4TUPA

Structure of human dna polymerase beta complexed with gg as the template (gg0b) in a 1-nucleotide gapped dna
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
329
structure length
326
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural Basis for the Inefficient Nucleotide Incorporation Opposite Cisplatin-DNA Lesion by Human DNA Polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 103
structure length 326
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4tupA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4tupA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4tupA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4tupA03
1NKCA 4TUQA 4UQGA 2PFPA 4B9VA 3PX6A 4WC5A 4F4ZA 8ICSA 4DFJA 5KG3A 1KNYA 5DG7A 1Z00A 3MABA 3GV8B 1ZQNA 4M2YA 1JX4A 5DB6A 3HJ1A 1BPDA 4YXMA 5J0UA 5J2JA 1XSLA 3MR5A 1XSPA 2PFNA 4WC3A 4JUZA 8ICNA 1NK5A 1T4GA 4YMMA 8ICHA 8ICOA 4DOCA 4X4SA 1KLNA 1MIYA 1ZQUA 2VA8A 1QTMA 3PX4A 1D9DA 4KLSA 1KEJA 4YFKA 1L3SA 5CR0A 5KFNA 4Q8EA 4KLQA 3ZDEA 1X2IA 4KLGA 1ZQLA 1Y88A 5DG8A 1QSYA 3NTUA 4KLMA 3H8SA 1TAQA 2ISOA 4DF4A 3GQCA 2NRXA 4DL5A 1U47A 4DQPA 4C8LA 3SV3A 3H38A 1TFYA 1B43A 5J2GA 4UB5A 5DQHA 3THVA 8ICZA 3IM1A 1FA0A 3N97B 5DGBA 9ICVA 3B0XA 4YD1A 3PX0A 2VA3A 3PMNA 2KFZA 3ZDAA 4NLGA 3Q8MA 5CHGA 1KDHA 4ECYA 3QE9Y 2I1QA 2ZUBA 5KFKA 5HHIA 4RNMA 3JPNA 1MQ3A 4AT7A 4R65A 4RT3A 4F4WA 1T7PA 4RQ7A 2P6RA 1S0NA 2NRKA 4DSIA 4IR9A 1JXEA 4Z6CA 1S77D 3WFRE 4JV1A 1CEZA 9ICOA 3RRHA 2XO7A 4I2AA 2KZ3A 5D46A 5HMMA 3MFHA 5CWRA 1R8CA 3V7KA 1L3UA 4KLTA 7ICLA 9ICEA 4DFMA 5KFSA 7ICNA 3OJUA 2XGQA 2RDIA 1ZQEA 8ICUA 2HW3A 2ALZA 2MAXA 5KFVA 1ZQKA 4EYHB 7ICJA 2RFFA 2OWOA 2HHWA 3OHAA 4X4RA 4F4YA 3FDSA 4RQ3A 3C2LA 2BHNA 5HRHA 3LK9A 4EZ9A 2LYHA 4E8FA 8ICKA 4X4UA 3K75D 2HHXA 1TK5A 9ICRA 4M04A 5J2KA 2ZJ8A 4YMOA 4RWQA 4ED3A 2HHQA 4ECRA 3JPPA 3JPQA 9ICHA 2ZTCA 5DLFA 4RWNA 3JPSA 4UB1A 3JPRA 1XS9D 4K4GA 3UXOA 3ZD8A 1ZQMA 4KLLA 8ICAA 1BNPA 4CCHA 5KT5A 1K1SA 1V9PA 3FYHA 5J0TA 4QWCA 3BQ2A 1BPZA 3H4DA 4ED8A 2ZH9A 4R8UB 1TK8A 5J2AA 3T3FA 1KFDA 4QZBA 3M8RA 3MFIA 5KFGA 1ZQXA 2A1JA 4RPXA 2AU0A 4J9NA 2HHPA 1NJZA 9ICBA 3RH6A 2DR5A 1S0MA 4ECTA 8ICPA 2FLLA 2C22A 1UEVA 4AT9A 5DLGA 4AT8B 4ATBB 7ICGA 3C2KA 4XQ8A 3WFSC 4TUPA 2XY6A 1ZQDA 1COOA 8ICVA 4RQ0A 1NZPA 4C8NA 1ZQVA 3HP6A 3EZ5A 4QZEA 4DL2A 4O0IA 4AT9B 1LV5A 2PI4A 4YXJA 3N4MB 4X5VA 4DL6A 1ZQGA 3EYZA 3AQMA 2AGQA 2PI5A 8ICCA 4IRKA 4DF8A 2IHNA 1TVAA 1TV9A 3Q8SB 2JEGA 8ICIA 2XCAA 1L5UA 4WC1A 5L9XA 3M9NB 3G6YA 5CJ7A 2HHUA 3AU2A 1SKWA 4ELTA 5DQIA 1JMSA 4R64A 4RQ6A 2W8LA 3AU6A 3RJKA 3C2MA 4ZH4A 4KTQA 4Q8FA 1U49A 4UD4A 3PNCA 2BCSA 3NYBA 4WBYA 2H5XA 4I2JA 4PHPA 4KITB 4WC2A 5KT3A 1TKDA 3KHHA 1ZQJA 1X9SA 5HRKA 1MIVA 4FS2A 1U9LA 4ED0A 4M6WB 4J9SA 1XU4A 4JV0A 5KG0A 9ICAA 1JAJA 3LWMA 3V6JA 1DK3A 5CP2A 1BVSA 4P4MA 4RZRA 3AQKA 2V4QA 1ZQQA 2PFOA 2JEIA 3K4GA 4Q44A 2C2EA 1RXVA 2AQ4A 2IA6A 3H39A 3H8JA 4M9NA 2ZJAA 5KFCA 4DQQA 5EWFA 2ASDA 2R8JA 4PGYA 4WBZA 1HJPA 2ZH3A 5BPCA 1SL2A 4Q43A 3RJJA 4MF8A 7ICHA 1MIWA 3AQLA 1MSWD 1N48A 4ED2A 1WOTA 4UD5A 2KZZA 4HYKA 3NGDA 4IR1A 1MC8A 1WCNA 4IQWA 4NKTA 5KFDA 2ASJA 4Z6FA 2FPLA 4B9TA 4PHAA 1YLQA 4BWJA 4RWOA 3HPOA 1RPLA 4O9MA 5HP4A 5C5JA 5KFBA 2NRTA 5KFRA 1KFSA 4KLFA 4KN4A 1DK2A 1JN3A 3RJHA 7ICOA 1Q79A 4RUCA 3L9DA 4RQ5A 3ISBA 4RQ1A 2Y1IA 4YMNA 3RR8A 4M9JA 1ZJNA 5J29A 8ICLA 4QZGA 4EBCA 3OJSA 3RJFA 3C21A 3LQCB 1EXNA 5DQGA 1ZYQA 2HVHA 4M5DA 4I2HA 1IM4A 3T5LA 3TAPA 3IHQB 1TAUA 1XO1A 3OHBA 8ICRA 4RU9A 2DRBA 8ICMA 1BGXT 5TZVA 3HW8A 5DB7A 4X0AA 5KFLA 2XGPA 3HJ4A 4F5NA 1PX5A 5HR9A 1SL0A 2W9BB 4ECZA 2IHMA 5KT6A 3ZD9A 4WC4A 3RTVA 4EEYA 1C7YA 1RXWA 3UPSA 1U45A 1TK0A 4KLDA 4ECQA 5KFJA 5L1LA 5DB8A 8ICGA 2DR9A 2UVVA 2ZTEA 4RQ4A 4GXJA 2V9WA 4UAYA 1ZQYA 4NLNA 5KFFA 2AJQA 2MUTB 2P6UA 4P4OA 4DFKA 4MFFA 4WC0A 3V6HA 4C8KA 3C5FA 2C2RA 1X9MA 3BQ1A 1SZPA 4YN4A 4DL4A 5HRDA 2Q66A 9ICJA 4QWBA 4BDPA 2BE3A 3T5KA 4DS5A 3OSPA 4X4OA 2GWSA 4J9LA 4ED7A 5IILA 8ICTA 2J6SA 2VA2A 3PW5A 2FLNA 7ICMA 2BQ3A 1ZQIA 2AGPA 4YR3A 4G3IA 5HREA 5L1KA 3BDPA 4YVZA 4DS4A 4EZ6A 1NKBA 3KTQA 2BCVA 3H37A 4X4NA 9ICMA 3RJEA 2NRVA 5IIMA 1N56A 3ORYA 3C5GA 3H3AA 9ICKA 2ZHBA 3OUYA 2NRWA 5DG9A 3PW7A 1ZQBA 4RNNA 2JZBB 1UA0A 1ZQRA 4DQIA 4B9SA 4KMUA 5IIJA 3RB6A 7ICIA 4DOBA 1Q78A 3OUYB 1UT8A 3JPTA 8ICFA 2M2TA 1NOMA 3PV8A 2F1HA 4R66A 3PMLA 3RB3A 1XSNA 4NM1A 4B9LA 5KG7A 4B9MA 2HHSA 9ICSA 3RH4A 5HRIA 5DBAA 4R8UA 2BPCA 8ICXA 4EBKA 4DLGA 1DOQA 4S3NA 4PPXA 5HMLA 1RYSA 2M9NA 4E80A 5DDYA 4Z6DA 7ICTA 1ZQPA 2PXIA 4I2EA 7ICKA 4J9OA 2ZH4A 1IXRA 1XWLA 4YR2A 4P4PA 4NLZA 4KLUA 2W8KA 4I2DA 4ATBA 1JIHA 4AT8A 1D8YA 4F92B 3GFKB 5DKWA 4YD2A 1S10A 2UVUA 3ISCA 4F4KA 1JQRA 5J2CA 3M8SA 9ICPA 3OGUA 3KHRA 3MGHA 4GC6A 4M9LA 1F5AA 1KRPA 5J0SA 4DL3A 4QZCA 3HX0A 5L1JA 1H38A 1ZQSA 4I2FA 4UBCA 9ICFA 2HHVA 2C2DA 5J0RA 5J0XA 3H4BA 4KLHA 1RZTA 3Q8KA 1S0VA 1ZQAA 5KFTA 3Q8QB 3UQ0A 1BNOA 3LDAA 3GIJA 4K4HA 3KHLA 4UAZA 2W9MA 5KFZA 4J9RA 2KN7A 1NK9A 4GLXA 4RT2A 9ICQA 7ICSA 1T3NA 5D4BA 9ICXA 5J2DA 3BQTA 4M6WA 3QZ7A 2BCQA 4I27A 2FPMA 3RJIA 4YP3A 3RAQA 2R8GA 3SYZA 2M2WA 3PR5B 4IG8A 2DPIA 4ECUA 4QWEA 4O5EA 5KFOA 1L3TA 1KFTA 3OVSA 2F1IA 4PHDA 4EP7A 3C23A 4EBEA 4DQSA 4IQUA 4F5RA 5KFEA 1ZQWA 5D49A 2KP7A 1NJXA 5HRFA 5KFPA 3C66A 3PO4A 5KFIA 4BWMA 3H40A 3RAXA 2J6UA 2C28A 2DFLA 3OVAA 4QW8A 4QZFA 1TFRA 3GDXA 2B21A 4NM2A 5KT4A 5DBBA 4DEZA 1QSLA 3ZDBA 9ICNA 4PH5A 3SV4A 2ZH2A 3QZ8A 4NLKA 2KTQA 1QLNA 4YR0A 8ICJA 1S97A 2ZJ5A 3H8WA 2DPJA 4QZAA 1QSSA 4MEYA 7ICPA 5KFWA 9ICIA 2PFQA 3KHGA 3MDAA 5KG6A 5BOLA 2R8HA 1BPYA 4F4XA 1UA1A 4M9GA 4YG2A 4NXZA 5IIKA 4F3OA 3HT3A 3PO5A 3OVBA 3MBYA 3WFOA 4WCWA 1NK7A 5J0YA 3LWLA 3GIIA 2ZH7A 5J2FA 4YQWA 2DRAA 4I2GA 3ZDDA 2DVIA 9ICGA 4PHEA 1X9WA 4I28A 2R8KA 4TQRA 4DOAA 3T5HA 5DGAA 5KG5A 3T5JA 1HUZA 9ICUA 2NRZA 2V4RA 4LT6A 2ZTDA 1ZETA 4DL7A 1ZJMA 1NK4A 3EPGA 2KFNA 2ZH8A 4O3OA 1VFGA 4I2CA 2Q0ZX 5CA7A 4DLEA 1DGSA 2W9BA 3G6VA 1XC9A 2FMQA 4O5CA 4KLJA 4GC7A 3V6KA 5F9LA 2BPGA 4RQ2A 1KSPA 4FH3A 2UVWA 3SZ2A 5DBCA 1Z00B 2ATLA 4FHXA 5EOZA 3AQNA 4DSJA 5KFYA 3SI8A 1KTQA 4J9PA 4FHPA 2MUTA 4J9MA 4M0AA 3GIMA 1ZQHA 5DECA 2ZUDA 2JEJA 3AUOA 4E0DA 3V7LA 8ICBA 4X0BA 3GV5B 3PW4A 4UBBA 3WFPA 1BPEA 1NK6A 2F1JA 2ZUCA 5HNKA 3QEAZ 3RBEA 4ECVA 3PW2A 3ETLA 4FHYA 5JUMA 1AROP 1UETA 7ICRA 2RDJA 1NJYA 2BGWA 2KZMA 4RWPA 3JYYA 3G6XA 3QEBZ 4FHWA 5J2EA 3MDCA 4QWDA 4BGDA 3RBDA 3Q8LA 4KLIA 3PW0A 3HIYA 4FO6A 4M47A 9ICWA 4RPYA 2W9AA 1SL1A 4YCXA 4QZ8A 2O1PA 1TFWA 1K1QA 4DFPA 4PGXA 3MGIA 3GIKA 4LZGA 3M9OB 2BQRA 4UAWA 4LVSA 2JZBA 4DSFA 1UT5A 5KFAA 4F5PA 4C8OA 4O3QA 4UB3A 3TARA 3Q8PB 2FMPA 4FH5A 4O3PA 2BKEA 4M9HA 4C8MA 4DSLA 5KG4A 2AGOA 4E7XA 3UQ2A 2AQ0A 1R8AA 2ZHAA 4MFAA 2IMWP 2ZH5A 1BPXA 3RRGA 4IQTA 4AT7B 4FBUA 1HUOA 4IQVA 5EWGA 4ECWA 2J6TA 9ICTA 4X4VA 4NY8A 9ICLA 2IBKA 3PVXA 5EWEA 5J0WA 4ELVA 4FHVA 3TI0A 4F8RA 4I2IA 4DSEA 4F2RA 7ICFA 3UXPA 3EPIA 5J2HA 1NK8A 2FLPA 5DB9A 2R8IA 2BR0A 2JEFA 4O5KA 3H7IA 1UEUA 4MF2A 3TFSA 4IRCA 4Z6EA 4EBDA 5J2IA 4TURA 3BJYA 2HVIA 4QW9A 3MR6A 2HHTA 1VJ7A 5IINA 3M9MB 2O5AA 3ISDA 1U48A 9ICCA 5KT2A 3MR3A 4I29A 3V72A 1ZQTA 8ICEA 4R63A 3EW9A 5KTQA 4ECXA 3RB0A 4RUAA 2W9CA 1S0OA 1L3VA 3JZ0A 4RPZA 4BXOA 3ZDCA 4KLOA 4F91B 3BQ0A 4FS1A 5J0OA 1NKEA 2I9GA 4XQ7A 4XA5A 1BPBA 1PZNA 2W9CB 4UB2A 4GXKA 1SKRA 4O3SA 3C18A 4EBJA 4DSKA 1D8LA 5J0QA 1ZQCA 4BXOB 2UVRA 4ELUA 5HRGA 2P66A 7ICVA 4ECSA 5HRBA 5J2BA 1T8EA 2XC9A 5DDMA 1JXLA 3RJGA 4O3RA 5KFQA 4MFCA 4QZIA 2FMSA 4O3NA 4JWMA 4F2SA 1V4AA 3HWTA 3RH5A 1NJWA 1B22A 5F2VO 4QZHA 2DR8A 8ICWA 2ZH6A 4TQSA 2A1JB 2WTFA 3TANA 5BOMA 5F9NA 4QZ9A 2M2UA 2ASLA 4ED1A 5KFXA 1A76A 1ZQZA 4IRDA 4KN7A 3GILA 4B9UA 1R89A 4X4QA 5CB1A 3Q8RB 4GXIA 2DR7A 5KFHA 4NKUA 3MR2A 4WC7A 2Y1JA 3PY8A 3V7JA 1R8BA 3EWAA 4LZDA 4TUSA 1RYRA 1MQ2A 1S9FA 3OSNA 2BCRA 1OU5A 3C1YA 4J9QA 7ICUA 3WFQE 4J9KA 4F50A 8ICQA 2FPKA 2VANA 5HHHA 3C1ZA 5KT7A 3JPOA 4RQ8A 2XY5A 5IIOA 3RB4A 1WCLA 4MEXA 4JV2A 4K4IA 1NK0A 3TFRA 5KG2A 2BCUA 4DO9A 4JK1A 1A77A 5KFMA 4F5QA 2ZH1A 2BQUA 4FBTA 5KG1A 4XRHA 5KFUA 8ICYA 5L1IA 3PR4A 4ED6A 3TAQA 4JWNA 2XY7A 4QZDA 1ZQFA 3B0YA 4PGQA 5J0PA 2XCPA 4F5OA 3RR7A 1NO5A 1LB2B 5IIIA 4Q45A 4UB4A 2ISPA 4P2HA 7ICEA 5HC9A 4XUSA 4KLEA 3OV7A 4DWIA 1S76D 3UXNA 1D9FA 4RNOA 3E2EA 3TQ1A 4X4TA 1SKSA 2M2VA 2PBEA 4WC6A 4EYIB 2BPFA 4B9NA 4X4PA 3UPQA 2ID1A 3GV7B 7ICQA 5DEDA 1CUKA 1U4BA 4DQRA 4F93B 4I2BA 5HRLA 2BDPA 4QWAA 1Z3EB 1ZQOA
chains in the Genus database with same CATH superfamily
1NKCA 2PFPA 4B9VA 2F76X 2QLTA 3DEEA 5EE9A 4IC9A 1HEKA 3HJ1A 4YXMA 4JUZA 2BDUA 1T4GA 4WH5A 1WUDA 1X2IA 4KLGA 2DGZA 4KLMA 3H8SA 5JTGA 1FEZA 2E8NA 1SV4A 4CDGA 3H38A 2RRDA 2Y0SC 3N97B 5DGBA 3JCFA 3H0RB 2VA3A 3NVVA 4FFDA 5ALDA 2E8OA 2KFZA 3AN1A 3QE9Y 2I1QA 2ZUBA 3M1YA 2FCLA 5ALKA 4MHVA 4R65A 2P6RA 4RQ7A 4DSIA 3UMGA 3C28A 9ICOA 1YZ6A 3RRHA 5AKIA 1URJA 4KLTA 7ICLA 4GIBA 2YX8A 3HILA 2GO7A 2RDIA 4EYHB 1K5OA 7ICJA 3H8MA 3M7DA 4RQ3A 2HMXA 2BHNA 5D61A 1JRPA 5ALXA 1PUZA 1TK5A 3TADA 5J2KA 1B0XA 3D2QA 4ECRA 3JPQA 2ZTCA 4RWNA 3ERCC 1XS9D 3UXOA 1ZQMA 1BNPA 4CCHA 1K1SA 1V9PA 4EEKA 3D6JA 4R8UB 1M6YA 3T3FA 2W3SA 3OTQA 4UAVA 4RPXA 4ECTA 2K89A 4ATBB 3WFSC 3CYMA 4DL2A 4O0IA 4DL6A 2ZIVB 2AGQA 4IRKA 2JEGA 1WYGA 2LYAA 3G6YA 1SKWA 2KICA 1JMSA 4R64A 4RQ6A 4ZH4A 2HBJA 4WBYA 5ALYA 3AQFA 3ONNA 1ZQJA 1MIVA 4EV6A 1XU4A 2KHQA 3TKAA 3SR6A 5KG0A 3L3FX 3WK5A 2F8LA 5AI0A 1BVSA 2G5IB 3R9KA 2OEHA 2C2EA 2AQ4A 3H8JA 2W54A 1O08A 2ZJAA 5KFCA 2ASDA 2W03A 4PGYA 4MF8A 1MIWA 2NO4A 1S8OA 4IR1A 1WCNA 1VDVA 4BWJA 4KLFA 4WOYA 2EZYA 1Q79A 3RR8A 2Y1IA 4M9JA 2WF6A 4I2HA 3IHQB 8ICRA 5HR6A 1PX5A 2K60A 1MA7A 5AKZA 3RTVA 4KLDA 2ZXHA 5L1LA 2DR9A 4RQ4A 5GTIU 4NLNA 5AM0A 4WC0A 2HI0A 2P6UA 1RG6A 3OPXA 4MFFA 5TISU 3C5FA 3BQ1A 4BDPA 3T5KA 3OSPA 3FAHA 4Y2SA 4X4OA 4J9LA 4UASA 4MKPA 3CW2C 4YR3A 5L1KA 3ER9B 1ZD4A 4DS4A 3QXGA 3KTQA 2ZG6A 3QUTA 3RJEA 3A0HU 2NRVA 5IIMA 5ALMA 3ORYA 5DG9A 2Y9TA 2H3FA 3PW7A 4B9SA 5IIJA 4DOBA 2B56A 3OUYB 2M2TA 3IV6A 4B9LA 4KX3A 3RH4A 2BPCA 5HMLA 5AKGA 4K9BA 4K8VA 2H3QA 5CFUA 2ZH4A 4NXVA 2ZXIA 2W8KA 3KOOA 3GFKB 1S10A 5J2CA 2W43A 3AM9A 4QZCA 5L1JA 4I2FA 2HHVA 2C2DA 3Q8KA 1S0VA 2KJ8A 3TACB 4K4HA 4UAZA 3K1RB 4K96A 2KN7A 1NK9A 1S5LU 2JMGA 1ZXIA 2OHFA 4O67A 4M6WA 3QZ7A 2AHOB 4YP3A 4O5EA 5HRFA 4F5RA 4IQUA 3PO4A 3RAXA 2J6UA 3N7RC 2C28A 2DFLA 3GDXA 2Y9UA 2RQ5A 2RHFA 1QSLA 3SV4A 2ZH2A 2HBMA 4YR0A 5AIAA 1S97A 4NLBA 4CF4A 2DPJA 4MEYA 4P0PB 5KFWA 3MDAA 1KW4A 5KL1B 5KG6A 1BPYA 2WAQF 3I28A 2CXYA 4C0ZA 5J0YA 3ZDDA 4N7RA 2R8KA 3T5HA 3T5JA 1SXEA 1ZETA 1ZJMA 4I2CA 1XO0A 2YN4A 2W9BA 3G6VA 4KLJA 2QB0A 4O5CA 2PKEA 3AQEA 4RQ2A 3SZ2A 5B3QA 5EOZA 4DSJA 3AMZA 3GIMA 2F8KA 5DECA 3V7LA 1V38A 3GV5B 2KSOA 3RBEA 3PW2A 3ETLA 2GOLA 2RDJA 3WK7A 3QEBZ 5J2EA 4BGDA 3Q8LA 4RPYA 4KMOB 1TFWA 4QZ8A 2O1PA 1K1QA 3GIKA 2JH1A 4F5PA 4C8OA 3TARA 1MN8A 2WB1C 3Q8PB 5KG4A 1R8AA 2ZH5A 4KM5A 5EWGA 1COKA 3FM9A 5AM5A 2IBKA 4F8RA 1SWWA 4F2RA 5J2HA 1UEUA 2LM1A 2R8IA 2BR0A 3F2DA 4EBDA 1Z1VA 3BJYA 3MR6A 1VJ7A 4CE6A 3H0LB 1N2XA 4R63A 2HCFA 3EW9A 4ECXA 2W9CA 4RPZA 1RQNA 2NYVA 3BQ0A 1NKEA 1KQQA 3OV7A 4GXKA 3I1YA 3C18A 4DSKA 1ZQCA 4BXOB 3IN5A 4PZOA 5HRGA 3QUBA 1JUDA 4K98A 1JXLA 4MFCA 5KFQA 3RH5A 1B22A 4QZHA 2DR8A 8ICWA 3TANA 2M2UA 2F77X 1L7NA 4JB3A 4BX9C 5D62A 3C1YA 2RP5A 3GZFA 8ICQA 1IV8A 2VANA 3QU5A 3C1ZA 4RQ8A 5IIOA 2ZH1A 4F5QA 1VLBA 2H3ZA 2LBOA 5KFUA 2B51A 4ED6A 3TAQA 1DGJA 4WQLA 2BBHA 5AK6A 5HC9A 2DBYA 3QU4A 1RDFA 5F3XB 1SKSA 2M2VA 2PBEA 4DFDA 5GTHU 4EYIB 4X4PA 1LVHA 2VJ5A 4DQRA 4I2BA 5K4LA 5HRLA 1Z3EB 1ZQOA 1NI3A 4OJ6A 3PX6A 8ICSA 5KG3A 2F2AB 3MABA 3GV8B 2PMZF 5DG7A 5J0UA 4WC3A 3MR5A 1F0MA 2LI6A 8ICHA 1MIYA 1O03A 1D9DA 3SAGA 2W11A 3PX4A 4Q8EA 1L3SA 2VIXA 1ZQLA 3HJEA 1Y88A 5DG8A 1QSYA 1PK3A 3NTUA 4O68A 2ISOA 4DF4A 4LEYA 1TFYA 5J2GA 3IP4B 5DQHA 1FA0A 1UQVA 4NLGA 3Q8MA 1KDHA 2KNJA 3WK8A 1MQ3A 1T7PA 4XJEA 1JXEA 3QU7A 2G5HB 4I2AA 5HMMA 3MFHA 4AP9A 2GLEA 3A0BU 4DFMA 3OJUA 1ZQEA 8ICUA 2IOFK 2ALZA 5KFVA 1ZQKA 2OWOA 2HHWA 4C4RA 2O6KA 3FDSA 1ZRMA 2QB1A 3LK9A 4E8FA 3K75D 1LKYA 9ICRA 2ZJ8A 4YMOA 3UMBA 4ED3A 3JPPA 5DLFA 2MA1A 3ZD8A 3FYHA 4OJ5A 2DKXA 1TK8A 5KFGA 2A1JA 4RQMA 4HAIA 2AU0A 4J9NA 9ICBA 3ZI4A 2DR5A 8ICPA 2FLLA 4AT9A 4UB8U 3C2KA 4XQ8A 1COOA 4RQ0A 4C8NA 1ZQVA 4QIWF 4QZEA 2MU2A 1Z4OA 2PI4A 3EYZA 2PI5A 8ICCA 4FO1A 1TV9A 3K7DA 1X6JA 3M9NB 2XI9A 3AU2A 3RJKA 2W8LA 4Q8FA 3ICXA 1U49A 1J2NA 3PNCA 2H5XA 1Q8KA 1NZBA 4WC2A 4KITB 3KHHA 2D8CA 1U9LA 3SD7A 2DKZA 4M6WB 4J9SA 1IG6A 3L4PA 2IOHA 1JAJA 3V6JA 5ALEA 4P4MA 3IRUA 3KKAA 1L6NA 4M9NA 3S6JA 4DQQA 4KX5A 1N60A 2R8JA 1C20A 4WBZA 1HJPA 2ZH3A 3QUQA 1SL2A 1YT3A 1MSWD 1N48A 3WKEA 4UD5A 2KZZA 5AKHA 3NGDA 4NKTA 4IQWA 4Z6FA 5AKLA 2FPLA 1JI7A 1RPLA 5KFBA 2NRTA 1KFSA 1JN3A 3RJHA 7ICOA 4RQ1A 1ZJNA 4C7YA 3LQCB 3C21A 2HVHA 1IM4A 3T5LA 3TAPA 2DRBA 8ICMA 4Y2JA 5HR7A 1SL0A 2W9BB 4ECZA 2QB0B 5KT6A 4EEYA 5AI4A 3OWGA 4ECQA 5KFJA 5L1MA 8ICGA 2UVVA 2ZTEA 5CFTA 2V9WA 1ZQYA 4DFKA 2R18A 4C8KA 5HRDA 9ICJA 4QWBA 2BE3A 2GWSA 2KSOB 1SV0A 2FLNA 7ICMA 1P7DA 2EAOA 2HSZA 4G3IA 2E5SA 3BDPA 5CFSA 2ESEA 3E0FA 4EZ6A 1NKBA 4X4NA 9ICMA 3C5GA 3H3AA 2NRWA 4KMUA 3RB6A 4ZOHC 2HOFA 2F1HA 4R66A 4NM1A 9ICSA 5DBAA 4EBKA 1F44A 4DLGA 1DOQA 7ICTA 7ICKA 2KOBA 1D8BA 4P4PA 3TADC 4I2DA 1JIHA 5DKWA 3WK6A 3M8SA 4M9LA 9ICPA 3MGHA 2ES6A 1ZQSA 9ICFA 4KLHA 5J0RA 1Z4NA 1RZTA 1ZQAA 3CNHA 5KAIU 4Y2RA 3GIJA 3KHLA 2HDOA 3MGVA 1SWVA 2KV2A 5JRTA 5KFZA 1N5WA 3VCBA 2MRLA 9ICQA 1T3NA 1KKXA 4EEBA 4I27A 2BCQA 2R8GA 4UW9A 3BS5A 4QWEA 5KFOA 1KFTA 4EP7A 3C23A 3J81j 2KP7A 4C7ZA 3C66A 2WAQC 5D49A 3HKZF 5KFPA 2VJ4A 5KFIA 3OVAA 4Y2VA 1SXDA 2KK0A 1TFRA 5KT4A 4PH5A 1B4FA 2KTQA 2ZJ5A 3KHGA 5J8YA 1UA1A 5IIKA 5AKXA 2EDUA 3OVBA 4WCWA 3GIIA 4I2GA 1XNSA 9ICGA 4DOAA 5DGAA 2YQEA 2KIWA 3PSTA 2V4RA 2ZTDA 4PZNA 4DL7A 1KL9A 3F2CA 3EPGA 1ZD3A 5CA7A 4OJLA 1DGSA 1XC9A 4UB6U 5F9LA 2BPGA 3N7PD 4FHXA 3AQNA 2LHTA 3SI8A 3KFUF 4J9PA 1X6IA 3AUOA 2ZIXA 1KBUA 3ETRA 3PW4A 4PL1A 4UBBA 1BPEA 2F1JA 2ZUCA 4ACOA 4U7CA 5HNKA 2B0CA 3NRZA 4ECVA 5JUMA 4CGZA 5AM1A 2BGWA 2KZMA 4QWDA 3QYPA 3AL0B 3D2SA 9ICWA 2W9AA 4F71A 2DUYA 3QNMA 4DFPA 2VKQA 3M9OB 3LVWA 1V97A 2JZBA 5KFAA 2JR5A 4UB3A 2CN1A 2BKEA 4FZMA 3RFAA 4E7XA 3NVOA 2AQ0A 4OAGA 4Y2TA 2YB1A 1BPXA 1N5XA 4FBUA 1HUOA 4IQVA 4ECWA 4X4VA 4NY8A 9ICLA 5ALNA 3QU2A 4Y2PA 3SMVA 5J0WA 4ELVA 4FHVA 3PSIA 4I2IA 2JEFA 1X40A 4K9AA 3H7IA 3PSPA 4TURA 2HHTA 5KT2A 3MR3A 1ZQTA 3RB0A 4RUAA 3JZ0A 1LKYB 4F91B 4FS1A 4XA5A 1BPBA 4O3SA 4EBJA 1IIPA 1FIQA 5J0QA 4ELUA 4NXWA 3SEIA 4O3RA 4QZIA 4JWMA 1OXJA 3MCRA 5ALWA 3WKDA 5ALJA 5AI8A 2A1JB 5BOMA 2YMPA 5KFXA 1R89A 5CB1A 3Q8RB 4GXIA 5A0LA 3MR2A 5KNIA 3PY8A 4LZDA 1MQ2A 1OU5A 4NL9A 2BCRA 3OSNA 2EQYA 4O69A 7ICUA 4J9KA 2FPKA 2XY5A 4NV0A 2IHOA 4CRXA 1NK0A 1WG8A 5KG2A 4DO9A 4JK1A 2BCUA 4FZNA 2GAFD 2H3VA 3ER8C 8ICYA 2WF8A 3PR4A 1GPJA 1ZQFA 5J0PA 3RR7A 4CF3A 1LB2B 5IIIA 4P2HA 2PMZC 4XUSA 4KLEA 4DWIA 1S76D 3UXNA 3E2EA 4USAA 1L7MA 5DEDA 7ICQA 1U4BA 4TUQA 2KJ9A 4F4ZA 4DFJA 2EH9A 1KNYA 1Z00A 1ZQNA 2ZIWA 4LEWA 4M2YA 1JX4A 5DB6A 1BPDA 5J2JA 1XSLA 1XSPA 2PFNA 2BZFA 8ICNA 2G07A 1NK5A 1N62A 2LYBA 2KG5A 3KD3A 8ICOA 1ZQUA 1QTMA 5CR0A 3ZDEA 2IOFA 3WKBA 4QNLA 3CRXA 4JLZA 3GQCA 4DL5A 1U47A 1L7OA 4C8LA 5ALHA 1HIWA 1B43A 5CEHA 3UMCA 3IM1A 3PX0A 2A3VA 3N7SC 5ALUA 1L8LA 1FFUA 3ZDAA 5CHGA 4ECYA 2OCEA 2XICA 5E79U 5KFKA 4RNMA 4AT7A 4RT3A 4F4WA 2G0AA 4FZLA 4Z6CA 4IR9A 1S77D 2G09A 2I6XA 4JV1A 1WWUA 3O0FA 2XO7A 5D46A 2EANA 3U26A 2HW3A 5AICA 1PVPA 2RFFA 4OCZA 4UAUA 3OHAA 4X4RA 4F4YA 3T79A 2KKPA 2WFAA 4X4UA 2HHXA 4M04A 4RWQA 2HHQA 9ICHA 4UB1A 2B4VA 1A6SA 4K97A 4QIWC 4KLLA 2FDRA 1BPZA 3H4DA 3NS1A 4QZBA 3MFIA 1V85A 3RH6A 4NXUA 5AI5A 5DLGA 7ICGA 3HP6A 1LV5A 4YXJA 3N4MB 3NASA 4X5VA 1ZQGA 4LJXA 4DF8A 2IHNA 1TVAA 3Q8SB 2XCAA 4WC1A 1L7PA 5L9XA 5CJ7A 5DQIA 3AU6A 4KTQA 3C2MA 4UD4A 3NYBA 5KT3A 1TKDA 4HX0A 4FS2A 4ED0A 4NJ8A 2FI1A 9ICAA 3BS5B 2MSNA 1DK3A 5CP2A 3DDHA 5ALOA 1ZQQA 2PFOA 1CI4A 4Y2YA 2JEIA 3K4GA 1RXVA 2IA6A 3H39A 5EWFA 5BPCA 1UCVA 3RJJA 3AQLA 4IL6U 1WOTA 4HYKA 1MC8A 5KFDA 2KHVA 4B9TA 3QU9A 4PHAA 1RYUA 2KVCA 2EZXA 5HP4A 5C5JA 4O9MA 5KFRA 1DK2A 4KN4A 3L9DA 2D3DA 4RUCA 3ISBA 8ICLA 4O3MA 4IS7A 4US9A 2CRXA 5AK4A 1XO1A 4RU9A 4X0AA 4Y2UA 2XGPA 1Q3UA 1PK1A 3ZD9A 3I76A 4WC4A 3UPSA 1RXWA 1U45A 1TK0A 4UAYA 2LPEA 5KFFA 2AJQA 4P4OA 4YN4A 4DL4A 2ZIXB 3IDWA 4ED7A 8ICTA 5T14A 5AK5A 2BQ3A 3DV9A 2WF5A 5C0YA 3NVWA 5AIBA 4JMUA 3EF2A 3GU3A 1N56A 4U6PA 2ZHBA 9ICKA 3OUYA 1ZQBA 2JZBB 1Q78A 1UT8A 5ALVA 3JPTA 8ICFA 3PV8A 3RB3A 1PVRA 1XSNA 2W3RA 2HHSA 2E8MA 4OD0A 8ICXA 4BUGA 2CPRA 4K99A 1RYSA 1QQ6A 4E80A 5DDYA 1ZQPA 2PXIA 3BS7A 4J9OA 3M6ZA 1IXRA 5AKJA 4DCCA 4NLZA 4KLUA 4AT8A 2UVUA 3ISCA 2F3NA 3OGUA 1KRPA 5AKKA 5J0SA 3KZIU 4Y2QA 1N63A 3HX0A 4UBCA 3L5KA 5KFTA 3LDAA 1YZ7A 4RQNA 1SZHA 3WK9A 4QJFB 4J9RA 1NNLA 4GLXA 2QARA 7ICSA 9ICXA 2Z7JA 3RAQA 2M2WA 4IG8A 3SQIA 2DPIA 4ECUA 4PHDA 3F5AA 2HN2A 5CHEA 5AI6A 1ZQWA 2KE7A 3CK6A 3H40A 4QW8A 4QZFA 2B21A 2EZZA 4DEZA 9ICNA 3ZDBA 2W7PA 3QZ8A 4NLKA 5ALFA 1QLNA 1QQ7A 1QSSA 2DWQA 9ICIA 2PFQA 2BBJA 5BOLA 2R8HA 4F3OA 3HT3A 3KKAC 4A8EA 3MBYA 3WFOA 3LWLA 2ZH7A 5G5HA 4FE3A 2DRAA 2DVIA 2I5HA 1VJ5A 2YMMA 4PHEA 1X9WA 4TQRA 5EE0A 5KG5A 3B9JA 1HUZA 4LT6A 5KL8B 1VFGA 4PL2A 2LMRA 5D63A 4GC7A 3V6KA 1KSPA 3WK4A 2UVWA 5DBCA 1Z00B 2ZIWB 1AQ6A 1N61A 4FHPA 2MUTA 4US8A 2ODGA 4J9MA 4C4SA 3PSFA 1ZQHA 4M0AA 2JEJA 3F2BA 2JGAA 1SIJA 4EX7A 2KD1A 3QEAZ 2KVSA 3PZPA 1UETA 3D2NA 7ICRA 3HRDD 4RWPA 3JYYA 3G6XA 5CRXA 2YTUA 3MDCA 2K4PA 5AHXA 3RBDA 4KLIA 3PW0A 1SL1A 4YCXA 1QCKA 4PGXA 2BQRA 3E58A 4UAWA 4LVSA 5ALSA 3NKUA 3EUB2 2FMPA 4O3PA 4MFAA 1SV0C 2IMWP 3RRGA 4C80A 4IQTA 4JLXA 4AT7B 2J6TA 3PVXA 4P0QA 2B6GA 5KAFU 1OUQA 4MF2A 3TFSA 2O5AA 4C4TA 3M9MB 5IINA 4B6JA 3ISDA 1U48A 4I29A 8ICEA 1Z1BA 2L5YA 1L3VA 1S0OA 4BXOA 3ZDCA 2I9GA 1PZNA 2W9CB 4UB2A 1JROA 1SKRA 1D8LA 2P66A 7ICVA 4ECSA 5HRBA 5J2BA 2HBKA 1T8EA 2XC9A 2NV3A 5DDMA 4O3NA 1V4AA 3HWTA 4GFJA 1NJWA 4OAHA 5ALRA 5F2VO 2ZH6A 4TQSA 2WTFA 5F9NA 4QZ9A 2ASLA 4ED1A 1A76A 1ZQZA 4B9UA 5KFHA 4NKUA 4WC7A 1Q46A 3V7JA 1R8BA 4ICAA 2DF4B 1RYRA 5ALPA 4J9QA 3WFQE 4F50A 5KT7A 5HHHA 3NWIA 3RB4A 2GH1A 5AM4A 3TFRA 4K4IA 4EEDA 5KFMA 3FC4A 3QUCA 4FBTA 2A19A 5KG1A 5AKEA 5L1IA 4JWNA 2XY7A 3WKCA 2NO5A 3IG5A 4QZDA 4PGQA 5B5EU 4F5OA 1NO5A 1DRGA 4Q45A 4UB4A 2ISPA 7ICEA 1ZRNA 5AM2A 3TQ1A 4X4TA 2W04A 2BPFA 4B9NA 3UPQA 2ID1A 1UPHA 2YB4A 3GV7B 3NRWA 4QWAA 2YMLA 4UQGA 4WC5A 5J8YC 2RLTA 3AEVA 4YMMA 4DOCA 4X4SA 1KLNA 4OJOA 2VA8A 4KLSA 1KEJA 4YFKA 5KFNA 4AYBF 4KLQA 1SGGA 2W7OA 2JXJA 1TAQA 1T3QA 2JHDA 2NRXA 4DQPA 3SV3A 4UB5A 8ICZA 3THVA 2LM4A 1ZOLA 9ICVA 3B0XA 4YD1A 4KB6A 3PMNA 1PK1B 2HOQA 2FJ6A 5HHIA 3JPNA 1S0NA 2NRKA 2WF7A 3WFRE 3KBBA 1CEZA 2KZ3A 5CWRA 1R8CA 3V7KA 1L3UA 2Y0SF 9ICEA 7ICNA 5KFSA 2XGQA 2MAXA 3C2LA 2JV3A 1RM6C 5HRHA 4EZ9A 2LYHA 5EE1A 8ICKA 3F5EA 2A1AA 3BZKA 3JPSA 3JPRA 4K4GA 5AM3A 8ICAA 5KT5A 5J0TA 3LYSA 5ALGA 4QWCA 3BQ2A 3F53A 4ED8A 2ZH9A 2XVTA 5J2AA 1KFDA 3M8RA 1ZQXA 5ALZA 2HHPA 1NJZA 1S0MA 1UEVA 2C22A 4EENA 1ZD2P 4AT8B 2E1EA 4TUPA 2XY6A 2G06A 1ZQDA 1NZPA 8ICVA 1X42A 2ZIUA 3EZ5A 4AT9B 3BQ7A 3WU2U 3AQMA 3ED5A 3WKAA 8ICIA 1L5UA 4Y2XA 2HHUA 4ELTA 4FHWA 2BCSA 5FP0A 2KIVA 4I2JA 4PHPA 2AXTU 2K4HA 2K8CB 2IUBA 2QARB 1X9SA 5HRKA 4NL9C 1ZQ1C 4JV0A 4CF5A 1QH9A 3LWMA 1X9XA 2H3IA 4RZRA 3AQKA 2V4QA 4EGWA 4BJQA 2D6FC 4Q44A 2K4IA 4Q43A 7ICHA 4ED2A 2ASJA 2EAPA 2YY6A 1YLQA 4RWOA 2OM6A 3HPOA 2FE9A 4J03A 4RQ5A 4YMNA 5J29A 4QZGA 1A0PA 3OJSA 4EBCA 3RJFA 3RF9A 1EXNA 3M6KA 5DQGA 1ZYQA 4M5DA 1ED1A 1TAUA 3OHBA 1BGXT 5TZVA 3HW8A 5DB7A 5KFLA 3HJ4A 4F5NA 5HR9A 2K8BB 2IHMA 1C7YA 5ALIA 5DB8A 4GXJA 3NUQA 2MUTB 3V6HA 2C2RA 4F72A 1X9MA 1SZPA 2XIDA 2E3TA 2Q66A 1WWVA 4EX6A 4DS5A 5IILA 3N28A 2J6SA 2VA2A 3PW5A 2KMDA 2N1RA 5B3PA 1ZQIA 2AGPA 4NWIA 5HREA 5JTIA 4YVZA 3H37A 2BCVA 2EWRA 2JRZA 4RNNA 1ZQRA 1UA0A 4DQIA 4O6AA 5AI9A 7ICIA 2F44A 2YMQA 3H0MB 1NOMA 3PMLA 5KG7A 3C29A 4B9MA 5HRIA 4R8UA 4S3NA 2HOIA 4PPXA 1GO3F 2M9NA 4Z6DA 4I2EA 4P0QB 4YR2A 1XWLA 5H2FU 4ATBA 1D8YA 4F92B 4F4KA 4YD2A 1JQRA 4OO1J 1F5AA 3KHRA 4GC6A 1J2MA 4DL3A 2ZIVA 1H38A 5J0XA 3H4BA 1BNOA 3Q8QB 3UQ0A 1PVQA 3MC1A 2W9MA 1L8OA 3IG8A 4RT2A 2K4EA 1Z19A 5D4BA 5J2DA 4OAIZ 3BQTA 2FPMA 3RJIA 1OW5A 3SYZA 3PR5B 1UHUA 4NXXA 1L3TA 3OVSA 2F1IA 1ECWA 2JH7A 3BZCA 4EBEA 4DQSA 5KFEA 5ALTA 1DXSA 1SB3C 1NJXA 4LEZA 4BWMA 4CNQA 3K1ZA 4NM2A 5DBBA 4WJ3B 4PJ0U 1X66A 8ICJA 3H8WA 4QZAA 7ICPA 4UATA 4F4XA 4M9GA 1KN5A 4YG2A 4NXZA 3PO5A 1NK7A 3SAFA 5J2FA 4YQWA 1QQ5A 4I28A 9ICUA 2NRZA 1ZD5A 3UM9A 4UARA 1NK4A 2KFNA 2ZH8A 4O3OA 2K8AA 2Q0ZX 4DLEA 2FMQA 4FH3A 2ATLA 2E1FA 2DL0A 5KFYA 4OAFA 1KTQA 2ZUDA 4E0DA 8ICBA 4X0BA 4LEVA 2HN1A 2P35A 3SENA 3WFPA 4OJPA 1NK6A 4FHYA 2LKYA 1AROP 1NJYA 2DQNB 2AH5A 3HIYA 4FO6A 4M47A 2QKQA 3MGIA 4LZGA 4NLCA 1TAMA 4DSFA 1UT5A 4O3QA 4FH5A 3CP8A 4M9HA 4C8MA 4DSLA 2AGOA 3UQ2A 3KZXA 2ZHAA 2OYYA 4I0UA 2HBLA 1FFVA 9ICTA 2KEYA 5EWEA 1CRXA 3TI0A 4DSEA 7ICFA 3UXPA 3EPIA 1NK8A 2FLPA 5DB9A 4O5KA 3VC8A 2M0NA 4IRCA 4Z6EA 5J2IA 2WB1F 2HVIA 2OXOA 4QW9A 5EE3A 9ICCA 3V72A 5AK3A 5KTQA 1T94A 4WQKA 4KLOA 5J0OA 4XQ7A 3NVYA 2UVRA 3PHZA 2W55A 3HKZC 5JU5A 3RJGA 5AKYA 2FMSA 4F2SA 4NXTA 2GA9D 1RQLA 1J97A 2EAMA 2WF9A 4G9BA 2OH2A 4IRDA 4X4QA 4KN7A 3GILA 2DR7A 2E8PA 5ALQA 2Y1JA 3EWAA 4TUSA 2Q4TA 2ZIUB 1FO4A 1S9FA 3JPOA 1TE2A 1F5SA 1WCLA 4EELA 4MEXA 4JV2A 5B66U 1A77A 2KKVA 4P0PA 2BQUA 3SAHA 4XRHA 2WHEA 1Q3VA 2G08A 3B0YA 2XCPA 3LVVA 3NVZA 3QX7A 1D9FA 4RNOA 3ALRA 2KJ5A 4WC6A 1CUKA 4AYBC 4F93B 5G5GA 1JALA 2BDPA 5ALLA
chains in the Genus database with same CATH topology
1NKCA 4TUQA 4UQGA 2PFPA 4B9VA 3PX6A 4WC5A 4F4ZA 8ICSA 4DFJA 5KG3A 1KNYA 5DG7A 1Z00A 3MABA 3GV8B 1ZQNA 4M2YA 1JX4A 5DB6A 3HJ1A 1BPDA 4YXMA 5J0UA 5J2JA 1XSLA 3MR5A 1XSPA 2PFNA 4WC3A 4JUZA 8ICNA 1NK5A 1T4GA 4YMMA 8ICHA 8ICOA 4DOCA 4X4SA 1KLNA 1MIYA 1ZQUA 2VA8A 1QTMA 3PX4A 1D9DA 4KLSA 1KEJA 4YFKA 1L3SA 5CR0A 5KFNA 4Q8EA 4KLQA 3ZDEA 1X2IA 4KLGA 1ZQLA 1Y88A 5DG8A 1QSYA 3NTUA 4KLMA 3H8SA 1TAQA 2ISOA 4DF4A 3GQCA 2NRXA 4DL5A 1U47A 4DQPA 4C8LA 3SV3A 3H38A 1TFYA 1B43A 5J2GA 4UB5A 5DQHA 3THVA 8ICZA 3IM1A 1FA0A 3N97B 5DGBA 9ICVA 3B0XA 4YD1A 3PX0A 2VA3A 3PMNA 2KFZA 3ZDAA 4NLGA 3Q8MA 5CHGA 1KDHA 4ECYA 3QE9Y 2I1QA 2ZUBA 5KFKA 5HHIA 4RNMA 3JPNA 1MQ3A 4AT7A 4R65A 4RT3A 4F4WA 1T7PA 4RQ7A 2P6RA 1S0NA 2NRKA 4DSIA 4IR9A 1JXEA 4Z6CA 1S77D 3WFRE 4JV1A 1CEZA 9ICOA 3RRHA 2XO7A 4I2AA 2KZ3A 5D46A 5HMMA 3MFHA 5CWRA 1R8CA 3V7KA 1L3UA 4KLTA 7ICLA 9ICEA 4DFMA 5KFSA 7ICNA 3OJUA 2XGQA 2RDIA 1ZQEA 8ICUA 2HW3A 2ALZA 2MAXA 5KFVA 1ZQKA 4EYHB 7ICJA 2RFFA 2OWOA 2HHWA 3OHAA 4X4RA 4F4YA 3FDSA 4RQ3A 3C2LA 2BHNA 5HRHA 3LK9A 4EZ9A 2LYHA 4E8FA 8ICKA 4X4UA 3K75D 2HHXA 1TK5A 9ICRA 4M04A 5J2KA 2ZJ8A 4YMOA 4RWQA 4ED3A 2HHQA 4ECRA 3JPPA 3JPQA 9ICHA 2ZTCA 5DLFA 4RWNA 3JPSA 4UB1A 3JPRA 1XS9D 4K4GA 3UXOA 3ZD8A 1ZQMA 4KLLA 8ICAA 1BNPA 4CCHA 5KT5A 1K1SA 1V9PA 3FYHA 5J0TA 4QWCA 3BQ2A 1BPZA 3H4DA 4ED8A 2ZH9A 4R8UB 1TK8A 5J2AA 3T3FA 1KFDA 4QZBA 3M8RA 3MFIA 5KFGA 1ZQXA 2A1JA 4RPXA 2AU0A 4J9NA 2HHPA 1NJZA 9ICBA 3RH6A 2DR5A 1S0MA 4ECTA 8ICPA 2FLLA 2C22A 1UEVA 4AT9A 5DLGA 4AT8B 4ATBB 7ICGA 3C2KA 4XQ8A 3WFSC 4TUPA 2XY6A 1ZQDA 1COOA 8ICVA 4RQ0A 1NZPA 4C8NA 1ZQVA 3HP6A 3EZ5A 4QZEA 4DL2A 4O0IA 4AT9B 1LV5A 2PI4A 4YXJA 3N4MB 4X5VA 4DL6A 1ZQGA 3EYZA 3AQMA 2AGQA 2PI5A 8ICCA 4IRKA 4DF8A 2IHNA 1TVAA 1TV9A 3Q8SB 2JEGA 8ICIA 2XCAA 1L5UA 4WC1A 5L9XA 3M9NB 3G6YA 5CJ7A 2HHUA 3AU2A 1SKWA 4ELTA 5DQIA 1JMSA 4R64A 4RQ6A 2W8LA 3AU6A 3RJKA 3C2MA 4ZH4A 4KTQA 4Q8FA 1U49A 4UD4A 3PNCA 2BCSA 3NYBA 4WBYA 2H5XA 4I2JA 4PHPA 4KITB 4WC2A 5KT3A 1TKDA 3KHHA 1ZQJA 1X9SA 5HRKA 1MIVA 4FS2A 1U9LA 4ED0A 4M6WB 4J9SA 1XU4A 4JV0A 5KG0A 9ICAA 1JAJA 3LWMA 3V6JA 1DK3A 5CP2A 1BVSA 4P4MA 4RZRA 3AQKA 2V4QA 1ZQQA 2PFOA 2JEIA 3K4GA 4Q44A 2C2EA 1RXVA 2AQ4A 2IA6A 3H39A 3H8JA 4M9NA 2ZJAA 5KFCA 4DQQA 5EWFA 2ASDA 2R8JA 4PGYA 4WBZA 1HJPA 2ZH3A 5BPCA 1SL2A 4Q43A 3RJJA 4MF8A 7ICHA 1MIWA 3AQLA 1MSWD 1N48A 4ED2A 1WOTA 4UD5A 2KZZA 4HYKA 3NGDA 4IR1A 1MC8A 1WCNA 4IQWA 4NKTA 5KFDA 2ASJA 4Z6FA 2FPLA 4B9TA 4PHAA 1YLQA 4BWJA 4RWOA 3HPOA 1RPLA 4O9MA 5HP4A 5C5JA 5KFBA 2NRTA 5KFRA 1KFSA 4KLFA 4KN4A 1DK2A 1JN3A 3RJHA 7ICOA 1Q79A 4RUCA 3L9DA 4RQ5A 3ISBA 4RQ1A 2Y1IA 4YMNA 3RR8A 4M9JA 1ZJNA 5J29A 8ICLA 4QZGA 4EBCA 3OJSA 3RJFA 3C21A 3LQCB 1EXNA 5DQGA 1ZYQA 2HVHA 4M5DA 4I2HA 1IM4A 3T5LA 3TAPA 3IHQB 1TAUA 1XO1A 3OHBA 8ICRA 4RU9A 2DRBA 8ICMA 1BGXT 5TZVA 3HW8A 5DB7A 4X0AA 5KFLA 2XGPA 3HJ4A 4F5NA 1PX5A 5HR9A 1SL0A 2W9BB 4ECZA 2IHMA 5KT6A 3ZD9A 4WC4A 3RTVA 4EEYA 1C7YA 1RXWA 3UPSA 1U45A 1TK0A 4KLDA 4ECQA 5KFJA 5L1LA 5DB8A 8ICGA 2DR9A 2UVVA 2ZTEA 4RQ4A 4GXJA 2V9WA 4UAYA 1ZQYA 4NLNA 5KFFA 2AJQA 2MUTB 2P6UA 4P4OA 4DFKA 4MFFA 4WC0A 3V6HA 4C8KA 3C5FA 2C2RA 1X9MA 3BQ1A 1SZPA 4YN4A 4DL4A 5HRDA 2Q66A 9ICJA 4QWBA 4BDPA 2BE3A 3T5KA 4DS5A 3OSPA 4X4OA 2GWSA 4J9LA 4ED7A 5IILA 8ICTA 2J6SA 2VA2A 3PW5A 2FLNA 7ICMA 2BQ3A 1ZQIA 2AGPA 4YR3A 4G3IA 5HREA 5L1KA 3BDPA 4YVZA 4DS4A 4EZ6A 1NKBA 3KTQA 2BCVA 3H37A 4X4NA 9ICMA 3RJEA 2NRVA 5IIMA 1N56A 3ORYA 3C5GA 3H3AA 9ICKA 2ZHBA 3OUYA 2NRWA 5DG9A 3PW7A 1ZQBA 4RNNA 2JZBB 1UA0A 1ZQRA 4DQIA 4B9SA 4KMUA 5IIJA 3RB6A 7ICIA 4DOBA 1Q78A 3OUYB 1UT8A 3JPTA 8ICFA 2M2TA 1NOMA 3PV8A 2F1HA 4R66A 3PMLA 3RB3A 1XSNA 4NM1A 4B9LA 5KG7A 4B9MA 2HHSA 9ICSA 3RH4A 5HRIA 5DBAA 4R8UA 2BPCA 8ICXA 4EBKA 4DLGA 1DOQA 4S3NA 4PPXA 5HMLA 1RYSA 2M9NA 4E80A 5DDYA 4Z6DA 7ICTA 1ZQPA 2PXIA 4I2EA 7ICKA 4J9OA 2ZH4A 1IXRA 1XWLA 4YR2A 4P4PA 4NLZA 4KLUA 2W8KA 4I2DA 4ATBA 1JIHA 4AT8A 1D8YA 4F92B 3GFKB 5DKWA 4YD2A 1S10A 2UVUA 3ISCA 4F4KA 1JQRA 5J2CA 3M8SA 9ICPA 3OGUA 3KHRA 3MGHA 4GC6A 4M9LA 1F5AA 1KRPA 5J0SA 4DL3A 4QZCA 3HX0A 5L1JA 1H38A 1ZQSA 4I2FA 4UBCA 9ICFA 2HHVA 2C2DA 5J0RA 5J0XA 3H4BA 4KLHA 1RZTA 3Q8KA 1S0VA 1ZQAA 5KFTA 3Q8QB 3UQ0A 1BNOA 3LDAA 3GIJA 4K4HA 3KHLA 4UAZA 2W9MA 5KFZA 4J9RA 2KN7A 1NK9A 4GLXA 4RT2A 9ICQA 7ICSA 1T3NA 5D4BA 9ICXA 5J2DA 3BQTA 4M6WA 3QZ7A 2BCQA 4I27A 2FPMA 3RJIA 4YP3A 3RAQA 2R8GA 3SYZA 2M2WA 3PR5B 4IG8A 2DPIA 4ECUA 4QWEA 4O5EA 5KFOA 1L3TA 1KFTA 3OVSA 2F1IA 4PHDA 4EP7A 3C23A 4EBEA 4DQSA 4IQUA 4F5RA 5KFEA 1ZQWA 5D49A 2KP7A 1NJXA 5HRFA 5KFPA 3C66A 3PO4A 5KFIA 4BWMA 3H40A 3RAXA 2J6UA 2C28A 2DFLA 3OVAA 4QW8A 4QZFA 1TFRA 3GDXA 2B21A 4NM2A 5KT4A 5DBBA 4DEZA 1QSLA 3ZDBA 9ICNA 4PH5A 3SV4A 2ZH2A 3QZ8A 4NLKA 2KTQA 1QLNA 4YR0A 8ICJA 1S97A 2ZJ5A 3H8WA 2DPJA 4QZAA 1QSSA 4MEYA 7ICPA 5KFWA 9ICIA 2PFQA 3KHGA 3MDAA 5KG6A 5BOLA 2R8HA 1BPYA 4F4XA 1UA1A 4M9GA 4YG2A 4NXZA 5IIKA 4F3OA 3HT3A 3PO5A 3OVBA 3MBYA 3WFOA 4WCWA 1NK7A 5J0YA 3LWLA 3GIIA 2ZH7A 5J2FA 4YQWA 2DRAA 4I2GA 3ZDDA 2DVIA 9ICGA 4PHEA 1X9WA 4I28A 2R8KA 4TQRA 4DOAA 3T5HA 5DGAA 5KG5A 3T5JA 1HUZA 9ICUA 2NRZA 2V4RA 4LT6A 2ZTDA 1ZETA 4DL7A 1ZJMA 1NK4A 3EPGA 2KFNA 2ZH8A 4O3OA 1VFGA 4I2CA 2Q0ZX 5CA7A 4DLEA 1DGSA 2W9BA 3G6VA 1XC9A 2FMQA 4O5CA 4KLJA 4GC7A 3V6KA 5F9LA 2BPGA 4RQ2A 1KSPA 4FH3A 2UVWA 3SZ2A 5DBCA 1Z00B 2ATLA 4FHXA 5EOZA 3AQNA 4DSJA 5KFYA 3SI8A 1KTQA 4J9PA 4FHPA 2MUTA 4J9MA 4M0AA 3GIMA 1ZQHA 5DECA 2ZUDA 2JEJA 3AUOA 4E0DA 3V7LA 8ICBA 4X0BA 3GV5B 3PW4A 4UBBA 3WFPA 1BPEA 1NK6A 2F1JA 2ZUCA 5HNKA 3QEAZ 3RBEA 4ECVA 3PW2A 3ETLA 4FHYA 5JUMA 1AROP 1UETA 7ICRA 2RDJA 1NJYA 2BGWA 2KZMA 4RWPA 3JYYA 3G6XA 3QEBZ 4FHWA 5J2EA 3MDCA 4QWDA 4BGDA 3RBDA 3Q8LA 4KLIA 3PW0A 3HIYA 4FO6A 4M47A 9ICWA 4RPYA 2W9AA 1SL1A 4YCXA 4QZ8A 2O1PA 1TFWA 1K1QA 4DFPA 4PGXA 3MGIA 3GIKA 4LZGA 3M9OB 2BQRA 4UAWA 4LVSA 2JZBA 4DSFA 1UT5A 5KFAA 4F5PA 4C8OA 4O3QA 4UB3A 3TARA 3Q8PB 2FMPA 4FH5A 4O3PA 2BKEA 4M9HA 4C8MA 4DSLA 5KG4A 2AGOA 4E7XA 3UQ2A 2AQ0A 1R8AA 2ZHAA 4MFAA 2IMWP 2ZH5A 1BPXA 3RRGA 4IQTA 4AT7B 4FBUA 1HUOA 4IQVA 5EWGA 4ECWA 2J6TA 9ICTA 4X4VA 4NY8A 9ICLA 2IBKA 3PVXA 5EWEA 5J0WA 4ELVA 4FHVA 3TI0A 4F8RA 4I2IA 4DSEA 4F2RA 7ICFA 3UXPA 3EPIA 5J2HA 1NK8A 2FLPA 5DB9A 2R8IA 2BR0A 2JEFA 4O5KA 3H7IA 1UEUA 4MF2A 3TFSA 4IRCA 4Z6EA 4EBDA 5J2IA 4TURA 3BJYA 2HVIA 4QW9A 3MR6A 2HHTA 1VJ7A 5IINA 3M9MB 2O5AA 3ISDA 1U48A 9ICCA 5KT2A 3MR3A 4I29A 3V72A 1ZQTA 8ICEA 4R63A 3EW9A 5KTQA 4ECXA 3RB0A 4RUAA 2W9CA 1S0OA 1L3VA 3JZ0A 4RPZA 4BXOA 3ZDCA 4KLOA 4F91B 3BQ0A 4FS1A 5J0OA 1NKEA 2I9GA 4XQ7A 4XA5A 1BPBA 1PZNA 2W9CB 4UB2A 4GXKA 1SKRA 4O3SA 3C18A 4EBJA 4DSKA 1D8LA 5J0QA 1ZQCA 4BXOB 2UVRA 4ELUA 5HRGA 2P66A 7ICVA 4ECSA 5HRBA 5J2BA 1T8EA 2XC9A 5DDMA 1JXLA 3RJGA 4O3RA 5KFQA 4MFCA 4QZIA 2FMSA 4O3NA 4JWMA 4F2SA 1V4AA 3HWTA 3RH5A 1NJWA 1B22A 5F2VO 4QZHA 2DR8A 8ICWA 2ZH6A 4TQSA 2A1JB 2WTFA 3TANA 5BOMA 5F9NA 4QZ9A 2M2UA 2ASLA 4ED1A 5KFXA 1A76A 1ZQZA 4IRDA 4KN7A 3GILA 4B9UA 1R89A 4X4QA 5CB1A 3Q8RB 4GXIA 2DR7A 5KFHA 4NKUA 3MR2A 4WC7A 2Y1JA 3PY8A 3V7JA 1R8BA 3EWAA 4LZDA 4TUSA 1RYRA 1MQ2A 1S9FA 3OSNA 2BCRA 1OU5A 3C1YA 4J9QA 7ICUA 3WFQE 4J9KA 4F50A 8ICQA 2FPKA 2VANA 5HHHA 3C1ZA 5KT7A 3JPOA 4RQ8A 2XY5A 5IIOA 3RB4A 1WCLA 4MEXA 4JV2A 4K4IA 1NK0A 3TFRA 5KG2A 2BCUA 4DO9A 4JK1A 1A77A 5KFMA 4F5QA 2ZH1A 2BQUA 4FBTA 5KG1A 4XRHA 5KFUA 8ICYA 5L1IA 3PR4A 4ED6A 3TAQA 4JWNA 2XY7A 4QZDA 1ZQFA 3B0YA 4PGQA 5J0PA 2XCPA 4F5OA 3RR7A 1NO5A 1LB2B 5IIIA 4Q45A 4UB4A 2ISPA 4P2HA 7ICEA 5HC9A 4XUSA 4KLEA 3OV7A 4DWIA 1S76D 3UXNA 1D9FA 4RNOA 3E2EA 3TQ1A 4X4TA 1SKSA 2M2VA 2PBEA 4WC6A 4EYIB 2BPFA 4B9NA 4X4PA 3UPQA 2ID1A 3GV7B 7ICQA 5DEDA 1CUKA 1U4BA 4DQRA 4F93B 4I2BA 5HRLA 2BDPA 4QWAA 1Z3EB 1ZQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NKC A;  4TUQ A;  4UQG A;  2PFP A;  4B9V A;  3PX6 A;  4WC5 A;  4F4Z A;  8ICS A;  4DFJ A;  5KG3 A;  1KNY A;  5DG7 A;  1Z00 A;  3MAB A;  3GV8 B;  1ZQN A;  4M2Y A;  1JX4 A;  5DB6 A;  3HJ1 A;  1BPD A;  4YXM A;  5J0U A;  5J2J A;  1XSL A;  3MR5 A;  1XSP A;  2PFN A;  4WC3 A;  4JUZ A;  8ICN A;  1NK5 A;  1T4G A;  4YMM A;  8ICH A;  8ICO A;  4DOC A;  4X4S A;  1KLN A;  1MIY A;  1ZQU A;  2VA8 A;  1QTM A;  3PX4 A;  1D9D A;  4KLS A;  1KEJ A;  4YFK A;  1L3S A;  5CR0 A;  5KFN A;  4Q8E A;  4KLQ A;  3ZDE A;  1X2I A;  4KLG A;  1ZQL A;  1Y88 A;  5DG8 A;  1QSY A;  3NTU A;  4KLM A;  3H8S A;  1TAQ A;  2ISO A;  4DF4 A;  3GQC A;  2NRX A;  4DL5 A;  1U47 A;  4DQP A;  4C8L A;  3SV3 A;  3H38 A;  1TFY A;  1B43 A;  5J2G A;  4UB5 A;  5DQH A;  3THV A;  8ICZ A;  3IM1 A;  1FA0 A;  3N97 B;  5DGB A;  9ICV A;  3B0X A;  4YD1 A;  3PX0 A;  2VA3 A;  3PMN A;  2KFZ A;  3ZDA A;  4NLG A;  3Q8M A;  5CHG A;  1KDH A;  4ECY A;  3QE9 Y;  2I1Q A;  2ZUB A;  5KFK A;  5HHI A;  4RNM A;  3JPN A;  1MQ3 A;  4AT7 A;  4R65 A;  4RT3 A;  4F4W A;  1T7P A;  4RQ7 A;  2P6R A;  1S0N A;  2NRK A;  4DSI A;  4IR9 A;  1JXE A;  4Z6C A;  1S77 D;  3WFR E;  4JV1 A;  1CEZ A;  9ICO A;  3RRH A;  2XO7 A;  4I2A A;  2KZ3 A;  5D46 A;  5HMM A;  3MFH A;  5CWR A;  1R8C A;  3V7K A;  1L3U A;  4KLT A;  7ICL A;  9ICE A;  4DFM A;  5KFS A;  7ICN A;  3OJU A;  2XGQ A;  2RDI A;  1ZQE A;  8ICU A;  2HW3 A;  2ALZ A;  2MAX A;  5KFV A;  1ZQK A;  4EYH B;  7ICJ A;  2RFF A;  2OWO A;  2HHW A;  3OHA A;  4X4R A;  4F4Y A;  3FDS A;  4RQ3 A;  3C2L A;  2BHN A;  5HRH A;  3LK9 A;  4EZ9 A;  2LYH A;  4E8F A;  8ICK A;  4X4U A;  3K75 D;  2HHX A;  1TK5 A;  9ICR A;  4M04 A;  5J2K A;  2ZJ8 A;  4YMO A;  4RWQ A;  4ED3 A;  2HHQ A;  4ECR A;  3JPP A;  3JPQ A;  9ICH A;  2ZTC A;  5DLF A;  4RWN A;  3JPS A;  4UB1 A;  3JPR A;  1XS9 D;  4K4G A;  3UXO A;  3ZD8 A;  1ZQM A;  4KLL A;  8ICA A;  1BNP A;  4CCH A;  5KT5 A;  1K1S A;  1V9P A;  3FYH A;  5J0T A;  4QWC A;  3BQ2 A;  1BPZ A;  3H4D A;  4ED8 A;  2ZH9 A;  4R8U B;  1TK8 A;  5J2A A;  3T3F A;  1KFD A;  4QZB A;  3M8R A;  3MFI A;  5KFG A;  1ZQX A;  2A1J A;  4RPX A;  2AU0 A;  4J9N A;  2HHP A;  1NJZ A;  9ICB A;  3RH6 A;  2DR5 A;  1S0M A;  4ECT A;  8ICP A;  2FLL A;  2C22 A;  1UEV A;  4AT9 A;  5DLG A;  4AT8 B;  4ATB B;  7ICG A;  3C2K A;  4XQ8 A;  3WFS C;  4TUP A;  2XY6 A;  1ZQD A;  1COO A;  8ICV A;  4RQ0 A;  1NZP A;  4C8N A;  1ZQV A;  3HP6 A;  3EZ5 A;  4QZE A;  4DL2 A;  4O0I A;  4AT9 B;  1LV5 A;  2PI4 A;  4YXJ A;  3N4M B;  4X5V A;  4DL6 A;  1ZQG A;  3EYZ A;  3AQM A;  2AGQ A;  2PI5 A;  8ICC A;  4IRK A;  4DF8 A;  2IHN A;  1TVA A;  1TV9 A;  3Q8S B;  2JEG A;  8ICI A;  2XCA A;  1L5U A;  4WC1 A;  5L9X A;  3M9N B;  3G6Y A;  5CJ7 A;  2HHU A;  3AU2 A;  1SKW A;  4ELT A;  5DQI A;  1JMS A;  4R64 A;  4RQ6 A;  2W8L A;  3AU6 A;  3RJK A;  3C2M A;  4ZH4 A;  4KTQ A;  4Q8F A;  1U49 A;  4UD4 A;  3PNC A;  2BCS A;  3NYB A;  4WBY A;  2H5X A;  4I2J A;  4PHP A;  4KIT B;  4WC2 A;  5KT3 A;  1TKD A;  3KHH A;  1ZQJ A;  1X9S A;  5HRK A;  1MIV A;  4FS2 A;  1U9L A;  4ED0 A;  4M6W B;  4J9S A;  1XU4 A;  4JV0 A;  5KG0 A;  9ICA A;  1JAJ A;  3LWM A;  3V6J A;  1DK3 A;  5CP2 A;  1BVS A;  4P4M A;  4RZR A;  3AQK A;  2V4Q A;  1ZQQ A;  2PFO A;  2JEI A;  3K4G A;  4Q44 A;  2C2E A;  1RXV A;  2AQ4 A;  2IA6 A;  3H39 A;  3H8J A;  4M9N A;  2ZJA A;  5KFC A;  4DQQ A;  5EWF A;  2ASD A;  2R8J A;  4PGY A;  4WBZ A;  1HJP A;  2ZH3 A;  5BPC A;  1SL2 A;  4Q43 A;  3RJJ A;  4MF8 A;  7ICH A;  1MIW A;  3AQL A;  1MSW D;  1N48 A;  4ED2 A;  1WOT A;  4UD5 A;  2KZZ A;  4HYK A;  3NGD A;  4IR1 A;  1MC8 A;  1WCN A;  4IQW A;  4NKT A;  5KFD A;  2ASJ A;  4Z6F A;  2FPL A;  4B9T A;  4PHA A;  1YLQ A;  4BWJ A;  4RWO A;  3HPO A;  1RPL A;  4O9M A;  5HP4 A;  5C5J A;  5KFB A;  2NRT A;  5KFR A;  1KFS A;  4KLF A;  4KN4 A;  1DK2 A;  1JN3 A;  3RJH A;  7ICO A;  1Q79 A;  4RUC A;  3L9D A;  4RQ5 A;  3ISB A;  4RQ1 A;  2Y1I A;  4YMN A;  3RR8 A;  4M9J A;  1ZJN A;  5J29 A;  8ICL A;  4QZG A;  4EBC A;  3OJS A;  3RJF A;  3C21 A;  3LQC B;  1EXN A;  5DQG A;  1ZYQ A;  2HVH A;  4M5D A;  4I2H A;  1IM4 A;  3T5L A;  3TAP A;  3IHQ B;  1TAU A;  1XO1 A;  3OHB A;  8ICR A;  4RU9 A;  2DRB A;  8ICM A;  1BGX T;  5TZV A;  3HW8 A;  5DB7 A;  4X0A A;  5KFL A;  2XGP A;  3HJ4 A;  4F5N A;  1PX5 A;  5HR9 A;  1SL0 A;  2W9B B;  4ECZ A;  2IHM A;  5KT6 A;  3ZD9 A;  4WC4 A;  3RTV A;  4EEY A;  1C7Y A;  1RXW A;  3UPS A;  1U45 A;  1TK0 A;  4KLD A;  4ECQ A;  5KFJ A;  5L1L A;  5DB8 A;  8ICG A;  2DR9 A;  2UVV A;  2ZTE A;  4RQ4 A;  4GXJ A;  2V9W A;  4UAY A;  1ZQY A;  4NLN A;  5KFF A;  2AJQ A;  2MUT B;  2P6U A;  4P4O A;  4DFK A;  4MFF A;  4WC0 A;  3V6H A;  4C8K A;  3C5F A;  2C2R A;  1X9M A;  3BQ1 A;  1SZP A;  4YN4 A;  4DL4 A;  5HRD A;  2Q66 A;  9ICJ A;  4QWB A;  4BDP A;  2BE3 A;  3T5K A;  4DS5 A;  3OSP A;  4X4O A;  2GWS A;  4J9L A;  4ED7 A;  5IIL A;  8ICT A;  2J6S A;  2VA2 A;  3PW5 A;  2FLN A;  7ICM A;  2BQ3 A;  1ZQI A;  2AGP A;  4YR3 A;  4G3I A;  5HRE A;  5L1K A;  3BDP A;  4YVZ A;  4DS4 A;  4EZ6 A;  1NKB A;  3KTQ A;  2BCV A;  3H37 A;  4X4N A;  9ICM A;  3RJE A;  2NRV A;  5IIM A;  1N56 A;  3ORY A;  3C5G A;  3H3A A;  9ICK A;  2ZHB A;  3OUY A;  2NRW A;  5DG9 A;  3PW7 A;  1ZQB A;  4RNN A;  2JZB B;  1UA0 A;  1ZQR A;  4DQI A;  4B9S A;  4KMU A;  5IIJ A;  3RB6 A;  7ICI A;  4DOB A;  1Q78 A;  3OUY B;  1UT8 A;  3JPT A;  8ICF A;  2M2T A;  1NOM A;  3PV8 A;  2F1H A;  4R66 A;  3PML A;  3RB3 A;  1XSN A;  4NM1 A;  4B9L A;  5KG7 A;  4B9M A;  2HHS A;  9ICS A;  3RH4 A;  5HRI A;  5DBA A;  4R8U A;  2BPC A;  8ICX A;  4EBK A;  4DLG A;  1DOQ A;  4S3N A;  4PPX A;  5HML A;  1RYS A;  2M9N A;  4E80 A;  5DDY A;  4Z6D A;  7ICT A;  1ZQP A;  2PXI A;  4I2E A;  7ICK A;  4J9O A;  2ZH4 A;  1IXR A;  1XWL A;  4YR2 A;  4P4P A;  4NLZ A;  4KLU A;  2W8K A;  4I2D A;  4ATB A;  1JIH A;  4AT8 A;  1D8Y A;  4F92 B;  3GFK B;  5DKW A;  4YD2 A;  1S10 A;  2UVU A;  3ISC A;  4F4K A;  1JQR A;  5J2C A;  3M8S A;  9ICP A;  3OGU A;  3KHR A;  3MGH A;  4GC6 A;  4M9L A;  1F5A A;  1KRP A;  5J0S A;  4DL3 A;  4QZC A;  3HX0 A;  5L1J A;  1H38 A;  1ZQS A;  4I2F A;  4UBC A;  9ICF A;  2HHV A;  2C2D A;  5J0R A;  5J0X A;  3H4B A;  4KLH A;  1RZT A;  3Q8K A;  1S0V A;  1ZQA A;  5KFT A;  3Q8Q B;  3UQ0 A;  1BNO A;  3LDA A;  3GIJ A;  4K4H A;  3KHL A;  4UAZ A;  2W9M A;  5KFZ A;  4J9R A;  2KN7 A;  1NK9 A;  4GLX A;  4RT2 A;  9ICQ A;  7ICS A;  1T3N A;  5D4B A;  9ICX A;  5J2D A;  3BQT A;  4M6W A;  3QZ7 A;  2BCQ A;  4I27 A;  2FPM A;  3RJI A;  4YP3 A;  3RAQ A;  2R8G A;  3SYZ A;  2M2W A;  3PR5 B;  4IG8 A;  2DPI A;  4ECU A;  4QWE A;  4O5E A;  5KFO A;  1L3T A;  1KFT A;  3OVS A;  2F1I A;  4PHD A;  4EP7 A;  3C23 A;  4EBE A;  4DQS A;  4IQU A;  4F5R A;  5KFE A;  1ZQW A;  5D49 A;  2KP7 A;  1NJX A;  5HRF A;  5KFP A;  3C66 A;  3PO4 A;  5KFI A;  4BWM A;  3H40 A;  3RAX A;  2J6U A;  2C28 A;  2DFL A;  3OVA A;  4QW8 A;  4QZF A;  1TFR A;  3GDX A;  2B21 A;  4NM2 A;  5KT4 A;  5DBB A;  4DEZ A;  1QSL A;  3ZDB A;  9ICN A;  4PH5 A;  3SV4 A;  2ZH2 A;  3QZ8 A;  4NLK A;  2KTQ A;  1QLN A;  4YR0 A;  8ICJ A;  1S97 A;  2ZJ5 A;  3H8W A;  2DPJ A;  4QZA A;  1QSS A;  4MEY A;  7ICP A;  5KFW A;  9ICI A;  2PFQ A;  3KHG A;  3MDA A;  5KG6 A;  5BOL A;  2R8H A;  1BPY A;  4F4X A;  1UA1 A;  4M9G A;  4YG2 A;  4NXZ A;  5IIK A;  4F3O A;  3HT3 A;  3PO5 A;  3OVB A;  3MBY A;  3WFO A;  4WCW A;  1NK7 A;  5J0Y A;  3LWL A;  3GII A;  2ZH7 A;  5J2F A;  4YQW A;  2DRA A;  4I2G A;  3ZDD A;  2DVI A;  9ICG A;  4PHE A;  1X9W A;  4I28 A;  2R8K A;  4TQR A;  4DOA A;  3T5H A;  5DGA A;  5KG5 A;  3T5J A;  1HUZ A;  9ICU A;  2NRZ A;  2V4R A;  4LT6 A;  2ZTD A;  1ZET A;  4DL7 A;  1ZJM A;  1NK4 A;  3EPG A;  2KFN A;  2ZH8 A;  4O3O A;  1VFG A;  4I2C A;  2Q0Z X;  5CA7 A;  4DLE A;  1DGS A;  2W9B A;  3G6V A;  1XC9 A;  2FMQ A;  4O5C A;  4KLJ A;  4GC7 A;  3V6K A;  5F9L A;  2BPG A;  4RQ2 A;  1KSP A;  4FH3 A;  2UVW A;  3SZ2 A;  5DBC A;  1Z00 B;  2ATL A;  4FHX A;  5EOZ A;  3AQN A;  4DSJ A;  5KFY A;  3SI8 A;  1KTQ A;  4J9P A;  4FHP A;  2MUT A;  4J9M A;  4M0A A;  3GIM A;  1ZQH A;  5DEC A;  2ZUD A;  2JEJ A;  3AUO A;  4E0D A;  3V7L A;  8ICB A;  4X0B A;  3GV5 B;  3PW4 A;  4UBB A;  3WFP A;  1BPE A;  1NK6 A;  2F1J A;  2ZUC A;  5HNK A;  3QEA Z;  3RBE A;  4ECV A;  3PW2 A;  3ETL A;  4FHY A;  5JUM A;  1ARO P;  1UET A;  7ICR A;  2RDJ A;  1NJY A;  2BGW A;  2KZM A;  4RWP A;  3JYY A;  3G6X A;  3QEB Z;  4FHW A;  5J2E A;  3MDC A;  4QWD A;  4BGD A;  3RBD A;  3Q8L A;  4KLI A;  3PW0 A;  3HIY A;  4FO6 A;  4M47 A;  9ICW A;  4RPY A;  2W9A A;  1SL1 A;  4YCX A;  4QZ8 A;  2O1P A;  1TFW A;  1K1Q A;  4DFP A;  4PGX A;  3MGI A;  3GIK A;  4LZG A;  3M9O B;  2BQR A;  4UAW A;  4LVS A;  2JZB A;  4DSF A;  1UT5 A;  5KFA A;  4F5P A;  4C8O A;  4O3Q A;  4UB3 A;  3TAR A;  3Q8P B;  2FMP A;  4FH5 A;  4O3P A;  2BKE A;  4M9H A;  4C8M A;  4DSL A;  5KG4 A;  2AGO A;  4E7X A;  3UQ2 A;  2AQ0 A;  1R8A A;  2ZHA A;  4MFA A;  2IMW P;  2ZH5 A;  1BPX A;  3RRG A;  4IQT A;  4AT7 B;  4FBU A;  1HUO A;  4IQV A;  5EWG A;  4ECW A;  2J6T A;  9ICT A;  4X4V A;  4NY8 A;  9ICL A;  2IBK A;  3PVX A;  5EWE A;  5J0W A;  4ELV A;  4FHV A;  3TI0 A;  4F8R A;  4I2I A;  4DSE A;  4F2R A;  7ICF A;  3UXP A;  3EPI A;  5J2H A;  1NK8 A;  2FLP A;  5DB9 A;  2R8I A;  2BR0 A;  2JEF A;  4O5K A;  3H7I A;  1UEU A;  4MF2 A;  3TFS A;  4IRC A;  4Z6E A;  4EBD A;  5J2I A;  4TUR A;  3BJY A;  2HVI A;  4QW9 A;  3MR6 A;  2HHT A;  1VJ7 A;  5IIN A;  3M9M B;  2O5A A;  3ISD A;  1U48 A;  9ICC A;  5KT2 A;  3MR3 A;  4I29 A;  3V72 A;  1ZQT A;  8ICE A;  4R63 A;  3EW9 A;  5KTQ A;  4ECX A;  3RB0 A;  4RUA A;  2W9C A;  1S0O A;  1L3V A;  3JZ0 A;  4RPZ A;  4BXO A;  3ZDC A;  4KLO A;  4F91 B;  3BQ0 A;  4FS1 A;  5J0O A;  1NKE A;  2I9G A;  4XQ7 A;  4XA5 A;  1BPB A;  1PZN A;  2W9C B;  4UB2 A;  4GXK A;  1SKR A;  4O3S A;  3C18 A;  4EBJ A;  4DSK A;  1D8L A;  5J0Q A;  1ZQC A;  4BXO B;  2UVR A;  4ELU A;  5HRG A;  2P66 A;  7ICV A;  4ECS A;  5HRB A;  5J2B A;  1T8E A;  2XC9 A;  5DDM A;  1JXL A;  3RJG A;  4O3R A;  5KFQ A;  4MFC A;  4QZI A;  2FMS A;  4O3N A;  4JWM A;  4F2S A;  1V4A A;  3HWT A;  3RH5 A;  1NJW A;  1B22 A;  5F2V O;  4QZH A;  2DR8 A;  8ICW A;  2ZH6 A;  4TQS A;  2A1J B;  2WTF A;  3TAN A;  5BOM A;  5F9N A;  4QZ9 A;  2M2U A;  2ASL A;  4ED1 A;  5KFX A;  1A76 A;  1ZQZ A;  4IRD A;  4KN7 A;  3GIL A;  4B9U A;  1R89 A;  4X4Q A;  5CB1 A;  3Q8R B;  4GXI A;  2DR7 A;  5KFH A;  4NKU A;  3MR2 A;  4WC7 A;  2Y1J A;  3PY8 A;  3V7J A;  1R8B A;  3EWA A;  4LZD A;  4TUS A;  1RYR A;  1MQ2 A;  1S9F A;  3OSN A;  2BCR A;  1OU5 A;  3C1Y A;  4J9Q A;  7ICU A;  3WFQ E;  4J9K A;  4F50 A;  8ICQ A;  2FPK A;  2VAN A;  5HHH A;  3C1Z A;  5KT7 A;  3JPO A;  4RQ8 A;  2XY5 A;  5IIO A;  3RB4 A;  1WCL A;  4MEX A;  4JV2 A;  4K4I A;  1NK0 A;  3TFR A;  5KG2 A;  2BCU A;  4DO9 A;  4JK1 A;  1A77 A;  5KFM A;  4F5Q A;  2ZH1 A;  2BQU A;  4FBT A;  5KG1 A;  4XRH A;  5KFU A;  8ICY A;  5L1I A;  3PR4 A;  4ED6 A;  3TAQ A;  4JWN A;  2XY7 A;  4QZD A;  1ZQF A;  3B0Y A;  4PGQ A;  5J0P A;  2XCP A;  4F5O A;  3RR7 A;  1NO5 A;  1LB2 B;  5III A;  4Q45 A;  4UB4 A;  2ISP A;  4P2H A;  7ICE A;  5HC9 A;  4XUS A;  4KLE A;  3OV7 A;  4DWI A;  1S76 D;  3UXN A;  1D9F A;  4RNO A;  3E2E A;  3TQ1 A;  4X4T A;  1SKS A;  2M2V A;  2PBE A;  4WC6 A;  4EYI B;  2BPF A;  4B9N A;  4X4P A;  3UPQ A;  2ID1 A;  3GV7 B;  7ICQ A;  5DED A;  1CUK A;  1U4B A;  4DQR A;  4F93 B;  4I2B A;  5HRL A;  2BDP A;  4QWA A;  1Z3E B;  1ZQO A; 
#chains in the Genus database with same CATH topology
 1NKC A;  2PFP A;  4B9V A;  2F76 X;  2QLT A;  3DEE A;  5EE9 A;  4IC9 A;  1HEK A;  3HJ1 A;  4YXM A;  4JUZ A;  2BDU A;  1T4G A;  4WH5 A;  1WUD A;  1X2I A;  4KLG A;  2DGZ A;  4KLM A;  3H8S A;  5JTG A;  1FEZ A;  2E8N A;  1SV4 A;  4CDG A;  3H38 A;  2RRD A;  2Y0S C;  3N97 B;  5DGB A;  3JCF A;  3H0R B;  2VA3 A;  3NVV A;  4FFD A;  5ALD A;  2E8O A;  2KFZ A;  3AN1 A;  3QE9 Y;  2I1Q A;  2ZUB A;  3M1Y A;  2FCL A;  5ALK A;  4MHV A;  4R65 A;  2P6R A;  4RQ7 A;  4DSI A;  3UMG A;  3C28 A;  9ICO A;  1YZ6 A;  3RRH A;  5AKI A;  1URJ A;  4KLT A;  7ICL A;  4GIB A;  2YX8 A;  3HIL A;  2GO7 A;  2RDI A;  4EYH B;  1K5O A;  7ICJ A;  3H8M A;  3M7D A;  4RQ3 A;  2HMX A;  2BHN A;  5D61 A;  1JRP A;  5ALX A;  1PUZ A;  1TK5 A;  3TAD A;  5J2K A;  1B0X A;  3D2Q A;  4ECR A;  3JPQ A;  2ZTC A;  4RWN A;  3ERC C;  1XS9 D;  3UXO A;  1ZQM A;  1BNP A;  4CCH A;  1K1S A;  1V9P A;  4EEK A;  3D6J A;  4R8U B;  1M6Y A;  3T3F A;  2W3S A;  3OTQ A;  4UAV A;  4RPX A;  4ECT A;  2K89 A;  4ATB B;  3WFS C;  3CYM A;  4DL2 A;  4O0I A;  4DL6 A;  2ZIV B;  2AGQ A;  4IRK A;  2JEG A;  1WYG A;  2LYA A;  3G6Y A;  1SKW A;  2KIC A;  1JMS A;  4R64 A;  4RQ6 A;  4ZH4 A;  2HBJ A;  4WBY A;  5ALY A;  3AQF A;  3ONN A;  1ZQJ A;  1MIV A;  4EV6 A;  1XU4 A;  2KHQ A;  3TKA A;  3SR6 A;  5KG0 A;  3L3F X;  3WK5 A;  2F8L A;  5AI0 A;  1BVS A;  2G5I B;  3R9K A;  2OEH A;  2C2E A;  2AQ4 A;  3H8J A;  2W54 A;  1O08 A;  2ZJA A;  5KFC A;  2ASD A;  2W03 A;  4PGY A;  4MF8 A;  1MIW A;  2NO4 A;  1S8O A;  4IR1 A;  1WCN A;  1VDV A;  4BWJ A;  4KLF A;  4WOY A;  2EZY A;  1Q79 A;  3RR8 A;  2Y1I A;  4M9J A;  2WF6 A;  4I2H A;  3IHQ B;  8ICR A;  5HR6 A;  1PX5 A;  2K60 A;  1MA7 A;  5AKZ A;  3RTV A;  4KLD A;  2ZXH A;  5L1L A;  2DR9 A;  4RQ4 A;  5GTI U;  4NLN A;  5AM0 A;  4WC0 A;  2HI0 A;  2P6U A;  1RG6 A;  3OPX A;  4MFF A;  5TIS U;  3C5F A;  3BQ1 A;  4BDP A;  3T5K A;  3OSP A;  3FAH A;  4Y2S A;  4X4O A;  4J9L A;  4UAS A;  4MKP A;  3CW2 C;  4YR3 A;  5L1K A;  3ER9 B;  1ZD4 A;  4DS4 A;  3QXG A;  3KTQ A;  2ZG6 A;  3QUT A;  3RJE A;  3A0H U;  2NRV A;  5IIM A;  5ALM A;  3ORY A;  5DG9 A;  2Y9T A;  2H3F A;  3PW7 A;  4B9S A;  5IIJ A;  4DOB A;  2B56 A;  3OUY B;  2M2T A;  3IV6 A;  4B9L A;  4KX3 A;  3RH4 A;  2BPC A;  5HML A;  5AKG A;  4K9B A;  4K8V A;  2H3Q A;  5CFU A;  2ZH4 A;  4NXV A;  2ZXI A;  2W8K A;  3KOO A;  3GFK B;  1S10 A;  5J2C A;  2W43 A;  3AM9 A;  4QZC A;  5L1J A;  4I2F A;  2HHV A;  2C2D A;  3Q8K A;  1S0V A;  2KJ8 A;  3TAC B;  4K4H A;  4UAZ A;  3K1R B;  4K96 A;  2KN7 A;  1NK9 A;  1S5L U;  2JMG A;  1ZXI A;  2OHF A;  4O67 A;  4M6W A;  3QZ7 A;  2AHO B;  4YP3 A;  4O5E A;  5HRF A;  4F5R A;  4IQU A;  3PO4 A;  3RAX A;  2J6U A;  3N7R C;  2C28 A;  2DFL A;  3GDX A;  2Y9U A;  2RQ5 A;  2RHF A;  1QSL A;  3SV4 A;  2ZH2 A;  2HBM A;  4YR0 A;  5AIA A;  1S97 A;  4NLB A;  4CF4 A;  2DPJ A;  4MEY A;  4P0P B;  5KFW A;  3MDA A;  1KW4 A;  5KL1 B;  5KG6 A;  1BPY A;  2WAQ F;  3I28 A;  2CXY A;  4C0Z A;  5J0Y A;  3ZDD A;  4N7R A;  2R8K A;  3T5H A;  3T5J A;  1SXE A;  1ZET A;  1ZJM A;  4I2C A;  1XO0 A;  2YN4 A;  2W9B A;  3G6V A;  4KLJ A;  2QB0 A;  4O5C A;  2PKE A;  3AQE A;  4RQ2 A;  3SZ2 A;  5B3Q A;  5EOZ A;  4DSJ A;  3AMZ A;  3GIM A;  2F8K A;  5DEC A;  3V7L A;  1V38 A;  3GV5 B;  2KSO A;  3RBE A;  3PW2 A;  3ETL A;  2GOL A;  2RDJ A;  3WK7 A;  3QEB Z;  5J2E A;  4BGD A;  3Q8L A;  4RPY A;  4KMO B;  1TFW A;  4QZ8 A;  2O1P A;  1K1Q A;  3GIK A;  2JH1 A;  4F5P A;  4C8O A;  3TAR A;  1MN8 A;  2WB1 C;  3Q8P B;  5KG4 A;  1R8A A;  2ZH5 A;  4KM5 A;  5EWG A;  1COK A;  3FM9 A;  5AM5 A;  2IBK A;  4F8R A;  1SWW A;  4F2R A;  5J2H A;  1UEU A;  2LM1 A;  2R8I A;  2BR0 A;  3F2D A;  4EBD A;  1Z1V A;  3BJY A;  3MR6 A;  1VJ7 A;  4CE6 A;  3H0L B;  1N2X A;  4R63 A;  2HCF A;  3EW9 A;  4ECX A;  2W9C A;  4RPZ A;  1RQN A;  2NYV A;  3BQ0 A;  1NKE A;  1KQQ A;  3OV7 A;  4GXK A;  3I1Y A;  3C18 A;  4DSK A;  1ZQC A;  4BXO B;  3IN5 A;  4PZO A;  5HRG A;  3QUB A;  1JUD A;  4K98 A;  1JXL A;  4MFC A;  5KFQ A;  3RH5 A;  1B22 A;  4QZH A;  2DR8 A;  8ICW A;  3TAN A;  2M2U A;  2F77 X;  1L7N A;  4JB3 A;  4BX9 C;  5D62 A;  3C1Y A;  2RP5 A;  3GZF A;  8ICQ A;  1IV8 A;  2VAN A;  3QU5 A;  3C1Z A;  4RQ8 A;  5IIO A;  2ZH1 A;  4F5Q A;  1VLB A;  2H3Z A;  2LBO A;  5KFU A;  2B51 A;  4ED6 A;  3TAQ A;  1DGJ A;  4WQL A;  2BBH A;  5AK6 A;  5HC9 A;  2DBY A;  3QU4 A;  1RDF A;  5F3X B;  1SKS A;  2M2V A;  2PBE A;  4DFD A;  5GTH U;  4EYI B;  4X4P A;  1LVH A;  2VJ5 A;  4DQR A;  4I2B A;  5K4L A;  5HRL A;  1Z3E B;  1ZQO A;  1NI3 A;  4OJ6 A;  3PX6 A;  8ICS A;  5KG3 A;  2F2A B;  3MAB A;  3GV8 B;  2PMZ F;  5DG7 A;  5J0U A;  4WC3 A;  3MR5 A;  1F0M A;  2LI6 A;  8ICH A;  1MIY A;  1O03 A;  1D9D A;  3SAG A;  2W11 A;  3PX4 A;  4Q8E A;  1L3S A;  2VIX A;  1ZQL A;  3HJE A;  1Y88 A;  5DG8 A;  1QSY A;  1PK3 A;  3NTU A;  4O68 A;  2ISO A;  4DF4 A;  4LEY A;  1TFY A;  5J2G A;  3IP4 B;  5DQH A;  1FA0 A;  1UQV A;  4NLG A;  3Q8M A;  1KDH A;  2KNJ A;  3WK8 A;  1MQ3 A;  1T7P A;  4XJE A;  1JXE A;  3QU7 A;  2G5H B;  4I2A A;  5HMM A;  3MFH A;  4AP9 A;  2GLE A;  3A0B U;  4DFM A;  3OJU A;  1ZQE A;  8ICU A;  2IOF K;  2ALZ A;  5KFV A;  1ZQK A;  2OWO A;  2HHW A;  4C4R A;  2O6K A;  3FDS A;  1ZRM A;  2QB1 A;  3LK9 A;  4E8F A;  3K75 D;  1LKY A;  9ICR A;  2ZJ8 A;  4YMO A;  3UMB A;  4ED3 A;  3JPP A;  5DLF A;  2MA1 A;  3ZD8 A;  3FYH A;  4OJ5 A;  2DKX A;  1TK8 A;  5KFG A;  2A1J A;  4RQM A;  4HAI A;  2AU0 A;  4J9N A;  9ICB A;  3ZI4 A;  2DR5 A;  8ICP A;  2FLL A;  4AT9 A;  4UB8 U;  3C2K A;  4XQ8 A;  1COO A;  4RQ0 A;  4C8N A;  1ZQV A;  4QIW F;  4QZE A;  2MU2 A;  1Z4O A;  2PI4 A;  3EYZ A;  2PI5 A;  8ICC A;  4FO1 A;  1TV9 A;  3K7D A;  1X6J A;  3M9N B;  2XI9 A;  3AU2 A;  3RJK A;  2W8L A;  4Q8F A;  3ICX A;  1U49 A;  1J2N A;  3PNC A;  2H5X A;  1Q8K A;  1NZB A;  4WC2 A;  4KIT B;  3KHH A;  2D8C A;  1U9L A;  3SD7 A;  2DKZ A;  4M6W B;  4J9S A;  1IG6 A;  3L4P A;  2IOH A;  1JAJ A;  3V6J A;  5ALE A;  4P4M A;  3IRU A;  3KKA A;  1L6N A;  4M9N A;  3S6J A;  4DQQ A;  4KX5 A;  1N60 A;  2R8J A;  1C20 A;  4WBZ A;  1HJP A;  2ZH3 A;  3QUQ A;  1SL2 A;  1YT3 A;  1MSW D;  1N48 A;  3WKE A;  4UD5 A;  2KZZ A;  5AKH A;  3NGD A;  4NKT A;  4IQW A;  4Z6F A;  5AKL A;  2FPL A;  1JI7 A;  1RPL A;  5KFB A;  2NRT A;  1KFS A;  1JN3 A;  3RJH A;  7ICO A;  4RQ1 A;  1ZJN A;  4C7Y A;  3LQC B;  3C21 A;  2HVH A;  1IM4 A;  3T5L A;  3TAP A;  2DRB A;  8ICM A;  4Y2J A;  5HR7 A;  1SL0 A;  2W9B B;  4ECZ A;  2QB0 B;  5KT6 A;  4EEY A;  5AI4 A;  3OWG A;  4ECQ A;  5KFJ A;  5L1M A;  8ICG A;  2UVV A;  2ZTE A;  5CFT A;  2V9W A;  1ZQY A;  4DFK A;  2R18 A;  4C8K A;  5HRD A;  9ICJ A;  4QWB A;  2BE3 A;  2GWS A;  2KSO B;  1SV0 A;  2FLN A;  7ICM A;  1P7D A;  2EAO A;  2HSZ A;  4G3I A;  2E5S A;  3BDP A;  5CFS A;  2ESE A;  3E0F A;  4EZ6 A;  1NKB A;  4X4N A;  9ICM A;  3C5G A;  3H3A A;  2NRW A;  4KMU A;  3RB6 A;  4ZOH C;  2HOF A;  2F1H A;  4R66 A;  4NM1 A;  9ICS A;  5DBA A;  4EBK A;  1F44 A;  4DLG A;  1DOQ A;  7ICT A;  7ICK A;  2KOB A;  1D8B A;  4P4P A;  3TAD C;  4I2D A;  1JIH A;  5DKW A;  3WK6 A;  3M8S A;  4M9L A;  9ICP A;  3MGH A;  2ES6 A;  1ZQS A;  9ICF A;  4KLH A;  5J0R A;  1Z4N A;  1RZT A;  1ZQA A;  3CNH A;  5KAI U;  4Y2R A;  3GIJ A;  3KHL A;  2HDO A;  3MGV A;  1SWV A;  2KV2 A;  5JRT A;  5KFZ A;  1N5W A;  3VCB A;  2MRL A;  9ICQ A;  1T3N A;  1KKX A;  4EEB A;  4I27 A;  2BCQ A;  2R8G A;  4UW9 A;  3BS5 A;  4QWE A;  5KFO A;  1KFT A;  4EP7 A;  3C23 A;  3J81 j;  2KP7 A;  4C7Z A;  3C66 A;  2WAQ C;  5D49 A;  3HKZ F;  5KFP A;  2VJ4 A;  5KFI A;  3OVA A;  4Y2V A;  1SXD A;  2KK0 A;  1TFR A;  5KT4 A;  4PH5 A;  1B4F A;  2KTQ A;  2ZJ5 A;  3KHG A;  5J8Y A;  1UA1 A;  5IIK A;  5AKX A;  2EDU A;  3OVB A;  4WCW A;  3GII A;  4I2G A;  1XNS A;  9ICG A;  4DOA A;  5DGA A;  2YQE A;  2KIW A;  3PST A;  2V4R A;  2ZTD A;  4PZN A;  4DL7 A;  1KL9 A;  3F2C A;  3EPG A;  1ZD3 A;  5CA7 A;  4OJL A;  1DGS A;  1XC9 A;  4UB6 U;  5F9L A;  2BPG A;  3N7P D;  4FHX A;  3AQN A;  2LHT A;  3SI8 A;  3KFU F;  4J9P A;  1X6I A;  3AUO A;  2ZIX A;  1KBU A;  3ETR A;  3PW4 A;  4PL1 A;  4UBB A;  1BPE A;  2F1J A;  2ZUC A;  4ACO A;  4U7C A;  5HNK A;  2B0C A;  3NRZ A;  4ECV A;  5JUM A;  4CGZ A;  5AM1 A;  2BGW A;  2KZM A;  4QWD A;  3QYP A;  3AL0 B;  3D2S A;  9ICW A;  2W9A A;  4F71 A;  2DUY A;  3QNM A;  4DFP A;  2VKQ A;  3M9O B;  3LVW A;  1V97 A;  2JZB A;  5KFA A;  2JR5 A;  4UB3 A;  2CN1 A;  2BKE A;  4FZM A;  3RFA A;  4E7X A;  3NVO A;  2AQ0 A;  4OAG A;  4Y2T A;  2YB1 A;  1BPX A;  1N5X A;  4FBU A;  1HUO A;  4IQV A;  4ECW A;  4X4V A;  4NY8 A;  9ICL A;  5ALN A;  3QU2 A;  4Y2P A;  3SMV A;  5J0W A;  4ELV A;  4FHV A;  3PSI A;  4I2I A;  2JEF A;  1X40 A;  4K9A A;  3H7I A;  3PSP A;  4TUR A;  2HHT A;  5KT2 A;  3MR3 A;  1ZQT A;  3RB0 A;  4RUA A;  3JZ0 A;  1LKY B;  4F91 B;  4FS1 A;  4XA5 A;  1BPB A;  4O3S A;  4EBJ A;  1IIP A;  1FIQ A;  5J0Q A;  4ELU A;  4NXW A;  3SEI A;  4O3R A;  4QZI A;  4JWM A;  1OXJ A;  3MCR A;  5ALW A;  3WKD A;  5ALJ A;  5AI8 A;  2A1J B;  5BOM A;  2YMP A;  5KFX A;  1R89 A;  5CB1 A;  3Q8R B;  4GXI A;  5A0L A;  3MR2 A;  5KNI A;  3PY8 A;  4LZD A;  1MQ2 A;  1OU5 A;  4NL9 A;  2BCR A;  3OSN A;  2EQY A;  4O69 A;  7ICU A;  4J9K A;  2FPK A;  2XY5 A;  4NV0 A;  2IHO A;  4CRX A;  1NK0 A;  1WG8 A;  5KG2 A;  4DO9 A;  4JK1 A;  2BCU A;  4FZN A;  2GAF D;  2H3V A;  3ER8 C;  8ICY A;  2WF8 A;  3PR4 A;  1GPJ A;  1ZQF A;  5J0P A;  3RR7 A;  4CF3 A;  1LB2 B;  5III A;  4P2H A;  2PMZ C;  4XUS A;  4KLE A;  4DWI A;  1S76 D;  3UXN A;  3E2E A;  4USA A;  1L7M A;  5DED A;  7ICQ A;  1U4B A;  4TUQ A;  2KJ9 A;  4F4Z A;  4DFJ A;  2EH9 A;  1KNY A;  1Z00 A;  1ZQN A;  2ZIW A;  4LEW A;  4M2Y A;  1JX4 A;  5DB6 A;  1BPD A;  5J2J A;  1XSL A;  1XSP A;  2PFN A;  2BZF A;  8ICN A;  2G07 A;  1NK5 A;  1N62 A;  2LYB A;  2KG5 A;  3KD3 A;  8ICO A;  1ZQU A;  1QTM A;  5CR0 A;  3ZDE A;  2IOF A;  3WKB A;  4QNL A;  3CRX A;  4JLZ A;  3GQC A;  4DL5 A;  1U47 A;  1L7O A;  4C8L A;  5ALH A;  1HIW A;  1B43 A;  5CEH A;  3UMC A;  3IM1 A;  3PX0 A;  2A3V A;  3N7S C;  5ALU A;  1L8L A;  1FFU A;  3ZDA A;  5CHG A;  4ECY A;  2OCE A;  2XIC A;  5E79 U;  5KFK A;  4RNM A;  4AT7 A;  4RT3 A;  4F4W A;  2G0A A;  4FZL A;  4Z6C A;  4IR9 A;  1S77 D;  2G09 A;  2I6X A;  4JV1 A;  1WWU A;  3O0F A;  2XO7 A;  5D46 A;  2EAN A;  3U26 A;  2HW3 A;  5AIC A;  1PVP A;  2RFF A;  4OCZ A;  4UAU A;  3OHA A;  4X4R A;  4F4Y A;  3T79 A;  2KKP A;  2WFA A;  4X4U A;  2HHX A;  4M04 A;  4RWQ A;  2HHQ A;  9ICH A;  4UB1 A;  2B4V A;  1A6S A;  4K97 A;  4QIW C;  4KLL A;  2FDR A;  1BPZ A;  3H4D A;  3NS1 A;  4QZB A;  3MFI A;  1V85 A;  3RH6 A;  4NXU A;  5AI5 A;  5DLG A;  7ICG A;  3HP6 A;  1LV5 A;  4YXJ A;  3N4M B;  3NAS A;  4X5V A;  1ZQG A;  4LJX A;  4DF8 A;  2IHN A;  1TVA A;  3Q8S B;  2XCA A;  4WC1 A;  1L7P A;  5L9X A;  5CJ7 A;  5DQI A;  3AU6 A;  4KTQ A;  3C2M A;  4UD4 A;  3NYB A;  5KT3 A;  1TKD A;  4HX0 A;  4FS2 A;  4ED0 A;  4NJ8 A;  2FI1 A;  9ICA A;  3BS5 B;  2MSN A;  1DK3 A;  5CP2 A;  3DDH A;  5ALO A;  1ZQQ A;  2PFO A;  1CI4 A;  4Y2Y A;  2JEI A;  3K4G A;  1RXV A;  2IA6 A;  3H39 A;  5EWF A;  5BPC A;  1UCV A;  3RJJ A;  3AQL A;  4IL6 U;  1WOT A;  4HYK A;  1MC8 A;  5KFD A;  2KHV A;  4B9T A;  3QU9 A;  4PHA A;  1RYU A;  2KVC A;  2EZX A;  5HP4 A;  5C5J A;  4O9M A;  5KFR A;  1DK2 A;  4KN4 A;  3L9D A;  2D3D A;  4RUC A;  3ISB A;  8ICL A;  4O3M A;  4IS7 A;  4US9 A;  2CRX A;  5AK4 A;  1XO1 A;  4RU9 A;  4X0A A;  4Y2U A;  2XGP A;  1Q3U A;  1PK1 A;  3ZD9 A;  3I76 A;  4WC4 A;  3UPS A;  1RXW A;  1U45 A;  1TK0 A;  4UAY A;  2LPE A;  5KFF A;  2AJQ A;  4P4O A;  4YN4 A;  4DL4 A;  2ZIX B;  3IDW A;  4ED7 A;  8ICT A;  5T14 A;  5AK5 A;  2BQ3 A;  3DV9 A;  2WF5 A;  5C0Y A;  3NVW A;  5AIB A;  4JMU A;  3EF2 A;  3GU3 A;  1N56 A;  4U6P A;  2ZHB A;  9ICK A;  3OUY A;  1ZQB A;  2JZB B;  1Q78 A;  1UT8 A;  5ALV A;  3JPT A;  8ICF A;  3PV8 A;  3RB3 A;  1PVR A;  1XSN A;  2W3R A;  2HHS A;  2E8M A;  4OD0 A;  8ICX A;  4BUG A;  2CPR A;  4K99 A;  1RYS A;  1QQ6 A;  4E80 A;  5DDY A;  1ZQP A;  2PXI A;  3BS7 A;  4J9O A;  3M6Z A;  1IXR A;  5AKJ A;  4DCC A;  4NLZ A;  4KLU A;  4AT8 A;  2UVU A;  3ISC A;  2F3N A;  3OGU A;  1KRP A;  5AKK A;  5J0S A;  3KZI U;  4Y2Q A;  1N63 A;  3HX0 A;  4UBC A;  3L5K A;  5KFT A;  3LDA A;  1YZ7 A;  4RQN A;  1SZH A;  3WK9 A;  4QJF B;  4J9R A;  1NNL A;  4GLX A;  2QAR A;  7ICS A;  9ICX A;  2Z7J A;  3RAQ A;  2M2W A;  4IG8 A;  3SQI A;  2DPI A;  4ECU A;  4PHD A;  3F5A A;  2HN2 A;  5CHE A;  5AI6 A;  1ZQW A;  2KE7 A;  3CK6 A;  3H40 A;  4QW8 A;  4QZF A;  2B21 A;  2EZZ A;  4DEZ A;  9ICN A;  3ZDB A;  2W7P A;  3QZ8 A;  4NLK A;  5ALF A;  1QLN A;  1QQ7 A;  1QSS A;  2DWQ A;  9ICI A;  2PFQ A;  2BBJ A;  5BOL A;  2R8H A;  4F3O A;  3HT3 A;  3KKA C;  4A8E A;  3MBY A;  3WFO A;  3LWL A;  2ZH7 A;  5G5H A;  4FE3 A;  2DRA A;  2DVI A;  2I5H A;  1VJ5 A;  2YMM A;  4PHE A;  1X9W A;  4TQR A;  5EE0 A;  5KG5 A;  3B9J A;  1HUZ A;  4LT6 A;  5KL8 B;  1VFG A;  4PL2 A;  2LMR A;  5D63 A;  4GC7 A;  3V6K A;  1KSP A;  3WK4 A;  2UVW A;  5DBC A;  1Z00 B;  2ZIW B;  1AQ6 A;  1N61 A;  4FHP A;  2MUT A;  4US8 A;  2ODG A;  4J9M A;  4C4S A;  3PSF A;  1ZQH A;  4M0A A;  2JEJ A;  3F2B A;  2JGA A;  1SIJ A;  4EX7 A;  2KD1 A;  3QEA Z;  2KVS A;  3PZP A;  1UET A;  3D2N A;  7ICR A;  3HRD D;  4RWP A;  3JYY A;  3G6X A;  5CRX A;  2YTU A;  3MDC A;  2K4P A;  5AHX A;  3RBD A;  4KLI A;  3PW0 A;  1SL1 A;  4YCX A;  1QCK A;  4PGX A;  2BQR A;  3E58 A;  4UAW A;  4LVS A;  5ALS A;  3NKU A;  3EUB 2;  2FMP A;  4O3P A;  4MFA A;  1SV0 C;  2IMW P;  3RRG A;  4C80 A;  4IQT A;  4JLX A;  4AT7 B;  2J6T A;  3PVX A;  4P0Q A;  2B6G A;  5KAF U;  1OUQ A;  4MF2 A;  3TFS A;  2O5A A;  4C4T A;  3M9M B;  5IIN A;  4B6J A;  3ISD A;  1U48 A;  4I29 A;  8ICE A;  1Z1B A;  2L5Y A;  1L3V A;  1S0O A;  4BXO A;  3ZDC A;  2I9G A;  1PZN A;  2W9C B;  4UB2 A;  1JRO A;  1SKR A;  1D8L A;  2P66 A;  7ICV A;  4ECS A;  5HRB A;  5J2B A;  2HBK A;  1T8E A;  2XC9 A;  2NV3 A;  5DDM A;  4O3N A;  1V4A A;  3HWT A;  4GFJ A;  1NJW A;  4OAH A;  5ALR A;  5F2V O;  2ZH6 A;  4TQS A;  2WTF A;  5F9N A;  4QZ9 A;  2ASL A;  4ED1 A;  1A76 A;  1ZQZ A;  4B9U A;  5KFH A;  4NKU A;  4WC7 A;  1Q46 A;  3V7J A;  1R8B A;  4ICA A;  2DF4 B;  1RYR A;  5ALP A;  4J9Q A;  3WFQ E;  4F50 A;  5KT7 A;  5HHH A;  3NWI A;  3RB4 A;  2GH1 A;  5AM4 A;  3TFR A;  4K4I A;  4EED A;  5KFM A;  3FC4 A;  3QUC A;  4FBT A;  2A19 A;  5KG1 A;  5AKE A;  5L1I A;  4JWN A;  2XY7 A;  3WKC A;  2NO5 A;  3IG5 A;  4QZD A;  4PGQ A;  5B5E U;  4F5O A;  1NO5 A;  1DRG A;  4Q45 A;  4UB4 A;  2ISP A;  7ICE A;  1ZRN A;  5AM2 A;  3TQ1 A;  4X4T A;  2W04 A;  2BPF A;  4B9N A;  3UPQ A;  2ID1 A;  1UPH A;  2YB4 A;  3GV7 B;  3NRW A;  4QWA A;  2YML A;  4UQG A;  4WC5 A;  5J8Y C;  2RLT A;  3AEV A;  4YMM A;  4DOC A;  4X4S A;  1KLN A;  4OJO A;  2VA8 A;  4KLS A;  1KEJ A;  4YFK A;  5KFN A;  4AYB F;  4KLQ A;  1SGG A;  2W7O A;  2JXJ A;  1TAQ A;  1T3Q A;  2JHD A;  2NRX A;  4DQP A;  3SV3 A;  4UB5 A;  8ICZ A;  3THV A;  2LM4 A;  1ZOL A;  9ICV A;  3B0X A;  4YD1 A;  4KB6 A;  3PMN A;  1PK1 B;  2HOQ A;  2FJ6 A;  5HHI A;  3JPN A;  1S0N A;  2NRK A;  2WF7 A;  3WFR E;  3KBB A;  1CEZ A;  2KZ3 A;  5CWR A;  1R8C A;  3V7K A;  1L3U A;  2Y0S F;  9ICE A;  7ICN A;  5KFS A;  2XGQ A;  2MAX A;  3C2L A;  2JV3 A;  1RM6 C;  5HRH A;  4EZ9 A;  2LYH A;  5EE1 A;  8ICK A;  3F5E A;  2A1A A;  3BZK A;  3JPS A;  3JPR A;  4K4G A;  5AM3 A;  8ICA A;  5KT5 A;  5J0T A;  3LYS A;  5ALG A;  4QWC A;  3BQ2 A;  3F53 A;  4ED8 A;  2ZH9 A;  2XVT A;  5J2A A;  1KFD A;  3M8R A;  1ZQX A;  5ALZ A;  2HHP A;  1NJZ A;  1S0M A;  1UEV A;  2C22 A;  4EEN A;  1ZD2 P;  4AT8 B;  2E1E A;  4TUP A;  2XY6 A;  2G06 A;  1ZQD A;  1NZP A;  8ICV A;  1X42 A;  2ZIU A;  3EZ5 A;  4AT9 B;  3BQ7 A;  3WU2 U;  3AQM A;  3ED5 A;  3WKA A;  8ICI A;  1L5U A;  4Y2X A;  2HHU A;  4ELT A;  4FHW A;  2BCS A;  5FP0 A;  2KIV A;  4I2J A;  4PHP A;  2AXT U;  2K4H A;  2K8C B;  2IUB A;  2QAR B;  1X9S A;  5HRK A;  4NL9 C;  1ZQ1 C;  4JV0 A;  4CF5 A;  1QH9 A;  3LWM A;  1X9X A;  2H3I A;  4RZR A;  3AQK A;  2V4Q A;  4EGW A;  4BJQ A;  2D6F C;  4Q44 A;  2K4I A;  4Q43 A;  7ICH A;  4ED2 A;  2ASJ A;  2EAP A;  2YY6 A;  1YLQ A;  4RWO A;  2OM6 A;  3HPO A;  2FE9 A;  4J03 A;  4RQ5 A;  4YMN A;  5J29 A;  4QZG A;  1A0P A;  3OJS A;  4EBC A;  3RJF A;  3RF9 A;  1EXN A;  3M6K A;  5DQG A;  1ZYQ A;  4M5D A;  1ED1 A;  1TAU A;  3OHB A;  1BGX T;  5TZV A;  3HW8 A;  5DB7 A;  5KFL A;  3HJ4 A;  4F5N A;  5HR9 A;  2K8B B;  2IHM A;  1C7Y A;  5ALI A;  5DB8 A;  4GXJ A;  3NUQ A;  2MUT B;  3V6H A;  2C2R A;  4F72 A;  1X9M A;  1SZP A;  2XID A;  2E3T A;  2Q66 A;  1WWV A;  4EX6 A;  4DS5 A;  5IIL A;  3N28 A;  2J6S A;  2VA2 A;  3PW5 A;  2KMD A;  2N1R A;  5B3P A;  1ZQI A;  2AGP A;  4NWI A;  5HRE A;  5JTI A;  4YVZ A;  3H37 A;  2BCV A;  2EWR A;  2JRZ A;  4RNN A;  1ZQR A;  1UA0 A;  4DQI A;  4O6A A;  5AI9 A;  7ICI A;  2F44 A;  2YMQ A;  3H0M B;  1NOM A;  3PML A;  5KG7 A;  3C29 A;  4B9M A;  5HRI A;  4R8U A;  4S3N A;  2HOI A;  4PPX A;  1GO3 F;  2M9N A;  4Z6D A;  4I2E A;  4P0Q B;  4YR2 A;  1XWL A;  5H2F U;  4ATB A;  1D8Y A;  4F92 B;  4F4K A;  4YD2 A;  1JQR A;  4OO1 J;  1F5A A;  3KHR A;  4GC6 A;  1J2M A;  4DL3 A;  2ZIV A;  1H38 A;  5J0X A;  3H4B A;  1BNO A;  3Q8Q B;  3UQ0 A;  1PVQ A;  3MC1 A;  2W9M A;  1L8O A;  3IG8 A;  4RT2 A;  2K4E A;  1Z19 A;  5D4B A;  5J2D A;  4OAI Z;  3BQT A;  2FPM A;  3RJI A;  1OW5 A;  3SYZ A;  3PR5 B;  1UHU A;  4NXX A;  1L3T A;  3OVS A;  2F1I A;  1ECW A;  2JH7 A;  3BZC A;  4EBE A;  4DQS A;  5KFE A;  5ALT A;  1DXS A;  1SB3 C;  1NJX A;  4LEZ A;  4BWM A;  4CNQ A;  3K1Z A;  4NM2 A;  5DBB A;  4WJ3 B;  4PJ0 U;  1X66 A;  8ICJ A;  3H8W A;  4QZA A;  7ICP A;  4UAT A;  4F4X A;  4M9G A;  1KN5 A;  4YG2 A;  4NXZ A;  3PO5 A;  1NK7 A;  3SAF A;  5J2F A;  4YQW A;  1QQ5 A;  4I28 A;  9ICU A;  2NRZ A;  1ZD5 A;  3UM9 A;  4UAR A;  1NK4 A;  2KFN A;  2ZH8 A;  4O3O A;  2K8A A;  2Q0Z X;  4DLE A;  2FMQ A;  4FH3 A;  2ATL A;  2E1F A;  2DL0 A;  5KFY A;  4OAF A;  1KTQ A;  2ZUD A;  4E0D A;  8ICB A;  4X0B A;  4LEV A;  2HN1 A;  2P35 A;  3SEN A;  3WFP A;  4OJP A;  1NK6 A;  4FHY A;  2LKY A;  1ARO P;  1NJY A;  2DQN B;  2AH5 A;  3HIY A;  4FO6 A;  4M47 A;  2QKQ A;  3MGI A;  4LZG A;  4NLC A;  1TAM A;  4DSF A;  1UT5 A;  4O3Q A;  4FH5 A;  3CP8 A;  4M9H A;  4C8M A;  4DSL A;  2AGO A;  3UQ2 A;  3KZX A;  2ZHA A;  2OYY A;  4I0U A;  2HBL A;  1FFV A;  9ICT A;  2KEY A;  5EWE A;  1CRX A;  3TI0 A;  4DSE A;  7ICF A;  3UXP A;  3EPI A;  1NK8 A;  2FLP A;  5DB9 A;  4O5K A;  3VC8 A;  2M0N A;  4IRC A;  4Z6E A;  5J2I A;  2WB1 F;  2HVI A;  2OXO A;  4QW9 A;  5EE3 A;  9ICC A;  3V72 A;  5AK3 A;  5KTQ A;  1T94 A;  4WQK A;  4KLO A;  5J0O A;  4XQ7 A;  3NVY A;  2UVR A;  3PHZ A;  2W55 A;  3HKZ C;  5JU5 A;  3RJG A;  5AKY A;  2FMS A;  4F2S A;  4NXT A;  2GA9 D;  1RQL A;  1J97 A;  2EAM A;  2WF9 A;  4G9B A;  2OH2 A;  4IRD A;  4X4Q A;  4KN7 A;  3GIL A;  2DR7 A;  2E8P A;  5ALQ A;  2Y1J A;  3EWA A;  4TUS A;  2Q4T A;  2ZIU B;  1FO4 A;  1S9F A;  3JPO A;  1TE2 A;  1F5S A;  1WCL A;  4EEL A;  4MEX A;  4JV2 A;  5B66 U;  1A77 A;  2KKV A;  4P0P A;  2BQU A;  3SAH A;  4XRH A;  2WHE A;  1Q3V A;  2G08 A;  3B0Y A;  2XCP A;  3LVV A;  3NVZ A;  3QX7 A;  1D9F A;  4RNO A;  3ALR A;  2KJ5 A;  4WC6 A;  1CUK A;  4AYB C;  4F93 B;  5G5G A;  1JAL A;  2BDP A;  5ALL A; 
#chains in the Genus database with same CATH homology
 1NKC A;  4TUQ A;  4UQG A;  2PFP A;  4B9V A;  3PX6 A;  4WC5 A;  4F4Z A;  8ICS A;  4DFJ A;  5KG3 A;  1KNY A;  5DG7 A;  1Z00 A;  3MAB A;  3GV8 B;  1ZQN A;  4M2Y A;  1JX4 A;  5DB6 A;  3HJ1 A;  1BPD A;  4YXM A;  5J0U A;  5J2J A;  1XSL A;  3MR5 A;  1XSP A;  2PFN A;  4WC3 A;  4JUZ A;  8ICN A;  1NK5 A;  1T4G A;  4YMM A;  8ICH A;  8ICO A;  4DOC A;  4X4S A;  1KLN A;  1MIY A;  1ZQU A;  2VA8 A;  1QTM A;  3PX4 A;  1D9D A;  4KLS A;  1KEJ A;  4YFK A;  1L3S A;  5CR0 A;  5KFN A;  4Q8E A;  4KLQ A;  3ZDE A;  1X2I A;  4KLG A;  1ZQL A;  1Y88 A;  5DG8 A;  1QSY A;  3NTU A;  4KLM A;  3H8S A;  1TAQ A;  2ISO A;  4DF4 A;  3GQC A;  2NRX A;  4DL5 A;  1U47 A;  4DQP A;  4C8L A;  3SV3 A;  3H38 A;  1TFY A;  1B43 A;  5J2G A;  4UB5 A;  5DQH A;  3THV A;  8ICZ A;  3IM1 A;  1FA0 A;  3N97 B;  5DGB A;  9ICV A;  3B0X A;  4YD1 A;  3PX0 A;  2VA3 A;  3PMN A;  2KFZ A;  3ZDA A;  4NLG A;  3Q8M A;  5CHG A;  1KDH A;  4ECY A;  3QE9 Y;  2I1Q A;  2ZUB A;  5KFK A;  5HHI A;  4RNM A;  3JPN A;  1MQ3 A;  4AT7 A;  4R65 A;  4RT3 A;  4F4W A;  1T7P A;  4RQ7 A;  2P6R A;  1S0N A;  2NRK A;  4DSI A;  4IR9 A;  1JXE A;  4Z6C A;  1S77 D;  3WFR E;  4JV1 A;  1CEZ A;  9ICO A;  3RRH A;  2XO7 A;  4I2A A;  2KZ3 A;  5D46 A;  5HMM A;  3MFH A;  5CWR A;  1R8C A;  3V7K A;  1L3U A;  4KLT A;  7ICL A;  9ICE A;  4DFM A;  5KFS A;  7ICN A;  3OJU A;  2XGQ A;  2RDI A;  1ZQE A;  8ICU A;  2HW3 A;  2ALZ A;  2MAX A;  5KFV A;  1ZQK A;  4EYH B;  7ICJ A;  2RFF A;  2OWO A;  2HHW A;  3OHA A;  4X4R A;  4F4Y A;  3FDS A;  4RQ3 A;  3C2L A;  2BHN A;  5HRH A;  3LK9 A;  4EZ9 A;  2LYH A;  4E8F A;  8ICK A;  4X4U A;  3K75 D;  2HHX A;  1TK5 A;  9ICR A;  4M04 A;  5J2K A;  2ZJ8 A;  4YMO A;  4RWQ A;  4ED3 A;  2HHQ A;  4ECR A;  3JPP A;  3JPQ A;  9ICH A;  2ZTC A;  5DLF A;  4RWN A;  3JPS A;  4UB1 A;  3JPR A;  1XS9 D;  4K4G A;  3UXO A;  3ZD8 A;  1ZQM A;  4KLL A;  8ICA A;  1BNP A;  4CCH A;  5KT5 A;  1K1S A;  1V9P A;  3FYH A;  5J0T A;  4QWC A;  3BQ2 A;  1BPZ A;  3H4D A;  4ED8 A;  2ZH9 A;  4R8U B;  1TK8 A;  5J2A A;  3T3F A;  1KFD A;  4QZB A;  3M8R A;  3MFI A;  5KFG A;  1ZQX A;  2A1J A;  4RPX A;  2AU0 A;  4J9N A;  2HHP A;  1NJZ A;  9ICB A;  3RH6 A;  2DR5 A;  1S0M A;  4ECT A;  8ICP A;  2FLL A;  2C22 A;  1UEV A;  4AT9 A;  5DLG A;  4AT8 B;  4ATB B;  7ICG A;  3C2K A;  4XQ8 A;  3WFS C;  4TUP A;  2XY6 A;  1ZQD A;  1COO A;  8ICV A;  4RQ0 A;  1NZP A;  4C8N A;  1ZQV A;  3HP6 A;  3EZ5 A;  4QZE A;  4DL2 A;  4O0I A;  4AT9 B;  1LV5 A;  2PI4 A;  4YXJ A;  3N4M B;  4X5V A;  4DL6 A;  1ZQG A;  3EYZ A;  3AQM A;  2AGQ A;  2PI5 A;  8ICC A;  4IRK A;  4DF8 A;  2IHN A;  1TVA A;  1TV9 A;  3Q8S B;  2JEG A;  8ICI A;  2XCA A;  1L5U A;  4WC1 A;  5L9X A;  3M9N B;  3G6Y A;  5CJ7 A;  2HHU A;  3AU2 A;  1SKW A;  4ELT A;  5DQI A;  1JMS A;  4R64 A;  4RQ6 A;  2W8L A;  3AU6 A;  3RJK A;  3C2M A;  4ZH4 A;  4KTQ A;  4Q8F A;  1U49 A;  4UD4 A;  3PNC A;  2BCS A;  3NYB A;  4WBY A;  2H5X A;  4I2J A;  4PHP A;  4KIT B;  4WC2 A;  5KT3 A;  1TKD A;  3KHH A;  1ZQJ A;  1X9S A;  5HRK A;  1MIV A;  4FS2 A;  1U9L A;  4ED0 A;  4M6W B;  4J9S A;  1XU4 A;  4JV0 A;  5KG0 A;  9ICA A;  1JAJ A;  3LWM A;  3V6J A;  1DK3 A;  5CP2 A;  1BVS A;  4P4M A;  4RZR A;  3AQK A;  2V4Q A;  1ZQQ A;  2PFO A;  2JEI A;  3K4G A;  4Q44 A;  2C2E A;  1RXV A;  2AQ4 A;  2IA6 A;  3H39 A;  3H8J A;  4M9N A;  2ZJA A;  5KFC A;  4DQQ A;  5EWF A;  2ASD A;  2R8J A;  4PGY A;  4WBZ A;  1HJP A;  2ZH3 A;  5BPC A;  1SL2 A;  4Q43 A;  3RJJ A;  4MF8 A;  7ICH A;  1MIW A;  3AQL A;  1MSW D;  1N48 A;  4ED2 A;  1WOT A;  4UD5 A;  2KZZ A;  4HYK A;  3NGD A;  4IR1 A;  1MC8 A;  1WCN A;  4IQW A;  4NKT A;  5KFD A;  2ASJ A;  4Z6F A;  2FPL A;  4B9T A;  4PHA A;  1YLQ A;  4BWJ A;  4RWO A;  3HPO A;  1RPL A;  4O9M A;  5HP4 A;  5C5J A;  5KFB A;  2NRT A;  5KFR A;  1KFS A;  4KLF A;  4KN4 A;  1DK2 A;  1JN3 A;  3RJH A;  7ICO A;  1Q79 A;  4RUC A;  3L9D A;  4RQ5 A;  3ISB A;  4RQ1 A;  2Y1I A;  4YMN A;  3RR8 A;  4M9J A;  1ZJN A;  5J29 A;  8ICL A;  4QZG A;  4EBC A;  3OJS A;  3RJF A;  3C21 A;  3LQC B;  1EXN A;  5DQG A;  1ZYQ A;  2HVH A;  4M5D A;  4I2H A;  1IM4 A;  3T5L A;  3TAP A;  3IHQ B;  1TAU A;  1XO1 A;  3OHB A;  8ICR A;  4RU9 A;  2DRB A;  8ICM A;  1BGX T;  5TZV A;  3HW8 A;  5DB7 A;  4X0A A;  5KFL A;  2XGP A;  3HJ4 A;  4F5N A;  1PX5 A;  5HR9 A;  1SL0 A;  2W9B B;  4ECZ A;  2IHM A;  5KT6 A;  3ZD9 A;  4WC4 A;  3RTV A;  4EEY A;  1C7Y A;  1RXW A;  3UPS A;  1U45 A;  1TK0 A;  4KLD A;  4ECQ A;  5KFJ A;  5L1L A;  5DB8 A;  8ICG A;  2DR9 A;  2UVV A;  2ZTE A;  4RQ4 A;  4GXJ A;  2V9W A;  4UAY A;  1ZQY A;  4NLN A;  5KFF A;  2AJQ A;  2MUT B;  2P6U A;  4P4O A;  4DFK A;  4MFF A;  4WC0 A;  3V6H A;  4C8K A;  3C5F A;  2C2R A;  1X9M A;  3BQ1 A;  1SZP A;  4YN4 A;  4DL4 A;  5HRD A;  2Q66 A;  9ICJ A;  4QWB A;  4BDP A;  2BE3 A;  3T5K A;  4DS5 A;  3OSP A;  4X4O A;  2GWS A;  4J9L A;  4ED7 A;  5IIL A;  8ICT A;  2J6S A;  2VA2 A;  3PW5 A;  2FLN A;  7ICM A;  2BQ3 A;  1ZQI A;  2AGP A;  4YR3 A;  4G3I A;  5HRE A;  5L1K A;  3BDP A;  4YVZ A;  4DS4 A;  4EZ6 A;  1NKB A;  3KTQ A;  2BCV A;  3H37 A;  4X4N A;  9ICM A;  3RJE A;  2NRV A;  5IIM A;  1N56 A;  3ORY A;  3C5G A;  3H3A A;  9ICK A;  2ZHB A;  3OUY A;  2NRW A;  5DG9 A;  3PW7 A;  1ZQB A;  4RNN A;  2JZB B;  1UA0 A;  1ZQR A;  4DQI A;  4B9S A;  4KMU A;  5IIJ A;  3RB6 A;  7ICI A;  4DOB A;  1Q78 A;  3OUY B;  1UT8 A;  3JPT A;  8ICF A;  2M2T A;  1NOM A;  3PV8 A;  2F1H A;  4R66 A;  3PML A;  3RB3 A;  1XSN A;  4NM1 A;  4B9L A;  5KG7 A;  4B9M A;  2HHS A;  9ICS A;  3RH4 A;  5HRI A;  5DBA A;  4R8U A;  2BPC A;  8ICX A;  4EBK A;  4DLG A;  1DOQ A;  4S3N A;  4PPX A;  5HML A;  1RYS A;  2M9N A;  4E80 A;  5DDY A;  4Z6D A;  7ICT A;  1ZQP A;  2PXI A;  4I2E A;  7ICK A;  4J9O A;  2ZH4 A;  1IXR A;  1XWL A;  4YR2 A;  4P4P A;  4NLZ A;  4KLU A;  2W8K A;  4I2D A;  4ATB A;  1JIH A;  4AT8 A;  1D8Y A;  4F92 B;  3GFK B;  5DKW A;  4YD2 A;  1S10 A;  2UVU A;  3ISC A;  4F4K A;  1JQR A;  5J2C A;  3M8S A;  9ICP A;  3OGU A;  3KHR A;  3MGH A;  4GC6 A;  4M9L A;  1F5A A;  1KRP A;  5J0S A;  4DL3 A;  4QZC A;  3HX0 A;  5L1J A;  1H38 A;  1ZQS A;  4I2F A;  4UBC A;  9ICF A;  2HHV A;  2C2D A;  5J0R A;  5J0X A;  3H4B A;  4KLH A;  1RZT A;  3Q8K A;  1S0V A;  1ZQA A;  5KFT A;  3Q8Q B;  3UQ0 A;  1BNO A;  3LDA A;  3GIJ A;  4K4H A;  3KHL A;  4UAZ A;  2W9M A;  5KFZ A;  4J9R A;  2KN7 A;  1NK9 A;  4GLX A;  4RT2 A;  9ICQ A;  7ICS A;  1T3N A;  5D4B A;  9ICX A;  5J2D A;  3BQT A;  4M6W A;  3QZ7 A;  2BCQ A;  4I27 A;  2FPM A;  3RJI A;  4YP3 A;  3RAQ A;  2R8G A;  3SYZ A;  2M2W A;  3PR5 B;  4IG8 A;  2DPI A;  4ECU A;  4QWE A;  4O5E A;  5KFO A;  1L3T A;  1KFT A;  3OVS A;  2F1I A;  4PHD A;  4EP7 A;  3C23 A;  4EBE A;  4DQS A;  4IQU A;  4F5R A;  5KFE A;  1ZQW A;  5D49 A;  2KP7 A;  1NJX A;  5HRF A;  5KFP A;  3C66 A;  3PO4 A;  5KFI A;  4BWM A;  3H40 A;  3RAX A;  2J6U A;  2C28 A;  2DFL A;  3OVA A;  4QW8 A;  4QZF A;  1TFR A;  3GDX A;  2B21 A;  4NM2 A;  5KT4 A;  5DBB A;  4DEZ A;  1QSL A;  3ZDB A;  9ICN A;  4PH5 A;  3SV4 A;  2ZH2 A;  3QZ8 A;  4NLK A;  2KTQ A;  1QLN A;  4YR0 A;  8ICJ A;  1S97 A;  2ZJ5 A;  3H8W A;  2DPJ A;  4QZA A;  1QSS A;  4MEY A;  7ICP A;  5KFW A;  9ICI A;  2PFQ A;  3KHG A;  3MDA A;  5KG6 A;  5BOL A;  2R8H A;  1BPY A;  4F4X A;  1UA1 A;  4M9G A;  4YG2 A;  4NXZ A;  5IIK A;  4F3O A;  3HT3 A;  3PO5 A;  3OVB A;  3MBY A;  3WFO A;  4WCW A;  1NK7 A;  5J0Y A;  3LWL A;  3GII A;  2ZH7 A;  5J2F A;  4YQW A;  2DRA A;  4I2G A;  3ZDD A;  2DVI A;  9ICG A;  4PHE A;  1X9W A;  4I28 A;  2R8K A;  4TQR A;  4DOA A;  3T5H A;  5DGA A;  5KG5 A;  3T5J A;  1HUZ A;  9ICU A;  2NRZ A;  2V4R A;  4LT6 A;  2ZTD A;  1ZET A;  4DL7 A;  1ZJM A;  1NK4 A;  3EPG A;  2KFN A;  2ZH8 A;  4O3O A;  1VFG A;  4I2C A;  2Q0Z X;  5CA7 A;  4DLE A;  1DGS A;  2W9B A;  3G6V A;  1XC9 A;  2FMQ A;  4O5C A;  4KLJ A;  4GC7 A;  3V6K A;  5F9L A;  2BPG A;  4RQ2 A;  1KSP A;  4FH3 A;  2UVW A;  3SZ2 A;  5DBC A;  1Z00 B;  2ATL A;  4FHX A;  5EOZ A;  3AQN A;  4DSJ A;  5KFY A;  3SI8 A;  1KTQ A;  4J9P A;  4FHP A;  2MUT A;  4J9M A;  4M0A A;  3GIM A;  1ZQH A;  5DEC A;  2ZUD A;  2JEJ A;  3AUO A;  4E0D A;  3V7L A;  8ICB A;  4X0B A;  3GV5 B;  3PW4 A;  4UBB A;  3WFP A;  1BPE A;  1NK6 A;  2F1J A;  2ZUC A;  5HNK A;  3QEA Z;  3RBE A;  4ECV A;  3PW2 A;  3ETL A;  4FHY A;  5JUM A;  1ARO P;  1UET A;  7ICR A;  2RDJ A;  1NJY A;  2BGW A;  2KZM A;  4RWP A;  3JYY A;  3G6X A;  3QEB Z;  4FHW A;  5J2E A;  3MDC A;  4QWD A;  4BGD A;  3RBD A;  3Q8L A;  4KLI A;  3PW0 A;  3HIY A;  4FO6 A;  4M47 A;  9ICW A;  4RPY A;  2W9A A;  1SL1 A;  4YCX A;  4QZ8 A;  2O1P A;  1TFW A;  1K1Q A;  4DFP A;  4PGX A;  3MGI A;  3GIK A;  4LZG A;  3M9O B;  2BQR A;  4UAW A;  4LVS A;  2JZB A;  4DSF A;  1UT5 A;  5KFA A;  4F5P A;  4C8O A;  4O3Q A;  4UB3 A;  3TAR A;  3Q8P B;  2FMP A;  4FH5 A;  4O3P A;  2BKE A;  4M9H A;  4C8M A;  4DSL A;  5KG4 A;  2AGO A;  4E7X A;  3UQ2 A;  2AQ0 A;  1R8A A;  2ZHA A;  4MFA A;  2IMW P;  2ZH5 A;  1BPX A;  3RRG A;  4IQT A;  4AT7 B;  4FBU A;  1HUO A;  4IQV A;  5EWG A;  4ECW A;  2J6T A;  9ICT A;  4X4V A;  4NY8 A;  9ICL A;  2IBK A;  3PVX A;  5EWE A;  5J0W A;  4ELV A;  4FHV A;  3TI0 A;  4F8R A;  4I2I A;  4DSE A;  4F2R A;  7ICF A;  3UXP A;  3EPI A;  5J2H A;  1NK8 A;  2FLP A;  5DB9 A;  2R8I A;  2BR0 A;  2JEF A;  4O5K A;  3H7I A;  1UEU A;  4MF2 A;  3TFS A;  4IRC A;  4Z6E A;  4EBD A;  5J2I A;  4TUR A;  3BJY A;  2HVI A;  4QW9 A;  3MR6 A;  2HHT A;  1VJ7 A;  5IIN A;  3M9M B;  2O5A A;  3ISD A;  1U48 A;  9ICC A;  5KT2 A;  3MR3 A;  4I29 A;  3V72 A;  1ZQT A;  8ICE A;  4R63 A;  3EW9 A;  5KTQ A;  4ECX A;  3RB0 A;  4RUA A;  2W9C A;  1S0O A;  1L3V A;  3JZ0 A;  4RPZ A;  4BXO A;  3ZDC A;  4KLO A;  4F91 B;  3BQ0 A;  4FS1 A;  5J0O A;  1NKE A;  2I9G A;  4XQ7 A;  4XA5 A;  1BPB A;  1PZN A;  2W9C B;  4UB2 A;  4GXK A;  1SKR A;  4O3S A;  3C18 A;  4EBJ A;  4DSK A;  1D8L A;  5J0Q A;  1ZQC A;  4BXO B;  2UVR A;  4ELU A;  5HRG A;  2P66 A;  7ICV A;  4ECS A;  5HRB A;  5J2B A;  1T8E A;  2XC9 A;  5DDM A;  1JXL A;  3RJG A;  4O3R A;  5KFQ A;  4MFC A;  4QZI A;  2FMS A;  4O3N A;  4JWM A;  4F2S A;  1V4A A;  3HWT A;  3RH5 A;  1NJW A;  1B22 A;  5F2V O;  4QZH A;  2DR8 A;  8ICW A;  2ZH6 A;  4TQS A;  2A1J B;  2WTF A;  3TAN A;  5BOM A;  5F9N A;  4QZ9 A;  2M2U A;  2ASL A;  4ED1 A;  5KFX A;  1A76 A;  1ZQZ A;  4IRD A;  4KN7 A;  3GIL A;  4B9U A;  1R89 A;  4X4Q A;  5CB1 A;  3Q8R B;  4GXI A;  2DR7 A;  5KFH A;  4NKU A;  3MR2 A;  4WC7 A;  2Y1J A;  3PY8 A;  3V7J A;  1R8B A;  3EWA A;  4LZD A;  4TUS A;  1RYR A;  1MQ2 A;  1S9F A;  3OSN A;  2BCR A;  1OU5 A;  3C1Y A;  4J9Q A;  7ICU A;  3WFQ E;  4J9K A;  4F50 A;  8ICQ A;  2FPK A;  2VAN A;  5HHH A;  3C1Z A;  5KT7 A;  3JPO A;  4RQ8 A;  2XY5 A;  5IIO A;  3RB4 A;  1WCL A;  4MEX A;  4JV2 A;  4K4I A;  1NK0 A;  3TFR A;  5KG2 A;  2BCU A;  4DO9 A;  4JK1 A;  1A77 A;  5KFM A;  4F5Q A;  2ZH1 A;  2BQU A;  4FBT A;  5KG1 A;  4XRH A;  5KFU A;  8ICY A;  5L1I A;  3PR4 A;  4ED6 A;  3TAQ A;  4JWN A;  2XY7 A;  4QZD A;  1ZQF A;  3B0Y A;  4PGQ A;  5J0P A;  2XCP A;  4F5O A;  3RR7 A;  1NO5 A;  1LB2 B;  5III A;  4Q45 A;  4UB4 A;  2ISP A;  4P2H A;  7ICE A;  5HC9 A;  4XUS A;  4KLE A;  3OV7 A;  4DWI A;  1S76 D;  3UXN A;  1D9F A;  4RNO A;  3E2E A;  3TQ1 A;  4X4T A;  1SKS A;  2M2V A;  2PBE A;  4WC6 A;  4EYI B;  2BPF A;  4B9N A;  4X4P A;  3UPQ A;  2ID1 A;  3GV7 B;  7ICQ A;  5DED A;  1CUK A;  1U4B A;  4DQR A;  4F93 B;  4I2B A;  5HRL A;  2BDP A;  4QWA A;  1Z3E B;  1ZQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...