4EEBA

Cora coiled-coil mutant under mg2+ absence
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
324
structure length
314
Chain Sequence
DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport
molecule keywords Magnesium transport protein CorA
total genus 95
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eebA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eebA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eebA01
3NVOA 2BBJA 3NWIA 2HN1A 4I0UA 3JCFA 5JTGA 2BBHA 2IUBA 3RKGA 3CK6A 2HN2A 4EEDA 4EEBA 4EGWA 4EV6A
chains in the Genus database with same CATH superfamily
4CQIA 4K4IA 4CI1B 4ATBB 5J2UE 4M9HA 3X1DA 2FUPA 4UR9A 2BS3A 2X0HA 2WCAA 4RPXA 8ICXA 3A5XA 4WQLA 3P4PA 2PBEA 8ICWA 3ONXA 7ICHA 2E2AA 1D1CA 2IC6A 1BR2A 4RWOA 3ERCC 4LZGA 3EUHA 5FNVE 1OEDB 3RYCE 2E9XB 1I94T 1WYBA 2C5KT 3O1HA 2BVMA 1OWAA 5LOVE 5AQVB 4ADZA 4MKPA 4I27A 3VHLA 2V7MA 5J0QA 9ICIA 2X0LB 2CMRA 2W62A 2WU5A 4K0UA 4ISTA 2AE9A 4P4MA 3HJ1A 2W2UA 2JIWA 3VKGA 2E9XD 5J2IA 3LBXB 4R66A 4OYJA 3AU6A 4TUYE 1YQ3A 3UTKA 4HKAA 1GPJA 4IQUA 2WP9A 4K0KT 3WAJA 2DR8A 3FZMB 2QVAA 4PGXA 3NKZA 1JN3A 4FI5A 2YINA 3Q5EA 2W9MA 4LEVA 4WW0A 1BPEA 2C5JA 5J0PA 1CUNA 4YTMA 2WZIA 2X9WA 4O68A 4X65T 3H3AA 4ZI3C 4UAWA 2ODUA 2BZBA 3ZYLA 4XA5A 1XDOA 1XZYA 3FB2A 3LFMA 4V1Av 3MGIA 3PMNA 2NWBA 4OAIZ 4MFAA 3NRXA 4TNVA 4OAHA 1ZOYA 1BPDA 4FHWA 2HPJA 5IIMA 3ISDA 4NXUA 2BKPA 2XQ5A 5AQSB 1HR0T 2LM9A 5CB4E 4TUQA 3E08A 5F2VO 5J0WA 1HG2A 2MAWA 4NKTA 5D63A 4AXPA 1MMGA 1RPLA 3GA8A 1HF8A 3AA7B 3PURA 1YD8G 4KI0F 1KDHA 1PX5A 2C5IT 1O3XA 3RGLA 4IHJE 4P4PA 1JQRA 4YJ3E 1KFYA 4DV0T 3MBYA 2UUBT 4U74A 3ZYMA 3QC9A 5HXHA 4GOUA 2JMHA 3N9MA 4PK6A 4K99A 4FHPA 9ICSA 4AT8A 2XM2A 3UFGA 4YXDA 3CKDA 3TFRA 7ICJA 5IIIA 5HXEA 4UBCA 3MA9A 3MDAA 1OXZA 2CBJA 5J0ZA 2EHOC 2VB6A 2OA5A 4EAHA 2UXDT 3AEFA 2ISOA 9ICRA 1OEDC 4CI2B 8ICOA 1TFYA 2VWAA 2ZHBA 2DRBA 4X1YE 2W66A 5F8PA 5DB6A 4BAYB 3SWHA 4XQ8A 5HCJA 2XHEB 2H3RA 5J2HA 3FXDB 5L3BB 4JWNA 5D62A 4QHOA 9ICHA 3ZMVB 3ESLA 4QZHA 5JDLA 5HHHA 3AE3A 1N33T 4YSXA 1W09A 3N9PA 5LMNT 4H63H 4KMCA 3HJ4A 9ICLA 3J7Yq 3QB5K 3TLTA 5TAOA 1DU2A 4X4RA 5AQIB 4NXMT 5D61A 3MGHA 4PJLA 4EV6A 4KLGA 2FBWA 3NVOA 2BBJA 1D0YA 3WAKA 2XAFB 4Z91A 4QZ8A 3LSVA 4BJMA 4EIWA 3AB3B 1I6ZA 3DTOA 5AQLB 5KMGP 4WC2A 8ICVA 2D0TA 2IHOA 1WRDA 5AQPB 3AEDA 4EGWA 1H7CA 4X62T 2HPLA 4KLTA 1UGOA 2DL1A 1HTJF 3AE9A 2ZH1A 4DOAA 4Z90A 2Y8DA 3RKGA 4IQTA 4B3MT 4DR3T 3CPZA 2XQ4A 2DHRA 2IW5B 4QZEA 2SPCA 4X4NA 3ZCIA 2XJ7A 5EK3A 1J5WA 4CN4A 3N9NA 3ZN1B 2OV9A 5JREA 5LG3A 4QXHB 4F6RC 4FO1A 3U3IA 3WFPA 4WC7A 1KNZA 2M2TA 4N7RA 3ZN0B 2UXNB 4E7SA 2V26A 3AE4A 4QH1A 2DR5A 3LQCB 2QYWA 4YTNA 4UELA 5ABGA 3R84B 4JV5T 4KP3C 5JR9A 5M4YA 4FHXA 3AQMA 5IUXA 4DV7T 3OUYB 3OKQA 3ZMTB 5L4EA 3RJFA 2LRLA 3NKUA 3F31A 5H6RB 4LF9T 4LFBT 5CP2A 5FP3A 3GWHA 4EYUA 4EXTA 4QZ9A 4I50E 5DDYA 3MDCA 2XQYA 2AXDS 2CCQA 2WZHA 4GXJA 2WM9A 4L9IA 4O4LE 4YLHA 4OK0A 3PNCA 3C4ZA 4NXTA 1W9RA 4RQ4A 4P09A 4YY3T 4TX5A 2BG9A 1ZQWA 4PAGA 3CQCB 4RQ6A 4DO0A 3V72A 5L3EB 3ZSTA 2H88A 3EHZA 4UF0B 3I9YA 4XBFB 2BCVA 4JEUB 2LHNA 5J2EA 4AQFA 4K4HA 4DV5T 3MKDA 7ICLA 1MMAA 2LSYA 1XMOT 3IBPA 1ZQGA 5JRCB 5FXWA 5AQMB 2I6HA 4A97A 4FHVA 4UBBA 3GDXA 4LT6A 4KLUA 4A56A 1KK7A 4MFFA 2LKGA 2R6GF 4DNDA 4O5EA 4LEZA 4H9NC 3QK6A 2E9XA 4NLKA 4E80A 1G8XA 2LSKA 5HRKA 5FY7A 4ZI7E 5HCMA 5EZYE 5HXSA 4KHZF 1ZQHA 3UXOA 3AXJB 3ZMZB 4GXKA 2IHMA 9ICTA 3Q5XA 1BPYA 4QH5A 4JI3T 4OFZA 5HXRA 4I2HA 3P4QA 2N9DA 2CM0A 3AE2A 2V6YB 1ZQJA 3UQ4A 4JEHB 2JMKA 3HR0A 4B3ST 3ABVA 4X4SA 2DR7A 4M04A 5AQGB 4NLZA 3HKDE 4WYVA 3VU7H 5BOLA 3N2OA 3C18A 3C5FA 5LGUB 4HEAA 2Q9QD 2V1DB 5DQVA 2CRBA 4GK5E 5L3CB 2KXPB 3GMIA 2M2WA 3KV5A 5TZVA 5LNKA 3AEEA 4GYRA 4WZXA 1QUUA 1UURA 3PUVF 3UT5E 9ICMA 4O4IE 4X4TA 4K96A 3RHWA 3JADA 2WQYA 3PE0A 3N2KE 4XQ7A 3LK3B 7ICTA 1HX8A 2XZEA 3Q5DA 3MZKB 4C90A 4WC1A 3HKCE 3RI5A 1ZQBA 2Q9QA 4AKGA 2I0MA 5AQFB 2EHOD 4LF7T 1HX1B 3PJAA 4JWMA 3H38A 2ZH8A 5AFUL 1ZQYA 8ICQA 9ICVA 2KT9A 4TUPA 4P2HA 1ZQTA 1FEWA 2XSAA 4PFOA 4AKHA 4YMOA 3BQIA 4QH4A 4AIUA 2BS2A 2WDRA 2M67A 7ICSA 3PU8A 3OVAA 2FJBA 1MQ2A 2WMNA 1S35A 3KV4A 5KDMC 4X0AA 2YU1A 1MNDA 1VCTA 2WWUA 2J1DG 4X64T 1IJ5A 4AKRB 5J2GA 4WBYA 2FMSA 4UEMA 2BCQA 4JBWF 3FBZA 3UQ2A 4HWHA 4PJMA 4YHHT 4IGUA 2WY2A 4XRHA 8ICCA 3AUOA 7ICOA 4LMLA 4DR2T 8ICHA 4COFA 1ZQMA 3OGUA 2EHOB 3ETVA 4QXBB 2YKSA 4NXZA 4FHYA 4E7XA 4I2GA 4F5OA 5CA7A 3WFSC 3SFEA 1R89A 2EWRA 3FZLB 4PJJA 2XQ3A 3K7DA 8ICYA 3UUBA 4JI0T 2KWHA 2LEHA 3UPSA 3ZJ1A 4F5RA 2UU9T 4Q25A 4M9GA 4LF4T 2KSRA 2LLYA 8ICKA 2NP9A 4YCXA 4I4TE 5HWXA 3TLSA 8ICMA 3HWTA 4UAZA 2CEAA 3JAFA 4IDPA 2DR9A 1XSLA 2BG9C 1HNXT 4WC3A 9ICAA 4X4QA 3P7IA 3S4UA 4H9QC 5HYAA 3AVRA 3ZJ2A 5LJMA 3JZ0A 3PMLA 5L3DB 1CHUA 5HHIA 4DR5T 3RPUA 4Z6CA 2DLRA 7ICNA 3UXPA 4GIWA 2IAKA 2VKJA 3NRYA 4HFDA 4O2BE 4PJNA 3B13A 4P4OA 4AKIA 2CLYB 2V5CA 5HXCA 1FMWA 4YN4A 4LF6T 4KLFA 2ID1A 3PDYA 5J29A 2VQFT 2LRKA 4AT7A 3V7KA 5DQWA 1ZQCA 4F5PA 1N34T 4P0AA 3L3PA 2X9HA 2JQQA 4HN9A 4JI5T 2WDVA 4JUYA 4PGQA 4ZI3D 2JPFA 5J2FA 1XSNA 4X66T 9ICEA 4HFVA 4I2CA 5L47A 1TV9A 3JYYA 8ICNA 1KEYA 3VR8A 5CFBA 4DBQA 4IDZA 4DBRA 4UF0A 3FZKB 4UB5A 1BPBA 3RX6A 4YTPA 3FXEB 2NW9A 2WU2A 4IQWA 2EHOA 2A2FX 1YKEB 3O9XA 4LZDA 2XAHB 5J0UA 4DV1T 4PFPA 5FY1A 4DV6T 9ICFA 1BR1A 2NRKA 7ICQA 3K1SA 2CWOA 4CN1A 2DI4A 2XASB 4UV9B 3CMLA 1HNWT 4R64A 4UIGA 2UXXB 3ZT6A 4CZZB 2M6BA 2XQAA 4DV3T 4K9BA 2DWGA 3JPQA 3OYZA 4NXXA 3RIUA 2HH7A 2ES0A 1UEVA 5HRBA 2KNDA 4DVDA 3AEAA 3T8OA 4TN7B 4LMJA 5HRFA 4TWHA 4FO6A 5AQQB 4NIQA 5HRHA 4X0BA 1BR4A 9ICPA 3JAEA 4RT2A 4X5VA 1SUMB 8ICAA 3ANWB 4GXIA 5GONE 8ICFA 2PFPA 4B3RT 4YSZA 4JLEA 3RIUC 4EYYR 5LCYA 3C51A 4H9RC 1E7PA 5LYJE 3C2MA 4ILBA 1UETA 2X68A 3F2EA 3MK7C 5IIOA 1OEDA 3AXJA 3SOLA 3EDUA 4O2AE 3V5UA 3ZPOA 4GYSA 3RC8A 3RF1A 4ILCA 5BMVE 4OHFA 3A7MA 4RQ1A 3B5MA 3VRAA 4AKLA 2D2SA 5L2LA 3CQXC 2FMQA 4OX9T 3C64A 4Z6DA 5CFSA 2CXFA 7ICGA 2B1EA 3MACA 2JQHA 4XAXB 2VKDA 1SE7A 3JPOA 5DECA 2BKNA 1IJ6A 4QZGA 3C2LA 2CPTA 5KX5E 2ACXA 3UU8A 3K75D 4O6AA 2ZM8A 3ZYKA 2M2UA 4IT4A 3LK2B 1FA0A 4H63V 5DB9A 4OAFA 4WH5A 3JC6C 4QX8B 3TFSA 3WFQE 4EOZB 1D1BA 2IIUA 3AQKA 5CA1E 4RWQA 5LG4A 5HC9A 2H89A 3I9WA 5ABFB 4XUSA 2RFFA 3CX8B 8ICTA 3OVUA 4K4GA 3AA0B 5FVKA 2ISPA 3ANWA 4WBNE 3AQNA 4M2YA 2M6IA 5J0TA 2KLQA 4PHDA 3ER8C 4HFIA 2B76A 4JI4T 2HN1A 4O69A 5J2DA 4G63A 1UX5A 1Q79A 3OBVE 3PUAA 3OVSA 3KDSE 1ZQPA 3PUWF 4LF8T 4KLEA 3ZCJA 4ILAA 1XDPA 3I0OA 1V9DA 3N9LA 4TWFA 3AE8A 1IZNB 1BPZA 5IINA 2ZM6T 4IE0A 4ILUA 5JTGA 3N2GE 9ICUA 3AA1B 4U7YA 4RPZA 4I2DA 1ZJNA 5J1GA 4JI8T 4KLIA 2J4GA 4UVAB 3VKHA 4RQ2A 3WFRE 2MPKA 4PK5A 1ZV4X 3H39A 3T1HT 5LHHB 2IDOB 2K24A 3DJBA 4JLZA 4NM1A 3SRZA 4I28A 4DUZT 2B51A 4YD2A 4ZS2A 1ZQLA 9ICNA 5D46A 4X4PA 3KINB 5B3QA 5ABHA 5FL1A 1TVAA 5AQUB 5LMUT 3KVBA 9ICJA 1IBMT 3HX0A 2GA9D 4M1PA 2MBGA 1IBKT 4ANJA 4ZZCA 1QSDA 8ICZA 3TLVA 3OPCA 4U3CA 1BPXA 2CHOA 2W61A 4NXVA 4X20E 4ZS3A 3OUYA 5JDHA 4I2AA 2BCSA 3P4RA 2W0GA 3RLFF 1KEJA 2Y6XA 5AQOB 5DBBA 2CWYA 2PFVA 4KUMB 2ZMAA 1ZP0A 4H9PC 1KNYA 5DJQC 4HE8A 3RKOA 3W15B 5ABFA 4LFAT 3JPNA 1LVFA 2FJDA 4YMNA 3RH3A 4MF2A 4I2IA 1WYCA 4KBMB 3PJAJ 3EF2A 1YLQA 5D4BA 1MMDA 4B3TT 3KBTA 4NUVA 3OTOT 5F5WA 3EDVA 4YJ2E 1U4QA 4H9OC 3C2KA 4AT9B 2QGSA 4I29A 2M2VA 4M9LA 4WCWA 4KM5A 2WMOA 3FZHB 4QZAA 2X67A 5LJNA 2KWIB 4PPXA 4YHJA 1XNQT 3RRWA 2BPFA 2XM1A 3HL6A 4O5KA 3OWGA 4JYAT 2VQET 1NO5A 2N1GA 3UUXB 2V8SV 2Y48B 2VASA 4X1KE 4ASKA 1ZQKA 2YK0A 2X0YA 3AE7A 2W4XA 4DIDB 4QZDA 2NW8A 3SFDA 1AJ3A 3HI2A 4TNWA 2O1PA 4G2AA 4KLQA 1IAPA 4ZXLA 5C3JA 5CFTA 3WFOA 4I2BA 4TV8E 4WC4A 2LT3A 2RP4A 8ICBA 2IMLA 2W67A 2IHR1 5DB8A 4EEDA 5CGMA 4ZI2D 1M7KA 2X9XA 3PUYF 3GN5B 3RC3A 1R8AA 2GAFD 3NBXX 5DB7A 2BBHA 3JC6D 4ZHQE 3OV7A 5LP6E 2L8KA 4E8FA 4UB2A 5CB1A 2D0UA 3K3QC 5ABEA 4IL4A 3IHRA 8ICEA 2D5UA 3ZT5A 1ZQIA 1D0ZA 1E2AA 1HCIA 1VJ7A 4IREA 4R65A 3OJAA 5JDNA 2NTXA 3UFEA 5IIJA 3EAMA 3K3OA 4TV9E 3VR9A 4NY8A 4YT0A 5AQJB 4PHAA 2P9BA 5DBAA 3EI0A 2ZH4A 4I43B 5ADXL 5JDMA 2VKOA 4WQKA 2IUBA 3P50A 4JI2T 1Y01A 4IDOA 5CFUA 3FBLA 1WOTA 3PUZF 4KLHA 5HEGA 3R6NA 4DV2T 2D9DA 4PK4A 3RH5A 3HKBE 2KINB 1ZQQA 3N9QA 4EP7A 2C0SA 3WI3A 2CHNA 1UK5A 3IEEA 2LOPA 2ZH5A 3LBXA 1M62A 4NUUA 1MIWA 1VCSA 4LEYA 5AQKB 4OAGA 2I9GA 2MYSA 4NXWA 4O5CA 1ZQNA 3B0XA 4U33A 2K9AA 1B7TA 2JRKA 4ATBA 3KV9A 4S3NA 5HRLA 4CXYA 4EEBA 4RWNA 1NAFA 3NZPA 3V7LA 3PU3A 4DMVA 4HWIB 3AE5A 4DV4T 4K8VA 4X4OA 4BJNA 3PUXF 3FHNA 5L3FB 8ICRA 5LXTE 2VVSA 4U31A 5JDGA 4FJOA 4RT3A 3MXZA 1LVKA 2V6XA 3LK42 5CHGA 5BOMA 3L8RA 3JPPA 2W63A 3AU2A 4KHPT 2K3WA 4PHPA 5J2BA 1E1HB 1MMNA 1J1JA 4WBZA 1XSPA 8ICUA 9ICXA 1Y64B 3BQKA 4HFHA 5LHGB 4UB4A 1T8BA 3L39A 2LKHA 3LK9A 1YKHB 9ICKA 1UX4A 4HWCA 1MIYA 2BCUA 1NWMX 4B6XA 3LDQB 2XTLA 3CQGB 4EZHA 3P4WA 4ERRA 3PUSA 5FVLA 1HFAA 2YDSA 2WBLA 2QA7A 1XNRT 4NM2A 2DVIA 2V5DA 4DUYT 4M9NA 3U78A 2WB5A 3NYBA 5HWYA 5J0RA 3ZMSB 1YW0A 5J0OA 3AQLA 2JJ9A 4L0RA 5AQHB 4E7ZA 1TFWA 4UVBB 3PTRB 3KVAA 3RIFA 3UU4A 3CIRA 4I2JA 2BPGA 2FJEA 2CBIA 3OVBA 4JI6T 3H3MA 9ICWA 4KX6A 7ICFA 3O4XE 4NLNA 2PJQA 3EVYA 1FJGT 3EABA 1GQEA 3ZLIA 5L3GB 5F3JA 1JNRA 4EB6E 5IILA 1ZQFA 4QXCB 2ZHAA 2P66A 4KLJA 3ISBA 2Q66A 5J0XA 2YDQA 2VURA 4IG8A 4Z6EA 4CXWA 9ICBA 4HWFA 2X9YA 2CA5A 3B57A 2FCLA 2LOSA 3QNUA 1KNRA 5H6QB 3RQWA 2XQ8A 2NW7A 3F57A 1VFGA 2J47A 2CLYC 4MHCA 2XAQB 3PV0F 3RJIA 4P0BA 2XSBA 4Z8XA 3AEGA 1F5AA 5CWRA 3AA6B 3C66A 4KLMA 2JQKA 2LM2A 5FXVA 2PFNA 4AISA 5LBQB 2NTYA 2Q9QC 4GK0E 5FXZA 5HEHA 3L9DA 9ICOA 4MBQA 5JDFA 3ONLC 3G06A 4MFCA 2PBIA 1JMSA 3TLWA 4HX0A 2PFOA 7ICIA 4NPPA 1ZHCA 4IQVA 3RJJA 4X5TA 4FH5A 4RPYA 1JAJA 4F8HA 5L4HA 3RIAA 7ICKA 2Q9QB 3ISCA 4IE6A 5DABA 4QZFA 3PUGA 4WC0A 4AI6A 1R8IA 2FJAA 4Z6FA 4P1NA 5EOZA 2B56A 4F5NA 4X1IE 1QLBA 3MJXA 4FH3A 1T7SA 5IWAT 4I0UA 3C4WA 9ICQA 9ICCA 3MCRA 2BDEA 4O4JE 2BCRA 3ZC0A 1ZEEA 2MOZA 4X4UA 5BR8T 4DR6T 2UUCT 4R63A 3UU6A 4CXXA 3CK6A 5C2TA 1X9BA 4RQ0A 2LSIA 3AAAB 1T72A 3RH4A 2XY8B 2WAUA 4O67A 5CR0A 4ZEYA 2XAJB 3RRCA 1G73A 1S94A 3NWIA 5B3PA 2VK9A 8ICGA 2LSGA 3ZKRA 3IA3A 5FKYA 2A72A 7ICVA 4DR1T 4UAYA 2HN2A 2V7IA 3T1YT 5JDQA 3HIYA 4J2CA 4WC5A 4M47A 2FMPA 1ZQSA 4LF5T 4BA9A 2F4VT 2WS3A 2L9QA 2V6YA 2YDRA 4TUSA 3LG7A 5FY0A 3Q9DA 4IE5A 2XQ9A 7ICPA 4MLKA 4ZZBA 1WCRA 2DCFA 3TKLB 1ZQRA 2HHPA 4U72A 3Q5WA 8ICLA 4QWNB 4U2ZA 5IHYA 2BG9B 2XAGB 5CA0E 7ICMA 3D0TA 4O4HE 4HFCA 8ICPA 3N5LA 2VL8A 5EK4A 5HRGA 2WWVA 1SHZC 4HGAA 1OU5A 4K9AA 3L09A 3KBUA 3CX7B 2DRAA 5JQGE 4DOCA 1MIVA 3CX6B 4H9SE 3AAEB 3M65A 1NEKA 3TLUA 2K5BB 2H7OA 2X51A 5AQTB 2PXIA 3K3NA 4CN6A 2B4VA 5HRIA 4M9JA 5ETWA 3I1AA 2ZH7A 4U2YA 4IE7A 4KB6A 4WNKA 1U5PA 5LBMA 4OYKA 4UD4A 2OLTA 5J2CA 1ZQOA 2DNXA 3QB5A 5DDMA 4HWDA 3HKEE 4PGYA 3RJEA 3UUMA 4LEWA 3HW8A 2XPKA 5CJ7A 1RZTA 3AVSA 4DOBA 3UPQA 5IYZE 5J2TE 2LSJA 3GN5A 2J62A 4A5XA 5LGTB 5CJ5A 5DBCA 4TZ4C 1R8CA 5FYMA 5AQRB 2BG9E 4PNIA 5A1LA 1NOMA 2KZ7B 4GKKT 3SS1A 4RQ3A 2WSSV 2PG8A 3E0ZA 1ZQXA 3M3ZB 2A3DA 4RQ7A 3BQLA 3AE6A 4UVCB 2E5VA 1HUOA 4AT8B 2ZM0A 1D0XA 2UUAT 7ICRA 3Q2MA 1IBLT 3UXNA 4I2EA 1R8BA 2ZH6A 3RJHA 4JLXA 4PH5A 1KNPA 1Q78A 2E9XC 2E8IA 3UUNA 3AE1A 3CVRA 2JQ9A 4IIJE 3V7JA 1VOMA 3RJGA 8ICJA 5J2AA 1US7B 5J0YA 5JH7E 4ZI2C 4MF8A 3JPSA 2RPAA 1D1AA 4I2FA 3ZSSA 1ZJMA 3C50A 4QZIA 4LVSA 4KLSA 2H7VC 3ZMUB 4KLOA 4KLLA 3DP7A 2BVLA 4DR7T 4JI7T 3UULA 5C8YE 3C5GA 3ETUA 5IIKA 4K97A 8ICSA 4RQ5A 5FXXA 2K48A 4QZCA 5KXJA 4AT9A 1MQ3A 2DWKA 2YN6A 1Z0PA 4O8SA 2X66A 2O5AA 2ZM2A 5JR9C 4YFSA 2CXDA 1FIOA 1KF6A 1HG5A 4IDNA 2BE3A 2NOXA 2WDQA 2BPCA 1WR6A 4QZBA 1N32T 3ZT7A 4LMKA 4UXNB 5HRDA 2ACZA 4TWDA 4JI1T 4UD5A 3UQ0A 1W0BA 4DMWA 4M0AA 3JPRA 2MTQA 3J9X1 4N78D 4QX7B 3UU3A 2BKOA 2VVNA 4CI3B 1L0VA 5CHEA 2VL0A 3ER9B 1LRZA 3ZEFB 1JNZA 1VRBA 3HA4A 4U7IA 3UQ7A 1YQ4A 4MALA 2G0UA 2GWSA 2LHRA 4F5QA 1HUZA 3P4SA 4XJEA 1T98A 3I0QA 4DO9A 2KMFA 2W00A 3RYIE 8ICIA 1J5ET 5DEDA 5BPCA 3RH6A 2RA1A 7ICUA 2GK9A 1HS7A 3IF8B 2VANA 3RJKA 3O1JA 5AQNB 4A98A 2N2NA 1ZQUA 1NENA 4UV8B 4ZOLE 4AQGA 2UXCT 4EBKA 1SA0E 9ICGA 2BS4A 2XUEA 2HHHT 1YXRA 3ONJA 3ZC1A 2E5LT 5LB7B 2XQ6A 2ZLYA 3QOFA 5HREA 3JPTA 2V7JA 3P8CD 4X4VA 3NZQA 2L3LA 4M5DA 1MNEA 2QRXA 4HFEA 4WBOA 5DKWA 1LKXA 4HTEA 3B0YA 2PFQA 1BR0A 5LGNB 2LE8A 3C98B 3FZFB 4PW8A 5LHIB 1WLXA 4YD1A 4EBJA 3KV6A 2CE7A 1HNZT 4LFCT 4YMMA 2CXLA 2I59A 1UCUA 2VKHA 3QUJA 3RQUA 1X79A 4QKNA 4AT7B 7ICEA 1ZQDA 5HEUA 1W0AA 3RYFE 3C4XA 2V7LA 5HR9A 4ISSA 2ZH3A 3BK9A 3AEBA 5HEOA 4HFBA 4PHEA 5E0OA 1V4AA 5J2KA 1WR0A 3RYHE 5JR9B 4UB3A 1ZQEA 2V7KA 3UU5A 2ZH9A 1ZKEA 5JRCA 3E22E 4O9MA 4MFRA 1UEUA 4WC6A 3K8PC 4AQFC 2ODVA 3KFWX 3PUQA 4NKUA 5EK2A 4L5GA 4GKJT 3VRBA 4IE4A 4K98A 1ZQZA 4IL9A 1Z8UA 5HAXA 4DR4T 3JCFA 3N9OA 4YSYA 2YOEA 3AAIA 2IC9A 5FMNA 3PHZA 1XWMA 2XQ7A 3A8YC 3LJCA 4NXNT 4EZ4A 5HEJA 1EZ3A 1ZQVA 3CWZB 5FL0A 2UXBT 5J0SA 3OYXA 2LJLA 1WFDA 2ZH2A 1UUSA 5J2JA 2PTFA 4TURA 3V5SA 2A9UA 3H37A 2NR4A 4WOYA 2YEVC 4IDQA 4AQYT 1N36T 3O1IA 4RWPA 4XZCA 4RQ8A 1OEDE 4UB1A 4KLDA 1FMVA 5D49A 1XMQT 5LA6E 2Z6EA 3AECA 5JVDE 4I55E 2YU2A 1ZQAA 4C91A
chains in the Genus database with same CATH topology
3NVOA 2BBJA 3NWIA 2HN1A 4I0UA 3JCFA 5JTGA 2BBHA 2IUBA 3RKGA 3CK6A 2HN2A 4EEDA 4EEBA 4EGWA 4EV6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVO A;  2BBJ A;  3NWI A;  2HN1 A;  4I0U A;  3JCF A;  5JTG A;  2BBH A;  2IUB A;  3RKG A;  3CK6 A;  2HN2 A;  4EED A;  4EEB A;  4EGW A;  4EV6 A; 
#chains in the Genus database with same CATH topology
 4CQI A;  4K4I A;  4CI1 B;  4ATB B;  5J2U E;  4M9H A;  3X1D A;  2FUP A;  4UR9 A;  2BS3 A;  2X0H A;  2WCA A;  4RPX A;  8ICX A;  3A5X A;  4WQL A;  3P4P A;  2PBE A;  8ICW A;  3ONX A;  7ICH A;  2E2A A;  1D1C A;  2IC6 A;  1BR2 A;  4RWO A;  3ERC C;  4LZG A;  3EUH A;  5FNV E;  1OED B;  3RYC E;  2E9X B;  1I94 T;  1WYB A;  2C5K T;  3O1H A;  2BVM A;  1OWA A;  5LOV E;  5AQV B;  4ADZ A;  4MKP A;  4I27 A;  3VHL A;  2V7M A;  5J0Q A;  9ICI A;  2X0L B;  2CMR A;  2W62 A;  2WU5 A;  4K0U A;  4IST A;  2AE9 A;  4P4M A;  3HJ1 A;  2W2U A;  2JIW A;  3VKG A;  2E9X D;  5J2I A;  3LBX B;  4R66 A;  4OYJ A;  3AU6 A;  4TUY E;  1YQ3 A;  3UTK A;  4HKA A;  1GPJ A;  4IQU A;  2WP9 A;  4K0K T;  3WAJ A;  2DR8 A;  3FZM B;  2QVA A;  4PGX A;  3NKZ A;  1JN3 A;  4FI5 A;  2YIN A;  3Q5E A;  2W9M A;  4LEV A;  4WW0 A;  1BPE A;  2C5J A;  5J0P A;  1CUN A;  4YTM A;  2WZI A;  2X9W A;  4O68 A;  4X65 T;  3H3A A;  4ZI3 C;  4UAW A;  2ODU A;  2BZB A;  3ZYL A;  4XA5 A;  1XDO A;  1XZY A;  3FB2 A;  3LFM A;  4V1A v;  3MGI A;  3PMN A;  2NWB A;  4OAI Z;  4MFA A;  3NRX A;  4TNV A;  4OAH A;  1ZOY A;  1BPD A;  4FHW A;  2HPJ A;  5IIM A;  3ISD A;  4NXU A;  2BKP A;  2XQ5 A;  5AQS B;  1HR0 T;  2LM9 A;  5CB4 E;  4TUQ A;  3E08 A;  5F2V O;  5J0W A;  1HG2 A;  2MAW A;  4NKT A;  5D63 A;  4AXP A;  1MMG A;  1RPL A;  3GA8 A;  1HF8 A;  3AA7 B;  3PUR A;  1YD8 G;  4KI0 F;  1KDH A;  1PX5 A;  2C5I T;  1O3X A;  3RGL A;  4IHJ E;  4P4P A;  1JQR A;  4YJ3 E;  1KFY A;  4DV0 T;  3MBY A;  2UUB T;  4U74 A;  3ZYM A;  3QC9 A;  5HXH A;  4GOU A;  2JMH A;  3N9M A;  4PK6 A;  4K99 A;  4FHP A;  9ICS A;  4AT8 A;  2XM2 A;  3UFG A;  4YXD A;  3CKD A;  3TFR A;  7ICJ A;  5III A;  5HXE A;  4UBC A;  3MA9 A;  3MDA A;  1OXZ A;  2CBJ A;  5J0Z A;  2EHO C;  2VB6 A;  2OA5 A;  4EAH A;  2UXD T;  3AEF A;  2ISO A;  9ICR A;  1OED C;  4CI2 B;  8ICO A;  1TFY A;  2VWA A;  2ZHB A;  2DRB A;  4X1Y E;  2W66 A;  5F8P A;  5DB6 A;  4BAY B;  3SWH A;  4XQ8 A;  5HCJ A;  2XHE B;  2H3R A;  5J2H A;  3FXD B;  5L3B B;  4JWN A;  5D62 A;  4QHO A;  9ICH A;  3ZMV B;  3ESL A;  4QZH A;  5JDL A;  5HHH A;  3AE3 A;  1N33 T;  4YSX A;  1W09 A;  3N9P A;  5LMN T;  4H63 H;  4KMC A;  3HJ4 A;  9ICL A;  3J7Y q;  3QB5 K;  3TLT A;  5TAO A;  1DU2 A;  4X4R A;  5AQI B;  4NXM T;  5D61 A;  3MGH A;  4PJL A;  4EV6 A;  4KLG A;  2FBW A;  3NVO A;  2BBJ A;  1D0Y A;  3WAK A;  2XAF B;  4Z91 A;  4QZ8 A;  3LSV A;  4BJM A;  4EIW A;  3AB3 B;  1I6Z A;  3DTO A;  5AQL B;  5KMG P;  4WC2 A;  8ICV A;  2D0T A;  2IHO A;  1WRD A;  5AQP B;  3AED A;  4EGW A;  1H7C A;  4X62 T;  2HPL A;  4KLT A;  1UGO A;  2DL1 A;  1HTJ F;  3AE9 A;  2ZH1 A;  4DOA A;  4Z90 A;  2Y8D A;  3RKG A;  4IQT A;  4B3M T;  4DR3 T;  3CPZ A;  2XQ4 A;  2DHR A;  2IW5 B;  4QZE A;  2SPC A;  4X4N A;  3ZCI A;  2XJ7 A;  5EK3 A;  1J5W A;  4CN4 A;  3N9N A;  3ZN1 B;  2OV9 A;  5JRE A;  5LG3 A;  4QXH B;  4F6R C;  4FO1 A;  3U3I A;  3WFP A;  4WC7 A;  1KNZ A;  2M2T A;  4N7R A;  3ZN0 B;  2UXN B;  4E7S A;  2V26 A;  3AE4 A;  4QH1 A;  2DR5 A;  3LQC B;  2QYW A;  4YTN A;  4UEL A;  5ABG A;  3R84 B;  4JV5 T;  4KP3 C;  5JR9 A;  5M4Y A;  4FHX A;  3AQM A;  5IUX A;  4DV7 T;  3OUY B;  3OKQ A;  3ZMT B;  5L4E A;  3RJF A;  2LRL A;  3NKU A;  3F31 A;  5H6R B;  4LF9 T;  4LFB T;  5CP2 A;  5FP3 A;  3GWH A;  4EYU A;  4EXT A;  4QZ9 A;  4I50 E;  5DDY A;  3MDC A;  2XQY A;  2AXD S;  2CCQ A;  2WZH A;  4GXJ A;  2WM9 A;  4L9I A;  4O4L E;  4YLH A;  4OK0 A;  3PNC A;  3C4Z A;  4NXT A;  1W9R A;  4RQ4 A;  4P09 A;  4YY3 T;  4TX5 A;  2BG9 A;  1ZQW A;  4PAG A;  3CQC B;  4RQ6 A;  4DO0 A;  3V72 A;  5L3E B;  3ZST A;  2H88 A;  3EHZ A;  4UF0 B;  3I9Y A;  4XBF B;  2BCV A;  4JEU B;  2LHN A;  5J2E A;  4AQF A;  4K4H A;  4DV5 T;  3MKD A;  7ICL A;  1MMA A;  2LSY A;  1XMO T;  3IBP A;  1ZQG A;  5JRC B;  5FXW A;  5AQM B;  2I6H A;  4A97 A;  4FHV A;  4UBB A;  3GDX A;  4LT6 A;  4KLU A;  4A56 A;  1KK7 A;  4MFF A;  2LKG A;  2R6G F;  4DND A;  4O5E A;  4LEZ A;  4H9N C;  3QK6 A;  2E9X A;  4NLK A;  4E80 A;  1G8X A;  2LSK A;  5HRK A;  5FY7 A;  4ZI7 E;  5HCM A;  5EZY E;  5HXS A;  4KHZ F;  1ZQH A;  3UXO A;  3AXJ B;  3ZMZ B;  4GXK A;  2IHM A;  9ICT A;  3Q5X A;  1BPY A;  4QH5 A;  4JI3 T;  4OFZ A;  5HXR A;  4I2H A;  3P4Q A;  2N9D A;  2CM0 A;  3AE2 A;  2V6Y B;  1ZQJ A;  3UQ4 A;  4JEH B;  2JMK A;  3HR0 A;  4B3S T;  3ABV A;  4X4S A;  2DR7 A;  4M04 A;  5AQG B;  4NLZ A;  3HKD E;  4WYV A;  3VU7 H;  5BOL A;  3N2O A;  3C18 A;  3C5F A;  5LGU B;  4HEA A;  2Q9Q D;  2V1D B;  5DQV A;  2CRB A;  4GK5 E;  5L3C B;  2KXP B;  3GMI A;  2M2W A;  3KV5 A;  5TZV A;  5LNK A;  3AEE A;  4GYR A;  4WZX A;  1QUU A;  1UUR A;  3PUV F;  3UT5 E;  9ICM A;  4O4I E;  4X4T A;  4K96 A;  3RHW A;  3JAD A;  2WQY A;  3PE0 A;  3N2K E;  4XQ7 A;  3LK3 B;  7ICT A;  1HX8 A;  2XZE A;  3Q5D A;  3MZK B;  4C90 A;  4WC1 A;  3HKC E;  3RI5 A;  1ZQB A;  2Q9Q A;  4AKG A;  2I0M A;  5AQF B;  2EHO D;  4LF7 T;  1HX1 B;  3PJA A;  4JWM A;  3H38 A;  2ZH8 A;  5AFU L;  1ZQY A;  8ICQ A;  9ICV A;  2KT9 A;  4TUP A;  4P2H A;  1ZQT A;  1FEW A;  2XSA A;  4PFO A;  4AKH A;  4YMO A;  3BQI A;  4QH4 A;  4AIU A;  2BS2 A;  2WDR A;  2M67 A;  7ICS A;  3PU8 A;  3OVA A;  2FJB A;  1MQ2 A;  2WMN A;  1S35 A;  3KV4 A;  5KDM C;  4X0A A;  2YU1 A;  1MND A;  1VCT A;  2WWU A;  2J1D G;  4X64 T;  1IJ5 A;  4AKR B;  5J2G A;  4WBY A;  2FMS A;  4UEM A;  2BCQ A;  4JBW F;  3FBZ A;  3UQ2 A;  4HWH A;  4PJM A;  4YHH T;  4IGU A;  2WY2 A;  4XRH A;  8ICC A;  3AUO A;  7ICO A;  4LML A;  4DR2 T;  8ICH A;  4COF A;  1ZQM A;  3OGU A;  2EHO B;  3ETV A;  4QXB B;  2YKS A;  4NXZ A;  4FHY A;  4E7X A;  4I2G A;  4F5O A;  5CA7 A;  3WFS C;  3SFE A;  1R89 A;  2EWR A;  3FZL B;  4PJJ A;  2XQ3 A;  3K7D A;  8ICY A;  3UUB A;  4JI0 T;  2KWH A;  2LEH A;  3UPS A;  3ZJ1 A;  4F5R A;  2UU9 T;  4Q25 A;  4M9G A;  4LF4 T;  2KSR A;  2LLY A;  8ICK A;  2NP9 A;  4YCX A;  4I4T E;  5HWX A;  3TLS A;  8ICM A;  3HWT A;  4UAZ A;  2CEA A;  3JAF A;  4IDP A;  2DR9 A;  1XSL A;  2BG9 C;  1HNX T;  4WC3 A;  9ICA A;  4X4Q A;  3P7I A;  3S4U A;  4H9Q C;  5HYA A;  3AVR A;  3ZJ2 A;  5LJM A;  3JZ0 A;  3PML A;  5L3D B;  1CHU A;  5HHI A;  4DR5 T;  3RPU A;  4Z6C A;  2DLR A;  7ICN A;  3UXP A;  4GIW A;  2IAK A;  2VKJ A;  3NRY A;  4HFD A;  4O2B E;  4PJN A;  3B13 A;  4P4O A;  4AKI A;  2CLY B;  2V5C A;  5HXC A;  1FMW A;  4YN4 A;  4LF6 T;  4KLF A;  2ID1 A;  3PDY A;  5J29 A;  2VQF T;  2LRK A;  4AT7 A;  3V7K A;  5DQW A;  1ZQC A;  4F5P A;  1N34 T;  4P0A A;  3L3P A;  2X9H A;  2JQQ A;  4HN9 A;  4JI5 T;  2WDV A;  4JUY A;  4PGQ A;  4ZI3 D;  2JPF A;  5J2F A;  1XSN A;  4X66 T;  9ICE A;  4HFV A;  4I2C A;  5L47 A;  1TV9 A;  3JYY A;  8ICN A;  1KEY A;  3VR8 A;  5CFB A;  4DBQ A;  4IDZ A;  4DBR A;  4UF0 A;  3FZK B;  4UB5 A;  1BPB A;  3RX6 A;  4YTP A;  3FXE B;  2NW9 A;  2WU2 A;  4IQW A;  2EHO A;  2A2F X;  1YKE B;  3O9X A;  4LZD A;  2XAH B;  5J0U A;  4DV1 T;  4PFP A;  5FY1 A;  4DV6 T;  9ICF A;  1BR1 A;  2NRK A;  7ICQ A;  3K1S A;  2CWO A;  4CN1 A;  2DI4 A;  2XAS B;  4UV9 B;  3CML A;  1HNW T;  4R64 A;  4UIG A;  2UXX B;  3ZT6 A;  4CZZ B;  2M6B A;  2XQA A;  4DV3 T;  4K9B A;  2DWG A;  3JPQ A;  3OYZ A;  4NXX A;  3RIU A;  2HH7 A;  2ES0 A;  1UEV A;  5HRB A;  2KND A;  4DVD A;  3AEA A;  3T8O A;  4TN7 B;  4LMJ A;  5HRF A;  4TWH A;  4FO6 A;  5AQQ B;  4NIQ A;  5HRH A;  4X0B A;  1BR4 A;  9ICP A;  3JAE A;  4RT2 A;  4X5V A;  1SUM B;  8ICA A;  3ANW B;  4GXI A;  5GON E;  8ICF A;  2PFP A;  4B3R T;  4YSZ A;  4JLE A;  3RIU C;  4EYY R;  5LCY A;  3C51 A;  4H9R C;  1E7P A;  5LYJ E;  3C2M A;  4ILB A;  1UET A;  2X68 A;  3F2E A;  3MK7 C;  5IIO A;  1OED A;  3AXJ A;  3SOL A;  3EDU A;  4O2A E;  3V5U A;  3ZPO A;  4GYS A;  3RC8 A;  3RF1 A;  4ILC A;  5BMV E;  4OHF A;  3A7M A;  4RQ1 A;  3B5M A;  3VRA A;  4AKL A;  2D2S A;  5L2L A;  3CQX C;  2FMQ A;  4OX9 T;  3C64 A;  4Z6D A;  5CFS A;  2CXF A;  7ICG A;  2B1E A;  3MAC A;  2JQH A;  4XAX B;  2VKD A;  1SE7 A;  3JPO A;  5DEC A;  2BKN A;  1IJ6 A;  4QZG A;  3C2L A;  2CPT A;  5KX5 E;  2ACX A;  3UU8 A;  3K75 D;  4O6A A;  2ZM8 A;  3ZYK A;  2M2U A;  4IT4 A;  3LK2 B;  1FA0 A;  4H63 V;  5DB9 A;  4OAF A;  4WH5 A;  3JC6 C;  4QX8 B;  3TFS A;  3WFQ E;  4EOZ B;  1D1B A;  2IIU A;  3AQK A;  5CA1 E;  4RWQ A;  5LG4 A;  5HC9 A;  2H89 A;  3I9W A;  5ABF B;  4XUS A;  2RFF A;  3CX8 B;  8ICT A;  3OVU A;  4K4G A;  3AA0 B;  5FVK A;  2ISP A;  3ANW A;  4WBN E;  3AQN A;  4M2Y A;  2M6I A;  5J0T A;  2KLQ A;  4PHD A;  3ER8 C;  4HFI A;  2B76 A;  4JI4 T;  2HN1 A;  4O69 A;  5J2D A;  4G63 A;  1UX5 A;  1Q79 A;  3OBV E;  3PUA A;  3OVS A;  3KDS E;  1ZQP A;  3PUW F;  4LF8 T;  4KLE A;  3ZCJ A;  4ILA A;  1XDP A;  3I0O A;  1V9D A;  3N9L A;  4TWF A;  3AE8 A;  1IZN B;  1BPZ A;  5IIN A;  2ZM6 T;  4IE0 A;  4ILU A;  5JTG A;  3N2G E;  9ICU A;  3AA1 B;  4U7Y A;  4RPZ A;  4I2D A;  1ZJN A;  5J1G A;  4JI8 T;  4KLI A;  2J4G A;  4UVA B;  3VKH A;  4RQ2 A;  3WFR E;  2MPK A;  4PK5 A;  1ZV4 X;  3H39 A;  3T1H T;  5LHH B;  2IDO B;  2K24 A;  3DJB A;  4JLZ A;  4NM1 A;  3SRZ A;  4I28 A;  4DUZ T;  2B51 A;  4YD2 A;  4ZS2 A;  1ZQL A;  9ICN A;  5D46 A;  4X4P A;  3KIN B;  5B3Q A;  5ABH A;  5FL1 A;  1TVA A;  5AQU B;  5LMU T;  3KVB A;  9ICJ A;  1IBM T;  3HX0 A;  2GA9 D;  4M1P A;  2MBG A;  1IBK T;  4ANJ A;  4ZZC A;  1QSD A;  8ICZ A;  3TLV A;  3OPC A;  4U3C A;  1BPX A;  2CHO A;  2W61 A;  4NXV A;  4X20 E;  4ZS3 A;  3OUY A;  5JDH A;  4I2A A;  2BCS A;  3P4R A;  2W0G A;  3RLF F;  1KEJ A;  2Y6X A;  5AQO B;  5DBB A;  2CWY A;  2PFV A;  4KUM B;  2ZMA A;  1ZP0 A;  4H9P C;  1KNY A;  5DJQ C;  4HE8 A;  3RKO A;  3W15 B;  5ABF A;  4LFA T;  3JPN A;  1LVF A;  2FJD A;  4YMN A;  3RH3 A;  4MF2 A;  4I2I A;  1WYC A;  4KBM B;  3PJA J;  3EF2 A;  1YLQ A;  5D4B A;  1MMD A;  4B3T T;  3KBT A;  4NUV A;  3OTO T;  5F5W A;  3EDV A;  4YJ2 E;  1U4Q A;  4H9O C;  3C2K A;  4AT9 B;  2QGS A;  4I29 A;  2M2V A;  4M9L A;  4WCW A;  4KM5 A;  2WMO A;  3FZH B;  4QZA A;  2X67 A;  5LJN A;  2KWI B;  4PPX A;  4YHJ A;  1XNQ T;  3RRW A;  2BPF A;  2XM1 A;  3HL6 A;  4O5K A;  3OWG A;  4JYA T;  2VQE T;  1NO5 A;  2N1G A;  3UUX B;  2V8S V;  2Y48 B;  2VAS A;  4X1K E;  4ASK A;  1ZQK A;  2YK0 A;  2X0Y A;  3AE7 A;  2W4X A;  4DID B;  4QZD A;  2NW8 A;  3SFD A;  1AJ3 A;  3HI2 A;  4TNW A;  2O1P A;  4G2A A;  4KLQ A;  1IAP A;  4ZXL A;  5C3J A;  5CFT A;  3WFO A;  4I2B A;  4TV8 E;  4WC4 A;  2LT3 A;  2RP4 A;  8ICB A;  2IML A;  2W67 A;  2IHR 1;  5DB8 A;  4EED A;  5CGM A;  4ZI2 D;  1M7K A;  2X9X A;  3PUY F;  3GN5 B;  3RC3 A;  1R8A A;  2GAF D;  3NBX X;  5DB7 A;  2BBH A;  3JC6 D;  4ZHQ E;  3OV7 A;  5LP6 E;  2L8K A;  4E8F A;  4UB2 A;  5CB1 A;  2D0U A;  3K3Q C;  5ABE A;  4IL4 A;  3IHR A;  8ICE A;  2D5U A;  3ZT5 A;  1ZQI A;  1D0Z A;  1E2A A;  1HCI A;  1VJ7 A;  4IRE A;  4R65 A;  3OJA A;  5JDN A;  2NTX A;  3UFE A;  5IIJ A;  3EAM A;  3K3O A;  4TV9 E;  3VR9 A;  4NY8 A;  4YT0 A;  5AQJ B;  4PHA A;  2P9B A;  5DBA A;  3EI0 A;  2ZH4 A;  4I43 B;  5ADX L;  5JDM A;  2VKO A;  4WQK A;  2IUB A;  3P50 A;  4JI2 T;  1Y01 A;  4IDO A;  5CFU A;  3FBL A;  1WOT A;  3PUZ F;  4KLH A;  5HEG A;  3R6N A;  4DV2 T;  2D9D A;  4PK4 A;  3RH5 A;  3HKB E;  2KIN B;  1ZQQ A;  3N9Q A;  4EP7 A;  2C0S A;  3WI3 A;  2CHN A;  1UK5 A;  3IEE A;  2LOP A;  2ZH5 A;  3LBX A;  1M62 A;  4NUU A;  1MIW A;  1VCS A;  4LEY A;  5AQK B;  4OAG A;  2I9G A;  2MYS A;  4NXW A;  4O5C A;  1ZQN A;  3B0X A;  4U33 A;  2K9A A;  1B7T A;  2JRK A;  4ATB A;  3KV9 A;  4S3N A;  5HRL A;  4CXY A;  4EEB A;  4RWN A;  1NAF A;  3NZP A;  3V7L A;  3PU3 A;  4DMV A;  4HWI B;  3AE5 A;  4DV4 T;  4K8V A;  4X4O A;  4BJN A;  3PUX F;  3FHN A;  5L3F B;  8ICR A;  5LXT E;  2VVS A;  4U31 A;  5JDG A;  4FJO A;  4RT3 A;  3MXZ A;  1LVK A;  2V6X A;  3LK4 2;  5CHG A;  5BOM A;  3L8R A;  3JPP A;  2W63 A;  3AU2 A;  4KHP T;  2K3W A;  4PHP A;  5J2B A;  1E1H B;  1MMN A;  1J1J A;  4WBZ A;  1XSP A;  8ICU A;  9ICX A;  1Y64 B;  3BQK A;  4HFH A;  5LHG B;  4UB4 A;  1T8B A;  3L39 A;  2LKH A;  3LK9 A;  1YKH B;  9ICK A;  1UX4 A;  4HWC A;  1MIY A;  2BCU A;  1NWM X;  4B6X A;  3LDQ B;  2XTL A;  3CQG B;  4EZH A;  3P4W A;  4ERR A;  3PUS A;  5FVL A;  1HFA A;  2YDS A;  2WBL A;  2QA7 A;  1XNR T;  4NM2 A;  2DVI A;  2V5D A;  4DUY T;  4M9N A;  3U78 A;  2WB5 A;  3NYB A;  5HWY A;  5J0R A;  3ZMS B;  1YW0 A;  5J0O A;  3AQL A;  2JJ9 A;  4L0R A;  5AQH B;  4E7Z A;  1TFW A;  4UVB B;  3PTR B;  3KVA A;  3RIF A;  3UU4 A;  3CIR A;  4I2J A;  2BPG A;  2FJE A;  2CBI A;  3OVB A;  4JI6 T;  3H3M A;  9ICW A;  4KX6 A;  7ICF A;  3O4X E;  4NLN A;  2PJQ A;  3EVY A;  1FJG T;  3EAB A;  1GQE A;  3ZLI A;  5L3G B;  5F3J A;  1JNR A;  4EB6 E;  5IIL A;  1ZQF A;  4QXC B;  2ZHA A;  2P66 A;  4KLJ A;  3ISB A;  2Q66 A;  5J0X A;  2YDQ A;  2VUR A;  4IG8 A;  4Z6E A;  4CXW A;  9ICB A;  4HWF A;  2X9Y A;  2CA5 A;  3B57 A;  2FCL A;  2LOS A;  3QNU A;  1KNR A;  5H6Q B;  3RQW A;  2XQ8 A;  2NW7 A;  3F57 A;  1VFG A;  2J47 A;  2CLY C;  4MHC A;  2XAQ B;  3PV0 F;  3RJI A;  4P0B A;  2XSB A;  4Z8X A;  3AEG A;  1F5A A;  5CWR A;  3AA6 B;  3C66 A;  4KLM A;  2JQK A;  2LM2 A;  5FXV A;  2PFN A;  4AIS A;  5LBQ B;  2NTY A;  2Q9Q C;  4GK0 E;  5FXZ A;  5HEH A;  3L9D A;  9ICO A;  4MBQ A;  5JDF A;  3ONL C;  3G06 A;  4MFC A;  2PBI A;  1JMS A;  3TLW A;  4HX0 A;  2PFO A;  7ICI A;  4NPP A;  1ZHC A;  4IQV A;  3RJJ A;  4X5T A;  4FH5 A;  4RPY A;  1JAJ A;  4F8H A;  5L4H A;  3RIA A;  7ICK A;  2Q9Q B;  3ISC A;  4IE6 A;  5DAB A;  4QZF A;  3PUG A;  4WC0 A;  4AI6 A;  1R8I A;  2FJA A;  4Z6F A;  4P1N A;  5EOZ A;  2B56 A;  4F5N A;  4X1I E;  1QLB A;  3MJX A;  4FH3 A;  1T7S A;  5IWA T;  4I0U A;  3C4W A;  9ICQ A;  9ICC A;  3MCR A;  2BDE A;  4O4J E;  2BCR A;  3ZC0 A;  1ZEE A;  2MOZ A;  4X4U A;  5BR8 T;  4DR6 T;  2UUC T;  4R63 A;  3UU6 A;  4CXX A;  3CK6 A;  5C2T A;  1X9B A;  4RQ0 A;  2LSI A;  3AAA B;  1T72 A;  3RH4 A;  2XY8 B;  2WAU A;  4O67 A;  5CR0 A;  4ZEY A;  2XAJ B;  3RRC A;  1G73 A;  1S94 A;  3NWI A;  5B3P A;  2VK9 A;  8ICG A;  2LSG A;  3ZKR A;  3IA3 A;  5FKY A;  2A72 A;  7ICV A;  4DR1 T;  4UAY A;  2HN2 A;  2V7I A;  3T1Y T;  5JDQ A;  3HIY A;  4J2C A;  4WC5 A;  4M47 A;  2FMP A;  1ZQS A;  4LF5 T;  4BA9 A;  2F4V T;  2WS3 A;  2L9Q A;  2V6Y A;  2YDR A;  4TUS A;  3LG7 A;  5FY0 A;  3Q9D A;  4IE5 A;  2XQ9 A;  7ICP A;  4MLK A;  4ZZB A;  1WCR A;  2DCF A;  3TKL B;  1ZQR A;  2HHP A;  4U72 A;  3Q5W A;  8ICL A;  4QWN B;  4U2Z A;  5IHY A;  2BG9 B;  2XAG B;  5CA0 E;  7ICM A;  3D0T A;  4O4H E;  4HFC A;  8ICP A;  3N5L A;  2VL8 A;  5EK4 A;  5HRG A;  2WWV A;  1SHZ C;  4HGA A;  1OU5 A;  4K9A A;  3L09 A;  3KBU A;  3CX7 B;  2DRA A;  5JQG E;  4DOC A;  1MIV A;  3CX6 B;  4H9S E;  3AAE B;  3M65 A;  1NEK A;  3TLU A;  2K5B B;  2H7O A;  2X51 A;  5AQT B;  2PXI A;  3K3N A;  4CN6 A;  2B4V A;  5HRI A;  4M9J A;  5ETW A;  3I1A A;  2ZH7 A;  4U2Y A;  4IE7 A;  4KB6 A;  4WNK A;  1U5P A;  5LBM A;  4OYK A;  4UD4 A;  2OLT A;  5J2C A;  1ZQO A;  2DNX A;  3QB5 A;  5DDM A;  4HWD A;  3HKE E;  4PGY A;  3RJE A;  3UUM A;  4LEW A;  3HW8 A;  2XPK A;  5CJ7 A;  1RZT A;  3AVS A;  4DOB A;  3UPQ A;  5IYZ E;  5J2T E;  2LSJ A;  3GN5 A;  2J62 A;  4A5X A;  5LGT B;  5CJ5 A;  5DBC A;  4TZ4 C;  1R8C A;  5FYM A;  5AQR B;  2BG9 E;  4PNI A;  5A1L A;  1NOM A;  2KZ7 B;  4GKK T;  3SS1 A;  4RQ3 A;  2WSS V;  2PG8 A;  3E0Z A;  1ZQX A;  3M3Z B;  2A3D A;  4RQ7 A;  3BQL A;  3AE6 A;  4UVC B;  2E5V A;  1HUO A;  4AT8 B;  2ZM0 A;  1D0X A;  2UUA T;  7ICR A;  3Q2M A;  1IBL T;  3UXN A;  4I2E A;  1R8B A;  2ZH6 A;  3RJH A;  4JLX A;  4PH5 A;  1KNP A;  1Q78 A;  2E9X C;  2E8I A;  3UUN A;  3AE1 A;  3CVR A;  2JQ9 A;  4IIJ E;  3V7J A;  1VOM A;  3RJG A;  8ICJ A;  5J2A A;  1US7 B;  5J0Y A;  5JH7 E;  4ZI2 C;  4MF8 A;  3JPS A;  2RPA A;  1D1A A;  4I2F A;  3ZSS A;  1ZJM A;  3C50 A;  4QZI A;  4LVS A;  4KLS A;  2H7V C;  3ZMU B;  4KLO A;  4KLL A;  3DP7 A;  2BVL A;  4DR7 T;  4JI7 T;  3UUL A;  5C8Y E;  3C5G A;  3ETU A;  5IIK A;  4K97 A;  8ICS A;  4RQ5 A;  5FXX A;  2K48 A;  4QZC A;  5KXJ A;  4AT9 A;  1MQ3 A;  2DWK A;  2YN6 A;  1Z0P A;  4O8S A;  2X66 A;  2O5A A;  2ZM2 A;  5JR9 C;  4YFS A;  2CXD A;  1FIO A;  1KF6 A;  1HG5 A;  4IDN A;  2BE3 A;  2NOX A;  2WDQ A;  2BPC A;  1WR6 A;  4QZB A;  1N32 T;  3ZT7 A;  4LMK A;  4UXN B;  5HRD A;  2ACZ A;  4TWD A;  4JI1 T;  4UD5 A;  3UQ0 A;  1W0B A;  4DMW A;  4M0A A;  3JPR A;  2MTQ A;  3J9X 1;  4N78 D;  4QX7 B;  3UU3 A;  2BKO A;  2VVN A;  4CI3 B;  1L0V A;  5CHE A;  2VL0 A;  3ER9 B;  1LRZ A;  3ZEF B;  1JNZ A;  1VRB A;  3HA4 A;  4U7I A;  3UQ7 A;  1YQ4 A;  4MAL A;  2G0U A;  2GWS A;  2LHR A;  4F5Q A;  1HUZ A;  3P4S A;  4XJE A;  1T98 A;  3I0Q A;  4DO9 A;  2KMF A;  2W00 A;  3RYI E;  8ICI A;  1J5E T;  5DED A;  5BPC A;  3RH6 A;  2RA1 A;  7ICU A;  2GK9 A;  1HS7 A;  3IF8 B;  2VAN A;  3RJK A;  3O1J A;  5AQN B;  4A98 A;  2N2N A;  1ZQU A;  1NEN A;  4UV8 B;  4ZOL E;  4AQG A;  2UXC T;  4EBK A;  1SA0 E;  9ICG A;  2BS4 A;  2XUE A;  2HHH T;  1YXR A;  3ONJ A;  3ZC1 A;  2E5L T;  5LB7 B;  2XQ6 A;  2ZLY A;  3QOF A;  5HRE A;  3JPT A;  2V7J A;  3P8C D;  4X4V A;  3NZQ A;  2L3L A;  4M5D A;  1MNE A;  2QRX A;  4HFE A;  4WBO A;  5DKW A;  1LKX A;  4HTE A;  3B0Y A;  2PFQ A;  1BR0 A;  5LGN B;  2LE8 A;  3C98 B;  3FZF B;  4PW8 A;  5LHI B;  1WLX A;  4YD1 A;  4EBJ A;  3KV6 A;  2CE7 A;  1HNZ T;  4LFC T;  4YMM A;  2CXL A;  2I59 A;  1UCU A;  2VKH A;  3QUJ A;  3RQU A;  1X79 A;  4QKN A;  4AT7 B;  7ICE A;  1ZQD A;  5HEU A;  1W0A A;  3RYF E;  3C4X A;  2V7L A;  5HR9 A;  4ISS A;  2ZH3 A;  3BK9 A;  3AEB A;  5HEO A;  4HFB A;  4PHE A;  5E0O A;  1V4A A;  5J2K A;  1WR0 A;  3RYH E;  5JR9 B;  4UB3 A;  1ZQE A;  2V7K A;  3UU5 A;  2ZH9 A;  1ZKE A;  5JRC A;  3E22 E;  4O9M A;  4MFR A;  1UEU A;  4WC6 A;  3K8P C;  4AQF C;  2ODV A;  3KFW X;  3PUQ A;  4NKU A;  5EK2 A;  4L5G A;  4GKJ T;  3VRB A;  4IE4 A;  4K98 A;  1ZQZ A;  4IL9 A;  1Z8U A;  5HAX A;  4DR4 T;  3JCF A;  3N9O A;  4YSY A;  2YOE A;  3AAI A;  2IC9 A;  5FMN A;  3PHZ A;  1XWM A;  2XQ7 A;  3A8Y C;  3LJC A;  4NXN T;  4EZ4 A;  5HEJ A;  1EZ3 A;  1ZQV A;  3CWZ B;  5FL0 A;  2UXB T;  5J0S A;  3OYX A;  2LJL A;  1WFD A;  2ZH2 A;  1UUS A;  5J2J A;  2PTF A;  4TUR A;  3V5S A;  2A9U A;  3H37 A;  2NR4 A;  4WOY A;  2YEV C;  4IDQ A;  4AQY T;  1N36 T;  3O1I A;  4RWP A;  4XZC A;  4RQ8 A;  1OED E;  4UB1 A;  4KLD A;  1FMV A;  5D49 A;  1XMQ T;  5LA6 E;  2Z6E A;  3AEC A;  5JVD E;  4I55 E;  2YU2 A;  1ZQA A;  4C91 A; 
#chains in the Genus database with same CATH homology
 3NVO A;  2BBJ A;  3NWI A;  2HN1 A;  4I0U A;  3JCF A;  5JTG A;  2BBH A;  2IUB A;  3RKG A;  3CK6 A;  2HN2 A;  4EED A;  4EEB A;  4EGW A;  4EV6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...