4EEBA

Cora coiled-coil mutant under mg2+ absence
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
324
structure length
314
Chain Sequence
DFEIEVMNYSIEEFREFKTTDVESVLPFRDSSTPTWINITGIHRTDVVQRVGEFFGIHPLVLEDILNVHQRPKVEFFENYVFIVLKMFTYDKNLHELESEQVSLILTKNCVLMFQEKIGDVFDPVRERIRYNRGIIRKKRADYLLYSLIDALVDDYFVLLEKIDDEIDVLEEEVLERPEKETVQRTHQLKRNLVELAATIWPLREVLSSLYRDVPPLIEKETVPYFRDVYDHTIQIADTVETFRDIVSGLLDVYLSSVSNKTNEVMKVLTIIATIFMPLTFIAGIYGMNFGYPVVLAVMGVIAVIMVVYFKKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Magnesium transport protein CorA
publication title Structural asymmetry in the magnesium channel CorA points to sequential allosteric regulation.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 95
structure length 314
sequence length 324
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01544 CorA CorA-like Mg2+ transporter protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eebA02
1.20.58.340 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Magnesium transport protein CorA, transmembrane region 4eebA03
3.30.460.20 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 CorA soluble domain-like 4eebA01
4EEDA 2HN2A 3JCFA 3NWIA 4EV6A 2IUBA 2BBJA 4EGWA 3RKGA 5JTGA 3CK6A 4I0UA 4EEBA 2HN1A 3NVOA 2BBHA
chains in the Genus database with same CATH superfamily
2PBIA 3PUWF 3ZMZB 2O1PA 1N34T 3JC6C 4R65A 3AE4A 2J4GA 2SPCA 3PJAJ 2X9YA 1QLBA 5HEOA 2X51A 3CPZA 4WC4A 4ZI3C 4NIQA 3ZYMA 3QK6A 1G8XA 4QZBA 1OEDC 2RFFA 5IUXA 5LHIB 4PGXA 5FL1A 4L0RA 3O1HA 2FJBA 5C3JA 2NTYA 2K5BB 4ZI2D 4M04A 2X68A 1YW0A 7ICSA 1CHUA 4H9RC 4ILBA 3ZSSA 2OV9A 4IDZA 4YHJA 3L39A 5AQTB 5JDNA 5IIKA 1ZOYA 2UUAT 4KLGA 1ZQUA 1XZYA 4OYKA 4IDNA 2BBHA 4UB4A 2M2TA 2V6XA 5HHIA 2N2NA 3N2GE 2YKSA 5IIOA 2Z6EA 4AQFA 3M65A 1W9RA 2KINB 3N9LA 3T1YT 3U3IA 4DOAA 4DR5T 3B5MA 4DR1T 2IHOA 4IDPA 3RJHA 4Z90A 2LSJA 3UUMA 3WFSC 3CX7B 4HN9A 2BPCA 2XAFB 7ICPA 2LOPA 4XQ7A 3ANWA 7ICGA 3RC8A 2HH7A 4TN7B 2X67A 2LRKA 3UQ7A 4PHPA 3MA9A 4PK4A 4NM2A 4OFZA 5DB6A 4RPXA 2EHOC 8ICGA 5LBMA 3QNUA 4IE5A 4WQLA 2FMQA 4O5KA 4DO0A 3OYZA 1W09A 4YXDA 5LJMA 4TUPA 1D1BA 2W66A 2BDEA 2GWSA 4Q25A 1YD8G 3FBZA 3PMLA 5J2JA 3RH5A 1MIVA 9ICBA 1ZQAA 2DR7A 5B3QA 4P09A 2ZH4A 2Q9QD 1WR0A 3UU8A 4YN4A 9ICVA 1XDOA 1KDHA 4B3MT 4TURA 8ICTA 1OEDB 4ILAA 3ESLA 4WC3A 3I0QA 4R63A 3AE8A 3TKLB 4MHCA 4O8SA 4X4RA 1HG2A 2BE3A 5J0QA 1B7TA 4B3RT 3HX0A 2DVIA 4DOCA 5AQPB 3RJKA 3QUJA 5DECA 2HPLA 2J47A 1HNZT 2YDRA 2F4VT 5KXJA 4ATBB 4UD4A 5HEJA 4X4TA 2D0TA 2WB5A 4YJ3E 4UV8B 3CX8B 7ICJA 3ZCJA 3VU7H 4OAFA 4JLEA 4O9MA 4XQ8A 1VFGA 2YEVC 1D1CA 5HREA 4IE4A 5JDFA 4WBZA 2O5AA 3ZJ1A 4CI3B 3RYHE 3OVSA 5HWXA 5J2TE 4LMKA 1HCIA 3RPUA 3AE6A 2Y48B 5DDMA 1ZQQA 1VJ7A 3NKZA 5CB4E 5L2LA 3CVRA 3CQGB 5L3CB 8ICMA 1T8BA 3ONLC 4NLNA 1E2AA 4H63V 1W0AA 1T98A 2LSYA 4JLZA 5B3PA 4M9JA 1KNZA 1Z8UA 3PUAA 2CWYA 4RT3A 3P4RA 4K8VA 4LT6A 3NKUA 4EXTA 3AB3B 4EP7A 3RH3A 4I2HA 5DJQC 2XASB 1ZKEA 5BPCA 4I2EA 4V1Av 4A56A 1ZQWA 3IF8B 3RRWA 3QB5A 4WC7A 4DR7T 2ZH3A 1CUNA 4LF5T 3PUYF 3N2OA 5L4HA 2BG9B 4Z8XA 5J2HA 2H89A 5HCMA 3UQ2A 2RPAA 1N36T 3O1IA 2BVLA 2IHMA 4PJMA 2NW7A 1ZQGA 4I2JA 2JQKA 4O4HE 2C5IT 3PU3A 3B0XA 4K4IA 2XAGB 2QRXA 4U74A 5AQRB 4DV2T 5FVKA 4JBWF 4AKGA 4DMVA 2E9XA 5D49A 3AAEB 3Q5WA 4RQ3A 4JLXA 1ZJNA 3SFEA 2KMFA 4M9NA 3JPSA 3HL6A 3ZT7A 2UUCT 2CCQA 3V5UA 2VURA 2WY2A 4K9BA 2ISPA 4YSZA 1D0XA 2BBJA 8ICFA 2IDOB 4AT7A 4I28A 5LOVE 5JH7E 3OVAA 3KBUA 4JI6T 1FJGT 1FMWA 3RX6A 3RHWA 4HTEA 7ICQA 4KLQA 4K0UA 4F5PA 4I43B 4DIDB 4I2BA 4UF0A 2PG8A 3AE1A 5J0ZA 9ICIA 3PV0F 3LFMA 4WNKA 4DMWA 4OAHA 3AEEA 3KBTA 4K96A 5AQFB 4TWFA 1IAPA 4EGWA 7ICUA 4I2AA 4XA5A 4KLDA 4LF7T 4GXKA 8ICOA 3AEFA 3SS1A 2DL1A 5DEDA 3K8PC 4EBJA 1Q78A 3JCFA 4O4LE 1KNPA 5FY1A 3KFWX 4IQTA 2JRKA 3JPRA 2A9UA 3ZYKA 1UK5A 3H3AA 3JPPA 1MQ2A 2EWRA 2WAUA 1WRDA 1ZQFA 2NR4A 1FA0A 4OHFA 4IL4A 2XHEB 2UU9T 3NRXA 4WC6A 2CHOA 3C98B 4UVBB 4FHVA 2WU2A 5BMVE 4NPPA 5J2EA 3PNCA 4XZCA 5HRFA 5TZVA 5ADXL 5HHHA 2H3RA 3P4WA 4QZAA 4YTPA 2ISOA 3WAJA 3ISCA 5FY0A 3PURA 4PH5A 4EEBA 1OXZA 3ABVA 7ICHA 3R6NA 1JN3A 4HE8A 3MXZA 1SHZC 2CPTA 5IIJA 2XM2A 5AQUB 3CQXC 4MFRA 3EHZA 3JYYA 4HFHA 2JMKA 5DKWA 1Y01A 2IIUA 1YQ3A 4E7SA 2KWIB 3FZLB 3U78A 2EHOA 2BPGA 3PUXF 3HKDE 2QGSA 5J2KA 3C51A 3ONJA 1MMGA 4UIGA 3G06A 1NEKA 2MTQA 3UXNA 2K9AA 2MBGA 2PXIA 3RIUC 2I6HA 3ANWB 2ZH9A 3KVAA 4IE0A 2JMHA 2CBJA 2ID1A 3C2MA 4KHPT 3CX6B 2QA7A 9ICEA 9ICPA 1UGOA 2HHHT 3EVYA 2ZH8A 3ZSTA 5J2DA 3HI2A 1RZTA 2ZM0A 3LG7A 1F5AA 4U31A 1V9DA 3IBPA 1XSLA 1HNWT 1HS7A 1MIYA 3CQCB 4E7ZA 5AQVB 5J0WA 2ZH5A 1ZJMA 4G63A 4PHAA 2XQ7A 3ZT5A 4LF6T 4BA9A 5J29A 1ZQDA 4CXYA 4H9OC 1UURA 1ZQJA 3WFRE 2V1DB 3GN5A 3LSVA 3QOFA 3L9DA 4O2BE 5FNVE 4GOUA 5J0PA 8ICIA 4PJNA 4NXVA 4F5RA 4IGUA 9ICQA 3ZT6A 3VHLA 2XZEA 4ILUA 4X64T 7ICLA 4WBOA 4JI7T 3MGIA 5JREA 5AQHB 2UXDT 5LHGB 4IQWA 5HWYA 3AE9A 2LE8A 2JJ9A 1KFYA 4I2IA 4KI0F 3NWIA 5AQGB 3OVUA 2YN6A 4YLHA 3LDQB 9ICLA 1UEVA 2ZHAA 2E2AA 4IIJE 9ICFA 1T7SA 2BS2A 3GDXA 1ZQTA 4BAYB 2D2SA 2WSSV 4P4PA 4PGQA 3V7KA 4PHDA 2NW8A 4I2CA 3KV9A 1RPLA 1XWMA 4Z6CA 4PHEA 8ICLA 2KXPB 3AAIA 4FHYA 3B0YA 4OYJA 4QXHB 5A1LA 4CXXA 4X62T 4OX9T 2LSGA 2ZMAA 2IMLA 1WOTA 1UX5A 3AA1B 8ICEA 4WC0A 4RT2A 4LEZA 2LLYA 4X20E 4DV4T 4UXNB 4MFFA 5LA6E 4LFCT 3Q5DA 4MBQA 2XAQB 2DLRA 4O5CA 5FXZA 2MYSA 3B13A 4U7IA 4GK5E 4ZI3D 3RGLA 2NW9A 4NY8A 1MMDA 3AVSA 5EK4A 4AT8A 2BVMA 4GK0E 4GXIA 2V5DA 4KLSA 9ICAA 1IBKT 4IE7A 3UT5E 2XSAA 3KVBA 3V7JA 2FJAA 4PJJA 1UUSA 4JWMA 3OUYA 2KLQA 1GQEA 2KSRA 3KDSE 5DQWA 3SOLA 4ADZA 2VASA 4Z6DA 4YMNA 5KX5E 3RIAA 4RPZA 3OKQA 3ZN0B 2E9XB 3MACA 3N9OA 4TV8E 4DBRA 4IQUA 1E1HB 2V26A 1EZ3A 2XQ6A 3PUVF 2X0YA 5F3JA 4HFIA 2NTXA 4OAIZ 2DR8A 4M9LA 2MAWA 3ER8C 4UAYA 4X1KE 3RJJA 4MALA 4A97A 3JADA 2NRKA 4XJEA 3T8OA 5LCYA 4HFVA 4HFCA 3FXEB 3L8RA 4AT7B 3AEAA 4CI2B 8ICKA 4EYUA 3MDCA 4XUSA 2P66A 1VCSA 4ISTA 5LGUB 4WC1A 1NO5A 5J2AA 4UF0B 3A5XA 4AKRB 2PFVA 5LG3A 4ZS2A 8ICWA 3UUXB 4IE6A 4KUMB 5ABFA 4CZZB 1HUOA 2FCLA 5IYZE 2X9HA 4KLJA 4TZ4C 4EYYR 1D0YA 5CGMA 3LK42 1X79A 4I0UA 2W67A 3GA8A 1O3XA 5ABEA 2WZHA 2AXDS 2CRBA 1KNRA 1R8IA 3M3ZB 4NXXA 5E0OA 3ER9B 4S3NA 2V7KA 4XBFB 4PNIA 5HXHA 1ZQZA 3V5SA 4HWFA 2WMOA 3ISBA 3I9WA 2IUBA 1T72A 1E7PA 2VANA 2ZM8A 3JAFA 4YD2A 4MF8A 4ASKA 5AQIB 3AQLA 1D0ZA 4C91A 2V7MA 2BZBA 2UUBT 3PE0A 4BJMA 3P8CD 4RQ8A 2WM9A 9ICWA 5J2UE 1SA0E 4L5GA 3ZC1A 5LYJE 3HA4A 5ETWA 1JNRA 1JMSA 4WCWA 4JI0T 2CHNA 3BQLA 2XQ4A 3SFDA 4DUYT 4FO1A 5CJ5A 4EAHA 4JI5T 3UU6A 9ICGA 3RIUA 3PUGA 2XSBA 3KINB 1HNXT 5GONE 4OAGA 5ABHA 1PX5A 2ZH6A 2BCSA 2XQ5A 7ICNA 4KLHA 1NAFA 4HKAA 4P0BA 4JEUB 3F57A 4TX5A 8ICVA 4Z91A 1JQRA 2EHOB 5DB8A 4NKUA 2LSKA 3HW8A 2LM2A 3ISDA 2D0UA 5D63A 4WH5A 3MJXA 2LKGA 2N9DA 5LGTB 5FVLA 4DV3T 4DR2T 2M2UA 1ZEEA 1ZQVA 4ZI7E 4P4MA 4IDOA 1ZQXA 4X4SA 5C8YE 2ZLYA 3RJFA 2XQ9A 3O1JA 5LHHB 4JI3T 4FH5A 3HKBE 4F8HA 2DI4A 4O6AA 4FHWA 2ZH2A 2QVAA 4KM5A 4P4OA 3LJCA 4B6XA 3D0TA 2K24A 3AE7A 2H7OA 2A3DA 3C4ZA 4X5TA 4LEWA 4LVSA 4B3TT 4LFAT 1S94A 2N1GA 3AXJA 1YKEB 2XQ3A 3SWHA 4U2ZA 2JPFA 3VR8A 4H9PC 5HXEA 2CLYC 3OV7A 3GN5B 3K3OA 4PK5A 5D61A 2B4VA 4NKTA 3K3QC 4AKIA 1TFWA 9ICUA 5HRDA 4WQKA 3ETUA 9ICOA 2ODVA 2GA9D 4FHPA 2FMPA 5L3BB 5F8PA 3AECA 5JDHA 2I59A 2K3WA 8ICQA 3AQMA 4H9NC 5FXXA 2VKHA 4J2CA 3GWHA 4WC5A 2J1DG 5FY7A 3ZN1B 2LRLA 5HRLA 4E8FA 4ZHQE 1S35A 5CA0E 3PHZA 2J62A 5AQQB 4PK6A 2Y6XA 3KV5A 2E8IA 4KLOA 4NUVA 1R89A 4CN4A 8ICRA 1NENA 1IJ6A 5DDYA 1TV9A 8ICSA 7ICFA 8ICAA 1ZP0A 1SUMB 5AQMB 5L47A 4EZHA 4PW8A 4QZ8A 1UCUA 3HKCE 4RWQA 8ICXA 3ZC0A 2LM9A 3AQNA 4X1YE 1ZQOA 3W15B 3AE3A 2R6GF 3NZPA 3H3MA 5IWAT 5JDMA 5FL0A 4MLKA 2MOZA 1U5PA 4KLIA 2CLYB 3ZMUB 5LMNT 2VL8A 2DWKA 4RQ0A 4DR4T 1ZQMA 3TLVA 3UU4A 8ICNA 4QH1A 1FIOA 4O69A 4AT8B 4MF2A 5L4EA 1HTJF 3Q5EA 5EOZA 2C0SA 4OK0A 1J5ET 1M62A 3AAAB 2WDRA 3DTOA 1BPEA 3LK9A 4HFEA 5HEGA 2VL0A 4I29A 2B56A 3OUYB 4LF8T 1ZQNA 1UETA 7ICOA 4PFPA 3J7Yq 3E08A 2ZH1A 9ICJA 5JDQA 3ZPOA 4NXMT 2IC6A 2IC9A 4LMLA 5CFUA 4TUQA 4KLFA 5LBQB 5JDLA 1DU2A 4M9GA 5HXRA 2W61A 3GMIA 5LP6E 3K3NA 3DJBA 3RI5A 3VRBA 4RPYA 4X0BA 5FMNA 4AIUA 3ZLIA 2LHRA 2VQET 3CWZB 5J0OA 8ICZA 5LXTE 4UV9B 2A72A 4X66T 2CXDA 3EAMA 2WWUA 4RQ5A 4A5XA 5AQOB 4E80A 1KF6A 3RIFA 5ABGA 4ZEYA 5LJNA 2WU5A 1L0VA 4EZ4A 3MCRA 4XRHA 5IINA 2RA1A 1HF8A 4F5OA 5HC9A 4F5QA 1XSPA 5HEHA 4UB2A 5FXWA 5ABFB 2XQ8A 4PAGA 3RYCE 1UX4A 4UR9A 2DWGA 4QXCB 4KP3C 1ZQRA 4TV9E 3UPSA 3AE2A 3IA3A 2XAHB 4Z6FA 3A7MA 3ZEFB 3L09A 3F2EA 2UXNB 2OA5A 4ZZBA 1H7CA 2YOEA 5DQVA 5CFTA 2K48A 2W0GA 5J2CA 2Q9QA 4RQ1A 3UU5A 2V6YA 4GKJT 4U2YA 3P4SA 4QH5A 3MGHA 3EDUA 5EZYE 5FXVA 3P4PA 3ERCC 4NXTA 3UFEA 3TLWA 3EDVA 4M0AA 2LKHA 4M1PA 4QZIA 3FZFB 4IQVA 1LRZA 3RRCA 2KZ7B 3P4QA 4QX8B 2XJ7A 4WC2A 3E0ZA 2JQ9A 2IHR1 3Q5XA 1BPZA 2VK9A 4I55E 4AKHA 4UB5A 2PFQA 5IIMA 5LG4A 5IHYA 4YFSA 4DV5T 4GYSA 2E9XD 1KEYA 4DV1T 1XNRT 1BR4A 3H39A 3C5FA 2WDQA 1ZV4X 2M2VA 3CMLA 1HX1B 4P0AA 1KEJA 3OYXA 3DP7A 4KLLA 3C4XA 2M2WA 5CA1E 3I9YA 2D5UA 2NWBA 2YDSA 4I2GA 2X66A 5JRCA 3KV6A 3ZJ2A 5CA7A 5J0SA 2B1EA 1FMVA 3FHNA 3AEBA 4YTMA 4X4OA 4WBYA 4K9AA 1HG5A 2BCRA 2M67A 3T1HT 1BR2A 1ZQBA 4ISSA 5J2IA 2B76A 5AQNB 4YMMA 3NYBA 4AISA 7ICTA 2BS3A 2WP9A 2M6IA 4U33A 4P1NA 4O4IE 2HN1A 1VCTA 2JQQA 3TFRA 5J1GA 4LF9T 4H9SE 4C90A 1M7KA 4ZOLE 5EK2A 4AT9A 3L3PA 2W62A 1FEWA 4EEDA 2BCQA 3ETVA 2X0LB 1OEDE 2FUPA 2Y8DA 2LSIA 4N78D 3JC6D 4UB3A 4M2YA 2LJLA 4ZXLA 2KT9A 4U72A 3RLFF 3UQ4A 4M5DA 1YLQA 4HWDA 2E5VA 4X4NA 4RQ6A 2QYWA 3H38A 4KBMB 4YSXA 5AQSB 4GXJA 2BS4A 3EUHA 5F2VO 1Y64B 4K98A 5CP2A 4O5EA 1LKXA 2KWHA 3RKGA 3FB2A 4ANJA 2DRAA 3AXJB 3HJ4A 3JPTA 5DBCA 2CEAA 4DV0T 4O68A 5AQKB 3OTOT 3ZMVB 4RQ2A 3QC9A 4QXBB 4YD1A 5CB1A 1KK7A 3F31A 2CWOA 3AE5A 3VR9A 4I50E 2VVSA 3ONXA 3EI0A 4QZEA 1J5WA 3N9QA 4E7XA 2RP4A 3MK7C 3RF1A 3RC3A 4DV6T 5JDGA 4KHZF 4I4TE 2W2UA 9ICMA 3IEEA 4WYVA 3N2KE 5KDMC 3C66A 4FJOA 5KMGP 2CBIA 3OPCA 2IW5B 3UXOA 3VKGA 4UELA 3AA7B 1R8AA 3AU2A 3FXDB 5CR0A 3ZMSB 4X5VA 2WWVA 1N32T 5C2TA 4R64A 4H9QC 2ZM2A 1AJ3A 1W0BA 4K4GA 2AE9A 3FZMB 4IREA 2A2FX 2EHOD 4ZI2C 4CN1A 2OLTA 5JR9A 2PFPA 3AA6B 3JZ0A 4QZFA 4F6RC 4AQYT 1XMOT 3R84B 2PBEA 3V7LA 3PDYA 1ZQYA 3UQ0A 2G0UA 2LOSA 2ACZA 4FH3A 4RWNA 1NOMA 2JIWA 4CI1B 2FJDA 4JI1T 1ZQEA 2W00A 2W4XA 3CK6A 1NWMX 2WQYA 2BKOA 2DHRA 1V4AA 4COFA 2I0MA 2VKDA 2LT3A 2BG9E 4GYRA 3N9MA 8ICYA 4FO6A 1WCRA 9ICTA 3Q9DA 1GPJA 3P7IA 4LFBT 1BPXA 5HRKA 4ZZCA 1WYBA 5JQGE 1R8CA 5CWRA 3JAEA 4JWNA 3CKDA 3UU3A 2VB6A 3AA0B 4EOZB 4K4HA 1N33T 1XDPA 4LEYA 4O4JE 4X4UA 4TNWA 2Q66A 3TLSA 3JPNA 1QSDA 3Q2MA 3OGUA 2B51A 1Z0PA 3ZMTB 7ICIA 2IAKA 5H6RB 2FMSA 5FP3A 4WZXA 2WCAA 3NRYA 1HUZA 5DBBA 1US7B 4IT4A 3OVBA 4TNVA 2Q9QC 3PUSA 1MNEA 5J0YA 1U4QA 4QH4A 4G2AA 3B57A 4KMCA 2BG9C 1ZQKA 1VRBA 3K1SA 2BPFA 3WFPA 1BR0A 3AEDA 2GK9A 8ICBA 3S4UA 5L3EB 2ACXA 1MMNA 3LBXA 4MKPA 4YT0A 4NM1A 1VOMA 4UB1A 3C5GA 1IZNB 4TWDA 4QZ9A 5HRGA 5J0TA 4K0KT 3FZHB 4YTNA 9ICKA 4X1IE 5D4BA 4FI5A 4QZHA 1D1AA 4YMOA 3WFOA 1MMAA 3UULA 3WAKA 1ZQIA 5CFBA 4DBQA 3RJIA 2E5LT 2DR9A 1BPYA 4N7RA 4IL9A 3HKEE 4HX0A 1I6ZA 3RH4A 4PJLA 2WZIA 3HJ1A 2M6BA 1UEUA 4NXUA 3O9XA 3BK9A 4M9HA 1BPBA 2L3LA 4TUSA 2D9DA 3FBLA 3N5LA 3AUOA 4NUUA 3HIYA 4UVCB 2WDVA 3VRAA 4GKKT 2JQHA 5HRIA 5J0XA 2Q9QB 2V6YB 2XAJB 3RYFE 3TFSA 4JI8T 3QB5K 2PTFA 3RKOA 5LNKA 2PFNA 4HWIB 2C5KT 3C2KA 4KX6A 4TUYE 2YU1A 3UFGA 4DO9A 4LZGA 4X65T 4RQ4A 8ICJA 7ICRA 2DR5A 4KLEA 2I9GA 4I2DA 1G73A 1ZHCA 4DR3T 4RWPA 5HYAA 2XQAA 2LEHA 2WS3A 5FKYA 5J2GA 4X4PA 4YJ2E 4Z6EA 1LVFA 4JI2T 1I94T 4NXZA 3PJAA 5L3DB 5DBAA 3C4WA 3C64A 7ICEA 4KB6A 4O67A 3KV4A 1HX8A 3OBVE 3UPQA 2YK0A 1WLXA 1LVKA 5FYMA 5DABA 3BQIA 5HCJA 3O4XE 3NBXX 5JRCB 1XNQT 1MQ3A 3WI3A 1R8BA 4NLZA 2X0HA 4YCXA 3UUNA 3P50A 4UEMA 5L3FB 9ICNA 4KLMA 3NZQA 5J2FA 1ZQSA 5J0RA 4JI4T 2YU2A 2CXLA 4ERRA 3VKHA 2LHNA 4EV6A 4JYAT 4AT9B 1X9BA 5J2BA 5JR9C 1ZQCA 1Q79A 5LMUT 4DR6T 2DRBA 2NOXA 4AQFC 4X0AA 3HR0A 4I2FA 3JPQA 2PFOA 3RH6A 5CFSA 2V7IA 2VKJA 5HR9A 5IILA 4AXPA 4IHJE 4UD5A 4PGYA 4HWHA 1MIWA 1XMQT 1QUUA 5CHGA 4IG8A 3FZKB 1KNYA 3JPOA 1HR0T 4MFCA 3PTRB 5M4YA 1IBLT 2L9QA 4LZDA 4AQGA 3MZKB 1OEDA 3RQWA 5HXSA 8ICCA 3OJAA 4QX7B 2HPJA 2V7LA 4QZCA 4UAWA 4QKNA 2ZHBA 5CHEA 1J1JA 5JTGA 5H6QB 5LGNB 1IJ5A 4K97A 3C2LA 4M47A 4YY3T 3PU8A 1XSNA 5DB9A 5L3GB 2YINA 4DOBA 4ATBA 2ZM6T 4MFAA 1JNZA 4WW0A 3C50A 1TVAA 4TWHA 4U3CA 3PMNA 4QZGA 3CIRA 3I0OA 5DB7A 3IHRA 4R66A 3H37A 3PUZF 1OWAA 1IBMT 5BOLA 4LEVA 4ZS3A 5AQLB 2CM0A 1TFYA 2FJEA 2HHPA 4EBKA 2X9XA 1WFDA 2XTLA 4HEAA 7ICKA 5HEUA 4IDQA 5JR9B 2YDQA 3TLUA 3HWTA 4X4VA 3EF2A 4A98A 4DNDA 2WBLA 2VVNA 4U7YA 2P9BA 2CE7A 2W9MA 2H7VC 2GAFD 5HAXA 8ICPA 3ZYLA 3V72A 2NP9A 4BJNA 4NLKA 5HRBA 1BR1A 3PUQA 2UXBT 3K75D 3AU6A 4L9IA 1ZQHA 4ILCA 3X1DA 2XM1A 4XAXB 4RWOA 4DUZT 4O2AE 1YXRA 2ODUA 5EK3A 4K99A 3MBYA 4JUYA 2UXCT 5D62A 4LMJA 4LF4T 3J9X1 4WBNE 4CXWA 2WMNA 3EABA 5F5WA 4CQIA 3MKDA 2BG9A 1WR6A 1MNDA 3A8YC 4HFBA 4X4QA 4UVAB 2BKPA 3ZCIA 4F5NA 3K7DA 3I1AA 5JVDE 2H88A 9ICHA 3AEGA 4GIWA 2DNXA 1HFAA 2BCUA 1OU5A 3RJEA 3UXPA 4YSYA 3LQCB 4I27A 2ES0A 5IIIA 4B3ST 3SRZA 2X9WA 4AKLA 2VQFT 5TAOA 4UAZA 3TLTA 2XQYA 5AFUL 2CXFA 4KLTA 4NXNT 4HFDA 8ICHA 1YQ4A 3BQKA 3N9NA 5D46A 5CJ7A 3E22E 3NVOA 3RJGA 4P2HA 2BCVA 7ICVA 9ICSA 4PPXA 2HN2A 2XUEA 3AQKA 4H63H 1SE7A 4PFOA 4WOYA 2KNDA 4HWCA 3UTKA 4NXWA 2BKNA 4CN6A 7ICMA 2C5JA 3LBXB 1WYCA 1YKHB 3MDAA 9ICRA 2E9XC 4EIWA 2XY8B 4UBBA 9ICXA 2V5CA 9ICCA 5LB7B 5BR8T 5AQJB 3LK2B 4QZDA 2CMRA 5BOMA 4DV7T 2VWAA 4JEHB 3RYIE 2DCFA 5J0UA 3WFQE 4UBCA 1ZQPA 5HXCA 4KLUA 4YHHT 1JAJA 4RQ7A 2ZH7A 2UXXB 2FBWA 3RQUA 2CA5A 2MPKA 3OWGA 1ZQLA 5HRHA 2W63A 3ZKRA 4AI6A 2V7JA 4QHOA 3LK3B 2L8KA 4JV5T 4DVDA 1BPDA 3N9PA 4QWNB 2XPKA 3C18A 3UUBA 3AVRA 2VKOA 4FHXA 4EB6E 4HGAA 2V8SV 8ICUA 2PJQA
chains in the Genus database with same CATH topology
4EEDA 2HN2A 3JCFA 3NWIA 4EV6A 2IUBA 2BBJA 4EGWA 3RKGA 5JTGA 3CK6A 4I0UA 4EEBA 2HN1A 3NVOA 2BBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EED A;  2HN2 A;  3JCF A;  3NWI A;  4EV6 A;  2IUB A;  2BBJ A;  4EGW A;  3RKG A;  5JTG A;  3CK6 A;  4I0U A;  4EEB A;  2HN1 A;  3NVO A;  2BBH A; 
#chains in the Genus database with same CATH topology
 2PBI A;  3PUW F;  3ZMZ B;  2O1P A;  1N34 T;  3JC6 C;  4R65 A;  3AE4 A;  2J4G A;  2SPC A;  3PJA J;  2X9Y A;  1QLB A;  5HEO A;  2X51 A;  3CPZ A;  4WC4 A;  4ZI3 C;  4NIQ A;  3ZYM A;  3QK6 A;  1G8X A;  4QZB A;  1OED C;  2RFF A;  5IUX A;  5LHI B;  4PGX A;  5FL1 A;  4L0R A;  3O1H A;  2FJB A;  5C3J A;  2NTY A;  2K5B B;  4ZI2 D;  4M04 A;  2X68 A;  1YW0 A;  7ICS A;  1CHU A;  4H9R C;  4ILB A;  3ZSS A;  2OV9 A;  4IDZ A;  4YHJ A;  3L39 A;  5AQT B;  5JDN A;  5IIK A;  1ZOY A;  2UUA T;  4KLG A;  1ZQU A;  1XZY A;  4OYK A;  4IDN A;  2BBH A;  4UB4 A;  2M2T A;  2V6X A;  5HHI A;  2N2N A;  3N2G E;  2YKS A;  5IIO A;  2Z6E A;  4AQF A;  3M65 A;  1W9R A;  2KIN B;  3N9L A;  3T1Y T;  3U3I A;  4DOA A;  4DR5 T;  3B5M A;  4DR1 T;  2IHO A;  4IDP A;  3RJH A;  4Z90 A;  2LSJ A;  3UUM A;  3WFS C;  3CX7 B;  4HN9 A;  2BPC A;  2XAF B;  7ICP A;  2LOP A;  4XQ7 A;  3ANW A;  7ICG A;  3RC8 A;  2HH7 A;  4TN7 B;  2X67 A;  2LRK A;  3UQ7 A;  4PHP A;  3MA9 A;  4PK4 A;  4NM2 A;  4OFZ A;  5DB6 A;  4RPX A;  2EHO C;  8ICG A;  5LBM A;  3QNU A;  4IE5 A;  4WQL A;  2FMQ A;  4O5K A;  4DO0 A;  3OYZ A;  1W09 A;  4YXD A;  5LJM A;  4TUP A;  1D1B A;  2W66 A;  2BDE A;  2GWS A;  4Q25 A;  1YD8 G;  3FBZ A;  3PML A;  5J2J A;  3RH5 A;  1MIV A;  9ICB A;  1ZQA A;  2DR7 A;  5B3Q A;  4P09 A;  2ZH4 A;  2Q9Q D;  1WR0 A;  3UU8 A;  4YN4 A;  9ICV A;  1XDO A;  1KDH A;  4B3M T;  4TUR A;  8ICT A;  1OED B;  4ILA A;  3ESL A;  4WC3 A;  3I0Q A;  4R63 A;  3AE8 A;  3TKL B;  4MHC A;  4O8S A;  4X4R A;  1HG2 A;  2BE3 A;  5J0Q A;  1B7T A;  4B3R T;  3HX0 A;  2DVI A;  4DOC A;  5AQP B;  3RJK A;  3QUJ A;  5DEC A;  2HPL A;  2J47 A;  1HNZ T;  2YDR A;  2F4V T;  5KXJ A;  4ATB B;  4UD4 A;  5HEJ A;  4X4T A;  2D0T A;  2WB5 A;  4YJ3 E;  4UV8 B;  3CX8 B;  7ICJ A;  3ZCJ A;  3VU7 H;  4OAF A;  4JLE A;  4O9M A;  4XQ8 A;  1VFG A;  2YEV C;  1D1C A;  5HRE A;  4IE4 A;  5JDF A;  4WBZ A;  2O5A A;  3ZJ1 A;  4CI3 B;  3RYH E;  3OVS A;  5HWX A;  5J2T E;  4LMK A;  1HCI A;  3RPU A;  3AE6 A;  2Y48 B;  5DDM A;  1ZQQ A;  1VJ7 A;  3NKZ A;  5CB4 E;  5L2L A;  3CVR A;  3CQG B;  5L3C B;  8ICM A;  1T8B A;  3ONL C;  4NLN A;  1E2A A;  4H63 V;  1W0A A;  1T98 A;  2LSY A;  4JLZ A;  5B3P A;  4M9J A;  1KNZ A;  1Z8U A;  3PUA A;  2CWY A;  4RT3 A;  3P4R A;  4K8V A;  4LT6 A;  3NKU A;  4EXT A;  3AB3 B;  4EP7 A;  3RH3 A;  4I2H A;  5DJQ C;  2XAS B;  1ZKE A;  5BPC A;  4I2E A;  4V1A v;  4A56 A;  1ZQW A;  3IF8 B;  3RRW A;  3QB5 A;  4WC7 A;  4DR7 T;  2ZH3 A;  1CUN A;  4LF5 T;  3PUY F;  3N2O A;  5L4H A;  2BG9 B;  4Z8X A;  5J2H A;  2H89 A;  5HCM A;  3UQ2 A;  2RPA A;  1N36 T;  3O1I A;  2BVL A;  2IHM A;  4PJM A;  2NW7 A;  1ZQG A;  4I2J A;  2JQK A;  4O4H E;  2C5I T;  3PU3 A;  3B0X A;  4K4I A;  2XAG B;  2QRX A;  4U74 A;  5AQR B;  4DV2 T;  5FVK A;  4JBW F;  4AKG A;  4DMV A;  2E9X A;  5D49 A;  3AAE B;  3Q5W A;  4RQ3 A;  4JLX A;  1ZJN A;  3SFE A;  2KMF A;  4M9N A;  3JPS A;  3HL6 A;  3ZT7 A;  2UUC T;  2CCQ A;  3V5U A;  2VUR A;  2WY2 A;  4K9B A;  2ISP A;  4YSZ A;  1D0X A;  2BBJ A;  8ICF A;  2IDO B;  4AT7 A;  4I28 A;  5LOV E;  5JH7 E;  3OVA A;  3KBU A;  4JI6 T;  1FJG T;  1FMW A;  3RX6 A;  3RHW A;  4HTE A;  7ICQ A;  4KLQ A;  4K0U A;  4F5P A;  4I43 B;  4DID B;  4I2B A;  4UF0 A;  2PG8 A;  3AE1 A;  5J0Z A;  9ICI A;  3PV0 F;  3LFM A;  4WNK A;  4DMW A;  4OAH A;  3AEE A;  3KBT A;  4K96 A;  5AQF B;  4TWF A;  1IAP A;  4EGW A;  7ICU A;  4I2A A;  4XA5 A;  4KLD A;  4LF7 T;  4GXK A;  8ICO A;  3AEF A;  3SS1 A;  2DL1 A;  5DED A;  3K8P C;  4EBJ A;  1Q78 A;  3JCF A;  4O4L E;  1KNP A;  5FY1 A;  3KFW X;  4IQT A;  2JRK A;  3JPR A;  2A9U A;  3ZYK A;  1UK5 A;  3H3A A;  3JPP A;  1MQ2 A;  2EWR A;  2WAU A;  1WRD A;  1ZQF A;  2NR4 A;  1FA0 A;  4OHF A;  4IL4 A;  2XHE B;  2UU9 T;  3NRX A;  4WC6 A;  2CHO A;  3C98 B;  4UVB B;  4FHV A;  2WU2 A;  5BMV E;  4NPP A;  5J2E A;  3PNC A;  4XZC A;  5HRF A;  5TZV A;  5ADX L;  5HHH A;  2H3R A;  3P4W A;  4QZA A;  4YTP A;  2ISO A;  3WAJ A;  3ISC A;  5FY0 A;  3PUR A;  4PH5 A;  4EEB A;  1OXZ A;  3ABV A;  7ICH A;  3R6N A;  1JN3 A;  4HE8 A;  3MXZ A;  1SHZ C;  2CPT A;  5IIJ A;  2XM2 A;  5AQU B;  3CQX C;  4MFR A;  3EHZ A;  3JYY A;  4HFH A;  2JMK A;  5DKW A;  1Y01 A;  2IIU A;  1YQ3 A;  4E7S A;  2KWI B;  3FZL B;  3U78 A;  2EHO A;  2BPG A;  3PUX F;  3HKD E;  2QGS A;  5J2K A;  3C51 A;  3ONJ A;  1MMG A;  4UIG A;  3G06 A;  1NEK A;  2MTQ A;  3UXN A;  2K9A A;  2MBG A;  2PXI A;  3RIU C;  2I6H A;  3ANW B;  2ZH9 A;  3KVA A;  4IE0 A;  2JMH A;  2CBJ A;  2ID1 A;  3C2M A;  4KHP T;  3CX6 B;  2QA7 A;  9ICE A;  9ICP A;  1UGO A;  2HHH T;  3EVY A;  2ZH8 A;  3ZST A;  5J2D A;  3HI2 A;  1RZT A;  2ZM0 A;  3LG7 A;  1F5A A;  4U31 A;  1V9D A;  3IBP A;  1XSL A;  1HNW T;  1HS7 A;  1MIY A;  3CQC B;  4E7Z A;  5AQV B;  5J0W A;  2ZH5 A;  1ZJM A;  4G63 A;  4PHA A;  2XQ7 A;  3ZT5 A;  4LF6 T;  4BA9 A;  5J29 A;  1ZQD A;  4CXY A;  4H9O C;  1UUR A;  1ZQJ A;  3WFR E;  2V1D B;  3GN5 A;  3LSV A;  3QOF A;  3L9D A;  4O2B E;  5FNV E;  4GOU A;  5J0P A;  8ICI A;  4PJN A;  4NXV A;  4F5R A;  4IGU A;  9ICQ A;  3ZT6 A;  3VHL A;  2XZE A;  4ILU A;  4X64 T;  7ICL A;  4WBO A;  4JI7 T;  3MGI A;  5JRE A;  5AQH B;  2UXD T;  5LHG B;  4IQW A;  5HWY A;  3AE9 A;  2LE8 A;  2JJ9 A;  1KFY A;  4I2I A;  4KI0 F;  3NWI A;  5AQG B;  3OVU A;  2YN6 A;  4YLH A;  3LDQ B;  9ICL A;  1UEV A;  2ZHA A;  2E2A A;  4IIJ E;  9ICF A;  1T7S A;  2BS2 A;  3GDX A;  1ZQT A;  4BAY B;  2D2S A;  2WSS V;  4P4P A;  4PGQ A;  3V7K A;  4PHD A;  2NW8 A;  4I2C A;  3KV9 A;  1RPL A;  1XWM A;  4Z6C A;  4PHE A;  8ICL A;  2KXP B;  3AAI A;  4FHY A;  3B0Y A;  4OYJ A;  4QXH B;  5A1L A;  4CXX A;  4X62 T;  4OX9 T;  2LSG A;  2ZMA A;  2IML A;  1WOT A;  1UX5 A;  3AA1 B;  8ICE A;  4WC0 A;  4RT2 A;  4LEZ A;  2LLY A;  4X20 E;  4DV4 T;  4UXN B;  4MFF A;  5LA6 E;  4LFC T;  3Q5D A;  4MBQ A;  2XAQ B;  2DLR A;  4O5C A;  5FXZ A;  2MYS A;  3B13 A;  4U7I A;  4GK5 E;  4ZI3 D;  3RGL A;  2NW9 A;  4NY8 A;  1MMD A;  3AVS A;  5EK4 A;  4AT8 A;  2BVM A;  4GK0 E;  4GXI A;  2V5D A;  4KLS A;  9ICA A;  1IBK T;  4IE7 A;  3UT5 E;  2XSA A;  3KVB A;  3V7J A;  2FJA A;  4PJJ A;  1UUS A;  4JWM A;  3OUY A;  2KLQ A;  1GQE A;  2KSR A;  3KDS E;  5DQW A;  3SOL A;  4ADZ A;  2VAS A;  4Z6D A;  4YMN A;  5KX5 E;  3RIA A;  4RPZ A;  3OKQ A;  3ZN0 B;  2E9X B;  3MAC A;  3N9O A;  4TV8 E;  4DBR A;  4IQU A;  1E1H B;  2V26 A;  1EZ3 A;  2XQ6 A;  3PUV F;  2X0Y A;  5F3J A;  4HFI A;  2NTX A;  4OAI Z;  2DR8 A;  4M9L A;  2MAW A;  3ER8 C;  4UAY A;  4X1K E;  3RJJ A;  4MAL A;  4A97 A;  3JAD A;  2NRK A;  4XJE A;  3T8O A;  5LCY A;  4HFV A;  4HFC A;  3FXE B;  3L8R A;  4AT7 B;  3AEA A;  4CI2 B;  8ICK A;  4EYU A;  3MDC A;  4XUS A;  2P66 A;  1VCS A;  4IST A;  5LGU B;  4WC1 A;  1NO5 A;  5J2A A;  4UF0 B;  3A5X A;  4AKR B;  2PFV A;  5LG3 A;  4ZS2 A;  8ICW A;  3UUX B;  4IE6 A;  4KUM B;  5ABF A;  4CZZ B;  1HUO A;  2FCL A;  5IYZ E;  2X9H A;  4KLJ A;  4TZ4 C;  4EYY R;  1D0Y A;  5CGM A;  3LK4 2;  1X79 A;  4I0U A;  2W67 A;  3GA8 A;  1O3X A;  5ABE A;  2WZH A;  2AXD S;  2CRB A;  1KNR A;  1R8I A;  3M3Z B;  4NXX A;  5E0O A;  3ER9 B;  4S3N A;  2V7K A;  4XBF B;  4PNI A;  5HXH A;  1ZQZ A;  3V5S A;  4HWF A;  2WMO A;  3ISB A;  3I9W A;  2IUB A;  1T72 A;  1E7P A;  2VAN A;  2ZM8 A;  3JAF A;  4YD2 A;  4MF8 A;  4ASK A;  5AQI B;  3AQL A;  1D0Z A;  4C91 A;  2V7M A;  2BZB A;  2UUB T;  3PE0 A;  4BJM A;  3P8C D;  4RQ8 A;  2WM9 A;  9ICW A;  5J2U E;  1SA0 E;  4L5G A;  3ZC1 A;  5LYJ E;  3HA4 A;  5ETW A;  1JNR A;  1JMS A;  4WCW A;  4JI0 T;  2CHN A;  3BQL A;  2XQ4 A;  3SFD A;  4DUY T;  4FO1 A;  5CJ5 A;  4EAH A;  4JI5 T;  3UU6 A;  9ICG A;  3RIU A;  3PUG A;  2XSB A;  3KIN B;  1HNX T;  5GON E;  4OAG A;  5ABH A;  1PX5 A;  2ZH6 A;  2BCS A;  2XQ5 A;  7ICN A;  4KLH A;  1NAF A;  4HKA A;  4P0B A;  4JEU B;  3F57 A;  4TX5 A;  8ICV A;  4Z91 A;  1JQR A;  2EHO B;  5DB8 A;  4NKU A;  2LSK A;  3HW8 A;  2LM2 A;  3ISD A;  2D0U A;  5D63 A;  4WH5 A;  3MJX A;  2LKG A;  2N9D A;  5LGT B;  5FVL A;  4DV3 T;  4DR2 T;  2M2U A;  1ZEE A;  1ZQV A;  4ZI7 E;  4P4M A;  4IDO A;  1ZQX A;  4X4S A;  5C8Y E;  2ZLY A;  3RJF A;  2XQ9 A;  3O1J A;  5LHH B;  4JI3 T;  4FH5 A;  3HKB E;  4F8H A;  2DI4 A;  4O6A A;  4FHW A;  2ZH2 A;  2QVA A;  4KM5 A;  4P4O A;  3LJC A;  4B6X A;  3D0T A;  2K24 A;  3AE7 A;  2H7O A;  2A3D A;  3C4Z A;  4X5T A;  4LEW A;  4LVS A;  4B3T T;  4LFA T;  1S94 A;  2N1G A;  3AXJ A;  1YKE B;  2XQ3 A;  3SWH A;  4U2Z A;  2JPF A;  3VR8 A;  4H9P C;  5HXE A;  2CLY C;  3OV7 A;  3GN5 B;  3K3O A;  4PK5 A;  5D61 A;  2B4V A;  4NKT A;  3K3Q C;  4AKI A;  1TFW A;  9ICU A;  5HRD A;  4WQK A;  3ETU A;  9ICO A;  2ODV A;  2GA9 D;  4FHP A;  2FMP A;  5L3B B;  5F8P A;  3AEC A;  5JDH A;  2I59 A;  2K3W A;  8ICQ A;  3AQM A;  4H9N C;  5FXX A;  2VKH A;  4J2C A;  3GWH A;  4WC5 A;  2J1D G;  5FY7 A;  3ZN1 B;  2LRL A;  5HRL A;  4E8F A;  4ZHQ E;  1S35 A;  5CA0 E;  3PHZ A;  2J62 A;  5AQQ B;  4PK6 A;  2Y6X A;  3KV5 A;  2E8I A;  4KLO A;  4NUV A;  1R89 A;  4CN4 A;  8ICR A;  1NEN A;  1IJ6 A;  5DDY A;  1TV9 A;  8ICS A;  7ICF A;  8ICA A;  1ZP0 A;  1SUM B;  5AQM B;  5L47 A;  4EZH A;  4PW8 A;  4QZ8 A;  1UCU A;  3HKC E;  4RWQ A;  8ICX A;  3ZC0 A;  2LM9 A;  3AQN A;  4X1Y E;  1ZQO A;  3W15 B;  3AE3 A;  2R6G F;  3NZP A;  3H3M A;  5IWA T;  5JDM A;  5FL0 A;  4MLK A;  2MOZ A;  1U5P A;  4KLI A;  2CLY B;  3ZMU B;  5LMN T;  2VL8 A;  2DWK A;  4RQ0 A;  4DR4 T;  1ZQM A;  3TLV A;  3UU4 A;  8ICN A;  4QH1 A;  1FIO A;  4O69 A;  4AT8 B;  4MF2 A;  5L4E A;  1HTJ F;  3Q5E A;  5EOZ A;  2C0S A;  4OK0 A;  1J5E T;  1M62 A;  3AAA B;  2WDR A;  3DTO A;  1BPE A;  3LK9 A;  4HFE A;  5HEG A;  2VL0 A;  4I29 A;  2B56 A;  3OUY B;  4LF8 T;  1ZQN A;  1UET A;  7ICO A;  4PFP A;  3J7Y q;  3E08 A;  2ZH1 A;  9ICJ A;  5JDQ A;  3ZPO A;  4NXM T;  2IC6 A;  2IC9 A;  4LML A;  5CFU A;  4TUQ A;  4KLF A;  5LBQ B;  5JDL A;  1DU2 A;  4M9G A;  5HXR A;  2W61 A;  3GMI A;  5LP6 E;  3K3N A;  3DJB A;  3RI5 A;  3VRB A;  4RPY A;  4X0B A;  5FMN A;  4AIU A;  3ZLI A;  2LHR A;  2VQE T;  3CWZ B;  5J0O A;  8ICZ A;  5LXT E;  4UV9 B;  2A72 A;  4X66 T;  2CXD A;  3EAM A;  2WWU A;  4RQ5 A;  4A5X A;  5AQO B;  4E80 A;  1KF6 A;  3RIF A;  5ABG A;  4ZEY A;  5LJN A;  2WU5 A;  1L0V A;  4EZ4 A;  3MCR A;  4XRH A;  5IIN A;  2RA1 A;  1HF8 A;  4F5O A;  5HC9 A;  4F5Q A;  1XSP A;  5HEH A;  4UB2 A;  5FXW A;  5ABF B;  2XQ8 A;  4PAG A;  3RYC E;  1UX4 A;  4UR9 A;  2DWG A;  4QXC B;  4KP3 C;  1ZQR A;  4TV9 E;  3UPS A;  3AE2 A;  3IA3 A;  2XAH B;  4Z6F A;  3A7M A;  3ZEF B;  3L09 A;  3F2E A;  2UXN B;  2OA5 A;  4ZZB A;  1H7C A;  2YOE A;  5DQV A;  5CFT A;  2K48 A;  2W0G A;  5J2C A;  2Q9Q A;  4RQ1 A;  3UU5 A;  2V6Y A;  4GKJ T;  4U2Y A;  3P4S A;  4QH5 A;  3MGH A;  3EDU A;  5EZY E;  5FXV A;  3P4P A;  3ERC C;  4NXT A;  3UFE A;  3TLW A;  3EDV A;  4M0A A;  2LKH A;  4M1P A;  4QZI A;  3FZF B;  4IQV A;  1LRZ A;  3RRC A;  2KZ7 B;  3P4Q A;  4QX8 B;  2XJ7 A;  4WC2 A;  3E0Z A;  2JQ9 A;  2IHR 1;  3Q5X A;  1BPZ A;  2VK9 A;  4I55 E;  4AKH A;  4UB5 A;  2PFQ A;  5IIM A;  5LG4 A;  5IHY A;  4YFS A;  4DV5 T;  4GYS A;  2E9X D;  1KEY A;  4DV1 T;  1XNR T;  1BR4 A;  3H39 A;  3C5F A;  2WDQ A;  1ZV4 X;  2M2V A;  3CML A;  1HX1 B;  4P0A A;  1KEJ A;  3OYX A;  3DP7 A;  4KLL A;  3C4X A;  2M2W A;  5CA1 E;  3I9Y A;  2D5U A;  2NWB A;  2YDS A;  4I2G A;  2X66 A;  5JRC A;  3KV6 A;  3ZJ2 A;  5CA7 A;  5J0S A;  2B1E A;  1FMV A;  3FHN A;  3AEB A;  4YTM A;  4X4O A;  4WBY A;  4K9A A;  1HG5 A;  2BCR A;  2M67 A;  3T1H T;  1BR2 A;  1ZQB A;  4ISS A;  5J2I A;  2B76 A;  5AQN B;  4YMM A;  3NYB A;  4AIS A;  7ICT A;  2BS3 A;  2WP9 A;  2M6I A;  4U33 A;  4P1N A;  4O4I E;  2HN1 A;  1VCT A;  2JQQ A;  3TFR A;  5J1G A;  4LF9 T;  4H9S E;  4C90 A;  1M7K A;  4ZOL E;  5EK2 A;  4AT9 A;  3L3P A;  2W62 A;  1FEW A;  4EED A;  2BCQ A;  3ETV A;  2X0L B;  1OED E;  2FUP A;  2Y8D A;  2LSI A;  4N78 D;  3JC6 D;  4UB3 A;  4M2Y A;  2LJL A;  4ZXL A;  2KT9 A;  4U72 A;  3RLF F;  3UQ4 A;  4M5D A;  1YLQ A;  4HWD A;  2E5V A;  4X4N A;  4RQ6 A;  2QYW A;  3H38 A;  4KBM B;  4YSX A;  5AQS B;  4GXJ A;  2BS4 A;  3EUH A;  5F2V O;  1Y64 B;  4K98 A;  5CP2 A;  4O5E A;  1LKX A;  2KWH A;  3RKG A;  3FB2 A;  4ANJ A;  2DRA A;  3AXJ B;  3HJ4 A;  3JPT A;  5DBC A;  2CEA A;  4DV0 T;  4O68 A;  5AQK B;  3OTO T;  3ZMV B;  4RQ2 A;  3QC9 A;  4QXB B;  4YD1 A;  5CB1 A;  1KK7 A;  3F31 A;  2CWO A;  3AE5 A;  3VR9 A;  4I50 E;  2VVS A;  3ONX A;  3EI0 A;  4QZE A;  1J5W A;  3N9Q A;  4E7X A;  2RP4 A;  3MK7 C;  3RF1 A;  3RC3 A;  4DV6 T;  5JDG A;  4KHZ F;  4I4T E;  2W2U A;  9ICM A;  3IEE A;  4WYV A;  3N2K E;  5KDM C;  3C66 A;  4FJO A;  5KMG P;  2CBI A;  3OPC A;  2IW5 B;  3UXO A;  3VKG A;  4UEL A;  3AA7 B;  1R8A A;  3AU2 A;  3FXD B;  5CR0 A;  3ZMS B;  4X5V A;  2WWV A;  1N32 T;  5C2T A;  4R64 A;  4H9Q C;  2ZM2 A;  1AJ3 A;  1W0B A;  4K4G A;  2AE9 A;  3FZM B;  4IRE A;  2A2F X;  2EHO D;  4ZI2 C;  4CN1 A;  2OLT A;  5JR9 A;  2PFP A;  3AA6 B;  3JZ0 A;  4QZF A;  4F6R C;  4AQY T;  1XMO T;  3R84 B;  2PBE A;  3V7L A;  3PDY A;  1ZQY A;  3UQ0 A;  2G0U A;  2LOS A;  2ACZ A;  4FH3 A;  4RWN A;  1NOM A;  2JIW A;  4CI1 B;  2FJD A;  4JI1 T;  1ZQE A;  2W00 A;  2W4X A;  3CK6 A;  1NWM X;  2WQY A;  2BKO A;  2DHR A;  1V4A A;  4COF A;  2I0M A;  2VKD A;  2LT3 A;  2BG9 E;  4GYR A;  3N9M A;  8ICY A;  4FO6 A;  1WCR A;  9ICT A;  3Q9D A;  1GPJ A;  3P7I A;  4LFB T;  1BPX A;  5HRK A;  4ZZC A;  1WYB A;  5JQG E;  1R8C A;  5CWR A;  3JAE A;  4JWN A;  3CKD A;  3UU3 A;  2VB6 A;  3AA0 B;  4EOZ B;  4K4H A;  1N33 T;  1XDP A;  4LEY A;  4O4J E;  4X4U A;  4TNW A;  2Q66 A;  3TLS A;  3JPN A;  1QSD A;  3Q2M A;  3OGU A;  2B51 A;  1Z0P A;  3ZMT B;  7ICI A;  2IAK A;  5H6R B;  2FMS A;  5FP3 A;  4WZX A;  2WCA A;  3NRY A;  1HUZ A;  5DBB A;  1US7 B;  4IT4 A;  3OVB A;  4TNV A;  2Q9Q C;  3PUS A;  1MNE A;  5J0Y A;  1U4Q A;  4QH4 A;  4G2A A;  3B57 A;  4KMC A;  2BG9 C;  1ZQK A;  1VRB A;  3K1S A;  2BPF A;  3WFP A;  1BR0 A;  3AED A;  2GK9 A;  8ICB A;  3S4U A;  5L3E B;  2ACX A;  1MMN A;  3LBX A;  4MKP A;  4YT0 A;  4NM1 A;  1VOM A;  4UB1 A;  3C5G A;  1IZN B;  4TWD A;  4QZ9 A;  5HRG A;  5J0T A;  4K0K T;  3FZH B;  4YTN A;  9ICK A;  4X1I E;  5D4B A;  4FI5 A;  4QZH A;  1D1A A;  4YMO A;  3WFO A;  1MMA A;  3UUL A;  3WAK A;  1ZQI A;  5CFB A;  4DBQ A;  3RJI A;  2E5L T;  2DR9 A;  1BPY A;  4N7R A;  4IL9 A;  3HKE E;  4HX0 A;  1I6Z A;  3RH4 A;  4PJL A;  2WZI A;  3HJ1 A;  2M6B A;  1UEU A;  4NXU A;  3O9X A;  3BK9 A;  4M9H A;  1BPB A;  2L3L A;  4TUS A;  2D9D A;  3FBL A;  3N5L A;  3AUO A;  4NUU A;  3HIY A;  4UVC B;  2WDV A;  3VRA A;  4GKK T;  2JQH A;  5HRI A;  5J0X A;  2Q9Q B;  2V6Y B;  2XAJ B;  3RYF E;  3TFS A;  4JI8 T;  3QB5 K;  2PTF A;  3RKO A;  5LNK A;  2PFN A;  4HWI B;  2C5K T;  3C2K A;  4KX6 A;  4TUY E;  2YU1 A;  3UFG A;  4DO9 A;  4LZG A;  4X65 T;  4RQ4 A;  8ICJ A;  7ICR A;  2DR5 A;  4KLE A;  2I9G A;  4I2D A;  1G73 A;  1ZHC A;  4DR3 T;  4RWP A;  5HYA A;  2XQA A;  2LEH A;  2WS3 A;  5FKY A;  5J2G A;  4X4P A;  4YJ2 E;  4Z6E A;  1LVF A;  4JI2 T;  1I94 T;  4NXZ A;  3PJA A;  5L3D B;  5DBA A;  3C4W A;  3C64 A;  7ICE A;  4KB6 A;  4O67 A;  3KV4 A;  1HX8 A;  3OBV E;  3UPQ A;  2YK0 A;  1WLX A;  1LVK A;  5FYM A;  5DAB A;  3BQI A;  5HCJ A;  3O4X E;  3NBX X;  5JRC B;  1XNQ T;  1MQ3 A;  3WI3 A;  1R8B A;  4NLZ A;  2X0H A;  4YCX A;  3UUN A;  3P50 A;  4UEM A;  5L3F B;  9ICN A;  4KLM A;  3NZQ A;  5J2F A;  1ZQS A;  5J0R A;  4JI4 T;  2YU2 A;  2CXL A;  4ERR A;  3VKH A;  2LHN A;  4EV6 A;  4JYA T;  4AT9 B;  1X9B A;  5J2B A;  5JR9 C;  1ZQC A;  1Q79 A;  5LMU T;  4DR6 T;  2DRB A;  2NOX A;  4AQF C;  4X0A A;  3HR0 A;  4I2F A;  3JPQ A;  2PFO A;  3RH6 A;  5CFS A;  2V7I A;  2VKJ A;  5HR9 A;  5IIL A;  4AXP A;  4IHJ E;  4UD5 A;  4PGY A;  4HWH A;  1MIW A;  1XMQ T;  1QUU A;  5CHG A;  4IG8 A;  3FZK B;  1KNY A;  3JPO A;  1HR0 T;  4MFC A;  3PTR B;  5M4Y A;  1IBL T;  2L9Q A;  4LZD A;  4AQG A;  3MZK B;  1OED A;  3RQW A;  5HXS A;  8ICC A;  3OJA A;  4QX7 B;  2HPJ A;  2V7L A;  4QZC A;  4UAW A;  4QKN A;  2ZHB A;  5CHE A;  1J1J A;  5JTG A;  5H6Q B;  5LGN B;  1IJ5 A;  4K97 A;  3C2L A;  4M47 A;  4YY3 T;  3PU8 A;  1XSN A;  5DB9 A;  5L3G B;  2YIN A;  4DOB A;  4ATB A;  2ZM6 T;  4MFA A;  1JNZ A;  4WW0 A;  3C50 A;  1TVA A;  4TWH A;  4U3C A;  3PMN A;  4QZG A;  3CIR A;  3I0O A;  5DB7 A;  3IHR A;  4R66 A;  3H37 A;  3PUZ F;  1OWA A;  1IBM T;  5BOL A;  4LEV A;  4ZS3 A;  5AQL B;  2CM0 A;  1TFY A;  2FJE A;  2HHP A;  4EBK A;  2X9X A;  1WFD A;  2XTL A;  4HEA A;  7ICK A;  5HEU A;  4IDQ A;  5JR9 B;  2YDQ A;  3TLU A;  3HWT A;  4X4V A;  3EF2 A;  4A98 A;  4DND A;  2WBL A;  2VVN A;  4U7Y A;  2P9B A;  2CE7 A;  2W9M A;  2H7V C;  2GAF D;  5HAX A;  8ICP A;  3ZYL A;  3V72 A;  2NP9 A;  4BJN A;  4NLK A;  5HRB A;  1BR1 A;  3PUQ A;  2UXB T;  3K75 D;  3AU6 A;  4L9I A;  1ZQH A;  4ILC A;  3X1D A;  2XM1 A;  4XAX B;  4RWO A;  4DUZ T;  4O2A E;  1YXR A;  2ODU A;  5EK3 A;  4K99 A;  3MBY A;  4JUY A;  2UXC T;  5D62 A;  4LMJ A;  4LF4 T;  3J9X 1;  4WBN E;  4CXW A;  2WMN A;  3EAB A;  5F5W A;  4CQI A;  3MKD A;  2BG9 A;  1WR6 A;  1MND A;  3A8Y C;  4HFB A;  4X4Q A;  4UVA B;  2BKP A;  3ZCI A;  4F5N A;  3K7D A;  3I1A A;  5JVD E;  2H88 A;  9ICH A;  3AEG A;  4GIW A;  2DNX A;  1HFA A;  2BCU A;  1OU5 A;  3RJE A;  3UXP A;  4YSY A;  3LQC B;  4I27 A;  2ES0 A;  5III A;  4B3S T;  3SRZ A;  2X9W A;  4AKL A;  2VQF T;  5TAO A;  4UAZ A;  3TLT A;  2XQY A;  5AFU L;  2CXF A;  4KLT A;  4NXN T;  4HFD A;  8ICH A;  1YQ4 A;  3BQK A;  3N9N A;  5D46 A;  5CJ7 A;  3E22 E;  3NVO A;  3RJG A;  4P2H A;  2BCV A;  7ICV A;  9ICS A;  4PPX A;  2HN2 A;  2XUE A;  3AQK A;  4H63 H;  1SE7 A;  4PFO A;  4WOY A;  2KND A;  4HWC A;  3UTK A;  4NXW A;  2BKN A;  4CN6 A;  7ICM A;  2C5J A;  3LBX B;  1WYC A;  1YKH B;  3MDA A;  9ICR A;  2E9X C;  4EIW A;  2XY8 B;  4UBB A;  9ICX A;  2V5C A;  9ICC A;  5LB7 B;  5BR8 T;  5AQJ B;  3LK2 B;  4QZD A;  2CMR A;  5BOM A;  4DV7 T;  2VWA A;  4JEH B;  3RYI E;  2DCF A;  5J0U A;  3WFQ E;  4UBC A;  1ZQP A;  5HXC A;  4KLU A;  4YHH T;  1JAJ A;  4RQ7 A;  2ZH7 A;  2UXX B;  2FBW A;  3RQU A;  2CA5 A;  2MPK A;  3OWG A;  1ZQL A;  5HRH A;  2W63 A;  3ZKR A;  4AI6 A;  2V7J A;  4QHO A;  3LK3 B;  2L8K A;  4JV5 T;  4DVD A;  1BPD A;  3N9P A;  4QWN B;  2XPK A;  3C18 A;  3UUB A;  3AVR A;  2VKO A;  4FHX A;  4EB6 E;  4HGA A;  2V8S V;  8ICU A;  2PJQ A; 
#chains in the Genus database with same CATH homology
 4EED A;  2HN2 A;  3JCF A;  3NWI A;  4EV6 A;  2IUB A;  2BBJ A;  4EGW A;  3RKG A;  5JTG A;  3CK6 A;  4I0U A;  4EEB A;  2HN1 A;  3NVO A;  2BBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...