH A;  4UBC A;  4XAX B;  1ZQX A;  4ASK A;  4RPY A;  3AA6 B;  4PFP A;  3F31 A;  4FHX A;  3RYH E;  2NWB A;  4WQK A;  2Y6X A;  3P50 A;  4E7S A;  4PPX A;  2ACX A;  1ZJM A;  2SPC A;  4LFB T;  3ZC0 A;  1ZQL A;  1W0A A;  3PUV F;  2CBI A;  1BR4 A;  2FJA A;  4EBJ A;  5JDN A;  4WC5 A;  3RJE A;  2VAS A;  3UT5 E;  2VUR A;  1XSP A;  1D0Z A;  2EWR A;  4PHE A;  3L9D A;  3L39 A;  4TZ4 C;  7ICU A;  2EHO B;  3FBL A;  3RC3 A;  4CN6 A;  4MF2 A;  2YU1 A;  3MGH A;  3S4U A;  3MCR A;  2A3D A;  1OED A;  2ACZ A;  4GYR A;  3R6N A;  4EBK A;  5DBA A;  2D0T A;  2PFP A;  5J0T A;  3Q5E A;  4AKH A;  4AT9 B;  3L3P A;  1R8A A;  3RKG A;  2MTQ A;  4JWN A;  1T98 A;  4I2J A;  5C8Y E;  5IHY A;  4DBQ A;  3ZLI A;  3M65 A;  4IGU A;  4AQG A;  2ZM8 A;  4O4J E;  5F8P A;  3WFQ E;  3RKO A;  3V7L A;  3I1A A;  2K5B B;  2W2U A;  4UD4 A;  1BPB A;  4LF7 T;  4AI6 A;  2AXD S;  1HR0 T;  5AFU L;  2A2F X;  4I2F A;  2M67 A;  5FY0 A;  2MPK A;  2CLY C;  3AU6 A;  2FJD A;  4LZD A;  4KP3 C;  1WYB A;  4PJN A;  4KLO A;  4DV1 T;  4UAZ A;  2LSY A;  4WC6 A;  2CWO A;  5CHG A;  5HRK A;  4FH3 A;  3WFR E;  2XSB A;  4O2B E;  4OYK A;  4O6A A;  4FO1 A;  4BJN A;  1ZQT A;  4X4O A;  2ISO A;  1T72 A;  4XBF B;  4DOA A;  4UIG A;  3HR0 A;  3RYF E;  2V8S V;  3GDX A;  4YTP A;  4JI0 T;  3N2G E;  3P4S A;  2IC6 A;  4KB6 A;  2LOP A;  4P2H A;  3HIY A;  1D1A A;  4WC0 A;  5HEU A;  2ZHA A;  3UUB A;  3A7M A;  2DHR A;  2X0H A;  5M4Y A;  4XRH A;  2ZHB A;  2N9D A;  1JN3 A;  2XQ5 A;  3TLT A;  2XPK A;  5FL0 A;  2E9X D;  4PFO A;  2ZH3 A;  2YU2 A;  4TWH A;  5FY1 A;  3BQI A;  4ZOL E;  2JQQ A;  4GXK A;  1WRD A;  2G0U A;  3UQ4 A;  2IW5 B;  1B7T A;  1MIW A;  5D63 A;  2K48 A;  3ZJ1 A;  4WC3 A;  4X4Q A;  1WYC A;  2M6I A;  3X1D A;  4L5G A;  4PJL A;  4H9N C;  2L9Q A;  4M9H A;  5LHI B;  5ABE A;  5H6Q B;  4I2G A;  2XQ8 A;  2LOS A;  5DKW A;  4UB2 A;  3LK9 A;  1FEW A;  3AA7 B;  4U33 A;  1ZQA A;  2WMO A;  3C51 A;  4QH5 A;  4YSY A;  5AQF B;  3P8C D;  3SRZ A;  2X9H A;  1MMA A;  4ADZ A;  5LG3 A;  1BPX A;  9ICN A;  2MOZ A;  5J0Q A;  2J1D G;  9ICG A;  2V7L A;  1KEY A;  4LEY A;  2FBW A;  3KVB A;  1MIY A;  4UF0 B;  2WDV A;  4G2A A;  5L4H A;  3FBZ A;  1QLB A;  5HRL A;  5FVK A;  5FXX A;  4I0U A;  5CJ5 A;  3EI0 A;  8ICN A;  2KLQ A;  4AT7 B;  2XHE B;  2E8I A;  4EOZ B;  1HF8 A;  3E22 E;  2E5L T;  4AKG A;  3E0Z A;  7ICQ A;  4YMO A;  2VK9 A;  5J0Y A;  4QZ9 A;  3N2K E;  1OU5 A;  3OPC A;  4RQ8 A;  2YDQ A;  5CA0 E;  2X0L B;  2X51 A;  3HA4 A;  4FHW A;  5CP2 A;  4ANJ A;  5BOM A;  5IIN A;  4R63 A;  1MQ2 A;  1MIV A;  5LJM A;  4DMW A;  2YEV C;  3AVS A;  3FZH B;  4CI1 B;  5JDM A;  3UPS A;  1E2A A;  1I6Z A;  5JDQ A;  4E7X A;  3EDU A;  3JPT A;  3Q5W A;  3I0Q A;  1ZQC A;  4CN4 A;  3PUW F;  3C4W A;  1ZQJ A;  2BKP A;  3VKH A;  3K75 D;  2M2V A;  3CX6 B;  4DR6 T;  4IQW A;  2NP9 A;  4YJ2 E;  5LMU T;  4WC2 A;  4JUY A;  4Z91 A;  4U2Y A;  2C0S A;  2WU2 A;  4K0K T;  2BG9 A;  4DUY T;  3AE9 A;  3C66 A;  4PK5 A;  2IDO B;  4NM2 A;  4HFD A;  3CKD A;  7ICT A;  4R64 A;  5DB9 A;  8ICO A;  5J2C A;  5DAB A;  3MBY A;  5CFB A;  3HJ1 A;  4E8F A;  3V72 A;  4HX0 A;  1OXZ A;  3C2M A;  4LVS A;  3G06 A;  5LJN A;  2B51 A;  2FMP A;  1UET A;  3UFE A;  2JMK A;  2F4V T;  2RP4 A;  3OJA A;  2LSJ A;  4AKL A;  3JAE A;  3WFS C;  3AQN A;  2OV9 A;  3CVR A;  4AT9 A;  1SE7 A;  1VCS A;  5AQK B;  3ZJ2 A;  1UX4 A;  2XTL A;  2E2A A;  4ZI3 C;  4WYV A;  4GXJ A;  2DRA A;  5HWY A;  2K9A A;  1GQE A;  3MXZ A;  4NXX A;  5D61 A;  4JLZ A;  3JCF A;  3N9N A;  5FXV A;  3AED A;  1UX5 A;  4CN1 A;  1J1J A;  2IHR 1;  2ZM0 A;  4DV3 T;  4UXN B;  3HW8 A;  4KI0 F;  3N9L A;  1PX5 A;  2H89 A;  2V7M A;  5CJ7 A;  1HX8 A;  1YKH B;  3RJI A;  2DVI A;  2W61 A; 
#chains in the Genus database with same CATH homology
 2BBH A;  2IUB A;  4EEB A;  2BBJ A;  2HN1 A;  5JTG A;  3CK6 A;  4EV6 A;  3NVO A;  4EGW A;  3RKG A;  4EED A;  2HN2 A;  4I0U A;  3JCF A;  3NWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...