4EEDA

Cora coiled-coil mutant under mg2+ presence
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
324
structure length
314
Chain Sequence
DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport
molecule keywords Magnesium transport protein CorA
total genus 98
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eedA01
4EEDA 3CK6A 4EGWA 4EV6A 3NWIA 4EEBA 5JTGA 2HN1A 2BBHA 2BBJA 4I0UA 3RKGA 2HN2A 2IUBA 3NVOA 3JCFA
chains in the Genus database with same CATH superfamily
5B3PA 2M2WA 3VR8A 4RQ4A 2JQ9A 1KDHA 4DBQA 3Q9DA 2W00A 2XPKA 3GA8A 3U3IA 1OEDC 3ANWB 3JPQA 3EDUA 3T8OA 2VKDA 1HFAA 4B3RT 2DLRA 3O9XA 4AKIA 3UU5A 5JQGE 4E7ZA 1D0YA 4P4PA 1ZQOA 1RZTA 3RJHA 3SRZA 1EZ3A 2JIWA 4HX0A 4G2AA 4EZ4A 4EYYR 3H37A 3ZT6A 4U3CA 1US7B 3ZYKA 2QYWA 5EZYE 5KMGP 2X51A 1UEVA 4EZHA 4EEBA 4F6RC 2B56A 4QH1A 1YW0A 1XZYA 4JLEA 3K7DA 4IHJE 3RJFA 3N2KE 4IG8A 3OVAA 5DB6A 3W15B 4KX6A 9ICRA 1FJGT 1ZJMA 2NRKA 4QZ8A 3O1JA 4JWNA 3WFRE 1J1JA 2W62A 3CMLA 2A9UA 3Q5EA 5TAOA 3AXJB 3TLUA 4XZCA 4I0UA 4B6XA 3BQKA 3OUYB 7ICMA 4DUZT 5ABGA 3UQ0A 2BG9B 4UB2A 3NRXA 4U2ZA 2E9XD 4NLZA 5FL1A 3UT5E 5HXHA 3B13A 3LQCB 4MF8A 2LSGA 2Q66A 1W0BA 3EAMA 2WQYA 1XSPA 2XAQB 1W09A 4HFIA 4E8FA 5J29A 3NWIA 5HXSA 5D49A 5L4HA 1BPZA 9ICKA 9ICTA 4DMWA 4ZI3C 2F4VT 3O1HA 4IREA 3FZFB 2AE9A 4KMCA 1ZP0A 2BCUA 3CK6A 4YT0A 4PHDA 3JZ0A 2CBJA 4K99A 1VCTA 3GWHA 2L9QA 1M62A 4YXDA 2VKJA 4Z8XA 1OEDE 2WBLA 2W2UA 8ICXA 3IEEA 4N7RA 2FMQA 2W0GA 3RX6A 5H6QB 4KLOA 4UF0B 2PTFA 4KP3C 3BQLA 2W67A 4DV7T 4L9IA 2LSJA 4I2FA 3TLTA 3N2OA 2WZHA 8ICCA 3LJCA 5LXTE 4IDPA 4J2CA 4EGWA 5FXVA 4O2BE 3N5LA 4HWDA 3J9X1 2WMNA 2OLTA 1XNRT 4A98A 5L3FB 4RT3A 4KLDA 2V7IA 4ZS3A 4AQYT 2B51A 2P9BA 3HKCE 3RRCA 2KXPB 5GONE 4KLMA 4ILAA 2HN1A 4P09A 2ISPA 5FY0A 1B7TA 2CE7A 2DHRA 4FHPA 1HUZA 3TLSA 4DR7T 4LF4T 4UB4A 2D9DA 3JADA 2ID1A 4YMNA 4DO0A 5LNKA 4DMVA 2LOSA 2NP9A 5IIKA 8ICPA 2ZH5A 5AQSB 5C2TA 1KNYA 5H6RB 1IJ6A 2IC9A 3NKUA 2PFPA 4DR2T 5LGTB 3NBXX 5KX5E 1FEWA 3J7Yq 1TFYA 2LJLA 3AE8A 5CB1A 4EEDA 1GQEA 2WSSV 3ZN0B 4RWQA 4OX9T 2E9XC 5AQIB 5F5WA 5L47A 4I2HA 5BPCA 2M6BA 2Y6XA 2QVAA 4RQ3A 3RQWA 3AA1B 4RPYA 3RH6A 2OV9A 2X68A 3MGHA 4MBQA 1OWAA 4I2DA 2BPGA 4O9MA 3GN5B 1ZQXA 4FH3A 2IMLA 3NKZA 4LEWA 3U78A 3ONJA 3PUVF 9ICUA 5LMUT 3LK3B 3RRWA 2YK0A 3HL6A 2E5VA 4AT9B 4EXTA 4DOAA 4OAGA 3A8YC 4UAYA 3AA0B 5J0UA 3PUSA 3E0ZA 3ZLIA 5FMNA 1D1BA 5DKWA 8ICWA 2HN2A 2BZBA 2LE8A 4AKHA 4O69A 3CPZA 2P66A 2BG9C 2BKNA 4PK4A 5EK2A 4M0AA 5J2FA 7ICIA 4AISA 4KB6A 4XQ8A 5LCYA 1H7CA 1WR6A 4ADZA 4Z91A 4QZ9A 4DBRA 2JMHA 4P1NA 3MGIA 2IHMA 3H3AA 4ASKA 2IHOA 5FKYA 4IE0A 4EBJA 4NM2A 4R66A 3V7LA 4AT8A 8ICRA 2YDSA 3UPQA 5TZVA 4MFAA 2DR5A 5HCMA 4UVAB 2Q9QD 4ZOLE 2B1EA 3RJKA 2PBEA 2XTLA 5FYMA 4I2BA 3EABA 1ZQFA 3RJGA 4QZCA 3UXOA 4H9RC 8ICUA 1T72A 3FHNA 4I28A 3EUHA 2DVIA 4HWFA 3SOLA 1YLQA 4XJEA 4O5EA 3PV0F 2ACZA 1NENA 3V5SA 3AE1A 3WAJA 5L3DB 7ICNA 1QSDA 2PXIA 1J5WA 4L0RA 1UGOA 2K5BB 3WAKA 2BS3A 7ICQA 2JJ9A 3JC6C 9ICCA 4GK0E 3QB5A 1ZQCA 4I29A 4U7IA 3FBZA 1YQ4A 2K48A 2VQFT 1ZQSA 2ZHAA 3ZN1B 9ICPA 4I2EA 1U4QA 2LOPA 1YD8G 3I0OA 2CWOA 4I55E 5HWXA 5LJMA 3PUXF 2ODVA 2IHR1 4Z6DA 1ZQIA 2D0TA 3PU8A 3PUZF 2N2NA 3D0TA 2X9XA 4AKLA 1UEUA 5EK4A 4UF0A 4TZ4C 2EHOC 1ZQEA 1G8XA 3UU4A 4PNIA 5FXWA 8ICFA 4I4TE 2B4VA 3JAFA 1ZOYA 2K9AA 5CHEA 4M9GA 3RC8A 4IQWA 5DECA 1OU5A 3AVSA 3P4WA 4LF5T 3ETUA 3UUNA 3VHLA 4UELA 2UXDT 4KBMB 3C5FA 4X4OA 2PJQA 3P4SA 4X0BA 5LJNA 4KLTA 4X4PA 4DIDB 2VK9A 4HGAA 4LF6T 3MACA 4IE6A 3WFSC 2VQET 4NPPA 4A97A 1YQ3A 4WZXA 4CI2B 2BCQA 1HUOA 4KLJA 4HE8A 5LMNT 1E1HB 4NM1A 3CWZB 4HN9A 3ZC1A 4QXHB 3CQGB 5HEOA 4TWDA 2IAKA 4B3MT 4QZFA 1JNRA 9ICOA 5J0OA 5KXJA 2M2VA 2FJDA 3L3PA 1HG5A 1ZJNA 3RGLA 4MF2A 4WNKA 2CBIA 3PUGA 5LB7B 2J62A 3KVAA 4Q25A 4LEYA 4OFZA 1TVAA 2GWSA 3NRYA 9ICGA 4GYSA 3ZMTB 5JDHA 3C50A 4X1IE 3PDYA 3EDVA 3FXEB 3L09A 4ZZCA 5J0SA 4UD4A 8ICBA 4DV3T 3N9PA 4JI2T 2V1DB 2FMPA 2H88A 3AXJA 3FBLA 5FNVE 3ZCJA 3TKLB 2QA7A 4HWIB 4IDZA 2K24A 1HNXT 4O68A 4AT9A 4ZS2A 3FZKB 3PJAJ 2GA9D 1X9BA 2A2FX 3VKGA 4WC2A 2W4XA 5L2LA 4FHXA 2ZM2A 4YSXA 5L3GB 3RPUA 7ICSA 2V7LA 2O1PA 4X4SA 3PMNA 5FXZA 5HAXA 4LFBT 4U33A 3UUBA 3FXDB 8ICAA 1HNWT 2W61A 3OV7A 3ONXA 3NVOA 2CLYB 4M47A 4M1PA 2M2TA 1IAPA 1X79A 4X66T 3HA4A 1UX4A 2CWYA 4YTMA 4PW8A 2D0UA 1BR0A 3RYHE 4NXVA 2YU2A 4A5XA 4QH4A 2XM1A 1HS7A 3EI0A 5A1LA 3VU7H 2V26A 5HXEA 2KINB 3UUMA 4KLFA 3N9QA 3JCFA 3AA6B 2K3WA 5HEHA 4PK6A 2UUBT 1BR1A 4GKKT 1NOMA 4GOUA 1ZEEA 4OYJA 2BE3A 4XQ7A 2X9HA 3PHZA 1T8BA 1ZHCA 4RPXA 4M9JA 3AE3A 3P4PA 2XASB 2MPKA 1BPBA 5AQGB 4DR6T 3Q2MA 2XQ9A 5J0ZA 2DL1A 4WC0A 1Q79A 4UV8B 2X0HA 3OGUA 2BKPA 2QRXA 4FH5A 2FBWA 1WR0A 3RH3A 3PUQA 9ICFA 3AAAB 5ABFB 2M2UA 3KVBA 1KNRA 1Z8UA 2WU2A 4PJLA 3N9MA 2XUEA 4QZDA 1E7PA 9ICWA 4X20E 5EK3A 1D0XA 5JDNA 3E08A 1UETA 3B0XA 3T1HT 1N36T 5IIJA 3UFEA 2IW5B 1N34T 5DB8A 4WCWA 3P4QA 3N9NA 2EWRA 3KV9A 3T1YT 1IJ5A 3DP7A 1ZQRA 4GXIA 4UB3A 5J2IA 1FIOA 4H9PC 4NXTA 4AQFA 2WDRA 3QK6A 4ILUA 2JQKA 2A3DA 3AE2A 1NO5A 4N78D 3KFWX 3RIUC 4PJMA 3TFRA 5M4YA 3GN5A 2MBGA 3B5MA 4WC4A 4WBOA 4MALA 5JR9B 3UULA 1O3XA 3M65A 3C2MA 4QZAA 3C18A 2A72A 5LA6E 3RJJA 7ICHA 4LMJA 5J2UE 2PFQA 4JI8T 5AQTB 3IHRA 4NLNA 3AAEB 4NXXA 2J1DG 4IQTA 4IDNA 4ZI3D 5BMVE 5J0QA 2FMSA 1T7SA 3QOFA 5AQOB 8ICZA 2FUPA 2ZMAA 2IIUA 4R64A 1ZQDA 4IT4A 4WQLA 5IWAT 5LHGB 5J2EA 4JBWF 2XQ3A 4NXWA 4YTNA 2I0MA 1WYBA 4K9BA 2LSKA 3RLFF 4LZGA 1HNZT 4H9NC 3PMLA 4JUYA 2PG8A 7ICRA 4EV6A 4CN4A 4JEHB 5FY1A 4E7SA 1WLXA 5CA1E 5AQRB 9ICBA 2LEHA 3RKGA 5HREA 2WCAA 2WAUA 4WW0A 7ICPA 4AT8B 3KV6A 4O5CA 3RJEA 2VURA 2E9XB 4I27A 4B3ST 3CKDA 2UUCT 3JYYA 3AEGA 3PE0A 5HRGA 4AI6A 3ZPOA 3FZMB 4AQGA 4LEZA 4WC7A 4DV2T 1MQ3A 1ZQTA 3LFMA 4UB5A 1FMVA 4DOBA 3K3OA 4NXZA 3C2KA 2Q9QC 4CQIA 3CX7B 4Z6FA 3QUJA 4XRHA 4E7XA 2VL0A 3SFDA 3ZKRA 1BPDA 1CUNA 4LF7T 2RPAA 4WOYA 1LVFA 2UXBT 1LKXA 2CXDA 3HIYA 3AE6A 2V6YB 3QB5K 4IE5A 2G0UA 3LDQB 4GXJA 1BPXA 2WP9A 5JRCB 5L3CB 1R8BA 4X0AA 3ERCC 2WWVA 5KDMC 2XQ8A 3SS1A 4CXYA 3LG7A 4PFPA 2UXXB 3F57A 4O4IE 3V7JA 2RA1A 2XJ7A 3ZMUB 3C4ZA 2BBJA 2UU9T 1XNQT 4K4IA 3RHWA 2DWGA 3VRBA 3ESLA 4K4HA 3S4UA 3NZQA 4LVSA 5J2HA 4HWCA 3PJAA 2VKOA 1KFYA 3UXPA 5LGNB 1YKHB 5DQVA 4H9OC 4X4QA 3ER8C 4TUYE 5HRKA 8ICNA 3KBUA 5DBBA 7ICJA 4JI4T 3A5XA 1OEDA 3HJ1A 3ZEFB 3P4RA 4NXNT 3Q5XA 4G63A 5C3JA 4ZI2C 3NZPA 5F2VO 2WU5A 5CJ5A 1ZQJA 2KWIB 4X62T 4X1YE 5FP3A 4GYRA 3WFOA 4NKUA 5E0OA 4QWNB 2XSBA 3AE9A 8ICIA 2NTYA 5J0RA 3HKEE 4C90A 3OPCA 4V1Av 4UIGA 4YLHA 3P50A 3VKHA 5LHIB 4U2YA 3MCRA 4LFCT 4KLUA 2MYSA 4U7YA 4PAGA 4DV4T 4GIWA 3ZSTA 5HRFA 1PX5A 2BG9E 5JDGA 1CHUA 5AQPB 4KLQA 2PFOA 2KNDA 5FXXA 2C5IT 1R8CA 3BQIA 3P8CD 4NIQA 4HEAA 2GAFD 3OVUA 3LK9A 2YEVC 3OVBA 1N33T 2J4GA 4WC6A 5HHIA 2C5JA 3KINB 3KDSE 4RWPA 1DU2A 4CI1B 3CQCB 4RQ6A 4WBYA 9ICMA 3AQNA 2YKSA 2J47A 5JR9A 1ZQUA 3ZC0A 4WQKA 1VRBA 3MKDA 4QZGA 4R63A 4OAIZ 4TUQA 3VRAA 2VANA 5LP6E 2IDOB 4ZZBA 4JV5T 2HPJA 2NW9A 2V6XA 2V5CA 2FJBA 3ZJ1A 1HX1B 3IBPA 1JN3A 4TWHA 3WI3A 4P2HA 4IQVA 4S3NA 2LHNA 2VB6A 4DV6T 5CGMA 2PBIA 2NW7A 4IIJE 2IUBA 3Q5DA 4PGYA 4U74A 1JNZA 2LM2A 3X1DA 4KLGA 5HRBA 4QXBB 4F5RA 1NEKA 4OAFA 5LOVE 3RIFA 1N32T 4ZXLA 5FY7A 1YXRA 4HFVA 5AQHB 2MOZA 5AQNB 1WRDA 2XQ4A 3AUOA 4YHHT 5HXRA 4K8VA 2WY2A 4IL4A 3SFEA 4DNDA 2V7KA 2XQ7A 4U72A 2ZH8A 2VASA 3AA7B 3OYZA 3PU3A 2YN6A 4K96A 3LK42 4UB1A 4X5VA 3ZMSB 3N2GE 4L5GA 4X4RA 1MMNA 5LGUB 1UK5A 4U31A 4IE4A 5DDMA 4IE7A 4QXCB 2IC6A 5AQLB 5DB7A 4EAHA 3LBXB 3ZT7A 5J2GA 2NWBA 3LSVA 4X65T 5HXCA 4K97A 2X0YA 3K3NA 2WWUA 4O67A 1VFGA 2FJEA 3UU6A 5JDFA 2V6YA 1ZQBA 1XDOA 4JWMA 2LSYA 4X1KE 5ABFA 2NOXA 4XAXB 2WM9A 4Z90A 3FB2A 2KSRA 2XQ5A 5IIMA 3OJAA 3WFPA 2DR9A 2NW8A 3TFSA 2VL8A 2DWKA 1WCRA 3RYCE 2JPFA 7ICOA 1IBKT 2H89A 1ZKEA 4WC1A 4QZBA 4PPXA 9ICLA 4NLKA 4QKNA 1HF8A 2MTQA 1ZQMA 4DV5T 2D5UA 4ZI2D 4EIWA 4EB6E 3A7MA 1AJ3A 3DJBA 4O8SA 2FCLA 3KV5A 2H7VC 3DTOA 2UXCT 4X5TA 1IBLT 5HCJA 2B76A 3MZKB 7ICGA 4FHVA 3ZJ2A 1TV9A 5CA7A 4IGUA 3TLWA 2X9WA 4MLKA 3C5GA 4F5QA 4GKJT 1ZQWA 3AEFA 5IILA 2HH7A 3PTRB 4F8HA 2KMFA 3F31A 5HEGA 5HRDA 4TUPA 4ERRA 4I2IA 3UXNA 4OK0A 3AEBA 5LHHB 4TUSA 2V7MA 4TWFA 3CQXC 2ZHBA 4JI1T 4H9QC 3OYXA 4HFEA 4UBCA 4RQ8A 4X4VA 3QC9A 3ZSSA 1VOMA 3I1AA 5CFUA 5IIOA 2XY8B 2YU1A 1U5PA 3CX6B 3UPSA 8ICOA 5LYJE 1RPLA 2BPCA 4HTEA 1QUUA 1SE7A 4NXUA 4EBKA 4RQ7A 4WC3A 3ISCA 3V72A 2O5AA 4M9LA 2ES0A 3HJ4A 2DRAA 1VJ7A 4UV9B 4YFSA 2N1GA 4WBNE 4M9HA 1UUSA 4MFRA 3RQUA 3ZT5A 2XSAA 5EOZA 4BJMA 2E9XA 2X9YA 4WH5A 9ICQA 4AKGA 5JDLA 4RQ5A 4DR1T 4TN7B 3L8RA 3I9YA 3RI5A 3LK2B 4QZIA 5AQUB 2C5KT 4M9NA 2UUAT 5DQWA 4LZDA 1MNDA 2ZLYA 4LFAT 5JREA 3L9DA 4LT6A 4WBZA 7ICTA 2M67A 3B57A 4M2YA 4TNVA 5IINA 1UURA 5J2CA 1L0VA 3O4XE 4ANJA 4PFOA 2Y48B 4ILBA 2DRBA 3QNUA 1HX8A 3FZHB 4K9AA 4KM5A 2VKHA 2KT9A 5JRCA 4YD1A 1JAJA 2H7OA 4QX8B 2GK9A 2ZH3A 3OVSA 5JVDE 5DEDA 4ATBA 1ZQVA 2LHRA 5D62A 4UAZA 1MMGA 5DABA 4KLHA 4DV1T 8ICJA 2EHOA 4AXPA 2KZ7B 4X4UA 3I0QA 3AVRA 4LMLA 1GPJA 2L3LA 1KEYA 3JPRA 3RYFE 5C8YE 2ZH2A 2CPTA 4WYVA 2BBHA 1G73A 2XQAA 4PJNA 4JEUB 4IQUA 3CVRA 1R8AA 4I2GA 5J2AA 4I50E 4RWOA 3Q5WA 4YSYA 3C4XA 3IF8B 4P0AA 2OA5A 4O4JE 4H63H 3RJIA 4AKRB 4P0BA 3FZLB 3P7IA 2WMOA 5BR8T 4FI5A 2QGSA 1OEDB 5JTGA 4AT7B 4MFFA 3AQLA 4TV9E 1MNEA 4LEVA 2EHOD 4K98A 3AE5A 2ZH7A 4YCXA 3OBVE 4M04A 9ICHA 2WZIA 2DI4A 2JQHA 3K1SA 4UBBA 5D4BA 4BJNA 2ZH9A 2WB5A 4UVBB 2XAJB 2CXLA 9ICEA 4O4LE 2WS3A 4LMKA 2D2SA 2E8IA 3TLVA 5AFUL 1VCSA 2CXFA 3V5UA 3EVYA 4H63V 4UAWA 1Z0PA 4BAYB 1I94T 5HC9A 2FJAA 2LKGA 3PUWF 5AQVB 3JPOA 5CA0E 8ICVA 4RQ1A 1IZNB 2XHEB 4RPZA 5IHYA 4R65A 2CHNA 3UQ4A 5L3EB 1XDPA 2Q9QA 4DV0T 3AAIA 2BCVA 3JC6D 4F5OA 1FA0A 3UU3A 4O6AA 2X66A 2PFVA 3OTOT 3N9LA 1BR2A 4CN6A 3JPNA 3AQKA 5ABEA 5AQKB 4XA5A 4PH5A 4GXKA 1ZQPA 8ICHA 2XAHB 5L3BB 4QZHA 1V9DA 3ONLC 8ICLA 5J0TA 2CLYC 1S94A 5LBQB 7ICUA 4UXNB 3JPPA 2XAGB 3JPSA 1XWMA 4YJ2E 4AIUA 4DUYT 4UD5A 2BDEA 3AU2A 5BOMA 2CRBA 2KWHA 5CFBA 2VWAA 1ZQYA 3ZYLA 5AQFB 3UQ7A 3R84B 4YHJA 4MKPA 1F5AA 2E5LT 3AB3B 3ANWA 4KI0F 3UFGA 1I6ZA 5J0PA 2PFNA 4YD2A 4IDOA 5HHHA 5DJQC 4OAHA 5ABHA 3V7KA 3MXZA 3ER9B 3RIUA 2ISOA 4Z6CA 1MIYA 4YN4A 1ZQZA 5IUXA 5J2KA 3HW8A 4DR4T 1R89A 2V7JA 5IIIA 3MBYA 5D61A 5AQJB 4HFBA 3N9OA 2WDVA 2YDQA 4KLLA 1MIWA 3K75D 2BVLA 4O4HE 1KEJA 4NKTA 4QHOA 2RFFA 4K4GA 3RF1A 1TFWA 3BK9A 4ZHQE 2XQYA 8ICYA 2XQ6A 8ICMA 2XM2A 5JDMA 3AE7A 7ICKA 4NUVA 4JLZA 2MAWA 1QLBA 5DBAA 7ICFA 3PNCA 3VR9A 2CMRA 2ZH1A 4KLEA 1BR4A 2V5DA 8ICTA 4DVDA 1D1CA 4TNWA 4LF9T 5LG3A 3OUYA 1KK7A 7ICVA 4HKAA 4JI0T 1ZQHA 3RC3A 5J2JA 2V8SV 1BPEA 1J5ET 5IYZE 4RWNA 4ISTA 2DCFA 4I2CA 4NUUA 3MK7C 2W63A 1WYCA 2AXDS 3LBXA 4DO9A 1FMWA 5JR9C 2ZH4A 4UR9A 2CA5A 3HR0A 4TURA 3ZMVB 3UQ2A 5FVKA 4YSZA 1MMAA 3JAEA 5J2DA 3EHZA 1E2AA 5AQQB 4QZEA 2ZM0A 5HRIA 2SPCA 3RIAA 5D63A 1ZQKA 1MIVA 1KNZA 3C66A 4M5DA 9ICVA 1R8IA 2BCSA 3IA3A 4AQFC 2I6HA 1IBMT 2ZH6A 4FO6A 3AU6A 4K0UA 4X4NA 5HRHA 4TX5A 2X67A 3EF2A 3GMIA 4XBFB 4KLSA 4C91A 4H9SE 2CEAA 4F5NA 4CI3B 5L4EA 7ICEA 2LLYA 4EP7A 2NTXA 5F3JA 9ICIA 8ICEA 1ZQGA 1JQRA 4F5PA 1W0AA 2L8KA 4X64T 4O2AE 1SA0E 4ILCA 8ICSA 1HCIA 4KHZF 5AQMB 4YJ3E 3L39A 4GK5E 4P4OA 2JRKA 5B3QA 3PUYF 5FVLA 4DOCA 4JI5T 5HYAA 5CFSA 5J0YA 5ADXL 2E2AA 2C0SA 4PHAA 1Q78A 4NXMT 2Z6EA 4B3TT 2BKOA 3WFQE 1XMOT 2BS4A 4JI6T 2N9DA 1MQ2A 4MFCA 2LSIA 1SHZC 4ZEYA 2LT3A 2VVNA 1KNPA 5F8PA 2LM9A 3ZMZB 5HRLA 4QH5A 5HEUA 2Y8DA 4HFHA 2ZM8A 3H38A 9ICJA 1UX5A 1W9RA 3RKOA 1BPYA 2LRKA 1HG2A 3HWTA 1S35A 1NWMX 4E80A 4XUSA 5JDQA 3MDCA 3R6NA 2WDQA 1Y01A 4QX7B 3ABVA 2M6IA 2BVMA 3AEAA 3H39A 3GDXA 2YDRA 3JPTA 3RH5A 4FHYA 2W9MA 3ETVA 5D46A 3UTKA 4CXXA 2BG9A 1HTJF 4PGXA 2NR4A 4PHPA 3F2EA 1V4AA 4I2AA 1XMQT 8ICKA 2LRLA 2I59A 2DR8A 2XZEA 4YTPA 2JMKA 2W66A 4YMOA 2BS2A 4LF8T 4A56A 4BA9A 1OXZA 5CB4E 1ZV4X 1LVKA 3H3MA 5LG4A 4YY3T 1KF6A 3MJXA 1NAFA 3RH4A 4FHWA 3ZCIA 5CFTA 4K0KT 1SUMB 3AEEA 5BOLA 3B0YA 4COFA 3NYBA 1WFDA 2LKHA 4PJJA 5J0WA 1Y64B 2DNXA 5ETWA 3G06A 3HX0A 3PUAA 1ZQAA 3UU8A 1T98A 1XSNA 9ICAA 4KUMB 5HR9A 4WC5A 3ISDA 3C64A 4ATBB 4UEMA 4I2JA 3AEDA 5LBMA 4IL9A 2EHOB 3C98B 4P4MA 1YKEB 3KBTA 1LRZA 5DDYA 3M3ZB 4OHFA 4I43B 1WOTA 4JLXA 9ICNA 2HHHT 4DR5T 4MHCA 8ICQA 2JQQA 4DR3T 4RT2A 3C51A 4Z6EA 5CHGA 5J2BA 4KHPT 9ICXA 3AE4A 3MDAA 1XSLA 3I9WA 4CN1A 2I9GA 4FO1A 4FJOA 2VVSA 3ISBA 7ICLA 3HKDE 4PK5A 3E22E 1M7KA 5CR0A 4HWHA 4AT7A 4PHEA 5CWRA 3OKQA 5HWYA 4YMMA 5CJ7A 3HKBE 2KLQA 2BCRA 5CP2A 5J1GA 2UXNB 2YINA 3AECA 4JI7T 3OWGA 2CHOA 2DR7A 2ZM6T 2BPFA 4ISSA 1ZQQA 2X0LB 8ICGA 5J0XA 3AQMA 2H3RA 4UVCB 5HEJA 4EOZB 4NY8A 4ZI7E 4IDQA 5J2TE 4HFDA 4KLIA 4TV8E 3CIRA 1HR0T 2HHPA 2ODUA 1MMDA 1UCUA 3C2LA 1JMSA 3HI2A 2HPLA 4CXWA 4O5KA 2Q9QB 2CM0A 3K8PC 3PURA 4X4TA 4RQ2A 9ICSA 5JH7E 4RQ0A 3UUXB 4CZZB 4EYUA 2XAFB 4HFCA 5FL0A 3SWHA 2ACXA 3RYIE 2CCQA 1ZQNA 3K3QC 5DBCA 2YOEA 3CX8B 4OYKA 3MA9A 1D0ZA 4JYAT 3C4WA 3O1IA 4JI3T 4PGQA 2RP4A 3ZYMA 1D1AA 3KV4A 1ZQLA 5DB9A 2R6GF
chains in the Genus database with same CATH topology
4EEDA 3CK6A 4EGWA 4EV6A 3NWIA 4EEBA 5JTGA 2HN1A 2BBHA 2BBJA 4I0UA 3RKGA 2HN2A 2IUBA 3NVOA 3JCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EED A;  3CK6 A;  4EGW A;  4EV6 A;  3NWI A;  4EEB A;  5JTG A;  2HN1 A;  2BBH A;  2BBJ A;  4I0U A;  3RKG A;  2HN2 A;  2IUB A;  3NVO A;  3JCF A; 
#chains in the Genus database with same CATH topology
 5B3P A;  2M2W A;  3VR8 A;  4RQ4 A;  2JQ9 A;  1KDH A;  4DBQ A;  3Q9D A;  2W00 A;  2XPK A;  3GA8 A;  3U3I A;  1OED C;  3ANW B;  3JPQ A;  3EDU A;  3T8O A;  2VKD A;  1HFA A;  4B3R T;  2DLR A;  3O9X A;  4AKI A;  3UU5 A;  5JQG E;  4E7Z A;  1D0Y A;  4P4P A;  1ZQO A;  1RZT A;  3RJH A;  3SRZ A;  1EZ3 A;  2JIW A;  4HX0 A;  4G2A A;  4EZ4 A;  4EYY R;  3H37 A;  3ZT6 A;  4U3C A;  1US7 B;  3ZYK A;  2QYW A;  5EZY E;  5KMG P;  2X51 A;  1UEV A;  4EZH A;  4EEB A;  4F6R C;  2B56 A;  4QH1 A;  1YW0 A;  1XZY A;  4JLE A;  3K7D A;  4IHJ E;  3RJF A;  3N2K E;  4IG8 A;  3OVA A;  5DB6 A;  3W15 B;  4KX6 A;  9ICR A;  1FJG T;  1ZJM A;  2NRK A;  4QZ8 A;  3O1J A;  4JWN A;  3WFR E;  1J1J A;  2W62 A;  3CML A;  2A9U A;  3Q5E A;  5TAO A;  3AXJ B;  3TLU A;  4XZC A;  4I0U A;  4B6X A;  3BQK A;  3OUY B;  7ICM A;  4DUZ T;  5ABG A;  3UQ0 A;  2BG9 B;  4UB2 A;  3NRX A;  4U2Z A;  2E9X D;  4NLZ A;  5FL1 A;  3UT5 E;  5HXH A;  3B13 A;  3LQC B;  4MF8 A;  2LSG A;  2Q66 A;  1W0B A;  3EAM A;  2WQY A;  1XSP A;  2XAQ B;  1W09 A;  4HFI A;  4E8F A;  5J29 A;  3NWI A;  5HXS A;  5D49 A;  5L4H A;  1BPZ A;  9ICK A;  9ICT A;  4DMW A;  4ZI3 C;  2F4V T;  3O1H A;  4IRE A;  3FZF B;  2AE9 A;  4KMC A;  1ZP0 A;  2BCU A;  3CK6 A;  4YT0 A;  4PHD A;  3JZ0 A;  2CBJ A;  4K99 A;  1VCT A;  3GWH A;  2L9Q A;  1M62 A;  4YXD A;  2VKJ A;  4Z8X A;  1OED E;  2WBL A;  2W2U A;  8ICX A;  3IEE A;  4N7R A;  2FMQ A;  2W0G A;  3RX6 A;  5H6Q B;  4KLO A;  4UF0 B;  2PTF A;  4KP3 C;  3BQL A;  2W67 A;  4DV7 T;  4L9I A;  2LSJ A;  4I2F A;  3TLT A;  3N2O A;  2WZH A;  8ICC A;  3LJC A;  5LXT E;  4IDP A;  4J2C A;  4EGW A;  5FXV A;  4O2B E;  3N5L A;  4HWD A;  3J9X 1;  2WMN A;  2OLT A;  1XNR T;  4A98 A;  5L3F B;  4RT3 A;  4KLD A;  2V7I A;  4ZS3 A;  4AQY T;  2B51 A;  2P9B A;  3HKC E;  3RRC A;  2KXP B;  5GON E;  4KLM A;  4ILA A;  2HN1 A;  4P09 A;  2ISP A;  5FY0 A;  1B7T A;  2CE7 A;  2DHR A;  4FHP A;  1HUZ A;  3TLS A;  4DR7 T;  4LF4 T;  4UB4 A;  2D9D A;  3JAD A;  2ID1 A;  4YMN A;  4DO0 A;  5LNK A;  4DMV A;  2LOS A;  2NP9 A;  5IIK A;  8ICP A;  2ZH5 A;  5AQS B;  5C2T A;  1KNY A;  5H6R B;  1IJ6 A;  2IC9 A;  3NKU A;  2PFP A;  4DR2 T;  5LGT B;  3NBX X;  5KX5 E;  1FEW A;  3J7Y q;  1TFY A;  2LJL A;  3AE8 A;  5CB1 A;  4EED A;  1GQE A;  2WSS V;  3ZN0 B;  4RWQ A;  4OX9 T;  2E9X C;  5AQI B;  5F5W A;  5L47 A;  4I2H A;  5BPC A;  2M6B A;  2Y6X A;  2QVA A;  4RQ3 A;  3RQW A;  3AA1 B;  4RPY A;  3RH6 A;  2OV9 A;  2X68 A;  3MGH A;  4MBQ A;  1OWA A;  4I2D A;  2BPG A;  4O9M A;  3GN5 B;  1ZQX A;  4FH3 A;  2IML A;  3NKZ A;  4LEW A;  3U78 A;  3ONJ A;  3PUV F;  9ICU A;  5LMU T;  3LK3 B;  3RRW A;  2YK0 A;  3HL6 A;  2E5V A;  4AT9 B;  4EXT A;  4DOA A;  4OAG A;  3A8Y C;  4UAY A;  3AA0 B;  5J0U A;  3PUS A;  3E0Z A;  3ZLI A;  5FMN A;  1D1B A;  5DKW A;  8ICW A;  2HN2 A;  2BZB A;  2LE8 A;  4AKH A;  4O69 A;  3CPZ A;  2P66 A;  2BG9 C;  2BKN A;  4PK4 A;  5EK2 A;  4M0A A;  5J2F A;  7ICI A;  4AIS A;  4KB6 A;  4XQ8 A;  5LCY A;  1H7C A;  1WR6 A;  4ADZ A;  4Z91 A;  4QZ9 A;  4DBR A;  2JMH A;  4P1N A;  3MGI A;  2IHM A;  3H3A A;  4ASK A;  2IHO A;  5FKY A;  4IE0 A;  4EBJ A;  4NM2 A;  4R66 A;  3V7L A;  4AT8 A;  8ICR A;  2YDS A;  3UPQ A;  5TZV A;  4MFA A;  2DR5 A;  5HCM A;  4UVA B;  2Q9Q D;  4ZOL E;  2B1E A;  3RJK A;  2PBE A;  2XTL A;  5FYM A;  4I2B A;  3EAB A;  1ZQF A;  3RJG A;  4QZC A;  3UXO A;  4H9R C;  8ICU A;  1T72 A;  3FHN A;  4I28 A;  3EUH A;  2DVI A;  4HWF A;  3SOL A;  1YLQ A;  4XJE A;  4O5E A;  3PV0 F;  2ACZ A;  1NEN A;  3V5S A;  3AE1 A;  3WAJ A;  5L3D B;  7ICN A;  1QSD A;  2PXI A;  1J5W A;  4L0R A;  1UGO A;  2K5B B;  3WAK A;  2BS3 A;  7ICQ A;  2JJ9 A;  3JC6 C;  9ICC A;  4GK0 E;  3QB5 A;  1ZQC A;  4I29 A;  4U7I A;  3FBZ A;  1YQ4 A;  2K48 A;  2VQF T;  1ZQS A;  2ZHA A;  3ZN1 B;  9ICP A;  4I2E A;  1U4Q A;  2LOP A;  1YD8 G;  3I0O A;  2CWO A;  4I55 E;  5HWX A;  5LJM A;  3PUX F;  2ODV A;  2IHR 1;  4Z6D A;  1ZQI A;  2D0T A;  3PU8 A;  3PUZ F;  2N2N A;  3D0T A;  2X9X A;  4AKL A;  1UEU A;  5EK4 A;  4UF0 A;  4TZ4 C;  2EHO C;  1ZQE A;  1G8X A;  3UU4 A;  4PNI A;  5FXW A;  8ICF A;  4I4T E;  2B4V A;  3JAF A;  1ZOY A;  2K9A A;  5CHE A;  4M9G A;  3RC8 A;  4IQW A;  5DEC A;  1OU5 A;  3AVS A;  3P4W A;  4LF5 T;  3ETU A;  3UUN A;  3VHL A;  4UEL A;  2UXD T;  4KBM B;  3C5F A;  4X4O A;  2PJQ A;  3P4S A;  4X0B A;  5LJN A;  4KLT A;  4X4P A;  4DID B;  2VK9 A;  4HGA A;  4LF6 T;  3MAC A;  4IE6 A;  3WFS C;  2VQE T;  4NPP A;  4A97 A;  1YQ3 A;  4WZX A;  4CI2 B;  2BCQ A;  1HUO A;  4KLJ A;  4HE8 A;  5LMN T;  1E1H B;  4NM1 A;  3CWZ B;  4HN9 A;  3ZC1 A;  4QXH B;  3CQG B;  5HEO A;  4TWD A;  2IAK A;  4B3M T;  4QZF A;  1JNR A;  9ICO A;  5J0O A;  5KXJ A;  2M2V A;  2FJD A;  3L3P A;  1HG5 A;  1ZJN A;  3RGL A;  4MF2 A;  4WNK A;  2CBI A;  3PUG A;  5LB7 B;  2J62 A;  3KVA A;  4Q25 A;  4LEY A;  4OFZ A;  1TVA A;  2GWS A;  3NRY A;  9ICG A;  4GYS A;  3ZMT B;  5JDH A;  3C50 A;  4X1I E;  3PDY A;  3EDV A;  3FXE B;  3L09 A;  4ZZC A;  5J0S A;  4UD4 A;  8ICB A;  4DV3 T;  3N9P A;  4JI2 T;  2V1D B;  2FMP A;  2H88 A;  3AXJ A;  3FBL A;  5FNV E;  3ZCJ A;  3TKL B;  2QA7 A;  4HWI B;  4IDZ A;  2K24 A;  1HNX T;  4O68 A;  4AT9 A;  4ZS2 A;  3FZK B;  3PJA J;  2GA9 D;  1X9B A;  2A2F X;  3VKG A;  4WC2 A;  2W4X A;  5L2L A;  4FHX A;  2ZM2 A;  4YSX A;  5L3G B;  3RPU A;  7ICS A;  2V7L A;  2O1P A;  4X4S A;  3PMN A;  5FXZ A;  5HAX A;  4LFB T;  4U33 A;  3UUB A;  3FXD B;  8ICA A;  1HNW T;  2W61 A;  3OV7 A;  3ONX A;  3NVO A;  2CLY B;  4M47 A;  4M1P A;  2M2T A;  1IAP A;  1X79 A;  4X66 T;  3HA4 A;  1UX4 A;  2CWY A;  4YTM A;  4PW8 A;  2D0U A;  1BR0 A;  3RYH E;  4NXV A;  2YU2 A;  4A5X A;  4QH4 A;  2XM1 A;  1HS7 A;  3EI0 A;  5A1L A;  3VU7 H;  2V26 A;  5HXE A;  2KIN B;  3UUM A;  4KLF A;  3N9Q A;  3JCF A;  3AA6 B;  2K3W A;  5HEH A;  4PK6 A;  2UUB T;  1BR1 A;  4GKK T;  1NOM A;  4GOU A;  1ZEE A;  4OYJ A;  2BE3 A;  4XQ7 A;  2X9H A;  3PHZ A;  1T8B A;  1ZHC A;  4RPX A;  4M9J A;  3AE3 A;  3P4P A;  2XAS B;  2MPK A;  1BPB A;  5AQG B;  4DR6 T;  3Q2M A;  2XQ9 A;  5J0Z A;  2DL1 A;  4WC0 A;  1Q79 A;  4UV8 B;  2X0H A;  3OGU A;  2BKP A;  2QRX A;  4FH5 A;  2FBW A;  1WR0 A;  3RH3 A;  3PUQ A;  9ICF A;  3AAA B;  5ABF B;  2M2U A;  3KVB A;  1KNR A;  1Z8U A;  2WU2 A;  4PJL A;  3N9M A;  2XUE A;  4QZD A;  1E7P A;  9ICW A;  4X20 E;  5EK3 A;  1D0X A;  5JDN A;  3E08 A;  1UET A;  3B0X A;  3T1H T;  1N36 T;  5IIJ A;  3UFE A;  2IW5 B;  1N34 T;  5DB8 A;  4WCW A;  3P4Q A;  3N9N A;  2EWR A;  3KV9 A;  3T1Y T;  1IJ5 A;  3DP7 A;  1ZQR A;  4GXI A;  4UB3 A;  5J2I A;  1FIO A;  4H9P C;  4NXT A;  4AQF A;  2WDR A;  3QK6 A;  4ILU A;  2JQK A;  2A3D A;  3AE2 A;  1NO5 A;  4N78 D;  3KFW X;  3RIU C;  4PJM A;  3TFR A;  5M4Y A;  3GN5 A;  2MBG A;  3B5M A;  4WC4 A;  4WBO A;  4MAL A;  5JR9 B;  3UUL A;  1O3X A;  3M65 A;  3C2M A;  4QZA A;  3C18 A;  2A72 A;  5LA6 E;  3RJJ A;  7ICH A;  4LMJ A;  5J2U E;  2PFQ A;  4JI8 T;  5AQT B;  3IHR A;  4NLN A;  3AAE B;  4NXX A;  2J1D G;  4IQT A;  4IDN A;  4ZI3 D;  5BMV E;  5J0Q A;  2FMS A;  1T7S A;  3QOF A;  5AQO B;  8ICZ A;  2FUP A;  2ZMA A;  2IIU A;  4R64 A;  1ZQD A;  4IT4 A;  4WQL A;  5IWA T;  5LHG B;  5J2E A;  4JBW F;  2XQ3 A;  4NXW A;  4YTN A;  2I0M A;  1WYB A;  4K9B A;  2LSK A;  3RLF F;  4LZG A;  1HNZ T;  4H9N C;  3PML A;  4JUY A;  2PG8 A;  7ICR A;  4EV6 A;  4CN4 A;  4JEH B;  5FY1 A;  4E7S A;  1WLX A;  5CA1 E;  5AQR B;  9ICB A;  2LEH A;  3RKG A;  5HRE A;  2WCA A;  2WAU A;  4WW0 A;  7ICP A;  4AT8 B;  3KV6 A;  4O5C A;  3RJE A;  2VUR A;  2E9X B;  4I27 A;  4B3S T;  3CKD A;  2UUC T;  3JYY A;  3AEG A;  3PE0 A;  5HRG A;  4AI6 A;  3ZPO A;  3FZM B;  4AQG A;  4LEZ A;  4WC7 A;  4DV2 T;  1MQ3 A;  1ZQT A;  3LFM A;  4UB5 A;  1FMV A;  4DOB A;  3K3O A;  4NXZ A;  3C2K A;  2Q9Q C;  4CQI A;  3CX7 B;  4Z6F A;  3QUJ A;  4XRH A;  4E7X A;  2VL0 A;  3SFD A;  3ZKR A;  1BPD A;  1CUN A;  4LF7 T;  2RPA A;  4WOY A;  1LVF A;  2UXB T;  1LKX A;  2CXD A;  3HIY A;  3AE6 A;  2V6Y B;  3QB5 K;  4IE5 A;  2G0U A;  3LDQ B;  4GXJ A;  1BPX A;  2WP9 A;  5JRC B;  5L3C B;  1R8B A;  4X0A A;  3ERC C;  2WWV A;  5KDM C;  2XQ8 A;  3SS1 A;  4CXY A;  3LG7 A;  4PFP A;  2UXX B;  3F57 A;  4O4I E;  3V7J A;  2RA1 A;  2XJ7 A;  3ZMU B;  3C4Z A;  2BBJ A;  2UU9 T;  1XNQ T;  4K4I A;  3RHW A;  2DWG A;  3VRB A;  3ESL A;  4K4H A;  3S4U A;  3NZQ A;  4LVS A;  5J2H A;  4HWC A;  3PJA A;  2VKO A;  1KFY A;  3UXP A;  5LGN B;  1YKH B;  5DQV A;  4H9O C;  4X4Q A;  3ER8 C;  4TUY E;  5HRK A;  8ICN A;  3KBU A;  5DBB A;  7ICJ A;  4JI4 T;  3A5X A;  1OED A;  3HJ1 A;  3ZEF B;  3P4R A;  4NXN T;  3Q5X A;  4G63 A;  5C3J A;  4ZI2 C;  3NZP A;  5F2V O;  2WU5 A;  5CJ5 A;  1ZQJ A;  2KWI B;  4X62 T;  4X1Y E;  5FP3 A;  4GYR A;  3WFO A;  4NKU A;  5E0O A;  4QWN B;  2XSB A;  3AE9 A;  8ICI A;  2NTY A;  5J0R A;  3HKE E;  4C90 A;  3OPC A;  4V1A v;  4UIG A;  4YLH A;  3P50 A;  3VKH A;  5LHI B;  4U2Y A;  3MCR A;  4LFC T;  4KLU A;  2MYS A;  4U7Y A;  4PAG A;  4DV4 T;  4GIW A;  3ZST A;  5HRF A;  1PX5 A;  2BG9 E;  5JDG A;  1CHU A;  5AQP B;  4KLQ A;  2PFO A;  2KND A;  5FXX A;  2C5I T;  1R8C A;  3BQI A;  3P8C D;  4NIQ A;  4HEA A;  2GAF D;  3OVU A;  3LK9 A;  2YEV C;  3OVB A;  1N33 T;  2J4G A;  4WC6 A;  5HHI A;  2C5J A;  3KIN B;  3KDS E;  4RWP A;  1DU2 A;  4CI1 B;  3CQC B;  4RQ6 A;  4WBY A;  9ICM A;  3AQN A;  2YKS A;  2J47 A;  5JR9 A;  1ZQU A;  3ZC0 A;  4WQK A;  1VRB A;  3MKD A;  4QZG A;  4R63 A;  4OAI Z;  4TUQ A;  3VRA A;  2VAN A;  5LP6 E;  2IDO B;  4ZZB A;  4JV5 T;  2HPJ A;  2NW9 A;  2V6X A;  2V5C A;  2FJB A;  3ZJ1 A;  1HX1 B;  3IBP A;  1JN3 A;  4TWH A;  3WI3 A;  4P2H A;  4IQV A;  4S3N A;  2LHN A;  2VB6 A;  4DV6 T;  5CGM A;  2PBI A;  2NW7 A;  4IIJ E;  2IUB A;  3Q5D A;  4PGY A;  4U74 A;  1JNZ A;  2LM2 A;  3X1D A;  4KLG A;  5HRB A;  4QXB B;  4F5R A;  1NEK A;  4OAF A;  5LOV E;  3RIF A;  1N32 T;  4ZXL A;  5FY7 A;  1YXR A;  4HFV A;  5AQH B;  2MOZ A;  5AQN B;  1WRD A;  2XQ4 A;  3AUO A;  4YHH T;  5HXR A;  4K8V A;  2WY2 A;  4IL4 A;  3SFE A;  4DND A;  2V7K A;  2XQ7 A;  4U72 A;  2ZH8 A;  2VAS A;  3AA7 B;  3OYZ A;  3PU3 A;  2YN6 A;  4K96 A;  3LK4 2;  4UB1 A;  4X5V A;  3ZMS B;  3N2G E;  4L5G A;  4X4R A;  1MMN A;  5LGU B;  1UK5 A;  4U31 A;  4IE4 A;  5DDM A;  4IE7 A;  4QXC B;  2IC6 A;  5AQL B;  5DB7 A;  4EAH A;  3LBX B;  3ZT7 A;  5J2G A;  2NWB A;  3LSV A;  4X65 T;  5HXC A;  4K97 A;  2X0Y A;  3K3N A;  2WWU A;  4O67 A;  1VFG A;  2FJE A;  3UU6 A;  5JDF A;  2V6Y A;  1ZQB A;  1XDO A;  4JWM A;  2LSY A;  4X1K E;  5ABF A;  2NOX A;  4XAX B;  2WM9 A;  4Z90 A;  3FB2 A;  2KSR A;  2XQ5 A;  5IIM A;  3OJA A;  3WFP A;  2DR9 A;  2NW8 A;  3TFS A;  2VL8 A;  2DWK A;  1WCR A;  3RYC E;  2JPF A;  7ICO A;  1IBK T;  2H89 A;  1ZKE A;  4WC1 A;  4QZB A;  4PPX A;  9ICL A;  4NLK A;  4QKN A;  1HF8 A;  2MTQ A;  1ZQM A;  4DV5 T;  2D5U A;  4ZI2 D;  4EIW A;  4EB6 E;  3A7M A;  1AJ3 A;  3DJB A;  4O8S A;  2FCL A;  3KV5 A;  2H7V C;  3DTO A;  2UXC T;  4X5T A;  1IBL T;  5HCJ A;  2B76 A;  3MZK B;  7ICG A;  4FHV A;  3ZJ2 A;  1TV9 A;  5CA7 A;  4IGU A;  3TLW A;  2X9W A;  4MLK A;  3C5G A;  4F5Q A;  4GKJ T;  1ZQW A;  3AEF A;  5IIL A;  2HH7 A;  3PTR B;  4F8H A;  2KMF A;  3F31 A;  5HEG A;  5HRD A;  4TUP A;  4ERR A;  4I2I A;  3UXN A;  4OK0 A;  3AEB A;  5LHH B;  4TUS A;  2V7M A;  4TWF A;  3CQX C;  2ZHB A;  4JI1 T;  4H9Q C;  3OYX A;  4HFE A;  4UBC A;  4RQ8 A;  4X4V A;  3QC9 A;  3ZSS A;  1VOM A;  3I1A A;  5CFU A;  5IIO A;  2XY8 B;  2YU1 A;  1U5P A;  3CX6 B;  3UPS A;  8ICO A;  5LYJ E;  1RPL A;  2BPC A;  4HTE A;  1QUU A;  1SE7 A;  4NXU A;  4EBK A;  4RQ7 A;  4WC3 A;  3ISC A;  3V72 A;  2O5A A;  4M9L A;  2ES0 A;  3HJ4 A;  2DRA A;  1VJ7 A;  4UV9 B;  4YFS A;  2N1G A;  4WBN E;  4M9H A;  1UUS A;  4MFR A;  3RQU A;  3ZT5 A;  2XSA A;  5EOZ A;  4BJM A;  2E9X A;  2X9Y A;  4WH5 A;  9ICQ A;  4AKG A;  5JDL A;  4RQ5 A;  4DR1 T;  4TN7 B;  3L8R A;  3I9Y A;  3RI5 A;  3LK2 B;  4QZI A;  5AQU B;  2C5K T;  4M9N A;  2UUA T;  5DQW A;  4LZD A;  1MND A;  2ZLY A;  4LFA T;  5JRE A;  3L9D A;  4LT6 A;  4WBZ A;  7ICT A;  2M67 A;  3B57 A;  4M2Y A;  4TNV A;  5IIN A;  1UUR A;  5J2C A;  1L0V A;  3O4X E;  4ANJ A;  4PFO A;  2Y48 B;  4ILB A;  2DRB A;  3QNU A;  1HX8 A;  3FZH B;  4K9A A;  4KM5 A;  2VKH A;  2KT9 A;  5JRC A;  4YD1 A;  1JAJ A;  2H7O A;  4QX8 B;  2GK9 A;  2ZH3 A;  3OVS A;  5JVD E;  5DED A;  4ATB A;  1ZQV A;  2LHR A;  5D62 A;  4UAZ A;  1MMG A;  5DAB A;  4KLH A;  4DV1 T;  8ICJ A;  2EHO A;  4AXP A;  2KZ7 B;  4X4U A;  3I0Q A;  3AVR A;  4LML A;  1GPJ A;  2L3L A;  1KEY A;  3JPR A;  3RYF E;  5C8Y E;  2ZH2 A;  2CPT A;  4WYV A;  2BBH A;  1G73 A;  2XQA A;  4PJN A;  4JEU B;  4IQU A;  3CVR A;  1R8A A;  4I2G A;  5J2A A;  4I50 E;  4RWO A;  3Q5W A;  4YSY A;  3C4X A;  3IF8 B;  4P0A A;  2OA5 A;  4O4J E;  4H63 H;  3RJI A;  4AKR B;  4P0B A;  3FZL B;  3P7I A;  2WMO A;  5BR8 T;  4FI5 A;  2QGS A;  1OED B;  5JTG A;  4AT7 B;  4MFF A;  3AQL A;  4TV9 E;  1MNE A;  4LEV A;  2EHO D;  4K98 A;  3AE5 A;  2ZH7 A;  4YCX A;  3OBV E;  4M04 A;  9ICH A;  2WZI A;  2DI4 A;  2JQH A;  3K1S A;  4UBB A;  5D4B A;  4BJN A;  2ZH9 A;  2WB5 A;  4UVB B;  2XAJ B;  2CXL A;  9ICE A;  4O4L E;  2WS3 A;  4LMK A;  2D2S A;  2E8I A;  3TLV A;  5AFU L;  1VCS A;  2CXF A;  3V5U A;  3EVY A;  4H63 V;  4UAW A;  1Z0P A;  4BAY B;  1I94 T;  5HC9 A;  2FJA A;  2LKG A;  3PUW F;  5AQV B;  3JPO A;  5CA0 E;  8ICV A;  4RQ1 A;  1IZN B;  2XHE B;  4RPZ A;  5IHY A;  4R65 A;  2CHN A;  3UQ4 A;  5L3E B;  1XDP A;  2Q9Q A;  4DV0 T;  3AAI A;  2BCV A;  3JC6 D;  4F5O A;  1FA0 A;  3UU3 A;  4O6A A;  2X66 A;  2PFV A;  3OTO T;  3N9L A;  1BR2 A;  4CN6 A;  3JPN A;  3AQK A;  5ABE A;  5AQK B;  4XA5 A;  4PH5 A;  4GXK A;  1ZQP A;  8ICH A;  2XAH B;  5L3B B;  4QZH A;  1V9D A;  3ONL C;  8ICL A;  5J0T A;  2CLY C;  1S94 A;  5LBQ B;  7ICU A;  4UXN B;  3JPP A;  2XAG B;  3JPS A;  1XWM A;  4YJ2 E;  4AIU A;  4DUY T;  4UD5 A;  2BDE A;  3AU2 A;  5BOM A;  2CRB A;  2KWH A;  5CFB A;  2VWA A;  1ZQY A;  3ZYL A;  5AQF B;  3UQ7 A;  3R84 B;  4YHJ A;  4MKP A;  1F5A A;  2E5L T;  3AB3 B;  3ANW A;  4KI0 F;  3UFG A;  1I6Z A;  5J0P A;  2PFN A;  4YD2 A;  4IDO A;  5HHH A;  5DJQ C;  4OAH A;  5ABH A;  3V7K A;  3MXZ A;  3ER9 B;  3RIU A;  2ISO A;  4Z6C A;  1MIY A;  4YN4 A;  1ZQZ A;  5IUX A;  5J2K A;  3HW8 A;  4DR4 T;  1R89 A;  2V7J A;  5III A;  3MBY A;  5D61 A;  5AQJ B;  4HFB A;  3N9O A;  2WDV A;  2YDQ A;  4KLL A;  1MIW A;  3K75 D;  2BVL A;  4O4H E;  1KEJ A;  4NKT A;  4QHO A;  2RFF A;  4K4G A;  3RF1 A;  1TFW A;  3BK9 A;  4ZHQ E;  2XQY A;  8ICY A;  2XQ6 A;  8ICM A;  2XM2 A;  5JDM A;  3AE7 A;  7ICK A;  4NUV A;  4JLZ A;  2MAW A;  1QLB A;  5DBA A;  7ICF A;  3PNC A;  3VR9 A;  2CMR A;  2ZH1 A;  4KLE A;  1BR4 A;  2V5D A;  8ICT A;  4DVD A;  1D1C A;  4TNW A;  4LF9 T;  5LG3 A;  3OUY A;  1KK7 A;  7ICV A;  4HKA A;  4JI0 T;  1ZQH A;  3RC3 A;  5J2J A;  2V8S V;  1BPE A;  1J5E T;  5IYZ E;  4RWN A;  4IST A;  2DCF A;  4I2C A;  4NUU A;  3MK7 C;  2W63 A;  1WYC A;  2AXD S;  3LBX A;  4DO9 A;  1FMW A;  5JR9 C;  2ZH4 A;  4UR9 A;  2CA5 A;  3HR0 A;  4TUR A;  3ZMV B;  3UQ2 A;  5FVK A;  4YSZ A;  1MMA A;  3JAE A;  5J2D A;  3EHZ A;  1E2A A;  5AQQ B;  4QZE A;  2ZM0 A;  5HRI A;  2SPC A;  3RIA A;  5D63 A;  1ZQK A;  1MIV A;  1KNZ A;  3C66 A;  4M5D A;  9ICV A;  1R8I A;  2BCS A;  3IA3 A;  4AQF C;  2I6H A;  1IBM T;  2ZH6 A;  4FO6 A;  3AU6 A;  4K0U A;  4X4N A;  5HRH A;  4TX5 A;  2X67 A;  3EF2 A;  3GMI A;  4XBF B;  4KLS A;  4C91 A;  4H9S E;  2CEA A;  4F5N A;  4CI3 B;  5L4E A;  7ICE A;  2LLY A;  4EP7 A;  2NTX A;  5F3J A;  9ICI A;  8ICE A;  1ZQG A;  1JQR A;  4F5P A;  1W0A A;  2L8K A;  4X64 T;  4O2A E;  1SA0 E;  4ILC A;  8ICS A;  1HCI A;  4KHZ F;  5AQM B;  4YJ3 E;  3L39 A;  4GK5 E;  4P4O A;  2JRK A;  5B3Q A;  3PUY F;  5FVL A;  4DOC A;  4JI5 T;  5HYA A;  5CFS A;  5J0Y A;  5ADX L;  2E2A A;  2C0S A;  4PHA A;  1Q78 A;  4NXM T;  2Z6E A;  4B3T T;  2BKO A;  3WFQ E;  1XMO T;  2BS4 A;  4JI6 T;  2N9D A;  1MQ2 A;  4MFC A;  2LSI A;  1SHZ C;  4ZEY A;  2LT3 A;  2VVN A;  1KNP A;  5F8P A;  2LM9 A;  3ZMZ B;  5HRL A;  4QH5 A;  5HEU A;  2Y8D A;  4HFH A;  2ZM8 A;  3H38 A;  9ICJ A;  1UX5 A;  1W9R A;  3RKO A;  1BPY A;  2LRK A;  1HG2 A;  3HWT A;  1S35 A;  1NWM X;  4E80 A;  4XUS A;  5JDQ A;  3MDC A;  3R6N A;  2WDQ A;  1Y01 A;  4QX7 B;  3ABV A;  2M6I A;  2BVM A;  3AEA A;  3H39 A;  3GDX A;  2YDR A;  3JPT A;  3RH5 A;  4FHY A;  2W9M A;  3ETV A;  5D46 A;  3UTK A;  4CXX A;  2BG9 A;  1HTJ F;  4PGX A;  2NR4 A;  4PHP A;  3F2E A;  1V4A A;  4I2A A;  1XMQ T;  8ICK A;  2LRL A;  2I59 A;  2DR8 A;  2XZE A;  4YTP A;  2JMK A;  2W66 A;  4YMO A;  2BS2 A;  4LF8 T;  4A56 A;  4BA9 A;  1OXZ A;  5CB4 E;  1ZV4 X;  1LVK A;  3H3M A;  5LG4 A;  4YY3 T;  1KF6 A;  3MJX A;  1NAF A;  3RH4 A;  4FHW A;  3ZCI A;  5CFT A;  4K0K T;  1SUM B;  3AEE A;  5BOL A;  3B0Y A;  4COF A;  3NYB A;  1WFD A;  2LKH A;  4PJJ A;  5J0W A;  1Y64 B;  2DNX A;  5ETW A;  3G06 A;  3HX0 A;  3PUA A;  1ZQA A;  3UU8 A;  1T98 A;  1XSN A;  9ICA A;  4KUM B;  5HR9 A;  4WC5 A;  3ISD A;  3C64 A;  4ATB B;  4UEM A;  4I2J A;  3AED A;  5LBM A;  4IL9 A;  2EHO B;  3C98 B;  4P4M A;  1YKE B;  3KBT A;  1LRZ A;  5DDY A;  3M3Z B;  4OHF A;  4I43 B;  1WOT A;  4JLX A;  9ICN A;  2HHH T;  4DR5 T;  4MHC A;  8ICQ A;  2JQQ A;  4DR3 T;  4RT2 A;  3C51 A;  4Z6E A;  5CHG A;  5J2B A;  4KHP T;  9ICX A;  3AE4 A;  3MDA A;  1XSL A;  3I9W A;  4CN1 A;  2I9G A;  4FO1 A;  4FJO A;  2VVS A;  3ISB A;  7ICL A;  3HKD E;  4PK5 A;  3E22 E;  1M7K A;  5CR0 A;  4HWH A;  4AT7 A;  4PHE A;  5CWR A;  3OKQ A;  5HWY A;  4YMM A;  5CJ7 A;  3HKB E;  2KLQ A;  2BCR A;  5CP2 A;  5J1G A;  2UXN B;  2YIN A;  3AEC A;  4JI7 T;  3OWG A;  2CHO A;  2DR7 A;  2ZM6 T;  2BPF A;  4ISS A;  1ZQQ A;  2X0L B;  8ICG A;  5J0X A;  3AQM A;  2H3R A;  4UVC B;  5HEJ A;  4EOZ B;  4NY8 A;  4ZI7 E;  4IDQ A;  5J2T E;  4HFD A;  4KLI A;  4TV8 E;  3CIR A;  1HR0 T;  2HHP A;  2ODU A;  1MMD A;  1UCU A;  3C2L A;  1JMS A;  3HI2 A;  2HPL A;  4CXW A;  4O5K A;  2Q9Q B;  2CM0 A;  3K8P C;  3PUR A;  4X4T A;  4RQ2 A;  9ICS A;  5JH7 E;  4RQ0 A;  3UUX B;  4CZZ B;  4EYU A;  2XAF B;  4HFC A;  5FL0 A;  3SWH A;  2ACX A;  3RYI E;  2CCQ A;  1ZQN A;  3K3Q C;  5DBC A;  2YOE A;  3CX8 B;  4OYK A;  3MA9 A;  1D0Z A;  4JYA T;  3C4W A;  3O1I A;  4JI3 T;  4PGQ A;  2RP4 A;  3ZYM A;  1D1A A;  3KV4 A;  1ZQL A;  5DB9 A;  2R6G F; 
#chains in the Genus database with same CATH homology
 4EED A;  3CK6 A;  4EGW A;  4EV6 A;  3NWI A;  4EEB A;  5JTG A;  2HN1 A;  2BBH A;  2BBJ A;  4I0U A;  3RKG A;  2HN2 A;  2IUB A;  3NVO A;  3JCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...