4EEDA

Cora coiled-coil mutant under mg2+ presence
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
324
structure length
314
Chain Sequence
DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Magnesium transport protein CorA
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 98
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eedA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eedA01
3JCFA 4EV6A 2IUBA 4I0UA 4EEBA 4EGWA 2HN1A 2BBHA 2HN2A 3RKGA 2BBJA 3NVOA 5JTGA 3NWIA 3CK6A 4EEDA
chains in the Genus database with same CATH superfamily
3JCFA 4OHFA 4O8SA 2XQ6A 3VRBA 4E80A 1IAPA 3ZCJA 4UB5A 2XPKA 3JZ0A 4RWQA 2X9YA 2ISPA 4DV2T 5JDQA 4Z6DA 3NZPA 4DV0T 4MFAA 3JAEA 4UB4A 4GKJT 3K3OA 2HHPA 2M2WA 4I2JA 5FNVE 3EAMA 4JI6T 4WC4A 3Q2MA 3PE0A 4N78D 4QZ8A 3FZLB 3NVOA 2CXFA 1RZTA 4YHHT 2CPTA 5LHGB 3I0QA 2YDSA 3QNUA 5KMGP 2WDRA 3DP7A 2E9XA 3JAFA 4HWDA 4LF9T 4DR1T 2UXBT 4WC5A 3HKEE 4UB2A 4XUSA 4E8FA 2W0GA 2BE3A 4QHOA 4DNDA 3KDSE 3RJIA 2N9DA 4E7SA 7ICQA 1XNQT 4QX8B 4P2HA 3N2KE 1NOMA 4AIUA 4RQ1A 3I9YA 4ZI2D 3HJ1A 3ZYKA 5J2KA 7ICHA 3PUXF 1HUOA 1MMNA 3AAAB 5KDMC 4ISSA 5DDMA 5J2HA 3MBYA 3ZMSB 2J62A 4X0AA 4A5XA 5HHIA 4AKLA 4JI5T 2P66A 1NENA 7ICTA 2D9DA 9ICOA 4CN4A 2BVLA 3WI3A 2FJAA 4QWNB 1MIYA 4LFBT 4I2FA 2SPCA 4QZDA 2N2NA 9ICNA 1YD8G 2HHHT 4PK5A 4EYYR 1ZQYA 5HC9A 3K8PC 2HPLA 4NPPA 2NWBA 1Z0PA 4AT7B 1VCSA 5HRDA 8ICNA 3MCRA 3RC3A 4H9RC 3RIUA 4YD2A 1D1AA 4UB1A 5D62A 3CWZB 5HXEA 4MF8A 2XAFB 4DO0A 4P09A 1ZJNA 3UQ2A 4X65T 4GXKA 5FMNA 2XQ8A 3HL6A 3J7Yq 5LJNA 5IILA 4A97A 5LBMA 3C2MA 4IE6A 9ICBA 4WC3A 1ZQEA 4NXWA 4IIJE 7ICPA 2IHOA 1TVAA 2JQQA 8ICIA 3FBZA 1M62A 3P4SA 4IE0A 2UUBT 2XQ7A 4M47A 2OV9A 3NWIA 4H9PC 4DR4T 4O5EA 2VASA 2ZH5A 4DBRA 3WFOA 3UPSA 4PJNA 2IW5B 4FHYA 3JPTA 5KXJA 3AA0B 2WDQA 1HNXT 1VFGA 2XTLA 5LG4A 1UETA 5L3FB 1MQ2A 4EOZB 4RQ6A 8ICTA 2CHNA 3CX8B 2CLYC 4X4NA 2LSYA 1XDPA 4CI2B 7ICJA 3VKHA 3RGLA 2BDEA 4LVSA 3RHWA 4NXXA 3C50A 4AKGA 1UGOA 1YW0A 1FA0A 4TURA 4EEDA 4KX6A 1R8AA 1VOMA 4PK4A 4ATBB 3L39A 2ID1A 3MACA 2Z6EA 3ZMVB 3TKLB 5J2FA 2W67A 4UEMA 1YKEB 4EB6E 4O68A 4TV9E 2YU1A 4UBCA 4PPXA 2BG9A 5FL0A 2D5UA 1DU2A 3LK9A 4WQKA 3B57A 4RQ7A 3ETUA 2VVSA 4HGAA 2I59A 1UURA 3EDVA 3H37A 9ICVA 4G63A 3Q5EA 3LBXA 7ICOA 3UUNA 2VL0A 4UAZA 5HEUA 2JMKA 2M67A 3C5GA 2AXDS 1BPEA 1ZV4X 1IJ5A 2YINA 1ZQHA 4WC6A 3ER9B 5HXHA 3TLTA 2UXNB 4AKIA 4CQIA 4PH5A 2B56A 1Z8UA 4O4LE 4HFCA 2ZM6T 3OGUA 1ZQJA 1ZQKA 4MF2A 1Y01A 3J9X1 2ODVA 3H3MA 1Q79A 3ZLIA 1KDHA 4YJ2E 1KNRA 1W09A 3AE9A 3WFQE 5DJQC 4MFFA 3ZSTA 3SRZA 5EK2A 5FVKA 3AEAA 4A98A 4QKNA 4PHDA 2ZM8A 3S4UA 1ZQZA 3MKDA 2WZHA 1G73A 3RLFF 4FHWA 4QZFA 3RJJA 4UAYA 2UXXB 4AXPA 4MFRA 1HG2A 4I2AA 4KHZF 4B3MT 3PURA 5HCMA 5J2TE 2E5LT 5AFUL 2ZH9A 5CP2A 3CKDA 4NIQA 4AKRB 3BQIA 3UU3A 2FMPA 1QUUA 3MJXA 1YLQA 5HEGA 1JN3A 3PU8A 3LK42 2KSRA 2LSJA 4KLGA 2BG9E 2ZMAA 5CHGA 4PAGA 4JYAT 2RP4A 3C4XA 3C4ZA 2X0YA 3LJCA 4DIDB 1UCUA 2EHOC 3RYIE 1N36T 4M9LA 3FBLA 3LQCB 2M6BA 5DDYA 4EXTA 4Z6EA 2VQFT 3RKGA 1HR0T 3NKZA 4LF6T 5CJ5A 1HX8A 4HKAA 3SOLA 1ZP0A 5C2TA 1IBKT 3AE7A 3T1HT 2XY8B 3GA8A 2DL1A 4HFBA 5IUXA 3IHRA 2PFVA 4DV4T 1ZQLA 4RQ2A 4ZEYA 3GN5A 1N33T 4WC0A 2YKSA 3AECA 4KLOA 4QH5A 3GWHA 2LEHA 5DQVA 5LNKA 7ICEA 1WR6A 2ISOA 7ICSA 4TNWA 1XNRT 1UX5A 4ILAA 3ZC0A 7ICVA 3AAIA 5D61A 4PGXA 2J1DG 4LMLA 2MYSA 3PJAJ 4TNVA 4OAFA 1NWMX 9ICTA 1F5AA 4M9JA 3RI5A 4KLHA 4JI8T 3Q5WA 2IC6A 2JQHA 3IBPA 3P7IA 3N2OA 4DVDA 3OVBA 3VHLA 2XQ9A 1I6ZA 4DR2T 2LSGA 3OVAA 4B6XA 9ICEA 3AA1B 4I27A 4WOYA 2CA5A 4M2YA 4M9GA 1AJ3A 5FY0A 4HN9A 4WBOA 3ZMUB 5J2CA 3PNCA 4UD5A 4H63V 3N9LA 5TZVA 5AQIB 1ZQNA 4L0RA 5J0ZA 4NY8A 4NLZA 3CMLA 9ICWA 1ZQGA 3UQ0A 3R84B 1BR1A 3PUGA 5ABHA 5JDFA 1ZQIA 2BG9B 5IIIA 2A9UA 3B0XA 4F5RA 2PXIA 3DJBA 1ZQSA 4I55E 5GONE 4K98A 5AQMB 2ZHBA 8ICWA 4O4HE 2HN1A 2NW8A 5LCYA 2PFQA 1BR4A 3LBXB 4K96A 4JI0T 3MDCA 4ZS3A 2BCVA 2KMFA 3HKBE 3O1HA 5JTGA 3AEBA 1FMWA 1D1CA 3N5LA 2OLTA 3U3IA 3QB5A 1MMAA 4KHPT 3N9QA 5D63A 3HR0A 4OAGA 4E7XA 5CWRA 2CBJA 3PTRB 3UTKA 4ZI3D 4I28A 2GA9D 3DTOA 4FI5A 5AQRB 3RJEA 4QXHB 4LEYA 3PV0F 2XHEB 2Q9QC 3NZQA 4EV6A 2C0SA 1OWAA 3CQXC 4WNKA 3F31A 4WQLA 2WZIA 1BPYA 3AQLA 4TWDA 2UXDT 4U72A 4E7ZA 4LEWA 3ISDA 9ICIA 4GXIA 2X0LB 2WMNA 2PFOA 3N2GE 1WRDA 1BPBA 4LF8T 4YTPA 4FO1A 2XZEA 1JQRA 3V7KA 4U33A 3AE2A 4RQ5A 2BS4A 4Z6CA 2YN6A 4LF5T 1WR0A 2LSIA 2QRXA 4UF0A 5CA0E 4NXTA 4QZIA 9ICQA 1OXZA 8ICHA 4QZ9A 4TUSA 3OWGA 5CHEA 2HPJA 1SHZC 5L3BB 4F5QA 4KMCA 4WBNE 4Z90A 2DRBA 2CWOA 4UV9B 2C5JA 2JPFA 2V7LA 5AQUB 1ZEEA 2V7JA 3VRAA 5JQGE 3WAKA 3WAJA 2LOPA 4HWFA 2BCRA 2XAQB 2HN2A 2CXDA 5B3QA 3C18A 1H7CA 1U5PA 4WH5A 4M9NA 2BCSA 3EDUA 4WYVA 4XQ8A 1BR2A 4ATBA 5J0XA 3ESLA 4AT8A 2VKDA 1SA0E 3PU3A 3K7DA 1IBMT 4IDPA 4I2GA 3KFWX 5LMUT 5HRKA 2JMHA 5J0PA 3AA6B 4X4RA 9ICGA 4PNIA 5FXWA 2IIUA 1YXRA 4AQGA 1XWMA 2QYWA 2WM9A 2AE9A 3C51A 4JUYA 2CCQA 4IDQA 3HA4A 3SWHA 3JPPA 3OUYB 4NKTA 1LVKA 2ZHAA 4EBKA 4Z6FA 7ICIA 4CXXA 5HCJA 4LFCT 1VCTA 1T7SA 5CA7A 3E0ZA 4ZI2C 2BZBA 4LF7T 4O9MA 4S3NA 2VVNA 1HFAA 2LOSA 2EWRA 2EHOA 2V6YA 5AQGB 3P8CD 2A3DA 5EK4A 3JPOA 2JRKA 2BKNA 2CE7A 2XSAA 2JQKA 2PBIA 1TFYA 2R6GF 2B51A 4ERRA 5L4EA 2WWUA 4DUZT 3ZC1A 3N9MA 4RQ8A 5HAXA 3ZN1B 3AE3A 5HREA 4I2HA 2W9MA 1TV9A 4DV6T 1T8BA 2FMQA 4JLEA 2XQ3A 4LMJA 4IHJE 2PG8A 4YMMA 3QC9A 5ETWA 3RRCA 1HCIA 2NTXA 4NXUA 2CXLA 3T8OA 3JC6D 3EHZA 4P0AA 2V7IA 1XDOA 4FO6A 4IQVA 1MNEA 2LRKA 4IREA 3KBUA 3CX6B 3UXNA 4BA9A 3VR9A 3TFSA 1Y64B 1KF6A 3X1DA 4EEBA 2PFNA 4DR3T 7ICMA 5AQKB 4NUUA 4ILBA 1V9DA 4YT0A 1BPDA 4JLZA 3C2LA 5L3GB 4AQYT 3ONLC 4G2AA 4WC7A 2CHOA 4H9NC 2CLYB 1E1HB 4YLHA 4F5NA 1X79A 2BCUA 3W15B 3NRYA 4KI0F 2UUCT 2E2AA 1US7B 1X9BA 3CK6A 5IHYA 9ICMA 2K9AA 4IGUA 5J2AA 4V1Av 4I4TE 2JJ9A 2H7VC 5JR9C 3RRWA 3O9XA 3NKUA 3KVAA 4KLDA 4AI6A 4RQ3A 3I9WA 4CZZB 4K99A 4QH4A 1HG5A 1LVFA 4WBYA 3QUJA 5LHHB 3IA3A 2P9BA 1ZQWA 4GK5E 1MMGA 1O3XA 3ZJ1A 3AQNA 4JI1T 2WBLA 1GQEA 4Q25A 4UF0B 5CFTA 4HFHA 5LP6E 5LXTE 5DB7A 5J2UE 4ILUA 3V5UA 2MBGA 5BMVE 3RYHE 4HFDA 3UXOA 4JEHB 3UUXB 2LHRA 3MK7C 3UU5A 4NKUA 5F3JA 1BR0A 2A2FX 4XBFB 3RYFE 2WSSV 4YD1A 5DECA 2MAWA 2ZLYA 4LT6A 5H6RB 3UU8A 3ZMTB 1IJ6A 3RX6A 3ZN0B 2IAKA 4KLJA 4AT8B 5HXCA 3UU4A 4OX9T 3GMIA 2I6HA 4UD4A 1ZQQA 5J2JA 2Q9QA 3OYXA 4LEZA 2WDVA 2WU5A 4UXNB 1KFYA 2N1GA 2WB5A 5JDMA 2W66A 4MKPA 4XJEA 4DV5T 2Q66A 1ZQXA 2FMSA 4M04A 5ABGA 4NXMT 3L3PA 4RQ0A 3HW8A 5JH7E 2DR9A 3PMNA 2M2TA 4WCWA 5AQNB 9ICUA 5CB4E 1PX5A 3ABVA 4YSYA 4O5CA 2KWHA 4ANJA 4X20E 1BPXA 4RT3A 9ICRA 5JVDE 4CN6A 2GAFD 3AE5A 1ZQAA 3A5XA 3ZMZB 2VKOA 3AQKA 3KV9A 2EHOB 4PHAA 4NXNT 2V6YB 4OFZA 4GK0E 4IQUA 5HEJA 3UU6A 4NLNA 4RQ4A 2RPAA 4XAXB 1VJ7A 9ICHA 3AAEB 4XQ7A 3P4RA 2KWIB 2WU2A 4FJOA 2PFPA 4NLKA 3E22E 4X4UA 2DWKA 3ZPOA 1ZJMA 4KLTA 4JEUB 3EABA 1MQ3A 4PJLA 4U7YA 4KLUA 5HRIA 4P4OA 1W9RA 2W63A 4HFVA 3IF8B 4MALA 5LMNT 4K9BA 2YDQA 4O69A 2XASB 1GPJA 2J47A 2NRKA 1SUMB 3FB2A 2KINB 3PUYF 4X4PA 4XA5A 3CPZA 3T1YT 4K8VA 5BR8T 4M1PA 3SS1A 2LJLA 2NTYA 2VK9A 2O1PA 3AUOA 4YJ3E 3N9NA 5ABEA 3ERCC 2X9WA 4YSXA 5FL1A 9ICKA 1U4QA 2M6IA 2IC9A 3ZEFB 4U2ZA 5JDLA 9ICSA 2XQ5A 3AXJA 4LMKA 4PFPA 4FHVA 4M0AA 4PJMA 2J4GA 5J2DA 3PJAA 3F2EA 3ETVA 4RWOA 5AQHB 2M2VA 1ZKEA 3UUBA 2E9XC 2LM2A 4KLMA 9ICLA 3O4XE 4K0KT 2H88A 7ICFA 4EP7A 3LK3B 4O4IE 3I1AA 3ONJA 3JPRA 4HWIB 4WC1A 5IIMA 1KEJA 1UEUA 2DVIA 3WFSC 4DV7T 3ZT5A 3PMLA 2ZH2A 1ZQCA 4DOAA 2BCQA 1EZ3A 4DR7T 4C91A 4IDOA 4HWHA 4F5OA 3JYYA 2V7MA 5AQQB 4ISTA 5EZYE 5F2VO 4YSZA 7ICUA 2MOZA 2EHOD 4I2CA 4YXDA 4UB3A 5HEHA 8ICQA 2XSBA 3OUYA 5HRGA 4QZHA 4BJMA 2YDRA 3MGHA 5HRLA 4X5TA 4Z91A 5IWAT 9ICJA 4UBBA 5FXZA 4IDZA 3FZFB 4JI3T 4LZGA 2V5DA 3AEFA 3AU2A 5LB7B 4PHEA 3PUQA 2NW7A 2XJ7A 4YTNA 1IBLT 5LOVE 4H9OC 3ZT7A 2PTFA 4HTEA 2DRAA 1KK7A 5HR9A 3RIUC 1D0XA 4QZCA 5HYAA 1I94T 4QZAA 5H6QB 4CN1A 3OVSA 4LEVA 5HRHA 2BKPA 1R8BA 5J0TA 2GK9A 2Q9QB 5DBBA 5EK3A 1WLXA 1R8IA 4I2IA 1XSLA 3RH4A 3ZJ2A 5KX5E 5D4BA 4RPXA 4I43B 4UELA 4BJNA 4UVAB 1ZHCA 1JAJA 3PUVF 5LA6E 8ICGA 4HX0A 2WY2A 2E5VA 1ZQFA 3FXDB 4O6AA 4PGYA 3P4WA 5ADXL 4LFAT 5J0OA 1KNYA 5HXSA 2ACZA 4TN7B 4WBZA 2JIWA 4H9SE 8ICUA 4I2EA 2H3RA 1FMVA 2DWGA 4XRHA 4NXVA 5D46A 4U74A 4I29A 3HKDE 4ZZBA 2CRBA 2V1DB 1RPLA 2XAHB 1WYCA 1ZQDA 2C5KT 4OYJA 4NM2A 1MMDA 1MIVA 4DV3T 2YOEA 2DR7A 3AEEA 3AVSA 5F5WA 4TUQA 3K1SA 3BQLA 3RKOA 3RJFA 4UVCB 2V26A 4K9AA 2KT9A 4YN4A 4KM5A 2ZH7A 3JPNA 2V5CA 4BAYB 2I0MA 2YK0A 4P0BA 3RC8A 3TFRA 4QX7B 1M7KA 2LSKA 1S94A 2VKJA 3QK6A 4JI2T 2XQ4A 5L47A 3C2KA 3AXJB 3K3NA 5JDGA 5IIKA 5FP3A 3LG7A 1LRZA 3P4QA 1IZNB 2IMLA 4KLEA 2Q9QD 2VQET 3HKCE 3UPQA 3EUHA 2IDOB 3BQKA 3FZMB 4U3CA 1KNZA 4HWCA 1T98A 3M3ZB 3ZT6A 3AVRA 4R63A 3OKQA 3HIYA 1SE7A 5FXVA 4X1KE 4P4MA 5L3EB 4EIWA 1OEDC 5J2GA 3VKGA 3WFRE 5HRBA 3AB3B 2K3WA 8ICJA 3UXPA 2KXPB 3MGIA 4U2YA 8ICBA 4UAWA 3FHNA 2BVMA 2DLRA 4KB6A 4RWNA 2LHNA 4P4PA 4YMOA 1YQ3A 4M9HA 4TX5A 2ZH3A 3GDXA 9ICAA 4JLXA 3V5SA 4IE7A 5LYJE 2IUBA 3CQCB 2K5BB 4AQFC 4X4VA 4KUMB 4KP3C 4MLKA 2V7KA 4YHJA 3SFDA 3LSVA 2QA7A 2XQYA 5HWYA 4TWHA 8ICYA 3PUZF 3CX7B 3OVUA 3AEGA 5DABA 4PW8A 3B13A 5J29A 2YEVC 1HX1B 2FUPA 2L9QA 3CIRA 1V4AA 2Y48B 5C8YE 3JC6C 7ICKA 1G8XA 5LJMA 5FY7A 1ZQBA 3OTOT 5FXXA 2DHRA 5LBQB 4RPYA 5J0QA 2LE8A 1MIWA 5JRCB 4A56A 5JR9B 2UU9T 4X62T 2BBHA 4X5VA 1J1JA 2FCLA 3NRXA 3MA9A 4B3TT 4Z8XA 2KLQA 1HS7A 2QGSA 8ICFA 4MBQA 4IQTA 4UIGA 1WFDA 4JI7T 9ICPA 4GOUA 5B3PA 4X4SA 1XMQT 2XQAA 1XSNA 2CWYA 3ZYLA 4IT4A 2ZM0A 3RIAA 3FXEB 3KVBA 3O1IA 1CHUA 3TLVA 5LHIB 2DNXA 8ICEA 4X4QA 1JNRA 5JREA 3WFPA 3Q5DA 3VR8A 2ODUA 3EI0A 4QZBA 4F5PA 2K48A 2A72A 5L3CB 5AQSB 3Q5XA 1HF8A 3A8YC 2H89A 8ICMA 2VURA 3AE1A 8ICRA 1JMSA 4ZS2A 4H63H 1FJGT 2ZH6A 3R6NA 1ZQOA 4CI3B 4O2AE 3D0TA 2BS3A 4QXCB 4ILCA 1QSDA 2L3LA 2LKHA 2ZM2A 4DOBA 4F8HA 2GWSA 9ICFA 1ZOYA 1NAFA 5DB9A 5A1LA 2BPGA 2LRLA 4ASKA 4FH3A 4RWPA 4MFCA 4OK0A 5J0RA 3HWTA 4H9QC 2WS3A 3ZKRA 1WOTA 1XZYA 3RH3A 2C5IT 3QB5K 3PUWF 2D0TA 4RPZA 3V72A 4U7IA 3H39A 5L4HA 4K4HA 5CA1E 4HFIA 4IE4A 4TUPA 3ISBA 1CUNA 3RH6A 3ZSSA 2UXCT 5HRFA 4GYSA 2WAUA 3K3QC 5E0OA 8ICAA 4TZ4C 1HNZT 2Y8DA 4L5GA 3C98B 4R65A 1J5WA 5LGTB 3N9OA 3RPUA 2JQ9A 2VWAA 5FY1A 4DV1T 4ZZCA 2CEAA 2XM2A 4MHCA 3TLWA 7ICNA 1QLBA 4WZXA 1LKXA 3AQMA 4JV5T 4PHPA 8ICKA 4HE8A 3OJAA 1XMOT 2VANA 4X4OA 4IL9A 4EAHA 3UULA 1J5ET 1JNZA 3SFEA 2BBJA 1ZQTA 5HEOA 2PBEA 2L8KA 2MTQA 4ZXLA 3LK2B 1HUZA 9ICXA 4HFEA 2BPFA 1WCRA 5IYZE 1ZQPA 2B76A 8ICLA 2KNDA 4DR6T 1R8CA 5DBCA 4DOCA 1YQ4A 3O1JA 3L9DA 3RJGA 4X1IE 4B3ST 4YTMA 5BOMA 1ZQMA 5LG3A 5LGUB 2FJDA 4U31A 4GKKT 2XAJB 3AE6A 2Y6XA 5JDHA 4EBJA 4FH5A 4XZCA 5BPCA 4K97A 2FBWA 4CXWA 3JPSA 3M65A 1NEKA 1D0ZA 4DO9A 4X0BA 3F57A 3HJ4A 5LGNB 1W0BA 2O5AA 5AQTB 2MPKA 4X1YE 4AT9A 3RQWA 2DCFA 2X9HA 5DKWA 2IHMA 1R89A 1ZQRA 2E9XB 2VL8A 3RH5A 4DUYT 2H7OA 4JWMA 2ZH8A 2DI4A 4I2BA 2B4VA 5D49A 2CMRA 1OEDA 4EYUA 4O2BE 4DMVA 5ABFA 4QZGA 3OV7A 3ONXA 2WP9A 2NP9A 1D1BA 4GYRA 4FHXA 3LFMA 2HH7A 4QZEA 2RFFA 4TUYE 2X68A 4EZHA 4KLSA 1S35A 2XAGB 8ICOA 3RJKA 4NXZA 2ZH4A 3EVYA 4UV8B 4X64T 5CR0A 5CB1A 5J0SA 4KLQA 5L2LA 4EGWA 4RT2A 3A7MA 1L0VA 1VRBA 5J2EA 2I9GA 4O5KA 3C5FA 5DEDA 4TV8E 3N9PA 7ICLA 5FYMA 4AQFA 1NO5A 3MXZA 3AE4A 3AE8A 5AQJB 4M5DA 4IG8A 3C4WA 4IDNA 1ZQUA 3U78A 3FZKB 4R66A 3TLUA 3VU7H 3V7LA 2NOXA 4AISA 3ANWA 3KV6A 4F6RC 4ADZA 8ICZA 5IINA 4O4JE 3B0YA 2LT3A 3ER8C 4UR9A 1MNDA 2FJEA 3KV5A 4I50E 4YFSA 2YU2A 3CVRA 1N32T 2BKOA 4NUVA 3G06A 2D0UA 2NR4A 4EZ4A 3EF2A 1XSPA 3MZKB 1OEDE 4O67A 3OPCA 4K4IA 2DR5A 2F4VT 4C90A 1UK5A 3PUSA 3V7JA 4WW0A 5J0YA 1UEVA 2FJBA 2D2SA 4L9IA 5TAOA 1UX4A 2CBIA 3PUAA 3H38A 2E9XD 3RF1A 2X0HA 5DQWA 8ICVA 2X51A 5CFSA 3E08A 3UQ4A 3AA7B 4I2DA 4DMWA 5AQLB 4YY3T 3RJHA 4ZHQE 4ZI7E 4OYKA 8ICCA 2K24A 3PHZA 3QOFA 2G0UA 3KBTA 2KZ7B 2UUAT 2V8SV 1OU5A 3UFEA 1D0YA 1B7TA 5AQFB 4JBWF 2LKGA 2B1EA 3TLSA 5JRCA 7ICGA 3KV4A 5JR9A 4GXJA 5HWXA 4ZI3C 4JWNA 3UUMA 3L09A 3OBVE 2M2UA 2W61A 3B5MA 2X67A 4P1NA 3KINB 4GIWA 4LZDA 5J0WA 5L3DB 3UFGA 4N7RA 2WQYA 8ICPA 2WMOA 1FEWA 5CGMA 3FZHB 2PJQA 1UUSA 5FVLA 4X4TA 1Q78A 5CFBA 5EOZA 4CXYA 5FKYA 5M4YA 1T72A 2W00A 4ZOLE 1E2AA 9ICCA 5J2IA 2XM1A 4IL4A 3OYZA 3P4PA 2X9XA 3BK9A 3RYCE 4OAIZ 3AU6A 4OAHA 3C66A 4LF4T 3AEDA 4AKHA 4K0UA 4AT9B 5CFUA 3PDYA 3ISCA 3CQGB 5DB8A 2VB6A 2ES0A 1N34T 5J0UA 3NYBA 4WC2A 3C64A 4B3RT 3K75D 4AT7A 1OEDB 5DBAA 2BS2A 5ABFB 4DR5T 2OA5A 2E8IA 4J2CA 4JI4T 4IQWA 4KLLA 5AQOB 3RIFA 4PK6A 2BG9C 1KNPA 5IIJA 3RQUA 5C3JA 1ZQVA 5J1GA 3UT5E 2NW9A 2LLYA 4PFOA 2LM9A 4DBQA 1YKHB 5HHHA 1HTJF 3UQ7A 2WCAA 4PGQA 3Q9DA 5JDNA 2VKHA 5AQVB 3NBXX 4KLIA 4KLFA 4KBMB 7ICRA 4UVBB 5DB6A 2XUEA 5AQPB 4QXBB 2IHR1 3ZCIA 3P50A 5J2BA 4PJJA 2DR8A 8ICSA 3JPQA 5IIOA 3LDQB 4I0UA 2ZH1A 4QH1A 5BOLA 4X66T 1FIOA 4CI1B 5CJ7A 3ANWB 2X66A 2CM0A 2W2UA 3H3AA 1WYBA 3IEEA 4NM1A 1BPZA 1HNWT 4TWFA 2W62A 2BPCA 4IE5A 4YCXA 3MDAA 3GN5B 5F8PA 4K4GA 2ACXA 2W4XA 1TFWA 3JADA 2RA1A 4HEAA 2QVAA 4COFA 2V6XA 4FHPA 1E7PA 3L8RA 3I0OA 3HI2A 1KEYA 3HX0A 3ZYMA 1W0AA 5HXRA 8ICXA 4YMNA 2WWVA 4R64A
chains in the Genus database with same CATH topology
3JCFA 4EV6A 2IUBA 4I0UA 4EEBA 4EGWA 2HN1A 2BBHA 2HN2A 3RKGA 2BBJA 3NVOA 5JTGA 3NWIA 3CK6A 4EEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCF A;  4EV6 A;  2IUB A;  4I0U A;  4EEB A;  4EGW A;  2HN1 A;  2BBH A;  2HN2 A;  3RKG A;  2BBJ A;  3NVO A;  5JTG A;  3NWI A;  3CK6 A;  4EED A; 
#chains in the Genus database with same CATH topology
 3JCF A;  4OHF A;  4O8S A;  2XQ6 A;  3VRB A;  4E80 A;  1IAP A;  3ZCJ A;  4UB5 A;  2XPK A;  3JZ0 A;  4RWQ A;  2X9Y A;  2ISP A;  4DV2 T;  5JDQ A;  4Z6D A;  3NZP A;  4DV0 T;  4MFA A;  3JAE A;  4UB4 A;  4GKJ T;  3K3O A;  2HHP A;  2M2W A;  4I2J A;  5FNV E;  3EAM A;  4JI6 T;  4WC4 A;  3Q2M A;  3PE0 A;  4N78 D;  4QZ8 A;  3FZL B;  3NVO A;  2CXF A;  1RZT A;  4YHH T;  2CPT A;  5LHG B;  3I0Q A;  2YDS A;  3QNU A;  5KMG P;  2WDR A;  3DP7 A;  2E9X A;  3JAF A;  4HWD A;  4LF9 T;  4DR1 T;  2UXB T;  4WC5 A;  3HKE E;  4UB2 A;  4XUS A;  4E8F A;  2W0G A;  2BE3 A;  4QHO A;  4DND A;  3KDS E;  3RJI A;  2N9D A;  4E7S A;  7ICQ A;  1XNQ T;  4QX8 B;  4P2H A;  3N2K E;  1NOM A;  4AIU A;  4RQ1 A;  3I9Y A;  4ZI2 D;  3HJ1 A;  3ZYK A;  5J2K A;  7ICH A;  3PUX F;  1HUO A;  1MMN A;  3AAA B;  5KDM C;  4ISS A;  5DDM A;  5J2H A;  3MBY A;  3ZMS B;  2J62 A;  4X0A A;  4A5X A;  5HHI A;  4AKL A;  4JI5 T;  2P66 A;  1NEN A;  7ICT A;  2D9D A;  9ICO A;  4CN4 A;  2BVL A;  3WI3 A;  2FJA A;  4QWN B;  1MIY A;  4LFB T;  4I2F A;  2SPC A;  4QZD A;  2N2N A;  9ICN A;  1YD8 G;  2HHH T;  4PK5 A;  4EYY R;  1ZQY A;  5HC9 A;  3K8P C;  2HPL A;  4NPP A;  2NWB A;  1Z0P A;  4AT7 B;  1VCS A;  5HRD A;  8ICN A;  3MCR A;  3RC3 A;  4H9R C;  3RIU A;  4YD2 A;  1D1A A;  4UB1 A;  5D62 A;  3CWZ B;  5HXE A;  4MF8 A;  2XAF B;  4DO0 A;  4P09 A;  1ZJN A;  3UQ2 A;  4X65 T;  4GXK A;  5FMN A;  2XQ8 A;  3HL6 A;  3J7Y q;  5LJN A;  5IIL A;  4A97 A;  5LBM A;  3C2M A;  4IE6 A;  9ICB A;  4WC3 A;  1ZQE A;  4NXW A;  4IIJ E;  7ICP A;  2IHO A;  1TVA A;  2JQQ A;  8ICI A;  3FBZ A;  1M62 A;  3P4S A;  4IE0 A;  2UUB T;  2XQ7 A;  4M47 A;  2OV9 A;  3NWI A;  4H9P C;  4DR4 T;  4O5E A;  2VAS A;  2ZH5 A;  4DBR A;  3WFO A;  3UPS A;  4PJN A;  2IW5 B;  4FHY A;  3JPT A;  5KXJ A;  3AA0 B;  2WDQ A;  1HNX T;  1VFG A;  2XTL A;  5LG4 A;  1UET A;  5L3F B;  1MQ2 A;  4EOZ B;  4RQ6 A;  8ICT A;  2CHN A;  3CX8 B;  2CLY C;  4X4N A;  2LSY A;  1XDP A;  4CI2 B;  7ICJ A;  3VKH A;  3RGL A;  2BDE A;  4LVS A;  3RHW A;  4NXX A;  3C50 A;  4AKG A;  1UGO A;  1YW0 A;  1FA0 A;  4TUR A;  4EED A;  4KX6 A;  1R8A A;  1VOM A;  4PK4 A;  4ATB B;  3L39 A;  2ID1 A;  3MAC A;  2Z6E A;  3ZMV B;  3TKL B;  5J2F A;  2W67 A;  4UEM A;  1YKE B;  4EB6 E;  4O68 A;  4TV9 E;  2YU1 A;  4UBC A;  4PPX A;  2BG9 A;  5FL0 A;  2D5U A;  1DU2 A;  3LK9 A;  4WQK A;  3B57 A;  4RQ7 A;  3ETU A;  2VVS A;  4HGA A;  2I59 A;  1UUR A;  3EDV A;  3H37 A;  9ICV A;  4G63 A;  3Q5E A;  3LBX A;  7ICO A;  3UUN A;  2VL0 A;  4UAZ A;  5HEU A;  2JMK A;  2M67 A;  3C5G A;  2AXD S;  1BPE A;  1ZV4 X;  1IJ5 A;  2YIN A;  1ZQH A;  4WC6 A;  3ER9 B;  5HXH A;  3TLT A;  2UXN B;  4AKI A;  4CQI A;  4PH5 A;  2B56 A;  1Z8U A;  4O4L E;  4HFC A;  2ZM6 T;  3OGU A;  1ZQJ A;  1ZQK A;  4MF2 A;  1Y01 A;  3J9X 1;  2ODV A;  3H3M A;  1Q79 A;  3ZLI A;  1KDH A;  4YJ2 E;  1KNR A;  1W09 A;  3AE9 A;  3WFQ E;  5DJQ C;  4MFF A;  3ZST A;  3SRZ A;  5EK2 A;  5FVK A;  3AEA A;  4A98 A;  4QKN A;  4PHD A;  2ZM8 A;  3S4U A;  1ZQZ A;  3MKD A;  2WZH A;  1G73 A;  3RLF F;  4FHW A;  4QZF A;  3RJJ A;  4UAY A;  2UXX B;  4AXP A;  4MFR A;  1HG2 A;  4I2A A;  4KHZ F;  4B3M T;  3PUR A;  5HCM A;  5J2T E;  2E5L T;  5AFU L;  2ZH9 A;  5CP2 A;  3CKD A;  4NIQ A;  4AKR B;  3BQI A;  3UU3 A;  2FMP A;  1QUU A;  3MJX A;  1YLQ A;  5HEG A;  1JN3 A;  3PU8 A;  3LK4 2;  2KSR A;  2LSJ A;  4KLG A;  2BG9 E;  2ZMA A;  5CHG A;  4PAG A;  4JYA T;  2RP4 A;  3C4X A;  3C4Z A;  2X0Y A;  3LJC A;  4DID B;  1UCU A;  2EHO C;  3RYI E;  1N36 T;  4M9L A;  3FBL A;  3LQC B;  2M6B A;  5DDY A;  4EXT A;  4Z6E A;  2VQF T;  3RKG A;  1HR0 T;  3NKZ A;  4LF6 T;  5CJ5 A;  1HX8 A;  4HKA A;  3SOL A;  1ZP0 A;  5C2T A;  1IBK T;  3AE7 A;  3T1H T;  2XY8 B;  3GA8 A;  2DL1 A;  4HFB A;  5IUX A;  3IHR A;  2PFV A;  4DV4 T;  1ZQL A;  4RQ2 A;  4ZEY A;  3GN5 A;  1N33 T;  4WC0 A;  2YKS A;  3AEC A;  4KLO A;  4QH5 A;  3GWH A;  2LEH A;  5DQV A;  5LNK A;  7ICE A;  1WR6 A;  2ISO A;  7ICS A;  4TNW A;  1XNR T;  1UX5 A;  4ILA A;  3ZC0 A;  7ICV A;  3AAI A;  5D61 A;  4PGX A;  2J1D G;  4LML A;  2MYS A;  3PJA J;  4TNV A;  4OAF A;  1NWM X;  9ICT A;  1F5A A;  4M9J A;  3RI5 A;  4KLH A;  4JI8 T;  3Q5W A;  2IC6 A;  2JQH A;  3IBP A;  3P7I A;  3N2O A;  4DVD A;  3OVB A;  3VHL A;  2XQ9 A;  1I6Z A;  4DR2 T;  2LSG A;  3OVA A;  4B6X A;  9ICE A;  3AA1 B;  4I27 A;  4WOY A;  2CA5 A;  4M2Y A;  4M9G A;  1AJ3 A;  5FY0 A;  4HN9 A;  4WBO A;  3ZMU B;  5J2C A;  3PNC A;  4UD5 A;  4H63 V;  3N9L A;  5TZV A;  5AQI B;  1ZQN A;  4L0R A;  5J0Z A;  4NY8 A;  4NLZ A;  3CML A;  9ICW A;  1ZQG A;  3UQ0 A;  3R84 B;  1BR1 A;  3PUG A;  5ABH A;  5JDF A;  1ZQI A;  2BG9 B;  5III A;  2A9U A;  3B0X A;  4F5R A;  2PXI A;  3DJB A;  1ZQS A;  4I55 E;  5GON E;  4K98 A;  5AQM B;  2ZHB A;  8ICW A;  4O4H E;  2HN1 A;  2NW8 A;  5LCY A;  2PFQ A;  1BR4 A;  3LBX B;  4K96 A;  4JI0 T;  3MDC A;  4ZS3 A;  2BCV A;  2KMF A;  3HKB E;  3O1H A;  5JTG A;  3AEB A;  1FMW A;  1D1C A;  3N5L A;  2OLT A;  3U3I A;  3QB5 A;  1MMA A;  4KHP T;  3N9Q A;  5D63 A;  3HR0 A;  4OAG A;  4E7X A;  5CWR A;  2CBJ A;  3PTR B;  3UTK A;  4ZI3 D;  4I28 A;  2GA9 D;  3DTO A;  4FI5 A;  5AQR B;  3RJE A;  4QXH B;  4LEY A;  3PV0 F;  2XHE B;  2Q9Q C;  3NZQ A;  4EV6 A;  2C0S A;  1OWA A;  3CQX C;  4WNK A;  3F31 A;  4WQL A;  2WZI A;  1BPY A;  3AQL A;  4TWD A;  2UXD T;  4U72 A;  4E7Z A;  4LEW A;  3ISD A;  9ICI A;  4GXI A;  2X0L B;  2WMN A;  2PFO A;  3N2G E;  1WRD A;  1BPB A;  4LF8 T;  4YTP A;  4FO1 A;  2XZE A;  1JQR A;  3V7K A;  4U33 A;  3AE2 A;  4RQ5 A;  2BS4 A;  4Z6C A;  2YN6 A;  4LF5 T;  1WR0 A;  2LSI A;  2QRX A;  4UF0 A;  5CA0 E;  4NXT A;  4QZI A;  9ICQ A;  1OXZ A;  8ICH A;  4QZ9 A;  4TUS A;  3OWG A;  5CHE A;  2HPJ A;  1SHZ C;  5L3B B;  4F5Q A;  4KMC A;  4WBN E;  4Z90 A;  2DRB A;  2CWO A;  4UV9 B;  2C5J A;  2JPF A;  2V7L A;  5AQU B;  1ZEE A;  2V7J A;  3VRA A;  5JQG E;  3WAK A;  3WAJ A;  2LOP A;  4HWF A;  2BCR A;  2XAQ B;  2HN2 A;  2CXD A;  5B3Q A;  3C18 A;  1H7C A;  1U5P A;  4WH5 A;  4M9N A;  2BCS A;  3EDU A;  4WYV A;  4XQ8 A;  1BR2 A;  4ATB A;  5J0X A;  3ESL A;  4AT8 A;  2VKD A;  1SA0 E;  3PU3 A;  3K7D A;  1IBM T;  4IDP A;  4I2G A;  3KFW X;  5LMU T;  5HRK A;  2JMH A;  5J0P A;  3AA6 B;  4X4R A;  9ICG A;  4PNI A;  5FXW A;  2IIU A;  1YXR A;  4AQG A;  1XWM A;  2QYW A;  2WM9 A;  2AE9 A;  3C51 A;  4JUY A;  2CCQ A;  4IDQ A;  3HA4 A;  3SWH A;  3JPP A;  3OUY B;  4NKT A;  1LVK A;  2ZHA A;  4EBK A;  4Z6F A;  7ICI A;  4CXX A;  5HCJ A;  4LFC T;  1VCT A;  1T7S A;  5CA7 A;  3E0Z A;  4ZI2 C;  2BZB A;  4LF7 T;  4O9M A;  4S3N A;  2VVN A;  1HFA A;  2LOS A;  2EWR A;  2EHO A;  2V6Y A;  5AQG B;  3P8C D;  2A3D A;  5EK4 A;  3JPO A;  2JRK A;  2BKN A;  2CE7 A;  2XSA A;  2JQK A;  2PBI A;  1TFY A;  2R6G F;  2B51 A;  4ERR A;  5L4E A;  2WWU A;  4DUZ T;  3ZC1 A;  3N9M A;  4RQ8 A;  5HAX A;  3ZN1 B;  3AE3 A;  5HRE A;  4I2H A;  2W9M A;  1TV9 A;  4DV6 T;  1T8B A;  2FMQ A;  4JLE A;  2XQ3 A;  4LMJ A;  4IHJ E;  2PG8 A;  4YMM A;  3QC9 A;  5ETW A;  3RRC A;  1HCI A;  2NTX A;  4NXU A;  2CXL A;  3T8O A;  3JC6 D;  3EHZ A;  4P0A A;  2V7I A;  1XDO A;  4FO6 A;  4IQV A;  1MNE A;  2LRK A;  4IRE A;  3KBU A;  3CX6 B;  3UXN A;  4BA9 A;  3VR9 A;  3TFS A;  1Y64 B;  1KF6 A;  3X1D A;  4EEB A;  2PFN A;  4DR3 T;  7ICM A;  5AQK B;  4NUU A;  4ILB A;  1V9D A;  4YT0 A;  1BPD A;  4JLZ A;  3C2L A;  5L3G B;  4AQY T;  3ONL C;  4G2A A;  4WC7 A;  2CHO A;  4H9N C;  2CLY B;  1E1H B;  4YLH A;  4F5N A;  1X79 A;  2BCU A;  3W15 B;  3NRY A;  4KI0 F;  2UUC T;  2E2A A;  1US7 B;  1X9B A;  3CK6 A;  5IHY A;  9ICM A;  2K9A A;  4IGU A;  5J2A A;  4V1A v;  4I4T E;  2JJ9 A;  2H7V C;  5JR9 C;  3RRW A;  3O9X A;  3NKU A;  3KVA A;  4KLD A;  4AI6 A;  4RQ3 A;  3I9W A;  4CZZ B;  4K99 A;  4QH4 A;  1HG5 A;  1LVF A;  4WBY A;  3QUJ A;  5LHH B;  3IA3 A;  2P9B A;  1ZQW A;  4GK5 E;  1MMG A;  1O3X A;  3ZJ1 A;  3AQN A;  4JI1 T;  2WBL A;  1GQE A;  4Q25 A;  4UF0 B;  5CFT A;  4HFH A;  5LP6 E;  5LXT E;  5DB7 A;  5J2U E;  4ILU A;  3V5U A;  2MBG A;  5BMV E;  3RYH E;  4HFD A;  3UXO A;  4JEH B;  3UUX B;  2LHR A;  3MK7 C;  3UU5 A;  4NKU A;  5F3J A;  1BR0 A;  2A2F X;  4XBF B;  3RYF E;  2WSS V;  4YD1 A;  5DEC A;  2MAW A;  2ZLY A;  4LT6 A;  5H6R B;  3UU8 A;  3ZMT B;  1IJ6 A;  3RX6 A;  3ZN0 B;  2IAK A;  4KLJ A;  4AT8 B;  5HXC A;  3UU4 A;  4OX9 T;  3GMI A;  2I6H A;  4UD4 A;  1ZQQ A;  5J2J A;  2Q9Q A;  3OYX A;  4LEZ A;  2WDV A;  2WU5 A;  4UXN B;  1KFY A;  2N1G A;  2WB5 A;  5JDM A;  2W66 A;  4MKP A;  4XJE A;  4DV5 T;  2Q66 A;  1ZQX A;  2FMS A;  4M04 A;  5ABG A;  4NXM T;  3L3P A;  4RQ0 A;  3HW8 A;  5JH7 E;  2DR9 A;  3PMN A;  2M2T A;  4WCW A;  5AQN B;  9ICU A;  5CB4 E;  1PX5 A;  3ABV A;  4YSY A;  4O5C A;  2KWH A;  4ANJ A;  4X20 E;  1BPX A;  4RT3 A;  9ICR A;  5JVD E;  4CN6 A;  2GAF D;  3AE5 A;  1ZQA A;  3A5X A;  3ZMZ B;  2VKO A;  3AQK A;  3KV9 A;  2EHO B;  4PHA A;  4NXN T;  2V6Y B;  4OFZ A;  4GK0 E;  4IQU A;  5HEJ A;  3UU6 A;  4NLN A;  4RQ4 A;  2RPA A;  4XAX B;  1VJ7 A;  9ICH A;  3AAE B;  4XQ7 A;  3P4R A;  2KWI B;  2WU2 A;  4FJO A;  2PFP A;  4NLK A;  3E22 E;  4X4U A;  2DWK A;  3ZPO A;  1ZJM A;  4KLT A;  4JEU B;  3EAB A;  1MQ3 A;  4PJL A;  4U7Y A;  4KLU A;  5HRI A;  4P4O A;  1W9R A;  2W63 A;  4HFV A;  3IF8 B;  4MAL A;  5LMN T;  4K9B A;  2YDQ A;  4O69 A;  2XAS B;  1GPJ A;  2J47 A;  2NRK A;  1SUM B;  3FB2 A;  2KIN B;  3PUY F;  4X4P A;  4XA5 A;  3CPZ A;  3T1Y T;  4K8V A;  5BR8 T;  4M1P A;  3SS1 A;  2LJL A;  2NTY A;  2VK9 A;  2O1P A;  3AUO A;  4YJ3 E;  3N9N A;  5ABE A;  3ERC C;  2X9W A;  4YSX A;  5FL1 A;  9ICK A;  1U4Q A;  2M6I A;  2IC9 A;  3ZEF B;  4U2Z A;  5JDL A;  9ICS A;  2XQ5 A;  3AXJ A;  4LMK A;  4PFP A;  4FHV A;  4M0A A;  4PJM A;  2J4G A;  5J2D A;  3PJA A;  3F2E A;  3ETV A;  4RWO A;  5AQH B;  2M2V A;  1ZKE A;  3UUB A;  2E9X C;  2LM2 A;  4KLM A;  9ICL A;  3O4X E;  4K0K T;  2H88 A;  7ICF A;  4EP7 A;  3LK3 B;  4O4I E;  3I1A A;  3ONJ A;  3JPR A;  4HWI B;  4WC1 A;  5IIM A;  1KEJ A;  1UEU A;  2DVI A;  3WFS C;  4DV7 T;  3ZT5 A;  3PML A;  2ZH2 A;  1ZQC A;  4DOA A;  2BCQ A;  1EZ3 A;  4DR7 T;  4C91 A;  4IDO A;  4HWH A;  4F5O A;  3JYY A;  2V7M A;  5AQQ B;  4IST A;  5EZY E;  5F2V O;  4YSZ A;  7ICU A;  2MOZ A;  2EHO D;  4I2C A;  4YXD A;  4UB3 A;  5HEH A;  8ICQ A;  2XSB A;  3OUY A;  5HRG A;  4QZH A;  4BJM A;  2YDR A;  3MGH A;  5HRL A;  4X5T A;  4Z91 A;  5IWA T;  9ICJ A;  4UBB A;  5FXZ A;  4IDZ A;  3FZF B;  4JI3 T;  4LZG A;  2V5D A;  3AEF A;  3AU2 A;  5LB7 B;  4PHE A;  3PUQ A;  2NW7 A;  2XJ7 A;  4YTN A;  1IBL T;  5LOV E;  4H9O C;  3ZT7 A;  2PTF A;  4HTE A;  2DRA A;  1KK7 A;  5HR9 A;  3RIU C;  1D0X A;  4QZC A;  5HYA A;  1I94 T;  4QZA A;  5H6Q B;  4CN1 A;  3OVS A;  4LEV A;  5HRH A;  2BKP A;  1R8B A;  5J0T A;  2GK9 A;  2Q9Q B;  5DBB A;  5EK3 A;  1WLX A;  1R8I A;  4I2I A;  1XSL A;  3RH4 A;  3ZJ2 A;  5KX5 E;  5D4B A;  4RPX A;  4I43 B;  4UEL A;  4BJN A;  4UVA B;  1ZHC A;  1JAJ A;  3PUV F;  5LA6 E;  8ICG A;  4HX0 A;  2WY2 A;  2E5V A;  1ZQF A;  3FXD B;  4O6A A;  4PGY A;  3P4W A;  5ADX L;  4LFA T;  5J0O A;  1KNY A;  5HXS A;  2ACZ A;  4TN7 B;  4WBZ A;  2JIW A;  4H9S E;  8ICU A;  4I2E A;  2H3R A;  1FMV A;  2DWG A;  4XRH A;  4NXV A;  5D46 A;  4U74 A;  4I29 A;  3HKD E;  4ZZB A;  2CRB A;  2V1D B;  1RPL A;  2XAH B;  1WYC A;  1ZQD A;  2C5K T;  4OYJ A;  4NM2 A;  1MMD A;  1MIV A;  4DV3 T;  2YOE A;  2DR7 A;  3AEE A;  3AVS A;  5F5W A;  4TUQ A;  3K1S A;  3BQL A;  3RKO A;  3RJF A;  4UVC B;  2V26 A;  4K9A A;  2KT9 A;  4YN4 A;  4KM5 A;  2ZH7 A;  3JPN A;  2V5C A;  4BAY B;  2I0M A;  2YK0 A;  4P0B A;  3RC8 A;  3TFR A;  4QX7 B;  1M7K A;  2LSK A;  1S94 A;  2VKJ A;  3QK6 A;  4JI2 T;  2XQ4 A;  5L47 A;  3C2K A;  3AXJ B;  3K3N A;  5JDG A;  5IIK A;  5FP3 A;  3LG7 A;  1LRZ A;  3P4Q A;  1IZN B;  2IML A;  4KLE A;  2Q9Q D;  2VQE T;  3HKC E;  3UPQ A;  3EUH A;  2IDO B;  3BQK A;  3FZM B;  4U3C A;  1KNZ A;  4HWC A;  1T98 A;  3M3Z B;  3ZT6 A;  3AVR A;  4R63 A;  3OKQ A;  3HIY A;  1SE7 A;  5FXV A;  4X1K E;  4P4M A;  5L3E B;  4EIW A;  1OED C;  5J2G A;  3VKG A;  3WFR E;  5HRB A;  3AB3 B;  2K3W A;  8ICJ A;  3UXP A;  2KXP B;  3MGI A;  4U2Y A;  8ICB A;  4UAW A;  3FHN A;  2BVM A;  2DLR A;  4KB6 A;  4RWN A;  2LHN A;  4P4P A;  4YMO A;  1YQ3 A;  4M9H A;  4TX5 A;  2ZH3 A;  3GDX A;  9ICA A;  4JLX A;  3V5S A;  4IE7 A;  5LYJ E;  2IUB A;  3CQC B;  2K5B B;  4AQF C;  4X4V A;  4KUM B;  4KP3 C;  4MLK A;  2V7K A;  4YHJ A;  3SFD A;  3LSV A;  2QA7 A;  2XQY A;  5HWY A;  4TWH A;  8ICY A;  3PUZ F;  3CX7 B;  3OVU A;  3AEG A;  5DAB A;  4PW8 A;  3B13 A;  5J29 A;  2YEV C;  1HX1 B;  2FUP A;  2L9Q A;  3CIR A;  1V4A A;  2Y48 B;  5C8Y E;  3JC6 C;  7ICK A;  1G8X A;  5LJM A;  5FY7 A;  1ZQB A;  3OTO T;  5FXX A;  2DHR A;  5LBQ B;  4RPY A;  5J0Q A;  2LE8 A;  1MIW A;  5JRC B;  4A56 A;  5JR9 B;  2UU9 T;  4X62 T;  2BBH A;  4X5V A;  1J1J A;  2FCL A;  3NRX A;  3MA9 A;  4B3T T;  4Z8X A;  2KLQ A;  1HS7 A;  2QGS A;  8ICF A;  4MBQ A;  4IQT A;  4UIG A;  1WFD A;  4JI7 T;  9ICP A;  4GOU A;  5B3P A;  4X4S A;  1XMQ T;  2XQA A;  1XSN A;  2CWY A;  3ZYL A;  4IT4 A;  2ZM0 A;  3RIA A;  3FXE B;  3KVB A;  3O1I A;  1CHU A;  3TLV A;  5LHI B;  2DNX A;  8ICE A;  4X4Q A;  1JNR A;  5JRE A;  3WFP A;  3Q5D A;  3VR8 A;  2ODU A;  3EI0 A;  4QZB A;  4F5P A;  2K48 A;  2A72 A;  5L3C B;  5AQS B;  3Q5X A;  1HF8 A;  3A8Y C;  2H89 A;  8ICM A;  2VUR A;  3AE1 A;  8ICR A;  1JMS A;  4ZS2 A;  4H63 H;  1FJG T;  2ZH6 A;  3R6N A;  1ZQO A;  4CI3 B;  4O2A E;  3D0T A;  2BS3 A;  4QXC B;  4ILC A;  1QSD A;  2L3L A;  2LKH A;  2ZM2 A;  4DOB A;  4F8H A;  2GWS A;  9ICF A;  1ZOY A;  1NAF A;  5DB9 A;  5A1L A;  2BPG A;  2LRL A;  4ASK A;  4FH3 A;  4RWP A;  4MFC A;  4OK0 A;  5J0R A;  3HWT A;  4H9Q C;  2WS3 A;  3ZKR A;  1WOT A;  1XZY A;  3RH3 A;  2C5I T;  3QB5 K;  3PUW F;  2D0T A;  4RPZ A;  3V72 A;  4U7I A;  3H39 A;  5L4H A;  4K4H A;  5CA1 E;  4HFI A;  4IE4 A;  4TUP A;  3ISB A;  1CUN A;  3RH6 A;  3ZSS A;  2UXC T;  5HRF A;  4GYS A;  2WAU A;  3K3Q C;  5E0O A;  8ICA A;  4TZ4 C;  1HNZ T;  2Y8D A;  4L5G A;  3C98 B;  4R65 A;  1J5W A;  5LGT B;  3N9O A;  3RPU A;  2JQ9 A;  2VWA A;  5FY1 A;  4DV1 T;  4ZZC A;  2CEA A;  2XM2 A;  4MHC A;  3TLW A;  7ICN A;  1QLB A;  4WZX A;  1LKX A;  3AQM A;  4JV5 T;  4PHP A;  8ICK A;  4HE8 A;  3OJA A;  1XMO T;  2VAN A;  4X4O A;  4IL9 A;  4EAH A;  3UUL A;  1J5E T;  1JNZ A;  3SFE A;  2BBJ A;  1ZQT A;  5HEO A;  2PBE A;  2L8K A;  2MTQ A;  4ZXL A;  3LK2 B;  1HUZ A;  9ICX A;  4HFE A;  2BPF A;  1WCR A;  5IYZ E;  1ZQP A;  2B76 A;  8ICL A;  2KND A;  4DR6 T;  1R8C A;  5DBC A;  4DOC A;  1YQ4 A;  3O1J A;  3L9D A;  3RJG A;  4X1I E;  4B3S T;  4YTM A;  5BOM A;  1ZQM A;  5LG3 A;  5LGU B;  2FJD A;  4U31 A;  4GKK T;  2XAJ B;  3AE6 A;  2Y6X A;  5JDH A;  4EBJ A;  4FH5 A;  4XZC A;  5BPC A;  4K97 A;  2FBW A;  4CXW A;  3JPS A;  3M65 A;  1NEK A;  1D0Z A;  4DO9 A;  4X0B A;  3F57 A;  3HJ4 A;  5LGN B;  1W0B A;  2O5A A;  5AQT B;  2MPK A;  4X1Y E;  4AT9 A;  3RQW A;  2DCF A;  2X9H A;  5DKW A;  2IHM A;  1R89 A;  1ZQR A;  2E9X B;  2VL8 A;  3RH5 A;  4DUY T;  2H7O A;  4JWM A;  2ZH8 A;  2DI4 A;  4I2B A;  2B4V A;  5D49 A;  2CMR A;  1OED A;  4EYU A;  4O2B E;  4DMV A;  5ABF A;  4QZG A;  3OV7 A;  3ONX A;  2WP9 A;  2NP9 A;  1D1B A;  4GYR A;  4FHX A;  3LFM A;  2HH7 A;  4QZE A;  2RFF A;  4TUY E;  2X68 A;  4EZH A;  4KLS A;  1S35 A;  2XAG B;  8ICO A;  3RJK A;  4NXZ A;  2ZH4 A;  3EVY A;  4UV8 B;  4X64 T;  5CR0 A;  5CB1 A;  5J0S A;  4KLQ A;  5L2L A;  4EGW A;  4RT2 A;  3A7M A;  1L0V A;  1VRB A;  5J2E A;  2I9G A;  4O5K A;  3C5F A;  5DED A;  4TV8 E;  3N9P A;  7ICL A;  5FYM A;  4AQF A;  1NO5 A;  3MXZ A;  3AE4 A;  3AE8 A;  5AQJ B;  4M5D A;  4IG8 A;  3C4W A;  4IDN A;  1ZQU A;  3U78 A;  3FZK B;  4R66 A;  3TLU A;  3VU7 H;  3V7L A;  2NOX A;  4AIS A;  3ANW A;  3KV6 A;  4F6R C;  4ADZ A;  8ICZ A;  5IIN A;  4O4J E;  3B0Y A;  2LT3 A;  3ER8 C;  4UR9 A;  1MND A;  2FJE A;  3KV5 A;  4I50 E;  4YFS A;  2YU2 A;  3CVR A;  1N32 T;  2BKO A;  4NUV A;  3G06 A;  2D0U A;  2NR4 A;  4EZ4 A;  3EF2 A;  1XSP A;  3MZK B;  1OED E;  4O67 A;  3OPC A;  4K4I A;  2DR5 A;  2F4V T;  4C90 A;  1UK5 A;  3PUS A;  3V7J A;  4WW0 A;  5J0Y A;  1UEV A;  2FJB A;  2D2S A;  4L9I A;  5TAO A;  1UX4 A;  2CBI A;  3PUA A;  3H38 A;  2E9X D;  3RF1 A;  2X0H A;  5DQW A;  8ICV A;  2X51 A;  5CFS A;  3E08 A;  3UQ4 A;  3AA7 B;  4I2D A;  4DMW A;  5AQL B;  4YY3 T;  3RJH A;  4ZHQ E;  4ZI7 E;  4OYK A;  8ICC A;  2K24 A;  3PHZ A;  3QOF A;  2G0U A;  3KBT A;  2KZ7 B;  2UUA T;  2V8S V;  1OU5 A;  3UFE A;  1D0Y A;  1B7T A;  5AQF B;  4JBW F;  2LKG A;  2B1E A;  3TLS A;  5JRC A;  7ICG A;  3KV4 A;  5JR9 A;  4GXJ A;  5HWX A;  4ZI3 C;  4JWN A;  3UUM A;  3L09 A;  3OBV E;  2M2U A;  2W61 A;  3B5M A;  2X67 A;  4P1N A;  3KIN B;  4GIW A;  4LZD A;  5J0W A;  5L3D B;  3UFG A;  4N7R A;  2WQY A;  8ICP A;  2WMO A;  1FEW A;  5CGM A;  3FZH B;  2PJQ A;  1UUS A;  5FVL A;  4X4T A;  1Q78 A;  5CFB A;  5EOZ A;  4CXY A;  5FKY A;  5M4Y A;  1T72 A;  2W00 A;  4ZOL E;  1E2A A;  9ICC A;  5J2I A;  2XM1 A;  4IL4 A;  3OYZ A;  3P4P A;  2X9X A;  3BK9 A;  3RYC E;  4OAI Z;  3AU6 A;  4OAH A;  3C66 A;  4LF4 T;  3AED A;  4AKH A;  4K0U A;  4AT9 B;  5CFU A;  3PDY A;  3ISC A;  3CQG B;  5DB8 A;  2VB6 A;  2ES0 A;  1N34 T;  5J0U A;  3NYB A;  4WC2 A;  3C64 A;  4B3R T;  3K75 D;  4AT7 A;  1OED B;  5DBA A;  2BS2 A;  5ABF B;  4DR5 T;  2OA5 A;  2E8I A;  4J2C A;  4JI4 T;  4IQW A;  4KLL A;  5AQO B;  3RIF A;  4PK6 A;  2BG9 C;  1KNP A;  5IIJ A;  3RQU A;  5C3J A;  1ZQV A;  5J1G A;  3UT5 E;  2NW9 A;  2LLY A;  4PFO A;  2LM9 A;  4DBQ A;  1YKH B;  5HHH A;  1HTJ F;  3UQ7 A;  2WCA A;  4PGQ A;  3Q9D A;  5JDN A;  2VKH A;  5AQV B;  3NBX X;  4KLI A;  4KLF A;  4KBM B;  7ICR A;  4UVB B;  5DB6 A;  2XUE A;  5AQP B;  4QXB B;  2IHR 1;  3ZCI A;  3P50 A;  5J2B A;  4PJJ A;  2DR8 A;  8ICS A;  3JPQ A;  5IIO A;  3LDQ B;  4I0U A;  2ZH1 A;  4QH1 A;  5BOL A;  4X66 T;  1FIO A;  4CI1 B;  5CJ7 A;  3ANW B;  2X66 A;  2CM0 A;  2W2U A;  3H3A A;  1WYB A;  3IEE A;  4NM1 A;  1BPZ A;  1HNW T;  4TWF A;  2W62 A;  2BPC A;  4IE5 A;  4YCX A;  3MDA A;  3GN5 B;  5F8P A;  4K4G A;  2ACX A;  2W4X A;  1TFW A;  3JAD A;  2RA1 A;  4HEA A;  2QVA A;  4COF A;  2V6X A;  4FHP A;  1E7P A;  3L8R A;  3I0O A;  3HI2 A;  1KEY A;  3HX0 A;  3ZYM A;  1W0A A;  5HXR A;  8ICX A;  4YMN A;  2WWV A;  4R64 A; 
#chains in the Genus database with same CATH homology
 3JCF A;  4EV6 A;  2IUB A;  4I0U A;  4EEB A;  4EGW A;  2HN1 A;  2BBH A;  2HN2 A;  3RKG A;  2BBJ A;  3NVO A;  5JTG A;  3NWI A;  3CK6 A;  4EED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...