4TUPA

Structure of human dna polymerase beta complexed with gg as the template (gg0b) in a 1-nucleotide gapped dna
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural Basis for the Inefficient Nucleotide Incorporation Opposite Cisplatin-DNA Lesion by Human DNA Polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 103
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4tupA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4tupA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4tupA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4tupA03
4DFPA 3MFHA 8ICMA 4FHWA 4QWDA 5HP4A 1R8AA 1MQ3A 1ZQUA 5J0OA 2ATLA 3AU2A 1RYSA 1KNYA 1N48A 3H39A 4DF4A 2BPFA 4IRCA 2ZH2A 1Z00B 1TAQA 4QZIA 4KLFA 4DQRA 2BCVA 5HRKA 2VA8A 4JK1A 5HMMA 3HX0A 3ISBA 5DG7A 5J0XA 3TFRA 1QLNA 3ETLA 3MGHA 3MDCA 2ZH1A 3ORYA 4PHEA 1NZPA 2NRXA 3Q8LA 9ICTA 2P66A 9ICAA 2R8IA 2UVUA 1BGXT 2AJQA 2C2EA 4MF2A 3GV8B 2J6TA 4DOBA 1BNOA 2ZUCA 1NK8A 5HREA 4Z6DA 5KT7A 1KTQA 5IIIA 4EP7A 4RWOA 4P4PA 4UBBA 1HJPA 4F5RA 5KTQA 3JPNA 3ZDDA 2O5AA 3JYYA 5KFQA 4NKTA 4KLMA 4K4HA 1C7YA 2MUTB 5L1JA 4X4PA 9ICVA 1U9LA 3WFPA 4QZ8A 4R63A 1MSWD 4PPXA 1K1SA 5IINA 4LVSA 5D49A 1BPDA 4YR2A 1K1QA 1T3NA 4YMMA 4FHYA 5J2IA 2DR8A 5DQIA 4RWQA 5HRGA 5BOMA 4WC0A 3MR2A 4WC5A 2FLLA 3PW2A 4MF8A 4WCWA 1TK5A 4C8KA 1U4BA 4YR3A 4BXOA 1JAJA 4J9KA 5L1IA 4XQ7A 4YD1A 3RBDA 3RBEA 3RJFA 9ICPA 4WC1A 4C8NA 4YVZA 2XC9A 3PX4A 1SKSA 2NRWA 2DPIA 3PY8A 1T8EA 3K75D 4Q44A 4RPZA 2O1PA 3OV7A 2JEIA 1TK0A 3OHBA 4R64A 2BCSA 2ZH7A 1X9SA 4P4MA 2BCUA 7ICPA 3AUOA 3G6VA 3HW8A 3PR5B 2UVWA 4YFKA 4KLGA 7ICGA 4AT7B 2AQ0A 4C8MA 3C2LA 3ISCA 3RH6A 4PGYA 1NK4A 1KFSA 4F5PA 3KTQA 3H4DA 2ISOA 4B9TA 4M6WA 4QWAA 8ICEA 2DR9A 2C2DA 8ICHA 5KT4A 3Q8RB 4X4QA 4UAZA 5L1KA 4J9MA 4B9VA 3C66A 2ZHBA 1WOTA 5F2VO 4NXZA 3OUYB 9ICXA 2I9GA 3RAQA 1S0NA 1NK6A 4YQWA 5KFGA 2BPGA 1TAUA 4LZGA 4O0IA 4BGDA 4KITB 1TFYA 3PNCA 2ZH3A 1VJ7A 2IA6A 9ICNA 2IHMA 9ICWA 2BPCA 1H38A 4IG8A 4XA5A 2LYHA 3MR5A 1XO1A 3M9NB 5J29A 3V7JA 3V6KA 1NK5A 1S97A 4R8UA 4Q8EA 1NO5A 3V7LA 4NLGA 3GIIA 4RQ7A 4EBCA 4M9JA 9ICGA 1UETA 4DOCA 1UT8A 4NM2A 1NJYA 4TURA 1UEVA 5DQHA 2BQ3A 1KDHA 7ICHA 3JPRA 3BQ2A 3QEAZ 1ZYQA 2BDPA 4Q8FA 2ZH5A 3M9OB 9ICQA 4YN4A 4X5VA 4ECSA 2A1JA 3JPSA 4RNOA 2ZUDA 4O3PA 4QWEA 1BPXA 4JV2A 5HRBA 2HHSA 4M9LA 1BNPA 1HUZA 4FH5A 4F8RA 4ED2A 4I2EA 2ISPA 9ICIA 4F5OA 2BGWA 5TZVA 1Z00A 3T3FA 1ZQDA 4DL3A 1S0VA 3NYBA 5J0WA 4GXKA 4J9NA 5IIOA 4NLNA 5IIJA 4NLZA 5D46A 3KHGA 3LDAA 4ECWA 1ZQMA 4NLKA 4YR0A 1XSPA 2ZTEA 2NRTA 4TQRA 5KFZA 5DLGA 5KFOA 3MFIA 3T5LA 4E0DA 4I28A 5DBAA 2KZ3A 2W9CB 1R89A 4I2IA 3WFOA 1DGSA 1L3VA 5DDYA 4ECZA 3IHQB 1ZQNA 2AGPA 4UD4A 3TAPA 1V4AA 3LK9A 2UVRA 4B9SA 4ELUA 4NY8A 2HW3A 5DB6A 3H40A 4EBJA 4ED8A 4B9NA 2DR7A 7ICMA 3FYHA 7ICTA 5CP2A 4R66A 5J0QA 2AGOA 3SV3A 4O3SA 2MUTA 5DLFA 4I27A 4RPXA 4MFFA 4DFKA 8ICQA 2HHPA 4M9GA 1TVAA 2J6SA 7ICUA 2DRAA 4MFAA 3G6YA 2PXIA 1ZQAA 4C8OA 4RNNA 3HP6A 2HHTA 1ZQXA 4KMUA 4PGQA 4KLTA 3RAXA 4X4OA 2W9MA 4QZAA 4I2AA 4F4ZA 4KLUA 2NRKA 5CB1A 3KHLA 1RPLA 4B9MA 4O3QA 5KT2A 3RB6A 4YD2A 1UA1A 2PFOA 3RR8A 4EEYA 3LWLA 4ECYA 1ZQQA 3C18A 4LT6A 1D9DA 3EPIA 3RR7A 5KFFA 3MGIA 1D8YA 4X4VA 4X4SA 2PFNA 7ICJA 3H7IA 2HHUA 2Q0ZX 2BR0A 9ICKA 4Q45A 3H37A 4WC4A 2B21A 4F4KA 1EXNA 8ICLA 5KFBA 1NK0A 1ZQVA 3RJJA 9ICMA 1ZQLA 4AT7A 5KFRA 4GC6A 5HHHA 4ECTA 2ALZA 4IQVA 3UXPA 4IQWA 7ICQA 1OU5A 4KLJA 2W9AA 3PW4A 2HHVA 1D9FA 3M8SA 5KT6A 4M47A 8ICPA 4F4XA 4KLOA 3V7KA 1NKBA 5J0YA 3PMLA 3FDSA 5KFTA 1TKDA 3RJHA 5HRLA 4B9UA 2RFFA 4NKUA 3AU6A 8ICOA 2M2TA 1RXWA 3OJUA 3OVAA 9ICBA 5KFLA 2W8LA 2KFZA 2FLPA 5BOLA 9ICCA 5HR9A 3GILA 2HVIA 4ATBA 3H4BA 2KN7A 1U48A 4AT8A 2C2RA 4NM1A 3OSNA 4BWJA 4DOAA 3TQ1A 2FMSA 4EBDA 4YP3A 4F5QA 1N56A 4DL5A 3RJGA 5HRFA 2BQRA 3BQ1A 3C2MA 1SKRA 4I29A 1UT5A 4UD5A 4DSLA 4I2JA 9ICEA 7ICVA 2DR5A 3OVBA 3EWAA 5J2KA 3MR3A 3SV4A 3V6JA 4QWCA 3PW5A 4FS2A 3TAQA 5KFPA 5J2JA 1ZJMA 1FA0A 4KTQA 5HRDA 4F5NA 1XC9A 4YCXA 3UPSA 1NJWA 4UB4A 3PMNA 4DO9A 2BCQA 1TFWA 2M9NA 5KFCA 8ICJA 5KT5A 4X0AA 4XQ8A 4ECXA 5EWEA 8ICWA 4ED1A 4EZ9A 2AGQA 7ICFA 1ZQYA 3G6XA 3RRGA 5DQGA 5DEDA 3H8JA 2BCRA 4J9QA 4DQSA 2ZJAA 3B0YA 4KLIA 3WFRE 5C5JA 4DL4A 2FPLA 4BWMA 4O5CA 4PHPA 4RNMA 2IMWP 3BJYA 4DFMA 1ZQCA 4QZDA 1ZQBA 2VA2A 7ICRA 4EBEA 3KHRA 5HMLA 4DF8A 3ZD9A 4J9OA 2JZBB 3Q8SB 2Y1JA 4KLSA 2W9CA 2H5XA 1JN3A 5J0TA 4I2FA 8ICGA 3Q8KA 9ICSA 1X9MA 4X4UA 5KFDA 2VANA 2M2VA 4X0BA 8ICUA 2KTQA 2RDIA 3C1ZA 5JUMA 8ICFA 3EW9A 4JV0A 3RB0A 1ZQIA 4P4OA 4RUCA 3ZDAA 2R8GA 3ZDCA 5J0SA 3LWMA 1VFGA 4FHXA 4EYHB 5DBCA 2V4QA 4G3IA 4ED7A 4ED3A 1BPBA 1B22A 4DS4A 4WC6A 5EWGA 1L3UA 4M9HA 1IM4A 1SL0A 5KFIA 4UB5A 2J6UA 5IIKA 7ICKA 1LB2B 7ICOA 3NTUA 3HT3A 4DS5A 4FHVA 3RRHA 2BKEA 4QZ9A 3GIMA 4GC7A 1ZQFA 1R8CA 4DQPA 2NRZA 3TARA 4GXJA 1X9WA 2I1QA 2R8HA 3OGUA 5CJ7A 4RQ3A 5KFVA 3MDAA 4DWIA 5DECA 2W9BB 3TANA 4ED6A 4AT9B 4MEYA 4RU9A 4LZDA 3T5KA 1ZQSA 3C23A 2XCAA 3RTVA 2ZHAA 1ZQEA 1U45A 3JPQA 2ZH6A 4FH3A 3PR4A 2JEGA 4O3RA 4GLXA 4F92B 3PW7A 5EWFA 2VA3A 1IXRA 2XGPA 1SKWA 3HJ4A 4QW8A 1NKEA 3PO5A 9ICRA 4DL2A 1V9PA 2M2WA 5J2HA 2WTFA 2ZH9A 3NGDA 2KZZA 5KG3A 3RJIA 3Q8MA 3V72A 4UBCA 4F93B 3PV8A 4X4TA 1ZQTA 1NK7A 1RZTA 1JMSA 1COOA 4F50A 3M9MB 3C2KA 3AQMA 5CWRA 3OVSA 1F5AA 4E8FA 1JXEA 5KFUA 4QZHA 5L1LA 5IIMA 1BVSA 1ZETA 1MQ2A 4XUSA 1PX5A 1JX4A 4TQSA 3MBYA 5DB7A 4UB3A 2F1JA 5J2GA 1S9FA 1BPEA 1QSSA 2JEJA 9ICLA 1L3SA 4I2CA 4Z6EA 4EZ6A 2P6UA 3JPOA 3K4GA 1U47A 4UAYA 4F3OA 4PH5A 5CR0A 1Q79A 3GV7B 1XWLA 5F9LA 4UB2A 1UA0A 1QTMA 4E80A 3EPGA 2DFLA 3QE9Y 3H3AA 5KFJA 4I2HA 7ICNA 2NRVA 4J9SA 1Z3EB 4J9PA 3RJKA 2HHWA 5DKWA 1RYRA 2KFNA 1TFRA 2OWOA 1NOMA 1ZQZA 3B0XA 5HRIA 4M5DA 3RH4A 2PI5A 3H38A 2A1JB 4IQUA 3GDXA 5J0UA 1WCLA 1KFDA 2AU0A 2IHNA 3PW0A 1XS9D 8ICBA 1MIVA 3H8SA 4IR1A 4K4GA 1S77D 9ICJA 2KP7A 4E7XA 1S0MA 4JWMA 4RUAA 4BDPA 5KFAA 3JPTA 2PBEA 3OUYA 5BPCA 4WBZA 4YXMA 5F9NA 4PHAA 2JZBA 1ZQHA 8ICTA 1YLQA 3HWTA 5KG4A 2ZUBA 3M8RA 1NJXA 1L3TA 1ZQOA 2XGQA 3UPQA 3SI8A 1MIYA 1Y88A 3N97B 3AQKA 9ICUA 3C1YA 5CA7A 1Q78A 4O3OA 4ECVA 2FPKA 4F2SA 4Z6CA 3MR6A 3C21A 3BDPA 3RJEA 5KG6A 3H8WA 4P2HA 3HJ1A 2PFQA 5CHGA 3ISDA 4EYIB 1BPYA 9ICOA 2BE3A 2ASJA 1D8LA 2ASLA 1JIHA 1SL1A 5KFMA 4J9RA 1ZQGA 4O3NA 5IILA 9ICHA 3GQCA 1PZNA 3KHHA 4RQ1A 4J9LA 3Q8PB 4WBYA 3AQLA 1DK3A 4F4YA 2ASDA 3E2EA 4IRKA 4K4IA 1NK9A 4ECUA 1JXLA 2KZMA 2HHXA 4IRDA 4KLEA 9ICFA 4YG2A 1R8BA 2ZJ5A 1ZQWA 3QEBZ 3HPOA 4JWNA 8ICZA 4ELVA 4M04A 4PHDA 3V6HA 5J0RA 3ZDEA 4UB1A 4UQGA 2AQ4A 1LV5A 1CEZA 1WCNA 4GXIA 3PX0A 7ICEA 4JUZA 4XRHA 4RT3A 4B9LA 2W9BA 1NKCA 2MAXA 1SL2A 1MC8A 4AT9A 4QZCA 2BHNA 4Q43A 4ED0A 4DSKA 4IQTA 4DFJA 1QSYA 1S76D 3IM1A 1MIWA 4DSFA 4DEZA 5L9XA 1T4GA 3TI0A 3C5GA 3ZD8A 4RQ5A 2XY5A 8ICAA 2UVVA 2DRBA 4JV1A 5HC9A 3BQ0A 4HYKA 2C22A 4DSJA 4O9MA 1XU4A 1KLNA 2HHQA 3WFQE 3UXOA 3QZ8A 4YMNA 4I2GA 1ZQPA 2FMPA 1ZQKA 1ZQRA 3OSPA 1HUOA 4QZEA 2F1HA 4DQIA 4X4RA 4QWBA 5KG0A 4YXJA 5KFNA 3T5JA 2XY7A 3JZ0A 4RQ4A 4DSEA 2XY6A 5DB8A 4FS1A 8ICCA 2IBKA 5DG8A 2ID1A 4DLGA 4RWNA 1KEJA 4QZFA 3L9DA 3T5HA 2ZH4A 2F1IA 4X4NA 5KG2A 5DB9A 2DVIA 1TK8A 4DL6A 4I2DA 1L5UA 8ICRA 4DQQA 5DGBA 3OHAA 2FLNA 3N4MB 4FHPA 2HVHA 4O5KA 4ATBB 3UQ0A 3RH5A 5J2DA 4PGXA 3OJSA 3EYZA 2BQUA 4AT8B 4RT2A 5KG5A 4EBKA 5KFWA 3PX6A 2V9WA 5DGAA 2DPJA 3GV5B 4KLHA 5DG9A 1XSLA 4BXOB 4C8LA 3BQTA 3C5FA 3MABA 2V4RA 3GIKA 5KFEA 4CCHA 3PO4A 4QZGA 2PFPA 2FPMA 1CUKA 4ZH4A 1ZJNA 4O5EA 1KFTA 2W8KA 1KSPA 4FO6A 4M0AA 5HHIA 3JPPA 7ICIA 3RB3A 4FBUA 4WC7A 4RQ8A 2RDJA 4RPYA 3WFSC 4RQ0A 1A76A 3Q8QB 4MEXA 4KLLA 5KFKA 4Z6FA 5KFHA 4QZBA 3UQ2A 5KT3A 3THVA 4KN7A 5KFYA 1TV9A 2PI4A 1QSLA 2P6RA 2ZTDA 2ZJ8A 4YMOA 1KRPA 1JQRA 4RWPA 4WC3A 4WC2A 5D4BA 4ELTA 2R8KA 4TUQA 5J2CA 1ZQJA 2Q66A 4M6WB 5KG1A 1AROP 3SYZA 8ICXA 3TFSA 5J2EA 1U49A 4DSIA 3GIJA 3ZDBA 1NJZA 2C28A 4F91B 4F2RA 4M9NA 8ICYA 4KLQA 4MFCA 5KG7A 8ICNA 4R65A 7ICLA 7ICSA 5DBBA 4UAWA 2FMQA 5J0PA 3RB4A 2R8JA 4KLDA 8ICKA 8ICSA 3AQNA 3LQCB 1BPZA 5KFSA 4TUSA 5J2FA 4KN4A 2XO7A 3EZ5A 2Y1IA 4FBTA 4M2YA 2ZH8A 3SZ2A 5KFXA 8ICIA 1A77A 1S10A 1DOQA 2M2UA 4S3NA 8ICVA 1X2IA 4R8UB 1T7PA 5HRHA 3UXNA 2ZTCA 1DK2A 1B43A 1RXVA 4I2BA 4QW9A 3GFKB 4ECQA 3QZ7A 4RQ6A 4RQ2A 2XCPA 3PVXA 2GWSA 5EOZA 5J2AA 4DL7A 1XSNA 1S0OA 4ECRA 1UEUA 5J2BA 1SZPA 4DLEA 4IR9A 4TUPA 3HIYA 2JEFA 4F4WA 5DDMA 4RZRA 5HNKA
chains in the Genus database with same CATH superfamily
3BS5B 2VJ5A 3QX7A 3H39A 4Y2VA 2BPFA 5KNIA 4LJXA 2VA8A 4JK1A 5J0XA 3TFRA 1QLNA 3ETLA 3WK8A 3Q8LA 2P66A 4US9A 2R8IA 2UVUA 5CRXA 3IRUA 2C2EA 2J6TA 4DOBA 5B3PA 4C4SA 1N62A 5KT7A 1KTQA 4RWOA 2F8LA 4UBBA 2OYYA 5EE9A 5KL8B 1U9LA 2EAMA 5IINA 4LVSA 4FHYA 2OHFA 4Y2TA 2ZIWB 3EUB2 4J9KA 3RJFA 9ICPA 4WC1A 4C8NA 2XC9A 1SKSA 4US8A 3QU7A 3K75D 1TK0A 2BCSA 2RLTA 3WKBA 7ICGA 4AT7B 3IDWA 2JMGA 2FI1A 1A6SA 3ISCA 1WYGA 2ISOA 3PHZA 2DR9A 4OO1J 4J9MA 2KE7A 5F2VO 3D2NA 3OUYB 3HILA 3RAQA 1S0NA 1NK6A 5KFGA 4IC9A 1ZRNA 3MGVA 4IG8A 5J29A 1NO5A 4R8UA 2VKQA 3IN5A 2XICA 4RQ7A 2QKQA 1UT8A 4NM2A 4OAGA 3QEAZ 3IP4B 3M9OB 4YN4A 2KNJA 1UQVA 3BS5A 3PSPA 1BNPA 4F8RA 4ED2A 4P0PB 1YT3A 4F5OA 2BGWA 1ZQDA 3T3FA 5IIJA 2LYBA 4ECWA 1FEZA 4NLKA 2ZTEA 3KOOA 4E0DA 3T5LA 4I28A 4O3MA 1V97A 2KZ3A 3QU5A 4JB3A 4A8EA 4USAA 4UD4A 3TAPA 1V4AA 2UVRA 2K4IA 3D2SA 5CFSA 2IOHA 3H40A 3DV9A 3WK7A 2DR7A 1HEKA 4O3SA 5J0QA 3SV3A 5B3QA 4MFFA 8ICQA 3CP8A 2HHPA 2J6SA 3G6YA 3F5EA 3HP6A 2EZYA 1ZQXA 4KLUA 4HAIA 5CB1A 3NASA 5KT2A 1UA1A 2PFOA 4YD2A 1L8OA 4O68A 4EEYA 4ECYA 2KK0A 5AKKA 3RR7A 4X4SA 7ICJA 3H7IA 2Q0ZX 4CNQA 1NK0A 1ZQVA 9ICMA 2YMLA 4AT7A 1OU5A 4KMOB 5KT6A 4M47A 4F4XA 1NKBA 3RJHA 1TAMA 5AM4A 8ICOA 1RXWA 2W8LA 4AP9A 2KFZA 3WK9A 1N56A 2PMZF 4UD5A 2DR5A 3OVBA 4OD0A 3SV4A 3V6JA 1FA0A 4F5NA 3PSTA 4YCXA 1D8BA 3RFAA 4CF5A 3C28A 3SD7A 4X0AA 4WOYA 1CRXA 5EWEA 4ED1A 4EZ9A 3G6XA 3RRGA 4KLIA 1Q3VA 2YB4A 5C5JA 2FPLA 4RNMA 1ZQCA 4Y2PA 3TACB 1RM6C 5HMLA 4DF8A 3ZD9A 4J9OA 3Q8SB 2A3VA 9ICSA 2KJ8A 3BZCA 1C20A 3C1ZA 2G07A 4FE3A 8ICFA 3EW9A 2GLEA 1ZQIA 2WAQC 4RUCA 3TADC 1VFGA 3LWMA 4FHXA 2WF8A 4I0UA 3KZXA 1BPBA 4KX3A 5KFIA 1DRGA 4UB5A 3N7RC 2DF4B 5H2FU 4QZ9A 1ZQFA 4DQPA 5AI6A 2DGZA 2I1QA 1N60A 4RQ3A 3MDAA 5DECA 1ZD4A 2W9BB 4ED6A 3RTVA 5ALGA 2K4EA 4O3RA 4GLXA 1X42A 2RQ5A 2XGPA 3PO5A 2G06A 2M2WA 2XVTA 4MHVA 2KZZA 4F93B 1ZQTA 3LYSA 5J8YA 3AQMA 1NNLA 5L1LA 1RDFA 1ZETA 4QJFB 5J2GA 2JEJA 5ALSA 3AEVA 2G0AA 3K4GA 4LEYA 5AIBA 4UAYA 5CR0A 5AK6A 4UAVA 3GV7B 5F9LA 3EPGA 2DFLA 5KFJA 7ICNA 4J9SA 2KFNA 2A1AA 2F44A 5HRIA 4M5DA 5AK4A 5JTGA 3F2DA 1F0MA 3NS1A 1VJ5A 5HR7A 3PW0A 1S77D 3GZFA 1ZD2P 2Z7JA 2R18A 5ALWA 4RUAA 3JPTA 1RG6A 1O03A 2CRXA 3HWTA 5KG4A 1NJXA 1ZQOA 4O69A 1L3TA 3AQFA 3UPQA 3SI8A 3OWGA 1Y88A 3B9JA 9ICUA 3C1YA 3CK6A 2NO5A 1LVHA 4ECVA 2E8NA 3KKAC 3C21A 4P2HA 3H8WA 2H3VA 2BE3A 1D8LA 1SL1A 4FZMA 3KHHA 3Q8PB 2ASDA 4K4IA 2KZMA 4IRDA 2W04A 1ZQWA 2RP5A 1L7PA 4UB1A 2AQ4A 1WCNA 4XRHA 4CF4A 4B9LA 2W7PA 1O08A 2W9BA 2MAXA 1SL2A 1MC8A 3SEIA 4KB6A 5JTIA 4ED0A 4WH5A 4IQTA 1K5OA 4DSFA 2HSZA 3C5GA 2XY5A 1Q46A 2UVVA 8ICAA 1J97A 2EZXA 4O9MA 2HHQA 1KLNA 3UXOA 4YMNA 1ZQPA 2FMPA 2QARB 1HUOA 4EELA 4X4RA 1TE2A 4QWBA 5ALPA 2XY6A 4RWNA 2ID1A 1KEJA 2F1IA 2Y0SC 4NJ8A 2HCFA 4QIWF 4I2DA 1L5UA 2G09A 3AL0B 5DGBA 2FLNA 4O5KA 4NLCA 3UQ0A 1HIWA 5J2DA 4PGXA 4WJ3B 4RT2A 4F71A 4EBKA 3PX6A 2ZIUB 4UB6U 5DG9A 3BQTA 2V4RA 5KFEA 4QZGA 1ZJNA 2EQYA 4F72A 1KSPA 2H3IA 2B0CA 4FBUA 2RDJA 2HBJA 3QU2A 4RQ0A 3Q8QB 4MEXA 4Z6FA 2E3TA 4KN7A 1TV9A 2HOIA 2JR5A 3L3FX 1ZQJA 8ICXA 3WKAA 2PKEA 1T3QA 7ICLA 4KM5A 4C0ZA 4UAWA 2R8JA 5J0PA 2YY6A 2LBOA 3RB4A 4KLDA 2ZH8A 1VDVA 2M2UA 8ICVA 1X2IA 5HRHA 2ZTCA 5AK3A 5ALTA 4I2BA 4QW9A 3PVXA 2E5SA 2XCPA 5J2AA 4DLEA 5DDMA 4RZRA 2IOFA 2ZHBA 8ICMA 4FHWA 1FFUA 1R8AA 1MQ3A 1ZQUA 1TAQA 4KLFA 3WKCA 3AM9A 4DQRA 5HRKA 3MGHA 3ORYA 4PHEA 1NZPA 9ICTA 1ZOLA 2HN1A 2RRDA 4MF2A 1BNOA 2ZUCA 4EP7A 4F5RA 5KFQA 4QZ8A 2YMPA 4R63A 1MSWD 4PPXA 5D49A 1K1QA 1T3NA 1SWVA 2K89A 5J2IA 2DR8A 4RWQA 2QB0B 2ZIUA 3QNMA 2FLLA 4MF8A 4K9BA 1U4BA 4YR3A 2JRZA 4YD1A 3RBEA 4YVZA 3PX4A 2DPIA 2NRWA 5ALRA 1SXDA 2O1PA 3F2BA 5HRFA 4P4MA 2BCUA 2ZH7A 3PR5B 2AQ0A 4KX5A 3RH6A 3JCFA 4PGYA 1NK4A 1KFSA 3KTQA 4B9TA 4Y2UA 3H4DA 4NLNA 4QWAA 8ICEA 1GO3F 2NO4A 8ICHA 3Q8RB 2NV3A 5B66U 4UAZA 4U6PA 1JALA 4NXZA 2I9GA 2W3SA 4LZGA 4O0IA 4BGDA 1TFYA 3N7PD 1FIQA 2IHMA 2BPCA 2F76X 4XA5A 3M9NB 3V6KA 1XO1A 2WF7A 3PZPA 2F2AB 2W3RA 3GIIA 4EBCA 4M9JA 3GU3A 4Y2QA 5ALEA 1MN8A 4C80A 1KDHA 1PUZA 4Q8FA 2BDPA 1KBUA 1JRPA 4X5VA 2A1JA 3JPSA 4RNOA 4QWEA 4JV2A 5HRBA 2HHSA 4M9LA 2G5IB 2LM1A 1SV0C 4GXKA 4B6JA 4J9NA 4NLZA 5D46A 3LDAA 2HBLA 4YR0A 1X40A 2YTUA 5KFZA 4K99A 1R89A 3CW2C 5DDYA 1B4FA 3IHQB 3RF9A 2HW3A 4EBJA 4B9NA 1WG8A 4UAUA 1NZBA 4M9GA 2DRAA 4MFAA 1ZQAA 3L4PA 2HN2A 4RNNA 5AIAA 2LMRA 4PGQA 4X4OA 2W9MA 4I2AA 4EGWA 4F4ZA 4O3QA 3C18A 1D8YA 2PFNA 4EEBA 2HHUA 2BR0A 1T94A 4Q45A 1ECWA 3F53A 4PL2A 3RJJA 3NRZA 1ZQLA 4ECTA 4IQVA 2W9AA 2HHVA 5AICA 2FDRA 8ICPA 4KLOA 5ALLA 5J0YA 2B56A 4B9UA 3AU6A 5ALYA 1X9XA 9ICCA 1ZD5A 2FLPA 1U48A 2XI9A 3OSNA 4YP3A 4DL5A 4J03A 3C2MA 1UT5A 1XNSA 4I2JA 3D2QA 1XC9A 1TFWA 3PMNA 8ICJA 3MCRA 7ICFA 1ZQYA 5DEDA 3TADA 2ZJAA 3B0YA 2IMWP 3BJYA 2VA2A 1ZXIA 4QZDA 1ZQBA 3U26A 1IG6A 3Q8KA 3K1RB 1X9MA 2W43A 4X0BA 2YMMA 1FO4A 5JUMA 4JV0A 4UARA 5TISU 4C7ZA 2R8GA 5AK5A 5J0SA 3ZDCA 4EYHB 4K96A 4ED3A 3SQIA 2E1EA 1L3UA 4M9HA 2YN4A 2OCEA 4Y2XA 3NTUA 2L5YA 4DS5A 2EH9A 1LKYB 2BKEA 3ER9B 1B0XA 3GIMA 2NRZA 3TARA 5AM0A 3FAHA 3OGUA 2W11A 3ER8C 4LZDA 5ALUA 2XCAA 2ZHAA 1ZQEA 3JPQA 2E8PA 2Y9UA 5L1MA 1PVPA 2JEGA 2DUYA 1Z4OA 5EWFA 3PW7A 2VA3A 4QW8A 5AKLA 1FFVA 1NKEA 9ICRA 4DL2A 3V72A 4UBCA 3NVOA 1QQ6A 2CXYA 4MKPA 2LHTA 1F5AA 4NL9C 1JXEA 1BVSA 5ALKA 1MQ2A 4XUSA 2ZIWA 1JX4A 2MU2A 4OCZA 4TQSA 1QQ5A 3MBYA 5DB7A 2GAFD 1QSSA 2Q4TA 4EZ6A 1U47A 1Q79A 4UB2A 4E80A 2OWOA 1ZQZA 3KKAA 2PI5A 5EE1A 1WCLA 1KFDA 3IG5A 2IHNA 8ICBA 3H8SA 4IR1A 4K4GA 9ICJA 4EEKA 3OUYA 5KFAA 1SIJA 4PHAA 1ZQHA 2YQEA 3M8RA 3UMBA 4CGZA 1MIYA 5G5GA 5KAIU 3AQKA 3MR6A 3BDPA 3NRWA 3HJ1A 5KG6A 4EENA 2ASJA 1KQQA 5KFMA 5IILA 1PZNA 3NVYA 4J9LA 3ED5A 4WQLA 1DK3A 4F4YA 1NK9A 2K8CB 4OJLA 9ICFA 3UMGA 3QEBZ 1S5LU 3HPOA 8ICZA 4ELVA 4GFJA 3M1YA 1LV5A 1CEZA 2KEYA 2JV3A 4P0PA 4RT3A 2JH7A 4EX7A 2LM4A 1MIWA 3A0BU 2KMDA 4DEZA 5L9XA 1T4GA 3TI0A 3ZD8A 2DRBA 4JV1A 3BQ0A 2KSOB 3SMVA 3UMCA 1QQ7A 4I2GA 4QZEA 4DQIA 3T5JA 2XY7A 3JZ0A 4RQ4A 4FS1A 8ICCA 2IBKA 5DG8A 3S6JA 4DLGA 2ZH4A 2QB1A 4X4NA 2XIDA 2DVIA 4DQQA 4ATBB 3CRXA 3RH5A 3LVWA 4AT8B 5AKYA 3GV5B 4KLHA 3ICXA 2LYAA 3PO4A 2HOQA 4O5EA 1CUKA 4ZH4A 2W8KA 4FO6A 3JPPA 1N5XA 4RPYA 2FJ6A 1A76A 4Y2SA 2B6GA 5KFKA 5KFHA 3UQ2A 2MRLA 3THVA 5HRGA 5KFYA 2P6RA 4C7YA 2R8KA 3AMZA 5D62A 3NVVA 5KG1A 1AROP 2YX8A 1UCVA 1YZ6A 1NJZA 4F91B 4NXXA 8ICYA 1Z4NA 3SENA 5KG7A 7ICSA 1KKXA 2LPEA 8ICKA 8ICSA 1BPZA 5KFSA 4TUSA 1X66A 1Z19A 1ED1A 8ICIA 1A77A 4S3NA 4NV0A 1T7PA 1DK2A 1B43A 5ALHA 1RXVA 2D3DA 4RQ6A 4DL7A 1S0OA 2EAOA 4F4WA 4KMUA 5HNKA 4DFPA 2GOLA 4QWDA 2WB1C 4NLBA 5J0OA 1DGJA 3AU2A 1N48A 4DF4A 2HDOA 4PZOA 4IRCA 1Z00B 4QZIA 2E8OA 2EWRA 2AXTU 5DG7A 3HX0A 2KSOA 2ZH1A 2ODGA 1BGXT 1IV8A 3GV8B 3IG8A 3ALRA 4Z6DA 5CFUA 3NVWA 5KTQA 3JYYA 1JUDA 4NKTA 4KLMA 1C7YA 3OTQA 2OH2A 9ICVA 2G08A 3WFPA 1K1SA 2F8KA 1BPDA 4YR2A 4WC0A 3HJEA 4WC5A 3PW2A 4WCWA 1M6YA 2AHOB 3RBDA 3E58A 5AI4A 2ES6A 3PY8A 3OV7A 2JEIA 2KV2A 4R64A 4NWIA 3G6VA 4KLGA 2HI0A 5GTIU 3C2LA 2C2DA 5L1KA 4EX6A 2I5HA 4B9VA 3C66A 2DL0A 2BPGA 1TAUA 4KITB 3J81j 3PNCA 4ICAA 2ZH3A 4FZLA 9ICWA 1H38A 1SV0A 4Q8EA 3V7LA 4NLGA 4DFDA 9ICGA 1NJYA 4TURA 2BQ3A 3QUTA 1ZYQA 2ZH5A 2VIXA 2ZUDA 1BPXA 3AQEA 2KD1A 1HUZA 4I2EA 9ICIA 1PVQA 3H8MA 5E79U 5TZVA 1Z00A 4DL3A 3NYBA 5IIOA 3KZIU 3KHGA 3D6JA 1Q3UA 1XSPA 4TQRA 4LEWA 5KFOA 5DLGA 3MFIA 5DBAA 4I2IA 1MA7A 4ECZA 2KHQA 2KIVA 1ZQNA 2CN1A 4B9SA 4PJ0U 4NY8A 4ED8A 7ICMA 3FYHA 5CP2A 2AGOA 1TVAA 2GA9D 4C8OA 2HHTA 3ETRA 3SAHA 3RAXA 2NRKA 3KHLA 1RPLA 4B9MA 3RB6A 5D63A 5FP0A 3RR8A 4LT6A 3LWLA 3EPIA 3MGIA 3FM9A 3H37A 2B21A 2O6KA 3QU9A 2BBHA 2QARA 5KFBA 5KFRA 7ICQA 5HHHA 2KJ5A 2D8CA 3FDSA 2EAPA 4IL6U 5KFTA 1TKDA 1L7OA 1SXEA 5KFLA 4PZNA 5T14A 5BOLA 5GTHU 3H4BA 2KN7A 2IHOA 2C2RA 4BWJA 2KKVA 3BQ1A 1SKRA 4I29A 4DSLA 2MA1A 2BZFA 7ICVA 1PK3A 5J2KA 1VLBA 3TAQA 5HRDA 1NJWA 2BCQA 4DCCA 5KT5A 4ECXA 8ICWA 2ZG6A 2F77X 3SAGA 2KIWA 3R9KA 1Z1BA 3H8JA 2BCRA 5AKXA 4DL4A 1S8OA 7ICRA 3KHRA 4O67A 2WAQF 5J0TA 4X4UA 2M2VA 3HKZC 8ICUA 2KTQA 2RDIA 3RB0A 2I6XA 4P4OA 4G3IA 4EV6A 5EWGA 7ICOA 5IIKA 3HT3A 3A0HU 4FHVA 3RRHA 2H3FA 4GC7A 4QNLA 4GXJA 2ZIVB 1X9WA 3DEEA 5CJ7A 4DWIA 2QLTA 4MEYA 1WUDA 1V85A 1Q8KA 5ALMA 3C23A 3QU4A 5KL1B 4C4RA 4NL9A 3PR4A 4U7CA 2KOBA 1SWWA 3HJ4A 3NKUA 1IXRA 1V9PA 5J2HA 2ZH9A 3NGDA 3RJIA 3PV8A 1A0PA 1NK7A 1RZTA 1JMSA 1COOA 4F50A 3M9MB 3C2KA 2QB0A 1X6IA 5KFUA 4QZHA 5AKJA 1XO0A 1PX5A 9ICLA 4OJ5A 1BPEA 3N7SC 5CFTA 4I2CA 1AQ6A 2P6UA 3JPOA 3UM9A 4P0QB 2WF9A 2ZIXB 4NXVA 3QE9Y 3H3AA 2MSNA 4I2HA 3EF2A 1Z3EB 4J9PA 2HHWA 5DKWA 2WB1F 3WK6A 2LI6A 1NOMA 3B0XA 3NWIA 4CE6A 5J0UA 2AU0A 1P7DA 1XS9D 4Y2JA 3QUCA 4E7XA 2F3NA 2KP7A 4BDPA 5BPCA 3WKDA 5F9NA 3ERCC 1YLQA 4X4TA 3MC1A 2ZUBA 3WK5A 3N97B 1Q78A 5CA7A 4Z6CA 3FC4A 5CHGA 4EEDA 3ISDA 2ASLA 1JIHA 3GQCA 3AQLA 4IRKA 2HBMA 4KLEA 1R8BA 2EDUA 4M04A 4PHDA 5J0RA 5AI0A 2Y9TA 2ZIVA 3BS7A 3PX0A 7ICEA 4JUZA 4JLZA 4NXTA 4QZCA 3NUQA 3PSFA 4DFJA 1QSYA 3IM1A 3M7DA 1JROA 2KG5A 4UB8U 3C29A 4RQ5A 5AKZA 2DBYA 2KJ9A 5HC9A 4HYKA 5G5HA 4DSJA 3WFQE 5CHEA 3QZ8A 1ZQKA 1L7MA 1ZQRA 4BX9C 2Y0SF 4YXJA 4K8VA 4DSEA 5DB8A 3QXGA 4ACOA 3L9DA 1ZRMA 3QYPA 5KG2A 1TK8A 4DL6A 3N28A 3OHAA 2W03A 2NYVA 3N4MB 4AYBC 2BQUA 4QIWC 5K4LA 5KG5A 5KFWA 2V9WA 2DPJA 3HRDD 1DXSA 4P0QA 2ZIXA 3WU2U 1GPJA 4BXOB 4OAHA 2D6FC 3MABA 3GIKA 4CCHA 1KFTA 4OAFA 2K4HA 4M0AA 3H0LB 5HHIA 7ICIA 3RB3A 4RQ8A 3WFSC 4KLLA 4QZBA 5KT3A 2W55A 2ZTDA 1KRPA 1JQRA 2IUBA 4WC2A 5D4BA 4TUQA 5J2CA 2Q66A 1UPHA 4M6WB 2DWQA 3SYZA 5ALZA 3TFSA 5J2EA 1U49A 4CF3A 3GIJA 4F2RA 5A0LA 2C28A 1J2MA 4KLQA 4FFDA 1N2XA 2FMQA 3AQNA 3LQCB 2A19A 4KN4A 5ALIA 3EZ5A 2Y1IA 4M2YA 3SZ2A 5KFXA 1J2NA 1DOQA 2K60A 2LKYA 2DQNB 2YMQA 1RQNA 3QZ7A 4RQ2A 2GWSA 5EOZA 1UEUA 1UHUA 4RQNA 1SZPA 5J2BA 4IR9A 4TUPA 4JLXA 1V38A 3MFHA 5HP4A 2ATLA 1RYSA 1KNYA 2ZH2A 3NVZA 3I1YA 2DKZA 2BCVA 3ISBA 5HMMA 3MDCA 3T79A 2NRXA 9ICAA 2AJQA 1F44A 1NK8A 1QH9A 4BJQA 5HREA 5IIIA 4P4PA 1HJPA 3ZDDA 3JPNA 2O5AA 4K4HA 5ALFA 2MUTB 5L1JA 4X4PA 5AHXA 2FE9A 1LKYA 2W54A 4YMMA 5EE3A 5DQIA 5BOMA 3MR2A 1QCKA 1TK5A 4C8KA 4BXOA 1JAJA 3KFUF 5L1IA 4XQ7A 1COKA 3SR6A 2E1FA 1T8EA 4Q44A 4RPZA 2K8AA 3OHBA 1X9SA 7ICPA 3AUOA 3HW8A 2UVWA 4YFKA 4UATA 1SV4A 4C8MA 4F5PA 2HBKA 4M6WA 1OXJA 4UW9A 5KT4A 2HOFA 4X4QA 3DDHA 1WOTA 3HKZF 9ICXA 2H3QA 4LEVA 4YQWA 1PK1B 3L5KA 1VJ7A 2OM6A 2IA6A 9ICNA 3V7JA 2EANA 2LYHA 5AM5A 3MR5A 1NK5A 1S97A 1UETA 4DOCA 3ONNA 1UEVA 5DQHA 7ICHA 4ZOHC 3JPRA 3BQ2A 9ICQA 3I28A 3O0FA 4ECSA 2ZH6A 4CRXA 4O3PA 1X6JA 4FH5A 4N7RA 2ISPA 1S0VA 2KVSA 5J0WA 5AI8A 1ZQMA 5ALVA 3WKEA 5D61A 2NRTA 5ALXA 1ZQ1C 3K7DA 2W9CB 3WFOA 1DGSA 1L3VA 2JHDA 2KKPA 2AGPA 3LK9A 4ELUA 2IOFK 5DB6A 7ICTA 4R66A 2B51A 4PL1A 2MUTA 4OJOA 5DLFA 4I27A 4RPXA 1WWUA 4DFKA 5AM2A 5AI5A 7ICUA 1IIPA 2PXIA 5F3XB 1KL9A 3QUQA 3PSIA 1RYUA 4KLTA 5ALNA 4QZAA 3E0FA 2KHVA 3ZI4A 1ZQQA 3CYMA 1D9DA 3H0MB 1N63A 1YZ7A 5AM1A 5KFFA 4X4VA 2CPRA 9ICKA 4WC4A 4F4KA 1EXNA 8ICLA 4GC6A 2ALZA 4IQWA 3UXPA 4KLJA 3PW4A 1D9FA 3M8SA 1L7NA 1KW4A 3V7KA 5JRTA 2RFFA 3PMLA 5HRLA 4NKUA 4K98A 4OJPA 2M2TA 3OJUA 3OVAA 9ICBA 1PK1A 5HR9A 4ATBA 3GILA 2HVIA 4AT8A 4RQMA 2E8MA 4NM1A 5AKGA 4DOAA 3TQ1A 2FMSA 4EBDA 4F5QA 3RJGA 5C0YA 2BQRA 2K8BB 9ICEA 3EWAA 3MR3A 3PW5A 2WF6A 4C4TA 4QWCA 4FS2A 5KFPA 5J2JA 1ZJMA 4KTQA 3UPSA 4UB4A 4DO9A 3KBBA 2M9NA 3QUBA 1SZHA 5KFCA 2FCLA 1SB3C 4XQ8A 2JH1A 4IS7A 5EE0A 1ZD3A 2AGQA 5JU5A 3TKAA 5DQGA 2P35A 1Z1VA 4J9QA 4DQSA 3WFRE 2YB1A 4O5CA 4BWMA 4PHPA 4DFMA 4EBEA 4HX0A 4CDGA 4KLSA 2JZBB 2Y1JA 5ALOA 2W9CA 2WFAA 2H5XA 1JN3A 4I2FA 8ICGA 3H0RB 2VANA 3K1ZA 5KFDA 2OXOA 1URJA 2N1RA 5AKHA 2BDUA 3ZDAA 5DBCA 2ZXHA 2V4QA 1WWVA 4ED7A 5AM3A 1B22A 4DS4A 4WC6A 1IM4A 4AYBF 1SL0A 2J6UA 7ICKA 1LB2B 1NI3A 3CNHA 5ALDA 1R8CA 5ALQA 2R8HA 2G5HB 5KFVA 1L6NA 3TANA 2BBJA 4AT9B 4RU9A 3VCBA 3T5KA 1ZQSA 2M0NA 2KVCA 2JGAA 1U45A 2GH1A 3BZKA 4FH3A 4F92B 1SKWA 1L8LA 3F2CA 2WTFA 5KG3A 3Q8MA 5CEHA 4NXUA 4BUGA 1OUQA 5CWRA 3OVSA 4E8FA 5IIMA 5AI9A 3BQ7A 2GO7A 4Y2YA 1S9FA 4UB3A 2F1JA 5HR6A 4Y2RA 1L3SA 4Z6EA 1PVRA 4F3OA 2WF5A 4PH5A 1OW5A 2EZZA 1XWLA 1UA0A 5KAFU 1QTMA 4NXWA 5J8YC 2NRVA 3RJKA 1RYRA 1TFRA 3RH4A 4FZNA 3H38A 2A1JB 4IQUA 3GDXA 3OPXA 1MIVA 1S0MA 4JWMA 2WHEA 2PBEA 4WBZA 4YXMA 2HMXA 2JZBA 8ICTA 2XGQA 3SAFA 4K9AA 4O3OA 2FPKA 4F2SA 3RJEA 2PFQA 3F5AA 4EYIB 1BPYA 9ICOA 1F5SA 4J9RA 1ZQGA 4O3NA 9ICHA 3LVVA 4RQ1A 2PMZC 4WBYA 5AKEA 4WQKA 3WK4A 3E2EA 1JXLA 4ECUA 2VJ4A 5ALJA 2HHXA 4YG2A 2ZJ5A 4JWNA 1SGGA 3V6HA 5AKIA 3ZDEA 4UQGA 4UASA 4GXIA 2KICA 1NKCA 4AT9A 3AN1A 2BHNA 4Q43A 1CI4A 4DSKA 1S76D 1JI7A 1RQLA 2C22A 2ZXIA 1XU4A 3OSPA 2F1HA 2W7OA 5KG0A 5KFNA 1N61A 4QZFA 3M6ZA 3T5HA 2AH5A 5DB9A 5B5EU 1N5WA 1KN5A 4G9BA 8ICRA 4OAIZ 4FHPA 2HVHA 3OJSA 3EYZA 3M6KA 5DGAA 1XSLA 4C8LA 4XJEA 3C5FA 2PFPA 2FPMA 4WC7A 2H3ZA 3KD3A 2PI4A 3IV6A 1QSLA 2ZJ8A 4RWPA 4YMOA 4WC3A 4ELTA 2ESEA 3VC8A 4DSIA 4FO1A 3ZDBA 4M9NA 2RHFA 4JMUA 4LEZA 4MFCA 8ICNA 4R65A 5DBBA 4OJ6A 5J2FA 2XO7A 4O6AA 2JXJA 4FBTA 1S10A 2DKXA 4R8UB 2OEHA 2B4VA 3UXNA 4K97A 3GFKB 4ECQA 2K4PA 1XSNA 4ECRA 3HIYA 3I76A 2JEFA 4GIBA
chains in the Genus database with same CATH topology
4DFPA 3MFHA 8ICMA 4FHWA 4QWDA 5HP4A 1R8AA 1MQ3A 1ZQUA 5J0OA 2ATLA 3AU2A 1RYSA 1KNYA 1N48A 3H39A 4DF4A 2BPFA 4IRCA 2ZH2A 1Z00B 1TAQA 4QZIA 4KLFA 4DQRA 2BCVA 5HRKA 2VA8A 4JK1A 5HMMA 3HX0A 3ISBA 5DG7A 5J0XA 3TFRA 1QLNA 3ETLA 3MGHA 3MDCA 2ZH1A 3ORYA 4PHEA 1NZPA 2NRXA 3Q8LA 9ICTA 2P66A 9ICAA 2R8IA 2UVUA 1BGXT 2AJQA 2C2EA 4MF2A 3GV8B 2J6TA 4DOBA 1BNOA 2ZUCA 1NK8A 5HREA 4Z6DA 5KT7A 1KTQA 5IIIA 4EP7A 4RWOA 4P4PA 4UBBA 1HJPA 4F5RA 5KTQA 3JPNA 3ZDDA 2O5AA 3JYYA 5KFQA 4NKTA 4KLMA 4K4HA 1C7YA 2MUTB 5L1JA 4X4PA 9ICVA 1U9LA 3WFPA 4QZ8A 4R63A 1MSWD 4PPXA 1K1SA 5IINA 4LVSA 5D49A 1BPDA 4YR2A 1K1QA 1T3NA 4YMMA 4FHYA 5J2IA 2DR8A 5DQIA 4RWQA 5HRGA 5BOMA 4WC0A 3MR2A 4WC5A 2FLLA 3PW2A 4MF8A 4WCWA 1TK5A 4C8KA 1U4BA 4YR3A 4BXOA 1JAJA 4J9KA 5L1IA 4XQ7A 4YD1A 3RBDA 3RBEA 3RJFA 9ICPA 4WC1A 4C8NA 4YVZA 2XC9A 3PX4A 1SKSA 2NRWA 2DPIA 3PY8A 1T8EA 3K75D 4Q44A 4RPZA 2O1PA 3OV7A 2JEIA 1TK0A 3OHBA 4R64A 2BCSA 2ZH7A 1X9SA 4P4MA 2BCUA 7ICPA 3AUOA 3G6VA 3HW8A 3PR5B 2UVWA 4YFKA 4KLGA 7ICGA 4AT7B 2AQ0A 4C8MA 3C2LA 3ISCA 3RH6A 4PGYA 1NK4A 1KFSA 4F5PA 3KTQA 3H4DA 2ISOA 4B9TA 4M6WA 4QWAA 8ICEA 2DR9A 2C2DA 8ICHA 5KT4A 3Q8RB 4X4QA 4UAZA 5L1KA 4J9MA 4B9VA 3C66A 2ZHBA 1WOTA 5F2VO 4NXZA 3OUYB 9ICXA 2I9GA 3RAQA 1S0NA 1NK6A 4YQWA 5KFGA 2BPGA 1TAUA 4LZGA 4O0IA 4BGDA 4KITB 1TFYA 3PNCA 2ZH3A 1VJ7A 2IA6A 9ICNA 2IHMA 9ICWA 2BPCA 1H38A 4IG8A 4XA5A 2LYHA 3MR5A 1XO1A 3M9NB 5J29A 3V7JA 3V6KA 1NK5A 1S97A 4R8UA 4Q8EA 1NO5A 3V7LA 4NLGA 3GIIA 4RQ7A 4EBCA 4M9JA 9ICGA 1UETA 4DOCA 1UT8A 4NM2A 1NJYA 4TURA 1UEVA 5DQHA 2BQ3A 1KDHA 7ICHA 3JPRA 3BQ2A 3QEAZ 1ZYQA 2BDPA 4Q8FA 2ZH5A 3M9OB 9ICQA 4YN4A 4X5VA 4ECSA 2A1JA 3JPSA 4RNOA 2ZUDA 4O3PA 4QWEA 1BPXA 4JV2A 5HRBA 2HHSA 4M9LA 1BNPA 1HUZA 4FH5A 4F8RA 4ED2A 4I2EA 2ISPA 9ICIA 4F5OA 2BGWA 5TZVA 1Z00A 3T3FA 1ZQDA 4DL3A 1S0VA 3NYBA 5J0WA 4GXKA 4J9NA 5IIOA 4NLNA 5IIJA 4NLZA 5D46A 3KHGA 3LDAA 4ECWA 1ZQMA 4NLKA 4YR0A 1XSPA 2ZTEA 2NRTA 4TQRA 5KFZA 5DLGA 5KFOA 3MFIA 3T5LA 4E0DA 4I28A 5DBAA 2KZ3A 2W9CB 1R89A 4I2IA 3WFOA 1DGSA 1L3VA 5DDYA 4ECZA 3IHQB 1ZQNA 2AGPA 4UD4A 3TAPA 1V4AA 3LK9A 2UVRA 4B9SA 4ELUA 4NY8A 2HW3A 5DB6A 3H40A 4EBJA 4ED8A 4B9NA 2DR7A 7ICMA 3FYHA 7ICTA 5CP2A 4R66A 5J0QA 2AGOA 3SV3A 4O3SA 2MUTA 5DLFA 4I27A 4RPXA 4MFFA 4DFKA 8ICQA 2HHPA 4M9GA 1TVAA 2J6SA 7ICUA 2DRAA 4MFAA 3G6YA 2PXIA 1ZQAA 4C8OA 4RNNA 3HP6A 2HHTA 1ZQXA 4KMUA 4PGQA 4KLTA 3RAXA 4X4OA 2W9MA 4QZAA 4I2AA 4F4ZA 4KLUA 2NRKA 5CB1A 3KHLA 1RPLA 4B9MA 4O3QA 5KT2A 3RB6A 4YD2A 1UA1A 2PFOA 3RR8A 4EEYA 3LWLA 4ECYA 1ZQQA 3C18A 4LT6A 1D9DA 3EPIA 3RR7A 5KFFA 3MGIA 1D8YA 4X4VA 4X4SA 2PFNA 7ICJA 3H7IA 2HHUA 2Q0ZX 2BR0A 9ICKA 4Q45A 3H37A 4WC4A 2B21A 4F4KA 1EXNA 8ICLA 5KFBA 1NK0A 1ZQVA 3RJJA 9ICMA 1ZQLA 4AT7A 5KFRA 4GC6A 5HHHA 4ECTA 2ALZA 4IQVA 3UXPA 4IQWA 7ICQA 1OU5A 4KLJA 2W9AA 3PW4A 2HHVA 1D9FA 3M8SA 5KT6A 4M47A 8ICPA 4F4XA 4KLOA 3V7KA 1NKBA 5J0YA 3PMLA 3FDSA 5KFTA 1TKDA 3RJHA 5HRLA 4B9UA 2RFFA 4NKUA 3AU6A 8ICOA 2M2TA 1RXWA 3OJUA 3OVAA 9ICBA 5KFLA 2W8LA 2KFZA 2FLPA 5BOLA 9ICCA 5HR9A 3GILA 2HVIA 4ATBA 3H4BA 2KN7A 1U48A 4AT8A 2C2RA 4NM1A 3OSNA 4BWJA 4DOAA 3TQ1A 2FMSA 4EBDA 4YP3A 4F5QA 1N56A 4DL5A 3RJGA 5HRFA 2BQRA 3BQ1A 3C2MA 1SKRA 4I29A 1UT5A 4UD5A 4DSLA 4I2JA 9ICEA 7ICVA 2DR5A 3OVBA 3EWAA 5J2KA 3MR3A 3SV4A 3V6JA 4QWCA 3PW5A 4FS2A 3TAQA 5KFPA 5J2JA 1ZJMA 1FA0A 4KTQA 5HRDA 4F5NA 1XC9A 4YCXA 3UPSA 1NJWA 4UB4A 3PMNA 4DO9A 2BCQA 1TFWA 2M9NA 5KFCA 8ICJA 5KT5A 4X0AA 4XQ8A 4ECXA 5EWEA 8ICWA 4ED1A 4EZ9A 2AGQA 7ICFA 1ZQYA 3G6XA 3RRGA 5DQGA 5DEDA 3H8JA 2BCRA 4J9QA 4DQSA 2ZJAA 3B0YA 4KLIA 3WFRE 5C5JA 4DL4A 2FPLA 4BWMA 4O5CA 4PHPA 4RNMA 2IMWP 3BJYA 4DFMA 1ZQCA 4QZDA 1ZQBA 2VA2A 7ICRA 4EBEA 3KHRA 5HMLA 4DF8A 3ZD9A 4J9OA 2JZBB 3Q8SB 2Y1JA 4KLSA 2W9CA 2H5XA 1JN3A 5J0TA 4I2FA 8ICGA 3Q8KA 9ICSA 1X9MA 4X4UA 5KFDA 2VANA 2M2VA 4X0BA 8ICUA 2KTQA 2RDIA 3C1ZA 5JUMA 8ICFA 3EW9A 4JV0A 3RB0A 1ZQIA 4P4OA 4RUCA 3ZDAA 2R8GA 3ZDCA 5J0SA 3LWMA 1VFGA 4FHXA 4EYHB 5DBCA 2V4QA 4G3IA 4ED7A 4ED3A 1BPBA 1B22A 4DS4A 4WC6A 5EWGA 1L3UA 4M9HA 1IM4A 1SL0A 5KFIA 4UB5A 2J6UA 5IIKA 7ICKA 1LB2B 7ICOA 3NTUA 3HT3A 4DS5A 4FHVA 3RRHA 2BKEA 4QZ9A 3GIMA 4GC7A 1ZQFA 1R8CA 4DQPA 2NRZA 3TARA 4GXJA 1X9WA 2I1QA 2R8HA 3OGUA 5CJ7A 4RQ3A 5KFVA 3MDAA 4DWIA 5DECA 2W9BB 3TANA 4ED6A 4AT9B 4MEYA 4RU9A 4LZDA 3T5KA 1ZQSA 3C23A 2XCAA 3RTVA 2ZHAA 1ZQEA 1U45A 3JPQA 2ZH6A 4FH3A 3PR4A 2JEGA 4O3RA 4GLXA 4F92B 3PW7A 5EWFA 2VA3A 1IXRA 2XGPA 1SKWA 3HJ4A 4QW8A 1NKEA 3PO5A 9ICRA 4DL2A 1V9PA 2M2WA 5J2HA 2WTFA 2ZH9A 3NGDA 2KZZA 5KG3A 3RJIA 3Q8MA 3V72A 4UBCA 4F93B 3PV8A 4X4TA 1ZQTA 1NK7A 1RZTA 1JMSA 1COOA 4F50A 3M9MB 3C2KA 3AQMA 5CWRA 3OVSA 1F5AA 4E8FA 1JXEA 5KFUA 4QZHA 5L1LA 5IIMA 1BVSA 1ZETA 1MQ2A 4XUSA 1PX5A 1JX4A 4TQSA 3MBYA 5DB7A 4UB3A 2F1JA 5J2GA 1S9FA 1BPEA 1QSSA 2JEJA 9ICLA 1L3SA 4I2CA 4Z6EA 4EZ6A 2P6UA 3JPOA 3K4GA 1U47A 4UAYA 4F3OA 4PH5A 5CR0A 1Q79A 3GV7B 1XWLA 5F9LA 4UB2A 1UA0A 1QTMA 4E80A 3EPGA 2DFLA 3QE9Y 3H3AA 5KFJA 4I2HA 7ICNA 2NRVA 4J9SA 1Z3EB 4J9PA 3RJKA 2HHWA 5DKWA 1RYRA 2KFNA 1TFRA 2OWOA 1NOMA 1ZQZA 3B0XA 5HRIA 4M5DA 3RH4A 2PI5A 3H38A 2A1JB 4IQUA 3GDXA 5J0UA 1WCLA 1KFDA 2AU0A 2IHNA 3PW0A 1XS9D 8ICBA 1MIVA 3H8SA 4IR1A 4K4GA 1S77D 9ICJA 2KP7A 4E7XA 1S0MA 4JWMA 4RUAA 4BDPA 5KFAA 3JPTA 2PBEA 3OUYA 5BPCA 4WBZA 4YXMA 5F9NA 4PHAA 2JZBA 1ZQHA 8ICTA 1YLQA 3HWTA 5KG4A 2ZUBA 3M8RA 1NJXA 1L3TA 1ZQOA 2XGQA 3UPQA 3SI8A 1MIYA 1Y88A 3N97B 3AQKA 9ICUA 3C1YA 5CA7A 1Q78A 4O3OA 4ECVA 2FPKA 4F2SA 4Z6CA 3MR6A 3C21A 3BDPA 3RJEA 5KG6A 3H8WA 4P2HA 3HJ1A 2PFQA 5CHGA 3ISDA 4EYIB 1BPYA 9ICOA 2BE3A 2ASJA 1D8LA 2ASLA 1JIHA 1SL1A 5KFMA 4J9RA 1ZQGA 4O3NA 5IILA 9ICHA 3GQCA 1PZNA 3KHHA 4RQ1A 4J9LA 3Q8PB 4WBYA 3AQLA 1DK3A 4F4YA 2ASDA 3E2EA 4IRKA 4K4IA 1NK9A 4ECUA 1JXLA 2KZMA 2HHXA 4IRDA 4KLEA 9ICFA 4YG2A 1R8BA 2ZJ5A 1ZQWA 3QEBZ 3HPOA 4JWNA 8ICZA 4ELVA 4M04A 4PHDA 3V6HA 5J0RA 3ZDEA 4UB1A 4UQGA 2AQ4A 1LV5A 1CEZA 1WCNA 4GXIA 3PX0A 7ICEA 4JUZA 4XRHA 4RT3A 4B9LA 2W9BA 1NKCA 2MAXA 1SL2A 1MC8A 4AT9A 4QZCA 2BHNA 4Q43A 4ED0A 4DSKA 4IQTA 4DFJA 1QSYA 1S76D 3IM1A 1MIWA 4DSFA 4DEZA 5L9XA 1T4GA 3TI0A 3C5GA 3ZD8A 4RQ5A 2XY5A 8ICAA 2UVVA 2DRBA 4JV1A 5HC9A 3BQ0A 4HYKA 2C22A 4DSJA 4O9MA 1XU4A 1KLNA 2HHQA 3WFQE 3UXOA 3QZ8A 4YMNA 4I2GA 1ZQPA 2FMPA 1ZQKA 1ZQRA 3OSPA 1HUOA 4QZEA 2F1HA 4DQIA 4X4RA 4QWBA 5KG0A 4YXJA 5KFNA 3T5JA 2XY7A 3JZ0A 4RQ4A 4DSEA 2XY6A 5DB8A 4FS1A 8ICCA 2IBKA 5DG8A 2ID1A 4DLGA 4RWNA 1KEJA 4QZFA 3L9DA 3T5HA 2ZH4A 2F1IA 4X4NA 5KG2A 5DB9A 2DVIA 1TK8A 4DL6A 4I2DA 1L5UA 8ICRA 4DQQA 5DGBA 3OHAA 2FLNA 3N4MB 4FHPA 2HVHA 4O5KA 4ATBB 3UQ0A 3RH5A 5J2DA 4PGXA 3OJSA 3EYZA 2BQUA 4AT8B 4RT2A 5KG5A 4EBKA 5KFWA 3PX6A 2V9WA 5DGAA 2DPJA 3GV5B 4KLHA 5DG9A 1XSLA 4BXOB 4C8LA 3BQTA 3C5FA 3MABA 2V4RA 3GIKA 5KFEA 4CCHA 3PO4A 4QZGA 2PFPA 2FPMA 1CUKA 4ZH4A 1ZJNA 4O5EA 1KFTA 2W8KA 1KSPA 4FO6A 4M0AA 5HHIA 3JPPA 7ICIA 3RB3A 4FBUA 4WC7A 4RQ8A 2RDJA 4RPYA 3WFSC 4RQ0A 1A76A 3Q8QB 4MEXA 4KLLA 5KFKA 4Z6FA 5KFHA 4QZBA 3UQ2A 5KT3A 3THVA 4KN7A 5KFYA 1TV9A 2PI4A 1QSLA 2P6RA 2ZTDA 2ZJ8A 4YMOA 1KRPA 1JQRA 4RWPA 4WC3A 4WC2A 5D4BA 4ELTA 2R8KA 4TUQA 5J2CA 1ZQJA 2Q66A 4M6WB 5KG1A 1AROP 3SYZA 8ICXA 3TFSA 5J2EA 1U49A 4DSIA 3GIJA 3ZDBA 1NJZA 2C28A 4F91B 4F2RA 4M9NA 8ICYA 4KLQA 4MFCA 5KG7A 8ICNA 4R65A 7ICLA 7ICSA 5DBBA 4UAWA 2FMQA 5J0PA 3RB4A 2R8JA 4KLDA 8ICKA 8ICSA 3AQNA 3LQCB 1BPZA 5KFSA 4TUSA 5J2FA 4KN4A 2XO7A 3EZ5A 2Y1IA 4FBTA 4M2YA 2ZH8A 3SZ2A 5KFXA 8ICIA 1A77A 1S10A 1DOQA 2M2UA 4S3NA 8ICVA 1X2IA 4R8UB 1T7PA 5HRHA 3UXNA 2ZTCA 1DK2A 1B43A 1RXVA 4I2BA 4QW9A 3GFKB 4ECQA 3QZ7A 4RQ6A 4RQ2A 2XCPA 3PVXA 2GWSA 5EOZA 5J2AA 4DL7A 1XSNA 1S0OA 4ECRA 1UEUA 5J2BA 1SZPA 4DLEA 4IR9A 4TUPA 3HIYA 2JEFA 4F4WA 5DDMA 4RZRA 5HNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DFP A;  3MFH A;  8ICM A;  4FHW A;  4QWD A;  5HP4 A;  1R8A A;  1MQ3 A;  1ZQU A;  5J0O A;  2ATL A;  3AU2 A;  1RYS A;  1KNY A;  1N48 A;  3H39 A;  4DF4 A;  2BPF A;  4IRC A;  2ZH2 A;  1Z00 B;  1TAQ A;  4QZI A;  4KLF A;  4DQR A;  2BCV A;  5HRK A;  2VA8 A;  4JK1 A;  5HMM A;  3HX0 A;  3ISB A;  5DG7 A;  5J0X A;  3TFR A;  1QLN A;  3ETL A;  3MGH A;  3MDC A;  2ZH1 A;  3ORY A;  4PHE A;  1NZP A;  2NRX A;  3Q8L A;  9ICT A;  2P66 A;  9ICA A;  2R8I A;  2UVU A;  1BGX T;  2AJQ A;  2C2E A;  4MF2 A;  3GV8 B;  2J6T A;  4DOB A;  1BNO A;  2ZUC A;  1NK8 A;  5HRE A;  4Z6D A;  5KT7 A;  1KTQ A;  5III A;  4EP7 A;  4RWO A;  4P4P A;  4UBB A;  1HJP A;  4F5R A;  5KTQ A;  3JPN A;  3ZDD A;  2O5A A;  3JYY A;  5KFQ A;  4NKT A;  4KLM A;  4K4H A;  1C7Y A;  2MUT B;  5L1J A;  4X4P A;  9ICV A;  1U9L A;  3WFP A;  4QZ8 A;  4R63 A;  1MSW D;  4PPX A;  1K1S A;  5IIN A;  4LVS A;  5D49 A;  1BPD A;  4YR2 A;  1K1Q A;  1T3N A;  4YMM A;  4FHY A;  5J2I A;  2DR8 A;  5DQI A;  4RWQ A;  5HRG A;  5BOM A;  4WC0 A;  3MR2 A;  4WC5 A;  2FLL A;  3PW2 A;  4MF8 A;  4WCW A;  1TK5 A;  4C8K A;  1U4B A;  4YR3 A;  4BXO A;  1JAJ A;  4J9K A;  5L1I A;  4XQ7 A;  4YD1 A;  3RBD A;  3RBE A;  3RJF A;  9ICP A;  4WC1 A;  4C8N A;  4YVZ A;  2XC9 A;  3PX4 A;  1SKS A;  2NRW A;  2DPI A;  3PY8 A;  1T8E A;  3K75 D;  4Q44 A;  4RPZ A;  2O1P A;  3OV7 A;  2JEI A;  1TK0 A;  3OHB A;  4R64 A;  2BCS A;  2ZH7 A;  1X9S A;  4P4M A;  2BCU A;  7ICP A;  3AUO A;  3G6V A;  3HW8 A;  3PR5 B;  2UVW A;  4YFK A;  4KLG A;  7ICG A;  4AT7 B;  2AQ0 A;  4C8M A;  3C2L A;  3ISC A;  3RH6 A;  4PGY A;  1NK4 A;  1KFS A;  4F5P A;  3KTQ A;  3H4D A;  2ISO A;  4B9T A;  4M6W A;  4QWA A;  8ICE A;  2DR9 A;  2C2D A;  8ICH A;  5KT4 A;  3Q8R B;  4X4Q A;  4UAZ A;  5L1K A;  4J9M A;  4B9V A;  3C66 A;  2ZHB A;  1WOT A;  5F2V O;  4NXZ A;  3OUY B;  9ICX A;  2I9G A;  3RAQ A;  1S0N A;  1NK6 A;  4YQW A;  5KFG A;  2BPG A;  1TAU A;  4LZG A;  4O0I A;  4BGD A;  4KIT B;  1TFY A;  3PNC A;  2ZH3 A;  1VJ7 A;  2IA6 A;  9ICN A;  2IHM A;  9ICW A;  2BPC A;  1H38 A;  4IG8 A;  4XA5 A;  2LYH A;  3MR5 A;  1XO1 A;  3M9N B;  5J29 A;  3V7J A;  3V6K A;  1NK5 A;  1S97 A;  4R8U A;  4Q8E A;  1NO5 A;  3V7L A;  4NLG A;  3GII A;  4RQ7 A;  4EBC A;  4M9J A;  9ICG A;  1UET A;  4DOC A;  1UT8 A;  4NM2 A;  1NJY A;  4TUR A;  1UEV A;  5DQH A;  2BQ3 A;  1KDH A;  7ICH A;  3JPR A;  3BQ2 A;  3QEA Z;  1ZYQ A;  2BDP A;  4Q8F A;  2ZH5 A;  3M9O B;  9ICQ A;  4YN4 A;  4X5V A;  4ECS A;  2A1J A;  3JPS A;  4RNO A;  2ZUD A;  4O3P A;  4QWE A;  1BPX A;  4JV2 A;  5HRB A;  2HHS A;  4M9L A;  1BNP A;  1HUZ A;  4FH5 A;  4F8R A;  4ED2 A;  4I2E A;  2ISP A;  9ICI A;  4F5O A;  2BGW A;  5TZV A;  1Z00 A;  3T3F A;  1ZQD A;  4DL3 A;  1S0V A;  3NYB A;  5J0W A;  4GXK A;  4J9N A;  5IIO A;  4NLN A;  5IIJ A;  4NLZ A;  5D46 A;  3KHG A;  3LDA A;  4ECW A;  1ZQM A;  4NLK A;  4YR0 A;  1XSP A;  2ZTE A;  2NRT A;  4TQR A;  5KFZ A;  5DLG A;  5KFO A;  3MFI A;  3T5L A;  4E0D A;  4I28 A;  5DBA A;  2KZ3 A;  2W9C B;  1R89 A;  4I2I A;  3WFO A;  1DGS A;  1L3V A;  5DDY A;  4ECZ A;  3IHQ B;  1ZQN A;  2AGP A;  4UD4 A;  3TAP A;  1V4A A;  3LK9 A;  2UVR A;  4B9S A;  4ELU A;  4NY8 A;  2HW3 A;  5DB6 A;  3H40 A;  4EBJ A;  4ED8 A;  4B9N A;  2DR7 A;  7ICM A;  3FYH A;  7ICT A;  5CP2 A;  4R66 A;  5J0Q A;  2AGO A;  3SV3 A;  4O3S A;  2MUT A;  5DLF A;  4I27 A;  4RPX A;  4MFF A;  4DFK A;  8ICQ A;  2HHP A;  4M9G A;  1TVA A;  2J6S A;  7ICU A;  2DRA A;  4MFA A;  3G6Y A;  2PXI A;  1ZQA A;  4C8O A;  4RNN A;  3HP6 A;  2HHT A;  1ZQX A;  4KMU A;  4PGQ A;  4KLT A;  3RAX A;  4X4O A;  2W9M A;  4QZA A;  4I2A A;  4F4Z A;  4KLU A;  2NRK A;  5CB1 A;  3KHL A;  1RPL A;  4B9M A;  4O3Q A;  5KT2 A;  3RB6 A;  4YD2 A;  1UA1 A;  2PFO A;  3RR8 A;  4EEY A;  3LWL A;  4ECY A;  1ZQQ A;  3C18 A;  4LT6 A;  1D9D A;  3EPI A;  3RR7 A;  5KFF A;  3MGI A;  1D8Y A;  4X4V A;  4X4S A;  2PFN A;  7ICJ A;  3H7I A;  2HHU A;  2Q0Z X;  2BR0 A;  9ICK A;  4Q45 A;  3H37 A;  4WC4 A;  2B21 A;  4F4K A;  1EXN A;  8ICL A;  5KFB A;  1NK0 A;  1ZQV A;  3RJJ A;  9ICM A;  1ZQL A;  4AT7 A;  5KFR A;  4GC6 A;  5HHH A;  4ECT A;  2ALZ A;  4IQV A;  3UXP A;  4IQW A;  7ICQ A;  1OU5 A;  4KLJ A;  2W9A A;  3PW4 A;  2HHV A;  1D9F A;  3M8S A;  5KT6 A;  4M47 A;  8ICP A;  4F4X A;  4KLO A;  3V7K A;  1NKB A;  5J0Y A;  3PML A;  3FDS A;  5KFT A;  1TKD A;  3RJH A;  5HRL A;  4B9U A;  2RFF A;  4NKU A;  3AU6 A;  8ICO A;  2M2T A;  1RXW A;  3OJU A;  3OVA A;  9ICB A;  5KFL A;  2W8L A;  2KFZ A;  2FLP A;  5BOL A;  9ICC A;  5HR9 A;  3GIL A;  2HVI A;  4ATB A;  3H4B A;  2KN7 A;  1U48 A;  4AT8 A;  2C2R A;  4NM1 A;  3OSN A;  4BWJ A;  4DOA A;  3TQ1 A;  2FMS A;  4EBD A;  4YP3 A;  4F5Q A;  1N56 A;  4DL5 A;  3RJG A;  5HRF A;  2BQR A;  3BQ1 A;  3C2M A;  1SKR A;  4I29 A;  1UT5 A;  4UD5 A;  4DSL A;  4I2J A;  9ICE A;  7ICV A;  2DR5 A;  3OVB A;  3EWA A;  5J2K A;  3MR3 A;  3SV4 A;  3V6J A;  4QWC A;  3PW5 A;  4FS2 A;  3TAQ A;  5KFP A;  5J2J A;  1ZJM A;  1FA0 A;  4KTQ A;  5HRD A;  4F5N A;  1XC9 A;  4YCX A;  3UPS A;  1NJW A;  4UB4 A;  3PMN A;  4DO9 A;  2BCQ A;  1TFW A;  2M9N A;  5KFC A;  8ICJ A;  5KT5 A;  4X0A A;  4XQ8 A;  4ECX A;  5EWE A;  8ICW A;  4ED1 A;  4EZ9 A;  2AGQ A;  7ICF A;  1ZQY A;  3G6X A;  3RRG A;  5DQG A;  5DED A;  3H8J A;  2BCR A;  4J9Q A;  4DQS A;  2ZJA A;  3B0Y A;  4KLI A;  3WFR E;  5C5J A;  4DL4 A;  2FPL A;  4BWM A;  4O5C A;  4PHP A;  4RNM A;  2IMW P;  3BJY A;  4DFM A;  1ZQC A;  4QZD A;  1ZQB A;  2VA2 A;  7ICR A;  4EBE A;  3KHR A;  5HML A;  4DF8 A;  3ZD9 A;  4J9O A;  2JZB B;  3Q8S B;  2Y1J A;  4KLS A;  2W9C A;  2H5X A;  1JN3 A;  5J0T A;  4I2F A;  8ICG A;  3Q8K A;  9ICS A;  1X9M A;  4X4U A;  5KFD A;  2VAN A;  2M2V A;  4X0B A;  8ICU A;  2KTQ A;  2RDI A;  3C1Z A;  5JUM A;  8ICF A;  3EW9 A;  4JV0 A;  3RB0 A;  1ZQI A;  4P4O A;  4RUC A;  3ZDA A;  2R8G A;  3ZDC A;  5J0S A;  3LWM A;  1VFG A;  4FHX A;  4EYH B;  5DBC A;  2V4Q A;  4G3I A;  4ED7 A;  4ED3 A;  1BPB A;  1B22 A;  4DS4 A;  4WC6 A;  5EWG A;  1L3U A;  4M9H A;  1IM4 A;  1SL0 A;  5KFI A;  4UB5 A;  2J6U A;  5IIK A;  7ICK A;  1LB2 B;  7ICO A;  3NTU A;  3HT3 A;  4DS5 A;  4FHV A;  3RRH A;  2BKE A;  4QZ9 A;  3GIM A;  4GC7 A;  1ZQF A;  1R8C A;  4DQP A;  2NRZ A;  3TAR A;  4GXJ A;  1X9W A;  2I1Q A;  2R8H A;  3OGU A;  5CJ7 A;  4RQ3 A;  5KFV A;  3MDA A;  4DWI A;  5DEC A;  2W9B B;  3TAN A;  4ED6 A;  4AT9 B;  4MEY A;  4RU9 A;  4LZD A;  3T5K A;  1ZQS A;  3C23 A;  2XCA A;  3RTV A;  2ZHA A;  1ZQE A;  1U45 A;  3JPQ A;  2ZH6 A;  4FH3 A;  3PR4 A;  2JEG A;  4O3R A;  4GLX A;  4F92 B;  3PW7 A;  5EWF A;  2VA3 A;  1IXR A;  2XGP A;  1SKW A;  3HJ4 A;  4QW8 A;  1NKE A;  3PO5 A;  9ICR A;  4DL2 A;  1V9P A;  2M2W A;  5J2H A;  2WTF A;  2ZH9 A;  3NGD A;  2KZZ A;  5KG3 A;  3RJI A;  3Q8M A;  3V72 A;  4UBC A;  4F93 B;  3PV8 A;  4X4T A;  1ZQT A;  1NK7 A;  1RZT A;  1JMS A;  1COO A;  4F50 A;  3M9M B;  3C2K A;  3AQM A;  5CWR A;  3OVS A;  1F5A A;  4E8F A;  1JXE A;  5KFU A;  4QZH A;  5L1L A;  5IIM A;  1BVS A;  1ZET A;  1MQ2 A;  4XUS A;  1PX5 A;  1JX4 A;  4TQS A;  3MBY A;  5DB7 A;  4UB3 A;  2F1J A;  5J2G A;  1S9F A;  1BPE A;  1QSS A;  2JEJ A;  9ICL A;  1L3S A;  4I2C A;  4Z6E A;  4EZ6 A;  2P6U A;  3JPO A;  3K4G A;  1U47 A;  4UAY A;  4F3O A;  4PH5 A;  5CR0 A;  1Q79 A;  3GV7 B;  1XWL A;  5F9L A;  4UB2 A;  1UA0 A;  1QTM A;  4E80 A;  3EPG A;  2DFL A;  3QE9 Y;  3H3A A;  5KFJ A;  4I2H A;  7ICN A;  2NRV A;  4J9S A;  1Z3E B;  4J9P A;  3RJK A;  2HHW A;  5DKW A;  1RYR A;  2KFN A;  1TFR A;  2OWO A;  1NOM A;  1ZQZ A;  3B0X A;  5HRI A;  4M5D A;  3RH4 A;  2PI5 A;  3H38 A;  2A1J B;  4IQU A;  3GDX A;  5J0U A;  1WCL A;  1KFD A;  2AU0 A;  2IHN A;  3PW0 A;  1XS9 D;  8ICB A;  1MIV A;  3H8S A;  4IR1 A;  4K4G A;  1S77 D;  9ICJ A;  2KP7 A;  4E7X A;  1S0M A;  4JWM A;  4RUA A;  4BDP A;  5KFA A;  3JPT A;  2PBE A;  3OUY A;  5BPC A;  4WBZ A;  4YXM A;  5F9N A;  4PHA A;  2JZB A;  1ZQH A;  8ICT A;  1YLQ A;  3HWT A;  5KG4 A;  2ZUB A;  3M8R A;  1NJX A;  1L3T A;  1ZQO A;  2XGQ A;  3UPQ A;  3SI8 A;  1MIY A;  1Y88 A;  3N97 B;  3AQK A;  9ICU A;  3C1Y A;  5CA7 A;  1Q78 A;  4O3O A;  4ECV A;  2FPK A;  4F2S A;  4Z6C A;  3MR6 A;  3C21 A;  3BDP A;  3RJE A;  5KG6 A;  3H8W A;  4P2H A;  3HJ1 A;  2PFQ A;  5CHG A;  3ISD A;  4EYI B;  1BPY A;  9ICO A;  2BE3 A;  2ASJ A;  1D8L A;  2ASL A;  1JIH A;  1SL1 A;  5KFM A;  4J9R A;  1ZQG A;  4O3N A;  5IIL A;  9ICH A;  3GQC A;  1PZN A;  3KHH A;  4RQ1 A;  4J9L A;  3Q8P B;  4WBY A;  3AQL A;  1DK3 A;  4F4Y A;  2ASD A;  3E2E A;  4IRK A;  4K4I A;  1NK9 A;  4ECU A;  1JXL A;  2KZM A;  2HHX A;  4IRD A;  4KLE A;  9ICF A;  4YG2 A;  1R8B A;  2ZJ5 A;  1ZQW A;  3QEB Z;  3HPO A;  4JWN A;  8ICZ A;  4ELV A;  4M04 A;  4PHD A;  3V6H A;  5J0R A;  3ZDE A;  4UB1 A;  4UQG A;  2AQ4 A;  1LV5 A;  1CEZ A;  1WCN A;  4GXI A;  3PX0 A;  7ICE A;  4JUZ A;  4XRH A;  4RT3 A;  4B9L A;  2W9B A;  1NKC A;  2MAX A;  1SL2 A;  1MC8 A;  4AT9 A;  4QZC A;  2BHN A;  4Q43 A;  4ED0 A;  4DSK A;  4IQT A;  4DFJ A;  1QSY A;  1S76 D;  3IM1 A;  1MIW A;  4DSF A;  4DEZ A;  5L9X A;  1T4G A;  3TI0 A;  3C5G A;  3ZD8 A;  4RQ5 A;  2XY5 A;  8ICA A;  2UVV A;  2DRB A;  4JV1 A;  5HC9 A;  3BQ0 A;  4HYK A;  2C22 A;  4DSJ A;  4O9M A;  1XU4 A;  1KLN A;  2HHQ A;  3WFQ E;  3UXO A;  3QZ8 A;  4YMN A;  4I2G A;  1ZQP A;  2FMP A;  1ZQK A;  1ZQR A;  3OSP A;  1HUO A;  4QZE A;  2F1H A;  4DQI A;  4X4R A;  4QWB A;  5KG0 A;  4YXJ A;  5KFN A;  3T5J A;  2XY7 A;  3JZ0 A;  4RQ4 A;  4DSE A;  2XY6 A;  5DB8 A;  4FS1 A;  8ICC A;  2IBK A;  5DG8 A;  2ID1 A;  4DLG A;  4RWN A;  1KEJ A;  4QZF A;  3L9D A;  3T5H A;  2ZH4 A;  2F1I A;  4X4N A;  5KG2 A;  5DB9 A;  2DVI A;  1TK8 A;  4DL6 A;  4I2D A;  1L5U A;  8ICR A;  4DQQ A;  5DGB A;  3OHA A;  2FLN A;  3N4M B;  4FHP A;  2HVH A;  4O5K A;  4ATB B;  3UQ0 A;  3RH5 A;  5J2D A;  4PGX A;  3OJS A;  3EYZ A;  2BQU A;  4AT8 B;  4RT2 A;  5KG5 A;  4EBK A;  5KFW A;  3PX6 A;  2V9W A;  5DGA A;  2DPJ A;  3GV5 B;  4KLH A;  5DG9 A;  1XSL A;  4BXO B;  4C8L A;  3BQT A;  3C5F A;  3MAB A;  2V4R A;  3GIK A;  5KFE A;  4CCH A;  3PO4 A;  4QZG A;  2PFP A;  2FPM A;  1CUK A;  4ZH4 A;  1ZJN A;  4O5E A;  1KFT A;  2W8K A;  1KSP A;  4FO6 A;  4M0A A;  5HHI A;  3JPP A;  7ICI A;  3RB3 A;  4FBU A;  4WC7 A;  4RQ8 A;  2RDJ A;  4RPY A;  3WFS C;  4RQ0 A;  1A76 A;  3Q8Q B;  4MEX A;  4KLL A;  5KFK A;  4Z6F A;  5KFH A;  4QZB A;  3UQ2 A;  5KT3 A;  3THV A;  4KN7 A;  5KFY A;  1TV9 A;  2PI4 A;  1QSL A;  2P6R A;  2ZTD A;  2ZJ8 A;  4YMO A;  1KRP A;  1JQR A;  4RWP A;  4WC3 A;  4WC2 A;  5D4B A;  4ELT A;  2R8K A;  4TUQ A;  5J2C A;  1ZQJ A;  2Q66 A;  4M6W B;  5KG1 A;  1ARO P;  3SYZ A;  8ICX A;  3TFS A;  5J2E A;  1U49 A;  4DSI A;  3GIJ A;  3ZDB A;  1NJZ A;  2C28 A;  4F91 B;  4F2R A;  4M9N A;  8ICY A;  4KLQ A;  4MFC A;  5KG7 A;  8ICN A;  4R65 A;  7ICL A;  7ICS A;  5DBB A;  4UAW A;  2FMQ A;  5J0P A;  3RB4 A;  2R8J A;  4KLD A;  8ICK A;  8ICS A;  3AQN A;  3LQC B;  1BPZ A;  5KFS A;  4TUS A;  5J2F A;  4KN4 A;  2XO7 A;  3EZ5 A;  2Y1I A;  4FBT A;  4M2Y A;  2ZH8 A;  3SZ2 A;  5KFX A;  8ICI A;  1A77 A;  1S10 A;  1DOQ A;  2M2U A;  4S3N A;  8ICV A;  1X2I A;  4R8U B;  1T7P A;  5HRH A;  3UXN A;  2ZTC A;  1DK2 A;  1B43 A;  1RXV A;  4I2B A;  4QW9 A;  3GFK B;  4ECQ A;  3QZ7 A;  4RQ6 A;  4RQ2 A;  2XCP A;  3PVX A;  2GWS A;  5EOZ A;  5J2A A;  4DL7 A;  1XSN A;  1S0O A;  4ECR A;  1UEU A;  5J2B A;  1SZP A;  4DLE A;  4IR9 A;  4TUP A;  3HIY A;  2JEF A;  4F4W A;  5DDM A;  4RZR A;  5HNK A; 
#chains in the Genus database with same CATH topology
 3BS5 B;  2VJ5 A;  3QX7 A;  3H39 A;  4Y2V A;  2BPF A;  5KNI A;  4LJX A;  2VA8 A;  4JK1 A;  5J0X A;  3TFR A;  1QLN A;  3ETL A;  3WK8 A;  3Q8L A;  2P66 A;  4US9 A;  2R8I A;  2UVU A;  5CRX A;  3IRU A;  2C2E A;  2J6T A;  4DOB A;  5B3P A;  4C4S A;  1N62 A;  5KT7 A;  1KTQ A;  4RWO A;  2F8L A;  4UBB A;  2OYY A;  5EE9 A;  5KL8 B;  1U9L A;  2EAM A;  5IIN A;  4LVS A;  4FHY A;  2OHF A;  4Y2T A;  2ZIW B;  3EUB 2;  4J9K A;  3RJF A;  9ICP A;  4WC1 A;  4C8N A;  2XC9 A;  1SKS A;  4US8 A;  3QU7 A;  3K75 D;  1TK0 A;  2BCS A;  2RLT A;  3WKB A;  7ICG A;  4AT7 B;  3IDW A;  2JMG A;  2FI1 A;  1A6S A;  3ISC A;  1WYG A;  2ISO A;  3PHZ A;  2DR9 A;  4OO1 J;  4J9M A;  2KE7 A;  5F2V O;  3D2N A;  3OUY B;  3HIL A;  3RAQ A;  1S0N A;  1NK6 A;  5KFG A;  4IC9 A;  1ZRN A;  3MGV A;  4IG8 A;  5J29 A;  1NO5 A;  4R8U A;  2VKQ A;  3IN5 A;  2XIC A;  4RQ7 A;  2QKQ A;  1UT8 A;  4NM2 A;  4OAG A;  3QEA Z;  3IP4 B;  3M9O B;  4YN4 A;  2KNJ A;  1UQV A;  3BS5 A;  3PSP A;  1BNP A;  4F8R A;  4ED2 A;  4P0P B;  1YT3 A;  4F5O A;  2BGW A;  1ZQD A;  3T3F A;  5IIJ A;  2LYB A;  4ECW A;  1FEZ A;  4NLK A;  2ZTE A;  3KOO A;  4E0D A;  3T5L A;  4I28 A;  4O3M A;  1V97 A;  2KZ3 A;  3QU5 A;  4JB3 A;  4A8E A;  4USA A;  4UD4 A;  3TAP A;  1V4A A;  2UVR A;  2K4I A;  3D2S A;  5CFS A;  2IOH A;  3H40 A;  3DV9 A;  3WK7 A;  2DR7 A;  1HEK A;  4O3S A;  5J0Q A;  3SV3 A;  5B3Q A;  4MFF A;  8ICQ A;  3CP8 A;  2HHP A;  2J6S A;  3G6Y A;  3F5E A;  3HP6 A;  2EZY A;  1ZQX A;  4KLU A;  4HAI A;  5CB1 A;  3NAS A;  5KT2 A;  1UA1 A;  2PFO A;  4YD2 A;  1L8O A;  4O68 A;  4EEY A;  4ECY A;  2KK0 A;  5AKK A;  3RR7 A;  4X4S A;  7ICJ A;  3H7I A;  2Q0Z X;  4CNQ A;  1NK0 A;  1ZQV A;  9ICM A;  2YML A;  4AT7 A;  1OU5 A;  4KMO B;  5KT6 A;  4M47 A;  4F4X A;  1NKB A;  3RJH A;  1TAM A;  5AM4 A;  8ICO A;  1RXW A;  2W8L A;  4AP9 A;  2KFZ A;  3WK9 A;  1N56 A;  2PMZ F;  4UD5 A;  2DR5 A;  3OVB A;  4OD0 A;  3SV4 A;  3V6J A;  1FA0 A;  4F5N A;  3PST A;  4YCX A;  1D8B A;  3RFA A;  4CF5 A;  3C28 A;  3SD7 A;  4X0A A;  4WOY A;  1CRX A;  5EWE A;  4ED1 A;  4EZ9 A;  3G6X A;  3RRG A;  4KLI A;  1Q3V A;  2YB4 A;  5C5J A;  2FPL A;  4RNM A;  1ZQC A;  4Y2P A;  3TAC B;  1RM6 C;  5HML A;  4DF8 A;  3ZD9 A;  4J9O A;  3Q8S B;  2A3V A;  9ICS A;  2KJ8 A;  3BZC A;  1C20 A;  3C1Z A;  2G07 A;  4FE3 A;  8ICF A;  3EW9 A;  2GLE A;  1ZQI A;  2WAQ C;  4RUC A;  3TAD C;  1VFG A;  3LWM A;  4FHX A;  2WF8 A;  4I0U A;  3KZX A;  1BPB A;  4KX3 A;  5KFI A;  1DRG A;  4UB5 A;  3N7R C;  2DF4 B;  5H2F U;  4QZ9 A;  1ZQF A;  4DQP A;  5AI6 A;  2DGZ A;  2I1Q A;  1N60 A;  4RQ3 A;  3MDA A;  5DEC A;  1ZD4 A;  2W9B B;  4ED6 A;  3RTV A;  5ALG A;  2K4E A;  4O3R A;  4GLX A;  1X42 A;  2RQ5 A;  2XGP A;  3PO5 A;  2G06 A;  2M2W A;  2XVT A;  4MHV A;  2KZZ A;  4F93 B;  1ZQT A;  3LYS A;  5J8Y A;  3AQM A;  1NNL A;  5L1L A;  1RDF A;  1ZET A;  4QJF B;  5J2G A;  2JEJ A;  5ALS A;  3AEV A;  2G0A A;  3K4G A;  4LEY A;  5AIB A;  4UAY A;  5CR0 A;  5AK6 A;  4UAV A;  3GV7 B;  5F9L A;  3EPG A;  2DFL A;  5KFJ A;  7ICN A;  4J9S A;  2KFN A;  2A1A A;  2F44 A;  5HRI A;  4M5D A;  5AK4 A;  5JTG A;  3F2D A;  1F0M A;  3NS1 A;  1VJ5 A;  5HR7 A;  3PW0 A;  1S77 D;  3GZF A;  1ZD2 P;  2Z7J A;  2R18 A;  5ALW A;  4RUA A;  3JPT A;  1RG6 A;  1O03 A;  2CRX A;  3HWT A;  5KG4 A;  1NJX A;  1ZQO A;  4O69 A;  1L3T A;  3AQF A;  3UPQ A;  3SI8 A;  3OWG A;  1Y88 A;  3B9J A;  9ICU A;  3C1Y A;  3CK6 A;  2NO5 A;  1LVH A;  4ECV A;  2E8N A;  3KKA C;  3C21 A;  4P2H A;  3H8W A;  2H3V A;  2BE3 A;  1D8L A;  1SL1 A;  4FZM A;  3KHH A;  3Q8P B;  2ASD A;  4K4I A;  2KZM A;  4IRD A;  2W04 A;  1ZQW A;  2RP5 A;  1L7P A;  4UB1 A;  2AQ4 A;  1WCN A;  4XRH A;  4CF4 A;  4B9L A;  2W7P A;  1O08 A;  2W9B A;  2MAX A;  1SL2 A;  1MC8 A;  3SEI A;  4KB6 A;  5JTI A;  4ED0 A;  4WH5 A;  4IQT A;  1K5O A;  4DSF A;  2HSZ A;  3C5G A;  2XY5 A;  1Q46 A;  2UVV A;  8ICA A;  1J97 A;  2EZX A;  4O9M A;  2HHQ A;  1KLN A;  3UXO A;  4YMN A;  1ZQP A;  2FMP A;  2QAR B;  1HUO A;  4EEL A;  4X4R A;  1TE2 A;  4QWB A;  5ALP A;  2XY6 A;  4RWN A;  2ID1 A;  1KEJ A;  2F1I A;  2Y0S C;  4NJ8 A;  2HCF A;  4QIW F;  4I2D A;  1L5U A;  2G09 A;  3AL0 B;  5DGB A;  2FLN A;  4O5K A;  4NLC A;  3UQ0 A;  1HIW A;  5J2D A;  4PGX A;  4WJ3 B;  4RT2 A;  4F71 A;  4EBK A;  3PX6 A;  2ZIU B;  4UB6 U;  5DG9 A;  3BQT A;  2V4R A;  5KFE A;  4QZG A;  1ZJN A;  2EQY A;  4F72 A;  1KSP A;  2H3I A;  2B0C A;  4FBU A;  2RDJ A;  2HBJ A;  3QU2 A;  4RQ0 A;  3Q8Q B;  4MEX A;  4Z6F A;  2E3T A;  4KN7 A;  1TV9 A;  2HOI A;  2JR5 A;  3L3F X;  1ZQJ A;  8ICX A;  3WKA A;  2PKE A;  1T3Q A;  7ICL A;  4KM5 A;  4C0Z A;  4UAW A;  2R8J A;  5J0P A;  2YY6 A;  2LBO A;  3RB4 A;  4KLD A;  2ZH8 A;  1VDV A;  2M2U A;  8ICV A;  1X2I A;  5HRH A;  2ZTC A;  5AK3 A;  5ALT A;  4I2B A;  4QW9 A;  3PVX A;  2E5S A;  2XCP A;  5J2A A;  4DLE A;  5DDM A;  4RZR A;  2IOF A;  2ZHB A;  8ICM A;  4FHW A;  1FFU A;  1R8A A;  1MQ3 A;  1ZQU A;  1TAQ A;  4KLF A;  3WKC A;  3AM9 A;  4DQR A;  5HRK A;  3MGH A;  3ORY A;  4PHE A;  1NZP A;  9ICT A;  1ZOL A;  2HN1 A;  2RRD A;  4MF2 A;  1BNO A;  2ZUC A;  4EP7 A;  4F5R A;  5KFQ A;  4QZ8 A;  2YMP A;  4R63 A;  1MSW D;  4PPX A;  5D49 A;  1K1Q A;  1T3N A;  1SWV A;  2K89 A;  5J2I A;  2DR8 A;  4RWQ A;  2QB0 B;  2ZIU A;  3QNM A;  2FLL A;  4MF8 A;  4K9B A;  1U4B A;  4YR3 A;  2JRZ A;  4YD1 A;  3RBE A;  4YVZ A;  3PX4 A;  2DPI A;  2NRW A;  5ALR A;  1SXD A;  2O1P A;  3F2B A;  5HRF A;  4P4M A;  2BCU A;  2ZH7 A;  3PR5 B;  2AQ0 A;  4KX5 A;  3RH6 A;  3JCF A;  4PGY A;  1NK4 A;  1KFS A;  3KTQ A;  4B9T A;  4Y2U A;  3H4D A;  4NLN A;  4QWA A;  8ICE A;  1GO3 F;  2NO4 A;  8ICH A;  3Q8R B;  2NV3 A;  5B66 U;  4UAZ A;  4U6P A;  1JAL A;  4NXZ A;  2I9G A;  2W3S A;  4LZG A;  4O0I A;  4BGD A;  1TFY A;  3N7P D;  1FIQ A;  2IHM A;  2BPC A;  2F76 X;  4XA5 A;  3M9N B;  3V6K A;  1XO1 A;  2WF7 A;  3PZP A;  2F2A B;  2W3R A;  3GII A;  4EBC A;  4M9J A;  3GU3 A;  4Y2Q A;  5ALE A;  1MN8 A;  4C80 A;  1KDH A;  1PUZ A;  4Q8F A;  2BDP A;  1KBU A;  1JRP A;  4X5V A;  2A1J A;  3JPS A;  4RNO A;  4QWE A;  4JV2 A;  5HRB A;  2HHS A;  4M9L A;  2G5I B;  2LM1 A;  1SV0 C;  4GXK A;  4B6J A;  4J9N A;  4NLZ A;  5D46 A;  3LDA A;  2HBL A;  4YR0 A;  1X40 A;  2YTU A;  5KFZ A;  4K99 A;  1R89 A;  3CW2 C;  5DDY A;  1B4F A;  3IHQ B;  3RF9 A;  2HW3 A;  4EBJ A;  4B9N A;  1WG8 A;  4UAU A;  1NZB A;  4M9G A;  2DRA A;  4MFA A;  1ZQA A;  3L4P A;  2HN2 A;  4RNN A;  5AIA A;  2LMR A;  4PGQ A;  4X4O A;  2W9M A;  4I2A A;  4EGW A;  4F4Z A;  4O3Q A;  3C18 A;  1D8Y A;  2PFN A;  4EEB A;  2HHU A;  2BR0 A;  1T94 A;  4Q45 A;  1ECW A;  3F53 A;  4PL2 A;  3RJJ A;  3NRZ A;  1ZQL A;  4ECT A;  4IQV A;  2W9A A;  2HHV A;  5AIC A;  2FDR A;  8ICP A;  4KLO A;  5ALL A;  5J0Y A;  2B56 A;  4B9U A;  3AU6 A;  5ALY A;  1X9X A;  9ICC A;  1ZD5 A;  2FLP A;  1U48 A;  2XI9 A;  3OSN A;  4YP3 A;  4DL5 A;  4J03 A;  3C2M A;  1UT5 A;  1XNS A;  4I2J A;  3D2Q A;  1XC9 A;  1TFW A;  3PMN A;  8ICJ A;  3MCR A;  7ICF A;  1ZQY A;  5DED A;  3TAD A;  2ZJA A;  3B0Y A;  2IMW P;  3BJY A;  2VA2 A;  1ZXI A;  4QZD A;  1ZQB A;  3U26 A;  1IG6 A;  3Q8K A;  3K1R B;  1X9M A;  2W43 A;  4X0B A;  2YMM A;  1FO4 A;  5JUM A;  4JV0 A;  4UAR A;  5TIS U;  4C7Z A;  2R8G A;  5AK5 A;  5J0S A;  3ZDC A;  4EYH B;  4K96 A;  4ED3 A;  3SQI A;  2E1E A;  1L3U A;  4M9H A;  2YN4 A;  2OCE A;  4Y2X A;  3NTU A;  2L5Y A;  4DS5 A;  2EH9 A;  1LKY B;  2BKE A;  3ER9 B;  1B0X A;  3GIM A;  2NRZ A;  3TAR A;  5AM0 A;  3FAH A;  3OGU A;  2W11 A;  3ER8 C;  4LZD A;  5ALU A;  2XCA A;  2ZHA A;  1ZQE A;  3JPQ A;  2E8P A;  2Y9U A;  5L1M A;  1PVP A;  2JEG A;  2DUY A;  1Z4O A;  5EWF A;  3PW7 A;  2VA3 A;  4QW8 A;  5AKL A;  1FFV A;  1NKE A;  9ICR A;  4DL2 A;  3V72 A;  4UBC A;  3NVO A;  1QQ6 A;  2CXY A;  4MKP A;  2LHT A;  1F5A A;  4NL9 C;  1JXE A;  1BVS A;  5ALK A;  1MQ2 A;  4XUS A;  2ZIW A;  1JX4 A;  2MU2 A;  4OCZ A;  4TQS A;  1QQ5 A;  3MBY A;  5DB7 A;  2GAF D;  1QSS A;  2Q4T A;  4EZ6 A;  1U47 A;  1Q79 A;  4UB2 A;  4E80 A;  2OWO A;  1ZQZ A;  3KKA A;  2PI5 A;  5EE1 A;  1WCL A;  1KFD A;  3IG5 A;  2IHN A;  8ICB A;  3H8S A;  4IR1 A;  4K4G A;  9ICJ A;  4EEK A;  3OUY A;  5KFA A;  1SIJ A;  4PHA A;  1ZQH A;  2YQE A;  3M8R A;  3UMB A;  4CGZ A;  1MIY A;  5G5G A;  5KAI U;  3AQK A;  3MR6 A;  3BDP A;  3NRW A;  3HJ1 A;  5KG6 A;  4EEN A;  2ASJ A;  1KQQ A;  5KFM A;  5IIL A;  1PZN A;  3NVY A;  4J9L A;  3ED5 A;  4WQL A;  1DK3 A;  4F4Y A;  1NK9 A;  2K8C B;  4OJL A;  9ICF A;  3UMG A;  3QEB Z;  1S5L U;  3HPO A;  8ICZ A;  4ELV A;  4GFJ A;  3M1Y A;  1LV5 A;  1CEZ A;  2KEY A;  2JV3 A;  4P0P A;  4RT3 A;  2JH7 A;  4EX7 A;  2LM4 A;  1MIW A;  3A0B U;  2KMD A;  4DEZ A;  5L9X A;  1T4G A;  3TI0 A;  3ZD8 A;  2DRB A;  4JV1 A;  3BQ0 A;  2KSO B;  3SMV A;  3UMC A;  1QQ7 A;  4I2G A;  4QZE A;  4DQI A;  3T5J A;  2XY7 A;  3JZ0 A;  4RQ4 A;  4FS1 A;  8ICC A;  2IBK A;  5DG8 A;  3S6J A;  4DLG A;  2ZH4 A;  2QB1 A;  4X4N A;  2XID A;  2DVI A;  4DQQ A;  4ATB B;  3CRX A;  3RH5 A;  3LVW A;  4AT8 B;  5AKY A;  3GV5 B;  4KLH A;  3ICX A;  2LYA A;  3PO4 A;  2HOQ A;  4O5E A;  1CUK A;  4ZH4 A;  2W8K A;  4FO6 A;  3JPP A;  1N5X A;  4RPY A;  2FJ6 A;  1A76 A;  4Y2S A;  2B6G A;  5KFK A;  5KFH A;  3UQ2 A;  2MRL A;  3THV A;  5HRG A;  5KFY A;  2P6R A;  4C7Y A;  2R8K A;  3AMZ A;  5D62 A;  3NVV A;  5KG1 A;  1ARO P;  2YX8 A;  1UCV A;  1YZ6 A;  1NJZ A;  4F91 B;  4NXX A;  8ICY A;  1Z4N A;  3SEN A;  5KG7 A;  7ICS A;  1KKX A;  2LPE A;  8ICK A;  8ICS A;  1BPZ A;  5KFS A;  4TUS A;  1X66 A;  1Z19 A;  1ED1 A;  8ICI A;  1A77 A;  4S3N A;  4NV0 A;  1T7P A;  1DK2 A;  1B43 A;  5ALH A;  1RXV A;  2D3D A;  4RQ6 A;  4DL7 A;  1S0O A;  2EAO A;  4F4W A;  4KMU A;  5HNK A;  4DFP A;  2GOL A;  4QWD A;  2WB1 C;  4NLB A;  5J0O A;  1DGJ A;  3AU2 A;  1N48 A;  4DF4 A;  2HDO A;  4PZO A;  4IRC A;  1Z00 B;  4QZI A;  2E8O A;  2EWR A;  2AXT U;  5DG7 A;  3HX0 A;  2KSO A;  2ZH1 A;  2ODG A;  1BGX T;  1IV8 A;  3GV8 B;  3IG8 A;  3ALR A;  4Z6D A;  5CFU A;  3NVW A;  5KTQ A;  3JYY A;  1JUD A;  4NKT A;  4KLM A;  1C7Y A;  3OTQ A;  2OH2 A;  9ICV A;  2G08 A;  3WFP A;  1K1S A;  2F8K A;  1BPD A;  4YR2 A;  4WC0 A;  3HJE A;  4WC5 A;  3PW2 A;  4WCW A;  1M6Y A;  2AHO B;  3RBD A;  3E58 A;  5AI4 A;  2ES6 A;  3PY8 A;  3OV7 A;  2JEI A;  2KV2 A;  4R64 A;  4NWI A;  3G6V A;  4KLG A;  2HI0 A;  5GTI U;  3C2L A;  2C2D A;  5L1K A;  4EX6 A;  2I5H A;  4B9V A;  3C66 A;  2DL0 A;  2BPG A;  1TAU A;  4KIT B;  3J81 j;  3PNC A;  4ICA A;  2ZH3 A;  4FZL A;  9ICW A;  1H38 A;  1SV0 A;  4Q8E A;  3V7L A;  4NLG A;  4DFD A;  9ICG A;  1NJY A;  4TUR A;  2BQ3 A;  3QUT A;  1ZYQ A;  2ZH5 A;  2VIX A;  2ZUD A;  1BPX A;  3AQE A;  2KD1 A;  1HUZ A;  4I2E A;  9ICI A;  1PVQ A;  3H8M A;  5E79 U;  5TZV A;  1Z00 A;  4DL3 A;  3NYB A;  5IIO A;  3KZI U;  3KHG A;  3D6J A;  1Q3U A;  1XSP A;  4TQR A;  4LEW A;  5KFO A;  5DLG A;  3MFI A;  5DBA A;  4I2I A;  1MA7 A;  4ECZ A;  2KHQ A;  2KIV A;  1ZQN A;  2CN1 A;  4B9S A;  4PJ0 U;  4NY8 A;  4ED8 A;  7ICM A;  3FYH A;  5CP2 A;  2AGO A;  1TVA A;  2GA9 D;  4C8O A;  2HHT A;  3ETR A;  3SAH A;  3RAX A;  2NRK A;  3KHL A;  1RPL A;  4B9M A;  3RB6 A;  5D63 A;  5FP0 A;  3RR8 A;  4LT6 A;  3LWL A;  3EPI A;  3MGI A;  3FM9 A;  3H37 A;  2B21 A;  2O6K A;  3QU9 A;  2BBH A;  2QAR A;  5KFB A;  5KFR A;  7ICQ A;  5HHH A;  2KJ5 A;  2D8C A;  3FDS A;  2EAP A;  4IL6 U;  5KFT A;  1TKD A;  1L7O A;  1SXE A;  5KFL A;  4PZN A;  5T14 A;  5BOL A;  5GTH U;  3H4B A;  2KN7 A;  2IHO A;  2C2R A;  4BWJ A;  2KKV A;  3BQ1 A;  1SKR A;  4I29 A;  4DSL A;  2MA1 A;  2BZF A;  7ICV A;  1PK3 A;  5J2K A;  1VLB A;  3TAQ A;  5HRD A;  1NJW A;  2BCQ A;  4DCC A;  5KT5 A;  4ECX A;  8ICW A;  2ZG6 A;  2F77 X;  3SAG A;  2KIW A;  3R9K A;  1Z1B A;  3H8J A;  2BCR A;  5AKX A;  4DL4 A;  1S8O A;  7ICR A;  3KHR A;  4O67 A;  2WAQ F;  5J0T A;  4X4U A;  2M2V A;  3HKZ C;  8ICU A;  2KTQ A;  2RDI A;  3RB0 A;  2I6X A;  4P4O A;  4G3I A;  4EV6 A;  5EWG A;  7ICO A;  5IIK A;  3HT3 A;  3A0H U;  4FHV A;  3RRH A;  2H3F A;  4GC7 A;  4QNL A;  4GXJ A;  2ZIV B;  1X9W A;  3DEE A;  5CJ7 A;  4DWI A;  2QLT A;  4MEY A;  1WUD A;  1V85 A;  1Q8K A;  5ALM A;  3C23 A;  3QU4 A;  5KL1 B;  4C4R A;  4NL9 A;  3PR4 A;  4U7C A;  2KOB A;  1SWW A;  3HJ4 A;  3NKU A;  1IXR A;  1V9P A;  5J2H A;  2ZH9 A;  3NGD A;  3RJI A;  3PV8 A;  1A0P A;  1NK7 A;  1RZT A;  1JMS A;  1COO A;  4F50 A;  3M9M B;  3C2K A;  2QB0 A;  1X6I A;  5KFU A;  4QZH A;  5AKJ A;  1XO0 A;  1PX5 A;  9ICL A;  4OJ5 A;  1BPE A;  3N7S C;  5CFT A;  4I2C A;  1AQ6 A;  2P6U A;  3JPO A;  3UM9 A;  4P0Q B;  2WF9 A;  2ZIX B;  4NXV A;  3QE9 Y;  3H3A A;  2MSN A;  4I2H A;  3EF2 A;  1Z3E B;  4J9P A;  2HHW A;  5DKW A;  2WB1 F;  3WK6 A;  2LI6 A;  1NOM A;  3B0X A;  3NWI A;  4CE6 A;  5J0U A;  2AU0 A;  1P7D A;  1XS9 D;  4Y2J A;  3QUC A;  4E7X A;  2F3N A;  2KP7 A;  4BDP A;  5BPC A;  3WKD A;  5F9N A;  3ERC C;  1YLQ A;  4X4T A;  3MC1 A;  2ZUB A;  3WK5 A;  3N97 B;  1Q78 A;  5CA7 A;  4Z6C A;  3FC4 A;  5CHG A;  4EED A;  3ISD A;  2ASL A;  1JIH A;  3GQC A;  3AQL A;  4IRK A;  2HBM A;  4KLE A;  1R8B A;  2EDU A;  4M04 A;  4PHD A;  5J0R A;  5AI0 A;  2Y9T A;  2ZIV A;  3BS7 A;  3PX0 A;  7ICE A;  4JUZ A;  4JLZ A;  4NXT A;  4QZC A;  3NUQ A;  3PSF A;  4DFJ A;  1QSY A;  3IM1 A;  3M7D A;  1JRO A;  2KG5 A;  4UB8 U;  3C29 A;  4RQ5 A;  5AKZ A;  2DBY A;  2KJ9 A;  5HC9 A;  4HYK A;  5G5H A;  4DSJ A;  3WFQ E;  5CHE A;  3QZ8 A;  1ZQK A;  1L7M A;  1ZQR A;  4BX9 C;  2Y0S F;  4YXJ A;  4K8V A;  4DSE A;  5DB8 A;  3QXG A;  4ACO A;  3L9D A;  1ZRM A;  3QYP A;  5KG2 A;  1TK8 A;  4DL6 A;  3N28 A;  3OHA A;  2W03 A;  2NYV A;  3N4M B;  4AYB C;  2BQU A;  4QIW C;  5K4L A;  5KG5 A;  5KFW A;  2V9W A;  2DPJ A;  3HRD D;  1DXS A;  4P0Q A;  2ZIX A;  3WU2 U;  1GPJ A;  4BXO B;  4OAH A;  2D6F C;  3MAB A;  3GIK A;  4CCH A;  1KFT A;  4OAF A;  2K4H A;  4M0A A;  3H0L B;  5HHI A;  7ICI A;  3RB3 A;  4RQ8 A;  3WFS C;  4KLL A;  4QZB A;  5KT3 A;  2W55 A;  2ZTD A;  1KRP A;  1JQR A;  2IUB A;  4WC2 A;  5D4B A;  4TUQ A;  5J2C A;  2Q66 A;  1UPH A;  4M6W B;  2DWQ A;  3SYZ A;  5ALZ A;  3TFS A;  5J2E A;  1U49 A;  4CF3 A;  3GIJ A;  4F2R A;  5A0L A;  2C28 A;  1J2M A;  4KLQ A;  4FFD A;  1N2X A;  2FMQ A;  3AQN A;  3LQC B;  2A19 A;  4KN4 A;  5ALI A;  3EZ5 A;  2Y1I A;  4M2Y A;  3SZ2 A;  5KFX A;  1J2N A;  1DOQ A;  2K60 A;  2LKY A;  2DQN B;  2YMQ A;  1RQN A;  3QZ7 A;  4RQ2 A;  2GWS A;  5EOZ A;  1UEU A;  1UHU A;  4RQN A;  1SZP A;  5J2B A;  4IR9 A;  4TUP A;  4JLX A;  1V38 A;  3MFH A;  5HP4 A;  2ATL A;  1RYS A;  1KNY A;  2ZH2 A;  3NVZ A;  3I1Y A;  2DKZ A;  2BCV A;  3ISB A;  5HMM A;  3MDC A;  3T79 A;  2NRX A;  9ICA A;  2AJQ A;  1F44 A;  1NK8 A;  1QH9 A;  4BJQ A;  5HRE A;  5III A;  4P4P A;  1HJP A;  3ZDD A;  3JPN A;  2O5A A;  4K4H A;  5ALF A;  2MUT B;  5L1J A;  4X4P A;  5AHX A;  2FE9 A;  1LKY A;  2W54 A;  4YMM A;  5EE3 A;  5DQI A;  5BOM A;  3MR2 A;  1QCK A;  1TK5 A;  4C8K A;  4BXO A;  1JAJ A;  3KFU F;  5L1I A;  4XQ7 A;  1COK A;  3SR6 A;  2E1F A;  1T8E A;  4Q44 A;  4RPZ A;  2K8A A;  3OHB A;  1X9S A;  7ICP A;  3AUO A;  3HW8 A;  2UVW A;  4YFK A;  4UAT A;  1SV4 A;  4C8M A;  4F5P A;  2HBK A;  4M6W A;  1OXJ A;  4UW9 A;  5KT4 A;  2HOF A;  4X4Q A;  3DDH A;  1WOT A;  3HKZ F;  9ICX A;  2H3Q A;  4LEV A;  4YQW A;  1PK1 B;  3L5K A;  1VJ7 A;  2OM6 A;  2IA6 A;  9ICN A;  3V7J A;  2EAN A;  2LYH A;  5AM5 A;  3MR5 A;  1NK5 A;  1S97 A;  1UET A;  4DOC A;  3ONN A;  1UEV A;  5DQH A;  7ICH A;  4ZOH C;  3JPR A;  3BQ2 A;  9ICQ A;  3I28 A;  3O0F A;  4ECS A;  2ZH6 A;  4CRX A;  4O3P A;  1X6J A;  4FH5 A;  4N7R A;  2ISP A;  1S0V A;  2KVS A;  5J0W A;  5AI8 A;  1ZQM A;  5ALV A;  3WKE A;  5D61 A;  2NRT A;  5ALX A;  1ZQ1 C;  3K7D A;  2W9C B;  3WFO A;  1DGS A;  1L3V A;  2JHD A;  2KKP A;  2AGP A;  3LK9 A;  4ELU A;  2IOF K;  5DB6 A;  7ICT A;  4R66 A;  2B51 A;  4PL1 A;  2MUT A;  4OJO A;  5DLF A;  4I27 A;  4RPX A;  1WWU A;  4DFK A;  5AM2 A;  5AI5 A;  7ICU A;  1IIP A;  2PXI A;  5F3X B;  1KL9 A;  3QUQ A;  3PSI A;  1RYU A;  4KLT A;  5ALN A;  4QZA A;  3E0F A;  2KHV A;  3ZI4 A;  1ZQQ A;  3CYM A;  1D9D A;  3H0M B;  1N63 A;  1YZ7 A;  5AM1 A;  5KFF A;  4X4V A;  2CPR A;  9ICK A;  4WC4 A;  4F4K A;  1EXN A;  8ICL A;  4GC6 A;  2ALZ A;  4IQW A;  3UXP A;  4KLJ A;  3PW4 A;  1D9F A;  3M8S A;  1L7N A;  1KW4 A;  3V7K A;  5JRT A;  2RFF A;  3PML A;  5HRL A;  4NKU A;  4K98 A;  4OJP A;  2M2T A;  3OJU A;  3OVA A;  9ICB A;  1PK1 A;  5HR9 A;  4ATB A;  3GIL A;  2HVI A;  4AT8 A;  4RQM A;  2E8M A;  4NM1 A;  5AKG A;  4DOA A;  3TQ1 A;  2FMS A;  4EBD A;  4F5Q A;  3RJG A;  5C0Y A;  2BQR A;  2K8B B;  9ICE A;  3EWA A;  3MR3 A;  3PW5 A;  2WF6 A;  4C4T A;  4QWC A;  4FS2 A;  5KFP A;  5J2J A;  1ZJM A;  4KTQ A;  3UPS A;  4UB4 A;  4DO9 A;  3KBB A;  2M9N A;  3QUB A;  1SZH A;  5KFC A;  2FCL A;  1SB3 C;  4XQ8 A;  2JH1 A;  4IS7 A;  5EE0 A;  1ZD3 A;  2AGQ A;  5JU5 A;  3TKA A;  5DQG A;  2P35 A;  1Z1V A;  4J9Q A;  4DQS A;  3WFR E;  2YB1 A;  4O5C A;  4BWM A;  4PHP A;  4DFM A;  4EBE A;  4HX0 A;  4CDG A;  4KLS A;  2JZB B;  2Y1J A;  5ALO A;  2W9C A;  2WFA A;  2H5X A;  1JN3 A;  4I2F A;  8ICG A;  3H0R B;  2VAN A;  3K1Z A;  5KFD A;  2OXO A;  1URJ A;  2N1R A;  5AKH A;  2BDU A;  3ZDA A;  5DBC A;  2ZXH A;  2V4Q A;  1WWV A;  4ED7 A;  5AM3 A;  1B22 A;  4DS4 A;  4WC6 A;  1IM4 A;  4AYB F;  1SL0 A;  2J6U A;  7ICK A;  1LB2 B;  1NI3 A;  3CNH A;  5ALD A;  1R8C A;  5ALQ A;  2R8H A;  2G5H B;  5KFV A;  1L6N A;  3TAN A;  2BBJ A;  4AT9 B;  4RU9 A;  3VCB A;  3T5K A;  1ZQS A;  2M0N A;  2KVC A;  2JGA A;  1U45 A;  2GH1 A;  3BZK A;  4FH3 A;  4F92 B;  1SKW A;  1L8L A;  3F2C A;  2WTF A;  5KG3 A;  3Q8M A;  5CEH A;  4NXU A;  4BUG A;  1OUQ A;  5CWR A;  3OVS A;  4E8F A;  5IIM A;  5AI9 A;  3BQ7 A;  2GO7 A;  4Y2Y A;  1S9F A;  4UB3 A;  2F1J A;  5HR6 A;  4Y2R A;  1L3S A;  4Z6E A;  1PVR A;  4F3O A;  2WF5 A;  4PH5 A;  1OW5 A;  2EZZ A;  1XWL A;  1UA0 A;  5KAF U;  1QTM A;  4NXW A;  5J8Y C;  2NRV A;  3RJK A;  1RYR A;  1TFR A;  3RH4 A;  4FZN A;  3H38 A;  2A1J B;  4IQU A;  3GDX A;  3OPX A;  1MIV A;  1S0M A;  4JWM A;  2WHE A;  2PBE A;  4WBZ A;  4YXM A;  2HMX A;  2JZB A;  8ICT A;  2XGQ A;  3SAF A;  4K9A A;  4O3O A;  2FPK A;  4F2S A;  3RJE A;  2PFQ A;  3F5A A;  4EYI B;  1BPY A;  9ICO A;  1F5S A;  4J9R A;  1ZQG A;  4O3N A;  9ICH A;  3LVV A;  4RQ1 A;  2PMZ C;  4WBY A;  5AKE A;  4WQK A;  3WK4 A;  3E2E A;  1JXL A;  4ECU A;  2VJ4 A;  5ALJ A;  2HHX A;  4YG2 A;  2ZJ5 A;  4JWN A;  1SGG A;  3V6H A;  5AKI A;  3ZDE A;  4UQG A;  4UAS A;  4GXI A;  2KIC A;  1NKC A;  4AT9 A;  3AN1 A;  2BHN A;  4Q43 A;  1CI4 A;  4DSK A;  1S76 D;  1JI7 A;  1RQL A;  2C22 A;  2ZXI A;  1XU4 A;  3OSP A;  2F1H A;  2W7O A;  5KG0 A;  5KFN A;  1N61 A;  4QZF A;  3M6Z A;  3T5H A;  2AH5 A;  5DB9 A;  5B5E U;  1N5W A;  1KN5 A;  4G9B A;  8ICR A;  4OAI Z;  4FHP A;  2HVH A;  3OJS A;  3EYZ A;  3M6K A;  5DGA A;  1XSL A;  4C8L A;  4XJE A;  3C5F A;  2PFP A;  2FPM A;  4WC7 A;  2H3Z A;  3KD3 A;  2PI4 A;  3IV6 A;  1QSL A;  2ZJ8 A;  4RWP A;  4YMO A;  4WC3 A;  4ELT A;  2ESE A;  3VC8 A;  4DSI A;  4FO1 A;  3ZDB A;  4M9N A;  2RHF A;  4JMU A;  4LEZ A;  4MFC A;  8ICN A;  4R65 A;  5DBB A;  4OJ6 A;  5J2F A;  2XO7 A;  4O6A A;  2JXJ A;  4FBT A;  1S10 A;  2DKX A;  4R8U B;  2OEH A;  2B4V A;  3UXN A;  4K97 A;  3GFK B;  4ECQ A;  2K4P A;  1XSN A;  4ECR A;  3HIY A;  3I76 A;  2JEF A;  4GIB A; 
#chains in the Genus database with same CATH homology
 4DFP A;  3MFH A;  8ICM A;  4FHW A;  4QWD A;  5HP4 A;  1R8A A;  1MQ3 A;  1ZQU A;  5J0O A;  2ATL A;  3AU2 A;  1RYS A;  1KNY A;  1N48 A;  3H39 A;  4DF4 A;  2BPF A;  4IRC A;  2ZH2 A;  1Z00 B;  1TAQ A;  4QZI A;  4KLF A;  4DQR A;  2BCV A;  5HRK A;  2VA8 A;  4JK1 A;  5HMM A;  3HX0 A;  3ISB A;  5DG7 A;  5J0X A;  3TFR A;  1QLN A;  3ETL A;  3MGH A;  3MDC A;  2ZH1 A;  3ORY A;  4PHE A;  1NZP A;  2NRX A;  3Q8L A;  9ICT A;  2P66 A;  9ICA A;  2R8I A;  2UVU A;  1BGX T;  2AJQ A;  2C2E A;  4MF2 A;  3GV8 B;  2J6T A;  4DOB A;  1BNO A;  2ZUC A;  1NK8 A;  5HRE A;  4Z6D A;  5KT7 A;  1KTQ A;  5III A;  4EP7 A;  4RWO A;  4P4P A;  4UBB A;  1HJP A;  4F5R A;  5KTQ A;  3JPN A;  3ZDD A;  2O5A A;  3JYY A;  5KFQ A;  4NKT A;  4KLM A;  4K4H A;  1C7Y A;  2MUT B;  5L1J A;  4X4P A;  9ICV A;  1U9L A;  3WFP A;  4QZ8 A;  4R63 A;  1MSW D;  4PPX A;  1K1S A;  5IIN A;  4LVS A;  5D49 A;  1BPD A;  4YR2 A;  1K1Q A;  1T3N A;  4YMM A;  4FHY A;  5J2I A;  2DR8 A;  5DQI A;  4RWQ A;  5HRG A;  5BOM A;  4WC0 A;  3MR2 A;  4WC5 A;  2FLL A;  3PW2 A;  4MF8 A;  4WCW A;  1TK5 A;  4C8K A;  1U4B A;  4YR3 A;  4BXO A;  1JAJ A;  4J9K A;  5L1I A;  4XQ7 A;  4YD1 A;  3RBD A;  3RBE A;  3RJF A;  9ICP A;  4WC1 A;  4C8N A;  4YVZ A;  2XC9 A;  3PX4 A;  1SKS A;  2NRW A;  2DPI A;  3PY8 A;  1T8E A;  3K75 D;  4Q44 A;  4RPZ A;  2O1P A;  3OV7 A;  2JEI A;  1TK0 A;  3OHB A;  4R64 A;  2BCS A;  2ZH7 A;  1X9S A;  4P4M A;  2BCU A;  7ICP A;  3AUO A;  3G6V A;  3HW8 A;  3PR5 B;  2UVW A;  4YFK A;  4KLG A;  7ICG A;  4AT7 B;  2AQ0 A;  4C8M A;  3C2L A;  3ISC A;  3RH6 A;  4PGY A;  1NK4 A;  1KFS A;  4F5P A;  3KTQ A;  3H4D A;  2ISO A;  4B9T A;  4M6W A;  4QWA A;  8ICE A;  2DR9 A;  2C2D A;  8ICH A;  5KT4 A;  3Q8R B;  4X4Q A;  4UAZ A;  5L1K A;  4J9M A;  4B9V A;  3C66 A;  2ZHB A;  1WOT A;  5F2V O;  4NXZ A;  3OUY B;  9ICX A;  2I9G A;  3RAQ A;  1S0N A;  1NK6 A;  4YQW A;  5KFG A;  2BPG A;  1TAU A;  4LZG A;  4O0I A;  4BGD A;  4KIT B;  1TFY A;  3PNC A;  2ZH3 A;  1VJ7 A;  2IA6 A;  9ICN A;  2IHM A;  9ICW A;  2BPC A;  1H38 A;  4IG8 A;  4XA5 A;  2LYH A;  3MR5 A;  1XO1 A;  3M9N B;  5J29 A;  3V7J A;  3V6K A;  1NK5 A;  1S97 A;  4R8U A;  4Q8E A;  1NO5 A;  3V7L A;  4NLG A;  3GII A;  4RQ7 A;  4EBC A;  4M9J A;  9ICG A;  1UET A;  4DOC A;  1UT8 A;  4NM2 A;  1NJY A;  4TUR A;  1UEV A;  5DQH A;  2BQ3 A;  1KDH A;  7ICH A;  3JPR A;  3BQ2 A;  3QEA Z;  1ZYQ A;  2BDP A;  4Q8F A;  2ZH5 A;  3M9O B;  9ICQ A;  4YN4 A;  4X5V A;  4ECS A;  2A1J A;  3JPS A;  4RNO A;  2ZUD A;  4O3P A;  4QWE A;  1BPX A;  4JV2 A;  5HRB A;  2HHS A;  4M9L A;  1BNP A;  1HUZ A;  4FH5 A;  4F8R A;  4ED2 A;  4I2E A;  2ISP A;  9ICI A;  4F5O A;  2BGW A;  5TZV A;  1Z00 A;  3T3F A;  1ZQD A;  4DL3 A;  1S0V A;  3NYB A;  5J0W A;  4GXK A;  4J9N A;  5IIO A;  4NLN A;  5IIJ A;  4NLZ A;  5D46 A;  3KHG A;  3LDA A;  4ECW A;  1ZQM A;  4NLK A;  4YR0 A;  1XSP A;  2ZTE A;  2NRT A;  4TQR A;  5KFZ A;  5DLG A;  5KFO A;  3MFI A;  3T5L A;  4E0D A;  4I28 A;  5DBA A;  2KZ3 A;  2W9C B;  1R89 A;  4I2I A;  3WFO A;  1DGS A;  1L3V A;  5DDY A;  4ECZ A;  3IHQ B;  1ZQN A;  2AGP A;  4UD4 A;  3TAP A;  1V4A A;  3LK9 A;  2UVR A;  4B9S A;  4ELU A;  4NY8 A;  2HW3 A;  5DB6 A;  3H40 A;  4EBJ A;  4ED8 A;  4B9N A;  2DR7 A;  7ICM A;  3FYH A;  7ICT A;  5CP2 A;  4R66 A;  5J0Q A;  2AGO A;  3SV3 A;  4O3S A;  2MUT A;  5DLF A;  4I27 A;  4RPX A;  4MFF A;  4DFK A;  8ICQ A;  2HHP A;  4M9G A;  1TVA A;  2J6S A;  7ICU A;  2DRA A;  4MFA A;  3G6Y A;  2PXI A;  1ZQA A;  4C8O A;  4RNN A;  3HP6 A;  2HHT A;  1ZQX A;  4KMU A;  4PGQ A;  4KLT A;  3RAX A;  4X4O A;  2W9M A;  4QZA A;  4I2A A;  4F4Z A;  4KLU A;  2NRK A;  5CB1 A;  3KHL A;  1RPL A;  4B9M A;  4O3Q A;  5KT2 A;  3RB6 A;  4YD2 A;  1UA1 A;  2PFO A;  3RR8 A;  4EEY A;  3LWL A;  4ECY A;  1ZQQ A;  3C18 A;  4LT6 A;  1D9D A;  3EPI A;  3RR7 A;  5KFF A;  3MGI A;  1D8Y A;  4X4V A;  4X4S A;  2PFN A;  7ICJ A;  3H7I A;  2HHU A;  2Q0Z X;  2BR0 A;  9ICK A;  4Q45 A;  3H37 A;  4WC4 A;  2B21 A;  4F4K A;  1EXN A;  8ICL A;  5KFB A;  1NK0 A;  1ZQV A;  3RJJ A;  9ICM A;  1ZQL A;  4AT7 A;  5KFR A;  4GC6 A;  5HHH A;  4ECT A;  2ALZ A;  4IQV A;  3UXP A;  4IQW A;  7ICQ A;  1OU5 A;  4KLJ A;  2W9A A;  3PW4 A;  2HHV A;  1D9F A;  3M8S A;  5KT6 A;  4M47 A;  8ICP A;  4F4X A;  4KLO A;  3V7K A;  1NKB A;  5J0Y A;  3PML A;  3FDS A;  5KFT A;  1TKD A;  3RJH A;  5HRL A;  4B9U A;  2RFF A;  4NKU A;  3AU6 A;  8ICO A;  2M2T A;  1RXW A;  3OJU A;  3OVA A;  9ICB A;  5KFL A;  2W8L A;  2KFZ A;  2FLP A;  5BOL A;  9ICC A;  5HR9 A;  3GIL A;  2HVI A;  4ATB A;  3H4B A;  2KN7 A;  1U48 A;  4AT8 A;  2C2R A;  4NM1 A;  3OSN A;  4BWJ A;  4DOA A;  3TQ1 A;  2FMS A;  4EBD A;  4YP3 A;  4F5Q A;  1N56 A;  4DL5 A;  3RJG A;  5HRF A;  2BQR A;  3BQ1 A;  3C2M A;  1SKR A;  4I29 A;  1UT5 A;  4UD5 A;  4DSL A;  4I2J A;  9ICE A;  7ICV A;  2DR5 A;  3OVB A;  3EWA A;  5J2K A;  3MR3 A;  3SV4 A;  3V6J A;  4QWC A;  3PW5 A;  4FS2 A;  3TAQ A;  5KFP A;  5J2J A;  1ZJM A;  1FA0 A;  4KTQ A;  5HRD A;  4F5N A;  1XC9 A;  4YCX A;  3UPS A;  1NJW A;  4UB4 A;  3PMN A;  4DO9 A;  2BCQ A;  1TFW A;  2M9N A;  5KFC A;  8ICJ A;  5KT5 A;  4X0A A;  4XQ8 A;  4ECX A;  5EWE A;  8ICW A;  4ED1 A;  4EZ9 A;  2AGQ A;  7ICF A;  1ZQY A;  3G6X A;  3RRG A;  5DQG A;  5DED A;  3H8J A;  2BCR A;  4J9Q A;  4DQS A;  2ZJA A;  3B0Y A;  4KLI A;  3WFR E;  5C5J A;  4DL4 A;  2FPL A;  4BWM A;  4O5C A;  4PHP A;  4RNM A;  2IMW P;  3BJY A;  4DFM A;  1ZQC A;  4QZD A;  1ZQB A;  2VA2 A;  7ICR A;  4EBE A;  3KHR A;  5HML A;  4DF8 A;  3ZD9 A;  4J9O A;  2JZB B;  3Q8S B;  2Y1J A;  4KLS A;  2W9C A;  2H5X A;  1JN3 A;  5J0T A;  4I2F A;  8ICG A;  3Q8K A;  9ICS A;  1X9M A;  4X4U A;  5KFD A;  2VAN A;  2M2V A;  4X0B A;  8ICU A;  2KTQ A;  2RDI A;  3C1Z A;  5JUM A;  8ICF A;  3EW9 A;  4JV0 A;  3RB0 A;  1ZQI A;  4P4O A;  4RUC A;  3ZDA A;  2R8G A;  3ZDC A;  5J0S A;  3LWM A;  1VFG A;  4FHX A;  4EYH B;  5DBC A;  2V4Q A;  4G3I A;  4ED7 A;  4ED3 A;  1BPB A;  1B22 A;  4DS4 A;  4WC6 A;  5EWG A;  1L3U A;  4M9H A;  1IM4 A;  1SL0 A;  5KFI A;  4UB5 A;  2J6U A;  5IIK A;  7ICK A;  1LB2 B;  7ICO A;  3NTU A;  3HT3 A;  4DS5 A;  4FHV A;  3RRH A;  2BKE A;  4QZ9 A;  3GIM A;  4GC7 A;  1ZQF A;  1R8C A;  4DQP A;  2NRZ A;  3TAR A;  4GXJ A;  1X9W A;  2I1Q A;  2R8H A;  3OGU A;  5CJ7 A;  4RQ3 A;  5KFV A;  3MDA A;  4DWI A;  5DEC A;  2W9B B;  3TAN A;  4ED6 A;  4AT9 B;  4MEY A;  4RU9 A;  4LZD A;  3T5K A;  1ZQS A;  3C23 A;  2XCA A;  3RTV A;  2ZHA A;  1ZQE A;  1U45 A;  3JPQ A;  2ZH6 A;  4FH3 A;  3PR4 A;  2JEG A;  4O3R A;  4GLX A;  4F92 B;  3PW7 A;  5EWF A;  2VA3 A;  1IXR A;  2XGP A;  1SKW A;  3HJ4 A;  4QW8 A;  1NKE A;  3PO5 A;  9ICR A;  4DL2 A;  1V9P A;  2M2W A;  5J2H A;  2WTF A;  2ZH9 A;  3NGD A;  2KZZ A;  5KG3 A;  3RJI A;  3Q8M A;  3V72 A;  4UBC A;  4F93 B;  3PV8 A;  4X4T A;  1ZQT A;  1NK7 A;  1RZT A;  1JMS A;  1COO A;  4F50 A;  3M9M B;  3C2K A;  3AQM A;  5CWR A;  3OVS A;  1F5A A;  4E8F A;  1JXE A;  5KFU A;  4QZH A;  5L1L A;  5IIM A;  1BVS A;  1ZET A;  1MQ2 A;  4XUS A;  1PX5 A;  1JX4 A;  4TQS A;  3MBY A;  5DB7 A;  4UB3 A;  2F1J A;  5J2G A;  1S9F A;  1BPE A;  1QSS A;  2JEJ A;  9ICL A;  1L3S A;  4I2C A;  4Z6E A;  4EZ6 A;  2P6U A;  3JPO A;  3K4G A;  1U47 A;  4UAY A;  4F3O A;  4PH5 A;  5CR0 A;  1Q79 A;  3GV7 B;  1XWL A;  5F9L A;  4UB2 A;  1UA0 A;  1QTM A;  4E80 A;  3EPG A;  2DFL A;  3QE9 Y;  3H3A A;  5KFJ A;  4I2H A;  7ICN A;  2NRV A;  4J9S A;  1Z3E B;  4J9P A;  3RJK A;  2HHW A;  5DKW A;  1RYR A;  2KFN A;  1TFR A;  2OWO A;  1NOM A;  1ZQZ A;  3B0X A;  5HRI A;  4M5D A;  3RH4 A;  2PI5 A;  3H38 A;  2A1J B;  4IQU A;  3GDX A;  5J0U A;  1WCL A;  1KFD A;  2AU0 A;  2IHN A;  3PW0 A;  1XS9 D;  8ICB A;  1MIV A;  3H8S A;  4IR1 A;  4K4G A;  1S77 D;  9ICJ A;  2KP7 A;  4E7X A;  1S0M A;  4JWM A;  4RUA A;  4BDP A;  5KFA A;  3JPT A;  2PBE A;  3OUY A;  5BPC A;  4WBZ A;  4YXM A;  5F9N A;  4PHA A;  2JZB A;  1ZQH A;  8ICT A;  1YLQ A;  3HWT A;  5KG4 A;  2ZUB A;  3M8R A;  1NJX A;  1L3T A;  1ZQO A;  2XGQ A;  3UPQ A;  3SI8 A;  1MIY A;  1Y88 A;  3N97 B;  3AQK A;  9ICU A;  3C1Y A;  5CA7 A;  1Q78 A;  4O3O A;  4ECV A;  2FPK A;  4F2S A;  4Z6C A;  3MR6 A;  3C21 A;  3BDP A;  3RJE A;  5KG6 A;  3H8W A;  4P2H A;  3HJ1 A;  2PFQ A;  5CHG A;  3ISD A;  4EYI B;  1BPY A;  9ICO A;  2BE3 A;  2ASJ A;  1D8L A;  2ASL A;  1JIH A;  1SL1 A;  5KFM A;  4J9R A;  1ZQG A;  4O3N A;  5IIL A;  9ICH A;  3GQC A;  1PZN A;  3KHH A;  4RQ1 A;  4J9L A;  3Q8P B;  4WBY A;  3AQL A;  1DK3 A;  4F4Y A;  2ASD A;  3E2E A;  4IRK A;  4K4I A;  1NK9 A;  4ECU A;  1JXL A;  2KZM A;  2HHX A;  4IRD A;  4KLE A;  9ICF A;  4YG2 A;  1R8B A;  2ZJ5 A;  1ZQW A;  3QEB Z;  3HPO A;  4JWN A;  8ICZ A;  4ELV A;  4M04 A;  4PHD A;  3V6H A;  5J0R A;  3ZDE A;  4UB1 A;  4UQG A;  2AQ4 A;  1LV5 A;  1CEZ A;  1WCN A;  4GXI A;  3PX0 A;  7ICE A;  4JUZ A;  4XRH A;  4RT3 A;  4B9L A;  2W9B A;  1NKC A;  2MAX A;  1SL2 A;  1MC8 A;  4AT9 A;  4QZC A;  2BHN A;  4Q43 A;  4ED0 A;  4DSK A;  4IQT A;  4DFJ A;  1QSY A;  1S76 D;  3IM1 A;  1MIW A;  4DSF A;  4DEZ A;  5L9X A;  1T4G A;  3TI0 A;  3C5G A;  3ZD8 A;  4RQ5 A;  2XY5 A;  8ICA A;  2UVV A;  2DRB A;  4JV1 A;  5HC9 A;  3BQ0 A;  4HYK A;  2C22 A;  4DSJ A;  4O9M A;  1XU4 A;  1KLN A;  2HHQ A;  3WFQ E;  3UXO A;  3QZ8 A;  4YMN A;  4I2G A;  1ZQP A;  2FMP A;  1ZQK A;  1ZQR A;  3OSP A;  1HUO A;  4QZE A;  2F1H A;  4DQI A;  4X4R A;  4QWB A;  5KG0 A;  4YXJ A;  5KFN A;  3T5J A;  2XY7 A;  3JZ0 A;  4RQ4 A;  4DSE A;  2XY6 A;  5DB8 A;  4FS1 A;  8ICC A;  2IBK A;  5DG8 A;  2ID1 A;  4DLG A;  4RWN A;  1KEJ A;  4QZF A;  3L9D A;  3T5H A;  2ZH4 A;  2F1I A;  4X4N A;  5KG2 A;  5DB9 A;  2DVI A;  1TK8 A;  4DL6 A;  4I2D A;  1L5U A;  8ICR A;  4DQQ A;  5DGB A;  3OHA A;  2FLN A;  3N4M B;  4FHP A;  2HVH A;  4O5K A;  4ATB B;  3UQ0 A;  3RH5 A;  5J2D A;  4PGX A;  3OJS A;  3EYZ A;  2BQU A;  4AT8 B;  4RT2 A;  5KG5 A;  4EBK A;  5KFW A;  3PX6 A;  2V9W A;  5DGA A;  2DPJ A;  3GV5 B;  4KLH A;  5DG9 A;  1XSL A;  4BXO B;  4C8L A;  3BQT A;  3C5F A;  3MAB A;  2V4R A;  3GIK A;  5KFE A;  4CCH A;  3PO4 A;  4QZG A;  2PFP A;  2FPM A;  1CUK A;  4ZH4 A;  1ZJN A;  4O5E A;  1KFT A;  2W8K A;  1KSP A;  4FO6 A;  4M0A A;  5HHI A;  3JPP A;  7ICI A;  3RB3 A;  4FBU A;  4WC7 A;  4RQ8 A;  2RDJ A;  4RPY A;  3WFS C;  4RQ0 A;  1A76 A;  3Q8Q B;  4MEX A;  4KLL A;  5KFK A;  4Z6F A;  5KFH A;  4QZB A;  3UQ2 A;  5KT3 A;  3THV A;  4KN7 A;  5KFY A;  1TV9 A;  2PI4 A;  1QSL A;  2P6R A;  2ZTD A;  2ZJ8 A;  4YMO A;  1KRP A;  1JQR A;  4RWP A;  4WC3 A;  4WC2 A;  5D4B A;  4ELT A;  2R8K A;  4TUQ A;  5J2C A;  1ZQJ A;  2Q66 A;  4M6W B;  5KG1 A;  1ARO P;  3SYZ A;  8ICX A;  3TFS A;  5J2E A;  1U49 A;  4DSI A;  3GIJ A;  3ZDB A;  1NJZ A;  2C28 A;  4F91 B;  4F2R A;  4M9N A;  8ICY A;  4KLQ A;  4MFC A;  5KG7 A;  8ICN A;  4R65 A;  7ICL A;  7ICS A;  5DBB A;  4UAW A;  2FMQ A;  5J0P A;  3RB4 A;  2R8J A;  4KLD A;  8ICK A;  8ICS A;  3AQN A;  3LQC B;  1BPZ A;  5KFS A;  4TUS A;  5J2F A;  4KN4 A;  2XO7 A;  3EZ5 A;  2Y1I A;  4FBT A;  4M2Y A;  2ZH8 A;  3SZ2 A;  5KFX A;  8ICI A;  1A77 A;  1S10 A;  1DOQ A;  2M2U A;  4S3N A;  8ICV A;  1X2I A;  4R8U B;  1T7P A;  5HRH A;  3UXN A;  2ZTC A;  1DK2 A;  1B43 A;  1RXV A;  4I2B A;  4QW9 A;  3GFK B;  4ECQ A;  3QZ7 A;  4RQ6 A;  4RQ2 A;  2XCP A;  3PVX A;  2GWS A;  5EOZ A;  5J2A A;  4DL7 A;  1XSN A;  1S0O A;  4ECR A;  1UEU A;  5J2B A;  1SZP A;  4DLE A;  4IR9 A;  4TUP A;  3HIY A;  2JEF A;  4F4W A;  5DDM A;  4RZR A;  5HNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...