4EEBA

Cora coiled-coil mutant under mg2+ absence
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
324
structure length
314
Chain Sequence
DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnesium transport protein CorA
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Metal transport
total genus 95
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eebA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eebA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eebA01
3NWIA 2BBHA 3JCFA 2HN1A 3NVOA 2IUBA 2HN2A 3RKGA 2BBJA 4EEBA 4EEDA 4EGWA 5JTGA 4EV6A 3CK6A 4I0UA
chains in the Genus database with same CATH superfamily
3LQCB 4JI6T 5C8YE 3AEFA 5HRLA 4JI3T 4EBJA 4L0RA 2FBWA 2V7KA 4GYSA 1UEVA 2ACXA 1FIOA 9ICBA 4AKLA 8ICTA 3KV4A 4JBWF 4G2AA 3V5SA 2CXDA 2X67A 3K7DA 2ZM2A 8ICRA 1IJ5A 5FXVA 3EHZA 4IQVA 2B51A 3HJ1A 2X0HA 3ZYKA 3ZN0B 1SUMB 4LFBT 3G06A 1GQEA 3MGIA 1Z0PA 4TX5A 3PMLA 5HEOA 5IIIA 4WC7A 4EP7A 2XQ8A 2QRXA 4KLMA 2VK9A 3AEEA 1ZQKA 4OAHA 3L39A 4UV9B 4TN7B 3RYHE 4WC2A 3AE9A 3T1HT 4DVDA 4X4RA 1YQ3A 4KMCA 1MNEA 1NAFA 5LP6E 5BR8T 3ANWB 5FXXA 5J0RA 4LF9T 4GYRA 2H3RA 1X79A 3UU6A 4NXZA 3GMIA 4EEBA 3UTKA 4KLFA 1FMVA 2NWBA 4ZOLE 5HAXA 5J2CA 2A3DA 4FHYA 5L4EA 9ICEA 3LBXB 1D0YA 4XJEA 1U4QA 2JQKA 5KDMC 2WWUA 2PFVA 4WCWA 4JI1T 1D1CA 4H9SE 4DV0T 5B3PA 4XQ7A 5B3QA 4HFHA 8ICBA 3TLVA 4KLLA 2XJ7A 3GWHA 4PJJA 4MF8A 2E5LT 2M2UA 4X4OA 4AISA 4UB3A 5IYZE 1RPLA 5IILA 3PU3A 2WZHA 1ZQCA 1HX8A 2UUAT 3LK2B 5AQPB 5J0YA 3K8PC 3OUYA 4PJNA 2ZH4A 3PUVF 1KF6A 4GXKA 2DI4A 1R89A 5DECA 1VCSA 1ZQPA 3CQXC 3FZLB 4ZS2A 1LVFA 2J4GA 1YQ4A 3P4QA 4X1IE 4P4OA 3V7JA 4I55E 2W66A 2GWSA 2L8KA 4HEAA 2XAFB 4IT4A 1BPDA 2EWRA 5DDYA 3EAMA 4PK4A 1HNZT 2CXFA 1ZOYA 5GONE 4PH5A 2IMLA 3ZMZB 5DABA 3ZYLA 3RHWA 3RQUA 2LSYA 5HC9A 4X5VA 1HTJF 4JI7T 5HHHA 1KFYA 2FJEA 1IZNB 5LG3A 2YU2A 3N2OA 4UAWA 4U7IA 1KNRA 5CJ7A 3V72A 2WP9A 2C5JA 5IIMA 5H6RB 5AQVB 5HWYA 4HFBA 1BPXA 3J9X1 2PJQA 1T7SA 3RH6A 4UB4A 3ETUA 5CFTA 5HRHA 8ICIA 4WH5A 3MJXA 2N2NA 4RQ6A 4IIJE 3ZLIA 5JDLA 3A7MA 5CWRA 2NW9A 4IE7A 2XM2A 4JI8T 4AQGA 4RQ0A 2WB5A 3C4WA 1J5WA 4NPPA 4DV7T 3UUNA 1W09A 1BPBA 3ZT7A 3PNCA 1BR1A 3HWTA 2ID1A 1UETA 1Z8UA 2Q9QD 1UCUA 2CEAA 3M65A 4FHVA 3RJHA 1ZJMA 3PUSA 4IDOA 4KLDA 2X9XA 2LE8A 4EIWA 1UURA 3EVYA 5AQQB 2DWKA 2PFPA 2AXDS 1VCTA 3ZSTA 5TZVA 2L3LA 8ICOA 3RYIE 4P1NA 2LRKA 3MGHA 2ZLYA 1I94T 2C5IT 4XA5A 1ZQYA 2PTFA 1MMAA 1W9RA 4DV6T 2I59A 5C2TA 3RIUA 3X1DA 3UU4A 2BKPA 1OEDA 5LMNT 3I0QA 1D0XA 3JC6C 4LVSA 2M6BA 2XAGB 4AT8B 1TFYA 4KLEA 4X4VA 2YINA 1WOTA 3RH5A 1BPEA 1OEDE 3KFWX 5EK4A 5HEJA 4CI1B 1RZTA 3E0ZA 2H7VC 4HE8A 1LRZA 3AAAB 3AB3B 4ZI7E 5J2TE 3ESLA 3OJAA 1G73A 4WC6A 5AQLB 2XQ6A 1KEYA 3RJIA 4UR9A 8ICHA 1UX5A 9ICPA 5L3EB 3HJ4A 3HR0A 3E22E 2WDVA 3K1SA 3UU3A 4ASKA 5F8PA 4OHFA 2ACZA 2NTYA 3K3OA 5JVDE 4E7SA 4WBOA 3JAEA 3AE6A 3JPQA 4RQ4A 5JR9A 3CX8B 2XUEA 1LVKA 9ICKA 3TLSA 4WZXA 1D1AA 2K3WA 4JWNA 5LGNB 4I2HA 3MA9A 5AFUL 2D2SA 4X66T 4P2HA 3VRBA 5KXJA 2A2FX 5AQUB 1IBMT 3RRCA 4J2CA 2VKOA 5HXEA 3UFGA 2CXLA 4B3RT 3AEAA 4QZ9A 2ZH2A 1CUNA 3ZPOA 5ABFA 3UUMA 4I2GA 2A9UA 4WOYA 2VL0A 4A5XA 3PHZA 4BJNA 4ISSA 2KZ7B 7ICUA 2YKSA 4M9NA 4O8SA 8ICKA 4I2DA 3CK6A 4YLHA 3FXEB 5L3BB 3NYBA 4ZEYA 1WR6A 2M2WA 2UU9T 2WM9A 1DU2A 5EK2A 3IHRA 1T72A 3LDQB 1HNXT 3MDAA 3RJFA 4COFA 1AJ3A 1KEJA 5M4YA 4EGWA 2ES0A 4EYUA 5CA7A 3GN5A 1KNPA 2ZM6T 5JTGA 2ZHBA 2ZM0A 2W2UA 2J1DG 4KUMB 4K0KT 4WQKA 1F5AA 4U7YA 4UIGA 1ZQFA 1G8XA 5HR9A 1HCIA 4TWDA 4UEMA 1WYBA 5LJMA 4JLEA 1CHUA 2XAJB 1XZYA 3ZMUB 2BCUA 4P0AA 4ATBB 3RIFA 4JUYA 5FNVE 3L09A 4KLJA 3WFPA 4U72A 1UEUA 2KMFA 2KSRA 4IHJE 5IINA 3PU8A 4K97A 5CA1E 1ZKEA 4AQFC 1WRDA 3OBVE 4NY8A 3RJEA 3CQCB 4QH1A 3RYFE 4HFDA 4NLNA 3KVBA 3RGLA 3P8CD 4X1YE 2DLRA 4K98A 5L3GB 4WC4A 2AE9A 4EB6E 2XQAA 3C5FA 8ICVA 4PHAA 1BPYA 5LHGB 4KLIA 4OAGA 8ICCA 4IQUA 3LBXA 4PJLA 4E8FA 3AEDA 2Z6EA 4R64A 2DRBA 4XUSA 4HFIA 2NTXA 3C98B 2LHRA 3P50A 1VFGA 3P4SA 2LOSA 1HR0T 4DO9A 4DNDA 4LEWA 4GKKT 4YCXA 4LF5T 3N9MA 4F6RC 1ZQVA 2JIWA 3C64A 4EZ4A 3ZC1A 4PGYA 5AQJB 2ISOA 5CJ5A 5L3FB 3HX0A 2VKDA 2LOPA 1XSLA 4UBCA 4UF0B 2CBJA 2VB6A 1E7PA 3OVAA 2I9GA 3M3ZB 2H88A 4DOAA 5DB9A 3AECA 1JMSA 1D1BA 4UAZA 3LFMA 2CPTA 3LK9A 3IA3A 5IUXA 4QZFA 4OFZA 2DR9A 4OK0A 4HWCA 4B6XA 4GXJA 5LHHB 9ICHA 5J0WA 2J47A 3KBUA 5CA0E 4CN6A 2F4VT 3RH3A 2FMPA 3AE3A 2IHOA 1JNRA 5J2EA 4QZGA 1YD8G 5C3JA 3AE4A 4IL9A 4ZI3D 4AXPA 3AA7B 7ICQA 1ZV4X 2NR4A 4CQIA 4RPYA 1IAPA 2ODUA 4ILCA 3WI3A 7ICKA 4X1KE 5HRFA 2BS3A 2D5UA 1KNZA 1H7CA 5HRGA 4UB2A 4E7XA 4EYYR 3CPZA 4KI0F 3RKOA 1HF8A 4B3ST 4O2AE 5HYAA 4LZDA 2JRKA 4I2IA 1I6ZA 3JPNA 4DV2T 4X4SA 4R66A 3UULA 4WC1A 1NWMX 4WBNE 4YXDA 9ICXA 5CR0A 2QYWA 1ZQMA 9ICUA 1V9DA 4YMNA 4PGXA 4O67A 5TAOA 3PMNA 3ONJA 2ODVA 5IIKA 5LHIB 3ZC0A 4HWHA 8ICGA 2VKJA 3QC9A 4NXMT 2CCQA 3AQKA 4UBBA 3GA8A 4AT8A 2K48A 2W62A 2QVAA 4MALA 2GA9D 4NKUA 2H89A 1JN3A 4DUZT 3PDYA 3WFOA 1MIYA 4RWQA 5FP3A 2MYSA 5CGMA 4YY3T 4LF6T 3CQGB 4YTPA 3S4UA 2UXDT 3AQNA 5JDMA 3OWGA 1T8BA 4DOCA 3PJAJ 2KT9A 3QB5A 1FMWA 2B76A 1ZQTA 3RQWA 9ICOA 1E1HB 3ETVA 4H9OC 3R84B 4KHZF 2IDOB 1WCRA 2YOEA 4DR4T 3AU6A 3AVRA 4EZHA 1ZQEA 4FH3A 1TV9A 2CBIA 1XSNA 2X0LB 1YKEB 3BQLA 2XAQB 3ABVA 2LEHA 4JI0T 5AQGB 2Y6XA 4NLZA 2ZH9A 4YSZA 3AXJA 4GIWA 4PPXA 3UUBA 3PJAA 4NUVA 5J0UA 2PBIA 4S3NA 4Q25A 4DR1T 3PUXF 1OWAA 3CX6B 5EZYE 4NM1A 5JDGA 5J2GA 4TUSA 2CWYA 3V5UA 2ZH1A 1ZQXA 5F3JA 4X0BA 4HN9A 3F2EA 4TNWA 4YD1A 3O9XA 4R65A 2LSKA 2W4XA 2ZH5A 1GPJA 3WAJA 3AE1A 2UXBT 1ZQJA 4NIQA 4NXUA 5L47A 3RJJA 5FL0A 2IC6A 2WDRA 2ZH3A 4BJMA 5HRIA 4L9IA 4YSXA 2M2VA 2K9AA 3N9NA 5FY1A 4AKRB 3DJBA 4I28A 4U3CA 4DIDB 1MIVA 1V4AA 9ICGA 5AQRB 4X4PA 4QZBA 2X68A 3NVOA 5LGUB 1ZQOA 1B7TA 5HREA 4EAHA 1ZQRA 3FZMB 1S94A 2LM9A 4FJOA 4RT3A 1SHZC 5LYJE 7ICPA 2LLYA 2BBJA 4QXCB 4QH4A 2DWGA 4H63H 2XQ4A 1M62A 3V7LA 3ONXA 9ICQA 4JEHB 1Y01A 4FO1A 3L8RA 2E9XC 4ATBA 4X65T 5AQHB 3FZHB 2UXNB 3SWHA 4M0AA 4M47A 4H9QC 3QB5K 5HRBA 5HWXA 3UU8A 4QZAA 2OLTA 4LF8T 4I2FA 2CRBA 2HHHT 1FA0A 3ONLC 4P4PA 1SA0E 3RX6A 5J2AA 1X9BA 2PG8A 4ZS3A 4MKPA 4YD2A 4GKJT 7ICGA 1R8BA 4A98A 3O1IA 5J2DA 4X4NA 3D0TA 3DTOA 2V6YA 4I4TE 3AVSA 5L3DB 3WFRE 4ZI2C 2RA1A 4I2EA 2V7LA 3QOFA 5EOZA 5DQWA 3C2LA 1HG2A 5IIJA 3FBZA 4M9HA 2FUPA 5J2KA 4UVAB 1VJ7A 2WZIA 4O9MA 1YKHB 4ZZCA 4TWHA 2XY8B 1J1JA 3JC6D 1OXZA 3NRYA 2LJLA 4UVCB 5J0ZA 3TFSA 3FZFB 5IHYA 3TKLB 3LJCA 3PUGA 2WAUA 5FL1A 4JEUB 3PUAA 8ICWA 5LJNA 4MFFA 3N9LA 4IE5A 2E9XA 4JI5T 4IDZA 5FYMA 2X51A 5CP2A 9ICNA 4O4JE 3ZYMA 2JJ9A 4FI5A 2BKNA 2BE3A 2DRAA 2W61A 5ADXL 3ZEFB 2FJBA 4UF0A 4C90A 3N9PA 4RQ3A 7ICOA 2RPAA 5CFBA 3P4RA 3AA6B 1Q78A 1T98A 4HGAA 3CKDA 5DEDA 1HNWT 4CN4A 4ADZA 2XZEA 4OX9T 1N34T 4TNVA 3JPSA 4KLGA 3AXJB 4I2JA 4FHWA 3MKDA 4JV5T 4YMMA 8ICPA 3ISBA 4K4HA 1HFAA 2D0TA 2WMNA 4GXIA 4PFOA 4NM2A 3CVRA 4KLOA 1IBLT 1HG5A 3UQ2A 3OKQA 2YU1A 3O1HA 4DOBA 5HXRA 3VU7H 3VKHA 3UXPA 4FH5A 2E8IA 4E7ZA 2PXIA 3RJGA 4CZZB 5J0OA 2CWOA 1ZHCA 7ICRA 5J0QA 5IWAT 4XQ8A 4KLUA 3EF2A 4MFAA 4AIUA 2IW5B 2CLYC 2HN1A 4OAFA 3EABA 2X66A 7ICJA 5J0PA 4HFVA 4LFCT 3PTRB 1NENA 8ICZA 4HFEA 4CN1A 1ZQGA 2X9YA 5J0TA 1BR0A 8ICEA 3Q5XA 2LSIA 1UK5A 4JLZA 4JWMA 3ER9B 4YT0A 2WQYA 4U2YA 3ERCC 2BCVA 4IL4A 2WS3A 2O5AA 4PNIA 2HH7A 2JPFA 2GAFD 4ILUA 3PUQA 3QUJA 4ERRA 1E2AA 3MACA 4M2YA 3N2KE 4WBYA 4TUQA 2LSGA 2WY2A 4UV8B 5CB1A 4X62T 4YN4A 3ZN1B 2XASB 4O6AA 2BPGA 3MK7C 1QUUA 5JREA 4MBQA 4KLSA 4QZHA 2FMSA 4PGQA 2EHOC 4PAGA 4LFAT 3VR9A 2V6YB 4PK6A 4RWNA 3AE7A 1ZJNA 2ISPA 2XQ3A 5DBCA 8ICFA 3RRWA 3SRZA 3HKEE 4NKTA 5AQIB 3VHLA 7ICLA 4HFCA 5D4BA 1HUZA 3KV6A 2HHPA 3FXDB 2W63A 4Z6CA 2MBGA 1O3XA 3TLUA 3ZT5A 4DV4T 5LA6E 4ZZBA 3C2MA 3PE0A 7ICIA 4QWNB 5LXTE 4NXTA 2IHMA 4I2CA 3VKGA 2C5KT 3SS1A 1D0ZA 3KVAA 3MZKB 1EZ3A 3NKUA 4LEYA 3C2KA 1FEWA 5FY7A 5HCMA 2XQ9A 4QXBB 4F5OA 2E9XB 5HEHA 4H9NC 4H63V 3Q2MA 2KLQA 2IUBA 5AQKB 2D9DA 3Q5DA 4K99A 1YXRA 4RQ8A 1WR0A 5J2HA 4O68A 1ZQHA 4DMVA 4UXNB 3TLWA 3B13A 2Y48B 2YDSA 5LOVE 4XAXB 4Z6EA 2PFQA 1N33T 2P9BA 4LMKA 2V6XA 3O4XE 3UXOA 9ICJA 3AQLA 3B57A 1HS7A 4AQFA 4K9BA 2M67A 3AE8A 3NBXX 3TLTA 3Q5WA 3MXZA 2IC9A 4HX0A 2IHR1 2JMKA 3FHNA 5AQOB 2EHOA 1JNZA 2BG9C 9ICLA 2WU5A 5HRKA 3PV0F 7ICTA 2HPJA 1TFWA 5HXHA 4KHPT 2CHOA 4ISTA 3UPSA 4WC3A 4KBMB 4C91A 4F5NA 2XM1A 5FMNA 9ICMA 4TWFA 4M9LA 3F57A 5J2JA 5HXSA 5DKWA 1LKXA 7ICNA 4IQTA 4F5QA 4NXVA 3CMLA 2A72A 3JPRA 4X4TA 8ICYA 2XPKA 9ICRA 5FVLA 5L4HA 3OVBA 3IBPA 3A5XA 2PFNA 4X20E 3WAKA 3UT5E 3ZMVB 2B4VA 3HKDE 2BCRA 4GK0E 4DV5T 2WCAA 1YLQA 2V26A 2FJDA 5A1LA 2X9HA 5HEUA 2VKHA 9ICAA 3C4ZA 4YHJA 2P66A 3C66A 5J1GA 3ZJ2A 5L3CB 2K5BB 4BA9A 5FXWA 2M2TA 5DJQC 4YHHT 2E5VA 3KV5A 4LMLA 2UUBT 4O2BE 4ILBA 4EBKA 4PJMA 2BS2A 4X0AA 5KMGP 2JMHA 4WBZA 2BG9A 4HWFA 2I6HA 3ZCJA 3MCRA 4K8VA 4QZIA 2C0SA 3QNUA 4QH5A 7ICFA 5LBQB 4M9JA 4PK5A 3ER8C 2GK9A 3H3MA 4AT7B 2BG9E 3UXNA 2R6GF 1MIWA 2XTLA 2V8SV 5LMUT 3K3QC 3AQMA 3K75D 4O5KA 2W0GA 1QSDA 9ICVA 2OA5A 2DVIA 3C4XA 8ICSA 3ZJ1A 5LG4A 3LG7A 1ZQWA 2DR8A 1U5PA 2YEVC 4OYKA 2WWVA 4O69A 2FMQA 1R8IA 4JI4T 2NW7A 3ZSSA 2UXCT 3SOLA 2BCQA 1SE7A 2KWIB 3RKGA 5ETWA 5AQTB 2BCSA 4NUUA 3HA4A 1MNDA 2B56A 4RQ1A 2CLYB 1MQ3A 2J62A 3RJKA 8ICXA 4YMOA 5HRDA 5BOLA 3IF8B 4Z6FA 4CI2B 5D62A 8ICUA 5LBMA 2QGSA 4WW0A 4HTEA 3I0OA 4HWDA 7ICSA 3N2GE 2N1GA 2RP4A 4V1Av 1ZQUA 4O4LE 4IQWA 4AKHA 3V7KA 4DR5T 2Y8DA 2PFOA 4JYAT 3KINB 4ZXLA 4WQLA 1W0BA 2O1PA 4FHXA 3RIAA 2W9MA 3MDCA 3BQKA 4DR3T 5IIOA 2BPFA 3H38A 4AT9B 1UUSA 5JRCA 9ICCA 3PUZF 3DP7A 5JH7E 4I43B 2DR5A 3ZKRA 2YN6A 4N78D 2UXXB 2BKOA 1S35A 4DMWA 3O1JA 5CHGA 2XQYA 2VVSA 2I0MA 4B3TT 2G0UA 3CWZB 2XHEB 4Z91A 1MMGA 3HKBE 4EEDA 2EHOB 1ZQNA 3NKZA 4IDPA 5AQMB 4RWPA 2DHRA 3JCFA 1JAJA 3PURA 4X4UA 4KX6A 4K4IA 2NRKA 4XZCA 3AU2A 4CI3B 3K3NA 4DV3T 4E80A 3KBTA 5H6QB 4F5PA 3OTOT 2VWAA 1R8AA 2MOZA 3AEBA 5CFSA 1N32T 4WC5A 3FB2A 3KV9A 3NRXA 5DB6A 3EDUA 4CXXA 2HPLA 4TUPA 5HEGA 4U31A 5JDFA 3RH4A 2W00A 4U74A 3UQ0A 2V7MA 1ZQAA 4WYVA 3UQ4A 4OAIZ 3P4PA 3RIUC 4H9PC 2ZH6A 3UUXB 3Q5EA 3AAEB 1Y64B 1OEDC 4FO6A 4O4HE 3U3IA 1XDPA 5JQGE 3J7Yq 5J2FA 2XSBA 2E9XD 1NO5A 5ABHA 5CB4E 4M04A 2DNXA 4LF4T 3JPPA 5J2IA 3GDXA 5D61A 4IDQA 3B0XA 4I29A 2K24A 4QX7B 4Z8XA 4XRHA 3OYXA 4QZDA 4K96A 1QLBA 5BPCA 4LEVA 4CXYA 4NLKA 3OPCA 3JPOA 3UPQA 4DR2T 3VR8A 1US7B 4DBQA 4OYJA 2VQFT 1N36T 1KNYA 4KM5A 3CX7B 2LKGA 1FJGT 3LK42 4ILAA 4X64T 2KXPB 2XQ5A 2Q9QC 3I9YA 2BG9B 5E0OA 3ZMTB 4ANJA 5JR9C 4I27A 5JDNA 3NZQA 4YFSA 3P7IA 1BR2A 4ZI2D 4G63A 5FY0A 1ZP0A 4A97A 5J0SA 4YSYA 3PUWF 3AA0B 3MBYA 3IEEA 1HUOA 3H39A 2V5CA 4XBFB 4PFPA 3ZMSB 2Q66A 3JADA 4O5CA 1XMOT 2BS4A 4A56A 3AAIA 1MQ2A 3BQIA 5J2UE 7ICMA 3T8OA 1ZQLA 3AUOA 4P09A 4PHEA 2LKHA 3OGUA 2N9DA 4RT2A 3C18A 3RF1A 2KNDA 2XQ7A 2WDQA 1JQRA 7ICEA 5CFUA 5DB8A 5LNKA 5D46A 1ZQQA 3E08A 8ICQA 2UUCT 1ZQDA 3Q9DA 3P4WA 2YK0A 2V5DA 2FCLA 2VL8A 4P0BA 4RQ7A 2BBHA 3UU5A 2LM2A 2VURA 9ICTA 5F2VO 4KLHA 5FXZA 4RQ5A 2ZH8A 5LB7B 2MAWA 5DB7A 8ICJA 4CXWA 8ICNA 2Q9QA 2BVMA 3UQ7A 5HXCA 2YDQA 5D49A 3OYZA 9ICFA 5JRCB 4RWOA 5AQNB 2W67A 3I9WA 4IE0A 4RPZA 2XSAA 3AA1B 4IE6A 2M6IA 1XNRT 3VRAA 4TV8E 2JQ9A 1PX5A 8ICLA 5JDQA 1IJ6A 3AE5A 1ZQBA 4UVBB 4TURA 2DR7A 3WFQE 4RQ2A 3SFEA 4EV6A 3OUYB 4U33A 2KWHA 5BOMA 1J5ET 2PBEA 4X5TA 2XAHB 3RLFF 1R8CA 4U2ZA 1M7KA 3HL6A 4LT6A 1BR4A 1ZQZA 2WMOA 3OVUA 5J2BA 3AEGA 4NXNT 2LT3A 4PHDA 4K9AA 1BPZA 2SPCA 5BMVE 4BAYB 4O5EA 2VVNA 3RYCE 4I2AA 5CHEA 7ICHA 2ZH7A 4DBRA 4M9GA 4ZHQE 3NZPA 5ABEA 4QZEA 3L3PA 3U78A 2H7OA 3N5LA 4KP3C 3A8YC 3EI0A 2BVLA 5AQSB 3N9QA 5FKYA 4Z6DA 4PHPA 5AQFB 1XNQT 1WFDA 2V7IA 1L0VA 3EDVA 5HHIA 3N9OA 4QHOA 4GK5E 3ZCIA 3HIYA 4LEZA 4B3MT 2YDRA 2NOXA 5J0XA 2HN2A 3JPTA 1OU5A 2B1EA 4AT7A 5DBAA 3L9DA 5DBBA 2VANA 4M1PA 3PUYF 1Q79A 4DV1T 9ICSA 3H37A 5HCJA 4I50E 3B0YA 5LCYA 3W15B 5F5WA 3JYYA 3AE2A 3RC3A 9ICWA 2D0UA 2LRLA 1WYCA 5DQVA 2E2AA 5ABGA 4EOZB 2LHNA 2CE7A 4N7RA 4MF2A 5LGTB 1ZQIA 5KX5E 2CMRA 1XDOA 1KK7A 2RFFA 7ICVA 2EHOD 3C5GA 1UX4A 2NW8A 4MHCA 2WBLA 4QX8B 4X4QA 4IE4A 9ICIA 3HW8A 4I0UA 3LSVA 4TV9E 4EXTA 4QXHB 3UFEA 1KDHA 3TFRA 5DDMA 2WSSV 1XMQT 4LMJA 3ISDA 4JI2T 3ANWA 3T1YT 2DL1A 1MMNA 3I1AA 2CHNA 2ZM8A 2LSJA 3FZKB 2BZBA 2ZMAA 4RPXA 4P4MA 2FJAA 4K0UA 1OEDB 4UB1A 2DCFA 4O4IE 2JQQA 4JLXA 3RI5A 4WNKA 4LZGA 3OV7A 5L2LA 4DUYT 4MFRA 4AT9A 1UGOA 2ZHAA 2JQHA 4R63A 4QKNA 4YTMA 5EK3A 5JDHA 4YJ2E 3CIRA 4AQYT 4QZ8A 4I2BA 3LK3B 3QK6A 2BDEA 4UAYA 3RC8A 3HI2A 4UB5A 3HKCE 1NEKA 2V7JA 4WC0A 2IAKA 2V1DB 1VOMA 4DR7T 3KDSE 2X9WA 1NOMA 4UD5A 2Q9QB 1ZQSA 4TUYE 3NWIA 3BK9A 5JR9B 4GOUA 5FVKA 4Z90A 3ISCA 1W0AA 1MMDA 2L9QA 4IGUA 4UD4A 3WFSC 4MLKA 4IG8A 4TZ4C 4M5DA 3R6NA 4F8HA 3B5MA 4MFCA 4YTNA 4L5GA 1IBKT 4KLTA 4IDNA 5ABFB 2CA5A 4NXWA 4LF7T 2OV9A 2BPCA 4AI6A 8ICAA 4QZCA 4UELA 4HKAA 3C51A 1ZEEA 2CM0A 3H3AA 4DR6T 1HX1B 4H9RC 1WLXA 1XWMA 4IREA 4KB6A 1XSPA 4FHPA 3SFDA 4ZI3C 1YW0A 3F31A 3C50A 3ZT6A 1VRBA 2NP9A 3JZ0A 3FBLA 5J29A 2IIUA 4YJ3E 4K4GA 4AKGA 2KINB 3OVSA 2QA7A 4DO0A 5D63A 3RPUA 2MPKA 4PW8A 4HWIB 4NXXA 3GN5B 4KLQA 2MTQA 2X0YA 4F5RA 2WU2A 1TVAA 8ICMA 2VASA 3EUHA 3JAFA 4AKIA 2VQET
chains in the Genus database with same CATH topology
3NWIA 2BBHA 3JCFA 2HN1A 3NVOA 2IUBA 2HN2A 3RKGA 2BBJA 4EEBA 4EEDA 4EGWA 5JTGA 4EV6A 3CK6A 4I0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NWI A;  2BBH A;  3JCF A;  2HN1 A;  3NVO A;  2IUB A;  2HN2 A;  3RKG A;  2BBJ A;  4EEB A;  4EED A;  4EGW A;  5JTG A;  4EV6 A;  3CK6 A;  4I0U A; 
#chains in the Genus database with same CATH topology
 3LQC B;  4JI6 T;  5C8Y E;  3AEF A;  5HRL A;  4JI3 T;  4EBJ A;  4L0R A;  2FBW A;  2V7K A;  4GYS A;  1UEV A;  2ACX A;  1FIO A;  9ICB A;  4AKL A;  8ICT A;  3KV4 A;  4JBW F;  4G2A A;  3V5S A;  2CXD A;  2X67 A;  3K7D A;  2ZM2 A;  8ICR A;  1IJ5 A;  5FXV A;  3EHZ A;  4IQV A;  2B51 A;  3HJ1 A;  2X0H A;  3ZYK A;  3ZN0 B;  1SUM B;  4LFB T;  3G06 A;  1GQE A;  3MGI A;  1Z0P A;  4TX5 A;  3PML A;  5HEO A;  5III A;  4WC7 A;  4EP7 A;  2XQ8 A;  2QRX A;  4KLM A;  2VK9 A;  3AEE A;  1ZQK A;  4OAH A;  3L39 A;  4UV9 B;  4TN7 B;  3RYH E;  4WC2 A;  3AE9 A;  3T1H T;  4DVD A;  4X4R A;  1YQ3 A;  4KMC A;  1MNE A;  1NAF A;  5LP6 E;  5BR8 T;  3ANW B;  5FXX A;  5J0R A;  4LF9 T;  4GYR A;  2H3R A;  1X79 A;  3UU6 A;  4NXZ A;  3GMI A;  4EEB A;  3UTK A;  4KLF A;  1FMV A;  2NWB A;  4ZOL E;  5HAX A;  5J2C A;  2A3D A;  4FHY A;  5L4E A;  9ICE A;  3LBX B;  1D0Y A;  4XJE A;  1U4Q A;  2JQK A;  5KDM C;  2WWU A;  2PFV A;  4WCW A;  4JI1 T;  1D1C A;  4H9S E;  4DV0 T;  5B3P A;  4XQ7 A;  5B3Q A;  4HFH A;  8ICB A;  3TLV A;  4KLL A;  2XJ7 A;  3GWH A;  4PJJ A;  4MF8 A;  2E5L T;  2M2U A;  4X4O A;  4AIS A;  4UB3 A;  5IYZ E;  1RPL A;  5IIL A;  3PU3 A;  2WZH A;  1ZQC A;  1HX8 A;  2UUA T;  3LK2 B;  5AQP B;  5J0Y A;  3K8P C;  3OUY A;  4PJN A;  2ZH4 A;  3PUV F;  1KF6 A;  4GXK A;  2DI4 A;  1R89 A;  5DEC A;  1VCS A;  1ZQP A;  3CQX C;  3FZL B;  4ZS2 A;  1LVF A;  2J4G A;  1YQ4 A;  3P4Q A;  4X1I E;  4P4O A;  3V7J A;  4I55 E;  2W66 A;  2GWS A;  2L8K A;  4HEA A;  2XAF B;  4IT4 A;  1BPD A;  2EWR A;  5DDY A;  3EAM A;  4PK4 A;  1HNZ T;  2CXF A;  1ZOY A;  5GON E;  4PH5 A;  2IML A;  3ZMZ B;  5DAB A;  3ZYL A;  3RHW A;  3RQU A;  2LSY A;  5HC9 A;  4X5V A;  1HTJ F;  4JI7 T;  5HHH A;  1KFY A;  2FJE A;  1IZN B;  5LG3 A;  2YU2 A;  3N2O A;  4UAW A;  4U7I A;  1KNR A;  5CJ7 A;  3V72 A;  2WP9 A;  2C5J A;  5IIM A;  5H6R B;  5AQV B;  5HWY A;  4HFB A;  1BPX A;  3J9X 1;  2PJQ A;  1T7S A;  3RH6 A;  4UB4 A;  3ETU A;  5CFT A;  5HRH A;  8ICI A;  4WH5 A;  3MJX A;  2N2N A;  4RQ6 A;  4IIJ E;  3ZLI A;  5JDL A;  3A7M A;  5CWR A;  2NW9 A;  4IE7 A;  2XM2 A;  4JI8 T;  4AQG A;  4RQ0 A;  2WB5 A;  3C4W A;  1J5W A;  4NPP A;  4DV7 T;  3UUN A;  1W09 A;  1BPB A;  3ZT7 A;  3PNC A;  1BR1 A;  3HWT A;  2ID1 A;  1UET A;  1Z8U A;  2Q9Q D;  1UCU A;  2CEA A;  3M65 A;  4FHV A;  3RJH A;  1ZJM A;  3PUS A;  4IDO A;  4KLD A;  2X9X A;  2LE8 A;  4EIW A;  1UUR A;  3EVY A;  5AQQ B;  2DWK A;  2PFP A;  2AXD S;  1VCT A;  3ZST A;  5TZV A;  2L3L A;  8ICO A;  3RYI E;  4P1N A;  2LRK A;  3MGH A;  2ZLY A;  1I94 T;  2C5I T;  4XA5 A;  1ZQY A;  2PTF A;  1MMA A;  1W9R A;  4DV6 T;  2I59 A;  5C2T A;  3RIU A;  3X1D A;  3UU4 A;  2BKP A;  1OED A;  5LMN T;  3I0Q A;  1D0X A;  3JC6 C;  4LVS A;  2M6B A;  2XAG B;  4AT8 B;  1TFY A;  4KLE A;  4X4V A;  2YIN A;  1WOT A;  3RH5 A;  1BPE A;  1OED E;  3KFW X;  5EK4 A;  5HEJ A;  4CI1 B;  1RZT A;  3E0Z A;  2H7V C;  4HE8 A;  1LRZ A;  3AAA B;  3AB3 B;  4ZI7 E;  5J2T E;  3ESL A;  3OJA A;  1G73 A;  4WC6 A;  5AQL B;  2XQ6 A;  1KEY A;  3RJI A;  4UR9 A;  8ICH A;  1UX5 A;  9ICP A;  5L3E B;  3HJ4 A;  3HR0 A;  3E22 E;  2WDV A;  3K1S A;  3UU3 A;  4ASK A;  5F8P A;  4OHF A;  2ACZ A;  2NTY A;  3K3O A;  5JVD E;  4E7S A;  4WBO A;  3JAE A;  3AE6 A;  3JPQ A;  4RQ4 A;  5JR9 A;  3CX8 B;  2XUE A;  1LVK A;  9ICK A;  3TLS A;  4WZX A;  1D1A A;  2K3W A;  4JWN A;  5LGN B;  4I2H A;  3MA9 A;  5AFU L;  2D2S A;  4X66 T;  4P2H A;  3VRB A;  5KXJ A;  2A2F X;  5AQU B;  1IBM T;  3RRC A;  4J2C A;  2VKO A;  5HXE A;  3UFG A;  2CXL A;  4B3R T;  3AEA A;  4QZ9 A;  2ZH2 A;  1CUN A;  3ZPO A;  5ABF A;  3UUM A;  4I2G A;  2A9U A;  4WOY A;  2VL0 A;  4A5X A;  3PHZ A;  4BJN A;  4ISS A;  2KZ7 B;  7ICU A;  2YKS A;  4M9N A;  4O8S A;  8ICK A;  4I2D A;  3CK6 A;  4YLH A;  3FXE B;  5L3B B;  3NYB A;  4ZEY A;  1WR6 A;  2M2W A;  2UU9 T;  2WM9 A;  1DU2 A;  5EK2 A;  3IHR A;  1T72 A;  3LDQ B;  1HNX T;  3MDA A;  3RJF A;  4COF A;  1AJ3 A;  1KEJ A;  5M4Y A;  4EGW A;  2ES0 A;  4EYU A;  5CA7 A;  3GN5 A;  1KNP A;  2ZM6 T;  5JTG A;  2ZHB A;  2ZM0 A;  2W2U A;  2J1D G;  4KUM B;  4K0K T;  4WQK A;  1F5A A;  4U7Y A;  4UIG A;  1ZQF A;  1G8X A;  5HR9 A;  1HCI A;  4TWD A;  4UEM A;  1WYB A;  5LJM A;  4JLE A;  1CHU A;  2XAJ B;  1XZY A;  3ZMU B;  2BCU A;  4P0A A;  4ATB B;  3RIF A;  4JUY A;  5FNV E;  3L09 A;  4KLJ A;  3WFP A;  4U72 A;  1UEU A;  2KMF A;  2KSR A;  4IHJ E;  5IIN A;  3PU8 A;  4K97 A;  5CA1 E;  1ZKE A;  4AQF C;  1WRD A;  3OBV E;  4NY8 A;  3RJE A;  3CQC B;  4QH1 A;  3RYF E;  4HFD A;  4NLN A;  3KVB A;  3RGL A;  3P8C D;  4X1Y E;  2DLR A;  4K98 A;  5L3G B;  4WC4 A;  2AE9 A;  4EB6 E;  2XQA A;  3C5F A;  8ICV A;  4PHA A;  1BPY A;  5LHG B;  4KLI A;  4OAG A;  8ICC A;  4IQU A;  3LBX A;  4PJL A;  4E8F A;  3AED A;  2Z6E A;  4R64 A;  2DRB A;  4XUS A;  4HFI A;  2NTX A;  3C98 B;  2LHR A;  3P50 A;  1VFG A;  3P4S A;  2LOS A;  1HR0 T;  4DO9 A;  4DND A;  4LEW A;  4GKK T;  4YCX A;  4LF5 T;  3N9M A;  4F6R C;  1ZQV A;  2JIW A;  3C64 A;  4EZ4 A;  3ZC1 A;  4PGY A;  5AQJ B;  2ISO A;  5CJ5 A;  5L3F B;  3HX0 A;  2VKD A;  2LOP A;  1XSL A;  4UBC A;  4UF0 B;  2CBJ A;  2VB6 A;  1E7P A;  3OVA A;  2I9G A;  3M3Z B;  2H88 A;  4DOA A;  5DB9 A;  3AEC A;  1JMS A;  1D1B A;  4UAZ A;  3LFM A;  2CPT A;  3LK9 A;  3IA3 A;  5IUX A;  4QZF A;  4OFZ A;  2DR9 A;  4OK0 A;  4HWC A;  4B6X A;  4GXJ A;  5LHH B;  9ICH A;  5J0W A;  2J47 A;  3KBU A;  5CA0 E;  4CN6 A;  2F4V T;  3RH3 A;  2FMP A;  3AE3 A;  2IHO A;  1JNR A;  5J2E A;  4QZG A;  1YD8 G;  5C3J A;  3AE4 A;  4IL9 A;  4ZI3 D;  4AXP A;  3AA7 B;  7ICQ A;  1ZV4 X;  2NR4 A;  4CQI A;  4RPY A;  1IAP A;  2ODU A;  4ILC A;  3WI3 A;  7ICK A;  4X1K E;  5HRF A;  2BS3 A;  2D5U A;  1KNZ A;  1H7C A;  5HRG A;  4UB2 A;  4E7X A;  4EYY R;  3CPZ A;  4KI0 F;  3RKO A;  1HF8 A;  4B3S T;  4O2A E;  5HYA A;  4LZD A;  2JRK A;  4I2I A;  1I6Z A;  3JPN A;  4DV2 T;  4X4S A;  4R66 A;  3UUL A;  4WC1 A;  1NWM X;  4WBN E;  4YXD A;  9ICX A;  5CR0 A;  2QYW A;  1ZQM A;  9ICU A;  1V9D A;  4YMN A;  4PGX A;  4O67 A;  5TAO A;  3PMN A;  3ONJ A;  2ODV A;  5IIK A;  5LHI B;  3ZC0 A;  4HWH A;  8ICG A;  2VKJ A;  3QC9 A;  4NXM T;  2CCQ A;  3AQK A;  4UBB A;  3GA8 A;  4AT8 A;  2K48 A;  2W62 A;  2QVA A;  4MAL A;  2GA9 D;  4NKU A;  2H89 A;  1JN3 A;  4DUZ T;  3PDY A;  3WFO A;  1MIY A;  4RWQ A;  5FP3 A;  2MYS A;  5CGM A;  4YY3 T;  4LF6 T;  3CQG B;  4YTP A;  3S4U A;  2UXD T;  3AQN A;  5JDM A;  3OWG A;  1T8B A;  4DOC A;  3PJA J;  2KT9 A;  3QB5 A;  1FMW A;  2B76 A;  1ZQT A;  3RQW A;  9ICO A;  1E1H B;  3ETV A;  4H9O C;  3R84 B;  4KHZ F;  2IDO B;  1WCR A;  2YOE A;  4DR4 T;  3AU6 A;  3AVR A;  4EZH A;  1ZQE A;  4FH3 A;  1TV9 A;  2CBI A;  1XSN A;  2X0L B;  1YKE B;  3BQL A;  2XAQ B;  3ABV A;  2LEH A;  4JI0 T;  5AQG B;  2Y6X A;  4NLZ A;  2ZH9 A;  4YSZ A;  3AXJ A;  4GIW A;  4PPX A;  3UUB A;  3PJA A;  4NUV A;  5J0U A;  2PBI A;  4S3N A;  4Q25 A;  4DR1 T;  3PUX F;  1OWA A;  3CX6 B;  5EZY E;  4NM1 A;  5JDG A;  5J2G A;  4TUS A;  2CWY A;  3V5U A;  2ZH1 A;  1ZQX A;  5F3J A;  4X0B A;  4HN9 A;  3F2E A;  4TNW A;  4YD1 A;  3O9X A;  4R65 A;  2LSK A;  2W4X A;  2ZH5 A;  1GPJ A;  3WAJ A;  3AE1 A;  2UXB T;  1ZQJ A;  4NIQ A;  4NXU A;  5L47 A;  3RJJ A;  5FL0 A;  2IC6 A;  2WDR A;  2ZH3 A;  4BJM A;  5HRI A;  4L9I A;  4YSX A;  2M2V A;  2K9A A;  3N9N A;  5FY1 A;  4AKR B;  3DJB A;  4I28 A;  4U3C A;  4DID B;  1MIV A;  1V4A A;  9ICG A;  5AQR B;  4X4P A;  4QZB A;  2X68 A;  3NVO A;  5LGU B;  1ZQO A;  1B7T A;  5HRE A;  4EAH A;  1ZQR A;  3FZM B;  1S94 A;  2LM9 A;  4FJO A;  4RT3 A;  1SHZ C;  5LYJ E;  7ICP A;  2LLY A;  2BBJ A;  4QXC B;  4QH4 A;  2DWG A;  4H63 H;  2XQ4 A;  1M62 A;  3V7L A;  3ONX A;  9ICQ A;  4JEH B;  1Y01 A;  4FO1 A;  3L8R A;  2E9X C;  4ATB A;  4X65 T;  5AQH B;  3FZH B;  2UXN B;  3SWH A;  4M0A A;  4M47 A;  4H9Q C;  3QB5 K;  5HRB A;  5HWX A;  3UU8 A;  4QZA A;  2OLT A;  4LF8 T;  4I2F A;  2CRB A;  2HHH T;  1FA0 A;  3ONL C;  4P4P A;  1SA0 E;  3RX6 A;  5J2A A;  1X9B A;  2PG8 A;  4ZS3 A;  4MKP A;  4YD2 A;  4GKJ T;  7ICG A;  1R8B A;  4A98 A;  3O1I A;  5J2D A;  4X4N A;  3D0T A;  3DTO A;  2V6Y A;  4I4T E;  3AVS A;  5L3D B;  3WFR E;  4ZI2 C;  2RA1 A;  4I2E A;  2V7L A;  3QOF A;  5EOZ A;  5DQW A;  3C2L A;  1HG2 A;  5IIJ A;  3FBZ A;  4M9H A;  2FUP A;  5J2K A;  4UVA B;  1VJ7 A;  2WZI A;  4O9M A;  1YKH B;  4ZZC A;  4TWH A;  2XY8 B;  1J1J A;  3JC6 D;  1OXZ A;  3NRY A;  2LJL A;  4UVC B;  5J0Z A;  3TFS A;  3FZF B;  5IHY A;  3TKL B;  3LJC A;  3PUG A;  2WAU A;  5FL1 A;  4JEU B;  3PUA A;  8ICW A;  5LJN A;  4MFF A;  3N9L A;  4IE5 A;  2E9X A;  4JI5 T;  4IDZ A;  5FYM A;  2X51 A;  5CP2 A;  9ICN A;  4O4J E;  3ZYM A;  2JJ9 A;  4FI5 A;  2BKN A;  2BE3 A;  2DRA A;  2W61 A;  5ADX L;  3ZEF B;  2FJB A;  4UF0 A;  4C90 A;  3N9P A;  4RQ3 A;  7ICO A;  2RPA A;  5CFB A;  3P4R A;  3AA6 B;  1Q78 A;  1T98 A;  4HGA A;  3CKD A;  5DED A;  1HNW T;  4CN4 A;  4ADZ A;  2XZE A;  4OX9 T;  1N34 T;  4TNV A;  3JPS A;  4KLG A;  3AXJ B;  4I2J A;  4FHW A;  3MKD A;  4JV5 T;  4YMM A;  8ICP A;  3ISB A;  4K4H A;  1HFA A;  2D0T A;  2WMN A;  4GXI A;  4PFO A;  4NM2 A;  3CVR A;  4KLO A;  1IBL T;  1HG5 A;  3UQ2 A;  3OKQ A;  2YU1 A;  3O1H A;  4DOB A;  5HXR A;  3VU7 H;  3VKH A;  3UXP A;  4FH5 A;  2E8I A;  4E7Z A;  2PXI A;  3RJG A;  4CZZ B;  5J0O A;  2CWO A;  1ZHC A;  7ICR A;  5J0Q A;  5IWA T;  4XQ8 A;  4KLU A;  3EF2 A;  4MFA A;  4AIU A;  2IW5 B;  2CLY C;  2HN1 A;  4OAF A;  3EAB A;  2X66 A;  7ICJ A;  5J0P A;  4HFV A;  4LFC T;  3PTR B;  1NEN A;  8ICZ A;  4HFE A;  4CN1 A;  1ZQG A;  2X9Y A;  5J0T A;  1BR0 A;  8ICE A;  3Q5X A;  2LSI A;  1UK5 A;  4JLZ A;  4JWM A;  3ER9 B;  4YT0 A;  2WQY A;  4U2Y A;  3ERC C;  2BCV A;  4IL4 A;  2WS3 A;  2O5A A;  4PNI A;  2HH7 A;  2JPF A;  2GAF D;  4ILU A;  3PUQ A;  3QUJ A;  4ERR A;  1E2A A;  3MAC A;  4M2Y A;  3N2K E;  4WBY A;  4TUQ A;  2LSG A;  2WY2 A;  4UV8 B;  5CB1 A;  4X62 T;  4YN4 A;  3ZN1 B;  2XAS B;  4O6A A;  2BPG A;  3MK7 C;  1QUU A;  5JRE A;  4MBQ A;  4KLS A;  4QZH A;  2FMS A;  4PGQ A;  2EHO C;  4PAG A;  4LFA T;  3VR9 A;  2V6Y B;  4PK6 A;  4RWN A;  3AE7 A;  1ZJN A;  2ISP A;  2XQ3 A;  5DBC A;  8ICF A;  3RRW A;  3SRZ A;  3HKE E;  4NKT A;  5AQI B;  3VHL A;  7ICL A;  4HFC A;  5D4B A;  1HUZ A;  3KV6 A;  2HHP A;  3FXD B;  2W63 A;  4Z6C A;  2MBG A;  1O3X A;  3TLU A;  3ZT5 A;  4DV4 T;  5LA6 E;  4ZZB A;  3C2M A;  3PE0 A;  7ICI A;  4QWN B;  5LXT E;  4NXT A;  2IHM A;  4I2C A;  3VKG A;  2C5K T;  3SS1 A;  1D0Z A;  3KVA A;  3MZK B;  1EZ3 A;  3NKU A;  4LEY A;  3C2K A;  1FEW A;  5FY7 A;  5HCM A;  2XQ9 A;  4QXB B;  4F5O A;  2E9X B;  5HEH A;  4H9N C;  4H63 V;  3Q2M A;  2KLQ A;  2IUB A;  5AQK B;  2D9D A;  3Q5D A;  4K99 A;  1YXR A;  4RQ8 A;  1WR0 A;  5J2H A;  4O68 A;  1ZQH A;  4DMV A;  4UXN B;  3TLW A;  3B13 A;  2Y48 B;  2YDS A;  5LOV E;  4XAX B;  4Z6E A;  2PFQ A;  1N33 T;  2P9B A;  4LMK A;  2V6X A;  3O4X E;  3UXO A;  9ICJ A;  3AQL A;  3B57 A;  1HS7 A;  4AQF A;  4K9B A;  2M67 A;  3AE8 A;  3NBX X;  3TLT A;  3Q5W A;  3MXZ A;  2IC9 A;  4HX0 A;  2IHR 1;  2JMK A;  3FHN A;  5AQO B;  2EHO A;  1JNZ A;  2BG9 C;  9ICL A;  2WU5 A;  5HRK A;  3PV0 F;  7ICT A;  2HPJ A;  1TFW A;  5HXH A;  4KHP T;  2CHO A;  4IST A;  3UPS A;  4WC3 A;  4KBM B;  4C91 A;  4F5N A;  2XM1 A;  5FMN A;  9ICM A;  4TWF A;  4M9L A;  3F57 A;  5J2J A;  5HXS A;  5DKW A;  1LKX A;  7ICN A;  4IQT A;  4F5Q A;  4NXV A;  3CML A;  2A72 A;  3JPR A;  4X4T A;  8ICY A;  2XPK A;  9ICR A;  5FVL A;  5L4H A;  3OVB A;  3IBP A;  3A5X A;  2PFN A;  4X20 E;  3WAK A;  3UT5 E;  3ZMV B;  2B4V A;  3HKD E;  2BCR A;  4GK0 E;  4DV5 T;  2WCA A;  1YLQ A;  2V26 A;  2FJD A;  5A1L A;  2X9H A;  5HEU A;  2VKH A;  9ICA A;  3C4Z A;  4YHJ A;  2P66 A;  3C66 A;  5J1G A;  3ZJ2 A;  5L3C B;  2K5B B;  4BA9 A;  5FXW A;  2M2T A;  5DJQ C;  4YHH T;  2E5V A;  3KV5 A;  4LML A;  2UUB T;  4O2B E;  4ILB A;  4EBK A;  4PJM A;  2BS2 A;  4X0A A;  5KMG P;  2JMH A;  4WBZ A;  2BG9 A;  4HWF A;  2I6H A;  3ZCJ A;  3MCR A;  4K8V A;  4QZI A;  2C0S A;  3QNU A;  4QH5 A;  7ICF A;  5LBQ B;  4M9J A;  4PK5 A;  3ER8 C;  2GK9 A;  3H3M A;  4AT7 B;  2BG9 E;  3UXN A;  2R6G F;  1MIW A;  2XTL A;  2V8S V;  5LMU T;  3K3Q C;  3AQM A;  3K75 D;  4O5K A;  2W0G A;  1QSD A;  9ICV A;  2OA5 A;  2DVI A;  3C4X A;  8ICS A;  3ZJ1 A;  5LG4 A;  3LG7 A;  1ZQW A;  2DR8 A;  1U5P A;  2YEV C;  4OYK A;  2WWV A;  4O69 A;  2FMQ A;  1R8I A;  4JI4 T;  2NW7 A;  3ZSS A;  2UXC T;  3SOL A;  2BCQ A;  1SE7 A;  2KWI B;  3RKG A;  5ETW A;  5AQT B;  2BCS A;  4NUU A;  3HA4 A;  1MND A;  2B56 A;  4RQ1 A;  2CLY B;  1MQ3 A;  2J62 A;  3RJK A;  8ICX A;  4YMO A;  5HRD A;  5BOL A;  3IF8 B;  4Z6F A;  4CI2 B;  5D62 A;  8ICU A;  5LBM A;  2QGS A;  4WW0 A;  4HTE A;  3I0O A;  4HWD A;  7ICS A;  3N2G E;  2N1G A;  2RP4 A;  4V1A v;  1ZQU A;  4O4L E;  4IQW A;  4AKH A;  3V7K A;  4DR5 T;  2Y8D A;  2PFO A;  4JYA T;  3KIN B;  4ZXL A;  4WQL A;  1W0B A;  2O1P A;  4FHX A;  3RIA A;  2W9M A;  3MDC A;  3BQK A;  4DR3 T;  5IIO A;  2BPF A;  3H38 A;  4AT9 B;  1UUS A;  5JRC A;  9ICC A;  3PUZ F;  3DP7 A;  5JH7 E;  4I43 B;  2DR5 A;  3ZKR A;  2YN6 A;  4N78 D;  2UXX B;  2BKO A;  1S35 A;  4DMW A;  3O1J A;  5CHG A;  2XQY A;  2VVS A;  2I0M A;  4B3T T;  2G0U A;  3CWZ B;  2XHE B;  4Z91 A;  1MMG A;  3HKB E;  4EED A;  2EHO B;  1ZQN A;  3NKZ A;  4IDP A;  5AQM B;  4RWP A;  2DHR A;  3JCF A;  1JAJ A;  3PUR A;  4X4U A;  4KX6 A;  4K4I A;  2NRK A;  4XZC A;  3AU2 A;  4CI3 B;  3K3N A;  4DV3 T;  4E80 A;  3KBT A;  5H6Q B;  4F5P A;  3OTO T;  2VWA A;  1R8A A;  2MOZ A;  3AEB A;  5CFS A;  1N32 T;  4WC5 A;  3FB2 A;  3KV9 A;  3NRX A;  5DB6 A;  3EDU A;  4CXX A;  2HPL A;  4TUP A;  5HEG A;  4U31 A;  5JDF A;  3RH4 A;  2W00 A;  4U74 A;  3UQ0 A;  2V7M A;  1ZQA A;  4WYV A;  3UQ4 A;  4OAI Z;  3P4P A;  3RIU C;  4H9P C;  2ZH6 A;  3UUX B;  3Q5E A;  3AAE B;  1Y64 B;  1OED C;  4FO6 A;  4O4H E;  3U3I A;  1XDP A;  5JQG E;  3J7Y q;  5J2F A;  2XSB A;  2E9X D;  1NO5 A;  5ABH A;  5CB4 E;  4M04 A;  2DNX A;  4LF4 T;  3JPP A;  5J2I A;  3GDX A;  5D61 A;  4IDQ A;  3B0X A;  4I29 A;  2K24 A;  4QX7 B;  4Z8X A;  4XRH A;  3OYX A;  4QZD A;  4K96 A;  1QLB A;  5BPC A;  4LEV A;  4CXY A;  4NLK A;  3OPC A;  3JPO A;  3UPQ A;  4DR2 T;  3VR8 A;  1US7 B;  4DBQ A;  4OYJ A;  2VQF T;  1N36 T;  1KNY A;  4KM5 A;  3CX7 B;  2LKG A;  1FJG T;  3LK4 2;  4ILA A;  4X64 T;  2KXP B;  2XQ5 A;  2Q9Q C;  3I9Y A;  2BG9 B;  5E0O A;  3ZMT B;  4ANJ A;  5JR9 C;  4I27 A;  5JDN A;  3NZQ A;  4YFS A;  3P7I A;  1BR2 A;  4ZI2 D;  4G63 A;  5FY0 A;  1ZP0 A;  4A97 A;  5J0S A;  4YSY A;  3PUW F;  3AA0 B;  3MBY A;  3IEE A;  1HUO A;  3H39 A;  2V5C A;  4XBF B;  4PFP A;  3ZMS B;  2Q66 A;  3JAD A;  4O5C A;  1XMO T;  2BS4 A;  4A56 A;  3AAI A;  1MQ2 A;  3BQI A;  5J2U E;  7ICM A;  3T8O A;  1ZQL A;  3AUO A;  4P09 A;  4PHE A;  2LKH A;  3OGU A;  2N9D A;  4RT2 A;  3C18 A;  3RF1 A;  2KND A;  2XQ7 A;  2WDQ A;  1JQR A;  7ICE A;  5CFU A;  5DB8 A;  5LNK A;  5D46 A;  1ZQQ A;  3E08 A;  8ICQ A;  2UUC T;  1ZQD A;  3Q9D A;  3P4W A;  2YK0 A;  2V5D A;  2FCL A;  2VL8 A;  4P0B A;  4RQ7 A;  2BBH A;  3UU5 A;  2LM2 A;  2VUR A;  9ICT A;  5F2V O;  4KLH A;  5FXZ A;  4RQ5 A;  2ZH8 A;  5LB7 B;  2MAW A;  5DB7 A;  8ICJ A;  4CXW A;  8ICN A;  2Q9Q A;  2BVM A;  3UQ7 A;  5HXC A;  2YDQ A;  5D49 A;  3OYZ A;  9ICF A;  5JRC B;  4RWO A;  5AQN B;  2W67 A;  3I9W A;  4IE0 A;  4RPZ A;  2XSA A;  3AA1 B;  4IE6 A;  2M6I A;  1XNR T;  3VRA A;  4TV8 E;  2JQ9 A;  1PX5 A;  8ICL A;  5JDQ A;  1IJ6 A;  3AE5 A;  1ZQB A;  4UVB B;  4TUR A;  2DR7 A;  3WFQ E;  4RQ2 A;  3SFE A;  4EV6 A;  3OUY B;  4U33 A;  2KWH A;  5BOM A;  1J5E T;  2PBE A;  4X5T A;  2XAH B;  3RLF F;  1R8C A;  4U2Z A;  1M7K A;  3HL6 A;  4LT6 A;  1BR4 A;  1ZQZ A;  2WMO A;  3OVU A;  5J2B A;  3AEG A;  4NXN T;  2LT3 A;  4PHD A;  4K9A A;  1BPZ A;  2SPC A;  5BMV E;  4BAY B;  4O5E A;  2VVN A;  3RYC E;  4I2A A;  5CHE A;  7ICH A;  2ZH7 A;  4DBR A;  4M9G A;  4ZHQ E;  3NZP A;  5ABE A;  4QZE A;  3L3P A;  3U78 A;  2H7O A;  3N5L A;  4KP3 C;  3A8Y C;  3EI0 A;  2BVL A;  5AQS B;  3N9Q A;  5FKY A;  4Z6D A;  4PHP A;  5AQF B;  1XNQ T;  1WFD A;  2V7I A;  1L0V A;  3EDV A;  5HHI A;  3N9O A;  4QHO A;  4GK5 E;  3ZCI A;  3HIY A;  4LEZ A;  4B3M T;  2YDR A;  2NOX A;  5J0X A;  2HN2 A;  3JPT A;  1OU5 A;  2B1E A;  4AT7 A;  5DBA A;  3L9D A;  5DBB A;  2VAN A;  4M1P A;  3PUY F;  1Q79 A;  4DV1 T;  9ICS A;  3H37 A;  5HCJ A;  4I50 E;  3B0Y A;  5LCY A;  3W15 B;  5F5W A;  3JYY A;  3AE2 A;  3RC3 A;  9ICW A;  2D0U A;  2LRL A;  1WYC A;  5DQV A;  2E2A A;  5ABG A;  4EOZ B;  2LHN A;  2CE7 A;  4N7R A;  4MF2 A;  5LGT B;  1ZQI A;  5KX5 E;  2CMR A;  1XDO A;  1KK7 A;  2RFF A;  7ICV A;  2EHO D;  3C5G A;  1UX4 A;  2NW8 A;  4MHC A;  2WBL A;  4QX8 B;  4X4Q A;  4IE4 A;  9ICI A;  3HW8 A;  4I0U A;  3LSV A;  4TV9 E;  4EXT A;  4QXH B;  3UFE A;  1KDH A;  3TFR A;  5DDM A;  2WSS V;  1XMQ T;  4LMJ A;  3ISD A;  4JI2 T;  3ANW A;  3T1Y T;  2DL1 A;  1MMN A;  3I1A A;  2CHN A;  2ZM8 A;  2LSJ A;  3FZK B;  2BZB A;  2ZMA A;  4RPX A;  4P4M A;  2FJA A;  4K0U A;  1OED B;  4UB1 A;  2DCF A;  4O4I E;  2JQQ A;  4JLX A;  3RI5 A;  4WNK A;  4LZG A;  3OV7 A;  5L2L A;  4DUY T;  4MFR A;  4AT9 A;  1UGO A;  2ZHA A;  2JQH A;  4R63 A;  4QKN A;  4YTM A;  5EK3 A;  5JDH A;  4YJ2 E;  3CIR A;  4AQY T;  4QZ8 A;  4I2B A;  3LK3 B;  3QK6 A;  2BDE A;  4UAY A;  3RC8 A;  3HI2 A;  4UB5 A;  3HKC E;  1NEK A;  2V7J A;  4WC0 A;  2IAK A;  2V1D B;  1VOM A;  4DR7 T;  3KDS E;  2X9W A;  1NOM A;  4UD5 A;  2Q9Q B;  1ZQS A;  4TUY E;  3NWI A;  3BK9 A;  5JR9 B;  4GOU A;  5FVK A;  4Z90 A;  3ISC A;  1W0A A;  1MMD A;  2L9Q A;  4IGU A;  4UD4 A;  3WFS C;  4MLK A;  4IG8 A;  4TZ4 C;  4M5D A;  3R6N A;  4F8H A;  3B5M A;  4MFC A;  4YTN A;  4L5G A;  1IBK T;  4KLT A;  4IDN A;  5ABF B;  2CA5 A;  4NXW A;  4LF7 T;  2OV9 A;  2BPC A;  4AI6 A;  8ICA A;  4QZC A;  4UEL A;  4HKA A;  3C51 A;  1ZEE A;  2CM0 A;  3H3A A;  4DR6 T;  1HX1 B;  4H9R C;  1WLX A;  1XWM A;  4IRE A;  4KB6 A;  1XSP A;  4FHP A;  3SFD A;  4ZI3 C;  1YW0 A;  3F31 A;  3C50 A;  3ZT6 A;  1VRB A;  2NP9 A;  3JZ0 A;  3FBL A;  5J29 A;  2IIU A;  4YJ3 E;  4K4G A;  4AKG A;  2KIN B;  3OVS A;  2QA7 A;  4DO0 A;  5D63 A;  3RPU A;  2MPK A;  4PW8 A;  4HWI B;  4NXX A;  3GN5 B;  4KLQ A;  2MTQ A;  2X0Y A;  4F5R A;  2WU2 A;  1TVA A;  8ICM A;  2VAS A;  3EUH A;  3JAF A;  4AKI A;  2VQE T; 
#chains in the Genus database with same CATH homology
 3NWI A;  2BBH A;  3JCF A;  2HN1 A;  3NVO A;  2IUB A;  2HN2 A;  3RKG A;  2BBJ A;  4EEB A;  4EED A;  4EGW A;  5JTG A;  4EV6 A;  3CK6 A;  4I0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...