4TUPA

Structure of human dna polymerase beta complexed with gg as the template (gg0b) in a 1-nucleotide gapped dna
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Inefficient Nucleotide Incorporation Opposite Cisplatin-DNA Lesion by Human DNA Polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 103
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4tupA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4tupA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4tupA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4tupA03
4YR3A 1ZQMA 2MUTA 2O1PA 4X0BA 3GV7B 4F4ZA 1BPZA 5DDMA 7ICPA 4RUCA 2HVHA 5DBBA 1VJ7A 4M2YA 1A76A 4PGXA 3OJSA 2W8KA 8ICFA 7ICIA 1Q79A 4TQSA 4DO9A 4FHYA 4ECZA 4EBKA 5HMLA 4B9MA 5DG9A 1ZQIA 4O3PA 3TAQA 2FMQA 4KMUA 5KFLA 5DQIA 3AQNA 5DQHA 3BQ2A 2HHQA 5KG0A 3JPNA 1R8AA 7ICQA 2UVUA 9ICNA 2DVIA 4DEZA 4BWJA 3M8SA 4RQ1A 4YMNA 4UB2A 5KFNA 4KLFA 4X4PA 1RXVA 2IA6A 4Q8FA 2PI5A 4BGDA 1NKEA 4YD1A 4RUAA 4J9OA 4Q45A 3AUOA 8ICNA 2FPKA 3MDAA 1SZPA 2OWOA 3FYHA 4J9RA 4BXOB 1CUKA 2HHXA 4DL2A 2M2WA 4RPYA 4KN4A 4ED1A 1BPXA 4ELVA 4QZEA 4UB3A 4MEXA 1S10A 8ICHA 2VA8A 3V72A 3SZ2A 5IIJA 3PW0A 2XGPA 4YMOA 5CP2A 5KG2A 5J0XA 4DS5A 4DLEA 5DDYA 2HHTA 4J9NA 4JWNA 4UB4A 3WFOA 2DR9A 1SL0A 1Z00B 1Z3EB 2ISOA 4PPXA 4BWMA 5KT6A 1OU5A 2ZH3A 5BPCA 1N48A 2GWSA 3QEBZ 4O5CA 3H39A 2KN7A 3BQTA 4F5OA 4TUSA 3HIYA 3GIIA 4XQ8A 1QSSA 2BCQA 3EYZA 4FO6A 2BQRA 4PGQA 4I2GA 9ICCA 9ICUA 4NY8A 4UB1A 3KHRA 2ASDA 2DR8A 2R8GA 4KLEA 5J2EA 3LK9A 5KFOA 3HT3A 1KEJA 2M2UA 4NKTA 3FDSA 3RH4A 4IRKA 5IIOA 1MQ3A 2R8IA 1U45A 1L5UA 5KFCA 5HREA 4FBTA 2ZH9A 3HJ4A 5KFTA 1L3VA 4I2AA 9ICEA 3AQKA 4JWMA 5KFKA 4FS2A 4ECRA 3THVA 1BPEA 2LYHA 8ICVA 2H5XA 5KFJA 3ISBA 4DSLA 1KFTA 3KHHA 1T7PA 4QZ9A 2DPJA 1KSPA 4F8RA 2HHSA 8ICAA 1Y88A 4ED6A 9ICWA 4QW9A 1R8CA 4AT9B 2I9GA 4GC6A 4C8NA 5BOMA 3OUYB 4YQWA 4MFAA 3KHGA 2ZTEA 2AQ0A 5KFFA 3MDCA 3GIJA 1UA1A 5D46A 4I29A 8ICKA 3B0XA 4DL4A 1KLNA 2DPIA 5DLGA 2PFOA 4NM1A 5HMMA 1S0MA 2VA2A 5KT4A 4O5KA 2BKEA 4AT7A 4ATBA 1S0OA 3PX0A 8ICMA 5DKWA 4KLTA 2PBEA 4KLGA 4RWPA 5F2VO 3QZ7A 8ICQA 2JEFA 1U4BA 1RZTA 4DSKA 8ICZA 1MIVA 4X4VA 4YFKA 5KFRA 4X4NA 4J9MA 2JZBA 4RNOA 3MR5A 3RJJA 3ZD8A 4WC2A 4QWDA 9ICRA 4X4TA 3ZDEA 3AQMA 3H4BA 3BQ1A 1KTQA 4R65A 7ICSA 5HNKA 3PW2A 4KN7A 9ICXA 4LT6A 3M9MB 4ZH4A 1S0VA 3EZ5A 4WC6A 4I27A 5J0PA 5HRKA 2HHVA 5KFAA 1U48A 1JXLA 2NRTA 3Q8PB 3T5JA 5KG7A 3UXNA 5KFPA 3UXOA 5KFQA 4ECQA 4YD2A 5D4BA 4RWNA 2AGPA 5DB8A 2ALZA 4MEYA 2AU0A 1QSYA 5DLFA 4IQWA 1BNOA 2ZHBA 4UB5A 4M5DA 4DSIA 4DSEA 3K75D 2A1JB 8ICYA 1R89A 2ZH4A 1YLQA 1DK2A 2NRXA 4PHAA 3GDXA 3PO4A 1ZQWA 1FA0A 2ZH2A 5F9NA 4F2SA 5KT7A 3GILA 3K4GA 4RPZA 3LWLA 1KFDA 4ED0A 2M2VA 3JZ0A 3JPQA 4ECSA 9ICHA 2ZH1A 1LB2B 3RTVA 1X9SA 2W9MA 4DS4A 4ECWA 4UD5A 3RH5A 1TFRA 1ZQEA 1BVSA 4Z6FA 1RYSA 2BQUA 4J9SA 1QTMA 3ZDCA 1L3TA 4NLGA 7ICMA 2A1JA 1S9FA 5J2DA 3M8RA 4J9PA 5IIIA 3RB0A 2IMWP 2F1HA 2ZJ5A 5KFMA 4RPXA 3HW8A 4DOAA 4LZGA 2DR7A 3WFRE 4EYIB 4WC0A 4F3OA 3T5HA 4PHPA 1H38A 3AU6A 2HW3A 1NK7A 2KP7A 3H3AA 4O3SA 2KZ3A 5J0OA 3ZDBA 3HPOA 5DG7A 4GXJA 7ICFA 1K1QA 4RQ8A 4DOBA 1D8YA 3ZDDA 4B9LA 3AU2A 2BCSA 1S77D 8ICCA 4XRHA 3V7KA 2BQ3A 3MGIA 2XC9A 2ZTCA 5J0YA 3ORYA 3NGDA 4YCXA 1XO1A 5J2BA 2W9BA 4MFCA 1DOQA 3H4DA 2W8LA 3RJHA 1UETA 4GXIA 3TAPA 2JEIA 4I2BA 4DQPA 3OVBA 3RB6A 4DWIA 5KT5A 2NRZA 5J0RA 1HUOA 4I28A 1XS9D 8ICTA 5DGAA 4X5VA 4JV1A 2KTQA 2J6UA 3MFIA 2DRBA 1MIYA 4KLDA 3TARA 3PW7A 4EZ9A 3MR6A 1WOTA 5DGBA 5J2GA 5KFHA 3SYZA 1SL1A 4RQ2A 2FLNA 1COOA 4G3IA 2KFNA 3M9OB 1UEUA 3N97B 3HX0A 9ICPA 4R63A 1ZQAA 1DK3A 5EWEA 2P66A 3UPSA 2V4QA 3UQ0A 8ICGA 1R8BA 4YR2A 4QZIA 3GQCA 4ECYA 3PW5A 2XCPA 1L3SA 2JZBB 2FMPA 5DBCA 2I1QA 4YXJA 5L1KA 5KFSA 3PMNA 3KTQA 3N4MB 1ZQVA 1D9DA 5DEDA 3C2MA 3RB3A 4DQIA 4I2DA 4RU9A 3T3FA 5KFWA 3MR2A 2FPLA 1NJZA 1NK0A 2IHMA 4AT9A 3C5FA 5TZVA 5DBAA 3EW9A 5KFUA 3WFSC 1EXNA 1AROP 5CB1A 5L1IA 1ZQRA 5KG6A 4EBCA 4IG8A 2ATLA 3PNCA 3TFRA 3E2EA 1ZQQA 4WBYA 5DB6A 4WC3A 4QWEA 4KLIA 3RR7A 1MQ2A 4M6WA 3JPRA 3SV4A 5HRHA 1NOMA 3RAQA 3TANA 1PX5A 5DB9A 4E7XA 4QW8A 4RWOA 5CJ7A 2DR5A 3JPOA 4B9VA 1U47A 3BJYA 3ZD9A 3IHQB 4F5PA 4EBDA 1IXRA 4KLLA 1JQRA 1IM4A 5EOZA 2ZH5A 3G6XA 4YN4A 7ICTA 3GIMA 3H8SA 2ZUDA 1HUZA 3HWTA 4QZCA 3OSPA 1ZQFA 4I2HA 4K4IA 4MF2A 7ICEA 5HRBA 2DFLA 2XY6A 9ICGA 3L9DA 4YG2A 5DG8A 1JMSA 4M6WB 2W9AA 5KFIA 4NLZA 4FH3A 3EPGA 5J0SA 4M04A 4F91B 4BXOA 4O3RA 4WC7A 1MSWD 4DL5A 4EEYA 4AT8B 4R8UA 1UA0A 1NJWA 4QZBA 2C2DA 4EBEA 1ZQYA 2XY7A 4UBBA 2ZJ8A 3RJGA 4E80A 2DRAA 3KHLA 5JUMA 2HVIA 4O3NA 3PO5A 5KFDA 8ICSA 2BCUA 1S76D 1ZQOA 3Q8QB 4GC7A 2ZHAA 9ICLA 3PV8A 4ELTA 4C8KA 1SKWA 4M0AA 5DQGA 1ZQJA 4GLXA 4M47A 1D8LA 5L9XA 4AT8A 3MBYA 5CWRA 2RDJA 4DFPA 1TAQA 3ETLA 5J2CA 4PHDA 4X4SA 1XSNA 3RR8A 8ICRA 2XGQA 3RJEA 4F4WA 9ICVA 1ZJMA 5KFYA 3B0YA 4BDPA 1SKSA 1V4AA 5HRGA 2MAXA 4Z6CA 1NK6A 5CA7A 9ICQA 3Q8KA 3V6KA 2BPGA 3H38A 4FHXA 1ZQSA 5IIKA 4I2IA 2PXIA 5KFXA 4LVSA 4F4XA 5HP4A 1BPYA 9ICAA 4WC5A 3H8WA 3PR5B 5DB7A 2C22A 2P6RA 1T4GA 1ZQLA 3RJKA 4O3QA 7ICNA 4YMMA 1JXEA 5CHGA 4KLSA 8ICEA 4Z6EA 3QEAZ 5IIMA 4F50A 2BCVA 3RAXA 8ICWA 3Q8LA 2BGWA 5KFZA 4RNNA 3PR4A 4QZFA 2FLLA 3NTUA 1TAUA 5L1LA 1S0NA 3EPIA 4ED8A 1ZQGA 7ICKA 5EWFA 5KFBA 4IRDA 2W9CA 1T3NA 4RQ4A 4C8LA 5HRLA 3NYBA 5KG1A 4Q44A 5BOLA 4Z6DA 4AT7B 1ZETA 3WFPA 3H7IA 5KFEA 3MFHA 2WTFA 4K4GA 2AGQA 7ICVA 3OV7A 4YR0A 1UT8A 4QWCA 2VANA 5J2KA 2UVWA 1T8EA 5J2FA 5J0WA 2XO7A 3UPQA 3PX4A 1KRPA 4WBZA 3OGUA 3WFQE 3H40A 4PH5A 3MABA 3Q8SB 3G6VA 2W9CB 4DF4A 2Q0ZX 4NLNA 1RXWA 3LWMA 1V9PA 5J2JA 4KLQA 8ICLA 4J9LA 1UEVA 1BPBA 4JUZA 3ZDAA 4IQUA 8ICJA 2KZMA 3PW4A 1C7YA 4C8MA 1XWLA 1NK9A 5L1JA 8ICXA 3C2KA 8ICIA 4DFJA 3PY8A 4R64A 1SL2A 4JV0A 3C1ZA 5HC9A 5J0QA 1ZJNA 1D9FA 2IHNA 2PFPA 5J2IA 4R8UB 9ICFA 4YVZA 5HRDA 4J9QA 4E8FA 5J0UA 1U49A 4F93B 4EP7A 3TFSA 4I2CA 3HJ1A 2BHNA 3MR3A 4F5NA 4DQQA 5EWGA 4UAYA 1ZQNA 4M9LA 3JYYA 4FHWA 5KFVA 1ZQUA 1K1SA 2M2TA 2R8JA 1MC8A 1TVAA 4IQVA 4FS1A 4XUSA 3T5KA 4DF8A 2ASJA 4KLJA 1KFSA 4XA5A 5J2HA 1KDHA 4WC4A 4ECVA 2Y1IA 3RH6A 3RJFA 4WC1A 5KT2A 9ICMA 3H8JA 1ZYQA 1B43A 4KITB 2XCAA 1N56A 3QZ8A 2KZZA 1TK5A 2FPMA 5J29A 4FBUA 4NLKA 4S3NA 4IR1A 1U9LA 1NK5A 1L3UA 1QSLA 2PFNA 1NKBA 4B9SA 3GFKB 4RQ3A 1TK8A 2B21A 4F92B 3HP6A 3G6YA 2HHWA 4ED3A 3M9NB 4J9KA 2AGOA 3RBEA 4X4RA 5DECA 2W9BB 4IR9A 9ICBA 4QWAA 3T5LA 1X9MA 4DQRA 4O9MA 3GV5B 2PI4A 4RNMA 2C2EA 2ZJAA 1VFGA 3C18A 4YP3A 2JEGA 7ICLA 4I2FA 4X4OA 4QZDA 4B9UA 4IRCA 1NJXA 4B9NA 4EZ6A 4CCHA 2ISPA 4K4HA 3V7JA 4DFMA 3RRGA 7ICGA 1ZQTA 2AJQA 3BQ0A 1NO5A 3OVSA 4I2EA 8ICOA 4RZRA 3UQ2A 4XQ7A 1DGSA 1XSLA 1JIHA 4RQ7A 7ICOA 9ICIA 3LDAA 3OHAA 2ZTDA 2O5AA 4DL7A 3JPPA 2F1IA 1JX4A 4ATBB 2NRWA 1JAJA 2RDIA 4TQRA 5HHHA 5KFGA 1CEZA 5D49A 2Q66A 1BPDA 4P4OA 4ELUA 4KLHA 1WCLA 2XY5A 4F5RA 2Y1JA 4GXKA 3V7LA 2VA3A 4NKUA 5C5JA 5HRFA 4EYHB 7ICHA 4I2JA 2NRVA 4LZDA 1LV5A 2UVRA 3RRHA 4DL6A 4JV2A 4X4UA 2AQ4A 1ZQPA 3V6HA 1XSPA 2R8KA 1NZPA 1SKRA 4M9GA 1PZNA 7ICJA 1ZQBA 4IQTA 2BCRA 4Q8EA 2J6SA 4KLOA 2KFZA 9ICOA 4FHVA 9ICSA 1WCNA 4UQGA 4ECTA 3PX6A 4P2HA 4DSFA 2FMSA 4QZ8A 4TUQA 4DFKA 4F2RA 3OJUA 1B22A 1NKCA 4RQ5A 2FLPA 2J6TA 5KG3A 2BE3A 2C28A 2BPFA 3C5GA 3OVAA 5KT3A 4QZGA 3Q8MA 1BNPA 2NRKA 4R66A 4O0IA 4UAWA 3BDPA 3PMLA 3RBDA 5HHIA 4RT2A 4P4MA 1KNYA 1ZQCA 2BDPA 2ZH6A 1ZQXA 9ICKA 2ASLA 4E0DA 1ZQDA 3EWAA 1RPLA 4QWBA 4QZAA 4MF8A 2UVVA 1ZQKA 3ISCA 4DSJA 8ICPA 4RQ0A 1TFYA 1Z00A 2BPCA 5J0TA 3RJIA 4O5EA 4WCWA 1TKDA 1BGXT 3SV3A 8ICBA 3PVXA 4JK1A 4M9NA 4ED7A 3C1YA 4PHEA 3Q8RB 1QLNA 3AQLA 1UT5A 1NJYA 2PFQA 1XU4A 5IINA 3C21A 5F9LA 3OSNA 4ECXA 2P6UA 4FH5A 5IILA 4RQ6A 1XC9A 3C23A 3LQCB 2M9NA 1TK0A 4X4QA 3GV8B 3MGHA 7ICRA 4FHPA 3V6JA 1JN3A 4X0AA 4F5QA 8ICUA 4RT3A 2V4RA 3TQ1A 1TV9A 1NK8A 2ID1A 4RWQA 1X2IA 4UD4A 4UAZA 1F5AA 4KTQA 2IBKA 5HR9A 4M9HA 4TURA 4PGYA 5J2AA 1Q78A 5KG4A 4O3OA 4KLMA 2HHPA 3IM1A 3C2LA 3ISDA 1A77A 4UBCA 1ZQHA 4NXZA 2C2RA 4KLUA 1ZQZA 3RB4A 3UXPA 4ED2A 4F4YA 1NK4A 7ICUA 4MFFA 3H37A 2F1JA 2BR0A 3OUYA 2R8HA 2MUTB 2ZUCA 3OHBA 4DQSA 4QZHA 3QE9Y 4NM2A 1RYRA 2JEJA 2HHUA 1MIWA 5CR0A 2ZUBA 3C66A 1TFWA 3JPTA 5KG5A 5KTQA 1S97A 4HYKA 3JPSA 9ICJA 2ZH7A 4TUPA 4YXMA 5HRIA 3TI0A 9ICTA 2ZH8A 4DLGA 4DOCA 3SI8A 4P4PA 4C8OA 2RFFA 4Q43A 3GIKA 1X9WA 4M9JA 4DL3A 4EBJA 2V9WA 4B9TA 4ECUA 1HJPA 4F4KA
chains in the Genus database with same CATH superfamily
4X0BA 2O1PA 7ICPA 2HVHA 4M2YA 2WB1C 7ICIA 5HMLA 4O3PA 4KMUA 5DQIA 5DQHA 5KG0A 1R8AA 2LPEA 1KL9A 5AK4A 9ICNA 4DEZA 4RQ1A 1NKEA 4YD1A 5ALOA 1SZPA 2OWOA 4BXOB 4DL2A 4DCCA 4RPYA 4KN4A 3HJEA 4ED1A 1BPXA 3IN5A 4MEXA 5AIAA 3V72A 2YTUA 2XGPA 3K7DA 5CP2A 5KG2A 5J0XA 5DDYA 3WFOA 4PPXA 4BWMA 1N48A 4K96A 3QEBZ 2KN7A 5ALIA 4QJFB 2BCQA 4FO6A 2DR8A 1XO0A 3KHRA 5ALPA 4KLEA 2K4IA 5AI0A 2M2UA 1KEJA 4Y2VA 2R8IA 1OW5A 1U45A 4UARA 5KFCA 5HREA 3LVVA 1KSPA 1T3QA 4AT9B 4ED6A 9ICWA 4LEVA 2I9GA 4GC6A 4C8NA 4EX6A 3OUYB 3WKEA 1NZBA 2AQ0A 3MDCA 2FCLA 1KLNA 2LMRA 2DPIA 2QARA 4NM1A 2WAQC 5HMMA 5KT4A 3SAFA 3PX0A 8ICMA 5KL8B 5DKWA 4KLGA 3AL0B 5F2VO 5AKJA 4DSKA 3NVYA 1RZTA 4X4NA 4J9MA 4RNOA 5AKLA 3ZD8A 9ICRA 4X4TA 1WWVA 3SD7A 4HX0A 3FAHA 2OXOA 4PZNA 4CF5A 5J0PA 4OJOA 3AMZA 4RWNA 2AGPA 5DB8A 2ALZA 2A1JB 3K75D 2G08A 2KJ5A 2NRXA 2ZH2A 2VJ5A 4F2SA 3K4GA 3ERCC 3LWLA 2M2VA 2DQNB 9ICHA 2CN1A 3RTVA 5AM2A 1ZQEA 7ICMA 2W3SA 4WQKA 5J2DA 5IIIA 3RB0A 2DR7A 4WC0A 1PVPA 2KZ3A 4OCZA 3WFRE 5AKEA 4B9LA 2KSOB 3V7KA 2BQ3A 1RG6A 2D3DA 5J0YA 3ORYA 2W9BA 3EUB2 3TAPA 2JEIA 3ER9B 5KT5A 1X42A 5J0RA 1COKA 1HUOA 3C29A 2DRBA 4KLDA 5JU5A 3F5AA 2EWRA 4LEYA 1O08A 3HX0A 1ZQAA 3WK6A 4USAA 8ICGA 4QZIA 4YR2A 3PW5A 2UVRA 4NXTA 2DUYA 5DBCA 4YXJA 1D9DA 4DQIA 2EANA 4I2DA 4RU9A 1NNLA 1TAMA 2WF7A 1S5LU 1IG6A 1AROP 5L1IA 2ATLA 1ZQQA 4QWEA 4KLIA 1S8OA 2W3RA 3SV4A 1NOMA 1PX5A 2WF6A 3B9JA 1SV0A 3JPOA 3IHQB 1IXRA 2PMZC 2ZH5A 5EOZA 3N28A 1HUZA 3H8SA 2ZUDA 5AKXA 1ZOLA 7ICEA 5HRBA 4K4IA 5D63A 3L9DA 5DG8A 4UW9A 5J0SA 4M04A 4F91B 4AT8B 5AI9A 4R8UA 1L7NA 1UHUA 1UA0A 2XY7A 5ALQA 4O3NA 5KFDA 1ZXIA 1ZQOA 4GC7A 3PV8A 4K98A 2ES6A 3T79A 4M47A 3MBYA 4F4WA 9ICVA 2QB0B 2HSZA 5HRGA 2MAXA 1NK6A 9ICQA 3QX7A 4FHXA 5HR7A 1BPYA 5AI8A 2AXTU 3QU9A 1JXEA 3QEAZ 3PHZA 2BCVA 3Q8LA 5KFZA 3PR4A 2GLEA 1S0NA 5KFBA 5HRLA 3NYBA 5KG1A 1L7OA 4Q44A 4AT7B 2QLTA 1KQQA 1ZETA 3N7SC 5KFEA 2JR5A 2DBYA 1UT8A 3Q8SB 1JROA 3OWGA 4NXWA 2B51A 4IQUA 2KZMA 3PW4A 4C8MA 3C2KA 5H2FU 1SL2A 5HC9A 1ZJNA 4ICAA 2YQEA 5F3XB 1D9FA 5KL1B 4R8UB 5J2IA 9ICFA 2EQYA 4J9QA 5J0UA 3HJ1A 3MR3A 2KMDA 5KFVA 2M2TA 2LM1A 2G0AA 3QUBA 4FZMA 1TVAA 3T5KA 1KFSA 4JLXA 4XA5A 5J2HA 4WC4A 1FEZA 4WC1A 5KT2A 1ZYQA 2NO5A 1D8BA 5J29A 4NLKA 1U9LA 4RQ3A 1TK8A 3HP6A 4RQMA 3M9NB 1ZD2P 5DECA 4QWAA 1X9MA 4DQRA 3CK6A 3GV5B 3NRWA 2RRDA 2ZJAA 3C18A 1L8LA 3K1ZA 2E8MA 2B4VA 4K9BA 1NJXA 2AJQA 1ZQTA 2ZIWA 5ALWA 4GFJA 2F44A 1DGSA 1JIHA 2KOBA 3LDAA 2KEYA 2G5IB 2RLTA 2F1IA 1CEZA 4ELUA 4KLHA 2B6GA 1RM6C 4GXKA 3V7LA 5C5JA 4K8VA 3RFAA 2H3QA 2HBLA 1LV5A 3IV6A 2W7PA 5ALRA 7ICJA 4IQTA 2BCRA 2J6SA 5CRXA 4FHVA 2YX8A 2CPRA 3U26A 4TUQA 2W7OA 4F2RA 4EX7A 3OVAA 3IDWA 1QQ5A 4QZGA 1UCVA 2NRKA 4R66A 4O0IA 4UAWA 3RBDA 3WK9A 2GOLA 1KNYA 1ZQCA 2JH7A 9ICKA 3H0LB 1ZQDA 3EWAA 1ZQKA 4DSJA 5AKIA 1TKDA 8ICBA 3PVXA 2NO4A 4M9NA 2OM6A 1UT5A 1XU4A 4O6AA 2H3FA 4FH5A 5IILA 1XC9A 1SZHA 2B56A 2Y9TA 4FHPA 7ICRA 3WKAA 1JN3A 4X0AA 3C28A 4F5QA 1TV9A 3BZKA 4UAZA 3VC8A 4KTQA 1F5AA 4M9HA 4PGYA 4UB8U 2EZYA 3WKDA 4NXZA 1ZQZA 1X6JA 4F4YA 3TKAA 2F1JA 1V38A 2BR0A 2DKZA 2R8HA 4DQSA 1N62A 3QE9Y 2ZUCA 4CNQA 3OHBA 2IHOA 3SQIA 2ZUBA 4NV0A 2AH5A 5ALUA 1URJA 2XIDA 2ZH8A 4YXMA 1Q3UA 9ICTA 4P4PA 2BBJA 4M9JA 1SWVA 4EBJA 5ALFA 5AM3A 1YZ7A 4YR3A 3GV7B 4F4ZA 5DBBA 1VJ7A 1A76A 2G09A 3OJSA 3F2DA 2F2AB 2KIVA 4TQSA 2RP5A 4ECZA 1KW4A 3M1YA 4OD0A 5J8YC 5DG9A 3TAQA 3BQ2A 1V85A 2HHQA 1X40A 3JPNA 1GPJA 7ICQA 2LHTA 2DVIA 4BWJA 4UB2A 5KFNA 4KLFA 4X4PA 4F72A 4BGDA 3QU4A 8ICNA 4Q45A 3QUQA 3ONNA 1CUKA 2K4PA 4UB3A 8ICHA 4O3MA 2VA8A 4XJEA 3SZ2A 5IIJA 1P7DA 2HBJA 4DS5A 2LKYA 4DLEA 2ZIVB 4J9NA 4F71A 4JWNA 1SL0A 1Z3EB 2ISOA 1IIPA 5KT6A 2ZH3A 5BPCA 1FO4A 4O5CA 3WK7A 3BQTA 4TUSA 4XQ8A 4I2GA 4CDGA 4NY8A 4Y2UA 2R8GA 5J2EA 3LK9A 4NKTA 3FDSA 3H0MB 5ALEA 1MQ3A 4NWIA 3HJ4A 2HN2A 5KFTA 1L3VA 2KVCA 4I2AA 9ICEA 5KFJA 3ISBA 4DSLA 1ZD5A 2ZIUA 1KFTA 2HHSA 4QZ9A 4F8RA 1R8CA 1Y88A 2ZIXB 5BOMA 1KKXA 2KICA 2ZTEA 3GIJA 1J97A 3AEVA 5D46A 4I29A 3B0XA 2H3ZA 5AK3A 1S0MA 2VA2A 2WFAA 4AT7A 1S0OA 2PBEA 5B3QA 2E3TA 8ICQA 1U4BA 3NVOA 2JZBA 3MR5A 4WC2A 4QWDA 1N5XA 3ZDEA 4R65A 5HNKA 3KD3A 4ZH4A 4I27A 5B3PA 5HRKA 2HHVA 4C4RA 1QQ7A 1U48A 1JXLA 3Q8PB 3T5JA 4YD2A 2K8AA 1BNOA 2AU0A 2BBHA 4M5DA 4DSEA 3FC4A 4UB6U 3NS1A 4RPZA 1KN5A 3QUCA 3QU7A 1LB2B 2W9MA 3RH5A 1TFRA 4NLGA 1BVSA 3ZDCA 3M6KA 2BQUA 2A1JA 2DGZA 1J2NA 1F5SA 2F1HA 2ZJ5A 3HW8A 4LZGA 5FP0A 4EYIB 4F3OA 3T5HA 1H38A 5DG7A 1K1QA 4DOBA 1S77D 3AU2A 8ICCA 2KG5A 3MGIA 2GAFD 3NGDA 4Y2XA 2KJ9A 2F8KA 2L5YA 5ALHA 4DWIA 2MSNA 2GH1A 2ZIXA 4NLBA 5AKGA 4I28A 3KFUF 2I6XA 8ICTA 3MFIA 3TARA 3PW7A 3MR6A 2HDOA 5J2GA 3SYZA 4RQ2A 2G5HB 2KFNA 5EE1A 1MN8A 3M9OB 5CHEA 3N97B 1OXJA 4R63A 2P66A 3QU2A 1R8BA 5L1KA 5KFSA 3KTQA 3H0RB 3RB3A 3UMGA 3SR6A 3T3FA 1SXEA 2KKVA 3N7PD 5KFUA 1EXNA 4EBCA 4HAIA 3TANA 3PZPA 1PK1B 4QW8A 5TISU 4B9VA 3HRDD 3BJYA 3ZD9A 3FM9A 7ICTA 5AI4A 3OSPA 2DFLA 2OCEA 1J2MA 2A19A 4KX5A 3EPGA 3OTQA 1MSWD 4QZBA 2C2DA 5AI6A 3KHLA 5JUMA 2BCUA 3Q8QB 9ICLA 4CGZA 5D62A 5L9XA 4AT8A 3NVZA 4DFPA 4MHVA 4Y2QA 8ICRA 2PMZF 1ZJMA 2VKQA 5KFYA 4BDPA 1SKSA 5CA7A 3H38A 3V6KA 1ZQSA 2BDUA 4I2IA 5AICA 5KFXA 4F4XA 2AHOB 4G9BA 2P6RA 4EELA 7ICNA 4O3QA 4KLSA 4Z6EA 2JRZA 1CRXA 3RAXA 8ICWA 2BGWA 4RNNA 5KAIU 3NTUA 1TAUA 4ED8A 1Z1BA 1F44A 5CFUA 2B0CA 1T3NA 3QXGA 5BOLA 4Y2YA 2YMPA 3H7IA 7ICVA 4YR0A 3WFQE 3PX4A 4PH5A 2OH2A 3MABA 1V9PA 4KLQA 3ZDAA 4O67A 4QNLA 5JTGA 1NK9A 5L1JA 4IL6U 4R64A 1X9XA 2ZIVA 2PFPA 2CXYA 1SGGA 4QIWC 5HRDA 1VLBA 1U49A 4EP7A 4NXUA 2BHNA 4F5NA 5EWGA 1ZQNA 4M9LA 4FHWA 5AM5A 1ZQUA 4QIWF 4IQVA 4FS1A 4XUSA 2A3VA 4KLJA 2BZFA 1ZD3A 3DV9A 4ECVA 3H8JA 4KITB 4UAVA 4S3NA 4UAUA 1L3UA 4B9SA 3GFKB 4OAFA 4B9TA 4F92B 2HHWA 1QH9A 2W9BB 4IR9A 4O9MA 5L1MA 2PI4A 4K97A 4X4OA 4EZ6A 2K4EA 4CCHA 3V7JA 1NO5A 3OVSA 3UQ2A 4RQ7A 9ICIA 2ESEA 3OHAA 2O5AA 2HOQA 2W55A 4TQRA 5D49A 4P0PB 4P4OA 1WCLA 4AYBF 2XY5A 2ZIWB 3I76A 4X4UA 1PVRA 1NZPA 4NJ8A 1SKRA 1B0XA 1WCNA 4PJ0U 4P2HA 2LYAA 2KIWA 5A0LA 2FLPA 2BE3A 4ACOA 1ZQ1C 4KX3A 5D61A 3Q8MA 3ED5A 3PMLA 1RDFA 4OO1J 5HHIA 4RT2A 3ETRA 2ASLA 2KK0A 2YMLA 4QZAA 8ICPA 4RQ0A 1Z00A 4A8EA 1SV0C 5AI5A 4ED7A 4PHEA 1QLNA 5F9LA 4EV6A 2XI9A 2FE9A 1X6IA 4X4QA 2ID1A 3TQ1A 2IBKA 5HR9A 1N5WA 5J2AA 1RYUA 5KG4A 3IM1A 3C2LA 3ISDA 1DRGA 1A77A 4KLUA 3WU2U 3UXPA 7ICUA 3H37A 3J81j 1K5OA 4EBKA 3ZI4A 4US9A 1TFWA 2HHUA 3JPTA 1S97A 4HYKA 3JPSA 2ZH7A 2DL0A 4TUPA 3NVVA 4DOCA 4UASA 1LKYB 4ATBB 4ECUA 3BQ7A 1HJPA 5ALLA 1SV4A 2MUTA 5CFSA 5DDMA 3KKAA 5AK5A 4RUCA 4NLCA 2W8KA 4FZNA 4B9MA 2FMQA 1PK1A 2KV2A 1ZQIA 3HILA 3KKAC 3AQNA 2YB1A 3M8SA 3F5EA 4EEKA 2FDRA 1WUDA 2F8LA 1RXVA 2W04A 4RUAA 4PL1A 2RHFA 1V97A 4J9OA 3MDAA 1A6SA 2M2WA 3L4PA 1SXDA 1S10A 2K8CB 3PW0A 5EE9A 4YMOA 4Y2SA 5ALJA 2HHTA 4KM5A 1Z00B 5B5EU 2GWSA 2QB1A 3H39A 3GIIA 1QSSA 3EYZA 9ICUA 2ZIUB 2JV3A 2ASDA 3K1RB 3HT3A 1UQVA 3RH4A 2HOFA 2LI6A 5IIOA 1ED1A 1L5UA 2KSOA 1YT3A 4FBTA 2N1RA 4JWMA 4FS2A 3THVA 8ICVA 2H5XA 5ALVA 3KHHA 5G5HA 2HMXA 2DPJA 8ICAA 4QW9A 2MRLA 3CRXA 3R9KA 4OJPA 1CI4A 5ALYA 3UM9A 4YQWA 3L3FX 3D2QA 3GZFA 5KFFA 1JI7A 3M6ZA 5AM1A 4DL4A 4AYBC 4CF4A 2YN4A 4O5KA 2BKEA 4ATBA 4RWPA 3DDHA 2EZXA 3QZ7A 3WKBA 5KAFU 2Y0SF 3SAGA 3TACB 1KBUA 8ICZA 4YFKA 1MIVA 3H4BA 3BQ1A 1KTQA 7ICSA 9ICXA 1L7MA 5KFAA 2K8BB 4LJXA 5KFPA 5D4BA 5KFQA 4ECQA 4C7ZA 3AN1A 2NYVA 5DLFA 2ZHBA 1M6YA 5ALNA 4DSIA 8ICYA 2WF9A 2ZH4A 4PHAA 3GDXA 5AK6A 2KJ8A 4RQNA 3WK5A 3GILA 1KFDA 4ED0A 2ZH1A 4OJ6A 1X9SA 4ECWA 4UD5A 4O68A 1RYSA 4J9SA 1L3TA 2KD1A 4IC9A 1S9FA 3M8RA 5KFMA 4RPXA 1OUQA 3SEIA 4PHPA 2HOIA 2HW3A 4FO1A 1NK7A 3PSTA 4O3SA 3ZDBA 3HPOA 4GXJA 4RQ8A 4XRHA 1AQ6A 3HKZC 2XC9A 2ZTCA 5CFTA 4YCXA 1XO1A 4MFCA 2W8LA 4I2BA 2FI1A 3OVBA 3RB6A 1XNSA 2NRZA 1MA7A 2KE7A 4CRXA 2EH9A 3MC1A 2HN1A 2KTQA 2J6UA 5DGBA 1SL1A 4KMOB 2YMQA 4G3IA 5AIBA 4KB6A 1UEUA 9ICPA 5EWEA 4WQLA 3UPSA 2V4QA 3UQ0A 1L3SA 5ALTA 2XCPA 2FMPA 1L8OA 3PMNA 3N4MB 5DEDA 3C2MA 3NKUA 3MR2A 1NK0A 2FPLA 2IHMA 4AT9A 2H3VA 1O03A 3WFSC 5CB1A 4IG8A 3WK8A 5KG6A 3TFRA 3E2EA 1T94A 3RR7A 1MQ2A 1PVQA 1Q3VA 3JPRA 5ALSA 3KBBA 5CJ7A 2DR5A 4JMUA 4F5PA 1IV8A 1IM4A 1ZRMA 5GTIU 3G6XA 4MF2A 3HWTA 4I2HA 2LM4A 2XY6A 4P0QA 2EDUA 4YG2A 4M6WB 5KFIA 4NLZA 4O3RA 4DL5A 1Q46A 2WHEA 1DXSA 1NJWA 2DRAA 3BS5A 2HVIA 3PO5A 1DGJA 2M0NA 4ELTA 5B66U 1SKWA 4M0AA 1LVHA 5DQGA 1ZQJA 4GLXA 5CWRA 2RDJA 1FIQA 1TAQA 3ETLA 5J2CA 2MA1A 1XSNA 5AHXA 3RJEA 1ZD4A 3B0YA 4WH5A 1V4AA 4Z6CA 2NV3A 3Q8KA 2BPGA 2Z7JA 3TADC 3F53A 1SIJA 4OAHA 3F2CA 4LVSA 3H8WA 4C80A 5DB7A 2C22A 1T4GA 8ICEA 2HBMA 5IIMA 4F50A 4Y2JA 2FLLA 4QZFA 4NXVA 4GIBA 3EPIA 4CF3A 3D6JA 5EWFA 4C8LA 3NUQA 3OPXA 4Z6DA 3UMBA 2K89A 3MFHA 3OV7A 2VANA 5J2KA 5J2FA 2XO7A 3UPQA 2LYBA 4DF4A 3G6VA 2W9CB 2Q0ZX 4OJLA 1RXWA 3LWMA 5J2JA 3DEEA 4J9LA 1BPBA 2MU2A 2HBKA 3IG5A 4C0ZA 1C7YA 2W54A 1Q8KA 4C7YA 2H3IA 8ICIA 4DFJA 3C1ZA 5J0QA 4EEBA 1L6NA 1JALA 3BS5B 4F93B 4I2CA 3JYYA 1RQLA 2F3NA 1K1SA 2R8JA 2JXJA 1MC8A 4NXXA 2GO7A 4B6JA 4DF8A 2ASJA 1KDHA 3RH6A 1B43A 2XCAA 2KZZA 3QZ8A 1TK5A 4FBUA 3VCBA 1QSLA 2PFNA 1GO3F 2ODGA 3G6YA 4ED3A 4J9KA 4X4RA 5KNIA 2E8OA 9ICBA 2IOFK 3T5LA 4RNMA 7ICLA 4QZDA 4B9UA 4B9NA 4DFMA 3GU3A 4I2EA 8ICOA 2I5HA 1XSLA 4DL7A 1JX4A 3H8MA 2NRWA 1JAJA 5HHHA 5ALMA 5KFGA 4EEDA 2Q66A 2Y1JA 5AKKA 2VA3A 4NKUA 1QCKA 1B4FA 2O6KA 5J8YA 3RRHA 2KHQA 2AQ4A 1ZQPA 3V6HA 4M9GA 4Q8EA 4KLOA 2ZXIA 4ECTA 3PX6A 2K60A 4DSFA 2FMSA 4IS7A 4QZ8A 4DFKA 2OYYA 2BPFA 4N7RA 5KT3A 3BDPA 2IOFA 2ZH6A 1ZQXA 3ER8C 1Z1VA 1TFYA 2F76X 4C4TA 5J0TA 3RJIA 4WCWA 5HR6A 4LEZA 4JK1A 3C1YA 1SWWA 3AQLA 3OSNA 4ECXA 4RQ6A 3LQCB 4MKPA 3GV8B 5K4LA 3MGHA 3V6JA 2V4RA 3E0FA 4FZLA 1Q78A 4PZOA 2HHPA 2KVSA 1N61A 2YB4A 1NK4A 3RB4A 3I28A 4Y2RA 2KHVA 2MUTB 1N63A 4QZHA 4NM2A 1RYRA 5C0YA 1MIWA 3C66A 3M7DA 5CR0A 5JRTA 1PK3A 3SI8A 2RFFA 4C8OA 4Q43A 1X9WA 4DL3A 3QUTA 1ZQMA 1BPZA 4PGXA 8ICFA 1JUDA 1Q79A 4DO9A 4FHYA 2DF4B 2W11A 3EF2A 1X66A 5KFLA 2EAOA 2UVUA 4J03A 4YMNA 1QQ6A 2IA6A 4Q8FA 2PI5A 4EENA 3AUOA 2FPKA 4NL9A 3FYHA 4DFDA 4J9RA 2JGAA 2HHXA 4ELVA 4QZEA 4LEWA 5AM0A 1VDVA 5T14A 4UB4A 1OU5A 3E58A 4OAGA 2P35A 5ALXA 4F5OA 3HIYA 3ALRA 2BQRA 2OHFA 4PGQA 9ICCA 4UB1A 5KFOA 2QB0A 4BJQA 4IRKA 2ZH9A 2RQ5A 3AQKA 5KFKA 4ECRA 1BPEA 2LYHA 4C4SA 1T7PA 1L7PA 3QNMA 4MFAA 3KHGA 4Y2TA 1UA1A 5ALDA 2VJ4A 8ICKA 4BX9C 5DLGA 2PFOA 2FJ6A 1A0PA 2WAQF 1FFUA 1NI3A 4KLTA 1C20A 2JEFA 4X4VA 5KFRA 3NVWA 3RJJA 3AQMA 4WJ3B 4LT6A 1ECWA 3PW2A 4KN7A 5AKYA 3WKCA 3M9MB 1S0VA 3EZ5A 2WF8A 2JHDA 4WC6A 1Z4NA 2NRTA 5KG7A 3UXNA 3UXOA 1QSYA 4MEYA 4IQWA 4UB5A 3D2NA 3AQFA 1R89A 1YLQA 1DK2A 3S6JA 3PO4A 1ZQWA 1FA0A 5F9NA 5KT7A 4AP9A 2WF5A 3JPQA 4ECSA 3CP8A 4DS4A 4U6PA 4Z6FA 1QTMA 4US8A 4J9PA 4JLZA 2IMWP 4DOAA 1SB3C 4OJ5A 4BUGA 3CYMA 3AU6A 2KP7A 3H3AA 2E1EA 3JCFA 5J0OA 8ICLA 7ICFA 3ZDDA 1D8YA 2BCSA 2HI0A 3KZXA 5J2BA 1DOQA 3H4DA 3RJHA 1UETA 4GXIA 4DQPA 2E8PA 1JRPA 2YMMA 3NASA 4I0UA 1XS9D 5DGAA 4X5VA 4JV1A 1PUZA 1MIYA 4EZ9A 2YY6A 3A0BU 1WOTA 5KFHA 2FLNA 1COOA 5AM4A 1DK3A 2LBOA 4ECYA 3GQCA 2JZBB 4K9AA 2I1QA 1ZQVA 5E79U 5KFWA 1NJZA 1LKYA 3C5FA 5TZVA 5DBAA 3EW9A 1HEKA 4EGWA 1ZQRA 2Q4TA 2W03A 3PNCA 4WBYA 5DB6A 4WC3A 2E1FA 4M6WA 5HRHA 3RAQA 3IP4B 4RWOA 5DB9A 2EAMA 2CRXA 4E7XA 1U47A 4K99A 1F0MA 1WG8A 4EBDA 4KLLA 1JQRA 4YN4A 4JB3A 3AQEA 3GIMA 3JZ0A 1ZQFA 4QZCA 2IUBA 3BZCA 9ICGA 1JMSA 2W9AA 4FH3A 4BXOA 4WC7A 4EEYA 3BS7A 4EBEA 1ZQYA 3RJGA 4UBBA 2ZJ8A 4E80A 8ICSA 1S76D 2ZHAA 4WOYA 4C8KA 5ALKA 2JH1A 1D8LA 3NRZA 4U7CA 2XVTA 4PHDA 4X4SA 3RR8A 2XGQA 2IOHA 2E5SA 3MGVA 4PL2A 1N2XA 4P0PA 5IIKA 2DWQA 2PXIA 2Y9UA 5HP4A 9ICAA 4WC5A 3QU5A 3F2BA 3LYSA 3PR5B 4OAIZ 1ZQLA 2KNJA 3RJKA 4YMMA 5CHGA 3N7RC 2G06A 2D8CA 5GTHU 1FFVA 3UMCA 3IG8A 3PSPA 1RQNA 5L1LA 2JMGA 1ZQGA 7ICKA 2OEHA 4IRDA 2W9CA 2VIXA 4RQ4A 2W43A 3WFPA 3AM9A 3PSIA 4K4GA 1Z4OA 2WTFA 2AGQA 4QWCA 2UVWA 1T8EA 5J0WA 1KRPA 4WBZA 3OGUA 3H40A 1WWUA 4NLNA 2GA9D 1UEVA 4JUZA 4UATA 8ICJA 5CEHA 2KKPA 1XWLA 1Z19A 8ICXA 3PY8A 3HKZF 4JV0A 2IHNA 2D6FC 3RF9A 4YVZA 4E8FA 3TFSA 4DQQA 4UAYA 4ZOHC 2EAPA 4FE3A 2Y1IA 3RJFA 9ICMA 1N56A 2FPMA 4IR1A 1NK5A 1ZRNA 1HIWA 1VJ5A 1NKBA 2R18A 2B21A 4O69A 2AGOA 3RBEA 1UPHA 2G07A 5AKZA 3CNHA 2PKEA 3TADA 2C2EA 2XICA 3NWIA 3KZIU 5ALGA 1VFGA 4YP3A 2JEGA 4I2FA 3I1YA 4IRCA 4K4HA 2ISPA 3RRGA 7ICGA 1YZ6A 3BQ0A 3IRUA 4RZRA 4Y2PA 7ICOA 4XQ7A 2Y0SC 2HCFA 2ZTDA 3CW2C 3JPPA 1N60A 2RDIA 3O0FA 1BPDA 4F5RA 2ZG6A 5HRFA 4EYHB 7ICHA 4I2JA 2NRVA 4LZDA 4DL6A 4JV2A 3WK4A 1XSPA 2R8KA 1PZNA 1ZQBA 2DKXA 2F77X 2KFZA 9ICOA 9ICSA 4UQGA 2QKQA 3OJUA 1B22A 1NKCA 3KOOA 4RQ5A 2J6TA 5KG3A 2C28A 3ICXA 3QYPA 3C5GA 1BNPA 5JTIA 1WYGA 4P4MA 2BDPA 4P0QB 4E0DA 3MCRA 1RPLA 4QWBA 4MF8A 2UVVA 1TE2A 3ISCA 2BPCA 3PSFA 4O5EA 4FFDA 1BGXT 3SV3A 5AKHA 3Q8RB 1NJYA 2PFQA 2QARB 5IINA 3C21A 2P6UA 3C23A 3SENA 2M9NA 1TK0A 5EE3A 3A0HU 2A1AA 8ICUA 4RWQA 4RT3A 4UD4A 5EE0A 1NK8A 1X2IA 4CE6A 3L5KA 4TURA 2EZZA 4KLMA 2K4HA 4O3OA 4UBCA 1ZQHA 2C2RA 3SMVA 4ED2A 4MFFA 5ALZA 2E8NA 2WB1F 3OUYA 2DR9A 2JEJA 3SAHA 5KG5A 5KTQA 4NL9C 3D2SA 9ICJA 5HRIA 2ZXHA 3LVWA 3TI0A 4DLGA 3GIKA 5G5GA 2V9WA 4F4KA
chains in the Genus database with same CATH topology
4YR3A 1ZQMA 2MUTA 2O1PA 4X0BA 3GV7B 4F4ZA 1BPZA 5DDMA 7ICPA 4RUCA 2HVHA 5DBBA 1VJ7A 4M2YA 1A76A 4PGXA 3OJSA 2W8KA 8ICFA 7ICIA 1Q79A 4TQSA 4DO9A 4FHYA 4ECZA 4EBKA 5HMLA 4B9MA 5DG9A 1ZQIA 4O3PA 3TAQA 2FMQA 4KMUA 5KFLA 5DQIA 3AQNA 5DQHA 3BQ2A 2HHQA 5KG0A 3JPNA 1R8AA 7ICQA 2UVUA 9ICNA 2DVIA 4DEZA 4BWJA 3M8SA 4RQ1A 4YMNA 4UB2A 5KFNA 4KLFA 4X4PA 1RXVA 2IA6A 4Q8FA 2PI5A 4BGDA 1NKEA 4YD1A 4RUAA 4J9OA 4Q45A 3AUOA 8ICNA 2FPKA 3MDAA 1SZPA 2OWOA 3FYHA 4J9RA 4BXOB 1CUKA 2HHXA 4DL2A 2M2WA 4RPYA 4KN4A 4ED1A 1BPXA 4ELVA 4QZEA 4UB3A 4MEXA 1S10A 8ICHA 2VA8A 3V72A 3SZ2A 5IIJA 3PW0A 2XGPA 4YMOA 5CP2A 5KG2A 5J0XA 4DS5A 4DLEA 5DDYA 2HHTA 4J9NA 4JWNA 4UB4A 3WFOA 2DR9A 1SL0A 1Z00B 1Z3EB 2ISOA 4PPXA 4BWMA 5KT6A 1OU5A 2ZH3A 5BPCA 1N48A 2GWSA 3QEBZ 4O5CA 3H39A 2KN7A 3BQTA 4F5OA 4TUSA 3HIYA 3GIIA 4XQ8A 1QSSA 2BCQA 3EYZA 4FO6A 2BQRA 4PGQA 4I2GA 9ICCA 9ICUA 4NY8A 4UB1A 3KHRA 2ASDA 2DR8A 2R8GA 4KLEA 5J2EA 3LK9A 5KFOA 3HT3A 1KEJA 2M2UA 4NKTA 3FDSA 3RH4A 4IRKA 5IIOA 1MQ3A 2R8IA 1U45A 1L5UA 5KFCA 5HREA 4FBTA 2ZH9A 3HJ4A 5KFTA 1L3VA 4I2AA 9ICEA 3AQKA 4JWMA 5KFKA 4FS2A 4ECRA 3THVA 1BPEA 2LYHA 8ICVA 2H5XA 5KFJA 3ISBA 4DSLA 1KFTA 3KHHA 1T7PA 4QZ9A 2DPJA 1KSPA 4F8RA 2HHSA 8ICAA 1Y88A 4ED6A 9ICWA 4QW9A 1R8CA 4AT9B 2I9GA 4GC6A 4C8NA 5BOMA 3OUYB 4YQWA 4MFAA 3KHGA 2ZTEA 2AQ0A 5KFFA 3MDCA 3GIJA 1UA1A 5D46A 4I29A 8ICKA 3B0XA 4DL4A 1KLNA 2DPIA 5DLGA 2PFOA 4NM1A 5HMMA 1S0MA 2VA2A 5KT4A 4O5KA 2BKEA 4AT7A 4ATBA 1S0OA 3PX0A 8ICMA 5DKWA 4KLTA 2PBEA 4KLGA 4RWPA 5F2VO 3QZ7A 8ICQA 2JEFA 1U4BA 1RZTA 4DSKA 8ICZA 1MIVA 4X4VA 4YFKA 5KFRA 4X4NA 4J9MA 2JZBA 4RNOA 3MR5A 3RJJA 3ZD8A 4WC2A 4QWDA 9ICRA 4X4TA 3ZDEA 3AQMA 3H4BA 3BQ1A 1KTQA 4R65A 7ICSA 5HNKA 3PW2A 4KN7A 9ICXA 4LT6A 3M9MB 4ZH4A 1S0VA 3EZ5A 4WC6A 4I27A 5J0PA 5HRKA 2HHVA 5KFAA 1U48A 1JXLA 2NRTA 3Q8PB 3T5JA 5KG7A 3UXNA 5KFPA 3UXOA 5KFQA 4ECQA 4YD2A 5D4BA 4RWNA 2AGPA 5DB8A 2ALZA 4MEYA 2AU0A 1QSYA 5DLFA 4IQWA 1BNOA 2ZHBA 4UB5A 4M5DA 4DSIA 4DSEA 3K75D 2A1JB 8ICYA 1R89A 2ZH4A 1YLQA 1DK2A 2NRXA 4PHAA 3GDXA 3PO4A 1ZQWA 1FA0A 2ZH2A 5F9NA 4F2SA 5KT7A 3GILA 3K4GA 4RPZA 3LWLA 1KFDA 4ED0A 2M2VA 3JZ0A 3JPQA 4ECSA 9ICHA 2ZH1A 1LB2B 3RTVA 1X9SA 2W9MA 4DS4A 4ECWA 4UD5A 3RH5A 1TFRA 1ZQEA 1BVSA 4Z6FA 1RYSA 2BQUA 4J9SA 1QTMA 3ZDCA 1L3TA 4NLGA 7ICMA 2A1JA 1S9FA 5J2DA 3M8RA 4J9PA 5IIIA 3RB0A 2IMWP 2F1HA 2ZJ5A 5KFMA 4RPXA 3HW8A 4DOAA 4LZGA 2DR7A 3WFRE 4EYIB 4WC0A 4F3OA 3T5HA 4PHPA 1H38A 3AU6A 2HW3A 1NK7A 2KP7A 3H3AA 4O3SA 2KZ3A 5J0OA 3ZDBA 3HPOA 5DG7A 4GXJA 7ICFA 1K1QA 4RQ8A 4DOBA 1D8YA 3ZDDA 4B9LA 3AU2A 2BCSA 1S77D 8ICCA 4XRHA 3V7KA 2BQ3A 3MGIA 2XC9A 2ZTCA 5J0YA 3ORYA 3NGDA 4YCXA 1XO1A 5J2BA 2W9BA 4MFCA 1DOQA 3H4DA 2W8LA 3RJHA 1UETA 4GXIA 3TAPA 2JEIA 4I2BA 4DQPA 3OVBA 3RB6A 4DWIA 5KT5A 2NRZA 5J0RA 1HUOA 4I28A 1XS9D 8ICTA 5DGAA 4X5VA 4JV1A 2KTQA 2J6UA 3MFIA 2DRBA 1MIYA 4KLDA 3TARA 3PW7A 4EZ9A 3MR6A 1WOTA 5DGBA 5J2GA 5KFHA 3SYZA 1SL1A 4RQ2A 2FLNA 1COOA 4G3IA 2KFNA 3M9OB 1UEUA 3N97B 3HX0A 9ICPA 4R63A 1ZQAA 1DK3A 5EWEA 2P66A 3UPSA 2V4QA 3UQ0A 8ICGA 1R8BA 4YR2A 4QZIA 3GQCA 4ECYA 3PW5A 2XCPA 1L3SA 2JZBB 2FMPA 5DBCA 2I1QA 4YXJA 5L1KA 5KFSA 3PMNA 3KTQA 3N4MB 1ZQVA 1D9DA 5DEDA 3C2MA 3RB3A 4DQIA 4I2DA 4RU9A 3T3FA 5KFWA 3MR2A 2FPLA 1NJZA 1NK0A 2IHMA 4AT9A 3C5FA 5TZVA 5DBAA 3EW9A 5KFUA 3WFSC 1EXNA 1AROP 5CB1A 5L1IA 1ZQRA 5KG6A 4EBCA 4IG8A 2ATLA 3PNCA 3TFRA 3E2EA 1ZQQA 4WBYA 5DB6A 4WC3A 4QWEA 4KLIA 3RR7A 1MQ2A 4M6WA 3JPRA 3SV4A 5HRHA 1NOMA 3RAQA 3TANA 1PX5A 5DB9A 4E7XA 4QW8A 4RWOA 5CJ7A 2DR5A 3JPOA 4B9VA 1U47A 3BJYA 3ZD9A 3IHQB 4F5PA 4EBDA 1IXRA 4KLLA 1JQRA 1IM4A 5EOZA 2ZH5A 3G6XA 4YN4A 7ICTA 3GIMA 3H8SA 2ZUDA 1HUZA 3HWTA 4QZCA 3OSPA 1ZQFA 4I2HA 4K4IA 4MF2A 7ICEA 5HRBA 2DFLA 2XY6A 9ICGA 3L9DA 4YG2A 5DG8A 1JMSA 4M6WB 2W9AA 5KFIA 4NLZA 4FH3A 3EPGA 5J0SA 4M04A 4F91B 4BXOA 4O3RA 4WC7A 1MSWD 4DL5A 4EEYA 4AT8B 4R8UA 1UA0A 1NJWA 4QZBA 2C2DA 4EBEA 1ZQYA 2XY7A 4UBBA 2ZJ8A 3RJGA 4E80A 2DRAA 3KHLA 5JUMA 2HVIA 4O3NA 3PO5A 5KFDA 8ICSA 2BCUA 1S76D 1ZQOA 3Q8QB 4GC7A 2ZHAA 9ICLA 3PV8A 4ELTA 4C8KA 1SKWA 4M0AA 5DQGA 1ZQJA 4GLXA 4M47A 1D8LA 5L9XA 4AT8A 3MBYA 5CWRA 2RDJA 4DFPA 1TAQA 3ETLA 5J2CA 4PHDA 4X4SA 1XSNA 3RR8A 8ICRA 2XGQA 3RJEA 4F4WA 9ICVA 1ZJMA 5KFYA 3B0YA 4BDPA 1SKSA 1V4AA 5HRGA 2MAXA 4Z6CA 1NK6A 5CA7A 9ICQA 3Q8KA 3V6KA 2BPGA 3H38A 4FHXA 1ZQSA 5IIKA 4I2IA 2PXIA 5KFXA 4LVSA 4F4XA 5HP4A 1BPYA 9ICAA 4WC5A 3H8WA 3PR5B 5DB7A 2C22A 2P6RA 1T4GA 1ZQLA 3RJKA 4O3QA 7ICNA 4YMMA 1JXEA 5CHGA 4KLSA 8ICEA 4Z6EA 3QEAZ 5IIMA 4F50A 2BCVA 3RAXA 8ICWA 3Q8LA 2BGWA 5KFZA 4RNNA 3PR4A 4QZFA 2FLLA 3NTUA 1TAUA 5L1LA 1S0NA 3EPIA 4ED8A 1ZQGA 7ICKA 5EWFA 5KFBA 4IRDA 2W9CA 1T3NA 4RQ4A 4C8LA 5HRLA 3NYBA 5KG1A 4Q44A 5BOLA 4Z6DA 4AT7B 1ZETA 3WFPA 3H7IA 5KFEA 3MFHA 2WTFA 4K4GA 2AGQA 7ICVA 3OV7A 4YR0A 1UT8A 4QWCA 2VANA 5J2KA 2UVWA 1T8EA 5J2FA 5J0WA 2XO7A 3UPQA 3PX4A 1KRPA 4WBZA 3OGUA 3WFQE 3H40A 4PH5A 3MABA 3Q8SB 3G6VA 2W9CB 4DF4A 2Q0ZX 4NLNA 1RXWA 3LWMA 1V9PA 5J2JA 4KLQA 8ICLA 4J9LA 1UEVA 1BPBA 4JUZA 3ZDAA 4IQUA 8ICJA 2KZMA 3PW4A 1C7YA 4C8MA 1XWLA 1NK9A 5L1JA 8ICXA 3C2KA 8ICIA 4DFJA 3PY8A 4R64A 1SL2A 4JV0A 3C1ZA 5HC9A 5J0QA 1ZJNA 1D9FA 2IHNA 2PFPA 5J2IA 4R8UB 9ICFA 4YVZA 5HRDA 4J9QA 4E8FA 5J0UA 1U49A 4F93B 4EP7A 3TFSA 4I2CA 3HJ1A 2BHNA 3MR3A 4F5NA 4DQQA 5EWGA 4UAYA 1ZQNA 4M9LA 3JYYA 4FHWA 5KFVA 1ZQUA 1K1SA 2M2TA 2R8JA 1MC8A 1TVAA 4IQVA 4FS1A 4XUSA 3T5KA 4DF8A 2ASJA 4KLJA 1KFSA 4XA5A 5J2HA 1KDHA 4WC4A 4ECVA 2Y1IA 3RH6A 3RJFA 4WC1A 5KT2A 9ICMA 3H8JA 1ZYQA 1B43A 4KITB 2XCAA 1N56A 3QZ8A 2KZZA 1TK5A 2FPMA 5J29A 4FBUA 4NLKA 4S3NA 4IR1A 1U9LA 1NK5A 1L3UA 1QSLA 2PFNA 1NKBA 4B9SA 3GFKB 4RQ3A 1TK8A 2B21A 4F92B 3HP6A 3G6YA 2HHWA 4ED3A 3M9NB 4J9KA 2AGOA 3RBEA 4X4RA 5DECA 2W9BB 4IR9A 9ICBA 4QWAA 3T5LA 1X9MA 4DQRA 4O9MA 3GV5B 2PI4A 4RNMA 2C2EA 2ZJAA 1VFGA 3C18A 4YP3A 2JEGA 7ICLA 4I2FA 4X4OA 4QZDA 4B9UA 4IRCA 1NJXA 4B9NA 4EZ6A 4CCHA 2ISPA 4K4HA 3V7JA 4DFMA 3RRGA 7ICGA 1ZQTA 2AJQA 3BQ0A 1NO5A 3OVSA 4I2EA 8ICOA 4RZRA 3UQ2A 4XQ7A 1DGSA 1XSLA 1JIHA 4RQ7A 7ICOA 9ICIA 3LDAA 3OHAA 2ZTDA 2O5AA 4DL7A 3JPPA 2F1IA 1JX4A 4ATBB 2NRWA 1JAJA 2RDIA 4TQRA 5HHHA 5KFGA 1CEZA 5D49A 2Q66A 1BPDA 4P4OA 4ELUA 4KLHA 1WCLA 2XY5A 4F5RA 2Y1JA 4GXKA 3V7LA 2VA3A 4NKUA 5C5JA 5HRFA 4EYHB 7ICHA 4I2JA 2NRVA 4LZDA 1LV5A 2UVRA 3RRHA 4DL6A 4JV2A 4X4UA 2AQ4A 1ZQPA 3V6HA 1XSPA 2R8KA 1NZPA 1SKRA 4M9GA 1PZNA 7ICJA 1ZQBA 4IQTA 2BCRA 4Q8EA 2J6SA 4KLOA 2KFZA 9ICOA 4FHVA 9ICSA 1WCNA 4UQGA 4ECTA 3PX6A 4P2HA 4DSFA 2FMSA 4QZ8A 4TUQA 4DFKA 4F2RA 3OJUA 1B22A 1NKCA 4RQ5A 2FLPA 2J6TA 5KG3A 2BE3A 2C28A 2BPFA 3C5GA 3OVAA 5KT3A 4QZGA 3Q8MA 1BNPA 2NRKA 4R66A 4O0IA 4UAWA 3BDPA 3PMLA 3RBDA 5HHIA 4RT2A 4P4MA 1KNYA 1ZQCA 2BDPA 2ZH6A 1ZQXA 9ICKA 2ASLA 4E0DA 1ZQDA 3EWAA 1RPLA 4QWBA 4QZAA 4MF8A 2UVVA 1ZQKA 3ISCA 4DSJA 8ICPA 4RQ0A 1TFYA 1Z00A 2BPCA 5J0TA 3RJIA 4O5EA 4WCWA 1TKDA 1BGXT 3SV3A 8ICBA 3PVXA 4JK1A 4M9NA 4ED7A 3C1YA 4PHEA 3Q8RB 1QLNA 3AQLA 1UT5A 1NJYA 2PFQA 1XU4A 5IINA 3C21A 5F9LA 3OSNA 4ECXA 2P6UA 4FH5A 5IILA 4RQ6A 1XC9A 3C23A 3LQCB 2M9NA 1TK0A 4X4QA 3GV8B 3MGHA 7ICRA 4FHPA 3V6JA 1JN3A 4X0AA 4F5QA 8ICUA 4RT3A 2V4RA 3TQ1A 1TV9A 1NK8A 2ID1A 4RWQA 1X2IA 4UD4A 4UAZA 1F5AA 4KTQA 2IBKA 5HR9A 4M9HA 4TURA 4PGYA 5J2AA 1Q78A 5KG4A 4O3OA 4KLMA 2HHPA 3IM1A 3C2LA 3ISDA 1A77A 4UBCA 1ZQHA 4NXZA 2C2RA 4KLUA 1ZQZA 3RB4A 3UXPA 4ED2A 4F4YA 1NK4A 7ICUA 4MFFA 3H37A 2F1JA 2BR0A 3OUYA 2R8HA 2MUTB 2ZUCA 3OHBA 4DQSA 4QZHA 3QE9Y 4NM2A 1RYRA 2JEJA 2HHUA 1MIWA 5CR0A 2ZUBA 3C66A 1TFWA 3JPTA 5KG5A 5KTQA 1S97A 4HYKA 3JPSA 9ICJA 2ZH7A 4TUPA 4YXMA 5HRIA 3TI0A 9ICTA 2ZH8A 4DLGA 4DOCA 3SI8A 4P4PA 4C8OA 2RFFA 4Q43A 3GIKA 1X9WA 4M9JA 4DL3A 4EBJA 2V9WA 4B9TA 4ECUA 1HJPA 4F4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YR3 A;  1ZQM A;  2MUT A;  2O1P A;  4X0B A;  3GV7 B;  4F4Z A;  1BPZ A;  5DDM A;  7ICP A;  4RUC A;  2HVH A;  5DBB A;  1VJ7 A;  4M2Y A;  1A76 A;  4PGX A;  3OJS A;  2W8K A;  8ICF A;  7ICI A;  1Q79 A;  4TQS A;  4DO9 A;  4FHY A;  4ECZ A;  4EBK A;  5HML A;  4B9M A;  5DG9 A;  1ZQI A;  4O3P A;  3TAQ A;  2FMQ A;  4KMU A;  5KFL A;  5DQI A;  3AQN A;  5DQH A;  3BQ2 A;  2HHQ A;  5KG0 A;  3JPN A;  1R8A A;  7ICQ A;  2UVU A;  9ICN A;  2DVI A;  4DEZ A;  4BWJ A;  3M8S A;  4RQ1 A;  4YMN A;  4UB2 A;  5KFN A;  4KLF A;  4X4P A;  1RXV A;  2IA6 A;  4Q8F A;  2PI5 A;  4BGD A;  1NKE A;  4YD1 A;  4RUA A;  4J9O A;  4Q45 A;  3AUO A;  8ICN A;  2FPK A;  3MDA A;  1SZP A;  2OWO A;  3FYH A;  4J9R A;  4BXO B;  1CUK A;  2HHX A;  4DL2 A;  2M2W A;  4RPY A;  4KN4 A;  4ED1 A;  1BPX A;  4ELV A;  4QZE A;  4UB3 A;  4MEX A;  1S10 A;  8ICH A;  2VA8 A;  3V72 A;  3SZ2 A;  5IIJ A;  3PW0 A;  2XGP A;  4YMO A;  5CP2 A;  5KG2 A;  5J0X A;  4DS5 A;  4DLE A;  5DDY A;  2HHT A;  4J9N A;  4JWN A;  4UB4 A;  3WFO A;  2DR9 A;  1SL0 A;  1Z00 B;  1Z3E B;  2ISO A;  4PPX A;  4BWM A;  5KT6 A;  1OU5 A;  2ZH3 A;  5BPC A;  1N48 A;  2GWS A;  3QEB Z;  4O5C A;  3H39 A;  2KN7 A;  3BQT A;  4F5O A;  4TUS A;  3HIY A;  3GII A;  4XQ8 A;  1QSS A;  2BCQ A;  3EYZ A;  4FO6 A;  2BQR A;  4PGQ A;  4I2G A;  9ICC A;  9ICU A;  4NY8 A;  4UB1 A;  3KHR A;  2ASD A;  2DR8 A;  2R8G A;  4KLE A;  5J2E A;  3LK9 A;  5KFO A;  3HT3 A;  1KEJ A;  2M2U A;  4NKT A;  3FDS A;  3RH4 A;  4IRK A;  5IIO A;  1MQ3 A;  2R8I A;  1U45 A;  1L5U A;  5KFC A;  5HRE A;  4FBT A;  2ZH9 A;  3HJ4 A;  5KFT A;  1L3V A;  4I2A A;  9ICE A;  3AQK A;  4JWM A;  5KFK A;  4FS2 A;  4ECR A;  3THV A;  1BPE A;  2LYH A;  8ICV A;  2H5X A;  5KFJ A;  3ISB A;  4DSL A;  1KFT A;  3KHH A;  1T7P A;  4QZ9 A;  2DPJ A;  1KSP A;  4F8R A;  2HHS A;  8ICA A;  1Y88 A;  4ED6 A;  9ICW A;  4QW9 A;  1R8C A;  4AT9 B;  2I9G A;  4GC6 A;  4C8N A;  5BOM A;  3OUY B;  4YQW A;  4MFA A;  3KHG A;  2ZTE A;  2AQ0 A;  5KFF A;  3MDC A;  3GIJ A;  1UA1 A;  5D46 A;  4I29 A;  8ICK A;  3B0X A;  4DL4 A;  1KLN A;  2DPI A;  5DLG A;  2PFO A;  4NM1 A;  5HMM A;  1S0M A;  2VA2 A;  5KT4 A;  4O5K A;  2BKE A;  4AT7 A;  4ATB A;  1S0O A;  3PX0 A;  8ICM A;  5DKW A;  4KLT A;  2PBE A;  4KLG A;  4RWP A;  5F2V O;  3QZ7 A;  8ICQ A;  2JEF A;  1U4B A;  1RZT A;  4DSK A;  8ICZ A;  1MIV A;  4X4V A;  4YFK A;  5KFR A;  4X4N A;  4J9M A;  2JZB A;  4RNO A;  3MR5 A;  3RJJ A;  3ZD8 A;  4WC2 A;  4QWD A;  9ICR A;  4X4T A;  3ZDE A;  3AQM A;  3H4B A;  3BQ1 A;  1KTQ A;  4R65 A;  7ICS A;  5HNK A;  3PW2 A;  4KN7 A;  9ICX A;  4LT6 A;  3M9M B;  4ZH4 A;  1S0V A;  3EZ5 A;  4WC6 A;  4I27 A;  5J0P A;  5HRK A;  2HHV A;  5KFA A;  1U48 A;  1JXL A;  2NRT A;  3Q8P B;  3T5J A;  5KG7 A;  3UXN A;  5KFP A;  3UXO A;  5KFQ A;  4ECQ A;  4YD2 A;  5D4B A;  4RWN A;  2AGP A;  5DB8 A;  2ALZ A;  4MEY A;  2AU0 A;  1QSY A;  5DLF A;  4IQW A;  1BNO A;  2ZHB A;  4UB5 A;  4M5D A;  4DSI A;  4DSE A;  3K75 D;  2A1J B;  8ICY A;  1R89 A;  2ZH4 A;  1YLQ A;  1DK2 A;  2NRX A;  4PHA A;  3GDX A;  3PO4 A;  1ZQW A;  1FA0 A;  2ZH2 A;  5F9N A;  4F2S A;  5KT7 A;  3GIL A;  3K4G A;  4RPZ A;  3LWL A;  1KFD A;  4ED0 A;  2M2V A;  3JZ0 A;  3JPQ A;  4ECS A;  9ICH A;  2ZH1 A;  1LB2 B;  3RTV A;  1X9S A;  2W9M A;  4DS4 A;  4ECW A;  4UD5 A;  3RH5 A;  1TFR A;  1ZQE A;  1BVS A;  4Z6F A;  1RYS A;  2BQU A;  4J9S A;  1QTM A;  3ZDC A;  1L3T A;  4NLG A;  7ICM A;  2A1J A;  1S9F A;  5J2D A;  3M8R A;  4J9P A;  5III A;  3RB0 A;  2IMW P;  2F1H A;  2ZJ5 A;  5KFM A;  4RPX A;  3HW8 A;  4DOA A;  4LZG A;  2DR7 A;  3WFR E;  4EYI B;  4WC0 A;  4F3O A;  3T5H A;  4PHP A;  1H38 A;  3AU6 A;  2HW3 A;  1NK7 A;  2KP7 A;  3H3A A;  4O3S A;  2KZ3 A;  5J0O A;  3ZDB A;  3HPO A;  5DG7 A;  4GXJ A;  7ICF A;  1K1Q A;  4RQ8 A;  4DOB A;  1D8Y A;  3ZDD A;  4B9L A;  3AU2 A;  2BCS A;  1S77 D;  8ICC A;  4XRH A;  3V7K A;  2BQ3 A;  3MGI A;  2XC9 A;  2ZTC A;  5J0Y A;  3ORY A;  3NGD A;  4YCX A;  1XO1 A;  5J2B A;  2W9B A;  4MFC A;  1DOQ A;  3H4D A;  2W8L A;  3RJH A;  1UET A;  4GXI A;  3TAP A;  2JEI A;  4I2B A;  4DQP A;  3OVB A;  3RB6 A;  4DWI A;  5KT5 A;  2NRZ A;  5J0R A;  1HUO A;  4I28 A;  1XS9 D;  8ICT A;  5DGA A;  4X5V A;  4JV1 A;  2KTQ A;  2J6U A;  3MFI A;  2DRB A;  1MIY A;  4KLD A;  3TAR A;  3PW7 A;  4EZ9 A;  3MR6 A;  1WOT A;  5DGB A;  5J2G A;  5KFH A;  3SYZ A;  1SL1 A;  4RQ2 A;  2FLN A;  1COO A;  4G3I A;  2KFN A;  3M9O B;  1UEU A;  3N97 B;  3HX0 A;  9ICP A;  4R63 A;  1ZQA A;  1DK3 A;  5EWE A;  2P66 A;  3UPS A;  2V4Q A;  3UQ0 A;  8ICG A;  1R8B A;  4YR2 A;  4QZI A;  3GQC A;  4ECY A;  3PW5 A;  2XCP A;  1L3S A;  2JZB B;  2FMP A;  5DBC A;  2I1Q A;  4YXJ A;  5L1K A;  5KFS A;  3PMN A;  3KTQ A;  3N4M B;  1ZQV A;  1D9D A;  5DED A;  3C2M A;  3RB3 A;  4DQI A;  4I2D A;  4RU9 A;  3T3F A;  5KFW A;  3MR2 A;  2FPL A;  1NJZ A;  1NK0 A;  2IHM A;  4AT9 A;  3C5F A;  5TZV A;  5DBA A;  3EW9 A;  5KFU A;  3WFS C;  1EXN A;  1ARO P;  5CB1 A;  5L1I A;  1ZQR A;  5KG6 A;  4EBC A;  4IG8 A;  2ATL A;  3PNC A;  3TFR A;  3E2E A;  1ZQQ A;  4WBY A;  5DB6 A;  4WC3 A;  4QWE A;  4KLI A;  3RR7 A;  1MQ2 A;  4M6W A;  3JPR A;  3SV4 A;  5HRH A;  1NOM A;  3RAQ A;  3TAN A;  1PX5 A;  5DB9 A;  4E7X A;  4QW8 A;  4RWO A;  5CJ7 A;  2DR5 A;  3JPO A;  4B9V A;  1U47 A;  3BJY A;  3ZD9 A;  3IHQ B;  4F5P A;  4EBD A;  1IXR A;  4KLL A;  1JQR A;  1IM4 A;  5EOZ A;  2ZH5 A;  3G6X A;  4YN4 A;  7ICT A;  3GIM A;  3H8S A;  2ZUD A;  1HUZ A;  3HWT A;  4QZC A;  3OSP A;  1ZQF A;  4I2H A;  4K4I A;  4MF2 A;  7ICE A;  5HRB A;  2DFL A;  2XY6 A;  9ICG A;  3L9D A;  4YG2 A;  5DG8 A;  1JMS A;  4M6W B;  2W9A A;  5KFI A;  4NLZ A;  4FH3 A;  3EPG A;  5J0S A;  4M04 A;  4F91 B;  4BXO A;  4O3R A;  4WC7 A;  1MSW D;  4DL5 A;  4EEY A;  4AT8 B;  4R8U A;  1UA0 A;  1NJW A;  4QZB A;  2C2D A;  4EBE A;  1ZQY A;  2XY7 A;  4UBB A;  2ZJ8 A;  3RJG A;  4E80 A;  2DRA A;  3KHL A;  5JUM A;  2HVI A;  4O3N A;  3PO5 A;  5KFD A;  8ICS A;  2BCU A;  1S76 D;  1ZQO A;  3Q8Q B;  4GC7 A;  2ZHA A;  9ICL A;  3PV8 A;  4ELT A;  4C8K A;  1SKW A;  4M0A A;  5DQG A;  1ZQJ A;  4GLX A;  4M47 A;  1D8L A;  5L9X A;  4AT8 A;  3MBY A;  5CWR A;  2RDJ A;  4DFP A;  1TAQ A;  3ETL A;  5J2C A;  4PHD A;  4X4S A;  1XSN A;  3RR8 A;  8ICR A;  2XGQ A;  3RJE A;  4F4W A;  9ICV A;  1ZJM A;  5KFY A;  3B0Y A;  4BDP A;  1SKS A;  1V4A A;  5HRG A;  2MAX A;  4Z6C A;  1NK6 A;  5CA7 A;  9ICQ A;  3Q8K A;  3V6K A;  2BPG A;  3H38 A;  4FHX A;  1ZQS A;  5IIK A;  4I2I A;  2PXI A;  5KFX A;  4LVS A;  4F4X A;  5HP4 A;  1BPY A;  9ICA A;  4WC5 A;  3H8W A;  3PR5 B;  5DB7 A;  2C22 A;  2P6R A;  1T4G A;  1ZQL A;  3RJK A;  4O3Q A;  7ICN A;  4YMM A;  1JXE A;  5CHG A;  4KLS A;  8ICE A;  4Z6E A;  3QEA Z;  5IIM A;  4F50 A;  2BCV A;  3RAX A;  8ICW A;  3Q8L A;  2BGW A;  5KFZ A;  4RNN A;  3PR4 A;  4QZF A;  2FLL A;  3NTU A;  1TAU A;  5L1L A;  1S0N A;  3EPI A;  4ED8 A;  1ZQG A;  7ICK A;  5EWF A;  5KFB A;  4IRD A;  2W9C A;  1T3N A;  4RQ4 A;  4C8L A;  5HRL A;  3NYB A;  5KG1 A;  4Q44 A;  5BOL A;  4Z6D A;  4AT7 B;  1ZET A;  3WFP A;  3H7I A;  5KFE A;  3MFH A;  2WTF A;  4K4G A;  2AGQ A;  7ICV A;  3OV7 A;  4YR0 A;  1UT8 A;  4QWC A;  2VAN A;  5J2K A;  2UVW A;  1T8E A;  5J2F A;  5J0W A;  2XO7 A;  3UPQ A;  3PX4 A;  1KRP A;  4WBZ A;  3OGU A;  3WFQ E;  3H40 A;  4PH5 A;  3MAB A;  3Q8S B;  3G6V A;  2W9C B;  4DF4 A;  2Q0Z X;  4NLN A;  1RXW A;  3LWM A;  1V9P A;  5J2J A;  4KLQ A;  8ICL A;  4J9L A;  1UEV A;  1BPB A;  4JUZ A;  3ZDA A;  4IQU A;  8ICJ A;  2KZM A;  3PW4 A;  1C7Y A;  4C8M A;  1XWL A;  1NK9 A;  5L1J A;  8ICX A;  3C2K A;  8ICI A;  4DFJ A;  3PY8 A;  4R64 A;  1SL2 A;  4JV0 A;  3C1Z A;  5HC9 A;  5J0Q A;  1ZJN A;  1D9F A;  2IHN A;  2PFP A;  5J2I A;  4R8U B;  9ICF A;  4YVZ A;  5HRD A;  4J9Q A;  4E8F A;  5J0U A;  1U49 A;  4F93 B;  4EP7 A;  3TFS A;  4I2C A;  3HJ1 A;  2BHN A;  3MR3 A;  4F5N A;  4DQQ A;  5EWG A;  4UAY A;  1ZQN A;  4M9L A;  3JYY A;  4FHW A;  5KFV A;  1ZQU A;  1K1S A;  2M2T A;  2R8J A;  1MC8 A;  1TVA A;  4IQV A;  4FS1 A;  4XUS A;  3T5K A;  4DF8 A;  2ASJ A;  4KLJ A;  1KFS A;  4XA5 A;  5J2H A;  1KDH A;  4WC4 A;  4ECV A;  2Y1I A;  3RH6 A;  3RJF A;  4WC1 A;  5KT2 A;  9ICM A;  3H8J A;  1ZYQ A;  1B43 A;  4KIT B;  2XCA A;  1N56 A;  3QZ8 A;  2KZZ A;  1TK5 A;  2FPM A;  5J29 A;  4FBU A;  4NLK A;  4S3N A;  4IR1 A;  1U9L A;  1NK5 A;  1L3U A;  1QSL A;  2PFN A;  1NKB A;  4B9S A;  3GFK B;  4RQ3 A;  1TK8 A;  2B21 A;  4F92 B;  3HP6 A;  3G6Y A;  2HHW A;  4ED3 A;  3M9N B;  4J9K A;  2AGO A;  3RBE A;  4X4R A;  5DEC A;  2W9B B;  4IR9 A;  9ICB A;  4QWA A;  3T5L A;  1X9M A;  4DQR A;  4O9M A;  3GV5 B;  2PI4 A;  4RNM A;  2C2E A;  2ZJA A;  1VFG A;  3C18 A;  4YP3 A;  2JEG A;  7ICL A;  4I2F A;  4X4O A;  4QZD A;  4B9U A;  4IRC A;  1NJX A;  4B9N A;  4EZ6 A;  4CCH A;  2ISP A;  4K4H A;  3V7J A;  4DFM A;  3RRG A;  7ICG A;  1ZQT A;  2AJQ A;  3BQ0 A;  1NO5 A;  3OVS A;  4I2E A;  8ICO A;  4RZR A;  3UQ2 A;  4XQ7 A;  1DGS A;  1XSL A;  1JIH A;  4RQ7 A;  7ICO A;  9ICI A;  3LDA A;  3OHA A;  2ZTD A;  2O5A A;  4DL7 A;  3JPP A;  2F1I A;  1JX4 A;  4ATB B;  2NRW A;  1JAJ A;  2RDI A;  4TQR A;  5HHH A;  5KFG A;  1CEZ A;  5D49 A;  2Q66 A;  1BPD A;  4P4O A;  4ELU A;  4KLH A;  1WCL A;  2XY5 A;  4F5R A;  2Y1J A;  4GXK A;  3V7L A;  2VA3 A;  4NKU A;  5C5J A;  5HRF A;  4EYH B;  7ICH A;  4I2J A;  2NRV A;  4LZD A;  1LV5 A;  2UVR A;  3RRH A;  4DL6 A;  4JV2 A;  4X4U A;  2AQ4 A;  1ZQP A;  3V6H A;  1XSP A;  2R8K A;  1NZP A;  1SKR A;  4M9G A;  1PZN A;  7ICJ A;  1ZQB A;  4IQT A;  2BCR A;  4Q8E A;  2J6S A;  4KLO A;  2KFZ A;  9ICO A;  4FHV A;  9ICS A;  1WCN A;  4UQG A;  4ECT A;  3PX6 A;  4P2H A;  4DSF A;  2FMS A;  4QZ8 A;  4TUQ A;  4DFK A;  4F2R A;  3OJU A;  1B22 A;  1NKC A;  4RQ5 A;  2FLP A;  2J6T A;  5KG3 A;  2BE3 A;  2C28 A;  2BPF A;  3C5G A;  3OVA A;  5KT3 A;  4QZG A;  3Q8M A;  1BNP A;  2NRK A;  4R66 A;  4O0I A;  4UAW A;  3BDP A;  3PML A;  3RBD A;  5HHI A;  4RT2 A;  4P4M A;  1KNY A;  1ZQC A;  2BDP A;  2ZH6 A;  1ZQX A;  9ICK A;  2ASL A;  4E0D A;  1ZQD A;  3EWA A;  1RPL A;  4QWB A;  4QZA A;  4MF8 A;  2UVV A;  1ZQK A;  3ISC A;  4DSJ A;  8ICP A;  4RQ0 A;  1TFY A;  1Z00 A;  2BPC A;  5J0T A;  3RJI A;  4O5E A;  4WCW A;  1TKD A;  1BGX T;  3SV3 A;  8ICB A;  3PVX A;  4JK1 A;  4M9N A;  4ED7 A;  3C1Y A;  4PHE A;  3Q8R B;  1QLN A;  3AQL A;  1UT5 A;  1NJY A;  2PFQ A;  1XU4 A;  5IIN A;  3C21 A;  5F9L A;  3OSN A;  4ECX A;  2P6U A;  4FH5 A;  5IIL A;  4RQ6 A;  1XC9 A;  3C23 A;  3LQC B;  2M9N A;  1TK0 A;  4X4Q A;  3GV8 B;  3MGH A;  7ICR A;  4FHP A;  3V6J A;  1JN3 A;  4X0A A;  4F5Q A;  8ICU A;  4RT3 A;  2V4R A;  3TQ1 A;  1TV9 A;  1NK8 A;  2ID1 A;  4RWQ A;  1X2I A;  4UD4 A;  4UAZ A;  1F5A A;  4KTQ A;  2IBK A;  5HR9 A;  4M9H A;  4TUR A;  4PGY A;  5J2A A;  1Q78 A;  5KG4 A;  4O3O A;  4KLM A;  2HHP A;  3IM1 A;  3C2L A;  3ISD A;  1A77 A;  4UBC A;  1ZQH A;  4NXZ A;  2C2R A;  4KLU A;  1ZQZ A;  3RB4 A;  3UXP A;  4ED2 A;  4F4Y A;  1NK4 A;  7ICU A;  4MFF A;  3H37 A;  2F1J A;  2BR0 A;  3OUY A;  2R8H A;  2MUT B;  2ZUC A;  3OHB A;  4DQS A;  4QZH A;  3QE9 Y;  4NM2 A;  1RYR A;  2JEJ A;  2HHU A;  1MIW A;  5CR0 A;  2ZUB A;  3C66 A;  1TFW A;  3JPT A;  5KG5 A;  5KTQ A;  1S97 A;  4HYK A;  3JPS A;  9ICJ A;  2ZH7 A;  4TUP A;  4YXM A;  5HRI A;  3TI0 A;  9ICT A;  2ZH8 A;  4DLG A;  4DOC A;  3SI8 A;  4P4P A;  4C8O A;  2RFF A;  4Q43 A;  3GIK A;  1X9W A;  4M9J A;  4DL3 A;  4EBJ A;  2V9W A;  4B9T A;  4ECU A;  1HJP A;  4F4K A; 
#chains in the Genus database with same CATH topology
 4X0B A;  2O1P A;  7ICP A;  2HVH A;  4M2Y A;  2WB1 C;  7ICI A;  5HML A;  4O3P A;  4KMU A;  5DQI A;  5DQH A;  5KG0 A;  1R8A A;  2LPE A;  1KL9 A;  5AK4 A;  9ICN A;  4DEZ A;  4RQ1 A;  1NKE A;  4YD1 A;  5ALO A;  1SZP A;  2OWO A;  4BXO B;  4DL2 A;  4DCC A;  4RPY A;  4KN4 A;  3HJE A;  4ED1 A;  1BPX A;  3IN5 A;  4MEX A;  5AIA A;  3V72 A;  2YTU A;  2XGP A;  3K7D A;  5CP2 A;  5KG2 A;  5J0X A;  5DDY A;  3WFO A;  4PPX A;  4BWM A;  1N48 A;  4K96 A;  3QEB Z;  2KN7 A;  5ALI A;  4QJF B;  2BCQ A;  4FO6 A;  2DR8 A;  1XO0 A;  3KHR A;  5ALP A;  4KLE A;  2K4I A;  5AI0 A;  2M2U A;  1KEJ A;  4Y2V A;  2R8I A;  1OW5 A;  1U45 A;  4UAR A;  5KFC A;  5HRE A;  3LVV A;  1KSP A;  1T3Q A;  4AT9 B;  4ED6 A;  9ICW A;  4LEV A;  2I9G A;  4GC6 A;  4C8N A;  4EX6 A;  3OUY B;  3WKE A;  1NZB A;  2AQ0 A;  3MDC A;  2FCL A;  1KLN A;  2LMR A;  2DPI A;  2QAR A;  4NM1 A;  2WAQ C;  5HMM A;  5KT4 A;  3SAF A;  3PX0 A;  8ICM A;  5KL8 B;  5DKW A;  4KLG A;  3AL0 B;  5F2V O;  5AKJ A;  4DSK A;  3NVY A;  1RZT A;  4X4N A;  4J9M A;  4RNO A;  5AKL A;  3ZD8 A;  9ICR A;  4X4T A;  1WWV A;  3SD7 A;  4HX0 A;  3FAH A;  2OXO A;  4PZN A;  4CF5 A;  5J0P A;  4OJO A;  3AMZ A;  4RWN A;  2AGP A;  5DB8 A;  2ALZ A;  2A1J B;  3K75 D;  2G08 A;  2KJ5 A;  2NRX A;  2ZH2 A;  2VJ5 A;  4F2S A;  3K4G A;  3ERC C;  3LWL A;  2M2V A;  2DQN B;  9ICH A;  2CN1 A;  3RTV A;  5AM2 A;  1ZQE A;  7ICM A;  2W3S A;  4WQK A;  5J2D A;  5III A;  3RB0 A;  2DR7 A;  4WC0 A;  1PVP A;  2KZ3 A;  4OCZ A;  3WFR E;  5AKE A;  4B9L A;  2KSO B;  3V7K A;  2BQ3 A;  1RG6 A;  2D3D A;  5J0Y A;  3ORY A;  2W9B A;  3EUB 2;  3TAP A;  2JEI A;  3ER9 B;  5KT5 A;  1X42 A;  5J0R A;  1COK A;  1HUO A;  3C29 A;  2DRB A;  4KLD A;  5JU5 A;  3F5A A;  2EWR A;  4LEY A;  1O08 A;  3HX0 A;  1ZQA A;  3WK6 A;  4USA A;  8ICG A;  4QZI A;  4YR2 A;  3PW5 A;  2UVR A;  4NXT A;  2DUY A;  5DBC A;  4YXJ A;  1D9D A;  4DQI A;  2EAN A;  4I2D A;  4RU9 A;  1NNL A;  1TAM A;  2WF7 A;  1S5L U;  1IG6 A;  1ARO P;  5L1I A;  2ATL A;  1ZQQ A;  4QWE A;  4KLI A;  1S8O A;  2W3R A;  3SV4 A;  1NOM A;  1PX5 A;  2WF6 A;  3B9J A;  1SV0 A;  3JPO A;  3IHQ B;  1IXR A;  2PMZ C;  2ZH5 A;  5EOZ A;  3N28 A;  1HUZ A;  3H8S A;  2ZUD A;  5AKX A;  1ZOL A;  7ICE A;  5HRB A;  4K4I A;  5D63 A;  3L9D A;  5DG8 A;  4UW9 A;  5J0S A;  4M04 A;  4F91 B;  4AT8 B;  5AI9 A;  4R8U A;  1L7N A;  1UHU A;  1UA0 A;  2XY7 A;  5ALQ A;  4O3N A;  5KFD A;  1ZXI A;  1ZQO A;  4GC7 A;  3PV8 A;  4K98 A;  2ES6 A;  3T79 A;  4M47 A;  3MBY A;  4F4W A;  9ICV A;  2QB0 B;  2HSZ A;  5HRG A;  2MAX A;  1NK6 A;  9ICQ A;  3QX7 A;  4FHX A;  5HR7 A;  1BPY A;  5AI8 A;  2AXT U;  3QU9 A;  1JXE A;  3QEA Z;  3PHZ A;  2BCV A;  3Q8L A;  5KFZ A;  3PR4 A;  2GLE A;  1S0N A;  5KFB A;  5HRL A;  3NYB A;  5KG1 A;  1L7O A;  4Q44 A;  4AT7 B;  2QLT A;  1KQQ A;  1ZET A;  3N7S C;  5KFE A;  2JR5 A;  2DBY A;  1UT8 A;  3Q8S B;  1JRO A;  3OWG A;  4NXW A;  2B51 A;  4IQU A;  2KZM A;  3PW4 A;  4C8M A;  3C2K A;  5H2F U;  1SL2 A;  5HC9 A;  1ZJN A;  4ICA A;  2YQE A;  5F3X B;  1D9F A;  5KL1 B;  4R8U B;  5J2I A;  9ICF A;  2EQY A;  4J9Q A;  5J0U A;  3HJ1 A;  3MR3 A;  2KMD A;  5KFV A;  2M2T A;  2LM1 A;  2G0A A;  3QUB A;  4FZM A;  1TVA A;  3T5K A;  1KFS A;  4JLX A;  4XA5 A;  5J2H A;  4WC4 A;  1FEZ A;  4WC1 A;  5KT2 A;  1ZYQ A;  2NO5 A;  1D8B A;  5J29 A;  4NLK A;  1U9L A;  4RQ3 A;  1TK8 A;  3HP6 A;  4RQM A;  3M9N B;  1ZD2 P;  5DEC A;  4QWA A;  1X9M A;  4DQR A;  3CK6 A;  3GV5 B;  3NRW A;  2RRD A;  2ZJA A;  3C18 A;  1L8L A;  3K1Z A;  2E8M A;  2B4V A;  4K9B A;  1NJX A;  2AJQ A;  1ZQT A;  2ZIW A;  5ALW A;  4GFJ A;  2F44 A;  1DGS A;  1JIH A;  2KOB A;  3LDA A;  2KEY A;  2G5I B;  2RLT A;  2F1I A;  1CEZ A;  4ELU A;  4KLH A;  2B6G A;  1RM6 C;  4GXK A;  3V7L A;  5C5J A;  4K8V A;  3RFA A;  2H3Q A;  2HBL A;  1LV5 A;  3IV6 A;  2W7P A;  5ALR A;  7ICJ A;  4IQT A;  2BCR A;  2J6S A;  5CRX A;  4FHV A;  2YX8 A;  2CPR A;  3U26 A;  4TUQ A;  2W7O A;  4F2R A;  4EX7 A;  3OVA A;  3IDW A;  1QQ5 A;  4QZG A;  1UCV A;  2NRK A;  4R66 A;  4O0I A;  4UAW A;  3RBD A;  3WK9 A;  2GOL A;  1KNY A;  1ZQC A;  2JH7 A;  9ICK A;  3H0L B;  1ZQD A;  3EWA A;  1ZQK A;  4DSJ A;  5AKI A;  1TKD A;  8ICB A;  3PVX A;  2NO4 A;  4M9N A;  2OM6 A;  1UT5 A;  1XU4 A;  4O6A A;  2H3F A;  4FH5 A;  5IIL A;  1XC9 A;  1SZH A;  2B56 A;  2Y9T A;  4FHP A;  7ICR A;  3WKA A;  1JN3 A;  4X0A A;  3C28 A;  4F5Q A;  1TV9 A;  3BZK A;  4UAZ A;  3VC8 A;  4KTQ A;  1F5A A;  4M9H A;  4PGY A;  4UB8 U;  2EZY A;  3WKD A;  4NXZ A;  1ZQZ A;  1X6J A;  4F4Y A;  3TKA A;  2F1J A;  1V38 A;  2BR0 A;  2DKZ A;  2R8H A;  4DQS A;  1N62 A;  3QE9 Y;  2ZUC A;  4CNQ A;  3OHB A;  2IHO A;  3SQI A;  2ZUB A;  4NV0 A;  2AH5 A;  5ALU A;  1URJ A;  2XID A;  2ZH8 A;  4YXM A;  1Q3U A;  9ICT A;  4P4P A;  2BBJ A;  4M9J A;  1SWV A;  4EBJ A;  5ALF A;  5AM3 A;  1YZ7 A;  4YR3 A;  3GV7 B;  4F4Z A;  5DBB A;  1VJ7 A;  1A76 A;  2G09 A;  3OJS A;  3F2D A;  2F2A B;  2KIV A;  4TQS A;  2RP5 A;  4ECZ A;  1KW4 A;  3M1Y A;  4OD0 A;  5J8Y C;  5DG9 A;  3TAQ A;  3BQ2 A;  1V85 A;  2HHQ A;  1X40 A;  3JPN A;  1GPJ A;  7ICQ A;  2LHT A;  2DVI A;  4BWJ A;  4UB2 A;  5KFN A;  4KLF A;  4X4P A;  4F72 A;  4BGD A;  3QU4 A;  8ICN A;  4Q45 A;  3QUQ A;  3ONN A;  1CUK A;  2K4P A;  4UB3 A;  8ICH A;  4O3M A;  2VA8 A;  4XJE A;  3SZ2 A;  5IIJ A;  1P7D A;  2HBJ A;  4DS5 A;  2LKY A;  4DLE A;  2ZIV B;  4J9N A;  4F71 A;  4JWN A;  1SL0 A;  1Z3E B;  2ISO A;  1IIP A;  5KT6 A;  2ZH3 A;  5BPC A;  1FO4 A;  4O5C A;  3WK7 A;  3BQT A;  4TUS A;  4XQ8 A;  4I2G A;  4CDG A;  4NY8 A;  4Y2U A;  2R8G A;  5J2E A;  3LK9 A;  4NKT A;  3FDS A;  3H0M B;  5ALE A;  1MQ3 A;  4NWI A;  3HJ4 A;  2HN2 A;  5KFT A;  1L3V A;  2KVC A;  4I2A A;  9ICE A;  5KFJ A;  3ISB A;  4DSL A;  1ZD5 A;  2ZIU A;  1KFT A;  2HHS A;  4QZ9 A;  4F8R A;  1R8C A;  1Y88 A;  2ZIX B;  5BOM A;  1KKX A;  2KIC A;  2ZTE A;  3GIJ A;  1J97 A;  3AEV A;  5D46 A;  4I29 A;  3B0X A;  2H3Z A;  5AK3 A;  1S0M A;  2VA2 A;  2WFA A;  4AT7 A;  1S0O A;  2PBE A;  5B3Q A;  2E3T A;  8ICQ A;  1U4B A;  3NVO A;  2JZB A;  3MR5 A;  4WC2 A;  4QWD A;  1N5X A;  3ZDE A;  4R65 A;  5HNK A;  3KD3 A;  4ZH4 A;  4I27 A;  5B3P A;  5HRK A;  2HHV A;  4C4R A;  1QQ7 A;  1U48 A;  1JXL A;  3Q8P B;  3T5J A;  4YD2 A;  2K8A A;  1BNO A;  2AU0 A;  2BBH A;  4M5D A;  4DSE A;  3FC4 A;  4UB6 U;  3NS1 A;  4RPZ A;  1KN5 A;  3QUC A;  3QU7 A;  1LB2 B;  2W9M A;  3RH5 A;  1TFR A;  4NLG A;  1BVS A;  3ZDC A;  3M6K A;  2BQU A;  2A1J A;  2DGZ A;  1J2N A;  1F5S A;  2F1H A;  2ZJ5 A;  3HW8 A;  4LZG A;  5FP0 A;  4EYI B;  4F3O A;  3T5H A;  1H38 A;  5DG7 A;  1K1Q A;  4DOB A;  1S77 D;  3AU2 A;  8ICC A;  2KG5 A;  3MGI A;  2GAF D;  3NGD A;  4Y2X A;  2KJ9 A;  2F8K A;  2L5Y A;  5ALH A;  4DWI A;  2MSN A;  2GH1 A;  2ZIX A;  4NLB A;  5AKG A;  4I28 A;  3KFU F;  2I6X A;  8ICT A;  3MFI A;  3TAR A;  3PW7 A;  3MR6 A;  2HDO A;  5J2G A;  3SYZ A;  4RQ2 A;  2G5H B;  2KFN A;  5EE1 A;  1MN8 A;  3M9O B;  5CHE A;  3N97 B;  1OXJ A;  4R63 A;  2P66 A;  3QU2 A;  1R8B A;  5L1K A;  5KFS A;  3KTQ A;  3H0R B;  3RB3 A;  3UMG A;  3SR6 A;  3T3F A;  1SXE A;  2KKV A;  3N7P D;  5KFU A;  1EXN A;  4EBC A;  4HAI A;  3TAN A;  3PZP A;  1PK1 B;  4QW8 A;  5TIS U;  4B9V A;  3HRD D;  3BJY A;  3ZD9 A;  3FM9 A;  7ICT A;  5AI4 A;  3OSP A;  2DFL A;  2OCE A;  1J2M A;  2A19 A;  4KX5 A;  3EPG A;  3OTQ A;  1MSW D;  4QZB A;  2C2D A;  5AI6 A;  3KHL A;  5JUM A;  2BCU A;  3Q8Q B;  9ICL A;  4CGZ A;  5D62 A;  5L9X A;  4AT8 A;  3NVZ A;  4DFP A;  4MHV A;  4Y2Q A;  8ICR A;  2PMZ F;  1ZJM A;  2VKQ A;  5KFY A;  4BDP A;  1SKS A;  5CA7 A;  3H38 A;  3V6K A;  1ZQS A;  2BDU A;  4I2I A;  5AIC A;  5KFX A;  4F4X A;  2AHO B;  4G9B A;  2P6R A;  4EEL A;  7ICN A;  4O3Q A;  4KLS A;  4Z6E A;  2JRZ A;  1CRX A;  3RAX A;  8ICW A;  2BGW A;  4RNN A;  5KAI U;  3NTU A;  1TAU A;  4ED8 A;  1Z1B A;  1F44 A;  5CFU A;  2B0C A;  1T3N A;  3QXG A;  5BOL A;  4Y2Y A;  2YMP A;  3H7I A;  7ICV A;  4YR0 A;  3WFQ E;  3PX4 A;  4PH5 A;  2OH2 A;  3MAB A;  1V9P A;  4KLQ A;  3ZDA A;  4O67 A;  4QNL A;  5JTG A;  1NK9 A;  5L1J A;  4IL6 U;  4R64 A;  1X9X A;  2ZIV A;  2PFP A;  2CXY A;  1SGG A;  4QIW C;  5HRD A;  1VLB A;  1U49 A;  4EP7 A;  4NXU A;  2BHN A;  4F5N A;  5EWG A;  1ZQN A;  4M9L A;  4FHW A;  5AM5 A;  1ZQU A;  4QIW F;  4IQV A;  4FS1 A;  4XUS A;  2A3V A;  4KLJ A;  2BZF A;  1ZD3 A;  3DV9 A;  4ECV A;  3H8J A;  4KIT B;  4UAV A;  4S3N A;  4UAU A;  1L3U A;  4B9S A;  3GFK B;  4OAF A;  4B9T A;  4F92 B;  2HHW A;  1QH9 A;  2W9B B;  4IR9 A;  4O9M A;  5L1M A;  2PI4 A;  4K97 A;  4X4O A;  4EZ6 A;  2K4E A;  4CCH A;  3V7J A;  1NO5 A;  3OVS A;  3UQ2 A;  4RQ7 A;  9ICI A;  2ESE A;  3OHA A;  2O5A A;  2HOQ A;  2W55 A;  4TQR A;  5D49 A;  4P0P B;  4P4O A;  1WCL A;  4AYB F;  2XY5 A;  2ZIW B;  3I76 A;  4X4U A;  1PVR A;  1NZP A;  4NJ8 A;  1SKR A;  1B0X A;  1WCN A;  4PJ0 U;  4P2H A;  2LYA A;  2KIW A;  5A0L A;  2FLP A;  2BE3 A;  4ACO A;  1ZQ1 C;  4KX3 A;  5D61 A;  3Q8M A;  3ED5 A;  3PML A;  1RDF A;  4OO1 J;  5HHI A;  4RT2 A;  3ETR A;  2ASL A;  2KK0 A;  2YML A;  4QZA A;  8ICP A;  4RQ0 A;  1Z00 A;  4A8E A;  1SV0 C;  5AI5 A;  4ED7 A;  4PHE A;  1QLN A;  5F9L A;  4EV6 A;  2XI9 A;  2FE9 A;  1X6I A;  4X4Q A;  2ID1 A;  3TQ1 A;  2IBK A;  5HR9 A;  1N5W A;  5J2A A;  1RYU A;  5KG4 A;  3IM1 A;  3C2L A;  3ISD A;  1DRG A;  1A77 A;  4KLU A;  3WU2 U;  3UXP A;  7ICU A;  3H37 A;  3J81 j;  1K5O A;  4EBK A;  3ZI4 A;  4US9 A;  1TFW A;  2HHU A;  3JPT A;  1S97 A;  4HYK A;  3JPS A;  2ZH7 A;  2DL0 A;  4TUP A;  3NVV A;  4DOC A;  4UAS A;  1LKY B;  4ATB B;  4ECU A;  3BQ7 A;  1HJP A;  5ALL A;  1SV4 A;  2MUT A;  5CFS A;  5DDM A;  3KKA A;  5AK5 A;  4RUC A;  4NLC A;  2W8K A;  4FZN A;  4B9M A;  2FMQ A;  1PK1 A;  2KV2 A;  1ZQI A;  3HIL A;  3KKA C;  3AQN A;  2YB1 A;  3M8S A;  3F5E A;  4EEK A;  2FDR A;  1WUD A;  2F8L A;  1RXV A;  2W04 A;  4RUA A;  4PL1 A;  2RHF A;  1V97 A;  4J9O A;  3MDA A;  1A6S A;  2M2W A;  3L4P A;  1SXD A;  1S10 A;  2K8C B;  3PW0 A;  5EE9 A;  4YMO A;  4Y2S A;  5ALJ A;  2HHT A;  4KM5 A;  1Z00 B;  5B5E U;  2GWS A;  2QB1 A;  3H39 A;  3GII A;  1QSS A;  3EYZ A;  9ICU A;  2ZIU B;  2JV3 A;  2ASD A;  3K1R B;  3HT3 A;  1UQV A;  3RH4 A;  2HOF A;  2LI6 A;  5IIO A;  1ED1 A;  1L5U A;  2KSO A;  1YT3 A;  4FBT A;  2N1R A;  4JWM A;  4FS2 A;  3THV A;  8ICV A;  2H5X A;  5ALV A;  3KHH A;  5G5H A;  2HMX A;  2DPJ A;  8ICA A;  4QW9 A;  2MRL A;  3CRX A;  3R9K A;  4OJP A;  1CI4 A;  5ALY A;  3UM9 A;  4YQW A;  3L3F X;  3D2Q A;  3GZF A;  5KFF A;  1JI7 A;  3M6Z A;  5AM1 A;  4DL4 A;  4AYB C;  4CF4 A;  2YN4 A;  4O5K A;  2BKE A;  4ATB A;  4RWP A;  3DDH A;  2EZX A;  3QZ7 A;  3WKB A;  5KAF U;  2Y0S F;  3SAG A;  3TAC B;  1KBU A;  8ICZ A;  4YFK A;  1MIV A;  3H4B A;  3BQ1 A;  1KTQ A;  7ICS A;  9ICX A;  1L7M A;  5KFA A;  2K8B B;  4LJX A;  5KFP A;  5D4B A;  5KFQ A;  4ECQ A;  4C7Z A;  3AN1 A;  2NYV A;  5DLF A;  2ZHB A;  1M6Y A;  5ALN A;  4DSI A;  8ICY A;  2WF9 A;  2ZH4 A;  4PHA A;  3GDX A;  5AK6 A;  2KJ8 A;  4RQN A;  3WK5 A;  3GIL A;  1KFD A;  4ED0 A;  2ZH1 A;  4OJ6 A;  1X9S A;  4ECW A;  4UD5 A;  4O68 A;  1RYS A;  4J9S A;  1L3T A;  2KD1 A;  4IC9 A;  1S9F A;  3M8R A;  5KFM A;  4RPX A;  1OUQ A;  3SEI A;  4PHP A;  2HOI A;  2HW3 A;  4FO1 A;  1NK7 A;  3PST A;  4O3S A;  3ZDB A;  3HPO A;  4GXJ A;  4RQ8 A;  4XRH A;  1AQ6 A;  3HKZ C;  2XC9 A;  2ZTC A;  5CFT A;  4YCX A;  1XO1 A;  4MFC A;  2W8L A;  4I2B A;  2FI1 A;  3OVB A;  3RB6 A;  1XNS A;  2NRZ A;  1MA7 A;  2KE7 A;  4CRX A;  2EH9 A;  3MC1 A;  2HN1 A;  2KTQ A;  2J6U A;  5DGB A;  1SL1 A;  4KMO B;  2YMQ A;  4G3I A;  5AIB A;  4KB6 A;  1UEU A;  9ICP A;  5EWE A;  4WQL A;  3UPS A;  2V4Q A;  3UQ0 A;  1L3S A;  5ALT A;  2XCP A;  2FMP A;  1L8O A;  3PMN A;  3N4M B;  5DED A;  3C2M A;  3NKU A;  3MR2 A;  1NK0 A;  2FPL A;  2IHM A;  4AT9 A;  2H3V A;  1O03 A;  3WFS C;  5CB1 A;  4IG8 A;  3WK8 A;  5KG6 A;  3TFR A;  3E2E A;  1T94 A;  3RR7 A;  1MQ2 A;  1PVQ A;  1Q3V A;  3JPR A;  5ALS A;  3KBB A;  5CJ7 A;  2DR5 A;  4JMU A;  4F5P A;  1IV8 A;  1IM4 A;  1ZRM A;  5GTI U;  3G6X A;  4MF2 A;  3HWT A;  4I2H A;  2LM4 A;  2XY6 A;  4P0Q A;  2EDU A;  4YG2 A;  4M6W B;  5KFI A;  4NLZ A;  4O3R A;  4DL5 A;  1Q46 A;  2WHE A;  1DXS A;  1NJW A;  2DRA A;  3BS5 A;  2HVI A;  3PO5 A;  1DGJ A;  2M0N A;  4ELT A;  5B66 U;  1SKW A;  4M0A A;  1LVH A;  5DQG A;  1ZQJ A;  4GLX A;  5CWR A;  2RDJ A;  1FIQ A;  1TAQ A;  3ETL A;  5J2C A;  2MA1 A;  1XSN A;  5AHX A;  3RJE A;  1ZD4 A;  3B0Y A;  4WH5 A;  1V4A A;  4Z6C A;  2NV3 A;  3Q8K A;  2BPG A;  2Z7J A;  3TAD C;  3F53 A;  1SIJ A;  4OAH A;  3F2C A;  4LVS A;  3H8W A;  4C80 A;  5DB7 A;  2C22 A;  1T4G A;  8ICE A;  2HBM A;  5IIM A;  4F50 A;  4Y2J A;  2FLL A;  4QZF A;  4NXV A;  4GIB A;  3EPI A;  4CF3 A;  3D6J A;  5EWF A;  4C8L A;  3NUQ A;  3OPX A;  4Z6D A;  3UMB A;  2K89 A;  3MFH A;  3OV7 A;  2VAN A;  5J2K A;  5J2F A;  2XO7 A;  3UPQ A;  2LYB A;  4DF4 A;  3G6V A;  2W9C B;  2Q0Z X;  4OJL A;  1RXW A;  3LWM A;  5J2J A;  3DEE A;  4J9L A;  1BPB A;  2MU2 A;  2HBK A;  3IG5 A;  4C0Z A;  1C7Y A;  2W54 A;  1Q8K A;  4C7Y A;  2H3I A;  8ICI A;  4DFJ A;  3C1Z A;  5J0Q A;  4EEB A;  1L6N A;  1JAL A;  3BS5 B;  4F93 B;  4I2C A;  3JYY A;  1RQL A;  2F3N A;  1K1S A;  2R8J A;  2JXJ A;  1MC8 A;  4NXX A;  2GO7 A;  4B6J A;  4DF8 A;  2ASJ A;  1KDH A;  3RH6 A;  1B43 A;  2XCA A;  2KZZ A;  3QZ8 A;  1TK5 A;  4FBU A;  3VCB A;  1QSL A;  2PFN A;  1GO3 F;  2ODG A;  3G6Y A;  4ED3 A;  4J9K A;  4X4R A;  5KNI A;  2E8O A;  9ICB A;  2IOF K;  3T5L A;  4RNM A;  7ICL A;  4QZD A;  4B9U A;  4B9N A;  4DFM A;  3GU3 A;  4I2E A;  8ICO A;  2I5H A;  1XSL A;  4DL7 A;  1JX4 A;  3H8M A;  2NRW A;  1JAJ A;  5HHH A;  5ALM A;  5KFG A;  4EED A;  2Q66 A;  2Y1J A;  5AKK A;  2VA3 A;  4NKU A;  1QCK A;  1B4F A;  2O6K A;  5J8Y A;  3RRH A;  2KHQ A;  2AQ4 A;  1ZQP A;  3V6H A;  4M9G A;  4Q8E A;  4KLO A;  2ZXI A;  4ECT A;  3PX6 A;  2K60 A;  4DSF A;  2FMS A;  4IS7 A;  4QZ8 A;  4DFK A;  2OYY A;  2BPF A;  4N7R A;  5KT3 A;  3BDP A;  2IOF A;  2ZH6 A;  1ZQX A;  3ER8 C;  1Z1V A;  1TFY A;  2F76 X;  4C4T A;  5J0T A;  3RJI A;  4WCW A;  5HR6 A;  4LEZ A;  4JK1 A;  3C1Y A;  1SWW A;  3AQL A;  3OSN A;  4ECX A;  4RQ6 A;  3LQC B;  4MKP A;  3GV8 B;  5K4L A;  3MGH A;  3V6J A;  2V4R A;  3E0F A;  4FZL A;  1Q78 A;  4PZO A;  2HHP A;  2KVS A;  1N61 A;  2YB4 A;  1NK4 A;  3RB4 A;  3I28 A;  4Y2R A;  2KHV A;  2MUT B;  1N63 A;  4QZH A;  4NM2 A;  1RYR A;  5C0Y A;  1MIW A;  3C66 A;  3M7D A;  5CR0 A;  5JRT A;  1PK3 A;  3SI8 A;  2RFF A;  4C8O A;  4Q43 A;  1X9W A;  4DL3 A;  3QUT A;  1ZQM A;  1BPZ A;  4PGX A;  8ICF A;  1JUD A;  1Q79 A;  4DO9 A;  4FHY A;  2DF4 B;  2W11 A;  3EF2 A;  1X66 A;  5KFL A;  2EAO A;  2UVU A;  4J03 A;  4YMN A;  1QQ6 A;  2IA6 A;  4Q8F A;  2PI5 A;  4EEN A;  3AUO A;  2FPK A;  4NL9 A;  3FYH A;  4DFD A;  4J9R A;  2JGA A;  2HHX A;  4ELV A;  4QZE A;  4LEW A;  5AM0 A;  1VDV A;  5T14 A;  4UB4 A;  1OU5 A;  3E58 A;  4OAG A;  2P35 A;  5ALX A;  4F5O A;  3HIY A;  3ALR A;  2BQR A;  2OHF A;  4PGQ A;  9ICC A;  4UB1 A;  5KFO A;  2QB0 A;  4BJQ A;  4IRK A;  2ZH9 A;  2RQ5 A;  3AQK A;  5KFK A;  4ECR A;  1BPE A;  2LYH A;  4C4S A;  1T7P A;  1L7P A;  3QNM A;  4MFA A;  3KHG A;  4Y2T A;  1UA1 A;  5ALD A;  2VJ4 A;  8ICK A;  4BX9 C;  5DLG A;  2PFO A;  2FJ6 A;  1A0P A;  2WAQ F;  1FFU A;  1NI3 A;  4KLT A;  1C20 A;  2JEF A;  4X4V A;  5KFR A;  3NVW A;  3RJJ A;  3AQM A;  4WJ3 B;  4LT6 A;  1ECW A;  3PW2 A;  4KN7 A;  5AKY A;  3WKC A;  3M9M B;  1S0V A;  3EZ5 A;  2WF8 A;  2JHD A;  4WC6 A;  1Z4N A;  2NRT A;  5KG7 A;  3UXN A;  3UXO A;  1QSY A;  4MEY A;  4IQW A;  4UB5 A;  3D2N A;  3AQF A;  1R89 A;  1YLQ A;  1DK2 A;  3S6J A;  3PO4 A;  1ZQW A;  1FA0 A;  5F9N A;  5KT7 A;  4AP9 A;  2WF5 A;  3JPQ A;  4ECS A;  3CP8 A;  4DS4 A;  4U6P A;  4Z6F A;  1QTM A;  4US8 A;  4J9P A;  4JLZ A;  2IMW P;  4DOA A;  1SB3 C;  4OJ5 A;  4BUG A;  3CYM A;  3AU6 A;  2KP7 A;  3H3A A;  2E1E A;  3JCF A;  5J0O A;  8ICL A;  7ICF A;  3ZDD A;  1D8Y A;  2BCS A;  2HI0 A;  3KZX A;  5J2B A;  1DOQ A;  3H4D A;  3RJH A;  1UET A;  4GXI A;  4DQP A;  2E8P A;  1JRP A;  2YMM A;  3NAS A;  4I0U A;  1XS9 D;  5DGA A;  4X5V A;  4JV1 A;  1PUZ A;  1MIY A;  4EZ9 A;  2YY6 A;  3A0B U;  1WOT A;  5KFH A;  2FLN A;  1COO A;  5AM4 A;  1DK3 A;  2LBO A;  4ECY A;  3GQC A;  2JZB B;  4K9A A;  2I1Q A;  1ZQV A;  5E79 U;  5KFW A;  1NJZ A;  1LKY A;  3C5F A;  5TZV A;  5DBA A;  3EW9 A;  1HEK A;  4EGW A;  1ZQR A;  2Q4T A;  2W03 A;  3PNC A;  4WBY A;  5DB6 A;  4WC3 A;  2E1F A;  4M6W A;  5HRH A;  3RAQ A;  3IP4 B;  4RWO A;  5DB9 A;  2EAM A;  2CRX A;  4E7X A;  1U47 A;  4K99 A;  1F0M A;  1WG8 A;  4EBD A;  4KLL A;  1JQR A;  4YN4 A;  4JB3 A;  3AQE A;  3GIM A;  3JZ0 A;  1ZQF A;  4QZC A;  2IUB A;  3BZC A;  9ICG A;  1JMS A;  2W9A A;  4FH3 A;  4BXO A;  4WC7 A;  4EEY A;  3BS7 A;  4EBE A;  1ZQY A;  3RJG A;  4UBB A;  2ZJ8 A;  4E80 A;  8ICS A;  1S76 D;  2ZHA A;  4WOY A;  4C8K A;  5ALK A;  2JH1 A;  1D8L A;  3NRZ A;  4U7C A;  2XVT A;  4PHD A;  4X4S A;  3RR8 A;  2XGQ A;  2IOH A;  2E5S A;  3MGV A;  4PL2 A;  1N2X A;  4P0P A;  5IIK A;  2DWQ A;  2PXI A;  2Y9U A;  5HP4 A;  9ICA A;  4WC5 A;  3QU5 A;  3F2B A;  3LYS A;  3PR5 B;  4OAI Z;  1ZQL A;  2KNJ A;  3RJK A;  4YMM A;  5CHG A;  3N7R C;  2G06 A;  2D8C A;  5GTH U;  1FFV A;  3UMC A;  3IG8 A;  3PSP A;  1RQN A;  5L1L A;  2JMG A;  1ZQG A;  7ICK A;  2OEH A;  4IRD A;  2W9C A;  2VIX A;  4RQ4 A;  2W43 A;  3WFP A;  3AM9 A;  3PSI A;  4K4G A;  1Z4O A;  2WTF A;  2AGQ A;  4QWC A;  2UVW A;  1T8E A;  5J0W A;  1KRP A;  4WBZ A;  3OGU A;  3H40 A;  1WWU A;  4NLN A;  2GA9 D;  1UEV A;  4JUZ A;  4UAT A;  8ICJ A;  5CEH A;  2KKP A;  1XWL A;  1Z19 A;  8ICX A;  3PY8 A;  3HKZ F;  4JV0 A;  2IHN A;  2D6F C;  3RF9 A;  4YVZ A;  4E8F A;  3TFS A;  4DQQ A;  4UAY A;  4ZOH C;  2EAP A;  4FE3 A;  2Y1I A;  3RJF A;  9ICM A;  1N56 A;  2FPM A;  4IR1 A;  1NK5 A;  1ZRN A;  1HIW A;  1VJ5 A;  1NKB A;  2R18 A;  2B21 A;  4O69 A;  2AGO A;  3RBE A;  1UPH A;  2G07 A;  5AKZ A;  3CNH A;  2PKE A;  3TAD A;  2C2E A;  2XIC A;  3NWI A;  3KZI U;  5ALG A;  1VFG A;  4YP3 A;  2JEG A;  4I2F A;  3I1Y A;  4IRC A;  4K4H A;  2ISP A;  3RRG A;  7ICG A;  1YZ6 A;  3BQ0 A;  3IRU A;  4RZR A;  4Y2P A;  7ICO A;  4XQ7 A;  2Y0S C;  2HCF A;  2ZTD A;  3CW2 C;  3JPP A;  1N60 A;  2RDI A;  3O0F A;  1BPD A;  4F5R A;  2ZG6 A;  5HRF A;  4EYH B;  7ICH A;  4I2J A;  2NRV A;  4LZD A;  4DL6 A;  4JV2 A;  3WK4 A;  1XSP A;  2R8K A;  1PZN A;  1ZQB A;  2DKX A;  2F77 X;  2KFZ A;  9ICO A;  9ICS A;  4UQG A;  2QKQ A;  3OJU A;  1B22 A;  1NKC A;  3KOO A;  4RQ5 A;  2J6T A;  5KG3 A;  2C28 A;  3ICX A;  3QYP A;  3C5G A;  1BNP A;  5JTI A;  1WYG A;  4P4M A;  2BDP A;  4P0Q B;  4E0D A;  3MCR A;  1RPL A;  4QWB A;  4MF8 A;  2UVV A;  1TE2 A;  3ISC A;  2BPC A;  3PSF A;  4O5E A;  4FFD A;  1BGX T;  3SV3 A;  5AKH A;  3Q8R B;  1NJY A;  2PFQ A;  2QAR B;  5IIN A;  3C21 A;  2P6U A;  3C23 A;  3SEN A;  2M9N A;  1TK0 A;  5EE3 A;  3A0H U;  2A1A A;  8ICU A;  4RWQ A;  4RT3 A;  4UD4 A;  5EE0 A;  1NK8 A;  1X2I A;  4CE6 A;  3L5K A;  4TUR A;  2EZZ A;  4KLM A;  2K4H A;  4O3O A;  4UBC A;  1ZQH A;  2C2R A;  3SMV A;  4ED2 A;  4MFF A;  5ALZ A;  2E8N A;  2WB1 F;  3OUY A;  2DR9 A;  2JEJ A;  3SAH A;  5KG5 A;  5KTQ A;  4NL9 C;  3D2S A;  9ICJ A;  5HRI A;  2ZXH A;  3LVW A;  3TI0 A;  4DLG A;  3GIK A;  5G5G A;  2V9W A;  4F4K A; 
#chains in the Genus database with same CATH homology
 4YR3 A;  1ZQM A;  2MUT A;  2O1P A;  4X0B A;  3GV7 B;  4F4Z A;  1BPZ A;  5DDM A;  7ICP A;  4RUC A;  2HVH A;  5DBB A;  1VJ7 A;  4M2Y A;  1A76 A;  4PGX A;  3OJS A;  2W8K A;  8ICF A;  7ICI A;  1Q79 A;  4TQS A;  4DO9 A;  4FHY A;  4ECZ A;  4EBK A;  5HML A;  4B9M A;  5DG9 A;  1ZQI A;  4O3P A;  3TAQ A;  2FMQ A;  4KMU A;  5KFL A;  5DQI A;  3AQN A;  5DQH A;  3BQ2 A;  2HHQ A;  5KG0 A;  3JPN A;  1R8A A;  7ICQ A;  2UVU A;  9ICN A;  2DVI A;  4DEZ A;  4BWJ A;  3M8S A;  4RQ1 A;  4YMN A;  4UB2 A;  5KFN A;  4KLF A;  4X4P A;  1RXV A;  2IA6 A;  4Q8F A;  2PI5 A;  4BGD A;  1NKE A;  4YD1 A;  4RUA A;  4J9O A;  4Q45 A;  3AUO A;  8ICN A;  2FPK A;  3MDA A;  1SZP A;  2OWO A;  3FYH A;  4J9R A;  4BXO B;  1CUK A;  2HHX A;  4DL2 A;  2M2W A;  4RPY A;  4KN4 A;  4ED1 A;  1BPX A;  4ELV A;  4QZE A;  4UB3 A;  4MEX A;  1S10 A;  8ICH A;  2VA8 A;  3V72 A;  3SZ2 A;  5IIJ A;  3PW0 A;  2XGP A;  4YMO A;  5CP2 A;  5KG2 A;  5J0X A;  4DS5 A;  4DLE A;  5DDY A;  2HHT A;  4J9N A;  4JWN A;  4UB4 A;  3WFO A;  2DR9 A;  1SL0 A;  1Z00 B;  1Z3E B;  2ISO A;  4PPX A;  4BWM A;  5KT6 A;  1OU5 A;  2ZH3 A;  5BPC A;  1N48 A;  2GWS A;  3QEB Z;  4O5C A;  3H39 A;  2KN7 A;  3BQT A;  4F5O A;  4TUS A;  3HIY A;  3GII A;  4XQ8 A;  1QSS A;  2BCQ A;  3EYZ A;  4FO6 A;  2BQR A;  4PGQ A;  4I2G A;  9ICC A;  9ICU A;  4NY8 A;  4UB1 A;  3KHR A;  2ASD A;  2DR8 A;  2R8G A;  4KLE A;  5J2E A;  3LK9 A;  5KFO A;  3HT3 A;  1KEJ A;  2M2U A;  4NKT A;  3FDS A;  3RH4 A;  4IRK A;  5IIO A;  1MQ3 A;  2R8I A;  1U45 A;  1L5U A;  5KFC A;  5HRE A;  4FBT A;  2ZH9 A;  3HJ4 A;  5KFT A;  1L3V A;  4I2A A;  9ICE A;  3AQK A;  4JWM A;  5KFK A;  4FS2 A;  4ECR A;  3THV A;  1BPE A;  2LYH A;  8ICV A;  2H5X A;  5KFJ A;  3ISB A;  4DSL A;  1KFT A;  3KHH A;  1T7P A;  4QZ9 A;  2DPJ A;  1KSP A;  4F8R A;  2HHS A;  8ICA A;  1Y88 A;  4ED6 A;  9ICW A;  4QW9 A;  1R8C A;  4AT9 B;  2I9G A;  4GC6 A;  4C8N A;  5BOM A;  3OUY B;  4YQW A;  4MFA A;  3KHG A;  2ZTE A;  2AQ0 A;  5KFF A;  3MDC A;  3GIJ A;  1UA1 A;  5D46 A;  4I29 A;  8ICK A;  3B0X A;  4DL4 A;  1KLN A;  2DPI A;  5DLG A;  2PFO A;  4NM1 A;  5HMM A;  1S0M A;  2VA2 A;  5KT4 A;  4O5K A;  2BKE A;  4AT7 A;  4ATB A;  1S0O A;  3PX0 A;  8ICM A;  5DKW A;  4KLT A;  2PBE A;  4KLG A;  4RWP A;  5F2V O;  3QZ7 A;  8ICQ A;  2JEF A;  1U4B A;  1RZT A;  4DSK A;  8ICZ A;  1MIV A;  4X4V A;  4YFK A;  5KFR A;  4X4N A;  4J9M A;  2JZB A;  4RNO A;  3MR5 A;  3RJJ A;  3ZD8 A;  4WC2 A;  4QWD A;  9ICR A;  4X4T A;  3ZDE A;  3AQM A;  3H4B A;  3BQ1 A;  1KTQ A;  4R65 A;  7ICS A;  5HNK A;  3PW2 A;  4KN7 A;  9ICX A;  4LT6 A;  3M9M B;  4ZH4 A;  1S0V A;  3EZ5 A;  4WC6 A;  4I27 A;  5J0P A;  5HRK A;  2HHV A;  5KFA A;  1U48 A;  1JXL A;  2NRT A;  3Q8P B;  3T5J A;  5KG7 A;  3UXN A;  5KFP A;  3UXO A;  5KFQ A;  4ECQ A;  4YD2 A;  5D4B A;  4RWN A;  2AGP A;  5DB8 A;  2ALZ A;  4MEY A;  2AU0 A;  1QSY A;  5DLF A;  4IQW A;  1BNO A;  2ZHB A;  4UB5 A;  4M5D A;  4DSI A;  4DSE A;  3K75 D;  2A1J B;  8ICY A;  1R89 A;  2ZH4 A;  1YLQ A;  1DK2 A;  2NRX A;  4PHA A;  3GDX A;  3PO4 A;  1ZQW A;  1FA0 A;  2ZH2 A;  5F9N A;  4F2S A;  5KT7 A;  3GIL A;  3K4G A;  4RPZ A;  3LWL A;  1KFD A;  4ED0 A;  2M2V A;  3JZ0 A;  3JPQ A;  4ECS A;  9ICH A;  2ZH1 A;  1LB2 B;  3RTV A;  1X9S A;  2W9M A;  4DS4 A;  4ECW A;  4UD5 A;  3RH5 A;  1TFR A;  1ZQE A;  1BVS A;  4Z6F A;  1RYS A;  2BQU A;  4J9S A;  1QTM A;  3ZDC A;  1L3T A;  4NLG A;  7ICM A;  2A1J A;  1S9F A;  5J2D A;  3M8R A;  4J9P A;  5III A;  3RB0 A;  2IMW P;  2F1H A;  2ZJ5 A;  5KFM A;  4RPX A;  3HW8 A;  4DOA A;  4LZG A;  2DR7 A;  3WFR E;  4EYI B;  4WC0 A;  4F3O A;  3T5H A;  4PHP A;  1H38 A;  3AU6 A;  2HW3 A;  1NK7 A;  2KP7 A;  3H3A A;  4O3S A;  2KZ3 A;  5J0O A;  3ZDB A;  3HPO A;  5DG7 A;  4GXJ A;  7ICF A;  1K1Q A;  4RQ8 A;  4DOB A;  1D8Y A;  3ZDD A;  4B9L A;  3AU2 A;  2BCS A;  1S77 D;  8ICC A;  4XRH A;  3V7K A;  2BQ3 A;  3MGI A;  2XC9 A;  2ZTC A;  5J0Y A;  3ORY A;  3NGD A;  4YCX A;  1XO1 A;  5J2B A;  2W9B A;  4MFC A;  1DOQ A;  3H4D A;  2W8L A;  3RJH A;  1UET A;  4GXI A;  3TAP A;  2JEI A;  4I2B A;  4DQP A;  3OVB A;  3RB6 A;  4DWI A;  5KT5 A;  2NRZ A;  5J0R A;  1HUO A;  4I28 A;  1XS9 D;  8ICT A;  5DGA A;  4X5V A;  4JV1 A;  2KTQ A;  2J6U A;  3MFI A;  2DRB A;  1MIY A;  4KLD A;  3TAR A;  3PW7 A;  4EZ9 A;  3MR6 A;  1WOT A;  5DGB A;  5J2G A;  5KFH A;  3SYZ A;  1SL1 A;  4RQ2 A;  2FLN A;  1COO A;  4G3I A;  2KFN A;  3M9O B;  1UEU A;  3N97 B;  3HX0 A;  9ICP A;  4R63 A;  1ZQA A;  1DK3 A;  5EWE A;  2P66 A;  3UPS A;  2V4Q A;  3UQ0 A;  8ICG A;  1R8B A;  4YR2 A;  4QZI A;  3GQC A;  4ECY A;  3PW5 A;  2XCP A;  1L3S A;  2JZB B;  2FMP A;  5DBC A;  2I1Q A;  4YXJ A;  5L1K A;  5KFS A;  3PMN A;  3KTQ A;  3N4M B;  1ZQV A;  1D9D A;  5DED A;  3C2M A;  3RB3 A;  4DQI A;  4I2D A;  4RU9 A;  3T3F A;  5KFW A;  3MR2 A;  2FPL A;  1NJZ A;  1NK0 A;  2IHM A;  4AT9 A;  3C5F A;  5TZV A;  5DBA A;  3EW9 A;  5KFU A;  3WFS C;  1EXN A;  1ARO P;  5CB1 A;  5L1I A;  1ZQR A;  5KG6 A;  4EBC A;  4IG8 A;  2ATL A;  3PNC A;  3TFR A;  3E2E A;  1ZQQ A;  4WBY A;  5DB6 A;  4WC3 A;  4QWE A;  4KLI A;  3RR7 A;  1MQ2 A;  4M6W A;  3JPR A;  3SV4 A;  5HRH A;  1NOM A;  3RAQ A;  3TAN A;  1PX5 A;  5DB9 A;  4E7X A;  4QW8 A;  4RWO A;  5CJ7 A;  2DR5 A;  3JPO A;  4B9V A;  1U47 A;  3BJY A;  3ZD9 A;  3IHQ B;  4F5P A;  4EBD A;  1IXR A;  4KLL A;  1JQR A;  1IM4 A;  5EOZ A;  2ZH5 A;  3G6X A;  4YN4 A;  7ICT A;  3GIM A;  3H8S A;  2ZUD A;  1HUZ A;  3HWT A;  4QZC A;  3OSP A;  1ZQF A;  4I2H A;  4K4I A;  4MF2 A;  7ICE A;  5HRB A;  2DFL A;  2XY6 A;  9ICG A;  3L9D A;  4YG2 A;  5DG8 A;  1JMS A;  4M6W B;  2W9A A;  5KFI A;  4NLZ A;  4FH3 A;  3EPG A;  5J0S A;  4M04 A;  4F91 B;  4BXO A;  4O3R A;  4WC7 A;  1MSW D;  4DL5 A;  4EEY A;  4AT8 B;  4R8U A;  1UA0 A;  1NJW A;  4QZB A;  2C2D A;  4EBE A;  1ZQY A;  2XY7 A;  4UBB A;  2ZJ8 A;  3RJG A;  4E80 A;  2DRA A;  3KHL A;  5JUM A;  2HVI A;  4O3N A;  3PO5 A;  5KFD A;  8ICS A;  2BCU A;  1S76 D;  1ZQO A;  3Q8Q B;  4GC7 A;  2ZHA A;  9ICL A;  3PV8 A;  4ELT A;  4C8K A;  1SKW A;  4M0A A;  5DQG A;  1ZQJ A;  4GLX A;  4M47 A;  1D8L A;  5L9X A;  4AT8 A;  3MBY A;  5CWR A;  2RDJ A;  4DFP A;  1TAQ A;  3ETL A;  5J2C A;  4PHD A;  4X4S A;  1XSN A;  3RR8 A;  8ICR A;  2XGQ A;  3RJE A;  4F4W A;  9ICV A;  1ZJM A;  5KFY A;  3B0Y A;  4BDP A;  1SKS A;  1V4A A;  5HRG A;  2MAX A;  4Z6C A;  1NK6 A;  5CA7 A;  9ICQ A;  3Q8K A;  3V6K A;  2BPG A;  3H38 A;  4FHX A;  1ZQS A;  5IIK A;  4I2I A;  2PXI A;  5KFX A;  4LVS A;  4F4X A;  5HP4 A;  1BPY A;  9ICA A;  4WC5 A;  3H8W A;  3PR5 B;  5DB7 A;  2C22 A;  2P6R A;  1T4G A;  1ZQL A;  3RJK A;  4O3Q A;  7ICN A;  4YMM A;  1JXE A;  5CHG A;  4KLS A;  8ICE A;  4Z6E A;  3QEA Z;  5IIM A;  4F50 A;  2BCV A;  3RAX A;  8ICW A;  3Q8L A;  2BGW A;  5KFZ A;  4RNN A;  3PR4 A;  4QZF A;  2FLL A;  3NTU A;  1TAU A;  5L1L A;  1S0N A;  3EPI A;  4ED8 A;  1ZQG A;  7ICK A;  5EWF A;  5KFB A;  4IRD A;  2W9C A;  1T3N A;  4RQ4 A;  4C8L A;  5HRL A;  3NYB A;  5KG1 A;  4Q44 A;  5BOL A;  4Z6D A;  4AT7 B;  1ZET A;  3WFP A;  3H7I A;  5KFE A;  3MFH A;  2WTF A;  4K4G A;  2AGQ A;  7ICV A;  3OV7 A;  4YR0 A;  1UT8 A;  4QWC A;  2VAN A;  5J2K A;  2UVW A;  1T8E A;  5J2F A;  5J0W A;  2XO7 A;  3UPQ A;  3PX4 A;  1KRP A;  4WBZ A;  3OGU A;  3WFQ E;  3H40 A;  4PH5 A;  3MAB A;  3Q8S B;  3G6V A;  2W9C B;  4DF4 A;  2Q0Z X;  4NLN A;  1RXW A;  3LWM A;  1V9P A;  5J2J A;  4KLQ A;  8ICL A;  4J9L A;  1UEV A;  1BPB A;  4JUZ A;  3ZDA A;  4IQU A;  8ICJ A;  2KZM A;  3PW4 A;  1C7Y A;  4C8M A;  1XWL A;  1NK9 A;  5L1J A;  8ICX A;  3C2K A;  8ICI A;  4DFJ A;  3PY8 A;  4R64 A;  1SL2 A;  4JV0 A;  3C1Z A;  5HC9 A;  5J0Q A;  1ZJN A;  1D9F A;  2IHN A;  2PFP A;  5J2I A;  4R8U B;  9ICF A;  4YVZ A;  5HRD A;  4J9Q A;  4E8F A;  5J0U A;  1U49 A;  4F93 B;  4EP7 A;  3TFS A;  4I2C A;  3HJ1 A;  2BHN A;  3MR3 A;  4F5N A;  4DQQ A;  5EWG A;  4UAY A;  1ZQN A;  4M9L A;  3JYY A;  4FHW A;  5KFV A;  1ZQU A;  1K1S A;  2M2T A;  2R8J A;  1MC8 A;  1TVA A;  4IQV A;  4FS1 A;  4XUS A;  3T5K A;  4DF8 A;  2ASJ A;  4KLJ A;  1KFS A;  4XA5 A;  5J2H A;  1KDH A;  4WC4 A;  4ECV A;  2Y1I A;  3RH6 A;  3RJF A;  4WC1 A;  5KT2 A;  9ICM A;  3H8J A;  1ZYQ A;  1B43 A;  4KIT B;  2XCA A;  1N56 A;  3QZ8 A;  2KZZ A;  1TK5 A;  2FPM A;  5J29 A;  4FBU A;  4NLK A;  4S3N A;  4IR1 A;  1U9L A;  1NK5 A;  1L3U A;  1QSL A;  2PFN A;  1NKB A;  4B9S A;  3GFK B;  4RQ3 A;  1TK8 A;  2B21 A;  4F92 B;  3HP6 A;  3G6Y A;  2HHW A;  4ED3 A;  3M9N B;  4J9K A;  2AGO A;  3RBE A;  4X4R A;  5DEC A;  2W9B B;  4IR9 A;  9ICB A;  4QWA A;  3T5L A;  1X9M A;  4DQR A;  4O9M A;  3GV5 B;  2PI4 A;  4RNM A;  2C2E A;  2ZJA A;  1VFG A;  3C18 A;  4YP3 A;  2JEG A;  7ICL A;  4I2F A;  4X4O A;  4QZD A;  4B9U A;  4IRC A;  1NJX A;  4B9N A;  4EZ6 A;  4CCH A;  2ISP A;  4K4H A;  3V7J A;  4DFM A;  3RRG A;  7ICG A;  1ZQT A;  2AJQ A;  3BQ0 A;  1NO5 A;  3OVS A;  4I2E A;  8ICO A;  4RZR A;  3UQ2 A;  4XQ7 A;  1DGS A;  1XSL A;  1JIH A;  4RQ7 A;  7ICO A;  9ICI A;  3LDA A;  3OHA A;  2ZTD A;  2O5A A;  4DL7 A;  3JPP A;  2F1I A;  1JX4 A;  4ATB B;  2NRW A;  1JAJ A;  2RDI A;  4TQR A;  5HHH A;  5KFG A;  1CEZ A;  5D49 A;  2Q66 A;  1BPD A;  4P4O A;  4ELU A;  4KLH A;  1WCL A;  2XY5 A;  4F5R A;  2Y1J A;  4GXK A;  3V7L A;  2VA3 A;  4NKU A;  5C5J A;  5HRF A;  4EYH B;  7ICH A;  4I2J A;  2NRV A;  4LZD A;  1LV5 A;  2UVR A;  3RRH A;  4DL6 A;  4JV2 A;  4X4U A;  2AQ4 A;  1ZQP A;  3V6H A;  1XSP A;  2R8K A;  1NZP A;  1SKR A;  4M9G A;  1PZN A;  7ICJ A;  1ZQB A;  4IQT A;  2BCR A;  4Q8E A;  2J6S A;  4KLO A;  2KFZ A;  9ICO A;  4FHV A;  9ICS A;  1WCN A;  4UQG A;  4ECT A;  3PX6 A;  4P2H A;  4DSF A;  2FMS A;  4QZ8 A;  4TUQ A;  4DFK A;  4F2R A;  3OJU A;  1B22 A;  1NKC A;  4RQ5 A;  2FLP A;  2J6T A;  5KG3 A;  2BE3 A;  2C28 A;  2BPF A;  3C5G A;  3OVA A;  5KT3 A;  4QZG A;  3Q8M A;  1BNP A;  2NRK A;  4R66 A;  4O0I A;  4UAW A;  3BDP A;  3PML A;  3RBD A;  5HHI A;  4RT2 A;  4P4M A;  1KNY A;  1ZQC A;  2BDP A;  2ZH6 A;  1ZQX A;  9ICK A;  2ASL A;  4E0D A;  1ZQD A;  3EWA A;  1RPL A;  4QWB A;  4QZA A;  4MF8 A;  2UVV A;  1ZQK A;  3ISC A;  4DSJ A;  8ICP A;  4RQ0 A;  1TFY A;  1Z00 A;  2BPC A;  5J0T A;  3RJI A;  4O5E A;  4WCW A;  1TKD A;  1BGX T;  3SV3 A;  8ICB A;  3PVX A;  4JK1 A;  4M9N A;  4ED7 A;  3C1Y A;  4PHE A;  3Q8R B;  1QLN A;  3AQL A;  1UT5 A;  1NJY A;  2PFQ A;  1XU4 A;  5IIN A;  3C21 A;  5F9L A;  3OSN A;  4ECX A;  2P6U A;  4FH5 A;  5IIL A;  4RQ6 A;  1XC9 A;  3C23 A;  3LQC B;  2M9N A;  1TK0 A;  4X4Q A;  3GV8 B;  3MGH A;  7ICR A;  4FHP A;  3V6J A;  1JN3 A;  4X0A A;  4F5Q A;  8ICU A;  4RT3 A;  2V4R A;  3TQ1 A;  1TV9 A;  1NK8 A;  2ID1 A;  4RWQ A;  1X2I A;  4UD4 A;  4UAZ A;  1F5A A;  4KTQ A;  2IBK A;  5HR9 A;  4M9H A;  4TUR A;  4PGY A;  5J2A A;  1Q78 A;  5KG4 A;  4O3O A;  4KLM A;  2HHP A;  3IM1 A;  3C2L A;  3ISD A;  1A77 A;  4UBC A;  1ZQH A;  4NXZ A;  2C2R A;  4KLU A;  1ZQZ A;  3RB4 A;  3UXP A;  4ED2 A;  4F4Y A;  1NK4 A;  7ICU A;  4MFF A;  3H37 A;  2F1J A;  2BR0 A;  3OUY A;  2R8H A;  2MUT B;  2ZUC A;  3OHB A;  4DQS A;  4QZH A;  3QE9 Y;  4NM2 A;  1RYR A;  2JEJ A;  2HHU A;  1MIW A;  5CR0 A;  2ZUB A;  3C66 A;  1TFW A;  3JPT A;  5KG5 A;  5KTQ A;  1S97 A;  4HYK A;  3JPS A;  9ICJ A;  2ZH7 A;  4TUP A;  4YXM A;  5HRI A;  3TI0 A;  9ICT A;  2ZH8 A;  4DLG A;  4DOC A;  3SI8 A;  4P4P A;  4C8O A;  2RFF A;  4Q43 A;  3GIK A;  1X9W A;  4M9J A;  4DL3 A;  4EBJ A;  2V9W A;  4B9T A;  4ECU A;  1HJP A;  4F4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...