4EEBA

Cora coiled-coil mutant under mg2+ absence
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
324
structure length
314
Chain Sequence
DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transport protein CorA
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport
total genus 95
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eebA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eebA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eebA01
2HN1A 4EEDA 2BBJA 3JCFA 3CK6A 4I0UA 3RKGA 4EGWA 3NVOA 4EEBA 4EV6A 2IUBA 2HN2A 3NWIA 2BBHA 5JTGA
chains in the Genus database with same CATH superfamily
3HJ4A 2X9HA 3ZMZB 4P4PA 2NWBA 4XA5A 1V9DA 3K8PC 2IW5B 3PE0A 3CVRA 4IG8A 4U2ZA 1TVAA 4EB6E 2HHHT 1G8XA 2PG8A 4A5XA 1BR0A 4KLGA 2EHOC 5LHHB 4X4VA 2LOSA 2N2NA 4GYSA 3QOFA 2LSKA 5DDYA 3RH5A 4YLHA 3EDVA 1ZQQA 4FI5A 4X4OA 3UULA 4CN4A 3KV5A 4I2FA 4DMVA 3LK9A 5CA1E 5EK2A 5HXRA 3RYCE 2ISOA 3PHZA 2J4GA 1JNRA 1ZQOA 2KWHA 4KB6A 3CQXC 9ICSA 9ICFA 1M62A 9ICHA 4PAGA 4XRHA 1JAJA 3JPQA 3CWZB 2K24A 1WRDA 4PK4A 2KNDA 3C2LA 5EOZA 3PJAJ 4EAHA 4YD2A 1S35A 2A72A 2UUBT 3FZMB 5L4HA 4O2BE 8ICNA 4WC7A 3WAJA 2FBWA 1ZQEA 4UD5A 1MNDA 3TFRA 4AT8A 3H3MA 2VVNA 2X9YA 1QUUA 4LF4T 4OAFA 4PGYA 7ICVA 1Y01A 5AQOB 5LCYA 1TV9A 3V7JA 1T8BA 4I50E 4LFCT 4Z91A 3ZN1B 4R64A 4HX0A 3ZMTB 2A2FX 4DV4T 2D2SA 4X64T 2H7VC 2H7OA 4CI1B 4WC6A 2BVMA 5AQRB 4K8VA 5L3EB 1UX4A 3PMLA 4K96A 3EI0A 4WQKA 1ZQIA 1Z8UA 4FHXA 1N32T 3PUVF 1SUMB 4NLZA 5LMUT 1KNZA 4BJMA 4HGAA 4ZEYA 3HJ1A 4CXXA 5FYMA 4RQ8A 5HHHA 4ZI2D 3V7KA 5J2GA 2M2WA 4CN1A 2DI4A 1KEYA 3HR0A 2GA9D 2I6HA 4M9JA 5J2AA 2IIUA 2X0HA 3M3ZB 2GWSA 2NW8A 1IBKT 3E0ZA 3I9YA 3SS1A 2AE9A 2X9XA 3AVSA 5J0OA 4HFIA 8ICFA 2FJBA 5HEJA 1N34T 4F5OA 2DWGA 2JQ9A 1XSLA 2VASA 4I2IA 4O4JE 1RPLA 3P4QA 4QZ8A 2VL0A 1HG2A 3RC3A 7ICTA 4OX9T 5LBMA 1BR4A 5HEHA 4X4SA 5JQGE 4M9GA 2WU5A 4K0KT 4ATBB 4AT9B 3PV0F 3AE7A 4PHPA 3K3QC 4DMWA 1R8CA 1ZQSA 8ICLA 2DHRA 3VR9A 5JRCA 2BKOA 5AQUB 3C2MA 5CB4E 1YD8G 2XAGB 2UU9T 2V26A 5FY0A 4WC4A 2HPJA 4XUSA 1ZEEA 4QH5A 2C5JA 1FJGT 4UIGA 4NIQA 3C5GA 1J5WA 5ABEA 2M6IA 4GKKT 4I2HA 1MIYA 2W2UA 4IDZA 3O9XA 2FUPA 1X79A 2E9XA 2DRAA 1ZP0A 5IILA 2YN6A 3N2OA 4B6XA 9ICIA 1BPXA 7ICEA 3HKBE 2E2AA 5JDFA 3O1IA 3MGIA 2B4VA 3OYXA 2BG9E 4HWDA 4NLKA 1HG5A 2M67A 3RYFE 3MBYA 4PHAA 1MMNA 4YD1A 2DVIA 2CMRA 4B3ST 1UURA 5DJQC 2XQYA 2W62A 4QKNA 1FMVA 4PW8A 4RQ3A 4DVDA 2E5LT 2MAWA 4PNIA 4ANJA 2WDRA 5FXVA 3Q5EA 4XJEA 4WBOA 2XAQB 1KNPA 2D5UA 1UGOA 5FY7A 4NXTA 4UB2A 2QYWA 4TNVA 4TV9E 3TLWA 4HWIB 2NOXA 3J9X1 1DU2A 4CI2B 3AU6A 3PUYF 1ZKEA 2UXBT 5JRCB 3K1SA 4LEVA 3O4XE 5CJ5A 3MGHA 5L3BB 5HXCA 2W67A 3AEDA 4M2YA 4ZI2C 5CFUA 2CHNA 2IMLA 4RQ0A 3Q9DA 4QX8B 1KDHA 4JUYA 4X0BA 1N36T 2V6XA 4O5CA 2QVAA 2MTQA 3IF8B 2BS2A 3H37A 3ER8C 4TV8E 2W61A 2BKPA 4HWHA 4HEAA 4EP7A 8ICGA 4QH4A 3UU5A 3EF2A 3ZEFB 4HFBA 4PJJA 4EGWA 4HWFA 2XQ5A 2E9XC 2X0YA 4NXNT 2LRLA 4HE8A 3ZCIA 4IDQA 1X9BA 4Z6EA 4PGQA 1R8AA 3AE6A 8ICXA 5J2EA 5D63A 1MQ3A 2KLQA 2ZMAA 8ICIA 4I28A 4OFZA 8ICZA 4YSZA 5HRLA 1ZQJA 1E2AA 4NUVA 5J2DA 4LT6A 4ADZA 5IYZE 2ACZA 3AE9A 3WFPA 4EZ4A 4U31A 3LDQB 4U33A 5HEOA 9ICUA 4UF0A 2IUBA 5TZVA 3ER9B 3KBTA 5BR8T 3RH4A 2HN1A 3ANWB 3WAKA 5BOMA 4PGXA 2LKGA 4U3CA 4X5TA 3QK6A 2ZM0A 4O4HE 5AQHB 1HX8A 1XNQT 3RC8A 2V7KA 3Q2MA 3NZPA 2CLYB 5M4YA 5DDMA 2BCRA 1WCRA 4HFDA 4KLOA 3AE8A 4I0UA 1GQEA 3FXDB 4KLEA 1D0YA 1ZQFA 4I2GA 1MMGA 3UPSA 3ZJ2A 3ZSTA 4QXBB 4O4IE 7ICKA 2EHOD 2NR4A 2JQHA 5IIIA 2ZH1A 1UUSA 2DR9A 2LE8A 4IE6A 4UR9A 3ZYKA 3AE1A 5F8PA 4I43B 1NOMA 1LVKA 5HYAA 2YDSA 4LZDA 1VFGA 2XAFB 3PUAA 2C5KT 4UEMA 4EOZB 4DV0T 2C5IT 3NVOA 2HHPA 3NWIA 3OUYB 3O1HA 1AJ3A 4OHFA 3PUWF 4G63A 4H63H 3JPNA 4HKAA 3PUXF 4NKUA 4MFCA 4IQVA 2I9GA 2A9UA 4QXHB 1ZQMA 1MMAA 2CWYA 1BPDA 3OBVE 2DR7A 4Z8XA 3Q5WA 4HFEA 4Z90A 2XHEB 2FMPA 4X5VA 9ICCA 2NW7A 4YTNA 3BK9A 3K3OA 2BDEA 2CE7A 5ABFB 5LBQB 4Z6DA 5J2JA 2W00A 4F6RC 4UB4A 2BPFA 3CX6B 2ID1A 4AKLA 4GK5E 4FHVA 5AQPB 3JPRA 3AA7B 3AECA 4YJ2E 5DBCA 3P7IA 9ICRA 4MFFA 4O4LE 5HWXA 2CHOA 4P0BA 5CGMA 1W0BA 5CFSA 5J2FA 3MXZA 4IDPA 3VRAA 4G2AA 4H9QC 1MNEA 2G0UA 2ZH3A 3UXNA 3RJEA 2WAUA 4TURA 5L47A 4WH5A 4X4NA 4M0AA 7ICSA 1ZQVA 1FA0A 4PK6A 5JREA 1HNZT 2P9BA 3KBUA 3OVUA 3CQGB 2BG9A 3KV9A 5FKYA 1D1CA 3R84B 5L3DB 1OU5A 5F3JA 3L09A 2LT3A 5CR0A 4KBMB 4XAXB 7ICIA 4AISA 4NXMT 7ICHA 4KLDA 3RKGA 2X68A 3AXJA 1WOTA 5D49A 3ISCA 3ABVA 4IIJE 2YDRA 1KNYA 5LG4A 4NKTA 5CFBA 2CXLA 8ICWA 4Z6FA 4WC3A 2CXFA 4X1KE 4L0RA 2UUAT 4MBQA 4GKJT 3RRWA 4DR7T 3HKEE 4YMMA 3RIAA 5J2HA 4NXUA 7ICUA 2V6YA 4DR5T 1XDPA 4WCWA 2CBIA 3JADA 3UU3A 4HFVA 2ACXA 5C8YE 2VQET 4I29A 4DR3T 4QZHA 2VANA 3ZPOA 4O67A 3GN5B 1SE7A 4E80A 3UFEA 2ZH5A 4O9MA 4KUMB 4YTPA 3H39A 4FH5A 5DB7A 4JYAT 2BPGA 2M2TA 4QXCB 3UXPA 3EDUA 5LHIB 4P2HA 5J1GA 5D61A 3MDAA 5HCMA 1ZQAA 3HX0A 4IQTA 1TFWA 2BBJA 1FMWA 1OEDE 3JPPA 3RH3A 2N9DA 1WYBA 5DKWA 5JR9A 4IHJE 3QB5A 3LJCA 1YW0A 3TLTA 3B0YA 4X20E 4TUQA 2PFVA 2Y8DA 5LG3A 5HREA 2UXNB 1NWMX 1E1HB 2BKNA 3AQMA 2XAHB 5IUXA 5HRGA 2L3LA 4QZIA 8ICCA 3LBXB 3FZLB 5AQLB 4I2EA 3CMLA 1T72A 2PXIA 5J2KA 4ASKA 4YHHT 2BE3A 3P4WA 3VHLA 2JRKA 5KDMC 2ZH4A 9ICBA 2VKDA 2C0SA 5FXWA 4ISSA 1ZQDA 1UETA 2I0MA 5ABHA 4TUPA 4IQWA 4DBQA 2MYSA 5DB6A 3N9MA 3T1YT 3PJAA 2KINB 9ICQA 3UUNA 5JTGA 4QZDA 5J2UE 2XQ9A 5AQJB 2ZH7A 5H6QB 1EZ3A 3A7MA 3V5SA 4IE0A 5E0OA 3X1DA 1KFYA 3ONLC 1XMQT 1W0AA 2IC6A 3C50A 3AEGA 4O69A 4I2BA 3CK6A 4IL9A 2WWUA 2CRBA 5KX5E 1XWMA 3S4UA 4U2YA 4BAYB 3AA0B 8ICEA 1MQ2A 2Q9QA 2PFQA 3HKDE 3RH6A 4EBKA 3RQWA 3LFMA 4EYUA 2NTYA 4TUYE 8ICRA 4QH1A 5J2CA 1TFYA 2VB6A 5LP6E 2QRXA 2KT9A 3CQCB 3RPUA 2M2UA 3OWGA 3RYHE 3O1JA 2D0UA 4ZS2A 1KNRA 2FCLA 3UUXB 1IZNB 2NW9A 2LSYA 3UQ2A 4PFPA 3VKHA 3KINB 3LG7A 3BQKA 2XPKA 8ICPA 1ZJMA 1US7B 3VKGA 4O5EA 4YSXA 1NAFA 4YCXA 5FXZA 4ERRA 1VCTA 2V7JA 4WNKA 3C2KA 1D1AA 2FMSA 5LGTB 1I6ZA 3GDXA 4JI8T 4UVAB 2E9XD 4AT8B 3OKQA 4WC5A 3MZKB 2D9DA 2B1EA 4AKIA 4LEWA 5CFTA 3OV7A 4ZXLA 4JLXA 2LHNA 3GMIA 2OV9A 2LM9A 5ABGA 4IT4A 2BBHA 1NO5A 4DOCA 4XQ7A 3RJKA 3UUBA 2V7LA 2WMNA 2X67A 4MALA 5IHYA 2V8SV 4WBYA 1ZJNA 2ZM6T 3C51A 5J0XA 4I2AA 2IHOA 1HTJF 4B3TT 2L9QA 3BQLA 4PJLA 1E7PA 4LF8T 5HXEA 4M9NA 2W4XA 4KLQA 5J2BA 2V7IA 3NYBA 4RWOA 3NKZA 4ILUA 4FH3A 3MCRA 2YOEA 3ONJA 2Q9QC 4JEUB 9ICVA 3P8CD 2ZH2A 3ZMSB 3ZT7A 4RQ2A 3L8RA 4QX7B 1BPBA 2WMOA 1FIOA 3RLFF 1WYCA 3PURA 5DBBA 2LKHA 2D0TA 4CXWA 2IC9A 4MFRA 3R6NA 3IEEA 1WR0A 4UBCA 3HL6A 3LSVA 3RRCA 4R66A 4P0AA 1BR2A 4RPZA 2HPLA 4ILCA 1D1BA 4Q25A 2BZBA 2XM1A 1W9RA 4IDNA 5EZYE 3F2EA 2BCVA 1ZQHA 4KX6A 2WY2A 4OK0A 3AA1B 2DR8A 3P4SA 2F4VT 2XQ6A 4RQ5A 4P1NA 2V5CA 3FZFB 4AI6A 3JPSA 4AQGA 4GXKA 1J5ET 3EHZA 1ZOYA 2M6BA 4YMNA 2XQAA 8ICHA 5HXHA 4AT7A 4E8FA 3HIYA 5HR9A 3DTOA 4CXYA 5AQQB 4K97A 4N7RA 3NRYA 3ZSSA 3SOLA 5AQNB 4A97A 4K4IA 2E9XB 4ZS3A 3NKUA 4F5NA 3F57A 4JWMA 1SA0E 4L5GA 4LF7T 4GOUA 3ZLIA 1OXZA 2W9MA 4DIDB 4UV8B 3ZT5A 3MA9A 3K7DA 3ISDA 5HXSA 4DV5T 2DCFA 3PUSA 2WSSV 5AQKB 1KK7A 2J1DG 2WM9A 3OPCA 4IL4A 5HAXA 3LK3B 4KHPT 5DABA 7ICRA 3AEBA 4DNDA 4TWFA 5GONE 2PBEA 2CEAA 4X4TA 2XQ7A 2CXDA 2YU2A 1QSDA 3PU3A 3NZQA 4JI3T 4LZGA 5JDQA 2DRBA 3LK2B 4O8SA 5FL1A 5H6RB 4F5PA 4TWDA 2LEHA 2RP4A 2K3WA 4QZFA 5IWAT 4DV7T 4KI0F 3D0TA 1HUOA 5L3GB 1IBMT 1MIWA 2J47A 2RPAA 3OYZA 4JLZA 3K75D 4X4UA 2CM0A 2O1PA 2V5DA 1ZQZA 2J62A 8ICVA 4DOBA 3BQIA 4BA9A 5LHGB 2XY8B 9ICJA 4WW0A 4A98A 3AAAB 9ICOA 3AAEB 3RKOA 5LJMA 1WLXA 4UAZA 4R65A 4F8HA 2ZM8A 4X0AA 2ZHAA 1CHUA 3CKDA 3I0OA 4LF9T 3PUQA 3J7Yq 3V7LA 1XSPA 5IIJA 4DO0A 3N9OA 3W15B 4UB1A 8ICJA 4AKRB 4KLIA 2BCSA 5L2LA 3MKDA 4UV9B 4RWQA 4X1IE 4AKHA 5L3FB 2MBGA 4P09A 5DECA 4WBNE 4M1PA 4RQ6A 3C98B 1VCSA 2WWVA 4OAIZ 5FL0A 5J2IA 5J2TE 4FJOA 4H9SE 4YN4A 7ICPA 2V1DB 2WQYA 3IA3A 2FJDA 4M9LA 5L4EA 3RF1A 4I2CA 1JQRA 3UFGA 5J0YA 3A8YC 8ICKA 4EIWA 1W09A 3U78A 4X66T 3GWHA 4I2JA 3C4XA 2QA7A 3ZCJA 2LRKA 4NUUA 8ICUA 5LMNT 4UVBB 1LRZA 2IHMA 4M5DA 3B5MA 3EAMA 4LMKA 4PJMA 3ETVA 4LFBT 4XZCA 4PHEA 4UF0B 1B7TA 2AXDS 2RA1A 3I1AA 1HFAA 2KZ7B 9ICWA 4UXNB 3FB2A 3H3AA 1ZQPA 3AA6B 2LSGA 3ESLA 3ZKRA 3N9NA 3QC9A 5IIKA 3KDSE 3WI3A 3N5LA 4YHJA 2EHOA 5C2TA 4E7ZA 3E22E 2KMFA 2KXPB 1Y64B 8ICAA 4O68A 2VVSA 3E08A 3ZJ1A 2XJ7A 3N2GE 3V5UA 4FO1A 5CB1A 4KMCA 7ICMA 3RHWA 5J29A 4JBWF 4H9NC 3PNCA 2OLTA 1VRBA 5HRIA 4WBZA 4PK5A 3OVSA 3MK7C 4YMOA 3U3IA 3FHNA 4H9PC 2LOPA 2I59A 1ZQUA 4ZZCA 7ICGA 4UD4A 1MMDA 4IGUA 2NTXA 2H89A 3N9QA 4UB5A 2A3DA 3KVAA 4FHYA 3AEEA 5LGUB 3SRZA 4LEYA 3CX7B 4WQLA 2PTFA 4ZHQE 2ODVA 2L8KA 4K9BA 2CPTA 1H7CA 4I27A 5HRKA 3AVRA 7ICOA 5HRFA 4HWCA 4WC1A 3ETUA 3MDCA 1Q78A 1R89A 4AQFA 3RI5A 2WU2A 3JPOA 5LGNB 3B13A 1ZV4X 2ZLYA 2BCUA 4H9RC 1ZQYA 3CX8B 2CBJA 2QGSA 5FP3A 9ICAA 4IQUA 2UUCT 1UX5A 3JAFA 3TKLB 4KM5A 5FXXA 4NXWA 5LOVE 1ZQTA 4GIWA 4X65T 4PHDA 3AE3A 3TFSA 8ICQA 4U7IA 4RWNA 3AE5A 4PH5A 3RJFA 4MF8A 4GXIA 2B51A 5AQMB 4ILBA 4UELA 4KP3C 2DNXA 5JDMA 4IE5A 4UB3A 1I94T 3KV4A 1ZQCA 4LF6T 4MLKA 4KHZF 2BG9B 2N1GA 2DWKA 2JQKA 1IJ6A 4DV3T 4X4QA 8ICMA 3C18A 3AXJB 3EUHA 3JC6C 2BS4A 2MPKA 1M7KA 2YK0A 4V1Av 5DQWA 2Q9QD 2LHRA 1VOMA 3CPZA 2FJEA 1J1JA 2YINA 2BG9C 2XSBA 4FO6A 3N9LA 4LF5T 1XSNA 4DO9A 3RYIE 4H63V 4RT2A 3UPQA 4LFAT 3AEAA 3C4WA 2WZIA 4JLEA 3RJIA 2K48A 2V6YB 2W66A 5A1LA 2BVLA 4NLNA 3PDYA 4WZXA 4I2DA 3UQ4A 3ZYMA 2H88A 4DR6T 4RWPA 5IIOA 2DLRA 4GXJA 4OYJA 1YLQA 4ATBA 5BPCA 4PFOA 4WOYA 4DUZT 2LLYA 4AQFC 4ZOLE 5JDGA 5AQIB 4P4OA 3TLVA 3OVAA 4AT9A 3ZYLA 4ZI3C 5JVDE 2FJAA 1Q79A 1GPJA 2IHR1 4YSYA 3RIFA 4LMJA 1ZQKA 3PU8A 3WFSC 2VKOA 3HI2A 2WB5A 8ICOA 2VKHA 4DV1T 3OVBA 1T98A 2X9WA 5JDLA 5JR9B 4OYKA 2SPCA 5HCJA 4NM1A 5DB9A 9ICKA 3B57A 4UBBA 8ICTA 2VKJA 2WBLA 3PUGA 1N33T 3KFWX 4U7YA 3UU8A 3C66A 4M9HA 3PUZF 3A5XA 3AB3B 4O5KA 3KV6A 2KWIB 2WS3A 3RJJA 4UVCB 4YXDA 2LM2A 3P4RA 1U5PA 7ICJA 4PPXA 4DR2T 5JR9C 2XQ8A 2ZM2A 3RGLA 2P66A 2DL1A 4X4PA 1WFDA 3WFOA 3V72A 3CIRA 2W63A 4KLLA 3AE2A 4KLFA 4YFSA 4MHCA 5AQTB 4BJNA 4JWNA 4HTEA 2O5AA 3DJBA 5CJ7A 1XMOT 3H38A 3AQLA 1NENA 2R6GF 5EK4A 5J0SA 4NPPA 2Z6EA 4F5RA 2JMKA 3Q5XA 4DR4T 2ZH8A 4UAYA 4L9IA 4C91A 4QZAA 1Z0PA 1R8BA 4QZ9A 1YQ4A 1NEKA 1F5AA 3L9DA 1ZQWA 5J0PA 4KLJA 2Q9QB 4YTMA 2PJQA 2Y6XA 4NXVA 2E8IA 4KLTA 3B0XA 2UXDT 5D62A 4X62T 4RPXA 9ICXA 2JJ9A 5ADXL 3EABA 1FEWA 4A56A 4K4GA 4IE7A 2IAKA 4JI5T 1UCUA 2VQFT 2WP9A 5JDHA 7ICQA 1PX5A 2X51A 2VURA 1HX1B 4TUSA 1G73A 4B3RT 3MJXA 3SFDA 1YQ3A 9ICGA 1BPYA 3FZKB 2PFOA 3QUJA 5ETWA 2ZH9A 5HRDA 4XQ8A 3T1HT 4HFHA 3WFQE 9ICNA 4WC0A 2YDQA 4GYRA 3JPTA 3AQNA 4CQIA 3SFEA 1V4AA 2X66A 4YJ3E 1WR6A 4QZCA 4DOAA 2ODUA 5AQGB 1IJ5A 3VU7H 1HCIA 2VL8A 2PBIA 5DQVA 2YKSA 3EVYA 3UUMA 4JI2T 4EEDA 3AE4A 3QB5K 3AQKA 3GA8A 4J2CA 4M04A 3QNUA 5CHEA 3ISBA 1VJ7A 4O6AA 8ICSA 4NXZA 1YKEB 3MACA 4U72A 4TN7B 3UXOA 1JNZA 2UXCT 2XUEA 3F31A 5EK3A 4GK0E 5D4BA 5CA0E 2LSIA 5HRBA 4Z6CA 1JN3A 5CWRA 3I0QA 2JIWA 2WZHA 3ZMVB 4R63A 1OEDA 2IDOB 3ANWA 2ZH6A 9ICLA 3UQ0A 3HA4A 1SHZC 4OAGA 3K3NA 5HRHA 4AKGA 7ICNA 2NP9A 5KXJA 4JV5T 5FVKA 4H9OC 4F5QA 2CCQA 5JH7E 3NBXX 3ZT6A 4ILAA 4B3MT 2JQQA 4MKPA 5JDNA 3ERCC 4KLHA 2BS3A 1UK5A 3RQUA 3ZC1A 3PMNA 4PJNA 2VK9A 2LJLA 4ISTA 1BPZA 3LQCB 5FMNA 4K98A 3T8OA 5HC9A 2XTLA 3NRXA 5J0WA 2PFPA 1ZQBA 2CA5A 3RIUA 4EV6A 4AQYT 3FXEB 3HKCE 2W0GA 2H3RA 9ICEA 2YEVC 5J0UA 3FBZA 1IAPA 5IINA 3ZC0A 4RQ7A 4WYVA 3OUYA 5D46A 4ZI7E 2JMHA 3UQ7A 4JI1T 4P4MA 4JI4T 1ZQNA 4EYYR 4N78D 2KSRA 4LEZA 9ICPA 4ZZBA 2DR5A 3PTRB 1HS7A 4QWNB 1LKXA 3JCFA 3WFRE 5HWYA 4XBFB 4FHPA 3UTKA 1KEJA 1U4QA 2Y48B 4RT3A 3IBPA 5J0RA 5ABFA 3JZ0A 3AEFA 4AIUA 2PFNA 4COFA 4AT7B 3ONXA 2HN2A 5B3PA 1OEDB 4JI7T 2EWRA 4DBRA 5BMVE 1T7SA 3KVBA 1ZQXA 4NY8A 1HNWT 3AUOA 3VR8A 1D0XA 3Q5DA 1IBLT 2MOZA 1HF8A 4DV6T 2BCQA 3DP7A 3M65A 2B56A 1HR0T 1OEDC 5AFUL 2WDQA 4K4HA 3IHRA 4I4TE 4C90A 1XNRT 4KLSA 3ZMUB 3C5FA 5LA6E 1ZHCA 2CWOA 2YU1A 1YXRA 5LYJE 4MF2A 2CLYC 3UU6A 4IE4A 3TLUA 2XASB 3RX6A 5AQVB 1D0ZA 3OTOT 4CN6A 1HNXT 3C4ZA 5J0QA 4YY3T 4UAWA 1BR1A 4JI0T 4TNWA 3JC6D 5LB7B 3I9WA 2LSJA 4YT0A 3L3PA 4HN9A 5LNKA 1UEVA 2GAFD 4QHOA 5TAOA 5FNVE 2FMQA 5DEDA 2XZEA 5C3JA 4K99A 8ICBA 1RZTA 1MIVA 1XZYA 3FBLA 2E5VA 3RIUC 4IREA 4CI3B 5J0ZA 5B3QA 3UT5E 2ES0A 4OAHA 9ICMA 3N9PA 1ZQRA 3L39A 4LMLA 2K5BB 3UU4A 5J0TA 4JEHB 3RJHA 1O3XA 1ZQGA 4HFCA 4K9AA 7ICLA 5AQFB 3P50A 4RQ1A 4LVSA 4M47A 1YKHB 2WCAA 2WDVA 3GN5A 1OWAA 1R8IA 3N2KE 4I55E 4RPYA 3RJGA 4ZI3D 4X1YE 4EBJA 1XDOA 2ZHBA 5CA7A 7ICFA 8ICYA 4QZBA 4S3NA 3AU2A 3FZHB 5DBAA 3AAIA 2B76A 2M2VA 1LVFA 4E7SA 5FVLA 3SWHA 2VWAA 4NXXA 5DB8A 2X0LB 2XQ3A 4TX5A 4K0UA 4IDOA 4O2AE 1S94A 2GK9A 2JPFA 5BOLA 4DV2T 4DR1T 1HUZA 5HEGA 5IIMA 5CHGA 1KF6A 3G06A 5LXTE 3C64A 5FY1A 2XAJB 5F5WA 4MFAA 2BPCA 4X4RA 2XQ4A 2XSAA 4TZ4C 1L0VA 1CUNA 3OJAA 4EEBA 4U74A 3ZN0B 4WC2A 4QZGA 4FHWA 5KMGP 4KLMA 3LK42 3LBXA 3OGUA 4QZEA 4CZZB 1ZQLA 4EZHA 5CP2A 2Q66A 5LJNA 2UXXB 4E7XA 5AQSB 2K9AA 2RFFA 2V7MA 3P4PA 2ISPA 4DUYT 9ICTA 4AXPA 4NM2A 3VRBA 2XM2A 4KLUA 2NRKA 1QLBA 5L3CB 4JI6T 5HHIA 4RQ4A 3JAEA 2OA5A 1BPEA 5HEUA 3JYYA 4EXTA 2HH7A 3HW8A 5F2VO 3TLSA 2EHOB 3HWTA 1UEUA 1JMSA 4TWHA
chains in the Genus database with same CATH topology
2HN1A 4EEDA 2BBJA 3JCFA 3CK6A 4I0UA 3RKGA 4EGWA 3NVOA 4EEBA 4EV6A 2IUBA 2HN2A 3NWIA 2BBHA 5JTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HN1 A;  4EED A;  2BBJ A;  3JCF A;  3CK6 A;  4I0U A;  3RKG A;  4EGW A;  3NVO A;  4EEB A;  4EV6 A;  2IUB A;  2HN2 A;  3NWI A;  2BBH A;  5JTG A; 
#chains in the Genus database with same CATH topology
 3HJ4 A;  2X9H A;  3ZMZ B;  4P4P A;  2NWB A;  4XA5 A;  1V9D A;  3K8P C;  2IW5 B;  3PE0 A;  3CVR A;  4IG8 A;  4U2Z A;  1TVA A;  4EB6 E;  2HHH T;  1G8X A;  2PG8 A;  4A5X A;  1BR0 A;  4KLG A;  2EHO C;  5LHH B;  4X4V A;  2LOS A;  2N2N A;  4GYS A;  3QOF A;  2LSK A;  5DDY A;  3RH5 A;  4YLH A;  3EDV A;  1ZQQ A;  4FI5 A;  4X4O A;  3UUL A;  4CN4 A;  3KV5 A;  4I2F A;  4DMV A;  3LK9 A;  5CA1 E;  5EK2 A;  5HXR A;  3RYC E;  2ISO A;  3PHZ A;  2J4G A;  1JNR A;  1ZQO A;  2KWH A;  4KB6 A;  3CQX C;  9ICS A;  9ICF A;  1M62 A;  9ICH A;  4PAG A;  4XRH A;  1JAJ A;  3JPQ A;  3CWZ B;  2K24 A;  1WRD A;  4PK4 A;  2KND A;  3C2L A;  5EOZ A;  3PJA J;  4EAH A;  4YD2 A;  1S35 A;  2A72 A;  2UUB T;  3FZM B;  5L4H A;  4O2B E;  8ICN A;  4WC7 A;  3WAJ A;  2FBW A;  1ZQE A;  4UD5 A;  1MND A;  3TFR A;  4AT8 A;  3H3M A;  2VVN A;  2X9Y A;  1QUU A;  4LF4 T;  4OAF A;  4PGY A;  7ICV A;  1Y01 A;  5AQO B;  5LCY A;  1TV9 A;  3V7J A;  1T8B A;  4I50 E;  4LFC T;  4Z91 A;  3ZN1 B;  4R64 A;  4HX0 A;  3ZMT B;  2A2F X;  4DV4 T;  2D2S A;  4X64 T;  2H7V C;  2H7O A;  4CI1 B;  4WC6 A;  2BVM A;  5AQR B;  4K8V A;  5L3E B;  1UX4 A;  3PML A;  4K96 A;  3EI0 A;  4WQK A;  1ZQI A;  1Z8U A;  4FHX A;  1N32 T;  3PUV F;  1SUM B;  4NLZ A;  5LMU T;  1KNZ A;  4BJM A;  4HGA A;  4ZEY A;  3HJ1 A;  4CXX A;  5FYM A;  4RQ8 A;  5HHH A;  4ZI2 D;  3V7K A;  5J2G A;  2M2W A;  4CN1 A;  2DI4 A;  1KEY A;  3HR0 A;  2GA9 D;  2I6H A;  4M9J A;  5J2A A;  2IIU A;  2X0H A;  3M3Z B;  2GWS A;  2NW8 A;  1IBK T;  3E0Z A;  3I9Y A;  3SS1 A;  2AE9 A;  2X9X A;  3AVS A;  5J0O A;  4HFI A;  8ICF A;  2FJB A;  5HEJ A;  1N34 T;  4F5O A;  2DWG A;  2JQ9 A;  1XSL A;  2VAS A;  4I2I A;  4O4J E;  1RPL A;  3P4Q A;  4QZ8 A;  2VL0 A;  1HG2 A;  3RC3 A;  7ICT A;  4OX9 T;  5LBM A;  1BR4 A;  5HEH A;  4X4S A;  5JQG E;  4M9G A;  2WU5 A;  4K0K T;  4ATB B;  4AT9 B;  3PV0 F;  3AE7 A;  4PHP A;  3K3Q C;  4DMW A;  1R8C A;  1ZQS A;  8ICL A;  2DHR A;  3VR9 A;  5JRC A;  2BKO A;  5AQU B;  3C2M A;  5CB4 E;  1YD8 G;  2XAG B;  2UU9 T;  2V26 A;  5FY0 A;  4WC4 A;  2HPJ A;  4XUS A;  1ZEE A;  4QH5 A;  2C5J A;  1FJG T;  4UIG A;  4NIQ A;  3C5G A;  1J5W A;  5ABE A;  2M6I A;  4GKK T;  4I2H A;  1MIY A;  2W2U A;  4IDZ A;  3O9X A;  2FUP A;  1X79 A;  2E9X A;  2DRA A;  1ZP0 A;  5IIL A;  2YN6 A;  3N2O A;  4B6X A;  9ICI A;  1BPX A;  7ICE A;  3HKB E;  2E2A A;  5JDF A;  3O1I A;  3MGI A;  2B4V A;  3OYX A;  2BG9 E;  4HWD A;  4NLK A;  1HG5 A;  2M67 A;  3RYF E;  3MBY A;  4PHA A;  1MMN A;  4YD1 A;  2DVI A;  2CMR A;  4B3S T;  1UUR A;  5DJQ C;  2XQY A;  2W62 A;  4QKN A;  1FMV A;  4PW8 A;  4RQ3 A;  4DVD A;  2E5L T;  2MAW A;  4PNI A;  4ANJ A;  2WDR A;  5FXV A;  3Q5E A;  4XJE A;  4WBO A;  2XAQ B;  1KNP A;  2D5U A;  1UGO A;  5FY7 A;  4NXT A;  4UB2 A;  2QYW A;  4TNV A;  4TV9 E;  3TLW A;  4HWI B;  2NOX A;  3J9X 1;  1DU2 A;  4CI2 B;  3AU6 A;  3PUY F;  1ZKE A;  2UXB T;  5JRC B;  3K1S A;  4LEV A;  3O4X E;  5CJ5 A;  3MGH A;  5L3B B;  5HXC A;  2W67 A;  3AED A;  4M2Y A;  4ZI2 C;  5CFU A;  2CHN A;  2IML A;  4RQ0 A;  3Q9D A;  4QX8 B;  1KDH A;  4JUY A;  4X0B A;  1N36 T;  2V6X A;  4O5C A;  2QVA A;  2MTQ A;  3IF8 B;  2BS2 A;  3H37 A;  3ER8 C;  4TV8 E;  2W61 A;  2BKP A;  4HWH A;  4HEA A;  4EP7 A;  8ICG A;  4QH4 A;  3UU5 A;  3EF2 A;  3ZEF B;  4HFB A;  4PJJ A;  4EGW A;  4HWF A;  2XQ5 A;  2E9X C;  2X0Y A;  4NXN T;  2LRL A;  4HE8 A;  3ZCI A;  4IDQ A;  1X9B A;  4Z6E A;  4PGQ A;  1R8A A;  3AE6 A;  8ICX A;  5J2E A;  5D63 A;  1MQ3 A;  2KLQ A;  2ZMA A;  8ICI A;  4I28 A;  4OFZ A;  8ICZ A;  4YSZ A;  5HRL A;  1ZQJ A;  1E2A A;  4NUV A;  5J2D A;  4LT6 A;  4ADZ A;  5IYZ E;  2ACZ A;  3AE9 A;  3WFP A;  4EZ4 A;  4U31 A;  3LDQ B;  4U33 A;  5HEO A;  9ICU A;  4UF0 A;  2IUB A;  5TZV A;  3ER9 B;  3KBT A;  5BR8 T;  3RH4 A;  2HN1 A;  3ANW B;  3WAK A;  5BOM A;  4PGX A;  2LKG A;  4U3C A;  4X5T A;  3QK6 A;  2ZM0 A;  4O4H E;  5AQH B;  1HX8 A;  1XNQ T;  3RC8 A;  2V7K A;  3Q2M A;  3NZP A;  2CLY B;  5M4Y A;  5DDM A;  2BCR A;  1WCR A;  4HFD A;  4KLO A;  3AE8 A;  4I0U A;  1GQE A;  3FXD B;  4KLE A;  1D0Y A;  1ZQF A;  4I2G A;  1MMG A;  3UPS A;  3ZJ2 A;  3ZST A;  4QXB B;  4O4I E;  7ICK A;  2EHO D;  2NR4 A;  2JQH A;  5III A;  2ZH1 A;  1UUS A;  2DR9 A;  2LE8 A;  4IE6 A;  4UR9 A;  3ZYK A;  3AE1 A;  5F8P A;  4I43 B;  1NOM A;  1LVK A;  5HYA A;  2YDS A;  4LZD A;  1VFG A;  2XAF B;  3PUA A;  2C5K T;  4UEM A;  4EOZ B;  4DV0 T;  2C5I T;  3NVO A;  2HHP A;  3NWI A;  3OUY B;  3O1H A;  1AJ3 A;  4OHF A;  3PUW F;  4G63 A;  4H63 H;  3JPN A;  4HKA A;  3PUX F;  4NKU A;  4MFC A;  4IQV A;  2I9G A;  2A9U A;  4QXH B;  1ZQM A;  1MMA A;  2CWY A;  1BPD A;  3OBV E;  2DR7 A;  4Z8X A;  3Q5W A;  4HFE A;  4Z90 A;  2XHE B;  2FMP A;  4X5V A;  9ICC A;  2NW7 A;  4YTN A;  3BK9 A;  3K3O A;  2BDE A;  2CE7 A;  5ABF B;  5LBQ B;  4Z6D A;  5J2J A;  2W00 A;  4F6R C;  4UB4 A;  2BPF A;  3CX6 B;  2ID1 A;  4AKL A;  4GK5 E;  4FHV A;  5AQP B;  3JPR A;  3AA7 B;  3AEC A;  4YJ2 E;  5DBC A;  3P7I A;  9ICR A;  4MFF A;  4O4L E;  5HWX A;  2CHO A;  4P0B A;  5CGM A;  1W0B A;  5CFS A;  5J2F A;  3MXZ A;  4IDP A;  3VRA A;  4G2A A;  4H9Q C;  1MNE A;  2G0U A;  2ZH3 A;  3UXN A;  3RJE A;  2WAU A;  4TUR A;  5L47 A;  4WH5 A;  4X4N A;  4M0A A;  7ICS A;  1ZQV A;  1FA0 A;  4PK6 A;  5JRE A;  1HNZ T;  2P9B A;  3KBU A;  3OVU A;  3CQG B;  2BG9 A;  3KV9 A;  5FKY A;  1D1C A;  3R84 B;  5L3D B;  1OU5 A;  5F3J A;  3L09 A;  2LT3 A;  5CR0 A;  4KBM B;  4XAX B;  7ICI A;  4AIS A;  4NXM T;  7ICH A;  4KLD A;  3RKG A;  2X68 A;  3AXJ A;  1WOT A;  5D49 A;  3ISC A;  3ABV A;  4IIJ E;  2YDR A;  1KNY A;  5LG4 A;  4NKT A;  5CFB A;  2CXL A;  8ICW A;  4Z6F A;  4WC3 A;  2CXF A;  4X1K E;  4L0R A;  2UUA T;  4MBQ A;  4GKJ T;  3RRW A;  4DR7 T;  3HKE E;  4YMM A;  3RIA A;  5J2H A;  4NXU A;  7ICU A;  2V6Y A;  4DR5 T;  1XDP A;  4WCW A;  2CBI A;  3JAD A;  3UU3 A;  4HFV A;  2ACX A;  5C8Y E;  2VQE T;  4I29 A;  4DR3 T;  4QZH A;  2VAN A;  3ZPO A;  4O67 A;  3GN5 B;  1SE7 A;  4E80 A;  3UFE A;  2ZH5 A;  4O9M A;  4KUM B;  4YTP A;  3H39 A;  4FH5 A;  5DB7 A;  4JYA T;  2BPG A;  2M2T A;  4QXC B;  3UXP A;  3EDU A;  5LHI B;  4P2H A;  5J1G A;  5D61 A;  3MDA A;  5HCM A;  1ZQA A;  3HX0 A;  4IQT A;  1TFW A;  2BBJ A;  1FMW A;  1OED E;  3JPP A;  3RH3 A;  2N9D A;  1WYB A;  5DKW A;  5JR9 A;  4IHJ E;  3QB5 A;  3LJC A;  1YW0 A;  3TLT A;  3B0Y A;  4X20 E;  4TUQ A;  2PFV A;  2Y8D A;  5LG3 A;  5HRE A;  2UXN B;  1NWM X;  1E1H B;  2BKN A;  3AQM A;  2XAH B;  5IUX A;  5HRG A;  2L3L A;  4QZI A;  8ICC A;  3LBX B;  3FZL B;  5AQL B;  4I2E A;  3CML A;  1T72 A;  2PXI A;  5J2K A;  4ASK A;  4YHH T;  2BE3 A;  3P4W A;  3VHL A;  2JRK A;  5KDM C;  2ZH4 A;  9ICB A;  2VKD A;  2C0S A;  5FXW A;  4ISS A;  1ZQD A;  1UET A;  2I0M A;  5ABH A;  4TUP A;  4IQW A;  4DBQ A;  2MYS A;  5DB6 A;  3N9M A;  3T1Y T;  3PJA A;  2KIN B;  9ICQ A;  3UUN A;  5JTG A;  4QZD A;  5J2U E;  2XQ9 A;  5AQJ B;  2ZH7 A;  5H6Q B;  1EZ3 A;  3A7M A;  3V5S A;  4IE0 A;  5E0O A;  3X1D A;  1KFY A;  3ONL C;  1XMQ T;  1W0A A;  2IC6 A;  3C50 A;  3AEG A;  4O69 A;  4I2B A;  3CK6 A;  4IL9 A;  2WWU A;  2CRB A;  5KX5 E;  1XWM A;  3S4U A;  4U2Y A;  4BAY B;  3AA0 B;  8ICE A;  1MQ2 A;  2Q9Q A;  2PFQ A;  3HKD E;  3RH6 A;  4EBK A;  3RQW A;  3LFM A;  4EYU A;  2NTY A;  4TUY E;  8ICR A;  4QH1 A;  5J2C A;  1TFY A;  2VB6 A;  5LP6 E;  2QRX A;  2KT9 A;  3CQC B;  3RPU A;  2M2U A;  3OWG A;  3RYH E;  3O1J A;  2D0U A;  4ZS2 A;  1KNR A;  2FCL A;  3UUX B;  1IZN B;  2NW9 A;  2LSY A;  3UQ2 A;  4PFP A;  3VKH A;  3KIN B;  3LG7 A;  3BQK A;  2XPK A;  8ICP A;  1ZJM A;  1US7 B;  3VKG A;  4O5E A;  4YSX A;  1NAF A;  4YCX A;  5FXZ A;  4ERR A;  1VCT A;  2V7J A;  4WNK A;  3C2K A;  1D1A A;  2FMS A;  5LGT B;  1I6Z A;  3GDX A;  4JI8 T;  4UVA B;  2E9X D;  4AT8 B;  3OKQ A;  4WC5 A;  3MZK B;  2D9D A;  2B1E A;  4AKI A;  4LEW A;  5CFT A;  3OV7 A;  4ZXL A;  4JLX A;  2LHN A;  3GMI A;  2OV9 A;  2LM9 A;  5ABG A;  4IT4 A;  2BBH A;  1NO5 A;  4DOC A;  4XQ7 A;  3RJK A;  3UUB A;  2V7L A;  2WMN A;  2X67 A;  4MAL A;  5IHY A;  2V8S V;  4WBY A;  1ZJN A;  2ZM6 T;  3C51 A;  5J0X A;  4I2A A;  2IHO A;  1HTJ F;  4B3T T;  2L9Q A;  3BQL A;  4PJL A;  1E7P A;  4LF8 T;  5HXE A;  4M9N A;  2W4X A;  4KLQ A;  5J2B A;  2V7I A;  3NYB A;  4RWO A;  3NKZ A;  4ILU A;  4FH3 A;  3MCR A;  2YOE A;  3ONJ A;  2Q9Q C;  4JEU B;  9ICV A;  3P8C D;  2ZH2 A;  3ZMS B;  3ZT7 A;  4RQ2 A;  3L8R A;  4QX7 B;  1BPB A;  2WMO A;  1FIO A;  3RLF F;  1WYC A;  3PUR A;  5DBB A;  2LKH A;  2D0T A;  4CXW A;  2IC9 A;  4MFR A;  3R6N A;  3IEE A;  1WR0 A;  4UBC A;  3HL6 A;  3LSV A;  3RRC A;  4R66 A;  4P0A A;  1BR2 A;  4RPZ A;  2HPL A;  4ILC A;  1D1B A;  4Q25 A;  2BZB A;  2XM1 A;  1W9R A;  4IDN A;  5EZY E;  3F2E A;  2BCV A;  1ZQH A;  4KX6 A;  2WY2 A;  4OK0 A;  3AA1 B;  2DR8 A;  3P4S A;  2F4V T;  2XQ6 A;  4RQ5 A;  4P1N A;  2V5C A;  3FZF B;  4AI6 A;  3JPS A;  4AQG A;  4GXK A;  1J5E T;  3EHZ A;  1ZOY A;  2M6B A;  4YMN A;  2XQA A;  8ICH A;  5HXH A;  4AT7 A;  4E8F A;  3HIY A;  5HR9 A;  3DTO A;  4CXY A;  5AQQ B;  4K97 A;  4N7R A;  3NRY A;  3ZSS A;  3SOL A;  5AQN B;  4A97 A;  4K4I A;  2E9X B;  4ZS3 A;  3NKU A;  4F5N A;  3F57 A;  4JWM A;  1SA0 E;  4L5G A;  4LF7 T;  4GOU A;  3ZLI A;  1OXZ A;  2W9M A;  4DID B;  4UV8 B;  3ZT5 A;  3MA9 A;  3K7D A;  3ISD A;  5HXS A;  4DV5 T;  2DCF A;  3PUS A;  2WSS V;  5AQK B;  1KK7 A;  2J1D G;  2WM9 A;  3OPC A;  4IL4 A;  5HAX A;  3LK3 B;  4KHP T;  5DAB A;  7ICR A;  3AEB A;  4DND A;  4TWF A;  5GON E;  2PBE A;  2CEA A;  4X4T A;  2XQ7 A;  2CXD A;  2YU2 A;  1QSD A;  3PU3 A;  3NZQ A;  4JI3 T;  4LZG A;  5JDQ A;  2DRB A;  3LK2 B;  4O8S A;  5FL1 A;  5H6R B;  4F5P A;  4TWD A;  2LEH A;  2RP4 A;  2K3W A;  4QZF A;  5IWA T;  4DV7 T;  4KI0 F;  3D0T A;  1HUO A;  5L3G B;  1IBM T;  1MIW A;  2J47 A;  2RPA A;  3OYZ A;  4JLZ A;  3K75 D;  4X4U A;  2CM0 A;  2O1P A;  2V5D A;  1ZQZ A;  2J62 A;  8ICV A;  4DOB A;  3BQI A;  4BA9 A;  5LHG B;  2XY8 B;  9ICJ A;  4WW0 A;  4A98 A;  3AAA B;  9ICO A;  3AAE B;  3RKO A;  5LJM A;  1WLX A;  4UAZ A;  4R65 A;  4F8H A;  2ZM8 A;  4X0A A;  2ZHA A;  1CHU A;  3CKD A;  3I0O A;  4LF9 T;  3PUQ A;  3J7Y q;  3V7L A;  1XSP A;  5IIJ A;  4DO0 A;  3N9O A;  3W15 B;  4UB1 A;  8ICJ A;  4AKR B;  4KLI A;  2BCS A;  5L2L A;  3MKD A;  4UV9 B;  4RWQ A;  4X1I E;  4AKH A;  5L3F B;  2MBG A;  4P09 A;  5DEC A;  4WBN E;  4M1P A;  4RQ6 A;  3C98 B;  1VCS A;  2WWV A;  4OAI Z;  5FL0 A;  5J2I A;  5J2T E;  4FJO A;  4H9S E;  4YN4 A;  7ICP A;  2V1D B;  2WQY A;  3IA3 A;  2FJD A;  4M9L A;  5L4E A;  3RF1 A;  4I2C A;  1JQR A;  3UFG A;  5J0Y A;  3A8Y C;  8ICK A;  4EIW A;  1W09 A;  3U78 A;  4X66 T;  3GWH A;  4I2J A;  3C4X A;  2QA7 A;  3ZCJ A;  2LRK A;  4NUU A;  8ICU A;  5LMN T;  4UVB B;  1LRZ A;  2IHM A;  4M5D A;  3B5M A;  3EAM A;  4LMK A;  4PJM A;  3ETV A;  4LFB T;  4XZC A;  4PHE A;  4UF0 B;  1B7T A;  2AXD S;  2RA1 A;  3I1A A;  1HFA A;  2KZ7 B;  9ICW A;  4UXN B;  3FB2 A;  3H3A A;  1ZQP A;  3AA6 B;  2LSG A;  3ESL A;  3ZKR A;  3N9N A;  3QC9 A;  5IIK A;  3KDS E;  3WI3 A;  3N5L A;  4YHJ A;  2EHO A;  5C2T A;  4E7Z A;  3E22 E;  2KMF A;  2KXP B;  1Y64 B;  8ICA A;  4O68 A;  2VVS A;  3E08 A;  3ZJ1 A;  2XJ7 A;  3N2G E;  3V5U A;  4FO1 A;  5CB1 A;  4KMC A;  7ICM A;  3RHW A;  5J29 A;  4JBW F;  4H9N C;  3PNC A;  2OLT A;  1VRB A;  5HRI A;  4WBZ A;  4PK5 A;  3OVS A;  3MK7 C;  4YMO A;  3U3I A;  3FHN A;  4H9P C;  2LOP A;  2I59 A;  1ZQU A;  4ZZC A;  7ICG A;  4UD4 A;  1MMD A;  4IGU A;  2NTX A;  2H89 A;  3N9Q A;  4UB5 A;  2A3D A;  3KVA A;  4FHY A;  3AEE A;  5LGU B;  3SRZ A;  4LEY A;  3CX7 B;  4WQL A;  2PTF A;  4ZHQ E;  2ODV A;  2L8K A;  4K9B A;  2CPT A;  1H7C A;  4I27 A;  5HRK A;  3AVR A;  7ICO A;  5HRF A;  4HWC A;  4WC1 A;  3ETU A;  3MDC A;  1Q78 A;  1R89 A;  4AQF A;  3RI5 A;  2WU2 A;  3JPO A;  5LGN B;  3B13 A;  1ZV4 X;  2ZLY A;  2BCU A;  4H9R C;  1ZQY A;  3CX8 B;  2CBJ A;  2QGS A;  5FP3 A;  9ICA A;  4IQU A;  2UUC T;  1UX5 A;  3JAF A;  3TKL B;  4KM5 A;  5FXX A;  4NXW A;  5LOV E;  1ZQT A;  4GIW A;  4X65 T;  4PHD A;  3AE3 A;  3TFS A;  8ICQ A;  4U7I A;  4RWN A;  3AE5 A;  4PH5 A;  3RJF A;  4MF8 A;  4GXI A;  2B51 A;  5AQM B;  4ILB A;  4UEL A;  4KP3 C;  2DNX A;  5JDM A;  4IE5 A;  4UB3 A;  1I94 T;  3KV4 A;  1ZQC A;  4LF6 T;  4MLK A;  4KHZ F;  2BG9 B;  2N1G A;  2DWK A;  2JQK A;  1IJ6 A;  4DV3 T;  4X4Q A;  8ICM A;  3C18 A;  3AXJ B;  3EUH A;  3JC6 C;  2BS4 A;  2MPK A;  1M7K A;  2YK0 A;  4V1A v;  5DQW A;  2Q9Q D;  2LHR A;  1VOM A;  3CPZ A;  2FJE A;  1J1J A;  2YIN A;  2BG9 C;  2XSB A;  4FO6 A;  3N9L A;  4LF5 T;  1XSN A;  4DO9 A;  3RYI E;  4H63 V;  4RT2 A;  3UPQ A;  4LFA T;  3AEA A;  3C4W A;  2WZI A;  4JLE A;  3RJI A;  2K48 A;  2V6Y B;  2W66 A;  5A1L A;  2BVL A;  4NLN A;  3PDY A;  4WZX A;  4I2D A;  3UQ4 A;  3ZYM A;  2H88 A;  4DR6 T;  4RWP A;  5IIO A;  2DLR A;  4GXJ A;  4OYJ A;  1YLQ A;  4ATB A;  5BPC A;  4PFO A;  4WOY A;  4DUZ T;  2LLY A;  4AQF C;  4ZOL E;  5JDG A;  5AQI B;  4P4O A;  3TLV A;  3OVA A;  4AT9 A;  3ZYL A;  4ZI3 C;  5JVD E;  2FJA A;  1Q79 A;  1GPJ A;  2IHR 1;  4YSY A;  3RIF A;  4LMJ A;  1ZQK A;  3PU8 A;  3WFS C;  2VKO A;  3HI2 A;  2WB5 A;  8ICO A;  2VKH A;  4DV1 T;  3OVB A;  1T98 A;  2X9W A;  5JDL A;  5JR9 B;  4OYK A;  2SPC A;  5HCJ A;  4NM1 A;  5DB9 A;  9ICK A;  3B57 A;  4UBB A;  8ICT A;  2VKJ A;  2WBL A;  3PUG A;  1N33 T;  3KFW X;  4U7Y A;  3UU8 A;  3C66 A;  4M9H A;  3PUZ F;  3A5X A;  3AB3 B;  4O5K A;  3KV6 A;  2KWI B;  2WS3 A;  3RJJ A;  4UVC B;  4YXD A;  2LM2 A;  3P4R A;  1U5P A;  7ICJ A;  4PPX A;  4DR2 T;  5JR9 C;  2XQ8 A;  2ZM2 A;  3RGL A;  2P66 A;  2DL1 A;  4X4P A;  1WFD A;  3WFO A;  3V72 A;  3CIR A;  2W63 A;  4KLL A;  3AE2 A;  4KLF A;  4YFS A;  4MHC A;  5AQT B;  4BJN A;  4JWN A;  4HTE A;  2O5A A;  3DJB A;  5CJ7 A;  1XMO T;  3H38 A;  3AQL A;  1NEN A;  2R6G F;  5EK4 A;  5J0S A;  4NPP A;  2Z6E A;  4F5R A;  2JMK A;  3Q5X A;  4DR4 T;  2ZH8 A;  4UAY A;  4L9I A;  4C91 A;  4QZA A;  1Z0P A;  1R8B A;  4QZ9 A;  1YQ4 A;  1NEK A;  1F5A A;  3L9D A;  1ZQW A;  5J0P A;  4KLJ A;  2Q9Q B;  4YTM A;  2PJQ A;  2Y6X A;  4NXV A;  2E8I A;  4KLT A;  3B0X A;  2UXD T;  5D62 A;  4X62 T;  4RPX A;  9ICX A;  2JJ9 A;  5ADX L;  3EAB A;  1FEW A;  4A56 A;  4K4G A;  4IE7 A;  2IAK A;  4JI5 T;  1UCU A;  2VQF T;  2WP9 A;  5JDH A;  7ICQ A;  1PX5 A;  2X51 A;  2VUR A;  1HX1 B;  4TUS A;  1G73 A;  4B3R T;  3MJX A;  3SFD A;  1YQ3 A;  9ICG A;  1BPY A;  3FZK B;  2PFO A;  3QUJ A;  5ETW A;  2ZH9 A;  5HRD A;  4XQ8 A;  3T1H T;  4HFH A;  3WFQ E;  9ICN A;  4WC0 A;  2YDQ A;  4GYR A;  3JPT A;  3AQN A;  4CQI A;  3SFE A;  1V4A A;  2X66 A;  4YJ3 E;  1WR6 A;  4QZC A;  4DOA A;  2ODU A;  5AQG B;  1IJ5 A;  3VU7 H;  1HCI A;  2VL8 A;  2PBI A;  5DQV A;  2YKS A;  3EVY A;  3UUM A;  4JI2 T;  4EED A;  3AE4 A;  3QB5 K;  3AQK A;  3GA8 A;  4J2C A;  4M04 A;  3QNU A;  5CHE A;  3ISB A;  1VJ7 A;  4O6A A;  8ICS A;  4NXZ A;  1YKE B;  3MAC A;  4U72 A;  4TN7 B;  3UXO A;  1JNZ A;  2UXC T;  2XUE A;  3F31 A;  5EK3 A;  4GK0 E;  5D4B A;  5CA0 E;  2LSI A;  5HRB A;  4Z6C A;  1JN3 A;  5CWR A;  3I0Q A;  2JIW A;  2WZH A;  3ZMV B;  4R63 A;  1OED A;  2IDO B;  3ANW A;  2ZH6 A;  9ICL A;  3UQ0 A;  3HA4 A;  1SHZ C;  4OAG A;  3K3N A;  5HRH A;  4AKG A;  7ICN A;  2NP9 A;  5KXJ A;  4JV5 T;  5FVK A;  4H9O C;  4F5Q A;  2CCQ A;  5JH7 E;  3NBX X;  3ZT6 A;  4ILA A;  4B3M T;  2JQQ A;  4MKP A;  5JDN A;  3ERC C;  4KLH A;  2BS3 A;  1UK5 A;  3RQU A;  3ZC1 A;  3PMN A;  4PJN A;  2VK9 A;  2LJL A;  4IST A;  1BPZ A;  3LQC B;  5FMN A;  4K98 A;  3T8O A;  5HC9 A;  2XTL A;  3NRX A;  5J0W A;  2PFP A;  1ZQB A;  2CA5 A;  3RIU A;  4EV6 A;  4AQY T;  3FXE B;  3HKC E;  2W0G A;  2H3R A;  9ICE A;  2YEV C;  5J0U A;  3FBZ A;  1IAP A;  5IIN A;  3ZC0 A;  4RQ7 A;  4WYV A;  3OUY A;  5D46 A;  4ZI7 E;  2JMH A;  3UQ7 A;  4JI1 T;  4P4M A;  4JI4 T;  1ZQN A;  4EYY R;  4N78 D;  2KSR A;  4LEZ A;  9ICP A;  4ZZB A;  2DR5 A;  3PTR B;  1HS7 A;  4QWN B;  1LKX A;  3JCF A;  3WFR E;  5HWY A;  4XBF B;  4FHP A;  3UTK A;  1KEJ A;  1U4Q A;  2Y48 B;  4RT3 A;  3IBP A;  5J0R A;  5ABF A;  3JZ0 A;  3AEF A;  4AIU A;  2PFN A;  4COF A;  4AT7 B;  3ONX A;  2HN2 A;  5B3P A;  1OED B;  4JI7 T;  2EWR A;  4DBR A;  5BMV E;  1T7S A;  3KVB A;  1ZQX A;  4NY8 A;  1HNW T;  3AUO A;  3VR8 A;  1D0X A;  3Q5D A;  1IBL T;  2MOZ A;  1HF8 A;  4DV6 T;  2BCQ A;  3DP7 A;  3M65 A;  2B56 A;  1HR0 T;  1OED C;  5AFU L;  2WDQ A;  4K4H A;  3IHR A;  4I4T E;  4C90 A;  1XNR T;  4KLS A;  3ZMU B;  3C5F A;  5LA6 E;  1ZHC A;  2CWO A;  2YU1 A;  1YXR A;  5LYJ E;  4MF2 A;  2CLY C;  3UU6 A;  4IE4 A;  3TLU A;  2XAS B;  3RX6 A;  5AQV B;  1D0Z A;  3OTO T;  4CN6 A;  1HNX T;  3C4Z A;  5J0Q A;  4YY3 T;  4UAW A;  1BR1 A;  4JI0 T;  4TNW A;  3JC6 D;  5LB7 B;  3I9W A;  2LSJ A;  4YT0 A;  3L3P A;  4HN9 A;  5LNK A;  1UEV A;  2GAF D;  4QHO A;  5TAO A;  5FNV E;  2FMQ A;  5DED A;  2XZE A;  5C3J A;  4K99 A;  8ICB A;  1RZT A;  1MIV A;  1XZY A;  3FBL A;  2E5V A;  3RIU C;  4IRE A;  4CI3 B;  5J0Z A;  5B3Q A;  3UT5 E;  2ES0 A;  4OAH A;  9ICM A;  3N9P A;  1ZQR A;  3L39 A;  4LML A;  2K5B B;  3UU4 A;  5J0T A;  4JEH B;  3RJH A;  1O3X A;  1ZQG A;  4HFC A;  4K9A A;  7ICL A;  5AQF B;  3P50 A;  4RQ1 A;  4LVS A;  4M47 A;  1YKH B;  2WCA A;  2WDV A;  3GN5 A;  1OWA A;  1R8I A;  3N2K E;  4I55 E;  4RPY A;  3RJG A;  4ZI3 D;  4X1Y E;  4EBJ A;  1XDO A;  2ZHB A;  5CA7 A;  7ICF A;  8ICY A;  4QZB A;  4S3N A;  3AU2 A;  3FZH B;  5DBA A;  3AAI A;  2B76 A;  2M2V A;  1LVF A;  4E7S A;  5FVL A;  3SWH A;  2VWA A;  4NXX A;  5DB8 A;  2X0L B;  2XQ3 A;  4TX5 A;  4K0U A;  4IDO A;  4O2A E;  1S94 A;  2GK9 A;  2JPF A;  5BOL A;  4DV2 T;  4DR1 T;  1HUZ A;  5HEG A;  5IIM A;  5CHG A;  1KF6 A;  3G06 A;  5LXT E;  3C64 A;  5FY1 A;  2XAJ B;  5F5W A;  4MFA A;  2BPC A;  4X4R A;  2XQ4 A;  2XSA A;  4TZ4 C;  1L0V A;  1CUN A;  3OJA A;  4EEB A;  4U74 A;  3ZN0 B;  4WC2 A;  4QZG A;  4FHW A;  5KMG P;  4KLM A;  3LK4 2;  3LBX A;  3OGU A;  4QZE A;  4CZZ B;  1ZQL A;  4EZH A;  5CP2 A;  2Q66 A;  5LJN A;  2UXX B;  4E7X A;  5AQS B;  2K9A A;  2RFF A;  2V7M A;  3P4P A;  2ISP A;  4DUY T;  9ICT A;  4AXP A;  4NM2 A;  3VRB A;  2XM2 A;  4KLU A;  2NRK A;  1QLB A;  5L3C B;  4JI6 T;  5HHI A;  4RQ4 A;  3JAE A;  2OA5 A;  1BPE A;  5HEU A;  3JYY A;  4EXT A;  2HH7 A;  3HW8 A;  5F2V O;  3TLS A;  2EHO B;  3HWT A;  1UEU A;  1JMS A;  4TWH A; 
#chains in the Genus database with same CATH homology
 2HN1 A;  4EED A;  2BBJ A;  3JCF A;  3CK6 A;  4I0U A;  3RKG A;  4EGW A;  3NVO A;  4EEB A;  4EV6 A;  2IUB A;  2HN2 A;  3NWI A;  2BBH A;  5JTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...