4TUPA

Structure of human dna polymerase beta complexed with gg as the template (gg0b) in a 1-nucleotide gapped dna
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
326
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
publication title Structural Basis for the Inefficient Nucleotide Incorporation Opposite Cisplatin-DNA Lesion by Human DNA Polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4tupA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4tupA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4tupA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4tupA03
1VJ7A 3HW8A 4I2IA 4DSIA 3RTVA 2HHVA 5KG4A 3M8RA 1A77A 3KHRA 4JWNA 2W8KA 2HHXA 3PW4A 8ICMA 4R65A 4YVZA 1TVAA 5HRBA 1LV5A 1ZQNA 4O5CA 1SKSA 5HRGA 7ICUA 4KLFA 2HHUA 3LWMA 4B9UA 5KFUA 2HHTA 4QWAA 3RB3A 3QE9Y 1D9FA 4R63A 4Z6DA 3RBDA 1ZQKA 1S0MA 4RQ3A 4F5NA 4EBJA 4BXOB 2XCAA 4FS2A 4X0BA 5KT3A 4DLEA 4JWMA 5CJ7A 3ZDDA 1ZQDA 4RPZA 2JEJA 1LB2B 7ICEA 3EWAA 4DL3A 9ICTA 4TUSA 1UEVA 3T3FA 4M5DA 2BCQA 3NGDA 2BGWA 2HHWA 4LVSA 3QZ8A 2XGQA 1MQ2A 1WCLA 5KFWA 3ETLA 3FDSA 4UB2A 4QZGA 4RQ6A 4RQ2A 4UB4A 2BR0A 1RXVA 4J9RA 5J0OA 2R8GA 4M9LA 3NTUA 3RH5A 1U48A 2HVIA 2W9BA 2VA2A 1KNYA 3JZ0A 1RZTA 4WC0A 5KT5A 4BGDA 2BCRA 1QSYA 4B9SA 3MDCA 3QZ7A 4LT6A 4M9GA 4ATBB 4C8LA 4WC4A 4EYHB 1S76D 4KLJA 5F9NA 4QW9A 4NLNA 4WBYA 5DGBA 2JZBA 4I2AA 3T5KA 3H4BA 2ZH8A 9ICIA 5J2HA 5KFRA 2AQ4A 1KDHA 7ICKA 2ZTEA 4P2HA 3MR2A 1ZQGA 3RRGA 2J6TA 2NRVA 5J0QA 3IM1A 1EXNA 1NJYA 2DR9A 1COOA 3KHGA 4J9LA 3Q8MA 5L9XA 1XS9D 3RJIA 3C21A 4M9HA 1MIYA 2XY7A 1TFYA 4RQ7A 4P4PA 1HJPA 3TFSA 4IG8A 3H3AA 8ICZA 3G6YA 8ICNA 2OWOA 2B21A 3PVXA 3RJKA 4O5EA 1ZQMA 1NZPA 2ALZA 4NLKA 4XA5A 2BKEA 2MUTA 4I2GA 4YXMA 1ZQLA 1TFWA 4X4NA 2NRXA 1T4GA 2PFNA 4FHPA 2FLNA 9ICUA 1KTQA 2FPMA 5L1IA 2UVRA 4KLGA 2FPLA 2PI4A 4UAZA 7ICSA 3PO5A 4EBKA 1RPLA 2R8KA 5KG3A 2HHPA 1U47A 1H38A 3ZDCA 5KFSA 4WC5A 1DGSA 5L1KA 5HRKA 3UPSA 5CP2A 4ED3A 5KFQA 4B9LA 4QZHA 7ICLA 1ZQBA 4KLQA 3UXOA 1ZQIA 1MIWA 1C7YA 1IM4A 3THVA 1U4BA 4ELUA 2W9BB 4FHWA 4CCHA 4M04A 4P4OA 4JK1A 1PZNA 7ICJA 4RWPA 3KHHA 3QEBZ 4F4WA 1KLNA 4JV1A 7ICHA 4QWBA 4NXZA 3TFRA 1S0VA 2JZBB 1SKWA 4X4OA 2UVWA 5DLGA 4GXJA 2DR8A 4DWIA 3BQ0A 1U9LA 3GIMA 4DL2A 3WFRE 3RAQA 4WC2A 1ZQXA 3MR3A 2V9WA 5KFKA 4DFPA 1R8AA 4RPXA 2KZ3A 4MEXA 2BCVA 5KFTA 3PX0A 5J2AA 1ZQYA 8ICTA 9ICXA 4YXJA 8ICUA 4DQRA 3GV7B 1BPEA 3BQTA 4UB3A 1T8EA 4F3OA 2ZH3A 8ICIA 2C2EA 2FMSA 3WFOA 3V7KA 3OUYB 4MFAA 5CHGA 3PR5B 2BDPA 4S3NA 4RWNA 5D46A 4G3IA 2W9CB 1DK2A 5HRLA 1UA1A 2MUTB 1V9PA 3OHAA 3C5FA 2KFNA 1S9FA 1DK3A 4ATBA 3ISCA 3RH6A 4XUSA 1UT5A 8ICBA 2KTQA 2DR5A 1BNOA 4X4VA 5J0RA 5J0WA 3RR8A 2RFFA 4I2EA 3PMLA 4Q8FA 3PNCA 1A76A 2ZH9A 1RYSA 4X5VA 3V72A 3SZ2A 4AT8A 4TQRA 1S10A 3PX4A 2Y1JA 1X9MA 3PW7A 5KFMA 4PGYA 4EBDA 4FO6A 5DGAA 1KFTA 4WC7A 5DQIA 3LDAA 3PY8A 5KFFA 5HHIA 4NY8A 1L3SA 5KFVA 3H8WA 1K1QA 4I2DA 1SL2A 8ICHA 2ZJ5A 9ICKA 5F2VO 4X4RA 1ZQFA 2BCUA 1ZQCA 2J6UA 4RQ0A 2W9AA 5KG2A 3WFQE 2FMPA 3MGIA 2UVVA 8ICPA 5IINA 5KFNA 2FPKA 3UXPA 4FHYA 2ASLA 3TI0A 5HNKA 2Y1IA 7ICNA 2M2WA 1ZQHA 4RUAA 1SL1A 1AROP 3M8SA 5KFHA 1BGXT 5IIIA 1SL0A 4RQ4A 3BQ2A 3TAPA 2AGPA 1KEJA 4O3NA 9ICMA 1JQRA 3OVBA 4ECTA 3RB4A 5DB9A 1BPDA 2IHMA 3HIYA 4X4PA 1TFRA 3G6XA 2RDJA 4DFMA 4KLEA 5HREA 4M47A 1NKCA 3EPIA 4X4UA 9ICJA 2ZH1A 1F5AA 4WC3A 4WCWA 4AT7B 3HP6A 1KRPA 3AQNA 2KN7A 1PX5A 3LK9A 3IHQB 5J2FA 4C8MA 5KFIA 1UT8A 4QZEA 4EBEA 3EZ5A 1R8BA 4YQWA 2VA3A 4XQ7A 4QZCA 5D49A 2M2VA 4ED7A 4I2BA 4RZRA 5IIKA 1L3UA 4J9MA 3RB6A 3GIJA 4PGQA 2FLLA 4IRKA 4RQ5A 4IQUA 2J6SA 4Q45A 1KFSA 4XRHA 2KFZA 2Q66A 4J9NA 4F5QA 2P6UA 4X0AA 5CA7A 3OSNA 2DPJA 4IQTA 2R8JA 2HW3A 3ORYA 3JPQA 4DL4A 2BPFA 2NRWA 2NRZA 4EZ6A 8ICEA 3OHBA 3UQ2A 1R89A 4K4HA 2PFPA 4DSLA 1ZQTA 2ZH5A 5KT2A 1Y88A 5KFGA 5EOZA 1X9WA 1RXWA 3HWTA 3ZDAA 1Q79A 4FHVA 5J29A 3WFSC 3JPTA 5J2DA 1QLNA 2PFOA 5J0SA 3H8JA 2BQ3A 3H40A 3PR4A 2ZHBA 3M9OB 5KT6A 1N48A 3JYYA 4C8OA 3OUYA 1XWLA 3B0YA 2C28A 3OVSA 2W9CA 3JPOA 2PI5A 4O3PA 1S0NA 9ICQA 4F92B 5DB6A 4GC6A 4KTQA 1NK6A 4YR3A 1NJZA 4KLDA 2V4QA 8ICSA 7ICVA 4I2JA 1XSLA 4KLMA 4E0DA 3AU6A 4EEYA 1T7PA 4J9SA 4IRDA 2BHNA 5KT4A 1ZQOA 8ICQA 1WOTA 3RJGA 7ICMA 3RH4A 4MFFA 1ZQRA 3H38A 2UVUA 4RNNA 4QZIA 2R8HA 4UBCA 1NK0A 3UQ0A 4KLSA 4R8UA 5DKWA 4F5RA 2JEIA 8ICYA 5KFYA 4C8KA 1L3VA 3Q8PB 2BQUA 7ICTA 2RDIA 2O5AA 4YR2A 2DPIA 2IHNA 4JV0A 4XQ8A 3AQLA 4FS1A 1ZETA 1SZPA 1NK7A 5KG0A 2XCPA 3N4MB 4PHDA 2NRTA 2FLPA 1XO1A 4ELTA 3GDXA 3C2KA 3RJFA 1QSLA 4O9MA 7ICOA 5J2JA 1NJWA 4B9MA 3WFPA 2HVHA 4O3OA 4QWDA 4QWCA 4ED1A 7ICQA 1ZQWA 1Q78A 4O0IA 3BQ1A 3C2LA 5BOMA 3ISBA 1X9SA 4IRCA 4ECYA 9ICWA 3N97B 1D9DA 4DQSA 1NK4A 1ZJMA 3C66A 5DG9A 4DOAA 3MDAA 4JUZA 5KG1A 2V4RA 9ICBA 5HHHA 2BE3A 9ICSA 1MQ3A 4DEZA 5HRIA 5J2BA 1YLQA 5J2IA 2ZUDA 3JPRA 3JPPA 3Q8RB 4I28A 5IIMA 4YCXA 4DFJA 2JEFA 8ICCA 4QZ8A 4B9TA 4YR0A 3Q8KA 2HHSA 2M2UA 2DR7A 5KFZA 1Z00B 4J9QA 4F91B 4Z6CA 4ED0A 2I1QA 3AQKA 4J9OA 1S97A 3ZD9A 4IQWA 3GIKA 4KLOA 2PFQA 4AT9A 3PW0A 3H37A 3C1YA 5DG8A 1KSPA 1ZQJA 1NOMA 4ECZA 9ICNA 1UETA 4AT8B 3RAXA 4ED6A 3C1ZA 2BPGA 2ISOA 1JIHA 1BNPA 1NKEA 3TANA 3MR5A 4B9VA 4Q44A 3GV8B 3PO4A 4K4GA 4RU9A 4PGXA 2ZUCA 1V4AA 4EZ9A 1DOQA 4YD2A 3GV5B 4MF2A 1TK8A 5KG7A 4BWMA 3H8SA 4RQ1A 4PHPA 2C2RA 5KT7A 4F4XA 3LQCB 4X4TA 4R8UB 1ZJNA 1ZQZA 3LWLA 4GLXA 1HUOA 1BPZA 4BDPA 2ZH4A 4ED8A 2VA8A 1L5UA 1TAQA 5DB8A 5J2GA 3KTQA 1MIVA 1S0OA 2PXIA 4I2CA 5EWGA 5DQHA 4NM1A 4RNMA 3RJJA 1NK5A 1D8LA 7ICGA 4NLZA 2F1IA 1JMSA 4TQSA 3TAQA 4GC7A 1JXEA 1U49A 4HYKA 4QZ9A 4I2HA 2W9MA 4YD1A 4UD5A 5TZVA 3TQ1A 4I29A 5DDMA 4ECSA 8ICJA 4M9JA 5KFXA 1XU4A 9ICOA 3M9MB 3SV3A 3OJUA 4KLIA 4FH5A 3T5LA 4RNOA 4E7XA 2O1PA 1D8YA 4IQVA 4EYIB 1MC8A 4ECQA 1U45A 4PHEA 4KITB 5EWEA 5DB7A 2DFLA 2IBKA 2VANA 2BPCA 9ICAA 1NO5A 3GFKB 1OU5A 3SV4A 5KTQA 5J0YA 5J0TA 3NYBA 4M6WA 3H39A 4X4SA 2ZH6A 2ASDA 3MFIA 4UBBA 2PBEA 5HMMA 5HRFA 4F50A 5BOLA 2KZZA 4AT9B 7ICFA 3EPGA 2A1JB 4J9PA 2DRBA 5DBBA 5J2EA 2FMQA 2W8LA 4PPXA 2ASJA 2ZHAA 5HC9A 4FBTA 3GILA 8ICWA 4BWJA 5KG6A 4UAWA 4ELVA 3EW9A 4F2RA 4DFKA 8ICRA 4DSFA 2MAXA 4UAYA 1B43A 2WTFA 3PMNA 3PW2A 1SKRA 4YP3A 3V6KA 1ZQSA 3JPSA 5HRDA 1ZQEA 5KFBA 3TARA 1VFGA 3RRHA 3HJ4A 4YMOA 4DSJA 5L1JA 4Z6FA 4YMMA 4DO9A 3Q8LA 4QZBA 1T3NA 3AUOA 4KLUA 5DG7A 4PH5A 2AJQA 3C18A 2H5XA 5KFDA 4TUQA 4ECRA 2P6RA 3AQMA 2DVIA 8ICLA 4KLHA 3QEAZ 2M9NA 3V6JA 5IILA 3OSPA 2C22A 8ICAA 5HRHA 1TK0A 4O3RA 1X2IA 3Q8SB 1NKBA 1Z00A 9ICLA 1JAJA 1UEUA 4R66A 4UQGA 3MGHA 3HT3A 4DQQA 4ZH4A 4DSEA 2XY5A 5DECA 4JV2A 1CEZA 5DDYA 4DL6A 3T5JA 4IR9A 4QZFA 4NKUA 1ZQVA 3SI8A 4GXIA 9ICEA 1JN3A 3ISDA 3OVAA 4WC1A 5J2KA 9ICRA 4AT7A 1B22A 4DS4A 4EBCA 4DF8A 1TKDA 3V6HA 1HUZA 4NLGA 5CWRA 3RJHA 1MSWD 9ICVA 3C23A 3MABA 2R8IA 4I27A 4MEYA 8ICVA 5KFAA 1ZQAA 4KMUA 1ZQQA 3V7JA 4M2YA 1K1SA 4M6WB 5KFEA 4ECUA 3BDPA 4O3SA 4RWQA 4UD4A 4DL5A 2KZMA 4R64A 4LZGA 3K4GA 1L3TA 3C2MA 5J0UA 1ZQPA 4MF8A 5KG5A 2ZUBA 4DL7A 3RB0A 1BPBA 2BCSA 4DSKA 4NKTA 4ECWA 4FBUA 2ZJ8A 5CR0A 3T5HA 2GWSA 5KFCA 4TURA 7ICPA 3HPOA 2C2DA 4Q43A 4ECXA 2F1JA 3OJSA 4E80A 4RWOA 5KFLA 4F5PA 1ZYQA 5KFJA 3Q8QB 2JEGA 4I2FA 1N56A 3L9DA 1KFDA 3C5GA 2LYHA 3ZD8A 5HP4A 3HJ1A 2AQ0A 4KN4A 5IIOA 2P66A 5EWFA 4DLGA 4Q8EA 2ID1A 8ICGA 4RT3A 4F8RA 4FHXA 4NM2A 1CUKA 3B0XA 5C5JA 4QWEA 4F4YA 4LZDA 1JXLA 1BPYA 5DQGA 4UB5A 4K4IA 1BVSA 4ED2A 1NK9A 1NJXA 3RJEA 2IA6A 4KLTA 4QZAA 4IR1A 2F1HA 2I9GA 2AU0A 5D4BA 3MBYA 4DOBA 3V7LA 4QW8A 4O3QA 5KFPA 4YN4A 4WBZA 2BQRA 2A1JA 4TUPA 3AU2A 9ICGA 5L1LA 3M9NB 5J0XA 1Z3EB 5HMLA 4UB1A 3PW5A 4J9KA 4E8FA 1TV9A 3ZDEA 5KFOA 5J0PA 4DOCA 5DBCA 1QSSA 3MFHA 5J2CA 5CB1A 3G6VA 3OGUA 3RBEA 4F5OA 3RR7A 3ZDBA 4BXOA 5HR9A 4DQIA 5IIJA 4F93B 3JPNA 1S77D 1R8CA 7ICRA 2M2TA 1TK5A 1FA0A 9ICPA 3GIIA 3H4DA 3HX0A 4WC6A 2ZH7A 4F4KA 2ATLA 1UA0A 9ICCA 4RUCA 2IMWP 4B9NA 2ZH2A 5DLFA 4YMNA 2XGPA 2ZTDA 4FH3A 3FYHA 5BPCA 4RQ8A 1ZQUA 3UPQA 3EYZA 4PHAA 4RPYA 3SYZA 2XC9A 2ISPA 3E2EA 8ICFA 2NRKA 4YFKA 2Q0ZX 2XO7A 4DQPA 4RT2A 4ECVA 4GXKA 4DS5A 4QZDA 4DF4A 4P4MA 4MFCA 3KHLA 1NK8A 1IXRA 8ICOA 2AGOA 9ICHA 4Z6EA 4YG2A 5F9LA 4C8NA 2AGQA 2HHQA 3GQCA 1XSPA 2ZTCA 5DBAA 1QTMA 7ICIA 3UXNA 5JUMA 3BJYA 4F2SA 1RYRA 1BPXA 1XSNA 4M9NA 2KP7A 4X4QA 3PV8A 1WCNA 4KLLA 9ICFA 5DEDA 1XC9A 8ICKA 4O5KA 4EP7A 3OV7A 2DRAA 4M0AA 4F4ZA 3PX6A 4KN7A 8ICXA 3MR6A 2XY6A 1JX4A 3H7IA 3K75D 1TAUA 2ZJAA
chains in the Genus database with same CATH superfamily
4DSIA 3KHRA 1A77A 2E8NA 2W8KA 3PW4A 4R65A 4YVZA 1LV5A 1ZQNA 5KFUA 2HHTA 3RB3A 3QE9Y 3PSPA 1D9FA 5J8YA 4Z6DA 4RQMA 4F5NA 4X0BA 2K8AA 4BXOB 4I0UA 3M6KA 4JWMA 3QU7A 3EWAA 4LEYA 4DL3A 2XI9A 1COKA 2BCQA 4LVSA 1MQ2A 1WCLA 3FDSA 1Q79A 1RXVA 4M9LA 4C7ZA 1U48A 2FDRA 4WC0A 1QQ6A 2RRDA 4BGDA 4EYHB 3NVYA 4KLJA 3BS5B 4Y2RA 4QW9A 4I2AA 2ZH8A 5J2HA 4IL6U 7ICKA 3MR2A 1ZQGA 1N63A 3RRGA 5J0QA 3IM1A 4FE3A 3NWIA 3RJIA 1DRGA 1HJPA 3TFSA 3N7RC 2KJ5A 2DGZA 8ICNA 2OWOA 2B21A 3RJKA 4O5EA 2ALZA 4XA5A 1RG6A 4I2GA 4YXMA 2XICA 2W43A 1MN8A 3CK6A 3HKZF 2DUYA 3IP4B 1SGGA 1C20A 2PI4A 5HR6A 1H38A 3ZDCA 5KFSA 3K1RB 3UPSA 4B9LA 7ICLA 1ZQBA 5GTIU 1C7YA 2WF8A 2IOFK 3N7PD 4FHWA 2IOHA 4M04A 3OTQA 1PZNA 5AK6A 3F2BA 4KX5A 5AIBA 2E8OA 2UVWA 3BQ0A 1U9LA 4DL2A 3MR3A 4EEDA 2DWQA 5KFTA 1ZQYA 1RQNA 4YXJA 3GV7B 3BQTA 3WFOA 3OUYB 4MFAA 5CHGA 4S3NA 5D46A 2B4VA 5AKYA 1DK3A 3ISCA 8ICBA 4XUSA 2KTQA 3D2QA 5J0WA 1FO4A 4I2EA 3PNCA 2KSOA 5KFMA 4PGYA 2B51A 2DF4B 5DGAA 4NXWA 5KFFA 5HHIA 1SL2A 2CXYA 2ZIVA 4X4RA 1ZQCA 5ALQA 3WFQE 4OJOA 2UVVA 5ALTA 5IINA 5KFNA 3JCFA 4O68A 1Z1BA 1BGXT 9ICMA 3BQ2A 2AGPA 3OVBA 5CFUA 2HBJA 4CNQA 2YMPA 4PL2A 4CRXA 3IHQB 4K97A 4Y2VA 1R8BA 4XQ7A 3EZ5A 2KJ8A 2M2VA 2E8PA 4I2BA 1L3UA 4PGQA 3DDHA 4QNLA 3L3FX 3QU9A 5AI6A 4LEWA 2Q66A 2ZXIA 2DPJA 2JRZA 2KSOB 1Q3UA 2NRWA 2LM1A 5JTIA 2YTUA 2G0AA 3QYPA 4FHVA 5J29A 1CI4A 2ZIVB 2BQ3A 2QARA 2G5IB 2LKYA 5KT6A 1N48A 2CPRA 3C66A 4AT8A 2KG5A 4YR3A 1NJZA 4E0DA 2Q4TA 1J2NA 1WOTA 7ICMA 3H38A 2UVUA 4UBCA 4KLSA 3ONNA 4R8UA 2IHOA 1S5LU 5KFYA 4C8KA 2RDIA 2KNJA 3KD3A 4JV0A 1KW4A 5KG0A 2FLPA 1XO1A 4IC9A 3S6JA 3TADA 3GDXA 3UMBA 4UASA 1QSLA 3M1YA 3D2SA 3WFPA 4O3OA 4QWCA 3BQ1A 1QCKA 5AKZA 5BOMA 1X9SA 2KMDA 4DQSA 1NK4A 2AXTU 5DG9A 3WKAA 2KHVA 4DEZA 5HRIA 1Z19A 2E1EA 3Q8KA 2HHSA 2QARB 5KFZA 2Y0SC 2YY6A 4F91B 4Z6CA 4ED0A 4J9OA 3ZD9A 4IQWA 3PSFA 4AYBF 3KZIU 3H37A 1UETA 2K4PA 4AT8B 4ECZA 3RAXA 3OWGA 1X6JA 4OCZA 1JIHA 1Z1VA 4Q44A 3PO4A 4K4GA 4EZ9A 4RQ1A 2RHFA 2O6KA 4PHPA 3LQCB 4X4TA 5ALGA 4R8UB 4OD0A 4BDPA 1L5UA 1QH9A 4EENA 3WK6A 2YB4A 7ICGA 1UCVA 5JTGA 3TAQA 4I2HA 5ALOA 2W9MA 5TZVA 2EAMA 4ECSA 5KFXA 1XU4A 3SV3A 4FH5A 4KLIA 4E7XA 2O1PA 1D8YA 4IQVA 2EQYA 1MC8A 4EYIB 4ECQA 2IBKA 4FHPA 5EWEA 1NO5A 5ALXA 3GFKB 3SV4A 5KTQA 5AICA 2ASDA 3MFIA 4UBBA 5HMMA 3WK8A 2KZZA 3EPGA 4UATA 2FMQA 4FBTA 8ICWA 2K4IA 3AQFA 4DFKA 3V6KA 1ZQSA 5HRDA 3QNMA 1ZQEA 3TARA 1K5OA 4Z6FA 2YMQA 4YMMA 3Q8LA 4KLUA 1SIJA 4PH5A 3C18A 2P6RA 3AQMA 5IILA 3OSPA 2HDOA 4UQGA 2W3SA 4ZH4A 2WFAA 5DECA 2I5HA 1CEZA 5ALUA 4DL6A 1ZQVA 5KAIU 2RP5A 4GXIA 9ICEA 3OVAA 4WC1A 1B22A 4DF8A 3NRWA 4B6JA 3V6HA 1TKDA 1HUZA 3RJHA 1MSWD 5ALMA 1ZQAA 1ZQQA 3NVZA 1K1SA 4ECUA 1VLBA 5J0UA 1RM6C 1BPBA 1X40A 5CRXA 2GWSA 5KFCA 7ICPA 5ALRA 2W54A 4RWOA 4F5PA 1CRXA 3C5GA 5HP4A 2AQ0A 2P66A 3A0BU 5EWFA 2WF7A 1JRPA 2ID1A 3SAHA 2WAQF 4N7RA 1N5XA 1SV4A 1CUKA 4K4IA 1URJA 4ED2A 1ZD3A 1L8OA 2F76X 2F1HA 2AU0A 9ICGA 5AKEA 4NLBA 5J0XA 5HMLA 3AEVA 4E8FA 2ZXHA 5J0PA 9ICAA 3G6VA 3RBEA 3RR7A 1SXEA 4F5OA 4F93B 1FA0A 2ZH7A 3H4DA 3HX0A 4G9BA 9ICCA 4B9NA 5ALNA 4NJ8A 5DLFA 2MRLA 2ZTDA 3FYHA 4RQ8A 4PHAA 3SYZA 2ISPA 2XC9A 2NRKA 4YFKA 3N7SC 4RT2A 4DS5A 4MFCA 1NK8A 2BBHA 2HHQA 1RYRA 1WUDA 2ES6A 5AM3A 3PV8A 4NL9C 4KLLA 5DEDA 4K9BA 5KAFU 3H8MA 2RQ5A 3HILA 2CRXA 4KN7A 2WHEA 1JX4A 3H7IA 4O9MA 2YX8A 3HW8A 3D2NA 3RTVA 2HHXA 4JWNA 1NZBA 2HSZA 4O5CA 3MC1A 4KLFA 2JV3A 3NRZA 3J81j 4OAGA 4EBJA 1S0MA 2XCAA 5KT3A 2WF9A 1LB2B 1UEVA 5AM5A 3NGDA 3QZ8A 3QU2A 5KFWA 2BR0A 4RQ2A 4UB4A 4J9RA 4PL1A 2JMGA 3RH5A 2HVIA 2W9BA 3I1YA 1RZTA 2BCRA 4NV0A 4LT6A 4ATBB 4C8LA 4WC4A 3NVOA 1SV0C 2JZBA 3T5KA 3H4BA 2AQ4A 2J6TA 3WKBA 4J9LA 3Q8MA 2WB1C 2XY7A 1TFYA 8ICZA 3G6YA 2MUTA 1ZQLA 2NRXA 1T4GA 1SB3C 3CW2C 2YMLA 9ICUA 4KLGA 2KK0A 4UAZA 4EBKA 3AQEA 5KG3A 2HHPA 1U47A 2PMZF 4WC5A 4QZHA 2A19A 4KLQA 1ZQIA 1MIWA 2W9BB 5ALHA 4P4OA 4MHVA 7ICJA 2L5YA 1KLNA 3FM9A 2JZBB 4X4OA 3WFRE 3OPXA 2G5HB 5KL8B 8ICTA 3PX0A 4PZOA 9ICXA 4DQRA 5CFSA 3IV6A 3QU5A 4F3OA 2ZH3A 8ICIA 3AN1A 2FMSA 4UW9A 2VKQA 1YZ6A 2HOQA 2W9CB 1UA1A 2MUTB 3C5FA 3F5AA 1UT5A 1BNOA 5J0RA 3RR8A 3BS5A 3BS7A 1RYUA 3QX7A 5AKJA 2ZH9A 3SZ2A 1S10A 2Y1JA 4EBDA 1T94A 3LDAA 1L3SA 4IS7A 5KFVA 4I2DA 1X42A 2ZJ5A 2BCUA 2N1RA 4RQ0A 1SWVA 2W9AA 3PSTA 5KG2A 1OUQA 3MGIA 1ZD2P 2M2WA 2GOLA 1SL1A 3SMVA 5K4LA 1Z4NA 1JQRA 1KEJA 2KJ9A 3RB4A 5DB9A 4X4PA 4DFMA 9ICJA 3AQNA 5AI5A 5KFIA 4YQWA 3IDWA 4QZCA 4J9MA 1QQ7A 2FLLA 4IRKA 4RQ5A 4IQUA 4XRHA 2KFZA 4J9NA 2P6UA 5CA7A 3OSNA 4IQTA 4P0PA 4DL4A 2NRZA 1R89A 3OHBA 4US9A 4DSLA 1ZQTA 1F44A 4US8A 1RXWA 3HWTA 2GH1A 1N61A 3JPTA 5J0SA 3H8JA 1KBUA 1X66A 3WKDA 3M9OB 3JYYA 3OUYA 1UHUA 3B0YA 4FZMA 4UARA 1S0NA 4KLDA 5C0YA 1SZHA 7ICVA 3AU6A 4EEYA 4J9SA 4K9AA 2BHNA 5KT4A 1ZQOA 3RJGA 3RH4A 4MFFA 1ZQRA 1L7OA 4Y2JA 1PUZA 3UQ0A 2DQNB 4EX7A 1L3VA 3KKAC 2BQUA 7ICTA 2R18A 4YR2A 2DPIA 2IHNA 3AQLA 4FS1A 7ICOA 1S8OA 4QWDA 4ED1A 4QIWC 3C2LA 9ICWA 4P0PB 1L7NA 2F8KA 4DOAA 2QKQA 3TADC 5AI8A 5J2BA 1YLQA 5J2IA 3JPPA 5IIMA 4B9TA 2DR7A 4YR0A 4BJQA 1Z00B 3ICXA 3M7DA 3C1YA 9ICNA 4ED6A 2BPGA 2ISOA 3MR5A 1F5SA 3UMCA 5JU5A 4RU9A 2ZUCA 3GV5B 4MF2A 2F3NA 2H3QA 1AQ6A 1F0MA 2C2RA 3LWLA 4HX0A 3K1ZA 1B0XA 2PXIA 4I2CA 5DQHA 2B6GA 4NM1A 4CF4A 4NLZA 1JMSA 4GC7A 5ALYA 3TQ1A 2VJ5A 4M9JA 2BDUA 3OJUA 3T5LA 4RNOA 1PVPA 2ESEA 5EE1A 1U45A 4KITB 5DB7A 1MA7A 1TAMA 1L7MA 1OU5A 5J0TA 3NYBA 4CF3A 7ICFA 2A1JB 3NUQA 2B56A 5HC9A 2DKZA 2W8LA 2ASJA 2ZHAA 4ELVA 3EW9A 4DSFA 1SKRA 4YP3A 3JPSA 1L8LA 5KFBA 3RRHA 2HN2A 5L1JA 3DV9A 2AJQA 4ECRA 4K96A 4KLHA 2M9NA 1SWWA 5AM2A 9ICLA 4C80A 4R66A 3FC4A 3MGHA 4DQQA 4OAHA 2XY5A 5DDYA 4C4SA 4IR9A 4QZFA 4NKUA 3MCRA 3M6ZA 4AT7A 2LM4A 3C23A 4I27A 4MEYA 3V7JA 4M2YA 4O3SA 1O03A 3K4GA 1SXDA 2RLTA 4MF8A 1FIQA 2KKVA 5CR0A 3T5HA 4Q43A 5AKLA 1PK3A 5KFLA 4LEZA 2KD1A 2W3RA 2JEGA 1N56A 3ZD8A 1N60A 3HJ1A 4Y2TA 3C29A 8ICGA 3U26A 4NM2A 4K98A 4QWEA 4LZDA 5DQGA 5EE3A 4UB5A 3WK5A 3SENA 3RJEA 4IR1A 5D4BA 5KFPA 4WBZA 4FZLA 4TUPA 5L1LA 1Z3EB 2IOFA 3PHZA 4J9KA 3ZDEA 1QSSA 2G06A 4LEVA 1ECWA 4AT7B 4DQIA 5IIJA 2W04A 4WC6A 2EZXA 3FAHA 1X9XA 4F4KA 5AI4A 1UA0A 4RUCA 5BPCA 8ICFA 3EYZA 2Q0ZX 2XO7A 4DQPA 4DF4A 1HEKA 8ICOA 3IG5A 4Z6EA 4YG2A 5F9LA 1XSPA 2ZTCA 5DBAA 7ICIA 3UXNA 5JUMA 4X4QA 2KP7A 4M9NA 1LVHA 1WCNA 9ICFA 1XC9A 4O5KA 3OV7A 4F4ZA 3PX6A 3MR6A 2XY6A 3K75D 4WQLA 4UAVA 2HHVA 2EZZA 5KG4A 2EH9A 8ICMA 1TVAA 3B9JA 3AM9A 1SKSA 5HRGA 4B9UA 2OXOA 4QWAA 4R63A 2LI6A 1ZQKA 4FS2A 3ZDDA 2YB1A 7ICEA 9ICTA 3T3FA 2BGWA 2XGQA 4UB2A 4QZGA 2DRAA 3WK4A 4OJ6A 5J0OA 1KNYA 2IUBA 2VA2A 2EZYA 2OCEA 4B9SA 2JH1A 3QZ7A 4M9GA 2ZIWA 4NLNA 4WBYA 5KFRA 1KDHA 2ZTEA 4P2HA 3O0FA 4BX9C 1EXNA 5AM1A 1NJYA 4C7YA 4M9HA 2B0CA 1MIYA 2HN1A 2H3FA 4RQ7A 2H3ZA 4IG8A 4AP9A 3PVXA 1ZQMA 2BKEA 4U6PA 1TFWA 4X4NA 2PFNA 3UMGA 1ZOLA 4K8VA 2A1AA 1KTQA 2HOFA 2FPMA 1UQVA 5AM4A 3PO5A 2R8KA 2JXJA 2I6XA 5HRKA 5CP2A 5KL1B 5ALWA 4ELUA 4CCHA 4JK1A 3QEBZ 1FEZA 4JV1A 2KICA 4QWBA 2ZIWB 3TFRA 1S0VA 2EDUA 1SKWA 2NO5A 5DLGA 2DR8A 4DWIA 3GIMA 3RAQA 4WC2A 2WF6A 5H2FU 2V9WA 5KFKA 2MSNA 2KZ3A 4MEXA 2GO7A 1ZD5A 2FI1A 2OEHA 4UB3A 5ALVA 1T8EA 3HKZC 4EEKA 2C2EA 3C28A 3VC8A 4RWNA 3OHAA 4X0AA 4Y2PA 4ATBA 3RH6A 2DR5A 1P7DA 4U7CA 2W03A 4Q8FA 4X5VA 2XIDA 3V72A 4TQRA 3PX4A 5CHEA 3PW7A 3QU4A 5AI0A 2MU2A 4DFDA 3PY8A 2F77X 4NY8A 9ICKA 3H8WA 4OJLA 5F2VO 1ZQFA 2J6UA 3ETRA 2FMPA 8ICPA 2K89A 5AKHA 2ASLA 3F2DA 3TKAA 5HNKA 2Y1IA 7ICNA 4RUAA 1AROP 1JROA 4CGZA 2LPEA 1SL0A 4KB6A 4O3NA 4ECTA 3HIYA 1BPDA 1TFRA 5HREA 1L7PA 2ZH1A 4OAFA 1WYGA 1KRPA 4OJPA 2KN7A 3PZPA 2GLEA 2KE7A 2JGAA 5ALIA 1UT8A 4QZEA 1JI7A 4EBEA 5J8YC 3TACB 2FJ6A 5ALPA 2J6SA 1KFSA 2KOBA 3RF9A 4F5QA 2G09A 1VJ5A 5AI9A 3AL0B 2BPFA 1YZ7A 2ZH5A 5KT2A 5KFGA 5EOZA 1NI3A 4CF5A 1X9WA 1B4FA 2KVCA 5J2DA 1QLNA 5TISU 2ZHBA 3H40A 3PR4A 5CEHA 4DCCA 2W9CA 3ER8C 2PI5A 4O3PA 4KX3A 2KV2A 5DB6A 2V4QA 1XSLA 4KLMA 3I28A 1L6NA 3E58A 3WKCA 2Y0SF 4IRDA 8ICQA 1NK0A 3BZKA 8ICYA 3Q8PB 2O5AA 1SZPA 1NK7A 2XCPA 4ELTA 4WJ3B 2ZIUB 3C2KA 5J2JA 1NJWA 2GA9D 2ZH6A 5ALLA 1Q78A 3ISBA 4ECYA 3QUBA 3BQ7A 1D9DA 1ZJMA 3NKUA 2G07A 4JUZA 5KG1A 1D8BA 1MQ3A 4K99A 4I28A 5EE9A 8ICCA 4YCXA 3KFUF 2I1QA 4HAIA 1S97A 4KLOA 3WK9A 2PFQA 4AT9A 3PW0A 5DG8A 1KSPA 1NOMA 2KHQA 3C1ZA 1BNPA 1NKEA 4B9VA 2BBJA 4LJXA 4PGXA 1V4AA 4GIBA 5KG7A 1TK8A 3H8SA 4F4XA 5KT7A 2EAOA 3IG8A 2LBOA 1BPZA 2ZH4A 2VA8A 4JB3A 5J2GA 3KTQA 1MIVA 5EWGA 2YQEA 4NL9A 4RNMA 3RJJA 1NK5A 1D8LA 2XVTA 4TQSA 1IG6A 1JXEA 4YD1A 4UD5A 2E1FA 4C4RA 4I29A 2YMMA 4EGWA 8ICJA 2K8BB 9ICOA 2E8MA 4AYBC 3OVSA 4PHEA 4J03A 2DFLA 2JH7A 5J0YA 4FZNA 4M6WA 4X4SA 2PBEA 1OXJA 4EX6A 5BOLA 4AT9B 4J9PA 2BZFA 2ODGA 2OHFA 3GILA 4BWJA 5KG6A 4F2RA 1RQLA 2MAXA 2H3VA 3PMNA 1FFVA 3PW2A 1OW5A 4WQKA 1PVRA 1XO0A 3HJ4A 4YMOA 4DSJA 1JUDA 3F2CA 1SV0A 4QZBA 4PJ0U 2EWRA 2H5XA 4TUQA 2DVIA 5HR7A 3SAGA 3QEAZ 3V6JA 2C22A 8ICAA 4O3RA 5ALDA 1NKBA 1Z00A 3HT3A 2CN1A 4OO1J 4Y2SA 4JV2A 3T5JA 1N5WA 1V97A 2W7OA 5J2KA 9ICRA 4FFDA 4DS4A 2R8IA 3MABA 3EF2A 1HIWA 5KFAA 4M6WB 5KFEA 3BZCA 4DL5A 4USAA 2KZMA 4PZNA 1L3TA 1T3QA 3L4PA 1ZQPA 5KG5A 2ZUBA 4DSKA 4NKTA 1A6SA 3NASA 2F1JA 4E80A 1O08A 3L5KA 1ZYQA 5KFJA 3Q8QB 4I2FA 3R9KA 3L9DA 4BUGA 2LYHA 4KN4A 5IIOA 3HJEA 1J2MA 4Q8EA 4O67A 4F8RA 3B0XA 5C5JA 1JXLA 1BPYA 1BVSA 1NJXA 1NK9A 2G08A 4QZAA 2I9GA 2A3VA 4DOBA 5AKGA 1TE2A 2BQRA 2A1JA 3AU2A 4UB1A 3ALRA 3A0HU 4DOCA 8ICXA 1R8CA 2M0NA 5ALJA 7ICRA 2M2TA 1TK5A 3GIIA 2AH5A 2ATLA 2IMWP 2MA1A 2ZH2A 5AIAA 4YMNA 3LVVA 1ZQUA 5AM0A 3UPQA 3E2EA 4JLZA 4UB6U 4A8EA 4QZDA 3KHLA 5B3PA 4JMUA 9ICHA 3E0FA 1JALA 2AGQA 2WAQC 1QTMA 1BPXA 1N62A 2D8CA 2HCFA 3ZI4A 2LMRA 2HI0A 2FCLA 1TAUA 2ZJAA 1VJ7A 4I2IA 3M8RA 5HRBA 4EELA 1GO3F 2WB1F 7ICUA 3LWMA 2LYAA 3D6JA 3RBDA 4RQ3A 1NNLA 4DLEA 5CJ7A 4Y2XA 1ZQDA 4RPZA 2JEJA 4TUSA 4M5DA 5FP0A 2HHWA 5AK4A 3ETLA 4RQ6A 3CNHA 3IRUA 1GPJA 2R8GA 3NTUA 3JZ0A 4NXXA 1WWVA 5KT5A 1QSYA 4FO1A 4F71A 3MDCA 1ZRMA 2KVSA 1S76D 5F9NA 5DGBA 3T79A 9ICIA 2LHTA 3NS1A 1KQQA 2YN4A 4OAIZ 2NRVA 3LYSA 1UPHA 2DR9A 1V85A 1COOA 3CYMA 3KHGA 5L9XA 1XS9D 2DL0A 3C21A 4Y2QA 4P4PA 3H3AA 5F3XB 5AKXA 1NZPA 2VJ4A 4NLKA 1ZD4A 2KIVA 3H0RB 2FLNA 2VIXA 3KKAA 2H3IA 5L1IA 2UVRA 2FPLA 7ICSA 1RPLA 3N28A 1DXSA 2LYBA 5AHXA 2QB0A 1DGSA 5L1KA 4NXTA 4ED3A 5KFQA 4WOYA 3UXOA 3MGVA 1IM4A 3THVA 1U4BA 1KKXA 3IN5A 2DKXA 5ALZA 3H0LB 4NXUA 4RWPA 3KHHA 4F4WA 1N2XA 7ICHA 4NXZA 4Y2UA 2F44A 4GXJA 2GAFD 2KEYA 4OJ5A 1ZQXA 4DFPA 1IV8A 1Q46A 1R8AA 4RPXA 2F2AB 3QUTA 2BCVA 5L1MA 5J2AA 8ICUA 1YT3A 1DGJA 3PSIA 1BPEA 2HMXA 3V7KA 3PR5B 3UM9A 2BDPA 4G3IA 3GZFA 1DK2A 5HRLA 1V9PA 2KFNA 2K4HA 1S9FA 2PMZC 4X4VA 2EANA 3LVWA 3I76A 2RFFA 3PMLA 4P0QA 1A76A 1RYSA 1IIPA 1X9MA 4FO6A 2QB0B 1KFTA 4WC7A 5DQIA 3SEIA 4ICAA 1K1QA 8ICHA 2JHDA 3SQIA 2FPKA 3UXPA 4FHYA 3TI0A 2W11A 3KOOA 1ZXIA 1ZQHA 3M8SA 5ALKA 2K8CB 5KFHA 5IIIA 4RQNA 4RQ4A 3TAPA 2WF5A 2IHMA 3G6XA 2RDJA 4KLEA 4M47A 1NKCA 3EPIA 4X4UA 1F5AA 4WC3A 4WCWA 3HP6A 1PX5A 3LK9A 2QLTA 5J2FA 4C8MA 2HBLA 2VA3A 2K4EA 3F53A 5D49A 4ED7A 4RZRA 5IIKA 3RB6A 3GIJA 4UAUA 5AKKA 4Q45A 4F72A 1FFUA 2AHOB 2ZG6A 2R8JA 2K60A 5ALEA 4P0QB 2OYYA 2HW3A 3ORYA 3JPQA 4EZ6A 8ICEA 3UQ2A 3KBBA 3RFAA 4K4HA 1Q3VA 2PFPA 1Y88A 3ZDAA 5B5EU 3WFSC 3ED5A 4QIWF 2NO4A 2PFOA 3SD7A 4WH5A 1PVQA 2OM6A 3AMZA 1V38A 4C8OA 3HRDD 1XWLA 2C28A 1LKYA 3JPOA 9ICQA 5GTHU 4NLCA 4F92B 4GC6A 3SR6A 2QB1A 1NK6A 4KTQA 8ICSA 3SAFA 4I2JA 1T7PA 2W55A 5D61A 1ZQ1C 1Q8KA 4RNNA 4QZIA 2R8HA 1KN5A 5DKWA 4F5RA 2JEIA 4XQ8A 1ZETA 2EAPA 3N4MB 4PHDA 2NRTA 5D62A 2DBYA 3RJFA 4B9MA 2HVHA 7ICQA 5ALFA 1ZQWA 5G5GA 4O0IA 4IRCA 3N97B 3MDAA 2HOIA 2V4RA 9ICBA 5HHHA 2BE3A 9ICSA 2ZUDA 3JPRA 3Q8RB 4DFJA 2JEFA 2KKPA 4QZ8A 2M2UA 3CRXA 4J9QA 3AQKA 5D63A 3GIKA 1LKYB 5JRTA 3EUB2 1ZQJA 3QUQA 3GU3A 3TANA 3GV8B 4C0ZA 1DOQA 4YD2A 4BWMA 3DEEA 1ZJNA 1ZQZA 4GLXA 1HUOA 4ED8A 1TAQA 3CP8A 5AK3A 5DB8A 1S0OA 4JLXA 3K7DA 4UB8U 1WWUA 5CFTA 2F1IA 3NVVA 3VCBA 1U49A 4HYKA 4QZ9A 2D3DA 2P35A 5ALSA 5DDMA 2NYVA 1ED1A 3M9MB 4KMOB 3H0MB 2VANA 2BPCA 1A0PA 4CDGA 5HRFA 4QJFB 4F50A 4C4TA 4XJEA 1ZRNA 2DRBA 5DBBA 5J2EA 2ZIUA 4PPXA 4Y2YA 5AKIA 4NXVA 4UAWA 8ICRA 2D6FC 4UAYA 1B43A 2WTFA 1Z4OA 5EE0A 1VFGA 2Y9UA 4DO9A 1T3NA 3AUOA 3QXGA 5DG7A 3WU2U 5KFDA 8ICLA 5B66U 5HRHA 5A0LA 4KM5A 3F5EA 1TK0A 1X2IA 3Q8SB 5T14A 1UEUA 1JAJA 4CE6A 2Z7JA 4DSEA 3SI8A 1PK1A 3WKEA 1JN3A 3ISDA 3KZXA 3QUCA 4GFJA 3H39A 4EBCA 2OH2A 1X6IA 4NLGA 9ICVA 5CWRA 2F8LA 2ZIXA 8ICVA 4EV6A 1VDVA 1J97A 4KMUA 3NVWA 4RWQA 3BDPA 4MKPA 4UD4A 4R64A 4LZGA 3C2MA 5KNIA 3RB0A 4DL7A 4O6AA 2BCSA 4ECWA 4FBUA 2ZJ8A 4TURA 2E5SA 3HPOA 2C2DA 2JR5A 4ECXA 3OJSA 2NV3A 5G5HA 1KFDA 1KL9A 2HBMA 1XNSA 4DLGA 4RT3A 4FHXA 1RDFA 2KIWA 4F4YA 4O69A 4KLTA 2IA6A 2W7PA 3WK7A 4NWIA 4EEBA 3MBYA 3V7LA 4QW8A 4O3QA 4YN4A 2HBKA 3M9NB 3PW5A 1PK1B 2FE9A 1TV9A 5KFOA 5DBCA 2HHUA 3MFHA 5J2CA 5CB1A 3OGUA 3ZDBA 5HR9A 4BXOA 3JPNA 1S77D 1M6YA 2PKEA 9ICPA 2ZIXB 4ACOA 2XGPA 4FH3A 4RPYA 4ECVA 4GXKA 2Y9TA 4P4MA 1IXRA 2AGOA 5E79U 4C8NA 3ER9B 3GQCA 2E3TA 3BJYA 4F2SA 1XSNA 4O3MA 5AK5A 3ERCC 8ICKA 4ZOHC 4EP7A 5B3QA 1WG8A 4M0AA 1QQ5A
chains in the Genus database with same CATH topology
1VJ7A 3HW8A 4I2IA 4DSIA 3RTVA 2HHVA 5KG4A 3M8RA 1A77A 3KHRA 4JWNA 2W8KA 2HHXA 3PW4A 8ICMA 4R65A 4YVZA 1TVAA 5HRBA 1LV5A 1ZQNA 4O5CA 1SKSA 5HRGA 7ICUA 4KLFA 2HHUA 3LWMA 4B9UA 5KFUA 2HHTA 4QWAA 3RB3A 3QE9Y 1D9FA 4R63A 4Z6DA 3RBDA 1ZQKA 1S0MA 4RQ3A 4F5NA 4EBJA 4BXOB 2XCAA 4FS2A 4X0BA 5KT3A 4DLEA 4JWMA 5CJ7A 3ZDDA 1ZQDA 4RPZA 2JEJA 1LB2B 7ICEA 3EWAA 4DL3A 9ICTA 4TUSA 1UEVA 3T3FA 4M5DA 2BCQA 3NGDA 2BGWA 2HHWA 4LVSA 3QZ8A 2XGQA 1MQ2A 1WCLA 5KFWA 3ETLA 3FDSA 4UB2A 4QZGA 4RQ6A 4RQ2A 4UB4A 2BR0A 1RXVA 4J9RA 5J0OA 2R8GA 4M9LA 3NTUA 3RH5A 1U48A 2HVIA 2W9BA 2VA2A 1KNYA 3JZ0A 1RZTA 4WC0A 5KT5A 4BGDA 2BCRA 1QSYA 4B9SA 3MDCA 3QZ7A 4LT6A 4M9GA 4ATBB 4C8LA 4WC4A 4EYHB 1S76D 4KLJA 5F9NA 4QW9A 4NLNA 4WBYA 5DGBA 2JZBA 4I2AA 3T5KA 3H4BA 2ZH8A 9ICIA 5J2HA 5KFRA 2AQ4A 1KDHA 7ICKA 2ZTEA 4P2HA 3MR2A 1ZQGA 3RRGA 2J6TA 2NRVA 5J0QA 3IM1A 1EXNA 1NJYA 2DR9A 1COOA 3KHGA 4J9LA 3Q8MA 5L9XA 1XS9D 3RJIA 3C21A 4M9HA 1MIYA 2XY7A 1TFYA 4RQ7A 4P4PA 1HJPA 3TFSA 4IG8A 3H3AA 8ICZA 3G6YA 8ICNA 2OWOA 2B21A 3PVXA 3RJKA 4O5EA 1ZQMA 1NZPA 2ALZA 4NLKA 4XA5A 2BKEA 2MUTA 4I2GA 4YXMA 1ZQLA 1TFWA 4X4NA 2NRXA 1T4GA 2PFNA 4FHPA 2FLNA 9ICUA 1KTQA 2FPMA 5L1IA 2UVRA 4KLGA 2FPLA 2PI4A 4UAZA 7ICSA 3PO5A 4EBKA 1RPLA 2R8KA 5KG3A 2HHPA 1U47A 1H38A 3ZDCA 5KFSA 4WC5A 1DGSA 5L1KA 5HRKA 3UPSA 5CP2A 4ED3A 5KFQA 4B9LA 4QZHA 7ICLA 1ZQBA 4KLQA 3UXOA 1ZQIA 1MIWA 1C7YA 1IM4A 3THVA 1U4BA 4ELUA 2W9BB 4FHWA 4CCHA 4M04A 4P4OA 4JK1A 1PZNA 7ICJA 4RWPA 3KHHA 3QEBZ 4F4WA 1KLNA 4JV1A 7ICHA 4QWBA 4NXZA 3TFRA 1S0VA 2JZBB 1SKWA 4X4OA 2UVWA 5DLGA 4GXJA 2DR8A 4DWIA 3BQ0A 1U9LA 3GIMA 4DL2A 3WFRE 3RAQA 4WC2A 1ZQXA 3MR3A 2V9WA 5KFKA 4DFPA 1R8AA 4RPXA 2KZ3A 4MEXA 2BCVA 5KFTA 3PX0A 5J2AA 1ZQYA 8ICTA 9ICXA 4YXJA 8ICUA 4DQRA 3GV7B 1BPEA 3BQTA 4UB3A 1T8EA 4F3OA 2ZH3A 8ICIA 2C2EA 2FMSA 3WFOA 3V7KA 3OUYB 4MFAA 5CHGA 3PR5B 2BDPA 4S3NA 4RWNA 5D46A 4G3IA 2W9CB 1DK2A 5HRLA 1UA1A 2MUTB 1V9PA 3OHAA 3C5FA 2KFNA 1S9FA 1DK3A 4ATBA 3ISCA 3RH6A 4XUSA 1UT5A 8ICBA 2KTQA 2DR5A 1BNOA 4X4VA 5J0RA 5J0WA 3RR8A 2RFFA 4I2EA 3PMLA 4Q8FA 3PNCA 1A76A 2ZH9A 1RYSA 4X5VA 3V72A 3SZ2A 4AT8A 4TQRA 1S10A 3PX4A 2Y1JA 1X9MA 3PW7A 5KFMA 4PGYA 4EBDA 4FO6A 5DGAA 1KFTA 4WC7A 5DQIA 3LDAA 3PY8A 5KFFA 5HHIA 4NY8A 1L3SA 5KFVA 3H8WA 1K1QA 4I2DA 1SL2A 8ICHA 2ZJ5A 9ICKA 5F2VO 4X4RA 1ZQFA 2BCUA 1ZQCA 2J6UA 4RQ0A 2W9AA 5KG2A 3WFQE 2FMPA 3MGIA 2UVVA 8ICPA 5IINA 5KFNA 2FPKA 3UXPA 4FHYA 2ASLA 3TI0A 5HNKA 2Y1IA 7ICNA 2M2WA 1ZQHA 4RUAA 1SL1A 1AROP 3M8SA 5KFHA 1BGXT 5IIIA 1SL0A 4RQ4A 3BQ2A 3TAPA 2AGPA 1KEJA 4O3NA 9ICMA 1JQRA 3OVBA 4ECTA 3RB4A 5DB9A 1BPDA 2IHMA 3HIYA 4X4PA 1TFRA 3G6XA 2RDJA 4DFMA 4KLEA 5HREA 4M47A 1NKCA 3EPIA 4X4UA 9ICJA 2ZH1A 1F5AA 4WC3A 4WCWA 4AT7B 3HP6A 1KRPA 3AQNA 2KN7A 1PX5A 3LK9A 3IHQB 5J2FA 4C8MA 5KFIA 1UT8A 4QZEA 4EBEA 3EZ5A 1R8BA 4YQWA 2VA3A 4XQ7A 4QZCA 5D49A 2M2VA 4ED7A 4I2BA 4RZRA 5IIKA 1L3UA 4J9MA 3RB6A 3GIJA 4PGQA 2FLLA 4IRKA 4RQ5A 4IQUA 2J6SA 4Q45A 1KFSA 4XRHA 2KFZA 2Q66A 4J9NA 4F5QA 2P6UA 4X0AA 5CA7A 3OSNA 2DPJA 4IQTA 2R8JA 2HW3A 3ORYA 3JPQA 4DL4A 2BPFA 2NRWA 2NRZA 4EZ6A 8ICEA 3OHBA 3UQ2A 1R89A 4K4HA 2PFPA 4DSLA 1ZQTA 2ZH5A 5KT2A 1Y88A 5KFGA 5EOZA 1X9WA 1RXWA 3HWTA 3ZDAA 1Q79A 4FHVA 5J29A 3WFSC 3JPTA 5J2DA 1QLNA 2PFOA 5J0SA 3H8JA 2BQ3A 3H40A 3PR4A 2ZHBA 3M9OB 5KT6A 1N48A 3JYYA 4C8OA 3OUYA 1XWLA 3B0YA 2C28A 3OVSA 2W9CA 3JPOA 2PI5A 4O3PA 1S0NA 9ICQA 4F92B 5DB6A 4GC6A 4KTQA 1NK6A 4YR3A 1NJZA 4KLDA 2V4QA 8ICSA 7ICVA 4I2JA 1XSLA 4KLMA 4E0DA 3AU6A 4EEYA 1T7PA 4J9SA 4IRDA 2BHNA 5KT4A 1ZQOA 8ICQA 1WOTA 3RJGA 7ICMA 3RH4A 4MFFA 1ZQRA 3H38A 2UVUA 4RNNA 4QZIA 2R8HA 4UBCA 1NK0A 3UQ0A 4KLSA 4R8UA 5DKWA 4F5RA 2JEIA 8ICYA 5KFYA 4C8KA 1L3VA 3Q8PB 2BQUA 7ICTA 2RDIA 2O5AA 4YR2A 2DPIA 2IHNA 4JV0A 4XQ8A 3AQLA 4FS1A 1ZETA 1SZPA 1NK7A 5KG0A 2XCPA 3N4MB 4PHDA 2NRTA 2FLPA 1XO1A 4ELTA 3GDXA 3C2KA 3RJFA 1QSLA 4O9MA 7ICOA 5J2JA 1NJWA 4B9MA 3WFPA 2HVHA 4O3OA 4QWDA 4QWCA 4ED1A 7ICQA 1ZQWA 1Q78A 4O0IA 3BQ1A 3C2LA 5BOMA 3ISBA 1X9SA 4IRCA 4ECYA 9ICWA 3N97B 1D9DA 4DQSA 1NK4A 1ZJMA 3C66A 5DG9A 4DOAA 3MDAA 4JUZA 5KG1A 2V4RA 9ICBA 5HHHA 2BE3A 9ICSA 1MQ3A 4DEZA 5HRIA 5J2BA 1YLQA 5J2IA 2ZUDA 3JPRA 3JPPA 3Q8RB 4I28A 5IIMA 4YCXA 4DFJA 2JEFA 8ICCA 4QZ8A 4B9TA 4YR0A 3Q8KA 2HHSA 2M2UA 2DR7A 5KFZA 1Z00B 4J9QA 4F91B 4Z6CA 4ED0A 2I1QA 3AQKA 4J9OA 1S97A 3ZD9A 4IQWA 3GIKA 4KLOA 2PFQA 4AT9A 3PW0A 3H37A 3C1YA 5DG8A 1KSPA 1ZQJA 1NOMA 4ECZA 9ICNA 1UETA 4AT8B 3RAXA 4ED6A 3C1ZA 2BPGA 2ISOA 1JIHA 1BNPA 1NKEA 3TANA 3MR5A 4B9VA 4Q44A 3GV8B 3PO4A 4K4GA 4RU9A 4PGXA 2ZUCA 1V4AA 4EZ9A 1DOQA 4YD2A 3GV5B 4MF2A 1TK8A 5KG7A 4BWMA 3H8SA 4RQ1A 4PHPA 2C2RA 5KT7A 4F4XA 3LQCB 4X4TA 4R8UB 1ZJNA 1ZQZA 3LWLA 4GLXA 1HUOA 1BPZA 4BDPA 2ZH4A 4ED8A 2VA8A 1L5UA 1TAQA 5DB8A 5J2GA 3KTQA 1MIVA 1S0OA 2PXIA 4I2CA 5EWGA 5DQHA 4NM1A 4RNMA 3RJJA 1NK5A 1D8LA 7ICGA 4NLZA 2F1IA 1JMSA 4TQSA 3TAQA 4GC7A 1JXEA 1U49A 4HYKA 4QZ9A 4I2HA 2W9MA 4YD1A 4UD5A 5TZVA 3TQ1A 4I29A 5DDMA 4ECSA 8ICJA 4M9JA 5KFXA 1XU4A 9ICOA 3M9MB 3SV3A 3OJUA 4KLIA 4FH5A 3T5LA 4RNOA 4E7XA 2O1PA 1D8YA 4IQVA 4EYIB 1MC8A 4ECQA 1U45A 4PHEA 4KITB 5EWEA 5DB7A 2DFLA 2IBKA 2VANA 2BPCA 9ICAA 1NO5A 3GFKB 1OU5A 3SV4A 5KTQA 5J0YA 5J0TA 3NYBA 4M6WA 3H39A 4X4SA 2ZH6A 2ASDA 3MFIA 4UBBA 2PBEA 5HMMA 5HRFA 4F50A 5BOLA 2KZZA 4AT9B 7ICFA 3EPGA 2A1JB 4J9PA 2DRBA 5DBBA 5J2EA 2FMQA 2W8LA 4PPXA 2ASJA 2ZHAA 5HC9A 4FBTA 3GILA 8ICWA 4BWJA 5KG6A 4UAWA 4ELVA 3EW9A 4F2RA 4DFKA 8ICRA 4DSFA 2MAXA 4UAYA 1B43A 2WTFA 3PMNA 3PW2A 1SKRA 4YP3A 3V6KA 1ZQSA 3JPSA 5HRDA 1ZQEA 5KFBA 3TARA 1VFGA 3RRHA 3HJ4A 4YMOA 4DSJA 5L1JA 4Z6FA 4YMMA 4DO9A 3Q8LA 4QZBA 1T3NA 3AUOA 4KLUA 5DG7A 4PH5A 2AJQA 3C18A 2H5XA 5KFDA 4TUQA 4ECRA 2P6RA 3AQMA 2DVIA 8ICLA 4KLHA 3QEAZ 2M9NA 3V6JA 5IILA 3OSPA 2C22A 8ICAA 5HRHA 1TK0A 4O3RA 1X2IA 3Q8SB 1NKBA 1Z00A 9ICLA 1JAJA 1UEUA 4R66A 4UQGA 3MGHA 3HT3A 4DQQA 4ZH4A 4DSEA 2XY5A 5DECA 4JV2A 1CEZA 5DDYA 4DL6A 3T5JA 4IR9A 4QZFA 4NKUA 1ZQVA 3SI8A 4GXIA 9ICEA 1JN3A 3ISDA 3OVAA 4WC1A 5J2KA 9ICRA 4AT7A 1B22A 4DS4A 4EBCA 4DF8A 1TKDA 3V6HA 1HUZA 4NLGA 5CWRA 3RJHA 1MSWD 9ICVA 3C23A 3MABA 2R8IA 4I27A 4MEYA 8ICVA 5KFAA 1ZQAA 4KMUA 1ZQQA 3V7JA 4M2YA 1K1SA 4M6WB 5KFEA 4ECUA 3BDPA 4O3SA 4RWQA 4UD4A 4DL5A 2KZMA 4R64A 4LZGA 3K4GA 1L3TA 3C2MA 5J0UA 1ZQPA 4MF8A 5KG5A 2ZUBA 4DL7A 3RB0A 1BPBA 2BCSA 4DSKA 4NKTA 4ECWA 4FBUA 2ZJ8A 5CR0A 3T5HA 2GWSA 5KFCA 4TURA 7ICPA 3HPOA 2C2DA 4Q43A 4ECXA 2F1JA 3OJSA 4E80A 4RWOA 5KFLA 4F5PA 1ZYQA 5KFJA 3Q8QB 2JEGA 4I2FA 1N56A 3L9DA 1KFDA 3C5GA 2LYHA 3ZD8A 5HP4A 3HJ1A 2AQ0A 4KN4A 5IIOA 2P66A 5EWFA 4DLGA 4Q8EA 2ID1A 8ICGA 4RT3A 4F8RA 4FHXA 4NM2A 1CUKA 3B0XA 5C5JA 4QWEA 4F4YA 4LZDA 1JXLA 1BPYA 5DQGA 4UB5A 4K4IA 1BVSA 4ED2A 1NK9A 1NJXA 3RJEA 2IA6A 4KLTA 4QZAA 4IR1A 2F1HA 2I9GA 2AU0A 5D4BA 3MBYA 4DOBA 3V7LA 4QW8A 4O3QA 5KFPA 4YN4A 4WBZA 2BQRA 2A1JA 4TUPA 3AU2A 9ICGA 5L1LA 3M9NB 5J0XA 1Z3EB 5HMLA 4UB1A 3PW5A 4J9KA 4E8FA 1TV9A 3ZDEA 5KFOA 5J0PA 4DOCA 5DBCA 1QSSA 3MFHA 5J2CA 5CB1A 3G6VA 3OGUA 3RBEA 4F5OA 3RR7A 3ZDBA 4BXOA 5HR9A 4DQIA 5IIJA 4F93B 3JPNA 1S77D 1R8CA 7ICRA 2M2TA 1TK5A 1FA0A 9ICPA 3GIIA 3H4DA 3HX0A 4WC6A 2ZH7A 4F4KA 2ATLA 1UA0A 9ICCA 4RUCA 2IMWP 4B9NA 2ZH2A 5DLFA 4YMNA 2XGPA 2ZTDA 4FH3A 3FYHA 5BPCA 4RQ8A 1ZQUA 3UPQA 3EYZA 4PHAA 4RPYA 3SYZA 2XC9A 2ISPA 3E2EA 8ICFA 2NRKA 4YFKA 2Q0ZX 2XO7A 4DQPA 4RT2A 4ECVA 4GXKA 4DS5A 4QZDA 4DF4A 4P4MA 4MFCA 3KHLA 1NK8A 1IXRA 8ICOA 2AGOA 9ICHA 4Z6EA 4YG2A 5F9LA 4C8NA 2AGQA 2HHQA 3GQCA 1XSPA 2ZTCA 5DBAA 1QTMA 7ICIA 3UXNA 5JUMA 3BJYA 4F2SA 1RYRA 1BPXA 1XSNA 4M9NA 2KP7A 4X4QA 3PV8A 1WCNA 4KLLA 9ICFA 5DEDA 1XC9A 8ICKA 4O5KA 4EP7A 3OV7A 2DRAA 4M0AA 4F4ZA 3PX6A 4KN7A 8ICXA 3MR6A 2XY6A 1JX4A 3H7IA 3K75D 1TAUA 2ZJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VJ7 A;  3HW8 A;  4I2I A;  4DSI A;  3RTV A;  2HHV A;  5KG4 A;  3M8R A;  1A77 A;  3KHR A;  4JWN A;  2W8K A;  2HHX A;  3PW4 A;  8ICM A;  4R65 A;  4YVZ A;  1TVA A;  5HRB A;  1LV5 A;  1ZQN A;  4O5C A;  1SKS A;  5HRG A;  7ICU A;  4KLF A;  2HHU A;  3LWM A;  4B9U A;  5KFU A;  2HHT A;  4QWA A;  3RB3 A;  3QE9 Y;  1D9F A;  4R63 A;  4Z6D A;  3RBD A;  1ZQK A;  1S0M A;  4RQ3 A;  4F5N A;  4EBJ A;  4BXO B;  2XCA A;  4FS2 A;  4X0B A;  5KT3 A;  4DLE A;  4JWM A;  5CJ7 A;  3ZDD A;  1ZQD A;  4RPZ A;  2JEJ A;  1LB2 B;  7ICE A;  3EWA A;  4DL3 A;  9ICT A;  4TUS A;  1UEV A;  3T3F A;  4M5D A;  2BCQ A;  3NGD A;  2BGW A;  2HHW A;  4LVS A;  3QZ8 A;  2XGQ A;  1MQ2 A;  1WCL A;  5KFW A;  3ETL A;  3FDS A;  4UB2 A;  4QZG A;  4RQ6 A;  4RQ2 A;  4UB4 A;  2BR0 A;  1RXV A;  4J9R A;  5J0O A;  2R8G A;  4M9L A;  3NTU A;  3RH5 A;  1U48 A;  2HVI A;  2W9B A;  2VA2 A;  1KNY A;  3JZ0 A;  1RZT A;  4WC0 A;  5KT5 A;  4BGD A;  2BCR A;  1QSY A;  4B9S A;  3MDC A;  3QZ7 A;  4LT6 A;  4M9G A;  4ATB B;  4C8L A;  4WC4 A;  4EYH B;  1S76 D;  4KLJ A;  5F9N A;  4QW9 A;  4NLN A;  4WBY A;  5DGB A;  2JZB A;  4I2A A;  3T5K A;  3H4B A;  2ZH8 A;  9ICI A;  5J2H A;  5KFR A;  2AQ4 A;  1KDH A;  7ICK A;  2ZTE A;  4P2H A;  3MR2 A;  1ZQG A;  3RRG A;  2J6T A;  2NRV A;  5J0Q A;  3IM1 A;  1EXN A;  1NJY A;  2DR9 A;  1COO A;  3KHG A;  4J9L A;  3Q8M A;  5L9X A;  1XS9 D;  3RJI A;  3C21 A;  4M9H A;  1MIY A;  2XY7 A;  1TFY A;  4RQ7 A;  4P4P A;  1HJP A;  3TFS A;  4IG8 A;  3H3A A;  8ICZ A;  3G6Y A;  8ICN A;  2OWO A;  2B21 A;  3PVX A;  3RJK A;  4O5E A;  1ZQM A;  1NZP A;  2ALZ A;  4NLK A;  4XA5 A;  2BKE A;  2MUT A;  4I2G A;  4YXM A;  1ZQL A;  1TFW A;  4X4N A;  2NRX A;  1T4G A;  2PFN A;  4FHP A;  2FLN A;  9ICU A;  1KTQ A;  2FPM A;  5L1I A;  2UVR A;  4KLG A;  2FPL A;  2PI4 A;  4UAZ A;  7ICS A;  3PO5 A;  4EBK A;  1RPL A;  2R8K A;  5KG3 A;  2HHP A;  1U47 A;  1H38 A;  3ZDC A;  5KFS A;  4WC5 A;  1DGS A;  5L1K A;  5HRK A;  3UPS A;  5CP2 A;  4ED3 A;  5KFQ A;  4B9L A;  4QZH A;  7ICL A;  1ZQB A;  4KLQ A;  3UXO A;  1ZQI A;  1MIW A;  1C7Y A;  1IM4 A;  3THV A;  1U4B A;  4ELU A;  2W9B B;  4FHW A;  4CCH A;  4M04 A;  4P4O A;  4JK1 A;  1PZN A;  7ICJ A;  4RWP A;  3KHH A;  3QEB Z;  4F4W A;  1KLN A;  4JV1 A;  7ICH A;  4QWB A;  4NXZ A;  3TFR A;  1S0V A;  2JZB B;  1SKW A;  4X4O A;  2UVW A;  5DLG A;  4GXJ A;  2DR8 A;  4DWI A;  3BQ0 A;  1U9L A;  3GIM A;  4DL2 A;  3WFR E;  3RAQ A;  4WC2 A;  1ZQX A;  3MR3 A;  2V9W A;  5KFK A;  4DFP A;  1R8A A;  4RPX A;  2KZ3 A;  4MEX A;  2BCV A;  5KFT A;  3PX0 A;  5J2A A;  1ZQY A;  8ICT A;  9ICX A;  4YXJ A;  8ICU A;  4DQR A;  3GV7 B;  1BPE A;  3BQT A;  4UB3 A;  1T8E A;  4F3O A;  2ZH3 A;  8ICI A;  2C2E A;  2FMS A;  3WFO A;  3V7K A;  3OUY B;  4MFA A;  5CHG A;  3PR5 B;  2BDP A;  4S3N A;  4RWN A;  5D46 A;  4G3I A;  2W9C B;  1DK2 A;  5HRL A;  1UA1 A;  2MUT B;  1V9P A;  3OHA A;  3C5F A;  2KFN A;  1S9F A;  1DK3 A;  4ATB A;  3ISC A;  3RH6 A;  4XUS A;  1UT5 A;  8ICB A;  2KTQ A;  2DR5 A;  1BNO A;  4X4V A;  5J0R A;  5J0W A;  3RR8 A;  2RFF A;  4I2E A;  3PML A;  4Q8F A;  3PNC A;  1A76 A;  2ZH9 A;  1RYS A;  4X5V A;  3V72 A;  3SZ2 A;  4AT8 A;  4TQR A;  1S10 A;  3PX4 A;  2Y1J A;  1X9M A;  3PW7 A;  5KFM A;  4PGY A;  4EBD A;  4FO6 A;  5DGA A;  1KFT A;  4WC7 A;  5DQI A;  3LDA A;  3PY8 A;  5KFF A;  5HHI A;  4NY8 A;  1L3S A;  5KFV A;  3H8W A;  1K1Q A;  4I2D A;  1SL2 A;  8ICH A;  2ZJ5 A;  9ICK A;  5F2V O;  4X4R A;  1ZQF A;  2BCU A;  1ZQC A;  2J6U A;  4RQ0 A;  2W9A A;  5KG2 A;  3WFQ E;  2FMP A;  3MGI A;  2UVV A;  8ICP A;  5IIN A;  5KFN A;  2FPK A;  3UXP A;  4FHY A;  2ASL A;  3TI0 A;  5HNK A;  2Y1I A;  7ICN A;  2M2W A;  1ZQH A;  4RUA A;  1SL1 A;  1ARO P;  3M8S A;  5KFH A;  1BGX T;  5III A;  1SL0 A;  4RQ4 A;  3BQ2 A;  3TAP A;  2AGP A;  1KEJ A;  4O3N A;  9ICM A;  1JQR A;  3OVB A;  4ECT A;  3RB4 A;  5DB9 A;  1BPD A;  2IHM A;  3HIY A;  4X4P A;  1TFR A;  3G6X A;  2RDJ A;  4DFM A;  4KLE A;  5HRE A;  4M47 A;  1NKC A;  3EPI A;  4X4U A;  9ICJ A;  2ZH1 A;  1F5A A;  4WC3 A;  4WCW A;  4AT7 B;  3HP6 A;  1KRP A;  3AQN A;  2KN7 A;  1PX5 A;  3LK9 A;  3IHQ B;  5J2F A;  4C8M A;  5KFI A;  1UT8 A;  4QZE A;  4EBE A;  3EZ5 A;  1R8B A;  4YQW A;  2VA3 A;  4XQ7 A;  4QZC A;  5D49 A;  2M2V A;  4ED7 A;  4I2B A;  4RZR A;  5IIK A;  1L3U A;  4J9M A;  3RB6 A;  3GIJ A;  4PGQ A;  2FLL A;  4IRK A;  4RQ5 A;  4IQU A;  2J6S A;  4Q45 A;  1KFS A;  4XRH A;  2KFZ A;  2Q66 A;  4J9N A;  4F5Q A;  2P6U A;  4X0A A;  5CA7 A;  3OSN A;  2DPJ A;  4IQT A;  2R8J A;  2HW3 A;  3ORY A;  3JPQ A;  4DL4 A;  2BPF A;  2NRW A;  2NRZ A;  4EZ6 A;  8ICE A;  3OHB A;  3UQ2 A;  1R89 A;  4K4H A;  2PFP A;  4DSL A;  1ZQT A;  2ZH5 A;  5KT2 A;  1Y88 A;  5KFG A;  5EOZ A;  1X9W A;  1RXW A;  3HWT A;  3ZDA A;  1Q79 A;  4FHV A;  5J29 A;  3WFS C;  3JPT A;  5J2D A;  1QLN A;  2PFO A;  5J0S A;  3H8J A;  2BQ3 A;  3H40 A;  3PR4 A;  2ZHB A;  3M9O B;  5KT6 A;  1N48 A;  3JYY A;  4C8O A;  3OUY A;  1XWL A;  3B0Y A;  2C28 A;  3OVS A;  2W9C A;  3JPO A;  2PI5 A;  4O3P A;  1S0N A;  9ICQ A;  4F92 B;  5DB6 A;  4GC6 A;  4KTQ A;  1NK6 A;  4YR3 A;  1NJZ A;  4KLD A;  2V4Q A;  8ICS A;  7ICV A;  4I2J A;  1XSL A;  4KLM A;  4E0D A;  3AU6 A;  4EEY A;  1T7P A;  4J9S A;  4IRD A;  2BHN A;  5KT4 A;  1ZQO A;  8ICQ A;  1WOT A;  3RJG A;  7ICM A;  3RH4 A;  4MFF A;  1ZQR A;  3H38 A;  2UVU A;  4RNN A;  4QZI A;  2R8H A;  4UBC A;  1NK0 A;  3UQ0 A;  4KLS A;  4R8U A;  5DKW A;  4F5R A;  2JEI A;  8ICY A;  5KFY A;  4C8K A;  1L3V A;  3Q8P B;  2BQU A;  7ICT A;  2RDI A;  2O5A A;  4YR2 A;  2DPI A;  2IHN A;  4JV0 A;  4XQ8 A;  3AQL A;  4FS1 A;  1ZET A;  1SZP A;  1NK7 A;  5KG0 A;  2XCP A;  3N4M B;  4PHD A;  2NRT A;  2FLP A;  1XO1 A;  4ELT A;  3GDX A;  3C2K A;  3RJF A;  1QSL A;  4O9M A;  7ICO A;  5J2J A;  1NJW A;  4B9M A;  3WFP A;  2HVH A;  4O3O A;  4QWD A;  4QWC A;  4ED1 A;  7ICQ A;  1ZQW A;  1Q78 A;  4O0I A;  3BQ1 A;  3C2L A;  5BOM A;  3ISB A;  1X9S A;  4IRC A;  4ECY A;  9ICW A;  3N97 B;  1D9D A;  4DQS A;  1NK4 A;  1ZJM A;  3C66 A;  5DG9 A;  4DOA A;  3MDA A;  4JUZ A;  5KG1 A;  2V4R A;  9ICB A;  5HHH A;  2BE3 A;  9ICS A;  1MQ3 A;  4DEZ A;  5HRI A;  5J2B A;  1YLQ A;  5J2I A;  2ZUD A;  3JPR A;  3JPP A;  3Q8R B;  4I28 A;  5IIM A;  4YCX A;  4DFJ A;  2JEF A;  8ICC A;  4QZ8 A;  4B9T A;  4YR0 A;  3Q8K A;  2HHS A;  2M2U A;  2DR7 A;  5KFZ A;  1Z00 B;  4J9Q A;  4F91 B;  4Z6C A;  4ED0 A;  2I1Q A;  3AQK A;  4J9O A;  1S97 A;  3ZD9 A;  4IQW A;  3GIK A;  4KLO A;  2PFQ A;  4AT9 A;  3PW0 A;  3H37 A;  3C1Y A;  5DG8 A;  1KSP A;  1ZQJ A;  1NOM A;  4ECZ A;  9ICN A;  1UET A;  4AT8 B;  3RAX A;  4ED6 A;  3C1Z A;  2BPG A;  2ISO A;  1JIH A;  1BNP A;  1NKE A;  3TAN A;  3MR5 A;  4B9V A;  4Q44 A;  3GV8 B;  3PO4 A;  4K4G A;  4RU9 A;  4PGX A;  2ZUC A;  1V4A A;  4EZ9 A;  1DOQ A;  4YD2 A;  3GV5 B;  4MF2 A;  1TK8 A;  5KG7 A;  4BWM A;  3H8S A;  4RQ1 A;  4PHP A;  2C2R A;  5KT7 A;  4F4X A;  3LQC B;  4X4T A;  4R8U B;  1ZJN A;  1ZQZ A;  3LWL A;  4GLX A;  1HUO A;  1BPZ A;  4BDP A;  2ZH4 A;  4ED8 A;  2VA8 A;  1L5U A;  1TAQ A;  5DB8 A;  5J2G A;  3KTQ A;  1MIV A;  1S0O A;  2PXI A;  4I2C A;  5EWG A;  5DQH A;  4NM1 A;  4RNM A;  3RJJ A;  1NK5 A;  1D8L A;  7ICG A;  4NLZ A;  2F1I A;  1JMS A;  4TQS A;  3TAQ A;  4GC7 A;  1JXE A;  1U49 A;  4HYK A;  4QZ9 A;  4I2H A;  2W9M A;  4YD1 A;  4UD5 A;  5TZV A;  3TQ1 A;  4I29 A;  5DDM A;  4ECS A;  8ICJ A;  4M9J A;  5KFX A;  1XU4 A;  9ICO A;  3M9M B;  3SV3 A;  3OJU A;  4KLI A;  4FH5 A;  3T5L A;  4RNO A;  4E7X A;  2O1P A;  1D8Y A;  4IQV A;  4EYI B;  1MC8 A;  4ECQ A;  1U45 A;  4PHE A;  4KIT B;  5EWE A;  5DB7 A;  2DFL A;  2IBK A;  2VAN A;  2BPC A;  9ICA A;  1NO5 A;  3GFK B;  1OU5 A;  3SV4 A;  5KTQ A;  5J0Y A;  5J0T A;  3NYB A;  4M6W A;  3H39 A;  4X4S A;  2ZH6 A;  2ASD A;  3MFI A;  4UBB A;  2PBE A;  5HMM A;  5HRF A;  4F50 A;  5BOL A;  2KZZ A;  4AT9 B;  7ICF A;  3EPG A;  2A1J B;  4J9P A;  2DRB A;  5DBB A;  5J2E A;  2FMQ A;  2W8L A;  4PPX A;  2ASJ A;  2ZHA A;  5HC9 A;  4FBT A;  3GIL A;  8ICW A;  4BWJ A;  5KG6 A;  4UAW A;  4ELV A;  3EW9 A;  4F2R A;  4DFK A;  8ICR A;  4DSF A;  2MAX A;  4UAY A;  1B43 A;  2WTF A;  3PMN A;  3PW2 A;  1SKR A;  4YP3 A;  3V6K A;  1ZQS A;  3JPS A;  5HRD A;  1ZQE A;  5KFB A;  3TAR A;  1VFG A;  3RRH A;  3HJ4 A;  4YMO A;  4DSJ A;  5L1J A;  4Z6F A;  4YMM A;  4DO9 A;  3Q8L A;  4QZB A;  1T3N A;  3AUO A;  4KLU A;  5DG7 A;  4PH5 A;  2AJQ A;  3C18 A;  2H5X A;  5KFD A;  4TUQ A;  4ECR A;  2P6R A;  3AQM A;  2DVI A;  8ICL A;  4KLH A;  3QEA Z;  2M9N A;  3V6J A;  5IIL A;  3OSP A;  2C22 A;  8ICA A;  5HRH A;  1TK0 A;  4O3R A;  1X2I A;  3Q8S B;  1NKB A;  1Z00 A;  9ICL A;  1JAJ A;  1UEU A;  4R66 A;  4UQG A;  3MGH A;  3HT3 A;  4DQQ A;  4ZH4 A;  4DSE A;  2XY5 A;  5DEC A;  4JV2 A;  1CEZ A;  5DDY A;  4DL6 A;  3T5J A;  4IR9 A;  4QZF A;  4NKU A;  1ZQV A;  3SI8 A;  4GXI A;  9ICE A;  1JN3 A;  3ISD A;  3OVA A;  4WC1 A;  5J2K A;  9ICR A;  4AT7 A;  1B22 A;  4DS4 A;  4EBC A;  4DF8 A;  1TKD A;  3V6H A;  1HUZ A;  4NLG A;  5CWR A;  3RJH A;  1MSW D;  9ICV A;  3C23 A;  3MAB A;  2R8I A;  4I27 A;  4MEY A;  8ICV A;  5KFA A;  1ZQA A;  4KMU A;  1ZQQ A;  3V7J A;  4M2Y A;  1K1S A;  4M6W B;  5KFE A;  4ECU A;  3BDP A;  4O3S A;  4RWQ A;  4UD4 A;  4DL5 A;  2KZM A;  4R64 A;  4LZG A;  3K4G A;  1L3T A;  3C2M A;  5J0U A;  1ZQP A;  4MF8 A;  5KG5 A;  2ZUB A;  4DL7 A;  3RB0 A;  1BPB A;  2BCS A;  4DSK A;  4NKT A;  4ECW A;  4FBU A;  2ZJ8 A;  5CR0 A;  3T5H A;  2GWS A;  5KFC A;  4TUR A;  7ICP A;  3HPO A;  2C2D A;  4Q43 A;  4ECX A;  2F1J A;  3OJS A;  4E80 A;  4RWO A;  5KFL A;  4F5P A;  1ZYQ A;  5KFJ A;  3Q8Q B;  2JEG A;  4I2F A;  1N56 A;  3L9D A;  1KFD A;  3C5G A;  2LYH A;  3ZD8 A;  5HP4 A;  3HJ1 A;  2AQ0 A;  4KN4 A;  5IIO A;  2P66 A;  5EWF A;  4DLG A;  4Q8E A;  2ID1 A;  8ICG A;  4RT3 A;  4F8R A;  4FHX A;  4NM2 A;  1CUK A;  3B0X A;  5C5J A;  4QWE A;  4F4Y A;  4LZD A;  1JXL A;  1BPY A;  5DQG A;  4UB5 A;  4K4I A;  1BVS A;  4ED2 A;  1NK9 A;  1NJX A;  3RJE A;  2IA6 A;  4KLT A;  4QZA A;  4IR1 A;  2F1H A;  2I9G A;  2AU0 A;  5D4B A;  3MBY A;  4DOB A;  3V7L A;  4QW8 A;  4O3Q A;  5KFP A;  4YN4 A;  4WBZ A;  2BQR A;  2A1J A;  4TUP A;  3AU2 A;  9ICG A;  5L1L A;  3M9N B;  5J0X A;  1Z3E B;  5HML A;  4UB1 A;  3PW5 A;  4J9K A;  4E8F A;  1TV9 A;  3ZDE A;  5KFO A;  5J0P A;  4DOC A;  5DBC A;  1QSS A;  3MFH A;  5J2C A;  5CB1 A;  3G6V A;  3OGU A;  3RBE A;  4F5O A;  3RR7 A;  3ZDB A;  4BXO A;  5HR9 A;  4DQI A;  5IIJ A;  4F93 B;  3JPN A;  1S77 D;  1R8C A;  7ICR A;  2M2T A;  1TK5 A;  1FA0 A;  9ICP A;  3GII A;  3H4D A;  3HX0 A;  4WC6 A;  2ZH7 A;  4F4K A;  2ATL A;  1UA0 A;  9ICC A;  4RUC A;  2IMW P;  4B9N A;  2ZH2 A;  5DLF A;  4YMN A;  2XGP A;  2ZTD A;  4FH3 A;  3FYH A;  5BPC A;  4RQ8 A;  1ZQU A;  3UPQ A;  3EYZ A;  4PHA A;  4RPY A;  3SYZ A;  2XC9 A;  2ISP A;  3E2E A;  8ICF A;  2NRK A;  4YFK A;  2Q0Z X;  2XO7 A;  4DQP A;  4RT2 A;  4ECV A;  4GXK A;  4DS5 A;  4QZD A;  4DF4 A;  4P4M A;  4MFC A;  3KHL A;  1NK8 A;  1IXR A;  8ICO A;  2AGO A;  9ICH A;  4Z6E A;  4YG2 A;  5F9L A;  4C8N A;  2AGQ A;  2HHQ A;  3GQC A;  1XSP A;  2ZTC A;  5DBA A;  1QTM A;  7ICI A;  3UXN A;  5JUM A;  3BJY A;  4F2S A;  1RYR A;  1BPX A;  1XSN A;  4M9N A;  2KP7 A;  4X4Q A;  3PV8 A;  1WCN A;  4KLL A;  9ICF A;  5DED A;  1XC9 A;  8ICK A;  4O5K A;  4EP7 A;  3OV7 A;  2DRA A;  4M0A A;  4F4Z A;  3PX6 A;  4KN7 A;  8ICX A;  3MR6 A;  2XY6 A;  1JX4 A;  3H7I A;  3K75 D;  1TAU A;  2ZJA A; 
#chains in the Genus database with same CATH topology
 4DSI A;  3KHR A;  1A77 A;  2E8N A;  2W8K A;  3PW4 A;  4R65 A;  4YVZ A;  1LV5 A;  1ZQN A;  5KFU A;  2HHT A;  3RB3 A;  3QE9 Y;  3PSP A;  1D9F A;  5J8Y A;  4Z6D A;  4RQM A;  4F5N A;  4X0B A;  2K8A A;  4BXO B;  4I0U A;  3M6K A;  4JWM A;  3QU7 A;  3EWA A;  4LEY A;  4DL3 A;  2XI9 A;  1COK A;  2BCQ A;  4LVS A;  1MQ2 A;  1WCL A;  3FDS A;  1Q79 A;  1RXV A;  4M9L A;  4C7Z A;  1U48 A;  2FDR A;  4WC0 A;  1QQ6 A;  2RRD A;  4BGD A;  4EYH B;  3NVY A;  4KLJ A;  3BS5 B;  4Y2R A;  4QW9 A;  4I2A A;  2ZH8 A;  5J2H A;  4IL6 U;  7ICK A;  3MR2 A;  1ZQG A;  1N63 A;  3RRG A;  5J0Q A;  3IM1 A;  4FE3 A;  3NWI A;  3RJI A;  1DRG A;  1HJP A;  3TFS A;  3N7R C;  2KJ5 A;  2DGZ A;  8ICN A;  2OWO A;  2B21 A;  3RJK A;  4O5E A;  2ALZ A;  4XA5 A;  1RG6 A;  4I2G A;  4YXM A;  2XIC A;  2W43 A;  1MN8 A;  3CK6 A;  3HKZ F;  2DUY A;  3IP4 B;  1SGG A;  1C20 A;  2PI4 A;  5HR6 A;  1H38 A;  3ZDC A;  5KFS A;  3K1R B;  3UPS A;  4B9L A;  7ICL A;  1ZQB A;  5GTI U;  1C7Y A;  2WF8 A;  2IOF K;  3N7P D;  4FHW A;  2IOH A;  4M04 A;  3OTQ A;  1PZN A;  5AK6 A;  3F2B A;  4KX5 A;  5AIB A;  2E8O A;  2UVW A;  3BQ0 A;  1U9L A;  4DL2 A;  3MR3 A;  4EED A;  2DWQ A;  5KFT A;  1ZQY A;  1RQN A;  4YXJ A;  3GV7 B;  3BQT A;  3WFO A;  3OUY B;  4MFA A;  5CHG A;  4S3N A;  5D46 A;  2B4V A;  5AKY A;  1DK3 A;  3ISC A;  8ICB A;  4XUS A;  2KTQ A;  3D2Q A;  5J0W A;  1FO4 A;  4I2E A;  3PNC A;  2KSO A;  5KFM A;  4PGY A;  2B51 A;  2DF4 B;  5DGA A;  4NXW A;  5KFF A;  5HHI A;  1SL2 A;  2CXY A;  2ZIV A;  4X4R A;  1ZQC A;  5ALQ A;  3WFQ E;  4OJO A;  2UVV A;  5ALT A;  5IIN A;  5KFN A;  3JCF A;  4O68 A;  1Z1B A;  1BGX T;  9ICM A;  3BQ2 A;  2AGP A;  3OVB A;  5CFU A;  2HBJ A;  4CNQ A;  2YMP A;  4PL2 A;  4CRX A;  3IHQ B;  4K97 A;  4Y2V A;  1R8B A;  4XQ7 A;  3EZ5 A;  2KJ8 A;  2M2V A;  2E8P A;  4I2B A;  1L3U A;  4PGQ A;  3DDH A;  4QNL A;  3L3F X;  3QU9 A;  5AI6 A;  4LEW A;  2Q66 A;  2ZXI A;  2DPJ A;  2JRZ A;  2KSO B;  1Q3U A;  2NRW A;  2LM1 A;  5JTI A;  2YTU A;  2G0A A;  3QYP A;  4FHV A;  5J29 A;  1CI4 A;  2ZIV B;  2BQ3 A;  2QAR A;  2G5I B;  2LKY A;  5KT6 A;  1N48 A;  2CPR A;  3C66 A;  4AT8 A;  2KG5 A;  4YR3 A;  1NJZ A;  4E0D A;  2Q4T A;  1J2N A;  1WOT A;  7ICM A;  3H38 A;  2UVU A;  4UBC A;  4KLS A;  3ONN A;  4R8U A;  2IHO A;  1S5L U;  5KFY A;  4C8K A;  2RDI A;  2KNJ A;  3KD3 A;  4JV0 A;  1KW4 A;  5KG0 A;  2FLP A;  1XO1 A;  4IC9 A;  3S6J A;  3TAD A;  3GDX A;  3UMB A;  4UAS A;  1QSL A;  3M1Y A;  3D2S A;  3WFP A;  4O3O A;  4QWC A;  3BQ1 A;  1QCK A;  5AKZ A;  5BOM A;  1X9S A;  2KMD A;  4DQS A;  1NK4 A;  2AXT U;  5DG9 A;  3WKA A;  2KHV A;  4DEZ A;  5HRI A;  1Z19 A;  2E1E A;  3Q8K A;  2HHS A;  2QAR B;  5KFZ A;  2Y0S C;  2YY6 A;  4F91 B;  4Z6C A;  4ED0 A;  4J9O A;  3ZD9 A;  4IQW A;  3PSF A;  4AYB F;  3KZI U;  3H37 A;  1UET A;  2K4P A;  4AT8 B;  4ECZ A;  3RAX A;  3OWG A;  1X6J A;  4OCZ A;  1JIH A;  1Z1V A;  4Q44 A;  3PO4 A;  4K4G A;  4EZ9 A;  4RQ1 A;  2RHF A;  2O6K A;  4PHP A;  3LQC B;  4X4T A;  5ALG A;  4R8U B;  4OD0 A;  4BDP A;  1L5U A;  1QH9 A;  4EEN A;  3WK6 A;  2YB4 A;  7ICG A;  1UCV A;  5JTG A;  3TAQ A;  4I2H A;  5ALO A;  2W9M A;  5TZV A;  2EAM A;  4ECS A;  5KFX A;  1XU4 A;  3SV3 A;  4FH5 A;  4KLI A;  4E7X A;  2O1P A;  1D8Y A;  4IQV A;  2EQY A;  1MC8 A;  4EYI B;  4ECQ A;  2IBK A;  4FHP A;  5EWE A;  1NO5 A;  5ALX A;  3GFK B;  3SV4 A;  5KTQ A;  5AIC A;  2ASD A;  3MFI A;  4UBB A;  5HMM A;  3WK8 A;  2KZZ A;  3EPG A;  4UAT A;  2FMQ A;  4FBT A;  8ICW A;  2K4I A;  3AQF A;  4DFK A;  3V6K A;  1ZQS A;  5HRD A;  3QNM A;  1ZQE A;  3TAR A;  1K5O A;  4Z6F A;  2YMQ A;  4YMM A;  3Q8L A;  4KLU A;  1SIJ A;  4PH5 A;  3C18 A;  2P6R A;  3AQM A;  5IIL A;  3OSP A;  2HDO A;  4UQG A;  2W3S A;  4ZH4 A;  2WFA A;  5DEC A;  2I5H A;  1CEZ A;  5ALU A;  4DL6 A;  1ZQV A;  5KAI U;  2RP5 A;  4GXI A;  9ICE A;  3OVA A;  4WC1 A;  1B22 A;  4DF8 A;  3NRW A;  4B6J A;  3V6H A;  1TKD A;  1HUZ A;  3RJH A;  1MSW D;  5ALM A;  1ZQA A;  1ZQQ A;  3NVZ A;  1K1S A;  4ECU A;  1VLB A;  5J0U A;  1RM6 C;  1BPB A;  1X40 A;  5CRX A;  2GWS A;  5KFC A;  7ICP A;  5ALR A;  2W54 A;  4RWO A;  4F5P A;  1CRX A;  3C5G A;  5HP4 A;  2AQ0 A;  2P66 A;  3A0B U;  5EWF A;  2WF7 A;  1JRP A;  2ID1 A;  3SAH A;  2WAQ F;  4N7R A;  1N5X A;  1SV4 A;  1CUK A;  4K4I A;  1URJ A;  4ED2 A;  1ZD3 A;  1L8O A;  2F76 X;  2F1H A;  2AU0 A;  9ICG A;  5AKE A;  4NLB A;  5J0X A;  5HML A;  3AEV A;  4E8F A;  2ZXH A;  5J0P A;  9ICA A;  3G6V A;  3RBE A;  3RR7 A;  1SXE A;  4F5O A;  4F93 B;  1FA0 A;  2ZH7 A;  3H4D A;  3HX0 A;  4G9B A;  9ICC A;  4B9N A;  5ALN A;  4NJ8 A;  5DLF A;  2MRL A;  2ZTD A;  3FYH A;  4RQ8 A;  4PHA A;  3SYZ A;  2ISP A;  2XC9 A;  2NRK A;  4YFK A;  3N7S C;  4RT2 A;  4DS5 A;  4MFC A;  1NK8 A;  2BBH A;  2HHQ A;  1RYR A;  1WUD A;  2ES6 A;  5AM3 A;  3PV8 A;  4NL9 C;  4KLL A;  5DED A;  4K9B A;  5KAF U;  3H8M A;  2RQ5 A;  3HIL A;  2CRX A;  4KN7 A;  2WHE A;  1JX4 A;  3H7I A;  4O9M A;  2YX8 A;  3HW8 A;  3D2N A;  3RTV A;  2HHX A;  4JWN A;  1NZB A;  2HSZ A;  4O5C A;  3MC1 A;  4KLF A;  2JV3 A;  3NRZ A;  3J81 j;  4OAG A;  4EBJ A;  1S0M A;  2XCA A;  5KT3 A;  2WF9 A;  1LB2 B;  1UEV A;  5AM5 A;  3NGD A;  3QZ8 A;  3QU2 A;  5KFW A;  2BR0 A;  4RQ2 A;  4UB4 A;  4J9R A;  4PL1 A;  2JMG A;  3RH5 A;  2HVI A;  2W9B A;  3I1Y A;  1RZT A;  2BCR A;  4NV0 A;  4LT6 A;  4ATB B;  4C8L A;  4WC4 A;  3NVO A;  1SV0 C;  2JZB A;  3T5K A;  3H4B A;  2AQ4 A;  2J6T A;  3WKB A;  4J9L A;  3Q8M A;  2WB1 C;  2XY7 A;  1TFY A;  8ICZ A;  3G6Y A;  2MUT A;  1ZQL A;  2NRX A;  1T4G A;  1SB3 C;  3CW2 C;  2YML A;  9ICU A;  4KLG A;  2KK0 A;  4UAZ A;  4EBK A;  3AQE A;  5KG3 A;  2HHP A;  1U47 A;  2PMZ F;  4WC5 A;  4QZH A;  2A19 A;  4KLQ A;  1ZQI A;  1MIW A;  2W9B B;  5ALH A;  4P4O A;  4MHV A;  7ICJ A;  2L5Y A;  1KLN A;  3FM9 A;  2JZB B;  4X4O A;  3WFR E;  3OPX A;  2G5H B;  5KL8 B;  8ICT A;  3PX0 A;  4PZO A;  9ICX A;  4DQR A;  5CFS A;  3IV6 A;  3QU5 A;  4F3O A;  2ZH3 A;  8ICI A;  3AN1 A;  2FMS A;  4UW9 A;  2VKQ A;  1YZ6 A;  2HOQ A;  2W9C B;  1UA1 A;  2MUT B;  3C5F A;  3F5A A;  1UT5 A;  1BNO A;  5J0R A;  3RR8 A;  3BS5 A;  3BS7 A;  1RYU A;  3QX7 A;  5AKJ A;  2ZH9 A;  3SZ2 A;  1S10 A;  2Y1J A;  4EBD A;  1T94 A;  3LDA A;  1L3S A;  4IS7 A;  5KFV A;  4I2D A;  1X42 A;  2ZJ5 A;  2BCU A;  2N1R A;  4RQ0 A;  1SWV A;  2W9A A;  3PST A;  5KG2 A;  1OUQ A;  3MGI A;  1ZD2 P;  2M2W A;  2GOL A;  1SL1 A;  3SMV A;  5K4L A;  1Z4N A;  1JQR A;  1KEJ A;  2KJ9 A;  3RB4 A;  5DB9 A;  4X4P A;  4DFM A;  9ICJ A;  3AQN A;  5AI5 A;  5KFI A;  4YQW A;  3IDW A;  4QZC A;  4J9M A;  1QQ7 A;  2FLL A;  4IRK A;  4RQ5 A;  4IQU A;  4XRH A;  2KFZ A;  4J9N A;  2P6U A;  5CA7 A;  3OSN A;  4IQT A;  4P0P A;  4DL4 A;  2NRZ A;  1R89 A;  3OHB A;  4US9 A;  4DSL A;  1ZQT A;  1F44 A;  4US8 A;  1RXW A;  3HWT A;  2GH1 A;  1N61 A;  3JPT A;  5J0S A;  3H8J A;  1KBU A;  1X66 A;  3WKD A;  3M9O B;  3JYY A;  3OUY A;  1UHU A;  3B0Y A;  4FZM A;  4UAR A;  1S0N A;  4KLD A;  5C0Y A;  1SZH A;  7ICV A;  3AU6 A;  4EEY A;  4J9S A;  4K9A A;  2BHN A;  5KT4 A;  1ZQO A;  3RJG A;  3RH4 A;  4MFF A;  1ZQR A;  1L7O A;  4Y2J A;  1PUZ A;  3UQ0 A;  2DQN B;  4EX7 A;  1L3V A;  3KKA C;  2BQU A;  7ICT A;  2R18 A;  4YR2 A;  2DPI A;  2IHN A;  3AQL A;  4FS1 A;  7ICO A;  1S8O A;  4QWD A;  4ED1 A;  4QIW C;  3C2L A;  9ICW A;  4P0P B;  1L7N A;  2F8K A;  4DOA A;  2QKQ A;  3TAD C;  5AI8 A;  5J2B A;  1YLQ A;  5J2I A;  3JPP A;  5IIM A;  4B9T A;  2DR7 A;  4YR0 A;  4BJQ A;  1Z00 B;  3ICX A;  3M7D A;  3C1Y A;  9ICN A;  4ED6 A;  2BPG A;  2ISO A;  3MR5 A;  1F5S A;  3UMC A;  5JU5 A;  4RU9 A;  2ZUC A;  3GV5 B;  4MF2 A;  2F3N A;  2H3Q A;  1AQ6 A;  1F0M A;  2C2R A;  3LWL A;  4HX0 A;  3K1Z A;  1B0X A;  2PXI A;  4I2C A;  5DQH A;  2B6G A;  4NM1 A;  4CF4 A;  4NLZ A;  1JMS A;  4GC7 A;  5ALY A;  3TQ1 A;  2VJ5 A;  4M9J A;  2BDU A;  3OJU A;  3T5L A;  4RNO A;  1PVP A;  2ESE A;  5EE1 A;  1U45 A;  4KIT B;  5DB7 A;  1MA7 A;  1TAM A;  1L7M A;  1OU5 A;  5J0T A;  3NYB A;  4CF3 A;  7ICF A;  2A1J B;  3NUQ A;  2B56 A;  5HC9 A;  2DKZ A;  2W8L A;  2ASJ A;  2ZHA A;  4ELV A;  3EW9 A;  4DSF A;  1SKR A;  4YP3 A;  3JPS A;  1L8L A;  5KFB A;  3RRH A;  2HN2 A;  5L1J A;  3DV9 A;  2AJQ A;  4ECR A;  4K96 A;  4KLH A;  2M9N A;  1SWW A;  5AM2 A;  9ICL A;  4C80 A;  4R66 A;  3FC4 A;  3MGH A;  4DQQ A;  4OAH A;  2XY5 A;  5DDY A;  4C4S A;  4IR9 A;  4QZF A;  4NKU A;  3MCR A;  3M6Z A;  4AT7 A;  2LM4 A;  3C23 A;  4I27 A;  4MEY A;  3V7J A;  4M2Y A;  4O3S A;  1O03 A;  3K4G A;  1SXD A;  2RLT A;  4MF8 A;  1FIQ A;  2KKV A;  5CR0 A;  3T5H A;  4Q43 A;  5AKL A;  1PK3 A;  5KFL A;  4LEZ A;  2KD1 A;  2W3R A;  2JEG A;  1N56 A;  3ZD8 A;  1N60 A;  3HJ1 A;  4Y2T A;  3C29 A;  8ICG A;  3U26 A;  4NM2 A;  4K98 A;  4QWE A;  4LZD A;  5DQG A;  5EE3 A;  4UB5 A;  3WK5 A;  3SEN A;  3RJE A;  4IR1 A;  5D4B A;  5KFP A;  4WBZ A;  4FZL A;  4TUP A;  5L1L A;  1Z3E B;  2IOF A;  3PHZ A;  4J9K A;  3ZDE A;  1QSS A;  2G06 A;  4LEV A;  1ECW A;  4AT7 B;  4DQI A;  5IIJ A;  2W04 A;  4WC6 A;  2EZX A;  3FAH A;  1X9X A;  4F4K A;  5AI4 A;  1UA0 A;  4RUC A;  5BPC A;  8ICF A;  3EYZ A;  2Q0Z X;  2XO7 A;  4DQP A;  4DF4 A;  1HEK A;  8ICO A;  3IG5 A;  4Z6E A;  4YG2 A;  5F9L A;  1XSP A;  2ZTC A;  5DBA A;  7ICI A;  3UXN A;  5JUM A;  4X4Q A;  2KP7 A;  4M9N A;  1LVH A;  1WCN A;  9ICF A;  1XC9 A;  4O5K A;  3OV7 A;  4F4Z A;  3PX6 A;  3MR6 A;  2XY6 A;  3K75 D;  4WQL A;  4UAV A;  2HHV A;  2EZZ A;  5KG4 A;  2EH9 A;  8ICM A;  1TVA A;  3B9J A;  3AM9 A;  1SKS A;  5HRG A;  4B9U A;  2OXO A;  4QWA A;  4R63 A;  2LI6 A;  1ZQK A;  4FS2 A;  3ZDD A;  2YB1 A;  7ICE A;  9ICT A;  3T3F A;  2BGW A;  2XGQ A;  4UB2 A;  4QZG A;  2DRA A;  3WK4 A;  4OJ6 A;  5J0O A;  1KNY A;  2IUB A;  2VA2 A;  2EZY A;  2OCE A;  4B9S A;  2JH1 A;  3QZ7 A;  4M9G A;  2ZIW A;  4NLN A;  4WBY A;  5KFR A;  1KDH A;  2ZTE A;  4P2H A;  3O0F A;  4BX9 C;  1EXN A;  5AM1 A;  1NJY A;  4C7Y A;  4M9H A;  2B0C A;  1MIY A;  2HN1 A;  2H3F A;  4RQ7 A;  2H3Z A;  4IG8 A;  4AP9 A;  3PVX A;  1ZQM A;  2BKE A;  4U6P A;  1TFW A;  4X4N A;  2PFN A;  3UMG A;  1ZOL A;  4K8V A;  2A1A A;  1KTQ A;  2HOF A;  2FPM A;  1UQV A;  5AM4 A;  3PO5 A;  2R8K A;  2JXJ A;  2I6X A;  5HRK A;  5CP2 A;  5KL1 B;  5ALW A;  4ELU A;  4CCH A;  4JK1 A;  3QEB Z;  1FEZ A;  4JV1 A;  2KIC A;  4QWB A;  2ZIW B;  3TFR A;  1S0V A;  2EDU A;  1SKW A;  2NO5 A;  5DLG A;  2DR8 A;  4DWI A;  3GIM A;  3RAQ A;  4WC2 A;  2WF6 A;  5H2F U;  2V9W A;  5KFK A;  2MSN A;  2KZ3 A;  4MEX A;  2GO7 A;  1ZD5 A;  2FI1 A;  2OEH A;  4UB3 A;  5ALV A;  1T8E A;  3HKZ C;  4EEK A;  2C2E A;  3C28 A;  3VC8 A;  4RWN A;  3OHA A;  4X0A A;  4Y2P A;  4ATB A;  3RH6 A;  2DR5 A;  1P7D A;  4U7C A;  2W03 A;  4Q8F A;  4X5V A;  2XID A;  3V72 A;  4TQR A;  3PX4 A;  5CHE A;  3PW7 A;  3QU4 A;  5AI0 A;  2MU2 A;  4DFD A;  3PY8 A;  2F77 X;  4NY8 A;  9ICK A;  3H8W A;  4OJL A;  5F2V O;  1ZQF A;  2J6U A;  3ETR A;  2FMP A;  8ICP A;  2K89 A;  5AKH A;  2ASL A;  3F2D A;  3TKA A;  5HNK A;  2Y1I A;  7ICN A;  4RUA A;  1ARO P;  1JRO A;  4CGZ A;  2LPE A;  1SL0 A;  4KB6 A;  4O3N A;  4ECT A;  3HIY A;  1BPD A;  1TFR A;  5HRE A;  1L7P A;  2ZH1 A;  4OAF A;  1WYG A;  1KRP A;  4OJP A;  2KN7 A;  3PZP A;  2GLE A;  2KE7 A;  2JGA A;  5ALI A;  1UT8 A;  4QZE A;  1JI7 A;  4EBE A;  5J8Y C;  3TAC B;  2FJ6 A;  5ALP A;  2J6S A;  1KFS A;  2KOB A;  3RF9 A;  4F5Q A;  2G09 A;  1VJ5 A;  5AI9 A;  3AL0 B;  2BPF A;  1YZ7 A;  2ZH5 A;  5KT2 A;  5KFG A;  5EOZ A;  1NI3 A;  4CF5 A;  1X9W A;  1B4F A;  2KVC A;  5J2D A;  1QLN A;  5TIS U;  2ZHB A;  3H40 A;  3PR4 A;  5CEH A;  4DCC A;  2W9C A;  3ER8 C;  2PI5 A;  4O3P A;  4KX3 A;  2KV2 A;  5DB6 A;  2V4Q A;  1XSL A;  4KLM A;  3I28 A;  1L6N A;  3E58 A;  3WKC A;  2Y0S F;  4IRD A;  8ICQ A;  1NK0 A;  3BZK A;  8ICY A;  3Q8P B;  2O5A A;  1SZP A;  1NK7 A;  2XCP A;  4ELT A;  4WJ3 B;  2ZIU B;  3C2K A;  5J2J A;  1NJW A;  2GA9 D;  2ZH6 A;  5ALL A;  1Q78 A;  3ISB A;  4ECY A;  3QUB A;  3BQ7 A;  1D9D A;  1ZJM A;  3NKU A;  2G07 A;  4JUZ A;  5KG1 A;  1D8B A;  1MQ3 A;  4K99 A;  4I28 A;  5EE9 A;  8ICC A;  4YCX A;  3KFU F;  2I1Q A;  4HAI A;  1S97 A;  4KLO A;  3WK9 A;  2PFQ A;  4AT9 A;  3PW0 A;  5DG8 A;  1KSP A;  1NOM A;  2KHQ A;  3C1Z A;  1BNP A;  1NKE A;  4B9V A;  2BBJ A;  4LJX A;  4PGX A;  1V4A A;  4GIB A;  5KG7 A;  1TK8 A;  3H8S A;  4F4X A;  5KT7 A;  2EAO A;  3IG8 A;  2LBO A;  1BPZ A;  2ZH4 A;  2VA8 A;  4JB3 A;  5J2G A;  3KTQ A;  1MIV A;  5EWG A;  2YQE A;  4NL9 A;  4RNM A;  3RJJ A;  1NK5 A;  1D8L A;  2XVT A;  4TQS A;  1IG6 A;  1JXE A;  4YD1 A;  4UD5 A;  2E1F A;  4C4R A;  4I29 A;  2YMM A;  4EGW A;  8ICJ A;  2K8B B;  9ICO A;  2E8M A;  4AYB C;  3OVS A;  4PHE A;  4J03 A;  2DFL A;  2JH7 A;  5J0Y A;  4FZN A;  4M6W A;  4X4S A;  2PBE A;  1OXJ A;  4EX6 A;  5BOL A;  4AT9 B;  4J9P A;  2BZF A;  2ODG A;  2OHF A;  3GIL A;  4BWJ A;  5KG6 A;  4F2R A;  1RQL A;  2MAX A;  2H3V A;  3PMN A;  1FFV A;  3PW2 A;  1OW5 A;  4WQK A;  1PVR A;  1XO0 A;  3HJ4 A;  4YMO A;  4DSJ A;  1JUD A;  3F2C A;  1SV0 A;  4QZB A;  4PJ0 U;  2EWR A;  2H5X A;  4TUQ A;  2DVI A;  5HR7 A;  3SAG A;  3QEA Z;  3V6J A;  2C22 A;  8ICA A;  4O3R A;  5ALD A;  1NKB A;  1Z00 A;  3HT3 A;  2CN1 A;  4OO1 J;  4Y2S A;  4JV2 A;  3T5J A;  1N5W A;  1V97 A;  2W7O A;  5J2K A;  9ICR A;  4FFD A;  4DS4 A;  2R8I A;  3MAB A;  3EF2 A;  1HIW A;  5KFA A;  4M6W B;  5KFE A;  3BZC A;  4DL5 A;  4USA A;  2KZM A;  4PZN A;  1L3T A;  1T3Q A;  3L4P A;  1ZQP A;  5KG5 A;  2ZUB A;  4DSK A;  4NKT A;  1A6S A;  3NAS A;  2F1J A;  4E80 A;  1O08 A;  3L5K A;  1ZYQ A;  5KFJ A;  3Q8Q B;  4I2F A;  3R9K A;  3L9D A;  4BUG A;  2LYH A;  4KN4 A;  5IIO A;  3HJE A;  1J2M A;  4Q8E A;  4O67 A;  4F8R A;  3B0X A;  5C5J A;  1JXL A;  1BPY A;  1BVS A;  1NJX A;  1NK9 A;  2G08 A;  4QZA A;  2I9G A;  2A3V A;  4DOB A;  5AKG A;  1TE2 A;  2BQR A;  2A1J A;  3AU2 A;  4UB1 A;  3ALR A;  3A0H U;  4DOC A;  8ICX A;  1R8C A;  2M0N A;  5ALJ A;  7ICR A;  2M2T A;  1TK5 A;  3GII A;  2AH5 A;  2ATL A;  2IMW P;  2MA1 A;  2ZH2 A;  5AIA A;  4YMN A;  3LVV A;  1ZQU A;  5AM0 A;  3UPQ A;  3E2E A;  4JLZ A;  4UB6 U;  4A8E A;  4QZD A;  3KHL A;  5B3P A;  4JMU A;  9ICH A;  3E0F A;  1JAL A;  2AGQ A;  2WAQ C;  1QTM A;  1BPX A;  1N62 A;  2D8C A;  2HCF A;  3ZI4 A;  2LMR A;  2HI0 A;  2FCL A;  1TAU A;  2ZJA A;  1VJ7 A;  4I2I A;  3M8R A;  5HRB A;  4EEL A;  1GO3 F;  2WB1 F;  7ICU A;  3LWM A;  2LYA A;  3D6J A;  3RBD A;  4RQ3 A;  1NNL A;  4DLE A;  5CJ7 A;  4Y2X A;  1ZQD A;  4RPZ A;  2JEJ A;  4TUS A;  4M5D A;  5FP0 A;  2HHW A;  5AK4 A;  3ETL A;  4RQ6 A;  3CNH A;  3IRU A;  1GPJ A;  2R8G A;  3NTU A;  3JZ0 A;  4NXX A;  1WWV A;  5KT5 A;  1QSY A;  4FO1 A;  4F71 A;  3MDC A;  1ZRM A;  2KVS A;  1S76 D;  5F9N A;  5DGB A;  3T79 A;  9ICI A;  2LHT A;  3NS1 A;  1KQQ A;  2YN4 A;  4OAI Z;  2NRV A;  3LYS A;  1UPH A;  2DR9 A;  1V85 A;  1COO A;  3CYM A;  3KHG A;  5L9X A;  1XS9 D;  2DL0 A;  3C21 A;  4Y2Q A;  4P4P A;  3H3A A;  5F3X B;  5AKX A;  1NZP A;  2VJ4 A;  4NLK A;  1ZD4 A;  2KIV A;  3H0R B;  2FLN A;  2VIX A;  3KKA A;  2H3I A;  5L1I A;  2UVR A;  2FPL A;  7ICS A;  1RPL A;  3N28 A;  1DXS A;  2LYB A;  5AHX A;  2QB0 A;  1DGS A;  5L1K A;  4NXT A;  4ED3 A;  5KFQ A;  4WOY A;  3UXO A;  3MGV A;  1IM4 A;  3THV A;  1U4B A;  1KKX A;  3IN5 A;  2DKX A;  5ALZ A;  3H0L B;  4NXU A;  4RWP A;  3KHH A;  4F4W A;  1N2X A;  7ICH A;  4NXZ A;  4Y2U A;  2F44 A;  4GXJ A;  2GAF D;  2KEY A;  4OJ5 A;  1ZQX A;  4DFP A;  1IV8 A;  1Q46 A;  1R8A A;  4RPX A;  2F2A B;  3QUT A;  2BCV A;  5L1M A;  5J2A A;  8ICU A;  1YT3 A;  1DGJ A;  3PSI A;  1BPE A;  2HMX A;  3V7K A;  3PR5 B;  3UM9 A;  2BDP A;  4G3I A;  3GZF A;  1DK2 A;  5HRL A;  1V9P A;  2KFN A;  2K4H A;  1S9F A;  2PMZ C;  4X4V A;  2EAN A;  3LVW A;  3I76 A;  2RFF A;  3PML A;  4P0Q A;  1A76 A;  1RYS A;  1IIP A;  1X9M A;  4FO6 A;  2QB0 B;  1KFT A;  4WC7 A;  5DQI A;  3SEI A;  4ICA A;  1K1Q A;  8ICH A;  2JHD A;  3SQI A;  2FPK A;  3UXP A;  4FHY A;  3TI0 A;  2W11 A;  3KOO A;  1ZXI A;  1ZQH A;  3M8S A;  5ALK A;  2K8C B;  5KFH A;  5III A;  4RQN A;  4RQ4 A;  3TAP A;  2WF5 A;  2IHM A;  3G6X A;  2RDJ A;  4KLE A;  4M47 A;  1NKC A;  3EPI A;  4X4U A;  1F5A A;  4WC3 A;  4WCW A;  3HP6 A;  1PX5 A;  3LK9 A;  2QLT A;  5J2F A;  4C8M A;  2HBL A;  2VA3 A;  2K4E A;  3F53 A;  5D49 A;  4ED7 A;  4RZR A;  5IIK A;  3RB6 A;  3GIJ A;  4UAU A;  5AKK A;  4Q45 A;  4F72 A;  1FFU A;  2AHO B;  2ZG6 A;  2R8J A;  2K60 A;  5ALE A;  4P0Q B;  2OYY A;  2HW3 A;  3ORY A;  3JPQ A;  4EZ6 A;  8ICE A;  3UQ2 A;  3KBB A;  3RFA A;  4K4H A;  1Q3V A;  2PFP A;  1Y88 A;  3ZDA A;  5B5E U;  3WFS C;  3ED5 A;  4QIW F;  2NO4 A;  2PFO A;  3SD7 A;  4WH5 A;  1PVQ A;  2OM6 A;  3AMZ A;  1V38 A;  4C8O A;  3HRD D;  1XWL A;  2C28 A;  1LKY A;  3JPO A;  9ICQ A;  5GTH U;  4NLC A;  4F92 B;  4GC6 A;  3SR6 A;  2QB1 A;  1NK6 A;  4KTQ A;  8ICS A;  3SAF A;  4I2J A;  1T7P A;  2W55 A;  5D61 A;  1ZQ1 C;  1Q8K A;  4RNN A;  4QZI A;  2R8H A;  1KN5 A;  5DKW A;  4F5R A;  2JEI A;  4XQ8 A;  1ZET A;  2EAP A;  3N4M B;  4PHD A;  2NRT A;  5D62 A;  2DBY A;  3RJF A;  4B9M A;  2HVH A;  7ICQ A;  5ALF A;  1ZQW A;  5G5G A;  4O0I A;  4IRC A;  3N97 B;  3MDA A;  2HOI A;  2V4R A;  9ICB A;  5HHH A;  2BE3 A;  9ICS A;  2ZUD A;  3JPR A;  3Q8R B;  4DFJ A;  2JEF A;  2KKP A;  4QZ8 A;  2M2U A;  3CRX A;  4J9Q A;  3AQK A;  5D63 A;  3GIK A;  1LKY B;  5JRT A;  3EUB 2;  1ZQJ A;  3QUQ A;  3GU3 A;  3TAN A;  3GV8 B;  4C0Z A;  1DOQ A;  4YD2 A;  4BWM A;  3DEE A;  1ZJN A;  1ZQZ A;  4GLX A;  1HUO A;  4ED8 A;  1TAQ A;  3CP8 A;  5AK3 A;  5DB8 A;  1S0O A;  4JLX A;  3K7D A;  4UB8 U;  1WWU A;  5CFT A;  2F1I A;  3NVV A;  3VCB A;  1U49 A;  4HYK A;  4QZ9 A;  2D3D A;  2P35 A;  5ALS A;  5DDM A;  2NYV A;  1ED1 A;  3M9M B;  4KMO B;  3H0M B;  2VAN A;  2BPC A;  1A0P A;  4CDG A;  5HRF A;  4QJF B;  4F50 A;  4C4T A;  4XJE A;  1ZRN A;  2DRB A;  5DBB A;  5J2E A;  2ZIU A;  4PPX A;  4Y2Y A;  5AKI A;  4NXV A;  4UAW A;  8ICR A;  2D6F C;  4UAY A;  1B43 A;  2WTF A;  1Z4O A;  5EE0 A;  1VFG A;  2Y9U A;  4DO9 A;  1T3N A;  3AUO A;  3QXG A;  5DG7 A;  3WU2 U;  5KFD A;  8ICL A;  5B66 U;  5HRH A;  5A0L A;  4KM5 A;  3F5E A;  1TK0 A;  1X2I A;  3Q8S B;  5T14 A;  1UEU A;  1JAJ A;  4CE6 A;  2Z7J A;  4DSE A;  3SI8 A;  1PK1 A;  3WKE A;  1JN3 A;  3ISD A;  3KZX A;  3QUC A;  4GFJ A;  3H39 A;  4EBC A;  2OH2 A;  1X6I A;  4NLG A;  9ICV A;  5CWR A;  2F8L A;  2ZIX A;  8ICV A;  4EV6 A;  1VDV A;  1J97 A;  4KMU A;  3NVW A;  4RWQ A;  3BDP A;  4MKP A;  4UD4 A;  4R64 A;  4LZG A;  3C2M A;  5KNI A;  3RB0 A;  4DL7 A;  4O6A A;  2BCS A;  4ECW A;  4FBU A;  2ZJ8 A;  4TUR A;  2E5S A;  3HPO A;  2C2D A;  2JR5 A;  4ECX A;  3OJS A;  2NV3 A;  5G5H A;  1KFD A;  1KL9 A;  2HBM A;  1XNS A;  4DLG A;  4RT3 A;  4FHX A;  1RDF A;  2KIW A;  4F4Y A;  4O69 A;  4KLT A;  2IA6 A;  2W7P A;  3WK7 A;  4NWI A;  4EEB A;  3MBY A;  3V7L A;  4QW8 A;  4O3Q A;  4YN4 A;  2HBK A;  3M9N B;  3PW5 A;  1PK1 B;  2FE9 A;  1TV9 A;  5KFO A;  5DBC A;  2HHU A;  3MFH A;  5J2C A;  5CB1 A;  3OGU A;  3ZDB A;  5HR9 A;  4BXO A;  3JPN A;  1S77 D;  1M6Y A;  2PKE A;  9ICP A;  2ZIX B;  4ACO A;  2XGP A;  4FH3 A;  4RPY A;  4ECV A;  4GXK A;  2Y9T A;  4P4M A;  1IXR A;  2AGO A;  5E79 U;  4C8N A;  3ER9 B;  3GQC A;  2E3T A;  3BJY A;  4F2S A;  1XSN A;  4O3M A;  5AK5 A;  3ERC C;  8ICK A;  4ZOH C;  4EP7 A;  5B3Q A;  1WG8 A;  4M0A A;  1QQ5 A; 
#chains in the Genus database with same CATH homology
 1VJ7 A;  3HW8 A;  4I2I A;  4DSI A;  3RTV A;  2HHV A;  5KG4 A;  3M8R A;  1A77 A;  3KHR A;  4JWN A;  2W8K A;  2HHX A;  3PW4 A;  8ICM A;  4R65 A;  4YVZ A;  1TVA A;  5HRB A;  1LV5 A;  1ZQN A;  4O5C A;  1SKS A;  5HRG A;  7ICU A;  4KLF A;  2HHU A;  3LWM A;  4B9U A;  5KFU A;  2HHT A;  4QWA A;  3RB3 A;  3QE9 Y;  1D9F A;  4R63 A;  4Z6D A;  3RBD A;  1ZQK A;  1S0M A;  4RQ3 A;  4F5N A;  4EBJ A;  4BXO B;  2XCA A;  4FS2 A;  4X0B A;  5KT3 A;  4DLE A;  4JWM A;  5CJ7 A;  3ZDD A;  1ZQD A;  4RPZ A;  2JEJ A;  1LB2 B;  7ICE A;  3EWA A;  4DL3 A;  9ICT A;  4TUS A;  1UEV A;  3T3F A;  4M5D A;  2BCQ A;  3NGD A;  2BGW A;  2HHW A;  4LVS A;  3QZ8 A;  2XGQ A;  1MQ2 A;  1WCL A;  5KFW A;  3ETL A;  3FDS A;  4UB2 A;  4QZG A;  4RQ6 A;  4RQ2 A;  4UB4 A;  2BR0 A;  1RXV A;  4J9R A;  5J0O A;  2R8G A;  4M9L A;  3NTU A;  3RH5 A;  1U48 A;  2HVI A;  2W9B A;  2VA2 A;  1KNY A;  3JZ0 A;  1RZT A;  4WC0 A;  5KT5 A;  4BGD A;  2BCR A;  1QSY A;  4B9S A;  3MDC A;  3QZ7 A;  4LT6 A;  4M9G A;  4ATB B;  4C8L A;  4WC4 A;  4EYH B;  1S76 D;  4KLJ A;  5F9N A;  4QW9 A;  4NLN A;  4WBY A;  5DGB A;  2JZB A;  4I2A A;  3T5K A;  3H4B A;  2ZH8 A;  9ICI A;  5J2H A;  5KFR A;  2AQ4 A;  1KDH A;  7ICK A;  2ZTE A;  4P2H A;  3MR2 A;  1ZQG A;  3RRG A;  2J6T A;  2NRV A;  5J0Q A;  3IM1 A;  1EXN A;  1NJY A;  2DR9 A;  1COO A;  3KHG A;  4J9L A;  3Q8M A;  5L9X A;  1XS9 D;  3RJI A;  3C21 A;  4M9H A;  1MIY A;  2XY7 A;  1TFY A;  4RQ7 A;  4P4P A;  1HJP A;  3TFS A;  4IG8 A;  3H3A A;  8ICZ A;  3G6Y A;  8ICN A;  2OWO A;  2B21 A;  3PVX A;  3RJK A;  4O5E A;  1ZQM A;  1NZP A;  2ALZ A;  4NLK A;  4XA5 A;  2BKE A;  2MUT A;  4I2G A;  4YXM A;  1ZQL A;  1TFW A;  4X4N A;  2NRX A;  1T4G A;  2PFN A;  4FHP A;  2FLN A;  9ICU A;  1KTQ A;  2FPM A;  5L1I A;  2UVR A;  4KLG A;  2FPL A;  2PI4 A;  4UAZ A;  7ICS A;  3PO5 A;  4EBK A;  1RPL A;  2R8K A;  5KG3 A;  2HHP A;  1U47 A;  1H38 A;  3ZDC A;  5KFS A;  4WC5 A;  1DGS A;  5L1K A;  5HRK A;  3UPS A;  5CP2 A;  4ED3 A;  5KFQ A;  4B9L A;  4QZH A;  7ICL A;  1ZQB A;  4KLQ A;  3UXO A;  1ZQI A;  1MIW A;  1C7Y A;  1IM4 A;  3THV A;  1U4B A;  4ELU A;  2W9B B;  4FHW A;  4CCH A;  4M04 A;  4P4O A;  4JK1 A;  1PZN A;  7ICJ A;  4RWP A;  3KHH A;  3QEB Z;  4F4W A;  1KLN A;  4JV1 A;  7ICH A;  4QWB A;  4NXZ A;  3TFR A;  1S0V A;  2JZB B;  1SKW A;  4X4O A;  2UVW A;  5DLG A;  4GXJ A;  2DR8 A;  4DWI A;  3BQ0 A;  1U9L A;  3GIM A;  4DL2 A;  3WFR E;  3RAQ A;  4WC2 A;  1ZQX A;  3MR3 A;  2V9W A;  5KFK A;  4DFP A;  1R8A A;  4RPX A;  2KZ3 A;  4MEX A;  2BCV A;  5KFT A;  3PX0 A;  5J2A A;  1ZQY A;  8ICT A;  9ICX A;  4YXJ A;  8ICU A;  4DQR A;  3GV7 B;  1BPE A;  3BQT A;  4UB3 A;  1T8E A;  4F3O A;  2ZH3 A;  8ICI A;  2C2E A;  2FMS A;  3WFO A;  3V7K A;  3OUY B;  4MFA A;  5CHG A;  3PR5 B;  2BDP A;  4S3N A;  4RWN A;  5D46 A;  4G3I A;  2W9C B;  1DK2 A;  5HRL A;  1UA1 A;  2MUT B;  1V9P A;  3OHA A;  3C5F A;  2KFN A;  1S9F A;  1DK3 A;  4ATB A;  3ISC A;  3RH6 A;  4XUS A;  1UT5 A;  8ICB A;  2KTQ A;  2DR5 A;  1BNO A;  4X4V A;  5J0R A;  5J0W A;  3RR8 A;  2RFF A;  4I2E A;  3PML A;  4Q8F A;  3PNC A;  1A76 A;  2ZH9 A;  1RYS A;  4X5V A;  3V72 A;  3SZ2 A;  4AT8 A;  4TQR A;  1S10 A;  3PX4 A;  2Y1J A;  1X9M A;  3PW7 A;  5KFM A;  4PGY A;  4EBD A;  4FO6 A;  5DGA A;  1KFT A;  4WC7 A;  5DQI A;  3LDA A;  3PY8 A;  5KFF A;  5HHI A;  4NY8 A;  1L3S A;  5KFV A;  3H8W A;  1K1Q A;  4I2D A;  1SL2 A;  8ICH A;  2ZJ5 A;  9ICK A;  5F2V O;  4X4R A;  1ZQF A;  2BCU A;  1ZQC A;  2J6U A;  4RQ0 A;  2W9A A;  5KG2 A;  3WFQ E;  2FMP A;  3MGI A;  2UVV A;  8ICP A;  5IIN A;  5KFN A;  2FPK A;  3UXP A;  4FHY A;  2ASL A;  3TI0 A;  5HNK A;  2Y1I A;  7ICN A;  2M2W A;  1ZQH A;  4RUA A;  1SL1 A;  1ARO P;  3M8S A;  5KFH A;  1BGX T;  5III A;  1SL0 A;  4RQ4 A;  3BQ2 A;  3TAP A;  2AGP A;  1KEJ A;  4O3N A;  9ICM A;  1JQR A;  3OVB A;  4ECT A;  3RB4 A;  5DB9 A;  1BPD A;  2IHM A;  3HIY A;  4X4P A;  1TFR A;  3G6X A;  2RDJ A;  4DFM A;  4KLE A;  5HRE A;  4M47 A;  1NKC A;  3EPI A;  4X4U A;  9ICJ A;  2ZH1 A;  1F5A A;  4WC3 A;  4WCW A;  4AT7 B;  3HP6 A;  1KRP A;  3AQN A;  2KN7 A;  1PX5 A;  3LK9 A;  3IHQ B;  5J2F A;  4C8M A;  5KFI A;  1UT8 A;  4QZE A;  4EBE A;  3EZ5 A;  1R8B A;  4YQW A;  2VA3 A;  4XQ7 A;  4QZC A;  5D49 A;  2M2V A;  4ED7 A;  4I2B A;  4RZR A;  5IIK A;  1L3U A;  4J9M A;  3RB6 A;  3GIJ A;  4PGQ A;  2FLL A;  4IRK A;  4RQ5 A;  4IQU A;  2J6S A;  4Q45 A;  1KFS A;  4XRH A;  2KFZ A;  2Q66 A;  4J9N A;  4F5Q A;  2P6U A;  4X0A A;  5CA7 A;  3OSN A;  2DPJ A;  4IQT A;  2R8J A;  2HW3 A;  3ORY A;  3JPQ A;  4DL4 A;  2BPF A;  2NRW A;  2NRZ A;  4EZ6 A;  8ICE A;  3OHB A;  3UQ2 A;  1R89 A;  4K4H A;  2PFP A;  4DSL A;  1ZQT A;  2ZH5 A;  5KT2 A;  1Y88 A;  5KFG A;  5EOZ A;  1X9W A;  1RXW A;  3HWT A;  3ZDA A;  1Q79 A;  4FHV A;  5J29 A;  3WFS C;  3JPT A;  5J2D A;  1QLN A;  2PFO A;  5J0S A;  3H8J A;  2BQ3 A;  3H40 A;  3PR4 A;  2ZHB A;  3M9O B;  5KT6 A;  1N48 A;  3JYY A;  4C8O A;  3OUY A;  1XWL A;  3B0Y A;  2C28 A;  3OVS A;  2W9C A;  3JPO A;  2PI5 A;  4O3P A;  1S0N A;  9ICQ A;  4F92 B;  5DB6 A;  4GC6 A;  4KTQ A;  1NK6 A;  4YR3 A;  1NJZ A;  4KLD A;  2V4Q A;  8ICS A;  7ICV A;  4I2J A;  1XSL A;  4KLM A;  4E0D A;  3AU6 A;  4EEY A;  1T7P A;  4J9S A;  4IRD A;  2BHN A;  5KT4 A;  1ZQO A;  8ICQ A;  1WOT A;  3RJG A;  7ICM A;  3RH4 A;  4MFF A;  1ZQR A;  3H38 A;  2UVU A;  4RNN A;  4QZI A;  2R8H A;  4UBC A;  1NK0 A;  3UQ0 A;  4KLS A;  4R8U A;  5DKW A;  4F5R A;  2JEI A;  8ICY A;  5KFY A;  4C8K A;  1L3V A;  3Q8P B;  2BQU A;  7ICT A;  2RDI A;  2O5A A;  4YR2 A;  2DPI A;  2IHN A;  4JV0 A;  4XQ8 A;  3AQL A;  4FS1 A;  1ZET A;  1SZP A;  1NK7 A;  5KG0 A;  2XCP A;  3N4M B;  4PHD A;  2NRT A;  2FLP A;  1XO1 A;  4ELT A;  3GDX A;  3C2K A;  3RJF A;  1QSL A;  4O9M A;  7ICO A;  5J2J A;  1NJW A;  4B9M A;  3WFP A;  2HVH A;  4O3O A;  4QWD A;  4QWC A;  4ED1 A;  7ICQ A;  1ZQW A;  1Q78 A;  4O0I A;  3BQ1 A;  3C2L A;  5BOM A;  3ISB A;  1X9S A;  4IRC A;  4ECY A;  9ICW A;  3N97 B;  1D9D A;  4DQS A;  1NK4 A;  1ZJM A;  3C66 A;  5DG9 A;  4DOA A;  3MDA A;  4JUZ A;  5KG1 A;  2V4R A;  9ICB A;  5HHH A;  2BE3 A;  9ICS A;  1MQ3 A;  4DEZ A;  5HRI A;  5J2B A;  1YLQ A;  5J2I A;  2ZUD A;  3JPR A;  3JPP A;  3Q8R B;  4I28 A;  5IIM A;  4YCX A;  4DFJ A;  2JEF A;  8ICC A;  4QZ8 A;  4B9T A;  4YR0 A;  3Q8K A;  2HHS A;  2M2U A;  2DR7 A;  5KFZ A;  1Z00 B;  4J9Q A;  4F91 B;  4Z6C A;  4ED0 A;  2I1Q A;  3AQK A;  4J9O A;  1S97 A;  3ZD9 A;  4IQW A;  3GIK A;  4KLO A;  2PFQ A;  4AT9 A;  3PW0 A;  3H37 A;  3C1Y A;  5DG8 A;  1KSP A;  1ZQJ A;  1NOM A;  4ECZ A;  9ICN A;  1UET A;  4AT8 B;  3RAX A;  4ED6 A;  3C1Z A;  2BPG A;  2ISO A;  1JIH A;  1BNP A;  1NKE A;  3TAN A;  3MR5 A;  4B9V A;  4Q44 A;  3GV8 B;  3PO4 A;  4K4G A;  4RU9 A;  4PGX A;  2ZUC A;  1V4A A;  4EZ9 A;  1DOQ A;  4YD2 A;  3GV5 B;  4MF2 A;  1TK8 A;  5KG7 A;  4BWM A;  3H8S A;  4RQ1 A;  4PHP A;  2C2R A;  5KT7 A;  4F4X A;  3LQC B;  4X4T A;  4R8U B;  1ZJN A;  1ZQZ A;  3LWL A;  4GLX A;  1HUO A;  1BPZ A;  4BDP A;  2ZH4 A;  4ED8 A;  2VA8 A;  1L5U A;  1TAQ A;  5DB8 A;  5J2G A;  3KTQ A;  1MIV A;  1S0O A;  2PXI A;  4I2C A;  5EWG A;  5DQH A;  4NM1 A;  4RNM A;  3RJJ A;  1NK5 A;  1D8L A;  7ICG A;  4NLZ A;  2F1I A;  1JMS A;  4TQS A;  3TAQ A;  4GC7 A;  1JXE A;  1U49 A;  4HYK A;  4QZ9 A;  4I2H A;  2W9M A;  4YD1 A;  4UD5 A;  5TZV A;  3TQ1 A;  4I29 A;  5DDM A;  4ECS A;  8ICJ A;  4M9J A;  5KFX A;  1XU4 A;  9ICO A;  3M9M B;  3SV3 A;  3OJU A;  4KLI A;  4FH5 A;  3T5L A;  4RNO A;  4E7X A;  2O1P A;  1D8Y A;  4IQV A;  4EYI B;  1MC8 A;  4ECQ A;  1U45 A;  4PHE A;  4KIT B;  5EWE A;  5DB7 A;  2DFL A;  2IBK A;  2VAN A;  2BPC A;  9ICA A;  1NO5 A;  3GFK B;  1OU5 A;  3SV4 A;  5KTQ A;  5J0Y A;  5J0T A;  3NYB A;  4M6W A;  3H39 A;  4X4S A;  2ZH6 A;  2ASD A;  3MFI A;  4UBB A;  2PBE A;  5HMM A;  5HRF A;  4F50 A;  5BOL A;  2KZZ A;  4AT9 B;  7ICF A;  3EPG A;  2A1J B;  4J9P A;  2DRB A;  5DBB A;  5J2E A;  2FMQ A;  2W8L A;  4PPX A;  2ASJ A;  2ZHA A;  5HC9 A;  4FBT A;  3GIL A;  8ICW A;  4BWJ A;  5KG6 A;  4UAW A;  4ELV A;  3EW9 A;  4F2R A;  4DFK A;  8ICR A;  4DSF A;  2MAX A;  4UAY A;  1B43 A;  2WTF A;  3PMN A;  3PW2 A;  1SKR A;  4YP3 A;  3V6K A;  1ZQS A;  3JPS A;  5HRD A;  1ZQE A;  5KFB A;  3TAR A;  1VFG A;  3RRH A;  3HJ4 A;  4YMO A;  4DSJ A;  5L1J A;  4Z6F A;  4YMM A;  4DO9 A;  3Q8L A;  4QZB A;  1T3N A;  3AUO A;  4KLU A;  5DG7 A;  4PH5 A;  2AJQ A;  3C18 A;  2H5X A;  5KFD A;  4TUQ A;  4ECR A;  2P6R A;  3AQM A;  2DVI A;  8ICL A;  4KLH A;  3QEA Z;  2M9N A;  3V6J A;  5IIL A;  3OSP A;  2C22 A;  8ICA A;  5HRH A;  1TK0 A;  4O3R A;  1X2I A;  3Q8S B;  1NKB A;  1Z00 A;  9ICL A;  1JAJ A;  1UEU A;  4R66 A;  4UQG A;  3MGH A;  3HT3 A;  4DQQ A;  4ZH4 A;  4DSE A;  2XY5 A;  5DEC A;  4JV2 A;  1CEZ A;  5DDY A;  4DL6 A;  3T5J A;  4IR9 A;  4QZF A;  4NKU A;  1ZQV A;  3SI8 A;  4GXI A;  9ICE A;  1JN3 A;  3ISD A;  3OVA A;  4WC1 A;  5J2K A;  9ICR A;  4AT7 A;  1B22 A;  4DS4 A;  4EBC A;  4DF8 A;  1TKD A;  3V6H A;  1HUZ A;  4NLG A;  5CWR A;  3RJH A;  1MSW D;  9ICV A;  3C23 A;  3MAB A;  2R8I A;  4I27 A;  4MEY A;  8ICV A;  5KFA A;  1ZQA A;  4KMU A;  1ZQQ A;  3V7J A;  4M2Y A;  1K1S A;  4M6W B;  5KFE A;  4ECU A;  3BDP A;  4O3S A;  4RWQ A;  4UD4 A;  4DL5 A;  2KZM A;  4R64 A;  4LZG A;  3K4G A;  1L3T A;  3C2M A;  5J0U A;  1ZQP A;  4MF8 A;  5KG5 A;  2ZUB A;  4DL7 A;  3RB0 A;  1BPB A;  2BCS A;  4DSK A;  4NKT A;  4ECW A;  4FBU A;  2ZJ8 A;  5CR0 A;  3T5H A;  2GWS A;  5KFC A;  4TUR A;  7ICP A;  3HPO A;  2C2D A;  4Q43 A;  4ECX A;  2F1J A;  3OJS A;  4E80 A;  4RWO A;  5KFL A;  4F5P A;  1ZYQ A;  5KFJ A;  3Q8Q B;  2JEG A;  4I2F A;  1N56 A;  3L9D A;  1KFD A;  3C5G A;  2LYH A;  3ZD8 A;  5HP4 A;  3HJ1 A;  2AQ0 A;  4KN4 A;  5IIO A;  2P66 A;  5EWF A;  4DLG A;  4Q8E A;  2ID1 A;  8ICG A;  4RT3 A;  4F8R A;  4FHX A;  4NM2 A;  1CUK A;  3B0X A;  5C5J A;  4QWE A;  4F4Y A;  4LZD A;  1JXL A;  1BPY A;  5DQG A;  4UB5 A;  4K4I A;  1BVS A;  4ED2 A;  1NK9 A;  1NJX A;  3RJE A;  2IA6 A;  4KLT A;  4QZA A;  4IR1 A;  2F1H A;  2I9G A;  2AU0 A;  5D4B A;  3MBY A;  4DOB A;  3V7L A;  4QW8 A;  4O3Q A;  5KFP A;  4YN4 A;  4WBZ A;  2BQR A;  2A1J A;  4TUP A;  3AU2 A;  9ICG A;  5L1L A;  3M9N B;  5J0X A;  1Z3E B;  5HML A;  4UB1 A;  3PW5 A;  4J9K A;  4E8F A;  1TV9 A;  3ZDE A;  5KFO A;  5J0P A;  4DOC A;  5DBC A;  1QSS A;  3MFH A;  5J2C A;  5CB1 A;  3G6V A;  3OGU A;  3RBE A;  4F5O A;  3RR7 A;  3ZDB A;  4BXO A;  5HR9 A;  4DQI A;  5IIJ A;  4F93 B;  3JPN A;  1S77 D;  1R8C A;  7ICR A;  2M2T A;  1TK5 A;  1FA0 A;  9ICP A;  3GII A;  3H4D A;  3HX0 A;  4WC6 A;  2ZH7 A;  4F4K A;  2ATL A;  1UA0 A;  9ICC A;  4RUC A;  2IMW P;  4B9N A;  2ZH2 A;  5DLF A;  4YMN A;  2XGP A;  2ZTD A;  4FH3 A;  3FYH A;  5BPC A;  4RQ8 A;  1ZQU A;  3UPQ A;  3EYZ A;  4PHA A;  4RPY A;  3SYZ A;  2XC9 A;  2ISP A;  3E2E A;  8ICF A;  2NRK A;  4YFK A;  2Q0Z X;  2XO7 A;  4DQP A;  4RT2 A;  4ECV A;  4GXK A;  4DS5 A;  4QZD A;  4DF4 A;  4P4M A;  4MFC A;  3KHL A;  1NK8 A;  1IXR A;  8ICO A;  2AGO A;  9ICH A;  4Z6E A;  4YG2 A;  5F9L A;  4C8N A;  2AGQ A;  2HHQ A;  3GQC A;  1XSP A;  2ZTC A;  5DBA A;  1QTM A;  7ICI A;  3UXN A;  5JUM A;  3BJY A;  4F2S A;  1RYR A;  1BPX A;  1XSN A;  4M9N A;  2KP7 A;  4X4Q A;  3PV8 A;  1WCN A;  4KLL A;  9ICF A;  5DED A;  1XC9 A;  8ICK A;  4O5K A;  4EP7 A;  3OV7 A;  2DRA A;  4M0A A;  4F4Z A;  3PX6 A;  4KN7 A;  8ICX A;  3MR6 A;  2XY6 A;  1JX4 A;  3H7I A;  3K75 D;  1TAU A;  2ZJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...