4EEBA

Cora coiled-coil mutant under mg2+ absence
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
324
structure length
314
Chain Sequence
b'DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transport protein CorA
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport
total genus 95
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eebA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eebA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eebA01
3CK6A 3JCFA 4EEBA 2HN2A 3NVOA 4EV6A 3NWIA 2BBHA 2IUBA 4I0UA 4EEDA 2HN1A 4EGWA 3RKGA 2BBJA 5JTGA
chains in the Genus database with same CATH superfamily
5LHHB 1RZTA 2LJLA 4KLTA 4X4TA 3VR9A 2KLQA 1ZQYA 3RJJA 4UVBB 4LEWA 5BOMA 2VASA 2MAWA 3GN5B 1B7TA 3OTOT 4RQ7A 1ZJMA 2YEVC 4RQ8A 1IJ5A 3A7MA 2QYWA 4UD5A 3NWIA 4LMKA 4TX5A 1MMAA 3ZPOA 5J1GA 2KINB 5J0OA 4IHJE 4O2AE 5DKWA 3JPQA 4Z91A 4YXDA 4MFAA 2ES0A 3VHLA 4ATBA 3QB5A 3RRWA 4YSYA 4LZGA 4UXNB 2LKHA 1XWMA 2UXCT 8ICAA 3C2LA 2MTQA 4XA5A 3EUHA 3AEFA 2W0GA 3V7LA 4RT2A 9ICRA 3PE0A 3UU5A 3P7IA 4O5CA 3K7DA 3GWHA 3UU8A 1NWMX 5D46A 3AQMA 5IIOA 3UFGA 4QH4A 5L4HA 4AQFC 4TURA 4EGWA 1VFGA 5JDLA 3ABVA 4MALA 4E7XA 1NO5A 3AA1B 4UIGA 1ZQAA 2KWHA 4KLMA 1ZJNA 4NLKA 3RJFA 4M9HA 4K98A 1VCTA 3UULA 5HRHA 2V6YA 7ICOA 1IBKT 3JCFA 1YW0A 2M6BA 2CLYB 5LP6E 1W09A 4X4SA 3Q5WA 4X5TA 4ZI3C 4XUSA 2Q9QA 4IREA 4BAYB 4DMVA 2BCQA 4QXCB 3KFWX 2JQ9A 3RJIA 1QSDA 5IILA 3C5FA 2QGSA 3LBXA 5DABA 8ICZA 1PX5A 2CXLA 4O4JE 2L8KA 3N9LA 1TFYA 1YLQA 3FXDB 4MLKA 8ICNA 1FIOA 3LSVA 4NXUA 3CMLA 1ZQEA 4UBCA 1ZV4X 4CXYA 5J0WA 4FI5A 4QKNA 4X4UA 2OLTA 5IUXA 2YOEA 4AI6A 4RQ6A 4KLDA 4WBYA 2V8SV 2YINA 3FBZA 5DB7A 4GXJA 4LF5T 5J2HA 4I2HA 5IIKA 5L3CB 3F57A 1GPJA 4GK0E 3AQLA 2YN6A 4M47A 4CI1B 3PDYA 7ICPA 1NEKA 1BPXA 2YK0A 3UUXB 3UQ7A 5CJ5A 2KNDA 5FXXA 3GDXA 3AU2A 1MMDA 1L0VA 5J0ZA 3VRAA 2WU2A 4A56A 4JI3T 3NZQA 4DBRA 2CWOA 2D9DA 5CB4E 2E9XB 5EK3A 4G2AA 3AE7A 5FVLA 3HKEE 3HI2A 3IHRA 7ICRA 4H9NC 9ICQA 3Q5EA 4PHPA 5L3EB 4YTMA 5F2VO 4UB1A 3HX0A 5EZYE 4QZHA 2H7OA 4DR1T 1D1AA 3KV9A 5EOZA 2H89A 3PJAJ 4KLFA 4ZI3D 4IE7A 3TKLB 3FZKB 1R8BA 1W9RA 3CQXC 2JMHA 2VKOA 2XZEA 4P2HA 3LK3B 1J5ET 2XY8B 2WM9A 1US7B 2FBWA 3EABA 2EHOC 3RHWA 4H9SE 2EWRA 3RJGA 1D0YA 5HR9A 4F6RC 1T72A 2ZH5A 3HKBE 8ICRA 4NM1A 5IYZE 1UCUA 2WSSV 4X1IE 4MFFA 3ZC0A 4M9JA 4Q25A 2FUPA 3C4XA 3OBVE 1Y64B 1BPYA 4MKPA 5TZVA 3UU4A 1ZQBA 5LOVE 4KLOA 1WR6A 4UVAB 4KBMB 5JDHA 4CN1A 4X0AA 5L3FB 4Z6FA 1XSPA 4RQ5A 1KNRA 5ABFB 3RH6A 4ZI2C 2BCUA 1ZQJA 3V7KA 5HC9A 4KLQA 5L4EA 1ZQVA 4ISTA 3P4PA 5DECA 2BVMA 3C18A 4H9PC 1T98A 5FXZA 4CI2B 2F4VT 4GXKA 2LT3A 4OAFA 8ICGA 4DR5T 4TWHA 4P0AA 4UEMA 2LLYA 4F5RA 4LT6A 2A3DA 2E8IA 4EP7A 3MKDA 3OVUA 4KLHA 4KHPT 3ZT7A 4WC4A 2DR7A 2RA1A 1X79A 3F2EA 3UU6A 1D1CA 5HYAA 4ZI7E 1FEWA 2W4XA 4ERRA 4CXWA 3FXEB 4HFIA 5D62A 3FZLB 4PHEA 3PUZF 4QX8B 3V7JA 2GK9A 8ICIA 1LVFA 4XZCA 2LRLA 2LHRA 2EHOD 4OYKA 3HKDE 5F5WA 1MNEA 4L5GA 4X1KE 1T8BA 4JBWF 3FZFB 7ICUA 3CQCB 5J2UE 3OKQA 4O5EA 2XAJB 4PGYA 3QB5K 4U31A 3UXNA 2IIUA 2ISPA 3VKHA 4GIWA 5D61A 1V4AA 4EZ4A 4KLEA 1J5WA 4RQ3A 1J1JA 5AQVB 3UPQA 5LYJE 4KX6A 2X66A 2PTFA 1KK7A 3V5SA 2BBHA 2CPTA 5IIIA 8ICLA 5FYMA 2JIWA 5LA6E 2W62A 3RRCA 3LG7A 1KNZA 5LGNB 3ZN0B 4YJ3E 5E0OA 3JPRA 4LF6T 3LDQB 2I0MA 1OEDB 4MHCA 2BKNA 5KX5E 5AQRB 4KLGA 2D0UA 4RWNA 1N33T 1U4QA 3H3MA 5HXCA 3AUOA 4JI7T 5DBBA 4ATBB 2JPFA 5JDFA 3AAIA 3C2MA 4I2GA 1IZNB 4QXHB 2K9AA 3F31A 2BS3A 2L9QA 2UUAT 4NXNT 2FJBA 3P4SA 1JN3A 3NBXX 4FO6A 4K4IA 4AT7A 4K0UA 1FMWA 3ZCIA 4PHDA 3TFRA 3PUYF 2X9XA 3UQ4A 3ZT5A 2H7VC 4DV2T 1FA0A 2VB6A 1KNYA 4I2IA 3ERCC 3OYZA 3CX8B 3K8PC 3K1SA 3I0OA 5JDMA 2X0HA 9ICVA 3LK2B 4YMMA 2ZM2A 2IC9A 3WFPA 2HPLA 4DV4T 4GYSA 2VVNA 2V7KA 3WI3A 1WCRA 2V6YB 4I0UA 3RIAA 5FL1A 2GA9D 2BS2A 8ICKA 3L8RA 4M1PA 4H63V 4HN9A 5AQGB 1MIYA 3PUWF 2DRAA 4JLZA 4PJJA 5JTGA 4LFBT 1BR1A 3K75D 3AEAA 1WYCA 4DIDB 3EAMA 1MMGA 3ESLA 3MDAA 4PHAA 7ICMA 5AFUL 4Z6DA 2X51A 4M0AA 2RPAA 2Q9QB 2VKHA 3JAFA 5FMNA 4IDPA 4X0BA 4J2CA 1XZYA 4R65A 1KDHA 3N9QA 1ZEEA 2XAHB 2XQ4A 3RH3A 3PHZA 4ZOLE 4JI4T 4XRHA 4UB5A 4WBZA 2O5AA 2X0LB 2PFVA 4R64A 7ICQA 2MBGA 5EK4A 2BG9B 2C5IT 2UXDT 2W2UA 2X9YA 4CZZB 4NM2A 1HNXT 5IINA 4FHVA 3JAEA 3NKZA 4WYVA 5J29A 1E1HB 2OA5A 4AT9A 3ER9B 4U7IA 5HRFA 4K0KT 4MF8A 2VVSA 4OFZA 3RH4A 2MOZA 2B51A 3AEEA 1ZQOA 3O1JA 1V9DA 4AISA 5F3JA 4DMWA 3BK9A 2CWYA 4RWQA 1WR0A 4X4PA 9ICJA 3N9PA 4FO1A 8ICMA 5JVDE 3E0ZA 4S3NA 5J0QA 5J0RA 4FH5A 5CJ7A 3P4QA 1ZQUA 4KP3C 3W15B 3LK42 1TFWA 5KMGP 2PFNA 9ICCA 3EHZA 4QZEA 4DNDA 2PG8A 3C51A 4FHXA 4JI0T 3RIFA 5HRIA 2X68A 4WZXA 4TNWA 4X4VA 3MZKB 5BR8T 4DUZT 2NW8A 4RQ2A 5LG4A 3JADA 3IA3A 1M7KA 2E2AA 3EDUA 4B3MT 7ICIA 4F5PA 4XAXB 9ICTA 7ICKA 2IMLA 5JDGA 3PUQA 4UF0B 2D5UA 5C3JA 5LGTB 4NUUA 5CA0E 1HUZA 3AXJB 1GQEA 2RP4A 4YMOA 5J2GA 2C0SA 8ICBA 3JPNA 4M2YA 1M62A 4EEBA 4EB6E 3UXPA 5HCMA 2YU1A 2BE3A 2BZBA 5CGMA 2XM1A 4WBOA 3LK9A 3K3QC 4H9RC 3I9YA 4FH3A 3JPTA 5J0YA 4YD1A 2DRBA 5L2LA 3BQLA 2B4VA 5A1LA 4XJEA 4X4RA 4LEYA 8ICWA 1IAPA 2Z6EA 3RJEA 8ICOA 8ICSA 4NXMT 4NIQA 2BDEA 4IE6A 1KF6A 5DB8A 3HL6A 2CLYC 2V6XA 4IG8A 2C5JA 4P4OA 4JEHB 2I59A 9ICMA 3U78A 4YT0A 4QZBA 2X9WA 3OUYA 3AAAB 2UUBT 2KSRA 2QA7A 4DV3T 5LJMA 4U74A 4F8HA 3C4WA 2V7MA 5HREA 3V72A 2VL0A 4JLEA 3CQGB 1G8XA 2VKDA 4UV9B 3KV4A 9ICOA 4I28A 1N32T 1MIWA 3UQ0A 3CVRA 1F5AA 1HUOA 3PMLA 2LSJA 3B0YA 3UUNA 2YDRA 2BCSA 3N9OA 3TLVA 4A97A 5LBQB 3AVSA 5IHYA 1ZKEA 5HEGA 4CQIA 1JNRA 4UAWA 4YJ2E 2XQ7A 4K96A 2Y6XA 5F8PA 4ZHQE 3E22E 4LF4T 3AE6A 5ABEA 1HR0T 3JPPA 3EI0A 5LB7B 2DL1A 4OX9T 5L3DB 2ZM6T 2KMFA 4AKLA 2CXDA 4AKGA 1BPZA 2ZHAA 4X20E 2K24A 3OPCA 3B5MA 5DBCA 4XBFB 1BPDA 2V5DA 1ZQTA 3ZYKA 4CN4A 5AQJB 4F5NA 3TLWA 2LKGA 2E9XC 4FHYA 2HHPA 9ICFA 2Q66A 2WY2A 3RLFF 3C98B 5JR9B 2LOSA 1YXRA 2V1DB 1ZQFA 4LMLA 7ICNA 4R66A 1R8AA 3UPSA 5FP3A 2LM9A 4HFVA 5LG3A 1XSLA 5FVKA 2V26A 4IE0A 4QZAA 3AA6B 4YTPA 1VJ7A 4YTNA 4U33A 3ONLC 2WDVA 4I50E 3ZMVB 1ZQGA 4JWMA 4TWFA 4YY3T 9ICLA 4PAGA 3RX6A 5FXWA 5ABHA 1XDPA 2NOXA 5BPCA 5J2DA 4JI6T 9ICKA 2IAKA 3FB2A 3G06A 2HH7A 5HRLA 3I1AA 4K4GA 7ICEA 4KLIA 3ANWB 3J7Yq 4I2FA 3PUSA 2FMSA 4JYAT 2JJ9A 2K5BB 1UX4A 1JNZA 3RJHA 2BPCA 8ICCA 9ICBA 3ZJ2A 1JAJA 2CM0A 3P50A 2XAGB 4DR3T 3QC9A 2ZH4A 3OVBA 1HX8A 4TNVA 4LMJA 3MA9A 2FJAA 4HFHA 7ICGA 4ANJA 4U3CA 5AQSB 2Y8DA 4KLSA 1XNRT 5LHGB 1ZOYA 2XSAA 7ICTA 2XUEA 4NPPA 1YQ4A 3RKGA 5HXEA 1WFDA 4NXTA 4ZZBA 1UETA 5HEJA 2AXDS 5CFSA 3RF1A 7ICFA 4QWNB 2IHMA 4X65T 4YHHT 2E9XD 1QLBA 2M2TA 2VKJA 5IIMA 1HNZT 4Z6CA 4KLLA 5M4YA 3CWZB 4IIJE 1R8CA 5J0XA 1ZQRA 4PJNA 3UUBA 4E7ZA 1XNQT 3TLSA 4B3RT 1Y01A 3O1IA 2CEAA 4TWDA 3A5XA 5HWYA 4IQVA 2M2VA 4ZXLA 2V7LA 4DV5T 1BR4A 2HN2A 3NVOA 4TUSA 5DEDA 4L9IA 4KM5A 4XQ7A 4JLXA 4N7RA 3AE3A 2R6GF 3ZLIA 2DNXA 4IDZA 4PGQA 5J2IA 4TV9E 5LXTE 7ICLA 4AT9B 5CB1A 4O67A 2D2SA 2XQAA 1HFAA 5J2TE 5HXRA 4WC7A 4YSXA 8ICPA 1T7SA 2XAFB 4M04A 2A9UA 2VURA 5HXSA 3B13A 5J0UA 4TUYE 3H38A 4EV6A 4AXPA 4NXZA 9ICWA 3ZJ1A 1ZQCA 3PUAA 4NKTA 4IGUA 1N34T 2DLRA 4U2YA 2ACZA 2CXFA 2D0TA 4YLHA 2B76A 3OV7A 3CKDA 1ZQMA 1S94A 4GXIA 4G63A 2DI4A 2FJDA 4HGAA 3PNCA 4DV0T 3CPZA 2XQYA 2HN1A 3PUGA 2N2NA 3AEBA 4HWFA 5L3BB 2NW7A 4AQFA 2BCRA 9ICXA 3ZT6A 5LMUT 3RPUA 7ICVA 5ABGA 1OEDC 3MBYA 3DP7A 2N9DA 3VR8A 3CX6B 5HEHA 5DDMA 5JRCA 4LVSA 2YKSA 4LEZA 5J2KA 4NXVA 3NRYA 1KNPA 4DO0A 1UX5A 1ZP0A 3ZYLA 1HF8A 4P4MA 4GYRA 3J9X1 4KI0F 3OYXA 4KHZF 4NY8A 5CA1E 4I27A 4AKHA 2XSBA 4X66T 2UUCT 1ZQWA 2ZMAA 4YFSA 1LRZA 2ZM0A 4PFPA 2ACXA 5GONE 4WH5A 3K3OA 2P9BA 4GKKT 5FKYA 2CMRA 4UAZA 4MBQA 2IC6A 1SHZC 4RPYA 2CHOA 2LOPA 4AKIA 2LRKA 3FHNA 5BMVE 2BPGA 5JDQA 2GWSA 2NWBA 4QXBB 5AQLB 2FJEA 1FJGT 3ONXA 4DOAA 3NYBA 4KLUA 1UURA 1IBLT 3BQIA 4O8SA 5HRBA 2VWAA 1ZQZA 2E9XA 2XAQB 5L3GB 4AQYT 3RH5A 4P1NA 3TLTA 1VOMA 5H6RB 4H63H 3MGIA 4IDNA 4WNKA 3JPSA 2E5VA 3AVRA 1YKEB 4A5XA 2Q9QC 1N36T 1OWAA 3OUYB 4K97A 4TN7B 3BQKA 4UELA 4QHOA 1CHUA 4BA9A 5FY0A 5HXHA 5CWRA 4DOBA 5J0SA 3JPOA 4RQ1A 5LBMA 3PU3A 4P4PA 2W67A 4UB4A 1ZQQA 4FJOA 3QUJA 3RJKA 2BG9C 2WZIA 5ADXL 7ICSA 1X9BA 4X5VA 4PNIA 3I9WA 3JC6C 5HRDA 4YD2A 5J2FA 4I4TE 2WWUA 2MPKA 1YD8G 5FXVA 2PXIA 4NXWA 3LBXB 2X0YA 3SFDA 2LSYA 4PK6A 2XASB 4EBKA 3ISDA 3P8CD 4O4LE 3KBUA 3PURA 5B3PA 1OEDE 1ZQSA 3VKGA 5AQOB 3RYFE 1QUUA 3T1YT 4ASKA 4UBBA 2LM2A 4I2AA 1WRDA 5HRKA 5CA7A 3ZKRA 2LEHA 2XPKA 2DWGA 3L3PA 3GMIA 3UTKA 2WP9A 3N2OA 1W0BA 2V5CA 2WDQA 5D63A 2EHOA 1EZ3A 3EDVA 4HEAA 1D0XA 5DB9A 1UUSA 4IL4A 4I29A 8ICEA 4OAHA 2NRKA 5D49A 4HWDA 5IWAT 1WLXA 1NAFA 4LF8T 2ODUA 3N9NA 4HWCA 2A72A 2Q9QD 2W63A 2CHNA 1Z0PA 3HKCE 3ZSTA 3SWHA 3ZC1A 4Z6EA 1BPBA 4ILBA 3UT5E 2AE9A 4E7SA 3ER8C 2MYSA 2WQYA 4K9BA 4IQWA 4NKUA 2ZH3A 4O9MA 3ZMUB 2IW5B 3ZSSA 4M9GA 3L9DA 1DU2A 1I6ZA 5B3QA 5HEUA 2JMKA 2ZHBA 3I0QA 2UXXB 1NOMA 1VRBA 3LJCA 3ZEFB 4JI1T 3ETUA 2WMOA 3JC6D 2DR9A 2WB5A 2BG9E 1S35A 2DHRA 4AQGA 3AE9A 2NR4A 3K3NA 5AQUB 3ISCA 4EEDA 3SRZA 4BJNA 3MJXA 2ZH9A 4YMNA 2KWIB 3KV5A 4WQKA 5IIJA 2N1GA 5J0TA 1KEYA 2YU2A 5DBAA 5KDMC 2UXNB 1MIVA 5JH7E 4U72A 4TZ4C 4OHFA 3RYHE 4NXXA 4DR7T 4HFCA 2ZH2A 4F5OA 3M65A 3R6NA 2XQ3A 1ZQNA 2W61A 2M6IA 1OEDA 4MF2A 3QOFA 4X1YE 2V7IA 3VRBA 3NKUA 9ICUA 2KZ7B 1XSNA 4O2BE 4WOYA 4KLJA 4LF7T 4P09A 1HG2A 3C64A 4UV8B 3DJBA 2B1EA 4OAGA 4FHPA 3PUXF 5EK2A 5JREA 2ISOA 3WFSC 5C2TA 3JZ0A 4PFOA 3V5UA 4JI8T 4HFBA 3HWTA 2P66A 2QRXA 2K48A 4AT8A 4M9LA 2CCQA 5DB6A 4RQ0A 3D0TA 5JR9C 4DV6T 5JQGE 4PW8A 3N2GE 2BKOA 4MFRA 4DR4T 5H6QB 4NLZA 1YQ3A 4HTEA 1IBMT 4JI2T 2VQET 3GA8A 4LFCT 4QZDA 4X64T 2RFFA 4LZDA 3C5GA 4O4HE 5HAXA 4LF9T 2PFOA 2IUBA 9ICIA 2XJ7A 3PU8A 5J2JA 5AQFB 4PK4A 4I55E 2VQFT 2VL8A 3FZHB 2Y48B 4OK0A 2IHOA 3HA4A 2ZH1A 3WFRE 3AE4A 4PJLA 4EZHA 4C90A 2WS3A 2OV9A 9ICHA 2KT9A 2WAUA 4BJMA 2ZH6A 4K99A 4OAIZ 8ICFA 4O5KA 2C5KT 3AAEB 3PMNA 1TVAA 4NLNA 5BOLA 3RIUC 4UD4A 2WCAA 2ZH8A 5HHIA 5LJNA 1ZQHA 5JRCB 1UEVA 2BG9A 1MQ3A 1FMVA 2PFPA 1E2AA 4HWHA 4WC3A 3OJAA 1UK5A 3MDCA 1W0AA 4IQTA 4L0RA 3HW8A 2VANA 5CFTA 2LSIA 4K9AA 3Q2MA 3ZN1B 2BBJA 3TFSA 3AE5A 2O1PA 4HKAA 2JQKA 5LCYA 4X4OA 1KFYA 4ADZA 4DBQA 3C66A 5DDYA 2X67A 3U3IA 2W00A 3CIRA 1HX1B 2WU5A 3Q5XA 2CA5A 4ILCA 4EXTA 4E80A 3AEGA 4I2EA 2BCVA 4M5DA 2XTLA 2WMNA 4HX0A 4H9QC 3EVYA 4JUYA 3NRXA 5D4BA 5KXJA 5J0PA 4Z8XA 4O68A 1JQRA 4AT7B 5CHGA 2BPFA 5FL0A 4K8VA 4AIUA 3AECA 3EF2A 1ZQKA 2E5LT 1TV9A 2IHR1 4QZGA 4ZEYA 2H3RA 1G73A 5HRGA 2CBIA 4TUPA 5FY1A 2K3WA 3HIYA 2ODVA 2JQQA 3WFOA 3CK6A 8ICYA 4UF0A 1ZQDA 4B6XA 4B3ST 1XMOT 4GKJT 2ZH7A 3VU7H 3AXJA 5J2EA 3RI5A 2J47A 4DVDA 1R8IA 4Z90A 5CFUA 4O69A 4QZFA 3GN5A 2DWKA 2QVAA 2XQ8A 3HJ1A 3RKOA 2UU9T 3N2KE 4QZCA 4O4IE 2PBEA 2XM2A 8ICHA 1ZQPA 3ZMSB 4PJMA 3SFEA 4QH1A 4OYJA 3RQUA 4PGXA 4I2JA 3UQ2A 2JRKA 1U5PA 4DOCA 4YSZA 3C2KA 3Q9DA 1MQ2A 4IQUA 5AQIB 2BVLA 4WC6A 2JQHA 4EBJA 2J62A 3DTOA 3AQKA 1E7PA 1BR0A 3HR0A 5LNKA 3PV0F 1Q79A 2NTXA 2BKPA 4O6AA 1SE7A 3NZPA 3LQCB 1WYBA 1ZHCA 2EHOB 2XQ6A 5HCJA 4KB6A 4WC1A 3SS1A 2DCFA 2LSKA 4EYUA 4XQ8A 4NUVA 2FMQA 3OVSA 3N5LA 4RPXA 1I94T 2I9GA 1HS7A 1H7CA 2SPCA 1D0ZA 2WWVA 5AQMB 4UB3A 4EAHA 8ICQA 3LFMA 4WC0A 2LHNA 4ISSA 3H3AA 1XMQT 5J2BA 4R63A 2NP9A 2HPJA 2DR8A 4IE5A 4HFEA 3RYCE 4IDOA 2ZLYA 1NENA 3ONJA 1O3XA 2CE7A 3AQNA 4M9NA 5J2AA 5CHEA 1KEJA 1IJ6A 3ZYMA 1HCIA 2NTYA 3IF8B 4YN4A 2B56A 4TUQA 4IT4A 4B3TT 1HG5A 1SUMB 1UEUA 4CI3B 4QH5A 3MACA 1HTJF 4HFDA 3C50A 1XDOA 2X9HA 3PTRB 5JR9A 5DJQC 5LGUB 2J4GA 3T8OA 8ICVA 2J1DG 2PFQA 4K4HA 9ICPA 4N78D 3MGHA 2W9MA 3X1DA 4X4QA 5HHHA 4H9OC 2M2UA 4RWPA 4COFA 5FNVE 3ZMTB 3UU3A 1OU5A 5C8YE 1RPLA 4RWOA 3ISBA 5L47A 4DUYT 2V7JA 4EOZB 4QZ9A 7ICJA 3B57A 4CXXA 5DQWA 4FHWA 2LE8A 3AB3B 3N9MA 3OWGA 4QZIA 3CX7B 3RYIE 4ZI2D 4V1Av 3KBTA 2NW9A 9ICGA 5HWXA 3WFQE 2UXBT 3WAKA 1R89A 4C91A 3UFEA 5AQKB 4JEUB 3ZMZB 8ICTA 4I43B 3RIUA 3AA7B 4UR9A 2WDRA 4AKRB 5CR0A 3B0XA 3ZCJA 2YDSA 3ANWA 4F5QA 1YKHB 3E08A 5AQQB 2PBIA 4UAYA 4KMCA 3OVAA 1LKXA 4RT3A 2XQ9A 3AE1A 4IE4A 4QZ8A 2ID1A 3H37A 4DV1T 1JMSA 2VK9A 2FMPA 3JYYA 2PJQA 2YDQA 4KUMB 3Q5DA 4UB2A 5CP2A 4MFCA 1Q78A 1AJ3A 3RQWA 3R84B 3HJ4A 3T1HT 2HHHT 3MK7C 3AU6A 4AT8B 4RPZA 2XQ5A 5AQTB 3RGLA 1UGOA 4EYYR 2LSGA 1BR2A 4A98A 3KV6A 5LMNT 4I2DA 5CFBA 1ZQXA 4WCWA 5AQHB 2CRBA 3O4XE 3IEEA 1MNDA 3AEDA 3UUMA 3QK6A 5AQPB 2H88A 2KXPB 5AQNB 3SOLA 3AA0B 2FCLA 2BS4A 3KVBA 3P4RA 3C4ZA 3KDSE 4DR6T 4IL9A 1ZQLA 3P4WA 2W66A 4DV7T 4WC2A 3PJAA 4HWIB 1SA0E 4LFAT 2M2WA 1Z8UA 4IDQA 4ILUA 5ABFA 9ICEA 4ZS3A 3KVAA 4PPXA 4X4NA 1D1BA 4EIWA 4JV5T 4E8FA 8ICJA 3UXOA 4I2BA 2G0UA 4GK5E 2GAFD 3O1HA 4WW0A 5FY7A 2A2FX 3AE2A 4U2ZA 4PH5A 8ICXA 3A8YC 9ICAA 4ILAA 4GOUA 4CN6A 3RC3A 3WAJA 2CBJA 2XHEB 4JWNA 4X62T 3MCRA 1WOTA 2IDOB 3PUVF 3AE8A 4DO9A 1VCSA 5LHIB 1HNWT 9ICSA 4ZS2A 2DVIA 4U7YA 1MMNA 3O9XA 3L39A 2DR5A 1ZQIA 5DQVA 2WZHA 3IBPA 1CUNA 3M3ZB 5HEOA 1OXZA 5TAOA 3QNUA 8ICUA 4I2CA 4YCXA 3FBLA 3ETVA 4ZZCA 3OGUA 4WQLA 5JDNA 4LEVA 4P0BA 9ICNA 4DR2T 2I6HA 3KINB 4RQ4A 4JI5T 3S4UA 4UVCB 4HE8A 4WC5A 4PK5A 2M67A 7ICHA 5J2CA 3L09A 1LVKA 2L3LA 3H39A 4TV8E 2ZM8A 5ETWA 3FZMB 1BPEA 2WBLA 4QX7B 4WBNE 3RC8A 3MXZA 3TLUA 4YHJA
chains in the Genus database with same CATH topology
3CK6A 3JCFA 4EEBA 2HN2A 3NVOA 4EV6A 3NWIA 2BBHA 2IUBA 4I0UA 4EEDA 2HN1A 4EGWA 3RKGA 2BBJA 5JTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK6 A;  3JCF A;  4EEB A;  2HN2 A;  3NVO A;  4EV6 A;  3NWI A;  2BBH A;  2IUB A;  4I0U A;  4EED A;  2HN1 A;  4EGW A;  3RKG A;  2BBJ A;  5JTG A; 
#chains in the Genus database with same CATH topology
 5LHH B;  1RZT A;  2LJL A;  4KLT A;  4X4T A;  3VR9 A;  2KLQ A;  1ZQY A;  3RJJ A;  4UVB B;  4LEW A;  5BOM A;  2VAS A;  2MAW A;  3GN5 B;  1B7T A;  3OTO T;  4RQ7 A;  1ZJM A;  2YEV C;  4RQ8 A;  1IJ5 A;  3A7M A;  2QYW A;  4UD5 A;  3NWI A;  4LMK A;  4TX5 A;  1MMA A;  3ZPO A;  5J1G A;  2KIN B;  5J0O A;  4IHJ E;  4O2A E;  5DKW A;  3JPQ A;  4Z91 A;  4YXD A;  4MFA A;  2ES0 A;  3VHL A;  4ATB A;  3QB5 A;  3RRW A;  4YSY A;  4LZG A;  4UXN B;  2LKH A;  1XWM A;  2UXC T;  8ICA A;  3C2L A;  2MTQ A;  4XA5 A;  3EUH A;  3AEF A;  2W0G A;  3V7L A;  4RT2 A;  9ICR A;  3PE0 A;  3UU5 A;  3P7I A;  4O5C A;  3K7D A;  3GWH A;  3UU8 A;  1NWM X;  5D46 A;  3AQM A;  5IIO A;  3UFG A;  4QH4 A;  5L4H A;  4AQF C;  4TUR A;  4EGW A;  1VFG A;  5JDL A;  3ABV A;  4MAL A;  4E7X A;  1NO5 A;  3AA1 B;  4UIG A;  1ZQA A;  2KWH A;  4KLM A;  1ZJN A;  4NLK A;  3RJF A;  4M9H A;  4K98 A;  1VCT A;  3UUL A;  5HRH A;  2V6Y A;  7ICO A;  1IBK T;  3JCF A;  1YW0 A;  2M6B A;  2CLY B;  5LP6 E;  1W09 A;  4X4S A;  3Q5W A;  4X5T A;  4ZI3 C;  4XUS A;  2Q9Q A;  4IRE A;  4BAY B;  4DMV A;  2BCQ A;  4QXC B;  3KFW X;  2JQ9 A;  3RJI A;  1QSD A;  5IIL A;  3C5F A;  2QGS A;  3LBX A;  5DAB A;  8ICZ A;  1PX5 A;  2CXL A;  4O4J E;  2L8K A;  3N9L A;  1TFY A;  1YLQ A;  3FXD B;  4MLK A;  8ICN A;  1FIO A;  3LSV A;  4NXU A;  3CML A;  1ZQE A;  4UBC A;  1ZV4 X;  4CXY A;  5J0W A;  4FI5 A;  4QKN A;  4X4U A;  2OLT A;  5IUX A;  2YOE A;  4AI6 A;  4RQ6 A;  4KLD A;  4WBY A;  2V8S V;  2YIN A;  3FBZ A;  5DB7 A;  4GXJ A;  4LF5 T;  5J2H A;  4I2H A;  5IIK A;  5L3C B;  3F57 A;  1GPJ A;  4GK0 E;  3AQL A;  2YN6 A;  4M47 A;  4CI1 B;  3PDY A;  7ICP A;  1NEK A;  1BPX A;  2YK0 A;  3UUX B;  3UQ7 A;  5CJ5 A;  2KND A;  5FXX A;  3GDX A;  3AU2 A;  1MMD A;  1L0V A;  5J0Z A;  3VRA A;  2WU2 A;  4A56 A;  4JI3 T;  3NZQ A;  4DBR A;  2CWO A;  2D9D A;  5CB4 E;  2E9X B;  5EK3 A;  4G2A A;  3AE7 A;  5FVL A;  3HKE E;  3HI2 A;  3IHR A;  7ICR A;  4H9N C;  9ICQ A;  3Q5E A;  4PHP A;  5L3E B;  4YTM A;  5F2V O;  4UB1 A;  3HX0 A;  5EZY E;  4QZH A;  2H7O A;  4DR1 T;  1D1A A;  3KV9 A;  5EOZ A;  2H89 A;  3PJA J;  4KLF A;  4ZI3 D;  4IE7 A;  3TKL B;  3FZK B;  1R8B A;  1W9R A;  3CQX C;  2JMH A;  2VKO A;  2XZE A;  4P2H A;  3LK3 B;  1J5E T;  2XY8 B;  2WM9 A;  1US7 B;  2FBW A;  3EAB A;  2EHO C;  3RHW A;  4H9S E;  2EWR A;  3RJG A;  1D0Y A;  5HR9 A;  4F6R C;  1T72 A;  2ZH5 A;  3HKB E;  8ICR A;  4NM1 A;  5IYZ E;  1UCU A;  2WSS V;  4X1I E;  4MFF A;  3ZC0 A;  4M9J A;  4Q25 A;  2FUP A;  3C4X A;  3OBV E;  1Y64 B;  1BPY A;  4MKP A;  5TZV A;  3UU4 A;  1ZQB A;  5LOV E;  4KLO A;  1WR6 A;  4UVA B;  4KBM B;  5JDH A;  4CN1 A;  4X0A A;  5L3F B;  4Z6F A;  1XSP A;  4RQ5 A;  1KNR A;  5ABF B;  3RH6 A;  4ZI2 C;  2BCU A;  1ZQJ A;  3V7K A;  5HC9 A;  4KLQ A;  5L4E A;  1ZQV A;  4IST A;  3P4P A;  5DEC A;  2BVM A;  3C18 A;  4H9P C;  1T98 A;  5FXZ A;  4CI2 B;  2F4V T;  4GXK A;  2LT3 A;  4OAF A;  8ICG A;  4DR5 T;  4TWH A;  4P0A A;  4UEM A;  2LLY A;  4F5R A;  4LT6 A;  2A3D A;  2E8I A;  4EP7 A;  3MKD A;  3OVU A;  4KLH A;  4KHP T;  3ZT7 A;  4WC4 A;  2DR7 A;  2RA1 A;  1X79 A;  3F2E A;  3UU6 A;  1D1C A;  5HYA A;  4ZI7 E;  1FEW A;  2W4X A;  4ERR A;  4CXW A;  3FXE B;  4HFI A;  5D62 A;  3FZL B;  4PHE A;  3PUZ F;  4QX8 B;  3V7J A;  2GK9 A;  8ICI A;  1LVF A;  4XZC A;  2LRL A;  2LHR A;  2EHO D;  4OYK A;  3HKD E;  5F5W A;  1MNE A;  4L5G A;  4X1K E;  1T8B A;  4JBW F;  3FZF B;  7ICU A;  3CQC B;  5J2U E;  3OKQ A;  4O5E A;  2XAJ B;  4PGY A;  3QB5 K;  4U31 A;  3UXN A;  2IIU A;  2ISP A;  3VKH A;  4GIW A;  5D61 A;  1V4A A;  4EZ4 A;  4KLE A;  1J5W A;  4RQ3 A;  1J1J A;  5AQV B;  3UPQ A;  5LYJ E;  4KX6 A;  2X66 A;  2PTF A;  1KK7 A;  3V5S A;  2BBH A;  2CPT A;  5III A;  8ICL A;  5FYM A;  2JIW A;  5LA6 E;  2W62 A;  3RRC A;  3LG7 A;  1KNZ A;  5LGN B;  3ZN0 B;  4YJ3 E;  5E0O A;  3JPR A;  4LF6 T;  3LDQ B;  2I0M A;  1OED B;  4MHC A;  2BKN A;  5KX5 E;  5AQR B;  4KLG A;  2D0U A;  4RWN A;  1N33 T;  1U4Q A;  3H3M A;  5HXC A;  3AUO A;  4JI7 T;  5DBB A;  4ATB B;  2JPF A;  5JDF A;  3AAI A;  3C2M A;  4I2G A;  1IZN B;  4QXH B;  2K9A A;  3F31 A;  2BS3 A;  2L9Q A;  2UUA T;  4NXN T;  2FJB A;  3P4S A;  1JN3 A;  3NBX X;  4FO6 A;  4K4I A;  4AT7 A;  4K0U A;  1FMW A;  3ZCI A;  4PHD A;  3TFR A;  3PUY F;  2X9X A;  3UQ4 A;  3ZT5 A;  2H7V C;  4DV2 T;  1FA0 A;  2VB6 A;  1KNY A;  4I2I A;  3ERC C;  3OYZ A;  3CX8 B;  3K8P C;  3K1S A;  3I0O A;  5JDM A;  2X0H A;  9ICV A;  3LK2 B;  4YMM A;  2ZM2 A;  2IC9 A;  3WFP A;  2HPL A;  4DV4 T;  4GYS A;  2VVN A;  2V7K A;  3WI3 A;  1WCR A;  2V6Y B;  4I0U A;  3RIA A;  5FL1 A;  2GA9 D;  2BS2 A;  8ICK A;  3L8R A;  4M1P A;  4H63 V;  4HN9 A;  5AQG B;  1MIY A;  3PUW F;  2DRA A;  4JLZ A;  4PJJ A;  5JTG A;  4LFB T;  1BR1 A;  3K75 D;  3AEA A;  1WYC A;  4DID B;  3EAM A;  1MMG A;  3ESL A;  3MDA A;  4PHA A;  7ICM A;  5AFU L;  4Z6D A;  2X51 A;  4M0A A;  2RPA A;  2Q9Q B;  2VKH A;  3JAF A;  5FMN A;  4IDP A;  4X0B A;  4J2C A;  1XZY A;  4R65 A;  1KDH A;  3N9Q A;  1ZEE A;  2XAH B;  2XQ4 A;  3RH3 A;  3PHZ A;  4ZOL E;  4JI4 T;  4XRH A;  4UB5 A;  4WBZ A;  2O5A A;  2X0L B;  2PFV A;  4R64 A;  7ICQ A;  2MBG A;  5EK4 A;  2BG9 B;  2C5I T;  2UXD T;  2W2U A;  2X9Y A;  4CZZ B;  4NM2 A;  1HNX T;  5IIN A;  4FHV A;  3JAE A;  3NKZ A;  4WYV A;  5J29 A;  1E1H B;  2OA5 A;  4AT9 A;  3ER9 B;  4U7I A;  5HRF A;  4K0K T;  4MF8 A;  2VVS A;  4OFZ A;  3RH4 A;  2MOZ A;  2B51 A;  3AEE A;  1ZQO A;  3O1J A;  1V9D A;  4AIS A;  5F3J A;  4DMW A;  3BK9 A;  2CWY A;  4RWQ A;  1WR0 A;  4X4P A;  9ICJ A;  3N9P A;  4FO1 A;  8ICM A;  5JVD E;  3E0Z A;  4S3N A;  5J0Q A;  5J0R A;  4FH5 A;  5CJ7 A;  3P4Q A;  1ZQU A;  4KP3 C;  3W15 B;  3LK4 2;  1TFW A;  5KMG P;  2PFN A;  9ICC A;  3EHZ A;  4QZE A;  4DND A;  2PG8 A;  3C51 A;  4FHX A;  4JI0 T;  3RIF A;  5HRI A;  2X68 A;  4WZX A;  4TNW A;  4X4V A;  3MZK B;  5BR8 T;  4DUZ T;  2NW8 A;  4RQ2 A;  5LG4 A;  3JAD A;  3IA3 A;  1M7K A;  2E2A A;  3EDU A;  4B3M T;  7ICI A;  4F5P A;  4XAX B;  9ICT A;  7ICK A;  2IML A;  5JDG A;  3PUQ A;  4UF0 B;  2D5U A;  5C3J A;  5LGT B;  4NUU A;  5CA0 E;  1HUZ A;  3AXJ B;  1GQE A;  2RP4 A;  4YMO A;  5J2G A;  2C0S A;  8ICB A;  3JPN A;  4M2Y A;  1M62 A;  4EEB A;  4EB6 E;  3UXP A;  5HCM A;  2YU1 A;  2BE3 A;  2BZB A;  5CGM A;  2XM1 A;  4WBO A;  3LK9 A;  3K3Q C;  4H9R C;  3I9Y A;  4FH3 A;  3JPT A;  5J0Y A;  4YD1 A;  2DRB A;  5L2L A;  3BQL A;  2B4V A;  5A1L A;  4XJE A;  4X4R A;  4LEY A;  8ICW A;  1IAP A;  2Z6E A;  3RJE A;  8ICO A;  8ICS A;  4NXM T;  4NIQ A;  2BDE A;  4IE6 A;  1KF6 A;  5DB8 A;  3HL6 A;  2CLY C;  2V6X A;  4IG8 A;  2C5J A;  4P4O A;  4JEH B;  2I59 A;  9ICM A;  3U78 A;  4YT0 A;  4QZB A;  2X9W A;  3OUY A;  3AAA B;  2UUB T;  2KSR A;  2QA7 A;  4DV3 T;  5LJM A;  4U74 A;  4F8H A;  3C4W A;  2V7M A;  5HRE A;  3V72 A;  2VL0 A;  4JLE A;  3CQG B;  1G8X A;  2VKD A;  4UV9 B;  3KV4 A;  9ICO A;  4I28 A;  1N32 T;  1MIW A;  3UQ0 A;  3CVR A;  1F5A A;  1HUO A;  3PML A;  2LSJ A;  3B0Y A;  3UUN A;  2YDR A;  2BCS A;  3N9O A;  3TLV A;  4A97 A;  5LBQ B;  3AVS A;  5IHY A;  1ZKE A;  5HEG A;  4CQI A;  1JNR A;  4UAW A;  4YJ2 E;  2XQ7 A;  4K96 A;  2Y6X A;  5F8P A;  4ZHQ E;  3E22 E;  4LF4 T;  3AE6 A;  5ABE A;  1HR0 T;  3JPP A;  3EI0 A;  5LB7 B;  2DL1 A;  4OX9 T;  5L3D B;  2ZM6 T;  2KMF A;  4AKL A;  2CXD A;  4AKG A;  1BPZ A;  2ZHA A;  4X20 E;  2K24 A;  3OPC A;  3B5M A;  5DBC A;  4XBF B;  1BPD A;  2V5D A;  1ZQT A;  3ZYK A;  4CN4 A;  5AQJ B;  4F5N A;  3TLW A;  2LKG A;  2E9X C;  4FHY A;  2HHP A;  9ICF A;  2Q66 A;  2WY2 A;  3RLF F;  3C98 B;  5JR9 B;  2LOS A;  1YXR A;  2V1D B;  1ZQF A;  4LML A;  7ICN A;  4R66 A;  1R8A A;  3UPS A;  5FP3 A;  2LM9 A;  4HFV A;  5LG3 A;  1XSL A;  5FVK A;  2V26 A;  4IE0 A;  4QZA A;  3AA6 B;  4YTP A;  1VJ7 A;  4YTN A;  4U33 A;  3ONL C;  2WDV A;  4I50 E;  3ZMV B;  1ZQG A;  4JWM A;  4TWF A;  4YY3 T;  9ICL A;  4PAG A;  3RX6 A;  5FXW A;  5ABH A;  1XDP A;  2NOX A;  5BPC A;  5J2D A;  4JI6 T;  9ICK A;  2IAK A;  3FB2 A;  3G06 A;  2HH7 A;  5HRL A;  3I1A A;  4K4G A;  7ICE A;  4KLI A;  3ANW B;  3J7Y q;  4I2F A;  3PUS A;  2FMS A;  4JYA T;  2JJ9 A;  2K5B B;  1UX4 A;  1JNZ A;  3RJH A;  2BPC A;  8ICC A;  9ICB A;  3ZJ2 A;  1JAJ A;  2CM0 A;  3P50 A;  2XAG B;  4DR3 T;  3QC9 A;  2ZH4 A;  3OVB A;  1HX8 A;  4TNV A;  4LMJ A;  3MA9 A;  2FJA A;  4HFH A;  7ICG A;  4ANJ A;  4U3C A;  5AQS B;  2Y8D A;  4KLS A;  1XNR T;  5LHG B;  1ZOY A;  2XSA A;  7ICT A;  2XUE A;  4NPP A;  1YQ4 A;  3RKG A;  5HXE A;  1WFD A;  4NXT A;  4ZZB A;  1UET A;  5HEJ A;  2AXD S;  5CFS A;  3RF1 A;  7ICF A;  4QWN B;  2IHM A;  4X65 T;  4YHH T;  2E9X D;  1QLB A;  2M2T A;  2VKJ A;  5IIM A;  1HNZ T;  4Z6C A;  4KLL A;  5M4Y A;  3CWZ B;  4IIJ E;  1R8C A;  5J0X A;  1ZQR A;  4PJN A;  3UUB A;  4E7Z A;  1XNQ T;  3TLS A;  4B3R T;  1Y01 A;  3O1I A;  2CEA A;  4TWD A;  3A5X A;  5HWY A;  4IQV A;  2M2V A;  4ZXL A;  2V7L A;  4DV5 T;  1BR4 A;  2HN2 A;  3NVO A;  4TUS A;  5DED A;  4L9I A;  4KM5 A;  4XQ7 A;  4JLX A;  4N7R A;  3AE3 A;  2R6G F;  3ZLI A;  2DNX A;  4IDZ A;  4PGQ A;  5J2I A;  4TV9 E;  5LXT E;  7ICL A;  4AT9 B;  5CB1 A;  4O67 A;  2D2S A;  2XQA A;  1HFA A;  5J2T E;  5HXR A;  4WC7 A;  4YSX A;  8ICP A;  1T7S A;  2XAF B;  4M04 A;  2A9U A;  2VUR A;  5HXS A;  3B13 A;  5J0U A;  4TUY E;  3H38 A;  4EV6 A;  4AXP A;  4NXZ A;  9ICW A;  3ZJ1 A;  1ZQC A;  3PUA A;  4NKT A;  4IGU A;  1N34 T;  2DLR A;  4U2Y A;  2ACZ A;  2CXF A;  2D0T A;  4YLH A;  2B76 A;  3OV7 A;  3CKD A;  1ZQM A;  1S94 A;  4GXI A;  4G63 A;  2DI4 A;  2FJD A;  4HGA A;  3PNC A;  4DV0 T;  3CPZ A;  2XQY A;  2HN1 A;  3PUG A;  2N2N A;  3AEB A;  4HWF A;  5L3B B;  2NW7 A;  4AQF A;  2BCR A;  9ICX A;  3ZT6 A;  5LMU T;  3RPU A;  7ICV A;  5ABG A;  1OED C;  3MBY A;  3DP7 A;  2N9D A;  3VR8 A;  3CX6 B;  5HEH A;  5DDM A;  5JRC A;  4LVS A;  2YKS A;  4LEZ A;  5J2K A;  4NXV A;  3NRY A;  1KNP A;  4DO0 A;  1UX5 A;  1ZP0 A;  3ZYL A;  1HF8 A;  4P4M A;  4GYR A;  3J9X 1;  4KI0 F;  3OYX A;  4KHZ F;  4NY8 A;  5CA1 E;  4I27 A;  4AKH A;  2XSB A;  4X66 T;  2UUC T;  1ZQW A;  2ZMA A;  4YFS A;  1LRZ A;  2ZM0 A;  4PFP A;  2ACX A;  5GON E;  4WH5 A;  3K3O A;  2P9B A;  4GKK T;  5FKY A;  2CMR A;  4UAZ A;  4MBQ A;  2IC6 A;  1SHZ C;  4RPY A;  2CHO A;  2LOP A;  4AKI A;  2LRK A;  3FHN A;  5BMV E;  2BPG A;  5JDQ A;  2GWS A;  2NWB A;  4QXB B;  5AQL B;  2FJE A;  1FJG T;  3ONX A;  4DOA A;  3NYB A;  4KLU A;  1UUR A;  1IBL T;  3BQI A;  4O8S A;  5HRB A;  2VWA A;  1ZQZ A;  2E9X A;  2XAQ B;  5L3G B;  4AQY T;  3RH5 A;  4P1N A;  3TLT A;  1VOM A;  5H6R B;  4H63 H;  3MGI A;  4IDN A;  4WNK A;  3JPS A;  2E5V A;  3AVR A;  1YKE B;  4A5X A;  2Q9Q C;  1N36 T;  1OWA A;  3OUY B;  4K97 A;  4TN7 B;  3BQK A;  4UEL A;  4QHO A;  1CHU A;  4BA9 A;  5FY0 A;  5HXH A;  5CWR A;  4DOB A;  5J0S A;  3JPO A;  4RQ1 A;  5LBM A;  3PU3 A;  4P4P A;  2W67 A;  4UB4 A;  1ZQQ A;  4FJO A;  3QUJ A;  3RJK A;  2BG9 C;  2WZI A;  5ADX L;  7ICS A;  1X9B A;  4X5V A;  4PNI A;  3I9W A;  3JC6 C;  5HRD A;  4YD2 A;  5J2F A;  4I4T E;  2WWU A;  2MPK A;  1YD8 G;  5FXV A;  2PXI A;  4NXW A;  3LBX B;  2X0Y A;  3SFD A;  2LSY A;  4PK6 A;  2XAS B;  4EBK A;  3ISD A;  3P8C D;  4O4L E;  3KBU A;  3PUR A;  5B3P A;  1OED E;  1ZQS A;  3VKG A;  5AQO B;  3RYF E;  1QUU A;  3T1Y T;  4ASK A;  4UBB A;  2LM2 A;  4I2A A;  1WRD A;  5HRK A;  5CA7 A;  3ZKR A;  2LEH A;  2XPK A;  2DWG A;  3L3P A;  3GMI A;  3UTK A;  2WP9 A;  3N2O A;  1W0B A;  2V5C A;  2WDQ A;  5D63 A;  2EHO A;  1EZ3 A;  3EDV A;  4HEA A;  1D0X A;  5DB9 A;  1UUS A;  4IL4 A;  4I29 A;  8ICE A;  4OAH A;  2NRK A;  5D49 A;  4HWD A;  5IWA T;  1WLX A;  1NAF A;  4LF8 T;  2ODU A;  3N9N A;  4HWC A;  2A72 A;  2Q9Q D;  2W63 A;  2CHN A;  1Z0P A;  3HKC E;  3ZST A;  3SWH A;  3ZC1 A;  4Z6E A;  1BPB A;  4ILB A;  3UT5 E;  2AE9 A;  4E7S A;  3ER8 C;  2MYS A;  2WQY A;  4K9B A;  4IQW A;  4NKU A;  2ZH3 A;  4O9M A;  3ZMU B;  2IW5 B;  3ZSS A;  4M9G A;  3L9D A;  1DU2 A;  1I6Z A;  5B3Q A;  5HEU A;  2JMK A;  2ZHB A;  3I0Q A;  2UXX B;  1NOM A;  1VRB A;  3LJC A;  3ZEF B;  4JI1 T;  3ETU A;  2WMO A;  3JC6 D;  2DR9 A;  2WB5 A;  2BG9 E;  1S35 A;  2DHR A;  4AQG A;  3AE9 A;  2NR4 A;  3K3N A;  5AQU B;  3ISC A;  4EED A;  3SRZ A;  4BJN A;  3MJX A;  2ZH9 A;  4YMN A;  2KWI B;  3KV5 A;  4WQK A;  5IIJ A;  2N1G A;  5J0T A;  1KEY A;  2YU2 A;  5DBA A;  5KDM C;  2UXN B;  1MIV A;  5JH7 E;  4U72 A;  4TZ4 C;  4OHF A;  3RYH E;  4NXX A;  4DR7 T;  4HFC A;  2ZH2 A;  4F5O A;  3M65 A;  3R6N A;  2XQ3 A;  1ZQN A;  2W61 A;  2M6I A;  1OED A;  4MF2 A;  3QOF A;  4X1Y E;  2V7I A;  3VRB A;  3NKU A;  9ICU A;  2KZ7 B;  1XSN A;  4O2B E;  4WOY A;  4KLJ A;  4LF7 T;  4P09 A;  1HG2 A;  3C64 A;  4UV8 B;  3DJB A;  2B1E A;  4OAG A;  4FHP A;  3PUX F;  5EK2 A;  5JRE A;  2ISO A;  3WFS C;  5C2T A;  3JZ0 A;  4PFO A;  3V5U A;  4JI8 T;  4HFB A;  3HWT A;  2P66 A;  2QRX A;  2K48 A;  4AT8 A;  4M9L A;  2CCQ A;  5DB6 A;  4RQ0 A;  3D0T A;  5JR9 C;  4DV6 T;  5JQG E;  4PW8 A;  3N2G E;  2BKO A;  4MFR A;  4DR4 T;  5H6Q B;  4NLZ A;  1YQ3 A;  4HTE A;  1IBM T;  4JI2 T;  2VQE T;  3GA8 A;  4LFC T;  4QZD A;  4X64 T;  2RFF A;  4LZD A;  3C5G A;  4O4H E;  5HAX A;  4LF9 T;  2PFO A;  2IUB A;  9ICI A;  2XJ7 A;  3PU8 A;  5J2J A;  5AQF B;  4PK4 A;  4I55 E;  2VQF T;  2VL8 A;  3FZH B;  2Y48 B;  4OK0 A;  2IHO A;  3HA4 A;  2ZH1 A;  3WFR E;  3AE4 A;  4PJL A;  4EZH A;  4C90 A;  2WS3 A;  2OV9 A;  9ICH A;  2KT9 A;  2WAU A;  4BJM A;  2ZH6 A;  4K99 A;  4OAI Z;  8ICF A;  4O5K A;  2C5K T;  3AAE B;  3PMN A;  1TVA A;  4NLN A;  5BOL A;  3RIU C;  4UD4 A;  2WCA A;  2ZH8 A;  5HHI A;  5LJN A;  1ZQH A;  5JRC B;  1UEV A;  2BG9 A;  1MQ3 A;  1FMV A;  2PFP A;  1E2A A;  4HWH A;  4WC3 A;  3OJA A;  1UK5 A;  3MDC A;  1W0A A;  4IQT A;  4L0R A;  3HW8 A;  2VAN A;  5CFT A;  2LSI A;  4K9A A;  3Q2M A;  3ZN1 B;  2BBJ A;  3TFS A;  3AE5 A;  2O1P A;  4HKA A;  2JQK A;  5LCY A;  4X4O A;  1KFY A;  4ADZ A;  4DBQ A;  3C66 A;  5DDY A;  2X67 A;  3U3I A;  2W00 A;  3CIR A;  1HX1 B;  2WU5 A;  3Q5X A;  2CA5 A;  4ILC A;  4EXT A;  4E80 A;  3AEG A;  4I2E A;  2BCV A;  4M5D A;  2XTL A;  2WMN A;  4HX0 A;  4H9Q C;  3EVY A;  4JUY A;  3NRX A;  5D4B A;  5KXJ A;  5J0P A;  4Z8X A;  4O68 A;  1JQR A;  4AT7 B;  5CHG A;  2BPF A;  5FL0 A;  4K8V A;  4AIU A;  3AEC A;  3EF2 A;  1ZQK A;  2E5L T;  1TV9 A;  2IHR 1;  4QZG A;  4ZEY A;  2H3R A;  1G73 A;  5HRG A;  2CBI A;  4TUP A;  5FY1 A;  2K3W A;  3HIY A;  2ODV A;  2JQQ A;  3WFO A;  3CK6 A;  8ICY A;  4UF0 A;  1ZQD A;  4B6X A;  4B3S T;  1XMO T;  4GKJ T;  2ZH7 A;  3VU7 H;  3AXJ A;  5J2E A;  3RI5 A;  2J47 A;  4DVD A;  1R8I A;  4Z90 A;  5CFU A;  4O69 A;  4QZF A;  3GN5 A;  2DWK A;  2QVA A;  2XQ8 A;  3HJ1 A;  3RKO A;  2UU9 T;  3N2K E;  4QZC A;  4O4I E;  2PBE A;  2XM2 A;  8ICH A;  1ZQP A;  3ZMS B;  4PJM A;  3SFE A;  4QH1 A;  4OYJ A;  3RQU A;  4PGX A;  4I2J A;  3UQ2 A;  2JRK A;  1U5P A;  4DOC A;  4YSZ A;  3C2K A;  3Q9D A;  1MQ2 A;  4IQU A;  5AQI B;  2BVL A;  4WC6 A;  2JQH A;  4EBJ A;  2J62 A;  3DTO A;  3AQK A;  1E7P A;  1BR0 A;  3HR0 A;  5LNK A;  3PV0 F;  1Q79 A;  2NTX A;  2BKP A;  4O6A A;  1SE7 A;  3NZP A;  3LQC B;  1WYB A;  1ZHC A;  2EHO B;  2XQ6 A;  5HCJ A;  4KB6 A;  4WC1 A;  3SS1 A;  2DCF A;  2LSK A;  4EYU A;  4XQ8 A;  4NUV A;  2FMQ A;  3OVS A;  3N5L A;  4RPX A;  1I94 T;  2I9G A;  1HS7 A;  1H7C A;  2SPC A;  1D0Z A;  2WWV A;  5AQM B;  4UB3 A;  4EAH A;  8ICQ A;  3LFM A;  4WC0 A;  2LHN A;  4ISS A;  3H3A A;  1XMQ T;  5J2B A;  4R63 A;  2NP9 A;  2HPJ A;  2DR8 A;  4IE5 A;  4HFE A;  3RYC E;  4IDO A;  2ZLY A;  1NEN A;  3ONJ A;  1O3X A;  2CE7 A;  3AQN A;  4M9N A;  5J2A A;  5CHE A;  1KEJ A;  1IJ6 A;  3ZYM A;  1HCI A;  2NTY A;  3IF8 B;  4YN4 A;  2B56 A;  4TUQ A;  4IT4 A;  4B3T T;  1HG5 A;  1SUM B;  1UEU A;  4CI3 B;  4QH5 A;  3MAC A;  1HTJ F;  4HFD A;  3C50 A;  1XDO A;  2X9H A;  3PTR B;  5JR9 A;  5DJQ C;  5LGU B;  2J4G A;  3T8O A;  8ICV A;  2J1D G;  2PFQ A;  4K4H A;  9ICP A;  4N78 D;  3MGH A;  2W9M A;  3X1D A;  4X4Q A;  5HHH A;  4H9O C;  2M2U A;  4RWP A;  4COF A;  5FNV E;  3ZMT B;  3UU3 A;  1OU5 A;  5C8Y E;  1RPL A;  4RWO A;  3ISB A;  5L47 A;  4DUY T;  2V7J A;  4EOZ B;  4QZ9 A;  7ICJ A;  3B57 A;  4CXX A;  5DQW A;  4FHW A;  2LE8 A;  3AB3 B;  3N9M A;  3OWG A;  4QZI A;  3CX7 B;  3RYI E;  4ZI2 D;  4V1A v;  3KBT A;  2NW9 A;  9ICG A;  5HWX A;  3WFQ E;  2UXB T;  3WAK A;  1R89 A;  4C91 A;  3UFE A;  5AQK B;  4JEU B;  3ZMZ B;  8ICT A;  4I43 B;  3RIU A;  3AA7 B;  4UR9 A;  2WDR A;  4AKR B;  5CR0 A;  3B0X A;  3ZCJ A;  2YDS A;  3ANW A;  4F5Q A;  1YKH B;  3E08 A;  5AQQ B;  2PBI A;  4UAY A;  4KMC A;  3OVA A;  1LKX A;  4RT3 A;  2XQ9 A;  3AE1 A;  4IE4 A;  4QZ8 A;  2ID1 A;  3H37 A;  4DV1 T;  1JMS A;  2VK9 A;  2FMP A;  3JYY A;  2PJQ A;  2YDQ A;  4KUM B;  3Q5D A;  4UB2 A;  5CP2 A;  4MFC A;  1Q78 A;  1AJ3 A;  3RQW A;  3R84 B;  3HJ4 A;  3T1H T;  2HHH T;  3MK7 C;  3AU6 A;  4AT8 B;  4RPZ A;  2XQ5 A;  5AQT B;  3RGL A;  1UGO A;  4EYY R;  2LSG A;  1BR2 A;  4A98 A;  3KV6 A;  5LMN T;  4I2D A;  5CFB A;  1ZQX A;  4WCW A;  5AQH B;  2CRB A;  3O4X E;  3IEE A;  1MND A;  3AED A;  3UUM A;  3QK6 A;  5AQP B;  2H88 A;  2KXP B;  5AQN B;  3SOL A;  3AA0 B;  2FCL A;  2BS4 A;  3KVB A;  3P4R A;  3C4Z A;  3KDS E;  4DR6 T;  4IL9 A;  1ZQL A;  3P4W A;  2W66 A;  4DV7 T;  4WC2 A;  3PJA A;  4HWI B;  1SA0 E;  4LFA T;  2M2W A;  1Z8U A;  4IDQ A;  4ILU A;  5ABF A;  9ICE A;  4ZS3 A;  3KVA A;  4PPX A;  4X4N A;  1D1B A;  4EIW A;  4JV5 T;  4E8F A;  8ICJ A;  3UXO A;  4I2B A;  2G0U A;  4GK5 E;  2GAF D;  3O1H A;  4WW0 A;  5FY7 A;  2A2F X;  3AE2 A;  4U2Z A;  4PH5 A;  8ICX A;  3A8Y C;  9ICA A;  4ILA A;  4GOU A;  4CN6 A;  3RC3 A;  3WAJ A;  2CBJ A;  2XHE B;  4JWN A;  4X62 T;  3MCR A;  1WOT A;  2IDO B;  3PUV F;  3AE8 A;  4DO9 A;  1VCS A;  5LHI B;  1HNW T;  9ICS A;  4ZS2 A;  2DVI A;  4U7Y A;  1MMN A;  3O9X A;  3L39 A;  2DR5 A;  1ZQI A;  5DQV A;  2WZH A;  3IBP A;  1CUN A;  3M3Z B;  5HEO A;  1OXZ A;  5TAO A;  3QNU A;  8ICU A;  4I2C A;  4YCX A;  3FBL A;  3ETV A;  4ZZC A;  3OGU A;  4WQL A;  5JDN A;  4LEV A;  4P0B A;  9ICN A;  4DR2 T;  2I6H A;  3KIN B;  4RQ4 A;  4JI5 T;  3S4U A;  4UVC B;  4HE8 A;  4WC5 A;  4PK5 A;  2M67 A;  7ICH A;  5J2C A;  3L09 A;  1LVK A;  2L3L A;  3H39 A;  4TV8 E;  2ZM8 A;  5ETW A;  3FZM B;  1BPE A;  2WBL A;  4QX7 B;  4WBN E;  3RC8 A;  3MXZ A;  3TLU A;  4YHJ A; 
#chains in the Genus database with same CATH homology
 3CK6 A;  3JCF A;  4EEB A;  2HN2 A;  3NVO A;  4EV6 A;  3NWI A;  2BBH A;  2IUB A;  4I0U A;  4EED A;  2HN1 A;  4EGW A;  3RKG A;  2BBJ A;  5JTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...