4EEDA

Cora coiled-coil mutant under mg2+ presence
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
324
structure length
314
Chain Sequence
b'DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transport protein CorA
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport
total genus 98
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eedA01
2BBHA 5JTGA 4EEDA 4I0UA 4EEBA 4EGWA 3JCFA 2HN1A 3CK6A 3NVOA 2BBJA 3NWIA 2HN2A 4EV6A 3RKGA 2IUBA
chains in the Genus database with same CATH superfamily
4P2HA 2V7MA 2A2FX 2P9BA 2X0YA 5CR0A 1YQ4A 1U4QA 5J0OA 2V5DA 5HRFA 2A9UA 3EHZA 5LG3A 3AA7B 2JJ9A 4QH4A 8ICXA 3J7Yq 4DV0T 4ERRA 1NENA 2XM2A 4QX7B 4X1KE 4CN1A 8ICGA 4QZ9A 3S4UA 5CFSA 1Z0PA 2NR4A 4ASKA 4KLDA 5EK2A 1BPXA 4YSYA 2H3RA 2IHR1 2NW9A 3Q9DA 4KLLA 2YU2A 4I2JA 3AEAA 4LFCT 2DRBA 3FZKB 4M5DA 4KLQA 4ISSA 2BKNA 3PU8A 3GMIA 1D0YA 3RJIA 4OK0A 3L09A 3ZSTA 1W0BA 2FMSA 3ZT5A 3JPSA 1ZV4X 1J1JA 4OAFA 4HFCA 4DVDA 4WC7A 3SOLA 5IIIA 2YU1A 3TLSA 1RZTA 1UGOA 4X0AA 4P0BA 2BG9C 4BJNA 2LEHA 3GWHA 2C0SA 4LFBT 2ZM2A 3AEBA 3CWZB 4EBJA 4WNKA 4H9SE 3HX0A 2CPTA 3MGIA 2KT9A 8ICNA 3NBXX 3F31A 4RQ6A 4HWDA 4PGXA 1MQ2A 4AKHA 1YW0A 1G8XA 5HR9A 4RQ0A 3Q5DA 2XQ5A 2BCVA 2DR7A 5HEOA 2YN6A 2MTQA 4K0KT 5DB7A 2ZM6T 2WMOA 4ZI2D 2VQFT 4FO6A 5F5WA 4U7IA 3ONJA 5ABEA 4UAWA 2B76A 2KMFA 2NOXA 3GN5B 5L4HA 1ZQKA 2I0MA 2MYSA 4U74A 4Q25A 3OWGA 2JQQA 3MKDA 2UUCT 3AU2A 5CHEA 1IBMT 4EXTA 4EGWA 3WAJA 2CBJA 3W15B 2V8SV 3V5SA 4DV4T 2X67A 8ICPA 5AQPB 3UUNA 7ICIA 4YLHA 5IIMA 2H88A 9ICLA 1UK5A 4HWCA 1OEDA 5HXRA 4X65T 4RQ4A 5J0PA 1ZKEA 5FNVE 3ER9B 3RH5A 2EHOC 3A5XA 4X4SA 3RIFA 4QZDA 1V4AA 2UUBT 4EP7A 2ID1A 4WYVA 1E2AA 4IHJE 4YFSA 1Q78A 3GA8A 4QH1A 3CK6A 2DVIA 4LEZA 4KLSA 2V6YA 4U3CA 1I6ZA 4CI2B 2LKHA 3O1IA 3V72A 2K9AA 2ISOA 3ANWB 9ICSA 3Q5EA 3ZT7A 2RFFA 4E7XA 5HRDA 5ABGA 2JQKA 2V26A 2DWGA 1W09A 4IL4A 4HGAA 5CA0E 4TV9E 3E08A 2XQ3A 2C5KT 1FMWA 2N9DA 4K97A 4DV5T 3VRAA 2PXIA 3DJBA 5AFUL 5HEGA 3RYCE 1E1HB 4JI4T 2M67A 4ILBA 4U31A 1W0AA 2Y48B 1XNRT 2LT3A 2LM9A 3RPUA 2LHNA 1E7PA 3AB3B 2XJ7A 5AQQB 4PAGA 2PFVA 2DL1A 4UD5A 2IC9A 4IE4A 5IUXA 5JREA 4EEBA 2VWAA 3RYHE 3MDCA 4Z6FA 4NUVA 4JV5T 2NWBA 2J4GA 2J47A 4LZGA 3FHNA 2E8IA 3C66A 4N78D 3C4XA 3KBTA 5LA6E 4NXVA 4DV6T 2X0LB 3AE7A 4XAXB 2K5BB 1CHUA 4X64T 2BG9E 4HX0A 4EOZB 3TLUA 4U33A 3RQUA 3RRWA 1ZQUA 1N34T 3UUBA 5LGTB 2ZHAA 2BKPA 3H37A 5JR9B 3QB5K 3PU3A 4ZOLE 4IT4A 2NW8A 4WC0A 4JWMA 2D0TA 3AQMA 3TLVA 4ATBA 2CLYB 8ICUA 2LSIA 4IDZA 4QZGA 4B3TT 3B0XA 1YLQA 4OHFA 4YHHT 4BA9A 2DLRA 3EUHA 4O67A 5LMUT 3PURA 2FJBA 4JLZA 3X1DA 3KV4A 4YTNA 4O6AA 1O3XA 2I59A 2WQYA 5AQFB 1LVKA 4HKAA 5B3PA 3JPQA 3NKUA 2ZM8A 2M2WA 4DR6T 4AKLA 2RA1A 4Z6DA 3FZHB 5LHGB 3OTOT 5J2AA 1MIWA 2CM0A 4CQIA 4H9NC 4RQ1A 3C5GA 1X79A 7ICHA 3ZC0A 1UURA 1G73A 2L9QA 3P4QA 4ZXLA 3PUWF 3ISBA 1XMQT 4I0UA 4OAGA 2JMHA 3C5FA 2HH7A 5HEJA 4M47A 4MBQA 4IE7A 1HNZT 5HEUA 1KF6A 4JI0T 4FI5A 3FZFB 3EDVA 1ZQWA 5DJQC 2Q9QD 4NUUA 3GN5A 4C90A 5BMVE 3P4RA 4LF7T 4I2GA 2KWHA 1N33T 5IINA 2OA5A 3O1JA 4IDNA 4HFVA 3OV7A 3RH4A 9ICQA 3H3MA 4E80A 9ICFA 4WW0A 4ISTA 2M6IA 8ICFA 5FL0A 3WFSC 3KDSE 7ICGA 1D0XA 4K9AA 3RHWA 2KXPB 1TFYA 4O69A 1UETA 3C4WA 4KHPT 3CMLA 4KB6A 3CPZA 2M2UA 2KNDA 2FMPA 3SFDA 2ZH7A 4UELA 5CFUA 5J2FA 4YJ2E 3C18A 7ICRA 3J9X1 2WCAA 2DR8A 2ZH1A 4I28A 4H9PC 4CN6A 2CEAA 4Z91A 4WQLA 9ICEA 4DIDB 4GXJA 4UAYA 2HPJA 3TLTA 4X4RA 4OYJA 3I1AA 2I9GA 3D0TA 3NZQA 2XUEA 5ABFB 3KV9A 4CN4A 1HG5A 3O9XA 4RT2A 8ICOA 5J2TE 2CHNA 4I4TE 4CXYA 2VKOA 1DU2A 4EV6A 3RKOA 5J2IA 4WC4A 7ICVA 4GOUA 5L3DB 1WR0A 9ICMA 4LEYA 3ZMUB 4UXNB 3CKDA 3N9LA 1UCUA 2EWRA 5JQGE 4K0UA 1S35A 3U78A 4P4PA 1FIOA 5JVDE 5LGNB 2W61A 8ICYA 3KVBA 3UULA 1BR1A 4PK5A 5CJ7A 3SRZA 4RT3A 4FJOA 3RRCA 3UU5A 1OWAA 4LF4T 1ZQEA 2M6BA 3K3NA 5EZYE 4K98A 4HFHA 2PFQA 4KBMB 2Q9QA 1J5ET 5HRHA 8ICCA 3NKZA 2WS3A 3JPRA 5J2CA 4LMJA 1OEDB 4ADZA 4QZ8A 3TFRA 4JYAT 4PH5A 3UFGA 5HRIA 9ICJA 3H39A 1XSPA 3CX8B 5J2GA 5IWAT 4ANJA 3TFSA 4ZEYA 5LJNA 1BR2A 3AU6A 3IHRA 2KINB 3HJ4A 2V6YB 4KLJA 5EK3A 4LFAT 3ZMTB 2V6XA 5AQVB 3OUYA 1XMOT 4H63V 2WU5A 3PJAJ 3ZYKA 1I94T 5DABA 3L9DA 1IBLT 1NOMA 4HWIB 9ICRA 5J2UE 3K7DA 2NW7A 3BQKA 4DR4T 4ZI3C 2XZEA 3M65A 1BPBA 2WZIA 3RJHA 1KFYA 4RPXA 2ODUA 3AA0B 1D0ZA 2DNXA 3I9WA 2DI4A 5JDMA 2XAQB 1HS7A 2QVAA 3MBYA 3V7KA 3WFRE 4M9HA 2V7LA 3H38A 1ZQOA 5LMNT 4XQ7A 4X4TA 2ZH8A 8ICBA 4XZCA 2VANA 3MJXA 5D62A 5L2LA 5HRGA 2D9DA 2FJAA 2VKHA 1XSNA 4XJEA 4YMMA 1ZQDA 2ZHBA 5FKYA 4MF8A 2WDVA 4TWDA 3FBZA 4C91A 4XQ8A 4PHEA 4DR3T 3AEGA 1IZNB 4O2BE 4A56A 4I2BA 4O5KA 5J2JA 5IIKA 5DECA 4GYRA 5ADXL 3ABVA 3VKGA 4TNWA 4QKNA 2AE9A 4X0BA 8ICEA 3SWHA 4AT8A 2FUPA 2C5JA 4QWNB 3RYFE 2WMNA 2P66A 4AKRB 5LB7B 1VOMA 4R66A 1ZOYA 4UF0B 1BR0A 2WAUA 1YKHB 3C2KA 4UIGA 3UTKA 4IE6A 4GYSA 1T7SA 2X51A 1ZQBA 1VFGA 1MNDA 4ATBB 3PUAA 2IHMA 4RWNA 2BVLA 5AQRB 4O9MA 4E8FA 5L3CB 3LG7A 4K96A 3RX6A 4RWPA 4IQWA 2IUBA 3E22E 4DMWA 4X1IE 5EK4A 1S94A 2XY8B 4YY3T 4ILUA 5CP2A 3EVYA 5LG4A 3LK42 3ZKRA 1OU5A 3V5UA 5J0UA 2W4XA 1MMDA 2BKOA 2ODVA 3K8PC 4FH3A 4F5OA 3HKDE 4G2AA 5ABFA 1ZEEA 2WDQA 1WYCA 4LZDA 5F2VO 3ERCC 1ZQLA 4RQ3A 4OX9T 2NRKA 1Z8UA 2K48A 1HUZA 2HPLA 2G0UA 4NM1A 3WFOA 4I2AA 3OVUA 2LSYA 7ICEA 4DBQA 4PGYA 1ZQNA 4YSZA 1TFWA 1ZQAA 5BR8T 4L0RA 5AQJB 2H89A 4LMLA 4YCXA 4UEMA 4JUYA 1M7KA 3JC6C 4AKGA 2BPCA 1YQ3A 4Z8XA 1KNPA 4HFBA 5BOLA 2ZH6A 3MZKB 4AT7B 3IF8B 5FY7A 3RIUA 1ZQQA 4A98A 1ZQIA 4YMNA 1XSLA 4ZI7E 3OJAA 4P09A 1KNYA 1D1CA 4CI1B 3Q5WA 2PFNA 4LF9T 5LXTE 1H7CA 3WAKA 2E2AA 4NXZA 1ZQTA 3ZT6A 1XNQT 1LRZA 4X4VA 3AVSA 1BPEA 5J0RA 5J2HA 5J0ZA 2O5AA 4U2ZA 2CLYC 4M9NA 4UB3A 5AQKB 1T8BA 4KMCA 3K75D 2WZHA 3R84B 3ZYLA 2ZH9A 3VKHA 3JPPA 2WWUA 4I2HA 2X9WA 1QUUA 2OV9A 9ICGA 4M9JA 8ICJA 2UXBT 2PBIA 3BK9A 5FVKA 5C8YE 2QA7A 4UB5A 1UEUA 4HWFA 2Z6EA 2LSJA 4ZHQE 4JI6T 2CBIA 4AQFC 3AAIA 3AQKA 5KMGP 3VU7H 5HREA 3B0YA 3RIAA 1ZQXA 5JTGA 4LEVA 4PJJA 4S3NA 7ICQA 4H9OC 4HE8A 1MMNA 2W67A 4FHWA 8ICKA 3CIRA 2JRKA 4TV8E 5IYZE 4WBYA 2N2NA 4YT0A 2UXDT 4XRHA 4I27A 4DOBA 4KX6A 5AQLB 2VVSA 5JDLA 4UVCB 4UVAB 4WQKA 2K3WA 4KLUA 4HN9A 4TX5A 3AE2A 3ONXA 4X20E 4ZI3D 5JRCB 5LP6E 4ILCA 2Q9QB 3JZ0A 8ICWA 4I2EA 1U5PA 4KP3C 5HRBA 2GAFD 4FHVA 2VL0A 4J2CA 4PJMA 2PJQA 2UUAT 4M0AA 2VB6A 1L0VA 5AQIB 4NXTA 3AVRA 2V1DB 4JBWF 4E7SA 4FO1A 1KEJA 2LOPA 3B5MA 3OBVE 3PUZF 5DKWA 4ILAA 2O1PA 2PFPA 4PFOA 2YK0A 4PPXA 2WU2A 3AE3A 2JMKA 1YD8G 5CJ5A 3AE5A 4TUPA 3F2EA 5KX5E 5DB9A 3PHZA 3K3OA 5DB8A 4IL9A 4YD1A 7ICTA 2CWYA 2BCSA 1HCIA 4ZS3A 3HWTA 4WC5A 2B56A 4UV9B 2WY2A 4UF0A 5DBBA 3AXJA 4O5CA 3ESLA 3ZCIA 3JAEA 4LF6T 4DV7T 3ZPOA 2JQ9A 2KZ7B 3UQ4A 2DHRA 2WDRA 3OUYB 9ICUA 1WR6A 5J2BA 3OKQA 3P8CD 5IILA 1HG2A 5L3EB 2MAWA 2YDSA 4M9LA 7ICLA 4AIUA 3QB5A 3VHLA 5HXEA 3JCFA 2BE3A 4DMVA 4TUSA 1R8AA 2PBEA 4A97A 3EABA 4TURA 2Q66A 1ZQVA 4AT9B 3K3QC 3QUJA 4JEUB 3IBPA 5H6RB 2VASA 3OVSA 3RJGA 1WFDA 3AECA 1IBKT 4WOYA 2E9XC 4B6XA 3RH3A 2XSBA 1WLXA 2FJDA 2V7KA 9ICIA 1R8BA 4K9BA 3KINB 4HFDA 3WI3A 3T1HT 4GKKT 3HJ1A 4I2CA 4HFIA 1CUNA 5LHIB 7ICFA 4K4GA 4H9RC 3UXOA 4WC6A 2XQ4A 4IDPA 2LJLA 1UUSA 4MLKA 5FXWA 4KLIA 3HR0A 1HNXT 2W66A 3EAMA 3UFEA 4F8HA 4QXHB 4G63A 2PTFA 4RWOA 2I6HA 5JDGA 2ZH2A 4TWFA 4AQYT 3CQXC 4X66T 1ZQMA 2D0UA 1JNRA 4JI2T 2LKGA 3C4ZA 1KEYA 5HWXA 4AT8B 4JEHB 8ICSA 3UU6A 1OEDC 2XQ6A 3Q5XA 3A7MA 5B3QA 3VR8A 5GONE 4MKPA 3ZN1B 3FB2A 3AAAB 4M04A 2J1DG 4AT7A 7ICMA 5TAOA 5LNKA 3PUGA 1Y01A 1XDOA 4WC2A 4EYYR 3UU4A 4DR7T 2N1GA 1FMVA 3A8YC 4R63A 5JDFA 5LGUB 4LEWA 4YTPA 1ZQFA 3N9OA 3PMLA 2IC6A 1ZQJA 2VQET 5FXXA 4JI5T 3JC6D 2W63A 5AQUB 3C51A 4I2IA 4O8SA 4KLFA 2H7VC 3PDYA 3HW8A 1J5WA 3RJFA 4NLKA 2WWVA 4JLXA 4KM5A 2JPFA 2ZLYA 2NTYA 1UX4A 4JI1T 9ICHA 4WC1A 1SE7A 4RPZA 2EHOD 4YSXA 4UVBB 3P7IA 3AE9A 1R8IA 4AKIA 2B4VA 4COFA 2CE7A 2GWSA 4R64A 3NZPA 4ZI2C 2K24A 2CXLA 5HYAA 4PK6A 4PK4A 1XZYA 3LK3B 4EB6E 4KLMA 4GXIA 3U3IA 5D49A 4XUSA 4IREA 2BG9A 3L39A 5L47A 3B57A 5IHYA 4I50E 4EZHA 4LVSA 1MQ3A 1YXRA 3ZCJA 2CWOA 4RWQA 4MHCA 4YD2A 2CMRA 4PJLA 3QC9A 5D61A 5J0WA 3FXDB 5JRCA 5DQWA 1ZQHA 2FCLA 4NIQA 1R89A 4U2YA 5EOZA 4KLGA 2LLYA 4WCWA 3UPQA 3AEEA 2KLQA 1YKEB 5HCJA 3LFMA 3JYYA 4L5GA 2XAGB 2BCRA 4NLNA 3LSVA 2NP9A 4GIWA 3RGLA 2A3DA 2BBHA 4RPYA 3UU8A 2WSSV 1XDPA 4NXWA 3ZYMA 3PE0A 5C2TA 3JPOA 3V7JA 1WYBA 1ZP0A 3MACA 3SFEA 4IQUA 3E0ZA 4GKJT 4YJ3E 4JLEA 2ZMAA 3AA6B 5LBMA 4PNIA 2ZM0A 3AA1B 5F8PA 1FA0A 3M3ZB 2QYWA 2A72A 5M4YA 3UQ0A 2IMLA 3AE1A 3UUMA 4O4LE 2XASB 4H63H 2MBGA 4UB2A 4DV2T 1ZQPA 5HXSA 4AT9A 4CXWA 2EHOA 3LK9A 2YDRA 1PX5A 3N9PA 5J2KA 3FBLA 4QZFA 5AQGB 3GDXA 2VVNA 1QSDA 3HA4A 4X4OA 4QZHA 2ZH5A 3N9QA 1RPLA 4M1PA 3DP7A 1VRBA 1MNEA 2XQ9A 9ICOA 3UQ7A 1KNZA 3RLFF 4X4UA 4GK5E 5FL1A 2Y6XA 1F5AA 2B1EA 2PG8A 2VKDA 1HX8A 3AE8A 5AQOB 5HWYA 4X62T 1OEDE 3RJJA 3LBXB 3B13A 4X5TA 3VR9A 3OVAA 1BR4A 3KVAA 2V5CA 3T1YT 2E9XD 4Z6CA 1ZQRA 3P4PA 3AE6A 5F3JA 5IIOA 1SA0E 3PUSA 5E0OA 4PHPA 4B3ST 3WFQE 3ONLC 2SPCA 4JI8T 5CA7A 3UXPA 4RQ5A 3C64A 2YINA 8ICHA 4NXUA 2ISPA 2FJEA 1IAPA 4OFZA 5D63A 3RH6A 3MK7C 4CI3B 4I29A 5CB1A 4F5QA 4WZXA 3MDAA 4F5RA 3AXJB 5LJMA 3PUQA 4OAHA 5JDQA 2DR5A 1MIVA 3OVBA 3LJCA 5AQHB 1US7B 4NLZA 2FBWA 2WP9A 5IIJA 2XQ7A 2LRKA 1X9BA 2JQHA 9ICNA 4I2FA 4L9IA 5J1GA 4O2AE 1AJ3A 3AAEB 4WBNE 3IEEA 3AQLA 5CFTA 4EZ4A 1MMAA 5FY1A 4BJMA 3ZC1A 1JN3A 2L3LA 5CWRA 4QZIA 1D1AA 2OLTA 7ICPA 9ICAA 1JNZA 3CX7B 4DOCA 3AQNA 4X1YE 1QLBA 4KHZF 4NM2A 1N36T 3WFPA 3HKCE 4UR9A 4YXDA 3MXZA 4IE5A 2XQYA 1IJ6A 4I2DA 3NRXA 4ZZCA 4PW8A 1VJ7A 4LF5T 2LSKA 1WCRA 2KSRA 4FHYA 1HX1B 2FMQA 2VKJA 3ZMZB 4UBBA 4JI3T 1GQEA 2HN1A 4DNDA 4JWNA 1BPDA 2WBLA 5J2EA 2Q9QC 2XPKA 2CA5A 2LM2A 2E9XA 4TN7B 1ZJNA 3I9YA 2XQ8A 4A5XA 2UXNB 3F57A 3I0QA 4LT6A 4P4OA 4TUYE 3EF2A 4YN4A 5A1LA 9ICKA 4FH5A 4F5PA 8ICZA 4DUYT 3Q2MA 2X68A 4LF8T 4PGQA 3O1HA 5CB4E 4AI6A 3NYBA 2VK9A 5CFBA 4HTEA 5FVLA 2W62A 4GXKA 4U7YA 1EZ3A 3V7LA 3HKEE 4U72A 4KLHA 5JDHA 4X4PA 4KLTA 4I43B 1HTJF 4WBOA 4QZCA 2IAKA 2CRBA 5HRLA 1B7TA 4DR5T 2D2SA 2QGSA 4IDOA 4DV1T 5JR9C 1ZHCA 4ZS2A 5J2DA 4MFCA 2BS4A 4UBCA 2IIUA 5FYMA 1Q79A 3EI0A 3PV0F 2BVMA 1D1BA 3JADA 2C5IT 1ZQCA 8ICAA 4MFFA 3ER8C 4DOAA 9ICVA 4HWHA 2MOZA 2DR9A 4K4HA 4DBRA 4MFAA 5HCMA 5HHIA 4PHDA 2BS3A 1ZQZA 4V1Av 2BPFA 3AEDA 3AUOA 4QXBB 2BG9B 2YOEA 2CXFA 2IDOB 3H3AA 4YTMA 2BPGA 2XTLA 3C50A 4PJNA 4DR2T 1GPJA 4YMOA 1TVAA 5L3GB 2BZBA 4QZAA 4P1NA 9ICBA 5HHHA 2AXDS 4WC3A 2UU9T 5BOMA 2UXCT 3RF1A 3L8RA 4XA5A 2LSGA 5ABHA 9ICCA 2V7JA 2W00A 3LBXA 5HC9A 4TNVA 3N5LA 7ICNA 3RC3A 8ICRA 2JIWA 2WM9A 3O4XE 3KV5A 3RJKA 3VRBA 3I0OA 4I55E 5D4BA 3C2LA 3G06A 3PNCA 4P4MA 9ICWA 3CQCB 3ETVA 3PUXF 4Z90A 3ZJ2A 4O4JE 4MF2A 1ZJMA 4DO0A 3RC8A 3ZMSB 3C2MA 3FZMB 5JH7E 3BQIA 2DWKA 2HHHT 3RJEA 4EEDA 2BS2A 3JAFA 4QX8B 4MALA 4QHOA 5AQMB 4OAIZ 3HL6A 1VCSA 1HF8A 3NRYA 1UEVA 5J0QA 1W9RA 3NVOA 2WB5A 2B51A 1IJ5A 4DR1T 4FHPA 2IW5B 2X9YA 2LE8A 5LYJE 1LKXA 3RI5A 4BAYB 4QXCB 4EBKA 2GK9A 4X4QA 2R6GF 2EHOB 5BPCA 2ACZA 1HR0T 4EIWA 3L3PA 8ICQA 4H9QC 5FMNA 5HRKA 4NKUA 4XBFB 3JPTA 7ICJA 1FEWA 9ICXA 1MIYA 3PUYF 2V7IA 4OYKA 3ZJ1A 1KDHA 8ICLA 2CXDA 4TUQA 4AXPA 2DCFA 5KXJA 4KLEA 5HXHA 3N2GE 3N2KE 1WOTA 3UXNA 5AQSB 3MCRA 4QZEA 3LDQB 3ISDA 3N2OA 3CX6B 4DUZT 4QH5A 4M9GA 1ZQYA 4WBZA 1OXZA 5J29A 2X9XA 4F6RC 2XAJB 5CHGA 3ISCA 3N9MA 4AQGA 1V9DA 4CXXA 3FZLB 3UU3A 2BCQA 4X4NA 4NXXA 5KDMC 3ZSSA 5CGMA 4NXMT 1XWMA 2RPAA 4ZZBA 4R65A 1LVFA 3P4WA 1UX5A 3CVRA 4KI0F 2Y8DA 3RIUC 3UQ2A 4EAHA 1SUMB 5DBCA 1R8CA 4GK0E 4NKTA 1NO5A 4E7ZA 3LQCB 1NEKA 8ICMA 3EDUA 5CA1E 3AEFA 1VCTA 3UT5E 4NXNT 4PFPA 2X0HA 4RQ7A 3PUVF 3SS1A 5ETWA 4HEAA 2XAFB 7ICKA 2IHOA 2KWIB 2W2UA 5AQNB 4NPPA 4UD4A 3NWIA 4Z6EA 4KLOA 4YHJA 4IG8A 2QRXA 2H7OA 1JMSA 5DDYA 5L4EA 5AQTB 4UB1A 2UXXB 2BDEA 3DTOA 8ICVA 4CZZB 5DDMA 3QK6A 3R6NA 2X9HA 5C3JA 1T98A 1N32T 1ZQGA 4LMKA 1KK7A 2XSAA 2LOSA 4QZBA 2J62A 4O4IE 7ICSA 1JAJA 3MA9A 5FXVA 3TKLB 3AE4A 3IA3A 4B3RT 3UPSA 2YKSA 1NAFA 4UB4A 5L3FB 4AISA 2D5UA 2DRAA 4KUMB 3ZLIA 2XHEB 4PHAA 2PFOA 2CHOA 3N9NA 1TV9A 3PTRB 1Y64B 4O4HE 5J0TA 4MFRA 3ANWA 4TWHA 2XAHB 2E9XB 1MMGA 3P50A 4IIJE 5FY0A 3KFWX 3BQLA 5HXCA 1ZQSA 5DEDA 2M2VA 4N7RA 3RYIE 4EYUA 2YEVC 2BBJA 2MPKA 4O5EA 4O68A 3OYXA 4JI7T 3RQWA 4X5VA 1FJGT 4F5NA 3T8OA 5HAXA 8ICIA 4IDQA 4TZ4C 3OGUA 2ZH3A 4IQTA 2BCUA 3UUXB 4P0AA 8ICTA 2ES0A 4DV3T 2LRLA 1BPZA 2W0GA 3MGHA 2VURA 1NWMX 2M2TA 3ETUA 3FXEB 5J0YA 9ICTA 3ZEFB 2VL8A 5LBQB 5LOVE 2CCQA 3K1SA 5L3BB 4IGUA 2NTXA 5DB6A 4RQ2A 2RP4A 1SHZC 2XM1A 1HFAA 1T72A 2X66A 7ICUA 9ICPA 4UV8B 1HNWT 3KV6A 2W9MA 4K99A 3KBUA 3P4SA 1HUOA 4RQ8A 7ICOA 3PJAA 4NY8A 4IQVA 3HKBE 1BPYA 3RKGA 5LHHB 3JPNA 4WH5A 2GA9D 2LHRA 5JR9A 2F4VT 2ZH4A 3ZN0B 3QOFA 4M2YA 3HIYA 5DBAA 3C98B 5HEHA 5DQVA 2HHPA 4UAZA 5JDNA 3PMNA 4K4IA 5FP3A 2YDQA 5H6QB 4HFEA 2E5VA 4B3MT 2L8KA 3QNUA 3LK2B 3HI2A 3OYZA 5J0SA 5D46A 3ZMVB 4IE0A 3TLWA 4DO9A 3OPCA 5FXZA 1JQRA 4FHXA 2XQAA 2ACXA 1KNRA 5TZVA 5LCYA 3CQGB 1M62A 2E5LT 1WRDA 4AQFA 2HN2A 4K8VA 5J0XA
chains in the Genus database with same CATH topology
2BBHA 5JTGA 4EEDA 4I0UA 4EEBA 4EGWA 3JCFA 2HN1A 3CK6A 3NVOA 2BBJA 3NWIA 2HN2A 4EV6A 3RKGA 2IUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBH A;  5JTG A;  4EED A;  4I0U A;  4EEB A;  4EGW A;  3JCF A;  2HN1 A;  3CK6 A;  3NVO A;  2BBJ A;  3NWI A;  2HN2 A;  4EV6 A;  3RKG A;  2IUB A; 
#chains in the Genus database with same CATH topology
 4P2H A;  2V7M A;  2A2F X;  2P9B A;  2X0Y A;  5CR0 A;  1YQ4 A;  1U4Q A;  5J0O A;  2V5D A;  5HRF A;  2A9U A;  3EHZ A;  5LG3 A;  3AA7 B;  2JJ9 A;  4QH4 A;  8ICX A;  3J7Y q;  4DV0 T;  4ERR A;  1NEN A;  2XM2 A;  4QX7 B;  4X1K E;  4CN1 A;  8ICG A;  4QZ9 A;  3S4U A;  5CFS A;  1Z0P A;  2NR4 A;  4ASK A;  4KLD A;  5EK2 A;  1BPX A;  4YSY A;  2H3R A;  2IHR 1;  2NW9 A;  3Q9D A;  4KLL A;  2YU2 A;  4I2J A;  3AEA A;  4LFC T;  2DRB A;  3FZK B;  4M5D A;  4KLQ A;  4ISS A;  2BKN A;  3PU8 A;  3GMI A;  1D0Y A;  3RJI A;  4OK0 A;  3L09 A;  3ZST A;  1W0B A;  2FMS A;  3ZT5 A;  3JPS A;  1ZV4 X;  1J1J A;  4OAF A;  4HFC A;  4DVD A;  4WC7 A;  3SOL A;  5III A;  2YU1 A;  3TLS A;  1RZT A;  1UGO A;  4X0A A;  4P0B A;  2BG9 C;  4BJN A;  2LEH A;  3GWH A;  2C0S A;  4LFB T;  2ZM2 A;  3AEB A;  3CWZ B;  4EBJ A;  4WNK A;  4H9S E;  3HX0 A;  2CPT A;  3MGI A;  2KT9 A;  8ICN A;  3NBX X;  3F31 A;  4RQ6 A;  4HWD A;  4PGX A;  1MQ2 A;  4AKH A;  1YW0 A;  1G8X A;  5HR9 A;  4RQ0 A;  3Q5D A;  2XQ5 A;  2BCV A;  2DR7 A;  5HEO A;  2YN6 A;  2MTQ A;  4K0K T;  5DB7 A;  2ZM6 T;  2WMO A;  4ZI2 D;  2VQF T;  4FO6 A;  5F5W A;  4U7I A;  3ONJ A;  5ABE A;  4UAW A;  2B76 A;  2KMF A;  2NOX A;  3GN5 B;  5L4H A;  1ZQK A;  2I0M A;  2MYS A;  4U74 A;  4Q25 A;  3OWG A;  2JQQ A;  3MKD A;  2UUC T;  3AU2 A;  5CHE A;  1IBM T;  4EXT A;  4EGW A;  3WAJ A;  2CBJ A;  3W15 B;  2V8S V;  3V5S A;  4DV4 T;  2X67 A;  8ICP A;  5AQP B;  3UUN A;  7ICI A;  4YLH A;  5IIM A;  2H88 A;  9ICL A;  1UK5 A;  4HWC A;  1OED A;  5HXR A;  4X65 T;  4RQ4 A;  5J0P A;  1ZKE A;  5FNV E;  3ER9 B;  3RH5 A;  2EHO C;  3A5X A;  4X4S A;  3RIF A;  4QZD A;  1V4A A;  2UUB T;  4EP7 A;  2ID1 A;  4WYV A;  1E2A A;  4IHJ E;  4YFS A;  1Q78 A;  3GA8 A;  4QH1 A;  3CK6 A;  2DVI A;  4LEZ A;  4KLS A;  2V6Y A;  4U3C A;  1I6Z A;  4CI2 B;  2LKH A;  3O1I A;  3V72 A;  2K9A A;  2ISO A;  3ANW B;  9ICS A;  3Q5E A;  3ZT7 A;  2RFF A;  4E7X A;  5HRD A;  5ABG A;  2JQK A;  2V26 A;  2DWG A;  1W09 A;  4IL4 A;  4HGA A;  5CA0 E;  4TV9 E;  3E08 A;  2XQ3 A;  2C5K T;  1FMW A;  2N9D A;  4K97 A;  4DV5 T;  3VRA A;  2PXI A;  3DJB A;  5AFU L;  5HEG A;  3RYC E;  1E1H B;  4JI4 T;  2M67 A;  4ILB A;  4U31 A;  1W0A A;  2Y48 B;  1XNR T;  2LT3 A;  2LM9 A;  3RPU A;  2LHN A;  1E7P A;  3AB3 B;  2XJ7 A;  5AQQ B;  4PAG A;  2PFV A;  2DL1 A;  4UD5 A;  2IC9 A;  4IE4 A;  5IUX A;  5JRE A;  4EEB A;  2VWA A;  3RYH E;  3MDC A;  4Z6F A;  4NUV A;  4JV5 T;  2NWB A;  2J4G A;  2J47 A;  4LZG A;  3FHN A;  2E8I A;  3C66 A;  4N78 D;  3C4X A;  3KBT A;  5LA6 E;  4NXV A;  4DV6 T;  2X0L B;  3AE7 A;  4XAX B;  2K5B B;  1CHU A;  4X64 T;  2BG9 E;  4HX0 A;  4EOZ B;  3TLU A;  4U33 A;  3RQU A;  3RRW A;  1ZQU A;  1N34 T;  3UUB A;  5LGT B;  2ZHA A;  2BKP A;  3H37 A;  5JR9 B;  3QB5 K;  3PU3 A;  4ZOL E;  4IT4 A;  2NW8 A;  4WC0 A;  4JWM A;  2D0T A;  3AQM A;  3TLV A;  4ATB A;  2CLY B;  8ICU A;  2LSI A;  4IDZ A;  4QZG A;  4B3T T;  3B0X A;  1YLQ A;  4OHF A;  4YHH T;  4BA9 A;  2DLR A;  3EUH A;  4O67 A;  5LMU T;  3PUR A;  2FJB A;  4JLZ A;  3X1D A;  3KV4 A;  4YTN A;  4O6A A;  1O3X A;  2I59 A;  2WQY A;  5AQF B;  1LVK A;  4HKA A;  5B3P A;  3JPQ A;  3NKU A;  2ZM8 A;  2M2W A;  4DR6 T;  4AKL A;  2RA1 A;  4Z6D A;  3FZH B;  5LHG B;  3OTO T;  5J2A A;  1MIW A;  2CM0 A;  4CQI A;  4H9N C;  4RQ1 A;  3C5G A;  1X79 A;  7ICH A;  3ZC0 A;  1UUR A;  1G73 A;  2L9Q A;  3P4Q A;  4ZXL A;  3PUW F;  3ISB A;  1XMQ T;  4I0U A;  4OAG A;  2JMH A;  3C5F A;  2HH7 A;  5HEJ A;  4M47 A;  4MBQ A;  4IE7 A;  1HNZ T;  5HEU A;  1KF6 A;  4JI0 T;  4FI5 A;  3FZF B;  3EDV A;  1ZQW A;  5DJQ C;  2Q9Q D;  4NUU A;  3GN5 A;  4C90 A;  5BMV E;  3P4R A;  4LF7 T;  4I2G A;  2KWH A;  1N33 T;  5IIN A;  2OA5 A;  3O1J A;  4IDN A;  4HFV A;  3OV7 A;  3RH4 A;  9ICQ A;  3H3M A;  4E80 A;  9ICF A;  4WW0 A;  4IST A;  2M6I A;  8ICF A;  5FL0 A;  3WFS C;  3KDS E;  7ICG A;  1D0X A;  4K9A A;  3RHW A;  2KXP B;  1TFY A;  4O69 A;  1UET A;  3C4W A;  4KHP T;  3CML A;  4KB6 A;  3CPZ A;  2M2U A;  2KND A;  2FMP A;  3SFD A;  2ZH7 A;  4UEL A;  5CFU A;  5J2F A;  4YJ2 E;  3C18 A;  7ICR A;  3J9X 1;  2WCA A;  2DR8 A;  2ZH1 A;  4I28 A;  4H9P C;  4CN6 A;  2CEA A;  4Z91 A;  4WQL A;  9ICE A;  4DID B;  4GXJ A;  4UAY A;  2HPJ A;  3TLT A;  4X4R A;  4OYJ A;  3I1A A;  2I9G A;  3D0T A;  3NZQ A;  2XUE A;  5ABF B;  3KV9 A;  4CN4 A;  1HG5 A;  3O9X A;  4RT2 A;  8ICO A;  5J2T E;  2CHN A;  4I4T E;  4CXY A;  2VKO A;  1DU2 A;  4EV6 A;  3RKO A;  5J2I A;  4WC4 A;  7ICV A;  4GOU A;  5L3D B;  1WR0 A;  9ICM A;  4LEY A;  3ZMU B;  4UXN B;  3CKD A;  3N9L A;  1UCU A;  2EWR A;  5JQG E;  4K0U A;  1S35 A;  3U78 A;  4P4P A;  1FIO A;  5JVD E;  5LGN B;  2W61 A;  8ICY A;  3KVB A;  3UUL A;  1BR1 A;  4PK5 A;  5CJ7 A;  3SRZ A;  4RT3 A;  4FJO A;  3RRC A;  3UU5 A;  1OWA A;  4LF4 T;  1ZQE A;  2M6B A;  3K3N A;  5EZY E;  4K98 A;  4HFH A;  2PFQ A;  4KBM B;  2Q9Q A;  1J5E T;  5HRH A;  8ICC A;  3NKZ A;  2WS3 A;  3JPR A;  5J2C A;  4LMJ A;  1OED B;  4ADZ A;  4QZ8 A;  3TFR A;  4JYA T;  4PH5 A;  3UFG A;  5HRI A;  9ICJ A;  3H39 A;  1XSP A;  3CX8 B;  5J2G A;  5IWA T;  4ANJ A;  3TFS A;  4ZEY A;  5LJN A;  1BR2 A;  3AU6 A;  3IHR A;  2KIN B;  3HJ4 A;  2V6Y B;  4KLJ A;  5EK3 A;  4LFA T;  3ZMT B;  2V6X A;  5AQV B;  3OUY A;  1XMO T;  4H63 V;  2WU5 A;  3PJA J;  3ZYK A;  1I94 T;  5DAB A;  3L9D A;  1IBL T;  1NOM A;  4HWI B;  9ICR A;  5J2U E;  3K7D A;  2NW7 A;  3BQK A;  4DR4 T;  4ZI3 C;  2XZE A;  3M65 A;  1BPB A;  2WZI A;  3RJH A;  1KFY A;  4RPX A;  2ODU A;  3AA0 B;  1D0Z A;  2DNX A;  3I9W A;  2DI4 A;  5JDM A;  2XAQ B;  1HS7 A;  2QVA A;  3MBY A;  3V7K A;  3WFR E;  4M9H A;  2V7L A;  3H38 A;  1ZQO A;  5LMN T;  4XQ7 A;  4X4T A;  2ZH8 A;  8ICB A;  4XZC A;  2VAN A;  3MJX A;  5D62 A;  5L2L A;  5HRG A;  2D9D A;  2FJA A;  2VKH A;  1XSN A;  4XJE A;  4YMM A;  1ZQD A;  2ZHB A;  5FKY A;  4MF8 A;  2WDV A;  4TWD A;  3FBZ A;  4C91 A;  4XQ8 A;  4PHE A;  4DR3 T;  3AEG A;  1IZN B;  4O2B E;  4A56 A;  4I2B A;  4O5K A;  5J2J A;  5IIK A;  5DEC A;  4GYR A;  5ADX L;  3ABV A;  3VKG A;  4TNW A;  4QKN A;  2AE9 A;  4X0B A;  8ICE A;  3SWH A;  4AT8 A;  2FUP A;  2C5J A;  4QWN B;  3RYF E;  2WMN A;  2P66 A;  4AKR B;  5LB7 B;  1VOM A;  4R66 A;  1ZOY A;  4UF0 B;  1BR0 A;  2WAU A;  1YKH B;  3C2K A;  4UIG A;  3UTK A;  4IE6 A;  4GYS A;  1T7S A;  2X51 A;  1ZQB A;  1VFG A;  1MND A;  4ATB B;  3PUA A;  2IHM A;  4RWN A;  2BVL A;  5AQR B;  4O9M A;  4E8F A;  5L3C B;  3LG7 A;  4K96 A;  3RX6 A;  4RWP A;  4IQW A;  2IUB A;  3E22 E;  4DMW A;  4X1I E;  5EK4 A;  1S94 A;  2XY8 B;  4YY3 T;  4ILU A;  5CP2 A;  3EVY A;  5LG4 A;  3LK4 2;  3ZKR A;  1OU5 A;  3V5U A;  5J0U A;  2W4X A;  1MMD A;  2BKO A;  2ODV A;  3K8P C;  4FH3 A;  4F5O A;  3HKD E;  4G2A A;  5ABF A;  1ZEE A;  2WDQ A;  1WYC A;  4LZD A;  5F2V O;  3ERC C;  1ZQL A;  4RQ3 A;  4OX9 T;  2NRK A;  1Z8U A;  2K48 A;  1HUZ A;  2HPL A;  2G0U A;  4NM1 A;  3WFO A;  4I2A A;  3OVU A;  2LSY A;  7ICE A;  4DBQ A;  4PGY A;  1ZQN A;  4YSZ A;  1TFW A;  1ZQA A;  5BR8 T;  4L0R A;  5AQJ B;  2H89 A;  4LML A;  4YCX A;  4UEM A;  4JUY A;  1M7K A;  3JC6 C;  4AKG A;  2BPC A;  1YQ3 A;  4Z8X A;  1KNP A;  4HFB A;  5BOL A;  2ZH6 A;  3MZK B;  4AT7 B;  3IF8 B;  5FY7 A;  3RIU A;  1ZQQ A;  4A98 A;  1ZQI A;  4YMN A;  1XSL A;  4ZI7 E;  3OJA A;  4P09 A;  1KNY A;  1D1C A;  4CI1 B;  3Q5W A;  2PFN A;  4LF9 T;  5LXT E;  1H7C A;  3WAK A;  2E2A A;  4NXZ A;  1ZQT A;  3ZT6 A;  1XNQ T;  1LRZ A;  4X4V A;  3AVS A;  1BPE A;  5J0R A;  5J2H A;  5J0Z A;  2O5A A;  4U2Z A;  2CLY C;  4M9N A;  4UB3 A;  5AQK B;  1T8B A;  4KMC A;  3K75 D;  2WZH A;  3R84 B;  3ZYL A;  2ZH9 A;  3VKH A;  3JPP A;  2WWU A;  4I2H A;  2X9W A;  1QUU A;  2OV9 A;  9ICG A;  4M9J A;  8ICJ A;  2UXB T;  2PBI A;  3BK9 A;  5FVK A;  5C8Y E;  2QA7 A;  4UB5 A;  1UEU A;  4HWF A;  2Z6E A;  2LSJ A;  4ZHQ E;  4JI6 T;  2CBI A;  4AQF C;  3AAI A;  3AQK A;  5KMG P;  3VU7 H;  5HRE A;  3B0Y A;  3RIA A;  1ZQX A;  5JTG A;  4LEV A;  4PJJ A;  4S3N A;  7ICQ A;  4H9O C;  4HE8 A;  1MMN A;  2W67 A;  4FHW A;  8ICK A;  3CIR A;  2JRK A;  4TV8 E;  5IYZ E;  4WBY A;  2N2N A;  4YT0 A;  2UXD T;  4XRH A;  4I27 A;  4DOB A;  4KX6 A;  5AQL B;  2VVS A;  5JDL A;  4UVC B;  4UVA B;  4WQK A;  2K3W A;  4KLU A;  4HN9 A;  4TX5 A;  3AE2 A;  3ONX A;  4X20 E;  4ZI3 D;  5JRC B;  5LP6 E;  4ILC A;  2Q9Q B;  3JZ0 A;  8ICW A;  4I2E A;  1U5P A;  4KP3 C;  5HRB A;  2GAF D;  4FHV A;  2VL0 A;  4J2C A;  4PJM A;  2PJQ A;  2UUA T;  4M0A A;  2VB6 A;  1L0V A;  5AQI B;  4NXT A;  3AVR A;  2V1D B;  4JBW F;  4E7S A;  4FO1 A;  1KEJ A;  2LOP A;  3B5M A;  3OBV E;  3PUZ F;  5DKW A;  4ILA A;  2O1P A;  2PFP A;  4PFO A;  2YK0 A;  4PPX A;  2WU2 A;  3AE3 A;  2JMK A;  1YD8 G;  5CJ5 A;  3AE5 A;  4TUP A;  3F2E A;  5KX5 E;  5DB9 A;  3PHZ A;  3K3O A;  5DB8 A;  4IL9 A;  4YD1 A;  7ICT A;  2CWY A;  2BCS A;  1HCI A;  4ZS3 A;  3HWT A;  4WC5 A;  2B56 A;  4UV9 B;  2WY2 A;  4UF0 A;  5DBB A;  3AXJ A;  4O5C A;  3ESL A;  3ZCI A;  3JAE A;  4LF6 T;  4DV7 T;  3ZPO A;  2JQ9 A;  2KZ7 B;  3UQ4 A;  2DHR A;  2WDR A;  3OUY B;  9ICU A;  1WR6 A;  5J2B A;  3OKQ A;  3P8C D;  5IIL A;  1HG2 A;  5L3E B;  2MAW A;  2YDS A;  4M9L A;  7ICL A;  4AIU A;  3QB5 A;  3VHL A;  5HXE A;  3JCF A;  2BE3 A;  4DMV A;  4TUS A;  1R8A A;  2PBE A;  4A97 A;  3EAB A;  4TUR A;  2Q66 A;  1ZQV A;  4AT9 B;  3K3Q C;  3QUJ A;  4JEU B;  3IBP A;  5H6R B;  2VAS A;  3OVS A;  3RJG A;  1WFD A;  3AEC A;  1IBK T;  4WOY A;  2E9X C;  4B6X A;  3RH3 A;  2XSB A;  1WLX A;  2FJD A;  2V7K A;  9ICI A;  1R8B A;  4K9B A;  3KIN B;  4HFD A;  3WI3 A;  3T1H T;  4GKK T;  3HJ1 A;  4I2C A;  4HFI A;  1CUN A;  5LHI B;  7ICF A;  4K4G A;  4H9R C;  3UXO A;  4WC6 A;  2XQ4 A;  4IDP A;  2LJL A;  1UUS A;  4MLK A;  5FXW A;  4KLI A;  3HR0 A;  1HNX T;  2W66 A;  3EAM A;  3UFE A;  4F8H A;  4QXH B;  4G63 A;  2PTF A;  4RWO A;  2I6H A;  5JDG A;  2ZH2 A;  4TWF A;  4AQY T;  3CQX C;  4X66 T;  1ZQM A;  2D0U A;  1JNR A;  4JI2 T;  2LKG A;  3C4Z A;  1KEY A;  5HWX A;  4AT8 B;  4JEH B;  8ICS A;  3UU6 A;  1OED C;  2XQ6 A;  3Q5X A;  3A7M A;  5B3Q A;  3VR8 A;  5GON E;  4MKP A;  3ZN1 B;  3FB2 A;  3AAA B;  4M04 A;  2J1D G;  4AT7 A;  7ICM A;  5TAO A;  5LNK A;  3PUG A;  1Y01 A;  1XDO A;  4WC2 A;  4EYY R;  3UU4 A;  4DR7 T;  2N1G A;  1FMV A;  3A8Y C;  4R63 A;  5JDF A;  5LGU B;  4LEW A;  4YTP A;  1ZQF A;  3N9O A;  3PML A;  2IC6 A;  1ZQJ A;  2VQE T;  5FXX A;  4JI5 T;  3JC6 D;  2W63 A;  5AQU B;  3C51 A;  4I2I A;  4O8S A;  4KLF A;  2H7V C;  3PDY A;  3HW8 A;  1J5W A;  3RJF A;  4NLK A;  2WWV A;  4JLX A;  4KM5 A;  2JPF A;  2ZLY A;  2NTY A;  1UX4 A;  4JI1 T;  9ICH A;  4WC1 A;  1SE7 A;  4RPZ A;  2EHO D;  4YSX A;  4UVB B;  3P7I A;  3AE9 A;  1R8I A;  4AKI A;  2B4V A;  4COF A;  2CE7 A;  2GWS A;  4R64 A;  3NZP A;  4ZI2 C;  2K24 A;  2CXL A;  5HYA A;  4PK6 A;  4PK4 A;  1XZY A;  3LK3 B;  4EB6 E;  4KLM A;  4GXI A;  3U3I A;  5D49 A;  4XUS A;  4IRE A;  2BG9 A;  3L39 A;  5L47 A;  3B57 A;  5IHY A;  4I50 E;  4EZH A;  4LVS A;  1MQ3 A;  1YXR A;  3ZCJ A;  2CWO A;  4RWQ A;  4MHC A;  4YD2 A;  2CMR A;  4PJL A;  3QC9 A;  5D61 A;  5J0W A;  3FXD B;  5JRC A;  5DQW A;  1ZQH A;  2FCL A;  4NIQ A;  1R89 A;  4U2Y A;  5EOZ A;  4KLG A;  2LLY A;  4WCW A;  3UPQ A;  3AEE A;  2KLQ A;  1YKE B;  5HCJ A;  3LFM A;  3JYY A;  4L5G A;  2XAG B;  2BCR A;  4NLN A;  3LSV A;  2NP9 A;  4GIW A;  3RGL A;  2A3D A;  2BBH A;  4RPY A;  3UU8 A;  2WSS V;  1XDP A;  4NXW A;  3ZYM A;  3PE0 A;  5C2T A;  3JPO A;  3V7J A;  1WYB A;  1ZP0 A;  3MAC A;  3SFE A;  4IQU A;  3E0Z A;  4GKJ T;  4YJ3 E;  4JLE A;  2ZMA A;  3AA6 B;  5LBM A;  4PNI A;  2ZM0 A;  3AA1 B;  5F8P A;  1FA0 A;  3M3Z B;  2QYW A;  2A72 A;  5M4Y A;  3UQ0 A;  2IML A;  3AE1 A;  3UUM A;  4O4L E;  2XAS B;  4H63 H;  2MBG A;  4UB2 A;  4DV2 T;  1ZQP A;  5HXS A;  4AT9 A;  4CXW A;  2EHO A;  3LK9 A;  2YDR A;  1PX5 A;  3N9P A;  5J2K A;  3FBL A;  4QZF A;  5AQG B;  3GDX A;  2VVN A;  1QSD A;  3HA4 A;  4X4O A;  4QZH A;  2ZH5 A;  3N9Q A;  1RPL A;  4M1P A;  3DP7 A;  1VRB A;  1MNE A;  2XQ9 A;  9ICO A;  3UQ7 A;  1KNZ A;  3RLF F;  4X4U A;  4GK5 E;  5FL1 A;  2Y6X A;  1F5A A;  2B1E A;  2PG8 A;  2VKD A;  1HX8 A;  3AE8 A;  5AQO B;  5HWY A;  4X62 T;  1OED E;  3RJJ A;  3LBX B;  3B13 A;  4X5T A;  3VR9 A;  3OVA A;  1BR4 A;  3KVA A;  2V5C A;  3T1Y T;  2E9X D;  4Z6C A;  1ZQR A;  3P4P A;  3AE6 A;  5F3J A;  5IIO A;  1SA0 E;  3PUS A;  5E0O A;  4PHP A;  4B3S T;  3WFQ E;  3ONL C;  2SPC A;  4JI8 T;  5CA7 A;  3UXP A;  4RQ5 A;  3C64 A;  2YIN A;  8ICH A;  4NXU A;  2ISP A;  2FJE A;  1IAP A;  4OFZ A;  5D63 A;  3RH6 A;  3MK7 C;  4CI3 B;  4I29 A;  5CB1 A;  4F5Q A;  4WZX A;  3MDA A;  4F5R A;  3AXJ B;  5LJM A;  3PUQ A;  4OAH A;  5JDQ A;  2DR5 A;  1MIV A;  3OVB A;  3LJC A;  5AQH B;  1US7 B;  4NLZ A;  2FBW A;  2WP9 A;  5IIJ A;  2XQ7 A;  2LRK A;  1X9B A;  2JQH A;  9ICN A;  4I2F A;  4L9I A;  5J1G A;  4O2A E;  1AJ3 A;  3AAE B;  4WBN E;  3IEE A;  3AQL A;  5CFT A;  4EZ4 A;  1MMA A;  5FY1 A;  4BJM A;  3ZC1 A;  1JN3 A;  2L3L A;  5CWR A;  4QZI A;  1D1A A;  2OLT A;  7ICP A;  9ICA A;  1JNZ A;  3CX7 B;  4DOC A;  3AQN A;  4X1Y E;  1QLB A;  4KHZ F;  4NM2 A;  1N36 T;  3WFP A;  3HKC E;  4UR9 A;  4YXD A;  3MXZ A;  4IE5 A;  2XQY A;  1IJ6 A;  4I2D A;  3NRX A;  4ZZC A;  4PW8 A;  1VJ7 A;  4LF5 T;  2LSK A;  1WCR A;  2KSR A;  4FHY A;  1HX1 B;  2FMQ A;  2VKJ A;  3ZMZ B;  4UBB A;  4JI3 T;  1GQE A;  2HN1 A;  4DND A;  4JWN A;  1BPD A;  2WBL A;  5J2E A;  2Q9Q C;  2XPK A;  2CA5 A;  2LM2 A;  2E9X A;  4TN7 B;  1ZJN A;  3I9Y A;  2XQ8 A;  4A5X A;  2UXN B;  3F57 A;  3I0Q A;  4LT6 A;  4P4O A;  4TUY E;  3EF2 A;  4YN4 A;  5A1L A;  9ICK A;  4FH5 A;  4F5P A;  8ICZ A;  4DUY T;  3Q2M A;  2X68 A;  4LF8 T;  4PGQ A;  3O1H A;  5CB4 E;  4AI6 A;  3NYB A;  2VK9 A;  5CFB A;  4HTE A;  5FVL A;  2W62 A;  4GXK A;  4U7Y A;  1EZ3 A;  3V7L A;  3HKE E;  4U72 A;  4KLH A;  5JDH A;  4X4P A;  4KLT A;  4I43 B;  1HTJ F;  4WBO A;  4QZC A;  2IAK A;  2CRB A;  5HRL A;  1B7T A;  4DR5 T;  2D2S A;  2QGS A;  4IDO A;  4DV1 T;  5JR9 C;  1ZHC A;  4ZS2 A;  5J2D A;  4MFC A;  2BS4 A;  4UBC A;  2IIU A;  5FYM A;  1Q79 A;  3EI0 A;  3PV0 F;  2BVM A;  1D1B A;  3JAD A;  2C5I T;  1ZQC A;  8ICA A;  4MFF A;  3ER8 C;  4DOA A;  9ICV A;  4HWH A;  2MOZ A;  2DR9 A;  4K4H A;  4DBR A;  4MFA A;  5HCM A;  5HHI A;  4PHD A;  2BS3 A;  1ZQZ A;  4V1A v;  2BPF A;  3AED A;  3AUO A;  4QXB B;  2BG9 B;  2YOE A;  2CXF A;  2IDO B;  3H3A A;  4YTM A;  2BPG A;  2XTL A;  3C50 A;  4PJN A;  4DR2 T;  1GPJ A;  4YMO A;  1TVA A;  5L3G B;  2BZB A;  4QZA A;  4P1N A;  9ICB A;  5HHH A;  2AXD S;  4WC3 A;  2UU9 T;  5BOM A;  2UXC T;  3RF1 A;  3L8R A;  4XA5 A;  2LSG A;  5ABH A;  9ICC A;  2V7J A;  2W00 A;  3LBX A;  5HC9 A;  4TNV A;  3N5L A;  7ICN A;  3RC3 A;  8ICR A;  2JIW A;  2WM9 A;  3O4X E;  3KV5 A;  3RJK A;  3VRB A;  3I0O A;  4I55 E;  5D4B A;  3C2L A;  3G06 A;  3PNC A;  4P4M A;  9ICW A;  3CQC B;  3ETV A;  3PUX F;  4Z90 A;  3ZJ2 A;  4O4J E;  4MF2 A;  1ZJM A;  4DO0 A;  3RC8 A;  3ZMS B;  3C2M A;  3FZM B;  5JH7 E;  3BQI A;  2DWK A;  2HHH T;  3RJE A;  4EED A;  2BS2 A;  3JAF A;  4QX8 B;  4MAL A;  4QHO A;  5AQM B;  4OAI Z;  3HL6 A;  1VCS A;  1HF8 A;  3NRY A;  1UEV A;  5J0Q A;  1W9R A;  3NVO A;  2WB5 A;  2B51 A;  1IJ5 A;  4DR1 T;  4FHP A;  2IW5 B;  2X9Y A;  2LE8 A;  5LYJ E;  1LKX A;  3RI5 A;  4BAY B;  4QXC B;  4EBK A;  2GK9 A;  4X4Q A;  2R6G F;  2EHO B;  5BPC A;  2ACZ A;  1HR0 T;  4EIW A;  3L3P A;  8ICQ A;  4H9Q C;  5FMN A;  5HRK A;  4NKU A;  4XBF B;  3JPT A;  7ICJ A;  1FEW A;  9ICX A;  1MIY A;  3PUY F;  2V7I A;  4OYK A;  3ZJ1 A;  1KDH A;  8ICL A;  2CXD A;  4TUQ A;  4AXP A;  2DCF A;  5KXJ A;  4KLE A;  5HXH A;  3N2G E;  3N2K E;  1WOT A;  3UXN A;  5AQS B;  3MCR A;  4QZE A;  3LDQ B;  3ISD A;  3N2O A;  3CX6 B;  4DUZ T;  4QH5 A;  4M9G A;  1ZQY A;  4WBZ A;  1OXZ A;  5J29 A;  2X9X A;  4F6R C;  2XAJ B;  5CHG A;  3ISC A;  3N9M A;  4AQG A;  1V9D A;  4CXX A;  3FZL B;  3UU3 A;  2BCQ A;  4X4N A;  4NXX A;  5KDM C;  3ZSS A;  5CGM A;  4NXM T;  1XWM A;  2RPA A;  4ZZB A;  4R65 A;  1LVF A;  3P4W A;  1UX5 A;  3CVR A;  4KI0 F;  2Y8D A;  3RIU C;  3UQ2 A;  4EAH A;  1SUM B;  5DBC A;  1R8C A;  4GK0 E;  4NKT A;  1NO5 A;  4E7Z A;  3LQC B;  1NEK A;  8ICM A;  3EDU A;  5CA1 E;  3AEF A;  1VCT A;  3UT5 E;  4NXN T;  4PFP A;  2X0H A;  4RQ7 A;  3PUV F;  3SS1 A;  5ETW A;  4HEA A;  2XAF B;  7ICK A;  2IHO A;  2KWI B;  2W2U A;  5AQN B;  4NPP A;  4UD4 A;  3NWI A;  4Z6E A;  4KLO A;  4YHJ A;  4IG8 A;  2QRX A;  2H7O A;  1JMS A;  5DDY A;  5L4E A;  5AQT B;  4UB1 A;  2UXX B;  2BDE A;  3DTO A;  8ICV A;  4CZZ B;  5DDM A;  3QK6 A;  3R6N A;  2X9H A;  5C3J A;  1T98 A;  1N32 T;  1ZQG A;  4LMK A;  1KK7 A;  2XSA A;  2LOS A;  4QZB A;  2J62 A;  4O4I E;  7ICS A;  1JAJ A;  3MA9 A;  5FXV A;  3TKL B;  3AE4 A;  3IA3 A;  4B3R T;  3UPS A;  2YKS A;  1NAF A;  4UB4 A;  5L3F B;  4AIS A;  2D5U A;  2DRA A;  4KUM B;  3ZLI A;  2XHE B;  4PHA A;  2PFO A;  2CHO A;  3N9N A;  1TV9 A;  3PTR B;  1Y64 B;  4O4H E;  5J0T A;  4MFR A;  3ANW A;  4TWH A;  2XAH B;  2E9X B;  1MMG A;  3P50 A;  4IIJ E;  5FY0 A;  3KFW X;  3BQL A;  5HXC A;  1ZQS A;  5DED A;  2M2V A;  4N7R A;  3RYI E;  4EYU A;  2YEV C;  2BBJ A;  2MPK A;  4O5E A;  4O68 A;  3OYX A;  4JI7 T;  3RQW A;  4X5V A;  1FJG T;  4F5N A;  3T8O A;  5HAX A;  8ICI A;  4IDQ A;  4TZ4 C;  3OGU A;  2ZH3 A;  4IQT A;  2BCU A;  3UUX B;  4P0A A;  8ICT A;  2ES0 A;  4DV3 T;  2LRL A;  1BPZ A;  2W0G A;  3MGH A;  2VUR A;  1NWM X;  2M2T A;  3ETU A;  3FXE B;  5J0Y A;  9ICT A;  3ZEF B;  2VL8 A;  5LBQ B;  5LOV E;  2CCQ A;  3K1S A;  5L3B B;  4IGU A;  2NTX A;  5DB6 A;  4RQ2 A;  2RP4 A;  1SHZ C;  2XM1 A;  1HFA A;  1T72 A;  2X66 A;  7ICU A;  9ICP A;  4UV8 B;  1HNW T;  3KV6 A;  2W9M A;  4K99 A;  3KBU A;  3P4S A;  1HUO A;  4RQ8 A;  7ICO A;  3PJA A;  4NY8 A;  4IQV A;  3HKB E;  1BPY A;  3RKG A;  5LHH B;  3JPN A;  4WH5 A;  2GA9 D;  2LHR A;  5JR9 A;  2F4V T;  2ZH4 A;  3ZN0 B;  3QOF A;  4M2Y A;  3HIY A;  5DBA A;  3C98 B;  5HEH A;  5DQV A;  2HHP A;  4UAZ A;  5JDN A;  3PMN A;  4K4I A;  5FP3 A;  2YDQ A;  5H6Q B;  4HFE A;  2E5V A;  4B3M T;  2L8K A;  3QNU A;  3LK2 B;  3HI2 A;  3OYZ A;  5J0S A;  5D46 A;  3ZMV B;  4IE0 A;  3TLW A;  4DO9 A;  3OPC A;  5FXZ A;  1JQR A;  4FHX A;  2XQA A;  2ACX A;  1KNR A;  5TZV A;  5LCY A;  3CQG B;  1M62 A;  2E5L T;  1WRD A;  4AQF A;  2HN2 A;  4K8V A;  5J0X A; 
#chains in the Genus database with same CATH homology
 2BBH A;  5JTG A;  4EED A;  4I0U A;  4EEB A;  4EGW A;  3JCF A;  2HN1 A;  3CK6 A;  3NVO A;  2BBJ A;  3NWI A;  2HN2 A;  4EV6 A;  3RKG A;  2IUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...